4W1UA

Crystal structure of rv3557c/kstr2, a transcriptional repressor involved in cholesterol metabolism in mycobacterium tuberculosis
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
198
structure length
193
Chain Sequence
RVARRGELLELAAAMFAERGLRATTVRDIADGAGILSGSLYHHFASKEEMVDELLRGFLDWLFARYRDIVDSTANPLERLQGLFMASFEAIEHHHAQVVIYQDEAQRLASQPRFSYIEDRNKQQRKMWVDVLNQGIEEGYFRPDLDVDLVYRFIRDTTWVSVRWYRPGGPLTAQQVGQQYLAIVLGGITKEGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional repressor KstR2
publication title Crystal structure of Rv3557c/KstR2, a transcriptional repressor involved in cholesterol metabolism in Mycobacterium tuberculosis.
rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription
total genus 79
structure length 193
sequence length 198
ec nomenclature
pdb deposition date 2014-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17932 TetR_C_24 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4w1uA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 4w1uA02
1AKHA 3DPJA 2WAQN 4XICA 3S5RA 2HDDA 3NI7A 3JSJA 3JRAA 3PPBA 2EH3A 4DW6A 2ME0A 3PM1A 2R7ZJ 5CXIA 2E1OA 2ZCXA 5M3FJ 1H89C 3GTQJ 4A3FJ 4A3KJ 3BNIA 2L0KA 4FE4A 2L9RA 2CUEA 2WUIA 3FKIJ 2X6OA 3BJBA 5F1JA 2XPUA 1W0TA 1GUUA 3HGYA 5K7ZA 3LSRA 2Y30A 3RQIA 1UG2A 3Q3SA 2LP0A 1A6IA 2XDNA 2DA1A 4RDUA 1JKPC 4JL3A 1OCTC 4DYRA 2PMZN 2EBIA 3BRUA 4M3DA 4A3LJ 3EUPA 4LOCA 4A3IJ 2UXIA 3ZQCA 5F0FA 1POGA 1JJ6C 1BA5A 2B63J 5M5YJ 2O7OA 2OI8A 4D7NA 4DZPA 4X6AJ 3V78A 1IV6A 3BQZA 3BT9A 4FTHA 2DA4A 2DMUA 1B72A 1OFCX 1VNDA 1HDPA 3BR6A 3G1MA 3GZIA 2QIBA 2AHQA 1WCMJ 4A69C 2MSYA 3JRBA 3S15J 4AC6A 3IUVA 3JRDA 1WH5A 2ZOZA 3HGGA 2K9NA 5EGOA 2TRTA 3HOUJ 4JX6A 3BG5A 4A93J 3VOKA 2R93J 3VOXA 1IG7A 1MBJA 5J1RA 4B3AA 3WHBA 1D5YA 5JLWA 3S2DJ 1HLVA 3CRJA 5FGLA 1LFBA 5M5WJ 3I4MJ 3PO2J 2VPRA 3S1MJ 3JRFA 1F36A 1NK2P 5EZHA 3SFIA 1JTXA 3B81A 1F43A 2YS9A 3LSPA 2NVYJ 1P7JA 2GLOA 2NP3A 4MFEA 1APLC 3OSGA 4CYCA 1QRYA 3NARA 4M3GA 2Y9ZA 3BHQA 3WHCA 3H3VK 5C44J 2PBXA 3HE0A 3GTOJ 3ANPA 3HIMA 1ZR2A 3BR0A 3ON2A 2DMNA 2HYJA 3HOVJ 2XGCA 2HKUA 2HOSA 3VPRA 2QKOA 1T56A 3FIWA 2ELKA 3G56A 3IV5A 4HNVA 3GTJJ 1H88C 3B6AA 3G1LA 3G1OA 2M8GX 1ZK8A 5DTDA 1UHSA 4DYQA 2KDZA 4ACIA 3TP0A 3BG3A 5IOYA 1YRNB 4NELA 3A03A 4YZEA 4BBRJ 4C3IJ 4QSHA 3UKGA 4MXMA 5EG0B 3MVPA 2K9QA 5HAWA 2JA7J 1I50J 1MBFA 3QPSA 4IHVA 2WV1A 1ETXA 3C2BA 1O4XA 5EG0A 1GDTA 3D1NI 1JT6A 2EZIA 1BW5A 1QVTA 2OF7A 2MGQA 3SJMA 1X58A 1WH7A 3HM5A 1MNMC 2RASA 1SGMA 3BR5A 1U8BA 1JTYA 2DG7A 4IHWA 3BTIA 3K2AA 5HBUA 2EZKA 2X48A 4A3GJ 3CWRA 3LWJA 2Y31A 1IC8A 3QKXA 1MBEA 2ME6A 2H1KA 5D18A 4M3BA 2E19A 3JREA 1TWFJ 5FKKA 5M3MJ 5F0CA 1HDDC 1Y1WJ 3OIOA 5K7FA 3HTJA 3VIBA 4JP0A 2P81A 1JUPA 5IP7J 5C3EJ 3FK6A 1AKHB 3I4NJ 2UXOA 1MBKA 2JMWA 3VW0A 2QF7A 1ZGWA 2GFNA 2LKXA 3ZOBA 2JK3A 1IRZA 1EF4A 1FTTA 2LK2A 2LVSA 1ZKGA 4DZJA 3HTAA 3COLA 4NN1A 5EDNA 2MW8A 2CU7A 1IDYA 2IBDA 5IYDJ 1HF0A 2M2EA 3ANGA 2QCOA 4B1RA 2O8KA 1MSFC 1B8IB 2E2JJ 1Z77A 3KKDA 5E3NA 4AUXA 3AQTA 1MBGA 3BR3A 2ZCNA 1B8IA 3JRCA 5EF6A 2CJJA 3IH2A 2DA7A 3NXCA 1RKTA 2WB1N 1A5JA 3AQSA 2XGEA 3M4OJ 5IOZA 3E7LA 5FKLA 3VUQA 2N8GA 1ETVA 4JNNA 2NS8A 2ZOYA 3SDGA 3O8GA 2FX0A 3NRGA 2XB0X 2GENA 2HOTA 3CMYA 1VI0A 2HI3A 2MG4A 2FBQA 2H8RA 1B72B 4XIDA 2CRGA 4UDSA 3LNQA 5EYRA 4G12A 2HXOA 4XRSG 4A3DJ 3TW7A 1VFCA 1LFUP 4AC0A 1FIPA 3MKLA 3KKCA 5EGOB 5EFYA 3JRGA 5FKNA 1NK3P 5EZGA 2ID3A 4JX5A 5EEAA 5H9TA 3PO3J 2ZCMA 1E3OC 3S2HJ 4X1EA 1RR7A 3GTGJ 4XRMA 2LD5A 3MN2A 4BXXJ 1VF9A 1PUFA 4A3BJ 1H8AC 3VP5A 3ZQIA 4A3JJ 3C07A 1RPWA 1XC5A 2YU9J 2JJ7A 4CYCB 3HOXJ 5DS9A 3KZ9A 4ICHA 1WPKA 1MSEC 5M5XJ 5K7HA 2DMPA 2FJ1A 2YVEA 3VVYA 1ZR4A 1WI3A 5GPCA 2X9DA 5C4YA 1XG1A 5FJ8J 2R0QC 1T33A 2O9LA 3O60A 2DA2A 1DU0A 4UUSA 1ETWA 1RESA 4JX4A 4D5FA 3L1PA 2AO9A 5FKMA 2TCTA 5E3OA 3GTMJ 3ZQLA 2W53A 1IGNA 3OOUA 4MLOA 3HTHA 3BTCA 5E3MA 2VKEA 5F27A 1QPIA 1MH3A 3S1NJ 1TC3C 4UUTA 3M3YJ 5D19A 5D1RA 2Y0SN 3O8HA 2REKA 5FMPA 5JLXA 4A3MJ 2R5ZA 3FISA 2M0CA 1G2HA 4B4CA 1S7EA 1ETKA 1IJWC 2XSDC 1OJLA 5CW8A 4NDLA 1JKQC 3QQAA 1FJLA 2EZHA 1UI5A 2HYTA 3NNRA 3OSFA 2L7ZA 4M6VA 2ECCA 1QVUA 4FE7A 5BNGA 1AHDP 4W97A 1GV2A 1BL0A 1TWCJ 5J1YA 1CQTA 3HOZJ 3VW2A 4MFDA 2O7TA 5HODA 2V57A 2UXPA 2G3BA 3TEDA 2QOPA 5AQCA 3KNWA 2JWTA 3BTJA 3DCFA 2EZLA 4RBOA 1JKRC 3NAUA 1AU7A 2G7LA 4GCTA 2COBA 4M3FA 2NOGA 4BKXA 4C3JJ 3DEWA 5IP6A 1HOMA 4GCKA 1MH4A 2XPWA 3QPLA 3HBLA 3A01A 1BW6A 2LFBA 1JKOC 3S1RJ 2DA6A 1RETA 2RAEA 5GPAA 1UMQA 4I6ZA 2D6YA 5J3LA 3IH4A 3HB9A 2Y9YA 1ETQA 1DU6A 3PASA 3LSJA 1K61A 2DG8A 4CGRA 2DA3A 2QWTA 2PZ9A 5FLVA 2EQRA 3ZQFA 2W48A 1U78A 2CQQA 1LE8A 3HDDA 1R9TJ 1RKWA 2IU5A 3A02A 3B6CA 2Q24A 3GTKJ 2VUMJ 1K83J 4IEJA 4S0HB 2G7SA 4C2MJ 1HCRA 5CXGA 2M9HA 1X2NA 1IUFA 4QTRA 2UXHA 1NTCA 3Q0VA 5E3LA 4Y52J 1IDZA 2E2IJ 5IPAA 3RZDJ 4QIWN 1GV5A 4GFBA 2FQ4A 3VW1A 1WGXA 3F0CA 4GCLA 1ENHA 4V2GA 3GBGA 4M3EA 4JKZA 4HKUA 2JA8J 5GP9A 2JA6J 3EGQA 2FD5A 2E2HJ 1I6HJ 1I3QJ 4FCYA 2D5VA 5F08A 1ETOA 3HEFA 2K9SA 3W6VA 4FISA 2CUFA 2JN6A 4MIMA 1PUFB 2GUHA 3CQZJ 3VVXA 3TP3A 3S14J 1BJZA 3CDLA 1UI6A 2LY9A 3T6NA 2QTQA 3IH3A 1TWAJ 1Y1VJ 3LSGA 3JRIA 3VVZA 1GT0C 4ABZA 2IEKA 3S16J 3BCGA 2YUSA 1Q1VA 2G7GA 3ZQGA 1X2MA 1MBHA 2XRLA 4EEFG 4D5CA 5C4JJ 2JA5J 4GFLA 4AF5A 3CCYA 2M34A 4XK4A 2YVHA 2OPTA 2CQXA 5IYBJ 2VKVA 4UUSB 2F07A 4D7MA 2HXIA 3MNLA 2L7MP 3JR9A 2WGBA 3V6GA 3TW6A 1SANA 3BR2A 4XRSA 4BBSJ 4MK6A 1JUMA 3FRQA 2GBYA 2GM4A 1TWHJ 2L7FP 2HQ5A 2UXUA 4AYBN 3F1BA 3BTLA 3LHQA 5DAJA 2IAIA 3QBMA 2NVQJ 2KT0A 2R5ZB 9ANTA 3E7QA 5K58A 3Q0UA 1P7IA 2DTZA 3GEUA 3FK7A 5IYCJ 3S1QJ 3ON4A 3RH2A 3RD3A 2NP5A 4BY7J 2DA5A 1U9OA 2HOAA 4Y7NJ 4J19A 4GFKA 2R5YB 3K7AJ 2I10A 1ZTRA 3H0GJ 1W0UA 2R5YA 5C4XJ 3HKZN 2NS7A 4JYKA 2R92J 1JUSA 3JRHA 3BQYA 3RZOJ 2LR8A 2XGDA 4IHXA 1JJ8C 1YRNA 4I76A 2DJNA 2ID6A 2NX4A 3G7RA 4A3CJ 5F04A 1JT0A 1FIAA 1U9NA 2ECBA 2XB5A 4MO7A 2K40A 1ZQ3P 3P9TA 2LLKA 2ZB9A 3HOYJ 3RKQA 3HTIA 1ETYA 4BY1J 5FLMJ 2G0EA 2DMTA 2XPVA 4W1UA 3GTLJ 3NPIA 2NVTJ 2OERA 2RHAA 2LTPA 3HOWJ 4L62A 4V2FA 4C3HJ 3ZQHA 1GVDA 1SFOJ 1ITYA 3LJLA 5HSZA 5FKOA 4PXIA 3A01B 2Y2ZA 3S17J 4IHYA 5FHPA 5J1UA 1XS9A 1TWGJ 1Z0XA 4DYCA 4L5EA 1ORKA 1OCPA 2DN0A 2VI6A 1FEXA 3CJDA 3GTPJ 1JGGA 3BG9A 2NVXJ 4ME9A 2DMQA 3LOCA 4KWAA 5F0HA 5IP9J 3BR1A 1LE8B 1FTZA 3Q0WA 4A3EJ
chains in the Genus database with same CATH superfamily
1UZCA 4XICA 2HDDA 2QKMB 3DP7A 1HW2A 2EH3A 4DW6A 3BJAA 5KAFC 2ME0A 1EJ9A 4YFNF 3U2RA 5CXIA 4XRFA 4ZTFA 1U0JA 1O57A 4OIQF 3WTTC 1I27A 3DKYA 1RUNA 4P1WA 3EUHA 3FKIJ 2CH0A 1FP1D 3CCMI 5F1JA 4M6YA 5KVRA 5FO5A 3HGYA 5BOXA 5K7ZA 2FMLA 2Y30A 4Q5SF 3K9TA 4UVBA 1UG2A 4RM3A 4UV9A 2XDNA 3K4BA 5K5OA 2DA1A 4RDUA 2HYGD 2X6WA 3OYDA 1V55H 3TGNA 4A3LJ 1R58A 4A3IJ 5F0FA 2W25A 2O7OA 3SZTA 2JSCA 2BW3B 2F5FA 2H6CA 3I0TA 2PMUA 4D7NA 1VQ7I 4X6AJ 1FBUA 1ZGAA 3BT9A 4FTHA 2FE3A 1CF7A 3BG7A 2K5CA 1R5ID 4DNCA 1P4AA 2I5UA 2EFNA 1DUXC 1B72A 2GZWA 1VNDA 2DQLA 2MH2A 4CCOA 1WCMJ 3WU2C 1ZARA 2M4KA 2K9MA 5DEQA 1H0MA 3CC7I 4FT8A 2JA2A 3GLLA 1WI9A 1T0FA 4RM2A 3LMMA 4JX6A 4BHCA 4A93J 1UAAA 3RDIA 4DQ2A 5D6FA 1DDNA 2JTVA 1MBJA 4HDVA 4B3AA 3WHBA 3CRJA 5JLWA 5FGLA 5L3EA 1HW1A 2XIGA 3HSRA 3I4MJ 2XROA 5A2QK 4YIIA 2FU4A 5EZHA 4G7HF 2AQFA 3SFIA 2M8EA 1JTXA 3OWTA 4HBLA 4Q47A 3D5RC 4PGHA 3LSPA 4MFEA 1APLC 3OSGA 2MLKA 1R23A 1QRYA 3BHQA 3AKZA 4I7HA 2PBXA 3ANPA 3HIMA 2CYYA 3ON2A 3FZVA 5LRRA 3TKYA 2ZMEA 4ITVA 2A6TA 2XGCA 4XKBA 5J6XA 2HOSA 4AVPA 4LB5A 3E6DA 3RQ4A 5HLIA 1ONVA 1R1VA 3LSMA 4PJMA 2YU3A 1Z9CA 3LFUA 5L3GA 1UHSA 2QVOA 2B0LA 3PUFA 4IHTA 3BG3A 4BE1A 1YRNB 3GEZA 1KU3A 3WG9A 4C3IJ 1OR7C 4ZTJA 2P7VB 2M5WA 4YRVA 3OYKA 2DO7A 2VQCA 1I1GA 2WV1A 1JE8A 5EG0A 2ICWG 2CG4A 1BW5A 1QVTA 2KDOA 3ABTA 3IP4B 4KN7X 3KEYA 2A3SA 3HZJA 5J47A 2STTA 2YR2A 1LFPA 2HR3A 4UB8C 3CCVI 2RASA 2LY1A 3BR5A 3R61A 2RV8A 5CPRB 2D1HA 2OUMA 3K8PC 4CH7A 1XDSA 5E1ZB 5HBUA 1MD0A 1V5GA 2X48A 5H20A 5E17F 1IC8A 2LF8A 3QKXA 1MBEA 2OAZA 5K5QA 5D18A 1WVRA 1EA3A 3ASNH 4BH9A 1R71A 3HTJA 3A4CA 4KUMA 5IP7J 5C3EJ 4XN3A 2UXOA 1IXSB 2IVMA 2JMWA 3SHFA 1HBXG 1ZGWA 2GFNA 3VW0A 2W1OA 4UUVA 4N9HA 1N78A 2EB7A 3LSHA 1VQ6I 4JQFA 4HG2A 3OYNA 3V8JA 3D5SC 5EDNA 5BQTA 2XKOA 1GXPA 3RYRA 1ON1A 1VQPI 1HF0A 4LG0B 4BACA 3KKDA 5E3NA 2E60A 4AUXA 3FM5A 2M30A 2O03A 2CJJA 4Z2YA 5ILVA 2A6HF 4XLNF 2ZXHA 1RKTA 4JOMA 5EEHA 4R1HA 4EMSA 4RB1A 3OOPA 3FXQA 2COMA 5KK1A 1BOAA 2NS8A 5LHHA 3SDGA 4EQQA 4FX4A 3S3MA 5JVGF 2P5VA 2PN6A 3HPHA 3CMYA 5BMZA 1CF7B 4CHUA 2HI3A 4HX7A 1ZG1A 2VE8A 2FBQA 1ZAOA 2BXYA 1B72B 4XIDA 5DCMA 2E1CA 2F2EA 3VYRB 5E1WA 3LNQA 3JTGA 5E18F 2LREA 1JI8A 3OY9A 3ISPA 5GAEJ 5IY5H 1LFUP 4A6EA 2GXAA 2EFQA 3HRUA 4ZC3A 3P9CA 2OC6A 5AIQA 5B3SH 2IS2A 1OLTA 1T38A 3BPVA 2ID3A 5EEAA 3CC4I 2VL8A 1U5TA 5H9TA 4H0EA 3HSFA 1TNSA 5LEJA 4LLGF 3PIOF 4BXXJ 2JVGA 3SFZA 1USTA 1H8AC 3K4JA 3FKJA 3ZQIA 3C07A 6PAXA 4MTDA 2LH9A 5GTIC 2V26A 3F8NA 3HOXJ 4MQVA 4G7ZF 2P5KA 1WHUA 2PMHA 5M5XJ 3VVYA 2ZMEB 3PNTA 3OMYA 1ZR4A 2GXBA 5LD2C 2QBYB 3CJQB 4XLPF 1BI1A 3WE3A 2O9LA 3O60A 3TDZC 4IRVA 2ZKZA 3IUOA 2XF7A 4UUSA 4U87A 3OOUA 3R4KA 3HTHA 1VQ5I 3K69A 2Y48A 3L2VA 3GXOA 4OOIA 1W7PA 1Y0UA 2HQNA 2DLLA 2VXZA 4WXCA 5FD6A 4PGGA 3DTKA 1TZLA 4YIRX 4X0GA 5JLXA 4A3MJ 3AG1H 5TJJA 4U7BA 3HXLA 4KITB 3FWEA 1IRGA 3QP6A 4QPOA 1LVAA 3MKYB 2KKOA 3QQAA 4XL9A 3NWSA 2VKDA 2HYTA 2VB6A 3RSNA 3OSFA 2KP6A 2ECCA 4KT6A 1XB4A 4FE7A 1AOYA 1YTYA 3CJNA 1X1CA 2UZKA 2L5QA 2RQPA 3SEQA 5DUKA 2BHYA 3KZZA 2G7UA 2JSPA 2VC0A 3TBIA 4AIKA 1ZG5A 3ABLH 1CQTA 4FX0A 2RREA 1YLFA 5LFAA 1I5ZA 2VOOA 3CTAA 3O6BB 4LK1F 1HKSA 2DI3A 1FPQA 2LSOA 3PQKA 1YYVA 2BHZA 5H2FC 3BTJA 3W6JB 4E7ZA 4RBOA 1XPXA 2CV0A 1B4AA 2KMUA 1G3WA 2NS0A 5LGUA 1S3JA 2FA5A 2GXGA 2NOGA 2R3SA 4H4KC 3WTXC 2BBYA 1O3SA 3DEWA 5DUIA 1VQ4I 2JQ7A 3CCRI 4XKVA 1REPC 3BWGA 4YFKF 2V7FA 2FBIA 2DA6A 3P7NA 1IN4A 3W3CA 1RR8C 3CUQC 3IH4A 3CCJI 1K4TA 2Y9YA 