3BR6A

Crystal structure of the complex of rhodamine 6g bound to qacr(e120q), a mutant of a multidrug binding transcriptional repressor
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
186
structure length
185
Chain Sequence
NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKSEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYTNSINEKMNKLQNKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator qacR
publication title Formal electrostatic interactions do not govern QacR-cation affinity
rcsb
source organism Staphylococcus aureus
molecule tags Transcription
total genus 72
structure length 185
sequence length 186
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2007-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3br6A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3br6A02
2Y2ZA 3Q0UA 2CRGA 1UI5A 2ZCNA 2EH3A 1BW5A 2Y30A 3C2BA 1B72B 1RESA 3QPSA 2EBIA 2IBDA 3B6CA 3NPIA 2OPTA 4BBRJ 4JKZA 4AUXA 3RZDJ 3QPLA 4UUSA 3S15J 3OIOA 4PXIA 2UXOA 3S5RA 1TWAJ 1XG1A 4X6AJ 5IP6A 1IDYA 4FE4A 2ZB9A 2Y0SN 3JRFA 4M3FA 1MSEC 1S7EA 2JA6J 4HKUA 3V78A 3HOVJ 3NI7A 1P7IA 1MNMC 3GTOJ 3VW0A 4M6VA 3HIMA 2DMQA 1H88C 3LNQA 2O7OA 1U78A 4AC6A 4JNNA 4CYCB 5F1JA 2IAIA 3SJMA 1H8AC 3VW2A 3F0CA 3BTJA 3PO2J 2DMPA 1F36A 5EYRA 1MH4A 5J1YA 2FX0A 3ZOBA 2OI8A 1MBEA 2M8GX 1GVDA 1ZR2A 2D6YA 3DEWA 3GTQJ 2F07A 1ZKGA 3WHBA 1HF0A 2UXHA 1GV2A 2HYJA 2E2IJ 2O7TA 3HOWJ 3Q0VA 2HOTA 4L62A 3BR0A 1WH7A 2LR8A 2M9HA 4IHWA 2XDNA 4BBSJ 1U9OA 2P81A 4JYKA 4LOCA 3HOYJ 5FMPA 3S2DJ 3BT9A 3IH2A 1IGNA 4X1EA 1RKTA 1Y1WJ 3S1QJ 2IEKA 3VIBA 2PBXA 5BNGA 2EZHA 5IYBJ 2QF7A 2ID6A 4A93J 2G7SA 2Q24A 1JTYA 2HI3A 2K9NA 3GTJJ 1T33A 2NVYJ 3BNIA 1MBGA 1MBHA 1I3QJ 1UI6A 4I6ZA 2X48A 3A02A 4BY7J 4M3GA 2ECBA 3E7QA 5C44J 3CJDA 2H8RA 2NVXJ 3OSGA 1I50J 3A01B 2NVQJ 1AKHB 2E2HJ 1UHSA 5IPAA 3T6NA 2HOAA 2QCOA 2DA4A 3LSGA 1JTXA 5JLXA 2LTPA 4J19A 3HOZJ 1FTTA 4RDUA 3JREA 4MXMA 1JKQC 5M5WJ 2GUHA 5H9TA 3GTKJ 2L0KA 5E3MA 2R5YA 3FK6A 4AF5A 1TC3C 3G1MA 1DU0A 2CQQA 4FCYA 2MW8A 2CJJA 2DMUA 3BR5A 2IU5A 3ON2A 3BTCA 3BTIA 5FHPA 2Y9YA 1HOMA 1K61A 1O4XA 2XGDA 1A5JA 1ITYA 1MBJA 1IJWC 3D1NI 5CXIA 3IV5A 2EZIA 2HYTA 1QPIA 4A3DJ 2ME6A 2QOPA 2Y31A 2MG4A 3BTLA 2K40A 3HBLA 3MNLA 4A3IJ 1HDDC 3GTGJ 1JJ8C 5HSZA 5K7HA 4Y52J 3BR3A 3HM5A 4CGRA 1SANA 3M4OJ 1ETOA 5FKOA 4IHYA 1JT6A 5C4XJ 5AQCA 1WI3A 2E1OA 3PO3J 2KDZA 2QIBA 2JN6A 2M2EA 1ZQ3P 3C07A 1RR7A 4MLOA 1XC5A 1RKWA 4A3CJ 3MVPA 4M3DA 3GTMJ 3LWJA 3VUQA 4AC0A 2UXUA 3BQZA 2XSDC 3G1LA 3QBMA 4L5EA 4GCTA 3HGGA 3LJLA 2L7FP 1FTZA 4GFKA 1BW6A 2WV1A 1NTCA 4M3EA 1E3OC 2ID3A 3S1MJ 2HQ5A 3JRDA 2R92J 4IEJA 5EGOA 1B8IA 2VUMJ 2JMWA 4A3FJ 4QSHA 3ZQHA 1APLC 2R5YB 5GPCA 4D5FA 3HTAA 3IUVA 4D7NA 3AQSA 2DJNA 5M3MJ 3VVZA 3AQTA 4RBOA 3TP3A 4ACIA 3L1PA 5EDNA 3LSPA 2L9RA 4Y7NJ 4XICA 5EG0B 5D1RA 2GENA 2LKXA 1LE8B 9ANTA 5CW8A 2EZKA 2NVTJ 3S14J 3BCGA 3S1NJ 2COBA 2LD5A 3RZOJ 5GPAA 1WH5A 2OERA 2W48A 2X6OA 4B1RA 2VKVA 3UKGA 3HE0A 3VOKA 3BG9A 1ZR4A 5D18A 1GUUA 1U9NA 3KZ9A 2R5ZA 2YU9J 1A6IA 4QIWN 3SDGA 3KKCA 4C3JJ 3FIWA 4YZEA 3I4MJ 2QWTA 2UXPA 3VVYA 4D5CA 3ON4A 4MFDA 3Q0WA 5F08A 3LHQA 2XB5A 4MIMA 2DTZA 1HLVA 2N8GA 2L7ZA 3VW1A 2ELKA 1JUSA 4JX5A 3TW6A 4JL3A 3G56A 2K9QA 3JRCA 4A3GJ 3PPBA 4JX6A 3NXCA 2JA8J 1FIAA 3ZQFA 3V6GA 5F0HA 3JSJA 1QRYA 4B3AA 1D5YA 1G2HA 1IDZA 5E3NA 1JUPA 3IH4A 2O9LA 3HB9A 1B8IB 5EGOB 1TWHJ 2DA5A 4UUSB 2XGEA 2X9DA 2DMNA 5GP9A 1ETQA 3E7LA 2H1KA 1MBFA 1SFOJ 2GLOA 1MH3A 4M3BA 1EF4A 3FK7A 3S2HJ 1JKRC 1ZGWA 4JX4A 1UG2A 2AO9A 2M34A 1Q1VA 2YVEA 2NP3A 1BL0A 1F43A 2L7MP 3HTHA 2QTQA 4MFEA 3LSJA 3HTJA 5DAJA 3RD3A 3K7AJ 5J3LA 3TEDA 5IOYA 1QVUA 2GFNA 2UXIA 2OF7A 2LP0A 1X58A 5C3EJ 2DA1A 1PUFA 2R5ZB 4HNVA 3A03A 2YS9A 1MSFC 5F0CA 1JKOC 2LFBA 1YRNA 4NN1A 2FBQA 2GBYA 2EZLA 4A3LJ 3PASA 3NARA 1VI0A 3H3VK 3ZQGA 3JRHA 4UUTA 1MBKA 3HDDA 3FRQA 2FQ4A 3I4NJ 5F0FA 2ZOYA 4BY1J 2O8KA 4BKXA 2ZCMA 2REKA 2TCTA 1W0TA 1JT0A 2CQXA 1WGXA 1ZTRA 2XB0X 4XRSA 3M3YJ 5HAWA 1ETYA 4NDLA 2W53A 4DYRA 5K7ZA 3NNRA 4W97A 1NK3P 2G3BA 5EZHA 2DMTA 2DG7A 4V2GA 3EGQA 3HTIA 1ETXA 2I10A 2PMZN 5FKNA 3ZQIA 3LSRA 3COLA 1ETKA 5FGLA 3BR1A 4XRMA 3O8GA 4DYCA 5K58A 3ZQLA 2CUEA 2R7ZJ 3CMYA 1VNDA 2HXIA 2ME0A 2RAEA 2XGCA 2GM4A 4ME9A 3VP5A 2JWTA 3KKDA 2RASA 2MGQA 2NS8A 2TRTA 2XRLA 2CUFA 5K7FA 3RQIA 5FJ8J 1IV6A 1POGA 4A69C 4UDSA 2HKUA 1GT0C 1UMQA 2B63J 3VVXA 1JKPC 1ETVA 1ETWA 5CXGA 5JLWA 4XRSG 3G1OA 2WB1N 3JRIA 2MSYA 1JUMA 1XS9A 1WPKA 3GZIA 2HXOA 2G0EA 3BR6A 2DA7A 5EF6A 1X2NA 1IC8A 1FJLA 1U8BA 4JP0A 2KT0A 4I76A 5HODA 2HDDA 1Y1VJ 3W6VA 5IYDJ 1IUFA 5F27A 3JRBA 1JJ6C 3CQZJ 4C2MJ 1OCPA 4MK6A 2LY9A 4C3HJ 1W0UA 4G12A 2ZCXA 2YUSA 3JR9A 1RPWA 1VF9A 1H89C 3FISA 5J1UA 2M0CA 3HEFA 3A01A 1AKHA 3S17J 4FE7A 2WGBA 1SGMA 5FKKA 5J1RA 5M5XJ 4GCKA 3MN2A 2K9SA 2DG8A 2DN0A 3CCYA 2ZOZA 3ANPA 4C3IJ 1CQTA 4DZJA 3DCFA 3CDLA 1TWFJ 5C4JJ 3ZQCA 1AHDP 3NAUA 2DA6A 2WAQN 3O60A 4XK4A 1FEXA 3B81A 3CRJA 3GTLJ 5D19A 2JA5J 5EEAA 4XIDA 2PZ9A 2V57A 5EZGA 4FTHA 5EFYA 1HCRA 3OSFA 1Z77A 2NX4A 2ECCA 1AU7A 4NELA 1OJLA 5IP7J 3BHQA 2R0QC 2NOGA 3NRGA 3O8HA 5FKMA 3HKZN 2LVSA 3HGYA 3DPJA 4AYBN 3JRAA 2E2JJ 1GDTA 1OFCX 1LFBA 1T56A 2VKEA 1ZK8A 3BJBA 3BR2A 1NK2P 1WCMJ 5IOZA 5IP9J 5C4YA 3MKLA 3PM1A 2AHQA 3BRUA 2LK2A 3HOXJ 1OCTC 2LLKA 3VPRA 2YVHA 4DW6A 1Z0XA 1R9TJ 3K2AA 2XPWA 5E3LA 3KNWA 2NS7A 3F1BA 4GFLA 2D5VA 4D7MA 1QVTA 2NP5A 3FKIJ 4A3KJ 5DS9A 4IHXA 5DTDA 4DYQA 3EUPA 2XPVA 1K83J 1LFUP 3BQYA 3G7RA 4A3MJ 1IG7A 1ENHA 1B72A 5IYCJ 2EQRA 3S16J 2G7GA 3LOCA 1GV5A 3P9TA 4A3JJ 1BA5A 2WUIA 2FD5A 3S1RJ 3BG3A 1JGGA 3GTPJ 3VOXA 3CWRA 2R93J 5E3OA 3RKQA 4W1UA 4A3EJ 5M5YJ 3ANGA 5HBUA 2CU7A 3WHCA 5FLMJ 4MO7A 1RETA 2E19A 3H0GJ 1TWCJ 1DU6A 2RHAA 4ICHA 3TP0A 2QKOA 1TWGJ 3BG5A 4FISA 4S0HB 3IH3A 4IHVA 5EG0A 5M3FJ 4V2FA 1HDPA 3QKXA 1LE8A 2FJ1A 1BJZA 3GBGA 2DA3A 1P7JA 2DA2A 5FKLA 3B6AA 4B4CA 4CYCA 1ORKA 4BXXJ 3QQAA 3Q3SA 3SFIA 1I6HJ 2JK3A 3TW7A 4GFBA 2XPUA 5FLVA 1PUFB 2Y9ZA 2HOSA 4A3BJ 4ABZA 3HOUJ 3JRGA 1X2MA 2VPRA 2JA7J 1VFCA 2JJ7A 2VI6A 3OOUA 5F04A 1YRNB 1IRZA 2G7LA 3GEUA 4DZPA 4KWAA 1FIPA 3RH2A 4GCLA 4EEFG 4QTRA
chains in the Genus database with same CATH superfamily
2Y2ZA 3ABLH 1NG7A 4KIFA 2VJ5A 2EH3A 2RV8A 1OYIA 1J0RA 4Q4ZF 3MEXA 3IP4B 3V7CA 1AWCA 3BJOA 2F5FA 2P5VA 2UUZA 2YR2A 1SC7A 2PJPA 3ELKA 4HPQA 2DU9A 2KL4A 1I6XA 3S15J 4MGRA 1K6OA 3S5RA 1TWAJ 1SFUA 3SDBA 2ZB9A 4M9XA 1T0FA 1XDUA 2F5DA 5HLIA 4I02A 2R7QA 1W7PD 4IL6C 2LMDA 3RTRA 4D0PA 4M6VA 2CQ7A 2ZMEC 2L9VA 2VONA 4OD5A 2DYSH 2MABA 1VQ5I 1U78A 4AC6A 1OKRA 4IPAA 3DPUA 4EJTA 1H8AC 2HVQA 3IAM2 2OJED 2M30A 2QLZA 2IS4A 4CCNA 5EYRA 3RI4A 5CYVA 4QPOA 4BJ6C 3OYGA 4XORA 4MTDA 2OI8A 1SVLA 1XMXA 1S5LC 4M71A 3J80Z 3DEWA 2Q0OA 2IP2A 3OY9A 2KQRA 1HF0A 3K4KA 5HVQC 1P9QC 1GV2A 4PUSA 1LNWA 2X1CA 1O3SA 2E2IJ 4OIRF 3D0SA 2BY2A 4RAYA 4EVIA 4CGZA 1I39A 2F2EA 2MD5A 2D2WA 1YJNI 4Y33A 4IHWA 2LKSA 5IY5H 1D1CA 3MAJA 2ETHA 5FMPA 4LJZF 2EFWA 3S2DJ 1IGNA 2A05A 4X1EA 1RKTA 1HC8A 3VIBA 1QGPA 2XAFA 2PBXA 4IO9F 5BNGA 2ZFWA 3CCLI 4G6DA 3ABMH 2Q24A 2HI3A 3GTJJ 1T33A 3HPHA 3RPUA 3WODF 1FZPB 2DK5A 1I3QJ 1QNTA 3A02A 4M3GA 2X85A 3K4LA 1R71A 3CJDA 2H8RA 1WJEA 2BW3B 3HTUA 4BH9A 2EFQA 4HNTA 4UV9A 4HYEA 1F1ZA 3A01B 2FMLA 3OMYA 3CLQA 2R7RA 2HOAA 5FD6A 4UVAA 3HSRA 1H0MA 3F8MA 2LTPA 5L3DA 4NHJA 4ZTJA 4Q5SF 4XLHA 2QKMB 3I4PA 2A3SA 4XOPA 3N4MA 4MHGA 2PX9A 4RDUA 3JREA 4MXMA 1JKQC 1UAAA 1UJ8A 4A2UA 4HV5A 1XGOA 3ECOA 2F4MB 3K4NA 1TC3C 3OYAA 2L02A 3K70D 4EGZA 2E36A 2MW8A 3MKYB 4HDVA 3BR5A 1FOKA 3BTIA 2E7WA 1OMIA 3K4CA 1K61A 1A5JA 4QPQA 1IJWC 1UELB 3IV5A 5CXIA 4KYWA 3BOQA 2HYTA 5LGNA 1VQNI 2V1XA 4A3DJ 2V1DA 3LSTA 3OWTA 2Y31A 2WADA 5HDKA 3KZIC 3BG7A 2VJJA 3GLXA 3PSIA 1SFEA 2Y69H 3QYFA 2AXTC 2EV0A 2LOOA 5HSZA 3RDIA 1QA6A 2FJI1 1FX7A 5L3FA 5D5UB 4IHYA 2AXLA 4O3MA 1KGSA 5E1WA 1ZQ3P 1MMNA 2KIQA 4MLOA 2IW5A 1XC5A 3GMEA 4A3CJ 3MVPA 3VUQA 1G3WA 4AC0A 4XRFA 3DKXA 1LDKB 4LB6B 1TP4A 1O7FA 3BQZA 2XSDC 4WWCA 2ZJPF 4L5EA 1FOXA 1HKTA 2R3SA 3RCOA 4OOIA 1D8JA 2WV1A 5DM7F 1E3OC 1WKMA 4KDPA 2M45A 5CVIA 3S1MJ 3FXKA 2VUMJ 3ASOH 2HNHA 4KIGA 3CD6I 2EA2A 3ZQHA 3ZMSA 2M87A 2R5YB 4D5FA 3HTAA 3G3ZA 1BOAA 5M3MJ 2F6CA 5EDNA 1VTNC 1HW2A 3LSPA 4XICA 3PUBA 5D1RA 2BY0A 9ANTA 2P0WA 4A6DA 5L3GA 2LD5A 1WH5A 3IWZA 3QOEA 4R79A 2X6OA 3BJ6A 2VKVA 3JTHA 3RYPA 1GUUA 1QO0D 2R5ZA 5ED4A 3PQKA 3I5UA 4HW0A 2EIKH 2IA0A 2CGPA 1JE8A 1LB2A 3W6KB 3V7SA 3ERMA 2KJCA 5L3EA 2P5KA 1TZLA 2P7CB 5F08A 3FXLA 4MIMA 2CV2A 5D5VB 1WJAA 4MQVA 3QU6A 3DF8A 2PQ8A 5GAGJ 2LY2A 2HQNA 2EPFA 3TBIA 4EJUA 3DWLE 2O5RA 4JX6A 3NXCA 5F0HA 4BHCA 2X1EA 1QRYA 4B3AA 4BE2A 3CO6C 5FRNA 2X4HA 4OU0A 3TMOA 4U7BA 2O9LA 1IDZA 2ISYA 1B8IB 4UUSB 1FYKA 1P92A 3J7AY 3DKWA 4YFNF 2H1KA 3WE3A 1MH3A 1Z7LA 2QQ9A 4IQJA 4ITVA 2QSFX 3FK7A 3CCVI 3MKZA 2AO9A 2M34A 5D8KB 1Q1VA 4CSWA 1BL0A 4MTEA 3ZXSA 3IRRA 1FYMA 2VKDA 3EYIA 2ZSIB 1ONVA 4IRIA 3LSJA 2EILH 2XUBA 4XSZF 5LHGA 2RC4A 2H09A 1V5FA 1IO2A 2CQKA 2HKXA 4F7ZA 4S05A 3FWEA 2UXIA 3LL7A 2CMPA 3M1EA 3M07A 3REOA 1J59A 1X1CA 3A03A 1BC7C 3DTIA 4BQAA 3J81K 1IW7F 2LFBA 1XGSA 3PFYA 2GBYA 3Q9SA 1R00A 1X3ZB 1LFPA 3W2AA 2VN2A 1MBKA 3V8LA 3UR3C 3ZQQA 3HDDA 1Z3YA 4C30A 4KT5C 2ZOYA 1BIBA 4BKXA 3L2VA 2ZCMA 1S7AA 3FM5A 3CF5F 3FM3A 1W0TA 5IT9Z 3AAFA 3NS4A 2XB0X 4XRSA 4KJZA 2MYSA 2W53A 2H6BA 1MDMB 4N9IA 5K7ZA 2K27A 2R7UA 1YITI 3DEEA 4W97A 1HXDA 3V8KA 3HSFA 3R0AA 1RZ4A 4WX9A 3HTIA 2I10A 1W7PB 2OQGA 2QUFA 3ZQIA 4JK1X 4L9NA 4WXCA 3JAMZ 3DLLF 3HTSB 5AONA 4E7HA 1OCCH 1QHGA 5K58A 3ZQLA 2R7ZJ 4WCGA 1IXCA 3CMYA 2HXIA 3VP5A 4GO1A 2XGCA 3RQ4A 3LMMA 1A6QA 2B0LA 2ESNA 2XAUA 4CXFA 1G3TA 4F92B 2VXZA 1GVJA 3KKDA 2MGQA 1WHUA 2TRTA 2NOJB 3CZ6A 5LHIA 3KLNA 4PJ0C 3WTUC 2VT3A 2ZJRF 1YG2A 1IV6A 3K4JA 4A69C 2XF6A 4UDSA 2F5VA 1ZGAA 1GT0C 1T2KA 2K5CA 3IC7A 2DQLA 4AWXB 5HS8A 1OYYA 5CXGA 3MKWB 4YELA 3G1OA 4BXUA 3JRIA 