3WHCA

Crystal structure of a transcriptional regulator fadr from bacillus subtilis in complex with stearoyl-coa
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
190
structure length
190
Chain Sequence
KRPKYMQIIDAAVEVIAENGYHQSQVSKIAKQAGVADGTIYLYFKNKEDILISLFKEKMGQFIERMEEDIKEKATAKEKLALVISKHFSLLAGDHNLAIVTQLELRQSNLELRQKINEILKGYLNILDGILTEGIQSGEIKEGLDVRLARQMIFGTIDETVTTWVMNDQKYDLVALSNSVLELLVSGIHN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of a ligand-bound form of Bacillus subtilis FadR involved in the regulation of fatty acid degradation.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription
molecule keywords Fatty acid metabolism regulator protein
total genus 77
structure length 190
sequence length 190
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08359 TetR_C_4 YsiA-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3whcA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3whcA02
2RHAA 3BTLA 2M0CA 1GDTA 2VUMJ 2UXIA 2XB5A 1AKHA 2ECBA 5EGOA 4W1UA 1HF0A 1BW6A 2N8GA 2MW8A 4X1EA 3LSPA 2G7LA 2COBA 5EDNA 2ZOZA 1LE8A 4LOCA 2EZLA 4DYRA 3RZOJ 2RAEA 1VF9A 2OI8A 2O7OA 4L5EA 1UI5A 1D5YA 3M3YJ 4D5CA 3BR6A 2H8RA 4A3IJ 3HBLA 2JK3A 1QPIA 4FTHA 4AYBN 1Y1VJ 2NS7A 2NS8A 2HQ5A 1ITYA 2WAQN 3MNLA 2DG7A 2JN6A 3NNRA 2Y2ZA 1UHSA 3TEDA 2XSDC 5C4XJ 3DCFA 3JR9A 2NOGA 4XRSG 5CW8A 4X6AJ 2EZIA 2Y9ZA 1B8IA 5FGLA 2DA5A 5IOZA 1EF4A 3NARA 5DTDA 4D7MA 1U78A 4D7NA 1ETXA 2Y30A 5F27A 2I10A 1U9NA 2M8GX 5F0FA 1IDYA 2MGQA 5EZGA 4BY7J 1P7IA 1TWHJ 3Q0UA 1XS9A 3CMYA 2ZOYA 3L1PA 4I76A 2R5ZA 2DA6A 3HTHA 2LK2A 2FJ1A 2B63J 3S1QJ 2QF7A 5K7FA 3GTLJ 3IV5A 1CQTA 2L7MP 2LR8A 1ZR2A 3ZQLA 3G1MA 3T6NA 2D6YA 2E19A 2L0KA 5C44J 1SFOJ 1OCPA 5F0CA 3KNWA 5J1UA 2QCOA 2G0EA 4M3FA 3VUQA 4M3DA 2R92J 3ZOBA 2OF7A 2FQ4A 5F08A 1GVDA 1BL0A 2O9LA 1Z77A 3BG3A 2CRGA 2GENA 3HE0A 3HOVJ 2DA2A 2LTPA 3VPRA 5IYCJ 3GTGJ 3V78A 2JA6J 3BQYA 1Z0XA 2G7SA 2X6OA 1HOMA 5IOYA 1GUUA 4DZJA 1B72B 3BHQA 1ZTRA 3B6CA 2JWTA 2O7TA 2XGDA 4W97A 3G1LA 3G1OA 5EYRA 1W0TA 3S14J 2DA4A 2R0QC 1BA5A 3VP5A 4C3IJ 1T56A 2E2IJ 3JSJA 1WPKA 2ZCXA 3CDLA 5FHPA 1I6HJ 5EFYA 3RZDJ 3LHQA 3MVPA 1RPWA 4A3DJ 3RD3A 3S1RJ 3TW7A 3BR3A 1FTTA 4QSHA 2RASA 2R5ZB 1RR7A 1Y1WJ 5AQCA 2HKUA 2FX0A 1IUFA 1FTZA 2E1OA 2HDDA 2QOPA 2EBIA 4C2MJ 3GTMJ 3GZIA 3OSFA 3PPBA 3HIMA 2O8KA 2K9SA 3TW6A 4L62A 4GFBA 3LSRA 5FJ8J 2D5VA 2L9RA 5F04A 1NTCA 3E7LA 2VI6A 4BBRJ 4UUSB 5J3LA 1E3OC 3FKIJ 2NP3A 2UXUA 3LSGA 3K2AA 2R5YB 2GM4A 2XGCA 3GTQJ 2L7ZA 4MFDA 3W6VA 3MN2A 3QBMA 4B4CA 3A01A 3A01B 4AC0A 3JRBA 1AHDP 2HYJA 3OOUA 3CQZJ 3WHBA 1MSFC 4A3LJ 1ETYA 2VPRA 3GBGA 2R5YA 1S7EA 5FKLA 2ECCA 3SJMA 2KDZA 3JRAA 3Q0VA 5K7HA 3BTIA 5EEAA 4A3CJ 3COLA 4ICHA 1ETOA 3IH2A 2LKXA 5IP9J 2WV1A 1MH3A 3B6AA 3NI7A 5FMPA 2XB0X 4PXIA 2NP5A 3DEWA 5FKKA 4GFKA 2LLKA 3D1NI 1F43A 1JUMA 1U8BA 4BXXJ 3CRJA 3GEUA 5CXIA 1JJ8C 5IP7J 9ANTA 4JL3A 1IRZA 3TP0A 2DG8A 3F0CA 1R9TJ 3K7AJ 2WB1N 5FLVA 5K58A 3HTJA 4MFEA 5K7ZA 5C3EJ 2X9DA 5E3OA 3ZQGA 3I4MJ 2FD5A 1ORKA 3AQSA 2HXIA 4ACIA 1U9OA 2K9NA 1ETVA 1X58A 4IEJA 3QPSA 1JJ6C 2CUFA 5EG0B 2IBDA 2FBQA 2REKA 4A3KJ 1Q1VA 2LY9A 1ZGWA 2ZCMA 3BCGA 4JP0A 5HODA 4FCYA 2YVHA 1QVTA 4A3BJ 2DA1A 2MSYA 3BR0A 5BNGA 2LD5A 3BG9A 1ZK8A 2NVYJ 4CYCB 4CYCA 2UXOA 3ON4A 1SANA 1JKOC 4IHXA 2JJ7A 4XRMA 4G12A 2NVXJ 2WUIA 3VVZA 3SDGA 3FIWA 3TP3A 1ETWA 2K40A 4JKZA 3RQIA 4V2FA 4Y52J 1IJWC 4B1RA 3ANGA 5E3NA 3FRQA 4JNNA 3HTIA 5D1RA 1ENHA 1IC8A 2AHQA 4IHYA 3Q0WA 2YS9A 3GTOJ 1HDDC 4UDSA 5J1YA 2TRTA 3RKQA 2NVTJ 3EUPA 3H0GJ 1OJLA 5E3MA 3HOUJ 2GLOA 1RKTA 2E2HJ 3B81A 5IYBJ 2H1KA 3MKLA 2WGBA 1GT0C 3NXCA 1MBFA 1BJZA 1IDZA 3EGQA 2UXPA 1TWFJ 2DJNA 3S15J 2HI3A 4M3GA 3BJBA 2E2JJ 2JA5J 2XPVA 1FJLA 2Q24A 3HOWJ 2JA8J 2ZCNA 3VW1A 1FIAA 2LP0A 2HXOA 2ZB9A 3S2HJ 1G2HA 3P9TA 5FKMA 5M5YJ 3HKZN 1DU0A 4XICA 5HSZA 5DAJA 2YUSA 1TWGJ 2EQRA 3E7QA 2HOTA 2GFNA 3KKDA 1QVUA 4D5FA 1IV6A 2YVEA 2EH3A 3O60A 4HKUA 4HNVA 5E3LA 3NRGA 2HOAA 3LSJA 4CGRA 1JUPA 2DMTA 3FISA 4C3HJ 3PASA 5DS9A 4JX4A 4MK6A 4GCLA 4JYKA 2PMZN 5IPAA 3S1MJ 3RH2A 1JKQC 1MBKA 1H8AC 3JRGA 3ZQCA 3ZQFA 1JT6A 2ME6A 1LFBA 4JX5A 4UUTA 1H89C 2HOSA 3HGYA 3PM1A 3HDDA 3GTKJ 3HOXJ 3UKGA 2QKOA 3G56A 1OCTC 3HGGA 4BKXA 2DMNA 2X48A 4UUSA 1LE8B 1WCMJ 1YRNA 3BR5A 5FKNA 4QIWN 5EZHA 2W48A 4XRSA 3KKCA 3OSGA 1RESA 4XK4A 3QQAA 4RBOA 2ME0A 2LVSA 3BTJA 2ID3A 2NX4A 2XDNA 3VVXA 4DW6A 1WH5A 3S16J 2QIBA 3ON2A 2DMUA 5EF6A 2Y0SN 2DN0A 1X2MA 1B72A 1ETQA 3M4OJ 3BNIA 4A3EJ 4JX6A 4XIDA 3BG5A 4ABZA 4MXMA 1APLC 3V6GA 3BRUA 2QWTA 1MBEA 1WI3A 3A02A 4MO7A 5EG0A 1JKPC 2HYTA 3VW2A 3IH4A 2CUEA 5FKOA 3JRIA 1JTYA 5J1RA 1ZQ3P 4AC6A 4NELA 4NN1A 1NK3P 1P7JA 3LNQA 2M34A 2Y31A 2IU5A 1PUFA 1A6IA 1H88C 4DYCA 5HBUA 1VI0A 1WH7A 1MNMC 3C2BA 3HB9A 4GCKA 2LFBA 3S1NJ 3BR2A 5F0HA 1UI6A 3GTJJ 1YRNB 3BR1A 5M3MJ 1I3QJ 1HCRA 3PO2J 2W53A 3VW0A 4FE4A 1POGA 3HOYJ 2OPTA 1RKWA 2CQQA 2Y9YA 1I50J 1X2NA 5JLWA 1B8IB 4J19A 2DA3A 3NAUA 3C07A 3VIBA 4AUXA 2NVQJ 3JREA 2V57A 2JMWA 1UG2A 3ZQIA 4A3FJ 5M5XJ 1IG7A 2IEKA 3HTAA 1QRYA 2IAIA 3SFIA 2G7GA 1FEXA 1T33A 3G7RA 2VKEA 1HLVA 3NPIA 3JRDA 4EEFG 2PBXA 3O8GA 1JTXA 2L7FP 3IH3A 3A03A 1VFCA 1SGMA 3BTCA 3S5RA 3JRHA 1JKRC 2M9HA 4FISA 4C3JJ 2R7ZJ 5EGOB 3LWJA 2GBYA 4M6VA 5IP6A 2QTQA 1HDPA 5M3FJ 4I6ZA 5GPAA 3GTPJ 1XC5A 1GV5A 4M3BA 3HEFA 4M3EA 3KZ9A 1MSEC 2GUHA 3JRFA 2F07A 1A5JA 3ANPA 1RETA 1JUSA 2MG4A 2XPWA 3BT9A 1AKHB 3PO3J 4A93J 4B3AA 4IHWA 3HM5A 2P81A 1WGXA 1OFCX 3BQZA 1UMQA 2R93J 4FE7A 4ME9A 2CU7A 3CWRA 4A3MJ 5D19A 4MLOA 3CJDA 2KT0A 4V2GA 1TWCJ 1VNDA 3WHCA 1W0UA 3QKXA 2UXHA 5C4YA 2XRLA 4S0HB 4IHVA 4GFLA 1O4XA 4NDLA 1MH4A 2DMQA 3OIOA 3DPJA 3VOKA 1ZKGA 3LJLA 1ETKA 2M2EA 4A69C 5C4JJ 4BY1J 3S2DJ 2DTZA 3IUVA 3F1BA 3VVYA 3Q3SA 2YU9J 2VKVA 3QPLA 5FLMJ 1LFUP 4KWAA 3AQTA 3VOXA 3FK6A 2EZHA 2CJJA 4GCTA 2CQXA 4DZPA 5F1JA 3CCYA 3HOZJ 4DYQA 4RDUA 3S17J 1TWAJ 5IYDJ 4YZEA 2AO9A 5JLXA 1NK2P 4A3GJ 2ELKA 3FK7A 1PUFB 1TC3C 5D18A 1JGGA 1BW5A 1K61A 1JT0A 2EZKA 2XGEA 4A3JJ 2OERA 3H3VK 1K83J 1XG1A 4Y7NJ 1FIPA 2G3BA 2K9QA 1F36A 3I4NJ 5CXGA 2JA7J 1MBGA 4AF5A 4MIMA 5GPCA 3LOCA 1MBHA 3JRCA 1MBJA 3O8HA 4QTRA 3ZQHA 1IGNA 2DA7A 2PZ9A 1GV2A 5H9TA 2TCTA 5GP9A 2DMPA 1ZR4A 4BBSJ 1AU7A 1DU6A 5M5WJ 2ID6A 2XPUA 5HAWA
chains in the Genus database with same CATH superfamily
4IF4A 2FXAA 2XB5A 3O3KA 2ETHA 2EFPA 3OY9A 1QZYA 4X1EA 4DJAA 2MW8A 2RV8A 2ZOZA 3P9KA 1YIJI 3GZ5A 1VF9A 1J2XA 3IUOA 4BS9A 1XPXA 4D5CA 3KP4A 3RPUD 3CC4I 2ELHA 4A3IJ 2ZSIB 5EJCA 3RJPA 3BC8A 3JSOA 1W5TA 1EJ9A 1UFMA 2NS8A 2HQ5A 2VL8A 1XMAA 1BR1A 1ZHFA 2PX9A 2JN6A 3OS2A 5C4XJ 5CW8A 1IN8A 1ZLJA 1V5FA 2GA1A 1H9TA 1K7AA 2DJIA 1B8IA 4HF1A 3NARA 5DTDA 3W2AA 1SFKA 4D7MA 3BROA 2KIQA 3T5XA 1TT0A 3HG9A 1QHHD 2I10A 2M8GX 4BY7J 5J1YA 1HC8A 1TWHJ 3Q0UA 5DV5A 2X6WA 3JCUC 2FJ1A 5CYVA 2QF7A 2A6HF 4LIVA 4XONA 2FOWA 4IHTA 1LFPA 1CQTA 2L7MP 3SWHA 1IW7F 3GUDA 3QU6A 4Y3OA 2LMDA 5ICGA 4M9SA 5C44J 4CHUA 2D6YA 2P7CB 5F0CA 3KNWA 2HQRA 4DBRA 1OQYA 3ZOBA 3AL0C 1GVDA 2ZNYA 1G59A 3H5NA 3HOVJ 3BZCA 3GTGJ 3LSIA 1W5SA 1YLFA 3F8BA 1P2FA 4HG2A 4BQOA 1G3YA 3HPHA 4KDPA 2EIMH 2V7FA 2IS2A 4KIFA 3VYSB 2JSCA 2GXBA 4A12A 2X6OA 1JE8A 5IOYA 3B6CA 5HS9A 3F3XA 2XGDA 3G1LA 1R5HA 3G1OA 5EYRA 1W36D 3K1NA 4C3IJ 5L3BA 4P5OA 3CZ6A 2EV5A 3EETA 4L9JA 2DFHA 2ZCXA 4HZFA 3CDLA 3PQJA 5FHPA 1WJFA 3MZHA 2PBIA 3LHQA 2GIVA 2BY2A 2RVCA 4KMFA 5J4VA 3LSKA 1YW7A 2EV6A 3KETA 3K8PC 1FTTA 2IGNA 3VODA 2VQHA 3DEUA 3SDBA 2HKUA 1IUFA 4DVYP 2DYSH 2EBIA 1VQ9I 3HRSA 5H2FC 4ANJA 2O8KA 2K9SA 4GFBA 5F04A 2W82A 3K1MA 4UUSB 5J3LA 3FKIJ 1UZCA 2CWEA 2RQQA 2YR2A 4E7SA 4EM0B 1I1GA 3DWLE 1WKMA 2CV1A 4B4CA 1Y56A 2BZTA 4IQ4A 2K3PA 2M7AA 3E0JB 3E6BA 4KUMA 4CCKA 5FFXA 4CXFA 1HW1A 4EATA 3T1BA 1MSFC 4A3LJ 1ETYA 1ZGJA 2VPRA 3WTZA 1S7EA 2M87A 2VQGA 5F6FA 3W2WA 4B3XA 1KQ8A 3BWGA 2CS3A 1MMGA 3BTIA 5K7HA 2H94A 1Z7UA 4G94A 5IP9J 2WV1A 3B6AA 3K2ZA 4RGXA 2XC7A 4ENMA 3RPUA 2NP5A 3ABMH 4HSTA 4XR6A 3ZMDA 4HAMA 1VQOI 3ZN1A 1GLNA 1KYZA 1JJ8C 9ANTA 4E7LA 1U5TA 3K7AJ 2P6SA 2NAZA 2YPRA 3WE2A 3OYBA 4IKFA 3CDIA 3SEZA 4Y4RA 4LJZF 1EH7A 1KU2A 3LSMA 3H5RA 5C3EJ 1LJ9A 1G6NA 4OWRB 2RN7A 3ZQGA 4GYGA 1ORKA 5AIPA 2HXIA 2F4OB 3CESA 4DGWB 2VLAA 1XGSA 4ACIA 3OYFA 3KP5A 1JJ6C 5EG0B 1VZ0A 3CJTB 1OKRA 2RKHA 1R4MB 3R60A 4BDYA 3H9GA 2GWRA 4JP0A 4FCYA 4Q5SF 1S7AA 5JVGF 2MSYA 3VTIA 3M1CA 2MABA 4NQWB 2K27A 2FEZA 2LD5A 4R8HA 2NVYJ 4CYCA 2MLKA 3B02A 2JJ7A 1ZYRF 5HDKA 4LLNA 2NVXJ 2X6XA 2LREA 3VVZA 3GO5A 3FIWA 4FX0A 1B6AA 4U0VA 3VFZA 3L2UA 2LOOA 4BGDA 1IO2A 1EA3A 2W4SA 3ANGA 3DBRB 2ZMEA 3FRQA 1QGPA 1OCZH 3PIOF 3FM3A 3KE2A 3S3NA 4AM3A 1FP1D 3TDZC 1X3ZB 2XV4S 1HDDC 4G7ZF 4L9VA 4BACA 2TRTA 4I01A 3RKQA 2NVTJ 5DDGA 4D1QA 3G4SI 2DXIA 4UHTA 5ICCA 2E7XA 3QODA 2H1KA 4LGWA 3FMQA 3QRFF 1MKMA 1BR2A 1MBFA 1IDZA 3FM5A 5DUIA 2VB6A 3OV8A 2WAQA 3KX2A 3QPTA 2ZCNA 2IA2A 2JA8J 1FIAA 1U6GA 2ZB9A 5B66C 3V8LA 1DU0A 3PSIA 2EA2A 1A31A 3L7WA 3WTXC 5DAJA 1R36A 1TWGJ 3F8FA 2B1EA 3HL2A 2JRMA 3EUKL 3K0LA 4XLNF 3NRGA 3ZMVA 2JRTA 4C3HJ 4CCOA 3G73A 3X2QH 4JX4A 3F6VA 1QQIA 4MTDA 2MLGA 1K79A 2IA0A 2PMZN 4ENNA 1MW7A 1B4AA 3HTHA 3ZQCA 2K86A 3WTUC 1LFBA 2VQCA 1IN7A 3ML6A 4JX5A 4HW0A 4UUTA 4Y15A 3MKYB 1X4OA 1OCCH 4HBLA 3T8RA 3H9JA 2MH2A 1T95A 2P4WA 3KFWX 2FU4A 2CYYA 5JVTA 1XCVA 2DMNA 3MZYA 1LE8B 3E97A 3VB2A 3DKXA 3M7GA 1WCMJ 4BDZA 3CMEI 3R4KA 1D8KA 2AQEA 2KDOA 3ASNH 1Z05A 3QYFA 3DU5A 3CUQC 4RBOA 2IP2A 5CVVA 2LVSA 3GLXA 4FX4A 2QIBA 2FBHA 4QPOA 2WTEA 1CF7A 1NHAA 2E1CA 3H92A 2LKPA 1IN5A 2DOEA 2IS4A 1KZHA 4XQFA 2OQGA 4MXMA 3JAMK 3F22A 3V6GA 2B0LA 1UAAA 3BRUA 3A02A 2WA0A 4MO7A 5EG0A 3KLNA 1JKPC 3VW2A 3IH4A 5FKOA 2AXTC 3JRIA 5J1RA 2E1NA 4UVAA 4XLAA 1KU7A 2NRAC 5FRMA 3DTEA 2VN2A 3ROUA 1ZGAA 4YFXF 2GIZA 1WJAA 4WCGA 2MH9A 4AIDA 4LLLA 4BNCA 1MNMC 2GZWA 3HB9A 2DT7B 2LRDA 2LFBA 5CVIA 1K4TA 3BR2A 2OJED 1BBYA 1Z3YA 2XKPA 1YRNB 3BR1A 3PFYA 1MJBA 1XSVA 