3CJDA

Crystal structure of putative tetr transcriptional regulator (yp_510936.1) from jannaschia sp. ccs1 at 1.79 a resolution
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
189
structure length
182
Chain Sequence
KAALREKLIDLAEAQIEAEGLASLRARELARQADCAVGAIYTHFQDLNALTLEVNGRTFARLGAAVGDDHPNERLIAMSHAYLAFAREHPKLWRALFDVEMRSDGPVPQWYGHAMAQLFSYITTPLAKIFPESDDAELDLMTRTLFSSVHGIVLLGLENRISGVPGEQLKTMIRLLLEQVGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative TetR transcriptional regulator (YP_510936.1) from Jannaschia sp. CCS1 at 1.79 A resolution
rcsb
source organism Jannaschia sp.
molecule tags Transcription regulator
molecule keywords Transcriptional regulator, TetR family
total genus 64
structure length 182
sequence length 189
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF13305 TetR_C_33 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3cjdA00
3BNIA 4X1EA 5DAJA 3SFIA 4XK4A 3BCGA 3G1LA 5J1UA 5IPAA 5FMPA 4B3AA 2IEKA 3Q3SA 3S5RA 2UXUA 4V2GA 3ON2A 2VKVA 3LWJA 1UI5A 1QVUA 1JT0A 5F0FA 1U9NA 4M3DA 3EGQA 4I76A 2YVEA 3Q0UA 2QCOA 3VOXA 5D19A 2DTZA 1T33A 3C07A 4D5FA 3VW2A 2TCTA 3DEWA 2F07A 3VPRA 4W97A 4MXMA 2UXPA 5HAWA 1JUMA 3QPLA 2ZOYA 2GENA 5FKLA 1ZK8A 3F0CA 2HYTA 2ZB9A 3B6CA 3MVPA 3BT9A 5FKNA 5K7FA 3VOKA 1RKWA 2ZCNA 2Q24A 2XDNA 3LSRA 3BR6A 3ZQIA 1JT6A 2XRLA 3LSJA 5AQCA 2Y2ZA 1JTYA 2NP5A 3Q0VA 5D1RA 4DW6A 4W1UA 2FBQA 2NX4A 4MK6A 3NPIA 2OERA 3IH2A 2QOPA 3FIWA 4NN1A 3PASA 1RKTA 5FKMA 3QPSA 2UXOA 3IH3A 3PPBA 3LHQA 5IOYA 5EZHA 2IAIA 4PXIA 4D5CA 2RASA 2WGBA 5CW8A 5F08A 3G1OA 4M3EA 2NP3A 3ZQLA 3BR2A 2QKOA 1Z77A 1SGMA 3G7RA 2REKA 3BR5A 2DG8A 3VW1A 3E7QA 2HQ5A 3SDGA 3CWRA 5J3LA 2V57A 3VVZA 2HKUA 3O8GA 3TP3A 4I6ZA 1JUSA 2OF7A 3MNLA 3NI7A 3WHBA 2HYJA 2OPTA 5K7ZA 1RPWA 2G7GA 3BRUA 4CGRA 2QIBA 3VVYA 3V78A 4JL3A 3ZQFA 3COLA 5EZGA 2HXOA 1A6IA 5HSZA 3BQZA 5C4YA 3KNWA 3BR1A 3NRGA 3QQAA 3QKXA 3HTJA 3VIBA 3O8HA 2UXHA 2QTQA 1T56A 2W53A 1QVTA 3BTLA 3CDLA 5EYRA 1ZKGA 4KWAA 5F1JA 2XGCA 2VKEA 1JTXA 4B1RA 3ON4A 4YZEA 2VPRA 2QWTA 2JK3A 1BJZA 3JSJA 3DPJA 2UXIA 3HE0A 2EH3A 2FD5A 2G7SA 4G12A 3AQTA 1UI6A 2D6YA 4HKUA 5H9TA 5F27A 5FHPA 3EUPA 5K7HA 3RH2A 4ICHA 2I10A 1JUPA 3B6AA 3NNRA 4AUXA 3B81A 4GFLA 3HGGA 3IUVA 2RAEA 4ME9A 2ZOZA 4M3BA 3HIMA 4D7MA 4ABZA 2JJ7A 2X9DA 2IBDA 