3CJDA

Crystal structure of putative tetr transcriptional regulator (yp_510936.1) from jannaschia sp. ccs1 at 1.79 a resolution
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
189
structure length
182
Chain Sequence
b'KAALREKLIDLAEAQIEAEGLASLRARELARQADCAVGAIYTHFQDLNALTLEVNGRTFARLGAAVGDDHPNERLIAMSHAYLAFAREHPKLWRALFDVEMRSDGPVPQWYGHAMAQLFSYITTPLAKIFPESDDAELDLMTRTLFSSVHGIVLLGLENRISGVPGEQLKTMIRLLLEQVGR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, TetR family
publication title Crystal structure of putative TetR transcriptional regulator (YP_510936.1) from Jannaschia sp. CCS1 at 1.79 A resolution
rcsb
source organism Jannaschia sp.
molecule tags Transcription regulator
total genus 64
structure length 182
sequence length 189
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF13305 TetR_C_33 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3cjdA00
1Z77A 3G1MA 3FK7A 2WV1A 2G7SA 3CRJA 3FRQA 2UXUA 4NN1A 2ID6A 3C07A 3VVZA 3QKXA 5HBUA 2I10A 3KZ9A 1SGMA 4W1UA 5FKLA 2PZ9A 3SDGA 3ANGA 1JUSA 2ZCMA 2VKEA 3BJBA 4GFKA 2GFNA 2HXIA 5EYRA 2GUHA 4W97A 5CW8A 5FKOA 1JUPA 5CXGA 3EGQA 5GP9A 5K7ZA 4ICHA 2HKUA 5FKMA 5FHPA 2G0EA 2XRLA 4M3GA 3Q0VA 1JUMA 3HE0A 2REKA 2FJ1A 5IOZA 1JTYA 5J1YA 3V78A 3BRUA 5IPAA 2GBYA 3BR3A 3QPSA 3VVXA 3HTIA 2PBXA 5D18A 5GPAA 3FIWA 4MXMA 3BR2A 3IH2A 4KWAA 5HSZA 2QIBA 5K7HA 4JNNA 1T56A 3COLA 2YVHA 3LHQA 3BHQA 4G12A 2XB5A 4AF5A 2QTQA 3B81A 4AC6A 2IEKA 3IH3A 1UI6A 3KKDA 3BR1A 3VOKA 2G7GA 2XPWA 2ZB9A 3DEWA 4HKUA 5K7FA 3QBMA 1QVUA 2HYJA 2Y30A 3B6AA 2G3BA 5F04A 4M3DA 3G1LA 3HGGA 5AQCA 3NRGA 3WHBA 1ORKA 1A6IA 1ZK8A 2VPRA 3DCFA 3VOXA 4GCTA 2TCTA 3VW2A 3AQTA 4GFLA 5DAJA 3P9TA 3SFIA 5J3LA 5FGLA 3E7QA 5K58A 3FK6A 3BTIA 3PPBA 2DG8A 2XGCA 3AQSA 4M3EA 4M3FA 2HXOA 1RPWA 4JYKA 3QQAA 3ANPA 3BR0A 3Q3SA 5J1UA 2YVEA 2HQ5A 2Y2ZA 3LSPA 3GEUA 4D5FA 4I6ZA 2XDNA 2XPVA 4D5CA 3F0CA 3NPIA 1U9OA 3NI7A 2JK3A 4JKZA 5D1RA 2IU5A 3BR6A 2OF7A 2O7TA 2FQ4A 3DPJA 3HTHA 1QPIA 2UXOA 3BQYA 4XK4A 3BTCA 2Q24A 2X9DA 3CCYA 2OPTA 3MVPA 2ID3A 3MNLA 3F1BA 3ON4A 2QWTA 5F0CA 2IBDA 3HIMA 4V2FA 2GENA 4GCKA 2IAIA 3ZQIA 5FKNA 3KKCA 5F0HA 5GPCA 2TRTA 2ZOYA 3LWJA 3BTLA 4AC0A 3BTJA 2QKOA 2RAEA 4V2GA 5EZHA 4MO7A 1QVTA 2XPUA 5IOYA 2QOPA 1BJZA 3BQZA 5H9TA 3ZQHA 3ZQGA 4AUXA 2WGBA 5C4YA 5EFYA 