3QPSA

Crystal structures of cmer-bile acid complexes from campylobacter jejuni
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
202
structure length
202
Chain Sequence
TPSQKVLARQEKIKAVALELFLTKGYQETSLSDIIKLSGGSYSNIYDGFKSKEGLFFEILDDICKKHFHLIYSKTQEIKNGTLKEILTSFGLAFIEIFNQPEAVAFGKIIYSQVYDKDRHLANWIENNQQNFSYNILMGFFKQQNNSYMKKNAEKLAVLFCTMLKEPYHHLNVLINAPLKNKKEQKEHVEFVVNVFLNGINS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CmeR
publication title Crystal structures of CmeR-bile acid complexes from Campylobacter jejuni.
pubmed doi rcsb
source organism Campylobacter jejuni
molecule tags Transcription
total genus 78
structure length 202
sequence length 202
ec nomenclature
pdb deposition date 2011-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3qpsA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3qpsA02
2WB1N 4G12A 5C4JJ 2IBDA 3I4NJ 4Y52J 2ID3A 1Q1VA 3EUPA 3OIOA 1UI6A 2ME0A 3A02A 4DW6A 1P7JA 2X9DA 4IHYA 3VIBA 3JRIA 2RASA 4AC6A 1H89C 1GV2A 5F08A 3O8HA 5F0CA 2HI3A 4B4CA 2DMQA 3OOUA 2DA1A 3VUQA 4IHXA 3BR1A 3VW0A 2OF7A 3A01A 4BKXA 2EH3A 3GEUA 3KKDA 2GENA 4M3BA 4HNVA 3LSGA 2P81A 2RAEA 3CDLA 2DMTA 3G1MA 4JKZA 3FK6A 1DU6A 3O60A 5FKKA 2DN0A 2NOGA 3GTKJ 5FJ8J 3V6GA 3I4MJ 2JA8J 4XRSA 2R5ZA 2G7LA 2FX0A 3QBMA 4JX4A 1AKHB 2UXOA 4IHWA 5E3LA 1P7IA 3TP0A 1XS9A 1RKTA 2CQXA 2DTZA 2CU7A 2MSYA 3Q0VA 3GTLJ 2HKUA 2ZB9A 4QIWN 2M34A 3HM5A 3BCGA 3VOXA 3M3YJ 2LTPA 3G56A 1TWFJ 5CXIA 2ECBA 4MK6A 3B6AA 2EBIA 2D6YA 2LR8A 4B1RA 4W1UA 5F04A 5EF6A 3ON4A 4JX5A 2EQRA 2YUSA 4DYQA 3QKXA 5IOZA 1K61A 1U8BA 1SFOJ 2RHAA 2R93J 3VOKA 4X1EA 3O8GA 2GLOA 1IV6A 3HOWJ 4I76A 3JRFA 3BR6A 4A3IJ 3KZ9A 3NRGA 4ME9A 2JN6A 1UMQA 3CRJA 3S2DJ 1A5JA 4JL3A 3VVZA 1JUMA 5IYCJ 3BR2A 1Y1VJ 1W0TA 1UI5A 3TW6A 4XICA 1ETQA 5DAJA 3HGGA 3RH2A 1NK2P 3M4OJ 3FRQA 3VVYA 5K58A 2JA7J 4BBRJ 3GTMJ 4DZPA 1JTXA 2JWTA 3DCFA 1LE8B 2M9HA 3E7LA 1WGXA 1YRNB 5HBUA 2TCTA 5C44J 3QQAA 3BTJA 5GPCA 4C3HJ 3JRHA 2JA5J 2CQQA 2CRGA 2NVQJ 5J1RA 2ZOZA 2R5YB 2LKXA 4FISA 3JRAA 2O7TA 4A3KJ 1GV5A 3D1NI 4GCTA 1WPKA 3CWRA 5GP9A 1BW5A 3BG9A 4UDSA 2DA5A 5FKMA 2L7MP 2YVHA 3RZDJ 4A3BJ 1BJZA 3K2AA 1NTCA 4XIDA 1F36A 5D1RA 2KT0A 3ZOBA 3TW7A 5FGLA 1Y1WJ 1XG1A 3ANGA 2DA2A 3FK7A 1FTTA 4NELA 2VUMJ 3S5RA 1ETYA 3GTPJ 3PM1A 1MNMC 3BQYA 1MH3A 4UUSA 4LOCA 5AQCA 2H1KA 4W97A 1QVTA 5J1UA 1ZR2A 2PBXA 2LK2A 3RQIA 2E2IJ 5F0FA 1IGNA 1PUFA 1QPIA 4MIMA 3S17J 4CYCB 4AUXA 2XPVA 4A3JJ 1TWGJ 2ECCA 1ETWA 2VKEA 4IHVA 4L5EA 1R9TJ 3JSJA 5EGOB 4V2GA 1T56A 1OFCX 2UXHA 1B8IB 3VW1A 2NX4A 1A6IA 4MLOA 4BY7J 4AF5A 3ON2A 2OI8A 4XRMA 5M5WJ 4FTHA 3NARA 3S16J 2CUFA 2HXOA 5M3FJ 2HDDA 5FMPA 1JUPA 1MBGA 2E2JJ 1MSEC 1IRZA 1ENHA 3OSGA 2UXPA 2QCOA 2WAQN 2K9QA 3GTGJ 3E7QA 1ORKA 4A3DJ 2NS7A 4YZEA 3VP5A 2MGQA 1H88C 1JUSA 1XC5A 4MO7A 5IP9J 3HGYA 1OCPA 5CXGA 2R0QC 1JJ6C 3RKQA 3ANPA 3A01B 4GCLA 4D7MA 4NDLA 3S1RJ 3NAUA 2HOTA 2GM4A 3TEDA 1MBHA 1MSFC 4NN1A 1DU0A 2B63J 1WI3A 4BBSJ 2GFNA 2WV1A 1JTYA 4L62A 2IEKA 2LY9A 2Y0SN 3F1BA 2COBA 2G7SA 1MBKA 4AYBN 3BTIA 1GVDA 2HYJA 3CQZJ 2H8RA 2QWTA 4J19A 2R5ZB 2E1OA 5K7HA 1ZR4A 2XPUA 1NK3P 2Y31A 3G1OA 3S15J 5IPAA 2MW8A 1IG7A 2XRLA 3HTAA 4M3FA 2Y9YA 2Y30A 2M2EA 2O7OA 3G1LA 3JRCA 5IYDJ 2OERA 3HIMA 5DTDA 2XB5A 5HSZA 2WUIA 2LVSA 5HAWA 2NP3A 1Z0XA 4M3DA 3AQSA 3S14J 2Y9ZA 2NVYJ 4JX6A 1RETA 1JJ8C 2DJNA 3JRGA 5C4YA 5M3MJ 2V57A 2E19A 2KDZA 3VW2A 1OCTC 1ETKA 4DYCA 2E2HJ 1U78A 1H8AC 5K7FA 3BTLA 2JA6J 4GFKA 3NXCA 4AC0A 1JKPC 1X58A 1ETVA 2IAIA 5JLXA 4RDUA 3IV5A 2HQ5A 5JLWA 1W0UA 2DA7A 2R7ZJ 3IUVA 3HBLA 3GZIA 1B72A 1HCRA 1FJLA 5HODA 2O8KA 4FE4A 4A3EJ 2ZCXA 1QRYA 1MBFA 1VF9A 2PMZN 3ZQGA 3ZQHA 5FLMJ 4D5FA 2I10A 3FIWA 2W48A 4A3GJ 2EZKA 2XGDA 2LD5A 4Y7NJ 2PZ9A 2VI6A 2FQ4A 3FISA 2D5VA 1K83J 1FIAA 1LE8A 5D19A 2N8GA 4A93J 1S7EA 2XPWA 4BY1J 2UXUA 3KNWA 3W6VA 5E3MA 2X6OA 3DEWA 3H0GJ 5F0HA 1IDZA 3MN2A 4GFBA 1MBJA 2WGBA 2X48A 3B81A 2EZHA 3PO2J 4V2FA 4GFLA 4M3GA 3SJMA 3B6CA 1ETOA 3GTJJ 2FD5A 2HXIA 1SANA 3JREA 1POGA 1WH7A 2Y2ZA 3Q0UA 4C3IJ 3HTHA 3LWJA 3ZQIA 1JKRC 2OPTA 3HB9A 3EGQA 1ZTRA 5EG0A 1IDYA 2NVXJ 3RZOJ 1IC8A 2K9NA 2VKVA 5IYBJ 4DYRA 3JR9A 2NVTJ 5C4XJ 3L1PA 2ME6A 3JRDA 1FTZA 1SGMA 2K40A 1ZK8A 3IH4A 3UKGA 5EZGA 4UUSB 3HOYJ 5EDNA 2ZCNA 3PPBA 4S0HB 3BHQA 3A03A 1MBEA 2UXIA 2FBQA 5GPAA 2HOSA 1PUFB 3LSPA 2ID6A 3HE0A 4C3JJ 1ZGWA 2LFBA 1HDPA 5EZHA 1JKQC 3K7AJ 3LJLA 4A3MJ 3NI7A 3BNIA 5FKLA 4JP0A 2JK3A 4EEFG 3NNRA 2GBYA 1WCMJ 3HEFA 3MNLA 3P9TA 4M3EA 2O9LA 1RPWA 2NP5A 4A3LJ 1UHSA 2F07A 1O4XA 3HKZN 3BT9A 5J1YA 1UG2A 3CCYA 2QIBA 3HTIA 5D18A 2M0CA 5F27A 2L7ZA 1RKWA 2DMPA 3DPJA 3IH3A 2DMNA 1RR7A 3GTOJ 3COLA 1QVUA 4GCKA 4PXIA 2XSDC 1U9NA 3ZQCA 1ZQ3P 2L9RA 3HOXJ 2ELKA 3C2BA 3HDDA 5IP7J 4X6AJ 3S1QJ 2EZLA 1VI0A 4A69C 3HOUJ 1AHDP 2YVEA 3SFIA 4RBOA 1X2NA 1AKHA 3WHBA 2EZIA 4MFEA 1BW6A 2L0KA 4MXMA 2REKA 3LSJA 2XB0X 3CMYA 3H3VK 1HF0A 3OSFA 2HYTA 1Z77A 4ACIA 1GT0C 1HDDC 3HOZJ 1AU7A 3AQTA 4ABZA 5IOYA 3FKIJ 1VFCA 2DA4A 4FE7A 9ANTA 5FLVA 1I50J 4A3CJ 1G2HA 2HOAA 5DS9A 2G3BA 3VPRA 1T33A 1D5YA 3LOCA 2GUHA 1BA5A 3GTQJ 5M5XJ 2DG7A 1HOMA 4CGRA 1TC3C 4MFDA 1CQTA 4B3AA 3S2HJ 5C3EJ 4JNNA 3QPSA 3BR3A 2JMWA 1TWHJ 2QKOA 3LHQA 1ETXA 2YS9A 1F43A 1FIPA 3BTCA 1OJLA 3BQZA 1JT0A 1FEXA 4XK4A 5K7ZA 3IH2A 3QPLA 3ZQLA 3S1MJ 2ZCMA 4C2MJ 2NS8A 3MKLA 1X2MA 2R92J 5BNGA 3HOVJ 2DMUA 2XGEA 4JYKA 5F1JA 1APLC 3BR0A 4QTRA 3NPIA 1TWAJ 2CJJA 3BG3A 1LFBA 1B72B 2DA6A 3BJBA 1JKOC 2XGCA 3GBGA 5H9TA 4QSHA 1YRNA 1ZKGA 3JRBA 2QTQA 2G0EA 1LFUP 1HLVA 1E3OC 2YU9J 3V78A 3ZQFA 2DG8A 2QOPA 2CUEA 2R5YA 2XDNA 2AHQA 5M5YJ 3CJDA 1GUUA 2W53A 3KKCA 1MH4A 1VNDA 2Q24A 5EFYA 1EF4A 1I3QJ 5E3OA 2DA3A 4D7NA 2M8GX 1IUFA 1IJWC 4XRSG 5E3NA 5FKOA 2QF7A 3HTJA 1GDTA 3F0CA 3VVXA 2ZOYA 3BR5A 4DZJA 1RESA 4UUTA 2K9SA 3RD3A 3WHCA 3PO3J 3Q0WA 4HKUA 3T6NA 4I6ZA 5FKNA 4A3FJ 3TP3A 4BXXJ 1TWCJ 2VPRA 1BL0A 4ICHA 3LSRA 3BG5A 3G7RA 2FJ1A 3PASA 4FCYA 1U9OA 4IEJA 1JGGA 2MG4A 2G7GA 5EG0B 5EEAA 3LNQA 5CW8A 3MVPA 1ITYA 5EYRA 4CYCA 2LP0A 5FHPA 1JT6A 2JJ7A 2TRTA 4M6VA 4D5CA 3C07A 3SDGA 3Q3SA 4KWAA 1WH5A 2AO9A 5EGOA 5J3LA 1B8IA 5IP6A 1I6HJ 3S1NJ 3BRUA 2IU5A 2LLKA 2L7FP
chains in the Genus database with same CATH superfamily
5DCMA 2CWEA 2R7RA 4EJUA 1PYVA 5ILVA 2K3PA 1UI6A 4BNCA 5HOOA 3JRIA 2COMA 4PSWA 4BQAA 4H0EA 3CF2A 2L7KA 4B4CA 3GUDA 1HW5A 4BU2A 3BR1A 1N77A 1R1TA 2OF7A 2PEXA 5J47A 3A01A 2IJLA 1OPCA 1J9IA 4Z6YA 3GEUA 2P81A 2RAEA 2MLKA 2DMTA 3G1MA 3HKZA 3FK6A 4JKZA 1XX5A 3IKVA 2KMUA 3BG6A 1USTA 5J8CA 3FBNB 1V5EA 3RQ4A 1IO2A 1OCRH 1UJ8A 2IW5A 5CYVA 1IN4A 4KYWA 3FZVA 5GAHJ 3I4MJ 2JA8J 2G7LA 1XB4A 3MKYB 4H4KC 1AKHB 1IF1A 5E3LA 3TP0A 1RKTA 2DTZA 2MSYA 5CVRA 2LYCA 3F9KA 3DWLE 3GFLA 3K4MA 3BCGA 3WTSC 3M3YJ 3K0LA 2X51A 1BBYA 4R8HA 3U2RA 2K4BA 1UHWA 1DDNA 2D6YA 2L9SA 2VKDA 3MEXA 1STZA 5F04A 4B1RA 5EF6A 2EQRA 2YUSA 4DYQA 3NS4A 2F48A 2V6CA 1ODDA 5FB2A 5BMZA 3VOKA 2KRFA 2GXGA 2W24A 4B8XA 3HOWJ 1YO5C 4I76A 5LGUA 1W4MA 3KZ9A 4MQ9F 4P55A 2R7UA 1JI8A 2ELJA 2QKLB 4JL3A 3MQ0A 3VODA 1ZREA 2IA2A 3BR2A 4KDPA 2IXSA 1EV7A 2AQFA 4GYGA 4UXNA 3ZMSA 1Z91A 1ETQA 1W0TA 2GAUA 3HGGA 1FYMA 2V1DA 1QZYA 3VVYA 1ZARA 4BBRJ 2DFFA 3G6EI 3GTMJ 2ZC2A 3KYDB 3RI4A 4HF0A 5D4RA 2JWTA 4ITVA 3DCFA 4RA2A 3J7ZI 2X0LA 1AA7A 2DDBA 4WXDA 1R1UA 5HBUA 3IP4B 5JR3A 1A6QA 2TCTA 3ZQ7A 3ASOH 2BV6A 3MCZA 3CCVI 1IN6A 4QPQA 3C7JA 2ISZA 4LIVA 2JA5J 2P7CB 2CRGA 2EJRA 3T0YA 4J00A 4EM2A 1ERDA 2R5YB 2CUJA 5J8FA 1GXPA 1OQYA 1WPKA 4CCLA 4CCOA 4UDSA 2GXAA 4A3BJ 3S3MA 2QEXI 1FP2A 2KT0A 2HVRA 4ZDOA 1TT5B 2HFHA 3TOAA 1MMAA 1D1CA 4OIPF 1YJ9I 2VQLA 1KA8A 3FK7A 1S7OA 2EV0A 4EGYA 3BJ6A 3TKYA 2VUMJ 3S5RA 3GTPJ 1P4AA 3LA3A 1FOXA 1NG6A 1R6RA 3HHGA 3DPUA 5AQCA 4EM1A 4HV6A 4RMNA 4LK0F 4HX8A 4G7OF 2E2IJ 3MKZA 1PUFA 1MJAA 3ZRGA 4M6XA 3CC7I 2OCEA 3ABUA 2XASA 5HDGA 2ISYA 2ECCA 3QP6A 3OR1C 1FYLA 3OS0A 4JK1X 5ICCA 4BDYA 1VTNC 4AF5A 1JGSA 2OI8A 2IS6A 3WGIA 1HBXG 2DFEA 2VPLA 3DU5A 2Z33A 1VQ4I 4RS8A 2CUFA 3DEUA 4IXAA 4U0VA 1JUPA 3HHHA 4J01A 1MGTA 3ABKH 2OA4A 3OSGA 4ENNA 3PFYA 3E7QA 1S7AA 3BZCA 3LSHA 2NAZA 2OAZA 2VBYA 3KYLA 4NC8A 4PZJA 2YX4A 3HGYA 3KP4A 1VQ9I 1OCPA 2FRHA 2M30A 3ANPA 3K4NA 2V9KA 4F91B 4IO9F 3CDIA 5FGMA 1LB2A 3NAUA 4ZDPA 3AAFA 2GM4A 3U1DA 2HQRA 3S32A 3SWHA 3OS1A 5FROA 1MBHA 4CCMA 2JTVA 4KUMA 3E5QA 1KU7A 1BC8C 3KPHA 4NQWA 2B63J 4N9HA 2VC0A 3I5UA 3F72A 2G9WA 2IEKA 5DM6F 1ZRCA 1TP4A 3FXUA 4PJJA 1SD4A 3BWGA 3A0BC 3BTIA 4AD9A 1ZG5A 1LVKA 2HYJA 4PJMA 1YJNI 5E17F 1K7AA 1X3ZB 3DTKA 4RB2C 2R5ZB 4J19A 1QU3A 4E7IA 4ZJZA 2NNYA 1HW2A 1NK3P 2Y31A 1BI0A 1IG7A 2JT1A 4M3FA 3GO5A 4Y15A 4EQQA 3LSTA 4HNUA 4YFKF 1LNWA 1Z9CA 4ZYEA 1I39A 1G3WA 5HSZA 1Z0XA 3F8CA 3S14J 1X1PA 1Y0NA 2Z5UA 3OMYA 1O3SA 3VW2A 1OCTC 1ETKA 3KZYA 4DYCA 1U78A 4IRGA 4YIIA 2E2HJ 1YX3A 3BTLA 4M73A 3LAJA 3NXCA 4AC0A 4RDUA 1G8XA 1X1AA 3GZIA 2H1LA 2K3FA 4FE4A 4MNUA 3SZGA 2MA3A 2RC4A 2K27A 2FSWA 2DAOA 1MBFA 2KP6A 2PMZN 3D5RC 2ZCWA 4IL6C 4NC6A 2WA0A 4WCGA 4OMYA 3FIWA 2W48A 3W6KB 4A3GJ 3OYFA 2LD5A 1N25A 2VI6A 2FQ4A 4LIUA 3CCSI 2A6EF 3BZ6A 5CVJA 1K83J 2X85A 5LEJA 4BY1J 2XPWA 3LSIA 4UY8I 4C2TA 1Z05A 2PMZA 2Z9OA 3BPXA 4PSXA 4F52A 5E3MA 1X4PA 1MDMA 4PFPA 1R5HA 3DEWA 4U0WA 3V8JA 2WGBA 3CCQI 1D0YA 1QHHD 2EFPA 2EZHA 4GFLA 3CUOA 3DEEA 4HDUA 1ETOA 4UB8C 3FKJA 4L18B 2ESNA 3F3XA 3JREA 4LITA 3CJNA 3LWJA 3ZQIA 4LJZF 3E6BA 4HPQA 4XLHA 4GO1A 1JKRC 2HQAA 2W82A 5FLXK 1ZTRA 3ZQQA 3HTUA 5J4VA 2BGCA 1MNEA 3H92A 1WJFA 1IDYA 1S9HA 2DBBA 1HKTA 1VQ8I 2P5LC 3CCRI 4CICA 4XKWA 2IPQX 1IC8A 3WGGA 4F92B 2FOKA 5LD2C 1MW7A 1VQ7I 5C4XJ 4P96A 4LB6B 1YQAA 2W1OA 4A2UA 5EZGA 4UUSB 4BEHB 3OYNA 4KA4A 1FWZA 3RPUA 3A03A 4PJNA 2K85A 1ZAOA 2FBQA 5GPAA 3LSPA 2ID6A 3GXOA 3BLYA 1F5TA 1ZGWA 1JHFA 2LY1A 3NEUA 2VXZA 3WU0A 2BY2A 2KIUA 5IY5H 3LJLA 3CCJI 2NNNA 1YITI 2EIMH 3NNRA 2JA2A 1D8KA 2JK3A 2BE5F 4M3EA 2O9LA 1RPWA 2VQHA 4LFUA 1FLIA 2F07A 2AXLA 