4W1UA

Crystal structure of rv3557c/kstr2, a transcriptional repressor involved in cholesterol metabolism in mycobacterium tuberculosis
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
198
structure length
193
Chain Sequence
b'RVARRGELLELAAAMFAERGLRATTVRDIADGAGILSGSLYHHFASKEEMVDELLRGFLDWLFARYRDIVDSTANPLERLQGLFMASFEAIEHHHAQVVIYQDEAQRLASQPRFSYIEDRNKQQRKMWVDVLNQGIEEGYFRPDLDVDLVYRFIRDTTWVSVRWYRPGGPLTAQQVGQQYLAIVLGGITKEGV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional repressor KstR2
publication title Crystal structure of Rv3557c/KstR2, a transcriptional repressor involved in cholesterol metabolism in Mycobacterium tuberculosis.
rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
total genus 79
structure length 193
sequence length 198
ec nomenclature
pdb deposition date 2014-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17932 TetR_C_24 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4w1uA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 4w1uA02
1B72A 2ID6A 1X58A 2NVYJ 2E19A 2DMUA 3JRBA 1I50J 3S1NJ 2QKOA 3G1MA 2R5ZB 1TWFJ 3IH4A 2DG8A 5EYRA 3B81A 4JX6A 1MBKA 1F36A 3HE0A 2XGDA 3BR3A 5FKOA 2GM4A 4JL3A 1T33A 3JRHA 3S5RA 1ZR4A 1JKPC 2R93J 3JRGA 5C4XJ 1HOMA 4A3CJ 1H89C 2OF7A 1UG2A 2XRLA 4RBOA 2NVQJ 1H8AC 1MBFA 1TC3C 3PASA 2UXOA 3BR2A 1POGA 1O4XA 1JKRC 1DU0A 1NK3P 4A3KJ 2Q24A 4CGRA 4ICHA 3LSGA 4QTRA 3BT9A 3S1QJ 3S2DJ 3VIBA 2TCTA 1VF9A 2KT0A 2DA4A 3TW7A 2COBA 5CW8A 4LOCA 2HXOA 3HTJA 2IEKA 1BW6A 1IG7A 2WGBA 2DA2A 4M3DA 4IHWA 1BA5A 2V57A 5FKLA 3Q0VA 3UKGA 3O8HA 1ITYA 1A5JA 5K7ZA 4M3GA 2DA6A 3QPLA 5M5YJ 1S7EA 3G1OA 1GDTA 4GFBA 2Y31A 4HKUA 3L1PA 2O9LA 1H88C 1NTCA 2EH3A 3RKQA 3GTOJ 2ZCNA 2HOAA 2QCOA 5M3MJ 3MVPA 3JRDA 1HLVA 3GZIA 3AQSA 2ZCMA 2HXIA 3FK7A 4FCYA 5FJ8J 4NN1A 2M2EA 2HI3A 1FIPA 3IH3A 4FE4A 3BG5A 5IOYA 2JA6J 4BXXJ 2UXPA 5J1RA 2QWTA 1ETWA 2R5ZA 1B72B 1MH3A 4M6VA 5J1UA 1WPKA 3M3YJ 1HCRA 5K7HA 4DYQA 4NELA 2DMTA 3DPJA 2CU7A 2E1OA 3HB9A 2NVXJ 2EZKA 2K9QA 2EBIA 2ECCA 3HTAA 2UXHA 1W0TA 1U9OA 1IGNA 4MO7A 4V2GA 3AQTA 3V6GA 3OOUA 1MH4A 3LOCA 2XB5A 5HAWA 1EF4A 2IU5A 2F07A 3S15J 2G7LA 4XRMA 4MFDA 1WH5A 2MSYA 2Y0SN 1Y1WJ 1X2NA 2WUIA 4MK6A 5D18A 2ELKA 2NX4A 2LFBA 3GTKJ 3GTPJ 3CWRA 1RESA 3EGQA 4C3IJ 3KZ9A 2ECBA 4Y7NJ 2DN0A 2RHAA 4A3FJ 3HOZJ 4A3DJ 3QPSA 1SFOJ 1JT6A 1QRYA 4V2FA 4BY1J 3I4NJ 2XSDC 2R7ZJ 3NPIA 5IYDJ 4A69C 3EUPA 3E7QA 4I76A 3QQAA 4W1UA 1ETXA 2NOGA 3VOKA 1P7JA 2JN6A 2IAIA 2LVSA 4QSHA 2DMNA 3I4MJ 3HOVJ 1LE8A 2WAQN 1NK2P 2G7GA 4ME9A 1ZTRA 2MGQA 4DZJA 5EZHA 5FKMA 4AC0A 3CMYA 2CQQA 5E3MA 1HF0A 3GEUA 1JKOC 2E2IJ 3Q0WA 3S17J 2M8GX 3KNWA 2K9SA 3B6CA 2H1KA 2GLOA 3K2AA 2DA3A 1DU6A 3NI7A 3LJLA 1ZKGA 1K83J 2L7ZA 3MN2A 3ZQIA 3VW0A 2XPWA 1X2MA 1WCMJ 5EF6A 2JA8J 5K7FA 2HYJA 3VVYA 5FLMJ 4GFKA 3IH2A 4CYCB 4GCTA 3VUQA 5EDNA 2E2HJ 1JTYA 3NARA 5GPCA 1BJZA 3CCYA 3CRJA 3S14J 3LNQA 2JWTA 3SJMA 4XICA 1JGGA 4L5EA 3ZQFA 1AU7A 1JUSA 5F0CA 1JKQC 3PO2J 2AHQA 4A3LJ 3NNRA 3BQYA 4HNVA 1IV6A 3FKIJ 2FJ1A 4J19A 2ZCXA 5GPAA 2K40A 1GVDA 2OERA 2QOPA 3HOYJ 3BR0A 1FJLA 1OCPA 1Q1VA 4A3IJ 2VI6A 1GV2A 4A3MJ 4M3BA 1T56A 4GCKA 1IDZA 2NP5A 3RD3A 1Y1VJ 4BBRJ 2VKEA 3ZQHA 5IOZA 3C07A 3KKCA 2M34A 2ME6A 3COLA 4A3JJ 3FRQA 1FEXA 3FK6A 2Y2ZA 3RZDJ 3KKDA 3BG3A 2K9NA 5E3OA 1ENHA 5CXIA 3MNLA 2XGCA 2HKUA 3ANGA 3BRUA 1AKHA 2CRGA 2O8KA 5IP9J 2XGEA 2QIBA 2R92J 3E7LA 4JX4A 4W97A 4YZEA 3VW1A 3H0GJ 3HOXJ 5C3EJ 5JLXA 3BQZA 3JSJA 2LTPA 2YU9J 1LE8B 5M5XJ 4JYKA 4L62A 3QBMA 2LP0A 1TWAJ 1OFCX 3WHCA 4B3AA 1B8IB 3MKLA 2CJJA 2O7OA 2RAEA 3LSPA 2L7FP 4NDLA 1OJLA 2MW8A 2YUSA 1FTZA 2JK3A 1UMQA 3RZOJ 3VPRA 4UUTA 4CYCA 4DYCA 4BBSJ 3A02A 3WHBA 4B4CA 4XIDA 2XB0X 1QPIA 2VPRA 3O60A 4KWAA 3BHQA 3JRAA 3HTHA 4JKZA 1ETQA 1HDDC 2YVHA 2X9DA 2XDNA 2ZB9A 4M3FA 3SFIA 3NXCA 3F0CA 3BNIA 4GCLA 2WB1N 3A01B 1RR7A 3Q3SA 5AQCA 2L7MP 1PUFB 1WGXA 3BTCA 1VNDA 1MBGA 3P9TA 5F08A 4C3HJ 5FLVA 3ZOBA 2EZIA 3SDGA 3LHQA 1LFBA 1HDPA 2TRTA 5HBUA 3BR6A 2R5YA 3FISA 2GUHA 3RH2A 3PPBA 3GTJJ 2ME0A 1RKWA 2XPVA 3JRCA 5E3LA 5E3NA 3V78A 5C44J 1UI5A 2OI8A 2OPTA 1WH7A 5J3LA 2NVTJ 1ZQ3P 4A3BJ 1JUMA 4D7NA 1XC5A 1OCTC 1SANA 3OSGA 1D5YA 2KDZA 4ACIA 1Z0XA 3GTMJ 3HBLA 2LR8A 4FE7A 2PZ9A 2HQ5A 2W53A 1UI6A 1QVUA 4FISA 2RASA 4G12A 4C2MJ 3HIMA 1UHSA 1AKHB 1ETOA 1ZGWA 1JTXA 2JA7J 5F0HA 2CUFA 1ZK8A 4B1RA 5F0FA 2REKA 1IJWC 1FTTA 3BTIA 1K61A 4Y52J 4JX5A 4D7MA 4IHYA 2DA5A 2PBXA 2YS9A 3GBGA 1B8IA 4XRSG 2I10A 2Y9YA 1GUUA 2N8GA 1JT0A 3PM1A 1ORKA 1MBJA 4JNNA 4JP0A 4XK4A 1IUFA 4XRSA 4C3JJ 5IYBJ 1R9TJ 5K58A 5DS9A 1JUPA 3IV5A 4MLOA 9ANTA 3BTJA 5IPAA 4M3EA 2M0CA 5IP7J 3CJDA 2M9HA 3LSRA 2Y9ZA 3NRGA 5M5WJ 2EZLA 3G56A 3A01A 2GFNA 2H8RA 1W0UA 1PUFA 5JLWA 3TEDA 4MIMA 1XS9A 3BR5A 4ABZA 2LD5A 1VI0A 1WI3A 2CQXA 3BCGA 1P7IA 4X1EA 2W48A 1U9NA 4IHXA 4BY7J 1TWCJ 4A3EJ 1F43A 3QKXA 3TW6A 2R5YB 5F27A 3HKZN 2VKVA 1RPWA 2LK2A 5F04A 1U8BA 3VVXA 3CQZJ 1APLC 4MFEA 3VW2A 2L0KA 1VFCA 2HOSA 1BW5A 3HDDA 5J1YA 2G7SA 3VP5A 4IEJA 3OIOA 5D19A 3A03A 4UUSB 2DMPA 5M3FJ 5D1RA 3S2HJ 3W6VA 4QIWN 5EG0B 1LFUP 3C2BA 3G1LA 2B63J 2JMWA 1ZR2A 3Q0UA 4IHVA 2UXIA 1A6IA 4S0HB 2R0QC 1I6HJ 2DJNA 1SGMA 2MG4A 3O8GA 1XG1A 3ZQLA 1YRNB 1Z77A 5FKNA 4FTHA 2D6YA 5FKKA 1GV5A 2JJ7A 3JR9A 5FHPA 2NS8A 1AHDP 1IC8A 3DEWA 3HGGA 3GTGJ 3ON4A 1RETA 2FX0A 3CDLA 4BKXA 3S1RJ 2G0EA 1MSFC 2P81A 3GTQJ 2ID3A 2DG7A 2AO9A 2LY9A 3TP0A 5DTDA 3BJBA 4PXIA 5EFYA 4AUXA 2HYTA 4X6AJ 3VOXA 5GP9A 3ON2A 1U78A 5H9TA 4AC6A 3JRFA 5EGOB 3K7AJ 1MSEC 3S1MJ 5DAJA 2FQ4A 5IYCJ 4I6ZA 2GENA 2QF7A 3IUVA 4UDSA 2DA7A 3T6NA 1MBEA 2HOTA 3FIWA 1JJ8C 1QVTA 2EZHA 4RDUA 1E3OC 2L9RA 1IRZA 3DCFA 2CUEA 4GFLA 2E2JJ 3JRIA 1BL0A 2VUMJ 1RKTA 2FBQA 5HODA 2ZOZA 3HTIA 2X48A 4UUSA 5FGLA 1TWHJ 3BG9A 5FMPA 5IP6A 2JA5J 1G2HA 3ZQGA 2NP3A 3D1NI 2EQRA 5EG0A 2ZOYA 3HOWJ 4DZPA 2WV1A 4A93J 5CXGA 3GTLJ 1FIAA 2LKXA 5HSZA 3PO3J 1IDYA 3RQIA 5C4YA 3BTLA 3HEFA 5C4JJ 3HM5A 2DTZA 1ETVA 1TWGJ 3S16J 2X6OA 2YVEA 1MNMC 4AF5A 3TP3A 1ETYA 5EEAA 1YRNA 3ZQCA 2D5VA 2UXUA 5EZGA 2IBDA 2G3BA 4EEFG 2LLKA 3M4OJ 3ANPA 4AYBN 1MBHA 2FD5A 3B6AA 3G7RA 3BR1A 4DW6A 3HOUJ 4MXMA 2DMQA 1JJ6C 2XPUA 1CQTA 4A3GJ 4D5CA 1GT0C 2QTQA 3F1BA 3VVZA 3H3VK 3OSFA 2HDDA 2PMZN 5F1JA 2Y30A 1ETKA 1I3QJ 2NS7A 3NAUA 2GBYA 5EGOA 2O7TA 3LWJA 3JREA 4DYRA 3LSJA 2DA1A 3HGYA 5BNGA 4D5FA
chains in the Genus database with same CATH superfamily
2DQLA 3CUQC 2CV0A 1N25A 2ID6A 4EVIA 1J75A 3ONQA 3MFKA 2XKPA 3GFJA 2QBYB 1VQLI 3JRBA 2GAUA 3DV8A 3I58A 3G1MA 3FBIB 4KISA 5EYRA 4JX6A 2LF7A 4U0YA 5ERIA 3BR3A 2R93J 1A35A 4A3CJ 2NVQJ 4BE2A 3DPUA 3BPXA 3F8FA 4HYEA 3WU0A 1YW7A 4EQQA 1MBFA 1IRGA 1TC3C 4KA4A 3SEQA 2DTRA 2UXOA 1O4XA 2CUJA 4NUBA 1R6RA 5LRRA 4LLLA 4EM2A 3G3ZA 1J2XA 2Q24A 3LSGA 3BT9A 3K1NA 2OCEA 2QSGX 1TW2A 3ZMVA 4QPOA 1SC7A 2CGPA 3VIBA 2KL4A 3E97A 2VBXA 4RM3A 4MGRA 2IS6A 2YX7A 3DWLE 4L18B 4XONA 3KYLA 1XSXA 1KA8A 1N77A 1QHGA 3CLQA 5DEQA 1BW6A 5BOXA 2W84A 1Z6TA 4IRGA 2W57A 1R5HA 2LG4A 3HRMA 3JW4A 2BEOA 3PFIA 3MD2A 1E17A 2HYFA 3HYIA 2DA6A 3LQRA 5DM7F 5M5YJ 3G1OA 1UCRA 5L3CA 4XLEA 4HKUA 4BU2A 5H6QA 5J4YA 1F5TA 1QA6A 2ZCNA 2E71A 3RPUA 3GZIA 3CCLI 4ESJA 2HXIA 3PIOF 2VODA 3HIFA 2M30A 3BZKA 3VODA 2M2EA 4LFUA 4LK1F 2A3SA 2XAGA 4X0GA 2UXPA 1H0MA 4AM3A 5J1RA 3BP8A 3JSOA 2R5ZA 2R7TA 1J0RA 1XX5A 5J1UA 3A4CA 1HCRA 3DF8A 1WJAA 2RV8A 4E7IA 2DMTA 5IT9Z 3K9TA 4XM3A 1MJBA 1OR7C 1YO5C 1PP7U 3FM5A 1FOXA 4BXUA 1B6AA 1U9OA 4OOIA 4V2GA 4HV6A 3OOUA 3LOCA 2IU5A 1FBQA 2F07A 1X1AA 5J8CA 5KAIC 2Y0SN 2HZDA 2WUIA 3IKTA 5L3BA 4WWCA 5D18A 3DP7A 3GTKJ 3MMYB 1ONVA 3AG2H 2Z1DA 2ECBA 2EINH 3EETA 3PNYA 1U5TB 4A3FJ 3HOZJ 3E5UA 2M8EA 4ZTFA 3GMEA 3GEZA 2XUBA 2HTSA 1JT6A 3ZN0A 3I4NJ 4L5IA 3B02A 1GVJA 3O3KA 3LQQA 3OR1C 4I0AA 3H5AA 3HG9A 2H27A 2HKOA 4HX4A 4I76A 4E4HA 1SAXA 3VOKA 2DAOA 3J80Z 2JN6A 1YI2I 3KYCB 2IAIA 3VYUB 1YLFA 3VYRB 3ZCOA 3I4MJ 4XLFA 2WAQN 2VPLA 2G7GA 1KU3A 4ME9A 3VDXA 5FKMA 2RC4A 3CMYA 1SFEA 5E3MA 3GEUA 3MKZA 4II3A 1JKOC 2H94A 2DPDA 3EUAA 2K9SA 3F3XA 1HA8A 4JBAA 3WGGA 4GGGA 2JUGA 2F5FA 5K5OA 3OYIA 3F6VA 3NWTA 5EF6A 2E5ZA 3D5SC 4M71A 4G94A 2ZSHB 3PSFA 2E2HJ 2P5VA 5GPCA 3LWFA 3CRJA 1I39A 4RA2A 3S14J 2JWTA 3SJMA 3H1CA 2DYRH 1OYYA 3H5NA 2ZC2A 3PO2J 4WXHA 3H5RA 5E1WA 3BQYA 4U7DA 1R49A 2K9MA 1IV6A 3FKIJ 2FXAA 4J19A 4PK4A 2ZCXA 4O5VA 3E1SA 1GVDA 1U5TC 1O3SA 3H3ZA 3OOPA 4G9YA 1MMSA 1OCPA 4A3IJ 1T56A 2LKPA 4U88A 1MNDA 2KP6A 3AKZA 2DK5A 2Z2SB 2NP5A 2R4GA 4XNFA 4OD4A 2OU2A 1EH7A 3ZQHA 1LVAA 2R7SA 4UVCA 2F5EA 2P8TA 4LMYA 4IO9F 1FEXA 2Y2ZA 2E1NA 2OZUA 3BG3A 4LIUA 3V7SA 2XGCA 2HKUA 3ELKA 3ANGA 3BRUA 1AKHA 1DQUA 3CCEI 2EK5A 2CRGA 4M6YA 2PLYA 1OYWA 3RJPA 4LG0A 2R92J 3CESA 4KIFA 4JX4A 4W97A 3H0GJ 1N75A 2E34A 5JVTA 2ISYA 2ZMEB 2LTPA 4A0ZA 3SWHA 2X6XA 3PL8A 4LGWA 4JYKA 1V5FA 2WWYA 1TWAJ 2WAFA 3K70C 1A31A 2CJJA 2NRAC 4KICA 4PUSA 3LSPA 3ASOH 4LLGF 4NDLA 2MW8A 3LSTA 3PSIA 2ZO4A 5AONA 3SQNA 3VPRA 4UUTA 4CYCA 4XIDA 3DBHB 4DVYP 2OUMA 3RCOA 3BLYA 2DOFA 5TGTA 3HTHA 1KYWA 3QAHA 1MMNA 2X9DA 4RLFA 4HF2A 5GTHC 1IN4A 3SFIA 1KQ0A 3RI4A 2CH0A 4GCLA 2M3AA 2WB1N 3CP8A 3R0JA 3Q3SA 5AQCA 2K02A 4BEHB 2YPRA 3EPZA 1B1BA 1T8IA 2P6TA 3SDGA 3P7NA 3BR6A 2GUHA 1OCOH 3FISA 3CMEI 4D1QA 3PPBA 3FXQA 2ME0A 1RKWA 5CVIA 3RD3A 1D8KA 4Q48A 2L9VA 2QUFA 2B9SA 4A6EA 2DOEA 3CMAI 1XC5A 4ITVA 1V5GA 3EDPA 2LSOA 3P9IA 2LBFB 4NC6A 1Z0XA 2ZMEC 4IRVA 2LR8A 2PZ9A 2HQ5A 2RASA 2ISZA 1UHSA 2A2FX 5E20A 1AKHB 4OAZA 2F2EA 4AYBA 5F0HA 1SD4A 1ZK8A 4B1RA 5F0FA 3F8CA 2VN2A 3ABTA 1Z21A 4B8XA 1A6QA 4Y52J 4IHYA 2VONA 1B8IA 1J09A 2X1CA 4DNCA 1S8NA 2Y9YA 1OLTA 1K78B 5DV5A 1J5YA 2F4MB 3K69A 3VWBA 4JP0A 4DQ2A 3WTUC 5IYBJ 2L9SA 5K58A 2E7WA 2A05A 1LVKA 4PCQA 2EFPA 2EIMH 4CH7A 1ZGAA 2IS2A 2ZKZA 4LG3A 2M0CA 4I99C 1FYMA 3CJDA 1CGPA 1X3WB 5M5WJ 1LQ1A 2GFNA 1A36A 2H8RA 1E0EA 2F6CA 3ZRGA 5HLGA 3S2WA 3ZQ7A 1PUFA 3TEDA 2HEOA 2CYYA 4MIMA 2VLAA 5D5WB 5LLQA 2CQXA 3TO6A 