3C2BA 3ON2A 3Q0UA 3JSJA 1T33A 3NXCA 5HAWA 4PXIA 4D7NA 3O60A 2ZCNA 3CWRA 3EUPA 3GZIA 2XGEA 3TP3A 2FD5A 2VKVA 4I76A 1ZKGA 2FX0A 3ZQFA 3O8HA 2UXPA 5EZGA 4GCLA 3IUVA 3CDLA 2EH3A 2JJ7A 4ME9A 3HGYA 3TP0A 2W53A 4CGRA 3G1OA 5FKKA 4DW6A 4M3BA 3S5RA 2DTZA 3B6CA 1U9NA 1RKWA 2V57A 3T6NA 4ABZA 1Z0XA 4JL3A 3RH2A 1JTXA 2D6YA 5F0FA 3BR5A 1VI0A 4NELA 3LOCA 2OI8A 4ACIA 5D19A 2RHAA 4B1RA 1UI5A 3VPRA 5J1RA 2WUIA 2DG7A 3LJLA 3PASA 3VIBA 2F07A 3HTAA 1RKTA 3HTJA 4YZEA 5FMPA 2OERA 3LSRA 2NS7A 2QCOA 2ZCXA 3VUQA 3ZQLA 2NS8A 2ZOZA 4L62A 4MK6A 2FBQA 2RASA 3BT9A 3G7RA 3VW0A 5CXIA 3KNWA 2HYTA 2G7LA 3G56A 3QPLA 2NX4A 3IH4A 3CJDA 3LSJA 1JT6A 2Y31A 3BCGA 3Q0WA 3RD3A 2O7OA 4UDSA 4B3AA 2XGDA 2NP3A 3VW1A 3PM1A 3WHCA 5F1JA 5F27A 3BNIA 3NNRA 3V6GA 4X1EA 5F08A 5IP6A 2NP5A 3O8GA 3VP5A 3VVYA 2UXHA 1JT0A 2UXIA 4D7MA 2X6OA
chains in the Genus database with same CATH superfamily
1Z77A 3G1MA 3FK7A 2WV1A 2G7SA 3CRJA 3FRQA 2UXUA 4NN1A 2ID6A 3C07A 3VVZA 3NS4A 3QKXA 5HBUA 2I10A 3KZ9A 1SGMA 4W1UA 5FKLA 2PZ9A 3SDGA 3ANGA 1JUSA 2ZCMA 2VKEA 3BJBA 4GFKA 2GFNA 2HXIA 5EYRA 2GUHA 4W97A 5CW8A 5FKOA 1JUPA 5CXGA 3EGQA 5GP9A 5K7ZA 4ICHA 2HKUA 5FKMA 5FHPA 2G0EA 2XRLA 4M3GA 3Q0VA 1JUMA 2B1EA 3HE0A 2REKA 2FJ1A 5IOZA 1JTYA 5J1YA 3V78A 3BRUA 5IPAA 2GBYA 3BR3A 3QPSA 3VVXA 3HTIA 2PBXA 5D18A 5GPAA 3FIWA 2A2FX 4MXMA 3BR2A 3IH2A 4KWAA 5HSZA 2QIBA 5K7HA 4JNNA 1T56A 3COLA 2YVHA 3LHQA 3BHQA 4G12A 2XB5A 3VTIA 4AF5A 2QTQA 3B81A 4AC6A 2IEKA 3IH3A 1UI6A 3KKDA 3BR1A 3VOKA 2G7GA 2XPWA 2ZB9A 3DEWA 4HKUA 5K7FA 3QBMA 1QVUA 2HYJA 2Y30A 3B6AA 2G3BA 5F04A 4M3DA 3G1LA 3HGGA 5AQCA 3FHNA 3NRGA 3WHBA 1ORKA 1A6IA 1ZK8A 2VPRA 3DCFA 3VOXA 2B3WA 4GCTA 2TCTA 3VW2A 3AQTA 4GFLA 5DAJA 3P9TA 3SFIA 5J3LA 5FGLA 3E7QA 5K58A 3FK6A 3BTIA 3PPBA 2DG8A 2XGCA 3AQSA 4M3EA 4M3FA 2R7TA 2HXOA 1RPWA 4JYKA 3QQAA 3ANPA 3BR0A 3Q3SA 5J1UA 2YVEA 2HQ5A 2Y2ZA 3LSPA 2R7XA 2PFVA 3GEUA 4D5FA 4I6ZA 2XDNA 2XPVA 4D5CA 3F0CA 3NPIA 1U9OA 3NI7A 2JK3A 4JKZA 5D1RA 2IU5A 3KYLA 3BR6A 2OF7A 2O7TA 2FQ4A 3DPJA 3HTHA 1QPIA 2UXOA 3BQYA 4XK4A 3BTCA 2Q24A 2X9DA 2R7UA 3CCYA 2OPTA 3MVPA 2R7WA 2ID3A 4U9NA 4DVYP 3MNLA 3F1BA 3ON4A 3K8PC 2QWTA 5F0CA 2IBDA 3HIMA 4V2FA 2GENA 4GCKA 2IAIA 3DU5A 3ZQIA 5FKNA 3KKCA 5F0HA 5GPCA 2TRTA 2ZOYA 3LWJA 3BTLA 4AC0A 3BTJA 2QKOA 2RAEA 4V2GA 5EZHA 4MO7A 1QVTA 