2OPTA

Crystal structure of apo actr from streptomyces coelicolor.
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
219
structure length
209
Chain Sequence
AMAPLTQDRIVVTALGILDAEGLDALSMRRLAQELKTGHASLYAHVGNRDELLDLVFDIVLTEVEVPEPEPGRWAEQVKEMCRSLRRMFLAHRDLARIAIDRVPLGPNGMVGMERTMNLLRSGGLHDELAAYGGDLLSTFVTAEALEQSSRAGVFADQLHGYLKSLPATSFPNLVHLAGPITSLDSDRRFELGLEIIIAGLLAGAGEAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the Streptomyces coelicolor TetR-like protein ActR alone and in complex with actinorhodin or the actinorhodin biosynthetic precursor (S)-DNPA.
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Transcription
molecule keywords ActII protein
total genus 79
structure length 209
sequence length 219
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF02909 TetR_C_1 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2optA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2optA02
3GTPJ 2I10A 5HODA 3JRBA 2R5YA 1UHSA 2DA2A 2EZLA 3C2BA 4DZPA 3BRUA 1RPWA 1WH7A 1GV5A 2NVQJ 2NP3A 1OCPA 1IRZA 1F43A 4V2FA 5F04A 1K61A 3VW0A 4HNVA 2JA8J 2QKOA 4B4CA 4DW6A 4D7NA 1IDYA 2VPRA 2GBYA 2LFBA 3MVPA 3JRAA 1NK3P 3HB9A 1Y1VJ 3IH2A 1O4XA 1GT0C 5K7HA 3DPJA 5C3EJ 3Q0VA 1I6HJ 1B8IA 3UKGA 1Z0XA 1FTZA 5EZGA 1ETYA 2PMZN 4C2MJ 2CJJA 3BTJA 3BR0A 1UMQA 3JR9A 2DJNA 5C4JJ 3HOZJ 3HOXJ 2G7GA 1TWHJ 1RKTA 4X1EA 4NDLA 3HTAA 4DYQA 2EH3A 4GCTA 3Q0WA 3KKDA 3FISA 3GZIA 1B72B 1WGXA 2VKVA 1OJLA 3BTLA 3GTQJ 2OI8A 3OIOA 3HTJA 5J3LA 1JT6A 3VP5A 9ANTA 2GFNA 2EZIA 1POGA 2R5YB 1AU7A 2UXUA 4QIWN 2DMTA 3PPBA 3QQAA 1HF0A 1LFUP 3HE0A 1NTCA 3GBGA 1MH4A 1I50J 3A02A 3BHQA 3S1MJ 2Y31A 2M34A 1QRYA 4A3JJ 3JRGA 4ACIA 3LSPA 4M3EA 3O8HA 5JLWA 2LTPA 1XS9A 1JUMA 1R9TJ 5H9TA 2M2EA 3MN2A 3RKQA 1K83J 2ECBA 5FKKA 3ANGA 5C4XJ 3NARA 2TRTA 3HGYA 3BG3A 2WGBA 1WI3A 2UXOA 3BG5A 3QPSA 2Y9ZA 4V2GA 1JJ8C 2DTZA 5IPAA 2FBQA 3NXCA 3O60A 5FMPA 2HOAA 4D5CA 2HYTA 3LWJA 2HXOA 1Y1WJ 1YRNA 3M4OJ 1B8IB 1MH3A 1MSEC 2O8KA 5IYBJ 3KNWA 2QOPA 3RH2A 5C4YA 1FJLA 4BY7J 1OCTC 3QKXA 5F1JA 1F36A 4EEFG 1S7EA 2F07A 2DA7A 4CYCB 2JA5J 3BT9A 4YZEA 1JTYA 3AQTA 3PASA 2UXHA 4PXIA 3I4NJ 2XDNA 3A03A 4JX5A 3MNLA 2CUEA 3NRGA 5FLVA 5K7FA 3TP0A 4UUSA 4C3IJ 2ECCA 2NP5A 2EQRA 5EGOB 1W0UA 3HOWJ 2LLKA 3IH4A 1CQTA 1QVUA 1T56A 1JKRC 3V6GA 3ZQHA 3ZQCA 3V78A 1TWGJ 2DA3A 3CCYA 4I76A 3BTCA 2VUMJ 3NAUA 2GLOA 3RZDJ 3C07A 3O8GA 4FISA 5GPAA 3LSRA 4Y52J 5E3NA 3NNRA 3DEWA 4A69C 5E3MA 2CU7A 2ME6A 1NK2P 4ABZA 3BR6A 3E7LA 1H89C 2L7FP 3HBLA 5D1RA 2WB1N 3SFIA 2NOGA 4HKUA 4UUTA 2NS7A 2L7ZA 4GCKA 4MIMA 4GFKA 2LD5A 4A3LJ 3CJDA 3M3YJ 1LE8B 5EFYA 2L9RA 1IV6A 5F0CA 5HAWA 1TC3C 2XGEA 2LVSA 1D5YA 3JRDA 2WAQN 1Z77A 4DYCA 1JKPC 3Q3SA 3MKLA 2FQ4A 4B3AA 3JRIA 3JSJA 3PO3J 3ZQFA 3FRQA 5J1UA 3BQYA 1ZR4A 2JMWA 2VI6A 2X48A 5EG0B 4XRMA 3HIMA 3OOUA 2CQXA 4XRSA 1B72A 2JJ7A 1TWAJ 4W1UA 3GTGJ 4JP0A 3VVZA 5C44J 4AUXA 3SDGA 1A6IA 3JRHA 1A5JA 2RHAA 1HDPA 4JX4A 3LOCA 5FGLA 2G7SA 2YVHA 4MXMA 3K2AA 1JT0A 1HDDC 4QTRA 1MBEA 2O9LA 3OSGA 2Y2ZA 3LSGA 4BBSJ 4BXXJ 5IP6A 4BKXA 3G1LA 1GUUA 1AKHB 4A3IJ 3GTJJ 1ZTRA 3CMYA 2HDDA 4G12A 2IBDA 2HOSA 2IEKA 2EBIA 1IGNA 1ENHA 4MK6A 2PZ9A 3W6VA 2K9SA 3BTIA 4M3FA 3BG9A 2M8GX 2M9HA 2ZCXA 2LY9A 5E3LA 2LK2A 2JA7J 5EYRA 3QPLA 2MG4A 1RESA 2LP0A 4A3EJ 1VI0A 1IC8A 2OPTA 1YRNB 2G3BA 3VW2A 3HEFA 3JREA 2QIBA 4A3BJ 4ICHA 4NN1A 4RDUA 2EZKA 4IHYA 3AQSA 5D19A 3ZQLA 3VW1A 3OSFA 2E2JJ 2R5ZA 1MNMC 4A3GJ 3BCGA 1BW6A 4MFEA 2DA6A 5IOZA 4A3MJ 3G1OA 2W48A 1QPIA 4FTHA 1ZGWA 2UXPA 3ON2A 4M6VA 2R7ZJ 3S15J 3PM1A 3HKZN 2HOTA 1U9OA 3HTHA 3L1PA 4ME9A 3GTLJ 3VVYA 1DU0A 4A3CJ 2E2IJ 2G7LA 3A01A 5FKMA 5IP9J 4M3GA 3ZQIA 1HLVA 4S0HB 2GENA 3BJBA 4XK4A 2ZCNA 3FKIJ 1IUFA 2H8RA 3B6CA 5HBUA 2CRGA 4A3DJ 5EF6A 3I4MJ 2X9DA 3VOKA 1SGMA 4LOCA 4B1RA 1BL0A 3ON4A 3F0CA 2Y0SN 3LJLA 4IHXA 3ANPA 2XB0X 4DYRA 3KKCA 1ZKGA 1E3OC 2L7MP 2QF7A 1ETVA 1MBJA 2NS8A 3BR1A 5F08A 2R93J 4I6ZA 3ZQGA 4L5EA 2PBXA 1ORKA 1APLC 5JLXA 2AHQA 4BY1J 4FE4A 2DMPA 5FLMJ 3GEUA 3BQZA 1UG2A 3G56A 2N8GA 3BR2A 3VIBA 1FEXA 5IYDJ 3KZ9A 3TW6A 2W53A 1JKQC 2CUFA 2WUIA 1SFOJ 1VFCA 4GFBA 3RD3A 5EG0A 1ZR2A 5FHPA 3HTIA 1X58A 2Y9YA 1MBGA 1RKWA 2DA5A 1LFBA 3TP3A 3VPRA 1ZK8A 2HKUA 1GV2A 2MGQA 5M5WJ 4KWAA 4XIDA 3BR3A 5IYCJ 4CGRA 2HYJA 2DMNA 2RASA 3F1BA 1JKOC 2L0KA 1U78A 2M0CA 2X6OA 1XG1A 1LE8A 1GVDA 5D18A 2UXIA 2P81A 2QTQA 3SJMA 2XPWA 3FIWA 3CRJA 3EUPA 3JRCA 3S17J 3BNIA 2ID3A 1PUFB 5M3FJ 1VF9A 1MSFC 3G7RA 4C3HJ 3IH3A 2HI3A 2EZHA 3EGQA 3S5RA 2JK3A 5CXIA 1WCMJ 4AC0A 2MSYA 3B81A 3ZOBA 2JN6A 3HM5A 1EF4A 4GFLA 4AF5A 5M5XJ 3HOVJ 1ETOA 3Q0UA 4A93J 2Q24A 1HOMA 2QCOA 2DA4A 2ZCMA 3NPIA 1GDTA 3PO2J 3HDDA 3NI7A 3S14J 3G1MA 1VNDA 3FK7A 2Y30A 1AKHA 3VOXA 3S2HJ 5HSZA 5DAJA 1XC5A 5EGOA 1AHDP 1TWFJ 2YUSA 2XSDC 4JL3A 4J19A 3VUQA 2R5ZB 2ZOYA 3WHBA 2TCTA 3DCFA 1JGGA 3GTMJ 1P7JA 2LR8A 1U8BA 2NX4A 1JTXA 3TW7A 4UUSB 2GM4A 2NVTJ 2CQQA 2FD5A 3S1RJ 4JYKA 4M3DA 5FKNA 3COLA 1ETKA 5IP7J 2DMQA 2ELKA 2B63J 3T6NA 4MO7A 4IHWA 4JNNA 5DTDA 3LNQA 1JUPA 4FE7A 4L62A 2IU5A 3P9TA 4CYCA 1G2HA 3K7AJ 3D1NI 2XGDA 4A3KJ 1IJWC 5EDNA 4C3JJ 3IV5A 1BW5A 3H3VK 2R92J 2FX0A 1H88C 3S16J 5K58A 3LHQA 3TEDA 1ITYA 3CWRA 1BA5A 1P7IA 2FJ1A 5M5YJ 5EEAA 1ZQ3P 2OF7A 2G0EA 2KDZA 4NELA 3GTOJ 3CDLA 1BJZA 4D7MA 2AO9A 2DN0A 3GTKJ 5GPCA 2ZB9A 2NVYJ 1MBKA 2E1OA 2XRLA 1H8AC 2DMUA 2KT0A 1IG7A 3HGGA 4AC6A 5K7ZA 4FCYA 3HOUJ 1UI5A 3IUVA 1ETQA 2REKA 2YU9J 2MW8A 2OERA 1Q1VA 2XPUA 4JX6A 2HXIA 3VVXA 2XB5A 5CW8A 1SANA 4D5FA 4XRSG 5FKOA 1U9NA 2XPVA 1JJ6C 3LSJA 5AQCA 3S1QJ 1TWCJ 4RBOA 3HOYJ 2YVEA 2R0QC 1T33A 2RAEA 3BR5A 3FK6A 4DZJA 3S2DJ 1HCRA 4M3BA 2DG8A 5EZHA 3RQIA 1WH5A 5J1RA 5FKLA 3RZOJ 2HQ5A 4X6AJ 3QBMA 2K9NA 2O7OA 1RETA 2H1KA 2DA1A 5FJ8J 4GCLA 2LKXA 4MFDA 5E3OA 1FIPA 1X2NA 1MBHA 2JWTA 4XICA 2XGCA 1W0TA 1OFCX 4QSHA 4JKZA 2ME0A 2YS9A 2K40A 1QVTA 5F0HA 4IHVA 1ETWA 3A01B 4Y7NJ 1MBFA 5IOYA 4MLOA 5J1YA 5DS9A 2JA6J 2D6YA 1I3QJ 1X2MA 1JUSA 3E7QA 1UI6A 4A3FJ 5F27A 1FTTA 3S1NJ 5CXGA 3B6AA 1PUFA 4IEJA 2E19A 1WPKA 5F0FA 3CQZJ 3WHCA 4W97A 2D5VA 2QWTA 3JRFA 4AYBN 2COBA 2E2HJ 2WV1A 1ETXA 5BNGA 2VKEA 3H0GJ 1DU6A 2IAIA 1FIAA 2K9QA 2V57A 4BBRJ 5GP9A 2O7TA 4UDSA 1RR7A 2ID6A 5M3MJ 2DG7A 2ZOZA 2GUHA 1IDZA 2NVXJ
chains in the Genus database with same CATH superfamily
3GTPJ 5LRSA 1WH7A 4WXCA 1KU3A 3G6EI 1XCBA 2NVQJ 1F43A 4V2FA 3FMRA 5F04A 4B3XA 4X0GA 2E1CA 2ISZA 5GAEJ 2DFEA 5CVVA 4DW6A 1E0EA 2GBYA 3MVPA 1VQ6I 3OYDA 3HB9A 1FSEA 3JW4A 4WXHA 1HKQA 3MD2A 1T08B 1E2XA 1EKEA 3KP7A 1FNNA 2FF4A 1O4XA 3FKJA 5GAGJ 1I6HJ 1MJAA 1LEAA 4BS9A 3V8JA 3UKGA 2PMZN 3TO7A 4I99C 3BTJA 1T38A 5FB2A 1UMQA 3JR9A 1RI7A 2L02A 3HOXJ 3HTAA 4UB8C 4BDZA 4RA2A 4GCTA 1TZLA 3EUHC 1WKMA 3CC7I 4LITA 4ZYEA 4IQJA 1DPUA 3X2QH 5HLHA 3BTLA 3RI4A 1LDKB 1JT6A 9ANTA 3HPGA 3O6BB 3J7YJ 2R5YB 5CJ9A 2VJJA 2DMTA 2FXAA 2GUHA 2A61A 1HF0A 3J7AO 3A02A 2M34A 5KVRA 3V8KA 1QRYA 4YRVA 3JRGA 2IW5A 3LA2A 3LSPA 2QQ9A 4G7OF 1SFKA 5JLWA 2LTPA 4P1WA 3R0JA 3MN2A 4HX4A 2DOAA 3RKQA 1K83J 1FC3A 3EETA 5K5OA 3DPUA 4YG2F 4XKWA 1BOAA 1R22A 4XONA 3BG5A 3H5AA 3JTGA 1R1UA 4G6DA 2KJCA 2MD5A 3PL8A 3NXCA 2QWWA 2FBQA 1SEUA 1A6QA 3BJOA 4CCKA 2HYTA 2V9VA 2HXOA 3D5RC 4XSZF 1Y1WJ 4DVYP 2O8KA 4XLFA 2QOPA 1W7PB 4RB0A 3CCLI 3WG7H 2W7NA 4RAYA 1FJLA 4AIDA 4BY7J 1OCTC 2DFFA 1H0MA 2E71A 2JUCA 3QKXA 3L2UA 4GO1A 1BC8C 2QVOA 4G6TB 4O5VA 5D6FA 3KCCA 2F07A 4C30A 4CYCB 3GCMA 2IT0A 1BIAA 1W5SA 4YZEA 1OKRA 4M9ZA 1P4AA 3AQTA 3CF2A 2XKOA 2FA5A 3I4NJ 2XDNA 4JX5A 2CUEA 2MA3A 3MZYA 2NRAC 3ASOH 4UUSA 4C3IJ 2DXIA 3DKYA 2BV6A 2EFWA 5DUIA 4PK4A 2HDWA 3A2KA 2ZJ2A 1YW9A 3HUGA 1SD7A 1XPXA 3Q9VA 1JE8A 4EJTA 2VASA 1T56A 1JKRC 1X19A 5KNLA 1TWGJ 2Q2EB 5DEQA 2PFBA 3OYCA 3BTCA 2MLGA 3SXYA 3RZDJ 5CPRB 2MC3A 2F2EA 2RV8A 3DEWA 3DEUA 2CU7A 3LSIA 1FBUA 1QZEA 5HLTA 4IX7A 2E5ZA 2L7FP 3HBLA 2WB1N 3SFIA 5F1RA 2NOGA 3WTYC 2VKHA 3QP5A 3KZZA 3RYRA 2ESHA 2O0YA 1NG7A 4MIMA 3HOSA 3P9CA 3FMSA 1ZLKA 4XOPA 2XVCA 2IRFG 1IV6A 5F0CA 3R0AA 4HSTA 1NH3A 2XGEA 4IRGA 4LG0B 1D5YA 5LRRA 3E5XA 4DBRA 2FQ4A 3HIFA 4ENMA 4ITVA 4IVNA 3JRIA 4E7ZA 1LB2A 4E7JA 4PUSA 2OUMA 3FBNB 5J1UA 5J4VA 3HIMA 3H3UA 2MBFA 1B72A 1R1VA 1MMAA 1SFEA 1TWAJ 4M6XA 5JR3A 1BR4A 4P9FA 4UV9A 1YFHA 3GTGJ 3VVZA 3P9IA 4KN7X 5DYMA 3J81K 4XLCA 1A6IA 4KIGA 1P4WA 2VQHA 2HNHA 2PI0A 4OMYA 1QHGA 1W36D 4E7SA 4LLLA 1ZRCA 3ZRGA 2FUG2 3HKZA 2VIXA 1FY7A 2E7XA 1XB4A 2Y2ZA 3S2WA 3BPVA 2KIFA 5IP6A 3G1LA 3CMYA 2HOSA 5HS7A 2EBIA 2VQGA 4L0YB 1ENHA 4KMUX 4XLAA 2PZ9A 2K9SA 1LDJA 1XGNA 2M8GX 3L2CA 3R61A 5ICFA 4LB5A 1J09A 2LYCA 1BI3A 1VI0A 4A3EJ 1IC8A 3BG6A 1YRNB 2R7SA 3ZMVA 3H92A 3HEFA 1OMIA 3JREA 4A3BJ 2UZKA 1FYKA 2O8XA 3CP2A 3OYIA 3KEQA 3L2QA 3VW1A 3LWFA 1YS7A 2R5ZA 3S3MA 1D5VA 1QBJA 3IWFA 1N78A 1CGPA 4HDVA 5IOZA 1BN5A 3GXOA 4ZZDA 1YYVA 1U6GA 4BJTA 3G1OA 4DOZA 2W48A 4WK8F 2XDVA 1QPIA 1ZGWA 2UXPA 4M6VA 3KYDB 4ZJZA 4ESJA 3SQNA 4IXAA 4PJJA 2F6CA 1MMSA 2E7WA 2IGOA 2M1BA 4L5IA 1DU0A 2G7LA 3I71A 5FKMA 1HW5A 4S0HB 3F8NA 1AA7A 5DV5A 1VQOI 1MJ9A 1MNEA 5BMZA 2MABA 2ZCNA 3ZPLA 1IUFA 3OYKA 5HBUA 1DPRA 2GIZA 1SGMA 3KP6A 3E5UA 3AG4H 5FFXA 4C2TA 5HS9A 2Y0SN 2Y48A 3ANPA 4BGDA 2XB0X 4WF2A 3I64A 2EIKH 2LY1A 1MBJA 2NS8A 3V4GA 1I27A 2KIMA 4L5EA 2PBXA 3LL7A 1APLC 1N75A 2A5WA 2HKXA 2M87A 3DBLB 4UXNA 3H9QA 1PP8F 1FEXA 1JKQC 2A69F 3BOQA 4UNOA 1OYWA 2YU3A 3IRRA 3JTHA 4M9XA 3WTZA 2BVLA 3ABUA 4IL6C 5DM6F 1LUJB 2FJI1 2RVCA 1Y8QB 4BH9A 5B66C 2L9NA 1IN5A 4ZDOA 1X58A 3HTIA 2ZFWA 4RAFA 4BE2A 2DA5A 1T0FC 1YJ9I 3PFYA 2QBYA 5ICGA 4ZTFA 3C7JA 4CGRA 1A36A 4FETA 2RREA 2HYJA 2DMNA 2CG4A 2L0KA 3EPZA 2M0CA 2L4MA 3TO9A 5D18A 2QTQA 3FMQA 4XLHA 4I2OA 3KPHA 2DTRA 1PUFB 3G7RA 2NNYA 3RQ4A 1YX5A 3ZN0A 2HI3A 4WXDA 2LG4A 2ISYA 4HQEA 1W1WE 2EZHA 4CA0A 1RNLA 3B81A 1PP7U 3RIRA 5KAIC 4CO8A 3A0BC 4BHBA 2HGCA 2P8TA 4QLCU 1BI0A 2PMUA 2DA4A 2GOXB 3SHFA 4LIVA 2HDCA 3PO2J 3HDDA 3S14J 2H09A 1X1CA 