3WHCA

Crystal structure of a transcriptional regulator fadr from bacillus subtilis in complex with stearoyl-coa
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
190
structure length
190
Chain Sequence
KRPKYMQIIDAAVEVIAENGYHQSQVSKIAKQAGVADGTIYLYFKNKEDILISLFKEKMGQFIERMEEDIKEKATAKEKLALVISKHFSLLAGDHNLAIVTQLELRQSNLELRQKINEILKGYLNILDGILTEGIQSGEIKEGLDVRLARQMIFGTIDETVTTWVMNDQKYDLVALSNSVLELLVSGIHN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fatty acid metabolism regulator protein
publication title Structural characterization of a ligand-bound form of Bacillus subtilis FadR involved in the regulation of fatty acid degradation.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription
total genus 77
structure length 190
sequence length 190
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08359 TetR_C_4 YsiA-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3whcA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3whcA02
4W1UA 1FTTA 1MH4A 3S1NJ 3LSJA 3JRDA 2HYTA 1FIPA 3Q0VA 3Q3SA 1YRNA 1GUUA 3UKGA 3KKDA 4V2GA 3B81A 2G7GA 5J1YA 4AC6A 1OCPA 1ZK8A 2WAQN 5D18A 2D6YA 1X58A 3JR9A 4DZPA 5C4XJ 1JUPA 2FQ4A 2NVXJ 3QKXA 4BBRJ 5CW8A 1IV6A 3IH3A 3JRBA 1FEXA 2R7ZJ 3JRCA 1MBGA 3VVXA 3WHBA 2EZIA 3C2BA 4JX6A 5K7FA 4S0HB 5EGOB 2IU5A 3TEDA 5GP9A 1ETOA 3HOYJ 3RZOJ 1MNMC 4BY7J 4D5CA 1IUFA 1RETA 3HDDA 3S2DJ 1X2MA 1DU6A 1VF9A 2ZCXA 5K7ZA 4MFDA 2B63J 1MBJA 3GTKJ 3M3YJ 1MH3A 4G12A 4X1EA 1JT0A 2VPRA 4NELA 2WV1A 1DU0A 3DCFA 2NP5A 3RKQA 2NVYJ 1B72A 3CRJA 2K9QA 5JLWA 4JYKA 4FE4A 2UXOA 5HAWA 1SGMA 1POGA 2Y9YA 2RASA 3CWRA 1QVUA 2L9RA 4RDUA 4D7NA 2DA3A 2CRGA 4MO7A 4DW6A 1T33A 4QIWN 2EBIA 1MSFC 4AF5A 5EFYA 1AHDP 2H1KA 4MLOA 1SANA 3MN2A 3A02A 4M3EA 5DAJA 4ACIA 3RZDJ 5C4JJ 1W0UA 4I76A 1H88C 2R93J 1TWAJ 3JRIA 5HODA 2GLOA 1GT0C 1VI0A 4CYCB 2CQQA 2K9SA 1JTXA 4MIMA 3O8GA 5EYRA 2HDDA 1JKQC 1TC3C 2KT0A 2RAEA 3B6CA 4JKZA 3Q0WA 1XG1A 2V57A 1I3QJ 2CQXA 1ZR4A 5FKKA 3SFIA 3ANPA 3S5RA 3HTAA 2HOAA 3ON2A 4L62A 2XGDA 5IP9J 2LVSA 3ZOBA 3BTCA 1U9OA 5FGLA 3BCGA 3BTJA 1UI5A 4ME9A 1AU7A 5EZGA 4IHYA 3VOKA 2VI6A 5BNGA 3LJLA 1JJ8C 5EEAA 2E2JJ 4GCLA 3QQAA 5F27A 4XRSG 1A5JA 1WCMJ 4ABZA 3IV5A 2D5VA 3S14J 2G0EA 3AQTA 5FJ8J 1E3OC 1LE8A 1Z0XA 3KZ9A 2ME0A 2DMTA 2DA4A 2DA7A 2HYJA 2IAIA 2JN6A 1QPIA 3BT9A 3ON4A 3G7RA 3HE0A 5JLXA 2PBXA 2MG4A 5M5YJ 3RD3A 4XICA 4A3KJ 3BNIA 1W0TA 3AQSA 1MBEA 3JSJA 1OFCX 5FLMJ 4DYRA 9ANTA 3A03A 5C4YA 1H89C 4XRSA 1R9TJ 3G1LA 2L7FP 2QF7A 3DEWA 2NS8A 2KDZA 1ZKGA 2M0CA 2NVTJ 2O8KA 3GEUA 4GCKA 4A69C 2DA5A 2ZOZA 2OPTA 4XRMA 3GTJJ 1BJZA 4PXIA 3HTJA 4V2FA 4CYCA 2HOTA 2ME6A 1WPKA 2ID6A 3NI7A 3BG5A 3PPBA 3HKZN 1A6IA 1JUSA 5IYCJ 3LSRA 5GPAA 3GTMJ 2E19A 1LFBA 3CCYA 3K2AA 4X6AJ 3TP0A 2XPUA 4A3JJ 1U9NA 2NP3A 3MKLA 4J19A 3BR5A 5CXGA 3G1OA 3ZQIA 1MBFA 3NXCA 3ZQGA 3SDGA 3QPLA 3GTLJ 3O60A 1OJLA 2AO9A 4B3AA 2E2HJ 3VVYA 5FKMA 2Q24A 5DTDA 1ZTRA 5IP6A 2M9HA 4A3CJ 2W53A 1IRZA 2FJ1A 5C3EJ 3BR0A 5F0FA 2H8RA 1ETKA 1TWFJ 2MSYA 2X9DA 2GFNA 4CGRA 4ICHA 2VKVA 2NX4A 3KKCA 1XC5A 1IG7A 3S15J 1ETQA 3IUVA 4QTRA 1VFCA 2GM4A 2O9LA 4LOCA 5HSZA 3I4NJ 1T56A 1HDDC 2XRLA 3ZQFA 2DMUA 2XDNA 1P7IA 3FK6A 3BRUA 3IH4A 5EG0B 3GTOJ 5IOZA 2XGCA 4L5EA 2LD5A 3VIBA 5CXIA 2VUMJ 1LE8B 5E3LA 1ZQ3P 1IC8A 1MBKA 2L7MP 3VOXA 2G7SA 3HGGA 1GVDA 2PMZN 2L7ZA 1WGXA 4GFBA 1BW5A 1UMQA 5AQCA 3W6VA 3BTIA 2EZKA 3VPRA 2ELKA 2XPVA 1JUMA 2JA8J 1F43A 3O8HA 4DZJA 1QRYA 1NK2P 5F04A 5H9TA 2X6OA 4C2MJ 1UHSA 4BKXA 1JKRC 3FKIJ 4XK4A 1IGNA 1IJWC 1HOMA 3OSGA 4B1RA 5M5XJ 2R0QC 5J1UA 2XSDC 2GENA 1WI3A 1Y1VJ 3LWJA 3NPIA 4GFKA 3QBMA 1D5YA 2G7LA 3NAUA 5FMPA 2ID3A 3ZQCA 1APLC 2M2EA 1P7JA 2HI3A 3OIOA 5E3NA 2RHAA 3I4MJ 3CQZJ 2XPWA 1NTCA 3WHCA 3BG3A 1PUFB 4AC0A 2HQ5A 3BJBA 2DG8A 2UXIA 1ETYA 3G56A 2Y31A 5EZHA 1RESA 2O7TA 2GBYA 2NS7A 4IHWA 3NNRA 4QSHA 3PO3J 3JRHA 4I6ZA 2WGBA 2DTZA 5EG0A 1Z77A 2REKA 2TRTA 1ENHA 5IYBJ 3S1QJ 1EF4A 3HOZJ 2Y0SN 1RPWA 3F1BA 3ZQHA 1S7EA 3HOUJ 4JNNA 3CMYA 5FKOA 4DYCA 3D1NI 3HB9A 4Y7NJ 1B8IB 3GBGA 2LP0A 2UXHA 2O7OA 3K7AJ 1X2NA 2F07A 5F0CA 5IPAA 2IBDA 2QOPA 1BA5A 1GV2A 3H0GJ 2EQRA 2DMPA 2R92J 3MNLA 4NDLA 1QVTA 2LR8A 4GFLA 3BR2A 1OCTC 3BQYA 3LOCA 4IHVA 4AUXA 3EUPA 1GV5A 4GCTA 5EF6A 2X48A 4Y52J 2JK3A 3VP5A 2R5ZB 4A3FJ 3HM5A 4IHXA 1Y1WJ 4W97A 3HIMA 1F36A 2WB1N 4IEJA 1MBHA 1G2HA 5IOYA 5DS9A 2YU9J 3DPJA 2QTQA 1PUFA 3TW6A 1AKHB 4JL3A 1K83J 2N8GA 2FD5A 2COBA 5K58A 2FX0A 4M3BA 3LHQA 4JX5A 4FISA 2E2IJ 3COLA 2CUEA 5FLVA 3S2HJ 2OERA 1TWCJ 3GZIA 5C44J 1GDTA 3M4OJ 2LY9A 4BXXJ 2R5YA 2LTPA 3HOXJ 2JA5J 3RH2A 2K40A 3HBLA 3BG9A 3PO2J 1ORKA 3TW7A 1B8IA 3TP3A 4NN1A 3FRQA 1H8AC 3ZQLA 1TWHJ 4A3LJ 1ZGWA 5M5WJ 3FK7A 2Y30A 2Y2ZA 3OSFA 4MFEA 3JREA 2M34A 4A3IJ 2YVEA 3ANGA 3JRFA 1K61A 4M3GA 2QIBA 3S1MJ 4C3JJ 4UUSB 5FKLA 4D5FA 3FIWA 4M3DA 2DN0A 2MGQA 4YZEA 2EZLA 4M3FA 5FKNA 3QPSA 1MSEC 1Q1VA 4MXMA 2DG7A 2JWTA 3LNQA 1HF0A 2R5ZA 2YUSA 4A3GJ 3OOUA 4JP0A 1HLVA 1HCRA 1FIAA 2ECCA 2M8GX 2NOGA 3B6AA 2IEKA 1JJ6C 1AKHA 2UXPA 3P9TA 1I6HJ 1WH7A 4AYBN 2JA6J 3E7LA 1IDZA 3FISA 3G1MA 2HOSA 4B4CA 4MK6A 2LFBA 3L1PA 3A01B 1U8BA 1JGGA 1UG2A 3KNWA 2EH3A 1BW6A 3LSGA 1CQTA 3HOWJ 4A3DJ 2DMNA 5GPCA 5FHPA 4C3HJ 3CJDA 4UUTA 4D7MA 3GTPJ 1RKWA 4FCYA 1FJLA 5HBUA 1ETVA 3GTGJ 3S16J 3Q0UA 2LKXA 2QCOA 2DA6A 2E1OA 2L0KA 2I10A 1LFUP 3PASA 1JT6A 5F08A 2LLKA 3GTQJ 3S17J 5IP7J 3BHQA 3NARA 2ZCNA 1ETXA 2JJ7A 4BY1J 2WUIA 3C07A 1WH5A 