1Z67A 2A69F 1HCRA 4OU0A 3BP8A 2W53A 4FE4A 1W7PA 4DIQA 1RR8C 3HOYJ 1X3WB 2EINH 2LG4A 4NUBA 2HEOA 1RKWA 1X2NA 1XSXA 3U1KA 4XKCA 1R71A 1B8IB 3ZCOA 4AUXA 2X6YA 2IW5A 2L02A 2QQAA 3JREA 1SVLA 1B9MA 3OYMA 5FLXZ 4L5JA 2DT5A 5E1XA 1BM9A 3SFIA 3SXYA 2G7GA 2PJRB 3L2WA 3KP3A 5CKTA 1T33A 2VKEA 3C2GA 4IXAA 1P4AA 2DFIA 3UR3C 3JRDA 1K78B 1GHCA 1JTXA 1XX5A 3F9KA 1SGMA 2FNAA 2M4KA 2X1DA 1X1CA 4EV0A 2Z33A 2M9HA 4FISA 4KN4X 4C3JJ 1VQPI 1WHUA 3CCJI 4RS8A 3KZYA 5IP6A 1HDPA 1IV8A 3KEQA 1TP4A 2XAGA 4BE2A 1YO5C 3EYIA 4HF2A 2R7UA 3BDDA 3ZXSA 5J6XA 3UNGC 2PN6A 3GTPJ 4M3EA 2ZO4A 1ZG5A 1MSEC 2ZNZA 1ODDA 2VT2A 3OS1A 2F07A 4IOAF 5D6FA 3PNVA 4UVCA 4IJAA 3N97A 1AKHB 2OTLI 1P9QC 1V4RA 3EPZA 3CF5F 1RZ4A 2AXLA 3F8MA 3R0AA 3K4MA 1P92A 2EILH 5LHHA 3D0SA 4CO8A 2CU7A 2R3SA 4XM3A 2PJRA 2GAUA 3KZZA 5D19A 4ZYDA 3CJDA 4V2GA 1TWCJ 1W0UA 1Z3XA 2UZKA 1WQ2A 3LL7A 4GFLA 4NDLA 3TO6A 3OIPA 3OIOA 4RAFA 4E7IA 5GTIC 3DPJA 1FX7A 3VOKA 3SYTA 3W6KB 1ETKA 5ILUA 3L2RA 2K7LA 1O3TA 5GAEJ 2VKVA 1EKEA 2PJPA 1SAXA 2LNBA 3AQTA 1R1UA 3LMMA 2V26A 3V7RA 3OYJA 1MZBA 2WY7Q 3GZ6A 4DZPA 1DGRM 2HVSA 4DYQA 3GFIA 2LDUA 1TWAJ 1FLIA 3RDIA 1FP2A 1GXQA 4CCMA 5JLXA 3CJQB 3FKJA 3VYRB 4EGYA 4A3GJ 2ELKA 4A2UA 3WTYC 5D18A 1K61A 2F5EA 2IGKA 4ZDLA 2EZKA 1IXRC 1XG1A 2NYXA 4Y7NJ 4A6DA 2DK5A 2K9QA 3V7SA 1F36A 3I4NJ 3ECOA 2JA7J 3PNTA 2DPDA 4AF5A 2ZMEC 2E7WA 3NWTA 1UJ8A 3LOCA 2Q2EB 3H3UA 1IRGA 4QTRA 1IGNA 2DYRH 5JHUA 1TLHB 2FBKA 2VJIA 3HXLA 2TCTA 3H35A 4WXDA 4WF2A 2DMPA 4I02A 1ON2A 4G9YA 4ZYAA 1XTAA 2Q1ZB 4HYEA 5HAWA 1QBJA 3WGIA 1KA8A 1FY7A 4PFOA 5DEQA 2VUMJ 1FYLA 3FBIB 4E70A 4M72A 2ECBA 5EGOA 1G3SA 5B3SH 2G7LA 4N9IA 1ZRFA 4C2MA 5EDNA 1BOBA 1LE8A 4XKVA 3EUHA 2OI8A 2O7OA 4L5EA 1D5YA 3WODF 5IT3A 3M3YJ 1SC7A 2QA4I 3HZJA 4I0BA 2JT1A 1Q1HA 3H1CA 1Y1VJ 4I7HA 2B7EA 3FWEA 1ITYA 3BJOA 1OYIA 2WAQN 4JQFA 2VODA 3MNLA 5FB2A 2L4AA 2DQLA 4PJLA 1OR7C 2DG7A 1G8XA 2A5WA 1HXDA 4LFUA 4RGUA 2EIJH 3DCFA 1YTYA 3L9FA 1VTNC 2DPUA 3BZ6A 2Y9ZA 5BPIA 5IOZA 2YVXA 3C18A 3K4CA 3T8TA 1U78A 1VQ6I 1SD5A 2K9LA 4IRVA 2B3WA 1U9NA 2MGQA 1K6YA 1IDYA 3SFZA 3I59B 3VWBA 3J7AO 4NQWA 2O6GE 1UG0A 2LK2A 2B63J 5K7FA 1QPMA 4R79A 5BS6A 2CUZA 2VPLA 1YOVB 1I3AA 2GQQA 2QBYA 2L0KA 2XAUA 3F23A 5TJJA 3ZPLA 5BPDA 1S72I 3BOQA 5F08A 5EEGA 4B48A 2XGXA 3HE0A 2LTPA 1XDSA 4LG0B 1D0ZA 3MCZA 5ED4A 1VQ7I 1D8JA 3JAMZ 3BQYA 3TO7A 1Z0XA 2ZBKA 2VJ5A 1G3TA 3C2HA 4I09A 1B72B 2BY1A 4RAGA 4LD5A 3S32A 3S14J 4E7ZA 1RIOH 2XASA 3T0YA 1BA5A 2OTJI 1T56A 2E5ZA 2BW3A 2L2OA 1RPWA 2HTSA 4D9JA 3RD3A 3S1RJ 3TW7A 1BIAA 2R7TA 1QNTA 3BY6A 2R5ZB 3CO6C 2E1OA 2FUG2 2QOPA 2BEOA 4C2MJ 3OIQA 1PP7U 4Q47A 2MC4A 3TW6A 1WSUA 3LSRA 4XOTA 2D5VA 5LGTA 2PFBA 1QU3A 3E7LA 3DU6A 4YIIA 4BBRJ 3IKVA 3L2CA 1PP8F 4D0PA 3QP6A 2VT3A 2DO7A 2Y69H 2W57A 3MN2A 2F2EA 3I4PA 4YFNF 4IHSA 1O3QA 4AC0A 2F5CA 5K5QA 2HYJA 4BJTA 1BJAA 2CSOA 3GBGA 3E3VA 3WTSC 2Z9OA 5KCMA 2KDZA 2M5WA 3Q9SA 2VONA 3CLQA 3JRAA 2W1OA 2KPMA 3Q0VA 4ZDPA 4E6KG 5EEAA 2HZDA 2DW4A 2LKXA 4NHJA 2HU9A 2IGMA 2XB0X 3L2VA 4EJWA 4GFKA 2LLKA 3CUQA 1JUMA 1FMWA 1J0RA 2H6CA 4UB6C 1G3WA 5IP7J 1FOYA 3DPTA 1L3LA 1IRZA 2DG8A 3IWFA 3OYIA 3H9QA 1F4KA 1QA6A 4G8XA 2LY2A 2R7WA 2Z99A 1QZZA 4ZYGA 2DOAA 3CJNA 5K7ZA 2EB7A 4IVNA 1HBXG 5J40A 2KP6A 3AQSA 2ESNA 2HNHA 3HUGA 2QEXI 2DLLA 1U9OA 2LC2A 2Z16A 4YIRX 2A3SA 2K9NA 3OYHA 2HR3A 5JR3A 5ILSA 2EV0A 4HV6A 4UV9A 2QQ8A 1X58A 4I2OA 1VQKI 3HOSA 2X0LA 3H3ZA 2QVOA 2QBYB 2FBQA 2REKA 4MNUA 2LY9A 1ZGWA 2ZCMA 5HODA 1QVTA 2CO5A 1S29A 3K70C 3LA2A 1YG2A 3BR0A 5BNGA 2KZGA 4I99C 3ON4A 1X1PA 1X3UA 2ZJ2A 1JKOC 1OYYA 4BEHA 5BMZA 4RGRA 2DAOA 2WUIA 5GAHJ 3K10A 3CCVI 2FE3A 3TP3A 2L9NA 4JKZA 2K40A 1EH6A 4V2FA 4Y52J 2PG4A 4U87A 1IJWC 4B1RA 3HTIA 1ENHA 3VYTB 1DP3A 2ISZA 1BC8C 2V4JC 3DF8A 3L2QA 4BQNA 2HKOA 3Q0WA 3IAS2 2YS9A 4HOBA 4UDSA 3EUPA 5DD8A 5LRRA 1OJLA 2RREA 2E2HJ 3B81A 3DLLF 5D5VB 4AU7A 4YELA 1GT0C 3TGNA 3EGQA 1KGSA 1FZPB 2UXPA 4P9FA 2A05A 5AIQA 4CZZA 2HI3A 4M3GA 3S15J 2L9VA 3ZQ7A 3FXLA 4M9XA 2E2JJ 2JA5J 2ZSHB 2Q24A 3VW1A 3P9TA 3S2HJ 3FDYA 3IL2A 4BE1A 5FKMA 5M5YJ 2PEXA 3HKZN 3BJAA 2PLYA 2W00A 3E7QA 3GXOA 2HOTA 2GFNA 1WI9A 4XOPA 4IX7A 5K1YA 2EH3A 2O03A 3ZMTA 2M45A 3TO9A 4CGRA 2V6EA 1QO0D 3TOBA 1M1EB 2DK8A 3FISA 4ESFA 2H1LA 4GCVA 1XDUA 4HNUA 4JYKA 5LGUA 5GADJ 2FBIA 5HVQC 1MBKA 1BI1A 3S1MJ 3RH2A 4XLPF 3ZQFA 4N4NB 3HC7A 4F55A 5HNHA 2L01A 1DUXC 3ERMA 3GF2A 1H89C 1A35A 5HLIA 3GTKJ 2WV0A 1B59A 5E1ZB 5K5OA 3HOXJ 2JUCA 3LA3A 3G56A 2P8TA 4YEJA 3HGGA 4PJJA 4BKXA 5E20A 2UXXA 3DQVC 4XNFA 1Y8QB 3IRRA 1A6QA 3BR5A 1T08B 5FKNA 4EVIA 4FT8A 2VC0A 2W48A 4C2UA 4LIUA 1RESA 4XLEA 2WAFA 3WGHA 1MMSA 1J09A 3WE3A 2MC3A 3RKWA 2ID3A 2XDNA 3VVXA 4KIBA 1WH5A 3BZKA 4DW6A 2R7SA 2Y0SN 2DN0A 3ZMSA 3CDHA 4M6YA 4YFKF 4AIKA 4BJ6C 3M4OJ 1YIOA 2DQRA 3WU0A 3BNIA 2XKOA 3FZVA 3I64A 3C3WA 1RC9A 4RAZA 2XHKA 2QM3A 1MBEA 3CD6I 2QWTA 1W5CC 5B1AH 3LA7A 1AWCA 1D0YA 3AG2H 2HYTA 3ECHA 1YITI 1ZH5A 1ZQ3P 2BE5F 2M3AA 4ZJZA 4NELA 2IS1A 1TTYA 1OPCA 1NK3P 3M07A 5DCMA 2BVLA 2G7HA 3LNQA 2M0MA 2Y31A 2IRFG 1PUFA 2TDXA 1A6IA 1MMNA 1LDJA 1XGMA 2Q0OA 1S6LA 1WH7A 2V1DA 1HW2A 3C2BA 1XGNA 4KNYA 3ZQQA 3COAC 1LUJB 5CPRB 4BH9A 4KISA 4LK1F 3CMMA 1YFHA 4U0YA 3PQKA 3HKZA 2CG4A 1POGA 3MQ0A 1LDKB 4G7OF 1WRJA 2DBBA 3DP7A 4KJZA 2Z5UA 3KLOA 5DYMA 5JLWA 2R7OA 4KMUX 3RSNA 4PSWA 2DA3A 3A4CA 3NAUA 5LBQA 1T8IA 1SFUA 1MJAA 1X1BA 1WFXA 1UG2A 2JMWA 3MEXA 4NC7A 4ZYHA 5M5XJ 3VOEA 1SVOA 4FETA 4S05A 4A3FJ 3HTSB 3PUFA 2VOOA 2VE9A 3HTAA 1Y8RB 1TW2A 1OCRH 3DBLB 3ZMUA 4OAZA 1FEXA 1YW8A 2XF5A 3TDUC 4OD4A 4MQ9F 3CCEI 3OYEA 2V9VA 4EEFG 1ZELA 4YRVA 2JVGA 3A03A 4LK0F 2CV2A 2VQLA 2ZXWH 3KP7A 4HEA2 1JKRC 3LWJA 3FF5A 2QTQA 5M3FJ 5ERIA 2KIFA 2LBFB 4BAYA 3NS4A 4PSXA 3A2KA 1XC5A 1GV5A 4QPQA 4HA8A 3KZ9A 3FX3A 2FMYA 4B44A 1EV7A 1F9NA 3HRTA 4ENKA 3ANPA 2EPFA 3BT9A 4UV8A 2M1BA 3D5RC 4L9NA 4CSWA 4IHWA 2W85A 1WGXA 1T39A 5E8IA 2HGCA 5TGTA 1OFCX 3BQZA 1UMQA 4FE7A 3KP2A 3OYGA 1T0FA 1BI3A 2P6TA 2DT6A 1DQUA 1MNDA 3GW2A 4MLOA 2KT0A 2EIKH 3WHCA 4E4HA 4XSZF 4ESJA 2XRLA 4IHVA 4IRHA 4CUGA 1MH4A 4R1HA 4BXUA 3M8EA 1OR7A 2A5YB 1TQIA 3LJLA 4O5VA 4BY1J 2R4GA 3JTGA 3F1BA 5DCFA 4PJ0C 1UHMA 1W7PB 1YYVA 1R23A 4O6JA 3FK6A 1QHGA 1FNNA 2M30A 4UVBA 3NWSA 4GCTA 3RQ4A 5F1JA 1D0XA 3FXMA 4HPQA 2W7NA 2DTRA 2P5KA 1YX3A 4II3A 4DBQA 2F4IA 3NRVA 5E8GA 1R58A 1FWZA 2X51A 3VEPA 1JGGA 5LRSA 1JT0A 5LEJA 1BW5A 4GXOA 1V5EA 1V5GA 2RQPA 4IRGA 3OYNA 5BQTA 2H6BA 2WY8Q 3K9TA 3IKTA 4ZDOA 2FOKA 2XF6A 4M73A 4ON0A 1MBJA 2H8WA 2NVUB 3ZRGA 1BC7C 2PZ9A 2HZTA 1FYKA 1ON1A 4ESBA 2D1HA 1ZR4A 2B9SA 1AU7A 4M9ZA 2STTA 5JFRA 2VBZA 3LFKA 4EMSA 5KK1A 3BTLA 5J47A 1GDTA 2UXIA 2L54A 3IP4B 3GFMA 3HRMA 4W1UA 1HF0A 2DDBA 1BW6A 3LSPA 4DQ2A 1KU9A 4DYRA 3RZOJ 5J8FA 3P9CA 3DTKA 5TISC 1C0WA 1LNWA 4RM3A 1UI5A 1J75A 2MD0A 4YG2F 2H8RA 4L0YB 4GDFA 3HHGA 2JK3A 2QKLB 1QPIA 4FTHA 2NS7A 4BU2A 3GWZA 1SEUA 2UUZA 4U9NA 5J4YA 3NNRA 1STZA 2V9PA 1Z91A 2XSDC 3U21A 1USSA 2NOGA 4XRSG 4X6AJ 2EZIA 3KYCB 3HYIA 5FGLA 1EF4A 4UXNA 1T0FC 1BOAA 2KZVA 4D7NA 1ETXA 2FSWA 2Y30A 5EZGA 1P7IA 3LAJA 3CMYA 1XS9A 2OBPA 3L1PA 4I76A 2R5ZA 2DA6A 4RB1A 2AS5F 2QQBA 2V1UA 1MJ9A 2G9WA 3HIFA 3R61A 4XSXF 5IY5H 3GTLJ 1N78A 4J00A 2K3FA 2LR8A 1IXCA 1NG6A 2A6TA 2JUGA 1ZR2A 3ZQLA 4F91B 2R7DA 1SFOJ 1OCPA 2CW7A 5J1UA 2KIUA 1WJDA 2QCOA 3RKYA 2G0EA 3VUQA 3ABTA 1R5ID 2DODA 3H0DA 1BL0A 2LSOA 1Z77A 3PNYA 1F5TA 2DA2A 3VPRA 2K02A 2WWYA 3FBNB 5IYCJ 1YHQI 3WTWC 1BIBA 2ZFUA 4XRFA 3TKYA 1PVEA 4Y33A 2STWA 3RPQA 2G7SA 2KJBA 3I3LA 3IHUA 4LB6B 1HOMA 1Z6TA 2FF4A 4U9LA 3QYBA 2E60A 4DZJA 3BHQA 1N77A 2JWTA 4IL6C 2FJI1 4OIRF 4W97A 2DA4A 2QSFX 3VP5A 2P0WA 3MWMA 3G6EI 3JSJA 1UCRA 4B09A 1I6HJ 2CQNA 4AVPA 3VDXA 3I9V2 4A3DJ 1ZAOA 1J7KA 3V7CA 2O5RA 1MMAA 2PMZA 4HSRA 4HQEA 2VXDA 5TRDA 2OZUA 4QSHA 2RASA 3U1DA 5BOXA 1Y1WJ 3KYLA 5AQCA 5HLGA 2F4MB 2FNPA 4KFCA 1WJCA 5H6RA 1FTZA 2LY1A 2JZYA 2KHMA 2HDDA 3K4LA 3M9AA 3GZIA 4A5NA 4HNTA 4RAYA 4CGZA 2HYFA 4HLXA 5CJ9A 4L62A 4LITA 1FOKA 3B73A 2EFOA 2OA4A 2UXUA 5L3DA 2ZXIA 2EFWA 2R5YB 2F5DA 2GM4A 3D5SC 2L7ZA 3M8JA 3BJ6A 5D4SA 4Z2YA 1I5ZA 3S8PA 3A01B 3S3MA 2R7VA 2HDCA 1FT9A 4XN3A 3JRBA 2O3FA 3HSFA 2W84A 3CQZJ 3WHBA 4EJTA 2R5YA 1FSEA 4RB0A 2PMUA 3HSRA 3SJMA 2CQ7A 4XORA 2HQAA 5E17F 3COLA 4ICHA 3GX4X 4A3CJ 1ETOA 2BY0A 1FBUA 3IH2A 1R1TA 1ULYA 1MMDA 3TQNA 4P55A 3NI7A 2QUFA 2CQKA 1S5LC 3C7JA 1U8BA 2FA5A 3GEUA 5CXIA 2IXSA 3GCMA 1U0JA 4JL3A 3HRUA 3TP0A 3F0CA 1R9TJ 1QZEA 2WB1N 1TZLA 1XMKA 3CO7C 3CMAI 2GOXB 5FLVA 5K58A 4F52A 1X1DA 3FXUA 1S3JA 1SD4A 2F5FA 2OUMA 1VQLI 3GMEA 3FHNA 5DM6F 4X0GA 1LEAA 1MGTA 3HUGB 1FSHA 1F1ZA 1E17A 4Z6YA 1ETVA 1I27A 5LHGA 4RMNA 1IRFA 2DCEA 2ZXHA 4IEJA 1LVAA 2GXAA 3W3CA 3I71A 2Y0MA 1Q1VA 2Z1DA 3L09A 3HTUA 1OMIA 4ZTJA 3BCGA 2KJCA 3TL4X 2HOEA 2DA1A 4BEHB 4C30A 2DFFA 3RYPA 4TV7A 3BG9A 2UXOA 4XLHA 1VQMI 1T2KA 4U7DA 2VKHA 5ICFA 3VSKA 2HTJA 1VQNI 4L9TA 1P4WA 4BJ5C 2HPMA 3CLOA 1YS6A 2LH9A 3RQIA 1WJ5A 1Y0NA 1YE9A 1U2WA 2CMPA 4MGRA 5JHFA 5KHDA 1IC8A 3P9IA 2Y0SA 2PMHA 3BPVA 3CP2A 3RYRA 3U2RA 4IHYA 2OCCH 3E5XA 3OYCA 2A61A 2Y75A 2X85A 2J5OA 1ZG3A 3MKWB 4LB5A 3HOUJ 5HDNA 1WVRA 1RKTA 1MNEA 1TQMA 4ZC3A 1YJWI 5IYBJ 5DUKA 4FQGA 2UV1A 3CTAA 3MKLA 3NXCA 4DOZA 2DJNA 2JSPA 4N0BA 3EDPA 3DPUA 3RIRA 3WTTC 1EH8A 3QAHA 2XPVA 1FJLA 2V9KA 2EFQA 4IZZA 2HXOA 1G2HA 1D5VA 1DDNA 4XICA 2LF8A 2YUSA 5CVUA 3G71I 3KKDA 1QVUA 1IV6A 1H9GA 4MHGA 1J5YA 1SAUA 4HNVA 2HOAA 5HDGA 1A04A 2QQ9A 3LWFA 1KONA 3PASA 4PZJA 1LEBA 4MK6A 1R6RA 4ZTFA 4GCLA 2V1XA 4F93B 2F48A 1JKQC 3U9GA 3JRGA 2A2FX 4OIQF 5E79C 3OL4A 2HOSA 3RCOA 3HGYA 3HDDA 4CDGA 2QKOA 5H20A 3UKGA 1S9HA 3KCCA 4OOIA 2X1CA 1BR4A 2CW8A 1MDMB 1XN7A 1D1CA 1DPRA 1I1SA 1XSDA 2CGPA 2QZ8A 3WG7H 4QIWN 5EZHA 3KPHA 3DEEA 4QWQA 2BOLA 4XRSA 3KKCA 1W36C 3OSGA 5HNFA 2QSHX 2L5QA 1P4XA 5IT9Z 3QQAA 4IPAA 3S16J 3ON2A 3I59A 5EF6A 6PAXA 3NEUA 2FQ3A 3R6SA 1CGPA 3LAPA 4MTEA 3AKZA 2F5VA 4PFPA 