2NAZA 2CWEA 2MLKA 1E17A 3SEZA 1LVKA 2YUSA 3E0JB 2JT1A 1BM9A 2ZOYA 4YFNF 2TCTA 1K79A 2HTJA 4CCJA 2ZO4A 4BXUA 5IY5H 2XV4S 5ILVA 2PMZA 2JTVA 4UUSB 1Z9CA 3ZP5A 3HPHA 2QYOA 4LD5A 5FKNA 2O03A 1ETKA 2VKDA 4L0ZB 2WWYA 2B7EA 2DPUA 4IHWA 4FASD 4JNNA 3RKWA 3CO6C 1FOWA 2IA1A 2IU5A 3EUAA 1W7PA 1VQ8I 3H1CA 3D1NI 2EA2A 1UAAA 2H6CA 4N9HA 3F6OA 2COMA 2VB6A 3CCQI 3F9KA 5EDNA 5L3BA 4BNCA 5FRMA 5ERIA 3ERED 3PUFA 3S16J 4CDGA 2DFIA 2BY2A 4ENJA 4Z6YA 3CUQA 5FGMA 1ITYA 3CWRA 2ICWG 4U9LA 3F6VA 3I4PA 5CVRA 1WZ2A 3ECOA 1ZQ3P 4IZZA 4XNFA 3V7RA 2JQ7A 2WY7Q 5GPCA 5CVJA 2NVYJ 1MBKA 2E1OA 4BAYA 2XRLA 4IRVA 3NWSA 1GXQA 3TKYA 2HEOA 3K6GA 2REKA 4M71A 5TGTA 1LFPA 2L4AA 2Q2EA 1QZYA 4LK0F 2Z5UA 4JX6A 5D5WB 3CUQC 4A5NA 2GA1A 5FKOA 4B43A 2QSFX 2XPVA 1JJ6C 2EV0A 2HQNA 3HC7A 3VYRB 3VB2A 3KZIC 1R5GA 4KA4A 1YW7A 1V5EA 3VEPA 4DZJA 2DG8A 2DT7B 2EK5A 1N77A 5FKLA 1XD7A 2DAOA 3LFUA 1LPQA 1UB9A 4EQQA 2O7OA 4L9TA 1ZGJA 5KK1A 2IPQX 3K1NA 2M5WA 5AIQA 5DD8A 2LKXA 3TMOA 4KICA 2VBYA 4GXOA 2BW3B 4RAGA 2E1MC 5K5QA 2BZTA 2AQEA 4H0EA 3VTIA 1L0OC 1ZAOA 1W7PD 2X6YA 1J2XA 4Y7NJ 2QENA 2KLOA 3ERMA 3GMEA 4XM3A 2VBZA 3G71I 5F27A 1FTTA 2E19A 2R7UA 3NWTA 5F0FA 5BS6A 1SMTA 2DI3A 4W97A 3VWBA 2XF7A 3OS2A 4ZYGA 3JRFA 3K9TA 4IO9F 4XORA 1FIAA 3ECHA 3U1KA 4DIQA 3OYGA 2V57A 3CC4I 5GP9A 2XAQA 2PN6A 2ZY9A 1IDZA 2BY1A 3GYHX 3OMYA 2CFXA 3QODA 2R5YA 1UHSA 1UJ8A 2DA2A 2EZLA 4DZPA 3SWHA 1OCPA 1IRZA 3GLLA 2QKOA 2KZVA 1IDYA 4HV5A 3VSKA 1NK3P 1ZHFA 1Y1VJ 3DKWA 1BOBA 1XSXA 4RGXA 3CJRB 2DQRA 1V4RA 1GT0C 1DGRM 3HG9A 5LLQA 3DPJA 2TDXA 3Q0VA 3BWGA 1XDSA 1B8IA 3CP8A 1Z0XA 1FTZA 1R36A 3HTUA 1ETYA 4G94A 3FXKA 3U21A 3ONQA 4HPQA 2DJNA 2G7GA 1TWHJ 3BDDA 1LKXA 1N25A 4BACA 4G6QA 4R79A 3CUQB 2K85A 3Q0WA 2CUZA 3GZIA 1WVRA 4JK1X 1MDMB 3S32A 2VKVA 1OJLA 3J7AY 4D0PA 1Y8RB 1POGA 2F5DA 3I59B 4IHTA 3M07A 4F93B 3QQAA 3R4KA 1KU7A 3T8RA 1BC7C 2VC1A 1VQKI 5LGUA 2ZXWH 4HEA2 3ZMDA 3WTSC 4A3JJ 2F5FA 4TV7A 2IS1A 4ACIA 3D5SC 4BDYA 4A0YA 2IA2A 4RGRA 5E8GA 1JUMA 1R9TJ 1R5ID 2LMDA 3BC8A 5ICCA 3HSEA 2R7XA 2ECBA 4DGWB 3OYLA 1VQLI 5C4XJ 2B1EA 2PFVA 3BG3A 4NB5A 2WGBA 2PX9A 3LAJA 2EPFA 3QPSA 1RC9A 3REOA 4V2GA 5IPAA 5FMPA 3W6KB 1WJBA 4RLFA 1R5HA 4ESBA 1RUNA 3K4KA 5L3GA 1F4KA 1I1SA 1B8IB 3AG3H 1MH3A 1MSEC 3KNWA 2G7HA 4XLPF 4ZYDA 4R1HA 3RH2A 3K4LA 2R7OA 3LQQA 3LSMA 4HBLA 2K3PA 1S7EA 2KHMA 4B8XA 3DLLF 2FNPA 4ZC3A 3BT9A 3E97A 1YIOA 4XBFA 5JI6A 3HRMA 2UXHA 4PXIA 2OTJI 3MQ0A 2CQNA 1Y0UA 3NRGA 1YOVB 3MKZA 2EIMH 2BEOA 2VXDA 5K7FA 1OCRH 2DG7A 2E35A 2KPMA 2NP5A 2EQRA 3FXOA 3CCJI 3PJRA 2F5VA 4ZYAA 1OCZH 2L54A 1W0UA 3RYPA 3R6SA 3GZ6A 3BROA 1ZH5A 3ZQHA 2ZNZA 5HNHA 2KL4A 3OL3A 2VUMJ 2HVSA 2GLOA 4C2UA 3CDHA 3C07A 2FU4A 4AD9A 5GPAA 4FISA 2O5RA 3KLNA 5E3NA 3NNRA 2BVMA 4A69C 5E3MA 3OY9A 1I39A 2HWVA 3PNYA 3BR6A 5F64A 4EJOA 3OYFA 4G7ZF 4PZJA 1Z3XA 1H89C 1S7AA 1R4NB 3CUOA 4ON0A 1DDNA 2R7FA 3GO5A 4HKUA 4UUTA 1UFMA 3M1CA 2W4SA 1HA8A 2DK5A 2CW8A 3RPQA 4OU0A 4A3LJ 2BW3A 3CJDA 2W00A 2B0LA 2Z2SB 3T1BA 5EFYA 4RMNA 3RPUD 5HAWA 2ZXJA 1TC3C 1RZ4A 3VDXA 4OIPF 4DYCA 2PQ8A 2V1DA 1P6RA 1JKPC 3C18A 3FHZA 4KT5C 2L01A 2VBWA 3JSJA 3L09A 5H20A 2KRHA 2OQRA 1X1DA 2G7UA 5HLGA 2Z1DA 4HLXA 5CVUA 2FE3A 3FM3A 3WTUC 1IN7A 3ZMSA 3FHNA 4NC7A 4Y17A 1QQIA 2NXNB 5D4SA 2L9VA 1IZ1A 1FP2A 2G7SA 2YVHA 3RTRA 3TQNA 1MBEA 3DTKA 3CC2I 2DW4A 1SD6A 4BBSJ 1OLTA 1GUUA 3NRVA 3MKWB 1AKHB 2HDDA 1H9TA 3FXMA 4G12A 1IGNA 4MK6A 1MMGA 1YX3A 2JVHA 1HBXG 1KONA 5FLXK 3BG9A 1T95A 3KIOA 5E3LA 5J40A 2JA7J 5EYRA 3QPLA 3QP6A 3J80K 1RESA 2H8WA 2OPTA 4E7IA 2DOEA 2XAFA 2BXZA 2QIBA 2E60A 5J8FA 4HQMA 4RDUA 1OCCH 1W5CC 2XIGA 3ZQLA 3FDYA 2E2JJ 2M0MA 2JRMA 2QQ8A 1JI8A 4MHGA 1KZHA 2XF6A 4MFEA 3WTXC 3GUDA 4A6EA 3HXLA 5B1BH 4A3MJ 1F1ZA 5L3DA 2OAZA 3PFIA 5L3FA 3N97A 5B3SH 2CH0A 2R7ZJ 3HRTA 4KIBA 3PM1A 2HOTA 3FZVA 4P9UA 4AIKA 2KRFA 1X1AA 3IKTA 5DCFA 4A3CJ 2QKMB 3RCOA 3DFGA 3A01A 5IP9J 4M3GA 3ZQIA 1HLVA 4Y33A 5J8CA 3MZ8A 5DD4A 2EINH 2R7DA 4RM3A 4XLEA 3GZ5A 2P4WA 1UELB 4U0VA 4B1RA 4I0BA 3HJEA 2L7KA 3LJLA 1KU9A 4IHXA 1LEBA 3SZGA 3A0HC 5BOXA 4J00A 5F08A 3EDPA 2L9SA 3BR1A 3MEXA 2ZFUA 3ZR8X 4BXFA 3C2GA 3LSHA 2XF5A 4BY1J 2PJPA 1S29A 3ZGKA 4EV0A 1UG2A 1SFUA 3BCAA 3G56A 4EM0B 1WI9A 4HZFA 4PJMA 3VIBA 1EA3A 2QEXI 2LBFA 4MTEA 3O3KA 1SFOJ 5LEKA 1O7FA 4AYBA 3IUOA 3VSLA 1VFCA 3DPTA 4J01A 2GXAA 5FHPA 4LGWA 1RKWA 3CMEI 3DLAA 2Z33A 3BZKA 2DT5A 3TP3A 1GV2A 4LLNA 1Z3YA 5M5WJ 4KWAA 4DNCA 4BHPA 2VQLA 3WTWC 3HUGB 3LMMA 3LSKA 4NQWA 3ZQ7A 4YEJA 2DCEA 1U78A 1BBYA 4G9YA 4I09A 4IRHA 3COAC 4HRIA 2GOMA 1MW7A 1XG1A 1LE8A 1WQ2A 2LF8A 2NOJB 3JRCA 3BNIA 3SZPA 2ID3A 1U3EM 3E6BA 4UHTA 1MSFC 4HF2A 2YVXA 2BXYA 3P9KA 2G9WA 3KP5A 2VE8A 5E79C 2ZNYA 3HM5A 4I01A 2Q8KA 3ML6A 2KRCA 5A2QK 2CS3A 2OA4A 2B3WA 3HOVJ 1FSHA 1ETOA 2OJED 4A93J 2Q24A 2QCOA 1I6XA 3OR1C 2DDBA 3OL4A 3NI7A 4HX8A 1VNDA 1JHFA 4HYEA 5HSZA 4IOCF 2Z9OA 1Z05A 1XC5A 1MMDA 1AHDP 4CSWA 1MKMA 1U0JA 4J19A 4M73A 4KITB 2R5ZB 5CLSA 2H6BA 2A07F 3DP7A 4F92B 3WHBA 4RB1A 2KP6A 1XN7A 4OINF 2J5PA 3CCRI 1JGGA 5F6FA 4E70A 2F4IA 2V6CA 5EEGA 3F8FA 2XKPA 4QWQA 5CVIA 3AG1H 4JYKA 3COLA 2DPDA 5IP7J 4BE1A 2ELKA 3L2WA 4GCVA 3EYIA 3QOEA 2JRTA 3LNQA 1JUPA 2GA2A 3DBHB 1OQYA 4HF0A 4RM2A 4HNUA 2XUBA 2XGDA 3K69A 4U0WA 2XASA 3I55I 4A3KJ 3L2RA 2ETHA 4I02A 4ESFA 1IJWC 1BR2A 1O57A 1OCOH 3V42A 2GAUA 1BW5A 3QPHA 3H3VK 4II2A 2FX0A 1HQCA 3LHQA 3S3OA 1BA5A 2A3SA 1OPCA 4E7HA 2FJ1A 2PMHA 3K1MA 1J59A 2OF7A 2G0EA 2DO7A 2IS6A 2K27A 1ZYRF 3CDLA 4D7MA 2AO9A 3KE2A 4F3QA 3K0LA 2ZSHB 1H8AC 4LLGF 2DMUA 3HGGA 5K7ZA 3IUVA 3QYEA 4HG2A 3QOPA 1S6LA 2MYSA 1G3YA 2L2OA 2YU9J 1Q1HA 3CCUI 3ULQB 1FP1D 3LFKA 2RNJA 4PJLA 2ZJQF 5L3EA 4DBQA 3CTAA 4LIUA 5CW8A 4XRSG 5FLXZ 3D0SA 4HF1A 4NC6A 3S1QJ 1TWCJ 2VN2A 1MD0A 2R0QC 3ROUA 3BR5A 3FK6A 3P5JA 2O6GE 1R00A 4M3BA 1X3WB 1HW1A 2HQ5A 4X6AJ 4S05A 2LOOA 3TL4X 2RQQA 4WCGA 3BJ6A 2K9NA 1WJAA 2K5CA 4R8HA 3UR3C 4B48A 2VT2A 4GCLA 2CSOA 5TJJA 5HVQC 2JPBA 3JSPA 1FIPA 4Y13A 2P0WA 4FHTA 1W0TA 2WTEA 2J5OA 1OFCX 3ZMTA 3PSIA 4JKZA 2K40A 1QVTA 1ETWA 5FFZA 3A01B 5IT3A 1D1BA 5IOYA 4MLOA 2JA6J 4CCLA 2STTA 1JUSA 2XROA 3ZCOA 4N0BA 4A3FJ 3S1NJ 1TW2A 3PQJA 4IEJA 1R58A 3KYLA 4CHUA 2UWMA 4XR6A 5A2QZ 2HS5A 3CQZJ 5GADJ 2FMLA 2BE5F 2QKLB 4BUPA 2QWTA 2XGXA 2YX4A 2LY2A 4AYBN 1XCVA 2ZXHA 2KFDA 2LC2A 1ETXA 3K10A 1IRGA 1IRFA 2C6YA 2IAIA 1QZZA 4Q47A 2AS5F 2K9QA 2ZOZA 4FT8A 4B44A 2IJLA 2UV1A 4PFPA 2M7AA 2E34A 2PG4A 4UDSA 1RR7A 2ID6A 2M4GA 1E3HA 5E1XA 3FWEA 5HODA 1U5TA 2F5EA 4AWXB 3JRBA 3BRUA 3J81Z 4PJNA 1RPWA 4OIOF 4Q48A 2NP3A 1TTYA 2D1HA 3FX3A 1K61A 3VW0A 3PQKA 1IO2A 5D4RA 1E3PA 1T6SA 4K2EA 3MZHA 3S17J 1XGOA 3JRAA 5J47A 2FOWA 3UNGC 5IT9Z 1P2FA 1VQ9I 2DT6A 5FD5A 4HA8A 5CYVA 3L9FA 1T8IA 4L9JA 5K7HA 3GLXA 3OYAA 2QSGX 2EFPA 2RDPA 3VFZA 2W1OA 4U7DA 3BR0A 5J4YA 1HKSA 3HOZJ 5C4JJ 1BIBA 1ON1A 1RKTA 4X1EA 2ACJA 2A5YB 3H9JA 3G4SI 1RRJA 2OCCH 3DU5A 3M8FA 3DF8A 3S3NA 3KKDA 2P6SA 3FISA 5FROA 3GX4X 2ZSIB 5BQTA 1WGXA 1IV8A 4BYYA 2OI8A 2DODA 4RB3C 3HTJA 5J3LA 2HR3A 4KFCA 1SD5A 5E20A 2UXUA 1D3YA 4QIWN 3W2AA 1S5LC 1LFUP 1XSDA 1PDNC 3HE0A 1MH4A 1I50J 3S1MJ 2Y31A 2M4KA 2LH9A 1VQ4I 1ZRDA 4M3EA 1RIOH 2K86A 4CICA 3O8HA 2DYRH 4KYWA 1YIJI 1VTNC 1QGPA 3TDZC 5J6XA 3TDUC 3JCUC 2K9MA 2TRTA 3HGYA 3RKYA 1WI3A 2ELHA 2VJ4A 4UVBA 1DGWY 5DCMA 2OD5A 4E6KG 2X1EA 2Y9ZA 3PUBA 3DWLE 1TL8A 4L5JA 2HOEA 3M4OJ 1YRNA 4S04A 3A4CA 4XKVA 5IYBJ 2OQGA 2IGKA 4IPAA 2HVRA 2V6EA 5F1JA 1ZLJA 1KYZA 2R7WA 1O3SA 2UUZA 4DJAA 2YSRA 3I0TA 3DV8A 4QPOA 4IKFA 3CCVI 3MNLA 1U5TB 1IAWA 3SFZA 3TP0A 3HL2A 2VONA 4L9VA 1ONVA 3C2HA 3MAJA 3J80Z 4Q5SF 5EGOB 3KP4A 3RDIA 3GZNB 1R49A 4U0YA 5TISC 1YS6A 2VOPA 1X4OA 3K70D 1V3FA 1V54H 3HOWJ 2LLKA 4YELA 3VODA 3V6GA 4PSXA 3GF2A 3V78A 2MC4A 5EEHA 2DA3A 2GZWA 1YI2I 4XOTA 3NAUA 3FM5A 4XMYA 6PAXA 1T98A 2MFZA 3U9GA 3LSRA 3N05A 4Y52J 5E8IA 2ME6A 1NK2P 4XL9A 2FNAA 3E7LA 1GVJA 5JHFA 4KMFA 5TRDA 4KISA 5BPDA 2NS7A 1NHAA 2OTLI 5HLIA 2LD5A 1O7LA 1XMXA 3IHUA 3M3YJ 2FOKA 1M1EB 2L9RA 3LA7A 3CCEI 5KCMA 3WU0A 2I8DA 2LVSA 3FF5A 1J0RA 1L3LA 2WAQN 1Z77A 1FYMA 5HOOA 1X1BA 1Z7LA 3OYNA 4B3AA 1I3AA 1IRXA 1O3QA 1R7JA 3NS4A 4YFXF 3ZQFA 1A04A 2V9PA 3P7NA 3QYBA 2X0LA 3GFIA 3FRQA 3BQYA 1ZR4A 2JMWA 2X48A 4OAZA 5AONA 2FMYA 4XQFA 2Y0SA 2BY0A 3KEOA 4AIJA 2ZMEA 4XRSA 4N4OB 2JJ7A 4WIBA 2XHKA 4Y15A 5LGNA 3KYCB 4JP0A 2STWA 4CH7A 4AUXA 3S93A 1XTAA 4C2MA 2W57A 3SZTA 3JRHA 2KIUA 1A5JA 4O3MA 1HDPA 2HVQA 2KZGA 1J7KA 3LOCA 3OIQA 4F91B 5E17F 1S3JA 2IP2A 3K2AA 3H0DA 1JT0A 1CF7B 3F8CA 4QTRA 3HHHA 4M6YA 2O9LA 2F4OB 3OSGA 1ZGAA 3GWZA 1FYLA 3MKYB 2R7RA 4BKXA 1ZTRA 3QPTA 2IBDA 2IEKA 2V1NA 1YHQI 2W24A 2HU9A 3PSFA 1ACIA 3W6VA 1FLIA 1S9HA 2X1CA 2M9HA 3EUHA 3F72A 2LY9A 2LK2A 3EUKL 4M72A 3ESWB 1KQ0A 2QQAA 2MG4A 3CMMA 4RGSA 2LP0A 2PJRA 1FT9A 2G3BA 3VW2A 3T0YA 1V5FA 1X3UA 4ICHA 2EZKA 3AQSA 2EA4A 1IF1A 1MNMC 4IQ4A 2JZYA 3F23A 2DA6A 2EV5A 1IXRC 1FMVA 5DDGA 2RGVA 3KZYA 3ISPA 2YR2A 2XSJC 4FTHA 3ON2A 5K1YA 3S15J 3FXQA 3DQVC 1Z6TA 3HKZN 1YJNI 3HTHA 4EJWA 2DYSH 1WJDA 1HC8A 2NS0A 5E1ZB 1Y6IA 3VVYA 5FD6A 1STZA 1MDMA 5CKTA 1HKTA 3KP3A 2GENA 1VQMI 2E5NA 2HZTA 3T8TA 2H8RA 3B6CA 4BQQA 2CRGA 4A3DJ 5EF6A 3I4MJ 2X9DA 2QLZA 2O3FA 4ZYHA 1D0XA 3C3WA 3GVAA 4HDUA 4EVIA 4OD4A 3ZMUA 1W5TA 3RKXA 1VZ0A 4DYRA 1ZKGA 2Z16A 2L7MP 2UXXA 2QF7A 3BCBA 3E3VA 3K8PC 2JSCA 2NNNA 3CESA 4I6ZA 2W82A 4MEXF 3QRFF 5JVTA 5LBQA 3DTIA 2YX7A 1ORKA 4ASNA 1ODDA 2AHQA 5JLXA 2QM3A 1BI2A 2AXLA 2DMPA 4EM2A 5HDNA 1TBXA 2ZMEB 1SFXA 2N8GA 2BGCA 1REPC 4L18B 2KKOA 2HQAA 2CUFA 2HKOA 2Y75A 4PCQA 2M30A 2VPLA 4D1QA 4HNTA 3VYUB 1WSUA 3AL0B 3CJQB 3M1EA 4GFBA 3RD3A 2F4MB 1ZR2A 4UVCA 3K4NA 5JFRA 3I59A 4IRIA 1LFBA 2XAGA 2HKUA 2MGQA 4PJ0C 4PFOA 4QPQA 3WGGA 1HSTA 1OYIA 2FQ3A 1Z1DA 4XIDA 2FSWA 5IYCJ 2HZDA 3RSNA 4AU7A 3I3LA 1ON2A 4HAMA 2XAUA 3W3CA 4RGUA 2X6OA 3HRSA 2WV0A 4F55A 2UXIA 3CRJA 3SJMA 2XPWA 3FIWA 4KIFA 4PGHA 1VF9A 5ED4A 1WFXA 2FEZA 