5D1RA 1I50J 3BR6A 3JRGA 3BR3A 2VKEA 1VNDA 1XS9A 2FBQA 4UUSA 1ITYA 1RKTA 1TWGJ 2R5YB 2YS9A 3EGQA 5EDNA 3H3VK 2CU7A 2W48A 3HOVJ 2DMQA 3VW2A 5EGOA 3HGYA 3SJMA 3VUQA 5F1JA 4A3BJ 2DA1A 2HXOA 4XIDA 2DA2A 4FE7A 5E3MA 1YRNB 4BBSJ 2Y9ZA 2ZCMA 2XB0X 3E7QA 3BTLA 1HDPA 1IDYA 1JKOC 2GUHA 4C3IJ 2OI8A 1RR7A 1O4XA 1U78A 1UI6A 2ZB9A 5F0HA 3A01A 2CUFA 2G3BA 3IH2A 4HKUA 2TCTA 2QWTA 5D19A 3VW0A 3F0CA 1JTYA 2P81A 1ETWA 5J1RA 2K9NA 2HXIA 4DYQA 3NRGA 2DJNA 2XGEA 3V78A 2OF7A 2QKOA 3BQZA 5K7HA 4RBOA 3PM1A 4HNVA 4A3MJ 5M3MJ 4JX4A 2ECBA 2HKUA 2LK2A 1JKPC 4UDSA 3JRAA 3HTHA 3HEFA 4A93J 3HTIA 1NK3P 3VW1A 2YVHA 4FTHA 2JMWA 3LSPA 5J3LA 2XB5A 3CDLA 1BL0A 4EEFG 4A3EJ 3S1RJ 3VVZA 1B72B 2ZOYA 5M3FJ 2UXUA 1FTZA 4M6VA 3BR1A 2CJJA 1SFOJ 4KWAA 2NVQJ 2JA7J 3T6NA 2MW8A 5IYDJ 2PZ9A 3V6GA 2AHQA 5E3OA 1ZR2A 2EZHA 3RQIA 3MVPA
chains in the Genus database with same CATH superfamily
3IC7A 2KDOA 3QOPA 1U5TA 3FXLA 1OCCH 2HYTA 1U3EM 3Q3SA 2IGMA 1YRNA 3BJOA 4EQQA 1GUUA 3UKGA 2BVLA 2HQNA 2M3AA 4V2GA 5LD2C 3J7AY 2JRMA 3B81A 3DBLB 1W5TA 4OOIA 4P5OA 2WAQN 3K10A 5D18A 2OA4A 2CGPA 3JR9A 1TT5B 2OJED 2FQ4A 2VLAA 1D0YA 1OR7A 2NVXJ 1XGOA 5CW8A 3KEYA 1QZEA 1IV6A 3AG3H 5L3EA 4HOBA 1FEXA 2LY2A 4FASD 3HTUA 1Y56A 4IZZA 2F5EA 2EZIA 3R61A 3ROUA 2BOLA 1D8KA 2KJCA 2PMZA 5GP9A 3RZOJ 1MNMC 3EUKL 4BY7J 1H9GA 4RM2A 2DK8A 4G94A 3HDDA 3SHFA 3CMAI 2ZCXA 1FNNA 2QSFX 4XRFA 2VKDA 4MFDA 2DOAA 2OZ6A 3GTKJ 2L4AA 3WE3A 3M3YJ 3NRVA 1T08B 4X1EA 1YJ9I 2ZJPF 2MC4A 4H4KC 2VPRA 4PUSA 4FX0A 2PMUA 2WV1A 2P7CB 3DCFA 5JVGF 1ZAOA 3W6KB 1S29A 1CGPA 4BE0A 4FE4A 5IY5H 2R3SA 1YIJI 1Y39A 2RASA 3DTEA 2JPCA 2EFWA 3GUDA 2UV1A 1XCBA 2E60A 3DV8A 4KN7X 4EJUA 4D7NA 4MO7A 4QIWN 4UUVA 4AF5A 3C1DA 5HLGA 1AHDP 4M3EA 5GTIC 1O3SA 3RZDJ 1L0OC 4ZYDA 3CCLI 4IQJA 2R93J 1UB9A 2IA2A 3A2KA 3TOBA 2VBZA 1YO5C 4MIMA 1JTXA 4PFPA 2D1VA 3OYEA 2HDDA 1JKQC 1TC3C 3V42A 4G7OF 5E18F 1XG1A 2R7FA 4IVNA 2V57A 1ZR4A 3S5RA 1YW9A 3SFIA 5ERIA 1LEBA 4MGRA 2BEOA 3ZOBA 3PNYA 1MGTA 3GX4X 5FGLA 3BCGA 3C7JA 2Z16A 5BNGA 3F6VA 1NH3A 2G7HA 1YJNI 2PJPA 4GCLA 5F27A 3U9GA 4IXAA 3CCQI 2XSJC 1Z67A 4ABZA 2D5VA 3T1BA 3AQTA 3WTVC 1E3OC 2IS4A 3RTRA 1LE8A 3C2GA 1ERDA 3HZJA 1ZELA 4L18B 2ME0A 1P4XA 2DMTA 2RQPA 5LFAA 4FETA 2VJ4A 2VQLA 1X1CA 3HRSA 5IT3A 2PBXA 2Y69H 1E2XA 5M5YJ 3ERED 4XICA 4HQEA 1MBEA 4KN4X 3A03A 3H1CA 3PQKA 3GFIA 5JHFA 4XRSA 5H6QA 4D0PA 4HLYA 2L7FP 3CC4I 2NS8A 1FBSA 1KU9A 2M0CA 3HOSA 2H27A 4Y15A 3TBIA 3EUHA 1T38A 3LSKA 5L3DA 2HS5A 4XRMA 1MKMA 5LHIA 4Y33A 1VQOI 5K5RA 5HDKA 2ME6A 1WPKA 2ID6A 1SAUA 2BHZA 1A6IA 1XMAA 2M1BA 5IYCJ 3LSRA 2WAFA 1LFBA 3CCYA 4JOMA 2CUJA 4UNOA 2J5OA 1PDNC 2GQQA 2KP6A 2W25A 4I02A 2ZMEC 4NHJA 1ZRFA 3CUQB 3MKLA 3CJTB 4J19A 1F9NA 2VQGA 5CXGA 3G1OA 3KETA 3NXCA 1LDKB 2ZCWA 5ICGA 2E2HJ 4B3AA 1GXPA 3VVYA 2ADUA 2Q24A 4KYWA 2L9SA 2M9HA 2YSRA 1J5YA 2WAQA 3O2PE 2P4WA 5DYMA 5C3EJ 3BR0A 4E6KG 2UWMA 5E1ZB 1Z05A 2MSYA 2X9DA 4NBQA 2GFNA 4WIBA 2ZO4A 4ICHA 4CGRA 2G7UA 2EIKH 3DPUA 2EFQA 1FX7A 3EYIA 1MIJA 3DPTA 5GAHJ 2HPMA 4ZDLA 2GXGA 1VQ4I 1VFCA 5GADJ 2ZXIA 2CQNA 3H5NA 1DP7P 3CTAA 2QQAA 4XLEA 3ZQFA 3D5RC 3GCMA 5A2QZ 2IGKA 5FLXZ 4R8HA 1QHGA 1ZLJA 4AYBA 2QEXI 2L9NA 2XGCA 4L5EA 3VIBA 4XKBA 2B7EA 2VUMJ 1YYVA 4HSRA 1SFUA 5E3LA 2BY1A 3PUBA 4CSWA 3OYBA 4HF1A 3JTGA 3CC7I 1WGXA 2XAJA 2D1HA 1UMQA 3GLXA 1T0FC 3VPRA 3CO7C 3U1DA 3IKTA 3OS0A 3L7WA 3OMYA 4BS9A 2DK5A 2KZGA 5F04A 5H9TA 1ZRCA 2XAQA 2AS5F 2ZJ2A 3ZP5A 3WODF 1G59A 3FKIJ 1IGNA 2VQHA 1IJWC 5KNLA 4B1RA 2GA1A 5M5XJ 3BCAA 2XSDC 2QYOA 4GFKA 2BYVE 5L3FA 1K79A 3F8FA 2ID3A 1REPC 3ZQCA 4YFNF 2Z5UA 3J7YJ 1FBQA 2MLGA 2HI3A 2V26A 5KHDA 1IRGA 2VXZA 1J9IA 2HQAA 3SYTA 5J47A 3GFMA 1PUFB 3BJBA 3P9CA 2OQGA 3CDIA 1K6OA 1LDJA 2BY0A 2NS7A 5KVRA 3ZRGA 3PO3J 1G6NA 2O61A 2LYCA 3JRHA 2WGBA 5EG0A 3D5SC 4LGWA 1Z77A 2V1UA 4G6TB 4IPAA 3UNGC 1ENHA 2Y0SN 2QENA 3C2HA 2E71A 5ED4A 1UHMA 3E6DA 4HX4A 4LIVA 4EJTA 1KYZA 4Y7NJ 4WXHA 4GGGA 3GBGA 3MKYB 1B8IB 2UXHA 3OYNA 1XPXA 2O7OA 1X2NA 2A5WA 2ZFWA 5F0CA 5IPAA 2IBDA 1ONVA 5E79C 3AG1H 4RB3C 4NC7A 4C9YA 3FHNA 1L3LA 2RC4A 1NHAA 3B73A 4LJZF 5CKTA 4XSXF 1F36A 2OZUA 4IEJA 1MBHA 1G2HA 1EV7A 2ZSIB 3DPJA 2QTQA 2JZYA 4R79A 3M07A 2VOOA 3WU2C 3AFHA 1K83J 2N8GA 2ELJA 2R7TA 3P7NA 1MJAA 1B4AA 3HJEA 2LOOA 1IV8A 1YLFA 1B9NA 3GFJA 3S3NA 1TWCJ 3GZIA 5L3BA 1DDNA 1Z21A 3CCVI 4HV6A 1JI8A 1R1VA 3HOXJ 2DQRA 5CJ9A 2K40A 3HBLA 3NWSA 1LEAA 3CCUI 3E3VA 3FRQA 3FWEA 4A3LJ 5M5WJ 1P4AA 2V9PA 2BE5F 3M7GA 2Y2ZA 4E70A 4CH7A 4UHTA 1LNWA 4A3IJ 4XN3A 1SD6A 1G8XA 4KITB 2UZKA 5FKLA 2MGQA 5CQEA 5BOXA 3QPSA 1R49A 1Q1VA 1TLHB 4O3MA 5ICEA 3SZPA 2K85A 3OOUA 2PFBA 1KYWA 3J7AO 5LGTA 1O3RA 2NOGA 1LKXA 5LRSA 1P4WA 4I99C 1K6YA 3R4KA 1FYKA 2JA6J 4CO8A 4B4CA 5DD4A 1JGGA 1UG2A 5FRNA 1F4KA 1P92A 2EH3A 3ASNH 3LSGA 3KZYA 2GXBA 2WA0A 2HFHA 5E20A 2DMNA 4C3HJ 3CJDA 2Y48A 2L01A 4UUTA 4A12A 3GTPJ 3I9V2 1ON1A 4FCYA 3ABTA 1BC7C 3GTGJ 1WZ2A 4HQMA 2E7XA 4B09A 3RKWA 5F08A 3ZMDA 2LLKA 4JBAA 1WJCA 2GA2A 3F3XA 3QWLA 2ZCNA 3OL4A 4HEA2 2XAUA 3WU1B 3BR6A 1WRJA 4I2OA 4QPQA 2RDPA 2VKEA 4U7DA 1XSXA 4U7BA 5FFZA 3OYCA 2FBQA 2EWNA 2X4HA 4PGGA 3BJ6A 2P7VB 1TWGJ 3T8RA 2Y0SA 3H3VK 4YFXF 2CU7A 3IWZA 3KPHA 3HOVJ 5EGOA 1U5TB 3DKYA 2A3SA 3VUQA 1ZG5A 4S04A 3SZGA 1H0MA 3NWTA 4A3BJ 2DA1A 4ENMA 4FE7A 2PJRA 1YRNB 2F4OB 2L4MA 4G6QA 4BJTA 3I56I 2XB0X 5BPDA 1FYLA 3BTLA 3QODA 1HDPA 4B44A 2FBHA 5CVJA 5ICFA 5AIQA 1RR7A 4XKWA 2FNAA 2CUFA 3ULQB 