4WIBA

Crystal structure of magnesium transporter mgte
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
178
structure length
178
Chain Sequence
LVYSEAGPVALWLARVRWLVILILTGMVTSSILQGFESVLEAVTALAFYVPVLLGTGGNTGNQSATLIIRALATRDLDLRDWRRVFLKEMGVGLLLGLTLSFLLVGKVYWDGHPLLLPVVGVSLVLIVFFANLVGAMLPFLLRRLGVDPALVSNPLVATLSDVTGLLIYLSVARLLLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Magnesium transporter MgtE
publication title Structural basis for ion selectivity revealed by high-resolution crystal structure of Mg(2+) channel MgtE
pubmed doi rcsb
source organism Thermus thermophilus hb8
molecule tags Metal transport
total genus 64
structure length 178
sequence length 178
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01769 MgtE Divalent cation transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.20 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 SLC41 divalent cation transporters, integral membrane domain 4wibA00
4WIBA 4U9LA 2ZY9A 2YVXA 4U9NA
chains in the Genus database with same CATH superfamily
2R7SA 3GEUA 3DPJA 2DG7A 1U9OA 4U9NA 2R7RA 1JTYA 2ZY9A 2IU5A 3VIBA 2GFNA 3LHQA 3KZ9A 3Q0WA 3DU6A 3NNRA 1JT0A 2QKOA 3G1OA 3QKXA 4NN1A 5H9TA 2NS7A 3VOXA 5FKOA 1JUSA 5F27A 2XGCA 1T56A 3EGQA 2PZ9A 2VPRA 2JJ7A 2FBQA 3G7RA 3ZQFA 4CGRA 3DCFA 3HGGA 3KYLA 2XGEA 5J1RA 2B3WA 5FHPA 1Z77A 3BR0A 5FGLA 5K58A 2ZCXA 5EYRA 2XDNA 3IH4A 3LSPA 1JUPA 3PPBA 3G56A 2ZCNA 4D7MA 3BJBA 1RPWA 5FKLA 2O7OA 2ID3A 5GPAA 1SGMA 4M3FA 3VP5A 3HTJA 1RKTA 3IH3A 2HKUA 5FKMA 2ZOZA 3KKCA 3NS4A 2HYJA 2UXIA 4B1RA 3JSJA 3SFIA 3RD3A 4B3AA 5EZGA 3QPSA 4D7NA 3VVZA 3HTIA 4D5FA 4YZEA 3BRUA 3SWHA 2XPUA 4W1UA 1QVUA 3VW2A 3HGYA 5CXIA 4JL3A 2WV1A 1UI5A 2NX4A 1JUMA 2OERA 2YVXA 3MNLA 4L62A 2FQ4A 1VI0A 2QCOA 4MO7A 4W97A 2RHAA 3HE0A 4U9LA 4OD4A 4GFKA 2PFVA 2RASA 5IPAA 2R7OA 3B6AA 4M3GA 5IP6A 2OPTA 2I10A 2WUIA 3O8HA 5J3LA 2V57A 4V2FA 4M3BA 2QOPA 3VW0A 4HKUA 4MXMA 1ZKGA 3ZQIA 2Y2ZA 5DAJA 3TP0A 2G7LA 5CQGA 2ZCMA 2ZB9A 3NXCA 4KWAA 5J1UA 3FIWA 3ZQLA 5HSZA 3O8GA 4GCLA 3NRGA 5D19A 3LSRA 3NI7A 2G3BA 4I76A 3ANGA 3NPIA 4JNNA 1BJZA 3VVXA 4MK6A 3VVYA 3G1MA 3HTAA 2FX0A 4AF5A 1ORKA 1QVTA 2FD5A 3EUPA 2G0EA 4DVYP 5EZHA 4ME9A 3ZQGA 3ON4A 3C2BA 2OF7A 1Z0XA 5F0CA 5J1YA 4IRVA 2DTZA 3VOKA 3C07A 5D18A 3K8PC 3RH2A 2GBYA 4AC0A 5K7FA 3VTIA 2FJI1 1UI6A 4ICHA 4GCKA 3B6CA 1A6IA 3CCYA 4C2MA 2D6YA 4V2GA 3BR5A 2XPWA 3WHCA 2R7UA 3DEWA 2UXOA 2YVHA 2NP3A 3BTLA 5FKKA 3G1LA 3QPLA 2TCTA 5FMPA 3B81A 1QPIA 3HTHA 2GUHA 3LSJA 2R7WA 2DG8A 4X1EA 