2UXNA 3IH3A 4C3HJ 1XMKA 1T2KA 4NHJA 3OS0A 2WA0A 1O3RA 3F22A 2VLAA 2WAEA 5H6RA 5CXIA 1WCMJ 4AC0A 2IS2A 2MSYA 4EM1A 3ZOBA 2JN6A 2DLLA 1X1PA 2VBXA 1EF4A 4GFLA 4AM3A 4BQNA 3DU6A 2BYVE 4UY8I 3H35A 1HOMA 4CZZA 2ZCMA 2XAHA 1SC7A 1GDTA 2EILH 2IGMA 2W84A 2HYFA 3G1MA 3FK7A 1QA6A 2PLYA 4D9JA 3VOXA 1J9IA 1GLNA 1I5ZA 3KFWX 5DAJA 5EGOA 1USSA 1TWFJ 3BG7A 2XSDC 2RKHA 3B02A 1IN8A 2MH2A 5LD2C 3KETA 4NUBA 3GTMJ 3LAPA 1P7JA 2LR8A 4I7HA 2NX4A 2GM4A 2NVTJ 2Y69H 2CQQA 2IVMA 2A68F 3DKXA 2CW0F 3S1RJ 5LGTA 3Q5FA 1GXPA 1Z6RA 2VC0A 2DMQA 1T0FA 3WTVC 2B63J 3AL0C 1R1TA 3QAHA 3JAMZ 2OV7A 4FE7A 1TW3A 2RN7A 1FZPB 4CYCA 3H3ZA 4LG3A 4EJVA 2MH9A 2A6TA 2K3FA 4P5OA 1EV7A 1R4MB 1VQNI 1MMNA 2R7VA 2VXZA 1U2WA 2Z99A 4OD5A 2Q0OA 3H9GA 4GRIA 3IV5A 5K58A 1H88C 3SYTA 1W4MA 1PUEE 4KJZA 1EH7A 3TEDA 1LJ9A 1G8XA 2ZMEC 2V1UA 2WADA 1FWZA 1SAUA 5EEAA 1QU3A 4U7BA 1K6OA 2ZXIA 1BJZA 3GTKJ 3I5UA 2CV0A 1BI1A 2ZB9A 5E1WA 4N4NB 1H9GA 2GIVA 4MGRA 2K4BA 1YW8A 3I56I 2M7BA 1G3WA 4II3A 3OYHA 2KT0A 3IP4B 4AC6A 4FCYA 1UI5A 1ETQA 2A05A 1LDDA 3K2ZA 4XSXF 2R4GA 2LSOA 3M8EA 2OZUA 4RLQA 4CCMA 2HXIA 2QSHX 2XB5A 1U9NA 3OYBA 3LSJA 4HX7A 3I54A 1D8JA 4LMYA 4Q4ZF 3S2DJ 1KQ8A 2I5UA 3RJPA 4HV6A 1Z67A 5EZHA 1WH5A 2P7VB 3J7ZI 2ZC2A 3M9AA 2OU2A 3AAFA 3W6JB 4KUMA 2EFOA 3ABLH 2L3DA 1RETA 3LSTA 1P9QC 2DA1A 2HPIA 4ZDPA 3VYSB 4A0XA 4CZCA 2A6HF 3HHGA 3OWTA 4MFDA 3F21A 4YIIA 4BL0B 3PNTA 3BJAA 3AFHA 1X2NA 1LQ1A 4XICA 3IL2A 4QSHA 2FBKA 2ME0A 2M3AA 4IHVA 2QZ8A 2D6YA 1MBFA 5DS9A 3E7QA 3WG9A 5D8KB 4A6DA 1QO0D 5CXGA 1MNDA 1YO5C 1PUFA 1WPKA 4I0AA 4IJAA 2ZJPF 3WHCA 4HLYA 4OOIA 2EFQA 2VL8A 2E2HJ 2COBA 4MNUA 3Q9SA 2IS4A 1DU6A 4F52A 1LNWA 2QGUA 3VOEA 1R6RA 2CMPA 1I1GA 1FOYA 1G6NA 3K1PA 2O7TA 3GEZA 2OZ6A 4RAZA 3PASA 1IN6A 1VQ5I 2NVXJ 1FX7A 2I10A 1A31A 1EH8A 3C2BA 3WGHA 2XRNA 3K4MA 1GV5A 5FGLA 3JSOA 1WJ5A 4YIRX 4HNVA 3IRQA 2JA8J 2V9KA 2QA4I 4B4CA 1EJ9A 4D7NA 2DBBA 1KA8A 2LFBA 2VPRA 2V26A 2PJRB 5FRNA 4Y3OA 4EATA 4BQOA 3IH2A 1Y56A 2HFHA 1WJEA 2WC2A 1AOYA 3WE3A 3E1SA 1G3TA 2VJ5A 2CUJA 2LNBA 5C3EJ 5LHHA 5HNFA 1XMAA 5EZGA 3OYMA 4C2MJ 2CJJA 1ZREA 4PSWA 4BJ6C 4IHSA 3S8PA 4P55A 5GAHJ 2JPCA 4BU2A 2CFOA 5B1AH 4KN4X 4NDLA 4DYQA 3AKZA 1PVEA 1RR8C 2P6TA 2EH3A 1B72B 3I58A 4UUVA 4MQ9F 4LK1F 3OS1A 3OYEA 2WB1A 3G2BA 2X6WA 4H4KC 3GTQJ 3OIOA 2V7FA 4ZDLA 2XAJA 3VP5A 2GFNA 2EZIA 3TOAA 1FMWA 3G3ZA 1AU7A 5L3CA 5CQGA 3PPBA 1B6AA 3OR2C 2ELJA 3R60A 1NTCA 2KISA 3GBGA 3NQOA 3CCSI 3BHQA 3TO6A 4N9IA 4OMZA 1OYYA 1K7AA 1FBQA 4L9NA 2K7LA 1XS9A 1ZN2A 2VJIA 1EH6A 5H9TA 2LF7A 3HZJA 2M2EA 5K5RA 3CJNA 1F9NA 1BJAA 1A35A 5E18F 5FKKA 3ANGA 2Y0MA 2D1VA 3I9V2 3NARA 3WU1B 3T5XA 4Z2YA 3U2RA 3OYJA 1TNTA 4BEHB 2UXOA 4GYGA 4BE0A 1JJ8C 2DTZA 3O60A 2BHYA 4XRFA 2HOAA 4D5CA 3LWJA 5HDGA 1WWXA 3QU3A 5C4YA 3E6DA 3GFMA 1Z7UA 4XN0A 5LHIA 4IOAF 4AVZA 3F3XA 1J5YA 2DOFA 3M7GA 1F36A 3KX2A 1K4SA 4EEFG 2V4JC 1LVAA 2DA7A 3OOPA 2JA5J 1ZRFA 1JTYA 4BQAA 2EB7A 4UV8A 4CCOA 4ENNA 2CO5A 3WTTC 4KDPA 1P4XA 3MMYB 2RQPA 3A03A 5FLVA 3ELKA 5CQEA 2QBYB 2ECCA 2XC7A 1P92A 3PIPF 2R3SA 1BR1A 3LA3A 1IXCA 1OR7C 1DQUA 4OIQF 3CZ6A 5ICEA 4G8XA 1ZG3A 3IH4A 1CQTA 1DP7P 1QVUA 3ZQCA 3CCYA 4MEYF 4I76A 4MQVA 1UG0A 1Z91A 2LKPA 3E6MA 2KJBA 5D5XB 3O8GA 2DDAA 4LG0A 1D1AA 4AIHA 5GTIC 1XDUA 4ABZA 2H1LA 2HQRA 2LKSA 2RNGA 5D1RA 2VE9A 2BOLA 1K78B 2P5LC 1TLHB 2ZJRF 2L7ZA 2P5VA 5HS8A 1FPQA 4GCKA 2WAQA 4NNJA 4GFKA 3KP2A 2K9LA 2K02A 5DM7F 1XGSA 1LE8B 3CLQA 3CJTB 4RB2C 1SVLA 3TOBA 3JRDA 2M8EA 3Q3SA 2EJRA 3MKLA 3L7WA 1B9NA 3K70C 3ABMH 2W25A 3PO3J 1D0YA 3A1YA 3EQLF 2F48A 2VQCA 4EJUA 1O3TA 1TQIA 2VI6A 3N4MA 5EG0B 4XRMA 5AIPA 3OOUA 2D45A 2BY3A 2CQXA 3ZXSA 1YE9A 3BZ6A 4W1UA 4B47A 2LRDA 4G7HF 5C44J 4OWRB 2AXTC 2R7QA 1KQ9A 5ILUA 3SDGA 4GYIA 3H5NA 2RHAA 1GHCA 1IN4A 4JX4A 1JGSA 4HSRA 4MXMA 2X6XA 3H36A 2PEXA 5LFAA 4ZTJA 2OCEA 1HDDC 3EYYA 2FBIA 4GGGA 4MTDA 2YPRA 2DK8A 4CGZA 3LSGA 2GXBA 2VODA 4E7KA 3F8BA 1X4PA 4BXXJ 5DUKA 4Y4RA 3WODF 3BLYA 4A3IJ 3GTJJ 4U88A 1K6YA 1SD4A 4O6JA 2F5CA 3B73A 1VQPI 1UCRA 3BTIA 4M3FA 2GQQA 2ZCWA 2ZCXA 1T39A 4A0ZA 3KLOA 1RUOA 3IAS2 3CO7C 2ADUA 1ZARA 4I98B 4NN1A 4NQWB 4XKCA 4IHYA 2A2FX 2BBYA 5FO5A 4WWCA 3MWMA 3CF5F 5D19A 3OSFA 4V19K 1S72I 1B59A 4A3GJ 3DXJF 2X1DA 4U9NA 3BCGA 3MFKA 1BW6A 4JOMA 4M74A 2FRHA 1S7OA 2VT3A 1SAXA 2HTSA 1YG2A 2FBHA 3W2WA 2E1NA 2X51A 4CYDA 4WX9A 4FX0A 2RC4A 3QWLA 5HDKA 3E5QA 4BJ5C 3G73A 2DFHA 1TNSA 3V8LA 1U9OA 4ME9A 3L1PA 2P5KA 3GTLJ 3ABTA 1ZELA 2JUGA 2WY8Q 2NVUB 3DTEA 4PGGA 2E2IJ 1WHUA 2E1MB 3MCZA 4EGYA 3C1DA 1MJBA 1USTA 1G4DA 1FOXA 3BJBA 1QNTA 4XK4A 2NYXA 3H5RA 3FKIJ 4UVAA 1MZBA 3VOKA 2OBPA 3HTSB 4LOCA 4KT6A 1U8RA 1S8NA 2L5QA 1BL0A 2LREA 3ON4A 3F0CA 3IC7A 5EJCA 3KKCA 1E3OC 1ETVA 2R93J 2W85A 3TBIA 3IWZA 2Z3YA 3ZQGA 1TP4A 3FXLA 1IXSB 3DBRB 3IAM2 4FE4A 2CV1A 5FLMJ 3GEUA 3BQZA 4XN3A 1B1BA 1AWCA 4JQFA 3BR2A 1JXSA 3W2VA 3DPLC 5IYDJ 3KZ9A 3TW6A 2X4HA 2W53A 2WUIA 3V7SA 2V1XA 2M45A 4KNYA 1QHHD 3SDBA 1TT0A 2CYYA 2Q1ZB 3FXRA 1YITI 5EG0A 2OC6A 5D6EA 3HSFA 2Y9YA 1MBGA 2H27A 1KYWA 3CD6I 3HOTA 3VPRA 1ZK8A 3RPUA 4IF4A 1KU2A 5ILSA 1MGTA 1HW2A 3QU6A 3BR3A 4FX4A 2E36A 4YIFA 2R7TA 2RASA 3F1BA 1JKOC 5JHUA 3DEEA 3K4BA 1B4AA 1GVDA 5LHGA 3EUPA 2P81A 1G59A 3NEUA 3U1DA 1TQMA 1UHWA 3TGNA 5M3FJ 4EMSA 1WRJA 2ZKZA 3L00A 1U5TC 3EGQA 3S5RA 2JK3A 3BY6A 2PBIA 2H94A 5BPIA 3PNVA 2CGPA 2WAFA 3HYIA 1R23A 3CMAI 3E6CC 4AF5A 5M5XJ 1SMYF 3ZMZA 3Q0UA 2B9SA 1Y0NA 2ZBKA 3NPIA 2HPMA 3OV8A 4RS8A 4DQ2A 3VYTB 2Y30A 1AKHA 2CV2A 1B9MA 1D0ZA 1ZG5A 3S2HJ 4OIRF 2KDOA 3ASNH 4XLNF 4JL3A 4GDFA 3VUQA 3CDIA 5DCMB 3M8JA 2WBMA 3DCFA 3AG2H 3V7CA 1X3ZB 5H6QA 2IXSA 3GFLA 5JVGF 2CW7A 1YTYA 1XX5A 1U8BA 1JTXA 3TW7A 1WJCA 2FD5A 2D2WA 1IW7F 4M3DA 4ZZLA 5IT9K 1DP3A 4U87A 2KQRA 2A6EF 4PDKA 3WU2C 4A5MA 3T6NA 4MO7A 4E7LA 4CCNA 2CQ7A 1OR7A 1SVMA 2IA0A 5DTDA 1XSVA 2X85A 1Z21A 4L62A 1C0WA 4JBAA 3P9TA 3F8MA 1G2HA 2O61A 3K7AJ 4EGZA 3HRUA 5B5EC 4CXFA 4E4HA 1QPMA 4M9SA 1UZCA 4C3JJ 2GXGA 2K4JA 3JAMK 1PJRA 4BEHA 4F7ZA 1W36C 2R92J 1V55H 1V5GA 2V79A 5D8LB 1WJFA 4A2UA 2EV6A 1K4TA 3BZCA 2DQLA 1P7IA 1J75A 2KMUA 5M5YJ 1K78A 2EFNA 2JSPA 2QQBA 4NELA 2VOOA 1HSJA 2KDZA 1YQAA 1Y39A 3ZN1A 3GTOJ 1CF7A 4LJZF 1FBSA 2DN0A 1FOKA 4AVPA 4FQGA 3SEQA 2QUFA 5LEJA 3FBIB 1SVOA 3FXUA 1KGSA 1IG7A 3HOUJ 4ETSA 1MIJA 5D5VB 2ESNA 3BPXA 2MW8A 1XGMA 1IUYA 1ERDA 3KEYA 1Q1VA 2XPUA 2OERA 4NC8A 4B09A 3VVXA 3GW2A 2KIQA 4C9YA 4YFKF 1SANA 4D5FA 2EIJH 3I53A 5AQCA 2IGNA 5KHDA 4RBOA 3HOYJ 2YVEA 1OISA 3ZQQA 1T33A 2RAEA 3ABKH 1TQPA 2GWRA 3IKVA 1F5TA 2LBFB 4LFUA 1NG6A 2LDUA 1HCRA 3RQIA 5J1RA 3RZOJ 4BHCA 1VQ7I 5D5UB 3QBMA 3CLOA 4OAYA 2H1KA 4ZH4F 4CUGA 3GFJA 2AQFA 5FJ8J 1R71A 1ULYA 3LQRA 5H2FC 5E3OA 5GTHC 1YJWI 3OIPA 1MBHA 2JWTA 2MD0A 2XGCA 2YS9A 3K4CA 1HXDA 5F0HA 3PIOF 5J1YA 3O2PE 2DJIA 4ANJA 1I3QJ 1X2MA 1ZG1A 3FXJA 1UI6A 3K4JA 1UHMA 3B6AA 4HOBA 1YLFA 2HYGD 5KAFC 1D8KA 2CQKA 2P7CB 4A12A 1D1CA 2D5VA 3QYFA 3WGIA 3L2VA 4HW0A 1G3SA 2WV1A 5BNGA 1PYVA 2VKEA 4LB6B 3H0GJ 3WE2A 2JVGA 4UB6C 2DU9A 1DUXC 4ENKA 3HSRA 3D5LA 4BBRJ 1JHHA 2BHZA 2EWNA 3CCMI 4P96A 2JA2A 3BP8A 4NBQA 1TT5B 4XKBA 5M3MJ
chains in the Genus database with same CATH topology
3GTPJ 2I10A 5HODA 3JRBA 2R5YA 1UHSA 2DA2A 2EZLA 3C2BA 4DZPA 3BRUA 1RPWA 1WH7A 1GV5A 2NVQJ 2NP3A 1OCPA 1IRZA 1F43A 4V2FA 5F04A 1K61A 3VW0A 4HNVA 2JA8J 2QKOA 4B4CA 4DW6A 4D7NA 1IDYA 2VPRA 2GBYA 2LFBA 3MVPA 3JRAA 1NK3P 3HB9A 1Y1VJ 3IH2A 1O4XA 1GT0C 5K7HA 3DPJA 5C3EJ 3Q0VA 1I6HJ 1B8IA 3UKGA 1Z0XA 1FTZA 5EZGA 1ETYA 2PMZN 4C2MJ 2CJJA 3BTJA 3BR0A 1UMQA 3JR9A 2DJNA 5C4JJ 3HOZJ 3HOXJ 2G7GA 1TWHJ 1RKTA 4X1EA 4NDLA 3HTAA 4DYQA 2EH3A 4GCTA 3Q0WA 3KKDA 3FISA 3GZIA 1B72B 1WGXA 2VKVA 1OJLA 3BTLA 3GTQJ 2OI8A 3OIOA 3HTJA 5J3LA 1JT6A 3VP5A 9ANTA 2GFNA 2EZIA 1POGA 2R5YB 1AU7A 2UXUA 4QIWN 2DMTA 3PPBA 3QQAA 1HF0A 1LFUP 3HE0A 1NTCA 3GBGA 1MH4A 1I50J 3A02A 3BHQA 3S1MJ 2Y31A 2M34A 1QRYA 4A3JJ 3JRGA 4ACIA 3LSPA 4M3EA 3O8HA 5JLWA 2LTPA 1XS9A 1JUMA 1R9TJ 5H9TA 2M2EA 3MN2A 3RKQA 1K83J 2ECBA 5FKKA 3ANGA 5C4XJ 3NARA 2TRTA 3HGYA 3BG3A 2WGBA 1WI3A 2UXOA 3BG5A 3QPSA 2Y9ZA 4V2GA 1JJ8C 2DTZA 5IPAA 2FBQA 3NXCA 3O60A 5FMPA 2HOAA 4D5CA 2HYTA 3LWJA 2HXOA 1Y1WJ 1YRNA 3M4OJ 1B8IB 1MH3A 1MSEC 2O8KA 5IYBJ 3KNWA 2QOPA 3RH2A 5C4YA 1FJLA 4BY7J 1OCTC 3QKXA 5F1JA 1F36A 4EEFG 1S7EA 2F07A 2DA7A 4CYCB 2JA5J 3BT9A 4YZEA 1JTYA 3AQTA 3PASA 2UXHA 4PXIA 3I4NJ 2XDNA 3A03A 4JX5A 3MNLA 2CUEA 3NRGA 5FLVA 5K7FA 3TP0A 4UUSA 4C3IJ 2ECCA 2NP5A 2EQRA 5EGOB 1W0UA 3HOWJ 2LLKA 3IH4A 1CQTA 1QVUA 1T56A 1JKRC 3V6GA 3ZQHA 3ZQCA 3V78A 1TWGJ 2DA3A 3CCYA 4I76A 3BTCA 2VUMJ 3NAUA 2GLOA 3RZDJ 3C07A 3O8GA 4FISA 5GPAA 3LSRA 4Y52J 5E3NA 3NNRA 3DEWA 4A69C 5E3MA 2CU7A 2ME6A 1NK2P 4ABZA 3BR6A 3E7LA 1H89C 2L7FP 3HBLA 5D1RA 2WB1N 3SFIA 2NOGA 4HKUA 4UUTA 2NS7A 2L7ZA 4GCKA 4MIMA 4GFKA 2LD5A 4A3LJ 3CJDA 3M3YJ 1LE8B 5EFYA 2L9RA 1IV6A 5F0CA 5HAWA 1TC3C 2XGEA 2LVSA 1D5YA 3JRDA 2WAQN 1Z77A 4DYCA 1JKPC 3Q3SA 3MKLA 2FQ4A 4B3AA 3JRIA 3JSJA 3PO3J 3ZQFA 3FRQA 5J1UA 3BQYA 1ZR4A 2JMWA 2VI6A 2X48A 5EG0B 4XRMA 3HIMA 3OOUA 2CQXA 4XRSA 1B72A 2JJ7A 1TWAJ 4W1UA 3GTGJ 4JP0A 3VVZA 5C44J 4AUXA 3SDGA 1A6IA 3JRHA 1A5JA 2RHAA 1HDPA 4JX4A 3LOCA 5FGLA 2G7SA 2YVHA 4MXMA 3K2AA 1JT0A 1HDDC 4QTRA 1MBEA 2O9LA 3OSGA 2Y2ZA 3LSGA 4BBSJ 4BXXJ 5IP6A 4BKXA 3G1LA 1GUUA 1AKHB 4A3IJ 3GTJJ 1ZTRA 3CMYA 2HDDA 4G12A 2IBDA 2HOSA 2IEKA 2EBIA 1IGNA 1ENHA 4MK6A 2PZ9A 3W6VA 2K9SA 3BTIA 4M3FA 3BG9A 2M8GX 2M9HA 2ZCXA 2LY9A 5E3LA 2LK2A 2JA7J 5EYRA 3QPLA 2MG4A 1RESA 2LP0A 4A3EJ 1VI0A 1IC8A 2OPTA 1YRNB 2G3BA 3VW2A 3HEFA 3JREA 2QIBA 4A3BJ 4ICHA 4NN1A 4RDUA 2EZKA 4IHYA 3AQSA 5D19A 3ZQLA 3VW1A 3OSFA 2E2JJ 2R5ZA 1MNMC 4A3GJ 3BCGA 1BW6A 4MFEA 2DA6A 5IOZA 4A3MJ 3G1OA 2W48A 1QPIA 4FTHA 1ZGWA 2UXPA 3ON2A 4M6VA 2R7ZJ 3S15J 3PM1A 3HKZN 2HOTA 1U9OA 3HTHA 3L1PA 4ME9A 3GTLJ 3VVYA 1DU0A 4A3CJ 2E2IJ 2G7LA 3A01A 5FKMA 5IP9J 4M3GA 3ZQIA 1HLVA 4S0HB 2GENA 