2MSYA 1JUMA 5DYMA 1WPKA 2K9MA 2HXOA 2QZ8A 2DA7A 1RUOA 4II2A 4PK4A 3EUAA 1H9TA 4CCMA 3IL2A 4CCLA 1K7AA 2B3WA 2XF7A 1JJ6C 2W24A 2OAZA 4BDYA 2FOWA 1OCPA 1I1GA 2ZCXA 1Z05A 2BW3A 2HQAA 1N25A 3WE2A 5H2FC 2M0CA 3A01A 2EK5A 1YHQI 1WI9A 5HLGA 2PMZA 1XB4A 5KHDA 3HRTA 5FKKA 1FYLA 5M5XJ 5DD8A 3C2HA 3F8BA 5DV5A 2KRHA 3LWFA 1ZELA 3MZYA 2DG8A 2ZOZA 2IPQX 1CQTA 3ANPA 2DDAA 4DZJA 3CC4I 3OYDA 1GXPA 2BEOA 1W36D 2WAQN 1QZZA 3O60A 2KISA 3GEZA 2R7OA 3B81A 2KJBA 3VFZA 3VDXA 1BOBA 3CRJA 1DQUA 4U9NA 2XV4S 1WSUA 2JA5J 3TO6A 1LQ1A 3OSFA 1Z77A 1PP8F 2O3FA 2NX4A 1AU7A 4UUVA 3E5UA 2RNJA 4XLNF 1LEBA 4KICA 4Y15A 2LYCA 2Z16A 4CHUA 3S8PA 3BHQA 5DUKA 2F48A 2M8EA 2IT0A 1OFCX 1T56A 2BGCA 3BJBA 5FROA 2K7LA 1FMWA 2DI3A 1TTYA 2IVMA 2L3DA 2AHQA 3DQVC 2H8WA 1OCTC 3VPRA 3ML6A 1QZEA 3SEQA 3FZVA 2DT7B 4GYGA 5J8CA 4D7MA 4BXFA 4DQ2A 1ZG5A 4LD5A 1D0YA 2QYOA 3OS1A 2ZXIA 2HGCA 1LFUP 2DAOA 3ASNH 4A3MJ 1WVRA 3I53A 3C2GA 1K78B 1B72A 5EEHA 3L2WA 1XSXA 1GV5A 3GO5A 5FFXA 4L9TA 3MMYB 1B4AA 1VZ0A 4ENMA 3S1RJ 3BG3A 2EA4A 2DW4A 3GTPJ 2VQHA 3VOXA 1MW7A 1ZHFA 3RKQA 4A3EJ 5DCFA 4I0AA 3T0YA 1B9NA 2KZVA 2L4AA 1D1AA 1O3RA 5BPDA 1N78A 2CH0A 2P6SA 2QGUA 1YQAA 1K4SA 3F72A 4J00A 2XIGA 4ICHA 3TOAA 1SVMA 2QKOA 3BZCA 1KYZA 4UXNA 4WIBA 1HDPA 1BJZA 4ZYEA 2KDOA 3B6AA 4BU2A 1E3HA 4B4CA 3EPZA 4CYCA 2XRNA 3QQAA 4AYBA 5LEJA 3U1DA 5HLHA 4U9LA 4AM3A 3H35A 3HOUJ 1X2MA 2VPRA 3B02A 3HJEA 4Y3OA 2MH2A 4HAMA 5F04A 1O3QA 1K79A 3LA7A 2RQPA 4JOMA 1S8NA 3EETA 4GCLA 2OZ6A 2VC0A 3I71A 4FHTA 4LG3A 2EV5A 2GXGA 1BW5A 3E6CC 3C2BA 2BVLA 1RESA 3OIQA 3QPSA 2IBDA 1YX3A 2BXZA 2Z5UA 3A0HC 2VODA 4RGRA 1IAWA 2RVCA 1VQOI 4P9UA 1G3SA 1IN6A 2EV6A 3RZDJ 3A0BC 4UUSA 1YYVA 3DBHB 3ZMTA 2BYVE 4B3XA 3H3UA 1XG1A 3A4CA 3FMSA 2HU9A 4OIQF 2X6YA 1IDYA 5K5OA 4RB3C 2Y0SN 4DGWB 1V4RA 2O03A 1R1VA 4HF0A 2JA6J 3HOVJ 2XHKA 5J4YA 2HYGD 1Z67A 1EV7A 2EFOA 1Y0UA 2FBIA 3LNQA 1OR7C 4BDZA 4L9JA 2O7OA 1IRFA 3MD2A 4HZFA 5F1JA 3VW2A 3CC7I 2X6XA 3BTJA 2DOAA 2QM3A 4DBRA 3FXRA 1ACIA 4Y17A 4RB2C 1W1WE 3ZOBA 1MBEA 1Y6IA 1ZR2A 1PUEE 5KNLA 3E7QA 5L3BA 2JRTA 5TISC 1VQLI 1ZKGA 4RLFA 3WHBA 5DDGA 4UHTA 5JHUA 4CYDA 3O2PE 1FC3A 2O7TA 4L62A 2LR8A 1R1UA 4BACA 2XDNA 1QZYA 2GIZA 2ESHA 4JYKA 2QKLB 4UY8I 1Y1WJ 1OCZH 3E1SA 2PLYA 1FBUA 3J81Z 2EZHA 2M4GA 3ZP5A 2WY8Q 2JVGA 2NVYJ 3VB2A 4I98B 1MBHA 2X48A 4RM2A 1G59A 4BY7J 4A0YA 1W7PA 5C44J 2VJIA 4FX4A 4MNUA 3E0JB 4C2UA 4KNYA 1ZN2A 3OSGA 1I50J 1L0OC 1AKHB 1OQYA 3G4SI 4HX7A 2A07F 1Y56A 1X1PA 2QCOA 4IF4A 4RLQA 1LEAA 1VQ6I 1DPUA 3LSGA 5ICFA 1JTXA 4J19A 2LSOA 1Z6TA 1FSEA 3WGIA 3KYLA 3S3NA 5E17F 5HLTA 2OTJI 2V4JC 2ZJ2A 3EUHA 5CQGA 5JI6A 4O5VA 1F5TA 2L01A 1EA3A 1SMTA 1U2WA 3F8CA 2DBBA 2K86A 2XAQA 5LGTA 1AOYA 3K8PC 4AF5A 3I9V2 1DU0A 3R60A 2CQQA 2OC6A 4AIDA 3ON2A 4NB5A 1BR4A 4S04A 5E79C 3LSIA 4AVPA 1R5HA 2ZXJA 1ITYA 1MBJA 3QYBA 3D1NI 2ELHA 3DU6A 3S32A 3KETA 4UNOA 2FA5A 1FOYA 2ME6A 2GIVA 2VBZA 2P6TA 2MG4A 3G71I 3MNLA 1WWXA 5TGTA 4EM0B 3I56I 3GTGJ 2OUMA 2DQRA 5F1RA 4Y52J 4U0VA 1A36A 3HM5A 4CGRA 1SANA 3M4OJ 4YIIA 4JQFA 4E4HA 3X2QH 1JT6A 2E1OA 4XKBA 2KDZA 5F64A 5GTIC 3GYHX 1HA8A 3LWJA 1HW5A 3FKJA 3J7YJ 2UXUA 4UVCA 3I59B 3HHHA 1FTZA 4OMZA 1BW6A 3ECHA 4M3EA 3OYNA 1F4KA 4HOBA 4PGHA 4AIHA 1E3PA 1FPQA 2M4KA 3JRDA 2R92J 1PDNC 4IEJA 5EGOA 2JMWA 4A12A 4A3FJ 4G7OF 3H5NA 1APLC 3OOPA 5CKTA 4YRVA 3GWZA 2BHZA 2GXBA 1RNLA 1YS6A 1D1BA 2DJNA 3VOEA 3AQTA 3LSKA 3TP3A 4ACIA 1V5GA 3L1PA 3F23A 3H1CA 4B8XA 1LE8B 4IRGA 2O61A 3WU1B 4IKFA 1V54H 1ZLJA 3S14J 2OCCH 3BZKA 3L9FA 2COBA 3BCAA 1U5TB 4RAFA 2A6EF 5LGUA 2VT2A 1J75A 3RZOJ 3WTXC 3HE0A 2JVHA 2VL8A 3OIPA 5D18A 1IXRC 1ON2A 1P4XA 1U9NA 3KKCA 2FNPA 2V9KA 1Q1HA 3FIWA 3I4MJ 5J8FA 1W5TA 2EWNA 4ZYAA 2FBHA 1YO5C 1VQ8I 1DPRA 3ON4A 3GZ5A 3Q0WA 3LHQA 2XB5A 1HKQA 3H5RA 4XBFA 1HLVA 2VOPA 2L7ZA 5GAEJ 5GTHC 4JL3A 3G56A 4A3GJ 1K78A 2LNBA 1X1BA 3SWHA 2WV0A 2FXAA 3OR1C 4LIUA 3TKYA 4PJMA 3L2UA 3QRFF 3IH4A 4XKWA 3AL0C 4XLPF 4HF1A 1SD6A 2DA5A 2F4OB 1BBYA 2JT1A 3T1BA 4N9HA 3D5LA 4YEJA 1SAUA 2DYRH 2DFHA 4L9VA 2HKOA 1UG2A 3MQ0A 5BQTA 3J7ZI 1KQ0A 2YVEA 3CUQA 2QTQA 4CCJA 3PNTA 3ZR8X 3CDHA 3CJNA 5HDNA 2RKHA 1QVUA 3KPHA 3QWLA 4ENNA 3GFJA 4GYIA 2LG4A 2STWA 2WC2A 1E2XA 2NS0A 2OF7A 2VQCA 4HLXA 3V4GA 3DPLC 3SQNA 4HNVA 2JPBA 3CMMA 2YS9A 3HHGA 3VWBA 2LREA 3K2ZA 5J4VA 3WTSC 3JRHA 3KP2A 2RREA 3OYFA 2BZTA 2WBMA 4RAGA 5E20A 1FOWA 3W2WA 5BMZA 1NHAA 3QU3A 4BY1J 4IHTA 4Y4RA 3FX3A 2COMA 2ZMEB 2PFVA 3O6BB 2CQXA 1WGXA 1ZTRA 2CUJA 2P5LC 5HAWA 1VQPI 4HF2A 4DYRA 3HXLA 4ASNA 2WA0A 1NK3P 1W5CC 3C1DA 3HUGB 1O7LA 3FXJA 1ETXA 3CJTB 3LSRA 1YIJI 1V55H 2DJIA 3KP6A 4ZDPA 2DOFA 4MQ9F 3SYTA 5K5QA 3CO7C 3B73A 2D45A 1MJAA 3BR1A 4DYCA 4PGGA 4ZZLA 2DPDA 2L5QA 2QSGX 2ME0A 2RAEA 1OPCA 1JXSA 1I3AA 2Q2EB 1TQIA 3IHUA 4ESFA 1PYVA 2VIXA 5E1ZB 4ZC3A 1MD0A 1X19A 4GXOA 1V5EA 2CUFA 2PMHA 3RQIA 1TLHB 3DP7A 1Y39A 2OD5A 4OD4A 2JSPA 3J7AO 5ILVA 1BM9A 2HKUA 2AS5F 5AIQA 2ZO4A 1UMQA 5E8GA 1PJRA 2IA2A 2B63J 3VVXA 1STZA 2O6GE 1JKPC 3U2RA 4BUPA 5JLWA 3R61A 2L4MA 1HW1A 2PBIA 4HEA2 3SEZA 2Y75A 4NC6A 2HYFA 5CVJA 3OYEA 3HG9A 1U8BA 2VLAA 2M0MA 4JP0A 5IYDJ 4XN0A 3GF2A 2FEZA 3RIRA 4E7JA 2A6HF 4E7LA 1ZH5A 3M7GA 2E34A 3FF5A 4LLGF 3UNGC 4C2MJ 5HDGA 3C7JA 3E6BA 3HRMA 4ANJA 3DEUA 4MEYF 3NWTA 5CJ9A 1AKHA 3S17J 1T95A 4FE7A 5H6RA 2K9SA 4CUGA 4L18B 2EB7A 4BE1A 1TWFJ 4KMFA 3ZQCA 3F22A 1PP7U 3NAUA 2R7TA 1BIAA 3I55I 1YJ9I 1FEXA 1Z91A 2DTRA 4U88A 2NXNB 5AIPA 2R7DA 5D19A 4XIDA 4UV8A 2L2OA 2ECCA 3T8TA 4HG2A 2A69F 3DU5A 1KYWA 3FDYA 4LITA 1UB9A 3NRGA 3HKZN 2E35A 2ZXWH 2GA1A 1CF7B 1GDTA 2RQQA 4BL0B 5CVVA 2NNYA 4EJVA 4D1QA 2VKEA 3RYRA 1U8RA 2XSJC 3BR2A 3IUOA 2QBYB 4DIQA 2VBWA 2WB1A 3MKLA 3ZRGA 3A1YA 3FMQA 4DBQA 1B6AA 2F4IA 3IKVA 2LK2A 3BY6A 3ERED 2LLKA 1Z0XA 5CQEA 2CV0A 3COAC 2NS7A 3F1BA 4LLNA 4GFLA 2P4WA 1Z21A 2VBXA 2WAFA 2NP5A 2JRMA 1HQCA 3N05A 4DYQA 4FASD 4X0GA 4HA8A 3EUPA 1K83J 3AG2H 3I59A 5E18F 4H0EA 3SZTA 2EQRA 1T8IA 1YTYA 5B1BH 4A3JJ 1QU3A 1BA5A 2CFOA 3GFMA 1E0EA 2UV1A 3HYIA 3F8NA 4IHSA 3CWRA 2EFPA 2R93J 3RKYA 3MZ8A 1MNEA 5EJCA 4LFUA 5HBUA 1P2FA 1LDDA 2CU7A 3WHCA 3KIOA 4MO7A 3CESA 3H0GJ 1TWCJ 2RHAA 3AG1H 4KT6A 3BG5A 4FISA 3IKTA 4PJLA 4V2FA 1LE8A 1RR8C 2FJ1A 1BI2A 2X0LA 3L7WA 4GRIA 3EUKL 4LGWA 1P7JA 1SFKA 1U5TA 3DTKA 1FBSA 1FNNA 1ORKA 3JSPA 3ISPA 2VBYA 1EH7A 1I6HJ 3CTAA 2JK3A 1BI3A 1T0FC 3LQRA 4GFBA 1E17A 2H1LA 4P1WA 3VEPA 3F9KA 5FLVA 1PUFB 1S6LA 1RUNA 2HEOA 1VQ7I 2HOSA 4ABZA 3KEYA 3JRGA 2JA7J 3GEUA 3OOUA 3HL2A 1YRNB 1IRZA 4OIOF 2CS3A 2P7VB 5GADJ 4BS9A 4XKVA 1EH6A 3H3ZA 4EEFG 4QTRA 1YE9A 4IRVA 1OCOH 5HS9A 2XKPA 1R23A 4DOZA 5E8IA 1QPMA 1IN7A 1A35A 2EBIA 2HTSA 3NPIA 3FXQA 4BBRJ 4GGGA 4AUXA 2UXXA 4KA4A 5KCMA 2QEXI 1YW8A 4PXIA 2UXOA 2XROA 4X6AJ 5IP6A 4FE4A 5ICCA 5D8LB 1R58A 1MSEC 4M3FA 1S7EA 4HKUA 1Y8QB 3PL8A 4ZDLA 3NI7A 4E7ZA 3DTEA 4R8HA 2MFZA 1SD5A 1DP3A 3H9GA 5JHFA 1FBQA 3KCCA 4NC8A 1H88C 4EQQA 2CYYA 5D4RA 2D1HA 3BP8A 4JNNA 4P55A 4J01A 4FQGA 4A6EA 1F36A 2L9SA 3LSMA 1R4MB 2W25A 1WZ2A 3BPVA 3L2RA 2RN7A 3GTQJ 2D6YA 2F07A 4FETA 4IOAF 2PMUA 1XX5A 3K1MA 2HYJA 2LF7A 3Q0VA 4ENJA 2ICWG 2IGMA 3BR0A 2JUGA 1WH7A 4C2MA 3ZPLA 3C3WA 1FWZA 2A61A 3OR2C 4BBSJ 5FD5A 1U9OA 3FMRA 2M5WA 4N4OB 4LOCA 2QWWA 3IH2A 2ZMEA 2IEKA 5ICEA 2CW0F 4U87A 5JVTA 2XAHA 3CMEI 3IRQA 2V6EA 2G7SA 4A93J 1JTYA 2K9NA 5KVRA 3HUGA 1TW3A 4IOCF 3P9IA 3J80K 5TJJA 2QQBA 5FFZA 5HNHA 2HR3A 2DT5A 1MJBA 1R5ID 5DUIA 3MWMA 2NVQJ 2E2HJ 3F21A 2HPIA 1UHSA 5IPAA 3T6NA 2DA4A 3U21A 2D1VA 1D5VA 3TO7A 1B59A 3VTIA 2Q2EA 2V6CA 2H6CA 2BHYA 1R5GA 4G7HF 2LBFB 1H9GA 5M5WJ 2GUHA 5H9TA 3GTKJ 2L0KA 3FHNA 5E3MA 2R5YA 4G9YA 2XC7A 3CF2A 3ZMVA 3MCZA 4FCYA 2Z3YA 3CJRB 1WRJA 1OISA 2DMUA 4PCQA 1JI8A 3AG3H 2L9NA 3TDUC 1EH8A 1HOMA 3GUDA 2CFXA 1Z7UA 2XGDA 4IQ4A 4A0ZA 1KONA 1R6RA 2EZIA 2JSCA 3SZGA 1ZRDA 4BQQA 3HOTA 2Y48A 3Q5FA 3GVAA 5LEKA 1IRGA 3BTLA 3HBLA 4A3IJ 2FUG2 1HDDC 3ABUA 1OLTA 1YIOA 3OL4A 1JJ8C 1R22A 1ZAOA 1WJBA 2HQRA 4LB5A 2FNAA 5AQCA 4L5IA 1KU7A 1WI3A 4YFXF 4V19K 3PO3J 2W57A 4BGDA 2DK8A 2JN6A 3WG7H 3C07A 1RR7A 1RKWA 3GTMJ 4I01A 3LFKA 4PSXA 2CUZA 2NYXA 4F55A 3G1LA 4G6TB 1MGTA 4EV0A 3QBMA 3TGNA 4GCTA 3LJLA 3KLOA 1T39A 2KZGA 2L7FP 2O8XA 4M6YA 4M72A 4GFKA 4IXAA 1BJAA 3I3LA 1NTCA 4U7DA 2PEXA 4P96A 1D8KA 1KU9A 3DLAA 5CPRB 2HQ5A 2K3PA 1B8IA 2MA3A 2HZDA 1XTAA 5BS6A 4RGSA 2Q1ZB 4ZTFA 2DXIA 5GPCA 2J5PA 2Z33A 1QHHD 3NQOA 4XKCA 3CJQB 1KU3A 2KMUA 3F6VA 3VVZA 3OYCA 1QQIA 3G73A 4ZDOA 4I7HA 3W2VA 3OV8A 1L3LA 3BJAA 4B47A 2LKXA 4PDKA 1VQ9I 2EZKA 4ESJA 2W1OA 4A5MA 3ZN1A 2NVTJ 4RGXA 3JTGA 3BCGA 3S1NJ 5LRRA 4NQWB 3F8FA 2QBYA 2OERA 6PAXA 1XMKA 3UKGA 2JZYA 3BG9A 3KEOA 4C2TA 3KEQA 3KZ9A 2YU9J 4QIWN 3SDGA 2MD0A 1A31A 1DGRM 3ROUA 1XN7A 4YZEA 2MLKA 1XMAA 3VVYA 2K85A 4D5CA 4HNUA 3OYMA 5KK1A 1ZREA 3OYKA 4MFDA 4IVNA 4DNCA 5KAIC 3OYBA 4I2OA 2LRDA 2DFEA 1OYWA 4L5JA 3FBNB 1S3JA 2N8GA 1T6SA 5JVGF 2ELKA 3TW6A 2BY1A 1RRJA 2DLLA 3JRCA 2Z99A 2ZXHA 1R36A 4XM3A 3WU2C 2JA8J 1FIAA 2V9VA 3ZQFA 5ERIA 1U3EM 4E70A 1D5YA 1JUPA 2R7WA 3HB9A 4KUMA 1TWHJ 2AQEA 3K9TA 3BZ6A 1MDMA 2X9DA 4XLFA 1ETQA 1G3YA 3ZMZA 2HVSA 1MBFA 4RB0A 1SFOJ 3KZYA 1ZRCA 2GLOA 4HDUA 4K2EA 1K6YA 1JKRC 5FRMA 1ZGWA 5H20A 3NWSA 3KZZA 4FT8A 3CCSI 2NP3A 3BC8A 2AQFA 3HTHA 2IA1A 4MFEA 1VQ4I 3RD3A 3KYCB 2V79A 3K7AJ 2UXNA 2VASA 4BQNA 2XAJA 5IOYA 4AD9A 2OQRA 2GFNA 1LKXA 3CCQI 3OYJA 2CO5A 2DA1A 1SMYF 2R5ZB 4EM2A 1PUFA 2RGVA 3HRSA 4PFOA 4E6KG 4OMYA 2IGOA 4M74A 5F0CA 1JKOC 1YRNA 3GLLA 3RSNA 3JCUC 3CCEI 2EZLA 3PASA 4DJAA 1VI0A 3CLOA 2JA2A 2VE8A 2CW7A 2FF4A 4UUTA 3K1PA 2UWMA 3CCJI 2LH9A 2OA4A 5HOOA 2NAZA 2RDPA 5F0FA 1ZLKA 2VQLA 2OCEA 3ZGKA 2O8KA 2CV1A 2REKA 2M1BA 3KX2A 5L3CA 2YX4A 3KP4A 2FSWA 5K1YA 2OZUA 2BVMA 1DP7P 2FOKA 1ETYA 1X3UA 3ABTA 3E5XA 1Y0NA 1ZRFA 3CP2A 3GXOA 1ZG3A 1YX5A 4BHPA 3E6MA 5DD4A 4CA0A 2LC2A 2QENA 1T08B 1WFXA 3GFLA 5EZHA 4ON0A 3WTWC 2G7HA 1SAXA 2B1EA 3LAPA 2Q8KA 3EGQA 