2OPTA

Crystal structure of apo actr from streptomyces coelicolor.
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
219
structure length
209
Chain Sequence
AMAPLTQDRIVVTALGILDAEGLDALSMRRLAQELKTGHASLYAHVGNRDELLDLVFDIVLTEVEVPEPEPGRWAEQVKEMCRSLRRMFLAHRDLARIAIDRVPLGPNGMVGMERTMNLLRSGGLHDELAAYGGDLLSTFVTAEALEQSSRAGVFADQLHGYLKSLPATSFPNLVHLAGPITSLDSDRRFELGLEIIIAGLLAGAGEAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the Streptomyces coelicolor TetR-like protein ActR alone and in complex with actinorhodin or the actinorhodin biosynthetic precursor (S)-DNPA.
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Transcription
molecule keywords ActII protein
total genus 79
structure length 209
sequence length 219
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF02909 TetR_C_1 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2optA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2optA02
2K9QA 3HGGA 1FTZA 4A3CJ 4A69C 2HOSA 3BQYA 2YVHA 1QPIA 3S1RJ 1B8IB 1AKHA 4XRSG 4C3IJ 3CJDA 3VVXA 1OFCX 1QVTA 2QOPA 1QVUA 2Y30A 5CXGA 2M9HA 2IEKA 5CXIA 2DMQA 1CQTA 1ETYA 1ZR2A 2I10A 2DTZA 3S15J 3LSJA 3HOUJ 2VKEA 1FTTA 2H1KA 3G56A 3TP3A 3GBGA 3QQAA 4IHWA 3L1PA 4IHYA 4I76A 3BTJA 3OSFA 2HXIA 2XB0X 3NI7A 4CGRA 3TP0A 4JL3A 4NDLA 4FISA 1GV5A 2DA1A 3BR1A 4C3HJ 3ZOBA 1IC8A 5F04A 2EZHA 2W53A 4A3DJ 3QPSA 4BY7J 4BBRJ 5FLVA 2TRTA 3MNLA 5D1RA 3HIMA 2EZIA 1ZKGA 1XG1A 5AQCA 4FTHA 3PPBA 3VW0A 5H9TA 2X6OA 3MVPA 3BR0A 2E1OA 4D7MA 2FQ4A 3BJBA 1FIAA 4S0HB 3UKGA 1QRYA 2OERA 3S5RA 1SANA 2ZCXA 1K61A 3K2AA 1AU7A 1LFUP 4BXXJ 3EGQA 1BA5A 1GDTA 2YU9J 2R93J 2DMUA 3HOXJ 2JA8J 1U78A 3HTAA 4JP0A 4AC0A 3HTHA 1IV6A 1X58A 1IRZA 2NP5A 2TCTA 4A3FJ 3NRGA 4HNVA 3O8HA 2FD5A 2NVXJ 4ME9A 3BG9A 3CCYA 1JT0A 5F1JA 5FJ8J 3FK6A 1WCMJ 2JWTA 2NS7A 2QIBA 2UXIA 4A3MJ 1WH5A 5C4JJ 4CYCA 5DTDA 3HM5A 2DA7A 2L9RA 3G7RA 2HYJA 3B6CA 4B3AA 4M3BA 2XPWA 5BNGA 1BW6A 5FKKA 4M3DA 3JRDA 4A3KJ 2AHQA 5E3MA 3COLA 5C4YA 1YRNB 1HCRA 4DW6A 4BBSJ 5EZGA 3VVYA 1EF4A 3QBMA 2HOAA 4C3JJ 5IOZA 2VPRA 4ACIA 1IJWC 2IAIA 1GUUA 4AC6A 4QSHA 2DN0A 3HBLA 5IPAA 3GTMJ 2H8RA 2XB5A 2COBA 4A3GJ 4X6AJ 4HKUA 3RZDJ 1FIPA 3C2BA 2MW8A 4M3EA 3WHCA 2DG8A 3LSGA 1U8BA 1MBJA 3ZQLA 2EBIA 2XPUA 1FJLA 3JRBA 9ANTA 1UI6A 1H8AC 1FEXA 2M0CA 3GTJJ 4IHVA 3G1LA 4XICA 3F0CA 2MGQA 5EDNA 2VKVA 5EFYA 2JJ7A 1I6HJ 2XGEA 1XS9A 3Q3SA 2G7SA 4UDSA 3JR9A 2VUMJ 3HOWJ 5EYRA 1Y1WJ 4CYCB 1NK2P 2R5YA 4D7NA 4DYRA 5CW8A 2GLOA 2EZKA 5FKNA 3JRAA 4A3IJ 2NOGA 2P81A 2GM4A 2JA5J 2Y31A 3VVZA 3F1BA 3LNQA 3SFIA 4L5EA 2LFBA 2DMTA 2AO9A 4LOCA 2XPVA 2HYTA 2EZLA 3BTIA 2YUSA 3Q0WA 3TW6A 5EGOB 2QKOA 5J1UA 1TWAJ 2QCOA 3B6AA 1LE8A 5EZHA 2IBDA 2Y2ZA 3TW7A 2HKUA 3ON2A 3RD3A 1NK3P 1PUFB 3T6NA 1TWCJ 3FIWA 4MFEA 1APLC 4QIWN 2R5YB 4JNNA 2HOTA 2RAEA 3BNIA 2NVYJ 4A3LJ 5K58A 5F0FA 1U9OA 3PO3J 4XIDA 5HBUA 4JX4A 3O60A 3QKXA 3HDDA 2K40A 4YZEA 1WI3A 3H3VK 2M2EA 1Y1VJ 3JRFA 2MG4A 1W0TA 5IOYA 3A01B 3M4OJ 3DCFA 2ME0A 4EEFG 3JRIA 2CJJA 4AUXA 2YVEA 1WPKA 4M3GA 3LOCA 4JYKA 3OOUA 2ZCNA 1BW5A 1AHDP 1TWHJ 4BKXA 3C07A 2R0QC 4B1RA 1TC3C 3CWRA 1I3QJ 5IP9J 1P7IA 4BY1J 3RQIA 5JLWA 1ZQ3P 5IYDJ 3FK7A 2NVQJ 5F0CA 1ZR4A 1ETWA 1A6IA 3BT9A 3VOXA 2CQXA 2ECCA 2EH3A 1WH7A 3GTOJ 4W97A 4AF5A 3ZQHA 2DMNA 1MNMC 3VW1A 5FKLA 4NELA 1GV2A 4D5FA 2Q24A 2RASA 1JTYA 2VI6A 2LKXA 3FRQA 4JX5A 2M34A 5J3LA 1IDZA 3S2DJ 2E2IJ 3ZQIA 3FISA 4I6ZA 3K7AJ 2LP0A 3A03A 5DAJA 5M5YJ 5J1RA 1OCTC 2OF7A 1HF0A 2O7TA 2UXPA 5FLMJ 4UUTA 3GEUA 2K9SA 1JTXA 1X2NA 2DA4A 4DZJA 5GPCA 4QTRA 4Y52J 3NPIA 3IH4A 1OJLA 2L7MP 3HOVJ 3IH3A 3G1OA 5K7HA 1B72B 4NN1A 3ZQFA 4GCLA 2HQ5A 4XK4A 2F07A 5FKOA 1X2MA 2XSDC 2O9LA 3Q0UA 4W1UA 2DA2A 3QPLA 1B72A 5EGOA 1IGNA 3HE0A 5F08A 3LWJA 2HXOA 1IG7A 2FX0A 2PMZN 4Y7NJ 1SGMA 1ZGWA 1XC5A 2JN6A 5E3NA 4DYQA 5M3MJ 5IP7J 3PO2J 2G7LA 3KKCA 2WUIA 2GENA 2L0KA 4MK6A 3LJLA 2V57A 2FBQA 1RKWA 5C4XJ 4GCKA 2LLKA 3BR5A 2Y9YA 3D1NI 2CU7A 1YRNA 2XRLA 1ITYA 4IHXA 3NNRA 1IDYA 2JA7J 1JJ6C 2CUFA 5E3OA 3BTCA 5D18A 2D5VA 3BTLA 2NVTJ 3JSJA 1Z77A 4B4CA 1JJ8C 2JA6J 1K83J 3LSRA 1ORKA 3RKQA 2MSYA 2QWTA 5F0HA 4ICHA 1ETKA 1VI0A 3HOZJ 4V2GA 2K9NA 3VIBA 3IUVA 3W6VA 1E3OC 2WB1N 4IEJA 3CQZJ 1MSFC 2UXOA 3VOKA 3BG3A 2R7ZJ 2M8GX 3M3YJ 5GPAA 5EG0B 1JUPA 2DA3A 2R5ZA 4J19A 4UUSA 2XDNA 3NARA 4FE4A 2R92J 4A3JJ 3HOYJ 2PBXA 3ZQCA 1GT0C 2WGBA 3HKZN 4GFBA 3RH2A 1UG2A 3Q0VA 5HODA 5EG0A 2R5ZB 3HGYA 1UI5A 1ETOA 1F43A 1I50J 1SFOJ 1OCPA 1B8IA 1AKHB 1JKOC 3LHQA 3V6GA 5FMPA 1T56A 4DYCA 5IYCJ 5F27A 2QTQA 4FCYA 1D5YA 1R9TJ 5FKMA 1H88C 4MFDA 3GZIA 3S1QJ 2DJNA 3IV5A 1GVDA 4AYBN 3S16J 2E2HJ 1H89C 2GUHA 3E7LA 4A3BJ 4JX6A 1HDPA 3A01A 2WV1A 1JUMA 2X48A 4RDUA 1VNDA 3BRUA 1JT6A 4MIMA 3HTIA 5DS9A 4RBOA 1T33A 3BQZA 4A3EJ 1JGGA 4DZPA 5EEAA 3BCGA 3VPRA 4GCTA 3ON4A 1VF9A 1JKRC 3AQSA 2ELKA 2ECBA 3BG5A 4KWAA 3CMYA 2O8KA 3GTLJ 5C3EJ 1TWGJ 2PZ9A 5K7FA 1G2HA 3S17J 1ETVA 1VFCA 2G3BA 5EF6A 3RZOJ 3I4NJ 2ZOYA 2GFNA 4PXIA 1UMQA 4V2FA 4XRSA 3KNWA 1MH4A 3KKDA 1MH3A 4MO7A 3WHBA 3S1MJ 3ANPA 4M6VA 1BL0A 3PASA 4C2MJ 5IYBJ 2CRGA 2EQRA 5K7ZA 2REKA 1UHSA 3G1MA 2LD5A 3A02A 1NTCA 2G0EA 1S7EA 2UXHA 3VUQA 1U9NA 2L7FP 3ZQGA 3O8GA 1Q1VA 1HOMA 5C44J 3JREA 1TWFJ 3GTQJ 3BR6A 2G7GA 2UXUA 1IUFA 2ZB9A 2LR8A 3GTKJ 2RHAA 4D5CA 3VW2A 3I4MJ 5M3FJ 1ETQA 2DA5A 3JRGA 5J1YA 1MBHA 5IP6A 2DA6A 1BJZA 1JKQC 1JKPC 4UUSB 4A93J 3HEFA 2ID6A 3BR2A 1ZTRA 3GTPJ 3CRJA 1F36A 1MBKA 2WAQN 5HAWA 4XRMA 2QF7A 4X1EA 1DU6A 3HTJA 2FJ1A 4G12A 2JMWA 3LSPA 2E19A 5GP9A 3GTGJ 2D6YA 2E2JJ 3NXCA 3P9TA 5FHPA 2IU5A 2N8GA 4L62A 3MN2A 1MSEC 2ZOZA 2ME6A 5FGLA 3KZ9A 4M3FA 1Z0XA 1ENHA 1MBGA 2CQQA 1RPWA 1RR7A 3DEWA 3HB9A 2NX4A 4JKZA 3S14J 1ZK8A 2JK3A 2Y9ZA 3BR3A 3NAUA 4ABZA 1MBFA 2LY9A 1PUFA 3S1NJ 3MKLA 2YS9A 2O7OA 2L7ZA 4GFKA 5E3LA 1DU0A 3FKIJ 1HLVA 3IH2A 3CDLA 3SDGA 5M5XJ 2ZCMA 3H0GJ 1POGA 3DPJA 3OSGA 2LTPA 4GFLA 1RETA 2ID3A 2W48A 3EUPA 4FE7A 1MBEA 2XGCA 5JLXA 1A5JA 3OIOA 2KT0A 5D19A 2GBYA 5M5WJ 2X9DA 2HDDA 5HSZA 2HI3A 2NS8A 1ETXA 4MLOA 3ANGA 4MXMA 2DMPA 1WGXA 3V78A 2LVSA 1P7JA 1LE8B 3JRCA 3BHQA 1JUSA 2OI8A 3B81A 3VP5A 3S2HJ 2DG7A 2NP3A 3TEDA 3E7QA 1RKTA 2KDZA 1O4XA 3PM1A 2CUEA 3JRHA 2OPTA 3AQTA 2Y0SN 1LFBA 1W0UA 2B63J 3SJMA 2LK2A 1RESA 1HDDC 2XGDA
chains in the Genus database with same CATH superfamily
2K9QA 3PL8A 1FTZA 4A69C 2X1DA 3E6BA 3OIQA 3FXQA 1FNNA 1B8IB 3BZ6A 2YR2A 4RLQA 1OFCX 3OYGA 3KCCA 1QVTA 4FT8A 2QOPA 4E7KA 1D0ZA 1X3ZB 2ZSIB 5CVUA 2IA0A 1U8RA 5FLXK 5F64A 1ZR2A 4BQNA 2DTZA 5JI6A 3PFYA 2H1KA 3FKJA 4CUGA 2R7OA 5KK1A 1XMAA 3L1PA 3ZR8X 3HRMA 3HHGA 2L2OA 3JCUC 2XB0X 3NI7A 3M1CA 3TP0A 4NDLA 1V5FA 4FISA 1C0WA 2DA1A 3IAM2 1Z6RA 3ZOBA 2EV5A 3HTUA 2EZHA 4NQWA 4C2TA 2W53A 2J5PA 4U87A 4U0VA 3WODF 5FGMA 1GXPA 1XSXA 2RKHA 1Z1DA 5D1RA 4CGZA 2E71A 2VBYA 2AS5F 3HXLA 2ZXIA 5JVTA 5AQCA 3K70D 4G6TB 2PG4A 2LOOA 1H9TA 5DEQA 2RREA 2DFIA 2X6OA 2NNYA 2BOLA 2E1OA 4HDUA 1BOAA 2FQ4A 5J40A 4LK0F 3UKGA 3J81Z 3FMSA 4KIFA 3S5RA 4L5IA 4YIIA 4LB6B 2XVCA 3H5AA 3LL7A 4YFXF 2Z99A 2A2FX 3OMYA 2R93J 2CW8A 2L9NA 3DQVC 2K3PA 3I3LA 4MQ9F 2JA8J 5FLXZ 3I64A 1FBSA 1SVMA 2XASA 3HTSB 2V1NA 4JP0A 2W4SA 4X0GA 2JUGA 3DBLB 2NP5A 4HX7A 4PFOA 3A2KA 4HNVA 3O8HA 1J9IA 3G73A 2K4JA 5H6QA 3BG9A 2DU9A 1E3HA 5F1JA 1WSUA 4CYCA 5CKTA 3HM5A 1A35A 2XKOA 2GOXB 4M3BA 3WTTC 4RLFA 5TRDA 3F8CA 2H6CA 4IKFA 3DTIA 4M3DA 4A3KJ 3RIRA 2QKLB 2JRTA 3G4SI 4BE1A 1HCRA 3F22A 4AIJA 4BBSJ 3VVYA 1HQCA 1Z7LA 1EF4A 3QBMA 4C3JJ 5AONA 1QQIA 3MZ8A 2XDVA 2VE8A 1DUXC 4IQJA 3AAFA 4YG2F 4X6AJ 2DG8A 2ICWG 3LSGA 5CVRA 1MBJA 4ZYAA 1WJCA 2E1CA 4BNCA 2X51A 4XM3A 3ONQA 3HUGB 1FJLA 1EV7A 2XAUA 2DOAA 3PNYA 2L3DA 2M0CA 2W84A 4G6QA 1TL8A 4IHVA 1IN4A 3F21A 1WRJA 1XN7A 3HG9A 3Q3SA 3HOWJ 5EYRA 1M1EB 1Y1WJ 2VBZA 4LLGF 3E6CC 3FXJA 2BY0A 4AVPA 4DYRA 3R61A 2R5YA 2OJED 4C9YA 4PJ0C 3VVZA 4F92B 3V7CA 2DT7B 3LNQA 3NEUA 3SFIA 4BHBA 5E8IA 4L5EA 4LOCA 2XPVA 2HYTA 2EZLA 3BTIA 4A0YA 3TDUC 2Z3YA 1W7PD 2QCOA 2VBXA 5EZHA 2IBDA 4IZZA 1DDNA 2HQNA 3RD3A 4IL6C 4CXFA 5EEGA 3K70C 1TWCJ 4F7ZA 5BPDA 3A4CA 3CD6I 2WY7Q 2HOTA 1YS6A 1UZCA 2Y48A 4I02A 4RMNA 4WXHA 3TO7A 5F0FA 2KP6A 3K1PA 2HTSA 2KIMA 2F5DA 3PO3J 2GAUA 4XIDA 3O3KA 4C2UA 3ZQQA 4IXAA 3I0TA 3GCMA 2M4GA 2E1MB 3HDDA 3Q9SA 2XSJC 3K4MA 3K10A 2EB7A 3H3VK 2VJJA 1W0TA 3MZHA 5IOYA 3I55I 2GA2A 3QYFA 4G6DA 1B6AA 2YVXA 1RIOH 3TO9A 3AFHA 2ZBKA 3CUQB 2H94A 2YVEA 3BY6A 4ZDLA 2IGKA 3IHUA 1ZARA 2A68F 2PFVA 2L5QA 4HAMA 2OU2A 4IQ4A 2XF6A 2ZXWH 2JUCA 3CWRA 2A3SA 3HSEA 3WGHA 1P7IA 3KEOA 5IP9J 5J8CA 4AU7A 5ICFA 1MZBA 1SVLA 3FXUA 1VQOI 2NVQJ 5B5EC 1A6IA 3VOXA 1FYLA 2H8WA 3HKZA 2BXYA 5TJJA 2EFQA 3M8JA 3ZQHA 2DMNA 4ZYDA 2HU9A 4CHUA 1XPXA 5J3LA 1IDZA 3AG3H 1BN5A 2DFFA 4CZCA 3E3VA 2LP0A 4Y33A 2CSOA 5LFAA 1PVEA 1WKMA 5E1XA 5M5YJ 5J1RA 4N4NB 3RPQA 2UXPA 4I0AA 1FBUA 5FLMJ 1OMIA 4KN4X 4QTRA 3NPIA 1W36D 4XRFA 3IH4A 4CCJA 1U3EM 3IH3A 5K7HA 5JFRA 4OWRB 2KIQA 3FWEA 4ASNA 1QBJA 4LJZF 1RUOA 4XLCA 2CG4A 4HW0A 4PSWA 4XK4A 2FQ3A 4IO9F 5FKOA 5A2QK 4W1UA 5B66C 5EGOA 1IGNA 5F08A 2GIZA 3ABLH 4CICA 2FX0A 3GLXA 1G3WA 3L9FA 1QZYA 3P9KA 1XC5A 3MCZA 5E3NA 1IN8A 5M3MJ 5IP7J 3DEEA 4HQMA 3KKCA 1IRFA 1W5SA 1REPC 2Z16A 3BOQA 5ERIA 2ZKZA 2STWA 4GCKA 2VE9A 2LLKA 2PFBA 3TQNA 2CU7A 2E7WA 2FOWA 4ZYGA 3OS2A 5FRMA 2BYVE 1Y56A 2V4JC 1LQ1A 2CUFA 3NS4A 2X6YA 4LIUA 3BCAA 1TQIA 2NVTJ 3JSJA 1IUYA 4B4CA 3OYMA 4LB5A 3RKQA 3OYCA 1YFHA 3ZGKA 3HYIA 5F1RA 3HOZJ 5KAIC 3VIBA 2PN6A 1VQ7I 2LF8A 3VWBA 1XCBA 2WB1N 4Y13A 3JW4A 3IUVA 3LA2A 2HNHA 3BG3A 2YU3A 5J6XA 2B9SA 2L4MA 3M3YJ 5GPAA 5EG0B 5LGNA 1EH8A 4MHGA 1ZLKA 2XAJA 4FE4A 1BI2A 4A3JJ 2M1BA 3DTKA 5HOOA 1SD7A 4C30A 1YO5C 2WGBA 3F23A 3RH2A 3TDZC 2CQKA 1BR1A 4P55A 5EG0A 2O6GE 2FEZA 4EMSA 3VOEA 3CCUI 1TZLA 3WE2A 1T56A 1D0YA 2QQAA 2IA2A 3CLQA 3BC8A 1WJDA 5F27A 5D6EA 1D5YA 3GZIA 1H88C 3H5NA 2V26A 4XMYA 1TP4A 1QNTA 4BU2A 3IV5A 1GVDA 2DO7A 1G6NA 4KISA 5ILSA 4CCKA 