3I58A 1X4OA 2OCEA 2RC4A 1DU6A 2IW5A 3LSJA 2IPQX 3WGGA 3V8KA 3DLLF 5FLVA 1LE8A 2CQQA 2BYVE 3K70D 1XCVA 3Q5FA 3HDDA 3A02A 2Z16A 3L2RA 3WTZA 2HYFA 2PMZA 1EH6A 2A68F 5ILSA 3AG3H 1VZ0A 4IZZA 1L3LA 4P96A 2BY2A 2CQ7A 4CCKA 1FBQA 2F5EA 2R7XA 4QTRA 4XOTA 2GA1A 2UXHA 1W1WE 3PL8A 5E3LA 5H6RA 3BROA 1S7OA 2DFHA 3RZDJ 1LEBA 5K1YA 3CLQA 3QYFA 1Y56A 4L9NA 1IN5A 3KYCB 3KYDB 1ENHA 2V9KA 4UV8A 2F5CA 2JA8J 4NC8A 5HS8A 1I3QJ 3E97A 2ZY9A 3ERMA 1YW7A 2CUFA 2NXNB 4MIMA 3LQRA 3GLXA 1JGSA 3MFKA 3S14J 3KEQA 2PJPA 2M3AA 3BZCA 1UI6A 3RIRA 2D2WA 1JXSA 2BOLA 3LSGA 4WK8F 1GT0C 5GAHJ 2O6GE 3H3UA 1Q1VA 2W57A 4EEFG 4N9IA 1MBHA 2G7GA 4GFLA 5HDKA 3CCYA 4XK4A 2QSGX 4PSXA 4BJ6C 4U0YA 3G6EI 4BJ5C 5IYBJ 3LAPA 1PDNC 2ISYA 4UUSB 2UXXA 4OAZA 4Y17A 4D7MA 3F8FA 5LEKA 3MNLA 3GVAA 4I0AA 3EQLF 3TW6A 3JR9A 1FWZA 1SANA 4L18B 2RQQA 1V4RA 2ZO4A 3HJEA 5E1XA 1W7PB 4CXFA 4B48A 1WJBA 1BI2A 3V8LA 4CCLA 1S8NA 4YELA 1BR2A 3F1BA 3FXJA 4S05A 5HLGA 3QBMA 3GO5A 3OR1C 5ICGA 2VPLA 2P6SA 4HV6A 3E7QA 3K4KA 5K58A 3VODA 3C7JA 5ED4A 3GEUA 5BS6A 1ZG3A 2Y0SA 4HEA2 3VSLA 3BJOA 3BZKA 2L9VA 4XOPA 4L5IA 2VQLA 3GW2A 4GFKA 1BC8C 1X4PA 4ZYDA 4YEJA 1B59A 2I10A 2K85A 4ANJA 3T5XA 1ZTRA 1W0UA 2R5YA 5C4XJ 4FQGA 1S5LC 4I99C 2ELHA 3WU1B 1Y6IA 1P6RA 1X1PA 1P92A 3RZOJ 1DP7P 4GXOA 2HQRA 4KYWA 2KHMA 2FSWA 3NQOA 4HOBA 5F04A 2D45A 1HKQA 5TRDA 3QPHA 2BY1A 2XB5A 1Z05A 4DBQA 2Z5UA 2R7UA 2ZB9A 2JPBA 1G3SA 1QQIA 2L4MA 2XPVA 5FLMJ 4BXUA 3BC8A 1XMXA 3OYBA 3ERED 1J9IA 4LGWA 2NVTJ 5LGNA 2CW0F 4ZH4F 1Z67A 1SVMA 4M73A 1SFOJ 3W2VA 5DDGA 4IRHA 4L5JA 2Y2ZA 2OTJI 4G6TB 4XM3A 3TOAA 4A0YA 4E7IA 4IL6C 3AG4H 5J1UA 4Y3OA 4DYCA 2MH9A 4CYDA 3CCQI 1UB9A 3OS1A 5A2QZ 4CUGA 1OKRA 1LQ1A 2NNNA 3L7WA 1WRJA 4E7JA 1SD6A 4XBFA 1JGGA 3V7SA 2NVXJ 3CCUI 2VC1A 2KRFA 4E6KG 3G73A 5IP9J 1LE8B 1USSA 1FTZA 2E71A 2ZNYA 4PFPA 3ZMUA 1TL8A 3S5RA 1FLIA 3JRAA 2K4BA 3PPBA 2V9VA 3PM1A 2R7ZJ 2QQAA 2ZCXA 3RKYA 2JRMA 5M3FJ 1MMGA 4HQMA 4A3FJ 4BYYA 2WUIA 5D5XB 5TISC 4ZZDA 3WTVC 3HUGA 3BOQA 3OR2C 2FXAA 4HQEA 2XPUA 4DVYP 1OCCH 1X3UA 2V4JC 1GUUA 2K7LA 4UB6C 1WZ2A 1MZBA 2LP0A 1A6IA 2L9NA 1JKPC 3RKWA 2ZNZA 3NEUA 2PMZN 4DYRA 3CC2I 3ROUA 3K1PA 3JTHA 3BRUA 4M3DA 3J7ZI 4LOCA 1POGA 1W5SA 1QGPA 2B63J 4BU2A 3I55I 2OI8A 5JR3A 5KAIC 2Z1DA 3E1SA 2KIFA 4DIQA 1YI2I 1YIOA 1STZA 2BW3A 3FDYA 4KIGA 2LMDA 1B6AA 4RLQA 4UVCA 4ON0A 1OFCX 3G1MA 1ZGJA 2ZBKA 3JAMZ 2AHQA 1LDKB 1QZEA 5HLHA 4HSTA 3JRBA 1YJWI 4AC6A 2CUZA 2XAQA 4BNCA 1WH5A 4HF1A 1A04A 5EGOA 3HOUJ 3BG5A 1W36D 1MGTA 2CQNA 4PUSA 4EM1A 4BGDA 3VOXA 1IG7A 3V7RA 2RGVA 1LFBA 3FM3A 3CESA 2VPRA 3J7AO 1KQ0A 2HDWA 2NYXA 4IQJA 1SFXA 3MZ8A 1F43A 2DPDA 3HTSB 3ZGKA 2NP3A 4AYBA 3ABKH 3NARA 2R7SA 1FYKA 1I39A 1QO0D 1D0ZA 2WA0A 3CP2A 4RGSA 1YOVB 1J7KA 4BHBA 4E7SA 1MNDA 2ZSIB 1QHGA 2DMNA 2F5DA 3BR0A 5FFZA 4F3QA 3HOVJ 2QKOA 3VPRA 2YPRA 2ELKA 3VOEA 1X1DA 2HVQA 3H9JA 2ZXWH 3DWLE 4BDZA 3QYEA 2QYOA 1MDMA 3B6AA 3IL2A 3LSTA 2M8GX 3RPUA 1TLHB 4ACIA 1YJ9I 2KFDA 3WE2A 3R0JA 3A03A 3FHZA 4XLEA 2X1CA 3UKGA 1XGMA 3G4SI 1WSUA 3BDDA 3FMQA 2VN2A 2JA7J 1WJDA 1MBFA 2DT5A 1MJ9A 1JT6A 1W4MA 3K2ZA 3M1CA 5H6QA 2NVUB 2FBHA 4ENJA 4RB0A 2W82A 3IRQA 2OF7A 2ELJA 3L09A 2MGQA 3ZRGA 2XKPA 1HA8A 4B3XA 3HM5A 2M87A 2Z9OA 4RB3C 2LRDA 4II3A 2EV5A 2HNHA 2XUBA 3I5UA 1JTYA 5DM7F 1U8BA 3T8TA 2DG7A 4IHWA 3BTIA 4RB2C 2CV2A 4EVIA 3VYTB 2VQGA 3WODF 1O7LA 2ME6A 5J8FA 2K02A 4M3BA 4BEHA 4RA2A 2X85A 3JREA 5FKKA 1D5VA 2Z3YA 1HDDC 5F0CA 1Y1WJ 3OIOA 3F22A 4JP0A 4ZDLA 1Z7UA 3LA2A 4GDFA 3RKXA 1FSHA 2HS5A 1G6NA 2K9LA 3ZOBA 2CUJA 1G4DA 2HU9A 1XDUA 2QZ8A 4CCJA 1ZKGA 4XSXF 4NN1A 2HVSA 2CU7A 5TGTA 1C0WA 4IHSA 2FBKA 3HUGB 1Y0NA 2GIVA 3I4PA 3WG7H 3MKWB 4B1RA 2O8KA 3DLAA 1Z77A 3N05A 4LG0A 3AQTA 1J5YA 3EETA 3RPQA 3ZCOA 2MD5A 5FB2A 4A6DA 3IH2A 2DA7A 2VQHA 3NXCA 4ESBA 1U6GA 2WB1N 1A5JA 2K27A 3AQSA 1IXCA 2E7WA 5IOZA 1X3ZB 3E7LA 1JHHA 2QSFX 1UG0A 3K4MA 4RS8A 3N97A 3CMMA 2MC3A 3IC7A 2J5OA 2EJRA 2KPMA 1YFHA 1TW3A 3O8GA 2GENA 3SEZA 2HOTA 4K2EA 1PJRA 2V1DA 3FBIB 4XNFA 4BE2A 5ICCA 2MG4A 2H8RA 3OIQA 2XAGA 4G12A 2HXOA 4XRSG 4N4OB 4A3DJ 1VFCA 4CO8A 2XAFA 3KKCA 2IA2A 3ONQA 5EGOB 3HIFA 4MTEA 4YFXF 1KYWA 1RC9A 1HQCA 2V9PA 5HS7A 4LLNA 3K70C 5HDNA 2QWWA 3J81Z 4HLXA 2MD0A 4KT5C 4X1EA 3GTGJ 2LD5A 3DKXA 1X19A 3MN2A 1VF9A 3K0LA 2OJED 2FNPA 1H9GA 4A3JJ 1UCRA 2XF5A 3H5AA 2JJ7A 1UELB 3GMEA 1MSEC 5K7HA 2DMPA 1OCRH 2DYSH 4XMYA 3I64A 1WI3A 5GPCA 1T33A 1ZHFA 1FZPB 3NWTA 2QBYA 1MDMB 1DU0A 4NBQA 3VTIA 3D5LA 3PFYA 1HSJA 2ZJ2A 5CKTA 5FKMA 4II2A 4D5FA 3ZQLA 1IUYA 1IGNA 1TP4A 4MLOA 2DPUA 2O61A 5E3MA 4ESFA 3S1NJ 2LYCA 1E0EA 1MW7A 4B43A 5E8GA 4C30A 2A5YB 3M3YJ 1GVJA 4WWCA 4OD4A 3FMRA 5D19A 5D1RA 4MGRA 5E79C 3O8HA 5FMPA 4PCQA 2R5ZA 2IS4A 2GWRA 2M0CA 4ZYAA 1G2HA 3ZMTA 4RGUA 2PI0A 4B4CA 2M7BA 1T2KA 4AM3A 1OJLA 2M45A 3HC7A 3AL0C 1QA6A 2A61A 2FEZA 1JKQC 3C2HA 4IQ4A 1FJLA 1SD4A 5B5EC 1UI5A 1QVUA 1XN7A 2E5ZA 3VB2A 4E7HA 3G2BA 1AHDP 1TQPA 1S9HA 3KP3A 1GV2A 1FT9A 4BEHB 3JAMK 1M1EB 5J1YA 1HC8A 3VW2A 2M4GA 3IAM2 2BVLA 4LIUA 3H1CA 5HODA 2F4IA 2KIQA 3JCUC 5KNLA 3SZGA 3KNWA 3A0HC 2EZLA 3EYYA 2OBPA 2COBA 4AU7A 3WGIA 4GYGA 1MJAA 1MH4A 4RAZA 1Q1HA 3M8FA 1IXRC 2GAUA 3HBLA 3MMYB 3S1RJ 2RAEA 3BP8A 1YJNI 2D6YA 2ESHA 2XDVA 4IF4A 4CGZA 3CD6I 2VBYA 5JHFA 2FF4A 3ECHA 2PZ9A 2ZSHB 1DP3A 2W48A 2XVCA 4KA4A 1R9TJ 1VQOI 1RKWA 2Q0OA 3B6CA 3H5RA 1FMWA 2Q24A 4OINF 5JFRA 3T1BA 3BJ6A 1HKTA 4IEJA 1K78B 4EGYA 2GIZA 2OV7A 4PSWA 3CUQA 1SMYF 2JUCA 1IDZA 3MAJA 4QIWN 1XGOA 1G3YA 3H92A 4LFUA 4WIBA 4C2MA 3E5UA 3F0CA 4GCLA 1ZLJA 4V2GA 3H35A 4M3EA 1K7AA 2F48A 5GP9A 3CP8A 4WF2A 4FETA 4FCYA 3A2KA 3ZMDA 3F8MA 2D5VA 1N75A 5F08A 1LDJA 2EV6A 4RAGA 4EM2A 1O7FA 2K9SA 2PX9A 4EV0A 4IOCF 1XSVA 1O3QA 4IOAF 2Y69H 4QWQA 2E36A 2IGMA 3DV8A 3ABUA 3REOA 3WGHA 4CICA 4P55A 1QU3A 3NS4A 2HDCA 2CMPA 4ZDPA 3T6NA 1LPQA 3ZMSA 1Y1VJ 2PJRA 5D4RA 4LB6B 4HX8A 3WTUC 3S16J 2G9WA 4ZYGA 3L2CA 2EPFA 3M7GA 3KP6A 2YUSA 1P9QC 1X2MA 2XRLA 4AF5A 2JA5J 1L0OC 1F1ZA 2OPTA 2VKVA 1R22A 2F07A 2DT7B 1ZN2A 4F93B 4HYEA 5ERIA 3BCBA 2XHKA 2A5WA 4BBSJ 4MK6A 1JUMA 4PJLA 4GO1A 1I1SA 1TWHJ 1MJBA 1SD5A 2IAIA 4O5VA 2R5ZB 2NVQJ 4L9VA 1OMIA 2MFZA 2ZFWA 2WV0A 3ON4A 2NP5A 4BY7J 2DA5A 4IO9F 3DPUA 3C2GA 3K7AJ 2ZXJA 3I59A 4HZFA 2JPCA 2DTRA 3SYTA 3CCSI 2DBBA 1BBYA 3I56I 2KJBA 3J7YJ 3JSPA 1DPRA 1W36C 1VQKI 3QOEA 2EINH 3SZPA 3JRHA 3OIPA 4PK4A 5DYMA 3DPTA 2QA4I 2L7KA 3RTRA 4WCGA 1G3TA 3CDIA 2DJNA 3VWBA 1VQLI 3G7RA 4A3CJ 1JT0A 1U9NA 2IA0A 3TOBA 1RNLA 3K4LA 1GHCA 4M9SA 3QOPA 1OQYA 1Z1DA 3ULQB 3DFGA 2XAUA 3M1EA 4BY1J 2O3FA 4W1UA 2XGXA 3KP5A 2BEOA 5HS9A 3GTLJ 2P8TA 3J81K 1DGWY 1TBXA 2RHAA 2XF6A 2LTPA 3GFMA 4ZYHA 4V2FA 2AXTC 3ZQHA 1GVDA 5HNHA 4NQWA 4PXIA 3WTWC 3VYSB 3DTEA 1YITI 1ZELA 3PFIA 3LQQA 1HSTA 2Y0MA 1R5HA 1FEXA 4LK0F 3F8CA 3GTPJ 2ADUA 2DMQA 4KWAA 5F0HA 4C9YA 1BIAA 4KFCA 2K4JA 4XN0A 1AKHA 3HYIA 2R7WA 4HNTA 3DPJA 3NI7A 3O3KA 1RRJA 2JRTA 4HF2A 4QPQA 4BE0A 5LBQA 1YHQI 1MKMA 1TTYA 3CUQB 1H89C 3GTQJ 1R7JA 4J01A 1WQ2A 2W00A 4KISA 5GAGJ 4DGWB 4FE4A 2L9RA 1E3PA 2CUEA 4N0BA 5JHUA 2X6OA 1Z21A 4FHTA 3BJBA 1EH8A 3L9FA 1FOXA 2L9SA 2E1NA 1W0TA 2R7RA 3LSRA 4OWRB 3FXRA 3RQIA 5JI6A 5IT9Z 1XSXA 2EV0A 2STWA 2VJIA 3S3OA 3VEPA 3VSKA 3M07A 1OCTC 5HDGA 3EUPA 4HW0A 2UXIA 3G71I 3ZQCA 3HPGA 1GLNA 1JJ6C 2C6YA 3W6KB 3FXLA 1X1BA 2YX4A 3BQZA 2PJRB 2KIMA 5LHGA 2DMUA 5FRNA 4A0XA 3U9GA 3J80K 3IWFA 3BR6A 1HDPA 2L4AA 2A2FX 3DU6A 2RDPA 2QIBA 5D6EA 1BIBA 2QSHX 2MSYA 1YX5A 3S15J 4EJOA 2XV4S 4AWXB 4JBAA 1VQNI 2TRTA 4BUPA 2R93J 2R7TA 3IKVA 5C4YA 1D5YA 3K4CA 4QLCU 5M5WJ 1E3HA 1XCBA 1EV7A 3JRFA 2FNAA 4G8XA 2A07F 4EJUA 2R7FA 2FOWA 1QZZA 1P7JA 2Y75A 1U2WA 2X4HA 4Y33A 3S8PA 1J0RA 3GF2A 1O3RA 2H8WA 3F3XA 4BQOA 1D1BA 4M3GA 2VBZA 3WHCA 3H3VK 1MMSA 3HE0A 3GTOJ 3BY6A 3MKZA 5L3BA 1FP2A 2EFPA 2HYJA 3I59B 1FOKA 1T56A 3FIWA 3WTSC 1UHWA 4WX9A 3DEUA 4HNVA 1H88C 1QPMA 2ZXIA 2OQGA 3KZIC 1NG7A 4OIOF 4A2UA 1YW9A 3G1OA 2IP2A 4P9FA 5J8CA 3OYFA 5CVUA 1ZK8A 2V6CA 4DYQA 4Q4ZF 3E3VA 1T98A 3F6VA 3HKZA 1XMKA 4NELA 5D8LB 1LJ9A 1J75A 2CO5A 2VIXA 4YZEA 4WXHA 2W7NA 3P9KA 1R36A 2PFVA 5CVJA 3QPSA 2ZOZA 4HKUA 3C2BA 1O4XA 1GDTA 3HHGA 4LD5A 4F7ZA 1Z6TA 1PUEE 3LL7A 1A36A 1OISA 1S29A 3SJMA 4XQFA 1UHMA 1Z6RA 2HTJA 3GFJA 4NQWB 2Q1ZB 3E5XA 3QAHA 2GA2A 3HRSA 5ICFA 3E6CC 2IXSA 2AQEA 4HAMA 2EZKA 3CWRA 3LWJA 2L3DA 3KEOA 2Y31A 1IW7F 4CCNA 3H36A 1D8KA 3OYCA 2H1KA 1WJEA 4ZJZA 3F23A 2A05A 5K7FA 4UXNA 4CZZA 2P81A 1JUPA 4RAYA 3GFLA 4ENKA 3FX3A 4XLHA 1WJAA 3FK6A 1R00A 1AKHB 3IKTA 3I4NJ 1MBKA 2MABA 2OD5A 2DK8A 3LWFA 2LKXA 2JK3A 5DV5A 2LVSA 4UVAA 4CSWA 3WU0A 4U9NA 3KE2A 4KJZA 4NC7A 4EGZA 3COLA 2MW8A 2Q2EA 4BS9A 4NB5A 4UHTA 1IDYA 5IYDJ 2BZTA 3ANGA 2M2EA 3VFZA 2DFEA 3OYGA 1MSFC 4RAFA 1B8IB 1V5FA 2E2JJ 5GTHC 2G7HA 3LSIA 1MBGA 3PNYA 2YVXA 2OCCH 1IRFA 5EF6A 1MNEA 1SFUA 1S6LA 4XKWA 2XGEA 3M4OJ 1FY7A 2NRAC 2KRHA 1PVEA 5J4VA 5CQGA 1ETVA 1TT0A 5AONA 4KICA 3NRGA 2BGCA 4ETSA 4MEYF 5D5WB 2ACJA 4B44A 1DQUA 5ICEA 2Q8KA 4BAYA 1H9TA 5EYRA 2IT0A 2WY7Q 3K10A 4I2OA 2HZDA 1FIPA 3MKLA 1T6SA 4JK1X 1R4MB 3V42A 3G3ZA 1ZRFA 5FKNA 2O8XA 2DT6A 3ELKA 5EZGA 4JX5A 1NK3P 2VLAA 3PO3J 1E3OC 3ZQ7A 1RZ4A 5EJCA 3S2HJ 1RR7A 1MIJA 2F4MB 1PUFA 4A3BJ 4OU0A 1D1CA 1U8RA 3VP5A 3GCMA 2B7EA 1RPWA 1SD7A 1XC5A 2WAEA 3CF2A 2QQ8A 3KLOA 4ICHA 1F9NA 1RI7A 2FJ1A 3I53A 4L0ZB 2YVEA 2H1LA 1R5GA 3SXYA 2X9DA 3HOSA 3F72A 1TQIA 3ZMZA 2W4SA 3CCLI 2NOJB 3KP4A 3HTUA 4BHPA 5E8IA 3OS0A 1ETWA 4JX4A 2W53A 4NNJA 3U21A 3IHUA 4P9UA 3B73A 2PLYA 1SFEA 1KU2A 2BVMA 5F27A 1QPIA 1ULYA 3PSIA 5GADJ 1TC3C 4OMZA 2DODA 4S04A 5IT9K 3SWHA 1IF1A 1VQ9I 2Y0SN 4A5NA 4NHJA 5FGMA 2REKA 2L54A 1NG6A 1ZYRF 4ASNA 1YS6A 2QKLB 5ILUA 1ETKA 2LF7A 2QLZA 3LA7A 2IA1A 5F1RA 3COAC 1OCZH 4NDLA 1SAUA 2BY0A 3I54A 2EZHA 2ZFUA 4M6VA 4LIVA 5BNGA 1N25A 4F55A 3UNGC 4W97A 2R7QA 3JSOA 2W84A 4Y15A 1BL0A 2ZJPF 3RJPA 1TWCJ 3HOZJ 2UWMA 5FD5A 4MFDA 3BPXA 3MEXA 4KN4X 2V57A 2FOKA 4U88A 