2PMZN 4WXDA 1YJWI 3KP5A 4XRMA 1LDJA 4XR6A 3BPXA 3H0DA 2BV6A 3JW4A 2VXDA 2A6TA 3I64A 1VNDA 2KIUA 4ME9A 1YW7A 5CVUA 3P7NA 4B09A 1XGMA 5IT9K 2QSHX 1D0XA 3CCMI 2NS8A 2RNGA 4E7IA 2ZY9A 3W6JB 2BBYA 1I5ZA 2K02A 5IT3A 3WU0A 4CZZA 5K7FA 5FJ8J 1POGA 1S9HA 2XAGA 3WTZA 3V7RA 4N4NB 2IS6A 2MBFA 3JAMK 4U0YA 1ETWA 4OWRB 2EIJH 3K0LA 4XMYA 4KMUX 3GZIA 1XS9A 2WTEA 1FJLA 2G0EA 3BR6A 3QPTA 3VYSB 1X2NA 1XDSA 1REPC 1XSVA 5HODA 2HDDA 2GOXB 1Y1VJ 1HBXG 4BEHB 1IUFA 3QODA 5F27A 3QYEA 3VYRB 3WTVC 1XSDA 2LDUA 1WJFA 3VODA 4DVYP 2WY7Q 1FSHA 2E71A 2IS1A 3SXYA 4MK6A 2LY9A 4C3HJ 4G12A 4YFKF 2ELJA 2LKPA 1IN5A 2YUSA 3LFUA 2WAEA 1VF9A 1H89C 2DOEA 3FISA 2YVXA 1NG6A 4BQOA 1F9NA 2WGBA 3WG9A 4GCKA 5A2QK 3MN2A 2GAUA 2E7XA 4C3IJ 3DCFA 5C4JJ 1AHDP 2ZNYA 2X6WA 1JHHA 2DA6A 2JTVA 1A04A 2LBFA 3GCMA 4G7ZF 1LVAA 2OBPA 1B9MA 4ENKA 1Z3XA 1KQ9A 5EEAA 2V57A 5EFYA 5EZGA 4FTHA 5D4SA 1HCRA 3PFIA 5H6QA 3ZN0A 5DCMB 4B48A 2QVOA 4CO8A 2ZFUA 3O3KA 4LK1F 1YI2I 2R7XA 3DPTA 2JUCA 1SVOA 2NOGA 1LUJB 4AYBN 3OS0A 3PUFA 3JRAA 3QP5A 4KN4X 1CGPA 2BY3A 4B43A 3CUOA 1SD4A 4EJOA 4WK8F 4FX0A 5IOZA 2EFNA 5C4YA 1Z1DA 3PM1A 2MC4A 3ZCOA 1X4OA 2V7FA 3RKXA 1C0WA 2F5CA 1SEUA 1VQKI 3HRUA 1BN5A 5B66C 3K2AA 2DO7A 2XPWA 3NRVA 5E3LA 1R9TJ 4U0WA 3KNWA 4PFPA 3R0JA 2D5VA 1X1AA 5FO5A 1QVTA 1XPXA 4M6XA 3FKIJ 4E7SA 2KHMA 1PVEA 2IGKA 1HSTA 2W4SA 5ILUA 4ZYGA 3D5RC 3BQYA 1BR2A 5DM6F 4CCKA 1ENHA 5HS7A 3LSHA 1EKEA 3OL3A 2L7KA 2G7GA 3LOCA 2ZJQF 3P9TA 2WWYA 1R4NB 4HSRA 1FP2A 2FD5A 2V26A 1JGGA 1MIJA 2CQNA 1O57A 3QPHA 5E3OA 1MMDA 4W1UA 1R49A 2WAQA 5FLMJ 2XASA 1MMAA 4WF2A 4HX4A 3JSOA 1FMVA 1TWGJ 1TL8A 2STTA 3IH3A 4IHVA 1XCVA 3GBGA 1XGNA 3PIPF 1W5SA 1SD7A 4NQWA 2MH9A 4BXXJ 1G4DA 3Q3SA 1T38A 4LG0B 1JHFA 2XPUA 3VYTB 1S29A 4AU7A 3WTYC 2MLGA 2VI6A 2G7LA 4BNCA 2VOOA 3AL0B 4DZPA 2ZKZA 1FIPA 4NUBA 4OAYA 4KWAA 3RH2A 1ODDA 2GA2A 3AKZA 4G94A 3Q0UA 4IZZA 2CRGA 3TQNA 1UI5A 2E1NA 2IGNA 4E7KA 2ZCNA 2JPCA 1TBXA 2Y30A 1B72B 1FY7A 4Y13A 4XQFA 3B6CA 3HZJA 5JR3A 4C9YA 2OPTA 4HLYA 4JKZA 1R7JA 4MEXF 2VKHA 3E3VA 3QPLA 1TT5B 5DEQA 2W84A 4XLEA 3OIOA 4RB1A 4ZJZA 3S3MA 2R7VA 3KE2A 4XLAA 3DXJF 3JRFA 3EQLF 3RPUD 3V78A 2DFIA 2PJRB 3K69A 1P7IA 1MNMC 1IRXA 3DKYA 1BI0A 3GTOJ 2JQ7A 3VW0A 3HIMA 3BG6A 1FP1D 2DMQA 3AG4H 5B1AH 5LLQA 4P9FA 2VB6A 1YFHA 3TOBA 4F3QA 3FBIB 1GLNA 4CYCB 1OCRH 3PIOF 2IAIA 3SJMA 2FMYA 3F0CA 4PZJA 2ZCWA 3W3CA 2HVRA 3PO2J 1YW9A 2DMPA 1MH4A 5J1YA 1J09A 2FX0A 1X4PA 2M8GX 5FGMA 1GVDA 1TQPA 1XCBA 2W7NA 2KRCA 2UXHA 3WGGA 2QA4I 1MKMA 2HWVA 3HOWJ 2HOTA 2XKOA 2EJRA 2M9HA 3H9JA 2W82A 4B44A 2IRFG 2P81A 3HOYJ 2E60A 3CC2I 1MMGA 3BT9A 3S1QJ 3EUHC 3RPQA 1OR7A 3QAHA 1KZHA 3E5QA 2HTJA 2E5NA 5IYBJ 2QF7A 3BWGA 2ID6A 4Z2YA 3CDIA 4NNJA 1TW2A 1I27A 3IAS2 3M8EA 3BNIA 1MBGA 4LIVA 4CH7A 1UI6A 4I6ZA 4HRIA 1ZARA 2ECBA 1V3FA 1UCRA 3QOPA 5ILSA 1S72I 2HPMA 2A68F 2G9WA 3A2KA 5F6FA 3T8RA 1IN4A 3BROA 2NVXJ 2Y0SA 5GAHJ 4ZZDA 3RKWA 2W85A 5LD2C 1GHCA 1WJCA 2B7EA 3PSFA 3HSEA 3L09A 3L2CA 5JLXA 1P4AA 3M9AA 3HOZJ 2EINH 1B1BA 1FTTA 2G7UA 4F91B 2Z2SB 1MNDA 3FK6A 3G1MA 1Z9CA 3PJRA 2CJJA 4NC7A 2IU5A 4EMSA 3BTCA 5FHPA 4HBLA 5D6EA 2Y9YA 3F6OA 1O4XA 1BC8C 3H5AA 2XVCA 4BJTA 1QPIA 2YU3A 2DDBA 1JGSA 2HFHA 2A2FX 3K4BA 2QOPA 4UVBA 3SHFA 1N77A 1DGWY 2FE3A 2K40A 4BEHA 3QP6A 4YG2F 3K70C 5K7HA 3BR3A 3ONQA 2L54A 5B5EC 4RGUA 3GZ6A 2UZKA 4L0ZB 1ETOA 5FKOA 5C4XJ 4YIRX 3U1KA 2EIMH 2QIBA 2M2EA 4BYYA 3DFGA 1Y8RB 4M3DA 1HSJA 3RJPA 3CP8A 3CCUI 2KIMA 2E1CA 1IV8A 3BDDA 1HKSA 1RIOH 3HGGA 3D5SC 3ESWB 4WXHA 1YLFA 2IS2A 2DODA 4AIKA 1KA8A 2ID3A 3PNYA 3SZPA 4PJNA 3ZMDA 4D9JA 3KP3A 4BE0A 4QSHA 4R1HA 3AFHA 3FXUA 5D6FA 4IX7A 3KYDB 3CCRI 3IUVA 4M9ZA 5FLXK 4RMNA 2PG4A 5DCMA 4D7NA 3AQSA 1IN8A 4RBOA 2GQQA 3DBLB 1USTA 4CICA 5A2QZ 2L9RA 4Y7NJ 1X3WB 2ZSHB 2KRFA 3LA3A 4QWQA 4CZCA 5EG0B 3TO9A 2NRAC 2PI0A 2GENA 5CW8A 4GCVA 4A0XA 3S93A 2NNNA 1WQ2A 4UB6C 5GPAA 3GFIA 3ZMUA 1DDNA 1IF1A 2W48A 4B1RA 3VOKA 3H92A 4AIJA 1ZR4A 1SFXA 2BOLA 4GDFA 1A6IA 4C3JJ 4ZH4F 4NBQA 3OS2A 2QWTA 2UXPA 3GX4X 4XSXF 3CUQC 1LPQA 3WTTC 2IJLA 1AA7A 1D0ZA 3P5JA 3KP7A 2B9SA 2VE9A 4RA2A 2DTZA 1Z6RA 2PN6A 4H4KC 4LK0F 3VW1A 1JUSA 1TT0A 4JX5A 2K9QA 3PPBA 2KIFA 3I58A 3V6GA 2ACJA 5CVRA 3JSJA 3EDPA 3SFZA 3VYUB 1G2HA 3E97A 4HQEA 5E3NA 1D3YA 5EGOB 2XGEA 4RM3A 2YX7A 2DMNA 5GP9A 5J40A 1VQMI 3E7LA 3NEUA 5J47A 1TQMA 2BE5F 3BCBA 3HPGA 4M3BA 1EF4A 4OINF 3S2HJ 3BLYA 3PNVA 4JX4A 1QBJA 2M7BA 3LQQA 2V1UA 2BXYA 1F43A 2L7MP 1FT9A 4HQMA 4II3A 5BPIA 3HTJA 5DAJA 4M73A 2HZTA 2GZWA 5J3LA 3TEDA 1IZ1A 2DCEA 3DBRB 2K9LA 3C18A 4RS8A 4ZYHA 2X1DA 2Z9OA 1S7OA 3T5XA 4LG0A 2R7SA 4XONA 2FBKA 2KKOA 2LP0A 1X58A 3ZQ7A 5C3EJ 4EGYA 1MSFC 4NN1A 1UG0A 2OTLI 5ICGA 2FBQA 3FXOA 1J9IA 4A3LJ 4CCOA 3NARA 4KITB 2FU4A 3H3VK 3ZQGA 1I1SA 2K4JA 4G6QA 4O6JA 1UHMA 1USSA 2HOEA 1RC9A 5JFRA 4Z6YA 3FRQA 2FQ4A 1P4WA 2M7AA 3I4NJ 3U9GA 2TDXA 1FLIA 4EM1A 2XDVA 4ETSA 2CSOA 4BAYA 5D5WB 2TCTA 3TL4X 4XLCA 1JT0A 1KU2A 2VC1A 3M3YJ 4QLCU 1N75A 1WJ5A 4NDLA 2CWEA 2J5OA 2DT6A 3IWFA 3OYIA 1P6RA 3NNRA 2V1NA 3FXMA 1R1TA 2R4GA 2G3BA 1X1DA 1MMSA 2DMTA 4L0YB 4V2GA 3WGHA 1M1EB 3E6DA 2PJRA 2DG7A 2W00A 1UZCA 3K4MA 5FKNA 2VJ4A 3G6EI 3COLA 5LFAA 1ETKA 4KISA 3CUQB 5FGLA 1K4TA 4OAZA 2CG4A 2MC3A 4ZYDA 3O8GA 2FQ3A 3EYYA 3L00A 1BI1A 2VQGA 2CUEA 2A5YB 2CW8A 5E1XA 2GM4A 1WJDA 4IJAA 1MJ9A 2JWTA 2OU2A 2YSRA 3VSKA 2DPUA 2RASA 2C6YA 4KIBA 3I0TA 1RI7A 2XRLA 4EJWA 4ESBA 4F52A 2OV7A 2K3FA 2I8DA 4G8XA 1J2XA 1IXSB 2E5ZA 3M8FA 2E1MC 4HX8A 5J6XA 4EATA 2H94A 1ETVA 4M9SA 2LY1A 4XNFA 1KQ8A 3K6GA 4XRSG 1CF7A 2WB1N 3LA2A 5CLSA 4PJJA 2FRHA 3PQJA 1IC8A 5EF6A 5K5RA 2VPLA 4HSTA 2KT0A 4I76A 3W6VA 2Z1DA 3JRBA 1O3TA 1ULYA 1ZYRF 2QQ8A 4I09A 2KFDA 3CQZJ 5B3SH 1T98A 1EJ9A 2XF5A 2Y0MA 3H36A 1W0UA 3KFWX 3Q9VA 3ABKH 3JR9A 4Q48A 3LAJA 1RPWA 3I54A 5J1UA 1XD7A 3M8JA 3HEFA 4PSWA 2NVUB 4KN7X 4JBAA 1SGMA 2GXAA 1YOVB 5J1RA 4I0BA 2XGXA 5KAFC 2ZNZA 3DV8A 2LF8A 2DN0A 3CCYA 5BOXA 3CDLA 3TDZC 3K1NA 4Q47A 3V42A 4XK4A 1YS7A 3GTLJ 1IUYA 5TRDA 2PZ9A 2HDWA 5HNFA 1GXQA 4NELA 1OJLA 3HIFA 1J5YA 5FB2A 5IP7J 1NH3A 4RAZA 2R0QC 4XOTA 2HS5A 3O8HA 5FKMA 1TNTA 2LVSA 2YPRA 3HGYA 4YIFA 1W36C 3DPJA 4F93B 2E2JJ 4TV7A 1LFBA 4CDGA 1ZK8A 2P8TA 5LRSA 1NK2P 3P9KA 1WCMJ 2X51A 3L2QA 3GZNB 5EEGA 5IP9J 3FHZA 2GOMA 1U6GA 1UHWA 1U0JA 3BRUA 3MFKA 3HOXJ 1DUXC 2YVHA 4DW6A 3VSLA 5D5XB 1LVKA 3OYLA 2H27A 2R7FA 2KP6A 2O0YA 4A3KJ 5LHHA 5DS9A 4IHXA 4LLLA 1U5TC 5DTDA 2E1MB 2XPVA 4I99C 3M1CA 1W4MA 3G7RA 2ZBKA 1IG7A 2F5EA 5IYCJ 2ISZA 3S16J 3OYHA 4XL9A 1ON1A 2PFBA 3K10A 2WUIA 2ZC2A 3V8JA 1G8XA 4IRHA 4P5OA 5M5YJ 3ANGA 2A5WA 1J7KA 1TNSA 4N0BA 3HOSA 1RETA 3S2WA 2E19A 3F3XA 4BJ5C 1DU6A 1ZG1A 4UB8C 3CMAI 3TP0A 2KPMA 4S0HB 2KLOA 4OIPF 2K4BA 5EG0A 5M3FJ 3QKXA 3H9QA 2IXSA 2DA3A 1BR1A 1UFMA 1G6NA 2DA2A 5FKLA 4AVZA 2GWRA 2ADUA 4HV6A 1ERDA 3HKZA 3SFIA 1LJ9A 3GW2A 3TW7A 3N97A 3R4KA 3S3OA 5LBQA 3G2BA 3HC7A 2Y9ZA 3MZHA 4A3BJ 1ZGJA 5FLXZ 4LMYA 2I5UA 1VFCA 2JJ7A 3P9CA 3ULQB 2DFFA 2QQAA 2M3AA 2V9PA 4XN3A 4BHBA 4KFCA 1MZBA 3R6SA 2HDCA 4A5NA
chains in the Genus database with same CATH topology
2Y2ZA 3Q0UA 2CRGA 1UI5A 2ZCNA 2EH3A 1BW5A 2Y30A 3C2BA 1B72B 1RESA 3QPSA 2EBIA 2IBDA 3B6CA 3NPIA 2OPTA 4BBRJ 4JKZA 4AUXA 3RZDJ 3QPLA 4UUSA 3S15J 3OIOA 4PXIA 2UXOA 3S5RA 1TWAJ 1XG1A 4X6AJ 5IP6A 1IDYA 4FE4A 2ZB9A 2Y0SN 3JRFA 4M3FA 1MSEC 1S7EA 2JA6J 4HKUA 3V78A 3HOVJ 3NI7A 1P7IA 1MNMC 3GTOJ 3VW0A 4M6VA 3HIMA 2DMQA 1H88C 3LNQA 2O7OA 1U78A 4AC6A 4JNNA 4CYCB 5F1JA 2IAIA 3SJMA 1H8AC 3VW2A 3F0CA 3BTJA 3PO2J 2DMPA 1F36A 5EYRA 1MH4A 5J1YA 2FX0A 3ZOBA 2OI8A 1MBEA 2M8GX 1GVDA 1ZR2A 2D6YA 3DEWA 3GTQJ 2F07A 1ZKGA 3WHBA 1HF0A 2UXHA 1GV2A 2HYJA 2E2IJ 2O7TA 3HOWJ 3Q0VA 2HOTA 4L62A 3BR0A 1WH7A 2LR8A 2M9HA 4IHWA 2XDNA 4BBSJ 1U9OA 2P81A 4JYKA 4LOCA 3HOYJ 5FMPA 3S2DJ 3BT9A 3IH2A 1IGNA 4X1EA 1RKTA 1Y1WJ 3S1QJ 2IEKA 3VIBA 2PBXA 5BNGA 2EZHA 5IYBJ 2QF7A 2ID6A 4A93J 2G7SA 2Q24A 1JTYA 2HI3A 2K9NA 3GTJJ 1T33A 2NVYJ 3BNIA 1MBGA 1MBHA 1I3QJ 1UI6A 4I6ZA 2X48A 3A02A 4BY7J 4M3GA 2ECBA 3E7QA 5C44J 3CJDA 2H8RA 2NVXJ 3OSGA 1I50J 3A01B 2NVQJ 1AKHB 2E2HJ 1UHSA 5IPAA 3T6NA 2HOAA 2QCOA 2DA4A 3LSGA 1JTXA 5JLXA 2LTPA 4J19A 3HOZJ 1FTTA 4RDUA 3JREA 4MXMA 1JKQC 5M5WJ 2GUHA 5H9TA 3GTKJ 2L0KA 5E3MA 2R5YA 3FK6A 4AF5A 1TC3C 3G1MA 1DU0A 2CQQA 4FCYA 2MW8A 2CJJA 2DMUA 3BR5A 2IU5A 3ON2A 3BTCA 3BTIA 5FHPA 2Y9YA 1HOMA 1K61A 1O4XA 2XGDA 1A5JA 1ITYA 1MBJA 1IJWC 3D1NI 5CXIA 3IV5A 2EZIA 2HYTA 1QPIA 4A3DJ 2ME6A 2QOPA 2Y31A 2MG4A 3BTLA 2K40A 3HBLA 3MNLA 4A3IJ 1HDDC 3GTGJ 1JJ8C 5HSZA 5K7HA 4Y52J 3BR3A 3HM5A 4CGRA 1SANA 3M4OJ 1ETOA 5FKOA 4IHYA 1JT6A 5C4XJ 5AQCA 1WI3A 2E1OA 3PO3J 2KDZA 2QIBA 2JN6A 2M2EA 1ZQ3P 3C07A 1RR7A 4MLOA 1XC5A 1RKWA 4A3CJ 3MVPA 4M3DA 3GTMJ 3LWJA 3VUQA 4AC0A 2UXUA 3BQZA 2XSDC 3G1LA 3QBMA 4L5EA 4GCTA 3HGGA 3LJLA 2L7FP 1FTZA 4GFKA 1BW6A 2WV1A 1NTCA 4M3EA 1E3OC 2ID3A 3S1MJ 2HQ5A 3JRDA 2R92J 4IEJA 5EGOA 1B8IA 2VUMJ 2JMWA 4A3FJ 4QSHA 3ZQHA 1APLC 2R5YB 5GPCA 4D5FA 3HTAA 3IUVA 4D7NA 3AQSA 2DJNA 5M3MJ 3VVZA 3AQTA 4RBOA 3TP3A 4ACIA 3L1PA 5EDNA 3LSPA 2L9RA 4Y7NJ 4XICA 5EG0B 5D1RA 2GENA 2LKXA 1LE8B 9ANTA 5CW8A 2EZKA 2NVTJ 3S14J 3BCGA 3S1NJ 2COBA 2LD5A 3RZOJ 5GPAA 1WH5A 2OERA 2W48A 2X6OA 4B1RA 2VKVA 3UKGA 3HE0A 3VOKA 3BG9A 1ZR4A 5D18A 1GUUA 1U9NA 3KZ9A 2R5ZA 2YU9J 1A6IA 4QIWN 3SDGA 3KKCA 4C3JJ 3FIWA 4YZEA 3I4MJ 2QWTA 2UXPA 3VVYA 4D5CA 3ON4A 4MFDA 3Q0WA 5F08A 3LHQA 2XB5A 4MIMA 2DTZA 1HLVA 2N8GA 2L7ZA 3VW1A 2ELKA 1JUSA 4JX5A 3TW6A 4JL3A 3G56A 2K9QA 3JRCA 4A3GJ 3PPBA 4JX6A 3NXCA 2JA8J 1FIAA 3ZQFA 3V6GA 5F0HA 3JSJA 1QRYA 4B3AA 1D5YA 1G2HA 1IDZA 5E3NA 1JUPA 3IH4A 2O9LA 3HB9A 1B8IB 5EGOB 1TWHJ 2DA5A 4UUSB 2XGEA 2X9DA 2DMNA 5GP9A 1ETQA 3E7LA 2H1KA 1MBFA 1SFOJ 2GLOA 1MH3A 4M3BA 1EF4A 3FK7A 3S2HJ 1JKRC 1ZGWA 4JX4A 1UG2A 2AO9A 2M34A 1Q1VA 2YVEA 2NP3A 1BL0A 1F43A 2L7MP 3HTHA 2QTQA 4MFEA 3LSJA 3HTJA 5DAJA 3RD3A 3K7AJ 5J3LA 