3QPSA

Crystal structures of cmer-bile acid complexes from campylobacter jejuni
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
202
structure length
202
Chain Sequence
TPSQKVLARQEKIKAVALELFLTKGYQETSLSDIIKLSGGSYSNIYDGFKSKEGLFFEILDDICKKHFHLIYSKTQEIKNGTLKEILTSFGLAFIEIFNQPEAVAFGKIIYSQVYDKDRHLANWIENNQQNFSYNILMGFFKQQNNSYMKKNAEKLAVLFCTMLKEPYHHLNVLINAPLKNKKEQKEHVEFVVNVFLNGINS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords CmeR
publication title Crystal structures of CmeR-bile acid complexes from Campylobacter jejuni.
pubmed doi rcsb
source organism Campylobacter jejuni
total genus 78
structure length 202
sequence length 202
ec nomenclature
pdb deposition date 2011-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3qpsA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3qpsA02
1MSFC 1X2MA 1TWAJ 1MNMC 2GLOA 3GTOJ 4JX4A 5J1UA 2H8RA 2GFNA 1NK3P 2R7ZJ 2AHQA 1RPWA 4M3DA 1PUFA 3NXCA 3PO2J 2G7GA 1WH5A 2G0EA 1RKWA 4AUXA 2QCOA 3BT9A 3ZQGA 5IOYA 1JGGA 3VVZA 3GTGJ 4MIMA 3S5RA 5F0FA 3HGYA 3TW7A 4M3EA 4M6VA 3LJLA 2DMNA 3OSFA 1WH7A 2QTQA 1F43A 3MNLA 3ZQHA 2R93J 3P9TA 1JTYA 3BJBA 1G2HA 1O4XA 4X1EA 2HQ5A 4V2GA 2Y30A 3TP0A 3W6VA 3C07A 4JYKA 5IP9J 1FIAA 4UDSA 2DA1A 3Q0UA 3BR2A 1ZR4A 2M0CA 1ZR2A 2NX4A 2WB1N 1IUFA 2EZKA 3ZOBA 1D5YA 3O60A 3NI7A 1ETQA 2XB0X 2XB5A 1YRNB 1VI0A 3ZQIA 1W0UA 3EGQA 4JX6A 4GFLA 3NARA 4NDLA 2NVXJ 2DA6A 5D1RA 3A03A 5F04A 2NP3A 3HTAA 3L1PA 2MGQA 2LVSA 4NELA 4S0HB 2ZOZA 5EG0B 1JUSA 4ABZA 3WHCA 1FJLA 2L9RA 2O9LA 3JSJA 4DYRA 3S17J 3SDGA 2WUIA 3A01B 2NS8A 3K7AJ 2ID6A 2LKXA 1IRZA 1H88C 3B6AA 1X58A 2V57A 1BL0A 3BTCA 3H0GJ 1CQTA 3S1NJ 3O8GA 3I4MJ 3VPRA 2NVQJ 4Y52J 4A3CJ 2UXPA 1AU7A 3M4OJ 3S1RJ 2GENA 2GUHA 1S7EA 2VUMJ 1ETYA 3D1NI 5FKKA 1U8BA 2JA7J 3T6NA 2L7ZA 3FKIJ 4I6ZA 2W53A 3RKQA 2M9HA 1Y1WJ 5K7HA 1UI5A 3PPBA 2DA2A 3VVYA 5GPAA 4XRSG 1P7IA 3H3VK 2CUFA 2REKA 1B8IB 2EZIA 2Q24A 2CJJA 2FD5A 3ZQLA 5FKMA 4D5CA 1DU6A 4A93J 2EZHA 2N8GA 5EFYA 4MK6A 2YU9J 1APLC 3TEDA 3CRJA 1JT6A 2EH3A 4L5EA 2ZCNA 4X6AJ 2X48A 3QQAA 4RDUA 1RKTA 1FEXA 1GV2A 4NN1A 3FK6A 3JRFA 4B4CA 1MBGA 4QSHA 4D5FA 2LK2A 4ACIA 3ON4A 1JUMA 3CMYA 4A3FJ 3G7RA 3CJDA 5FMPA 2ZCMA 4JP0A 3BR0A 4M3FA 5J3LA 2PBXA 2YS9A 2UXIA 5C44J 5IP7J 2XGCA 1WCMJ 2ME0A 3HBLA 1ZGWA 3HOYJ 4C3IJ 2CUEA 3B81A 1MBJA 3LNQA 1I3QJ 3S2DJ 5F08A 3BRUA 5C3EJ 3BR1A 1UG2A 2JN6A 5GPCA 1PUFB 5K7FA 3AQSA 3LSPA 2K9QA 3SFIA 1FTTA 2VKEA 3COLA 1VFCA 1WGXA 5FKOA 2D6YA 2DMQA 2Y31A 2LTPA 4B3AA 5E3MA 2R5ZA 2E2HJ 5DAJA 2L7FP 4XIDA 4AYBN 3QBMA 3LHQA 4XRSA 1ZKGA 1JKRC 2LFBA 2XPUA 2EZLA 1ETOA 1POGA 1AKHA 3ZQCA 5F0HA 4IHXA 2IU5A 1AHDP 5FJ8J 1JJ8C 2JA6J 2DG7A 3HB9A 2LR8A 2G7SA 3G56A 3V78A 2DN0A 4J19A 1E3OC 5EGOA 2XPWA 3BR6A 4EEFG 1T56A 4JNNA 3HKZN 4FTHA 1Z77A 1HF0A 1MH4A 2E2JJ 3BCGA 1JKQC 1W0TA 1IJWC 1ETVA 1Q1VA 2G7LA 3OIOA 3PM1A 3ANGA 3VW1A 2NVYJ 2M2EA 2DA5A 1TWGJ 1JKOC 2FX0A 1NTCA 4A3KJ 4FCYA 2YUSA 2ZCXA 2R5YA 3DPJA 2MW8A 3G1OA 3HM5A 2UXOA 1HDPA 4BBRJ 2XGDA 2XGEA 1QPIA 3JREA 1IGNA 3HOZJ 2COBA 2MSYA 4CYCA 3CWRA 3HE0A 4HNVA 4A3IJ 4LOCA 4UUTA 3BTLA 3NNRA 5H9TA 2RASA 1T33A 4A3EJ 4C3JJ 5M3FJ 2AO9A 2LLKA 2MG4A 3MVPA 3G1LA 3HOXJ 3RD3A 3ON2A 1I50J 1UMQA 1Y1VJ 5FGLA 5EEAA 4YZEA 3RH2A 4A3DJ 3QPSA 4KWAA 3GTLJ 2Y9ZA 4AC0A 1U9OA 1SGMA 2X6OA 5FKNA 4Y7NJ 2Y2ZA 3F0CA 1XC5A 4MLOA 5IYDJ 2HXIA 5M5YJ 1JUPA 3GTMJ 4A3GJ 4C3HJ 2DMUA 4A3MJ 3JRHA 3DCFA 1BA5A 1EF4A 2WAQN 1XG1A 3G1MA 2ZB9A 3BR3A 4QTRA 3GTPJ 2F07A 4MXMA 2IBDA 3HOWJ 1JJ6C 3CQZJ 1B72A 3FISA 3BQZA 3PO3J 3HEFA 2DMTA 3BTIA 3BTJA 1ORKA 1QVUA 1FTZA 2HKUA 4ME9A 4I76A 1GT0C 3IH3A 2TRTA 2DA4A 4M3GA 5HAWA 1VF9A 4DZPA 3B6CA 4A3JJ 3NRGA 4BBSJ 2H1KA 3BHQA 5AQCA 4L62A 5C4XJ 4IHYA 5EF6A 1UI6A 1OCTC 3NPIA 1GV5A 5HODA 5F27A 3JRCA 3UKGA 2ECCA 2RHAA 2PZ9A 3EUPA 1GUUA 1LFUP 2XRLA 4MFDA 1F36A 3JRGA 2M8GX 1H89C 1WI3A 1SANA 2HDDA 3VOXA 1SFOJ 2HOTA 4UUSB 5J1YA 3ANPA 3I4NJ 3RZDJ 5IYBJ 2NS7A 1MBEA 5M5XJ 3S16J 4CGRA 1U9NA 4XICA 5HSZA 2UXHA 4AC6A 2QWTA 3JRDA 2HYJA 2TCTA 4JKZA 3HGGA 2GBYA 2R5ZB 1H8AC 1TWFJ 4DW6A 5D19A 2EBIA 3GBGA 3PASA 3VVXA 1MBHA 1AKHB 2B63J 2QIBA 2NP5A 5J1RA 5DTDA 4GCKA 2OERA 1HLVA 5EGOB 4JX5A 1OFCX 3S15J 3LSRA 1RETA 3IH4A 2HI3A 5CXGA 2YVEA 5EZGA 2UXUA 5K58A 1QVTA 3MN2A 2O7OA 2K9NA 3BR5A 3NAUA 2E2IJ 5CXIA 3VW2A 3QPLA 2R0QC 3MKLA 4AF5A 4FISA 4V2FA 5D18A 3S1MJ 3GTQJ 2K9SA 4FE7A 3KKDA 2HYTA 3LWJA 5EYRA 1ZK8A 2R5YB 3BG3A 1ZQ3P 2DJNA 3VUQA 2CQQA 5M5WJ 3RZOJ 1GVDA 2LP0A 2QF7A 2FBQA 3WHBA 1LE8A 3CCYA 5CW8A 3E7LA 4DZJA 2HXOA 4D7MA 1RESA 2KDZA 4CYCB 2CQXA 4A3LJ 3S2HJ 5JLWA 2Y0SN 1ZTRA 1HOMA 3ZQFA 3BNIA 3Q0WA 2CRGA 1HCRA 3HTJA 4BXXJ 2HOAA 2JA8J 3GEUA 3JRBA 3TP3A 2JMWA 4MFEA 2ID3A 2NVTJ 3BQYA 4XRMA 1U78A 4MO7A 5IYCJ 5K7ZA 2YVHA 2QOPA 3HOUJ 3FIWA 2Y9YA 2XPVA 2QKOA 1UHSA 4IHVA 2VKVA 2IEKA 2OF7A 4GCTA 3JRIA 4IEJA 3LSGA 4B1RA 4G12A 3K2AA 3JRAA 2DA7A 2M34A 3LSJA 4HKUA 3LOCA 4DYCA 3O8HA 1ETXA 1TWCJ 5E3NA 2E1OA 2DMPA 4GCLA 2E19A 2GM4A 3JR9A 1B72B 2L7MP 3IH2A 2HOSA 1XS9A 1QRYA 4IHWA 2OPTA 2EQRA 2IAIA 1I6HJ 2G3BA 4QIWN 5HBUA 1R9TJ 5JLXA 1YRNA 4D7NA 2L0KA 1RR7A 1NK2P 4XK4A 1OCPA 5BNGA 4FE4A 2X9DA 3QKXA 4C2MJ 1JT0A 3KNWA 3GTJJ 3VIBA 4A69C 5FKLA 4BKXA 5M3MJ 1JTXA 1IG7A 1IDZA 3IV5A 5EG0A 3HOVJ 4BY7J 3VP5A 1MH3A 3AQTA 4M3BA 1WPKA 1IDYA 5F1JA 5FHPA 5GP9A 1BW6A 5DS9A 2LD5A 4ICHA 2WV1A 2WGBA 4W1UA 2D5VA 3A01A 2W48A 4GFKA 3FRQA 2JWTA 3DEWA 2ECBA 3TW6A 3S14J 5C4YA 1FIPA 3IUVA 1IV6A 5C4JJ 4A3BJ 3HTIA 4JL3A 4W97A 5E3LA 1Z0XA 2FQ4A 3F1BA 1OJLA 3SJMA 2ELKA 2XSDC 4DYQA 9ANTA 1IC8A 3OOUA 2DA3A 3S1QJ 2PMZN 3GZIA 2DG8A 3E7QA 1MBFA 3OSGA 3VOKA 1LFBA 2VI6A 3CDLA 1MBKA 1ETWA 2OI8A 1BW5A 2ME6A 3BG5A 3HIMA 2VPRA 5IOZA 5EDNA 1TC3C 2XDNA 1B8IA 1A6IA 4BY1J 2R92J 1K61A 3HTHA 2RAEA 2K40A 1JKPC 1P7JA 1MSEC 3KZ9A 1BJZA 5F0CA 3RQIA 3A02A 1K83J 3Q0VA 5IP6A 3HDDA 2JJ7A 2JA5J 2O7TA 4PXIA 2LY9A 2NOGA 1ENHA 2I10A 3GTKJ 2DTZA 2P81A 2JK3A 1TWHJ 3KKCA 5E3OA 1A5JA 3BG9A 1VNDA 3FK7A 1X2NA 5IPAA 5FLMJ 3M3YJ 1DU0A 2ZOYA 1LE8B 3V6GA 2CU7A 2KT0A 1HDDC 4UUSA 1GDTA 5EZHA 2O8KA 4GFBA 1ETKA 3Q3SA 2FJ1A 5FLVA 1ITYA 4RBOA 3C2BA 3VW0A
chains in the Genus database with same CATH superfamily
1MSFC 1X2MA 5CQGA 1WHUA 2V9KA 2XVCA 4L9TA 4CA0A 1XDSA 5D8LB 4M3DA 3HXLA 3AG1H 3I3LA 3EYYA 3MZHA 2XAUA 3FHNA 3MD2A 2Z5UA 1IN5A 1T08B 1Y0NA 2P7CB 1KQ0A 3OSFA 1IZ1A 2WBMA 1EKEA 2ZXHA 1MMNA 4HAMA 3VYSB 4G7ZF 2QQBA 3QPHA 3VSLA 2R93J 1JTYA 2DU9A 2P5LC 4X1EA 4BAYA 2NOJB 1MJBA 3H0DA 1T98A 4UHTA 2E1MB 1YS6A 2M4GA 3TQNA 5IP9J 4PDKA 2R7XA 2X4HA 2Y0SA 3BR2A 1Z3XA 4ESFA 3G3ZA 2BVMA 3CCQI 1J7KA 2NX4A 2ZSIB 1T38A 3I0TA 3PJRA 1ETQA 1YQAA 2M1BA 5DM6F 2PFBA 3ZQIA 1HKSA 3F72A 2X1CA 4R1HA 4NDLA 5ICEA 2DA6A 3GUDA 1RUOA 3A03A 5D1RA 2NP3A 4EV0A 3SDBA 2LF7A 3GFLA 2FJI1 5ILUA 3HTUA 3L1PA 4RA2A 4DOZA 3U9GA 2E7XA 3R6SA 2QQAA 1XSXA 3BPVA 3I59A 4ABZA 1FZPB 3TO6A 4HSTA 1A31A 2UZKA 4QPOA 1L3LA 1IRGA 2CQ7A 2M7AA 3IP4B 4XKCA 1IRZA 1OLTA 2DQLA 2K5CA 4KJZA 5DDGA 3S1NJ 2QLZA 3N4MA 4Y52J 1D5VA 1D0ZA 2F5EA 2PEXA 1VQ7I 3M4OJ 3CO6C 3FBNB 3MEXA 2FBIA 3AG4H 3T6NA 3DTIA 3FKIJ 5ERIA 3RKQA 2M9HA 1Y1WJ 2MC4A 2LMDA 4IQ4A 3PIPF 1HC8A 4NBQA 1HKTA 3CMMA 3F8BA 2CQKA 2W82A 5AONA 2REKA 4BQAA 1B8IB 1YW8A 3IL2A 4B47A 3W2AA 1BR1A 4D5CA 2V1NA 1LFPA 4D1QA 2N8GA 1JT6A 2EH3A 2ZCNA 5KAFC 4XLNF 1MDMA 3QQAA 2YU3A 2DOAA 1GV2A 1XMKA 2VE9A 5E79C 5HOOA 3P9CA 1J0RA 1X4OA 3JAMK 4XRFA 1CGPA 3CJDA 2ZCMA 5GTHC 1WCMJ 3W3CA 2CS3A 1ZGWA 3HOYJ 3ZQQA 2GA2A 2QKLB 2HKXA 4DBRA 3LNQA 4KMFA 4F55A 5KHDA 1ZRFA 2BHYA 3SQNA 3A1YA 3Q5FA 3DV8A 4OD4A 2O3FA 1PUFB 4UV8A 1MMDA 5K7FA 3LSPA 3PL8A 1FTTA 5E18F 3COLA 1TLHB 1J5YA 2XRNA 2QQ8A 2IRFG 1QNTA 1I27A 4YELA 3HRMA 2MC3A 5E3MA 4XIDA 1KYWA 4UV9A 3QBMA 5HLTA 2CGPA 1ZKGA 4Y17A 4PJNA 3OL3A 4X0GA 5DV5A 2IU5A 2VJ4A 4PK4A 1JJ8C 1LDDA 1Z1DA 3BJ6A 2DG7A 4Q4ZF 2QEXI 3HB9A 2LR8A 3S93A 1NHAA 2EA4A 2DN0A 2EFWA 5EGOA 4EEFG 3CC2I 2X6WA 2E2JJ 3ZR8X 1MH4A 3R0JA 4GGGA 1W0TA 1G6NA 3LMMA 5IT3A 3FXOA 2Z33A 1LPQA 2ZC2A 2VJ5A 2NVYJ 5CKTA 4KNYA 4LK1F 2DA5A 1TWGJ 2EJRA 4OAYA 3LSTA 2FX0A 1HA8A 1NTCA 2HTJA 4UVCA 2JQ7A 2YUSA 1BC7C 3COAC 3LSKA 2EIJH 1YTYA 3HM5A 4IOAF 1HDPA 2LDUA 1MD0A 3I54A 2XGDA 2ESNA 2KIQA 4BJTA 1QPIA 2A5YB 2COBA 2MSYA 3RSNA 4XOTA 3AL0C 3ABUA 3HE0A 2PMUA 4S04A 3MQ0A 4UUTA 1FBUA 3H36A 4Y4RA 5LGNA 4A3EJ 3NNRA 2AO9A 4G6QA 4G7OF 2WB1A 1IUYA 4KYWA 3E5QA 2IS6A 3HOXJ 4LLNA 5J4VA 1R5ID 2YX4A 3CUQC 1I50J 5FGLA 2H09A 2DBBA 3RPUD 2LKSA 1JXSA 2VQGA 2Y9ZA 1SGMA 4Y7NJ 4ENJA 5DD4A 1R00A 1XC5A 2V79A 4MLOA 4I09A 3K1NA 1FBQA 3OYGA 4HF0A 3ZMUA 1O3RA 4A3GJ 4C3HJ 3G71I 2K9LA 1BA5A 1EF4A 1XG1A 2LYCA 5TGTA 2HYFA 3GMEA 2JA2A 2OD5A 2OQRA 2XASA 4HBLA 3LSMA 5DUIA 1G3YA 3FISA 1B1BA 1B4AA 5D6FA 2OCEA 4ME9A 2TRTA 1XPXA 1YFHA 1SD6A 4M3GA 5HAWA 4H4KC 4CSWA 4YG2F 3B6CA 2F5VA 4A3JJ 3NRGA 2F5CA 2H1KA 5K5OA 1IN8A 3WG7H 2B9SA 4L62A 1OISA 3H3ZA 2L5QA 3BPXA 2QKMB 2ZSHB 3HUGA 5K5RA 1GV5A 2KDOA 5BS6A 3GLXA 3RJPA 5HODA 5F27A 2PJPA 4HZFA 2NXNB 3HRUA 3UKGA 2RHAA 5K5QA 3CCEI 1H9GA 3BZCA 1LFUP 3OIQA 4KT6A 2FEZA 3EUKL 5HS9A 2WY7Q 2OTLI 2I5UA 5J1YA 3I4NJ 5JVGF 1TNTA 3CD6I 3T0YA 1MBEA 4CGRA 2VBXA 4WXHA 3JSPA 4II3A 2ISYA 1KGSA 1W7PD 2L9NA 2R5ZB 4JKZA 3F23A 3CJTB 3DFGA 3GZNB 2EBIA 1Y6IA 4BQQA 3PASA 4HQMA 4ZH4F 3VVXA 1ONVA 2FQ3A 4IL6C 2QIBA 2FOWA 2X51A 1MZBA 2EPFA 2JVGA 5DTDA 1FOXA 2OERA 1HLVA 4DVYP 1RETA 4WXCA 5CXGA 1UHMA 5EZGA 5FLXZ 2XGXA 1BR4A 1QVTA 2HVSA 5CLSA 2ZY9A 1LEAA 3IAM2 1FBSA 2VE8A 4HA8A 3OYDA 1FSHA 1UELB 3WTTC 4V2FA 2CV2A 3GTQJ 3S1MJ 1MMSA 3BWGA 2K9SA 3LWJA 4B44A 1ZK8A 2CQQA 1YX3A 2ZJ2A 3I4PA 2LP0A 1VQOI 3EUHC 1W5SA 1F1ZA 2IS2A 3CCYA 3ROUA 2D1HA 2ZXWH 5CW8A 1XTAA 3E7LA 2JTVA 4D7MA 1HW2A 2LSOA 4A3LJ 2EILH 4PFOA 1Z7LA 2ZBKA 5HDGA 5L3EA 2Y48A 1HOMA 4XMYA 3ZQFA 4XN0A 5DCMA 4I7HA 2Q2EB 2CRGA 3BNIA 1HCRA 4BXXJ 1EA3A 3JRBA 5FROA 1USTA 4XRMA 4MO7A 4OMZA 5K7ZA 1V55H 