3BR6A

Crystal structure of the complex of rhodamine 6g bound to qacr(e120q), a mutant of a multidrug binding transcriptional repressor
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
186
structure length
185
Chain Sequence
NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKSEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYTNSINEKMNKLQNKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator qacR
publication title Formal electrostatic interactions do not govern QacR-cation affinity
rcsb
source organism Staphylococcus aureus
molecule tags Transcription
total genus 72
structure length 185
sequence length 186
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2007-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3br6A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3br6A02
3KKCA 1G2HA 2HYTA 2QTQA 3VVXA 3ZQIA 4BY1J 1RPWA 4HKUA 2HOAA 2DA6A 3BHQA 3ZOBA 4A3CJ 2HI3A 2DJNA 3KKDA 1ETWA 3TP0A 2YUSA 1FIPA 4RDUA 1W0UA 1FTZA 5D18A 1TWAJ 2HKUA 2EQRA 1H89C 2Y0SN 2VI6A 4A3JJ 3C07A 2R5YA 3PO3J 1JUSA 4MIMA 5DTDA 3B6CA 3CRJA 2IBDA 2WB1N 4A69C 1JKQC 1NTCA 4JX5A 3HOUJ 3HOVJ 4ACIA 3NI7A 4GCKA 4DZPA 2PMZN 3E7QA 3ON2A 4J19A 3HBLA 3GTMJ 2PBXA 2HOTA 4A3MJ 3GTQJ 1ZQ3P 1SANA 4HNVA 3L1PA 3G1OA 3BCGA 5IPAA 1ZR2A 1YRNA 3VPRA 2X48A 5J1YA 2XPVA 5F0HA 3FKIJ 3LWJA 3MVPA 3M3YJ 3A01A 2PZ9A 3T6NA 2CU7A 1TC3C 1XS9A 1ZR4A 1HLVA 3EUPA 3W6VA 4GCTA 4AC0A 2LR8A 1HOMA 5EGOA 5CW8A 1GT0C 2D5VA 3AQSA 2LVSA 1F36A 3JRCA 1AHDP 5IYDJ 3QQAA 1P7JA 2NOGA 4AUXA 3JRBA 2ZB9A 4FE4A 4GCLA 1QPIA 1ETKA 1IV6A 5E3OA 4XIDA 3WHBA 4QIWN 3VUQA 3O8HA 1GUUA 4A3EJ 2M8GX 4B4CA 4MK6A 4D5CA 5CXGA 2HDDA 1XG1A 1UI5A 1LFBA 4JYKA 3BG3A 5H9TA 1MBHA 2NP3A 1QRYA 3HGYA 3MN2A 5EZHA 3DPJA 1PUFA 4AC6A 3A02A 1JTXA 3FIWA 5EEAA 1IRZA 1H8AC 1MNMC 4JX6A 3BR0A 4MO7A 3TEDA 2DMQA 2O7OA 3ON4A 2COBA 1FIAA 2XPUA 1WPKA 2DA5A 4Y52J 1JUMA 3CCYA 4DW6A 1MH4A 5FHPA 3A03A 5GPAA 3BT9A 4V2GA 2H8RA 5DAJA 2MGQA 2K9SA 3MNLA 3BR3A 2OPTA 4FCYA 3S14J 2DTZA 3QKXA 3TW7A 5BNGA 3VP5A 4UUTA 2B63J 4JX4A 2W48A 4XRSG 3BR6A 3O60A 4D5FA 3GTGJ 1JKPC 2LP0A 3VIBA 1I3QJ 3VW2A 3CJDA 3VOXA 2D6YA 1XC5A 4V2FA 1ENHA 2M9HA 3HE0A 5FKMA 1HCRA 2LD5A 3RZDJ 3B81A 2E1OA 1MSFC 3VOKA 2JK3A 2M0CA 2DN0A 1U8BA 2UXOA 3JRIA 1B72B 1JT0A 4CYCB 3NPIA 2CUEA 2Y30A 3PPBA 4UDSA 2NP5A 3FRQA 2X9DA 4UUSB 1VFCA 1ZK8A 1T33A 1B8IA 5M5YJ 3E7LA 3HDDA 1ETQA 5C4XJ 5M3FJ 2R5ZB 3D1NI 4AF5A 2CQXA 1K61A 2EZLA 4CGRA 1UHSA 2EZIA 4L5EA 4IHXA 4FTHA 2JA6J 1AKHA 3GTJJ 1T56A 2IU5A 3ZQCA 4IHVA 4X1EA 1R9TJ 2DA1A 2NS7A 5EG0B 2NS8A 5E3NA 3JREA 4GFLA 1NK2P 1BA5A 1IDZA 2W53A 4YZEA 2ME6A 2ZOZA 3JRAA 5M5XJ 4MXMA 1ZTRA 4EEFG 4S0HB 2FD5A 2LK2A 2TCTA 1X2NA 1SFOJ 1JUPA 3A01B 2WAQN 2Y9ZA 2OI8A 3LSPA 2ID3A 5F0CA 3GTPJ 5E3MA 2R7ZJ 3RH2A 2K9QA 2LTPA 1WGXA 2LFBA 3JRFA 2RAEA 5JLWA 3QPSA 3S2HJ 2K40A 2O8KA 3OSGA 3UKGA 1ETXA 3KZ9A 2HXOA 4QSHA 2KT0A 1F43A 2ECCA 3ZQGA 4A3BJ 1GDTA 1FTTA 3RKQA 5F04A 2I10A 2NVXJ 3TP3A 2NVYJ 1P7IA 1UG2A 2G7GA 3S1NJ 3V78A 1UMQA 2G0EA 1O4XA 3VW1A 3F1BA 5FLVA 4MFEA 1OCTC 2QWTA 4NN1A 1POGA 4W97A 3ANGA 5J1RA 4JKZA 3QPLA 4AYBN 4B1RA 3QBMA 2CRGA 1QVTA 4XRSA 1A5JA 3Q0WA 1JTYA 1X58A 2MSYA 3WHCA 4GFBA 1LFUP 3AQTA 1TWCJ 3RD3A 2DMTA 2NVTJ 5EYRA 1BW6A 3IV5A 4BKXA 3RQIA 1LE8B 4M3GA 1JT6A 1APLC 2YVHA 3OSFA 1BW5A 4ICHA 2YVEA 2M34A 2KDZA 5K7FA 2R0QC 2UXUA 3BR2A 2DA7A 2G7SA 3BTIA 2XB0X 3ZQHA 4IHWA 2L7MP 1H88C 3GZIA 1TWGJ 3BTJA 1Y1WJ 4JNNA 2AO9A 1VI0A 2DA4A 2MG4A 2EZKA 3Q0VA 3I4NJ 2R93J 5IP9J 4KWAA 5J1UA 3FK6A 5D1RA 5FLMJ 4Y7NJ 2AHQA 3HOZJ 1Z0XA 1JJ8C 1IGNA 2CQQA 4BY7J 3H0GJ 5AQCA 3GBGA 3LSJA 1JJ6C 2YS9A 1ZKGA 2XSDC 2FX0A 1NK3P 1ORKA 3TW6A 1FJLA 5C4YA 2GBYA 2G7LA 1MBFA 3G1LA 2QIBA 3LHQA 3GTKJ 5FGLA 2QOPA 5J3LA 2DA2A 1MH3A 3GTLJ 4DYCA 5DS9A 5FKKA 1CQTA 2JA7J 4A3DJ 2Q24A 2LLKA 3NNRA 2IEKA 1AU7A 2G3BA 2DMNA 1UI6A 4I6ZA 4C3IJ 4XRMA 4BBSJ 1FEXA 3DCFA 5F1JA 2P81A 3S16J 2UXPA 1TWHJ 2TRTA 4NELA 3S5RA 1BJZA 4I76A 3ZQLA 3HTAA 1U78A 2Y9YA 3SFIA 3ZQFA 2R5YB 1JKRC 1EF4A 3OIOA 3BQZA 3EGQA 3HEFA 1MBKA 3S17J 1MBJA 5M3MJ 3BQYA 3COLA 2REKA 2K9NA 4NDLA 3BR5A 2XGDA 1HDDC 2XB5A 3BR1A 2FJ1A 2HXIA 2FQ4A 2E2HJ 2UXHA 2N8GA 2XPWA 4M6VA 3BRUA 5K7ZA 3HGGA 2ZCXA 5IOYA 4D7NA 3HOXJ 4X6AJ 2IAIA 1YRNB 4C3JJ 2OERA 4LOCA 3KNWA 2ECBA 3NARA 2HYJA 3HIMA 2L7FP 3LOCA 4M3DA 2QCOA 3SDGA 2WV1A 1Q1VA 2JN6A 1U9NA 1MSEC 4BXXJ 3PASA 3NXCA 2EZHA 2F07A 4M3EA 4A3KJ 3IH2A 1GV5A 2VKEA 3BTCA 4XICA 2E2IJ 3S1QJ 5FJ8J 3G7RA 2L0KA 1B72A 5EGOB 4CYCA 2H1KA 1I6HJ 2QF7A 4UUSA 2XRLA 3S2DJ 3NAUA 2JJ7A 2Y31A 1VNDA 4PXIA 5K7HA 2JMWA 4BBRJ 4C3HJ 2GFNA 2M2EA 2R5ZA 2ZCMA 4G12A 3CMYA 1D5YA 3VVYA 4FE7A 1WH5A 3I4MJ 2CJJA 4GFKA 5D19A 1WI3A 1HF0A 3F0CA 5CXIA 1MBEA 4A3IJ 2L7ZA 1I50J 2ME0A 5HODA 3BG5A 2E2JJ 1GV2A 1RR7A 3HTHA 5EF6A 5EG0A 2X6OA 5FKOA 3S1MJ 2O9LA 4FISA 3BNIA 2NVQJ 3VW0A 5M5WJ 5F27A 1ETVA 5IOZA 4B3AA 1OCPA 1PUFB 2XDNA 2RHAA 4IEJA 1MBGA 5IP6A 1ITYA 2CUFA 1WCMJ 4ME9A 2XGCA 3LNQA 3HOWJ 2UXIA 1GVDA 3LSRA 1IG7A 5FKLA 3HOYJ 5C3EJ 1RKTA 2ID6A 2VUMJ 1IJWC 2DG7A 3P9TA 4MLOA 4XK4A 2ELKA 2XGEA 3JRGA 5JLXA 3C2BA 3FISA 2YU9J 2DMPA 3S15J 2ZOYA 3LJLA 3OOUA 1IUFA 3JSJA 4A3FJ 1RETA 5GPCA 2LKXA 3V6GA 2VKVA 3MKLA 2HOSA 5C44J 4C2MJ 1TWFJ 3O8GA 2GENA 1HDPA 3FK7A 2WGBA 3ANPA 2QKOA 1RKWA 4L62A 1DU6A 2L9RA 2MW8A 1A6IA 1Y1VJ 4DYQA 2FBQA 3B6AA 5K58A 3GTOJ 1IDYA 1OJLA 3K7AJ 5E3LA 3JRHA 3NRGA 2DA3A 3JRDA 1S7EA 4JL3A 5FMPA 5GP9A 3H3VK 9ANTA 4A3GJ 1ETYA 3BG9A 1B8IB 2NX4A 2WUIA 2JWTA 5IYCJ 2HQ5A 5HSZA 2GUHA 5C4JJ 2LY9A 3RZOJ 1BL0A 4A93J 3M4OJ 1WH7A 2JA5J 1X2MA 3CDLA 3IH4A 2Y2ZA 4MFDA 4RBOA 1JKOC 1LE8A 5EDNA 1AKHB 2DMUA 3LSGA 3HTJA 2EH3A 2R92J 1K83J 1ETOA 1OFCX 1VF9A 3Q3SA 2ZCNA 3CWRA 3HB9A 4QTRA 4ABZA 3HM5A 3PM1A 3HKZN 3G1MA 1Z77A 3VVZA 4DZJA 1QVUA 5IYBJ 2GLOA 5HBUA 2JA8J 2EBIA 5F08A 5EFYA 1RESA 1JGGA 2GM4A 1IC8A 2DG8A 3IH3A 1SGMA 5HAWA 1ZGWA 3JR9A 3S1RJ 4M3FA 3SJMA 4DYRA 1W0TA 1DU0A 3BJBA 3GEUA 1U9OA 4JP0A 3DEWA 3IUVA 4A3LJ 4W1UA 4M3BA 5EZGA 4D7MA 3BTLA 2RASA 2E19A 3HTIA 2VPRA 3CQZJ 2O7TA 2V57A 3K2AA 5F0FA 3G56A 4IHYA 2OF7A 5IP7J 5FKNA 1E3OC 3PO2J 3Q0UA
chains in the Genus database with same CATH superfamily
3KKCA 4NQWA 2QTQA 4HNUA 1DP3A 3V4GA 3SZTA 1RPWA 4HKUA 2HOAA 3BHQA 3D0SA 4A3CJ 2DJNA 3KKDA 1ETWA 2Y75A 2YUSA 2EWNA 3FWEA 2HKUA 2KL4A 1DPRA 3K4BA 4E7HA 1UHMA 2HNHA 2VI6A 3GUDA 2HQAA 4Q4ZF 1OQYA 4U0VA 3GFLA 2R5YA 2QKMB 5FB2A 4N0BA 1JUSA 3PO3J 2CMPA 1Z1DA 4HBLA 4ZJZA 2B3WA 1Z9CA 1NTCA 3O2PE 3WGIA 3HOUJ 3OYAA 1FPQA 1STZA 2DFIA 5EEHA 3BOQA 3E7QA 1UFMA 4KUMA 2WAFA 3KFWX 2HOTA 4BHCA 2V9VA 2UWMA 1OKRA 3L1PA 4OWRB 3DF8A 4XN0A 1ZR2A 3VPRA 4PCQA 3CO7C 5J1YA 5ICFA 1IRGA 4QLCU 4XSZF 2DQRA 3TO7A 3LWJA 2PZ9A 3A01A 3OMYA 4Q5SF 4B48A 1KQ8A 1VQPI 1XS9A 1ZR4A 3EUPA 1BIAA 3W6VA 4GCTA 4ZDLA 2PI0A 2HYFA 5EGOA 2LDUA 5CW8A 4L0YB 1YW7A 5DD8A 3JRCA 1IF1A 5IYDJ 4MGRA 1GXQA 4MTDA 2NOGA 3ABTA 3O3KA 2CW7A 3QOPA 2ZB9A 2HKOA 1YS7A 4XIDA 5BMZA 1GUUA 4A3EJ 5CXGA 4D5CA 1X19A 2HPIA 1XG1A 2JSCA 2BY2A 1ON1A 2CV0A 1BOAA 4LD5A 3MN2A 3KX2A 1B9NA 4LB6B 1ZG3A 3FIWA 1JTXA 2A6HF 1H8AC 1LVKA 1B6AA 5ERIA 3WU1B 1A31A 4KISA 3VTIA 5GTHC 4BNCA 4II3A 1W5TA 4KIBA 1R1UA 1ZREA 2O7OA 3ON4A 2FBIA 1DGWY 4RA2A 4Y52J 4HW0A 2B9SA 2K9MA 3I9V2 1AWCA 3WE2A 4DW6A 1OR7C 3JSPA 2NVUB 1ZG5A 5GPAA 3E6BA 3CMEI 3BR3A 4FCYA 5DEQA 2FEZA 2FMYA 3CJNA 3G6EI 2DTZA 4BQOA 1EH8A 3QAHA 1SMTA 2W48A 3QOEA 3BR6A 4D5FA 2DQLA 4KICA 3IWZA 2NS0A 2MD0A 4LJZF 3WTXC 3VOXA 1UELB 1MD0A 2OA4A 2L02A 2LBFA 3BJAA 3BP8A 5HLIA 2LD5A 1R7JA 2FBKA 1FSEA 2VC0A 1IN5A 3PIOF 3PJRA 1MSFC 3EUHC 4ENNA 4KDPA 2DN0A 5ED4A 1MJAA 3T5XA 4WWCA 5BPIA 3LSKA 3NPIA 3VSKA 2L3DA 1H0MA 1YG2A 2X9DA 2NP5A 3FRQA 3OS0A 2CFXA 2XAGA 1FBQA 3P9IA 3PFIA 3FMRA 3HDDA 3BCBA 3D1NI 4IL6C 2QM3A 2F2EA 3CCQI 3OS2A 1EJ9A 3W6JB 1UHSA 2EZIA 2X1DA 3LQQA 2JA6J 1T56A 4Q47A 4NC8A 1R1VA 3WTUC 2QEXI 3M07A 3QU3A 1XN7A 2NS7A 3ZQ7A 1R9TJ 4G7HF 5A2QZ 1D3YA 2H6BA 1ON2A 4GFLA 2O8XA 1X4PA 3J80Z 2FMLA 2NNYA 3RQ4A 1NK2P 2G7UA 2L9VA 2HQRA 4UB6C 2ME6A 3BLYA 5E8IA 4MXMA 1ZTRA 3BY6A 2HPMA 1YFHA 3K4LA 3R6SA 3OYHA 3G3ZA 2CGPA 4IRHA 2L4AA 4BE2A 2OU2A 1ZELA 3FXQA 4PGGA 2IGKA 3LSPA 2ID3A 5F0CA 3R0AA 2QQAA 2VN2A 1J7KA 2LY2A 3H9JA 2IPQX 2BGCA 1RZ4A 3L2RA 1J75A 4L18B 2WADA 2Z9OA 3S2HJ 5K5OA 2O8KA 4EGYA 2ADUA 3KP3A 3IKVA 2HXOA 1D0XA 3IC7A 1PVEA 3F8FA 1F43A 4A3BJ 1GDTA 2VIXA 5DD4A 5L3EA 2I10A 2NVXJ 2LREA 3H9QA 1P7IA 5LBQA 2MA3A 5L3FA 1Y0NA 3V78A 2F4OB 1O4XA 3VW1A 2ZBKA 5LHIA 1X4OA 2BY0A 3V42A 2DYSH 2L9SA 5CVRA 1D0YA 4NN1A 5J4VA 3ANGA 1XSDA 5J1RA 4KN7X 2FJI1 3HC7A 2EV0A 3MMYB 2M1BA 4XRSA 4PJ0C 2GQQA 1IZ1A 1A5JA 1OCOH 2DODA 4BACA 5FROA 3CJQB 2ZMEB 5D8KB 4P1WA 3QP5A 1P2FA 1MJ9A 1YJ9I 2FA5A 1W4MA 3ASOH 5HS9A 4ZH4F 3AAFA 5LHGA 4FHTA 4BKXA 3RQIA 3TDUC 1KU2A 1LE8B 2EIKH 2F6CA 1SD5A 4Z2YA 1FMWA 5K7FA 3CC2I 2KRHA 3BR2A 2L7MP 5K5QA 2LF7A 1HW1A 1TWGJ 4IHTA 4F55A 2AO9A 5LRRA 2ZNZA 4GGGA 5HVQC 1EV7A 3GCMA 3I4NJ 1GLNA 2IA1A 4EM1A 1S29A 4HQEA 1FZPB 3DP7A 5E1ZB 5J1UA 4CSWA 3FK6A 1HQCA 2EFWA 5DM7F 3RKWA 1LPQA 1Z0XA 3V8KA 1F9NA 4ESFA 1S7OA 3F72A 5AQCA 3LSJA 4RAFA 1JJ6C 4OD4A 1NK3P 4XMYA 2PLYA 3TW6A 2YVXA 4IOCF 2G7LA 2MABA 2DDBA 3CESA 3BPVA 2QOPA 2DO7A 1WJ5A 3IWFA 3M9AA 2B7EA 2AQFA 1MZBA 1MH3A 1Z7UA 4NQWB 1CQTA 3M8FA 5FKKA 5DS9A 2JA7J 4A3DJ 3I59A 3ZMZA 2LLKA 2P7VB 2H27A 1AU7A 1U2WA 4HV5A 3M8EA 2G3BA 1TBXA 2DMNA 3BJ6A 3LSTA 1T98A 3ZCOA 3A1YA 3B02A 3K4KA 1XGSA 2EIJH 4CCJA 2V6EA 3FXMA 2L4MA 2P81A 2TRTA 1MW7A 2HVQA 4I76A 3HTAA 3U1KA 1WHUA 2Y9YA 2XF7A 3G71I 2R5YB 1JKRC 2W84A 2LNBA 5DCFA 3VODA 1BI0A 3WTWC 3BQZA 3R0JA 4FX4A 2I5UA 3BWGA 2Q1ZB 1MBKA 3VWBA 1O3SA 4EGZA 4IOAF 2K9NA 4NDLA 2DXIA 2CH0A 5GAHJ 2DFHA 2O0YA 4BHBA 3E6CC 2N8GA 4RGSA 3ECHA 3PSIA 1JHFA 2M3AA 2WB1A 2ZCXA 4PZJA 5IOYA 1BBYA 3E5UA 1IXSB 2JRMA 2OERA 5DCMA 3HIMA 5F6FA 2PMZA 2WV1A 1MMAA 3DU6A 