2XPUA 5IOYA 2QOPA 1BJZA 3BQZA 4C2MA 5H9TA 3ZQHA 3ZQGA 4AUXA 2WGBA 5C4YA 5EFYA 3C2BA 3ON2A 3Q0UA 3JSJA 1T33A 3NXCA 4OD4A 5HAWA 4PXIA 4D7NA 3O60A 2ZCNA 3CWRA 3EUPA 2YVXA 3GZIA 2XGEA 3TP3A 2FD5A 2VKVA 4I76A 1ZKGA 2FX0A 3ZQFA 3O8HA 2UXPA 2FJI1 5EZGA 4GCLA 2R7QA 3IUVA 3CDLA 2EH3A 2JJ7A 4ME9A 3HGYA 3TP0A 2W53A 4CGRA 3G1OA 2R7VA 5FKKA 4DW6A 4M3BA 2R7OA 3S5RA 2DTZA 3B6CA 1U9NA 1RKWA 2V57A 3T6NA 4ABZA 1Z0XA 4JL3A 3RH2A 1JTXA 2D6YA 5F0FA 3BR5A 1VI0A 4NELA 3LOCA 2OI8A 4OD5A 4ACIA 5D19A 2RHAA 4B1RA 1UI5A 3VPRA 5J1RA 2WUIA 2DG7A 3LJLA 5CQGA 3PASA 3VIBA 2F07A 4WIBA 3HTAA 1RKTA 3HTJA 4YZEA 5FMPA 2OERA 2R7RA 3LSRA 2NS7A 2QCOA 2ZCXA 3VUQA 3ZQLA 2NS8A 2ZY9A 2ZOZA 4L62A 4MK6A 2FBQA 2RASA 3BT9A 3G7RA 3VW0A 5CXIA 3KNWA 2HYTA 2G7LA 3G56A 3QPLA 2NX4A 3IH4A 3CJDA 3LSJA 2R7SA 1JT6A 2Y31A 3BCGA 3Q0WA 3RD3A 2O7OA 4U9LA 4UDSA 4B3AA 2XGDA 2NP3A 3VW1A 3PM1A 3WHCA 5F1JA 5F27A 3BNIA 3NNRA 3V6GA 4X1EA 5F08A 5IP6A 2NP5A 3O8GA 3VP5A 3DU6A 4IRVA 3VVYA 3SWHA 2UXHA 1JT0A 2UXIA 4D7MA 2X6OA
chains in the Genus database with same CATH topology
1Z77A 3G1MA 3FK7A 2WV1A 2G7SA 3CRJA 3FRQA 2UXUA 4NN1A 2ID6A 3C07A 3VVZA 3QKXA 5HBUA 2I10A 3KZ9A 1SGMA 4W1UA 5FKLA 2PZ9A 3SDGA 3ANGA 1JUSA 2ZCMA 2VKEA 3BJBA 4GFKA 2GFNA 2HXIA 5EYRA 2GUHA 4W97A 5CW8A 5FKOA 1JUPA 5CXGA 3EGQA 5GP9A 5K7ZA 4ICHA 2HKUA 5FKMA 5FHPA 2G0EA 2XRLA 4M3GA 3Q0VA 1JUMA 3HE0A 2REKA 2FJ1A 5IOZA 1JTYA 5J1YA 3V78A 3BRUA 5IPAA 2GBYA 3BR3A 3QPSA 3VVXA 3HTIA 2PBXA 5D18A 5GPAA 3FIWA 4MXMA 3BR2A 3IH2A 4KWAA 5HSZA 2QIBA 5K7HA 4JNNA 1T56A 3COLA 2YVHA 3LHQA 3BHQA 4G12A 2XB5A 4AF5A 2QTQA 3B81A 4AC6A 2IEKA 3IH3A 1UI6A 3KKDA 3BR1A 3VOKA 2G7GA 2XPWA 2ZB9A 3DEWA 4HKUA 5K7FA 3QBMA 1QVUA 2HYJA 2Y30A 3B6AA 2G3BA 5F04A 4M3DA 3G1LA 3HGGA 5AQCA 3NRGA 3WHBA 1ORKA 1A6IA 1ZK8A 2VPRA 3DCFA 3VOXA 4GCTA 2TCTA 3VW2A 3AQTA 4GFLA 5DAJA 3P9TA 3SFIA 5J3LA 5FGLA 3E7QA 5K58A 3FK6A 3BTIA 3PPBA 2DG8A 2XGCA 3AQSA 4M3EA 4M3FA 2HXOA 1RPWA 4JYKA 3QQAA 3ANPA 3BR0A 3Q3SA 5J1UA 2YVEA 2HQ5A 2Y2ZA 3LSPA 3GEUA 4D5FA 4I6ZA 2XDNA 2XPVA 4D5CA 3F0CA 3NPIA 1U9OA 3NI7A 2JK3A 4JKZA 5D1RA 2IU5A 3BR6A 2OF7A 2O7TA 2FQ4A 3DPJA 3HTHA 1QPIA 2UXOA 3BQYA 4XK4A 3BTCA 2Q24A 2X9DA 3CCYA 2OPTA 3MVPA 2ID3A 3MNLA 3F1BA 3ON4A 2QWTA 5F0CA 2IBDA 3HIMA 4V2FA 2GENA 4GCKA 2IAIA 3ZQIA 5FKNA 3KKCA 5F0HA 