2EH3A 3BTJA 5GPCA 3KKDA 2UXPA 3QBMA 3TP3A 3Q3SA 3F0CA 5F0FA 3ANPA 3KNWA 3BQZA 2OI8A 5D1RA 3WHBA 4JKZA 2REKA 2ZOYA 2R7QA 3AQSA 2ID6A 2W53A 3FK7A 3BR3A 3AQTA 4D5CA 3BTIA 5EFYA 2NS8A 3BR1A 4I6ZA 5HAWA 2XPVA 4WIBA 3IUVA 2X6OA 2F07A 2Q24A 2G7GA 2JK3A 4NELA 1U9NA 2A2FX 3LWJA 3BR2A 3VPRA 3COLA 3E7QA 4PXIA 3BHQA 4GCTA 2HYTA 4M3EA 5FKNA 2XB5A 2O7TA 2RAEA 5GP9A 5F0HA 2R7TA 4M3DA 5F1JA 3V78A 3MVPA 2IEKA 2R7VA 3DU5A 4DW6A 1ZK8A 3BTCA 3SDGA 5K7HA 3LOCA 2QTQA 3F1BA 2Y30A 2HXIA 3QQAA 3BQYA 2X9DA 3BT9A 3PASA 2QIBA 3FRQA 4AUXA 3BR6A 3PM1A 2XRLA 4JYKA 2HQ5A 3CRJA 3O60A 2HXOA 3FK6A 1JTXA 3BNIA 4AC6A 1T33A 2G7SA 5F08A 5C4YA 1RKWA 3GZIA 4XK4A 2UXUA 2TRTA 4G12A 3LJLA 3P9TA 2R7XA 2B1EA 2VKEA 3IH2A 2NP5A 1JT6A 3VW1A 2YVEA 2GENA 2QWTA 2XGDA 5CXGA 2IBDA 2FJ1A 3CDLA 3HIMA 5IOZA 5CW8A 4UDSA 3T6NA 3VUQA 3CWRA 5K7ZA 3S5RA 2WGBA 3V6GA 2PBXA 4OD5A 5IOYA 3FHNA 3CJDA 3ON2A 2VKVA 3Q0UA 4ACIA 2UXHA 4GFLA 3BCGA 3Q0VA 3ZQHA 2IAIA 5F04A 2Y31A 5AQCA 4ABZA 5HBUA
chains in the Genus database with same CATH topology
4WIBA 4U9LA 2ZY9A 2YVXA 4U9NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WIB A;  4U9L A;  2ZY9 A;  2YVX A;  4U9N A; 
#chains in the Genus database with same CATH topology
 2R7S A;  3GEU A;  3DPJ A;  2DG7 A;  1U9O A;  4U9N A;  2R7R A;  1JTY A;  2ZY9 A;  2IU5 A;  3VIB A;  2GFN A;  3LHQ A;  3KZ9 A;  3Q0W A;  3DU6 A;  3NNR A;  1JT0 A;  2QKO A;  3G1O A;  3QKX A;  4NN1 A;  5H9T A;  2NS7 A;  3VOX A;  5FKO A;  1JUS A;  5F27 A;  2XGC A;  1T56 A;  3EGQ A;  2PZ9 A;  2VPR A;  2JJ7 A;  2FBQ A;  3G7R A;  3ZQF A;  4CGR A;  3DCF A;  3HGG A;  3KYL A;  2XGE A;  5J1R A;  2B3W A;  5FHP A;  1Z77 A;  3BR0 A;  5FGL A;  5K58 A;  2ZCX A;  5EYR A;  2XDN A;  3IH4 A;  3LSP A;  1JUP A;  3PPB A;  3G56 A;  2ZCN A;  4D7M A;  3BJB A;  1RPW A;  5FKL A;  2O7O A;  2ID3 A;  5GPA A;  1SGM A;  4M3F A;  3VP5 A;  3HTJ A;  1RKT A;  3IH3 A;  2HKU A;  5FKM A;  2ZOZ A;  3KKC A;  3NS4 A;  2HYJ A;  2UXI A;  4B1R A;  3JSJ A;  3SFI A;  3RD3 A;  4B3A A;  5EZG A;  3QPS A;  4D7N A;  3VVZ A;  3HTI A;  4D5F A;  4YZE A;  3BRU A;  3SWH A;  2XPU A;  4W1U A;  1QVU A;  3VW2 A;  3HGY A;  5CXI A;  4JL3 A;  2WV1 A;  1UI5 A;  2NX4 A;  1JUM A;  2OER A;  2YVX A;  3MNL A;  4L62 A;  2FQ4 A;  1VI0 A;  2QCO A;  4MO7 A;  4W97 A;  2RHA A;  3HE0 A;  4U9L A;  4OD4 A;  4GFK A;  2PFV A;  2RAS A;  5IPA A;  2R7O A;  3B6A A;  4M3G A;  5IP6 A;  2OPT A;  2I10 A;  2WUI A;  3O8H A;  5J3L A;  2V57 A;  4V2F A;  4M3B A;  2QOP A;  3VW0 A;  4HKU A;  4MXM