3WHCA

Crystal structure of a transcriptional regulator fadr from bacillus subtilis in complex with stearoyl-coa
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
190
structure length
190
Chain Sequence
KRPKYMQIIDAAVEVIAENGYHQSQVSKIAKQAGVADGTIYLYFKNKEDILISLFKEKMGQFIERMEEDIKEKATAKEKLALVISKHFSLLAGDHNLAIVTQLELRQSNLELRQKINEILKGYLNILDGILTEGIQSGEIKEGLDVRLARQMIFGTIDETVTTWVMNDQKYDLVALSNSVLELLVSGIHN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Fatty acid metabolism regulator protein
publication title Structural characterization of a ligand-bound form of Bacillus subtilis FadR involved in the regulation of fatty acid degradation.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 77
structure length 190
sequence length 190
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08359 TetR_C_4 YsiA-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3whcA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3whcA02
2OF7A 4DYQA 3S2HJ 3T6NA 3A02A 4JL3A 2HQ5A 5EF6A 1NK2P 4JP0A 3S1RJ 5M5WJ 3RZDJ 3SFIA 1RR7A 5J3LA 3HTIA 1QVUA 4ACIA 2K9NA 3HIMA 3I4MJ 3GEUA 2HKUA 1RPWA 2LKXA 3ANGA 2L7ZA 3K7AJ 4B1RA 4M3EA 3BR0A 3FRQA 3HOZJ 3BHQA 3G56A 1A5JA 2K40A 2PBXA 3IUVA 1TWAJ 5F0CA 3NI7A 3MN2A 4X1EA 1WI3A 3VW2A 4L62A 3E7LA 5FLVA 1IRZA 2UXUA 3HBLA 4A3CJ 2VI6A 3OSFA 4B4CA 4JKZA 1LE8B 2EQRA 4NELA 5M3FJ 1P7JA 2CUEA 4LOCA 2DA2A 5JLXA 4QIWN 2CU7A 3HEFA 1K83J 1IDYA 2OERA 5C4JJ 5CW8A 2O7OA 1JKOC 2LD5A 1OCTC 1T56A 1TWFJ 4MFDA 1I3QJ 4PXIA 2AHQA 1SFOJ 4XRMA 1RKWA 3HM5A 1IGNA 4I6ZA 3VVYA 2NS8A 1MBEA 3WHCA 4HNVA 2HDDA 2EZIA 2NVYJ 3Q3SA 1DU0A 1F36A 2E1OA 2L0KA 4CYCB 1JTYA 5FKLA 3HTJA 2B63J 2XPVA 1ENHA 1PUFA 2D5VA 3GTGJ 4FE7A 3S5RA 1I50J 1FIAA 5FHPA 3BTJA 3IH3A 4C3HJ 2R0QC 2NP3A 3F1BA 1GUUA 4W1UA 1JT6A 2VKVA 1HOMA 4MFEA 2COBA 4V2FA 2LY9A 5IYCJ 3V6GA 5DS9A 4A3LJ 3FKIJ 3RQIA 3GTQJ 5F0FA 1Y1VJ 5C44J 1UI5A 3KKCA 4DZJA 3NAUA 3GTJJ 1D5YA 1FEXA 3AQSA 4JNNA 3HOUJ 3VW1A 3VPRA 2G7GA 4ICHA 1LFBA 2VPRA 2G7SA 2Y2ZA 2NX4A 1ETVA 5FKKA 4BXXJ 2H8RA 3COLA 3Q0WA 4DYCA 4GCKA 3LSRA 2O7TA 2DA6A 1S7EA 1JKRC 1UG2A 2M0CA 3ZQHA 2R5ZB 1ZR2A 3EUPA 2IAIA 4AYBN 3LWJA 3JSJA 4HKUA 3CMYA 1Q1VA 3BTLA 2R5YB 5J1YA 1APLC 4FISA 1GT0C 5F04A 4CGRA 1VFCA 1EF4A 1X2NA 3GZIA 2CQQA 1WCMJ 2L9RA 3MVPA 3OOUA 3BR1A 2N8GA 3GTLJ 1MBFA 3JRBA 3LSPA 2UXHA 2R92J 3BR2A 4MIMA 2LFBA 4YZEA 4M3FA 4AC0A 5FMPA 1AKHA 1WGXA 3WHBA 2HXOA 4G12A 5D1RA 4W97A 2XSDC 1MBJA 2HI3A 2HOAA 3EGQA 2YS9A 3BR6A 4V2GA 4C3JJ 5E3OA 2H1KA 2F07A 5HBUA 3BR3A 1H88C 3IV5A 3HTAA 4DYRA 2M8GX 2LR8A 1MSEC 1RKTA 2UXIA 5EG0A 2FBQA 3JR9A 2YVEA 3O8GA 2ME6A 4IHWA 3O60A 4RBOA 3BNIA 3CDLA 1W0UA 4EEFG 4BBSJ 3CQZJ 2RASA 1MBKA 2E2IJ 4IHVA 2MW8A 5FKOA 2QWTA 5EZHA 2VUMJ 4AF5A 1Z0XA 2P81A 5IP9J 2VKEA 2ID3A 2TRTA 3LOCA 3JRIA 4FE4A 1QVTA 4A3MJ 1B8IB 2M2EA 2DA4A 1O4XA 2W53A 3I4NJ 5CXGA 1JKQC 2X9DA 1JJ6C 3GBGA 3GTPJ 2MG4A 5DTDA 5K7ZA 3BG9A 3SJMA 4BBRJ 4GCLA 3BG3A 2MSYA 4A3KJ 3NARA 5EEAA 1ETKA 3FK6A 1HDPA 5CXIA 5EZGA 1JUSA 2L7FP 2DA7A 3C2BA 4FTHA 3NPIA 3S16J 3RKQA 2CJJA 4XRSA 2TCTA 3VW0A 4UUSB 1I6HJ 1ETYA 1HF0A 1U9OA 2GM4A 4A3FJ 1FJLA 2HOTA 1VNDA 3ON2A 4XICA 1XS9A 4UDSA 2QIBA 2WAQN 5DAJA 1BW5A 2LP0A 2GBYA 3GTMJ 2HOSA 2ZCXA 2UXOA 2NP5A 2CUFA 4A3IJ 2DJNA 4M6VA 3A01B 2E19A 4XK4A 2JMWA 1LE8A 1IJWC 3OSGA 4M3GA 2WUIA 5HSZA 2CQXA 4DW6A 1BL0A 3JRAA 3S2DJ 1JT0A 2XPUA 2ID6A 1MBHA 3LNQA 5K58A 3V78A 3BCGA 3VOKA 2M34A 3F0CA 1UI6A 4AUXA 2DA3A 2DMNA 2WGBA 2JA8J 2O8KA 5EGOB 5K7FA 2FD5A 3IH2A 1XC5A 3RZOJ 2Y9YA 2EZKA 3QKXA 3ZQFA 4IEJA 2GENA 1ETQA 5IOYA 1HCRA 5HAWA 2QF7A 1AHDP 3K2AA 1OFCX 1BJZA 1OJLA 5M5YJ 3HKZN 4A3DJ 1ITYA 3HB9A 4IHYA 3QPLA 5F08A 2NVQJ 3NXCA 2AO9A 3ANPA 5AQCA 2KT0A 1TWCJ 1TC3C 1QRYA 4QSHA 3TEDA 2ZB9A 3PPBA 3VVXA 2YUSA 5IP6A 3GTKJ 1RETA 4GFKA 5GP9A 5FJ8J 3PASA 3JRCA 1ZK8A 3BR5A 3QPSA 3BQYA 4XRSG 4MLOA 5F0HA 3BQZA 1B72B 3ZOBA 3IH4A 2ME0A 2MGQA 2L7MP 4JX6A 2DG8A 3NRGA 2LVSA 1MBGA 1A6IA 4AC6A 5M5XJ 2XB5A 4BY7J 5E3NA 4S0HB 1NK3P 2ZOZA 1LFUP 2M9HA 2HYTA 1K61A 1JKPC 5C4YA 3RD3A 3G1MA 3ZQGA 2RHAA 2R5YA 1YRNA 1FTZA 5F27A 1IG7A 3FIWA 3W6VA 4M3DA 1AKHB 1MSFC 1JJ8C 3ZQLA 3HTHA 3NNRA 3JRGA 5EFYA 3JRHA 1ZQ3P 3ON4A 2DMQA 3PO3J 4Y52J 4MO7A 5H9TA 1HLVA 3OIOA 1MH4A 2EH3A 1TWHJ 5E3MA 2K9QA 3LSGA 4C2MJ 3BT9A 5FLMJ 3HOWJ 4J19A 1NTCA 3SDGA 1SANA 1GVDA 2E2HJ 3S1MJ 2JJ7A 2WV1A 3H3VK 2XGDA 3CWRA 5D19A 2X6OA 2CRGA 3HGGA 5D18A 3AQTA 4D5CA 4JX4A 2DTZA 4B3AA 2QTQA 3LSJA 1R9TJ 1AU7A 2PZ9A 3KZ9A 3S14J 1HDDC 5F1JA 5C3EJ 2XGCA 3M4OJ 3BRUA 4D7MA 3QQAA 5FKMA 2D6YA 1VI0A 1Y1WJ 2IU5A 2NVTJ 3VIBA 5E3LA 4KWAA 2FJ1A 4M3BA 3S15J 2EBIA 3FISA 3JREA 1WH5A 2IEKA 1UHSA 2XB0X 2DA5A 3VVZA 3B6CA 2PMZN 1B8IA 3CRJA 3VP5A 2XRLA 3RH2A 1MH3A 3GTOJ 2JK3A 2W48A 4GFBA 3QBMA 4JYKA 2HXIA 5IYDJ 3C07A 2YU9J 3B81A 4FCYA 3CJDA 3DCFA 2XPWA 5FGLA 1FIPA 1IUFA 5FKNA 3PO2J 2NS7A 2JA7J 2QCOA 3TP0A 2GLOA 3LJLA 4A3GJ 4XIDA 1H89C 3MKLA 1IC8A 5C4XJ 2ZCMA 3CCYA 3P9TA 9ANTA 4Y7NJ 4RDUA 1GDTA 5IPAA 4UUSA 1ETWA 3L1PA 3HGYA 3Q0UA 3D1NI 3TW7A 2DA1A 1JUMA 4A69C 2RAEA 5EYRA 1U78A 5GPCA 3JRFA 1H8AC 3VUQA 4DZPA 2X48A 4A93J 2R93J 2G3BA 3PM1A 3KKDA 3FK7A 1XG1A 3G1OA 2Y0SN 3A01A 1PUFB 2I10A 2G7LA 2GFNA 3ZQCA 3HOVJ 2REKA 1ZTRA 5J1RA 5BNGA 4MXMA 4ME9A 2LTPA 4CYCA 2QOPA 5JLWA 2KDZA 3M3YJ 2FX0A 2DN0A 3HOYJ 2Y9ZA 1WH7A 4BY1J 3JRDA 5IOZA 2XGEA 3O8HA 5EDNA 1ETOA 1JTXA 2DMTA 5EGOA 3HDDA 4JX5A 2JN6A 3BG5A 2FQ4A 3G7RA 5K7HA 4A3BJ 4ABZA 2JA5J 2XDNA 5IP7J 1POGA 5M3MJ 4X6AJ 3HOXJ 2GUHA 2Y31A 1MNMC 2EZLA 2DMUA 1UMQA 3S1NJ 1G2HA 4A3EJ 3TP3A 3Q0VA 4QTRA 3A03A 1ZR4A 2R7ZJ 4L5EA 1W0TA 2ECCA 2V57A 1U8BA 3B6AA 1BA5A 1GV2A 5HODA 1IV6A 1GV5A 3DEWA 2OI8A 5IYBJ 2R5ZA 4UUTA 3TW6A 3BTCA 5J1UA 1IDZA 1FTTA 2DG7A 2EZHA 1B72A 4MK6A 4GFLA 1WPKA 1SGMA 2DMPA 1T33A 2IBDA 1CQTA 1OCPA 4NDLA 4D7NA 3BTIA 1BW6A 1YRNB 2HYJA 4C3IJ 3UKGA 2UXPA 2Q24A 3BJBA 3MNLA 3ZQIA 1X2MA 2JWTA 4GCTA 1TWGJ 2ELKA 1F43A 1E3OC 2ZCNA 2YVHA 2LK2A 2ZOYA 1Z77A 1RESA 2G0EA 2OPTA 1ZGWA 5GPAA 5EG0B 1QPIA 1JUPA 1ZKGA 2NOGA 2WB1N 1DU6A 1X58A 3VOXA 3LHQA 1ETXA 1ORKA 3H0GJ 1VF9A 3KNWA 4IHXA 4BKXA 2Y30A 2K9SA 3S1QJ 2E2JJ 2O9LA 3DPJA 4D5FA 3S17J 2LLKA 1JGGA 4NN1A 4I76A 2NVXJ 3HE0A 3G1LA 2JA6J 1P7IA 1U9NA 4A3JJ 3E7QA 2QKOA 2ECBA
chains in the Genus database with same CATH superfamily
3A02A 3VB2A 2EV0A 2HQ5A 4FT8A 4R8HA 3S1RJ 2OCEA 2RQQA 1R5HA 1QVUA 4ACIA 2ZMEC 3HIMA 4AIKA 2KJCA 4LLLA 1CF7A 1Z7UA 2HKUA 3GEUA 5CYVA 3K7AJ 2F6CA 1VQLI 1D8KA 1DQUA 4B1RA 2DQRA 1YS6A 3BR0A 3TQNA 3G71I 3G56A 1PJRA 3I3LA 1T0FA 2NYXA 2MABA 2IVMA 5HNFA 2OQGA 1WI3A 3E7LA 2RC4A 3QOEA 1XPXA 1IRZA 2UXUA 3CP8A 1D0XA 2CO5A 4RGUA 3S3OA 3CCLI 3MFKA 3F72A 1I39A 1X4OA 2HEOA 4JKZA 4KIBA 1TNTA 1P7JA 4L9TA 3BC8A 4DBRA 3I54A 2LNBA 3HEFA 2BE5F 2MD5A 5GAGJ 3CO7C 5C4JJ 3VODA 4BEHB 2VBXA 1GHCA 1OCTC 1DGRM 1TWFJ 3JCUC 4PXIA 2CFOA 2BY1A 2RGVA 3BCBA 1MZBA 2NOJB 3HM5A 4I6ZA 3N05A 1IGNA 1WJAA 3WHCA 2EZIA 4O5VA 1SD7A 2FNAA 5DM6F 4XLEA 2OQRA 3BG7A 4DQ2A 2QEXI 3W6JB 2J5OA 3S5RA 2AXLA 3IH3A 3GCMA 4C3HJ 2R0QC 2NP3A 1EA3A 3O3KA 1JT6A 2V6EA 2VKVA 2X6XA 4ESFA 2DLLA 1SFOJ 1T38A 1GXPA 4D9JA 5F0FA 2XROA 3QU6A 2K4JA 1A35A 4LITA 1D5YA 3AQSA 4Y33A 3RJPA 2OTLI 1UHWA 2G7SA 1XD7A 2NX4A 4U7DA 2IGNA 3S2WA 4L5JA 2KHMA 1FNNA 3COLA 3Q0WA 4DYCA 4GCKA 1QHGA 5DCMA 3R61A 3LSRA 1JKRC 2RREA 3OYBA 1ZR2A 2IAIA 3EUKL 3FMQA 4HKUA 1HSJA 4UXNA 5FLXZ 2CG4A 2OA4A 1APLC 2QWWA 4IHTA 4FX0A 1GT0C 3J7AO 2KDOA 5F04A 3WTWC 4CGRA 1VFCA 3I58A 3IP4B 3RDIA 3GEZA 2ZJ2A 1ON1A 3LL7A 5DUKA 4I0AA 4E6KG 1YIOA 5LHGA 4C9YA 2LFBA 3J7YJ 4CA0A 2YPRA 1FC3A 1AKHA 3LSKA 3DXJF 4J01A 2HXOA 1FSEA 1HXDA 5D1RA 2BZTA 3EGQA 2JUGA 1SFUA 5LGUA 3FZVA 2CW8A 3TGNA 2H1KA 3IV5A 3DKYA 4F93B 2M7AA 2M8GX 1IXSB 1OPCA 3EUHC 1RUNA 1R71A 1G59A 3H35A 3RTRA 4IHWA 2YVEA 3HIFA 5J4YA 4RBOA 3O60A 2MH2A 2WV0A 4EEFG 2Z1DA 1O57A 1WJFA 3ASNH 5F1RA 1XSDA 4RB1A 3RKXA 4E7KA 2Q8KA 2VBYA 2E2IJ 4IHVA 3ZMUA 2QWTA 4XSZF 4IRHA 3MKWB 2P81A 2M7BA 2XAUA 2VKEA 2ID3A 3LOCA 1R1UA 2XKOA 4XLAA 4ZTJA 3QODA 4FE4A 1QVTA 2IGKA 2W4SA 4CH7A 1K7AA 2HKOA 5L3GA 1JE8A 2VKHA 4M6YA 2XVCA 4X0GA 4G9YA 2V26A 1WRJA 1Z91A 1JKQC 2X9DA 4ENMA 4EJUA 3GTPJ 3G73A 4AYBA 4Z2YA 4GCLA 3KFWX 3TMOA 2MSYA 4I99C 1MMNA 4A3KJ 5FGMA 3PFIA 4WK8F 1LEAA 1IZ1A 1HDPA 4U9NA 2HPMA 2KMUA 2L7FP 2DA7A 2ETHA 3RKQA 2CJJA 2WC2A 1E3HA 2Q0OA 1S72I 4OU0A 2YU3A 1HF0A 1VZ0A 1U9OA 1L0OC 4A3FJ 1FJLA 2HOTA 3ON2A 4HX8A 2RV8A 3DU6A 5DAJA 5CVUA 2W85A 4CCLA 2HOSA 2V7FA 1PUEE 2NP5A 1BN5A 1IN5A 2L5QA 1B9MA 4XK4A 2JMWA 2VLAA 3OSGA 4M3GA 3GUDA 4LFUA 1UCRA 3PQKA 3OYHA 5D4RA 1A31A 3S2DJ 5GADJ 1JT0A 4YIFA 1WFXA 2GXGA 1ZYRF 1MBHA 4Q4ZF 1UAAA 3V78A 2VIXA 3RYPA 1UI6A 1TQPA 2DMNA 2WA0A 2V6CA 3IRQA 4IKFA 1EH6A 1IV8A 1GVJA 4B44A 3O2PE 3S3NA 3OR1C 2XKPA 1G4DA 2EZKA 2KZVA 2VC1A 2NVUB 1IRGA 3ZQFA 4PJLA 4IEJA 5HAWA 1USSA 2QF7A 4HYEA 2HVSA 3QOPA 2Q2EB 3CJTB 3HB9A 3DTIA 3AL0C 2LY1A 2LOOA 3W2VA 1TW2A 3NXCA 3RCOA 5ILVA 1TC3C 2ZB9A 3W6KB 2DK8A 2QKLB 3T1BA 4YRVA 2XC7A 3PASA 3JRCA 2BY2A 1XGMA 1B72B 3ZOBA 4EJTA 3K69A 1T8IA 4NC6A 4BL0B 2L7MP 2WAQA 5TRDA 2QBYB 2VQLA 3CJRB 1A6IA 4MEXF 2UXNA 5KCMA 1B59A 3QYBA 4KIGA 1R5GA 2HYTA 2K3FA 4RB0A 1Y8RB 1OCOH 1W36C 1WZ2A 1P9QC 1FYMA 2RHAA 3MKYB 2LDUA 2W1OA 3BP8A 2JUCA 5CKTA 1JI8A 4M3DA 1MSFC 4HPQA 1JJ8C 3CTAA 2IRFG 4V19K 3MWMA 1K78A 2DMQA 1ZARA 2COMA 1DDNA 1ZAOA 4II3A 2X6YA 1W7PA 3NRVA 5LHIA 1IN7A 2QQBA 2E2HJ 2GWRA 1SANA 3DBRB 3SQNA 3GVAA 1YJNI 1LJ9A 4U0YA 3H3VK 4CGZA 5D19A 2PLYA 4YFNF 5D18A 4MNUA 2HGCA 2DFEA 5H6RA 1YW8A 2DTZA 2H1LA 3CUOA 1IN4A 2EJRA 5FROA 3LWFA 3CLQA 3D5LA 1YW9A 3ABTA 3S14J 1HDDC 2DOAA 2A6HF 1X1DA 3M4OJ 2H8WA 5D5XB 2VN2A 4BE0A 1E0EA 5FKMA 3V7RA 2IU5A 1S7AA 5E3LA 1XN7A 2FJ1A 4QLCU 3FISA 2H94A 3OYNA 4CCNA 1WH5A 1S3JA 3I71A 2V1DA 2PMZN 1B8IA 4RAFA 3FX3A 4I98B 3FWEA 3BOQA 1J5YA 1MH3A 1MNEA 2BYVE 2F5CA 4A6EA 2W48A 3S3MA 3CCUI 