5GPCA 2TRTA 2ZOYA 3LWJA 3BTLA 4AC0A 3BTJA 2QKOA 2RAEA 4V2GA 5EZHA 4MO7A 1QVTA 2XPUA 5IOYA 2QOPA 1BJZA 3BQZA 5H9TA 3ZQHA 3ZQGA 4AUXA 2WGBA 5C4YA 5EFYA 3C2BA 3ON2A 3Q0UA 3JSJA 1T33A 3NXCA 5HAWA 4PXIA 4D7NA 3O60A 2ZCNA 3CWRA 3EUPA 3GZIA 2XGEA 3TP3A 2FD5A 2VKVA 4I76A 1ZKGA 2FX0A 3ZQFA 3O8HA 2UXPA 5EZGA 4GCLA 3IUVA 3CDLA 2EH3A 2JJ7A 4ME9A 3HGYA 3TP0A 2W53A 4CGRA 3G1OA 5FKKA 4DW6A 4M3BA 3S5RA 2DTZA 3B6CA 1U9NA 1RKWA 2V57A 3T6NA 4ABZA 1Z0XA 4JL3A 3RH2A 1JTXA 2D6YA 5F0FA 3BR5A 1VI0A 4NELA 3LOCA 2OI8A 4ACIA 5D19A 2RHAA 4B1RA 1UI5A 3VPRA 5J1RA 2WUIA 2DG7A 3LJLA 3PASA 3VIBA 2F07A 3HTAA 1RKTA 3HTJA 4YZEA 5FMPA 2OERA 3LSRA 2NS7A 2QCOA 2ZCXA 3VUQA 3ZQLA 2NS8A 2ZOZA 4L62A 4MK6A 2FBQA 2RASA 3BT9A 3G7RA 3VW0A 5CXIA 3KNWA 2HYTA 2G7LA 3G56A 3QPLA 2NX4A 3IH4A 3CJDA 3LSJA 1JT6A 2Y31A 3BCGA 3Q0WA 3RD3A 2O7OA 4UDSA 4B3AA 2XGDA 2NP3A 3VW1A 3PM1A 3WHCA 5F1JA 5F27A 3BNIA 3NNRA 3V6GA 4X1EA 5F08A 5IP6A 2NP5A 3O8GA 3VP5A 3VVYA 2UXHA 1JT0A 2UXIA 4D7MA 2X6OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z77 A;  3G1M A;  3FK7 A;  2WV1 A;  2G7S A;  3CRJ A;  3FRQ A;  2UXU A;  4NN1 A;  2ID6 A;  3C07 A;  3VVZ A;  3QKX A;  5HBU A;  2I10 A;  3KZ9 A;  1SGM A;  4W1U A;  5FKL A;  2PZ9 A;  3SDG A;  3ANG A;  1JUS A;  2ZCM A;  2VKE A;  3BJB A;  4GFK A;  2GFN A;  2HXI A;  5EYR A;  2GUH A;  4W97 A;  5CW8 A;  5FKO A;  1JUP A;  5CXG A;  3EGQ A;  5GP9 A;  5K7Z A;  4ICH A;  2HKU A;  5FKM A;  5FHP A;  2G0E A;  2XRL A;  4M3G A;  3Q0V A;  1JUM A;  3HE0 A;  2REK A;  2FJ1 A;  5IOZ A;  1JTY A;  5J1Y A;  3V78 A;  3BRU A;  5IPA A;  2GBY A;  3BR3 A;  3QPS A;  3VVX A;  3HTI A;  2PBX A;  5D18 A;  5GPA A;  3FIW A;  4MXM A;  3BR2 A;  3IH2 A;  4KWA A;  5HSZ A;  2QIB A;  5K7H A;  4JNN A;  1T56 A;  3COL A;  2YVH A;  3LHQ A;  3BHQ A;  4G12 A;  2XB5 A;  4AF5 A;  2QTQ A;  3B81 A;  4AC6 A;  2IEK A;  3IH3 A;  1UI6 A;  3KKD A;  3BR1 A;  3VOK A;  2G7G A;  2XPW A;  2ZB9 A;  3DEW A;  4HKU A;  5K7F A;  3QBM A;  1QVU A;  2HYJ A;  2Y30 A;  3B6A A;  2G3B A;  5F04 A;  4M3D A;  3G1L A;  3HGG A;  5AQC A;  3NRG A;  3WHB A;  1ORK A;  1A6I A;  1ZK8 A;  2VPR A;  3DCF A;  3VOX A;  4GCT A;  2TCT A;  3VW2 A;  3AQT A;  4GFL A;  5DAJ A;  3P9T A;  3SFI A;  5J3L A;  5FGL A;  3E7Q A;  5K58 A;  3FK6 A;  3BTI A;  3PPB A;  2DG8 A;  2XGC