2G3BA 3F8BA 1MMDA 2QOPA 4I0BA 2K3FA 3DCFA 1JKRC 2UXNA 3NAUA 2CQKA 4GCTA 2M1BA 4M3FA 4UNOA 3I71A 3F9KA 5LRSA 4C3JJ 5IP6A 1HOMA 2VXDA 5BPIA 3QPLA 2O5RA 3E6BA 2WAQA 2Q2EB 3UR3C 3A01A 1BW6A 2LFBA 1JKOC 3ZN1A 4ZZLA 2GOXB 5GPAA 1UMQA 3OYJA 3H0DA 3FHNA 3CDHA 5F64A 2P5LC 1LUJB 2X6YA 1ETQA 3PASA 2DG8A 1XTAA 3GX4X 4WXDA 2DA3A 2QWTA 4XKCA 2MYSA 2EQRA 3L2WA 1QZYA 2TDXA 2IU5A 3NRVA 3KCCA 5DD8A 3DEEA 2I8DA 5E20A 4F92B 1B9NA 3GTKJ 2VUMJ 5B1BH 1Z3YA 2O0YA 4KDPA 2VT3A 4KIBA 4C2MJ 1K78A 1W7PD 1LVKA 1X2NA 3EPZA 4O3MA 1IV8A 2E2IJ 1V3FA 5CVRA 4GFBA 4NUBA 2FQ4A 3VW1A 2VASA 4GYIA 1WGXA 3CCEI 3GBGA 3DBHB 1XMAA 1KZHA 3SDBA 1EKEA 2WADA 4BQNA 2JA6J 3EGQA 1T8IA 2FD5A 2R4GA 2E2HJ 1I6HJ 1Y39A 2CW8A 4F52A 4HLYA 1HW5A 2JN6A 4XONA 1PUFB 3VVXA 3KX2A 2VJJA 3V7CA 4D0PA 1BJZA 1N77A 5LLQA 3J7AY 2AS5F 2J5PA 2OZUA 2QUFA 3IH3A 1TWAJ 3R0AA 2LBFB 1X1AA 3JRIA 3VVZA 4BJTA 4MEXF 3BCGA 2JUGA 4R8HA 2X51A 2EK5A 4LMYA 1D8JA 1KQ9A 4D9JA 5C4JJ 2CW7A 2M34A 1KQ8A 2JT1A 1FYMA 2YVHA 4TV7A 2RKHA 3C1DA 1R1TA 2WGBA 3V6GA 2LKSA 1F5TA 4HX4A 2IRFG 2GBYA 1R6RA 4U9LA 2K86A 1SMTA 1JHFA 2HQ5A 2UXUA 4AYBN 3LHQA 5DAJA 3CMEI 1KONA 2KT0A 5FLXZ 3DU5A 1KGSA 1XGSA 4PJJA 2DTZA 3FK7A 1YQAA 5IYCJ 3KYLA 1KA8A 1TT5B 3RD3A 1U9OA 1FOYA 2HOAA 4J19A 1W5TA 1LB2A 2EIKH 1BJAA 4Z6YA 2DOEA 2EWNA 1IAWA 1DPUA 3OYLA 2HOEA 3BCAA 5CJ9A 4JYKA 3LA3A 1T95A 2ETHA 3JW4A 5KHDA 1EH7A 2V1UA 2R92J 2VJ4A 2LR8A 2XGDA 4IHXA 3TMOA 3GZ5A 2JVHA 3ASOH 2QEXI 4E70A 2OZ6A 2NX4A 3H9GA 1FIAA 2ZJQF 2ECBA 2RN7A 4IRIA 3AL0B 4MO7A 4BL0B 1ZQ3P 3K1NA 3P9TA 2LLKA 3DXJF 1FYLA 3HOYJ 3CJTB 3RKQA 3HTIA 2GOMA 2E35A 3J80Z 2XC7A 3AG2H 2G0EA 2DAOA 1R4NB 2Z99A 1KU7A 3FXMA 2RNGA 5AIPA 1DGRM 2CFXA 3PNVA 3OV8A 3HOWJ 3DBRB 4C3HJ 4PZJA 1WJ5A 4M72A 5IT3A 2XASA 3A01B 3HOTA 2YSRA 4GRIA 3S17J 2K3PA 1TW2A 1ZH5A 2DFFA 2UUZA 1Z0XA 1WJFA 1E17A 5D5UB 4YIFA 1ORKA 2X1EA 2DN0A 1J09A 2M7AA 2VI6A 3EUHC 3KLNA 2DU9A 3BG9A 3S32A 3KPHA 1NHAA 3LOCA 2VBWA 1K4SA 3BR1A 3CLOA 3BLYA 3Q0WA 2X1DA 4A3EJ 2MLGA 1BC7C 3O2PE 1YS7A 4RGRA 2WAQN 3U1KA 1K6YA 2FRHA 3JSJA 1LNWA 2E1OA 3OL3A 2E34A 3CF5F 4ENMA 2H09A 2KJCA 3RCOA 4CCMA 1Z7LA 2E5NA 4A3KJ 2WTEA 3BNIA 2L0KA 1IN8A 2GQQA 4P5OA 2VBXA 4FASD 2H6BA 2X6XA 4LJZF 3Q3SA 2HKOA 3FMSA 2LG4A 3KZYA 4JL3A 1S7AA 2KQRA 3VYUB 2QQBA 3CJRB 3QYBA 3MZHA 2EBIA 4NC6A 4PFOA 3TO6A 1T0FC 1BA5A 3IWZA 5M5YJ 4MHGA 4DZPA 3R6SA 2E7XA 2F5VA 3Q9SA 3DQVC 3V78A 1IV6A 1K6OA 2KLOA 2NAZA 4R79A 2YX7A 2HEOA 1ERDA 2DA4A 2IS6A 2HZTA 2DDBA 4M9ZA 4XLFA 4OD5A 4AIHA 3S3NA 3GZIA 3GWZA 2MBFA 2KZVA 4A69C 4L0YB 2XAJA 3M9AA 3IUVA 3I9V2 2HTSA 3JRDA 1OPCA 3OL4A 2QGUA 1XSDA 3HGGA 3QRFF 1D1AA 2K9NA 1ODDA 2ZMEC 1SVLA 3VOKA 4G94A 4KMFA 5L3DA 3OS2A 5J1RA 3S2DJ 4HDUA 1HLVA 1MMAA 1XX5A 3QWLA 3PO2J 4OIPF 3S1MJ 2B1EA 4IXAA 1F36A 1NK2P 3KETA 4BQQA 3B81A 2YS9A 1IN6A 2NVYJ 3RYPA 2GLOA 4CYCA 1YE9A 4IPAA 2Y9ZA 4D1QA 5C44J 1TNTA 3BZ6A 5B66C 1ZR2A 2DFIA 2HKUA 2KL4A 3G56A 1ZRCA 3IV5A 3GTJJ 1SFKA 4EM0B 5F6FA 3G1LA 4HA8A 4I02A 4BQAA 2V1NA 4ZDOA 3ECOA 5DTDA 2KDZA 1RIOH 4J00A 1OYWA 4LG3A 3TP0A 3ZR8X 4E4HA 3QODA 5IOYA 2IGKA 4BBRJ 4QSHA 1B9MA 2VJ5A 4G6QA 2QQ9A 4MXMA 1I6XA 5EG0B 3L2UA 3MVPA 2K9QA 4AVZA 5HAWA 1I50J 1S72I 4HV5A 4IHVA 1ETXA 3ZP5A 3S2WA 3D1NI 1Z91A 2EZIA 4CDGA 4I09A 4RGXA 3H5NA 2EFOA 2VT2A 1J59A 1X58A 1WH7A 1MNMC 1A31A 1D0YA 1Z3XA 1SGMA 1QNTA 2P7CB 2M0MA 3HRTA 3KP7A 3PSFA 1HXDA 3K2AA 1A35A 2ZC2A 4V19K 4A3GJ 1KYZA 2HGCA 5D5VB 2NNYA 2MA3A 4OAYA 3LSKA 4IVNA 2E19A 2RVCA 1P4WA 1TWFJ 4HNUA 1P2FA 3K1MA 5M3MJ 4G6DA 3VIBA 1FX7A 3ZQQA 2PG4A 3IRRA 2EIJH 2QF7A 1X3WB 1IRZA 1EF4A 1FTTA 2LK2A 3E5QA 1QHHD 3H9QA 4DZJA 3HTAA 4RLFA 4ZYEA 1G8XA 3HRMA 2CSOA 5FLXK 3N4MA 3GUDA 2IBDA 1IRXA 3DBLB 2P6TA 2QCOA 4A5MA 2WWYA 1B1BA 3FBNB 4E7LA 1XD7A 2DYRH 4IRGA 3LAJA 2VKHA 3BR3A 1BI3A 2IGNA 3JRCA 1K79A 1B8IA 2ZCNA 3QPTA 4N4NB 3A1YA 2FMYA 2DOAA 1WFXA 2L2OA 3I3LA 2P4WA 4XR6A 3AFHA 3GZ6A 4M71A 1LDDA 4KNYA 5HNFA 3M8JA 1W5CC 1A6QA 5FKLA 4HSRA 2HPMA 3VUQA 2DOFA 2N8GA 4JNNA 2ZOYA 1FMVA 1U5TC 2FX0A 1VQ8I 2XB0X 3RPUD 5L3FA 3EYIA 3KFWX 3BG6A 3CO7C 4C2TA 5DCMB 1VI0A 1WKMA 1Y8QB 4XLAA 2CRGA 4Q48A 2V1XA 4UDSA 4DOZA 2VE9A 4AIDA 3TW7A 4AC0A 2XAHA 1MMNA 5CQEA 5EFYA 1SC7A 3H3ZA 3JRGA 1U5TB 4UY8I 2ESNA 4YG2F 4ESJA 3S93A 3WTYC 4LITA 3AAFA 4IJAA 2ZCMA 2PEXA 2B3WA 3HG9A 4XRMA 1PP7U 2R7OA 2CS3A 4Y4RA 3ZN0A 4CA0A 2YU9J 1YO5C 1G59A 2E1MC 4CYCB 2EFWA 5DS9A 3KZ9A 2DQRA 1BR1A 4IX7A 1WPKA 3C18A 2UV1A 5DCFA 2WC2A 2EIMH 1OYYA 3A0BC 2EILH 2V6EA 2DCEA 1XG1A 2F4OB 5HVQC 5FJ8J 2R0QC 3MZYA 3ZPLA 2VONA 2DA2A 5J40A 2XSJC 1ZLKA 3FXUA 4G7OF 3L1PA 1RESA 4I01A 3GTMJ 5FFXA 2AO9A 4B8XA 2TCTA 2DJIA 5K5RA 5E3OA 2OTLI 1KU9A 4AIJA 3BTCA 4HRIA 3VDXA 2E1MB 4IKFA 1V54H 2BY3A 5CYVA 2VKEA 3C3WA 2PFBA 3PIPF 1MH3A 3KIOA 1YW8A 4UUTA 4CZCA 2FUG2 3T0YA 4C2UA 1QBJA 3FISA 4M6XA 1ON2A 4Y13A 1UJ8A 1S7EA 3E6MA 1IJWC 2XSDC 3OYEA 5CW8A 3ABMH 1FOWA 2X0LA 5CVVA 3NNRA 1FBSA 2L7ZA 3OYIA 5D8KB 3TL4X 3CZ6A 2WY8Q 3X2QH 3T8RA 2VOPA 1RUOA 2CFOA 4F91B 2JZYA 2L01A 5HOOA 3EDPA 2O7TA 3TQNA 5J4YA 1ZRDA 1ZREA 2UXPA 2BE5F 2LC2A 3MCZA 3TEDA 4MNUA 5AQCA 2JWTA 3CUOA 1AU7A 2ZJRF 2G7LA 5KCMA 1P4XA 1IO2A 1UFMA 4BKXA 1XGNA 2A69F 2IS1A 3IAS2 4GCKA 2XPWA 4RMNA 2ZCWA 3ZXSA 3DF8A 2IGOA 2XRNA 2Z2SB 3CO6C 3LFKA 2HQAA 4AD9A 1RETA 1PP8F 4KMUX 3P9IA 4I6ZA 1VTNC 3W2WA 5J3LA 4XSZF 3HB9A 2V79A 1D0XA 5LHIA 1NH3A 1K61A 3QP5A 2H94A 4MQ9F 4CGRA 3DKWA 3P5JA 2R7DA 3ZQFA 1U78A 4L9JA 1TQMA 4EATA 2B9SA 2QM3A 2OA4A 2WB1A 1LKXA 3HHHA 1BN5A 2EA2A 3PQJA 4XORA 1YIJI 1K83J 4S0HB 1BM9A 2R7VA 1V5EA 4B47A 3L2QA 1F4KA 1OCOH 2G7SA 1HCRA 4U0WA 5CXGA 3TO9A 2W24A 2M9HA 3CMAI 2ISZA 1IUFA 1J2XA 1NTCA 2HWVA 3Q0VA 4Y52J 2BXZA 5IPAA 4OMYA 2DXIA 1IN7A 1BR4A 1GV5A 3OYAA 4PJ0C 1SVOA 2WBMA 3K6GA 5JVTA 2CWEA 1R49A 4JKZA 3F21A 2RNJA 3PJRA 4BDYA 5L3CA 1LEAA 1D3YA 4A0ZA 2DK5A 4U7DA 1ETOA 3HEFA 3L00A 3W6VA 4FISA 4DBRA 3OYMA 2KISA 2GUHA 3CQZJ 2FJI1 3TP3A 4ENNA 3B02A 3CDLA 5FRMA 5LGTA 2P0WA 5CLSA 2LY9A 2A6EF 1BOBA 4LLLA 2QTQA 2WAFA 2H27A 4PDKA 5FROA 4ABZA 2IEKA 1WJCA 2LBFA 2CV1A 3FF5A 3TO7A 2KZGA 3ZQGA 3R60A 2HVRA 3W2AA 4D5CA 4O6JA 1YG2A 2CQXA 2KRCA 4HPQA 3KP2A 2HXIA 4BXFA 3SQNA 3GZNB 2L7MP 1OYIA 1YX3A 3BR2A 2L02A 4XRSA 3RI4A 1SAXA 5CVIA 4KIFA 3FRQA 3ZMVA 1Y8RB 1R1UA 2GM4A 4XLCA 2L7FP 4OIRF 3BTLA 2LY2A 5HLTA 2AXLA 9ANTA 1WWXA 2EA4A 2HPIA 3D0SA 1GXQA 1I3AA 1P7IA 3DPLC 3Q0UA 3S1QJ 2DW4A 1FSEA 3GFIA 3RH2A 2BV6A 3MWMA 1T39A 4B09A 1AWCA 1FC3A 2QENA 3Q9VA 4Y7NJ 2F6CA 2FQ3A 3TDUC 2R5YB 5D4SA 2VODA 3H0GJ 4L9TA 3GYHX 5BPDA 2CGPA 2IJLA 3HKZN 2NS7A 3V4GA 4PJNA 3EUKL 1JUSA 1E2XA 2OQRA 3BQYA 3HL2A 3M8EA 1CGPA 3U1DA 3MD2A 4EJTA 3F6OA 4U0VA 1JJ8C 4GGGA 1VQMI 1YRNA 4I76A 2ID6A 4DJAA 2HFHA 2LKPA 3QU6A 4EJVA 5DD4A 1IZ1A 2Z33A 2K40A 3K4NA 4E7KA 3OYHA 2HKXA 3FXKA 1ETYA 2DMTA 3PUBA 1SEUA 3NPIA 5EEGA 2LNBA 4EJWA 3DTIA 3ESWB 2OERA 4L62A 2KIUA 4A12A 2MC4A 1ITYA 3LJLA 5HSZA 5FKOA 3EUAA 4GCVA 2LOOA 3FXOA 1BI0A 4IHYA 5FHPA 5DM6F 1OR7A 3ML6A 1O3TA 1XS9A 1TWGJ 3E0JB 4L5EA 1T08B 4M9XA 3QU3A 4G9YA 1OCPA 3CJDA 2PBIA 2OU2A 2W85A 1FNNA 1PYVA 3MQ0A 4M74A 5B1AH 4ME9A 2PQ8A 1ACIA 2DDAA 2D1VA 1AA7A 3HSEA 4I98B 1U3EM 2LDUA 4HF0A
chains in the Genus database with same CATH topology
1AKHA 3DPJA 2WAQN 4XICA 3S5RA 2HDDA 3NI7A 3JSJA 3JRAA 3PPBA 2EH3A 4DW6A 2ME0A 3PM1A 2R7ZJ 5CXIA 2E1OA 2ZCXA 5M3FJ 1H89C 3GTQJ 4A3FJ 4A3KJ 3BNIA 2L0KA 4FE4A 2L9RA 2CUEA 2WUIA 3FKIJ 2X6OA 3BJBA 5F1JA 2XPUA 1W0TA 1GUUA 3HGYA 5K7ZA 3LSRA 2Y30A 3RQIA 1UG2A 3Q3SA 2LP0A 1A6IA 2XDNA 2DA1A 4RDUA 1JKPC 4JL3A 1OCTC 4DYRA 2PMZN 2EBIA 3BRUA 4M3DA 4A3LJ 3EUPA 4LOCA 4A3IJ 2UXIA 3ZQCA 5F0FA 1POGA 1JJ6C 1BA5A 2B63J 5M5YJ 2O7OA 2OI8A 4D7NA 4DZPA 4X6AJ 3V78A 1IV6A 3BQZA 3BT9A 4FTHA 2DA4A 2DMUA 1B72A 1OFCX 1VNDA 1HDPA 3BR6A 3G1MA 3GZIA 2QIBA 2AHQA 1WCMJ 4A69C 2MSYA 3JRBA 3S15J 4AC6A 3IUVA 3JRDA 1WH5A 2ZOZA 3HGGA 2K9NA 5EGOA 2TRTA 3HOUJ 4JX6A 3BG5A 4A93J 3VOKA 2R93J 3VOXA 1IG7A 1MBJA 5J1RA 4B3AA 3WHBA 1D5YA 5JLWA 3S2DJ 1HLVA 3CRJA 5FGLA 1LFBA 5M5WJ 3I4MJ 3PO2J 2VPRA 3S1MJ 3JRFA 1F36A 1NK2P 5EZHA 3SFIA 1JTXA 3B81A 1F43A 2YS9A 3LSPA 2NVYJ 1P7JA 2GLOA 2NP3A 4MFEA 1APLC 3OSGA 4CYCA 1QRYA 3NARA 4M3GA 2Y9ZA 3BHQA 3WHCA 3H3VK 5C44J 2PBXA 3HE0A 3GTOJ 3ANPA 3HIMA 1ZR2A 3BR0A 3ON2A 2DMNA 2HYJA 3HOVJ 2XGCA 2HKUA 2HOSA 3VPRA 2QKOA 1T56A 3FIWA 2ELKA 3G56A 3IV5A 4HNVA 3GTJJ 1H88C 3B6AA 3G1LA 3G1OA 2M8GX 1ZK8A 5DTDA 1UHSA 4DYQA 2KDZA 4ACIA 3TP0A 3BG3A 5IOYA 1YRNB 4NELA 3A03A 4YZEA 4BBRJ 4C3IJ 4QSHA 3UKGA 4MXMA 5EG0B 3MVPA 2K9QA 5HAWA 2JA7J 1I50J 1MBFA 3QPSA 4IHVA 2WV1A 1ETXA 3C2BA 1O4XA 5EG0A 1GDTA 3D1NI 1JT6A 2EZIA 1BW5A 1QVTA 2OF7A 2MGQA 3SJMA 1X58A 1WH7A 3HM5A 1MNMC 2RASA 1SGMA 3BR5A 1U8BA 1JTYA 2DG7A 4IHWA 3BTIA 3K2AA 5HBUA 2EZKA 2X48A 4A3GJ 3CWRA 3LWJA 2Y31A 1IC8A 3QKXA 1MBEA 2ME6A 2H1KA 5D18A 4M3BA 2E19A 3JREA 1TWFJ 5FKKA 5M3MJ 5F0CA 1HDDC 1Y1WJ 3OIOA 5K7FA 3HTJA 3VIBA 4JP0A 2P81A 1JUPA 5IP7J 5C3EJ 3FK6A 1AKHB 3I4NJ 2UXOA 1MBKA 2JMWA 3VW0A 2QF7A 1ZGWA 2GFNA 2LKXA 3ZOBA 2JK3A 1IRZA 1EF4A 1FTTA 2LK2A 2LVSA 1ZKGA 4DZJA 3HTAA 3COLA 4NN1A 5EDNA 2MW8A 2CU7A 1IDYA 2IBDA 5IYDJ 1HF0A 2M2EA 3ANGA 2QCOA 4B1RA 2O8KA 1MSFC 1B8IB 2E2JJ 1Z77A 3KKDA 5E3NA 4AUXA 3AQTA 1MBGA 3BR3A 2ZCNA 1B8IA 3JRCA 5EF6A 2CJJA 3IH2A 2DA7A 3NXCA 1RKTA 2WB1N 1A5JA 3AQSA 2XGEA 3M4OJ 5IOZA 3E7LA 5FKLA 3VUQA 2N8GA 1ETVA 4JNNA 2NS8A 2ZOYA 3SDGA 3O8GA 2FX0A 3NRGA 2XB0X 2GENA 2HOTA 3CMYA 1VI0A 2HI3A 2MG4A 2FBQA 2H8RA 1B72B 4XIDA 2CRGA 4UDSA 3LNQA 5EYRA 4G12A 2HXOA 4XRSG 4A3DJ 3TW7A 1VFCA 1LFUP 4AC0A 1FIPA 3MKLA 3KKCA 5EGOB 5EFYA 3JRGA 5FKNA 1NK3P 5EZGA 2ID3A 4JX5A 5EEAA 5H9TA 3PO3J 2ZCMA 1E3OC 3S2HJ 4X1EA 1RR7A 3GTGJ 4XRMA 2LD5A 3MN2A 4BXXJ 1VF9A 1PUFA 4A3BJ 1H8AC 3VP5A 3ZQIA 4A3JJ 3C07A 1RPWA 1XC5A 2YU9J 2JJ7A 4CYCB 3HOXJ 5DS9A 3KZ9A 4ICHA 1WPKA 1MSEC 5M5XJ 5K7HA 2DMPA 2FJ1A 2YVEA 3VVYA 1ZR4A 1WI3A 5GPCA 2X9DA 5C4YA 