2PBXA 3HGYA 3Q0WA 4JKZA 2IU5A 5FKKA 3G1MA 5FKOA 5IOZA 3ANPA 2G3BA 4GCTA 2XB5A 2PZ9A 5F0CA 1Z0XA 2FJ1A 4V2FA 3CCYA 3NXCA 3BTJA 5J1YA 2NS7A 3BHQA 3RD3A 3AQSA 3GZIA 4JNNA 3KKCA 5CXGA 2G7LA 2Y30A 5GP9A 2XPWA 3HTAA 3ANGA 4UDSA 5GPCA 5K58A 2OI8A 4D7NA 3P9TA 3HTHA 2XGEA 2ZCXA 5F0HA 3ZQGA 2HXIA 1ORKA 3GEUA 4GCKA 5EFYA 2O7TA 2ID6A 3VUQA 2GUHA 4ACIA 1QPIA 5F04A 2X6OA 5CXIA 2ZCMA 3FK7A 2ID3A 3VW0A 3CJDA 3DCFA 3G56A 2FQ4A 3TP0A 1VI0A 3PM1A 2XPUA 2XGDA 3VP5A 4NELA 2XPVA 5HBUA 4AF5A 2GFNA 3LSPA 3LOCA 3V6GA 3IH4A 5GPAA 3O60A 4L62A 2NS8A 3WHCA 1U9OA 2G0EA 5FGLA 5D18A 4GFKA 3BR0A 3HTIA 2WUIA 3FRQA 3VVXA 2RHAA 4MO7A 3C2BA 4AC6A 3BR3A 3ZQHA 2O7OA 4AC0A 3KKDA 4JYKA 5J1RA 3BTIA 3KZ9A 3F1BA 3CRJA 4GCLA 2DG7A 3QBMA 3BJBA 4M3FA 2Y31A 3T6NA 2TRTA 2YVHA 3BQYA 2WV1A 5IP6A 3BTCA 2GBYA 3FK6A 3LJLA 4M3GA 2FX0A
chains in the Genus database with same CATH superfamily
3BNIA 4X1EA 5DAJA 3SFIA 2R7UA 4XK4A 3BCGA 3G1LA 5J1UA 5IPAA 5FMPA 4B3AA 2IEKA 3Q3SA 3S5RA 3K8PC 2UXUA 4V2GA 2FJI1 3ON2A 2VKVA 3LWJA 1UI5A 1QVUA 1JT0A 3FHNA 5F0FA 1U9NA 4M3DA 3EGQA 4I76A 2YVEA 3Q0UA 2QCOA 3VOXA 5D19A 2DTZA 1T33A 3C07A 4D5FA 3VW2A 2TCTA 3DEWA 2F07A 3VPRA 4W97A 4MXMA 3DU6A 2R7TA 2UXPA 5HAWA 1JUMA 3QPLA 2ZOYA 2GENA 5FKLA 1ZK8A 3F0CA 2HYTA 2ZB9A 3B6CA 3MVPA 3BT9A 5FKNA 4WIBA 5K7FA 3VOKA 1RKWA 2ZCNA 4C2MA 2Q24A 2XDNA 3LSRA 3BR6A 3ZQIA 2B3WA 1JT6A 2XRLA 3LSJA 5AQCA 2Y2ZA 1JTYA 2NP5A 3Q0VA 5D1RA 4IRVA 4DW6A 4W1UA 2FBQA 2NX4A 4MK6A 3NPIA 2OERA 3IH2A 2QOPA 3FIWA 4NN1A 3PASA 1RKTA 5FKMA 3QPSA 2UXOA 3IH3A 2R7RA 3PPBA 4OD5A 3SWHA 3LHQA 5IOYA 5EZHA 2IAIA 4PXIA 4D5CA 2RASA 2WGBA 5CW8A 5F08A 3G1OA 4M3EA 2YVXA 2NP3A 3ZQLA 3BR2A 2QKOA 1Z77A 3DU5A 1SGMA 3G7RA 2REKA 3BR5A 2DG8A 3VW1A 3E7QA 2HQ5A 3SDGA 3CWRA 2B1EA 2V57A 5J3LA 3VVZA 2HKUA 3O8GA 3TP3A 4I6ZA 1JUSA 2OF7A 3MNLA 3NI7A 3WHBA 2HYJA 4DVYP 2R7OA 2OPTA 5K7ZA 1RPWA 2G7GA 3BRUA 4CGRA 2QIBA 3VVYA 3V78A 4JL3A 3ZQFA 3COLA 5EZGA 2HXOA 5CQGA 1A6IA 5HSZA 3BQZA 5C4YA 3KNWA 3BR1A 3NRGA 3QQAA 3QKXA 3HTJA 3VIBA 3O8HA 2UXHA 2QTQA 1T56A 2W53A 1QVTA 3BTLA 3CDLA 5EYRA 1ZKGA 4KWAA 5F1JA 2XGCA 2VKEA 1JTXA 4B1RA 3ON4A 2R7VA 4YZEA 2VPRA 2QWTA 2JK3A 1BJZA 3JSJA 3DPJA 2UXIA 3HE0A 2EH3A 2FD5A 2G7SA 4G12A 3AQTA 1UI6A 2D6YA 4HKUA 5H9TA 5F27A 5FHPA 2R7WA 3EUPA 2PFVA 5K7HA 3RH2A 4ICHA 2I10A 