3F8FA 5GTHC 1S7OA 3HTUA 2XPWA 4XN3A 3C2GA 4EJOA 2KL4A 2E1CA 5FGLA 5D6EA 2R7XA 1Z1DA 2A05A 3B73A 3FXOA 3KZYA 3CC4I 4EQQA 2CW0F 3BPXA 3KZZA 1ZH5A 5C4XJ 4I09A 3L2UA 4RDUA 1GDTA 3S8PA 4UUSA 2I5UA 1ETWA 2V79A 5B66C 3TW7A 2DA1A 2RAEA 1H8AC 3OYLA 3VUQA 3ASOH 2DOFA 3TOBA 4DZPA 2X48A 4OMYA 1KA8A 3JAMZ 3O6BB 3SWHA 2GAUA 1TT5B 2LBFA 1PUFB 3WTSC 2G7LA 3LSIA 1T6SA 4ENJA 2BHYA 4UB8C 1SAUA 2UUZA 3SZTA 1KU7A 2PJRA 4ZYHA 4RM2A 3ZQ7A 5JLWA 1VQMI 1FP2A 5ICGA 2DN0A 2Y9ZA 4G6DA 4C30A 2XGEA 1W5SA 5EDNA 2M3AA 1JTXA 3QPTA 2JN6A 2DBBA 4EV0A 2QYOA 1WI9A 4G7OF 4RLQA 2XDNA 5IP7J 5HNHA 2DU9A 2ZBKA 1U0JA 4OIRF 4A6DA 4A3EJ 1YLFA 1S29A 2C6YA 4KITB 3BDDA 2MD0A 4QTRA 3A03A 1GLNA 2ZMEB 1Z6TA 1U8BA 3B6AA 2PG4A 5HODA 1D1CA 3K4JA 3N4MA 4K2EA 4IXAA 3DEWA 2OI8A 2L2OA 2XV4S 2R5ZA 2L01A 5H6QA 3J80Z 3ROUA 3H9GA 5TISC 1R58A 3BTCA 5J1UA 2DAOA 4Y15A 4DBQA 2EZHA 3C18A 3K10A 3VYTB 1SGMA 3IWZA 4G6QA 2BVLA 2KRCA 4PUSA 3E97A 3DQVC 2EA2A 2P7CB 3BTIA 2FMYA 2FBIA 4JQFA 3UKGA 3D0SA 5E8GA 2Q24A 2VC0A 2GOMA 2JWTA 4IZZA 3AAFA 4XLPF 1BC8C 2YVHA 2V9PA 1P4XA 1QBJA 3P7NA 1FLIA 1VQOI 1XB4A 1Z77A 4B8XA 4HW0A 2F5FA 2OPTA 4KA4A 3DU5A 3M1CA 4GDFA 2DK5A 3AG3H 3LHQA 3MEXA 4IL6C 4XKBA 1VF9A 1KQ9A 2P0WA 4ZDOA 1FOKA 2Y69H 4CZZA 2O9LA 3DPJA 3V8JA 4D5FA 3S17J 2KPMA 3JAMK 4BXUA 5A2QZ 1FOYA 4AIJA 3HE0A 3ZGKA 5HS8A 3E7QA 1FTTA 1I1GA 4DYQA 2CV0A 3S2HJ 1NK2P 3AG1H 4ZC3A 1RR7A 2E34A 2ZJRF 1REPC 1YOVB 4OOIA 3ZMZA 1O7FA 1IF1A 3HUGA 4PDKA 1R4NB 3J7ZI 2PN6A 2BW3A 3FBIB 3TO9A 1KU2A 2EIKH 4M3EA 2VL8A 2I8DA 3FRQA 2VQCA 3H3UA 1A5JA 2X51A 4P9FA 3ZMSA 3FXJA 3I59A 2K40A 1TWAJ 3T8RA 1P4AA 3Q9SA 1MNDA 5GAEJ 4EGZA 4X1EA 3GO5A 3LQQA 4L62A 2Z16A 4XNFA 2JTVA 1I6XA 2ZXHA 3HBLA 2W57A 3H0DA 4BXFA 4A3CJ 3OSFA 1J75A 2OTJI 2K7LA 3GZNB 2Y0MA 3KYLA 2EQRA 4KFCA 3J80K 1G3SA 2LH9A 3EUAA 2XAHA 3IRRA 2DA2A 2DYSH 4QIWN 1A36A 4E7SA 3TO7A 1TP4A 4E7ZA 1TZLA 2LD5A 1T56A 2YX7A 4MFDA 2QENA 3IUOA 5DD4A 1IW7F 2AHQA 4CXFA 3MAJA 1RKWA 4RGSA 5E1ZB 2IJLA 3GW2A 2NS8A 4S05A 2HDDA 3ESWB 3MZ8A 2B1EA 3BJAA 3KP5A 5ICEA 1JTYA 2QSHX 5FKLA 2QZ8A 3FM5A 2D5VA 4UY8I 4P55A 1I50J 2RKHA 2K3PA 1ZHFA 4F92B 1XDSA 2HR3A 4NQWA 4W1UA 2ISYA 5E1WA 2D45A 3QP6A 4MFEA 2COBA 4HX7A 3SEQA 1K4SA 1B9NA 3GLLA 4A3LJ 3FKIJ 3RQIA 1O3RA 1QA6A 5HLTA 2D1HA 1IN6A 3N97A 4DZJA 1Z3XA 3ECHA 4JNNA 3HOUJ 2G7GA 2FBKA 4ZYEA 2TDXA 2EINH 1W36D 3M8EA 4HLXA 4CCMA 1VQ4I 1BIBA 3V4GA 2KISA 2VXDA 2DA6A 3DP7A 5ICFA 3OYFA 2BHZA 1H9TA 3FF5A 4P1WA 1UG2A 1MJAA 1EV7A 2OCCH 3OYDA 3MMYB 4AYBN 1A6QA 2ZXJA 3PUFA 2P5KA 2DI3A 4EM2A 4F3QA 4HF1A 3JSJA 3LWJA 2JT1A 2R5YB 5J1YA 2JZYA 3K2ZA 4WXCA 4E4HA 3MKZA 4LB5A 1WCMJ 4OD5A 3MVPA 3L2VA 2N8GA 1UELB 1MBFA 2L54A 3JRBA 3L2CA 4IOCF 3LSPA 2UXHA 2E5ZA 1OYWA 3BR2A 4AC0A 5D8KB 4MGRA 1D8JA 1WGXA 2NS0A 1MW7A 3DPTA 4W97A 1L3LA 3WTZA 3OYAA 1R23A 1U5TA 3UR3C 4U7BA 1FYKA 3SHFA 4A5NA 2MA3A 2FNPA 3FXUA 1R1TA 3BR3A 4IVNA 4DYRA 3IWFA 1YTYA 1MD0A 4ASNA 3MCZA 4YIIA 1V54H 5EG0A 2FBQA 1H9GA 4GCVA 2IGMA 2DOEA 2DDAA 3KEOA 5ERIA 1R1VA 3CCQI 3RPUD 2CH0A 4XM3A 1BI2A 5DM7F 3E6BA 3RYRA 5E79C 1S8NA 3J7AY 4F52A 4HOBA 3GFLA 4XLCA 5EZHA 3ZCOA 2VODA 1Z0XA 5IP9J 4N4NB 1XDUA 3FKJA 2VOOA 3GX4X 4A3MJ 3KP6A 1OCRH 2M2EA 4IJAA 2DA4A 1CF7B 2K9LA 4Q47A 5DCFA 1V5EA 1LDJA 5BPIA 1KU3A 1SVOA 1ZG3A 1JJ6C 1E2XA 3C2HA 3AL0B 3HSFA 5DTDA 3RKYA 2R7FA 4BBRJ 4WWCA 3L9FA 1X3UA 5EEAA 3GLXA 3CD6I 2KIUA 3WE3A 1OR7A 5EZGA 2M0MA 3V7SA 3CCJI 2FMLA 3C2BA 2DQLA 4F55A 1HKQA 1GXQA 2QQAA 4XRSA 1XCVA 2HS5A 4FQGA 3F23A 3VW0A 1OQYA 1ETYA 2LY2A 2HFHA 4XICA 1XS9A 2OU2A 5D5UB 2WAQN 1WVRA 2LP0A 2R7DA 4CDGA 2NXNB 1HW2A 2LMDA 2DJNA 4BU2A 3KYCB 3ABUA 2R7SA 3MD2A 1IJWC 2X85A 2YR2A 2WAFA 5JFRA 2CQXA 4DW6A 1IXRC 3JRAA 2E1MB 2F5VA 3H1CA 3OL4A 5K58A 4EM1A 4BEHA 4LJZF 2JA8J 2XAQA 5B3SH 4BQQA 3DTKA 3SDBA 4MQVA 3IH2A 3ZMTA 1X1CA 2Y9YA 3RZOJ 3LFUA 1E17A 3M9AA 3OYEA 5IOYA 1HCRA 1JHFA 1HBXG 1AHDP 1OFCX 4C2UA 1BJZA 1OJLA 1TLHB 4XOPA 3T8TA 5M5YJ 3GZ6A 5KHDA 1ZRCA 3QPLA 1UFMA 2CV2A 2YVXA 2NVQJ 4YG2F 2HDWA 4RB2C 3ANPA 5AQCA 1BOAA 1QRYA 1SAXA 3VVXA 2X0LA 1B4AA 2YUSA 1TBXA 4KMFA 1A04A 1TNSA 4GFKA 5FJ8J 4HSTA 1T2KA 3K1PA 2L3DA 3BR5A 5DCMB 5F0HA 3IH4A 2ME0A 3RPUA 2B3WA 3BY6A 3H9JA 2ZJPF 1LVAA 4JX6A 2VJ4A 3L2RA 2R3SA 1ZRFA 4BY7J 4S0HB 1SVMA 4WF2A 2ZOZA 2IW5A 3WTXC 1LFUP 3MZYA 3OS0A 2LKPA 2V1NA 1JKPC 2HU9A 2XRNA 3ZQGA 2IP2A 4CICA 2CGPA 1IG7A 2KQRA 3WE2A 1DP7P 5F64A 1F9NA 1AKHB 1KYWA 3W6VA 3NNRA 3KEYA 5EFYA 3ML6A 5HS9A 3VSKA 3ABLH 5H9TA 2X1CA 1YJWI 2FEZA 2GOXB 1MH4A 1TWHJ 3F22A 4C2MA 3SZPA 4XBFA 2P5VA 3HOWJ 4HEA2 4J19A 3F9KA 1IO2A 3SDGA 4R1HA 2Z33A 1I27A 3WU1B 4XN0A 5HLIA 2ZFUA 3HGGA 5L3CA 3NEUA 2V1XA 3JSOA 2RQPA 1RC9A 4OIPF 3AG4H 3AFHA 5TGTA 1AU7A 4LG0B 2PZ9A 2CQNA 2QKMB 4P9UA 1V55H 2ELHA 2UV1A 1ODDA 3DEUA 3CJQB 4A0XA 5GAHJ 1TTYA 1LVKA 4RGRA 2YSRA 1WJCA 3ABMH 4AM3A 4BS9A 1SMYF 4P5OA 5J47A 3PL8A 1V4RA 4XMYA 4L9NA 1YHQI 1UHSA 3VVZA 4JK1X 1YE9A 1FZPB 3CRJA 3VP5A 2XRLA 5D8LB 3WTTC 1W7PD 3L2QA 4CUGA 3NWSA 1ZG1A 4BHPA 5LFAA 2H6BA 2HXIA 3LSMA 5KVRA 2YU9J 4PFOA 4FCYA 1LNWA 3WG7H 1FIPA 2ZCWA 3OYMA 2H6CA 2X1EA 3LA2A 3C3WA 2DT6A 2O3FA 1FY7A 3TP0A 1OMIA 4CZCA 5L3FA 5FLXK 3MKLA 2STTA 2VQHA 3PNTA 1IC8A 3P9TA 9ANTA 4U0VA 1YG2A 5BQTA 5IPAA 4ITVA 1U5TC 1R49A 1S5LC 2HWVA 1U78A 1OKRA 5EYRA 1FOXA 2HQNA 2XASA 1IXCA 3CUQB 1Z3YA 2BXZA 1Z05A 2X1DA 1MDMB 2R93J 3T5XA 4AVZA 3P9CA 3E5QA 3RSNA 4DGWB 1HA8A 2VE9A 4XRFA 4U0WA 4HF0A 4NHJA 3VYRB 1TW3A 3IAS2 3HOVJ 4GXOA 4QPOA 1Z6RA 1G6NA 2VJIA 2E7XA 4MXMA 3V8LA 4ME9A 4CYCA 5J40A 4HLYA 4CYDA 5BMZA 3K4CA 2G7HA 2KDZA 2EB7A 5BS6A 4TV7A 1LDDA 1JHHA 2UZKA 3K8PC 1FPQA 1MMDA 3BCAA 4BY1J 5IOZA 2M4KA 3O8HA 2DMTA 2VT3A 2NNNA 2GA2A 1T0FC 4A3BJ 1DP3A 4ABZA 4OAYA 2M1BA 1W4MA 2ESNA 3A2KA 4X6AJ 2Q2EA 2PJPA 2MFZA 4HBLA 1MNMC 1OR7C 1G2HA 3TO6A 2HDCA 2K02A 3DKXA 2OUMA 4HF2A 3Q0VA 4KNYA 3HPHA 4G6TB 4L5EA 2JVHA 5FO5A 2ECCA 3EYIA 1UJ8A 4CO8A 2V57A 4AU7A 1GV2A 4A5MA 3D5SC 1XMKA 2QVOA 3K4LA 2EILH 2EIMH 4NC8A 5IYBJ 4LLNA 1PYVA 4BHBA 2DG7A 1IDZA 4MK6A 1B72A 1UB9A 1WPKA 3L00A 3DBHB 2DMPA 4XQFA 1CQTA 2QBYA 4QPQA 2JVGA 1J7KA 3ELKA 4D7NA 4C3IJ 2R7UA 2W7NA 3BJBA 3ZQIA 2Y0SA 4YIRX 1VQKI 4IF4A 4XKVA 4GCTA 2NNYA 2RN7A 2LK2A 5HDGA 2L02A 1ZGWA 3WGIA 1QPIA 3Q9VA 4QWQA 2ZXWH 2NOGA 1DU6A 1FBUA 1N75A 3I5UA 3VOXA 1LQ1A 2O03A 3U21A 2ZSHB 3DWLE 2F4IA 1YQAA 3IKVA 3KYDB 3S1QJ 3H5AA 2V9VA 4GRIA 1JGGA 4NN1A 3H9QA 1KONA 3M7GA 2NVXJ 4ENKA 1WQ2A 5FFZA 2CUJA 2K86A 3G1LA 1P7IA 2L9NA 4A3JJ 3M8FA 5GTIC 2OF7A 3F6OA 4JL3A 1N25A 5EF6A 4JP0A 3RZDJ 2O61A 3OMYA 2HTJA 3SZGA 3LFKA 1STZA 2K9NA 1S6LA 4BYYA 5F6FA 3I4MJ 1YJ9I 1YI2I 2A5WA 2LKXA 3ANGA 1T39A 4KISA 4XKCA 4BNCA 2QLZA 4MTEA 4AIDA 3BHQA 2DTRA 3CF2A 1MJ9A 2PBXA 4P96A 5DUIA 3MN2A 3VW2A 5FLVA 2KP6A 1G8XA 2V9KA 2MLGA 2OC6A 2FJI1 2VI6A 1U6GA 4B4CA 2EFQA 2DPDA 5J4VA 1BR1A 4N4OB 1LE8B 2Y75A 2EFNA 5M3FJ 2HOEA 1FMWA 1G3YA 4LOCA 2KZGA 2CMPA 2CU7A 1K83J 5IY5H 1IDYA 1V5GA 2R7QA 4DIQA 4U9LA 1I3QJ 4FHTA 3F8NA 2A5YB 4HSRA 5CVJA 1FBQA 2LBFB 4M9XA 4ENNA 1Z21A 4J00A 2GIZA 3VTIA 3BZ6A 5HOOA 1MBEA 2NVYJ 1WJ5A 3Q3SA 4BQOA 1F36A 1J09A 1DU0A 4D1QA 4BQNA 1ACIA 2ZFWA 4FETA 3HTJA 2PJRB 2B63J 1Y39A 3H5RA 1PUFA 3ZQQA 2K27A 4FE7A 1FIAA 4F7ZA 2H09A 5K5RA 2IA2A 4RLFA 1TQIA 1HOMA 4Q48A 3OYJA 1ON2A 2LY9A 2VJ5A 4OD4A 1PP7U 5DS9A 4EATA 1Y1VJ 4EVIA 3HSEA 4XLFA 5LEKA 3I64A 2CSOA 3A0HC 2DJIA 2B9SA 4L9JA 3QRFF 3VW1A 4ICHA 1MKMA 3OWTA 2CFXA 2KIFA 2VPRA 1XSVA 3K4MA 2DFIA 1ETVA 4O6JA 1D0YA 4BXXJ 4HQMA 1Y6IA 2M87A 3W2WA 4HNTA 1O3TA 3JTHA 3DKWA 2VPLA 4DVYP 2O7TA 3H5NA 2R7TA 2R5ZB 4EMSA 4GYGA 3RQ4A 4I02A 3EUPA 1VQ6I 1F1ZA 3F8CA 1WSUA 4H4KC 2R7VA 1SEUA 3HJEA 3CMYA 3BTLA 3K6GA 3FBNB 4E7IA 5H20A 2EA4A 3GZIA 2AQFA 2CQQA 3OOUA 4Y4RA 4O3MA 3BR1A 3GTLJ 4CCKA 2R92J 4MIMA 4AD9A 4YZEA 1PDNC 1R4MB 2QQ8A 1ONVA 3TL4X 3WHBA 3FXLA 4G12A 4PJJA 2XSDC 1MBJA 2HI3A 2XAJA 3I0TA 3ZMDA 2YS9A 4BUPA 1I1SA 1OYIA 4V2GA 2FXAA 3KP7A 2F07A 1EH8A 4YELA 3FMRA 4UVAA 2LR8A 4FX4A 2OZUA 4PJMA 1RKTA 2FE3A 1R00A 2EK5A 3H92A 4BDYA 1Z9CA 3R4KA 4I0BA 3CDLA 4M9SA 3REOA 1ZG5A 1W0UA 2LRDA 3BNIA 2VASA 1VQ5I 4ZDLA 5E8IA 1K79A 2MW8A 2JPCA 4LGWA 4WXDA 5LEJA 4AF5A 2M30A 1R5ID 2CUZA 3HRSA 3RI4A 3HUGB 1O4XA 2CWEA 2VXZA 3QPHA 2BW3B 4II2A 4YFXF 2ZKZA 5DYMA 3I4NJ 5CXGA 3KX2A 5FFXA 4PGHA 1ZGJA 5K7ZA 4AIHA 3ONQA 5CVRA 3BG3A 4PSXA 1RR8C 3TOAA 4A12A 3FK6A 3OYIA 1JUSA 2H27A 4FTHA 4RMNA 2HVRA 2MLKA 2JRMA 3NPIA 3JW4A 2TCTA 4G7HF 3WTVC 5B1AH 1YX3A 1I6HJ 2DT7B 2LF7A 5CJ9A 1VNDA 2HZTA 4RM3A 5TJJA 2QIBA 4UDSA 1QZEA 3GTMJ 2GBYA 3GWZA 4PJNA 1BW5A 5BPDA 5K1YA 2UXOA 2CUFA 4A3IJ 3V7CA 2EPFA 5K5OA 2RVCA 3FDYA 3NQOA 3A01B 2E19A 1D1AA 3KP3A 2QSFX 5HSZA 2XHKA 2F4MB 3CCVI 2CS3A 2OD5A 3BWGA 2DO7A 2KJBA 3IKTA 4LG3A 1NH3A 2ID6A 3LNQA 3W3CA 2DDBA 1IAWA 4HA8A 3RIRA 4AUXA 4DJAA 2P7VB 2XGXA 3HYIA 1R6RA 4GGGA 3WTYC 1ZLKA 2VONA 2P8TA 1HKSA 5EGOB 4GO1A 1YS7A 2OJED 1XC5A 2DW4A 3QKXA 3UNGC 2QKOA 3BPVA 4KDPA 2MYSA 1ETQA 5DD8A 3OIPA 3K2AA 5A2QK 2MH9A 5DDGA 4A3DJ 3ZRGA 3K1MA 1KGSA 4XOTA 4IHYA 5F08A 2AO9A 4LIUA 4UUVA 4UHTA 5HS7A 4E70A 2PFVA 4QSHA 3FXRA 3PPBA 1WJDA 2VBZA 4HDVA 1ZREA 5IP6A 1RETA 4A0ZA 1C0WA 4I2OA 3SYTA 3HRMA 3CC2I 1ZK8A 4UNOA 4KN7X 3BQYA 2Z99A 3BQZA 1HQCA 2XF5A 3IL2A 5DEQA 3DPLC 1T98A 3CC7I 2KFDA 3IHUA 3E3VA 2MGQA 4LIVA 1DUXC 2DG8A 1FT9A 3NRGA 1MBGA 1U2WA 3CDHA 2XB5A 5E3NA 1R36A 4XL9A 2OBPA 4DOZA 2M9HA 3ZPLA 2L9VA 3EPZA 1X3WB 1SMTA 2EWNA 3OR2C 4ESJA 1K61A 5C4YA 3RD3A 3QP5A 4NB5A 2CQKA 2R5YA 2D2WA 2XF7A 1YRNA 1FTZA 1PVEA 2BXYA 4BE1A 1ZRDA 1WJEA 2E35A 3FIWA 1IRFA 2BV6A 1ZQ3P 4Y52J 1HLVA 2L9SA 3R0AA 2DODA 1K4TA 5B5EC 5L3EA 1U5TB 2MC4A 5E3MA 1OCCH 2PBIA 3BLYA 3VDXA 1NTCA 3ISPA 3S1MJ 1GVDA 5J8CA 2ELJA 1XTAA 2WV1A 2XGDA 1SFXA 3CWRA 2OZ6A 4C2TA 4DNCA 2CRGA 4AVPA 4I01A 1VQ9I 2QTQA 1YFHA 3WU0A 2A61A 1TQMA 2FBHA 2Y48A 4M6XA 3KZ9A 3P9IA 1HW1A 1U3EM 5AONA 5DV5A 2XGCA 3BRUA 3HOTA 3QYEA 4L5IA 