1XG1A 5FJ8J 2R0QC 1T33A 2O9LA 3O60A 2DA2A 1DU0A 4UUSA 1ETWA 1RESA 4JX4A 4D5FA 3L1PA 2AO9A 5FKMA 2TCTA 5E3OA 3GTMJ 3ZQLA 2W53A 1IGNA 3OOUA 4MLOA 3HTHA 3BTCA 5E3MA 2VKEA 5F27A 1QPIA 1MH3A 3S1NJ 1TC3C 4UUTA 3M3YJ 5D19A 5D1RA 2Y0SN 3O8HA 2REKA 5FMPA 5JLXA 4A3MJ 2R5ZA 3FISA 2M0CA 1G2HA 4B4CA 1S7EA 1ETKA 1IJWC 2XSDC 1OJLA 5CW8A 4NDLA 1JKQC 3QQAA 1FJLA 2EZHA 1UI5A 2HYTA 3NNRA 3OSFA 2L7ZA 4M6VA 2ECCA 1QVUA 4FE7A 5BNGA 1AHDP 4W97A 1GV2A 1BL0A 1TWCJ 5J1YA 1CQTA 3HOZJ 3VW2A 4MFDA 2O7TA 5HODA 2V57A 2UXPA 2G3BA 3TEDA 2QOPA 5AQCA 3KNWA 2JWTA 3BTJA 3DCFA 2EZLA 4RBOA 1JKRC 3NAUA 1AU7A 2G7LA 4GCTA 2COBA 4M3FA 2NOGA 4BKXA 4C3JJ 3DEWA 5IP6A 1HOMA 4GCKA 1MH4A 2XPWA 3QPLA 3HBLA 3A01A 1BW6A 2LFBA 1JKOC 3S1RJ 2DA6A 1RETA 2RAEA 5GPAA 1UMQA 4I6ZA 2D6YA 5J3LA 3IH4A 3HB9A 2Y9YA 1ETQA 1DU6A 3PASA 3LSJA 1K61A 2DG8A 4CGRA 2DA3A 2QWTA 2PZ9A 5FLVA 2EQRA 3ZQFA 2W48A 1U78A 2CQQA 1LE8A 3HDDA 1R9TJ 1RKWA 2IU5A 3A02A 3B6CA 2Q24A 3GTKJ 2VUMJ 1K83J 4IEJA 4S0HB 2G7SA 4C2MJ 1HCRA 5CXGA 2M9HA 1X2NA 1IUFA 4QTRA 2UXHA 1NTCA 3Q0VA 5E3LA 4Y52J 1IDZA 2E2IJ 5IPAA 3RZDJ 4QIWN 1GV5A 4GFBA 2FQ4A 3VW1A 1WGXA 3F0CA 4GCLA 1ENHA 4V2GA 3GBGA 4M3EA 4JKZA 4HKUA 2JA8J 5GP9A 2JA6J 3EGQA 2FD5A 2E2HJ 1I6HJ 1I3QJ 4FCYA 2D5VA 5F08A 1ETOA 3HEFA 2K9SA 3W6VA 4FISA 2CUFA 2JN6A 4MIMA 1PUFB 2GUHA 3CQZJ 3VVXA 3TP3A 3S14J 1BJZA 3CDLA 1UI6A 2LY9A 3T6NA 2QTQA 3IH3A 1TWAJ 1Y1VJ 3LSGA 3JRIA 3VVZA 1GT0C 4ABZA 2IEKA 3S16J 3BCGA 2YUSA 1Q1VA 2G7GA 3ZQGA 1X2MA 1MBHA 2XRLA 4EEFG 4D5CA 5C4JJ 2JA5J 4GFLA 4AF5A 3CCYA 2M34A 4XK4A 2YVHA 2OPTA 2CQXA 5IYBJ 2VKVA 4UUSB 2F07A 4D7MA 2HXIA 3MNLA 2L7MP 3JR9A 2WGBA 3V6GA 3TW6A 1SANA 3BR2A 4XRSA 4BBSJ 4MK6A 1JUMA 3FRQA 2GBYA 2GM4A 1TWHJ 2L7FP 2HQ5A 2UXUA 4AYBN 3F1BA 3BTLA 3LHQA 5DAJA 2IAIA 3QBMA 2NVQJ 2KT0A 2R5ZB 9ANTA 3E7QA 5K58A 3Q0UA 1P7IA 2DTZA 3GEUA 3FK7A 5IYCJ 3S1QJ 3ON4A 3RH2A 3RD3A 2NP5A 4BY7J 2DA5A 1U9OA 2HOAA 4Y7NJ 4J19A 4GFKA 2R5YB 3K7AJ 2I10A 1ZTRA 3H0GJ 1W0UA 2R5YA 5C4XJ 3HKZN 2NS7A 4JYKA 2R92J 1JUSA 3JRHA 3BQYA 3RZOJ 2LR8A 2XGDA 4IHXA 1JJ8C 1YRNA 4I76A 2DJNA 2ID6A 2NX4A 3G7RA 4A3CJ 5F04A 1JT0A 1FIAA 1U9NA 2ECBA 2XB5A 4MO7A 2K40A 1ZQ3P 3P9TA 2LLKA 2ZB9A 3HOYJ 3RKQA 3HTIA 1ETYA 4BY1J 5FLMJ 2G0EA 2DMTA 2XPVA 4W1UA 3GTLJ 3NPIA 2NVTJ 2OERA 2RHAA 2LTPA 3HOWJ 4L62A 4V2FA 4C3HJ 3ZQHA 1GVDA 1SFOJ 1ITYA 3LJLA 5HSZA 5FKOA 4PXIA 3A01B 2Y2ZA 3S17J 4IHYA 5FHPA 5J1UA 1XS9A 1TWGJ 1Z0XA 4DYCA 4L5EA 1ORKA 1OCPA 2DN0A 2VI6A 1FEXA 3CJDA 3GTPJ 1JGGA 3BG9A 2NVXJ 4ME9A 2DMQA 3LOCA 4KWAA 5F0HA 5IP9J 3BR1A 1LE8B 1FTZA 3Q0WA 4A3EJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AKH A;  3DPJ A;  2WAQ N;  4XIC A;  3S5R A;  2HDD A;  3NI7 A;  3JSJ A;  3JRA A;  3PPB A;  2EH3 A;  4DW6 A;  2ME0 A;  3PM1 A;  2R7Z J;  5CXI A;  2E1O A;  2ZCX A;  5M3F J;  1H89 C;  3GTQ J;  4A3F J;  4A3K J;  3BNI A;  2L0K A;  4FE4 A;  2L9R A;  2CUE A;  2WUI A;  3FKI J;  2X6O A;  3BJB A;  5F1J A;  2XPU A;  1W0T A;  1GUU A;  3HGY A;  5K7Z A;  3LSR A;  2Y30 A;  3RQI A;  1UG2 A;  3Q3S A;  2LP0 A;  1A6I A;  2XDN A;  2DA1 A;  4RDU A;  1JKP C;  4JL3 A;  1OCT C;  4DYR A;  2PMZ N;  2EBI A;  3BRU A;  4M3D A;  4A3L J;  3EUP A;  4LOC A;  4A3I J;  2UXI A;  3ZQC A;  5F0F A;  1POG A;  1JJ6 C;  1BA5 A;  2B63 J;  5M5Y J;  2O7O A;  2OI8 A;  4D7N A;  4DZP A;  4X6A J;  3V78 A;  1IV6 A;  3BQZ A;  3BT9 A;  4FTH A;  2DA4 A;  2DMU A;  1B72 A;  1OFC X;  1VND A;  1HDP A;  3BR6 A;  3G1M A;  3GZI A;  2QIB A;  2AHQ A;  1WCM J;  4A69 C;  2MSY A;  3JRB A;  3S15 J;  4AC6 A;  3IUV A;  3JRD A;  1WH5 A;  2ZOZ A;  3HGG A;  2K9N A;  5EGO A;  2TRT A;  3HOU J;  4JX6 A;  3BG5 A;  4A93 J;  3VOK A;  2R93 J;  3VOX A;  1IG7 A;  1MBJ A;  5J1R A;  4B3A A;  3WHB A;  1D5Y A;  5JLW A;  3S2D J;  1HLV A;  3CRJ A;  5FGL A;  1LFB A;  5M5W J;  3I4M J;  3PO2 J;  2VPR A;  3S1M J;  3JRF A;  1F36 A;  1NK2 P;  5EZH A;  3SFI A;  1JTX A;  3B81 A;  1F43 A;  2YS9 A;  3LSP A;  2NVY J;  1P7J A;  2GLO A;  2NP3 A;  4MFE A;  1APL C;  3OSG A;  4CYC A;  1QRY A;  3NAR A;  4M3G A;  2Y9Z A;  3BHQ A;  3WHC A;  3H3V K;  5C44 J;  2PBX A;  3HE0 A;  3GTO J;  3ANP A;  3HIM A;  1ZR2 A;  3BR0 A;  3ON2 A;  2DMN A;  2HYJ A;  3HOV J;  2XGC A;  2HKU A;  2HOS A;  3VPR A;  2QKO A;  1T56 A;  3FIW A;  2ELK A;  3G56 A;  3IV5 A;  4HNV A;  3GTJ J;  1H88 C;  3B6A A;  3G1L A;  3G1O A;  2M8G X;  1ZK8 A;  5DTD A;  1UHS A;  4DYQ A;  2KDZ A;  4ACI A;  3TP0 A;  3BG3 A;  5IOY A;  1YRN B;  4NEL A;  3A03 A;  4YZE A;  4BBR J;  4C3I J;  4QSH A;  3UKG A;  4MXM A;  5EG0 B;  3MVP A;  2K9Q A;  5HAW A;  2JA7 J;  1I50 J;  1MBF A;  3QPS A;  4IHV A;  2WV1 A;  1ETX A;  3C2B A;  1O4X A;  5EG0 A;  1GDT A;  3D1N I;  1JT6 A;  2EZI A;  1BW5 A;  1QVT A;  2OF7 A;  2MGQ A;  3SJM A;  1X58 A;  1WH7 A;  3HM5 A;  1MNM C;  2RAS A;  1SGM A;  3BR5 A;  1U8B A;  1JTY A;  2DG7 A;  4IHW A;  3BTI A;  3K2A A;  5HBU A;  2EZK A;  2X48 A;  4A3G J;  3CWR A;  3LWJ A;  2Y31 A;  1IC8 A;  3QKX A;  1MBE A;  2ME6 A;  2H1K A;  5D18 A;  4M3B A;  2E19 A;  3JRE A;  1TWF J;  5FKK A;  5M3M J;  5F0C A;  1HDD C;  1Y1W J;  3OIO A;  5K7F A;  3HTJ A;  3VIB A;  4JP0 A;  2P81 A;  1JUP A;  5IP7 J;  5C3E J;  3FK6 A;  1AKH B;  3I4N J;  2UXO A;  1MBK A;  2JMW A;  3VW0 A;  2QF7 A;  1ZGW A;  2GFN A;  2LKX A;  3ZOB A;  2JK3 A;  1IRZ A;  1EF4 A;  1FTT A;  2LK2 A;  2LVS A;  1ZKG A;  4DZJ A;  3HTA A;  3COL A;  4NN1 A;  5EDN A;  2MW8 A;  2CU7 A;  1IDY A;  2IBD A;  5IYD J;  1HF0 A;  2M2E A;  3ANG A;  2QCO A;  4B1R A;  2O8K A;  1MSF C;  1B8I B;  2E2J J;  1Z77 A;  3KKD A;  5E3N A;  4AUX A;  3AQT A;  1MBG A;  3BR3 A;  2ZCN A;  1B8I A;  3JRC A;  5EF6 A;  2CJJ A;  3IH2 A;  2DA7 A;  3NXC A;  1RKT A;  2WB1 N;  1A5J A;  3AQS A;  2XGE A;  3M4O J;  5IOZ A;  3E7L A;  5FKL A;  3VUQ A;  2N8G A;  1ETV A;  4JNN A;  2NS8 A;  2ZOY A;  3SDG A;  3O8G A;  2FX0 A;  3NRG A;  2XB0 X;  2GEN A;  2HOT A;  3CMY A;  1VI0 A;  2HI3 A;  2MG4 A;  2FBQ A;  2H8R A;  1B72 B;  4XID A;  2CRG A;  4UDS A;  3LNQ A;  5EYR A;  4G12 A;  2HXO A;  4XRS G;  4A3D J;  3TW7 A;  1VFC A;  1LFU P;  4AC0 A;  1FIP A;  3MKL A;  3KKC A;  5EGO B;  5EFY A;  3JRG A;  5FKN A;  1NK3 P;  5EZG A;  2ID3 A;  4JX5 A;  5EEA A;  5H9T A;  3PO3 J;  2ZCM A;  1E3O C;  3S2H J;  4X1E A;  1RR7 A;  3GTG J;  4XRM A;  2LD5 A;  3MN2 A;  4BXX J;  1VF9 A;  1PUF A;  4A3B J;  1H8A C;  3VP5 A;  3ZQI A;  4A3J J;  3C07 A;  1RPW A;  1XC5 A;  2YU9 J;  2JJ7 A;  4CYC B;  3HOX J;  5DS9 A;  3KZ9 A;  4ICH A;  1WPK A;  1MSE C;  5M5X J;  5K7H A;  2DMP A;  2FJ1 A;  2YVE A;  3VVY A;  1ZR4 A;  1WI3 A;  5GPC A;  2X9D A;  5C4Y A;  1XG1 A;  5FJ8 J;  2R0Q C;  1T33 A;  2O9L A;  3O60 A;  2DA2 A;  1DU0 A;  4UUS A;  1ETW A;  1RES A;  4JX4 A;  4D5F A;  3L1P A;  2AO9 A;  5FKM A;  2TCT A;  5E3O A;  3GTM J;  3ZQL A;  2W53 A;  1IGN A;  3OOU A;  4MLO A;  3HTH A;  3BTC A;  5E3M A;  2VKE A;  5F27 A;  1QPI A;  1MH3 A;  3S1N J;  1TC3 C;  4UUT A;  3M3Y J;  5D19 A;  5D1R A;  2Y0S N;  3O8H A;  2REK A;  5FMP A;  5JLX A;  4A3M J;  2R5Z A;  3FIS A;  2M0C A;  1G2H A;  4B4C A;  1S7E A;  1ETK A;  1IJW C;  2XSD C;  1OJL A;  5CW8 A;  4NDL A;  1JKQ C;  3QQA A;  1FJL A;  2EZH A;  1UI5 A;  2HYT A;  3NNR A;  3OSF A;  2L7Z A;  4M6V A;  2ECC A;  1QVU A;  4FE7 A;  5BNG A;  1AHD P;  4W97 A;  1GV2 A;  1BL0 A;  1TWC J;  5J1Y A;  1CQT A;  3HOZ J;  3VW2 A;  4MFD A;  2O7T A;  5HOD A;  2V57 A;  2UXP A;  2G3B A;  3TED A;  2QOP A;  5AQC A;  3KNW A;  2JWT A;  3BTJ A;  3DCF A;  2EZL A;  4RBO A;  1JKR C;  3NAU A;  1AU7 A;  2G7L A;  4GCT A;  2COB A;  4M3F A;  2NOG A;  4BKX A;  4C3J J;  3DEW A;  5IP6 A;  1HOM A;  4GCK A;  1MH4 A;  2XPW A;  3QPL A;  3HBL A;  3A01 A;  1BW6 A;  2LFB A;  1JKO C;  3S1R J;  2DA6 A;  1RET A;  2RAE A;  5GPA A;  1UMQ A;  4I6Z A;  2D6Y A;  5J3L A;  3IH4 A;  3HB9 A;  2Y9Y A;  1ETQ A;  1DU6 A;  3PAS A;  3LSJ A;  1K61 A;  2DG8 A;  4CGR A;  2DA3 A;  2QWT A;  2PZ9 A;  5FLV A;  2EQR A;  3ZQF A;  2W48 A;  1U78 A;  2CQQ A;  1LE8 A;  3HDD A;  1R9T J;  1RKW A;  2IU5 A;  3A02 A;  3B6C A;  2Q24 A;  3GTK J;  2VUM J;  1K83 J;  4IEJ A;  4S0H B;  2G7S A;  4C2M J;  1HCR A;  5CXG A;  2M9H A;  1X2N A;  1IUF A;  4QTR A;  2UXH A;  1NTC A;  3Q0V A;  5E3L A;  4Y52 J;  1IDZ A;  2E2I J;  5IPA A;  3RZD J;  4QIW N;  1GV5 A;  4GFB A;  2FQ4 A;  3VW1 A;  1WGX A;  3F0C A;  4GCL A;  1ENH A;  4V2G A;  3GBG A;  4M3E A;  4JKZ A;  4HKU A;  2JA8 J;  5GP9 A;  2JA6 J;  3EGQ A;  2FD5 A;  2E2H J;  1I6H J;  1I3Q J;  4FCY A;  2D5V A;  5F08 A;  1ETO A;  3HEF A;  2K9S A;  3W6V A;  4FIS A;  2CUF A;  2JN6 A;  4MIM A;  1PUF B;  2GUH A;  3CQZ J;  3VVX A;  3TP3 A;  3S14 J;  1BJZ A;  3CDL A;  1UI6 A;  2LY9 A;  3T6N A;  2QTQ A;  3IH3 A;  1TWA J;  1Y1V J;  3LSG A;  3JRI A;  3VVZ A;  1GT0 C;  4ABZ A;  2IEK A;  3S16 J;  3BCG A;  2YUS A;  1Q1V A;  2G7G A;  3ZQG A;  1X2M A;  1MBH A;  2XRL A;  4EEF G;  4D5C A;  5C4J J;  2JA5 J;  4GFL A;  4AF5 A;  3CCY A;  2M34 A;  4XK4 A;  2YVH A;  2OPT A;  2CQX A;  5IYB J;  2VKV A;  4UUS B;  2F07 A;  4D7M A;  2HXI A;  3MNL A;  2L7M P;  3JR9 A;  2WGB A;  3V6G A;  3TW6 A;  1SAN A;  3BR2 A;  4XRS A;  4BBS J;  4MK6 A;  1JUM A;  3FRQ A;  2GBY A;  2GM4 A;  1TWH J;  2L7F P;  2HQ5 A;  2UXU A;  4AYB N;  3F1B A;  3BTL A;  3LHQ A;  5DAJ A;  2IAI A;  3QBM A;  2NVQ J;  2KT0 A;  2R5Z B;  9ANT A;  3E7Q A;  5K58 A;  3Q0U A;  1P7I A;  2DTZ A;  3GEU A;  3FK7 A;  5IYC J;  3S1Q J;  3ON4 A;  3RH2 A;  3RD3 A;  2NP5 A;  4BY7 J;  2DA5 A;  1U9O A;  2HOA A;  4Y7N J;  4J19 A;  4GFK A;  2R5Y B;  3K7A J;  2I10 A;  1ZTR A;  3H0G J;  1W0U A;  2R5Y A;  5C4X J;  3HKZ N;  2NS7 A;  4JYK A;  2R92 J;  1JUS A;  3JRH A;  3BQY A;  3RZO J;  2LR8 A;  2XGD A;  4IHX A;  1JJ8 C;  1YRN A;  4I76 A;  2DJN A;  2ID6 A;  2NX4 A;  3G7R A;  4A3C J;  5F04 A;  1JT0 A;  1FIA A;  1U9N A;  2ECB A;  2XB5 A;  4MO7 A;  2K40 A;  1ZQ3 P;  3P9T A;  2LLK A;  2ZB9 A;  3HOY J;  3RKQ A;  3HTI A;  1ETY A;  4BY1 J;  5FLM J;  2G0E A;  2DMT A;  2XPV A;  4W1U A;  3GTL J;  3NPI A;  2NVT J;  2OER A;  2RHA A;  2LTP A;  3HOW J;  4L62 A;  4V2F A;  4C3H J;  3ZQH A;  1GVD A;  1SFO J;  1ITY A;  3LJL A;  5HSZ A;  5FKO A;  4PXI A;  3A01 B;  2Y2Z A;  3S17 J;  4IHY A;  5FHP A;  5J1U A;  1XS9 A;  1TWG J;  1Z0X A;  4DYC A;  4L5E A;  1ORK A;  1OCP A;  2DN0 A;  2VI6 A;  1FEX A;  3CJD A;  3GTP J;  1JGG A;  3BG9 A;  2NVX J;  4ME9 A;  2DMQ A;  3LOC A;  4KWA A;  5F0H A;  5IP9 J;  3BR1 A;  1LE8 B;  1FTZ A;  3Q0W A;  4A3E J; 
#chains in the Genus database with same CATH topology
 1UZC A;  4XIC A;  2HDD A;  2QKM B;  3DP7 A;  1HW2 A;  2EH3 A;  4DW6 A;  3BJA A;  5KAF C;  2ME0 A;  1EJ9 A;  4YFN F;  3U2R A;  5CXI A;  4XRF A;  4ZTF A;  1U0J A;  1O57 A;  4OIQ F;  3WTT C;  1I27 A;  3DKY A;  1RUN A;  4P1W A;  3EUH A;  3FKI J;  2CH0 A;  1FP1 D;  3CCM I;  5F1J A;  4M6Y A;  5KVR A;  5FO5 A;  3HGY A;  5BOX A;  5K7Z A;  2FML A;  2Y30 A;  4Q5S F;  3K9T A;  4UVB A;  1UG2 A;  4RM3 A;  4UV9 A;  2XDN A;  3K4B A;  5K5O A;  2DA1 A;  4RDU A;  2HYG D;  2X6W A;  3OYD A;  1V55 H;  3TGN A;  4A3L J;  1R58 A;  4A3I J;  5F0F A;  2W25 A;  2O7O A;  3SZT A;  2JSC A;  2BW3 B;  2F5F A;  2H6C A;  3I0T A;  2PMU A;  4D7N A;  1VQ7 I;  4X6A J;  1FBU A;  1ZGA A;  3BT9 A;  4FTH A;  2FE3 A;  1CF7 A;  3BG7 A;  2K5C A;  1R5I D;  4DNC A;  1P4A A;  2I5U A;  2EFN A;  1DUX C;  1B72 A;  2GZW A;  1VND A;  2DQL A;  2MH2 A;  4CCO A;  1WCM J;  3WU2 C;  1ZAR A;  2M4K A;  2K9M A;  5DEQ A;  1H0M A;  3CC7 I;  4FT8 A;  2JA2 A;  3GLL A;  1WI9 A;  1T0F A;  4RM2 A;  3LMM A;  4JX6 A;  4BHC A;  4A93 J;  1UAA A;  3RDI A;  4DQ2 A;  5D6F A;  1DDN A;  2JTV A;  1MBJ A;  4HDV A;  4B3A A;  3WHB A;  3CRJ A;  5JLW A;  5FGL A;  5L3E A;  1HW1 A;  2XIG A;  3HSR A;  3I4M J;  2XRO A;  5A2Q K;  4YII A;  2FU4 A;  5EZH A;  4G7H F;  2AQF A;  3SFI A;  2M8E A;  1JTX A;  3OWT A;  4HBL A;  4Q47 A;  3D5R C;  4PGH A;  3LSP A;  4MFE A;  1APL C;  3OSG A;  2MLK A;  1R23 A;  1QRY A;  3BHQ A;  3AKZ A;  4I7H A;  2PBX A;  3ANP A;  3HIM A;  2CYY A;  3ON2 A;  3FZV A;  5LRR A;  3TKY A;  2ZME A;  4ITV A;  2A6T A;  2XGC A;  4XKB A;  5J6X A;  2HOS A;  4AVP A;  4LB5 A;  3E6D A;  3RQ4 A;  5HLI A;  1ONV A;  1R1V A;  3LSM A;  4PJM A;  2YU3 A;  1Z9C A;  3LFU A;  5L3G A;  1UHS A;  2QVO A;  2B0L A;  3PUF A;  4IHT A;  3BG3 A;  4BE1 A;  1YRN B;  3GEZ A;  1KU3 A;  3WG9 A;  4C3I J;  1OR7 C;  4ZTJ A;  2P7V B;  2M5W A;  4YRV A;  3OYK A;  2DO7 A;  2VQC A;  1I1G A;  2WV1 A;  1JE8 A;  5EG0 A;  2ICW G;  2CG4 A;  1BW5 A;  1QVT A;  2KDO A;  3ABT A;  3IP4 B;  4KN7 X;  3KEY A;  2A3S A;  3HZJ A;  5J47 A;  2STT A;  2YR2 A;  1LFP A;  2HR3 A;  4UB8 C;  3CCV I;  2RAS A;  2LY1 A;  3BR5 A;  3R61 A;  2RV8 A;  5CPR B;  2D1H A;  2OUM A;  3K8P C;  4CH7 A;  1XDS A;  5E1Z B;  5HBU A;  1MD0 A;  1V5G A;  2X48 A;  5H20 A;  5E17 F;  1IC8 A;  2LF8 A;  3QKX A;  1MBE A;  2OAZ A;  5K5Q A;  5D18 A;  1WVR A;  1EA3 A;  3ASN H;  4BH9 A;  1R71 A;  3HTJ A;  3A4C A;  4KUM A;  5IP7 J;  5C3E J;  4XN3 A;  2UXO A;  1IXS B;  2IVM A;  2JMW A;  3SHF A;  1HBX G;  1ZGW A;  2GFN A;  3VW0 A;  2W1O A;  4UUV A;  4N9H A;  1N78 A;  2EB7 A;  3LSH A;  1VQ6 I;  4JQF A;  4HG2 A;  3OYN A;  3V8J A;  3D5S C;  5EDN A;  5BQT A;  2XKO A;  1GXP A;  3RYR A;  1ON1 A;  1VQP I;  1HF0 A;  4LG0 B;  4BAC A;  3KKD A;  5E3N A;  2E60 A;  4AUX A;  3FM5 A;  2M30 A;  2O03 A;  2CJJ A;  4Z2Y A;  5ILV A;  2A6H F;  4XLN F;  2ZXH A;  1RKT A;  4JOM A;  5EEH A;  4R1H A;  4EMS A;  4RB1 A;  3OOP A;  3FXQ A;  2COM A;  5KK1 A;  1BOA A;  2NS8 A;  5LHH A;  3SDG A;  4EQQ A;  4FX4 A;  3S3M A;  5JVG F;  2P5V A;  2PN6 A;  3HPH A;  3CMY A;  5BMZ A;  1CF7 B;  4CHU A;  2HI3 A;  4HX7 A;  1ZG1 A;  2VE8 A;  2FBQ A;  1ZAO A;  2BXY A;  1B72 B;  4XID A;  5DCM A;  2E1C A;  2F2E A;  3VYR B;  5E1W A;  3LNQ A;  3JTG A;  5E18 F;  2LRE A;  1JI8 A;  3OY9 A;  3ISP A;  5GAE J;  5IY5 H;  1LFU P;  4A6E A;  2GXA A;  2EFQ A;  3HRU A;  4ZC3 A;  3P9C A;  2OC6 A;  5AIQ A;  5B3S H;  2IS2 A;  1OLT A;  1T38 A;  3BPV A;  2ID3 A;  5EEA A;  3CC4 I;  2VL8 A;  1U5T A;  5H9T A;  4H0E A;  3HSF A;  1TNS A;  5LEJ A;  4LLG F;  3PIO F;  4BXX J;  2JVG A;  3SFZ A;  1UST A;  1H8A C;  3K4J A;  3FKJ A;  3ZQI A;  3C07 A;  6PAX A;  4MTD A;  2LH9 A;  5GTI C;  2V26 A;  3F8N A;  3HOX J;  4MQV A;  4G7Z F;  2P5K A;  1WHU A;  2PMH A;  5M5X J;  3VVY A;  2ZME B;  3PNT A;  3OMY A;  1ZR4 A;  2GXB A;  5LD2 C;  2QBY B;  3CJQ B;  4XLP F;  1BI1 A;  3WE3 A;  2O9L A;  3O60 A;  3TDZ C;  4IRV A;  2ZKZ A;  3IUO A;  2XF7 A;  4UUS A;  4U87 A;  3OOU A;  3R4K A;  3HTH A;  1VQ5 I;  3K69 A;  2Y48 A;  3L2V A;  3GXO A;  4OOI A;  1W7P A;  1Y0U A;  2HQN A;  2DLL A;  2VXZ A;  4WXC A;  5FD6 A;  4PGG A;  3DTK A;  1TZL A;  4YIR X;  4X0G A;  5JLX A;  4A3M J;  3AG1 H;  5TJJ A;  4U7B A;  3HXL A;  4KIT B;  3FWE A;  1IRG A;  3QP6 A;  4QPO A;  1LVA A;  3MKY B;  2KKO A;  3QQA A;  4XL9 A;  3NWS A;  2VKD A;  2HYT A;  2VB6 A;  3RSN A;  3OSF A;  2KP6 A;  2ECC A;  4KT6 A;  1XB4 A;  4FE7 A;  1AOY A;  1YTY A;  3CJN A;  1X1C A;  2UZK A;  2L5Q A;  2RQP A;  3SEQ A;  5DUK A;  2BHY A;  3KZZ A;  2G7U A;  2JSP A;  2VC0 A;  3TBI A;  4AIK A;  1ZG5 A;  3ABL H;  1CQT A;  4FX0 A;  2RRE A;  1YLF A;  5LFA A;  1I5Z A;  2VOO A;  3CTA A;  3O6B B;  4LK1 F;  1HKS A;  2DI3 A;  1FPQ A;  2LSO A;  3PQK A;  1YYV A;  2BHZ A;  5H2F C;  3BTJ A;  3W6J B;  4E7Z A;  4RBO A;  1XPX A;  2CV0 A;  1B4A A;  2KMU A;  1G3W A;  2NS0 A;  5LGU A;  1S3J A;  2FA5 A;  2GXG A;  2NOG A;  2R3S A;  4H4K C;  3WTX C;  2BBY A;  1O3S A;  3DEW A;  5DUI A;  1VQ4 I;  2JQ7 A;  3CCR I;  4XKV A;  1REP C;  3BWG A;  4YFK F;  2V7F A;  2FBI A;  2DA6 A;  3P7N A;  1IN4 A;  3W3C A;  1RR8 C;  3CUQ C;  3IH4 A;  3CCJ I;  1K4T A;  2Y9Y A;  3I58 A;  1X4O A;  2OCE A;  2RC4 A;  1DU6 A;  2IW5 A;  3LSJ A;  2IPQ X;  3WGG A;  3V8K A;  3DLL F;  5FLV A;  1LE8 A;  2CQQ A;  2BYV E;  3K70 D;  1XCV A;  3Q5F A;  3HDD A;  3A02 A;  2Z16 A;  3L2R A;  3WTZ A;  2HYF A;  2PMZ A;  1EH6 A;  2A68 F;  5ILS A;  3AG3 H;  1VZ0 A;  4IZZ A;  1L3L A;  4P96 A;  2BY2 A;  2CQ7 A;  4CCK A;  1FBQ A;  2F5E A;  2R7X A;  4QTR A;  4XOT A;  2GA1 A;  2UXH A;  1W1W E;  3PL8 A;  5E3L A;  5H6R A;  3BRO A;  1S7O A;  2DFH A;  3RZD J;  1LEB A;  5K1Y A;  3CLQ A;  3QYF A;  1Y56 A;  4L9N A;  1IN5 A;  3KYC B;  3KYD B;  1ENH A;  2V9K A;  4UV8 A;  2F5C A;  2JA8 J;  4NC8 A;  5HS8 A;  1I3Q J;  3E97 A;  2ZY9 A;  3ERM A;  1YW7 A;  2CUF A;  2NXN B;  4MIM A;  3LQR A;  3GLX A;  1JGS A;  3MFK A;  3S14 J;  3KEQ A;  2PJP A;  2M3A A;  3BZC A;  1UI6 A;  3RIR A;  2D2W A;  1JXS A;  2BOL A;  3LSG A;  4WK8 F;  1GT0 C;  5GAH J;  2O6G E;  3H3U A;  1Q1V A;  2W57 A;  4EEF G;  4N9I A;  1MBH A;  2G7G A;  4GFL A;  5HDK A;  3CCY A;  4XK4 A;  2QSG X;  4PSX A;  4BJ6 C;  4U0Y A;  3G6E I;  4BJ5 C;  5IYB J;  3LAP A;  1PDN C;  2ISY A;  4UUS B;  2UXX A;  4OAZ A;  4Y17 A;  4D7M A;  3F8F A;  5LEK A;  3MNL A;  3GVA A;  4I0A A;  3EQL F;  3TW6 A;  3JR9 A;  1FWZ A;  1SAN A;  4L18 B;  2RQQ A;  1V4R A;  2ZO4 A;  3HJE A;  5E1X A;  1W7P B;  4CXF A;  4B48 A;  1WJB A;  1BI2 A;  3V8L A;  4CCL A;  1S8N A;  4YEL A;  1BR2 A;  3F1B A;  3FXJ A;  4S05 A;  5HLG A;  3QBM A;  3GO5 A;  3OR1 C;  5ICG A;  2VPL A;  2P6S A;  4HV6 A;  3E7Q A;  3K4K A;  5K58 A;  3VOD A;  3C7J A;  5ED4 A;  3GEU A;  5BS6 A;  1ZG3 A;  2Y0S A;  4HEA 2;  3VSL A;  3BJO A;  3BZK A;  2L9V A;  4XOP A;  4L5I A;  2VQL A;  3GW2 A;  4GFK A;  1BC8 C;  1X4P A;  4ZYD A;  4YEJ A;  1B59 A;  2I10 A;  2K85 A;  4ANJ A;  3T5X A;  1ZTR A;  1W0U A;  2R5Y A;  5C4X J;  4FQG A;  1S5L C;  4I99 C;  2ELH A;  3WU1 B;  1Y6I A;  1P6R A;  1X1P A;  1P92 A;  3RZO J;  1DP7 P;  4GXO A;  2HQR A;  4KYW A;  2KHM A;  2FSW A;  3NQO A;  4HOB A;  5F04 A;  2D45 A;  1HKQ A;  5TRD A;  3QPH A;  2BY1 A;  2XB5 A;  1Z05 A;  4DBQ A;  2Z5U A;  2R7U A;  2ZB9 A;  2JPB A;  1G3S A;  1QQI A;  2L4M A;  2XPV A;  5FLM J;  4BXU A;  3BC8 A;  1XMX A;  3OYB A;  3ERE D;  1J9I A;  4LGW A;  2NVT J;  5LGN A;  2CW0 F;  4ZH4 F;  1Z67 A;  1SVM A;  4M73 A;  1SFO J;  3W2V A;  5DDG A;  4IRH A;  4L5J A;  2Y2Z A;  2OTJ I;  4G6T B;  4XM3 A;  3TOA A;  4A0Y A;  4E7I A;  4IL6 C;  3AG4 H;  5J1U A;  4Y3O A;  4DYC A;  2MH9 A;  4CYD A;  3CCQ I;  1UB9 A;  3OS1 A;  5A2Q Z;  4CUG A;  1OKR A;  1LQ1 A;  2NNN A;  3L7W A;  1WRJ A;  4E7J A;  1SD6 A;  4XBF A;  1JGG A;  3V7S A;  2NVX J;  3CCU I;  2VC1 A;  2KRF A;  4E6K G;  3G73 A;  5IP9 J;  1LE8 B;  1USS A;  1FTZ A;  2E71 A;  2ZNY A;  4PFP A;  3ZMU A;  1TL8 A;  3S5R A;  1FLI A;  3JRA A;  2K4B A;  3PPB A;  2V9V A;  3PM1 A;  2R7Z J;  2QQA A;  2ZCX A;  3RKY A;  2JRM A;  5M3F J;  1MMG A;  4HQM A;  4A3F J;  4BYY A;  2WUI A;  5D5X B;  5TIS C;  4ZZD A;  3WTV C;  3HUG A;  3BOQ A;  3OR2 C;  2FXA A;  4HQE A;  2XPU A;  4DVY P;  1OCC H;  1X3U A;  2V4J C;  1GUU A;  2K7L A;  4UB6 C;  1WZ2 A;  1MZB A;  2LP0 A;  1A6I A;  2L9N A;  1JKP C;  3RKW A;  2ZNZ A;  3NEU A;  2PMZ N;  4DYR A;  3CC2 I;  3ROU A;  3K1P A;  3JTH A;  3BRU A;  4M3D A;  3J7Z I;  4LOC A;  1POG A;  1W5S A;  1QGP A;  2B63 J;  4BU2 A;  3I55 I;  2OI8 A;  5JR3 A;  5KAI C;  2Z1D A;  3E1S A;  2KIF A;  4DIQ A;  1YI2 I;  1YIO A;  1STZ A;  2BW3 A;  3FDY A;  4KIG A;  2LMD A;  1B6A A;  4RLQ A;  4UVC A;  4ON0 A;  1OFC X;  3G1M A;  1ZGJ A;  2ZBK A;  3JAM Z;  2AHQ A;  1LDK B;  1QZE A;  5HLH A;  4HST A;  3JRB A;  1YJW I;  4AC6 A;  2CUZ A;  2XAQ A;  4BNC A;  1WH5 A;  4HF1 A;  1A04 A;  5EGO A;  3HOU J;  3BG5 A;  1W36 D;  1MGT A;  2CQN A;  4PUS A;  4EM1 A;  4BGD A;  3VOX A;  1IG7 A;  3V7R A;  2RGV A;  1LFB A;  3FM3 A;  3CES A;  2VPR A;  3J7A O;  1KQ0 A;  2HDW A;  