3BJBA 4XK4A 2ZCNA 3FKIJ 1IUFA 2H8RA 3B6CA 5HBUA 2CRGA 4A3DJ 5EF6A 3I4MJ 2X9DA 3VOKA 1SGMA 4LOCA 4B1RA 1BL0A 3ON4A 3F0CA 2Y0SN 3LJLA 4IHXA 3ANPA 2XB0X 4DYRA 3KKCA 1ZKGA 1E3OC 2L7MP 2QF7A 1ETVA 1MBJA 2NS8A 3BR1A 5F08A 2R93J 4I6ZA 3ZQGA 4L5EA 2PBXA 1ORKA 1APLC 5JLXA 2AHQA 4BY1J 4FE4A 2DMPA 5FLMJ 3GEUA 3BQZA 1UG2A 3G56A 2N8GA 3BR2A 3VIBA 1FEXA 5IYDJ 3KZ9A 3TW6A 2W53A 1JKQC 2CUFA 2WUIA 1SFOJ 1VFCA 4GFBA 3RD3A 5EG0A 1ZR2A 5FHPA 3HTIA 1X58A 2Y9YA 1MBGA 1RKWA 2DA5A 1LFBA 3TP3A 3VPRA 1ZK8A 2HKUA 1GV2A 2MGQA 5M5WJ 4KWAA 4XIDA 3BR3A 5IYCJ 4CGRA 2HYJA 2DMNA 2RASA 3F1BA 1JKOC 2L0KA 1U78A 2M0CA 2X6OA 1XG1A 1LE8A 1GVDA 5D18A 2UXIA 2P81A 2QTQA 3SJMA 2XPWA 3FIWA 3CRJA 3EUPA 3JRCA 3S17J 3BNIA 2ID3A 1PUFB 5M3FJ 1VF9A 1MSFC 3G7RA 4C3HJ 3IH3A 2HI3A 2EZHA 3EGQA 3S5RA 2JK3A 5CXIA 1WCMJ 4AC0A 2MSYA 3B81A 3ZOBA 2JN6A 3HM5A 1EF4A 4GFLA 4AF5A 5M5XJ 3HOVJ 1ETOA 3Q0UA 4A93J 2Q24A 1HOMA 2QCOA 2DA4A 2ZCMA 3NPIA 1GDTA 3PO2J 3HDDA 3NI7A 3S14J 3G1MA 1VNDA 3FK7A 2Y30A 1AKHA 3VOXA 3S2HJ 5HSZA 5DAJA 1XC5A 5EGOA 1AHDP 1TWFJ 2YUSA 2XSDC 4JL3A 4J19A 3VUQA 2R5ZB 2ZOYA 3WHBA 2TCTA 3DCFA 1JGGA 3GTMJ 1P7JA 2LR8A 1U8BA 2NX4A 1JTXA 3TW7A 4UUSB 2GM4A 2NVTJ 2CQQA 2FD5A 3S1RJ 4JYKA 4M3DA 5FKNA 3COLA 1ETKA 5IP7J 2DMQA 2ELKA 2B63J 3T6NA 4MO7A 4IHWA 4JNNA 5DTDA 3LNQA 1JUPA 4FE7A 4L62A 2IU5A 3P9TA 4CYCA 1G2HA 3K7AJ 3D1NI 2XGDA 4A3KJ 1IJWC 5EDNA 4C3JJ 3IV5A 1BW5A 3H3VK 2R92J 2FX0A 1H88C 3S16J 5K58A 3LHQA 3TEDA 1ITYA 3CWRA 1BA5A 1P7IA 2FJ1A 5M5YJ 5EEAA 1ZQ3P 2OF7A 2G0EA 2KDZA 4NELA 3GTOJ 3CDLA 1BJZA 4D7MA 2AO9A 2DN0A 3GTKJ 5GPCA 2ZB9A 2NVYJ 1MBKA 2E1OA 2XRLA 1H8AC 2DMUA 2KT0A 1IG7A 3HGGA 4AC6A 5K7ZA 4FCYA 3HOUJ 1UI5A 3IUVA 1ETQA 2REKA 2YU9J 2MW8A 2OERA 1Q1VA 2XPUA 4JX6A 2HXIA 3VVXA 2XB5A 5CW8A 1SANA 4D5FA 4XRSG 5FKOA 1U9NA 2XPVA 1JJ6C 3LSJA 5AQCA 3S1QJ 1TWCJ 4RBOA 3HOYJ 2YVEA 2R0QC 1T33A 2RAEA 3BR5A 3FK6A 4DZJA 3S2DJ 1HCRA 4M3BA 2DG8A 5EZHA 3RQIA 1WH5A 5J1RA 5FKLA 3RZOJ 2HQ5A 4X6AJ 3QBMA 2K9NA 2O7OA 1RETA 2H1KA 2DA1A 5FJ8J 4GCLA 2LKXA 4MFDA 5E3OA 1FIPA 1X2NA 1MBHA 2JWTA 4XICA 2XGCA 1W0TA 1OFCX 4QSHA 4JKZA 2ME0A 2YS9A 2K40A 1QVTA 5F0HA 4IHVA 1ETWA 3A01B 4Y7NJ 1MBFA 5IOYA 4MLOA 5J1YA 5DS9A 2JA6J 2D6YA 1I3QJ 1X2MA 1JUSA 3E7QA 1UI6A 4A3FJ 5F27A 1FTTA 3S1NJ 5CXGA 3B6AA 1PUFA 4IEJA 2E19A 1WPKA 5F0FA 3CQZJ 3WHCA 4W97A 2D5VA 2QWTA 3JRFA 4AYBN 2COBA 2E2HJ 2WV1A 1ETXA 5BNGA 2VKEA 3H0GJ 1DU6A 2IAIA 1FIAA 2K9QA 2V57A 4BBRJ 5GP9A 2O7TA 4UDSA 1RR7A 2ID6A 5M3MJ 2DG7A 2ZOZA 2GUHA 1IDZA 2NVXJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTP J;  2I10 A;  5HOD A;  3JRB A;  2R5Y A;  1UHS A;  2DA2 A;  2EZL A;  3C2B A;  4DZP A;  3BRU A;  1RPW A;  1WH7 A;  1GV5 A;  2NVQ J;  2NP3 A;  1OCP A;  1IRZ A;  1F43 A;  4V2F A;  5F04 A;  1K61 A;  3VW0 A;  4HNV A;  2JA8 J;  2QKO A;  4B4C A;  4DW6 A;  4D7N A;  1IDY A;  2VPR A;  2GBY A;  2LFB A;  3MVP A;  3JRA A;  1NK3 P;  3HB9 A;  1Y1V J;  3IH2 A;  1O4X A;  1GT0 C;  5K7H A;  3DPJ A;  5C3E J;  3Q0V A;  1I6H J;  1B8I A;  3UKG A;  1Z0X A;  1FTZ A;  5EZG A;  1ETY A;  2PMZ N;  4C2M J;  2CJJ A;  3BTJ A;  3BR0 A;  1UMQ A;  3JR9 A;  2DJN A;  5C4J J;  3HOZ J;  3HOX J;  2G7G A;  1TWH J;  1RKT A;  4X1E A;  4NDL A;  3HTA A;  4DYQ A;  2EH3 A;  4GCT A;  3Q0W A;  3KKD A;  3FIS A;  3GZI A;  1B72 B;  1WGX A;  2VKV A;  1OJL A;  3BTL A;  3GTQ J;  2OI8 A;  3OIO A;  3HTJ A;  5J3L A;  1JT6 A;  3VP5 A;  9ANT A;  2GFN A;  2EZI A;  1POG A;  2R5Y B;  1AU7 A;  2UXU A;  4QIW N;  2DMT A;  3PPB A;  3QQA A;  1HF0 A;  1LFU P;  3HE0 A;  1NTC A;  3GBG A;  1MH4 A;  1I50 J;  3A02 A;  3BHQ A;  3S1M J;  2Y31 A;  2M34 A;  1QRY A;  4A3J J;  3JRG A;  4ACI A;  3LSP A;  4M3E A;  3O8H A;  5JLW A;  2LTP A;  1XS9 A;  1JUM A;  1R9T J;  5H9T A;  2M2E A;  3MN2 A;  3RKQ A;  1K83 J;  2ECB A;  5FKK A;  3ANG A;  5C4X J;  3NAR A;  2TRT A;  3HGY A;  3BG3 A;  2WGB A;  1WI3 A;  2UXO A;  3BG5 A;  3QPS A;  2Y9Z A;  4V2G A;  1JJ8 C;  2DTZ A;  5IPA A;  2FBQ A;  3NXC A;  3O60 A;  5FMP A;  2HOA A;  4D5C A;  2HYT A;  3LWJ A;  2HXO A;  1Y1W J;  1YRN A;  3M4O J;  1B8I B;  1MH3 A;  1MSE C;  2O8K A;  5IYB J;  3KNW A;  2QOP A;  3RH2 A;  5C4Y A;  1FJL A;  4BY7 J;  1OCT C;  3QKX A;  5F1J A;  1F36 A;  4EEF G;  1S7E A;  2F07 A;  2DA7 A;  4CYC B;  2JA5 J;  3BT9 A;  4YZE A;  1JTY A;  3AQT A;  3PAS A;  2UXH A;  4PXI A;  3I4N J;  2XDN A;  3A03 A;  4JX5 A;  3MNL A;  2CUE A;  3NRG A;  5FLV A;  5K7F A;  3TP0 A;  4UUS A;  4C3I J;  2ECC A;  2NP5 A;  2EQR A;  5EGO B;  1W0U A;  3HOW J;  2LLK A;  3IH4 A;  1CQT A;  1QVU A;  1T56 A;  1JKR C;  3V6G A;  3ZQH A;  3ZQC A;  3V78 A;  1TWG J;  2DA3 A;  3CCY A;  4I76 A;  3BTC A;  2VUM J;  3NAU A;  2GLO A;  3RZD J;  3C07 A;  3O8G A;  4FIS A;  5GPA A;  3LSR A;  4Y52 J;  5E3N A;  3NNR A;  3DEW A;  4A69 C;  5E3M A;  2CU7 A;  2ME6 A;  1NK2 P;  4ABZ A;  3BR6 A;  3E7L A;  1H89 C;  2L7F P;  3HBL A;  5D1R A;  2WB1 N;  3SFI A;  2NOG A;  4HKU A;  4UUT A;  2NS7 A;  2L7Z A;  4GCK A;  4MIM A;  4GFK A;  2LD5 A;  4A3L J;  3CJD A;  3M3Y J;  1LE8 B;  5EFY A;  2L9R A;  1IV6 A;  5F0C A;  5HAW A;  1TC3 C;  2XGE A;  2LVS A;  1D5Y A;  3JRD A;  2WAQ N;  1Z77 A;  4DYC A;  1JKP C;  3Q3S A;  3MKL A;  2FQ4 A;  4B3A A;  3JRI A;  3JSJ A;  3PO3 J;  3ZQF A;  3FRQ A;  5J1U A;  3BQY A;  1ZR4 A;  2JMW A;  2VI6 A;  2X48 A;  5EG0 B;  4XRM A;  3HIM A;  3OOU A;  2CQX A;  4XRS A;  1B72 A;  2JJ7 A;  1TWA J;  4W1U A;  3GTG J;  4JP0 A;  3VVZ A;  5C44 J;  4AUX A;  3SDG A;  1A6I A;  3JRH A;  1A5J A;  2RHA A;  1HDP A;  4JX4 A;  3LOC A;  5FGL A;  2G7S A;  2YVH A;  4MXM A;  3K2A A;  1JT0 A;  1HDD C;  4QTR A;  1MBE A;  2O9L A;  3OSG A;  2Y2Z A;  3LSG A;  4BBS J;  4BXX J;  5IP6 A;  4BKX A;  3G1L A;  1GUU A;  1AKH B;  4A3I J;  3GTJ J;  1ZTR A;  3CMY A;  2HDD A;  4G12 A;  2IBD A;  2HOS A;  2IEK A;  2EBI A;  1IGN A;  1ENH A;  4MK6 A;  2PZ9 A;  3W6V A;  2K9S A;  3BTI A;  4M3F A;  3BG9 A;  2M8G X;  2M9H A;  2ZCX A;  2LY9 A;  5E3L A;  2LK2 A;  2JA7 J;  5EYR A;  3QPL A;  2MG4 A;  1RES A;  2LP0 A;  4A3E J;  1VI0 A;  1IC8 A;  2OPT A;  1YRN B;  2G3B A;  3VW2 A;  3HEF A;  3JRE A;  2QIB A;  4A3B J;  4ICH A;  4NN1 A;  4RDU A;  2EZK A;  4IHY A;  3AQS A;  5D19 A;  3ZQL A;  3VW1 A;  3OSF A;  2E2J J;  2R5Z A;  1MNM C;  4A3G J;  3BCG A;  1BW6 A;  4MFE A;  2DA6 A;  5IOZ A;  4A3M J;  3G1O A;  2W48 A;  1QPI A;  4FTH A;  1ZGW A;  2UXP A;  3ON2 A;  4M6V A;  2R7Z J;  3S15 J;  3PM1 A;  3HKZ N;  2HOT A;  1U9O A;  3HTH A;  3L1P A;  4ME9 A;  3GTL J;  3VVY A;  1DU0 A;  4A3C J;  2E2I J;  2G7L A;  3A01 A;  5FKM A;  5IP9 J;  4M3G A;  3ZQI A;  1HLV A;  4S0H B;  2GEN A;  3BJB A;  4XK4 A;  2ZCN A;  3FKI J;  1IUF A;  2H8R A;  3B6C A;  5HBU A;  2CRG A;  4A3D J;  5EF6 A;  3I4M J;  2X9D A;  3VOK A;  1SGM A;  4LOC A;  4B1R A;  1BL0 A;  3ON4 A;  3F0C A;  2Y0S N;  3LJL A;  4IHX A;  3ANP A;  2XB0 X;  4DYR A;  3KKC A;  1ZKG A;  1E3O C;  2L7M P;  2QF7 A;  1ETV A;  1MBJ A;  2NS8 A;  3BR1 A;  5F08 A;  2R93 J;  4I6Z A;  3ZQG A;  4L5E A;  2PBX A;  1ORK A;  1APL C;  5JLX A;  2AHQ A;  4BY1 J;  4FE4 A;  2DMP A;  5FLM J;  3GEU A;  3BQZ A;  1UG2 A;  3G56 A;  2N8G A;  3BR2 A;  3VIB A;  1FEX A;  5IYD J;  3KZ9 A;  3TW6 A;  2W53 A;  1JKQ C;  2CUF A;  2WUI A;  1SFO J;  1VFC A;  4GFB A;  3RD3 A;  5EG0 A;  1ZR2 A;  5FHP A;  3HTI A;  1X58 A;  2Y9Y A;  1MBG A;  1RKW A;  2DA5 A;  1LFB A;  3TP3 A;  3VPR A;  1ZK8 A;  2HKU A;  1GV2 A;  2MGQ A;  5M5W J;  4KWA A;  4XID A;  3BR3 A;  5IYC J;  4CGR A;  2HYJ A;  2DMN A;  2RAS A;  3F1B A;  1JKO C;  2L0K A;  1U78 A;  2M0C A;  2X6O A;  1XG1 A;  1LE8 A;  1GVD A;  5D18 A;  2UXI A;  2P81 A;  2QTQ A;  3SJM A;  2XPW A;  3FIW A;  3CRJ A;  3EUP A;  3JRC A;  3S17 J;  3BNI A;  2ID3 A;  1PUF B;  5M3F J;  1VF9 A;  1MSF C;  3G7R A;  4C3H J;  3IH3 A;  2HI3 A;  2EZH A;  3EGQ A;  3S5R A;  2JK3 A;  5CXI A;  1WCM J;  4AC0 A;  2MSY A;  3B81 A;  3ZOB A;  2JN6 A;  3HM5 A;  1EF4 A;  4GFL A;  4AF5 A;  5M5X J;  3HOV J;  1ETO A;  3Q0U A;  4A93 J;  2Q24 A;  1HOM A;  2QCO A;  2DA4 A;  2ZCM A;  3NPI A;  1GDT A;  3PO2 J;  3HDD A;  3NI7 A;  3S14 J;  3G1M A;  1VND A;  3FK7 A;  2Y30 A;  1AKH A;  3VOX A;  3S2H J;  5HSZ A;  5DAJ A;  1XC5 A;  5EGO A;  1AHD P;  1TWF J;  2YUS A;  2XSD C;  4JL3 A;  4J19 A;  3VUQ A;  2R5Z B;  2ZOY A;  3WHB A;  2TCT A;  3DCF A;  1JGG A;  3GTM J;  1P7J A;  2LR8 A;  1U8B A;  2NX4 A;  1JTX A;  3TW7 A;  4UUS B;  2GM4 A;  2NVT J;  2CQQ A;  2FD5 A;  3S1R J;  4JYK A;  4M3D A;  5FKN A;  3COL A;  1ETK A;  5IP7 J;  2DMQ A;  2ELK A;  2B63 J;  3T6N A;  4MO7 A;  4IHW A;  4JNN A;  5DTD A;  3LNQ A;  1JUP A;  4FE7 A;  4L62 A;  2IU5 A;  3P9T A;  4CYC A;  1G2H A;  3K7A J;  3D1N I;  2XGD A;  4A3K J;  1IJW C;  5EDN A;  4C3J J;  3IV5 A;  1BW5 A;  3H3V K;  2R92 J;  2FX0 A;  1H88 C;  3S16 J;  5K58 A;  3LHQ A;  3TED A;  1ITY A;  3CWR A;  1BA5 A;  1P7I A;  2FJ1 A;  5M5Y J;  5EEA A;  1ZQ3 P;  2OF7 A;  2G0E A;  2KDZ A;  4NEL A;  3GTO J;  3CDL A;  1BJZ A;  4D7M A;  2AO9 A;  2DN0 A;  3GTK J;  5GPC A;  2ZB9 A;  2NVY J;  1MBK A;  2E1O A;  2XRL A;  1H8A C;  2DMU A;  2KT0 A;  1IG7 A;  3HGG A;  4AC6 A;  5K7Z A;  4FCY A;  3HOU J;  1UI5 A;  3IUV A;  1ETQ A;  2REK A;  2YU9 J;  2MW8 A;  2OER A;  1Q1V A;  2XPU A;  4JX6 A;  2HXI A;  3VVX A;  2XB5 A;  5CW8 A;  1SAN A;  4D5F A;  4XRS G;  5FKO A;  1U9N A;  2XPV A;  1JJ6 C;  3LSJ A;  5AQC A;  3S1Q J;  1TWC J;  4RBO A;  3HOY J;  2YVE A;  2R0Q C;  1T33 A;  2RAE A;  3BR5 A;  3FK6 A;  4DZJ A;  3S2D J;  1HCR A;  4M3B A;  2DG8 A;  5EZH A;  3RQI A;  1WH5 A;  5J1R A;  5FKL A;  3RZO J;  2HQ5 A;  4X6A J;  3QBM A;  2K9N A;  2O7O A;  1RET A;  2H1K A;  2DA1 A;  5FJ8 J;  4GCL A;  2LKX A;  4MFD A;  5E3O A;  1FIP A;  1X2N A;  1MBH A;  2JWT A;  4XIC A;  2XGC A;  1W0T A;  1OFC X;  4QSH A;  4JKZ A;  2ME0 A;  2YS9 A;  2K40 A;  1QVT A;  5F0H A;  4IHV A;  1ETW A;  3A01 B;  4Y7N J;  1MBF A;  5IOY A;  4MLO A;  5J1Y A;  5DS9 A;  2JA6 J;  2D6Y A;  1I3Q J;  1X2M A;  1JUS A;  3E7Q A;  1UI6 A;  4A3F J;  5F27 A;  1FTT A;  3S1N J;  5CXG A;  3B6A A;  1PUF A;  4IEJ A;  2E19 A;  1WPK A;  5F0F A;  3CQZ J;  3WHC A;  4W97 A;  2D5V A;  2QWT A;  3JRF A;  4AYB N;  2COB A;  2E2H J;  2WV1 A;  1ETX A;  5BNG A;  2VKE A;  3H0G J;  1DU6 A;  2IAI A;  1FIA A;  2K9Q A;  2V57 A;  4BBR J;  5GP9 A;  2O7T A;  4UDS A;  1RR7 A;  2ID6 A;  5M3M J;  2DG7 A;  2ZOZ A;  2GUH A;  1IDZ A;  2NVX J; 