2IGNA 1O4XA 3KZZA 3BT9A 2IS1A 5D18A 2M0CA 1P92A 3SDBA 2DK5A 2DMPA 2WY8Q 3ZR8X 3I59A 3IH3A 3GTOJ 4RM2A 3ZMVA 4GCKA 4PXIA 1KYZA 5KK1A 3ZQCA 2L9RA 2D1HA 1XMAA 3S1QJ 2DFIA 3I58A 2VOPA 4A69C 3D5LA 3SFIA 1ZHFA 3VDXA 4RBOA 3ABLH 3WHBA 4ESJA 5EEGA 2XB0X 1HF0A 3OSFA 4C2UA 1Z77A 3SEQA 2UWMA 1GT0C 2VJJA 1LDKB 1W5TA 2GWRA 5KAFC 1AU7A 3HSFA 2EINH 4FE7A 1T2KA 2QM3A 1U8RA 2DODA 2BY1A 2Y0SA 4A3CJ 4M9XA 1G2HA 4L5JA 4HV5A 5HDKA 1D5YA 2KRHA 4PCQA 3GTQJ 1W1WE 2ETHA 4IRHA 2D1VA 4HRIA 2DG7A 1HOMA 1FOWA 5ILSA 1HW1A 4XLCA 4MFDA 3K1MA 1CQTA 3N05A 5C3EJ 3RTRA 4RGSA 4DOZA 3BR3A 2JMWA 3LHQA 2P6SA 1JT0A 1OJLA 3NQOA 4L9NA 3E3VA 3GLXA 3IH2A 3QPLA 3ZQLA 1UCRA 1LEAA 3T1BA 2XAJA 4BACA 3HOVJ 2LBFA 1APLC 2R7OA 3FXLA 1TWAJ 2QBYA 4YFNF 5GAGJ 3TDUC 3K70D 4F3QA 1LQ1A 2DJIA 4RB3C 2DA6A 5CKTA 3BJBA 2OUMA 3GBGA 4BDZA 5H9TA 3F8MA 3PSIA 1DQUA 3CCUI 1RRJA 3JRBA 5B1BH 4NBQA 3GYHX 1O7LA 1SFKA 3ZQFA 4G7ZF 1IXSB 3ROUA 1EH6A 2D2WA 2HTSA 1X3UA 2V26A 2AHQA 5M5YJ 5TISC 3KKCA 2W53A 3JAMZ 1YYVA 2VLAA 1OYYA 4P1WA 5EFYA 4MTDA 1X1BA 3OS2A 3AL0C 1Y8RB 2O0YA 1TQIA 1MKMA 2IGOA 4DBQA 1REPC 4XRSG 1D0ZA 1KQ0A 2YPRA 3P9CA 1LJ9A 1GDTA 2HR3A 3S3NA 5JHUA 4DZJA 5H6RA 5A2QZ 1OR7A 2BXYA 3RD3A 1H0MA 3WHCA 2F4OB 4HKUA 2QQAA 5ICFA 1AOYA 1RZ4A 3W6JB 3K70C 2MG4A 2Q1ZB 2A68F 4D1QA 3FDYA 1T0FC 1ITYA 4IQ4A 5GTIC 4CYCA 2LF8A 1Z3XA 2HWVA 1B1BA 1FPQA 4M6VA 4KWAA 3Q3SA 3OWTA 4CH7A 5J3LA 1RIOH 2RNJA 3DU6A 2P0WA 2LY2A 2UZKA 2IU5A 3BRUA 2L7FP 2WB1N 3MZ8A 4G12A 5HS7A 3L2VA 4BYYA 1DP7P 2M1BA 1O57A 1N78A 3M8FA 3OIOA 2ME0A 5LRRA 2XKOA 4AIHA 4DW6A 1WJ5A 4IHYA 1HC8A 2QENA 1GV2A 4U9NA 5F64A 4OMZA 2WWYA 2HI3A 5CQGA 3VUQA 2L4AA 1IRXA 3GLLA 4IHXA 5CVIA 4ZC3A 2QQ8A 1R71A 4HQMA 5LGNA 1J2XA 2DLLA 1SFUA 2WB1A 4BJ6C 3A1YA 2XHKA 1IAWA 1X4OA 2BHYA 2KKOA 4HNVA 2PJRA 3EPZA 3LSGA 1X3WB 3PIOF 3DBHB 3KP2A 4RAZA 4HF1A 5JI6A 4BJTA 4UVCA 2GXBA 2RVCA 5FKKA 1VQPI 1YW7A 1WRJA 3KX2A 2NOGA 3BDDA 3FM3A 4R1HA 3EUAA 3GTKJ 1EH8A 3V6GA 2BXZA 1IRGA 2OBPA 3E0JB 3GFIA 3JW4A 4K2EA 4ESFA 4IZZA 2FX0A 4KNYA 4BXUA 3QOEA 2UXOA 4IHWA 1FT9A 4NUBA 1XS9A 3GTLJ 4S05A 4QIWN 1QNTA 3KLOA 3F21A 3VOXA 5DV5A 1VQKI 1BI3A 2ZNZA 1MNDA 2ECBA 2WC2A 5D5XB 2EBIA 4HLXA 2LR8A 2FU4A 3ZCOA 3ON4A 2E7WA 4JX5A 3QOPA 5F6FA 1I1SA 4MQVA 1DP3A 2LMDA 4G8XA 5L3DA 4UVAA 4WX9A 4CYDA 1U0JA 3RDIA 3ULQB 1XDUA 2PMUA 3CUQC 3JRFA 2CS3A 3NRGA 2JN6A 1G4DA 2ZMEA 1BJAA 1JUMA 2QUFA 3GWZA 2HEOA 2H94A 3HUGA 1J59A 1YHQI 3E6CC 1Y1VJ 4GYIA 5B5EC 3T5XA 1R4NB 1NK2P 3M4OJ 3PUFA 2JA7J 5ICGA 4BXFA 2J5OA 4DZPA 4LG0A 4IQJA 1JTXA 1V55H 2EFNA 5E8IA 4IOCF 5FRMA 4U7BA 3E7LA 1YRNB 5JVGF 1MD0A 2CH0A 3BTJA 3OYJA 4EVIA 5GPCA 4V19K 2E71A 3JRHA 3L2CA 2NS0A 1O7FA 2HGCA 2LKXA 4FISA 3JRAA 2O7TA 4A3KJ 1GV5A 4GCTA 2E34A 1T08B 1BW5A 2BZTA 3N97A 2VN2A 3MMYB 3K2AA 2OV7A 3F23A 3PQKA 4UV9A 4XIDA 2H6BA 3RYRA 1W7PD 5EEHA 1WVRA 2ZJRF 3EETA 3WTUC 2IA1A 2DA2A 1FTTA 4NELA 1KZHA 1IZ1A 3A4CA 1E0EA 3DTEA 1MNMC 3BQYA 1ZRFA 1LEBA 4QWQA 2RKHA 1ZR2A 2EA2A 2LK2A 2J5PA 2RQQA 4ENMA 3RQIA 2PBXA 4ZYGA 1FMVA 2A5WA 2M87A 3O2PE 3VYUB 2XUBA 1QPIA 1MMSA 2O03A 3EQLF 2CSOA 4XOPA 2XPVA 4E7ZA 1E3PA 4AIDA 1ETWA 3REOA 4L5EA 2OZ6A 4P9FA 5EGOB 1WSUA 1R9TJ 3JSJA 5FFZA 2Z16A 2UXHA 3E6DA 3DLAA 1B8IB 1PDNC 3VW1A 4BY7J 4A6EA 4FX0A 1J0RA 4XRMA 2KHMA 1YOVB 3RIRA 1J09A 4FTHA 4R79A 1PVEA 3S16J 5K1YA 5FMPA 2IS4A 3VB2A 5FO5A 1MSEC 2GA1A 2UXPA 2B9SA 3DBLB 1BIBA 3R61A 3WE3A 1MJ9A 1ORKA 3OYGA 3V8KA 5CVUA 4YZEA 3VP5A 2MGQA 2Q8KA 2EV5A 1JUSA 1QO0D 2WTEA 1MIJA 4MO7A 5E1ZB 2DPDA 1HKQA 3N4MA 1UB9A 2L9VA 3LA2A 5CXGA 1T38A 2R0QC 1WWXA 2KISA 4M74A 1ZYRF 1KQ9A 3PFIA 4D7MA 1D3YA 1R1VA 2VJ4A 3T8RA 2ZFWA 2DO7A 4I0BA 4NN1A 3L2UA 1DU0A 3ZN0A 3IKTA 1T39A 1V5FA 3AG3H 3ZPLA 3CJTB 2GA2A 4WIBA 3K9TA 2IGKA 2ZKZA 2L02A 2EFQA 1UELB 2COBA 1TL8A 1FYKA 2G7SA 2LC2A 2XSJC 2FMYA 2XIGA 3H9JA 4U87A 3S8PA 1Z67A 2E1OA 1R7JA 1ZR4A 2XPUA 2KPMA 3AL0B 3S15J 5IPAA 2MW8A 3HTAA 2AS5F 4F7ZA 3H9QA 2M2EA 2O7OA 1MZBA 5HVQC 2Z1DA 4PUSA 4RGXA 2XB5A 2LF7A 3GVAA 3E5UA 2R7QA 2DCEA 4FASD 3P7NA 2CW7A 3F6OA 3KEOA 4CCKA 2VXDA 1VQOI 4EMSA 2DW4A 3JRGA 2HDCA 1J5YA 5M3MJ 2V57A 2E19A 2V4JC 3H36A 3M1EA 1OISA 2VB6A 2HVQA 4PGHA 2QKMB 4AVZA 5K7FA 3KP5A 1L0OC 1OLTA 1RI7A 2IAIA 2R7ZJ 3ZMTA 1W0UA 2DA7A 1G3YA 4FQGA 5CLSA 1B72A 1FJLA 4PFOA 4A3EJ 1QRYA 2A5YB 5CVVA 2GOMA 1G3TA 3W2AA 4UNOA 3I3LA 5FLMJ 4D5FA 4GCVA 3RPQA 4Y7NJ 3TO6A 5L3EA 2MYSA 3ZGKA 4FETA 2ZBKA 2E1NA 5D19A 2N8GA 4A93J 1S7EA 2JVHA 1DPRA 2GOXB 5CJ9A 3V7SA 1QGPA 4NNJA 3KNWA 2YSRA 3ZN1A 1T95A 2KL4A 2X6OA 3H0GJ 1IW7F 4GFBA 1MBJA 2X48A 5E20A 1KU2A 3G3ZA 4G6DA 4L9JA 3TGNA 2KIFA 2HXIA 2ZSIB 4AM3A 1POGA 1X1CA 3CMMA 5ICEA 3V42A 3HTHA 1A35A 3DP7A 3W3CA 3H5AA 4WXHA 4PDKA 2OPTA 3HB9A 4ZZDA 3GFMA 5KCMA 4XLFA 2NVXJ 3Q9VA 4I01A 5CPRB 1SMYF 4DYRA 3JR9A 2NVTJ 2KJCA 2VQGA 2ME6A 3VSKA 4D0PA 3L1PA 3JRDA 4HYEA 1FTZA 2O6GE 2R7VA 1ZK8A 4B48A 3OYEA 3IH4A 4X0GA 1NH3A 3ERMA 4BHPA 2QZ8A 3HOYJ 2ZCNA 2L2OA 3LQRA 2R4GA 2P4WA 3BCAA 4Q47A 4BHBA 3H35A 4XKBA 3HE0A 1VQMI 3BC8A 1Z7LA 4BQOA 2KFDA 2LFBA 4QPOA 3K7AJ 3L7WA 1WJDA 3LMMA 3RKYA 1SD7A 3NI7A 4JP0A 3G2BA 2GBYA 1WCMJ 3MNLA 4BAYA 1GHCA 2KDOA 3Q9SA 3BJAA 1Y8QB 3P9TA 3FXJA 1TQMA 3QU3A 2NP5A 1K78B 5K5OA 1UHSA 3CUQB 4I09A 4I98B 3U21A 3VYTB 5J1YA 2DK8A 2V1NA 4CCNA 1RC9A 4OU0A 2F6CA 4D9JA 1RR7A 1WJCA 2A6HF 4L9TA 5HS8A 1FX7A 1U9NA 2LG4A 3GCMA 2H09A 3LAPA 1DPUA 2VJ5A 4U88A 3HDDA 1S3JA 3FXRA 2OZUA 2EZLA 2HKXA 2YVEA 1AKHA 3IRQA 2EZIA 2QVOA 1SEUA 5J6XA 2DDAA 1R22A 3RCOA 1I6XA 5LHGA 2R7DA 3RSNA 1HDDC 3HOZJ 2JUCA 1L3LA 3FKIJ 3GZNB 1VFCA 3KFWX 5D6FA 3M9AA 4EATA 9ANTA 3JSOA 1I50J 1UAAA 2K5CA 4A6DA 2PJPA 2G3BA 2WBMA 2K4JA 3KCCA 3VTIA 3QPHA 1JE8A 5B3SH 3GZ6A 3RYPA 1BM9A 3LL7A 3BCBA 1YJWI 2BYVE 3CP2A 1TC3C 4B3AA 4N0BA 2C6YA 3CJRB 4JNNA 3DKXA 2A6TA 3DTIA 4HOBA 3I55I 3BTCA 4KMUX 3BQZA 3ML6A 1FEXA 1K4SA 3W2WA 4KT5C 2DPUA 2V9PA 3NRVA 4XLAA 1PP8F 3UNGC 2P5VA 4JYKA 5F1JA 3X2QH 4QTRA 3NPIA 3FMQA 3BG3A 1R49A 2L5QA 3MZHA 3K8PC 3CZ6A 2VOOA 2KLOA 4KISA 4AVPA 1MMNA 4DJAA 4XLPF 1JKOC 4JOMA 1FBQA 1A31A 4QSHA 4CA0A 1CF7B 1UHMA 2QTQA 2G0EA 2JSPA 1OCCH 3PUBA 1HLVA 2YU9J 5TRDA 2O5RA 2DG8A 1KONA 3C18A 2CUEA 4RAYA 2OCCH 4HA8A 1V54H 2R5YA 2KZVA 4EJWA 5B1AH 1OCOH 1GUUA 1WFXA 4YFXF 3ABTA 4EV0A 3WTXC 1HSJA 3I9V2 4UB6C 4U0YA 3AG1H 4MGRA 4ZTJA 3OYAA 1EF4A 5KVRA 3HRSA 1W7PB 4E7SA 2W57A 4ON0A 5H2FC 5E3OA 4XKCA 1E17A 3ZMZA 5E3NA 3QU6A 3HTJA 2P5KA 2WADA 3QYFA 1XPXA 4A0XA 3VVXA 2L4MA 2PFVA 5IT3A 2QSGX 4Y17A 1RESA 2CMPA 5LHIA 2B0LA 3WTZA 4CDGA 3Q0WA 3T6NA 2QA4I 3TO7A 1YTYA 4XN0A 3DXJF 2PBIA 1BL0A 5J4YA 4AIKA 3BG5A 4Q4ZF 2FJ1A 4LD5A 4XORA 1JGGA 1GLNA 5TJJA 3G7RA 4CO8A 1LDJA 5EG0B 1UG0A 3WTWC 2NVUB 3HSRA 1O3TA 1JT6A 2JJ7A 3EUHA 4D5CA 3OYMA 3SDGA 3AFHA 4BH9A 3H3UA 1WH5A 2AO9A 1KQ8A 6PAXA 2W25A 1U2WA 4GGGA 2VE8A 3TBIA 2L54A 2YR2A 5HS9A 3I4NJ 3FHZA 3CC2I 2W84A 3EUPA 4XKVA 3A02A 3WU1B 3FBIB 1P7JA 1FY7A 2X9DA 4JBAA 4M6YA 2RASA 2KIQA 2MFZA 4ZYHA 3KLNA 5F08A 4XMYA 1B9MA 3O8HA 3F8BA 1K6YA 2DMQA 4BQNA 3OOUA 5DUKA 3H5NA 2V6EA 2X1DA 1D1AA 3VW0A 2VT2A 3OYDA 2X4HA 2EH3A 4ZYAA 3KKDA 2A3SA 4M3BA 2BHZA 3CDLA 2L01A 4LK1F 1YW9A 3J80Z 3OYIA 1XGMA 4I99C 3O60A 1S5LC 1X19A 2QSHX 4LLNA 2DN0A 1IUYA 2I8DA 4HX7A 2HU9A 4Q5SF 3A2KA 3DKYA 1ZGAA 2R5ZA 3K69A 4JX4A 3Q0VA 1P9QC 2CQXA 2HKUA 2ZY9A 3L00A 1LFPA 2ZB9A 2A05A 4Q48A 1SAUA 2M34A 3HM5A 1M1EB 3TL4X 5AIQA 4E7KA 2JUGA 3ABMH 3R6SA 3EDPA 2LTPA 2CQ7A 1V5GA 1ZG3A 3G56A 5CXIA 3OYBA 3JTGA 2FMLA 4MK6A 2E36A 3B6AA 2A69F 1TZLA 4MHGA 2IRFG 1KYWA 2QLZA 4XSXF 3I71A 5E18F 3QKXA 5EJCA 2DYRH 5IOZA 2FNPA 4A5MA 2G7UA 3KEQA 4ZTFA 3TMOA 4EJTA 2Y69H 2Q2EB 5HLHA 3FXMA 2CV0A 3BR6A 4OAZA 2OJED 3K1PA 3K6GA 1QZZA 1A5JA 5IYCJ 1Y6IA 4MEYF 2XF5A 4MEXF 3R0AA 1QZEA 4XICA 5DAJA 3RH2A 5K58A 2GIZA 4HX4A 3CCLI 3EYYA 5L3BA 2QYOA 3HPGA 4N9IA 1IRFA 1LE8B 2MH9A 3R60A 1WGXA 2ADUA 3GEZA 1ACIA 5C44J 3IUOA 3BPVA 2NOJB 2KQRA 4PGGA 4C3HJ 3C3WA 2PN6A 4M71A 3MWMA 3K2ZA 2DI3A 2VE9A 1F1ZA 2NVQJ 5J1RA 1O3RA 4P5OA 4BL0B 1VQLI 3ONQA 4KIFA 1BOAA 2DT7B 2DA5A 3HRMA 5FKMA 2YVHA 1MJBA 4ENKA 1BJZA 2LKPA 5L3CA 1NTCA 2FOWA 1CGPA 1XSVA 1F36A 3ZOBA 3TW7A 1P2FA 5FGLA 3V4GA 2OC6A 5DCFA 1HA8A 1S29A 2OD5A 2G7HA 3FX3A 1FOKA 3H3ZA 2ZXWH 1ETYA 1SAXA 2DQRA 2L9NA 2XKPA 4KFCA 4UUSA 2R7WA 4BEHA 2H1KA 2UXXA 3K10A 2VC1A 5F0FA 4GRIA 1C0WA 3KP3A 4WF2A 3QODA 3L2QA 4MIMA 3S17J 4AUXA 2EIKH 2MC4A 2VKEA 3NWSA 4IHVA 2UUZA 1EKEA 2VBWA 3KP6A 4V2GA 1HSTA 1BN5A 1OFCX 3BJOA 2NX4A 3LFKA 2HZTA 1TNSA 1EJ9A 1U5TC 1KU3A 2P6TA 2YU3A 5DCMB 5M5WJ 1VQ6I 3NARA 5DM7F 2HXOA 5M3FJ 1B9NA 3U9GA 2HDDA 2JQ7A 2M7AA 3DV8A 2STTA 1MBGA 2XVCA 1ZGJA 3HRUA 1FP1D 2QCOA 4HW0A 2K9QA 2JZYA 3PIPF 3QWLA 5ED4A 1TBXA 1XSDA 1W5SA 4UVBA 1BIAA 1B59A 4KN7X 5E1XA 1XC5A 5IP9J 3WTTC 3GMEA 3RKQA 3A01B 4NDLA 3CMEI 4N4OB 2O3FA 1MSFC 2GFNA 2VQCA 4BBSJ 2WV1A 4LB5A 1KGSA 1JTYA 2DQLA 1VQ5I 1R23A 2FF4A 3W2VA 2IVMA 1TNTA 4ANJA 4L0ZB 4AYBN 5JHFA 2M4GA 2H8RA 1ON1A 1MMDA 3VSLA 3HXLA 4CHUA 4HLYA 2F4IA 2FXAA 3LQQA 4IJAA 3R0JA 5K7HA 3I4PA 4PK4A 2QGUA 4BS9A 2K86A 2R7SA 2Y9YA 3DPTA 2Y30A 5IYDJ 3HIMA 4XLEA 1HKSA 5DTDA 4B09A 3DLLF 3T8TA 4C30A 5LBQA 3WG7H 2WUIA 2LVSA 5HAWA 4YELA 2NP3A 3AQSA 3OOPA 1ZLKA 1KU9A 3SYTA 1RETA 3P9IA 5IT9K 2M8EA 2XAUA 2QBYB 3BP8A 5C4YA 1LKXA 1IV8A 4NB5A 1H8AC 4BE0A 1FC3A 2JA6J 4GFKA 1BI2A 3CTAA 1JKPC 3IWZA 1X58A 1ETVA 3CO6C 3IV5A 2F4MB 3J81K 3CCMI 4XQFA 1HCRA 3JAMK 3SQNA 1IN5A 4KITB 3ZQGA 2ACJA 1Z7UA 3GX4X 3ZQHA 3C2GA 1B4AA 2XGDA 1VZ0A 4AWXB 2FNAA 2VBXA 3M07A 2B7EA 2RNGA 2ELHA 2RQPA 1OKRA 1ONVA 4NHJA 3FXOA 2Z3YA 1SFXA 4CSWA 1LE8A 2DT5A 5A2QK 5K5QA 4OIQF 4RLQA 1RUOA 5D6EA 3W6VA 3G4SI 1YFHA 2JPBA 4IPAA 1Z6TA 4ZDLA 2M7BA 1V3FA 3MN2A 3F6VA 1F9NA 1NG7A 3E6MA 3PO2J 4V2FA 3WGHA 3DFGA 2HQNA 4M3GA 3PNYA 3D0SA 4XN3A 1FMWA 2LNBA 3SJMA 1XSXA 2FD5A 1SANA 2RDPA 3M7GA 2OTJI 1WH7A 2TDXA 5DDGA 2Y2ZA 2ZXHA 4C3IJ 4OAYA 