4D7MA 4ZJZA 3OYKA 3NS4A 5HDNA 3QQAA 2VE8A 4KIFA 2RNJA 1FSHA 1Y1WJ 2NVTJ 3G2BA 2XDVA 2BVMA 1LKXA 4OWRB 4KWAA 4NC7A 1SD4A 2XUBA 2EBIA 4N9HA 3S15J 1YIJI 3DLAA 2PMUA 2IEKA 2M5WA 4PSWA 4EJVA 4MTDA 1W1WE 4L9VA 4U88A 5JVTA 2K85A 2GXBA 3GTOJ 4ETSA 2IPQX 2JK3A 1RUOA 3EETA 1P6RA 2IGOA 4JYKA 5IYDJ 1BI3A 1W5TA 3B81A 1ULYA 3CJDA 3DCFA 4BJTA 2BY3A 3CF5F 1IUFA 2Q1ZB 4CHUA 3PO2J 2NS7A 1NG6A 2GXAA 2QCOA 1EJ9A 4BJ5C 1X1PA 3LJLA 1NHAA 1H89C 3ZP5A 4IOAF 3BG6A 2BEOA 5CQEA 4L0YB 2ZC2A 3ZN1A 3CJNA 2V4JC 3HGYA 3Q0UA 1X1AA 3KP2A 3F6VA 5GPCA 2W24A 1QNTA 4FASD 5E1XA 1T08B 1ZLJA 2E71A 3PM1A 2ZO4A 3FK7A 2IS4A 2HQAA 2Y0SN 3AKZA 1SD6A 1UG0A 4U87A 1J0RA 4I7HA 3ZQCA 2LREA 2PX9A 4UV9A 1VQ8I 1ZTRA 3CLOA 5J1RA 3OYCA 2QUFA 5FD6A 2K5CA 1OCZH 2QOPA 4OMZA 5JR3A 3PNYA 2DXIA 1WJBA 4NUBA 3M3YJ 5LGNA 3R0JA 5CPRB 2FX0A 4R79A 1WH7A 3JRDA 2KKOA 3WTUC 3I56I 1ETOA 3HDDA 4JX5A 2ZXIA 3TDZC 3BG5A 2JQ7A 2FQ4A 2PQ8A 4F91B 1P4WA 5K7HA 5D6FA 3L7WA 2P4WA 2JA5J 2EFPA 1POGA 4BE2A 3K70D 2OV7A 2EZLA 1LUJB 1UMQA 4IPAA 4A2UA 3S1NJ 2ICWG 1LDKB 2M4GA 5B1BH 4ZYDA 3K4NA 3PFYA 1W0TA 2CW7A 4B09A 1U8RA 3D5RC 1IV6A 2FF4A 4HNUA 1JGSA 1UZCA 1GV5A 3HRTA 1FBSA 5L3BA 4UUTA 3TW6A 4GFLA 3WG9A 3PSIA 3FHZA 1J59A 1N78A 2FA5A 2VQGA 4EM0B 4D0PA 3HL2A 2WBMA 1T33A 1OCPA 2F5EA 3GF2A 4NDLA 3CO6C 1J2XA 5E20A 3MNLA 3ECOA 4PGGA 4G7ZF 1ZGAA 4M71A 1J9IA 1SFKA 2KLOA 2X4HA 2ZCNA 1E3OC 2STWA 1XCBA 2ESHA 2L7KA 2QM3A 4JBAA 2R7OA 2GA1A 4BJ6C 1RESA 2G0EA 4OIQF 1T95A 1F4KA 2FUG2 4N9IA 1H0MA 1KZHA 2NRAC 2ZSIB 1ZKGA 1RNLA 3DTEA 1O7LA 4PJ0C 3H0GJ 1ORKA 3WGGA 2PEXA 4IHXA 4YEJA 2K9SA 2F48A 3ZR8X 4HQEA 3F3XA 3CCRI 1BC7C 4I76A 6PAXA 2XAGA 2EFOA 5D4SA 1MJBA 4IX7A 1QGPA 1U9NA 3CESA 3HOSA 2ZJQF 3T6NA 4RB3C 4B48A 2LF8A 4KT6A 5M5WJ 2AXTC 3PIPF 3SFIA 4LG0A 4XLNF 3RPQA 3ZMVA 2A6EF 2FOWA 5J3LA 3HTIA 3I4PA 3GYHX 3HG9A 4CCOA 4NNJA 3BZKA 1RPWA 4G94A 1WHUA 2L7ZA 1R7JA 2E5NA 1I5ZA 4XONA 1D0ZA 3HOZJ 3KCCA 1I3AA 2B0LA 2JRTA 4ON0A 4IQJA 4MHGA 2KIMA 5LHHA 3IUVA 2VBWA 5F0CA 2JA2A 3NI7A 3F8BA 3E1SA 2LG4A 2ZNYA 3F8MA 3IC7A 4B43A 1LPQA 2BOLA 3PQJA 3LA7A 1RIOH 3GZ5A 3KLNA 5CLSA 3E0JB 3E6CC 1CGPA 3BROA 4NELA 5JVGF 1RI7A 2CUEA 1YX5A 4B47A 5IT9Z 5JLXA 1VQNI 3BJOA 1XGSA 1RRJA 1FYLA 3K1NA 1BR4A 2WB1A 3EDPA 2RDPA 1ERDA 2OERA 1D5VA 2PI0A 2HPIA 3T0YA 5HLHA 5CW8A 2O7OA 1JKOC 2O5RA 3PNVA 2VOPA 3KP4A 3QU3A 2A2FX 1FX7A 3DPUA 4XRMA 3CUQA 1K6OA 4KUMA 3VVYA 2E36A 4HNVA 1MDMA 4UVCA 5KAFC 1OYYA 4BACA 3R6SA 2E1OA 2HNHA 2FOKA 2L0KA 4CYCB 2XPVA 1ENHA 2P5LC 3GTGJ 1K6YA 4A0YA 3SEZA 5FHPA 3BTJA 1X3ZB 3F1BA 2L4AA 1GUUA 1Y56A 3VYUB 3ABKH 3KLOA 4V2FA 5FB2A 2WAEA 2DCEA 5IYCJ 2GIVA 2PFBA 4OAZA 3V6GA 2IXSA 3I9V2 3GTQJ 2W82A 5C44J 1UI5A 3KKCA 2IA0A 3NAUA 2LSOA 3GTJJ 5LLQA 1FEXA 3BZCA 1FWZA 3NWTA 5LRRA 3VPRA 2Z9OA 1LFBA 2Y2ZA 5FKKA 2ZNZA 3ERMA 1EH7A 3LQRA 3PSFA 2H8RA 2IS2A 3HSRA 3H36A 5J8FA 3X2QH 1S7EA 2JSPA 2M0CA 3ZQHA 3GFMA 1SD5A 2JPBA 4PCQA 3U2RA 1X1BA 4LMYA 4OINF 4CCJA 1D1BA 4HV6A 1Q1VA 4FISA 1XSXA 3FXKA 1EF4A 1X2NA 3K4KA 3CCEI 2L9RA 3CDIA 3J81Z 2HTSA 1XGOA 3OL3A 3U1KA 1K78B 5D5WB 2A07F 1Y8QB 2WY7Q 1EKEA 1W7PB 2A3SA 4M3FA 1WWXA 5FMPA 1USTA 3A4CA 2E1MC 5HLGA 1X19A 4LK1F 4BAYA 5H2FC 1BIAA 5ICCA 2HOAA 1ZN2A 4KT5C 1FMVA 2E1NA 3M07A 4M72A 2HVQA 5IT9K 1D3YA 3BR6A 1V5FA 3S32A 4ZDPA 3G6EI 4C3JJ 5J6XA 4BQAA 5E3OA 5HBUA 1AA7A 2WWYA 3DLLF 1H88C 3HTAA 1MSEC 2UXIA 1E3PA 4AWXB 4MEYF 3WODF 3JR9A 3CMEI 2IS1A 3O8GA 2ME6A 3BJ6A 3OOPA 3COAC 2B7EA 3CCSI 1DGWY 2V1UA 3IAM2 4BBSJ 3CQZJ 4MQ9F 2IS6A 1OLTA 4EJWA 2RASA 1MBKA 5FKOA 3P9KA 1XMAA 3VEPA 1OISA 2VUMJ 1QZYA 2GQQA 4ZH4F 2TRTA 2F4OB 4WX9A 3V8KA 3JRIA 1B8IB 3GXOA 3OIQA 1B1BA 2HYFA 2W53A 3CZ6A 2DT5A 3DBLB 3AG2H 5LGTA 2R7RA 2MBFA 2QSGX 3GBGA 3FM3A 2MG4A 5CVVA 3BG9A 3SJMA 3JSPA 4PFPA 3NARA 4Q5SF 2QGUA 1ETKA 3JTGA 5JI6A 5CXIA 1QHHD 5KNLA 1V3FA 3L09A 2UWMA 1G3TA 4RS8A 2CV1A 3S16J 4LD5A 4Y3OA 1F5TA 3P5JA 2QQ9A 2XIGA 1MIJA 4UUSB 3GMEA 2GM4A 4LLGF 3QAHA 1MMGA 2HYGD 1SFEA 4EGYA 1LEBA 2CQ7A 3HTSB 2KRFA 2ZCXA 4OIOF 4M6VA 1PP8F 3OS1A 1HC8A 3KEQA 5ILUA 3ULQB 1M1EB 5AIPA 1KU9A 1UHMA 4M9ZA 1LE8A 2WUIA 5BOXA 1BL0A 4RAGA 5CVIA 3J81K 1KQ0A 2XPUA 1IRXA 4Z6YA 2XAFA 3BCGA 3VOKA 4HRIA 2M34A 3F0CA 2DA3A 2WGBA 1O3SA 2O8KA 3KPHA 5K7FA 4HDUA 2FD5A 4UVBA 2EFWA 5IT3A 1B6AA 2O8XA 3B02A 3QWLA 4NBQA 4WCGA 3C7JA 2GENA 4WXHA 1LB2A 3OV8A 1YYVA 2FU4A 1BBYA 2VKDA 2X6WA 4UV8A 4XKWA 3HKZN 4ZTFA 2IA1A 1ITYA 4RA2A 3VFZA 1WKMA 1LFPA 5D5VB 3K0LA 2KT0A 1N77A 5KK1A 1TWCJ 3A1YA 4KN4X 3TEDA 3G3ZA 3H3ZA 4BGDA 2KRHA 1W5CC 4IRVA 3GTKJ 1KQ8A 5GP9A 4XLHA 4KMUX 2LYCA 4IRGA 3QPSA 4XRSG 4MLOA 2ZMEA 2UXXA 4XORA 4IRIA 1BM9A 2K9MA 2P6SA 5FRMA 5HDKA 3K70C 2L4MA 4ZYGA 4BH9A 1IN8A 3FMSA 3GFJA 1QU3A 2ISZA 2LVSA 4AC6A 5M5XJ 1NK3P 4Y17A 2ADUA 3FHNA 1AOYA 3CMAI 3G1MA 2E60A 1YO5C 5FD5A 5F27A 3CUQC 3E5UA 2WTEA 1YITI 2LKSA 2EV5A 3HTHA 3ZQLA 3JRGA 3JRHA 2P6TA 3ON4A 5LBQA 3PO3J 3Q5FA 4LB6B 2FQ3A 4MO7A 3LSTA 2EIJH 2BBYA 3OIOA 3MQ0A 2FSWA 4ZZLA 3VWBA 2EH3A 2QA4I 2RNGA 2K9QA 1VQ7I 3LSGA 2A6TA 1HW5A 3BT9A 3DV8A 4C2MJ 5FLMJ 2R4GA 3PJRA 4KYWA 3EQLF 3SXYA 1RZ4A 3L2WA 2JJ7A 1VTNC 1Q1HA 1TL8A 4BDZA 2X6OA 2XSJC 3AQTA 4D5CA 2HZDA 4JX4A 4B3AA 1KYZA 4GYIA 3LSJA 1R9TJ 2LC2A 4PK4A 2JSCA 1QPMA 2KIQA 5F1JA 5LRSA 5C3EJ 3G4SI 1BI0A 1JXSA 4RAYA 2D6YA 1VI0A 3C1DA 3VIBA 3FXMA 1AWCA 3CP2A 3VYSB 4M3BA 3K9TA 5ILSA 3JREA 4H0EA 3DF8A 1XGNA 2XB0X 1XMXA 2DA5A 2WY8Q 3I59B 3U9GA 3PIOF 3B6CA 2E7WA 3F21A 2DYRH 1Z7LA 3RH2A 2F2EA 3LSHA 2BGCA 5KAIC 3TKYA 1P2FA 4YFKF 4GFBA 3QBMA 4KICA 3C07A 1G3WA 1QQIA 2ZY9A 4RAZA 2HKXA 3LMMA 5ED4A 3DFGA 1O3QA 5FKNA 4CSWA 2WADA 2NAZA 2JA7J 1TT0A 4HG2A 2GLOA 3U1DA 5JHUA 4A3GJ 4KJZA 4XIDA 1BI1A 3LA3A 2ZCMA 3CCYA 1SVLA 4RGXA 4Y7NJ 3HHGA 2M8EA 1VQPI 2DFHA 1X4PA 4E7HA 3L1PA 3D1NI 1JUMA 4A69C 4N0BA 3VSLA 1FOWA 5EEHA 2XF6A 3OY9A 3JRFA 5LD2C 4A93J 3KIOA 3WU2C 2Z2SB 2G3BA 2ACJA 3KKDA 1XG1A 1FP1D 2W84A 3G1OA 3KE2A 5HVQC 3A01A 2A69F 3M8JA 1R22A 4Y13A 2I10A 3E6MA 4IQ4A 2R7WA 1MGTA 3FXQA 3M1EA 3WGHA 4XR6A 3MZHA 3I53A 2GFNA 2G7UA 2REKA 4NQWB 3OS2A 5BNGA 3LAJA 2LTPA 4G8XA 1BOBA 1MMSA 2M45A 3VOEA 2AQEA 3EYYA 3OYGA 3HZJA 3HOYJ 4XSXF 2DFFA 1NG7A 3I55I 2O6GE 5EGOA 2OAZA 1MMAA 2O0YA 3ERED 3EUHA 2D1VA 5JHFA 3R60A 3G7RA 2PMZA 4JOMA 1SC7A 4M74A 5FRNA 5M3MJ 3HOXJ 2GUHA 2Y31A 1BJAA 1HSTA 2BY0A 2DMUA 4UB6C 3E5XA 3LAPA 3A0BC 3HHHA 1Z67A 2YX4A 4ESBA 4L0ZB 3TP3A 1ZR4A 1DPRA 5E18F 2R7ZJ 1HKTA 1YW7A 2AS5F 1BA5A 3HXLA 4PZJA 2IT0A 3W2AA 2G9WA 4ZZDA 3V42A 3ZXSA 2F5DA 4B3XA 3K4BA 1QO0D 4IHSA 4HZFA 2K4BA 4BHCA 1S9HA 1Y0NA 3QYFA 4WIBA 2IBDA 3DEEA 2HQRA 4E7LA 3HRUA 2DPUA 2MC3A 2VJJA 1YRNB 1BW6A 2HYJA 4LK0F 2UXPA 1XX5A 1X2MA 1ZELA 4ANJA 4S04A 3S93A 1TWGJ 2ELKA 3E6DA 3PUBA 3KETA 1F43A 2ZOYA 2PMHA 2VB6A 3KZIC 5CQGA 5EJCA 1IUYA 2GZWA 3ZN0A 5GPAA 2W00A 2Z5UA 5EG0B 1JUPA 5AIQA 3CCMI 3TDUC 2FRHA 4IO9F 4L18B 3HKZA 1DPUA 2WB1N 3SFZA 1X58A 4HV5A 5L3DA 1ETXA 1BR2A 2A68F 2Z3YA 3TBIA 2EV6A 2VT2A 2CYYA 3KNWA 1QZZA 4BKXA 2Y30A 4M73A 2E2JJ 5E17F 3RKWA 2LLKA 3HPGA 4HAMA 4E7JA 2J5PA 4HX4A 5EEGA 4ZYAA 3GFIA 1Y0UA 3CMMA 2JA6J 1P92A 2W25A 3HC7A 5K5QA 2ECBA
chains in the Genus database with same CATH topology
2OF7A 4DYQA 3S2HJ 3T6NA 3A02A 4JL3A 2HQ5A 5EF6A 1NK2P 4JP0A 3S1RJ 5M5WJ 3RZDJ 3SFIA 1RR7A 5J3LA 3HTIA 1QVUA 4ACIA 2K9NA 3HIMA 3I4MJ 3GEUA 2HKUA 1RPWA 2LKXA 3ANGA 2L7ZA 3K7AJ 4B1RA 4M3EA 3BR0A 3FRQA 3HOZJ 3BHQA 3G56A 1A5JA 2K40A 2PBXA 3IUVA 1TWAJ 5F0CA 3NI7A 3MN2A 4X1EA 1WI3A 3VW2A 4L62A 3E7LA 5FLVA 1IRZA 2UXUA 3HBLA 4A3CJ 2VI6A 3OSFA 4B4CA 4JKZA 1LE8B 2EQRA 4NELA 5M3FJ 1P7JA 2CUEA 4LOCA 2DA2A 5JLXA 4QIWN 2CU7A 3HEFA 1K83J 1IDYA 2OERA 5C4JJ 5CW8A 2O7OA 1JKOC 2LD5A 1OCTC 1T56A 1TWFJ 4MFDA 1I3QJ 4PXIA 2AHQA 1SFOJ 4XRMA 1RKWA 3HM5A 1IGNA 4I6ZA 3VVYA 2NS8A 1MBEA 3WHCA 4HNVA 2HDDA 2EZIA 2NVYJ 3Q3SA 1DU0A 1F36A 2E1OA 2L0KA 4CYCB 1JTYA 5FKLA 3HTJA 2B63J 2XPVA 1ENHA 1PUFA 2D5VA 3GTGJ 4FE7A 3S5RA 1I50J 1FIAA 5FHPA 3BTJA 3IH3A 4C3HJ 2R0QC 2NP3A 3F1BA 1GUUA 4W1UA 1JT6A 2VKVA 1HOMA 4MFEA 2COBA 4V2FA 2LY9A 5IYCJ 3V6GA 5DS9A 4A3LJ 3FKIJ 3RQIA 3GTQJ 5F0FA 1Y1VJ 5C44J 1UI5A 3KKCA 4DZJA 3NAUA 3GTJJ 1D5YA 1FEXA 3AQSA 4JNNA 3HOUJ 3VW1A 3VPRA 2G7GA 4ICHA 1LFBA 2VPRA 2G7SA 2Y2ZA 2NX4A 1ETVA 5FKKA 4BXXJ 2H8RA 3COLA 3Q0WA 4DYCA 4GCKA 3LSRA 2O7TA 2DA6A 1S7EA 1JKRC 1UG2A 2M0CA 3ZQHA 2R5ZB 1ZR2A 3EUPA 2IAIA 4AYBN 3LWJA 3JSJA 4HKUA 3CMYA 1Q1VA 3BTLA 2R5YB 5J1YA 1APLC 4FISA 1GT0C 5F04A 4CGRA 1VFCA 1EF4A 1X2NA 3GZIA 2CQQA 1WCMJ 2L9RA 3MVPA 3OOUA 3BR1A 2N8GA 3GTLJ 1MBFA 3JRBA 3LSPA 2UXHA 2R92J 3BR2A 4MIMA 2LFBA 4YZEA 4M3FA 4AC0A 5FMPA 1AKHA 1WGXA 3WHBA 2HXOA 4G12A 5D1RA 4W97A 2XSDC 1MBJA 2HI3A 2HOAA 3EGQA 2YS9A 3BR6A 4V2GA 4C3JJ 5E3OA 2H1KA 2F07A 5HBUA 3BR3A 1H88C 3IV5A 3HTAA 4DYRA 2M8GX 2LR8A 1MSEC 1RKTA 2UXIA 5EG0A 2FBQA 3JR9A 2YVEA 3O8GA 2ME6A 4IHWA 3O60A 4RBOA 3BNIA 3CDLA 1W0UA 4EEFG 4BBSJ 3CQZJ 2RASA 1MBKA 2E2IJ 4IHVA 2MW8A 5FKOA 2QWTA 5EZHA 2VUMJ 4AF5A 1Z0XA 2P81A 5IP9J 2VKEA 2ID3A 2TRTA 3LOCA 3JRIA 4FE4A 1QVTA 4A3MJ 1B8IB 2M2EA 2DA4A 1O4XA 2W53A 3I4NJ 5CXGA 1JKQC 2X9DA 1JJ6C 3GBGA 3GTPJ 2MG4A 5DTDA 5K7ZA 3BG9A 3SJMA 4BBRJ 4GCLA 3BG3A 2MSYA 4A3KJ 3NARA 5EEAA 1ETKA 3FK6A 1HDPA 5CXIA 5EZGA 1JUSA 2L7FP 2DA7A 3C2BA 4FTHA 3NPIA 3S16J 3RKQA 2CJJA 4XRSA 2TCTA 3VW0A 4UUSB 1I6HJ 1ETYA 1HF0A 1U9OA 2GM4A 4A3FJ 1FJLA 2HOTA 1VNDA 3ON2A 4XICA 1XS9A 4UDSA 2QIBA 2WAQN 5DAJA 1BW5A 2LP0A 2GBYA 3GTMJ 2HOSA 2ZCXA 2UXOA 2NP5A 2CUFA 4A3IJ 2DJNA 4M6VA 3A01B 2E19A 4XK4A 2JMWA 1LE8A 1IJWC 3OSGA 4M3GA 2WUIA 5HSZA 2CQXA 4DW6A 1BL0A 3JRAA 3S2DJ 1JT0A 2XPUA 2ID6A 1MBHA 3LNQA 5K58A 3V78A 3BCGA 3VOKA 2M34A 3F0CA 1UI6A 4AUXA 2DA3A 2DMNA 2WGBA 2JA8J 2O8KA 5EGOB 5K7FA 2FD5A 3IH2A 1XC5A 3RZOJ 2Y9YA 2EZKA 3QKXA 3ZQFA 4IEJA 2GENA 1ETQA 5IOYA 1HCRA 5HAWA 2QF7A 1AHDP 3K2AA 1OFCX 1BJZA 1OJLA 5M5YJ 3HKZN 4A3DJ 1ITYA 3HB9A 4IHYA 3QPLA 5F08A 2NVQJ 