#chains in the Genus database with same CATH topology
 3GTP J;  5LRS A;  1WH7 A;  4WXC A;  1KU3 A;  3G6E I;  1XCB A;  2NVQ J;  1F43 A;  4V2F A;  3FMR A;  5F04 A;  4B3X A;  4X0G A;  2E1C A;  2ISZ A;  5GAE J;  2DFE A;  5CVV A;  4DW6 A;  1E0E A;  2GBY A;  3MVP A;  1VQ6 I;  3OYD A;  3HB9 A;  1FSE A;  3JW4 A;  4WXH A;  1HKQ A;  3MD2 A;  1T08 B;  1E2X A;  1EKE A;  3KP7 A;  1FNN A;  2FF4 A;  1O4X A;  3FKJ A;  5GAG J;  1I6H J;  1MJA A;  1LEA A;  4BS9 A;  3V8J A;  3UKG A;  2PMZ N;  3TO7 A;  4I99 C;  3BTJ A;  1T38 A;  5FB2 A;  1UMQ A;  3JR9 A;  1RI7 A;  2L02 A;  3HOX J;  3HTA A;  4UB8 C;  4BDZ A;  4RA2 A;  4GCT A;  1TZL A;  3EUH C;  1WKM A;  3CC7 I;  4LIT A;  4ZYE A;  4IQJ A;  1DPU A;  3X2Q H;  5HLH A;  3BTL A;  3RI4 A;  1LDK B;  1JT6 A;  9ANT A;  3HPG A;  3O6B B;  3J7Y J;  2R5Y B;  5CJ9 A;  2VJJ A;  2DMT A;  2FXA A;  2GUH A;  2A61 A;  1HF0 A;  3J7A O;  3A02 A;  2M34 A;  5KVR A;  3V8K A;  1QRY A;  4YRV A;  3JRG A;  2IW5 A;  3LA2 A;  3LSP A;  2QQ9 A;  4G7O F;  1SFK A;  5JLW A;  2LTP A;  4P1W A;  3R0J A;  3MN2 A;  4HX4 A;  2DOA A;  3RKQ A;  1K83 J;  1FC3 A;  3EET A;  5K5O A;  3DPU A;  4YG2 F;  4XKW A;  1BOA A;  1R22 A;  4XON A;  3BG5 A;  3H5A A;  3JTG A;  1R1U A;  4G6D A;  2KJC A;  2MD5 A;  3PL8 A;  3NXC A;  2QWW A;  2FBQ A;  1SEU A;  1A6Q A;  3BJO A;  4CCK A;  2HYT A;  2V9V A;  2HXO A;  3D5R C;  4XSZ F;  1Y1W J;  4DVY P;  2O8K A;  4XLF A;  2QOP A;  1W7P B;  4RB0 A;  3CCL I;  3WG7 H;  2W7N A;  4RAY A;  1FJL A;  4AID A;  4BY7 J;  1OCT C;  2DFF A;  1H0M A;  2E71 A;  2JUC A;  3QKX A;  3L2U A;  4GO1 A;  1BC8 C;  2QVO A;  4G6T B;  4O5V A;  5D6F A;  3KCC A;  2F07 A;  4C30 A;  4CYC B;  3GCM A;  2IT0 A;  1BIA A;  1W5S A;  4YZE A;  1OKR A;  4M9Z A;  1P4A A;  3AQT A;  3CF2 A;  2XKO A;  2FA5 A;  3I4N J;  2XDN A;  4JX5 A;  2CUE A;  2MA3 A;  3MZY A;  2NRA C;  3ASO H;  4UUS A;  4C3I J;  2DXI A;  3DKY A;  2BV6 A;  2EFW A;  5DUI A;  4PK4 A;  2HDW A;  3A2K A;  2ZJ2 A;  1YW9 A;  3HUG A;  1SD7 A;  1XPX A;  3Q9V A;  1JE8 A;  4EJT A;  2VAS A;  1T56 A;  1JKR C;  1X19 A;  5KNL A;  1TWG J;  2Q2E B;  5DEQ A;  2PFB A;  3OYC A;  3BTC A;  2MLG A;  3SXY A;  3RZD J;  5CPR B;  2MC3 A;  2F2E A;  2RV8 A;  3DEW A;  3DEU A;  2CU7 A;  3LSI A;  1FBU A;  1QZE A;  5HLT A;  4IX7 A;  2E5Z A;  2L7F P;  3HBL A;  2WB1 N;  3SFI A;  5F1R A;  2NOG A;  3WTY C;  2VKH A;  3QP5 A;  3KZZ A;  3RYR A;  2ESH A;  2O0Y A;  1NG7 A;  4MIM A;  3HOS A;  3P9C A;  3FMS A;  1ZLK A;  4XOP A;  2XVC A;  2IRF G;  1IV6 A;  5F0C A;  3R0A A;  4HST A;  1NH3 A;  2XGE A;  4IRG A;  4LG0 B;  1D5Y A;  5LRR A;  3E5X A;  4DBR A;  2FQ4 A;  3HIF A;  4ENM A;  4ITV A;  4IVN A;  3JRI A;  4E7Z A;  1LB2 A;  4E7J A;  4PUS A;  2OUM A;  3FBN B;  5J1U A;  5J4V A;  3HIM A;  3H3U A;  2MBF A;  1B72 A;  1R1V A;  1MMA A;  1SFE A;  1TWA J;  4M6X A;  5JR3 A;  1BR4 A;  4P9F A;  4UV9 A;  1YFH A;  3GTG J;  3VVZ A;  3P9I A;  4KN7 X;  5DYM A;  3J81 K;  4XLC A;  1A6I A;  4KIG A;  1P4W A;  2VQH A;  2HNH A;  2PI0 A;  4OMY A;  1QHG A;  1W36 D;  4E7S A;  4LLL A;  1ZRC A;  3ZRG A;  2FUG 2;  3HKZ A;  2VIX A;  1FY7 A;  2E7X A;  1XB4 A;  2Y2Z A;  3S2W A;  3BPV A;  2KIF A;  5IP6 A;  3G1L A;  3CMY A;  2HOS A;  5HS7 A;  2EBI A;  2VQG A;  4L0Y B;  1ENH A;  4KMU X;  4XLA A;  2PZ9 A;  2K9S A;  1LDJ A;  1XGN A;  2M8G X;  3L2C A;  3R61 A;  5ICF A;  4LB5 A;  1J09 A;  2LYC A;  1BI3 A;  1VI0 A;  4A3E J;  1IC8 A;  3BG6 A;  1YRN B;  2R7S A;  3ZMV A;  3H92 A;  3HEF A;  1OMI A;  3JRE A;  4A3B J;  2UZK A;  1FYK A;  2O8X A;  3CP2 A;  3OYI A;  3KEQ A;  3L2Q A;  3VW1 A;  3LWF A;  1YS7 A;  2R5Z A;  3S3M A;  1D5V A;  1QBJ A;  3IWF A;  1N78 A;  1CGP A;  4HDV A;  5IOZ A;  1BN5 A;  3GXO A;  4ZZD A;  1YYV A;  1U6G A;  4BJT A;  3G1O A;  4DOZ A;  2W48 A;  4WK8 F;  2XDV A;  1QPI A;  1ZGW A;  2UXP A;  4M6V A;  3KYD B;  4ZJZ A;  4ESJ A;  3SQN A;  4IXA A;  4PJJ A;  2F6C A;  1MMS A;  2E7W A;  2IGO A;  2M1B A;  4L5I A;  1DU0 A;  2G7L A;  3I71 A;  5FKM A;  1HW5 A;  4S0H B;  3F8N A;  1AA7 A;  5DV5 A;  1VQO I;  1MJ9 A;  1MNE A;  5BMZ A;  2MAB A;  2ZCN A;  3ZPL A;  1IUF A;  3OYK A;  5HBU A;  1DPR A;  2GIZ A;  1SGM A;  3KP6 A;  3E5U A;  3AG4 H;  5FFX A;  4C2T A;  5HS9 A;  2Y0S N;  2Y48 A;  3ANP A;  4BGD A;  2XB0 X;  4WF2 A;  3I64 A;  2EIK H;  2LY1 A;  1MBJ A;  2NS8 A;  3V4G A;  1I27 A;  2KIM A;  4L5E A;  2PBX A;  3LL7 A;  1APL C;  1N75 A;  2A5W A;  2HKX A;  2M87 A;  3DBL B;  4UXN A;  3H9Q A;  1PP8 F;  1FEX A;  1JKQ C;  2A69 F;  3BOQ A;  4UNO A;  1OYW A;  2YU3 A;  3IRR A;  3JTH A;  4M9X A;  3WTZ A;  2BVL A;  3ABU A;  4IL6 C;  5DM6 F;  1LUJ B;  2FJI 1;  2RVC A;  1Y8Q B;  4BH9 A;  5B66 C;  2L9N A;  1IN5 A;  4ZDO A;  1X58 A;  3HTI A;  2ZFW A;  4RAF A;  4BE2 A;  2DA5 A;  1T0F C;  1YJ9 I;  3PFY A;  2QBY A;  5ICG A;  4ZTF A;  3C7J A;  4CGR A;  1A36 A;  4FET A;  2RRE A;  2HYJ A;  2DMN A;  2CG4 A;  2L0K A;  3EPZ A;  2M0C A;  2L4M A;  3TO9 A;  5D18 A;  2QTQ A;  3FMQ A;  4XLH A;  4I2O A;  3KPH A;  2DTR A;  1PUF B;  3G7R A;  2NNY A;  3RQ4 A;  1YX5 A;  3ZN0 A;  2HI3 A;  4WXD A;  2LG4 A;  2ISY A;  4HQE A;  1W1W E;  2EZH A;  4CA0 A;  1RNL A;  3B81 A;  1PP7 U;  3RIR A;  5KAI C;  4CO8 A;  3A0B C;  4BHB A;  2HGC A;  2P8T A;  4QLC U;  1BI0 A;  2PMU A;  2DA4 A;  2GOX B;  3SHF A;  4LIV A;  2HDC A;  3PO2 J;  3HDD A;  3S14 J;  2H09 A;  1X1C A;  2NAZ A;  2CWE A;  2MLK A;  1E17 A;  3SEZ A;  1LVK A;  2YUS A;  3E0J B;  2JT1 A;  1BM9 A;  2ZOY A;  4YFN F;  2TCT A;  1K79 A;  2HTJ A;  4CCJ A;  2ZO4 A;  4BXU A;  5IY5 H;  2XV4 S;  5ILV A;  2PMZ A;  2JTV A;  4UUS B;  1Z9C A;  3ZP5 A;  3HPH A;  2QYO A;  4LD5 A;  5FKN A;  2O03 A;  1ETK A;  2VKD A;  4L0Z B;  2WWY A;  2B7E A;  2DPU A;  4IHW A;  4FAS D;  4JNN A;  3RKW A;  3CO6 C;  1FOW A;  2IA1 A;  2IU5 A;  3EUA A;  1W7P A;  1VQ8 I;  3H1C A;  3D1N I;  2EA2 A;  1UAA A;  2H6C A;  4N9H A;  3F6O A;  2COM A;  2VB6 A;  3CCQ I;  3F9K A;  5EDN A;  5L3B A;  4BNC A;  5FRM A;  5ERI A;  3ERE D;  3PUF A;  3S16 J;  4CDG A;  2DFI A;  2BY2 A;  4ENJ A;  4Z6Y A;  3CUQ A;  5FGM A;  1ITY A;  3CWR A;  2ICW G;  4U9L A;  3F6V A;  3I4P A;  5CVR A;  1WZ2 A;  3ECO A;  1ZQ3 P;  4IZZ A;  4XNF A;  3V7R A;  2JQ7 A;  2WY7 Q;  5GPC A;  5CVJ A;  2NVY J;  1MBK A;  2E1O A;  4BAY A;  2XRL A;  4IRV A;  3NWS A;  1GXQ A;  3TKY A;  2HEO A;  3K6G A;  2REK A;  4M71 A;  5TGT A;  1LFP A;  2L4A A;  2Q2E A;  1QZY A;  4LK0 F;  2Z5U A;  4JX6 A;  5D5W B;  3CUQ C;  4A5N A;  2GA1 A;  5FKO A;  4B43 A;  2QSF X;  2XPV A;  1JJ6 C;  2EV0 A;  2HQN A;  3HC7 A;  3VYR B;  3VB2 A;  3KZI C;  1R5G A;  4KA4 A;  1YW7 A;  1V5E A;  3VEP A;  4DZJ A;  2DG8 A;  2DT7 B;  2EK5 A;  1N77 A;  5FKL A;  1XD7 A;  2DAO A;  3LFU A;  1LPQ A;  1UB9 A;  4EQQ A;  2O7O A;  4L9T A;  1ZGJ A;  5KK1 A;  2IPQ X;  3K1N A;  2M5W A;  5AIQ A;  5DD8 A;  2LKX A;  3TMO A;  4KIC A;  2VBY A;  4GXO A;  2BW3 B;  4RAG A;  2E1M C;  5K5Q A;  2BZT A;  2AQE A;  4H0E A;  3VTI A;  1L0O C;  1ZAO A;  1W7P D;  2X6Y A;  1J2X A;  4Y7N J;  2QEN A;  2KLO A;  3ERM A;  3GME A;  4XM3 A;  2VBZ A;  3G71 I;  5F27 A;  1FTT A;  2E19 A;  2R7U A;  3NWT A;  5F0F A;  5BS6 A;  1SMT A;  2DI3 A;  4W97 A;  3VWB A;  2XF7 A;  3OS2 A;  4ZYG A;  3JRF A;  3K9T A;  4IO9 F;  4XOR A;  1FIA A;  3ECH A;  3U1K A;  4DIQ A;  3OYG A;  2V57 A;  3CC4 I;  5GP9 A;  2XAQ A;  2PN6 A;  2ZY9 A;  1IDZ A;  2BY1 A;  3GYH X;  3OMY A;  2CFX A;  3QOD A;  2R5Y A;  1UHS A;  1UJ8 A;  2DA2 A;  2EZL A;  4DZP A;  3SWH A;  1OCP A;  1IRZ A;  3GLL A;  2QKO A;  2KZV A;  1IDY A;  4HV5 A;  3VSK A;  1NK3 P;  1ZHF A;  1Y1V J;  3DKW A;  1BOB A;  1XSX A;  4RGX A;  3CJR B;  2DQR A;  1V4R A;  1GT0 C;  1DGR M;  3HG9 A;  5LLQ A;  3DPJ A;  2TDX A;  3Q0V A;  3BWG A;  1XDS A;  1B8I A;  3CP8 A;  1Z0X A;  1FTZ A;  1R36 A;  3HTU A;  1ETY A;  4G94 A;  3FXK A;  3U21 A;  3ONQ A;  4HPQ A;  2DJN A;  2G7G A;  1TWH J;  3BDD A;  1LKX A;  1N25 A;  4BAC A;  4G6Q A;  4R79 A;  3CUQ B;  2K85 A;  3Q0W A;  2CUZ A;  3GZI A;  1WVR A;  4JK1 X;  1MDM B;  3S32 A;  2VKV A;  1OJL A;  3J7A Y;  4D0P A;  1Y8R B;  1POG A;  2F5D A;  3I59 B;  4IHT A;  3M07 A;  4F93 B;  3QQA A;  3R4K A;  1KU7 A;  3T8R A;  1BC7 C;  2VC1 A;  1VQK I;  5LGU A;  2ZXW H;  4HEA 2;  3ZMD A;  3WTS C;  4A3J J;  2F5F A;  4TV7 A;  2IS1 A;  4ACI A;  3D5S C;  4BDY A;  4A0Y A;  2IA2 A;  4RGR A;  5E8G A;  1JUM A;  1R9T J;  1R5I D;  2LMD A;  3BC8 A;  5ICC A;  3HSE A;  2R7X A;  2ECB A;  4DGW B;  3OYL A;  1VQL I;  5C4X J;  2B1E A;  2PFV A;  3BG3 A;  4NB5 A;  2WGB A;  2PX9 A;  3LAJ A;  2EPF A;  3QPS A;  1RC9 A;  3REO A;  4V2G A;  5IPA A;  5FMP A;  3W6K B;  1WJB A;  4RLF A;  1R5H A;  4ESB A;  1RUN A;  3K4K A;  5L3G A;  1F4K A;  1I1S A;  1B8I B;  3AG3 H;  1MH3 A;  1MSE C;  3KNW A;  2G7H A;  4XLP F;  4ZYD A;  4R1H A;  3RH2 A;  3K4L A;  2R7O A;  3LQQ A;  3LSM A;  4HBL A;  2K3P A;  1S7E A;  2KHM A;  4B8X A;  3DLL F;  2FNP A;  4ZC3 A;  3BT9 A;  3E97 A;  1YIO A;  4XBF A;  5JI6 A;  3HRM A;  2UXH A;  4PXI A;  2OTJ I;  3MQ0 A;  2CQN A;  1Y0U A;  3NRG A;  1YOV B;  3MKZ A;  2EIM H;  2BEO A;  2VXD A;  5K7F A;  1OCR H;  2DG7 A;  2E35 A;  2KPM A;  2NP5 A;  2EQR A;  3FXO A;  3CCJ I;  3PJR A;  2F5V A;  4ZYA A;  1OCZ H;  2L54 A;  1W0U A;  3RYP A;  3R6S A;  3GZ6 A;  3BRO A;  1ZH5 A;  3ZQH A;  2ZNZ A;  5HNH A;  2KL4 A;  3OL3 A;  2VUM J;  2HVS A;  2GLO A;  4C2U A;  3CDH A;  3C07 A;  2FU4 A;  4AD9 A;  5GPA A;  4FIS A;  2O5R A;  3KLN A;  5E3N A;  3NNR A;  2BVM A;  4A69 C;  5E3M A;  3OY9 A;  1I39 A;  2HWV A;  3PNY A;  3BR6 A;  5F64 A;  4EJO A;  3OYF A;  4G7Z F;  4PZJ A;  1Z3X A;  1H89 C;  1S7A A;  1R4N B;  3CUO A;  4ON0 A;  1DDN A;  2R7F A;  3GO5 A;  4HKU A;  4UUT A;  1UFM A;  3M1C A;  2W4S A;  1HA8 A;  2DK5 A;  2CW8 A;  3RPQ A;  4OU0 A;  4A3L J;  2BW3 A;  3CJD A;  2W00 A;  2B0L A;  2Z2S B;  3T1B A;  5EFY A;  4RMN A;  3RPU D;  5HAW A;  2ZXJ A;  1TC3 C;  1RZ4 A;  3VDX A;  4OIP F;  4DYC A;  2PQ8 A;  2V1D A;  1P6R A;  1JKP C;  3C18 A;  3FHZ A;  4KT5 C;  2L01 A;  2VBW A;  3JSJ A;  3L09 A;  5H20 A;  2KRH A;  2OQR A;  1X1D A;  2G7U A;  5HLG A;  2Z1D A;  4HLX A;  5CVU A;  2FE3 A;  3FM3 A;  3WTU C;  1IN7 A;  3ZMS A;  3FHN A;  4NC7 A;  4Y17 A;  1QQI A;  2NXN B;  5D4S A;  2L9V A;  1IZ1 A;  1FP2 A;  2G7S A;  2YVH A;  3RTR A;  3TQN A;  1MBE A;  3DTK A;  3CC2 I;  2DW4 A;  1SD6 A;  4BBS J;  1OLT A;  1GUU A;  3NRV A;  3MKW B;  1AKH B;  2HDD A;  1H9T A;  3FXM A;  4G12 A;  1IGN A;  4MK6 A;  1MMG A;  1YX3 A;  2JVH A;  1HBX G;  1KON A;  5FLX K;  3BG9 A;  1T95 A;  3KIO A;  5E3L A;  5J40 A;  2JA7 J;  5EYR A;  3QPL A;  3QP6 A;  3J80 K;  1RES A;  2H8W A;  2OPT A;  4E7I A;  2DOE A;  2XAF A;  2BXZ A;  2QIB A;  2E60 A;  5J8F A;  4HQM A;  4RDU A;  1OCC H;  1W5C C;  2XIG A;  3ZQL A;  3FDY A;  2E2J J;  2M0M A;  2JRM A;  2QQ8 A;  1JI8 A;  4MHG A;  1KZH A;  2XF6 A;  4MFE A;  3WTX C;  3GUD A;  4A6E A;  3HXL A;  5B1B H;  4A3M J;  1F1Z A;  5L3D A;  2OAZ A;  3PFI A;  5L3F A;  3N97 A;  5B3S H;  2CH0 A;  2R7Z J;  3HRT A;  4KIB A;  3PM1 A;  2HOT A;  3FZV A;  4P9U A;  4AIK A;  2KRF A;  1X1A A;  3IKT A;  5DCF A;  4A3C J;  2QKM B;  3RCO A;  3DFG A;  3A01 A;  5IP9 J;  4M3G A;  3ZQI A;  1HLV A;  4Y33 A;  5J8C A;  3MZ8 A;  5DD4 A;  2EIN H;  2R7D A;  4RM3 A;  4XLE A;  3GZ5 A;  2P4W A;  1UEL B;  4U0V A;  4B1R A;  4I0B A;  3HJE A;  2L7K A;  3LJL A;  1KU9 A;  4IHX A;  1LEB A;  3SZG A;  3A0H C;  5BOX A;  4J00 A;  5F08 A;  3EDP A;  2L9S A;  3BR1 A;  3MEX A;  2ZFU A;  3ZR8 X;  4BXF A;  3C2G A;  3LSH A;  2XF5 A;  4BY1 J;  2PJP A;  1S29 A;  3ZGK A;  4EV0 A;  1UG2 A;  1SFU A;  3BCA A;  3G56 A;  4EM0 B;  1WI9 A;  4HZF A;  4PJM A;  3VIB A;  1EA3 A;  2QEX I;  2LBF A;  4MTE A;  3O3K A;  1SFO J;  5LEK A;  1O7F A;  4AYB A;  3IUO A;  3VSL A;  1VFC A;  3DPT A;  4J01 A;  2GXA A;  5FHP A;  4LGW A;  1RKW A;  3CME I;  3DLA A;  2Z33 A;  3BZK A;  2DT5 A;  3TP3 A;  1GV2 A;  4LLN A;  1Z3Y A;  5M5W J;  4KWA A;  4DNC A;  4BHP A;  2VQL A;  3WTW C;  3HUG B;  3LMM A;  3LSK A;  4NQW A;  3ZQ7 A;  4YEJ A;  2DCE A;  1U78 A;  1BBY A;  4G9Y A;  4I09 A;  4IRH A;  3COA C;  4HRI A;  2GOM A;  1MW7 A;  1XG1 A;  1LE8 A;  1WQ2 A;  2LF8 A;  2NOJ B;  3JRC A;  3BNI A;  3SZP A;  2ID3 A;  1U3E M;  3E6B A;  4UHT A;  1MSF C;  4HF2 A;  2YVX A;  2BXY A;  3P9K A;  2G9W A;  3KP5 A;  2VE8 A;  5E79 C;  2ZNY A;  3HM5 A;  4I01 A;  2Q8K A;  3ML6 A;  2KRC A;  5A2Q K;  2CS3 A;  2OA4 A;  2B3W A;  3HOV J;  1FSH A;  1ETO A;  2OJE D;  4A93 J;  2Q24 A;  2QCO A;  1I6X A;  3OR1 C;  2DDB A;  3OL4 A;  3NI7 A;  4HX8 A;  1VND A;  1JHF A;  4HYE A;  5HSZ A;  4IOC F;  2Z9O A;  1Z05 A;  1XC5 A;  1MMD A;  1AHD P;  4CSW A;  1MKM A;  1U0J A;  4J19 A;  4M73 A;  4KIT B;  2R5Z B;  5CLS A;  2H6B A;  2A07 F;  3DP7 A;  4F92 B;  3WHB A;  4RB1 A;  2KP6 A;  1XN7 A;  4OIN F;  2J5P A;  3CCR I;  1JGG A;  5F6F A;  4E70 A;  2F4I A;  2V6C A;  5EEG A;  3F8F A;  2XKP A;  4QWQ A;  5CVI A;  3AG1 H;  4JYK A;  3COL A;  2DPD A;  5IP7 J;  4BE1 A;  2ELK A;  3L2W A;  4GCV A;  3EYI A;  3QOE A;  2JRT A;  3LNQ A;  1JUP A;  2GA2 A;  3DBH B;  1OQY A;  4HF0 A;  4RM2 A;  4HNU A;  2XUB A;  2XGD A;  3K69 A;  4U0W A;  2XAS A;  3I55 I;  4A3K J;  3L2R A;  2ETH A;  4I02 A;  4ESF A;  1IJW C;  1BR2 A;  1O57 A;  1OCO H;  3V42 A;  2GAU A;  1BW5 A;  3QPH A;  3H3V K;  4II2 A;  2FX0 A;  1HQC A;  3LHQ A;  3S3O A;  1BA5 A;  2A3S A;  1OPC A;  4E7H A;  2FJ1 A;  2PMH A;  3K1M A;  1J59 A;  2OF7 A;  2G0E A;  2DO7 A;  2IS6 A;  2K27 A;  1ZYR F;  3CDL A;  4D7M A;  2AO9 A;  3KE2 A;  4F3Q A;  3K0L A;  2ZSH B;  1H8A C;  4LLG F;  2DMU A;  3HGG A;  5K7Z A;  3IUV A;  3QYE A;  4HG2 A;  3QOP A;  1S6L A;  2MYS A;  1G3Y A;  2L2O A;  2YU9 J;  1Q1H A;  3CCU I;  3ULQ B;  1FP1 D;  3LFK A;  2RNJ A;  4PJL A;  2ZJQ F;  5L3E A;  4DBQ A;  3CTA A;  4LIU A;  5CW8 A;  4XRS G;  5FLX Z;  3D0S A;  4HF1 A;  4NC6 A;  3S1Q J;  1TWC J;  2VN2 A;  1MD0 A;  2R0Q C;  3ROU A;  3BR5 A;  3FK6 A;  3P5J A;  2O6G E;  1R00 A;  4M3B A;  1X3W B;  1HW1 A;  2HQ5 A;  4X6A J;  4S05 A;  2LOO A;  3TL4 X;  2RQQ A;  4WCG A;  3BJ6 A;  2K9N A;  1WJA A;  2K5C A;  4R8H A;  3UR3 C;  4B48 A;  2VT2 A;  4GCL A;  2CSO A;  5TJJ A;  5HVQ C;  2JPB A;  3JSP A;  1FIP A;  4Y13 A;  2P0W A;  4FHT A;  1W0T A;  2WTE A;  2J5O A;  1OFC X;  3ZMT A;  3PSI A;  4JKZ A;  2K40 A;  1QVT A;  1ETW A;  5FFZ A;  3A01 B;  5IT3 A;  1D1B A;  5IOY A;  4MLO A;  2JA6 J;  4CCL A;  2STT A;  1JUS A;  2XRO A;  3ZCO A;  4N0B A;  4A3F J;  3S1N J;  1TW2 A;  3PQJ A;  4IEJ A;  1R58 A;  3KYL A;  4CHU A;  2UWM A;  4XR6 A;  5A2Q Z;  2HS5 A;  3CQZ J;  5GAD J;  2FML A;  2BE5 F;  2QKL B;  4BUP A;  2QWT A;  2XGX A;  2YX4 A;  2LY2 A;  4AYB N;  1XCV A;  2ZXH A;  2KFD A;  2LC2 A;  1ETX A;  3K10 A;  1IRG A;  1IRF A;  2C6Y A;  2IAI A;  1QZZ A;  4Q47 A;  2AS5 F;  2K9Q A;  2ZOZ A;  4FT8 A;  4B44 A;  2IJL A;  2UV1 A;  4PFP A;  2M7A A;  2E34 A;  2PG4 A;  4UDS A;  1RR7 A;  2ID6 A;  2M4G A;  1E3H A;  5E1X A;  3FWE A;  5HOD A;  1U5T A;  2F5E A;  4AWX B;  3JRB A;  3BRU A;  3J81 Z;  4PJN A;  1RPW A;  4OIO F;  4Q48 A;  2NP3 A;  1TTY A;  2D1H A;  3FX3 A;  1K61 A;  3VW0 A;  3PQK A;  1IO2 A;  5D4R A;  1E3P A;  1T6S A;  4K2E A;  3MZH A;  3S17 J;  1XGO A;  3JRA A;  5J47 A;  2FOW A;  3UNG C;  5IT9 Z;  1P2F A;  1VQ9 I;  2DT6 A;  5FD5 A;  4HA8 A;  5CYV A;  3L9F A;  1T8I A;  4L9J A;  5K7H A;  3GLX A;  3OYA A;  2QSG X;  2EFP A;  2RDP A;  3VFZ A;  2W1O A;  4U7D A;  3BR0 A;  5J4Y A;  1HKS A;  3HOZ J;  5C4J J;  1BIB A;  1ON1 A;  1RKT A;  4X1E A;  2ACJ A;  2A5Y B;  3H9J A;  3G4S I;  1RRJ A;  2OCC H;  3DU5 A;  3M8F A;  3DF8 A;  3S3N A;  3KKD A;  2P6S A;  3FIS A;  5FRO A;  3GX4 X;  2ZSI B;  5BQT A;  1WGX A;  1IV8 A;  4BYY A;  2OI8 A;  2DOD A;  4RB3 C;  3HTJ A;  5J3L A;  2HR3 A;  4KFC A;  1SD5 A;  5E20 A;  2UXU A;  1D3Y A;  4QIW N;  3W2A A;  1S5L C;  1LFU P;  1XSD A;  1PDN C;  3HE0 A;  1MH4 A;  1I50 J;  3S1M J;  2Y31 A;  2M4K A;  2LH9 A;  1VQ4 I;  1ZRD A;  4M3E A;  1RIO H;  2K86 A;  4CIC A;  3O8H A;  2DYR H;  4KYW A;  1YIJ I;  1VTN C;  1QGP A;  3TDZ C;  5J6X A;  3TDU C;  3JCU C;  2K9M A;  2TRT A;  3HGY A;  3RKY A;  1WI3 A;  2ELH A;  2VJ4 A;  4UVB A;  1DGW Y;  5DCM A;  2OD5 A;  4E6K G;  2X1E A;  2Y9Z A;  3PUB A;  3DWL E;  1TL8 A;  4L5J A;  2HOE A;  3M4O J;  1YRN A;  4S04 A;  3A4C A;  4XKV A;  5IYB J;  2OQG A;  2IGK A;  4IPA A;  2HVR A;  2V6E A;  5F1J A;  1ZLJ A;  1KYZ A;  2R7W A;  1O3S A;  2UUZ A;  4DJA A;  2YSR A;  3I0T A;  3DV8 A;  4QPO A;  4IKF A;  3CCV I;  3MNL A;  1U5T B;  1IAW A;  3SFZ A;  3TP0 A;  3HL2 A;  2VON A;  4L9V A;  1ONV A;  3C2H A;  3MAJ A;  3J80 Z;  4Q5S F;  5EGO B;  3KP4 A;  3RDI A;  3GZN B;  1R49 A;  4U0Y A;  5TIS C;  1YS6 A;  2VOP A;  1X4O A;  3K70 D;  1V3F A;  1V54 H;  3HOW J;  2LLK A;  4YEL A;  3VOD A;  3V6G A;  4PSX A;  3GF2 A;  3V78 A;  2MC4 A;  5EEH A;  2DA3 A;  2GZW A;  1YI2 I;  4XOT A;  3NAU A;  3FM5 A;  4XMY A;  6PAX A;  1T98 A;  2MFZ A;  3U9G A;  3LSR A;  3N05 A;  4Y52 J;  5E8I A;  2ME6 A;  1NK2 P;  4XL9 A;  2FNA A;  3E7L A;  1GVJ A;  5JHF A;  4KMF A;  5TRD A;  4KIS A;  5BPD A;  2NS7 A;  1NHA A;  2OTL I;  5HLI A;  2LD5 A;  1O7L A;  1XMX A;  3IHU A;  3M3Y J;  2FOK A;  1M1E B;  2L9R A;  3LA7 A;  3CCE I;  5KCM A;  3WU0 A;  2I8D A;  2LVS A;  3FF5 A;  1J0R A;  1L3L A;  2WAQ N;  1Z77 A;  1FYM A;  5HOO A;  1X1B A;  1Z7L A;  3OYN A;  4B3A A;  1I3A A;  1IRX A;  1O3Q A;  1R7J A;  3NS4 A;  4YFX F;  3ZQF A;  1A04 A;  2V9P A;  3P7N A;  3QYB A;  2X0L A;  3GFI A;  3FRQ A;  3BQY A;  1ZR4 A;  2JMW A;  2X48 A;  4OAZ A;  5AON A;  2FMY A;  4XQF A;  2Y0S A;  2BY0 A;  3KEO A;  4AIJ A;  2ZME A;  4XRS A;  4N4O B;  2JJ7 A;  4WIB A;  2XHK A;  4Y15 A;  5LGN A;  3KYC B;  4JP0 A;  2STW A;  4CH7 A;  4AUX A;  3S93 A;  1XTA A;  4C2M A;  2W57 A;  3SZT A;  3JRH A;  2KIU A;  1A5J A;  4O3M A;  1HDP A;  2HVQ A;  2KZG A;  1J7K A;  3LOC A;  3OIQ A;  4F91 B;  5E17 F;  1S3J A;  2IP2 A;  3K2A A;  3H0D A;  1JT0 A;  1CF7 B;  3F8C A;  4QTR A;  3HHH A;  4M6Y A;  2O9L A;  2F4O B;  3OSG A;  1ZGA A;  3GWZ A;  1FYL A;  3MKY B;  2R7R A;  4BKX A;  1ZTR A;  3QPT A;  2IBD A;  2IEK A;  2V1N A;  1YHQ I;  2W24 A;  2HU9 A;  3PSF A;  1ACI A;  3W6V A;  1FLI A;  1S9H A;  2X1C A;  2M9H A;  3EUH A;  3F72 A;  2LY9 A;  2LK2 A;  3EUK L;  4M72 A;  3ESW B;  1KQ0 A;  2QQA A;  2MG4 A;  3CMM A;  4RGS A;  2LP0 A;  2PJR A;  1FT9 A;  2G3B A;  3VW2 A;  3T0Y A;  1V5F A;  1X3U A;  4ICH A;  2EZK A;  3AQS A;  2EA4 A;  1IF1 A;  1MNM C;  4IQ4 A;  2JZY A;  3F23 A;  2DA6 A;  2EV5 A;  1IXR C;  1FMV A;  5DDG A;  2RGV A;  3KZY A;  3ISP A;  2YR2 A;  2XSJ C;  4FTH A;  3ON2 A;  5K1Y A;  3S15 J;  3FXQ A;  3DQV C;  1Z6T A;  3HKZ N;  1YJN I;  3HTH A;  4EJW A;  2DYS H;  1WJD A;  1HC8 A;  2NS0 A;  5E1Z B;  1Y6I A;  3VVY A;  5FD6 A;  1STZ A;  1MDM A;  5CKT A;  1HKT A;  3KP3 A;  2GEN A;  1VQM I;  2E5N A;  2HZT A;  3T8T A;  2H8R A;  3B6C A;  4BQQ A;  2CRG A;  4A3D J;  5EF6 A;  3I4M J;  2X9D