3TEDA 5IOYA 1QVUA 2GFNA 2UXIA 2OF7A 2LP0A 1X58A 5C3EJ 2DA1A 1PUFA 2R5ZB 4HNVA 3A03A 2YS9A 1MSFC 5F0CA 1JKOC 2LFBA 1YRNA 4NN1A 2FBQA 2GBYA 2EZLA 4A3LJ 3PASA 3NARA 1VI0A 3H3VK 3ZQGA 3JRHA 4UUTA 1MBKA 3HDDA 3FRQA 2FQ4A 3I4NJ 5F0FA 2ZOYA 4BY1J 2O8KA 4BKXA 2ZCMA 2REKA 2TCTA 1W0TA 1JT0A 2CQXA 1WGXA 1ZTRA 2XB0X 4XRSA 3M3YJ 5HAWA 1ETYA 4NDLA 2W53A 4DYRA 5K7ZA 3NNRA 4W97A 1NK3P 2G3BA 5EZHA 2DMTA 2DG7A 4V2GA 3EGQA 3HTIA 1ETXA 2I10A 2PMZN 5FKNA 3ZQIA 3LSRA 3COLA 1ETKA 5FGLA 3BR1A 4XRMA 3O8GA 4DYCA 5K58A 3ZQLA 2CUEA 2R7ZJ 3CMYA 1VNDA 2HXIA 2ME0A 2RAEA 2XGCA 2GM4A 4ME9A 3VP5A 2JWTA 3KKDA 2RASA 2MGQA 2NS8A 2TRTA 2XRLA 2CUFA 5K7FA 3RQIA 5FJ8J 1IV6A 1POGA 4A69C 4UDSA 2HKUA 1GT0C 1UMQA 2B63J 3VVXA 1JKPC 1ETVA 1ETWA 5CXGA 5JLWA 4XRSG 3G1OA 2WB1N 3JRIA 2MSYA 1JUMA 1XS9A 1WPKA 3GZIA 2HXOA 2G0EA 3BR6A 2DA7A 5EF6A 1X2NA 1IC8A 1FJLA 1U8BA 4JP0A 2KT0A 4I76A 5HODA 2HDDA 1Y1VJ 3W6VA 5IYDJ 1IUFA 5F27A 3JRBA 1JJ6C 3CQZJ 4C2MJ 1OCPA 4MK6A 2LY9A 4C3HJ 1W0UA 4G12A 2ZCXA 2YUSA 3JR9A 1RPWA 1VF9A 1H89C 3FISA 5J1UA 2M0CA 3HEFA 3A01A 1AKHA 3S17J 4FE7A 2WGBA 1SGMA 5FKKA 5J1RA 5M5XJ 4GCKA 3MN2A 2K9SA 2DG8A 2DN0A 3CCYA 2ZOZA 3ANPA 4C3IJ 1CQTA 4DZJA 3DCFA 3CDLA 1TWFJ 5C4JJ 3ZQCA 1AHDP 3NAUA 2DA6A 2WAQN 3O60A 4XK4A 1FEXA 3B81A 3CRJA 3GTLJ 5D19A 2JA5J 5EEAA 4XIDA 2PZ9A 2V57A 5EZGA 4FTHA 5EFYA 1HCRA 3OSFA 1Z77A 2NX4A 2ECCA 1AU7A 4NELA 1OJLA 5IP7J 3BHQA 2R0QC 2NOGA 3NRGA 3O8HA 5FKMA 3HKZN 2LVSA 3HGYA 3DPJA 4AYBN 3JRAA 2E2JJ 1GDTA 1OFCX 1LFBA 1T56A 2VKEA 1ZK8A 3BJBA 3BR2A 1NK2P 1WCMJ 5IOZA 5IP9J 5C4YA 3MKLA 3PM1A 2AHQA 3BRUA 2LK2A 3HOXJ 1OCTC 2LLKA 3VPRA 2YVHA 4DW6A 1Z0XA 1R9TJ 3K2AA 2XPWA 5E3LA 3KNWA 2NS7A 3F1BA 4GFLA 2D5VA 4D7MA 1QVTA 2NP5A 3FKIJ 4A3KJ 5DS9A 4IHXA 5DTDA 4DYQA 3EUPA 2XPVA 1K83J 1LFUP 3BQYA 3G7RA 4A3MJ 1IG7A 1ENHA 1B72A 5IYCJ 2EQRA 3S16J 2G7GA 3LOCA 1GV5A 3P9TA 4A3JJ 1BA5A 2WUIA 2FD5A 3S1RJ 3BG3A 1JGGA 3GTPJ 3VOXA 3CWRA 2R93J 5E3OA 3RKQA 4W1UA 4A3EJ 5M5YJ 3ANGA 5HBUA 2CU7A 3WHCA 5FLMJ 4MO7A 1RETA 2E19A 3H0GJ 1TWCJ 1DU6A 2RHAA 4ICHA 3TP0A 2QKOA 1TWGJ 3BG5A 4FISA 4S0HB 3IH3A 4IHVA 5EG0A 5M3FJ 4V2FA 1HDPA 3QKXA 1LE8A 2FJ1A 1BJZA 3GBGA 2DA3A 1P7JA 2DA2A 5FKLA 3B6AA 4B4CA 4CYCA 1ORKA 4BXXJ 3QQAA 3Q3SA 3SFIA 1I6HJ 2JK3A 3TW7A 4GFBA 2XPUA 5FLVA 1PUFB 2Y9ZA 2HOSA 4A3BJ 4ABZA 3HOUJ 3JRGA 1X2MA 2VPRA 2JA7J 1VFCA 2JJ7A 2VI6A 3OOUA 5F04A 1YRNB 1IRZA 2G7LA 3GEUA 4DZPA 4KWAA 1FIPA 3RH2A 4GCLA 4EEFG 4QTRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y2Z A;  3Q0U A;  2CRG A;  1UI5 A;  2ZCN A;  2EH3 A;  1BW5 A;  2Y30 A;  3C2B A;  1B72 B;  1RES A;  3QPS A;  2EBI A;  2IBD A;  3B6C A;  3NPI A;  2OPT A;  4BBR J;  4JKZ A;  4AUX A;  3RZD J;  3QPL A;  4UUS A;  3S15 J;  3OIO A;  4PXI A;  2UXO A;  3S5R A;  1TWA J;  1XG1 A;  4X6A J;  5IP6 A;  1IDY A;  4FE4 A;  2ZB9 A;  2Y0S N;  3JRF A;  4M3F A;  1MSE C;  1S7E A;  2JA6 J;  4HKU A;  3V78 A;  3HOV J;  3NI7 A;  1P7I A;  1MNM C;  3GTO J;  3VW0 A;  4M6V A;  3HIM A;  2DMQ A;  1H88 C;  3LNQ A;  2O7O A;  1U78 A;  4AC6 A;  4JNN A;  4CYC B;  5F1J A;  2IAI A;  3SJM A;  1H8A C;  3VW2 A;  3F0C A;  3BTJ A;  3PO2 J;  2DMP A;  1F36 A;  5EYR A;  1MH4 A;  5J1Y A;  2FX0 A;  3ZOB A;  2OI8 A;  1MBE A;  2M8G X;  1GVD A;  1ZR2 A;  2D6Y A;  3DEW A;  3GTQ J;  2F07 A;  1ZKG A;  3WHB A;  1HF0 A;  2UXH A;  1GV2 A;  2HYJ A;  2E2I J;  2O7T A;  3HOW J;  3Q0V A;  2HOT A;  4L62 A;  3BR0 A;  1WH7 A;  2LR8 A;  2M9H A;  4IHW A;  2XDN A;  4BBS J;  1U9O A;  2P81 A;  4JYK A;  4LOC A;  3HOY J;  5FMP A;  3S2D J;  3BT9 A;  3IH2 A;  1IGN A;  4X1E A;  1RKT A;  1Y1W J;  3S1Q J;  2IEK A;  3VIB A;  2PBX A;  5BNG A;  2EZH A;  5IYB J;  2QF7 A;  2ID6 A;  4A93 J;  2G7S A;  2Q24 A;  1JTY A;  2HI3 A;  2K9N A;  3GTJ J;  1T33 A;  2NVY J;  3BNI A;  1MBG A;  1MBH A;  1I3Q J;  1UI6 A;  4I6Z A;  2X48 A;  3A02 A;  4BY7 J;  4M3G A;  2ECB A;  3E7Q A;  5C44 J;  3CJD A;  2H8R A;  2NVX J;  3OSG A;  1I50 J;  3A01 B;  2NVQ J;  1AKH B;  2E2H J;  1UHS A;  5IPA A;  3T6N A;  2HOA A;  2QCO A;  2DA4 A;  3LSG A;  1JTX A;  5JLX A;  2LTP A;  4J19 A;  3HOZ J;  1FTT A;  4RDU A;  3JRE A;  4MXM A;  1JKQ C;  5M5W J;  2GUH A;  5H9T A;  3GTK J;  2L0K A;  5E3M A;  2R5Y A;  3FK6 A;  4AF5 A;  1TC3 C;  3G1M A;  1DU0 A;  2CQQ A;  4FCY A;  2MW8 A;  2CJJ A;  2DMU A;  3BR5 A;  2IU5 A;  3ON2 A;  3BTC A;  3BTI A;  5FHP A;  2Y9Y A;  1HOM A;  1K61 A;  1O4X A;  2XGD A;  1A5J A;  1ITY A;  1MBJ A;  1IJW C;  3D1N I;  5CXI A;  3IV5 A;  2EZI A;  2HYT A;  1QPI A;  4A3D J;  2ME6 A;  2QOP A;  2Y31 A;  2MG4 A;  3BTL A;  2K40 A;  3HBL A;  3MNL A;  4A3I J;  1HDD C;  3GTG J;  1JJ8 C;  5HSZ A;  5K7H A;  4Y52 J;  3BR3 A;  3HM5 A;  4CGR A;  1SAN A;  3M4O J;  1ETO A;  5FKO A;  4IHY A;  1JT6 A;  5C4X J;  5AQC A;  1WI3 A;  2E1O A;  3PO3 J;  2KDZ A;  2QIB A;  2JN6 A;  2M2E A;  1ZQ3 P;  3C07 A;  1RR7 A;  4MLO A;  1XC5 A;  1RKW A;  4A3C J;  3MVP A;  4M3D A;  3GTM J;  3LWJ A;  3VUQ A;  4AC0 A;  2UXU A;  3BQZ A;  2XSD C;  3G1L A;  3QBM A;  4L5E A;  4GCT A;  3HGG A;  3LJL A;  2L7F P;  1FTZ A;  4GFK A;  1BW6 A;  2WV1 A;  1NTC A;  4M3E A;  1E3O C;  2ID3 A;  3S1M J;  2HQ5 A;  3JRD A;  2R92 J;  4IEJ A;  5EGO A;  1B8I A;  2VUM J;  2JMW A;  4A3F J;  4QSH A;  3ZQH A;  1APL C;  2R5Y B;  5GPC A;  4D5F A;  3HTA A;  3IUV A;  4D7N A;  3AQS A;  2DJN A;  5M3M J;  3VVZ A;  3AQT A;  4RBO A;  3TP3 A;  4ACI A;  3L1P A;  5EDN A;  3LSP A;  2L9R A;  4Y7N J;  4XIC A;  5EG0 B;  5D1R A;  2GEN A;  2LKX A;  1LE8 B;  9ANT A;  5CW8 A;  2EZK A;  2NVT J;  3S14 J;  3BCG A;  3S1N J;  2COB A;  2LD5 A;  3RZO J;  5GPA A;  1WH5 A;  2OER A;  2W48 A;  2X6O A;  4B1R A;  2VKV A;  3UKG A;  3HE0 A;  3VOK A;  3BG9 A;  1ZR4 A;  5D18 A;  1GUU A;  1U9N A;  3KZ9 A;  2R5Z A;  2YU9 J;  1A6I A;  4QIW N;  3SDG A;  3KKC A;  4C3J J;  3FIW A;  4YZE A;  3I4M J;  2QWT A;  2UXP A;  3VVY A;  4D5C A;  3ON4 A;  4MFD A;  3Q0W A;  5F08 A;  3LHQ A;  2XB5 A;  4MIM A;  2DTZ A;  1HLV A;  2N8G A;  2L7Z A;  3VW1 A;  2ELK A;  1JUS A;  4JX5 A;  3TW6 A;  4JL3 A;  3G56 A;  2K9Q A;  3JRC A;  4A3G J;  3PPB A;  4JX6 A;  3NXC A;  2JA8 J;  1FIA A;  3ZQF A;  3V6G A;  5F0H A;  3JSJ A;  1QRY A;  4B3A A;  1D5Y A;  1G2H A;  1IDZ A;  5E3N A;  1JUP A;  3IH4 A;  2O9L A;  3HB9 A;  1B8I B;  5EGO B;  1TWH J;  2DA5 A;  4UUS B;  2XGE A;  2X9D A;  2DMN A;  5GP9 A;  1ETQ A;  3E7L A;  2H1K A;  1MBF A;  1SFO J;  2GLO A;  1MH3 A;  4M3B A;  1EF4 A;  3FK7 A;  3S2H J;  1JKR C;  1ZGW A;  4JX4 A;  1UG2 A;  2AO9 A;  2M34 A;  1Q1V A;  2YVE A;  2NP3 A;  1BL0 A;  1F43 A;  2L7M P;  3HTH A;  2QTQ A;  4MFE A;  3LSJ A;  3HTJ A;  5DAJ A;  3RD3 A;  3K7A J;  5J3L A;  3TED A;  5IOY A;  1QVU A;  2GFN A;  2UXI A;  2OF7 A;  2LP0 A;  1X58 A;  5C3E J;  2DA1 A;  1PUF A;  2R5Z B;  4HNV A;  3A03 A;  2YS9 A;  1MSF C;  5F0C A;  1JKO C;  2LFB A;  1YRN A;  4NN1 A;  2FBQ A;  2GBY A;  2EZL A;  4A3L J;  3PAS A;  3NAR A;  1VI0 A;  3H3V K;  3ZQG A;  3JRH A;  4UUT A;  1MBK A;  3HDD A;  3FRQ A;  2FQ4 A;  3I4N J;  5F0F A;  2ZOY A;  4BY1 J;  2O8K A;  4BKX A;  2ZCM A;  2REK A;  2TCT A;  1W0T A;  1JT0 A;  2CQX A;  1WGX A;  1ZTR A;  2XB0 X;  4XRS A;  3M3Y J;  5HAW A;  1ETY A;  4NDL A;  2W53 A;  4DYR A;  5K7Z A;  3NNR A;  4W97 A;  1NK3 P;  2G3B A;  5EZH A;  2DMT A;  2DG7 A;  4V2G A;  3EGQ A;  3HTI A;  1ETX A;  2I10 A;  2PMZ N;  5FKN A;  3ZQI A;  3LSR A;  3COL A;  1ETK A;  5FGL A;  3BR1 A;  4XRM A;  3O8G A;  4DYC A;  5K58 A;  3ZQL A;  2CUE A;  2R7Z J;  3CMY A;  1VND A;  2HXI A;  2ME0 A;  2RAE A;  2XGC A;  2GM4 A;  4ME9 A;  3VP5 A;  2JWT A;  3KKD A;  2RAS A;  2MGQ A;  2NS8 A;  2TRT A;  2XRL A;  2CUF A;  5K7F A;  3RQI A;  5FJ8 J;  1IV6 A;  1POG A;  4A69 C;  4UDS A;  2HKU A;  1GT0 C;  1UMQ A;  2B63 J;  3VVX A;  1JKP C;  1ETV A;  1ETW A;  5CXG A;  5JLW A;  4XRS G;  3G1O A;  2WB1 N;  3JRI A;  2MSY A;  1JUM A;  1XS9 A;  1WPK A;  3GZI A;  2HXO A;  2G0E A;  3BR6 A;  2DA7 A;  5EF6 A;  1X2N A;  1IC8 A;  1FJL A;  1U8B A;  4JP0 A;  2KT0 A;  4I76 A;  5HOD A;  2HDD A;  1Y1V J;  3W6V A;  5IYD J;  1IUF A;  5F27 A;  3JRB A;  1JJ6 C;  3CQZ J;  4C2M J;  1OCP A;  4MK6 A;  2LY9 A;  4C3H J;  1W0U A;  4G12 A;  2ZCX A;  2YUS A;  3JR9 A;  1RPW A;  1VF9 A;  1H89 C;  3FIS A;  5J1U A;  2M0C A;  3HEF A;  3A01 A;  1AKH A;  3S17 J;  4FE7 A;  2WGB A;  1SGM A;  5FKK A;  5J1R A;  5M5X J;  4GCK A;  3MN2 A;  2K9S A;  2DG8 A;  2DN0 A;  3CCY A;  2ZOZ A;  3ANP A;  4C3I J;  1CQT A;  4DZJ A;  3DCF A;  3CDL A;  1TWF J;  5C4J J;  3ZQC A;  1AHD P;  3NAU A;  2DA6 A;  2WAQ N;  3O60 A;  4XK4 A;  1FEX A;  3B81 A;  3CRJ A;  3GTL J;  5D19 A;  2JA5 J;  5EEA A;  4XID A;  2PZ9 A;  2V57 A;  5EZG A;  4FTH A;  5EFY A;  1HCR A;  3OSF A;  1Z77 A;  2NX4 A;  2ECC A;  1AU7 A;  4NEL A;  1OJL A;  5IP7 J;  3BHQ A;  2R0Q C;  2NOG A;  3NRG A;  3O8H A;  5FKM A;  3HKZ N;  2LVS A;  3HGY A;  3DPJ A;  4AYB N;  3JRA A;  2E2J J;  1GDT A;  1OFC X;  1LFB A;  1T56 A;  2VKE A;  1ZK8 A;  3BJB A;  3BR2 A;  1NK2 P;  1WCM J;  5IOZ A;  5IP9 J;  5C4Y A;  3MKL A;  3PM1 A;  2AHQ A;  3BRU A;  2LK2 A;  3HOX J;  1OCT C;  2LLK A;  3VPR A;  2YVH A;  4DW6 A;  1Z0X A;  1R9T J;  3K2A A;  2XPW A;  5E3L A;  3KNW A;  2NS7 A;  3F1B A;  4GFL A;  2D5V A;  4D7M A;  1QVT A;  2NP5 A;  3FKI J;  4A3K J;  5DS9 A;  4IHX A;  5DTD A;  4DYQ A;  3EUP A;  2XPV A;  1K83 J;  1LFU P;  3BQY A;  3G7R A;  4A3M J;  1IG7 A;  1ENH A;  1B72 A;  5IYC J;  2EQR A;  3S16 J;  2G7G A;  3LOC A;  1GV5 A;  3P9T A;  4A3J J;  1BA5 A;  2WUI A;  2FD5 A;  3S1R J;  3BG3 A;  1JGG A;  3GTP J;  3VOX A;  3CWR A;  2R93 J;  5E3O A;  3RKQ A;  4W1U A;  4A3E J;  5M5Y J;  3ANG A;  5HBU A;  2CU7 A;  3WHC A;  5FLM J;  4MO7 A;  1RET A;  2E19 A;  3H0G J;  1TWC J;  1DU6 A;  2RHA A;  4ICH A;  3TP0 A;  2QKO A;  1TWG J;  3BG5 A;  4FIS A;  4S0H B;  3IH3 A;  4IHV A;  5EG0 A;  5M3F J;  4V2F A;  1HDP A;  3QKX A;  1LE8 A;  2FJ1 A;  1BJZ A;  3GBG A;  2DA3 A;  1P7J A;  2DA2 A;  5FKL A;  3B6A A;  4B4C A;  4CYC A;  1ORK A;  4BXX J;  3QQA A;  3Q3S A;  3SFI A;  1I6H J;  2JK3 A;  3TW7 A;  4GFB A;  2XPU A;  5FLV A;  1PUF B;  2Y9Z A;  2HOS A;  4A3B J;  4ABZ A;  3HOU J;  3JRG A;  1X2M A;  2VPR A;  2JA7 J;  1VFC A;  2JJ7 A;  2VI6 A;  3OOU A;  5F04 A;  1YRN B;  1IRZ A;  2G7L A;  3GEU A;  4DZP A;  4KWA A;  1FIP A;  3RH2 A;  4GCL A;  4EEF G;  4QTR A; 