3PASA 2DPUA 2VJ4A 3ZGKA 4EJUA 5JHUA 1R00A 1A35A 2F07A 3OR2C 4M3EA 5H20A 3OV8A 4BQNA 4D1QA 3J81Z 4RM3A 3QYBA 4IRVA 3LA3A 4XICA 1IXRC 4O6JA 1MGTA 1TQMA 5EGOB 1WSUA 3MFKA 1TL8A 3MCZA 2QF7A 2VQCA 3RPUA 2CFOA 3BJOA 3KEYA 4ON0A 2Y31A 4C3HJ 4IRGA 4XR6A 2R5ZA 1IV8A 3CMYA 1HSJA 4GFKA 5D19A 2L54A 2P5LC 1R5GA 5CXIA 1MBEA 3F6VA 4A3IJ 1T39A 3DBRB 3BROA 1V55H 3ABLH 2DK8A 1RR7A 2UXNA 2X6OA 2F48A 3GLXA 3S1MJ 4FISA 1OYWA 2BVLA 5F27A 4A0YA 3VDXA 2J5PA 2RHAA 5KHDA 2KHMA 1MBGA 3CP2A 3H1CA 1K4TA 2VB6A 1GVJA 3Q9VA 2UXIA 1KGSA 2TDXA 1GVDA 3D5RC 4D0PA 4II2A 2LH9A 3LA7A 5ICCA 3DV8A 4PDKA 2IP2A 5FKLA 2ID6A 4M6YA 5C3EJ 2EK5A 4EJWA 3VOEA 4CCLA 4FX0A 3JRGA 2V1DA 3RKYA 5JLXA 3C2BA 1K79A 2F5DA 2DMPA 1UHWA 5HDGA 2ZOYA 2RDPA 3HSEA 3I5UA 3LAJA 4BU2A 5C44J 4M9SA 4MQ9F 1CGPA 1TWFJ 4RGRA 4ASNA 5ILUA 4OMYA 2PBIA 3FK7A 1P92A 3WGHA 4HPQA 4U9NA 4E7ZA 2LBFB 3TMOA 2L9RA 1DU6A 1W5SA 4CXFA 4I2OA 1Y1VJ 3KP5A 1WQ2A 3FDYA 5K58A 3GTOJ 4AVZA 5E3LA 4P9UA 1YIJI 1TNTA 3JRHA 3QODA 4JL3A 2EV6A 4F93B 5FMPA 9ANTA 3AG3H 4WF2A 5KVRA 4YFNF 2JWTA 1VQLI 3EDPA 2QSHX 2GUHA 1WKMA 1YYVA 5C4JJ 2HVSA 2RV8A 1FX7A 1FWZA 1X1PA 4I0BA 1X2MA 4G8XA 4LG0A 1Z91A 3CDLA 2Y2ZA 3E3VA 2ISYA 1ZGAA 2DMUA 3WTTC 3CC7I 3F9KA 2ELJA 1ETOA 1WJDA 4ZZLA 1BC8C 4QTRA 3PM1A 3G1MA 1Z77A 2MBFA 3HKZN 2GLOA 1QVUA 3FX3A 1UAAA 5KK1A 5L3BA 4NHJA 5EFYA 2GM4A 1ULYA 5DYMA 3CUQA 5HAWA 1ZGWA 3MD2A 3T8TA 4DYRA 1U8RA 1JXSA 2EIMH 5DV5A 3GVAA 3GEUA 1VQ7I 3CCRI 4P55A 3SWHA 3D5SC 4M3BA 5EZGA 4G6TB 2IVMA 3U21A 3HTIA 2OD5A 2GOMA 3CQZJ 2O7TA 3RI4A 2ZY9A 2ELHA 2YX7A 3AL0B 4EM0B 1V5FA 1OMIA 2KIMA 4DGWB 2OF7A 4OMZA 3KYLA 1TLHB 3R4KA 2HR3A 4BY1J 3MQ0A 5D4RA 3IRRA 3DU5A 2DAOA 2XKPA 3ZOBA 4GRIA 1KU7A 2XAQA 3TP0A 3C7JA 4RDUA 3P5JA 1LNWA 1QZZA 3NEUA 3I56I 2OBPA 2EQRA 1TTYA 4NB5A 2Y0SN 3OIPA 1MMGA 4P5OA 4O3MA 1P4AA 4XM3A 1SVMA 2XSJC 4HDUA 1KQ9A 2MC3A 3R61A 1SVLA 2IBDA 1JKQC 1BOBA 3ELKA 3HOVJ 3CD6I 3NI7A 2LY1A 4RGUA 4AYBA 4DZPA 2IJLA 2A07F 3KZYA 2FXAA 3KP6A 5GAGJ 4N9IA 1K6OA 1J09A 3ON2A 4BQAA 2Q0OA 4J19A 5CQGA 2R7DA 3HBLA 2PFVA 4N4NB 1YHQI 4KITB 4A3MJ 2HGCA 4A5MA 1FOKA 3GTQJ 2BOLA 3FXUA 1SANA 4HNVA 4E7KA 1LKXA 1YRNA 2FRHA 1XSVA 1MDMA 3E5QA 2X1EA 2VL8A 4I0AA 1IUYA 4LFUA 4CCNA 2XHKA 5HS7A 3FKIJ 3MVPA 2BE5F 3I71A 3M3YJ 2CU7A 4MNUA 1FBSA 4RGXA 2STWA 1HLVA 1HOMA 2BY1A 3FF5A 2LVSA 2WWYA 1AHDP 5CJ9A 3I55I 1P7JA 3H35A 3MZ8A 4AUXA 1J9IA 4BJ5C 5D4SA 2QZ8A 2H1LA 3WHBA 3QPHA 2KIQA 1QHHD 3P9KA 5BQTA 3VUQA 4PSWA 4B4CA 2VC1A 2JUCA 3FXLA 2FUG2 4BDZA 3I59B 4RM2A 2NP3A 4C9YA 1YLFA 2P5VA 3OY9A 5E17F 4JX6A 2COBA 2O3FA 2XPUA 2DA5A 3EUKL 1K4SA 1ZHFA 5ICEA 1MH4A 4EV0A 4V2GA 2H8RA 5DAJA 3LSMA 2MGQA 3MNLA 2W4SA 5FGMA 2RGVA 2WY8Q 3DWLE 2RNJA 4BXUA 1D1AA 3RPUD 4CH7A 2BEOA 2WY7Q 4DOZA 1A6QA 5ILVA 3VP5A 2W25A 3VYTB 4JX4A 1OYIA 2RVCA 2X6YA 4CUGA 1RIOH 2F5CA 3RSNA 3O60A 3GTGJ 2LP0A 2VQHA 5DCMB 4E7LA 4UUVA 1YE9A 1TNSA 1XC5A 4P96A 1CF7A 4F52A 3HE0A 2Z3YA 5FKMA 2VQGA 1VQ5I 4ZYGA 2QYOA 3FMSA 4AD9A 3I3LA 2FNPA 3QRFF 2JK3A 1SD6A 1U8BA 2A2FX 4QWQA 4UDSA 2AQEA 2GA2A 5FRNA 3TDZC 5CKTA 4P9FA 1B8IA 1G3TA 2RKHA 2R7QA 2P8TA 5M5YJ 5LD2C 2GXGA 1E0EA 4I99C 4AWXB 5J4YA 3GZ5A 4RLQA 2R5ZB 4ZTJA 2XRNA 4IVNA 2KJCA 2R4GA 4XQFA 1YOVB 4CGRA 2P4WA 4L5EA 4FTHA 2DT7B 1FSHA 4E7IA 2IU5A 4C2TA 1U0JA 1F5TA 4X1EA 2EV5A 4YG2F 2DA1A 3PNVA 2PJPA 4RMNA 2NS8A 1BR2A 2V79A 4YFXF 1QBJA 1O7LA 3JREA 1BM9A 2ZFUA 4HOBA 4IO9F 2HDWA 5JR3A 4HLXA 5KAFC 2RNGA 1BA5A 1GHCA 1F1ZA 1IDZA 2W53A 4ZC3A 3GXOA 3TL4X 2R7WA 5CVIA 2CQKA 4HG2A 4EEFG 4S0HB 3F8BA 1WI9A 2FD5A 5LEJA 2LK2A 3WU2C 3SQNA 2HTJA 3NWSA 1SFOJ 2VT3A 4HSRA 5H2FC 1JI8A 2Y9ZA 5E3MA 4YIRX 3RH2A 4YIFA 2W24A 1G8XA 3KPHA 4YFKF 4HNTA 4L9JA 4BJ6C 2KIFA 5HNHA 4OIOF 3PSFA 3QPSA 4B3XA 2K40A 2KJBA 2KRCA 1O3RA 3BCAA 1AOYA 2KT0A 1ZN2A 2ECCA 2PEXA 3SHFA 2L5QA 3ZQGA 1FTTA 4UB8C 3TKYA 4IF4A 3RKQA 3C2HA 4XKVA 3KP7A 3A0BC 4LB5A 5EJCA 4U0YA 4ANJA 1Q1HA 3S1NJ 1UMQA 2DOEA 1SAUA 3F1BA 5FLVA 1WRJA 2ZMEC 4MFEA 1E2XA 1OCTC 1TT0A 1X1BA 2NRAC 4W97A 4C30A 1IN8A 3I58A 4B1RA 3ZP5A 3QBMA 2GIZA 2F5EA 3SZGA 3Q0WA 4Z6YA 2MSYA 3OR1C 3S2WA 2D1VA 1WZ2A 1T8IA 4F7ZA 2O5RA 3MZYA 4LG0B 4AU7A 3K70D 2IA0A 1JT6A 2YVHA 2ZXWH 4NC6A 1XGNA 1G6NA 3RYPA 4EATA 2QVOA 3GEZA 3TBIA 2HFHA 2UXUA 2DA7A 3BTIA 2XB0X 1JGSA 3S3MA 3OYJA 3PQKA 3KEOA 1H88C 3GZIA 3BTJA 1Y1WJ 1VI0A 2DA4A 1WJAA 4B8XA 3Q0VA 2HWVA 3CUQB 3RDIA 5IP9J 4KWAA 5FRMA 5IY5H 3DKYA 1Y0UA 1SVOA 5HLTA 1XTAA 2JTVA 3CF2A 2W1OA 3GBGA 2DU9A 2VOOA 3V7CA 5FFZA 4B09A 1ZKGA 3DPLC 2XSDC 5J47A 1ORKA 3C18A 5C4YA 1MBFA 2MH2A 2Y69H 3L2VA 3DLLF 4NC7A 3J7YJ 2DT5A 3SDBA 5GAEJ 2BY3A 2OCEA 3E5XA 5H6RA 4MHGA 3KZIC 4ENKA 2V4JC 1LDKB 4F92B 1HSTA 4XNFA 1N78A 1IN4A 3K6GA 4I6ZA 2F4MB 2XAHA 2QBYA 5F1JA 4PSXA 5E79C 2K9LA 3CO6C 3S5RA 4XORA 1BJZA 2E1MB 3K0LA 2GOXB 2WV0A 3G4SI 3G73A 4RB2C 2CW0F 4HRIA 3ZQFA 1W5CC 3OIOA 4L5JA 4BAYA 5M3MJ 1S3JA 1E17A 3BR5A 1QZEA 3WTYC 2ZJPF 2Z16A 2XB5A 1PYVA 2FJ1A 2YU3A 3MAJA 2FQ4A 2Z2SB 2UXHA 2XPWA 2CV2A 4PJLA 4XKWA 1OCRH 2P6TA 4PFOA 4X6AJ 2IAIA 1YRNB 4OINF 2V1NA 4LOCA 4BGDA 2ECBA 4ZYHA 5CLSA 1MDMB 3LOCA 4MEYF 3OS1A 3SDGA 5J8FA 2E5ZA 2JN6A 1QZYA 2X0LA 1PDNC 2R7FA 3W2VA 3DKWA 1DQUA 2VKEA 3G7RA 4KNYA 2KZVA 2L0KA 1B72A 2ESHA 2H1KA 1I6HJ 2W85A 2DDAA 2DTRA 2XRLA 4UUSA 1R58A 3AG4H 3OWTA 3S2DJ 1VNDA 4U88A 1R49A 3OIQA 5K7HA 4DNCA 4BBRJ 1YJNI 4OIRF 4I02A 4S05A 4K2EA 4DVYP 3GW2A 2DFFA 1WH5A 4FE7A 3PNYA 1H9TA 4M71A 1KONA 3F0CA 2JPCA 2L7ZA 2LMDA 1LUJB 3A0HC 4ENJA 3P7NA 3OOPA 1A04A 2VLAA 5EF6A 2GA1A 2O9LA 3BNIA 2Q8KA 2NVQJ 3HRUA 1XMAA 5IOZA 5M5WJ 2STTA 4JOMA 3LFKA 1TP4A 3F6OA 3HIFA 4U87A 4EJOA 5IP6A 1QU3A 5EEGA 1ITYA 4RS8A 1YIOA 3EQLF 3LNQA 1YQAA 3LWFA 1MMDA 2RQQA 3P9TA 1RKTA 2VUMJ 3CF5F 2LF8A 2DJIA 2R7VA 2CQNA 2DFEA 2CS3A 2ELKA 1RI7A 2BHYA 2HQNA 5JI6A 3H0DA 4LITA 3LJLA 1IUFA 1TW3A 2LKXA 1BJAA 2PMHA 5GPCA 2ACJA 1I5ZA 2VKVA 3MKLA 5CYVA 3V6GA 3REOA 1UG0A 1KYWA 4HLYA 3ANPA 4EMSA 3Q9SA 5CVVA 1CF7B 1RNLA 3CCMI 4M9ZA 3DQVC 3RCOA 2FBQA 1HW5A 2PN6A 3HUGB 1HKSA 3FKJA 1SD7A 2KFDA 5D5XB 2DA3A 1S7EA 3NQOA 4GYIA 3H3VK 2E35A 1T08B 3K4JA 1ETYA 3FXJA 1B8IB 4J00A 2EILH 5CPRB 4OAZA 5HSZA 4UHTA 2LY9A 1FYLA 3RZOJ 2R7TA 2OV7A 2JA5J 1J5YA 5JVTA 3EPZA 3ROUA 4BXFA 5DDGA 4MFDA 4OAYA 2OUMA 4LG3A 4RBOA 2CUJA 2M8EA 3K4NA 1B59A 3LSGA 1X1DA 2K85A 2MH9A 3HTJA 4AIDA 2R92J 4QPQA 2JA2A 3PQJA 4KMUX 1VF9A 3CP8A 3Q3SA 2VBWA 3JSOA 3JAMK 4ABZA 3KLNA 1W36D 2JA8J 2EBIA 2LC2A 4XLAA 5L3CA 2ICWG 3DBLB 1I39A 3LA2A 1QO0D 1IC8A 2DG8A 2BV6A 4BEHA 3JR9A 3S1RJ 4M3FA 3SJMA 1Y8QB 3MKYB 2D45A 3AL0C 2VXDA 4ITVA 1IW7F 4JP0A 3WTVC 3DEWA 3L2CA 5DUIA 4A3LJ 3OL3A 1WFXA 4W1UA 4YIIA 4D7MA 2QKLB 3BTLA 2DBBA 3W6KB 3BZCA 5ICGA 1HW2A 5DM6F 5CQEA 5F0FA 4N4OB 2BVMA 3QYFA 1IXCA 1LJ9A 3CCVI 5IP7J 2HKXA 5FKNA 2Z99A 1E3OC 1ZRDA 1WVRA 1KU3A 4GCVA 2VJJA 2HYTA 3VVXA 2BXZA 1R71A 2QSGX 4OIPF 4L9TA 1FT9A 2LKPA 1K6YA 3SYTA 3I64A 1FTZA 5D18A 2DK5A 3R60A 3ULQB 3K2ZA 2VT2A 3HL2A 1UJ8A 3L2WA 1BIBA 2A6TA 4ZYDA 2D1HA 3B6CA 3CRJA 1T38A 3ZMDA 4A69C 1DPUA 2IS4A 4JX5A 3BZ6A 4ACIA 2HOEA 4GCKA 1UB9A 2PBXA 2X6XA 2HS5A 1ZQ3P 3G1OA 4DQ2A 3WTSC 4LLLA 1YJWI 5LRSA 5TGTA 4ENMA 1RR8C 1N77A 3HTUA 3E1SA 3KYCB 2LKSA 4E6KG 2R7UA 1O3TA 5B1BH 4F3QA 5F0HA 2K7LA 2XGXA 4PGHA 1ZRFA 1TC3C 1VQNI 2COMA 2IT0A 3OYMA 1B4AA 1XX5A 3ASNH 4YELA 1IN6A 1EKEA 1GT0C 2QQ8A 3ERMA 5B3SH 2D5VA 3NWTA 4CHUA 3PUBA 2VJ5A 4BJTA 1OCZH 4GCLA 1ETKA 1IV6A 5E3OA 4QIWN 1SFEA 3H92A 3KP2A 1G3WA 1IN7A 2M8GX 1ZRCA 2HDDA 1UI5A 1LFBA 3KCCA 3OYNA 5H9TA 1FOWA 1MBHA 1N25A 4L5IA 4DIQA 1B1BA 3HGYA 3ESWB 3HOTA 3DPJA 5EEAA 1T95A 2QBYB 5E8GA 4R1HA 1MNMC 3BR0A 2O03A 3HPGA 2DMQA 2P7CB 2FOWA 4CICA 1FIAA 2M7AA 3KYDB 3CCYA 2CSOA 2K27A 5FHPA 1IRXA 3A03A 3SFZA 2K9SA 2DW4A 2OPTA 3E6MA 3S14J 2JVGA 2W82A 2ZJ2A 2VOPA 1Z05A 3QKXA 2E60A 4MQVA 3SZPA 2RQPA 1BN5A 3VW2A 4XKBA 3CJDA 4IPAA 4R79A 4B44A 2DI3A 3HHHA 2D6YA 4V2FA 1QNTA 1U5TB 1ZYRF 3E6DA 4UV9A 3TQNA 3OYDA 1V3FA 1YX5A 5H6QA 4GO1A 3CLOA 1ZLJA 1MJBA 2E1OA 2F5VA 3VOKA 2M0CA 1K78A 1X1AA 3QU6A 3JTHA 3JRIA 3ZQQA 2UXOA 3VEPA 1B72B 1X3WB 1JT0A 1KZHA 4EQQA 2M30A 2Z5UA 3MWMA 4UUSB 4BE0A 1VQ8I 1T0FA 1RRJA 1T33A 2KKOA 3VFZA 4G7OF 3AKZA 1SD4A 1WJFA 1ETQA 5C4XJ 4EVIA 1RUNA 2KDOA 5J6XA 2NOJB 3OL4A 2XROA 2GWRA 1K61A 4IHXA 1AKHA 3GTJJ 3K4MA 3ZQCA 4IHVA 4OU0A 2BW3A 1TQPA 5E3NA 3L09A 4ZYEA 3L2QA 1JE8A 4YZEA 4M6XA 3U2RA 4ETSA 5M5XJ 1EH7A 3BC8A 4DBQA 4HQMA 2YPRA 1J0RA 4M9XA 1GXPA 2LSOA 4XONA 2TCTA 2X1CA 3CMAI 1HC8A 1X2NA 3DPTA 3T1BA 2WAQN 1YTYA 3DBHB 2DYRH 2OI8A 1PP7U 2R7ZJ 3GTPJ 4BS9A 3FBIB 4JK1X 1YO5C 2IA2A 2K9QA 3LSHA 1WGXA 3HHGA 1L3LA 2LFBA 3JRFA 5GTIC 1ACIA 2IW5A 4IRIA 3W2WA 2LG4A 1DP7P 5JLWA 2FNAA 1BI3A 1SMYF 1LDJA 3OSGA 3V7RA 1ETXA 2P5KA 1FOXA 4UNOA 1R6RA 2ZJRF 4H0EA 1QA6A 2M7BA 5IT9Z 3F21A 1T2KA 3K4CA 2D2WA 4OD5A 3PIPF 2DLLA 2NVYJ 4DBRA 4RB3C 1R36A 2IS2A 2G0EA 3DTEA 2NXNB 3S3NA 2CQ7A 2F4IA 2GZWA 2VKHA 1FLIA 1POGA 1HKTA 3O6BB 3ZMUA 4JKZA 4LK0F 3HZJA 3QYEA 1JHHA 5GADJ 2UZKA 2H6CA 4UXNA 4Y17A 1XSXA 4M72A 1XPXA 4FQGA 2OC6A 2HYGD 4Y4RA 1XGOA 4GFBA 4GDFA 1LFUP 3GFJA 3RD3A 2OQGA 5EYRA 2E34A 3GYHX 2JSPA 2E5NA 1APLC 1BW5A 4V19K 4ICHA 5LLQA 2KDZA 2R7XA 2V1XA 4I09A 3CUQC 2R0QC 2E7WA 3OYEA 2G7SA 3CMMA 3ZQHA 4IHWA 1BI2A 2CG4A 3KEQA 4JBAA 3ABMH 2I8DA 3DTKA 2Z33A 2BHZA 2ZXHA 4JNNA 4IXAA 1YX3A 1Z3XA 2MG4A 2EZKA 3JCUC 4MEXF 3K70C 1LEAA 3CJRB 4BUPA 4BEHB 2R93J 2R7OA 4RAZA 3HKZA 4CA0A 5FLMJ 3OYLA 2AHQA 2W7NA 1JJ8C 3ERED 2CQQA 2HZTA 5D5WB 4BY7J 3H0GJ 1VQKI 3I0TA 1Z6TA 3FZVA 2EFQA 2VODA 2GBYA 2JQ7A 3G1LA 2QIBA 2DCEA 4BQQA 1D5VA 3HPHA 1TZLA 2CYYA 5TRDA 5FD6A 3HXLA 2OAZA 1BR4A 5J3LA 2DA2A 5ILSA 3TOAA 2HDCA 2P6SA 2DOFA 5FFXA 4DYCA 2Q24A 3H5NA 3NNRA 2E1MC 2JT1A 3HUGA 3J7AO 2HEOA 1M1EB 1NG7A 3GLLA 2VPLA 2EA2A 4XRMA 4BBSJ 1FEXA 1I3AA 1MIJA 3S16J 2OTJI 3UR3C 1SFXA 3RYRA 4XLNF 1U78A 1LVAA 1R4NB 3MZHA 4YRVA 3K10A 5LFAA 2AXLA 