3NXCA 2AO9A 3ANPA 5AQCA 2KT0A 1TWCJ 1TC3C 1QRYA 4QSHA 3TEDA 2ZB9A 3PPBA 3VVXA 2YUSA 5IP6A 3GTKJ 1RETA 4GFKA 5GP9A 5FJ8J 3PASA 3JRCA 1ZK8A 3BR5A 3QPSA 3BQYA 4XRSG 4MLOA 5F0HA 3BQZA 1B72B 3ZOBA 3IH4A 2ME0A 2MGQA 2L7MP 4JX6A 2DG8A 3NRGA 2LVSA 1MBGA 1A6IA 4AC6A 5M5XJ 2XB5A 4BY7J 5E3NA 4S0HB 1NK3P 2ZOZA 1LFUP 2M9HA 2HYTA 1K61A 1JKPC 5C4YA 3RD3A 3G1MA 3ZQGA 2RHAA 2R5YA 1YRNA 1FTZA 5F27A 1IG7A 3FIWA 3W6VA 4M3DA 1AKHB 1MSFC 1JJ8C 3ZQLA 3HTHA 3NNRA 3JRGA 5EFYA 3JRHA 1ZQ3P 3ON4A 2DMQA 3PO3J 4Y52J 4MO7A 5H9TA 1HLVA 3OIOA 1MH4A 2EH3A 1TWHJ 5E3MA 2K9QA 3LSGA 4C2MJ 3BT9A 5FLMJ 3HOWJ 4J19A 1NTCA 3SDGA 1SANA 1GVDA 2E2HJ 3S1MJ 2JJ7A 2WV1A 3H3VK 2XGDA 3CWRA 5D19A 2X6OA 2CRGA 3HGGA 5D18A 3AQTA 4D5CA 4JX4A 2DTZA 4B3AA 2QTQA 3LSJA 1R9TJ 1AU7A 2PZ9A 3KZ9A 3S14J 1HDDC 5F1JA 5C3EJ 2XGCA 3M4OJ 3BRUA 4D7MA 3QQAA 5FKMA 2D6YA 1VI0A 1Y1WJ 2IU5A 2NVTJ 3VIBA 5E3LA 4KWAA 2FJ1A 4M3BA 3S15J 2EBIA 3FISA 3JREA 1WH5A 2IEKA 1UHSA 2XB0X 2DA5A 3VVZA 3B6CA 2PMZN 1B8IA 3CRJA 3VP5A 2XRLA 3RH2A 1MH3A 3GTOJ 2JK3A 2W48A 4GFBA 3QBMA 4JYKA 2HXIA 5IYDJ 3C07A 2YU9J 3B81A 4FCYA 3CJDA 3DCFA 2XPWA 5FGLA 1FIPA 1IUFA 5FKNA 3PO2J 2NS7A 2JA7J 2QCOA 3TP0A 2GLOA 3LJLA 4A3GJ 4XIDA 1H89C 3MKLA 1IC8A 5C4XJ 2ZCMA 3CCYA 3P9TA 9ANTA 4Y7NJ 4RDUA 1GDTA 5IPAA 4UUSA 1ETWA 3L1PA 3HGYA 3Q0UA 3D1NI 3TW7A 2DA1A 1JUMA 4A69C 2RAEA 5EYRA 1U78A 5GPCA 3JRFA 1H8AC 3VUQA 4DZPA 2X48A 4A93J 2R93J 2G3BA 3PM1A 3KKDA 3FK7A 1XG1A 3G1OA 2Y0SN 3A01A 1PUFB 2I10A 2G7LA 2GFNA 3ZQCA 3HOVJ 2REKA 1ZTRA 5J1RA 5BNGA 4MXMA 4ME9A 2LTPA 4CYCA 2QOPA 5JLWA 2KDZA 3M3YJ 2FX0A 2DN0A 3HOYJ 2Y9ZA 1WH7A 4BY1J 3JRDA 5IOZA 2XGEA 3O8HA 5EDNA 1ETOA 1JTXA 2DMTA 5EGOA 3HDDA 4JX5A 2JN6A 3BG5A 2FQ4A 3G7RA 5K7HA 4A3BJ 4ABZA 2JA5J 2XDNA 5IP7J 1POGA 5M3MJ 4X6AJ 3HOXJ 2GUHA 2Y31A 1MNMC 2EZLA 2DMUA 1UMQA 3S1NJ 1G2HA 4A3EJ 3TP3A 3Q0VA 4QTRA 3A03A 1ZR4A 2R7ZJ 4L5EA 1W0TA 2ECCA 2V57A 1U8BA 3B6AA 1BA5A 1GV2A 5HODA 1IV6A 1GV5A 3DEWA 2OI8A 5IYBJ 2R5ZA 4UUTA 3TW6A 3BTCA 5J1UA 1IDZA 1FTTA 2DG7A 2EZHA 1B72A 4MK6A 4GFLA 1WPKA 1SGMA 2DMPA 1T33A 2IBDA 1CQTA 1OCPA 4NDLA 4D7NA 3BTIA 1BW6A 1YRNB 2HYJA 4C3IJ 3UKGA 2UXPA 2Q24A 3BJBA 3MNLA 3ZQIA 1X2MA 2JWTA 4GCTA 1TWGJ 2ELKA 1F43A 1E3OC 2ZCNA 2YVHA 2LK2A 2ZOYA 1Z77A 1RESA 2G0EA 2OPTA 1ZGWA 5GPAA 5EG0B 1QPIA 1JUPA 1ZKGA 2NOGA 2WB1N 1DU6A 1X58A 3VOXA 3LHQA 1ETXA 1ORKA 3H0GJ 1VF9A 3KNWA 4IHXA 4BKXA 2Y30A 2K9SA 3S1QJ 2E2JJ 2O9LA 3DPJA 4D5FA 3S17J 2LLKA 1JGGA 4NN1A 4I76A 2NVXJ 3HE0A 3G1LA 2JA6J 1P7IA 1U9NA 4A3JJ 3E7QA 2QKOA 2ECBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OF7 A;  4DYQ A;  3S2H J;  3T6N A;  3A02 A;  4JL3 A;  2HQ5 A;  5EF6 A;  1NK2 P;  4JP0 A;  3S1R J;  5M5W J;  3RZD J;  3SFI A;  1RR7 A;  5J3L A;  3HTI A;  1QVU A;  4ACI A;  2K9N A;  3HIM A;  3I4M J;  3GEU A;  2HKU A;  1RPW A;  2LKX A;  3ANG A;  2L7Z A;  3K7A J;  4B1R A;  4M3E A;  3BR0 A;  3FRQ A;  3HOZ J;  3BHQ A;  3G56 A;  1A5J A;  2K40 A;  2PBX A;  3IUV A;  1TWA J;  5F0C A;  3NI7 A;  3MN2 A;  4X1E A;  1WI3 A;  3VW2 A;  4L62 A;  3E7L A;  5FLV A;  1IRZ A;  2UXU A;  3HBL A;  4A3C J;  2VI6 A;  3OSF A;  4B4C A;  4JKZ A;  1LE8 B;  2EQR A;  4NEL A;  5M3F J;  1P7J A;  2CUE A;  4LOC A;  2DA2 A;  5JLX A;  4QIW N;  2CU7 A;  3HEF A;  1K83 J;  1IDY A;  2OER A;  5C4J J;  5CW8 A;  2O7O A;  1JKO C;  2LD5 A;  1OCT C;  1T56 A;  1TWF J;  4MFD A;  1I3Q J;  4PXI A;  2AHQ A;  1SFO J;  4XRM A;  1RKW A;  3HM5 A;  1IGN A;  4I6Z A;  3VVY A;  2NS8 A;  1MBE A;  3WHC A;  4HNV A;  2HDD A;  2EZI A;  2NVY J;  3Q3S A;  1DU0 A;  1F36 A;  2E1O A;  2L0K A;  4CYC B;  1JTY A;  5FKL A;  3HTJ A;  2B63 J;  2XPV A;  1ENH A;  1PUF A;  2D5V A;  3GTG J;  4FE7 A;  3S5R A;  1I50 J;  1FIA A;  5FHP A;  3BTJ A;  3IH3 A;  4C3H J;  2R0Q C;  2NP3 A;  3F1B A;  1GUU A;  4W1U A;  1JT6 A;  2VKV A;  1HOM A;  4MFE A;  2COB A;  4V2F A;  2LY9 A;  5IYC J;  3V6G A;  5DS9 A;  4A3L J;  3FKI J;  3RQI A;  3GTQ J;  5F0F A;  1Y1V J;  5C44 J;  1UI5 A;  3KKC A;  4DZJ A;  3NAU A;  3GTJ J;  1D5Y A;  1FEX A;  3AQS A;  4JNN A;  3HOU J;  3VW1 A;  3VPR A;  2G7G A;  4ICH A;  1LFB A;  2VPR A;  2G7S A;  2Y2Z A;  2NX4 A;  1ETV A;  5FKK A;  4BXX J;  2H8R A;  3COL A;  3Q0W A;  4DYC A;  4GCK A;  3LSR A;  2O7T A;  2DA6 A;  1S7E A;  1JKR C;  1UG2 A;  2M0C A;  3ZQH A;  2R5Z B;  1ZR2 A;  3EUP A;  2IAI A;  4AYB N;  3LWJ A;  3JSJ A;  4HKU A;  3CMY A;  1Q1V A;  3BTL A;  2R5Y B;  5J1Y A;  1APL C;  4FIS A;  1GT0 C;  5F04 A;  4CGR A;  1VFC A;  1EF4 A;  1X2N A;  3GZI A;  2CQQ A;  1WCM J;  2L9R A;  3MVP A;  3OOU A;  3BR1 A;  2N8G A;  3GTL J;  1MBF A;  3JRB A;  3LSP A;  2UXH A;  2R92 J;  3BR2 A;  4MIM A;  2LFB A;  4YZE A;  4M3F A;  4AC0 A;  5FMP A;  1AKH A;  1WGX A;  3WHB A;  2HXO A;  4G12 A;  5D1R A;  4W97 A;  2XSD C;  1MBJ A;  2HI3 A;  2HOA A;  3EGQ A;  2YS9 A;  3BR6 A;  4V2G A;  4C3J J;  5E3O A;  2H1K A;  2F07 A;  5HBU A;  3BR3 A;  1H88 C;  3IV5 A;  3HTA A;  4DYR A;  2M8G X;  2LR8 A;  1MSE C;  1RKT A;  2UXI A;  5EG0 A;  2FBQ A;  3JR9 A;  2YVE A;  3O8G A;  2ME6 A;  4IHW A;  3O60 A;  4RBO A;  3BNI A;  3CDL A;  1W0U A;  4EEF G;  4BBS J;  3CQZ J;  2RAS A;  1MBK A;  2E2I J;  4IHV A;  2MW8 A;  5FKO A;  2QWT A;  5EZH A;  2VUM J;  4AF5 A;  1Z0X A;  2P81 A;  5IP9 J;  2VKE A;  2ID3 A;  2TRT A;  3LOC A;  3JRI A;  4FE4 A;  1QVT A;  4A3M J;  1B8I B;  2M2E A;  2DA4 A;  1O4X A;  2W53 A;  3I4N J;  5CXG A;  1JKQ C;  2X9D A;  1JJ6 C;  3GBG A;  3GTP J;  2MG4 A;  5DTD A;  5K7Z A;  3BG9 A;  3SJM A;  4BBR J;  4GCL A;  3BG3 A;  2MSY A;  4A3K J;  3NAR A;  5EEA A;  1ETK A;  3FK6 A;  1HDP A;  5CXI A;  5EZG A;  1JUS A;  2L7F P;  2DA7 A;  3C2B A;  4FTH A;  3NPI A;  3S16 J;  3RKQ A;  2CJJ A;  4XRS A;  2TCT A;  3VW0 A;  4UUS B;  1I6H J;  1ETY A;  1HF0 A;  1U9O A;  2GM4 A;  4A3F J;  1FJL A;  2HOT A;  1VND A;  3ON2 A;  4XIC A;  1XS9 A;  4UDS A;  2QIB A;  2WAQ N;  5DAJ A;  1BW5 A;  2LP0 A;  2GBY A;  3GTM J;  2HOS A;  2ZCX A;  2UXO A;  2NP5 A;  2CUF A;  4A3I J;  2DJN A;  4M6V A;  3A01 B;  2E19 A;  4XK4 A;  2JMW A;  1LE8 A;  1IJW C;  3OSG A;  4M3G A;  2WUI A;  5HSZ A;  2CQX A;  4DW6 A;  1BL0 A;  3JRA A;  3S2D J;  1JT0 A;  2XPU A;  2ID6 A;  1MBH A;  3LNQ A;  5K58 A;  3V78 A;  3BCG A;  3VOK A;  2M34 A;  3F0C A;  1UI6 A;  4AUX A;  2DA3 A;  2DMN A;  2WGB A;  2JA8 J;  2O8K A;  5EGO B;  5K7F A;  2FD5 A;  3IH2 A;  1XC5 A;  3RZO J;  2Y9Y A;  2EZK A;  3QKX A;  3ZQF A;  4IEJ A;  2GEN A;  1ETQ A;  5IOY A;  1HCR A;  5HAW A;  2QF7 A;  1AHD P;  3K2A A;  1OFC X;  1BJZ A;  1OJL A;  5M5Y J;  3HKZ N;  4A3D J;  1ITY A;  3HB9 A;  4IHY A;  3QPL A;  5F08 A;  2NVQ J;  3NXC A;  2AO9 A;  3ANP A;  5AQC A;  2KT0 A;  1TWC J;  1TC3 C;  1QRY A;  4QSH A;  3TED A;  2ZB9 A;  3PPB A;  3VVX A;  2YUS A;  5IP6 A;  3GTK J;  1RET A;  4GFK A;  5GP9 A;  5FJ8 J;  3PAS A;  3JRC A;  1ZK8 A;  3BR5 A;  3QPS A;  3BQY A;  4XRS G;  4MLO A;  5F0H A;  3BQZ A;  1B72 B;  3ZOB A;  3IH4 A;  2ME0 A;  2MGQ A;  2L7M P;  4JX6 A;  2DG8 A;  3NRG A;  2LVS A;  1MBG A;  1A6I A;  4AC6 A;  5M5X J;  2XB5 A;  4BY7 J;  5E3N A;  4S0H B;  1NK3 P;  2ZOZ A;  1LFU P;  2M9H A;  2HYT A;  1K61 A;  1JKP C;  5C4Y A;  3RD3 A;  3G1M A;  3ZQG A;  2RHA A;  2R5Y A;  1YRN A;  1FTZ A;  5F27 A;  1IG7 A;  3FIW A;  3W6V A;  4M3D A;  1AKH B;  1MSF C;  1JJ8 C;  3ZQL A;  3HTH A;  3NNR A;  3JRG A;  5EFY A;  3JRH A;  1ZQ3 P;  3ON4 A;  2DMQ A;  3PO3 J;  4Y52 J;  4MO7 A;  5H9T A;  1HLV A;  3OIO A;  1MH4 A;  2EH3 A;  1TWH J;  5E3M A;  2K9Q A;  3LSG A;  4C2M J;  3BT9 A;  5FLM J;  3HOW J;  4J19 A;  1NTC A;  3SDG A;  1SAN A;  1GVD A;  2E2H J;  3S1M J;  2JJ7 A;  2WV1 A;  3H3V K;  2XGD A;  3CWR A;  5D19 A;  2X6O A;  2CRG A;  3HGG A;  5D18 A;  3AQT A;  4D5C A;  4JX4 A;  2DTZ A;  4B3A A;  2QTQ A;  3LSJ A;  1R9T J;  1AU7 A;  2PZ9 A;  3KZ9 A;  3S14 J;  1HDD C;  5F1J A;  5C3E J;  2XGC A;  3M4O J;  3BRU A;  4D7M A;  3QQA A;  5FKM A;  2D6Y A;  1VI0 A;  1Y1W J;  2IU5 A;  2NVT J;  3VIB A;  5E3L A;  4KWA A;  2FJ1 A;  4M3B A;  3S15 J;  2EBI A;  3FIS A;  3JRE A;  1WH5 A;  2IEK A;  1UHS A;  2XB0 X;  2DA5 A;  3VVZ A;  3B6C A;  2PMZ N;  1B8I A;  3CRJ A;  3VP5 A;  2XRL A;  3RH2 A;  1MH3 A;  3GTO J;  2JK3 A;  2W48 A;  4GFB A;  3QBM A;  4JYK A;  2HXI A;  5IYD J;  3C07 A;  2YU9 J;  3B81 A;  4FCY A;  3CJD A;  3DCF A;  2XPW A;  5FGL A;  1FIP A;  1IUF A;  5FKN A;  3PO2 J;  2NS7 A;  2JA7 J;  2QCO A;  3TP0 A;  2GLO A;  3LJL A;  4A3G J;  4XID A;  1H89 C;  3MKL A;  1IC8 A;  5C4X J;  2ZCM A;  3CCY A;  3P9T A;  9ANT A;  4Y7N J;  4RDU A;  1GDT A;  5IPA A;  4UUS A;  1ETW A;  3L1P A;  3HGY A;  3Q0U A;  3D1N I;  3TW7 A;  2DA1 A;  1JUM A;  4A69 C;  2RAE A;  5EYR A;  1U78 A;  5GPC A;  3JRF A;  1H8A C;  3VUQ A;  4DZP A;  2X48 A;  4A93 J;  2R93 J;  2G3B A;  3PM1 A;  3KKD A;  3FK7 A;  1XG1 A;  3G1O A;  2Y0S N;  3A01 A;  1PUF B;  2I10 A;  2G7L A;  2GFN A;  3ZQC A;  3HOV J;  2REK A;  1ZTR A;  5J1R A;  5BNG A;  4MXM A;  4ME9 A;  2LTP A;  4CYC A;  2QOP A;  5JLW A;  2KDZ A;  3M3Y J;  2FX0 A;  2DN0 A;  3HOY J;  2Y9Z A;  1WH7 A;  4BY1 J;  3JRD A;  5IOZ A;  2XGE A;  3O8H A;  5EDN A;  1ETO A;  1JTX A;  2DMT A;  5EGO A;  3HDD A;  4JX5 A;  2JN6 A;  3BG5 A;  2FQ4 A;  3G7R A;  5K7H A;  4A3B J;  4ABZ A;  2JA5 J;  2XDN A;  5IP7 J;  1POG A;  5M3M J;  4X6A J;  3HOX J;  2GUH A;  2Y31 A;  1MNM C;  2EZL A;  2DMU A;  1UMQ A;  3S1N J;  1G2H A;  4A3E J;  3TP3 A;  3Q0V A;  4QTR A;  3A03 A;  1ZR4 A;  2R7Z J;  4L5E A;  1W0T A;  2ECC A;  2V57 A;  1U8B A;  3B6A A;  1BA5 A;  1GV2 A;  5HOD A;  1IV6 A;  1GV5 A;  3DEW A;  2OI8 A;  5IYB J;  2R5Z A;  4UUT A;  3TW6 A;  3BTC A;  5J1U A;  1IDZ A;  1FTT A;  2DG7 A;  2EZH A;  1B72 A;  4MK6 A;  4GFL A;  1WPK A;  1SGM A;  2DMP A;  1T33 A;  2IBD A;  1CQT A;  1OCP A;  4NDL A;  4D7N A;  3BTI A;  1BW6 A;  1YRN B;  2HYJ A;  4C3I J;  3UKG A;  2UXP A;  2Q24 A;  3BJB A;  3MNL A;  3ZQI A;  1X2M A;  2JWT A;  4GCT A;  1TWG J;  2ELK A;  1F43 A;  1E3O C;  2ZCN A;  2YVH A;  2LK2 A;  2ZOY A;  1Z77 A;  1RES A;  2G0E A;  2OPT A;  1ZGW A;  5GPA A;  5EG0 B;  1QPI A;  1JUP A;  1ZKG A;  2NOG A;  2WB1 N;  1DU6 A;  1X58 A;  3VOX A;  3LHQ A;  1ETX A;  1ORK A;  3H0G J;  1VF9 A;  3KNW A;  4IHX A;  4BKX A;  2Y30 A;  2K9S A;  3S1Q J;  2E2J J;  2O9L A;  3DPJ A;  4D5F A;  3S17 J;  2LLK A;  1JGG A;  4NN1 A;  4I76 A;  2NVX J;  3HE0 A;  3G1L A;  2JA6 J;  1P7I A;  1U9N A;  4A3J J;  3E7Q A;  2QKO A;  2ECB A; 
