3CJDA

Crystal structure of putative tetr transcriptional regulator (yp_510936.1) from jannaschia sp. ccs1 at 1.79 a resolution
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
189
structure length
182
Chain Sequence
KAALREKLIDLAEAQIEAEGLASLRARELARQADCAVGAIYTHFQDLNALTLEVNGRTFARLGAAVGDDHPNERLIAMSHAYLAFAREHPKLWRALFDVEMRSDGPVPQWYGHAMAQLFSYITTPLAKIFPESDDAELDLMTRTLFSSVHGIVLLGLENRISGVPGEQLKTMIRLLLEQVGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, TetR family
publication title Crystal structure of putative TetR transcriptional regulator (YP_510936.1) from Jannaschia sp. CCS1 at 1.79 A resolution
rcsb
source organism Jannaschia sp.
molecule tags Transcription regulator
total genus 64
structure length 182
sequence length 189
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF13305 TetR_C_33 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3cjdA00
2XRLA 2RHAA 3ANPA 4I76A 4ICHA 4JKZA 2G3BA 3SFIA 2DTZA 2ZCMA 3B6AA 5J3LA 3HTAA 2PZ9A 3QBMA 3WHBA 2NX4A 2IAIA 2F07A 5F27A 5AQCA 5GPCA 1Z0XA 2ZB9A 2OF7A 2IU5A 2XDNA 5H9TA 3BCGA 4M3FA 3ON4A 4GFKA 3IUVA 2HYTA 2QTQA 4AC0A 3BR5A 4KWAA 3BR1A 2GUHA 2RASA 2ZCNA 5D18A 3O8GA 3V78A 5FKKA 5FKMA 2W53A 2HXOA 3CDLA 3LSRA 3KKCA 5F08A 2ZOZA 4XK4A 1BJZA 3HTHA 3O60A 3F0CA 2XGDA 4DW6A 2XPWA 3HE0A 5EYRA 3TP3A 3BTCA 1T33A 4MXMA 2QOPA 5J1RA 3CCYA 3BR6A 3RH2A 4YZEA 1A6IA 1QPIA 3VVXA 4B1RA 1ZK8A 2OERA 3S5RA 3FK6A 2G7GA 3NRGA 3O8HA 4CGRA 5D1RA 2ID6A 5F04A 4M3EA 5CXIA 3G56A 1JT6A 1JUPA 2JK3A 1UI5A 5FMPA 5HBUA 1RKTA 1ORKA 3Q3SA 1JUSA 3MNLA 2V57A 4M3GA 4NELA 2TCTA 4W1UA 2O7OA 3CJDA 1SGMA 1ZKGA 2D6YA 2GBYA 3F1BA 3BT9A 2Y2ZA 2X9DA 2NP3A 5IOZA 3BR3A 1QVTA 3C2BA 3QKXA 2TRTA 3HTIA 4JL3A 4AC6A 2VKEA 4JYKA 3HGYA 1JTXA 2GFNA 2FBQA 3HIMA 3JSJA 5K7HA 3BHQA 3VP5A 2NP5A 5GPAA 4GCKA 5HSZA 3IH2A 3G1OA 2FJ1A 2IEKA 1QVUA 2O7TA 3QPLA 3T6NA 4L62A 2XGCA 2I10A 5IP6A 3P9TA 1VI0A 3LSPA 3B81A 5DAJA 1UI6A 3KKDA 1Z77A 2JJ7A 3NXCA 5C4YA 3BTIA 3VIBA 3PM1A 2FD5A 3VW2A 3VVYA 3G1LA 3BQZA 4PXIA 5EZHA 2XPUA 3MVPA 3LJLA 5EFYA 2ZCXA 2HXIA 5K58A 3QQAA 5D19A 3LHQA 2PBXA 2UXOA 4D7MA 4GFLA 3G7RA 1U9NA 2G7SA 3IH3A 2QWTA 5J1YA 3ZQGA 3Q0VA 3NNRA 4GCTA 2DG7A 2QKOA 5F0FA 4AUXA 4G12A 3GZIA 3VPRA 3C07A 2G0EA 3WHCA 5FKNA 2DG8A 4ABZA 4M3BA 5IOYA 3KNWA 5K7FA 3BR0A 1U9OA 