2QSFX 1UAAA 1P7IA 3PQJA 2BXZA 4X1EA 2W48A 4Y13A 2HPIA 3L09A 4BY7J 4A3EJ 2FJI1 1F43A 3QKXA 2V9PA 3WG9A 3H9QA 3OL3A 1YQAA 4P9UA 4XLCA 2FE3A 1U8BA 3VVXA 4MFEA 3G71I 1VFCA 2EB7A 1BW5A 4CDGA 1YX5A 1R5ID 3HJEA 3CCSI 3A03A 1MKMA 4LD5A 1IZ1A 4MHGA 5D1RA 1Z6RA 4BJTA 3ZN1A 2GA1A 1U0JA 2FEZA 3G1LA 2B63J 2VQLA 3R0AA 3SFZA 3CJQB 1VQNI 1A6IA 1USTA 3HXLA 2WA0A 2R0QC 2L4AA 5LRSA 4KT6A 2DJNA 1HBXG 1X3ZB 2MG4A 5L3EA 1EKEA 4BQAA 1XG1A 3V8LA 1Z77A 4FTHA 3RKYA 1R71A 5E17F 4DBRA 5D5VB 3BZCA 3KP6A 1GV5A 2IVMA 2MLGA 1I1GA 3GW2A 2CUZA 3KCCA 2P5LC 4Y33A 2GOXB 1AHDP 5J6XA 4Y17A 4FQGA 2QENA 2CO5A 3LSMA 2HDCA 4E70A 3FX3A 1RETA 2FX0A 2LDUA 3CDLA 3S1RJ 2ICWG 3SXYA 2G0EA 2FBIA 5E8GA 3L9FA 3FHZA 3HOTA 1FMWA 2DG7A 2LY9A 4KT5C 4KUMA 1Z1DA 5DTDA 1XCBA 5GAEJ 3MKYB 4G7ZF 2XGXA 2DFHA 2PFBA 3IP4B 3QU3A 1U78A 5H9TA 4L9VA 5EGOB 2MABA 4XOTA 3IUOA 1MSEC 5DD8A 2FQ4A 5ICFA 4PFPA 5JHFA 1SD5A 3KPHA 1QVTA 4RDUA 1E3OC 4D9JA 4NQWB 1TP4A 2DI3A 4KIGA 2JPCA 2QKLB 2GWRA 3J81Z 2Z3YA 3W2WA 2GXGA 3E6DA 3TBIA 2E2JJ 1FBUA 3L2VA 4P9FA 4YFXF 1BL0A 4F3QA 3M8FA 2PFVA 1BR1A 1RKTA 4RB2C 4EJTA 2B3WA 2L4MA 4UUSA 5FGLA 4HNUA 4IKFA 4BUPA 2AS5F 2JA5J 3J7AY 1BR4A 3D1NI 2RKHA 2Z5UA 3LFUA 4RMNA 3C1DA 3HPGA 3DTIA 3HOWJ 3S3OA 2ZOYA 4A93J 4F7ZA 5L3DA 4G7HF 5HSZA 5C4YA 1KQ9A 3HTSB 1D5VA 3RPQA 4V19K 3HM5A 2DTZA 2YVEA 2X6OA 1OYIA 5D6EA 3CO6C 1I1SA 1B9NA 3JTGA 3I4PA 1MNMC 3K10A 3TP3A 1O3QA 1YRNA 2D5VA 3EYIA 4KN7X 3WTSC 2G3BA 3ANPA 2YR2A 3IKVA 2NNNA 5KCMA 2E5NA 3V8JA 3NQOA 4ZYEA 4LB5A 3DLLF 4E7JA 2VJ5A 5LHHA 4L0ZB 2KRCA 3QP5A 5LHIA 2PMZN 1J59A 2V79A 2Y30A 5A2QK 3H9GA 3MCZA 1AWCA 2HQAA 3HUGB 1X4OA 3NAUA 1BC7C 3R6SA 5CVRA 3JREA 3ZR8X 2O8XA 3JRDA 3HGYA 4RM2A 4F91B 4L9JA 3IRQA 3OL4A 2E19A 1UJ8A 1NH3A 3QP6A 2XC7A 3CDIA 1I50J 3S1NJ 2QKOA 2QQBA 3IH4A 2KRHA 4BQNA 1R1UA 2OCCH 3CUQA 4XN0A 1PDNC 2GM4A 1OQYA 4KJZA 2HPMA 3S5RA 1ZR4A 3NS4A 1JKPC 3OYBA 4F55A 2RQPA 3JRGA 5C4XJ 3FHNA 2XRLA 5CQGA 4E7ZA 4DGWB 4YRVA 1H8AC 2IGKA 1IAWA 1POGA 1DU0A 1NK3P 1TQPA 2BY2A 4IPAA 4A3KJ 5BS6A 5E8IA 4OIOF 2M45A 3S1QJ 1DP3A 3LA2A 1G8XA 1V4RA 1M1EB 4BJ5C 3S2DJ 3KP3A 2YX4A 2BHYA 1R4NB 3WTWC 2WY7Q 4BS9A 1QZEA 2JSPA 2RNJA 5ICCA 5CW8A 4O3MA 4LOCA 5HVQC 5HS9A 1F4KA 4EGZA 3K4CA 2R7RA 1XCVA 3IAS2 4RGSA 2IEKA 5HLIA 3WTYC 3BJ6A 3A0HC 4TV7A 1X1BA 1L0OC 2HR3A 3EUKL 4ESBA 3OYFA 3HL2A 1IG7A 1IN7A 2V57A 5FKLA 3Q0VA 3UKGA 3IWZA 1LEBA 1ITYA 1A5JA 4NBQA 1KZHA 3FF5A 2W82A 1GDTA 1WJBA 2RDPA 3T8TA 1LDJA 3VYSB 1H88C 1NTCA 3RKQA 1HW5A 3K4BA 1OCZH 2HOAA 5M3MJ 4RAGA 4O6JA 3AQSA 2WTEA 5CPRB 4FCYA 5FJ8J 3RKXA 2GA2A 4DBQA 2NXNB 2QQAA 1Y6IA 1Y0UA 4RLQA 1EV7A 3IH3A 3QYBA 5IOYA 1XSDA 2JA6J 3OS0A 4OAYA 4XN3A 3F23A 2QBYA 4ENNA 2PMHA 3GO5A 4M6VA 1WPKA 3M3YJ 2YSRA 2K5CA 1YJNI 4Q5SF 3LA3A 4ZC3A 1S29A 1W1WE 4B48A 2NVXJ 4CCJA 2OC6A 2EZKA 3OYCA 2CFXA 1W0TA 1TQMA 4NC7A 3J7YJ 5FLXZ 1VQ9I 1S6LA 1R1TA 2DO7A 2M4KA 3AQTA 1UHMA 3V6GA 1MH4A 2JSCA 2XB5A 5HAWA 1OCCH 3ZMZA 4CCOA 1YITI 2G7LA 1E3HA 1ULYA 3P9KA 1WSUA 2V1UA 1Y1WJ 3KE2A 2ELKA 2NX4A 2LFBA 3GTPJ 3CWRA 1RESA 3W3CA 4A3DJ 4WXCA 3HPHA 3IC7A 1DUXC 5K5RA 4BY1J 3OIPA 3GZ5A 4A69C 3G2BA 3QQAA 2CWEA 1ETXA 4HV5A 2NOGA 1LNWA 2LKSA 2R7XA 2IGNA 4ESFA 3VYTB 1T95A 3PFYA 1LB2A 3F8NA 3REOA 2EPFA 1ZTRA 4DZJA 5HOOA 4UV9A 1O3TA 3DTEA 3H9JA 3PNVA 1HF0A 2QSHX 2E2IJ 5BPDA 3M7GA 4XOPA 2QQ9A 3V4GA 2H1KA 1LKXA 4I2OA 2GLOA 1SAUA 2DA3A 2LY1A 2DU9A 3N97A 1QBJA 1ZKGA 2L7ZA 3I59B 3MN2A 4N4NB 3BJOA 2GXAA 4CGZA 3DPLC 4HQEA 2CSOA 3BZ6A 1KYZA 2HYJA 4WIBA 1DDNA 1R23A 2FRHA 3G73A 3DBLB 4EM0B 5CQEA 3ZMSA 5EDNA 2VL8A 1JTYA 3JAMZ 1ZRDA 3FKJA 3CCYA 3LNQA 3K4MA 3CMMA 3ZQFA 1JUSA 5F0CA 1JKQC 2H6CA 4ZDLA 1D1BA 3HKZA 2FJ1A 5D5XB 4HA8A 3V7RA 3HTUA 2MLKA 2OERA 1FJLA 2QLZA 1KONA 2L3DA 2VI6A 4C9YA 1BI1A 1S72I 1GV2A 4KNYA 4GCKA 2KHMA 4GYGA 2HTJA 4Z6YA 1IF1A 3AL0C 1U5TA 1IDZA 3RQ4A 2WAEA 5B66C 4XLAA 4Q47A 3GFMA 1Y1VJ 2VE8A 2EWNA 3QODA 4E7SA 2ZJ2A 4JQFA 5DUKA 4A3JJ 3FK6A 2DODA 3KKDA 2E7XA 1YX3A 2K9NA 2Q0OA 3KX2A 2WC2A 2YU3A 1UELB 3ESWB 4LJZF 1YW8A 3QOEA 5B1AH 2QIBA 3E7LA 4XKWA 4KMFA 5CVJA 3RYRA 5C3EJ 1G3WA 3JSJA 3HSEA 4YFKF 5M5XJ 3D0SA 1D1CA 1FLIA 4L62A 2LP0A 3FXLA 1R5GA 4B3AA 1K6OA 2TDXA 4HW0A 1YJ9I 2L02A 5ICGA 2FF4A 2RAEA 2L7FP 1QPMA 2LREA 4XR6A 4B3XA 4ZH4F 3RZOJ 3JTHA 4BBSJ 4B4CA 4H0EA 4S04A 2GIVA 1QPIA 2VPRA 1P2FA 3O60A 1MMGA 4OMYA 3F8MA 1LEAA 4F92B 2P5KA 2COMA 2XAFA 2WBMA 1W5CC 2O03A 3JRAA 4JKZA 3CDHA 2ZB9A 3MWMA 4PJ0C 1DPRA 4OD5A 4LIVA 2K27A 3F0CA 3SYTA 2VC1A 2IRFG 3WTVC 2CV2A 1FSEA 2EA4A 3K4JA 3R60A 2L7MP 1FYLA 1BC8C 1NG7A 4HQMA 1TT0A 3P9TA 2EA2A 5FLVA 3TGNA 1K4SA 2TRTA 3LHQA 2R5YA 3GYHX 2XPVA 3JRCA 5E3LA 2FNAA 5C44J 1EJ9A 2OI8A 4EJOA 5J3LA 2NVTJ 2DCEA 2X6WA 2BOLA 1ZQ3P 4YEJA 3MEXA 5LHGA 2D2WA 2KISA 2LH9A 2KDZA 1D5YA 4ACIA 3HBLA 4FE7A 2VC0A 1QVUA 4G12A 4CCKA 3HIMA 3CC7I 4XORA 2BE5F 2DW4A 2FOWA 2JA7J 4BNCA 2ZMEA 3SZGA 5IT3A 2Z33A 3BTIA 2VT3A 3ECHA 1K61A 4BQQA 4D7MA 2XF6A 4EATA 2FNPA 5DD4A 1YTYA 1W4MA 1FOYA 2I10A 3M1EA 5B5EC 1D0XA 1Y8RB 1MBJA 4JNNA 1KGSA 2ZXWH 2P6SA 1WJ5A 2JRMA 4XRSA 4C3JJ 3GVAA 2IP2A 1QHHD 4MLOA 9ANTA 3BTJA 2OV7A 5IPAA 4M3EA 1BI3A 3KEQA 4HSRA 4LLNA 4HX8A 4BHPA 1G3SA 2LNBA 2M9HA 5H2FC 3HOSA 2K4JA 4XLNF 3DKXA 1W0UA 2HVRA 4BEHA 2ZNZA 1XS9A 5ILVA 1QU3A 2LMDA 1VI0A 1BM9A 3DEUA 1BN5A 1JGSA 3OYMA 5F6FA 2QA4I 2JTVA 1ZG5A 2LY2A 4CUGA 2R5YB 2Y0MA 1UZCA 3L2RA 2L9NA 3H92A 3VSKA 2VOPA 2VKVA 3E5QA 4GCVA 3CQZJ 3VW2A 2L0KA 2LBFA 1SMYF 3K4KA 3DFGA 5J1YA 4XMYA 2G7SA 3MKWB 3VP5A 5D19A 4XKCA 2M0MA 2FBKA 1Y8QB 2NOJB 2QEXI 3S2HJ 1AOYA 1MDMB 2BYVE 2O6GE 1XSVA 3FMRA 3C2BA 4KYWA 3Q0UA 3MZYA 3FM3A 2HDWA 5H6RA 5D4SA 1AA7A 2R7QA 1KQ8A 1K78A 1SGMA 2KDOA 3O8GA 1FT9A 3FXKA 4CSWA 1HSTA 5JHUA 2D6YA 2V26A 4HLXA 2BGCA 3QWLA 3ZGKA 5FB2A 5FHPA 3T8RA 1ZREA 2DPUA 3F21A 4ASNA 3GTGJ 4C2MA 3L2QA 4BKXA 3W6KB 1FYKA 2NS0A 3TKYA 1FMVA 4HRIA 2GQQA 3OYHA 2ZSIB 3DXJF 2HYTA 4X6AJ 4MQVA 2ZJPF 3DU6A 3LL7A 5E1ZB 1HKSA 3SZPA 2A69F 3ERED 2D45A 4HSTA 3J81K 3SHFA 5CVUA 2CQNA 3M8JA 1LDDA 3S1MJ 5DAJA 4UDSA 2UV1A 1MBEA 2VE9A 3FIWA 3HRSA 4AVPA 5F64A 5LGTA 4CYDA 3DCFA 2RN7A 4GFLA 1TNTA 2CS3A 1PP8F 2XRNA 3PUBA 2Y0SA 4BAYA 2DT7B 5DYMA 2FBQA 2ZOZA 1T08B 3HTIA 4I02A 2X48A 2X1DA 2ZFUA 1TWHJ 3TQNA 4CXFA 3FDYA 5LBQA 2W7NA 5IP6A 2NP3A 2BBYA 2EFOA 2EQRA 4C2TA 4OIPF 2VJIA 4DZPA 4II2A 5JR3A 5FFZA 3GTLJ 1FIAA 2LKXA 3PO3J 1IDYA 3M1CA 1K6YA 3BTLA 3HEFA 2PG4A 3PNTA 1TWGJ 1VTNC 3S16J 3OYEA 3SEZA 2Z16A 2KFDA 4AIHA 3WTTC 3CCQI 1ETYA 3H35A 3GFIA 2WAQA 3RSNA 2LLKA 4PSXA 1QO0D 1MBHA 2E35A 1XGOA 3G7RA 3HOUJ 2OTLI 2DMQA 2M4GA 3ULQB 5GADJ 4XSXF 1JJ6C 2OBPA 2XPUA 3O2PE 2FMLA 4U87A 1CQTA 3BROA 1GT0C 3F1BA 5HDNA 3VVZA 4PDKA 3SDBA 3BWGA 1XPXA 3H3VK 3OSFA 4ZZLA 2A07F 4HDVA 1PJRA 2VBYA 5F1JA 2MFZA 1UFMA 4N0BA 2Y75A 2J5PA 3ZQQA 4R79A 2WY8Q 5EGOA 2O7TA 1K4TA 2JT1A 2GOMA 4IQJA 3OV8A 3HC7A 4I01A 4OINF 5BNGA 5JLWA 3I55I 3KNWA 4MQ9F 4L0YB 2O61A 2W25A 1R58A 2VKHA 4NQWA 4YIRX 3H36A 2DMUA 4DJAA 3CC2I 1TWFJ 2DG8A 3B81A 1MBKA 4WCGA 2V1NA 5J47A 1J9IA 4GYIA 5ILSA 4JL3A 5FKOA 1T33A 1Q1HA 1BIAA 1YFHA 2MA3A 1FNNA 4E7LA 3F72A 2OF7A 1MGTA 1UG2A 5ED4A 4RBOA 3OYAA 1ACIA 3KEYA 4BHCA 1Z7LA 3DBRB 4M6XA 4ZYGA 1ZRFA 2A68F 3PASA 3BR2A 5LGUA 2VKDA 1TZLA 1XGMA 2I8DA 4ICHA 4QTRA 2RREA 2W24A 3KP5A 3FMSA 2EJRA 3F8BA 3KP7A 2M7BA 4AU7A 2QM3A 5JI6A 1U2WA 3LSHA 1B4AA 2KT0A 3TW7A 1RI7A 1YHQI 2COBA 3TO7A 3ZXSA 1PUEE 2CW8A 3TDUC 3E3VA 2H1LA 4HZFA 2HXOA 3BG7A 3CCUI 3CO7C 2Z9OA 2KJBA 4WXDA 1ZGJA 2DA2A 3O8HA 1IN5A 2XVCA 4CCLA 2RQQA 4M3GA 5K7ZA 2ZY9A 3QPLA 1S7EA 4P96A 1XTAA 1CF7B 3K2ZA 2O9LA 4IVNA 3RKWA 4QWQA 3HUGA 3MVPA 2QVOA 1HLVA 2ZCMA 2XF5A 3FK7A 1T0FA 4NN1A 2WADA 1R7JA 1WI9A 2OQGA 2V1DA 5J8FA 4OIRF 1W5TA 2HI3A 4P55A 1FIPA 4FE4A 3BG5A 3EYYA 1ZG1A 1DPUA 1ERDA 2QWTA 3K0LA 1ETWA 1MH3A 2F48A 2BVLA 2JA2A 4OU0A 3L7WA 5FLXK 5HDKA 3DU5A 1PVEA 4DYQA 5K7HA 3LAPA 4IOCF 4NELA 2PQ8A 4JK1X 5KVRA 2JQ7A 3DPJA 2E1OA 1X1CA 3HB9A 4YIIA 2E1CA 3GZNB 3LMMA 1UG0A 2K9QA 4MNUA 1P9QC 3LSKA 4A5NA 5FRMA 1IGNA 1S5LC 4MO7A 3OY9A 3KP2A 3Q9SA 4BACA 3PQKA 3KLNA 1EF4A 3S15J 3CUOA 4C30A 2GZWA 2UXXA 1DGWY 4MFDA 2MYSA 1WH5A 2MSYA 3FXRA 3I9V2 1X2NA 2W4SA 4MK6A 5L3FA 3HHGA 4BGDA 2IPQX 2XIGA 4LITA 4C3IJ 3KZ9A 4Y7NJ 2DN0A 5DM6F 4ENMA 1G4DA 4QPQA 1XMXA 3FZVA 1QRYA 2CW7A 4V2FA 3S3NA 2XSDC 3NPIA 5BQTA 3EUPA 1GXPA 1MW7A 2DJIA 2KPMA 3KZIC 4W1UA 3TMOA 1P7JA 4OWRB 2V6CA 4QSHA 2DMNA 1JE8A 5E18F 4K2EA 3PIPF 2X6YA 1NK2P 4ZYHA 2MGQA 1QNTA 4CA0A 1R22A 1OPCA 2CQQA 1GHCA 2VBZA 4M72A 3Q0WA 3S17J 2M8GX 5FD6A 4BHBA 4U7BA 3MZHA 2A61A 2L54A 3K2AA 1YIOA 3NI7A 4E7HA 1K83J 2D1HA 5DCMB 3JAMK 3ZQIA 3LFKA 2I5UA 2XPWA 1X2MA 1WCMJ 4H4KC 5K7FA 5ILUA 2NNYA 3IRRA 4KITB 3PJRA 5FLMJ 5CYVA 2JA8J 2DQRA 1FP1D 3OYJA 3ASNH 2O3FA 3GXOA 3TDZC 3J7AO 3WE2A 3ROUA 2HVSA 2P0WA 1KU2A 1MD0A 3FBNB 3K1MA 1W7PD 4EV0A 4XICA 4L5EA 1AU7A 2FQ3A 2AHQA 3NNRA 4PJMA 2EIKH 3QU6A 4F93B 3P9CA 4L9TA 1REPC 2DT6A 5GPAA 4FHTA 2EV6A 2VQCA 3BR0A 4CO8A 1JI8A 1KU9A 1ZLJA 2DFFA 2X85A 4M3BA 1IXRC 2EFNA 1QQIA 4BJ6C 1BI0A 1U3EM 4IF4A 1B59A 1JHHA 1FX7A 1NG6A 2CMPA 2VKEA 4G6QA 5CLSA 4BBRJ 5IOZA 3OYDA 3C07A 1D3YA 1S7AA 3HHHA 3GX4X 3COLA 3FRQA 3RZDJ 4PJNA 3DKYA 4R1HA 5CXIA 3MNLA 3U1KA 1YE9A 2GXBA 2E1MB 2ZXJA 1USSA 3OYKA 5IP9J 2XGEA 4I09A 4UV8A 3TL4X 3D5LA 5F1RA 1T6SA 1P6RA 3VW1A 3HOXJ 4IJAA 4XRFA 3S8PA 5JLXA 4AWXB 2K7LA 2HZTA 5GTIC 1T0FC 2R7UA 1JHFA 2YU9J 4IRHA 5HS7A 1TLHB 2ZFWA 2VASA 2DFEA 2R7VA 2F4OB 3WHCA 4IX7A 1ON1A 3I59A 3MKLA 3TOAA 1OMIA 4IOAF 2VB6A 1FWZA 1IV8A 2B0LA 1FTZA 4U0WA 4NHJA 1OCRH 1UMQA 2BHZA 1GXQA 3KEOA 2UZKA 2VXZA 3WHBA 4S05A 2XB0X 4M74A 1IUYA 2FA5A 3TOBA 2HGCA 2IA1A 3BHQA 4E6KG 3W2VA 2EILH 3VOEA 2BW3B 3KZZA 1ETQA 3DPTA 3OWTA 4A6DA 1HDDC 1SVLA 2YVHA 1WJCA 2X4HA 2XDNA 2UUZA 2HQRA 4M3FA 1SVMA 3NXCA 4HEA2 3OYLA 3A2KA 2HYGD 2MH9A 4AIJA 2BXYA 3A01B 2FBHA 1XDSA 4AIKA 5LD2C 1SD7A 4GDFA 5E1XA 1WGXA 1VNDA 