#chains in the Genus database with same CATH topology
 3A02 A;  3VB2 A;  2EV0 A;  2HQ5 A;  4FT8 A;  4R8H A;  3S1R J;  2OCE A;  2RQQ A;  1R5H A;  1QVU A;  4ACI A;  2ZME C;  3HIM A;  4AIK A;  2KJC A;  4LLL A;  1CF7 A;  1Z7U A;  2HKU A;  3GEU A;  5CYV A;  3K7A J;  2F6C A;  1VQL I;  1D8K A;  1DQU A;  4B1R A;  2DQR A;  1YS6 A;  3BR0 A;  3TQN A;  3G71 I;  3G56 A;  1PJR A;  3I3L A;  1T0F A;  2NYX A;  2MAB A;  2IVM A;  5HNF A;  2OQG A;  1WI3 A;  3E7L A;  2RC4 A;  3QOE A;  1XPX A;  1IRZ A;  2UXU A;  3CP8 A;  1D0X A;  2CO5 A;  4RGU A;  3S3O A;  3CCL I;  3MFK A;  3F72 A;  1I39 A;  1X4O A;  2HEO A;  4JKZ A;  4KIB A;  1TNT A;  1P7J A;  4L9T A;  3BC8 A;  4DBR A;  3I54 A;  2LNB A;  3HEF A;  2BE5 F;  2MD5 A;  5GAG J;  3CO7 C;  5C4J J;  3VOD A;  4BEH B;  2VBX A;  1GHC A;  1OCT C;  1DGR M;  1TWF J;  3JCU C;  4PXI A;  2CFO A;  2BY1 A;  2RGV A;  3BCB A;  1MZB A;  2NOJ B;  3HM5 A;  4I6Z A;  3N05 A;  1IGN A;  1WJA A;  3WHC A;  2EZI A;  4O5V A;  1SD7 A;  2FNA A;  5DM6 F;  4XLE A;  2OQR A;  3BG7 A;  4DQ2 A;  2QEX I;  3W6J B;  2J5O A;  3S5R A;  2AXL A;  3IH3 A;  3GCM A;  4C3H J;  2R0Q C;  2NP3 A;  1EA3 A;  3O3K A;  1JT6 A;  2V6E A;  2VKV A;  2X6X A;  4ESF A;  2DLL A;  1SFO J;  1T38 A;  1GXP A;  4D9J A;  5F0F A;  2XRO A;  3QU6 A;  2K4J A;  1A35 A;  4LIT A;  1D5Y A;  3AQS A;  4Y33 A;  3RJP A;  2OTL I;  1UHW A;  2G7S A;  1XD7 A;  2NX4 A;  4U7D A;  2IGN A;  3S2W A;  4L5J A;  2KHM A;  1FNN A;  3COL A;  3Q0W A;  4DYC A;  4GCK A;  1QHG A;  5DCM A;  3R61 A;  3LSR A;  1JKR C;  2RRE A;  3OYB A;  1ZR2 A;  2IAI A;  3EUK L;  3FMQ A;  4HKU A;  1HSJ A;  4UXN A;  5FLX Z;  2CG4 A;  2OA4 A;  1APL C;  2QWW A;  4IHT A;  4FX0 A;  1GT0 C;  3J7A O;  2KDO A;  5F04 A;  3WTW C;  4CGR A;  1VFC A;  3I58 A;  3IP4 B;  3RDI A;  3GEZ A;  2ZJ2 A;  1ON1 A;  3LL7 A;  5DUK A;  4I0A A;  4E6K G;  1YIO A;  5LHG A;  4C9Y A;  2LFB A;  3J7Y J;  4CA0 A;  2YPR A;  1FC3 A;  1AKH A;  3LSK A;  3DXJ F;  4J01 A;  2HXO A;  1FSE A;  1HXD A;  5D1R A;  2BZT A;  3EGQ A;  2JUG A;  1SFU A;  5LGU A;  3FZV A;  2CW8 A;  3TGN A;  2H1K A;  3IV5 A;  3DKY A;  4F93 B;  2M7A A;  2M8G X;  1IXS B;  1OPC A;  3EUH C;  1RUN A;  1R71 A;  1G59 A;  3H35 A;  3RTR A;  4IHW A;  2YVE A;  3HIF A;  5J4Y A;  4RBO A;  3O60 A;  2MH2 A;  2WV0 A;  4EEF G;  2Z1D A;  1O57 A;  1WJF A;  3ASN H;  5F1R A;  1XSD A;  4RB1 A;  3RKX A;  4E7K A;  2Q8K A;  2VBY A;  2E2I J;  4IHV A;  3ZMU A;  2QWT A;  4XSZ F;  4IRH A;  3MKW B;  2P81 A;  2M7B A;  2XAU A;  2VKE A;  2ID3 A;  3LOC A;  1R1U A;  2XKO A;  4XLA A;  4ZTJ A;  3QOD A;  4FE4 A;  1QVT A;  2IGK A;  2W4S A;  4CH7 A;  1K7A A;  2HKO A;  5L3G A;  1JE8 A;  2VKH A;  4M6Y A;  2XVC A;  4X0G A;  4G9Y A;  2V26 A;  1WRJ A;  1Z91 A;  1JKQ C;  2X9D A;  4ENM A;  4EJU A;  3GTP J;  3G73 A;  4AYB A;  4Z2Y A;  4GCL A;  3KFW X;  3TMO A;  2MSY A;  4I99 C;  1MMN A;  4A3K J;  5FGM A;  3PFI A;  4WK8 F;  1LEA A;  1IZ1 A;  1HDP A;  4U9N A;  2HPM A;  2KMU A;  2L7F P;  2DA7 A;  2ETH A;  3RKQ A;  2CJJ A;  2WC2 A;  1E3H A;  2Q0O A;  1S72 I;  4OU0 A;  2YU3 A;  1HF0 A;  1VZ0 A;  1U9O A;  1L0O C;  4A3F J;  1FJL A;  2HOT A;  3ON2 A;  4HX8 A;  2RV8 A;  3DU6 A;  5DAJ A;  5CVU A;  2W85 A;  4CCL A;  2HOS A;  2V7F A;  1PUE E;  2NP5 A;  1BN5 A;  1IN5 A;  2L5Q A;  1B9M A;  4XK4 A;  2JMW A;  2VLA A;  3OSG A;  4M3G A;  3GUD A;  4LFU A;  1UCR A;  3PQK A;  3OYH A;  5D4R A;  1A31 A;  3S2D J;  5GAD J;  1JT0 A;  4YIF A;  1WFX A;  2GXG A;  1ZYR F;  1MBH A;  4Q4Z F;  1UAA A;  3V78 A;  2VIX A;  3RYP A;  1UI6 A;  1TQP A;  2DMN A;  2WA0 A;  2V6C A;  3IRQ A;  4IKF A;  1EH6 A;  1IV8 A;  1GVJ A;  4B44 A;  3O2P E;  3S3N A;  3OR1 C;  2XKP A;  1G4D A;  2EZK A;  2KZV A;  2VC1 A;  2NVU B;  1IRG A;  3ZQF A;  4PJL A;  4IEJ A;  5HAW A;  1USS A;  2QF7 A;  4HYE A;  2HVS A;  3QOP A;  2Q2E B;  3CJT B;  3HB9 A;  3DTI A;  3AL0 C;  2LY1 A;  2LOO A;  3W2V A;  1TW2 A;  3NXC A;  3RCO A;  5ILV A;  1TC3 C;  2ZB9 A;  3W6K B;  2DK8 A;  2QKL B;  3T1B A;  4YRV A;  2XC7 A;  3PAS A;  3JRC A;  2BY2 A;  1XGM A;  1B72 B;  3ZOB A;  4EJT A;  3K69 A;  1T8I A;  4NC6 A;  4BL0 B;  2L7M P;  2WAQ A;  5TRD A;  2QBY B;  2VQL A;  3CJR B;  1A6I A;  4MEX F;  2UXN A;  5KCM A;  1B59 A;  3QYB A;  4KIG A;  1R5G A;  2HYT A;  2K3F A;  4RB0 A;  1Y8R B;  1OCO H;  1W36 C;  1WZ2 A;  1P9Q C;  1FYM A;  2RHA A;  3MKY B;  2LDU A;  2W1O A;  3BP8 A;  2JUC A;  5CKT A;  1JI8 A;  4M3D A;  1MSF C;  4HPQ A;  1JJ8 C;  3CTA A;  2IRF G;  4V19 K;  3MWM A;  1K78 A;  2DMQ A;  1ZAR A;  2COM A;  1DDN A;  1ZAO A;  4II3 A;  2X6Y A;  1W7P A;  3NRV A;  5LHI A;  1IN7 A;  2QQB A;  2E2H J;  2GWR A;  1SAN A;  3DBR B;  3SQN A;  3GVA A;  1YJN I;  1LJ9 A;  4U0Y A;  3H3V K;  4CGZ A;  5D19 A;  2PLY A;  4YFN F;  5D18 A;  4MNU A;  2HGC A;  2DFE A;  5H6R A;  1YW8 A;  2DTZ A;  2H1L A;  3CUO A;  1IN4 A;  2EJR A;  5FRO A;  3LWF A;  3CLQ A;  3D5L A;  1YW9 A;  3ABT A;  3S14 J;  1HDD C;  2DOA A;  2A6H F;  1X1D A;  3M4O J;  2H8W A;  5D5X B;  2VN2 A;  4BE0 A;  1E0E A;  5FKM A;  3V7R A;  2IU5 A;  1S7A A;  5E3L A;  1XN7 A;  2FJ1 A;  4QLC U;  3FIS A;  2H94 A;  3OYN A;  4CCN A;  1WH5 A;  1S3J A;  3I71 A;  2V1D A;  2PMZ N;  1B8I A;  4RAF A;  3FX3 A;  4I98 B;  3FWE A;  3BOQ A;  1J5Y A;  1MH3 A;  1MNE A;  2BYV E;  2F5C A;  4A6E A;  2W48 A;  3S3M A;  3CCU I;  3F8F A;  5GTH C;  1S7O A;  3HTU A;  2XPW A;  4XN3 A;  3C2G A;  4EJO A;  2KL4 A;  2E1C A;  5FGL A;  5D6E A;  2R7X A;  1Z1D A;  2A05 A;  3B73 A;  3FXO A;  3KZY A;  3CC4 I;  4EQQ A;  2CW0 F;  3BPX A;  3KZZ A;  1ZH5 A;  5C4X J;  4I09 A;  3L2U A;  4RDU A;  1GDT A;  3S8P A;  4UUS A;  2I5U A;  1ETW A;  2V79 A;  5B66 C;  3TW7 A;  2DA1 A;  2RAE A;  1H8A C;  3OYL A;  3VUQ A;  3ASO H;  2DOF A;  3TOB A;  4DZP A;  2X48 A;  4OMY A;  1KA8 A;  3JAM Z;  3O6B B;  3SWH A;  2GAU A;  1TT5 B;  2LBF A;  1PUF B;  3WTS C;  2G7L A;  3LSI A;  1T6S A;  4ENJ A;  2BHY A;  4UB8 C;  1SAU A;  2UUZ A;  3SZT A;  1KU7 A;  2PJR A;  4ZYH A;  4RM2 A;  3ZQ7 A;  5JLW A;  1VQM I;  1FP2 A;  5ICG A;  2DN0 A;  2Y9Z A;  4G6D A;  4C30 A;  2XGE A;  1W5S A;  5EDN A;  2M3A A;  1JTX A;  3QPT A;  2JN6 A;  2DBB A;  4EV0 A;  2QYO A;  1WI9 A;  4G7O F;  4RLQ A;  2XDN A;  5IP7 J;  5HNH A;  2DU9 A;  2ZBK A;  1U0J A;  4OIR F;  4A6D A;  4A3E J;  1YLF A;  1S29 A;  2C6Y A;  4KIT B;  3BDD A;  2MD0 A;  4QTR A;  3A03 A;  1GLN A;  2ZME B;  1Z6T A;  1U8B A;  3B6A A;  2PG4 A;  5HOD A;  1D1C A;  3K4J A;  3N4M A;  4K2E A;  4IXA A;  3DEW A;  2OI8 A;  2L2O A;  2XV4 S;  2R5Z A;  2L01 A;  5H6Q A;  3J80 Z;  3ROU A;  3H9G A;  5TIS C;  1R58 A;  3BTC A;  5J1U A;  2DAO A;  4Y15 A;  4DBQ A;  2EZH A;  3C18 A;  3K10 A;  3VYT B;  1SGM A;  3IWZ A;  4G6Q A;  2BVL A;  2KRC A;  4PUS A;  3E97 A;  3DQV C;  2EA2 A;  2P7C B;  3BTI A;  2FMY A;  2FBI A;  4JQF A;  3UKG A;  3D0S A;  5E8G A;  2Q24 A;  2VC0 A;  2GOM A;  2JWT A;  4IZZ A;  3AAF A;  4XLP F;  1BC8 C;  2YVH A;  2V9P A;  1P4X A;  1QBJ A;  3P7N A;  1FLI A;  1VQO I;  1XB4 A;  1Z77 A;  4B8X A;  4HW0 A;  2F5F A;  2OPT A;  4KA4 A;  3DU5 A;  3M1C A;  4GDF A;  2DK5 A;  3AG3 H;  3LHQ A;  3MEX A;  4IL6 C;  4XKB A;  1VF9 A;  1KQ9 A;  2P0W A;  4ZDO A;  1FOK A;  2Y69 H;  4CZZ A;  2O9L A;  3DPJ A;  3V8J A;  4D5F A;  3S17 J;  2KPM A;  3JAM K;  4BXU A;  5A2Q Z;  1FOY A;  4AIJ A;  3HE0 A;  3ZGK A;  5HS8 A;  3E7Q A;  1FTT A;  1I1G A;  4DYQ A;  2CV0 A;  3S2H J;  1NK2 P;  3AG1 H;  4ZC3 A;  1RR7 A;  2E34 A;  2ZJR F;  1REP C;  1YOV B;  4OOI A;  3ZMZ A;  1O7F A;  1IF1 A;  3HUG A;  4PDK A;  1R4N B;  3J7Z I;  2PN6 A;  2BW3 A;  3FBI B;  3TO9 A;  1KU2 A;  2EIK H;  4M3E A;  2VL8 A;  2I8D A;  3FRQ A;  2VQC A;  3H3U A;  1A5J A;  2X51 A;  4P9F A;  3ZMS A;  3FXJ A;  3I59 A;  2K40 A;  1TWA J;  3T8R A;  1P4A A;  3Q9S A;  1MND A;  5GAE J;  4EGZ A;  4X1E A;  3GO5 A;  3LQQ A;  4L62 A;  2Z16 A;  4XNF A;  2JTV A;  1I6X A;  2ZXH A;  3HBL A;  2W57 A;  3H0D A;  4BXF A;  4A3C J;  3OSF A;  1J75 A;  2OTJ I;  2K7L A;  3GZN B;  2Y0M A;  3KYL A;  2EQR A;  4KFC A;  3J80 K;  1G3S A;  2LH9 A;  3EUA A;  2XAH A;  3IRR A;  2DA2 A;  2DYS H;  4QIW N;  1A36 A;  4E7S A;  3TO7 A;  1TP4 A;  4E7Z A;  1TZL A;  2LD5 A;  1T56 A;  2YX7 A;  4MFD A;  2QEN A;  3IUO A;  5DD4 A;  1IW7 F;  2AHQ A;  4CXF A;  3MAJ A;  1RKW A;  4RGS A;  5E1Z B;  2IJL A;  3GW2 A;  2NS8 A;  4S05 A;  2HDD A;  3ESW B;  3MZ8 A;  2B1E A;  3BJA A;  3KP5 A;  5ICE A;  1JTY A;  2QSH X;  5FKL A;  2QZ8 A;  3FM5 A;  2D5V A;  4UY8 I;  4P55 A;  1I50 J;  2RKH A;  2K3P A;  1ZHF A;  4F92 B;  1XDS A;  2HR3 A;  4NQW A;  4W1U A;  2ISY A;  5E1W A;  2D45 A;  3QP6 A;  4MFE A;  2COB A;  4HX7 A;  3SEQ A;  1K4S A;  1B9N A;  3GLL A;  4A3L J;  3FKI J;  3RQI A;  1O3R A;  1QA6 A;  5HLT A;  2D1H A;  1IN6 A;  3N97 A;  4DZJ A;  1Z3X A;  3ECH A;  4JNN A;  3HOU J;  2G7G A;  2FBK A;  4ZYE A;  2TDX A;  2EIN H;  1W36 D;  3M8E A;  4HLX A;  4CCM A;  1VQ4 I;  1BIB A;  3V4G A;  2KIS A;  2VXD A;  2DA6 A;  3DP7 A;  5ICF A;  3OYF A;  2BHZ A;  1H9T A;  3FF5 A;  4P1W A;  1UG2 A;  1MJA A;  1EV7 A;  2OCC H;  3OYD A;  3MMY B;  4AYB N;  1A6Q A;  2ZXJ A;  3PUF A;  2P5K A;  2DI3 A;  4EM2 A;  4F3Q A;  4HF1 