3LWJA 1JT0A 3ON2A 3FK7A 1T56A 4MO7A 2QIBA 3QPSA 4V2FA 3SDGA 1JUMA 3DPJA 4GCLA 5CW8A 4M3DA 2Q24A 3V6GA 4I6ZA 5IPAA 2UXPA 3TP0A 2VPRA 2WUIA 3BTLA 3FIWA 3BJBA 3BTJA 4D5FA 1RPWA 3EUPA 3PASA 3LSJA 3ZQHA 2WV1A 5FGLA 2OPTA 3AQTA 3VOKA 3E7QA 3VVZA 3HGGA 2UXUA 3CWRA 3EGQA 3AQSA 2UXIA 5FKLA 2XB5A 2ZOYA 3BNIA 2WGBA 3BRUA 2RAEA 2UXHA 2Y31A 2EH3A 4V2GA 5J1UA 3Q0WA 4MK6A 2ID3A 3HTJA 3NI7A 2YVEA 2FQ4A 5F0HA 5HAWA 3DCFA 2REKA 3RD3A 3G1MA 2OI8A 4W97A 3COLA 2GENA 5EZGA 4D7NA 1JTYA 3BQYA 2IBDA 2Y30A 4ME9A 3GEUA 3ZQFA 2HKUA 3B6CA 2YVHA 3DEWA 3BR2A 3ANGA 2HQ5A 4AF5A 3VW0A 4B3AA 3NPIA 2XPVA 3KZ9A 5K7ZA 4UDSA 4D5CA 1RKWA 2NS8A 2X6OA 3LOCA 3Q0UA 5CXGA 4HKUA 5F1JA 2HYJA 4X1EA 2FX0A 4JNNA 3CRJA 3ZQLA 2VKVA 5GP9A 3VOXA 4ACIA 3FRQA 3VW1A 3PPBA 2XGEA 2NS7A 5F0CA 2G7LA 3ZQIA 4NN1A 3IH4A 2QCOA 3VUQA 5FHPA 5FKOA
chains in the Genus database with same CATH superfamily
2XRLA 2RHAA 3ANPA 4I76A 4ICHA 4DVYP 4JKZA 2G3BA 3SFIA 2DTZA 2ZCMA 3VTIA 3B6AA 5J3LA 3HTAA 2PZ9A 3QBMA 3WHBA 2NX4A 2IAIA 5CQGA 2F07A 4C2MA 5F27A 5AQCA 5GPCA 1Z0XA 2ZB9A 2OF7A 2IU5A 2XDNA 5H9TA 3BCGA 4M3FA 3ON4A 4WIBA 4GFKA 3IUVA 2HYTA 2QTQA 4AC0A 3BR5A 4KWAA 3BR1A 4OD4A 2GUHA 4U9NA 2RASA 4U9LA 2ZCNA 5D18A 3O8GA 3V78A 5FKKA 5FKMA 2W53A 2HXOA 3CDLA 3LSRA 3KKCA 5F08A 2ZOZA 4XK4A 1BJZA 2B1EA 3HTHA 3O60A 3F0CA 2XGDA 4DW6A 2XPWA 3HE0A 5EYRA 3TP3A 3BTCA 2R7SA 1T33A 4MXMA 2QOPA 5J1RA 3CCYA 3BR6A 3RH2A 4YZEA 1A6IA 2A2FX 2R7RA 1QPIA 3VVXA 4B1RA 1ZK8A 2OERA 2R7WA 3S5RA 3FK6A 2YVXA 2G7GA 3NRGA 3O8HA 4CGRA 5D1RA 2ID6A 5F04A 4M3EA 5CXIA 3G56A 1JT6A 1JUPA 2JK3A 1UI5A 5FMPA 5HBUA 1RKTA 1ORKA 3Q3SA 1JUSA 3MNLA 2V57A 4M3GA 4NELA 2TCTA 4W1UA 2O7OA 3CJDA 1SGMA 1ZKGA 2D6YA 2GBYA 2FJI1 3BT9A 3F1BA 2Y2ZA 2X9DA 4IRVA 2NP3A 5IOZA 3DU5A 3BR3A 2R7OA 1QVTA 3C2BA 3QKXA 2B3WA 2TRTA 3HTIA 4JL3A 4AC6A 2VKEA 4JYKA 3HGYA 1JTXA 2GFNA 2FBQA 3HIMA 3JSJA 5K7HA 3BHQA 3VP5A 2NP5A 3KYLA 5GPAA 4GCKA 5HSZA 3IH2A 3G1OA 2FJ1A 2IEKA 1QVUA 2O7TA 3QPLA 3NS4A 3T6NA 4L62A 2XGCA 2I10A 5IP6A 3P9TA 1VI0A 3LSPA 3B81A 5DAJA 1UI6A 3KKDA 1Z77A 2JJ7A 3NXCA 5C4YA 3BTIA 3VIBA 3PM1A 2FD5A 3VW2A 3VVYA 3K8PC 3G1LA 3BQZA 4PXIA 5EZHA 2XPUA 3MVPA 3LJLA 5EFYA 2ZCXA 2HXIA 5K58A 3QQAA 5D19A 3LHQA 2PBXA 2UXOA 4D7MA 4GFLA 3G7RA 1U9NA 2G7SA 3IH3A 2QWTA 5J1YA 3ZQGA 3Q0VA 3NNRA 4GCTA 2DG7A 