A;  2QLZ A;  2O3F A;  4ZYH A;  1D0X A;  3C3W A;  3GVA A;  4HDU A;  4EVI A;  4OD4 A;  3ZMU A;  1W5T A;  3RKX A;  1VZ0 A;  4DYR A;  1ZKG A;  2Z16 A;  2L7M P;  2UXX A;  2QF7 A;  3BCB A;  3E3V A;  3K8P C;  2JSC A;  2NNN A;  3CES A;  4I6Z A;  2W82 A;  4MEX F;  3QRF F;  5JVT A;  5LBQ A;  3DTI A;  2YX7 A;  1ORK A;  4ASN A;  1ODD A;  2AHQ A;  5JLX A;  2QM3 A;  1BI2 A;  2AXL A;  2DMP A;  4EM2 A;  5HDN A;  1TBX A;  2ZME B;  1SFX A;  2N8G A;  2BGC A;  1REP C;  4L18 B;  2KKO A;  2HQA A;  2CUF A;  2HKO A;  2Y75 A;  4PCQ A;  2M30 A;  2VPL A;  4D1Q A;  4HNT A;  3VYU B;  1WSU A;  3AL0 B;  3CJQ B;  3M1E A;  4GFB A;  3RD3 A;  2F4M B;  1ZR2 A;  4UVC A;  3K4N A;  5JFR A;  3I59 A;  4IRI A;  1LFB A;  2XAG A;  2HKU A;  2MGQ A;  4PJ0 C;  4PFO A;  4QPQ A;  3WGG A;  1HST A;  1OYI A;  2FQ3 A;  1Z1D A;  4XID A;  2FSW A;  5IYC J;  2HZD A;  3RSN A;  4AU7 A;  3I3L A;  1ON2 A;  4HAM A;  2XAU A;  3W3C A;  4RGU A;  2X6O A;  3HRS A;  2WV0 A;  4F55 A;  2UXI A;  3CRJ A;  3SJM A;  2XPW A;  3FIW A;  4KIF A;  4PGH A;  1VF9 A;  5ED4 A;  1WFX A;  2FEZ A;  2UXN A;  3IH3 A;  4C3H J;  1XMK A;  1T2K A;  4NHJ A;  3OS0 A;  2WA0 A;  1O3R A;  3F22 A;  2VLA A;  2WAE A;  5H6R A;  5CXI A;  1WCM J;  4AC0 A;  2IS2 A;  2MSY A;  4EM1 A;  3ZOB A;  2JN6 A;  2DLL A;  1X1P A;  2VBX A;  1EF4 A;  4GFL A;  4AM3 A;  4BQN A;  3DU6 A;  2BYV E;  4UY8 I;  3H35 A;  1HOM A;  4CZZ A;  2ZCM A;  2XAH A;  1SC7 A;  1GDT A;  2EIL H;  2IGM A;  2W84 A;  2HYF A;  3G1M A;  3FK7 A;  1QA6 A;  2PLY A;  4D9J A;  3VOX A;  1J9I A;  1GLN A;  1I5Z A;  3KFW X;  5DAJ A;  5EGO A;  1USS A;  1TWF J;  3BG7 A;  2XSD C;  2RKH A;  3B02 A;  1IN8 A;  2MH2 A;  5LD2 C;  3KET A;  4NUB A;  3GTM J;  3LAP A;  1P7J A;  2LR8 A;  4I7H A;  2NX4 A;  2GM4 A;  2NVT J;  2Y69 H;  2CQQ A;  2IVM A;  2A68 F;  3DKX A;  2CW0 F;  3S1R J;  5LGT A;  3Q5F A;  1GXP A;  1Z6R A;  2VC0 A;  2DMQ A;  1T0F A;  3WTV C;  2B63 J;  3AL0 C;  1R1T A;  3QAH A;  3JAM Z;  2OV7 A;  4FE7 A;  1TW3 A;  2RN7 A;  1FZP B;  4CYC A;  3H3Z A;  4LG3 A;  4EJV A;  2MH9 A;  2A6T A;  2K3F A;  4P5O A;  1EV7 A;  1R4M B;  1VQN I;  1MMN A;  2R7V A;  2VXZ A;  1U2W A;  2Z99 A;  4OD5 A;  2Q0O A;  3H9G A;  4GRI A;  3IV5 A;  5K58 A;  1H88 C;  3SYT A;  1W4M A;  1PUE E;  4KJZ A;  1EH7 A;  3TED A;  1LJ9 A;  1G8X A;  2ZME C;  2V1U A;  2WAD A;  1FWZ A;  1SAU A;  5EEA A;  1QU3 A;  4U7B A;  1K6O A;  2ZXI A;  1BJZ A;  3GTK J;  3I5U A;  2CV0 A;  1BI1 A;  2ZB9 A;  5E1W A;  4N4N B;  1H9G A;  2GIV A;  4MGR A;  2K4B A;  1YW8 A;  3I56 I;  2M7B A;  1G3W A;  4II3 A;  3OYH A;  2KT0 A;  3IP4 B;  4AC6 A;  4FCY A;  1UI5 A;  1ETQ A;  2A05 A;  1LDD A;  3K2Z A;  4XSX F;  2R4G A;  2LSO A;  3M8E A;  2OZU A;  4RLQ A;  4CCM A;  2HXI A;  2QSH X;  2XB5 A;  1U9N A;  3OYB A;  3LSJ A;  4HX7 A;  3I54 A;  1D8J A;  4LMY A;  4Q4Z F;  3S2D J;  1KQ8 A;  2I5U A;  3RJP A;  4HV6 A;  1Z67 A;  5EZH A;  1WH5 A;  2P7V B;  3J7Z I;  2ZC2 A;  3M9A A;  2OU2 A;  3AAF A;  3W6J B;  4KUM A;  2EFO A;  3ABL H;  2L3D A;  1RET A;  3LST A;  1P9Q C;  2DA1 A;  2HPI A;  4ZDP A;  3VYS B;  4A0X A;  4CZC A;  2A6H F;  3HHG A;  3OWT A;  4MFD A;  3F21 A;  4YII A;  4BL0 B;  3PNT A;  3BJA A;  3AFH A;  1X2N A;  1LQ1 A;  4XIC A;  3IL2 A;  4QSH A;  2FBK A;  2ME0 A;  2M3A A;  4IHV A;  2QZ8 A;  2D6Y A;  1MBF A;  5DS9 A;  3E7Q A;  3WG9 A;  5D8K B;  4A6D A;  1QO0 D;  5CXG A;  1MND A;  1YO5 C;  1PUF A;  1WPK A;  4I0A A;  4IJA A;  2ZJP F;  3WHC A;  4HLY A;  4OOI A;  2EFQ A;  2VL8 A;  2E2H J;  2COB A;  4MNU A;  3Q9S A;  2IS4 A;  1DU6 A;  4F52 A;  1LNW A;  2QGU A;  3VOE A;  1R6R A;  2CMP A;  1I1G A;  1FOY A;  1G6N A;  3K1P A;  2O7T A;  3GEZ A;  2OZ6 A;  4RAZ A;  3PAS A;  1IN6 A;  1VQ5 I;  2NVX J;  1FX7 A;  2I10 A;  1A31 A;  1EH8 A;  3C2B A;  3WGH A;  2XRN A;  3K4M A;  1GV5 A;  5FGL A;  3JSO A;  1WJ5 A;  4YIR X;  4HNV A;  3IRQ A;  2JA8 J;  2V9K A;  2QA4 I;  4B4C A;  1EJ9 A;  4D7N A;  2DBB A;  1KA8 A;  2LFB A;  2VPR A;  2V26 A;  2PJR B;  5FRN A;  4Y3O A;  4EAT A;  4BQO A;  3IH2 A;  1Y56 A;  2HFH A;  1WJE A;  2WC2 A;  1AOY A;  3WE3 A;  3E1S A;  1G3T A;  2VJ5 A;  2CUJ A;  2LNB A;  5C3E J;  5LHH A;  5HNF A;  1XMA A;  5EZG A;  3OYM A;  4C2M J;  2CJJ A;  1ZRE A;  4PSW A;  4BJ6 C;  4IHS A;  3S8P A;  4P55 A;  5GAH J;  2JPC A;  4BU2 A;  2CFO A;  5B1A H;  4KN4 X;  4NDL A;  4DYQ A;  3AKZ A;  1PVE A;  1RR8 C;  2P6T A;  2EH3 A;  1B72 B;  3I58 A;  4UUV A;  4MQ9 F;  4LK1 F;  3OS1 A;  3OYE A;  2WB1 A;  3G2B A;  2X6W A;  4H4K C;  3GTQ J;  3OIO A;  2V7F A;  4ZDL A;  2XAJ A;  3VP5 A;  2GFN A;  2EZI A;  3TOA A;  1FMW A;  3G3Z A;  1AU7 A;  5L3C A;  5CQG A;  3PPB A;  1B6A A;  3OR2 C;  2ELJ A;  3R60 A;  1NTC A;  2KIS A;  3GBG A;  3NQO A;  3CCS I;  3BHQ A;  3TO6 A;  4N9I A;  4OMZ A;  1OYY A;  1K7A A;  1FBQ A;  4L9N A;  2K7L A;  1XS9 A;  1ZN2 A;  2VJI A;  1EH6 A;  5H9T A;  2LF7 A;  3HZJ A;  2M2E A;  5K5R A;  3CJN A;  1F9N A;  1BJA A;  1A35 A;  5E18 F;  5FKK A;  3ANG A;  2Y0M A;  2D1V A;  3I9V 2;  3NAR A;  3WU1 B;  3T5X A;  4Z2Y A;  3U2R A;  3OYJ A;  1TNT A;  4BEH B;  2UXO A;  4GYG A;  4BE0 A;  1JJ8 C;  2DTZ A;  3O60 A;  2BHY A;  4XRF A;  2HOA A;  4D5C A;  3LWJ A;  5HDG A;  1WWX A;  3QU3 A;  5C4Y A;  3E6D A;  3GFM A;  1Z7U A;  4XN0 A;  5LHI A;  4IOA F;  4AVZ A;  3F3X A;  1J5Y A;  2DOF A;  3M7G A;  1F36 A;  3KX2 A;  1K4S A;  4EEF G;  2V4J C;  1LVA A;  2DA7 A;  3OOP A;  2JA5 J;  1ZRF A;  1JTY A;  4BQA A;  2EB7 A;  4UV8 A;  4CCO A;  4ENN A;  2CO5 A;  3WTT C;  4KDP A;  1P4X A;  3MMY B;  2RQP A;  3A03 A;  5FLV A;  3ELK A;  5CQE A;  2QBY B;  2ECC A;  2XC7 A;  1P92 A;  3PIP F;  2R3S A;  1BR1 A;  3LA3 A;  1IXC A;  1OR7 C;  1DQU A;  4OIQ F;  3CZ6 A;  5ICE A;  4G8X A;  1ZG3 A;  3IH4 A;  1CQT A;  1DP7 P;  1QVU A;  3ZQC A;  3CCY A;  4MEY F;  4I76 A;  4MQV A;  1UG0 A;  1Z91 A;  2LKP A;  3E6M A;  2KJB A;  5D5X B;  3O8G A;  2DDA A;  4LG0 A;  1D1A A;  4AIH A;  5GTI C;  1XDU A;  4ABZ A;  2H1L A;  2HQR A;  2LKS A;  2RNG A;  5D1R A;  2VE9 A;  2BOL A;  1K78 B;  2P5L C;  1TLH B;  2ZJR F;  2L7Z A;  2P5V A;  5HS8 A;  1FPQ A;  4GCK A;  2WAQ A;  4NNJ A;  4GFK A;  3KP2 A;  2K9L A;  2K02 A;  5DM7 F;  1XGS A;  1LE8 B;  3CLQ A;  3CJT B;  4RB2 C;  1SVL A;  3TOB A;  3JRD A;  2M8E A;  3Q3S A;  2EJR A;  3MKL A;  3L7W A;  1B9N A;  3K70 C;  3ABM H;  2W25 A;  3PO3 J;  1D0Y A;  3A1Y A;  3EQL F;  2F48 A;  2VQC A;  4EJU A;  1O3T A;  1TQI A;  2VI6 A;  3N4M A;  5EG0 B;  4XRM A;  5AIP A;  3OOU A;  2D45 A;  2BY3 A;  2CQX A;  3ZXS A;  1YE9 A;  3BZ6 A;  4W1U A;  4B47 A;  2LRD A;  4G7H F;  5C44 J;  4OWR B;  2AXT C;  2R7Q A;  1KQ9 A;  5ILU A;  3SDG A;  4GYI A;  3H5N A;  2RHA A;  1GHC A;  1IN4 A;  4JX4 A;  1JGS A;  4HSR A;  4MXM A;  2X6X A;  3H36 A;  2PEX A;  5LFA A;  4ZTJ A;  2OCE A;  1HDD C;  3EYY A;  2FBI A;  4GGG A;  4MTD A;  2YPR A;  2DK8 A;  4CGZ A;  3LSG A;  2GXB A;  2VOD A;  4E7K A;  3F8B A;  1X4P A;  4BXX J;  5DUK A;  4Y4R A;  3WOD F;  3BLY A;  4A3I J;  3GTJ J;  4U88 A;  1K6Y A;  1SD4 A;  4O6J A;  2F5C A;  3B73 A;  1VQP I;  1UCR A;  3BTI A;  4M3F A;  2GQQ A;  2ZCW A;  2ZCX A;  1T39 A;  4A0Z A;  3KLO A;  1RUO A;  3IAS 2;  3CO7 C;  2ADU A;  1ZAR A;  4I98 B;  4NN1 A;  4NQW B;  4XKC A;  4IHY A;  2A2F X;  2BBY A;  5FO5 A;  4WWC A;  3MWM A;  3CF5 F;  5D19 A;  3OSF A;  4V19 K;  1S72 I;  1B59 A;  4A3G J;  3DXJ F;  2X1D A;  4U9N A;  3BCG A;  3MFK A;  1BW6 A;  4JOM A;  4M74 A;  2FRH A;  1S7O A;  2VT3 A;  1SAX A;  2HTS A;  1YG2 A;  2FBH A;  3W2W A;  2E1N A;  2X51 A;  4CYD A;  4WX9 A;  4FX0 A;  2RC4 A;  3QWL A;  5HDK A;  3E5Q A;  4BJ5 C;  3G73 A;  2DFH A;  1TNS A;  3V8L A;  1U9O A;  4ME9 A;  3L1P A;  2P5K A;  3GTL J;  3ABT A;  1ZEL A;  2JUG A;  2WY8 Q;  2NVU B;  3DTE A;  4PGG A;  2E2I J;  1WHU A;  2E1M B;  3MCZ A;  4EGY A;  3C1D A;  1MJB A;  1UST A;  1G4D A;  1FOX A;  3BJB A;  1QNT A;  4XK4 A;  2NYX A;  3H5R A;  3FKI J;  4UVA A;  1MZB A;  3VOK A;  2OBP A;  3HTS B;  4LOC A;  4KT6 A;  1U8R A;  1S8N A;  2L5Q A;  1BL0 A;  2LRE A;  3ON4 A;  3F0C A;  3IC7 A;  5EJC A;  3KKC A;  1E3O C;  1ETV A;  2R93 J;  2W85 A;  3TBI A;  3IWZ A;  2Z3Y A;  3ZQG A;  1TP4 A;  3FXL A;  1IXS B;  3DBR B;  3IAM 2;  4FE4 A;  2CV1 A;  5FLM J;  3GEU A;  3BQZ A;  4XN3 A;  1B1B A;  1AWC A;  4JQF A;  3BR2 A;  1JXS A;  3W2V A;  3DPL C;  5IYD J;  3KZ9 A;  3TW6 A;  2X4H A;  2W53 A;  2WUI A;  3V7S A;  2V1X A;  2M45 A;  4KNY A;  1QHH D;  3SDB A;  1TT0 A;  2CYY A;  2Q1Z B;  3FXR A;  1YIT I;  5EG0 A;  2OC6 A;  5D6E A;  3HSF A;  2Y9Y A;  1MBG A;  2H27 A;  1KYW A;  3CD6 I;  3HOT A;  3VPR A;  1ZK8 A;  3RPU A;  4IF4 A;  1KU2 A;  5ILS A;  1MGT A;  1HW2 A;  3QU6 A;  3BR3 A;  4FX4 A;  2E36 A;  4YIF A;  2R7T A;  2RAS A;  3F1B A;  1JKO C;  5JHU A;  3DEE A;  3K4B A;  1B4A A;  1GVD A;  5LHG A;  3EUP A;  2P81 A;  1G59 A;  3NEU A;  3U1D A;  1TQM A;  1UHW A;  3TGN A;  5M3F J;  4EMS A;  1WRJ A;  2ZKZ A;  3L00 A;  1U5T C;  3EGQ A;  3S5R A;  2JK3 A;  3BY6 A;  2PBI A;  2H94 A;  5BPI A;  3PNV A;  2CGP A;  2WAF A;  3HYI A;  1R23 A;  3CMA I;  3E6C C;  4AF5 A;  5M5X J;  1SMY F;  3ZMZ A;  3Q0U A;  2B9S A;  1Y0N A;  2ZBK A;  3NPI A;  2HPM A;  3OV8 A;  4RS8 A;  4DQ2 A;  3VYT B;  2Y30 A;  1AKH A;  2CV2 A;  1B9M A;  1D0Z A;  1ZG5 A;  3S2H J;  4OIR F;  2KDO A;  3ASN H;  4XLN F;  4JL3 A;  4GDF A;  3VUQ A;  3CDI A;  5DCM B;  3M8J A;  2WBM A;  3DCF A;  3AG2 H;  3V7C A;  1X3Z B;  5H6Q A;  2IXS A;  3GFL A;  5JVG F;  2CW7 A;  1YTY A;  1XX5 A;  1U8B A;  1JTX A;  3TW7 A;  1WJC A;  2FD5 A;  2D2W A;  1IW7 F;  4M3D A;  4ZZL A;  5IT9 K;  1DP3 A;  4U87 A;  2KQR A;  2A6E F;  4PDK A;  3WU2 C;  4A5M A;  3T6N A;  4MO7 A;  4E7L A;  4CCN A;  2CQ7 A;  1OR7 A;  1SVM A;  2IA0 A;  5DTD A;  1XSV A;  2X85 A;  1Z21 A;  4L62 A;  1C0W A;  4JBA A;  