3CJDA

Crystal structure of putative tetr transcriptional regulator (yp_510936.1) from jannaschia sp. ccs1 at 1.79 a resolution
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
189
structure length
182
Chain Sequence
KAALREKLIDLAEAQIEAEGLASLRARELARQADCAVGAIYTHFQDLNALTLEVNGRTFARLGAAVGDDHPNERLIAMSHAYLAFAREHPKLWRALFDVEMRSDGPVPQWYGHAMAQLFSYITTPLAKIFPESDDAELDLMTRTLFSSVHGIVLLGLENRISGVPGEQLKTMIRLLLEQVGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, TetR family
publication title Crystal structure of putative TetR transcriptional regulator (YP_510936.1) from Jannaschia sp. CCS1 at 1.79 A resolution
rcsb
source organism Jannaschia sp.
molecule tags Transcription regulator
total genus 64
structure length 182
sequence length 189
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF13305 TetR_C_33 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3cjdA00
5C4YA 3GEUA 5J3LA 5HBUA 2QOPA 3KZ9A 4I76A 3ANGA 3V78A 3KNWA 2OERA 1RPWA 4KWAA 4D5FA 2G0EA 1BJZA 5F0HA 2XDNA 3G1MA 2IU5A 3HGGA 5FMPA 4ABZA 2ZOYA 2FBQA 3IH3A 4W97A 1JTXA 4M3EA 2XRLA 2QKOA 4AF5A 3NNRA 2NX4A 4ACIA 3QQAA 2DG7A 2OPTA 3LOCA 4M3GA 3RD3A 3IH2A 2HXOA 2GUHA 5J1YA 2WUIA 2TCTA 5D18A 3SFIA 2Y30A 2O7OA 2XPVA 5K7ZA 5AQCA 3QPLA 3BR2A 2G7SA 2UXPA 2XGDA 4UDSA 2UXIA 2OF7A 2GFNA 3ZQFA 2FJ1A 2XGCA 2IEKA 2HYTA 3B6CA 3RH2A 2QIBA 5F08A 3HGYA 3QKXA 3Q3SA 3FK7A 4D5CA 2F07A 3BR3A 4B3AA 2QCOA 2JJ7A 5H9TA 5F0CA 3FIWA 3O8GA 5IP6A 3Q0UA 2Y2ZA 4V2GA 5F0FA 1JUPA 3VVZA 3BR0A 4AUXA 2QWTA 3G7RA 3ON4A 4YZEA 3C07A 3BR5A 2ID3A 3NRGA 3EGQA 5GPCA 4M3FA 3ZQIA 3TP0A 2ID6A 5EFYA 5GP9A 5EZGA 4GFKA 1QPIA 3Q0VA 5FKMA 3FRQA 2WGBA 5GPAA 1Z77A 2HQ5A 3HTHA 2DTZA 3G1LA 3LSPA 5FHPA 4ICHA 5F27A 4GCTA 2UXHA 3BQZA 2HKUA 3F0CA 3TP3A 3C2BA 3VUQA 4V2FA 2ZOZA 3WHCA 3CCYA 2G7LA 5CXGA 3IH4A 3JSJA 2RASA 4JL3A 5FKNA 1ZKGA 5J1RA 3MNLA 3FK6A 2FD5A 3QBMA 4GFLA 2I10A 2UXUA 5EZHA 4JNNA 2REKA 5F04A 3G56A 3AQTA 3LSJA 2UXOA 3V6GA 2VKVA 5IOZA 5DAJA 2X9DA 5FGLA 4X1EA 3BTIA 3BRUA 1JUSA 3S5RA 3NPIA 4NN1A 1UI6A 3MVPA 3BNIA 5D19A 5K7HA 3CRJA 4M3DA 3BR1A 2G7GA 3HE0A 3CDLA 4GCKA 2FQ4A 4CGRA 2DG8A 2EH3A 3CJDA 5EYRA 4ME9A 2ZCNA 5HAWA 2V57A 2NP5A 3WHBA 3LHQA 4D7NA 3IUVA 4HKUA 1QVUA 1T56A 3HIMA 2XPWA 3LWJA 4MK6A 2VKEA 1JT0A 3BR6A 2YVEA 3O60A 3ON2A 4G12A 3VIBA 