2QKOA 5F0FA 4AUXA 4G12A 3GZIA 3VPRA 3C07A 2G0EA 3WHCA 5FKNA 2DG8A 4ABZA 4M3BA 5IOYA 3KNWA 5K7FA 3BR0A 2R7QA 1U9OA 3LWJA 1JT0A 3ON2A 3FK7A 1T56A 4MO7A 2QIBA 3QPSA 4V2FA 3SDGA 1JUMA 3DPJA 4GCLA 2R7VA 5CW8A 4M3DA 2Q24A 3V6GA 4I6ZA 5IPAA 2UXPA 3TP0A 2VPRA 2WUIA 3BTLA 3FIWA 3BJBA 2R7UA 3BTJA 4D5FA 1RPWA 3EUPA 3PASA 3LSJA 3ZQHA 2WV1A 5FGLA 2OPTA 3AQTA 3VOKA 3E7QA 3VVZA 3HGGA 2UXUA 3CWRA 3EGQA 3AQSA 2UXIA 5FKLA 2XB5A 2ZOYA 2ZY9A 3BNIA 2WGBA 3BRUA 2RAEA 2UXHA 2Y31A 2EH3A 4V2GA 5J1UA 3Q0WA 2PFVA 4MK6A 2ID3A 3HTJA 3NI7A 2YVEA 2FQ4A 5F0HA 5HAWA 3DCFA 2REKA 3RD3A 3G1MA 2OI8A 4W97A 2R7TA 3COLA 2GENA 5EZGA 4D7NA 1JTYA 3BQYA 2IBDA 2Y30A 3FHNA 3GEUA 4ME9A 3ZQFA 2HKUA 3B6CA 2YVHA 3DEWA 3SWHA 3BR2A 3ANGA 3DU6A 2HQ5A 4AF5A 3VW0A 4B3AA 3NPIA 2XPVA 3KZ9A 5K7ZA 4UDSA 4D5CA 1RKWA 2NS8A 2X6OA 3LOCA 3Q0UA 5CXGA 4HKUA 5F1JA 2HYJA 4X1EA 2FX0A 4JNNA 3CRJA 3ZQLA 2VKVA 5GP9A 4OD5A 3VOXA 4ACIA 3FRQA 3VW1A 3PPBA 2XGEA 2NS7A 5F0CA 2R7XA 2G7LA 3ZQIA 4NN1A 3IH4A 2QCOA 3VUQA 5FHPA 5FKOA
chains in the Genus database with same CATH topology
2XRLA 2RHAA 3ANPA 4I76A 4ICHA 4JKZA 2G3BA 3SFIA 2DTZA 2ZCMA 3B6AA 5J3LA 3HTAA 2PZ9A 3QBMA 3WHBA 2NX4A 2IAIA 2F07A 5F27A 5AQCA 5GPCA 1Z0XA 2ZB9A 2OF7A 2IU5A 2XDNA 5H9TA 3BCGA 4M3FA 3ON4A 4GFKA 3IUVA 2HYTA 2QTQA 4AC0A 3BR5A 4KWAA 3BR1A 2GUHA 2RASA 2ZCNA 5D18A 3O8GA 3V78A 5FKKA 5FKMA 2W53A 2HXOA 3CDLA 3LSRA 3KKCA 5F08A 2ZOZA 4XK4A 1BJZA 3HTHA 3O60A 3F0CA 2XGDA 4DW6A 2XPWA 3HE0A 5EYRA 3TP3A 3BTCA 1T33A 4MXMA 2QOPA 5J1RA 3CCYA 3BR6A 3RH2A 4YZEA 1A6IA 1QPIA 3VVXA 4B1RA 1ZK8A 2OERA 3S5RA 3FK6A 2G7GA 3NRGA 3O8HA 4CGRA 5D1RA 2ID6A 5F04A 4M3EA 5CXIA 3G56A 1JT6A 1JUPA 2JK3A 1UI5A 5FMPA 5HBUA 1RKTA 1ORKA 3Q3SA 1JUSA 3MNLA 2V57A 4M3GA 4NELA 2TCTA 4W1UA 2O7OA 3CJDA 1SGMA 1ZKGA 2D6YA 2GBYA 3F1BA 3BT9A 2Y2ZA 2X9DA 2NP3A 5IOZA 3BR3A 1QVTA 3C2BA 3QKXA 2TRTA 3HTIA 4JL3A 4AC6A 2VKEA 4JYKA 3HGYA 1JTXA 2GFNA 2FBQA 3HIMA 3JSJA 5K7HA 3BHQA 3VP5A 2NP5A 5GPAA 4GCKA 5HSZA 3IH2A 3G1OA 2FJ1A 2IEKA 1QVUA 2O7TA 3QPLA 3T6NA 4L62A 2XGCA 2I10A 5IP6A 3P9TA 1VI0A 3LSPA 3B81A 5DAJA 1UI6A 3KKDA 1Z77A 2JJ7A 3NXCA 5C4YA 3BTIA 3VIBA 3PM1A 2FD5A 3VW2A 3VVYA 3G1LA 3BQZA 4PXIA 5EZHA 2XPUA 3MVPA 3LJLA 5EFYA 2ZCXA 2HXIA 5K58A 3QQAA 5D19A 3LHQA 2PBXA 2UXOA 4D7MA 4GFLA 3G7RA 1U9NA 2G7SA 3IH3A 