3BR6A

Crystal structure of the complex of rhodamine 6g bound to qacr(e120q), a mutant of a multidrug binding transcriptional repressor
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
186
structure length
185
Chain Sequence
b'NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKSEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYTNSINEKMNKLQNKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator qacR
publication title Formal electrostatic interactions do not govern QacR-cation affinity
rcsb
source organism Staphylococcus aureus
molecule tags Transcription
total genus 72
structure length 185
sequence length 186
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2007-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3br6A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3br6A02
4A3MJ 4UDSA 3LWJA 3S5RA 3BG5A 3MKLA 1OFCX 2XGEA 3VIBA 2NVQJ 2R5YA 4JX4A 1RR7A 2Y9YA 5FKNA 5EZGA 2LR8A 2M8GX 3A03A 4Y7NJ 2X9DA 3NRGA 3GZIA 1GDTA 1POGA 1TC3C 3PO2J 3B6CA 2LP0A 3HTHA 3JRHA 3JRCA 2O9LA 3TW7A 2LFBA 1AKHA 3RZDJ 2Q24A 4NN1A 1ZR2A 3HEFA 3VPRA 2ME6A 4A3GJ 2DG8A 3S1QJ 3GTGJ 2LKXA 2M0CA 5K7HA 4UUTA 2NS7A 4JX5A 1JTXA 2JMWA 2EZHA 5FKLA 2HI3A 3RD3A 2G0EA 4IHWA 3LOCA 4GCLA 3BQZA 3V6GA 5M5YJ 3UKGA 2ID3A 1UMQA 4JX6A 1T56A 4CYCA 1VFCA 5FGLA 1WI3A 1I50J 2M9HA 3JRFA 2OF7A 1BA5A 5IP7J 1YRNA 1H88C 1LFBA 2AO9A 1NTCA 4D7MA 2G7LA 3PM1A 3G7RA 2MG4A 1JT6A 4A3FJ 4V2FA 3SJMA 5FKMA 3HKZN 2VPRA 3BTIA 1JGGA 3HE0A 2XGDA 1FEXA 1JKOC 1RETA 3BRUA 1TWCJ 1X2MA 3WHCA 4CYCB 3IUVA 1ZK8A 3VVXA 1B8IA 3JSJA 2FX0A 4G12A 2XB5A 4A93J 2L7FP 2IEKA 4FISA 5F27A 2YUSA 4UUSB 3GTPJ 1MSFC 2ELKA 3HOYJ 1RKTA 4ME9A 5J1YA 3FK7A 3HGYA 3S14J 1FIPA 4J19A 2DMUA 5HODA 1B8IB 2GUHA 2LK2A 4XRSA 5EG0B 5D19A 2CRGA 2P81A 3S16J 2REKA 3K7AJ 2DJNA 1VI0A 2QIBA 2E2IJ 4GFBA 2YVHA 3RZOJ 3JRDA 1ETWA 2LD5A 2UXIA 1Z77A 1LFUP 4JNNA 3IV5A 5K58A 1U8BA 2X6OA 2CJJA 3BTCA 5D1RA 1Q1VA 1QRYA 1HDDC 1BJZA 1JUSA 1W0TA 4C3HJ 3B81A 4W97A 2NS8A 5CXIA 1JTYA 2KDZA 5FHPA 2DA7A 1ETYA 3JRIA 1HLVA 2XB0X 4IHVA 2R92J 5EF6A 4MK6A 2H1KA 4LOCA 4M3EA 1UI5A 3IH2A 1B72A 3JRAA 2RHAA 3NPIA 3BG3A 3QPLA 4IEJA 2UXOA 3I4MJ 1TWFJ 2HOTA 3VW2A 5F08A 3LSPA 2G7GA 5EYRA 1H8AC 4A3CJ 2W53A 3HDDA 3PPBA 2EH3A 4C2MJ 5GPCA 3HB9A 2NOGA 2I10A 5FJ8J 3PASA 1IJWC 3Q0UA 2Y9ZA 2NP3A 3Q0WA 4M3DA 4MIMA 3VOXA 2K40A 2R0QC 5C44J 5IYDJ 4HNVA 3C07A 1TWAJ 5FKOA 1JUMA 2K9NA 2WAQN 2MGQA 2FD5A 3TEDA 4X6AJ 3A01B 5JLXA 4L5EA 1EF4A 3KKCA 1JKQC 3T6NA 2K9QA 1FJLA 1AU7A 1MH3A 3MNLA 1BL0A 2OI8A 1MBHA 1SFOJ 1MBJA 2DA3A 4X1EA 3BTJA 1ETXA 3G56A 3P9TA 3VW1A 5FLVA 2VI6A 3GBGA 1U9OA 3BNIA 2DA6A 4C3JJ 3QKXA 2HXIA 3HOVJ 3D1NI 1I6HJ 3GTJJ 1IDYA 2E2HJ 3Q0VA 4A3BJ 1MNMC 3S17J 2HYTA 2NVTJ 2GBYA 1LE8B 3LSRA 3GTLJ 3M3YJ 3DEWA 4JYKA 5C4XJ 3BR6A 1MSEC 1IG7A 1ZTRA 4DZPA 2JN6A 1OCPA 3QBMA 2E1OA 3BR1A 2E2JJ 1BW5A 4BY7J 2QOPA 3ZQIA 3W6VA 1XG1A 2DN0A 3NARA 3S1NJ 2HDDA 1TWGJ 1MBGA 4DYRA 2R93J 3LSGA 5EGOB 2O8KA 4DYCA 5FLMJ 4UUSA 3S1RJ 2D6YA 2TRTA 5M5WJ 2HOAA 4GFKA 4BXXJ 2HKUA 1UHSA 2EZKA 4A3IJ 1DU6A 1ETVA 1WGXA 2WB1N 1F43A 4B4CA 1MBEA 2JA7J 5M3MJ 3HGGA 5JLWA 1DU0A 2DMPA 2Y31A 4MFDA 4D7NA 5DS9A 5EZHA 5EG0A 1PUFA 3DPJA 3EGQA 1MH4A 1S7EA 5IOYA 2R5ZB 3I4NJ 5IP9J 5CW8A 4AC6A 2FJ1A 1JT0A 1P7JA 4IHXA 1T33A 4PXIA 2NX4A 2ECBA 5IYCJ 5E3OA 2QWTA 3NNRA 5E3LA 1IUFA 2H8RA 3CWRA 2EQRA 2D5VA 3FISA 2TCTA 1PUFB 2ZCMA 4A3KJ 3CQZJ 3IH3A 1QPIA 2O7TA 2WUIA 5GP9A 3F0CA 1ETOA 1H89C 3BR2A 1OJLA 2AHQA 3CJDA 1X58A 1FIAA 4BKXA 2CQXA 2L0KA 1XS9A 1HF0A 2DG7A 2VKEA 4NELA 3TP3A 1XC5A 2N8GA 4QIWN 1O4XA 2XSDC 3IH4A 3HIMA 5EFYA 3O8HA 4JL3A 5IOZA 1P7IA 2XRLA 3BT9A 5GPAA 2JA6J 4IHYA 5F0FA 1APLC 2QKOA 2CUEA 4AYBN 2UXPA 3BJBA 3ZOBA 3HTIA 4MLOA 4XRSG 3KZ9A 3ON4A 3VUQA 3M4OJ 4S0HB 1HOMA 4FCYA 4AF5A 2DMNA 5HBUA 2ZCXA 2YU9J 3HTAA 1FTZA 1JJ8C 1K83J 2XPWA 3FKIJ 2G3BA 3E7QA 2B63J 3GTOJ 4B3AA 5J1UA 2UXUA 3NXCA 4NDLA 3S2HJ 5AQCA 1BW6A 3HBLA 3FIWA 4YZEA 2PMZN 2PZ9A 4DW6A 3S15J 1ITYA 1IC8A 2CU7A 2LTPA 1JJ6C 5IP6A 3GTQJ 3A01A 3ANGA 1MBKA 3BR0A 1ZKGA 3NAUA 1MBFA 2VKVA 2GFNA 3JREA 3VW0A 2ZB9A 3OIOA 4Y52J 3KNWA 3FK6A 3RH2A 3ZQGA 4C3IJ 1JUPA 1IV6A 3HTJA 3OOUA 3LNQA 1WCMJ 1U78A 2K9SA 5J1RA 3C2BA 2GLOA 1ZR4A 3ANPA 1GUUA 2ID6A 4I6ZA 1ZGWA 2M2EA 4ABZA 4A3LJ 2JWTA 3HOXJ 2ZCNA 3GTMJ 1LE8A 3L1PA 4L62A 3H3VK 1E3OC 5F0HA 4KWAA 4BY1J 3ZQFA 2NVXJ 1VF9A 2ME0A 2V57A 3LJLA 1WH5A 4JKZA 1ETQA 2WGBA 2DA1A 1U9NA 4GCKA 4GCTA 4QTRA 2COBA 4XICA 5EGOA 1ETKA 1UG2A 4RDUA 2WV1A 1ORKA 2IBDA 1GV2A 2HYJA 5DAJA 2RAEA 3CDLA 4GFLA 2JA8J 3S1MJ 3AQSA 5E3MA 2CUFA 1K61A 3H0GJ 3SFIA 4DZJA 3HOWJ 2DA4A 2JK3A 4MFEA 3KKDA 3HM5A 2GENA 4B1RA 2R5ZA 1HDPA 3HOUJ 2L9RA 3K2AA 3QPSA 1SGMA 2W48A 3BQYA 2R5YB 1NK3P 2JA5J 5EEAA 2O7OA 1ENHA 3EUPA 3OSGA 2KT0A 2Y2ZA 4W1UA 1NK2P 3COLA 3RQIA 1X2NA 3JR9A 5E3NA 1IDZA 3O8GA 2DA5A 2NVYJ 2IAIA 3MN2A 4XIDA 3CMYA 3G1OA 3RKQA 1AKHB 2DTZA 2FBQA 4MXMA 9ANTA 1FTTA 1IGNA 2ZOYA 2X48A 5C3EJ 1F36A 1R9TJ 1SANA 2Y0SN 4AUXA 1I3QJ 2XGCA 2XPVA 4FTHA 3B6AA 1JKRC 3ZQLA 2OERA 3ZQHA 5F1JA 2OPTA 3VP5A 5EDNA 1A6IA 4DYQA 3BHQA 1QVTA 2YVEA 2LLKA 3HOZJ 4JP0A 2G7SA 2IU5A 2QTQA 3ZQCA 3AQTA 3VVZA 2EBIA 2Y30A 1RPWA 2R7ZJ 4M3BA 2E19A 3E7LA 1AHDP 4CGRA 2CQQA 2HQ5A 4FE4A 4A69C 2LVSA 1YRNB 4RBOA 2HOSA 1G2HA 2DMTA 3CCYA 4D5CA 4V2GA 3PO3J 3JRGA 2F07A 4BBSJ 3TW6A 3LSJA 1QVUA 5DTDA 2JJ7A 2MW8A 3BR3A 5J3LA 5C4JJ 2HXOA 2RASA 4AC0A 3SDGA 3LHQA 2MSYA 2DMQA 4A3JJ 3ON2A 1HCRA 3QQAA 1CQTA 2EZIA 1VNDA 1D5YA 2EZLA 3WHBA 4QSHA 4EEFG 4FE7A 2LY9A 2QCOA 4D5FA 5CXGA 4ICHA 3O60A 1A5JA 5H9TA 1Y1WJ 3MVPA 5F0CA 1ZQ3P 5C4YA 4A3EJ 4XRMA 5K7FA 5F04A 4M3GA 3S2DJ 5IPAA 5FKKA 1WH7A 1RKWA 3JRBA 1GV5A 2ECCA 3GTKJ 5M5XJ 1GVDA 3CRJA 1JKPC 3GEUA 1GT0C 3FRQA 3V78A 2L7MP 1UI6A 2NP5A 2DA2A 4A3DJ 3VOKA 2YS9A 1Z0XA 2FQ4A 2XPUA 3BG9A 3F1BA 2UXHA 1RESA 4XK4A 1W0UA 2PBXA 5D18A 3DCFA 5IYBJ 2ZOZA 5HAWA 3G1LA 2M34A 1WPKA 2GM4A 3VVYA 3Q3SA 2L7ZA 4M6VA 4MO7A 2QF7A 1TWHJ 3OSFA 4M3FA 3BTLA 1B72B 3BCGA 3NI7A 5HSZA 4I76A 5K7ZA 4BBRJ 1OCTC 2VUMJ 3TP0A 3A02A 4ACIA 4HKUA 1Y1VJ 3G1MA 5BNGA 5M3FJ 5FMPA 3BR5A 1IRZA 2XDNA
chains in the Genus database with same CATH superfamily
4A3MJ 2JT1A 3WU2C 3RYRA 2R4GA 2X0LA 4KITB 2PG4A 2QVOA 4S05A 1FLIA 2H6CA 3KETA 1OFCX 1TBXA 2NVQJ 4JX4A 3BZ6A 3H9QA 3LSKA 3RYPA 3GFJA 2X6WA 3GEZA 3V7SA 1MNDA 2X9DA 3OS1A 1ZG3A 3GZIA 3CTAA 1QGPA 5DUKA 2HR3A 2ZXWH 3J81Z 2O9LA 2Q24A 2G7UA 5LEJA 2ME6A 4A3GJ 3S1QJ 3ISPA 3S8PA 3ZN1A 2M0CA 5K7HA 3SYTA 1LUJB 3MZYA 2JMWA 1PP7U 4HV5A 1T0FC 2O0YA 4BXFA 1VQ9I 4OD4A 3ABKH 2K5CA 2STTA 2KZVA 1UMQA 1T56A 4CYCA 1VFCA 2QWWA 4DVYP 3JRFA 3DWLE 1IN5A 3WU0A 4ZYEA 2COMA 3F8CA 4N4OB 1YRNA 1H88C 1TZLA 3GLLA 4G9YA 4D7MA 2AXLA 2JUCA 4L9JA 3TO7A 3PM1A 4U0YA 1JT6A 2LH9A 4LD5A 1LEBA 4AIKA 1KQ9A 4ETSA 4DBRA 4BDYA 1R1TA 4LIUA 4ON0A 1ON1A 4Y3OA 4DGWB 3OYEA 1TWCJ 2VOOA 4RLQA 2V1DA 2FOWA 4G12A 2XB5A 1HC8A 4A93J 4G94A 1Z6TA 2EA4A 4HX7A 2XV4S 2EWNA 2JSCA 1P92A 3ESWB 1LKXA 4Y13A 3HOYJ 3L2WA 2VN2A 2P4WA 4HZFA 2HU9A 3S2WA 3FK7A 4IPAA 2GUHA 3IKVA 5EG0B 2JRMA 2KIFA 2CRGA 1RUOA 2P81A 3K7AJ 2DJNA 3HL2A 1K4SA 4PJLA 2WA0A 2QEXI 1VI0A 5D6EA 2PJRA 2XASA 1E0EA 5JI6A 4OOIA 2MYSA 2VBXA 2BOLA 4RB2C 2EFOA 5K58A 1K4TA 2IW5A 3BTCA 1ZRFA 1MW7A 1K78A 2A68F 3U9GA 5D1RA 1QRYA 1HDDC 2MC3A 1W0TA 3E6BA 3K4BA 3FM3A 4F92B 4C3HJ 2ZSHB 1TL8A 2VC0A 1BC8C 2YX7A 2HVSA 2NS8A 2M1BA 3X2QH 2KDZA 3K8PC 3ZN0A 2CV1A 4EJWA 3JRIA 2GA1A 2Z3YA 4A2UA 4OMZA 2BY1A 4LOCA 3FHNA 2FE3A 3OYJA 4YRVA 4KA4A 1B72A 3ZMZA 1U5TA 2RHAA 3NPIA 4IVNA 4IEJA 2F5DA 2ZJPF 3I4MJ 3VB2A 2HOTA 3VW2A 2FMLA 1OCRH 5F08A 3FWEA 2M4KA 2FNPA 2BY0A 4BGDA 5D5VB 5D5WB 2QA4I 4A5NA 4IRVA 2FF4A 4G7OF 2KQRA 3C2HA 2E7WA 5LHIA 3OYAA 3ASOH 4CCNA 4MIMA 4A5MA 3VOXA 2XVCA 3N05A 5C44J 4LB5A 1FNNA 3O6BB 2HOEA 3C07A 4LLLA 3J80K 3OYKA 2JRTA 1OR7C 4OIRF 3LSIA 4CXFA 2MGQA 2H09A 2KP6A 3WU1B 1OCZH 1QPMA 2IS4A 1VQNI 3KFWX 4X0GA 2K9QA 5GAGJ 2HNHA 3GUDA 1N25A 2FBKA 1FYLA 1TNSA 5HLTA 3FXQA 1KU9A 3WODF 4B09A 2RVCA 1ULYA 2DQLA 3BNIA 4ESJA 2WY8Q 2VBWA 3L2VA 3QKXA 3F8MA 2BW3B 2DFEA 3GTJJ 3OY9A 4L0YB 2IA0A 1U0JA 5CQEA 2HYTA 2GBYA 3GTLJ 3RIRA 3BZKA 4JYKA 2ADUA 4UV9A 3QOPA 3BR6A 5CVJA 4LB6B 1BI2A 5ILSA 1ZTRA 4DZPA 2JN6A 3OL4A 1K79A 3BR1A 1YQAA 4ZDPA 4BY7J 3M07A 2CYYA 2KLOA 4XONA 4U9NA 2F48A 2Q2EB 2DN0A 4XR6A 1TWGJ 3FZVA 4I99C 4DYCA 3S1RJ 1D0ZA 4I2OA 3N97A 3CMEI 2TRTA 1FMWA 1ZGJA 2ZXIA 3I59B 1HXDA 1WGXA 4LLNA 1MBEA 2JA7J 2DBBA 5M3MJ 5JVTA 1X1AA 3J7ZI 1R4NB 1CGPA 1ZRDA 1MKMA 1QZZA 1DU0A 1LDJA 1EV7A 4G6QA 3C18A 4PJ0C 3EGQA 1MH4A 2EV0A 4CCJA 2R5ZB 5IP9J 2K02A 1O3RA 1P7JA 2RC4A 2P5VA 5AIQA 1Z21A 2ZKZA 1ODDA 2QWTA 5E3OA 3CO6C 5E3LA 4YIIA 2O5RA 3AG4H 3CWRA 4ENMA 3FISA 4BHCA 5GTHC 1PUFB 2ZCMA 3M1CA 5K5QA 4KIGA 5GP9A 5KAFC 5DV5A 2DOAA 1W36D 1X58A 2RNJA 3KP3A 2OC6A 2CQXA 1Y0UA 3CC2I 1VQ4I 3CCEI 3PJRA 5ICFA 2N8GA 1O4XA 1PVEA 3IH4A 3K4MA 5IOZA 2XRLA 5GPAA 4IHYA 1APLC 3F3XA 4AYBN 3BJBA 2JA2A 1HBXG 2HPMA 5D5XB 1C0WA 5J8CA 1W4MA 5L3FA 4Y17A 2DMNA 1GXQA 3S3MA 1IXSB 2M5WA 3BWGA 1XDSA 4A0YA 1K83J 2B0LA 2ZJ2A 5JFRA 2LY1A 1YJ9I 1O57A 3C2GA 4LLGF 4NDLA 3S2HJ 1V5EA 1BI3A 3FIWA 5GADJ 4WIBA 3S15J 1IC8A 1WHUA 4XBFA 1JJ6C 3ANGA 3A01A 2E5NA 2M7AA 4PGGA 2XF7A 3BR0A 2W24A 1EH6A 3RCOA 2F5CA 5AONA 3VW0A 4P55A 3KNWA 2DO7A 2MBFA 4PJMA 5HNHA 3S3OA 4JOMA 1XPXA 3JAMK 2CV0A 2L9SA 2JPBA 4MEXF 3NWTA 3QYBA 2W1OA 3FMRA 2BZTA 3WGHA 4CDGA 3TDUC 3WG7H 2M2EA 4XL9A 1F5TA 4ABZA 3OIQA 3EPZA 2VE9A 3CZ6A 4NHJA 2LNBA 3L1PA 4OWRB 2VIXA 4UV8A 4ESBA 4I02A 3CCVI 1LVKA 2DDAA 3V4GA 2PN6A 3ZQFA 1MJAA 3SEQA 3OYMA 1VF9A 3DBHB 4RM2A 1K6YA 3MEXA 1F9NA 1U9NA 2LY2A 3TO6A 4PGHA 2DPDA 2JTVA 1RRJA 1UG2A 3MKWB 3TL4X 3DXJF 3PIPF 5KNLA 2DYSH 3UR3C 3H3UA 2JA8J 5J40A 2XAJA 1BI0A 1EJ9A 3QU3A 3T5XA 1WZ2A 2DA4A 4MFEA 2XGXA 2NVUB 2EIKH 3HOUJ 3K2AA 4BE2A 2Y0MA 3FXUA 3BQYA 3CJRB 