1XSDA 3VSLA 1WJ5A 5LBQA 2R7SA 2QWTA 2P81A 2K9NA 3FBIB 4KMFA 4G7HF 2ELHA 1VQ8I 4DYQA 4CCKA 3V78A 1OYWA 4XQFA 1V55H 3WTXC 1MMNA 2LK2A 3JRAA 3HEFA 3HTIA 1NK3P 4M6YA 1UCRA 1IN6A 1NG6A 2JMWA 3LSPA 4FTHA 4RAFA 5J3LA 1BR1A 3QAHA 2JT1A 5D5XB 3F22A 3O6BB 4U0VA 1Z7UA 1I6XA 5EJCA 3HXLA 3VVZA 3WTZA 2QVOA 3EQLF 4KWAA 3DPLC 4BQQA 2G9WA 2XIGA 3V6GA 1SD5A 2AHQA 2VBXA 4TV7A 3SEZA 4K2EA 4XKVA 1WVRA 3NEUA 2LREA 3S1NJ 3JRDA 2XKPA 2IS1A 1OCOH 2BVMA 4MQ9F 3K6GA 1I27A 1FIPA 1V5EA 2ZXJA 1R00A 1MDMA 2DODA 2X0LA 3KKDA 3BPVA 1TNSA 2CWEA 3I4PA 2G7GA 3OV8A 4AC6A 3NQOA 1ZK8A 3IAM2 1X58A 4A5MA 2DOEA 4LITA 4WF2A 3K4JA 3SQNA 1XGMA 3K4MA 3ZGKA 5D5UB 1OKRA 1RC9A 4BBRJ 1JHHA 3IH3A 2ZMEA 2DYSH 3JRCA 4CCOA 2JUGA 4M6XA 4JX6A 4HF0A 2UXNA 3TEDA 1KGSA 1IN7A 3HOYJ 2IW5A 2XC7A 3K1PA 3V4GA 4U87A 1FY7A 1RETA 3S2DJ 1X2MA 1DU6A 2A61A 3C18A 2YU3A 1XCVA 3UR3C 4P1WA 3MFKA 4G12A 1W36D 5GAGJ 1G3WA 1R22A 2M4GA 1DU0A 3LSHA 2PG4A 1B72A 2R7OA 3TGNA 2K9QA 1IAWA 3AL0B 1RUNA 1IF1A 2M0MA 5HAWA 2C6YA 2LKSA 4DNCA 3W2WA 2QUFA 2KPMA 2QKLB 1IXCA 5HDNA 1MSFC 1QGPA 1T33A 4LD5A 3REOA 3RIRA 3DEEA 2H1KA 1K7AA 4MLOA 3AAFA 3A02A 2OTLI 3IKVA 4HX7A 5DAJA 5C4JJ 1R4MB 2V1DA 4L5JA 1W0UA 3PUFA 4DIQA 4I76A 3OYLA 1H88C 4KFCA 1TWAJ 2F48A 3JRIA 5HODA 3O3KA 2GLOA 1GT0C 2CQQA 3V7RA 1TL8A 4UV9A 2DFIA 4UXNA 5EYRA 5B66C 3ABKH 2EK5A 3MZYA 1MJBA 3BZKA 3Q0WA 4PCQA 1KU7A 4U9LA 2IVMA 3HTAA 4ESBA 2BHYA 5IP9J 3MKWB 1UI5A 4ME9A 2WY8Q 3KLNA 1YW7A 4OAZA 2M45A 2VI6A 2M5WA 4CZZA 3LQQA 2HGCA 2OCEA 2GWRA 1QZYA 4WXCA 1R5GA 4Q48A 1IO2A 2KRFA 2XASA 1WCMJ 3HPHA 4AU7A 3IV5A 4ON0A 3HYIA 3ONQA 1V3FA 3E6BA 1MMSA 3RPUA 3KZ9A 1JHFA 2IAIA 2DA7A 1OCZH 2HYJA 1QPIA 3BT9A 5J4YA 1TQIA 4B3XA 2LMDA 1YFHA 3S2WA 2EILH 2MG4A 3HHHA 4ITVA 4A6DA 1U6GA 4R1HA 4A3KJ 1B6AA 3BNIA 2B3WA 1OFCX 2Y0MA 9ANTA 3CD6I 2M30A 2LBFB 3W2VA 3MKZA 2GOXB 1R9TJ 1X1DA 2DDAA 2QF7A 4KIGA 2MD0A 2M4KA 3CJNA 2O8KA 1SMYF 5JR3A 3I3LA 4A69C 2OPTA 2BGCA 1D5VA 1SFEA 4CYCA 2EJRA 2HOTA 5E8IA 5CQGA 3NI7A 3BG5A 2ICWG 2X6XA 3GTMJ 3CP8A 3GMEA 3R60A 2ESHA 5H6RA 2DT6A 3VYRB 4X6AJ 3PSIA 3TP0A 1XMXA 1YTYA 3HG9A 4BDZA 1Z3YA 2UXXA 2NP3A 1WQ2A 4XLAA 2DI3A 4RAZA 1EKEA 4NQWA 1J0RA 5D8KB 1VTNC 5JHUA 3WE2A 4MQVA 2X51A 3SDGA 4GCVA 1WJBA 4YIRX 5IP6A 1ZTRA 3H36A 5HS8A 5LEKA 3GW2A 2FJ1A 2QQBA 3I58A 3CESA 3JW4A 4FQGA 4I98B 2I8DA 2ZSHB 3S32A 4B47A 1TWFJ 3TO7A 1FSEA 1YI2I 2VKVA 2ZNZA 3DFGA 5KCMA 3OYHA 2NX4A 1IG7A 1XGNA 1T6SA 4OAYA 5F1RA 2OCCH 2O9LA 1BR4A 2HDWA 3VODA 4CCMA 5ICCA 5B5EC 3BWGA 3ABLH 3CUQC 2DT7B 2F5VA 2FOWA 3IH4A 3E5UA 5EG0B 3GEZA 1E3PA 5LGUA 5CXIA 2ACJA 4RGXA 1I39A 5FB2A 4Q4ZF 3PNVA 2L7MP 5DUIA 4ZTFA 2VC0A 3HRMA 1BW5A 2A6TA 5HS7A 3I55I 2XPVA 4L9JA 2JA8J 1F43A 3S3MA 3LA2A 3A0HC 1RI7A 1MW7A 2L9VA 1W36C 4C2MJ 1RZ4A 1UHSA 1QQIA 4PDKA 4XKCA 3S93A 1JKRC 4V19K 4HA8A 1DQUA 2K3PA 2W24A 2F5DA 4ZZDA 3OSGA 1VQNI 2R0QC 2HTSA 2GENA 1WI3A 1Y1VJ 1HXDA 4ESFA 3NPIA 1A36A 1BR2A 1R5ID 3QBMA 3NAUA 2RKHA 3QU6A 4HLXA 4BQNA 1VQPI 2OV7A 1P7JA 3OYDA 4I01A 4KA4A 3RPUD 3WHCA 4U88A 3K70C 1W7PA 2K3FA 2XVCA 1ETYA 3QPTA 4O5VA 5E17F 1X4OA 1WJAA 2H6BA 1RESA 2VC1A 3KLOA 3CMMA 1ACIA 2GBYA 2J5PA 1ON2A 1MJ9A 2CFXA 3M1EA 4ENNA 5J40A 1HSJA 5D4RA 2KISA 4XOPA 4XLCA 4KUMA 1YITI 3ECHA 5IYBJ 1EF4A 3LL7A 4U0YA 4E7KA 3HOUJ 1S7EA 1K4SA 5FKOA 4KIBA 3D1NI 2ZXHA 3HB9A 4QPOA 2Q8KA 1E17A 1X19A 2LP0A 3KP3A 2E1MB 2E35A 2F2EA 2VN2A 3J81K 2F07A 3MCZA 3RKYA 3ZMVA 1DGWY 1X1AA 5DCMA 1GV2A 2R92J 3FHZA 3MNLA 4NDLA 2LR8A 4GFLA 3BOQA 3BR2A 5HNFA 4NC8A 3DTIA 3LOCA 3PQJA 1FOYA 3GXOA 5LHHA 4E7HA 1GV5A 4XMYA 1FOWA 3QRFF 1K78B 2WAEA 1WI9A 2LRDA 1KONA 4P9FA 2X48A 2JK3A 1UG0A 2OBPA 2BXZA 4A3FJ 4E7IA 2WB1N 3FXKA 4U0WA 2ETHA 5IOYA 3TW6A 1TQPA 3KCCA 2KHMA 2VBYA 1Y0UA 4CA0A 3I5UA 2FD5A 2FBKA 4YG2F 4XLPF 3J7ZI 3LHQA 2IS2A 3V7SA 2ZJQF 3COLA 2CUEA 5FLVA 4GYIA 3S2HJ 2VONA 3HPGA 4QWQA 3OYFA 3F8CA 4GDFA 1GDTA 2DO7A 3D0SA 1W5SA 4PJNA 4BXXJ 2OTJI 3T8TA 1OQYA 2LTPA 1XGSA 2JA5J 1YIOA 3BG9A 3PO2J 2STTA 3ESWB 2CH0A 1Z6RA 3H5AA 4NN1A 4AWXB 3ZQLA 1TWHJ 3S8PA 1ULYA 2Y30A 1AOYA 4XSZF 5FRMA 3ERMA 2P8TA 3N4MA 2YVEA 3ANGA 3JRFA 1IN5A 4A5NA 2PLYA 2QIBA 3FXMA 3S1MJ 3FM3A 1R4NB 1X1BA 3OR1C 4D5FA 4YZEA 4M3DA 4MEYF 2CW0F 2EZLA 4M3FA 5FKNA 3K4KA 2P0WA 3BZ6A 2JWTA 1HF0A 4OIPF 2R5ZA 2YUSA 5CYVA 1HCRA 4IL6C 2HYGD 2ECCA 2M8GX 2MD5A 2R7RA 2PJRB 3G6EI 5E1XA 2FBIA 3TDZC 2DPUA 3KE2A 3WTUC 1AKHA 2XAGA 1I6HJ 3G1MA 1VQ6I 2E34A 5JFRA 2PFVA 1NG7A 1FOXA 4P9UA 1U8BA 2FA5A 3BG7A 3M8JA 4OMZA 3HOWJ 1MD0A 2XROA 1FJLA 3L2VA 5HBUA 2L7KA 3H9JA 1FPQA 3FBNB 4RAGA 3S16J 2B1EA 3Q0UA 4D1QA 2JUCA 3I71A 1JT6A 2KIUA 3VYTB 3S17J 4HV5A 5CVUA 1GLNA 3TOAA 2R7DA 3CJQB 4PJLA 4RLQA 3C07A 1JE8A 4LK1F 3OS1A 5D1RA 2PEXA 3BR3A 1USTA 2L5QA 4Y4RA 4ENKA 1X4PA 3GWZA 3MZHA 4UUSA 2VT3A 1ITYA 4HZFA 1ZYRF 2Y75A 4BE1A 2R5YB 2YS9A 3EGQA 2DYRH 2W48A 4XLFA 2DMQA 5D5VB 2F4IA 1OCRH 3SJMA 2FF4A 5F1JA 4GXOA 2HXOA 2IP2A 2H8WA 2ZCMA 1QZZA 2EFPA 2FOKA 2W4SA 1TW2A 1MDMB 4E7LA 3OL3A 2KIMA 4CHUA 1JGSA 4I09A 1IDYA 3L00A 1JKOC 4Q5SF 2XKOA 3ABMH 1RNLA 2FQ3A 2L54A 3DU6A 2ZB9A 5F0HA 1BIAA 5HDGA 3A01A 1W5CC 4IF4A 2A6HF 3IH2A 4HG2A 2JSPA 4HKUA 1LJ9A 1S6LA 3DQVC 5D19A 3VW0A 3F0CA 1ETWA 3HHGA 2R7WA 1XDSA 1Z6TA 5L3CA 2XAHA 1BM9A 3H9GA 4IJAA 1E3HA 2WB1A 3BQZA 2QA4I 4DBRA 1KU3A 3VSKA 5K7HA 1O3QA 4RBOA 2WBMA 4JX4A 1WSUA 2ECBA 4HW0A 2HKUA 5B1BH 1JKPC 2A07F 2VXDA 1U5TC 4UDSA 2R7VA 4J00A 1FMVA 4YEJA 2OC6A 3OR2C 