3CWRA 5FKLA 2HXIA 2RAEA 4B1RA 3VW2A 4MXMA 3Q0WA 5HSZA 1JT6A 4M3BA 2QTQA 3COLA 4JYKA 2XGEA 3EUPA 3VW0A 2NS7A 2PBXA 2D6YA 4L62A 3PASA 3E7QA 1Z0XA 1T33A 3O8HA 2O7TA 2JK3A 3B6AA 1RKTA 3VW1A 2VPRA 2HYJA 4MO7A 3DEWA 4XK4A 5FKKA 3SDGA 3P9TA 2YVHA 5IPAA 5D1RA 2IAIA 4NELA 4I6ZA 2IBDA 3HTJA 5IOYA 3HTIA 3AQSA 2Q24A 3BTJA 3BCGA 3LSRA 4AC6A 2Y31A 3ZQLA 3QPSA 1JUMA 3BTCA 5J1UA 5K7FA 3LJLA 3T6NA 2NP3A 3F1BA 3DCFA 5CW8A 3NXCA 1ZK8A 3GZIA 2PZ9A 2G3BA 5K58A 4GCLA 1U9NA 1U9OA 1SGMA 1QVTA 3HTAA 1RKWA 5F1JA 3VVXA 3VPRA 4PXIA 1ORKA 3B81A 3ANPA 3ZQHA 2GBYA 2XB5A 4D7MA 3BHQA 3VVYA 4JKZA 2X6OA 1VI0A 3BJBA 3BQYA 3DPJA 1UI5A 3BT9A 3KKCA 3PPBA 3VOKA 5FKOA 3ZQGA 1A6IA 3PM1A 3KKDA 3VP5A 2ZCMA 2TRTA 3VOXA 2ZCXA 1JTYA 2NS8A 4DW6A 2FX0A 5CXIA 2W53A 2ZB9A 2OI8A 4AC0A 3BTLA 2WV1A 4W1UA 3G1OA 2RHAA 2GENA 3NI7A 2XPUA
chains in the Genus database with same CATH superfamily
4DVYP 5C4YA 3GEUA 5J3LA 5HBUA 2QOPA 3KZ9A 4I76A 3K8PC 3ANGA 3V78A 3KNWA 2B1EA 2OERA 1RPWA 4KWAA 4D5FA 2G0EA 1BJZA 2R7UA 3NS4A 5F0HA 2XDNA 3G1MA 2IU5A 3HGGA 5FMPA 4ABZA 2ZOYA 2FBQA 3IH3A 4W97A 1JTXA 4M3EA 5CQGA 2XRLA 4IRVA 2QKOA 4AF5A 3NNRA 2NX4A 4ACIA 3QQAA 2DG7A 2OPTA 2FJI1 3LOCA 4M3GA 3RD3A 3IH2A 2HXOA 2GUHA 5J1YA 2WUIA 2TCTA 5D18A 3SFIA 2Y30A 2O7OA 2XPVA 5K7ZA 5AQCA 3QPLA 3BR2A 2G7SA 2UXPA 2XGDA 4UDSA 2UXIA 2OF7A 2GFNA 3ZQFA 2FJ1A 2XGCA 2IEKA 2HYTA 3B6CA 3RH2A 2QIBA 3VTIA 5F08A 3HGYA 3QKXA 3Q3SA 3FK7A 4D5CA 2F07A 3BR3A 4B3AA 2QCOA 2JJ7A 5H9TA 5F0CA 3FIWA 3O8GA 5IP6A 3Q0UA 2Y2ZA 4V2GA 5F0FA 1JUPA 3VVZA 3BR0A 4AUXA 2QWTA 3G7RA 3ON4A 4YZEA 3C07A 3BR5A 2ID3A 3NRGA 3EGQA 5GPCA 4M3FA 3ZQIA 3TP0A 2ID6A 5EFYA 5GP9A 5EZGA 4GFKA 1QPIA 3Q0VA 5FKMA 3FRQA 2WGBA 5GPAA 1Z77A 2HQ5A 3HTHA 2DTZA 3G1LA 3LSPA 5FHPA 4ICHA 5F27A 4GCTA 2UXHA 3BQZA 2HKUA 3F0CA 3TP3A 2PFVA 3C2BA 3VUQA 4V2FA 2ZOZA 3DU6A 3WHCA 3DU5A 3CCYA 2B3WA 2R7OA 2G7LA 4U9NA 2R7XA 5CXGA 3IH4A 3JSJA 2RASA 4JL3A 5FKNA 2R7WA 1ZKGA 2R7QA 5J1RA 3MNLA 3FK6A 2FD5A 3QBMA 4GFLA 2I10A 2UXUA 5EZHA 4JNNA 2REKA 5F04A 3G56A 3AQTA 3LSJA 2UXOA 3V6GA 2VKVA 5IOZA 4U9LA 5DAJA 2X9DA 5FGLA 4X1EA 3SWHA 3BTIA 3BRUA 1JUSA 3S5RA 3NPIA 3FHNA 4NN1A 4WIBA 1UI6A 3MVPA 3BNIA 5D19A 5K7HA 3CRJA 4M3DA 3BR1A 2G7GA 3HE0A 3CDLA 4GCKA 2FQ4A 4CGRA 2DG8A 2EH3A 3CJDA 5EYRA 4ME9A 2A2FX 2ZCNA 5HAWA 2V57A 2NP5A 