1VQ9I 3K4MA 2WTEA 2KZGA 3AG3H 3HOUJ 1IXCA 1Y56A 2R7SA 3PSIA 4B48A 2XPVA 1N25A 4IHVA 2RNGA 3I71A 5H6QA 2UV1A 1VQMI 4B1RA 3K2AA 4XLPF 1VQ6I 3JRAA 2DA7A 1E17A 2EA2A 2D1VA 3PNTA 3KCCA 3R0AA 2DFIA 2FMLA 1TWCJ 4GCLA 2EK5A 2HVRA 4D0PA 2PI0A 4P5OA 2L7MP 3IH2A 3I5UA 2HOSA 1QRYA 1YO5C 2OPTA 2EQRA 1ZARA 2EIKH 2HTSA 2IAIA 4HX4A 4WF2A 2IW5A 1SAXA 3ABTA 1RR7A 1QZYA 5BNGA 4FE4A 5KK1A 1OCZH 2X9DA 1W36D 3BZ6A 3ABMH 4C30A 3VIBA 5HNFA 3KNWA 3QYEA 4J01A 4A69C 1HW1A 1IDZA 4BKXA 5M3MJ 2WWYA 4LIUA 3L2QA 3L2WA 4XLAA 5FHPA 5GP9A 1FNNA 1BW6A 5DS9A 2F2EA 2LD5A 3ZPLA 2WGBA 5KVRA 3QYBA 3K4JA 4E7IA 2D5VA 3SEZA 3FMSA 1OCCH 1PUEE 3MKYB 4GFKA 2KP6A 4UNOA 4EJUA 2ECBA 3HIFA 3ZXSA 5D5XB 4ENNA 2L4AA 1ODDA 1A35A 4CCNA 4JL3A 1Z0XA 2KZVA 3F1BA 1LJ9A 2VASA 2XSDC 3MZYA 4QLCU 2DA3A 2DJIA 1D8JA 3F22A 3VOKA 2VI6A 3AL0B 3CDLA 4HQEA 1BW5A 4HF1A 5IOZA 5EDNA 2IGOA 1I3AA 2BE5F 4YIIA 5IT9K 2XDNA 2JPBA 1A6IA 1X3UA 3WTVC 4GDFA 3GFIA 5KNLA 3CF2A 3IWZA 2L02A 1BJZA 3CUQB 5F0CA 1K83J 2YPRA 4LD5A 1ON1A 2JJ7A 1K4TA 4PZJA 3B73A 1ENHA 2I10A 3KX2A 2RN7A 4Q48A 3FXLA 1DPRA 3GYHX 1VNDA 1K4SA 2DI3A 5FLMJ 4U7BA 5J40A 2K02A 1BN5A 4IJAA 1TTYA 5DM7F 1TQMA 3DBLB 1OYWA 3TMOA 1T0FA 5EZHA 4GFBA 1OKRA 3KZZA 4RBOA 3VW0A 3CLOA 4ZYAA 3FX3A 3GTOJ 2H8RA 2AHQA 4EJWA 2G7GA 1FY7A 1WH5A 2G0EA 2G7HA 4JBAA 2QCOA 3PQKA 5GAEJ 3VVZA 2COMA 2XF5A 3SFZA 2Y75A 2YX7A 3S5RA 3F3XA 4NHJA 3KP5A 1MNDA 4OU0A 4IPAA 1AA7A 5DEQA 3CCMI 3LJLA 4Y15A 1W36C 1WH7A 4RB3C 2ACJA 1J2XA 5E20A 3T5XA 3MNLA 3ZQHA 2G7UA 1G2HA 1O4XA 2HQ5A 2ZNYA 3W6VA 1LEBA 3DF8A 2AQFA 4UDSA 4EGZA 1ZR4A 4BXFA 1RC9A 1YLFA 3ERED 2X85A 2EZKA 4G94A 2IPQX 2W84A 1R22A 2XB0X 2XB5A 4M71A 5JHUA 2WV0A 3D0SA 1YIJI 1YRNB 2XIGA 1HQCA 1VI0A 2EFPA 3F8NA 4L9NA 4BS9A 3J81Z 2NVXJ 5F04A 2IS1A 2VODA 3V8LA 5D6EA 3HTAA 1WQ2A 2XAQA 2LVSA 5FGMA 5JI6A 4LGWA 5HNHA 4S0HB 1XMAA 5EG0B 1PJRA 4HPQA 1QPMA 1J09A 2ZMEA 3IHUA 4LK0F 4MEYF 1XCBA 3J7AY 2HGCA 3SDGA 3A01B 2GXBA 3HRTA 1V3FA 3GF2A 1OYYA 1R6RA 1H88C 3W6KB 4EGYA 2STWA 3BTCA 4C2MA 2E5NA 2E34A 2HQAA 4A3CJ 1STZA 2UXPA 2PX9A 3AG2H 2HDWA 4F93B 3D1NI 4U0VA 1P9QC 5FKKA 3OYAA 1ZRCA 3QYFA 3J7AO 1U8BA 4I6ZA 2DXIA 2W53A 1FLIA 5K7HA 1UI5A 3OYMA 3REOA 5GPAA 4GXOA 4E7LA 1F4KA 2ZKZA 2OTJI 1P7IA 3DXJF 3H3VK 2LY1A 2FD5A 4PGHA 5FKMA 4ZYEA 1HSJA 3KEOA 4XLCA 4XSZF 5EFYA 3HPGA 2Z16A 3AFHA 4RGSA 2YU9J 3CJQB 1APLC 4L5EA 1EJ9A 2X48A 1ZHFA 4ASNA 3DTKA 4LLLA 2R7RA 4XLEA 5AIQA 3A0BC 1OYIA 5HLGA 3CLQA 3V8JA 4QSHA 2EIMH 2WY8Q 2PFVA 2LK2A 4IF4A 5LHHA 3SZTA 2FMYA 5D5UB 4M3FA 5J3LA 3BCAA 2UXIA 5C44J 1AWCA 3HBLA 3KFWX 3FXKA 2VT3A 4CDGA 1I3QJ 3BRUA 5C3EJ 1WJAA 5LFAA 4RAGA 2IA2A 1B6AA 5DUKA 4ZJZA 5GPCA 1OPCA 3AQSA 2VQLA 3I58A 3MKWB 3E3VA 3B02A 3VDXA 4I2OA 4ON0A 3QODA 4BQNA 4YEJA 4XBFA 1WGXA 3KP7A 1ZRDA 1FP2A 3QP6A 2HQNA 5FKOA 3HC7A 1W7PB 2L7FP 1WJEA 2BVLA 4XRSA 4XLHA 1JKRC 2LFBA 4FASD 5HVQC 1AKHA 5F0HA 3CZ6A 1AHDP 5FJ8J 5KCMA 3TBIA 3P5JA 5EJCA 4E7SA 4JOMA 2G7SA 3G56A 2DW4A 1E3OC 1WJ5A 2XPWA 3G2BA 1T56A 3KE2A 3BJOA 2JUCA 1Z77A 4FTHA 3F8FA 1HF0A 3BCGA 2VIXA 3K69A 2W85A 2QBYA 3OIOA 3PM1A 1SFUA 5FRNA 3RQ4A 5LBQA 1O7FA 1YYVA 2M2EA 1VQNI 1WVRA 4IVNA 4U88A 2IP2A 3GLLA 3JTHA 3U21A 3CF5F 2HEOA 3HSFA 2VC0A 1LUJB 3VFZA 1T8IA 2ZCXA 1BIAA 4RLQA 3NQOA 1R1UA 2R5YA 2L01A 1SFKA 3G1OA 5CVRA 2OV7A 3BDDA 4EMSA 2F6CA 3SWHA 4KMUX 1X1CA 3QRFF 3JREA 2MH2A 3WTSC 4IO9F 1IGNA 4UXNA 1QO0D 2P0WA 1RNLA 3CWRA 4A3IJ 3GW2A 1DUXC 4G7HF 1T33A 1ZGAA 4WIBA 2LLKA 1SVMA 2ISZA 3VSKA 3PFYA 4WXDA 3RD3A 3ON2A 2Y69H 5EEAA 3RH2A 3QPSA 4F3QA 1U9OA 2UXXA 2X6OA 2CO5A 5FKNA 2Y2ZA 3F0CA 3M1CA 5BMZA 5IYDJ 1Z6TA 3TOAA 3GFJA 4CCJA 3S8PA 3GTMJ 2CFOA 2CV0A 2DMUA 4PJJA 2EV5A 4A3MJ 2XSJC 3WGGA 3JRHA 2B3WA 2H8WA 2WAQN 4MXMA 2ZB9A 1X1BA 1K7AA 2ZFUA 3OOPA 1JJ6C 4AM3A 2VXZA 2C6YA 3CUOA 2RKHA 3CQZJ 1B72A 3IRQA 3DLLF 2HVQA 4II2A 3VOEA 2M5WA 1QVUA 3V4GA 2D45A 2STTA 3IH3A 4V19K 3SYTA 3J81K 2WAQA 1D1CA 2IXSA 1UCRA 4BBSJ 2JSCA 2VQHA 4Q47A 2E7WA 1UAAA 3TO9A 1QZEA 5C4XJ 2MA3A 2GZWA 2J5OA 4OAZA 5EF6A 1UI6A 3Q9VA 3OYLA 2M4KA 2KIFA 1R58A 2XKPA 1ZELA 3C7JA 3RPUA 3JRCA 4N9IA 3VTIA 3EUPA 1GUUA 2XAFA 1Y8RB 4UY8I 1KA8A 4BL0B 4HYEA 1H89C 2UXNA 3VOXA 1G8XA 3F6OA 2HOTA 1FYLA 4UUSB 2OZUA 2ADUA 3A2KA 3RZDJ 1FPQA 2NS7A 1UHWA 5IYBJ 1R1TA 4XICA 5HSZA 2RGVA 2F5FA 2QGUA 4ESJA 2BXYA 4A6EA 3N97A 1USSA 3CJRB 1OR7A 3LQQA 4HNUA 2ZJQF 5LHGA 1MBHA 3EYIA 3CCRI 2B63J 5BOXA 1YITI 3ONQA 4XOPA 4JX5A 4YRVA 3S15J 3LSRA 2YVEA 2R7QA 2O7OA 4L9JA 1B9NA 2DK5A 1KQ9A 2LH9A 3FDYA 3LSIA 3AKZA 4J00A 4BE0A 3QP5A 2I8DA 4MHGA 3FXMA 3J80K 5D18A 2KHMA 1BBYA 4A12A 2PBIA 4FE7A 4KN4X 4E7KA 5EYRA 5GADJ 2IA0A 1G4DA 2DJNA 4ZC3A 5M5WJ 1TW3A 3RZOJ 2FBQA 2QF7A 4O6JA 4A5NA 2K9MA 3WHBA 1LE8A 1ZREA 4XM3A 1SVLA 1I5ZA 4DZJA 2HXOA 3K6GA 1P92A 4CYCB 1QQIA 5JFRA 3PNVA 1O57A 3KP6A 4LB5A 1FOYA 5LRRA 2HYGD 5JVTA 1W7PA 3MWMA 3GEUA 2DK8A 2KKOA 1WSUA 3CMAI 2ID3A 2FE3A 1YI2I 1U78A 5LGTA 1H9TA 2CV1A 3K4KA 4G8XA 4I02A 2QOPA 5D4SA 2YVHA 4BU2A 2VJIA 5LEKA 4S05A 2DLLA 1U0JA 2BYVE 1SD7A 2QKOA 2VXDA 3RDIA 2IEKA 2OF7A 1H0MA 1DP7P 5CVUA 3A4CA 1S6LA 1D0XA 3UNGC 4B43A 4Q5SF 3S3OA 4A0XA 4OMYA 3ABLH 1SMTA 4G9YA 5J6XA 1KU3A 5E3NA 2CW7A 2DMPA 1UJ8A 2X6YA 4CZCA 1DP3A 2OAZA 2FOKA 2K85A 1R71A 2H6BA 3DBRB 4I98B 1XS9A 2HOEA 4IHWA 1I6HJ 2G3BA 4QIWN 3D5RC 1XGSA 4DBQA 1NG6A 1QBJA 2L0KA 2VKDA 1NK2P 1TL8A 3CC4I 1BI2A 2KFDA 4BGDA 1T6SA 1N75A 4AIHA 5ICFA 2GA1A 2XKOA 1IRXA 1D3YA 3HJEA 3FXQA 4E4HA 4BUPA 2FRHA 3FF5A 5FKLA 1K78B 1P4AA 2IGMA 4ZZLA 2BOLA 2M45A 4BYYA 1WPKA 5TISC 3RYPA 3RKYA 4EJTA 2ELJA 3LAJA 3ZMZA 2JWTA 5HDNA 3PNYA 3DEWA 3S14J 5LHIA 1FIPA 1JE8A 2BXZA 4CGZA 2DCEA 1WJDA 5D5VB 2YR2A 3MMYB 3ZRGA 2KISA 5E3LA 2FQ4A 3PUBA 1R5HA 3HG9A 4RB0A 2EV0A 3IAS2 3SJMA 2ZFWA 4KIBA 5K1YA 3V7CA 4ZYDA 3S1QJ 2B1EA 1BI1A 1IW7F 3GEZA 3E7QA 3CCLI 1MBFA 5ICGA 1MBKA 1ETWA 2XV4S 1HBXG 2L7KA 3BG5A 1SD4A 1W5CC 2ZXJA 4Z2YA 2YSRA 4OINF 3VODA 3HYIA 4NUBA 3OYCA 3JCUC 1B8IA 4BY1J 2M3AA 1UB9A 4MTEA 2QA4I 2VL8A 2CSOA 3HL2A 3HTHA 3MFKA 1MMGA 2CG4A 1MSEC 2VPLA 3RQIA 3A0HC 3Q0VA 1VQLI 2JA5J 2O7TA 4IQJA 2LY9A 2NOGA 4R79A 3FMQA 2DTZA 4LITA 2JK3A 2P6SA 1TWHJ 3L2UA 4RGUA 4M9XA 2L54A 1A5JA 3FXRA 4ENMA 3IUOA 3DU5A 5IPAA 3E0JB 2RC4A 2QZ8A 1Z67A 1V5GA 4KIFA 3LFKA 1ZH5A 2BGCA 4AIJA 3H35A 2W57A 3L7WA 4UUSA 3GVAA 2KJBA 4NC6A 4U87A 1NH3A 1QHGA 1GDTA 2O8KA 5DCFA 4B09A 2GLOA 1TWAJ 1MNMC 4IHSA 1KONA 4JX4A 5J1UA 4CZZA 2R7ZJ 1RPWA 1PUFA 2CUJA 3NXCA 5B3SH 3K2ZA 4RS8A 1RKWA 4AUXA 1JGGA 3ASNH 2P8TA 1S9HA 5IOYA 3E5UA 2RV8A 4RB2C 3GTGJ 1FYKA 1IV8A 4RGXA 3IC7A 3M07A 1R1VA 3S2WA 4M3EA 3TW7A 2W25A 1BC8C 3OYIA 4BJ6C 2HQRA 1RZ4A 4GYGA 3LSHA 3SZGA 1YIOA 1DQUA 3SEQA 3ZMTA 3RCOA 1U3EM 3P9TA 3U1DA 3GCMA 3OYNA 3BJBA 1CF7B 1XD7A 2JRTA 2Y30A 1S8NA 1R49A 3E97A 1XDUA 2HZDA 4JYKA 4BJ5C 2A5WA 4MGRA 3K70D 1K79A 3DPTA 2W00A 2M7BA 1ZR2A 3CO7C 1IUFA 2JT1A 1D5YA 2LC2A 3O60A 2WAFA 1FT9A 4FT8A 1KZHA 2ZXIA 4E7ZA 3K0LA 3KETA 2VC1A 2KJCA 2H6CA 4MNUA 1D8KA 3W2VA 3NARA 1J59A 2DPUA 4M9SA 1R36A 2IA1A 3LL7A 4AVZA 1RUNA 5CQEA 1P4XA 3ECHA 2MGQA 3I64A 3FXUA 3H5NA 2ZOZA 2E60A 1XGOA 3BCBA 3WHCA 1GVJA 4XKBA 1FJLA 3JTGA 2O9LA 1JI8A 4DYRA 1SEUA 2WUIA 4D9JA 1IXRC 2DAOA 3BROA 2ID6A 1VTNC 2D2WA 1T2KA 1P2FA 2LBFB 1TBXA 4CCMA 5B1BH 1FP1D 3B6AA 2V57A 1YX5A 1CQTA 1PP8F 1HKQA 1Z05A 2LG4A 3KYCB 1WI9A 2KRFA 4C2TA 2NVQJ 4Y33A 3K4BA 3BLYA 4M74A 4MTDA 4FETA 1ETYA 2FF4A 4A0YA 2E71A 2VOOA 4IXAA 4YFKF 1WZ2A 3ELKA 4IRIA 2DFHA 3PPBA 3K9TA 2X1EA 1V5EA 4L18B 2F48A 1VQ8I 2R7DA 3F8CA 2EFNA 1BOBA 3T1BA 1IAWA 3CESA 1T95A 4ZZDA 2QWWA 1S72I 5FRMA 1Z3YA 2CUFA 3P9IA 4ZDLA 2QENA 3ML6A 4CH7A 1DU6A 4A93J 2EZHA 1EH6A 1WWXA 2R7VA 3CRJA 2XF6A 4BEHB 5LEJA 4X6AJ 3VYUB 4CHUA 2WC2A 2DPDA 4RDUA 4HDUA 2KRHA 1YJ9I 4XSXF 5A2QZ 3KYDB 2UWMA 4OIRF 2XF7A 4CO8A 1FC3A 2F4IA 2HKOA 3FK6A 3GZ5A 2MABA 3JRFA 2A61A 1EH7A 1I1SA 4D5FA 3DKYA 4RAZA 3ON4A 1JUMA 2BW3B 4A3FJ 3M1EA 3G7RA 5FMPA 3RI4A 4BDYA 4JP0A 4CXFA 3V42A 2PBXA 1SVOA 2ZNZA 2OA4A 1ZG1A 4KIGA 5IP7J 4NC8A 3GO5A 2XGCA 4ZDPA 4RMNA 4C3IJ 2CUEA 3V7RA 3ZMVA 4LG0B 3WE2A 2Z99A 1UG2A 2JN6A 4M6XA 3K70C 1Y8QB 2L9VA 5IY5H 1IN6A 4UVBA 3F21A 4L9VA 3SFIA 2Q1ZB 3K4NA 2VKEA 3K10A 1VFCA 4RB1A 3L00A 3DBHB 2IJLA 4DJAA 2AS5F 2FUG2 2Y31A 4B3AA 2WADA 4MQ9F 2R5ZA 2E2HJ 5DAJA 2LY2A 2R7FA 4AYBN 5B66C 2XPUA 3HZJA 2JRMA 2EZLA 1I1GA 2P6TA 1POGA 2CH0A 3L09A 3QPTA 4FQGA 4Y3OA 2ZJRF 4HF2A 2JZYA 2VB6A 3CTAA 4EQQA 3E6MA 3OYJA 3HSEA 2MYSA 2AXLA 4J19A 1BIBA 3R60A 4BHCA 3KP4A 3HKZN 2O5RA 6PAXA 4HX7A 2CUZA 1ETVA 1Q1VA 3H92A 4AYBA 2G7LA 3ANGA 1LNWA 3KP3A 1JKOC 4BQOA 4HOBA 2GQQA 2V9VA 1V4RA 4P9FA 1X3ZB 5FLXK 3OY9A 2YVXA 2QUFA 3WODF 5KAIC 3DPJA 2MW8A 3HKZA 5E1WA 3W2WA 2UXOA 3I59B 3E6BA 4YIFA 1RI7A 3L2VA 1MJ9A 5LRSA 3BG7A 4HNVA 2EWNA 4LOCA 3GX4X 1G59A 2MG4A 2Q2EA 3G1LA 3G6EI 5BPDA 1R4NB 1BR2A 4AIDA 1Y1VJ 4YZEA 5F6FA 1CF7A 4A3DJ 2V7FA 5EEHA 3I55I 4AD9A 4AC0A 4HW0A 3DEUA 4IKFA 2OC6A 3MCZA 1JUPA 3ZGKA 1MNEA 2EV6A 4M9ZA 2IS4A 2P5KA 2NAZA 1R23A 3DLAA 3K8PC 1EH8A 2DYRH 2FBKA 3L9FA 3BR3A 4OOIA 3OL4A 4QTRA 3LAPA 3ULQB 3HOWJ 1BJAA 3M7GA 2PLYA 3TO7A 5E17F 1FMWA 2DQRA 2DT5A 5AIPA 3JAMZ 1D1BA 1DDNA 1XGMA 3BQZA 3PO3J 3HEFA 1WJFA 1MDMB 2R7UA 1ORKA 3FWEA 1FTZA 5FFZA 2XC7A 1FWZA 1W4MA 2V1DA 2XAJA 4OIOF 2DA4A 5CYVA 4FX4A 3WU0A 1TQIA 4LLGF 5EEGA 3O6BB 4DZPA 3BOQA 5LLQA 3I56I 3OR2C 1SD5A 4KISA 4ZTFA 2LNBA 2ZJPF 2W1OA 3BHQA 4WCGA 4NC7A 4OIPF 5CPRB 2QQ9A 1OCOH 4IHYA 1HXDA 3G73A 4F7ZA 4OIQF 3NPIA 3MKZA 1KU2A 4UVAA 2DODA 2ECCA 2PZ9A 3OS1A 2XRLA 4MFDA 4DIQA 4YIRX 2B0LA 1WI3A 1SANA 4LB6B 3RPQA 1SFOJ 1U8RA 3S16J 5M5XJ 3FM3A 3E6DA 2ETHA 5ILSA 2UXHA 2QWTA 4AC6A 1PYVA 3JRDA 2TCTA 3RKXA 3H3UA 2AXTC 1C0WA 4N4NB 4XLFA 2GBYA 1TWFJ 4DW6A 5D19A 4HLXA 1LDJA 3J7YJ 2NS0A 4U0WA 2VN2A 4U9NA 1TT5B 3DEEA 4BEHA 3WG9A 4O5VA 3F9KA 4N9HA 3I53A 5EGOB 3IH4A 4XKWA 2A69F 2KRCA 5K58A 3CUQA 1XB4A 5JR3A 