4RM3A 1BL0A 3CJRB 5ILUA 1B72B 1BOBA 1HSTA 2BY3A 1BC8C 3GF2A 4LLGF 3T0YA 3FXUA 4S05A 3CLOA 4AIJA 3DTKA 1OR7C 2CO5A 1ZR2A 1VQLI 3RQIA 2QLZA 3F23A 1PYVA 4Y3OA 1IUYA 1DUXC 3KFWX 5HLHA 1MH4A 2EB7A 3LSJA 2Z2SB 2E5NA 3FMSA 3FXQA 4XNFA 2OAZA 3Q0VA 2JPBA 3MD2A 1V54H 5J1YA 5TGTA 1HKTA 2KRCA 3OY9A 1I1SA 2RGVA 3EYYA 2FU4A 4RGUA 3VTIA 3TDUC 2AQEA 4PGHA 4LLNA 3WHBA 3C2BA 5K7FA 4YRVA 2EA4A 4HRIA 3P5JA 3SZTA 2IU5A 5HLTA 5DV5A 2BBYA 1SFKA 3VEPA 1UAAA 3K4LA 1TTYA 2HOEA 4N9HA 1KQ9A 1WHUA 3AG2H 3DEUA 3LSTA 1IUFA 3IP4B 3KEOA 2CQ7A 5K7ZA 3OYJA 1MBJA 3J81Z 3FXJA 1MH3A 1JT0A 2F5FA 2CSOA 1A31A 1ODDA 3L2QA 2CV2A 2NP5A 3CRJA 4RMNA 1VQKI 2LSOA 5LEJA 4HF2A 1YOVB 3WG7H 2KZVA 2KKOA 3GZNB 3H3UA 1QVUA 2L9RA 3IL2A 2K7LA 1OMIA 2DA3A 1SVOA 4KT6A 2M8EA 5F6FA 1RIOH 3KP6A 5EFYA 2VJJA 3IRQA 1Z9CA 2K9MA 4CUGA 1FP2A 1W4MA 3RYPA 2CS3A 5ILVA 2MBFA 1VI0A 4CYCB 1YX3A 5DD8A 3MQ0A 3BZCA 3PFIA 1B59A 1R7JA 4DOZA 3RPQA 4JKZA 2LKPA 2CW7A 1I3QJ 2CQXA 3ANPA 1UFMA 4M73A 2HOAA 3RYRA 3ON2A 4L62A 3I53A 3AL0C 2FSWA 2NRAC 3M8EA 1YE9A 4NQWB 3E5QA 4IKFA 5FROA 4BHPA 2E7WA 5EZGA 1AU7A 2Z9OA 3VOKA 2IS6A 3LJLA 4F92B 1JJ8C 2HPIA 5EEAA 1RR8C 2VOPA 1BI1A 3M1CA 1QU3A 3R6SA 2MFZA 2XGXA 3LFUA 4J01A 3CO6C 2O3FA 4UVCA 1FOKA 1YX5A 3MAJA 2ZJRF 3EUHC 2DA4A 2JN6A 2CYYA 3L2CA 5DM7F 4UB6C 3G7RA 4BDYA 2O5RA 2H09A 1I3AA 1O7LA 1R58A 2HR3A 2K9LA 3OYMA 1W0TA 3AQSA 5C4YA 2R7UA 1Z91A 3KP4A 4A0YA 3Q9SA 3G1LA 1SD7A 3S3OA 4RB1A 2K4JA 3DEWA 3BG6A 3HSFA 2JSCA 3GO5A 3TL4X 1G3SA 4GCKA 4LB6B 4ANJA 1BJZA 1HW1A 1GXQA 2A05A 4O6JA 3W6JB 3ZQ7A 3OYGA 3GTJJ 1YJWI 4V2FA 5FGMA 4BHBA 5J8FA 4WWCA 2Z33A 5IT9K 1V4RA 4HNTA 3WTYC 3HKZN 1V5GA 2KIFA 2DU9A 5GPAA 2W7NA 2L2OA 2E19A 3CDHA 3V8JA 1N75A 2E1CA 2HQRA 2EIJH 2Z1DA 3DKWA 3A1YA 1UJ8A 1U9NA 4A3JJ 3NS4A 3FX3A 2YX7A 4ZYHA 2KL4A 4Y17A 3TMOA 1STZA 2DFFA 1MBFA 1QNTA 3O60A 2BV6A 2MABA 2AO9A 5TISC 5FKMA 3WGIA 5DTDA 4A3CJ 4CCJA 2CW8A 1U0JA 5F0FA 1ETKA 3EETA 1HBXG 2HZDA 2HKXA 4MHGA 4IQ4A 2M7AA 4B8XA 2Q2EA 2R4GA 1KQ8A 3AKZA 3KKCA 1ETQA 3IUVA 1H9TA 1W7PB 1P9QC 1T39A 2GM4A 2NVUB 2QKMB 3I4NJ 1T56A 4HPQA 1HDDC 2XRLA 1AA7A 2FJI1 2DMUA 1W1WE 4LK0F 1S3JA 4LB5A 1SC7A 3FXOA 2XDNA 1P7IA 2WWYA 3FK6A 5E8GA 1DPRA 2HNHA 2RN7A 2LD5A 2R7QA 1LE8B 1FMWA 2X85A 5TJJA 3VYUB 1YS6A 2LF8A 1IC8A 2MC3A 1MBKA 4XONA 2G7SA 2PMZN 2F4MB 2WTEA 1TP4A 2WC2A 2STWA 1QHHD 2ELKA 2QQ9A 2F5CA 2QSGX 1A35A 1QRYA 2HEOA 1MNDA 3WG9A 1X3ZB 3CC2I 2X6OA 3GFLA 5DCMB 4BKXA 2EA2A 2HVSA 2W82A 4XK4A 5DCFA 1TW3A 4GYGA 1QBJA 5J1UA 2XF6A 5B1AH 4LFUA 2JTVA 3G2BA 2L02A 2CG4A 3E97A 3IHUA 5F64A 1T0FA 2G7LA 1T95A 1KQ0A 3K69A 5FMPA 5CLSA 3OIOA 2RHAA 2XF5A 3CQZJ 3U21A 4IX7A 2OUMA 3DBRB 3TQNA 4B43A 1S9HA 4E7ZA 4MTEA 1QPMA 2HQ5A 4AC0A 1R1UA 2UXIA 3J80K 2Y31A 1WFXA 3VOEA 2YPRA 3ZMZA 2LNBA 4L9NA 4MTDA 2JA2A 4IHWA 3NNRA 4QSHA 2GOMA 3ZMTA 3L2RA 4I6ZA 3QYBA 3H0DA 4RGSA 4WXDA 1AWCA 1UHWA 1IZ1A 4QLCU 1XB4A 4BJ5C 3L2UA 4JNNA 4IHTA 3CMYA 2VB6A 1B1BA 4Q47A 3RJPA 3WTTC 1QA6A 3MMYB 2VE8A 1IXRC 5KAIC 4CDGA 4E4HA 2QOPA 1BA5A 1HW5A 2EQRA 3QYEA 2HZTA 1QVTA 1OCTC 1G3TA 3BQYA 3CCEI 4AUXA 3K0LA 3EUPA 3R0AA 4MEXF 4GCTA 1D3YA 3KIOA 1UELB 1ZGJA 5EF6A 2FUG2 3PIPF 4CXFA 3OS2A 2TDXA 4XLNF 4YFKF 4L0ZB 4A0XA 3HKZA 2R5ZB 4Y52J 1PP7U 3VP5A 3U2RA 3HM5A 1Y6IA 2FXAA 2AXTC 4OIRF 4W97A 1E0EA 3BLYA 1SD4A 1B9MA 1PVEA 3ZN0A 5DS9A 2YU9J 4I0BA 2ISZA 1HKSA 1U8RA 2H6CA 1AKHB 3L9FA 3TO6A 2W84A 2QQ8A 1YG2A 4BACA 5K58A 2E1MC 2FX0A 4JX5A 4FISA 1IRFA 2HU9A 4BL0B 2E2IJ 3G73A 2IA1A 4C2TA 5J8CA 4BYYA 3I59A 3M4OJ 4N4OB 5K5QA 4OD5A 4BQOA 2A68F 3FF5A 1Z7LA 2ZBKA 4G6DA 1GVJA 4OINF 4LG0A 5D4SA 2VIXA 3WU0A 3ZMUA 1ORKA 3TW7A 3TP3A 1ZGWA 3QU3A 4RA2A 2H94A 4I0AA 3FK7A 5H2FC 1ZH5A 2VQCA 3V8LA 3H5RA 3OSFA 4MFEA 4OD4A 4KISA 1S7AA 1K61A 4M3GA 3KYDB 3QP6A 4C3JJ 5JVTA 4UUSB 2COMA 3LFKA 3FIWA 2DN0A 3DLAA 3QPHA 2JRTA 3M9AA 1MSEC 2DG7A 2KLOA 3HSEA 1ZRDA 3P9IA 5E1WA 1SEUA 3SFZA 4PSWA 2Q1ZB 5BQTA 4BJ6C 1D0ZA 2XRNA 3F8NA 3B6AA 4M74A 2IEKA 4EMSA 2EFNA 4RGRA 5KK1A 3K8PC 2RVCA 1LUJB 1JJ6C 2UXPA 4OU0A 2OU2A 1WH7A 4AYBN 4PJJA 3E7LA 1IDZA 4AIHA 2GAUA 1VQMI 4OWRB 5HOOA 3A01B 1O3TA 1YS7A 2O8XA 4IOAF 4AIDA 3KNWA 1BW6A 4EGYA 1CQTA 4AM3A 4A3DJ 2M87A 5FHPA 4CICA 1QO0D 3FZVA 3HRUA 2IRFG 2R7XA 5IT9Z 4D7MA 1KZHA 3RKXA 1KA8A 3U1KA 4ZJZA 4KDPA 1EJ9A 4E7JA 4BU2A 1ETVA 2W00A 1R5HA 3DP7A 2JVGA 2QCOA 4DJAA 2E1OA 2L0KA 2VPLA 4PZJA 3PASA 4IRVA 2VJIA 4AD9A 3LQRA 4KMUX 3GTQJ 2YR2A 5IP7J 2V9VA 1HC8A 2Z99A 3OIQA 3NARA 4UV8A 4BY1J 2WUIA 1WH5A 3JRGA 1ZARA 3CLQA 5KAFC 4IOCF 4C2MA 2V1XA 4M9SA 2QWWA 1XS9A 2XUBA 2DW4A 2K02A 1RKTA 5AIPA 1MMGA 2EV0A 1P6RA 2PN6A 3OOPA 4HNUA 4BGDA 4CCLA 3PIOF 3VW2A 5J4VA 3HGYA 1G3YA 1CF7A 2B0LA 2LY1A 2DA2A 3K4CA 1XD7A 3SWHA 4BBSJ 4CZCA 1PP8F 4EVIA 3K1NA 2QBYA 2ZXWH 4HSTA 2GUHA 2OI8A 2EIMH 3E1SA 1J7KA 4ZZLA 3M8FA 1MMDA 3I0TA 2G3BA 1SFXA 2L3DA 3VFZA 2TCTA 3ML6A 4PJMA 1ZGAA 4LMYA 5J1RA 1D1AA 2V79A 4P55A 3TKYA 1OYIA 2HXIA 3NRGA 1FC3A 4UVAA 2OF7A 1VQ7I 3ZN1A 3JTHA 3ABUA 5M3MJ 3FXRA 2A69F 5D8LB 4A93J 1DP3A 3VW1A 4DBQA 3T5XA 1GHCA 2P6SA 2XB5A 3LMMA 2QGUA 1EA3A 3CDLA 2PI0A 1SVLA 3S1RJ 1DPUA 3N05A 1R71A 2ZOYA 2VJ5A 5AONA 1N25A 2CJJA 3BR1A 3BROA 2DAOA 1SFOJ 3H9QA 2NVQJ 3FMRA 2JA7J 2W85A 3HUGA 2ZC2A 5E3OA 4CGZA 3WTSC 4N0BA 3HIFA 2NNYA 2EZHA 4L5IA 3WGGA 3MVPA 4W1UA 2XHKA 4X0GA 1FTTA 2O6GE 4EM1A 4AIKA 4II2A 1MNEA 2RQQA 2XV4S 3J80Z 5EEHA 4KT5C 1OCPA 1BJAA 2D6YA 4ZYEA 1V5FA 4DZPA 5C4XJ 