2QWTA 5J1YA 3ZQGA 3Q0VA 3NNRA 4GCTA 2DG7A 2QKOA 5F0FA 4AUXA 4G12A 3GZIA 3VPRA 3C07A 2G0EA 3WHCA 5FKNA 2DG8A 4ABZA 4M3BA 5IOYA 3KNWA 5K7FA 3BR0A 1U9OA 3LWJA 1JT0A 3ON2A 3FK7A 1T56A 4MO7A 2QIBA 3QPSA 4V2FA 3SDGA 1JUMA 3DPJA 4GCLA 5CW8A 4M3DA 2Q24A 3V6GA 4I6ZA 5IPAA 2UXPA 3TP0A 2VPRA 2WUIA 3BTLA 3FIWA 3BJBA 3BTJA 4D5FA 1RPWA 3EUPA 3PASA 3LSJA 3ZQHA 2WV1A 5FGLA 2OPTA 3AQTA 3VOKA 3E7QA 3VVZA 3HGGA 2UXUA 3CWRA 3EGQA 3AQSA 2UXIA 5FKLA 2XB5A 2ZOYA 3BNIA 2WGBA 3BRUA 2RAEA 2UXHA 2Y31A 2EH3A 4V2GA 5J1UA 3Q0WA 4MK6A 2ID3A 3HTJA 3NI7A 2YVEA 2FQ4A 5F0HA 5HAWA 3DCFA 2REKA 3RD3A 3G1MA 2OI8A 4W97A 3COLA 2GENA 5EZGA 4D7NA 1JTYA 3BQYA 2IBDA 2Y30A 4ME9A 3GEUA 3ZQFA 2HKUA 3B6CA 2YVHA 3DEWA 3BR2A 3ANGA 2HQ5A 4AF5A 3VW0A 4B3AA 3NPIA 2XPVA 3KZ9A 5K7ZA 4UDSA 4D5CA 1RKWA 2NS8A 2X6OA 3LOCA 3Q0UA 5CXGA 4HKUA 5F1JA 2HYJA 4X1EA 2FX0A 4JNNA 3CRJA 3ZQLA 2VKVA 5GP9A 3VOXA 4ACIA 3FRQA 3VW1A 3PPBA 2XGEA 2NS7A 5F0CA 2G7LA 3ZQIA 4NN1A 3IH4A 2QCOA 3VUQA 5FHPA 5FKOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XRL A;  2RHA A;  3ANP A;  4I76 A;  4ICH A;  4JKZ A;  2G3B A;  3SFI A;  2DTZ A;  2ZCM A;  3B6A A;  5J3L A;  3HTA A;  2PZ9 A;  3QBM A;  3WHB A;  2NX4 A;  2IAI A;  2F07 A;  5F27 A;  5AQC A;  5GPC A;  1Z0X A;  2ZB9 A;  2OF7 A;  2IU5 A;  2XDN A;  5H9T A;  3BCG A;  4M3F A;  3ON4 A;  4GFK A;  3IUV A;  2HYT A;  2QTQ A;  4AC0 A;  3BR5 A;  4KWA A;  3BR1 A;  2GUH A;  2RAS A;  2ZCN A;  5D18 A;  3O8G A;  3V78 A;  5FKK A;  5FKM A;  2W53 A;  2HXO A;  3CDL A;  3LSR A;  3KKC A;  5F08 A;  2ZOZ A;  4XK4 A;  1BJZ A;  3HTH A;  3O60 A;  3F0C A;  2XGD A;  4DW6 A;  2XPW A;  3HE0 A;  5EYR A;  3TP3 A;  3BTC A;  1T33 A;  4MXM A;  2QOP A;  5J1R A;  3CCY A;  3BR6 A;  3RH2 A;  4YZE A;  1A6I A;  1QPI A;  3VVX A;  4B1R A;  1ZK8 A;  2OER A;  3S5R A;  3FK6 A;  2G7G A;  3NRG A;  3O8H A;  4CGR A;  5D1R A;  2ID6 A;  5F04 A;  4M3E A;  5CXI A;  3G56 A;  1JT6 A;  1JUP A;  2JK3 A;  1UI5 A;  5FMP A;  5HBU A;  1RKT A;  1ORK A;  3Q3S A;  1JUS A;  3MNL A;  2V57 A;  4M3G A;  4NEL A;  2TCT A;  4W1U A;  2O7O A;  3CJD A;  1SGM A;  1ZKG A;  2D6Y A;  2GBY A;  3F1B A;  3BT9 A;  2Y2Z A;  2X9D A;  2NP3 A;  5IOZ A;  3BR3 A;  1QVT A;  3C2B A;  3QKX A;  2TRT A;  3HTI A;  4JL3 A;  4AC6 A;  2VKE A;  4JYK A;  3HGY A;  1JTX A;  2GFN