1MBGA 4IL6C 5F08A 5BPIA 1HQCA 3PUFA 3GWZA 4HNTA 2EZIA 3N05A 1ZH5A 1D1AA 2RNGA 1HDPA 4RGXA 3I5UA 2ZXHA 5EEGA 5E3NA 1UI5A 2KLOA 2E1MC 4WX9A 1WH7A 1X1PA 2KKOA 1FOWA 2O5RA 4M9XA 2DFIA 1VQ5I 1W36C 4A3BJ 1SFKA 1VQ7I 3WG7H 1SANA 3OSGA 4ZYDA 2PN6A 5D8KB 3GTMJ 2A6EF 3ZMUA 2XASA 1UI6A 3QYEA 2KIQA 1O57A 1JTXA 1R4MB 2CUFA 4UXNA 2ADUA 1IJWC 1FTTA 4A0XA 2REKA 3JSPA 3GUDA 2JVGA 3T5XA 3R4KA 2V7FA 2YS9A 3GBGA 3L2UA 4B47A 1I3AA 2OAZA 2XAUA 1DGRM 5J4VA 2XROA 2HVQA 1GUUA 2N8GA 4EMSA 2JRTA 3AG3H 2PMZA 3CCMI 3RYPA 3DEEA 3HSRA 2Y69H 1XMAA 4UNOA 1R9TJ 2Q2EB 4ANJA 1BOAA 2P4WA 1JUPA 3E6MA 4PZJA 4KFCA 3IV5A 1P4WA 3FMQA 3H0DA 4EJVA 3LSIA 5D5UB 3FXUA 2H09A 5IP7J 3EUHC 2Y9ZA 2QKMB 3G56A 5D8LB 3SZTA 3OYGA 4U0VA 1SMTA 2XAQA 3OYNA 2RVCA 4FETA 2LD5A 5TRDA 1MJAA 1IRXA 1WI3A 1FZPB 4FT8A 5GAGJ 2XF7A 4R8HA 4IHXA 1TWCJ 2OQRA 3TW6A 5HLTA 2NVUB 4NB5A 3U2RA 4ZJZA 1DP7P 2IGOA 1RPWA 2LK2A 4BL0B 1HXDA 4RB1A 1ZRCA 2HFHA 1APLC 3BY6A 2HOSA 3CJNA 1MNEA 3HDDA 2ELHA 4I7HA 3AG4H 2BY3A 3IL2A 2VJJA 2R7WA 4JOMA 3CF5F 3W6VA 4A5MA 2VT2A 2OD5A 3BOQA 3ECOA 1VZ0A 4EJWA 5EG0B 4J01A 1LFUP 5A2QZ 3LA7A 1R36A 4MEYF 4IHVA 4L5JA 2B7EA 4HF1A 1I6HJ 1Y0NA 2DLLA 3DKWA 3I56I 2R7FA 2BV6A 1WQ2A 3ZQLA 4UB6C 1BOBA 1TBXA 5FKNA 1RIOH 2DK8A 4XL9A 2KMUA 1FY7A 3BG6A 4Y15A 3JR9A 3E5XA 2NS8A 2ZCWA 5KK1A 4YFNF 1IC8A 2PEXA 4B43A 1WWXA 1YOVB 5EJCA 2P81A 3KLOA 2XAHA 5HLHA 3GTQJ 3GZ6A 1HC8A 3TP0A 5HNFA 3BJBA 4PXIA 4CICA 4AUXA 3FXMA 2H6BA 4XBFA 5H20A 3VOXA 2HKXA 5GP9A 3GLLA 1VQKI 2PBIA 1D0ZA 3JRFA 2VQGA 1LFPA 5IYCJ 4IZZA 2CFOA 2GENA 3NRVA 1K79A 1STZA 1E2XA 2EZHA 5B1BH 2L9RA 4MTDA 4BE1A 2A6HF 2V1XA 1EA3A 1XGSA 2CUEA 2L5QA 2FMYA 1LJ9A 2C6YA 1W7PA 5FGMA 2XV4S 3A0BC 3AFHA 2PX9A 1ON2A 3VEPA 2QYOA 1E3PA 2K9LA 1MDMA 1S3JA 2K85A 3AG1H 4YELA 3ZQGA 1D0YA 2ZBKA 2QGUA 4G6TB 1P92A 2V9VA 2WV1A 2F4IA 3OS2A 4XLPF 5CXGA 2KIFA 2F5CA 1P4AA 2OZ6A 2EFQA 3RQIA 5C4JJ 1ETVA 4C2UA 3K1PA 1GLNA 3L00A 2ZJQF 5D6FA 1O3RA 4EGYA 2IBDA 3CTAA 3E6BA 4EEFG 4AYBN 5CVVA 4MTEA 1WJFA 2A6TA 4BE0A 2DT5A 1YG2A 1ZARA 3VSLA 1SFXA 1SEUA 1H9TA 4D5CA 2NYXA 4N9IA 1ZN2A 2XKOA 1EH6A 3ABKH 4LK0F 4ZZDA 1S7OA 4M73A 3UR3C 1ETKA 2KZGA 1RRJA 1X3UA 2JUCA 3IAM2 5FO5A 1I3QJ 2KIUA 3I53A 2R3SA 3IWFA 2BY0A 4OIQF 2GBYA 3LWJA 4G6DA 4KMUX 2EV5A 1B72A 3K4LA 4RAZA 1X58A 2NVYJ 4EM1A 4RS8A 4A2UA 4B44A 5L3GA 1IN8A 2R5ZB 3KIOA 1LPQA 5HNHA 1F36A 3HE0A 1TTYA 2XGDA 1BJAA 3JRHA 2DXIA 1HOMA 1W7PB 2AQEA 1H89C 4BDYA 2M87A 3ERMA 2KJCA 1TW3A 1JKRC 2X51A 2Y48A 4WF2A 5EEHA 4N9HA 1W36D 1IN6A 2L01A 4CGRA 2VXDA 2KZVA 1YJWI 3F6OA 1TT5B 3M8EA 1O7FA 5AIQA 4M9SA 1XGNA 5DCFA 2TCTA 1VF9A 3CZ6A 2DA4A 2JZYA 2MH2A 4IQ4A 4ENKA 2AXLA 3VB2A 1T39A 2XHKA 3HTJA 1HKQA 2R7OA 4RGUA 3S93A 2WGBA 1IO2A 1O7LA 3KZYA 4M3DA 4J00A 4IHWA 1BA5A 3DLAA 4PGHA 4LB6B 1K7AA 1HKTA 2FUG2 2V6EA 1R00A 1BR2A 2MD5A 2NAZA 2IA0A 2P7VB 3GLXA 4GFBA 2Y31A 2O0YA 3L1PA 1HSJA 2L7KA 2EH3A 3E6CC 3GTOJ 2QCOA 5B3SH 1N78A 1RZ4A 2FOKA 4ZDPA 3MZ8A 2WV0A 2MC4A 1OKRA 2EIJH 4BXXJ 1RC9A 2QQ8A 4I98B 1ZLKA 1B72B 3HRUA 2CQ7A 3WGHA 1J7KA 3RIRA 3QRFF 1XN7A 2CU7A 4CCMA 4HX7A 3WU2C 3Q9VA 2IS4A 1Z3XA 3BDDA 4Y4RA 2EBIA 2ECCA 5DUIA 3HTAA 3C2HA 2LRDA 2UXHA 1Y56A 1YIJI 2Z99A 1RUNA 2W85A 3C3WA 3C7JA 3QPHA 3KETA 4XRMA 4RAFA 4HG2A 2CV1A 2UXNA 5TJJA 4NNJA 2EV0A 4UVBA 1XB4A 3EGQA 2JVHA 1WZ2A 2HNHA 2RHAA 3H3UA 3QPSA 1SFOJ 3AAFA 3BCBA 5FRNA 2R7ZJ 5IYDJ 3V7CA 4QLCU 1T2KA 1HW2A 2B1EA 3E7QA 4PJJA 3Q5FA 2VBWA 4F52A 2MD0A 3CCRI 3O6BB 2DDBA 4PGGA 4PFOA 3LAJA 2LVSA 4ZDOA 2A5WA 3K6GA 1CF7A 4LG0B 3HOVJ 1LE8A 4ENJA 2STTA 2VQHA 4M9ZA 5EZHA 4AC0A 1IRFA 3WU1B 2ESNA 4U9LA 3HRTA 1SVOA 3B6CA 1P4XA 3VFZA 1W5SA 1HW1A 4IHSA 1DU6A 3LJLA 3S3MA 2KQRA 5E79C 1MMAA 3VW0A 1ZG3A 2Q1ZB 1VQ4I 2LYCA 3ISPA 3P5JA 4HF0A 3VVYA 2IJLA 4GFKA 2Q8KA 3IH2A 4CYCB 1ZYRF 2AQFA 4ZTJA 1IXSB 3B73A 4GCTA 3VUQA 4XKVA 2K3PA 5LFAA 3NARA 3S32A 4BQOA 1FSHA 1BJZA 1X19A 2K86A 3CC4I 3BCAA 1WJEA 4UB8C 1JGGA 4ZYAA 5HS8A 2W1OA 3MAJA 4A3LJ 3QOPA 4Z2YA 4HNVA 4UUVA 3ZMDA 4YIFA 2ELJA 1SFUA 4RAYA 2QZ8A 2IW5A 1NHAA 3HZJA 5KHDA 4HOBA 3G4SI 2K40A 3COAC 2M1BA 3F22A 5DDGA 2QOPA 4KIBA 1G59A 3HOYJ 1VQOI 1Q1VA 4A3MJ 2K4BA 4Q4ZF 3M9AA 2E36A 5K1YA 4WK8F 2PJRA 3ZPLA 3KKCA 2BVMA 2M34A 3CP2A 2ME6A 2P7CB 2LC2A 5E3OA 1ENHA 3NWSA 3V42A 3MQ0A 2R7DA 1XMKA 2DYSH 2O8KA 2A5YB 1SD6A 3U1DA 1Z05A 3WE3A 2CQKA 4YZEA 2F5DA 2IGMA 1VQ6I 1YS7A 3BQZA 1LE8B 2X0LA 1G3TA 3QBMA 1V5EA 1OFCX 1FOKA 1B8IB 4G7OF 5DCMA 4D0PA 5JVGF 1ZAOA 5LEKA 1WKMA 2O7OA 2HQNA 3ZMTA 1OJLA 2D1VA 2YUSA 2JK3A 5BMZA 3CJTB 4DYCA 3A02A 5AIPA 1G3YA 2WB1A 5LGNA 2CG4A 3W6JB 3QYFA 1QZZA 4KWAA 4AVZA 5JFRA 1ZHFA 1WHUA 2DOAA 3DTKA 2AXTC 3I54A 4BH9A 4HDUA 1KU7A 3J7ZI 2FU4A 3BNIA 4GO1A 1RR7A 3A1YA 2ZXIA 2W00A 1MZBA 3KYDB 3RTRA 1PUFB 3BTCA 4XKBA 4C3HJ 3CJRB 4DIQA 2FSWA 2IS1A 3K4NA 1BBYA 3ZOBA 1LFBA 3FXJA 1FPQA 5HBUA 3RH2A 1X4PA 3U21A 3GTJJ 1Z67A 2ACJA 2MBFA 2QWWA 3CD6I 4XSZF 1U6GA 1QZYA 3V78A 3OIQA 2OPTA 2G7HA 3GCMA 2F5VA 4AIDA 2PI0A 3WTXC 1EH8A 1JUMA 3FXOA 5IY5H 3JCUC 2ZJRF 4D7NA 5CKTA 1BIBA 1ODDA 2XAJA 1OCTC 2PJRB 2G7UA 2J5OA 1VQ8I 3I3LA 2W53A 4FISA 4C2MJ 1ETOA 1ZGWA 4RB3C 2OTJI 1YS6A 3V8KA 2ESHA 2XSJC 4CCNA 1R1VA 4JX5A 2DA5A 2PBXA 1BI2A 5ICEA 1B9MA 3QPTA 3FWEA 4XRSG 3RPUD 3CCJI 3ML6A 1JT0A 2HWVA 1TQIA 3PM1A 1ORKA 4XK4A 2E60A 1IUFA 5DS9A 1JXSA 4A0YA 4HBLA 1IW7F 3ABLH 3K70D 2MC3A 2PJPA 4RB0A 4FASD 1V55H 2BW3A 3D5RC 2IA2A 3K8PC 1TL8A 3ABUA 5GAHJ 3LSRA 3NRGA 2EZLA 4ETSA 4GXOA 4HAMA 4NC8A 3A01A 1IXCA 3GF2A 4B09A 2PMUA 2XDVA 3EUHA 5CJ9A 2CW0F 3BR5A 4ABZA 1L3LA 4UVAA 4I0BA 3L2WA 3BCGA 1U9NA 2IT0A 3NEUA 1G6NA 1C0WA 1RNLA 1LDKB 1F1ZA 1FC3A 5F27A 3HKZN 1Z9CA 1YW9A 1UB9A 5F04A 3VTIA 2IXSA 3WTZA 3TO9A 5K5QA 4KDPA 4RGRA 1WJDA 4IEJA 3OIOA 5FROA 4UUSB 2DMPA 5M3FJ 2OJED 2RGVA 4XQFA 1D8JA 2KRFA 1T38A 4QIWN 1S9HA 1Z7UA 4E7KA 3HSFA 3WGIA 1QGPA 3T1BA 2HOEA 3KFWX 3T0YA 3DQVC 2JMWA 4PJLA 4P5OA 4FX4A 1ZR2A 2KIMA 3I71A 4IHTA 2UXIA 1X1DA 3N4MA 4S0HB 3BPVA 4CZCA 1XDUA 5KNLA 4GRIA 1RUOA 1VQMI 4EJUA 2M7AA 4ON0A 1OISA 1RR8C 1YRNB 2EFWA 4HLYA 2Q2EA 4OMZA 5D4RA 2H8WA 5FKKA 1F9NA 4UHTA 2JJ7A 1U8RA 3W2AA 3DEWA 3HGGA 2HS5A 2UWMA 3ON4A 4U9NA 2OA4A 3ABMH 3EQLF 1FBSA 5FD5A 1MSFC 2ID3A 3OR2C 2AO9A 5FFXA 1LUJB 2GIZA 4IXAA 1V54H 5EFYA 4XLHA 3ZP5A 3ON2A 2ETHA 3I64A 4A12A 2M5WA 4AC6A 3OMYA 4DOZA 3K7AJ 5IT9K 4BDZA 4G8XA 1MMDA 3WODF 4N4OB 1YYVA 4I6ZA 3IUVA 2QF7A 4CHUA 2DA7A 3CF2A 3T6NA 2HOTA 2VIXA 1JJ8C 1IRZA 4AD9A 2VOOA 2YVXA 1PYVA 3M07A 3CLOA 2VJ4A 1I27A 4HPQA 3GFLA 3JRIA 1UHWA 2VUMJ 3CUQB 2L2OA 5HODA 3C2GA 1XD7A 1Z3YA 2X1EA 2LOOA 3E0JB 3BG9A 5FMPA 4PSWA 3X2QH 4IRIA 1G2HA 1OR7A 2V4JC 5EG0A 3RDIA 4UY8I 4Y3OA 3I0TA 5LEJA 3L2CA 2HU9A 5HDGA 4KN4X 5KAFC 2JPBA 3BC8A 2BY1A 1MJ9A 1WFXA 2BZTA 4P1WA 3J80K 4AF5A 3KP4A 5EEAA 4YG2F 3ZQCA 2STWA 2UXUA 3OS1A 5EZGA 4BYYA 2G9WA 3G6EI 3F9KA 1I5ZA 3M4OJ 3AL0B 2LF8A 2FD5A 3B6AA 4CZZA 3BR1A 1I6XA 4DW6A 1A04A 1FP2A 1Z91A 4MXMA 1H9GA 1ZELA 2V9KA 4FX0A 1VQPI 1Y39A 5J40A 2ZNYA 4A3GJ 2QTQA 3C18A 4BXFA 1MIJA 3BJAA 2HDDA 1TNSA 2DDAA 6PAXA 2K3FA 2DBBA 3R61A 3CCVI 1T98A 1WRJA 2NS7A 4MEXF 3U9GA 5TISC 4DYRA 1WVRA 3LSJA 2DA1A 3IHUA 3UNGC 4L9NA 1V3FA 4D5FA
chains in the Genus database with same CATH topology
1B72A 2ID6A 1X58A 2NVYJ 2E19A 2DMUA 3JRBA 1I50J 3S1NJ 2QKOA 3G1MA 2R5ZB 1TWFJ 3IH4A 2DG8A 5EYRA 3B81A 4JX6A 1MBKA 1F36A 3HE0A 2XGDA 3BR3A 5FKOA 2GM4A 4JL3A 1T33A 3JRHA 3S5RA 1ZR4A 1JKPC 2R93J 3JRGA 5C4XJ 1HOMA 4A3CJ 1H89C 2OF7A 1UG2A 2XRLA 4RBOA 2NVQJ 1H8AC 1MBFA 1TC3C 3PASA 2UXOA 3BR2A 1POGA 1O4XA 1JKRC 1DU0A 1NK3P 4A3KJ 2Q24A 4CGRA 4ICHA 3LSGA 4QTRA 3BT9A 3S1QJ 3S2DJ 3VIBA 2TCTA 1VF9A 2KT0A 2DA4A 3TW7A 2COBA 5CW8A 4LOCA 2HXOA 3HTJA 2IEKA 1BW6A 1IG7A 2WGBA 2DA2A 4M3DA 4IHWA 1BA5A 2V57A 5FKLA 3Q0VA 3UKGA 3O8HA 1ITYA 1A5JA 5K7ZA 4M3GA 2DA6A 3QPLA 5M5YJ 1S7EA 3G1OA 1GDTA 4GFBA 2Y31A 4HKUA 3L1PA 2O9LA 1H88C 1NTCA 2EH3A 3RKQA 3GTOJ 2ZCNA 2HOAA 2QCOA 5M3MJ 3MVPA 3JRDA 1HLVA 3GZIA 3AQSA 2ZCMA 2HXIA 3FK7A 4FCYA 5FJ8J 4NN1A 2M2EA 2HI3A 1FIPA 3IH3A 4FE4A 3BG5A 5IOYA 2JA6J 4BXXJ 2UXPA 5J1RA 2QWTA 1ETWA 2R5ZA 1B72B 1MH3A 4M6VA 5J1UA 1WPKA 3M3YJ 1HCRA 5K7HA 4DYQA 4NELA 2DMTA 3DPJA 2CU7A 2E1OA 3HB9A 2NVXJ 2EZKA 2K9QA 2EBIA 2ECCA 3HTAA 2UXHA 1W0TA 1U9OA 1IGNA 4MO7A 4V2GA 3AQTA 3V6GA 3OOUA 1MH4A 3LOCA 2XB5A 5HAWA 1EF4A 2IU5A 2F07A 3S15J 2G7LA 4XRMA 4MFDA 1WH5A 2MSYA 2Y0SN 1Y1WJ 1X2NA 2WUIA 4MK6A 5D18A 2ELKA 2NX4A 2LFBA 3GTKJ 3GTPJ 3CWRA 1RESA 3EGQA 4C3IJ 3KZ9A 2ECBA 4Y7NJ 2DN0A 2RHAA 4A3FJ 3HOZJ 4A3DJ 3QPSA 1SFOJ 1JT6A 1QRYA 4V2FA 4BY1J 3I4NJ 2XSDC 2R7ZJ 3NPIA 5IYDJ 4A69C 3EUPA 3E7QA 4I76A 3QQAA 4W1UA 1ETXA 2NOGA 3VOKA 1P7JA 2JN6A 2IAIA 2LVSA 4QSHA 2DMNA 3I4MJ 3HOVJ 1LE8A 2WAQN 1NK2P 2G7GA 4ME9A 1ZTRA 2MGQA 4DZJA 5EZHA 5FKMA 4AC0A 3CMYA 2CQQA 5E3MA 1HF0A 3GEUA 1JKOC 2E2IJ 3Q0WA 3S17J 2M8GX 3KNWA 2K9SA 3B6CA 2H1KA 2GLOA 3K2AA 2DA3A 1DU6A 3NI7A 3LJLA 1ZKGA 1K83J 2L7ZA 3MN2A 3ZQIA 3VW0A 2XPWA 1X2MA 1WCMJ 5EF6A 2JA8J 5K7FA 2HYJA 3VVYA 5FLMJ 4GFKA 3IH2A 4CYCB 4GCTA 3VUQA 5EDNA 2E2HJ 1JTYA 3NARA 5GPCA 1BJZA 3CCYA 3CRJA 3S14J 3LNQA 2JWTA 3SJMA 4XICA 1JGGA 4L5EA 3ZQFA 1AU7A 1JUSA 5F0CA 1JKQC 3PO2J 2AHQA 4A3LJ 3NNRA 3BQYA 4HNVA 1IV6A 3FKIJ 2FJ1A 4J19A 2ZCXA 5GPAA 2K40A 1GVDA 2OERA 2QOPA 3HOYJ 3BR0A 1FJLA 1OCPA 1Q1VA 4A3IJ 2VI6A 1GV2A 4A3MJ 4M3BA 1T56A 4GCKA 1IDZA 2NP5A 3RD3A 1Y1VJ 4BBRJ 2VKEA 3ZQHA 5IOZA 3C07A 3KKCA 2M34A 2ME6A 3COLA 4A3JJ 3FRQA 1FEXA 3FK6A 2Y2ZA 3RZDJ 3KKDA 3BG3A 2K9NA 5E3OA 1ENHA 5CXIA 3MNLA 2XGCA 2HKUA 3ANGA 3BRUA 1AKHA 2CRGA 2O8KA 5IP9J 2XGEA 2QIBA 2R92J 3E7LA 4JX4A 4W97A 4YZEA 3VW1A 3H0GJ 3HOXJ 5C3EJ 5JLXA 3BQZA 3JSJA 2LTPA 2YU9J 1LE8B 5M5XJ 4JYKA 4L62A 3QBMA 2LP0A 1TWAJ 1OFCX 3WHCA 4B3AA 1B8IB 3MKLA 2CJJA 2O7OA 2RAEA 3LSPA 2L7FP 4NDLA 1OJLA 2MW8A 2YUSA 1FTZA 2JK3A 1UMQA 3RZOJ 3VPRA 4UUTA 4CYCA 4DYCA 4BBSJ 3A02A 3WHBA 4B4CA 4XIDA 2XB0X 1QPIA 2VPRA 