3WHBA 3LHQA 4D7NA 3IUVA 4HKUA 2ZY9A 1QVUA 1T56A 4OD4A 3HIMA 2XPWA 3LWJA 4MK6A 2VKEA 1JT0A 3BR6A 2YVEA 3O60A 3ON2A 4G12A 3VIBA 3CWRA 5FKLA 2HXIA 2RAEA 2R7RA 4B1RA 3VW2A 2R7SA 4MXMA 3Q0WA 5HSZA 1JT6A 4M3BA 2R7VA 2QTQA 3COLA 4JYKA 2XGEA 3EUPA 3VW0A 2NS7A 2PBXA 2D6YA 4L62A 3PASA 3E7QA 1Z0XA 1T33A 3O8HA 2O7TA 2JK3A 3B6AA 1RKTA 3VW1A 2VPRA 4C2MA 2HYJA 4MO7A 3DEWA 4XK4A 5FKKA 3SDGA 3P9TA 2YVHA 5IPAA 5D1RA 2IAIA 4NELA 4I6ZA 2IBDA 3HTJA 5IOYA 3HTIA 3AQSA 2Q24A 3BTJA 3BCGA 3LSRA 4AC6A 2Y31A 3ZQLA 3QPSA 1JUMA 3BTCA 5J1UA 5K7FA 3LJLA 3T6NA 2NP3A 3F1BA 3DCFA 5CW8A 3NXCA 1ZK8A 3GZIA 2PZ9A 2G3BA 5K58A 4GCLA 2R7TA 1U9NA 1U9OA 1SGMA 3KYLA 1QVTA 3HTAA 1RKWA 5F1JA 3VVXA 3VPRA 4PXIA 1ORKA 3B81A 3ANPA 3ZQHA 2GBYA 2XB5A 4D7MA 3BHQA 3VVYA 4JKZA 2X6OA 1VI0A 3BJBA 3BQYA 3DPJA 1UI5A 3BT9A 3KKCA 3PPBA 3VOKA 5FKOA 3ZQGA 1A6IA 3PM1A 3KKDA 3VP5A 2ZCMA 2TRTA 3VOXA 2ZCXA 1JTYA 2NS8A 4OD5A 4DW6A 2FX0A 5CXIA 2W53A 2ZB9A 2OI8A 4AC0A 3BTLA 2YVXA 2WV1A 4W1UA 3G1OA 2RHAA 2GENA 3NI7A 2XPUA
chains in the Genus database with same CATH topology
5C4YA 3GEUA 5J3LA 5HBUA 2QOPA 3KZ9A 4I76A 3ANGA 3V78A 3KNWA 2OERA 1RPWA 4KWAA 4D5FA 2G0EA 1BJZA 5F0HA 2XDNA 3G1MA 2IU5A 3HGGA 5FMPA 4ABZA 2ZOYA 2FBQA 3IH3A 4W97A 1JTXA 4M3EA 2XRLA 2QKOA 4AF5A 3NNRA 2NX4A 4ACIA 3QQAA 2DG7A 2OPTA 3LOCA 4M3GA 3RD3A 3IH2A 2HXOA 2GUHA 5J1YA 2WUIA 2TCTA 5D18A 3SFIA 2Y30A 2O7OA 2XPVA 5K7ZA 5AQCA 3QPLA 3BR2A 2G7SA 2UXPA 2XGDA 4UDSA 2UXIA 2OF7A 2GFNA 3ZQFA 2FJ1A 2XGCA 2IEKA 2HYTA 3B6CA 3RH2A 2QIBA 5F08A 3HGYA 3QKXA 3Q3SA 3FK7A 4D5CA 2F07A 3BR3A 4B3AA 2QCOA 2JJ7A 5H9TA 5F0CA 3FIWA 3O8GA 5IP6A 3Q0UA 2Y2ZA 4V2GA 5F0FA 1JUPA 3VVZA 3BR0A 4AUXA 2QWTA 3G7RA 3ON4A 4YZEA 3C07A 3BR5A 2ID3A 3NRGA 3EGQA 5GPCA 4M3FA 3ZQIA 3TP0A 2ID6A 5EFYA 5GP9A 5EZGA 4GFKA 1QPIA 3Q0VA 5FKMA 3FRQA 2WGBA 5GPAA 1Z77A 2HQ5A 3HTHA 2DTZA 3G1LA 3LSPA 5FHPA 4ICHA 5F27A 4GCTA 2UXHA 3BQZA 2HKUA 3F0CA 3TP3A 3C2BA 3VUQA 4V2FA 2ZOZA 3WHCA 3CCYA 2G7LA 5CXGA 3IH4A 3JSJA 2RASA 4JL3A 5FKNA 1ZKGA 5J1RA 3MNLA 3FK6A 2FD5A 3QBMA 4GFLA 2I10A 2UXUA 5EZHA 4JNNA 2REKA 5F04A 3G56A 3AQTA 3LSJA 2UXOA 3V6GA 2VKVA 5IOZA 5DAJA 2X9DA 5FGLA 4X1EA 3BTIA 3BRUA 1JUSA 3S5RA 3NPIA 4NN1A 1UI6A 3MVPA 3BNIA 5D19A 5K7HA 3CRJA 4M3DA 3BR1A 2G7GA 3HE0A 3CDLA 4GCKA 2FQ4A 4CGRA 2DG8A 2EH3A 3CJDA 