A;  2FBQ A;  3HIM A;  3JSJ A;  5K7H A;  3BHQ A;  3VP5 A;  2NP5 A;  5GPA A;  4GCK A;  5HSZ A;  3IH2 A;  3G1O A;  2FJ1 A;  2IEK A;  1QVU A;  2O7T A;  3QPL A;  3T6N A;  4L62 A;  2XGC A;  2I10 A;  5IP6 A;  3P9T A;  1VI0 A;  3LSP A;  3B81 A;  5DAJ A;  1UI6 A;  3KKD A;  1Z77 A;  2JJ7 A;  3NXC A;  5C4Y A;  3BTI A;  3VIB A;  3PM1 A;  2FD5 A;  3VW2 A;  3VVY A;  3G1L A;  3BQZ A;  4PXI A;  5EZH A;  2XPU A;  3MVP A;  3LJL A;  5EFY A;  2ZCX A;  2HXI A;  5K58 A;  3QQA A;  5D19 A;  3LHQ A;  2PBX A;  2UXO A;  4D7M A;  4GFL A;  3G7R A;  1U9N A;  2G7S A;  3IH3 A;  2QWT A;  5J1Y A;  3ZQG A;  3Q0V A;  3NNR A;  4GCT A;  2DG7 A;  2QKO A;  5F0F A;  4AUX A;  4G12 A;  3GZI A;  3VPR A;  3C07 A;  2G0E A;  3WHC A;  5FKN A;  2DG8 A;  4ABZ A;  4M3B A;  5IOY A;  3KNW A;  5K7F A;  3BR0 A;  1U9O A;  3LWJ A;  1JT0 A;  3ON2 A;  3FK7 A;  1T56 A;  4MO7 A;  2QIB A;  3QPS A;  4V2F A;  3SDG A;  1JUM A;  3DPJ A;  4GCL A;  5CW8 A;  4M3D A;  2Q24 A;  3V6G A;  4I6Z A;  5IPA A;  2UXP A;  3TP0 A;  2VPR A;  2WUI A;  3BTL A;  3FIW A;  3BJB A;  3BTJ A;  4D5F A;  1RPW A;  3EUP A;  3PAS A;  3LSJ A;  3ZQH A;  2WV1 A;  5FGL A;  2OPT A;  3AQT A;  3VOK A;  3E7Q A;  3VVZ A;  3HGG A;  2UXU A;  3CWR A;  3EGQ A;  3AQS A;  2UXI A;  5FKL A;  2XB5 A;  2ZOY A;  3BNI A;  2WGB A;  3BRU A;  2RAE A;  2UXH A;  2Y31 A;  2EH3 A;  4V2G A;  5J1U A;  3Q0W A;  4MK6 A;  2ID3 A;  3HTJ A;  3NI7 A;  2YVE A;  2FQ4 A;  5F0H A;  5HAW A;  3DCF A;  2REK A;  3RD3 A;  3G1M A;  2OI8 A;  4W97 A;  3COL A;  2GEN A;  5EZG A;  4D7N A;  1JTY A;  3BQY A;  2IBD A;  2Y30 A;  4ME9 A;  3GEU A;  3ZQF A;  2HKU A;  3B6C A;  2YVH A;  3DEW A;  3BR2 A;  3ANG A;  2HQ5 A;  4AF5 A;  3VW0 A;  4B3A A;  3NPI A;  2XPV A;  3KZ9 A;  5K7Z A;  4UDS A;  4D5C A;  1RKW A;  2NS8 A;  2X6O A;  3LOC A;  3Q0U A;  5CXG A;  4HKU A;  5F1J A;  2HYJ A;  4X1E A;  2FX0 A;  4JNN A;  3CRJ A;  3ZQL A;  2VKV A;  5GP9 A;  3VOX A;  4ACI A;  3FRQ A;  3VW1 A;  3PPB A;  2XGE A;  2NS7 A;  5F0C A;  2G7L A;  3ZQI A;  4NN1 A;  3IH4 A;  2QCO A;  3VUQ A;  5FHP A;  5FKO A; 
#chains in the Genus database with same CATH topology