5E1WA 1UAAA 1HA8A 1MW7A 2GUHA 4RGXA 4XNFA 3WG7H 1HDPA 3A01A 4RDUA 4YRVA 3KYDB 3BRUA 1JT6A 1QU3A 2Q8KA 4AM3A 1L3LA 3ZMTA 1IZ1A 5EEAA 2KJBA 3ON4A 1VF9A 3H3UA 2JQ7A 3AQSA 2H1LA 4KWAA 3GTLJ 3ZMUA 2E36A 4HLYA 5C3EJ 3SQNA 2PZ9A 4EGZA 2H09A 3DF8A 1ETVA 1SFUA 1QA6A 4KFCA 3DBRB 4AWXB 3I4NJ 3RYPA 2WTEA 4UNOA 3DP7A 3DEUA 1BI3A 1WHUA 4RA2A 3WHBA 1YW8A 4M6VA 3IL2A 3LSMA 3PASA 1MJ9A 5IYBJ 3LSIA 2E34A 5K7ZA 2REKA 1IAWA 2DCEA 4XSXF 1YTYA 2G0EA 1S7EA 3KZIC 2XUBA 1LJ9A 2LG4A 2VC0A 3FM5A 2L7FP 3JAMZ 1L0OC 4ESFA 1TWFJ 3GTQJ 1AOYA 1J2XA 2D45A 2EA4A 2ACJA 1IRXA 1EH6A 1Z3YA 5GAEJ 2VBWA 2LYCA 1PUEE 2DA5A 2F2EA 2HKOA 3JRGA 1JKQC 1BJZA 2W57A 4UUSB 1XD7A 4PGGA 2V9PA 4UV9A 3FDYA 3KX2A 4XKWA 4EM0B 1MIJA 1FC3A 2NRAC 2E19A 3P9CA 1U0JA 3V8KA 3NXCA 3FF5A 2GWRA 3SFZA 1U5TB 3MN2A 3KZ9A 3H0DA 1TNSA 4CCLA 2O0YA 3H1CA 4E7IA 4M3FA 2IP2A 4KT5C 4HV5A 2XHKA 2EILH 3COAC 3I59B 1RR7A 2RV8A 3FXKA 4XQFA 1IF1A 1BC7C 2NX4A 2JK3A 3MAJA 4GYIA 3BR3A 2KZVA 4BJ5C 2NOJB 1BI0A 3SYTA 4RB1A 2LY9A 3F8MA 4XLHA 3S1NJ 1ERDA 3OYNA 2DQLA 1ZHFA 4ESBA 5DV5A 4HRIA 4ENNA 1H0MA 1OCRH 3E5UA 3RDIA 5E3LA 2ZJPF 3F8BA 3FKIJ 1W4MA 1HLVA 3CDLA 3IH2A 3SDGA 1RI7A 1ZAOA 4LD5A 3DPJA 4GFLA 1Z91A 2ID3A 1WVRA 4M74A 4FE7A 4IF4A 4KJZA 1MBEA 5DUKA 3GX4X 3OIOA 4AIDA 2GBYA 3OV8A 1ETXA 3ANGA 1V55H 2UXXA 2DMPA 2E35A 1X1PA 3V78A 2KKOA 3CP8A 1ZG1A 2LVSA 3VYUB 4S04A 4BEHB 2KZGA 1G3TA 5CPRB 3BHQA 3B81A 3GFLA 1Y0NA 1VQPI 3K8PC 1HBXG 1RKTA 2DJIA 3K0LA 5TGTA 5KNLA 1O4XA 1VQ8I 2EIJH 3AQTA 2XV4S 2Y0SN 2W1OA 4J00A 3J80K 4DVYP 2X1EA 3SJMA 3M8EA 1ACIA 4IRIA 1K4TA 4A3CJ 3BQYA 4BS9A 2YVHA 2M8EA 5H6RA 3KP5A 2NVUB 2W7NA 4A0ZA 1IXRC 3CCVI 1T38A 1QVUA 2Y30A 5CXGA 3GFJA 4RGSA 4N4OB 4L9NA 2DMQA 4YFKF 3PNVA 1R58A 3S15J 1X1DA 3ABUA 4PJJA 4Q4ZF 2FBHA 3HOUJ 2WBMA 2MA3A 2VKEA 2FMLA 2B3WA 3GBGA 4IHYA 3BTJA 4HOBA 4A12A 2WV0A 5FFZA 4JL3A 1ZYRF 1GV5A 4NNJA 1IC8A 3EUAA 4C3HJ 4EATA 3W2VA 2A5WA 2J5OA 3QPSA 2CW7A 2L9VA 4BHPA 2ZXJA 1BJAA 3IWZA 3MNLA 2K4BA 2DPUA 3H3ZA 1Z67A 4PK4A 4J01A 1ZKGA 1XG1A 3J7AO 1HW5A 3V8JA 3WTUC 3ASOH 4UVCA 4M9SA 2GQQA 3BR0A 3BJBA 2HVQA 3M1EA 4BYYA 4XLAA 4M71A 3VSLA 4WCGA 3T8RA 2Z5UA 2WA0A 4I7HA 4U0YA 1J5YA 1K61A 1SEUA 1YOVB 1LFUP 4BXXJ 1I3AA 3IP4B 4P9FA 2YU9J 4K2EA 2DMUA 4ZTFA 2Q1ZB 2KL4A 3WGGA 4KN7X 1U78A 3BDDA 1OCCH 2DFHA 3HTAA 3HTHA 1D1AA 1VQ4I 3OS1A 4N0BA 2KRCA 1YIJI 1Z21A 1W7PA 3WTWC 1TBXA 4G94A 3MKWB 1D8JA 1T98A 3CCYA 1Q1HA 3N97A 4KMFA 1GLNA 2JWTA 3QOPA 2UXIA 4A3MJ 1WH5A 4XORA 5DTDA 1GHCA 1A6QA 3G7RA 2HYJA 1K6YA 4I98B 3KP3A 3WGIA 2XAQA 4XN0A 3SEQA 5F6FA 1YI2I 4O3MA 2A6EF 2EV6A 3EYYA 1O57A 3ROUA 4S05A 3ERMA 2AHQA 1BBYA 5E3MA 3FHZA 1R49A 5EZGA 2A6HF 1I6XA 4EM2A 2HVSA 4ACIA 2IAIA 4AC6A 2H8RA 2ZNZA 2XB5A 1XDUA 2COBA 2CO5A 2PX9A 1FIPA 3GZNB 2F5VA 2M4KA 1U8BA 3PFIA 2K86A 1USSA 2Q2EB 4O6JA 5K5OA 1GXQA 2YX7A 4EVIA 5DCFA 1FP2A 1SFXA 3KZZA 2XPUA 2CMPA 1IN6A 2LREA 3L2WA 5HVQC 1D1CA 2VKVA 1XS9A 2L9SA 2ZJRF 4UDSA 2LBFB 4UB6C 5FD5A 3CO6C 5HLTA 2K9LA 3VTIA 3UR3C 2YPRA 4CYCB 2HZTA 2LKSA 5CW8A 3OIPA 2P81A 2JA5J 4OMZA 2DMTA 3ML6A 2YUSA 4RB3C 3M7GA 3PQJA 5D8LB 2QKOA 4BEHA 3S3OA 2HKUA 2ETHA 3IUOA 1SFKA 3KEYA 5HDNA 1R5HA 1HKQA 1JE8A 5DM6F 3T6NA 3FIWA 2QBYB 3TOAA 4OAZA 4QIWN 1YYVA 1FMVA 3F9KA 1VQ5I 4LITA 3C18A 1MMSA 3K4LA 3PNTA 1YX3A 1OLTA 2JT1A 1IV8A 5B3SH 2XROA 3O60A 1XGNA 5LBQA 1SAXA 4RAYA 4LGWA 2K40A 1WI3A 3ABTA 4F55A 4CA0A 1V5GA 5ED4A 4EEFG 3JRIA 1PP8F 3S3MA 1QHHD 4U9LA 2CJJA 4YIFA 1WPKA 1OYIA 4M3GA 4JYKA 4DNCA 1FMWA 3IWFA 4RGRA 4BKXA 3CF5F 5FFXA 2GIVA 3CUQC 2XC7A 1YJ9I 1TC3C 2HS5A 3VODA 1LKXA 1Y8RB 5JHFA 5D4RA 3FK7A 5F0CA 3E6MA 3BT9A 5H20A 2HYFA 2FBKA 2EH3A 4O5VA 4W97A 3B73A 4II2A 1MNMC 4CDGA 5FKLA 4NELA 2R7XA 3FRQA 1XGMA 4JX5A 1UHWA 3I9V2 3I54A 2E1NA 3ZQIA 3HRUA 2GXAA 2MLKA 3BZCA 3HUGA 4I6ZA 1D8KA 2RVCA 4BE0A 1FY7A 1Z6TA 3HPGA 1HF0A 2O7TA 3GEUA 4Y52J 4DZJA 3L2UA 5CQEA 1E2XA 2HPIA 4AVZA 2F4IA 2VT2A 3PIPF 1OJLA 2L7MP 4EM1A 4HNTA 5LEJA 4NC6A 3REOA 4L5JA 2P5LC 1HKSA 4NN1A 3DPTA 4B8XA 1RUNA 4GCLA 2PJPA 5EJCA 2EFNA 2F4OB 1X2MA 4GO1A 2UZKA 4EJUA 2LMDA 3M07A 2H27A 2TDXA 2VT3A 2XGXA 4ITVA 3K1MA 1UJ8A 3Q9VA 5ICEA 1IG7A 2VN2A 2V9KA 1SGMA 3P5JA 5HNHA 2NS0A 3HJEA 4DYQA 5DM7F 4EGYA 4AYBA 3OYAA 1VQLI 3CC4I 1EH7A 3PO2J 2D1VA 1FYKA 2WUIA 2L0KA 5HLHA 1DPRA 2QQ8A 2V57A 4IJAA 5HNFA 1RKWA 4N9IA 3J81K 3E5XA 3S93A 3BR5A 3SWHA 1X3WB 3D1NI 3NNRA 3ULQB 2JA7J 1JJ6C 3BZKA 3BTCA 3PUBA 4D1QA 4U7BA 2VB6A 1Y0UA 3OL4A 5HDGA 1F5TA 1TT0A 1LEAA 4XKVA 1XMKA 4IRGA 1ZRDA 1JJ8C 1OQYA 3WTSC 1K83J 2QWTA 2MSYA 2QM3A 1VQ9I 4F93B 5TISC 2VOPA 3ZMVA 2IRFG 2K9NA 3L2VA 1QO0D 4BQOA 2PBIA 2GA1A 1T08B 3I59A 2R5ZA 4EJOA 3IKVA 4XSZF 4HF2A 4U9NA 2ZMEC 1I1GA 1R71A 2P6SA 3K4NA 3HOYJ 4KICA 1KZHA 3HKZN 2HKXA 4FX0A 2FOKA 2B1EA 1UG2A 3Q0VA 1FYMA 5HODA 2R5ZB 5LHHA 1S7OA 1YS7A 1FOKA 1F43A 3WTZA 3W3CA 3CMAI 2QQBA 1OCPA 1AKHB 2VODA 4H4KC 3ASNH 4WIBA 1S3JA 3BP8A 2AXLA 2RNJA 1R9TJ 3ZN0A 2QLZA 1P4XA 3F72A 3OWTA 4OU0A 5GADJ 2DJNA 1WJ5A 2O5RA 2QBYA 5DD4A 1QZEA 2ZY9A 5CVIA 2OQGA 2BY3A 3BROA 1HXDA 3E7LA 4JX6A 4ZYEA 3P7NA 1KONA 4PZJA 2DPDA 2X48A 1AA7A 5HS9A 1ONVA 1VNDA 2LSOA 4Q47A 1R7JA 1P6RA 3HTIA 3BCGA 3OYLA 2H6BA 3R4KA 1VQ6I 2EPFA 4CCMA 1JKRC 2DTRA 2Q0OA 4RB0A 1JHFA 3CMYA 1P9QC 2O8KA 4CYDA 3U2RA 1G4DA 2PJRB 3F8FA 1N78A 3CESA 3I53A 3E0JB 2OA4A 4LG0A 3RZOJ 1X1CA 1T6SA 2KDOA 2FA5A 1UMQA 2MD0A 1MH4A 3D5SC 1MH3A 4MO7A 3CCJI 3S1MJ 2VQGA 4C2MJ 2CV2A 2CRGA 4XOPA 2W24A 4WK8F 3CCLI 2QVOA 3G1MA 3OY9A 2R7WA 2M7AA 4LIVA 3TOBA 3I71A 1NTCA 2NAZA 4Y4RA 1U9NA 2ZO4A 2B0LA 1SAUA 1HOMA 2HWVA 3DV8A 4P5OA 2LNBA 2P7CB 1IUFA 5H2FC 2QSFX 3RSNA 5E18F 4WXCA 3QYEA 5D8KB 4LFUA 2BGCA 1XGOA 3OS0A 5HS7A 5J1YA 1G8XA 2DA6A 4QPOA 4E4HA 1ZTRA 2R7DA 1SFEA 1K79A 3GTPJ 4XRMA 3RTRA 1DU6A 3DWLE 1W1WE 2DDAA 1FBQA 5D5WB 4G12A 2JMWA 4KYWA 4WX9A 2BW3B 3L2CA 3P9TA 5FHPA 3GFMA 2VKHA 2IU5A 1MSEC 2ZOZA 1YW7A 1XSVA 2MC4A 2BZTA 4BACA 1ENHA 4HX4A 3DEWA 1IW7F 4R8HA 3S14J 3F3XA 3LA7A 2FU4A 3QAHA 2A6TA 4XLNF 4ABZA 3BPXA 1MBFA 3KEQA 4ZYHA 2V6CA 5DUIA 3MKLA 2EFPA 1NH3A 2YS9A 2O61A 2L7ZA 2LKPA 3K4BA 3QOEA 5L3FA 4Y17A 1ZN2A 2MABA 2ZSHB 2QWWA 3KYCB 2BHZA 4XOTA 3H0GJ 3AG4H 5CVJA 4PGHA 3OSGA 1LFPA 5K5QA 5DYMA 4KDPA 2W48A 3IRQA 4ZJZA 3U21A 3LAPA 2XGCA 2LY2A 5JLXA 3DU6A 1YG2A 3FBNB 2ZJQF 5HSZA 4MXMA 4MLOA 1QZZA 3JTHA 2EFWA 4IRHA 4KIBA 1ULYA 4YELA 3SEZA 2WADA 5CYVA 2IJLA 2P0WA 2Q2EA 2VL8A 3QU3A 4GDFA 1XB4A 2DG7A 2E5NA 3TEDA 1H9GA 1R4MB 2NXNB 3ABMH 3C3WA 3PM1A 2V6EA 2CUEA 3K9TA 3M9AA 4GCVA 3I5UA 1LFBA 2DLLA 3KYLA 2RQQA 2R3SA 5C4XJ 2V7FA 3CDHA 2EINH 2HQAA 3KLOA 2HPMA 1QPIA 3S1RJ 2ADUA 2P6TA 1AKHA 4C3IJ 2BE5F 2K02A 3P9IA 5L3DA 5LGTA 1D0XA 2DOFA 1ODDA 2V1XA 2ZNYA 2M9HA 2IEKA 3G3ZA 4XR6A 4B3XA 3CCEI 4G9YA 1ETYA 3GMEA 2I10A 1BC8C 3ISPA 4GYGA 2RC4A 2WAQA 2DFEA 4DIQA 3G56A 3TP3A 1G3YA 1U6GA 3QQAA 3HIFA 1SMTA 2L01A 3LSHA 1MMAA 1R1VA 2P4WA 5FD6A 1D3YA 3OSFA 4BXUA 2R7UA 3HZJA 2CH0A 4CGRA 2VQCA 1XTAA 3UNGC 4CO8A 3BR1A 4BDZA 5F04A 4A3DJ 3WU1B 1P4WA 3CCMI 3K69A 2W82A 2M3AA 3WU0A 4L0ZB 4HYEA 2TRTA 4U0WA 2PJRA 2BXZA 3CC2I 2EZIA 4UV8A 4FTHA 1PYVA 1YQAA 2IGOA 4XN3A 1HSTA 1UFMA 3C1DA 1DPUA 2R7VA 3VW0A 5H9TA 2ZMEB 4HSTA 1IXCA 3L00A 4D7MA 4FASD 2OAZA 4S0HB 3T8TA 1UHMA 3E1SA 1I39A 2OERA 2D2WA 2BHYA 4U7DA 3H9GA 3GVAA 4C2MA 3K2AA 1K4SA 1AU7A 2ZMEA 4BGDA 3EGQA 3CMMA 3TKYA 3HOXJ 2QUFA 1K78A 3QPTA 1Z7UA 3PQKA 1MMDA 1V54H 1X58A 2CQ7A 3BJOA 3PSIA 5GTIC 4A3FJ 2HYGD 2UV1A 2FD5A 3FMRA 3NRVA 3GYHX 3J7YJ 4DGWB 4P1WA 1VQKI 1R6RA 2NVXJ 1A36A 4ME9A 5GAHJ 4M9XA 2W85A 3FK6A 1IXSB 2NS7A 4YEJA 1KGSA 1TNTA 5DD8A 4KITB 1AWCA 2FNAA 2CYYA 2O03A 2HGCA 4JQFA 4E7ZA 2XPWA 5LD2C 2FXAA 2X1CA 5BNGA 6PAXA 5CVVA 4JBAA 1BOBA 2XIGA 3JRDA 1FSEA 1TTYA 2E7XA 2OD5A 3GLLA 5C4YA 3SZPA 4ENKA 2PEXA 1G59A 1Z9CA 5IOZA 1PJRA 1STZA 1IJWC 4Z6YA 1GUUA 2MH9A 2VJIA 3S2WA 4QSHA 2DN0A 3HBLA 5IPAA 3GTMJ 4M73A 4A3GJ 4HKUA 3RZDJ 5JR3A 2M30A 2MW8A 3WHCA 1ZLJA 4B48A 1ZG5A 2LH9A 3ESWB 3K4JA 4HDVA 2CUZA 3ZQLA 5B1AH 2EBIA 3ZCOA 1IRGA 1UI6A 9ANTA 5BPIA 1H8AC 3JAMK 3KP7A 3FBIB 3DPLC 3GTJJ 1Y39A 4XICA 4KIGA 3F0CA 2MGQA 5EDNA 5EFYA 2JJ7A 1I6HJ 2G7SA 4PSXA 2QYOA 3JR9A 3OL3A 2VUMJ 2PMUA 2VKDA 1FOYA 2Y0SA 3MD2A 2FSWA 3AL0C 5IT9K 3GO5A 2EZKA 1KQ9A 3D5LA 4A3IJ 2NOGA 2GM4A 2EK5A 2Y31A 2QSHX 2UWMA 3S3NA 2LFBA 2VOOA 5J1UA 1TWAJ 4PFPA 3ON2A 2R7FA 2ZC2A 2Y2ZA 3TW7A 5LLQA 4BDYA 3FXRA 2KMUA 3QPHA 1PUFB 4LLNA 1APLC 3H5RA 2R5YB 1R23A 4JNNA 2RAEA 4G8XA 3W2WA 1RR8C 2NVYJ 5K58A 1SD4A 4ZTJA 5A2QZ 1MDMA 2L7KA 1E17A 3H35A 4E6KG 1CF7B 3EDPA 2E60A 1CGPA 1ZH5A 5HBUA 5L3CA 3QKXA 4XKCA 4QPQA 2VC1A 4E7SA 2M2EA 1Y1VJ 2HDCA 2MG4A 1N25A 1MNDA 2V79A 2D1HA 4HA8A 3A01B 3M4OJ 2QEXI 2IS6A 1UELB 2ME0A 5KHDA 3I4PA 3DKYA 2QKMB 4AUXA 3LOCA 3OOUA 1KU9A 1W36C 2ZCNA 1J09A 3OYKA 1BW5A 1FOWA 3C07A 2R0QC 1I3QJ 4ESJA 4BY1J 3FXMA 1Z05A 1LVKA 1MD0A 2IW5A 1ZQ3P 4KA4A 1ZR4A 3GEZA 2A69F 2MFZA 2DYRH 2OUMA 1T0FC 1S72I 2ECCA 3GZ5A 1WH7A 2R7QA 2Z33A 3GTOJ 2ESHA 1JGSA 2KIFA 1UB9A 5GAGJ 4UXNA 1KQ8A 2EV0A 1GV2A 2RASA 5D6FA 2VI6A 2LKXA 2HOEA 2M34A 3ABKH 3FISA 1HC8A 2VASA 3U1KA 4UY8I 4OIPF 3CTAA 3MKZA 4FQGA 2OF7A 2NYXA 4M72A 3GUDA 1ON1A 4UUTA 5GPCA 4IVNA 3FXOA 5ILVA 2DW4A 4HG2A 1DQUA 2CS3A 2DK8A 1B72B 4FHTA 4HEA2 1E3PA 2VONA 2KQRA 2F07A 2XSDC 3Q0UA 3VEPA 2BBYA 2X4HA 3QPLA 4HX8A 1B72A 3HE0A 1MMNA 1B59A 1ZRFA 4MGRA 3GXOA 3LWJA 2PMZN 3DKWA 1R1TA 4BAYA 1ZGWA 5LRSA 4I01A 2WWYA 4B09A 2CGPA 2MYSA 2G7LA 4G7OF 2OCCH 2GENA 1BM9A 3RKYA 4MK6A 3LJLA 4OD5A 4DBQA 3BLYA 5E17F 4A5NA 4ENMA 2EFOA 2IT0A 3Q5FA 5L3EA 3O2PE 2JTVA 2XRLA 1YHQI 1ITYA 1IDYA 5JHUA 1ZELA 2FRHA 5D18A 2VLAA 4WXDA 3BTLA 3IRRA 1TQMA 3V4GA 2HDWA 2FUG2 4GGGA 4RM3A 1ORKA 2OCEA 2LY1A 1OYWA 3LSTA 5F0HA 1BR2A 2DDBA 2WC2A 1XGSA 1LUJB 2FJI1 4BUPA 1A31A 3W6VA 2R7RA 3K1NA 2UXOA 3VOKA 4PJMA 4FETA 4UVBA 1QGPA 5E79C 3V42A 2R7ZJ 3KLNA 2ZCWA 4J19A 1JUPA 1O3QA 1WFXA 1IN5A 2CWEA 