4JX6A 4XIDA 3BG5A 4ABZA 1KYWA 2UXNA 4ASNA 1APLC 4PJNA 1R00A 2E1MC 5FO5A 1Z1DA 1JTYA 3P7NA 4AC6A 5L3CA 2P5VA 2IU5A 4AD9A 2ZOYA 4I98B 3ELKA 3EUAA 4DYCA 1TW3A 5KAIC 3CCLI 3ESWB 4GCKA 5LEKA 2R7RA 3S1NJ 5F0HA 3SQNA 3LSTA 1O57A 1J59A 3GTJJ 1IUYA 2VJ4A 1I3QJ 4ETSA 1R4NB 3PO2J 3VW0A 4A0XA 3M1EA 2Y48A 2VBXA 3ERED 2CQQA 2Y9YA 5HS7A 4UUVA 2KL4A 2R7FA 1I50J 3N4MA 3GZNB 2E35A 1JGSA 4BE0A 4G6DA 3CUOA 3C07A 4P1WA 4OIPF 1I39A 1HW5A 2QYOA 3ZQIA 1IG7A 2IT0A 3AFHA 4HLYA 4Y17A 2IEKA 4E7JA 2BY3A 2Q2EA 4YIFA 3F8NA 2IAIA 4PGHA 4BHBA 1S8NA 2D45A 2Z2SB 3WGGA 2BBYA 3OYKA 1HLVA 3NPIA 2PBXA 2L7FP 3V42A 3IH3A 1LPQA 2BVMA 3FHZA 4KICA 3SZTA 3JRHA 4IO9F 2R7ZJ 1V55H 1TBXA 3W6JB 2CFOA 4XLFA 4M6VA 5FGMA 1OISA 4I6ZA 5GPAA 3BCAA 2LYCA 1X1AA 3A0BC 4BQQA 4B8XA 2GUHA 1U5TC 3MKZA 1A5JA 1RETA 4F3QA 1BI2A 4Q48A 4KYWA 4HDVA 3F8CA 3ASOH 4AVZA 3PO3J 3S2WA 4B3AA 4DNCA 4C2TA 4A93J 2P81A 5EEHA 2L9SA 2JA2A 5KNLA 4ME9A 1X19A 1X4PA 3CWRA 4JOMA 3N05A 2PQ8A 1W4MA 2VIXA 2M8EA 4HV5A 1VNDA 3QKXA 3VSLA 3J80K 5C4YA 4L0ZB 5LGNA 5A2QZ 2DMQA 3M8FA 2OV7A 3GVAA 2K4BA 5L3EA 4KITB 1ZKGA 2M2EA 3CCUI 3IUVA 5AONA 2DTZA 5LLQA 1UHWA 5D5UB 4ZH4F 2XSJC 3CCQI 2LKSA 2NS0A 3IAM2 2MA3A 2M7BA 3QPLA 3MD2A 3BCBA 4KWAA 3VOXA 2RNGA 2K85A 1HKTA 4S04A 1USTA 3PFIA 1R22A 2CJJA 3F6OA 2V6CA 3OYLA 3CCYA 3FMRA 3HPGA 3HOZJ 3D5LA 3S17J 4EJVA 4WK8F 5IYDJ 3ONQA 4FASD 2C6YA 2OZ6A 1KU3A 2EFNA 2FRHA 3KZIC 3NQOA 4RA2A 4A0ZA 4Q4ZF 1NK2P 1TC3C 3J7AY 1IN4A 2IGOA 1Y6IA 3OWTA 1D1AA 4GYIA 1K6OA 1K83J 4QLCU 5ILVA 3H3VK 4E7HA 2H27A 2G3BA 1ZRDA 3WG9A 2ZY9A 1MBGA 3I54A 1O3RA 4MIMA 5GPCA 2ACJA 1MBHA 3JRCA 4HDUA 3O8HA 3ZQHA 3V8JA 5H9TA 3I0TA 3L00A 5GP9A 3E6CC 3HJEA 2BXYA 3OR2C 2BV6A 1GXPA 4OIOF 2EA4A 1DU6A 2ID6A 3E6MA 3JW4A 4Y13A 2A07F 2RHAA 2M0CA 2XAHA 3Q9VA 4EJUA 1E3HA 1AKHA 1UB9A 3DBHB 2N8GA 4NNJA 1JHFA 2COBA 1D1BA 4LOCA 2VJJA 2EZLA 4IOCF 2HS5A 4NC6A 2RAEA 1WJEA 1K78A 1NH3A 3BR6A 5DM7F 3KEOA 4IQJA 3HBLA 3PSFA 1RUNA 3LQRA 4RB2C 4AYBN 2VBWA 1HSJA 2VKDA 1J9IA 2Y2ZA 1UHSA 3TEDA 4G6QA 5A2QK 4N4OB 3JR9A 4XN0A 4RB3C 4J01A 3J80Z 2DA5A 3BG7A 5H6QA 1R7JA 1DPUA 2DOFA 5F27A 5F0FA 1VQ5I 1E3PA 2D1VA 4XLCA 1CF7B 2HFHA 4XKBA 3S1QJ 5HOOA 5CVJA 3IV5A 2DU9A 2ZCWA 1XGOA 5D5XB 4MEYF 1ONVA 2HDWA 1LVKA 3G1MA 2HVRA 2KRHA 3T6NA 2E19A 3BLYA 3DXJF 1W7PD 1B9NA 4BYYA 1S7OA 1O7FA 4M3FA 2XVCA 4M3DA 1T38A 4LG3A 2R92J 2OF7A 2FQ4A 2O9LA 3BG3A 2CRGA 2LF7A 2GENA 2QENA 4KN7X 1ERDA 1B1BA 3F72A 3ISPA 2ZJRF 1AA7A 2WB1A 3V78A 3V4GA 2JA6J 3CCSI 4RGSA 1I6XA 4U0WA 4CCNA 4LG0A 3GYHX 3DKWA 3SHFA 2L4MA 1GUUA 1FC3A 1ZTRA 4XMYA 2O7TA 2IA1A 1G4DA 2IPQX 1W0TA 1PJRA 1YQAA 3EQLF 1SD7A 2R0QC 2QLZA 4HX7A 2E2IJ 4NBQA 4HX4A 5IT9K 4UY8I 1WPKA 2ELJA 5EFYA 1SVMA 3RZDJ 3RTRA 3CC2I 1WWXA 3GLLA 3MVPA 4L5IA 2NNNA 3ZMZA 3QOPA 5CQGA 1PDNC 5HLTA 3PIPF 4KA4A 1TL8A 4LLGF 2IS6A 2RNJA 3BR3A 3OYAA 4U7BA 3E5QA 1HSTA 1RR7A 2FX0A 3K69A 2MBFA 1IRXA 2GOMA 3K4KA 1YJNI 3CUQB 4N9HA 1PUEE 5KVRA 5L3FA 2YX4A 2ZFWA 3GTMJ 4LMYA 4EGZA 2HVQA 3OSFA 3PPBA 5LHIA 3HIMA 2YSRA 4BUPA 4K2EA 3OR1C 1KQ0A 5FJ8J 2I8DA 2L9RA 1NTCA 1R5GA 4UNOA 3MFKA 2VI6A 4CH7A 2K5CA 1E3OC 1E0EA 3BPXA 2PI0A 2NP3A 3LSGA 3K2AA 4HX8A 2ZKZA 3CJRB 2XGCA 3GTQJ 4MFDA 3W6VA 4G7HF 2M4GA 1VQ8I 3QBMA 3A01A 3PJRA 3V8KA 4BXFA 3J7YJ 1FOXA 1AHDP 3FXJA 2NNYA 2OD5A 2G7UA 3OOUA 3TOAA 3O6BB 1IZ1A 3QWLA 4O3MA 1AOYA 5FKLA 2ECCA 3TMOA 1GVJA 3J81K 1YI2I 1UELB 2K4JA 4H0EA 2ZXJA 2HPIA 5E1WA 1Z9CA 2BYVE 5HS8A 1R49A 2E5NA 3OL3A 1MH3A 4XL9A 5FD5A 5FMPA 3R0JA 2NOJB 4PXIA 1FOWA 3DEWA 5FKKA 2XAFA 3D1NI 5J8CA 1F43A 4BXXJ 3CRJA 3HOTA 3BG6A 3CF2A 3HHHA 4GRIA 1TNSA 1TNTA 2R7XA 2XAJA 4M71A 3ZGKA 4PK4A 1ZREA 4M74A 1XCBA 3HTJA 4MFEA 1TT5B 2X9DA 5E3OA 2E36A 2QGUA 3I4MJ 2FD5A 3VYUB 4I0AA 3WU2C 2UWMA 5CQEA 5DCMB 3DKYA 3I58A 2ESHA 1FBQA 1XMXA 2EWNA 3IWZA 3SZGA 2KFDA 3QPSA 2CUFA 2IBDA 2P5LC 3RKXA 1O3SA 1ZRCA 4A3KJ 2K9MA 3DV8A 3AG1H 3FXOA 2YVHA 3CCMI 1JHHA 4A3BJ 3REOA 4CICA 5FFZA 4ENJA 3WTVC 4II2A 4HRIA 3I55I 2XAQA 1P6RA 1ZK8A 2CW0F 2OU2A 4CYCB 1H0MA 4L18B 5FLXK 2GA2A 1LDDA 3KEYA 4ZYEA 2DI3A 1SANA 3G3ZA 1RUOA 4BQAA 4IHXA 3WU1B 4OMZA 2DDAA 4XRMA 1VQ4I 3AAFA 1SMYF 2RDPA 4G12A 2D2WA 2J5PA 1V3FA 3SDGA 2QWWA 5K5RA 2KKOA 2WBMA 4BL0B 1ETWA 3K6GA 4KIGA 4PJMA 4RLFA 2WADA 2OQRA 5E3NA 4JNNA 2BGCA 5D1RA 2RGVA 1Z7LA 2AHQA 4OD5A 2KIMA 1IN6A 1SD6A 3KYDB 4ITVA 3K70D 2A68F 1RNLA 3IC7A 3GTOJ 2L7KA 2VOPA 2ICWG 3FXKA 5F1RA 4A5MA 1U5TB 3H0GJ 5E3MA 3LFUA 3ZR8X 2GLOA 1YW9A 1LKXA 4RM2A 1DP7P 5LD2C 3PL8A 1JI8A 2CH0A 2KRFA 3P5JA 2WGBA 1FBSA 1BJZA 1ZARA 1TWFJ 2Z3YA 2L3DA 3BJBA 2HYGD 2DFEA 5FD6A 3HOWJ 1WJBA 2BHYA 2LP0A 3QYEA 2YX7A 5CVRA 5HSZA 4EJOA 3OMYA 4OAYA 3GFLA 2EQRA 4XKWA 4E7KA 3DPLC 2CV0A 5D8LB 4ZZLA 2ZJPF 1SMTA 4D5FA 1ZLKA 2YVEA 3O60A 4M6XA 4HKUA 3KP6A 5E3LA 1MD0A 3HSEA 2OC6A 3LSJA 4BHPA 4EM2A 1JUPA 2DMTA 1IF1A 5DS9A 4PUSA 2OAZA 3KIOA 2VASA 5IPAA 1H8AC 4OINF 5D4RA 2CUJA 1JT6A 4PDKA 2ME6A 1SFXA 4WWCA 4GGGA 3ZP5A 3PM1A 1W1WE 2WAEA 3GEZA 3G2BA 1OCTC 2VXZA 4AYBA 2VC1A 2X48A 4CCJA 4UUSA 3K4NA 2BHZA 5D8KB 2NXNB 1YRNA 1IAWA 3I53A 2V79A 2IJLA 5HLHA 5DD4A 1HKQA 4XK4A 2ME0A 3BTJA 2NX4A 3IRQA 3PUBA 2DMUA 1T98A 4A0YA 2E34A 3Q5FA 1X2MA 2BXZA 4WX9A 1B72A 1ETQA 1LQ1A 2IVMA 2X4HA 3EYYA 1LB2A 3AG3H 4A3EJ 1A36A 3E5UA 1WI3A 2YU3A 1FYMA 4A6EA 2E71A 5D6EA 4EM1A 2CUEA 4B43A 1N25A 1Z6RA 3ZN0A 1L0OC 2MFZA 1U3EM 4NN1A 1P7JA 1DGWY 3W2VA 1U8RA 2MYSA 2M34A 2CFXA 1H88C 4WIBA 1N75A 5HBUA 1VI0A 2ISYA 2JPCA 2LBFA 2ZC2A 4AIJA 1Y39A 2ADUA 1OYWA 5KAFC 3FXQA 5B5EC 4G6TB 3AL0B 2AQFA 5B1BH 4JK1X 1XB4A 5M3MJ 4EQQA 1REPC 3E6DA 2OCEA 1UI6A 3AG4H 4P96A 3JSPA 2ZJQF 1V54H 3A1YA 4OMYA 2OPTA 4KT5C 1JXSA 4F92B 2COMA 3SZPA 2EJRA 4CA0A 2W25A 3E1SA 2Q8KA 1ACIA 1TQPA 3ABKH 4J19A 4H4KC 4RLQA 3I56I 1FPQA 3VIBA 2HKXA 2NVQJ 1O7LA 2V57A 4NB5A 2JQ7A 3FXRA 4BHCA 3ABLH 2XIGA 4UB8C 2XROA 1QRYA 2E1MB 2KMUA 1NG7A 2HQNA 3J7ZI 3ULQB 3C1DA 1WZ2A 3G7RA 3DTIA 4V19K 2XDVA 3QU3A 4WXCA 1IXSB 5L3GA 1YJ9I 3O8GA 5JI6A 4CCLA 1VFCA 3QPHA 2KLOA 2I5UA 3BTCA 4PCQA 4WXHA 3S5RA 5EGOB 4NC8A 2GBYA 3TBIA 2V1NA 3ABUA 1E2XA 1XD7A 3GFJA 1HKSA 2PFVA 2H09A 4PGGA 4FHTA 4M3BA 3HEFA 1BI0A 1MIJA 3DLAA 2VE8A 3MZ8A 3CC7I 2O61A 3JRFA 3LSHA 3CP8A 1JUSA 1ZG1A 2MG4A 2XPWA 4ZZDA 3S3OA 3K4JA 3HM5A 3MMYB 2BW3B 1T6SA 4CYDA 2KQRA 2MD5A 2R93J 3F21A 2XF7A 4GO1A 3OS0A 3MAJA 4A3MJ 3H36A 3OYDA 3SEQA 2JTVA 2UXHA 1PYVA 4KT6A 5ICEA 4S0HB 4JBAA 2XRNA 1Y0UA 1O4XA 1HA8A 2ZMEB 2QSGX 3J81Z 3K4BA 3S93A 5FRNA 1KQ9A 1YS7A 4A69C 5C4JJ 3S2DJ 2FMLA 4HQMA 2W24A 2JPBA 3FMSA 3VVYA 3Q3SA 2YU9J 4F7ZA 1FMVA 5FLMJ 1LFUP 2XUBA 2EZHA 1MDMA 2WC2A 2EK5A 3EUHC 2GXGA 4IRIA 2HWVA 2CQXA 1Z21A 1RRJA 3K1PA 5GTHC 5E18F 5GAGJ 2P7VB 3I5UA 1YX5A 2KISA 1D3YA 3OOPA 4RDUA 5CLSA 4XBFA 1R1VA 3QP5A 4YZEA 2AO9A 5FROA 1HQCA 4AIHA 3FK7A 1PUFB 4AWXB 3H5AA 3DFGA 3O2PE 2O8XA 4MEXF 5D5WB 3JTHA 4P9UA 3QOEA 1ZN2A 4A3JJ 2XGEA 4C9YA 1RI7A 3LQQA 2OERA 2R7QA 1FIPA 2KRCA 2RC4A 2QKMB 1K4SA 5F64A 1BN5A 3RI4A 5CXGA 2A6EF 3CCRI 5LFAA 1OCOH 2X1EA 4HF0A 1SFEA 3A0HC 2DA7A 1GV2A 1OLTA 4MQVA 4B47A 4CZCA 2JVHA 4BBSJ 5M5WJ 2XPUA 2F6CA 2VBYA 2O0YA 4U88A
chains in the Genus database with same CATH topology
2RHAA 3BTLA 2M0CA 1GDTA 2VUMJ 2UXIA 2XB5A 1AKHA 2ECBA 5EGOA 4W1UA 1HF0A 1BW6A 2N8GA 2MW8A 4X1EA 3LSPA 2G7LA 2COBA 5EDNA 2ZOZA 1LE8A 4LOCA 2EZLA 4DYRA 3RZOJ 2RAEA 1VF9A 2OI8A 2O7OA 4L5EA 1UI5A 1D5YA 3M3YJ 4D5CA 3BR6A 2H8RA 4A3IJ 3HBLA 2JK3A 1QPIA 4FTHA 4AYBN 1Y1VJ 2NS7A 2NS8A 2HQ5A 1ITYA 2WAQN 3MNLA 2DG7A 2JN6A 3NNRA 2Y2ZA 1UHSA 3TEDA 2XSDC 5C4XJ 3DCFA 3JR9A 2NOGA 4XRSG 5CW8A 4X6AJ 2EZIA 2Y9ZA 1B8IA 5FGLA 2DA5A 5IOZA 1EF4A 3NARA 5DTDA 4D7MA 1U78A 4D7NA 1ETXA 2Y30A 5F27A 2I10A 1U9NA 2M8GX 5F0FA 1IDYA 2MGQA 5EZGA 4BY7J 1P7IA 1TWHJ 3Q0UA 1XS9A 3CMYA 2ZOYA 3L1PA 4I76A 2R5ZA 2DA6A 3HTHA 2LK2A 2FJ1A 2B63J 3S1QJ 2QF7A 5K7FA 3GTLJ 3IV5A 1CQTA 2L7MP 2LR8A 1ZR2A 3ZQLA 3G1MA 3T6NA 2D6YA 2E19A 2L0KA 5C44J 1SFOJ 1OCPA 5F0CA 3KNWA 5J1UA 2QCOA 2G0EA 4M3FA 3VUQA 4M3DA 2R92J 3ZOBA 2OF7A 2FQ4A 5F08A 1GVDA 1BL0A 2O9LA 1Z77A 3BG3A 2CRGA 2GENA 3HE0A 3HOVJ 2DA2A 2LTPA 3VPRA 5IYCJ 3GTGJ 3V78A 2JA6J 3BQYA 1Z0XA 2G7SA 2X6OA 1HOMA 5IOYA 1GUUA 4DZJA 1B72B 3BHQA 1ZTRA 3B6CA 2JWTA 2O7TA 2XGDA 4W97A 3G1LA 3G1OA 5EYRA 1W0TA 3S14J 2DA4A 2R0QC 1BA5A 3VP5A 4C3IJ 1T56A 2E2IJ 3JSJA 1WPKA 2ZCXA 3CDLA 5FHPA 1I6HJ 5EFYA 3RZDJ 3LHQA 3MVPA 1RPWA 4A3DJ 3RD3A 3S1RJ 3TW7A 3BR3A 1FTTA 4QSHA 2RASA 2R5ZB 1RR7A 1Y1WJ 5AQCA 2HKUA 2FX0A 1IUFA 1FTZA 2E1OA 2HDDA 2QOPA 2EBIA 4C2MJ 3GTMJ 3GZIA 3OSFA 3PPBA 3HIMA 2O8KA 2K9SA 3TW6A 4L62A 4GFBA 3LSRA 5FJ8J 2D5VA 2L9RA 5F04A 1NTCA 3E7LA 2VI6A 4BBRJ 4UUSB 5J3LA 1E3OC 3FKIJ 2NP3A 2UXUA 3LSGA 3K2AA 2R5YB 2GM4A 2XGCA 3GTQJ 2L7ZA 4MFDA 3W6VA 3MN2A 3QBMA 4B4CA 3A01A 3A01B 4AC0A 3JRBA 1AHDP 2HYJA 3OOUA 3CQZJ 3WHBA 1MSFC 4A3LJ 1ETYA 2VPRA 3GBGA 2R5YA 1S7EA 5FKLA 2ECCA 3SJMA 2KDZA 3JRAA 3Q0VA 5K7HA 3BTIA 5EEAA 4A3CJ 3COLA 4ICHA 1ETOA 3IH2A 2LKXA 5IP9J 2WV1A 1MH3A 3B6AA 3NI7A 5FMPA 2XB0X 4PXIA 2NP5A 3DEWA 5FKKA 4GFKA 2LLKA 3D1NI 1F43A 1JUMA 1U8BA 4BXXJ 3CRJA 3GEUA 5CXIA 1JJ8C 5IP7J 9ANTA 4JL3A 1IRZA 3TP0A 2DG8A 3F0CA 1R9TJ 3K7AJ 2WB1N 5FLVA 5K58A 3HTJA 4MFEA 5K7ZA 5C3EJ 2X9DA 5E3OA 3ZQGA 3I4MJ 2FD5A 1ORKA 3AQSA 2HXIA 4ACIA 1U9OA 2K9NA 1ETVA 1X58A 4IEJA 3QPSA 1JJ6C 2CUFA 5EG0B 2IBDA 2FBQA 2REKA 4A3KJ 1Q1VA 2LY9A 1ZGWA 2ZCMA 3BCGA 4JP0A 5HODA 4FCYA 2YVHA 1QVTA 4A3BJ 2DA1A 2MSYA 3BR0A 5BNGA 2LD5A 3BG9A 1ZK8A 2NVYJ 4CYCB 4CYCA 2UXOA 3ON4A 1SANA 1JKOC 4IHXA 2JJ7A 4XRMA 4G12A 2NVXJ 2WUIA 3VVZA 3SDGA 3FIWA 3TP3A 1ETWA 2K40A 4JKZA 3RQIA 4V2FA 4Y52J 1IJWC 4B1RA 3ANGA 5E3NA 3FRQA 4JNNA 3HTIA 5D1RA 1ENHA 1IC8A 2AHQA 4IHYA 3Q0WA 2YS9A 3GTOJ 1HDDC 4UDSA 5J1YA 2TRTA 3RKQA 2NVTJ 3EUPA 3H0GJ 1OJLA 5E3MA 3HOUJ 2GLOA 1RKTA 2E2HJ 3B81A 5IYBJ 2H1KA 3MKLA 2WGBA 1GT0C 3NXCA 1MBFA 1BJZA 1IDZA 3EGQA 2UXPA 1TWFJ 2DJNA 3S15J 2HI3A 