A;  1ZKG A;  3ZQI A;  2Y2Z A;  5DAJ A;  3TP0 A;  2G7L A;  5CQG A;  2ZCM A;  2ZB9 A;  3NXC A;  4KWA A;  5J1U A;  3FIW A;  3ZQL A;  5HSZ A;  3O8G A;  4GCL A;  3NRG A;  5D19 A;  3LSR A;  3NI7 A;  2G3B A;  4I76 A;  3ANG A;  3NPI A;  4JNN A;  1BJZ A;  3VVX A;  4MK6 A;  3VVY A;  3G1M A;  3HTA A;  2FX0 A;  4AF5 A;  1ORK A;  1QVT A;  2FD5 A;  3EUP A;  2G0E A;  4DVY P;  5EZH A;  4ME9 A;  3ZQG A;  3ON4 A;  3C2B A;  2OF7 A;  1Z0X A;  5F0C A;  5J1Y A;  4IRV A;  2DTZ A;  3VOK A;  3C07 A;  5D18 A;  3K8P C;  3RH2 A;  2GBY A;  4AC0 A;  5K7F A;  3VTI A;  2FJI 1;  1UI6 A;  4ICH A;  4GCK A;  3B6C A;  1A6I A;  3CCY A;  4C2M A;  2D6Y A;  4V2G A;  3BR5 A;  2XPW A;  3WHC A;  2R7U A;  3DEW A;  2UXO A;  2YVH A;  2NP3 A;  3BTL A;  5FKK A;  3G1L A;  3QPL A;  2TCT A;  5FMP A;  3B81 A;  1QPI A;  3HTH A;  2GUH A;  3LSJ A;  2R7W A;  2DG8 A;  4X1E A;  2EH3 A;  3BTJ A;  5GPC A;  3KKD A;  2UXP A;  3QBM A;  3TP3 A;  3Q3S A;  3F0C A;  5F0F A;  3ANP A;  3KNW A;  3BQZ A;  2OI8 A;  5D1R A;  3WHB A;  4JKZ A;  2REK A;  2ZOY A;  2R7Q A;  3AQS A;  2ID6 A;  2W53 A;  3FK7 A;  3BR3 A;  3AQT A;  4D5C A;  3BTI A;  5EFY A;  2NS8 A;  3BR1 A;  4I6Z A;  5HAW A;  2XPV A;  4WIB A;  3IUV A;  2X6O A;  2F07 A;  2Q24 A;  2G7G A;  2JK3 A;  4NEL A;  1U9N A;  2A2F X;  3LWJ A;  3BR2 A;  3VPR A;  3COL A;  3E7Q A;  4PXI A;  3BHQ A;  4GCT A;  2HYT A;  4M3E A;  5FKN A;  2XB5 A;  2O7T A;  2RAE A;  5GP9 A;  5F0H A;  2R7T A;  4M3D A;  5F1J A;  3V78 A;  3MVP A;  2IEK A;  2R7V A;  3DU5 A;  4DW6 A;  1ZK8 A;  3BTC A;  3SDG A;  5K7H A;  3LOC A;  2QTQ A;  3F1B A;  2Y30 A;  2HXI A;  3QQA A;  3BQY A;  2X9D A;  3BT9 A;  3PAS A;  2QIB A;  3FRQ A;  4AUX A;  3BR6 A;  3PM1 A;  2XRL A;  4JYK A;  2HQ5 A;  3CRJ A;  3O60 A;  2HXO A;  3FK6 A;  1JTX A;  3BNI A;  4AC6 A;  1T33 A;  2G7S A;  5F08 A;  5C4Y A;  1RKW A;  3GZI A;  4XK4 A;  2UXU A;  2TRT A;  4G12 A;  3LJL A;  3P9T A;  2R7X A;  2B1E A;  2VKE A;  3IH2 A;  2NP5 A;  1JT6 A;  3VW1 A;  2YVE A;  2GEN A;  2QWT A;  2XGD A;  5CXG A;  2IBD A;  2FJ1 A;  3CDL A;  3HIM A;  5IOZ A;  5CW8 A;  4UDS A;  3T6N A;  3VUQ A;  3CWR A;  5K7Z A;  3S5R A;  2WGB A;  3V6G A;  2PBX A;  4OD5 A;  5IOY A;  3FHN A;  3CJD A;  3ON2 A;  2VKV A;  3Q0U A;  4ACI A;  2UXH A;  4GFL A;  3BCG A;  3Q0V A;  3ZQH A;  2IAI A;  5F04 A;  2Y31 A;  5AQC A;  4ABZ A;  5HBU A; 
#chains in the Genus database with same CATH homology
 4WIB A;  4U9L A;  2ZY9 A;  2YVX A;  4U9N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...