3OYDA 2FE3A 4AIKA 3ZPLA 5L3GA 3NARA 2R92J 1IN7A 3EETA 1NG7A 4B44A 3ZQCA 4Q48A 2DT5A 2VIXA 4GFBA 5ICGA 1LDKB 5BS6A 2XAGA 3AG1H 1UI5A 1ETOA 1MNEA 2X0LA 4M9ZA 3EUKL 3HC7A 1I50J 1KU2A 5BMZA 3RI4A 3LHQA 3H92A 1OR7C 3DLAA 3H36A 1N77A 3PJRA 1VQNI 2QTQA 3D5RC 4N9HA 4L9JA 5J4YA 3BPVA 5FKMA 4MFDA 2KRHA 3BCBA 3S1QJ 3PSFA 2MLGA 4A6DA 2LF7A 2IGNA 1KU7A 3L09A 1H89C 2C6YA 2A05A 1T8IA 3FM3A 2XAHA 2Y75A 3NWTA 3HRTA 3CP2A 1G3SA 3HRSA 3WG9A 1FLIA 2OC6A 1S9HA 4MIMA 5E20A 5DS9A 4RBOA 1T33A 3BQZA 5D5UB 4A3EJ 1UG0A 3VPRA 4NBQA 4Q5SF 1F9NA 2ECBA 3KFWX 3JSOA 4HZFA 5DDGA 3EYIA 1FOXA 3FX3A 1OISA 1XSDA 2DT6A 1T2KA 1FSHA 1B1BA 5KVRA 2VJ4A 3S17J 1VFCA 2IGMA 1I5ZA 4H0EA 4PXIA 3KNWA 1TW3A 2MBFA 3O6BB 3ANPA 4I09A 1BL0A 2PMZA 3DPUA 2EQRA 4BHCA 2OTJI 5E8GA 4EJWA 2G7HA 1R4NB 3A02A 3CLOA 4OIRF 1VQMI 1P92A 4WF2A 2UXHA 3VUQA 4L18B 2GOMA 2HFHA 1XMXA 1Q1VA 3RKWA 2DYSH 3JREA 1MMGA 1BIAA 3BR6A 4RGUA 4A2UA 2G7GA 2UXUA 4ZZLA 2LR8A 3OYIA 3N4MA 2M7BA 2RHAA 1DGWY 4IRVA 5IT3A 4D5CA 4M6YA 4NHJA 3VW2A 3I4MJ 5M3FJ 3R6SA 1D5VA 1MBHA 5IP6A 1JKPC 1W5TA 3TO6A 3V7RA 4A93J 3HEFA 4PUSA 3OYEA 3VYTB 1F36A 1MBKA 2K5CA 5HAWA 1T95A 2DQRA 4X1EA 3SZGA 4IPAA 3JTGA 3QRFF 3LSPA 3LFUA 5GP9A 2CV0A 3GTGJ 1NG6A 3TGNA 2L54A 2D6YA 4NC8A 2ZJ2A 4L62A 3ZQ7A 2MC3A 2ME6A 2QSGX 1YJNI 3GF2A 4RB2C 3E5QA 5J47A 1XX5A 1MBGA 1S8NA 3MEXA 2IA1A 1U2WA 1KQ0A 1HW1A 1RZ4A 3HB9A 3ECOA 5IT9Z 3W2AA 5CQGA 3LWFA 2IS4A 1V4RA 4BE2A 1SC7A 1YE9A 5FRNA 2HZDA 2OQRA 2WAEA 1LNWA 2A07F 1MJBA 4GFKA 1DU0A 3CMEI 1KYZA 4L0YB 1DP7P 3ZRGA 1POGA 1S29A 5L3BA 2M45A 3EUPA 1ZGJA 2XF5A 2K85A 1JI8A 1N75A 2KT0A 3J7ZI 5D19A 5M5WJ 2HDDA 4V19K 3DU5A 4RAFA 2HI3A 2NS8A 2XRNA 4UUVA 1I27A 3MMYB 1YW9A 4RS8A 2UXNA 4UHTA 2W25A 1V3FA 1LE8B 3JRCA 1J59A 4LG3A 2OI8A 3VP5A 1F1ZA 1FX7A 3HOSA 2KDZA 1OCOH 3GWZA 3JRHA 4BL0B 2M87A 4HF0A 4E70A 1X3UA 1YIOA 2AQEA 1W0UA 2LRDA 2LK2A 2KJCA 3VYSB 4A3BJ 1HDDC 1HSJA 2XGDA 3HGGA 1V5EA 2HOSA 1QHGA 3TL4X 2KISA 4M6XA 1VZ0A 3E97A 3FHNA 4XRSG 2Z2SB 2DOEA 3ZMZA 3MFKA 3CJDA 2EWNA 3QODA 3VVXA 5JVGF 1O7FA 5CXIA 1OKRA 4OAYA 4OOIA 1CQTA 2K3FA 3EQLF 2FBIA 2RNGA 3RCOA 2HEOA 3LSJA 4ZH4F 1FTTA 3CDIA 1LDJA 2K9MA 1J75A 4IHWA 2KPMA 2VXZA 4I76A 1PDNC 4TV7A 4B43A 3OYHA 3DXJF 2HXIA 1UCRA 5D5XB 1Z3XA 1MDMB 3DBHB 1KYWA 4MTEA 2BVLA 2JZYA 4CZZA 1BIBA 4BY7J 4BBRJ 4I99C 3SHFA 1YX5A 4A5MA 5FLVA 4BJTA 2V1UA 2P5KA 3QYBA 2F4MB 1FT9A 2E5ZA 2P5VA 5LGUA 3HIMA 2PMHA 1FPQA 2KIUA 3LQRA 3VFZA 1HW2A 3PPBA 2R7TA 2OV7A 3MVPA 2P7VB 1F4KA 1FIAA 4YIRX 3WTVC 4QLCU 1QRYA 1ZG3A 4XLFA 2QZ8A 2WY8Q 1SANA 3JSPA 2QENA 2ZCXA 4R1HA 3WTYC 1P2FA 2BV6A 4NUBA 3BG6A 2YX4A 4JOMA 1BA5A 2BY2A 3CJNA 1GDTA 4IHTA 1MKMA 5BOXA 4OIQF 4AC0A 2JA2A 2VQHA 3KETA 1IV6A 2HQRA 1IRZA 1Y8QB 1R5GA 5CJ9A 2B7EA 2TCTA 3NRGA 3ZP5A 3AG2H 2A5YB 2V1DA 3EUHA 2OZUA 5ILUA 4LK1F 1SD5A 4EQQA 2MD5A 3LMMA 3MKYB 1JT0A 5FJ8J 4F91B 1WCMJ 2QIBA 3CUQA 4ZC3A 4F3QA 5C4JJ 2BY1A 5LRRA 3ZMSA 2DA7A 2L9RA 5LHIA 3B6CA 1GVJA 4B3AA 1USTA 1U5TA 2CFXA 4GXOA 3S32A 5HDKA 1LVAA 1BW6A 2KHMA 2LDUA 1LEBA 2CFOA 5FKKA 4FX4A 3CCQI 2OBPA 1MGTA 2JSPA 3COLA 2QGUA 3C7JA 1YRNB 3RQ4A 4DW6A 1LPQA 2HOAA 4ZDPA 2VPRA 4UB8C 5DCMB 4ON0A 2CQNA 2JVGA 3CJQB 3C2HA 1OYYA 2EJRA 4XONA 2VPLA 3OOPA 2Z9OA 3C2BA 4M3EA 5LHGA 3TBIA 3KP6A 2X6XA 4KMUX 1P4AA 3OR1C 3A1YA 4P9UA 1ZRCA 4Y15A 1S7AA 3JRBA 3FZVA 4P96A 4CSWA 1FEXA 1T39A 4ETSA 5CLSA 3G1LA 2G9WA 2XGEA 1JXSA 3H9JA 2ISZA 5AIPA 1WJAA 3IKTA 4DBRA 3BJ6A 4NB5A 5HS8A 3A0HC 2VXDA 3X2QH 2FF4A 1NK2P 5FO5A 4D7NA 4MEXF 2I8DA 1RNLA 4HPQA 2GLOA 2RGVA 5HLGA 3F8NA 5FKNA 4XBFA 3JRAA 4HBLA 3GZ6A 4HQEA 3HOTA 1TW2A 3FXLA 2NNNA 4LLLA 4AD9A 3F1BA 3AL0B 5D5VB 1DP3A 2AO9A 1KU3A 3TW6A 5EGOB 2XKPA 3Q0WA 3G71I 4MTDA 4I0BA 4ANJA 1LE8A 2R7SA 3B6AA 2O8XA 1O3SA 1NK3P 2BVMA 3K4CA 1S5LC 4MFEA 1R00A 3KP2A 4XL9A 4PCQA 4CCOA 2E1MC 2MH2A 3BNIA 3OYFA 4A3LJ 4XKBA 1K78B 1U9OA 3BG7A 4NQWB 2DK5A 4E7LA 2L02A 4AIHA 4JX4A 3R0AA 5EEHA 4NC7A 3WTXC 4YZEA 2DAOA 3JRFA 3U9GA 2JPCA 3M8FA 3LAJA 2IPQX 3DCFA 3K6GA 1B4AA 4ZZDA 5ICCA 2AXTC 1LDDA 1XCVA 3LA3A 3QP5A 1YLFA 3L2QA 3F6VA 1SVOA 1AHDP 2K27A 1TWHJ 3VSKA 4B1RA 4LMYA 4RM2A 3KZYA 3RQIA 5JLWA 2PI0A 5IYDJ 3LQQA 2ISYA 5GTHC 4II3A 1T0FA 1ETWA 5IY5H 1KA8A 2CQXA 3CZ6A 2STTA 1D1BA 3NWSA 3R0JA 3N05A 4B47A 4AF5A 3I58A 3VW1A 1B9MA 3LFKA 4D5FA 4RAZA 1JTYA 4ZDOA 2Q24A 2JVHA 2K7LA 4XLEA 4BH9A 3SZTA 3S2DJ 4Y3OA 2E2IJ 3I56I 2WB1A 2ELHA 1J0RA 1MJAA 3K7AJ 3A03A 5DAJA 4A6EA 4G7HF 1OCTC 4OD4A 1R36A 2K9SA 1JTXA 1X2NA 2DA4A 3IC7A 3CF2A 4HV6A 3F6OA 4Z2YA 3HOVJ 3G1OA 3DLLF 4WWCA 3QU6A 3W6KB 5D4SA 2OZ6A 2I5UA 1Y6IA 1TLHB 3ZQFA 2HQ5A 1BR4A 3PUFA 2O9LA 3W6JB 2ESNA 3VYRB 2DA2A 2RQPA 4HSRA 2YSRA 1IO2A 2KFDA 2HXOA 2XF7A 4Y7NJ 4ENJA 3SXYA 3SDBA 2JN6A 5J4VA 3CCRI 1X4PA 2EA2A 4D9JA 4BQQA 1YITI 3U1DA 1R5ID 3A0BC 1RC9A 2CUJA 3B02A 1YJWI 2FBQA 2X6WA 2QQ9A 2IS1A 2Y9YA 3OYJA 2DBBA 1YRNA 3CUOA 1FP1D 4IHXA 2EIKH 3G2BA 5E3OA 4CH7A 2D5VA 1SD6A 3ERED 1Z77A 2P8TA 2LC2A 4GRIA 4KT6A 1PP7U 3LSRA 5KCMA 2JA6J 4DOZA 3EUHC 3RPUA 1I1SA 3MZYA 4YFNF 4ICHA 1ETKA 1VI0A 2JSCA 4V2GA 5AIQA 5E1ZB 4D0PA 1TQPA 4BQAA 3OYBA 1E3OC 4IEJA 3CQZJ 1MSFC 4MEYF 4DJAA 3GFIA 2M8GX 4CCNA 3OR2C 2PLYA 3QWLA 1R1UA 2DA3A 1W5CC 4UUSA 1ZREA 2IXSA 2PQ8A 2XDNA 4U88A 2HVRA 4JK1X 2PBXA 1OR7A 1GT0C 3KP4A 3GW2A 3HGYA 4IX7A 1EA3A 3R60A 4L9VA 1BI1A 1WJBA 3DFGA 3NQOA 1SFOJ 1TT5B 2KLOA 3CO7C 1B8IA 1JKOC 3V6GA 2VJ5A 4IOAF 5FMPA 2ZFWA 4A0XA 4DYCA 5IYCJ 1WQ2A 3ZMDA 4FCYA 3S8PA 4XLPF 1HKTA 1OPCA 1X1AA 4BJ6C 2V9VA 4RAGA 4AYBN 1X4OA 3S16J 3TMOA 1FZPB 2E2HJ 2X85A 2LBFA 3ZXSA 3J7AY 4BXFA 2DXIA 5J8FA 2W00A 4LG0B 2CV1A 2WV1A 1JUMA 1WI9A 4EJTA 3L7WA 3T0YA 4R79A 4GCTA 1JGGA 3RPUD 4DZPA 4PJNA 2G7UA 2HTJA 2VQLA 1SMYF 2ELKA 3VB2A 3BG5A 1E0EA 3T1BA 5LEKA 3ELKA 1TWGJ 5K7FA 1G2HA 2G3BA 3BWGA 2BEOA 5EF6A 2ZOYA 2L4AA 1WZ2A 1EKEA 1DGRM 3K2ZA 2GFNA 2F5FA 4V2FA 4XRSA 1LB2A 3HL2A 3KKDA 3V8LA 2M5WA 5HLIA 2COMA 2WAFA 4OIOF 3D0SA 4PJLA 3IAS2 1UHSA 1VTNC 1O7LA 3LSKA 2LD5A 2GZWA 4I2OA 1A04A 3MQ0A 2JRMA 4HF1A 5B1BH 3KIOA 1QPMA 3ZQGA 3ZN1A 3O8GA 5C44J 2OTLI 3QP6A 2ZB9A 4KNYA 3GTKJ 2EIMH 4QWQA 3CJTB 3RJPA 4OMYA 1ETQA 2UUZA 4L9TA 2R4GA 3WE3A 1B9NA 3KE2A 3DTEA 2F5EA 2ID6A 3BR2A 3RKXA 2FMYA 3CRJA 2HR3A 2Y69H 4OINF 4E7JA 2JPBA 1K7AA 2GXGA 2WAQN 2RDPA 3CC7I 2F5CA 1U5TC 3MWMA 1R22A 2QF7A 4UVAA 3HTJA 2FJ1A 3K4KA 4E7HA 2ZFUA 1X19A 4MQVA 5FROA 1K6OA 2M0MA 1ON2A 2FNPA 3PIOF 2E2JJ 2N8GA 2QA4I 3KPHA 2DI3A 4G7ZF 5FGLA 2ZXHA 5K5RA 1O3RA 3DKXA 3ECHA 5FB2A 3L2RA 1Z0XA 4PDKA 4IOCF 1J7KA 2CQQA 1RPWA 4DQ2A 2GXBA 3EPZA 3FMQA 5K1YA 4JKZA 3E6DA 3CCSI 1ZK8A 2Y9ZA 1RRJA 2Y0MA 3NAUA 3RYRA 2BW3A 5BQTA 3HPHA 1PUFA 4IHSA 4HLXA 2XAFA 3T5XA 2ELJA 2IVMA 4MNUA 2O7OA 2CW0F 3HHHA 5KAFC 2KRFA 2AQFA 2ZCMA 5M5XJ 1CF7A 1XDSA 2F6CA 3J80Z 2LTPA 1RETA 1WWXA 1JHHA 3CJRB 2DODA 2O3FA 1A5JA 1WJEA 3V7SA 5DCMA 3HSFA 1S6LA 2F48A 1X1BA 2X9DA 2IS2A 1OCZH 3G6EI 1O3TA 3VDXA 4EV0A 1W7PB 1WGXA 1P7JA 1WJFA 4EJVA 3AKZA 1EJ9A 1JUSA 3C2GA 1FWZA 3S2HJ 1NHAA 2NP3A 3E7QA 4HNUA 2Z1DA 2RN7A 3BJAA 1ZGAA 2OPTA 3H9QA 2A61A 3WU2C 2B63J 3HSRA 4KUMA 4F52A 1RESA
chains in the Genus database with same CATH topology
2K9QA 3HGGA 1FTZA 4A3CJ 4A69C 2HOSA 3BQYA 2YVHA 1QPIA 3S1RJ 1B8IB 1AKHA 4XRSG 4C3IJ 3CJDA 3VVXA 1OFCX 1QVTA 2QOPA 1QVUA 2Y30A 5CXGA 2M9HA 2IEKA 5CXIA 2DMQA 1CQTA 1ETYA 1ZR2A 2I10A 2DTZA 3S15J 3LSJA 3HOUJ 2VKEA 1FTTA 2H1KA 3G56A 3TP3A 3GBGA 3QQAA 4IHWA 3L1PA 4IHYA 4I76A 3BTJA 3OSFA 2HXIA 2XB0X 3NI7A 4CGRA 3TP0A 4JL3A 4NDLA 4FISA 1GV5A 2DA1A 3BR1A 4C3HJ 3ZOBA 1IC8A 5F04A 2EZHA 2W53A 4A3DJ 3QPSA 4BY7J 4BBRJ 5FLVA 2TRTA 3MNLA 5D1RA 3HIMA 2EZIA 1ZKGA 1XG1A 5AQCA 4FTHA 3PPBA 3VW0A 5H9TA 2X6OA 3MVPA 3BR0A 2E1OA 4D7MA 2FQ4A 3BJBA 1FIAA 4S0HB 3UKGA 1QRYA 2OERA 3S5RA 1SANA 2ZCXA 1K61A 3K2AA 1AU7A 1LFUP 4BXXJ 3EGQA 1BA5A 1GDTA 2YU9J 2R93J 2DMUA 3HOXJ 2JA8J 1U78A 3HTAA 4JP0A 4AC0A 3HTHA 1IV6A 1X58A 1IRZA 2NP5A 2TCTA 4A3FJ 3NRGA 4HNVA 3O8HA 2FD5A 2NVXJ 4ME9A 3BG9A 3CCYA 1JT0A 5F1JA 5FJ8J 3FK6A 1WCMJ 2JWTA 2NS7A 2QIBA 2UXIA 4A3MJ 1WH5A 5C4JJ 4CYCA 5DTDA 3HM5A 2DA7A 2L9RA 3G7RA 2HYJA 3B6CA 4B3AA 4M3BA 2XPWA 5BNGA 1BW6A 5FKKA 4M3DA 3JRDA 4A3KJ 2AHQA 5E3MA 3COLA 5C4YA 1YRNB 1HCRA 4DW6A 4BBSJ 5EZGA 3VVYA 1EF4A 3QBMA 2HOAA 4C3JJ 5IOZA 2VPRA 4ACIA 1IJWC 2IAIA 1GUUA 4AC6A 4QSHA 2DN0A 3HBLA 5IPAA 3GTMJ 2H8RA 2XB5A 2COBA 4A3GJ 4X6AJ 4HKUA 3RZDJ 1FIPA 3C2BA 2MW8A 4M3EA 3WHCA 2DG8A 3LSGA 1U8BA 1MBJA 3ZQLA 2EBIA 2XPUA 1FJLA 3JRBA 9ANTA 1UI6A 1H8AC 1FEXA 2M0CA 3GTJJ 4IHVA 3G1LA 4XICA 3F0CA 2MGQA 5EDNA 2VKVA 5EFYA 2JJ7A 1I6HJ 2XGEA 1XS9A 3Q3SA 2G7SA 4UDSA 3JR9A 2VUMJ 3HOWJ 5EYRA 1Y1WJ 4CYCB 1NK2P 2R5YA 4D7NA 4DYRA 5CW8A 2GLOA 2EZKA 5FKNA 3JRAA 4A3IJ 2NOGA 2P81A 2GM4A 2JA5J 2Y31A 3VVZA 3F1BA 3LNQA 3SFIA 4L5EA 2LFBA 2DMTA 2AO9A 4LOCA 2XPVA 2HYTA 2EZLA 3BTIA 2YUSA 3Q0WA 3TW6A 5EGOB 2QKOA 5J1UA 1TWAJ 2QCOA 3B6AA 1LE8A 5EZHA 2IBDA 2Y2ZA 3TW7A 2HKUA 3ON2A 3RD3A 1NK3P 1PUFB 3T6NA 1TWCJ 3FIWA 4MFEA 1APLC 4QIWN 2R5YB 4JNNA 2HOTA 2RAEA 3BNIA 2NVYJ 4A3LJ 5K58A 5F0FA 1U9OA 3PO3J 4XIDA 5HBUA 4JX4A 3O60A 3QKXA 3HDDA 2K40A 4YZEA 1WI3A 3H3VK 2M2EA 1Y1VJ 3JRFA 2MG4A 1W0TA 5IOYA 3A01B 3M4OJ 3DCFA 2ME0A 4EEFG 3JRIA 2CJJA 4AUXA 2YVEA 1WPKA 4M3GA 3LOCA 4JYKA 3OOUA 2ZCNA 1BW5A 1AHDP 1TWHJ 4BKXA 3C07A 2R0QC 4B1RA 1TC3C 3CWRA 1I3QJ 5IP9J 1P7IA 4BY1J 3RQIA 5JLWA 1ZQ3P 5IYDJ 3FK7A 2NVQJ 5F0CA 1ZR4A 1ETWA 1A6IA 3BT9A 3VOXA 2CQXA 2ECCA 2EH3A 1WH7A 3GTOJ 4W97A 4AF5A 3ZQHA 2DMNA 1MNMC 3VW1A 5FKLA 4NELA 1GV2A 4D5FA 2Q24A 2RASA 1JTYA 2VI6A 2LKXA 3FRQA 4JX5A 2M34A 5J3LA 1IDZA 3S2DJ 2E2IJ 3ZQIA 3FISA 4I6ZA 3K7AJ 2LP0A 3A03A 5DAJA 5M5YJ 5J1RA 1OCTC 2OF7A 1HF0A 2O7TA 2UXPA 5FLMJ 4UUTA 3GEUA 2K9SA 1JTXA 1X2NA 2DA4A 4DZJA 5GPCA 4QTRA 4Y52J 3NPIA 3IH4A 1OJLA 2L7MP 3HOVJ 3IH3A 3G1OA 5K7HA 1B72B 4NN1A 3ZQFA 4GCLA 2HQ5A 4XK4A 2F07A 5FKOA 1X2MA 2XSDC 2O9LA 3Q0UA 