2NYX A;  4IQJ A;  1SFX A;  3MZ8 A;  1F43 A;  2DPD A;  3HTS B;  3ZGK A;  2NP3 A;  4AYB A;  3ABK H;  3NAR A;  2R7S A;  1FYK A;  1I39 A;  1QO0 D;  1D0Z A;  2WA0 A;  3CP2 A;  4RGS A;  1YOV B;  1J7K A;  4BHB A;  4E7S A;  1MND A;  2ZSI B;  1QHG A;  2DMN A;  2F5D A;  3BR0 A;  5FFZ A;  4F3Q A;  3HOV J;  2QKO A;  3VPR A;  2YPR A;  2ELK A;  3VOE A;  1X1D A;  2HVQ A;  3H9J A;  2ZXW H;  3DWL E;  4BDZ A;  3QYE A;  2QYO A;  1MDM A;  3B6A A;  3IL2 A;  3LST A;  2M8G X;  3RPU A;  1TLH B;  4ACI A;  1YJ9 I;  2KFD A;  3WE2 A;  3R0J A;  3A03 A;  3FHZ A;  4XLE A;  2X1C A;  3UKG A;  1XGM A;  3G4S I;  1WSU A;  3BDD A;  3FMQ A;  2VN2 A;  2JA7 J;  1WJD A;  1MBF A;  2DT5 A;  1MJ9 A;  1JT6 A;  1W4M A;  3K2Z A;  3M1C A;  5H6Q A;  2NVU B;  2FBH A;  4ENJ A;  4RB0 A;  2W82 A;  3IRQ A;  2OF7 A;  2ELJ A;  3L09 A;  2MGQ A;  3ZRG A;  2XKP A;  1HA8 A;  4B3X A;  3HM5 A;  2M87 A;  2Z9O A;  4RB3 C;  2LRD A;  4II3 A;  2EV5 A;  2HNH A;  2XUB A;  3I5U A;  1JTY A;  5DM7 F;  1U8B A;  3T8T A;  2DG7 A;  4IHW A;  3BTI A;  4RB2 C;  2CV2 A;  4EVI A;  3VYT B;  2VQG A;  3WOD F;  1O7L A;  2ME6 A;  5J8F A;  2K02 A;  4M3B A;  4BEH A;  4RA2 A;  2X85 A;  3JRE A;  5FKK A;  1D5V A;  2Z3Y A;  1HDD C;  5F0C A;  1Y1W J;  3OIO A;  3F22 A;  4JP0 A;  4ZDL A;  1Z7U A;  3LA2 A;  4GDF A;  3RKX A;  1FSH A;  2HS5 A;  1G6N A;  2K9L A;  3ZOB A;  2CUJ A;  1G4D A;  2HU9 A;  1XDU A;  2QZ8 A;  4CCJ A;  1ZKG A;  4XSX F;  4NN1 A;  2HVS A;  2CU7 A;  5TGT A;  1C0W A;  4IHS A;  2FBK A;  3HUG B;  1Y0N A;  2GIV A;  3I4P A;  3WG7 H;  3MKW B;  4B1R A;  2O8K A;  3DLA A;  1Z77 A;  3N05 A;  4LG0 A;  3AQT A;  1J5Y A;  3EET A;  3RPQ A;  3ZCO A;  2MD5 A;  5FB2 A;  4A6D A;  3IH2 A;  2DA7 A;  2VQH A;  3NXC A;  4ESB A;  1U6G A;  2WB1 N;  1A5J A;  2K27 A;  3AQS A;  1IXC A;  2E7W A;  5IOZ A;  1X3Z B;  3E7L A;  1JHH A;  2QSF X;  1UG0 A;  3K4M A;  4RS8 A;  3N97 A;  3CMM A;  2MC3 A;  3IC7 A;  2J5O A;  2EJR A;  2KPM A;  1YFH A;  1TW3 A;  3O8G A;  2GEN A;  3SEZ A;  2HOT A;  4K2E A;  1PJR A;  2V1D A;  3FBI B;  4XNF A;  4BE2 A;  5ICC A;  2MG4 A;  2H8R A;  3OIQ A;  2XAG A;  4G12 A;  2HXO A;  4XRS G;  4N4O B;  4A3D J;  1VFC A;  4CO8 A;  2XAF A;  3KKC A;  2IA2 A;  3ONQ A;  5EGO B;  3HIF A;  4MTE A;  4YFX F;  1KYW A;  1RC9 A;  1HQC A;  2V9P A;  5HS7 A;  4LLN A;  3K70 C;  5HDN A;  2QWW A;  3J81 Z;  4HLX A;  2MD0 A;  4KT5 C;  4X1E A;  3GTG J;  2LD5 A;  3DKX A;  1X19 A;  3MN2 A;  1VF9 A;  3K0L A;  2OJE D;  2FNP A;  1H9G A;  4A3J J;  1UCR A;  2XF5 A;  3H5A A;  2JJ7 A;  1UEL B;  3GME A;  1MSE C;  5K7H A;  2DMP A;  1OCR H;  2DYS H;  4XMY A;  3I64 A;  1WI3 A;  5GPC A;  1T33 A;  1ZHF A;  1FZP B;  3NWT A;  2QBY A;  1MDM B;  1DU0 A;  4NBQ A;  3VTI A;  3D5L A;  3PFY A;  1HSJ A;  2ZJ2 A;  5CKT A;  5FKM A;  4II2 A;  4D5F A;  3ZQL A;  1IUY A;  1IGN A;  1TP4 A;  4MLO A;  2DPU A;  2O61 A;  5E3M A;  4ESF A;  3S1N J;  2LYC A;  1E0E A;  1MW7 A;  4B43 A;  5E8G A;  4C30 A;  2A5Y B;  3M3Y J;  1GVJ A;  4WWC A;  4OD4 A;  3FMR A;  5D19 A;  5D1R A;  4MGR A;  5E79 C;  3O8H A;  5FMP A;  4PCQ A;  2R5Z A;  2IS4 A;  2GWR A;  2M0C A;  4ZYA A;  1G2H A;  3ZMT A;  4RGU A;  2PI0 A;  4B4C A;  2M7B A;  1T2K A;  4AM3 A;  1OJL A;  2M45 A;  3HC7 A;  3AL0 C;  1QA6 A;  2A61 A;  2FEZ A;  1JKQ C;  3C2H A;  4IQ4 A;  1FJL A;  1SD4 A;  5B5E C;  1UI5 A;  1QVU A;  1XN7 A;  2E5Z A;  3VB2 A;  4E7H A;  3G2B A;  1AHD P;  1TQP A;  1S9H A;  3KP3 A;  1GV2 A;  1FT9 A;  4BEH B;  3JAM K;  1M1E B;  5J1Y A;  1HC8 A;  3VW2 A;  2M4G A;  3IAM 2;  2BVL A;  4LIU A;  3H1C A;  5HOD A;  2F4I A;  2KIQ A;  3JCU C;  5KNL A;  3SZG A;  3KNW A;  3A0H C;  2EZL A;  3EYY A;  2OBP A;  2COB A;  4AU7 A;  3WGI A;  4GYG A;  1MJA A;  1MH4 A;  4RAZ A;  1Q1H A;  3M8F A;  1IXR C;  2GAU A;  3HBL A;  3MMY B;  3S1R J;  2RAE A;  3BP8 A;  1YJN I;  2D6Y A;  2ESH A;  2XDV A;  4IF4 A;  4CGZ A;  3CD6 I;  2VBY A;  5JHF A;  2FF4 A;  3ECH A;  2PZ9 A;  2ZSH B;  1DP3 A;  2W48 A;  2XVC A;  4KA4 A;  1R9T J;  1VQO I;  1RKW A;  2Q0O A;  3B6C A;  3H5R A;  1FMW A;  2Q24 A;  4OIN F;  5JFR A;  3T1B A;  3BJ6 A;  1HKT A;  4IEJ A;  1K78 B;  4EGY A;  2GIZ A;  2OV7 A;  4PSW A;  3CUQ A;  1SMY F;  2JUC A;  1IDZ A;  3MAJ A;  4QIW N;  1XGO A;  1G3Y A;  3H92 A;  4LFU A;  4WIB A;  4C2M A;  3E5U A;  3F0C A;  4GCL A;  1ZLJ A;  4V2G A;  3H35 A;  4M3E A;  1K7A A;  2F48 A;  5GP9 A;  3CP8 A;  4WF2 A;  4FET A;  4FCY A;  3A2K A;  3ZMD A;  3F8M A;  2D5V A;  1N75 A;  5F08 A;  1LDJ A;  2EV6 A;  4RAG A;  4EM2 A;  1O7F A;  2K9S A;  2PX9 A;  4EV0 A;  4IOC F;  1XSV A;  1O3Q A;  4IOA F;  2Y69 H;  4QWQ A;  2E36 A;  2IGM A;  3DV8 A;  3ABU A;  3REO A;  3WGH A;  4CIC A;  4P55 A;  1QU3 A;  3NS4 A;  2HDC A;  2CMP A;  4ZDP A;  3T6N A;  1LPQ A;  3ZMS A;  1Y1V J;  2PJR A;  5D4R A;  4LB6 B;  4HX8 A;  3WTU C;  3S16 J;  2G9W A;  4ZYG A;  3L2C A;  2EPF A;  3M7G A;  3KP6 A;  2YUS A;  1P9Q C;  1X2M A;  2XRL A;  4AF5 A;  2JA5 J;  1L0O C;  1F1Z A;  2OPT A;  2VKV A;  1R22 A;  2F07 A;  2DT7 B;  1ZN2 A;  4F93 B;  4HYE A;  5ERI A;  3BCB A;  2XHK A;  2A5W A;  4BBS J;  4MK6 A;  1JUM A;  4PJL A;  4GO1 A;  1I1S A;  1TWH J;  1MJB A;  1SD5 A;  2IAI A;  4O5V A;  2R5Z B;  2NVQ J;  4L9V A;  1OMI A;  2MFZ A;  2ZFW A;  2WV0 A;  3ON4 A;  2NP5 A;  4BY7 J;  2DA5 A;  4IO9 F;  3DPU A;  3C2G A;  3K7A J;  2ZXJ A;  3I59 A;  4HZF A;  2JPC A;  2DTR A;  3SYT A;  3CCS I;  2DBB A;  1BBY A;  3I56 I;  2KJB A;  3J7Y J;  3JSP A;  1DPR A;  1W36 C;  1VQK I;  3QOE A;  2EIN H;  3SZP A;  3JRH A;  3OIP A;  4PK4 A;  5DYM A;  3DPT A;  2QA4 I;  2L7K A;  3RTR A;  4WCG A;  1G3T A;  3CDI A;  2DJN A;  3VWB A;  1VQL I;  3G7R A;  4A3C J;  1JT0 A;  1U9N A;  2IA0 A;  3TOB A;  1RNL A;  3K4L A;  1GHC A;  4M9S A;  3QOP A;  1OQY A;  1Z1D A;  3ULQ B;  3DFG A;  2XAU A;  3M1E A;  4BY1 J;  2O3F A;  4W1U A;  2XGX A;  3KP5 A;  2BEO A;  5HS9 A;  3GTL J;  2P8T A;  3J81 K;  1DGW Y;  1TBX A;  2RHA A;  2XF6 A;  2LTP A;  3GFM A;  4ZYH A;  4V2F A;  2AXT C;  3ZQH A;  1GVD A;  5HNH A;  4NQW A;  4PXI A;  3WTW C;  3VYS B;  3DTE A;  1YIT I;  1ZEL A;  3PFI A;  3LQQ A;  1HST A;  2Y0M A;  1R5H A;  1FEX A;  4LK0 F;  3F8C A;  3GTP J;  2ADU A;  2DMQ A;  4KWA A;  5F0H A;  4C9Y A;  1BIA A;  4KFC A;  2K4J A;  4XN0 A;  1AKH A;  3HYI A;  2R7W A;  4HNT A;  3DPJ A;  3NI7 A;  3O3K A;  1RRJ A;  2JRT A;  4HF2 A;  4QPQ A;  4BE0 A;  5LBQ A;  1YHQ I;  1MKM A;  1TTY A;  3CUQ B;  1H89 C;  3GTQ J;  1R7J A;  4J01 A;  1WQ2 A;  2W00 A;  4KIS A;  5GAG J;  4DGW B;  4FE4 A;  2L9R A;  1E3P A;  2CUE A;  4N0B A;  5JHU A;  2X6O A;  1Z21 A;  4FHT A;  3BJB A;  1EH8 A;  3L9F A;  1FOX A;  2L9S A;  2E1N A;  1W0T A;  2R7R A;  3LSR A;  4OWR B;  3FXR A;  3RQI A;  5JI6 A;  5IT9 Z;  1XSX A;  2EV0 A;  2STW A;  2VJI A;  3S3O A;  3VEP A;  3VSK A;  3M07 A;  1OCT C;  5HDG A;  3EUP A;  4HW0 A;  2UXI A;  3G71 I;  3ZQC A;  3HPG A;  1GLN A;  1JJ6 C;  2C6Y A;  3W6K B;  3FXL A;  1X1B A;  2YX4 A;  3BQZ A;  2PJR B;  2KIM A;  5LHG A;  2DMU A;  5FRN A;  4A0X A;  3U9G A;  3J80 K;  3IWF A;  3BR6 A;  1HDP A;  2L4A A;  2A2F X;  3DU6 A;  2RDP A;  2QIB A;  5D6E A;  1BIB A;  2QSH X;  2MSY A;  1YX5 A;  3S15 J;  4EJO A;  2XV4 S;  4AWX B;  4JBA A;  1VQN I;  2TRT A;  4BUP A;  2R93 J;  2R7T A;  3IKV A;  5C4Y A;  1D5Y A;  3K4C A;  4QLC U;  5M5W J;  1E3H A;  1XCB A;  1EV7 A;  3JRF A;  2FNA A;  4G8X A;  2A07 F;  4EJU A;  2R7F A;  2FOW A;  1QZZ A;  1P7J A;  2Y75 A;  1U2W A;  2X4H A;  4Y33 A;  3S8P A;  1J0R A;  3GF2 A;  1O3R A;  2H8W A;  3F3X A;  4BQO A;  1D1B A;  4M3G A;  2VBZ A;  3WHC A;  3H3V K;  1MMS A;  3HE0 A;  3GTO J;  3BY6 A;  3MKZ A;  5L3B A;  1FP2 A;  2EFP A;  2HYJ A;  3I59 B;  1FOK A;  1T56 A;  3FIW A;  3WTS C;  1UHW A;  4WX9 A;  3DEU A;  4HNV A;  1H88 C;  1QPM A;  2ZXI A;  2OQG A;  3KZI C;  1NG7 A;  4OIO F;  4A2U A;  1YW9 A;  3G1O A;  2IP2 A;  4P9F A;  5J8C A;  3OYF A;  5CVU A;  1ZK8 A;  2V6C A;  4DYQ A;  4Q4Z F;  3E3V A;  1T98 A;  3F6V A;  3HKZ A;  1XMK A;  4NEL A;  5D8L B;  1LJ9 A;  1J75 A;  2CO5 A;  2VIX A;  4YZE A;  4WXH A;  2W7N A;  3P9K A;  1R36 A;  2PFV A;  5CVJ A;  3QPS A;  2ZOZ A;  4HKU A;  3C2B A;  1O4X A;  1GDT A;  3HHG A;  4LD5 A;  4F7Z A;  1Z6T A;  1PUE E;  3LL7 A;  1A36 A;  1OIS A;  1S29 A;  3SJM A;  4XQF A;  1UHM A;  1Z6R A;  2HTJ A;  3GFJ A;  4NQW B;  2Q1Z B;  3E5X A;  3QAH A;  2GA2 A;  3HRS A;  5ICF A;  3E6C C;  2IXS A;  2AQE A;  4HAM A;  2EZK A;  3CWR A;  3LWJ A;  2L3D A;  3KEO A;  2Y31 A;  1IW7 F;  4CCN A;  3H36 A;  1D8K A;  3OYC A;  2H1K A;  1WJE A;  4ZJZ A;  3F23 A;  2A05 A;  5K7F A;  4UXN A;  4CZZ A;  2P81 A;  1JUP A;  4RAY A;  3GFL A;  4ENK A;  3FX3 A;  4XLH A;  1WJA A;  3FK6 A;  1R00 A;  1AKH B;  3IKT A;  3I4N J;  1MBK A;  2MAB A;  2OD5 A;  2DK8 A;  3LWF A;  2LKX A;  2JK3 A;  5DV5 A;  2LVS A;  4UVA A;  4CSW A;  3WU0 A;  4U9N A;  3KE2 A;  4KJZ A;  4NC7 A;  4EGZ A;  3COL A;  2MW8 A;  2Q2E A;  4BS9 A;  4NB5 A;  4UHT A;  1IDY A;  5IYD J;  2BZT A;  3ANG A;  2M2E A;  3VFZ A;  2DFE A;  3OYG A;  1MSF C;  4RAF A;  1B8I B;  1V5F A;  2E2J J;  5GTH C;  2G7H A;  3LSI A;  1MBG A;  3PNY A;  2YVX A;  2OCC H;  1IRF A;  5EF6 A;  1MNE A;  1SFU A;  1S6L A;  4XKW A;  2XGE A;  3M4O J;  1FY7 A;  2NRA C;  2KRH A;  1PVE A;  5J4V A;  5CQG A;  1ETV A;  1TT0 A;  5AON A;  4KIC A;  3NRG A;  2BGC A;  4ETS A;  4MEY F;  5D5W B;  2ACJ A;  4B44 A;  1DQU A;  5ICE A;  2Q8K A;  4BAY A;  1H9T A;  5EYR A;  2IT0 A;  2WY7 Q;  3K10 A;  4I2O A;  2HZD A;  1FIP A;  3MKL A;  1T6S A;  4JK1 X;  1R4M B;  3V42 A;  3G3Z A;  1ZRF A;  5FKN A;  2O8X A;  2DT6 A;  3ELK A;  5EZG A;  4JX5 A;  1NK3 P;  2VLA A;  3PO3 J;  1E3O C;  3ZQ7 A;  1RZ4 A;  5EJC A;  3S2H J;  1RR7 A;  1MIJ A;  2F4M B;  1PUF A;  4A3B J;  4OU0 A;  1D1C A;  1U8R A;  3VP5 A;  3GCM A;  2B7E A;  1RPW