2OPTA

Crystal structure of apo actr from streptomyces coelicolor.
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
219
structure length
209
Chain Sequence
b'AMAPLTQDRIVVTALGILDAEGLDALSMRRLAQELKTGHASLYAHVGNRDELLDLVFDIVLTEVEVPEPEPGRWAEQVKEMCRSLRRMFLAHRDLARIAIDRVPLGPNGMVGMERTMNLLRSGGLHDELAAYGGDLLSTFVTAEALEQSSRAGVFADQLHGYLKSLPATSFPNLVHLAGPITSLDSDRRFELGLEIIIAGLLAGAGEAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ActII protein
publication title Crystal structures of the Streptomyces coelicolor TetR-like protein ActR alone and in complex with actinorhodin or the actinorhodin biosynthetic precursor (S)-DNPA.
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Transcription
total genus 79
structure length 209
sequence length 219
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF02909 TetR_C_1 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2optA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2optA02
3VPRA 3HOXJ 3HIMA 2L7MP 2CRGA 3I4NJ 2WAQN 3BHQA 3RKQA 1BW5A 1FJLA 2HOAA 5CXIA 4AC0A 2GFNA 4M6VA 3GTMJ 2MSYA 2K9SA 3LNQA 1AKHB 2LFBA 5FHPA 1DU6A 5IP6A 3PPBA 1OJLA 3HM5A 4AF5A 1JJ6C 3G1OA 4B3AA 3JRDA 3ZQCA 2LTPA 3S1RJ 4A3CJ 3MVPA 5F0CA 1OCTC 1SANA 1WPKA 1EF4A 3BRUA 3JRCA 2CJJA 2EZKA 2E2JJ 1K83J 2WV1A 3GTJJ 3BNIA 4GCLA 4CYCB 4W97A 5J3LA 3JRGA 2HKUA 3HGYA 2B63J 1LFUP 2ECCA 3FK7A 2ME0A 1W0UA 3GTQJ 3ZQGA 4XRMA 2VKVA 4QIWN 1ZKGA 3FIWA 2D5VA 2F07A 3BQZA 1U9OA 1JTXA 5FKNA 1DU0A 1XC5A 2LK2A 1T56A 5E3NA 1JUSA 3LSPA 2UXIA 1WGXA 2QKOA 1G2HA 3UKGA 1A5JA 2Y9ZA 5JLWA 4A3JJ 1UI5A 2R5YA 1RKTA 2DN0A 3M3YJ 2ID6A 1UI6A 1TWCJ 4UUSA 3Q3SA 3IH3A 1X2MA 2ZOZA 3WHCA 5M3FJ 3SDGA 3JREA 1F43A 1HF0A 3EUPA 2FD5A 5FLMJ 2JWTA 2HDDA 3BR3A 1RPWA 1PUFA 2QCOA 4A3KJ 3LOCA 4DYRA 2XRLA 3OSFA 2R92J 1H88C 1ZR2A 5JLXA 1WCMJ 3TW6A 3A01A 1ITYA 2G7LA 3P9TA 3VUQA 2DMNA 2X6OA 5EGOA 3ZQIA 1VI0A 5M5WJ 3LJLA 4JYKA 2PMZN 3VW2A 2ME6A 2Y0SN 1JKPC 2NOGA 4JP0A 4XRSG 5J1RA 1YRNB 5D1RA 3HOVJ 2NVTJ 1RETA 1GVDA 3FKIJ 1QVTA 4AYBN 2E19A 3RH2A 2ZB9A 1HLVA 4MK6A 2R5ZB 2EH3A 5C4XJ 2TCTA 3VW0A 3S14J 4LOCA 2JA8J 4XICA 3B81A 2XPVA 2NS7A 4ABZA 2HXOA 1VFCA 2H1KA 4GFKA 3H3VK 3NAUA 2YUSA 3BCGA 3ZQLA 4FTHA 3ZQHA 5M5YJ 2DA5A 4RDUA 2O8KA 4A3GJ 4AC6A 1JUMA 3Q0UA 1F36A 5FMPA 5F27A 4X1EA 4V2FA 5HBUA 2FX0A 4RBOA 3CDLA 1ETKA 2YVEA 1TWHJ 4BKXA 3VOKA 3GZIA 4M3BA 2JMWA 4A3DJ 2DMPA 2VUMJ 2G3BA 1QRYA 1IUFA 4M3GA 4GFBA 3S17J 2JA5J 2OPTA 3OSGA 2OI8A 2DMUA 2QWTA 2EQRA 4QTRA 3OOUA 4DYQA 4YZEA 3VP5A 1JGGA 1SFOJ 3GTGJ 3A02A 2AO9A 1IDZA 5D19A 4CGRA 2QF7A 3CRJA 1WH5A 3BR2A 2O7TA 4JL3A 2HI3A 3AQTA 3PASA 1OFCX 5EG0A 2DG7A 4QSHA 2DMQA 4A93J 5GPAA 1LFBA 1NTCA 4MFDA 2Y31A 4DW6A 1UHSA 4IHWA 3HOZJ 4A3FJ 1IG7A 1NK3P 2NVQJ 1IV6A 4MO7A 5C3EJ 1OCPA 2XB0X 3Q0VA 1MNMC 3KKCA 3BG9A 3HOYJ 1ETQA 3V78A 4GCTA 3Q0WA 2NX4A 3GTKJ 5FKKA 1BJZA 2NP5A 1XS9A 2IU5A 4MFEA 2QIBA 1ZGWA 5M3MJ 1RKWA 2FBQA 3BT9A 1W0TA 5FKLA 2LP0A 3FISA 2XB5A 4UUTA 1CQTA 4G12A 3NPIA 3KZ9A 3S16J 1QVUA 2R5YB 3QBMA 2GLOA 5HSZA 4A3IJ 4UUSB 3BR0A 1MSFC 3HTAA 4FE7A 2N8GA 4D5CA 4AUXA 5K7FA 4FISA 1JT6A 2VKEA 5F1JA 3IV5A 1HCRA 2E2IJ 2V57A 2JA7J 5H9TA 3GEUA 1IGNA 1FIAA 1JTYA 4FE4A 4MIMA 1PUFB 2HQ5A 2LY9A 2MG4A 5DAJA 1IDYA 2G7GA 3M4OJ 1SGMA 5IYBJ 3A01B 2H8RA 4XRSA 3S15J 5EGOB 1BA5A 2K9QA 1AHDP 4NELA 3BR1A 4ME9A 3K7AJ 2M2EA 2ZCNA 4NDLA 2QTQA 3EGQA 4IEJA 1HOMA 2HYJA 1I3QJ 2CQXA 3D1NI 2WUIA 3JRHA 5C4JJ 1D5YA 5FGLA 3BR6A 2RASA 2HOSA 4A3LJ 1UMQA 2NVYJ 5EZHA 1VNDA 1I6HJ 3S1QJ 2DA7A 2ZCMA 2CUFA 2LVSA 2OF7A 1IJWC 4DYCA 3VVYA 4D7NA 3F1BA 4HKUA 2COBA 2EZLA 5FLVA 4BY7J 5DTDA 5EFYA 2XDNA 1IC8A 3E7QA 1U8BA 3NARA 3QPSA 2MGQA 3K2AA 1ZK8A 1ETVA 4I6ZA 2K9NA 4IHXA 2YS9A 1Z77A 2ECBA 3VIBA 2UXUA 1AU7A 3TP0A 5IOYA 5EDNA 3L1PA 3VVXA 2XSDC 5DS9A 3VOXA 3CJDA 1ETWA 1FTZA 3DCFA 4L5EA 3H0GJ 5F0FA 5E3LA 3PO2J 1TWAJ 2AHQA 3HTIA 4I76A 4XK4A 4Y52J 4BY1J 1BW6A 1ETYA 3HKZN 2DG8A 1MBHA 1LE8A 2G0EA 1HDDC 3ZOBA 5IOZA 3COLA 1A6IA 2IAIA 1O4XA 1WI3A 5EG0B 2R0QC 3ON4A 2TRTA 2L7FP 3ON2A 4L62A 5AQCA 5K7ZA 5E3MA 1B8IA 3HTJA 2X48A 2DA2A 4JNNA 3LSGA 3HOWJ 5FJ8J 2XPUA 3G7RA 4XIDA 4Y7NJ 2GUHA 2DMTA 1RESA 1X2NA 5M5XJ 3QPLA 3NXCA 5GPCA 4JX4A 3RZDJ 1K61A 1BL0A 2LD5A 5F0HA 2LLKA 3PM1A 3CQZJ 3ANPA 3C2BA 3CMYA 1ZTRA 3DEWA 5F08A 2CQQA 2O9LA 2REKA 3RD3A 2UXHA 2JA6J 5C44J 4BBSJ 2M0CA 3O8GA 5IYCJ 1JT0A 3IUVA 2YVHA 2L7ZA 1GT0C 2EZHA 5CW8A 4BXXJ 2GM4A 3GTOJ 4ACIA 2Q24A 4C2MJ 5BNGA 3KKDA 2E2HJ 4KWAA 3BQYA 3W6VA 2RHAA 2XGDA 2QOPA 1I50J 2WB1N 4M3DA 1JKRC 1TC3C 5K58A 2NP3A 1JJ8C 4A69C 1Z0XA 3CWRA 1U9NA 1MBKA 1TWGJ 5HODA 4IHVA 4C3IJ 1E3OC 2P81A 1B72A 3BTJA 2Y2ZA 3A03A 1H8AC 2VI6A 3T6NA 2WGBA 2E1OA 2ID3A 2JJ7A 1FTTA 5C4YA 2LKXA 3RZOJ 3NI7A 2ZCXA 4D5FA 3JRAA 2DTZA 1GUUA 3VVZA 2VPRA 2GENA 1APLC 4EEFG 1IRZA 1UG2A 3HBLA 3C07A 2LR8A 4S0HB 4MXMA 3VW1A 3MNLA 2G7SA 2W53A 3LSJA 2YU9J 2Y9YA 3RQIA 1Y1VJ 3SFIA 2DA1A 2D6YA 2K40A 4GFLA 1JKOC 2IBDA 5EYRA 3BR5A 3G1LA 1Q1VA 3PO3J 1T33A 3FK6A 5GP9A 3OIOA 5F04A 2KDZA 2XPWA 4JKZA 2GBYA 1QPIA 3FRQA 4MLOA 5J1UA 2R7ZJ 3HOUJ 3HTHA 2JN6A 3JRFA 3GTPJ 5HAWA 2MW8A 4ICHA 3LWJA 5IPAA 3BTLA 2OERA 3JR9A 1AKHA 2M34A 1MBEA 4JX6A 1MH4A 2L9RA 1ETXA 3B6AA 3NNRA 3S1MJ 2UXPA 1VF9A 3BG3A 3GBGA 1LE8B 3ZQFA 3GTLJ 3BTIA 5IYDJ 2O7OA 3F0CA 4C3JJ 3ANGA 2I10A 4JX5A 1GV2A 1S7EA 2DA6A 2X9DA 3B6CA 4DZJA 1B8IB 3WHBA 2ELKA 5J1YA 2RAEA 1NK2P 1R9TJ 4UDSA 4CYCA 2M8GX 4IHYA 3HDDA 3G56A 1MSEC 3S2DJ 3G1MA 4A3BJ 1WH7A 3QKXA 4GCKA 2FJ1A 4C3HJ 3AQSA 1GV5A 3TW7A 3O8HA 4V2GA 3BG5A 3S5RA 3LSRA 4BBRJ 3HGGA 3MN2A 2Y30A 4HNVA 2DA3A 5K7HA 2R93J 3JRBA 3TP3A 4D7MA 2NVXJ 1POGA 1U78A 2XGCA 4M3FA 2ZOYA 2DJNA 3SJMA 1ZR4A 3BJBA 5D18A 3E7LA 1MBJA 3O60A 2UXOA 3S2HJ 2PZ9A 2CUEA 3TEDA 2HOTA 4A3MJ 1ZQ3P 3DPJA 4FCYA 2HYTA 1JKQC 2KT0A 5FKMA 1ENHA 1GDTA 5EEAA 2M9HA 1MH3A 2W48A 5FKOA 2HXIA 2NS8A 3IH4A 1P7IA 3HE0A 1H89C 1B72B 3JSJA 5IP7J 1YRNA 1ORKA 1P7JA 3IH2A 4B1RA 2L0KA 2EBIA 3LHQA 2DA4A 4X6AJ 4W1UA 5E3OA 5IP9J 3NRGA 2R5ZA 4DZPA 3MKLA 1XG1A 1JUPA 3I4MJ 1RR7A 2EZIA 1MBGA 3CCYA 3JRIA 3HB9A 3QQAA 3KNWA 3S1NJ 1ETOA 2FQ4A 3HEFA 2JK3A 2XGEA 4M3EA 2PBXA 4NN1A 3V6GA 5EF6A 4A3EJ 2CU7A 9ANTA 1TWFJ 2IEKA 1MBFA 1FEXA 4PXIA 5EZGA 1HDPA 3BTCA 4B4CA 5CXGA 4J19A 1FIPA 1Y1WJ 1X58A
chains in the Genus database with same CATH superfamily
3VPRA 1MIJA 3HIMA 2VN2A 2RDPA 2M87A 3I4NJ 3G3ZA 4E7KA 1QBJA 1D3YA 4E6KG 1FJLA 5CXIA 2O6GE 1LEBA 2H6BA 4AC0A 4MEYF 3GTMJ 2K9SA 2X85A 2DLLA 2XGXA 1ZAOA 2L9VA 1N78A 1X1CA 2Z2SB 2R7XA 2EFQA 2KIFA 1A04A 4BXUA 2PFVA 3VYTB 1FYMA 2KRFA 4BAYA 2WV0A 2E1CA 3ZQCA 3PUFA 3S1RJ 2WBMA 2NNNA 3AL0B 1OCTC 1FYLA 1WI9A 3BRUA 3EETA 3JRCA 2EZKA 5JFRA 1V3FA 1K83J 3R0JA 3DPLC 3BNIA 3T8TA 4D9JA 4W97A 4OWRB 5J3LA 3SXYA 2EV6A 5JR3A 2OQRA 3FK7A 1D8KA 4BXFA 5FRMA 2Z33A 3ZQGA 4XRMA 3NS4A 1FPQA 2V1DA 4QIWN 2E34A 3BQZA 4ENMA 4DIQA 4L9TA 4A12A 2CQNA 5FKNA 1U3EM 4ZJZA 1D0YA 3UKGA 1A5JA 1U5TC 2W1OA 4Y33A 2ZXWH 2ZO4A 1PUEE 1X4OA 3M3YJ 2ID6A 4ASNA 1TWCJ 2ZFWA 3CMMA 1W7PB 3FXLA 4CUGA 1ACIA 2P5KA 1HW2A 1TBXA 1X2MA 3IH3A 4XLNF 3OIPA 1B6AA 3EUPA 4GYGA 1LNWA 3GYHX 1LQ1A 3WG7H 3BR3A 3CO6C 1YS6A 1YJWI 3P5JA 2D45A 2XRLA 1DGWY 2ZJRF 3BJOA 1WCMJ 1G3SA 1U5TA 2DOEA 3OYBA 4WF2A 5M5WJ 4JYKA 2PMZN 1ZHFA 4ZC3A 1O3RA 5J1RA 5D1RA 2NRAC 3VYUB 1ZG5A 1R36A 3NQOA 4AYBN 2OUMA 4I0BA 4R8HA 2R5ZB 1OLTA 3TQNA 3SEZA 2JA8J 2FBKA 4XICA 2H1KA 1MZBA 1QZZA 2A61A 5TGTA 1E17A 3BCGA 3ZQLA 5M5YJ 4RDUA 2GIZA 4A3GJ 4FHTA 5IY5H 3Q0UA 4X1EA 1KU2A 2O03A 3I5UA 3IP4B 2JSCA 2IS6A 3PJRA 4BKXA 3VOKA 3GZIA 2HVQA 3V42A 2P8TA 3OYEA 4ENJA 4NC8A 3S17J 1SFXA 2OPTA 2VE9A 4ZYGA 2IGKA 3C2GA 5CVIA 2KMUA 4A6EA 4DYQA 2VQGA 2BOLA 3BPVA 3GTGJ 3K69A 1IDZA 3MZ8A 2CMPA 2QF7A 4N9IA 4JL3A 2HI3A 2JT1A 3AQTA 1AA7A 4ESBA 2ZJPF 5E1ZB 5J47A 3QODA 3UNGC 2FEZA 1TQPA 4QSHA 2MD5A 1SVLA 1UZCA 2LC2A 5LRRA 2OZUA 2QSFX 3OOPA 3HL2A 3BPXA 2H94A 4M73A 3FF5A 5L3CA 3RKXA 2Y31A 2EFNA 3HOZJ 3IAM2 1X1AA 4A3FJ 2LREA 4HNTA 1IG7A 5DM6F 1FOYA 3QYEA 3LSKA 2EIJH 1IV6A 4MO7A 2YPRA 2AS5F 4CCKA 3CP2A 3GZ5A 1OCPA 5J6XA 3M1CA 2K85A 1G8XA 1X3ZB 1KU9A 1NHAA 3TGNA 1BM9A 4GCTA 2NX4A 1BOBA 1Z7LA 5FKKA 1BJZA 2ZKZA 4MFEA 1ZGWA 1R1UA 1T2KA 2DOFA 5BQTA 4ZZDA 3W6KB 4E7IA 2XF6A 3R60A 1YHQI 4G6QA 4I98B 1N77A 4GO1A 1WKMA 3NWTA 3ONQA 3OR1C 1W5SA 3T8RA 1MSFC 3IRRA 3HTAA 1VQKI 5HS8A 4D5CA 2GIVA 3ABLH 1JHHA 3IV5A 2V57A 1BI3A 2BHYA 3BWGA 4ZTJA 2JA7J 4FE4A 2FXAA 3H92A 5FD5A 4E70A 2CV0A 2PLYA 5DAJA 4BJTA 2DDAA 2G7GA 1OCOH 3H0DA 3K10A 2ZMEC 2HZTA 3C2HA 3QP6A 3QOPA 3BR1A 4XKVA 2QTQA 4HW0A 3PNVA 1J0RA 4IEJA 4CCMA 2PI0A 1PVEA 4BHCA 1YS7A 3ZGKA 5K1YA 4E7ZA 3NRVA 3BR6A 4AVZA 2HOSA 3NWSA 3VSLA 5LRSA 1UMQA 2M7AA 5EZHA 4OINF 3F9KA 3S1QJ 1FT9A 1PP7U 5B5EC 2ZMEA 3DFGA 3W3CA 4D7NA 4M74A 2GA1A 4HKUA 1BC8C 3MEXA 2F5EA 2COBA 2EZLA 5FLVA 1RR8C 2XDNA 1O3QA 1U8BA 3NARA 2IPQX 3QPSA 2BY1A 3RPUA 4HG2A 2K27A 3R6SA 4XL9A 3JSPA 1XSXA 4LLGF 1W5CC 2BGCA 1YOVB 3WGHA 4P9FA 5K5QA 2XASA 5CVRA 2XSDC 1XDUA 1ZYRF 5D8LB 4L5EA 5F0FA 3CCVI 1FBSA 4MGRA 2IA2A 4LIUA 1J75A 4CYDA 3HKZN 2DG8A 1MBHA 4KN7X 3R0AA 3SYTA 2JSPA 1SAXA 3KYLA 3CESA 2FU4A 5IOZA 1BOAA 4RM3A 4XSXF 3G73A 5ED4A 3TMOA 3ON2A 3OR2C 1HKQA 2ZNZA 5K7ZA 5E3MA 3SHFA 3HTJA 2DT6A 3K2ZA 3LSGA 5FJ8J 2XPUA 4XIDA 2DMTA 1R22A 2W00A 1V54H 4Y15A 5GPCA 1E3PA 2IVMA 1MJBA 3MAJA 1UCRA 3FXUA 3RZDJ 4GRIA 4KUMA 5F0HA 1BN5A 3HSFA 3OYNA 4BQQA 3OL4A 1WZ2A 4PGHA 3L2VA 2CQQA 1I1GA 1FMWA 3RD3A 4KIFA 2JA6J 1I1SA 4BBSJ 2DPDA 2UXXA 2QEXI 2EZHA 3WU1B 3ZN1A 2LYCA 1PYVA 3J81K 1Z6TA 2F2EA 4IRGA 2RREA 5FRNA 2G7UA 1YLFA 3KKDA 2BHZA 4PCQA 4KWAA 2HYFA 3W6VA 1XMAA 3TOAA 4CA0A 2P7VB 5CQGA 1TC3C 2NP3A 1Z0XA 2VXDA 4EM0B 2VC0A 2WY8Q 1MBKA 3CCMI 5CQEA 4I7HA 1TWGJ 1X1PA 2HVRA 4N9HA 1XMKA 1BBYA 2P81A 3QAHA 2HZDA 1H8AC 2VI6A 4RAYA 2E1OA 2CW7A 1MJ9A 3V7CA 3ZXSA 2ZCXA 2AXLA 1SD5A 1VZ0A 1XGOA 4L9VA 3RI4A 3R61A 2GENA 1RZ4A 2DODA 1FP1D 