4WIBA

Crystal structure of magnesium transporter mgte
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
178
structure length
178
Chain Sequence
LVYSEAGPVALWLARVRWLVILILTGMVTSSILQGFESVLEAVTALAFYVPVLLGTGGNTGNQSATLIIRALATRDLDLRDWRRVFLKEMGVGLLLGLTLSFLLVGKVYWDGHPLLLPVVGVSLVLIVFFANLVGAMLPFLLRRLGVDPALVSNPLVATLSDVTGLLIYLSVARLLLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Metal transport
molecule keywords Magnesium transporter MgtE
publication title Structural basis for ion selectivity revealed by high-resolution crystal structure of Mg(2+) channel MgtE
pubmed doi rcsb
source organism Thermus thermophilus hb8
total genus 64
structure length 178
sequence length 178
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01769 MgtE Divalent cation transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.20 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 SLC41 divalent cation transporters, integral membrane domain 4wibA00
2ZY9A 4WIBA 4U9LA 4U9NA 2YVXA
chains in the Genus database with same CATH superfamily
2QTQA 3BTIA 3HGYA 3B81A 5IP6A 5DAJA 3BR5A 3DEWA 2FJI1 4M3FA 3V6GA 3VTIA 3TP0A 5J3LA 3QPSA 3VOXA 2HXIA 5HAWA 3CCYA 1UI5A 3O8HA 2FD5A 3BHQA 3SFIA 5K7HA 3QPLA 4G12A 2FQ4A 3FIWA 3VUQA 2PBXA 4UDSA 2R7OA 2UXIA 1Z77A 2FBQA 3VIBA 3P9TA 4AC0A 4DVYP 1A6IA 3NPIA 2DG7A 4JL3A 3IH2A 5FKLA 4D7MA 2WGBA 2NS8A 3KKCA 4ABZA 3BR2A 3BNIA 5HSZA 4XK4A 3F0CA 2R7UA 4GCTA 4X1EA 1SGMA 3Q3SA 5GPCA 3GZIA 1JT6A 3O8GA 2NP3A 3IH3A 1JUPA 5FHPA 3B6CA 4JYKA 3HE0A 2QKOA 5F04A 2XDNA 3GEUA 5IOYA 5IOZA 2IEKA 3BQZA 2Q24A 3VW1A 3G1LA 2G3BA 2OI8A 2XGEA 3BR3A 2IAIA 3RH2A 3NXCA 4GFKA 1JT0A 4MXMA 3LWJA 5FKNA 3DCFA 4D7NA 3WHCA 3ZQLA 2GUHA 5FKMA 4JKZA 3G56A 2G0EA 5CXGA 1RKWA 2GFNA 4M3BA 2OERA 5GP9A 2YVHA 2R7SA 2ZCNA 2HQ5A 1JTXA 3BTLA 3CRJA 3HIMA 2Y31A 4MK6A 2YVXA 2JJ7A 5IPAA 3F1BA 4CGRA 1QVTA 2JK3A 2QWTA 4W1UA 2ZOYA 1VI0A 3BTCA 4PXIA 2XGDA 2B3WA 2TCTA 2UXUA 2ID3A 1U9OA 2ID6A 3ON2A 2D6YA 1T56A 5J1RA 3QQAA 2HXOA 5F08A 2UXHA 3BR1A 3BRUA 5F27A 5D1RA 3KYLA 2RHAA 4AF5A 2XPVA 3FK7A 2O7OA 2RAEA 2PFVA 3CJDA 5CXIA 2F07A 5GPAA 5EFYA 4JNNA 2Y2ZA 4ICHA 2HKUA 2GBYA 2IBDA 2NS7A 3C07A 3PPBA 2V57A 1RKTA 4YZEA 1ZKGA 3FRQA 3BCGA 4U9LA 3CDLA 2R7WA 3SDGA 3BTJA 2VKVA 3MNLA 2DG8A 3T6NA 2QOPA 3COLA 2FJ1A 2TRTA 3C2BA 4L62A 4WIBA 5AQCA 2ZCMA 2O7TA 3DU6A 3HGGA 3O60A 2WUIA 4ACIA 3CWRA 3FK6A 3K8PC 3BR0A 5K7ZA 5EZGA 3JSJA 4M3EA 4MO7A 2G7SA 5FGLA 4M3DA 3VP5A 4KWAA 3Q0VA 3G7RA 3LJLA 4OD5A 4OD4A 4C2MA 4D5CA 2ZY9A 2QCOA 