5EYRA 4ME9A 2ZCNA 5HAWA 2V57A 2NP5A 3WHBA 3LHQA 4D7NA 3IUVA 4HKUA 1QVUA 1T56A 3HIMA 2XPWA 3LWJA 4MK6A 2VKEA 1JT0A 3BR6A 2YVEA 3O60A 3ON2A 4G12A 3VIBA 3CWRA 5FKLA 2HXIA 2RAEA 4B1RA 3VW2A 4MXMA 3Q0WA 5HSZA 1JT6A 4M3BA 2QTQA 3COLA 4JYKA 2XGEA 3EUPA 3VW0A 2NS7A 2PBXA 2D6YA 4L62A 3PASA 3E7QA 1Z0XA 1T33A 3O8HA 2O7TA 2JK3A 3B6AA 1RKTA 3VW1A 2VPRA 2HYJA 4MO7A 3DEWA 4XK4A 5FKKA 3SDGA 3P9TA 2YVHA 5IPAA 5D1RA 2IAIA 4NELA 4I6ZA 2IBDA 3HTJA 5IOYA 3HTIA 3AQSA 2Q24A 3BTJA 3BCGA 3LSRA 4AC6A 2Y31A 3ZQLA 3QPSA 1JUMA 3BTCA 5J1UA 5K7FA 3LJLA 3T6NA 2NP3A 3F1BA 3DCFA 5CW8A 3NXCA 1ZK8A 3GZIA 2PZ9A 2G3BA 5K58A 4GCLA 1U9NA 1U9OA 1SGMA 1QVTA 3HTAA 1RKWA 5F1JA 3VVXA 3VPRA 4PXIA 1ORKA 3B81A 3ANPA 3ZQHA 2GBYA 2XB5A 4D7MA 3BHQA 3VVYA 4JKZA 2X6OA 1VI0A 3BJBA 3BQYA 3DPJA 1UI5A 3BT9A 3KKCA 3PPBA 3VOKA 5FKOA 3ZQGA 1A6IA 3PM1A 3KKDA 3VP5A 2ZCMA 2TRTA 3VOXA 2ZCXA 1JTYA 2NS8A 4DW6A 2FX0A 5CXIA 2W53A 2ZB9A 2OI8A 4AC0A 3BTLA 2WV1A 4W1UA 3G1OA 2RHAA 2GENA 3NI7A 2XPUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C4Y A;  3GEU A;  5J3L A;  5HBU A;  2QOP A;  3KZ9 A;  4I76 A;  3ANG A;  3V78 A;  3KNW A;  2OER A;  1RPW A;  4KWA A;  4D5F A;  2G0E A;  1BJZ A;  5F0H A;  2XDN A;  3G1M A;  2IU5 A;  3HGG A;  5FMP A;  4ABZ A;  2ZOY A;  2FBQ A;  3IH3 A;  4W97 A;  1JTX A;  4M3E A;  2XRL A;  2QKO A;  4AF5 A;  3NNR A;  2NX4 A;  4ACI A;  3QQA A;  2DG7 A;  2OPT A;  3LOC A;  4M3G A;  3RD3 A;  3IH2 A;  2HXO A;  2GUH A;  5J1Y A;  2WUI A;  2TCT A;  5D18 A;  3SFI A;  2Y30 A;  2O7O A;  2XPV A;  5K7Z A;  5AQC A;  3QPL A;  3BR2 A;  2G7S A;  2UXP A;  2XGD A;  4UDS A;  2UXI A;  2OF7 A;  2GFN A;  3ZQF A;  2FJ1 A;  2XGC A;  2IEK A;  2HYT A;  3B6C A;  3RH2 A;  2QIB A;  5F08 A;  3HGY A;  3QKX A;  3Q3S A;  3FK7 A;  4D5C A;  2F07 A;  3BR3 A;  4B3A A;  2QCO A;  2JJ7 A;  5H9T A;  5F0C A;  3FIW A;  3O8G A;  5IP6 A;  3Q0U A;  2Y2Z A;  4V2G A;  5F0F A;  1JUP A;  3VVZ A;  3BR0 A;  4AUX A;  2QWT A;  3G7R A;  3ON4 A;  4YZE A;  3C07 A;  3BR5 A;  2ID3 A;  3NRG A;  3EGQ A;  5GPC A;  4M3F A;  3ZQI A;  3TP0 A;  2ID6 A;  5EFY A;  5GP9 A;  5EZG A;  4GFK A;  1QPI A;  3Q0V A;  5FKM A;  3FRQ A;  2WGB A;  5GPA A;  1Z77 A;  2HQ5 A;  3HTH A;  2DTZ A;  3G1L A;  3LSP A;  5FHP A;  4ICH A;  5F27 A;  4GCT A;  2UXH A;  3BQZ A;  2HKU A;  3F0C