2OA4A 4LJZF 2VKHA 1MDMA 1AA7A 2CUJA 3DEEA 2O7OA 3OMYA 1I3AA 5IT3A 2KT0A 2Y2ZA 2OD5A 2IGKA 1NK2P 3KE2A 3COLA 1X2NA 1D8KA 4BS9A 1UAAA 1HW1A 2DA5A 4FHTA 1X1BA 4EVIA 2ZO4A 9ANTA 1FTTA 2ZOYA 1WSUA 1R9TJ 3S32A 1S72I 2XGCA 5DCMB 1YJWI 4FTHA 2GQQA 3B6AA 3HJEA 4XSZF 5E18F 1R00A 3KP4A 2P5LC 3D0SA 3WE2A 4FX4A 3QAHA 2HWVA 4CZCA 1XMKA 4IRGA 5B1BH 2GOMA 2X6XA 2C6YA 3BCBA 2G7SA 3W2AA 1T0FA 2L5QA 5FLXK 2FNAA 2KL4A 3LA2A 1OISA 4IQ4A 2Y30A 3S93A 3MFKA 4ZTJA 2QBYB 1RZ4A 4GCVA 2R7ZJ 3W6JB 1U5TC 3I0TA 4BE1A 2ISZA 2WWYA 4EM1A 3BG7A 4RBOA 4CGZA 1HSTA 2DMTA 5H6RA 1DDNA 4V2GA 3JW4A 3BCAA 3HOTA 4YFKF 4ZYGA 1PP8F 2JJ7A 2MW8A 5J3LA 5J47A 5TRDA 2RASA 1X4PA 2W84A 5L3BA 2MSYA 4LG0A 3RPQA 2E1MC 5D5UB 4A3JJ 1U6GA 4BQOA 1G6NA 1R4MB 1X3WB 2V4JC 5KHDA 1CQTA 1TLHB 4RGXA 1D5YA 3I9V2 2FBIA 3VYRB 5CXGA 3C7JA 4ICHA 3R0AA 4O6JA 3O60A 2EINH 4E7IA 3KP6A 4CSWA 1Z1DA 4RB1A 3E97A 2WAFA 3BJAA 4MQVA 3QODA 2K4BA 2KRFA 2E35A 1HW5A 2PI0A 2EIJH 3PNVA 3FRQA 1TQPA 3V78A 2L7MP 3RSNA 4F91B 3BJOA 1A35A 1RI7A 2NP5A 1YITI 2MC4A 2A69F 2F4IA 4CCOA 3CCRI 3WG9A 2YS9A 2RGVA 1Z0XA 3KEYA 5KVRA 2AXTC 2OQGA 1KGSA 2QENA 1DP7P 3U1DA 2E36A 4PCQA 3RJPA 4NQWB 1OCCH 3W2VA 3E3VA 3VVYA 2L7ZA 2KPMA 4MO7A 5L3CA 4M3FA 4BACA 1G3YA 3E1SA 2G7HA 2W85A 3BTLA 3RQ4A 3FX3A 5K7ZA 2FU4A 2XIGA 2GIVA 4HQMA 3TP0A 2HS5A 4RB3C 3MKYB 1IF1A 3CCSI 2VQGA 5M3FJ 1Z3YA 3Q9SA 1J5YA 3HTUA 1LB2A 3ROUA 3PFIA 1U2WA 4JQFA 3ERMA 1YHQI 3WE3A 5JVGF 1YW7A 1V5GA 4A12A 5IT9K 3IHUA 1KA8A 3F6VA 3NRVA 2R5YA 5FKNA 5EZGA 2LR8A 5KAIC 5F1RA 3ABLH 3FM5A 3DKXA 4KMUX 2E34A 2CO5A 2X1EA 3B6CA 2L02A 4G7HF 2ZMEC 3JRCA 1I27A 1YIOA 1AKHA 2DG8A 3MZ8A 3VPRA 1IN4A 1OR7A 3ZRGA 3WTXC 4AYBA 4UUTA 4E7SA 3HXLA 4BJ6C 4M71A 2NNNA 3PUBA 2EZHA 3RD3A 4GCLA 1YOVB 3IUOA 4GYIA 4I09A 2ISYA 4JX6A 2L54A 1I50J 4IQJA 5TGTA 2E71A 1WJ5A 5IP7J 1I5ZA 4E4HA 1NTCA 1BR4A 4AD9A 5ILUA 2F5EA 2OZ6A 3AL0B 3ZMVA 3HKZN 1JGGA 1SMYF 5KCMA 1KQ0A 1FEXA 1MMNA 3GLXA 4Y4RA 3V7RA 2PBIA 3CC7I 3OYDA 2UWMA 1KYWA 2L7FP 5F27A 3OYIA 1KYZA 4E7KA 4UUSB 4E70A 4ZYDA 1MSFC 2QQBA 4ME9A 3DTIA 4TV7A 2HDWA 2LBFB 2PQ8A 4F3QA 3HGYA 1VQLI 2ZSIB 5HODA 4XRSA 3HPGA 4N0BA 2REKA 5HDGA 3DTKA 5HOOA 1K6OA 2UZKA 1S7AA 4XLAA 2UXIA 4HNUA 2LD5A 1Z77A 1LFUP 2E1NA 4JNNA 1TW3A 1U8BA 1FSEA 3LSTA 2K85A 5JR3A 1BIBA 3DP7A 5A2QZ 1Q1VA 4HAMA 1JUSA 5CVUA 4HSRA 4ZDLA 5FHPA 4HV6A 5EEHA 4GRIA 4I0AA 3UNGC 4IHVA 5EF6A 1OYYA 4MK6A 2H1KA 3M8JA 1Z67A 3L9FA 3QPLA 1VQ8I 1P9QC 3KYCB 4QPQA 3LSPA 4XN0A 1SAXA 2AS5F 1FOYA 2K9MA 3HHGA 1XSXA 5GAHJ 3OS2A 2WBMA 2EH3A 4C2MJ 2ICWG 4GYGA 3HB9A 1REPC 2NOGA 2I10A 3SQNA 5K5OA 3GFIA 5CVIA 4HF1A 2NP3A 4OAZA 4XOPA 2HEOA 3I53A 2CUZA 2FJI1 2UXXA 3CC4I 4D0PA 3T0YA 4UY8I 4U7BA 4D1QA 2DTRA 3VYTB 2VLAA 3HUGB 1YE9A 4N9HA 3NQOA 4B44A 3OV8A 4KMFA 3ZMUA 1LJ9A 2FD5A 5FD5A 1ON2A 3ZMDA 2HQRA 1EF4A 2GOXB 3N4MA 1Y0NA 1JKQC 3T6NA 4EMSA 3CCJI 1FJLA 2OV7A 5EJCA 3RPUD 1YO5C 1VQOI 2I5UA 1BL0A 5LEKA 3FXJA 4GDFA 1MBHA 3DPTA 4G8XA 1SFOJ 3ZPLA 3H3ZA 2K3PA 3P9TA 1Z9CA 3MD2A 2V7FA 3GBGA 4J01A 2BY3A 4HX8A 4R1HA 3FXKA 4JBAA 1KONA 3D1NI 3HOVJ 2E2HJ 2EK5A 3IWFA 3Q0VA 1TTYA 5E79C 4HA8A 4DJAA 1A36A 1R1UA 2J5OA 2GXAA 3H5NA 3S17J 1SVOA 4P9FA 2NVTJ 5FB2A 1LE8B 3M3YJ 4O5VA 3DEWA 4CZZA 2HTJA 1KU3A 2VE8A 2NS0A 1T8IA 3HG9A 3EYYA 2L4AA 1MNEA 4CCKA 4E7JA 2OTLI 2V9KA 3CLQA 2E1OA 5FFXA 2MLKA 2E2JJ 4F55A 3HTSB 4WF2A 3O2PE 1VQPI 2CW8A 2IXSA 5EGOB 2DQRA 1VZ0A 5FLMJ 2VBZA 4XLFA 1TT0A 5M5WJ 5CPRB 2HOAA 1UHSA 1YX5A 2EZKA 3HPHA 1ZN2A 3HIFA 4PDKA 3OYFA 2L01A 4A3IJ 1J75A 5CKTA 2WB1N 3SZTA 4B4CA 1PUFA 1R49A 3I4PA 1NG7A 2DMPA 2Y31A 4MFDA 4UVCA 2W7NA 2ZFWA 3KIOA 1SC7A 3P7NA 5B5EC 3WGIA 3DPJA 3FMQA 5CW8A 5IOYA 4KFCA 1G3WA 1XD7A 2FJ1A 2XAUA 2PJPA 1H9GA 3I3LA 1T33A 1TQIA 2KKOA 2L4MA 5D8LB 3J81K 1IUFA 4KN7X 2EQRA 3A0BC 2D5VA 2K3FA 1QPIA 3F0CA 1TT5B 2XAQA 1OJLA 3BR2A 4NC8A 2Z9OA 3CJDA 1W36C 1R5GA 1W7PA 1XN7A 3HYIA 4BKXA 3WTSC 4EGZA 1E3PA 3I71A 5E8GA 1HF0A 2V1UA 2DAOA 1D1BA 2LREA 4QIWN 2JVGA 4NC6A 3HIMA 5EFYA 3SWHA 2GIZA 3O8HA 3ONQA 5BPIA 2JA6J 2YVXA 2UXPA 2QKOA 3GX4X 2CMPA 4MLOA 4XRSG 3REOA 3ON4A 2UXNA 4ESFA 2A05A 4S0HB 2M0MA 1S29A 4ZTFA 4ZH4F 1SD7A 5DM6F 2FEZA 2MABA 3E7QA 2B63J 2MLGA 2HFHA 2QUFA 3HZJA 5J1UA 3V7CA 5AQCA 3BLYA 4EJUA 1BW6A 4BL0B 3A1YA 2EPFA 4YZEA 1A04A 4CYDA 2PZ9A 2Z33A 1FY7A 2VXDA 1TW2A 2QQ9A 5JHFA 5LGUA 4XLCA 1XSDA 4RAZA 1L0OC 3GVAA 2VKVA 1EH7A 4EM0B 4Y52J 4IRHA 4B48A 1T38A 1ZREA 3LL7A 3JSOA 2RV8A 3BPVA 3RDIA 1WCMJ 2VQLA 4KJZA 3HTJA 2K9SA 1PDNC 1ZLKA 1Y56A 3C2BA 5J1RA 4IOCF 1GUUA 2BVLA 2ID6A 2J5PA 3HKZA 3ZMTA 1ZGWA 1G4DA 4KIBA 3DU6A 1O7FA 4EJOA 2ZCNA 3GTMJ 2IPQX 1XGMA 5HDKA 3VYSB 1VQ5I 5F64A 1GHCA 4EV0A 2NVXJ 4ENNA 2P6SA 1WH5A 2XC7A 2EB7A 1XX5A 2COBA 3R61A 3CP8A 3SZGA 1ETKA 1R7JA 1ORKA 1T2KA 2BXYA 3HC7A 4IO9F 5DAJA 2RAEA 4EM2A 2VPLA 3LA3A 2RQPA 3CDLA 4KDPA 2ZJRF 4U9LA 3CMAI 4HRIA 2CUFA 3H0GJ 4DZJA 2PEXA 3RKYA 4ANJA 5HLGA 4UB6C 2JK3A 3HM5A 1YX3A 2A5WA 2V9VA 4RAFA 5L3GA 1NH3A 2XRNA 4B1RA 2L9NA 2L9RA 3QPSA 1SGMA 3QP6A 5CJ9A 1OMIA 1YS7A 2X85A 2DYRH 3L2QA 2JA5J 4OMYA 1BR1A 5EEAA 3QYEA 3EUPA 2F2EA 1T08B 4R8HA 4W1UA 2ZFUA 3CF5F 3RQIA 4ENJA 2KDOA 4ZYAA 3O8GA 2IAIA 3RKQA 2LOOA 2R7SA 4L5IA 4MXMA 2XHKA 3HRTA 2NOJB 5H20A 2X48A 3EQLF 2QBYA 1GXPA 2VODA 1RR8C 2Y0SN 4L18B 1WJBA 1J0RA 2ZMEA 3ZQLA 1KZHA 2OERA 2VXZA 3ZQHA 2XKOA 1VQ7I 2HVQA 3L2RA 1A6IA 2F5FA 3FXMA 1IW7F 1QVTA 1O7LA 1RC9A 2LLKA 1XGNA 3CCUI 1LNWA 1F1ZA 4JP0A 1IN8A 1UCRA 3ASNH 2EBIA 2E60A 1WI9A 2ZNZA 2OUMA 1MMGA 3G3ZA 4G6TB 4Z2YA 1YRNB 4Q47A 1OQYA 4Q5SF 2IVMA 2EIMH 1XSVA 1J9IA 1YLFA 1DP3A 3FKJA 4HLYA 5C4JJ 2HXOA 4RGUA 3SDGA 2HQAA 2CV2A 1B9NA 1FMVA 3ERED 3ON2A 1SAUA 2QZ8A 2RKHA 3FHZA 3QQAA 1VNDA 4HW0A 2H1LA 2K86A 5ERIA 2ZJQF 4FE7A 2GA2A 3KEQA 2RREA 2YU3A 4K2EA 4HX4A 1A5JA 1FP1D 1X3ZB 4OAYA 3T8RA 5C4YA 4A3EJ 4XRMA 3WTTC 2V6CA 1U8RA 4L9VA 3EUAA 3GF2A 5IPAA 5FKKA 1FOKA 2XF5A 5IY5H 1L3LA 4M9ZA 3NWSA 5M5XJ 1GVDA 2JZYA 4NQWA 1JKPC 5FD6A 4P1WA 3VDXA 1GT0C 4LITA 1UI6A 1USSA 3VWBA 3VOKA 5LRRA 1FBQA 1K78B 3ABMH 2KIQA 3BG9A 3LFUA 2PBXA 5D18A 4P9UA 3OR1C 3DCFA 3M9AA 2ZOZA 2M34A 1R71A 1WPKA 3CJTB 1ZRCA 2WB1A 2V9PA 1TWHJ 4RGRA 1B72B 3W3CA 4WXCA 5HSZA 2OCEA 2GXBA 1OCOH 1OCTC 3A02A 4I01A 3G1MA 1HW2A 3D5LA 1IRGA 2P0WA 2DK8A 2Y48A 2WAEA 4WWCA 4UDSA 3CESA 3LWJA 3JCUC 3S5RA 3BG5A 3MKLA 1ZELA 2XGEA 3R0JA 4XNFA 1N78A 1RR7A 4M6XA 2DCEA 1WFXA 2BBYA 3CUQB 4Y7NJ 1GDTA 1POGA 2FA5A 2LP0A 1SVLA 4BAYA 2ELJA 4DOZA 2MFZA 3JRHA 2CQNA 3TW7A 2LFBA 2OQRA 4I0BA 4NN1A 2CQ7A 3GTGJ 2LKXA 3R6SA 3COAC 2HVRA 1QQIA 5E1ZB 3OYNA 1UHWA 4JX5A 2E1CA 4OD5A 3RTRA 1JTXA 1Y6IA 2CQKA 2RNGA 5FKLA 3H35A 4RB0A 2P5KA 2VJ5A 5ICCA 4IHWA 2M8EA 2EFQA 1UHMA 2DT7B 4XKBA 5M5YJ 3UKGA 1J2XA 2ID3A 1E2XA 5DEQA 1VQKI 3OYCA 5FGLA 1BC7C 1WI3A 1I6XA 1IO2A 2M9HA 1WJDA 4B3XA 1BA5A 2OAZA 1LFBA 2TDXA 3LQQA 5GAEJ 2O3FA 5HNFA 2X1CA 4KN4X 2P7CB 3TOAA 2M87A 3G7RA 5K5RA 2MG4A 4B47A 4FQGA 4CCMA 5FKMA 1FSHA 2IS6A 2CW7A 2VPRA 4XM3A 4YFXF 2XGDA 2W82A 2LBFA 4KUMA 5DYMA 5DDGA 1RETA 2X1DA 3I55I 2V79A 1JKOC 1JI8A 1X2MA 3BC8A 2JUGA 4HEA2 4AIJA 3IUVA 3VVXA 4OU0A 2DPUA 3JSJA 2FX0A 1QZEA 2Z5UA 2IEKA 3GXOA 4FISA 2YUSA 2R7QA 1XMAA 4YIFA 1XGOA 5CQGA 2EFNA 5AIPA 1I1GA 2ELKA 2DU9A 1S5LC 1RKTA 2B7EA 3TDZC 4ASNA 5J1YA 3ZQ7A 2W25A 3S14J 1FIPA 1ZG1A 1YTYA 4RLFA 3BPXA 1B8IB 3BY6A 1LVAA 1A6QA 3IRQA 1G59A 3NS4A 3K6GA 5D19A 5ICEA 2P8TA 1ZGAA 3BJ6A 2H8WA 4II3A 4CHUA 4I98B 3IAS2 1TP4A 4GFBA 1QHHD 2NYXA 3TO9A 2D45A 1WJFA 3JRDA 3ZGKA 1XB4A 4J00A 1T98A 4M9SA 1FBUA 3PFYA 2X6OA 2CJJA 4UVBA 4XQFA 1MJ9A 2HGCA 3QPHA 3MCZA 3VYUB 2DDBA 2Q0OA 4W97A 1MIJA 3HRMA 1R23A 1JTYA 5CXIA 2YR2A 3A4CA 2DK5A 4WXDA 4PFOA 2XB0X 1HLVA 1D8JA 3KYLA 4IZZA 4L5JA 3CUQC 2Z99A 1PJRA 3C1DA 3IH2A 3VEPA 1UI5A 4CICA 4LK1F 4C9YA 4ZZLA 3JRAA 2EFWA 3BG3A 3JSPA 3ZCOA 2DOFA 1TWFJ 3KZIC 4HF2A 4IL6C 1MJBA 1SMTA 5EYRA 1YIJI 3GW2A 3K4JA 2DFIA 2ESNA 2X6YA 3ML6A 5LLQA 4ZJZA 2W53A 3PPBA 3ZR8X 5GPCA 5FJ8J 3AKZA 2P6TA 1VQ6I 1PYVA 3PIOF 1X1DA 2B9SA 2HDCA 2R7DA 4G7ZF 1ZHFA 4BQQA 2EJRA 5K1YA 3VOEA 5B3SH 1BIAA 2Y0SA 3V8LA 4AM3A 1LFPA 3DU5A 2RQQA 1MGTA 3HSRA 4X6AJ 3A01B 4L5EA 4LMYA 3ECHA 4UNOA 2GAUA 1MH3A 1D0XA 2OI8A 4YG2F 1P4XA 1Y8QB 1W5CC 4ZYHA 2W4SA 2DA3A 4BXUA 4RGSA 3IP4B 1V54H 4X1EA 1ETXA 4H0EA 4HDVA 2IGMA 2BV6A 3B73A 3FXRA 3MZHA 4KYWA 2HXIA 3BG6A 4BJTA 2IT0A 1I6HJ 3WTZA 4OIPF 2EA2A 5FO5A 3CO7C 1D5VA 3E0JB 4NB5A 4N9IA 4ENKA 5C4XJ 3GCMA 3EUHC 3KZZA 4ZC3A 1JGSA 2LKSA 3QBMA 4BYYA 3ABUA 5LD2C 3SHFA 5E1WA 2QOPA 1QA6A 2H27A 3ZQIA 2O6GE 5LGTA 1G3TA 1XG1A 3AG3H 1SEUA 4DYRA 5HS9A 3LSGA 4FASD 2O8KA 2HZTA 2H94A 2HYFA 2LF8A 5GTIC 1QBJA 3K70D 2HKUA 3H5RA 4KIFA 1E3HA 2X4HA 1ETVA 3LMMA 2UV1A 5CVRA 3HRUA 2BE5F 2LYCA 1D1AA 3HGGA 4CUGA 1FOXA 1WJEA 4CCLA 4IHSA 4D7NA 2O8XA 5DS9A 5EG0A 1YG2A 2QSHX 1G3SA 1IRFA 1S7EA 3I4NJ 1W5SA 1IUYA 2CSOA 1N77A 1MDMB 2LC2A 3G6EI 2ZNYA 2NX4A 5IYCJ 3GFLA 4M74A 1FPQA 4E7LA 3NNRA 2KRHA 4WXHA 3VTIA 4A3KJ 1IV8A 2MD0A 2O7TA 3OOPA 4LG3A 2WUIA 1ETOA 2AHQA 1STZA 4QLCU 4MEYF 4A6EA 4XRFA 1P2FA 2FXAA 2NXNB 1FP2A 1XS9A 2VKEA 5BPDA 4NELA 3PQJA 1XC5A 2M7BA 5FFZA 2XSDC 1RUNA 2K9LA 1P7IA 3BT9A 3QWLA 5F0FA 3W6KB 2OTJI 2DT5A 4B43A 2R7UA 2BYVE 3ZOBA 1K7AA 2CWEA 3H0DA 2AQFA 3DPLC 3VUQA 3OWTA 3K69A 3M4OJ 5LRSA 1IZ1A 3E6CC 3LWFA 1HOMA 1BJAA 1AOYA 1HKSA 1YW9A 2MH2A 5HBUA 2YU9J 1T95A 1JJ8C 2VONA 3A0HC 3M8FA 4CA0A 3GTOJ 4B3AA 4IJAA 1OYWA 3KP2A 4GO1A 1UB9A 3ZP5A 3NXCA 2EILH 1QZYA 3HBLA 3VFZA 2LKPA 2R7VA 2PMZN 4LG0B 1ITYA 2CU7A 3RKWA 2LTPA 1B1BA 2PX9A 2DODA 5EEGA 5D4SA 4U7DA 2M4GA 3KP7A 3MKZA 3GTQJ 1W1WE 4PSWA 2Y69H 3B02A 1ZKGA 3K10A 1MBFA 3QYFA 3L2UA 1TNTA 2GFNA 2QGUA 3QU6A 1QO0D 4YFNF 5ED4A 3OIOA 5E17F 2FMYA 5E1XA 1IN6A 4NNJA 3LSHA 3H9JA 4EQQA 3FK6A 3RH2A 3ZQGA 2KZGA 4U0WA 1QNTA 1IV6A 4KT6A 2LG4A 2VJ4A 4XLNF 4KT5C 3CLOA 5H6QA 2IJLA 4B8XA 1U78A 2BW3A 3ANPA 1ZR4A 1YI2I 1BR2A 1Z6RA 