4G7OF 1X4PA 3WTYC 3RYPA 2I8DA 4XN0A 5E1XA 1ON2A 3VW1A 3MNLA 2G7SA 2O8XA 3AFHA 3LSJA 3OYGA 2O0YA 4N0BA 3FKJA 4G6DA 2V1XA 1XMXA 2XAHA 3B73A 1GVJA 3SFIA 1H0MA 4XKCA 1FZPB 4G6TB 1GXPA 4L0ZB 4GFLA 2ZMEB 1D0ZA 2R7WA 4F91B 1S7OA 1Z21A 2M8EA 5EYRA 4B3XA 3Q5FA 5FLXK 3W2AA 3K9TA 1Z3XA 3F8FA 4G8XA 2HQRA 3DEUA 2GBYA 5FFZA 3FRQA 4MLOA 5DD8A 2OA4A 3LA7A 2R7ZJ 3HTHA 2HKXA 3T5XA 2K3PA 4V19K 3MD2A 5HAWA 3LMMA 3UR3C 3VTIA 4Y13A 4H4KC 4O5VA 1B9MA 3CZ6A 2OERA 2QKLB 1AKHA 5CVVA 1MH4A 2PQ8A 4F55A 4ZYAA 5BMZA 2Q0OA 1Y8QB 1VF9A 3GBGA 3ZQFA 3G4SI 3GTLJ 4R1HA 3F0CA 3A0BC 4C3JJ 5GTIC 3ANGA 1D1CA 5HNFA 3DQVC 1YJNI 5D6EA 2I10A 3OWTA 2ZXJA 2DA6A 5FB2A 3VFZA 1OR7C 4PDKA 2ELKA 1ON1A 3WHBA 5J1YA 4HDUA 3GX4X 2M8GX 3HDDA 1VQ9I 4PJMA 3G1MA 3HYIA 3QKXA 3K4MA 1K79A 4LITA 2JPCA 2RV8A 2KJCA 3KE2A 1NH3A 2FJ1A 3AQSA 1M1EB 2HDWA 3LSTA 4L9NA 4V2GA 1FOKA 3WGIA 3CJQB 2M7BA 2DA3A 5K7HA 2LG4A 5GAHJ 3K4LA 2OC6A 3ML6A 4RB1A 1WJCA 4F3QA 1OR7A 2MC3A 1V5FA 1X3WB 5J4VA 4BEHA 4XLAA 1EJ9A 1IXRC 3DU5A 1FWZA 1R7JA 3WE2A 3VYRB 2KIUA 3E7LA 3LQRA 3O60A 3CCRI 2A2FX 1I5ZA 1SAUA 2ZNYA 2CO5A 1XTAA 3V8LA 1FNNA 3DPJA 2X6WA 2GA2A 2DW4A 1IXCA 1XCVA 3DLLF 2EWNA 2OAZA 1MH3A 4C2UA 3M07A 3KLOA 4A0YA 1K4TA 5FKOA 2HXIA 2NS8A 2WGBA 3HE0A 2P4WA 1H89C 5IP7J 3V8KA 1TW2A 1Z67A 1ORKA 1P7JA 1YIOA 1VQMI 4PJNA 2L0KA 3BJAA 2DA4A 4W1UA 2FMLA 1OCCH 1XG1A 2XAUA 2EZIA 4EM2A 4P55A 3CCYA 1Z05A 1FP2A 3JRIA 2G9WA 1DGRM 5KAIC 2W25A 3KNWA 1ETOA 5KHDA 2FQ4A 2FSWA 3DTIA 5E79C 3WE3A 4M3EA 2XGEA 1J59A 4YFKF 3ECHA 4M72A 4A3EJ 2CU7A 3IL2A 3JAMK 4PXIA 5EZGA 5CXGA 4I99C 3JSOA 1FIPA 4XMYA 3J80K 1XX5A 1K4SA 2L7MP 2CRGA 4KA4A 5L3EA 1YW7A 3IRQA 2HOAA 2STTA 1Z9CA 4P1WA 4QWQA 2ZXHA 4JBAA 4HPQA 5HVQC 1YJ9I 2GFNA 3D5RC 2LY1A 1AKHB 2QLZA 4XSZF 3MZHA 1LVAA 1DU6A 3TOBA 1SD4A 4C2TA 5JHUA 2XUBA 3FDYA 2FQ3A 4IOCF 3RJPA 3JW4A 1FOWA 2RQPA 4RA2A 3BOQA 2MH9A 4KITB 5LHIA 3JTGA 1LVKA 3DTKA 4ZYDA 2CJJA 4OIRF 2WV1A 4QLCU 4GCLA 3KP5A 4I2OA 3H1CA 1YW8A 3ZQQA 4FX4A 1F1ZA 4B43A 5DDGA 1ZARA 4C30A 2DYRH 1BC7C 4B8XA 1CF7B 2AQEA 2VT2A 3ESWB 2RQQA 5DV5A 4ENNA 2F07A 1U9OA 2HWVA 4BDZA 2WB1A 1JTXA 2PBIA 4UNOA 3BZKA 2LK2A 1T56A 3B02A 4KN4X 3D5SC 3MQ0A 3K70C 2Y9ZA 2TDXA 4A6DA 1UI5A 4BEHB 3CDHA 4BNCA 4UUSA 3HTUA 4RS8A 1QO0D 3Q3SA 3BZCA 1T39A 2HPIA 3SZTA 3OYKA 5M3FJ 4DVYP 3JREA 3N97A 2DPUA 2L02A 1HF0A 4M6YA 4ZDPA 3ZP5A 1PUFA 1V55H 1OCZH 3OYLA 1YTYA 3CTAA 3I4PA 2A5WA 2R92J 5E8GA 2VKDA 4LGWA 1W1WE 3SQNA 3A01A 2CUZA 2HU9A 4U0WA 1ITYA 3ZMTA 3VUQA 1XGMA 1G6NA 3VW2A 2PEXA 2ME6A 1JKPC 4JP0A 3G71I 4XLCA 4LB5A 1F9NA 3N4MA 4WXCA 3HOVJ 2HVSA 1GXQA 3RH2A 2YSRA 1HLVA 2J5OA 4MK6A 2MYSA 2JQ7A 1BI2A 2BV6A 3ZMZA 1UAAA 2TCTA 2P7CB 4I0AA 2JUGA 2UWMA 3ASNH 1AOYA 2QQ9A 3B81A 2XPVA 2NS7A 4JOMA 3BDDA 1TZLA 3H5RA 4PSWA 2IT0A 4UVAA 2YUSA 2DA5A 4AC6A 5FMPA 5J40A 1EA3A 1QZYA 5F27A 1TT0A 4V2FA 5HBUA 4E7SA 2ETHA 5HDGA 2V9VA 2DMPA 3G2BA 3O3KA 4F92B 4U9LA 4M3GA 4GFBA 1DP7P 2DOAA 2XAGA 2JA5J 4E7LA 2OI8A 2QWTA 1WVRA 4HRIA 3VP5A 3FWEA 1ZG1A 1UFMA 2BZTA 1RIOH 2DJIA 5HLGA 5D19A 4CGRA 2DAOA 2O7TA 3I64A 2E1MC 3PASA 1OFCX 5EG0A 1MW7A 2ISYA 3C7JA 2DMQA 2OQGA 1B9NA 1K6OA 1TL8A 4O6JA 1WFXA 4IOAF 5L3FA 4AIJA 2DYSH 4DW6A 1UHSA 1NK3P 3HZJA 4XBFA 2VBZA 4IXAA 1SD6A 3V7RA 4LG0A 3J7ZI 4CICA 1W36D 3U9GA 3Q0VA 5FGMA 2FA5A 2L9SA 3FXKA 1HW5A 1MNMC 3GEZA 2ADUA 4Q48A 5LBQA 1ETQA 3V78A 2KJBA 3Q0WA 1TW3A 4PUSA 5D5VB 1JXSA 4XN3A 2ACJA 2GOXB 4NNJA 4RGUA 2BVLA 1XS9A 2GXAA 4RM2A 2IU5A 1RKWA 2FBQA 1OKRA 4HX8A 4IRIA 5FKLA 2R3SA 3O6BB 4G12A 3GWZA 1EH7A 3KZ9A 3S16J 1A36A 1JHFA 3A0HC 3HUGA 5HSZA 4A3IJ 4UUSB 5ICFA 4FETA 4NB5A 1SMTA 2BW3A 4AUXA 3I3LA 3GZNB 4HNUA 4FISA 2LMDA 1JT6A 1HCRA 4DBRA 2K02A 3TDZC 4E4HA 4MIMA 1EH8A 4PZJA 1PUFB 2VODA 2LOOA 4XOTA 1Q1HA 1LKXA 5K5RA 3L09A 1G3YA 1SGMA 5F6FA 5IYBJ 1R6RA 3A01B 3M8FA 2H8RA 1KA8A 2CV1A 4B44A 3X2QH 3MMYB 4XRSA 1AHDP 2X0LA 4IRHA 4EGZA 3CCUI 3EGQA 3PNTA 3TO7A 3PFYA 4IHSA 4K2EA 1OPCA 4L5JA 2HYJA 1I3QJ 1ZELA 4XM3A 3H9GA 3ZRGA 2BE5F 4E7JA 2ZFUA 1MMSA 2RASA 3K8PC 2GXGA 1S3JA 2F48A 3RCOA 2X1CA 3DKYA 3FX3A 4WWCA 1USTA 4AIKA 2CUFA 1YQAA 4KICA 2WAQA 4DYCA 5K5OA 2EV5A 2XKPA 3FBIB 5ICCA 2VC1A 4BY7J 3F21A 5EFYA 2KHMA 4KJZA 1ZK8A 2CQKA 1ETVA 5DD4A 4I6ZA 2K9NA 1VQLI 2YVXA 2YS9A 4U7DA 1Z77A 2ECBA 3EUAA 2UXUA 3VIBA 2YU3A 5IOYA 4D0PA 4KMUX 4CO8A 1S8NA 3L1PA 2PMHA 5E1WA 3ABMH 3HOSA 2BY0A 5D6FA 3CJDA 1ETWA 2YR2A 3K0LA 2L9NA 3PO2J 2IRFG 3HTIA 4BE1A 4I76A 2X4HA 4Y52J 2FE3A 2KKOA 3BY6A 2ZBKA 1LE8A 3ECOA 3TO9A 4GGGA 4L18B 4BQNA 2JTVA 2CV2A 1HDDC 2PJRA 2QKMB 2VJ5A 1S29A 3ZOBA 2IAIA 2XDVA 5LLQA 3RTRA 5EG0B 2R0QC 3ON4A 2KISA 2TRTA 2L54A 3TO6A 3PFIA 1B8IA 1R4NB 1EV7A 2F5CA 1RUNA 2DFEA 1UELB 3K4NA 4Y7NJ 5J8FA 1RESA 1RRJA 4PFPA 1Z6RA 1OYWA 2R7SA 3BLYA 3WU2C 5FD6A 3ULQB 1R58A 1WQ2A 2ESNA 3NEUA 4LG0B 2VL8A 3CQZJ 1D5VA 3ANPA 3C2BA 3M8JA 2IGNA 2V6CA 2E1MB 3H5NA 2X6YA 4CH7A 2UXHA 1TP4A 5IYCJ 1JT0A 2IGOA 4G9YA 5L3BA 1SFKA 2HEOA 2BY2A 3WODF 4UVBA 4BXXJ 2BVMA 4ACIA 4HOBA 3MKWB 1VQNI 2H8WA 4ZZLA 4H0EA 3TKYA 3HUGB 2BEOA 4M3DA 2V1NA 1QU3A 3QOEA 4CZZA 2QQAA 2QZ8A 2BW3B 5K58A 4AM3A 2XROA 4DOZA 4ESJA 1BR2A 3OMYA 1R1VA 1E3OC 1ZLKA 2MD0A 1B72A 5B1AH 3T6NA 3IWZA 4HF1A 2I5UA 1D0XA 2OCCH 2W4SA 2ID3A 2JJ7A 4FQGA 3BROA 2F4OB 2LKXA 2ZY9A 2A6EF 3NI7A 2PN6A 2NYXA 4YFNF 1Y8RB 2M0MA 4II2A 5ILUA 3KX2A 2ELJA 3F3XA 4OAZA 1KONA 3F8NA 4WIBA 4EEFG 1HKSA 3DKWA 2B7EA 2W24A 5A2QZ 3C07A 1WJ5A 2LR8A 3HSRA 4MXMA 3GFMA 1D8JA 3RYRA 3FM5A 2KZVA 3PQKA 5LD2C 3L2UA 2W53A 2YU9J 2Y9YA 1Y1VJ 5D5UB 4ETSA 4YIIA 4HV5A 2MABA 3MKZA 3PSIA 3FZVA 3BR5A 1Q1VA 1U5TB 1IN4A 1T33A 2OV7A 2Y0MA 3HSEA 3PO3J 2FMYA 1IN6A 2WAEA 5F04A 1OISA 2E35A 2HFHA 1QPIA 4MNUA 2L01A 1DUXC 3GTPJ 2KZGA 2D1HA 3A1YA 3CJTB 2DT5A 4ICHA 1XDSA 3A4CA 3OYAA 3WG9A 2M34A 5JVTA 1MBEA 1L0OC 4JX6A 3W6JB 3KP6A 4HSTA 1ETXA 1FY7A 3FXJA 1U6GA 3H9JA 3BG3A 3HTSB 1SEUA 1LE8B 1Y6IA 2Z99A 2O7OA 3GW2A 2GQQA 2PJRB 3ZPLA 1EKEA 2IS4A 3VDXA 3CJRB 3CCQI 2EFPA 3HG9A 4ESFA 4X0GA 3E5QA 1X19A 1B8IB 3J7YJ 2DFHA 1NK2P 4UDSA 4IHYA 1V4RA 2Z9OA 3DU6A 5DCFA 4A3BJ 1WH7A 1XGSA 3LA3A 4GCKA 1XB4A 1REPC 3Q9SA 1X3UA 3BG5A 3SDBA 1MNEA 2K7LA 3MN2A 1SFUA 4HF2A 4HBLA 3RIRA 3TP3A 1QQIA 2NVXJ 1POGA 2KPMA 4M3FA 1WHUA 3A2KA 1J5YA 5TRDA 3DKXA 1G3WA 1FBQA 5BPIA 2OTLI 1R71A 3HXLA 3BJBA 5D18A 1MMGA 1MBJA 2M5WA 1IO2A 4WXHA 2HTSA 2KLOA 2EV0A 4BE0A 5ERIA 2IS2A 2BY3A 2HYTA 4IF4A 1JKQC 3F23A 5FKMA 3S93A 2DQRA 4L0YB 2CYYA 4B47A 3E6BA 4U88A 5EJCA 5HOOA 1FX7A 2EILH 3I54A 3IH4A 2CS3A 1B72B 3IKVA 1P4XA 5HLIA 4OU0A 4B1RA 1PJRA 4LD5A 3LHQA 2EINH 2K4BA 5CVJA 5E3OA 1O3SA 1IN5A 3NRGA 3PIPF 1B1BA 1MBGA 2JA2A 3EPZA 2VONA 2Y0SA 3GLLA 4HEA2 1KZHA 3SEQA 1NG6A 3HEFA 5KNLA 3GFLA 4RAFA 2XF5A 3E1SA 2JK3A 3TL4X 2PBXA 4NN1A 3OIQA 2FUG2 1K78A 3S2WA 2B3WA 2IEKA 3I0TA 2VBYA 1TT5B 2GWRA 3WTVC 2Z3YA 2KFDA 4J19A 4BQAA 1N75A 1W4MA 2L4AA 2P6TA 2Q8KA 2IW5A 3I59A 2R7QA 3BHQA 3RKQA 1BW5A 3E0JB 2LNBA 1H9TA 3HRMA 1UHWA 4KFCA 3LAJA 2FOWA 2MSYA 2FOKA 2RGVA 4BH9A 4E7HA 3S8PA 2CSOA 2HYGD 1OJLA 3L2RA 2MBFA 1JJ6C 5D4SA 3MFKA 2AXTC 3CUOA 5FO5A 3JRDA 2R7DA 2LTPA 4IHTA 4A3CJ 2DT7B 3SZPA 5F0CA 3BG6A 1WJDA 4U7BA 2JVGA 2AQFA 4XKWA 4EGYA 4BYYA 1EF4A 2E2JJ 3ABKH 1S7AA 1D1BA 1VQOI 3KYCB 2KRCA 2RN7A 1U0JA 3PUBA 5CLSA 2F5VA 4XOPA 3HGYA 2B63J 1LFUP 4YFXF 2ECCA 2ME0A 2XAFA 5LGTA 2VQCA 2XV4S 2VKVA 1ZKGA 3FIWA 2P0WA 2DCEA 2VBWA 3K70D 3FXRA 1DU0A 1XC5A 1SVMA 5E3NA 1JUSA 3LSPA 1WGXA 3CF5F 2QKOA 5LEJA 2BBYA 5JLWA 4Z6YA 1R23A 1RKTA 3GF2A 4EJOA 1W7PD 1YIJI 3GXOA 2K4JA 2J5PA 2DK5A 4BS9A 4I01A 3F8MA 2FD5A 3V7SA 1QHHD 2IA0A 2E60A 2HDDA 2Y48A 1HBXG 2QCOA 4A3KJ 1DPUA 2A05A 4DYRA 1QZEA 1E3HA 3TW6A 3ZMVA 1O7FA 2DMNA 2X6OA 5EGOA 2LKSA 4HYEA 3ZQIA 2VLAA 4EMSA 2X51A 2Y0SN 2NOGA 3VSKA 4XRSG 1J2XA 1DQUA 2FJI1 2NVTJ 4CSWA 1GVDA 5B1BH 2FF4A 3QPHA 2E19A 3VODA 2STWA 1WJFA 2ZB9A 2EH3A 2WADA 3KPHA 3VW0A 4BE2A 3S14J 3DLAA 4GFKA 5JVGF 4ABZA 1LDKB 2DFFA 2OU2A 3H3VK 2CFOA 2QYOA 5DUKA 2H6CA 4F52A 1MD0A 4CCOA 4FTHA 2O8KA 4RB0A 3CD6I 3VYSB 1Y56A 1VQPI 1JUMA 2EJRA 1F36A 4OMZA 4YELA 2BXZA 4P5OA 2F4MB 1K78B 1E2XA 2FX0A 3FM3A 3CDLA 1ETKA 2M4GA 4RBOA 2W7NA 1LJ9A 1TWHJ 2EFWA 4M3BA 2JMWA 4EJTA 3ISPA 2G3BA 1KQ9A 3EUKL 1QRYA 1IUFA 2LDUA 4A5NA 1SVOA 2FRHA 4HLXA 2DXIA 4IRVA 3OSGA 2PJPA 2DMUA 1YFHA 4OD5A 3I59B 5HDKA 4YZEA 4N4OB 3FMRA 5E18F 1SFOJ 3CCJI 2AO9A 2DU9A 1VQ7I 4DQ2A 4PJLA 3W2WA 4OAYA 4ZDLA 1YW9A 3QYFA 4JK1X 5CPRB 2VJIA 2QBYA 1IF1A 5ICEA 1O3TA 5BS6A 5IT9K 1ODDA 3H35A 3QU6A 1O57A 3Q9VA 4XLEA 1VQ4I 4A93J 4II3A 2DG7A 1FSEA 5GPAA 4OIOF 3FXOA 1P4WA 4IQ4A 4KYWA 1LFBA 1YX5A 3C3WA 1ZLJA 2OCEA 3ZN0A 4MFDA 5LGUA 3WTXC 3K1PA 1IV8A 1BIAA 4EJWA 1ERDA 2XHKA 3DBRB 1VQ5I 2IS1A 5L3DA 2XIGA 5C3EJ 1QHGA 2JVHA 3HOYJ 4LJZF 2RNJA 3PNYA 3T0YA 3GTKJ 1N25A 1FMVA 4HQEA 2NP5A 2QIBA 2CGPA 1I6XA 4UHTA 4G7HF 2LP0A 2XB5A 4UUTA 2Z1DA 2OZ6A 3K6GA 1MJAA 1KGSA 3D0SA 3J81Z 1QVUA 1T08B 2GLOA 1WJEA 3P9KA 3VEPA 4FE7A 2N8GA 3HHHA 4A0ZA 5K7FA 4HAMA 3DBLB 3LSIA 2VKEA 5F1JA 5H9TA 3KZIC 4M71A 1FIAA 2CH0A 2LY9A 3BC8A 3FMSA 4MEXF 2MG4A 1IDYA 2XSJC 3VB2A 1T8IA 2VQLA 1PP8F 5H6RA 3S15J 5EGOB 1BA5A 1IRGA 2K9QA 4NELA 5D8KB 1T38A 2M2EA 3AL0C 4NDLA 4LK1F 3FXQA 4PJ0C 2EIMH 2A07F 2WUIA 5LEKA 3JRHA 5C4JJ 3KFWX 1D5YA 5FGLA 5CVUA 1LEAA 2MC4A 3OS1A 4HLYA 3EYYA 1FSHA 4A3LJ 5CJ9A 3QPTA 2NVYJ 1VNDA 1USSA 1ZG3A 5H6QA 2E1NA 3E6DA 1F5TA 2ZCMA 1OYYA 2LVSA 2OF7A 1OMIA 5CYVA 4U0YA 3FHNA 1IJWC 3VWBA 2PG4A 3M1EA 2OTJI 4OIQF 4P96A 1KYZA 2KIQA 3F22A 3BG7A 1IC8A 1K6YA 3E7QA 4LLLA 2MGQA 3K2AA 5FLXZ 1IAWA 2B9SA 1UHMA 3CMAI 3E5UA 2A69F 2W84A 5BOXA 1DP3A 3VVXA 3VOXA 3DCFA 3H0GJ 2IP2A 3LL7A 4ON0A 1FLIA 2AHQA 3KEYA 5GADJ 4KMFA 3RDIA 2Z16A 2GXBA 4XK4A 2E71A 1BW6A 3J7AO 4I02A 2G0EA 2ISZA 1TTYA 2GAUA 3C1DA 2PX9A 2V9PA 2YX7A 3GCMA 2QBYB 3COLA 1O4XA 3OYJA 2VXZA 4BU2A 2L7FP 3OYIA 4L62A 5AQCA 1VTNC 3JCUC 4RLQA 4B48A 5LHGA 4FX0A 4XR6A 