3O60A 4KWAA 3BHQA 3JRAA 3HTHA 4JKZA 1ETQA 1HDDC 2YVHA 2X9DA 2XDNA 2ZB9A 4M3FA 3SFIA 3NXCA 3F0CA 3BNIA 4GCLA 2WB1N 3A01B 1RR7A 3Q3SA 5AQCA 2L7MP 1PUFB 1WGXA 3BTCA 1VNDA 1MBGA 3P9TA 5F08A 4C3HJ 5FLVA 3ZOBA 2EZIA 3SDGA 3LHQA 1LFBA 1HDPA 2TRTA 5HBUA 3BR6A 2R5YA 3FISA 2GUHA 3RH2A 3PPBA 3GTJJ 2ME0A 1RKWA 2XPVA 3JRCA 5E3LA 5E3NA 3V78A 5C44J 1UI5A 2OI8A 2OPTA 1WH7A 5J3LA 2NVTJ 1ZQ3P 4A3BJ 1JUMA 4D7NA 1XC5A 1OCTC 1SANA 3OSGA 1D5YA 2KDZA 4ACIA 1Z0XA 3GTMJ 3HBLA 2LR8A 4FE7A 2PZ9A 2HQ5A 2W53A 1UI6A 1QVUA 4FISA 2RASA 4G12A 4C2MJ 3HIMA 1UHSA 1AKHB 1ETOA 1ZGWA 1JTXA 2JA7J 5F0HA 2CUFA 1ZK8A 4B1RA 5F0FA 2REKA 1IJWC 1FTTA 3BTIA 1K61A 4Y52J 4JX5A 4D7MA 4IHYA 2DA5A 2PBXA 2YS9A 3GBGA 1B8IA 4XRSG 2I10A 2Y9YA 1GUUA 2N8GA 1JT0A 3PM1A 1ORKA 1MBJA 4JNNA 4JP0A 4XK4A 1IUFA 4XRSA 4C3JJ 5IYBJ 1R9TJ 5K58A 5DS9A 1JUPA 3IV5A 4MLOA 9ANTA 3BTJA 5IPAA 4M3EA 2M0CA 5IP7J 3CJDA 2M9HA 3LSRA 2Y9ZA 3NRGA 5M5WJ 2EZLA 3G56A 3A01A 2GFNA 2H8RA 1W0UA 1PUFA 5JLWA 3TEDA 4MIMA 1XS9A 3BR5A 4ABZA 2LD5A 1VI0A 1WI3A 2CQXA 3BCGA 1P7IA 4X1EA 2W48A 1U9NA 4IHXA 4BY7J 1TWCJ 4A3EJ 1F43A 3QKXA 3TW6A 2R5YB 5F27A 3HKZN 2VKVA 1RPWA 2LK2A 5F04A 1U8BA 3VVXA 3CQZJ 1APLC 4MFEA 3VW2A 2L0KA 1VFCA 2HOSA 1BW5A 3HDDA 5J1YA 2G7SA 3VP5A 4IEJA 3OIOA 5D19A 3A03A 4UUSB 2DMPA 5M3FJ 5D1RA 3S2HJ 3W6VA 4QIWN 5EG0B 1LFUP 3C2BA 3G1LA 2B63J 2JMWA 1ZR2A 3Q0UA 4IHVA 2UXIA 1A6IA 4S0HB 2R0QC 1I6HJ 2DJNA 1SGMA 2MG4A 3O8GA 1XG1A 3ZQLA 1YRNB 1Z77A 5FKNA 4FTHA 2D6YA 5FKKA 1GV5A 2JJ7A 3JR9A 5FHPA 2NS8A 1AHDP 1IC8A 3DEWA 3HGGA 3GTGJ 3ON4A 1RETA 2FX0A 3CDLA 4BKXA 3S1RJ 2G0EA 1MSFC 2P81A 3GTQJ 2ID3A 2DG7A 2AO9A 2LY9A 3TP0A 5DTDA 3BJBA 4PXIA 5EFYA 4AUXA 2HYTA 4X6AJ 3VOXA 5GP9A 3ON2A 1U78A 5H9TA 4AC6A 3JRFA 5EGOB 3K7AJ 1MSEC 3S1MJ 5DAJA 2FQ4A 5IYCJ 4I6ZA 2GENA 2QF7A 3IUVA 4UDSA 2DA7A 3T6NA 1MBEA 2HOTA 3FIWA 1JJ8C 1QVTA 2EZHA 4RDUA 1E3OC 2L9RA 1IRZA 3DCFA 2CUEA 4GFLA 2E2JJ 3JRIA 1BL0A 2VUMJ 1RKTA 2FBQA 5HODA 2ZOZA 3HTIA 2X48A 4UUSA 5FGLA 1TWHJ 3BG9A 5FMPA 5IP6A 2JA5J 1G2HA 3ZQGA 2NP3A 3D1NI 2EQRA 5EG0A 2ZOYA 3HOWJ 4DZPA 2WV1A 4A93J 5CXGA 3GTLJ 1FIAA 2LKXA 5HSZA 3PO3J 1IDYA 3RQIA 5C4YA 3BTLA 3HEFA 5C4JJ 3HM5A 2DTZA 1ETVA 1TWGJ 3S16J 2X6OA 2YVEA 1MNMC 4AF5A 3TP3A 1ETYA 5EEAA 1YRNA 3ZQCA 2D5VA 2UXUA 5EZGA 2IBDA 2G3BA 4EEFG 2LLKA 3M4OJ 3ANPA 4AYBN 1MBHA 2FD5A 3B6AA 3G7RA 3BR1A 4DW6A 3HOUJ 4MXMA 2DMQA 1JJ6C 2XPUA 1CQTA 4A3GJ 4D5CA 1GT0C 2QTQA 3F1BA 3VVZA 3H3VK 3OSFA 2HDDA 2PMZN 5F1JA 2Y30A 1ETKA 1I3QJ 2NS7A 3NAUA 2GBYA 5EGOA 2O7TA 3LWJA 3JREA 4DYRA 3LSJA 2DA1A 3HGYA 5BNGA 4D5FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B72 A;  2ID6 A;  1X58 A;  2NVY J;  2E19 A;  2DMU A;  3JRB A;  1I50 J;  3S1N J;  2QKO A;  3G1M A;  2R5Z B;  1TWF J;  3IH4 A;  2DG8 A;  5EYR A;  3B81 A;  4JX6 A;  1MBK A;  1F36 A;  3HE0 A;  2XGD A;  3BR3 A;  5FKO A;  2GM4 A;  4JL3 A;  1T33 A;  3JRH A;  3S5R A;  1ZR4 A;  1JKP C;  2R93 J;  3JRG A;  5C4X J;  1HOM A;  4A3C J;  1H89 C;  2OF7 A;  1UG2 A;  2XRL A;  4RBO A;  2NVQ J;  1H8A C;  1MBF A;  1TC3 C;  3PAS A;  2UXO A;  3BR2 A;  1POG A;  1O4X A;  1JKR C;  1DU0 A;  1NK3 P;  4A3K J;  2Q24 A;  4CGR A;  4ICH A;  3LSG A;  4QTR A;  3BT9 A;  3S1Q J;  3S2D J;  3VIB A;  2TCT A;  1VF9 A;  2KT0 A;  2DA4 A;  3TW7 A;  2COB A;  5CW8 A;  4LOC A;  2HXO A;  3HTJ A;  2IEK A;  1BW6 A;  1IG7 A;  2WGB A;  2DA2 A;  4M3D A;  4IHW A;  1BA5 A;  2V57 A;  5FKL A;  3Q0V A;  3UKG A;  3O8H A;  1ITY A;  1A5J A;  5K7Z A;  4M3G A;  2DA6 A;  3QPL A;  5M5Y J;  1S7E A;  3G1O A;  1GDT A;  4GFB A;  2Y31 A;  4HKU A;  3L1P A;  2O9L A;  1H88 C;  1NTC A;  2EH3 A;  3RKQ A;  3GTO J;  2ZCN A;  2HOA A;  2QCO A;  5M3M J;  3MVP A;  3JRD A;  1HLV A;  3GZI A;  3AQS A;  2ZCM A;  2HXI A;  3FK7 A;  4FCY A;  5FJ8 J;  4NN1 A;  2M2E A;  2HI3 A;  1FIP A;  3IH3 A;  4FE4 A;  3BG5 A;  5IOY A;  2JA6 J;  4BXX J;  2UXP A;  5J1R A;  2QWT A;  1ETW A;  2R5Z A;  1B72 B;  1MH3 A;  4M6V A;  5J1U A;  1WPK A;  3M3Y J;  1HCR A;  5K7H A;  4DYQ A;  4NEL A;  2DMT A;  3DPJ A;  2CU7 A;  2E1O A;  3HB9 A;  2NVX J;  2EZK A;  2K9Q A;  2EBI A;  2ECC A;  3HTA A;  2UXH A;  1W0T A;  1U9O A;  1IGN A;  4MO7 A;  4V2G A;  3AQT A;  3V6G A;  3OOU A;  1MH4 A;  3LOC A;  2XB5 A;  5HAW A;  1EF4 A;  2IU5 A;  2F07 A;  3S15 J;  2G7L A;  4XRM A;  4MFD A;  1WH5 A;  2MSY A;  2Y0S N;  1Y1W J;  1X2N A;  2WUI A;  4MK6 A;  5D18 A;  2ELK A;  2NX4 A;  2LFB A;  3GTK J;  3GTP J;  3CWR A;  1RES A;  3EGQ A;  4C3I J;  3KZ9 A;  2ECB A;  4Y7N J;  2DN0 A;  2RHA A;  4A3F J;  3HOZ J;  4A3D J;  3QPS A;  1SFO J;  1JT6 A;  1QRY A;  4V2F A;  4BY1 J;  3I4N J;  2XSD C;  2R7Z J;  3NPI A;  5IYD J;  4A69 C;  3EUP A;  3E7Q A;  4I76 A;  3QQA A;  4W1U A;  1ETX A;  2NOG A;  3VOK A;  1P7J A;  2JN6 A;  2IAI A;  2LVS A;  4QSH A;  2DMN A;  3I4M J;  3HOV J;  1LE8 A;  2WAQ N;  1NK2 P;  2G7G A;  4ME9 A;  1ZTR A;  2MGQ A;  4DZJ A;  5EZH A;  5FKM A;  4AC0 A;  3CMY A;  2CQQ A;  5E3M A;  1HF0 A;  3GEU A;  1JKO C;  2E2I J;  3Q0W A;  3S17 J;  2M8G X;  3KNW A;  2K9S A;  3B6C A;  2H1K A;  2GLO A;  3K2A A;  2DA3 A;  1DU6 A;  3NI7 A;  3LJL A;  1ZKG A;  1K83 J;  2L7Z A;  3MN2 A;  3ZQI A;  3VW0 A;  2XPW A;  1X2M A;  1WCM J;  5EF6 A;  2JA8 J;  5K7F A;  2HYJ A;  3VVY A;  5FLM J;  4GFK A;  3IH2 A;  4CYC B;  4GCT A;  3VUQ A;  5EDN A;  2E2H J;  1JTY A;  3NAR A;  5GPC A;  1BJZ A;  3CCY A;  3CRJ A;  3S14 J;  3LNQ A;  2JWT A;  3SJM A;  4XIC A;  1JGG A;  4L5E A;  3ZQF A;  1AU7 A;  1JUS A;  5F0C A;  1JKQ C;  3PO2 J;  2AHQ A;  4A3L J;  3NNR A;  3BQY A;  4HNV A;  1IV6 A;  3FKI J;  2FJ1 A;  4J19 A;  2ZCX A;  5GPA A;  2K40 A;  1GVD A;  2OER A;  2QOP A;  3HOY J;  3BR0 A;  1FJL A;  1OCP A;  1Q1V A;  4A3I J;  2VI6 A;  1GV2 A;  4A3M J;  4M3B A;  1T56 A;  4GCK A;  1IDZ A;  2NP5 A;  3RD3 A;  1Y1V J;  4BBR J;  2VKE A;  3ZQH A;  5IOZ A;  3C07 A;  3KKC A;  2M34 A;  2ME6 A;  3COL A;  4A3J J;  3FRQ A;  1FEX A;  3FK6 A;  2Y2Z A;  3RZD J;  3KKD A;  3BG3 A;  2K9N A;  5E3O A;  1ENH A;  5CXI A;  3MNL A;  2XGC A;  2HKU A;  3ANG A;  3BRU A;  1AKH A;  2CRG A;  2O8K A;  5IP9 J;  2XGE A;  2QIB A;  2R92 J;  3E7L A;  4JX4 A;  4W97 A;  4YZE A;  3VW1 A;  3H0G J;  3HOX J;  5C3E J;  5JLX A;  3BQZ A;  3JSJ A;  2LTP A;  2YU9 J;  1LE8 B;  5M5X J;  4JYK A;  4L62 A;  3QBM A;  2LP0 A;  1TWA J;  1OFC X;  3WHC A;  4B3A A;  1B8I B;  3MKL A;  2CJJ A;  2O7O A;  2RAE A;  3LSP A;  2L7F P;  4NDL A;  1OJL A;  2MW8 A;  2YUS A;  1FTZ A;  2JK3 A;  1UMQ A;  3RZO J;  3VPR A;  4UUT A;  4CYC A;  4DYC A;  4BBS J;  3A02 A;  3WHB A;  4B4C A;  4XID A;  2XB0 X;  1QPI A;  2VPR A;  3O60 A;  4KWA A;  3BHQ A;  3JRA A;  3HTH A;  4JKZ A;  1ETQ A;  1HDD C;  2YVH A;  2X9D A;  2XDN A;  2ZB9 A;  4M3F A;  3SFI A;  3NXC A;  3F0C A;  3BNI A;  4GCL A;  2WB1 N;  3A01 B;  1RR7 A;  3Q3S A;  5AQC A;  2L7M P;  1PUF B;  1WGX A;  3BTC A;  1VND A;  1MBG A;  3P9T A;  5F08 A;  4C3H J;  5FLV A;  3ZOB A;  2EZI A;  3SDG A;  3LHQ A;  1LFB A;  1HDP A;  2TRT A;  5HBU A;  3BR6 A;  2R5Y A;  3FIS A;  2GUH A;  3RH2 A;  3PPB A;  3GTJ J;  2ME0 A;  1RKW A;  2XPV A;  3JRC A;  5E3L A;  5E3N A;  3V78 A;  5C44 J;  1UI5 A;  2OI8 A;  2OPT A;  1WH7 A;  5J3L A;  2NVT J;  1ZQ3 P;  4A3B J;  1JUM A;  4D7N A;  1XC5 A;  1OCT C;  1SAN A;  3OSG A;  1D5Y A;  2KDZ A;  4ACI A;  1Z0X A;  3GTM J;  3HBL A;  2LR8 A;  4FE7 A;  2PZ9 A;  2HQ5 A;  2W53 A;  1UI6 A;  1QVU A;  4FIS A;  2RAS A;  4G12 A;  4C2M J;  3HIM A;  1UHS A;  1AKH B;  1ETO A;  1ZGW A;  1JTX A;  2JA7 J;  5F0H A;  2CUF A;  1ZK8 A;  4B1R A;  5F0F A;  2REK A;  1IJW C;  1FTT A;  3BTI A;  1K61 A;  4Y52 J;  4JX5 A;  4D7M A;  4IHY A;  2DA5 A;  2PBX A;  2YS9 A;  3GBG A;  1B8I A;  4XRS G;  2I10 A;  2Y9Y A;  1GUU A;  2N8G A;  1JT0 A;  3PM1 A;  1ORK A;  1MBJ A;  4JNN A;  4JP0 A;  4XK4 A;  1IUF A;  4XRS A;  4C3J J;  5IYB J;  1R9T J;  5K58 A;  5DS9 A;  1JUP A;  3IV5 A;  4MLO A;  9ANT A;  3BTJ A;  5IPA A;  4M3E A;  2M0C A;  5IP7 J;  3CJD A;  2M9H A;  3LSR A;  2Y9Z A;  3NRG A;  5M5W J;  2EZL A;  3G56 A;  3A01 A;  2GFN A;  2H8R A;  1W0U A;  1PUF A;  5JLW A;  3TED A;  4MIM A;  1XS9 A;  3BR5 A;  4ABZ A;  2LD5 A;  1VI0 A;  1WI3 A;  2CQX A;  3BCG A;  1P7I A;  4X1E A;  2W48 A;  1U9N A;  4IHX A;  4BY7 J;  1TWC J;  4A3E J;  1F43 A;  3QKX A;  3TW6 A;  2R5Y B;  5F27 A;  3HKZ N;  2VKV A;  1RPW A;  2LK2 A;  5F04 A;  1U8B A;  3VVX A;  3CQZ J;  1APL C;  4MFE A;  3VW2 A;  2L0K A;  1VFC A;  2HOS A;  1BW5 A;  3HDD A;  5J1Y A;  2G7S A;  3VP5 A;  4IEJ A;  3OIO A;  5D19 A;  3A03 A;  4UUS B;  2DMP A;  5M3F J;  5D1R A;  3S2H J;  3W6V A;  4QIW N;  5EG0 B;  1LFU P;  3C2B A;  3G1L A;  2B63 J;  2JMW A;  1ZR2 A;  3Q0U A;  4IHV A;  2UXI A;  1A6I A;  4S0H B;  2R0Q C;  1I6H J;  2DJN A;  1SGM A;  2MG4 A;  3O8G A;  1XG1 A;  3ZQL A;  1YRN B;  1Z77 A;  5FKN A;  4FTH A;  2D6Y A;  5FKK A;  1GV5 A;  2JJ7 A;  3JR9 A;  5FHP A;  2NS8 A;  1AHD P;  1IC8 A;  3DEW A;  3HGG A;  3GTG J;  3ON4 A;  1RET A;  2FX0 A;  3CDL A;  4BKX A;  3S1R J;  2G0E A;  1MSF C;  2P81 A;  3GTQ J;  2ID3 A;  2DG7 A;  2AO9 A;  2LY9 A;  3TP0 A;  5DTD A;  3BJB A;  4PXI A;  5EFY A;  4AUX A;  2HYT A;  4X6A J;  3VOX A;  5GP9 A;  3ON2 A;  1U78 A;  5H9T A;  4AC6 A;  3JRF A;  5EGO B;  3K7A J;  1MSE C;  3S1M J;  5DAJ A;  2FQ4 A;  5IYC J;  4I6Z A;  2GEN A;  2QF7 A;  3IUV A;  4UDS A;  2DA7 A;  3T6N A;  1MBE A;  2HOT A;  3FIW A;  1JJ8 C;  1QVT A;  2EZH A;  4RDU A;  1E3O C;  2L9R A;  1IRZ A;  3DCF A;  2CUE A;  4GFL A;  2E2J J;  3JRI A;  1BL0 A;  2VUM J;  1RKT A;  2FBQ A;  5HOD A;  2ZOZ A;  3HTI A;  2X48 A;  4UUS A;  5FGL A;  1TWH J;  3BG9 A;  5FMP A;  5IP6 A;  2JA5 J;  1G2H A;  3ZQG A;  2NP3 A;  3D1N I;  2EQR A;  5EG0 A;  2ZOY A;  3HOW J;  4DZP A;  2WV1 A;  4A93 J;  5CXG A;  3GTL J;  1FIA A;  2LKX A;  5HSZ A;  3PO3 J;  1IDY A;  3RQI A;  5C4Y A;  3BTL A;  3HEF A;  5C4J J;  3HM5 A;  2DTZ A;  1ETV A;  1TWG J;  3S16 J;  2X6O A;  2YVE A;  1MNM C;  4AF5 A;  3TP3 A;  1ETY A;  5EEA A;  1YRN A;  3ZQC A;  2D5V A;  2UXU A;  5EZG A;  2IBD A;  2G3B A;  4EEF G;  2LLK A;  3M4O J;  3ANP A;  4AYB N;  1MBH A;  2FD5 A;  3B6A A;  3G7R A;  3BR1 A;  4DW6 A;  3HOU J;  4MXM A;  2DMQ A;  1JJ6 C;  2XPU A;  1CQT A;  4A3G J;  4D5C A;  1GT0 C;  2QTQ A;  3F1B A;  3VVZ A;  3H3V K;  3OSF A;  2HDD A;  2PMZ N;  5F1J A;  2Y30 A;  1ETK A;  1I3Q J;  2NS7 A;  3NAU A;  2GBY A;  5EGO A;  2O7T A;  3LWJ A;  3JRE A;  4DYR A;  3LSJ A;  2DA1 A;  3HGY A;  5BNG A;  4D5F A; 