A;  3AQS A;  4M3E A;  4M3F A;  2HXO A;  1RPW A;  4JYK A;  3QQA A;  3ANP A;  3BR0 A;  3Q3S A;  5J1U A;  2YVE A;  2HQ5 A;  2Y2Z A;  3LSP A;  3GEU A;  4D5F A;  4I6Z A;  2XDN A;  2XPV A;  4D5C A;  3F0C A;  3NPI A;  1U9O A;  3NI7 A;  2JK3 A;  4JKZ A;  5D1R A;  2IU5 A;  3BR6 A;  2OF7 A;  2O7T A;  2FQ4 A;  3DPJ A;  3HTH A;  1QPI A;  2UXO A;  3BQY A;  4XK4 A;  3BTC A;  2Q24 A;  2X9D A;  3CCY A;  2OPT A;  3MVP A;  2ID3 A;  3MNL A;  3F1B A;  3ON4 A;  2QWT A;  5F0C A;  2IBD A;  3HIM A;  4V2F A;  2GEN A;  4GCK A;  2IAI A;  3ZQI A;  5FKN A;  3KKC A;  5F0H A;  5GPC A;  2TRT A;  2ZOY A;  3LWJ A;  3BTL A;  4AC0 A;  3BTJ A;  2QKO A;  2RAE A;  4V2G A;  5EZH A;  4MO7 A;  1QVT A;  2XPU A;  5IOY A;  2QOP A;  1BJZ A;  3BQZ A;  5H9T A;  3ZQH A;  3ZQG A;  4AUX A;  2WGB A;  5C4Y A;  5EFY A;  3C2B A;  3ON2 A;  3Q0U A;  3JSJ A;  1T33 A;  3NXC A;  5HAW A;  4PXI A;  4D7N A;  3O60 A;  2ZCN A;  3CWR A;  3EUP A;  3GZI A;  2XGE A;  3TP3 A;  2FD5 A;  2VKV A;  4I76 A;  1ZKG A;  2FX0 A;  3ZQF A;  3O8H A;  2UXP A;  5EZG A;  4GCL A;  3IUV A;  3CDL A;  2EH3 A;  2JJ7 A;  4ME9 A;  3HGY A;  3TP0 A;  2W53 A;  4CGR A;  3G1O A;  5FKK A;  4DW6 A;  4M3B A;  3S5R A;  2DTZ A;  3B6C A;  1U9N A;  1RKW A;  2V57 A;  3T6N A;  4ABZ A;  1Z0X A;  4JL3 A;  3RH2 A;  1JTX A;  2D6Y A;  5F0F A;  3BR5 A;  1VI0 A;  4NEL A;  3LOC A;  2OI8 A;  4ACI A;  5D19 A;  2RHA A;  4B1R A;  1UI5 A;  3VPR A;  5J1R A;  2WUI A;  2DG7 A;  3LJL A;  3PAS A;  3VIB A;  2F07 A;  3HTA A;  1RKT A;  3HTJ A;  4YZE A;  5FMP A;  2OER A;  3LSR A;  2NS7 A;  2QCO A;  2ZCX A;  3VUQ A;  3ZQL A;  2NS8 A;  2ZOZ A;  4L62 A;  4MK6 A;  2FBQ A;  2RAS A;  3BT9 A;  3G7R A;  3VW0 A;  5CXI A;  3KNW A;  2HYT A;  2G7L A;  3G56 A;  3QPL A;  2NX4 A;  3IH4 A;  3CJD A;  3LSJ A;  1JT6 A;  2Y31 A;  3BCG A;  3Q0W A;  3RD3 A;  2O7O A;  4UDS A;  4B3A A;  2XGD A;  2NP3 A;  3VW1 A;  3PM1 A;  3WHC A;  5F1J A;  5F27 A;  3BNI A;  3NNR A;  3V6G A;  4X1E A;  5F08 A;  5IP6 A;  2NP5 A;  3O8G A;  3VP5 A;  3VVY A;  2UXH A;  1JT0 A;  2UXI A;  4D7M A;  2X6O A; 
#chains in the Genus database with same CATH topology