1K7AA 2R7VA 4JNNA 3HOWJ 1Y0NA 1A35A 2GUHA 3DTEA 3QPLA 4UV9A 2QQ8A 3DV8A 3NXCA 4JX4A 2RC4A 1BL0A 2HGCA 4Y3OA 2LD5A 2JRTA 2QUFA 4HA8A 2LLKA 4UV8A 4CCLA 3PM1A 5F64A 3HJEA 3CMYA 1ZTRA 2BXYA 2HTJA 5F08A 3KP3A 3HPHA 2O9LA 5C44J 4NHJA 3O8GA 4YIFA 3IUVA 2YVHA 2L7ZA 4XLHA 1GT0C 3H9QA 4XLFA 1XSDA 5LHHA 1E0EA 1IRXA 5BPDA 3GTOJ 3CCEI 1P6RA 4C2MJ 3H36A 4ANJA 4G94A 2E2HJ 3BQYA 2RHAA 1LDDA 2XGDA 2O5RA 3WTUC 1I50J 2WB1N 2QOPA 3K1MA 2K5CA 2MLGA 2XAJA 2R7FA 2PMZA 1JJ8C 3CWRA 1FBUA 1P9QC 1U9NA 2L4MA 3AG2H 4MQ9F 2YX4A 4AYBA 2NOJB 5HODA 4IHVA 4C3IJ 3SZGA 3BTJA 3A03A 3LA2A 4MHGA 1QGPA 1A6QA 1I27A 1TNSA 5C4YA 2VJJA 3BCAA 3RZOJ 4C9YA 3JRAA 1QPMA 4RAGA 5AONA 1GUUA 5GTHC 1ZREA 4MTEA 1MMDA 1APLC 1UG2A 1UB9A 3HBLA 5H20A 3T1BA 1B4AA 1T95A 3HRSA 4S0HB 2R7UA 5LFAA 3HOTA 2H27A 2CQ7A 1WWXA 2ZSHB 4IL6C 1SD7A 2KQRA 2D6YA 4OMYA 1P2FA 4UB8C 5IT9Z 1RC9A 2E5NA 5GAEJ 3CC2I 4KNYA 5DEQA 3K4CA 2E7XA 5GP9A 2KDZA 3JAMZ 1TNTA 3RPUD 5E8IA 1T98A 4IPAA 5J1UA 1ONVA 2A3SA 3JRFA 2LBFA 2F5FA 2K3FA 3OL3A 3J80Z 2PFBA 4LFUA 5IT3A 5IPAA 3E3VA 3BTLA 1VQ6I 4Y17A 2ZJ2A 4L9JA 1HQCA 3NNRA 2FNAA 3ZMUA 2UXPA 5D5XB 4KIBA 4GYIA 4DJAA 3COAC 3BTIA 5IYDJ 2WC2A 5KVRA 3HRUA 1IRFA 5E20A 4JX5A 1LDJA 2QQBA 4XORA 4YEJA 5KCMA 1IGNA 4IVNA 4DZJA 3BZ6A 4RGXA 1R9TJ 3I58A 4CYCA 4XNFA 3EDPA 5F1RA 4AIDA 4BGDA 3G56A 1MSEC 3LFKA 4JQFA 3S2DJ 2EB7A 1GLNA 2CW8A 2HDCA 2ELHA 1WRJA 4C3HJ 2WWYA 1WSUA 1IUYA 1IXSB 2EA4A 3TW7A 3OS0A 3O8HA 1YE9A 3S5RA 3WTSC 3LSRA 1H9GA 3ZMDA 3HGGA 6PAXA 1MMNA 2Y30A 1IZ1A 4D7MA 3DWLE 1ZRFA 2V6EA 2MFZA 2MLKA 3IHUA 1U78A 1JI8A 4UUVA 2IA1A 2KP6A 2V4JC 1ZR4A 1MGTA 5LGNA 2CFXA 3CF2A 3E97A 3S2HJ 4N4NB 2FBIA 2CUEA 2PZ9A 2EFOA 3ZQ7A 1LUJB 4IZZA 4A3MJ 1YG2A 3K4BA 2HQNA 2L2OA 4EATA 2UV1A 3K4KA 2KT0A 4MTDA 2A5YB 5EEAA 4ZYEA 2ICWG 2W48A 2HNHA 3QWLA 1I3AA 2XC7A 4QPOA 1ZRCA 3S3NA 3RQ4A 3JSJA 3JTHA 3F8BA 5TJJA 1YRNA 3S32A 3IH2A 2UUZA 3KP2A 4NUBA 2E5ZA 1HC8A 3LSMA 2NAZA 2EBIA 4YIRX 2RNGA 4X6AJ 2X1EA 5IP9J 4DZPA 4WK8F 4ZTFA 3IUOA 2M3AA 4RLFA 1Y0UA 3HB9A 2HS5A 1ZH5A 4IJAA 4KDPA 1Z3YA 5HS9A 3P9IA 1Z1DA 2VKHA 5EF6A 2KRHA 1TWFJ 4M9SA 9ANTA 5ILVA 1WJAA 3PIOF 1J9IA 1FYKA 2L3DA 3IWFA 3KEQA 1FEXA 5HS7A 4Z2YA 4B4CA 3BTCA 1Y1WJ 3HOXJ 3HKZA 5KAFC 2EIKH 2F6CA 2VPLA 2WAQN 2XRNA 2LBFB 4Q5SF 5L3GA 1SMYF 1ZGJA 4YG2F 2D2WA 1PDNC 4M6VA 2DO7A 3REOA 3LNQA 1FC3A 3ELKA 1S6LA 2LFBA 3TDUC 1W36C 1XSVA 3DXJF 2CWEA 4BJ5C 5IP6A 5FHPA 1STZA 1J09A 1OQYA 3FHZA 3PPBA 2DDBA 3HM5A 4AF5A 1XN7A 4CXFA 4PFOA 1L3LA 3G1OA 4B3AA 4KISA 4PJJA 1OYIA 3HPGA 2NS0A 4M9XA 4Q4ZF 3MVPA 1SANA 1WPKA 5CKTA 3CO7C 3GTJJ 1YITI 4CYCB 3OV8A 3JRGA 2LF8A 2HKUA 3CMEI 1LPQA 3WTTC 2P6SA 1R5ID 5EEHA 1W0UA 3GTQJ 2D5VA 1KQ0A 1HW1A 2Y75A 4IX7A 3TBIA 3R4KA 3KZYA 4MQVA 3I71A 4IO9F 5H2FC 4RAZA 2UXIA 1IN7A 1G2HA 2VBXA 2HQAA 3AG4H 3CJNA 2QENA 3KETA 4A3JJ 2R5YA 3MWMA 2DN0A 1HA8A 4DBQA 1UI6A 4WXDA 4WCGA 3C18A 1MNDA 2ZOZA 3WHCA 3OYDA 3SDGA 1F43A 1VQ8I 2R7RA 4HDVA 5FLMJ 2JWTA 3KIOA 1MKMA 1RPWA 4EJVA 4RB2C 3KCCA 2XAQA 3LOCA 3OSFA 1H88C 1ZR2A 3QU3A 5JLXA 2G7LA 3P9TA 2JRMA 3AAFA 2B1EA 2XVCA 1VI0A 3ZR8X 2PMUA 3DP7A 5TISC 4DNCA 1A31A 3LJLA 1DPRA 1YRNB 2O61A 4LB6B 3OYMA 1RETA 2QSHX 2CUJA 4CCJA 2M1BA 3FKIJ 1QVTA 3GO5A 1WJBA 2F4IA 4GXOA 3U1DA 2LKPA 3ABUA 3LAPA 1Z91A 5C4XJ 4ZDOA 4BDYA 3OYCA 3GFJA 4LOCA 3LSHA 1VFCA 2HXOA 3EQLF 1O7LA 2Q1ZB 5DCMA 3NAUA 3U21A 4ZH4F 3ZQHA 1KU3A 2CG4A 1LB2A 3CDIA 3L2WA 4ENKA 2W85A 4NC7A 1BIBA 4TV7A 3K4JA 4G7ZF 2YVEA 4S04A 2Z5UA 4A3DJ 3AKZA 3S3MA 2VUMJ 3M9AA 1B59A 3OY9A 2P5LC 2QWWA 1NG7A 3MCZA 4IQJA 2EQRA 2RVCA 3I55I 4QTRA 3OOUA 2HKOA 1V5GA 3HHGA 3J7AY 1JGGA 1R49A 3A02A 1Z7UA 3CC7I 2HOEA 2XF7A 2P5VA 3DPTA 3CRJA 3F8CA 1WH5A 1KQ8A 3BR2A 4KT5C 3GMEA 1YX3A 3FXMA 3HIFA 3ROUA 5E17F 1JGSA 1S5LC 1NTCA 4IHWA 3WGGA 1QNTA 4AWXB 1MDMA 2NVUB 2NVQJ 3I56I 1SC7A 4A5MA 3H3UA 2H09A 2XB0X 1HKTA 3KKCA 1UG0A 3L2QA 3BG9A 3H3ZA 2G7HA 2VQHA 2RKHA 3AG1H 1IW7F 4C2MA 2M4KA 3CUQC 5M3MJ 4O3MA 3BT9A 4BHPA 1W0TA 1JE8A 2OJED 2DBBA 3L9FA 1CQTA 3FISA 1ULYA 2ZC2A 3NPIA 2VT3A 2R5YB 1X1DA 2WTEA 3QBMA 2VIXA 3P7NA 4A0XA 3BR0A 1CGPA 2LRDA 2V79A 2MH2A 2E2IJ 4GCVA 3GEUA 2E36A 4RGRA 3E6CC 1JTYA 3GZ6A 1FOXA 3CUQA 2X1DA 1P92A 2HQ5A 2M30A 1XGNA 4CCNA 4DGWB 1UJ8A 3M4OJ 4XLPF 1RNLA 2LY2A 4PSXA 5HNHA 4ME9A 2Y69H 1D1AA 3K7AJ 5ILSA 1R4MB 2W57A 3FBNB 2QGUA 2ZCNA 3ERMA 4M9ZA 3SWHA 4XKBA 1HOMA 3GLXA 3WTWC 4HX7A 2CQXA 2GZWA 5D5WB 3D1NI 3ERED 2L5QA 2ZXIA 4Q47A 2ZSIB 5DYMA 1I6HJ 2DA7A 3BJ6A 5DCMB 4BUPA 3VVYA 3F1BA 3FMQA 2OD5A 3HC7A 2VJ4A 4LLNA 3DPUA 3V8JA 5DTDA 4YRVA 4IHXA 3CLQA 4HZFA 2Q2EA 5AIPA 1AU7A 3TP0A 2DI3A 1U2WA 2NXNB 5EDNA 1DDNA 1W5TA 4R79A 4EV0A 5DS9A 2VOOA 2COMA 3S3OA 1BR4A 1FTZA 3W2VA 1CF7A 5E3LA 1TWAJ 4IKFA 4RGSA 4GDFA 5FFXA 2DK8A 4BY1J 1ETYA 2B0LA 4NQWA 5HDNA 3CCLI 1YI2I 3IAS2 1AWCA 2QA4I 1V5EA 2JPBA 4U9NA 3K1NA 1A6IA 3V4GA 3VOEA 1WI3A 3HRTA 2FBHA 2F5DA 3I53A 2X48A 3U1KA 2DA2A 2KIMA 4BACA 2R7TA 4QPQA 3G7RA 2IXSA 3BCBA 1EH6A 1X2NA 5M5XJ 2VE8A 1OCRH 2BYVE 1MDMB 1K61A 4ITVA 2V26A 1T0FC 2O3FA 3DEWA 1GHCA 3PSFA 1R5HA 2REKA 4F7ZA 3MZYA 3DF8A 2M0CA 4LG3A 3H5AA 4NBQA 5CW8A 3N05A 3P9CA 4EM1A 2VASA 2UZKA 2GM4A 1ZGAA 3ABTA 2ZJQF 2Q24A 3GFIA 1XPXA 5BNGA 2IGMA 3KP7A 4BJ6C 5DUIA 4ZYHA 1JKRC 3OYHA 1I39A 1T0FA 3DEEA 1ZRDA 2LF7A 2K9MA 2EA2A 2H1LA 4A69C 2W82A 1ZN2A 3GUDA 4KT6A 3D5LA 3M8EA 4LK0F 4LMYA 4KIGA 3CUQB 2R7OA 4S05A 3OYFA 2Y2ZA 5B3SH 1FTTA 3CC4I 2V9KA 2EPFA 3KP4A 3KLNA 2HPMA 4D5FA 3CP8A 1XCBA 3CLOA 4CZCA 2DTZA 1X1BA 3LQQA 3VVZA 2VPRA 1R00A 1G59A 1KYWA 3PL8A 1QA6A 2MA3A 1IRZA 2E7WA 3U2RA 4HQMA 4OIPF 2QVOA 2KDOA 1KU7A 2HR3A 5J4YA 2GOMA 3E5XA 3RQIA 1P4AA 2X6XA 2XKOA 2DA1A 1BI0A 2K40A 3QYBA 1JKOC 3IKTA 1LFPA 2IBDA 4XQFA 3G1LA 3FK6A 2LH9A 3OIOA 2XPWA 4JKZA 2QM3A 4LIVA 3F72A 1XD7A 4PGGA 3HOUJ 2JN6A 2Q2EB 4HF0A 4XONA 1BR1A 2WY7Q 2MW8A 3LWJA 3GVAA 4U0VA 3JR9A 3I9V2 5HLHA 5JHFA 3ASOH 4U87A 5FROA 4P9UA 2A6HF 2L9RA 1HXDA 1TQIA 3L2CA 4L5IA 3B6AA 1C0WA 3PQJA 4EQQA 4FASD 3S1MJ 2R4GA 2C6YA 4A2UA 4NQWB 2FNPA 2M45A 4RMNA 3LFUA 5JI6A 3KEOA 4F93B 3M7GA 3WTZA 2VB6A 5D4RA 4HSRA 1J7KA 3LWFA 4J00A 4J01A 1HSTA 1GV2A 2X9DA 3B6CA 1S7EA 2LSOA 3EUHC 3DBHB 2RAEA 3IC7A 1Y39A 2VOPA 1R5GA 4UB6C 2K9LA 5ICGA 3CCSI 2NNYA 3RSNA 4HV6A 1BJAA 3O2PE 3KZZA 5B66C 3BP8A 1T6SA 4EJUA 1GV5A 1R1TA 2DTRA 4EVIA 5KK1A 2V1UA 4BBRJ 4UVCA 2DQLA 4BL0B 4HNVA 1YO5C 1IN8A 2R93J 3JRBA 4CDGA 2D1VA 5DM7F 1U8RA 5GAGJ 3QRFF 3EUHA 2XGCA 2ZOYA 2DJNA 4BQOA 2L7KA 3AG3H 3SJMA 3ZCOA 4AD9A 1W7PA 2ESHA 3ZMSA 2OBPA 4UY8I 3G6EI 2UXOA 3TEDA 3L7WA 4PK4A 4AU7A 2DFIA 4OOIA 4B09A 1TQMA 1ZQ3P 3E6MA 4FCYA 2HOTA 3OS2A 1S9HA 2ZCWA 3SFZA 2KL4A 1ENHA 1G4DA 1GDTA 2M9HA 4UXNA 4AIHA 3KYDB 4OD4A 4CHUA 2IJLA 1P7IA 4AVPA 2WA0A 4M6XA 1BI1A 1TLHB 3F6OA 3RPQA 1S72I 2EK5A 4I09A 1HSJA 3EYIA 2WAFA 5A2QK 3WU0A 4FT8A 5AIQA 2R5ZA 3MKLA 2QSGX 1JUPA 3I4MJ 1RR7A 4D1QA 1YYVA 4XRFA 4NC6A 3L00A 3QQAA 2K86A 3RKYA 2A68F 2V7FA 3S1NJ 1RI7A 1MMAA 2CW0F 1G3TA 4BHBA 1RUOA 1SFEA 5J8CA 4Y4RA 2JUCA 3F6VA 3V6GA 4CGZA 4WX9A 2JZYA 1MBFA 4RB3C 3MKYB 1F4KA 5EEGA 4HX4A 5HLTA 3RKWA 1HDPA 3QP5A 2UXNA 2A6TA 1X58A
chains in the Genus database with same CATH topology
3VPRA 3HOXJ 3HIMA 2L7MP 2CRGA 3I4NJ 2WAQN 3BHQA 3RKQA 1BW5A 1FJLA 2HOAA 5CXIA 4AC0A 2GFNA 4M6VA 3GTMJ 2MSYA 2K9SA 3LNQA 1AKHB 2LFBA 5FHPA 1DU6A 5IP6A 3PPBA 1OJLA 3HM5A 4AF5A 1JJ6C 3G1OA 4B3AA 3JRDA 3ZQCA 2LTPA 3S1RJ 4A3CJ 3MVPA 5F0CA 1OCTC 1SANA 1WPKA 1EF4A 3BRUA 3JRCA 2CJJA 2EZKA 2E2JJ 1K83J 2WV1A 3GTJJ 3BNIA 4GCLA 4CYCB 4W97A 5J3LA 3JRGA 2HKUA 3HGYA 2B63J 1LFUP 2ECCA 3FK7A 2ME0A 1W0UA 3GTQJ 3ZQGA 4XRMA 2VKVA 4QIWN 1ZKGA 3FIWA 2D5VA 2F07A 3BQZA 1U9OA 1JTXA 5FKNA 1DU0A 1XC5A 2LK2A 1T56A 5E3NA 1JUSA 3LSPA 2UXIA 1WGXA 2QKOA 1G2HA 3UKGA 1A5JA 2Y9ZA 5JLWA 4A3JJ 1UI5A 2R5YA 1RKTA 2DN0A 3M3YJ 2ID6A 1UI6A 1TWCJ 4UUSA 3Q3SA 3IH3A 1X2MA 2ZOZA 3WHCA 5M3FJ 3SDGA 3JREA 1F43A 1HF0A 3EUPA 2FD5A 5FLMJ 2JWTA 2HDDA 3BR3A 1RPWA 1PUFA 2QCOA 4A3KJ 3LOCA 4DYRA 2XRLA 3OSFA 2R92J 1H88C 1ZR2A 5JLXA 1WCMJ 3TW6A 3A01A 1ITYA 2G7LA 3P9TA 3VUQA 2DMNA 2X6OA 5EGOA 3ZQIA 1VI0A 5M5WJ 3LJLA 4JYKA 2PMZN 3VW2A 2ME6A 2Y0SN 1JKPC 2NOGA 4JP0A 4XRSG 5J1RA 1YRNB 5D1RA 3HOVJ 2NVTJ 1RETA 1GVDA 3FKIJ 1QVTA 4AYBN 2E19A 3RH2A 2ZB9A 1HLVA 4MK6A 2R5ZB 2EH3A 5C4XJ 2TCTA 3VW0A 3S14J 4LOCA 2JA8J 4XICA 3B81A 2XPVA 2NS7A 4ABZA 2HXOA 1VFCA 2H1KA 4GFKA 3H3VK 3NAUA 2YUSA 3BCGA 3ZQLA 4FTHA 3ZQHA 5M5YJ 2DA5A 4RDUA 2O8KA 4A3GJ 4AC6A 1JUMA 3Q0UA 1F36A 5FMPA 5F27A 4X1EA 4V2FA 5HBUA 2FX0A 4RBOA 3CDLA 1ETKA 2YVEA 1TWHJ 4BKXA 3VOKA 3GZIA 4M3BA 2JMWA 4A3DJ 2DMPA 2VUMJ 2G3BA 1QRYA 1IUFA 4M3GA 4GFBA 3S17J 2JA5J 2OPTA 3OSGA 2OI8A 2DMUA 2QWTA 2EQRA 4QTRA 3OOUA 4DYQA 4YZEA 3VP5A 1JGGA 1SFOJ 3GTGJ 3A02A 2AO9A 1IDZA 5D19A 4CGRA 2QF7A 3CRJA 1WH5A 3BR2A 2O7TA 4JL3A 2HI3A 3AQTA 3PASA 1OFCX 5EG0A 2DG7A 4QSHA 2DMQA 4A93J 5GPAA 1LFBA 1NTCA 4MFDA 2Y31A 4DW6A 1UHSA 4IHWA 3HOZJ 4A3FJ 1IG7A 1NK3P 2NVQJ 1IV6A 4MO7A 5C3EJ 1OCPA 2XB0X 3Q0VA 1MNMC 3KKCA 3BG9A 3HOYJ 1ETQA 3V78A 4GCTA 3Q0WA 2NX4A 3GTKJ 5FKKA 1BJZA 2NP5A 1XS9A 2IU5A 4MFEA 2QIBA 1ZGWA 5M3MJ 1RKWA 2FBQA 3BT9A 1W0TA 5FKLA 2LP0A 3FISA 2XB5A 4UUTA 1CQTA 4G12A 3NPIA 3KZ9A 3S16J 1QVUA 2R5YB 3QBMA 2GLOA 5HSZA 4A3IJ 4UUSB 3BR0A 1MSFC 3HTAA 4FE7A 2N8GA 4D5CA 4AUXA 5K7FA 4FISA 1JT6A 2VKEA 5F1JA 3IV5A 1HCRA 2E2IJ 2V57A 2JA7J 5H9TA 3GEUA 1IGNA 1FIAA 1JTYA 4FE4A 4MIMA 1PUFB 2HQ5A 2LY9A 2MG4A 5DAJA 1IDYA 2G7GA 3M4OJ 1SGMA 5IYBJ 3A01B 2H8RA 4XRSA 3S15J 5EGOB 1BA5A 2K9QA 1AHDP 4NELA 3BR1A 4ME9A 3K7AJ 2M2EA 2ZCNA 4NDLA 2QTQA 3EGQA 4IEJA 1HOMA 2HYJA 1I3QJ 2CQXA 3D1NI 2WUIA 3JRHA 5C4JJ 1D5YA 5FGLA 3BR6A 2RASA 2HOSA 4A3LJ 1UMQA 2NVYJ 5EZHA 1VNDA 1I6HJ 3S1QJ 2DA7A 2ZCMA 2CUFA 2LVSA 2OF7A 1IJWC 4DYCA 3VVYA 4D7NA 3F1BA 4HKUA 2COBA 2EZLA 5FLVA 4BY7J 5DTDA 5EFYA 2XDNA 1IC8A 3E7QA 1U8BA 3NARA 3QPSA 2MGQA 3K2AA 1ZK8A 1ETVA 4I6ZA 