4M3GA 3BJBA 2E2JJ 2JA5J 2XPVA 1FJLA 2Q24A 3HOWJ 2JA8J 2ZCNA 3VW1A 1FIAA 2LP0A 2HXOA 2ZB9A 3S2HJ 1G2HA 3P9TA 5FKMA 5M5YJ 3HKZN 1DU0A 4XICA 5HSZA 5DAJA 2YUSA 1TWGJ 2EQRA 3E7QA 2HOTA 2GFNA 3KKDA 1QVUA 4D5FA 1IV6A 2YVEA 2EH3A 3O60A 4HKUA 4HNVA 5E3LA 3NRGA 2HOAA 3LSJA 4CGRA 1JUPA 2DMTA 3FISA 4C3HJ 3PASA 5DS9A 4JX4A 4MK6A 4GCLA 4JYKA 2PMZN 5IPAA 3S1MJ 3RH2A 1JKQC 1MBKA 1H8AC 3JRGA 3ZQCA 3ZQFA 1JT6A 2ME6A 1LFBA 4JX5A 4UUTA 1H89C 2HOSA 3HGYA 3PM1A 3HDDA 3GTKJ 3HOXJ 3UKGA 2QKOA 3G56A 1OCTC 3HGGA 4BKXA 2DMNA 2X48A 4UUSA 1LE8B 1WCMJ 1YRNA 3BR5A 5FKNA 4QIWN 5EZHA 2W48A 4XRSA 3KKCA 3OSGA 1RESA 4XK4A 3QQAA 4RBOA 2ME0A 2LVSA 3BTJA 2ID3A 2NX4A 2XDNA 3VVXA 4DW6A 1WH5A 3S16J 2QIBA 3ON2A 2DMUA 5EF6A 2Y0SN 2DN0A 1X2MA 1B72A 1ETQA 3M4OJ 3BNIA 4A3EJ 4JX6A 4XIDA 3BG5A 4ABZA 4MXMA 1APLC 3V6GA 3BRUA 2QWTA 1MBEA 1WI3A 3A02A 4MO7A 5EG0A 1JKPC 2HYTA 3VW2A 3IH4A 2CUEA 5FKOA 3JRIA 1JTYA 5J1RA 1ZQ3P 4AC6A 4NELA 4NN1A 1NK3P 1P7JA 3LNQA 2M34A 2Y31A 2IU5A 1PUFA 1A6IA 1H88C 4DYCA 5HBUA 1VI0A 1WH7A 1MNMC 3C2BA 3HB9A 4GCKA 2LFBA 3S1NJ 3BR2A 5F0HA 1UI6A 3GTJJ 1YRNB 3BR1A 5M3MJ 1I3QJ 1HCRA 3PO2J 2W53A 3VW0A 4FE4A 1POGA 3HOYJ 2OPTA 1RKWA 2CQQA 2Y9YA 1I50J 1X2NA 5JLWA 1B8IB 4J19A 2DA3A 3NAUA 3C07A 3VIBA 4AUXA 2NVQJ 3JREA 2V57A 2JMWA 1UG2A 3ZQIA 4A3FJ 5M5XJ 1IG7A 2IEKA 3HTAA 1QRYA 2IAIA 3SFIA 2G7GA 1FEXA 1T33A 3G7RA 2VKEA 1HLVA 3NPIA 3JRDA 4EEFG 2PBXA 3O8GA 1JTXA 2L7FP 3IH3A 3A03A 1VFCA 1SGMA 3BTCA 3S5RA 3JRHA 1JKRC 2M9HA 4FISA 4C3JJ 2R7ZJ 5EGOB 3LWJA 2GBYA 4M6VA 5IP6A 2QTQA 1HDPA 5M3FJ 4I6ZA 5GPAA 3GTPJ 1XC5A 1GV5A 4M3BA 3HEFA 4M3EA 3KZ9A 1MSEC 2GUHA 3JRFA 2F07A 1A5JA 3ANPA 1RETA 1JUSA 2MG4A 2XPWA 3BT9A 1AKHB 3PO3J 4A93J 4B3AA 4IHWA 3HM5A 2P81A 1WGXA 1OFCX 3BQZA 1UMQA 2R93J 4FE7A 4ME9A 2CU7A 3CWRA 4A3MJ 5D19A 4MLOA 3CJDA 2KT0A 4V2GA 1TWCJ 1VNDA 3WHCA 1W0UA 3QKXA 2UXHA 5C4YA 2XRLA 4S0HB 4IHVA 4GFLA 1O4XA 4NDLA 1MH4A 2DMQA 3OIOA 3DPJA 3VOKA 1ZKGA 3LJLA 1ETKA 2M2EA 4A69C 5C4JJ 4BY1J 3S2DJ 2DTZA 3IUVA 3F1BA 3VVYA 3Q3SA 2YU9J 2VKVA 3QPLA 5FLMJ 1LFUP 4KWAA 3AQTA 3VOXA 3FK6A 2EZHA 2CJJA 4GCTA 2CQXA 4DZPA 5F1JA 3CCYA 3HOZJ 4DYQA 4RDUA 3S17J 1TWAJ 5IYDJ 4YZEA 2AO9A 5JLXA 1NK2P 4A3GJ 2ELKA 3FK7A 1PUFB 1TC3C 5D18A 1JGGA 1BW5A 1K61A 1JT0A 2EZKA 2XGEA 4A3JJ 2OERA 3H3VK 1K83J 1XG1A 4Y7NJ 1FIPA 2G3BA 2K9QA 1F36A 3I4NJ 5CXGA 2JA7J 1MBGA 4AF5A 4MIMA 5GPCA 3LOCA 1MBHA 3JRCA 1MBJA 3O8HA 4QTRA 3ZQHA 1IGNA 2DA7A 2PZ9A 1GV2A 5H9TA 2TCTA 5GP9A 2DMPA 1ZR4A 4BBSJ 1AU7A 1DU6A 5M5WJ 2ID6A 2XPUA 5HAWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RHA A;  3BTL A;  2M0C A;  1GDT A;  2VUM J;  2UXI A;  2XB5 A;  1AKH A;  2ECB A;  5EGO A;  4W1U A;  1HF0 A;  1BW6 A;  2N8G A;  2MW8 A;  4X1E A;  3LSP A;  2G7L A;  2COB A;  5EDN A;  2ZOZ A;  1LE8 A;  4LOC A;  2EZL A;  4DYR A;  3RZO J;  2RAE A;  1VF9 A;  2OI8 A;  2O7O A;  4L5E A;  1UI5 A;  1D5Y A;  3M3Y J;  4D5C A;  3BR6 A;  2H8R A;  4A3I J;  3HBL A;  2JK3 A;  1QPI A;  4FTH A;  4AYB N;  1Y1V J;  2NS7 A;  2NS8 A;  2HQ5 A;  1ITY A;  2WAQ N;  3MNL A;  2DG7 A;  2JN6 A;  3NNR A;  2Y2Z A;  1UHS A;  3TED A;  2XSD C;  5C4X J;  3DCF A;  3JR9 A;  2NOG A;  4XRS G;  5CW8 A;  4X6A J;  2EZI A;  2Y9Z A;  1B8I A;  5FGL A;  2DA5 A;  5IOZ A;  1EF4 A;  3NAR A;  5DTD A;  4D7M A;  1U78 A;  4D7N A;  1ETX A;  2Y30 A;  5F27 A;  2I10 A;  1U9N A;  2M8G X;  5F0F A;  1IDY A;  2MGQ A;  5EZG A;  4BY7 J;  1P7I A;  1TWH J;  3Q0U A;  1XS9 A;  3CMY A;  2ZOY A;  3L1P A;  4I76 A;  2R5Z A;  2DA6 A;  3HTH A;  2LK2 A;  2FJ1 A;  2B63 J;  3S1Q J;  2QF7 A;  5K7F A;  3GTL J;  3IV5 A;  1CQT A;  2L7M P;  2LR8 A;  1ZR2 A;  3ZQL A;  3G1M A;  3T6N A;  2D6Y A;  2E19 A;  2L0K A;  5C44 J;  1SFO J;  1OCP A;  5F0C A;  3KNW A;  5J1U A;  2QCO A;  2G0E A;  4M3F A;  3VUQ A;  4M3D A;  2R92 J;  3ZOB A;  2OF7 A;  2FQ4 A;  5F08 A;  1GVD A;  1BL0 A;  2O9L A;  1Z77 A;  3BG3 A;  2CRG A;  2GEN A;  3HE0 A;  3HOV J;  2DA2 A;  2LTP A;  3VPR A;  5IYC J;  3GTG J;  3V78 A;  2JA6 J;  3BQY A;  1Z0X A;  2G7S A;  2X6O A;  1HOM A;  5IOY A;  1GUU A;  4DZJ A;  1B72 B;  3BHQ A;  1ZTR A;  3B6C A;  2JWT A;  2O7T A;  2XGD A;  4W97 A;  3G1L A;  3G1O A;  5EYR A;  1W0T A;  3S14 J;  2DA4 A;  2R0Q C;  1BA5 A;  3VP5 A;  4C3I J;  1T56 A;  2E2I J;  3JSJ A;  1WPK A;  2ZCX A;  3CDL A;  5FHP A;  1I6H J;  5EFY A;  3RZD J;  3LHQ A;  3MVP A;  1RPW A;  4A3D J;  3RD3 A;  3S1R J;  3TW7 A;  3BR3 A;  1FTT A;  4QSH A;  2RAS A;  2R5Z B;  1RR7 A;  1Y1W J;  5AQC A;  2HKU A;  2FX0 A;  1IUF A;  1FTZ A;  2E1O A;  2HDD A;  2QOP A;  2EBI A;  4C2M J;  3GTM J;  3GZI A;  3OSF A;  3PPB A;  3HIM A;  2O8K A;  2K9S A;  3TW6 A;  4L62 A;  4GFB A;  3LSR A;  5FJ8 J;  2D5V A;  2L9R A;  5F04 A;  1NTC A;  3E7L A;  2VI6 A;  4BBR J;  4UUS B;  5J3L A;  1E3O C;  3FKI J;  2NP3 A;  2UXU A;  3LSG A;  3K2A A;  2R5Y B;  2GM4 A;  2XGC A;  3GTQ J;  2L7Z A;  4MFD A;  3W6V A;  3MN2 A;  3QBM A;  4B4C A;  3A01 A;  3A01 B;  4AC0 A;  3JRB A;  1AHD P;  2HYJ A;  3OOU A;  3CQZ J;  3WHB A;  1MSF C;  4A3L J;  1ETY A;  2VPR A;  3GBG A;  2R5Y A;  1S7E A;  5FKL A;  2ECC A;  3SJM A;  2KDZ A;  3JRA A;  3Q0V A;  5K7H A;  3BTI A;  5EEA A;  4A3C J;  3COL A;  4ICH A;  1ETO A;  3IH2 A;  2LKX A;  5IP9 J;  2WV1 A;  1MH3 A;  3B6A A;  3NI7 A;  5FMP A;  2XB0 X;  4PXI A;  2NP5 A;  3DEW A;  5FKK A;  4GFK A;  2LLK A;  3D1N I;  1F43 A;  1JUM A;  1U8B A;  4BXX J;  3CRJ A;  3GEU A;  5CXI A;  1JJ8 C;  5IP7 J;  9ANT A;  4JL3 A;  1IRZ A;  3TP0 A;  2DG8 A;  3F0C A;  1R9T J;  3K7A J;  2WB1 N;  5FLV A;  5K58 A;  3HTJ A;  4MFE A;  5K7Z A;  5C3E J;  2X9D A;  5E3O A;  3ZQG A;  3I4M J;  2FD5 A;  1ORK A;  3AQS A;  2HXI A;  4ACI A;  1U9O A;  2K9N A;  1ETV A;  1X58 A;  4IEJ A;  3QPS A;  1JJ6 C;  2CUF A;  5EG0 B;  2IBD A;  2FBQ A;  2REK A;  4A3K J;  1Q1V A;  2LY9 A;  1ZGW A;  2ZCM A;  3BCG A;  4JP0 A;  5HOD A;  4FCY A;  2YVH A;  1QVT A;  4A3B J;  2DA1 A;  2MSY A;  3BR0 A;  5BNG A;  2LD5 A;  3BG9 A;  1ZK8 A;  2NVY J;  4CYC B;  4CYC A;  2UXO A;  3ON4 A;  1SAN A;  1JKO C;  4IHX A;  2JJ7 A;  4XRM A;  4G12 A;  2NVX J;  2WUI A;  3VVZ A;  3SDG A;  3FIW A;  3TP3 A;  1ETW A;  2K40 A;  4JKZ A;  3RQI A;  4V2F A;  4Y52 J;  1IJW C;  4B1R A;  3ANG A;  5E3N A;  3FRQ A;  4JNN A;  3HTI A;  5D1R A;  1ENH A;  1IC8 A;  2AHQ A;  4IHY A;  3Q0W A;  2YS9 A;  3GTO J;  1HDD C;  4UDS A;  5J1Y A;  2TRT A;  3RKQ A;  2NVT J;  3EUP A;  3H0G J;  1OJL A;  5E3M A;  3HOU J;  2GLO A;  1RKT A;  2E2H J;  3B81 A;  5IYB J;  2H1K A;  3MKL A;  2WGB A;  1GT0 C;  3NXC A;  1MBF A;  1BJZ A;  1IDZ A;  3EGQ A;  2UXP A;  1TWF J;  2DJN A;  3S15 J;  2HI3 A;  4M3G A;  3BJB A;  2E2J J;  2JA5 J;  2XPV A;  1FJL A;  2Q24 A;  3HOW J;  2JA8 J;  2ZCN A;  3VW1 A;  1FIA A;  2LP0 A;  2HXO A;  2ZB9 A;  3S2H J;  1G2H A;  3P9T A;  5FKM A;  5M5Y J;  3HKZ N;  1DU0 A;  4XIC A;  5HSZ A;  5DAJ A;  2YUS A;  1TWG J;  2EQR A;  3E7Q A;  2HOT A;  2GFN A;  3KKD A;  1QVU A;  4D5F A;  1IV6 A;  2YVE A;  2EH3 A;  3O60 A;  4HKU A;  4HNV A;  5E3L A;  3NRG A;  2HOA A;  3LSJ A;  4CGR A;  1JUP A;  2DMT A;  3FIS A;  4C3H J;  3PAS A;  5DS9 A;  4JX4 A;  4MK6 A;  4GCL A;  4JYK A;  2PMZ N;  5IPA A;  3S1M J;  3RH2 A;  1JKQ C;  1MBK A;  1H8A C;  3JRG A;  3ZQC A;  3ZQF A;  1JT6 A;  2ME6 A;  1LFB A;  4JX5 A;  4UUT A;  1H89 C;  2HOS A;  3HGY A;  3PM1 A;  3HDD A;  3GTK J;  3HOX J;  3UKG A;  2QKO A;  3G56 A;  1OCT C;  3HGG A;  4BKX A;  2DMN A;  2X48 A;  4UUS A;  1LE8 B;  1WCM J;  1YRN A;  3BR5 A;  5FKN A;  4QIW N;  5EZH A;  2W48 A;  4XRS A;  3KKC A;  3OSG A;  1RES A;  4XK4 A;  3QQA A;  4RBO A;  2ME0 A;  2LVS A;  3BTJ A;  2ID3 A;  2NX4 A;  2XDN A;  3VVX A;  4DW6 A;  1WH5 A;  3S16 J;  2QIB A;  3ON2 A;  2DMU A;  5EF6 A;  2Y0S N;  2DN0 A;  1X2M A;  1B72 A;  1ETQ A;  3M4O J;  3BNI A;  4A3E J;  4JX6 A;  4XID A;  3BG5 A;  4ABZ A;  4MXM A;  1APL C;  3V6G A;  3BRU A;  2QWT A;  1MBE A;  1WI3 A;  3A02 A;  4MO7 A;  5EG0 A;  1JKP C;  2HYT A;  3VW2 A;  3IH4 A;  2CUE A;  5FKO A;  3JRI A;  1JTY A;  5J1R A;  1ZQ3 P;  4AC6 A;  4NEL A;  4NN1 A;  1NK3 P;  1P7J A;  3LNQ A;  2M34 A;  2Y31 A;  2IU5 A;  1PUF A;  1A6I A;  1H88 C;  4DYC A;  5HBU A;  1VI0 A;  1WH7 A;  1MNM C;  3C2B A;  3HB9 A;  4GCK A;  2LFB A;  3S1N J;  3BR2 A;  5F0H A;  1UI6 A;  3GTJ J;  1YRN B;  3BR1 A;  5M3M J;  1I3Q J;  1HCR A;  3PO2 J;  2W53 A;  3VW0 A;  4FE4 A;  1POG A;  3HOY J;  2OPT A;  1RKW A;  2CQQ A;  2Y9Y A;  1I50 J;  1X2N A;  5JLW A;  1B8I B;  4J19 A;  2DA3 A;  3NAU A;  3C07 A;  3VIB A;  4AUX A;  2NVQ J;  3JRE A;  2V57 A;  2JMW A;  1UG2 A;  3ZQI A;  4A3F J;  5M5X J;  1IG7 A;  2IEK A;  3HTA A;  1QRY A;  2IAI A;  3SFI A;  2G7G A;  1FEX A;  1T33 A;  3G7R A;  2VKE A;  1HLV A;  3NPI A;  3JRD A;  4EEF G;  2PBX A;  3O8G A;  1JTX A;  2L7F P;  3IH3 A;  3A03 A;  1VFC A;  1SGM A;  3BTC A;  3S5R A;  3JRH A;  1JKR C;  2M9H A;  4FIS A;  4C3J J;  2R7Z J;  5EGO B;  3LWJ A;  2GBY A;  4M6V A;  5IP6 A;  2QTQ A;  1HDP A;  5M3F J;  4I6Z A;  5GPA A;  3GTP J;  1XC5 A;  1GV5 A;  4M3B A;  3HEF A;  4M3E A;  3KZ9 A;  1MSE C;  2GUH A;  3JRF A;  2F07 A;  1A5J A;  3ANP A;  1RET A;  1JUS A;  2MG4 A;  2XPW A;  3BT9 A;  1AKH B;  3PO3 J;  4A93 J;  4B3A A;  4IHW A;  3HM5 A;  2P81 A;  1WGX A;  1OFC X;  3BQZ A;  1UMQ A;  2R93 J;  4FE7 A;  4ME9 A;  2CU7 A;  3CWR A;  4A3M J;  5D19 A;  4MLO A;  3CJD A;  2KT0 A;  4V2G A;  1TWC J;  1VND A;  3WHC A;  1W0U A;  3QKX A;  2UXH A;  5C4Y A;  2XRL A;  4S0H B;  4IHV A;  4GFL A;  1O4X A;  4NDL A;  1MH4 A;  2DMQ A;  3OIO A;  3DPJ A;  3VOK A;  1ZKG A;  3LJL A;  1ETK A;  2M2E A;  4A69 C;  5C4J J;  4BY1 J;  3S2D J;  2DTZ A;  3IUV A;  3F1B A;  3VVY A;  3Q3S A;  2YU9 J;  2VKV A;  3QPL A;  5FLM J;  1LFU P;  4KWA A;  3AQT A;  3VOX A;  3FK6 A;  2EZH A;  2CJJ A;  4GCT A;  2CQX A;  4DZP A;  5F1J A;  3CCY A;  3HOZ J;  4DYQ A;  4RDU A;  3S17 J;  1TWA J;  5IYD J;  4YZE A;  2AO9 A;  5JLX A;  1NK2 P;  4A3G J;  2ELK A;  3FK7 A;  1PUF B;  1TC3 C;  5D18 A;  1JGG A;  1BW5 A;  1K61 A;  1JT0 A;  2EZK A;  2XGE A;  4A3J J;  2OER A;  3H3V K;  1K83 J;  1XG1 A;  4Y7N J;  1FIP A;  2G3B A;  2K9Q A;  1F36 A;  3I4N J;  5CXG A;  2JA7 J;  1MBG A;  4AF5 A;  4MIM A;  5GPC A;  3LOC A;  1MBH A;  3JRC A;  1MBJ A;  3O8H A;  4QTR A;  3ZQH A;  1IGN A;  2DA7 A;  2PZ9 A;  1GV2 A;  5H9T A;  2TCT A;  5GP9 A;  2DMP A;  1ZR4 A;  4BBS J;  1AU7 A;  1DU6 A;  5M5W J;  2ID6 A;  2XPU A;  5HAW A; 