A;  3JSJ A;  3LWJ A;  2JT1 A;  2R5Y B;  5J1Y A;  2JZY A;  3K2Z A;  4WXC A;  4E4H A;  3MKZ A;  4LB5 A;  1WCM J;  4OD5 A;  3MVP A;  3L2V A;  2N8G A;  1UEL B;  1MBF A;  2L54 A;  3JRB A;  3L2C A;  4IOC F;  3LSP A;  2UXH A;  2E5Z A;  1OYW A;  3BR2 A;  4AC0 A;  5D8K B;  4MGR A;  1D8J A;  1WGX A;  2NS0 A;  1MW7 A;  3DPT A;  4W97 A;  1L3L A;  3WTZ A;  3OYA A;  1R23 A;  1U5T A;  3UR3 C;  4U7B A;  1FYK A;  3SHF A;  4A5N A;  2MA3 A;  2FNP A;  3FXU A;  1R1T A;  3BR3 A;  4IVN A;  4DYR A;  3IWF A;  1YTY A;  1MD0 A;  4ASN A;  3MCZ A;  4YII A;  1V54 H;  5EG0 A;  2FBQ A;  1H9G A;  4GCV A;  2IGM A;  2DOE A;  2DDA A;  3KEO A;  5ERI A;  1R1V A;  3CCQ I;  3RPU D;  2CH0 A;  4XM3 A;  1BI2 A;  5DM7 F;  3E6B A;  3RYR A;  5E79 C;  1S8N A;  3J7A Y;  4F52 A;  4HOB A;  3GFL A;  4XLC A;  5EZH A;  3ZCO A;  2VOD A;  1Z0X A;  5IP9 J;  4N4N B;  1XDU A;  3FKJ A;  2VOO A;  3GX4 X;  4A3M J;  3KP6 A;  1OCR H;  2M2E A;  4IJA A;  2DA4 A;  1CF7 B;  2K9L A;  4Q47 A;  5DCF A;  1V5E A;  1LDJ A;  5BPI A;  1KU3 A;  1SVO A;  1ZG3 A;  1JJ6 C;  1E2X A;  3C2H A;  3AL0 B;  3HSF A;  5DTD A;  3RKY A;  2R7F A;  4BBR J;  4WWC A;  3L9F A;  1X3U A;  5EEA A;  3GLX A;  3CD6 I;  2KIU A;  3WE3 A;  1OR7 A;  5EZG A;  2M0M A;  3V7S A;  3CCJ I;  2FML A;  3C2B A;  2DQL A;  4F55 A;  1HKQ A;  1GXQ A;  2QQA A;  4XRS A;  1XCV A;  2HS5 A;  4FQG A;  3F23 A;  3VW0 A;  1OQY A;  1ETY A;  2LY2 A;  2HFH A;  4XIC A;  1XS9 A;  2OU2 A;  5D5U B;  2WAQ N;  1WVR A;  2LP0 A;  2R7D A;  4CDG A;  2NXN B;  1HW2 A;  2LMD A;  2DJN A;  4BU2 A;  3KYC B;  3ABU A;  2R7S A;  3MD2 A;  1IJW C;  2X85 A;  2YR2 A;  2WAF A;  5JFR A;  2CQX A;  4DW6 A;  1IXR C;  3JRA A;  2E1M B;  2F5V A;  3H1C A;  3OL4 A;  5K58 A;  4EM1 A;  4BEH A;  4LJZ F;  2JA8 J;  2XAQ A;  5B3S H;  4BQQ A;  3DTK A;  3SDB A;  4MQV A;  3IH2 A;  3ZMT A;  1X1C A;  2Y9Y A;  3RZO J;  3LFU A;  1E17 A;  3M9A A;  3OYE A;  5IOY A;  1HCR A;  1JHF A;  1HBX G;  1AHD P;  1OFC X;  4C2U A;  1BJZ A;  1OJL A;  1TLH B;  4XOP A;  3T8T A;  5M5Y J;  3GZ6 A;  5KHD A;  1ZRC A;  3QPL A;  1UFM A;  2CV2 A;  2YVX A;  2NVQ J;  4YG2 F;  2HDW A;  4RB2 C;  3ANP A;  5AQC A;  1BOA A;  1QRY A;  1SAX A;  3VVX A;  2X0L A;  1B4A A;  2YUS A;  1TBX A;  4KMF A;  1A04 A;  1TNS A;  4GFK A;  5FJ8 J;  4HST A;  1T2K A;  3K1P A;  2L3D A;  3BR5 A;  5DCM B;  5F0H A;  3IH4 A;  2ME0 A;  3RPU A;  2B3W A;  3BY6 A;  3H9J A;  2ZJP F;  1LVA A;  4JX6 A;  2VJ4 A;  3L2R A;  2R3S A;  1ZRF A;  4BY7 J;  4S0H B;  1SVM A;  4WF2 A;  2ZOZ A;  2IW5 A;  3WTX C;  1LFU P;  3MZY A;  3OS0 A;  2LKP A;  2V1N A;  1JKP C;  2HU9 A;  2XRN A;  3ZQG A;  2IP2 A;  4CIC A;  2CGP A;  1IG7 A;  2KQR A;  3WE2 A;  1DP7 P;  5F64 A;  1F9N A;  1AKH B;  1KYW A;  3W6V A;  3NNR A;  3KEY A;  5EFY A;  3ML6 A;  5HS9 A;  3VSK A;  3ABL H;  5H9T A;  2X1C A;  1YJW I;  2FEZ A;  2GOX B;  1MH4 A;  1TWH J;  3F22 A;  4C2M A;  3SZP A;  4XBF A;  2P5V A;  3HOW J;  4HEA 2;  4J19 A;  3F9K A;  1IO2 A;  3SDG A;  4R1H A;  2Z33 A;  1I27 A;  3WU1 B;  4XN0 A;  5HLI A;  2ZFU A;  3HGG A;  5L3C A;  3NEU A;  2V1X A;  3JSO A;  2RQP A;  1RC9 A;  4OIP F;  3AG4 H;  3AFH A;  5TGT A;  1AU7 A;  4LG0 B;  2PZ9 A;  2CQN A;  2QKM B;  4P9U A;  1V55 H;  2ELH A;  2UV1 A;  1ODD A;  3DEU A;  3CJQ B;  4A0X A;  5GAH J;  1TTY A;  1LVK A;  4RGR A;  2YSR A;  1WJC A;  3ABM H;  4AM3 A;  4BS9 A;  1SMY F;  4P5O A;  5J47 A;  3PL8 A;  1V4R A;  4XMY A;  4L9N A;  1YHQ I;  1UHS A;  3VVZ A;  4JK1 X;  1YE9 A;  1FZP B;  3CRJ A;  3VP5 A;  2XRL A;  5D8L B;  3WTT C;  1W7P D;  3L2Q A;  4CUG A;  3NWS A;  1ZG1 A;  4BHP A;  5LFA A;  2H6B A;  2HXI A;  3LSM A;  5KVR A;  2YU9 J;  4PFO A;  4FCY A;  1LNW A;  3WG7 H;  1FIP A;  2ZCW A;  3OYM A;  2H6C A;  2X1E A;  3LA2 A;  3C3W A;  2DT6 A;  2O3F A;  1FY7 A;  3TP0 A;  1OMI A;  4CZC A;  5L3F A;  5FLX K;  3MKL A;  2STT A;  2VQH A;  3PNT A;  1IC8 A;  3P9T A;  9ANT A;  4U0V A;  1YG2 A;  5BQT A;  5IPA A;  4ITV A;  1U5T C;  1R49 A;  1S5L C;  2HWV A;  1U78 A;  1OKR A;  5EYR A;  1FOX A;  2HQN A;  2XAS A;  1IXC A;  3CUQ B;  1Z3Y A;  2BXZ A;  1Z05 A;  2X1D A;  1MDM B;  2R93 J;  3T5X A;  4AVZ A;  3P9C A;  3E5Q A;  3RSN A;  4DGW B;  1HA8 A;  2VE9 A;  4XRF A;  4U0W A;  4HF0 A;  4NHJ A;  3VYR B;  1TW3 A;  3IAS 2;  3HOV J;  4GXO A;  4QPO A;  1Z6R A;  1G6N A;  2VJI A;  2E7X A;  4MXM A;  3V8L A;  4ME9 A;  4CYC A;  5J40 A;  4HLY A;  4CYD A;  5BMZ A;  3K4C A;  2G7H A;  2KDZ A;  2EB7 A;  5BS6 A;  4TV7 A;  1LDD A;  1JHH A;  2UZK A;  3K8P C;  1FPQ A;  1MMD A;  3BCA A;  4BY1 J;  5IOZ A;  2M4K A;  3O8H A;  2DMT A;  2VT3 A;  2NNN A;  2GA2 A;  1T0F C;  4A3B J;  1DP3 A;  4ABZ A;  4OAY A;  2M1B A;  1W4M A;  2ESN A;  3A2K A;  4X6A J;  2Q2E A;  2PJP A;  2MFZ A;  4HBL A;  1MNM C;  1OR7 C;  1G2H A;  3TO6 A;  2HDC A;  2K02 A;  3DKX A;  2OUM A;  4HF2 A;  3Q0V A;  4KNY A;  3HPH A;  4G6T B;  4L5E A;  2JVH A;  5FO5 A;  2ECC A;  3EYI A;  1UJ8 A;  4CO8 A;  2V57 A;  4AU7 A;  1GV2 A;  4A5M A;  3D5S C;  1XMK A;  2QVO A;  3K4L A;  2EIL H;  2EIM H;  4NC8 A;  5IYB J;  4LLN A;  1PYV A;  4BHB A;  2DG7 A;  1IDZ A;  4MK6 A;  1B72 A;  1UB9 A;  1WPK A;  3L00 A;  3DBH B;  2DMP A;  4XQF A;  1CQT A;  2QBY A;  4QPQ A;  2JVG A;  1J7K A;  3ELK A;  4D7N A;  4C3I J;  2R7U A;  2W7N A;  3BJB A;  3ZQI A;  2Y0S A;  4YIR X;  1VQK I;  4IF4 A;  4XKV A;  4GCT A;  2NNY A;  2RN7 A;  2LK2 A;  5HDG A;  2L02 A;  1ZGW A;  3WGI A;  1QPI A;  3Q9V A;  4QWQ A;  2ZXW H;  2NOG A;  1DU6 A;  1FBU A;  1N75 A;  3I5U A;  3VOX A;  1LQ1 A;  2O03 A;  3U21 A;  2ZSH B;  3DWL E;  2F4I A;  1YQA A;  3IKV A;  3KYD B;  3S1Q J;  3H5A A;  2V9V A;  4GRI A;  1JGG A;  4NN1 A;  3H9Q A;  1KON A;  3M7G A;  2NVX J;  4ENK A;  1WQ2 A;  5FFZ A;  2CUJ A;  2K86 A;  3G1L A;  1P7I A;  2L9N A;  4A3J J;  3M8F A;  5GTI C;  2OF7 A;  3F6O A;  4JL3 A;  1N25 A;  5EF6 A;  4JP0 A;  3RZD J;  2O61 A;  3OMY A;  2HTJ A;  3SZG A;  3LFK A;  1STZ A;  2K9N A;  1S6L A;  4BYY A;  5F6F A;  3I4M J;  1YJ9 I;  1YI2 I;  2A5W A;  2LKX A;  3ANG A;  1T39 A;  4KIS A;  4XKC A;  4BNC A;  2QLZ A;  4MTE A;  4AID A;  3BHQ A;  2DTR A;  3CF2 A;  1MJ9 A;  2PBX A;  4P96 A;  5DUI A;  3MN2 A;  3VW2 A;  5FLV A;  2KP6 A;  1G8X A;  2V9K A;  2MLG A;  2OC6 A;  2FJI 1;  2VI6 A;  1U6G A;  4B4C A;  2EFQ A;  2DPD A;  5J4V A;  1BR1 A;  4N4O B;  1LE8 B;  2Y75 A;  2EFN A;  5M3F J;  2HOE A;  1FMW A;  1G3Y A;  4LOC A;  2KZG A;  2CMP A;  2CU7 A;  1K83 J;  5IY5 H;  1IDY A;  1V5G A;  2R7Q A;  4DIQ A;  4U9L A;  1I3Q J;  4FHT A;  3F8N A;  2A5Y B;  4HSR A;  5CVJ A;  1FBQ A;  2LBF B;  4M9X A;  4ENN A;  1Z21 A;  4J00 A;  2GIZ A;  3VTI A;  3BZ6 A;  5HOO A;  1MBE A;  2NVY J;  1WJ5 A;  3Q3S A;  4BQO A;  1F36 A;  1J09 A;  1DU0 A;  4D1Q A;  4BQN A;  1ACI A;  2ZFW A;  4FET A;  3HTJ A;  2PJR B;  2B63 J;  1Y39 A;  3H5R A;  1PUF A;  3ZQQ A;  2K27 A;  4FE7 A;  1FIA A;  4F7Z A;  2H09 A;  5K5R A;  2IA2 A;  4RLF A;  1TQI A;  1HOM A;  4Q48 A;  3OYJ A;  1ON2 A;  2LY9 A;  2VJ5 A;  4OD4 A;  1PP7 U;  5DS9 A;  4EAT A;  1Y1V J;  4EVI A;  3HSE A;  4XLF A;  5LEK A;  3I64 A;  2CSO A;  3A0H C;  2DJI A;  2B9S A;  4L9J A;  3QRF F;  3VW1 A;  4ICH A;  1MKM A;  3OWT A;  2CFX A;  2KIF A;  2VPR A;  1XSV A;  3K4M A;  2DFI A;  1ETV A;  4O6J A;  1D0Y A;  4BXX J;  4HQM A;  1Y6I A;  2M87 A;  3W2W A;  4HNT A;  1O3T A;  3JTH A;  3DKW A;  2VPL A;  4DVY P;  2O7T A;  3H5N A;  2R7T A;  2R5Z B;  4EMS A;  4GYG A;  3RQ4 A;  4I02 A;  3EUP A;  1VQ6 I;  1F1Z A;  3F8C A;  1WSU A;  4H4K C;  2R7V A;  1SEU A;  3HJE A;  3CMY A;  3BTL A;  3K6G A;  3FBN B;  4E7I A;  5H20 A;  2EA4 A;  3GZI A;  2AQF A;  2CQQ A;  3OOU A;  4Y4R A;  4O3M A;  3BR1 A;  3GTL J;  4CCK A;  2R92 J;  4MIM A;  4AD9 A;  4YZE A;  1PDN C;  1R4M B;  2QQ8 A;  1ONV A;  3TL4 X;  3WHB A;  3FXL A;  4G12 A;  4PJJ A;  2XSD C;  1MBJ A;  2HI3 A;  2XAJ A;  3I0T A;  3ZMD A;  2YS9 A;  4BUP A;  1I1S A;  1OYI A;  4V2G A;  2FXA A;  3KP7 A;  2F07 A;  1EH8 A;  4YEL A;  3FMR A;  4UVA A;  2LR8 A;  4FX4 A;  2OZU A;  4PJM A;  1RKT A;  2FE3 A;  1R00 A;  2EK5 A;  3H92 A;  4BDY A;  1Z9C A;  3R4K A;  4I0B A;  3CDL A;  4M9S A;  3REO A;  1ZG5 A;  1W0U A;  2LRD A;  3BNI A;  2VAS A;  1VQ5 I;  4ZDL A;  5E8I A;  1K79 A;  2MW8 A;  2JPC A;  4LGW A;  4WXD A;  5LEJ A;  4AF5 A;  2M30 A;  1R5I D;  2CUZ A;  3HRS A;  3RI4 A;  3HUG B;  1O4X A;  2CWE A;  2VXZ A;  3QPH A;  2BW3 B;  4II2 A;  4YFX F;  2ZKZ A;  5DYM A;  3I4N J;  5CXG A;  3KX2 A;  5FFX A;  4PGH A;  1ZGJ A;  5K7Z A;  4AIH A;  3ONQ A;  5CVR A;  3BG3 A;  4PSX A;  1RR8 C;  3TOA A;  4A12 A;  3FK6 A;  3OYI A;  1JUS A;  2H27 A;  4FTH A;  4RMN A;  2HVR A;  2MLK A;  2JRM A;  3NPI A;  3JW4 A;  2TCT A;  4G7H F;  3WTV C;  5B1A H;  1YX3 A;  1I6H J;  2DT7 B;  2LF7 A;  5CJ9 A;  1VND A;  2HZT A;  4RM3 A;  5TJJ A;  2QIB A;  4UDS A;  1QZE A;  3GTM J;  2GBY A;  3GWZ A;  4PJN A;  1BW5 A;  5BPD A;  5K1Y A;  2UXO A;  2CUF A;  4A3I J;  3V7C A;  2EPF A;  5K5O A;  2RVC A;  3FDY A;  3NQO A;  3A01 B;  2E19 A;  1D1A A;  3KP3 A;  2QSF X;  5HSZ A;  2XHK A;  2F4M B;  3CCV I;  2CS3 A;  2OD5 A;  3BWG A;  2DO7 A;  2KJB A;  3IKT A;  4LG3 A;  1NH3 A;  2ID6 A;  3LNQ A;  3W3C A;  2DDB A;  1IAW A;  4HA8 A;  3RIR A;  4AUX A;  4DJA A;  2P7V B;  2XGX A;  3HYI A;  1R6R A;  4GGG A;  3WTY C;  1ZLK A;  2VON A;  2P8T A;  1HKS A;  5EGO B;  4GO1 A;  1YS7 A;  2OJE D;  1XC5 A;  2DW4 A;  3QKX A;  3UNG C;  2QKO A;  3BPV A;  4KDP A;  2MYS A;  1ETQ A;  5DD8 A;  3OIP A;  3K2A A;  5A2Q K;  2MH9 A;  5DDG A;  4A3D J;  3ZRG A;  3K1M A;  1KGS A;  4XOT A;  4IHY A;  5F08 A;  2AO9 A;  4LIU A;  4UUV A;  4UHT A;  5HS7 A;  4E70 A;  2PFV A;  4QSH A;  3FXR A;  3PPB A;  1WJD A;  2VBZ A;  4HDV A;  1ZRE A;  5IP6 A;  1RET A;  4A0Z A;  1C0W A;  4I2O A;  3SYT A;  3HRM A;  3CC2 I;  1ZK8 A;  