#chains in the Genus database with same CATH topology
 2Y2Z A;  3ABL H;  1NG7 A;  4KIF A;  2VJ5 A;  2EH3 A;  2RV8 A;  1OYI A;  1J0R A;  4Q4Z F;  3MEX A;  3IP4 B;  3V7C A;  1AWC A;  3BJO A;  2F5F A;  2P5V A;  2UUZ A;  2YR2 A;  1SC7 A;  2PJP A;  3ELK A;  4HPQ A;  2DU9 A;  2KL4 A;  1I6X A;  3S15 J;  4MGR A;  1K6O A;  3S5R A;  1TWA J;  1SFU A;  3SDB A;  2ZB9 A;  4M9X A;  1T0F A;  1XDU A;  2F5D A;  5HLI A;  4I02 A;  2R7Q A;  1W7P D;  4IL6 C;  2LMD A;  3RTR A;  4D0P A;  4M6V A;  2CQ7 A;  2ZME C;  2L9V A;  2VON A;  4OD5 A;  2DYS H;  2MAB A;  1VQ5 I;  1U78 A;  4AC6 A;  1OKR A;  4IPA A;  3DPU A;  4EJT A;  1H8A C;  2HVQ A;  3IAM 2;  2OJE D;  2M30 A;  2QLZ A;  2IS4 A;  4CCN A;  5EYR A;  3RI4 A;  5CYV A;  4QPO A;  4BJ6 C;  3OYG A;  4XOR A;  4MTD A;  2OI8 A;  1SVL A;  1XMX A;  1S5L C;  4M71 A;  3J80 Z;  3DEW A;  2Q0O A;  2IP2 A;  3OY9 A;  2KQR A;  1HF0 A;  3K4K A;  5HVQ C;  1P9Q C;  1GV2 A;  4PUS A;  1LNW A;  2X1C A;  1O3S A;  2E2I J;  4OIR F;  3D0S A;  2BY2 A;  4RAY A;  4EVI A;  4CGZ A;  1I39 A;  2F2E A;  2MD5 A;  2D2W A;  1YJN I;  4Y33 A;  4IHW A;  2LKS A;  5IY5 H;  1D1C A;  3MAJ A;  2ETH A;  5FMP A;  4LJZ F;  2EFW A;  3S2D J;  1IGN A;  2A05 A;  4X1E A;  1RKT A;  1HC8 A;  3VIB A;  1QGP A;  2XAF A;  2PBX A;  4IO9 F;  5BNG A;  2ZFW A;  3CCL I;  4G6D A;  3ABM H;  2Q24 A;  2HI3 A;  3GTJ J;  1T33 A;  3HPH A;  3RPU A;  3WOD F;  1FZP B;  2DK5 A;  1I3Q J;  1QNT A;  3A02 A;  4M3G A;  2X85 A;  3K4L A;  1R71 A;  3CJD A;  2H8R A;  1WJE A;  2BW3 B;  3HTU A;  4BH9 A;  2EFQ A;  4HNT A;  4UV9 A;  4HYE A;  1F1Z A;  3A01 B;  2FML A;  3OMY A;  3CLQ A;  2R7R A;  2HOA A;  5FD6 A;  4UVA A;  3HSR A;  1H0M A;  3F8M A;  2LTP A;  5L3D A;  4NHJ A;  4ZTJ A;  4Q5S F;  4XLH A;  2QKM B;  3I4P A;  2A3S A;  4XOP A;  3N4M A;  4MHG A;  2PX9 A;  4RDU A;  3JRE A;  4MXM A;  1JKQ C;  1UAA A;  1UJ8 A;  4A2U A;  4HV5 A;  1XGO A;  3ECO A;  2F4M B;  3K4N A;  1TC3 C;  3OYA A;  2L02 A;  3K70 D;  4EGZ A;  2E36 A;  2MW8 A;  3MKY B;  4HDV A;  3BR5 A;  1FOK A;  3BTI A;  2E7W A;  1OMI A;  3K4C A;  1K61 A;  1A5J A;  4QPQ A;  1IJW C;  1UEL B;  3IV5 A;  5CXI A;  4KYW A;  3BOQ A;  2HYT A;  5LGN A;  1VQN I;  2V1X A;  4A3D J;  2V1D A;  3LST A;  3OWT A;  2Y31 A;  2WAD A;  5HDK A;  3KZI C;  3BG7 A;  2VJJ A;  3GLX A;  3PSI A;  1SFE A;  2Y69 H;  3QYF A;  2AXT C;  2EV0 A;  2LOO A;  5HSZ A;  3RDI A;  1QA6 A;  2FJI 1;  1FX7 A;  5L3F A;  5D5U B;  4IHY A;  2AXL A;  4O3M A;  1KGS A;  5E1W A;  1ZQ3 P;  1MMN A;  2KIQ A;  4MLO A;  2IW5 A;  1XC5 A;  3GME A;  4A3C J;  3MVP A;  3VUQ A;  1G3W A;  4AC0 A;  4XRF A;  3DKX A;  1LDK B;  4LB6 B;  1TP4 A;  1O7F A;  3BQZ A;  2XSD C;  4WWC A;  2ZJP F;  4L5E A;  1FOX A;  1HKT A;  2R3S A;  3RCO A;  4OOI A;  1D8J A;  2WV1 A;  5DM7 F;  1E3O C;  1WKM A;  4KDP A;  2M45 A;  5CVI A;  3S1M J;  3FXK A;  2VUM J;  3ASO H;  2HNH A;  4KIG A;  3CD6 I;  2EA2 A;  3ZQH A;  3ZMS A;  2M87 A;  2R5Y B;  4D5F A;  3HTA A;  3G3Z A;  1BOA A;  5M3M J;  2F6C A;  5EDN A;  1VTN C;  1HW2 A;  3LSP A;  4XIC A;  3PUB A;  5D1R A;  2BY0 A;  9ANT A;  2P0W A;  4A6D A;  5L3G A;  2LD5 A;  1WH5 A;  3IWZ A;  3QOE A;  4R79 A;  2X6O A;  3BJ6 A;  2VKV A;  3JTH A;  3RYP A;  1GUU A;  1QO0 D;  2R5Z A;  5ED4 A;  3PQK A;  3I5U A;  4HW0 A;  2EIK H;  2IA0 A;  2CGP A;  1JE8 A;  1LB2 A;  3W6K B;  3V7S A;  3ERM A;  2KJC A;  5L3E A;  2P5K A;  1TZL A;  2P7C B;  5F08 A;  3FXL A;  4MIM A;  2CV2 A;  5D5V B;  1WJA A;  4MQV A;  3QU6 A;  3DF8 A;  2PQ8 A;  5GAG J;  2LY2 A;  2HQN A;  2EPF A;  3TBI A;  4EJU A;  3DWL E;  2O5R A;  4JX6 A;  3NXC A;  5F0H A;  4BHC A;  2X1E A;  1QRY A;  4B3A A;  4BE2 A;  3CO6 C;  5FRN A;  2X4H A;  4OU0 A;  3TMO A;  4U7B A;  2O9L A;  1IDZ A;  2ISY A;  1B8I B;  4UUS B;  1FYK A;  1P92 A;  3J7A Y;  3DKW A;  4YFN F;  2H1K A;  3WE3 A;  1MH3 A;  1Z7L A;  2QQ9 A;  4IQJ A;  4ITV A;  2QSF X;  3FK7 A;  3CCV I;  3MKZ A;  2AO9 A;  2M34 A;  5D8K B;  1Q1V A;  4CSW A;  1BL0 A;  4MTE A;  3ZXS A;  3IRR A;  1FYM A;  2VKD A;  3EYI A;  2ZSI B;  1ONV A;  4IRI A;  3LSJ A;  2EIL H;  2XUB A;  4XSZ F;  5LHG A;  2RC4 A;  2H09 A;  1V5F A;  1IO2 A;  2CQK A;  2HKX A;  4F7Z A;  4S05 A;  3FWE A;  2UXI A;  3LL7 A;  2CMP A;  3M1E A;  3M07 A;  3REO A;  1J59 A;  1X1C A;  3A03 A;  1BC7 C;  3DTI A;  4BQA A;  3J81 K;  1IW7 F;  2LFB A;  1XGS A;  3PFY A;  2GBY A;  3Q9S A;  1R00 A;  1X3Z B;  1LFP A;  3W2A A;  2VN2 A;  1MBK A;  3V8L A;  3UR3 C;  3ZQQ A;  3HDD A;  1Z3Y A;  4C30 A;  4KT5 C;  2ZOY A;  1BIB A;  4BKX A;  3L2V A;  2ZCM A;  1S7A A;  3FM5 A;  3CF5 F;  3FM3 A;  1W0T A;  5IT9 Z;  3AAF A;  3NS4 A;  2XB0 X;  4XRS A;  4KJZ A;  2MYS A;  2W53 A;  2H6B A;  1MDM B;  4N9I A;  5K7Z A;  2K27 A;  2R7U A;  1YIT I;  3DEE A;  4W97 A;  1HXD A;  3V8K A;  3HSF A;  3R0A A;  1RZ4 A;  4WX9 A;  3HTI A;  2I10 A;  1W7P B;  2OQG A;  2QUF A;  3ZQI A;  4JK1 X;  4L9N A;  4WXC A;  3JAM Z;  3DLL F;  3HTS B;  5AON A;  4E7H A;  1OCC H;  1QHG A;  5K58 A;  3ZQL A;  2R7Z J;  4WCG A;  1IXC A;  3CMY A;  2HXI A;  3VP5 A;  4GO1 A;  2XGC A;  3RQ4 A;  3LMM A;  1A6Q A;  2B0L A;  2ESN A;  2XAU A;  4CXF A;  1G3T A;  4F92 B;  2VXZ A;  1GVJ A;  3KKD A;  2MGQ A;  1WHU A;  2TRT A;  2NOJ B;  3CZ6 A;  5LHI A;  3KLN A;  4PJ0 C;  3WTU C;  2VT3 A;  2ZJR F;  1YG2 A;  1IV6 A;  3K4J A;  4A69 C;  2XF6 A;  4UDS A;  2F5V A;  1ZGA A;  1GT0 C;  1T2K A;  2K5C A;  3IC7 A;  2DQL A;  4AWX B;  5HS8 A;  1OYY A;  5CXG A;  3MKW B;  4YEL A;  3G1O A;  4BXU A;  3JRI A;  2MSY A;  1JUM A;  5DYM A;  1WPK A;  2K9M A;  2HXO A;  2QZ8 A;  2DA7 A;  1RUO A;  4II2 A;  4PK4 A;  3EUA A;  1H9T A;  4CCM A;  3IL2 A;  4CCL A;  1K7A A;  2B3W A;  2XF7 A;  1JJ6 C;  2W24 A;  2OAZ A;  4BDY A;  2FOW A;  1OCP A;  1I1G A;  2ZCX A;  1Z05 A;  2BW3 A;  2HQA A;  1N25 A;  3WE2 A;  5H2F C;  2M0C A;  3A01 A;  2EK5 A;  1YHQ I;  1WI9 A;  5HLG A;  2PMZ A;  1XB4 A;  5KHD A;  3HRT A;  5FKK A;  1FYL A;  5M5X J;  5DD8 A;  3C2H A;  3F8B A;  5DV5 A;  2KRH A;  3LWF A;  1ZEL A;  3MZY A;  2DG8 A;  2ZOZ A;  2IPQ X;  1CQT A;  3ANP A;  2DDA A;  4DZJ A;  3CC4 I;  3OYD A;  1GXP A;  2BEO A;  1W36 D;  2WAQ N;  1QZZ A;  3O60 A;  2KIS A;  3GEZ A;  2R7O A;  3B81 A;  2KJB A;  3VFZ A;  3VDX A;  1BOB A;  3CRJ A;  1DQU A;  4U9N A;  2XV4 S;  1WSU A;  2JA5 J;  3TO6 A;  1LQ1 A;  3OSF A;  1Z77 A;  1PP8 F;  2O3F A;  2NX4 A;  1AU7 A;  4UUV A;  3E5U A;  2RNJ A;  4XLN F;  1LEB A;  4KIC A;  4Y15 A;  2LYC A;  2Z16 A;  4CHU A;  3S8P A;  3BHQ A;  5DUK A;  2F48 A;  2M8E A;  2IT0 A;  1OFC X;  1T56 A;  2BGC A;  3BJB A;  5FRO A;  2K7L A;  1FMW A;  2DI3 A;  1TTY A;  2IVM A;  2L3D A;  2AHQ A;  3DQV C;  2H8W A;  1OCT C;  3VPR A;  3ML6 A;  1QZE A;  3SEQ A;  3FZV A;  2DT7 B;  4GYG A;  5J8C A;  4D7M A;  4BXF A;  4DQ2 A;  1ZG5 A;  4LD5 A;  1D0Y A;  2QYO A;  3OS1 A;  2ZXI A;  2HGC A;  1LFU P;  2DAO A;  3ASN H;  4A3M J;  1WVR A;  3I53 A;  3C2G A;  1K78 B;  1B72 A;  5EEH A;  3L2W A;  1XSX A;  1GV5 A;  3GO5 A;  5FFX A;  4L9T A;  3MMY B;  1B4A A;  1VZ0 A;  4ENM A;  3S1R J;  3BG3 A;  2EA4 A;  2DW4 A;  3GTP J;  2VQH A;  3VOX A;  1MW7 A;  1ZHF A;  3RKQ A;  4A3E J;  5DCF A;  4I0A A;  3T0Y A;  1B9N A;  2KZV A;  2L4A A;  1D1A A;  1O3R A;  5BPD A;  1N78 A;  2CH0 A;  2P6S A;  2QGU A;  1YQA A;  1K4S A;  3F72 A;  4J00 A;  2XIG A;  4ICH A;  3TOA A;  1SVM A;  2QKO A;  3BZC A;  1KYZ A;  4UXN A;  4WIB A;  1HDP A;  1BJZ A;  4ZYE A;  2KDO A;  3B6A A;  4BU2 A;  1E3H A;  4B4C A;  3EPZ A;  4CYC A;  2XRN A;  3QQA A;  4AYB A;  5LEJ A;  3U1D A;  5HLH A;  4U9L A;  4AM3 A;  3H35 A;  3HOU J;  1X2M A;  2VPR A;  3B02 A;  3HJE A;  4Y3O A;  2MH2 A;  4HAM A;  5F04 A;  1O3Q A;  1K79 A;  3LA7 A;  2RQP A;  4JOM A;  1S8N A;  3EET A;  4GCL A;  2OZ6 A;  2VC0 A;  3I71 A;  4FHT A;  4LG3 A;  2EV5 A;  2GXG A;  1BW5 A;  3E6C C;  3C2B A;  2BVL A;  1RES A;  3OIQ A;  3QPS A;  2IBD A;  1YX3 A;  2BXZ A;  2Z5U A;  3A0H C;  2VOD A;  4RGR A;  1IAW A;  2RVC A;  1VQO I;  4P9U A;  1G3S A;  1IN6 A;  2EV6 A;  3RZD J;  3A0B C;  4UUS A;  1YYV A;  3DBH B;  3ZMT A;  2BYV E;  4B3X A;  3H3U A;  1XG1 A;  3A4C A;  3FMS A;  2HU9 A;  4OIQ F;  2X6Y A;  1IDY A;  5K5O A;  4RB3 C;  2Y0S N;  4DGW B;  1V4R A;  2O03 A;  1R1V A;  4HF0 A;  2JA6 J;  3HOV J;  2XHK A;  5J4Y A;  2HYG D;  1Z67 A;  1EV7 A;  2EFO A;  1Y0U A;  2FBI A;  3LNQ A;  1OR7 C;  4BDZ A;  4L9J A;  2O7O A;  1IRF A;  3MD2 A;  4HZF A;  5F1J A;  3VW2 A;  3CC7 I;  2X6X A;  3BTJ A;  2DOA A;  2QM3 A;  4DBR A;  3FXR A;  1ACI A;  4Y17 A;  4RB2 C;  1W1W E;  3ZOB A;  1MBE A;  1Y6I A;  1ZR2 A;  1PUE E;  5KNL A;  3E7Q A;  5L3B A;  2JRT A;  5TIS C;  1VQL I;  1ZKG A;  4RLF A;  3WHB A;  5DDG A;  4UHT A;  5JHU A;  4CYD A;  3O2P E;  1FC3 A;  2O7T A;  4L62 A;  2LR8 A;  1R1U A;  4BAC A;  2XDN A;  1QZY A;  2GIZ A;  2ESH A;  4JYK A;  2QKL B;  4UY8 I;  1Y1W J;  1OCZ H;  3E1S A;  2PLY A;  1FBU A;  3J81 Z;  2EZH A;  2M4G A;  3ZP5 A;  2WY8 Q;  2JVG A;  2NVY J;  3VB2 A;  4I98 B;  1MBH A;  2X48 A;  4RM2 A;  1G59 A;  4BY7 J;  4A0Y A;  1W7P A;  5C44 J;  2VJI A;  4FX4 A;  4MNU A;  3E0J B;  4C2U A;  4KNY A;  1ZN2 A;  3OSG A;  1I50 J;  1L0O C;  1AKH B;  1OQY A;  3G4S I;  4HX7 A;  2A07 F;  1Y56 A;  1X1P A;  2QCO