#chains in the Genus database with same CATH topology
 4IF4 A;  2FXA A;  2XB5 A;  3O3K A;  2ETH A;  2EFP A;  3OY9 A;  1QZY A;  4X1E A;  4DJA A;  2MW8 A;  2RV8 A;  2ZOZ A;  3P9K A;  1YIJ I;  3GZ5 A;  1VF9 A;  1J2X A;  3IUO A;  4BS9 A;  1XPX A;  4D5C A;  3KP4 A;  3RPU D;  3CC4 I;  2ELH A;  4A3I J;  2ZSI B;  5EJC A;  3RJP A;  3BC8 A;  3JSO A;  1W5T A;  1EJ9 A;  1UFM A;  2NS8 A;  2HQ5 A;  2VL8 A;  1XMA A;  1BR1 A;  1ZHF A;  2PX9 A;  2JN6 A;  3OS2 A;  5C4X J;  5CW8 A;  1IN8 A;  1ZLJ A;  1V5F A;  2GA1 A;  1H9T A;  1K7A A;  2DJI A;  1B8I A;  4HF1 A;  3NAR A;  5DTD A;  3W2A A;  1SFK A;  4D7M A;  3BRO A;  2KIQ A;  3T5X A;  1TT0 A;  3HG9 A;  1QHH D;  2I10 A;  2M8G X;  4BY7 J;  5J1Y A;  1HC8 A;  1TWH J;  3Q0U A;  5DV5 A;  2X6W A;  3JCU C;  2FJ1 A;  5CYV A;  2QF7 A;  2A6H F;  4LIV A;  4XON A;  2FOW A;  4IHT A;  1LFP A;  1CQT A;  2L7M P;  3SWH A;  1IW7 F;  3GUD A;  3QU6 A;  4Y3O A;  2LMD A;  5ICG A;  4M9S A;  5C44 J;  4CHU A;  2D6Y A;  2P7C B;  5F0C A;  3KNW A;  2HQR A;  4DBR A;  1OQY A;  3ZOB A;  3AL0 C;  1GVD A;  2ZNY A;  1G59 A;  3H5N A;  3HOV J;  3BZC A;  3GTG J;  3LSI A;  1W5S A;  1YLF A;  3F8B A;  1P2F A;  4HG2 A;  4BQO A;  1G3Y A;  3HPH A;  4KDP A;  2EIM H;  2V7F A;  2IS2 A;  4KIF A;  3VYS B;  2JSC A;  2GXB A;  4A12 A;  2X6O A;  1JE8 A;  5IOY A;  3B6C A;  5HS9 A;  3F3X A;  2XGD A;  3G1L A;  1R5H A;  3G1O A;  5EYR A;  1W36 D;  3K1N A;  4C3I J;  5L3B A;  4P5O A;  3CZ6 A;  2EV5 A;  3EET A;  4L9J A;  2DFH A;  2ZCX A;  4HZF A;  3CDL A;  3PQJ A;  5FHP A;  1WJF A;  3MZH A;  2PBI A;  3LHQ A;  2GIV A;  2BY2 A;  2RVC A;  4KMF A;  5J4V A;  3LSK A;  1YW7 A;  2EV6 A;  3KET A;  3K8P C;  1FTT A;  2IGN A;  3VOD A;  2VQH A;  3DEU A;  3SDB A;  2HKU A;  1IUF A;  4DVY P;  2DYS H;  2EBI A;  1VQ9 I;  3HRS A;  5H2F C;  4ANJ A;  2O8K A;  2K9S A;  4GFB A;  5F04 A;  2W82 A;  3K1M A;  4UUS B;  5J3L A;  3FKI J;  1UZC A;  2CWE A;  2RQQ A;  2YR2 A;  4E7S A;  4EM0 B;  1I1G A;  3DWL E;  1WKM A;  2CV1 A;  4B4C A;  1Y56 A;  2BZT A;  4IQ4 A;  2K3P A;  2M7A A;  3E0J B;  3E6B A;  4KUM A;  4CCK A;  5FFX A;  4CXF A;  1HW1 A;  4EAT A;  3T1B A;  1MSF C;  4A3L J;  1ETY A;  1ZGJ A;  2VPR A;  3WTZ A;  1S7E A;  2M87 A;  2VQG A;  5F6F A;  3W2W A;  4B3X A;  1KQ8 A;  3BWG A;  2CS3 A;  1MMG A;  3BTI A;  5K7H A;  2H94 A;  1Z7U A;  4G94 A;  5IP9 J;  2WV1 A;  3B6A A;  3K2Z A;  4RGX A;  2XC7 A;  4ENM A;  3RPU A;  2NP5 A;  3ABM H;  4HST A;  4XR6 A;  3ZMD A;  4HAM A;  1VQO I;  3ZN1 A;  1GLN A;  1KYZ A;  1JJ8 C;  9ANT A;  4E7L A;  1U5T A;  3K7A J;  2P6S A;  2NAZ A;  2YPR A;  3WE2 A;  3OYB A;  4IKF A;  3CDI A;  3SEZ A;  4Y4R A;  4LJZ F;  1EH7 A;  1KU2 A;  3LSM A;  3H5R A;  5C3E J;  1LJ9 A;  1G6N A;  4OWR B;  2RN7 A;  3ZQG A;  4GYG A;  1ORK A;  5AIP A;  2HXI A;  2F4O B;  3CES A;  4DGW B;  2VLA A;  1XGS A;  4ACI A;  3OYF A;  3KP5 A;  1JJ6 C;  5EG0 B;  1VZ0 A;  3CJT B;  1OKR A;  2RKH A;  1R4M B;  3R60 A;  4BDY A;  3H9G A;  2GWR A;  4JP0 A;  4FCY A;  4Q5S F;  1S7A A;  5JVG F;  2MSY A;  3VTI A;  3M1C A;  2MAB A;  4NQW B;  2K27 A;  2FEZ A;  2LD5 A;  4R8H A;  2NVY J;  4CYC A;  2MLK A;  3B02 A;  2JJ7 A;  1ZYR F;  5HDK A;  4LLN A;  2NVX J;  2X6X A;  2LRE A;  3VVZ A;  3GO5 A;  3FIW A;  4FX0 A;  1B6A A;  4U0V A;  3VFZ A;  3L2U A;  2LOO A;  4BGD A;  1IO2 A;  1EA3 A;  2W4S A;  3ANG A;  3DBR B;  2ZME A;  3FRQ A;  1QGP A;  1OCZ H;  3PIO F;  3FM3 A;  3KE2 A;  3S3N A;  4AM3 A;  1FP1 D;  3TDZ C;  1X3Z B;  2XV4 S;  1HDD C;  4G7Z F;  4L9V A;  4BAC A;  2TRT A;  4I01 A;  3RKQ A;  2NVT J;  5DDG A;  4D1Q A;  3G4S I;  2DXI A;  4UHT A;  5ICC A;  2E7X A;  3QOD A;  2H1K A;  4LGW A;  3FMQ A;  3QRF F;  1MKM A;  1BR2 A;  1MBF A;  1IDZ A;  3FM5 A;  5DUI A;  2VB6 A;  3OV8 A;  2WAQ A;  3KX2 A;  3QPT A;  2ZCN A;  2IA2 A;  2JA8 J;  1FIA A;  1U6G A;  2ZB9 A;  5B66 C;  3V8L A;  1DU0 A;  3PSI A;  2EA2 A;  1A31 A;  3L7W A;  3WTX C;  5DAJ A;  1R36 A;  1TWG J;  3F8F A;  2B1E A;  3HL2 A;  2JRM A;  3EUK L;  3K0L A;  4XLN F;  3NRG A;  3ZMV A;  2JRT A;  4C3H J;  4CCO A;  3G73 A;  3X2Q H;  4JX4 A;  3F6V A;  1QQI A;  4MTD A;  2MLG A;  1K79 A;  2IA0 A;  2PMZ N;  4ENN A;  1MW7 A;  1B4A A;  3HTH A;  3ZQC A;  2K86 A;  3WTU C;  1LFB A;  2VQC A;  1IN7 A;  3ML6 A;  4JX5 A;  4HW0 A;  4UUT A;  4Y15 A;  3MKY B;  1X4O A;  1OCC H;  4HBL A;  3T8R A;  3H9J A;  2MH2 A;  1T95 A;  2P4W A;  3KFW X;  2FU4 A;  2CYY A;  5JVT A;  1XCV A;  2DMN A;  3MZY A;  1LE8 B;  3E97 A;  3VB2 A;  3DKX A;  3M7G A;  1WCM J;  4BDZ A;  3CME I;  3R4K A;  1D8K A;  2AQE A;  2KDO A;  3ASN H;  1Z05 A;  3QYF A;  3DU5 A;  3CUQ C;  4RBO A;  2IP2 A;  5CVV A;  2LVS A;  3GLX A;  4FX4 A;  2QIB A;  2FBH A;  4QPO A;  2WTE A;  1CF7 A;  1NHA A;  2E1C A;  3H92 A;  2LKP A;  1IN5 A;  2DOE A;  2IS4 A;  1KZH A;  4XQF A;  2OQG A;  4MXM A;  3JAM K;  3F22 A;  3V6G A;  2B0L A;  1UAA A;  3BRU A;  3A02 A;  2WA0 A;  4MO7 A;  5EG0 A;  3KLN A;  1JKP C;  3VW2 A;  3IH4 A;  5FKO A;  2AXT C;  3JRI A;  5J1R A;  2E1N A;  4UVA A;  4XLA A;  1KU7 A;  2NRA C;  5FRM A;  3DTE A;  2VN2 A;  3ROU A;  1ZGA A;  4YFX F;  2GIZ A;  1WJA A;  4WCG A;  2MH9 A;  4AID A;  4LLL A;  4BNC A;  1MNM C;  2GZW A;  3HB9 A;  2DT7 B;  2LRD A;  2LFB A;  5CVI A;  1K4T A;  3BR2 A;  2OJE D;  1BBY A;  1Z3Y A;  2XKP A;  1YRN B;  3BR1 A;  3PFY A;  1MJB A;  1XSV A;  1Z67 A;  2A69 F;  1HCR A;  4OU0 A;  3BP8 A;  2W53 A;  4FE4 A;  1W7P A;  4DIQ A;  1RR8 C;  3HOY J;  1X3W B;  2EIN H;  2LG4 A;  4NUB A;  2HEO A;  1RKW A;  1X2N A;  1XSX A;  3U1K A;  4XKC A;  1R71 A;  1B8I B;  3ZCO A;  4AUX A;  2X6Y A;  2IW5 A;  2L02 A;  2QQA A;  3JRE A;  1SVL A;  1B9M A;  3OYM A;  5FLX Z;  4L5J A;  2DT5 A;  5E1X A;  1BM9 A;  3SFI A;  3SXY A;  2G7G A;  2PJR B;  3L2W A;  3KP3 A;  5CKT A;  1T33 A;  2VKE A;  3C2G A;  4IXA A;  1P4A A;  2DFI A;  3UR3 C;  3JRD A;  1K78 B;  1GHC A;  1JTX A;  1XX5 A;  3F9K A;  1SGM A;  2FNA A;  2M4K A;  2X1D A;  1X1C A;  4EV0 A;  2Z33 A;  2M9H A;  4FIS A;  4KN4 X;  4C3J J;  1VQP I;  1WHU A;  3CCJ I;  4RS8 A;  3KZY A;  5IP6 A;  1HDP A;  1IV8 A;  3KEQ A;  1TP4 A;  2XAG A;  4BE2 A;  1YO5 C;  3EYI A;  4HF2 A;  2R7U A;  3BDD A;  3ZXS A;  5J6X A;  3UNG C;  2PN6 A;  3GTP J;  4M3E A;  2ZO4 A;  1ZG5 A;  1MSE C;  2ZNZ A;  1ODD A;  2VT2 A;  3OS1 A;  2F07 A;  4IOA F;  5D6F A;  3PNV A;  4UVC A;  4IJA A;  3N97 A;  1AKH B;  2OTL I;  1P9Q C;  1V4R A;  3EPZ A;  3CF5 F;  1RZ4 A;  2AXL A;  3F8M A;  3R0A A;  3K4M A;  1P92 A;  2EIL H;  5LHH A;  3D0S A;  4CO8 A;  2CU7 A;  2R3S A;  4XM3 A;  2PJR A;  2GAU A;  3KZZ A;  5D19 A;  4ZYD A;  3CJD A;  4V2G A;  1TWC J;  1W0U A;  1Z3X A;  2UZK A;  1WQ2 A;  3LL7 A;  4GFL A;  4NDL A;  3TO6 A;  3OIP A;  3OIO A;  4RAF A;  4E7I A;  5GTI C;  3DPJ A;  1FX7 A;  3VOK A;  3SYT A;  3W6K B;  1ETK A;  5ILU A;  3L2R A;  2K7L A;  1O3T A;  5GAE J;  2VKV A;  1EKE A;  2PJP A;  1SAX A;  2LNB A;  3AQT A;  1R1U A;  3LMM A;  2V26 A;  3V7R A;  3OYJ A;  1MZB A;  2WY7 Q;  3GZ6 A;  4DZP A;  1DGR M;  2HVS A;  4DYQ A;  3GFI A;  2LDU A;  1TWA J;  1FLI A;  3RDI A;  1FP2 A;  1GXQ A;  4CCM A;  5JLX A;  3CJQ B;  3FKJ A;  3VYR B;  4EGY A;  4A3G J;  2ELK A;  4A2U A;  3WTY C;  5D18 A;  1K61 A;  2F5E A;  2IGK A;  4ZDL A;  2EZK A;  1IXR C;  1XG1 A;  2NYX A;  4Y7N J;  4A6D A;  2DK5 A;  2K9Q A;  3V7S A;  1F36 A;  3I4N J;  3ECO A;  2JA7 J;  3PNT A;  2DPD A;  4AF5 A;  2ZME C;  2E7W A;  3NWT A;  1UJ8 A;  3LOC A;  2Q2E B;  3H3U A;  1IRG A;  4QTR A;  1IGN A;  2DYR H;  5JHU A;  1TLH B;  2FBK A;  2VJI A;  3HXL A;  2TCT A;  3H35 A;  4WXD A;  4WF2 A;  2DMP A;  4I02 A;  1ON2 A;  4G9Y A;  4ZYA A;  1XTA A;  2Q1Z B;  4HYE A;  5HAW A;  1QBJ A;  3WGI A;  1KA8 A;  1FY7 A;  4PFO A;  5DEQ A;  2VUM J;  1FYL A;  3FBI B;  4E70 A;  4M72 A;  2ECB A;  5EGO A;  1G3S A;  5B3S H;  2G7L A;  4N9I A;  1ZRF A;  4C2M A;  5EDN A;  1BOB A;  1LE8 A;  4XKV A;  3EUH A;  2OI8 A;  2O7O A;  4L5E A;  1D5Y A;  3WOD F;  5IT3 A;  3M3Y J;  1SC7 A;  2QA4 I;  3HZJ A;  4I0B A;  2JT1 A;  1Q1H A;  3H1C A;  1Y1V J;  4I7H A;  2B7E A;  3FWE A;  1ITY A;  3BJO A;  1OYI A;  2WAQ N;  4JQF A;  2VOD A;  3MNL A;  5FB2 A;  2L4A A;  2DQL A;  4PJL A;  1OR7 C;  2DG7 A;  1G8X A;  2A5W A;  1HXD A;  4LFU A;  4RGU A;  2EIJ H;  3DCF A;  1YTY A;  3L9F A;  1VTN C;  2DPU A;  3BZ6 A;  2Y9Z A;  5BPI A;  5IOZ A;  2YVX A;  3C18 A;  3K4C A;  3T8T A;  1U78 A;  1VQ6 I;  1SD5 A;  2K9L A;  4IRV A;  2B3W A;  1U9N A;  2MGQ A;  1K6Y A;  1IDY A;  3SFZ A;  3I59 B;  3VWB A;  3J7A O;  4NQW A;  2O6G E;  1UG0 A;  2LK2 A;  2B63 J;  5K7F A;  1QPM A;  4R79 A;  5BS6 A;  2CUZ A;  2VPL A;  1YOV B;  1I3A A;  2GQQ A;  2QBY A;  2L0K A;  2XAU A;  3F23 A;  5TJJ A;  3ZPL A;  5BPD A;  1S72 I;  3BOQ A;  5F08 A;  5EEG A;  4B48 A;  2XGX A;  3HE0 A;  2LTP A;  1XDS A;  4LG0 B;  1D0Z A;  3MCZ A;  5ED4 A;  1VQ7 I;  1D8J A;  3JAM Z;  3BQY A;  3TO7 A;  1Z0X A;  2ZBK A;  2VJ5 A;  1G3T A;  3C2H A;  4I09 A;  1B72 B;  2BY1 A;  4RAG A;  4LD5 A;  3S32 A;  3S14 J;  4E7Z A;  1RIO H;  2XAS A;  3T0Y A;  1BA5 A;  2OTJ I;  1T56 A;  2E5Z A;  2BW3 A;  2L2O A;  1RPW A;  2HTS A;  4D9J A;  3RD3 A;  3S1R J;  3TW7 A;  1BIA A;  2R7T A;  