3MN2A 1O3QA 5LGUA 3BR5A 2E2IJ 1Y0UA 1FOWA 3OV8A 3OS2A 3BJAA 1V54H 5CXIA 4FISA 2M87A 3HOSA 3KKDA 3KZYA 2HNHA 3VWBA 2HYTA 1ZAOA 4LG0A 3BG3A 1YHQI 3VUQA 1SFXA 3T8RA 4RAYA 4ANJA 3K4LA 4I0BA 3PUFA 1DPUA 3H9QA 5J8CA 2CW0F 3H1CA 2KDZA 5HLIA 4P55A 2F4OB 3OYFA 3S2HJ 5JLWA 2NVUB 2K3FA 2Y0SN 2M30A 4CUGA 1Z21A 3K1PA 3Q0WA 2R7OA 3ASOH 2DDAA 2V26A 3TP3A 2JMWA 4MFEA 2O03A 2NVTJ 5TRDA 3S3MA 1RRJA 1Q1HA 2FNAA 3K4CA 2X1DA 5H20A 2FXAA 2Y9YA 4Y13A 4BE1A 4F92B 4MEXF 1ON2A 3WTUC 2VKVA 3EPZA 3JRIA 2KLOA 2V1XA 4IEJA 5F1RA 3LSGA 3PIOF 3CJNA 2M34A 1GLNA 3LSJA 2K7LA 2MLGA 4U9LA 2W4SA 1F9NA 2DT7B 3LOCA 3O8HA 4DYCA 1ETXA 4B3XA 1U5TC 1BI0A 2E1OA 4E6KG 3H5RA 1B59A 1T0FC 2MLKA 3PQJA 3JR9A 2E36A 1X19A 4MQVA 4IHTA 4M6YA 2P4WA 3ZN0A 1R9TJ 2K27A 5JLXA 1OCRH 4D7NA 1ZYRF 5D5WB 1YRNA 1UG0A 4P9UA 4O3MA 3M8EA 1JGSA 4F52A 3WTZA 4XK4A 1OCPA 2A2FX 2KIUA 1HSTA 5DD8A 1G3TA 3C2HA 4BNCA 1FYMA 5EG0A 4BY7J 3AQTA 3HUGB 4M3BA 4CCKA 3G4SI 1IDYA 5E8IA 5FFXA 2BZTA 4DQ2A 3LFUA 3A01A 4FHTA 3FRQA 1ULYA 3LA2A 5LD2C 2HPMA 3TW6A 3ABKH 1IV6A 3DTEA 3GWZA 3QOPA 1LDKB 4A3BJ 4XONA 4W97A 1YG2A 2MD0A 3F6VA 4AU7A 2FNPA 3EDPA 4I0AA 1X1AA 1IRFA 2K3PA 4LMYA 4QPQA 4XQFA 1V5FA 2ELKA 3WGIA 2VBZA 4DYQA 3DKWA 2KQRA 3EUHA 3OOUA 3U1KA 4I99C 1IC8A 1DGRM 2PMZN 2XDVA 2DG8A 1A04A 4LJZF 4LFUA 2X6XA 4L0YB 2OI8A 3HPHA 1E3PA 1Z91A 4AWXB 4U0YA 2GXAA 2EB7A 3AAFA 4E70A 2R92J 2O8XA 2CYYA 2ZMEC 1K61A 4WK8F 2BEOA 1JKPC 2XROA 1EV7A 4HRIA 1F5TA 4L5JA 4GRIA 2R4GA 2PMZA 3ZQ7A 1J75A 2PJRB 1TNSA 2VQCA 1WKMA 3GTKJ 2P81A 2VONA 2QSGX 3KKCA 3HSRA 3R61A 1YOVB 4N0BA 1E3HA 3FK7A 1X2NA 1JHHA 3M3YJ 2FU4A 1S3JA 4K2EA 1DU0A 2ZOYA 1SC7A 2LREA 3V6GA 2HWVA 2MD5A 2VJJA 5D4RA 1ACIA 1O7LA 1N78A 3KIOA 2Z9OA 3Q3SA 2FJ1A 3KYLA 2LKPA 5FLVA 4XNFA 2IT0A 3ZMDA 2GFNA 3V78A 5DCMB 2HDCA 1NK3P 5ILVA 1I6XA 3ESWB 3PO2J 2J5PA 2BY0A 3BT9A 3ZQGA 3RKWA 4F91B 1MW7A 3DP7A 4MIMA 1YW9A 5F0FA 3HGYA 4M6VA 2DMNA 3BY6A 1S7AA 3D5SC 5F64A 4YFNF 2QTQA 5CJ9A 5FO5A 1F43A 1GXPA 2A6TA 2O6GE 5L3CA 3TP0A 4V2GA 3C07A 5E1ZB 2IGKA 4TV7A 3SHFA 1FIAA 2OU2A 3CDIA 1IF1A 4UB8C 5J8FA 1G3WA 2GWRA 2DA1A 3Q0UA 4RAFA 3OMYA 3KLNA 4OD5A 2M0CA 4BHBA 2EFOA 2E5ZA 2WB1N 3ZOBA 1PDNC 3NI7A 4E7HA 2Q0OA 1KU7A 2FA5A 2H1LA 2A6EF 1W0UA 3EGQA 1UFMA 4JX6A 4GFLA 3LQRA 4RM2A 1MJAA 4HSRA 3IKVA 4NELA 3V8KA 1BOAA 2OCCH 1JUSA 3OYBA 2GXGA 4M72A 2JVHA 1QU3A 1E2XA 2L9RA 3JSJA 2FSWA 2OBPA 3S17J 3TL4X 2V6CA 2NS8A 3FXJA 3K7AJ 3M9AA 1FSEA 4KT5C 2LKXA 2PG4A 2MFZA 1X58A 2EINH 2K4JA 1TT0A 3H0GJ 5CVVA 5JHFA 3MZ8A 3O8GA 1BL0A 2QSHX 3I4MJ 3JW4A 3VPRA 1XCVA 1FMVA 1KU9A 4EATA 1AU7A 3S1RJ 1O3SA 2GENA 2GUHA 1S7EA 2VUMJ 1G3SA 1ERDA 3S32A 2OZ6A 5IT9Z 2BY3A 2JA7J 2L7ZA 5BPIA 4BHPA 3BC8A 2DA2A 3VVYA 1BI3A 3C18A 4I01A 4XRSG 3E6CC 3NS4A 5CVIA 5D8KB 4KITB 1QA6A 3WU1B 2Q24A 2EZIA 3L2RA 2ZCWA 2CJJA 3ZQLA 3W6JB 5BQTA 3VEPA 2Q8KA 2JUGA 1IN7A 4PJLA 4MK6A 2GIZA 3LWFA 3O3KA 3CCUI 3TEDA 1Z7UA 4A6DA 4BE2A 1I39A 3WTYC 1RKTA 1XSVA 1LKXA 1FEXA 2TDXA 4XKVA 2HU9A 3FBIB 1FOKA 1VQKI 1J9IA 4NN1A 4B4CA 1MBGA 5GTIC 1R4MB 5J4YA 1X1PA 4ZDOA 1FX7A 4ACIA 3CMYA 3WTWC 3IKTA 1YW7A 1KQ8A 3BR0A 2NNYA 3DPUA 3K1MA 2YS9A 2A05A 3JSOA 4HNTA 1U5TB 3CDHA 5DYMA 4A2UA 3M8FA 2ME0A 2M0MA 4RGRA 4CICA 4PSWA 1LVKA 2V6EA 3B81A 2KL4A 2V9PA 1MBJA 2IVMA 3S2DJ 5F08A 5CVJA 3BR1A 1ZG3A 3R4KA 2LRDA 4P1WA 2H27A 4A5MA 3IWFA 2BHZA 3CCSI 2K9QA 4LIVA 3UR3C 2LOOA 3DU6A 3I9V2 2L9SA 1P4WA 2VBWA 4QWQA 2D6YA 2DMQA 3ISPA 4Z6YA 2LTPA 4BDZA 4DGWB 2OQGA 5HS7A 2V4JC 3LHQA 1NG7A 1ETOA 2BY2A 2VLAA 3ZQCA 4IHXA 2PJRA 2B7EA 2JA6J 2BBYA 3C3WA 3Q9SA 2KPMA 4JNNA 3BR6A 3H9JA 3HRSA 1HW5A 2F4MB 1JKQC 2CW8A 1IJWC 3VW1A 2OJED 2NNNA 1ZLJA 1P6RA 4EVIA 2G9WA 4EM2A 5HLHA 3OS0A 2RDPA 4A3KJ 4FCYA 4CCLA 1WRJA 2E35A 2ZO4A 4RM3A 3TGNA 4BBRJ 2QVOA 3IRRA 2MH9A 1OR7C 3EUAA 2XGEA 2ZMEB 1QZZA 5FD6A 3HOZJ 1SAUA 3HHGA 4CYCA 4PJMA 1K6OA 3BTLA 5H9TA 2RASA 4C3JJ 5M3FJ 3MVPA 4KICA 2RVCA 5H2FC 4KFCA 4U7DA 1JHFA 2H94A 1UZCA 1UMQA 5L3BA 2HS5A 4HG2A 1LB2A 1U6GA 1D1AA 4KWAA 2CWEA 5FD5A 3GTLJ 3RTRA 1TZLA 3GFMA 1Z6RA 3OR1C 4CYDA 2GIVA 2HXIA 3ZCOA 1AOYA 5M5YJ 1A36A 1REPC 3P7NA 3BZKA 4EM1A 2QYOA 3DCFA 2F07A 1GXQA 3G1MA 2A07F 3U2RA 3NEUA 3GTPJ 2IBDA 1BM9A 1PVEA 3DPLC 4B8XA 3DKXA 3H5AA 3TKYA 1ZLKA 4JK1X 5ED4A 3HHHA 4UB6C 4EJOA 3FHZA 2DMTA 2RQPA 3BTIA 5TJJA 3BTJA 2HKUA 1S7OA 3QAHA 2ICWG 4I76A 1GT0C 1TW2A 3CP8A 4IX7A 4EJVA 3NWTA 2JPCA 3FZVA 3CC7I 3KEYA 1VF9A 5L3FA 2L2OA 3PFIA 4M73A 3OYHA 4ZYHA 4HV5A 4DNCA 2WA0A 5AQCA 2KMUA 2K4BA 1K78A 3VYRB 4GCVA 4AVPA 1SFEA 4BH9A 3M8JA 1MMAA 3X2QH 2ESHA 1OCTC 4GO1A 5B5EC 1YJWI 2Z3YA 2DTRA 5HS8A 2VKHA 3KLOA 2E1NA 4R8HA 2E1MC 3E1SA 1R7JA 3TOBA 4NQWB 2HPIA 3VB2A 1F36A 3BP8A 3JRGA 2IGNA 2M8GX 3V7SA 4HDVA 2HDDA 2A68F 3HTSB 1XX5A 2CFXA 1WFXA 3TDZC 2R7WA 3ANPA 3OWTA 4IZZA 1LQ1A 4IOCF 1U9NA 4EM0B 2DOFA 5H6RA 3RYRA 1B9MA 3FKJA 2WAEA 5E1XA 3F8MA 2HYJA 3TDUC 3HGGA 1IN4A 1H8AC 3NRVA 1X4PA 3O2PE 2FBHA 2NRAC 3GBGA 2HZTA 1L0OC 2CQNA 2PN6A 2GOMA 1AKHB 3WTXC 4KUMA 5GAHJ 4XN3A 3ZN1A 5FB2A 2GOXB 4KN7X 5J1RA 1S29A 3FM5A 2NP5A 4GCKA 4JQFA 1KYZA 1OFCX 2O0YA 4RLFA 2HI3A 4ENKA 2UXUA 2QBYB 2K9NA 3NAUA 4BXUA 1VQ4I 2BV6A 3VW2A 3QPLA 2JSPA 2R0QC 3MKLA 2RREA 1U5TA 4AF5A 1W1WE 3ERMA 2XAHA 2RQQA 4C2UA 4PFPA 1X3WB 2R5YB 1ZQ3P 3OIPA 1YE9A 2DO7A 1GVDA 1LVAA 3GXOA 1T39A 2RNJA 3CP2A 3PSFA 1RESA 3DWLE 2CQXA 4KA4A 1VQPI 3C2GA 3RIRA 1ZTRA 4L5IA 4WWCA 4KDPA 2Z1DA 4XR6A 3CCJI 2L4MA 2P5VA 2VBYA 3HTJA 4AIKA 2HOAA 3LA7A 1XMXA 1SMYF 2M8EA 3ZP5A 2JA8J 3QU3A 4C9YA 3BG6A 3BQYA 5IYCJ 3J7ZI 1A6QA 3FIWA 2Y0MA 1WJBA 1O3TA 1R5GA 1UHSA 2L3DA 4P96A 2EFQA 2HR3A 4GCTA 1K6YA 1W5TA 1RIOH 2W7NA 4G12A 2MBFA 2O61A 1IXSB 5HDKA 4G6TB 4HKUA 4GYIA 4HEA2 2R7TA 2V1UA 1OMIA 4HV6A 3T8TA 4N4OB 1RR8C 3FMRA 3WU2C 2E19A 3ECOA 2GM4A 3SXYA 3N05A 4YFXF 4PJ0C 1B72B 1U2WA 2XUBA 3SZPA 5HBUA 3HOTA 1WJCA 1XSDA 1ZG5A 1N77A 3KPHA 5ICCA 2HFHA 2XAGA 1ZGJA 1YS7A 2BY1A 4IRGA 4NNJA 3KP2A 3VYTB 3QKXA 4C2MJ 1S5LC 2OUMA 4ITVA 1JT0A 1D0YA 3GTJJ 1PP7U 3WGHA 2W24A 2X0LA 1QGPA 1IG7A 1JTXA 3QOEA 3IV5A 3CCVI 3HOVJ 3VP5A 1MH3A 4H0EA 4IRHA 1OQYA 5E8GA 1XN7A 5F1JA 4E7JA 4ICHA 1MGTA 2WV1A 2DFEA 4W1UA 2W48A 4PCQA 2LBFA 2DYSH 3D5LA 3NWSA 5C4YA 1XGNA 3IUVA 4WX9A 2E1CA 2VOPA 5C4JJ 2DT6A 3L2CA 2AQEA 2QSFX 5GAGJ 2P7VB 4XL9A 3HTIA 1MKMA 2DFFA 2UUZA 4ZYGA 1Y39A 2VT2A 3H9GA 1OJLA 1TP4A 1VZ0A 1YJNI 4XORA 1E0EA 9ANTA 1QHHD 3QU6A 2ELHA 3GZIA 3QWLA 5B1AH 3EETA 4ETSA 4G6DA 1LFBA 3DQVC 3LA3A 4HX8A 4PUSA 3OSGA 3C1DA 1Z9CA 2ME6A 4PGGA 3HIMA 2VPRA 1TC3C 2Z2SB 1DGWY 1VQ5I 2QM3A 3CMEI 2KIMA 3J80Z 4FX0A 2RAEA 2K40A 4ESBA 1P7JA 2K86A 3ZMSA 4CCOA 3KZ9A 3A02A 3HDDA 5IP6A 4PXIA 1IO2A 5L3DA 2XHKA 4IRVA 4ZTJA 3E5XA 1M1EB 4PSXA 4A0ZA 5J47A 3P9KA 4L0ZB 5E3OA 3OYKA 3BG9A 4HLYA 2A3SA 2F5DA 2PMHA 2BW3A 3KZIC 3S3NA 2CMPA 3EQLF 3OYEA 3MAJA 1MIJA 3GZ6A 2LF8A 2DDBA 1X1DA 2NYXA 3KEQA 4NQWA 1LE8B 5A2QK 2R3SA 2CU7A 2KT0A 5L3GA 2GAUA 4LG3A 4BACA 1HDDC 2PQ8A 1GHCA 3WE3A 4NB5A 1TQPA 1ZN2A 4OWRB 4UUVA 2DOEA 1ETKA 1ITYA 2A6HF 3C2BA
chains in the Genus database with same CATH topology
1MSFC 1X2MA 1TWAJ 1MNMC 2GLOA 3GTOJ 4JX4A 5J1UA 2H8RA 2GFNA 1NK3P 2R7ZJ 2AHQA 1RPWA 4M3DA 1PUFA 3NXCA 3PO2J 2G7GA 1WH5A 2G0EA 1RKWA 4AUXA 2QCOA 3BT9A 3ZQGA 5IOYA 1JGGA 3VVZA 3GTGJ 4MIMA 3S5RA 5F0FA 3HGYA 3TW7A 4M3EA 4M6VA 3LJLA 2DMNA 3OSFA 1WH7A 2QTQA 1F43A 3MNLA 3ZQHA 2R93J 3P9TA 1JTYA 3BJBA 1G2HA 1O4XA 4X1EA 2HQ5A 4V2GA 2Y30A 3TP0A 3W6VA 3C07A 4JYKA 5IP9J 1FIAA 4UDSA 2DA1A 3Q0UA 3BR2A 1ZR4A 2M0CA 1ZR2A 2NX4A 2WB1N 1IUFA 2EZKA 3ZOBA 1D5YA 3O60A 3NI7A 1ETQA 2XB0X 2XB5A 1YRNB 1VI0A 3ZQIA 1W0UA 3EGQA 4JX6A 4GFLA 3NARA 4NDLA 2NVXJ 2DA6A 5D1RA 3A03A 5F04A 2NP3A 3HTAA 3L1PA 2MGQA 2LVSA 4NELA 4S0HB 2ZOZA 5EG0B 1JUSA 4ABZA 3WHCA 1FJLA 2L9RA 2O9LA 3JSJA 4DYRA 3S17J 3SDGA 2WUIA 3A01B 2NS8A 3K7AJ 2ID6A 2LKXA 1IRZA 1H88C 3B6AA 1X58A 2V57A 1BL0A 3BTCA 3H0GJ 1CQTA 3S1NJ 3O8GA 3I4MJ 3VPRA 2NVQJ 4Y52J 4A3CJ 2UXPA 1AU7A 3M4OJ 3S1RJ 2GENA 2GUHA 1S7EA 2VUMJ 1ETYA 3D1NI 5FKKA 1U8BA 2JA7J 3T6NA 2L7ZA 3FKIJ 4I6ZA 2W53A 3RKQA 2M9HA 1Y1WJ 5K7HA 1UI5A 3PPBA 2DA2A 3VVYA 5GPAA 4XRSG 1P7IA 3H3VK 2CUFA 2REKA 1B8IB 2EZIA 2Q24A 2CJJA 2FD5A 3ZQLA 5FKMA 4D5CA 1DU6A 4A93J 2EZHA 2N8GA 5EFYA 4MK6A 2YU9J 1APLC 3TEDA 3CRJA 1JT6A 2EH3A 4L5EA 2ZCNA 4X6AJ 2X48A 3QQAA 4RDUA 1RKTA 1FEXA 1GV2A 4NN1A 3FK6A 3JRFA 4B4CA 1MBGA 4QSHA 4D5FA 2LK2A 4ACIA 3ON4A 1JUMA 3CMYA 4A3FJ 3G7RA 3CJDA 5FMPA 2ZCMA 4JP0A 3BR0A 4M3FA 5J3LA 2PBXA 2YS9A 2UXIA 5C44J 5IP7J 2XGCA 1WCMJ 2ME0A 3HBLA 1ZGWA 3HOYJ 4C3IJ 2CUEA 3B81A 1MBJA 3LNQA 1I3QJ 3S2DJ 5F08A 3BRUA 5C3EJ 3BR1A 1UG2A 2JN6A 5GPCA 1PUFB 5K7FA 3AQSA 3LSPA 2K9QA 3SFIA 1FTTA 2VKEA 3COLA 1VFCA 1WGXA 5FKOA 2D6YA 2DMQA 2Y31A 2LTPA 4B3AA 5E3MA 2R5ZA 2E2HJ 5DAJA 2L7FP 4XIDA 4AYBN 3QBMA 3LHQA 4XRSA 1ZKGA 1JKRC 2LFBA 2XPUA 2EZLA 1ETOA 1POGA 1AKHA 3ZQCA 5F0HA 4IHXA 2IU5A 1AHDP 5FJ8J 1JJ8C 2JA6J 2DG7A 3HB9A 2LR8A 2G7SA 3G56A 3V78A 2DN0A 4J19A 1E3OC 5EGOA 2XPWA 3BR6A 4EEFG 1T56A 4JNNA 3HKZN 4FTHA 1Z77A 1HF0A 1MH4A 2E2JJ 3BCGA 1JKQC 1W0TA 1IJWC 1ETVA 1Q1VA 2G7LA 3OIOA 3PM1A 3ANGA 3VW1A 2NVYJ 2M2EA 2DA5A 1TWGJ 1JKOC 2FX0A 1NTCA 4A3KJ 4FCYA 2YUSA 2ZCXA 2R5YA 3DPJA 2MW8A 3G1OA 3HM5A 2UXOA 1HDPA 4BBRJ 2XGDA 2XGEA 1QPIA 3JREA 1IGNA 3HOZJ 2COBA 2MSYA 4CYCA 3CWRA 3HE0A 4HNVA 4A3IJ 4LOCA 4UUTA 3BTLA 3NNRA 5H9TA 2RASA 1T33A 4A3EJ 4C3JJ 5M3FJ 2AO9A 2LLKA 2MG4A 3MVPA 3G1LA 3HOXJ 3RD3A 3ON2A 1I50J 1UMQA 1Y1VJ 5FGLA 5EEAA 4YZEA 3RH2A 4A3DJ 3QPSA 4KWAA 3GTLJ 2Y9ZA 4AC0A 1U9OA 1SGMA 2X6OA 5FKNA 4Y7NJ 2Y2ZA 3F0CA 1XC5A 4MLOA 5IYDJ 2HXIA 5M5YJ 1JUPA 3GTMJ 4A3GJ 4C3HJ 2DMUA 4A3MJ 3JRHA 3DCFA 1BA5A 1EF4A 2WAQN 1XG1A 3G1MA 2ZB9A 3BR3A 4QTRA 3GTPJ 2F07A 4MXMA 2IBDA 3HOWJ 1JJ6C 3CQZJ 1B72A 3FISA 3BQZA 3PO3J 3HEFA 2DMTA 3BTIA 3BTJA 1ORKA 1QVUA 1FTZA 2HKUA 4ME9A 4I76A 1GT0C 3IH3A 2TRTA 2DA4A 4M3GA 5HAWA 1VF9A 