A;  3TP3 A;  3C2B A;  3VUQ A;  4V2F A;  2ZOZ A;  3WHC A;  3CCY A;  2G7L A;  5CXG A;  3IH4 A;  3JSJ A;  2RAS A;  4JL3 A;  5FKN A;  1ZKG A;  5J1R A;  3MNL A;  3FK6 A;  2FD5 A;  3QBM A;  4GFL A;  2I10 A;  2UXU A;  5EZH A;  4JNN A;  2REK A;  5F04 A;  3G56 A;  3AQT A;  3LSJ A;  2UXO A;  3V6G A;  2VKV A;  5IOZ A;  5DAJ A;  2X9D A;  5FGL A;  4X1E A;  3BTI A;  3BRU A;  1JUS A;  3S5R A;  3NPI A;  4NN1 A;  1UI6 A;  3MVP A;  3BNI A;  5D19 A;  5K7H A;  3CRJ A;  4M3D A;  3BR1 A;  2G7G A;  3HE0 A;  3CDL A;  4GCK A;  2FQ4 A;  4CGR A;  2DG8 A;  2EH3 A;  3CJD A;  5EYR A;  4ME9 A;  2ZCN A;  5HAW A;  2V57 A;  2NP5 A;  3WHB A;  3LHQ A;  4D7N A;  3IUV A;  4HKU A;  1QVU A;  1T56 A;  3HIM A;  2XPW A;  3LWJ A;  4MK6 A;  2VKE A;  1JT0 A;  3BR6 A;  2YVE A;  3O60 A;  3ON2 A;  4G12 A;  3VIB A;  3CWR A;  5FKL A;  2HXI A;  2RAE A;  4B1R A;  3VW2 A;  4MXM A;  3Q0W A;  5HSZ A;  1JT6 A;  4M3B A;  2QTQ A;  3COL A;  4JYK A;  2XGE A;  3EUP A;  3VW0 A;  2NS7 A;  2PBX A;  2D6Y A;  4L62 A;  3PAS A;  3E7Q A;  1Z0X A;  1T33 A;  3O8H A;  2O7T A;  2JK3 A;  3B6A A;  1RKT A;  3VW1 A;  2VPR A;  2HYJ A;  4MO7 A;  3DEW A;  4XK4 A;  5FKK A;  3SDG A;  3P9T A;  2YVH A;  5IPA A;  5D1R A;  2IAI A;  4NEL A;  4I6Z A;  2IBD A;  3HTJ A;  5IOY A;  3HTI A;  3AQS A;  2Q24 A;  3BTJ A;  3BCG A;  3LSR A;  4AC6 A;  2Y31 A;  3ZQL A;  3QPS A;  1JUM A;  3BTC A;  5J1U A;  5K7F A;  3LJL A;  3T6N A;  2NP3 A;  3F1B A;  3DCF A;  5CW8 A;  3NXC A;  1ZK8 A;  3GZI A;  2PZ9 A;  2G3B A;  5K58 A;  4GCL A;  1U9N A;  1U9O A;  1SGM A;  1QVT A;  3HTA A;  1RKW A;  5F1J A;  3VVX A;  3VPR A;  4PXI A;  1ORK A;  3B81 A;  3ANP A;  3ZQH A;  2GBY A;  2XB5 A;  4D7M A;  3BHQ A;  3VVY A;  4JKZ A;  2X6O A;  1VI0 A;  3BJB A;  3BQY A;  3DPJ A;  1UI5 A;  3BT9 A;  3KKC A;  3PPB A;  3VOK A;  5FKO A;  3ZQG A;  1A6I A;  3PM1 A;  3KKD A;  3VP5 A;  2ZCM A;  2TRT A;  3VOX A;  2ZCX A;  1JTY A;  2NS8 A;  4DW6 A;  2FX0 A;  5CXI A;  2W53 A;  2ZB9 A;  2OI8 A;  4AC0 A;  3BTL A;  2WV1 A;  4W1U A;  3G1O A;  2RHA A;  2GEN A;  3NI7 A;  2XPU A; 
#chains in the Genus database with same CATH topology