3S2WA 1BR1A 2H8WA 3IAM2 1FBUA 3CJQB 4CUGA 1LPQA 3B73A 5D5VB 1XCBA 5HLGA 2EA4A 2OTLI 1SVMA 2ZXJA 2A07F 2K9NA 4BGDA 5IYBJ 1QA6A 4HAMA 2CW8A 3IHUA 2K40A 2AXTC 2LH9A 2ZSHB 1F4KA 3ZXSA 5EDNA 3PPBA 4XL9A 4XONA 2BBYA 4HZFA 1MBEA 4XOTA 5FD5A 1Y39A 2HOSA 4XBFA 1PUFB 2PG4A 4P9UA 2Y75A 3LA7A 4PJLA 3TQNA 5GAEJ 3J7AY 4XNFA 2CYYA 1R5ID 5L3GA 4A3MJ 3FMRA 5FKLA 3HIFA 5E79C 1RUNA 4A3LJ 2ZNYA 3JTHA 3HKZN 1T8IA 1UG2A 2HPMA 2QIBA 2MC3A 2ZJQF 5F27A 4GDFA 2EV6A 1RKWA 3F8FA 3KP7A 5LLQA 3H1CA 1FOYA 3COLA 2F5DA 3VYRB 1QVUA 5D8KB 4CGZA 3HZJA 2XSDC 1I27A 2HS5A 1FNNA 5JVTA 3DBRB 3VYSB 5BPIA 2E7XA 3E1SA 2F5FA 2E1MB 1VI0A 1AHDP 3CCEI 1WHUA 5B66C 1SVLA 3HJEA 4A0ZA 3BG7A 3K4LA 4RM3A 2L0KA 4MXMA 2F5VA 3LSJA 2WAFA 3H3VK 2HYTA 1OR7C 3CESA 4NQWB 3OYHA 1TW2A 5ERIA 3ERED 4LGWA 3AQTA 3OIPA 5IOYA 2DA4A 4YIRX 3CLQA 3F22A 1RR8C 5FLVA 2HYGD 2HOAA 5DS9A 3ECHA 3VPRA 1T33A 1BA5A 4Y33A 4CZCA 5GADJ 4O6JA 4G6QA 1XMXA 3S2HJ 3ISPA 2VL8A 1R58A 3OL3A 3QPSA 4QLCU 2QKOA 1FIPA 1FSEA 2XAQA 4RAGA 3S1MJ 3TDZC 3CC4I 2ZCMA 1LUJB 3GFJA 4C2MJ 3K4KA 3MKLA 1X2MA 4HNTA 2XAHA 3CDHA 2XGEA 2FJI1 1A36A 2MBFA 2XV4S 2CJJA 4I7HA 4NC7A 3SZPA 5FFXA 2EWNA 1P4WA 4M72A 3IL2A 2XGCA 3AKZA 1YRNA 1G6NA 4A12A 3SHFA 1XDSA 3OIQA 1LFUP 1U5TB 4OOIA 3V78A 3KIOA 3JSPA 2XDVA 1Y56A 4G6TB 2RV8A 3HOSA 2QOPA 3M8JA 3G73A 4EM0B 2VIXA 3MKWB 2KJBA 3CJDA 3SEZA 1B6AA 1MH4A 1VNDA 2PFBA 3ELKA 4DQ2A 4BHCA 2HZDA 3SZTA 3Q5FA 2X1EA 4BQQA 4E70A 3H9GA 1MDMB 1IN7A 2M8GX 1XGSA 3KEYA 1K79A 1MMGA 1N75A 2EFOA 5FKOA 2R3SA 1JXSA 3F0CA 4RGUA 1U3EM 3BR5A 5HNFA 2B3WA 3I53A 1YX5A 4I02A 2BEOA 4UUTA 1QBJA 3PNTA 4OD5A 4DBRA 1G59A 3C1DA 4I6ZA 5FKNA 1O3QA 3L9FA 4A3FJ 5BOXA 4BXXJ 2VPRA 3LSRA 1U9OA 1YS7A 4IEJA 1FZPB 2F2EA 5CW8A 3M1CA 5EYRA 5FHPA 2LP0A 2A61A 2E5NA 2TRTA 3C07A 4CXFA 2P7VB 5EGOA 2WY7Q 2CV2A 4G94A 2GZWA 3O6BB 1B8IA 3F8NA 2DOFA 1I6HJ 1T98A 4ESBA 3MZYA 2VODA 2ZMEC 4ENJA 2LLKA 3QYBA 5FLXZ 3FXQA 5C4JJ 1DGRM 2IBDA 2DTRA 3ZMUA 4Y52J 4KIBA 2ID3A 1Q1VA 5GTHC 1XCVA 5LGTA 3DF8A 1WJEA 3K4BA 3VIBA 3KYCB 2MABA 3S3OA 5HDNA 3L2RA 4AC6A 5ILUA 3HL2A 1H89C 4C2MA 5F0CA 1ZELA 4ETSA 3OYKA 4FHTA 3L09A 2DA1A 2JRTA 4Y3OA 4C9YA 2Z2SB 3TOBA 2STWA 4YEJA 4A5NA 2XAGA 5HLTA 2DXIA 2IP2A 2E5ZA 4BKXA 2MH2A 1E3HA 2GENA 1TLHB 2Q0OA 2FBHA 2CFXA 3AG4H 1DU6A 1Z1DA 3GZ5A 1XTAA 2DYSH 3I59B 4OD4A 1Y0UA 3OYLA 5F1RA 4EGZA 1BR4A 2FA5A 4U9LA 5E1WA 4HBLA 1TT0A 5FJ8J 3UR3C 4HSTA 3RKWA 3MFKA 4XRSA 4FX4A 3LSKA 2X6YA 3I64A 3QBMA 5BQTA 1P7IA 1SC7A 4II3A 3RJPA 2CU7A 1T6SA 2CG4A 4DIQA 1ZN2A 2CV1A 2H6CA 1HQCA 1X1DA 2MLGA 4WWCA 2VONA 4BE2A 1OCZH 1TWFJ 2XROA 3WU2C 2F5EA 4UV8A 2IT0A 4HG2A 2ZFUA 2NYXA 4W1UA 4F55A 4HSRA 3L2WA 3JCUC 5DEQA 1D5VA 2EB7A 1K61A 1U8BA 1SFOJ 2RHAA 2R93J 1T0FA 3VOEA 4X1EA 3O8GA 3IWFA 1WJBA 1IV6A 2GLOA 3LFUA 2PI0A 1P4XA 3ECOA 4A3IJ 4ME9A 1UMQA 3CRJA 3S2DJ 3MAJA 2GIVA 3VVZA 1SD6A 1PUEE 5LEKA 1J75A 2DFHA 4KICA 4BUPA 1UI5A 3TW6A 1UFMA 4TV7A 3FRQA 2LBFB 4DNCA 2K02A 4IF4A 2K9MA 4S04A 4HEA2 5KNLA 4RAFA 3DQVC 2W7NA 1SVOA 2CFOA 2M0MA 1U5TA 2LRDA 2M9HA 4E7HA 1SFEA 4AU7A 2BW3B 3QQAA 2IS2A 2Y0MA 3HC7A 2CQQA 2KZGA 2LDUA 3R4KA 2ZOZA 2HYFA 1YI2I 3D1NI 3CWRA 5GP9A 2QSFX 4BE1A 4JQFA 5LRSA 1IXRC 3BG9A 2L7MP 2GQQA 3LWFA 4IVNA 3HPHA 3RZDJ 3J7AO 1HXDA 2UXNA 1ZG1A 5BPDA 1V4RA 1Z21A 5D1RA 2EIJH 2WV0A 3I56I 4HDVA 2VKHA 5CQEA 2FQ3A 1Y1WJ 4E6KG 3OL4A 4XRFA 5D4SA 1R4MB 3HRTA 1XG1A 2YX7A 4B3XA 2O61A 3ANGA 2E60A 3QP5A 2FUG2 3FXKA 1ZH5A 3PM1A 2K7LA 3E97A 1I1GA 1MH3A 5BS6A 3EYIA 2VJIA 4LOCA 2CO5A 4W97A 1QVTA 5J1UA 5LHHA 1S72I 3V7RA 1IGNA 1S6LA 3OYCA 2H27A 3COAC 4I0AA 1WQ2A 2IA0A 4CYCB 1E2XA 5JFRA 4A3JJ 1TWGJ 2ZO4A 5TGTA 4HQEA 1YS6A 1T56A 3J7YJ 5AIPA 2RN7A 4L0YB 1A6IA 4MLOA 2D45A 4RGRA 3ON2A 1K78A 4OIRF 3CUQA 3OY9A 3FM5A 3HTSB 1BOBA 3MD2A 1R5GA 2HKOA 1IN8A 2E2JJ 1IRZA 1ENHA 4O5VA 1WKMA 2AQEA 2WAQN 3GTGJ 2FBIA 4LLLA 4A3DJ 2NS7A 3IAS2 4E4HA 3WG9A 1H88C 1BI1A 5H20A 4PJ0C 3G71I 1PJRA 1J7KA 1XN7A 1JJ6C 4GCLA 3PSFA 3S1RJ 2HOTA 4E7LA 2PJRB 3TEDA 2X6WA 3H5RA 3CLOA 3WTVC 1WI3A 2EILH 2WAQA 4WXCA 5HNHA 1P6RA 2BY0A 3SFZA 1BR2A 2LY9A 4L62A 2Y0SN 1A04A 2FE3A 1AWCA 3F1BA 3DKWA 4WK8F 2QQ9A 2WAEA 2OU2A 1MBKA 4RB0A 1GVDA 1VQNI 3CQZJ 2LREA 2NXNB 2BOLA 4YRVA 3TO9A 2QWTA 4B43A 1YIOA 4GXOA 2R7XA 3G1OA 2K9LA 1DUXC 1NHAA 1XGOA 5KHDA 2FEZA 2XRLA 4AIJA 5J40A 1U6GA 1FBSA 3G1LA 3QPTA 3JRCA 2OERA 3D5SC 3K4CA 2MD0A 3B02A 2UV1A 4M3DA 2Y9ZA 1LVAA 1RNLA 2NVYJ 4JX6A 1JJ8C 2CUZA 2DJNA 2XC7A 2HTJA 2KDZA 2R7TA 4M9ZA 3FF5A 2E1CA 1GXQA 4KIGA 5JLXA 3IUVA 2JPCA 2HQ5A 5JLWA 2OQGA 3HBLA 2W00A 2F5CA 1IXCA 5HODA 3WTYC 2O8KA 1FSHA 5AONA 2ZCXA 1VF9A 4ZH4F 1UZCA 3BY6A 2E1MC 3HOTA 1YE9A 3RKXA 2ZJ2A 3A0HC 1CF7A 2EK5A 2I10A 2EFWA 2ZMEB 2CGPA 2EZKA 3HUGB 3KZIC 2M5WA 2PZ9A 2X6XA 3FISA 2D5VA 1FIAA 4L9VA 5IT9Z 1G3SA 5K5RA 4XLNF 2UXUA 1XD7A 4LG0B 2BW3A 3PL8A 3CO7C 3ZP5A 2XF7A 3AG2H 3E5XA 4ZYDA 1W7PA 5D5WB 5F0HA 1IDZA 3O3KA 2YVXA 3B81A 3J81Z 1QQIA 1QHGA 4L5IA 1QPMA 3B6CA 3GTJJ 2DOEA 4UHTA 1S8NA 3I54A 3Q0UA 1ULYA 3BROA 4FT8A 4ZZLA 2PLYA 4O3MA 3CP8A 3P5JA 3EGQA 1H9GA 2Z99A 4G9YA 5EG0A 2KIMA 2V79A 1I3AA 1Z3YA 3VEPA 3RZOJ 2XAFA 5DUIA 1DGWY 3GF2A 2DU9A 2VKVA 1LDDA 2P8TA 4Z2YA 1SGMA 1BC7C 3BZKA 3QRFF 2E35A 4BJ5C 3UKGA 3ESWB 2JVGA 3FWEA 3OV8A 4S0HB 3BHQA 5E8GA 2UXIA 4KJZA 5FD6A 5D5UB 1YW8A 3IRRA 4LMYA 4C3JJ 2M4KA 3J80K 3K1NA 3H0DA 5EZHA 1HDPA 2O8XA 2V9VA 1JKQC 3RPUD 4IOAF 1D8JA 1GVJA 4IX7A 3BNIA 1R00A 4XM3A 4EEFG 2XGXA 3PNVA 3HEFA 3QYEA 4A0YA 5DD8A 1D1BA 1JHHA 1R36A 4OIOF 2VBZA 3SXYA 1WZ2A 2CQKA 3HTIA 3CCYA 2XRNA 2RGVA 2L7ZA 4UUVA 3DPJA 2DMNA 1YIJI 3OR2C 3ZMDA 1ZQ3P 3HOXJ 5H6QA 2ELKA 3C2BA 1TQPA 1Q1HA 2CW0F 3I0TA 4EJVA 3KETA 5IP7J 3FHNA 2ESHA 1PP7U 2BVMA 4I2OA 4X6AJ 2B1EA 4XSZF 3HOUJ 2DOAA 1YG2A 1X2NA 2PX9A 4U7DA 4MFEA 1BW6A 2PQ8A 4MTEA 2REKA 3CD6I 4OWRB 3S93A 4B44A 3CMYA 3HG9A 4RB1A 4ACIA 3QAHA 2I5UA 4XR6A 3GW2A 1SD5A 5HLIA 4ABZA 1EA3A 5DD4A 5KAIC 1WJAA 2HDWA 3V8LA 2A2FX 1XGNA 3HYIA 4AYBA 1SMTA 2OQRA 2MD5A 3LOCA 2GUHA 3PJRA 1K4TA 5M5XJ 3EUHC 4YG2F 4N4NB 3CMAI 2FBKA 4CGRA 4DVYP 4YIFA 3HSEA 4EJOA 2HOEA 3DPLC 2Q2EA 3CF5F 1TWHJ 2BY3A 3FMSA 3M8EA 1TTYA 2CQNA 4E7JA 3NWTA 1ETXA 2YS9A 1F43A 2EPFA 4XK4A 3V7CA 5K7ZA 2LSOA 3K4JA 2NS8A 1ON2A 2QWWA 1H9TA 1K6OA 2R92J 5BNGA 3VWBA 1EH7A 2DMUA 3EUKL 3BR0A 1XMKA 3ASNH 4G7HF 2DT6A 1OMIA 1LFBA 3WODF 1B72B 3VFZA 3U1KA 3C2HA 1YLFA 1ZLJA 1ZKGA 2QQBA 4IKFA 5FRNA 2PMHA 1E3OC 2RREA 4M9SA 1W36D 4IRVA 2V7FA 3BOQA 2NRAC 4RLFA 1TW3A 4F93B 2XDNA 1ZRDA 2W4SA 2ICWG 3IC7A 2IGMA 4CCJA 2XF6A 5D8LB 2Q24A 2X1CA 4LG3A 2LKSA 1I3QJ 2VASA 2DA3A 2KRCA 4D7NA 1WI9A 4IRIA 4IHTA 1IUFA 1OYIA 2VT3A 1IJWC 2QF7A 2V1UA 1OYWA 2ZOYA 2M3AA 4Y4RA 1W5CC 4B47A 2K9SA 1USSA 3PO3J 3LSMA 4CZZA 4LLGF 2W85A 4II2A 5LFAA 4KMFA 3KE2A 2LOOA 3TP3A 2L3DA 1TWCJ 2HPIA 4IHSA 4ICHA 2V1XA 4ASNA 3PASA 4FCYA 2R7FA 2HNHA 2Y48A 3P9KA 2G7GA 4OINF 5EEAA 3LNQA 3WE2A 4HF2A 3MVPA 3PQJA 2JRMA 1D0XA 2M45A 2ZXIA 1Z6RA 2HVSA 4KT6A 4Y13A 2ZJPF 4DGWB 2BVLA 5DYMA 5IP6A 3S1NJ 1W36C 2JSCA 1I5ZA 4KN4X 5L3FA
chains in the Genus database with same CATH topology
2WB1N 4G12A 5C4JJ 2IBDA 3I4NJ 4Y52J 2ID3A 1Q1VA 3EUPA 3OIOA 1UI6A 2ME0A 3A02A 4DW6A 1P7JA 2X9DA 4IHYA 3VIBA 3JRIA 2RASA 4AC6A 1H89C 1GV2A 5F08A 3O8HA 5F0CA 2HI3A 4B4CA 2DMQA 3OOUA 2DA1A 3VUQA 4IHXA 3BR1A 3VW0A 2OF7A 3A01A 4BKXA 2EH3A 3GEUA 3KKDA 2GENA 4M3BA 4HNVA 3LSGA 2P81A 2RAEA 3CDLA 2DMTA 3G1MA 4JKZA 3FK6A 1DU6A 3O60A 5FKKA 2DN0A 2NOGA 3GTKJ 5FJ8J 3V6GA 3I4MJ 2JA8J 4XRSA 2R5ZA 2G7LA 2FX0A 3QBMA 4JX4A 1AKHB 2UXOA 4IHWA 5E3LA 1P7IA 3TP0A 1XS9A 1RKTA 2CQXA 2DTZA 2CU7A 2MSYA 3Q0VA 3GTLJ 2HKUA 2ZB9A 4QIWN 2M34A 3HM5A 3BCGA 3VOXA 3M3YJ 2LTPA 3G56A 1TWFJ 5CXIA 2ECBA 4MK6A 3B6AA 2EBIA 2D6YA 2LR8A 4B1RA 4W1UA 5F04A 5EF6A 3ON4A 4JX5A 2EQRA 2YUSA 4DYQA 3QKXA 5IOZA 1K61A 1U8BA 1SFOJ 2RHAA 2R93J 3VOKA 4X1EA 3O8GA 2GLOA 1IV6A 3HOWJ 4I76A 3JRFA 3BR6A 4A3IJ 3KZ9A 3NRGA 4ME9A 2JN6A 1UMQA 3CRJA 3S2DJ 1A5JA 4JL3A 3VVZA 1JUMA 5IYCJ 3BR2A 1Y1VJ 1W0TA 1UI5A 3TW6A 4XICA 1ETQA 5DAJA 3HGGA 3RH2A 1NK2P 3M4OJ 3FRQA 3VVYA 5K58A 2JA7J 4BBRJ 3GTMJ 4DZPA 1JTXA 2JWTA 3DCFA 1LE8B 2M9HA 3E7LA 1WGXA 1YRNB 5HBUA 2TCTA 5C44J 3QQAA 3BTJA 5GPCA 4C3HJ 3JRHA 2JA5J 2CQQA 2CRGA 2NVQJ 5J1RA 2ZOZA 2R5YB 2LKXA 4FISA 3JRAA 2O7TA 4A3KJ 1GV5A 3D1NI 4GCTA 1WPKA 3CWRA 5GP9A 1BW5A 3BG9A 4UDSA 2DA5A 5FKMA 2L7MP 2YVHA 3RZDJ 4A3BJ 1BJZA 3K2AA 1NTCA 4XIDA 1F36A 5D1RA 2KT0A 3ZOBA 3TW7A 5FGLA 1Y1WJ 1XG1A 3ANGA 2DA2A 3FK7A 1FTTA 4NELA 2VUMJ 3S5RA 1ETYA 3GTPJ 3PM1A 1MNMC 3BQYA 1MH3A 4UUSA 4LOCA 5AQCA 2H1KA 4W97A 1QVTA 5J1UA 1ZR2A 2PBXA 2LK2A 3RQIA 2E2IJ 5F0FA 1IGNA 1PUFA 1QPIA 4MIMA 3S17J 4CYCB 4AUXA 2XPVA 4A3JJ 1TWGJ 2ECCA 1ETWA 2VKEA 4IHVA 4L5EA 1R9TJ 3JSJA 5EGOB 4V2GA 1T56A 1OFCX 2UXHA 1B8IB 3VW1A 2NX4A 1A6IA 4MLOA 4BY7J 4AF5A 3ON2A 2OI8A 4XRMA 5M5WJ 4FTHA 3NARA 3S16J 2CUFA 2HXOA 5M3FJ 2HDDA 5FMPA 1JUPA 1MBGA 2E2JJ 1MSEC 1IRZA 1ENHA 3OSGA 2UXPA 2QCOA 2WAQN 2K9QA 3GTGJ 3E7QA 1ORKA 4A3DJ 2NS7A 4YZEA 3VP5A 2MGQA 1H88C 1JUSA 1XC5A 4MO7A 5IP9J 3HGYA 1OCPA 5CXGA 2R0QC 1JJ6C 3RKQA 3ANPA 3A01B 4GCLA 4D7MA 4NDLA 3S1RJ 3NAUA 2HOTA 2GM4A 3TEDA 1MBHA 1MSFC 4NN1A 1DU0A 2B63J 1WI3A 4BBSJ 2GFNA 2WV1A 1JTYA 4L62A 2IEKA 2LY9A 2Y0SN 3F1BA 2COBA 2G7SA 1MBKA 4AYBN 3BTIA 1GVDA 2HYJA 3CQZJ 2H8RA 2QWTA 4J19A 2R5ZB 2E1OA 5K7HA 1ZR4A 2XPUA 1NK3P 2Y31A 3G1OA 3S15J 5IPAA 2MW8A 1IG7A 2XRLA 3HTAA 4M3FA 2Y9YA 2Y30A 2M2EA 2O7OA 3G1LA 3JRCA 5IYDJ 2OERA 3HIMA 5DTDA 2XB5A 5HSZA 2WUIA 2LVSA 5HAWA 2NP3A 1Z0XA 4M3DA 3AQSA 3S14J 2Y9ZA 2NVYJ 4JX6A 1RETA 1JJ8C 2DJNA 3JRGA 5C4YA 5M3MJ 2V57A 2E19A 2KDZA 3VW2A 1OCTC 1ETKA 4DYCA 2E2HJ 1U78A 1H8AC 5K7FA 3BTLA 2JA6J 4GFKA 3NXCA 4AC0A 1JKPC 1X58A 1ETVA 2IAIA 5JLXA 4RDUA 3IV5A 2HQ5A 5JLWA 1W0UA 2DA7A 2R7ZJ 3IUVA 3HBLA 3GZIA 1B72A 1HCRA 1FJLA 5HODA 2O8KA 4FE4A 4A3EJ 2ZCXA 1QRYA 1MBFA 1VF9A 2PMZN 