2K9NA 4IHXA 2YS9A 1Z77A 2ECBA 3VIBA 2UXUA 1AU7A 3TP0A 5IOYA 5EDNA 3L1PA 3VVXA 2XSDC 5DS9A 3VOXA 3CJDA 1ETWA 1FTZA 3DCFA 4L5EA 3H0GJ 5F0FA 5E3LA 3PO2J 1TWAJ 2AHQA 3HTIA 4I76A 4XK4A 4Y52J 4BY1J 1BW6A 1ETYA 3HKZN 2DG8A 1MBHA 1LE8A 2G0EA 1HDDC 3ZOBA 5IOZA 3COLA 1A6IA 2IAIA 1O4XA 1WI3A 5EG0B 2R0QC 3ON4A 2TRTA 2L7FP 3ON2A 4L62A 5AQCA 5K7ZA 5E3MA 1B8IA 3HTJA 2X48A 2DA2A 4JNNA 3LSGA 3HOWJ 5FJ8J 2XPUA 3G7RA 4XIDA 4Y7NJ 2GUHA 2DMTA 1RESA 1X2NA 5M5XJ 3QPLA 3NXCA 5GPCA 4JX4A 3RZDJ 1K61A 1BL0A 2LD5A 5F0HA 2LLKA 3PM1A 3CQZJ 3ANPA 3C2BA 3CMYA 1ZTRA 3DEWA 5F08A 2CQQA 2O9LA 2REKA 3RD3A 2UXHA 2JA6J 5C44J 4BBSJ 2M0CA 3O8GA 5IYCJ 1JT0A 3IUVA 2YVHA 2L7ZA 1GT0C 2EZHA 5CW8A 4BXXJ 2GM4A 3GTOJ 4ACIA 2Q24A 4C2MJ 5BNGA 3KKDA 2E2HJ 4KWAA 3BQYA 3W6VA 2RHAA 2XGDA 2QOPA 1I50J 2WB1N 4M3DA 1JKRC 1TC3C 5K58A 2NP3A 1JJ8C 4A69C 1Z0XA 3CWRA 1U9NA 1MBKA 1TWGJ 5HODA 4IHVA 4C3IJ 1E3OC 2P81A 1B72A 3BTJA 2Y2ZA 3A03A 1H8AC 2VI6A 3T6NA 2WGBA 2E1OA 2ID3A 2JJ7A 1FTTA 5C4YA 2LKXA 3RZOJ 3NI7A 2ZCXA 4D5FA 3JRAA 2DTZA 1GUUA 3VVZA 2VPRA 2GENA 1APLC 4EEFG 1IRZA 1UG2A 3HBLA 3C07A 2LR8A 4S0HB 4MXMA 3VW1A 3MNLA 2G7SA 2W53A 3LSJA 2YU9J 2Y9YA 3RQIA 1Y1VJ 3SFIA 2DA1A 2D6YA 2K40A 4GFLA 1JKOC 2IBDA 5EYRA 3BR5A 3G1LA 1Q1VA 3PO3J 1T33A 3FK6A 5GP9A 3OIOA 5F04A 2KDZA 2XPWA 4JKZA 2GBYA 1QPIA 3FRQA 4MLOA 5J1UA 2R7ZJ 3HOUJ 3HTHA 2JN6A 3JRFA 3GTPJ 5HAWA 2MW8A 4ICHA 3LWJA 5IPAA 3BTLA 2OERA 3JR9A 1AKHA 2M34A 1MBEA 4JX6A 1MH4A 2L9RA 1ETXA 3B6AA 3NNRA 3S1MJ 2UXPA 1VF9A 3BG3A 3GBGA 1LE8B 3ZQFA 3GTLJ 3BTIA 5IYDJ 2O7OA 3F0CA 4C3JJ 3ANGA 2I10A 4JX5A 1GV2A 1S7EA 2DA6A 2X9DA 3B6CA 4DZJA 1B8IB 3WHBA 2ELKA 5J1YA 2RAEA 1NK2P 1R9TJ 4UDSA 4CYCA 2M8GX 4IHYA 3HDDA 3G56A 1MSEC 3S2DJ 3G1MA 4A3BJ 1WH7A 3QKXA 4GCKA 2FJ1A 4C3HJ 3AQSA 1GV5A 3TW7A 3O8HA 4V2GA 3BG5A 3S5RA 3LSRA 4BBRJ 3HGGA 3MN2A 2Y30A 4HNVA 2DA3A 5K7HA 2R93J 3JRBA 3TP3A 4D7MA 2NVXJ 1POGA 1U78A 2XGCA 4M3FA 2ZOYA 2DJNA 3SJMA 1ZR4A 3BJBA 5D18A 3E7LA 1MBJA 3O60A 2UXOA 3S2HJ 2PZ9A 2CUEA 3TEDA 2HOTA 4A3MJ 1ZQ3P 3DPJA 4FCYA 2HYTA 1JKQC 2KT0A 5FKMA 1ENHA 1GDTA 5EEAA 2M9HA 1MH3A 2W48A 5FKOA 2HXIA 2NS8A 3IH4A 1P7IA 3HE0A 1H89C 1B72B 3JSJA 5IP7J 1YRNA 1ORKA 1P7JA 3IH2A 4B1RA 2L0KA 2EBIA 3LHQA 2DA4A 4X6AJ 4W1UA 5E3OA 5IP9J 3NRGA 2R5ZA 4DZPA 3MKLA 1XG1A 1JUPA 3I4MJ 1RR7A 2EZIA 1MBGA 3CCYA 3JRIA 3HB9A 3QQAA 3KNWA 3S1NJ 1ETOA 2FQ4A 3HEFA 2JK3A 2XGEA 4M3EA 2PBXA 4NN1A 3V6GA 5EF6A 4A3EJ 2CU7A 9ANTA 1TWFJ 2IEKA 1MBFA 1FEXA 4PXIA 5EZGA 1HDPA 3BTCA 4B4CA 5CXGA 4J19A 1FIPA 1Y1WJ 1X58A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VPR A;  3HOX J;  3HIM A;  2L7M P;  2CRG A;  3I4N J;  2WAQ N;  3BHQ A;  3RKQ A;  1BW5 A;  1FJL A;  2HOA A;  5CXI A;  4AC0 A;  2GFN A;  4M6V A;  3GTM J;  2MSY A;  2K9S A;  3LNQ A;  1AKH B;  2LFB A;  5FHP A;  1DU6 A;  5IP6 A;  3PPB A;  1OJL A;  3HM5 A;  4AF5 A;  1JJ6 C;  3G1O A;  4B3A A;  3JRD A;  3ZQC A;  2LTP A;  3S1R J;  4A3C J;  3MVP A;  5F0C A;  1OCT C;  1SAN A;  1WPK A;  1EF4 A;  3BRU A;  3JRC A;  2CJJ A;  2EZK A;  2E2J J;  1K83 J;  2WV1 A;  3GTJ J;  3BNI A;  4GCL A;  4CYC B;  4W97 A;  5J3L A;  3JRG A;  2HKU A;  3HGY A;  2B63 J;  1LFU P;  2ECC A;  3FK7 A;  2ME0 A;  1W0U A;  3GTQ J;  3ZQG A;  4XRM A;  2VKV A;  4QIW N;  1ZKG A;  3FIW A;  2D5V A;  2F07 A;  3BQZ A;  1U9O A;  1JTX A;  5FKN A;  1DU0 A;  1XC5 A;  2LK2 A;  1T56 A;  5E3N A;  1JUS A;  3LSP A;  2UXI A;  1WGX A;  2QKO A;  1G2H A;  3UKG A;  1A5J A;  2Y9Z A;  5JLW A;  4A3J J;  1UI5 A;  2R5Y A;  1RKT A;  2DN0 A;  3M3Y J;  2ID6 A;  1UI6 A;  1TWC J;  4UUS A;  3Q3S A;  3IH3 A;  1X2M A;  2ZOZ A;  3WHC A;  5M3F J;  3SDG A;  3JRE A;  1F43 A;  1HF0 A;  3EUP A;  2FD5 A;  5FLM J;  2JWT A;  2HDD A;  3BR3 A;  1RPW A;  1PUF A;  2QCO A;  4A3K J;  3LOC A;  4DYR A;  2XRL A;  3OSF A;  2R92 J;  1H88 C;  1ZR2 A;  5JLX A;  1WCM J;  3TW6 A;  3A01 A;  1ITY A;  2G7L A;  3P9T A;  3VUQ A;  2DMN A;  2X6O A;  5EGO A;  3ZQI A;  1VI0 A;  5M5W J;  3LJL A;  4JYK A;  2PMZ N;  3VW2 A;  2ME6 A;  2Y0S N;  1JKP C;  2NOG A;  4JP0 A;  4XRS G;  5J1R A;  1YRN B;  5D1R A;  3HOV J;  2NVT J;  1RET A;  1GVD A;  3FKI J;  1QVT A;  4AYB N;  2E19 A;  3RH2 A;  2ZB9 A;  1HLV A;  4MK6 A;  2R5Z B;  2EH3 A;  5C4X J;  2TCT A;  3VW0 A;  3S14 J;  4LOC A;  2JA8 J;  4XIC A;  3B81 A;  2XPV A;  2NS7 A;  4ABZ A;  2HXO A;  1VFC A;  2H1K A;  4GFK A;  3H3V K;  3NAU A;  2YUS A;  3BCG A;  3ZQL A;  4FTH A;  3ZQH A;  5M5Y J;  2DA5 A;  4RDU A;  2O8K A;  4A3G J;  4AC6 A;  1JUM A;  3Q0U A;  1F36 A;  5FMP A;  5F27 A;  4X1E A;  4V2F A;  5HBU A;  2FX0 A;  4RBO A;  3CDL A;  1ETK A;  2YVE A;  1TWH J;  4BKX A;  3VOK A;  3GZI A;  4M3B A;  2JMW A;  4A3D J;  2DMP A;  2VUM J;  2G3B A;  1QRY A;  1IUF A;  4M3G A;  4GFB A;  3S17 J;  2JA5 J;  2OPT A;  3OSG A;  2OI8 A;  2DMU A;  2QWT A;  2EQR A;  4QTR A;  3OOU A;  4DYQ A;  4YZE A;  3VP5 A;  1JGG A;  1SFO J;  3GTG J;  3A02 A;  2AO9 A;  1IDZ A;  5D19 A;  4CGR A;  2QF7 A;  3CRJ A;  1WH5 A;  3BR2 A;  2O7T A;  4JL3 A;  2HI3 A;  3AQT A;  3PAS A;  1OFC X;  5EG0 A;  2DG7 A;  4QSH A;  2DMQ A;  4A93 J;  5GPA A;  1LFB A;  1NTC A;  4MFD A;  2Y31 A;  4DW6 A;  1UHS A;  4IHW A;  3HOZ J;  4A3F J;  1IG7 A;  1NK3 P;  2NVQ J;  1IV6 A;  4MO7 A;  5C3E J;  1OCP A;  2XB0 X;  3Q0V A;  1MNM C;  3KKC A;  3BG9 A;  3HOY J;  1ETQ A;  3V78 A;  4GCT A;  3Q0W A;  2NX4 A;  3GTK J;  5FKK A;  1BJZ A;  2NP5 A;  1XS9 A;  2IU5 A;  4MFE A;  2QIB A;  1ZGW A;  5M3M J;  1RKW A;  2FBQ A;  3BT9 A;  1W0T A;  5FKL A;  2LP0 A;  3FIS A;  2XB5 A;  4UUT A;  1CQT A;  4G12 A;  3NPI A;  3KZ9 A;  3S16 J;  1QVU A;  2R5Y B;  3QBM A;  2GLO A;  5HSZ A;  4A3I J;  4UUS B;  3BR0 A;  1MSF C;  3HTA A;  4FE7 A;  2N8G A;  4D5C A;  4AUX A;  5K7F A;  4FIS A;  1JT6 A;  2VKE A;  5F1J A;  3IV5 A;  1HCR A;  2E2I J;  2V57 A;  2JA7 J;  5H9T A;  3GEU A;  1IGN A;  1FIA A;  1JTY A;  4FE4 A;  4MIM A;  1PUF B;  2HQ5 A;  2LY9 A;  2MG4 A;  5DAJ A;  1IDY A;  2G7G A;  3M4O J;  1SGM A;  5IYB J;  3A01 B;  2H8R A;  4XRS A;  3S15 J;  5EGO B;  1BA5 A;  2K9Q A;  1AHD P;  4NEL A;  3BR1 A;  4ME9 A;  3K7A J;  2M2E A;  2ZCN A;  4NDL A;  2QTQ A;  3EGQ A;  4IEJ A;  1HOM A;  2HYJ A;  1I3Q J;  2CQX A;  3D1N I;  2WUI A;  3JRH A;  5C4J J;  1D5Y A;  5FGL A;  3BR6 A;  2RAS A;  2HOS A;  4A3L J;  1UMQ A;  2NVY J;  5EZH A;  1VND A;  1I6H J;  3S1Q J;  2DA7 A;  2ZCM A;  2CUF A;  2LVS A;  2OF7 A;  1IJW C;  4DYC A;  3VVY A;  4D7N A;  3F1B A;  4HKU A;  2COB A;  2EZL A;  5FLV A;  4BY7 J;  5DTD A;  5EFY A;  2XDN A;  1IC8 A;  3E7Q A;  1U8B A;  3NAR A;  3QPS A;  2MGQ A;  3K2A A;  1ZK8 A;  1ETV A;  4I6Z A;  2K9N A;  4IHX A;  2YS9 A;  1Z77 A;  2ECB A;  3VIB A;  2UXU A;  1AU7 A;  3TP0 A;  5IOY A;  5EDN A;  3L1P A;  3VVX A;  2XSD C;  5DS9 A;  3VOX A;  3CJD A;  1ETW A;  1FTZ A;  3DCF A;  4L5E A;  3H0G J;  5F0F A;  5E3L A;  3PO2 J;  1TWA J;  2AHQ A;  3HTI A;  4I76 A;  4XK4 A;  4Y52 J;  4BY1 J;  1BW6 A;  1ETY A;  3HKZ N;  2DG8 A;  1MBH A;  1LE8 A;  2G0E A;  1HDD C;  3ZOB A;  5IOZ A;  3COL A;  1A6I A;  2IAI A;  1O4X A;  1WI3 A;  5EG0 B;  2R0Q C;  3ON4 A;  2TRT A;  2L7F P;  3ON2 A;  4L62 A;  5AQC A;  5K7Z A;  5E3M A;  1B8I A;  3HTJ A;  2X48 A;  2DA2 A;  4JNN A;  3LSG A;  3HOW J;  5FJ8 J;  2XPU A;  3G7R A;  4XID A;  4Y7N J;  2GUH A;  2DMT A;  1RES A;  1X2N A;  5M5X J;  3QPL A;  3NXC A;  5GPC A;  4JX4 A;  3RZD J;  1K61 A;  1BL0 A;  2LD5 A;  5F0H A;  2LLK A;  3PM1 A;  3CQZ J;  3ANP A;  3C2B A;  3CMY A;  1ZTR A;  3DEW A;  5F08 A;  2CQQ A;  2O9L A;  2REK A;  3RD3 A;  2UXH A;  2JA6 J;  5C44 J;  4BBS J;  2M0C A;  3O8G A;  5IYC J;  1JT0 A;  3IUV A;  2YVH A;  2L7Z A;  1GT0 C;  2EZH A;  5CW8 A;  4BXX J;  2GM4 A;  3GTO J;  4ACI A;  2Q24 A;  4C2M J;  5BNG A;  3KKD A;  2E2H J;  4KWA A;  3BQY A;  3W6V A;  2RHA A;  2XGD A;  2QOP A;  1I50 J;  2WB1 N;  4M3D A;  1JKR C;  1TC3 C;  5K58 A;  2NP3 A;  1JJ8 C;  4A69 C;  1Z0X A;  3CWR A;  1U9N A;  1MBK A;  1TWG J;  5HOD A;  4IHV A;  4C3I J;  1E3O C;  2P81 A;  1B72 A;  3BTJ A;  2Y2Z A;  3A03 A;  1H8A C;  2VI6 A;  3T6N A;  2WGB A;  2E1O A;  2ID3 A;  2JJ7 A;  1FTT A;  5C4Y A;  2LKX A;  3RZO J;  3NI7 A;  2ZCX A;  4D5F A;  3JRA A;  2DTZ A;  1GUU A;  3VVZ A;  2VPR A;  2GEN A;  1APL C;  4EEF G;  1IRZ A;  1UG2 A;  3HBL A;  3C07 A;  2LR8 A;  4S0H B;  4MXM A;  3VW1 A;  3MNL A;  2G7S A;  2W53 A;  3LSJ A;  2YU9 J;  2Y9Y A;  3RQI A;  1Y1V J;  3SFI A;  2DA1 A;  2D6Y A;  2K40 A;  4GFL A;  1JKO C;  2IBD A;  5EYR A;  3BR5 A;  3G1L A;  1Q1V A;  3PO3 J;  1T33 A;  3FK6 A;  5GP9 A;  3OIO A;  5F04 A;  2KDZ A;  2XPW A;  4JKZ A;  2GBY A;  1QPI A;  3FRQ A;  4MLO A;  5J1U A;  2R7Z J;  3HOU J;  3HTH A;  2JN6 A;  3JRF A;  3GTP J;  5HAW A;  2MW8 A;  4ICH A;  3LWJ A;  5IPA A;  3BTL A;  2OER A;  3JR9 A;  1AKH A;  2M34 A;  1MBE A;  4JX6 A;  1MH4 A;  2L9R A;  1ETX A;  3B6A A;  3NNR A;  3S1M J;  2UXP A;  1VF9 A;  3BG3 A;  3GBG A;  1LE8 B;  3ZQF A;  3GTL J;  3BTI A;  5IYD J;  2O7O A;  3F0C A;  4C3J J;  3ANG A;  2I10 A;  4JX5 A;  1GV2 A;  1S7E A;  2DA6 A;  2X9D A;  3B6C A;  4DZJ A;  1B8I B;  3WHB A;  2ELK A;  5J1Y A;  2RAE A;  1NK2 P;  1R9T J;  4UDS A;  4CYC A;  2M8G X;  4IHY A;  3HDD A;  3G56 A;  1MSE C;  3S2D J;  3G1M A;  4A3B J;  1WH7 A;  3QKX A;  4GCK A;  2FJ1 A;  4C3H J;  3AQS A;  1GV5 A;  3TW7 A;  3O8H A;  4V2G A;  3BG5 A;  3S5R A;  3LSR A;  4BBR J;  3HGG A;  3MN2 A;  2Y30 A;  4HNV A;  2DA3 A;  5K7H A;  2R93 J;  3JRB A;  3TP3 A;  4D7M A;  2NVX J;  1POG A;  1U78 A;  2XGC A;  4M3F A;  2ZOY A;  2DJN A;  3SJM A;  1ZR4 A;  3BJB A;  5D18 A;  3E7L A;  1MBJ A;  3O60 A;  2UXO A;  3S2H J;  2PZ9 A;  2CUE A;  3TED A;  2HOT A;  4A3M J;  1ZQ3 P;  3DPJ A;  4FCY A;  2HYT A;  1JKQ C;  2KT0 A;  5FKM A;  1ENH A;  1GDT A;  5EEA A;  2M9H A;  1MH3 A;  2W48 A;  5FKO A;  2HXI A;  2NS8 A;  3IH4 A;  1P7I A;  3HE0 A;  1H89 C;  1B72 B;  3JSJ A;  5IP7 J;  1YRN A;  1ORK A;  1P7J A;  3IH2 A;  4B1R A;  2L0K A;  2EBI A;  3LHQ A;  2DA4 A;  4X6A J;  4W1U A;  5E3O A;  5IP9 J;  3NRG A;  2R5Z A;  4DZP A;  3MKL A;  1XG1 A;  1JUP A;  3I4M J;  1RR7 A;  2EZI A;  1MBG A;  3CCY A;  3JRI A;  3HB9 A;  3QQA A;  3KNW A;  3S1N J;  1ETO A;  2FQ4 A;  3HEF A;  2JK3 A;  2XGE A;  4M3E A;  2PBX A;  4NN1 A;  3V6G A;  5EF6 A;  4A3E J;  2CU7 A;  9ANT A;  1TWF J;  2IEK A;  1MBF A;  1FEX A;  4PXI A;  5EZG A;  1HDP A;  3BTC A;  4B4C A;  5CXG A;  4J19 A;  1FIP A;  1Y1W J;  1X58 A; 