A;  4IF4 A;  4RLQ A;  1LEA A;  1VQ6 I;  1DPU A;  3LSG A;  5ICF A;  1JTX A;  4J19 A;  2LSO A;  1Z6T A;  1FSE A;  3WGI A;  3KYL A;  3S3N A;  5E17 F;  5HLT A;  2OTJ I;  2V4J C;  2ZJ2 A;  3EUH A;  5CQG A;  5JI6 A;  4O5V A;  1F5T A;  2L01 A;  1EA3 A;  1SMT A;  1U2W A;  3F8C A;  2DBB A;  2K86 A;  2XAQ A;  5LGT A;  1AOY A;  3K8P C;  4AF5 A;  3I9V 2;  1DU0 A;  3R60 A;  2CQQ A;  2OC6 A;  4AID A;  3ON2 A;  4NB5 A;  1BR4 A;  4S04 A;  5E79 C;  3LSI A;  4AVP A;  1R5H A;  2ZXJ A;  1ITY A;  1MBJ A;  3QYB A;  3D1N I;  2ELH A;  3DU6 A;  3S32 A;  3KET A;  4UNO A;  2FA5 A;  1FOY A;  2ME6 A;  2GIV A;  2VBZ A;  2P6T A;  2MG4 A;  3G71 I;  3MNL A;  1WWX A;  5TGT A;  4EM0 B;  3I56 I;  3GTG J;  2OUM A;  2DQR A;  5F1R A;  4Y52 J;  4U0V A;  1A36 A;  3HM5 A;  4CGR A;  1SAN A;  3M4O J;  4YII A;  4JQF A;  4E4H A;  3X2Q H;  1JT6 A;  2E1O A;  4XKB A;  2KDZ A;  5F64 A;  5GTI C;  3GYH X;  1HA8 A;  3LWJ A;  1HW5 A;  3FKJ A;  3J7Y J;  2UXU A;  4UVC A;  3I59 B;  3HHH A;  1FTZ A;  4OMZ A;  1BW6 A;  3ECH A;  4M3E A;  3OYN A;  1F4K A;  4HOB A;  4PGH A;  4AIH A;  1E3P A;  1FPQ A;  2M4K A;  3JRD A;  2R92 J;  1PDN C;  4IEJ A;  5EGO A;  2JMW A;  4A12 A;  4A3F J;  4G7O F;  3H5N A;  1APL C;  3OOP A;  5CKT A;  4YRV A;  3GWZ A;  2BHZ A;  2GXB A;  1RNL A;  1YS6 A;  1D1B A;  2DJN A;  3VOE A;  3AQT A;  3LSK A;  3TP3 A;  4ACI A;  1V5G A;  3L1P A;  3F23 A;  3H1C A;  4B8X A;  1LE8 B;  4IRG A;  2O61 A;  3WU1 B;  4IKF A;  1V54 H;  1ZLJ A;  3S14 J;  2OCC H;  3BZK A;  3L9F A;  2COB A;  3BCA A;  1U5T B;  4RAF A;  2A6E F;  5LGU A;  2VT2 A;  1J75 A;  3RZO J;  3WTX C;  3HE0 A;  2JVH A;  2VL8 A;  3OIP A;  5D18 A;  1IXR C;  1ON2 A;  1P4X A;  1U9N A;  3KKC A;  2FNP A;  2V9K A;  1Q1H A;  3FIW A;  3I4M J;  5J8F A;  1W5T A;  2EWN A;  4ZYA A;  2FBH A;  1YO5 C;  1VQ8 I;  1DPR A;  3ON4 A;  3GZ5 A;  3Q0W A;  3LHQ A;  2XB5 A;  1HKQ A;  3H5R A;  4XBF A;  1HLV A;  2VOP A;  2L7Z A;  5GAE J;  5GTH C;  4JL3 A;  3G56 A;  4A3G J;  1K78 A;  2LNB A;  1X1B A;  3SWH A;  2WV0 A;  2FXA A;  3OR1 C;  4LIU A;  3TKY A;  4PJM A;  3L2U A;  3QRF F;  3IH4 A;  4XKW A;  3AL0 C;  4XLP F;  4HF1 A;  1SD6 A;  2DA5 A;  2F4O B;  1BBY A;  2JT1 A;  3T1B A;  4N9H A;  3D5L A;  4YEJ A;  1SAU A;  2DYR H;  2DFH A;  4L9V A;  2HKO A;  1UG2 A;  3MQ0 A;  5BQT A;  3J7Z I;  1KQ0 A;  2YVE A;  3CUQ A;  2QTQ A;  4CCJ A;  3PNT A;  3ZR8 X;  3CDH A;  3CJN A;  5HDN A;  2RKH A;  1QVU A;  3KPH A;  3QWL A;  4ENN A;  3GFJ A;  4GYI A;  2LG4 A;  2STW A;  2WC2 A;  1E2X A;  2NS0 A;  2OF7 A;  2VQC A;  4HLX A;  3V4G A;  3DPL C;  3SQN A;  4HNV A;  2JPB A;  3CMM A;  2YS9 A;  3HHG A;  3VWB A;  2LRE A;  3K2Z A;  5J4V A;  3WTS C;  3JRH A;  3KP2 A;  2RRE A;  3OYF A;  2BZT A;  2WBM A;  4RAG A;  5E20 A;  1FOW A;  3W2W A;  5BMZ A;  1NHA A;  3QU3 A;  4BY1 J;  4IHT A;  4Y4R A;  3FX3 A;  2COM A;  2ZME B;  2PFV A;  3O6B B;  2CQX A;  1WGX A;  1ZTR A;  2CUJ A;  2P5L C;  5HAW A;  1VQP I;  4HF2 A;  4DYR A;  3HXL A;  4ASN A;  2WA0 A;  1NK3 P;  1W5C C;  3C1D A;  3HUG B;  1O7L A;  3FXJ A;  1ETX A;  3CJT B;  3LSR A;  1YIJ I;  1V55 H;  2DJI A;  3KP6 A;  4ZDP A;  2DOF A;  4MQ9 F;  3SYT A;  5K5Q A;  3CO7 C;  3B73 A;  2D45 A;  1MJA A;  3BR1 A;  4DYC A;  4PGG A;  4ZZL A;  2DPD A;  2L5Q A;  2QSG X;  2ME0 A;  2RAE A;  1OPC A;  1JXS A;  1I3A A;  2Q2E B;  1TQI A;  3IHU A;  4ESF A;  1PYV A;  2VIX A;  5E1Z B;  4ZC3 A;  1MD0 A;  1X19 A;  4GXO A;  1V5E A;  2CUF A;  2PMH A;  3RQI A;  1TLH B;  3DP7 A;  1Y39 A;  2OD5 A;  4OD4 A;  2JSP A;  3J7A O;  5ILV A;  1BM9 A;  2HKU A;  2AS5 F;  5AIQ A;  2ZO4 A;  1UMQ A;  5E8G A;  1PJR A;  2IA2 A;  2B63 J;  3VVX A;  1STZ A;  2O6G E;  1JKP C;  3U2R A;  4BUP A;  5JLW A;  3R61 A;  2L4M A;  1HW1 A;  2PBI A;  4HEA 2;  3SEZ A;  2Y75 A;  4NC6 A;  2HYF A;  5CVJ A;  3OYE A;  3HG9 A;  1U8B A;  2VLA A;  2M0M A;  4JP0 A;  5IYD J;  4XN0 A;  3GF2 A;  2FEZ A;  3RIR A;  4E7J A;  2A6H F;  4E7L A;  1ZH5 A;  3M7G A;  2E34 A;  3FF5 A;  4LLG F;  3UNG C;  4C2M J;  5HDG A;  3C7J A;  3E6B A;  3HRM A;  4ANJ A;  3DEU A;  4MEY F;  3NWT A;  5CJ9 A;  1AKH A;  3S17 J;  1T95 A;  4FE7 A;  5H6R A;  2K9S A;  4CUG A;  4L18 B;  2EB7 A;  4BE1 A;  1TWF J;  4KMF A;  3ZQC A;  3F22 A;  1PP7 U;  3NAU A;  2R7T A;  1BIA A;  3I55 I;  1YJ9 I;  1FEX A;  1Z91 A;  2DTR A;  4U88 A;  2NXN B;  5AIP A;  2R7D A;  5D19 A;  4XID A;  4UV8 A;  2L2O A;  2ECC A;  3T8T A;  4HG2 A;  2A69 F;  3DU5 A;  1KYW A;  3FDY A;  4LIT A;  1UB9 A;  3NRG A;  3HKZ N;  2E35 A;  2ZXW H;  2GA1 A;  1CF7 B;  1GDT A;  2RQQ A;  4BL0 B;  5CVV A;  2NNY A;  4EJV A;  4D1Q A;  2VKE A;  3RYR A;  1U8R A;  2XSJ C;  3BR2 A;  3IUO A;  2QBY B;  4DIQ A;  2VBW A;  2WB1 A;  3MKL A;  3ZRG A;  3A1Y A;  3FMQ A;  4DBQ A;  1B6A A;  2F4I A;  3IKV A;  2LK2 A;  3BY6 A;  3ERE D;  2LLK A;  1Z0X A;  5CQE A;  2CV0 A;  3COA C;  2NS7 A;  3F1B A;  4LLN A;  4GFL A;  2P4W A;  1Z21 A;  2VBX A;  2WAF A;  2NP5 A;  2JRM A;  1HQC A;  3N05 A;  4DYQ A;  4FAS D;  4X0G A;  4HA8 A;  3EUP A;  1K83 J;  3AG2 H;  3I59 A;  5E18 F;  4H0E A;  3SZT A;  2EQR A;  1T8I A;  1YTY A;  5B1B H;  4A3J J;  1QU3 A;  1BA5 A;  2CFO A;  3GFM A;  1E0E A;  2UV1 A;  3HYI A;  3F8N A;  4IHS A;  3CWR A;  2EFP A;  2R93 J;  3RKY A;  3MZ8 A;  1MNE A;  5EJC A;  4LFU A;  5HBU A;  1P2F A;  1LDD A;  2CU7 A;  3WHC A;  3KIO A;  4MO7 A;  3CES A;  3H0G J;  1TWC J;  2RHA A;  3AG1 H;  4KT6 A;  3BG5 A;  4FIS A;  3IKT A;  4PJL A;  4V2F A;  1LE8 A;  1RR8 C;  2FJ1 A;  1BI2 A;  2X0L A;  3L7W A;  4GRI A;  3EUK L;  4LGW A;  1P7J A;  1SFK A;  1U5T A;  3DTK A;  1FBS A;  1FNN A;  1ORK A;  3JSP A;  3ISP A;  2VBY A;  1EH7 A;  1I6H J;  3CTA A;  2JK3 A;  1BI3 A;  1T0F C;  3LQR A;  4GFB A;  1E17 A;  2H1L A;  4P1W A;  3VEP A;  3F9K A;  5FLV A;  1PUF B;  1S6L A;  1RUN A;  2HEO A;  1VQ7 I;  2HOS A;  4ABZ A;  3KEY A;  3JRG A;  2JA7 J;  3GEU A;  3OOU A;  3HL2 A;  1YRN B;  1IRZ A;  4OIO F;  2CS3 A;  2P7V B;  5GAD J;  4BS9 A;  4XKV A;  1EH6 A;  3H3Z A;  4EEF G;  4QTR A;  1YE9 A;  4IRV A;  1OCO H;  5HS9 A;  2XKP A;  1R23 A;  4DOZ A;  5E8I A;  1QPM A;  1IN7 A;  1A35 A;  2EBI A;  2HTS A;  3NPI A;  3FXQ A;  4BBR J;  4GGG A;  4AUX A;  2UXX A;  4KA4 A;  5KCM A;  2QEX I;  1YW8 A;  4PXI A;  2UXO A;  2XRO A;  4X6A J;  5IP6 A;  4FE4 A;  5ICC A;  5D8L B;  1R58 A;  1MSE C;  4M3F A;  1S7E A;  4HKU A;  1Y8Q B;  3PL8 A;  4ZDL A;  3NI7 A;  4E7Z A;  3DTE A;  4R8H A;  2MFZ A;  1SD5 A;  1DP3 A;  3H9G A;  5JHF A;  1FBQ A;  3KCC A;  4NC8 A;  1H88 C;  4EQQ A;  2CYY A;  5D4R A;  2D1H A;  3BP8 A;  4JNN A;  4P55 A;  4J01 A;  4FQG A;  4A6E A;  1F36 A;  2L9S A;  3LSM A;  1R4M B;  2W25 A;  1WZ2 A;  3BPV A;  3L2R A;  2RN7 A;  3GTQ J;  2D6Y A;  2F07 A;  4FET A;  4IOA F;  2PMU A;  1XX5 A;  3K1M A;  2HYJ A;  2LF7 A;  3Q0V A;  4ENJ A;  2ICW G;  2IGM A;  3BR0 A;  2JUG A;  1WH7 A;  4C2M A;  3ZPL A;  3C3W A;  1FWZ A;  2A61 A;  3OR2 C;  4BBS J;  5FD5 A;  1U9O A;  3FMR A;  2M5W A;  4N4O B;  4LOC A;  2QWW A;  3IH2 A;  2ZME A;  2IEK A;  5ICE A;  2CW0 F;  4U87 A;  5JVT A;  2XAH A;  3CME I;  3IRQ A;  2V6E A;  2G7S A;  4A93 J;  1JTY A;  2K9N A;  5KVR A;  3HUG A;  1TW3 A;  4IOC F;  3P9I A;  3J80 K;  5TJJ A;  2QQB A;  5FFZ A;  5HNH A;  2HR3 A;  2DT5 A;  1MJB A;  1R5I D;  5DUI A;  3MWM A;  2NVQ J;  2E2H J;  3F21 A;  2HPI A;  1UHS A;  5IPA A;  3T6N A;  2DA4 A;  3U21 A;  2D1V A;  1D5V A;  3TO7 A;  1B59 A;  3VTI A;  2Q2E A;  2V6C A;  2H6C A;  2BHY A;  1R5G A;  4G7H F;  2LBF B;  1H9G A;  5M5W J;  2GUH A;  5H9T A;  3GTK J;  2L0K A;  3FHN A;  5E3M A;  2R5Y A;  4G9Y A;  2XC7 A;  3CF2 A;  3ZMV A;  3MCZ A;  4FCY A;  2Z3Y A;  3CJR B;  1WRJ A;  1OIS A;  2DMU A;  4PCQ A;  1JI8 A;  3AG3 H;  2L9N A;  3TDU C;  1EH8 A;  1HOM A;  3GUD A;  2CFX A;  1Z7U A;  2XGD A;  4IQ4 A;  4A0Z A;  1KON A;  1R6R A;  2EZI A;  2JSC A;  3SZG A;  1ZRD A;  4BQQ A;  3HOT A;  2Y48 A;  3Q5F A;  3GVA A;  5LEK A;  1IRG A;  3BTL A;  3HBL A;  4A3I J;  2FUG 2;  1HDD C;  3ABU A;  1OLT A;  1YIO A;  3OL4 A;  1JJ8 C;  1R22 A;  1ZAO A;  1WJB A;  2HQR A;  4LB5 A;  2FNA A;  5AQC A;  4L5I A;  1KU7 A;  1WI3 A;  4YFX F;  4V19 K;  3PO3 J;  2W57 A;  4BGD A;  2DK8 A;  2JN6 A;  3WG7 H;  3C07 A;  1RR7 A;  1RKW A;  3GTM J;  4I01 A;  3LFK A;  4PSX A;  2CUZ A;  2NYX A;  4F55 A;  3G1L A;  4G6T B;  1MGT A;  4EV0 A;  3QBM A;  3TGN A;  4GCT A;  3LJL A;  3KLO A;  1T39 A;  2KZG A;  2L7F P;  2O8X A;  4M6Y A;  4M72 A;  4GFK A;  4IXA A;  1BJA A;  3I3L A;  1NTC A;  4U7D A;  2PEX A;  4P96 A;  1D8K A;  1KU9 A;  3DLA A;  5CPR B;  2HQ5 A;  2K3P A;  1B8I A;  2MA3 A;  2HZD A;  1XTA A;  5BS6 A;  4RGS A;  2Q1Z B;  4ZTF A;  2DXI A;  5GPC A;  2J5P A;  2Z33 A;  1QHH D;  3NQO A;  4XKC A;  3CJQ B;  1KU3 A;  2KMU A;  3F6V A;  3VVZ A;  3OYC A;  1QQI A;  3G73 A;  4ZDO A;  4I7H A;  3W2V A;  3OV8 A;  1L3L A;  3BJA A;  4B47 A;  2LKX A;  4PDK A;  1VQ9 I;  2EZK A;  4ESJ A;  2W1O A;  4A5M A;  3ZN1 A;  2NVT J;  4RGX A;  3JTG A;  3BCG A;  3S1N J;  5LRR A;  4NQW B;  3F8F A;  2QBY A;  2OER A;  6PAX A;  1XMK A;  3UKG A;  2JZY A;  3BG9 A;  3KEO A;  4C2T A;  3KEQ A;  3KZ9 A;  2YU9 J;  4QIW N;  3SDG A;  2MD0 A;  1A31 A;  1DGR M;  3ROU A;  1XN7 A;  4YZE A;  2MLK A;  1XMA A;  3VVY A;  2K85 A;  4D5C A;  4HNU A;  3OYM A;  5KK1 A;  1ZRE A;  3OYK A;  4MFD A;  4IVN A;  4DNC A;  5KAI C;  3OYB A;  4I2O A;  2LRD A;  2DFE A;  1OYW A;  4L5J A;  3FBN B;  1S3J A;  2N8G A;  1T6S A;  5JVG F;  2ELK A;  3TW6 A;  2BY1 A;  1RRJ A;  2DLL A;  3JRC A;  2Z99 A;  2ZXH A;  1R36 A;  4XM3 A;  3WU2 C;  2JA8 J;  1FIA A;  2V9V A;  3ZQF A;  5ERI A;  1U3E M;  4E70 A;  1D5Y A;  1JUP A;  2R7W A;  3HB9 A;  4KUM A;  1TWH J;  2AQE A;  3K9T A;  3BZ6 A;  1MDM A;  2X9D A;  4XLF A;  1ETQ A;  1G3Y A;  3ZMZ A;  2HVS A;  1MBF