3ZQGA 3ZQHA 5FLMJ 4D5FA 2I10A 3FIWA 2W48A 4A3GJ 2EZKA 2XGDA 2LD5A 4Y7NJ 2PZ9A 2VI6A 2FQ4A 3FISA 2D5VA 1K83J 1FIAA 1LE8A 5D19A 2N8GA 4A93J 1S7EA 2XPWA 4BY1J 2UXUA 3KNWA 3W6VA 5E3MA 2X6OA 3DEWA 3H0GJ 5F0HA 1IDZA 3MN2A 4GFBA 1MBJA 2WGBA 2X48A 3B81A 2EZHA 3PO2J 4V2FA 4GFLA 4M3GA 3SJMA 3B6CA 1ETOA 3GTJJ 2FD5A 2HXIA 1SANA 3JREA 1POGA 1WH7A 2Y2ZA 3Q0UA 4C3IJ 3HTHA 3LWJA 3ZQIA 1JKRC 2OPTA 3HB9A 3EGQA 1ZTRA 5EG0A 1IDYA 2NVXJ 3RZOJ 1IC8A 2K9NA 2VKVA 5IYBJ 4DYRA 3JR9A 2NVTJ 5C4XJ 3L1PA 2ME6A 3JRDA 1FTZA 1SGMA 2K40A 1ZK8A 3IH4A 3UKGA 5EZGA 4UUSB 3HOYJ 5EDNA 2ZCNA 3PPBA 4S0HB 3BHQA 3A03A 1MBEA 2UXIA 2FBQA 5GPAA 2HOSA 1PUFB 3LSPA 2ID6A 3HE0A 4C3JJ 1ZGWA 2LFBA 1HDPA 5EZHA 1JKQC 3K7AJ 3LJLA 4A3MJ 3NI7A 3BNIA 5FKLA 4JP0A 2JK3A 4EEFG 3NNRA 2GBYA 1WCMJ 3HEFA 3MNLA 3P9TA 4M3EA 2O9LA 1RPWA 2NP5A 4A3LJ 1UHSA 2F07A 1O4XA 3HKZN 3BT9A 5J1YA 1UG2A 3CCYA 2QIBA 3HTIA 5D18A 2M0CA 5F27A 2L7ZA 1RKWA 2DMPA 3DPJA 3IH3A 2DMNA 1RR7A 3GTOJ 3COLA 1QVUA 4GCKA 4PXIA 2XSDC 1U9NA 3ZQCA 1ZQ3P 2L9RA 3HOXJ 2ELKA 3C2BA 3HDDA 5IP7J 4X6AJ 3S1QJ 2EZLA 1VI0A 4A69C 3HOUJ 1AHDP 2YVEA 3SFIA 4RBOA 1X2NA 1AKHA 3WHBA 2EZIA 4MFEA 1BW6A 2L0KA 4MXMA 2REKA 3LSJA 2XB0X 3CMYA 3H3VK 1HF0A 3OSFA 2HYTA 1Z77A 4ACIA 1GT0C 1HDDC 3HOZJ 1AU7A 3AQTA 4ABZA 5IOYA 3FKIJ 1VFCA 2DA4A 4FE7A 9ANTA 5FLVA 1I50J 4A3CJ 1G2HA 2HOAA 5DS9A 2G3BA 3VPRA 1T33A 1D5YA 3LOCA 2GUHA 1BA5A 3GTQJ 5M5XJ 2DG7A 1HOMA 4CGRA 1TC3C 4MFDA 1CQTA 4B3AA 3S2HJ 5C3EJ 4JNNA 3QPSA 3BR3A 2JMWA 1TWHJ 2QKOA 3LHQA 1ETXA 2YS9A 1F43A 1FIPA 3BTCA 1OJLA 3BQZA 1JT0A 1FEXA 4XK4A 5K7ZA 3IH2A 3QPLA 3ZQLA 3S1MJ 2ZCMA 4C2MJ 2NS8A 3MKLA 1X2MA 2R92J 5BNGA 3HOVJ 2DMUA 2XGEA 4JYKA 5F1JA 1APLC 3BR0A 4QTRA 3NPIA 1TWAJ 2CJJA 3BG3A 1LFBA 1B72B 2DA6A 3BJBA 1JKOC 2XGCA 3GBGA 5H9TA 4QSHA 1YRNA 1ZKGA 3JRBA 2QTQA 2G0EA 1LFUP 1HLVA 1E3OC 2YU9J 3V78A 3ZQFA 2DG8A 2QOPA 2CUEA 2R5YA 2XDNA 2AHQA 5M5YJ 3CJDA 1GUUA 2W53A 3KKCA 1MH4A 1VNDA 2Q24A 5EFYA 1EF4A 1I3QJ 5E3OA 2DA3A 4D7NA 2M8GX 1IUFA 1IJWC 4XRSG 5E3NA 5FKOA 2QF7A 3HTJA 1GDTA 3F0CA 3VVXA 2ZOYA 3BR5A 4DZJA 1RESA 4UUTA 2K9SA 3RD3A 3WHCA 3PO3J 3Q0WA 4HKUA 3T6NA 4I6ZA 5FKNA 4A3FJ 3TP3A 4BXXJ 1TWCJ 2VPRA 1BL0A 4ICHA 3LSRA 3BG5A 3G7RA 2FJ1A 3PASA 4FCYA 1U9OA 4IEJA 1JGGA 2MG4A 2G7GA 5EG0B 5EEAA 3LNQA 5CW8A 3MVPA 1ITYA 5EYRA 4CYCA 2LP0A 5FHPA 1JT6A 2JJ7A 2TRTA 4M6VA 4D5CA 3C07A 3SDGA 3Q3SA 4KWAA 1WH5A 2AO9A 5EGOA 5J3LA 1B8IA 5IP6A 1I6HJ 3S1NJ 3BRUA 2IU5A 2LLKA 2L7FP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WB1 N;  4G12 A;  5C4J J;  2IBD A;  3I4N J;  4Y52 J;  2ID3 A;  1Q1V A;  3EUP A;  3OIO A;  1UI6 A;  2ME0 A;  3A02 A;  4DW6 A;  1P7J A;  2X9D A;  4IHY A;  3VIB A;  3JRI A;  2RAS A;  4AC6 A;  1H89 C;  1GV2 A;  5F08 A;  3O8H A;  5F0C A;  2HI3 A;  4B4C A;  2DMQ A;  3OOU A;  2DA1 A;  3VUQ A;  4IHX A;  3BR1 A;  3VW0 A;  2OF7 A;  3A01 A;  4BKX A;  2EH3 A;  3GEU A;  3KKD A;  2GEN A;  4M3B A;  4HNV A;  3LSG A;  2P81 A;  2RAE A;  3CDL A;  2DMT A;  3G1M A;  4JKZ A;  3FK6 A;  1DU6 A;  3O60 A;  5FKK A;  2DN0 A;  2NOG A;  3GTK J;  5FJ8 J;  3V6G A;  3I4M J;  2JA8 J;  4XRS A;  2R5Z A;  2G7L A;  2FX0 A;  3QBM A;  4JX4 A;  1AKH B;  2UXO A;  4IHW A;  5E3L A;  1P7I A;  3TP0 A;  1XS9 A;  1RKT A;  2CQX A;  2DTZ A;  2CU7 A;  2MSY A;  3Q0V A;  3GTL J;  2HKU A;  2ZB9 A;  4QIW N;  2M34 A;  3HM5 A;  3BCG A;  3VOX A;  3M3Y J;  2LTP A;  3G56 A;  1TWF J;  5CXI A;  2ECB A;  4MK6 A;  3B6A A;  2EBI A;  2D6Y A;  2LR8 A;  4B1R A;  4W1U A;  5F04 A;  5EF6 A;  3ON4 A;  4JX5 A;  2EQR A;  2YUS A;  4DYQ A;  3QKX A;  5IOZ A;  1K61 A;  1U8B A;  1SFO J;  2RHA A;  2R93 J;  3VOK A;  4X1E A;  3O8G A;  2GLO A;  1IV6 A;  3HOW J;  4I76 A;  3JRF A;  3BR6 A;  4A3I J;  3KZ9 A;  3NRG A;  4ME9 A;  2JN6 A;  1UMQ A;  3CRJ A;  3S2D J;  1A5J A;  4JL3 A;  3VVZ A;  1JUM A;  5IYC J;  3BR2 A;  1Y1V J;  1W0T A;  1UI5 A;  3TW6 A;  4XIC A;  1ETQ A;  5DAJ A;  3HGG A;  3RH2 A;  1NK2 P;  3M4O J;  3FRQ A;  3VVY A;  5K58 A;  2JA7 J;  4BBR J;  3GTM J;  4DZP A;  1JTX A;  2JWT A;  3DCF A;  1LE8 B;  2M9H A;  3E7L A;  1WGX A;  1YRN B;  5HBU A;  2TCT A;  5C44 J;  3QQA A;  3BTJ A;  5GPC A;  4C3H J;  3JRH A;  2JA5 J;  2CQQ A;  2CRG A;  2NVQ J;  5J1R A;  2ZOZ A;  2R5Y B;  2LKX A;  4FIS A;  3JRA A;  2O7T A;  4A3K J;  1GV5 A;  3D1N I;  4GCT A;  1WPK A;  3CWR A;  5GP9 A;  1BW5 A;  3BG9 A;  4UDS A;  2DA5 A;  5FKM A;  2L7M P;  2YVH A;  3RZD J;  4A3B J;  1BJZ A;  3K2A A;  1NTC A;  4XID A;  1F36 A;  5D1R A;  2KT0 A;  3ZOB A;  3TW7 A;  5FGL A;  1Y1W J;  1XG1 A;  3ANG A;  2DA2 A;  3FK7 A;  1FTT A;  4NEL A;  2VUM J;  3S5R A;  1ETY A;  3GTP J;  3PM1 A;  1MNM C;  3BQY A;  1MH3 A;  4UUS A;  4LOC A;  5AQC A;  2H1K A;  4W97 A;  1QVT A;  5J1U A;  1ZR2 A;  2PBX A;  2LK2 A;  3RQI A;  2E2I J;  5F0F A;  1IGN A;  1PUF A;  1QPI A;  4MIM A;  3S17 J;  4CYC B;  4AUX A;  2XPV A;  4A3J J;  1TWG J;  2ECC A;  1ETW A;  2VKE A;  4IHV A;  4L5E A;  1R9T J;  3JSJ A;  5EGO B;  4V2G A;  1T56 A;  1OFC X;  2UXH A;  1B8I B;  3VW1 A;  2NX4 A;  1A6I A;  4MLO A;  4BY7 J;  4AF5 A;  3ON2 A;  2OI8 A;  4XRM A;  5M5W J;  4FTH A;  3NAR A;  3S16 J;  2CUF A;  2HXO A;  5M3F J;  2HDD A;  5FMP A;  1JUP A;  1MBG A;  2E2J J;  1MSE C;  1IRZ A;  1ENH A;  3OSG A;  2UXP A;  2QCO A;  2WAQ N;  2K9Q A;  3GTG J;  3E7Q A;  1ORK A;  4A3D J;  2NS7 A;  4YZE A;  3VP5 A;  2MGQ A;  1H88 C;  1JUS A;  1XC5 A;  4MO7 A;  5IP9 J;  3HGY A;  1OCP A;  5CXG A;  2R0Q C;  1JJ6 C;  3RKQ A;  3ANP A;  3A01 B;  4GCL A;  4D7M A;  4NDL A;  3S1R J;  3NAU A;  2HOT A;  2GM4 A;  3TED A;  1MBH A;  1MSF C;  4NN1 A;  1DU0 A;  2B63 J;  1WI3 A;  4BBS J;  2GFN A;  2WV1 A;  1JTY A;  4L62 A;  2IEK A;  2LY9 A;  2Y0S N;  3F1B A;  2COB A;  2G7S A;  1MBK A;  4AYB N;  3BTI A;  1GVD A;  2HYJ A;  3CQZ J;  2H8R A;  2QWT A;  4J19 A;  2R5Z B;  2E1O A;  5K7H A;  1ZR4 A;  2XPU A;  1NK3 P;  2Y31 A;  3G1O A;  3S15 J;  5IPA A;  2MW8 A;  1IG7 A;  2XRL A;  3HTA A;  4M3F A;  2Y9Y A;  2Y30 A;  2M2E A;  2O7O A;  3G1L A;  3JRC A;  5IYD J;  2OER A;  3HIM A;  5DTD A;  2XB5 A;  5HSZ A;  2WUI A;  2LVS A;  5HAW A;  2NP3 A;  1Z0X A;  4M3D A;  3AQS A;  3S14 J;  2Y9Z A;  2NVY J;  4JX6 A;  1RET A;  1JJ8 C;  2DJN A;  3JRG A;  5C4Y A;  5M3M J;  2V57 A;  2E19 A;  2KDZ A;  3VW2 A;  1OCT C;  1ETK A;  4DYC A;  2E2H J;  1U78 A;  1H8A C;  5K7F A;  3BTL A;  2JA6 J;  4GFK A;  3NXC A;  4AC0 A;  1JKP C;  1X58 A;  1ETV A;  2IAI A;  5JLX A;  4RDU A;  3IV5 A;  2HQ5 A;  5JLW A;  1W0U A;  2DA7 A;  2R7Z J;  3IUV A;  3HBL A;  3GZI A;  1B72 A;  1HCR A;  1FJL A;  5HOD A;  2O8K A;  4FE4 A;  4A3E J;  2ZCX A;  1QRY A;  1MBF A;  1VF9 A;  2PMZ N;  3ZQG A;  3ZQH A;  5FLM J;  4D5F A;  2I10 A;  3FIW A;  2W48 A;  4A3G J;  2EZK A;  2XGD A;  2LD5 A;  4Y7N J;  2PZ9 A;  2VI6 A;  2FQ4 A;  3FIS A;  2D5V A;  1K83 J;  1FIA A;  1LE8 A;  5D19 A;  2N8G A;  4A93 J;  1S7E A;  2XPW A;  4BY1 J;  2UXU A;  3KNW A;  3W6V A;  5E3M A;  2X6O A;  3DEW A;  3H0G J;  5F0H A;  1IDZ A;  3MN2 A;  4GFB A;  1MBJ A;  2WGB A;  2X48 A;  3B81 A;  2EZH A;  3PO2 J;  4V2F A;  4GFL A;  4M3G A;  3SJM A;  3B6C A;  1ETO A;  3GTJ J;  2FD5 A;  2HXI A;  1SAN A;  3JRE A;  1POG A;  1WH7 A;  2Y2Z A;  3Q0U A;  4C3I J;  3HTH A;  3LWJ A;  3ZQI A;  1JKR C;  2OPT A;  3HB9 A;  3EGQ A;  1ZTR A;  5EG0 A;  1IDY A;  2NVX J;  3RZO J;  1IC8 A;  2K9N A;  2VKV A;  5IYB J;  4DYR A;  3JR9 A;  2NVT J;  5C4X J;  3L1P A;  2ME6 A;  3JRD A;  1FTZ A;  1SGM A;  2K40 A;  1ZK8 A;  3IH4 A;  3UKG A;  5EZG A;  4UUS B;  3HOY J;  5EDN A;  2ZCN A;  3PPB A;  4S0H B;  3BHQ A;  3A03 A;  1MBE A;  2UXI A;  2FBQ A;  5GPA A;  2HOS A;  1PUF B;  3LSP A;  2ID6 A;  3HE0 A;  4C3J J;  1ZGW A;  2LFB A;  1HDP A;  5EZH A;  1JKQ C;  3K7A J;  3LJL A;  4A3M J;  3NI7 A;  3BNI A;  5FKL A;  4JP0 A;  2JK3 A;  4EEF G;  3NNR A;  2GBY A;  1WCM J;  3HEF A;  3MNL A;  3P9T A;  4M3E A;  2O9L A;  1RPW A;  2NP5 A;  4A3L J;  1UHS A;  2F07 A;  1O4X A;  3HKZ N;  3BT9 A;  5J1Y A;  1UG2 A;  3CCY A;  2QIB A;  3HTI A;  5D18 A;  2M0C A;  5F27 A;  2L7Z A;  1RKW A;  2DMP A;  3DPJ A;  3IH3 A;  2DMN A;  1RR7 A;  3GTO J;  3COL A;  1QVU A;  4GCK A;  4PXI A;  2XSD C;  1U9N A;  3ZQC A;  1ZQ3 P;  2L9R A;  3HOX J;  2ELK A;  3C2B A;  3HDD A;  5IP7 J;  4X6A J;  3S1Q J;  2EZL A;  1VI0 A;  4A69 C;  3HOU J;  1AHD P;  2YVE A;  3SFI A;  4RBO A;  1X2N A;  1AKH A;  3WHB A;  2EZI A;  4MFE A;  1BW6 A;  2L0K A;  4MXM A;  2REK A;  3LSJ A;  2XB0 X;  3CMY A;  3H3V K;  1HF0 A;  3OSF A;  2HYT A;  1Z77 A;  4ACI A;  1GT0 C;  1HDD C;  3HOZ J;  1AU7 A;  3AQT A;  4ABZ A;  5IOY A;  3FKI J;  1VFC A;  2DA4 A;  4FE7 A;  9ANT A;  5FLV A;  1I50 J;  4A3C J;  1G2H A;  2HOA A;  5DS9 A;  2G3B A;  3VPR A;  1T33 A;  1D5Y A;  3LOC A;  2GUH A;  1BA5 A;  3GTQ J;  5M5X J;  2DG7 A;  1HOM A;  4CGR A;  1TC3 C;  4MFD A;  1CQT A;  4B3A A;  3S2H J;  5C3E J;  4JNN A;  3QPS A;  3BR3 A;  2JMW A;  1TWH J;  2QKO A;  3LHQ A;  1ETX A;  2YS9 A;  1F43 A;  1FIP A;  3BTC A;  1OJL A;  3BQZ A;  1JT0 A;  1FEX A;  4XK4 A;  5K7Z A;  3IH2 A;  3QPL A;  3ZQL A;  3S1M J;  2ZCM A;  4C2M J;  2NS8 A;  3MKL A;  1X2M A;  2R92 J;  5BNG A;  3HOV J;  2DMU A;  2XGE A;  4JYK A;  5F1J A;  1APL C;  3BR0 A;  4QTR A;  3NPI A;  1TWA J;  2CJJ A;  3BG3 A;  1LFB A;  1B72 B;  2DA6 A;  3BJB A;  1JKO C;  2XGC A;  3GBG A;  5H9T A;  4QSH A;  1YRN A;  1ZKG A;  3JRB A;  2QTQ A;  2G0E A;  1LFU P;  1HLV A;  1E3O C;  2YU9 J;  3V78 A;  3ZQF A;  2DG8 A;  2QOP A;  2CUE A;  2R5Y A;  2XDN A;  2AHQ A;  5M5Y J;  3CJD A;  1GUU A;  2W53 A;  3KKC A;  1MH4 A;  1VND A;  2Q24 A;  5EFY A;  1EF4 A;  1I3Q J;  5E3O A;  2DA3 A;  4D7N A;  2M8G X;  1IUF A;  1IJW C;  4XRS G;  5E3N A;  5FKO A;  2QF7 A;  3HTJ A;  1GDT A;  3F0C A;  3VVX A;  2ZOY A;  3BR5 A;  4DZJ A;  1RES A;  4UUT A;  2K9S A;  3RD3 A;  3WHC A;  3PO3 J;  3Q0W A;  4HKU A;  3T6N A;  4I6Z A;  5FKN A;  4A3F J;  3TP3 A;  4BXX J;  1TWC J;  2VPR A;  1BL0 A;  4ICH A;  3LSR A;  3BG5 A;  3G7R A;  2FJ1 A;  3PAS A;  4FCY A;  1U9O A;  4IEJ A;  1JGG A;  2MG4 A;  2G7G A;  5EG0 B;  5EEA A;  3LNQ A;  5CW8 A;  3MVP A;  1ITY A;  5EYR A;  4CYC A;  2LP0 A;  5FHP A;  1JT6 A;  2JJ7 A;  2TRT A;  4M6V A;  4D5C A;  3C07 A;  3SDG A;  3Q3S A;  4KWA A;  1WH5 A;  2AO9 A;  5EGO A;  5J3L A;  1B8I A;  5IP6 A;  1I6H J;  3S1N J;  3BRU A;  2IU5 A;  2LLK A;  2L7F P; 