1JUPA 3B6AA 3NNRA 4AUXA 3B81A 4GFLA 3HGGA 3IUVA 2RAEA 4ME9A 2ZOZA 4M3BA 3HIMA 4D7MA 4ABZA 2A2FX 2JJ7A 2X9DA 2IBDA 2PBXA 3HGYA 3Q0WA 4JKZA 2IU5A 5FKKA 3G1MA 5FKOA 5IOZA 3ANPA 2G3BA 2R7QA 4GCTA 2XB5A 2PZ9A 5F0CA 1Z0XA 2FJ1A 4V2FA 3CCYA 3NXCA 3BTJA 2R7SA 5J1YA 2NS7A 3BHQA 3RD3A 3AQSA 3GZIA 4JNNA 3KKCA 5CXGA 2G7LA 2Y30A 5GP9A 2XPWA 3HTAA 3ANGA 4UDSA 5GPCA 5K58A 2OI8A 3P9TA 4D7NA 3HTHA 2XGEA 2ZCXA 3NS4A 2R7XA 5F0HA 2ZY9A 3ZQGA 2HXIA 1ORKA 3GEUA 4GCKA 5EFYA 4U9NA 2O7TA 2ID6A 3VUQA 2GUHA 4ACIA 1QPIA 5F04A 2X6OA 5CXIA 2ZCMA 3FK7A 2ID3A 3VW0A 3CJDA 3DCFA 3G56A 2FQ4A 3TP0A 1VI0A 3PM1A 2XPUA 2XGDA 3VP5A 4NELA 2XPVA 5HBUA 4AF5A 2GFNA 3LSPA 3LOCA 3V6GA 3IH4A 5GPAA 3O60A 4L62A 2NS8A 3WHCA 1U9OA 2G0EA 5FGLA 4OD4A 5D18A 4GFKA 3BR0A 3HTIA 2WUIA 3FRQA 3VVXA 2RHAA 4MO7A 3C2BA 4AC6A 3BR3A 3ZQHA 2O7OA 4AC0A 3KKDA 4JYKA 5J1RA 3BTIA 3KZ9A 3F1BA 3CRJA 4GCLA 3KYLA 2DG7A 3QBMA 3BJBA 4M3FA 2Y31A 3T6NA 2TRTA 2YVHA 3BQYA 2WV1A 5IP6A 3BTCA 2GBYA 3FK6A 3LJLA 4M3GA 4U9LA 2FX0A 3VTIA
chains in the Genus database with same CATH topology
3BNIA 4X1EA 5DAJA 3SFIA 4XK4A 3BCGA 3G1LA 5J1UA 5IPAA 5FMPA 4B3AA 2IEKA 3Q3SA 3S5RA 2UXUA 4V2GA 3ON2A 2VKVA 3LWJA 1UI5A 1QVUA 1JT0A 5F0FA 1U9NA 4M3DA 3EGQA 4I76A 2YVEA 3Q0UA 2QCOA 3VOXA 5D19A 2DTZA 1T33A 3C07A 4D5FA 3VW2A 2TCTA 3DEWA 2F07A 3VPRA 4W97A 4MXMA 2UXPA 5HAWA 1JUMA 3QPLA 2ZOYA 2GENA 5FKLA 1ZK8A 3F0CA 2HYTA 2ZB9A 3B6CA 3MVPA 3BT9A 5FKNA 5K7FA 3VOKA 1RKWA 2ZCNA 2Q24A 2XDNA 3LSRA 3BR6A 3ZQIA 1JT6A 2XRLA 3LSJA 5AQCA 2Y2ZA 1JTYA 2NP5A 3Q0VA 5D1RA 4DW6A 4W1UA 2FBQA 2NX4A 4MK6A 3NPIA 2OERA 3IH2A 2QOPA 3FIWA 4NN1A 3PASA 1RKTA 5FKMA 3QPSA 2UXOA 3IH3A 3PPBA 3LHQA 5IOYA 5EZHA 2IAIA 4PXIA 4D5CA 2RASA 2WGBA 5CW8A 5F08A 3G1OA 4M3EA 2NP3A 3ZQLA 3BR2A 2QKOA 1Z77A 1SGMA 3G7RA 2REKA 3BR5A 2DG8A 3VW1A 3E7QA 2HQ5A 3SDGA 3CWRA 5J3LA 2V57A 3VVZA 2HKUA 3O8GA 3TP3A 4I6ZA 1JUSA 2OF7A 3MNLA 3NI7A 3WHBA 2HYJA 2OPTA 5K7ZA 1RPWA 2G7GA 3BRUA 4CGRA 2QIBA 3VVYA 3V78A 4JL3A 3ZQFA 3COLA 5EZGA 2HXOA 1A6IA 5HSZA 3BQZA 5C4YA 3KNWA 3BR1A 3NRGA 3QQAA 3QKXA 3HTJA 3VIBA 3O8HA 2UXHA 2QTQA 1T56A 2W53A 1QVTA 3BTLA 3CDLA 5EYRA 1ZKGA 4KWAA 5F1JA 2XGCA 2VKEA 1JTXA 4B1RA 3ON4A 4YZEA 2VPRA 2QWTA 2JK3A 1BJZA 3JSJA 3DPJA 2UXIA 3HE0A 2EH3A 2FD5A 2G7SA 4G12A 3AQTA 1UI6A 2D6YA 4HKUA 5H9TA 