A;  1SD7 A;  1XC5 A;  2WAE A;  3CF2 A;  2QQ8 A;  3KLO A;  4ICH A;  1F9N A;  1RI7 A;  2FJ1 A;  3I53 A;  4L0Z B;  2YVE A;  2H1L A;  1R5G A;  3SXY A;  2X9D A;  3HOS A;  3F72 A;  1TQI A;  3ZMZ A;  2W4S A;  3CCL I;  2NOJ B;  3KP4 A;  3HTU A;  4BHP A;  5E8I A;  3OS0 A;  1ETW A;  4JX4 A;  2W53 A;  4NNJ A;  3U21 A;  3IHU A;  4P9U A;  3B73 A;  2PLY A;  1SFE A;  1KU2 A;  2BVM A;  5F27 A;  1QPI A;  1ULY A;  3PSI A;  5GAD J;  1TC3 C;  4OMZ A;  2DOD A;  4S04 A;  5IT9 K;  3SWH A;  1IF1 A;  1VQ9 I;  2Y0S N;  4A5N A;  4NHJ A;  5FGM A;  2REK A;  2L54 A;  1NG6 A;  1ZYR F;  4ASN A;  1YS6 A;  2QKL B;  5ILU A;  1ETK A;  2LF7 A;  2QLZ A;  3LA7 A;  2IA1 A;  5F1R A;  3COA C;  1OCZ H;  4NDL A;  1SAU A;  2BY0 A;  3I54 A;  2EZH A;  2ZFU A;  4M6V A;  4LIV A;  5BNG A;  1N25 A;  4F55 A;  3UNG C;  4W97 A;  2R7Q A;  3JSO A;  2W84 A;  4Y15 A;  1BL0 A;  2ZJP F;  3RJP A;  1TWC J;  3HOZ J;  2UWM A;  5FD5 A;  4MFD A;  3BPX A;  3MEX A;  4KN4 X;  2V57 A;  2FOK A;  4U88 A;  2G3B A;  3F8B A;  1MMD A;  2QOP A;  4I0B A;  2K3F A;  3DCF A;  1JKR C;  2UXN A;  3NAU A;  2CQK A;  4GCT A;  2M1B A;  4M3F A;  4UNO A;  3I71 A;  3F9K A;  5LRS A;  4C3J J;  5IP6 A;  1HOM A;  2VXD A;  5BPI A;  3QPL A;  2O5R A;  3E6B A;  2WAQ A;  2Q2E B;  3UR3 C;  3A01 A;  1BW6 A;  2LFB A;  1JKO C;  3ZN1 A;  4ZZL A;  2GOX B;  5GPA A;  1UMQ A;  3OYJ A;  3H0D A;  3FHN A;  3CDH A;  5F64 A;  2P5L C;  1LUJ B;  2X6Y A;  1ETQ A;  3PAS A;  2DG8 A;  1XTA A;  3GX4 X;  4WXD A;  2DA3 A;  2QWT A;  4XKC A;  2MYS A;  2EQR A;  3L2W A;  1QZY A;  2TDX A;  2IU5 A;  3NRV A;  3KCC A;  5DD8 A;  3DEE A;  2I8D A;  5E20 A;  4F92 B;  1B9N A;  3GTK J;  2VUM J;  5B1B H;  1Z3Y A;  2O0Y A;  4KDP A;  2VT3 A;  4KIB A;  4C2M J;  1K78 A;  1W7P D;  1LVK A;  1X2N A;  3EPZ A;  4O3M A;  1IV8 A;  2E2I J;  1V3F A;  5CVR A;  4GFB A;  4NUB A;  2FQ4 A;  3VW1 A;  2VAS A;  4GYI A;  1WGX A;  3CCE I;  3GBG A;  3DBH B;  1XMA A;  1KZH A;  3SDB A;  1EKE A;  2WAD A;  4BQN A;  2JA6 J;  3EGQ A;  1T8I A;  2FD5 A;  2R4G A;  2E2H J;  1I6H J;  1Y39 A;  2CW8 A;  4F52 A;  4HLY A;  1HW5 A;  2JN6 A;  4XON A;  1PUF B;  3VVX A;  3KX2 A;  2VJJ A;  3V7C A;  4D0P A;  1BJZ A;  1N77 A;  5LLQ A;  3J7A Y;  2AS5 F;  2J5P A;  2OZU A;  2QUF A;  3IH3 A;  1TWA J;  3R0A A;  2LBF B;  1X1A A;  3JRI A;  3VVZ A;  4BJT A;  4MEX F;  3BCG A;  2JUG A;  4R8H A;  2X51 A;  2EK5 A;  4LMY A;  1D8J A;  1KQ9 A;  4D9J A;  5C4J J;  2CW7 A;  2M34 A;  1KQ8 A;  2JT1 A;  1FYM A;  2YVH A;  4TV7 A;  2RKH A;  3C1D A;  1R1T A;  2WGB A;  3V6G A;  2LKS A;  1F5T A;  4HX4 A;  2IRF G;  2GBY A;  1R6R A;  4U9L A;  2K86 A;  1SMT A;  1JHF A;  2HQ5 A;  2UXU A;  4AYB N;  3LHQ A;  5DAJ A;  3CME I;  1KON A;  2KT0 A;  5FLX Z;  3DU5 A;  1KGS A;  1XGS A;  4PJJ A;  2DTZ A;  3FK7 A;  1YQA A;  5IYC J;  3KYL A;  1KA8 A;  1TT5 B;  3RD3 A;  1U9O A;  1FOY A;  2HOA A;  4J19 A;  1W5T A;  1LB2 A;  2EIK H;  1BJA A;  4Z6Y A;  2DOE A;  2EWN A;  1IAW A;  1DPU A;  3OYL A;  2HOE A;  3BCA A;  5CJ9 A;  4JYK A;  3LA3 A;  1T95 A;  2ETH A;  3JW4 A;  5KHD A;  1EH7 A;  2V1U A;  2R92 J;  2VJ4 A;  2LR8 A;  2XGD A;  4IHX A;  3TMO A;  3GZ5 A;  2JVH A;  3ASO H;  2QEX I;  4E70 A;  2OZ6 A;  2NX4 A;  3H9G A;  1FIA A;  2ZJQ F;  2ECB A;  2RN7 A;  4IRI A;  3AL0 B;  4MO7 A;  4BL0 B;  1ZQ3 P;  3K1N A;  3P9T A;  2LLK A;  3DXJ F;  1FYL A;  3HOY J;  3CJT B;  3RKQ A;  3HTI A;  2GOM A;  2E35 A;  3J80 Z;  2XC7 A;  3AG2 H;  2G0E A;  2DAO A;  1R4N B;  2Z99 A;  1KU7 A;  3FXM A;  2RNG A;  5AIP A;  1DGR M;  2CFX A;  3PNV A;  3OV8 A;  3HOW J;  3DBR B;  4C3H J;  4PZJ A;  1WJ5 A;  4M72 A;  5IT3 A;  2XAS A;  3A01 B;  3HOT A;  2YSR A;  4GRI A;  3S17 J;  2K3P A;  1TW2 A;  1ZH5 A;  2DFF A;  2UUZ A;  1Z0X A;  1WJF A;  1E17 A;  5D5U B;  4YIF A;  1ORK A;  2X1E A;  2DN0 A;  1J09 A;  2M7A A;  2VI6 A;  3EUH C;  3KLN A;  2DU9 A;  3BG9 A;  3S32 A;  3KPH A;  1NHA A;  3LOC A;  2VBW A;  1K4S A;  3BR1 A;  3CLO A;  3BLY A;  3Q0W A;  2X1D A;  4A3E J;  2MLG A;  1BC7 C;  3O2P E;  1YS7 A;  4RGR A;  2WAQ N;  3U1K A;  1K6Y A;  2FRH A;  3JSJ A;  1LNW A;  2E1O A;  3OL3 A;  2E34 A;  3CF5 F;  4ENM A;  2H09 A;  2KJC A;  3RCO A;  4CCM A;  1Z7L A;  2E5N A;  4A3K J;  2WTE A;  3BNI A;  2L0K A;  1IN8 A;  2GQQ A;  4P5O A;  2VBX A;  4FAS D;  2H6B A;  2X6X A;  4LJZ F;  3Q3S A;  2HKO A;  3FMS A;  2LG4 A;  3KZY A;  4JL3 A;  1S7A A;  2KQR A;  3VYU B;  2QQB A;  3CJR B;  3QYB A;  3MZH A;  2EBI A;  4NC6 A;  4PFO A;  3TO6 A;  1T0F C;  1BA5 A;  3IWZ A;  5M5Y J;  4MHG A;  4DZP A;  3R6S A;  2E7X A;  2F5V A;  3Q9S A;  3DQV C;  3V78 A;  1IV6 A;  1K6O A;  2KLO A;  2NAZ A;  4R79 A;  2YX7 A;  2HEO A;  1ERD A;  2DA4 A;  2IS6 A;  2HZT A;  2DDB A;  4M9Z A;  4XLF A;  4OD5 A;  4AIH A;  3S3N A;  3GZI A;  3GWZ A;  2MBF A;  2KZV A;  4A69 C;  4L0Y B;  2XAJ A;  3M9A A;  3IUV A;  3I9V 2;  2HTS A;  3JRD A;  1OPC A;  3OL4 A;  2QGU A;  1XSD A;  3HGG A;  3QRF F;  1D1A A;  2K9N A;  1ODD A;  2ZME C;  1SVL A;  3VOK A;  4G94 A;  4KMF A;  5L3D A;  3OS2 A;  5J1R A;  3S2D J;  4HDU A;  1HLV A;  1MMA A;  1XX5 A;  3QWL A;  3PO2 J;  4OIP F;  3S1M J;  2B1E A;  4IXA A;  1F36 A;  1NK2 P;  3KET A;  4BQQ A;  3B81 A;  2YS9 A;  1IN6 A;  2NVY J;  3RYP A;  2GLO A;  4CYC A;  1YE9 A;  4IPA A;  2Y9Z A;  4D1Q A;  5C44 J;  1TNT A;  3BZ6 A;  5B66 C;  1ZR2 A;  2DFI A;  2HKU A;  2KL4 A;  3G56 A;  1ZRC A;  3IV5 A;  3GTJ J;  1SFK A;  4EM0 B;  5F6F A;  3G1L A;  4HA8 A;  4I02 A;  4BQA A;  2V1N A;  4ZDO A;  3ECO A;  5DTD A;  2KDZ A;  1RIO H;  4J00 A;  1OYW A;  4LG3 A;  3TP0 A;  3ZR8 X;  4E4H A;  3QOD A;  5IOY A;  2IGK A;  4BBR J;  4QSH A;  1B9M A;  2VJ5 A;  4G6Q A;  2QQ9 A;  4MXM A;  1I6X A;  5EG0 B;  3L2U A;  3MVP A;  2K9Q A;  4AVZ A;  5HAW A;  1I50 J;  1S72 I;  4HV5 A;  4IHV A;  1ETX A;  3ZP5 A;  3S2W A;  3D1N I;  1Z91 A;  2EZI A;  4CDG A;  4I09 A;  4RGX A;  3H5N A;  2EFO A;  2VT2 A;  1J59 A;  1X58 A;  1WH7 A;  1MNM C;  1A31 A;  1D0Y A;  1Z3X A;  1SGM A;  1QNT A;  2P7C B;  2M0M A;  3HRT A;  3KP7 A;  3PSF A;  1HXD A;  3K2A A;  1A35 A;  2ZC2 A;  4V19 K;  4A3G J;  1KYZ A;  2HGC A;  5D5V B;  2NNY A;  2MA3 A;  4OAY A;  3LSK A;  4IVN A;  2E19 A;  2RVC A;  1P4W A;  1TWF J;  4HNU A;  1P2F A;  3K1M A;  5M3M J;  4G6D A;  3VIB A;  1FX7 A;  3ZQQ A;  2PG4 A;  3IRR A;  2EIJ H;  2QF7 A;  1X3W B;  1IRZ A;  1EF4 A;  1FTT A;  2LK2 A;  3E5Q A;  1QHH D;  3H9Q A;  4DZJ A;  3HTA A;  4RLF A;  4ZYE A;  1G8X A;  3HRM A;  2CSO A;  5FLX K;  3N4M A;  3GUD A;  2IBD A;  1IRX A;  3DBL B;  2P6T A;  2QCO A;  4A5M A;  2WWY A;  1B1B A;  3FBN B;  4E7L A;  1XD7 A;  2DYR H;  4IRG A;  3LAJ A;  2VKH A;  3BR3 A;  1BI3 A;  2IGN A;  3JRC A;  1K79 A;  1B8I A;  2ZCN A;  3QPT A;  4N4N B;  3A1Y A;  2FMY A;  2DOA A;  1WFX A;  2L2O A;  3I3L A;  2P4W A;  4XR6 A;  3AFH A;  3GZ6 A;  4M71 A;  1LDD A;  4KNY A;  5HNF A;  3M8J A;  1W5C C;  1A6Q A;  5FKL A;  4HSR A;  2HPM A;  3VUQ A;  2DOF A;  2N8G A;  4JNN A;  2ZOY A;  1FMV A;  1U5T C;  2FX0 A;  1VQ8 I;  2XB0 X;  3RPU D;  5L3F A;  3EYI A;  3KFW X;  3BG6 A;  3CO7 C;  4C2T A;  5DCM B;  1VI0 A;  1WKM A;  1Y8Q B;  4XLA A;  2CRG A;  4Q48 A;  2V1X A;  4UDS A;  4DOZ A;  2VE9 A;  4AID A;  3TW7 A;  4AC0 A;  2XAH A;  1MMN A;  5CQE A;  5EFY A;  1SC7 A;  3H3Z A;  3JRG A;  1U5T B;  4UY8 I;  2ESN A;  4YG2 F;  4ESJ A;  3S93 A;  3WTY C;  4LIT A;  3AAF A;  4IJA A;  2ZCM A;  2PEX A;  2B3W A;  3HG9 A;  4XRM A;  1PP7 U;  2R7O A;  2CS3 A;  4Y4R A;  3ZN0 A;  4CA0 A;  2YU9 J;  1YO5 C;  1G59 A;  2E1M C;  4CYC B;  2EFW A;  5DS9 A;  3KZ9 A;  2DQR A;  1BR1 A;  4IX7 A;  1WPK A;  3C18 A;  2UV1 A;  5DCF A;  2WC2 A;  2EIM H;  1OYY A;  3A0B C;  2EIL H;  2V6E A;  2DCE A;  1XG1 A;  2F4O B;  5HVQ C;  5FJ8 J;  2R0Q C;  3MZY A;  3ZPL A;  2VON A;  2DA2 A;  5J40 A;  2XSJ C;  1ZLK A;  3FXU A;  4G7O F;  3L1P A;  1RES A;  4I01 A;  3GTM J;  5FFX A;  2AO9 A;  4B8X A;  2TCT A;  2DJI A;  5K5R A;  5E3O A;  2OTL I;  1KU9 A;  4AIJ A;  3BTC A;  4HRI A;  3VDX A;  2E1M B;  4IKF A;  1V54 H;  2BY3 A;  5CYV A;  2VKE A;  3C3W A;  2PFB A;  3PIP F;  1MH3 A;  3KIO A;  1YW8 A;  4UUT A;  4CZC A;  2FUG 2;  3T0Y A;  4C2U A;  1QBJ A;  3FIS A;  4M6X A;  1ON2 A;  4Y13 A;  1UJ8 A;  1S7E A;  3E6M A;  1IJW C;  2XSD C;  3OYE A;  5CW8 A;  3ABM H;  1FOW A;  2X0L A;  5CVV A;  3NNR A;  1FBS A;  2L7Z A;  3OYI A;  5D8K B;  3TL4 X;  3CZ6 A;  2WY8 Q;  3X2Q H;  3T8R A;  2VOP A;  1RUO A;  2CFO A;  4F91 B;  2JZY A;  2L01 A;  5HOO A;  3EDP A;  2O7T A;  3TQN A;  5J4Y A;  1ZRD A;  1ZRE A;  2UXP A;  2BE5 F;  2LC2 A;  3MCZ A;  3TED A;  4MNU A;  5AQC A;  2JWT A;  3CUO A;  1AU7 A;  2ZJR F;  2G7L A;  5KCM A;  1P4X A;  1IO2 A;  1UFM A;  4BKX A;  1XGN A;  2A69 F;  2IS1 A;  3IAS 2;  4GCK A;  2XPW A;  4RMN A;  2ZCW A;  3ZXS A;  3DF8 A;  2IGO A;  2XRN A;  2Z2S B;  3CO6 C;  3LFK A;  2HQA A;  4AD9 A;  1RET A;  1PP8 F;  4KMU X;  3P9I A;  4I6Z A;  1VTN C;  3W2W A;  5J3L A;  4XSZ F;  3HB9 A;  2V79 A;  1D0X A;  5LHI A;  1NH3 A;  1K61 A;  3QP5 A;  2H94 A;  4MQ9 F;  4CGR A;  3DKW A;  3P5J A;  2R7D A;  3ZQF A;  1U78 A;  4L9J A;  1TQM A;  4EAT A;  2B9S A;  2QM3 A;  2OA4 A;  2WB1 A;  1LKX A;  3HHH A;  1BN5 A;  2EA2 A;  3PQJ A;  4XOR A;  1YIJ I;  1K83 J;  4S0H B;  1BM9 A;  2R7V A;  1V5E A;  4B47 A;  3L2Q A;  1F4K A;  1OCO H;  2G7S A;  1HCR A;  4U0W A;  5CXG A;  3TO9 A;  2W24 A;  2M9H A;  3CMA I;  2ISZ A;  1IUF A;  1J2X A;  1NTC A;  2HWV A;  3Q0V A;  4Y52 J;  2BXZ A;  5IPA A;  4OMY A;  2DXI A;  1IN7 A;  1BR4 A;  1GV5 A;  3OYA A;  4PJ0 C;  1SVO A;  2WBM A;  3K6G A;  5JVT A;  2CWE A;  1R49 A;  4JKZ A;  3F21 A;  2RNJ A;  3PJR A;  4BDY A;  5L3C A;  1LEA A;  1D3Y A;  4A0Z A;  2DK5 A;  4U7D A;  1ETO A;  3HEF A;  3L00 A;  3W6V A;  4FIS A;  4DBR A;  3OYM A;  2KIS A;  2GUH A;  3CQZ J;  2FJI 