4AWXB 3AL0C 4PUSA 4CO8A 1Z05A 2LSOA 3RKXA 1WVRA 3HOXJ 1DPRA 3DTEA 4XKCA 4PK4A 1S3JA 3H3VK 2Q1ZB 1E3OC 4F52A 4O3MA 4BY1J 4IKFA 4QWQA 4UVAA 2ME0A 1UFMA 2XKPA 4OIOF 2G9WA 2CGPA 4JKZA 1ETQA 3FDYA 2WGBA 4C2MA 2NRAC 2Q2EA 1EH8A 2QSFX 4GCTA 2DOEA 4R79A 5J6XA 3PSIA 3K1NA 4RDUA 2WV1A 3DF8A 1S7OA 2EV6A 2CFOA 2E7XA 4OIQF 3K4KA 2K4JA 4DIQA 4KNYA 3RI4A 4E7HA 2K27A 3D5SC 2F5VA 1CF7B 4GFLA 2VOPA 3I59A 1ZYRF 3S1MJ 5E3MA 4WCGA 1R1VA 3J7AY 1R58A 3DEUA 3ELKA 4IOAF 1FBSA 3KKDA 1YS6A 2LDUA 4AIHA 3BP8A 2GENA 2HKOA 2R5ZA 1HDPA 4U87A 2FBHA 2W48A 4L9TA 4OINF 1B4AA 4YEJA 4E7ZA 2R5YB 1NK3P 2XAHA 3WTVC 2KIUA 3WTWC 2MA3A 1ENHA 3OYGA 3OSGA 1BM9A 4BEHB 4UUVA 1UZCA 4FT8A 3JR9A 5HVQC 2VT3A 1IDZA 3VODA 2NVYJ 3MN2A 1BI1A 2FBQA 3G1OA 4PFPA 3HSEA 1AKHB 3I58A 1B9MA 3AG2H 1IGNA 1F36A 4AUXA 1AWCA 3LFKA 3G2BA 1DGWY 1HQCA 1B6AA 2GXGA 2O03A 3E5UA 1Q1HA 5BS6A 5F1JA 2Z1DA 1SD6A 5EDNA 3BHQA 4DYQA 5LHHA 2DXIA 2YVEA 2VC1A 4RM3A 3F23A 4BE0A 3R60A 3VVZA 2RN7A 3E6DA 1RPWA 1WWXA 2HPIA 1UG0A 1AHDP 1JHHA 4AU7A 4CGRA 2LVSA 2HOSA 2A6EF 3QPTA 1G2HA 3CCYA 4D5CA 2Z2SB 2D1VA 2PLYA 3OR2C 3FXLA 3PNYA 2DT6A 1WKMA 5BMZA 3TQNA 1DQUA 2Y75A 3MMYB 3BROA 3TW6A 1RNLA 2XAGA 1MMSA 4YELA 3I64A 5DTDA 3BR3A 4XSXF 2YPRA 2DFFA 3JTGA 3KP5A 3H1CA 3LHQA 2A61A 3ULQB 1XTAA 4BH9A 1H0MA 1HCRA 3H9GA 2D1HA 1FX7A 3J80Z 5LBQA 3G73A 4PJNA 2EFPA 2EZLA 3WHBA 4QSHA 4EEFG 1QU3A 2V6EA 2LY9A 4D5FA 2FUG2 1KQ8A 2JPCA 2VJIA 4A0ZA 2VKDA 3MVPA 5HDNA 2QM3A 4RMNA 1Z91A 5FRMA 3MWMA 1IN7A 1XDUA 4FX0A 2Z16A 1WH7A 3SXYA 3D5RC 2ECCA 5TJJA 4RAYA 2E5ZA 3QOEA 1T6SA 3PQKA 3CRJA 3WGGA 3DKWA 3GEUA 5B1AH 4A3DJ 3DFGA 3SEZA 2KMUA 2XUBA 5L3DA 3GO5A 2BGCA 3WTUC 4RA2A 2XPUA 2CFXA 2NNYA 4IF4A 2UXHA 2WC2A 1M1EB 4XK4A 1W0UA 1FYKA 4P96A 2A5YB 5IYBJ 5HLHA 3G1LA 3OYBA 2A6HF 2ZCWA 3Q3SA 3OSFA 2BVMA 2PFVA 3HSFA 1SFEA 3TMOA 2JSPA 5HS7A 3NI7A 4I76A 3VSKA 4BBRJ 4D9JA 2BHYA 4ACIA 3F8BA 1Y1VJ 3K9TA 3CUQA 5BNGA 1NG6A 1KU2A 3BR5A 1IXCA 2IS2A 3M8EA 1MZBA 1SD4A 1XMXA 1GLNA 3P9KA 2IP2A 2LF7A 1HSJA 2DI3A 3VIBA 2F4OB 2Y9YA 2R7XA 3F8NA 4BQAA 2M3AA 4HNTA 2M8GX 2GZWA 3A03A 4WK8F 2BHZA 3HRSA 3NRGA 4G6DA 3EETA 4LK0F 3PO2J 1TC3C 3HTHA 4NUBA 4HYEA 5HAWA 5FGMA 3RZDJ 1ZR2A 3HEFA 3LAJA 2LRDA 2A6TA 1WRJA 4UB8C 1JE8A 3EDPA 5DCMA 3DQVC 3GYHX 2NS7A 1ERDA 1P6RA 3P5JA 2DJIA 1F4KA 2HTSA 4N4NB 2HI3A 3LQRA 3RPUA 2G0EA 2L2OA 3LOCA 1V3FA 3BQZA 3V6GA 2V1NA 4IXAA 1S9HA 1Z3XA 2DLLA 1O3QA 3M7GA 4P5OA 2MD5A 2OF7A 1D1CA 3E6MA 5BQTA 1JXSA 1X4OA 1R5ID 3ABTA 2R7TA 3KLNA 1BOBA 2V26A 2AO9A 1MMDA 3CP2A 2G7LA 2ZBKA 3K4CA 1SD5A 2PMZA 5CLSA 4A3FJ 4V2FA 4IRIA 1SVMA 3SJMA 4HBLA 3BTIA 3HE0A 3P9IA 3BRUA 3EUHA 3WHCA 4CYCB 1ZK8A 3IKTA 3DV8A 1B8IA 2IA1A 4GXOA 4BJ5C 3KZYA 2GWRA 3F9KA 3GTPJ 1HA8A 1HKTA 4AVZA 2YX4A 1ZLJA 3I5UA 1LPQA 4XOTA 1SFXA 2BEOA 4II2A 4J19A 2DMUA 3GZ5A 2VT2A 2L7KA 3FF5A 4XLPF 3HOSA 2O61A 2LK2A 1QHGA 2CG4A 4BHBA 3K0LA 3BZCA 1FOWA 3S16J 4M73A 3JAMZ 2CW0F 1Y8RB 3OYHA 5D8KB 2QIBA 2E2IJ 3K2ZA 3RZOJ 2YVHA 1ETWA 3CDHA 2ZC2A 1BOAA 2OZUA 1H9TA 3IV5A 2A2FX 4JK1X 3V42A 1BJZA 3IC7A 3VSLA 1A31A 3B81A 2Q8KA 3AFHA 3K4NA 1W7PB 2DA7A 1S8NA 1ETYA 2PJRB 2R92J 3PNTA 4RS8A 5J8FA 4M3EA 5BOXA 2A07F 2KJBA 2WY7Q 2EV5A 3V8JA 3F8FA 2LMDA 1V4RA 2WADA 5LFAA 1ONVA 2UXOA 2P7VB 3OIPA 5L3EA 1IAWA 2G7GA 1H8AC 4A3CJ 3HDDA 3E5QA 3PASA 1IJWC 3Q0UA 2Y9ZA 1FT9A 2B1EA 3Q0WA 4M3DA 1R36A 3CCLI 2HKXA 3I56I 1U5TB 2K40A 3H36A 2IRFG 2R0QC 3M1EA 3U2RA 4LIVA 5IYDJ 2VL8A 4HNVA 4I7HA 1B59A 1XCVA 3H92A 1TWAJ 4BUPA 4EJTA 5FKOA 1JUMA 2K9NA 3PSFA 1ZG5A 2WAQN 3W2WA 3BOQA 3ECOA 1MD0A 3SFZA 3TEDA 4L9NA 2QSGX 5JLXA 2K7LA 3KKCA 2PMUA 1AU7A 2KISA 2E1MB 2KJCA 3V8KA 4DNCA 3J7AO 3MNLA 4WX9A 1EKEA 4RAGA 3G71I 2NAZA 1MBJA 3CMMA 4PZJA 5HLIA 4MGRA 2R7FA 2ELHA 3GZ6A 2ZY9A 3ZQQA 1OLTA 3BTJA 3K1MA 4U0VA 3G56A 3VW1A 5FLVA 2VI6A 1U9OA 2M45A 3OL3A 1ZH5A 3NEUA 2DA6A 4PSXA 4C3JJ 4UHTA 2ZXJA 4QPOA 3AG1H 1FYMA 2L9VA 4IHTA 1IDYA 4LGWA 4A3BJ 1MNMC 1S6LA 4XN3A 2F4MB 3I54A 3LA7A 4HPQA 1Y39A 1R22A 2HQNA 5FLXZ 3CDIA 3LSRA 4KISA 2PMHA 1MSEC 1IG7A 2KIMA 3F21A 4ZDOA 1OCPA 2UUZA 2ESHA 1BW5A 1FZPB 2JQ7A 1IRXA 1TQMA 1Z7LA 3IRRA 3W6VA 4MTDA 3KX2A 4EJVA 3NARA 2X51A 1X1CA 2HDDA 5FRNA 1MBGA 3LAPA 2R93J 3S1NJ 4XLHA 1I39A 4UUSA 1BN5A 4ITVA 1P4AA 5CVVA 2D6YA 5FROA 4FETA 1SFUA 1ACIA 4Q48A 4BXXJ 4GFKA 3K70C 3DPUA 3PUFA 1F43A 2OBPA 3L09A 2IGNA 2QQ8A 2AQEA 5JLWA 2H6BA 5B66C 2F6CA 2MH9A 5EZHA 3IWZA 4AC6A 5DM7F 2R7RA 1YJNI 3FXOA 1JT0A 2ETHA 3CUOA 4HG2A 3CJNA 4IHXA 2A3SA 2WTEA 1YFHA 2DFHA 5DD4A 4PXIA 1DGRM 2ECBA 3MAJA 4HOBA 5E20A 2V1XA 3K1PA 2H8RA 1WJAA 3EUKL 2TCTA 3CQZJ 3IH3A 4C2TA 2IGOA 1H89C 1GVJA 1FIAA 1YYVA 4MNUA 2XSJC 2ZMEB 1W5TA 2L0KA 5F6FA 1USTA 3FMSA 3CF2A 2DG7A 4BQNA 3TP3A 1OKRA 1V55H 2OCCH 4JL3A 4NC7A 4Q4ZF 2HYGD 2CUEA 3HTIA 1VQMI 3R4KA 2FRHA 2R7OA 3KZ9A 1HKQA 1FC3A 2BXZA 4F7ZA 3JTHA 1MMAA 4XMYA 4FCYA 3F22A 4AF5A 4EATA 3U1KA 3GMEA 2ZCXA 4HLXA 3HTAA 3DLAA 4DBQA 2VASA 3A2KA 1D3YA 1FTZA 2FQ3A 1O3TA 1N75A 2XPWA 5D6FA 3FKIJ 2G3BA 4EGYA 1ZAOA 2KFDA 2YSRA 2DW4A 4MQ9F 2UXUA 3HUGA 4Y33A 3TBIA 3WTYC 4IX7A 5IT9Z 1DPUA 4MHGA 3S3NA 3FBIB 1J59A 2OJED 4DW6A 1SFKA 1LEAA 4U88A 5IP6A 4C30A 5ICGA 2D2WA 1X1PA 4M72A 1DU6A 3KLOA 1MBKA 2XROA 3NAUA 1ZARA 3JREA 2ZB9A 3TKYA 3DLLF 3TOBA 2RDPA 1LQ1A 4XORA 3OYLA 4HSTA 1V5FA 1U3EM 3MQ0A 3AAFA 5CYVA 4C3IJ 1JUPA 3OOUA 3LNQA 1Z7UA 3KCCA 2GLOA 5LHGA 4I6ZA 1IXRC 3F6OA 4KICA 3SDBA 4A3LJ 2JWTA 2QKMB 1JHFA 4F93B 1WJCA 1LE8A 4L62A 4AVPA 5F0HA 4KWAA 2QKLB 4L0ZB 1CF7A 4XKVA 3QRFF 5J4VA 3J7YJ 3FBNB 2ZXHA 2ACJA 2V57A 3LJLA 1DUXC 4HDUA 4ZZDA 1D0YA 2I8DA 4M6YA 2DA1A 3P9CA 3IL2A 4GCKA 2W00A 5DCFA 4XICA 4QTRA 1PUEE 5EGOA 2CS3A 4UXNA 3T8TA 1LDDA 4XKWA 3TGNA 4MTEA 2IBDA 1OYIA 2WV0A 1GV2A 2HYJA 4BDZA 3T1BA 1VTNC 2VQHA 4BEHA 3L00A 3AQSA 5J4YA 1K61A 4Z6YA 3SFIA 3HOWJ 2XF6A 2OU2A 2KHMA 3G4SI 3CCQI 1RIOH 1O3SA 4V19K 1R6RA 2VB6A 4YIRX 3KEOA 3QP5A 3EYIA 3C3WA 3DKYA 2L3DA 2VQCA 3H5AA 5H2FC 2R7WA 1W7PD 5E3NA 4Y15A 4A0XA 5E8IA 4XIDA 3IAM2 3CMYA 3CCMI 2DTZA 4H4KC 5C3EJ 1SANA 4A6DA 1I3QJ 2XPVA 3SZPA 3L7WA 1XGSA 3GZNB 1JKRC 2XAFA 1XCBA 1FWZA 2FSWA 5HS8A 2B3WA 4BNCA 1WQ2A 2OPTA 2VJJA 3VP5A 4DQ2A 2XDVA 3KYDB 2M30A 1EA3A 3HOZJ 2QQAA 1KU7A 2IU5A 2QTQA 2QLZA 3ZQCA 3AQTA 3K4LA 4M9XA 3L2CA 6PAXA 3F72A 4M3BA 2E19A 3E7LA 1P4WA 1R5HA 2CQQA 2HQ5A 4FE4A 4GGGA 3BDDA 5KK1A 4A69C 4CH7A 2WAQA 2STWA 3E5XA 3ZXSA 5DD8A 3JRGA 3PO3J 2F07A 4BBSJ 3Q5FA 3KPHA 1X19A 3LSJA 1QVUA 4S04A 5DUIA 4AC0A 4E6KG 1BBYA 3GFMA 2DMQA 1T39A 3DBRB 2IA2A 3PL8A 1YW8A 2EZIA 1G8XA 3CJQB 2VBYA 3LSMA 3CD6I 4BHPA 2FOKA 2QCOA 4PJJA 1UJ8A 3HHHA 4XLEA 5H9TA 1Y1WJ 1LDKB 5F0CA 1ZQ3P 1J7KA 4C2UA 2PFBA 5K7FA 5F04A 4M3GA 3S2DJ 1RKWA 3JRBA 4HQEA 3ZMSA 1GV5A 5TISC 3O3KA 3GTKJ 3Q9VA 4BU2A 2QYOA 3U21A 3DBLB 2W57A 5ILVA 2DA2A 2KRCA 4AIDA 1J09A 3GWZA 2IS1A 1E17A 2FQ4A 3F1BA 2JVHA 1RESA 2R3SA 4HF0A 5D4RA 3OS0A 2GM4A 4M6VA 1NHAA 2QF7A 2CH0A 5A2QK 3BCGA 4LFUA 1UELB 1OPCA 1I1SA 2HZDA 2VUMJ 4HKUA 5FMPA 5JHUA 5LGNA 4NBQA 1IRZA 2XDNA 2BY2A 1X3UA
chains in the Genus database with same CATH topology
4A3MJ 4UDSA 3LWJA 3S5RA 3BG5A 3MKLA 1OFCX 2XGEA 3VIBA 2NVQJ 2R5YA 4JX4A 1RR7A 2Y9YA 5FKNA 5EZGA 2LR8A 2M8GX 3A03A 4Y7NJ 2X9DA 3NRGA 3GZIA 1GDTA 1POGA 1TC3C 3PO2J 3B6CA 2LP0A 3HTHA 3JRHA 3JRCA 2O9LA 3TW7A 2LFBA 1AKHA 3RZDJ 2Q24A 4NN1A 1ZR2A 3HEFA 3VPRA 2ME6A 4A3GJ 2DG8A 3S1QJ 3GTGJ 2LKXA 2M0CA 5K7HA 4UUTA 2NS7A 4JX5A 1JTXA 2JMWA 2EZHA 5FKLA 2HI3A 3RD3A 2G0EA 4IHWA 3LOCA 4GCLA 3BQZA 3V6GA 5M5YJ 3UKGA 2ID3A 1UMQA 4JX6A 1T56A 4CYCA 1VFCA 5FGLA 1WI3A 1I50J 2M9HA 3JRFA 2OF7A 1BA5A 5IP7J 1YRNA 1H88C 1LFBA 2AO9A 1NTCA 4D7MA 2G7LA 3PM1A 3G7RA 2MG4A 1JT6A 4A3FJ 4V2FA 3SJMA 5FKMA 3HKZN 2VPRA 3BTIA 1JGGA 3HE0A 2XGDA 1FEXA 1JKOC 1RETA 3BRUA 1TWCJ 1X2MA 3WHCA 4CYCB 3IUVA 1ZK8A 3VVXA 1B8IA 3JSJA 2FX0A 4G12A 2XB5A 4A93J 2L7FP 2IEKA 4FISA 5F27A 2YUSA 4UUSB 3GTPJ 1MSFC 2ELKA 3HOYJ 1RKTA 4ME9A 5J1YA 3FK7A 3HGYA 3S14J 1FIPA 4J19A 2DMUA 5HODA 1B8IB 2GUHA 2LK2A 4XRSA 5EG0B 5D19A 2CRGA 2P81A 3S16J 2REKA 3K7AJ 2DJNA 1VI0A 2QIBA 2E2IJ 4GFBA 2YVHA 3RZOJ 3JRDA 1ETWA 2LD5A 2UXIA 1Z77A 1LFUP 4JNNA 3IV5A 5K58A 1U8BA 2X6OA 2CJJA 3BTCA 5D1RA 1Q1VA 1QRYA 1HDDC 1BJZA 1JUSA 1W0TA 4C3HJ 3B81A 4W97A 2NS8A 5CXIA 1JTYA 2KDZA 5FHPA 2DA7A 1ETYA 3JRIA 1HLVA 2XB0X 4IHVA 2R92J 5EF6A 4MK6A 2H1KA 4LOCA 4M3EA 1UI5A 3IH2A 1B72A 3JRAA 2RHAA 3NPIA 3BG3A 3QPLA 4IEJA 2UXOA 3I4MJ 1TWFJ 2HOTA 3VW2A 5F08A 3LSPA 2G7GA 5EYRA 1H8AC 4A3CJ 2W53A 3HDDA 3PPBA 2EH3A 4C2MJ 5GPCA 3HB9A 2NOGA 2I10A 5FJ8J 3PASA 1IJWC 3Q0UA 2Y9ZA 2NP3A 3Q0WA 4M3DA 4MIMA 3VOXA 2K40A 2R0QC 5C44J 5IYDJ 4HNVA 3C07A 1TWAJ 5FKOA 1JUMA 2K9NA 2WAQN 2MGQA 2FD5A 3TEDA 4X6AJ 3A01B 5JLXA 4L5EA 1EF4A 3KKCA 1JKQC 3T6NA 2K9QA 1FJLA 1AU7A 1MH3A 3MNLA 1BL0A 2OI8A 1MBHA 1SFOJ 1MBJA 2DA3A 4X1EA 3BTJA 1ETXA 3G56A 3P9TA 3VW1A 5FLVA 2VI6A 3GBGA 1U9OA 3BNIA 2DA6A 4C3JJ 3QKXA 2HXIA 3HOVJ 3D1NI 1I6HJ 3GTJJ 1IDYA 2E2HJ 3Q0VA 4A3BJ 1MNMC 3S17J 2HYTA 2NVTJ 2GBYA 1LE8B 3LSRA 3GTLJ 3M3YJ 3DEWA 4JYKA 5C4XJ 3BR6A 1MSEC 1IG7A 1ZTRA 4DZPA 2JN6A 1OCPA 3QBMA 2E1OA 3BR1A 2E2JJ 1BW5A 4BY7J 2QOPA 3ZQIA 3W6VA 1XG1A 2DN0A 3NARA 3S1NJ 2HDDA 1TWGJ 1MBGA 4DYRA 2R93J 3LSGA 5EGOB 2O8KA 4DYCA 5FLMJ 4UUSA 3S1RJ 2D6YA 2TRTA 5M5WJ 2HOAA 4GFKA 4BXXJ 2HKUA 1UHSA 2EZKA 4A3IJ 1DU6A 1ETVA 1WGXA 2WB1N 1F43A 4B4CA 1MBEA 2JA7J 5M3MJ 3HGGA 5JLWA 1DU0A 2DMPA 2Y31A 4MFDA 4D7NA 5DS9A 5EZHA 5EG0A 1PUFA 3DPJA 3EGQA 1MH4A 1S7EA 5IOYA 2R5ZB 3I4NJ 5IP9J 5CW8A 4AC6A 2FJ1A 1JT0A 1P7JA 4IHXA 1T33A 4PXIA 2NX4A 2ECBA 5IYCJ 5E3OA 2QWTA 3NNRA 5E3LA 1IUFA 2H8RA 3CWRA 2EQRA 2D5VA 3FISA 2TCTA 1PUFB 2ZCMA 4A3KJ 3CQZJ 3IH3A 1QPIA 2O7TA 2WUIA 5GP9A 3F0CA 1ETOA 1H89C 3BR2A 1OJLA 2AHQA 3CJDA 1X58A 1FIAA 4BKXA 2CQXA 2L0KA 1XS9A 1HF0A 2DG7A 2VKEA 4NELA 3TP3A 1XC5A 2N8GA 4QIWN 1O4XA 2XSDC 3IH4A 3HIMA 5EFYA 3O8HA 4JL3A 