4UNO A;  4KN7 X;  3BQY A;  2Z99 A;  3BQZ A;  1HQC A;  2XF5 A;  3IL2 A;  5DEQ A;  3DPL C;  1T98 A;  3CC7 I;  2KFD A;  3IHU A;  3E3V A;  2MGQ A;  4LIV A;  1DUX C;  2DG8 A;  1FT9 A;  3NRG A;  1MBG A;  1U2W A;  3CDH A;  2XB5 A;  5E3N A;  1R36 A;  4XL9 A;  2OBP A;  4DOZ A;  2M9H A;  3ZPL A;  2L9V A;  3EPZ A;  1X3W B;  1SMT A;  2EWN A;  3OR2 C;  4ESJ A;  1K61 A;  5C4Y A;  3RD3 A;  3QP5 A;  4NB5 A;  2CQK A;  2R5Y A;  2D2W A;  2XF7 A;  1YRN A;  1FTZ A;  1PVE A;  2BXY A;  4BE1 A;  1ZRD A;  1WJE A;  2E35 A;  3FIW A;  1IRF A;  2BV6 A;  1ZQ3 P;  4Y52 J;  1HLV A;  2L9S A;  3R0A A;  2DOD A;  1K4T A;  5B5E C;  5L3E A;  1U5T B;  2MC4 A;  5E3M A;  1OCC H;  2PBI A;  3BLY A;  3VDX A;  1NTC A;  3ISP A;  3S1M J;  1GVD A;  5J8C A;  2ELJ A;  1XTA A;  2WV1 A;  2XGD A;  1SFX A;  3CWR A;  2OZ6 A;  4C2T A;  4DNC A;  2CRG A;  4AVP A;  4I01 A;  1VQ9 I;  2QTQ A;  1YFH A;  3WU0 A;  2A61 A;  1TQM A;  2FBH A;  2Y48 A;  4M6X A;  3KZ9 A;  3P9I A;  1HW1 A;  1U3E M;  5AON A;  5DV5 A;  2XGC A;  3BRU A;  3HOT A;  3QYE A;  4L5I A;  4D7M A;  4ZJZ A;  3OYK A;  3NS4 A;  5HDN A;  3QQA A;  2VE8 A;  4KIF A;  2RNJ A;  1FSH A;  1Y1W J;  2NVT J;  3G2B A;  2XDV A;  2BVM A;  1LKX A;  4OWR B;  4KWA A;  4NC7 A;  1SD4 A;  2XUB A;  2EBI A;  4N9H A;  3S15 J;  1YIJ I;  3DLA A;  2PMU A;  2IEK A;  2M5W A;  4PSW A;  4EJV A;  4MTD A;  1W1W E;  4L9V A;  4U88 A;  5JVT A;  2K85 A;  2GXB A;  3GTO J;  4ETS A;  2IPQ X;  2JK3 A;  1RUO A;  3EET A;  1P6R A;  2IGO A;  4JYK A;  5IYD J;  1BI3 A;  1W5T A;  3B81 A;  1ULY A;  3CJD A;  3DCF A;  4BJT A;  2BY3 A;  3CF5 F;  1IUF A;  2Q1Z B;  4CHU A;  3PO2 J;  2NS7 A;  1NG6 A;  2GXA A;  2QCO A;  1EJ9 A;  4BJ5 C;  1X1P A;  3LJL A;  1NHA A;  1H89 C;  3ZP5 A;  4IOA F;  3BG6 A;  2BEO A;  5CQE A;  4L0Y B;  2ZC2 A;  3ZN1 A;  3CJN A;  2V4J C;  3HGY A;  3Q0U A;  1X1A A;  3KP2 A;  3F6V A;  5GPC A;  2W24 A;  1QNT A;  4FAS D;  5E1X A;  1T08 B;  1ZLJ A;  2E71 A;  3PM1 A;  2ZO4 A;  3FK7 A;  2IS4 A;  2HQA A;  2Y0S N;  3AKZ A;  1SD6 A;  1UG0 A;  4U87 A;  1J0R A;  4I7H A;  3ZQC A;  2LRE A;  2PX9 A;  4UV9 A;  1VQ8 I;  1ZTR A;  3CLO A;  5J1R A;  3OYC A;  2QUF A;  5FD6 A;  2K5C A;  1OCZ H;  2QOP A;  4OMZ A;  5JR3 A;  3PNY A;  2DXI A;  1WJB A;  4NUB A;  3M3Y J;  5LGN A;  3R0J A;  5CPR B;  2FX0 A;  4R79 A;  1WH7 A;  3JRD A;  2KKO A;  3WTU C;  3I56 I;  1ETO A;  3HDD A;  4JX5 A;  2ZXI A;  3TDZ C;  3BG5 A;  2JQ7 A;  2FQ4 A;  2PQ8 A;  4F91 B;  1P4W A;  5K7H A;  5D6F A;  3L7W A;  2P4W A;  2JA5 J;  2EFP A;  1POG A;  4BE2 A;  3K70 D;  2OV7 A;  2EZL A;  1LUJ B;  1UMQ A;  4IPA A;  4A2U A;  3S1N J;  2ICW G;  1LDK B;  2M4G A;  5B1B H;  4ZYD A;  3K4N A;  3PFY A;  1W0T A;  2CW7 A;  4B09 A;  1U8R A;  3D5R C;  1IV6 A;  2FF4 A;  4HNU A;  1JGS A;  1UZC A;  1GV5 A;  3HRT A;  1FBS A;  5L3B A;  4UUT A;  3TW6 A;  4GFL A;  3WG9 A;  3PSI A;  3FHZ A;  1J59 A;  1N78 A;  2FA5 A;  2VQG A;  4EM0 B;  4D0P A;  3HL2 A;  2WBM A;  1T33 A;  1OCP A;  2F5E A;  3GF2 A;  4NDL A;  3CO6 C;  1J2X A;  5E20 A;  3MNL A;  3ECO A;  4PGG A;  4G7Z F;  1ZGA A;  4M71 A;  1J9I A;  1SFK A;  2KLO A;  2X4H A;  2ZCN A;  1E3O C;  2STW A;  1XCB A;  2ESH A;  2L7K A;  2QM3 A;  4JBA A;  2R7O A;  2GA1 A;  4BJ6 C;  1RES A;  2G0E A;  4OIQ F;  1T95 A;  1F4K A;  2FUG 2;  4N9I A;  1H0M A;  1KZH A;  2NRA C;  2ZSI B;  1ZKG A;  1RNL A;  3DTE A;  1O7L A;  4PJ0 C;  3H0G J;  1ORK A;  3WGG A;  2PEX A;  4IHX A;  4YEJ A;  2K9S A;  2F48 A;  3ZR8 X;  4HQE A;  3F3X A;  3CCR I;  1BC7 C;  4I76 A;  6PAX A;  2XAG A;  2EFO A;  5D4S A;  1MJB A;  4IX7 A;  1QGP A;  1U9N A;  3CES A;  3HOS A;  2ZJQ F;  3T6N A;  4RB3 C;  4B48 A;  2LF8 A;  4KT6 A;  5M5W J;  2AXT C;  3PIP F;  3SFI A;  4LG0 A;  4XLN F;  3RPQ A;  3ZMV A;  2A6E F;  2FOW A;  5J3L A;  3HTI A;  3I4P A;  3GYH X;  3HG9 A;  4CCO A;  4NNJ A;  3BZK A;  1RPW A;  4G94 A;  1WHU A;  2L7Z A;  1R7J A;  2E5N A;  1I5Z A;  4XON A;  1D0Z A;  3HOZ J;  3KCC A;  1I3A A;  2B0L A;  2JRT A;  4ON0 A;  4IQJ A;  4MHG A;  2KIM A;  5LHH A;  3IUV A;  2VBW A;  5F0C A;  2JA2 A;  3NI7 A;  3F8B A;  3E1S A;  2LG4 A;  2ZNY A;  3F8M A;  3IC7 A;  4B43 A;  1LPQ A;  2BOL A;  3PQJ A;  3LA7 A;  1RIO H;  3GZ5 A;  3KLN A;  5CLS A;  3E0J B;  3E6C C;  1CGP A;  3BRO A;  4NEL A;  5JVG F;  1RI7 A;  2CUE A;  1YX5 A;  4B47 A;  5IT9 Z;  5JLX A;  1VQN I;  3BJO A;  1XGS A;  1RRJ A;  1FYL A;  3K1N A;  1BR4 A;  2WB1 A;  3EDP A;  2RDP A;  1ERD A;  2OER A;  1D5V A;  2PI0 A;  2HPI A;  3T0Y A;  5HLH A;  5CW8 A;  2O7O A;  1JKO C;  2O5R A;  3PNV A;  2VOP A;  3KP4 A;  3QU3 A;  2A2F X;  1FX7 A;  3DPU A;  4XRM A;  3CUQ A;  1K6O A;  4KUM A;  3VVY A;  2E36 A;  4HNV A;  1MDM A;  4UVC A;  5KAF C;  1OYY A;  4BAC A;  3R6S A;  2E1O A;  2HNH A;  2FOK A;  2L0K A;  4CYC B;  2XPV A;  1ENH A;  2P5L C;  3GTG J;  1K6Y A;  4A0Y A;  3SEZ A;  5FHP A;  3BTJ A;  1X3Z B;  3F1B A;  2L4A A;  1GUU A;  1Y56 A;  3VYU B;  3ABK H;  3KLO A;  4V2F A;  5FB2 A;  2WAE A;  2DCE A;  5IYC J;  2GIV A;  2PFB A;  4OAZ A;  3V6G A;  2IXS A;  3I9V 2;  3GTQ J;  2W82 A;  5C44 J;  1UI5 A;  3KKC A;  2IA0 A;  3NAU A;  2LSO A;  3GTJ J;  5LLQ A;  1FEX A;  3BZC A;  1FWZ A;  3NWT A;  5LRR A;  3VPR A;  2Z9O A;  1LFB A;  2Y2Z A;  5FKK A;  2ZNZ A;  3ERM A;  1EH7 A;  3LQR A;  3PSF A;  2H8R A;  2IS2 A;  3HSR A;  3H36 A;  5J8F A;  3X2Q H;  1S7E A;  2JSP A;  2M0C A;  3ZQH A;  3GFM A;  1SD5 A;  2JPB A;  4PCQ A;  3U2R A;  1X1B A;  4LMY A;  4OIN F;  4CCJ A;  1D1B A;  4HV6 A;  1Q1V A;  4FIS A;  1XSX A;  3FXK A;  1EF4 A;  1X2N A;  3K4K A;  3CCE I;  2L9R A;  3CDI A;  3J81 Z;  2HTS A;  1XGO A;  3OL3 A;  3U1K A;  1K78 B;  5D5W B;  2A07 F;  1Y8Q B;  2WY7 Q;  1EKE A;  1W7P B;  2A3S A;  4M3F A;  1WWX A;  5FMP A;  1UST A;  3A4C A;  2E1M C;  5HLG A;  1X19 A;  4LK1 F;  4BAY A;  5H2F C;  1BIA A;  5ICC A;  2HOA A;  1ZN2 A;  4KT5 C;  1FMV A;  2E1N A;  3M07 A;  4M72 A;  2HVQ A;  5IT9 K;  1D3Y A;  3BR6 A;  1V5F A;  3S32 A;  4ZDP A;  3G6E I;  4C3J J;  5J6X A;  4BQA A;  5E3O A;  5HBU A;  1AA7 A;  2WWY A;  3DLL F;  1H88 C;  3HTA A;  1MSE C;  2UXI A;  1E3P A;  4AWX B;  4MEY F;  3WOD F;  3JR9 A;  3CME I;  2IS1 A;  3O8G A;  2ME6 A;  3BJ6 A;  3OOP A;  3COA C;  2B7E A;  3CCS I;  1DGW Y;  2V1U A;  3IAM 2;  4BBS J;  3CQZ J;  4MQ9 F;  2IS6 A;  1OLT A;  4EJW A;  2RAS A;  1MBK A;  5FKO A;  3P9K A;  1XMA A;  3VEP A;  1OIS A;  2VUM J;  1QZY A;  2GQQ A;  4ZH4 F;  2TRT A;  2F4O B;  4WX9 A;  3V8K A;  3JRI A;  1B8I B;  3GXO A;  3OIQ A;  1B1B A;  2HYF A;  2W53 A;  3CZ6 A;  2DT5 A;  3DBL B;  3AG2 H;  5LGT A;  2R7R A;  2MBF A;  2QSG X;  3GBG A;  3FM3 A;  2MG4 A;  5CVV A;  3BG9 A;  3SJM A;  3JSP A;  4PFP A;  3NAR A;  4Q5S F;  2QGU A;  1ETK A;  3JTG A;  5JI6 A;  5CXI A;  1QHH D;  5KNL A;  1V3F A;  3L09 A;  2UWM A;  1G3T A;  4RS8 A;  2CV1 A;  3S16 J;  4LD5 A;  4Y3O A;  1F5T A;  3P5J A;  2QQ9 A;  2XIG A;  1MIJ A;  4UUS B;  3GME A;  2GM4 A;  4LLG F;  3QAH A;  1MMG A;  2HYG D;  1SFE A;  4EGY A;  1LEB A;  2CQ7 A;  3HTS B;  2KRF A;  2ZCX A;  4OIO F;  4M6V A;  1PP8 F;  3OS1 A;  1HC8 A;  3KEQ A;  5ILU A;  3ULQ B;  1M1E B;  5AIP A;  1KU9 A;  1UHM A;  4M9Z A;  1LE8 A;  2WUI A;  5BOX A;  1BL0 A;  4RAG A;  5CVI A;  3J81 K;  1KQ0 A;  2XPU A;  1IRX A;  4Z6Y A;  2XAF A;  3BCG A;  3VOK A;  4HRI A;  2M34 A;  3F0C A;  2DA3 A;  2WGB A;  1O3S A;  2O8K A;  3KPH A;  5K7F A;  4HDU A;  2FD5 A;  4UVB A;  2EFW A;  5IT3 A;  1B6A A;  2O8X A;  3B02 A;  3QWL A;  4NBQ A;  4WCG A;  3C7J A;  2GEN A;  4WXH A;  1LB2 A;  3OV8 A;  1YYV A;  2FU4 A;  1BBY A;  2VKD A;  2X6W A;  4UV8 A;  4XKW A;  3HKZ N;  4ZTF A;  2IA1 A;  1ITY A;  4RA2 A;  3VFZ A;  1WKM A;  1LFP A;  5D5V B;  3K0L A;  2KT0 A;  1N77 A;  5KK1 A;  1TWC J;  3A1Y A;  4KN4 X;  3TED A;  3G3Z A;  3H3Z A;  4BGD A;  2KRH A;  1W5C C;  4IRV A;  3GTK J;  1KQ8 A;  5GP9 A;  4XLH A;  4KMU X;  2LYC A;  4IRG A;  3QPS A;  4XRS G;  4MLO A;  2ZME A;  2UXX A;  4XOR A;  4IRI A;  1BM9 A;  2K9M A;  2P6S A;  5FRM A;  5HDK A;  3K70 C;  2L4M A;  4ZYG A;  4BH9 A;  1IN8 A;  3FMS A;  3GFJ A;  1QU3 A;  2ISZ A;  2LVS A;  4AC6 A;  5M5X J;  1NK3 P;  4Y17 A;  2ADU A;  3FHN A;  1AOY A;  3CMA I;  3G1M A;  2E60 A;  1YO5 C;  5FD5 A;  5F27 A;  3CUQ C;  3E5U A;  2WTE A;  1YIT I;  2LKS A;  2EV5 A;  3HTH A;  3ZQL A;  3JRG A;  3JRH A;  2P6T A;  3ON4 A;  5LBQ A;  3PO3 J;  3Q5F A;  4LB6 B;  2FQ3 A;  4MO7 A;  3LST A;  2EIJ H;  2BBY A;  3OIO A;  3MQ0 A;  2FSW A;  4ZZL A;  3VWB A;  2EH3 A;  2QA4 I;  2RNG A;  2K9Q A;  1VQ7 I;  3LSG A;  2A6T A;  1HW5 A;  3BT9 A;  3DV8 A;  4C2M J;  5FLM J;  2R4G A;  3PJR A;  4KYW A;  3EQL F;  3SXY A;  1RZ4 A;  3L2W A;  2JJ7 A;  1VTN C;  1Q1H A;  1TL8 A;  4BDZ A;  2X6O A;  2XSJ C;  3AQT A;  4D5C A;  2HZD A;  4JX4 A;  4B3A A;  1KYZ A;  4GYI A;  3LSJ A;  1R9T J;  2LC2 A;  4PK4 A;  2JSC A;  1QPM A;  2KIQ A;  5F1J A;  5LRS A;  5C3E J;  3G4S I;  1BI0 A;  1JXS A;  4RAY A;  2D6Y A;  1VI0 A;  3C1D A;  3VIB A;  3FXM A;  1AWC A;  3CP2 A;  3VYS B;  4M3B A;  3K9T A;  5ILS A;  3JRE A;  4H0E A;  3DF8 A;  1XGN A;  2XB0 X;  1XMX A;  2DA5 A;  2WY8 Q;  3I59 B;  3U9G A;  3PIO F;  3B6C A;  2E7W A;  3F21 A;  2DYR H;  1Z7L A;  3RH2 A;  2F2E A;  3LSH A;  2BGC A;  5KAI C;  3TKY A;  1P2F A;  4YFK F;  4GFB A;  3QBM A;  4KIC A;  3C07 A;  1G3W A;  1QQI A;  2ZY9 A;  4RAZ A;  2HKX A;  3LMM A;  5ED4 A;  3DFG A;  1O3Q A;  5FKN A;  4CSW A;  2WAD A;  2NAZ A;  2JA7 J;  1TT0 A;  4HG2 A;  2GLO A;  3U1D A;  5JHU A;  4A3G J;  4KJZ A;  4XID A;  1BI1 A;  3LA3 A;  2ZCM A;  3CCY A;  1SVL A;  4RGX A;  4Y7N J;  3HHG A;  2M8E A;  1VQP I;  2DFH A;  1X4P A;  4E7H A;  3L1P A;  3D1N I;  1JUM A;  4A69 C;  4N0B A;  3VSL A;  1FOW A;  5EEH A;  2XF6 A;  3OY9 A;  3JRF A;  5LD2 C;  4A93 J;  3KIO A;  3WU2 C;  2Z2S B;  2G3B