5FKOA 2IU5A 2W53A 2R7QA 1JTYA 2XRLA 2X9DA 4D5FA 2UXOA 3VW0A 1UI6A 5CW8A 1JUSA 2REKA 3AQSA 5EZHA 3KNWA 2R7RA 5D18A 3AQTA 4V2GA 2EH3A 3VOKA 5CQGA 3ON4A 2OPTA 2XPWA 3LOCA 5F0FA 3NS4A 3G1MA 5H9TA 2YVEA 4V2FA 2X6OA 3ZQFA 5C4YA 3IUVA 3EGQA 3TP3A 5FMPA 4I6ZA 3KKDA 4I76A 3Q0WA 3BT9A 3SWHA 1BJZA 3BQYA 3DU5A 5HBUA 3PM1A 2VKEA 3FHNA 2B1EA 3ANPA 5J1UA 2G7GA 3NRGA 3NI7A 1QPIA 3QBMA 3VVZA 2VPRA 5D19A 2I10A 5F0CA 3ANGA 2UXPA 2GENA 3LHQA 3Q0UA 2XGCA 4W97A 5F1JA 1QVUA 4GCLA 2R7TA 4U9NA 1RPWA 2R7VA 2XB5A 5F0HA 5K7FA 4B1RA 5J1YA 2G7LA 5FKKA 3IH4A 4HKUA 4B3AA 3EUPA 4AC6A 3V78A 3VPRA 3QKXA 3VVYA 3HTAA 2PZ9A 3BJBA 3S5RA 3WHBA 2R7XA 3BR6A 2OF7A 4ME9A 3LSJA 2Y30A 4DW6A 2HYJA 3LSPA 3HTIA 2ZOZA 4IRVA 3B6AA 4GFLA 1Z0XA 3VVXA 4NN1A 2DTZA 3ZQGA 3RD3A 3ZQIA 1ORKA 1ZK8A 2ZB9A 3HTHA 2RASA 5EYRA 2A2FX 3PASA 3HTJA 2HYTA 4M3GA 3LSRA 4GCKA 2ZCXA 2NP5A 1T33A 2NX4A 3DPJA 2QIBA 3E7QA 3MVPA 3KZ9A 5K58A 3VW2A 2FX0A 3G1OA 4AUXA 2XPUA 1U9NA 3ZQHA 1JUMA 4NELA 2WV1A 3NNRA
chains in the Genus database with same CATH topology
2ZY9A 4WIBA 4U9LA 4U9NA 2YVXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZY9 A;  4WIB A;  4U9L A;  4U9N A;  2YVX A; 
#chains in the Genus database with same CATH topology
 2QTQ A;  3BTI A;  3HGY A;  3B81 A;  5IP6 A;  5DAJ A;  3BR5 A;  3DEW A;  2FJI 1;  4M3F A;  3V6G A;  3VTI A;  3TP0 A;  5J3L A;  3QPS A;  3VOX A;  2HXI A;  5HAW A;  3CCY A;  1UI5 A;  3O8H A;  2FD5 A;  3BHQ A;  3SFI A;  5K7H A;  3QPL A;  4G12 A;  2FQ4 A;  3FIW A;  3VUQ A;  2PBX A;  4UDS A;  2R7O A;  2UXI A;  1Z77 A;  2FBQ A;  3VIB A;  3P9T A;  4AC0 A;  4DVY P;  1A6I A;  3NPI A;  2DG7 A;  4JL3 A;  3IH2 A;  5FKL A;  4D7M A;  2WGB A;  2NS8 A;  3KKC A;  4ABZ A;  3BR2 A;  3BNI A;  5HSZ A;  4XK4 A;  3F0C A;  2R7U A;  4GCT A;  4X1E A;  1SGM A;  3Q3S A;  5GPC A;  3GZI A;  1JT6 A;  3O8G A;  2NP3 A;  3IH3 A;  1JUP A;  5FHP A;  3B6C A;  4JYK A;  3HE0 A;  2QKO A;  5F04 A;  2XDN A;  3GEU A;  5IOY A;  5IOZ A;  2IEK A;  3BQZ A;  2Q24 A;  3VW1 A;  3G1L A;  2G3B A;  2OI8 A;  2XGE A;  3BR3 A;  2IAI A;  3RH2 A;  3NXC A;  4GFK A;  1JT0 A;  4MXM A;  3LWJ A;  5FKN A;  3DCF A;  4D7N A;  3WHC A;  3ZQL A;  2GUH A;  5FKM A;  4JKZ A;  3G56 A;  2G0E A;  5CXG A;  1RKW A;  2GFN A;  4M3B A;  2OER A;  5GP9 A;  2YVH A;  2R7S A;  2ZCN A;  2HQ5 A;  1JTX A;  3BTL A;  3CRJ A;  3HIM A;  2Y31 A;  4MK6 A;  2YVX A;  2JJ7 A;  5IPA A;  3F1B A;  4CGR A;  1QVT A;  2JK3 A;  2QWT A;  4W1U A;  2ZOY A;  1VI0 A;  3BTC A;  4PXI A;  2XGD A;  2B3W A;  