 4DVY P;  5C4Y A;  3GEU A;  5J3L A;  5HBU A;  2QOP A;  3KZ9 A;  4I76 A;  3K8P C;  3ANG A;  3V78 A;  3KNW A;  2B1E A;  2OER A;  1RPW A;  4KWA A;  4D5F A;  2G0E A;  1BJZ A;  2R7U A;  3NS4 A;  5F0H A;  2XDN A;  3G1M A;  2IU5 A;  3HGG A;  5FMP A;  4ABZ A;  2ZOY A;  2FBQ A;  3IH3 A;  4W97 A;  1JTX A;  4M3E A;  5CQG A;  2XRL A;  4IRV A;  2QKO A;  4AF5 A;  3NNR A;  2NX4 A;  4ACI A;  3QQA A;  2DG7 A;  2OPT A;  2FJI 1;  3LOC A;  4M3G A;  3RD3 A;  3IH2 A;  2HXO A;  2GUH A;  5J1Y A;  2WUI A;  2TCT A;  5D18 A;  3SFI A;  2Y30 A;  2O7O A;  2XPV A;  5K7Z A;  5AQC A;  3QPL A;  3BR2 A;  2G7S A;  2UXP A;  2XGD A;  4UDS A;  2UXI A;  2OF7 A;  2GFN A;  3ZQF A;  2FJ1 A;  2XGC A;  2IEK A;  2HYT A;  3B6C A;  3RH2 A;  2QIB A;  3VTI A;  5F08 A;  3HGY A;  3QKX A;  3Q3S A;  3FK7 A;  4D5C A;  2F07 A;  3BR3 A;  4B3A A;  2QCO A;  2JJ7 A;  5H9T A;  5F0C A;  3FIW A;  3O8G A;  5IP6 A;  3Q0U A;  2Y2Z A;  4V2G A;  5F0F A;  1JUP A;  3VVZ A;  3BR0 A;  4AUX A;  2QWT A;  3G7R A;  3ON4 A;  4YZE A;  3C07 A;  3BR5 A;  2ID3 A;  3NRG A;  3EGQ A;  5GPC A;  4M3F A;  3ZQI A;  3TP0 A;  2ID6 A;  5EFY A;  5GP9 A;  5EZG A;  4GFK A;  1QPI A;  3Q0V A;  5FKM A;  3FRQ A;  2WGB A;  5GPA A;  1Z77 A;  2HQ5 A;  3HTH A;  2DTZ A;  3G1L A;  3LSP A;  5FHP A;  4ICH A;  5F27 A;  4GCT A;  2UXH A;  3BQZ A;  2HKU A;  3F0C A;  3TP3 A;  2PFV A;  3C2B A;  3VUQ A;  4V2F A;  2ZOZ A;  3DU6 A;  3WHC A;  3DU5 A;  3CCY A;  2B3W A;  2R7O A;  2G7L A;  4U9N A;  2R7X A;  5CXG A;  3IH4 A;  3JSJ A;  2RAS A;  4JL3 A;  5FKN A;  2R7W A;  1ZKG A;  2R7Q A;  5J1R A;  3MNL A;  3FK6 A;  2FD5 A;  3QBM A;  4GFL A;  2I10 A;  2UXU A;  5EZH A;  4JNN A;  2REK A;  5F04 A;  3G56 A;  3AQT A;  3LSJ A;  2UXO A;  3V6G A;  2VKV A;  5IOZ A;  4U9L A;  5DAJ A;  2X9D A;  5FGL A;  4X1E A;  3SWH A;  3BTI A;  3BRU A;  1JUS A;  3S5R A;  3NPI A;  3FHN A;  4NN1 A;  4WIB A;  1UI6 A;  3MVP A;  3BNI A;  5D19 A;  5K7H A;  3CRJ A;  4M3D A;  3BR1 A;  2G7G A;  3HE0 A;  3CDL A;  4GCK A;  2FQ4 A;  4CGR A;  2DG8 A;  2EH3 A;  3CJD A;  5EYR A;  4ME9 A;  2A2F X;  2ZCN A;  5HAW A;  2V57 A;  2NP5 A;  3WHB A;  3LHQ A;  4D7N A;  3IUV A;  4HKU A;  2ZY9 A;  1QVU A;  1T56 A;  4OD4 A;  3HIM A;  2XPW A;  3LWJ A;  4MK6 A;  2VKE A;  1JT0 A;  3BR6 A;  2YVE A;  3O60 A;  3ON2 A;  4G12 A;  3VIB A;  3CWR A;  5FKL A;  2HXI A;  2RAE A;  2R7R A;  4B1R A;  3VW2 A;  2R7S A;  4MXM A;  3Q0W A;  5HSZ A;  1JT6 A;  4M3B A;  2R7V A;  2QTQ A;  3COL A;  4JYK A;  