5F27A 5FHPA 3EUPA 5K7HA 3RH2A 4ICHA 2I10A 1JUPA 3B6AA 3NNRA 4AUXA 3B81A 4GFLA 3HGGA 3IUVA 2RAEA 4ME9A 2ZOZA 4M3BA 3HIMA 4D7MA 4ABZA 2JJ7A 2X9DA 2IBDA 2PBXA 3HGYA 3Q0WA 4JKZA 2IU5A 5FKKA 3G1MA 5FKOA 5IOZA 3ANPA 2G3BA 4GCTA 2XB5A 2PZ9A 5F0CA 1Z0XA 2FJ1A 4V2FA 3CCYA 3NXCA 3BTJA 5J1YA 2NS7A 3BHQA 3RD3A 3AQSA 3GZIA 4JNNA 3KKCA 5CXGA 2G7LA 2Y30A 5GP9A 2XPWA 3HTAA 3ANGA 4UDSA 5GPCA 5K58A 2OI8A 4D7NA 3P9TA 3HTHA 2XGEA 2ZCXA 5F0HA 3ZQGA 2HXIA 1ORKA 3GEUA 4GCKA 5EFYA 2O7TA 2ID6A 3VUQA 2GUHA 4ACIA 1QPIA 5F04A 2X6OA 5CXIA 2ZCMA 3FK7A 2ID3A 3VW0A 3CJDA 3DCFA 3G56A 2FQ4A 3TP0A 1VI0A 3PM1A 2XPUA 2XGDA 3VP5A 4NELA 2XPVA 5HBUA 4AF5A 2GFNA 3LSPA 3LOCA 3V6GA 3IH4A 5GPAA 3O60A 4L62A 2NS8A 3WHCA 1U9OA 2G0EA 5FGLA 5D18A 4GFKA 3BR0A 3HTIA 2WUIA 3FRQA 3VVXA 2RHAA 4MO7A 3C2BA 4AC6A 3BR3A 3ZQHA 2O7OA 4AC0A 3KKDA 4JYKA 5J1RA 3BTIA 3KZ9A 3F1BA 3CRJA 4GCLA 2DG7A 3QBMA 3BJBA 4M3FA 2Y31A 3T6NA 2TRTA 2YVHA 3BQYA 2WV1A 5IP6A 3BTCA 2GBYA 3FK6A 3LJLA 4M3GA 2FX0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BNI A;  4X1E A;  5DAJ A;  3SFI A;  4XK4 A;  3BCG A;  3G1L A;  5J1U A;  5IPA A;  5FMP A;  4B3A A;  2IEK A;  3Q3S A;  3S5R A;  2UXU A;  4V2G A;  3ON2 A;  2VKV A;  3LWJ A;  1UI5 A;  1QVU A;  1JT0 A;  5F0F A;  1U9N A;  4M3D A;  3EGQ A;  4I76 A;  2YVE A;  3Q0U A;  2QCO A;  3VOX A;  5D19 A;  2DTZ A;  1T33 A;  3C07 A;  4D5F A;  3VW2 A;  2TCT A;  3DEW A;  2F07 A;  3VPR A;  4W97 A;  4MXM A;  2UXP A;  5HAW A;  1JUM A;  3QPL A;  2ZOY A;  2GEN A;  5FKL A;  1ZK8 A;  3F0C A;  2HYT A;  2ZB9 A;  3B6C A;  3MVP A;  3BT9 A;  5FKN A;  5K7F A;  3VOK A;  1RKW A;  2ZCN A;  2Q24 A;  2XDN A;  3LSR A;  3BR6 A;  3ZQI A;  1JT6 A;  2XRL A;  3LSJ A;  5AQC A;  2Y2Z A;  1JTY A;  2NP5 A;  3Q0V A;  5D1R A;  4DW6 A;  4W1U A;  2FBQ A;  2NX4 A;  4MK6 A;  3NPI A;  2OER A;  3IH2 A;  2QOP A;  3FIW A;  4NN1 A;  3PAS A;  1RKT A;  5FKM A;  3QPS A;  2UXO A;  3IH3 A;  3PPB A;  3LHQ A;  5IOY A;  5EZH A;  2IAI A;  4PXI A;  4D5C A;  2RAS A;  2WGB A;  5CW8 A;  5F08 A;  3G1O A;  4M3E A;  2NP3 A;  3ZQL A;  3BR2 A;  2QKO A;  1Z77 A;  1SGM A;  3G7R A;  2REK A;  3BR5 A;  2DG8 A;  3VW1 A;  3E7Q A;  2HQ5 A;  3SDG A;  3CWR A;  5J3L A;  2V57 A;  3VVZ A;  2HKU A;  3O8G A;  3TP3 A;  4I6Z A;  1JUS A;  2OF7 A;  3MNL A;  3NI7 A;  3WHB