3S17J 2Y0SA 5HOOA 1TW2A 3COLA 3FHZA 2REKA 5B1AH 3BR1A 5IT9K 1MNEA 3HSRA 2HXIA 4TV7A 1OR7A 3DKXA 4M6VA 5K7ZA 3Q5FA 4X0GA 4D7NA 1LDDA 1PP8F 4I98B 3KNWA 3DEEA 3S8PA 3NARA 2HYJA 4C2MA 2X85A 2VBXA 4M3DA 4CCOA 3U1DA 1Q1VA 2UUZA 1U9NA 2JPBA 2QQ9A 4A6DA 1MSEC 2QENA 3ZPLA 2EZHA 3H3ZA 4A3KJ 2KLOA 1QHGA 4XLFA 1GV5A 5J40A 2F5FA 1FYMA 3BTCA 2E2IJ 2V9PA 1P9QC 1X3ZB 4CYCA 1W1WE 2KISA 4J01A 3LL7A 4G7ZF 3GZNB 3NAUA 3WG9A 1FBUA 3H5RA 1Z21A 4PXIA 2XF5A 2JMWA 2GFNA 3EUHA 4WXCA 2QUFA 2ZCMA 1SAXA 3ZN0A 3V8LA 1Z67A 4G12A 1D5YA 2HU9A 3I4MJ 2CJJA 2WA0A 1WI3A 3GF2A 1HF0A 4CZZA 1O3QA 3BG5A 2E2JJ 1GV2A 2VBZA 2H09A 5EG0A 4LGWA 2IRFG 3ZXSA 1R5HA 5AONA 4RAYA 2FBHA 4M73A 4BHPA 1SC7A 3VW0A 1ETVA 2JVHA 2DT6A 2X51A 3WU0A 1OCPA 5HS8A 3GFIA 2XDNA 1ODDA 4IEJA 4D9JA 1VQ4I 1YS6A 3F8NA 2P0WA 1WCMJ 2MLGA 3LFUA 4OOIA 5KNLA 2XGCA 3HOWJ 5E1XA 3LSRA 4XOPA 4PFPA 3QP6A 4RAGA 1Y8RB 3HSFA 2UXXA 2X4HA 3ABKH 3VSLA 5D5VB 3HOYJ 2DG7A 1IJWC 3CDHA 4MLOA 4XK4A 2PX9A 1A36A 2M5WA 3LSIA 3H36A 3FISA 2LRDA 5HLGA 1S8NA 1SEUA 2BBYA 3H3UA 2GXBA 3TOBA 3F23A 3GZ6A 4S04A 2AS5F 1S6LA 2KP6A 5FLXK 2WBMA 3O8GA 1WJBA 2XVCA 1HDPA 1L0OC 3ONQA 1RKWA 4L62A 1DUXC 2MW8A 5LGNA 4BL0B 5E1WA 4RB0A 1A6IA 3SXYA 3K8PC 3AG1H 1LB2A 2FOKA 6PAXA 1OJLA 3CCUI 3W2AA 2V26A 4KIFA 1K78B 3DEUA 1V54H 1V5GA 3JRDA 3TO6A 1BI1A 3EUAA 4E4HA 2HVRA 3OYBA 3VB2A 3OYFA 2L01A 3RJPA 4A3GJ 2WUIA 3CCJI 3C1DA 1SFUA 2NX4A 5FO5A 2HQ5A 2K3FA 2Y48A 4CYDA 4A93J 3LQRA 3M4OJ 3JTGA 1FNNA 2EFNA 3VYUB 2K4JA 2XF6A 4LMYA 4HF0A 1AKHB 4IQJA 1QPMA 4BE1A 4KJZA 2GIVA 1FC3A 3IUOA 1K83J 1OFCX 2BW3B 2MFZA 2DPDA 5JVGF 2MD5A 1T6SA 5IYBJ 5HBUA 1J59A 2M4KA 3SEZA 5F08A 3AFHA 3T8RA 1JGGA 2WC2A 1SGMA 1R23A 2KIUA 2XAJA 1DGRM 4QPOA 2KPMA 1U9OA 2K4BA 5DUKA 1I6XA 3I4PA 4Y15A 2EJRA 4GYGA 1W36C 2K3PA 4HX7A 3ZRGA 5B66C 2E19A 2RASA 1WJEA 3GFMA 4A0XA 2L2OA 2VXZA 3G56A 2IGOA 5AIPA 1XB4A 3CDIA 3LAPA 1LEBA 4PJMA 3PO2J 3Q0UA 4HX4A 4CCKA 1MNDA 1G2HA 1U5TA 3ZQIA 3JAMZ 1ZH5A 1EA3A 2XV4S 2H8WA 2DA6A 4KN4X 5LGTA 2HI3A 1ZARA 1W0UA 1FIPA 4Y3OA 1I1SA 1TWAJ 2HTSA 1I27A 4NUBA 1H89C 4A6EA 2E1NA 4A3JJ 2VQLA 3IHUA 5TISC 5IT3A 3C07A 2EFOA 1HA8A 2LYCA 3EYYA 3GO5A 5AIQA 3HG9A 2BZTA 4MIMA 3H5AA 5DTDA 2ZXJA 4HAMA 2WB1N 4YEJA 4Y33A 5LEKA 4ESBA 4ZZDA 2M45A 1QQIA 1YW8A 4G6DA 4LIUA 2PMZN 3X2QH 3QWLA 2KQRA 3GTMJ 1HXDA 1B9MA 3S32A 4KMFA 3BCGA 5IPAA 3N97A 3HTSB 2X48A 3WGGA 2XPVA 2R7RA 2PJRA 2QSFX 4FETA 3RTRA 3CUOA 3VYRB 4JQFA 3T6NA 4U7BA 1NHAA 3FHNA 4AC0A 4A12A 1OYYA 2LR8A 2RN7A 3AQSA 3WTZA 1U3EM 2PQ8A 1F36A 3V8JA 3DPUA 4XOTA 3RPQA 3QQAA 1AA7A 3CJTB 1PUEE 2XIGA 3JRBA 4LK1F 4FE4A 4G6QA 1QPIA 2EPFA 4IX7A 2CW8A 2L9NA 3FMQA 3O8HA 3K1NA 4MK6A 1VQ9I 2A68F 5TJJA 5HNFA 2ETHA 2GAUA 3CC4I 2CUZA 4CDGA 3A4CA 4JYKA 3HRTA 4KT5C 3BG3A 1FOYA 3GMEA 1LFPA 1H9GA 2VASA 5D8LB 1QRYA 2LOOA 4I01A 3FXRA 1HKQA 5EZHA 4XBFA 1X3UA 1PUFA 3EYIA 4AC6A 3A02A 3FXOA 2R7SA 1IRZA 3NS4A 4EM2A 2O61A 5BS6A 1R4MB 2ZKZA 4MO7A 2O6GE 5HDKA 3TEDA 3DXJF 3FXKA 2QA4I 2XASA 1WPKA 4PUSA 4XLEA 1JUMA 1S5LC 4M74A 4WXHA 3BT9A 4L0ZB 4AM3A 3V7SA 2V9KA 1ZLKA 2NYXA 1XMXA 2V1UA 3TW7A 5BNGA 4UUTA 2M87A 2B63J 1U5TC 4XRSG 3CLQA 5K5RA 3VIBA 1JKPC 1I3QJ 2FF4A 1KU9A 5A2QK 2XUBA 2ZO4A 4G9YA 2A3SA 1G3SA 1ENHA 3J80K 2M9HA 4BDYA 2OTLI 1W7PA 1HCRA 3RZDJ 2HZDA 2FE3A 2IS1A 3HRMA 3B81A 2FU4A 4HDVA 3J7ZI 2OZ6A 3IL2A 2E71A 2V7FA 2PFBA 3WODF 2ZJQF 2OCCH 4PJJA 5F64A 2H94A 4CYCB 2CUEA 2Y30A 3N05A 4NBQA 3PPBA 1KA8A 1VFCA 1ZK8A 2EA4A 4IKFA 2ZSIB 2NAZA 2YR2A 3KE2A 3E7LA 3K9TA 2MYSA 1YITI 3DLAA 5M3FJ 4U9LA 4AF5A 2Q2EA 4XKCA 3EETA 1D8JA 2CQXA 2AXTC 3G2BA 2EZLA 1VQOI 3D5LA 5HLHA 1V4RA 1C0WA 2CV1A 2E1CA 4ZYAA 1IAWA 1IRFA 5EG0B 1ZAOA 2R3SA 2OZUA 2WTEA 2ZOZA 2W00A 3JRAA 3BG7A 2ZXIA 4BYYA 1S72I 3ISPA 4LLGF 1D8KA 4HZFA 2ESNA 3OYGA 1P4WA 5CVJA 3SEQA 1JUPA 3A01B 3B73A 3MEXA 5L3GA 3F3XA 1F4KA 5D5UB 2XC7A 1REPC 2UV1A 1D0ZA 1QGPA 3C2GA 2LTPA 4XL9A 5F1RA 5LHHA 3PNTA 2VKDA 5E20A 1R1TA 3C3WA 3JW4A 2W57A 3BDDA 4WK8F 2RAEA 2A5YB 2VE9A 4HX8A 3UKGA 3KZ9A 4QSHA 3WE3A 3OYIA 3L7WA 1EH6A 3FBNB 2K02A 4XLCA 5F04A 3KETA 3TP3A 2PG4A 2J5OA 3DFGA 1RC9A 1UG2A 3N4MA 1OPCA 2G7GA 2WAEA 1ZG1A 4O5VA 1MMSA 3PL8A 2QWTA 1XDSA 4RB1A 1OLTA 3QPLA 4AYBN 3M1EA 1I1GA 2RREA 3ZMVA 2CRGA 2G7HA 2YSRA 1QVTA 2V6CA 1JTYA 2FQ3A 1X58A 4GXOA 4IQ4A 4HA8A 3WHCA 1FY7A 4A5NA 1MMNA 1Z6RA 2Z1DA 4AVPA 3AQTA 1TWCJ 3E0JB 2DMTA 4UVCA 2NVTJ 1BW6A 3MKWB 3L00A 3IV5A 1J2XA 4M3GA 3OSFA 4WCGA 2YVEA 1Y56A 2M34A 2E7XA 4WXDA 4DJAA 5L3DA 3ML6A 3UNGC 2IGNA 3CCEI 4KT6A 2ISZA 1E3PA 4U7DA 3I53A 1FYKA 3OYCA 2M0MA 4KFCA 4I7HA 4CO8A 5D1RA 1G3YA 4HSTA 3PUFA 2JUGA 4Y7NJ 3HOZJ 4KIGA 4F91B 1TT5B 1Y6IA 3CCSI 4FASD 4LLNA 1IGNA 1BR1A 2M4GA 3VYSB 3FM5A 2YS9A 4XRFA 2FX0A 3BZKA 4FT8A 2IGMA 4RLFA 1FJLA 2VONA 4NNJA 3LHQA 3U9GA 3BG6A 3GTKJ 5FGLA 4HV6A 3PFYA 1XMKA 1UCRA 1VZ0A 3F8CA 1XDUA 1VQ6I 3GTLJ 1UZCA 4PK4A 1Z3YA 4N9HA 1U6GA 4E7JA 2G9WA 1S9HA 1R22A 2DOAA 2IEKA 3IP4B 2A69F 1UI6A 4IJAA 2ZSHB 4G94A 4HYEA 4ZDOA 1MKMA 3TO9A 5LGUA 4C3IJ 3DCFA 2PMUA 1FMVA 2UXPA 4E70A 1TWHJ 4NELA 4AIHA 3J81K 3ZQLA 3ZMSA 2GXAA 5KCMA 3SFIA 2A61A 1KQ0A 1EF4A 1P4XA 4U0WA 3F8MA 3IAS2 3EGQA 3HEFA 3F22A 3BPXA 1MBJA 1N75A 4CZCA 3BQYA 3KLOA 2XGDA 1HBXG 2ZCWA 3FM3A 1HDDC 2A5WA 2JZYA 2OQRA 2E2HJ 3BRUA 5KAIC 1USSA 2IXSA 4WX9A 3HGGA 3ABUA 3HOXJ 2K86A 4C3JJ 4EJVA 2BYVE 5BOXA 3IRQA 3NRVA 1O57A 2L7FP 2KZGA 2QCOA 3T0YA 1YI2I 4HF1A 1S7AA 2PJRB 4BXXJ 3NXCA 4IHSA 3IH2A 3KIOA 1BC7C 4MTEA 3S1QJ 1YW9A 4PJNA 2XAFA 3GWZA 3RKXA 5FJ8J 2CO5A 2Y0MA 3ECOA 2IS6A 2L7KA 2RC4A 1FP2A 3CZ6A 2VE8A 2JJ7A 5CVUA 3KP4A 4L9NA 4IZZA 4OIQF 2QQBA 3K69A 2M2EA 1LQ1A 4BH9A 3VVYA 2XKOA 3MKZA 1K7AA 5JFRA 2EFPA 3J7AY 1VQMI 5FD5A 2XDVA 2ME0A 1I50J 1R5ID 1KYZA 3I54A 5HODA 4ZTFA 2QLZA 1G4DA 3HTHA 5FKOA 3QPTA 1Y39A 3L2UA 4HEA2 3WG7H 1V5EA 2KRFA 4B3AA 1E3HA 1PUFB 2QGUA 3K1MA 4CGZA 1SFKA 2EB7A 1WJCA 2CUFA 3IAM2 4ME9A 1Z7LA 3AG2H 1XCBA 1IG7A 1W7PD 3DTIA 3M1CA 4B47A 3TGNA 1XGMA 2NNNA 4UVBA 3W3CA 2QWWA 1XD7A 2XGEA 2YU9J 4KYWA 3S15J 3CTAA 3OOUA 3JSJA 4A3FJ 1RETA 3S93A 3ZR8X 2E36A 2HOSA 2OJED 5D6EA 3S3OA 2A05A 4C2MJ 2ZNYA 5BPDA 4A2UA 5JHFA 2EINH 2MLKA 3H9GA 4R8HA 2GENA 2WGBA 3GX4X 2QKOA 3HOSA 5HDNA 5D6FA 3LMMA 4C2UA 1W7PB 3COAC 4DYQA 3K1PA 1T0FC 3B6AA 4E7SA 5B5EC 4L9VA 4EJTA 2ZC2A 1IDYA 3K7AJ 1VTNC 1P6RA 1ZGJA 2KMUA 3NRGA 1D1CA 1TQIA 4ZDPA 3ZMTA 4UVAA 5GP9A 1NG6A 5J8CA 4XLPF 4XN3A 2ZFWA 4Q48A 3BG9A 3IKTA 4ESJA 1NH3A 3M7GA 5IYCJ 4UY8I 3RIRA 2ZMEA 4AIKA 3HYIA 1BL0A 2K5CA 1DDNA 2Q2EB 1WH7A 3OYKA 2A6EF 2XAUA 3IH4A 1JKOC 2C6YA 1LE8A 5EDNA 4AIJA 2VBYA 2EH3A 3HJEA 5FLXZ 1PJRA 1XCVA 2VJIA 3ZN1A 4LIVA 1USTA 4A0ZA 2ZCNA 3CWRA 3HB9A 3L9FA 1O7FA 1ERDA 1G59A 3HM5A 3VVZA 4DZJA 3CCLI 2JRTA 2B0LA 3M8JA 1RESA 4B43A 4XLHA 3A2KA 3IH3A 1WWXA 4KA4A 2X6WA 1IO2A 2BXYA 1RUOA 4HF2A 5K1YA 1FP1D 3P9CA 4WIBA 1W0TA 1DU0A 3BJBA 1D1BA 2YX4A 4Y13A 3IUVA 1X1CA 1ONVA 4CCMA 2VPRA 3HRSA 2MC4A 2V57A 3K2AA 2CWEA 2WAQA 4H4KC 4UV8A 1OCCH 5E18F 4XSXF 4IHYA 1OISA 3E97A 2B1EA 2FSWA 3KZZA
chains in the Genus database with same CATH topology
3KKCA 1G2HA 2HYTA 2QTQA 3VVXA 3ZQIA 4BY1J 1RPWA 4HKUA 2HOAA 2DA6A 3BHQA 3ZOBA 4A3CJ 2HI3A 2DJNA 3KKDA 1ETWA 3TP0A 2YUSA 1FIPA 4RDUA 1W0UA 1FTZA 5D18A 1TWAJ 2HKUA 2EQRA 1H89C 2Y0SN 2VI6A 4A3JJ 3C07A 2R5YA 3PO3J 1JUSA 4MIMA 5DTDA 3B6CA 3CRJA 2IBDA 2WB1N 4A69C 1JKQC 1NTCA 4JX5A 3HOUJ 3HOVJ 4ACIA 3NI7A 4GCKA 4DZPA 2PMZN 3E7QA 3ON2A 4J19A 3HBLA 3GTMJ 2PBXA 2HOTA 4A3MJ 3GTQJ 1ZQ3P 1SANA 4HNVA 3L1PA 3G1OA 3BCGA 5IPAA 1ZR2A 1YRNA 3VPRA 2X48A 5J1YA 2XPVA 5F0HA 3FKIJ 3LWJA 3MVPA 3M3YJ 3A01A 2PZ9A 3T6NA 2CU7A 1TC3C 1XS9A 1ZR4A 1HLVA 3EUPA 3W6VA 4GCTA 4AC0A 2LR8A 1HOMA 5EGOA 5CW8A 1GT0C 2D5VA 3AQSA 2LVSA 1F36A 3JRCA 1AHDP 5IYDJ 3QQAA 1P7JA 2NOGA 4AUXA 3JRBA 2ZB9A 4FE4A 4GCLA 1QPIA 1ETKA 1IV6A 5E3OA 4XIDA 3WHBA 4QIWN 3VUQA 3O8HA 1GUUA 4A3EJ 2M8GX 4B4CA 4MK6A 4D5CA 5CXGA 2HDDA 1XG1A 1UI5A 1LFBA 4JYKA 3BG3A 5H9TA 1MBHA 2NP3A 1QRYA 3HGYA 3MN2A 5EZHA 3DPJA 1PUFA 4AC6A 3A02A 1JTXA 3FIWA 5EEAA 1IRZA 1H8AC 1MNMC 4JX6A 3BR0A 4MO7A 3TEDA 2DMQA 2O7OA 3ON4A 2COBA 1FIAA 2XPUA 1WPKA 2DA5A 4Y52J 1JUMA 3CCYA 4DW6A 1MH4A 5FHPA 3A03A 5GPAA 3BT9A 4V2GA 2H8RA 5DAJA 2MGQA 2K9SA 3MNLA 3BR3A 2OPTA 4FCYA 3S14J 2DTZA 3QKXA 3TW7A 5BNGA 3VP5A 4UUTA 2B63J 4JX4A 2W48A 4XRSG 3BR6A 3O60A 4D5FA 3GTGJ 1JKPC 2LP0A 3VIBA 1I3QJ 3VW2A 3CJDA 3VOXA 2D6YA 1XC5A 4V2FA 1ENHA 2M9HA 3HE0A 5FKMA 1HCRA 2LD5A 3RZDJ 3B81A 2E1OA 1MSFC 3VOKA 2JK3A 2M0CA 2DN0A 1U8BA 2UXOA 3JRIA 1B72B 1JT0A 4CYCB 3NPIA 2CUEA 2Y30A 3PPBA 4UDSA 2NP5A 3FRQA 2X9DA 4UUSB 1VFCA 1ZK8A 1T33A 1B8IA 5M5YJ 3E7LA 3HDDA 1ETQA 5C4XJ 5M3FJ 2R5ZB 3D1NI 4AF5A 2CQXA 1K61A 2EZLA 4CGRA 1UHSA 2EZIA 4L5EA 4IHXA 4FTHA 2JA6J 1AKHA 3GTJJ 1T56A 2IU5A 3ZQCA 4IHVA 4X1EA 1R9TJ 2DA1A 2NS7A 5EG0B 2NS8A 5E3NA 3JREA 4GFLA 1NK2P 1BA5A 1IDZA 2W53A 4YZEA 2ME6A 2ZOZA 3JRAA 5M5XJ 4MXMA 1ZTRA 4EEFG 4S0HB 2FD5A 2LK2A 2TCTA 1X2NA 1SFOJ 1JUPA 3A01B 2WAQN 2Y9ZA 2OI8A 3LSPA 2ID3A 5F0CA 3GTPJ 5E3MA 2R7ZJ 3RH2A 2K9QA 2LTPA 1WGXA 2LFBA 3JRFA 2RAEA 5JLWA 3QPSA 3S2HJ 2K40A 2O8KA 3OSGA 3UKGA 1ETXA 3KZ9A 2HXOA 4QSHA 2KT0A 1F43A 2ECCA 3ZQGA 4A3BJ 1GDTA 1FTTA 3RKQA 5F04A 2I10A 2NVXJ 3TP3A 2NVYJ 1P7IA 1UG2A 2G7GA 3S1NJ 3V78A 1UMQA 2G0EA 1O4XA 3VW1A 3F1BA 5FLVA 4MFEA 1OCTC 2QWTA 4NN1A 1POGA 4W97A 3ANGA 5J1RA 4JKZA 3QPLA 4AYBN 4B1RA 3QBMA 2CRGA 1QVTA 4XRSA 1A5JA 3Q0WA 1JTYA 1X58A 2MSYA 3WHCA 4GFBA 1LFUP 3AQTA 1TWCJ 3RD3A 2DMTA 2NVTJ 5EYRA 1BW6A 3IV5A 4BKXA 3RQIA 1LE8B 4M3GA 1JT6A 1APLC 2YVHA 3OSFA 1BW5A 4ICHA 2YVEA 2M34A 2KDZA 5K7FA 2R0QC 2UXUA 3BR2A 2DA7A 2G7SA 3BTIA 2XB0X 3ZQHA 4IHWA 2L7MP 1H88C 3GZIA 1TWGJ 3BTJA 1Y1WJ 4JNNA 2AO9A 1VI0A 2DA4A 2MG4A 2EZKA 3Q0VA 3I4NJ 2R93J 5IP9J 4KWAA 5J1UA 3FK6A 5D1RA 5FLMJ 4Y7NJ 2AHQA 3HOZJ 1Z0XA 1JJ8C 1IGNA 2CQQA 4BY7J 3H0GJ 5AQCA 3GBGA 3LSJA 1JJ6C 2YS9A 