A;  4RB0 A;  1SFO J;  3KZY A;  1ZRC A;  2GLO A;  4HDU A;  4K2E A;  1K6Y A;  1JKR C;  5FRM A;  1ZGW A;  5H20 A;  3NWS A;  3KZZ A;  4FT8 A;  3CCS I;  2NP3 A;  3BC8 A;  2AQF A;  3HTH A;  2IA1 A;  4MFE A;  1VQ4 I;  3RD3 A;  3KYC B;  2V79 A;  3K7A J;  2UXN A;  2VAS A;  4BQN A;  2XAJ A;  5IOY A;  4AD9 A;  2OQR A;  2GFN A;  1LKX A;  3CCQ I;  3OYJ A;  2CO5 A;  2DA1 A;  1SMY F;  2R5Z B;  4EM2 A;  1PUF A;  2RGV A;  3HRS A;  4PFO A;  4E6K G;  4OMY A;  2IGO A;  4M74 A;  5F0C A;  1JKO C;  1YRN A;  3GLL A;  3RSN A;  3JCU C;  3CCE I;  2EZL A;  3PAS A;  4DJA A;  1VI0 A;  3CLO A;  2JA2 A;  2VE8 A;  2CW7 A;  2FF4 A;  4UUT A;  3K1P A;  2UWM A;  3CCJ I;  2LH9 A;  2OA4 A;  5HOO A;  2NAZ A;  2RDP A;  5F0F A;  1ZLK A;  2VQL A;  2OCE A;  3ZGK A;  2O8K A;  2CV1 A;  2REK A;  2M1B A;  3KX2 A;  5L3C A;  2YX4 A;  3KP4 A;  2FSW A;  5K1Y A;  2OZU A;  2BVM A;  1DP7 P;  2FOK A;  1ETY A;  1X3U A;  3ABT A;  3E5X A;  1Y0N A;  1ZRF A;  3CP2 A;  3GXO A;  1ZG3 A;  1YX5 A;  4BHP A;  3E6M A;  5DD4 A;  4CA0 A;  2LC2 A;  2QEN A;  1T08 B;  1WFX A;  3GFL A;  5EZH A;  4ON0 A;  3WTW C;  2G7H A;  1SAX A;  2B1E A;  3LAP A;  2Q8K A;  3EGQ A;  2PMZ N;  4WXD A;  1YJW I;  3KP5 A;  4XRM A;  1LDJ A;  4XR6 A;  3BPX A;  3H0D A;  2BV6 A;  3JW4 A;  2VXD A;  2A6T A;  3I64 A;  1VND A;  2KIU A;  4ME9 A;  1YW7 A;  5CVU A;  3P7N A;  4B09 A;  1XGM A;  5IT9 K;  2QSH X;  1D0X A;  3CCM I;  2NS8 A;  2RNG A;  4E7I A;  2ZY9 A;  3W6J B;  2BBY A;  1I5Z A;  2K02 A;  5IT3 A;  3WU0 A;  4CZZ A;  5K7F A;  5FJ8 J;  1POG A;  1S9H A;  2XAG A;  3WTZ A;  3V7R A;  4N4N B;  2IS6 A;  2MBF A;  3JAM K;  4U0Y A;  1ETW A;  4OWR B;  2EIJ H;  3K0L A;  4XMY A;  4KMU X;  3GZI A;  1XS9 A;  2WTE A;  1FJL A;  2G0E A;  3BR6 A;  3QPT A;  3VYS B;  1X2N A;  1XDS A;  1REP C;  1XSV A;  5HOD A;  2HDD A;  2GOX B;  1Y1V J;  1HBX G;  4BEH B;  1IUF A;  3QOD A;  5F27 A;  3QYE A;  3VYR B;  3WTV C;  1XSD A;  2LDU A;  1WJF A;  3VOD A;  4DVY P;  2WY7 Q;  1FSH A;  2E71 A;  2IS1 A;  3SXY A;  4MK6 A;  2LY9 A;  4C3H J;  4G12 A;  4YFK F;  2ELJ A;  2LKP A;  1IN5 A;  2YUS A;  3LFU A;  2WAE A;  1VF9 A;  1H89 C;  2DOE A;  3FIS A;  2YVX A;  1NG6 A;  4BQO A;  1F9N A;  2WGB A;  3WG9 A;  4GCK A;  5A2Q K;  3MN2 A;  2GAU A;  2E7X A;  4C3I J;  3DCF A;  5C4J J;  1AHD P;  2ZNY A;  2X6W A;  1JHH A;  2DA6 A;  2JTV A;  1A04 A;  2LBF A;  3GCM A;  4G7Z F;  1LVA A;  2OBP A;  1B9M A;  4ENK A;  1Z3X A;  1KQ9 A;  5EEA A;  2V57 A;  5EFY A;  5EZG A;  4FTH A;  5D4S A;  1HCR A;  3PFI A;  5H6Q A;  3ZN0 A;  5DCM B;  4B48 A;  2QVO A;  4CO8 A;  2ZFU A;  3O3K A;  4LK1 F;  1YI2 I;  2R7X A;  3DPT A;  2JUC A;  1SVO A;  2NOG A;  1LUJ B;  4AYB N;  3OS0 A;  3PUF A;  3JRA A;  3QP5 A;  4KN4 X;  1CGP A;  2BY3 A;  4B43 A;  3CUO A;  1SD4 A;  4EJO A;  4WK8 F;  4FX0 A;  5IOZ A;  2EFN A;  5C4Y A;  1Z1D A;  3PM1 A;  2MC4 A;  3ZCO A;  1X4O A;  2V7F A;  3RKX A;  1C0W A;  2F5C A;  1SEU A;  1VQK I;  3HRU A;  1BN5 A;  5B66 C;  3K2A A;  2DO7 A;  2XPW A;  3NRV A;  5E3L A;  1R9T J;  4U0W A;  3KNW A;  4PFP A;  3R0J A;  2D5V A;  1X1A A;  5FO5 A;  1QVT A;  1XPX A;  4M6X A;  3FKI J;  4E7S A;  2KHM A;  1PVE A;  2IGK A;  1HST A;  2W4S A;  5ILU A;  4ZYG A;  3D5R C;  3BQY A;  1BR2 A;  5DM6 F;  4CCK A;  1ENH A;  5HS7 A;  3LSH A;  1EKE A;  3OL3 A;  2L7K A;  2G7G A;  3LOC A;  2ZJQ F;  3P9T A;  2WWY A;  1R4N B;  4HSR A;  1FP2 A;  2FD5 A;  2V26 A;  1JGG A;  1MIJ A;  2CQN A;  1O57 A;  3QPH A;  5E3O A;  1MMD A;  4W1U A;  1R49 A;  2WAQ A;  5FLM J;  2XAS A;  1MMA A;  4WF2 A;  4HX4 A;  3JSO A;  1FMV A;  1TWG J;  1TL8 A;  2STT A;  3IH3 A;  4IHV A;  1XCV A;  3GBG A;  1XGN A;  3PIP F;  1W5S A;  1SD7 A;  4NQW A;  2MH9 A;  4BXX J;  1G4D A;  3Q3S A;  1T38 A;  4LG0 B;  1JHF A;  2XPU A;  3VYT B;  1S29 A;  4AU7 A;  3WTY C;  2MLG A;  2VI6 A;  2G7L A;  4BNC A;  2VOO A;  3AL0 B;  4DZP A;  2ZKZ A;  1FIP A;  4NUB A;  4OAY A;  4KWA A;  3RH2 A;  1ODD A;  2GA2 A;  3AKZ A;  4G94 A;  3Q0U A;  4IZZ A;  2CRG A;  3TQN A;  1UI5 A;  2E1N A;  2IGN A;  4E7K A;  2ZCN A;  2JPC A;  1TBX A;  2Y30 A;  1B72 B;  1FY7 A;  4Y13 A;  4XQF A;  3B6C A;  3HZJ A;  5JR3 A;  4C9Y A;  2OPT A;  4HLY A;  4JKZ A;  1R7J A;  4MEX F;  2VKH A;  3E3V A;  3QPL A;  1TT5 B;  5DEQ A;  2W84 A;  4XLE A;  3OIO A;  4RB1 A;  4ZJZ A;  3S3M A;  2R7V A;  3KE2 A;  4XLA A;  3DXJ F;  3JRF A;  3EQL F;  3RPU D;  3V78 A;  2DFI A;  2PJR B;  3K69 A;  1P7I A;  1MNM C;  1IRX A;  3DKY A;  1BI0 A;  3GTO J;  2JQ7 A;  3VW0 A;  3HIM A;  3BG6 A;  1FP1 D;  2DMQ A;  3AG4 H;  5B1A H;  5LLQ A;  4P9F A;  2VB6 A;  1YFH A;  3TOB A;  4F3Q A;  3FBI B;  1GLN A;  4CYC B;  1OCR H;  3PIO F;  2IAI A;  3SJM A;  2FMY A;  3F0C A;  4PZJ A;  2ZCW A;  3W3C A;  2HVR A;  3PO2 J;  1YW9 A;  2DMP A;  1MH4 A;  5J1Y A;  1J09 A;  2FX0 A;  1X4P A;  2M8G X;  5FGM A;  1GVD A;  1TQP A;  1XCB A;  2W7N A;  2KRC A;  2UXH A;  3WGG A;  2QA4 I;  1MKM A;  2HWV A;  3HOW J;  2HOT A;  2XKO A;  2EJR A;  2M9H A;  3H9J A;  2W82 A;  4B44 A;  2IRF G;  2P81 A;  3HOY J;  2E60 A;  3CC2 I;  1MMG A;  3BT9 A;  3S1Q J;  3EUH C;  3RPQ A;  1OR7 A;  3QAH A;  1KZH A;  3E5Q A;  2HTJ A;  2E5N A;  5IYB J;  2QF7 A;  3BWG A;  2ID6 A;  4Z2Y A;  3CDI A;  4NNJ A;  1TW2 A;  1I27 A;  3IAS 2;  3M8E A;  3BNI A;  1MBG A;  4LIV A;  4CH7 A;  1UI6 A;  4I6Z A;  4HRI A;  1ZAR A;  2ECB A;  1V3F A;  1UCR A;  3QOP A;  5ILS A;  1S72 I;  2HPM A;  2A68 F;  2G9W A;  3A2K A;  5F6F A;  3T8R A;  1IN4 A;  3BRO A;  2NVX J;  2Y0S A;  5GAH J;  4ZZD A;  3RKW A;  2W85 A;  5LD2 C;  1GHC A;  1WJC A;  2B7E A;  3PSF A;  3HSE A;  3L09 A;  3L2C A;  5JLX A;  1P4A A;  3M9A A;  3HOZ J;  2EIN H;  1B1B A;  1FTT A;  2G7U A;  4F91 B;  2Z2S B;  1MND A;  3FK6 A;  3G1M A;  1Z9C A;  3PJR A;  2CJJ A;  4NC7 A;  2IU5 A;  4EMS A;  3BTC A;  5FHP A;  4HBL A;  5D6E A;  2Y9Y A;  3F6O A;  1O4X A;  1BC8 C;  3H5A A;  2XVC A;  4BJT A;  1QPI A;  2YU3 A;  2DDB A;  1JGS A;  2HFH A;  2A2F X;  3K4B A;  2QOP A;  4UVB A;  3SHF A;  1N77 A;  1DGW Y;  2FE3 A;  2K40 A;  4BEH A;  3QP6 A;  4YG2 F;  3K70 C;  5K7H A;  3BR3 A;  3ONQ A;  2L54 A;  5B5E C;  4RGU A;  3GZ6 A;  2UZK A;  4L0Z B;  1ETO A;  5FKO A;  5C4X J;  4YIR X;  3U1K A;  2EIM H;  2QIB A;  2M2E A;  4BYY A;  3DFG A;  1Y8R B;  4M3D A;  1HSJ A;  3RJP A;  3CP8 A;  3CCU I;  2KIM A;  2E1C A;  1IV8 A;  3BDD A;  1HKS A;  1RIO H;  3HGG A;  3D5S C;  3ESW B;  4WXH A;  1YLF A;  2IS2 A;  2DOD A;  4AIK A;  1KA8 A;  2ID3 A;  3PNY A;  3SZP A;  4PJN A;  3ZMD A;  4D9J A;  3KP3 A;  4BE0 A;  4QSH A;  4R1H A;  3AFH A;  3FXU A;  5D6F A;  4IX7 A;  3KYD B;  3CCR I;  3IUV A;  4M9Z A;  5FLX K;  4RMN A;  2PG4 A;  5DCM A;  4D7N A;  3AQS A;  1IN8 A;  4RBO A;  2GQQ A;  3DBL B;  1UST A;  4CIC A;  5A2Q Z;  2L9R A;  4Y7N J;  1X3W B;  2ZSH B;  2KRF A;  3LA3 A;  4QWQ A;  4CZC A;  5EG0 B;  3TO9 A;  2NRA C;  2PI0 A;  2GEN A;  5CW8 A;  4GCV A;  4A0X A;  3S93 A;  2NNN A;  1WQ2 A;  4UB6 C;  5GPA A;  3GFI A;  3ZMU A;  1DDN A;  1IF1 A;  2W48 A;  4B1R A;  3VOK A;  3H92 A;  4AIJ A;  1ZR4 A;  1SFX A;  2BOL A;  4GDF A;  1A6I A;  4C3J J;  4ZH4 F;  4NBQ A;  3OS2 A;  2QWT A;  2UXP A;  3GX4 X;  4XSX F;  3CUQ C;  1LPQ A;  3WTT C;  2IJL A;  1AA7 A;  1D0Z A;  3P5J A;  3KP7 A;  2B9S A;  2VE9 A;  4RA2 A;  2DTZ A;  1Z6R A;  2PN6 A;  4H4K C;  4LK0 F;  3VW1 A;  1JUS A;  1TT0 A;  4JX5 A;  2K9Q A;  3PPB A;  2KIF A;  3I58 A;  3V6G A;  2ACJ A;  5CVR A;  3JSJ A;  3EDP A;  3SFZ A;  3VYU B;  1G2H A;  3E97 A;  4HQE A;  5E3N A;  1D3Y A;  5EGO B;  2XGE A;  4RM3 A;  2YX7 A;  2DMN A;  5GP9 A;  5J40 A;  1VQM I;  3E7L A;  3NEU A;  5J47 A;  1TQM A;  2BE5 F;  3BCB A;  3HPG A;  4M3B A;  1EF4 A;  4OIN F;  3S2H J;  3BLY A;  3PNV A;  4JX4 A;  1QBJ A;  2M7B A;  3LQQ A;  2V1U A;  2BXY A;  1F43 A;  2L7M P;  1FT9 A;  4HQM A;  4II3 A;  5BPI A;  3HTJ A;  5DAJ A;  4M73 A;  2HZT A;  2GZW A;  5J3L A;  3TED A;  1IZ1 A;  2DCE A;  3DBR B;  2K9L A;  3C18 A;  4RS8 A;  4ZYH A;  2X1D A;  2Z9O A;  1S7O A;  3T5X A;  4LG0 A;  2R7S A;  4XON A;  2FBK A;  2KKO A;  2LP0 A;  1X58 A;  3ZQ7 A;  5C3E J;  4EGY A;  1MSF C;  4NN1 A;  1UG0 A;  2OTL I;  5ICG A;  2FBQ A;  3FXO A;  1J9I A;  4A3L J;  4CCO A;  3NAR A;  4KIT B;  2FU4 A;  3H3V K;  3ZQG A;  1I1S A;  2K4J A;  4G6Q A;  4O6J A;  1UHM A;  1USS A;  2HOE A;  1RC9 A;  5JFR A;  4Z6Y A;  3FRQ A;  2FQ4 A;  1P4W A;  2M7A A;  3I4N J;  3U9G A;  2TDX A;  1FLI A;  4EM1 A;  2XDV A;  4ETS A;  2CSO A;  4BAY A;  5D5W B;  2TCT A;  3TL4 X;  4XLC A;  1JT0 A;  1KU2 A;  2VC1 A;  3M3Y J;  4QLC U;  1N75 A;  1WJ5 A;  4NDL A;  2CWE A;  2J5O A;  2DT6 A;  3IWF A;  3OYI A;  1P6R A;  3NNR A;  2V1N A;  3FXM A;  1R1T A;  2R4G A;  2G3B A;  1X1D A;  1MMS A;  2DMT A;  4L0Y B;  4V2G A;  3WGH A;  1M1E B;  3E6D A;  2PJR A;  2DG7 A;  2W00 A;  1UZC A;  3K4M A;  5FKN A;  2VJ4 A;  3G6E I;  3COL A;  5LFA A;  1ETK A;  4KIS A;  3CUQ B;  5FGL A;  1K4T A;  4OAZ A;  2CG4 A;  2MC3 A;  4ZYD A;  3O8G A;  2FQ3 A;  3EYY A;  3L00 A;  1BI1 A;  2VQG A;  2CUE A;  2A5Y B;  2CW8 A;  5E1X A;  2GM4 A;  1WJD A;  4IJA A;  1MJ9 A;  2JWT A;  2OU2 A;  2YSR A;  3VSK A;  2DPU A;  2RAS A;  2C6Y A;  4KIB A;  3I0T A;  1RI7 A;  2XRL A;  4EJW A;  4ESB A;  4F52 A;  2OV7 A;  2K3F A;  2I8D A;  4G8X A;  1J2X A;  1IXS B;  2E5Z A;  3M8F A;  2E1M C;  4HX8 A;  5J6X A;  4EAT A;  2H94 A;  1ETV A;  4M9S A;  2LY1 A;  4XNF A;  1KQ8 A;  3K6G A;  4XRS G;  1CF7 A;  2WB1 N;  3LA2 A;  5CLS A;  4PJJ A;  2FRH A;  3PQJ A;  1IC8 A;  5EF6 A;  5K5R A;  2VPL A;  4HST A;  2KT0 A;  4I76 A;  3W6V A;  2Z1D A;  3JRB A;  1O3T A;  1ULY A;  1ZYR F;  2QQ8 A;  4I09 A;  2KFD A;  3CQZ J;  5B3S H;  1T98 A;  1EJ9 A;  2XF5 A;  2Y0M A;  3H36 A;  1W0U A;  3KFW X;  3Q9V A;  3ABK H;  3JR9 A;  4Q48 A;  3LAJ A;  1RPW A;  