4W1UA 2DA2A 3QPLA 1B72A 5EGOA 1IGNA 3HE0A 5F08A 3LWJA 2HXOA 1IG7A 2FX0A 2PMZN 4Y7NJ 1SGMA 1ZGWA 1XC5A 2JN6A 5E3NA 4DYQA 5M3MJ 5IP7J 3PO2J 2G7LA 3KKCA 2WUIA 2GENA 2L0KA 4MK6A 3LJLA 2V57A 2FBQA 1RKWA 5C4XJ 4GCKA 2LLKA 3BR5A 2Y9YA 3D1NI 2CU7A 1YRNA 2XRLA 1ITYA 4IHXA 3NNRA 1IDYA 2JA7J 1JJ6C 2CUFA 5E3OA 3BTCA 5D18A 2D5VA 3BTLA 2NVTJ 3JSJA 1Z77A 4B4CA 1JJ8C 2JA6J 1K83J 3LSRA 1ORKA 3RKQA 2MSYA 2QWTA 5F0HA 4ICHA 1ETKA 1VI0A 3HOZJ 4V2GA 2K9NA 3VIBA 3IUVA 3W6VA 1E3OC 2WB1N 4IEJA 3CQZJ 1MSFC 2UXOA 3VOKA 3BG3A 2R7ZJ 2M8GX 3M3YJ 5GPAA 5EG0B 1JUPA 2DA3A 2R5ZA 4J19A 4UUSA 2XDNA 3NARA 4FE4A 2R92J 4A3JJ 3HOYJ 2PBXA 3ZQCA 1GT0C 2WGBA 3HKZN 4GFBA 3RH2A 1UG2A 3Q0VA 5HODA 5EG0A 2R5ZB 3HGYA 1UI5A 1ETOA 1F43A 1I50J 1SFOJ 1OCPA 1B8IA 1AKHB 1JKOC 3LHQA 3V6GA 5FMPA 1T56A 4DYCA 5IYCJ 5F27A 2QTQA 4FCYA 1D5YA 1R9TJ 5FKMA 1H88C 4MFDA 3GZIA 3S1QJ 2DJNA 3IV5A 1GVDA 4AYBN 3S16J 2E2HJ 1H89C 2GUHA 3E7LA 4A3BJ 4JX6A 1HDPA 3A01A 2WV1A 1JUMA 2X48A 4RDUA 1VNDA 3BRUA 1JT6A 4MIMA 3HTIA 5DS9A 4RBOA 1T33A 3BQZA 4A3EJ 1JGGA 4DZPA 5EEAA 3BCGA 3VPRA 4GCTA 3ON4A 1VF9A 1JKRC 3AQSA 2ELKA 2ECBA 3BG5A 4KWAA 3CMYA 2O8KA 3GTLJ 5C3EJ 1TWGJ 2PZ9A 5K7FA 1G2HA 3S17J 1ETVA 1VFCA 2G3BA 5EF6A 3RZOJ 3I4NJ 2ZOYA 2GFNA 4PXIA 1UMQA 4V2FA 4XRSA 3KNWA 1MH4A 3KKDA 1MH3A 4MO7A 3WHBA 3S1MJ 3ANPA 4M6VA 1BL0A 3PASA 4C2MJ 5IYBJ 2CRGA 2EQRA 5K7ZA 2REKA 1UHSA 3G1MA 2LD5A 3A02A 1NTCA 2G0EA 1S7EA 2UXHA 3VUQA 1U9NA 2L7FP 3ZQGA 3O8GA 1Q1VA 1HOMA 5C44J 3JREA 1TWFJ 3GTQJ 3BR6A 2G7GA 2UXUA 1IUFA 2ZB9A 2LR8A 3GTKJ 2RHAA 4D5CA 3VW2A 3I4MJ 5M3FJ 1ETQA 2DA5A 3JRGA 5J1YA 1MBHA 5IP6A 2DA6A 1BJZA 1JKQC 1JKPC 4UUSB 4A93J 3HEFA 2ID6A 3BR2A 1ZTRA 3GTPJ 3CRJA 1F36A 1MBKA 2WAQN 5HAWA 4XRMA 2QF7A 4X1EA 1DU6A 3HTJA 2FJ1A 4G12A 2JMWA 3LSPA 2E19A 5GP9A 3GTGJ 2D6YA 2E2JJ 3NXCA 3P9TA 5FHPA 2IU5A 2N8GA 4L62A 3MN2A 1MSEC 2ZOZA 2ME6A 5FGLA 3KZ9A 4M3FA 1Z0XA 1ENHA 1MBGA 2CQQA 1RPWA 1RR7A 3DEWA 3HB9A 2NX4A 4JKZA 3S14J 1ZK8A 2JK3A 2Y9ZA 3BR3A 3NAUA 4ABZA 1MBFA 2LY9A 1PUFA 3S1NJ 3MKLA 2YS9A 2O7OA 2L7ZA 4GFKA 5E3LA 1DU0A 3FKIJ 1HLVA 3IH2A 3CDLA 3SDGA 5M5XJ 2ZCMA 3H0GJ 1POGA 3DPJA 3OSGA 2LTPA 4GFLA 1RETA 2ID3A 2W48A 3EUPA 4FE7A 1MBEA 2XGCA 5JLXA 1A5JA 3OIOA 2KT0A 5D19A 2GBYA 5M5WJ 2X9DA 2HDDA 5HSZA 2HI3A 2NS8A 1ETXA 4MLOA 3ANGA 4MXMA 2DMPA 1WGXA 3V78A 2LVSA 1P7JA 1LE8B 3JRCA 3BHQA 1JUSA 2OI8A 3B81A 3VP5A 3S2HJ 2DG7A 2NP3A 3TEDA 3E7QA 1RKTA 2KDZA 1O4XA 3PM1A 2CUEA 3JRHA 2OPTA 3AQTA 2Y0SN 1LFBA 1W0UA 2B63J 3SJMA 2LK2A 1RESA 1HDDC 2XGDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K9Q A;  3HGG A;  1FTZ A;  4A3C J;  4A69 C;  2HOS A;  3BQY A;  2YVH A;  1QPI A;  3S1R J;  1B8I B;  1AKH A;  4XRS G;  4C3I J;  3CJD A;  3VVX A;  1OFC X;  1QVT A;  2QOP A;  1QVU A;  2Y30 A;  5CXG A;  2M9H A;  2IEK A;  5CXI A;  2DMQ A;  1CQT A;  1ETY A;  1ZR2 A;  2I10 A;  2DTZ A;  3S15 J;  3LSJ A;  3HOU J;  2VKE A;  1FTT A;  2H1K A;  3G56 A;  3TP3 A;  3GBG A;  3QQA A;  4IHW A;  3L1P A;  4IHY A;  4I76 A;  3BTJ A;  3OSF A;  2HXI A;  2XB0 X;  3NI7 A;  4CGR A;  3TP0 A;  4JL3 A;  4NDL A;  4FIS A;  1GV5 A;  2DA1 A;  3BR1 A;  4C3H J;  3ZOB A;  1IC8 A;  5F04 A;  2EZH A;  2W53 A;  4A3D J;  3QPS A;  4BY7 J;  4BBR J;  5FLV A;  2TRT A;  3MNL A;  5D1R A;  3HIM A;  2EZI A;  1ZKG A;  1XG1 A;  5AQC A;  4FTH A;  3PPB A;  3VW0 A;  5H9T A;  2X6O A;  3MVP A;  3BR0 A;  2E1O A;  4D7M A;  2FQ4 A;  3BJB A;  1FIA A;  4S0H B;  3UKG A;  1QRY A;  2OER A;  3S5R A;  1SAN A;  2ZCX A;  1K61 A;  3K2A A;  1AU7 A;  1LFU P;  4BXX J;  3EGQ A;  1BA5 A;  1GDT A;  2YU9 J;  2R93 J;  2DMU A;  3HOX J;  2JA8 J;  1U78 A;  3HTA A;  4JP0 A;  4AC0 A;  3HTH A;  1IV6 A;  1X58 A;  1IRZ A;  2NP5 A;  2TCT A;  4A3F J;  3NRG A;  4HNV A;  3O8H A;  2FD5 A;  2NVX J;  4ME9 A;  3BG9 A;  3CCY A;  1JT0 A;  5F1J A;  5FJ8 J;  3FK6 A;  1WCM J;  2JWT A;  2NS7 A;  2QIB A;  2UXI A;  4A3M J;  1WH5 A;  5C4J J;  4CYC A;  5DTD A;  3HM5 A;  2DA7 A;  2L9R A;  3G7R A;  2HYJ A;  3B6C A;  4B3A A;  4M3B A;  2XPW A;  5BNG A;  1BW6 A;  5FKK A;  4M3D A;  3JRD A;  4A3K J;  2AHQ A;  5E3M A;  3COL A;  5C4Y A;  1YRN B;  1HCR A;  4DW6 A;  4BBS J;  5EZG A;  3VVY A;  1EF4 A;  3QBM A;  2HOA A;  4C3J J;  5IOZ A;  2VPR A;  4ACI A;  1IJW C;  2IAI A;  1GUU A;  4AC6 A;  4QSH A;  2DN0 A;  3HBL A;  5IPA A;  3GTM J;  2H8R A;  2XB5 A;  2COB A;  4A3G J;  4X6A J;  4HKU A;  3RZD J;  1FIP A;  3C2B A;  2MW8 A;  4M3E A;  3WHC A;  2DG8 A;  3LSG A;  1U8B A;  1MBJ A;  3ZQL A;  2EBI A;  2XPU A;  1FJL A;  3JRB A;  9ANT A;  1UI6 A;  1H8A C;  1FEX A;  2M0C A;  3GTJ J;  4IHV A;  3G1L A;  4XIC A;  3F0C A;  2MGQ A;  5EDN A;  2VKV A;  5EFY A;  2JJ7 A;  1I6H J;  2XGE A;  1XS9 A;  3Q3S A;  2G7S A;  4UDS A;  3JR9 A;  2VUM J;  3HOW J;  5EYR A;  1Y1W J;  4CYC B;  1NK2 P;  2R5Y A;  4D7N A;  4DYR A;  5CW8 A;  2GLO A;  2EZK A;  5FKN A;  3JRA A;  4A3I J;  2NOG A;  2P81 A;  2GM4 A;  2JA5 J;  2Y31 A;  3VVZ A;  3F1B A;  3LNQ A;  3SFI A;  4L5E A;  2LFB A;  2DMT A;  2AO9 A;  4LOC A;  2XPV A;  2HYT A;  2EZL A;  3BTI A;  2YUS A;  3Q0W A;  3TW6 A;  5EGO B;  2QKO A;  5J1U A;  1TWA J;  2QCO A;  3B6A A;  1LE8 A;  5EZH A;  2IBD A;  2Y2Z A;  3TW7 A;  2HKU A;  3ON2 A;  3RD3 A;  1NK3 P;  1PUF B;  3T6N A;  1TWC J;  3FIW A;  4MFE A;  1APL C;  4QIW N;  2R5Y B;  4JNN A;  2HOT A;  2RAE A;  3BNI A;  2NVY J;  4A3L J;  5K58 A;  5F0F A;  1U9O A;  3PO3 J;  4XID A;  5HBU A;  4JX4 A;  3O60 A;  3QKX A;  3HDD A;  2K40 A;  4YZE A;  1WI3 A;  3H3V K;  2M2E A;  1Y1V J;  3JRF A;  2MG4 A;  1W0T A;  5IOY A;  3A01 B;  3M4O J;  3DCF A;  2ME0 A;  4EEF G;  3JRI A;  2CJJ A;  4AUX A;  2YVE A;  1WPK A;  4M3G A;  3LOC A;  4JYK A;  3OOU A;  2ZCN A;  1BW5 A;  1AHD P;  1TWH J;  4BKX A;  3C07 A;  2R0Q C;  4B1R A;  1TC3 C;  3CWR A;  1I3Q J;  5IP9 J;  1P7I A;  4BY1 J;  3RQI A;  5JLW A;  1ZQ3 P;  5IYD J;  3FK7 A;  2NVQ J;  5F0C A;  1ZR4 A;  1ETW A;  1A6I A;  3BT9 A;  3VOX A;  2CQX A;  2ECC A;  2EH3 A;  1WH7 A;  3GTO J;  4W97 A;  4AF5 A;  3ZQH A;  2DMN A;  1MNM C;  3VW1 A;  5FKL A;  4NEL A;  1GV2 A;  4D5F A;  2Q24 A;  2RAS A;  1JTY A;  2VI6 A;  2LKX A;  3FRQ A;  4JX5 A;  2M34 A;  5J3L A;  1IDZ A;  3S2D J;  2E2I J;  3ZQI A;  3FIS A;  4I6Z A;  3K7A J;  2LP0 A;  3A03 A;  5DAJ A;  5M5Y J;  5J1R A;  1OCT C;  2OF7 A;  1HF0 A;  2O7T A;  2UXP A;  5FLM J;  4UUT A;  3GEU A;  2K9S A;  1JTX A;  1X2N A;  2DA4 A;  4DZJ A;  5GPC A;  4QTR A;  4Y52 J;  3NPI A;  3IH4 A;  1OJL A;  2L7M P;  3HOV J;  3IH3 A;  3G1O A;  5K7H A;  1B72 B;  4NN1 A;  3ZQF A;  4GCL A;  2HQ5 A;  4XK4 A;  2F07 A;  5FKO A;  1X2M A;  2XSD C;  2O9L A;  3Q0U A;  4W1U A;  2DA2 A;  3QPL A;  1B72 A;  5EGO A;  1IGN A;  3HE0 A;  5F08 A;  3LWJ A;  2HXO A;  1IG7 A;  2FX0 A;  2PMZ N;  4Y7N J;  1SGM A;  1ZGW A;  1XC5 A;  2JN6 A;  5E3N A;  4DYQ A;  5M3M J;  5IP7 J;  3PO2 J;  2G7L A;  3KKC A;  2WUI A;  2GEN A;  2L0K A;  4MK6 A;  3LJL A;  2V57 A;  2FBQ A;  1RKW A;  5C4X J;  4GCK A;  2LLK A;  3BR5 A;  2Y9Y A;  3D1N I;  2CU7 A;  1YRN A;  2XRL A;  1ITY A;  4IHX A;  3NNR A;  1IDY A;  2JA7 J;  1JJ6 C;  2CUF A;  5E3O A;  3BTC A;  5D18 A;  2D5V A;  3BTL A;  2NVT J;  3JSJ A;  1Z77 A;  4B4C A;  1JJ8 C;  2JA6 J;  1K83 J;  3LSR A;  1ORK A;  3RKQ A;  2MSY A;  2QWT A;  5F0H A;  4ICH A;  1ETK A;  1VI0 A;  3HOZ J;  4V2G A;  2K9N A;  3VIB A;  3IUV A;  3W6V A;  1E3O C;  2WB1 N;  4IEJ A;  3CQZ J;  1MSF C;  2UXO A;  3VOK A;  3BG3 A;  2R7Z J;  2M8G X;  3M3Y J;  5GPA A;  5EG0 B;  1JUP A;  2DA3 A;  2R5Z A;  4J19 A;  4UUS A;  2XDN A;  3NAR A;  4FE4 A;  2R92 J;  4A3J J;  3HOY J;  2PBX A;  3ZQC A;  1GT0 C;  2WGB A;  3HKZ N;  4GFB A;  3RH2 A;  1UG2 A;  3Q0V A;  5HOD A;  5EG0 A;  2R5Z B;  3HGY A;  1UI5 A;  1ETO A;  1F43 A;  1I50 J;  1SFO J;  1OCP A;  1B8I A;  1AKH B;  1JKO C;  3LHQ A;  3V6G A;  5FMP A;  1T56 A;  4DYC A;  5IYC J;  5F27 A;  2QTQ A;  4FCY A;  1D5Y A;  1R9T J;  5FKM A;  1H88 C;  4MFD A;  3GZI A;  3S1Q J;  2DJN A;  3IV5 A;  1GVD A;  4AYB N;  3S16 J;  2E2H J;  1H89 C;  2GUH A;  3E7L A;  4A3B J;  4JX6 A;  1HDP A;  3A01 A;  2WV1 A;  1JUM A;  2X48 A;  4RDU A;  1VND A;  3BRU A;  1JT6 A;  4MIM A;  3HTI A;  5DS9 A;  4RBO A;  1T33 A;  3BQZ A;  4A3E J;  1JGG A;  4DZP A;  5EEA A;  3BCG A;  3VPR A;  4GCT A;  3ON4 A;  1VF9 A;  1JKR C;  3AQS A;  2ELK A;  2ECB A;  3BG5 A;  4KWA A;  3CMY A;  2O8K A;  3GTL J;  5C3E J;  1TWG J;  2PZ9 A;  5K7F A;  1G2H A;  3S17 J;  1ETV A;  1VFC A;  2G3B A;  5EF6 A;  3RZO J;  3I4N J;  2ZOY A;  2GFN A;  4PXI A;  1UMQ A;  4V2F A;  4XRS A;  3KNW A;  1MH4 A;  3KKD A;  1MH3 A;  4MO7 A;  3WHB A;  3S1M J;  3ANP A;  4M6V A;  1BL0 A;  3PAS A;  4C2M J;  5IYB J;  2CRG A;  2EQR A;  5K7Z A;  2REK A;  1UHS A;  3G1M A;  2LD5 A;  3A02 A;  1NTC A;  2G0E A;  1S7E A;  2UXH A;  3VUQ A;  1U9N A;  2L7F P;  3ZQG A;  3O8G A;  1Q1V A;  1HOM A;  5C44 J;  3JRE A;  1TWF J;  3GTQ J;  3BR6 A;  2G7G A;  2UXU A;  1IUF A;  2ZB9 A;  2LR8 A;  3GTK J;  2RHA A;  4D5C A;  3VW2 A;  3I4M J;  5M3F J;  1ETQ A;  2DA5 A;  3JRG A;  5J1Y A;  1MBH A;  5IP6 A;  2DA6 A;  1BJZ A;  1JKQ C;  1JKP C;  4UUS B;  4A93 J;  3HEF A;  2ID6 A;  3BR2 A;  1ZTR A;  3GTP J;  3CRJ A;  1F36 A;  1MBK A;  2WAQ N;  5HAW A;  4XRM A;  2QF7 A;  4X1E A;  1DU6 A;  3HTJ A;  2FJ1 A;  4G12 A;  2JMW A;  3LSP A;  2E19 A;  5GP9 A;  3GTG J;  2D6Y A;  2E2J J;  3NXC A;  3P9T A;  5FHP A;  2IU5 A;  2N8G A;  4L62 A;  3MN2 A;  1MSE C;  2ZOZ A;  2ME6 A;  5FGL A;  3KZ9 A;  4M3F A;  1Z0X A;  1ENH A;  1MBG A;  2CQQ A;  1RPW A;  1RR7 A;  3DEW A;  3HB9 A;  2NX4 A;  4JKZ A;  3S14 J;  1ZK8 A;  2JK3 A;  2Y9Z A;  3BR3 A;  3NAU A;  4ABZ A;  1MBF A;  2LY9 A;  1PUF A;  3S1N J;  3MKL A;  2YS9 A;  2O7O A;  2L7Z A;  4GFK A;  5E3L A;  1DU0 A;  3FKI J;  1HLV A;  3IH2 A;  3CDL A;  3SDG A;  5M5X J;  2ZCM A;  3H0G J;  1POG A;  3DPJ A;  3OSG A;  2LTP A;  4GFL A;  1RET A;  2ID3 A;  2W48 A;  3EUP A;  4FE7 A;  1MBE A;  2XGC A;  5JLX A;  1A5J A;  3OIO A;  2KT0 A;  5D19 A;  2GBY A;  5M5W J;  2X9D A;  2HDD A;  5HSZ A;  2HI3 A;  2NS8 A;  1ETX A;  4MLO A;  3ANG A;  4MXM A;  2DMP A;  1WGX A;  3V78 A;  2LVS A;  1P7J A;  1LE8 B;  3JRC A;  3BHQ A;  1JUS A;  2OI8 A;  3B81 A;  3VP5 A;  3S2H J;  2DG7 A;  2NP3 A;  3TED A;  3E7Q A;  1RKT A;  2KDZ A;  1O4X A;  3PM1 A;  2CUE A;  3JRH A;  2OPT A;  3AQT A;  2Y0S N;  1LFB A;  1W0U A;  2B63 J;  3SJM A;  2LK2 A;  1RES A;  1HDD C;  2XGD A; 