1ZKGA 2XSDC 2FX0A 1NK3P 1ORKA 3TW6A 1FJLA 5C4YA 2GBYA 2G7LA 1MBFA 3G1LA 2QIBA 3LHQA 3GTKJ 5FGLA 2QOPA 5J3LA 2DA2A 1MH3A 3GTLJ 4DYCA 5DS9A 5FKKA 1CQTA 2JA7J 4A3DJ 2Q24A 2LLKA 3NNRA 2IEKA 1AU7A 2G3BA 2DMNA 1UI6A 4I6ZA 4C3IJ 4XRMA 4BBSJ 1FEXA 3DCFA 5F1JA 2P81A 3S16J 2UXPA 1TWHJ 2TRTA 4NELA 3S5RA 1BJZA 4I76A 3ZQLA 3HTAA 1U78A 2Y9YA 3SFIA 3ZQFA 2R5YB 1JKRC 1EF4A 3OIOA 3BQZA 3EGQA 3HEFA 1MBKA 3S17J 1MBJA 5M3MJ 3BQYA 3COLA 2REKA 2K9NA 4NDLA 3BR5A 2XGDA 1HDDC 2XB5A 3BR1A 2FJ1A 2HXIA 2FQ4A 2E2HJ 2UXHA 2N8GA 2XPWA 4M6VA 3BRUA 5K7ZA 3HGGA 2ZCXA 5IOYA 4D7NA 3HOXJ 4X6AJ 2IAIA 1YRNB 4C3JJ 2OERA 4LOCA 3KNWA 2ECBA 3NARA 2HYJA 3HIMA 2L7FP 3LOCA 4M3DA 2QCOA 3SDGA 2WV1A 1Q1VA 2JN6A 1U9NA 1MSEC 4BXXJ 3PASA 3NXCA 2EZHA 2F07A 4M3EA 4A3KJ 3IH2A 1GV5A 2VKEA 3BTCA 4XICA 2E2IJ 3S1QJ 5FJ8J 3G7RA 2L0KA 1B72A 5EGOB 4CYCA 2H1KA 1I6HJ 2QF7A 4UUSA 2XRLA 3S2DJ 3NAUA 2JJ7A 2Y31A 1VNDA 4PXIA 5K7HA 2JMWA 4BBRJ 4C3HJ 2GFNA 2M2EA 2R5ZA 2ZCMA 4G12A 3CMYA 1D5YA 3VVYA 4FE7A 1WH5A 3I4MJ 2CJJA 4GFKA 5D19A 1WI3A 1HF0A 3F0CA 5CXIA 1MBEA 4A3IJ 2L7ZA 1I50J 2ME0A 5HODA 3BG5A 2E2JJ 1GV2A 1RR7A 3HTHA 5EF6A 5EG0A 2X6OA 5FKOA 3S1MJ 2O9LA 4FISA 3BNIA 2NVQJ 3VW0A 5M5WJ 5F27A 1ETVA 5IOZA 4B3AA 1OCPA 1PUFB 2XDNA 2RHAA 4IEJA 1MBGA 5IP6A 1ITYA 2CUFA 1WCMJ 4ME9A 2XGCA 3LNQA 3HOWJ 2UXIA 1GVDA 3LSRA 1IG7A 5FKLA 3HOYJ 5C3EJ 1RKTA 2ID6A 2VUMJ 1IJWC 2DG7A 3P9TA 4MLOA 4XK4A 2ELKA 2XGEA 3JRGA 5JLXA 3C2BA 3FISA 2YU9J 2DMPA 3S15J 2ZOYA 3LJLA 3OOUA 1IUFA 3JSJA 4A3FJ 1RETA 5GPCA 2LKXA 3V6GA 2VKVA 3MKLA 2HOSA 5C44J 4C2MJ 1TWFJ 3O8GA 2GENA 1HDPA 3FK7A 2WGBA 3ANPA 2QKOA 1RKWA 4L62A 1DU6A 2L9RA 2MW8A 1A6IA 1Y1VJ 4DYQA 2FBQA 3B6AA 5K58A 3GTOJ 1IDYA 1OJLA 3K7AJ 5E3LA 3JRHA 3NRGA 2DA3A 3JRDA 1S7EA 4JL3A 5FMPA 5GP9A 3H3VK 9ANTA 4A3GJ 1ETYA 3BG9A 1B8IB 2NX4A 2WUIA 2JWTA 5IYCJ 2HQ5A 5HSZA 2GUHA 5C4JJ 2LY9A 3RZOJ 1BL0A 4A93J 3M4OJ 1WH7A 2JA5J 1X2MA 3CDLA 3IH4A 2Y2ZA 4MFDA 4RBOA 1JKOC 1LE8A 5EDNA 1AKHB 2DMUA 3LSGA 3HTJA 2EH3A 2R92J 1K83J 1ETOA 1OFCX 1VF9A 3Q3SA 2ZCNA 3CWRA 3HB9A 4QTRA 4ABZA 3HM5A 3PM1A 3HKZN 3G1MA 1Z77A 3VVZA 4DZJA 1QVUA 5IYBJ 2GLOA 5HBUA 2JA8J 2EBIA 5F08A 5EFYA 1RESA 1JGGA 2GM4A 1IC8A 2DG8A 3IH3A 1SGMA 5HAWA 1ZGWA 3JR9A 3S1RJ 4M3FA 3SJMA 4DYRA 1W0TA 1DU0A 3BJBA 3GEUA 1U9OA 4JP0A 3DEWA 3IUVA 4A3LJ 4W1UA 4M3BA 5EZGA 4D7MA 3BTLA 2RASA 2E19A 3HTIA 2VPRA 3CQZJ 2O7TA 2V57A 3K2AA 5F0FA 3G56A 4IHYA 2OF7A 5IP7J 5FKNA 1E3OC 3PO2J 3Q0UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KKC A;  1G2H A;  2HYT A;  2QTQ A;  3VVX A;  3ZQI A;  4BY1 J;  1RPW A;  4HKU A;  2HOA A;  2DA6 A;  3BHQ A;  3ZOB A;  4A3C J;  2HI3 A;  2DJN A;  3KKD A;  1ETW A;  3TP0 A;  2YUS A;  1FIP A;  4RDU A;  1W0U A;  1FTZ A;  5D18 A;  1TWA J;  2HKU A;  2EQR A;  1H89 C;  2Y0S N;  2VI6 A;  4A3J J;  3C07 A;  2R5Y A;  3PO3 J;  1JUS A;  4MIM A;  5DTD A;  3B6C A;  3CRJ A;  2IBD A;  2WB1 N;  4A69 C;  1JKQ C;  1NTC A;  4JX5 A;  3HOU J;  3HOV J;  4ACI A;  3NI7 A;  4GCK A;  4DZP A;  2PMZ N;  3E7Q A;  3ON2 A;  4J19 A;  3HBL A;  3GTM J;  2PBX A;  2HOT A;  4A3M J;  3GTQ J;  1ZQ3 P;  1SAN A;  4HNV A;  3L1P A;  3G1O A;  3BCG A;  5IPA A;  1ZR2 A;  1YRN A;  3VPR A;  2X48 A;  5J1Y A;  2XPV A;  5F0H A;  3FKI J;  3LWJ A;  3MVP A;  3M3Y J;  3A01 A;  2PZ9 A;  3T6N A;  2CU7 A;  1TC3 C;  1XS9 A;  1ZR4 A;  1HLV A;  3EUP A;  3W6V A;  4GCT A;  4AC0 A;  2LR8 A;  1HOM A;  5EGO A;  5CW8 A;  1GT0 C;  2D5V A;  3AQS A;  2LVS A;  1F36 A;  3JRC A;  1AHD P;  5IYD J;  3QQA A;  1P7J A;  2NOG A;  4AUX A;  3JRB A;  2ZB9 A;  4FE4 A;  4GCL A;  1QPI A;  1ETK A;  1IV6 A;  5E3O A;  4XID A;  3WHB A;  4QIW N;  3VUQ A;  3O8H A;  1GUU A;  4A3E J;  2M8G X;  4B4C A;  4MK6 A;  4D5C A;  5CXG A;  2HDD A;  1XG1 A;  1UI5 A;  1LFB A;  4JYK A;  3BG3 A;  5H9T A;  1MBH A;  2NP3 A;  1QRY A;  3HGY A;  3MN2 A;  5EZH A;  3DPJ A;  1PUF A;  4AC6 A;  3A02 A;  1JTX A;  3FIW A;  5EEA A;  1IRZ A;  1H8A C;  1MNM C;  4JX6 A;  3BR0 A;  4MO7 A;  3TED A;  2DMQ A;  2O7O A;  3ON4 A;  2COB A;  1FIA A;  2XPU A;  1WPK A;  2DA5 A;  4Y52 J;  1JUM A;  3CCY A;  4DW6 A;  1MH4 A;  5FHP A;  3A03 A;  5GPA A;  3BT9 A;  4V2G A;  2H8R A;  5DAJ A;  2MGQ A;  2K9S A;  3MNL A;  3BR3 A;  2OPT A;  4FCY A;  3S14 J;  2DTZ A;  3QKX A;  3TW7 A;  5BNG A;  3VP5 A;  4UUT A;  2B63 J;  4JX4 A;  2W48 A;  4XRS G;  3BR6 A;  3O60 A;  4D5F A;  3GTG J;  1JKP C;  2LP0 A;  3VIB A;  1I3Q J;  3VW2 A;  3CJD A;  3VOX A;  2D6Y A;  1XC5 A;  4V2F A;  1ENH A;  2M9H A;  3HE0 A;  5FKM A;  1HCR A;  2LD5 A;  3RZD J;  3B81 A;  2E1O A;  1MSF C;  3VOK A;  2JK3 A;  2M0C A;  2DN0 A;  1U8B A;  2UXO A;  3JRI A;  1B72 B;  1JT0 A;  4CYC B;  3NPI A;  2CUE A;  2Y30 A;  3PPB A;  4UDS A;  2NP5 A;  3FRQ A;  2X9D A;  4UUS B;  1VFC A;  1ZK8 A;  1T33 A;  1B8I A;  5M5Y J;  3E7L A;  3HDD A;  1ETQ A;  5C4X J;  5M3F J;  2R5Z B;  3D1N I;  4AF5 A;  2CQX A;  1K61 A;  2EZL A;  4CGR A;  1UHS A;  2EZI A;  4L5E A;  4IHX A;  4FTH A;  2JA6 J;  1AKH A;  3GTJ J;  1T56 A;  2IU5 A;  3ZQC A;  4IHV A;  4X1E A;  1R9T J;  2DA1 A;  2NS7 A;  5EG0 B;  2NS8 A;  5E3N A;  3JRE A;  4GFL A;  1NK2 P;  1BA5 A;  1IDZ A;  2W53 A;  4YZE A;  2ME6 A;  2ZOZ A;  3JRA A;  5M5X J;  4MXM A;  1ZTR A;  4EEF G;  4S0H B;  2FD5 A;  2LK2 A;  2TCT A;  1X2N A;  1SFO J;  1JUP A;  3A01 B;  2WAQ N;  2Y9Z A;  2OI8 A;  3LSP A;  2ID3 A;  5F0C A;  3GTP J;  5E3M A;  2R7Z J;  3RH2 A;  2K9Q A;  2LTP A;  1WGX A;  2LFB A;  3JRF A;  2RAE A;  5JLW A;  3QPS A;  3S2H J;  2K40 A;  2O8K A;  3OSG A;  3UKG A;  1ETX A;  3KZ9 A;  2HXO A;  4QSH A;  2KT0 A;  1F43 A;  2ECC A;  3ZQG A;  4A3B J;  1GDT A;  1FTT A;  3RKQ A;  5F04 A;  2I10 A;  2NVX J;  3TP3 A;  2NVY J;  1P7I A;  1UG2 A;  2G7G A;  3S1N J;  3V78 A;  1UMQ A;  2G0E A;  1O4X A;  3VW1 A;  3F1B A;  5FLV A;  4MFE A;  1OCT C;  2QWT A;  4NN1 A;  1POG A;  4W97 A;  3ANG A;  5J1R A;  4JKZ A;  3QPL A;  4AYB N;  4B1R A;  3QBM A;  2CRG A;  1QVT A;  4XRS A;  1A5J A;  3Q0W A;  1JTY A;  1X58 A;  2MSY A;  3WHC A;  4GFB A;  1LFU P;  3AQT A;  1TWC J;  3RD3 A;  2DMT A;  2NVT J;  5EYR A;  1BW6 A;  3IV5 A;  4BKX A;  3RQI A;  1LE8 B;  4M3G A;  1JT6 A;  1APL C;  2YVH A;  3OSF A;  1BW5 A;  4ICH A;  2YVE A;  2M34 A;  2KDZ A;  5K7F A;  2R0Q C;  2UXU A;  3BR2 A;  2DA7 A;  2G7S A;  3BTI A;  2XB0 X;  3ZQH A;  4IHW A;  2L7M P;  1H88 C;  3GZI A;  1TWG J;  3BTJ A;  1Y1W J;  4JNN A;  2AO9 A;  1VI0 A;  2DA4 A;  2MG4 A;  2EZK A;  3Q0V A;  3I4N J;  2R93 J;  5IP9 J;  4KWA A;  5J1U A;  3FK6 A;  5D1R A;  5FLM J;  4Y7N J;  2AHQ A;  3HOZ J;  1Z0X A;  1JJ8 C;  1IGN A;  2CQQ A;  4BY7 J;  3H0G J;  5AQC A;  3GBG A;  3LSJ A;  1JJ6 C;  2YS9 A;  1ZKG A;  2XSD C;  2FX0 A;  1NK3 P;  1ORK A;  3TW6 A;  1FJL A;  5C4Y A;  2GBY A;  2G7L A;  1MBF A;  3G1L A;  2QIB A;  3LHQ A;  3GTK J;  5FGL A;  2QOP A;  5J3L A;  2DA2 A;  1MH3 A;  3GTL J;  4DYC A;  5DS9 A;  5FKK A;  1CQT A;  2JA7 J;  4A3D J;  2Q24 A;  2LLK A;  3NNR A;  2IEK A;  1AU7 A;  2G3B A;  2DMN A;  1UI6 A;  4I6Z A;  4C3I J;  4XRM A;  4BBS J;  1FEX A;  3DCF A;  5F1J A;  2P81 A;  3S16 J;  2UXP A;  1TWH J;  2TRT A;  4NEL A;  3S5R A;  1BJZ A;  4I76 A;  3ZQL A;  3HTA A;  1U78 A;  2Y9Y A;  3SFI A;  3ZQF A;  2R5Y B;  1JKR C;  1EF4 A;  3OIO A;  3BQZ A;  3EGQ A;  3HEF A;  1MBK A;  3S17 J;  1MBJ A;  5M3M J;  3BQY A;  3COL A;  2REK A;  2K9N A;  4NDL A;  3BR5 A;  2XGD A;  1HDD C;  2XB5 A;  3BR1 A;  2FJ1 A;  2HXI A;  2FQ4 A;  2E2H J;  2UXH A;  2N8G A;  2XPW A;  4M6V A;  3BRU A;  5K7Z A;  3HGG A;  2ZCX A;  5IOY A;  4D7N A;  3HOX J;  4X6A J;  2IAI A;  1YRN B;  4C3J J;  2OER A;  4LOC A;  3KNW A;  2ECB A;  3NAR A;  2HYJ A;  3HIM A;  2L7F P;  3LOC A;  4M3D A;  2QCO A;  3SDG A;  2WV1 A;  1Q1V A;  2JN6 A;  1U9N A;  1MSE C;  4BXX J;  3PAS A;  3NXC A;  2EZH A;  2F07 A;  4M3E A;  4A3K J;  3IH2 A;  1GV5 A;  2VKE A;  3BTC A;  4XIC A;  2E2I J;  3S1Q J;  5FJ8 J;  3G7R A;  2L0K A;  1B72 A;  5EGO B;  4CYC A;  2H1K A;  1I6H J;  2QF7 A;  4UUS A;  2XRL A;  3S2D J;  3NAU A;  2JJ7 A;  2Y31 A;  1VND A;  4PXI A;  5K7H A;  2JMW A;  4BBR J;  4C3H J;  2GFN A;  2M2E A;  2R5Z A;  2ZCM A;  4G12 A;  3CMY A;  1D5Y A;  3VVY A;  4FE7 A;  1WH5 A;  3I4M J;  2CJJ A;  4GFK A;  5D19 A;  1WI3 A;  1HF0 A;  3F0C A;  5CXI A;  1MBE A;  4A3I J;  2L7Z A;  1I50 J;  2ME0 A;  5HOD A;  3BG5 A;  2E2J J;  1GV2 A;  1RR7 A;  3HTH A;  5EF6 A;  5EG0 A;  2X6O A;  5FKO A;  3S1M J;  2O9L A;  4FIS A;  3BNI A;  2NVQ J;  3VW0 A;  5M5W J;  5F27 A;  1ETV A;  5IOZ A;  4B3A A;  1OCP A;  1PUF B;  2XDN A;  2RHA A;  4IEJ A;  1MBG A;  5IP6 A;  1ITY A;  2CUF A;  1WCM J;  4ME9 A;  2XGC A;  3LNQ A;  3HOW J;  2UXI A;  1GVD A;  3LSR A;  1IG7 A;  5FKL A;  3HOY J;  5C3E J;  1RKT A;  2ID6 A;  2VUM J;  1IJW C;  2DG7 A;  3P9T A;  4MLO A;  4XK4 A;  2ELK A;  2XGE A;  3JRG A;  5JLX A;  3C2B A;  3FIS A;  2YU9 J;  2DMP A;  3S15 J;  2ZOY A;  3LJL A;  3OOU A;  1IUF A;  3JSJ A;  4A3F J;  1RET A;  5GPC A;  2LKX A;  3V6G A;  2VKV A;  3MKL A;  2HOS A;  5C44 J;  4C2M J;  1TWF J;  3O8G A;  2GEN A;  1HDP A;  3FK7 A;  2WGB A;  3ANP A;  2QKO A;  1RKW A;  4L62 A;  1DU6 A;  2L9R A;  2MW8 A;  1A6I A;  1Y1V J;  4DYQ A;  2FBQ A;  3B6A A;  5K58 A;  3GTO J;  1IDY A;  1OJL A;  3K7A J;  5E3L A;  3JRH A;  3NRG A;  2DA3 A;  3JRD A;  1S7E A;  4JL3 A;  5FMP A;  5GP9 A;  3H3V K;  9ANT A;  4A3G J;  1ETY A;  3BG9 A;  1B8I B;  2NX4 A;  2WUI A;  2JWT A;  5IYC J;  2HQ5 A;  5HSZ A;  2GUH A;  5C4J J;  2LY9 A;  3RZO J;  1BL0 A;  4A93 J;  3M4O J;  1WH7 A;  2JA5 J;  1X2M A;  3CDL A;  3IH4 A;  2Y2Z A;  4MFD A;  4RBO A;  1JKO C;  1LE8 A;  5EDN A;  1AKH B;  2DMU A;  3LSG A;  3HTJ A;  2EH3 A;  2R92 J;  1K83 J;  1ETO A;  1OFC X;  1VF9 A;  3Q3S A;  2ZCN A;  3CWR A;  3HB9 A;  4QTR A;  4ABZ A;  3HM5 A;  3PM1 A;  3HKZ N;  3G1M A;  1Z77 A;  3VVZ A;  4DZJ A;  1QVU A;  5IYB J;  2GLO A;  5HBU A;  2JA8 J;  2EBI A;  5F08 A;  5EFY A;  1RES A;  1JGG A;  2GM4 A;  1IC8 A;  2DG8 A;  3IH3 A;  1SGM A;  5HAW A;  1ZGW A;  3JR9 A;  3S1R J;  4M3F A;  3SJM A;  4DYR A;  1W0T A;  1DU0 A;  3BJB A;  3GEU A;  1U9O A;  4JP0 A;  3DEW A;  3IUV A;  4A3L J;  4W1U A;  4M3B A;  5EZG A;  4D7M A;  3BTL A;  2RAS A;  2E19 A;  3HTI A;  2VPR A;  3CQZ J;  2O7T A;  2V57 A;  3K2A A;  5F0F A;  3G56 A;  4IHY A;  2OF7 A;  5IP7 J;  5FKN A;  1E3O C;  3PO2 J;  3Q0U A; 