2XGE A;  3EUP A;  3VW0 A;  2NS7 A;  2PBX A;  2D6Y A;  4L62 A;  3PAS A;  3E7Q A;  1Z0X A;  1T33 A;  3O8H A;  2O7T A;  2JK3 A;  3B6A A;  1RKT A;  3VW1 A;  2VPR A;  4C2M A;  2HYJ A;  4MO7 A;  3DEW A;  4XK4 A;  5FKK A;  3SDG A;  3P9T A;  2YVH A;  5IPA A;  5D1R A;  2IAI A;  4NEL A;  4I6Z A;  2IBD A;  3HTJ A;  5IOY A;  3HTI A;  3AQS A;  2Q24 A;  3BTJ A;  3BCG A;  3LSR A;  4AC6 A;  2Y31 A;  3ZQL A;  3QPS A;  1JUM A;  3BTC A;  5J1U A;  5K7F A;  3LJL A;  3T6N A;  2NP3 A;  3F1B A;  3DCF A;  5CW8 A;  3NXC A;  1ZK8 A;  3GZI A;  2PZ9 A;  2G3B A;  5K58 A;  4GCL A;  2R7T A;  1U9N A;  1U9O A;  1SGM A;  3KYL A;  1QVT A;  3HTA A;  1RKW A;  5F1J A;  3VVX A;  3VPR A;  4PXI A;  1ORK A;  3B81 A;  3ANP A;  3ZQH A;  2GBY A;  2XB5 A;  4D7M A;  3BHQ A;  3VVY A;  4JKZ A;  2X6O A;  1VI0 A;  3BJB A;  3BQY A;  3DPJ A;  1UI5 A;  3BT9 A;  3KKC A;  3PPB A;  3VOK A;  5FKO A;  3ZQG A;  1A6I A;  3PM1 A;  3KKD A;  3VP5 A;  2ZCM A;  2TRT A;  3VOX A;  2ZCX A;  1JTY A;  2NS8 A;  4OD5 A;  4DW6 A;  2FX0 A;  5CXI A;  2W53 A;  2ZB9 A;  2OI8 A;  4AC0 A;  3BTL A;  2YVX A;  2WV1 A;  4W1U A;  3G1O A;  2RHA A;  2GEN A;  3NI7 A;  2XPU A; 
#chains in the Genus database with same CATH homology
 5C4Y A;  3GEU A;  5J3L A;  5HBU A;  2QOP A;  3KZ9 A;  4I76 A;  3ANG A;  3V78 A;  3KNW A;  2OER A;  1RPW A;  4KWA A;  4D5F A;  2G0E A;  1BJZ A;  5F0H A;  2XDN A;  3G1M A;  2IU5 A;  3HGG A;  5FMP A;  4ABZ A;  2ZOY A;  2FBQ A;  3IH3 A;  4W97 A;  1JTX A;  4M3E A;  2XRL A;  2QKO A;  4AF5 A;  3NNR A;  2NX4 A;  4ACI A;  3QQA A;  2DG7 A;  2OPT A;  3LOC A;  4M3G A;  3RD3 A;  3IH2 A;  2HXO A;  2GUH A;  5J1Y A;  2WUI A;  2TCT A;  5D18 A;  3SFI A;  2Y30 A;  2O7O A;  2XPV A;  5K7Z A;  5AQC A;  3QPL A;  3BR2 A;  2G7S A;  2UXP A;  2XGD A;  4UDS A;  2UXI A;  2OF7 A;  2GFN A;  3ZQF A;  2FJ1 A;  2XGC A;  2IEK A;  2HYT A;  3B6C A;  3RH2 A;  2QIB A;  5F08 A;  3HGY A;  3QKX A;  3Q3S A;  3FK7 A;  4D5C A;  2F07 A;  3BR3 A;  4B3A A;  2QCO A;  2JJ7 A;  5H9T A;  5F0C A;  3FIW A;  3O8G A;  5IP6 A;  3Q0U A;  2Y2Z A;  4V2G A;  5F0F A;  1JUP A;  3VVZ A;  3BR0 A;  4AUX A;  2QWT A;  3G7R A;  3ON4 A;  4YZE A;  3C07 A;  3BR5 A;  2ID3 A;  3NRG A;  3EGQ A;  5GPC A;  4M3F A;  3ZQI A;  3TP0 A;  2ID6 A;  5EFY A;  5GP9 A;  5EZG A;  4GFK A;  1QPI A;  