 2XRL A;  2RHA A;  3ANP A;  4I76 A;  4ICH A;  4DVY P;  4JKZ A;  2G3B A;  3SFI A;  2DTZ A;  2ZCM A;  3VTI A;  3B6A A;  5J3L A;  3HTA A;  2PZ9 A;  3QBM A;  3WHB A;  2NX4 A;  2IAI A;  5CQG A;  2F07 A;  4C2M A;  5F27 A;  5AQC A;  5GPC A;  1Z0X A;  2ZB9 A;  2OF7 A;  2IU5 A;  2XDN A;  5H9T A;  3BCG A;  4M3F A;  3ON4 A;  4WIB A;  4GFK A;  3IUV A;  2HYT A;  2QTQ A;  4AC0 A;  3BR5 A;  4KWA A;  3BR1 A;  4OD4 A;  2GUH A;  4U9N A;  2RAS A;  4U9L A;  2ZCN A;  5D18 A;  3O8G A;  3V78 A;  5FKK A;  5FKM A;  2W53 A;  2HXO A;  3CDL A;  3LSR A;  3KKC A;  5F08 A;  2ZOZ A;  4XK4 A;  1BJZ A;  2B1E A;  3HTH A;  3O60 A;  3F0C A;  2XGD A;  4DW6 A;  2XPW A;  3HE0 A;  5EYR A;  3TP3 A;  3BTC A;  2R7S A;  1T33 A;  4MXM A;  2QOP A;  5J1R A;  3CCY A;  3BR6 A;  3RH2 A;  4YZE A;  1A6I A;  2A2F X;  2R7R A;  1QPI A;  3VVX A;  4B1R A;  1ZK8 A;  2OER A;  2R7W A;  3S5R A;  3FK6 A;  2YVX A;  2G7G A;  3NRG A;  3O8H A;  4CGR A;  5D1R A;  2ID6 A;  5F04 A;  4M3E A;  5CXI A;  3G56 A;  1JT6 A;  1JUP A;  2JK3 A;  1UI5 A;  5FMP A;  5HBU A;  1RKT A;  1ORK A;  3Q3S A;  1JUS A;  3MNL A;  2V57 A;  4M3G A;  4NEL A;  2TCT A;  4W1U A;  2O7O A;  3CJD A;  1SGM A;  1ZKG A;  2D6Y A;  2GBY A;  2FJI 1;  3BT9 A;  3F1B A;  2Y2Z A;  2X9D A;  4IRV A;  2NP3 A;  5IOZ A;  3DU5 A;  3BR3 A;  2R7O A;  1QVT A;  3C2B A;  3QKX A;  2B3W A;  2TRT A;  3HTI A;  4JL3 A;  4AC6 A;  2VKE A;  4JYK A;  3HGY A;  1JTX A;  2GFN A;  2FBQ A;  3HIM A;  3JSJ A;  5K7H A;  3BHQ A;  3VP5 A;  2NP5 A;  3KYL A;  5GPA A;  4GCK A;  5HSZ A;  3IH2 A;  3G1O A;  2FJ1 A;  2IEK A;  1QVU A;  2O7T A;  3QPL A;  3NS4 A;  3T6N A;  4L62 A;  2XGC A;  2I10 A;  5IP6 A;  3P9T A;  1VI0 A;  3LSP A;  3B81 A;  5DAJ A;  1UI6 A;  3KKD A;  1Z77 A;  2JJ7 A;  3NXC A;  5C4Y A;  3BTI A;  3VIB A;  3PM1 A;  2FD5 A;  3VW2 A;  3VVY A;  3K8P C;  3G1L A;  3BQZ A;  4PXI A;  5EZH A;  2XPU A;  3MVP A;  3LJL A;  5EFY A;  2ZCX A;  2HXI A;  5K58 A;  3QQA A;  5D19 A;  3LHQ A;  2PBX A;  2UXO A;  4D7M A;  4GFL A;  3G7R A;  1U9N A;  2G7S A;  3IH3 A;  2QWT A;  5J1Y A;  3ZQG A;  3Q0V A;  3NNR A;  4GCT A;  2DG7 A;  2QKO A;  5F0F A;  4AUX A;  4G12 A;  3GZI A;  3VPR A;  3C07 A;  2G0E A;  3WHC A;  5FKN A;  2DG8 A;  4ABZ A;  4M3B A;  5IOY A;  3KNW A;  5K7F A;  3BR0 A;  2R7Q A;  1U9O A;  3LWJ A;  1JT0 A;  3ON2 A;  3FK7 A;  1T56 A;  4MO7 A;  2QIB A;  3QPS A;  4V2F A;  3SDG A;  1JUM A;  3DPJ A;  4GCL A;  2R7V A;  5CW8 A;  4M3D A;  2Q24 A;  3V6G A;  4I6Z A;  