#chains in the Genus database with same CATH topology
 3VPR A;  1MIJ A;  3HIM A;  2VN2 A;  2RDP A;  2M87 A;  3I4N J;  3G3Z A;  4E7K A;  1QBJ A;  1D3Y A;  4E6K G;  1FJL A;  5CXI A;  2O6G E;  1LEB A;  2H6B A;  4AC0 A;  4MEY F;  3GTM J;  2K9S A;  2X85 A;  2DLL A;  2XGX A;  1ZAO A;  2L9V A;  1N78 A;  1X1C A;  2Z2S B;  2R7X A;  2EFQ A;  2KIF A;  1A04 A;  4BXU A;  2PFV A;  3VYT B;  1FYM A;  2KRF A;  4BAY A;  2WV0 A;  2E1C A;  3ZQC A;  3PUF A;  3S1R J;  2WBM A;  2NNN A;  3AL0 B;  1OCT C;  1FYL A;  1WI9 A;  3BRU A;  3EET A;  3JRC A;  2EZK A;  5JFR A;  1V3F A;  1K83 J;  3R0J A;  3DPL C;  3BNI A;  3T8T A;  4D9J A;  4W97 A;  4OWR B;  5J3L A;  3SXY A;  2EV6 A;  5JR3 A;  2OQR A;  3FK7 A;  1D8K A;  4BXF A;  5FRM A;  2Z33 A;  3ZQG A;  4XRM A;  3NS4 A;  1FPQ A;  2V1D A;  4QIW N;  2E34 A;  3BQZ A;  4ENM A;  4DIQ A;  4L9T A;  4A12 A;  2CQN A;  5FKN A;  1U3E M;  4ZJZ A;  1D0Y A;  3UKG A;  1A5J A;  1U5T C;  2W1O A;  4Y33 A;  2ZXW H;  2ZO4 A;  1PUE E;  1X4O A;  3M3Y J;  2ID6 A;  4ASN A;  1TWC J;  2ZFW A;  3CMM A;  1W7P B;  3FXL A;  4CUG A;  1ACI A;  2P5K A;  1HW2 A;  1TBX A;  1X2M A;  3IH3 A;  4XLN F;  3OIP A;  1B6A A;  3EUP A;  4GYG A;  1LNW A;  3GYH X;  1LQ1 A;  3WG7 H;  3BR3 A;  3CO6 C;  1YS6 A;  1YJW I;  3P5J A;  2D45 A;  2XRL A;  1DGW Y;  2ZJR F;  3BJO A;  1WCM J;  1G3S A;  1U5T A;  2DOE A;  3OYB A;  4WF2 A;  5M5W J;  4JYK A;  2PMZ N;  1ZHF A;  4ZC3 A;  1O3R A;  5J1R A;  5D1R A;  2NRA C;  3VYU B;  1ZG5 A;  1R36 A;  3NQO A;  4AYB N;  2OUM A;  4I0B A;  4R8H A;  2R5Z B;  1OLT A;  3TQN A;  3SEZ A;  2JA8 J;  2FBK A;  4XIC A;  2H1K A;  1MZB A;  1QZZ A;  2A61 A;  5TGT A;  1E17 A;  3BCG A;  3ZQL A;  5M5Y J;  4RDU A;  2GIZ A;  4A3G J;  4FHT A;  5IY5 H;  3Q0U A;  4X1E A;  1KU2 A;  2O03 A;  3I5U A;  3IP4 B;  2JSC A;  2IS6 A;  3PJR A;  4BKX A;  3VOK A;  3GZI A;  2HVQ A;  3V42 A;  2P8T A;  3OYE A;  4ENJ A;  4NC8 A;  3S17 J;  1SFX A;  2OPT A;  2VE9 A;  4ZYG A;  2IGK A;  3C2G A;  5CVI A;  2KMU A;  4A6E A;  4DYQ A;  2VQG A;  2BOL A;  3BPV A;  3GTG J;  3K69 A;  1IDZ A;  3MZ8 A;  2CMP A;  2QF7 A;  4N9I A;  4JL3 A;  2HI3 A;  2JT1 A;  3AQT A;  1AA7 A;  4ESB A;  2ZJP F;  5E1Z B;  5J47 A;  3QOD A;  3UNG C;  2FEZ A;  1TQP A;  4QSH A;  2MD5 A;  1SVL A;  1UZC A;  2LC2 A;  5LRR A;  2OZU A;  2QSF X;  3OOP A;  3HL2 A;  3BPX A;  2H94 A;  4M73 A;  3FF5 A;  5L3C A;  3RKX A;  2Y31 A;  2EFN A;  3HOZ J;  3IAM 2;  1X1A A;  4A3F J;  2LRE A;  4HNT A;  1IG7 A;  5DM6 F;  1FOY A;  3QYE A;  3LSK A;  2EIJ H;  1IV6 A;  4MO7 A;  2YPR A;  2AS5 F;  4CCK A;  3CP2 A;  3GZ5 A;  1OCP A;  5J6X A;  3M1C A;  2K85 A;  1G8X A;  1X3Z B;  1KU9 A;  1NHA A;  3TGN A;  1BM9 A;  4GCT A;  2NX4 A;  1BOB A;  1Z7L A;  5FKK A;  1BJZ A;  2ZKZ A;  4MFE A;  1ZGW A;  1R1U A;  1T2K A;  2DOF A;  5BQT A;  4ZZD A;  3W6K B;  4E7I A;  2XF6 A;  3R60 A;  1YHQ I;  4G6Q A;  4I98 B;  1N77 A;  4GO1 A;  1WKM A;  3NWT A;  3ONQ A;  3OR1 C;  1W5S A;  3T8R A;  1MSF C;  3IRR A;  3HTA A;  1VQK I;  5HS8 A;  4D5C A;  2GIV A;  3ABL H;  1JHH A;  3IV5 A;  2V57 A;  1BI3 A;  2BHY A;  3BWG A;  4ZTJ A;  2JA7 J;  4FE4 A;  2FXA A;  3H92 A;  5FD5 A;  4E70 A;  2CV0 A;  2PLY A;  5DAJ A;  4BJT A;  2DDA A;  2G7G A;  1OCO H;  3H0D A;  3K10 A;  2ZME C;  2HZT A;  3C2H A;  3QP6 A;  3QOP A;  3BR1 A;  4XKV A;  2QTQ A;  4HW0 A;  3PNV A;  1J0R A;  4IEJ A;  4CCM A;  2PI0 A;  1PVE A;  4BHC A;  1YS7 A;  3ZGK A;  5K1Y A;  4E7Z A;  3NRV A;  3BR6 A;  4AVZ A;  2HOS A;  3NWS A;  3VSL A;  5LRS A;  1UMQ A;  2M7A A;  5EZH A;  4OIN F;  3F9K A;  3S1Q J;  1FT9 A;  1PP7 U;  5B5E C;  2ZME A;  3DFG A;  3W3C A;  4D7N A;  4M74 A;  2GA1 A;  4HKU A;  1BC8 C;  3MEX A;  2F5E A;  2COB A;  2EZL A;  5FLV A;  1RR8 C;  2XDN A;  1O3Q A;  1U8B A;  3NAR A;  2IPQ X;  3QPS A;  2BY1 A;  3RPU A;  4HG2 A;  2K27 A;  3R6S A;  4XL9 A;  3JSP A;  1XSX A;  4LLG F;  1W5C C;  2BGC A;  1YOV B;  3WGH A;  4P9F A;  5K5Q A;  2XAS A;  5CVR A;  2XSD C;  1XDU A;  1ZYR F;  5D8L B;  4L5E A;  5F0F A;  3CCV I;  1FBS A;  4MGR A;  2IA2 A;  4LIU A;  1J75 A;  4CYD A;  3HKZ N;  2DG8 A;  1MBH A;  4KN7 X;  3R0A A;  3SYT A;  2JSP A;  1SAX A;  3KYL A;  3CES A;  2FU4 A;  5IOZ A;  1BOA A;  4RM3 A;  4XSX F;  3G73 A;  5ED4 A;  3TMO A;  3ON2 A;  3OR2 C;  1HKQ A;  2ZNZ A;  5K7Z A;  5E3M A;  3SHF A;  3HTJ A;  2DT6 A;  3K2Z A;  3LSG A;  5FJ8 J;  2XPU A;  4XID A;  2DMT A;  1R22 A;  2W00 A;  1V54 H;  4Y15 A;  5GPC A;  1E3P A;  2IVM A;  1MJB A;  3MAJ A;  1UCR A;  3FXU A;  3RZD J;  4GRI A;  4KUM A;  5F0H A;  1BN5 A;  3HSF A;  3OYN A;  4BQQ A;  3OL4 A;  1WZ2 A;  4PGH A;  3L2V A;  2CQQ A;  1I1G A;  1FMW A;  3RD3 A;  4KIF A;  2JA6 J;  1I1S A;  4BBS J;  2DPD A;  2UXX A;  2QEX I;  2EZH A;  3WU1 B;  3ZN1 A;  2LYC A;  1PYV A;  3J81 K;  1Z6T A;  2F2E A;  4IRG A;  2RRE A;  5FRN A;  2G7U A;  1YLF A;  3KKD A;  2BHZ A;  4PCQ A;  4KWA A;  2HYF A;  3W6V A;  1XMA A;  3TOA A;  4CA0 A;  2P7V B;  5CQG A;  1TC3 C;  2NP3 A;  1Z0X A;  2VXD A;  4EM0 B;  2VC0 A;  2WY8 Q;  1MBK A;  3CCM I;  5CQE A;  4I7H A;  1TWG J;  1X1P A;  2HVR A;  4N9H A;  1XMK A;  1BBY A;  2P81 A;  3QAH A;  2HZD A;  1H8A C;  2VI6 A;  4RAY A;  2E1O A;  2CW7 A;  1MJ9 A;  3V7C A;  3ZXS A;  2ZCX A;  2AXL A;  1SD5 A;  1VZ0 A;  1XGO A;  4L9V A;  3RI4 A;  3R61 A;  2GEN A;  1RZ4 A;  2DOD A;  1FP1 D;  4G7O F;  1X4P A;  3WTY C;  3RYP A;  2I8D A;  4XN0 A;  5E1X A;  1ON2 A;  3VW1 A;  3MNL A;  2G7S A;  2O8X A;  3AFH A;  3LSJ A;  3OYG A;  2O0Y A;  4N0B A;  3FKJ A;  4G6D A;  2V1X A;  1XMX A;  2XAH A;  3B73 A;  1GVJ A;  3SFI A;  1H0M A;  4XKC A;  1FZP B;  4G6T B;  1GXP A;  4L0Z B;  4GFL A;  2ZME B;  1D0Z A;  2R7W A;  4F91 B;  1S7O A;  1Z21 A;  2M8E A;  5EYR A;  4B3X A;  3Q5F A;  5FLX K;  3W2A A;  3K9T A;  1Z3X A;  3F8F A;  4G8X A;  2HQR A;  3DEU A;  2GBY A;  5FFZ A;  3FRQ A;  4MLO A;  5DD8 A;  2OA4 A;  3LA7 A;  2R7Z J;  3HTH A;  2HKX A;  3T5X A;  2K3P A;  4V19 K;  3MD2 A;  5HAW A;  3LMM A;  3UR3 C;  3VTI A;  4Y13 A;  4H4K C;  4O5V A;  1B9M A;  3CZ6 A;  2OER A;  2QKL B;  1AKH A;  5CVV A;  1MH4 A;  2PQ8 A;  4F55 A;  4ZYA A;  5BMZ A;  2Q0O A;  1Y8Q B;  1VF9 A;  3GBG A;  3ZQF A;  3G4S I;  3GTL J;  4R1H A;  3F0C A;  3A0B C;  4C3J J;  5GTI C;  3ANG A;  1D1C A;  5HNF A;  3DQV C;  1YJN I;  5D6E A;  2I10 A;  3OWT A;  2ZXJ A;  2DA6 A;  5FB2 A;  3VFZ A;  1OR7 C;  4PDK A;  2ELK A;  1ON1 A;  3WHB A;  5J1Y A;  4HDU A;  3GX4 X;  2M8G X;  3HDD A;  1VQ9 I;  4PJM A;  3G1M A;  3HYI A;  3QKX A;  3K4M A;  1K79 A;  4LIT A;  2JPC A;  2RV8 A;  2KJC A;  3KE2 A;  1NH3 A;  2FJ1 A;  3AQS A;  1M1E B;  2HDW A;  3LST A;  4L9N A;  4V2G A;  1FOK A;  3WGI A;  3CJQ B;  2M7B A;  2DA3 A;  5K7H A;  2LG4 A;  5GAH J;  3K4L A;  2OC6 A;  3ML6 A;  4RB1 A;  1WJC A;  4F3Q A;  1OR7 A;  2MC3 A;  1V5F A;  1X3W B;  5J4V A;  4BEH A;  4XLA A;  1EJ9 A;  1IXR C;  3DU5 A;  1FWZ A;  1R7J A;  3WE2 A;  3VYR B;  2KIU A;  3E7L A;  3LQR A;  3O60 A;  3CCR I;  2A2F X;  1I5Z A;  1SAU A;  2ZNY A;  2CO5 A;  1XTA A;  3V8L A;  1FNN A;  3DPJ A;  2X6W A;  2GA2 A;  2DW4 A;  1IXC A;  1XCV A;  3DLL F;  2EWN A;  2OAZ A;  1MH3 A;  4C2U A;  3M07 A;  3KLO A;  4A0Y A;  1K4T A;  5FKO A;  2HXI A;  2NS8 A;  2WGB A;  3HE0 A;  2P4W A;  1H89 C;  5IP7 J;  3V8K A;  1TW2 A;  1Z67 A;  1ORK A;  1P7J A;  1YIO A;  1VQM I;  4PJN A;  2L0K A;  3BJA A;  2DA4 A;  4W1U A;  2FML A;  1OCC H;  1XG1 A;  2XAU A;  2EZI A;  4EM2 A;  4P55 A;  3CCY A;  1Z05 A;  1FP2 A;  3JRI A;  2G9W A;  1DGR M;  5KAI C;  2W25 A;  3KNW A;  1ETO A;  5KHD A;  2FQ4 A;  2FSW A;  3DTI A;  5E79 C;  3WE3 A;  4M3E A;  2XGE A;  1J59 A;  4YFK F;  3ECH A;  4M72 A;  4A3E J;  2CU7 A;  3IL2 A;  3JAM K;  4PXI A;  5EZG A;  5CXG A;  4I99 C;  3JSO A;  1FIP A;  4XMY A;  3J80 K;  1XX5 A;  1K4S A;  2L7M P;  2CRG A;  4KA4 A;  5L3E A;  1YW7 A;  3IRQ A;  2HOA A;  2STT A;  1Z9C A;  4P1W A;  4QWQ A;  2ZXH A;  4JBA A;  4HPQ A;  5HVQ C;  1YJ9 I;  2GFN A;  3D5R C;  2LY1 A;  1AKH B;  2QLZ A;  4XSZ F;  3MZH A;  1LVA A;  1DU6 A;  3TOB A;  1SD4 A;  4C2T A;  5JHU A;  2XUB A;  3FDY A;  2FQ3 A;  4IOC F;  3RJP A;  3JW4 A;  1FOW A;  2RQP A;  4RA2 A;  3BOQ A;  2MH9 A;  4KIT B;  5LHI A;  3JTG A;  1LVK A;  3DTK A;  4ZYD A;  2CJJ A;  4OIR F;  2WV1 A;  4QLC U;  4GCL A;  3KP5 A;  4I2O A;  3H1C A;  1YW8 A;  3ZQQ A;  4FX4 A;  1F1Z A;  4B43 A;  5DDG A;  1ZAR A;  4C30 A;  2DYR H;  1BC7 C;  4B8X A;  1CF7 B;  2AQE A;  2VT2 A;  3ESW B;  2RQQ A;  5DV5 A;  4ENN A;  2F07 A;  1U9O A;  2HWV A;  4BDZ A;  2WB1 A;  1JTX A;  2PBI A;  4UNO A;  3BZK A;  2LK2 A;  1T56 A;  3B02 A;  4KN4 X;  3D5S C;  3MQ0 A;  3K70 C;  2Y9Z A;  2TDX A;  4A6D A;  1UI5 A;  4BEH B;  3CDH A;  4BNC A;  4UUS A;  3HTU A;  4RS8 A;  1QO0 D;  3Q3S A;  3BZC A;  1T39 A;  2HPI A;  3SZT A;  3OYK A;  5M3F J;  4DVY P;  3JRE A;  3N97 A;  2DPU A;  2L02 A;  1HF0 A;  4M6Y A;  4ZDP A;  3ZP5 A;  1PUF A;  1V55 H;  1OCZ H;  3OYL A;  1YTY A;  3CTA A;  3I4P A;  2A5W A;  2R92 J;  5E8G A;  2VKD A;  4LGW A;  1W1W E;  3SQN A;  3A01 A;  2CUZ A;  2HU9 A;  4U0W A;  1ITY A;  3ZMT A;  3VUQ A;  1XGM A;  1G6N A;  3VW2 A;  2PEX A;  2ME6 A;  1JKP C;  4JP0 A;  3G71 I;  4XLC