#chains in the Genus database with same CATH topology
 2K9Q A;  3PL8 A;  1FTZ A;  4A69 C;  2X1D A;  3E6B A;  3OIQ A;  3FXQ A;  1FNN A;  1B8I B;  3BZ6 A;  2YR2 A;  4RLQ A;  1OFC X;  3OYG A;  3KCC A;  1QVT A;  4FT8 A;  2QOP A;  4E7K A;  1D0Z A;  1X3Z B;  2ZSI B;  5CVU A;  2IA0 A;  1U8R A;  5FLX K;  5F64 A;  1ZR2 A;  4BQN A;  2DTZ A;  5JI6 A;  3PFY A;  2H1K A;  3FKJ A;  4CUG A;  2R7O A;  5KK1 A;  1XMA A;  3L1P A;  3ZR8 X;  3HRM A;  3HHG A;  2L2O A;  3JCU C;  2XB0 X;  3NI7 A;  3M1C A;  3TP0 A;  4NDL A;  1V5F A;  4FIS A;  1C0W A;  2DA1 A;  3IAM 2;  1Z6R A;  3ZOB A;  2EV5 A;  3HTU A;  2EZH A;  4NQW A;  4C2T A;  2W53 A;  2J5P A;  4U87 A;  4U0V A;  3WOD F;  5FGM A;  1GXP A;  1XSX A;  2RKH A;  1Z1D A;  5D1R A;  4CGZ A;  2E71 A;  2VBY A;  2AS5 F;  3HXL A;  2ZXI A;  5JVT A;  5AQC A;  3K70 D;  4G6T B;  2PG4 A;  2LOO A;  1H9T A;  5DEQ A;  2RRE A;  2DFI A;  2X6O A;  2NNY A;  2BOL A;  2E1O A;  4HDU A;  1BOA A;  2FQ4 A;  5J40 A;  4LK0 F;  3UKG A;  3J81 Z;  3FMS A;  4KIF A;  3S5R A;  4L5I A;  4YII A;  4LB6 B;  2XVC A;  3H5A A;  3LL7 A;  4YFX F;  2Z99 A;  2A2F X;  3OMY A;  2R93 J;  2CW8 A;  2L9N A;  3DQV C;  2K3P A;  3I3L A;  4MQ9 F;  2JA8 J;  5FLX Z;  3I64 A;  1FBS A;  1SVM A;  2XAS A;  3HTS B;  2V1N A;  4JP0 A;  2W4S A;  4X0G A;  2JUG A;  3DBL B;  2NP5 A;  4HX7 A;  4PFO A;  3A2K A;  4HNV A;  3O8H A;  1J9I A;  3G73 A;  2K4J A;  5H6Q A;  3BG9 A;  2DU9 A;  1E3H A;  5F1J A;  1WSU A;  4CYC A;  5CKT A;  3HM5 A;  1A35 A;  2XKO A;  2GOX B;  4M3B A;  3WTT C;  4RLF A;  5TRD A;  3F8C A;  2H6C A;  4IKF A;  3DTI A;  4M3D A;  4A3K J;  3RIR A;  2QKL B;  2JRT A;  3G4S I;  4BE1 A;  1HCR A;  3F22 A;  4AIJ A;  4BBS J;  3VVY A;  1HQC A;  1Z7L A;  1EF4 A;  3QBM A;  4C3J J;  5AON A;  1QQI A;  3MZ8 A;  2XDV A;  2VE8 A;  1DUX C;  4IQJ A;  3AAF A;  4YG2 F;  4X6A J;  2DG8 A;  2ICW G;  3LSG A;  5CVR A;  1MBJ A;  4ZYA A;  1WJC A;  2E1C A;  4BNC A;  2X51 A;  4XM3 A;  3ONQ A;  3HUG B;  1FJL A;  1EV7 A;  2XAU A;  2DOA A;  3PNY A;  2L3D A;  2M0C A;  2W84 A;  4G6Q A;  1TL8 A;  4IHV A;  1IN4 A;  3F21 A;  1WRJ A;  1XN7 A;  3HG9 A;  3Q3S A;  3HOW J;  5EYR A;  1M1E B;  1Y1W J;  2VBZ A;  4LLG F;  3E6C C;  3FXJ A;  2BY0 A;  4AVP A;  4DYR A;  3R61 A;  2R5Y A;  2OJE D;  4C9Y A;  4PJ0 C;  3VVZ A;  4F92 B;  3V7C A;  2DT7 B;  3LNQ A;  3NEU A;  3SFI A;  4BHB A;  5E8I A;  4L5E A;  4LOC A;  2XPV A;  2HYT A;  2EZL A;  3BTI A;  4A0Y A;  3TDU C;  2Z3Y A;  1W7P D;  2QCO A;  2VBX A;  5EZH A;  2IBD A;  4IZZ A;  1DDN A;  2HQN A;  3RD3 A;  4IL6 C;  4CXF A;  5EEG A;  3K70 C;  1TWC J;  4F7Z A;  5BPD A;  3A4C A;  3CD6 I;  2WY7 Q;  2HOT A;  1YS6 A;  1UZC A;  2Y48 A;  4I02 A;  4RMN A;  4WXH A;  3TO7 A;  5F0F A;  2KP6 A;  3K1P A;  2HTS A;  2KIM A;  2F5D A;  3PO3 J;  2GAU A;  4XID A;  3O3K A;  4C2U A;  3ZQQ A;  4IXA A;  3I0T A;  3GCM A;  2M4G A;  2E1M B;  3HDD A;  3Q9S A;  2XSJ C;  3K4M A;  3K10 A;  2EB7 A;  3H3V K;  2VJJ A;  1W0T A;  3MZH A;  5IOY A;  3I55 I;  2GA2 A;  3QYF A;  4G6D A;  1B6A A;  2YVX A;  1RIO H;  3TO9 A;  3AFH A;  2ZBK A;  3CUQ B;  2H94 A;  2YVE A;  3BY6 A;  4ZDL A;  2IGK A;  3IHU A;  1ZAR A;  2A68 F;  2PFV A;  2L5Q A;  4HAM A;  2OU2 A;  4IQ4 A;  2XF6 A;  2ZXW H;  2JUC A;  3CWR A;  2A3S A;  3HSE A;  3WGH A;  1P7I A;  3KEO A;  5IP9 J;  5J8C A;  4AU7 A;  5ICF A;  1MZB A;  1SVL A;  3FXU A;  1VQO I;  2NVQ J;  5B5E C;  1A6I A;  3VOX A;  1FYL A;  2H8W A;  3HKZ A;  2BXY A;  5TJJ A;  2EFQ A;  3M8J A;  3ZQH A;  2DMN A;  4ZYD A;  2HU9 A;  4CHU A;  1XPX A;  5J3L A;  1IDZ A;  3AG3 H;  1BN5 A;  2DFF A;  4CZC A;  3E3V A;  2LP0 A;  4Y33 A;  2CSO A;  5LFA A;  1PVE A;  1WKM A;  5E1X A;  5M5Y J;  5J1R A;  4N4N B;  3RPQ A;  2UXP A;  4I0A A;  1FBU A;  5FLM J;  1OMI A;  4KN4 X;  4QTR A;  3NPI A;  1W36 D;  4XRF A;  3IH4 A;  4CCJ A;  1U3E M;  3IH3 A;  5K7H A;  5JFR A;  4OWR B;  2KIQ A;  3FWE A;  4ASN A;  1QBJ A;  4LJZ F;  1RUO A;  4XLC A;  2CG4 A;  4HW0 A;  4PSW A;  4XK4 A;  2FQ3 A;  4IO9 F;  5FKO A;  5A2Q K;  4W1U A;  5B66 C;  5EGO A;  1IGN A;  5F08 A;  2GIZ A;  3ABL H;  4CIC A;  2FX0 A;  3GLX A;  1G3W A;  3L9F A;  1QZY A;  3P9K A;  1XC5 A;  3MCZ A;  5E3N A;  1IN8 A;  5M3M J;  5IP7 J;  3DEE A;  4HQM A;  3KKC A;  1IRF A;  1W5S A;  1REP C;  2Z16 A;  3BOQ A;  5ERI A;  2ZKZ A;  2STW A;  4GCK A;  2VE9 A;  2LLK A;  2PFB A;  3TQN A;  2CU7 A;  2E7W A;  2FOW A;  4ZYG A;  3OS2 A;  5FRM A;  2BYV E;  1Y56 A;  2V4J C;  1LQ1 A;  2CUF A;  3NS4 A;  2X6Y A;  4LIU A;  3BCA A;  1TQI A;  2NVT J;  3JSJ A;  1IUY A;  4B4C A;  3OYM A;  4LB5 A;  3RKQ A;  3OYC A;  1YFH A;  3ZGK A;  3HYI A;  5F1R A;  3HOZ J;  5KAI C;  3VIB A;  2PN6 A;  1VQ7 I;  2LF8 A;  3VWB A;  1XCB A;  2WB1 N;  4Y13 A;  3JW4 A;  3IUV A;  3LA2 A;  2HNH A;  3BG3 A;  2YU3 A;  5J6X A;  2B9S A;  2L4M A;  3M3Y J;  5GPA A;  5EG0 B;  5LGN A;  1EH8 A;  4MHG A;  1ZLK A;  2XAJ A;  4FE4 A;  1BI2 A;  4A3J J;  2M1B A;  3DTK A;  5HOO A;  1SD7 A;  4C30 A;  1YO5 C;  2WGB A;  3F23 A;  3RH2 A;  3TDZ C;  2CQK A;  1BR1 A;  4P55 A;  5EG0 A;  2O6G E;  2FEZ A;  4EMS A;  3VOE A;  3CCU I;  1TZL A;  3WE2 A;  1T56 A;  1D0Y A;  2QQA A;  2IA2 A;  3CLQ A;  3BC8 A;  1WJD A;  5F27 A;  5D6E A;  1D5Y A;  3GZI A;  1H88 C;  3H5N A;  2V26 A;  4XMY A;  1TP4 A;  1QNT A;  4BU2 A;  3IV5 A;  1GVD A;  2DO7 A;  1G6N A;  4KIS A;  5ILS A;  4CCK A;  5E1W A;  1UAA A;  1HA8 A;  1MW7 A;  2GUH A;  4RGX A;  4XNF A;  3WG7 H;  1HDP A;  3A01 A;  4RDU A;  4YRV A;  3KYD B;  3BRU A;  1JT6 A;  1QU3 A;  2Q8K A;  4AM3 A;  1L3L A;  3ZMT A;  1IZ1 A;  5EEA A;  2KJB A;  3ON4 A;  1VF9 A;  3H3U A;  2JQ7 A;  3AQS A;  2H1L A;  4KWA A;  3GTL J;  3ZMU A;  2E36 A;  4HLY A;  5C3E J;  3SQN A;  2PZ9 A;  4EGZ A;  2H09 A;  3DF8 A;  1ETV A;  1SFU A;  1QA6 A;  4KFC A;  3DBR B;  4AWX B;  3I4N J;  3RYP A;  2WTE A;  4UNO A;  3DP7 A;  3DEU A;  1BI3 A;  1WHU A;  4RA2 A;  3WHB A;  1YW8 A;  4M6V A;  3IL2 A;  3LSM A;  3PAS A;  1MJ9 A;  5IYB J;  3LSI A;  2E34 A;  5K7Z A;  2REK A;  1IAW A;  2DCE A;  4XSX F;  1YTY A;  2G0E A;  1S7E A;  3KZI C;  2XUB A;  1LJ9 A;  2LG4 A;  2VC0 A;  3FM5 A;  2L7F P;  3JAM Z;  1L0O C;  4ESF A;  1TWF J;  3GTQ J;  1AOY A;  1J2X A;  2D45 A;  2EA4 A;  2ACJ A;  1IRX A;  1EH6 A;  1Z3Y A;  5GAE J;  2VBW A;  2LYC A;  1PUE E;  2DA5 A;  2F2E A;  2HKO A;  3JRG A;  1JKQ C;  1BJZ A;  2W57 A;  4UUS B;  1XD7 A;  4PGG A;  2V9P A;  4UV9 A;  3FDY A;  3KX2 A;  4XKW A;  4EM0 B;  1MIJ A;  1FC3 A;  2NRA C;  2E19 A;  3P9C A;  1U0J A;  3V8K A;  3NXC A;  3FF5 A;  2GWR A;  3SFZ A;  1U5T B;  3MN2 A;  3KZ9 A;  3H0D A;  1TNS A;  4CCL A;  2O0Y A;  3H1C A;  4E7I A;  4M3F A;  2IP2 A;  4KT5 C;  4HV5 A;  2XHK A;  2EIL H;  3COA C;  3I59 B;  1RR7 A;  2RV8 A;  3FXK A;  4XQF A;  1IF1 A;  1BC7 C;  2NX4 A;  2JK3 A;  3MAJ A;  4GYI A;  3BR3 A;  2KZV A;  4BJ5 C;  2NOJ B;  1BI0 A;  3SYT A;  4RB1 A;  2LY9 A;  3F8M A;  4XLH A;  3S1N J;  1ERD A;  3OYN A;  2DQL A;  1ZHF A;  4ESB A;  5DV5 A;  4HRI A;  4ENN A;  1H0M A;  1OCR H;  3E5U A;  3RDI A;  5E3L A;  2ZJP F;  3F8B A;  3FKI J;  1W4M A;  1HLV A;  3CDL A;  3IH2 A;  3SDG A;  1RI7 A;  1ZAO A;  4LD5 A;  3DPJ A;  4GFL A;  1Z91 A;  2ID3 A;  1WVR A;  4M74 A;  4FE7 A;  4IF4 A;  4KJZ A;  1MBE A;  5DUK A;  3GX4 X;  3OIO A;  4AID A;  2GBY A;  3OV8 A;  1ETX A;  3ANG A;  1V55 H;  2UXX A;  2DMP A;  2E35 A;  1X1P A;  3V78 A;  2KKO A;  3CP8 A;  1ZG1 A;  2LVS A;  3VYU B;  4S04 A;  4BEH B;  2KZG A;  1G3T A;  5CPR B;  3BHQ A;  3B81 A;  3GFL A;  1Y0N A;  1VQP I;  3K8P C;  1HBX G;  1RKT A;  2DJI A;  3K0L A;  5TGT A;  5KNL A;  1O4X A;  1VQ8 I;  2EIJ H;  3AQT A;  2XV4 S;  2Y0S N;  2W1O A;  4J00 A;  3J80 K;  4DVY P;  2X1E A;  3SJM A;  3M8E A;  1ACI A;  4IRI A;  1K4T A;  4A3C J;  3BQY A;  4BS9 A;  2YVH A;  2M8E A;  5H6R A;  3KP5 A;  2NVU B;  2W7N A;  4A0Z A;  1IXR C;  3CCV I;  1T38 A;  1QVU A;  2Y30 A;  5CXG A;  3GFJ A;  4RGS A;  4N4O B;  4L9N A;  2DMQ A;  4YFK F;  3PNV A;  1R58 A;  3S15 J;  1X1D A;  3ABU A;  4PJJ A;  4Q4Z F;  2FBH A;  3HOU J;  2WBM A;  2MA3 A;  2VKE A;  2FML A;  2B3W A;  3GBG A;  4IHY A;  3BTJ A;  4HOB A;  4A12 A;  2WV0 A;  5FFZ A;  4JL3 A;  1ZYR F;  1GV5 A;  4NNJ A;  1IC8 A;  3EUA A;  4C3H J;  4EAT A;  3W2V A;  2A5W A;  2J5O A;  3QPS A;  2CW7 A;  2L9V A;  4BHP A;  2ZXJ A;  1BJA A;  3IWZ A;  3MNL A;  2K4B A;  2DPU A;  3H3Z A;  1Z67 A;  4PK4 A;  4J01 A;  1ZKG A;  1XG1 A;  3J7A O;  1HW5 A;  3V8J A;  3WTU C;  3ASO H;  4UVC A;  4M9S A;  2GQQ A;  3BR0 A;  3BJB A;  2HVQ A;  3M1E A;  4BYY A;  4XLA A;  4M71 A;  3VSL A;  4WCG A;  3T8R A;  2Z5U A;  2WA0 A;  4I7H A;  4U0Y A;  1J5Y A;  1K61 A;  1SEU A;  1YOV B;  1LFU P;  4BXX J;  1I3A A;  3IP4 B;  4P9F A;  2YU9 J;  4K2E A;  2DMU A;  4ZTF A;  2Q1Z B;  2KL4 A;  3WGG A;  4KN7 X;  1U78 A;  3BDD A;  1OCC H;  2DFH A;  3HTA A;  3HTH A;  1D1A A;  1VQ4 I;  3OS1 A;  4N0B A;  2KRC A;  1YIJ I;  1Z21 A;  1W7P A;  3WTW C;  1TBX A;  4G94 A;  3MKW B;  1D8J A;  1T98 A;  3CCY A;  1Q1H A;  3N97 A;  4KMF A;  1GLN A;  2JWT A;  3QOP A;  2UXI A;  4A3M J;  1WH5 A;  4XOR A;  5DTD A;  1GHC A;  1A6Q A;  3G7R A;  2HYJ A;  1K6Y A;  4I98 B;  3KP3 A;  3WGI A;  2XAQ A;  4XN0 A;  3SEQ A;  5F6F A;  1YI2 I;  4O3M A;  2A6E F;  2EV6 A;  3EYY A;  1O57 A;  3ROU A;  4S05 A;  3ERM A;  2AHQ A;  1BBY A;  5E3M A;  3FHZ A;  1R49 A;  5EZG A;  2A6H F;  1I6X A;  4EM2 A;  2HVS A;  4ACI A;  2IAI A;  4AC6 A;  2H8R A;  2ZNZ A;  2XB5 A;  1XDU A;  2COB A;  2CO5 A;  2PX9 A;  1FIP A;  3GZN B;  2F5V A;  2M4K A;  1U8B A;  3PFI A;  2K86 A;  1USS A;  2Q2E B;  4O6J A;  5K5O A;  1GXQ A;  2YX7 A;  4EVI A;  5DCF A;  1FP2 A;  1SFX A;  3KZZ A;  2XPU A;  2CMP A;  1IN6 A;  2LRE A;  3L2W A;  5HVQ C;  1D1C A;  2VKV A;  1XS9 A;  2L9S A;  2ZJR F;  4UDS A;  2LBF B;  4UB6 C;  5FD5 A;  3CO6 C;  5HLT A;  2K9L A;  3VTI A;  3UR3 C;  2YPR A;  4CYC B;  2HZT A;  2LKS A;  5CW8 A;  3OIP A;  2P81 A;  2JA5 J;  4OMZ A;  2DMT A;  3ML6 A;  2YUS A;  4RB3 C;  3M7G A;  3PQJ A;  5D8L B;  2QKO A;  4BEH A;  3S3O A;  2HKU A;  2ETH A;  3IUO A;  1SFK A;  3KEY A;  5HDN A;  1R5H A;  1HKQ A;  1JE8 A;  5DM6 F;  3T6N A;  3FIW A;  2QBY B;  3TOA A;  4OAZ A;  4QIW N;  1YYV A;  1FMV A;  3F9K A;  1VQ5 I;  4LIT A;  3C18 A;  1MMS A;  3K4L A;  3PNT A;  1YX3 A;  1OLT A;  2JT1 A;  1IV8 A;  5B3S H;  2XRO A;  3O60 A;  1XGN A;  5LBQ A;  1SAX A;  4RAY A;  4LGW A;  2K40 A;  1WI3 A;  3ABT A;  4F55 A;  4CA0 A;  1V5G A;  5ED4 A;  4EEF G;  3JRI A;  1PP8 F;  3S3M A;  1QHH D;  4U9L A;  2CJJ A;  4YIF A;  1WPK A;  1OYI A;  4M3G A;  4JYK A;  4DNC A;  1FMW A;  3IWF A;  4RGR A;  4BKX A;  3CF5 F;  5FFX A;  2GIV A;  3CUQ C;  2XC7 A;  1YJ9 I;  1TC3 C;  2HS5 A;  3VOD A;  1LKX A;  1Y8R B;  5JHF A;  5D4R A;  3FK7 A;  5F0C A;  3E6M A;  3BT9 A;  5H20 A;  2HYF A;  2FBK A;  2EH3 A;  4O5V A;  4W97 A;  3B73 A;  4II2 A;  1MNM C;  4CDG A;  5FKL A;  4NEL A;  2R7X A;  3FRQ A;  1XGM A;  4JX5 A;  1UHW A;  3I9V 2;  3I54 A;  2E1N A;  3ZQI A;  3HRU A;  2GXA A;  2MLK A;  3BZC A;  3HUG A;  4I6Z A;  1D8K A;  2RVC A;  4BE0 A;  1FY7 A;  1Z6T A;  3HPG A;  1HF0 A;  2O7T A;  3GEU A;  4Y52 J;  4DZJ A;  3L2U A;  5CQE A;  1E2X A;  2HPI A;  4AVZ A;  2F4I A;  2VT2 A;  3PIP F;  1OJL A;  2L7M P;  4EM1 A;  4HNT A;  5LEJ A;  4NC6 A;  3REO A;  4L5J A;  2P5L C;  1HKS A;  4NN1 A;  3DPT A;  4B8X A;  1RUN A;  4GCL A;  2PJP A;  5EJC A;  2EFN A;  2F4O B;  1X2M A;  4GO1 A;  2UZK A;  4EJU A;  2LMD A;  3M07 A;  2H27 A;  2TDX A;  2VT3 A;  2XGX A;  4ITV A;  3K1M A;  1UJ8 A;  3Q9V A;  5ICE A;  1IG7 A;  2VN2 A;  2V9K A;  1SGM A;  3P5J A;  5HNH A;  2NS0 A;  3HJE A;  4DYQ A;  5DM7 F;  4EGY A;  4AYB A;  3OYA A;  1VQL I;  3CC4 I;  1EH7 A;  3PO2 J;  2D1V A;  1FYK A;  2WUI A;  2L0K A;  5HLH A;  1DPR A;  2QQ8 A;  2V57 A;  4IJA A;  5HNF A;  1RKW A;  4N9I A;  3J81 K;  3E5X A;  3S93 A;  3BR5 A;  3SWH A;  1X3W B;  3D1N I;  3NNR A;  3ULQ B;  2JA7 J;  1JJ6 C;  3BZK A;  3BTC A;  3PUB A;  4D1Q A;  4U7B A;  2VB6 A;  1Y0U A;  3OL4 A;  5HDG A;  1F5T A;  1TT0 A;  1LEA A;  4XKV A;  1XMK A;  4IRG A;  1ZRD A;  1JJ8 C;  1OQY A;  3WTS C;  1K83 J;  2QWT A;  2MSY A;  2QM3 A;  1VQ9 I;  4F93 B;  5TIS C;  2VOP A;  3ZMV A;  2IRF G;  2K9N A;  3L2V A;  1QO0 D;  4BQO A;  2PBI A;  2GA1 A;  1T08 B;  3I59 A;  2R5Z A;  4EJO A;  3IKV A;  4XSZ F;  4HF2 A;  4U9N A;  2ZME C;  1I1G A;  1R71 A;  2P6S A;  3K4N A;  3HOY J;  4KIC A;  1KZH A;  3HKZ N;  2HKX A;  4FX0 A;  2FOK A;  2B1E A;  1UG2 A;  3Q0V A;  1FYM A;  5HOD A;  2R5Z B;  5LHH A;  1S7O A;  1YS7 A;  1FOK A;  1F43 A;  3WTZ A;  3W3C A;  3CMA I;  2QQB A;  1OCP A;  1AKH B;  2VOD A;  4H4K C;  3ASN H;  4WIB A;  1S3J A;  3BP8 A;  2AXL A;  2RNJ A;  1R9T J;  3ZN0 A;  2QLZ A;  1P4X A;  3F72 A;  3OWT A;  4OU0 A;  5GAD J;  2DJN A;  1WJ5 A;  2O5R A;  2QBY A;  5DD4 A;  1QZE A;  2ZY9 A;  5CVI A;  2OQG A;  2BY3 A;  3BRO A;  1HXD A;  3E7L A;  4JX6 A;  4ZYE A;  3P7N A;  1KON A;  4PZJ A;  2DPD A;  2X48 A;  1AA7 A;  5HS9 A;  1ONV A;  1VND A;  2LSO A;  4Q47 A;  1R7J A;  1P6R A;  3HTI A;  3BCG A;  3OYL A;  2H6B A;  3R4K A;  1VQ6 I;  2EPF A;  4CCM A;  1JKR C;  2DTR A;  2Q0O A;  4RB0 A;  1JHF A;  3CMY A;  1P9Q C;  2O8K A;  4CYD A;  3U2R A;  1G4D A;  2PJR B;  3F8F A;  1N78 A;  3CES A;  3I53 A;  3E0J B;  2OA4 A;  4LG0 A;  3RZO J;  1X1C A;  1T6S A;  2KDO A;  2FA5 A;  1UMQ A;  2MD0 A;  1MH4 A;  3D5S C;  1MH3 A;  4MO7 A;  3CCJ I;  3S1M J;  2VQG A;  4C2M J;  2CV2 A;  2CRG A;  4XOP A;  2W24 A;  4WK8 F;  3CCL I;  2QVO A;  3G1M A;  3OY9 A;  2R7W A;  2M7A A;  4LIV A;  3TOB A;  3I71 A;  1NTC A;  2NAZ A;  4Y4R A;  1U9N A;  2ZO4 A;  2B0L A;  1SAU A;  1HOM A;  2HWV A;  3DV8 A;  4P5O A;  2LNB A;  2P7C B;  1IUF A;  5H2F C;  2QSF X;  3RSN A;  5E18 F;  4WXC A;  3QYE A;  5D8K B;  4LFU A;  2BGC A;  1XGO A;  3OS0 A;  5HS7 A;  5J1Y A;  1G8X A;  2DA6 A;  4QPO A;  4E4H A;  1ZTR A;  2R7D A;  1SFE A;  1K79 A;  3GTP J;  4XRM A;  3RTR A;  1DU6 A;  3DWL E;  1W1W E;  2DDA A;  1FBQ A;  5D5W B;  4G12 A;  2JMW A;  4KYW A;  4WX9 A;  2BW3 B;  3L2C A;  3P9T A;  5FHP A;  3GFM A;  2VKH A;  2IU5 A;  1MSE C;  2ZOZ A;  1YW7 A;  1XSV A;  2MC4 A;  2BZT A;  4BAC A;  1ENH A;  4HX4 A;  3DEW A;  1IW7 F;  4R8H A;  3S14 J;  3F3X A;  3LA7 A;  2FU4 A;  3QAH A;  2A6T A;  4XLN F;  4ABZ A;  3BPX A;  1MBF A;  3KEQ A;  4ZYH A;  2V6C A;  5DUI A;  3MKL A;  2EFP A;  1NH3 A;  2YS9 A;  2O61 A;  2L7Z A;  2LKP A;  3K4B A;  3QOE A;  5L3F A;  4Y17 A;  1ZN2 A;  2MAB A;  2ZSH B;  2QWW A;  3KYC B;  2BHZ A;  4XOT A;  3H0G J;  3AG4 H;  5CVJ A;  4PGH A;  3OSG A;  1LFP A;  5K5Q A;  5DYM A;  4KDP A;  2W48 A;  3IRQ A;  4ZJZ A;  3U21 A;  3LAP A;  2XGC A;  2LY2 A;  5JLX A;  3DU6 A;  1YG2 A;  3FBN B;  2ZJQ F;  5HSZ A;  4MXM A;  4MLO A;  1QZZ A;  3JTH A;  2EFW A;  4IRH A;  4KIB A;  1ULY A;  4YEL A;  3SEZ A;  2WAD A;  5CYV A;  2IJL A;  2P0W A;  2Q2E A;  2VL8 A;  3QU3 A;  4GDF A;  1XB4 A;  2DG7 A;  2E5N A;  3TED A;  1H9G A;  1R4M B;  2NXN B;  3ABM H;  3C3W A;  3PM1 A;  2V6E A;  2CUE A;  3K9T A;  3M9A A;  4GCV A;  3I5U A;  1LFB A;  2DLL A;  3KYL A;  2RQQ A;  2R3S A;  5C4X J;  2V7F A;  3CDH A;  2EIN H;  2HQA A;  3KLO A;  2HPM A;  1QPI A;  3S1R J;  2ADU A;  2P6T A;  1AKH A;  4C3I J;  2BE5 F;  2K02 A;  3P9I A;  5L3D A;  5LGT A;  1D0X A;  2DOF A;  1ODD A;  2V1X A;  2ZNY A;  2M9H A;  2IEK A;  3G3Z A;  4XR6 A;  4B3X A;  3CCE I;  4G9Y A;  1ETY A;  3GME A;  2I10 A;  1BC8 C;  3ISP A;  4GYG A;  2RC4 A;  2WAQ A;  2DFE A;  4DIQ A;  3G56 A;  3TP3 A;  1G3Y A;  1U6G A;  3QQA A;  3HIF A;  1SMT A;  2L01 A;  3LSH A;  1MMA A;  1R1V A;  2P4W A;  5FD6 A;  1D3Y A;  3OSF A;  4BXU A;  2R7U A;  3HZJ A;  2CH0 A;  4CGR A;  2VQC A;  1XTA A;  3UNG C;  4CO8 A;  3BR1 A;  4BDZ A;  5F04 A;  4A3D J;  3WU1 B;  1P4W A;  3CCM I;  3K69 A;  2W82 A;  2M3A A;  3WU0 A;  4L0Z B;  4HYE A;  2TRT A;  4U0W A;  2PJR A;  2BXZ A;  3CC2 I;  2EZI A;  4UV8 A;  4FTH A;  1PYV A;  1YQA A;  2IGO A;  4XN3 A;  1HST A;  1UFM A;  3C1D A;  1DPU A;  2R7V A;  3VW0 A;  5H9T A;  2ZME B;  4HST A;  1IXC A;  3L00 A;  4D7M A;  4FAS D;  2OAZ A;  4S0H B;  3T8T A;  1UHM A;  3E1S A;  1I39 A;  2OER A;  2D2W A;  2BHY A;  4U7D A;  3H9G A;  3GVA A;  4C2M A;  3K2A A;  1K4S A;  1AU7 A;  2ZME A;  4BGD A;  3EGQ A;  3CMM A;  3TKY A;  3HOX J;  2QUF A;  1K78 A;  3QPT A;  1Z7U A;  3PQK A;  1MMD A;  1V54 H;  1X58 A;  2CQ7 A;  3BJO A;  3PSI A;  5GTI C;  4A3F J;  2HYG D;  2UV1 A;  2FD5 A;  3FMR A;  3NRV A;  3GYH X;  3J7Y J;  4DGW B;  4P1W A;  1VQK I;  1R6R A;  2NVX J;  1A36 A;  4ME9 A;  5GAH J;  4M9X A;  2W85 A;  3FK6 A;  1IXS B;  2NS7 A;  4YEJ A;  1KGS A;  1TNT A;  5DD8 A;  4KIT B;  1AWC A;  2FNA A;  2CYY A;  2O03 A;  2HGC A;  4JQF A;  4E7Z A;  2XPW A;  5LD2 C;  2FXA A;  2X1C A;  5BNG A;  6PAX A;  5CVV A;  4JBA A;  1BOB A;  2XIG A;  3JRD A;  1FSE A;  1TTY A;  2E7X A;  2OD5 A;  3GLL A;  5C4Y A;  3SZP A;  4ENK A;  2PEX A;  1G59 A;  1Z9C A;  5IOZ A;  1PJR A;  1STZ A;  1IJW C;  4Z6Y A;  1GUU A;  2MH9 A;  2VJI A;  3S2W A;  4QSH A;  2DN0 A;  3HBL A;  5IPA A;  3GTM J;  4M73 A;  4A3G J;  4HKU A;  3RZD J;  5JR3 A;  2M30 A;  2MW8 A;  3WHC A;  1ZLJ A;  4B48 A;  1ZG5 A;  2LH9 A;  3ESW B;  3K4J A;  4HDV A;  2CUZ A;  3ZQL A;  5B1A H;  2EBI A;  3ZCO A;  1IRG A;  1UI6 A;  9ANT A;  5BPI A;  1H8A C;  3JAM K;  3KP7 A;  3FBI B;  3DPL C;  3GTJ J;  1Y39 A;  4XIC A;  4KIG A;  3F0C A;  2MGQ A;  5EDN A;  5EFY A;  2JJ7 A;  1I6H J;  2G7S A;  4PSX A;  2QYO A;  3JR9 A;  3OL3 A;  2VUM J;  2PMU A;  2VKD A;  1FOY A;  2Y0S A;  3MD2 A;  2FSW A;  3AL0 C;  5IT9 K;  3GO5 A;  2EZK A;  1KQ9 A;  3D5L A;  4A3I J;  2NOG A;  2GM4 A;  2EK5 A;  2Y31 A;  2QSH X;  2UWM A;  3S3N A;  2LFB A;  2VOO A;  5J1U A;  1TWA J;  4PFP A;  3ON2 A;  2R7F A;  2ZC2 A;  2Y2Z A;  3TW7 A;  5LLQ A;  4BDY A;  3FXR A;  2KMU A;  3QPH A;  1PUF B;  4LLN A;  1APL C;  3H5R A;  2R5Y B;  1R23 A;  4JNN A;  2RAE A;  4G8X A;  3W2W A;  1RR8 C;  2NVY J;  5K58 A;  1SD4 A;  4ZTJ A;  5A2Q Z;  1MDM A;  2L7K A;  1E17 A;  3H35 A;  4E6K G;  1CF7 B;  3EDP A;  2E60 A;  1CGP A;  1ZH5 A;  5HBU A;  5L3C A;  3QKX A;  4XKC A;  4QPQ A;  2VC1 A;  4E7S A;  2M2E A;  1Y1V J;  2HDC A;  2MG4 A;  1N25 A;  1MND A;  2V79 A;  2D1H A;  4HA8 A;  3A01 B;  3M4O J;  2QEX I;  2IS6 A;  1UEL B;  2ME0 A;  5KHD A;  3I4P A;  3DKY A;  2QKM B;  4AUX A;  3LOC A;  3OOU A;  1KU9 A;  1W36 C;  2ZCN A;  1J09 A;  3OYK A;  1BW5 A;  1FOW A;  3C07 A;  2R0Q C;  1I3Q J;  4ESJ A;  4BY1 J;  3FXM A;  1Z05 A;  1LVK A;  1MD0 A;  2IW5 A;  1ZQ3 P;  4KA4 A;  1ZR4 A;  3GEZ A;  2A69 F;  2MFZ A;  2DYR H;  2OUM A;  1T0F C;  1S72 I;  2ECC A;  3GZ5 A;  1WH7 A;  2R7Q A;  2Z33 A;  3GTO J;  2ESH A;  1JGS A;  2KIF A;  1UB9 A;  5GAG J;  4UXN A;  1KQ8 A;  2EV0 A;  1GV2 A;  2RAS A;  5D6F A;  2VI6 A;  2LKX A;  2HOE A;  2M34 A;  3ABK H;  3FIS A;  1HC8 A;  2VAS A;  3U1K A;  4UY8 I;  4OIP F;  3CTA A;  3MKZ A;  4FQG A;  2OF7 A;  2NYX A;  4M72 A;  3GUD A;  1ON1 A;  4UUT