A;  2ACJ A;  3KKD A;  1XG1 A;  1FP1 D;  2W84 A;  3G1O A;  3KE2 A;  5HVQ C;  3A01 A;  2A69 F;  3M8J A;  1R22 A;  4Y13 A;  2I10 A;  3E6M A;  4IQ4 A;  2R7W A;  1MGT A;  3FXQ A;  3M1E A;  3WGH A;  4XR6 A;  3MZH A;  3I53 A;  2GFN A;  2G7U A;  2REK A;  4NQW B;  3OS2 A;  5BNG A;  3LAJ A;  2LTP A;  4G8X A;  1BOB A;  1MMS A;  2M45 A;  3VOE A;  2AQE A;  3EYY A;  3OYG A;  3HZJ A;  3HOY J;  4XSX F;  2DFF A;  1NG7 A;  3I55 I;  2O6G E;  5EGO A;  2OAZ A;  1MMA A;  2O0Y A;  3ERE D;  3EUH A;  2D1V A;  5JHF A;  3R60 A;  3G7R A;  2PMZ A;  4JOM A;  1SC7 A;  4M74 A;  5FRN A;  5M3M J;  3HOX J;  2GUH A;  2Y31 A;  1BJA A;  1HST A;  2BY0 A;  2DMU A;  4UB6 C;  3E5X A;  3LAP A;  3A0B C;  3HHH A;  1Z67 A;  2YX4 A;  4ESB A;  4L0Z B;  3TP3 A;  1ZR4 A;  1DPR A;  5E18 F;  2R7Z J;  1HKT A;  1YW7 A;  2AS5 F;  1BA5 A;  3HXL A;  4PZJ A;  2IT0 A;  3W2A A;  2G9W A;  4ZZD A;  3V42 A;  3ZXS A;  2F5D A;  4B3X A;  3K4B A;  1QO0 D;  4IHS A;  4HZF A;  2K4B A;  4BHC A;  1S9H A;  1Y0N A;  3QYF A;  4WIB A;  2IBD A;  3DEE A;  2HQR A;  4E7L A;  3HRU A;  2DPU A;  2MC3 A;  2VJJ A;  1YRN B;  1BW6 A;  2HYJ A;  4LK0 F;  2UXP A;  1XX5 A;  1X2M A;  1ZEL A;  4ANJ A;  4S04 A;  3S93 A;  1TWG J;  2ELK A;  3E6D A;  3PUB A;  3KET A;  1F43 A;  2ZOY A;  2PMH A;  2VB6 A;  3KZI C;  5CQG A;  5EJC A;  1IUY A;  2GZW A;  3ZN0 A;  5GPA A;  2W00 A;  2Z5U A;  5EG0 B;  1JUP A;  5AIQ A;  3CCM I;  3TDU C;  2FRH A;  4IO9 F;  4L18 B;  3HKZ A;  1DPU A;  2WB1 N;  3SFZ A;  1X58 A;  4HV5 A;  5L3D A;  1ETX A;  1BR2 A;  2A68 F;  2Z3Y A;  3TBI A;  2EV6 A;  2VT2 A;  2CYY A;  3KNW A;  1QZZ A;  4BKX A;  2Y30 A;  4M73 A;  2E2J J;  5E17 F;  3RKW A;  2LLK A;  3HPG A;  4HAM A;  4E7J A;  2J5P A;  4HX4 A;  5EEG A;  4ZYA A;  3GFI A;  1Y0U A;  3CMM A;  2JA6 J;  1P92 A;  2W25 A;  3HC7 A;  5K5Q A;  2ECB A; 
#chains in the Genus database with same CATH homology
 2OF7 A;  4DYQ A;  3S2H J;  3T6N A;  3A02 A;  4JL3 A;  2HQ5 A;  5EF6 A;  1NK2 P;  4JP0 A;  3S1R J;  5M5W J;  3RZD J;  3SFI A;  1RR7 A;  5J3L A;  3HTI A;  1QVU A;  4ACI A;  2K9N A;  3HIM A;  3I4M J;  3GEU A;  2HKU A;  1RPW A;  2LKX A;  3ANG A;  2L7Z A;  3K7A J;  4B1R A;  4M3E A;  3BR0 A;  3FRQ A;  3HOZ J;  3BHQ A;  3G56 A;  1A5J A;  2K40 A;  2PBX A;  3IUV A;  1TWA J;  5F0C A;  3NI7 A;  3MN2 A;  4X1E A;  1WI3 A;  3VW2 A;  4L62 A;  3E7L A;  5FLV A;  1IRZ A;  2UXU A;  3HBL A;  4A3C J;  2VI6 A;  3OSF A;  4B4C A;  4JKZ A;  1LE8 B;  2EQR A;  4NEL A;  5M3F J;  1P7J A;  2CUE A;  4LOC A;  2DA2 A;  5JLX A;  4QIW N;  2CU7 A;  3HEF A;  1K83 J;  1IDY A;  2OER A;  5C4J J;  5CW8 A;  2O7O A;  1JKO C;  2LD5 A;  1OCT C;  1T56 A;  1TWF J;  4MFD A;  1I3Q J;  4PXI A;  2AHQ A;  1SFO J;  4XRM A;  1RKW A;  3HM5 A;  1IGN A;  4I6Z A;  3VVY A;  2NS8 A;  1MBE A;  3WHC A;  4HNV A;  2HDD A;  2EZI A;  2NVY J;  3Q3S A;  1DU0 A;  1F36 A;  2E1O A;  2L0K A;  4CYC B;  1JTY A;  5FKL A;  3HTJ A;  2B63 J;  2XPV A;  1ENH A;  1PUF A;  2D5V A;  3GTG J;  4FE7 A;  3S5R A;  1I50 J;  1FIA A;  5FHP A;  3BTJ A;  3IH3 A;  4C3H J;  2R0Q C;  2NP3 A;  3F1B A;  1GUU A;  4W1U A;  1JT6 A;  2VKV A;  1HOM A;  4MFE A;  2COB A;  4V2F A;  2LY9 A;  5IYC J;  3V6G A;  5DS9 A;  4A3L J;  3FKI J;  3RQI A;  3GTQ J;  5F0F A;  1Y1V J;  5C44 J;  1UI5 A;  3KKC A;  4DZJ A;  3NAU A;  3GTJ J;  1D5Y A;  1FEX A;  3AQS A;  4JNN A;  3HOU J;  3VW1 A;  3VPR A;  2G7G A;  4ICH A;  1LFB A;  2VPR A;  2G7S A;  2Y2Z A;  2NX4 A;  1ETV A;  5FKK A;  4BXX J;  2H8R A;  3COL A;  3Q0W A;  4DYC A;  4GCK A;  3LSR A;  2O7T A;  2DA6 A;  1S7E A;  1JKR C;  1UG2 A;  2M0C A;  3ZQH A;  2R5Z B;  1ZR2 A;  3EUP A;  2IAI A;  4AYB N;  3LWJ A;  3JSJ A;  4HKU A;  3CMY A;  1Q1V A;  3BTL A;  2R5Y B;  5J1Y A;  1APL C;  4FIS A;  1GT0 C;  5F04 A;  4CGR A;  1VFC A;  1EF4 A;  1X2N A;  3GZI A;  2CQQ A;  1WCM J;  2L9R A;  3MVP A;  3OOU A;  3BR1 A;  2N8G A;  3GTL J;  1MBF A;  3JRB A;  3LSP A;  2UXH A;  2R92 J;  3BR2 A;  4MIM A;  2LFB A;  4YZE A;  4M3F A;  4AC0 A;  5FMP A;  1AKH A;  1WGX A;  3WHB A;  2HXO A;  4G12 A;  5D1R A;  4W97 A;  2XSD C;  1MBJ A;  2HI3 A;  2HOA A;  3EGQ A;  2YS9 A;  3BR6 A;  4V2G A;  4C3J J;  5E3O A;  2H1K A;  2F07 A;  5HBU A;  3BR3 A;  1H88 C;  3IV5 A;  3HTA A;  4DYR A;  2M8G X;  2LR8 A;  1MSE C;  1RKT A;  2UXI A;  5EG0 A;  2FBQ A;  3JR9 A;  2YVE A;  3O8G A;  2ME6 A;  4IHW A;  3O60 A;  4RBO A;  3BNI A;  3CDL A;  1W0U A;  4EEF G;  4BBS J;  3CQZ J;  2RAS A;  1MBK A;  2E2I J;  4IHV A;  2MW8 A;  5FKO A;  2QWT A;  5EZH A;  2VUM J;  4AF5 A;  1Z0X A;  2P81 A;  5IP9 J;  2VKE A;  2ID3 A;  2TRT A;  3LOC A;  3JRI A;  4FE4 A;  1QVT A;  4A3M J;  1B8I B;  2M2E A;  2DA4 A;  1O4X A;  2W53 A;  3I4N J;  5CXG A;  1JKQ C;  2X9D A;  1JJ6 C;  3GBG A;  3GTP J;  2MG4 A;  5DTD A;  5K7Z A;  3BG9 A;  3SJM A;  4BBR J;  4GCL A;  3BG3 A;  2MSY A;  4A3K J;  3NAR A;  5EEA A;  1ETK A;  3FK6 A;  1HDP A;  5CXI A;  5EZG A;  1JUS A;  2L7F P;  2DA7 A;  3C2B A;  4FTH A;  3NPI A;  3S16 J;  3RKQ A;  2CJJ A;  4XRS A;  2TCT A;  3VW0 A;  4UUS B;  1I6H J;  1ETY A;  1HF0 A;  1U9O A;  2GM4 A;  4A3F J;  1FJL A;  2HOT A;  1VND A;  3ON2 A;  4XIC A;  1XS9 A;  4UDS A;  2QIB A;  2WAQ N;  5DAJ A;  1BW5 A;  2LP0 A;  2GBY A;  3GTM J;  2HOS A;  2ZCX A;  2UXO A;  2NP5 A;  2CUF A;  4A3I J;  2DJN A;  4M6V A;  3A01 B;  2E19 A;  4XK4 A;  2JMW A;  1LE8 A;  1IJW C;  3OSG A;  4M3G A;  2WUI A;  5HSZ A;  2CQX A;  4DW6 A;  1BL0 A;  3JRA A;  3S2D J;  1JT0 A;  2XPU A;  2ID6 A;  1MBH A;  3LNQ A;  5K58 A;  3V78 A;  3BCG A;  3VOK A;  2M34 A;  3F0C A;  1UI6 A;  4AUX A;  2DA3 A;  2DMN A;  2WGB A;  2JA8 J;  2O8K A;  5EGO B;  5K7F A;  2FD5 A;  3IH2 A;  1XC5 A;  3RZO J;  2Y9Y A;  2EZK A;  3QKX A;  3ZQF A;  4IEJ A;  2GEN A;  1ETQ A;  5IOY A;  1HCR A;  5HAW A;  2QF7 A;  1AHD P;  3K2A A;  1OFC X;  1BJZ A;  1OJL A;  5M5Y J;  3HKZ N;  4A3D J;  1ITY A;  3HB9 A;  4IHY A;  3QPL A;  5F08 A;  2NVQ J;  3NXC A;  2AO9 A;  3ANP A;  5AQC A;  2KT0 A;  1TWC J;  1TC3 C;  1QRY A;  4QSH A;  3TED A;  2ZB9 A;  3PPB A;  3VVX A;  2YUS A;  5IP6 A;  3GTK J;  1RET A;  4GFK A;  5GP9 A;  5FJ8 J;  3PAS A;  3JRC A;  1ZK8 A;  3BR5 A;  3QPS A;  3BQY A;  4XRS G;  4MLO A;  5F0H A;  3BQZ A;  1B72 B;  3ZOB A;  3IH4 A;  2ME0 A;  2MGQ A;  2L7M P;  4JX6 A;  2DG8 A;  3NRG A;  2LVS A;  1MBG A;  1A6I A;  4AC6 A;  5M5X J;  2XB5 A;  4BY7 J;  5E3N A;  4S0H B;  1NK3 P;  2ZOZ A;  1LFU P;  2M9H A;  2HYT A;  1K61 A;  1JKP C;  5C4Y A;  3RD3 A;  3G1M A;  3ZQG A;  2RHA A;  2R5Y A;  1YRN A;  1FTZ A;  5F27 A;  1IG7 A;  3FIW A;  3W6V A;  4M3D A;  1AKH B;  1MSF C;  1JJ8 C;  3ZQL A;  3HTH A;  3NNR A;  3JRG A;  5EFY A;  3JRH A;  1ZQ3 P;  3ON4 A;  2DMQ A;  3PO3 J;  4Y52 J;  4MO7 A;  5H9T A;  1HLV A;  3OIO A;  1MH4 A;  2EH3 A;  1TWH J;  5E3M A;  2K9Q A;  3LSG A;  4C2M J;  3BT9 A;  5FLM J;  3HOW J;  4J19 A;  1NTC A;  3SDG A;  1SAN A;  1GVD A;  2E2H J;  3S1M J;  2JJ7 A;  2WV1 A;  3H3V K;  2XGD A;  3CWR A;  5D19 A;  2X6O A;  2CRG A;  3HGG A;  5D18 A;  3AQT A;  4D5C A;  4JX4 A;  2DTZ A;  4B3A A;  2QTQ A;  3LSJ A;  1R9T J;  1AU7 A;  2PZ9 A;  3KZ9 A;  3S14 J;  1HDD C;  5F1J A;  5C3E J;  2XGC A;  3M4O J;  3BRU A;  4D7M A;  3QQA A;  5FKM A;  2D6Y A;  1VI0 A;  1Y1W J;  2IU5 A;  2NVT J;  3VIB A;  5E3L A;  4KWA A;  2FJ1 A;  4M3B A;  3S15 J;  2EBI A;  3FIS A;  3JRE A;  1WH5 A;  2IEK A;  1UHS A;  2XB0 X;  2DA5 A;  3VVZ A;  3B6C A;  2PMZ N;  1B8I A;  3CRJ A;  3VP5 A;  2XRL A;  3RH2 A;  1MH3 A;  3GTO J;  2JK3 A;  2W48 A;  4GFB A;  3QBM A;  4JYK A;  2HXI A;  5IYD J;  3C07 A;  2YU9 J;  3B81 A;  4FCY A;  3CJD A;  3DCF A;  2XPW A;  5FGL A;  1FIP A;  1IUF A;  5FKN A;  3PO2 J;  2NS7 A;  2JA7 J;  2QCO A;  3TP0 A;  2GLO A;  3LJL A;  4A3G J;  4XID A;  1H89 C;  3MKL A;  1IC8 A;  5C4X J;  2ZCM A;  3CCY A;  3P9T A;  9ANT A;  4Y7N J;  4RDU A;  1GDT A;  5IPA A;  4UUS A;  1ETW A;  3L1P A;  3HGY A;  3Q0U A;  3D1N I;  3TW7 A;  2DA1 A;  1JUM A;  4A69 C;  2RAE A;  5EYR A;  1U78 A;  5GPC A;  3JRF A;  1H8A C;  3VUQ A;  4DZP A;  2X48 A;  4A93 J;  2R93 J;  2G3B A;  3PM1 A;  3KKD A;  3FK7 A;  1XG1 A;  3G1O A;  2Y0S N;  3A01 A;  1PUF B;  2I10 A;  2G7L A;  2GFN A;  3ZQC A;  3HOV J;  2REK A;  1ZTR A;  5J1R A;  5BNG A;  4MXM A;  4ME9 A;  2LTP A;  4CYC A;  2QOP A;  5JLW A;  2KDZ A;  3M3Y J;  2FX0 A;  2DN0 A;  3HOY J;  2Y9Z A;  1WH7 A;  4BY1 J;  3JRD A;  5IOZ A;  2XGE A;  3O8H A;  5EDN A;  1ETO A;  1JTX A;  2DMT A;  5EGO A;  3HDD A;  4JX5 A;  2JN6 A;  3BG5 A;  2FQ4 A;  3G7R A;  5K7H A;  4A3B J;  4ABZ A;  2JA5 J;  2XDN A;  5IP7 J;  1POG A;  5M3M J;  4X6A J;  3HOX J;  2GUH A;  2Y31 A;  1MNM C;  2EZL A;  2DMU A;  1UMQ A;  3S1N J;  1G2H A;  4A3E J;  3TP3 A;  3Q0V A;  4QTR A;  3A03 A;  1ZR4 A;  2R7Z J;  4L5E A;  1W0T A;  2ECC A;  2V57 A;  1U8B A;  3B6A A;  1BA5 A;  1GV2 A;  5HOD A;  1IV6 A;  1GV5 A;  3DEW A;  2OI8 A;  5IYB J;  2R5Z A;  4UUT A;  3TW6 A;  3BTC A;  5J1U A;  1IDZ A;  1FTT A;  2DG7 A;  2EZH A;  1B72 A;  4MK6 A;  4GFL A;  1WPK A;  1SGM A;  2DMP A;  1T33 A;  2IBD A;  1CQT A;  1OCP A;  4NDL A;  4D7N A;  3BTI A;  1BW6 A;  1YRN B;  2HYJ A;  4C3I J;  3UKG A;  2UXP A;  2Q24 A;  3BJB A;  3MNL A;  3ZQI A;  1X2M A;  2JWT A;  4GCT A;  1TWG J;  2ELK A;  1F43 A;  1E3O C;  2ZCN A;  2YVH A;  2LK2 A;  2ZOY A;  1Z77 A;  1RES A;  2G0E A;  2OPT A;  1ZGW A;  5GPA A;  5EG0 B;  1QPI A;  1JUP A;  1ZKG A;  2NOG A;  2WB1 N;  1DU6 A;  1X58 A;  3VOX A;  3LHQ A;  1ETX A;  1ORK A;  3H0G J;  1VF9 A;  3KNW A;  4IHX A;  4BKX A;  2Y30 A;  2K9S A;  3S1Q J;  2E2J J;  2O9L A;  3DPJ A;  4D5F A;  3S17 J;  2LLK A;  1JGG A;  4NN1 A;  4I76 A;  2NVX J;  3HE0 A;  3G1L A;  2JA6 J;  1P7I A;  1U9N A;  4A3J J;  3E7Q A;  2QKO A;  2ECB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...