4DZPA 3B6CA 4A3JJ 3NRGA 4BBSJ 2H1KA 3BHQA 5AQCA 4L62A 5C4XJ 4IHYA 5EF6A 1UI6A 1OCTC 3NPIA 1GV5A 5HODA 5F27A 3JRCA 3UKGA 2ECCA 2RHAA 2PZ9A 3EUPA 1GUUA 1LFUP 2XRLA 4MFDA 1F36A 3JRGA 2M8GX 1H89C 1WI3A 1SANA 2HDDA 3VOXA 1SFOJ 2HOTA 4UUSB 5J1YA 3ANPA 3I4NJ 3RZDJ 5IYBJ 2NS7A 1MBEA 5M5XJ 3S16J 4CGRA 1U9NA 4XICA 5HSZA 2UXHA 4AC6A 2QWTA 3JRDA 2HYJA 2TCTA 4JKZA 3HGGA 2GBYA 2R5ZB 1H8AC 1TWFJ 4DW6A 5D19A 2EBIA 3GBGA 3PASA 3VVXA 1MBHA 1AKHB 2B63J 2QIBA 2NP5A 5J1RA 5DTDA 4GCKA 2OERA 1HLVA 5EGOB 4JX5A 1OFCX 3S15J 3LSRA 1RETA 3IH4A 2HI3A 5CXGA 2YVEA 5EZGA 2UXUA 5K58A 1QVTA 3MN2A 2O7OA 2K9NA 3BR5A 3NAUA 2E2IJ 5CXIA 3VW2A 3QPLA 2R0QC 3MKLA 4AF5A 4FISA 4V2FA 5D18A 3S1MJ 3GTQJ 2K9SA 4FE7A 3KKDA 2HYTA 3LWJA 5EYRA 1ZK8A 2R5YB 3BG3A 1ZQ3P 2DJNA 3VUQA 2CQQA 5M5WJ 3RZOJ 1GVDA 2LP0A 2QF7A 2FBQA 3WHBA 1LE8A 3CCYA 5CW8A 3E7LA 4DZJA 2HXOA 4D7MA 1RESA 2KDZA 4CYCB 2CQXA 4A3LJ 3S2HJ 5JLWA 2Y0SN 1ZTRA 1HOMA 3ZQFA 3BNIA 3Q0WA 2CRGA 1HCRA 3HTJA 4BXXJ 2HOAA 2JA8J 3GEUA 3JRBA 3TP3A 2JMWA 4MFEA 2ID3A 2NVTJ 3BQYA 4XRMA 1U78A 4MO7A 5IYCJ 5K7ZA 2YVHA 2QOPA 3HOUJ 3FIWA 2Y9YA 2XPVA 2QKOA 1UHSA 4IHVA 2VKVA 2IEKA 2OF7A 4GCTA 3JRIA 4IEJA 3LSGA 4B1RA 4G12A 3K2AA 3JRAA 2DA7A 2M34A 3LSJA 4HKUA 3LOCA 4DYCA 3O8HA 1ETXA 1TWCJ 5E3NA 2E1OA 2DMPA 4GCLA 2E19A 2GM4A 3JR9A 1B72B 2L7MP 3IH2A 2HOSA 1XS9A 1QRYA 4IHWA 2OPTA 2EQRA 2IAIA 1I6HJ 2G3BA 4QIWN 5HBUA 1R9TJ 5JLXA 1YRNA 4D7NA 2L0KA 1RR7A 1NK2P 4XK4A 1OCPA 5BNGA 4FE4A 2X9DA 3QKXA 4C2MJ 1JT0A 3KNWA 3GTJJ 3VIBA 4A69C 5FKLA 4BKXA 5M3MJ 1JTXA 1IG7A 1IDZA 3IV5A 5EG0A 3HOVJ 4BY7J 3VP5A 1MH3A 3AQTA 4M3BA 1WPKA 1IDYA 5F1JA 5FHPA 5GP9A 1BW6A 5DS9A 2LD5A 4ICHA 2WV1A 2WGBA 4W1UA 2D5VA 3A01A 2W48A 4GFKA 3FRQA 2JWTA 3DEWA 2ECBA 3TW6A 3S14J 5C4YA 1FIPA 3IUVA 1IV6A 5C4JJ 4A3BJ 3HTIA 4JL3A 4W97A 5E3LA 1Z0XA 2FQ4A 3F1BA 1OJLA 3SJMA 2ELKA 2XSDC 4DYQA 9ANTA 1IC8A 3OOUA 2DA3A 3S1QJ 2PMZN 3GZIA 2DG8A 3E7QA 1MBFA 3OSGA 3VOKA 1LFBA 2VI6A 3CDLA 1MBKA 1ETWA 2OI8A 1BW5A 2ME6A 3BG5A 3HIMA 2VPRA 5IOZA 5EDNA 1TC3C 2XDNA 1B8IA 1A6IA 4BY1J 2R92J 1K61A 3HTHA 2RAEA 2K40A 1JKPC 1P7JA 1MSEC 3KZ9A 1BJZA 5F0CA 3RQIA 3A02A 1K83J 3Q0VA 5IP6A 3HDDA 2JJ7A 2JA5J 2O7TA 4PXIA 2LY9A 2NOGA 1ENHA 2I10A 3GTKJ 2DTZA 2P81A 2JK3A 1TWHJ 3KKCA 5E3OA 1A5JA 3BG9A 1VNDA 3FK7A 1X2NA 5IPAA 5FLMJ 3M3YJ 1DU0A 2ZOYA 1LE8B 3V6GA 2CU7A 2KT0A 1HDDC 4UUSA 1GDTA 5EZHA 2O8KA 4GFBA 1ETKA 3Q3SA 2FJ1A 5FLVA 1ITYA 4RBOA 3C2BA 3VW0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MSF C;  1X2M A;  1TWA J;  1MNM C;  2GLO A;  3GTO J;  4JX4 A;  5J1U A;  2H8R A;  2GFN A;  1NK3 P;  2R7Z J;  2AHQ A;  1RPW A;  4M3D A;  1PUF A;  3NXC A;  3PO2 J;  2G7G A;  1WH5 A;  2G0E A;  1RKW A;  4AUX A;  2QCO A;  3BT9 A;  3ZQG A;  5IOY A;  1JGG A;  3VVZ A;  3GTG J;  4MIM A;  3S5R A;  5F0F A;  3HGY A;  3TW7 A;  4M3E A;  4M6V A;  3LJL A;  2DMN A;  3OSF A;  1WH7 A;  2QTQ A;  1F43 A;  3MNL A;  3ZQH A;  2R93 J;  3P9T A;  1JTY A;  3BJB A;  1G2H A;  1O4X A;  4X1E A;  2HQ5 A;  4V2G A;  2Y30 A;  3TP0 A;  3W6V A;  3C07 A;  4JYK A;  5IP9 J;  1FIA A;  4UDS A;  2DA1 A;  3Q0U A;  3BR2 A;  1ZR4 A;  2M0C A;  1ZR2 A;  2NX4 A;  2WB1 N;  1IUF A;  2EZK A;  3ZOB A;  1D5Y A;  3O60 A;  3NI7 A;  1ETQ A;  2XB0 X;  2XB5 A;  1YRN B;  1VI0 A;  3ZQI A;  1W0U A;  3EGQ A;  4JX6 A;  4GFL A;  3NAR A;  4NDL A;  2NVX J;  2DA6 A;  5D1R A;  3A03 A;  5F04 A;  2NP3 A;  3HTA A;  3L1P A;  2MGQ A;  2LVS A;  4NEL A;  4S0H B;  2ZOZ A;  5EG0 B;  1JUS A;  4ABZ A;  3WHC A;  1FJL A;  2L9R A;  2O9L A;  3JSJ A;  4DYR A;  3S17 J;  3SDG A;  2WUI A;  3A01 B;  2NS8 A;  3K7A J;  2ID6 A;  2LKX A;  1IRZ A;  1H88 C;  3B6A A;  1X58 A;  2V57 A;  1BL0 A;  3BTC A;  3H0G J;  1CQT A;  3S1N J;  3O8G A;  3I4M J;  3VPR A;  2NVQ J;  4Y52 J;  4A3C J;  2UXP A;  1AU7 A;  3M4O J;  3S1R J;  2GEN A;  2GUH A;  1S7E A;  2VUM J;  1ETY A;  3D1N I;  5FKK A;  1U8B A;  2JA7 J;  3T6N A;  2L7Z A;  3FKI J;  4I6Z A;  2W53 A;  3RKQ A;  2M9H A;  1Y1W J;  5K7H A;  1UI5 A;  3PPB A;  2DA2 A;  3VVY A;  5GPA A;  4XRS G;  1P7I A;  3H3V K;  2CUF A;  2REK A;  1B8I B;  2EZI A;  2Q24 A;  2CJJ A;  2FD5 A;  3ZQL A;  5FKM A;  4D5C A;  1DU6 A;  4A93 J;  2EZH A;  2N8G A;  5EFY A;  4MK6 A;  2YU9 J;  1APL C;  3TED A;  3CRJ A;  1JT6 A;  2EH3 A;  4L5E A;  2ZCN A;  4X6A J;  2X48 A;  3QQA A;  4RDU A;  1RKT A;  1FEX A;  1GV2 A;  4NN1 A;  3FK6 A;  3JRF A;  4B4C A;  1MBG A;  4QSH A;  4D5F A;  2LK2 A;  4ACI A;  3ON4 A;  1JUM A;  3CMY A;  4A3F J;  3G7R A;  3CJD A;  5FMP A;  2ZCM A;  4JP0 A;  3BR0 A;  4M3F A;  5J3L A;  2PBX A;  2YS9 A;  2UXI A;  5C44 J;  5IP7 J;  2XGC A;  1WCM J;  2ME0 A;  3HBL A;  1ZGW A;  3HOY J;  4C3I J;  2CUE A;  3B81 A;  1MBJ A;  3LNQ A;  1I3Q J;  3S2D J;  5F08 A;  3BRU A;  5C3E J;  3BR1 A;  1UG2 A;  2JN6 A;  5GPC A;  1PUF B;  5K7F A;  3AQS A;  3LSP A;  2K9Q A;  3SFI A;  1FTT A;  2VKE A;  3COL A;  1VFC A;  1WGX A;  5FKO A;  2D6Y A;  2DMQ A;  2Y31 A;  2LTP A;  4B3A A;  5E3M A;  2R5Z A;  2E2H J;  5DAJ A;  2L7F P;  4XID A;  4AYB N;  3QBM A;  3LHQ A;  4XRS A;  1ZKG A;  1JKR C;  2LFB A;  2XPU A;  2EZL A;  1ETO A;  1POG A;  1AKH A;  3ZQC A;  5F0H A;  4IHX A;  2IU5 A;  1AHD P;  5FJ8 J;  1JJ8 C;  2JA6 J;  2DG7 A;  3HB9 A;  2LR8 A;  2G7S A;  3G56 A;  3V78 A;  2DN0 A;  4J19 A;  1E3O C;  5EGO A;  2XPW A;  3BR6 A;  4EEF G;  1T56 A;  4JNN A;  3HKZ N;  4FTH A;  1Z77 A;  1HF0 A;  1MH4 A;  2E2J J;  3BCG A;  1JKQ C;  1W0T A;  1IJW C;  1ETV A;  1Q1V A;  2G7L A;  3OIO A;  3PM1 A;  3ANG A;  3VW1 A;  2NVY J;  2M2E A;  2DA5 A;  1TWG J;  1JKO C;  2FX0 A;  1NTC A;  4A3K J;  4FCY A;  2YUS A;  2ZCX A;  2R5Y A;  3DPJ A;  2MW8 A;  3G1O A;  3HM5 A;  2UXO A;  1HDP A;  4BBR J;  2XGD A;  2XGE A;  1QPI A;  3JRE A;  1IGN A;  3HOZ J;  2COB A;  2MSY A;  4CYC A;  3CWR A;  3HE0 A;  4HNV A;  4A3I J;  4LOC A;  4UUT A;  3BTL A;  3NNR A;  5H9T A;  2RAS A;  1T33 A;  4A3E J;  4C3J J;  5M3F J;  2AO9 A;  2LLK A;  2MG4 A;  3MVP A;  3G1L A;  3HOX J;  3RD3 A;  3ON2 A;  1I50 J;  1UMQ A;  1Y1V J;  5FGL A;  5EEA A;  4YZE A;  3RH2 A;  4A3D J;  3QPS A;  4KWA A;  3GTL J;  2Y9Z A;  4AC0 A;  1U9O A;  1SGM A;  2X6O A;  5FKN A;  4Y7N J;  2Y2Z A;  3F0C A;  1XC5 A;  4MLO A;  5IYD J;  2HXI A;  5M5Y J;  1JUP A;  3GTM J;  4A3G J;  4C3H J;  2DMU A;  4A3M J;  3JRH A;  3DCF A;  1BA5 A;  1EF4 A;  2WAQ N;  1XG1 A;  3G1M A;  2ZB9 A;  3BR3 A;  4QTR A;  3GTP J;  2F07 A;  4MXM A;  2IBD A;  3HOW J;  1JJ6 C;  3CQZ J;  1B72 A;  3FIS A;  3BQZ A;  3PO3 J;  3HEF A;  2DMT A;  3BTI A;  3BTJ A;  1ORK A;  1QVU A;  1FTZ A;  2HKU A;  4ME9 A;  4I76 A;  1GT0 C;  3IH3 A;  2TRT A;  2DA4 A;  4M3G A;  5HAW A;  1VF9 A;  4DZP A;  3B6C A;  4A3J J;  3NRG A;  4BBS J;  2H1K A;  3BHQ A;  5AQC A;  4L62 A;  5C4X J;  4IHY A;  5EF6 A;  1UI6 A;  1OCT C;  3NPI A;  1GV5 A;  5HOD A;  5F27 A;  3JRC A;  3UKG A;  2ECC A;  2RHA A;  2PZ9 A;  3EUP A;  1GUU A;  1LFU P;  2XRL A;  4MFD A;  1F36 A;  3JRG A;  2M8G X;  1H89 C;  1WI3 A;  1SAN A;  2HDD A;  3VOX A;  1SFO J;  2HOT A;  4UUS B;  5J1Y A;  3ANP A;  3I4N J;  3RZD J;  5IYB J;  2NS7 A;  1MBE A;  5M5X J;  3S16 J;  4CGR A;  1U9N A;  4XIC A;  5HSZ A;  2UXH A;  4AC6 A;  2QWT A;  3JRD A;  2HYJ A;  2TCT A;  4JKZ A;  3HGG A;  2GBY A;  2R5Z B;  1H8A C;  1TWF J;  4DW6 A;  5D19 A;  2EBI A;  3GBG A;  3PAS A;  3VVX A;  1MBH A;  1AKH B;  2B63 J;  2QIB A;  2NP5 A;  5J1R A;  5DTD A;  4GCK A;  2OER A;  1HLV A;  5EGO B;  4JX5 A;  1OFC X;  3S15 J;  3LSR A;  1RET A;  3IH4 A;  2HI3 A;  5CXG A;  2YVE A;  5EZG A;  2UXU A;  5K58 A;  1QVT A;  3MN2 A;  2O7O A;  2K9N A;  3BR5 A;  3NAU A;  2E2I J;  5CXI A;  3VW2 A;  3QPL A;  2R0Q C;  3MKL A;  4AF5 A;  4FIS A;  4V2F A;  5D18 A;  3S1M J;  3GTQ J;  2K9S A;  4FE7 A;  3KKD A;  2HYT A;  3LWJ A;  5EYR A;  1ZK8 A;  2R5Y B;  3BG3 A;  1ZQ3 P;  2DJN A;  3VUQ A;  2CQQ A;  5M5W J;  3RZO J;  1GVD A;  2LP0 A;  2QF7 A;  2FBQ A;  3WHB A;  1LE8 A;  3CCY A;  5CW8 A;  3E7L A;  4DZJ A;  2HXO A;  4D7M A;  1RES A;  2KDZ A;  4CYC B;  2CQX A;  4A3L J;  3S2H J;  5JLW A;  2Y0S N;  1ZTR A;  1HOM A;  3ZQF A;  3BNI A;  3Q0W A;  2CRG A;  1HCR A;  3HTJ A;  4BXX J;  2HOA A;  2JA8 J;  3GEU A;  3JRB A;  3TP3 A;  2JMW A;  4MFE A;  2ID3 A;  2NVT J;  3BQY A;  4XRM A;  1U78 A;  4MO7 A;  5IYC J;  5K7Z A;  2YVH A;  2QOP A;  3HOU J;  3FIW A;  2Y9Y A;  2XPV A;  2QKO A;  1UHS A;  4IHV A;  2VKV A;  2IEK A;  2OF7 A;  4GCT A;  3JRI A;  4IEJ A;  3LSG A;  4B1R A;  4G12 A;  3K2A A;  3JRA A;  2DA7 A;  2M34 A;  3LSJ A;  4HKU A;  3LOC A;  4DYC A;  3O8H A;  1ETX A;  1TWC J;  5E3N A;  2E1O A;  2DMP A;  4GCL A;  2E19 A;  2GM4 A;  3JR9 A;  1B72 B;  2L7M P;  3IH2 A;  2HOS A;  1XS9 A;  1QRY A;  4IHW A;  2OPT A;  2EQR A;  2IAI A;  1I6H J;  2G3B A;  4QIW N;  5HBU A;  1R9T J;  5JLX A;  1YRN A;  4D7N A;  2L0K A;  1RR7 A;  1NK2 P;  4XK4 A;  1OCP A;  5BNG A;  4FE4 A;  2X9D A;  3QKX A;  4C2M J;  1JT0 A;  3KNW A;  3GTJ J;  3VIB A;  4A69 C;  5FKL A;  4BKX A;  5M3M J;  1JTX A;  1IG7 A;  1IDZ A;  3IV5 A;  5EG0 A;  3HOV J;  4BY7 J;  3VP5 A;  1MH3 A;  3AQT A;  4M3B A;  1WPK A;  1IDY A;  5F1J A;  5FHP A;  5GP9 A;  1BW6 A;  5DS9 A;  2LD5 A;  4ICH A;  2WV1 A;  2WGB A;  4W1U A;  2D5V A;  3A01 A;  2W48 A;  4GFK A;  3FRQ A;  2JWT A;  3DEW A;  2ECB A;  3TW6 A;  3S14 J;  5C4Y A;  1FIP A;  3IUV A;  1IV6 A;  5C4J J;  4A3B J;  3HTI A;  4JL3 A;  4W97 A;  5E3L A;  1Z0X A;  2FQ4 A;  3F1B A;  1OJL A;  3SJM A;  2ELK A;  2XSD C;  4DYQ A;  9ANT A;  1IC8 A;  3OOU A;  2DA3 A;  3S1Q J;  2PMZ N;  3GZI A;  2DG8 A;  3E7Q A;  1MBF A;  3OSG A;  3VOK A;  1LFB A;  2VI6 A;  3CDL A;  1MBK A;  1ETW A;  2OI8 A;  1BW5 A;  2ME6 A;  3BG5 A;  3HIM A;  2VPR A;  5IOZ A;  5EDN A;  1TC3 C;  2XDN A;  1B8I A;  1A6I A;  4BY1 J;  2R92 J;  1K61 A;  3HTH A;  2RAE A;  2K40 A;  1JKP C;  1P7J A;  1MSE C;  3KZ9 A;  1BJZ A;  5F0C A;  3RQI A;  3A02 A;  1K83 J;  3Q0V A;  5IP6 A;  3HDD A;  2JJ7 A;  2JA5 J;  2O7T A;  4PXI A;  2LY9 A;  2NOG A;  1ENH A;  2I10 A;  3GTK J;  2DTZ A;  2P81 A;  2JK3 A;  1TWH J;  3KKC A;  5E3O A;  1A5J A;  3BG9 A;  1VND A;  3FK7 A;  1X2N A;  5IPA A;  5FLM J;  3M3Y J;  1DU0 A;  2ZOY A;  1LE8 B;  3V6G A;  2CU7 A;  2KT0 A;  1HDD C;  4UUS A;  1GDT A;  5EZH A;  2O8K A;  4GFB A;  1ETK A;  3Q3S A;  2FJ1 A;  5FLV A;  1ITY A;  4RBO A;  3C2B A;  3VW0 A; 