5IOZA 1P7IA 2XRLA 3BT9A 5GPAA 2JA6J 4IHYA 5F0FA 1APLC 2QKOA 2CUEA 4AYBN 2UXPA 3BJBA 3ZOBA 3HTIA 4MLOA 4XRSG 3KZ9A 3ON4A 3VUQA 3M4OJ 4S0HB 1HOMA 4FCYA 4AF5A 2DMNA 5HBUA 2ZCXA 2YU9J 3HTAA 1FTZA 1JJ8C 1K83J 2XPWA 3FKIJ 2G3BA 3E7QA 2B63J 3GTOJ 4B3AA 5J1UA 2UXUA 3NXCA 4NDLA 3S2HJ 5AQCA 1BW6A 3HBLA 3FIWA 4YZEA 2PMZN 2PZ9A 4DW6A 3S15J 1ITYA 1IC8A 2CU7A 2LTPA 1JJ6C 5IP6A 3GTQJ 3A01A 3ANGA 1MBKA 3BR0A 1ZKGA 3NAUA 1MBFA 2VKVA 2GFNA 3JREA 3VW0A 2ZB9A 3OIOA 4Y52J 3KNWA 3FK6A 3RH2A 3ZQGA 4C3IJ 1JUPA 1IV6A 3HTJA 3OOUA 3LNQA 1WCMJ 1U78A 2K9SA 5J1RA 3C2BA 2GLOA 1ZR4A 3ANPA 1GUUA 2ID6A 4I6ZA 1ZGWA 2M2EA 4ABZA 4A3LJ 2JWTA 3HOXJ 2ZCNA 3GTMJ 1LE8A 3L1PA 4L62A 3H3VK 1E3OC 5F0HA 4KWAA 4BY1J 3ZQFA 2NVXJ 1VF9A 2ME0A 2V57A 3LJLA 1WH5A 4JKZA 1ETQA 2WGBA 2DA1A 1U9NA 4GCKA 4GCTA 4QTRA 2COBA 4XICA 5EGOA 1ETKA 1UG2A 4RDUA 2WV1A 1ORKA 2IBDA 1GV2A 2HYJA 5DAJA 2RAEA 3CDLA 4GFLA 2JA8J 3S1MJ 3AQSA 5E3MA 2CUFA 1K61A 3H0GJ 3SFIA 4DZJA 3HOWJ 2DA4A 2JK3A 4MFEA 3KKDA 3HM5A 2GENA 4B1RA 2R5ZA 1HDPA 3HOUJ 2L9RA 3K2AA 3QPSA 1SGMA 2W48A 3BQYA 2R5YB 1NK3P 2JA5J 5EEAA 2O7OA 1ENHA 3EUPA 3OSGA 2KT0A 2Y2ZA 4W1UA 1NK2P 3COLA 3RQIA 1X2NA 3JR9A 5E3NA 1IDZA 3O8GA 2DA5A 2NVYJ 2IAIA 3MN2A 4XIDA 3CMYA 3G1OA 3RKQA 1AKHB 2DTZA 2FBQA 4MXMA 9ANTA 1FTTA 1IGNA 2ZOYA 2X48A 5C3EJ 1F36A 1R9TJ 1SANA 2Y0SN 4AUXA 1I3QJ 2XGCA 2XPVA 4FTHA 3B6AA 1JKRC 3ZQLA 2OERA 3ZQHA 5F1JA 2OPTA 3VP5A 5EDNA 1A6IA 4DYQA 3BHQA 1QVTA 2YVEA 2LLKA 3HOZJ 4JP0A 2G7SA 2IU5A 2QTQA 3ZQCA 3AQTA 3VVZA 2EBIA 2Y30A 1RPWA 2R7ZJ 4M3BA 2E19A 3E7LA 1AHDP 4CGRA 2CQQA 2HQ5A 4FE4A 4A69C 2LVSA 1YRNB 4RBOA 2HOSA 1G2HA 2DMTA 3CCYA 4D5CA 4V2GA 3PO3J 3JRGA 2F07A 4BBSJ 3TW6A 3LSJA 1QVUA 5DTDA 2JJ7A 2MW8A 3BR3A 5J3LA 5C4JJ 2HXOA 2RASA 4AC0A 3SDGA 3LHQA 2MSYA 2DMQA 4A3JJ 3ON2A 1HCRA 3QQAA 1CQTA 2EZIA 1VNDA 1D5YA 2EZLA 3WHBA 4QSHA 4EEFG 4FE7A 2LY9A 2QCOA 4D5FA 5CXGA 4ICHA 3O60A 1A5JA 5H9TA 1Y1WJ 3MVPA 5F0CA 1ZQ3P 5C4YA 4A3EJ 4XRMA 5K7FA 5F04A 4M3GA 3S2DJ 5IPAA 5FKKA 1WH7A 1RKWA 3JRBA 1GV5A 2ECCA 3GTKJ 5M5XJ 1GVDA 3CRJA 1JKPC 3GEUA 1GT0C 3FRQA 3V78A 2L7MP 1UI6A 2NP5A 2DA2A 4A3DJ 3VOKA 2YS9A 1Z0XA 2FQ4A 2XPUA 3BG9A 3F1BA 2UXHA 1RESA 4XK4A 1W0UA 2PBXA 5D18A 3DCFA 5IYBJ 2ZOZA 5HAWA 3G1LA 2M34A 1WPKA 2GM4A 3VVYA 3Q3SA 2L7ZA 4M6VA 4MO7A 2QF7A 1TWHJ 3OSFA 4M3FA 3BTLA 1B72B 3BCGA 3NI7A 5HSZA 4I76A 5K7ZA 4BBRJ 1OCTC 2VUMJ 3TP0A 3A02A 4ACIA 4HKUA 1Y1VJ 3G1MA 5BNGA 5M3FJ 5FMPA 3BR5A 1IRZA 2XDNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3M J;  4UDS A;  3LWJ A;  3S5R A;  3BG5 A;  3MKL A;  1OFC X;  2XGE A;  3VIB A;  2NVQ J;  2R5Y A;  4JX4 A;  1RR7 A;  2Y9Y A;  5FKN A;  5EZG A;  2LR8 A;  2M8G X;  3A03 A;  4Y7N J;  2X9D A;  3NRG A;  3GZI A;  1GDT A;  1POG A;  1TC3 C;  3PO2 J;  3B6C A;  2LP0 A;  3HTH A;  3JRH A;  3JRC A;  2O9L A;  3TW7 A;  2LFB A;  1AKH A;  3RZD J;  2Q24 A;  4NN1 A;  1ZR2 A;  3HEF A;  3VPR A;  2ME6 A;  4A3G J;  2DG8 A;  3S1Q J;  3GTG J;  2LKX A;  2M0C A;  5K7H A;  4UUT A;  2NS7 A;  4JX5 A;  1JTX A;  2JMW A;  2EZH A;  5FKL A;  2HI3 A;  3RD3 A;  2G0E A;  4IHW A;  3LOC A;  4GCL A;  3BQZ A;  3V6G A;  5M5Y J;  3UKG A;  2ID3 A;  1UMQ A;  4JX6 A;  1T56 A;  4CYC A;  1VFC A;  5FGL A;  1WI3 A;  1I50 J;  2M9H A;  3JRF A;  2OF7 A;  1BA5 A;  5IP7 J;  1YRN A;  1H88 C;  1LFB A;  2AO9 A;  1NTC A;  4D7M A;  2G7L A;  3PM1 A;  3G7R A;  2MG4 A;  1JT6 A;  4A3F J;  4V2F A;  3SJM A;  5FKM A;  3HKZ N;  2VPR A;  3BTI A;  1JGG A;  3HE0 A;  2XGD A;  1FEX A;  1JKO C;  1RET A;  3BRU A;  1TWC J;  1X2M A;  3WHC A;  4CYC B;  3IUV A;  1ZK8 A;  3VVX A;  1B8I A;  3JSJ A;  2FX0 A;  4G12 A;  2XB5 A;  4A93 J;  2L7F P;  2IEK A;  4FIS A;  5F27 A;  2YUS A;  4UUS B;  3GTP J;  1MSF C;  2ELK A;  3HOY J;  1RKT A;  4ME9 A;  5J1Y A;  3FK7 A;  3HGY A;  3S14 J;  1FIP A;  4J19 A;  2DMU A;  5HOD A;  1B8I B;  2GUH A;  2LK2 A;  4XRS A;  5EG0 B;  5D19 A;  2CRG A;  2P81 A;  3S16 J;  2REK A;  3K7A J;  2DJN A;  1VI0 A;  2QIB A;  2E2I J;  4GFB A;  2YVH A;  3RZO J;  3JRD A;  1ETW A;  2LD5 A;  2UXI A;  1Z77 A;  1LFU P;  4JNN A;  3IV5 A;  5K58 A;  1U8B A;  2X6O A;  2CJJ A;  3BTC A;  5D1R A;  1Q1V A;  1QRY A;  1HDD C;  1BJZ A;  1JUS A;  1W0T A;  4C3H J;  3B81 A;  4W97 A;  2NS8 A;  5CXI A;  1JTY A;  2KDZ A;  5FHP A;  2DA7 A;  1ETY A;  3JRI A;  1HLV A;  2XB0 X;  4IHV A;  2R92 J;  5EF6 A;  4MK6 A;  2H1K A;  4LOC A;  4M3E A;  1UI5 A;  3IH2 A;  1B72 A;  3JRA A;  2RHA A;  3NPI A;  3BG3 A;  3QPL A;  4IEJ A;  2UXO A;  3I4M J;  1TWF J;  2HOT A;  3VW2 A;  5F08 A;  3LSP A;  2G7G A;  5EYR A;  1H8A C;  4A3C J;  2W53 A;  3HDD A;  3PPB A;  2EH3 A;  4C2M J;  5GPC A;  3HB9 A;  2NOG A;  2I10 A;  5FJ8 J;  3PAS A;  1IJW C;  3Q0U A;  2Y9Z A;  2NP3 A;  3Q0W A;  4M3D A;  4MIM A;  3VOX A;  2K40 A;  2R0Q C;  5C44 J;  5IYD J;  4HNV A;  3C07 A;  1TWA J;  5FKO A;  1JUM A;  2K9N A;  2WAQ N;  2MGQ A;  2FD5 A;  3TED A;  4X6A J;  3A01 B;  5JLX A;  4L5E A;  1EF4 A;  3KKC A;  1JKQ C;  3T6N A;  2K9Q A;  1FJL A;  1AU7 A;  1MH3 A;  3MNL A;  1BL0 A;  2OI8 A;  1MBH A;  1SFO J;  1MBJ A;  2DA3 A;  4X1E A;  3BTJ A;  1ETX A;  3G56 A;  3P9T A;  3VW1 A;  5FLV A;  2VI6 A;  3GBG A;  1U9O A;  3BNI A;  2DA6 A;  4C3J J;  3QKX A;  2HXI A;  3HOV J;  3D1N I;  1I6H J;  3GTJ J;  1IDY A;  2E2H J;  3Q0V A;  4A3B J;  1MNM C;  3S17 J;  2HYT A;  2NVT J;  2GBY A;  1LE8 B;  3LSR A;  3GTL J;  3M3Y J;  3DEW A;  4JYK A;  5C4X J;  3BR6 A;  1MSE C;  1IG7 A;  1ZTR A;  4DZP A;  2JN6 A;  1OCP A;  3QBM A;  2E1O A;  3BR1 A;  2E2J J;  1BW5 A;  4BY7 J;  2QOP A;  3ZQI A;  3W6V A;  1XG1 A;  2DN0 A;  3NAR A;  3S1N J;  2HDD A;  1TWG J;  1MBG A;  4DYR A;  2R93 J;  3LSG A;  5EGO B;  2O8K A;  4DYC A;  5FLM J;  4UUS A;  3S1R J;  2D6Y A;  2TRT A;  5M5W J;  2HOA A;  4GFK A;  4BXX J;  2HKU A;  1UHS A;  2EZK A;  4A3I J;  1DU6 A;  1ETV A;  1WGX A;  2WB1 N;  1F43 A;  4B4C A;  1MBE A;  2JA7 J;  5M3M J;  3HGG A;  5JLW A;  1DU0 A;  2DMP A;  2Y31 A;  4MFD A;  4D7N A;  5DS9 A;  5EZH A;  5EG0 A;  1PUF A;  3DPJ A;  3EGQ A;  1MH4 A;  1S7E A;  5IOY A;  2R5Z B;  3I4N J;  5IP9 J;  5CW8 A;  4AC6 A;  2FJ1 A;  1JT0 A;  1P7J A;  4IHX A;  1T33 A;  4PXI A;  2NX4 A;  2ECB A;  5IYC J;  5E3O A;  2QWT A;  3NNR A;  5E3L A;  1IUF A;  2H8R A;  3CWR A;  2EQR A;  2D5V A;  3FIS A;  2TCT A;  1PUF B;  2ZCM A;  4A3K J;  3CQZ J;  3IH3 A;  1QPI A;  2O7T A;  2WUI A;  5GP9 A;  3F0C A;  1ETO A;  1H89 C;  3BR2 A;  1OJL A;  2AHQ A;  3CJD A;  1X58 A;  1FIA A;  4BKX A;  2CQX A;  2L0K A;  1XS9 A;  1HF0 A;  2DG7 A;  2VKE A;  4NEL A;  3TP3 A;  1XC5 A;  2N8G A;  4QIW N;  1O4X A;  2XSD C;  3IH4 A;  3HIM A;  5EFY A;  3O8H A;  4JL3 A;  5IOZ A;  1P7I A;  2XRL A;  3BT9 A;  5GPA A;  2JA6 J;  4IHY A;  5F0F A;  1APL C;  2QKO A;  2CUE A;  4AYB N;  2UXP A;  3BJB A;  3ZOB A;  3HTI A;  4MLO A;  4XRS G;  3KZ9 A;  3ON4 A;  3VUQ A;  3M4O J;  4S0H B;  1HOM A;  4FCY A;  4AF5 A;  2DMN A;  5HBU A;  2ZCX A;  2YU9 J;  3HTA A;  1FTZ A;  1JJ8 C;  1K83 J;  2XPW A;  3FKI J;  2G3B A;  3E7Q A;  2B63 J;  3GTO J;  4B3A A;  5J1U A;  2UXU A;  3NXC A;  4NDL A;  3S2H J;  5AQC A;  1BW6 A;  3HBL A;  3FIW A;  4YZE A;  2PMZ N;  2PZ9 A;  4DW6 A;  3S15 J;  1ITY A;  1IC8 A;  2CU7 A;  2LTP A;  1JJ6 C;  5IP6 A;  3GTQ J;  3A01 A;  3ANG A;  1MBK A;  3BR0 A;  1ZKG A;  3NAU A;  1MBF A;  2VKV A;  2GFN A;  3JRE A;  3VW0 A;  2ZB9 A;  3OIO A;  4Y52 J;  3KNW A;  3FK6 A;  3RH2 A;  3ZQG A;  4C3I J;  1JUP A;  1IV6 A;  3HTJ A;  3OOU A;  3LNQ A;  1WCM J;  1U78 A;  2K9S A;  5J1R A;  3C2B A;  2GLO A;  1ZR4 A;  3ANP A;  1GUU A;  2ID6 A;  4I6Z A;  1ZGW A;  2M2E A;  4ABZ A;  4A3L J;  2JWT A;  3HOX J;  2ZCN A;  3GTM J;  1LE8 A;  3L1P A;  4L62 A;  3H3V K;  1E3O C;  5F0H A;  4KWA A;  4BY1 J;  3ZQF A;  2NVX J;  1VF9 A;  2ME0 A;  2V57 A;  3LJL A;  1WH5 A;  4JKZ A;  1ETQ A;  2WGB A;  2DA1 A;  1U9N A;  4GCK A;  4GCT A;  4QTR A;  2COB A;  4XIC A;  5EGO A;  1ETK A;  1UG2 A;  4RDU A;  2WV1 A;  1ORK A;  2IBD A;  1GV2 A;  2HYJ A;  5DAJ A;  2RAE A;  3CDL A;  4GFL A;  2JA8 J;  3S1M J;  3AQS A;  5E3M A;  2CUF A;  1K61 A;  3H0G J;  3SFI A;  4DZJ A;  3HOW J;  2DA4 A;  2JK3 A;  4MFE A;  3KKD A;  3HM5 A;  2GEN A;  4B1R A;  2R5Z A;  1HDP A;  3HOU J;  2L9R A;  3K2A A;  3QPS A;  1SGM A;  2W48 A;  3BQY A;  2R5Y B;  1NK3 P;  2JA5 J;  5EEA A;  2O7O A;  1ENH A;  3EUP A;  3OSG A;  2KT0 A;  2Y2Z A;  4W1U A;  1NK2 P;  3COL A;  3RQI A;  1X2N A;  3JR9 A;  5E3N A;  1IDZ A;  3O8G A;  2DA5 A;  2NVY J;  2IAI A;  3MN2 A;  4XID A;  3CMY A;  3G1O A;  3RKQ A;  1AKH B;  2DTZ A;  2FBQ A;  4MXM A;  9ANT A;  1FTT A;  1IGN A;  2ZOY A;  2X48 A;  5C3E J;  1F36 A;  1R9T J;  1SAN A;  2Y0S N;  4AUX A;  1I3Q J;  2XGC A;  2XPV A;  4FTH A;  3B6A A;  1JKR C;  3ZQL A;  2OER A;  3ZQH A;  5F1J A;  2OPT A;  3VP5 A;  5EDN A;  1A6I A;  4DYQ A;  3BHQ A;  1QVT A;  2YVE A;  2LLK A;  3HOZ J;  4JP0 A;  2G7S A;  2IU5 A;  2QTQ A;  3ZQC A;  3AQT A;  3VVZ A;  2EBI A;  2Y30 A;  1RPW A;  2R7Z J;  4M3B A;  2E19 A;  3E7L A;  1AHD P;  4CGR A;  2CQQ A;  2HQ5 A;  4FE4 A;  4A69 C;  2LVS A;  1YRN B;  4RBO A;  2HOS A;  1G2H A;  2DMT A;  3CCY A;  4D5C A;  4V2G A;  3PO3 J;  3JRG A;  2F07 A;  4BBS J;  3TW6 A;  3LSJ A;  1QVU A;  5DTD A;  2JJ7 A;  2MW8 A;  3BR3 A;  5J3L A;  5C4J J;  2HXO A;  2RAS A;  4AC0 A;  3SDG A;  3LHQ A;  2MSY A;  2DMQ A;  4A3J J;  3ON2 A;  1HCR A;  3QQA A;  1CQT A;  2EZI A;  1VND A;  1D5Y A;  2EZL A;  3WHB A;  4QSH A;  4EEF G;  4FE7 A;  2LY9 A;  2QCO A;  4D5F A;  5CXG A;  4ICH A;  3O60 A;  1A5J A;  5H9T A;  1Y1W J;  3MVP A;  5F0C A;  1ZQ3 P;  5C4Y A;  4A3E J;  4XRM A;  5K7F A;  5F04 A;  4M3G A;  3S2D J;  5IPA A;  5FKK A;  1WH7 A;  1RKW A;  3JRB A;  1GV5 A;  2ECC A;  3GTK J;  5M5X J;  1GVD A;  3CRJ A;  1JKP C;  3GEU A;  1GT0 C;  3FRQ A;  3V78 A;  2L7M P;  1UI6 A;  2NP5 A;  2DA2 A;  4A3D J;  3VOK A;  2YS9 A;  1Z0X A;  2FQ4 A;  2XPU A;  3BG9 A;  3F1B A;  2UXH A;  1RES A;  4XK4 A;  1W0U A;  2PBX A;  5D18 A;  3DCF A;  5IYB J;  2ZOZ A;  5HAW A;  3G1L A;  2M34 A;  1WPK A;  2GM4 A;  3VVY A;  3Q3S A;  2L7Z A;  4M6V A;  4MO7 A;  2QF7 A;  1TWH J;  3OSF A;  4M3F A;  3BTL A;  1B72 B;  3BCG A;  3NI7 A;  5HSZ A;  4I76 A;  5K7Z A;  4BBR J;  1OCT C;  2VUM J;  3TP0 A;  3A02 A;  4ACI A;  4HKU A;  1Y1V J;  3G1M A;  5BNG A;  5M3F J;  5FMP A;  3BR5 A;  1IRZ A;  2XDN A; 