A;  4LB5 A;  1F9N A;  3N4M A;  4WXC A;  3HOV J;  2HVS A;  1GXQ A;  3RH2 A;  2YSR A;  1HLV A;  2J5O A;  4MK6 A;  2MYS A;  2JQ7 A;  1BI2 A;  2BV6 A;  3ZMZ A;  1UAA A;  2TCT A;  2P7C B;  4I0A A;  2JUG A;  2UWM A;  3ASN H;  1AOY A;  2QQ9 A;  3B81 A;  2XPV A;  2NS7 A;  4JOM A;  3BDD A;  1TZL A;  3H5R A;  4PSW A;  2IT0 A;  4UVA A;  2YUS A;  2DA5 A;  4AC6 A;  5FMP A;  5J40 A;  1EA3 A;  1QZY A;  5F27 A;  1TT0 A;  4V2F A;  5HBU A;  4E7S A;  2ETH A;  5HDG A;  2V9V A;  2DMP A;  3G2B A;  3O3K A;  4F92 B;  4U9L A;  4M3G A;  4GFB A;  1DP7 P;  2DOA A;  2XAG A;  2JA5 J;  4E7L A;  2OI8 A;  2QWT A;  1WVR A;  4HRI A;  3VP5 A;  3FWE A;  1ZG1 A;  1UFM A;  2BZT A;  1RIO H;  2DJI A;  5HLG A;  5D19 A;  4CGR A;  2DAO A;  2O7T A;  3I64 A;  2E1M C;  3PAS A;  1OFC X;  5EG0 A;  1MW7 A;  2ISY A;  3C7J A;  2DMQ A;  2OQG A;  1B9N A;  1K6O A;  1TL8 A;  4O6J A;  1WFX A;  4IOA F;  5L3F A;  4AIJ A;  2DYS H;  4DW6 A;  1UHS A;  1NK3 P;  3HZJ A;  4XBF A;  2VBZ A;  4IXA A;  1SD6 A;  3V7R A;  4LG0 A;  3J7Z I;  4CIC A;  1W36 D;  3U9G A;  3Q0V A;  5FGM A;  2FA5 A;  2L9S A;  3FXK A;  1HW5 A;  1MNM C;  3GEZ A;  2ADU A;  4Q48 A;  5LBQ A;  1ETQ A;  3V78 A;  2KJB A;  3Q0W A;  1TW3 A;  4PUS A;  5D5V B;  1JXS A;  4XN3 A;  2ACJ A;  2GOX B;  4NNJ A;  4RGU A;  2BVL A;  1XS9 A;  2GXA A;  4RM2 A;  2IU5 A;  1RKW A;  2FBQ A;  1OKR A;  4HX8 A;  4IRI A;  5FKL A;  2R3S A;  3O6B B;  4G12 A;  3GWZ A;  1EH7 A;  3KZ9 A;  3S16 J;  1A36 A;  1JHF A;  3A0H C;  3HUG A;  5HSZ A;  4A3I J;  4UUS B;  5ICF A;  4FET A;  4NB5 A;  1SMT A;  2BW3 A;  4AUX A;  3I3L A;  3GZN B;  4HNU A;  4FIS A;  2LMD A;  1JT6 A;  1HCR A;  4DBR A;  2K02 A;  3TDZ C;  4E4H A;  4MIM A;  1EH8 A;  4PZJ A;  1PUF B;  2VOD A;  2LOO A;  4XOT A;  1Q1H A;  1LKX A;  5K5R A;  3L09 A;  1G3Y A;  1SGM A;  5F6F A;  5IYB J;  1R6R A;  3A01 B;  3M8F A;  2H8R A;  1KA8 A;  2CV1 A;  4B44 A;  3X2Q H;  3MMY B;  4XRS A;  1AHD P;  2X0L A;  4IRH A;  4EGZ A;  3CCU I;  3EGQ A;  3PNT A;  3TO7 A;  3PFY A;  4IHS A;  4K2E A;  1OPC A;  4L5J A;  2HYJ A;  1I3Q J;  1ZEL A;  4XM3 A;  3H9G A;  3ZRG A;  2BE5 F;  4E7J A;  2ZFU A;  1MMS A;  2RAS A;  3K8P C;  2GXG A;  1S3J A;  2F48 A;  3RCO A;  2X1C A;  3DKY A;  3FX3 A;  4WWC A;  1UST A;  4AIK A;  2CUF A;  1YQA A;  4KIC A;  2WAQ A;  4DYC A;  5K5O A;  2EV5 A;  2XKP A;  3FBI B;  5ICC A;  2VC1 A;  4BY7 J;  3F21 A;  5EFY A;  2KHM A;  4KJZ A;  1ZK8 A;  2CQK A;  1ETV A;  5DD4 A;  4I6Z A;  2K9N A;  1VQL I;  2YVX A;  2YS9 A;  4U7D A;  1Z77 A;  2ECB A;  3EUA A;  2UXU A;  3VIB A;  2YU3 A;  5IOY A;  4D0P A;  4KMU X;  4CO8 A;  1S8N A;  3L1P A;  2PMH A;  5E1W A;  3ABM H;  3HOS A;  2BY0 A;  5D6F A;  3CJD A;  1ETW A;  2YR2 A;  3K0L A;  2L9N A;  3PO2 J;  2IRF G;  3HTI A;  4BE1 A;  4I76 A;  2X4H A;  4Y52 J;  2FE3 A;  2KKO A;  3BY6 A;  2ZBK A;  1LE8 A;  3ECO A;  3TO9 A;  4GGG A;  4L18 B;  4BQN A;  2JTV A;  2CV2 A;  1HDD C;  2PJR A;  2QKM B;  2VJ5 A;  1S29 A;  3ZOB A;  2IAI A;  2XDV A;  5LLQ A;  3RTR A;  5EG0 B;  2R0Q C;  3ON4 A;  2KIS A;  2TRT A;  2L54 A;  3TO6 A;  3PFI A;  1B8I A;  1R4N B;  1EV7 A;  2F5C A;  1RUN A;  2DFE A;  1UEL B;  3K4N A;  4Y7N J;  5J8F A;  1RES A;  1RRJ A;  4PFP A;  1Z6R A;  1OYW A;  2R7S A;  3BLY A;  3WU2 C;  5FD6 A;  3ULQ B;  1R58 A;  1WQ2 A;  2ESN A;  3NEU A;  4LG0 B;  2VL8 A;  3CQZ J;  1D5V A;  3ANP A;  3C2B A;  3M8J A;  2IGN A;  2V6C A;  2E1M B;  3H5N A;  2X6Y A;  4CH7 A;  2UXH A;  1TP4 A;  5IYC J;  1JT0 A;  2IGO A;  4G9Y A;  5L3B A;  1SFK A;  2HEO A;  2BY2 A;  3WOD F;  4UVB A;  4BXX J;  2BVM A;  4ACI A;  4HOB A;  3MKW B;  1VQN I;  2H8W A;  4ZZL A;  4H0E A;  3TKY A;  3HUG B;  2BEO A;  4M3D A;  2V1N A;  1QU3 A;  3QOE A;  4CZZ A;  2QQA A;  2QZ8 A;  2BW3 B;  5K58 A;  4AM3 A;  2XRO A;  4DOZ A;  4ESJ A;  1BR2 A;  3OMY A;  1R1V A;  1E3O C;  1ZLK A;  2MD0 A;  1B72 A;  5B1A H;  3T6N A;  3IWZ A;  4HF1 A;  2I5U A;  1D0X A;  2OCC H;  2W4S A;  2ID3 A;  2JJ7 A;  4FQG A;  3BRO A;  2F4O B;  2LKX A;  2ZY9 A;  2A6E F;  3NI7 A;  2PN6 A;  2NYX A;  4YFN F;  1Y8R B;  2M0M A;  4II2 A;  5ILU A;  3KX2 A;  2ELJ A;  3F3X A;  4OAZ A;  1KON A;  3F8N A;  4WIB A;  4EEF G;  1HKS A;  3DKW A;  2B7E A;  2W24 A;  5A2Q Z;  3C07 A;  1WJ5 A;  2LR8 A;  3HSR A;  4MXM A;  3GFM A;  1D8J A;  3RYR A;  3FM5 A;  2KZV A;  3PQK A;  5LD2 C;  3L2U A;  2W53 A;  2YU9 J;  2Y9Y A;  1Y1V J;  5D5U B;  4ETS A;  4YII A;  4HV5 A;  2MAB A;  3MKZ A;  3PSI A;  3FZV A;  3BR5 A;  1Q1V A;  1U5T B;  1IN4 A;  1T33 A;  2OV7 A;  2Y0M A;  3HSE A;  3PO3 J;  2FMY A;  1IN6 A;  2WAE A;  5F04 A;  1OIS A;  2E35 A;  2HFH A;  1QPI A;  4MNU A;  2L01 A;  1DUX C;  3GTP J;  2KZG A;  2D1H A;  3A1Y A;  3CJT B;  2DT5 A;  4ICH A;  1XDS A;  3A4C A;  3OYA A;  3WG9 A;  2M34 A;  5JVT A;  1MBE A;  1L0O C;  4JX6 A;  3W6J B;  3KP6 A;  4HST A;  1ETX A;  1FY7 A;  3FXJ A;  1U6G A;  3H9J A;  3BG3 A;  3HTS B;  1SEU A;  1LE8 B;  1Y6I A;  2Z99 A;  2O7O A;  3GW2 A;  2GQQ A;  2PJR B;  3ZPL A;  1EKE A;  2IS4 A;  3VDX A;  3CJR B;  3CCQ I;  2EFP A;  3HG9 A;  4ESF A;  4X0G A;  3E5Q A;  1X19 A;  1B8I B;  3J7Y J;  2DFH A;  1NK2 P;  4UDS A;  4IHY A;  1V4R A;  2Z9O A;  3DU6 A;  5DCF A;  4A3B J;  1WH7 A;  1XGS A;  3LA3 A;  4GCK A;  1XB4 A;  1REP C;  3Q9S A;  1X3U A;  3BG5 A;  3SDB A;  1MNE A;  2K7L A;  3MN2 A;  1SFU A;  4HF2 A;  4HBL A;  3RIR A;  3TP3 A;  1QQI A;  2NVX J;  1POG A;  2KPM A;  4M3F A;  1WHU A;  3A2K A;  1J5Y A;  5TRD A;  3DKX A;  1G3W A;  1FBQ A;  5BPI A;  2OTL I;  1R71 A;  3HXL A;  3BJB A;  5D18 A;  1MMG A;  1MBJ A;  2M5W A;  1IO2 A;  4WXH A;  2HTS A;  2KLO A;  2EV0 A;  4BE0 A;  5ERI A;  2IS2 A;  2BY3 A;  2HYT A;  4IF4 A;  1JKQ C;  3F23 A;  5FKM A;  3S93 A;  2DQR A;  4L0Y B;  2CYY A;  4B47 A;  3E6B A;  4U88 A;  5EJC A;  5HOO A;  1FX7 A;  2EIL H;  3I54 A;  3IH4 A;  2CS3 A;  1B72 B;  3IKV A;  1P4X A;  5HLI A;  4OU0 A;  4B1R A;  1PJR A;  4LD5 A;  3LHQ A;  2EIN H;  2K4B A;  5CVJ A;  5E3O A;  1O3S A;  1IN5 A;  3NRG A;  3PIP F;  1B1B A;  1MBG A;  2JA2 A;  3EPZ A;  2VON A;  2Y0S A;  3GLL A;  4HEA 2;  1KZH A;  3SEQ A;  1NG6 A;  3HEF A;  5KNL A;  3GFL A;  4RAF A;  2XF5 A;  3E1S A;  2JK3 A;  3TL4 X;  2PBX A;  4NN1 A;  3OIQ A;  2FUG 2;  1K78 A;  3S2W A;  2B3W A;  2IEK A;  3I0T A;  2VBY A;  1TT5 B;  2GWR A;  3WTV C;  2Z3Y A;  2KFD A;  4J19 A;  4BQA A;  1N75 A;  1W4M A;  2L4A A;  2P6T A;  2Q8K A;  2IW5 A;  3I59 A;  2R7Q A;  3BHQ A;  3RKQ A;  1BW5 A;  3E0J B;  2LNB A;  1H9T A;  3HRM A;  1UHW A;  4KFC A;  3LAJ A;  2FOW A;  2MSY A;  2FOK A;  2RGV A;  4BH9 A;  4E7H A;  3S8P A;  2CSO A;  2HYG D;  1OJL A;  3L2R A;  2MBF A;  1JJ6 C;  5D4S A;  3MFK A;  2AXT C;  3CUO A;  5FO5 A;  3JRD A;  2R7D A;  2LTP A;  4IHT A;  4A3C J;  2DT7 B;  3SZP A;  5F0C A;  3BG6 A;  1WJD A;  4U7B A;  2JVG A;  2AQF A;  4XKW A;  4EGY A;  4BYY A;  1EF4 A;  2E2J J;  3ABK H;  1S7A A;  1D1B A;  1VQO I;  3KYC B;  2KRC A;  2RN7 A;  1U0J A;  3PUB A;  5CLS A;  2F5V A;  4XOP A;  3HGY A;  2B63 J;  1LFU P;  4YFX F;  2ECC A;  2ME0 A;  2XAF A;  5LGT A;  2VQC A;  2XV4 S;  2VKV A;  1ZKG A;  3FIW A;  2P0W A;  2DCE A;  2VBW A;  3K70 D;  3FXR A;  1DU0 A;  1XC5 A;  1SVM A;  5E3N A;  1JUS A;  3LSP A;  1WGX A;  3CF5 F;  2QKO A;  5LEJ A;  2BBY A;  5JLW A;  4Z6Y A;  1R23 A;  1RKT A;  3GF2 A;  4EJO A;  1W7P D;  1YIJ I;  3GXO A;  2K4J A;  2J5P A;  2DK5 A;  4BS9 A;  4I01 A;  3F8M A;  2FD5 A;  3V7S A;  1QHH D;  2IA0 A;  2E60 A;  2HDD A;  2Y48 A;  1HBX G;  2QCO A;  4A3K J;  1DPU A;  2A05 A;  4DYR A;  1QZE A;  1E3H A;  3TW6 A;  3ZMV A;  1O7F A;  2DMN A;  2X6O A;  5EGO A;  2LKS A;  4HYE A;  3ZQI A;  2VLA A;  4EMS A;  2X51 A;  2Y0S N;  2NOG A;  3VSK A;  4XRS G;  1J2X A;  1DQU A;  2FJI 1;  2NVT J;  4CSW A;  1GVD A;  5B1B H;  2FF4 A;  3QPH A;  2E19 A;  3VOD A;  2STW A;  1WJF A;  2ZB9 A;  2EH3 A;  2WAD A;  3KPH A;  3VW0 A;  4BE2 A;  3S14 J;  3DLA A;  4GFK A;  5JVG F;  4ABZ A;  1LDK B;  2DFF A;  2OU2 A;  3H3V K;  2CFO A;  2QYO A;  5DUK A;  2H6C A;  4F52 A;  1MD0 A;  4CCO A;  4FTH A;  2O8K A;  4RB0 A;  3CD6 I;  3VYS B;  1Y56 A;  1VQP I;  1JUM A;  2EJR A;  1F36 A;  4OMZ A;  4YEL A;  2BXZ A;  4P5O A;  2F4M B;  1K78 B;  1E2X A;  2FX0 A;  3FM3 A;  3CDL A;  1ETK A;  2M4G A;  4RBO A;  2W7N A;  1LJ9 A;  1TWH J;  2EFW A;  4M3B A;  2JMW A;  4EJT A;  3ISP A;  2G3B A;  1KQ9 A;  3EUK L;  1QRY A;  1IUF A;  2LDU A;  4A5N A;  1SVO A;  2FRH A;  4HLX A;  2DXI A;  4IRV A;  3OSG A;  2PJP A;  2DMU A;  1YFH A;  4OD5 A;  3I59 B;  5HDK A;  4YZE A;  4N4O B;  3FMR A;  5E18 F;  1SFO J;  3CCJ I;  2AO9 A;  2DU9 A;  1VQ7 I;  4DQ2 A;  4PJL A;  3W2W A;  4OAY A;  4ZDL A;  1YW9 A;  3QYF A;  4JK1 X;  5CPR B;  2VJI A;  2QBY A;  1IF1 A;  5ICE A;  1O3T A;  5BS6 A;  5IT9 K;  1ODD A;  3H35 A;  3QU6 A;  1O57 A;  3Q9V A;  4XLE A;  1VQ4 I;  4A93 J;  4II3 A;  2DG7 A;  1FSE A;  5GPA A;  4OIO F;  3FXO A;  1P4W A;  4IQ4 A;  4KYW A;  1LFB A;  1YX5 A;  3C3W A;  1ZLJ A;  2OCE A;  3ZN0 A;  4MFD A;  5LGU A;  3WTX C;  3K1P A;  1IV8 A;  1BIA A;  4EJW A;  1ERD A;  2XHK A;  3DBR B;  1VQ5 I;  2IS1 A;  5L3D A;  2XIG A;  5C3E J;  1QHG A;  2JVH A;  3HOY J;  4LJZ F;  2RNJ A;  3PNY A;  3T0Y A;  3GTK J;  1N25 A;  1FMV A;  4HQE A;  2NP5 A;  2QIB A;  2CGP A;  1I6X A;  4UHT A;  4G7H F;  2LP0 A;  2XB5 A;  4UUT A;  2Z1D A;  2OZ6 A;  3K6G A;  1MJA A;  1KGS A;  3D0S A;  3J81 Z;  1QVU A;  1T08 B;  2GLO A;  1WJE A;  3P9K A;  3VEP A;  4FE7 A;  2N8G A;  3HHH A;  4A0Z A;  5K7F A;  4HAM A;  3DBL B;  3LSI A;  2VKE A;  5F1J A;  5H9T A;  3KZI C;  4M71 A;  1FIA A;  2CH0 A;  2LY9 A;  3BC8 A;  3FMS A;  4MEX F;  2MG4 A;  1IDY A;  2XSJ C;  3VB2 A;  1T8I A;  2VQL A;  1PP8 F;  5H6R A;  3S15 J;  5EGO B;  1BA5 A;  1IRG A;  2K9Q A;  4NEL A;  5D8K B;  1T38 A;  2M2E A;  3AL0 C;  