#chains in the Genus database with same CATH topology
 5DCM A;  2CWE A;  2R7R A;  4EJU A;  1PYV A;  5ILV A;  2K3P A;  1UI6 A;  4BNC A;  5HOO A;  3JRI A;  2COM A;  4PSW A;  4BQA A;  4H0E A;  3CF2 A;  2L7K A;  4B4C A;  3GUD A;  1HW5 A;  4BU2 A;  3BR1 A;  1N77 A;  1R1T A;  2OF7 A;  2PEX A;  5J47 A;  3A01 A;  2IJL A;  1OPC A;  1J9I A;  4Z6Y A;  3GEU A;  2P81 A;  2RAE A;  2MLK A;  2DMT A;  3G1M A;  3HKZ A;  3FK6 A;  4JKZ A;  1XX5 A;  3IKV A;  2KMU A;  3BG6 A;  1UST A;  5J8C A;  3FBN B;  1V5E A;  3RQ4 A;  1IO2 A;  1OCR H;  1UJ8 A;  2IW5 A;  5CYV A;  1IN4 A;  4KYW A;  3FZV A;  5GAH J;  3I4M J;  2JA8 J;  2G7L A;  1XB4 A;  3MKY B;  4H4K C;  1AKH B;  1IF1 A;  5E3L A;  3TP0 A;  1RKT A;  2DTZ A;  2MSY A;  5CVR A;  2LYC A;  3F9K A;  3DWL E;  3GFL A;  3K4M A;  3BCG A;  3WTS C;  3M3Y J;  3K0L A;  2X51 A;  1BBY A;  4R8H A;  3U2R A;  2K4B A;  1UHW A;  1DDN A;  2D6Y A;  2L9S A;  2VKD A;  3MEX A;  1STZ A;  5F04 A;  4B1R A;  5EF6 A;  2EQR A;  2YUS A;  4DYQ A;  3NS4 A;  2F48 A;  2V6C A;  1ODD A;  5FB2 A;  5BMZ A;  3VOK A;  2KRF A;  2GXG A;  2W24 A;  4B8X A;  3HOW J;  1YO5 C;  4I76 A;  5LGU A;  1W4M A;  3KZ9 A;  4MQ9 F;  4P55 A;  2R7U A;  1JI8 A;  2ELJ A;  2QKL B;  4JL3 A;  3MQ0 A;  3VOD A;  1ZRE A;  2IA2 A;  3BR2 A;  4KDP A;  2IXS A;  1EV7 A;  2AQF A;  4GYG A;  4UXN A;  3ZMS A;  1Z91 A;  1ETQ A;  1W0T A;  2GAU A;  3HGG A;  1FYM A;  2V1D A;  1QZY A;  3VVY A;  1ZAR A;  4BBR J;  2DFF A;  3G6E I;  3GTM J;  2ZC2 A;  3KYD B;  3RI4 A;  4HF0 A;  5D4R A;  2JWT A;  4ITV A;  3DCF A;  4RA2 A;  3J7Z I;  2X0L A;  1AA7 A;  2DDB A;  4WXD A;  1R1U A;  5HBU A;  3IP4 B;  5JR3 A;  1A6Q A;  2TCT A;  3ZQ7 A;  3ASO H;  2BV6 A;  3MCZ A;  3CCV I;  1IN6 A;  4QPQ A;  3C7J A;  2ISZ A;  4LIV A;  2JA5 J;  2P7C B;  2CRG A;  2EJR A;  3T0Y A;  4J00 A;  4EM2 A;  1ERD A;  2R5Y B;  2CUJ A;  5J8F A;  1GXP A;  1OQY A;  1WPK A;  4CCL A;  4CCO A;  4UDS A;  2GXA A;  4A3B J;  3S3M A;  2QEX I;  1FP2 A;  2KT0 A;  2HVR A;  4ZDO A;  1TT5 B;  2HFH A;  3TOA A;  1MMA A;  1D1C A;  4OIP F;  1YJ9 I;  2VQL A;  1KA8 A;  3FK7 A;  1S7O A;  2EV0 A;  4EGY A;  3BJ6 A;  3TKY A;  2VUM J;  3S5R A;  3GTP J;  1P4A A;  3LA3 A;  1FOX A;  1NG6 A;  1R6R A;  3HHG A;  3DPU A;  5AQC A;  4EM1 A;  4HV6 A;  4RMN A;  4LK0 F;  4HX8 A;  4G7O F;  2E2I J;  3MKZ A;  1PUF A;  1MJA A;  3ZRG A;  4M6X A;  3CC7 I;  2OCE A;  3ABU A;  2XAS A;  5HDG A;  2ISY A;  2ECC A;  3QP6 A;  3OR1 C;  1FYL A;  3OS0 A;  4JK1 X;  5ICC A;  4BDY A;  1VTN C;  4AF5 A;  1JGS A;  2OI8 A;  2IS6 A;  3WGI A;  1HBX G;  2DFE A;  2VPL A;  3DU5 A;  2Z33 A;  1VQ4 I;  4RS8 A;  2CUF A;  3DEU A;  4IXA A;  4U0V A;  1JUP A;  3HHH A;  4J01 A;  1MGT A;  3ABK H;  2OA4 A;  3OSG A;  4ENN A;  3PFY A;  3E7Q A;  1S7A A;  3BZC A;  3LSH A;  2NAZ A;  2OAZ A;  2VBY A;  3KYL A;  4NC8 A;  4PZJ A;  2YX4 A;  3HGY A;  3KP4 A;  1VQ9 I;  1OCP A;  2FRH A;  2M30 A;  3ANP A;  3K4N A;  2V9K A;  4F91 B;  4IO9 F;  3CDI A;  5FGM A;  1LB2 A;  3NAU A;  4ZDP A;  3AAF A;  2GM4 A;  3U1D A;  2HQR A;  3S32 A;  3SWH A;  3OS1 A;  5FRO A;  1MBH A;  4CCM A;  2JTV A;  4KUM A;  3E5Q A;  1KU7 A;  1BC8 C;  3KPH A;  4NQW A;  2B63 J;  4N9H A;  2VC0 A;  3I5U A;  3F72 A;  2G9W A;  2IEK A;  5DM6 F;  1ZRC A;  1TP4 A;  3FXU A;  4PJJ A;  1SD4 A;  3BWG A;  3A0B C;  3BTI A;  4AD9 A;  1ZG5 A;  1LVK A;  2HYJ A;  4PJM A;  1YJN I;  5E17 F;  1K7A A;  1X3Z B;  3DTK A;  4RB2 C;  2R5Z B;  4J19 A;  1QU3 A;  4E7I A;  4ZJZ A;  2NNY A;  1HW2 A;  1NK3 P;  2Y31 A;  1BI0 A;  1IG7 A;  2JT1 A;  4M3F A;  3GO5 A;  4Y15 A;  4EQQ A;  3LST A;  4HNU A;  4YFK F;  1LNW A;  1Z9C A;  4ZYE A;  1I39 A;  1G3W A;  5HSZ A;  1Z0X A;  3F8C A;  3S14 J;  1X1P A;  1Y0N A;  2Z5U A;  3OMY A;  1O3S A;  3VW2 A;  1OCT C;  1ETK A;  3KZY A;  4DYC A;  1U78 A;  4IRG A;  4YII A;  2E2H J;  1YX3 A;  3BTL A;  4M73 A;  3LAJ A;  3NXC A;  4AC0 A;  4RDU A;  1G8X A;  1X1A A;  3GZI A;  2H1L A;  2K3F A;  4FE4 A;  4MNU A;  3SZG A;  2MA3 A;  2RC4 A;  2K27 A;  2FSW A;  2DAO A;  1MBF A;  2KP6 A;  2PMZ N;  3D5R C;  2ZCW A;  4IL6 C;  4NC6 A;  2WA0 A;  4WCG A;  4OMY A;  3FIW A;  2W48 A;  3W6K B;  4A3G J;  3OYF A;  2LD5 A;  1N25 A;  2VI6 A;  2FQ4 A;  4LIU A;  3CCS I;  2A6E F;  3BZ6 A;  5CVJ A;  1K83 J;  2X85 A;  5LEJ A;  4BY1 J;  2XPW A;  3LSI A;  4UY8 I;  4C2T A;  1Z05 A;  2PMZ A;  2Z9O A;  3BPX A;  4PSX A;  4F52 A;  5E3M A;  1X4P A;  1MDM A;  4PFP A;  1R5H A;  3DEW A;  4U0W A;  3V8J A;  2WGB A;  3CCQ I;  1D0Y A;  1QHH D;  2EFP A;  2EZH A;  4GFL A;  3CUO A;  3DEE A;  4HDU A;  1ETO A;  4UB8 C;  3FKJ A;  4L18 B;  2ESN A;  3F3X A;  3JRE A;  4LIT A;  3CJN A;  3LWJ A;  3ZQI A;  4LJZ F;  3E6B A;  4HPQ A;  4XLH A;  4GO1 A;  1JKR C;  2HQA A;  2W82 A;  5FLX K;  1ZTR A;  3ZQQ A;  3HTU A;  5J4V A;  2BGC A;  1MNE A;  3H92 A;  1WJF A;  1IDY A;  1S9H A;  2DBB A;  1HKT A;  1VQ8 I;  2P5L C;  3CCR I;  4CIC A;  4XKW A;  2IPQ X;  1IC8 A;  3WGG A;  4F92 B;  2FOK A;  5LD2 C;  1MW7 A;  1VQ7 I;  5C4X J;  4P96 A;  4LB6 B;  1YQA A;  2W1O A;  4A2U A;  5EZG A;  4UUS B;  4BEH B;  3OYN A;  4KA4 A;  1FWZ A;  3RPU A;  3A03 A;  4PJN A;  2K85 A;  1ZAO A;  2FBQ A;  5GPA A;  3LSP A;  2ID6 A;  3GXO A;  3BLY A;  1F5T A;  1ZGW A;  1JHF A;  2LY1 A;  3NEU A;  2VXZ A;  3WU0 A;  2BY2 A;  2KIU A;  5IY5 H;  3LJL A;  3CCJ I;  2NNN A;  1YIT I;  2EIM H;  3NNR A;  2JA2 A;  1D8K A;  2JK3 A;  2BE5 F;  4M3E A;  2O9L A;  1RPW A;  2VQH A;  4LFU A;  1FLI A;  2F07 A;  2AXL A;  2IGN A;  1O4X A;  3KZZ A;  3BT9 A;  2IS1 A;  5D18 A;  2M0C A;  1P92 A;  3SDB A;  2DK5 A;  2DMP A;  2WY8 Q;  3ZR8 X;  3I59 A;  3IH3 A;  3GTO J;  4RM2 A;  3ZMV A;  4GCK A;  4PXI A;  1KYZ A;  5KK1 A;  3ZQC A;  2L9R A;  2D1H A;  1XMA A;  3S1Q J;  2DFI A;  3I58 A;  2VOP A;  4A69 C;  3D5L A;  3SFI A;  1ZHF A;  3VDX A;  4RBO A;  3ABL H;  3WHB A;  4ESJ A;  5EEG A;  2XB0 X;  1HF0 A;  3OSF A;  4C2U A;  1Z77 A;  3SEQ A;  2UWM A;  1GT0 C;  2VJJ A;  1LDK B;  1W5T A;  2GWR A;  5KAF C;  1AU7 A;  3HSF A;  2EIN H;  4FE7 A;  1T2K A;  2QM3 A;  1U8R A;  2DOD A;  2BY1 A;  2Y0S A;  4A3C J;  4M9X A;  1G2H A;  4L5J A;  4HV5 A;  5HDK A;  1D5Y A;  2KRH A;  4PCQ A;  3GTQ J;  1W1W E;  2ETH A;  4IRH A;  2D1V A;  4HRI A;  2DG7 A;  1HOM A;  1FOW A;  5ILS A;  1HW1 A;  4XLC A;  4MFD A;  3K1M A;  1CQT A;  3N05 A;  5C3E J;  3RTR A;  4RGS A;  4DOZ A;  3BR3 A;  2JMW A;  3LHQ A;  2P6S A;  1JT0 A;  1OJL A;  3NQO A;  4L9N A;  3E3V A;  3GLX A;  3IH2 A;  3QPL A;  3ZQL A;  1UCR A;  1LEA A;  3T1B A;  2XAJ A;  4BAC A;  3HOV J;  2LBF A;  1APL C;  2R7O A;  3FXL A;  1TWA J;  2QBY A;  4YFN F;  5GAG J;  3TDU C;  3K70 D;  4F3Q A;  1LQ1 A;  2DJI A;  4RB3 C;  2DA6 A;  5CKT A;  3BJB A;  2OUM A;  3GBG A;  4BDZ A;  5H9T A;  3F8M A;  3PSI A;  1DQU A;  3CCU I;  1RRJ A;  3JRB A;  5B1B H;  4NBQ A;  3GYH X;  1O7L A;  1SFK A;  3ZQF A;  4G7Z F;  1IXS B;  3ROU A;  1EH6 A;  2D2W A;  2HTS A;  1X3U A;  2V26 A;  2AHQ A;  5M5Y J;  5TIS C;  3KKC A;  2W53 A;  3JAM Z;  1YYV A;  2VLA A;  1OYY A;  4P1W A;  5EFY A;  4MTD A;  1X1B A;  3OS2 A;  3AL0 C;  1Y8R B;  2O0Y A;  1TQI A;  1MKM A;  2IGO A;  4DBQ A;  1REP C;  4XRS G;  1D0Z A;  1KQ0 A;  2YPR A;  3P9C A;  1LJ9 A;  1GDT A;  2HR3 A;  3S3N A;  5JHU A;  4DZJ A;  5H6R A;  5A2Q Z;  1OR7 A;  2BXY A;  3RD3 A;  1H0M A;  3WHC A;  2F4O B;  4HKU A;  2QQA A;  5ICF A;  1AOY A;  1RZ4 A;  3W6J B;  3K70 C;  2MG4 A;  2Q1Z B;  2A68 F;  4D1Q A;  3FDY A;  1T0F C;  1ITY A;  4IQ4 A;  5GTI C;  4CYC A;  2LF8 A;  1Z3X A;  2HWV A;  1B1B A;  1FPQ A;  4M6V A;  4KWA A;  3Q3S A;  3OWT A;  4CH7 A;  5J3L A;  1RIO H;  2RNJ A;  3DU6 A;  2P0W A;  2LY2 A;  2UZK A;  2IU5 A;  3BRU A;  2L7F P;  2WB1 N;  3MZ8 A;  4G12 A;  5HS7 A;  3L2V A;  4BYY A;  1DP7 P;  2M1B A;  1O57 A;  1N78 A;  3M8F A;  3OIO A;  2ME0 A;  5LRR A;  2XKO A;  4AIH A;  4DW6 A;  1WJ5 A;  4IHY A;  1HC8 A;  2QEN A;  1GV2 A;  4U9N A;  5F64 A;  4OMZ A;  2WWY A;  2HI3 A;  5CQG A;  3VUQ A;  2L4A A;  1IRX A;  3GLL A;  4IHX A;  5CVI A;  4ZC3 A;  2QQ8 A;  1R71 A;  4HQM A;  5LGN A;  1J2X A;  2DLL A;  1SFU A;  2WB1 A;  4BJ6 C;  3A1Y A;  2XHK A;  1IAW A;  1X4O A;  2BHY A;  2KKO A;  4HNV A;  2PJR A;  3EPZ A;  3LSG A;  1X3W B;  3PIO F;  3DBH B;  3KP2 A;  4RAZ A;  4HF1 A;  5JI6 A;  4BJT A;  4UVC A;  2GXB A;  2RVC A;  5FKK A;  1VQP I;  1YW7 A;  1WRJ A;  3KX2 A;  2NOG A;  3BDD A;  3FM3 A;  4R1H A;  3EUA A;  3GTK J;  1EH8 A;  3V6G A;  2BXZ A;  1IRG A;  2OBP A;  3E0J B;  3GFI A;  3JW4 A;  4K2E A;  4ESF A;  4IZZ A;  2FX0 A;  4KNY A;  4BXU A;  3QOE A;  2UXO A;  4IHW A;  1FT9 A;  4NUB A;  1XS9 A;  3GTL J;  4S05 A;  4QIW N;  1QNT A;  3KLO A;  3F21 A;  3VOX A;  5DV5 A;  1VQK I;  1BI3 A;  2ZNZ A;  1MND A;  2ECB A;  2WC2 A;  5D5X B;  2EBI A;  4HLX A;  2LR8 A;  2FU4 A;  3ZCO A;  3ON4 A;  2E7W A;  4JX5 A;  3QOP A;  5F6F A;  1I1S A;  4MQV A;  1DP3 A;  2LMD A;  4G8X A;  5L3D A;  4UVA A;  4WX9 A;  4CYD A;  1U0J A;  3RDI A;  3ULQ B;  1XDU A;  2PMU A;  3CUQ C;  3JRF A;  2CS3 A;  3NRG A;  2JN6 A;  1G4D A;  2ZME A;  1BJA A;  1JUM A;  2QUF A;  3GWZ A;  2HEO A;  2H94 A;  3HUG A;  1J59 A;  1YHQ I;  3E6C C;  1Y1V J;  4GYI A;  5B5E C;  3T5X A;  1R4N B;  1NK2 P;  3M4O J;  