#chains in the Genus database with same CATH topology
 2DQL A;  3CUQ C;  2CV0 A;  1N25 A;  2ID6 A;  4EVI A;  1J75 A;  3ONQ A;  3MFK A;  2XKP A;  3GFJ A;  2QBY B;  1VQL I;  3JRB A;  2GAU A;  3DV8 A;  3I58 A;  3G1M A;  3FBI B;  4KIS A;  5EYR A;  4JX6 A;  2LF7 A;  4U0Y A;  5ERI A;  3BR3 A;  2R93 J;  1A35 A;  4A3C J;  2NVQ J;  4BE2 A;  3DPU A;  3BPX A;  3F8F A;  4HYE A;  3WU0 A;  1YW7 A;  4EQQ A;  1MBF A;  1IRG A;  1TC3 C;  4KA4 A;  3SEQ A;  2DTR A;  2UXO A;  1O4X A;  2CUJ A;  4NUB A;  1R6R A;  5LRR A;  4LLL A;  4EM2 A;  3G3Z A;  1J2X A;  2Q24 A;  3LSG A;  3BT9 A;  3K1N A;  2OCE A;  2QSG X;  1TW2 A;  3ZMV A;  4QPO A;  1SC7 A;  2CGP A;  3VIB A;  2KL4 A;  3E97 A;  2VBX A;  4RM3 A;  4MGR A;  2IS6 A;  2YX7 A;  3DWL E;  4L18 B;  4XON A;  3KYL A;  1XSX A;  1KA8 A;  1N77 A;  1QHG A;  3CLQ A;  5DEQ A;  1BW6 A;  5BOX A;  2W84 A;  1Z6T A;  4IRG A;  2W57 A;  1R5H A;  2LG4 A;  3HRM A;  3JW4 A;  2BEO A;  3PFI A;  3MD2 A;  1E17 A;  2HYF A;  3HYI A;  2DA6 A;  3LQR A;  5DM7 F;  5M5Y J;  3G1O A;  1UCR A;  5L3C A;  4XLE A;  4HKU A;  4BU2 A;  5H6Q A;  5J4Y A;  1F5T A;  1QA6 A;  2ZCN A;  2E71 A;  3RPU A;  3GZI A;  3CCL I;  4ESJ A;  2HXI A;  3PIO F;  2VOD A;  3HIF A;  2M30 A;  3BZK A;  3VOD A;  2M2E A;  4LFU A;  4LK1 F;  2A3S A;  2XAG A;  4X0G A;  2UXP A;  1H0M A;  4AM3 A;  5J1R A;  3BP8 A;  3JSO A;  2R5Z A;  2R7T A;  1J0R A;  1XX5 A;  5J1U A;  3A4C A;  1HCR A;  3DF8 A;  1WJA A;  2RV8 A;  4E7I A;  2DMT A;  5IT9 Z;  3K9T A;  4XM3 A;  1MJB A;  1OR7 C;  1YO5 C;  1PP7 U;  3FM5 A;  1FOX A;  4BXU A;  1B6A A;  1U9O A;  4OOI A;  4V2G A;  4HV6 A;  3OOU A;  3LOC A;  2IU5 A;  1FBQ A;  2F07 A;  1X1A A;  5J8C A;  5KAI C;  2Y0S N;  2HZD A;  2WUI A;  3IKT A;  5L3B A;  4WWC A;  5D18 A;  3DP7 A;  3GTK J;  3MMY B;  1ONV A;  3AG2 H;  2Z1D A;  2ECB A;  2EIN H;  3EET A;  3PNY A;  1U5T B;  4A3F J;  3HOZ J;  3E5U A;  2M8E A;  4ZTF A;  3GME A;  3GEZ A;  2XUB A;  2HTS A;  1JT6 A;  3ZN0 A;  3I4N J;  4L5I A;  3B02 A;  1GVJ A;  3O3K A;  3LQQ A;  3OR1 C;  4I0A A;  3H5A A;  3HG9 A;  2H27 A;  2HKO A;  4HX4 A;  4I76 A;  4E4H A;  1SAX A;  3VOK A;  2DAO A;  3J80 Z;  2JN6 A;  1YI2 I;  3KYC B;  2IAI A;  3VYU B;  1YLF A;  3VYR B;  3ZCO A;  3I4M J;  4XLF A;  2WAQ N;  2VPL A;  2G7G A;  1KU3 A;  4ME9 A;  3VDX A;  5FKM A;  2RC4 A;  3CMY A;  1SFE A;  5E3M A;  3GEU A;  3MKZ A;  4II3 A;  1JKO C;  2H94 A;  2DPD A;  3EUA A;  2K9S A;  3F3X A;  1HA8 A;  4JBA A;  3WGG A;  4GGG A;  2JUG A;  2F5F A;  5K5O A;  3OYI A;  3F6V A;  3NWT A;  5EF6 A;  2E5Z A;  3D5S C;  4M71 A;  4G94 A;  2ZSH B;  3PSF A;  2E2H J;  2P5V A;  5GPC A;  3LWF A;  3CRJ A;  1I39 A;  4RA2 A;  3S14 J;  2JWT A;  3SJM A;  3H1C A;  2DYR H;  1OYY A;  3H5N A;  2ZC2 A;  3PO2 J;  4WXH A;  3H5R A;  5E1W A;  3BQY A;  4U7D A;  1R49 A;  2K9M A;  1IV6 A;  3FKI J;  2FXA A;  4J19 A;  4PK4 A;  2ZCX A;  4O5V A;  3E1S A;  1GVD A;  1U5T C;  1O3S A;  3H3Z A;  3OOP A;  4G9Y A;  1MMS A;  1OCP A;  4A3I J;  1T56 A;  2LKP A;  4U88 A;  1MND A;  2KP6 A;  3AKZ A;  2DK5 A;  2Z2S B;  2NP5 A;  2R4G A;  4XNF A;  4OD4 A;  2OU2 A;  1EH7 A;  3ZQH A;  1LVA A;  2R7S A;  4UVC A;  2F5E A;  2P8T A;  4LMY A;  4IO9 F;  1FEX A;  2Y2Z A;  2E1N A;  2OZU A;  3BG3 A;  4LIU A;  3V7S A;  2XGC A;  2HKU A;  3ELK A;  3ANG A;  3BRU A;  1AKH A;  1DQU A;  3CCE I;  2EK5 A;  2CRG A;  4M6Y A;  2PLY A;  1OYW A;  3RJP A;  4LG0 A;  2R92 J;  3CES A;  4KIF A;  4JX4 A;  4W97 A;  3H0G J;  1N75 A;  2E34 A;  5JVT A;  2ISY A;  2ZME B;  2LTP A;  4A0Z A;  3SWH A;  2X6X A;  3PL8 A;  4LGW A;  4JYK A;  1V5F A;  2WWY A;  1TWA J;  2WAF A;  3K70 C;  1A31 A;  2CJJ A;  2NRA C;  4KIC A;  4PUS A;  3LSP A;  3ASO H;  4LLG F;  4NDL A;  2MW8 A;  3LST A;  3PSI A;  2ZO4 A;  5AON A;  3SQN A;  3VPR A;  4UUT A;  4CYC A;  4XID A;  3DBH B;  4DVY P;  2OUM A;  3RCO A;  3BLY A;  2DOF A;  5TGT A;  3HTH A;  1KYW A;  3QAH A;  1MMN A;  2X9D A;  4RLF A;  4HF2 A;  5GTH C;  1IN4 A;  3SFI A;  1KQ0 A;  3RI4 A;  2CH0 A;  4GCL A;  2M3A A;  2WB1 N;  3CP8 A;  3R0J A;  3Q3S A;  5AQC A;  2K02 A;  4BEH B;  2YPR A;  3EPZ A;  1B1B A;  1T8I A;  2P6T A;  3SDG A;  3P7N A;  3BR6 A;  2GUH A;  1OCO H;  3FIS A;  3CME I;  4D1Q A;  3PPB A;  3FXQ A;  2ME0 A;  1RKW A;  5CVI A;  3RD3 A;  1D8K A;  4Q48 A;  2L9V A;  2QUF A;  2B9S A;  4A6E A;  2DOE A;  3CMA I;  1XC5 A;  4ITV A;  1V5G A;  3EDP A;  2LSO A;  3P9I A;  2LBF B;  4NC6 A;  1Z0X A;  2ZME C;  4IRV A;  2LR8 A;  2PZ9 A;  2HQ5 A;  2RAS A;  2ISZ A;  1UHS A;  2A2F X;  5E20 A;  1AKH B;  4OAZ A;  2F2E A;  4AYB A;  5F0H A;  1SD4 A;  1ZK8 A;  4B1R A;  5F0F A;  3F8C A;  2VN2 A;  3ABT A;  1Z21 A;  4B8X A;  1A6Q A;  4Y52 J;  4IHY A;  2VON A;  1B8I A;  1J09 A;  2X1C A;  4DNC A;  1S8N A;  2Y9Y A;  1OLT A;  1K78 B;  5DV5 A;  1J5Y A;  2F4M B;  3K69 A;  3VWB A;  4JP0 A;  4DQ2 A;  3WTU C;  5IYB J;  2L9S A;  5K58 A;  2E7W A;  2A05 A;  1LVK A;  4PCQ A;  2EFP A;  2EIM H;  4CH7 A;  1ZGA A;  2IS2 A;  2ZKZ A;  4LG3 A;  2M0C A;  4I99 C;  1FYM A;  3CJD A;  1CGP A;  1X3W B;  5M5W J;  1LQ1 A;  2GFN A;  1A36 A;  2H8R A;  1E0E A;  2F6C A;  3ZRG A;  5HLG A;  3S2W A;  3ZQ7 A;  1PUF A;  3TED A;  2HEO A;  2CYY A;  4MIM A;  2VLA A;  5D5W B;  5LLQ A;  2CQX A;  3TO6 A;  2QSF X;  1UAA A;  1P7I A;  3PQJ A;  2BXZ A;  4X1E A;  2W48 A;  4Y13 A;  2HPI A;  3L09 A;  4BY7 J;  4A3E J;  2FJI 1;  1F43 A;  3QKX A;  2V9P A;  3WG9 A;  3H9Q A;  3OL3 A;  1YQA A;  4P9U A;  4XLC A;  2FE3 A;  1U8B A;  3VVX A;  4MFE A;  3G71 I;  1VFC A;  2EB7 A;  1BW5 A;  4CDG A;  1YX5 A;  1R5I D;  3HJE A;  3CCS I;  3A03 A;  1MKM A;  4LD5 A;  1IZ1 A;  4MHG A;  5D1R A;  1Z6R A;  4BJT A;  3ZN1 A;  2GA1 A;  1U0J A;  2FEZ A;  3G1L A;  2B63 J;  2VQL A;  3R0A A;  3SFZ A;  3CJQ B;  1VQN I;  1A6I A;  1UST A;  3HXL A;  2WA0 A;  2R0Q C;  2L4A A;  5LRS A;  4KT6 A;  2DJN A;  1HBX G;  1X3Z B;  2MG4 A;  5L3E A;  1EKE A;  4BQA A;  1XG1 A;  3V8L A;  1Z77 A;  4FTH A;  3RKY A;  1R71 A;  5E17 F;  4DBR A;  5D5V B;  3BZC A;  3KP6 A;  1GV5 A;  2IVM A;  2MLG A;  1I1G A;  3GW2 A;  2CUZ A;  3KCC A;  2P5L C;  4Y33 A;  2GOX B;  1AHD P;  5J6X A;  4Y17 A;  4FQG A;  2QEN A;  2CO5 A;  3LSM A;  2HDC A;  4E70 A;  3FX3 A;  1RET A;  2FX0 A;  2LDU A;  3CDL A;  3S1R J;  2ICW G;  3SXY A;  2G0E A;  2FBI A;  5E8G A;  3L9F A;  3FHZ A;  3HOT A;  1FMW A;  2DG7 A;  2LY9 A;  4KT5 C;  4KUM A;  1Z1D A;  5DTD A;  1XCB A;  5GAE J;  3MKY B;  4G7Z F;  2XGX A;  2DFH A;  2PFB A;  3IP4 B;  3QU3 A;  1U78 A;  5H9T A;  4L9V A;  5EGO B;  2MAB A;  4XOT A;  3IUO A;  1MSE C;  5DD8 A;  2FQ4 A;  5ICF A;  4PFP A;  5JHF A;  1SD5 A;  3KPH A;  1QVT A;  4RDU A;  1E3O C;  4D9J A;  4NQW B;  1TP4 A;  2DI3 A;  4KIG A;  2JPC A;  2QKL B;  2GWR A;  3J81 Z;  2Z3Y A;  3W2W A;  2GXG A;  3E6D A;  3TBI A;  2E2J J;  1FBU A;  3L2V A;  4P9F A;  4YFX F;  1BL0 A;  4F3Q A;  3M8F A;  2PFV A;  1BR1 A;  1RKT A;  4RB2 C;  4EJT A;  2B3W A;  2L4M A;  4UUS A;  5FGL A;  4HNU A;  4IKF A;  4BUP A;  2AS5 F;  2JA5 J;  3J7A Y;  1BR4 A;  3D1N I;  2RKH A;  2Z5U A;  3LFU A;  4RMN A;  3C1D A;  3HPG A;  3DTI A;  3HOW J;  3S3O A;  2ZOY A;  4A93 J;  4F7Z A;  5L3D A;  4G7H F;  5HSZ A;  5C4Y A;  1KQ9 A;  3HTS B;  1D5V A;  3RPQ A;  4V19 K;  3HM5 A;  2DTZ A;  2YVE A;  2X6O A;  1OYI A;  5D6E A;  3CO6 C;  1I1S A;  1B9N A;  3JTG A;  3I4P A;  1MNM C;  3K10 A;  3TP3 A;  1O3Q A;  1YRN A;  2D5V A;  3EYI A;  4KN7 X;  3WTS C;  2G3B A;  3ANP A;  2YR2 A;  3IKV A;  2NNN A;  5KCM A;  2E5N A;  3V8J A;  3NQO A;  4ZYE A;  4LB5 A;  3DLL F;  4E7J A;  2VJ5 A;  5LHH A;  4L0Z B;  2KRC A;  3QP5 A;  5LHI A;  2PMZ N;  1J59 A;  2V79 A;  2Y30 A;  5A2Q K;  3H9G A;  3MCZ A;  1AWC A;  2HQA A;  3HUG B;  1X4O A;  3NAU A;  1BC7 C;  3R6S A;  5CVR A;  3JRE A;  3ZR8 X;  2O8X A;  3JRD A;  3HGY A;  4RM2 A;  4F91 B;  4L9J A;  3IRQ A;  3OL4 A;  2E19 A;  1UJ8 A;  1NH3 A;  3QP6 A;  2XC7 A;  3CDI A;  1I50 J;  3S1N J;  2QKO A;  2QQB A;  3IH4 A;  2KRH A;  4BQN A;  1R1U A;  2OCC H;  3CUQ A;  4XN0 A;  1PDN C;  2GM4 A;  1OQY A;  4KJZ A;  2HPM A;  3S5R A;  1ZR4 A;  3NS4 A;  1JKP C;  3OYB A;  4F55 A;  2RQP A;  3JRG A;  5C4X J;  3FHN A;  2XRL A;  5CQG A;  4E7Z A;  4DGW B;  4YRV A;  1H8A C;  2IGK A;  1IAW A;  1POG A;  1DU0 A;  1NK3 P;  1TQP A;  2BY2 A;  4IPA A;  4A3K J;  5BS6 A;  5E8I A;  4OIO F;  2M45 A;  3S1Q J;  1DP3 A;  3LA2 A;  1G8X A;  1V4R A;  1M1E B;  4BJ5 C;  3S2D J;  3KP3 A;  2YX4 A;  2BHY A;  1R4N B;  3WTW C;  2WY7 Q;  4BS9 A;  1QZE A;  2JSP A;  2RNJ A;  5ICC A;  5CW8 A;  4O3M A;  4LOC A;  5HVQ C;  5HS9 A;  1F4K A;  4EGZ A;  3K4C A;  2R7R A;  1XCV A;  3IAS 2;  4RGS A;  2IEK A;  5HLI A;  3WTY C;  3BJ6 A;  3A0H C;  4TV7 A;  1X1B A;  1L0O C;  2HR3 A;  3EUK L;  4ESB A;  3OYF A;  3HL2 A;  1IG7 A;  1IN7 A;  2V57 A;  5FKL A;  3Q0V A;  3UKG A;  3IWZ A;  1LEB A;  1ITY A;  1A5J A;  4NBQ A;  1KZH A;  3FF5 A;  2W82 A;  1GDT A;  1WJB A;  2RDP A;  3T8T A;  1LDJ A;  3VYS B;  1H88 C;  1NTC A;  3RKQ A;  1HW5 A;  3K4B A;  1OCZ H;  2HOA A;  5M3M J;  4RAG A;  4O6J A;  3AQS A;  2WTE A;  5CPR B;  4FCY A;  5FJ8 J;  3RKX A;  2GA2 A;  4DBQ A;  2NXN B;  2QQA A;  