4NDL A;  4LK1 F;  3FXQ A;  4PJ0 C;  2EIM H;  2A07 F;  2WUI A;  5LEK A;  3JRH A;  5C4J J;  3KFW X;  1D5Y A;  5FGL A;  5CVU A;  1LEA A;  2MC4 A;  3OS1 A;  4HLY A;  3EYY A;  1FSH A;  4A3L J;  5CJ9 A;  3QPT A;  2NVY J;  1VND A;  1USS A;  1ZG3 A;  5H6Q A;  2E1N A;  3E6D A;  1F5T A;  2ZCM A;  1OYY A;  2LVS A;  2OF7 A;  1OMI A;  5CYV A;  4U0Y A;  3FHN A;  1IJW C;  3VWB A;  2PG4 A;  3M1E A;  2OTJ I;  4OIQ F;  4P96 A;  1KYZ A;  2KIQ A;  3F22 A;  3BG7 A;  1IC8 A;  1K6Y A;  3E7Q A;  4LLL A;  2MGQ A;  3K2A A;  5FLX Z;  1IAW A;  2B9S A;  1UHM A;  3CMA I;  3E5U A;  2A69 F;  2W84 A;  5BOX A;  1DP3 A;  3VVX A;  3VOX A;  3DCF A;  3H0G J;  2IP2 A;  3LL7 A;  4ON0 A;  1FLI A;  2AHQ A;  3KEY A;  5GAD J;  4KMF A;  3RDI A;  2Z16 A;  2GXB A;  4XK4 A;  2E71 A;  1BW6 A;  3J7A O;  4I02 A;  2G0E A;  2ISZ A;  1TTY A;  2GAU A;  3C1D A;  2PX9 A;  2V9P A;  2YX7 A;  3GCM A;  2QBY B;  3COL A;  1O4X A;  3OYJ A;  2VXZ A;  4BU2 A;  2L7F P;  3OYI A;  4L62 A;  5AQC A;  1VTN C;  3JCU C;  4RLQ A;  4B48 A;  5LHG A;  4FX0 A;  4XR6 A;  1K7A A;  2R7V A;  4JNN A;  3HOW J;  1Y0N A;  1A35 A;  2GUH A;  3DTE A;  3QPL A;  4UV9 A;  2QQ8 A;  3DV8 A;  3NXC A;  4JX4 A;  2RC4 A;  1BL0 A;  2HGC A;  4Y3O A;  2LD5 A;  2JRT A;  2QUF A;  4HA8 A;  2LLK A;  4UV8 A;  4CCL A;  3PM1 A;  5F64 A;  3HJE A;  3CMY A;  1ZTR A;  2BXY A;  2HTJ A;  5F08 A;  3KP3 A;  3HPH A;  2O9L A;  5C44 J;  4NHJ A;  3O8G A;  4YIF A;  3IUV A;  2YVH A;  2L7Z A;  4XLH A;  1GT0 C;  3H9Q A;  4XLF A;  1XSD A;  5LHH A;  1E0E A;  1IRX A;  5BPD A;  3GTO J;  3CCE I;  1P6R A;  4C2M J;  3H36 A;  4ANJ A;  4G94 A;  2E2H J;  3BQY A;  2RHA A;  1LDD A;  2XGD A;  2O5R A;  3WTU C;  1I50 J;  2WB1 N;  2QOP A;  3K1M A;  2K5C A;  2MLG A;  2XAJ A;  2R7F A;  2PMZ A;  1JJ8 C;  3CWR A;  1FBU A;  1P9Q C;  1U9N A;  2L4M A;  3AG2 H;  4MQ9 F;  2YX4 A;  4AYB A;  2NOJ B;  5HOD A;  4IHV A;  4C3I J;  3SZG A;  3BTJ A;  3A03 A;  3LA2 A;  4MHG A;  1QGP A;  1A6Q A;  1I27 A;  1TNS A;  5C4Y A;  2VJJ A;  3BCA A;  3RZO J;  4C9Y A;  3JRA A;  1QPM A;  4RAG A;  5AON A;  1GUU A;  5GTH C;  1ZRE A;  4MTE A;  1MMD A;  1APL C;  1UG2 A;  1UB9 A;  3HBL A;  5H20 A;  3T1B A;  1B4A A;  1T95 A;  3HRS A;  4S0H B;  2R7U A;  5LFA A;  3HOT A;  2H27 A;  2CQ7 A;  1WWX A;  2ZSH B;  4IL6 C;  1SD7 A;  2KQR A;  2D6Y A;  4OMY A;  1P2F A;  4UB8 C;  5IT9 Z;  1RC9 A;  2E5N A;  5GAE J;  3CC2 I;  4KNY A;  5DEQ A;  3K4C A;  2E7X A;  5GP9 A;  2KDZ A;  3JAM Z;  1TNT A;  3RPU D;  5E8I A;  1T98 A;  4IPA A;  5J1U A;  1ONV A;  2A3S A;  3JRF A;  2LBF A;  2F5F A;  2K3F A;  3OL3 A;  3J80 Z;  2PFB A;  4LFU A;  5IT3 A;  5IPA A;  3E3V A;  3BTL A;  1VQ6 I;  4Y17 A;  2ZJ2 A;  4L9J A;  1HQC A;  3NNR A;  2FNA A;  3ZMU A;  2UXP A;  5D5X B;  4KIB A;  4GYI A;  4DJA A;  3COA C;  3BTI A;  5IYD J;  2WC2 A;  5KVR A;  3HRU A;  1IRF A;  5E20 A;  4JX5 A;  1LDJ A;  2QQB A;  4XOR A;  4YEJ A;  5KCM A;  1IGN A;  4IVN A;  4DZJ A;  3BZ6 A;  4RGX A;  1R9T J;  3I58 A;  4CYC A;  4XNF A;  3EDP A;  5F1R A;  4AID A;  4BGD A;  3G56 A;  1MSE C;  3LFK A;  4JQF A;  3S2D J;  2EB7 A;  1GLN A;  2CW8 A;  2HDC A;  2ELH A;  1WRJ A;  4C3H J;  2WWY A;  1WSU A;  1IUY A;  1IXS B;  2EA4 A;  3TW7 A;  3OS0 A;  3O8H A;  1YE9 A;  3S5R A;  3WTS C;  3LSR A;  1H9G A;  3ZMD A;  3HGG A;  6PAX A;  1MMN A;  2Y30 A;  1IZ1 A;  4D7M A;  3DWL E;  1ZRF A;  2V6E A;  2MFZ A;  2MLK A;  3IHU A;  1U78 A;  1JI8 A;  4UUV A;  2IA1 A;  2KP6 A;  2V4J C;  1ZR4 A;  1MGT A;  5LGN A;  2CFX A;  3CF2 A;  3E97 A;  3S2H J;  4N4N B;  2FBI A;  2CUE A;  2PZ9 A;  2EFO A;  3ZQ7 A;  1LUJ B;  4IZZ A;  4A3M J;  1YG2 A;  3K4B A;  2HQN A;  2L2O A;  4EAT A;  2UV1 A;  3K4K A;  2KT0 A;  4MTD A;  2A5Y B;  5EEA A;  4ZYE A;  2ICW G;  2W48 A;  2HNH A;  3QWL A;  1I3A A;  2XC7 A;  4QPO A;  1ZRC A;  3S3N A;  3RQ4 A;  3JSJ A;  3JTH A;  3F8B A;  5TJJ A;  1YRN A;  3S32 A;  3IH2 A;  2UUZ A;  3KP2 A;  4NUB A;  2E5Z A;  1HC8 A;  3LSM A;  2NAZ A;  2EBI A;  4YIR X;  2RNG A;  4X6A J;  2X1E A;  5IP9 J;  4DZP A;  4WK8 F;  4ZTF A;  3IUO A;  2M3A A;  4RLF A;  1Y0U A;  3HB9 A;  2HS5 A;  1ZH5 A;  4IJA A;  4KDP A;  1Z3Y A;  5HS9 A;  3P9I A;  1Z1D A;  2VKH A;  5EF6 A;  2KRH A;  1TWF J;  4M9S A;  9ANT A;  5ILV A;  1WJA A;  3PIO F;  1J9I A;  1FYK A;  2L3D A;  3IWF A;  3KEQ A;  1FEX A;  5HS7 A;  4Z2Y A;  4B4C A;  3BTC A;  1Y1W J;  3HOX J;  3HKZ A;  5KAF C;  2EIK H;  2F6C A;  2VPL A;  2WAQ N;  2XRN A;  2LBF B;  4Q5S F;  5L3G A;  1SMY F;  1ZGJ A;  4YG2 F;  2D2W A;  1PDN C;  4M6V A;  2DO7 A;  3REO A;  3LNQ A;  1FC3 A;  3ELK A;  1S6L A;  2LFB A;  3TDU C;  1W36 C;  1XSV A;  3DXJ F;  2CWE A;  4BJ5 C;  5IP6 A;  5FHP A;  1STZ A;  1J09 A;  1OQY A;  3FHZ A;  3PPB A;  2DDB A;  3HM5 A;  4AF5 A;  1XN7 A;  4CXF A;  4PFO A;  1L3L A;  3G1O A;  4B3A A;  4KIS A;  4PJJ A;  1OYI A;  3HPG A;  2NS0 A;  4M9X A;  4Q4Z F;  3MVP A;  1SAN A;  1WPK A;  5CKT A;  3CO7 C;  3GTJ J;  1YIT I;  4CYC B;  3OV8 A;  3JRG A;  2LF8 A;  2HKU A;  3CME I;  1LPQ A;  3WTT C;  2P6S A;  1R5I D;  5EEH A;  1W0U A;  3GTQ J;  2D5V A;  1KQ0 A;  1HW1 A;  2Y75 A;  4IX7 A;  3TBI A;  3R4K A;  3KZY A;  4MQV A;  3I71 A;  4IO9 F;  5H2F C;  4RAZ A;  2UXI A;  1IN7 A;  1G2H A;  2VBX A;  2HQA A;  3AG4 H;  3CJN A;  2QEN A;  3KET A;  4A3J J;  2R5Y A;  3MWM A;  2DN0 A;  1HA8 A;  4DBQ A;  1UI6 A;  4WXD A;  4WCG A;  3C18 A;  1MND A;  2ZOZ A;  3WHC A;  3OYD A;  3SDG A;  1F43 A;  1VQ8 I;  2R7R A;  4HDV A;  5FLM J;  2JWT A;  3KIO A;  1MKM A;  1RPW A;  4EJV A;  4RB2 C;  3KCC A;  2XAQ A;  3LOC A;  3OSF A;  1H88 C;  1ZR2 A;  3QU3 A;  5JLX A;  2G7L A;  3P9T A;  2JRM A;  3AAF A;  2B1E A;  2XVC A;  1VI0 A;  3ZR8 X;  2PMU A;  3DP7 A;  5TIS C;  4DNC A;  1A31 A;  3LJL A;  1DPR A;  1YRN B;  2O61 A;  4LB6 B;  3OYM A;  1RET A;  2QSH X;  2CUJ A;  4CCJ A;  2M1B A;  3FKI J;  1QVT A;  3GO5 A;  1WJB A;  2F4I A;  4GXO A;  3U1D A;  2LKP A;  3ABU A;  3LAP A;  1Z91 A;  5C4X J;  4ZDO A;  4BDY A;  3OYC A;  3GFJ A;  4LOC A;  3LSH A;  1VFC A;  2HXO A;  3EQL F;  1O7L A;  2Q1Z B;  5DCM A;  3NAU A;  3U21 A;  4ZH4 F;  3ZQH A;  1KU3 A;  2CG4 A;  1LB2 A;  3CDI A;  3L2W A;  4ENK A;  2W85 A;  4NC7 A;  1BIB A;  4TV7 A;  3K4J A;  4G7Z F;  2YVE A;  4S04 A;  2Z5U A;  4A3D J;  3AKZ A;  3S3M A;  2VUM J;  3M9A A;  1B59 A;  3OY9 A;  2P5L C;  2QWW A;  1NG7 A;  3MCZ A;  4IQJ A;  2EQR A;  2RVC A;  3I55 I;  4QTR A;  3OOU A;  2HKO A;  1V5G A;  3HHG A;  3J7A Y;  1JGG A;  1R49 A;  3A02 A;  1Z7U A;  3CC7 I;  2HOE A;  2XF7 A;  2P5V A;  3DPT A;  3CRJ A;  3F8C A;  1WH5 A;  1KQ8 A;  3BR2 A;  4KT5 C;  3GME A;  1YX3 A;  3FXM A;  3HIF A;  3ROU A;  5E17 F;  1JGS A;  1S5L C;  1NTC A;  4IHW A;  3WGG A;  1QNT A;  4AWX B;  1MDM A;  2NVU B;  2NVQ J;  3I56 I;  1SC7 A;  4A5M A;  3H3U A;  2H09 A;  2XB0 X;  1HKT A;  3KKC A;  1UG0 A;  3L2Q A;  3BG9 A;  3H3Z A;  2G7H A;  2VQH A;  2RKH A;  3AG1 H;  1IW7 F;  4C2M A;  2M4K A;  3CUQ C;  5M3M J;  4O3M A;  3BT9 A;  4BHP A;  1W0T A;  1JE8 A;  2OJE D;  2DBB A;  3L9F A;  1CQT A;  3FIS A;  1ULY A;  2ZC2 A;  3NPI A;  2VT3 A;  2R5Y B;  1X1D A;  2WTE A;  3QBM A;  2VIX A;  3P7N A;  4A0X A;  3BR0 A;  1CGP A;  2LRD A;  2V79 A;  2MH2 A;  2E2I J;  4GCV A;  3GEU A;  2E36 A;  4RGR A;  3E6C C;  1JTY A;  3GZ6 A;  1FOX A;  3CUQ A;  2X1D A;  1P92 A;  2HQ5 A;  2M30 A;  1XGN A;  4CCN A;  4DGW B;  1UJ8 A;  3M4O J;  4XLP F;  1RNL A;  2LY2 A;  4PSX A;  5HNH A;  4ME9 A;  2Y69 H;  1D1A A;  3K7A J;  5ILS A;  1R4M B;  2W57 A;  3FBN B;  2QGU A;  2ZCN A;  3ERM A;  4M9Z A;  3SWH A;  4XKB A;  1HOM A;  3GLX A;  3WTW C;  4HX7 A;  2CQX A;  2GZW A;  5D5W B;  3D1N I;  3ERE D;  2L5Q A;  2ZXI A;  4Q47 A;  2ZSI B;  5DYM A;  1I6H J;  2DA7 A;  3BJ6 A;  5DCM B;  4BUP A;  3VVY A;  3F1B A;  3FMQ A;  2OD5 A;  3HC7 A;  2VJ4 A;  4LLN A;  3DPU A;  3V8J A;  5DTD A;  4YRV A;  4IHX A;  3CLQ A;  4HZF A;  2Q2E A;  5AIP A;  1AU7 A;  3TP0 A;  2DI3 A;  1U2W A;  2NXN B;  5EDN A;  1DDN A;  1W5T A;  4R79 A;  4EV0 A;  5DS9 A;  2VOO A;  2COM A;  3S3O A;  1BR4 A;  1FTZ A;  3W2V A;  1CF7 A;  5E3L A;  1TWA J;  4IKF A;  4RGS A;  4GDF A;  5FFX A;  2DK8 A;  4BY1 J;  1ETY A;  2B0L A;  4NQW A;  5HDN A;  3CCL I;  1YI2 I;  3IAS 2;  1AWC A;  2QA4 I;  1V5E A;  2JPB A;  4U9N A;  3K1N A;  1A6I A;  3V4G A;  3VOE A;  1WI3 A;  3HRT A;  2FBH A;  2F5D A;  3I53 A;  2X48 A;  3U1K A;  2DA2 A;  2KIM A;  4BAC A;  2R7T A;  4QPQ A;  3G7R A;  2IXS A;  3BCB A;  1EH6 A;  1X2N A;  5M5X J;  2VE8 A;  1OCR H;  2BYV E;  1MDM B;  1K61 A;  4ITV A;  2V26 A;  1T0F C;  2O3F A;  3DEW A;  1GHC A;  3PSF A;  1R5H A;  2REK A;  4F7Z A;  3MZY A;  3DF8 A;  2M0C A;  4LG3 A;  3H5A A;  4NBQ A;  5CW8 A;  3N05 A;  3P9C A;  4EM1 A;  2VAS A;  2UZK A;  2GM4 A;  1ZGA A;  3ABT A;  2ZJQ F;  2Q24 A;  3GFI A;  1XPX A;  5BNG A;  2IGM A;  3KP7 A;  4BJ6 C;  5DUI A;  4ZYH A;  1JKR C;  3OYH A;  1I39 A;  1T0F A;  3DEE A;  1ZRD A;  2LF7 A;  2K9M A;  2EA2 A;  2H1L A;  4A69 C;  2W82 A;  1ZN2 A;  3GUD A;  4KT6 A;  3D5L A;  3M8E A;  4LK0 F;  4LMY A;  4KIG A;  3CUQ B;  2R7O A;  4S05 A;  3OYF A;  2Y2Z A;  5B3S H;  1FTT A;  3CC4 I;  2V9K A;  2EPF A;  3KP4 A;  3KLN A;  2HPM A;  4D5F A;  3CP8 A;  1XCB A;  3CLO A;  4CZC A;  2DTZ A;  1X1B A;  3LQQ A;  3VVZ A;  2VPR A;  1R00 A;  1G59 A;  1KYW A;  3PL8 A;  1QA6 A;  2MA3 A;  1IRZ A;  2E7W A;  3U2R A;  4HQM A;  4OIP F;  2QVO A;  2KDO A;  1KU7 A;  2HR3 A;  5J4Y A;  2GOM A;  3E5X A;  3RQI A;  1P4A A;  2X6X A;  2XKO A;  2DA1 A;  1BI0 A;  2K40 A;  3QYB A;  1JKO C;  3IKT A;  1LFP A;  2IBD A;  4XQF A;  3G1L A;  3FK6 A;  2LH9 A;  3OIO A;  2XPW A;  4JKZ A;  2QM3 A;  4LIV A;  3F72 A;  1XD7 A;  4PGG A;  3HOU J;  2JN6 A;  2Q2E B;  4HF0 A;  4XON A;  1BR1 A;  2WY7 Q;  2MW8 A;  3LWJ A;  3GVA A;  4U0V A;  3JR9 A;  3I9V 