A;  2HYJ A;  2OPT A;  5K7Z A;  1RPW A;  2G7G A;  3BRU A;  4CGR A;  2QIB A;  3VVY A;  3V78 A;  4JL3 A;  3ZQF A;  3COL A;  5EZG A;  2HXO A;  1A6I A;  5HSZ A;  3BQZ A;  5C4Y A;  3KNW A;  3BR1 A;  3NRG A;  3QQA A;  3QKX A;  3HTJ A;  3VIB A;  3O8H A;  2UXH A;  2QTQ A;  1T56 A;  2W53 A;  1QVT A;  3BTL A;  3CDL A;  5EYR A;  1ZKG A;  4KWA A;  5F1J A;  2XGC A;  2VKE A;  1JTX A;  4B1R A;  3ON4 A;  4YZE A;  2VPR A;  2QWT A;  2JK3 A;  1BJZ A;  3JSJ A;  3DPJ A;  2UXI A;  3HE0 A;  2EH3 A;  2FD5 A;  2G7S A;  4G12 A;  3AQT A;  1UI6 A;  2D6Y A;  4HKU A;  5H9T A;  5F27 A;  5FHP A;  3EUP A;  5K7H A;  3RH2 A;  4ICH A;  2I10 A;  1JUP A;  3B6A A;  3NNR A;  4AUX A;  3B81 A;  4GFL A;  3HGG A;  3IUV A;  2RAE A;  4ME9 A;  2ZOZ A;  4M3B A;  3HIM A;  4D7M A;  4ABZ A;  2JJ7 A;  2X9D A;  2IBD A;  2PBX A;  3HGY A;  3Q0W A;  4JKZ A;  2IU5 A;  5FKK A;  3G1M A;  5FKO A;  5IOZ A;  3ANP A;  2G3B A;  4GCT A;  2XB5 A;  2PZ9 A;  5F0C A;  1Z0X A;  2FJ1 A;  4V2F A;  3CCY A;  3NXC A;  3BTJ A;  5J1Y A;  2NS7 A;  3BHQ A;  3RD3 A;  3AQS A;  3GZI A;  4JNN A;  3KKC A;  5CXG A;  2G7L A;  2Y30 A;  5GP9 A;  2XPW A;  3HTA A;  3ANG A;  4UDS A;  5GPC A;  5K58 A;  2OI8 A;  4D7N A;  3P9T A;  3HTH A;  2XGE A;  2ZCX A;  5F0H A;  3ZQG A;  2HXI A;  1ORK A;  3GEU A;  4GCK A;  5EFY A;  2O7T A;  2ID6 A;  3VUQ A;  2GUH A;  4ACI A;  1QPI A;  5F04 A;  2X6O A;  5CXI A;  2ZCM A;  3FK7 A;  2ID3 A;  3VW0 A;  3CJD A;  3DCF A;  3G56 A;  2FQ4 A;  3TP0 A;  1VI0 A;  3PM1 A;  2XPU A;  2XGD A;  3VP5 A;  4NEL A;  2XPV A;  5HBU A;  4AF5 A;  2GFN A;  3LSP A;  3LOC A;  3V6G A;  3IH4 A;  5GPA A;  3O60 A;  4L62 A;  2NS8 A;  3WHC A;  1U9O A;  2G0E A;  5FGL A;  5D18 A;  4GFK A;  3BR0 A;  3HTI A;  2WUI A;  3FRQ A;  3VVX A;  2RHA A;  4MO7 A;  3C2B A;  4AC6 A;  3BR3 A;  3ZQH A;  2O7O A;  4AC0 A;  3KKD A;  4JYK A;  5J1R A;  3BTI A;  3KZ9 A;  3F1B A;  3CRJ A;  4GCL A;  2DG7 A;  3QBM A;  3BJB A;  4M3F A;  2Y31 A;  3T6N A;  2TRT A;  2YVH A;  3BQY A;  2WV1 A;  5IP6 A;  3BTC A;  2GBY A;  3FK6 A;  3LJL A;  4M3G A;  2FX0 A; 
#chains in the Genus database with same CATH topology