1Y6I A;  1Y0U A;  4RLQ A;  1EV7 A;  3IH3 A;  3QYB A;  5IOY A;  1XSD A;  2JA6 J;  3OS0 A;  4OAY A;  4XN3 A;  3F23 A;  2QBY A;  4ENN A;  2PMH A;  3GO5 A;  4M6V A;  1WPK A;  3M3Y J;  2YSR A;  2K5C A;  1YJN I;  4Q5S F;  3LA3 A;  4ZC3 A;  1S29 A;  1W1W E;  4B48 A;  2NVX J;  4CCJ A;  2OC6 A;  2EZK A;  3OYC A;  2CFX A;  1W0T A;  1TQM A;  4NC7 A;  3J7Y J;  5FLX Z;  1VQ9 I;  1S6L A;  1R1T A;  2DO7 A;  2M4K A;  3AQT A;  1UHM A;  3V6G A;  1MH4 A;  2JSC A;  2XB5 A;  5HAW A;  1OCC H;  3ZMZ A;  4CCO A;  1YIT I;  2G7L A;  1E3H A;  1ULY A;  3P9K A;  1WSU A;  2V1U A;  1Y1W J;  3KE2 A;  2ELK A;  2NX4 A;  2LFB A;  3GTP J;  3CWR A;  1RES A;  3W3C A;  4A3D J;  4WXC A;  3HPH A;  3IC7 A;  1DUX C;  5K5R A;  4BY1 J;  3OIP A;  3GZ5 A;  4A69 C;  3G2B A;  3QQA A;  2CWE A;  1ETX A;  4HV5 A;  2NOG A;  1LNW A;  2LKS A;  2R7X A;  2IGN A;  4ESF A;  3VYT B;  1T95 A;  3PFY A;  1LB2 A;  3F8N A;  3REO A;  2EPF A;  1ZTR A;  4DZJ A;  5HOO A;  4UV9 A;  1O3T A;  3DTE A;  3H9J A;  3PNV A;  1HF0 A;  2QSH X;  2E2I J;  5BPD A;  3M7G A;  4XOP A;  2QQ9 A;  3V4G A;  2H1K A;  1LKX A;  4I2O A;  2GLO A;  1SAU A;  2DA3 A;  2LY1 A;  2DU9 A;  3N97 A;  1QBJ A;  1ZKG A;  2L7Z A;  3I59 B;  3MN2 A;  4N4N B;  3BJO A;  2GXA A;  4CGZ A;  3DPL C;  4HQE A;  2CSO A;  3BZ6 A;  1KYZ A;  2HYJ A;  4WIB A;  1DDN A;  1R23 A;  2FRH A;  3G73 A;  3DBL B;  4EM0 B;  5CQE A;  3ZMS A;  5EDN A;  2VL8 A;  1JTY A;  3JAM Z;  1ZRD A;  3FKJ A;  3CCY A;  3LNQ A;  3K4M A;  3CMM A;  3ZQF A;  1JUS A;  5F0C A;  1JKQ C;  2H6C A;  4ZDL A;  1D1B A;  3HKZ A;  2FJ1 A;  5D5X B;  4HA8 A;  3V7R A;  3HTU A;  2MLK A;  2OER A;  1FJL A;  2QLZ A;  1KON A;  2L3D A;  2VI6 A;  4C9Y A;  1BI1 A;  1S72 I;  1GV2 A;  4KNY A;  4GCK A;  2KHM A;  4GYG A;  2HTJ A;  4Z6Y A;  1IF1 A;  3AL0 C;  1U5T A;  1IDZ A;  3RQ4 A;  2WAE A;  5B66 C;  4XLA A;  4Q47 A;  3GFM A;  1Y1V J;  2VE8 A;  2EWN A;  3QOD A;  4E7S A;  2ZJ2 A;  4JQF A;  5DUK A;  4A3J J;  3FK6 A;  2DOD A;  3KKD A;  2E7X A;  1YX3 A;  2K9N A;  2Q0O A;  3KX2 A;  2WC2 A;  2YU3 A;  1UEL B;  3ESW B;  4LJZ F;  1YW8 A;  3QOE A;  5B1A H;  2QIB A;  3E7L A;  4XKW A;  4KMF A;  5CVJ A;  3RYR A;  5C3E J;  1G3W A;  3JSJ A;  3HSE A;  4YFK F;  5M5X J;  3D0S A;  1D1C A;  1FLI A;  4L62 A;  2LP0 A;  3FXL A;  1R5G A;  4B3A A;  1K6O A;  2TDX A;  4HW0 A;  1YJ9 I;  2L02 A;  5ICG A;  2FF4 A;  2RAE A;  2L7F P;  1QPM A;  2LRE A;  4XR6 A;  4B3X A;  4ZH4 F;  3RZO J;  3JTH A;  4BBS J;  4B4C A;  4H0E A;  4S04 A;  2GIV A;  1QPI A;  2VPR A;  1P2F A;  3O60 A;  1MMG A;  4OMY A;  3F8M A;  1LEA A;  4F92 B;  2P5K A;  2COM A;  2XAF A;  2WBM A;  1W5C C;  2O03 A;  3JRA A;  4JKZ A;  3CDH A;  2ZB9 A;  3MWM A;  4PJ0 C;  1DPR A;  4OD5 A;  4LIV A;  2K27 A;  3F0C A;  3SYT A;  2VC1 A;  2IRF G;  3WTV C;  2CV2 A;  1FSE A;  2EA4 A;  3K4J A;  3R60 A;  2L7M P;  1FYL A;  1BC8 C;  1NG7 A;  4HQM A;  1TT0 A;  3P9T A;  2EA2 A;  5FLV A;  3TGN A;  1K4S A;  2TRT A;  3LHQ A;  2R5Y A;  3GYH X;  2XPV A;  3JRC A;  5E3L A;  2FNA A;  5C44 J;  1EJ9 A;  2OI8 A;  4EJO A;  5J3L A;  2NVT J;  2DCE A;  2X6W A;  2BOL A;  1ZQ3 P;  4YEJ A;  3MEX A;  5LHG A;  2D2W A;  2KIS A;  2LH9 A;  2KDZ A;  1D5Y A;  4ACI A;  3HBL A;  4FE7 A;  2VC0 A;  1QVU A;  4G12 A;  4CCK A;  3HIM A;  3CC7 I;  4XOR A;  2BE5 F;  2DW4 A;  2FOW A;  2JA7 J;  4BNC A;  2ZME A;  3SZG A;  5IT3 A;  2Z33 A;  3BTI A;  2VT3 A;  3ECH A;  1K61 A;  4BQQ A;  4D7M A;  2XF6 A;  4EAT A;  2FNP A;  5DD4 A;  1YTY A;  1W4M A;  1FOY A;  2I10 A;  3M1E A;  5B5E C;  1D0X A;  1Y8R B;  1MBJ A;  4JNN A;  1KGS A;  2ZXW H;  2P6S A;  1WJ5 A;  2JRM A;  4XRS A;  4C3J J;  3GVA A;  2IP2 A;  1QHH D;  4MLO A;  9ANT A;  3BTJ A;  2OV7 A;  5IPA A;  4M3E A;  1BI3 A;  3KEQ A;  4HSR A;  4LLN A;  4HX8 A;  4BHP A;  1G3S A;  2LNB A;  2M9H A;  5H2F C;  3HOS A;  2K4J A;  4XLN F;  3DKX A;  1W0U A;  2HVR A;  4BEH A;  2ZNZ A;  1XS9 A;  5ILV A;  1QU3 A;  2LMD A;  1VI0 A;  1BM9 A;  3DEU A;  1BN5 A;  1JGS A;  3OYM A;  5F6F A;  2QA4 I;  2JTV A;  1ZG5 A;  2LY2 A;  4CUG A;  2R5Y B;  2Y0M A;  1UZC A;  3L2R A;  2L9N A;  3H92 A;  3VSK A;  2VOP A;  2VKV A;  3E5Q A;  4GCV A;  3CQZ J;  3VW2 A;  2L0K A;  2LBF A;  1SMY F;  3K4K A;  3DFG A;  5J1Y A;  4XMY A;  2G7S A;  3MKW B;  3VP5 A;  5D19 A;  4XKC A;  2M0M A;  2FBK A;  1Y8Q B;  2NOJ B;  2QEX I;  3S2H J;  1AOY A;  1MDM B;  2BYV E;  2O6G E;  1XSV A;  3FMR A;  3C2B A;  4KYW A;  3Q0U A;  3MZY A;  3FM3 A;  2HDW A;  5H6R A;  5D4S A;  1AA7 A;  2R7Q A;  1KQ8 A;  1K78 A;  1SGM A;  2KDO A;  3O8G A;  1FT9 A;  3FXK A;  4CSW A;  1HST A;  5JHU A;  2D6Y A;  2V26 A;  4HLX A;  2BGC A;  3QWL A;  3ZGK A;  5FB2 A;  5FHP A;  3T8R A;  1ZRE A;  2DPU A;  3F21 A;  4ASN A;  3GTG J;  4C2M A;  3L2Q A;  4BKX A;  3W6K B;  1FYK A;  2NS0 A;  3TKY A;  1FMV A;  4HRI A;  2GQQ A;  3OYH A;  2ZSI B;  3DXJ F;  2HYT A;  4X6A J;  4MQV A;  2ZJP F;  3DU6 A;  3LL7 A;  5E1Z B;  1HKS A;  3SZP A;  2A69 F;  3ERE D;  2D45 A;  4HST A;  3J81 K;  3SHF A;  5CVU A;  2CQN A;  3M8J A;  1LDD A;  3S1M J;  5DAJ A;  4UDS A;  2UV1 A;  1MBE A;  2VE9 A;  3FIW A;  3HRS A;  4AVP A;  5F64 A;  5LGT A;  4CYD A;  3DCF A;  2RN7 A;  4GFL A;  1TNT A;  2CS3 A;  1PP8 F;  2XRN A;  3PUB A;  2Y0S A;  4BAY A;  2DT7 B;  5DYM A;  2FBQ A;  2ZOZ A;  1T08 B;  3HTI A;  4I02 A;  2X48 A;  2X1D A;  2ZFU A;  1TWH J;  3TQN A;  4CXF A;  3FDY A;  5LBQ A;  2W7N A;  5IP6 A;  2NP3 A;  2BBY A;  2EFO A;  2EQR A;  4C2T A;  4OIP F;  2VJI A;  4DZP A;  4II2 A;  5JR3 A;  5FFZ A;  3GTL J;  1FIA A;  2LKX A;  3PO3 J;  1IDY A;  3M1C A;  1K6Y A;  3BTL A;  3HEF A;  2PG4 A;  3PNT A;  1TWG J;  1VTN C;  3S16 J;  3OYE A;  3SEZ A;  2Z16 A;  2KFD A;  4AIH A;  3WTT C;  3CCQ I;  1ETY A;  3H35 A;  3GFI A;  2WAQ A;  3RSN A;  2LLK A;  4PSX A;  1QO0 D;  1MBH A;  2E35 A;  1XGO A;  3G7R A;  3HOU J;  2OTL I;  2DMQ A;  2M4G A;  3ULQ B;  5GAD J;  4XSX F;  1JJ6 C;  2OBP A;  2XPU A;  3O2P E;  2FML A;  4U87 A;  1CQT A;  3BRO A;  1GT0 C;  3F1B A;  5HDN A;  3VVZ A;  4PDK A;  3SDB A;  3BWG A;  1XPX A;  3H3V K;  3OSF A;  4ZZL A;  2A07 F;  4HDV A;  1PJR A;  2VBY A;  5F1J A;  2MFZ A;  1UFM A;  4N0B A;  2Y75 A;  2J5P A;  3ZQQ A;  4R79 A;  2WY8 Q;  5EGO A;  2O7T A;  1K4T A;  2JT1 A;  2GOM A;  4IQJ A;  3OV8 A;  3HC7 A;  4I01 A;  4OIN F;  5BNG A;  5JLW A;  3I55 I;  3KNW A;  4MQ9 F;  4L0Y B;  2O61 A;  2W25 A;  1R58 A;  2VKH A;  4NQW A;  4YIR X;  3H36 A;  2DMU A;  4DJA A;  3CC2 I;  1TWF J;  2DG8 A;  3B81 A;  1MBK A;  4WCG A;  2V1N A;  5J47 A;  1J9I A;  4GYI A;  5ILS A;  4JL3 A;  5FKO A;  1T33 A;  1Q1H A;  1BIA A;  1YFH A;  2MA3 A;  1FNN A;  4E7L A;  3F72 A;  2OF7 A;  1MGT A;  1UG2 A;  5ED4 A;  4RBO A;  3OYA A;  1ACI A;  3KEY A;  4BHC A;  1Z7L A;  3DBR B;  4M6X A;  4ZYG A;  1ZRF A;  2A68 F;  3PAS A;  3BR2 A;  5LGU A;  2VKD A;  1TZL A;  1XGM A;  2I8D A;  4ICH A;  4QTR A;  2RRE A;  2W24 A;  3KP5 A;  3FMS A;  2EJR A;  3F8B A;  3KP7 A;  2M7B A;  4AU7 A;  2QM3 A;  5JI6 A;  1U2W A;  3LSH A;  1B4A A;  2KT0 A;  3TW7 A;  1RI7 A;  1YHQ I;  2COB A;  3TO7 A;  3ZXS A;  1PUE E;  2CW8 A;  3TDU C;  3E3V A;  2H1L A;  4HZF A;  2HXO A;  3BG7 A;  3CCU I;  3CO7 C;  2Z9O A;  2KJB A;  4WXD A;  1ZGJ A;  2DA2 A;  3O8H A;  1IN5 A;  2XVC A;  4CCL A;  2RQQ A;  4M3G A;  5K7Z A;  2ZY9 A;  3QPL A;  1S7E A;  4P96 A;  1XTA A;  1CF7 B;  3K2Z A;  2O9L A;  4IVN A;  3RKW A;  4QWQ A;  3HUG A;  3MVP A;  2QVO A;  1HLV A;  2ZCM A;  2XF5 A;  3FK7 A;  1T0F A;  4NN1 A;  2WAD A;  1R7J A;  1WI9 A;  2OQG A;  2V1D A;  5J8F A;  4OIR F;  1W5T A;  2HI3 A;  4P55 A;  1FIP A;  4FE4 A;  3BG5 A;  3EYY A;  1ZG1 A;  1DPU A;  1ERD A;  2QWT A;  3K0L A;  1ETW A;  1MH3 A;  2F48 A;  2BVL A;  2JA2 A;  4OU0 A;  3L7W A;  5FLX K;  5HDK A;  3DU5 A;  1PVE A;  4DYQ A;  5K7H A;  3LAP A;  4IOC F;  4NEL A;  2PQ8 A;  4JK1 X;  5KVR A;  2JQ7 A;  3DPJ A;  2E1O A;  1X1C A;  3HB9 A;  4YII A;  2E1C A;  3GZN B;  3LMM A;  1UG0 A;  2K9Q A;  4MNU A;  1P9Q C;  3LSK A;  4A5N A;  5FRM A;  1IGN A;  1S5L C;  4MO7 A;  3OY9 A;  3KP2 A;  3Q9S A;  4BAC A;  3PQK A;  3KLN A;  1EF4 A;  3S15 J;  3CUO A;  4C30 A;  2GZW A;  2UXX A;  1DGW Y;  4MFD A;  2MYS A;  1WH5 A;  2MSY A;  3FXR A;  3I9V 2;  1X2N A;  2W4S A;  4MK6 A;  5L3F A;  3HHG A;  4BGD A;  2IPQ X;  2XIG A;  4LIT A;  4C3I J;  3KZ9 A;  4Y7N J;  2DN0 A;  5DM6 F;  4ENM A;  1G4D A;  4QPQ A;  1XMX A;  3FZV A;  1QRY A;  2CW7 A;  4V2F A;  3S3N A;  2XSD C;  3NPI A;  5BQT A;  3EUP A;  1GXP A;  1MW7 A;  2DJI A;  2KPM A;  3KZI C;  4W1U A;  3TMO A;  1P7J A;  4OWR B;  2V6C A;  4QSH A;  2DMN A;  1JE8 A;  5E18 F;  4K2E A;  3PIP F;  2X6Y A;  1NK2 P;  4ZYH A;  2MGQ A;  1QNT A;  4CA0 A;  1R22 A;  1OPC A;  2CQQ A;  1GHC A;  2VBZ A;  4M72 A;  3Q0W A;  3S17 J;  2M8G X;  5FD6 A;  4BHB A;  4U7B A;  3MZH A;  2A61 A;  2L54 A;  3K2A A;  1YIO A;  3NI7 A;  4E7H A;  1K83 J;  2D1H A;  5DCM B;  3JAM K;  3ZQI A;  3LFK A;  2I5U A;  2XPW A;  1X2M A;  1WCM J;  4H4K C;  5K7F A;  5ILU A;  2NNY A;  3IRR A;  4KIT B;  3PJR A;  5FLM J;  5CYV A;  2JA8 J;  2DQR A;  1FP1 D;  3OYJ A;  3ASN H;  2O3F A;  3GXO A;  3TDZ C;  3J7A O;  3WE2 A;  3ROU A;  2HVS A;  2P0W A;  1KU2 A;  1MD0 A;  3FBN B;  3K1M A;  1W7P D;  4EV0 A;  4XIC A;  4L5E A;  1AU7 A;  2FQ3 A;  2AHQ A;  3NNR A;  4PJM A;  2EIK H;  3QU6 A;  4F93 B;  3P9C A;  4L9T A;  1REP C;  2DT6 A;  5GPA A;  4FHT A;  2EV6 A;  2VQC A;  3BR0 A;  4CO8 A;  1JI8 A;  1KU9 A;  1ZLJ A;  2DFF A;  2X85 A;  4M3B A;  1IXR C;  2EFN A;  1QQI A;  4BJ6 C;  1BI0 A;  1U3E M;  4IF4 A;  1B59 A;  1JHH A;  1FX7 A;  1NG6 A;  2CMP A;  2VKE A;  4G6Q A;  5CLS A;  4BBR J;  5IOZ A;  3OYD A;  3C07 A;  1D3Y A;  1S7A A;  3HHH A;  3GX4 X;  3COL A;  3FRQ A;  3RZD J;  4PJN A;  3DKY A;  4R1H A;  5CXI A;  3MNL A;  3U1K A;  1YE9 A;  2GXB