1JUPA 2DXIA 3BC8A 1C0WA 3QKXA 1MMAA 3FKJA 3V8KA 5K1YA 2VODA 4AVZA 4IHSA 1Y8QB 3JRBA 2R7ZJ 1MBGA 2ZKZA 3VVXA 2VL8A 3G3ZA 4S0HB 5EGOB 4C30A 4IO9F 1ETOA 4D5CA 2LG4A 2LBFA 4KJZA 5EEGA 4ENJA 1BIBA 2XF7A 1VF9A 3LWFA 3LA7A 2B63J 3KP2A 4BEHA 2X1DA 4ZYAA 3LSIA 3LAJA 2BW3A 1SAXA 4NELA 1W7PD 3HSRA 1BN5A 3RKQA 1IW7F 2NVYJ 3RQ4A 4L9TA 4BQAA 3ZQQA 1LDDA 5JLWA 4JYKA 4G8XA 4M72A 3SDBA 2BZTA 3DLLF 1N77A 1XDUA 4E7SA 2LC2A 1BI0A 2UXOA 2O03A 1SGMA 2AQFA 1USSA 2DPDA 1POGA 2Y9YA 5TRDA 1Y0NA 3PL8A 2IJLA 4A0ZA 1OYYA 3GZ6A 2HDCA 3CWRA 1XSVA 4RDUA 4ZH4F 2CRGA 2HKOA 3P9KA 4DW6A 2EBIA 5BS6A 3MZ8A 3OYKA 1ZG1A 3X2QH 2ZY9A 3DBHB 4G7ZF 1YHQI 1SANA 3MN2A 2O0YA 4ACIA 2B9SA 4LLLA 3QYFA 4ZDOA 3RI4A 4KIFA 1J59A 3LSMA 3MWMA 2K9SA 3O8GA 2HTJA 3F72A 4PSXA 2V1NA 4XR6A 3ZMSA 2KT0A 2RAEA 1TNTA 3B6CA 3RCOA 4A2UA 3PNTA 1Y8RB 5FKKA 2AXLA 3K4BA 2P5LC 2XGDA 2DFEA 3PSFA 1J09A 4NNJA 2LVSA 2ZNYA 3BTCA 3DKXA 1U9OA 3BJAA 3JAMK 2P5KA 3BTJA 1VZ0A 5D5WB 3G71I 4NC6A 4IHYA 2NYXA 1UZCA 1X3WB 3DWLE 2E2JJ 2FEZA 4ETSA 1Z3XA 5HVQC 3CCSI 3QQAA 1XN7A 4XRSG 3IRRA 1A5JA 4PK4A 2KJBA 3S14J 1LVAA 2G0EA 2MYSA 3SXYA 4HBLA 5FJ8J 1Z0XA 4I7HA 2MH9A 2CV0A 3E6CC 2K5CA 1G4DA 2DJIA 2Q2EB 3ON4A 2ZMEB 2M7BA 2V9KA 3HE0A 5JLXA 3C3WA 2IGNA 4F52A 3ZCOA 4F93B 1D8JA 4M9XA 5GTHC 3RD3A 4JK1X 1BI2A 2ZFUA 5DM6F 4BXUA 4UY8I 3JSJA 5FLMJ 3KZIC 4DYRA 1F5TA 1HA8A 1H89C 3PFYA 2EPFA 3A4CA 1S72I 3F8BA 3CP2A 2KDZA 2D2WA 2KMUA 1ZKGA 2NVTJ 1SMTA 2D45A 4RB2C 3GEUA 1FLIA 2V6EA 4N9IA 3Q9VA 2DA5A 2ZOZA 3E6MA 1M1EB 1FYMA 4LG3A 2V4JC 4PXIA 2X6YA 3HTJA 2VBWA 2P5VA 3K4NA 4XN0A 1D0XA 2PX9A 5ILSA 3PPBA 4EV0A 1JUSA 1ZHFA 3K2ZA 3DF8A 4U9NA 4C2UA 1WKMA 3KYCB 2XAFA 3K2AA 4XOTA 4HDVA 3IWFA 2XPUA 2P6TA 2CMPA 3QOEA 4F55A 3BR5A 1D1CA 4BAYA 5J6XA 4AVPA 3ZQIA 1I1GA 3ZQGA 4A6EA 3GZ5A 3QPLA 3GTLJ 1OJLA 4RAYA 6PAXA 4HAMA 4HYEA 2W53A 2YX4A 3CF5F 4ASNA 1IRZA 2HVRA 3VWBA 4F91B 2QM3A 5LGNA 2H8RA 2NXNB 3CCJI 5CVIA 1T8IA 2NNNA 2FRHA 1XC5A 3S15J 2WY7Q 1S8NA 2DT5A 4QTRA 1LQ1A 3CUOA 3E5XA 2H1LA 3EPZA 2GIVA 4LOCA 4KICA 3HRTA 5HSZA 5BPIA 1WJFA 2VE9A 2DTRA 1S7OA 1XX5A 1T98A 2KIQA 3IAS2 2GXAA 3BRUA 2FMLA 1WJDA 3VB2A 2BY2A 3H92A 3GTOJ 5IOZA 4PFOA 1ZG3A 1K78A 4L0YB 4P96A 1ZQ3P 2DFHA 3BCBA 2CFOA 3KYLA 3VOXA 3WGHA 3HGGA 5CVVA 1GVDA 2X1CA 2L7ZA 5AQCA 1R1TA 2KRHA 1PUEE 4GFBA 3W6VA 3BTIA 2EZKA 4RB0A 1JUMA 1WWXA 3O8HA 4DZJA 5LRRA 4XORA 4WCGA 1NK2P 5DEQA 3CUQA 2E36A 4II3A 1U2WA 2LH9A 3OYIA 2DCEA 4F3QA 1HOMA 5HNHA 5D6FA 1T2KA 4ZYGA 3LWJA 1OISA 1Q1HA 4IRGA 1YQAA 1RUOA 2EFOA 3V7CA 1D5YA 4CYDA 2EV5A 1APLC 1I5ZA 1O57A 2EINH 2M2EA 3G4SI 1HW2A 5E3NA 3ZPLA 5H20A 4OIQF 3K9TA 2XPWA 3RSNA 1NTCA 2Q0OA 3A0BC 1OPCA 1XTAA 3BG3A 4EJOA 3G56A 3KZZA 2DG8A 5EZHA 2V6CA 2O7TA 3W2AA 1BI3A 4M71A 5FD5A 1IXSB 4L9VA 3ASOH 3JCUC 2FNPA 3D5LA 3ISPA 2CQKA 2Z3YA 4WX9A 2DTZA 1HQCA 5FD6A 1R6RA 3I59B 2REKA 4Z2YA 2TRTA 5B3SH 3S1QJ 1FSHA 2K86A 3JSOA 3HOZJ 1RPWA 3F1BA 2W57A 3BY6A 3QP5A 3ZQHA 3DXJF 2MLKA 4ESJA 3FM5A 4LG0B 4DYCA 3KX2A 2VT2A 3CCRI 2E5ZA 4BUPA 3CZ6A 1YW8A 2FMYA 3K7AJ 1ZLKA 1VQ9I 2WADA 3H35A 1A04A 3H0GJ 2DMPA 3AG4H 2LF7A 2DOFA 4IHVA 4EM2A 2W1OA 4G9YA 2YVXA 1EH6A 3ECOA 1TBXA 2CV1A 1IRXA 1VQ5I 4B48A 2A5YB 3LA3A 4FT8A 3HTSB 4RLFA 1Y1WJ 1FWZA 5DDGA 4YELA 4IHXA 1JXSA 4XL9A 1LPQA 3HIMA 2BXYA 5JI6A 3R0JA 2JVHA 3EDPA 1PUFA 2X6WA 4JL3A 3DU5A 3EUAA 2COBA 2K27A 3K1MA 3CCMI 3IUOA 4M3BA 4BHCA 1J75A 5FO5A 3GYHX 5LHGA 1F1ZA 2LDUA 2VASA 5HLIA 2OERA 3TO9A 3ZXSA 1ZN2A 5C44J 3HC7A 5GAEJ 1ZREA 2LY9A 4ZTJA 2R5YA 1FZPB 3E0JB 3RH2A 3BP8A 4EJWA 1B8IA 4MNUA 1H8AC 3H3ZA 1X3UA 2JQ7A 3JSPA 5CPRB 3JAMZ 1BBYA 1SVMA 3JREA 2M34A 2EV6A 1P2FA 2HWVA 1FP1D 1R36A 5LLQA 4D9JA 2ISYA 3COAC 2QZ8A 1A6QA 2GZWA 3CMEI 4MXMA 4UB8C 1O7FA 3LNQA 4A3GJ 1TZLA 2F6CA 3KEQA 1R23A 3KP5A 4JP0A 5K5OA 1RRJA 1HLVA 1CF7B 1FIAA 2X1EA 4BE2A 5D6EA 4Y13A 4DVYP 2RV8A 2DBBA 4BH9A 4GRIA 2E1NA 5FFXA 2A2FX 4EGZA 3OYAA 2OQRA 2QBYB 3P9TA 2IGOA 3FISA 2HOSA 3RDIA 2IA0A 4OIOF 2DLLA 4RS8A 4UVBA 4MK6A 3HOTA 1FBUA 2LFBA 3L1PA 1TT0A 3Q5FA 4DQ2A 1EH8A 1X1PA 2DQLA 2PBIA 1MZBA 1LFPA 2VKHA 5GPCA 3WTWC 4KNYA 3PJRA 1RKWA 3OIPA 2A6EF 2QSHX 2IPQX 4IRIA 2MA3A 2LKXA 2DA6A 2I10A 1LFUP 3K70D 3FDYA 3ZR8X 5L3GA 2IT0A 3FMQA 3KP7A 3VYSB 2I5UA 5CVRA 1OLTA 2CUZA 3BHQA 2GIZA 3F21A 1ETXA 2JJ7A 4XM3A 3N97A 1I50J 4Z6YA 2MH2A 1VNDA 2RNJA 1K4TA 4FX4A 3F6OA 4ZC3A 2HYFA 1WJEA 3CF2A 3SEQA 3HUGB 3LAPA 4DGWB 5EDNA 2NAZA 3I54A 3OWTA 3F8MA 1D1BA 4NB5A 1N78A 2KQRA 5HS9A 3MEXA 4WK8F 1XMKA 2WV0A 4XIDA 4F7ZA 5A2QK 5E3MA 2Y9ZA 5FLXK 4CCNA 4M9ZA 3E7QA 4YIIA 2FE3A 2IXSA 4PJ0C 4H0EA 1TQMA 4C3IJ 1O4XA 2PMHA 4LIUA 4XLHA 1IN8A 1U78A 1UI6A 4ZDPA 2ESNA 4JQFA 3L2WA 2RREA 1J2XA 2HVQA 3W3CA 2OD5A 1PJRA 4N4NB 4EATA 1JTYA 2NS0A 1Z1DA 4BNCA 4HX8A 1FT9A 4IRHA 3GLLA 5BMZA 1HKQA 2DJNA 2XGEA 1EH7A 2XDVA 2QKOA 2NOJB 2DDBA 4GO1A 1LB2A 3PM1A 4NUBA 4HNVA 4A3MJ 4YIFA 2PQ8A 3L09A 4BEHB 3HTHA 4FHTA 2YVHA 4BXFA 2UUZA 1IN4A 4EM0B 1S5LC 2RNGA 2BW3B 4HDUA 2KFDA 3B02A 3F9KA 4EEFG 4A3EJ 5M3FJ 4OMYA 1FTZA 2UXUA 2V7FA 4M6VA 4XBFA 1KU2A 4EJVA 3ELKA 5DUKA 1DGRM 3VDXA 1BOAA 3GVAA 1LVKA 3T6NA 2MW8A 5IYDJ 2PZ9A 3I64A 3HL2A 3BDDA 2K4BA 3I4MJ 3BPXA
chains in the Genus database with same CATH topology