#chains in the Genus database with same CATH topology
 3KKC A;  4NQW A;  2QTQ A;  4HNU A;  1DP3 A;  3V4G A;  3SZT A;  1RPW A;  4HKU A;  2HOA A;  3BHQ A;  3D0S A;  4A3C J;  2DJN A;  3KKD A;  1ETW A;  2Y75 A;  2YUS A;  2EWN A;  3FWE A;  2HKU A;  2KL4 A;  1DPR A;  3K4B A;  4E7H A;  1UHM A;  2HNH A;  2VI6 A;  3GUD A;  2HQA A;  4Q4Z F;  1OQY A;  4U0V A;  3GFL A;  2R5Y A;  2QKM B;  5FB2 A;  4N0B A;  1JUS A;  3PO3 J;  2CMP A;  1Z1D A;  4HBL A;  4ZJZ A;  2B3W A;  1Z9C A;  1NTC A;  3O2P E;  3WGI A;  3HOU J;  3OYA A;  1FPQ A;  1STZ A;  2DFI A;  5EEH A;  3BOQ A;  3E7Q A;  1UFM A;  4KUM A;  2WAF A;  3KFW X;  2HOT A;  4BHC A;  2V9V A;  2UWM A;  1OKR A;  3L1P A;  4OWR B;  3DF8 A;  4XN0 A;  1ZR2 A;  3VPR A;  4PCQ A;  3CO7 C;  5J1Y A;  5ICF A;  1IRG A;  4QLC U;  4XSZ F;  2DQR A;  3TO7 A;  3LWJ A;  2PZ9 A;  3A01 A;  3OMY A;  4Q5S F;  4B48 A;  1KQ8 A;  1VQP I;  1XS9 A;  1ZR4 A;  3EUP A;  1BIA A;  3W6V A;  4GCT A;  4ZDL A;  2PI0 A;  2HYF A;  5EGO A;  2LDU A;  5CW8 A;  4L0Y B;  1YW7 A;  5DD8 A;  3JRC A;  1IF1 A;  5IYD J;  4MGR A;  1GXQ A;  4MTD A;  2NOG A;  3ABT A;  3O3K A;  2CW7 A;  3QOP A;  2ZB9 A;  2HKO A;  1YS7 A;  4XID A;  5BMZ A;  1GUU A;  4A3E J;  5CXG A;  4D5C A;  1X19 A;  2HPI A;  1XG1 A;  2JSC A;  2BY2 A;  1ON1 A;  2CV0 A;  1BOA A;  4LD5 A;  3MN2 A;  3KX2 A;  1B9N A;  4LB6 B;  1ZG3 A;  3FIW A;  1JTX A;  2A6H F;  1H8A C;  1LVK A;  1B6A A;  5ERI A;  3WU1 B;  1A31 A;  4KIS A;  3VTI A;  5GTH C;  4BNC A;  4II3 A;  1W5T A;  4KIB A;  1R1U A;  1ZRE A;  2O7O A;  3ON4 A;  2FBI A;  1DGW Y;  4RA2 A;  4Y52 J;  4HW0 A;  2B9S A;  2K9M A;  3I9V 2;  1AWC A;  3WE2 A;  4DW6 A;  1OR7 C;  3JSP A;  2NVU B;  1ZG5 A;  5GPA A;  3E6B A;  3CME I;  3BR3 A;  4FCY A;  5DEQ A;  2FEZ A;  2FMY A;  3CJN A;  3G6E I;  2DTZ A;  4BQO A;  1EH8 A;  3QAH A;  1SMT A;  2W48 A;  3QOE A;  3BR6 A;  4D5F A;  2DQL A;  4KIC A;  3IWZ A;  2NS0 A;  2MD0 A;  4LJZ F;  3WTX C;  3VOX A;  1UEL B;  1MD0 A;  2OA4 A;  2L02 A;  2LBF A;  3BJA A;  3BP8 A;  5HLI A;  2LD5 A;  1R7J A;  2FBK A;  1FSE A;  2VC0 A;  1IN5 A;  3PIO F;  3PJR A;  1MSF C;  3EUH C;  4ENN A;  4KDP A;  2DN0 A;  5ED4 A;  1MJA A;  3T5X A;  4WWC A;  5BPI A;  3LSK A;  3NPI A;  3VSK A;  2L3D A;  1H0M A;  1YG2 A;  2X9D A;  2NP5 A;  3FRQ A;  3OS0 A;  2CFX A;  2XAG A;  1FBQ A;  3P9I A;  3PFI A;  3FMR A;  3HDD A;  3BCB A;  3D1N I;  4IL6 C;  2QM3 A;  2F2E A;  3CCQ I;  3OS2 A;  1EJ9 A;  3W6J B;  1UHS A;  2EZI A;  2X1D A;  3LQQ A;  2JA6 J;  1T56 A;  4Q47 A;  4NC8 A;  1R1V A;  3WTU C;  2QEX I;  3M07 A;  3QU3 A;  1XN7 A;  2NS7 A;  3ZQ7 A;  1R9T J;  4G7H F;  5A2Q Z;  1D3Y A;  2H6B A;  1ON2 A;  4GFL A;  2O8X A;  1X4P A;  3J80 Z;  2FML A;  2NNY A;  3RQ4 A;  1NK2 P;  2G7U A;  2L9V A;  2HQR A;  4UB6 C;  2ME6 A;  3BLY A;  5E8I A;  4MXM A;  1ZTR A;  3BY6 A;  2HPM A;  1YFH A;  3K4L A;  3R6S A;  3OYH A;  3G3Z A;  2CGP A;  4IRH A;  2L4A A;  4BE2 A;  2OU2 A;  1ZEL A;  3FXQ A;  4PGG A;  2IGK A;  3LSP A;  2ID3 A;  5F0C A;  3R0A A;  2QQA A;  2VN2 A;  1J7K A;  2LY2 A;  3H9J A;  2IPQ X;  2BGC A;  1RZ4 A;  3L2R A;  1J75 A;  4L18 B;  2WAD A;  2Z9O A;  3S2H J;  5K5O A;  2O8K A;  4EGY A;  2ADU A;  3KP3 A;  3IKV A;  2HXO A;  1D0X A;  3IC7 A;  1PVE A;  3F8F A;  1F43 A;  4A3B J;  1GDT A;  2VIX A;  5DD4 A;  5L3E A;  2I10 A;  2NVX J;  2LRE A;  3H9Q A;  1P7I A;  5LBQ A;  2MA3 A;  5L3F A;  1Y0N A;  3V78 A;  2F4O B;  1O4X A;  3VW1 A;  2ZBK A;  5LHI A;  1X4O A;  2BY0 A;  3V42 A;  2DYS H;  2L9S A;  5CVR A;  1D0Y A;  4NN1 A;  5J4V A;  3ANG A;  1XSD A;  5J1R A;  4KN7 X;  2FJI 1;  3HC7 A;  2EV0 A;  3MMY B;  2M1B A;  4XRS A;  4PJ0 C;  2GQQ A;  1IZ1 A;  1A5J A;  1OCO H;  2DOD A;  4BAC A;  5FRO A;  3CJQ B;  2ZME B;  5D8K B;  4P1W A;  3QP5 A;  1P2F A;  1MJ9 A;  1YJ9 I;  2FA5 A;  1W4M A;  3ASO H;  5HS9 A;  4ZH4 F;  3AAF A;  5LHG A;  4FHT A;  4BKX A;  3RQI A;  3TDU C;  1KU2 A;  1LE8 B;  2EIK H;  2F6C A;  1SD5 A;  4Z2Y A;  1FMW A;  5K7F A;  3CC2 I;  2KRH A;  3BR2 A;  2L7M P;  5K5Q A;  2LF7 A;  1HW1 A;  1TWG J;  4IHT A;  4F55 A;  2AO9 A;  5LRR A;  2ZNZ A;  4GGG A;  5HVQ C;  1EV7 A;  3GCM A;  3I4N J;  1GLN A;  2IA1 A;  4EM1 A;  1S29 A;  4HQE A;  1FZP B;  3DP7 A;  5E1Z B;  5J1U A;  4CSW A;  3FK6 A;  1HQC A;  2EFW A;  5DM7 F;  3RKW A;  1LPQ A;  1Z0X A;  3V8K A;  1F9N A;  4ESF A;  1S7O A;  3F72 A;  5AQC A;  3LSJ A;  4RAF A;  1JJ6 C;  4OD4 A;  1NK3 P;  4XMY A;  2PLY A;  3TW6 A;  2YVX A;  4IOC F;  2G7L A;  2MAB A;  2DDB A;  3CES A;  3BPV A;  2QOP A;  2DO7 A;  1WJ5 A;  3IWF A;  3M9A A;  2B7E A;  2AQF A;  1MZB A;  1MH3 A;  1Z7U A;  4NQW B;  1CQT A;  3M8F A;  5FKK A;  5DS9 A;  2JA7 J;  4A3D J;  3I59 A;  3ZMZ A;  2LLK A;  2P7V B;  2H27 A;  1AU7 A;  1U2W A;  4HV5 A;  3M8E A;  2G3B A;  1TBX A;  2DMN A;  3BJ6 A;  3LST A;  1T98 A;  3ZCO A;  3A1Y A;  3B02 A;  3K4K A;  1XGS A;  2EIJ H;  4CCJ A;  2V6E A;  3FXM A;  2L4M A;  2P81 A;  2TRT A;  1MW7 A;  2HVQ A;  4I76 A;  3HTA A;  3U1K A;  1WHU A;  2Y9Y A;  2XF7 A;  3G71 I;  2R5Y B;  1JKR C;  2W84 A;  2LNB A;  5DCF A;  3VOD A;  1BI0 A;  3WTW C;  3BQZ A;  3R0J A;  4FX4 A;  2I5U A;  3BWG A;  2Q1Z B;  1MBK A;  3VWB A;  1O3S A;  4EGZ A;  4IOA F;  2K9N A;  4NDL A;  2DXI A;  2CH0 A;  5GAH J;  2DFH A;  2O0Y A;  4BHB A;  3E6C C;  2N8G A;  4RGS A;  3ECH A;  3PSI A;  1JHF A;  2M3A A;  2WB1 A;  2ZCX A;  4PZJ A;  5IOY A;  1BBY A;  3E5U A;  1IXS B;  2JRM A;  2OER A;  5DCM A;  3HIM A;  5F6F A;  2PMZ A;  2WV1 A;  1MMA A;  3DU6 A;  3PAS A;  2DPU A;  2VJ4 A;  3ZGK A;  4EJU A;  5JHU A;  1R00 A;  1A35 A;  2F07 A;  3OR2 C;  4M3E A;  5H20 A;  3OV8 A;  4BQN A;  4D1Q A;  3J81 Z;  4RM3 A;  3QYB A;  4IRV A;  3LA3 A;  4XIC A;  1IXR C;  4O6J A;  1MGT A;  1TQM A;  5EGO B;  1WSU A;  3MFK A;  1TL8 A;  3MCZ A;  2QF7 A;  2VQC A;  3RPU A;  2CFO A;  3BJO A;  3KEY A;  4ON0 A;  2Y31 A;  4C3H J;  4IRG A;  4XR6 A;  2R5Z A;  1IV8 A;  3CMY A;  1HSJ A;  4GFK A;  5D19 A;  2L54 A;  2P5L C;  1R5G A;  5CXI A;  1MBE A;  3F6V A;  4A3I J;  1T39 A;  3DBR B;  3BRO A;  1V55 H;  3ABL H;  2DK8 A;  1RR7 A;  2UXN A;  2X6O A;  2F48 A;  3GLX A;  3S1M J;  4FIS A;  1OYW A;  2BVL A;  5F27 A;  4A0Y A;  3VDX A;  2J5P A;  2RHA A;  5KHD A;  2KHM A;  1MBG A;  3CP2 A;  3H1C A;  1K4T A;  2VB6 A;  1GVJ A;  3Q9V A;  2UXI A;  1KGS A;  2TDX A;  1GVD A;  3D5R C;  4D0P A;  4II2 A;  2LH9 A;  3LA7 A;  5ICC A;  3DV8 A;  4PDK A;  2IP2 A;  5FKL A;  2ID6 A;  4M6Y A;  5C3E J;  2EK5 A;  4EJW A;  3VOE A;  4CCL A;  4FX0 A;  3JRG A;  2V1D A;  3RKY A;  5JLX A;  3C2B A;  1K79 A;  2F5D A;  2DMP A;  1UHW A;  5HDG A;  2ZOY A;  2RDP A;  3HSE A;  3I5U A;  3LAJ A;  4BU2 A;  5C44 J;  4M9S A;  4MQ9 F;  1CGP A;  1TWF J;  4RGR A;  4ASN A;  5ILU A;  4OMY A;  2PBI A;  3FK7 A;  1P92 A;  3WGH A;  4HPQ A;  4U9N A;  4E7Z A;  2LBF B;  3TMO A;  2L9R A;  1DU6 A;  1W5S A;  4CXF A;  4I2O A;  1Y1V J;  3KP5 A;  1WQ2 A;  3FDY A;  5K58 A;  3GTO J;  4AVZ A;  5E3L A;  4P9U A;  1YIJ I;  1TNT A;  3JRH A;  3QOD A;  4JL3 A;  2EV6 A;  4F93 B;  5FMP A;  9ANT A;  3AG3 H;  4WF2 A;  5KVR A;  4YFN F;  2JWT A;  1VQL I;  3EDP A;  2QSH X;  2GUH A;  1WKM A;  1YYV A;  5C4J J;  2HVS A;  2RV8 A;  1FX7 A;  1FWZ A;  1X1P A;  4I0B A;  1X2M A;  4G8X A;  4LG0 A;  1Z91 A;  3CDL A;  2Y2Z A;  3E3V A;  2ISY A;  1ZGA A;  2DMU A;  3WTT C;  3CC7 I;  3F9K A;  2ELJ A;  1ETO A;  1WJD A;  4ZZL A;  1BC8 C;  4QTR A;  3PM1 A;  3G1M A;  1Z77 A;  2MBF A;  3HKZ N;  2GLO A;  1QVU A;  3FX3 A;  1UAA A;  5KK1 A;  5L3B A;  4NHJ A;  5EFY A;  2GM4 A;  1ULY A;  5DYM A;  3CUQ A;  5HAW A;  1ZGW A;  3MD2 A;  3T8T A;  4DYR A;  1U8R A;  1JXS A;  2EIM H;  5DV5 A;  3GVA A;  3GEU A;  1VQ7 I;  3CCR I;  4P55 A;  3SWH A;  3D5S C;  4M3B A;  5EZG A;  4G6T B;  2IVM A;  3U21 A;  3HTI A;  2OD5 A;  2GOM A;  3CQZ J;  2O7T A;  3RI4 A;  2ZY9 A;  2ELH A;  2YX7 A;  3AL0 B;  4EM0 B;  1V5F A;  1OMI A;  2KIM A;  4DGW B;  2OF7 A;  4OMZ A;  3KYL A;  1TLH B;  3R4K A;  2HR3 A;  4BY1 J;  3MQ0 A;  5D4R A;  3IRR A;  3DU5 A;  2DAO A;  2XKP A;  3ZOB A;  4GRI A;  1KU7 A;  2XAQ A;  3TP0 A;  3C7J A;  4RDU A;  3P5J A;  1LNW A;  1QZZ A;  3NEU A;  3I56 I;  2OBP A;  2EQR A;  1TTY A;  4NB5 A;  2Y0S N;  3OIP A;  1MMG A;  4P5O A;  4O3M A;  1P4A A;  4XM3 A;  1SVM A;  2XSJ C;  4HDU A;  1KQ9 A;  2MC3 A;  3R61 A;  1SVL A;  2IBD A;  1JKQ C;  1BOB A;  3ELK A;  3HOV J;  3CD6 I;  3NI7 A;  2LY1 A;  4RGU A;  4AYB A;  4DZP A;  2IJL A;  2A07 F;  3KZY A;  2FXA A;  3KP6 A;  5GAG J;  4N9I A;  1K6O A;  1J09 A;  3ON2 A;  4BQA A;  2Q0O A;  4J19 A;  5CQG A;  2R7D A;  3HBL A;  2PFV A;  4N4N B;  1YHQ I;  4KIT B;  4A3M J;  2HGC A;  4A5M A;  1FOK A;  3GTQ J;  2BOL A;  3FXU A;  1SAN A;  4HNV A;  4E7K A;  1LKX A;  1YRN A;  2FRH A;  1XSV A;  1MDM A;  3E5Q A;  2X1E A;  2VL8 A;  4I0A A;  1IUY A;  4LFU A;  4CCN A;  2XHK A;  5HS7 A;  3FKI J;  3MVP A;  2BE5 F;  3I71 A;  3M3Y J;  2CU7 A;  4MNU A;  1FBS A;  4RGX A;  2STW A;  1HLV A;  1HOM A;  2BY1 A;  3FF5 A;  2LVS A;  2WWY A;  1AHD P;  5CJ9 A;  3I55 I;  1P7J A;  3H35 A;  3MZ8 A;  4AUX A;  1J9I A;  4BJ5 C;  5D4S A;  2QZ8 A;  2H1L A;  3WHB A;  3QPH A;  2KIQ A;  1QHH D;  3P9K A;  5BQT A;  3VUQ A;  4PSW A;  4B4C A;  2VC1 