3Q0V A;  5FKM A;  3FRQ A;  2WGB A;  5GPA A;  1Z77 A;  2HQ5 A;  3HTH A;  2DTZ A;  3G1L A;  3LSP A;  5FHP A;  4ICH A;  5F27 A;  4GCT A;  2UXH A;  3BQZ A;  2HKU A;  3F0C A;  3TP3 A;  3C2B A;  3VUQ A;  4V2F A;  2ZOZ A;  3WHC A;  3CCY A;  2G7L A;  5CXG A;  3IH4 A;  3JSJ A;  2RAS A;  4JL3 A;  5FKN A;  1ZKG A;  5J1R A;  3MNL A;  3FK6 A;  2FD5 A;  3QBM A;  4GFL A;  2I10 A;  2UXU A;  5EZH A;  4JNN A;  2REK A;  5F04 A;  3G56 A;  3AQT A;  3LSJ A;  2UXO A;  3V6G A;  2VKV A;  5IOZ A;  5DAJ A;  2X9D A;  5FGL A;  4X1E A;  3BTI A;  3BRU A;  1JUS A;  3S5R A;  3NPI A;  4NN1 A;  1UI6 A;  3MVP A;  3BNI A;  5D19 A;  5K7H A;  3CRJ A;  4M3D A;  3BR1 A;  2G7G A;  3HE0 A;  3CDL A;  4GCK A;  2FQ4 A;  4CGR A;  2DG8 A;  2EH3 A;  3CJD A;  5EYR A;  4ME9 A;  2ZCN A;  5HAW A;  2V57 A;  2NP5 A;  3WHB A;  3LHQ A;  4D7N A;  3IUV A;  4HKU A;  1QVU A;  1T56 A;  3HIM A;  2XPW A;  3LWJ A;  4MK6 A;  2VKE A;  1JT0 A;  3BR6 A;  2YVE A;  3O60 A;  3ON2 A;  4G12 A;  3VIB A;  3CWR A;  5FKL A;  2HXI A;  2RAE A;  4B1R A;  3VW2 A;  4MXM A;  3Q0W A;  5HSZ A;  1JT6 A;  4M3B A;  2QTQ A;  3COL A;  4JYK A;  2XGE A;  3EUP A;  3VW0 A;  2NS7 A;  2PBX A;  2D6Y A;  4L62 A;  3PAS A;  3E7Q A;  1Z0X A;  1T33 A;  3O8H A;  2O7T A;  2JK3 A;  3B6A A;  1RKT A;  3VW1 A;  2VPR A;  2HYJ A;  4MO7 A;  3DEW A;  4XK4 A;  5FKK A;  3SDG A;  3P9T A;  2YVH A;  5IPA A;  5D1R A;  2IAI A;  4NEL A;  4I6Z A;  2IBD A;  3HTJ A;  5IOY A;  3HTI A;  3AQS A;  2Q24 A;  3BTJ A;  3BCG A;  3LSR A;  4AC6 A;  2Y31 A;  3ZQL A;  3QPS A;  1JUM A;  3BTC A;  5J1U A;  5K7F A;  3LJL A;  3T6N A;  2NP3 A;  3F1B A;  3DCF A;  5CW8 A;  3NXC A;  1ZK8 A;  3GZI A;  2PZ9 A;  2G3B A;  5K58 A;  4GCL A;  1U9N A;  1U9O A;  1SGM A;  1QVT A;  3HTA A;  1RKW A;  5F1J A;  3VVX A;  3VPR A;  4PXI A;  1ORK A;  3B81 A;  3ANP A;  3ZQH A;  2GBY A;  2XB5 A;  4D7M A;  3BHQ A;  3VVY A;  4JKZ A;  2X6O A;  1VI0 A;  3BJB A;  3BQY A;  3DPJ A;  1UI5 A;  3BT9 A;  3KKC A;  3PPB A;  3VOK A;  5FKO A;  3ZQG A;  1A6I A;  3PM1 A;  3KKD A;  3VP5 A;  2ZCM A;  2TRT A;  3VOX A;  2ZCX A;  1JTY A;  2NS8 A;  4DW6 A;  2FX0 A;  5CXI A;  2W53 A;  2ZB9 A;  2OI8 A;  4AC0 A;  3BTL A;  2WV1 A;  4W1U A;  3G1O A;  2RHA A;  2GEN A;  3NI7 A;  2XPU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...