3PUF A;  2JA7 J;  5ICG A;  4BXF A;  2J5O A;  4DZP A;  4LG0 A;  4IQJ A;  1JTX A;  1V55 H;  2EFN A;  5E8I A;  4IOC F;  5FRM A;  4U7B A;  3E7L A;  1YRN B;  5JVG F;  1MD0 A;  2CH0 A;  3BTJ A;  3OYJ A;  4EVI A;  5GPC A;  4V19 K;  2E71 A;  3JRH A;  3L2C A;  2NS0 A;  1O7F A;  2HGC A;  2LKX A;  4FIS A;  3JRA A;  2O7T A;  4A3K J;  1GV5 A;  4GCT A;  2E34 A;  1T08 B;  1BW5 A;  2BZT A;  3N97 A;  2VN2 A;  3MMY B;  3K2A A;  2OV7 A;  3F23 A;  3PQK A;  4UV9 A;  4XID A;  2H6B A;  3RYR A;  1W7P D;  5EEH A;  1WVR A;  2ZJR F;  3EET A;  3WTU C;  2IA1 A;  2DA2 A;  1FTT A;  4NEL A;  1KZH A;  1IZ1 A;  3A4C A;  1E0E A;  3DTE A;  1MNM C;  3BQY A;  1ZRF A;  1LEB A;  4QWQ A;  2RKH A;  1ZR2 A;  2EA2 A;  2LK2 A;  2J5P A;  2RQQ A;  4ENM A;  3RQI A;  2PBX A;  4ZYG A;  1FMV A;  2A5W A;  2M87 A;  3O2P E;  3VYU B;  2XUB A;  1QPI A;  1MMS A;  2O03 A;  3EQL F;  2CSO A;  4XOP A;  2XPV A;  4E7Z A;  1E3P A;  4AID A;  1ETW A;  3REO A;  4L5E A;  2OZ6 A;  4P9F A;  5EGO B;  1WSU A;  1R9T J;  3JSJ A;  5FFZ A;  2Z16 A;  2UXH A;  3E6D A;  3DLA A;  1B8I B;  1PDN C;  3VW1 A;  4BY7 J;  4A6E A;  4FX0 A;  1J0R A;  4XRM A;  2KHM A;  1YOV B;  3RIR A;  1J09 A;  4FTH A;  4R79 A;  1PVE A;  3S16 J;  5K1Y A;  5FMP A;  2IS4 A;  3VB2 A;  5FO5 A;  1MSE C;  2GA1 A;  2UXP A;  2B9S A;  3DBL B;  1BIB A;  3R61 A;  3WE3 A;  1MJ9 A;  1ORK A;  3OYG A;  3V8K A;  5CVU A;  4YZE A;  3VP5 A;  2MGQ A;  2Q8K A;  2EV5 A;  1JUS A;  1QO0 D;  2WTE A;  1MIJ A;  4MO7 A;  5E1Z B;  2DPD A;  1HKQ A;  3N4M A;  1UB9 A;  2L9V A;  3LA2 A;  5CXG A;  1T38 A;  2R0Q C;  1WWX A;  2KIS A;  4M74 A;  1ZYR F;  1KQ9 A;  3PFI A;  4D7M A;  1D3Y A;  1R1V A;  2VJ4 A;  3T8R A;  2ZFW A;  2DO7 A;  4I0B A;  4NN1 A;  3L2U A;  1DU0 A;  3ZN0 A;  3IKT A;  1T39 A;  1V5F A;  3AG3 H;  3ZPL A;  3CJT B;  2GA2 A;  4WIB A;  3K9T A;  2IGK A;  2ZKZ A;  2L02 A;  2EFQ A;  1UEL B;  2COB A;  1TL8 A;  1FYK A;  2G7S A;  2LC2 A;  2XSJ C;  2FMY A;  2XIG A;  3H9J A;  4U87 A;  3S8P A;  1Z67 A;  2E1O A;  1R7J A;  1ZR4 A;  2XPU A;  2KPM A;  3AL0 B;  3S15 J;  5IPA A;  2MW8 A;  3HTA A;  2AS5 F;  4F7Z A;  3H9Q A;  2M2E A;  2O7O A;  1MZB A;  5HVQ C;  2Z1D A;  4PUS A;  4RGX A;  2XB5 A;  2LF7 A;  3GVA A;  3E5U A;  2R7Q A;  2DCE A;  4FAS D;  3P7N A;  2CW7 A;  3F6O A;  3KEO A;  4CCK A;  2VXD A;  1VQO I;  4EMS A;  2DW4 A;  3JRG A;  2HDC A;  1J5Y A;  5M3M J;  2V57 A;  2E19 A;  2V4J C;  3H36 A;  3M1E A;  1OIS A;  2VB6 A;  2HVQ A;  4PGH A;  2QKM B;  4AVZ A;  5K7F A;  3KP5 A;  1L0O C;  1OLT A;  1RI7 A;  2IAI A;  2R7Z J;  3ZMT A;  1W0U A;  2DA7 A;  1G3Y A;  4FQG A;  5CLS A;  1B72 A;  1FJL A;  4PFO A;  4A3E J;  1QRY A;  2A5Y B;  5CVV A;  2GOM A;  1G3T A;  3W2A A;  4UNO A;  3I3L A;  5FLM J;  4D5F A;  4GCV A;  3RPQ A;  4Y7N J;  3TO6 A;  5L3E A;  2MYS A;  3ZGK A;  4FET A;  2ZBK A;  2E1N A;  5D19 A;  2N8G A;  4A93 J;  1S7E A;  2JVH A;  1DPR A;  2GOX B;  5CJ9 A;  3V7S A;  1QGP A;  4NNJ A;  3KNW A;  2YSR A;  3ZN1 A;  1T95 A;  2KL4 A;  2X6O A;  3H0G J;  1IW7 F;  4GFB A;  1MBJ A;  2X48 A;  5E20 A;  1KU2 A;  3G3Z A;  4G6D A;  4L9J A;  3TGN A;  2KIF A;  2HXI A;  2ZSI B;  4AM3 A;  1POG A;  1X1C A;  3CMM A;  5ICE A;  3V42 A;  3HTH A;  1A35 A;  3DP7 A;  3W3C A;  3H5A A;  4WXH A;  4PDK A;  2OPT A;  3HB9 A;  4ZZD A;  3GFM A;  5KCM A;  4XLF A;  2NVX J;  3Q9V A;  4I01 A;  5CPR B;  1SMY F;  4DYR A;  3JR9 A;  2NVT J;  2KJC A;  2VQG A;  2ME6 A;  3VSK A;  4D0P A;  3L1P A;  3JRD A;  4HYE A;  1FTZ A;  2O6G E;  2R7V A;  1ZK8 A;  4B48 A;  3OYE A;  3IH4 A;  4X0G A;  1NH3 A;  3ERM A;  4BHP A;  2QZ8 A;  3HOY J;  2ZCN A;  2L2O A;  3LQR A;  2R4G A;  2P4W A;  3BCA A;  4Q47 A;  4BHB A;  3H35 A;  4XKB A;  3HE0 A;  1VQM I;  3BC8 A;  1Z7L A;  4BQO A;  2KFD A;  2LFB A;  4QPO A;  3K7A J;  3L7W A;  1WJD A;  3LMM A;  3RKY A;  1SD7 A;  3NI7 A;  4JP0 A;  3G2B A;  2GBY A;  1WCM J;  3MNL A;  4BAY A;  1GHC A;  2KDO A;  3Q9S A;  3BJA A;  1Y8Q B;  3P9T A;  3FXJ A;  1TQM A;  3QU3 A;  2NP5 A;  1K78 B;  5K5O A;  1UHS A;  3CUQ B;  4I09 A;  4I98 B;  3U21 A;  3VYT B;  5J1Y A;  2DK8 A;  2V1N A;  4CCN A;  1RC9 A;  4OU0 A;  2F6C A;  4D9J A;  1RR7 A;  1WJC A;  2A6H F;  4L9T A;  5HS8 A;  1FX7 A;  1U9N A;  2LG4 A;  3GCM A;  2H09 A;  3LAP A;  1DPU A;  2VJ5 A;  4U88 A;  3HDD A;  1S3J A;  3FXR A;  2OZU A;  2EZL A;  2HKX A;  2YVE A;  1AKH A;  3IRQ A;  2EZI A;  2QVO A;  1SEU A;  5J6X A;  2DDA A;  1R22 A;  3RCO A;  1I6X A;  5LHG A;  2R7D A;  3RSN A;  1HDD C;  3HOZ J;  2JUC A;  1L3L A;  3FKI J;  3GZN B;  1VFC A;  3KFW X;  5D6F A;  3M9A A;  4EAT A;  9ANT A;  3JSO A;  1I50 J;  1UAA A;  2K5C A;  4A6D A;  2PJP A;  2G3B A;  2WBM A;  2K4J A;  3KCC A;  3VTI A;  3QPH A;  1JE8 A;  5B3S H;  3GZ6 A;  3RYP A;  1BM9 A;  3LL7 A;  3BCB A;  1YJW I;  2BYV E;  3CP2 A;  1TC3 C;  4B3A A;  4N0B A;  2C6Y A;  3CJR B;  4JNN A;  3DKX A;  2A6T A;  3DTI A;  4HOB A;  3I55 I;  3BTC A;  4KMU X;  3BQZ A;  3ML6 A;  1FEX A;  1K4S A;  3W2W A;  4KT5 C;  2DPU A;  2V9P A;  3NRV A;  4XLA A;  1PP8 F;  3UNG C;  2P5V A;  4JYK A;  5F1J A;  3X2Q H;  4QTR A;  3NPI A;  3FMQ A;  3BG3 A;  1R49 A;  2L5Q A;  3MZH A;  3K8P C;  3CZ6 A;  2VOO A;  2KLO A;  4KIS A;  4AVP A;  1MMN A;  4DJA A;  4XLP F;  1JKO C;  4JOM A;  1FBQ A;  1A31 A;  4QSH A;  4CA0 A;  1CF7 B;  1UHM A;  2QTQ A;  2G0E A;  2JSP A;  1OCC H;  3PUB A;  1HLV A;  2YU9 J;  5TRD A;  2O5R A;  2DG8 A;  1KON A;  3C18 A;  2CUE A;  4RAY A;  2OCC H;  4HA8 A;  1V54 H;  2R5Y A;  2KZV A;  4EJW A;  5B1A H;  1OCO H;  1GUU A;  1WFX A;  4YFX F;  3ABT A;  4EV0 A;  3WTX C;  1HSJ A;  3I9V 2;  4UB6 C;  4U0Y A;  3AG1 H;  4MGR A;  4ZTJ A;  3OYA A;  1EF4 A;  5KVR A;  3HRS A;  1W7P B;  4E7S A;  2W57 A;  4ON0 A;  5H2F C;  5E3O A;  4XKC A;  1E17 A;  3ZMZ A;  5E3N A;  3QU6 A;  3HTJ A;  2P5K A;  2WAD A;  3QYF A;  1XPX A;  4A0X A;  3VVX A;  2L4M A;  2PFV A;  5IT3 A;  2QSG X;  4Y17 A;  1RES A;  2CMP A;  5LHI A;  2B0L A;  3WTZ A;  4CDG A;  3Q0W A;  3T6N A;  2QA4 I;  3TO7 A;  1YTY A;  4XN0 A;  3DXJ F;  2PBI A;  1BL0 A;  5J4Y A;  4AIK A;  3BG5 A;  4Q4Z F;  2FJ1 A;  4LD5 A;  4XOR A;  1JGG A;  1GLN A;  5TJJ A;  3G7R A;  4CO8 A;  1LDJ A;  5EG0 B;  1UG0 A;  3WTW C;  2NVU B;  3HSR A;  1O3T A;  1JT6 A;  2JJ7 A;  3EUH A;  4D5C A;  3OYM A;  3SDG A;  3AFH A;  4BH9 A;  3H3U A;  1WH5 A;  2AO9 A;  1KQ8 A;  6PAX A;  2W25 A;  1U2W A;  4GGG A;  2VE8 A;  3TBI A;  2L54 A;  2YR2 A;  5HS9 A;  3I4N J;  3FHZ A;  3CC2 I;  2W84 A;  3EUP A;  4XKV A;  3A02 A;  3WU1 B;  3FBI B;  1P7J A;  1FY7 A;  2X9D A;  4JBA A;  4M6Y A;  2RAS A;  2KIQ A;  2MFZ A;  4ZYH A;  3KLN A;  5F08 A;  4XMY A;  1B9M A;  3O8H A;  3F8B A;  1K6Y A;  2DMQ A;  4BQN A;  3OOU A;  5DUK A;  3H5N A;  2V6E A;  2X1D A;  1D1A A;  3VW0 A;  2VT2 A;  3OYD A;  2X4H A;  2EH3 A;  4ZYA A;  3KKD A;  2A3S A;  4M3B A;  2BHZ A;  3CDL A;  2L01 A;  4LK1 F;  1YW9 A;  3J80 Z;  3OYI A;  1XGM A;  4I99 C;  3O60 A;  1S5L C;  1X19 A;  2QSH X;  4LLN A;  2DN0 A;  1IUY A;  2I8D A;  4HX7 A;  2HU9 A;  4Q5S F;  3A2K A;  3DKY A;  1ZGA A;  2R5Z A;  3K69 A;  4JX4 A;  3Q0V A;  1P9Q C;  2CQX A;  2HKU A;  2ZY9 A;  3L00 A;  1LFP A;  2ZB9 A;  2A05 A;  4Q48 A;  1SAU A;  2M34 A;  3HM5 A;  1M1E B;  3TL4 X;  5AIQ A;  4E7K A;  2JUG A;  3ABM H;  3R6S A;  3EDP A;  2LTP A;  2CQ7 A;  1V5G A;  1ZG3 A;  3G56 A;  5CXI A;  3OYB A;  3JTG A;  2FML A;  4MK6 A;  2E36 A;  3B6A A;  2A69 F;  1TZL A;  4MHG A;  2IRF G;  1KYW A;  2QLZ A;  4XSX F;  3I71 A;  5E18 F;  3QKX A;  5EJC A;  2DYR H;  5IOZ A;  2FNP A;  4A5M A;  2G7U A;  3KEQ A;  4ZTF A;  3TMO A;  4EJT A;  2Y69 H;  2Q2E B;  5HLH A;  3FXM A;  2CV0 A;  3BR6 A;  4OAZ A;  2OJE D;  3K1P A;  3K6G A;  1QZZ A;  1A5J A;  5IYC J;  1Y6I A;  4MEY F;  2XF5 A;  4MEX F;  3R0A A;  1QZE A;  4XIC A;  5DAJ A;  3RH2 A;  5K58 A;  2GIZ A;  4HX4 A;  3CCL I;  3EYY A;  5L3B A;  2QYO A;  3HPG A;  4N9I A;  1IRF A;  1LE8 B;  2MH9 A;  3R60 A;  1WGX A;  2ADU A;  3GEZ A;  1ACI A;  5C44 J;  3IUO A;  3BPV A;  2NOJ B;  2KQR A;  4PGG A;  4C3H J;  3C3W A;  2PN6 A;  4M71 A;  3MWM A;  3K2Z A;  2DI3 A;  2VE9 A;  1F1Z A;  2NVQ J;  5J1R A;  1O3R A;  4P5O A;  4BL0 B;  1VQL I;  3ONQ A;  4KIF A;  1BOA A;  2DT7 B;  2DA5 A;  3HRM A;  5FKM A;  2YVH A;  1MJB A;  4ENK A;  1BJZ A;  2LKP A;  5L3C A;  1NTC A;  2FOW A;  1CGP A;  1XSV A;  1F36 A;  3ZOB A;  3TW7 A;  1P2F A;  5FGL A;  3V4G A;  2OC6 A;  5DCF A;  1HA8 A;  1S29 A;  2OD5 A;  2G7H A;  3FX3 A;  1FOK A;  3H3Z A;  2ZXW H;  1ETY A;  1SAX A;  2DQR A;  2L9N A;  2XKP A;  4KFC A;  4UUS A;  2R7W A;  4BEH A;  2H1K A;  2UXX A;  3K10 A;  2VC1 A;  5F0F A;  4GRI A;  1C0W A;  3KP3 A;  4WF2 A;  3QOD A;  3L2Q A;  4MIM A;  3S17 J;  4AUX A;  2EIK H;  2MC4 A;  2VKE A;  3NWS A;  4IHV A;  2UUZ A;  1EKE A;  2VBW A;  3KP6 A;  4V2G A;  1HST A;  1BN5 A;  1OFC X;  3BJO A;  2NX4 A;  3LFK A;  2HZT A;  1TNS A;  1EJ9 A;  1U5T C;  1KU3 A;  2P6T A;  2YU3 A;  5DCM B;  5M5W J;  1VQ6 I;  3NAR A;  5DM7 F;  2HXO A;  5M3F J;  1B9N A;  3U9G A;  2HDD A;  2JQ7 A;  2M7A A;  3DV8 A;  2STT A;  1MBG A;  2XVC A;  1ZGJ A;  3HRU A;  1FP1 D;  2QCO A;  4HW0 A;  2K9Q A;  2JZY A;  3PIP F;  3QWL A;  5ED4 A;  1TBX A;  1XSD A;  1W5S A;  4UVB A;  1BIA A;  1B59 A;  4KN7 X;  5E1X A;  1XC5 A;  5IP9 J;  3WTT C;  3GME A;  3RKQ A;  3A01 B;  4NDL A;  3CME I;  4N4O B;  2O3F A;  1MSF C;  2GFN A;  2VQC A;  4BBS J;  2WV1 A;  4LB5 A;  1KGS A;  1JTY A;  2DQL A;  1VQ5 I;  1R23 A;  2FF4 A;  3W2V A;  2IVM A;  1TNT A;  4ANJ A;  4L0Z B;  4AYB N;  5JHF A;  2M4G A;  2H8R A;  1ON1 A;  1MMD A;  3VSL A;  3HXL A;  4CHU A;  4HLY A;  2F4I A;  2FXA A;  3LQQ A;  4IJA A;  3R0J A;  5K7H A;  3I4P A;  4PK4 A;  2QGU A;  4BS9 A;  2K86 A;  2R7S A;  2Y9Y A;  3DPT A;  2Y30 A;  5IYD J;  3HIM A;  4XLE A;  