 1Z77 A;  3G1M A;  3FK7 A;  2WV1 A;  2G7S A;  3CRJ A;  3FRQ A;  2UXU A;  4NN1 A;  2ID6 A;  3C07 A;  3VVZ A;  3NS4 A;  3QKX A;  5HBU A;  2I10 A;  3KZ9 A;  1SGM A;  4W1U A;  5FKL A;  2PZ9 A;  3SDG A;  3ANG A;  1JUS A;  2ZCM A;  2VKE A;  3BJB A;  4GFK A;  2GFN A;  2HXI A;  5EYR A;  2GUH A;  4W97 A;  5CW8 A;  5FKO A;  1JUP A;  5CXG A;  3EGQ A;  5GP9 A;  5K7Z A;  4ICH A;  2HKU A;  5FKM A;  5FHP A;  2G0E A;  2XRL A;  4M3G A;  3Q0V A;  1JUM A;  2B1E A;  3HE0 A;  2REK A;  2FJ1 A;  5IOZ A;  1JTY A;  5J1Y A;  3V78 A;  3BRU A;  5IPA A;  2GBY A;  3BR3 A;  3QPS A;  3VVX A;  3HTI A;  2PBX A;  5D18 A;  5GPA A;  3FIW A;  2A2F X;  4MXM A;  3BR2 A;  3IH2 A;  4KWA A;  5HSZ A;  2QIB A;  5K7H A;  4JNN A;  1T56 A;  3COL A;  2YVH A;  3LHQ A;  3BHQ A;  4G12 A;  2XB5 A;  3VTI A;  4AF5 A;  2QTQ A;  3B81 A;  4AC6 A;  2IEK A;  3IH3 A;  1UI6 A;  3KKD A;  3BR1 A;  3VOK A;  2G7G A;  2XPW A;  2ZB9 A;  3DEW A;  4HKU A;  5K7F A;  3QBM A;  1QVU A;  2HYJ A;  2Y30 A;  3B6A A;  2G3B A;  5F04 A;  4M3D A;  3G1L A;  3HGG A;  5AQC A;  3FHN A;  3NRG A;  3WHB A;  1ORK A;  1A6I A;  1ZK8 A;  2VPR A;  3DCF A;  3VOX A;  2B3W A;  4GCT A;  2TCT A;  3VW2 A;  3AQT A;  4GFL A;  5DAJ A;  3P9T A;  3SFI A;  5J3L A;  5FGL A;  3E7Q A;  5K58 A;  3FK6 A;  3BTI A;  3PPB A;  2DG8 A;  2XGC A;  3AQS A;  4M3E A;  4M3F A;  2R7T A;  2HXO A;  1RPW A;  4JYK A;  3QQA A;  3ANP A;  3BR0 A;  3Q3S A;  5J1U A;  2YVE A;  2HQ5 A;  2Y2Z A;  3LSP A;  2R7X A;  2PFV A;  3GEU A;  4D5F A;  4I6Z A;  2XDN A;  2XPV A;  4D5C A;  3F0C A;  3NPI A;  1U9O A;  3NI7 A;  2JK3 A;  4JKZ A;  5D1R A;  2IU5 A;  3KYL A;  3BR6 A;  2OF7 A;  2O7T A;  2FQ4 A;  3DPJ A;  3HTH A;  1QPI A;  2UXO A;  3BQY A;  4XK4 A;  3BTC A;  2Q24 A;  2X9D A;  2R7U A;  3CCY A;  2OPT A;  3MVP A;  2R7W A;  2ID3 A;  4U9N A;  4DVY P;  3MNL A;  3F1B A;  3ON4 A;  3K8P C;  2QWT A;  5F0C A;  2IBD A;  3HIM A;  4V2F A;  2GEN A;  4GCK A;  2IAI A;  3DU5 A;  3ZQI A;  5FKN A;  3KKC A;  5F0H A;  5GPC A;  2TRT A;  2ZOY A;  3LWJ A;  3BTL A;  4AC0 A;  3BTJ A;  2QKO A;  2RAE A;  4V2G A;  5EZH A;  4MO7 A;  1QVT A;  2XPU A;  5IOY A;  2QOP A;  1BJZ A;  3BQZ A;  4C2M A;  5H9T A;  3ZQH A;  3ZQG A;  4AUX A;  2WGB A;  5C4Y A;  5EFY A;  3C2B A;  3ON2 A;  3Q0U A;  3JSJ A;  1T33 A;  3NXC A;  4OD4 A;  5HAW A;  4PXI A;  4D7N A;  3O60 A;  2ZCN A;  3CWR A;  3EUP A;  2YVX A;  3GZI A;  2XGE A;  3TP3 A;  2FD5 A;  2VKV A;  4I76 A;  1ZKG A;  2FX0 A;  3ZQF A;  3O8H A;  