#chains in the Genus database with same CATH topology
 4A3M J;  2JT1 A;  3WU2 C;  3RYR A;  2R4G A;  2X0L A;  4KIT B;  2PG4 A;  2QVO A;  4S05 A;  1FLI A;  2H6C A;  3KET A;  1OFC X;  1TBX A;  2NVQ J;  4JX4 A;  3BZ6 A;  3H9Q A;  3LSK A;  3RYP A;  3GFJ A;  2X6W A;  3GEZ A;  3V7S A;  1MND A;  2X9D A;  3OS1 A;  1ZG3 A;  3GZI A;  3CTA A;  1QGP A;  5DUK A;  2HR3 A;  2ZXW H;  3J81 Z;  2O9L A;  2Q24 A;  2G7U A;  5LEJ A;  2ME6 A;  4A3G J;  3S1Q J;  3ISP A;  3S8P A;  3ZN1 A;  2M0C A;  5K7H A;  3SYT A;  1LUJ B;  3MZY A;  2JMW A;  1PP7 U;  4HV5 A;  1T0F C;  2O0Y A;  4BXF A;  1VQ9 I;  4OD4 A;  3ABK H;  2K5C A;  2STT A;  2KZV A;  1UMQ A;  1T56 A;  4CYC A;  1VFC A;  2QWW A;  4DVY P;  3JRF A;  3DWL E;  1IN5 A;  3WU0 A;  4ZYE A;  2COM A;  3F8C A;  4N4O B;  1YRN A;  1H88 C;  1TZL A;  3GLL A;  4G9Y A;  4D7M A;  2AXL A;  2JUC A;  4L9J A;  3TO7 A;  3PM1 A;  4U0Y A;  1JT6 A;  2LH9 A;  4LD5 A;  1LEB A;  4AIK A;  1KQ9 A;  4ETS A;  4DBR A;  4BDY A;  1R1T A;  4LIU A;  4ON0 A;  1ON1 A;  4Y3O A;  4DGW B;  3OYE A;  1TWC J;  2VOO A;  4RLQ A;  2V1D A;  2FOW A;  4G12 A;  2XB5 A;  1HC8 A;  4A93 J;  4G94 A;  1Z6T A;  2EA4 A;  4HX7 A;  2XV4 S;  2EWN A;  2JSC A;  1P92 A;  3ESW B;  1LKX A;  4Y13 A;  3HOY J;  3L2W A;  2VN2 A;  2P4W A;  4HZF A;  2HU9 A;  3S2W A;  3FK7 A;  4IPA A;  2GUH A;  3IKV A;  5EG0 B;  2JRM A;  2KIF A;  2CRG A;  1RUO A;  2P81 A;  3K7A J;  2DJN A;  3HL2 A;  1K4S A;  4PJL A;  2WA0 A;  2QEX I;  1VI0 A;  5D6E A;  2PJR A;  2XAS A;  1E0E A;  5JI6 A;  4OOI A;  2MYS A;  2VBX A;  2BOL A;  4RB2 C;  2EFO A;  5K58 A;  1K4T A;  2IW5 A;  3BTC A;  1ZRF A;  1MW7 A;  1K78 A;  2A68 F;  3U9G A;  5D1R A;  1QRY A;  1HDD C;  2MC3 A;  1W0T A;  3E6B A;  3K4B A;  3FM3 A;  4F92 B;  4C3H J;  2ZSH B;  1TL8 A;  2VC0 A;  1BC8 C;  2YX7 A;  2HVS A;  2NS8 A;  2M1B A;  3X2Q H;  2KDZ A;  3K8P C;  3ZN0 A;  2CV1 A;  4EJW A;  3JRI A;  2GA1 A;  2Z3Y A;  4A2U A;  4OMZ A;  2BY1 A;  4LOC A;  3FHN A;  2FE3 A;  3OYJ A;  4YRV A;  4KA4 A;  1B72 A;  3ZMZ A;  1U5T A;  2RHA A;  3NPI A;  4IVN A;  4IEJ A;  2F5D A;  2ZJP F;  3I4M J;  3VB2 A;  2HOT A;  3VW2 A;  2FML A;  1OCR H;  5F08 A;  3FWE A;  2M4K A;  2FNP A;  2BY0 A;  4BGD A;  5D5V B;  5D5W B;  2QA4 I;  4A5N A;  4IRV A;  2FF4 A;  4G7O F;  2KQR A;  3C2H A;  2E7W A;  5LHI A;  3OYA A;  3ASO H;  4CCN A;  4MIM A;  4A5M A;  3VOX A;  2XVC A;  3N05 A;  5C44 J;  4LB5 A;  1FNN A;  3O6B B;  2HOE A;  3C07 A;  4LLL A;  3J80 K;  3OYK A;  2JRT A;  1OR7 C;  4OIR F;  3LSI A;  4CXF A;  2MGQ A;  2H09 A;  2KP6 A;  3WU1 B;  1OCZ H;  1QPM A;  2IS4 A;  1VQN I;  3KFW X;  4X0G A;  2K9Q A;  5GAG J;  2HNH A;  3GUD A;  1N25 A;  2FBK A;  1FYL A;  1TNS A;  5HLT A;  3FXQ A;  1KU9 A;  3WOD F;  4B09 A;  2RVC A;  1ULY A;  2DQL A;  3BNI A;  4ESJ A;  2WY8 Q;  2VBW A;  3L2V A;  3QKX A;  3F8M A;  2BW3 B;  2DFE A;  3GTJ J;  3OY9 A;  4L0Y B;  2IA0 A;  1U0J A;  5CQE A;  2HYT A;  2GBY A;  3GTL J;  3RIR A;  3BZK A;  4JYK A;  2ADU A;  4UV9 A;  3QOP A;  3BR6 A;  5CVJ A;  4LB6 B;  1BI2 A;  5ILS A;  1ZTR A;  4DZP A;  2JN6 A;  3OL4 A;  1K79 A;  3BR1 A;  1YQA A;  4ZDP A;  4BY7 J;  3M07 A;  2CYY A;  2KLO A;  4XON A;  4U9N A;  2F48 A;  2Q2E B;  2DN0 A;  4XR6 A;  1TWG J;  3FZV A;  4I99 C;  4DYC A;  3S1R J;  1D0Z A;  4I2O A;  3N97 A;  3CME I;  2TRT A;  1FMW A;  1ZGJ A;  2ZXI A;  3I59 B;  1HXD A;  1WGX A;  4LLN A;  1MBE A;  2JA7 J;  2DBB A;  5M3M J;  5JVT A;  1X1A A;  3J7Z I;  1R4N B;  1CGP A;  1ZRD A;  1MKM A;  1QZZ A;  1DU0 A;  1LDJ A;  1EV7 A;  4G6Q A;  3C18 A;  4PJ0 C;  3EGQ A;  1MH4 A;  2EV0 A;  4CCJ A;  2R5Z B;  5IP9 J;  2K02 A;  1O3R A;  1P7J A;  2RC4 A;  2P5V A;  5AIQ A;  1Z21 A;  2ZKZ A;  1ODD A;  2QWT A;  5E3O A;  3CO6 C;  5E3L A;  4YII A;  2O5R A;  3AG4 H;  3CWR A;  4ENM A;  3FIS A;  4BHC A;  5GTH C;  1PUF B;  2ZCM A;  3M1C A;  5K5Q A;  4KIG A;  5GP9 A;  5KAF C;  5DV5 A;  2DOA A;  1W36 D;  1X58 A;  2RNJ A;  3KP3 A;  2OC6 A;  2CQX A;  1Y0U A;  3CC2 I;  1VQ4 I;  3CCE I;  3PJR A;  5ICF A;  2N8G A;  1O4X A;  1PVE A;  3IH4 A;  3K4M A;  5IOZ A;  2XRL A;  5GPA A;  4IHY A;  1APL C;  3F3X A;  4AYB N;  3BJB A;  2JA2 A;  1HBX G;  2HPM A;  5D5X B;  1C0W A;  5J8C A;  1W4M A;  5L3F A;  4Y17 A;  2DMN A;  1GXQ A;  3S3M A;  1IXS B;  2M5W A;  3BWG A;  1XDS A;  4A0Y A;  1K83 J;  2B0L A;  2ZJ2 A;  5JFR A;  2LY1 A;  1YJ9 I;  1O57 A;  3C2G A;  4LLG F;  4NDL A;  3S2H J;  1V5E A;  1BI3 A;  3FIW A;  5GAD J;  4WIB A;  3S15 J;  1IC8 A;  1WHU A;  4XBF A;  1JJ6 C;  3ANG A;  3A01 A;  2E5N A;  2M7A A;  4PGG A;  2XF7 A;  3BR0 A;  2W24 A;  1EH6 A;  3RCO A;  2F5C A;  5AON A;  3VW0 A;  4P55 A;  3KNW A;  2DO7 A;  2MBF A;  4PJM A;  5HNH A;  3S3O A;  4JOM A;  1XPX A;  3JAM K;  2CV0 A;  2L9S A;  2JPB A;  4MEX F;  3NWT A;  3QYB A;  2W1O A;  3FMR A;  2BZT A;  3WGH A;  4CDG A;  3TDU C;  3WG7 H;  2M2E A;  4XL9 A;  1F5T A;  4ABZ A;  3OIQ A;  3EPZ A;  2VE9 A;  3CZ6 A;  4NHJ A;  2LNB A;  3L1P A;  4OWR B;  2VIX A;  4UV8 A;  4ESB A;  4I02 A;  3CCV I;  1LVK A;  2DDA A;  3V4G A;  2PN6 A;  3ZQF A;  1MJA A;  3SEQ A;  3OYM A;  1VF9 A;  3DBH B;  4RM2 A;  1K6Y A;  3MEX A;  1F9N A;  1U9N A;  2LY2 A;  3TO6 A;  4PGH A;  2DPD A;  2JTV A;  1RRJ A;  1UG2 A;  3MKW B;  3TL4 X;  3DXJ F;  3PIP F;  5KNL A;  2DYS H;  3UR3 C;  3H3U A;  2JA8 J;  5J40 A;  2XAJ A;  1BI0 A;  1EJ9 A;  3QU3 A;  3T5X A;  1WZ2 A;  2DA4 A;  4MFE A;  2XGX A;  2NVU B;  2EIK H;  3HOU J;  3K2A A;  4BE2 A;  2Y0M A;  3FXU A;  3BQY A;  3CJR B;  2OA4 A;  4LJZ F;  2VKH A;  1MDM A;  1AA7 A;  2CUJ A;  3DEE A;  2O7O A;  3OMY A;  1I3A A;  5IT3 A;  2KT0 A;  2Y2Z A;  2OD5 A;  2IGK A;  1NK2 P;  3KE2 A;  3COL A;  1X2N A;  1D8K A;  4BS9 A;  1UAA A;  1HW1 A;  2DA5 A;  4FHT A;  1X1B A;  4EVI A;  2ZO4 A;  9ANT A;  1FTT A;  2ZOY A;  1WSU A;  1R9T J;  3S32 A;  1S72 I;  2XGC A;  5DCM B;  1YJW I;  4FTH A;  2GQQ A;  3B6A A;  3HJE A;  4XSZ F;  5E18 F;  1R00 A;  3KP4 A;  2P5L C;  3D0S A;  3WE2 A;  4FX4 A;  3QAH A;  2HWV A;  4CZC A;  1XMK A;  4IRG A;  5B1B H;  2GOM A;  2X6X A;  2C6Y A;  3BCB A;  2G7S A;  3W2A A;  1T0F A;  2L5Q A;  5FLX K;  2FNA A;  2KL4 A;  3LA2 A;  1OIS A;  4IQ4 A;  2Y30 A;  3S93 A;  3MFK A;  4ZTJ A;  2QBY B;  1RZ4 A;  4GCV A;  2R7Z J;  3W6J B;  1U5T C;  3I0T A;  4BE1 A;  2ISZ A;  2WWY A;  4EM1 A;  3BG7 A;  4RBO A;  4CGZ A;  1HST A;  2DMT A;  5H6R A;  1DDN A;  4V2G A;  3JW4 A;  3BCA A;  3HOT A;  4YFK F;  4ZYG A;  1PP8 F;  2JJ7 A;  2MW8 A;  5J3L A;  5J47 A;  5TRD A;  2RAS A;  1X4P A;  2W84 A;  5L3B A;  2MSY A;  4LG0 A;  3RPQ A;  2E1M C;  5D5U B;  4A3J J;  1U6G A;  4BQO A;  1G6N A;  1R4M B;  1X3W B;  2V4J C;  5KHD A;  1CQT A;  1TLH B;  4RGX A;  1D5Y A;  3I9V 2;  2FBI A;  3VYR B;  5CXG A;  3C7J A;  4ICH A;  3R0A A;  4O6J A;  3O60 A;  2EIN H;  4E7I A;  3KP6 A;  4CSW A;  1Z1D A;  4RB1 A;  3E97 A;  2WAF A;  3BJA A;  4MQV A;  3QOD A;  2K4B A;  2KRF A;  2E35 A;  1HW5 A;  2PI0 A;  2EIJ H;  3PNV A;  3FRQ A;  1TQP A;  3V78 A;  2L7M P;  3RSN A;  4F91 B;  3BJO A;  1A35 A;  1RI7 A;  2NP5 A;  1YIT I;  2MC4 A;  2A69 F;  2F4I A;  4CCO A;  3CCR I;  3WG9 A;  2YS9 A;  2RGV A;  1Z0X A;  3KEY A;  5KVR A;  2AXT C;  2OQG A;  1KGS A;  2QEN A;  1DP7 P;  3U1D A;  2E36 A;  4PCQ A;  3RJP A;  4NQW B;  1OCC H;  3W2V A;  3E3V A;  3VVY A;  2L7Z A;  2KPM A;  4MO7 A;  5L3C A;  4M3F A;  4BAC A;  1G3Y A;  3E1S A;  2G7H A;  2W85 A;  3BTL A;  3RQ4 A;  3FX3 A;  5K7Z A;  2FU4 A;  2XIG A;  2GIV A;  4HQM A;  3TP0 A;  2HS5 A;  4RB3 C;  3MKY B;  1IF1 A;  3CCS I;  2VQG A;  5M3F J;  1Z3Y A;  3Q9S A;  1J5Y A;  3HTU A;  1LB2 A;  3ROU A;  3PFI A;  1U2W A;  4JQF A;  3ERM A;  1YHQ I;  3WE3 A;  5JVG F;  1YW7 A;  1V5G A;  4A12 A;  5IT9 K;  3IHU A;  1KA8 A;  3F6V A;  3NRV A;  2R5Y A;  5FKN A;  5EZG A;  2LR8 A;  5KAI C;  5F1R A;  3ABL H;  3FM5 A;  3DKX A;  4KMU X;  2E34 A;  2CO5 A;  2X1E A;  3B6C A;  2L02 A;  4G7H F;  2ZME C;  3JRC A;  1I27 A;  1YIO A;  1AKH A;  2DG8 A;  3MZ8 A;  3VPR A;  1IN4 A;  1OR7 A;  3ZRG A;  3WTX C;  4AYB A;  4UUT A;  4E7S A;  3HXL A;  4BJ6 C;  4M71 A;  2NNN A;  3PUB A;  2EZH A;  3RD3 A;  4GCL A;  1YOV B;  3IUO A;  4GYI A;  4I09 A;  2ISY A;  4JX6 A;  2L54 A;  1I50 J;  4IQJ A;  5TGT A;  2E71 A;  1WJ5 A;  5IP7 J;  1I5Z A;  4E4H A;  1NTC A;  1BR4 A;  4AD9 A;  5ILU A;  2F5E A;  2OZ6 A;  3AL0 B;  3ZMV A;  3HKZ N;  1JGG A;  1SMY F;  5KCM A;  1KQ0 A;  1FEX A;  1MMN A;  3GLX A;  4Y4R A;  3V7R A;  2PBI A;  3CC7 I;  3OYD A;  2UWM A;  1KYW A;  2L7F P;  5F27 A;  3OYI A;  1KYZ A;  4E7K A;  4UUS B;  4E70 A;  4ZYD A;  1MSF C;  2QQB A;  4ME9 A;  3DTI A;  4TV7 A;  2HDW A;  2LBF B;  2PQ8 A;  4F3Q A;  3HGY A;  1VQL I;  2ZSI B;  5HOD A;  4XRS A;  3HPG A;  4N0B A;  2REK A;  5HDG A;  3DTK A;  5HOO A;  1K6O A;  2UZK A;  1S7A A;  4XLA A;  2UXI A;  4HNU A;  2LD5 A;  1Z77 A;  1LFU P;  2E1N A;  4JNN A;  1TW3 A;  1U8B A;  1FSE A;  3LST A;  2K85 A;  5JR3 A;  1BIB A;  3DP7 A;  5A2Q Z;  1Q1V A;  4HAM A;  1JUS A;  5CVU A;  4HSR A;  4ZDL A;  5FHP A;  4HV6 A;  5EEH A;  4GRI A;  4I0A A;  3UNG C;  4IHV A;  5EF6 A;  1OYY A;  4MK6 A;  2H1K A;  3M8J A;  1Z67 A;  3L9F A;  3QPL A;  1VQ8 I;  1P9Q C;  3KYC B;  4QPQ A;  3LSP A;  4XN0 A;  1SAX