1HKS A;  5DTD A;  4B09 A;  3DLL F;  3T8T A;  4C30 A;  5LBQ A;  3WG7 H;  2WUI A;  2LVS A;  5HAW A;  4YEL A;  2NP3 A;  3AQS A;  3OOP A;  1ZLK A;  1KU9 A;  3SYT A;  1RET A;  3P9I A;  5IT9 K;  2M8E A;  2XAU A;  2QBY B;  3BP8 A;  5C4Y A;  1LKX A;  1IV8 A;  4NB5 A;  1H8A C;  4BE0 A;  1FC3 A;  2JA6 J;  4GFK A;  1BI2 A;  3CTA A;  1JKP C;  3IWZ A;  1X58 A;  1ETV A;  3CO6 C;  3IV5 A;  2F4M B;  3J81 K;  3CCM I;  4XQF A;  1HCR A;  3JAM K;  3SQN A;  1IN5 A;  4KIT B;  3ZQG A;  2ACJ A;  1Z7U A;  3GX4 X;  3ZQH A;  3C2G A;  1B4A A;  2XGD A;  1VZ0 A;  4AWX B;  2FNA A;  2VBX A;  3M07 A;  2B7E A;  2RNG A;  2ELH A;  2RQP A;  1OKR A;  1ONV A;  4NHJ A;  3FXO A;  2Z3Y A;  1SFX A;  4CSW A;  1LE8 A;  2DT5 A;  5A2Q K;  5K5Q A;  4OIQ F;  4RLQ A;  1RUO A;  5D6E A;  3W6V A;  3G4S I;  1YFH A;  2JPB A;  4IPA A;  1Z6T A;  4ZDL A;  2M7B A;  1V3F A;  3MN2 A;  3F6V A;  1F9N A;  1NG7 A;  3E6M A;  3PO2 J;  4V2F A;  3WGH A;  3DFG A;  2HQN A;  4M3G A;  3PNY A;  3D0S A;  4XN3 A;  1FMW A;  2LNB A;  3SJM A;  1XSX A;  2FD5 A;  1SAN A;  2RDP A;  3M7G A;  2OTJ I;  1WH7 A;  2TDX A;  5DDG A;  2Y2Z A;  2ZXH A;  4C3I J;  4OAY A;  3S2W A;  1BR1 A;  2H8W A;  3IAM 2;  1FBU A;  3CJQ B;  4CUG A;  1LPQ A;  3B73 A;  5D5V B;  1XCB A;  5HLG A;  2EA4 A;  2OTL I;  1SVM A;  2ZXJ A;  2A07 F;  2K9N A;  4BGD A;  5IYB J;  1QA6 A;  4HAM A;  2CW8 A;  3IHU A;  2K40 A;  2AXT C;  2LH9 A;  2ZSH B;  1F4K A;  3ZXS A;  5EDN A;  3PPB A;  4XL9 A;  4XON A;  2BBY A;  4HZF A;  1MBE A;  4XOT A;  5FD5 A;  1Y39 A;  2HOS A;  4XBF A;  1PUF B;  2PG4 A;  4P9U A;  2Y75 A;  3LA7 A;  4PJL A;  3TQN A;  5GAE J;  3J7A Y;  4XNF A;  2CYY A;  1R5I D;  5L3G A;  4A3M J;  3FMR A;  5FKL A;  3HIF A;  5E79 C;  1RUN A;  4A3L J;  2ZNY A;  3JTH A;  3HKZ N;  1T8I A;  1UG2 A;  2HPM A;  2QIB A;  2MC3 A;  2ZJQ F;  5F27 A;  4GDF A;  2EV6 A;  1RKW A;  3F8F A;  3KP7 A;  5LLQ A;  3H1C A;  1FOY A;  3COL A;  2F5D A;  3VYR B;  1QVU A;  5D8K B;  4CGZ A;  3HZJ A;  2XSD C;  1I27 A;  2HS5 A;  1FNN A;  5JVT A;  3DBR B;  3VYS B;  5BPI A;  2E7X A;  3E1S A;  2F5F A;  2E1M B;  1VI0 A;  1AHD P;  3CCE I;  1WHU A;  5B66 C;  1SVL A;  3HJE A;  4A0Z A;  3BG7 A;  3K4L A;  4RM3 A;  2L0K A;  4MXM A;  2F5V A;  3LSJ A;  2WAF A;  3H3V K;  2HYT A;  1OR7 C;  3CES A;  4NQW B;  3OYH A;  1TW2 A;  5ERI A;  3ERE D;  4LGW A;  3AQT A;  3OIP A;  5IOY A;  2DA4 A;  4YIR X;  3CLQ A;  3F22 A;  1RR8 C;  5FLV A;  2HYG D;  2HOA A;  5DS9 A;  3ECH A;  3VPR A;  1T33 A;  1BA5 A;  4Y33 A;  4CZC A;  5GAD J;  4O6J A;  4G6Q A;  1XMX A;  3S2H J;  3ISP A;  2VL8 A;  1R58 A;  3OL3 A;  3QPS A;  4QLC U;  2QKO A;  1FIP A;  1FSE A;  2XAQ A;  4RAG A;  3S1M J;  3TDZ C;  3CC4 I;  2ZCM A;  1LUJ B;  3GFJ A;  4C2M J;  3K4K A;  3MKL A;  1X2M A;  4HNT A;  2XAH A;  3CDH A;  2XGE A;  2FJI 1;  1A36 A;  2MBF A;  2XV4 S;  2CJJ A;  4I7H A;  4NC7 A;  3SZP A;  5FFX A;  2EWN A;  1P4W A;  4M72 A;  3IL2 A;  2XGC A;  3AKZ A;  1YRN A;  1G6N A;  4A12 A;  3SHF A;  1XDS A;  3OIQ A;  1LFU P;  1U5T B;  4OOI A;  3V78 A;  3KIO A;  3JSP A;  2XDV A;  1Y56 A;  4G6T B;  2RV8 A;  3HOS A;  2QOP A;  3M8J A;  3G73 A;  4EM0 B;  2VIX A;  3MKW B;  2KJB A;  3CJD A;  3SEZ A;  1B6A A;  1MH4 A;  1VND A;  2PFB A;  3ELK A;  4DQ2 A;  4BHC A;  2HZD A;  3SZT A;  3Q5F A;  2X1E A;  4BQQ A;  4E70 A;  3H9G A;  1MDM B;  1IN7 A;  2M8G X;  1XGS A;  3KEY A;  1K79 A;  1MMG A;  1N75 A;  2EFO A;  5FKO A;  2R3S A;  1JXS A;  3F0C A;  4RGU A;  1U3E M;  3BR5 A;  5HNF A;  2B3W A;  3I53 A;  1YX5 A;  4I02 A;  2BEO A;  4UUT A;  1QBJ A;  3PNT A;  4OD5 A;  4DBR A;  1G59 A;  3C1D A;  4I6Z A;  5FKN A;  1O3Q A;  3L9F A;  4A3F J;  5BOX A;  4BXX J;  2VPR A;  3LSR A;  1U9O A;  1YS7 A;  4IEJ A;  1FZP B;  2F2E A;  5CW8 A;  3M1C A;  5EYR A;  5FHP A;  2LP0 A;  2A61 A;  2E5N A;  2TRT A;  3C07 A;  4CXF A;  2P7V B;  5EGO A;  2WY7 Q;  2CV2 A;  4G94 A;  2GZW A;  3O6B B;  1B8I A;  3F8N A;  2DOF A;  1I6H J;  1T98 A;  4ESB A;  3MZY A;  2VOD A;  2ZME C;  4ENJ A;  2LLK A;  3QYB A;  5FLX Z;  3FXQ A;  5C4J J;  1DGR M;  2IBD A;  2DTR A;  3ZMU A;  4Y52 J;  4KIB A;  2ID3 A;  1Q1V A;  5GTH C;  1XCV A;  5LGT A;  3DF8 A;  1WJE A;  3K4B A;  3VIB A;  3KYC B;  2MAB A;  3S3O A;  5HDN A;  3L2R A;  4AC6 A;  5ILU A;  3HL2 A;  1H89 C;  4C2M A;  5F0C A;  1ZEL A;  4ETS A;  3OYK A;  4FHT A;  3L09 A;  2DA1 A;  2JRT A;  4Y3O A;  4C9Y A;  2Z2S B;  3TOB A;  2STW A;  4YEJ A;  4A5N A;  2XAG A;  5HLT A;  2DXI A;  2IP2 A;  2E5Z A;  4BKX A;  2MH2 A;  1E3H A;  2GEN A;  1TLH B;  2Q0O A;  2FBH A;  2CFX A;  3AG4 H;  1DU6 A;  1Z1D A;  3GZ5 A;  1XTA A;  2DYS H;  3I59 B;  4OD4 A;  1Y0U A;  3OYL A;  5F1R A;  4EGZ A;  1BR4 A;  2FA5 A;  4U9L A;  5E1W A;  4HBL A;  1TT0 A;  5FJ8 J;  3UR3 C;  4HST A;  3RKW A;  3MFK A;  4XRS A;  4FX4 A;  3LSK A;  2X6Y A;  3I64 A;  3QBM A;  5BQT A;  1P7I A;  1SC7 A;  4II3 A;  3RJP A;  2CU7 A;  1T6S A;  2CG4 A;  4DIQ A;  1ZN2 A;  2CV1 A;  2H6C A;  1HQC A;  1X1D A;  2MLG A;  4WWC A;  2VON A;  4BE2 A;  1OCZ H;  1TWF J;  2XRO A;  3WU2 C;  2F5E A;  4UV8 A;  2IT0 A;  4HG2 A;  2ZFU A;  2NYX A;  4W1U A;  4F55 A;  4HSR A;  3L2W A;  3JCU C;  5DEQ A;  1D5V A;  2EB7 A;  1K61 A;  1U8B A;  1SFO J;  2RHA A;  2R93 J;  1T0F A;  3VOE A;  4X1E A;  3O8G A;  3IWF A;  1WJB A;  1IV6 A;  2GLO A;  3LFU A;  2PI0 A;  1P4X A;  3ECO A;  4A3I J;  4ME9 A;  1UMQ A;  3CRJ A;  3S2D J;  3MAJ A;  2GIV A;  3VVZ A;  1SD6 A;  1PUE E;  5LEK A;  1J75 A;  2DFH A;  4KIC A;  4BUP A;  1UI5 A;  3TW6 A;  1UFM A;  4TV7 A;  3FRQ A;  2LBF B;  4DNC A;  2K02 A;  4IF4 A;  2K9M A;  4S04 A;  4HEA 2;  5KNL A;  4RAF A;  3DQV C;  2W7N A;  1SVO A;  2CFO A;  2M0M A;  1U5T A;  2LRD A;  2M9H A;  4E7H A;  1SFE A;  4AU7 A;  2BW3 B;  3QQA A;  2IS2 A;  2Y0M A;  3HC7 A;  2CQQ A;  2KZG A;  2LDU A;  3R4K A;  2ZOZ A;  2HYF A;  1YI2 I;  3D1N I;  3CWR A;  5GP9 A;  2QSF X;  4BE1 A;  4JQF A;  5LRS A;  1IXR C;  3BG9 A;  2L7M P;  2GQQ A;  3LWF A;  4IVN A;  3HPH A;  3RZD J;  3J7A O;  1HXD A;  2UXN A;  1ZG1 A;  5BPD A;  1V4R A;  1Z21 A;  5D1R A;  2EIJ H;  2WV0 A;  3I56 I;  4HDV A;  2VKH A;  5CQE A;  2FQ3 A;  1Y1W J;  4E6K G;  3OL4 A;  4XRF A;  5D4S A;  1R4M B;  3HRT A;  1XG1 A;  2YX7 A;  4B3X A;  2O61 A;  3ANG A;  2E60 A;  3QP5 A;  2FUG 2;  3FXK A;  1ZH5 A;  3PM1 A;  2K7L A;  3E97 A;  1I1G A;  1MH3 A;  5BS6 A;  3EYI A;  2VJI A;  4LOC A;  2CO5 A;  4W97 A;  1QVT A;  5J1U A;  5LHH A;  1S72 I;  3V7R A;  1IGN A;  1S6L A;  3OYC A;  2H27 A;  3COA C;  4I0A A;  1WQ2 A;  2IA0 A;  4CYC B;  1E2X A;  5JFR A;  4A3J J;  1TWG J;  2ZO4 A;  5TGT A;  4HQE A;  1YS6 A;  1T56 A;  3J7Y J;  5AIP A;  2RN7 A;  4L0Y B;  1A6I A;  4MLO A;  2D45 A;  4RGR A;  3ON2 A;  1K78 A;  4OIR F;  3CUQ A;  3OY9 A;  3FM5 A;  3HTS B;  1BOB A;  3MD2 A;  1R5G A;  2HKO A;  1IN8 A;  2E2J J;  1IRZ A;  1ENH A;  4O5V A;  1WKM A;  2AQE A;  2WAQ N;  3GTG J;  2FBI A;  4LLL A;  4A3D J;  2NS7 A;  3IAS 2;  4E4H A;  3WG9 A;  1H88 C;  1BI1 A;  5H20 A;  4PJ0 C;  3G71 I;  1PJR A;  1J7K A;  1XN7 A;  1JJ6 C;  4GCL A;  3PSF A;  3S1R J;  2HOT A;  4E7L A;  2PJR B;  3TED A;  2X6W A;  3H5R A;  3CLO A;  3WTV C;  1WI3 A;  2EIL H;  2WAQ A;  4WXC A;  5HNH A;  1P6R A;  2BY0 A;  3SFZ A;  1BR2 A;  2LY9 A;  4L62 A;  2Y0S N;  1A04 A;  2FE3 A;  1AWC A;  3F1B A;  3DKW A;  4WK8 F;  2QQ9 A;  2WAE A;  2OU2 A;  1MBK A;  4RB0 A;  1GVD A;  1VQN I;  3CQZ J;  2LRE A;  2NXN B;  2BOL A;  4YRV A;  3TO9 A;  2QWT A;  4B43 A;  1YIO A;  4GXO A;  2R7X A;  3G1O A;  2K9L A;  1DUX C;  1NHA A;  1XGO A;  5KHD A;  2FEZ A;  2XRL A;  4AIJ A;  5J40 A;  1U6G A;  1FBS A;  3G1L A;  3QPT A;  3JRC A;  2OER A;  3D5S C;  3K4C A;  2MD0 A;  3B02 A;  2UV1 A;  4M3D A;  2Y9Z A;  1LVA A;  1RNL A;  2NVY J;  4JX6 A;  1JJ8 C;  2CUZ A;  2DJN A;  2XC7 A;  2HTJ A;  2KDZ A;  2R7T A;  4M9Z A;  3FF5 A;  2E1C A;  1GXQ A;  4KIG A;  5JLX A;  3IUV A;  2JPC A;  2HQ5 A;  5JLW A;  2OQG A;  3HBL A;  2W00 A;  2F5C A;  1IXC A;  5HOD A;  3WTY C;  2O8K A;  1FSH A;  5AON A;  2ZCX A;  1VF9 A;  4ZH4 F;  1UZC A;  3BY6 A;  2E1M C;  3HOT A;  1YE9 A;  3RKX A;  2ZJ2 A;  3A0H C;  1CF7 A;  2EK5 A;  2I10 A;  2EFW A;  2ZME B;  2CGP A;  2EZK A;  3HUG B;  3KZI C;  2M5W A;  2PZ9 A;  2X6X A;  3FIS A;  2D5V A;  1FIA A;  4L9V A;  5IT9 Z;  1G3S A;  5K5R A;  4XLN F;  2UXU A;  1XD7 A;  4LG0 B;  2BW3 A;  3PL8 A;  3CO7 C;  3ZP5 A;  2XF7 A;  3AG2 H;  3E5X A;  4ZYD A;  1W7P A;  5D5W B;  5F0H A;  1IDZ A;  3O3K A;  2YVX A;  3B81 A;  3J81 Z;  1QQI A;  1QHG A;  4L5I A;  1QPM A;  3B6C A;  3GTJ J;  2DOE A;  4UHT A;  1S8N A;  3I54 A;  3Q0U A;  1ULY A;  3BRO A;  4FT8 A;  4ZZL A;  2PLY A;  4O3M A;  3CP8 A;  3P5J A;  3EGQ A;  1H9G A;  2Z99 A;  4G9Y A;  5EG0 A;  2KIM A;  2V79 A;  1I3A A;  1Z3Y A;  3VEP A;  3RZO J;  2XAF A;  5DUI A;  1DGW Y;  3GF2 A;  2DU9 A;  2VKV A;  1LDD A;  2P8T A;  4Z2Y A;  1SGM A;  1BC7 C;  3BZK A;  3QRF F;  2E35 A;  4BJ5 C;  3UKG A;  3ESW B;  2JVG A;  3FWE A;  3OV8 A;  4S0H B;  3BHQ A;  5E8G A;  2UXI A;  4KJZ A;  5FD6 A;  5D5U B;  1YW8 A;  3IRR A;  4LMY A;  4C3J J;  2M4K A;  3J80 K;  3K1N A;  3H0D A;  5EZH A;  1HDP A;  2O8X A;  2V9V A;  1JKQ C;  3RPU D;  4IOA F;  1D8J A;  1GVJ A;  4IX7 A;  3BNI A;  1R00 A;  4XM3 A;  4EEF G;  2XGX A;  3PNV A;  3HEF A;  3QYE A;  4A0Y A;  5DD8 A;  1D1B A;  1JHH A;  1R36 A;  4OIO F;  2VBZ A;  3SXY A;  1WZ2 A;  2CQK A;  3HTI A;  3CCY A;  2XRN A;  2RGV A;  2L7Z A;  4UUV A;  3DPJ A;  2DMN A;  1YIJ I;  3OR2 C;  3ZMD A;  1ZQ3 P;  3HOX J;  5H6Q A;  2ELK A;  3C2B A;  1TQP A;  1Q1H A;  2CW0 F;  3I0T A;  4EJV A;  3KET A;  5IP7 J;  3FHN A;  2ESH A;  1PP7 U;  2BVM A;  4I2O A;  4X6A J;  2B1E A;  4XSZ F;  3HOU J;  2DOA A;  1YG2 A;  1X2N A;  2PX9 A;  4U7D A;  4MFE A;  1BW6 A;  2PQ8 A;  4MTE A;  