#chains in the Genus database with same CATH topology
 1MSF C;  1X2M A;  5CQG A;  1WHU A;  2V9K A;  2XVC A;  4L9T A;  4CA0 A;  1XDS A;  5D8L B;  4M3D A;  3HXL A;  3AG1 H;  3I3L A;  3EYY A;  3MZH A;  2XAU A;  3FHN A;  3MD2 A;  2Z5U A;  1IN5 A;  1T08 B;  1Y0N A;  2P7C B;  1KQ0 A;  3OSF A;  1IZ1 A;  2WBM A;  1EKE A;  2ZXH A;  1MMN A;  4HAM A;  3VYS B;  4G7Z F;  2QQB A;  3QPH A;  3VSL A;  2R93 J;  1JTY A;  2DU9 A;  2P5L C;  4X1E A;  4BAY A;  2NOJ B;  1MJB A;  3H0D A;  1T98 A;  4UHT A;  2E1M B;  1YS6 A;  2M4G A;  3TQN A;  5IP9 J;  4PDK A;  2R7X A;  2X4H A;  2Y0S A;  3BR2 A;  1Z3X A;  4ESF A;  3G3Z A;  2BVM A;  3CCQ I;  1J7K A;  2NX4 A;  2ZSI B;  1T38 A;  3I0T A;  3PJR A;  1ETQ A;  1YQA A;  2M1B A;  5DM6 F;  2PFB A;  3ZQI A;  1HKS A;  3F72 A;  2X1C A;  4R1H A;  4NDL A;  5ICE A;  2DA6 A;  3GUD A;  1RUO A;  3A03 A;  5D1R A;  2NP3 A;  4EV0 A;  3SDB A;  2LF7 A;  3GFL A;  2FJI 1;  5ILU A;  3HTU A;  3L1P A;  4RA2 A;  4DOZ A;  3U9G A;  2E7X A;  3R6S A;  2QQA A;  1XSX A;  3BPV A;  3I59 A;  4ABZ A;  1FZP B;  3TO6 A;  4HST A;  1A31 A;  2UZK A;  4QPO A;  1L3L A;  1IRG A;  2CQ7 A;  2M7A A;  3IP4 B;  4XKC A;  1IRZ A;  1OLT A;  2DQL A;  2K5C A;  4KJZ A;  5DDG A;  3S1N J;  2QLZ A;  3N4M A;  4Y52 J;  1D5V A;  1D0Z A;  2F5E A;  2PEX A;  1VQ7 I;  3M4O J;  3CO6 C;  3FBN B;  3MEX A;  2FBI A;  3AG4 H;  3T6N A;  3DTI A;  3FKI J;  5ERI A;  3RKQ A;  2M9H A;  1Y1W J;  2MC4 A;  2LMD A;  4IQ4 A;  3PIP F;  1HC8 A;  4NBQ A;  1HKT A;  3CMM A;  3F8B A;  2CQK A;  2W82 A;  5AON A;  2REK A;  4BQA A;  1B8I B;  1YW8 A;  3IL2 A;  4B47 A;  3W2A A;  1BR1 A;  4D5C A;  2V1N A;  1LFP A;  4D1Q A;  2N8G A;  1JT6 A;  2EH3 A;  2ZCN A;  5KAF C;  4XLN F;  1MDM A;  3QQA A;  2YU3 A;  2DOA A;  1GV2 A;  1XMK A;  2VE9 A;  5E79 C;  5HOO A;  3P9C A;  1J0R A;  1X4O A;  3JAM K;  4XRF A;  1CGP A;  3CJD A;  2ZCM A;  5GTH C;  1WCM J;  3W3C A;  2CS3 A;  1ZGW A;  3HOY J;  3ZQQ A;  2GA2 A;  2QKL B;  2HKX A;  4DBR A;  3LNQ A;  4KMF A;  4F55 A;  5KHD A;  1ZRF A;  2BHY A;  3SQN A;  3A1Y A;  3Q5F A;  3DV8 A;  4OD4 A;  2O3F A;  1PUF B;  4UV8 A;  1MMD A;  5K7F A;  3LSP A;  3PL8 A;  1FTT A;  5E18 F;  3COL A;  1TLH B;  1J5Y A;  2XRN A;  2QQ8 A;  2IRF G;  1QNT A;  1I27 A;  4YEL A;  3HRM A;  2MC3 A;  5E3M A;  4XID A;  1KYW A;  4UV9 A;  3QBM A;  5HLT A;  2CGP A;  1ZKG A;  4Y17 A;  4PJN A;  3OL3 A;  4X0G A;  5DV5 A;  2IU5 A;  2VJ4 A;  4PK4 A;  1JJ8 C;  1LDD A;  1Z1D A;  3BJ6 A;  2DG7 A;  4Q4Z F;  2QEX I;  3HB9 A;  2LR8 A;  3S93 A;  1NHA A;  2EA4 A;  2DN0 A;  2EFW A;  5EGO A;  4EEF G;  3CC2 I;  2X6W A;  2E2J J;  3ZR8 X;  1MH4 A;  3R0J A;  4GGG A;  1W0T A;  1G6N A;  3LMM A;  5IT3 A;  3FXO A;  2Z33 A;  1LPQ A;  2ZC2 A;  2VJ5 A;  2NVY J;  5CKT A;  4KNY A;  4LK1 F;  2DA5 A;  1TWG J;  2EJR A;  4OAY A;  3LST A;  2FX0 A;  1HA8 A;  1NTC A;  2HTJ A;  4UVC A;  2JQ7 A;  2YUS A;  1BC7 C;  3COA C;  3LSK A;  2EIJ H;  1YTY A;  3HM5 A;  4IOA F;  1HDP A;  2LDU A;  1MD0 A;  3I54 A;  2XGD A;  2ESN A;  2KIQ A;  4BJT A;  1QPI A;  2A5Y B;  2COB A;  2MSY A;  3RSN A;  4XOT A;  3AL0 C;  3ABU A;  3HE0 A;  2PMU A;  4S04 A;  3MQ0 A;  4UUT A;  1FBU A;  3H36 A;  4Y4R A;  5LGN A;  4A3E J;  3NNR A;  2AO9 A;  4G6Q A;  4G7O F;  2WB1 A;  1IUY A;  4KYW A;  3E5Q A;  2IS6 A;  3HOX J;  4LLN A;  5J4V A;  1R5I D;  2YX4 A;  3CUQ C;  1I50 J;  5FGL A;  2H09 A;  2DBB A;  3RPU D;  2LKS A;  1JXS A;  2VQG A;  2Y9Z A;  1SGM A;  4Y7N J;  4ENJ A;  5DD4 A;  1R00 A;  1XC5 A;  2V79 A;  4MLO A;  4I09 A;  3K1N A;  1FBQ A;  3OYG A;  4HF0 A;  3ZMU A;  1O3R A;  4A3G J;  4C3H J;  3G71 I;  2K9L A;  1BA5 A;  1EF4 A;  1XG1 A;  2LYC A;  5TGT A;  2HYF A;  3GME A;  2JA2 A;  2OD5 A;  2OQR A;  2XAS A;  4HBL A;  3LSM A;  5DUI A;  1G3Y A;  3FIS A;  1B1B A;  1B4A A;  5D6F A;  2OCE A;  4ME9 A;  2TRT A;  1XPX A;  1YFH A;  1SD6 A;  4M3G A;  5HAW A;  4H4K C;  4CSW A;  4YG2 F;  3B6C A;  2F5V A;  4A3J J;  3NRG A;  2F5C A;  2H1K A;  5K5O A;  1IN8 A;  3WG7 H;  2B9S A;  4L62 A;  1OIS A;  3H3Z A;  2L5Q A;  3BPX A;  2QKM B;  2ZSH B;  3HUG A;  5K5R A;  1GV5 A;  2KDO A;  5BS6 A;  3GLX A;  3RJP A;  5HOD A;  5F27 A;  2PJP A;  4HZF A;  2NXN B;  3HRU A;  3UKG A;  2RHA A;  5K5Q A;  3CCE I;  1H9G A;  3BZC A;  1LFU P;  3OIQ A;  4KT6 A;  2FEZ A;  3EUK L;  5HS9 A;  2WY7 Q;  2OTL I;  2I5U A;  5J1Y A;  3I4N J;  5JVG F;  1TNT A;  3CD6 I;  3T0Y A;  1MBE A;  4CGR A;  2VBX A;  4WXH A;  3JSP A;  4II3 A;  2ISY A;  1KGS A;  1W7P D;  2L9N A;  2R5Z B;  4JKZ A;  3F23 A;  3CJT B;  3DFG A;  3GZN B;  2EBI A;  1Y6I A;  4BQQ A;  3PAS A;  4HQM A;  4ZH4 F;  3VVX A;  1ONV A;  2FQ3 A;  4IL6 C;  2QIB A;  2FOW A;  2X51 A;  1MZB A;  2EPF A;  2JVG A;  5DTD A;  1FOX A;  2OER A;  1HLV A;  4DVY P;  1RET A;  4WXC A;  5CXG A;  1UHM A;  5EZG A;  5FLX Z;  2XGX A;  1BR4 A;  1QVT A;  2HVS A;  5CLS A;  2ZY9 A;  1LEA A;  3IAM 2;  1FBS A;  2VE8 A;  4HA8 A;  3OYD A;  1FSH A;  1UEL B;  3WTT C;  4V2F A;  2CV2 A;  3GTQ J;  3S1M J;  1MMS A;  3BWG A;  2K9S A;  3LWJ A;  4B44 A;  1ZK8 A;  2CQQ A;  1YX3 A;  2ZJ2 A;  3I4P A;  2LP0 A;  1VQO I;  3EUH C;  1W5S A;  1F1Z A;  2IS2 A;  3CCY A;  3ROU A;  2D1H A;  2ZXW H;  5CW8 A;  1XTA A;  3E7L A;  2JTV A;  4D7M A;  1HW2 A;  2LSO A;  4A3L J;  2EIL H;  4PFO A;  1Z7L A;  2ZBK A;  5HDG A;  5L3E A;  2Y48 A;  1HOM A;  4XMY A;  3ZQF A;  4XN0 A;  5DCM A;  4I7H A;  2Q2E B;  2CRG A;  3BNI A;  1HCR A;  4BXX J;  1EA3 A;  3JRB A;  5FRO A;  1UST A;  4XRM A;  4MO7 A;  4OMZ A;  5K7Z A;  1V55 H;  1VQ9 I;  3K4M A;  2WTE A;  2KZG A;  3AG3 H;  3HOU J;  1IXC A;  1Y56 A;  2R7S A;  3PSI A;  4B48 A;  2XPV A;  1N25 A;  4IHV A;  2RNG A;  3I71 A;  5H6Q A;  2UV1 A;  1VQM I;  4B1R A;  3K2A A;  4XLP F;  1VQ6 I;  3JRA A;  2DA7 A;  1E17 A;  2EA2 A;  2D1V A;  3PNT A;  3KCC A;  3R0A A;  2DFI A;  2FML A;  1TWC J;  4GCL A;  2EK5 A;  2HVR A;  4D0P A;  2PI0 A;  4P5O A;  2L7M P;  3IH2 A;  3I5U A;  2HOS A;  1QRY A;  1YO5 C;  2OPT A;  2EQR A;  1ZAR A;  2EIK H;  2HTS A;  2IAI A;  4HX4 A;  4WF2 A;  2IW5 A;  1SAX A;  3ABT A;  1RR7 A;  1QZY A;  5BNG A;  4FE4 A;  5KK1 A;  1OCZ H;  2X9D A;  1W36 D;  3BZ6 A;  3ABM H;  4C30 A;  3VIB A;  5HNF A;  3KNW A;  3QYE A;  4J01 A;  4A69 C;  1HW1 A;  1IDZ A;  4BKX A;  5M3M J;  2WWY A;  4LIU A;  3L2Q A;  3L2W A;  4XLA A;  5FHP A;  5GP9 A;  1FNN A;  1BW6 A;  5DS9 A;  2F2E A;  2LD5 A;  3ZPL A;  2WGB A;  5KVR A;  3QYB A;  3K4J A;  4E7I A;  2D5V A;  3SEZ A;  3FMS A;  1OCC H;  1PUE E;  3MKY B;  4GFK A;  2KP6 A;  4UNO A;  4EJU A;  2ECB A;  3HIF A;  3ZXS A;  5D5X B;  4ENN A;  2L4A A;  1ODD A;  1A35 A;  4CCN A;  4JL3 A;  1Z0X A;  2KZV A;  3F1B A;  1LJ9 A;  2VAS A;  2XSD C;  3MZY A;  4QLC U;  2DA3 A;  2DJI A;  1D8J A;  3F22 A;  3VOK A;  2VI6 A;  3AL0 B;  3CDL A;  4HQE A;  1BW5 A;  4HF1 A;  5IOZ A;  5EDN A;  2IGO A;  1I3A A;  2BE5 F;  4YII A;  5IT9 K;  2XDN A;  2JPB A;  1A6I A;  1X3U A;  3WTV C;  4GDF A;  3GFI A;  5KNL A;  3CF2 A;  3IWZ A;  2L02 A;  1BJZ A;  3CUQ B;  5F0C A;  1K83 J;  2YPR A;  4LD5 A;  1ON1 A;  2JJ7 A;  1K4T A;  4PZJ A;  3B73 A;  1ENH A;  2I10 A;  3KX2 A;  2RN7 A;  4Q48 A;  3FXL A;  1DPR A;  3GYH X;  1VND A;  1K4S A;  2DI3 A;  5FLM J;  4U7B A;  5J40 A;  2K02 A;  1BN5 A;  4IJA A;  1TTY A;  5DM7 F;  1TQM A;  3DBL B;  1OYW A;  3TMO A;  1T0F A;  5EZH A;  4GFB A;  1OKR A;  3KZZ A;  4RBO A;  3VW0 A;  3CLO A;  4ZYA A;  3FX3 A;  3GTO J;  2H8R A;  2AHQ A;  4EJW A;  2G7G A;  1FY7 A;  1WH5 A;  2G0E A;  2G7H A;  4JBA A;  2QCO A;  3PQK A;  5GAE J;  3VVZ A;  2COM A;  2XF5 A;  3SFZ A;  2Y75 A;  2YX7 A;  3S5R A;  3F3X A;  4NHJ A;  3KP5 A;  1MND A;  4OU0 A;  4IPA A;  1AA7 A;  5DEQ A;  3CCM I;  3LJL A;  4Y15 A;  1W36 C;  1WH7 A;  4RB3 C;  2ACJ A;  1J2X A;  5E20 A;  3T5X A;  3MNL A;  3ZQH A;  2G7U A;  1G2H A;  1O4X A;  2HQ5 A;  2ZNY A;  3W6V A;  1LEB A;  3DF8 A;  2AQF A;  4UDS A;  4EGZ A;  1ZR4 A;  4BXF A;  1RC9 A;  1YLF A;  3ERE D;  2X85 A;  2EZK A;  4G94 A;  2IPQ X;  2W84 A;  1R22 A;  2XB0 X;  2XB5 A;  4M71 A;  5JHU A;  2WV0 A;  3D0S A;  1YIJ I;  1YRN B;  2XIG A;  1HQC A;  1VI0 A;  2EFP A;  3F8N A;  4L9N A;  4BS9 A;  3J81 Z;  2NVX J;  5F04 A;  2IS1 A;  2VOD A;  3V8L A;  5D6E A;  3HTA A;  1WQ2 A;  2XAQ A;  2LVS A;  5FGM A;  5JI6 A;  4LGW A;  5HNH A;  4S0H B;  1XMA A;  5EG0 B;  1PJR A;  4HPQ A;  1QPM A;  1J09 A;  2ZME A;  3IHU A;  4LK0 F;  4MEY F;  1XCB A;  3J7A Y;  2HGC A;  3SDG A;  3A01 B;  2GXB A;  3HRT A;  1V3F A;  3GF2 A;  1OYY A;  1R6R A;  1H88 C;  3W6K B;  4EGY A;  2STW A;  3BTC A;  4C2M A;  2E5N A;  2E34 A;  2HQA A;  4A3C J;  1STZ A;  2UXP A;  2PX9 A;  3AG2 H;  2HDW A;  4F93 B;  3D1N I;  4U0V A;  1P9Q C;  5FKK A;  3OYA A;  1ZRC A;  3QYF A;  3J7A O;  1U8B A;  4I6Z A;  2DXI A;  2W53 A;  1FLI A;  5K7H A;  1UI5 A;  3OYM A;  3REO A;  5GPA A;  4GXO A;  4E7L A;  1F4K A;  2ZKZ A;  2OTJ I;  1P7I A;  3DXJ F;  3H3V K;  2LY1 A;  2FD5 A;  4PGH A;  5FKM A;  4ZYE A;  1HSJ A;  3KEO A;  4XLC A;  4XSZ F;  5EFY A;  3HPG A;  2Z16 A;  3AFH A;  4RGS A;  2YU9 J;  3CJQ B;  1APL C;  4L5E A;  1EJ9 A;  2X48 A;  1ZHF A;  4ASN A;  3DTK A;  4LLL A;  2R7R A;  4XLE A;  5AIQ A;  3A0B C;  1OYI A;  5HLG A;  3CLQ A;  3V8J A;  4QSH A;  