2;  5HLH A;  5JHF A;  3ASO H;  4U87 A;  5FRO A;  4P9U A;  2A6H F;  2L9R A;  1HXD A;  1TQI A;  3L2C A;  4L5I A;  3B6A A;  1C0W A;  3PQJ A;  4EQQ A;  4FAS D;  3S1M J;  2R4G A;  2C6Y A;  4A2U A;  4NQW B;  2FNP A;  2M45 A;  4RMN A;  3LFU A;  5JI6 A;  3KEO A;  4F93 B;  3M7G A;  3WTZ A;  2VB6 A;  5D4R A;  4HSR A;  1J7K A;  3LWF A;  4J00 A;  4J01 A;  1HST A;  1GV2 A;  2X9D A;  3B6C A;  1S7E A;  2LSO A;  3EUH C;  3DBH B;  2RAE A;  3IC7 A;  1Y39 A;  2VOP A;  1R5G A;  4UB6 C;  2K9L A;  5ICG A;  3CCS I;  2NNY A;  3RSN A;  4HV6 A;  1BJA A;  3O2P E;  3KZZ A;  5B66 C;  3BP8 A;  1T6S A;  4EJU A;  1GV5 A;  1R1T A;  2DTR A;  4EVI A;  5KK1 A;  2V1U A;  4BBR J;  4UVC A;  2DQL A;  4BL0 B;  4HNV A;  1YO5 C;  1IN8 A;  2R93 J;  3JRB A;  4CDG A;  2D1V A;  5DM7 F;  1U8R A;  5GAG J;  3QRF F;  3EUH A;  2XGC A;  2ZOY A;  2DJN A;  4BQO A;  2L7K A;  3AG3 H;  3SJM A;  3ZCO A;  4AD9 A;  1W7P A;  2ESH A;  3ZMS A;  2OBP A;  4UY8 I;  3G6E I;  2UXO A;  3TED A;  3L7W A;  4PK4 A;  4AU7 A;  2DFI A;  4OOI A;  4B09 A;  1TQM A;  1ZQ3 P;  3E6M A;  4FCY A;  2HOT A;  3OS2 A;  1S9H A;  2ZCW A;  3SFZ A;  2KL4 A;  1ENH A;  1G4D A;  1GDT A;  2M9H A;  4UXN A;  4AIH A;  3KYD B;  4OD4 A;  4CHU A;  2IJL A;  1P7I A;  4AVP A;  2WA0 A;  4M6X A;  1BI1 A;  1TLH B;  3F6O A;  3RPQ A;  1S72 I;  2EK5 A;  4I09 A;  1HSJ A;  3EYI A;  2WAF A;  5A2Q K;  3WU0 A;  4FT8 A;  5AIQ A;  2R5Z A;  3MKL A;  2QSG X;  1JUP A;  3I4M J;  1RR7 A;  4D1Q A;  1YYV A;  4XRF A;  4NC6 A;  3L00 A;  3QQA A;  2K86 A;  3RKY A;  2A68 F;  2V7F A;  3S1N J;  1RI7 A;  1MMA A;  2CW0 F;  1G3T A;  4BHB A;  1RUO A;  1SFE A;  5J8C A;  4Y4R A;  2JUC A;  3F6V A;  3V6G A;  4CGZ A;  4WX9 A;  2JZY A;  1MBF A;  4RB3 C;  3MKY B;  1F4K A;  5EEG A;  4HX4 A;  5HLT A;  3RKW A;  1HDP A;  3QP5 A;  2UXN A;  2A6T A;  1X58 A; 
#chains in the Genus database with same CATH homology
 3VPR A;  3HOX J;  3HIM A;  2L7M P;  2CRG A;  3I4N J;  2WAQ N;  3BHQ A;  3RKQ A;  1BW5 A;  1FJL A;  2HOA A;  5CXI A;  4AC0 A;  2GFN A;  4M6V A;  3GTM J;  2MSY A;  2K9S A;  3LNQ A;  1AKH B;  2LFB A;  5FHP A;  1DU6 A;  5IP6 A;  3PPB A;  1OJL A;  3HM5 A;  4AF5 A;  1JJ6 C;  3G1O A;  4B3A A;  3JRD A;  3ZQC A;  2LTP A;  3S1R J;  4A3C J;  3MVP A;  5F0C A;  1OCT C;  1SAN A;  1WPK A;  1EF4 A;  3BRU A;  3JRC A;  2CJJ A;  2EZK A;  2E2J J;  1K83 J;  2WV1 A;  3GTJ J;  3BNI A;  4GCL A;  4CYC B;  4W97 A;  5J3L A;  3JRG A;  2HKU A;  3HGY A;  2B63 J;  1LFU P;  2ECC A;  3FK7 A;  2ME0 A;  1W0U A;  3GTQ J;  3ZQG A;  4XRM A;  2VKV A;  4QIW N;  1ZKG A;  3FIW A;  2D5V A;  2F07 A;  3BQZ A;  1U9O A;  1JTX A;  5FKN A;  1DU0 A;  1XC5 A;  2LK2 A;  1T56 A;  5E3N A;  1JUS A;  3LSP A;  2UXI A;  1WGX A;  2QKO A;  1G2H A;  3UKG A;  1A5J A;  2Y9Z A;  5JLW A;  4A3J J;  1UI5 A;  2R5Y A;  1RKT A;  2DN0 A;  3M3Y J;  2ID6 A;  1UI6 A;  1TWC J;  4UUS A;  3Q3S A;  3IH3 A;  1X2M A;  2ZOZ A;  3WHC A;  5M3F J;  3SDG A;  3JRE A;  1F43 A;  1HF0 A;  3EUP A;  2FD5 A;  5FLM J;  2JWT A;  2HDD A;  3BR3 A;  1RPW A;  1PUF A;  2QCO A;  4A3K J;  3LOC A;  4DYR A;  2XRL A;  3OSF A;  2R92 J;  1H88 C;  1ZR2 A;  5JLX A;  1WCM J;  3TW6 A;  3A01 A;  1ITY A;  2G7L A;  3P9T A;  3VUQ A;  2DMN A;  2X6O A;  5EGO A;  3ZQI A;  1VI0 A;  5M5W J;  3LJL A;  4JYK A;  2PMZ N;  3VW2 A;  2ME6 A;  2Y0S N;  1JKP C;  2NOG A;  4JP0 A;  4XRS G;  5J1R A;  1YRN B;  5D1R A;  3HOV J;  2NVT J;  1RET A;  1GVD A;  3FKI J;  1QVT A;  4AYB N;  2E19 A;  3RH2 A;  2ZB9 A;  1HLV A;  4MK6 A;  2R5Z B;  2EH3 A;  5C4X J;  2TCT A;  3VW0 A;  3S14 J;  4LOC A;  2JA8 J;  4XIC A;  3B81 A;  2XPV A;  2NS7 A;  4ABZ A;  2HXO A;  1VFC A;  2H1K A;  4GFK A;  3H3V K;  3NAU A;  2YUS A;  3BCG A;  3ZQL A;  4FTH A;  3ZQH A;  5M5Y J;  2DA5 A;  4RDU A;  2O8K A;  4A3G J;  4AC6 A;  1JUM A;  3Q0U A;  1F36 A;  5FMP A;  5F27 A;  4X1E A;  4V2F A;  5HBU A;  2FX0 A;  4RBO A;  3CDL A;  1ETK A;  2YVE A;  1TWH J;  4BKX A;  3VOK A;  3GZI A;  4M3B A;  2JMW A;  4A3D J;  2DMP A;  2VUM J;  2G3B A;  1QRY A;  1IUF A;  4M3G A;  4GFB A;  3S17 J;  2JA5 J;  2OPT A;  3OSG A;  2OI8 A;  2DMU A;  2QWT A;  2EQR A;  4QTR A;  3OOU A;  4DYQ A;  4YZE A;  3VP5 A;  1JGG A;  1SFO J;  3GTG J;  3A02 A;  2AO9 A;  1IDZ A;  5D19 A;  4CGR A;  2QF7 A;  3CRJ A;  1WH5 A;  3BR2 A;  2O7T A;  4JL3 A;  2HI3 A;  3AQT A;  3PAS A;  1OFC X;  5EG0 A;  2DG7 A;  4QSH A;  2DMQ A;  4A93 J;  5GPA A;  1LFB A;  1NTC A;  4MFD A;  2Y31 A;  4DW6 A;  1UHS A;  4IHW A;  3HOZ J;  4A3F J;  1IG7 A;  1NK3 P;  2NVQ J;  1IV6 A;  4MO7 A;  5C3E J;  1OCP A;  2XB0 X;  3Q0V A;  1MNM C;  3KKC A;  3BG9 A;  3HOY J;  1ETQ A;  3V78 A;  4GCT A;  3Q0W A;  2NX4 A;  3GTK J;  5FKK A;  1BJZ A;  2NP5 A;  1XS9 A;  2IU5 A;  4MFE A;  2QIB A;  1ZGW A;  5M3M J;  1RKW A;  2FBQ A;  3BT9 A;  1W0T A;  5FKL A;  2LP0 A;  3FIS A;  2XB5 A;  4UUT A;  1CQT A;  4G12 A;  3NPI A;  3KZ9 A;  3S16 J;  1QVU A;  2R5Y B;  3QBM A;  2GLO A;  5HSZ A;  4A3I J;  4UUS B;  3BR0 A;  1MSF C;  3HTA A;  4FE7 A;  2N8G A;  4D5C A;  4AUX A;  5K7F A;  4FIS A;  1JT6 A;  2VKE A;  5F1J A;  3IV5 A;  1HCR A;  2E2I J;  2V57 A;  2JA7 J;  5H9T A;  3GEU A;  1IGN A;  1FIA A;  1JTY A;  4FE4 A;  4MIM A;  1PUF B;  2HQ5 A;  2LY9 A;  2MG4 A;  5DAJ A;  1IDY A;  2G7G A;  3M4O J;  1SGM A;  5IYB J;  3A01 B;  2H8R A;  4XRS A;  3S15 J;  5EGO B;  1BA5 A;  2K9Q A;  1AHD P;  4NEL A;  3BR1 A;  4ME9 A;  3K7A J;  2M2E A;  2ZCN A;  4NDL A;  2QTQ A;  3EGQ A;  4IEJ A;  1HOM A;  2HYJ A;  1I3Q J;  2CQX A;  3D1N I;  2WUI A;  3JRH A;  5C4J J;  1D5Y A;  5FGL A;  3BR6 A;  2RAS A;  2HOS A;  4A3L J;  1UMQ A;  2NVY J;  5EZH A;  1VND A;  1I6H J;  3S1Q J;  2DA7 A;  2ZCM A;  2CUF A;  2LVS A;  2OF7 A;  1IJW C;  4DYC A;  3VVY A;  4D7N A;  3F1B A;  4HKU A;  2COB A;  2EZL A;  5FLV A;  4BY7 J;  5DTD A;  5EFY A;  2XDN A;  1IC8 A;  3E7Q A;  1U8B A;  3NAR A;  3QPS A;  2MGQ A;  3K2A A;  1ZK8 A;  1ETV A;  4I6Z A;  2K9N A;  4IHX A;  2YS9 A;  1Z77 A;  2ECB A;  3VIB A;  2UXU A;  1AU7 A;  3TP0 A;  5IOY A;  5EDN A;  3L1P A;  3VVX A;  2XSD C;  5DS9 A;  3VOX A;  3CJD A;  1ETW A;  1FTZ A;  3DCF A;  4L5E A;  3H0G J;  5F0F A;  5E3L A;  3PO2 J;  1TWA J;  2AHQ A;  3HTI A;  4I76 A;  4XK4 A;  4Y52 J;  4BY1 J;  1BW6 A;  1ETY A;  3HKZ N;  2DG8 A;  1MBH A;  1LE8 A;  2G0E A;  1HDD C;  3ZOB A;  5IOZ A;  3COL A;  1A6I A;  2IAI A;  1O4X A;  1WI3 A;  5EG0 B;  2R0Q C;  3ON4 A;  2TRT A;  2L7F P;  3ON2 A;  4L62 A;  5AQC A;  5K7Z A;  5E3M A;  1B8I A;  3HTJ A;  2X48 A;  2DA2 A;  4JNN A;  3LSG A;  3HOW J;  5FJ8 J;  2XPU A;  3G7R A;  4XID A;  4Y7N J;  2GUH A;  2DMT A;  1RES A;  1X2N A;  5M5X J;  3QPL A;  3NXC A;  5GPC A;  4JX4 A;  3RZD J;  1K61 A;  1BL0 A;  2LD5 A;  5F0H A;  2LLK A;  3PM1 A;  3CQZ J;  3ANP A;  3C2B A;  3CMY A;  1ZTR A;  3DEW A;  5F08 A;  2CQQ A;  2O9L A;  2REK A;  3RD3 A;  2UXH A;  2JA6 J;  5C44 J;  4BBS J;  2M0C A;  3O8G A;  5IYC J;  1JT0 A;  3IUV A;  2YVH A;  2L7Z A;  1GT0 C;  2EZH A;  5CW8 A;  4BXX J;  2GM4 A;  3GTO J;  4ACI A;  2Q24 A;  4C2M J;  5BNG A;  3KKD A;  2E2H J;  4KWA A;  3BQY A;  3W6V A;  2RHA A;  2XGD A;  2QOP A;  1I50 J;  2WB1 N;  4M3D A;  1JKR C;  1TC3 C;  5K58 A;  2NP3 A;  1JJ8 C;  4A69 C;  1Z0X A;  3CWR A;  1U9N A;  1MBK A;  1TWG J;  5HOD A;  4IHV A;  4C3I J;  1E3O C;  2P81 A;  1B72 A;  3BTJ A;  2Y2Z A;  3A03 A;  1H8A C;  2VI6 A;  3T6N A;  2WGB A;  2E1O A;  2ID3 A;  2JJ7 A;  1FTT A;  5C4Y A;  2LKX A;  3RZO J;  3NI7 A;  2ZCX A;  4D5F A;  3JRA A;  2DTZ A;  1GUU A;  3VVZ A;  2VPR A;  2GEN A;  1APL C;  4EEF G;  1IRZ A;  1UG2 A;  3HBL A;  3C07 A;  2LR8 A;  4S0H B;  4MXM A;  3VW1 A;  3MNL A;  2G7S A;  2W53 A;  3LSJ A;  2YU9 J;  2Y9Y A;  3RQI A;  1Y1V J;  3SFI A;  2DA1 A;  2D6Y A;  2K40 A;  4GFL A;  1JKO C;  2IBD A;  5EYR A;  3BR5 A;  3G1L A;  1Q1V A;  3PO3 J;  1T33 A;  3FK6 A;  5GP9 A;  3OIO A;  5F04 A;  2KDZ A;  2XPW A;  4JKZ A;  2GBY A;  1QPI A;  3FRQ A;  4MLO A;  5J1U A;  2R7Z J;  3HOU J;  3HTH A;  2JN6 A;  3JRF A;  3GTP J;  5HAW A;  2MW8 A;  4ICH A;  3LWJ A;  5IPA A;  3BTL A;  2OER A;  3JR9 A;  1AKH A;  2M34 A;  1MBE A;  4JX6 A;  1MH4 A;  2L9R A;  1ETX A;  3B6A A;  3NNR A;  3S1M J;  2UXP A;  1VF9 A;  3BG3 A;  3GBG A;  1LE8 B;  3ZQF A;  3GTL J;  3BTI A;  5IYD J;  2O7O A;  3F0C A;  4C3J J;  3ANG A;  2I10 A;  4JX5 A;  1GV2 A;  1S7E A;  2DA6 A;  2X9D A;  3B6C A;  4DZJ A;  1B8I B;  3WHB A;  2ELK A;  5J1Y A;  2RAE A;  1NK2 P;  1R9T J;  4UDS A;  4CYC A;  2M8G X;  4IHY A;  3HDD A;  3G56 A;  1MSE C;  3S2D J;  3G1M A;  4A3B J;  1WH7 A;  3QKX A;  4GCK A;  2FJ1 A;  4C3H J;  3AQS A;  1GV5 A;  3TW7 A;  3O8H A;  4V2G A;  3BG5 A;  3S5R A;  3LSR A;  4BBR J;  3HGG A;  3MN2 A;  2Y30 A;  4HNV A;  2DA3 A;  5K7H A;  2R93 J;  3JRB A;  3TP3 A;  4D7M A;  2NVX J;  1POG A;  1U78 A;  2XGC A;  4M3F A;  2ZOY A;  2DJN A;  3SJM A;  1ZR4 A;  3BJB A;  5D18 A;  3E7L A;  1MBJ A;  3O60 A;  2UXO A;  3S2H J;  2PZ9 A;  2CUE A;  3TED A;  2HOT A;  4A3M J;  1ZQ3 P;  3DPJ A;  4FCY A;  2HYT A;  1JKQ C;  2KT0 A;  5FKM A;  1ENH A;  1GDT A;  5EEA A;  2M9H A;  1MH3 A;  2W48 A;  5FKO A;  2HXI A;  2NS8 A;  3IH4 A;  1P7I A;  3HE0 A;  1H89 C;  1B72 B;  3JSJ A;  5IP7 J;  1YRN A;  1ORK A;  1P7J A;  3IH2 A;  4B1R A;  2L0K A;  2EBI A;  3LHQ A;  2DA4 A;  4X6A J;  4W1U A;  5E3O A;  5IP9 J;  3NRG A;  2R5Z A;  4DZP A;  3MKL A;  1XG1 A;  1JUP A;  3I4M J;  1RR7 A;  2EZI A;  1MBG A;  3CCY A;  3JRI A;  3HB9 A;  3QQA A;  3KNW A;  3S1N J;  1ETO A;  2FQ4 A;  3HEF A;  2JK3 A;  2XGE A;  4M3E A;  2PBX A;  4NN1 A;  3V6G A;  5EF6 A;  4A3E J;  2CU7 A;  9ANT A;  1TWF J;  2IEK A;  1MBF A;  1FEX A;  4PXI A;  5EZG A;  1HDP A;  3BTC A;  4B4C A;  5CXG A;  4J19 A;  1FIP A;  1Y1W J;  1X58 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...