 3BNI A;  4X1E A;  5DAJ A;  3SFI A;  2R7U A;  4XK4 A;  3BCG A;  3G1L A;  5J1U A;  5IPA A;  5FMP A;  4B3A A;  2IEK A;  3Q3S A;  3S5R A;  3K8P C;  2UXU A;  4V2G A;  2FJI 1;  3ON2 A;  2VKV A;  3LWJ A;  1UI5 A;  1QVU A;  1JT0 A;  3FHN A;  5F0F A;  1U9N A;  4M3D A;  3EGQ A;  4I76 A;  2YVE A;  3Q0U A;  2QCO A;  3VOX A;  5D19 A;  2DTZ A;  1T33 A;  3C07 A;  4D5F A;  3VW2 A;  2TCT A;  3DEW A;  2F07 A;  3VPR A;  4W97 A;  4MXM A;  3DU6 A;  2R7T A;  2UXP A;  5HAW A;  1JUM A;  3QPL A;  2ZOY A;  2GEN A;  5FKL A;  1ZK8 A;  3F0C A;  2HYT A;  2ZB9 A;  3B6C A;  3MVP A;  3BT9 A;  5FKN A;  4WIB A;  5K7F A;  3VOK A;  1RKW A;  2ZCN A;  4C2M A;  2Q24 A;  2XDN A;  3LSR A;  3BR6 A;  3ZQI A;  2B3W A;  1JT6 A;  2XRL A;  3LSJ A;  5AQC A;  2Y2Z A;  1JTY A;  2NP5 A;  3Q0V A;  5D1R A;  4IRV A;  4DW6 A;  4W1U A;  2FBQ A;  2NX4 A;  4MK6 A;  3NPI A;  2OER A;  3IH2 A;  2QOP A;  3FIW A;  4NN1 A;  3PAS A;  1RKT A;  5FKM A;  3QPS A;  2UXO A;  3IH3 A;  2R7R A;  3PPB A;  4OD5 A;  3SWH A;  3LHQ A;  5IOY A;  5EZH A;  2IAI A;  4PXI A;  4D5C A;  2RAS A;  2WGB A;  5CW8 A;  5F08 A;  3G1O A;  4M3E A;  2YVX A;  2NP3 A;  3ZQL A;  3BR2 A;  2QKO A;  1Z77 A;  3DU5 A;  1SGM A;  3G7R A;  2REK A;  3BR5 A;  2DG8 A;  3VW1 A;  3E7Q A;  2HQ5 A;  3SDG A;  3CWR A;  2B1E A;  2V57 A;  5J3L A;  3VVZ A;  2HKU A;  3O8G A;  3TP3 A;  4I6Z A;  1JUS A;  2OF7 A;  3MNL A;  3NI7 A;  3WHB A;  2HYJ A;  4DVY P;  2R7O A;  2OPT A;  5K7Z A;  1RPW A;  2G7G A;  3BRU A;  4CGR A;  2QIB A;  3VVY A;  3V78 A;  4JL3 A;  3ZQF A;  3COL A;  5EZG A;  2HXO A;  5CQG A;  1A6I A;  5HSZ A;  3BQZ A;  5C4Y A;  3KNW A;  3BR1 A;  3NRG A;  3QQA A;  3QKX A;  3HTJ A;  3VIB A;  3O8H A;  2UXH A;  2QTQ A;  1T56 A;  2W53 A;  1QVT A;  3BTL A;  3CDL A;  5EYR A;  1ZKG A;  4KWA A;  5F1J A;  2XGC A;  2VKE A;  1JTX A;  4B1R A;  3ON4 A;  2R7V A;  4YZE A;  2VPR A;  2QWT A;  2JK3 A;  1BJZ A;  3JSJ A;  3DPJ A;  2UXI A;  3HE0 A;  2EH3 A;  2FD5 A;  2G7S A;  4G12 A;  3AQT A;  1UI6 A;  2D6Y A;  4HKU A;  5H9T A;  5F27 A;  5FHP A;  2R7W A;  3EUP A;  2PFV A;  5K7H A;  3RH2 A;  4ICH A;  2I10 A;  1JUP A;  3B6A A;  3NNR A;  4AUX A;  3B81 A;  4GFL A;  3HGG A;  3IUV A;  2RAE A;  4ME9 A;  2ZOZ A;  4M3B A;  3HIM A;  4D7M A;  4ABZ A;  2A2F X;  2JJ7 A;  2X9D A;  2IBD A;  2PBX A;  3HGY A;  3Q0W A;  4JKZ A;  2IU5 A;  5FKK A;  3G1M A;  5FKO A;  5IOZ A;  3ANP A;  2G3B A;  2R7Q A;  4GCT A;  2XB5 A;  2PZ9 A;  5F0C A;  1Z0X A;  2FJ1 A;  4V2F A;  