A;  2E1M B;  2ZXJ A;  1USS A;  3OYK A;  5IP9 J;  2XGE A;  4I09 A;  4UV8 A;  3TL4 X;  3D5L A;  5F1R A;  1T6S A;  1P6R A;  3VW1 A;  3HOX J;  4IJA A;  4XRF A;  3S8P A;  5JLX A;  4AWX B;  2K7L A;  2HZT A;  5GTI C;  1T0F C;  2R7U A;  1JHF A;  2YU9 J;  4IRH A;  5HS7 A;  1TLH B;  2ZFW A;  2VAS A;  2DFE A;  2R7V A;  2F4O B;  3WHC A;  4IX7 A;  1ON1 A;  3I59 A;  3MKL A;  3TOA A;  1OMI A;  4IOA F;  2VB6 A;  1FWZ A;  1IV8 A;  2B0L A;  1FTZ A;  4U0W A;  4NHJ A;  1OCR H;  1UMQ A;  2BHZ A;  1GXQ A;  3KEO A;  2UZK A;  2VXZ A;  3WHB A;  4S05 A;  2XB0 X;  4M74 A;  1IUY A;  2FA5 A;  3TOB A;  2HGC A;  2IA1 A;  3BHQ A;  4E6K G;  3W2V A;  2EIL H;  3VOE A;  2BW3 B;  3KZZ A;  1ETQ A;  3DPT A;  3OWT A;  4A6D A;  1HDD C;  1SVL A;  2YVH A;  1WJC A;  2X4H A;  2XDN A;  2UUZ A;  2HQR A;  4M3F A;  1SVM A;  3NXC A;  4HEA 2;  3OYL A;  3A2K A;  2HYG D;  2MH9 A;  4AIJ A;  2BXY A;  3A01 B;  2FBH A;  1XDS A;  4AIK A;  5LD2 C;  1SD7 A;  4GDF A;  5E1X A;  1WGX A;  1VND A;  1MBG A;  4IL6 C;  5F08 A;  5BPI A;  1HQC A;  3PUF A;  3GWZ A;  4HNT A;  2EZI A;  3N05 A;  1ZH5 A;  1D1A A;  2RNG A;  1HDP A;  4RGX A;  3I5U A;  2ZXH A;  5EEG A;  5E3N A;  1UI5 A;  2KLO A;  2E1M C;  4WX9 A;  1WH7 A;  1X1P A;  2KKO A;  1FOW A;  2O5R A;  4M9X A;  2DFI A;  1VQ5 I;  1W36 C;  4A3B J;  1SFK A;  1VQ7 I;  3WG7 H;  1SAN A;  3OSG A;  4ZYD A;  2PN6 A;  5D8K B;  3GTM J;  2A6E F;  3ZMU A;  2XAS A;  1UI6 A;  3QYE A;  2KIQ A;  1O57 A;  1JTX A;  1R4M B;  2CUF A;  4UXN A;  2ADU A;  1IJW C;  1FTT A;  4A0X A;  2REK A;  3JSP A;  3GUD A;  2JVG A;  3T5X A;  3R4K A;  2V7F A;  2YS9 A;  3GBG A;  3L2U A;  4B47 A;  1I3A A;  2OAZ A;  2XAU A;  1DGR M;  5J4V A;  2XRO A;  2HVQ A;  1GUU A;  2N8G A;  4EMS A;  2JRT A;  3AG3 H;  2PMZ A;  3CCM I;  3RYP A;  3DEE A;  3HSR A;  2Y69 H;  1XMA A;  4UNO A;  1R9T J;  2Q2E B;  4ANJ A;  1BOA A;  2P4W A;  1JUP A;  3E6M A;  4PZJ A;  4KFC A;  3IV5 A;  1P4W A;  3FMQ A;  3H0D A;  4EJV A;  3LSI A;  5D5U B;  3FXU A;  2H09 A;  5IP7 J;  3EUH C;  2Y9Z A;  2QKM B;  3G56 A;  5D8L B;  3SZT A;  3OYG A;  4U0V A;  1SMT A;  2XAQ A;  3OYN A;  2RVC A;  4FET A;  2LD5 A;  5TRD A;  1MJA A;  1IRX A;  1WI3 A;  1FZP B;  4FT8 A;  5GAG J;  2XF7 A;  4R8H A;  4IHX A;  1TWC J;  2OQR A;  3TW6 A;  5HLT A;  2NVU B;  4NB5 A;  3U2R A;  4ZJZ A;  1DP7 P;  2IGO A;  1RPW A;  2LK2 A;  4BL0 B;  1HXD A;  4RB1 A;  1ZRC A;  2HFH A;  1APL C;  3BY6 A;  2HOS A;  3CJN A;  1MNE A;  3HDD A;  2ELH A;  4I7H A;  3AG4 H;  2BY3 A;  3IL2 A;  2VJJ A;  2R7W A;  4JOM A;  3CF5 F;  3W6V A;  4A5M A;  2VT2 A;  2OD5 A;  3BOQ A;  3ECO A;  1VZ0 A;  4EJW A;  5EG0 B;  4J01 A;  1LFU P;  5A2Q Z;  3LA7 A;  1R36 A;  4MEY F;  4IHV A;  4L5J A;  2B7E A;  4HF1 A;  1I6H J;  1Y0N A;  2DLL A;  3DKW A;  3I56 I;  2R7F A;  2BV6 A;  1WQ2 A;  3ZQL A;  4UB6 C;  1BOB A;  1TBX A;  5FKN A;  1RIO H;  2DK8 A;  4XL9 A;  2KMU A;  1FY7 A;  3BG6 A;  4Y15 A;  3JR9 A;  3E5X A;  2NS8 A;  2ZCW A;  5KK1 A;  4YFN F;  1IC8 A;  2PEX A;  4B43 A;  1WWX A;  1YOV B;  5EJC A;  2P81 A;  3KLO A;  2XAH A;  5HLH A;  3GTQ J;  3GZ6 A;  1HC8 A;  3TP0 A;  5HNF A;  3BJB A;  4PXI A;  4CIC A;  4AUX A;  3FXM A;  2H6B A;  4XBF A;  5H20 A;  3VOX A;  2HKX A;  5GP9 A;  3GLL A;  1VQK I;  2PBI A;  1D0Z A;  3JRF A;  2VQG A;  1LFP A;  5IYC J;  4IZZ A;  2CFO A;  2GEN A;  3NRV A;  1K79 A;  1STZ A;  1E2X A;  2EZH A;  5B1B H;  2L9R A;  4MTD A;  4BE1 A;  2A6H F;  2V1X A;  1EA3 A;  1XGS A;  2CUE A;  2L5Q A;  2FMY A;  1LJ9 A;  2C6Y A;  1W7P A;  5FGM A;  2XV4 S;  3A0B C;  3AFH A;  2PX9 A;  1ON2 A;  3VEP A;  2QYO A;  1E3P A;  2K9L A;  1MDM A;  1S3J A;  2K85 A;  3AG1 H;  4YEL A;  3ZQG A;  1D0Y A;  2ZBK A;  2QGU A;  4G6T B;  1P92 A;  2V9V A;  2WV1 A;  2F4I A;  3OS2 A;  4XLP F;  5CXG A;  2KIF A;  2F5C A;  1P4A A;  2OZ6 A;  2EFQ A;  3RQI A;  5C4J J;  1ETV A;  4C2U A;  3K1P A;  1GLN A;  3L00 A;  2ZJQ F;  5D6F A;  1O3R A;  4EGY A;  2IBD A;  3CTA A;  3E6B A;  4EEF G;  4AYB N;  5CVV A;  4MTE A;  1WJF A;  2A6T A;  4BE0 A;  2DT5 A;  1YG2 A;  1ZAR A;  3VSL A;  1SFX A;  1SEU A;  1H9T A;  4D5C A;  2NYX A;  4N9I A;  1ZN2 A;  2XKO A;  1EH6 A;  3ABK H;  4LK0 F;  4ZZD A;  1S7O A;  4M73 A;  3UR3 C;  1ETK A;  2KZG A;  1RRJ A;  1X3U A;  2JUC A;  3IAM 2;  5FO5 A;  1I3Q J;  2KIU A;  3I53 A;  2R3S A;  3IWF A;  2BY0 A;  4OIQ F;  2GBY A;  3LWJ A;  4G6D A;  4KMU X;  2EV5 A;  1B72 A;  3K4L A;  4RAZ A;  1X58 A;  2NVY J;  4EM1 A;  4RS8 A;  4A2U A;  4B44 A;  5L3G A;  1IN8 A;  2R5Z B;  3KIO A;  1LPQ A;  5HNH A;  1F36 A;  3HE0 A;  1TTY A;  2XGD A;  1BJA A;  3JRH A;  2DXI A;  1HOM A;  1W7P B;  2AQE A;  1H89 C;  4BDY A;  2M87 A;  3ERM A;  2KJC A;  1TW3 A;  1JKR C;  2X51 A;  2Y48 A;  4WF2 A;  5EEH A;  4N9H A;  1W36 D;  1IN6 A;  2L01 A;  4CGR A;  2VXD A;  2KZV A;  1YJW I;  3F6O A;  1TT5 B;  3M8E A;  1O7F A;  5AIQ A;  4M9S A;  1XGN A;  5DCF A;  2TCT A;  1VF9 A;  3CZ6 A;  2DA4 A;  2JZY A;  2MH2 A;  4IQ4 A;  4ENK A;  2AXL A;  3VB2 A;  1T39 A;  2XHK A;  3HTJ A;  1HKQ A;  2R7O A;  4RGU A;  3S93 A;  2WGB A;  1IO2 A;  1O7L A;  3KZY A;  4M3D A;  4J00 A;  4IHW A;  1BA5 A;  3DLA A;  4PGH A;  4LB6 B;  1K7A A;  1HKT A;  2FUG 2;  2V6E A;  1R00 A;  1BR2 A;  2MD5 A;  2NAZ A;  2IA0 A;  2P7V B;  3GLX A;  4GFB A;  2Y31 A;  2O0Y A;  3L1P A;  1HSJ A;  2L7K A;  2EH3 A;  3E6C C;  3GTO J;  2QCO A;  5B3S H;  1N78 A;  1RZ4 A;  2FOK A;  4ZDP A;  3MZ8 A;  2WV0 A;  2MC4 A;  1OKR A;  2EIJ H;  4BXX J;  1RC9 A;  2QQ8 A;  4I98 B;  1ZLK A;  1B72 B;  3HRU A;  2CQ7 A;  3WGH A;  1J7K A;  3RIR A;  3QRF F;  1XN7 A;  2CU7 A;  4CCM A;  4HX7 A;  3WU2 C;  3Q9V A;  2IS4 A;  1Z3X A;  3BDD A;  4Y4R A;  2EBI A;  2ECC A;  5DUI A;  3HTA A;  3C2H A;  2LRD A;  2UXH A;  1Y56 A;  1YIJ I;  2Z99 A;  1RUN A;  2W85 A;  3C3W A;  3C7J A;  3QPH A;  3KET A;  4XRM A;  4RAF A;  4HG2 A;  2CV1 A;  2UXN A;  5TJJ A;  4NNJ A;  2EV0 A;  4UVB A;  1XB4 A;  3EGQ A;  2JVH A;  1WZ2 A;  2HNH A;  2RHA A;  3H3U A;  3QPS A;  1SFO J;  3AAF A;  3BCB A;  5FRN A;  2R7Z J;  5IYD J;  3V7C A;  4QLC U;  1T2K A;  1HW2 A;  2B1E A;  3E7Q A;  4PJJ A;  3Q5F A;  2VBW A;  4F52 A;  2MD0 A;  3CCR I;  3O6B B;  2DDB A;  4PGG A;  4PFO A;  3LAJ A;  2LVS A;  4ZDO A;  2A5W A;  3K6G A;  1CF7 A;  4LG0 B;  3HOV J;  1LE8 A;  4ENJ A;  2STT A;  2VQH A;  4M9Z A;  5EZH A;  4AC0 A;  1IRF A;  3WU1 B;  2ESN A;  4U9L A;  3HRT A;  1SVO A;  3B6C A;  1P4X A;  3VFZ A;  1W5S A;  1HW1 A;  4IHS A;  1DU6 A;  3LJL A;  3S3M A;  2KQR A;  5E79 C;  1MMA A;  3VW0 A;  1ZG3 A;  2Q1Z B;  1VQ4 I;  2LYC A;  3ISP A;  3P5J A;  4HF0 A;  3VVY A;  2IJL A;  4GFK A;  2Q8K A;  3IH2 A;  4CYC B;  1ZYR F;  2AQF A;  4ZTJ A;  1IXS B;  3B73 A;  4GCT A;  3VUQ A;  4XKV A;  2K3P A;  5LFA A;  3NAR A;  3S32 A;  4BQO A;  1FSH A;  1BJZ A;  1X19 A;  2K86 A;  3CC4 I;  3BCA A;  1WJE A;  4UB8 C;  1JGG A;  4ZYA A;  5HS8 A;  2W1O A;  3MAJ A;  4A3L J;  3QOP A;  4Z2Y A;  4HNV A;  4UUV A;  3ZMD A;  4YIF A;  2ELJ A;  1SFU A;  4RAY A;  2QZ8 A;  2IW5 A;  1NHA A;  3HZJ A;  5KHD A;  4HOB A;  3G4S I;  2K40 A;  3COA C;  2M1B A;  3F22 A;  5DDG A;  2QOP A;  4KIB A;  1G59 A;  3HOY J;  1VQO I;  1Q1V A;  4A3M J;  2K4B A;  4Q4Z F;  3M9A A;  2E36 A;  5K1Y A;  4WK8 F;  2PJR A;  3ZPL A;  3KKC A;  2BVM A;  2M34 A;  3CP2 A;  2ME6 A;  2P7C B;  2LC2 A;  5E3O A;  1ENH A;  3NWS A;  3V42 A;  3MQ0 A;  2R7D A;  1XMK A;  2DYS H;  2O8K A;  2A5Y B;  1SD6 A;  3U1D A;  1Z05 A;  3WE3 A;  2CQK A;  4YZE A;  2F5D A;  2IGM A;  1VQ6 I;  1YS7 A;  3BQZ A;  1LE8 B;  2X0L A;  1G3T A;  3QBM A;  1V5E A;  1OFC X;  1FOK A;  1B8I B;  4G7O F;  5DCM A;  4D0P A;  5JVG F;  1ZAO A;  5LEK A;  1WKM A;  2O7O A;  2HQN A;  3ZMT A;  1OJL A;  2D1V A;  2YUS A;  2JK3 A;  5BMZ A;  3CJT B;  4DYC A;  3A02 A;  5AIP A;  1G3Y A;  2WB1 A;  5LGN A;  2CG4 A;  3W6J B;  3QYF A;  1QZZ A;  4KWA A;  4AVZ A;  5JFR A;  1ZHF A;  1WHU A;  2DOA A;  3DTK A;  2AXT C;  3I54 A;  4BH9 A;  4HDU A;  1KU7 A;  3J7Z I;  2FU4 A;  3BNI A;  4GO1 A;  1RR7 A;  3A1Y A;  2ZXI A;  2W00 A;  1MZB A;  3KYD B;  3RTR A;  1PUF B;  3BTC A;  4XKB A;  4C3H J;  3CJR B;  4DIQ A;  2FSW A;  2IS1 A;  3K4N A;  1BBY A;  3ZOB A;  1LFB A;  3FXJ A;  1FPQ A;  5HBU A;  3RH2 A;  1X4P A;  3U21 A;  3GTJ J;  1Z67 A;  2ACJ A;  2MBF A;  2QWW A;  3CD6 I;  4XSZ F;  1U6G A;  1QZY A;  3V78 A;  3OIQ A;  2OPT A;  2G7H A;  3GCM A;  2F5V A;  4AID A;  2PI0 A;  3WTX C;  1EH8 A;  1JUM A;  3FXO A;  5IY5 H;  3JCU C;  2ZJR F;  4D7N A;  5CKT A;  1BIB A;  1ODD A;  2XAJ A;  1OCT C;  2PJR B;  2G7U A;  2J5O A;  1VQ8 I;  3I3L A;  2W53 A;  4FIS A;  4C2M J;  1ETO A;  1ZGW A;  4RB3 C;  2OTJ I;  1YS6 A;  3V8K A;  2ESH A;  2XSJ C;  4CCN A;  1R1V A;  4JX5 A;  2DA5 A;  2PBX A;  1BI2 A;  5ICE A;  1B9M A;  3QPT A;  3FWE A;  4XRS G;  3RPU D;  3CCJ I;  3ML6 A;  1JT0 A;  2HWV A;  1TQI A;  3PM1 A;  1ORK A;  4XK4 A;  2E60 A;  1IUF A;  5DS9 A;  1JXS A;  4A0Y A;  4HBL A;  1IW7 F;  3ABL H;  3K70 D;  2MC3 A;  2PJP A;  4RB0 A;  4FAS D;  1V55 H;  2BW3 A;  3D5R C;  2IA2 A;  3K8P C;  1TL8 A;  3ABU A;  5GAH J;  3LSR A;  3NRG A;  2EZL A;  4ETS A;  4GXO A;  4HAM A;  4NC8 A;  3A01 A;  1IXC A;  3GF2 A;  4B09 A;  2PMU A;  2XDV A;  3EUH A;  5CJ9 A;  2CW0 F;  3BR5 A;  4ABZ A;  1L3L A;  4UVA A;  4I0B A;  3L2W A;  3BCG A;  1U9N A;  2IT0 A;  3NEU A;  1G6N A;  1C0W A;  1RNL A;  1LDK B;  1F1Z A;  1FC3 A;  5F27 A;  3HKZ N;  1Z9C A;  1YW9 A;  1UB9 A;  5F04 A;  3VTI A;  2IXS A;  3WTZ A;  3TO9 A;  5K5Q A;  4KDP A;  4RGR A;  1WJD A;  4IEJ A;  3OIO A;  5FRO A;  4UUS B;  2DMP A;  5M3F J;  2OJE D;  2RGV A;  4XQF A;  1D8J A;  2KRF A;  1T38 A;  4QIW N;  1S9H A;  1Z7U A;  4E7K A;  3HSF A;  3WGI A;  1QGP A;  3T1B A;  2HOE A;  3KFW X;  3T0Y A;  3DQV C;  2JMW A;  4PJL A;  4P5O A;  4FX4 A;  1ZR2 A;  2KIM