2EIM H;  2WY8 Q;  2PFV A;  2LK2 A;  4IF4 A;  5LHH A;  3SZT A;  2FMY A;  5D5U B;  4M3F A;  5J3L A;  3BCA A;  2UXI A;  5C44 J;  1AWC A;  3HBL A;  3KFW X;  3FXK A;  2VT3 A;  4CDG A;  1I3Q J;  3BRU A;  5C3E J;  1WJA A;  5LFA A;  4RAG A;  2IA2 A;  1B6A A;  5DUK A;  4ZJZ A;  5GPC A;  1OPC A;  3AQS A;  2VQL A;  3I58 A;  3MKW B;  3E3V A;  3B02 A;  3VDX A;  4I2O A;  4ON0 A;  3QOD A;  4BQN A;  4YEJ A;  4XBF A;  1WGX A;  3KP7 A;  1ZRD A;  1FP2 A;  3QP6 A;  2HQN A;  5FKO A;  3HC7 A;  1W7P B;  2L7F P;  1WJE A;  2BVL A;  4XRS A;  4XLH A;  1JKR C;  2LFB A;  4FAS D;  5HVQ C;  1AKH A;  5F0H A;  3CZ6 A;  1AHD P;  5FJ8 J;  5KCM A;  3TBI A;  3P5J A;  5EJC A;  4E7S A;  4JOM A;  2G7S A;  3G56 A;  2DW4 A;  1E3O C;  1WJ5 A;  2XPW A;  3G2B A;  1T56 A;  3KE2 A;  3BJO A;  2JUC A;  1Z77 A;  4FTH A;  3F8F A;  1HF0 A;  3BCG A;  2VIX A;  3K69 A;  2W85 A;  2QBY A;  3OIO A;  3PM1 A;  1SFU A;  5FRN A;  3RQ4 A;  5LBQ A;  1O7F A;  1YYV A;  2M2E A;  1VQN I;  1WVR A;  4IVN A;  4U88 A;  2IP2 A;  3GLL A;  3JTH A;  3U21 A;  3CF5 F;  2HEO A;  3HSF A;  2VC0 A;  1LUJ B;  3VFZ A;  1T8I A;  2ZCX A;  1BIA A;  4RLQ A;  3NQO A;  1R1U A;  2R5Y A;  2L01 A;  1SFK A;  3G1O A;  5CVR A;  2OV7 A;  3BDD A;  4EMS A;  2F6C A;  3SWH A;  4KMU X;  1X1C A;  3QRF F;  3JRE A;  2MH2 A;  3WTS C;  4IO9 F;  1IGN A;  4UXN A;  1QO0 D;  2P0W A;  1RNL A;  3CWR A;  4A3I J;  3GW2 A;  1DUX C;  4G7H F;  1T33 A;  1ZGA A;  4WIB A;  2LLK A;  1SVM A;  2ISZ A;  3VSK A;  3PFY A;  4WXD A;  3RD3 A;  3ON2 A;  2Y69 H;  5EEA A;  3RH2 A;  3QPS A;  4F3Q A;  1U9O A;  2UXX A;  2X6O A;  2CO5 A;  5FKN A;  2Y2Z A;  3F0C A;  3M1C A;  5BMZ A;  5IYD J;  1Z6T A;  3TOA A;  3GFJ A;  4CCJ A;  3S8P A;  3GTM J;  2CFO A;  2CV0 A;  2DMU A;  4PJJ A;  2EV5 A;  4A3M J;  2XSJ C;  3WGG A;  3JRH A;  2B3W A;  2H8W A;  2WAQ N;  4MXM A;  2ZB9 A;  1X1B A;  1K7A A;  2ZFU A;  3OOP A;  1JJ6 C;  4AM3 A;  2VXZ A;  2C6Y A;  3CUO A;  2RKH A;  3CQZ J;  1B72 A;  3IRQ A;  3DLL F;  2HVQ A;  4II2 A;  3VOE A;  2M5W A;  1QVU A;  3V4G A;  2D45 A;  2STT A;  3IH3 A;  4V19 K;  3SYT A;  3J81 K;  2WAQ A;  1D1C A;  2IXS A;  1UCR A;  4BBS J;  2JSC A;  2VQH A;  4Q47 A;  2E7W A;  1UAA A;  3TO9 A;  1QZE A;  5C4X J;  2MA3 A;  2GZW A;  2J5O A;  4OAZ A;  5EF6 A;  1UI6 A;  3Q9V A;  3OYL A;  2M4K A;  2KIF A;  1R58 A;  2XKP A;  1ZEL A;  3C7J A;  3RPU A;  3JRC A;  4N9I A;  3VTI A;  3EUP A;  1GUU A;  2XAF A;  1Y8R B;  4UY8 I;  1KA8 A;  4BL0 B;  4HYE A;  1H89 C;  2UXN A;  3VOX A;  1G8X A;  3F6O A;  2HOT A;  1FYL A;  4UUS B;  2OZU A;  2ADU A;  3A2K A;  3RZD J;  1FPQ A;  2NS7 A;  1UHW A;  5IYB J;  1R1T A;  4XIC A;  5HSZ A;  2RGV A;  2F5F A;  2QGU A;  4ESJ A;  2BXY A;  4A6E A;  3N97 A;  1USS A;  3CJR B;  1OR7 A;  3LQQ A;  4HNU A;  2ZJQ F;  5LHG A;  1MBH A;  3EYI A;  3CCR I;  2B63 J;  5BOX A;  1YIT I;  3ONQ A;  4XOP A;  4JX5 A;  4YRV A;  3S15 J;  3LSR A;  2YVE A;  2R7Q A;  2O7O A;  4L9J A;  1B9N A;  2DK5 A;  1KQ9 A;  2LH9 A;  3FDY A;  3LSI A;  3AKZ A;  4J00 A;  4BE0 A;  3QP5 A;  2I8D A;  4MHG A;  3FXM A;  3J80 K;  5D18 A;  2KHM A;  1BBY A;  4A12 A;  2PBI A;  4FE7 A;  4KN4 X;  4E7K A;  5EYR A;  5GAD J;  2IA0 A;  1G4D A;  2DJN A;  4ZC3 A;  5M5W J;  1TW3 A;  3RZO J;  2FBQ A;  2QF7 A;  4O6J A;  4A5N A;  2K9M A;  3WHB A;  1LE8 A;  1ZRE A;  4XM3 A;  1SVL A;  1I5Z A;  4DZJ A;  2HXO A;  3K6G A;  1P92 A;  4CYC B;  1QQI A;  5JFR A;  3PNV A;  1O57 A;  3KP6 A;  4LB5 A;  1FOY A;  5LRR A;  2HYG D;  5JVT A;  1W7P A;  3MWM A;  3GEU A;  2DK8 A;  2KKO A;  1WSU A;  3CMA I;  2ID3 A;  2FE3 A;  1YI2 I;  1U78 A;  5LGT A;  1H9T A;  2CV1 A;  3K4K A;  4G8X A;  4I02 A;  2QOP A;  5D4S A;  2YVH A;  4BU2 A;  2VJI A;  5LEK A;  4S05 A;  2DLL A;  1U0J A;  2BYV E;  1SD7 A;  2QKO A;  2VXD A;  3RDI A;  2IEK A;  2OF7 A;  1H0M A;  1DP7 P;  5CVU A;  3A4C A;  1S6L A;  1D0X A;  3UNG C;  4B43 A;  4Q5S F;  3S3O A;  4A0X A;  4OMY A;  3ABL H;  1SMT A;  4G9Y A;  5J6X A;  1KU3 A;  5E3N A;  2CW7 A;  2DMP A;  1UJ8 A;  2X6Y A;  4CZC A;  1DP3 A;  2OAZ A;  2FOK A;  2K85 A;  1R71 A;  2H6B A;  3DBR B;  4I98 B;  1XS9 A;  2HOE A;  4IHW A;  1I6H J;  2G3B A;  4QIW N;  3D5R C;  1XGS A;  4DBQ A;  1NG6 A;  1QBJ A;  2L0K A;  2VKD A;  1NK2 P;  1TL8 A;  3CC4 I;  1BI2 A;  2KFD A;  4BGD A;  1T6S A;  1N75 A;  4AIH A;  5ICF A;  2GA1 A;  2XKO A;  1IRX A;  1D3Y A;  3HJE A;  3FXQ A;  4E4H A;  4BUP A;  2FRH A;  3FF5 A;  5FKL A;  1K78 B;  1P4A A;  2IGM A;  4ZZL A;  2BOL A;  2M45 A;  4BYY A;  1WPK A;  5TIS C;  3RYP A;  3RKY A;  4EJT A;  2ELJ A;  3LAJ A;  3ZMZ A;  2JWT A;  5HDN A;  3PNY A;  3DEW A;  3S14 J;  5LHI A;  1FIP A;  1JE8 A;  2BXZ A;  4CGZ A;  2DCE A;  1WJD A;  5D5V B;  2YR2 A;  3MMY B;  3ZRG A;  2KIS A;  5E3L A;  2FQ4 A;  3PUB A;  1R5H A;  3HG9 A;  4RB0 A;  2EV0 A;  3IAS 2;  3SJM A;  2ZFW A;  4KIB A;  5K1Y A;  3V7C A;  4ZYD A;  3S1Q J;  2B1E A;  1BI1 A;  1IW7 F;  3GEZ A;  3E7Q A;  3CCL I;  1MBF A;  5ICG A;  1MBK A;  1ETW A;  2XV4 S;  1HBX G;  2L7K A;  3BG5 A;  1SD4 A;  1W5C C;  2ZXJ A;  4Z2Y A;  2YSR A;  4OIN F;  3VOD A;  3HYI A;  4NUB A;  3OYC A;  3JCU C;  1B8I A;  4BY1 J;  2M3A A;  1UB9 A;  4MTE A;  2QA4 I;  2VL8 A;  2CSO A;  3HL2 A;  3HTH A;  3MFK A;  1MMG A;  2CG4 A;  1MSE C;  2VPL A;  3RQI A;  3A0H C;  3Q0V A;  1VQL I;  2JA5 J;  2O7T A;  4IQJ A;  2LY9 A;  2NOG A;  4R79 A;  3FMQ A;  2DTZ A;  4LIT A;  2JK3 A;  2P6S A;  1TWH J;  3L2U A;  4RGU A;  4M9X A;  2L54 A;  1A5J A;  3FXR A;  4ENM A;  3IUO A;  3DU5 A;  5IPA A;  3E0J B;  2RC4 A;  2QZ8 A;  1Z67 A;  1V5G A;  4KIF A;  3LFK A;  1ZH5 A;  2BGC A;  4AIJ A;  3H35 A;  2W57 A;  3L7W A;  4UUS A;  3GVA A;  2KJB A;  4NC6 A;  4U87 A;  1NH3 A;  1QHG A;  1GDT A;  2O8K A;  5DCF A;  4B09 A;  2GLO A;  1TWA J;  1MNM C;  4IHS A;  1KON A;  4JX4 A;  5J1U A;  4CZZ A;  2R7Z J;  1RPW A;  1PUF A;  2CUJ A;  3NXC A;  5B3S H;  3K2Z A;  4RS8 A;  1RKW A;  4AUX A;  1JGG A;  3ASN H;  2P8T A;  1S9H A;  5IOY A;  3E5U A;  2RV8 A;  4RB2 C;  3GTG J;  1FYK A;  1IV8 A;  4RGX A;  3IC7 A;  3M07 A;  1R1V A;  3S2W A;  4M3E A;  3TW7 A;  2W25 A;  1BC8 C;  3OYI A;  4BJ6 C;  2HQR A;  1RZ4 A;  4GYG A;  3LSH A;  3SZG A;  1YIO A;  1DQU A;  3SEQ A;  3ZMT A;  3RCO A;  1U3E M;  3P9T A;  3U1D A;  3GCM A;  3OYN A;  3BJB A;  1CF7 B;  1XD7 A;  2JRT A;  2Y30 A;  1S8N A;  1R49 A;  3E97 A;  1XDU A;  2HZD A;  4JYK A;  4BJ5 C;  2A5W A;  4MGR A;  3K70 D;  1K79 A;  3DPT A;  2W00 A;  2M7B A;  1ZR2 A;  3CO7 C;  1IUF A;  2JT1 A;  1D5Y A;  2LC2 A;  3O60 A;  2WAF A;  1FT9 A;  4FT8 A;  1KZH A;  2ZXI A;  4E7Z A;  3K0L A;  3KET A;  2VC1 A;  2KJC A;  2H6C A;  4MNU A;  1D8K A;  3W2V A;  3NAR A;  1J59 A;  2DPU A;  4M9S A;  1R36 A;  2IA1 A;  3LL7 A;  4AVZ A;  1RUN A;  5CQE A;  1P4X A;  3ECH A;  2MGQ A;  3I64 A;  3FXU A;  3H5N A;  2ZOZ A;  2E60 A;  1XGO A;  3BCB A;  3WHC A;  1GVJ A;  4XKB A;  1FJL A;  3JTG A;  2O9L A;  1JI8 A;  4DYR A;  1SEU A;  2WUI A;  4D9J A;  1IXR C;  2DAO A;  3BRO A;  2ID6 A;  1VTN C;  2D2W A;  1T2K A;  1P2F A;  2LBF B;  1TBX A;  4CCM A;  5B1B H;  1FP1 D;  3B6A A;  2V57 A;  1YX5 A;  1CQT A;  1PP8 F;  1HKQ A;  1Z05 A;  2LG4 A;  3KYC B;  1WI9 A;  2KRF A;  4C2T A;  2NVQ J;  4Y33 A;  3K4B A;  3BLY A;  4M74 A;  4MTD A;  4FET A;  1ETY A;  2FF4 A;  4A0Y A;  2E71 A;  2VOO A;  4IXA A;  4YFK F;  1WZ2 A;  3ELK A;  4IRI A;  2DFH A;  3PPB A;  3K9T A;  2X1E A;  1V5E A;  4L18 B;  2F48 A;  1VQ8 I;  2R7D A;  3F8C A;  2EFN A;  1BOB A;  3T1B A;  1IAW A;  3CES A;  1T95 A;  4ZZD A;  2QWW A;  1S72 I;  5FRM A;  1Z3Y A;  2CUF A;  3P9I A;  4ZDL A;  2QEN A;  3ML6 A;  4CH7 A;  1DU6 A;  4A93 J;  2EZH A;  1EH6 A;  1WWX A;  2R7V A;  3CRJ A;  2XF6 A;  4BEH B;  5LEJ A;  4X6A J;  3VYU B;  4CHU A;  2WC2 A;  2DPD A;  4RDU A;  4HDU A;  2KRH A;  1YJ9 I;  4XSX F;  5A2Q Z;  3KYD B;  2UWM A;  4OIR F;  2XF7 A;  4CO8 A;  1FC3 A;  2F4I A;  2HKO A;  3FK6 A;  3GZ5 A;  2MAB A;  3JRF A;  2A61 A;  1EH7 A;  1I1S A;  4D5F A;  3DKY A;  4RAZ A;  3ON4 A;  1JUM A;  2BW3 B;  4A3F J;  3M1E A;  3G7R A;  5FMP A;  3RI4 A;  4BDY A;  4JP0 A;  4CXF A;  3V42 A;  2PBX A;  1SVO A;  2ZNZ A;  2OA4 A;  1ZG1 A;  4KIG A;  5IP7 J;  4NC8 A;  3GO5 A;  2XGC A;  4ZDP A;  4RMN A;  4C3I J;  2CUE A;  3V7R A;  3ZMV A;  4LG0 B;  3WE2 A;  2Z99 A;  1UG2 A;  2JN6 A;  4M6X A;  3K70 C;  1Y8Q B;  2L9V A;  5IY5 H;  1IN6 A;  4UVB A;  3F21 A;  4L9V A;  3SFI A;  2Q1Z B;  3K4N A;  2VKE A;  3K10 A;  1VFC A;  4RB1 A;  3L00 A;  3DBH B;  2IJL A;  4DJA A;  2AS5 F;  2FUG 2;  2Y31 A;  4B3A A;  2WAD A;  4MQ9 F;  2R5Z A;  2E2H J;  5DAJ A;  2LY2 A;  2R7F A;  4AYB N;  5B66 C;  2XPU A;  3HZJ A;  2JRM A;  2EZL A;  1I1G A;  2P6T A;  1POG A;  2CH0 A;  3L09 A;  3QPT A;  4FQG A;  4Y3O A;  2ZJR F;  4HF2 A;  2JZY A;  2VB6 A;  3CTA A;  4EQQ A;  3E6M A;  3OYJ A;  3HSE A;  2MYS A;  2AXL A;  4J19 A;  1BIB A;  3R60 A;  4BHC A;  3KP4 A;  3HKZ N;  2O5R A;  6PAX A;  4HX7 A;  2CUZ A;  1ETV A;  1Q1V A;  3H92 A;  4AYB A;  2G7L A;  3ANG A;  1LNW A;  3KP3 A;  1JKO C;  4BQO A;  4HOB A;  2GQQ A;  2V9V A;  1V4R A;  4P9F A;  1X3Z B;  5FLX K;  3OY9 A;  2YVX A;  2QUF A;  3WOD F;  5KAI C;  3DPJ A;  2MW8 A;  3HKZ A;  5E1W A;  3W2W A;  2UXO A;  3I59 B;  3E6B A;  4YIF A;  1RI7 A;  3L2V A;  1MJ9 A;  5LRS A;  3BG7 A;  4HNV A;  2EWN A;  4LOC A;  3GX4 X;  1G59 A;  2MG4 A;  2Q2E A;  3G1L A;  3G6E I;  5BPD A;  1R4N B;  1BR2 A;  4AID A;  1Y1V J;  4YZE A;  5F6F A;  1CF7 A;  4A3D J;  2V7F A;  5EEH A;  3I55 I;  4AD9 A;  4AC0 A;  4HW0 A;  3DEU A;  4IKF A;  2OC6 A;  3MCZ A;  1JUP A;  3ZGK A;  1MNE A;  2EV6 A;  4M9Z A;  2IS4 A;  2P5K A;  2NAZ A;  1R23 A;  3DLA A;  3K8P C;  1EH8 A;  2DYR H;  2FBK A;  3L9F A;  3BR3 A;  4OOI A;  3OL4 A;  4QTR A;  3LAP A;  3ULQ B;  3HOW J;  1BJA