1QNT A;  3BY6 A;  2R5Z B;  3CO6 C;  2E1O A;  2FUG 2;  2QOP A;  2BEO A;  4C2M J;  3OIQ A;  1PP7 U;  4Q47 A;  2MC4 A;  3TW6 A;  1WSU A;  3LSR A;  4XOT A;  2D5V A;  5LGT A;  2PFB A;  1QU3 A;  3E7L A;  3DU6 A;  4YII A;  4BBR J;  3IKV A;  3L2C A;  1PP8 F;  4D0P A;  3QP6 A;  2VT3 A;  2DO7 A;  2Y69 H;  2W57 A;  3MN2 A;  2F2E A;  3I4P A;  4YFN F;  4IHS A;  1O3Q A;  4AC0 A;  2F5C A;  5K5Q A;  2HYJ A;  4BJT A;  1BJA A;  2CSO A;  3GBG A;  3E3V A;  3WTS C;  2Z9O A;  5KCM A;  2KDZ A;  2M5W A;  3Q9S A;  2VON A;  3CLQ A;  3JRA A;  2W1O A;  2KPM A;  3Q0V A;  4ZDP A;  4E6K G;  5EEA A;  2HZD A;  2DW4 A;  2LKX A;  4NHJ A;  2HU9 A;  2IGM A;  2XB0 X;  3L2V A;  4EJW A;  4GFK A;  2LLK A;  3CUQ A;  1JUM A;  1FMW A;  1J0R A;  2H6C A;  4UB6 C;  1G3W A;  5IP7 J;  1FOY A;  3DPT A;  1L3L A;  1IRZ A;  2DG8 A;  3IWF A;  3OYI A;  3H9Q A;  1F4K A;  1QA6 A;  4G8X A;  2LY2 A;  2R7W A;  2Z99 A;  1QZZ A;  4ZYG A;  2DOA A;  3CJN A;  5K7Z A;  2EB7 A;  4IVN A;  1HBX G;  5J40 A;  2KP6 A;  3AQS A;  2ESN A;  2HNH A;  3HUG A;  2QEX I;  2DLL A;  1U9O A;  2LC2 A;  2Z16 A;  4YIR X;  2A3S A;  2K9N A;  3OYH A;  2HR3 A;  5JR3 A;  5ILS A;  2EV0 A;  4HV6 A;  4UV9 A;  2QQ8 A;  1X58 A;  4I2O A;  1VQK I;  3HOS A;  2X0L A;  3H3Z A;  2QVO A;  2QBY B;  2FBQ A;  2REK A;  4MNU A;  2LY9 A;  1ZGW A;  2ZCM A;  5HOD A;  1QVT A;  2CO5 A;  1S29 A;  3K70 C;  3LA2 A;  1YG2 A;  3BR0 A;  5BNG A;  2KZG A;  4I99 C;  3ON4 A;  1X1P A;  1X3U A;  2ZJ2 A;  1JKO C;  1OYY A;  4BEH A;  5BMZ A;  4RGR A;  2DAO A;  2WUI A;  5GAH J;  3K10 A;  3CCV I;  2FE3 A;  3TP3 A;  2L9N A;  4JKZ A;  2K40 A;  1EH6 A;  4V2F A;  4Y52 J;  2PG4 A;  4U87 A;  1IJW C;  4B1R A;  3HTI A;  1ENH A;  3VYT B;  1DP3 A;  2ISZ A;  1BC8 C;  2V4J C;  3DF8 A;  3L2Q A;  4BQN A;  2HKO A;  3Q0W A;  3IAS 2;  2YS9 A;  4HOB A;  4UDS A;  3EUP A;  5DD8 A;  5LRR A;  1OJL A;  2RRE A;  2E2H J;  3B81 A;  3DLL F;  5D5V B;  4AU7 A;  4YEL A;  1GT0 C;  3TGN A;  3EGQ A;  1KGS A;  1FZP B;  2UXP A;  4P9F A;  2A05 A;  5AIQ A;  4CZZ A;  2HI3 A;  4M3G A;  3S15 J;  2L9V A;  3ZQ7 A;  3FXL A;  4M9X A;  2E2J J;  2JA5 J;  2ZSH B;  2Q24 A;  3VW1 A;  3P9T A;  3S2H J;  3FDY A;  3IL2 A;  4BE1 A;  5FKM A;  5M5Y J;  2PEX A;  3HKZ N;  3BJA A;  2PLY A;  2W00 A;  3E7Q A;  3GXO A;  2HOT A;  2GFN A;  1WI9 A;  4XOP A;  4IX7 A;  5K1Y A;  2EH3 A;  2O03 A;  3ZMT A;  2M45 A;  3TO9 A;  4CGR A;  2V6E A;  1QO0 D;  3TOB A;  1M1E B;  2DK8 A;  3FIS A;  4ESF A;  2H1L A;  4GCV A;  1XDU A;  4HNU A;  4JYK A;  5LGU A;  5GAD J;  2FBI A;  5HVQ C;  1MBK A;  1BI1 A;  3S1M J;  3RH2 A;  4XLP F;  3ZQF A;  4N4N B;  3HC7 A;  4F55 A;  5HNH A;  2L01 A;  1DUX C;  3ERM A;  3GF2 A;  1H89 C;  1A35 A;  5HLI A;  3GTK J;  2WV0 A;  1B59 A;  5E1Z B;  5K5O A;  3HOX J;  2JUC A;  3LA3 A;  3G56 A;  2P8T A;  4YEJ A;  3HGG A;  4PJJ A;  4BKX A;  5E20 A;  2UXX A;  3DQV C;  4XNF A;  1Y8Q B;  3IRR A;  1A6Q A;  3BR5 A;  1T08 B;  5FKN A;  4EVI A;  4FT8 A;  2VC0 A;  2W48 A;  4C2U A;  4LIU A;  1RES A;  4XLE A;  2WAF A;  3WGH A;  1MMS A;  1J09 A;  3WE3 A;  2MC3 A;  3RKW A;  2ID3 A;  2XDN A;  3VVX A;  4KIB A;  1WH5 A;  3BZK A;  4DW6 A;  2R7S A;  2Y0S N;  2DN0 A;  3ZMS A;  3CDH A;  4M6Y A;  4YFK F;  4AIK A;  4BJ6 C;  3M4O J;  1YIO A;  2DQR A;  3WU0 A;  3BNI A;  2XKO A;  3FZV A;  3I64 A;  3C3W A;  1RC9 A;  4RAZ A;  2XHK A;  2QM3 A;  1MBE A;  3CD6 I;  2QWT A;  1W5C C;  5B1A H;  3LA7 A;  1AWC A;  1D0Y A;  3AG2 H;  2HYT A;  3ECH A;  1YIT I;  1ZH5 A;  1ZQ3 P;  2BE5 F;  2M3A A;  4ZJZ A;  4NEL A;  2IS1 A;  1TTY A;  1OPC A;  1NK3 P;  3M07 A;  5DCM A;  2BVL A;  2G7H A;  3LNQ A;  2M0M A;  2Y31 A;  2IRF G;  1PUF A;  2TDX A;  1A6I A;  1MMN A;  1LDJ A;  1XGM A;  2Q0O A;  1S6L A;  1WH7 A;  2V1D A;  1HW2 A;  3C2B A;  1XGN A;  4KNY A;  3ZQQ A;  3COA C;  1LUJ B;  5CPR B;  4BH9 A;  4KIS A;  4LK1 F;  3CMM A;  1YFH A;  4U0Y A;  3PQK A;  3HKZ A;  2CG4 A;  1POG A;  3MQ0 A;  1LDK B;  4G7O F;  1WRJ A;  2DBB A;  3DP7 A;  4KJZ A;  2Z5U A;  3KLO A;  5DYM A;  5JLW A;  2R7O A;  4KMU X;  3RSN A;  4PSW A;  2DA3 A;  3A4C A;  3NAU A;  5LBQ A;  1T8I A;  1SFU A;  1MJA A;  1X1B A;  1WFX A;  1UG2 A;  2JMW A;  3MEX A;  4NC7 A;  4ZYH A;  5M5X J;  3VOE A;  1SVO A;  4FET A;  4S05 A;  4A3F J;  3HTS B;  3PUF A;  2VOO A;  2VE9 A;  3HTA A;  1Y8R B;  1TW2 A;  1OCR H;  3DBL B;  3ZMU A;  4OAZ A;  1FEX A;  1YW8 A;  2XF5 A;  3TDU C;  4OD4 A;  4MQ9 F;  3CCE I;  3OYE A;  2V9V A;  4EEF G;  1ZEL A;  4YRV A;  2JVG A;  3A03 A;  4LK0 F;  2CV2 A;  2VQL A;  2ZXW H;  3KP7 A;  4HEA 2;  1JKR C;  3LWJ A;  3FF5 A;  2QTQ A;  5M3F J;  5ERI A;  2KIF A;  2LBF B;  4BAY A;  3NS4 A;  4PSX A;  3A2K A;  1XC5 A;  1GV5 A;  4QPQ A;  4HA8 A;  3KZ9 A;  3FX3 A;  2FMY A;  4B44 A;  1EV7 A;  1F9N A;  3HRT A;  4ENK A;  3ANP A;  2EPF A;  3BT9 A;  4UV8 A;  2M1B A;  3D5R C;  4L9N A;  4CSW A;  4IHW A;  2W85 A;  1WGX A;  1T39 A;  5E8I A;  2HGC A;  5TGT A;  1OFC X;  3BQZ A;  1UMQ A;  4FE7 A;  3KP2 A;  3OYG A;  1T0F A;  1BI3 A;  2P6T A;  2DT6 A;  1DQU A;  1MND A;  3GW2 A;  4MLO A;  2KT0 A;  2EIK H;  3WHC A;  4E4H A;  4XSZ F;  4ESJ A;  2XRL A;  4IHV A;  4IRH A;  4CUG A;  1MH4 A;  4R1H A;  4BXU A;  3M8E A;  1OR7 A;  2A5Y B;  1TQI A;  3LJL A;  4O5V A;  4BY1 J;  2R4G A;  3JTG A;  3F1B A;  5DCF A;  4PJ0 C;  1UHM A;  1W7P B;  1YYV A;  1R23 A;  4O6J A;  3FK6 A;  1QHG A;  1FNN A;  2M30 A;  4UVB A;  3NWS A;  4GCT A;  3RQ4 A;  5F1J A;  1D0X A;  3FXM A;  4HPQ A;  2W7N A;  2DTR A;  2P5K A;  1YX3 A;  4II3 A;  4DBQ A;  2F4I A;  3NRV A;  5E8G A;  1R58 A;  1FWZ A;  2X51 A;  3VEP A;  1JGG A;  5LRS A;  1JT0 A;  5LEJ A;  1BW5 A;  4GXO A;  1V5E A;  1V5G A;  2RQP A;  4IRG A;  3OYN A;  5BQT A;  2H6B A;  2WY8 Q;  3K9T A;  3IKT A;  4ZDO A;  2FOK A;  2XF6 A;  4M73 A;  4ON0 A;  1MBJ A;  2H8W A;  2NVU B;  3ZRG A;  1BC7 C;  2PZ9 A;  2HZT A;  1FYK A;  1ON1 A;  4ESB A;  2D1H A;  1ZR4 A;  2B9S A;  1AU7 A;  4M9Z A;  2STT A;  5JFR A;  2VBZ A;  3LFK A;  4EMS A;  5KK1 A;  3BTL A;  5J47 A;  1GDT A;  2UXI A;  2L54 A;  3IP4 B;  3GFM A;  3HRM A;  4W1U A;  1HF0 A;  2DDB A;  1BW6 A;  3LSP A;  4DQ2 A;  1KU9 A;  4DYR A;  3RZO J;  5J8F A;  3P9C A;  3DTK A;  5TIS C;  1C0W A;  1LNW A;  4RM3 A;  1UI5 A;  1J75 A;  2MD0 A;  4YG2 F;  2H8R A;  4L0Y B;  4GDF A;  3HHG A;  2JK3 A;  2QKL B;  1QPI A;  4FTH A;  2NS7 A;  4BU2 A;  3GWZ A;  1SEU A;  2UUZ A;  4U9N A;  5J4Y A;  3NNR A;  1STZ A;  2V9P A;  1Z91 A;  2XSD C;  3U21 A;  1USS A;  2NOG A;  4XRS G;  4X6A J;  2EZI A;  3KYC B;  3HYI A;  5FGL A;  1EF4 A;  4UXN A;  1T0F C;  1BOA A;  2KZV A;  4D7N A;  1ETX A;  2FSW A;  2Y30 A;  5EZG A;  1P7I A;  3LAJ A;  3CMY A;  1XS9 A;  2OBP A;  3L1P A;  4I76 A;  2R5Z A;  2DA6 A;  4RB1 A;  2AS5 F;  2QQB A;  2V1U A;  1MJ9 A;  2G9W A;  3HIF A;  3R61 A;  4XSX F;  5IY5 H;  3GTL J;  1N78 A;  4J00 A;  2K3F A;  2LR8 A;  1IXC A;  1NG6 A;  2A6T A;  2JUG A;  1ZR2 A;  3ZQL A;  4F91 B;  2R7D A;  1SFO J;  1OCP A;  2CW7 A;  5J1U A;  2KIU A;  1WJD A;  2QCO A;  3RKY A;  2G0E A;  3VUQ A;  3ABT A;  1R5I D;  2DOD A;  3H0D A;  1BL0 A;  2LSO A;  1Z77 A;  3PNY A;  1F5T A;  2DA2 A;  3VPR A;  2K02 A;  2WWY A;  3FBN B;  5IYC J;  1YHQ I;  3WTW C;  1BIB A;  2ZFU A;  4XRF A;  3TKY A;  1PVE A;  4Y33 A;  2STW A;  3RPQ A;  2G7S A;  2KJB A;  3I3L A;  3IHU A;  4LB6 B;  1HOM A;  1Z6T A;  2FF4 A;  4U9L A;  3QYB A;  2E60 A;  4DZJ A;  3BHQ A;  1N77 A;  2JWT A;  4IL6 C;  2FJI 1;  4OIR F;  4W97 A;  2DA4 A;  2QSF X;  3VP5 A;  2P0W A;  3MWM A;  3G6E I;  3JSJ A;  1UCR A;  4B09 A;  1I6H J;  2CQN A;  4AVP A;  3VDX A;  3I9V 2;  4A3D J;  1ZAO A;  1J7K A;  3V7C A;  2O5R A;  1MMA A;  2PMZ A;  4HSR A;  4HQE A;  2VXD A;  5TRD A;  2OZU A;  4QSH A;  2RAS A;  3U1D A;  5BOX A;  1Y1W J;  3KYL A;  5AQC A;  5HLG A;  2F4M B;  2FNP A;  4KFC A;  1WJC A;  5H6R A;  1FTZ A;  2LY1 A;  2JZY A;  2KHM A;  2HDD A;  3K4L A;  3M9A A;  3GZI A;  4A5N A;  4HNT A;  4RAY A;  4CGZ A;  2HYF A;  4HLX A;  5CJ9 A;  4L62 A;  4LIT A;  1FOK A;  3B73 A;  2EFO A;  2OA4 A;  2UXU A;  5L3D A;  2ZXI A;  2EFW A;  2R5Y B;  2F5D A;  2GM4 A;  3D5S C;  2L7Z A;  3M8J A;  3BJ6 A;  5D4S A;  4Z2Y A;  1I5Z A;  3S8P A;  3A01 B;  3S3M A;  2R7V A;  2HDC A;  1FT9 A;  4XN3 A;  3JRB A;  2O3F A;  3HSF A;  2W84 A;  3CQZ J;  3WHB A;  4EJT A;  2R5Y A;  1FSE A;  4RB0 A;  2PMU A;  3HSR A;  3SJM A;  2CQ7 A;  4XOR A;  2HQA A;  5E17 F;  3COL A;  4ICH A;  3GX4 X;  4A3C J;  1ETO A;  2BY0 A;  1FBU A;  3IH2 A;  1R1T A;  1ULY A;  1MMD A;  3TQN A;  4P55 A;  3NI7 A;  2QUF A;  2CQK A;  1S5L C;  3C7J A;  1U8B A;  2FA5 A;  3GEU A;  5CXI A;  2IXS A;  3GCM A;  1U0J A;  4JL3 A;  3HRU A;  3TP0 A;  3F0C A;  1R9T J;  1QZE A;  2WB1 N;  1TZL A;  1XMK A;  3CO7 C;  3CMA I;  2GOX B;  5FLV A;  5K58 A;  4F52 A;  1X1D A;  3FXU A;  1S3J A;  1SD4 A;  2F5F A;  2OUM A;  1VQL I;  3GME A;  3FHN A;  5DM6 F;  4X0G A;  1LEA A;  1MGT A;  3HUG B;  1FSH A;  1F1Z A;  1E17 A;  4Z6Y A;  1ETV A;  1I27 A;  5LHG A;  4RMN A;  1IRF A;  2DCE A;  2ZXH A;  4IEJ A;  1LVA A;  2GXA A;  3W3C A;  3I71 A;  2Y0M A;  1Q1V A;  2Z1D A;  3L09 A;  3HTU A;  1OMI A;  4ZTJ A;  3BCG A;  2KJC A;  3TL4 X;  2HOE A;  2DA1 A;  4BEH B;  4C30 A;  2DFF A;  3RYP A;  4TV7 A;  3BG9 A;  2UXO A;  4XLH A;  1VQM I;  1T2K A;  4U7D A;  2VKH A;  5ICF A;  3VSK A;  2HTJ A;  1VQN I;  4L9T A;  1P4W A;  4BJ5 C;  2HPM A;  3CLO A;  1YS6 A;  2LH9 A;  3RQI A;  1WJ5 A;  1Y0N A;  1YE9 A;  1U2W A;  2CMP A;  4MGR A;  5JHF A;  5KHD A;  1IC8 A;  3P9I A;  2Y0S A;  2PMH A;  3BPV A;  3CP2 A;  3RYR A;  3U2R A;  4IHY A;  2OCC H;  3E5X A;  3OYC A;  2A61 A;  2Y75 A;  2X85 A;  2J5O A;  1ZG3 A;  3MKW B;  4LB5 A;  3HOU J;  5HDN A;  1WVR A;  1RKT A;  1MNE A;  1TQM A;  4ZC3 A;  1YJW I;  5IYB J;  5DUK A;  4FQG A;  