2UXP A;  2FJI 1;  5EZG A;  4GCL A;  2R7Q A;  3IUV A;  3CDL A;  2EH3 A;  2JJ7 A;  4ME9 A;  3HGY A;  3TP0 A;  2W53 A;  4CGR A;  3G1O A;  2R7V A;  5FKK A;  4DW6 A;  4M3B A;  2R7O A;  3S5R A;  2DTZ A;  3B6C A;  1U9N A;  1RKW A;  2V57 A;  3T6N A;  4ABZ A;  1Z0X A;  4JL3 A;  3RH2 A;  1JTX A;  2D6Y A;  5F0F A;  3BR5 A;  1VI0 A;  4NEL A;  3LOC A;  2OI8 A;  4OD5 A;  4ACI A;  5D19 A;  2RHA A;  4B1R A;  1UI5 A;  3VPR A;  5J1R A;  2WUI A;  2DG7 A;  3LJL A;  5CQG A;  3PAS A;  3VIB A;  2F07 A;  4WIB A;  3HTA A;  1RKT A;  3HTJ A;  4YZE A;  5FMP A;  2OER A;  2R7R A;  3LSR A;  2NS7 A;  2QCO A;  2ZCX A;  3VUQ A;  3ZQL A;  2NS8 A;  2ZY9 A;  2ZOZ A;  4L62 A;  4MK6 A;  2FBQ A;  2RAS A;  3BT9 A;  3G7R A;  3VW0 A;  5CXI A;  3KNW A;  2HYT A;  2G7L A;  3G56 A;  3QPL A;  2NX4 A;  3IH4 A;  3CJD A;  3LSJ A;  2R7S A;  1JT6 A;  2Y31 A;  3BCG A;  3Q0W A;  3RD3 A;  2O7O A;  4U9L A;  4UDS A;  4B3A A;  2XGD A;  2NP3 A;  3VW1 A;  3PM1 A;  3WHC A;  5F1J A;  5F27 A;  3BNI A;  3NNR A;  3V6G A;  4X1E A;  5F08 A;  5IP6 A;  2NP5 A;  3O8G A;  3VP5 A;  3DU6 A;  4IRV A;  3VVY A;  3SWH A;  2UXH A;  1JT0 A;  2UXI A;  4D7M A;  2X6O A; 
#chains in the Genus database with same CATH homology
 1Z77 A;  3G1M A;  3FK7 A;  2WV1 A;  2G7S A;  3CRJ A;  3FRQ A;  2UXU A;  4NN1 A;  2ID6 A;  3C07 A;  3VVZ A;  3QKX A;  5HBU A;  2I10 A;  3KZ9 A;  1SGM A;  4W1U A;  5FKL A;  2PZ9 A;  3SDG A;  3ANG A;  1JUS A;  2ZCM A;  2VKE A;  3BJB A;  4GFK A;  2GFN A;  2HXI A;  5EYR A;  2GUH A;  4W97 A;  5CW8 A;  5FKO A;  1JUP A;  5CXG A;  3EGQ A;  5GP9 A;  5K7Z A;  4ICH A;  2HKU A;  5FKM A;  5FHP A;  2G0E A;  2XRL A;  4M3G A;  3Q0V A;  1JUM A;  3HE0 A;  2REK A;  2FJ1 A;  5IOZ A;  1JTY A;  5J1Y A;  3V78 A;  3BRU A;  5IPA A;  2GBY A;  3BR3 A;  3QPS A;  3VVX A;  3HTI A;  2PBX A;  5D18 A;  5GPA A;  3FIW A;  4MXM A;  3BR2 A;  3IH2 A;  4KWA A;  5HSZ A;  2QIB A;  5K7H A;  4JNN A;  1T56 A;  3COL A;  2YVH A;  3LHQ A;  3BHQ A;  4G12 A;  2XB5 A;  4AF5 A;  2QTQ A;  3B81 A;  4AC6 A;  2IEK A;  3IH3 A;  1UI6 A;  3KKD A;  3BR1 A;  3VOK A;  2G7G A;  2XPW A;  2ZB9 A;  3DEW A;  4HKU A;  5K7F A;  3QBM A;  1QVU A;  2HYJ A;  2Y30 A;  3B6A A;  2G3B A;  5F04 A;  4M3D A;  3G1L A;  3HGG A;  5AQC A;  3NRG A;  3WHB A;  1ORK A;  1A6I A;  1ZK8 A;  2VPR A;  