A;  2AS5 F;  1FOY A;  2K9M A;  3HHG A;  1XSX A;  5GAH J;  3OS2 A;  2WBM A;  2EH3 A;  4C2M J;  2ICW G;  4GYG A;  3HB9 A;  1REP C;  2NOG A;  2I10 A;  3SQN A;  5K5O A;  3GFI A;  5CVI A;  4HF1 A;  2NP3 A;  4OAZ A;  4XOP A;  2HEO A;  3I53 A;  2CUZ A;  2FJI 1;  2UXX A;  3CC4 I;  4D0P A;  3T0Y A;  4UY8 I;  4U7B A;  4D1Q A;  2DTR A;  3VYT B;  2VLA A;  3HUG B;  1YE9 A;  4N9H A;  3NQO A;  4B44 A;  3OV8 A;  4KMF A;  3ZMU A;  1LJ9 A;  2FD5 A;  5FD5 A;  1ON2 A;  3ZMD A;  2HQR A;  1EF4 A;  2GOX B;  3N4M A;  1Y0N A;  1JKQ C;  3T6N A;  4EMS A;  3CCJ I;  1FJL A;  2OV7 A;  5EJC A;  3RPU D;  1YO5 C;  1VQO I;  2I5U A;  1BL0 A;  5LEK A;  3FXJ A;  4GDF A;  1MBH A;  3DPT A;  4G8X A;  1SFO J;  3ZPL A;  3H3Z A;  2K3P A;  3P9T A;  1Z9C A;  3MD2 A;  2V7F A;  3GBG A;  4J01 A;  2BY3 A;  4HX8 A;  4R1H A;  3FXK A;  4JBA A;  1KON A;  3D1N I;  3HOV J;  2E2H J;  2EK5 A;  3IWF A;  3Q0V A;  1TTY A;  5E79 C;  4HA8 A;  4DJA A;  1A36 A;  1R1U A;  2J5O A;  2GXA A;  3H5N A;  3S17 J;  1SVO A;  4P9F A;  2NVT J;  5FB2 A;  1LE8 B;  3M3Y J;  4O5V A;  3DEW A;  4CZZ A;  2HTJ A;  1KU3 A;  2VE8 A;  2NS0 A;  1T8I A;  3HG9 A;  3EYY A;  2L4A A;  1MNE A;  4CCK A;  4E7J A;  2OTL I;  2V9K A;  3CLQ A;  2E1O A;  5FFX A;  2MLK A;  2E2J J;  4F55 A;  3HTS B;  4WF2 A;  3O2P E;  1VQP I;  2CW8 A;  2IXS A;  5EGO B;  2DQR A;  1VZ0 A;  5FLM J;  2VBZ A;  4XLF A;  1TT0 A;  5M5W J;  5CPR B;  2HOA A;  1UHS A;  1YX5 A;  2EZK A;  3HPH A;  1ZN2 A;  3HIF A;  4PDK A;  3OYF A;  2L01 A;  4A3I J;  1J75 A;  5CKT A;  2WB1 N;  3SZT A;  4B4C A;  1PUF A;  1R49 A;  3I4P A;  1NG7 A;  2DMP A;  2Y31 A;  4MFD A;  4UVC A;  2W7N A;  2ZFW A;  3KIO A;  1SC7 A;  3P7N A;  5B5E C;  3WGI A;  3DPJ A;  3FMQ A;  5CW8 A;  5IOY A;  4KFC A;  1G3W A;  1XD7 A;  2FJ1 A;  2XAU A;  2PJP A;  1H9G A;  3I3L A;  1T33 A;  1TQI A;  2KKO A;  2L4M A;  5D8L B;  3J81 K;  1IUF A;  4KN7 X;  2EQR A;  3A0B C;  2D5V A;  2K3F A;  1QPI A;  3F0C A;  1TT5 B;  2XAQ A;  1OJL A;  3BR2 A;  4NC8 A;  2Z9O A;  3CJD A;  1W36 C;  1R5G A;  1W7P A;  1XN7 A;  3HYI A;  4BKX A;  3WTS C;  4EGZ A;  1E3P A;  3I71 A;  5E8G A;  1HF0 A;  2V1U A;  2DAO A;  1D1B A;  2LRE A;  4QIW N;  2JVG A;  4NC6 A;  3HIM A;  5EFY A;  3SWH A;  2GIZ A;  3O8H A;  3ONQ A;  5BPI A;  2JA6 J;  2YVX A;  2UXP A;  2QKO A;  3GX4 X;  2CMP A;  4MLO A;  4XRS G;  3REO A;  3ON4 A;  2UXN A;  4ESF A;  2A05 A;  4S0H B;  2M0M A;  1S29 A;  4ZTF A;  4ZH4 F;  1SD7 A;  5DM6 F;  2FEZ A;  2MAB A;  3E7Q A;  2B63 J;  2MLG A;  2HFH A;  2QUF A;  3HZJ A;  5J1U A;  3V7C A;  5AQC A;  3BLY A;  4EJU A;  1BW6 A;  4BL0 B;  3A1Y A;  2EPF A;  4YZE A;  1A04 A;  4CYD A;  2PZ9 A;  2Z33 A;  1FY7 A;  2VXD A;  1TW2 A;  2QQ9 A;  5JHF A;  5LGU A;  4XLC A;  1XSD A;  4RAZ A;  1L0O C;  3GVA A;  2VKV A;  1EH7 A;  4EM0 B;  4Y52 J;  4IRH A;  4B48 A;  1T38 A;  1ZRE A;  3LL7 A;  3JSO A;  2RV8 A;  3BPV A;  3RDI A;  1WCM J;  2VQL A;  4KJZ A;  3HTJ A;  2K9S A;  1PDN C;  1ZLK A;  1Y56 A;  3C2B A;  5J1R A;  4IOC F;  1GUU A;  2BVL A;  2ID6 A;  2J5P A;  3HKZ A;  3ZMT A;  1ZGW A;  1G4D A;  4KIB A;  3DU6 A;  1O7F A;  4EJO A;  2ZCN A;  3GTM J;  2IPQ X;  1XGM A;  5HDK A;  3VYS B;  1VQ5 I;  5F64 A;  1GHC A;  4EV0 A;  2NVX J;  4ENN A;  2P6S A;  1WH5 A;  2XC7 A;  2EB7 A;  1XX5 A;  2COB A;  3R61 A;  3CP8 A;  3SZG A;  1ETK A;  1R7J A;  1ORK A;  1T2K A;  2BXY A;  3HC7 A;  4IO9 F;  5DAJ A;  2RAE A;  4EM2 A;  2VPL A;  3LA3 A;  2RQP A;  3CDL A;  4KDP A;  2ZJR F;  4U9L A;  3CMA I;  4HRI A;  2CUF A;  3H0G J;  4DZJ A;  2PEX A;  3RKY A;  4ANJ A;  5HLG A;  4UB6 C;  2JK3 A;  3HM5 A;  1YX3 A;  2A5W A;  2V9V A;  4RAF A;  5L3G A;  1NH3 A;  2XRN A;  4B1R A;  2L9N A;  2L9R A;  3QPS A;  1SGM A;  3QP6 A;  5CJ9 A;  1OMI A;  1YS7 A;  2X85 A;  2DYR H;  3L2Q A;  2JA5 J;  4OMY A;  1BR1 A;  5EEA A;  3QYE A;  3EUP A;  2F2E A;  1T08 B;  4R8H A;  4W1U A;  2ZFU A;  3CF5 F;  3RQI A;  4ENJ A;  2KDO A;  4ZYA A;  3O8G A;  2IAI A;  3RKQ A;  2LOO A;  2R7S A;  4L5I A;  4MXM A;  2XHK A;  3HRT A;  2NOJ B;  5H20 A;  2X48 A;  3EQL F;  2QBY A;  1GXP A;  2VOD A;  1RR8 C;  2Y0S N;  4L18 B;  1WJB A;  1J0R A;  2ZME A;  3ZQL A;  1KZH A;  2OER A;  2VXZ A;  3ZQH A;  2XKO A;  1VQ7 I;  2HVQ A;  3L2R A;  1A6I A;  2F5F A;  3FXM A;  1IW7 F;  1QVT A;  1O7L A;  1RC9 A;  2LLK A;  1XGN A;  3CCU I;  1LNW A;  1F1Z A;  4JP0 A;  1IN8 A;  1UCR A;  3ASN H;  2EBI A;  2E60 A;  1WI9 A;  2ZNZ A;  2OUM A;  1MMG A;  3G3Z A;  4G6T B;  4Z2Y A;  1YRN B;  4Q47 A;  1OQY A;  4Q5S F;  2IVM A;  2EIM H;  1XSV A;  1J9I A;  1YLF A;  1DP3 A;  3FKJ A;  4HLY A;  5C4J J;  2HXO A;  4RGU A;  3SDG A;  2HQA A;  2CV2 A;  1B9N A;  1FMV A;  3ERE D;  3ON2 A;  1SAU A;  2QZ8 A;  2RKH A;  3FHZ A;  3QQA A;  1VND A;  4HW0 A;  2H1L A;  2K86 A;  5ERI A;  2ZJQ F;  4FE7 A;  2GA2 A;  3KEQ A;  2RRE A;  2YU3 A;  4K2E A;  4HX4 A;  1A5J A;  1FP1 D;  1X3Z B;  4OAY A;  3T8R A;  5C4Y A;  4A3E J;  4XRM A;  3WTT C;  2V6C A;  1U8R A;  4L9V A;  3EUA A;  3GF2 A;  5IPA A;  5FKK A;  1FOK A;  2XF5 A;  5IY5 H;  1L3L A;  4M9Z A;  3NWS A;  5M5X J;  1GVD A;  2JZY A;  4NQW A;  1JKP C;  5FD6 A;  4P1W A;  3VDX A;  1GT0 C;  4LIT A;  1UI6 A;  1USS A;  3VWB A;  3VOK A;  5LRR A;  1FBQ A;  1K78 B;  3ABM H;  2KIQ A;  3BG9 A;  3LFU A;  2PBX A;  5D18 A;  4P9U A;  3OR1 C;  3DCF A;  3M9A A;  2ZOZ A;  2M34 A;  1R71 A;  1WPK A;  3CJT B;  1ZRC A;  2WB1 A;  2V9P A;  1TWH J;  4RGR A;  1B72 B;  3W3C A;  4WXC A;  5HSZ A;  2OCE A;  2GXB A;  1OCO H;  1OCT C;  3A02 A;  4I01 A;  3G1M A;  1HW2 A;  3D5L A;  1IRG A;  2P0W A;  2DK8 A;  2Y48 A;  2WAE A;  4WWC A;  4UDS A;  3CES A;  3LWJ A;  3JCU C;  3S5R A;  3BG5 A;  3MKL A;  1ZEL A;  2XGE A;  3R0J A;  4XNF A;  1N78 A;  1RR7 A;  4M6X A;  2DCE A;  1WFX A;  2BBY A;  3CUQ B;  4Y7N J;  1GDT A;  1POG A;  2FA5 A;  2LP0 A;  1SVL A;  4BAY A;  2ELJ A;  4DOZ A;  2MFZ A;  3JRH A;  2CQN A;  3TW7 A;  2LFB A;  2OQR A;  4I0B A;  4NN1 A;  2CQ7 A;  3GTG J;  2LKX A;  3R6S A;  3COA C;  2HVR A;  1QQI A;  5E1Z B;  3OYN A;  1UHW A;  4JX5 A;  2E1C A;  4OD5 A;  3RTR A;  1JTX A;  1Y6I A;  2CQK A;  2RNG A;  5FKL A;  3H35 A;  4RB0 A;  2P5K A;  2VJ5 A;  5ICC A;  4IHW A;  2M8E A;  2EFQ A;  1UHM A;  2DT7 B;  4XKB A;  5M5Y J;  3UKG A;  1J2X A;  2ID3 A;  1E2X A;  5DEQ A;  1VQK I;  3OYC A;  5FGL A;  1BC7 C;  1WI3 A;  1I6X A;  1IO2 A;  2M9H A;  1WJD A;  4B3X A;  1BA5 A;  2OAZ A;  1LFB A;  2TDX A;  3LQQ A;  5GAE J;  2O3F A;  5HNF A;  2X1C A;  4KN4 X;  2P7C B;  3TOA A;  2M87 A;  3G7R A;  5K5R A;  2MG4 A;  4B47 A;  4FQG A;  4CCM A;  5FKM A;  1FSH A;  2IS6 A;  2CW7 A;  2VPR A;  4XM3 A;  4YFX F;  2XGD A;  2W82 A;  2LBF A;  4KUM A;  5DYM A;  5DDG A;  1RET A;  2X1D A;  3I55 I;  2V79 A;  1JKO C;  1JI8 A;  1X2M A;  3BC8 A;  2JUG A;  4HEA 2;  4AIJ A;  3IUV A;  3VVX A;  4OU0 A;  2DPU A;  3JSJ A;  2FX0 A;  1QZE A;  2Z5U A;  2IEK A;  3GXO A;  4FIS A;  2YUS A;  2R7Q A;  1XMA A;  4YIF A;  1XGO A;  5CQG A;  2EFN A;  5AIP A;  1I1G A;  2ELK A;  2DU9 A;  1S5L C;  1RKT A;  2B7E A;  3TDZ C;  4ASN A;  5J1Y A;  3ZQ7 A;  2W25 A;  3S14 J;  1FIP A;  1ZG1 A;  1YTY A;  4RLF A;  3BPX A;  1B8I B;  3BY6 A;  1LVA A;  1A6Q A;  3IRQ A;  1G59 A;  3NS4 A;  3K6G A;  5D19 A;  5ICE A;  2P8T A;  1ZGA A;  3BJ6 A;  2H8W A;  4II3 A;  4CHU A;  4I98 B;  3IAS 2;  1TP4 A;  4GFB A;  1QHH D;  2NYX A;  3TO9 A;  2D45 A;  1WJF A;  3JRD A;  3ZGK A;  1XB4 A;  4J00 A;  1T98 A;  4M9S A;  1FBU A;  3PFY A;  2X6O A;  2CJJ A;  4UVB A;  4XQF A;  1MJ9 A;  2HGC A;  3QPH A;  3MCZ A;  3VYU B;  2DDB A;  2Q0O A;  4W97 A;  1MIJ A;  3HRM A;  1R23 A;  1JTY A;  5CXI A;  2YR2 A;  3A4C A;  2DK5 A;  4WXD A;  4PFO A;  2XB0 X;  1HLV A;  1D8J A;  3KYL A;  4IZZ A;  4L5J A;  3CUQ C;  2Z99 A;  1PJR A;  3C1D A;  3IH2 A;  3VEP A;  1UI5 A;  4CIC A;  4LK1 F;  4C9Y A;  4ZZL A;  3JRA A;  2EFW A;  3BG3 A;  3JSP A;  3ZCO A;  2DOF A;  1TWF J;  3KZI C;  4HF2 A;  4IL6 C;  1MJB A;  1SMT A;  5EYR A;  1YIJ I;  3GW2 A;  3K4J A;  2DFI A;  2ESN A;  2X6Y A;  3ML6 A;  5LLQ A;  4ZJZ A;  2W53 A;  3PPB A;  3ZR8 X;  5GPC A;  5FJ8 J;  3AKZ A;  2P6T A;  1VQ6 I;  1PYV A;  3PIO F;  1X1D A;  2B9S A;  2HDC A;  2R7D A;  4G7Z F;  1ZHF A;  4BQQ A;  2EJR A;  5K1Y A;  3VOE A;  5B3S H;  1BIA A;  2Y0S A;  3V8L A;  4AM3 A;  1LFP A;  3DU5 A;  2RQQ A;  1MGT A;  3HSR A;  4X6A J;  3A01 B;  4L5E A;  4LMY A;  3ECH A;  4UNO A;  2GAU A;  1MH3 A;  1D0X A;  2OI8 A;  4YG2 F;  1P4X A;  1Y8Q B;  1W5C C;  4ZYH A;  2W4S A;  2DA3 A;  4BXU A;  4RGS A;  3IP4 B;  1V54 H;  4X1E A;  1ETX A;  4H0E A;  4HDV A;  2IGM A;  2BV6 A;  3B73 A;  3FXR A;  3MZH A;  4KYW A;  2HXI A;  3BG6 A;  4BJT A;  2IT0 A;  1I6H J;  3WTZ A;  4OIP F;  2EA2 A;  5FO5 A;  3CO7 C;  1D5V A;  3E0J B;  4NB5 A;  4N9I A;  4ENK A;  5C4X J;  3GCM A;  3EUH C;  3KZZ A;  4ZC3 A;  1JGS A;  2LKS A;  3QBM A;  4BYY A;  3ABU A;  5LD2 C;  3SHF A;  5E1W A;  2QOP A;  1QA6 A;  2H27 A;  3ZQI A;  2O6G E;  5LGT A;  1G3T A;  1XG1 A;  3AG3 H;  1SEU A;  4DYR A;  5HS9 A;  3LSG A;  4FAS D;  2O8K A;  2HZT A;  2H94 A;  2HYF A;  2LF8 A;  5GTI C;  1QBJ A;  3K70 D;  2HKU A;  3H5R A;  4KIF A;  1E3H A;  2X4H A;  1ETV A;  3LMM A;  2UV1 A;  5CVR A;  3HRU A;  2BE5 F;  2LYC A;  1D1A A;  3HGG A;  4CUG A;  1FOX A;  1WJE A;  4CCL A;  4IHS A;  4D7N A;  2O8X A;  5DS9 A;  5EG0 A;  1YG2 A;  2QSH X;  1G3S A;  1IRF A;  1S7E A;  3I4N J;  1W5S A;  1IUY A;  2CSO A;  1N77 A;  1MDM B;  2LC2 A;  3G6E I;  2ZNY A;  2NX4 A;  5IYC J;  3GFL A;  4M74 A;  1FPQ A;  4E7L A;  3NNR A;  2KRH A;  4WXH A;  3VTI A;  4A3K J;  1IV8 A;  2MD0 A;  2O7T A;  3OOP A;  4LG3 A;  2WUI A;  1ETO A;  2AHQ A;  1STZ A;  4QLC U;  4MEY F;  4A6E A;  4XRF A;  1P2F A;  2FXA A;  2NXN B;  1FP2 A;  1XS9 A;  2VKE A;  5BPD A;  4NEL A;  3PQJ A;  1XC5 A;  2M7B A;  5FFZ A;  2XSD C;  1RUN A;  2K9L A;  1P7I A;  3BT9 A;  3QWL A;  5F0F A;  3W6K B;  2OTJ I;  2DT5 A;  4B43 A;  2R7U A;  2BYV E;  3ZOB A;  1K7A A;  2CWE A;  3H0D A;  2AQF A;  3DPL C;  3VUQ A;  3OWT A;  3K69 A;  3M4O J;  5LRS A;  1IZ1 A;  3E6C C;  3LWF A;  1HOM A;  1BJA A;  1AOY A;  1HKS A;  1YW9 A;  2MH2 A;  5HBU A;  2YU9 J;  1T95 A;  1JJ8 C;  2VON A;  3A0H C;  3M8F A;  4CA0 A;  3GTO J;  4B3A A;  4IJA A;  1OYW A;  3KP2 A;  4GO1 A;  1UB9 A;  3ZP5 A;  3NXC A;  2EIL H;  1QZY A;  3HBL A;  3VFZ A;  2LKP A;  2R7V A;  2PMZ N;  4LG0 B;  1ITY A;  2CU7 A;  3RKW A;  2LTP A;  1B1B A;  2PX9 A;  2DOD A;  5EEG A;  5D4S A;  4U7D A;  2M4G A;  3KP7 A;  3MKZ A;  3GTQ J;  1W1W E;  4PSW A;  2Y69 H;  3B02 A;  1ZKG A;  3K10 A;  1MBF A;  3QYF A;  3L2U A;  1TNT A;  2GFN A;  2QGU A;  3QU6 A;  1QO0 D;  4YFN F;  5ED4 A;  3OIO A;  5E17 F;  2FMY A;  5E1X A;  1IN6 A;  4NNJ A;  3LSH A;  3H9J A;  4EQQ A;  3FK6 A;  3RH2 A;  3ZQG A;  2KZG A;  4U0W A;  1QNT A;  1IV6 A;  4KT6 A;  2LG4 A;  2VJ4 A;  4XLN F;  4KT5 C;  3CLO A;  5H6Q A;  2IJL A;  4B8X A;  1U78 A;  2BW3 A;  3ANP A;  1ZR4 A;  1YI2 I;  1BR2 A;  1Z6R A;  4AWX B;  3AL0 C;  4PUS A;  4CO8 A;  1Z05 A;  2LSO A;  3RKX A;  1WVR A;  3HOX J;  1DPR A;  3DTE A;  4XKC A;  4PK4 A;  1S3J A;  3H3V K;  2Q1Z B;  1E3O C;  4F52 A;  4O3M A;  4BY1 J;  4IKF A;  4QWQ A;  4UVA A;  2ME0 A;  1UFM A;  2XKP A;  4OIO F;  2G9W A;  2CGP A;  4JKZ A;  1ETQ A;  3FDY A;  2WGB A;  4C2M A;  2NRA C;  2Q2E A;  1EH8 A;  2QSF X;  4GCT A;  2DOE A;  4R79 A;  5J6X A;  3PSI A;  3K1N A;  4RDU A;  2WV1 A;  3DF8 A;  1S7O A;  2EV6 A;  2CFO A;  2E7X A;  4OIQ F;  3K4K A;  2K4J A;  4DIQ A;  4KNY A;  3RI4 A;  4E7H A;  2K27 A;  3D5S C;  2F5V A;  1CF7 B;  4GFL A;  2VOP A;  3I59 A;  1ZYR F;  3S1M J;  5E3M A;  4WCG A;  1R1V A;  3J7A Y;  1R58 A;  3DEU A;  3ELK A;  4IOA F;  1FBS A;  3KKD A;  1YS6 A;  2LDU A;  4AIH A;  3BP8 A;  2GEN A;  2HKO A;  2R5Z A;  1HDP A;  4U87 A;  2FBH A;  2W48 A;  4L9T A;  4OIN F;  1B4A A;  4YEJ A;  4E7Z A;  2R5Y B;  1NK3 P;  2XAH A;  3WTV C;  2KIU A;  3WTW C;  2MA3 A;  1ENH A;  3OYG A;  3OSG A;  1BM9 A;  4BEH B;  4UUV A;  1UZC A;  4FT8 A;  3JR9 A;  5HVQ C;  2VT3 A;  1IDZ A;  3VOD A;  2NVY J;  3MN2 A;  1BI1 A;  2FBQ A;  3G1O A;  4PFP A;  3HSE A;  1AKH B;  3I58 A;  1B9M A;  3AG2 H;  1IGN A;  1F36 A;  4AUX A;  1AWC A;  3LFK A;  3G2B A;  1DGW Y;  1HQC A;  1B6A A;  2GXG A;  2O03 A;  3E5U A;  1Q1H A;  5BS6 A;  5F1J A;  2Z1D A;  1SD6 A;  5EDN A;  3BHQ A;  4DYQ A;  5LHH A;  2DXI A;  2YVE A;  2VC1 A;  4RM3 A;  3F23 A;  4BE0 A;  3R60 A;  3VVZ A;  2RN7 A;  3E6D A;  1RPW A;  1WWX A;  2HPI A;  1UG0 A;  1AHD P;  1JHH A;  4AU7 A;  4CGR A;  2LVS A;  2HOS A;  2A6E F;  3QPT A;  1G2H A;  3CCY A;  4D5C A;  2Z2S B;  2D1V A;  2PLY A;  3OR2 C;  3FXL A;  3PNY A;  2DT6 A;  1WKM A;  5BMZ A;  3TQN A;  1DQU A;  2Y75 A;  3MMY B;  3BRO A;  3TW6 A;  1RNL A;  2XAG A;  1MMS A;  4YEL A;  3I64 A;  5DTD A;  3BR3 A;  4XSX F;  2YPR A;  2DFF A;  3JTG A;  3KP5 A;  3H1C A;  3LHQ A;  2A61 A;  3ULQ B;  1XTA A;  4BH9 A;  1H0M A;  1HCR A;  3H9G A;  2D1H A;  1FX7 A;  3J80 Z;  5LBQ A;  3G73 A;  4PJN A;  2EFP A;  2EZL A;  3WHB A;  4QSH A;  4EEF G;  1QU3 A;  2V6E A;  2LY9 A;  4D5F A;  2FUG 2;  1KQ8 A;  2JPC A;  2VJI A;  4A0Z A;  2VKD A;  3MVP A;  5HDN A;  2QM3 A;  4RMN A;  1Z91 A;  5FRM A;  3MWM A;  1IN7 A;  1XDU A;  4FX0 A;  2Z16 A;  1WH7 A;  3SXY A;  3D5R C;  2ECC A;  5TJJ A;  4RAY A;  2E5Z A;  3QOE A;  1T6S A;  3PQK A;  3CRJ A;  3WGG A;  3DKW A;  3GEU A;  5B1A H;  4A3D J;  3DFG A;  3SEZ A;  2KMU A;  2XUB A;  5L3D A;  3GO5 A;  2BGC A;  3WTU C;  4RA2 A;  2XPU A;  2CFX A;  2NNY A;  4IF4 A;  2UXH A;  2WC2 A;  1M1E B;  4XK4 A;  1W0U A;  1FYK A;  4P96 A;  2A5Y B;  5IYB J;  5HLH A;  3G1L A;  3OYB A;  2A6H F;  2ZCW A;  3Q3S A;  3OSF A;  2BVM A;  2PFV A;  3HSF A;  1SFE A;  3TMO A;  2JSP A;  5HS7 A;  3NI7 A;  4I76 A;  3VSK A;  4BBR J;  4D9J A;  2BHY A;  4ACI A;  3F8B A;  1Y1V J;  3K9T A;  3CUQ A;  5BNG A;  1NG6 A;  1KU2 A;  3BR5 A;  1IXC A;  2IS2 A;  3M8E A;  1MZB A;  1SD4 A;  1XMX A;  1GLN A;  3P9K A;  2IP2 A;  2LF7 A;  1HSJ A;  2DI3 A;  3VIB A;  2F4O B;  2Y9Y A;  2R7X A;  3F8N A;  4BQA A;  2M3A A;  4HNT A;  2M8G X;  2GZW A;  3A03 A;  4WK8 F;  2BHZ A;  3HRS A;  3NRG A;  4G6D A;  3EET A;  4LK0 F;  3PO2 J;  1TC3 C;  3HTH A;  4NUB A;  4HYE A;  5HAW A;  5FGM A;  3RZD J;  1ZR2 A;  3HEF A;  3LAJ A;  2LRD A;  2A6T A;  1WRJ A;  4UB8 C;  1JE8 A;  3EDP A;  5DCM A;  3DQV C;  3GYH X;  2NS7 A;  1ERD A;  1P6R A;  3P5J A;  2DJI A;  1F4K A;  2HTS A;  4N4N B;  2HI3 A;  3LQR A;  3RPU A;  2G0E A;  2L2O A;  3LOC A;  1V3F A;  3BQZ A;  3V6G A;  2V1N A;  4IXA A;  1S9H A;  1Z3X A;  2DLL A;  1O3Q A;  3M7G A;  4P5O A;  2MD5 A;  2OF7 A;  1D1C A;  3E6M A;  5BQT A;  1JXS A;  1X4O A;  1R5I D;  3ABT A;  2R7T A;  3KLN A;  1BOB A;  2V26 A;  2AO9 A;  1MMD A;  3CP2 A;  2G7L A;  2ZBK A;  3K4C A;  1SD5 A;  2PMZ A;  5CLS A;  4A3F J;  4V2F A;  4IRI A;  1SVM A;  3SJM A;  4HBL A;  3BTI A;  3HE0 A;  3P9I A;  3BRU A;  3EUH A;  3WHC A;  4CYC B;  1ZK8 A;  3IKT A;  3DV8 A;  1B8I A;  2IA1 A;  4GXO A;  4BJ5 C;  3KZY A;  2GWR A;  3F9K A;  3GTP J;  1HA8 A;  1HKT A;  4AVZ A;  2YX4 A;  1ZLJ A;  3I5U A;  1LPQ A;  4XOT A;  1SFX A;  2BEO A;  4II2 A;  4J19 A;  2DMU A;  3GZ5 A;  2VT2 A;  2L7K A;  3FF5 A;  4XLP F;  3HOS A;  2O61 A;  2LK2 A;  1QHG A;  2CG4 A;  4BHB A;  3K0L A;  3BZC A;  1FOW A;  3S16 J;  4M73 A;  3JAM Z;  2CW0 F;  1Y8R B;  3OYH A;  5D8K B;  2QIB A;  2E2I J;  3K2Z A;  3RZO J;  2YVH A;  1ETW A;  3CDH A;  2ZC2 A;  1BOA A;  2OZU A;  1H9T A;  3IV5 A;  2A2F X;  4JK1 X;  3V42 A;  1BJZ A;  3IC7 A;  3VSL A;  1A31 A;  3B81 A;  2Q8K A;  3AFH A;  3K4N A;  1W7P B;  2DA7 A;  1S8N A;  1ETY A;  2PJR B;  2R92 J;  3PNT A;  4RS8 A;  5J8F A;  4M3E A;  5BOX A;  2A07 F;  2KJB A;  2WY7 Q;  2EV5 A;  3V8J A;  3F8F A;  2LMD A;  1V4R A;  2WAD A;  5LFA A;  1ONV A;  2UXO A;  2P7V B;  3OIP A;  5L3E A;  1IAW A;  2G7G A;  1H8A C;  4A3C J;  3HDD A;  3E5Q A;  3PAS A;  1IJW C;  3Q0U A;  2Y9Z A;  1FT9 A;  2B1E A;  3Q0W A;  4M3D A;  1R36 A;  3CCL I;  2HKX A;  3I56 I;  1U5T B;  2K40 A;  3H36 A;  2IRF G;  2R0Q C;  3M1E A;  3U2R A;  4LIV A;  5IYD J;  2VL8 A;  4HNV A;  4I7H A;  1B59 A;  1XCV A;  3H92 A;  1TWA J;  4BUP A;  4EJT A;  5FKO A;  1JUM A;  2K9N A;  3PSF A;  1ZG5 A;  2WAQ N;  3W2W A;  3BOQ A;  3ECO A;  1MD0 A;  3SFZ A;  3TED A;  4L9N A;  2QSG X;  5JLX A;  2K7L A;  3KKC A;  2PMU A;  1AU7 A;  2KIS A;  2E1M B;  2KJC A;  3V8K A;  4DNC A;  3J7A O;  3MNL A;  4WX9 A;  1EKE A;  4RAG A;  3G71 I;  2NAZ A;  1MBJ A;  3CMM A;  4PZJ A;  5HLI A;  4MGR A;  2R7F A;  2ELH A;  3GZ6 A;  2ZY9 A;  3ZQQ A;  1OLT A;  3BTJ A;  3K1M A;  4U0V A;  3G56 A;  3VW1 A;  5FLV A;  2VI6 A;  1U9O A;  2M45 A;  3OL3 A;  1ZH5 A;  3NEU A;  2DA6 A;  4PSX A;  4C3J J;  4UHT A;  2ZXJ A;  4QPO A;  3AG1 H;  1FYM A;  2L9V A;  4IHT A;  1IDY A;  4LGW A;  4A3B J;  1MNM C;  1S6L A;  4XN3 A;  2F4M B;  3I54 A;  3LA7 A;  4HPQ A;  1Y39 A;  1R22 A;  2HQN A;  5FLX Z;  3CDI A;  3LSR A;  4KIS A;  2PMH A;  1MSE C;  1IG7 A;  2KIM A;  3F21 A;  4ZDO A;  1OCP A;  2UUZ A;  2ESH A;  1BW5 A;  1FZP B;  2JQ7 A;  1IRX A;  1TQM A;  1Z7L A;  3IRR A;  3W6V A;  4MTD A;  3KX2 A;  4EJV A;  3NAR A;  2X51 A;  1X1C A;  2HDD A;  5FRN A;  1MBG A;  3LAP A;  2R93 J;  3S1N J;  4XLH A;  1I39 A;  4UUS A;  1BN5 A;  4ITV A;  1P4A A;  5CVV A;  2D6Y A;  5FRO A;  4FET A;  1SFU A;  1ACI A;  4Q48 A;  4BXX J;  4GFK A;  3K70 C;  3DPU A;  3PUF A;  1F43 A;  2OBP A;  3L09 A;  2IGN A;  2QQ8 A;  2AQE A;  5JLW A;  2H6B A;  5B66 C;  2F6C A;  2MH9 A;  5EZH A;  3IWZ A;  4AC6 A;  5DM7 F;  2R7R A;  1YJN I;  3FXO A;  1JT0 A;  2ETH A;  3CUO A;  4HG2 A;  3CJN A;  4IHX A;  2A3S A;  2WTE A;  1YFH A;  2DFH A;  5DD4 A;  4PXI A;  1DGR M;  2ECB A;  3MAJ A;  4HOB A;  5E20 A;  2V1X A;  3K1P A;  2H8R A;  1WJA A;  3EUK L;  2TCT A;  3CQZ J;  3IH3 A;  4C2T A;  2IGO A;  1H89 C;  1GVJ A;  1FIA A;  1YYV A;  4MNU A;  2XSJ C;  2ZME B;  1W5T A;  2L0K A;  5F6F A;  1UST A;  3FMS A;  3CF2 A;  2DG7 A;  4BQN A;  3TP3 A;  1OKR A;  1V55 H;  2OCC H;  4JL3 A;  4NC7 A;  4Q4Z F;  2HYG D;  2CUE A;  3HTI A;  1VQM I;  3R4K A;  2FRH A;  2R7O A;  3KZ9 A;  1HKQ A;  1FC3 A;  2BXZ A;  4F7Z A;  3JTH A;  1MMA A;  4XMY A;  4FCY A;  3F22 A;  4AF5 A;  4EAT A;  3U1K A;  3GME A;  2ZCX A;  4HLX A;  3HTA A;  3DLA A;  4DBQ A;  2VAS A;  3A2K A;  1D3Y A;  1FTZ A;  2FQ3 A;  1O3T A;  1N75 A;  2XPW A;  5D6F A;  3FKI J;  2G3B A;  4EGY A;  1ZAO A;  2KFD A;  2YSR A;  2DW4 A;  4MQ9 F;  2UXU A;  3HUG A;  4Y33 A;  3TBI A;  3WTY C;  4IX7 A;  5IT9 Z;  1DPU A;  4MHG A;  3S3N A;  3FBI B;  1J59 A;  2OJE D;  4DW6 A;  1SFK A;  1LEA A;  4U88 A;  5IP6 A;  4C30 A;  5ICG A;  2D2W A;  1X1P A;  4M72 A;  1DU6 A;  3KLO A;  1MBK A;  2XRO A;  3NAU A;  1ZAR A;  3JRE A;  2ZB9 A;  3TKY A;  3DLL F;  3TOB A;  2RDP A;  1LQ1 A;  4XOR A;  3OYL A;  4HST A;  1V5F A;  1U3E M;  3MQ0 A;  3AAF A;  5CYV A;  4C3I J;  1JUP A;  3OOU A;  3LNQ A;  1Z7U A;  3KCC A;  2GLO A;  5LHG A;  4I6Z A;  1IXR C;  3F6O A;  4KIC A;  3SDB A;  4A3L J;  2JWT A;  2QKM B;  1JHF A;  4F93 B;  1WJC A;  1LE8 A;  4L62 A;  4AVP A;  5F0H A;  4KWA A;  2QKL B;  4L0Z B;  1CF7 A;  4XKV A;  3QRF F;  5J4V A;  3J7Y J;  3FBN B;  2ZXH A;  2ACJ A;  2V57 A;  3LJL A;  1DUX C;  4HDU A;  4ZZD A;  1D0Y A;  2I8D A;  4M6Y A;  2DA1 A;  3P9C A;  3IL2 A;  4GCK A;  2W00 A;  5DCF A;  4XIC A;  4QTR A;  1PUE E;  5EGO A;  2CS3 A;  4UXN A;  3T8T A;  1LDD A;  4XKW A;  3TGN A;  4MTE A;  2IBD A;  1OYI A;  2WV0 A;  1GV2 A;  2HYJ A;  4BDZ A;  3T1B A;  1VTN C;  2VQH A;  4BEH A;  3L00 A;  3AQS A;  