3CCY A;  3NXC A;  3BTJ A;  2R7S A;  5J1Y A;  2NS7 A;  3BHQ A;  3RD3 A;  3AQS A;  3GZI A;  4JNN A;  3KKC A;  5CXG A;  2G7L A;  2Y30 A;  5GP9 A;  2XPW A;  3HTA A;  3ANG A;  4UDS A;  5GPC A;  5K58 A;  2OI8 A;  3P9T A;  4D7N A;  3HTH A;  2XGE A;  2ZCX A;  3NS4 A;  2R7X A;  5F0H A;  2ZY9 A;  3ZQG A;  2HXI A;  1ORK A;  3GEU A;  4GCK A;  5EFY A;  4U9N A;  2O7T A;  2ID6 A;  3VUQ A;  2GUH A;  4ACI A;  1QPI A;  5F04 A;  2X6O A;  5CXI A;  2ZCM A;  3FK7 A;  2ID3 A;  3VW0 A;  3CJD A;  3DCF A;  3G56 A;  2FQ4 A;  3TP0 A;  1VI0 A;  3PM1 A;  2XPU A;  2XGD A;  3VP5 A;  4NEL A;  2XPV A;  5HBU A;  4AF5 A;  2GFN A;  3LSP A;  3LOC A;  3V6G A;  3IH4 A;  5GPA A;  3O60 A;  4L62 A;  2NS8 A;  3WHC A;  1U9O A;  2G0E A;  5FGL A;  4OD4 A;  5D18 A;  4GFK A;  3BR0 A;  3HTI A;  2WUI A;  3FRQ A;  3VVX A;  2RHA A;  4MO7 A;  3C2B A;  4AC6 A;  3BR3 A;  3ZQH A;  2O7O A;  4AC0 A;  3KKD A;  4JYK A;  5J1R A;  3BTI A;  3KZ9 A;  3F1B A;  3CRJ A;  4GCL A;  3KYL A;  2DG7 A;  3QBM A;  3BJB A;  4M3F A;  2Y31 A;  3T6N A;  2TRT A;  2YVH A;  3BQY A;  2WV1 A;  5IP6 A;  3BTC A;  2GBY A;  3FK6 A;  3LJL A;  4M3G A;  4U9L A;  2FX0 A;  3VTI A; 
#chains in the Genus database with same CATH homology
 3BNI A;  4X1E A;  5DAJ A;  3SFI A;  4XK4 A;  3BCG A;  3G1L A;  5J1U A;  5IPA A;  5FMP A;  4B3A A;  2IEK A;  3Q3S A;  3S5R A;  2UXU A;  4V2G A;  3ON2 A;  2VKV A;  3LWJ A;  1UI5 A;  1QVU A;  1JT0 A;  5F0F A;  1U9N A;  4M3D A;  3EGQ A;  4I76 A;  2YVE A;  3Q0U A;  2QCO A;  3VOX A;  5D19 A;  2DTZ A;  1T33 A;  3C07 A;  4D5F A;  3VW2 A;  2TCT A;  3DEW A;  2F07 A;  3VPR A;  4W97 A;  4MXM A;  2UXP A;  5HAW A;  1JUM A;  3QPL A;  2ZOY A;  2GEN A;  5FKL A;  1ZK8 A;  3F0C A;  2HYT A;  2ZB9 A;  3B6C A;  3MVP A;  3BT9 A;  5FKN A;  5K7F A;  3VOK A;  1RKW A;  2ZCN A;  2Q24 A;  2XDN A;  3LSR A;  3BR6 A;  3ZQI A;  1JT6 A;  2XRL A;  3LSJ A;  5AQC A;  2Y2Z A;  1JTY A;  2NP5 A;  3Q0V A;  5D1R A;  4DW6 A;  4W1U A;  2FBQ A;  2NX4 A;  4MK6 A;  3NPI A;  2OER A;  3IH2 A;  2QOP A;  3FIW A;  4NN1 A;  3PAS A;  1RKT A;  5FKM A;  3QPS A;  2UXO A;  3IH3 A;  3PPB A;  3LHQ A;  5IOY A;  5EZH A;  2IAI A;  4PXI A;  4D5C A;  2RAS A;  2WGB A;  5CW8 A;  5F08 A;  3G1O A;  4M3E A;  2NP3 A;  3ZQL A;  3BR2 A;  2QKO A;  1Z77 A;  1SGM A;  3G7R A;  2REK A;  