5IPA A;  2UXP A;  3TP0 A;  2VPR A;  2WUI A;  3BTL A;  3FIW A;  3BJB A;  2R7U A;  3BTJ A;  4D5F A;  1RPW A;  3EUP A;  3PAS A;  3LSJ A;  3ZQH A;  2WV1 A;  5FGL A;  2OPT A;  3AQT A;  3VOK A;  3E7Q A;  3VVZ A;  3HGG A;  2UXU A;  3CWR A;  3EGQ A;  3AQS A;  2UXI A;  5FKL A;  2XB5 A;  2ZOY A;  2ZY9 A;  3BNI A;  2WGB A;  3BRU A;  2RAE A;  2UXH A;  2Y31 A;  2EH3 A;  4V2G A;  5J1U A;  3Q0W A;  2PFV A;  4MK6 A;  2ID3 A;  3HTJ A;  3NI7 A;  2YVE A;  2FQ4 A;  5F0H A;  5HAW A;  3DCF A;  2REK A;  3RD3 A;  3G1M A;  2OI8 A;  4W97 A;  2R7T A;  3COL A;  2GEN A;  5EZG A;  4D7N A;  1JTY A;  3BQY A;  2IBD A;  2Y30 A;  3FHN A;  3GEU A;  4ME9 A;  3ZQF A;  2HKU A;  3B6C A;  2YVH A;  3DEW A;  3SWH A;  3BR2 A;  3ANG A;  3DU6 A;  2HQ5 A;  4AF5 A;  3VW0 A;  4B3A A;  3NPI A;  2XPV A;  3KZ9 A;  5K7Z A;  4UDS A;  4D5C A;  1RKW A;  2NS8 A;  2X6O A;  3LOC A;  3Q0U A;  5CXG A;  4HKU A;  5F1J A;  2HYJ A;  4X1E A;  2FX0 A;  4JNN A;  3CRJ A;  3ZQL A;  2VKV A;  5GP9 A;  4OD5 A;  3VOX A;  4ACI A;  3FRQ A;  3VW1 A;  3PPB A;  2XGE A;  2NS7 A;  5F0C A;  2R7X A;  2G7L A;  3ZQI A;  4NN1 A;  3IH4 A;  2QCO A;  3VUQ A;  5FHP A;  5FKO A; 
#chains in the Genus database with same CATH homology
 2XRL A;  2RHA A;  3ANP A;  4I76 A;  4ICH A;  4JKZ A;  2G3B A;  3SFI A;  2DTZ A;  2ZCM A;  3B6A A;  5J3L A;  3HTA A;  2PZ9 A;  3QBM A;  3WHB A;  2NX4 A;  2IAI A;  2F07 A;  5F27 A;  5AQC A;  5GPC A;  1Z0X A;  2ZB9 A;  2OF7 A;  2IU5 A;  2XDN A;  5H9T A;  3BCG A;  4M3F A;  3ON4 A;  4GFK A;  3IUV A;  2HYT A;  2QTQ A;  4AC0 A;  3BR5 A;  4KWA A;  3BR1 A;  2GUH A;  2RAS A;  2ZCN A;  5D18 A;  3O8G A;  3V78 A;  5FKK A;  5FKM A;  2W53 A;  2HXO A;  3CDL A;  3LSR A;  3KKC A;  5F08 A;  2ZOZ A;  4XK4 A;  1BJZ A;  3HTH A;  3O60 A;  3F0C A;  2XGD A;  4DW6 A;  2XPW A;  3HE0 A;  5EYR A;  3TP3 A;  3BTC A;  1T33 A;  4MXM A;  2QOP A;  5J1R A;  3CCY A;  3BR6 A;  3RH2 A;  4YZE A;  1A6I A;  1QPI A;  3VVX A;  4B1R A;  1ZK8 A;  2OER A;  3S5R A;  3FK6 A;  2G7G A;  3NRG A;  3O8H A;  4CGR A;  5D1R A;  2ID6 A;  5F04 A;  4M3E A;  5CXI A;  3G56 A;  1JT6 A;  1JUP A;  2JK3 A;  1UI5 A;  5FMP A;  5HBU A;  1RKT A;  1ORK A;  3Q3S A;  1JUS A;  3MNL A;  2V57 A;  4M3G A;  4NEL A;  2TCT A;  4W1U A;  2O7O A;  3CJD A;  1SGM A;  1ZKG A;  2D6Y A;  2GBY A;  