A;  2JUC A;  3FXL A;  2FUG 2;  4BDZ A;  3I59 B;  4RM2 A;  2NP3 A;  4C9Y A;  1YLF A;  2P5V A;  3OY9 A;  5E17 F;  4JX6 A;  2COB A;  2O3F A;  2XPU A;  2DA5 A;  3EUK L;  1K4S A;  1ZHF A;  5ICE A;  1MH4 A;  4EV0 A;  4V2G A;  2H8R A;  5DAJ A;  3LSM A;  2MGQ A;  3MNL A;  2W4S A;  5FGM A;  2RGV A;  2WY8 Q;  3DWL E;  2RNJ A;  4BXU A;  1D1A A;  3RPU D;  4CH7 A;  2BEO A;  2WY7 Q;  4DOZ A;  1A6Q A;  5ILV A;  3VP5 A;  2W25 A;  3VYT B;  4JX4 A;  1OYI A;  2RVC A;  2X6Y A;  4CUG A;  1RIO H;  2F5C A;  3RSN A;  3O60 A;  3GTG J;  2LP0 A;  2VQH A;  5DCM B;  4E7L A;  4UUV A;  1YE9 A;  1TNS A;  1XC5 A;  4P96 A;  1CF7 A;  4F52 A;  3HE0 A;  2Z3Y A;  5FKM A;  2VQG A;  1VQ5 I;  4ZYG A;  2QYO A;  3FMS A;  4AD9 A;  3I3L A;  2FNP A;  3QRF F;  2JK3 A;  1SD6 A;  1U8B A;  2A2F X;  4QWQ A;  4UDS A;  2AQE A;  2GA2 A;  5FRN A;  3TDZ C;  5CKT A;  4P9F A;  1B8I A;  1G3T A;  2RKH A;  2R7Q A;  2P8T A;  5M5Y J;  5LD2 C;  2GXG A;  1E0E A;  4I99 C;  4AWX B;  5J4Y A;  3GZ5 A;  4RLQ A;  2R5Z B;  4ZTJ A;  2XRN A;  4IVN A;  2KJC A;  2R4G A;  4XQF A;  1YOV B;  4CGR A;  2P4W A;  4L5E A;  4FTH A;  2DT7 B;  1FSH A;  4E7I A;  2IU5 A;  4C2T A;  1U0J A;  1F5T A;  4X1E A;  2EV5 A;  4YG2 F;  2DA1 A;  3PNV A;  2PJP A;  4RMN A;  2NS8 A;  1BR2 A;  2V79 A;  4YFX F;  1QBJ A;  1O7L A;  3JRE A;  1BM9 A;  2ZFU A;  4HOB A;  4IO9 F;  2HDW A;  5JR3 A;  4HLX A;  5KAF C;  2RNG A;  1BA5 A;  1GHC A;  1F1Z A;  1IDZ A;  2W53 A;  4ZC3 A;  3GXO A;  3TL4 X;  2R7W A;  5CVI A;  2CQK A;  4HG2 A;  4EEF G;  4S0H B;  3F8B A;  1WI9 A;  2FD5 A;  5LEJ A;  2LK2 A;  3WU2 C;  3SQN A;  2HTJ A;  3NWS A;  1SFO J;  2VT3 A;  4HSR A;  5H2F C;  1JI8 A;  2Y9Z A;  5E3M A;  4YIR X;  3RH2 A;  4YIF A;  2W24 A;  1G8X A;  3KPH A;  4YFK F;  4HNT A;  4L9J A;  4BJ6 C;  2KIF A;  5HNH A;  4OIO F;  3PSF A;  3QPS A;  4B3X A;  2K40 A;  2KJB A;  2KRC A;  1O3R A;  3BCA A;  1AOY A;  2KT0 A;  1ZN2 A;  2ECC A;  2PEX A;  3SHF A;  2L5Q A;  3ZQG A;  1FTT A;  4UB8 C;  3TKY A;  4IF4 A;  3RKQ A;  3C2H A;  4XKV A;  3KP7 A;  3A0B C;  4LB5 A;  5EJC A;  4U0Y A;  4ANJ A;  1Q1H A;  3S1N J;  1UMQ A;  2DOE A;  1SAU A;  3F1B A;  5FLV A;  1WRJ A;  2ZME C;  4MFE A;  1E2X A;  1OCT C;  1TT0 A;  1X1B A;  2NRA C;  4W97 A;  4C30 A;  1IN8 A;  3I58 A;  4B1R A;  3ZP5 A;  3QBM A;  2GIZ A;  2F5E A;  3SZG A;  3Q0W A;  4Z6Y A;  2MSY A;  3OR1 C;  3S2W A;  2D1V A;  1WZ2 A;  1T8I A;  4F7Z A;  2O5R A;  3MZY A;  4LG0 B;  4AU7 A;  3K70 D;  2IA0 A;  1JT6 A;  2YVH A;  2ZXW H;  4NC6 A;  1XGN A;  1G6N A;  3RYP A;  4EAT A;  2QVO A;  3GEZ A;  3TBI A;  2HFH A;  2UXU A;  2DA7 A;  3BTI A;  2XB0 X;  1JGS A;  3S3M A;  3OYJ A;  3PQK A;  3KEO A;  1H88 C;  3GZI A;  3BTJ A;  1Y1W J;  1VI0 A;  2DA4 A;  1WJA A;  4B8X A;  3Q0V A;  2HWV A;  3CUQ B;  3RDI A;  5IP9 J;  4KWA A;  5FRM A;  5IY5 H;  3DKY A;  1Y0U A;  1SVO A;  5HLT A;  1XTA A;  2JTV A;  3CF2 A;  2W1O A;  3GBG A;  2DU9 A;  2VOO A;  3V7C A;  5FFZ A;  4B09 A;  1ZKG A;  3DPL C;  2XSD C;  5J47 A;  1ORK A;  3C18 A;  5C4Y A;  1MBF A;  2MH2 A;  2Y69 H;  3L2V A;  3DLL F;  4NC7 A;  3J7Y J;  2DT5 A;  3SDB A;  5GAE J;  2BY3 A;  2OCE A;  3E5X A;  5H6R A;  4MHG A;  3KZI C;  4ENK A;  2V4J C;  1LDK B;  4F92 B;  1HST A;  4XNF A;  1N78 A;  1IN4 A;  3K6G A;  4I6Z A;  2F4M B;  2XAH A;  2QBY A;  5F1J A;  4PSX A;  5E79 C;  2K9L A;  3CO6 C;  3S5R A;  4XOR A;  1BJZ A;  2E1M B;  3K0L A;  2GOX B;  2WV0 A;  3G4S I;  3G73 A;  4RB2 C;  2CW0 F;  4HRI A;  3ZQF A;  1W5C C;  3OIO A;  4L5J A;  4BAY A;  5M3M J;  1S3J A;  1E17 A;  3BR5 A;  1QZE A;  3WTY C;  2ZJP F;  2Z16 A;  2XB5 A;  1PYV A;  2FJ1 A;  2YU3 A;  3MAJ A;  2FQ4 A;  2Z2S B;  2UXH A;  2XPW A;  2CV2 A;  4PJL A;  4XKW A;  1OCR H;  2P6T A;  4PFO A;  4X6A J;  2IAI A;  1YRN B;  4OIN F;  2V1N A;  4LOC A;  4BGD A;  2ECB A;  4ZYH A;  5CLS A;  1MDM B;  3LOC A;  4MEY F;  3OS1 A;  3SDG A;  5J8F A;  2E5Z A;  2JN6 A;  1QZY A;  2X0L A;  1PDN C;  2R7F A;  3W2V A;  3DKW A;  1DQU A;  2VKE A;  3G7R A;  4KNY A;  2KZV A;  2L0K A;  1B72 A;  2ESH A;  2H1K A;  1I6H J;  2W85 A;  2DDA A;  2DTR A;  2XRL A;  4UUS A;  1R58 A;  3AG4 H;  3OWT A;  3S2D J;  1VND A;  4U88 A;  1R49 A;  3OIQ A;  5K7H A;  4DNC A;  4BBR J;  1YJN I;  4OIR F;  4I02 A;  4S05 A;  4K2E A;  4DVY P;  3GW2 A;  2DFF A;  1WH5 A;  4FE7 A;  3PNY A;  1H9T A;  4M71 A;  1KON A;  3F0C A;  2JPC A;  2L7Z A;  2LMD A;  1LUJ B;  3A0H C;  4ENJ A;  3P7N A;  3OOP A;  1A04 A;  2VLA A;  5EF6 A;  2GA1 A;  2O9L A;  3BNI A;  2Q8K A;  2NVQ J;  3HRU A;  1XMA A;  5IOZ A;  5M5W J;  2STT A;  4JOM A;  3LFK A;  1TP4 A;  3F6O A;  3HIF A;  4U87 A;  4EJO A;  5IP6 A;  1QU3 A;  5EEG A;  1ITY A;  4RS8 A;  1YIO A;  3EQL F;  3LNQ A;  1YQA A;  3LWF A;  1MMD A;  2RQQ A;  3P9T A;  1RKT A;  2VUM J;  3CF5 F;  2LF8 A;  2DJI A;  2R7V A;  2CQN A;  2DFE A;  2CS3 A;  2ELK A;  1RI7 A;  2BHY A;  2HQN A;  5JI6 A;  3H0D A;  4LIT A;  3LJL A;  1IUF A;  1TW3 A;  2LKX A;  1BJA A;  2PMH A;  5GPC A;  2ACJ A;  1I5Z A;  2VKV A;  3MKL A;  5CYV A;  3V6G A;  3REO A;  1UG0 A;  1KYW A;  4HLY A;  3ANP A;  4EMS A;  3Q9S A;  5CVV A;  1CF7 B;  1RNL A;  3CCM I;  4M9Z A;  3DQV C;  3RCO A;  2FBQ A;  1HW5 A;  2PN6 A;  3HUG B;  1HKS A;  3FKJ A;  1SD7 A;  2KFD A;  5D5X B;  2DA3 A;  1S7E A;  3NQO A;  4GYI A;  3H3V K;  2E35 A;  1T08 B;  3K4J A;  1ETY A;  3FXJ A;  1B8I B;  4J00 A;  2EIL H;  5CPR B;  4OAZ A;  5HSZ A;  4UHT A;  2LY9 A;  1FYL A;  3RZO J;  2R7T A;  2OV7 A;  2JA5 J;  1J5Y A;  5JVT A;  3EPZ A;  3ROU A;  4BXF A;  5DDG A;  4MFD A;  4OAY A;  2OUM A;  4LG3 A;  4RBO A;  2CUJ A;  2M8E A;  3K4N A;  1B59 A;  3LSG A;  1X1D A;  2K85 A;  2MH9 A;  3HTJ A;  4AID A;  2R92 J;  4QPQ A;  2JA2 A;  3PQJ A;  4KMU X;  1VF9 A;  3CP8 A;  3Q3S A;  2VBW A;  3JSO A;  3JAM K;  4ABZ A;  3KLN A;  1W36 D;  2JA8 J;  2EBI A;  2LC2 A;  4XLA A;  5L3C A;  2ICW G;  3DBL B;  1I39 A;  3LA2 A;  1QO0 D;  1IC8 A;  2DG8 A;  2BV6 A;  4BEH A;  3JR9 A;  3S1R J;  4M3F A;  3SJM A;  1Y8Q B;  3MKY B;  2D45 A;  3AL0 C;  2VXD A;  4ITV A;  1IW7 F;  4JP0 A;  3WTV C;  3DEW A;  3L2C A;  5DUI A;  4A3L J;  3OL3 A;  1WFX A;  4W1U A;  4YII A;  4D7M A;  2QKL B;  3BTL A;  2DBB A;  3W6K B;  3BZC A;  5ICG A;  1HW2 A;  5DM6 F;  5CQE A;  5F0F A;  4N4O B;  2BVM A;  3QYF A;  1IXC A;  1LJ9 A;  3CCV I;  5IP7 J;  2HKX A;  5FKN A;  2Z99 A;  1E3O C;  1ZRD A;  1WVR A;  1KU3 A;  4GCV A;  2VJJ A;  2HYT A;  3VVX A;  2BXZ A;  1R71 A;  2QSG X;  4OIP F;  4L9T A;  1FT9 A;  2LKP A;  1K6Y A;  3SYT A;  3I64 A;  1FTZ A;  5D18 A;  2DK5 A;  3R60 A;  3ULQ B;  3K2Z A;  2VT2 A;  3HL2 A;  1UJ8 A;  3L2W A;  1BIB A;  2A6T A;  4ZYD A;  2D1H A;  3B6C A;  3CRJ A;  1T38 A;  3ZMD A;  4A69 C;  1DPU A;  2IS4 A;  4JX5 A;  3BZ6 A;  4ACI A;  2HOE A;  4GCK A;  1UB9 A;  2PBX A;  2X6X A;  2HS5 A;  1ZQ3 P;  3G1O A;  4DQ2 A;  3WTS C;  4LLL A;  1YJW I;  5LRS A;  5TGT A;  4ENM A;  1RR8 C;  1N77 A;  3HTU A;  3E1S A;  3KYC B;  2LKS A;  4E6K G;  2R7U A;  1O3T A;  5B1B H;  4F3Q A;  5F0H A;  2K7L A;  2XGX A;  4PGH A;  1ZRF A;  1TC3 C;  1VQN I;  2COM A;  2IT0 A;  3OYM A;  1B4A A;  1XX5 A;  3ASN H;  4YEL A;  1IN6 A;  1EKE A;  1GT0 C;  2QQ8 A;  3ERM A;  5B3S H;  2D5V A;  3NWT A;  4CHU A;  3PUB A;  2VJ5 A;  4BJT A;  1OCZ H;  4GCL A;  1ETK A;  1IV6 A;  5E3O A;  4QIW N;  1SFE A;  3H92 A;  3KP2 A;  1G3W A;  1IN7 A;  2M8G X;  1ZRC A;  2HDD A;  1UI5 A;  1LFB A;  3KCC A;  3OYN A;  5H9T A;  1FOW A;  1MBH A;  1N25 A;  4L5I A;  4DIQ A;  1B1B A;  3HGY A;  3ESW B;  3HOT A;  3DPJ A;  5EEA A;  1T95 A;  2QBY B;  5E8G A;  4R1H A;  1MNM C;  3BR0 A;  2O03 A;  3HPG A;  2DMQ A;  2P7C B;  2FOW A;  4CIC A;  1FIA A;  2M7A A;  3KYD B;  3CCY A;  2CSO A;  2K27 A;  5FHP A;  1IRX A;  3A03 A;  3SFZ A;  2K9S A;  2DW4 A;  2OPT A;  3E6M A;  3S14 J;  2JVG A;  2W82 A;  2ZJ2 A;  2VOP A;  1Z05 A;  3QKX A;  2E60 A;  4MQV A;  3SZP A;  2RQP A;  1BN5 A;  3VW2 A;  4XKB A;  3CJD A;  4IPA A;  4R79 A;  4B44 A;  2DI3 A;  3HHH A;  2D6Y A;  4V2F A;  1QNT A;  1U5T B;  1ZYR F;  3E6D A;  4UV9 A;  3TQN A;  3OYD A;  1V3F A;  1YX5 A;  5H6Q A;  4GO1 A;  3CLO A;  1ZLJ A;  1MJB A;  2E1O A;  2F5V A;  3VOK A;  2M0C A;  1K78 A;  1X1A A;  3QU6 A;  3JTH A;  3JRI A;  3ZQQ A;  2UXO A;  3VEP A;  1B72 B;  1X3W B;  1JT0 A;  1KZH A;  4EQQ A;  2M30 A;  2Z5U A;  3MWM A;  4UUS B;  4BE0 A;  1VQ8 I;  1T0F A;  1RRJ A;  1T33 A;  2KKO A;  3VFZ A;  4G7O F;  3AKZ A;  1SD4 A;  1WJF A;  1ETQ A;  5C4X J;  4EVI A;  1RUN A;  2KDO A;  5J6X A;  2NOJ B;  3OL4 A;  2XRO A;  2GWR A;  1K61 A;  4IHX A;  1AKH A;  3GTJ J;  3K4M A;  3ZQC A;  4IHV A;  4OU0 A;  2BW3 A;  1TQP A;  5E3N A;  3L09 A;  4ZYE A;  3L2Q A;  1JE8 A;  4YZE A;  4M6X A;  3U2R A;  4ETS A;  5M5X J;  1EH7 A;  3BC8 A;  4DBQ A;  4HQM A;  2YPR A;  1J0R A;  4M9X A;  1GXP A;  2LSO A;  4XON A;  2TCT A;  2X1C A;  3CMA I;  1HC8 A;  1X2N A;  3DPT A;  3T1B A;  2WAQ N;  1YTY A;  3DBH B;  2DYR H;  2OI8 A;  1PP7 U;  2R7Z J;  3GTP J;  4BS9 A;  3FBI B;  4JK1 X;  1YO5 C;  2IA2 A;  2K9Q A;  3LSH A;  1WGX A;  3HHG A;  1L3L A;  2LFB A;  3JRF A;  5GTI C;  1ACI A;  2IW5 A;  4IRI A;  3W2W A;  2LG4 A;  1DP7 P;  5JLW A;  2FNA A;  1BI3 A;  1SMY F;  1LDJ A;  3OSG A;  3V7R A;  1ETX A;  2P5K A;  1FOX A;  4UNO A;  1R6R A;  2ZJR F;  4H0E A;  1QA6 A;  2M7B A;  5IT9 Z;  3F21 A;  1T2K A;  3K4C A;  2D2W A;  4OD5 A;  3PIP F;  2DLL A;  2NVY J;  4DBR A;  4RB3 C;  1R36 A;  2IS2 A;  2G0E A;  3DTE A;  2NXN B;  3S3N A;  2CQ7 A;  2F4I A;  2GZW A;  2VKH A;  1FLI A;  1POG A;  1HKT A;  3O6B B;  3ZMU A;  4JKZ A;  4LK0 F;  3HZJ A;  3QYE A;  1JHH A;  5GAD J;  2UZK A;  2H6C A;  4UXN A;  4Y17 A;  1XSX A;  4M72 A;  1XPX A;  4FQG A;  2OC6 A;  2HYG D;  4Y4R A;  1XGO A;  4GFB A;  4GDF A;  1LFU P;  3GFJ A;  3RD3 A;  2OQG