3BR5 A;  2DG8 A;  3VW1 A;  3E7Q A;  2HQ5 A;  3SDG A;  3CWR A;  5J3L A;  2V57 A;  3VVZ A;  2HKU A;  3O8G A;  3TP3 A;  4I6Z A;  1JUS A;  2OF7 A;  3MNL A;  3NI7 A;  3WHB A;  2HYJ A;  2OPT A;  5K7Z A;  1RPW A;  2G7G A;  3BRU A;  4CGR A;  2QIB A;  3VVY A;  3V78 A;  4JL3 A;  3ZQF A;  3COL A;  5EZG A;  2HXO A;  1A6I A;  5HSZ A;  3BQZ A;  5C4Y A;  3KNW A;  3BR1 A;  3NRG A;  3QQA A;  3QKX A;  3HTJ A;  3VIB A;  3O8H A;  2UXH A;  2QTQ A;  1T56 A;  2W53 A;  1QVT A;  3BTL A;  3CDL A;  5EYR A;  1ZKG A;  4KWA A;  5F1J A;  2XGC A;  2VKE A;  1JTX A;  4B1R A;  3ON4 A;  4YZE A;  2VPR A;  2QWT A;  2JK3 A;  1BJZ A;  3JSJ A;  3DPJ A;  2UXI A;  3HE0 A;  2EH3 A;  2FD5 A;  2G7S A;  4G12 A;  3AQT A;  1UI6 A;  2D6Y A;  4HKU A;  5H9T A;  5F27 A;  5FHP A;  3EUP A;  5K7H A;  3RH2 A;  4ICH A;  2I10 A;  1JUP A;  3B6A A;  3NNR A;  4AUX A;  3B81 A;  4GFL A;  3HGG A;  3IUV A;  2RAE A;  4ME9 A;  2ZOZ A;  4M3B A;  3HIM A;  4D7M A;  4ABZ A;  2JJ7 A;  2X9D A;  2IBD A;  2PBX A;  3HGY A;  3Q0W A;  4JKZ A;  2IU5 A;  5FKK A;  3G1M A;  5FKO A;  5IOZ A;  3ANP A;  2G3B A;  4GCT A;  2XB5 A;  2PZ9 A;  5F0C A;  1Z0X A;  2FJ1 A;  4V2F A;  3CCY A;  3NXC A;  3BTJ A;  5J1Y A;  2NS7 A;  3BHQ A;  3RD3 A;  3AQS A;  3GZI A;  4JNN A;  3KKC A;  5CXG A;  2G7L A;  2Y30 A;  5GP9 A;  2XPW A;  3HTA A;  3ANG A;  4UDS A;  5GPC A;  5K58 A;  2OI8 A;  4D7N A;  3P9T A;  3HTH A;  2XGE A;  2ZCX A;  5F0H A;  3ZQG A;  2HXI A;  1ORK A;  3GEU A;  4GCK A;  5EFY A;  2O7T A;  2ID6 A;  3VUQ A;  2GUH A;  4ACI A;  1QPI A;  5F04 A;  2X6O A;  5CXI A;  2ZCM A;  3FK7 A;  2ID3 A;  3VW0 A;  3CJD A;  3DCF A;  3G56 A;  2FQ4 A;  3TP0 A;  1VI0 A;  3PM1 A;  2XPU A;  2XGD A;  3VP5 A;  4NEL A;  2XPV A;  5HBU A;  4AF5 A;  2GFN A;  3LSP A;  3LOC A;  3V6G A;  3IH4 A;  5GPA A;  3O60 A;  4L62 A;  2NS8 A;  3WHC A;  1U9O A;  2G0E A;  5FGL A;  5D18 A;  4GFK A;  3BR0 A;  3HTI A;  2WUI A;  3FRQ A;  3VVX A;  2RHA A;  4MO7 A;  3C2B A;  4AC6 A;  3BR3 A;  3ZQH A;  2O7O A;  4AC0 A;  3KKD A;  4JYK A;  5J1R A;  3BTI A;  3KZ9 A;  3F1B A;  3CRJ A;  4GCL A;  2DG7 A;  3QBM A;  3BJB A;  4M3F A;  2Y31 A;  3T6N A;  2TRT A;  2YVH A;  3BQY A;  2WV1 A;  5IP6 A;  3BTC A;  2GBY A;  3FK6 A;  3LJL A;  4M3G A;  2FX0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...