2REK A;  3CD6 I;  4OWR B;  3S93 A;  4B44 A;  3CMY A;  3HG9 A;  4RB1 A;  4ACI A;  3QAH A;  2I5U A;  4XR6 A;  3GW2 A;  1SD5 A;  5HLI A;  4ABZ A;  1EA3 A;  5DD4 A;  5KAI C;  1WJA A;  2HDW A;  3V8L A;  2A2F X;  1XGN A;  3HYI A;  4AYB A;  1SMT A;  2OQR A;  2MD5 A;  3LOC A;  2GUH A;  3PJR A;  1K4T A;  5M5X J;  3EUH C;  4YG2 F;  4N4N B;  3CMA I;  2FBK A;  4CGR A;  4DVY P;  4YIF A;  3HSE A;  4EJO A;  2HOE A;  3DPL C;  2Q2E A;  3CF5 F;  1TWH J;  2BY3 A;  3FMS A;  3M8E A;  1TTY A;  2CQN A;  4E7J A;  3NWT A;  1ETX A;  2YS9 A;  1F43 A;  2EPF A;  4XK4 A;  3V7C A;  5K7Z A;  2LSO A;  3K4J A;  2NS8 A;  1ON2 A;  2QWW A;  1H9T A;  1K6O A;  2R92 J;  5BNG A;  3VWB A;  1EH7 A;  2DMU A;  3EUK L;  3BR0 A;  1XMK A;  3ASN H;  4G7H F;  2DT6 A;  1OMI A;  1LFB A;  3WOD F;  1B72 B;  3VFZ A;  3U1K A;  3C2H A;  1YLF A;  1ZLJ A;  1ZKG A;  2QQB A;  4IKF A;  5FRN A;  2PMH A;  1E3O C;  2RRE A;  4M9S A;  1W36 D;  4IRV A;  2V7F A;  3BOQ A;  2NRA C;  4RLF A;  1TW3 A;  4F93 B;  2XDN A;  1ZRD A;  2W4S A;  2ICW G;  3IC7 A;  2IGM A;  4CCJ A;  2XF6 A;  5D8L B;  2Q24 A;  2X1C A;  4LG3 A;  2LKS A;  1I3Q J;  2VAS A;  2DA3 A;  2KRC A;  4D7N A;  1WI9 A;  4IRI A;  4IHT A;  1IUF A;  1OYI A;  2VT3 A;  1IJW C;  2QF7 A;  2V1U A;  1OYW A;  2ZOY A;  2M3A A;  4Y4R A;  1W5C C;  4B47 A;  2K9S A;  1USS A;  3PO3 J;  3LSM A;  4CZZ A;  4LLG F;  2W85 A;  4II2 A;  5LFA A;  4KMF A;  3KE2 A;  2LOO A;  3TP3 A;  2L3D A;  1TWC J;  2HPI A;  4IHS A;  4ICH A;  2V1X A;  4ASN A;  3PAS A;  4FCY A;  2R7F A;  2HNH A;  2Y48 A;  3P9K A;  2G7G A;  4OIN F;  5EEA A;  3LNQ A;  3WE2 A;  4HF2 A;  3MVP A;  3PQJ A;  2JRM A;  1D0X A;  2M45 A;  2ZXI A;  1Z6R A;  2HVS A;  4KT6 A;  4Y13 A;  2ZJP F;  4DGW B;  2BVL A;  5DYM A;  5IP6 A;  3S1N J;  1W36 C;  2JSC A;  1I5Z A;  4KN4 X;  5L3F A; 
#chains in the Genus database with same CATH homology
 2WB1 N;  4G12 A;  5C4J J;  2IBD A;  3I4N J;  4Y52 J;  2ID3 A;  1Q1V A;  3EUP A;  3OIO A;  1UI6 A;  2ME0 A;  3A02 A;  4DW6 A;  1P7J A;  2X9D A;  4IHY A;  3VIB A;  3JRI A;  2RAS A;  4AC6 A;  1H89 C;  1GV2 A;  5F08 A;  3O8H A;  5F0C A;  2HI3 A;  4B4C A;  2DMQ A;  3OOU A;  2DA1 A;  3VUQ A;  4IHX A;  3BR1 A;  3VW0 A;  2OF7 A;  3A01 A;  4BKX A;  2EH3 A;  3GEU A;  3KKD A;  2GEN A;  4M3B A;  4HNV A;  3LSG A;  2P81 A;  2RAE A;  3CDL A;  2DMT A;  3G1M A;  4JKZ A;  3FK6 A;  1DU6 A;  3O60 A;  5FKK A;  2DN0 A;  2NOG A;  3GTK J;  5FJ8 J;  3V6G A;  3I4M J;  2JA8 J;  4XRS A;  2R5Z A;  2G7L A;  2FX0 A;  3QBM A;  4JX4 A;  1AKH B;  2UXO A;  4IHW A;  5E3L A;  1P7I A;  3TP0 A;  1XS9 A;  1RKT A;  2CQX A;  2DTZ A;  2CU7 A;  2MSY A;  3Q0V A;  3GTL J;  2HKU A;  2ZB9 A;  4QIW N;  2M34 A;  3HM5 A;  3BCG A;  3VOX A;  3M3Y J;  2LTP A;  3G56 A;  1TWF J;  5CXI A;  2ECB A;  4MK6 A;  3B6A A;  2EBI A;  2D6Y A;  2LR8 A;  4B1R A;  4W1U A;  5F04 A;  5EF6 A;  3ON4 A;  4JX5 A;  2EQR A;  2YUS A;  4DYQ A;  3QKX A;  5IOZ A;  1K61 A;  1U8B A;  1SFO J;  2RHA A;  2R93 J;  3VOK A;  4X1E A;  3O8G A;  2GLO A;  1IV6 A;  3HOW J;  4I76 A;  3JRF A;  3BR6 A;  4A3I J;  3KZ9 A;  3NRG A;  4ME9 A;  2JN6 A;  1UMQ A;  3CRJ A;  3S2D J;  1A5J A;  4JL3 A;  3VVZ A;  1JUM A;  5IYC J;  3BR2 A;  1Y1V J;  1W0T A;  1UI5 A;  3TW6 A;  4XIC A;  1ETQ A;  5DAJ A;  3HGG A;  3RH2 A;  1NK2 P;  3M4O J;  3FRQ A;  3VVY A;  5K58 A;  2JA7 J;  4BBR J;  3GTM J;  4DZP A;  1JTX A;  2JWT A;  3DCF A;  1LE8 B;  2M9H A;  3E7L A;  1WGX A;  1YRN B;  5HBU A;  2TCT A;  5C44 J;  3QQA A;  3BTJ A;  5GPC A;  4C3H J;  3JRH A;  2JA5 J;  2CQQ A;  2CRG A;  2NVQ J;  5J1R A;  2ZOZ A;  2R5Y B;  2LKX A;  4FIS A;  3JRA A;  2O7T A;  4A3K J;  1GV5 A;  3D1N I;  4GCT A;  1WPK A;  3CWR A;  5GP9 A;  1BW5 A;  3BG9 A;  4UDS A;  2DA5 A;  5FKM A;  2L7M P;  2YVH A;  3RZD J;  4A3B J;  1BJZ A;  3K2A A;  1NTC A;  4XID A;  1F36 A;  5D1R A;  2KT0 A;  3ZOB A;  3TW7 A;  5FGL A;  1Y1W J;  1XG1 A;  3ANG A;  2DA2 A;  3FK7 A;  1FTT A;  4NEL A;  2VUM J;  3S5R A;  1ETY A;  3GTP J;  3PM1 A;  1MNM C;  3BQY A;  1MH3 A;  4UUS A;  4LOC A;  5AQC A;  2H1K A;  4W97 A;  1QVT A;  5J1U A;  1ZR2 A;  2PBX A;  2LK2 A;  3RQI A;  2E2I J;  5F0F A;  1IGN A;  1PUF A;  1QPI A;  4MIM A;  3S17 J;  4CYC B;  4AUX A;  2XPV A;  4A3J J;  1TWG J;  2ECC A;  1ETW A;  2VKE A;  4IHV A;  4L5E A;  1R9T J;  3JSJ A;  5EGO B;  4V2G A;  1T56 A;  1OFC X;  2UXH A;  1B8I B;  3VW1 A;  2NX4 A;  1A6I A;  4MLO A;  4BY7 J;  4AF5 A;  3ON2 A;  2OI8 A;  4XRM A;  5M5W J;  4FTH A;  3NAR A;  3S16 J;  2CUF A;  2HXO A;  5M3F J;  2HDD A;  5FMP A;  1JUP A;  1MBG A;  2E2J J;  1MSE C;  1IRZ A;  1ENH A;  3OSG A;  2UXP A;  2QCO A;  2WAQ N;  2K9Q A;  3GTG J;  3E7Q A;  1ORK A;  4A3D J;  2NS7 A;  4YZE A;  3VP5 A;  2MGQ A;  1H88 C;  1JUS A;  1XC5 A;  4MO7 A;  5IP9 J;  3HGY A;  1OCP A;  5CXG A;  2R0Q C;  1JJ6 C;  3RKQ A;  3ANP A;  3A01 B;  4GCL A;  4D7M A;  4NDL A;  3S1R J;  3NAU A;  2HOT A;  2GM4 A;  3TED A;  1MBH A;  1MSF C;  4NN1 A;  1DU0 A;  2B63 J;  1WI3 A;  4BBS J;  2GFN A;  2WV1 A;  1JTY A;  4L62 A;  2IEK A;  2LY9 A;  2Y0S N;  3F1B A;  2COB A;  2G7S A;  1MBK A;  4AYB N;  3BTI A;  1GVD A;  2HYJ A;  3CQZ J;  2H8R A;  2QWT A;  4J19 A;  2R5Z B;  2E1O A;  5K7H A;  1ZR4 A;  2XPU A;  1NK3 P;  2Y31 A;  3G1O A;  3S15 J;  5IPA A;  2MW8 A;  1IG7 A;  2XRL A;  3HTA A;  4M3F A;  2Y9Y A;  2Y30 A;  2M2E A;  2O7O A;  3G1L A;  3JRC A;  5IYD J;  2OER A;  3HIM A;  5DTD A;  2XB5 A;  5HSZ A;  2WUI A;  2LVS A;  5HAW A;  2NP3 A;  1Z0X A;  4M3D A;  3AQS A;  3S14 J;  2Y9Z A;  2NVY J;  4JX6 A;  1RET A;  1JJ8 C;  2DJN A;  3JRG A;  5C4Y A;  5M3M J;  2V57 A;  2E19 A;  2KDZ A;  3VW2 A;  1OCT C;  1ETK A;  4DYC A;  2E2H J;  1U78 A;  1H8A C;  5K7F A;  3BTL A;  2JA6 J;  4GFK A;  3NXC A;  4AC0 A;  1JKP C;  1X58 A;  1ETV A;  2IAI A;  5JLX A;  4RDU A;  3IV5 A;  2HQ5 A;  5JLW A;  1W0U A;  2DA7 A;  2R7Z J;  3IUV A;  3HBL A;  3GZI A;  1B72 A;  1HCR A;  1FJL A;  5HOD A;  2O8K A;  4FE4 A;  4A3E J;  2ZCX A;  1QRY A;  1MBF A;  1VF9 A;  2PMZ N;  3ZQG A;  3ZQH A;  5FLM J;  4D5F A;  2I10 A;  3FIW A;  2W48 A;  4A3G J;  2EZK A;  2XGD A;  2LD5 A;  4Y7N J;  2PZ9 A;  2VI6 A;  2FQ4 A;  3FIS A;  2D5V A;  1K83 J;  1FIA A;  1LE8 A;  5D19 A;  2N8G A;  4A93 J;  1S7E A;  2XPW A;  4BY1 J;  2UXU A;  3KNW A;  3W6V A;  5E3M A;  2X6O A;  3DEW A;  3H0G J;  5F0H A;  1IDZ A;  3MN2 A;  4GFB A;  1MBJ A;  2WGB A;  2X48 A;  3B81 A;  2EZH A;  3PO2 J;  4V2F A;  4GFL A;  4M3G A;  3SJM A;  3B6C A;  1ETO A;  3GTJ J;  2FD5 A;  2HXI A;  1SAN A;  3JRE A;  1POG A;  1WH7 A;  2Y2Z A;  3Q0U A;  4C3I J;  3HTH A;  3LWJ A;  3ZQI A;  1JKR C;  2OPT A;  3HB9 A;  3EGQ A;  1ZTR A;  5EG0 A;  1IDY A;  2NVX J;  3RZO J;  1IC8 A;  2K9N A;  2VKV A;  5IYB J;  4DYR A;  3JR9 A;  2NVT J;  5C4X J;  3L1P A;  2ME6 A;  3JRD A;  1FTZ A;  1SGM A;  2K40 A;  1ZK8 A;  3IH4 A;  3UKG A;  5EZG A;  4UUS B;  3HOY J;  5EDN A;  2ZCN A;  3PPB A;  4S0H B;  3BHQ A;  3A03 A;  1MBE A;  2UXI A;  2FBQ A;  5GPA A;  2HOS A;  1PUF B;  3LSP A;  2ID6 A;  3HE0 A;  4C3J J;  1ZGW A;  2LFB A;  1HDP A;  5EZH A;  1JKQ C;  3K7A J;  3LJL A;  4A3M J;  3NI7 A;  3BNI A;  5FKL A;  4JP0 A;  2JK3 A;  4EEF G;  3NNR A;  2GBY A;  1WCM J;  3HEF A;  3MNL A;  3P9T A;  4M3E A;  2O9L A;  1RPW A;  2NP5 A;  4A3L J;  1UHS A;  2F07 A;  1O4X A;  3HKZ N;  3BT9 A;  5J1Y A;  1UG2 A;  3CCY A;  2QIB A;  3HTI A;  5D18 A;  2M0C A;  5F27 A;  2L7Z A;  1RKW A;  2DMP A;  3DPJ A;  3IH3 A;  2DMN A;  1RR7 A;  3GTO J;  3COL A;  1QVU A;  4GCK A;  4PXI A;  2XSD C;  1U9N A;  3ZQC A;  1ZQ3 P;  2L9R A;  3HOX J;  2ELK A;  3C2B A;  3HDD A;  5IP7 J;  4X6A J;  3S1Q J;  2EZL A;  1VI0 A;  4A69 C;  3HOU J;  1AHD P;  2YVE A;  3SFI A;  4RBO A;  1X2N A;  1AKH A;  3WHB A;  2EZI A;  4MFE A;  1BW6 A;  2L0K A;  4MXM A;  2REK A;  3LSJ A;  2XB0 X;  3CMY A;  3H3V K;  1HF0 A;  3OSF A;  2HYT A;  1Z77 A;  4ACI A;  1GT0 C;  1HDD C;  3HOZ J;  1AU7 A;  3AQT A;  4ABZ A;  5IOY A;  3FKI J;  1VFC A;  2DA4 A;  4FE7 A;  9ANT A;  5FLV A;  1I50 J;  4A3C J;  1G2H A;  2HOA A;  5DS9 A;  2G3B A;  3VPR A;  1T33 A;  1D5Y A;  3LOC A;  2GUH A;  1BA5 A;  3GTQ J;  5M5X J;  2DG7 A;  1HOM A;  4CGR A;  1TC3 C;  4MFD A;  1CQT A;  4B3A A;  3S2H J;  5C3E J;  4JNN A;  3QPS A;  3BR3 A;  2JMW A;  1TWH J;  2QKO A;  3LHQ A;  1ETX A;  2YS9 A;  1F43 A;  1FIP A;  3BTC A;  1OJL A;  3BQZ A;  1JT0 A;  1FEX A;  4XK4 A;  5K7Z A;  3IH2 A;  3QPL A;  3ZQL A;  3S1M J;  2ZCM A;  4C2M J;  2NS8 A;  3MKL A;  1X2M A;  2R92 J;  5BNG A;  3HOV J;  2DMU A;  2XGE A;  4JYK A;  5F1J A;  1APL C;  3BR0 A;  4QTR A;  3NPI A;  1TWA J;  2CJJ A;  3BG3 A;  1LFB A;  1B72 B;  2DA6 A;  3BJB A;  1JKO C;  2XGC A;  3GBG A;  5H9T A;  4QSH A;  1YRN A;  1ZKG A;  3JRB A;  2QTQ A;  2G0E A;  1LFU P;  1HLV A;  1E3O C;  2YU9 J;  3V78 A;  3ZQF A;  2DG8 A;  2QOP A;  2CUE A;  2R5Y A;  2XDN A;  2AHQ A;  5M5Y J;  3CJD A;  1GUU A;  2W53 A;  3KKC A;  1MH4 A;  1VND A;  2Q24 A;  5EFY A;  1EF4 A;  1I3Q J;  5E3O A;  2DA3 A;  4D7N A;  2M8G X;  1IUF A;  1IJW C;  4XRS G;  5E3N A;  5FKO A;  2QF7 A;  3HTJ A;  1GDT A;  3F0C A;  3VVX A;  2ZOY A;  3BR5 A;  4DZJ A;  1RES A;  4UUT A;  2K9S A;  3RD3 A;  3WHC A;  3PO3 J;  3Q0W A;  4HKU A;  3T6N A;  4I6Z A;  5FKN A;  4A3F J;  3TP3 A;  4BXX J;  1TWC J;  2VPR A;  1BL0 A;  4ICH A;  3LSR A;  3BG5 A;  3G7R A;  2FJ1 A;  3PAS A;  4FCY A;  1U9O A;  4IEJ A;  1JGG A;  2MG4 A;  2G7G A;  5EG0 B;  5EEA A;  3LNQ A;  5CW8 A;  3MVP A;  1ITY A;  5EYR A;  4CYC A;  2LP0 A;  5FHP A;  1JT6 A;  2JJ7 A;  2TRT A;  4M6V A;  4D5C A;  3C07 A;  3SDG A;  3Q3S A;  4KWA A;  1WH5 A;  2AO9 A;  5EGO A;  5J3L A;  1B8I A;  5IP6 A;  1I6H J;  3S1N J;  3BRU A;  2IU5 A;  2LLK A;  2L7F P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...