A;  3I71 A;  4IHT A;  2UXI A;  1X1D A;  3N4M A;  4S0H B;  3BPV A;  4CZC A;  1XDU A;  5KNL A;  4GRI A;  1RUO A;  1VQM I;  4EJU A;  2M7A A;  4ON0 A;  1OIS A;  1RR8 C;  1YRN B;  2EFW A;  4HLY A;  2Q2E A;  4OMZ A;  5D4R A;  2H8W A;  5FKK A;  1F9N A;  4UHT A;  2JJ7 A;  1U8R A;  3W2A A;  3DEW A;  3HGG A;  2HS5 A;  2UWM A;  3ON4 A;  4U9N A;  2OA4 A;  3ABM H;  3EQL F;  1FBS A;  5FD5 A;  1MSF C;  2ID3 A;  3OR2 C;  2AO9 A;  5FFX A;  1LUJ B;  2GIZ A;  4IXA A;  1V54 H;  5EFY A;  4XLH A;  3ZP5 A;  3ON2 A;  2ETH A;  3I64 A;  4A12 A;  2M5W A;  4AC6 A;  3OMY A;  4DOZ A;  3K7A J;  5IT9 K;  4BDZ A;  4G8X A;  1MMD A;  3WOD F;  4N4O B;  1YYV A;  4I6Z A;  3IUV A;  2QF7 A;  4CHU A;  2DA7 A;  3CF2 A;  3T6N A;  2HOT A;  2VIX A;  1JJ8 C;  1IRZ A;  4AD9 A;  2VOO A;  2YVX A;  1PYV A;  3M07 A;  3CLO A;  2VJ4 A;  1I27 A;  4HPQ A;  3GFL A;  3JRI A;  1UHW A;  2VUM J;  3CUQ B;  2L2O A;  5HOD A;  3C2G A;  1XD7 A;  1Z3Y A;  2X1E A;  2LOO A;  3E0J B;  3BG9 A;  5FMP A;  4PSW A;  3X2Q H;  4IRI A;  1G2H A;  1OR7 A;  2V4J C;  5EG0 A;  3RDI A;  4UY8 I;  4Y3O A;  3I0T A;  5LEJ A;  3L2C A;  2HU9 A;  5HDG A;  4KN4 X;  5KAF C;  2JPB A;  3BC8 A;  2BY1 A;  1MJ9 A;  1WFX A;  2BZT A;  4P1W A;  3J80 K;  4AF5 A;  3KP4 A;  5EEA A;  4YG2 F;  3ZQC A;  2STW A;  2UXU A;  3OS1 A;  5EZG A;  4BYY A;  2G9W A;  3G6E I;  3F9K A;  1I5Z A;  3M4O J;  3AL0 B;  2LF8 A;  2FD5 A;  3B6A A;  4CZZ A;  3BR1 A;  1I6X A;  4DW6 A;  1A04 A;  1FP2 A;  1Z91 A;  4MXM A;  1H9G A;  1ZEL A;  2V9K A;  4FX0 A;  1VQP I;  1Y39 A;  5J40 A;  2ZNY A;  4A3G J;  2QTQ A;  3C18 A;  4BXF A;  1MIJ A;  3BJA A;  2HDD A;  1TNS A;  2DDA A;  6PAX A;  2K3F A;  2DBB A;  3R61 A;  3CCV I;  1T98 A;  1WRJ A;  2NS7 A;  4MEX F;  3U9G A;  5TIS C;  4DYR A;  1WVR A;  3LSJ A;  2DA1 A;  3IHU A;  3UNG C;  4L9N A;  1V3F A;  4D5F A; 
#chains in the Genus database with same CATH homology
 1B72 A;  2ID6 A;  1X58 A;  2NVY J;  2E19 A;  2DMU A;  3JRB A;  1I50 J;  3S1N J;  2QKO A;  3G1M A;  2R5Z B;  1TWF J;  3IH4 A;  2DG8 A;  5EYR A;  3B81 A;  4JX6 A;  1MBK A;  1F36 A;  3HE0 A;  2XGD A;  3BR3 A;  5FKO A;  2GM4 A;  4JL3 A;  1T33 A;  3JRH A;  3S5R A;  1ZR4 A;  1JKP C;  2R93 J;  3JRG A;  5C4X J;  1HOM A;  4A3C J;  1H89 C;  2OF7 A;  1UG2 A;  2XRL A;  4RBO A;  2NVQ J;  1H8A C;  1MBF A;  1TC3 C;  3PAS A;  2UXO A;  3BR2 A;  1POG A;  1O4X A;  1JKR C;  1DU0 A;  1NK3 P;  4A3K J;  2Q24 A;  4CGR A;  4ICH A;  3LSG A;  4QTR A;  3BT9 A;  3S1Q J;  3S2D J;  3VIB A;  2TCT A;  1VF9 A;  2KT0 A;  2DA4 A;  3TW7 A;  2COB A;  5CW8 A;  4LOC A;  2HXO A;  3HTJ A;  2IEK A;  1BW6 A;  1IG7 A;  2WGB A;  2DA2 A;  4M3D A;  4IHW A;  1BA5 A;  2V57 A;  5FKL A;  3Q0V A;  3UKG A;  3O8H A;  1ITY A;  1A5J A;  5K7Z A;  4M3G A;  2DA6 A;  3QPL A;  5M5Y J;  1S7E A;  3G1O A;  1GDT A;  4GFB A;  2Y31 A;  4HKU A;  3L1P A;  2O9L A;  1H88 C;  1NTC A;  2EH3 A;  3RKQ A;  3GTO J;  2ZCN A;  2HOA A;  2QCO A;  5M3M J;  3MVP A;  3JRD A;  1HLV A;  3GZI A;  3AQS A;  2ZCM A;  2HXI A;  3FK7 A;  4FCY A;  5FJ8 J;  4NN1 A;  2M2E A;  2HI3 A;  1FIP A;  3IH3 A;  4FE4 A;  3BG5 A;  5IOY A;  2JA6 J;  4BXX J;  2UXP A;  5J1R A;  2QWT A;  1ETW A;  2R5Z A;  1B72 B;  1MH3 A;  4M6V A;  5J1U A;  1WPK A;  3M3Y J;  1HCR A;  5K7H A;  4DYQ A;  4NEL A;  2DMT A;  3DPJ A;  2CU7 A;  2E1O A;  3HB9 A;  2NVX J;  2EZK A;  2K9Q A;  2EBI A;  2ECC A;  3HTA A;  2UXH A;  1W0T A;  1U9O A;  1IGN A;  4MO7 A;  4V2G A;  3AQT A;  3V6G A;  3OOU A;  1MH4 A;  3LOC A;  2XB5 A;  5HAW A;  1EF4 A;  2IU5 A;  2F07 A;  3S15 J;  2G7L A;  4XRM A;  4MFD A;  1WH5 A;  2MSY A;  2Y0S N;  1Y1W J;  1X2N A;  2WUI A;  4MK6 A;  5D18 A;  2ELK A;  2NX4 A;  2LFB A;  3GTK J;  3GTP J;  3CWR A;  1RES A;  3EGQ A;  4C3I J;  3KZ9 A;  2ECB A;  4Y7N J;  2DN0 A;  2RHA A;  4A3F J;  3HOZ J;  4A3D J;  3QPS A;  1SFO J;  1JT6 A;  1QRY A;  4V2F A;  4BY1 J;  3I4N J;  2XSD C;  2R7Z J;  3NPI A;  5IYD J;  4A69 C;  3EUP A;  3E7Q A;  4I76 A;  3QQA A;  4W1U A;  1ETX A;  2NOG A;  3VOK A;  1P7J A;  2JN6 A;  2IAI A;  2LVS A;  4QSH A;  2DMN A;  3I4M J;  3HOV J;  1LE8 A;  2WAQ N;  1NK2 P;  2G7G A;  4ME9 A;  1ZTR A;  2MGQ A;  4DZJ A;  5EZH A;  5FKM A;  4AC0 A;  3CMY A;  2CQQ A;  5E3M A;  1HF0 A;  3GEU A;  1JKO C;  2E2I J;  3Q0W A;  3S17 J;  2M8G X;  3KNW A;  2K9S A;  3B6C A;  2H1K A;  2GLO A;  3K2A A;  2DA3 A;  1DU6 A;  3NI7 A;  3LJL A;  1ZKG A;  1K83 J;  2L7Z A;  3MN2 A;  3ZQI A;  3VW0 A;  2XPW A;  1X2M A;  1WCM J;  5EF6 A;  2JA8 J;  5K7F A;  2HYJ A;  3VVY A;  5FLM J;  4GFK A;  3IH2 A;  4CYC B;  4GCT A;  3VUQ A;  5EDN A;  2E2H J;  1JTY A;  3NAR A;  5GPC A;  1BJZ A;  3CCY A;  3CRJ A;  3S14 J;  3LNQ A;  2JWT A;  3SJM A;  4XIC A;  1JGG A;  4L5E A;  3ZQF A;  1AU7 A;  1JUS A;  5F0C A;  1JKQ C;  3PO2 J;  2AHQ A;  4A3L J;  3NNR A;  3BQY A;  4HNV A;  1IV6 A;  3FKI J;  2FJ1 A;  4J19 A;  2ZCX A;  5GPA A;  2K40 A;  1GVD A;  2OER A;  2QOP A;  3HOY J;  3BR0 A;  1FJL A;  1OCP A;  1Q1V A;  4A3I J;  2VI6 A;  1GV2 A;  4A3M J;  4M3B A;  1T56 A;  4GCK A;  1IDZ A;  2NP5 A;  3RD3 A;  1Y1V J;  4BBR J;  2VKE A;  3ZQH A;  5IOZ A;  3C07 A;  3KKC A;  2M34 A;  2ME6 A;  3COL A;  4A3J J;  3FRQ A;  1FEX A;  3FK6 A;  2Y2Z A;  3RZD J;  3KKD A;  3BG3 A;  2K9N A;  5E3O A;  1ENH A;  5CXI A;  3MNL A;  2XGC A;  2HKU A;  3ANG A;  3BRU A;  1AKH A;  2CRG A;  2O8K A;  5IP9 J;  2XGE A;  2QIB A;  2R92 J;  3E7L A;  4JX4 A;  4W97 A;  4YZE A;  3VW1 A;  3H0G J;  3HOX J;  5C3E J;  5JLX A;  3BQZ A;  3JSJ A;  2LTP A;  2YU9 J;  1LE8 B;  5M5X J;  4JYK A;  4L62 A;  3QBM A;  2LP0 A;  1TWA J;  1OFC X;  3WHC A;  4B3A A;  1B8I B;  3MKL A;  2CJJ A;  2O7O A;  2RAE A;  3LSP A;  2L7F P;  4NDL A;  1OJL A;  2MW8 A;  2YUS A;  1FTZ A;  2JK3 A;  1UMQ A;  3RZO J;  3VPR A;  4UUT A;  4CYC A;  4DYC A;  4BBS J;  3A02 A;  3WHB A;  4B4C A;  4XID A;  2XB0 X;  1QPI A;  2VPR A;  3O60 A;  4KWA A;  3BHQ A;  3JRA A;  3HTH A;  4JKZ A;  1ETQ A;  1HDD C;  2YVH A;  2X9D A;  2XDN A;  2ZB9 A;  4M3F A;  3SFI A;  3NXC A;  3F0C A;  3BNI A;  4GCL A;  2WB1 N;  3A01 B;  1RR7 A;  3Q3S A;  5AQC A;  2L7M P;  1PUF B;  1WGX A;  3BTC A;  1VND A;  1MBG A;  3P9T A;  5F08 A;  4C3H J;  5FLV A;  3ZOB A;  2EZI A;  3SDG A;  3LHQ A;  1LFB A;  1HDP A;  2TRT A;  5HBU A;  3BR6 A;  2R5Y A;  3FIS A;  2GUH A;  3RH2 A;  3PPB A;  3GTJ J;  2ME0 A;  1RKW A;  2XPV A;  3JRC A;  5E3L A;  5E3N A;  3V78 A;  5C44 J;  1UI5 A;  2OI8 A;  2OPT A;  1WH7 A;  5J3L A;  2NVT J;  1ZQ3 P;  4A3B J;  1JUM A;  4D7N A;  1XC5 A;  1OCT C;  1SAN A;  3OSG A;  1D5Y A;  2KDZ A;  4ACI A;  1Z0X A;  3GTM J;  3HBL A;  2LR8 A;  4FE7 A;  2PZ9 A;  2HQ5 A;  2W53 A;  1UI6 A;  1QVU A;  4FIS A;  2RAS A;  4G12 A;  4C2M J;  3HIM A;  1UHS A;  1AKH B;  1ETO A;  1ZGW A;  1JTX A;  2JA7 J;  5F0H A;  2CUF A;  1ZK8 A;  4B1R A;  5F0F A;  2REK A;  1IJW C;  1FTT A;  3BTI A;  1K61 A;  4Y52 J;  4JX5 A;  4D7M A;  4IHY A;  2DA5 A;  2PBX A;  2YS9 A;  3GBG A;  1B8I A;  4XRS G;  2I10 A;  2Y9Y A;  1GUU A;  2N8G A;  1JT0 A;  3PM1 A;  1ORK A;  1MBJ A;  4JNN A;  4JP0 A;  4XK4 A;  1IUF A;  4XRS A;  4C3J J;  5IYB J;  1R9T J;  5K58 A;  5DS9 A;  1JUP A;  3IV5 A;  4MLO A;  9ANT A;  3BTJ A;  5IPA A;  4M3E A;  2M0C A;  5IP7 J;  3CJD A;  2M9H A;  3LSR A;  2Y9Z A;  3NRG A;  5M5W J;  2EZL A;  3G56 A;  3A01 A;  2GFN A;  2H8R A;  1W0U A;  1PUF A;  5JLW A;  3TED A;  4MIM A;  1XS9 A;  3BR5 A;  4ABZ A;  2LD5 A;  1VI0 A;  1WI3 A;  2CQX A;  3BCG A;  1P7I A;  4X1E A;  2W48 A;  1U9N A;  4IHX A;  4BY7 J;  1TWC J;  4A3E J;  1F43 A;  3QKX A;  3TW6 A;  2R5Y B;  5F27 A;  3HKZ N;  2VKV A;  1RPW A;  2LK2 A;  5F04 A;  1U8B A;  3VVX A;  3CQZ J;  1APL C;  4MFE A;  3VW2 A;  2L0K A;  1VFC A;  2HOS A;  1BW5 A;  3HDD A;  5J1Y A;  2G7S A;  3VP5 A;  4IEJ A;  3OIO A;  5D19 A;  3A03 A;  4UUS B;  2DMP A;  5M3F J;  5D1R A;  3S2H J;  3W6V A;  4QIW N;  5EG0 B;  1LFU P;  3C2B A;  3G1L A;  2B63 J;  2JMW A;  1ZR2 A;  3Q0U A;  4IHV A;  2UXI A;  1A6I A;  4S0H B;  2R0Q C;  1I6H J;  2DJN A;  1SGM A;  2MG4 A;  3O8G A;  1XG1 A;  3ZQL A;  1YRN B;  1Z77 A;  5FKN A;  4FTH A;  2D6Y A;  5FKK A;  1GV5 A;  2JJ7 A;  3JR9 A;  5FHP A;  2NS8 A;  1AHD P;  1IC8 A;  3DEW A;  3HGG A;  3GTG J;  3ON4 A;  1RET A;  2FX0 A;  3CDL A;  4BKX A;  3S1R J;  2G0E A;  1MSF C;  2P81 A;  3GTQ J;  2ID3 A;  2DG7 A;  2AO9 A;  2LY9 A;  3TP0 A;  5DTD A;  3BJB A;  4PXI A;  5EFY A;  4AUX A;  2HYT A;  4X6A J;  3VOX A;  5GP9 A;  3ON2 A;  1U78 A;  5H9T A;  4AC6 A;  3JRF A;  5EGO B;  3K7A J;  1MSE C;  3S1M J;  5DAJ A;  2FQ4 A;  5IYC J;  4I6Z A;  2GEN A;  2QF7 A;  3IUV A;  4UDS A;  2DA7 A;  3T6N A;  1MBE A;  2HOT A;  3FIW A;  1JJ8 C;  1QVT A;  2EZH A;  4RDU A;  1E3O C;  2L9R A;  1IRZ A;  3DCF A;  2CUE A;  4GFL A;  2E2J J;  3JRI A;  1BL0 A;  2VUM J;  1RKT A;  2FBQ A;  5HOD A;  2ZOZ A;  3HTI A;  2X48 A;  4UUS A;  5FGL A;  1TWH J;  3BG9 A;  5FMP A;  5IP6 A;  2JA5 J;  1G2H A;  3ZQG A;  2NP3 A;  3D1N I;  2EQR A;  5EG0 A;  2ZOY A;  3HOW J;  4DZP A;  2WV1 A;  4A93 J;  5CXG A;  3GTL J;  1FIA A;  2LKX A;  5HSZ A;  3PO3 J;  1IDY A;  3RQI A;  5C4Y A;  3BTL A;  3HEF A;  5C4J J;  3HM5 A;  2DTZ A;  1ETV A;  1TWG J;  3S16 J;  2X6O A;  2YVE A;  1MNM C;  4AF5 A;  3TP3 A;  1ETY A;  5EEA A;  1YRN A;  3ZQC A;  2D5V A;  2UXU A;  5EZG A;  2IBD A;  2G3B A;  4EEF G;  2LLK A;  3M4O J;  3ANP A;  4AYB N;  1MBH A;  2FD5 A;  3B6A A;  3G7R A;  3BR1 A;  4DW6 A;  3HOU J;  4MXM A;  2DMQ A;  1JJ6 C;  2XPU A;  1CQT A;  4A3G J;  4D5C A;  1GT0 C;  2QTQ A;  3F1B A;  3VVZ A;  3H3V K;  3OSF A;  2HDD A;  2PMZ N;  5F1J A;  2Y30 A;  1ETK A;  1I3Q J;  2NS7 A;  3NAU A;  2GBY A;  5EGO A;  2O7T A;  3LWJ A;  3JRE A;  4DYR A;  3LSJ A;  2DA1 A;  3HGY A;  5BNG A;  4D5F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...