3F1B A;  3BT9 A;  2Y2Z A;  2X9D A;  2NP3 A;  5IOZ A;  3BR3 A;  1QVT A;  3C2B A;  3QKX A;  2TRT A;  3HTI A;  4JL3 A;  4AC6 A;  2VKE A;  4JYK A;  3HGY A;  1JTX A;  2GFN A;  2FBQ A;  3HIM A;  3JSJ A;  5K7H A;  3BHQ A;  3VP5 A;  2NP5 A;  5GPA A;  4GCK A;  5HSZ A;  3IH2 A;  3G1O A;  2FJ1 A;  2IEK A;  1QVU A;  2O7T A;  3QPL A;  3T6N A;  4L62 A;  2XGC A;  2I10 A;  5IP6 A;  3P9T A;  1VI0 A;  3LSP A;  3B81 A;  5DAJ A;  1UI6 A;  3KKD A;  1Z77 A;  2JJ7 A;  3NXC A;  5C4Y A;  3BTI A;  3VIB A;  3PM1 A;  2FD5 A;  3VW2 A;  3VVY A;  3G1L A;  3BQZ A;  4PXI A;  5EZH A;  2XPU A;  3MVP A;  3LJL A;  5EFY A;  2ZCX A;  2HXI A;  5K58 A;  3QQA A;  5D19 A;  3LHQ A;  2PBX A;  2UXO A;  4D7M A;  4GFL A;  3G7R A;  1U9N A;  2G7S A;  3IH3 A;  2QWT A;  5J1Y A;  3ZQG A;  3Q0V A;  3NNR A;  4GCT A;  2DG7 A;  2QKO A;  5F0F A;  4AUX A;  4G12 A;  3GZI A;  3VPR A;  3C07 A;  2G0E A;  3WHC A;  5FKN A;  2DG8 A;  4ABZ A;  4M3B A;  5IOY A;  3KNW A;  5K7F A;  3BR0 A;  1U9O A;  3LWJ A;  1JT0 A;  3ON2 A;  3FK7 A;  1T56 A;  4MO7 A;  2QIB A;  3QPS A;  4V2F A;  3SDG A;  1JUM A;  3DPJ A;  4GCL A;  5CW8 A;  4M3D A;  2Q24 A;  3V6G A;  4I6Z A;  5IPA A;  2UXP A;  3TP0 A;  2VPR A;  2WUI A;  3BTL A;  3FIW A;  3BJB A;  3BTJ A;  4D5F A;  1RPW A;  3EUP A;  3PAS A;  3LSJ A;  3ZQH A;  2WV1 A;  5FGL A;  2OPT A;  3AQT A;  3VOK A;  3E7Q A;  3VVZ A;  3HGG A;  2UXU A;  3CWR A;  3EGQ A;  3AQS A;  2UXI A;  5FKL A;  2XB5 A;  2ZOY A;  3BNI A;  2WGB A;  3BRU A;  2RAE A;  2UXH A;  2Y31 A;  2EH3 A;  4V2G A;  5J1U A;  3Q0W A;  4MK6 A;  2ID3 A;  3HTJ A;  3NI7 A;  2YVE A;  2FQ4 A;  5F0H A;  5HAW A;  3DCF A;  2REK A;  3RD3 A;  3G1M A;  2OI8 A;  4W97 A;  3COL A;  2GEN A;  5EZG A;  4D7N A;  1JTY A;  3BQY A;  2IBD A;  2Y30 A;  4ME9 A;  3GEU A;  3ZQF A;  2HKU A;  3B6C A;  2YVH A;  3DEW A;  3BR2 A;  3ANG A;  2HQ5 A;  4AF5 A;  3VW0 A;  4B3A A;  3NPI A;  2XPV A;  3KZ9 A;  5K7Z A;  4UDS A;  4D5C A;  1RKW A;  2NS8 A;  2X6O A;  3LOC A;  3Q0U A;  5CXG A;  4HKU A;  5F1J A;  2HYJ A;  4X1E A;  2FX0 A;  4JNN A;  3CRJ A;  3ZQL A;  2VKV A;  5GP9 A;  3VOX A;  4ACI A;  3FRQ A;  3VW1 A;  3PPB A;  2XGE A;  2NS7 A;  5F0C A;  2G7L A;  3ZQI A;  4NN1 A;  3IH4 A;  2QCO A;  3VUQ A;  5FHP A;  5FKO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...