3P9T A;  3F8M A;  1G2H A;  2O61 A;  3K7A J;  4EGZ A;  3HRU A;  5B5E C;  4CXF A;  4E4H A;  1QPM A;  4M9S A;  1UZC A;  4C3J J;  2GXG A;  2K4J A;  3JAM K;  1PJR A;  4BEH A;  4F7Z A;  1W36 C;  2R92 J;  1V55 H;  1V5G A;  2V79 A;  5D8L B;  1WJF A;  4A2U A;  2EV6 A;  1K4T A;  3BZC A;  2DQL A;  1P7I A;  1J75 A;  2KMU A;  5M5Y J;  1K78 A;  2EFN A;  2JSP A;  2QQB A;  4NEL A;  2VOO A;  1HSJ A;  2KDZ A;  1YQA A;  1Y39 A;  3ZN1 A;  3GTO J;  1CF7 A;  4LJZ F;  1FBS A;  2DN0 A;  1FOK A;  4AVP A;  4FQG A;  3SEQ A;  2QUF A;  5LEJ A;  3FBI B;  1SVO A;  3FXU A;  1KGS A;  1IG7 A;  3HOU J;  4ETS A;  1MIJ A;  5D5V B;  2ESN A;  3BPX A;  2MW8 A;  1XGM A;  1IUY A;  1ERD A;  3KEY A;  1Q1V A;  2XPU A;  2OER A;  4NC8 A;  4B09 A;  3VVX A;  3GW2 A;  2KIQ A;  4C9Y A;  4YFK F;  1SAN A;  4D5F A;  2EIJ H;  3I53 A;  5AQC A;  2IGN A;  5KHD A;  4RBO A;  3HOY J;  2YVE A;  1OIS A;  3ZQQ A;  1T33 A;  2RAE A;  3ABK H;  1TQP A;  2GWR A;  3IKV A;  1F5T A;  2LBF B;  4LFU A;  1NG6 A;  2LDU A;  1HCR A;  3RQI A;  5J1R A;  3RZO J;  4BHC A;  1VQ7 I;  5D5U B;  3QBM A;  3CLO A;  4OAY A;  2H1K A;  4ZH4 F;  4CUG A;  3GFJ A;  2AQF A;  5FJ8 J;  1R71 A;  1ULY A;  3LQR A;  5H2F C;  5E3O A;  5GTH C;  1YJW I;  3OIP A;  1MBH A;  2JWT A;  2MD0 A;  2XGC A;  2YS9 A;  3K4C A;  1HXD A;  5F0H A;  3PIO F;  5J1Y A;  3O2P E;  2DJI A;  4ANJ A;  1I3Q J;  1X2M A;  1ZG1 A;  3FXJ A;  1UI6 A;  3K4J A;  1UHM A;  3B6A A;  4HOB A;  1YLF A;  2HYG D;  5KAF C;  1D8K A;  2CQK A;  2P7C B;  4A12 A;  1D1C A;  2D5V A;  3QYF A;  3WGI A;  3L2V A;  4HW0 A;  1G3S A;  2WV1 A;  5BNG A;  1PYV A;  2VKE A;  4LB6 B;  3H0G J;  3WE2 A;  2JVG A;  4UB6 C;  2DU9 A;  1DUX C;  4ENK A;  3HSR A;  3D5L A;  4BBR J;  1JHH A;  2BHZ A;  2EWN A;  3CCM I;  4P96 A;  2JA2 A;  3BP8 A;  4NBQ A;  1TT5 B;  4XKB A;  5M3M J; 
#chains in the Genus database with same CATH homology
 3GTP J;  2I10 A;  5HOD A;  3JRB A;  2R5Y A;  1UHS A;  2DA2 A;  2EZL A;  3C2B A;  4DZP A;  3BRU A;  1RPW A;  1WH7 A;  1GV5 A;  2NVQ J;  2NP3 A;  1OCP A;  1IRZ A;  1F43 A;  4V2F A;  5F04 A;  1K61 A;  3VW0 A;  4HNV A;  2JA8 J;  2QKO A;  4B4C A;  4DW6 A;  4D7N A;  1IDY A;  2VPR A;  2GBY A;  2LFB A;  3MVP A;  3JRA A;  1NK3 P;  3HB9 A;  1Y1V J;  3IH2 A;  1O4X A;  1GT0 C;  5K7H A;  3DPJ A;  5C3E J;  3Q0V A;  1I6H J;  1B8I A;  3UKG A;  1Z0X A;  1FTZ A;  5EZG A;  1ETY A;  2PMZ N;  4C2M J;  2CJJ A;  3BTJ A;  3BR0 A;  1UMQ A;  3JR9 A;  2DJN A;  5C4J J;  3HOZ J;  3HOX J;  2G7G A;  1TWH J;  1RKT A;  4X1E A;  4NDL A;  3HTA A;  4DYQ A;  2EH3 A;  4GCT A;  3Q0W A;  3KKD A;  3FIS A;  3GZI A;  1B72 B;  1WGX A;  2VKV A;  1OJL A;  3BTL A;  3GTQ J;  2OI8 A;  3OIO A;  3HTJ A;  5J3L A;  1JT6 A;  3VP5 A;  9ANT A;  2GFN A;  2EZI A;  1POG A;  2R5Y B;  1AU7 A;  2UXU A;  4QIW N;  2DMT A;  3PPB A;  3QQA A;  1HF0 A;  1LFU P;  3HE0 A;  1NTC A;  3GBG A;  1MH4 A;  1I50 J;  3A02 A;  3BHQ A;  3S1M J;  2Y31 A;  2M34 A;  1QRY A;  4A3J J;  3JRG A;  4ACI A;  3LSP A;  4M3E A;  3O8H A;  5JLW A;  2LTP A;  1XS9 A;  1JUM A;  1R9T J;  5H9T A;  2M2E A;  3MN2 A;  3RKQ A;  1K83 J;  2ECB A;  5FKK A;  3ANG A;  5C4X J;  3NAR A;  2TRT A;  3HGY A;  3BG3 A;  2WGB A;  1WI3 A;  2UXO A;  3BG5 A;  3QPS A;  2Y9Z A;  4V2G A;  1JJ8 C;  2DTZ A;  5IPA A;  2FBQ A;  3NXC A;  3O60 A;  5FMP A;  2HOA A;  4D5C A;  2HYT A;  3LWJ A;  2HXO A;  1Y1W J;  1YRN A;  3M4O J;  1B8I B;  1MH3 A;  1MSE C;  2O8K A;  5IYB J;  3KNW A;  2QOP A;  3RH2 A;  5C4Y A;  1FJL A;  4BY7 J;  1OCT C;  3QKX A;  5F1J A;  1F36 A;  4EEF G;  1S7E A;  2F07 A;  2DA7 A;  4CYC B;  2JA5 J;  3BT9 A;  4YZE A;  1JTY A;  3AQT A;  3PAS A;  2UXH A;  4PXI A;  3I4N J;  2XDN A;  3A03 A;  4JX5 A;  3MNL A;  2CUE A;  3NRG A;  5FLV A;  5K7F A;  3TP0 A;  4UUS A;  4C3I J;  2ECC A;  2NP5 A;  2EQR A;  5EGO B;  1W0U A;  3HOW J;  2LLK A;  3IH4 A;  1CQT A;  1QVU A;  1T56 A;  1JKR C;  3V6G A;  3ZQH A;  3ZQC A;  3V78 A;  1TWG J;  2DA3 A;  3CCY A;  4I76 A;  3BTC A;  2VUM J;  3NAU A;  2GLO A;  3RZD J;  3C07 A;  3O8G A;  4FIS A;  5GPA A;  3LSR A;  4Y52 J;  5E3N A;  3NNR A;  3DEW A;  4A69 C;  5E3M A;  2CU7 A;  2ME6 A;  1NK2 P;  4ABZ A;  3BR6 A;  3E7L A;  1H89 C;  2L7F P;  3HBL A;  5D1R A;  2WB1 N;  3SFI A;  2NOG A;  4HKU A;  4UUT A;  2NS7 A;  2L7Z A;  4GCK A;  4MIM A;  4GFK A;  2LD5 A;  4A3L J;  3CJD A;  3M3Y J;  1LE8 B;  5EFY A;  2L9R A;  1IV6 A;  5F0C A;  5HAW A;  1TC3 C;  2XGE A;  2LVS A;  1D5Y A;  3JRD A;  2WAQ N;  1Z77 A;  4DYC A;  1JKP C;  3Q3S A;  3MKL A;  2FQ4 A;  4B3A A;  3JRI A;  3JSJ A;  3PO3 J;  3ZQF A;  3FRQ A;  5J1U A;  3BQY A;  1ZR4 A;  2JMW A;  2VI6 A;  2X48 A;  5EG0 B;  4XRM A;  3HIM A;  3OOU A;  2CQX A;  4XRS A;  1B72 A;  2JJ7 A;  1TWA J;  4W1U A;  3GTG J;  4JP0 A;  3VVZ A;  5C44 J;  4AUX A;  3SDG A;  1A6I A;  3JRH A;  1A5J A;  2RHA A;  1HDP A;  4JX4 A;  3LOC A;  5FGL A;  2G7S A;  2YVH A;  4MXM A;  3K2A A;  1JT0 A;  1HDD C;  4QTR A;  1MBE A;  2O9L A;  3OSG A;  2Y2Z A;  3LSG A;  4BBS J;  4BXX J;  5IP6 A;  4BKX A;  3G1L A;  1GUU A;  1AKH B;  4A3I J;  3GTJ J;  1ZTR A;  3CMY A;  2HDD A;  4G12 A;  2IBD A;  2HOS A;  2IEK A;  2EBI A;  1IGN A;  1ENH A;  4MK6 A;  2PZ9 A;  3W6V A;  2K9S A;  3BTI A;  4M3F A;  3BG9 A;  2M8G X;  2M9H A;  2ZCX A;  2LY9 A;  5E3L A;  2LK2 A;  2JA7 J;  5EYR A;  3QPL A;  2MG4 A;  1RES A;  2LP0 A;  4A3E J;  1VI0 A;  1IC8 A;  2OPT A;  1YRN B;  2G3B A;  3VW2 A;  3HEF A;  3JRE A;  2QIB A;  4A3B J;  4ICH A;  4NN1 A;  4RDU A;  2EZK A;  4IHY A;  3AQS A;  5D19 A;  3ZQL A;  3VW1 A;  3OSF A;  2E2J J;  2R5Z A;  1MNM C;  4A3G J;  3BCG A;  1BW6 A;  4MFE A;  2DA6 A;  5IOZ A;  4A3M J;  3G1O A;  2W48 A;  1QPI A;  4FTH A;  1ZGW A;  2UXP A;  3ON2 A;  4M6V A;  2R7Z J;  3S15 J;  3PM1 A;  3HKZ N;  2HOT A;  1U9O A;  3HTH A;  3L1P A;  4ME9 A;  3GTL J;  3VVY A;  1DU0 A;  4A3C J;  2E2I J;  2G7L A;  3A01 A;  5FKM A;  5IP9 J;  4M3G A;  3ZQI A;  1HLV A;  4S0H B;  2GEN A;  3BJB A;  4XK4 A;  2ZCN A;  3FKI J;  1IUF A;  2H8R A;  3B6C A;  5HBU A;  2CRG A;  4A3D J;  5EF6 A;  3I4M J;  2X9D A;  3VOK A;  1SGM A;  4LOC A;  4B1R A;  1BL0 A;  3ON4 A;  3F0C A;  2Y0S N;  3LJL A;  4IHX A;  3ANP A;  2XB0 X;  4DYR A;  3KKC A;  1ZKG A;  1E3O C;  2L7M P;  2QF7 A;  1ETV A;  1MBJ A;  2NS8 A;  3BR1 A;  5F08 A;  2R93 J;  4I6Z A;  3ZQG A;  4L5E A;  2PBX A;  1ORK A;  1APL C;  5JLX A;  2AHQ A;  4BY1 J;  4FE4 A;  2DMP A;  5FLM J;  3GEU A;  3BQZ A;  1UG2 A;  3G56 A;  2N8G A;  3BR2 A;  3VIB A;  1FEX A;  5IYD J;  3KZ9 A;  3TW6 A;  2W53 A;  1JKQ C;  2CUF A;  2WUI A;  1SFO J;  1VFC A;  4GFB A;  3RD3 A;  5EG0 A;  1ZR2 A;  5FHP A;  3HTI A;  1X58 A;  2Y9Y A;  1MBG A;  1RKW A;  2DA5 A;  1LFB A;  3TP3 A;  3VPR A;  1ZK8 A;  2HKU A;  1GV2 A;  2MGQ A;  5M5W J;  4KWA A;  4XID A;  3BR3 A;  5IYC J;  4CGR A;  2HYJ A;  2DMN A;  2RAS A;  3F1B A;  1JKO C;  2L0K A;  1U78 A;  2M0C A;  2X6O A;  1XG1 A;  1LE8 A;  1GVD A;  5D18 A;  2UXI A;  2P81 A;  2QTQ A;  3SJM A;  2XPW A;  3FIW A;  3CRJ A;  3EUP A;  3JRC A;  3S17 J;  3BNI A;  2ID3 A;  1PUF B;  5M3F J;  1VF9 A;  1MSF C;  3G7R A;  4C3H J;  3IH3 A;  2HI3 A;  2EZH A;  3EGQ A;  3S5R A;  2JK3 A;  5CXI A;  1WCM J;  4AC0 A;  2MSY A;  3B81 A;  3ZOB A;  2JN6 A;  3HM5 A;  1EF4 A;  4GFL A;  4AF5 A;  5M5X J;  3HOV J;  1ETO A;  3Q0U A;  4A93 J;  2Q24 A;  1HOM A;  2QCO A;  2DA4 A;  2ZCM A;  3NPI A;  1GDT A;  3PO2 J;  3HDD A;  3NI7 A;  3S14 J;  3G1M A;  1VND A;  3FK7 A;  2Y30 A;  1AKH A;  3VOX A;  3S2H J;  5HSZ A;  5DAJ A;  1XC5 A;  5EGO A;  1AHD P;  1TWF J;  2YUS A;  2XSD C;  4JL3 A;  4J19 A;  3VUQ A;  2R5Z B;  2ZOY A;  3WHB A;  2TCT A;  3DCF A;  1JGG A;  3GTM J;  1P7J A;  2LR8 A;  1U8B A;  2NX4 A;  1JTX A;  3TW7 A;  4UUS B;  2GM4 A;  2NVT J;  2CQQ A;  2FD5 A;  3S1R J;  4JYK A;  4M3D A;  5FKN A;  3COL A;  1ETK A;  5IP7 J;  2DMQ A;  2ELK A;  2B63 J;  3T6N A;  4MO7 A;  4IHW A;  4JNN A;  5DTD A;  3LNQ A;  1JUP A;  4FE7 A;  4L62 A;  2IU5 A;  3P9T A;  4CYC A;  1G2H A;  3K7A J;  3D1N I;  2XGD A;  4A3K J;  1IJW C;  5EDN A;  4C3J J;  3IV5 A;  1BW5 A;  3H3V K;  2R92 J;  2FX0 A;  1H88 C;  3S16 J;  5K58 A;  3LHQ A;  3TED A;  1ITY A;  3CWR A;  1BA5 A;  1P7I A;  2FJ1 A;  5M5Y J;  5EEA A;  1ZQ3 P;  2OF7 A;  2G0E A;  2KDZ A;  4NEL A;  3GTO J;  3CDL A;  1BJZ A;  4D7M A;  2AO9 A;  2DN0 A;  3GTK J;  5GPC A;  2ZB9 A;  2NVY J;  1MBK A;  2E1O A;  2XRL A;  1H8A C;  2DMU A;  2KT0 A;  1IG7 A;  3HGG A;  4AC6 A;  5K7Z A;  4FCY A;  3HOU J;  1UI5 A;  3IUV A;  1ETQ A;  2REK A;  2YU9 J;  2MW8 A;  2OER A;  1Q1V A;  2XPU A;  4JX6 A;  2HXI A;  3VVX A;  2XB5 A;  5CW8 A;  1SAN A;  4D5F A;  4XRS G;  5FKO A;  1U9N A;  2XPV A;  1JJ6 C;  3LSJ A;  5AQC A;  3S1Q J;  1TWC J;  4RBO A;  3HOY J;  2YVE A;  2R0Q C;  1T33 A;  2RAE A;  3BR5 A;  3FK6 A;  4DZJ A;  3S2D J;  1HCR A;  4M3B A;  2DG8 A;  5EZH A;  3RQI A;  1WH5 A;  5J1R A;  5FKL A;  3RZO J;  2HQ5 A;  4X6A J;  3QBM A;  2K9N A;  2O7O A;  1RET A;  2H1K A;  2DA1 A;  5FJ8 J;  4GCL A;  2LKX A;  4MFD A;  5E3O A;  1FIP A;  1X2N A;  1MBH A;  2JWT A;  4XIC A;  2XGC A;  1W0T A;  1OFC X;  4QSH A;  4JKZ A;  2ME0 A;  2YS9 A;  2K40 A;  1QVT A;  5F0H A;  4IHV A;  1ETW A;  3A01 B;  4Y7N J;  1MBF A;  5IOY A;  4MLO A;  5J1Y A;  5DS9 A;  2JA6 J;  2D6Y A;  1I3Q J;  1X2M A;  1JUS A;  3E7Q A;  1UI6 A;  4A3F J;  5F27 A;  1FTT A;  3S1N J;  5CXG A;  3B6A A;  1PUF A;  4IEJ A;  2E19 A;  1WPK A;  5F0F A;  3CQZ J;  3WHC A;  4W97 A;  2D5V A;  2QWT A;  3JRF A;  4AYB N;  2COB A;  2E2H J;  2WV1 A;  1ETX A;  5BNG A;  2VKE A;  3H0G J;  1DU6 A;  2IAI A;  1FIA A;  2K9Q A;  2V57 A;  4BBR J;  5GP9 A;  2O7T A;  4UDS A;  1RR7 A;  2ID6 A;  5M3M J;  2DG7 A;  2ZOZ A;  2GUH A;  1IDZ A;  2NVX J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...