A;  5GPC A;  4IVN A;  3FXO A;  5ILV A;  2DW4 A;  4HG2 A;  1DQU A;  2CS3 A;  2DK8 A;  1B72 B;  4FHT A;  4HEA 2;  1E3P A;  2VON A;  2KQR A;  2F07 A;  2XSD C;  3Q0U A;  3VEP A;  2BBY A;  2X4H A;  3QPL A;  4HX8 A;  1B72 A;  3HE0 A;  1MMN A;  1B59 A;  1ZRF A;  4MGR A;  3GXO A;  3LWJ A;  2PMZ N;  3DKW A;  1R1T A;  4BAY A;  1ZGW A;  5LRS A;  4I01 A;  2WWY A;  4B09 A;  2CGP A;  2MYS A;  2G7L A;  4G7O F;  2OCC H;  2GEN A;  1BM9 A;  3RKY A;  4MK6 A;  3LJL A;  4OD5 A;  4DBQ A;  3BLY A;  5E17 F;  4A5N A;  4ENM A;  2EFO A;  2IT0 A;  3Q5F A;  5L3E A;  3O2P E;  2JTV A;  2XRL A;  1YHQ I;  1ITY A;  1IDY A;  5JHU A;  1ZEL A;  2FRH A;  5D18 A;  2VLA A;  4WXD A;  3BTL A;  3IRR A;  1TQM A;  3V4G A;  2HDW A;  2FUG 2;  4GGG A;  4RM3 A;  1ORK A;  2OCE A;  2LY1 A;  1OYW A;  3LST A;  5F0H A;  1BR2 A;  2DDB A;  2WC2 A;  1XGS A;  1LUJ B;  2FJI 1;  4BUP A;  1A31 A;  3W6V A;  2R7R A;  3K1N A;  2UXO A;  3VOK A;  4PJM A;  4FET A;  4UVB A;  1QGP A;  5E79 C;  3V42 A;  2R7Z J;  3KLN A;  2ZCW A;  4J19 A;  1JUP A;  1O3Q A;  1WFX A;  1IN5 A;  2CWE A;  3OYD A;  2FE3 A;  4AIK A;  3ZPL A;  5L3G A;  3NAR A;  2R92 J;  1IN7 A;  3EET A;  1NG7 A;  4B44 A;  3ZQC A;  4Q48 A;  2DT5 A;  2VIX A;  4GFB A;  5ICG A;  1LDK B;  5BS6 A;  2XAG A;  3AG1 H;  1UI5 A;  1ETO A;  1MNE A;  2X0L A;  4M9Z A;  3EUK L;  3HC7 A;  1I50 J;  1KU2 A;  5BMZ A;  3RI4 A;  3LHQ A;  3H92 A;  1OR7 C;  3DLA A;  3H36 A;  1N77 A;  3PJR A;  1VQN I;  2QTQ A;  3D5R C;  4N9H A;  4L9J A;  5J4Y A;  3BPV A;  5FKM A;  4MFD A;  2KRH A;  3BCB A;  3S1Q J;  3PSF A;  2MLG A;  4A6D A;  2LF7 A;  2IGN A;  1KU7 A;  3L09 A;  1H89 C;  2C6Y A;  2A05 A;  1T8I A;  3FM3 A;  2XAH A;  2Y75 A;  3NWT A;  3HRT A;  3CP2 A;  1G3S A;  3HRS A;  3WG9 A;  1FLI A;  2OC6 A;  1S9H A;  4MIM A;  5E20 A;  5DS9 A;  4RBO A;  1T33 A;  3BQZ A;  5D5U B;  4A3E J;  1UG0 A;  3VPR A;  4NBQ A;  4Q5S F;  1F9N A;  2ECB A;  3KFW X;  3JSO A;  4HZF A;  5DDG A;  3EYI A;  1FOX A;  3FX3 A;  1OIS A;  1XSD A;  2DT6 A;  1T2K A;  1FSH A;  1B1B A;  5KVR A;  2VJ4 A;  3S17 J;  1VFC A;  2IGM A;  1I5Z A;  4H0E A;  4PXI A;  3KNW A;  1TW3 A;  2MBF A;  3O6B B;  3ANP A;  4I09 A;  1BL0 A;  2PMZ A;  3DPU A;  2EQR A;  4BHC A;  2OTJ I;  5E8G A;  4EJW A;  2G7H A;  1R4N B;  3A02 A;  3CLO A;  4OIR F;  1VQM I;  1P92 A;  4WF2 A;  2UXH A;  3VUQ A;  4L18 B;  2GOM A;  2HFH A;  1XMX A;  1Q1V A;  3RKW A;  2DYS H;  3JRE A;  1MMG A;  1BIA A;  3BR6 A;  4RGU A;  4A2U A;  2G7G A;  2UXU A;  4ZZL A;  2LR8 A;  3OYI A;  3N4M A;  2M7B A;  2RHA A;  1DGW Y;  4IRV A;  5IT3 A;  4D5C A;  4M6Y A;  4NHJ A;  3VW2 A;  3I4M J;  5M3F J;  3R6S A;  1D5V A;  1MBH A;  5IP6 A;  1JKP C;  1W5T A;  3TO6 A;  3V7R A;  4A93 J;  3HEF A;  4PUS A;  3OYE A;  3VYT B;  1F36 A;  1MBK A;  2K5C A;  5HAW A;  1T95 A;  2DQR A;  4X1E A;  3SZG A;  4IPA A;  3JTG A;  3QRF F;  3LSP A;  3LFU A;  5GP9 A;  2CV0 A;  3GTG J;  1NG6 A;  3TGN A;  2L54 A;  2D6Y A;  4NC8 A;  2ZJ2 A;  4L62 A;  3ZQ7 A;  2MC3 A;  2ME6 A;  2QSG X;  1YJN I;  3GF2 A;  4RB2 C;  3E5Q A;  5J47 A;  1XX5 A;  1MBG A;  1S8N A;  3MEX A;  2IA1 A;  1U2W A;  1KQ0 A;  1HW1 A;  1RZ4 A;  3HB9 A;  3ECO A;  5IT9 Z;  3W2A A;  5CQG A;  3LWF A;  2IS4 A;  1V4R A;  4BE2 A;  1SC7 A;  1YE9 A;  5FRN A;  2HZD A;  2OQR A;  2WAE A;  1LNW A;  2A07 F;  1MJB A;  4GFK A;  1DU0 A;  3CME I;  1KYZ A;  4L0Y B;  1DP7 P;  3ZRG A;  1POG A;  1S29 A;  5L3B A;  2M45 A;  3EUP A;  1ZGJ A;  2XF5 A;  2K85 A;  1JI8 A;  1N75 A;  2KT0 A;  3J7Z I;  5D19 A;  5M5W J;  2HDD A;  4V19 K;  3DU5 A;  4RAF A;  2HI3 A;  2NS8 A;  2XRN A;  4UUV A;  1I27 A;  3MMY B;  1YW9 A;  4RS8 A;  2UXN A;  4UHT A;  2W25 A;  1V3F A;  1LE8 B;  3JRC A;  1J59 A;  4LG3 A;  2OI8 A;  3VP5 A;  1F1Z A;  1FX7 A;  3HOS A;  2KDZ A;  1OCO H;  3GWZ A;  3JRH A;  4BL0 B;  2M87 A;  4HF0 A;  4E70 A;  1X3U A;  1YIO A;  2AQE A;  1W0U A;  2LRD A;  2LK2 A;  2KJC A;  3VYS B;  4A3B J;  1HDD C;  1HSJ A;  2XGD A;  3HGG A;  1V5E A;  2HOS A;  1QHG A;  3TL4 X;  2KIS A;  4M6X A;  1VZ0 A;  3E97 A;  3FHN A;  4XRS G;  2Z2S B;  2DOE A;  3ZMZ A;  3MFK A;  3CJD A;  2EWN A;  3QOD A;  3VVX A;  5JVG F;  1O7F A;  5CXI A;  1OKR A;  4OAY A;  4OOI A;  1CQT A;  2K3F A;  3EQL F;  2FBI A;  2RNG A;  3RCO A;  2HEO A;  3LSJ A;  4ZH4 F;  1FTT A;  3CDI A;  1LDJ A;  2K9M A;  1J75 A;  4IHW A;  2KPM A;  2VXZ A;  4I76 A;  1PDN C;  4TV7 A;  4B43 A;  3OYH A;  3DXJ F;  2HXI A;  1UCR A;  5D5X B;  1Z3X A;  1MDM B;  3DBH B;  1KYW A;  4MTE A;  2BVL A;  2JZY A;  4CZZ A;  1BIB A;  4BY7 J;  4BBR J;  4I99 C;  3SHF A;  1YX5 A;  4A5M A;  5FLV A;  4BJT A;  2V1U A;  2P5K A;  3QYB A;  2F4M B;  1FT9 A;  2E5Z A;  2P5V A;  5LGU A;  3HIM A;  2PMH A;  1FPQ A;  2KIU A;  3LQR A;  3VFZ A;  1HW2 A;  3PPB A;  2R7T A;  2OV7 A;  3MVP A;  2P7V B;  1F4K A;  1FIA A;  4YIR X;  3WTV C;  4QLC U;  1QRY A;  1ZG3 A;  4XLF A;  2QZ8 A;  2WY8 Q;  1SAN A;  3JSP A;  2QEN A;  2ZCX A;  4R1H A;  3WTY C;  1P2F A;  2BV6 A;  4NUB A;  3BG6 A;  2YX4 A;  4JOM A;  1BA5 A;  2BY2 A;  3CJN A;  1GDT A;  4IHT A;  1MKM A;  5BOX A;  4OIQ F;  4AC0 A;  2JA2 A;  2VQH A;  3KET A;  1IV6 A;  2HQR A;  1IRZ A;  1Y8Q B;  1R5G A;  5CJ9 A;  2B7E A;  2TCT A;  3NRG A;  3ZP5 A;  3AG2 H;  2A5Y B;  2V1D A;  3EUH A;  2OZU A;  5ILU A;  4LK1 F;  1SD5 A;  4EQQ A;  2MD5 A;  3LMM A;  3MKY B;  1JT0 A;  5FJ8 J;  4F91 B;  1WCM J;  2QIB A;  3CUQ A;  4ZC3 A;  4F3Q A;  5C4J J;  2BY1 A;  5LRR A;  3ZMS A;  2DA7 A;  2L9R A;  5LHI A;  3B6C A;  1GVJ A;  4B3A A;  1UST A;  1U5T A;  2CFX A;  4GXO A;  3S32 A;  5HDK A;  1LVA A;  1BW6 A;  2KHM A;  2LDU A;  1LEB A;  2CFO A;  5FKK A;  4FX4 A;  3CCQ I;  2OBP A;  1MGT A;  2JSP A;  3COL A;  2QGU A;  3C7J A;  1YRN B;  3RQ4 A;  4DW6 A;  1LPQ A;  2HOA A;  4ZDP A;  2VPR A;  4UB8 C;  5DCM B;  4ON0 A;  2CQN A;  2JVG A;  3CJQ B;  3C2H A;  1OYY A;  2EJR A;  4XON A;  2VPL A;  3OOP A;  2Z9O A;  3C2B A;  4M3E A;  5LHG A;  3TBI A;  3KP6 A;  2X6X A;  4KMU X;  1P4A A;  3OR1 C;  3A1Y A;  4P9U A;  1ZRC A;  4Y15 A;  1S7A A;  3JRB A;  3FZV A;  4P96 A;  4CSW A;  1FEX A;  1T39 A;  4ETS A;  5CLS A;  3G1L A;  2G9W A;  2XGE A;  1JXS A;  3H9J A;  2ISZ A;  5AIP A;  1WJA A;  3IKT A;  4DBR A;  3BJ6 A;  4NB5 A;  5HS8 A;  3A0H C;  2VXD A;  3X2Q H;  2FF4 A;  1NK2 P;  5FO5 A;  4D7N A;  4MEX F;  2I8D A;  1RNL A;  4HPQ A;  2GLO A;  2RGV A;  5HLG A;  3F8N A;  5FKN A;  4XBF A;  3JRA A;  4HBL A;  3GZ6 A;  4HQE A;  3HOT A;  1TW2 A;  3FXL A;  2NNN A;  4LLL A;  4AD9 A;  3F1B A;  3AL0 B;  5D5V B;  1DP3 A;  2AO9 A;  1KU3 A;  3TW6 A;  5EGO B;  2XKP A;  3Q0W A;  3G71 I;  4MTD A;  4I0B A;  4ANJ A;  1LE8 A;  2R7S A;  3B6A A;  2O8X A;  1O3S A;  1NK3 P;  2BVM A;  3K4C A;  1S5L C;  4MFE A;  1R00 A;  3KP2 A;  4XL9 A;  4PCQ A;  4CCO A;  2E1M C;  2MH2 A;  3BNI A;  3OYF A;  4A3L J;  4XKB A;  1K78 B;  1U9O A;  3BG7 A;  4NQW B;  2DK5 A;  4E7L A;  2L02 A;  4AIH A;  4JX4 A;  3R0A A;  5EEH A;  4NC7 A;  3WTX C;  4YZE A;  2DAO A;  3JRF A;  3U9G A;  2JPC A;  3M8F A;  3LAJ A;  2IPQ X;  3DCF A;  3K6G A;  1B4A A;  4ZZD A;  5ICC A;  2AXT C;  1LDD A;  1XCV A;  3LA3 A;  3QP5 A;  1YLF A;  3L2Q A;  3F6V A;  1SVO A;  1AHD P;  2K27 A;  1TWH J;  3VSK A;  4B1R A;  4LMY A;  4RM2 A;  3KZY A;  3RQI A;  5JLW A;  2PI0 A;  5IYD J;  3LQQ A;  2ISY A;  5GTH C;  4II3 A;  1T0F A;  1ETW A;  5IY5 H;  1KA8 A;  2CQX A;  3CZ6 A;  2STT A;  1D1B A;  3NWS A;  3R0J A;  3N05 A;  4B47 A;  4AF5 A;  3I58 A;  3VW1 A;  1B9M A;  3LFK A;  4D5F A;  4RAZ A;  1JTY A;  4ZDO A;  2Q24 A;  2JVH A;  2K7L A;  4XLE A;  4BH9 A;  3SZT A;  3S2D J;  4Y3O A;  2E2I J;  3I56 I;  2WB1 A;  2ELH A;  1J0R A;  1MJA A;  3K7A J;  3A03 A;  5DAJ A;  4A6E A;  4G7H F;  1OCT C;  4OD4 A;  1R36 A;  2K9S A;  1JTX A;  1X2N A;  2DA4 A;  3IC7 A;  3CF2 A;  4HV6 A;  3F6O A;  4Z2Y A;  3HOV J;  3G1O A;  3DLL F;  4WWC A;  3QU6 A;  3W6K B;  5D4S A;  2OZ6 A;  2I5U A;  1Y6I A;  1TLH B;  3ZQF A;  2HQ5 A;  1BR4 A;  3PUF A;  2O9L A;  3W6J B;  2ESN A;  3VYR B;  2DA2 A;  2RQP A;  4HSR A;  2YSR A;  1IO2 A;  2KFD A;  2HXO A;  2XF7 A;  4Y7N J;  4ENJ A;  3SXY A;  3SDB A;  2JN6 A;  5J4V A;  3CCR I;  1X4P A;  2EA2 A;  4D9J A;  4BQQ A;  1YIT I;  3U1D A;  1R5I D;  3A0B C;  1RC9 A;  2CUJ A;  3B02 A;  1YJW I;  2FBQ A;  2X6W A;  2QQ9 A;  2IS1 A;  2Y9Y A;  3OYJ A;  2DBB A;  1YRN A;  3CUO A;  1FP1 D;  4IHX A;  2EIK H;  3G2B A;  5E3O A;  4CH7 A;  2D5V A;  1SD6 A;  3ERE D;  1Z77 A;  2P8T A;  2LC2 A;  4GRI A;  4KT6 A;  1PP7 U;  3LSR A;  5KCM A;  2JA6 J;  4DOZ A;  3EUH C;  3RPU A;  1I1S A;  3MZY A;  4YFN F;  4ICH A;  1ETK A;  1VI0 A;  2JSC A;  4V2G A;  5AIQ A;  5E1Z B;  4D0P A;  1TQP A;  4BQA A;  3OYB A;  1E3O C;  4IEJ A;  3CQZ J;  1MSF C;  4MEY F;  4DJA A;  3GFI A;  2M8G X;  4CCN A;  3OR2 C;  2PLY A;  3QWL A;  1R1U A;  2DA3 A;  1W5C C;  4UUS A;  1ZRE A;  2IXS A;  2PQ8 A;  2XDN A;  4U88 A;  2HVR A;  4JK1 X;  2PBX A;  1OR7 A;  1GT0 C;  3KP4 A;  3GW2 A;  3HGY A;  4IX7 A;  1EA3 A;  3R60 A;  4L9V A;  1BI1 A;  1WJB A;  3DFG A;  3NQO A;  1SFO J;  1TT5 B;  2KLO A;  3CO7 C;  1B8I A;  1JKO C;  3V6G A;  2VJ5 A;  4IOA F;  5FMP A;  2ZFW A;  4A0X A;  4DYC A;  5IYC J;  1WQ2 A;  3ZMD A;  4FCY A;  3S8P A;  4XLP F;  1HKT A;  1OPC A;  1X1A A;  4BJ6 C;  2V9V A;  4RAG A;  4AYB N;  1X4O A;  3S16 J;  3TMO A;  1FZP B;  2E2H J;  2X85 A;  2LBF A;  3ZXS A;  3J7A Y;  4BXF A;  2DXI A;  5J8F A;  2W00 A;  4LG0 B;  2CV1 A;  2WV1 A;  1JUM A;  1WI9 A;  4EJT A;  3L7W A;  3T0Y A;  4R79 A;  4GCT A;  1JGG A;  3RPU D;  4DZP A;  4PJN A;  2G7U A;  2HTJ A;  2VQL A;  1SMY F;  2ELK A;  3VB2 A;  3BG5 A;  1E0E A;  3T1B A;  5LEK A;  3ELK A;  1TWG J;  5K7F A;  1G2H A;  2G3B A;  3BWG A;  2BEO A;  5EF6 A;  2ZOY A;  2L4A A;  1WZ2 A;  1EKE A;  1DGR M;  3K2Z A;  2GFN