2UV1 A;  3CTA A;  3MKL A;  3NXC A;  4DOZ A;  2DJN A;  2JSP A;  4N0B A;  3EDP A;  3DPU A;  3RIR A;  3WTT C;  1EH8 A;  3QAH A;  2XPV A;  1FJL A;  2V9K A;  2EFQ A;  4IZZ A;  2HXO A;  1G2H A;  1D5V A;  1DDN A;  4XIC A;  2LF8 A;  2YUS A;  5CVU A;  3G71 I;  3KKD A;  1QVU A;  1IV6 A;  1H9G A;  4MHG A;  1J5Y A;  1SAU A;  4HNV A;  2HOA A;  5HDG A;  1A04 A;  2QQ9 A;  3LWF A;  1KON A;  3PAS A;  4PZJ A;  1LEB A;  4MK6 A;  1R6R A;  4ZTF A;  4GCL A;  2V1X A;  4F93 B;  2F48 A;  1JKQ C;  3U9G A;  3JRG A;  2A2F X;  4OIQ F;  5E79 C;  3OL4 A;  2HOS A;  3RCO A;  3HGY A;  3HDD A;  4CDG A;  2QKO A;  5H20 A;  3UKG A;  1S9H A;  3KCC A;  4OOI A;  2X1C A;  1BR4 A;  2CW8 A;  1MDM B;  1XN7 A;  1D1C A;  1DPR A;  1I1S A;  1XSD A;  2CGP A;  2QZ8 A;  3WG7 H;  4QIW N;  5EZH A;  3KPH A;  3DEE A;  4QWQ A;  2BOL A;  4XRS A;  3KKC A;  1W36 C;  3OSG A;  5HNF A;  2QSH X;  2L5Q A;  1P4X A;  5IT9 Z;  3QQA A;  4IPA A;  3S16 J;  3ON2 A;  3I59 A;  5EF6 A;  6PAX A;  3NEU A;  2FQ3 A;  3R6S A;  1CGP A;  3LAP A;  4MTE A;  3AKZ A;  2F5V A;  4PFP A;  4JX6 A;  4XID A;  3BG5 A;  4ABZ A;  1KYW A;  2UXN A;  4ASN A;  1APL C;  4PJN A;  1R00 A;  2E1M C;  5FO5 A;  1Z1D A;  1JTY A;  3P7N A;  4AC6 A;  5L3C A;  2P5V A;  2IU5 A;  4AD9 A;  2ZOY A;  4I98 B;  3ELK A;  3EUA A;  4DYC A;  1TW3 A;  5KAI C;  3CCL I;  3ESW B;  4GCK A;  5LEK A;  2R7R A;  3S1N J;  5F0H A;  3SQN A;  3LST A;  1O57 A;  1J59 A;  3GTJ J;  1IUY A;  2VJ4 A;  1I3Q J;  4ETS A;  1R4N B;  3PO2 J;  3VW0 A;  4A0X A;  3M1E A;  2Y48 A;  2VBX A;  3ERE D;  2CQQ A;  2Y9Y A;  5HS7 A;  4UUV A;  2KL4 A;  2R7F A;  1I50 J;  3N4M A;  3GZN B;  2E35 A;  1JGS A;  4BE0 A;  4G6D A;  3CUO A;  3C07 A;  4P1W A;  4OIP F;  1I39 A;  1HW5 A;  2QYO A;  3ZQI A;  1IG7 A;  2IT0 A;  3AFH A;  4HLY A;  4Y17 A;  2IEK A;  4E7J A;  2BY3 A;  2Q2E A;  4YIF A;  3F8N A;  2IAI A;  4PGH A;  4BHB A;  1S8N A;  2D45 A;  2Z2S B;  3WGG A;  2BBY A;  3OYK A;  1HLV A;  3NPI A;  2PBX A;  2L7F P;  3V42 A;  3IH3 A;  1LPQ A;  2BVM A;  3FHZ A;  4KIC A;  3SZT A;  3JRH A;  4IO9 F;  2R7Z J;  1V55 H;  1TBX A;  3W6J B;  2CFO A;  4XLF A;  4M6V A;  5FGM A;  1OIS A;  4I6Z A;  5GPA A;  3BCA A;  2LYC A;  1X1A A;  3A0B C;  4BQQ A;  4B8X A;  2GUH A;  1U5T C;  3MKZ A;  1A5J A;  1RET A;  4F3Q A;  1BI2 A;  4Q48 A;  4KYW A;  4HDV A;  3F8C A;  3ASO H;  4AVZ A;  3PO3 J;  3S2W A;  4B3A A;  4DNC A;  4C2T A;  4A93 J;  2P81 A;  5EEH A;  2L9S A;  2JA2 A;  5KNL A;  4ME9 A;  1X19 A;  1X4P A;  3CWR A;  4JOM A;  3N05 A;  2PQ8 A;  1W4M A;  2VIX A;  2M8E A;  4HV5 A;  1VND A;  3QKX A;  3VSL A;  3J80 K;  5C4Y A;  4L0Z B;  5LGN A;  5A2Q Z;  2DMQ A;  3M8F A;  2OV7 A;  3GVA A;  2K4B A;  5L3E A;  4KIT B;  1ZKG A;  2M2E A;  3CCU I;  3IUV A;  5AON A;  2DTZ A;  5LLQ A;  1UHW A;  5D5U B;  4ZH4 F;  2XSJ C;  3CCQ I;  2LKS A;  2NS0 A;  3IAM 2;  2MA3 A;  2M7B A;  3QPL A;  3MD2 A;  3BCB A;  4KWA A;  3VOX A;  2RNG A;  2K85 A;  1HKT A;  4S04 A;  1UST A;  3PFI A;  1R22 A;  2CJJ A;  3F6O A;  2V6C A;  3OYL A;  3CCY A;  3FMR A;  3HPG A;  3HOZ J;  3D5L A;  3S17 J;  4EJV A;  4WK8 F;  5IYD J;  3ONQ A;  4FAS D;  2C6Y A;  2OZ6 A;  1KU3 A;  2EFN A;  2FRH A;  3KZI C;  3NQO A;  4RA2 A;  4A0Z A;  4Q4Z F;  1NK2 P;  1TC3 C;  3J7A Y;  1IN4 A;  2IGO A;  1Y6I A;  3OWT A;  1D1A A;  4GYI A;  1K6O A;  1K83 J;  4QLC U;  5ILV A;  3H3V K;  4E7H A;  2H27 A;  2G3B A;  1ZRD A;  3WG9 A;  2ZY9 A;  1MBG A;  3I54 A;  1O3R A;  4MIM A;  5GPC A;  2ACJ A;  1MBH A;  3JRC A;  4HDU A;  3O8H A;  3ZQH A;  3V8J A;  5H9T A;  3I0T A;  3L00 A;  5GP9 A;  3E6C C;  3HJE A;  2BXY A;  3OR2 C;  2BV6 A;  1GXP A;  4OIO F;  2EA4 A;  1DU6 A;  2ID6 A;  3E6M A;  3JW4 A;  4Y13 A;  2A07 F;  2RHA A;  2M0C A;  2XAH A;  3Q9V A;  4EJU A;  1E3H A;  1AKH A;  1UB9 A;  3DBH B;  2N8G A;  4NNJ A;  1JHF A;  2COB A;  1D1B A;  4LOC A;  2VJJ A;  2EZL A;  4IOC F;  2HS5 A;  4NC6 A;  2RAE A;  1WJE A;  1K78 A;  1NH3 A;  3BR6 A;  5DM7 F;  3KEO A;  4IQJ A;  3HBL A;  3PSF A;  1RUN A;  3LQR A;  4RB2 C;  4AYB N;  2VBW A;  1HSJ A;  2VKD A;  1J9I A;  2Y2Z A;  1UHS A;  3TED A;  4G6Q A;  5A2Q K;  4N4O B;  3JR9 A;  4XN0 A;  4RB3 C;  4J01 A;  3J80 Z;  2DA5 A;  3BG7 A;  5H6Q A;  1R7J A;  1DPU A;  2DOF A;  5F27 A;  5F0F A;  1VQ5 I;  1E3P A;  2D1V A;  4XLC A;  1CF7 B;  2HFH A;  4XKB A;  3S1Q J;  5HOO A;  5CVJ A;  3IV5 A;  2DU9 A;  2ZCW A;  1XGO A;  5D5X B;  4MEY F;  1ONV A;  2HDW A;  1LVK A;  3G1M A;  2HVR A;  2KRH A;  3T6N A;  2E19 A;  3BLY A;  3DXJ F;  1W7P D;  1B9N A;  4BYY A;  1S7O A;  1O7F A;  4M3F A;  2XVC A;  4M3D A;  1T38 A;  4LG3 A;  2R92 J;  2OF7 A;  2FQ4 A;  2O9L A;  3BG3 A;  2CRG A;  2LF7 A;  2GEN A;  2QEN A;  4KN7 X;  1ERD A;  1B1B A;  3F72 A;  3ISP A;  2ZJR F;  1AA7 A;  2WB1 A;  3V78 A;  3V4G A;  2JA6 J;  3CCS I;  4RGS A;  1I6X A;  4U0W A;  4CCN A;  4LG0 A;  3GYH X;  3DKW A;  3SHF A;  2L4M A;  1GUU A;  1FC3 A;  1ZTR A;  4XMY A;  2O7T A;  2IA1 A;  1G4D A;  2IPQ X;  1W0T A;  1PJR A;  1YQA A;  3EQL F;  1SD7 A;  2R0Q C;  2QLZ A;  4HX7 A;  2E2I J;  4NBQ A;  4HX4 A;  5IT9 K;  4UY8 I;  1WPK A;  2ELJ A;  5EFY A;  1SVM A;  3RZD J;  3RTR A;  3CC2 I;  1WWX A;  3GLL A;  3MVP A;  4L5I A;  2NNN A;  3ZMZ A;  3QOP A;  5CQG A;  1PDN C;  5HLT A;  3PIP F;  4KA4 A;  1TL8 A;  4LLG F;  2IS6 A;  2RNJ A;  3BR3 A;  3OYA A;  4U7B A;  3E5Q A;  1HST A;  1RR7 A;  2FX0 A;  3K69 A;  2MBF A;  1IRX A;  2GOM A;  3K4K A;  1YJN I;  3CUQ B;  4N9H A;  1PUE E;  5KVR A;  5L3F A;  2YX4 A;  2ZFW A;  3GTM J;  4LMY A;  4EGZ A;  2HVQ A;  3OSF A;  3PPB A;  5LHI A;  3HIM A;  2YSR A;  4BUP A;  4K2E A;  3OR1 C;  1KQ0 A;  5FJ8 J;  2I8D A;  2L9R A;  1NTC A;  1R5G A;  4UNO A;  3MFK A;  2VI6 A;  4CH7 A;  2K5C A;  1E3O C;  1E0E A;  3BPX A;  2PI0 A;  2NP3 A;  3LSG A;  3K2A A;  4HX8 A;  2ZKZ A;  3CJR B;  2XGC A;  3GTQ J;  4MFD A;  3W6V A;  4G7H F;  2M4G A;  1VQ8 I;  3QBM A;  3A01 A;  3PJR A;  3V8K A;  4BXF A;  3J7Y J;  1FOX A;  1AHD P;  3FXJ A;  2NNY A;  2OD5 A;  2G7U A;  3OOU A;  3TOA A;  3O6B B;  1IZ1 A;  3QWL A;  4O3M A;  1AOY A;  5FKL A;  2ECC A;  3TMO A;  1GVJ A;  3J81 K;  1YI2 I;  1UEL B;  2K4J A;  4H0E A;  2ZXJ A;  2HPI A;  5E1W A;  1Z9C A;  2BYV E;  5HS8 A;  1R49 A;  2E5N A;  3OL3 A;  1MH3 A;  4XL9 A;  5FD5 A;  5FMP A;  3R0J A;  2NOJ B;  4PXI A;  1FOW A;  3DEW A;  5FKK A;  2XAF A;  3D1N I;  5J8C A;  1F43 A;  4BXX J;  3CRJ A;  3HOT A;  3BG6 A;  3CF2 A;  3HHH A;  4GRI A;  1TNS A;  1TNT A;  2R7X A;  2XAJ A;  4M71 A;  3ZGK A;  4PK4 A;  1ZRE A;  4M74 A;  1XCB A;  3HTJ A;  4MFE A;  1TT5 B;  2X9D A;  5E3O A;  2E36 A;  2QGU A;  3I4M J;  2FD5 A;  3VYU B;  4I0A A;  3WU2 C;  2UWM A;  5CQE A;  5DCM B;  3DKY A;  3I58 A;  2ESH A;  1FBQ A;  1XMX A;  2EWN A;  3IWZ A;  3SZG A;  2KFD A;  3QPS A;  2CUF A;  2IBD A;  2P5L C;  3RKX A;  1O3S A;  1ZRC A;  4A3K J;  2K9M A;  3DV8 A;  3AG1 H;  3FXO A;  2YVH A;  3CCM I;  1JHH A;  4A3B J;  3REO A;  4CIC A;  5FFZ A;  4ENJ A;  3WTV C;  4II2 A;  4HRI A;  3I55 I;  2XAQ A;  1P6R A;  1ZK8 A;  2CW0 F;  2OU2 A;  4CYC B;  1H0M A;  4L18 B;  5FLX K;  2GA2 A;  1LDD A;  3KEY A;  4ZYE A;  2DI3 A;  1SAN A;  3G3Z A;  1RUO A;  4BQA A;  4IHX A;  3WU1 B;  4OMZ A;  2DDA A;  4XRM A;  1VQ4 I;  3AAF A;  1SMY F;  2RDP A;  4G12 A;  2D2W A;  2J5P A;  1V3F A;  3SDG A;  2QWW A;  5K5R A;  2KKO A;  2WBM A;  4BL0 B;  1ETW A;  3K6G A;  4KIG A;  4PJM A;  4RLF A;  2WAD A;  2OQR A;  5E3N A;  4JNN A;  2BGC A;  5D1R A;  2RGV A;  1Z7L A;  2AHQ A;  4OD5 A;  2KIM A;  1IN6 A;  1SD6 A;  3KYD B;  4ITV A;  3K70 D;  2A68 F;  1RNL A;  3IC7 A;  3GTO J;  2L7K A;  2VOP A;  2ICW G;  3FXK A;  5F1R A;  4A5M A;  1U5T B;  3H0G J;  5E3M A;  3LFU A;  3ZR8 X;  2GLO A;  1YW9 A;  1LKX A;  4RM2 A;  1DP7 P;  5LD2 C;  3PL8 A;  1JI8 A;  2CH0 A;  2KRF A;  3P5J A;  2WGB A;  1FBS A;  1BJZ A;  1ZAR A;  1TWF J;  2Z3Y A;  2L3D A;  3BJB A;  2HYG D;  2DFE A;  5FD6 A;  3HOW J;  1WJB A;  2BHY A;  2LP0 A;  3QYE A;  2YX7 A;  5CVR A;  5HSZ A;  4EJO A;  3OMY A;  4OAY A;  3GFL A;  2EQR A;  4XKW A;  4E7K A;  3DPL C;  2CV0 A;  5D8L B;  4ZZL A;  2ZJP F;  1SMT A;  4D5F A;  1ZLK A;  2YVE A;  3O60 A;  4M6X A;  4HKU A;  3KP6 A;  5E3L A;  1MD0 A;  3HSE A;  2OC6 A;  3LSJ A;  4BHP A;  4EM2 A;  1JUP A;  2DMT A;  1IF1 A;  5DS9 A;  4PUS A;  2OAZ A;  3KIO A;  2VAS A;  5IPA A;  1H8A C;  4OIN F;  5D4R A;  2CUJ A;  1JT6 A;  4PDK A;  2ME6 A;  1SFX A;  4WWC A;  4GGG A;  3ZP5 A;  3PM1 A;  1W1W E;  2WAE A;  3GEZ A;  3G2B A;  1OCT C;  2VXZ A;  4AYB A;  2VC1 A;  2X48 A;  4CCJ A;  4UUS A;  3K4N A;  2BHZ A;  5D8K B;  2NXN B;  1YRN A;  1IAW A;  3I53 A;  2V79 A;  2IJL A;  5HLH A;  5DD4 A;  1HKQ A;  4XK4 A;  2ME0 A;  3BTJ A;  2NX4 A;  3IRQ A;  3PUB A;  2DMU A;  1T98 A;  4A0Y A;  2E34 A;  3Q5F A;  1X2M A;  2BXZ A;  4WX9 A;  1B72 A;  1ETQ A;  1LQ1 A;  2IVM A;  2X4H A;  3EYY A;  1LB2 A;  3AG3 H;  4A3E J;  1A36 A;  3E5U A;  1WI3 A;  2YU3 A;  1FYM A;  4A6E A;  2E71 A;  5D6E A;  4EM1 A;  2CUE A;  4B43 A;  1N25 A;  1Z6R A;  3ZN0 A;  1L0O C;  2MFZ A;  1U3E M;  4NN1 A;  1P7J A;  1DGW Y;  3W2V A;  1U8R A;  2MYS A;  2M34 A;  2CFX A;  1H88 C;  4WIB A;  1N75 A;  5HBU A;  1VI0 A;  2ISY A;  2JPC A;  2LBF A;  2ZC2 A;  4AIJ A;  1Y39 A;  2ADU A;  1OYW A;  5KAF C;  3FXQ A;  5B5E C;  4G6T B;  3AL0 B;  2AQF A;  5B1B H;  4JK1 X;  1XB4 A;  5M3M J;  4EQQ A;  1REP C;  3E6D A;  2OCE A;  1UI6 A;  3AG4 H;  4P96 A;  3JSP A;  2ZJQ F;  1V54 H;  3A1Y A;  4OMY A;  2OPT A;  4KT5 C;  1JXS A;  4F92 B;  2COM A;  3SZP A;  2EJR A;  4CA0 A;  2W25 A;  3E1S A;  2Q8K A;  1ACI A;  1TQP A;  3ABK H;  4J19 A;  4H4K C;  4RLQ A;  3I56 I;  1FPQ A;  3VIB A;  2HKX A;  2NVQ J;  1O7L A;  2V57 A;  4NB5 A;  2JQ7 A;  3FXR A;  4BHC A;  3ABL H;  2XIG A;  4UB8 C;  2XRO A;  1QRY A;  2E1M B;  2KMU