A;  3M7G A;  2PLY A;  3TO7 A;  5E17 F;  1FMW A;  2DQR A;  2DT5 A;  5AIP A;  3JAM Z;  1D1B A;  1DDN A;  1XGM A;  3BQZ A;  3PO3 J;  3HEF A;  1WJF A;  1MDM B;  2R7U A;  1ORK A;  3FWE A;  1FTZ A;  5FFZ A;  2XC7 A;  1FWZ A;  1W4M A;  2V1D A;  2XAJ A;  4OIO F;  2DA4 A;  5CYV A;  4FX4 A;  3WU0 A;  1TQI A;  4LLG F;  5EEG A;  3O6B B;  4DZP A;  3BOQ A;  5LLQ A;  3I56 I;  3OR2 C;  1SD5 A;  4KIS A;  4ZTF A;  2LNB A;  2ZJP F;  2W1O A;  3BHQ A;  4WCG A;  4NC7 A;  4OIP F;  5CPR B;  2QQ9 A;  1OCO H;  4IHY A;  1HXD A;  3G73 A;  4F7Z A;  4OIQ F;  3NPI A;  3MKZ A;  1KU2 A;  4UVA A;  2DOD A;  2ECC A;  2PZ9 A;  3OS1 A;  2XRL A;  4MFD A;  4DIQ A;  4YIR X;  2B0L A;  1WI3 A;  1SAN A;  4LB6 B;  3RPQ A;  1SFO J;  1U8R A;  3S16 J;  5M5X J;  3FM3 A;  3E6D A;  2ETH A;  5ILS A;  2UXH A;  2QWT A;  4AC6 A;  1PYV A;  3JRD A;  2TCT A;  3RKX A;  3H3U A;  2AXT C;  1C0W A;  4N4N B;  4XLF A;  2GBY A;  1TWF J;  4DW6 A;  5D19 A;  4HLX A;  1LDJ A;  3J7Y J;  2NS0 A;  4U0W A;  2VN2 A;  4U9N A;  1TT5 B;  3DEE A;  4BEH A;  3WG9 A;  4O5V A;  3F9K A;  4N9H A;  3I53 A;  5EGO B;  3IH4 A;  4XKW A;  2A69 F;  2KRC A;  5K58 A;  3CUQ A;  1XB4 A;  5JR3 A;  3MN2 A;  1O3Q A;  5LGU A;  3BR5 A;  2E2I J;  1Y0U A;  1FOW A;  3OV8 A;  3OS2 A;  3BJA A;  1V54 H;  5CXI A;  4FIS A;  2M87 A;  3HOS A;  3KKD A;  3KZY A;  2HNH A;  3VWB A;  2HYT A;  1ZAO A;  4LG0 A;  3BG3 A;  1YHQ I;  3VUQ A;  1SFX A;  3T8R A;  4RAY A;  4ANJ A;  3K4L A;  4I0B A;  3PUF A;  1DPU A;  3H9Q A;  5J8C A;  2CW0 F;  3H1C A;  2KDZ A;  5HLI A;  4P55 A;  2F4O B;  3OYF A;  3S2H J;  5JLW A;  2NVU B;  2K3F A;  2Y0S N;  2M30 A;  4CUG A;  1Z21 A;  3K1P A;  3Q0W A;  2R7O A;  3ASO H;  2DDA A;  2V26 A;  3TP3 A;  2JMW A;  4MFE A;  2O03 A;  2NVT J;  5TRD A;  3S3M A;  1RRJ A;  1Q1H A;  2FNA A;  3K4C A;  2X1D A;  5H20 A;  2FXA A;  2Y9Y A;  4Y13 A;  4BE1 A;  4F92 B;  4MEX F;  1ON2 A;  3WTU C;  2VKV A;  3EPZ A;  3JRI A;  2KLO A;  2V1X A;  4IEJ A;  5F1R A;  3LSG A;  3PIO F;  3CJN A;  2M34 A;  1GLN A;  3LSJ A;  2K7L A;  2MLG A;  4U9L A;  2W4S A;  1F9N A;  2DT7 B;  3LOC A;  3O8H A;  4DYC A;  1ETX A;  4B3X A;  1U5T C;  1BI0 A;  2E1O A;  4E6K G;  3H5R A;  1B59 A;  1T0F C;  2MLK A;  3PQJ A;  3JR9 A;  2E36 A;  1X19 A;  4MQV A;  4IHT A;  4M6Y A;  2P4W A;  3ZN0 A;  1R9T J;  2K27 A;  5JLX A;  1OCR H;  4D7N A;  1ZYR F;  5D5W B;  1YRN A;  1UG0 A;  4P9U A;  4O3M A;  3M8E A;  1JGS A;  4F52 A;  3WTZ A;  4XK4 A;  1OCP A;  2A2F X;  2KIU A;  1HST A;  5DD8 A;  1G3T A;  3C2H A;  4BNC A;  1FYM A;  5EG0 A;  4BY7 J;  3AQT A;  3HUG B;  4M3B A;  4CCK A;  3G4S I;  1IDY A;  5E8I A;  5FFX A;  2BZT A;  4DQ2 A;  3LFU A;  3A01 A;  4FHT A;  3FRQ A;  1ULY A;  3LA2 A;  5LD2 C;  2HPM A;  3TW6 A;  3ABK H;  1IV6 A;  3DTE A;  3GWZ A;  3QOP A;  1LDK B;  4A3B J;  4XON A;  4W97 A;  1YG2 A;  2MD0 A;  3F6V A;  4AU7 A;  2FNP A;  3EDP A;  4I0A A;  1X1A A;  1IRF A;  2K3P A;  4LMY A;  4QPQ A;  4XQF A;  1V5F A;  2ELK A;  3WGI A;  2VBZ A;  4DYQ A;  3DKW A;  2KQR A;  3EUH A;  3OOU A;  3U1K A;  4I99 C;  1IC8 A;  1DGR M;  2PMZ N;  2XDV A;  2DG8 A;  1A04 A;  4LJZ F;  4LFU A;  2X6X A;  4L0Y B;  2OI8 A;  3HPH A;  1E3P A;  1Z91 A;  4AWX B;  4U0Y A;  2GXA A;  2EB7 A;  3AAF A;  4E70 A;  2R92 J;  2O8X A;  2CYY A;  2ZME C;  1K61 A;  4WK8 F;  2BEO A;  1JKP C;  2XRO A;  1EV7 A;  4HRI A;  1F5T A;  4L5J A;  4GRI A;  2R4G A;  2PMZ A;  3ZQ7 A;  1J75 A;  2PJR B;  1TNS A;  2VQC A;  1WKM A;  3GTK J;  2P81 A;  2VON A;  2QSG X;  3KKC A;  3HSR A;  3R61 A;  1YOV B;  4N0B A;  1E3H A;  3FK7 A;  1X2N A;  1JHH A;  3M3Y J;  2FU4 A;  1S3J A;  4K2E A;  1DU0 A;  2ZOY A;  1SC7 A;  2LRE A;  3V6G A;  2HWV A;  2MD5 A;  2VJJ A;  5D4R A;  1ACI A;  1O7L A;  1N78 A;  3KIO A;  2Z9O A;  3Q3S A;  2FJ1 A;  3KYL A;  2LKP A;  5FLV A;  4XNF A;  2IT0 A;  3ZMD A;  2GFN A;  3V78 A;  5DCM B;  2HDC A;  1NK3 P;  5ILV A;  1I6X A;  3ESW B;  3PO2 J;  2J5P A;  2BY0 A;  3BT9 A;  3ZQG A;  3RKW A;  4F91 B;  1MW7 A;  3DP7 A;  4MIM A;  1YW9 A;  5F0F A;  3HGY A;  4M6V A;  2DMN A;  3BY6 A;  1S7A A;  3D5S C;  5F64 A;  4YFN F;  2QTQ A;  5CJ9 A;  5FO5 A;  1F43 A;  1GXP A;  2A6T A;  2O6G E;  5L3C A;  3TP0 A;  4V2G A;  3C07 A;  5E1Z B;  2IGK A;  4TV7 A;  3SHF A;  1FIA A;  2OU2 A;  3CDI A;  1IF1 A;  4UB8 C;  5J8F A;  1G3W A;  2GWR A;  2DA1 A;  3Q0U A;  4RAF A;  3OMY A;  3KLN A;  4OD5 A;  2M0C A;  4BHB A;  2EFO A;  2E5Z A;  2WB1 N;  3ZOB A;  1PDN C;  3NI7 A;  4E7H A;  2Q0O A;  1KU7 A;  2FA5 A;  2H1L A;  2A6E F;  1W0U A;  3EGQ A;  1UFM A;  4JX6 A;  4GFL A;  3LQR A;  4RM2 A;  1MJA A;  4HSR A;  3IKV A;  4NEL A;  3V8K A;  1BOA A;  2OCC H;  1JUS A;  3OYB A;  2GXG A;  4M72 A;  2JVH A;  1QU3 A;  1E2X A;  2L9R A;  3JSJ A;  2FSW A;  2OBP A;  3S17 J;  3TL4 X;  2V6C A;  2NS8 A;  3FXJ A;  3K7A J;  3M9A A;  1FSE A;  4KT5 C;  2LKX A;  2PG4 A;  2MFZ A;  1X58 A;  2EIN H;  2K4J A;  1TT0 A;  3H0G J;  5CVV A;  5JHF A;  3MZ8 A;  3O8G A;  1BL0 A;  2QSH X;  3I4M J;  3JW4 A;  3VPR A;  1XCV A;  1FMV A;  1KU9 A;  4EAT A;  1AU7 A;  3S1R J;  1O3S A;  2GEN A;  2GUH A;  1S7E A;  2VUM J;  1G3S A;  1ERD A;  3S32 A;  2OZ6 A;  5IT9 Z;  2BY3 A;  2JA7 J;  2L7Z A;  5BPI A;  4BHP A;  3BC8 A;  2DA2 A;  3VVY A;  1BI3 A;  3C18 A;  4I01 A;  4XRS G;  3E6C C;  3NS4 A;  5CVI A;  5D8K B;  4KIT B;  1QA6 A;  3WU1 B;  2Q24 A;  2EZI A;  3L2R A;  2ZCW A;  2CJJ A;  3ZQL A;  3W6J B;  5BQT A;  3VEP A;  2Q8K A;  2JUG A;  1IN7 A;  4PJL A;  4MK6 A;  2GIZ A;  3LWF A;  3O3K A;  3CCU I;  3TED A;  1Z7U A;  4A6D A;  4BE2 A;  1I39 A;  3WTY C;  1RKT A;  1XSV A;  1LKX A;  1FEX A;  2TDX A;  4XKV A;  2HU9 A;  3FBI B;  1FOK A;  1VQK I;  1J9I A;  4NN1 A;  4B4C A;  1MBG A;  5GTI C;  1R4M B;  5J4Y A;  1X1P A;  4ZDO A;  1FX7 A;  4ACI A;  3CMY A;  3WTW C;  3IKT A;  1YW7 A;  1KQ8 A;  3BR0 A;  2NNY A;  3DPU A;  3K1M A;  2YS9 A;  2A05 A;  3JSO A;  4HNT A;  1U5T B;  3CDH A;  5DYM A;  4A2U A;  3M8F A;  2ME0 A;  2M0M A;  4RGR A;  4CIC A;  4PSW A;  1LVK A;  2V6E A;  3B81 A;  2KL4 A;  2V9P A;  1MBJ A;  2IVM A;  3S2D J;  5F08 A;  5CVJ A;  3BR1 A;  1ZG3 A;  3R4K A;  2LRD A;  4P1W A;  2H27 A;  4A5M A;  3IWF A;  2BHZ A;  3CCS I;  2K9Q A;  4LIV A;  3UR3 C;  2LOO A;  3DU6 A;  3I9V 2;  2L9S A;  1P4W A;  2VBW A;  4QWQ A;  2D6Y A;  2DMQ A;  3ISP A;  4Z6Y A;  2LTP A;  4BDZ A;  4DGW B;  2OQG A;  5HS7 A;  2V4J C;  3LHQ A;  1NG7 A;  1ETO A;  2BY2 A;  2VLA A;  3ZQC A;  4IHX A;  2PJR A;  2B7E A;  2JA6 J;  2BBY A;  3C3W A;  3Q9S A;  2KPM A;  4JNN A;  3BR6 A;  3H9J A;  3HRS A;  1HW5 A;  2F4M B;  1JKQ C;  2CW8 A;  1IJW C;  3VW1 A;  2OJE D;  2NNN A;  1ZLJ A;  1P6R A;  4EVI A;  2G9W A;  4EM2 A;  5HLH A;  3OS0 A;  2RDP A;  4A3K J;  4FCY A;  4CCL A;  1WRJ A;  2E35 A;  2ZO4 A;  4RM3 A;  3TGN A;  4BBR J;  2QVO A;  3IRR A;  2MH9 A;  1OR7 C;  3EUA A;  2XGE A;  2ZME B;  1QZZ A;  5FD6 A;  3HOZ J;  1SAU A;  3HHG A;  4CYC A;  4PJM A;  1K6O A;  3BTL A;  5H9T A;  2RAS A;  4C3J J;  5M3F J;  3MVP A;  4KIC A;  2RVC A;  5H2F C;  4KFC A;  4U7D A;  1JHF A;  2H94 A;  1UZC A;  1UMQ A;  5L3B A;  2HS5 A;  4HG2 A;  1LB2 A;  1U6G A;  1D1A A;  4KWA A;  2CWE A;  5FD5 A;  3GTL J;  3RTR A;  1TZL A;  3GFM A;  1Z6R A;  3OR1 C;  4CYD A;  2GIV A;  2HXI A;  3ZCO A;  1AOY A;  5M5Y J;  1A36 A;  1REP C;  3P7N A;  3BZK A;  4EM1 A;  2QYO A;  3DCF A;  2F07 A;  1GXQ A;  3G1M A;  2A07 F;  3U2R A;  3NEU A;  3GTP J;  2IBD A;  1BM9 A;  1PVE A;  3DPL C;  4B8X A;  3DKX A;  3H5A A;  3TKY A;  1ZLK A;  4JK1 X;  5ED4 A;  3HHH A;  4UB6 C;  4EJO A;  3FHZ A;  2DMT A;  2RQP A;  3BTI A;  5TJJ A;  3BTJ A;  2HKU A;  1S7O A;  3QAH A;  2ICW G;  4I76 A;  1GT0 C;  1TW2 A;  3CP8 A;  4IX7 A;  4EJV A;  3NWT A;  2JPC A;  3FZV A;  3CC7 I;  3KEY A;  1VF9 A;  5L3F A;  2L2O A;  3PFI A;  4M73 A;  3OYH A;  4ZYH A;  4HV5 A;  4DNC A;  2WA0 A;  5AQC A;  2KMU A;  2K4B A;  1K78 A;  3VYR B;  4GCV A;  4AVP A;  1SFE A;  4BH9 A;  3M8J A;  1MMA A;  3X2Q H;  2ESH A;  1OCT C;  4GO1 A;  5B5E C;  1YJW I;  2Z3Y A;  2DTR A;  5HS8 A;  2VKH A;  3KLO A;  2E1N A;  4R8H A;  2E1M C;  3E1S A;  1R7J A;  3TOB A;  4NQW B;  2HPI A;  3VB2 A;  1F36 A;  3BP8 A;  3JRG A;  2IGN A;  2M8G X;  3V7S A;  4HDV A;  2HDD A;  2A68 F;  3HTS B;  1XX5 A;  2CFX A;  1WFX A;  3TDZ C;  2R7W A;  3ANP A;  3OWT A;  4IZZ A;  1LQ1 A;  4IOC F;  1U9N A;  4EM0 B;  2DOF A;  5H6R A;  3RYR A;  1B9M A;  3FKJ A;  2WAE A;  5E1X A;  3F8M A;  2HYJ A;  3TDU C;  3HGG A;  1IN4 A;  1H8A C;  3NRV A;  1X4P A;  3O2P E;  2FBH A;  2NRA C;  3GBG A;  2HZT A;  1L0O C;  2CQN A;  2PN6 A;  2GOM A;  1AKH B;  3WTX C;  4KUM A;  5GAH J;  4XN3 A;  3ZN1 A;  5FB2 A;  2GOX B;  4KN7 X;  5J1R A;  1S29 A;  3FM5 A;  2NP5 A;  4GCK A;  4JQF A;  1KYZ A;  1OFC X;  2O0Y A;  4RLF A;  2HI3 A;  4ENK A;  2UXU A;  2QBY B;  2K9N A;  3NAU A;  4BXU A;  1VQ4 I;  2BV6 A;  3VW2 A;  3QPL A;  2JSP A;  2R0Q C;  3MKL A;  2RRE A;  1U5T A;  4AF5 A;  1W1W E;  3ERM A;  2XAH A;  2RQQ A;  4C2U A;  4PFP A;  1X3W B;  2R5Y B;  1ZQ3 P;  3OIP A;  1YE9 A;  2DO7 A;  1GVD A;  1LVA A;  3GXO A;  1T39 A;  2RNJ A;  3CP2 A;  3PSF A;  1RES A;  3DWL E;  2CQX A;  4KA4 A;  1VQP I;  3C2G A;  3RIR A;  1ZTR A;  4L5I A;  4WWC A;  4KDP A;  2Z1D A;  4XR6 A;  3CCJ I;  2L4M A;  2P5V A;  2VBY A;  3HTJ A;  4AIK A;  2HOA A;  3LA7 A;  1XMX A;  1SMY F;  2M8E A;  3ZP5 A;  2JA8 J;  3QU3 A;  4C9Y A;  3BG6 A;  3BQY A;  5IYC J;  3J7Z I;  1A6Q A;  3FIW A;  2Y0M A;  1WJB A;  1O3T A;  1R5G A;  1UHS A;  2L3D A;  4P96 A;  2EFQ A;  2HR3 A;  4GCT A;  1K6Y A;  1W5T A;  1RIO H;  2W7N A;  4G12 A;  2MBF A;  2O61 A;  1IXS B;  5HDK A;  4G6T B;  4HKU A;  4GYI A;  4HEA 2;  2R7T A;  2V1U A;  1OMI A;  4HV6 A;  3T8T A;  4N4O B;  1RR8 C;  3FMR A;  3WU2 C;  2E19 A;  3ECO A;  2GM4 A;  