A;  2F5F A;  4V2F A;  4XRS A;  1LB2 A;  3HL2 A;  3KKD A;  3V8L A;  2M5W A;  5HLI A;  2COM A;  2WAF A;  4OIO F;  3D0S A;  4PJL A;  3IAS 2;  1UHS A;  1VTN C;  1O7L A;  3LSK A;  2LD5 A;  2GZW A;  4I2O A;  1A04 A;  3MQ0 A;  2JRM A;  4HF1 A;  5B1B H;  3KIO A;  1QPM A;  3ZQG A;  3ZN1 A;  3O8G A;  5C44 J;  2OTL I;  3QP6 A;  2ZB9 A;  4KNY A;  3GTK J;  2EIM H;  4QWQ A;  3CJT B;  3RJP A;  4OMY A;  1ETQ A;  2UUZ A;  4L9T A;  2R4G A;  3WE3 A;  1B9N A;  3KE2 A;  3DTE A;  2F5E A;  2ID6 A;  3BR2 A;  3RKX A;  2FMY A;  3CRJ A;  2HR3 A;  2Y69 H;  4OIN F;  4E7J A;  2JPB A;  1K7A A;  2GXG A;  2WAQ N;  2RDP A;  3CC7 I;  2F5C A;  1U5T C;  3MWM A;  1R22 A;  2QF7 A;  4UVA A;  3HTJ A;  2FJ1 A;  3K4K A;  4E7H A;  2ZFU A;  1X19 A;  4MQV A;  5FRO A;  1K6O A;  2M0M A;  1ON2 A;  2FNP A;  3PIO F;  2E2J J;  2N8G A;  2QA4 I;  3KPH A;  2DI3 A;  4G7Z F;  5FGL A;  2ZXH A;  5K5R A;  1O3R A;  3DKX A;  3ECH A;  5FB2 A;  3L2R A;  1Z0X A;  4PDK A;  4IOC F;  1J7K A;  2CQQ A;  1RPW A;  4DQ2 A;  2GXB A;  3EPZ A;  3FMQ A;  5K1Y A;  4JKZ A;  3E6D A;  3CCS I;  1ZK8 A;  2Y9Z A;  1RRJ A;  2Y0M A;  3NAU A;  3RYR A;  2BW3 A;  5BQT A;  3HPH A;  1PUF A;  4IHS A;  4HLX A;  2XAF A;  3T5X A;  2ELJ A;  2IVM A;  4MNU A;  2O7O A;  2CW0 F;  3HHH A;  5KAF C;  2KRF A;  2AQF A;  2ZCM A;  5M5X J;  1CF7 A;  1XDS A;  2F6C A;  3J80 Z;  2LTP A;  1RET A;  1WWX A;  1JHH A;  3CJR B;  2DOD A;  2O3F A;  1A5J A;  1WJE A;  3V7S A;  5DCM A;  3HSF A;  1S6L A;  2F48 A;  1X1B A;  2X9D A;  2IS2 A;  1OCZ H;  3G6E I;  1O3T A;  3VDX A;  4EV0 A;  1W7P B;  1WGX A;  1P7J A;  1WJF A;  4EJV A;  3AKZ A;  1EJ9 A;  1JUS A;  3C2G A;  1FWZ A;  3S2H J;  1NHA A;  2NP3 A;  3E7Q A;  4HNU A;  2Z1D A;  2RN7 A;  3BJA A;  1ZGA A;  2OPT A;  3H9Q A;  2A61 A;  3WU2 C;  2B63 J;  3HSR A;  4KUM A;  4F52 A;  1RES A; 
#chains in the Genus database with same CATH homology
 2K9Q A;  3HGG A;  1FTZ A;  4A3C J;  4A69 C;  2HOS A;  3BQY A;  2YVH A;  1QPI A;  3S1R J;  1B8I B;  1AKH A;  4XRS G;  4C3I J;  3CJD A;  3VVX A;  1OFC X;  1QVT A;  2QOP A;  1QVU A;  2Y30 A;  5CXG A;  2M9H A;  2IEK A;  5CXI A;  2DMQ A;  1CQT A;  1ETY A;  1ZR2 A;  2I10 A;  2DTZ A;  3S15 J;  3LSJ A;  3HOU J;  2VKE A;  1FTT A;  2H1K A;  3G56 A;  3TP3 A;  3GBG A;  3QQA A;  4IHW A;  3L1P A;  4IHY A;  4I76 A;  3BTJ A;  3OSF A;  2HXI A;  2XB0 X;  3NI7 A;  4CGR A;  3TP0 A;  4JL3 A;  4NDL A;  4FIS A;  1GV5 A;  2DA1 A;  3BR1 A;  4C3H J;  3ZOB A;  1IC8 A;  5F04 A;  2EZH A;  2W53 A;  4A3D J;  3QPS A;  4BY7 J;  4BBR J;  5FLV A;  2TRT A;  3MNL A;  5D1R A;  3HIM A;  2EZI A;  1ZKG A;  1XG1 A;  5AQC A;  4FTH A;  3PPB A;  3VW0 A;  5H9T A;  2X6O A;  3MVP A;  3BR0 A;  2E1O A;  4D7M A;  2FQ4 A;  3BJB A;  1FIA A;  4S0H B;  3UKG A;  1QRY A;  2OER A;  3S5R A;  1SAN A;  2ZCX A;  1K61 A;  3K2A A;  1AU7 A;  1LFU P;  4BXX J;  3EGQ A;  1BA5 A;  1GDT A;  2YU9 J;  2R93 J;  2DMU A;  3HOX J;  2JA8 J;  1U78 A;  3HTA A;  4JP0 A;  4AC0 A;  3HTH A;  1IV6 A;  1X58 A;  1IRZ A;  2NP5 A;  2TCT A;  4A3F J;  3NRG A;  4HNV A;  3O8H A;  2FD5 A;  2NVX J;  4ME9 A;  3BG9 A;  3CCY A;  1JT0 A;  5F1J A;  5FJ8 J;  3FK6 A;  1WCM J;  2JWT A;  2NS7 A;  2QIB A;  2UXI A;  4A3M J;  1WH5 A;  5C4J J;  4CYC A;  5DTD A;  3HM5 A;  2DA7 A;  2L9R A;  3G7R A;  2HYJ A;  3B6C A;  4B3A A;  4M3B A;  2XPW A;  5BNG A;  1BW6 A;  5FKK A;  4M3D A;  3JRD A;  4A3K J;  2AHQ A;  5E3M A;  3COL A;  5C4Y A;  1YRN B;  1HCR A;  4DW6 A;  4BBS J;  5EZG A;  3VVY A;  1EF4 A;  3QBM A;  2HOA A;  4C3J J;  5IOZ A;  2VPR A;  4ACI A;  1IJW C;  2IAI A;  1GUU A;  4AC6 A;  4QSH A;  2DN0 A;  3HBL A;  5IPA A;  3GTM J;  2H8R A;  2XB5 A;  2COB A;  4A3G J;  4X6A J;  4HKU A;  3RZD J;  1FIP A;  3C2B A;  2MW8 A;  4M3E A;  3WHC A;  2DG8 A;  3LSG A;  1U8B A;  1MBJ A;  3ZQL A;  2EBI A;  2XPU A;  1FJL A;  3JRB A;  9ANT A;  1UI6 A;  1H8A C;  1FEX A;  2M0C A;  3GTJ J;  4IHV A;  3G1L A;  4XIC A;  3F0C A;  2MGQ A;  5EDN A;  2VKV A;  5EFY A;  2JJ7 A;  1I6H J;  2XGE A;  1XS9 A;  3Q3S A;  2G7S A;  4UDS A;  3JR9 A;  2VUM J;  3HOW J;  5EYR A;  1Y1W J;  4CYC B;  1NK2 P;  2R5Y A;  4D7N A;  4DYR A;  5CW8 A;  2GLO A;  2EZK A;  5FKN A;  3JRA A;  4A3I J;  2NOG A;  2P81 A;  2GM4 A;  2JA5 J;  2Y31 A;  3VVZ A;  3F1B A;  3LNQ A;  3SFI A;  4L5E A;  2LFB A;  2DMT A;  2AO9 A;  4LOC A;  2XPV A;  2HYT A;  2EZL A;  3BTI A;  2YUS A;  3Q0W A;  3TW6 A;  5EGO B;  2QKO A;  5J1U A;  1TWA J;  2QCO A;  3B6A A;  1LE8 A;  5EZH A;  2IBD A;  2Y2Z A;  3TW7 A;  2HKU A;  3ON2 A;  3RD3 A;  1NK3 P;  1PUF B;  3T6N A;  1TWC J;  3FIW A;  4MFE A;  1APL C;  4QIW N;  2R5Y B;  4JNN A;  2HOT A;  2RAE A;  3BNI A;  2NVY J;  4A3L J;  5K58 A;  5F0F A;  1U9O A;  3PO3 J;  4XID A;  5HBU A;  4JX4 A;  3O60 A;  3QKX A;  3HDD A;  2K40 A;  4YZE A;  1WI3 A;  3H3V K;  2M2E A;  1Y1V J;  3JRF A;  2MG4 A;  1W0T A;  5IOY A;  3A01 B;  3M4O J;  3DCF A;  2ME0 A;  4EEF G;  3JRI A;  2CJJ A;  4AUX A;  2YVE A;  1WPK A;  4M3G A;  3LOC A;  4JYK A;  3OOU A;  2ZCN A;  1BW5 A;  1AHD P;  1TWH J;  4BKX A;  3C07 A;  2R0Q C;  4B1R A;  1TC3 C;  3CWR A;  1I3Q J;  5IP9 J;  1P7I A;  4BY1 J;  3RQI A;  5JLW A;  1ZQ3 P;  5IYD J;  3FK7 A;  2NVQ J;  5F0C A;  1ZR4 A;  1ETW A;  1A6I A;  3BT9 A;  3VOX A;  2CQX A;  2ECC A;  2EH3 A;  1WH7 A;  3GTO J;  4W97 A;  4AF5 A;  3ZQH A;  2DMN A;  1MNM C;  3VW1 A;  5FKL A;  4NEL A;  1GV2 A;  4D5F A;  2Q24 A;  2RAS A;  1JTY A;  2VI6 A;  2LKX A;  3FRQ A;  4JX5 A;  2M34 A;  5J3L A;  1IDZ A;  3S2D J;  2E2I J;  3ZQI A;  3FIS A;  4I6Z A;  3K7A J;  2LP0 A;  3A03 A;  5DAJ A;  5M5Y J;  5J1R A;  1OCT C;  2OF7 A;  1HF0 A;  2O7T A;  2UXP A;  5FLM J;  4UUT A;  3GEU A;  2K9S A;  1JTX A;  1X2N A;  2DA4 A;  4DZJ A;  5GPC A;  4QTR A;  4Y52 J;  3NPI A;  3IH4 A;  1OJL A;  2L7M P;  3HOV J;  3IH3 A;  3G1O A;  5K7H A;  1B72 B;  4NN1 A;  3ZQF A;  4GCL A;  2HQ5 A;  4XK4 A;  2F07 A;  5FKO A;  1X2M A;  2XSD C;  2O9L A;  3Q0U A;  4W1U A;  2DA2 A;  3QPL A;  1B72 A;  5EGO A;  1IGN A;  3HE0 A;  5F08 A;  3LWJ A;  2HXO A;  1IG7 A;  2FX0 A;  2PMZ N;  4Y7N J;  1SGM A;  1ZGW A;  1XC5 A;  2JN6 A;  5E3N A;  4DYQ A;  5M3M J;  5IP7 J;  3PO2 J;  2G7L A;  3KKC A;  2WUI A;  2GEN A;  2L0K A;  4MK6 A;  3LJL A;  2V57 A;  2FBQ A;  1RKW A;  5C4X J;  4GCK A;  2LLK A;  3BR5 A;  2Y9Y A;  3D1N I;  2CU7 A;  1YRN A;  2XRL A;  1ITY A;  4IHX A;  3NNR A;  1IDY A;  2JA7 J;  1JJ6 C;  2CUF A;  5E3O A;  3BTC A;  5D18 A;  2D5V A;  3BTL A;  2NVT J;  3JSJ A;  1Z77 A;  4B4C A;  1JJ8 C;  2JA6 J;  1K83 J;  3LSR A;  1ORK A;  3RKQ A;  2MSY A;  2QWT A;  5F0H A;  4ICH A;  1ETK A;  1VI0 A;  3HOZ J;  4V2G A;  2K9N A;  3VIB A;  3IUV A;  3W6V A;  1E3O C;  2WB1 N;  4IEJ A;  3CQZ J;  1MSF C;  2UXO A;  3VOK A;  3BG3 A;  2R7Z J;  2M8G X;  3M3Y J;  5GPA A;  5EG0 B;  1JUP A;  2DA3 A;  2R5Z A;  4J19 A;  4UUS A;  2XDN A;  3NAR A;  4FE4 A;  2R92 J;  4A3J J;  3HOY J;  2PBX A;  3ZQC A;  1GT0 C;  2WGB A;  3HKZ N;  4GFB A;  3RH2 A;  1UG2 A;  3Q0V A;  5HOD A;  5EG0 A;  2R5Z B;  3HGY A;  1UI5 A;  1ETO A;  1F43 A;  1I50 J;  1SFO J;  1OCP A;  1B8I A;  1AKH B;  1JKO C;  3LHQ A;  3V6G A;  5FMP A;  1T56 A;  4DYC A;  5IYC J;  5F27 A;  2QTQ A;  4FCY A;  1D5Y A;  1R9T J;  5FKM A;  1H88 C;  4MFD A;  3GZI A;  3S1Q J;  2DJN A;  3IV5 A;  1GVD A;  4AYB N;  3S16 J;  2E2H J;  1H89 C;  2GUH A;  3E7L A;  4A3B J;  4JX6 A;  1HDP A;  3A01 A;  2WV1 A;  1JUM A;  2X48 A;  4RDU A;  1VND A;  3BRU A;  1JT6 A;  4MIM A;  3HTI A;  5DS9 A;  4RBO A;  1T33 A;  3BQZ A;  4A3E J;  1JGG A;  4DZP A;  5EEA A;  3BCG A;  3VPR A;  4GCT A;  3ON4 A;  1VF9 A;  1JKR C;  3AQS A;  2ELK A;  2ECB A;  3BG5 A;  4KWA A;  3CMY A;  2O8K A;  3GTL J;  5C3E J;  1TWG J;  2PZ9 A;  5K7F A;  1G2H A;  3S17 J;  1ETV A;  1VFC A;  2G3B A;  5EF6 A;  3RZO J;  3I4N J;  2ZOY A;  2GFN A;  4PXI A;  1UMQ A;  4V2F A;  4XRS A;  3KNW A;  1MH4 A;  3KKD A;  1MH3 A;  4MO7 A;  3WHB A;  3S1M J;  3ANP A;  4M6V A;  1BL0 A;  3PAS A;  4C2M J;  5IYB J;  2CRG A;  2EQR A;  5K7Z A;  2REK A;  1UHS A;  3G1M A;  2LD5 A;  3A02 A;  1NTC A;  2G0E A;  1S7E A;  2UXH A;  3VUQ A;  1U9N A;  2L7F P;  3ZQG A;  3O8G A;  1Q1V A;  1HOM A;  5C44 J;  3JRE A;  1TWF J;  3GTQ J;  3BR6 A;  2G7G A;  2UXU A;  1IUF A;  2ZB9 A;  2LR8 A;  3GTK J;  2RHA A;  4D5C A;  3VW2 A;  3I4M J;  5M3F J;  1ETQ A;  2DA5 A;  3JRG A;  5J1Y A;  1MBH A;  5IP6 A;  2DA6 A;  1BJZ A;  1JKQ C;  1JKP C;  4UUS B;  4A93 J;  3HEF A;  2ID6 A;  3BR2 A;  1ZTR A;  3GTP J;  3CRJ A;  1F36 A;  1MBK A;  2WAQ N;  5HAW A;  4XRM A;  2QF7 A;  4X1E A;  1DU6 A;  3HTJ A;  2FJ1 A;  4G12 A;  2JMW A;  3LSP A;  2E19 A;  5GP9 A;  3GTG J;  2D6Y A;  2E2J J;  3NXC A;  3P9T A;  5FHP A;  2IU5 A;  2N8G A;  4L62 A;  3MN2 A;  1MSE C;  2ZOZ A;  2ME6 A;  5FGL A;  3KZ9 A;  4M3F A;  1Z0X A;  1ENH A;  1MBG A;  2CQQ A;  1RPW A;  1RR7 A;  3DEW A;  3HB9 A;  2NX4 A;  4JKZ A;  3S14 J;  1ZK8 A;  2JK3 A;  2Y9Z A;  3BR3 A;  3NAU A;  4ABZ A;  1MBF A;  2LY9 A;  1PUF A;  3S1N J;  3MKL A;  2YS9 A;  2O7O A;  2L7Z A;  4GFK A;  5E3L A;  1DU0 A;  3FKI J;  1HLV A;  3IH2 A;  3CDL A;  3SDG A;  5M5X J;  2ZCM A;  3H0G J;  1POG A;  3DPJ A;  3OSG A;  2LTP A;  4GFL A;  1RET A;  2ID3 A;  2W48 A;  3EUP A;  4FE7 A;  1MBE A;  2XGC A;  5JLX A;  1A5J A;  3OIO A;  2KT0 A;  5D19 A;  2GBY A;  5M5W J;  2X9D A;  2HDD A;  5HSZ A;  2HI3 A;  2NS8 A;  1ETX A;  4MLO A;  3ANG A;  4MXM A;  2DMP A;  1WGX A;  3V78 A;  2LVS A;  1P7J A;  1LE8 B;  3JRC A;  3BHQ A;  1JUS A;  2OI8 A;  3B81 A;  3VP5 A;  3S2H J;  2DG7 A;  2NP3 A;  3TED A;  3E7Q A;  1RKT A;  2KDZ A;  1O4X A;  3PM1 A;  2CUE A;  3JRH A;  2OPT A;  3AQT A;  2Y0S N;  1LFB A;  1W0U A;  2B63 J;  3SJM A;  2LK2 A;  1RES A;  1HDD C;  2XGD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...