3I54 A;  5J1U A;  1XD7 A;  3M8J A;  3HEF A;  4PSW A;  2NVU B;  4KN7 X;  4JBA A;  1SGM A;  2GXA A;  1YOV B;  5J1R A;  4I0B A;  2XGX A;  5KAF C;  2ZNZ A;  3DV8 A;  2LF8 A;  2DN0 A;  3CCY A;  5BOX A;  3CDL A;  3TDZ C;  3K1N A;  4Q47 A;  3V42 A;  4XK4 A;  1YS7 A;  3GTL J;  1IUY A;  5TRD A;  2PZ9 A;  2HDW A;  5HNF A;  1GXQ A;  4NEL A;  1OJL A;  3HIF A;  1J5Y A;  5FB2 A;  5IP7 J;  1NH3 A;  4RAZ A;  2R0Q C;  4XOT A;  2HS5 A;  3O8H A;  5FKM A;  1TNT A;  2LVS A;  2YPR A;  3HGY A;  4YIF A;  1W36 C;  3DPJ A;  4F93 B;  2E2J J;  4TV7 A;  1LFB A;  4CDG A;  1ZK8 A;  2P8T A;  5LRS A;  1NK2 P;  3P9K A;  1WCM J;  2X51 A;  3L2Q A;  3GZN B;  5EEG A;  5IP9 J;  3FHZ A;  2GOM A;  1U6G A;  1UHW A;  1U0J A;  3BRU A;  3MFK A;  3HOX J;  1DUX C;  2YVH A;  4DW6 A;  3VSL A;  5D5X B;  1LVK A;  3OYL A;  2H27 A;  2R7F A;  2KP6 A;  2O0Y A;  4A3K J;  5LHH A;  5DS9 A;  4IHX A;  4LLL A;  1U5T C;  5DTD A;  2E1M B;  2XPV A;  4I99 C;  3M1C A;  1W4M A;  3G7R A;  2ZBK A;  1IG7 A;  2F5E A;  5IYC J;  2ISZ A;  3S16 J;  3OYH A;  4XL9 A;  1ON1 A;  2PFB A;  3K10 A;  2WUI A;  2ZC2 A;  3V8J A;  1G8X A;  4IRH A;  4P5O A;  5M5Y J;  3ANG A;  2A5W A;  1J7K A;  1TNS A;  4N0B A;  3HOS A;  1RET A;  3S2W A;  2E19 A;  3F3X A;  4BJ5 C;  1DU6 A;  1ZG1 A;  4UB8 C;  3CMA I;  3TP0 A;  2KPM A;  4S0H B;  2KLO A;  4OIP F;  2K4B A;  5EG0 A;  5M3F J;  3QKX A;  3H9Q A;  2IXS A;  2DA3 A;  1BR1 A;  1UFM A;  1G6N A;  2DA2 A;  5FKL A;  4AVZ A;  2GWR A;  2ADU A;  4HV6 A;  1ERD A;  3HKZ A;  3SFI A;  1LJ9 A;  3GW2 A;  3TW7 A;  3N97 A;  3R4K A;  3S3O A;  5LBQ A;  3G2B A;  3HC7 A;  2Y9Z A;  3MZH A;  4A3B J;  1ZGJ A;  5FLX Z;  4LMY A;  2I5U A;  1VFC A;  2JJ7 A;  3P9C A;  3ULQ B;  2DFF A;  2QQA A;  2M3A A;  2V9P A;  4XN3 A;  4BHB A;  4KFC A;  1MZB A;  3R6S A;  2HDC A;  4A5N A; 
#chains in the Genus database with same CATH homology
 2Y2Z A;  3Q0U A;  2CRG A;  1UI5 A;  2ZCN A;  2EH3 A;  1BW5 A;  2Y30 A;  3C2B A;  1B72 B;  1RES A;  3QPS A;  2EBI A;  2IBD A;  3B6C A;  3NPI A;  2OPT A;  4BBR J;  4JKZ A;  4AUX A;  3RZD J;  3QPL A;  4UUS A;  3S15 J;  3OIO A;  4PXI A;  2UXO A;  3S5R A;  1TWA J;  1XG1 A;  4X6A J;  5IP6 A;  1IDY A;  4FE4 A;  2ZB9 A;  2Y0S N;  3JRF A;  4M3F A;  1MSE C;  1S7E A;  2JA6 J;  4HKU A;  3V78 A;  3HOV J;  3NI7 A;  1P7I A;  1MNM C;  3GTO J;  3VW0 A;  4M6V A;  3HIM A;  2DMQ A;  1H88 C;  3LNQ A;  2O7O A;  1U78 A;  4AC6 A;  4JNN A;  4CYC B;  5F1J A;  2IAI A;  3SJM A;  1H8A C;  3VW2 A;  3F0C A;  3BTJ A;  3PO2 J;  2DMP A;  1F36 A;  5EYR A;  1MH4 A;  5J1Y A;  2FX0 A;  3ZOB A;  2OI8 A;  1MBE A;  2M8G X;  1GVD A;  1ZR2 A;  2D6Y A;  3DEW A;  3GTQ J;  2F07 A;  1ZKG A;  3WHB A;  1HF0 A;  2UXH A;  1GV2 A;  2HYJ A;  2E2I J;  2O7T A;  3HOW J;  3Q0V A;  2HOT A;  4L62 A;  3BR0 A;  1WH7 A;  2LR8 A;  2M9H A;  4IHW A;  2XDN A;  4BBS J;  1U9O A;  2P81 A;  4JYK A;  4LOC A;  3HOY J;  5FMP A;  3S2D J;  3BT9 A;  3IH2 A;  1IGN A;  4X1E A;  1RKT A;  1Y1W J;  3S1Q J;  2IEK A;  3VIB A;  2PBX A;  5BNG A;  2EZH A;  5IYB J;  2QF7 A;  2ID6 A;  4A93 J;  2G7S A;  2Q24 A;  1JTY A;  2HI3 A;  2K9N A;  3GTJ J;  1T33 A;  2NVY J;  3BNI A;  1MBG A;  1MBH A;  1I3Q J;  1UI6 A;  4I6Z A;  2X48 A;  3A02 A;  4BY7 J;  4M3G A;  2ECB A;  3E7Q A;  5C44 J;  3CJD A;  2H8R A;  2NVX J;  3OSG A;  1I50 J;  3A01 B;  2NVQ J;  1AKH B;  2E2H J;  1UHS A;  5IPA A;  3T6N A;  2HOA A;  2QCO A;  2DA4 A;  3LSG A;  1JTX A;  5JLX A;  2LTP A;  4J19 A;  3HOZ J;  1FTT A;  4RDU A;  3JRE A;  4MXM A;  1JKQ C;  5M5W J;  2GUH A;  5H9T A;  3GTK J;  2L0K A;  5E3M A;  2R5Y A;  3FK6 A;  4AF5 A;  1TC3 C;  3G1M A;  1DU0 A;  2CQQ A;  4FCY A;  2MW8 A;  2CJJ A;  2DMU A;  3BR5 A;  2IU5 A;  3ON2 A;  3BTC A;  3BTI A;  5FHP A;  2Y9Y A;  1HOM A;  1K61 A;  1O4X A;  2XGD A;  1A5J A;  1ITY A;  1MBJ A;  1IJW C;  3D1N I;  5CXI A;  3IV5 A;  2EZI A;  2HYT A;  1QPI A;  4A3D J;  2ME6 A;  2QOP A;  2Y31 A;  2MG4 A;  3BTL A;  2K40 A;  3HBL A;  3MNL A;  4A3I J;  1HDD C;  3GTG J;  1JJ8 C;  5HSZ A;  5K7H A;  4Y52 J;  3BR3 A;  3HM5 A;  4CGR A;  1SAN A;  3M4O J;  1ETO A;  5FKO A;  4IHY A;  1JT6 A;  5C4X J;  5AQC A;  1WI3 A;  2E1O A;  3PO3 J;  2KDZ A;  2QIB A;  2JN6 A;  2M2E A;  1ZQ3 P;  3C07 A;  1RR7 A;  4MLO A;  1XC5 A;  1RKW A;  4A3C J;  3MVP A;  4M3D A;  3GTM J;  3LWJ A;  3VUQ A;  4AC0 A;  2UXU A;  3BQZ A;  2XSD C;  3G1L A;  3QBM A;  4L5E A;  4GCT A;  3HGG A;  3LJL A;  2L7F P;  1FTZ A;  4GFK A;  1BW6 A;  2WV1 A;  1NTC A;  4M3E A;  1E3O C;  2ID3 A;  3S1M J;  2HQ5 A;  3JRD A;  2R92 J;  4IEJ A;  5EGO A;  1B8I A;  2VUM J;  2JMW A;  4A3F J;  4QSH A;  3ZQH A;  1APL C;  2R5Y B;  5GPC A;  4D5F A;  3HTA A;  3IUV A;  4D7N A;  3AQS A;  2DJN A;  5M3M J;  3VVZ A;  3AQT A;  4RBO A;  3TP3 A;  4ACI A;  3L1P A;  5EDN A;  3LSP A;  2L9R A;  4Y7N J;  4XIC A;  5EG0 B;  5D1R A;  2GEN A;  2LKX A;  1LE8 B;  9ANT A;  5CW8 A;  2EZK A;  2NVT J;  3S14 J;  3BCG A;  3S1N J;  2COB A;  2LD5 A;  3RZO J;  5GPA A;  1WH5 A;  2OER A;  2W48 A;  2X6O A;  4B1R A;  2VKV A;  3UKG A;  3HE0 A;  3VOK A;  3BG9 A;  1ZR4 A;  5D18 A;  1GUU A;  1U9N A;  3KZ9 A;  2R5Z A;  2YU9 J;  1A6I A;  4QIW N;  3SDG A;  3KKC A;  4C3J J;  3FIW A;  4YZE A;  3I4M J;  2QWT A;  2UXP A;  3VVY A;  4D5C A;  3ON4 A;  4MFD A;  3Q0W A;  5F08 A;  3LHQ A;  2XB5 A;  4MIM A;  2DTZ A;  1HLV A;  2N8G A;  2L7Z A;  3VW1 A;  2ELK A;  1JUS A;  4JX5 A;  3TW6 A;  4JL3 A;  3G56 A;  2K9Q A;  3JRC A;  4A3G J;  3PPB A;  4JX6 A;  3NXC A;  2JA8 J;  1FIA A;  3ZQF A;  3V6G A;  5F0H A;  3JSJ A;  1QRY A;  4B3A A;  1D5Y A;  1G2H A;  1IDZ A;  5E3N A;  1JUP A;  3IH4 A;  2O9L A;  3HB9 A;  1B8I B;  5EGO B;  1TWH J;  2DA5 A;  4UUS B;  2XGE A;  2X9D A;  2DMN A;  5GP9 A;  1ETQ A;  3E7L A;  2H1K A;  1MBF A;  1SFO J;  2GLO A;  1MH3 A;  4M3B A;  1EF4 A;  3FK7 A;  3S2H J;  1JKR C;  1ZGW A;  4JX4 A;  1UG2 A;  2AO9 A;  2M34 A;  1Q1V A;  2YVE A;  2NP3 A;  1BL0 A;  1F43 A;  2L7M P;  3HTH A;  2QTQ A;  4MFE A;  3LSJ A;  3HTJ A;  5DAJ A;  3RD3 A;  3K7A J;  5J3L A;  3TED A;  5IOY A;  1QVU A;  2GFN A;  2UXI A;  2OF7 A;  2LP0 A;  1X58 A;  5C3E J;  2DA1 A;  1PUF A;  2R5Z B;  4HNV A;  3A03 A;  2YS9 A;  1MSF C;  5F0C A;  1JKO C;  2LFB A;  1YRN A;  4NN1 A;  2FBQ A;  2GBY A;  2EZL A;  4A3L J;  3PAS A;  3NAR A;  1VI0 A;  3H3V K;  3ZQG A;  3JRH A;  4UUT A;  1MBK A;  3HDD A;  3FRQ A;  2FQ4 A;  3I4N J;  5F0F A;  2ZOY A;  4BY1 J;  2O8K A;  4BKX A;  2ZCM A;  2REK A;  2TCT A;  1W0T A;  1JT0 A;  2CQX A;  1WGX A;  1ZTR A;  2XB0 X;  4XRS A;  3M3Y J;  5HAW A;  1ETY A;  4NDL A;  2W53 A;  4DYR A;  5K7Z A;  3NNR A;  4W97 A;  1NK3 P;  2G3B A;  5EZH A;  2DMT A;  2DG7 A;  4V2G A;  3EGQ A;  3HTI A;  1ETX A;  2I10 A;  2PMZ N;  5FKN A;  3ZQI A;  3LSR A;  3COL A;  1ETK A;  5FGL A;  3BR1 A;  4XRM A;  3O8G A;  4DYC A;  5K58 A;  3ZQL A;  2CUE A;  2R7Z J;  3CMY A;  1VND A;  2HXI A;  2ME0 A;  2RAE A;  2XGC A;  2GM4 A;  4ME9 A;  3VP5 A;  2JWT A;  3KKD A;  2RAS A;  2MGQ A;  2NS8 A;  2TRT A;  2XRL A;  2CUF A;  5K7F A;  3RQI A;  5FJ8 J;  1IV6 A;  1POG A;  4A69 C;  4UDS A;  2HKU A;  1GT0 C;  1UMQ A;  2B63 J;  3VVX A;  1JKP C;  1ETV A;  1ETW A;  5CXG A;  5JLW A;  4XRS G;  3G1O A;  2WB1 N;  3JRI A;  2MSY A;  1JUM A;  1XS9 A;  1WPK A;  3GZI A;  2HXO A;  2G0E A;  3BR6 A;  2DA7 A;  5EF6 A;  1X2N A;  1IC8 A;  1FJL A;  1U8B A;  4JP0 A;  2KT0 A;  4I76 A;  5HOD A;  2HDD A;  1Y1V J;  3W6V A;  5IYD J;  1IUF A;  5F27 A;  3JRB A;  1JJ6 C;  3CQZ J;  4C2M J;  1OCP A;  4MK6 A;  2LY9 A;  4C3H J;  1W0U A;  4G12 A;  2ZCX A;  2YUS A;  3JR9 A;  1RPW A;  1VF9 A;  1H89 C;  3FIS A;  5J1U A;  2M0C A;  3HEF A;  3A01 A;  1AKH A;  3S17 J;  4FE7 A;  2WGB A;  1SGM A;  5FKK A;  5J1R A;  5M5X J;  4GCK A;  3MN2 A;  2K9S A;  2DG8 A;  2DN0 A;  3CCY A;  2ZOZ A;  3ANP A;  4C3I J;  1CQT A;  4DZJ A;  3DCF A;  3CDL A;  1TWF J;  5C4J J;  3ZQC A;  1AHD P;  3NAU A;  2DA6 A;  2WAQ N;  3O60 A;  4XK4 A;  1FEX A;  3B81 A;  3CRJ A;  3GTL J;  5D19 A;  2JA5 J;  5EEA A;  4XID A;  2PZ9 A;  2V57 A;  5EZG A;  4FTH A;  5EFY A;  1HCR A;  3OSF A;  1Z77 A;  2NX4 A;  2ECC A;  1AU7 A;  4NEL A;  1OJL A;  5IP7 J;  3BHQ A;  2R0Q C;  2NOG A;  3NRG A;  3O8H A;  5FKM A;  3HKZ N;  2LVS A;  3HGY A;  3DPJ A;  4AYB N;  3JRA A;  2E2J J;  1GDT A;  1OFC X;  1LFB A;  1T56 A;  2VKE A;  1ZK8 A;  3BJB A;  3BR2 A;  1NK2 P;  1WCM J;  5IOZ A;  5IP9 J;  5C4Y A;  3MKL A;  3PM1 A;  2AHQ A;  3BRU A;  2LK2 A;  3HOX J;  1OCT C;  2LLK A;  3VPR A;  2YVH A;  4DW6 A;  1Z0X A;  1R9T J;  3K2A A;  2XPW A;  5E3L A;  3KNW A;  2NS7 A;  3F1B A;  4GFL A;  2D5V A;  4D7M A;  1QVT A;  2NP5 A;  3FKI J;  4A3K J;  5DS9 A;  4IHX A;  5DTD A;  4DYQ A;  3EUP A;  2XPV A;  1K83 J;  1LFU P;  3BQY A;  3G7R A;  4A3M J;  1IG7 A;  1ENH A;  1B72 A;  5IYC J;  2EQR A;  3S16 J;  2G7G A;  3LOC A;  1GV5 A;  3P9T A;  4A3J J;  1BA5 A;  2WUI A;  2FD5 A;  3S1R J;  3BG3 A;  1JGG A;  3GTP J;  3VOX A;  3CWR A;  2R93 J;  5E3O A;  3RKQ A;  4W1U A;  4A3E J;  5M5Y J;  3ANG A;  5HBU A;  2CU7 A;  3WHC A;  5FLM J;  4MO7 A;  1RET A;  2E19 A;  3H0G J;  1TWC J;  1DU6 A;  2RHA A;  4ICH A;  3TP0 A;  2QKO A;  1TWG J;  3BG5 A;  4FIS A;  4S0H B;  3IH3 A;  4IHV A;  5EG0 A;  5M3F J;  4V2F A;  1HDP A;  3QKX A;  1LE8 A;  2FJ1 A;  1BJZ A;  3GBG A;  2DA3 A;  1P7J A;  2DA2 A;  5FKL A;  3B6A A;  4B4C A;  4CYC A;  1ORK A;  4BXX J;  3QQA A;  3Q3S A;  3SFI A;  1I6H J;  2JK3 A;  3TW7 A;  4GFB A;  2XPU A;  5FLV A;  1PUF B;  2Y9Z A;  2HOS A;  4A3B J;  4ABZ A;  3HOU J;  3JRG A;  1X2M A;  2VPR A;  2JA7 J;  1VFC A;  2JJ7 A;  2VI6 A;  3OOU A;  5F04 A;  1YRN B;  1IRZ A;  2G7L A;  3GEU A;  4DZP A;  4KWA A;  1FIP A;  3RH2 A;  4GCL A;  4EEF G;  4QTR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...