A;  5EYR A;  2E34 A;  3GYH X;  2JSP A;  2E5N A;  1APL C;  1BW5 A;  4V19 K;  4ICH A;  5LLQ A;  2KDZ A;  2R7X A;  2V1X A;  4I09 A;  3CUQ C;  2R0Q C;  2E7W A;  3OYE A;  2G7S A;  3CMM A;  3ZQH A;  4IHW A;  1BI2 A;  2CG4 A;  3KEQ A;  4JBA A;  3ABM H;  2I8D A;  3DTK A;  2Z33 A;  2BHZ A;  2ZXH A;  4JNN A;  4IXA A;  1YX3 A;  1Z3X A;  2MG4 A;  2EZK A;  3JCU C;  4MEX F;  3K70 C;  1LEA A;  3CJR B;  4BUP A;  4BEH B;  2R93 J;  2R7O A;  4RAZ A;  3HKZ A;  4CA0 A;  5FLM J;  3OYL A;  2AHQ A;  2W7N A;  1JJ8 C;  3ERE D;  2CQQ A;  2HZT A;  5D5W B;  4BY7 J;  3H0G J;  1VQK I;  3I0T A;  1Z6T A;  3FZV A;  2EFQ A;  2VOD A;  2GBY A;  2JQ7 A;  3G1L A;  2QIB A;  2DCE A;  4BQQ A;  1D5V A;  3HPH A;  1TZL A;  2CYY A;  5TRD A;  5FD6 A;  3HXL A;  2OAZ A;  1BR4 A;  5J3L A;  2DA2 A;  5ILS A;  3TOA A;  2HDC A;  2P6S A;  2DOF A;  5FFX A;  4DYC A;  2Q24 A;  3H5N A;  3NNR A;  2E1M C;  2JT1 A;  3HUG A;  3J7A O;  2HEO A;  1M1E B;  1NG7 A;  3GLL A;  2VPL A;  2EA2 A;  4XRM A;  4BBS J;  1FEX A;  1I3A A;  1MIJ A;  3S16 J;  2OTJ I;  3UR3 C;  1SFX A;  3RYR A;  4XLN F;  1U78 A;  1LVA A;  1R4N B;  3MZH A;  4YRV A;  3K10 A;  5LFA A;  2AXL A;  3S17 J;  2Y0S A;  5HOO A;  1TW2 A;  3COL A;  3FHZ A;  2REK A;  5B1A H;  3BR1 A;  5IT9 K;  1MNE A;  3HSR A;  2HXI A;  4TV7 A;  1OR7 A;  3DKX A;  4M6V A;  5K7Z A;  3Q5F A;  4X0G A;  4D7N A;  1LDD A;  1PP8 F;  4I98 B;  3KNW A;  3DEE A;  3S8P A;  3NAR A;  2HYJ A;  4C2M A;  2X85 A;  2VBX A;  4M3D A;  4CCO A;  3U1D A;  1Q1V A;  2UUZ A;  1U9N A;  2JPB A;  2QQ9 A;  4A6D A;  1MSE C;  2QEN A;  3ZPL A;  2EZH A;  3H3Z A;  4A3K J;  2KLO A;  1QHG A;  4XLF A;  1GV5 A;  5J40 A;  2F5F A;  1FYM A;  3BTC A;  2E2I J;  2V9P A;  1P9Q C;  1X3Z B;  4CYC A;  1W1W E;  2KIS A;  4J01 A;  3LL7 A;  4G7Z F;  3GZN B;  3NAU A;  3WG9 A;  1FBU A;  3H5R A;  1Z21 A;  4PXI A;  2XF5 A;  2JMW A;  2GFN A;  3EUH A;  4WXC A;  2QUF A;  2ZCM A;  1SAX A;  3ZN0 A;  3V8L A;  1Z67 A;  4G12 A;  1D5Y A;  2HU9 A;  3I4M J;  2CJJ A;  2WA0 A;  1WI3 A;  3GF2 A;  1HF0 A;  4CZZ A;  1O3Q A;  3BG5 A;  2E2J J;  1GV2 A;  2VBZ A;  2H09 A;  5EG0 A;  4LGW A;  2IRF G;  3ZXS A;  1R5H A;  5AON A;  4RAY A;  2FBH A;  4M73 A;  4BHP A;  1SC7 A;  3VW0 A;  1ETV A;  2JVH A;  2DT6 A;  2X51 A;  3WU0 A;  1OCP A;  5HS8 A;  3GFI A;  2XDN A;  1ODD A;  4IEJ A;  4D9J A;  1VQ4 I;  1YS6 A;  3F8N A;  2P0W A;  1WCM J;  2MLG A;  3LFU A;  4OOI A;  5KNL A;  2XGC A;  3HOW J;  5E1X A;  3LSR A;  4XOP A;  4PFP A;  3QP6 A;  4RAG A;  1Y8R B;  3HSF A;  2UXX A;  2X4H A;  3ABK H;  3VSL A;  5D5V B;  3HOY J;  2DG7 A;  1IJW C;  3CDH A;  4MLO A;  4XK4 A;  2PX9 A;  1A36 A;  2M5W A;  3LSI A;  3H36 A;  3FIS A;  2LRD A;  5HLG A;  1S8N A;  1SEU A;  2BBY A;  3H3U A;  2GXB A;  3TOB A;  3F23 A;  3GZ6 A;  4S04 A;  2AS5 F;  1S6L A;  2KP6 A;  5FLX K;  2WBM A;  3O8G A;  1WJB A;  2XVC A;  1HDP A;  1L0O C;  3ONQ A;  1RKW A;  4L62 A;  1DUX C;  2MW8 A;  5LGN A;  4BL0 B;  5E1W A;  4RB0 A;  1A6I A;  3SXY A;  3K8P C;  3AG1 H;  1LB2 A;  2FOK A;  6PAX A;  1OJL A;  3CCU I;  3W2A A;  2V26 A;  4KIF A;  1K78 B;  3DEU A;  1V54 H;  1V5G A;  3JRD A;  3TO6 A;  1BI1 A;  3EUA A;  4E4H A;  2HVR A;  3OYB A;  3VB2 A;  3OYF A;  2L01 A;  3RJP A;  4A3G J;  2WUI A;  3CCJ I;  3C1D A;  1SFU A;  2NX4 A;  5FO5 A;  2HQ5 A;  2K3F A;  2Y48 A;  4CYD A;  4A93 J;  3LQR A;  3M4O J;  3JTG A;  1FNN A;  2EFN A;  3VYU B;  2K4J A;  2XF6 A;  4LMY A;  4HF0 A;  1AKH B;  4IQJ A;  1QPM A;  4BE1 A;  4KJZ A;  2GIV A;  1FC3 A;  3IUO A;  1K83 J;  1OFC X;  2BW3 B;  2MFZ A;  2DPD A;  5JVG F;  2MD5 A;  1T6S A;  5IYB J;  5HBU A;  1J59 A;  2M4K A;  3SEZ A;  5F08 A;  3AFH A;  3T8R A;  1JGG A;  2WC2 A;  1SGM A;  1R23 A;  2KIU A;  2XAJ A;  1DGR M;  4QPO A;  2KPM A;  1U9O A;  2K4B A;  5DUK A;  1I6X A;  3I4P A;  4Y15 A;  2EJR A;  4GYG A;  1W36 C;  2K3P A;  4HX7 A;  3ZRG A;  5B66 C;  2E19 A;  2RAS A;  1WJE A;  3GFM A;  4A0X A;  2L2O A;  2VXZ A;  3G56 A;  2IGO A;  5AIP A;  1XB4 A;  3CDI A;  3LAP A;  1LEB A;  4PJM A;  3PO2 J;  3Q0U A;  4HX4 A;  4CCK A;  1MND A;  1G2H A;  1U5T A;  3ZQI A;  3JAM Z;  1ZH5 A;  1EA3 A;  2XV4 S;  2H8W A;  2DA6 A;  4KN4 X;  5LGT A;  2HI3 A;  1ZAR A;  1W0U A;  1FIP A;  4Y3O A;  1I1S A;  1TWA J;  2HTS A;  1I27 A;  4NUB A;  1H89 C;  4A6E A;  2E1N A;  4A3J J;  2VQL A;  3IHU A;  5TIS C;  5IT3 A;  3C07 A;  2EFO A;  1HA8 A;  2LYC A;  3EYY A;  3GO5 A;  5AIQ A;  3HG9 A;  2BZT A;  4MIM A;  3H5A A;  5DTD A;  2ZXJ A;  4HAM A;  2WB1 N;  4YEJ A;  4Y33 A;  5LEK A;  4ESB A;  4ZZD A;  2M45 A;  1QQI A;  1YW8 A;  4G6D A;  4LIU A;  2PMZ N;  3X2Q H;  3QWL A;  2KQR A;  3GTM J;  1HXD A;  1B9M A;  3S32 A;  4KMF A;  3BCG A;  5IPA A;  3N97 A;  3HTS B;  2X48 A;  3WGG A;  2XPV A;  2R7R A;  2PJR A;  2QSF X;  4FET A;  3RTR A;  3CUO A;  3VYR B;  4JQF A;  3T6N A;  4U7B A;  1NHA A;  3FHN A;  4AC0 A;  4A12 A;  1OYY A;  2LR8 A;  2RN7 A;  3AQS A;  3WTZ A;  1U3E M;  2PQ8 A;  1F36 A;  3V8J A;  3DPU A;  4XOT A;  3RPQ A;  3QQA A;  1AA7 A;  3CJT B;  1PUE E;  2XIG A;  3JRB A;  4LK1 F;  4FE4 A;  4G6Q A;  1QPI A;  2EPF A;  4IX7 A;  2CW8 A;  2L9N A;  3FMQ A;  3O8H A;  3K1N A;  4MK6 A;  1VQ9 I;  2A68 F;  5TJJ A;  5HNF A;  2ETH A;  2GAU A;  3CC4 I;  2CUZ A;  4CDG A;  3A4C A;  4JYK A;  3HRT A;  4KT5 C;  3BG3 A;  1FOY A;  3GME A;  1LFP A;  1H9G A;  2VAS A;  5D8L B;  1QRY A;  2LOO A;  4I01 A;  3FXR A;  1HKQ A;  5EZH A;  4XBF A;  1X3U A;  1PUF A;  3EYI A;  4AC6 A;  3A02 A;  3FXO A;  2R7S A;  1IRZ A;  3NS4 A;  4EM2 A;  2O61 A;  5BS6 A;  1R4M B;  2ZKZ A;  4MO7 A;  2O6G E;  5HDK A;  3TED A;  3DXJ F;  3FXK A;  2QA4 I;  2XAS A;  1WPK A;  4PUS A;  4XLE A;  1JUM A;  1S5L C;  4M74 A;  4WXH A;  3BT9 A;  4L0Z B;  4AM3 A;  3V7S A;  2V9K A;  1ZLK A;  2NYX A;  1XMX A;  2V1U A;  3TW7 A;  5BNG A;  4UUT A;  2M87 A;  2B63 J;  1U5T C;  4XRS G;  3CLQ A;  5K5R A;  3VIB A;  1JKP C;  1I3Q J;  2FF4 A;  1KU9 A;  5A2Q K;  2XUB A;  2ZO4 A;  4G9Y A;  2A3S A;  1G3S A;  1ENH A;  3J80 K;  2M9H A;  4BDY A;  2OTL I;  1W7P A;  1HCR A;  3RZD J;  2HZD A;  2FE3 A;  2IS1 A;  3HRM A;  3B81 A;  2FU4 A;  4HDV A;  3J7Z I;  2OZ6 A;  3IL2 A;  2E71 A;  2V7F A;  2PFB A;  3WOD F;  2ZJQ F;  2OCC H;  4PJJ A;  5F64 A;  2H94 A;  4CYC B;  2CUE A;  2Y30 A;  3N05 A;  4NBQ A;  3PPB A;  1KA8 A;  1VFC A;  1ZK8 A;  2EA4 A;  4IKF A;  2ZSI B;  2NAZ A;  2YR2 A;  3KE2 A;  3E7L A;  3K9T A;  2MYS A;  1YIT I;  3DLA A;  5M3F J;  4U9L A;  4AF5 A;  2Q2E A;  4XKC A;  3EET A;  1D8J A;  2CQX A;  2AXT C;  3G2B A;  2EZL A;  1VQO I;  3D5L A;  5HLH A;  1V4R A;  1C0W A;  2CV1 A;  2E1C A;  4ZYA A;  1IAW A;  1IRF A;  5EG0 B;  1ZAO A;  2R3S A;  2OZU A;  2WTE A;  2ZOZ A;  2W00 A;  3JRA A;  3BG7 A;  2ZXI A;  4BYY A;  1S72 I;  3ISP A;  4LLG F;  1D8K A;  4HZF A;  2ESN A;  3OYG A;  1P4W A;  5CVJ A;  3SEQ A;  1JUP A;  3A01 B;  3B73 A;  3MEX A;  5L3G A;  3F3X A;  1F4K A;  5D5U B;  2XC7 A;  1REP C;  2UV1 A;  1D0Z A;  1QGP A;  3C2G A;  2LTP A;  4XL9 A;  5F1R A;  5LHH A;  3PNT A;  2VKD A;  5E20 A;  1R1T A;  3C3W A;  3JW4 A;  2W57 A;  3BDD A;  4WK8 F;  2RAE A;  2A5Y B;  2VE9 A;  4HX8 A;  3UKG A;  3KZ9 A;  4QSH A;  3WE3 A;  3OYI A;  3L7W A;  1EH6 A;  3FBN B;  2K02 A;  4XLC A;  5F04 A;  3KET A;  3TP3 A;  2PG4 A;  2J5O A;  3DFG A;  1RC9 A;  1UG2 A;  3N4M A;  1OPC A;  2G7G A;  2WAE A;  1ZG1 A;  4O5V A;  1MMS A;  3PL8 A;  2QWT A;  1XDS A;  4RB1 A;  1OLT A;  3QPL A;  4AYB N;  3M1E A;  1I1G A;  2RRE A;  3ZMV A;  2CRG A;  2G7H A;  2YSR A;  1QVT A;  2V6C A;  1JTY A;  2FQ3 A;  1X58 A;  4GXO A;  4IQ4 A;  4HA8 A;  3WHC A;  1FY7 A;  4A5N A;  1MMN A;  1Z6R A;  2Z1D A;  4AVP A;  3AQT A;  1TWC J;  3E0J B;  2DMT A;  4UVC A;  2NVT J;  1BW6 A;  3MKW B;  3L00 A;  3IV5 A;  1J2X A;  4M3G A;  3OSF A;  4WCG A;  2YVE A;  1Y56 A;  2M34 A;  2E7X A;  4WXD A;  4DJA A;  5L3D A;  3ML6 A;  3UNG C;  2IGN A;  3CCE I;  4KT6 A;  2ISZ A;  1E3P A;  4U7D A;  3I53 A;  1FYK A;  3OYC A;  2M0M A;  4KFC A;  4I7H A;  4CO8 A;  5D1R A;  1G3Y A;  4HST A;  3PUF A;  2JUG A;  4Y7N J;  3HOZ J;  4KIG A;  4F91 B;  1TT5 B;  1Y6I A;  3CCS I;  4FAS D;  4LLN A;  1IGN A;  1BR1 A;  2M4G A;  3VYS B;  3FM5 A;  2YS9 A;  4XRF A;  2FX0 A;  3BZK A;  4FT8 A;  2IGM A;  4RLF A;  1FJL A;  2VON A;  4NNJ A;  3LHQ A;  3U9G A;  3BG6 A;  3GTK J;  5FGL A;  4HV6 A;  3PFY A;  1XMK A;  1UCR A;  1VZ0 A;  3F8C A;  1XDU A;  1VQ6 I;  3GTL J;  1UZC A;  4PK4 A;  1Z3Y A;  4N9H A;  1U6G A;  4E7J A;  2G9W A;  1S9H A;  1R22 A;  2DOA A;  2IEK A;  3IP4 B;  2A69 F;  1UI6 A;  4IJA A;  2ZSH B;  4G94 A;  4HYE A;  4ZDO A;  1MKM A;  3TO9 A;  5LGU A;  4C3I J;  3DCF A;  2PMU A;  1FMV A;  2UXP A;  4E70 A;  1TWH J;  4NEL A;  4AIH A;  3J81 K;  3ZQL A;  3ZMS A;  2GXA A;  5KCM A;  3SFI A;  2A61 A;  1KQ0 A;  1EF4 A;  1P4X A;  4U0W A;  3F8M A;  3IAS 2;  3EGQ A;  3HEF A;  3F22 A;  3BPX A;  1MBJ A;  1N75 A;  4CZC A;  3BQY A;  3KLO A;  2XGD A;  1HBX G;  2ZCW A;  3FM3 A;  1HDD C;  2A5W A;  2JZY A;  2OQR A;  2E2H J;  3BRU A;  5KAI C;  1USS A;  2IXS A;  4WX9 A;  3HGG A;  3ABU A;  3HOX J;  2K86 A;  4C3J J;  4EJV A;  2BYV E;  5BOX A;  3IRQ A;  3NRV A;  1O57 A;  2L7F P;  2KZG A;  2QCO A;  3T0Y A;  1YI2 I;  4HF1 A;  1S7A A;  2PJR B;  4BXX J;  3NXC A;  4IHS A;  3IH2 A;  3KIO A;  1BC7 C;  4MTE A;  3S1Q J;  1YW9 A;  4PJN A;  2XAF A;  3GWZ A;  3RKX A;  5FJ8 J;  2CO5 A;  2Y0M A;  3ECO A;  2IS6 A;  2L7K A;  2RC4 A;  1FP2 A;  3CZ6 A;  2VE8 A;  2JJ7 A;  5CVU A;  3KP4 A;  4L9N A;  4IZZ A;  4OIQ F;  2QQB A;  3K69 A;  2M2E A;  1LQ1 A;  4BH9 A;  3VVY A;  2XKO A;  3MKZ A;  1K7A A;  5JFR A;  2EFP A;  3J7A Y;  1VQM I;  5FD5 A;  2XDV A;  2ME0 A;  1I50 J;  1R5I D;  1KYZ A;  3I54 A;  5HOD A;  4ZTF A;  2QLZ A;  1G4D A;  3HTH A;  5FKO A;  3QPT A;  