3DCF A;  3VOX A;  4GCT A;  2TCT A;  3VW2 A;  3AQT A;  4GFL A;  5DAJ A;  3P9T A;  3SFI A;  5J3L A;  5FGL A;  3E7Q A;  5K58 A;  3FK6 A;  3BTI A;  3PPB A;  2DG8 A;  2XGC A;  3AQS A;  4M3E A;  4M3F A;  2HXO A;  1RPW A;  4JYK A;  3QQA A;  3ANP A;  3BR0 A;  3Q3S A;  5J1U A;  2YVE A;  2HQ5 A;  2Y2Z A;  3LSP A;  3GEU A;  4D5F A;  4I6Z A;  2XDN A;  2XPV A;  4D5C A;  3F0C A;  3NPI A;  1U9O A;  3NI7 A;  2JK3 A;  4JKZ A;  5D1R A;  2IU5 A;  3BR6 A;  2OF7 A;  2O7T A;  2FQ4 A;  3DPJ A;  3HTH A;  1QPI A;  2UXO A;  3BQY A;  4XK4 A;  3BTC A;  2Q24 A;  2X9D A;  3CCY A;  2OPT A;  3MVP A;  2ID3 A;  3MNL A;  3F1B A;  3ON4 A;  2QWT A;  5F0C A;  2IBD A;  3HIM A;  4V2F A;  2GEN A;  4GCK A;  2IAI A;  3ZQI A;  5FKN A;  3KKC A;  5F0H A;  5GPC A;  2TRT A;  2ZOY A;  3LWJ A;  3BTL A;  4AC0 A;  3BTJ A;  2QKO A;  2RAE A;  4V2G A;  5EZH A;  4MO7 A;  1QVT A;  2XPU A;  5IOY A;  2QOP A;  1BJZ A;  3BQZ A;  5H9T A;  3ZQH A;  3ZQG A;  4AUX A;  2WGB A;  5C4Y A;  5EFY A;  3C2B A;  3ON2 A;  3Q0U A;  3JSJ A;  1T33 A;  3NXC A;  5HAW A;  4PXI A;  4D7N A;  3O60 A;  2ZCN A;  3CWR A;  3EUP A;  3GZI A;  2XGE A;  3TP3 A;  2FD5 A;  2VKV A;  4I76 A;  1ZKG A;  2FX0 A;  3ZQF A;  3O8H A;  2UXP A;  5EZG A;  4GCL A;  3IUV A;  3CDL A;  2EH3 A;  2JJ7 A;  4ME9 A;  3HGY A;  3TP0 A;  2W53 A;  4CGR A;  3G1O A;  5FKK A;  4DW6 A;  4M3B A;  3S5R A;  2DTZ A;  3B6C A;  1U9N A;  1RKW A;  2V57 A;  3T6N A;  4ABZ A;  1Z0X A;  4JL3 A;  3RH2 A;  1JTX A;  2D6Y A;  5F0F A;  3BR5 A;  1VI0 A;  4NEL A;  3LOC A;  2OI8 A;  4ACI A;  5D19 A;  2RHA A;  4B1R A;  1UI5 A;  3VPR A;  5J1R A;  2WUI A;  2DG7 A;  3LJL A;  3PAS A;  3VIB A;  2F07 A;  3HTA A;  1RKT A;  3HTJ A;  4YZE A;  5FMP A;  2OER A;  3LSR A;  2NS7 A;  2QCO A;  2ZCX A;  3VUQ A;  3ZQL A;  2NS8 A;  2ZOZ A;  4L62 A;  4MK6 A;  2FBQ A;  2RAS A;  3BT9 A;  3G7R A;  3VW0 A;  5CXI A;  3KNW A;  2HYT A;  2G7L A;  3G56 A;  3QPL A;  2NX4 A;  3IH4 A;  3CJD A;  3LSJ A;  1JT6 A;  2Y31 A;  3BCG A;  3Q0W A;  3RD3 A;  2O7O A;  4UDS A;  4B3A A;  2XGD A;  2NP3 A;  3VW1 A;  3PM1 A;  3WHC A;  5F1J A;  5F27 A;  3BNI A;  3NNR A;  3V6G A;  4X1E A;  5F08 A;  5IP6 A;  2NP5 A;  3O8G A;  3VP5 A;  3VVY A;  2UXH A;  1JT0 A;  2UXI A;  4D7M A;  2X6O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...