3SXY A;  3N05 A;  4YFX F;  4PJ0 C;  1B72 B;  1U2W A;  2XUB A;  3SZP A;  5HBU A;  3HOT A;  1WJC A;  1XSD A;  1ZG5 A;  1N77 A;  3KPH A;  5ICC A;  2HFH A;  2XAG A;  1ZGJ A;  1YS7 A;  2BY1 A;  4IRG A;  4NNJ A;  3KP2 A;  3VYT B;  3QKX A;  4C2M J;  1S5L C;  2OUM A;  4ITV A;  1JT0 A;  1D0Y A;  3GTJ J;  1PP7 U;  3WGH A;  2W24 A;  2X0L A;  1QGP A;  1IG7 A;  1JTX A;  3QOE A;  3IV5 A;  3CCV I;  3HOV J;  3VP5 A;  1MH3 A;  4H0E A;  4IRH A;  1OQY A;  5E8G A;  1XN7 A;  5F1J A;  4E7J A;  4ICH A;  1MGT A;  2WV1 A;  2DFE A;  4W1U A;  2W48 A;  4PCQ A;  2LBF A;  2DYS H;  3D5L A;  3NWS A;  5C4Y A;  1XGN A;  3IUV A;  4WX9 A;  2E1C A;  2VOP A;  5C4J J;  2DT6 A;  3L2C A;  2AQE A;  2QSF X;  5GAG J;  2P7V B;  4XL9 A;  3HTI A;  1MKM A;  2DFF A;  2UUZ A;  4ZYG A;  1Y39 A;  2VT2 A;  3H9G A;  1OJL A;  1TP4 A;  1VZ0 A;  1YJN I;  4XOR A;  1E0E A;  9ANT A;  1QHH D;  3QU6 A;  2ELH A;  3GZI A;  3QWL A;  5B1A H;  3EET A;  4ETS A;  4G6D A;  1LFB A;  3DQV C;  3LA3 A;  4HX8 A;  4PUS A;  3OSG A;  3C1D A;  1Z9C A;  2ME6 A;  4PGG A;  3HIM A;  2VPR A;  1TC3 C;  2Z2S B;  1DGW Y;  1VQ5 I;  2QM3 A;  3CME I;  2KIM A;  3J80 Z;  4FX0 A;  2RAE A;  2K40 A;  4ESB A;  1P7J A;  2K86 A;  3ZMS A;  4CCO A;  3KZ9 A;  3A02 A;  3HDD A;  5IP6 A;  4PXI A;  1IO2 A;  5L3D A;  2XHK A;  4IRV A;  4ZTJ A;  3E5X A;  1M1E B;  4PSX A;  4A0Z A;  5J47 A;  3P9K A;  4L0Z B;  5E3O A;  3OYK A;  3BG9 A;  4HLY A;  2A3S A;  2F5D A;  2PMH A;  2BW3 A;  3KZI C;  3S3N A;  2CMP A;  3EQL F;  3OYE A;  3MAJ A;  1MIJ A;  3GZ6 A;  2LF8 A;  2DDB A;  1X1D A;  2NYX A;  3KEQ A;  4NQW A;  1LE8 B;  5A2Q K;  2R3S A;  2CU7 A;  2KT0 A;  5L3G A;  2GAU A;  4LG3 A;  4BAC A;  1HDD C;  2PQ8 A;  1GHC A;  3WE3 A;  4NB5 A;  1TQP A;  1ZN2 A;  4OWR B;  4UUV A;  2DOE A;  1ETK A;  1ITY A;  2A6H F;  3C2B A; 
#chains in the Genus database with same CATH homology
 1MSF C;  1X2M A;  1TWA J;  1MNM C;  2GLO A;  3GTO J;  4JX4 A;  5J1U A;  2H8R A;  2GFN A;  1NK3 P;  2R7Z J;  2AHQ A;  1RPW A;  4M3D A;  1PUF A;  3NXC A;  3PO2 J;  2G7G A;  1WH5 A;  2G0E A;  1RKW A;  4AUX A;  2QCO A;  3BT9 A;  3ZQG A;  5IOY A;  1JGG A;  3VVZ A;  3GTG J;  4MIM A;  3S5R A;  5F0F A;  3HGY A;  3TW7 A;  4M3E A;  4M6V A;  3LJL A;  2DMN A;  3OSF A;  1WH7 A;  2QTQ A;  1F43 A;  3MNL A;  3ZQH A;  2R93 J;  3P9T A;  1JTY A;  3BJB A;  1G2H A;  1O4X A;  4X1E A;  2HQ5 A;  4V2G A;  2Y30 A;  3TP0 A;  3W6V A;  3C07 A;  4JYK A;  5IP9 J;  1FIA A;  4UDS A;  2DA1 A;  3Q0U A;  3BR2 A;  1ZR4 A;  2M0C A;  1ZR2 A;  2NX4 A;  2WB1 N;  1IUF A;  2EZK A;  3ZOB A;  1D5Y A;  3O60 A;  3NI7 A;  1ETQ A;  2XB0 X;  2XB5 A;  1YRN B;  1VI0 A;  3ZQI A;  1W0U A;  3EGQ A;  4JX6 A;  4GFL A;  3NAR A;  4NDL A;  2NVX J;  2DA6 A;  5D1R A;  3A03 A;  5F04 A;  2NP3 A;  3HTA A;  3L1P A;  2MGQ A;  2LVS A;  4NEL A;  4S0H B;  2ZOZ A;  5EG0 B;  1JUS A;  4ABZ A;  3WHC A;  1FJL A;  2L9R A;  2O9L A;  3JSJ A;  4DYR A;  3S17 J;  3SDG A;  2WUI A;  3A01 B;  2NS8 A;  3K7A J;  2ID6 A;  2LKX A;  1IRZ A;  1H88 C;  3B6A A;  1X58 A;  2V57 A;  1BL0 A;  3BTC A;  3H0G J;  1CQT A;  3S1N J;  3O8G A;  3I4M J;  3VPR A;  2NVQ J;  4Y52 J;  4A3C J;  2UXP A;  1AU7 A;  3M4O J;  3S1R J;  2GEN A;  2GUH A;  1S7E A;  2VUM J;  1ETY A;  3D1N I;  5FKK A;  1U8B A;  2JA7 J;  3T6N A;  2L7Z A;  3FKI J;  4I6Z A;  2W53 A;  3RKQ A;  2M9H A;  1Y1W J;  5K7H A;  1UI5 A;  3PPB A;  2DA2 A;  3VVY A;  5GPA A;  4XRS G;  1P7I A;  3H3V K;  2CUF A;  2REK A;  1B8I B;  2EZI A;  2Q24 A;  2CJJ A;  2FD5 A;  3ZQL A;  5FKM A;  4D5C A;  1DU6 A;  4A93 J;  2EZH A;  2N8G A;  5EFY A;  4MK6 A;  2YU9 J;  1APL C;  3TED A;  3CRJ A;  1JT6 A;  2EH3 A;  4L5E A;  2ZCN A;  4X6A J;  2X48 A;  3QQA A;  4RDU A;  1RKT A;  1FEX A;  1GV2 A;  4NN1 A;  3FK6 A;  3JRF A;  4B4C A;  1MBG A;  4QSH A;  4D5F A;  2LK2 A;  4ACI A;  3ON4 A;  1JUM A;  3CMY A;  4A3F J;  3G7R A;  3CJD A;  5FMP A;  2ZCM A;  4JP0 A;  3BR0 A;  4M3F A;  5J3L A;  2PBX A;  2YS9 A;  2UXI A;  5C44 J;  5IP7 J;  2XGC A;  1WCM J;  2ME0 A;  3HBL A;  1ZGW A;  3HOY J;  4C3I J;  2CUE A;  3B81 A;  1MBJ A;  3LNQ A;  1I3Q J;  3S2D J;  5F08 A;  3BRU A;  5C3E J;  3BR1 A;  1UG2 A;  2JN6 A;  5GPC A;  1PUF B;  5K7F A;  3AQS A;  3LSP A;  2K9Q A;  3SFI A;  1FTT A;  2VKE A;  3COL A;  1VFC A;  1WGX A;  5FKO A;  2D6Y A;  2DMQ A;  2Y31 A;  2LTP A;  4B3A A;  5E3M A;  2R5Z A;  2E2H J;  5DAJ A;  2L7F P;  4XID A;  4AYB N;  3QBM A;  3LHQ A;  4XRS A;  1ZKG A;  1JKR C;  2LFB A;  2XPU A;  2EZL A;  1ETO A;  1POG A;  1AKH A;  3ZQC A;  5F0H A;  4IHX A;  2IU5 A;  1AHD P;  5FJ8 J;  1JJ8 C;  2JA6 J;  2DG7 A;  3HB9 A;  2LR8 A;  2G7S A;  3G56 A;  3V78 A;  2DN0 A;  4J19 A;  1E3O C;  5EGO A;  2XPW A;  3BR6 A;  4EEF G;  1T56 A;  4JNN A;  3HKZ N;  4FTH A;  1Z77 A;  1HF0 A;  1MH4 A;  2E2J J;  3BCG A;  1JKQ C;  1W0T A;  1IJW C;  1ETV A;  1Q1V A;  2G7L A;  3OIO A;  3PM1 A;  3ANG A;  3VW1 A;  2NVY J;  2M2E A;  2DA5 A;  1TWG J;  1JKO C;  2FX0 A;  1NTC A;  4A3K J;  4FCY A;  2YUS A;  2ZCX A;  2R5Y A;  3DPJ A;  2MW8 A;  3G1O A;  3HM5 A;  2UXO A;  1HDP A;  4BBR J;  2XGD A;  2XGE A;  1QPI A;  3JRE A;  1IGN A;  3HOZ J;  2COB A;  2MSY A;  4CYC A;  3CWR A;  3HE0 A;  4HNV A;  4A3I J;  4LOC A;  4UUT A;  3BTL A;  3NNR A;  5H9T A;  2RAS A;  1T33 A;  4A3E J;  4C3J J;  5M3F J;  2AO9 A;  2LLK A;  2MG4 A;  3MVP A;  3G1L A;  3HOX J;  3RD3 A;  3ON2 A;  1I50 J;  1UMQ A;  1Y1V J;  5FGL A;  5EEA A;  4YZE A;  3RH2 A;  4A3D J;  3QPS A;  4KWA A;  3GTL J;  2Y9Z A;  4AC0 A;  1U9O A;  1SGM A;  2X6O A;  5FKN A;  4Y7N J;  2Y2Z A;  3F0C A;  1XC5 A;  4MLO A;  5IYD J;  2HXI A;  5M5Y J;  1JUP A;  3GTM J;  4A3G J;  4C3H J;  2DMU A;  4A3M J;  3JRH A;  3DCF A;  1BA5 A;  1EF4 A;  2WAQ N;  1XG1 A;  3G1M A;  2ZB9 A;  3BR3 A;  4QTR A;  3GTP J;  2F07 A;  4MXM A;  2IBD A;  3HOW J;  1JJ6 C;  3CQZ J;  1B72 A;  3FIS A;  3BQZ A;  3PO3 J;  3HEF A;  2DMT A;  3BTI A;  3BTJ A;  1ORK A;  1QVU A;  1FTZ A;  2HKU A;  4ME9 A;  4I76 A;  1GT0 C;  3IH3 A;  2TRT A;  2DA4 A;  4M3G A;  5HAW A;  1VF9 A;  4DZP A;  3B6C A;  4A3J J;  3NRG A;  4BBS J;  2H1K A;  3BHQ A;  5AQC A;  4L62 A;  5C4X J;  4IHY A;  5EF6 A;  1UI6 A;  1OCT C;  3NPI A;  1GV5 A;  5HOD A;  5F27 A;  3JRC A;  3UKG A;  2ECC A;  2RHA A;  2PZ9 A;  3EUP A;  1GUU A;  1LFU P;  2XRL A;  4MFD A;  1F36 A;  3JRG A;  2M8G X;  1H89 C;  1WI3 A;  1SAN A;  2HDD A;  3VOX A;  1SFO J;  2HOT A;  4UUS B;  5J1Y A;  3ANP A;  3I4N J;  3RZD J;  5IYB J;  2NS7 A;  1MBE A;  5M5X J;  3S16 J;  4CGR A;  1U9N A;  4XIC A;  5HSZ A;  2UXH A;  4AC6 A;  2QWT A;  3JRD A;  2HYJ A;  2TCT A;  4JKZ A;  3HGG A;  2GBY A;  2R5Z B;  1H8A C;  1TWF J;  4DW6 A;  5D19 A;  2EBI A;  3GBG A;  3PAS A;  3VVX A;  1MBH A;  1AKH B;  2B63 J;  2QIB A;  2NP5 A;  5J1R A;  5DTD A;  4GCK A;  2OER A;  1HLV A;  5EGO B;  4JX5 A;  1OFC X;  3S15 J;  3LSR A;  1RET A;  3IH4 A;  2HI3 A;  5CXG A;  2YVE A;  5EZG A;  2UXU A;  5K58 A;  1QVT A;  3MN2 A;  2O7O A;  2K9N A;  3BR5 A;  3NAU A;  2E2I J;  5CXI A;  3VW2 A;  3QPL A;  2R0Q C;  3MKL A;  4AF5 A;  4FIS A;  4V2F A;  5D18 A;  3S1M J;  3GTQ J;  2K9S A;  4FE7 A;  3KKD A;  2HYT A;  3LWJ A;  5EYR A;  1ZK8 A;  2R5Y B;  3BG3 A;  1ZQ3 P;  2DJN A;  3VUQ A;  2CQQ A;  5M5W J;  3RZO J;  1GVD A;  2LP0 A;  2QF7 A;  2FBQ A;  3WHB A;  1LE8 A;  3CCY A;  5CW8 A;  3E7L A;  4DZJ A;  2HXO A;  4D7M A;  1RES A;  2KDZ A;  4CYC B;  2CQX A;  4A3L J;  3S2H J;  5JLW A;  2Y0S N;  1ZTR A;  1HOM A;  3ZQF A;  3BNI A;  3Q0W A;  2CRG A;  1HCR A;  3HTJ A;  4BXX J;  2HOA A;  2JA8 J;  3GEU A;  3JRB A;  3TP3 A;  2JMW A;  4MFE A;  2ID3 A;  2NVT J;  3BQY A;  4XRM A;  1U78 A;  4MO7 A;  5IYC J;  5K7Z A;  2YVH A;  2QOP A;  3HOU J;  3FIW A;  2Y9Y A;  2XPV A;  2QKO A;  1UHS A;  4IHV A;  2VKV A;  2IEK A;  2OF7 A;  4GCT A;  3JRI A;  4IEJ A;  3LSG A;  4B1R A;  4G12 A;  3K2A A;  3JRA A;  2DA7 A;  2M34 A;  3LSJ A;  4HKU A;  3LOC A;  4DYC A;  3O8H A;  1ETX A;  1TWC J;  5E3N A;  2E1O A;  2DMP A;  4GCL A;  2E19 A;  2GM4 A;  3JR9 A;  1B72 B;  2L7M P;  3IH2 A;  2HOS A;  1XS9 A;  1QRY A;  4IHW A;  2OPT A;  2EQR A;  2IAI A;  1I6H J;  2G3B A;  4QIW N;  5HBU A;  1R9T J;  5JLX A;  1YRN A;  4D7N A;  2L0K A;  1RR7 A;  1NK2 P;  4XK4 A;  1OCP A;  5BNG A;  4FE4 A;  2X9D A;  3QKX A;  4C2M J;  1JT0 A;  3KNW A;  3GTJ J;  3VIB A;  4A69 C;  5FKL A;  4BKX A;  5M3M J;  1JTX A;  1IG7 A;  1IDZ A;  3IV5 A;  5EG0 A;  3HOV J;  4BY7 J;  3VP5 A;  1MH3 A;  3AQT A;  4M3B A;  1WPK A;  1IDY A;  5F1J A;  5FHP A;  5GP9 A;  1BW6 A;  5DS9 A;  2LD5 A;  4ICH A;  2WV1 A;  2WGB A;  4W1U A;  2D5V A;  3A01 A;  2W48 A;  4GFK A;  3FRQ A;  2JWT A;  3DEW A;  2ECB A;  3TW6 A;  3S14 J;  5C4Y A;  1FIP A;  3IUV A;  1IV6 A;  5C4J J;  4A3B J;  3HTI A;  4JL3 A;  4W97 A;  5E3L A;  1Z0X A;  2FQ4 A;  3F1B A;  1OJL A;  3SJM A;  2ELK A;  2XSD C;  4DYQ A;  9ANT A;  1IC8 A;  3OOU A;  2DA3 A;  3S1Q J;  2PMZ N;  3GZI A;  2DG8 A;  3E7Q A;  1MBF A;  3OSG A;  3VOK A;  1LFB A;  2VI6 A;  3CDL A;  1MBK A;  1ETW A;  2OI8 A;  1BW5 A;  2ME6 A;  3BG5 A;  3HIM A;  2VPR A;  5IOZ A;  5EDN A;  1TC3 C;  2XDN A;  1B8I A;  1A6I A;  4BY1 J;  2R92 J;  1K61 A;  3HTH A;  2RAE A;  2K40 A;  1JKP C;  1P7J A;  1MSE C;  3KZ9 A;  1BJZ A;  5F0C A;  3RQI A;  3A02 A;  1K83 J;  3Q0V A;  5IP6 A;  3HDD A;  2JJ7 A;  2JA5 J;  2O7T A;  4PXI A;  2LY9 A;  2NOG A;  1ENH A;  2I10 A;  3GTK J;  2DTZ A;  2P81 A;  2JK3 A;  1TWH J;  3KKC A;  5E3O A;  1A5J A;  3BG9 A;  1VND A;  3FK7 A;  1X2N A;  5IPA A;  5FLM J;  3M3Y J;  1DU0 A;  2ZOY A;  1LE8 B;  3V6G A;  2CU7 A;  2KT0 A;  1HDD C;  4UUS A;  1GDT A;  5EZH A;  2O8K A;  4GFB A;  1ETK A;  3Q3S A;  2FJ1 A;  5FLV A;  1ITY A;  4RBO A;  3C2B A;  3VW0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...