2TCT A;  2UXU A;  2ID3 A;  1U9O A;  2ID6 A;  3ON2 A;  2D6Y A;  1T56 A;  5J1R A;  3QQA A;  2HXO A;  5F08 A;  2UXH A;  3BR1 A;  3BRU A;  5F27 A;  5D1R A;  3KYL A;  2RHA A;  4AF5 A;  2XPV A;  3FK7 A;  2O7O A;  2RAE A;  2PFV A;  3CJD A;  5CXI A;  2F07 A;  5GPA A;  5EFY A;  4JNN A;  2Y2Z A;  4ICH A;  2HKU A;  2GBY A;  2IBD A;  2NS7 A;  3C07 A;  3PPB A;  2V57 A;  1RKT A;  4YZE A;  1ZKG A;  3FRQ A;  3BCG A;  4U9L A;  3CDL A;  2R7W A;  3SDG A;  3BTJ A;  2VKV A;  3MNL A;  2DG8 A;  3T6N A;  2QOP A;  3COL A;  2FJ1 A;  2TRT A;  3C2B A;  4L62 A;  4WIB A;  5AQC A;  2ZCM A;  2O7T A;  3DU6 A;  3HGG A;  3O60 A;  2WUI A;  4ACI A;  3CWR A;  3FK6 A;  3K8P C;  3BR0 A;  5K7Z A;  5EZG A;  3JSJ A;  4M3E A;  4MO7 A;  2G7S A;  5FGL A;  4M3D A;  3VP5 A;  4KWA A;  3Q0V A;  3G7R A;  3LJL A;  4OD5 A;  4OD4 A;  4C2M A;  4D5C A;  2ZY9 A;  2QCO A;  5FKO A;  2IU5 A;  2W53 A;  2R7Q A;  1JTY A;  2XRL A;  2X9D A;  4D5F A;  2UXO A;  3VW0 A;  1UI6 A;  5CW8 A;  1JUS A;  2REK A;  3AQS A;  5EZH A;  3KNW A;  2R7R A;  5D18 A;  3AQT A;  4V2G A;  2EH3 A;  3VOK A;  5CQG A;  3ON4 A;  2OPT A;  2XPW A;  3LOC A;  5F0F A;  3NS4 A;  3G1M A;  5H9T A;  2YVE A;  4V2F A;  2X6O A;  3ZQF A;  5C4Y A;  3IUV A;  3EGQ A;  3TP3 A;  5FMP A;  4I6Z A;  3KKD A;  4I76 A;  3Q0W A;  3BT9 A;  3SWH A;  1BJZ A;  3BQY A;  3DU5 A;  5HBU A;  3PM1 A;  2VKE A;  3FHN A;  2B1E A;  3ANP A;  5J1U A;  2G7G A;  3NRG A;  3NI7 A;  1QPI A;  3QBM A;  3VVZ A;  2VPR A;  5D19 A;  2I10 A;  5F0C A;  3ANG A;  2UXP A;  2GEN A;  3LHQ A;  3Q0U A;  2XGC A;  4W97 A;  5F1J A;  1QVU A;  4GCL A;  2R7T A;  4U9N A;  1RPW A;  2R7V A;  2XB5 A;  5F0H A;  5K7F A;  4B1R A;  5J1Y A;  2G7L A;  5FKK A;  3IH4 A;  4HKU A;  4B3A A;  3EUP A;  4AC6 A;  3V78 A;  3VPR A;  3QKX A;  3VVY A;  3HTA A;  2PZ9 A;  3BJB A;  3S5R A;  3WHB A;  2R7X A;  3BR6 A;  2OF7 A;  4ME9 A;  3LSJ A;  2Y30 A;  4DW6 A;  2HYJ A;  3LSP A;  3HTI A;  2ZOZ A;  4IRV A;  3B6A A;  4GFL A;  1Z0X A;  3VVX A;  4NN1 A;  2DTZ A;  3ZQG A;  3RD3 A;  3ZQI A;  1ORK A;  1ZK8 A;  2ZB9 A;  3HTH A;  2RAS A;  5EYR A;  2A2F X;  3PAS A;  3HTJ A;  2HYT A;  4M3G A;  3LSR A;  4GCK A;  2ZCX A;  2NP5 A;  1T33 A;  2NX4 A;  3DPJ A;  2QIB A;  3E7Q A;  3MVP A;  3KZ9 A;  5K58 A;  3VW2 A;  2FX0 A;  3G1O A;  4AUX A;  2XPU A;  1U9N A;  3ZQH A;  1JUM A;  4NEL A;  2WV1 A;  3NNR A; 
#chains in the Genus database with same CATH homology
 2ZY9 A;  4WIB A;  4U9L A;  4U9N A;  2YVX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...