4W1UA 1FTTA 1MH4A 3S1NJ 3LSJA 3JRDA 2HYTA 1FIPA 3Q0VA 3Q3SA 1YRNA 1GUUA 3UKGA 3KKDA 4V2GA 3B81A 2G7GA 5J1YA 4AC6A 1OCPA 1ZK8A 2WAQN 5D18A 2D6YA 1X58A 3JR9A 4DZPA 5C4XJ 1JUPA 2FQ4A 2NVXJ 3QKXA 4BBRJ 5CW8A 1IV6A 3IH3A 3JRBA 1FEXA 2R7ZJ 3JRCA 1MBGA 3VVXA 3WHBA 2EZIA 3C2BA 4JX6A 5K7FA 4S0HB 5EGOB 2IU5A 3TEDA 5GP9A 1ETOA 3HOYJ 3RZOJ 1MNMC 4BY7J 4D5CA 1IUFA 1RETA 3HDDA 3S2DJ 1X2MA 1DU6A 1VF9A 2ZCXA 5K7ZA 4MFDA 2B63J 1MBJA 3GTKJ 3M3YJ 1MH3A 4G12A 4X1EA 1JT0A 2VPRA 4NELA 2WV1A 1DU0A 3DCFA 2NP5A 3RKQA 2NVYJ 1B72A 3CRJA 2K9QA 5JLWA 4JYKA 4FE4A 2UXOA 5HAWA 1SGMA 1POGA 2Y9YA 2RASA 3CWRA 1QVUA 2L9RA 4RDUA 4D7NA 2DA3A 2CRGA 4MO7A 4DW6A 1T33A 4QIWN 2EBIA 1MSFC 4AF5A 5EFYA 1AHDP 2H1KA 4MLOA 1SANA 3MN2A 3A02A 4M3EA 5DAJA 4ACIA 3RZDJ 5C4JJ 1W0UA 4I76A 1H88C 2R93J 1TWAJ 3JRIA 5HODA 2GLOA 1GT0C 1VI0A 4CYCB 2CQQA 2K9SA 1JTXA 4MIMA 3O8GA 5EYRA 2HDDA 1JKQC 1TC3C 2KT0A 2RAEA 3B6CA 4JKZA 3Q0WA 1XG1A 2V57A 1I3QJ 2CQXA 1ZR4A 5FKKA 3SFIA 3ANPA 3S5RA 3HTAA 2HOAA 3ON2A 4L62A 2XGDA 5IP9J 2LVSA 3ZOBA 3BTCA 1U9OA 5FGLA 3BCGA 3BTJA 1UI5A 4ME9A 1AU7A 5EZGA 4IHYA 3VOKA 2VI6A 5BNGA 3LJLA 1JJ8C 5EEAA 2E2JJ 4GCLA 3QQAA 5F27A 4XRSG 1A5JA 1WCMJ 4ABZA 3IV5A 2D5VA 3S14J 2G0EA 3AQTA 5FJ8J 1E3OC 1LE8A 1Z0XA 3KZ9A 2ME0A 2DMTA 2DA4A 2DA7A 2HYJA 2IAIA 2JN6A 1QPIA 3BT9A 3ON4A 3G7RA 3HE0A 5JLXA 2PBXA 2MG4A 5M5YJ 3RD3A 4XICA 4A3KJ 3BNIA 1W0TA 3AQSA 1MBEA 3JSJA 1OFCX 5FLMJ 4DYRA 9ANTA 3A03A 5C4YA 1H89C 4XRSA 1R9TJ 3G1LA 2L7FP 2QF7A 3DEWA 2NS8A 2KDZA 1ZKGA 2M0CA 2NVTJ 2O8KA 3GEUA 4GCKA 4A69C 2DA5A 2ZOZA 2OPTA 4XRMA 3GTJJ 1BJZA 4PXIA 3HTJA 4V2FA 4CYCA 2HOTA 2ME6A 1WPKA 2ID6A 3NI7A 3BG5A 3PPBA 3HKZN 1A6IA 1JUSA 5IYCJ 3LSRA 5GPAA 3GTMJ 2E19A 1LFBA 3CCYA 3K2AA 4X6AJ 3TP0A 2XPUA 4A3JJ 1U9NA 2NP3A 3MKLA 4J19A 3BR5A 5CXGA 3G1OA 3ZQIA 1MBFA 3NXCA 3ZQGA 3SDGA 3QPLA 3GTLJ 3O60A 1OJLA 2AO9A 4B3AA 2E2HJ 3VVYA 5FKMA 2Q24A 5DTDA 1ZTRA 5IP6A 2M9HA 4A3CJ 2W53A 1IRZA 2FJ1A 5C3EJ 3BR0A 5F0FA 2H8RA 1ETKA 1TWFJ 2MSYA 2X9DA 2GFNA 4CGRA 4ICHA 2VKVA 2NX4A 3KKCA 1XC5A 1IG7A 3S15J 1ETQA 3IUVA 4QTRA 1VFCA 2GM4A 2O9LA 4LOCA 5HSZA 3I4NJ 1T56A 1HDDC 2XRLA 3ZQFA 2DMUA 2XDNA 1P7IA 3FK6A 3BRUA 3IH4A 5EG0B 3GTOJ 5IOZA 2XGCA 4L5EA 2LD5A 3VIBA 5CXIA 2VUMJ 1LE8B 5E3LA 1ZQ3P 1IC8A 1MBKA 2L7MP 3VOXA 2G7SA 3HGGA 1GVDA 2PMZN 2L7ZA 1WGXA 4GFBA 1BW5A 1UMQA 5AQCA 3W6VA 3BTIA 2EZKA 3VPRA 2ELKA 2XPVA 1JUMA 2JA8J 1F43A 3O8HA 4DZJA 1QRYA 1NK2P 5F04A 5H9TA 2X6OA 4C2MJ 1UHSA 4BKXA 1JKRC 3FKIJ 4XK4A 1IGNA 1IJWC 1HOMA 3OSGA 4B1RA 5M5XJ 2R0QC 5J1UA 2XSDC 2GENA 1WI3A 1Y1VJ 3LWJA 3NPIA 4GFKA 3QBMA 1D5YA 2G7LA 3NAUA 5FMPA 2ID3A 3ZQCA 1APLC 2M2EA 1P7JA 2HI3A 3OIOA 5E3NA 2RHAA 3I4MJ 3CQZJ 2XPWA 1NTCA 3WHCA 3BG3A 1PUFB 4AC0A 2HQ5A 3BJBA 2DG8A 2UXIA 1ETYA 3G56A 2Y31A 5EZHA 1RESA 2O7TA 2GBYA 2NS7A 4IHWA 3NNRA 4QSHA 3PO3J 3JRHA 4I6ZA 2WGBA 2DTZA 5EG0A 1Z77A 2REKA 2TRTA 1ENHA 5IYBJ 3S1QJ 1EF4A 3HOZJ 2Y0SN 1RPWA 3F1BA 3ZQHA 1S7EA 3HOUJ 4JNNA 3CMYA 5FKOA 4DYCA 3D1NI 3HB9A 4Y7NJ 1B8IB 3GBGA 2LP0A 2UXHA 2O7OA 3K7AJ 1X2NA 2F07A 5F0CA 5IPAA 2IBDA 2QOPA 1BA5A 1GV2A 3H0GJ 2EQRA 2DMPA 2R92J 3MNLA 4NDLA 1QVTA 2LR8A 4GFLA 3BR2A 1OCTC 3BQYA 3LOCA 4IHVA 4AUXA 3EUPA 1GV5A 4GCTA 5EF6A 2X48A 4Y52J 2JK3A 3VP5A 2R5ZB 4A3FJ 3HM5A 4IHXA 1Y1WJ 4W97A 3HIMA 1F36A 2WB1N 4IEJA 1MBHA 1G2HA 5IOYA 5DS9A 2YU9J 3DPJA 2QTQA 1PUFA 3TW6A 1AKHB 4JL3A 1K83J 2N8GA 2FD5A 2COBA 5K58A 2FX0A 4M3BA 3LHQA 4JX5A 4FISA 2E2IJ 3COLA 2CUEA 5FLVA 3S2HJ 2OERA 1TWCJ 3GZIA 5C44J 1GDTA 3M4OJ 2LY9A 4BXXJ 2R5YA 2LTPA 3HOXJ 2JA5J 3RH2A 2K40A 3HBLA 3BG9A 3PO2J 1ORKA 3TW7A 1B8IA 3TP3A 4NN1A 3FRQA 1H8AC 3ZQLA 1TWHJ 4A3LJ 1ZGWA 5M5WJ 3FK7A 2Y30A 2Y2ZA 3OSFA 4MFEA 3JREA 2M34A 4A3IJ 2YVEA 3ANGA 3JRFA 1K61A 4M3GA 2QIBA 3S1MJ 4C3JJ 4UUSB 5FKLA 4D5FA 3FIWA 4M3DA 2DN0A 2MGQA 4YZEA 2EZLA 4M3FA 5FKNA 3QPSA 1MSEC 1Q1VA 4MXMA 2DG7A 2JWTA 3LNQA 1HF0A 2R5ZA 2YUSA 4A3GJ 3OOUA 4JP0A 1HLVA 1HCRA 1FIAA 2ECCA 2M8GX 2NOGA 3B6AA 2IEKA 1JJ6C 1AKHA 2UXPA 3P9TA 1I6HJ 1WH7A 4AYBN 2JA6J 3E7LA 1IDZA 3FISA 3G1MA 2HOSA 4B4CA 4MK6A 2LFBA 3L1PA 3A01B 1U8BA 1JGGA 1UG2A 3KNWA 2EH3A 1BW6A 3LSGA 1CQTA 3HOWJ 4A3DJ 2DMNA 5GPCA 5FHPA 4C3HJ 3CJDA 4UUTA 4D7MA 3GTPJ 1RKWA 4FCYA 1FJLA 5HBUA 1ETVA 3GTGJ 3S16J 3Q0UA 2LKXA 2QCOA 2DA6A 2E1OA 2L0KA 2I10A 1LFUP 3PASA 1JT6A 5F08A 2LLKA 3GTQJ 3S17J 5IP7J 3BHQA 3NARA 2ZCNA 1ETXA 2JJ7A 4BY1J 2WUIA 3C07A 1WH5A 5D1RA 1I50J 3BR6A 3JRGA 3BR3A 2VKEA 1VNDA 1XS9A 2FBQA 4UUSA 1ITYA 1RKTA 1TWGJ 2R5YB 2YS9A 3EGQA 5EDNA 3H3VK 2CU7A 2W48A 3HOVJ 2DMQA 3VW2A 5EGOA 3HGYA 3SJMA 3VUQA 5F1JA 4A3BJ 2DA1A 2HXOA 4XIDA 2DA2A 4FE7A 5E3MA 1YRNB 4BBSJ 2Y9ZA 2ZCMA 2XB0X 3E7QA 3BTLA 1HDPA 1IDYA 1JKOC 2GUHA 4C3IJ 2OI8A 1RR7A 1O4XA 1U78A 1UI6A 2ZB9A 5F0HA 3A01A 2CUFA 2G3BA 3IH2A 4HKUA 2TCTA 2QWTA 5D19A 3VW0A 3F0CA 1JTYA 2P81A 1ETWA 5J1RA 2K9NA 2HXIA 4DYQA 3NRGA 2DJNA 2XGEA 3V78A 2OF7A 2QKOA 3BQZA 5K7HA 4RBOA 3PM1A 4HNVA 4A3MJ 5M3MJ 4JX4A 2ECBA 2HKUA 2LK2A 1JKPC 4UDSA 3JRAA 3HTHA 3HEFA 4A93J 3HTIA 1NK3P 3VW1A 2YVHA 4FTHA 2JMWA 3LSPA 5J3LA 2XB5A 3CDLA 1BL0A 4EEFG 4A3EJ 3S1RJ 3VVZA 1B72B 2ZOYA 5M3FJ 2UXUA 1FTZA 4M6VA 3BR1A 2CJJA 1SFOJ 4KWAA 2NVQJ 2JA7J 3T6NA 2MW8A 5IYDJ 2PZ9A 3V6GA 2AHQA 5E3OA 1ZR2A 2EZHA 3RQIA 3MVPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W1U A;  1FTT A;  1MH4 A;  3S1N J;  3LSJ A;  3JRD A;  2HYT A;  1FIP A;  3Q0V A;  3Q3S A;  1YRN A;  1GUU A;  3UKG A;  3KKD A;  4V2G A;  3B81 A;  2G7G A;  5J1Y A;  4AC6 A;  1OCP A;  1ZK8 A;  2WAQ N;  5D18 A;  2D6Y A;  1X58 A;  3JR9 A;  4DZP A;  5C4X J;  1JUP A;  2FQ4 A;  2NVX J;  3QKX A;  4BBR J;  5CW8 A;  1IV6 A;  3IH3 A;  3JRB A;  1FEX A;  2R7Z J;  3JRC A;  1MBG A;  3VVX A;  3WHB A;  2EZI A;  3C2B A;  4JX6 A;  5K7F A;  4S0H B;  5EGO B;  2IU5 A;  3TED A;  5GP9 A;  1ETO A;  3HOY J;  3RZO J;  1MNM C;  4BY7 J;  4D5C A;  1IUF A;  1RET A;  3HDD A;  3S2D J;  1X2M A;  1DU6 A;  1VF9 A;  2ZCX A;  5K7Z A;  4MFD A;  2B63 J;  1MBJ A;  3GTK J;  3M3Y J;  1MH3 A;  4G12 A;  4X1E A;  1JT0 A;  2VPR A;  4NEL A;  2WV1 A;  1DU0 A;  3DCF A;  2NP5 A;  3RKQ A;  2NVY J;  1B72 A;  3CRJ A;  2K9Q A;  5JLW A;  4JYK A;  4FE4 A;  2UXO A;  5HAW A;  1SGM A;  1POG A;  2Y9Y A;  2RAS A;  3CWR A;  1QVU A;  2L9R A;  4RDU A;  4D7N A;  2DA3 A;  2CRG A;  4MO7 A;  4DW6 A;  1T33 A;  4QIW N;  2EBI A;  1MSF C;  4AF5 A;  5EFY A;  1AHD P;  2H1K A;  4MLO A;  1SAN A;  3MN2 A;  3A02 A;  4M3E A;  5DAJ A;  4ACI A;  3RZD J;  5C4J J;  1W0U A;  4I76 A;  1H88 C;  2R93 J;  1TWA J;  3JRI A;  5HOD A;  2GLO A;  1GT0 C;  1VI0 A;  4CYC B;  2CQQ A;  2K9S A;  1JTX A;  4MIM A;  3O8G A;  5EYR A;  2HDD A;  1JKQ C;  1TC3 C;  2KT0 A;  2RAE A;  3B6C A;  4JKZ A;  3Q0W A;  1XG1 A;  2V57 A;  1I3Q J;  2CQX A;  1ZR4 A;  5FKK A;  3SFI A;  3ANP A;  3S5R A;  3HTA A;  2HOA A;  3ON2 A;  4L62 A;  2XGD A;  5IP9 J;  2LVS A;  3ZOB A;  3BTC A;  1U9O A;  5FGL A;  3BCG A;  3BTJ A;  1UI5 A;  4ME9 A;  1AU7 A;  5EZG A;  4IHY A;  3VOK A;  2VI6 A;  5BNG A;  3LJL A;  1JJ8 C;  5EEA A;  2E2J J;  4GCL A;  3QQA A;  5F27 A;  4XRS G;  1A5J A;  1WCM J;  4ABZ A;  3IV5 A;  2D5V A;  3S14 J;  2G0E A;  3AQT A;  5FJ8 J;  1E3O C;  1LE8 A;  1Z0X A;  3KZ9 A;  2ME0 A;  2DMT A;  2DA4 A;  2DA7 A;  2HYJ A;  2IAI A;  2JN6 A;  1QPI A;  3BT9 A;  3ON4 A;  3G7R A;  3HE0 A;  5JLX A;  2PBX A;  2MG4 A;  5M5Y J;  3RD3 A;  4XIC A;  4A3K J;  3BNI A;  1W0T A;  3AQS A;  1MBE A;  3JSJ A;  1OFC X;  5FLM J;  4DYR A;  9ANT A;  3A03 A;  5C4Y A;  1H89 C;  4XRS A;  1R9T J;  3G1L A;  2L7F P;  2QF7 A;  3DEW A;  2NS8 A;  2KDZ A;  1ZKG A;  2M0C A;  2NVT J;  2O8K A;  3GEU A;  4GCK A;  4A69 C;  2DA5 A;  2ZOZ A;  2OPT A;  4XRM A;  3GTJ J;  1BJZ A;  4PXI A;  3HTJ A;  4V2F A;  4CYC A;  2HOT A;  2ME6 A;  1WPK A;  2ID6 A;  3NI7 A;  3BG5 A;  3PPB A;  3HKZ N;  1A6I A;  1JUS A;  5IYC J;  3LSR A;  5GPA A;  3GTM J;  2E19 A;  1LFB A;  3CCY A;  3K2A A;  4X6A J;  3TP0 A;  2XPU A;  4A3J J;  1U9N A;  2NP3 A;  3MKL A;  4J19 A;  3BR5 A;  5CXG A;  3G1O A;  3ZQI A;  1MBF A;  3NXC A;  3ZQG A;  3SDG A;  3QPL A;  3GTL J;  3O60 A;  1OJL A;  2AO9 A;  4B3A A;  2E2H J;  3VVY A;  5FKM A;  2Q24 A;  5DTD A;  1ZTR A;  5IP6 A;  2M9H A;  4A3C J;  2W53 A;  1IRZ A;  2FJ1 A;  5C3E J;  3BR0 A;  5F0F A;  2H8R A;  1ETK A;  1TWF J;  2MSY A;  2X9D A;  2GFN A;  4CGR A;  4ICH A;  2VKV A;  2NX4 A;  3KKC A;  1XC5 A;  1IG7 A;  3S15 J;  1ETQ A;  3IUV A;  4QTR A;  1VFC A;  2GM4 A;  2O9L A;  4LOC A;  5HSZ A;  3I4N J;  1T56 A;  1HDD C;  2XRL A;  3ZQF A;  2DMU A;  2XDN A;  1P7I A;  3FK6 A;  3BRU A;  3IH4 A;  5EG0 B;  3GTO J;  5IOZ A;  2XGC A;  4L5E A;  2LD5 A;  3VIB A;  5CXI A;  2VUM J;  1LE8 B;  5E3L A;  1ZQ3 P;  1IC8 A;  1MBK A;  2L7M P;  3VOX A;  2G7S A;  3HGG A;  1GVD A;  2PMZ N;  2L7Z A;  1WGX A;  4GFB A;  1BW5 A;  1UMQ A;  5AQC A;  3W6V A;  3BTI A;  2EZK A;  3VPR A;  2ELK A;  2XPV A;  1JUM A;  2JA8 J;  1F43 A;  3O8H A;  4DZJ A;  1QRY A;  1NK2 P;  5F04 A;  5H9T A;  2X6O A;  4C2M J;  1UHS A;  4BKX A;  1JKR C;  3FKI J;  4XK4 A;  1IGN A;  1IJW C;  1HOM A;  3OSG A;  4B1R A;  5M5X J;  2R0Q C;  5J1U A;  2XSD C;  2GEN A;  1WI3 A;  1Y1V J;  3LWJ A;  3NPI A;  4GFK A;  3QBM A;  1D5Y A;  2G7L A;  3NAU A;  5FMP A;  2ID3 A;  3ZQC A;  1APL C;  2M2E A;  1P7J A;  2HI3 A;  3OIO A;  5E3N A;  2RHA A;  3I4M J;  3CQZ J;  2XPW A;  1NTC A;  3WHC A;  3BG3 A;  1PUF B;  4AC0 A;  2HQ5 A;  3BJB A;  2DG8 A;  2UXI A;  1ETY A;  3G56 A;  2Y31 A;  5EZH A;  1RES A;  2O7T A;  2GBY A;  2NS7 A;  4IHW A;  3NNR A;  4QSH A;  3PO3 J;  3JRH A;  4I6Z A;  2WGB A;  2DTZ A;  5EG0 A;  1Z77 A;  2REK A;  2TRT A;  1ENH A;  5IYB J;  3S1Q J;  1EF4 A;  3HOZ J;  2Y0S N;  1RPW A;  3F1B A;  3ZQH A;  1S7E A;  3HOU J;  4JNN A;  3CMY A;  5FKO A;  4DYC A;  3D1N I;  3HB9 A;  4Y7N J;  1B8I B;  3GBG A;  2LP0 A;  2UXH A;  2O7O A;  3K7A J;  1X2N A;  2F07 A;  5F0C A;  5IPA A;  2IBD A;  2QOP A;  1BA5 A;  1GV2 A;  3H0G J;  2EQR A;  2DMP A;  2R92 J;  3MNL A;  4NDL A;  1QVT A;  2LR8 A;  4GFL A;  3BR2 A;  1OCT C;  3BQY A;  3LOC A;  4IHV A;  4AUX A;  3EUP A;  1GV5 A;  4GCT A;  5EF6 A;  2X48 A;  4Y52 J;  2JK3 A;  3VP5 A;  2R5Z B;  4A3F J;  3HM5 A;  4IHX A;  1Y1W J;  4W97 A;  3HIM A;  1F36 A;  2WB1 N;  4IEJ A;  1MBH A;  1G2H A;  5IOY A;  5DS9 A;  2YU9 J;  3DPJ A;  2QTQ A;  1PUF A;  3TW6 A;  1AKH B;  4JL3 A;  1K83 J;  2N8G A;  2FD5 A;  2COB A;  5K58 A;  2FX0 A;  4M3B A;  3LHQ A;  4JX5 A;  4FIS A;  2E2I J;  3COL A;  2CUE A;  5FLV A;  3S2H J;  2OER A;  1TWC J;  3GZI A;  5C44 J;  1GDT A;  3M4O J;  2LY9 A;  4BXX J;  2R5Y A;  2LTP A;  3HOX J;  2JA5 J;  3RH2 A;  2K40 A;  3HBL A;  3BG9 A;  3PO2 J;  1ORK A;  3TW7 A;  1B8I A;  3TP3 A;  4NN1 A;  3FRQ A;  1H8A C;  3ZQL A;  1TWH J;  4A3L J;  1ZGW A;  5M5W J;  3FK7 A;  2Y30 A;  2Y2Z A;  3OSF A;  4MFE A;  3JRE A;  2M34 A;  4A3I J;  2YVE A;  3ANG A;  3JRF A;  1K61 A;  4M3G A;  2QIB A;  3S1M J;  4C3J J;  4UUS B;  5FKL A;  4D5F A;  3FIW A;  4M3D A;  2DN0 A;  2MGQ A;  4YZE A;  