5J4Y A;  1K61 A;  4Z6Y A;  3SFI A;  3HOW J;  2XF6 A;  2OU2 A;  2KHM A;  3G4S I;  3CCQ I;  1RIO H;  1O3S A;  4V19 K;  1R6R A;  2VB6 A;  4YIR X;  3KEO A;  3QP5 A;  3EYI A;  3C3W A;  3DKY A;  2L3D A;  2VQC A;  3H5A A;  5H2F C;  2R7W A;  1W7P D;  5E3N A;  4Y15 A;  4A0X A;  5E8I A;  4XID A;  3IAM 2;  3CMY A;  3CCM I;  2DTZ A;  4H4K C;  5C3E J;  1SAN A;  4A6D A;  1I3Q J;  2XPV A;  3SZP A;  3L7W A;  1XGS A;  3GZN B;  1JKR C;  2XAF A;  1XCB A;  1FWZ A;  2FSW A;  5HS8 A;  2B3W A;  4BNC A;  1WQ2 A;  2OPT A;  2VJJ A;  3VP5 A;  4DQ2 A;  2XDV A;  3KYD B;  2M30 A;  1EA3 A;  3HOZ J;  2QQA A;  1KU7 A;  2IU5 A;  2QTQ A;  2QLZ A;  3ZQC A;  3AQT A;  3K4L A;  4M9X A;  3L2C A;  6PAX A;  3F72 A;  4M3B A;  2E19 A;  3E7L A;  1P4W A;  1R5H A;  2CQQ A;  2HQ5 A;  4FE4 A;  4GGG A;  3BDD A;  5KK1 A;  4A69 C;  4CH7 A;  2WAQ A;  2STW A;  3E5X A;  3ZXS A;  5DD8 A;  3JRG A;  3PO3 J;  2F07 A;  4BBS J;  3Q5F A;  3KPH A;  1X19 A;  3LSJ A;  1QVU A;  4S04 A;  5DUI A;  4AC0 A;  4E6K G;  1BBY A;  3GFM A;  2DMQ A;  1T39 A;  3DBR B;  2IA2 A;  3PL8 A;  1YW8 A;  2EZI A;  1G8X A;  3CJQ B;  2VBY A;  3LSM A;  3CD6 I;  4BHP A;  2FOK A;  2QCO A;  4PJJ A;  1UJ8 A;  3HHH A;  4XLE A;  5H9T A;  1Y1W J;  1LDK B;  5F0C A;  1ZQ3 P;  1J7K A;  4C2U A;  2PFB A;  5K7F A;  5F04 A;  4M3G A;  3S2D J;  1RKW A;  3JRB A;  4HQE A;  3ZMS A;  1GV5 A;  5TIS C;  3O3K A;  3GTK J;  3Q9V A;  4BU2 A;  2QYO A;  3U21 A;  3DBL B;  2W57 A;  5ILV A;  2DA2 A;  2KRC A;  4AID A;  1J09 A;  3GWZ A;  2IS1 A;  1E17 A;  2FQ4 A;  3F1B A;  2JVH A;  1RES A;  2R3S A;  4HF0 A;  5D4R A;  3OS0 A;  2GM4 A;  4M6V A;  1NHA A;  2QF7 A;  2CH0 A;  5A2Q K;  3BCG A;  4LFU A;  1UEL B;  1OPC A;  1I1S A;  2HZD A;  2VUM J;  4HKU A;  5FMP A;  5JHU A;  5LGN A;  4NBQ A;  1IRZ A;  2XDN A;  2BY2 A;  1X3U A; 
#chains in the Genus database with same CATH homology
 4A3M J;  4UDS A;  3LWJ A;  3S5R A;  3BG5 A;  3MKL A;  1OFC X;  2XGE A;  3VIB A;  2NVQ J;  2R5Y A;  4JX4 A;  1RR7 A;  2Y9Y A;  5FKN A;  5EZG A;  2LR8 A;  2M8G X;  3A03 A;  4Y7N J;  2X9D A;  3NRG A;  3GZI A;  1GDT A;  1POG A;  1TC3 C;  3PO2 J;  3B6C A;  2LP0 A;  3HTH A;  3JRH A;  3JRC A;  2O9L A;  3TW7 A;  2LFB A;  1AKH A;  3RZD J;  2Q24 A;  4NN1 A;  1ZR2 A;  3HEF A;  3VPR A;  2ME6 A;  4A3G J;  2DG8 A;  3S1Q J;  3GTG J;  2LKX A;  2M0C A;  5K7H A;  4UUT A;  2NS7 A;  4JX5 A;  1JTX A;  2JMW A;  2EZH A;  5FKL A;  2HI3 A;  3RD3 A;  2G0E A;  4IHW A;  3LOC A;  4GCL A;  3BQZ A;  3V6G A;  5M5Y J;  3UKG A;  2ID3 A;  1UMQ A;  4JX6 A;  1T56 A;  4CYC A;  1VFC A;  5FGL A;  1WI3 A;  1I50 J;  2M9H A;  3JRF A;  2OF7 A;  1BA5 A;  5IP7 J;  1YRN A;  1H88 C;  1LFB A;  2AO9 A;  1NTC A;  4D7M A;  2G7L A;  3PM1 A;  3G7R A;  2MG4 A;  1JT6 A;  4A3F J;  4V2F A;  3SJM A;  5FKM A;  3HKZ N;  2VPR A;  3BTI A;  1JGG A;  3HE0 A;  2XGD A;  1FEX A;  1JKO C;  1RET A;  3BRU A;  1TWC J;  1X2M A;  3WHC A;  4CYC B;  3IUV A;  1ZK8 A;  3VVX A;  1B8I A;  3JSJ A;  2FX0 A;  4G12 A;  2XB5 A;  4A93 J;  2L7F P;  2IEK A;  4FIS A;  5F27 A;  2YUS A;  4UUS B;  3GTP J;  1MSF C;  2ELK A;  3HOY J;  1RKT A;  4ME9 A;  5J1Y A;  3FK7 A;  3HGY A;  3S14 J;  1FIP A;  4J19 A;  2DMU A;  5HOD A;  1B8I B;  2GUH A;  2LK2 A;  4XRS A;  5EG0 B;  5D19 A;  2CRG A;  2P81 A;  3S16 J;  2REK A;  3K7A J;  2DJN A;  1VI0 A;  2QIB A;  2E2I J;  4GFB A;  2YVH A;  3RZO J;  3JRD A;  1ETW A;  2LD5 A;  2UXI A;  1Z77 A;  1LFU P;  4JNN A;  3IV5 A;  5K58 A;  1U8B A;  2X6O A;  2CJJ A;  3BTC A;  5D1R A;  1Q1V A;  1QRY A;  1HDD C;  1BJZ A;  1JUS A;  1W0T A;  4C3H J;  3B81 A;  4W97 A;  2NS8 A;  5CXI A;  1JTY A;  2KDZ A;  5FHP A;  2DA7 A;  1ETY A;  3JRI A;  1HLV A;  2XB0 X;  4IHV A;  2R92 J;  5EF6 A;  4MK6 A;  2H1K A;  4LOC A;  4M3E A;  1UI5 A;  3IH2 A;  1B72 A;  3JRA A;  2RHA A;  3NPI A;  3BG3 A;  3QPL A;  4IEJ A;  2UXO A;  3I4M J;  1TWF J;  2HOT A;  3VW2 A;  5F08 A;  3LSP A;  2G7G A;  5EYR A;  1H8A C;  4A3C J;  2W53 A;  3HDD A;  3PPB A;  2EH3 A;  4C2M J;  5GPC A;  3HB9 A;  2NOG A;  2I10 A;  5FJ8 J;  3PAS A;  1IJW C;  3Q0U A;  2Y9Z A;  2NP3 A;  3Q0W A;  4M3D A;  4MIM A;  3VOX A;  2K40 A;  2R0Q C;  5C44 J;  5IYD J;  4HNV A;  3C07 A;  1TWA J;  5FKO A;  1JUM A;  2K9N A;  2WAQ N;  2MGQ A;  2FD5 A;  3TED A;  4X6A J;  3A01 B;  5JLX A;  4L5E A;  1EF4 A;  3KKC A;  1JKQ C;  3T6N A;  2K9Q A;  1FJL A;  1AU7 A;  1MH3 A;  3MNL A;  1BL0 A;  2OI8 A;  1MBH A;  1SFO J;  1MBJ A;  2DA3 A;  4X1E A;  3BTJ A;  1ETX A;  3G56 A;  3P9T A;  3VW1 A;  5FLV A;  2VI6 A;  3GBG A;  1U9O A;  3BNI A;  2DA6 A;  4C3J J;  3QKX A;  2HXI A;  3HOV J;  3D1N I;  1I6H J;  3GTJ J;  1IDY A;  2E2H J;  3Q0V A;  4A3B J;  1MNM C;  3S17 J;  2HYT A;  2NVT J;  2GBY A;  1LE8 B;  3LSR A;  3GTL J;  3M3Y J;  3DEW A;  4JYK A;  5C4X J;  3BR6 A;  1MSE C;  1IG7 A;  1ZTR A;  4DZP A;  2JN6 A;  1OCP A;  3QBM A;  2E1O A;  3BR1 A;  2E2J J;  1BW5 A;  4BY7 J;  2QOP A;  3ZQI A;  3W6V A;  1XG1 A;  2DN0 A;  3NAR A;  3S1N J;  2HDD A;  1TWG J;  1MBG A;  4DYR A;  2R93 J;  3LSG A;  5EGO B;  2O8K A;  4DYC A;  5FLM J;  4UUS A;  3S1R J;  2D6Y A;  2TRT A;  5M5W J;  2HOA A;  4GFK A;  4BXX J;  2HKU A;  1UHS A;  2EZK A;  4A3I J;  1DU6 A;  1ETV A;  1WGX A;  2WB1 N;  1F43 A;  4B4C A;  1MBE A;  2JA7 J;  5M3M J;  3HGG A;  5JLW A;  1DU0 A;  2DMP A;  2Y31 A;  4MFD A;  4D7N A;  5DS9 A;  5EZH A;  5EG0 A;  1PUF A;  3DPJ A;  3EGQ A;  1MH4 A;  1S7E A;  5IOY A;  2R5Z B;  3I4N J;  5IP9 J;  5CW8 A;  4AC6 A;  2FJ1 A;  1JT0 A;  1P7J A;  4IHX A;  1T33 A;  4PXI A;  2NX4 A;  2ECB A;  5IYC J;  5E3O A;  2QWT A;  3NNR A;  5E3L A;  1IUF A;  2H8R A;  3CWR A;  2EQR A;  2D5V A;  3FIS A;  2TCT A;  1PUF B;  2ZCM A;  4A3K J;  3CQZ J;  3IH3 A;  1QPI A;  2O7T A;  2WUI A;  5GP9 A;  3F0C A;  1ETO A;  1H89 C;  3BR2 A;  1OJL A;  2AHQ A;  3CJD A;  1X58 A;  1FIA A;  4BKX A;  2CQX A;  2L0K A;  1XS9 A;  1HF0 A;  2DG7 A;  2VKE A;  4NEL A;  3TP3 A;  1XC5 A;  2N8G A;  4QIW N;  1O4X A;  2XSD C;  3IH4 A;  3HIM A;  5EFY A;  3O8H A;  4JL3 A;  5IOZ A;  1P7I A;  2XRL A;  3BT9 A;  5GPA A;  2JA6 J;  4IHY A;  5F0F A;  1APL C;  2QKO A;  2CUE A;  4AYB N;  2UXP A;  3BJB A;  3ZOB A;  3HTI A;  4MLO A;  4XRS G;  3KZ9 A;  3ON4 A;  3VUQ A;  3M4O J;  4S0H B;  1HOM A;  4FCY A;  4AF5 A;  2DMN A;  5HBU A;  2ZCX A;  2YU9 J;  3HTA A;  1FTZ A;  1JJ8 C;  1K83 J;  2XPW A;  3FKI J;  2G3B A;  3E7Q A;  2B63 J;  3GTO J;  4B3A A;  5J1U A;  2UXU A;  3NXC A;  4NDL A;  3S2H J;  5AQC A;  1BW6 A;  3HBL A;  3FIW A;  4YZE A;  2PMZ N;  2PZ9 A;  4DW6 A;  3S15 J;  1ITY A;  1IC8 A;  2CU7 A;  2LTP A;  1JJ6 C;  5IP6 A;  3GTQ J;  3A01 A;  3ANG A;  1MBK A;  3BR0 A;  1ZKG A;  3NAU A;  1MBF A;  2VKV A;  2GFN A;  3JRE A;  3VW0 A;  2ZB9 A;  3OIO A;  4Y52 J;  3KNW A;  3FK6 A;  3RH2 A;  3ZQG A;  4C3I J;  1JUP A;  1IV6 A;  3HTJ A;  3OOU A;  3LNQ A;  1WCM J;  1U78 A;  2K9S A;  5J1R A;  3C2B A;  2GLO A;  1ZR4 A;  3ANP A;  1GUU A;  2ID6 A;  4I6Z A;  1ZGW A;  2M2E A;  4ABZ A;  4A3L J;  2JWT A;  3HOX J;  2ZCN A;  3GTM J;  1LE8 A;  3L1P A;  4L62 A;  3H3V K;  1E3O C;  5F0H A;  4KWA A;  4BY1 J;  3ZQF A;  2NVX J;  1VF9 A;  2ME0 A;  2V57 A;  3LJL A;  1WH5 A;  4JKZ A;  1ETQ A;  2WGB A;  2DA1 A;  1U9N A;  4GCK A;  4GCT A;  4QTR A;  2COB A;  4XIC A;  5EGO A;  1ETK A;  1UG2 A;  4RDU A;  2WV1 A;  1ORK A;  2IBD A;  1GV2 A;  2HYJ A;  5DAJ A;  2RAE A;  3CDL A;  4GFL A;  2JA8 J;  3S1M J;  3AQS A;  5E3M A;  2CUF A;  1K61 A;  3H0G J;  3SFI A;  4DZJ A;  3HOW J;  2DA4 A;  2JK3 A;  4MFE A;  3KKD A;  3HM5 A;  2GEN A;  4B1R A;  2R5Z A;  1HDP A;  3HOU J;  2L9R A;  3K2A A;  3QPS A;  1SGM A;  2W48 A;  3BQY A;  2R5Y B;  1NK3 P;  2JA5 J;  5EEA A;  2O7O A;  1ENH A;  3EUP A;  3OSG A;  2KT0 A;  2Y2Z A;  4W1U A;  1NK2 P;  3COL A;  3RQI A;  1X2N A;  3JR9 A;  5E3N A;  1IDZ A;  3O8G A;  2DA5 A;  2NVY J;  2IAI A;  3MN2 A;  4XID A;  3CMY A;  3G1O A;  3RKQ A;  1AKH B;  2DTZ A;  2FBQ A;  4MXM A;  9ANT A;  1FTT A;  1IGN A;  2ZOY A;  2X48 A;  5C3E J;  1F36 A;  1R9T J;  1SAN A;  2Y0S N;  4AUX A;  1I3Q J;  2XGC A;  2XPV A;  4FTH A;  3B6A A;  1JKR C;  3ZQL A;  2OER A;  3ZQH A;  5F1J A;  2OPT A;  3VP5 A;  5EDN A;  1A6I A;  4DYQ A;  3BHQ A;  1QVT A;  2YVE A;  2LLK A;  3HOZ J;  4JP0 A;  2G7S A;  2IU5 A;  2QTQ A;  3ZQC A;  3AQT A;  3VVZ A;  2EBI A;  2Y30 A;  1RPW A;  2R7Z J;  4M3B A;  2E19 A;  3E7L A;  1AHD P;  4CGR A;  2CQQ A;  2HQ5 A;  4FE4 A;  4A69 C;  2LVS A;  1YRN B;  4RBO A;  2HOS A;  1G2H A;  2DMT A;  3CCY A;  4D5C A;  4V2G A;  3PO3 J;  3JRG A;  2F07 A;  4BBS J;  3TW6 A;  3LSJ A;  1QVU A;  5DTD A;  2JJ7 A;  2MW8 A;  3BR3 A;  5J3L A;  5C4J J;  2HXO A;  2RAS A;  4AC0 A;  3SDG A;  3LHQ A;  2MSY A;  2DMQ A;  4A3J J;  3ON2 A;  1HCR A;  3QQA A;  1CQT A;  2EZI A;  1VND A;  1D5Y A;  2EZL A;  3WHB A;  4QSH A;  4EEF G;  4FE7 A;  2LY9 A;  2QCO A;  4D5F A;  5CXG A;  4ICH A;  3O60 A;  1A5J A;  5H9T A;  1Y1W J;  3MVP A;  5F0C A;  1ZQ3 P;  5C4Y A;  4A3E J;  4XRM A;  5K7F A;  5F04 A;  4M3G A;  3S2D J;  5IPA A;  5FKK A;  1WH7 A;  1RKW A;  3JRB A;  1GV5 A;  2ECC A;  3GTK J;  5M5X J;  1GVD A;  3CRJ A;  1JKP C;  3GEU A;  1GT0 C;  3FRQ A;  3V78 A;  2L7M P;  1UI6 A;  2NP5 A;  2DA2 A;  4A3D J;  3VOK A;  2YS9 A;  1Z0X A;  2FQ4 A;  2XPU A;  3BG9 A;  3F1B A;  2UXH A;  1RES A;  4XK4 A;  1W0U A;  2PBX A;  5D18 A;  3DCF A;  5IYB J;  2ZOZ A;  5HAW A;  3G1L A;  2M34 A;  1WPK A;  2GM4 A;  3VVY A;  3Q3S A;  2L7Z A;  4M6V A;  4MO7 A;  2QF7 A;  1TWH J;  3OSF A;  4M3F A;  3BTL A;  1B72 B;  3BCG A;  3NI7 A;  5HSZ A;  4I76 A;  5K7Z A;  4BBR J;  1OCT C;  2VUM J;  3TP0 A;  3A02 A;  4ACI A;  4HKU A;  1Y1V J;  3G1M A;  5BNG A;  5M3F J;  5FMP A;  3BR5 A;  1IRZ A;  2XDN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...