1;  3TP3 A;  4ENN A;  3B02 A;  3CDL A;  5FRM A;  5LGT A;  2P0W A;  5CLS A;  2LY9 A;  2A6E F;  1BOB A;  4LLL A;  2QTQ A;  2WAF A;  2H27 A;  4PDK A;  5FRO A;  4ABZ A;  2IEK A;  1WJC A;  2LBF A;  2CV1 A;  3FF5 A;  3TO7 A;  2KZG A;  3ZQG A;  3R60 A;  2HVR A;  3W2A A;  4D5C A;  4O6J A;  1YG2 A;  2CQX A;  2KRC A;  4HPQ A;  3KP2 A;  2HXI A;  4BXF A;  3SQN A;  3GZN B;  2L7M P;  1OYI A;  1YX3 A;  3BR2 A;  2L02 A;  4XRS A;  3RI4 A;  1SAX A;  5CVI A;  4KIF A;  3FRQ A;  3ZMV A;  1Y8R B;  1R1U A;  2GM4 A;  4XLC A;  2L7F P;  4OIR F;  3BTL A;  2LY2 A;  5HLT A;  2AXL A;  9ANT A;  1WWX A;  2EA4 A;  2HPI A;  3D0S A;  1GXQ A;  1I3A A;  1P7I A;  3DPL C;  3Q0U A;  3S1Q J;  2DW4 A;  1FSE A;  3GFI A;  3RH2 A;  2BV6 A;  3MWM A;  1T39 A;  4B09 A;  1AWC A;  1FC3 A;  2QEN A;  3Q9V A;  4Y7N J;  2F6C A;  2FQ3 A;  3TDU C;  2R5Y B;  5D4S A;  2VOD A;  3H0G J;  4L9T A;  3GYH X;  5BPD A;  2CGP A;  2IJL A;  3HKZ N;  2NS7 A;  3V4G A;  4PJN A;  3EUK L;  1JUS A;  1E2X A;  2OQR A;  3BQY A;  3HL2 A;  3M8E A;  1CGP A;  3U1D A;  3MD2 A;  4EJT A;  3F6O A;  4U0V A;  1JJ8 C;  4GGG A;  1VQM I;  1YRN A;  4I76 A;  2ID6 A;  4DJA A;  2HFH A;  2LKP A;  3QU6 A;  4EJV A;  5DD4 A;  1IZ1 A;  2Z33 A;  2K40 A;  3K4N A;  4E7K A;  3OYH A;  2HKX A;  3FXK A;  1ETY A;  2DMT A;  3PUB A;  1SEU A;  3NPI A;  5EEG A;  2LNB A;  4EJW A;  3DTI A;  3ESW B;  2OER A;  4L62 A;  2KIU A;  4A12 A;  2MC4 A;  1ITY A;  3LJL A;  5HSZ A;  5FKO A;  3EUA A;  4GCV A;  2LOO A;  3FXO A;  1BI0 A;  4IHY A;  5FHP A;  5DM6 F;  1OR7 A;  3ML6 A;  1O3T A;  1XS9 A;  1TWG J;  3E0J B;  4L5E A;  1T08 B;  4M9X A;  3QU3 A;  4G9Y A;  1OCP A;  3CJD A;  2PBI A;  2OU2 A;  2W85 A;  1FNN A;  1PYV A;  3MQ0 A;  4M74 A;  5B1A H;  4ME9 A;  2PQ8 A;  1ACI A;  2DDA A;  2D1V A;  1AA7 A;  3HSE A;  4I98 B;  1U3E M;  2LDU A;  4HF0 A; 
#chains in the Genus database with same CATH homology
 1AKH A;  3DPJ A;  2WAQ N;  4XIC A;  3S5R A;  2HDD A;  3NI7 A;  3JSJ A;  3JRA A;  3PPB A;  2EH3 A;  4DW6 A;  2ME0 A;  3PM1 A;  2R7Z J;  5CXI A;  2E1O A;  2ZCX A;  5M3F J;  1H89 C;  3GTQ J;  4A3F J;  4A3K J;  3BNI A;  2L0K A;  4FE4 A;  2L9R A;  2CUE A;  2WUI A;  3FKI J;  2X6O A;  3BJB A;  5F1J A;  2XPU A;  1W0T A;  1GUU A;  3HGY A;  5K7Z A;  3LSR A;  2Y30 A;  3RQI A;  1UG2 A;  3Q3S A;  2LP0 A;  1A6I A;  2XDN A;  2DA1 A;  4RDU A;  1JKP C;  4JL3 A;  1OCT C;  4DYR A;  2PMZ N;  2EBI A;  3BRU A;  4M3D A;  4A3L J;  3EUP A;  4LOC A;  4A3I J;  2UXI A;  3ZQC A;  5F0F A;  1POG A;  1JJ6 C;  1BA5 A;  2B63 J;  5M5Y J;  2O7O A;  2OI8 A;  4D7N A;  4DZP A;  4X6A J;  3V78 A;  1IV6 A;  3BQZ A;  3BT9 A;  4FTH A;  2DA4 A;  2DMU A;  1B72 A;  1OFC X;  1VND A;  1HDP A;  3BR6 A;  3G1M A;  3GZI A;  2QIB A;  2AHQ A;  1WCM J;  4A69 C;  2MSY A;  3JRB A;  3S15 J;  4AC6 A;  3IUV A;  3JRD A;  1WH5 A;  2ZOZ A;  3HGG A;  2K9N A;  5EGO A;  2TRT A;  3HOU J;  4JX6 A;  3BG5 A;  4A93 J;  3VOK A;  2R93 J;  3VOX A;  1IG7 A;  1MBJ A;  5J1R A;  4B3A A;  3WHB A;  1D5Y A;  5JLW A;  3S2D J;  1HLV A;  3CRJ A;  5FGL A;  1LFB A;  5M5W J;  3I4M J;  3PO2 J;  2VPR A;  3S1M J;  3JRF A;  1F36 A;  1NK2 P;  5EZH A;  3SFI A;  1JTX A;  3B81 A;  1F43 A;  2YS9 A;  3LSP A;  2NVY J;  1P7J A;  2GLO A;  2NP3 A;  4MFE A;  1APL C;  3OSG A;  4CYC A;  1QRY A;  3NAR A;  4M3G A;  2Y9Z A;  3BHQ A;  3WHC A;  3H3V K;  5C44 J;  2PBX A;  3HE0 A;  3GTO J;  3ANP A;  3HIM A;  1ZR2 A;  3BR0 A;  3ON2 A;  2DMN A;  2HYJ A;  3HOV J;  2XGC A;  2HKU A;  2HOS A;  3VPR A;  2QKO A;  1T56 A;  3FIW A;  2ELK A;  3G56 A;  3IV5 A;  4HNV A;  3GTJ J;  1H88 C;  3B6A A;  3G1L A;  3G1O A;  2M8G X;  1ZK8 A;  5DTD A;  1UHS A;  4DYQ A;  2KDZ A;  4ACI A;  3TP0 A;  3BG3 A;  5IOY A;  1YRN B;  4NEL A;  3A03 A;  4YZE A;  4BBR J;  4C3I J;  4QSH A;  3UKG A;  4MXM A;  5EG0 B;  3MVP A;  2K9Q A;  5HAW A;  2JA7 J;  1I50 J;  1MBF A;  3QPS A;  4IHV A;  2WV1 A;  1ETX A;  3C2B A;  1O4X A;  5EG0 A;  1GDT A;  3D1N I;  1JT6 A;  2EZI A;  1BW5 A;  1QVT A;  2OF7 A;  2MGQ A;  3SJM A;  1X58 A;  1WH7 A;  3HM5 A;  1MNM C;  2RAS A;  1SGM A;  3BR5 A;  1U8B A;  1JTY A;  2DG7 A;  4IHW A;  3BTI A;  3K2A A;  5HBU A;  2EZK A;  2X48 A;  4A3G J;  3CWR A;  3LWJ A;  2Y31 A;  1IC8 A;  3QKX A;  1MBE A;  2ME6 A;  2H1K A;  5D18 A;  4M3B A;  2E19 A;  3JRE A;  1TWF J;  5FKK A;  5M3M J;  5F0C A;  1HDD C;  1Y1W J;  3OIO A;  5K7F A;  3HTJ A;  3VIB A;  4JP0 A;  2P81 A;  1JUP A;  5IP7 J;  5C3E J;  3FK6 A;  1AKH B;  3I4N J;  2UXO A;  1MBK A;  2JMW A;  3VW0 A;  2QF7 A;  1ZGW A;  2GFN A;  2LKX A;  3ZOB A;  2JK3 A;  1IRZ A;  1EF4 A;  1FTT A;  2LK2 A;  2LVS A;  1ZKG A;  4DZJ A;  3HTA A;  3COL A;  4NN1 A;  5EDN A;  2MW8 A;  2CU7 A;  1IDY A;  2IBD A;  5IYD J;  1HF0 A;  2M2E A;  3ANG A;  2QCO A;  4B1R A;  2O8K A;  1MSF C;  1B8I B;  2E2J J;  1Z77 A;  3KKD A;  5E3N A;  4AUX A;  3AQT A;  1MBG A;  3BR3 A;  2ZCN A;  1B8I A;  3JRC A;  5EF6 A;  2CJJ A;  3IH2 A;  2DA7 A;  3NXC A;  1RKT A;  2WB1 N;  1A5J A;  3AQS A;  2XGE A;  3M4O J;  5IOZ A;  3E7L A;  5FKL A;  3VUQ A;  2N8G A;  1ETV A;  4JNN A;  2NS8 A;  2ZOY A;  3SDG A;  3O8G A;  2FX0 A;  3NRG A;  2XB0 X;  2GEN A;  2HOT A;  3CMY A;  1VI0 A;  2HI3 A;  2MG4 A;  2FBQ A;  2H8R A;  1B72 B;  4XID A;  2CRG A;  4UDS A;  3LNQ A;  5EYR A;  4G12 A;  2HXO A;  4XRS G;  4A3D J;  3TW7 A;  1VFC A;  1LFU P;  4AC0 A;  1FIP A;  3MKL A;  3KKC A;  5EGO B;  5EFY A;  3JRG A;  5FKN A;  1NK3 P;  5EZG A;  2ID3 A;  4JX5 A;  5EEA A;  5H9T A;  3PO3 J;  2ZCM A;  1E3O C;  3S2H J;  4X1E A;  1RR7 A;  3GTG J;  4XRM A;  2LD5 A;  3MN2 A;  4BXX J;  1VF9 A;  1PUF A;  4A3B J;  1H8A C;  3VP5 A;  3ZQI A;  4A3J J;  3C07 A;  1RPW A;  1XC5 A;  2YU9 J;  2JJ7 A;  4CYC B;  3HOX J;  5DS9 A;  3KZ9 A;  4ICH A;  1WPK A;  1MSE C;  5M5X J;  5K7H A;  2DMP A;  2FJ1 A;  2YVE A;  3VVY A;  1ZR4 A;  1WI3 A;  5GPC A;  2X9D A;  5C4Y A;  1XG1 A;  5FJ8 J;  2R0Q C;  1T33 A;  2O9L A;  3O60 A;  2DA2 A;  1DU0 A;  4UUS A;  1ETW A;  1RES A;  4JX4 A;  4D5F A;  3L1P A;  2AO9 A;  5FKM A;  2TCT A;  5E3O A;  3GTM J;  3ZQL A;  2W53 A;  1IGN A;  3OOU A;  4MLO A;  3HTH A;  3BTC A;  5E3M A;  2VKE A;  5F27 A;  1QPI A;  1MH3 A;  3S1N J;  1TC3 C;  4UUT A;  3M3Y J;  5D19 A;  5D1R A;  2Y0S N;  3O8H A;  2REK A;  5FMP A;  5JLX A;  4A3M J;  2R5Z A;  3FIS A;  2M0C A;  1G2H A;  4B4C A;  1S7E A;  1ETK A;  1IJW C;  2XSD C;  1OJL A;  5CW8 A;  4NDL A;  1JKQ C;  3QQA A;  1FJL A;  2EZH A;  1UI5 A;  2HYT A;  3NNR A;  3OSF A;  2L7Z A;  4M6V A;  2ECC A;  1QVU A;  4FE7 A;  5BNG A;  1AHD P;  4W97 A;  1GV2 A;  1BL0 A;  1TWC J;  5J1Y A;  1CQT A;  3HOZ J;  3VW2 A;  4MFD A;  2O7T A;  5HOD A;  2V57 A;  2UXP A;  2G3B A;  3TED A;  2QOP A;  5AQC A;  3KNW A;  2JWT A;  3BTJ A;  3DCF A;  2EZL A;  4RBO A;  1JKR C;  3NAU A;  1AU7 A;  2G7L A;  4GCT A;  2COB A;  4M3F A;  2NOG A;  4BKX A;  4C3J J;  3DEW A;  5IP6 A;  1HOM A;  4GCK A;  1MH4 A;  2XPW A;  3QPL A;  3HBL A;  3A01 A;  1BW6 A;  2LFB A;  1JKO C;  3S1R J;  2DA6 A;  1RET A;  2RAE A;  5GPA A;  1UMQ A;  4I6Z A;  2D6Y A;  5J3L A;  3IH4 A;  3HB9 A;  2Y9Y A;  1ETQ A;  1DU6 A;  3PAS A;  3LSJ A;  1K61 A;  2DG8 A;  4CGR A;  2DA3 A;  2QWT A;  2PZ9 A;  5FLV A;  2EQR A;  3ZQF A;  2W48 A;  1U78 A;  2CQQ A;  1LE8 A;  3HDD A;  1R9T J;  1RKW A;  2IU5 A;  3A02 A;  3B6C A;  2Q24 A;  3GTK J;  2VUM J;  1K83 J;  4IEJ A;  4S0H B;  2G7S A;  4C2M J;  1HCR A;  5CXG A;  2M9H A;  1X2N A;  1IUF A;  4QTR A;  2UXH A;  1NTC A;  3Q0V A;  5E3L A;  4Y52 J;  1IDZ A;  2E2I J;  5IPA A;  3RZD J;  4QIW N;  1GV5 A;  4GFB A;  2FQ4 A;  3VW1 A;  1WGX A;  3F0C A;  4GCL A;  1ENH A;  4V2G A;  3GBG A;  4M3E A;  4JKZ A;  4HKU A;  2JA8 J;  5GP9 A;  2JA6 J;  3EGQ A;  2FD5 A;  2E2H J;  1I6H J;  1I3Q J;  4FCY A;  2D5V A;  5F08 A;  1ETO A;  3HEF A;  2K9S A;  3W6V A;  4FIS A;  2CUF A;  2JN6 A;  4MIM A;  1PUF B;  2GUH A;  3CQZ J;  3VVX A;  3TP3 A;  3S14 J;  1BJZ A;  3CDL A;  1UI6 A;  2LY9 A;  3T6N A;  2QTQ A;  3IH3 A;  1TWA J;  1Y1V J;  3LSG A;  3JRI A;  3VVZ A;  1GT0 C;  4ABZ A;  2IEK A;  3S16 J;  3BCG A;  2YUS A;  1Q1V A;  2G7G A;  3ZQG A;  1X2M A;  1MBH A;  2XRL A;  4EEF G;  4D5C A;  5C4J J;  2JA5 J;  4GFL A;  4AF5 A;  3CCY A;  2M34 A;  4XK4 A;  2YVH A;  2OPT A;  2CQX A;  5IYB J;  2VKV A;  4UUS B;  2F07 A;  4D7M A;  2HXI A;  3MNL A;  2L7M P;  3JR9 A;  2WGB A;  3V6G A;  3TW6 A;  1SAN A;  3BR2 A;  4XRS A;  4BBS J;  4MK6 A;  1JUM A;  3FRQ A;  2GBY A;  2GM4 A;  1TWH J;  2L7F P;  2HQ5 A;  2UXU A;  4AYB N;  3F1B A;  3BTL A;  3LHQ A;  5DAJ A;  2IAI A;  3QBM A;  2NVQ J;  2KT0 A;  2R5Z B;  9ANT A;  3E7Q A;  5K58 A;  3Q0U A;  1P7I A;  2DTZ A;  3GEU A;  3FK7 A;  5IYC J;  3S1Q J;  3ON4 A;  3RH2 A;  3RD3 A;  2NP5 A;  4BY7 J;  2DA5 A;  1U9O A;  2HOA A;  4Y7N J;  4J19 A;  4GFK A;  2R5Y B;  3K7A J;  2I10 A;  1ZTR A;  3H0G J;  1W0U A;  2R5Y A;  5C4X J;  3HKZ N;  2NS7 A;  4JYK A;  2R92 J;  1JUS A;  3JRH A;  3BQY A;  3RZO J;  2LR8 A;  2XGD A;  4IHX A;  1JJ8 C;  1YRN A;  4I76 A;  2DJN A;  2ID6 A;  2NX4 A;  3G7R A;  4A3C J;  5F04 A;  1JT0 A;  1FIA A;  1U9N A;  2ECB A;  2XB5 A;  4MO7 A;  2K40 A;  1ZQ3 P;  3P9T A;  2LLK A;  2ZB9 A;  3HOY J;  3RKQ A;  3HTI A;  1ETY A;  4BY1 J;  5FLM J;  2G0E A;  2DMT A;  2XPV A;  4W1U A;  3GTL J;  3NPI A;  2NVT J;  2OER A;  2RHA A;  2LTP A;  3HOW J;  4L62 A;  4V2F A;  4C3H J;  3ZQH A;  1GVD A;  1SFO J;  1ITY A;  3LJL A;  5HSZ A;  5FKO A;  4PXI A;  3A01 B;  2Y2Z A;  3S17 J;  4IHY A;  5FHP A;  5J1U A;  1XS9 A;  1TWG J;  1Z0X A;  4DYC A;  4L5E A;  1ORK A;  1OCP A;  2DN0 A;  2VI6 A;  1FEX A;  3CJD A;  3GTP J;  1JGG A;  3BG9 A;  2NVX J;  4ME9 A;  2DMQ A;  3LOC A;  4KWA A;  5F0H A;  5IP9 J;  3BR1 A;  1LE8 B;  1FTZ A;  3Q0W A;  4A3E J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...