1Y39 A;  3L2U A;  4HEA 2;  3WG7 H;  1V5E A;  2KRF A;  4B3A A;  1E3H A;  1PUF B;  2QGU A;  3K1M A;  4CGZ A;  1SFK A;  2EB7 A;  1WJC A;  2CUF A;  3IAM 2;  4ME9 A;  1Z7L A;  3AG2 H;  1XCB A;  1IG7 A;  1W7P D;  3DTI A;  3M1C A;  4B47 A;  3TGN A;  1XGM A;  2NNN A;  4UVB A;  3W3C A;  2QWW A;  1XD7 A;  2XGE A;  2YU9 J;  4KYW A;  3S15 J;  3CTA A;  3OOU A;  3JSJ A;  4A3F J;  1RET A;  3S93 A;  3ZR8 X;  2E36 A;  2HOS A;  2OJE D;  5D6E A;  3S3O A;  2A05 A;  4C2M J;  2ZNY A;  5BPD A;  4A2U A;  5JHF A;  2EIN H;  2MLK A;  3H9G A;  4R8H A;  2GEN A;  2WGB A;  3GX4 X;  2QKO A;  3HOS A;  5HDN A;  5D6F A;  3LMM A;  4C2U A;  1W7P B;  3COA C;  4DYQ A;  3K1P A;  1T0F C;  3B6A A;  4E7S A;  5B5E C;  4L9V A;  4EJT A;  2ZC2 A;  1IDY A;  3K7A J;  1VTN C;  1P6R A;  1ZGJ A;  2KMU A;  3NRG A;  1D1C A;  1TQI A;  4ZDP A;  3ZMT A;  4UVA A;  5GP9 A;  1NG6 A;  5J8C A;  4XLP F;  4XN3 A;  2ZFW A;  4Q48 A;  3BG9 A;  3IKT A;  4ESJ A;  1NH3 A;  3M7G A;  5IYC J;  4UY8 I;  3RIR A;  2ZME A;  4AIK A;  3HYI A;  1BL0 A;  2K5C A;  1DDN A;  2Q2E B;  1WH7 A;  3OYK A;  2A6E F;  2XAU A;  3IH4 A;  1JKO C;  2C6Y A;  1LE8 A;  5EDN A;  4AIJ A;  2VBY A;  2EH3 A;  3HJE A;  5FLX Z;  1PJR A;  1XCV A;  2VJI A;  3ZN1 A;  4LIV A;  1UST A;  4A0Z A;  2ZCN A;  3CWR A;  3HB9 A;  3L9F A;  1O7F A;  1ERD A;  1G59 A;  3HM5 A;  3VVZ A;  4DZJ A;  3CCL I;  2JRT A;  2B0L A;  3M8J A;  1RES A;  4B43 A;  4XLH A;  3A2K A;  3IH3 A;  1WWX A;  4KA4 A;  2X6W A;  1IO2 A;  2BXY A;  1RUO A;  4HF2 A;  5K1Y A;  1FP1 D;  3P9C A;  4WIB A;  1W0T A;  1DU0 A;  3BJB A;  1D1B A;  2YX4 A;  4Y13 A;  3IUV A;  1X1C A;  1ONV A;  4CCM A;  2VPR A;  3HRS A;  2MC4 A;  2V57 A;  3K2A A;  2CWE A;  2WAQ A;  4H4K C;  4UV8 A;  1OCC H;  5E18 F;  4XSX F;  4IHY A;  1OIS A;  3E97 A;  2B1E A;  2FSW A;  3KZZ A; 
#chains in the Genus database with same CATH homology
 3KKC A;  1G2H A;  2HYT A;  2QTQ A;  3VVX A;  3ZQI A;  4BY1 J;  1RPW A;  4HKU A;  2HOA A;  2DA6 A;  3BHQ A;  3ZOB A;  4A3C J;  2HI3 A;  2DJN A;  3KKD A;  1ETW A;  3TP0 A;  2YUS A;  1FIP A;  4RDU A;  1W0U A;  1FTZ A;  5D18 A;  1TWA J;  2HKU A;  2EQR A;  1H89 C;  2Y0S N;  2VI6 A;  4A3J J;  3C07 A;  2R5Y A;  3PO3 J;  1JUS A;  4MIM A;  5DTD A;  3B6C A;  3CRJ A;  2IBD A;  2WB1 N;  4A69 C;  1JKQ C;  1NTC A;  4JX5 A;  3HOU J;  3HOV J;  4ACI A;  3NI7 A;  4GCK A;  4DZP A;  2PMZ N;  3E7Q A;  3ON2 A;  4J19 A;  3HBL A;  3GTM J;  2PBX A;  2HOT A;  4A3M J;  3GTQ J;  1ZQ3 P;  1SAN A;  4HNV A;  3L1P A;  3G1O A;  3BCG A;  5IPA A;  1ZR2 A;  1YRN A;  3VPR A;  2X48 A;  5J1Y A;  2XPV A;  5F0H A;  3FKI J;  3LWJ A;  3MVP A;  3M3Y J;  3A01 A;  2PZ9 A;  3T6N A;  2CU7 A;  1TC3 C;  1XS9 A;  1ZR4 A;  1HLV A;  3EUP A;  3W6V A;  4GCT A;  4AC0 A;  2LR8 A;  1HOM A;  5EGO A;  5CW8 A;  1GT0 C;  2D5V A;  3AQS A;  2LVS A;  1F36 A;  3JRC A;  1AHD P;  5IYD J;  3QQA A;  1P7J A;  2NOG A;  4AUX A;  3JRB A;  2ZB9 A;  4FE4 A;  4GCL A;  1QPI A;  1ETK A;  1IV6 A;  5E3O A;  4XID A;  3WHB A;  4QIW N;  3VUQ A;  3O8H A;  1GUU A;  4A3E J;  2M8G X;  4B4C A;  4MK6 A;  4D5C A;  5CXG A;  2HDD A;  1XG1 A;  1UI5 A;  1LFB A;  4JYK A;  3BG3 A;  5H9T A;  1MBH A;  2NP3 A;  1QRY A;  3HGY A;  3MN2 A;  5EZH A;  3DPJ A;  1PUF A;  4AC6 A;  3A02 A;  1JTX A;  3FIW A;  5EEA A;  1IRZ A;  1H8A C;  1MNM C;  4JX6 A;  3BR0 A;  4MO7 A;  3TED A;  2DMQ A;  2O7O A;  3ON4 A;  2COB A;  1FIA A;  2XPU A;  1WPK A;  2DA5 A;  4Y52 J;  1JUM A;  3CCY A;  4DW6 A;  1MH4 A;  5FHP A;  3A03 A;  5GPA A;  3BT9 A;  4V2G A;  2H8R A;  5DAJ A;  2MGQ A;  2K9S A;  3MNL A;  3BR3 A;  2OPT A;  4FCY A;  3S14 J;  2DTZ A;  3QKX A;  3TW7 A;  5BNG A;  3VP5 A;  4UUT A;  2B63 J;  4JX4 A;  2W48 A;  4XRS G;  3BR6 A;  3O60 A;  4D5F A;  3GTG J;  1JKP C;  2LP0 A;  3VIB A;  1I3Q J;  3VW2 A;  3CJD A;  3VOX A;  2D6Y A;  1XC5 A;  4V2F A;  1ENH A;  2M9H A;  3HE0 A;  5FKM A;  1HCR A;  2LD5 A;  3RZD J;  3B81 A;  2E1O A;  1MSF C;  3VOK A;  2JK3 A;  2M0C A;  2DN0 A;  1U8B A;  2UXO A;  3JRI A;  1B72 B;  1JT0 A;  4CYC B;  3NPI A;  2CUE A;  2Y30 A;  3PPB A;  4UDS A;  2NP5 A;  3FRQ A;  2X9D A;  4UUS B;  1VFC A;  1ZK8 A;  1T33 A;  1B8I A;  5M5Y J;  3E7L A;  3HDD A;  1ETQ A;  5C4X J;  5M3F J;  2R5Z B;  3D1N I;  4AF5 A;  2CQX A;  1K61 A;  2EZL A;  4CGR A;  1UHS A;  2EZI A;  4L5E A;  4IHX A;  4FTH A;  2JA6 J;  1AKH A;  3GTJ J;  1T56 A;  2IU5 A;  3ZQC A;  4IHV A;  4X1E A;  1R9T J;  2DA1 A;  2NS7 A;  5EG0 B;  2NS8 A;  5E3N A;  3JRE A;  4GFL A;  1NK2 P;  1BA5 A;  1IDZ A;  2W53 A;  4YZE A;  2ME6 A;  2ZOZ A;  3JRA A;  5M5X J;  4MXM A;  1ZTR A;  4EEF G;  4S0H B;  2FD5 A;  2LK2 A;  2TCT A;  1X2N A;  1SFO J;  1JUP A;  3A01 B;  2WAQ N;  2Y9Z A;  2OI8 A;  3LSP A;  2ID3 A;  5F0C A;  3GTP J;  5E3M A;  2R7Z J;  3RH2 A;  2K9Q A;  2LTP A;  1WGX A;  2LFB A;  3JRF A;  2RAE A;  5JLW A;  3QPS A;  3S2H J;  2K40 A;  2O8K A;  3OSG A;  3UKG A;  1ETX A;  3KZ9 A;  2HXO A;  4QSH A;  2KT0 A;  1F43 A;  2ECC A;  3ZQG A;  4A3B J;  1GDT A;  1FTT A;  3RKQ A;  5F04 A;  2I10 A;  2NVX J;  3TP3 A;  2NVY J;  1P7I A;  1UG2 A;  2G7G A;  3S1N J;  3V78 A;  1UMQ A;  2G0E A;  1O4X A;  3VW1 A;  3F1B A;  5FLV A;  4MFE A;  1OCT C;  2QWT A;  4NN1 A;  1POG A;  4W97 A;  3ANG A;  5J1R A;  4JKZ A;  3QPL A;  4AYB N;  4B1R A;  3QBM A;  2CRG A;  1QVT A;  4XRS A;  1A5J A;  3Q0W A;  1JTY A;  1X58 A;  2MSY A;  3WHC A;  4GFB A;  1LFU P;  3AQT A;  1TWC J;  3RD3 A;  2DMT A;  2NVT J;  5EYR A;  1BW6 A;  3IV5 A;  4BKX A;  3RQI A;  1LE8 B;  4M3G A;  1JT6 A;  1APL C;  2YVH A;  3OSF A;  1BW5 A;  4ICH A;  2YVE A;  2M34 A;  2KDZ A;  5K7F A;  2R0Q C;  2UXU A;  3BR2 A;  2DA7 A;  2G7S A;  3BTI A;  2XB0 X;  3ZQH A;  4IHW A;  2L7M P;  1H88 C;  3GZI A;  1TWG J;  3BTJ A;  1Y1W J;  4JNN A;  2AO9 A;  1VI0 A;  2DA4 A;  2MG4 A;  2EZK A;  3Q0V A;  3I4N J;  2R93 J;  5IP9 J;  4KWA A;  5J1U A;  3FK6 A;  5D1R A;  5FLM J;  4Y7N J;  2AHQ A;  3HOZ J;  1Z0X A;  1JJ8 C;  1IGN A;  2CQQ A;  4BY7 J;  3H0G J;  5AQC A;  3GBG A;  3LSJ A;  1JJ6 C;  2YS9 A;  1ZKG A;  2XSD C;  2FX0 A;  1NK3 P;  1ORK A;  3TW6 A;  1FJL A;  5C4Y A;  2GBY A;  2G7L A;  1MBF A;  3G1L A;  2QIB A;  3LHQ A;  3GTK J;  5FGL A;  2QOP A;  5J3L A;  2DA2 A;  1MH3 A;  3GTL J;  4DYC A;  5DS9 A;  5FKK A;  1CQT A;  2JA7 J;  4A3D J;  2Q24 A;  2LLK A;  3NNR A;  2IEK A;  1AU7 A;  2G3B A;  2DMN A;  1UI6 A;  4I6Z A;  4C3I J;  4XRM A;  4BBS J;  1FEX A;  3DCF A;  5F1J A;  2P81 A;  3S16 J;  2UXP A;  1TWH J;  2TRT A;  4NEL A;  3S5R A;  1BJZ A;  4I76 A;  3ZQL A;  3HTA A;  1U78 A;  2Y9Y A;  3SFI A;  3ZQF A;  2R5Y B;  1JKR C;  1EF4 A;  3OIO A;  3BQZ A;  3EGQ A;  3HEF A;  1MBK A;  3S17 J;  1MBJ A;  5M3M J;  3BQY A;  3COL A;  2REK A;  2K9N A;  4NDL A;  3BR5 A;  2XGD A;  1HDD C;  2XB5 A;  3BR1 A;  2FJ1 A;  2HXI A;  2FQ4 A;  2E2H J;  2UXH A;  2N8G A;  2XPW A;  4M6V A;  3BRU A;  5K7Z A;  3HGG A;  2ZCX A;  5IOY A;  4D7N A;  3HOX J;  4X6A J;  2IAI A;  1YRN B;  4C3J J;  2OER A;  4LOC A;  3KNW A;  2ECB A;  3NAR A;  2HYJ A;  3HIM A;  2L7F P;  3LOC A;  4M3D A;  2QCO A;  3SDG A;  2WV1 A;  1Q1V A;  2JN6 A;  1U9N A;  1MSE C;  4BXX J;  3PAS A;  3NXC A;  2EZH A;  2F07 A;  4M3E A;  4A3K J;  3IH2 A;  1GV5 A;  2VKE A;  3BTC A;  4XIC A;  2E2I J;  3S1Q J;  5FJ8 J;  3G7R A;  2L0K A;  1B72 A;  5EGO B;  4CYC A;  2H1K A;  1I6H J;  2QF7 A;  4UUS A;  2XRL A;  3S2D J;  3NAU A;  2JJ7 A;  2Y31 A;  1VND A;  4PXI A;  5K7H A;  2JMW A;  4BBR J;  4C3H J;  2GFN A;  2M2E A;  2R5Z A;  2ZCM A;  4G12 A;  3CMY A;  1D5Y A;  3VVY A;  4FE7 A;  1WH5 A;  3I4M J;  2CJJ A;  4GFK A;  5D19 A;  1WI3 A;  1HF0 A;  3F0C A;  5CXI A;  1MBE A;  4A3I J;  2L7Z A;  1I50 J;  2ME0 A;  5HOD A;  3BG5 A;  2E2J J;  1GV2 A;  1RR7 A;  3HTH A;  5EF6 A;  5EG0 A;  2X6O A;  5FKO A;  3S1M J;  2O9L A;  4FIS A;  3BNI A;  2NVQ J;  3VW0 A;  5M5W J;  5F27 A;  1ETV A;  5IOZ A;  4B3A A;  1OCP A;  1PUF B;  2XDN A;  2RHA A;  4IEJ A;  1MBG A;  5IP6 A;  1ITY A;  2CUF A;  1WCM J;  4ME9 A;  2XGC A;  3LNQ A;  3HOW J;  2UXI A;  1GVD A;  3LSR A;  1IG7 A;  5FKL A;  3HOY J;  5C3E J;  1RKT A;  2ID6 A;  2VUM J;  1IJW C;  2DG7 A;  3P9T A;  4MLO A;  4XK4 A;  2ELK A;  2XGE A;  3JRG A;  5JLX A;  3C2B A;  3FIS A;  2YU9 J;  2DMP A;  3S15 J;  2ZOY A;  3LJL A;  3OOU A;  1IUF A;  3JSJ A;  4A3F J;  1RET A;  5GPC A;  2LKX A;  3V6G A;  2VKV A;  3MKL A;  2HOS A;  5C44 J;  4C2M J;  1TWF J;  3O8G A;  2GEN A;  1HDP A;  3FK7 A;  2WGB A;  3ANP A;  2QKO A;  1RKW A;  4L62 A;  1DU6 A;  2L9R A;  2MW8 A;  1A6I A;  1Y1V J;  4DYQ A;  2FBQ A;  3B6A A;  5K58 A;  3GTO J;  1IDY A;  1OJL A;  3K7A J;  5E3L A;  3JRH A;  3NRG A;  2DA3 A;  3JRD A;  1S7E A;  4JL3 A;  5FMP A;  5GP9 A;  3H3V K;  9ANT A;  4A3G J;  1ETY A;  3BG9 A;  1B8I B;  2NX4 A;  2WUI A;  2JWT A;  5IYC J;  2HQ5 A;  5HSZ A;  2GUH A;  5C4J J;  2LY9 A;  3RZO J;  1BL0 A;  4A93 J;  3M4O J;  1WH7 A;  2JA5 J;  1X2M A;  3CDL A;  3IH4 A;  2Y2Z A;  4MFD A;  4RBO A;  1JKO C;  1LE8 A;  5EDN A;  1AKH B;  2DMU A;  3LSG A;  3HTJ A;  2EH3 A;  2R92 J;  1K83 J;  1ETO A;  1OFC X;  1VF9 A;  3Q3S A;  2ZCN A;  3CWR A;  3HB9 A;  4QTR A;  4ABZ A;  3HM5 A;  3PM1 A;  3HKZ N;  3G1M A;  1Z77 A;  3VVZ A;  4DZJ A;  1QVU A;  5IYB J;  2GLO A;  5HBU A;  2JA8 J;  2EBI A;  5F08 A;  5EFY A;  1RES A;  1JGG A;  2GM4 A;  1IC8 A;  2DG8 A;  3IH3 A;  1SGM A;  5HAW A;  1ZGW A;  3JR9 A;  3S1R J;  4M3F A;  3SJM A;  4DYR A;  1W0T A;  1DU0 A;  3BJB A;  3GEU A;  1U9O A;  4JP0 A;  3DEW A;  3IUV A;  4A3L J;  4W1U A;  4M3B A;  5EZG A;  4D7M A;  3BTL A;  2RAS A;  2E19 A;  3HTI A;  2VPR A;  3CQZ J;  2O7T A;  2V57 A;  3K2A A;  5F0F A;  3G56 A;  4IHY A;  2OF7 A;  5IP7 J;  5FKN A;  1E3O C;  3PO2 J;  3Q0U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...