A;  1NG7 A;  2HQN A;  3J7Z I;  3ULQ B;  3C1D A;  1WZ2 A;  3G7R A;  3DTI A;  4V19 K;  2XDV A;  3QU3 A;  4WXC A;  1IXS B;  5L3G A;  1YJ9 I;  3O8G A;  5JI6 A;  4CCL A;  1VFC A;  3QPH A;  2KLO A;  2I5U A;  3BTC A;  4PCQ A;  4WXH A;  3S5R A;  5EGO B;  4NC8 A;  2GBY A;  3TBI A;  2V1N A;  3ABU A;  1E2X A;  1XD7 A;  3GFJ A;  1HKS A;  2PFV A;  2H09 A;  4PGG A;  4FHT A;  4M3B A;  3HEF A;  1BI0 A;  1MIJ A;  3DLA A;  2VE8 A;  3MZ8 A;  3CC7 I;  2O61 A;  3JRF A;  3LSH A;  3CP8 A;  1JUS A;  1ZG1 A;  2MG4 A;  2XPW A;  4ZZD A;  3S3O A;  3K4J A;  3HM5 A;  3MMY B;  2BW3 B;  1T6S A;  4CYD A;  2KQR A;  2MD5 A;  2R93 J;  3F21 A;  2XF7 A;  4GO1 A;  3OS0 A;  3MAJ A;  4A3M J;  3H36 A;  3OYD A;  3SEQ A;  2JTV A;  2UXH A;  1PYV A;  4KT6 A;  5ICE A;  4S0H B;  4JBA A;  2XRN A;  1Y0U A;  1O4X A;  1HA8 A;  2ZME B;  2QSG X;  3J81 Z;  3K4B A;  3S93 A;  5FRN A;  1KQ9 A;  1YS7 A;  4A69 C;  5C4J J;  3S2D J;  2FML A;  4HQM A;  2W24 A;  2JPB A;  3FMS A;  3VVY A;  3Q3S A;  2YU9 J;  4F7Z A;  1FMV A;  5FLM J;  1LFU P;  2XUB A;  2EZH A;  1MDM A;  2WC2 A;  2EK5 A;  3EUH C;  2GXG A;  4IRI A;  2HWV A;  2CQX A;  1Z21 A;  1RRJ A;  3K1P A;  5GTH C;  5E18 F;  5GAG J;  2P7V B;  3I5U A;  1YX5 A;  2KIS A;  1D3Y A;  3OOP A;  4RDU A;  5CLS A;  4XBF A;  1R1V A;  3QP5 A;  4YZE A;  2AO9 A;  5FRO A;  1HQC A;  4AIH A;  3FK7 A;  1PUF B;  4AWX B;  3H5A A;  3DFG A;  3O2P E;  2O8X A;  4MEX F;  5D5W B;  3JTH A;  4P9U A;  3QOE A;  1ZN2 A;  4A3J J;  2XGE A;  4C9Y A;  1RI7 A;  3LQQ A;  2OER A;  2R7Q A;  1FIP A;  2KRC A;  2RC4 A;  2QKM B;  1K4S A;  5F64 A;  1BN5 A;  3RI4 A;  5CXG A;  2A6E F;  3CCR I;  5LFA A;  1OCO H;  2X1E A;  4HF0 A;  1SFE A;  3A0H C;  2DA7 A;  1GV2 A;  1OLT A;  4MQV A;  4B47 A;  4CZC A;  2JVH A;  4BBS J;  5M5W J;  2XPU A;  2F6C A;  2VBY A;  2O0Y A;  4U88 A; 
#chains in the Genus database with same CATH homology
 2RHA A;  3BTL A;  2M0C A;  1GDT A;  2VUM J;  2UXI A;  2XB5 A;  1AKH A;  2ECB A;  5EGO A;  4W1U A;  1HF0 A;  1BW6 A;  2N8G A;  2MW8 A;  4X1E A;  3LSP A;  2G7L A;  2COB A;  5EDN A;  2ZOZ A;  1LE8 A;  4LOC A;  2EZL A;  4DYR A;  3RZO J;  2RAE A;  1VF9 A;  2OI8 A;  2O7O A;  4L5E A;  1UI5 A;  1D5Y A;  3M3Y J;  4D5C A;  3BR6 A;  2H8R A;  4A3I J;  3HBL A;  2JK3 A;  1QPI A;  4FTH A;  4AYB N;  1Y1V J;  2NS7 A;  2NS8 A;  2HQ5 A;  1ITY A;  2WAQ N;  3MNL A;  2DG7 A;  2JN6 A;  3NNR A;  2Y2Z A;  1UHS A;  3TED A;  2XSD C;  5C4X J;  3DCF A;  3JR9 A;  2NOG A;  4XRS G;  5CW8 A;  4X6A J;  2EZI A;  2Y9Z A;  1B8I A;  5FGL A;  2DA5 A;  5IOZ A;  1EF4 A;  3NAR A;  5DTD A;  4D7M A;  1U78 A;  4D7N A;  1ETX A;  2Y30 A;  5F27 A;  2I10 A;  1U9N A;  2M8G X;  5F0F A;  1IDY A;  2MGQ A;  5EZG A;  4BY7 J;  1P7I A;  1TWH J;  3Q0U A;  1XS9 A;  3CMY A;  2ZOY A;  3L1P A;  4I76 A;  2R5Z A;  2DA6 A;  3HTH A;  2LK2 A;  2FJ1 A;  2B63 J;  3S1Q J;  2QF7 A;  5K7F A;  3GTL J;  3IV5 A;  1CQT A;  2L7M P;  2LR8 A;  1ZR2 A;  3ZQL A;  3G1M A;  3T6N A;  2D6Y A;  2E19 A;  2L0K A;  5C44 J;  1SFO J;  1OCP A;  5F0C A;  3KNW A;  5J1U A;  2QCO A;  2G0E A;  4M3F A;  3VUQ A;  4M3D A;  2R92 J;  3ZOB A;  2OF7 A;  2FQ4 A;  5F08 A;  1GVD A;  1BL0 A;  2O9L A;  1Z77 A;  3BG3 A;  2CRG A;  2GEN A;  3HE0 A;  3HOV J;  2DA2 A;  2LTP A;  3VPR A;  5IYC J;  3GTG J;  3V78 A;  2JA6 J;  3BQY A;  1Z0X A;  2G7S A;  2X6O A;  1HOM A;  5IOY A;  1GUU A;  4DZJ A;  1B72 B;  3BHQ A;  1ZTR A;  3B6C A;  2JWT A;  2O7T A;  2XGD A;  4W97 A;  3G1L A;  3G1O A;  5EYR A;  1W0T A;  3S14 J;  2DA4 A;  2R0Q C;  1BA5 A;  3VP5 A;  4C3I J;  1T56 A;  2E2I J;  3JSJ A;  1WPK A;  2ZCX A;  3CDL A;  5FHP A;  1I6H J;  5EFY A;  3RZD J;  3LHQ A;  3MVP A;  1RPW A;  4A3D J;  3RD3 A;  3S1R J;  3TW7 A;  3BR3 A;  1FTT A;  4QSH A;  2RAS A;  2R5Z B;  1RR7 A;  1Y1W J;  5AQC A;  2HKU A;  2FX0 A;  1IUF A;  1FTZ A;  2E1O A;  2HDD A;  2QOP A;  2EBI A;  4C2M J;  3GTM J;  3GZI A;  3OSF A;  3PPB A;  3HIM A;  2O8K A;  2K9S A;  3TW6 A;  4L62 A;  4GFB A;  3LSR A;  5FJ8 J;  2D5V A;  2L9R A;  5F04 A;  1NTC A;  3E7L A;  2VI6 A;  4BBR J;  4UUS B;  5J3L A;  1E3O C;  3FKI J;  2NP3 A;  2UXU A;  3LSG A;  3K2A A;  2R5Y B;  2GM4 A;  2XGC A;  3GTQ J;  2L7Z A;  4MFD A;  3W6V A;  3MN2 A;  3QBM A;  4B4C A;  3A01 A;  3A01 B;  4AC0 A;  3JRB A;  1AHD P;  2HYJ A;  3OOU A;  3CQZ J;  3WHB A;  1MSF C;  4A3L J;  1ETY A;  2VPR A;  3GBG A;  2R5Y A;  1S7E A;  5FKL A;  2ECC A;  3SJM A;  2KDZ A;  3JRA A;  3Q0V A;  5K7H A;  3BTI A;  5EEA A;  4A3C J;  3COL A;  4ICH A;  1ETO A;  3IH2 A;  2LKX A;  5IP9 J;  2WV1 A;  1MH3 A;  3B6A A;  3NI7 A;  5FMP A;  2XB0 X;  4PXI A;  2NP5 A;  3DEW A;  5FKK A;  4GFK A;  2LLK A;  3D1N I;  1F43 A;  1JUM A;  1U8B A;  4BXX J;  3CRJ A;  3GEU A;  5CXI A;  1JJ8 C;  5IP7 J;  9ANT A;  4JL3 A;  1IRZ A;  3TP0 A;  2DG8 A;  3F0C A;  1R9T J;  3K7A J;  2WB1 N;  5FLV A;  5K58 A;  3HTJ A;  4MFE A;  5K7Z A;  5C3E J;  2X9D A;  5E3O A;  3ZQG A;  3I4M J;  2FD5 A;  1ORK A;  3AQS A;  2HXI A;  4ACI A;  1U9O A;  2K9N A;  1ETV A;  1X58 A;  4IEJ A;  3QPS A;  1JJ6 C;  2CUF A;  5EG0 B;  2IBD A;  2FBQ A;  2REK A;  4A3K J;  1Q1V A;  2LY9 A;  1ZGW A;  2ZCM A;  3BCG A;  4JP0 A;  5HOD A;  4FCY A;  2YVH A;  1QVT A;  4A3B J;  2DA1 A;  2MSY A;  3BR0 A;  5BNG A;  2LD5 A;  3BG9 A;  1ZK8 A;  2NVY J;  4CYC B;  4CYC A;  2UXO A;  3ON4 A;  1SAN A;  1JKO C;  4IHX A;  2JJ7 A;  4XRM A;  4G12 A;  2NVX J;  2WUI A;  3VVZ A;  3SDG A;  3FIW A;  3TP3 A;  1ETW A;  2K40 A;  4JKZ A;  3RQI A;  4V2F A;  4Y52 J;  1IJW C;  4B1R A;  3ANG A;  5E3N A;  3FRQ A;  4JNN A;  3HTI A;  5D1R A;  1ENH A;  1IC8 A;  2AHQ A;  4IHY A;  3Q0W A;  2YS9 A;  3GTO J;  1HDD C;  4UDS A;  5J1Y A;  2TRT A;  3RKQ A;  2NVT J;  3EUP A;  3H0G J;  1OJL A;  5E3M A;  3HOU J;  2GLO A;  1RKT A;  2E2H J;  3B81 A;  5IYB J;  2H1K A;  3MKL A;  2WGB A;  1GT0 C;  3NXC A;  1MBF A;  1BJZ A;  1IDZ A;  3EGQ A;  2UXP A;  1TWF J;  2DJN A;  3S15 J;  2HI3 A;  4M3G A;  3BJB A;  2E2J J;  2JA5 J;  2XPV A;  1FJL A;  2Q24 A;  3HOW J;  2JA8 J;  2ZCN A;  3VW1 A;  1FIA A;  2LP0 A;  2HXO A;  2ZB9 A;  3S2H J;  1G2H A;  3P9T A;  5FKM A;  5M5Y J;  3HKZ N;  1DU0 A;  4XIC A;  5HSZ A;  5DAJ A;  2YUS A;  1TWG J;  2EQR A;  3E7Q A;  2HOT A;  2GFN A;  3KKD A;  1QVU A;  4D5F A;  1IV6 A;  2YVE A;  2EH3 A;  3O60 A;  4HKU A;  4HNV A;  5E3L A;  3NRG A;  2HOA A;  3LSJ A;  4CGR A;  1JUP A;  2DMT A;  3FIS A;  4C3H J;  3PAS A;  5DS9 A;  4JX4 A;  4MK6 A;  4GCL A;  4JYK A;  2PMZ N;  5IPA A;  3S1M J;  3RH2 A;  1JKQ C;  1MBK A;  1H8A C;  3JRG A;  3ZQC A;  3ZQF A;  1JT6 A;  2ME6 A;  1LFB A;  4JX5 A;  4UUT A;  1H89 C;  2HOS A;  3HGY A;  3PM1 A;  3HDD A;  3GTK J;  3HOX J;  3UKG A;  2QKO A;  3G56 A;  1OCT C;  3HGG A;  4BKX A;  2DMN A;  2X48 A;  4UUS A;  1LE8 B;  1WCM J;  1YRN A;  3BR5 A;  5FKN A;  4QIW N;  5EZH A;  2W48 A;  4XRS A;  3KKC A;  3OSG A;  1RES A;  4XK4 A;  3QQA A;  4RBO A;  2ME0 A;  2LVS A;  3BTJ A;  2ID3 A;  2NX4 A;  2XDN A;  3VVX A;  4DW6 A;  1WH5 A;  3S16 J;  2QIB A;  3ON2 A;  2DMU A;  5EF6 A;  2Y0S N;  2DN0 A;  1X2M A;  1B72 A;  1ETQ A;  3M4O J;  3BNI A;  4A3E J;  4JX6 A;  4XID A;  3BG5 A;  4ABZ A;  4MXM A;  1APL C;  3V6G A;  3BRU A;  2QWT A;  1MBE A;  1WI3 A;  3A02 A;  4MO7 A;  5EG0 A;  1JKP C;  2HYT A;  3VW2 A;  3IH4 A;  2CUE A;  5FKO A;  3JRI A;  1JTY A;  5J1R A;  1ZQ3 P;  4AC6 A;  4NEL A;  4NN1 A;  1NK3 P;  1P7J A;  3LNQ A;  2M34 A;  2Y31 A;  2IU5 A;  1PUF A;  1A6I A;  1H88 C;  4DYC A;  5HBU A;  1VI0 A;  1WH7 A;  1MNM C;  3C2B A;  3HB9 A;  4GCK A;  2LFB A;  3S1N J;  3BR2 A;  5F0H A;  1UI6 A;  3GTJ J;  1YRN B;  3BR1 A;  5M3M J;  1I3Q J;  1HCR A;  3PO2 J;  2W53 A;  3VW0 A;  4FE4 A;  1POG A;  3HOY J;  2OPT A;  1RKW A;  2CQQ A;  2Y9Y A;  1I50 J;  1X2N A;  5JLW A;  1B8I B;  4J19 A;  2DA3 A;  3NAU A;  3C07 A;  3VIB A;  4AUX A;  2NVQ J;  3JRE A;  2V57 A;  2JMW A;  1UG2 A;  3ZQI A;  4A3F J;  5M5X J;  1IG7 A;  2IEK A;  3HTA A;  1QRY A;  2IAI A;  3SFI A;  2G7G A;  1FEX A;  1T33 A;  3G7R A;  2VKE A;  1HLV A;  3NPI A;  3JRD A;  4EEF G;  2PBX A;  3O8G A;  1JTX A;  2L7F P;  3IH3 A;  3A03 A;  1VFC A;  1SGM A;  3BTC A;  3S5R A;  3JRH A;  1JKR C;  2M9H A;  4FIS A;  4C3J J;  2R7Z J;  5EGO B;  3LWJ A;  2GBY A;  4M6V A;  5IP6 A;  2QTQ A;  1HDP A;  5M3F J;  4I6Z A;  5GPA A;  3GTP J;  1XC5 A;  1GV5 A;  4M3B A;  3HEF A;  4M3E A;  3KZ9 A;  1MSE C;  2GUH A;  3JRF A;  2F07 A;  1A5J A;  3ANP A;  1RET A;  1JUS A;  2MG4 A;  2XPW A;  3BT9 A;  1AKH B;  3PO3 J;  4A93 J;  4B3A A;  4IHW A;  3HM5 A;  2P81 A;  1WGX A;  1OFC X;  3BQZ A;  1UMQ A;  2R93 J;  4FE7 A;  4ME9 A;  2CU7 A;  3CWR A;  4A3M J;  5D19 A;  4MLO A;  3CJD A;  2KT0 A;  4V2G A;  1TWC J;  1VND A;  3WHC A;  1W0U A;  3QKX A;  2UXH A;  5C4Y A;  2XRL A;  4S0H B;  4IHV A;  4GFL A;  1O4X A;  4NDL A;  1MH4 A;  2DMQ A;  3OIO A;  3DPJ A;  3VOK A;  1ZKG A;  3LJL A;  1ETK A;  2M2E A;  4A69 C;  5C4J J;  4BY1 J;  3S2D J;  2DTZ A;  3IUV A;  3F1B A;  3VVY A;  3Q3S A;  2YU9 J;  2VKV A;  3QPL A;  5FLM J;  1LFU P;  4KWA A;  3AQT A;  3VOX A;  3FK6 A;  2EZH A;  2CJJ A;  4GCT A;  2CQX A;  4DZP A;  5F1J A;  3CCY A;  3HOZ J;  4DYQ A;  4RDU A;  3S17 J;  1TWA J;  5IYD J;  4YZE A;  2AO9 A;  5JLX A;  1NK2 P;  4A3G J;  2ELK A;  3FK7 A;  1PUF B;  1TC3 C;  5D18 A;  1JGG A;  1BW5 A;  1K61 A;  1JT0 A;  2EZK A;  2XGE A;  4A3J J;  2OER A;  3H3V K;  1K83 J;  1XG1 A;  4Y7N J;  1FIP A;  2G3B A;  2K9Q A;  1F36 A;  3I4N J;  5CXG A;  2JA7 J;  1MBG A;  4AF5 A;  4MIM A;  5GPC A;  3LOC A;  1MBH A;  3JRC A;  1MBJ A;  3O8H A;  4QTR A;  3ZQH A;  1IGN A;  2DA7 A;  2PZ9 A;  1GV2 A;  5H9T A;  2TCT A;  5GP9 A;  2DMP A;  1ZR4 A;  4BBS J;  1AU7 A;  1DU6 A;  5M5W J;  2ID6 A;  2XPU A;  5HAW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...