2EZL A;  4M3F A;  5FKN A;  3QPS A;  1MSE C;  1Q1V A;  4MXM A;  2DG7 A;  2JWT A;  3LNQ A;  1HF0 A;  2R5Z A;  2YUS A;  4A3G J;  3OOU A;  4JP0 A;  1HLV A;  1HCR A;  1FIA A;  2ECC A;  2M8G X;  2NOG A;  3B6A A;  2IEK A;  1JJ6 C;  1AKH A;  2UXP A;  3P9T A;  1I6H J;  1WH7 A;  4AYB N;  2JA6 J;  3E7L A;  1IDZ A;  3FIS A;  3G1M A;  2HOS A;  4B4C A;  4MK6 A;  2LFB A;  3L1P A;  3A01 B;  1U8B A;  1JGG A;  1UG2 A;  3KNW A;  2EH3 A;  1BW6 A;  3LSG A;  1CQT A;  3HOW J;  4A3D J;  2DMN A;  5GPC A;  5FHP A;  4C3H J;  3CJD A;  4UUT A;  4D7M A;  3GTP J;  1RKW A;  4FCY A;  1FJL A;  5HBU A;  1ETV A;  3GTG J;  3S16 J;  3Q0U A;  2LKX A;  2QCO A;  2DA6 A;  2E1O A;  2L0K A;  2I10 A;  1LFU P;  3PAS A;  1JT6 A;  5F08 A;  2LLK A;  3GTQ J;  3S17 J;  5IP7 J;  3BHQ A;  3NAR A;  2ZCN A;  1ETX A;  2JJ7 A;  4BY1 J;  2WUI A;  3C07 A;  1WH5 A;  5D1R A;  1I50 J;  3BR6 A;  3JRG A;  3BR3 A;  2VKE A;  1VND A;  1XS9 A;  2FBQ A;  4UUS A;  1ITY A;  1RKT A;  1TWG J;  2R5Y B;  2YS9 A;  3EGQ A;  5EDN A;  3H3V K;  2CU7 A;  2W48 A;  3HOV J;  2DMQ A;  3VW2 A;  5EGO A;  3HGY A;  3SJM A;  3VUQ A;  5F1J A;  4A3B J;  2DA1 A;  2HXO A;  4XID A;  2DA2 A;  4FE7 A;  5E3M A;  1YRN B;  4BBS J;  2Y9Z A;  2ZCM A;  2XB0 X;  3E7Q A;  3BTL A;  1HDP A;  1IDY A;  1JKO C;  2GUH A;  4C3I J;  2OI8 A;  1RR7 A;  1O4X A;  1U78 A;  1UI6 A;  2ZB9 A;  5F0H A;  3A01 A;  2CUF A;  2G3B A;  3IH2 A;  4HKU A;  2TCT A;  2QWT A;  5D19 A;  3VW0 A;  3F0C A;  1JTY A;  2P81 A;  1ETW A;  5J1R A;  2K9N A;  2HXI A;  4DYQ A;  3NRG A;  2DJN A;  2XGE A;  3V78 A;  2OF7 A;  2QKO A;  3BQZ A;  5K7H A;  4RBO A;  3PM1 A;  4HNV A;  4A3M J;  5M3M J;  4JX4 A;  2ECB A;  2HKU A;  2LK2 A;  1JKP C;  4UDS A;  3JRA A;  3HTH A;  3HEF A;  4A93 J;  3HTI A;  1NK3 P;  3VW1 A;  2YVH A;  4FTH A;  2JMW A;  3LSP A;  5J3L A;  2XB5 A;  3CDL A;  1BL0 A;  4EEF G;  4A3E J;  3S1R J;  3VVZ A;  1B72 B;  2ZOY A;  5M3F J;  2UXU A;  1FTZ A;  4M6V A;  3BR1 A;  2CJJ A;  1SFO J;  4KWA A;  2NVQ J;  2JA7 J;  3T6N A;  2MW8 A;  5IYD J;  2PZ9 A;  3V6G A;  2AHQ A;  5E3O A;  1ZR2 A;  2EZH A;  3RQI A;  3MVP A; 
#chains in the Genus database with same CATH topology
 3IC7 A;  2KDO A;  3QOP A;  1U5T A;  3FXL A;  1OCC H;  2HYT A;  1U3E M;  3Q3S A;  2IGM A;  1YRN A;  3BJO A;  4EQQ A;  1GUU A;  3UKG A;  2BVL A;  2HQN A;  2M3A A;  4V2G A;  5LD2 C;  3J7A Y;  2JRM A;  3B81 A;  3DBL B;  1W5T A;  4OOI A;  4P5O A;  2WAQ N;  3K10 A;  5D18 A;  2OA4 A;  2CGP A;  3JR9 A;  1TT5 B;  2OJE D;  2FQ4 A;  2VLA A;  1D0Y A;  1OR7 A;  2NVX J;  1XGO A;  5CW8 A;  3KEY A;  1QZE A;  1IV6 A;  3AG3 H;  5L3E A;  4HOB A;  1FEX A;  2LY2 A;  4FAS D;  3HTU A;  1Y56 A;  4IZZ A;  2F5E A;  2EZI A;  3R61 A;  3ROU A;  2BOL A;  1D8K A;  2KJC A;  2PMZ A;  5GP9 A;  3RZO J;  1MNM C;  3EUK L;  4BY7 J;  1H9G A;  4RM2 A;  2DK8 A;  4G94 A;  3HDD A;  3SHF A;  3CMA I;  2ZCX A;  1FNN A;  2QSF X;  4XRF A;  2VKD A;  4MFD A;  2DOA A;  2OZ6 A;  3GTK J;  2L4A A;  3WE3 A;  3M3Y J;  3NRV A;  1T08 B;  4X1E A;  1YJ9 I;  2ZJP F;  2MC4 A;  4H4K C;  2VPR A;  4PUS A;  4FX0 A;  2PMU A;  2WV1 A;  2P7C B;  3DCF A;  5JVG F;  1ZAO A;  3W6K B;  1S29 A;  1CGP A;  4BE0 A;  4FE4 A;  5IY5 H;  2R3S A;  1YIJ I;  1Y39 A;  2RAS A;  3DTE A;  2JPC A;  2EFW A;  3GUD A;  2UV1 A;  1XCB A;  2E60 A;  3DV8 A;  4KN7 X;  4EJU A;  4D7N A;  4MO7 A;  4QIW N;  4UUV A;  4AF5 A;  3C1D A;  5HLG A;  1AHD P;  4M3E A;  5GTI C;  1O3S A;  3RZD J;  1L0O C;  4ZYD A;  3CCL I;  4IQJ A;  2R93 J;  1UB9 A;  2IA2 A;  3A2K A;  3TOB A;  2VBZ A;  1YO5 C;  4MIM A;  1JTX A;  4PFP A;  2D1V A;  3OYE A;  2HDD A;  1JKQ C;  1TC3 C;  3V42 A;  4G7O F;  5E18 F;  1XG1 A;  2R7F A;  4IVN A;  2V57 A;  1ZR4 A;  3S5R A;  1YW9 A;  3SFI A;  5ERI A;  1LEB A;  4MGR A;  2BEO A;  3ZOB A;  3PNY A;  1MGT A;  3GX4 X;  5FGL A;  3BCG A;  3C7J A;  2Z16 A;  5BNG A;  3F6V A;  1NH3 A;  2G7H A;  1YJN I;  2PJP A;  4GCL A;  5F27 A;  3U9G A;  4IXA A;  3CCQ I;  2XSJ C;  1Z67 A;  4ABZ A;  2D5V A;  3T1B A;  3AQT A;  3WTV C;  1E3O C;  2IS4 A;  3RTR A;  1LE8 A;  3C2G A;  1ERD A;  3HZJ A;  1ZEL A;  4L18 B;  2ME0 A;  1P4X A;  2DMT A;  2RQP A;  5LFA A;  4FET A;  2VJ4 A;  2VQL A;  1X1C A;  3HRS A;  5IT3 A;  2PBX A;  2Y69 H;  1E2X A;  5M5Y J;  3ERE D;  4XIC A;  4HQE A;  1MBE A;  4KN4 X;  3A03 A;  3H1C A;  3PQK A;  3GFI A;  5JHF A;  4XRS A;  5H6Q A;  4D0P A;  4HLY A;  2L7F P;  3CC4 I;  2NS8 A;  1FBS A;  1KU9 A;  2M0C A;  3HOS A;  2H27 A;  4Y15 A;  3TBI A;  3EUH A;  1T38 A;  3LSK A;  5L3D A;  2HS5 A;  4XRM A;  1MKM A;  5LHI A;  4Y33 A;  1VQO I;  5K5R A;  5HDK A;  2ME6 A;  1WPK A;  2ID6 A;  1SAU A;  2BHZ A;  1A6I A;  1XMA A;  2M1B A;  5IYC J;  3LSR A;  2WAF A;  1LFB A;  3CCY A;  4JOM A;  2CUJ A;  4UNO A;  2J5O A;  1PDN C;  2GQQ A;  2KP6 A;  2W25 A;  4I02 A;  2ZME C;  4NHJ A;  1ZRF A;  3CUQ B;  3MKL A;  3CJT B;  4J19 A;  1F9N A;  2VQG A;  5CXG A;  3G1O A;  3KET A;  3NXC A;  1LDK B;  2ZCW A;  5ICG A;  2E2H J;  4B3A A;  1GXP A;  3VVY A;  2ADU A;  2Q24 A;  4KYW A;  2L9S A;  2M9H A;  2YSR A;  1J5Y A;  2WAQ A;  3O2P E;  2P4W A;  5DYM A;  5C3E J;  3BR0 A;  4E6K G;  2UWM A;  5E1Z B;  1Z05 A;  2MSY A;  2X9D A;  4NBQ A;  2GFN A;  4WIB A;  2ZO4 A;  4ICH A;  4CGR A;  2G7U A;  2EIK H;  3DPU A;  2EFQ A;  1FX7 A;  3EYI A;  1MIJ A;  3DPT A;  5GAH J;  2HPM A;  4ZDL A;  2GXG A;  1VQ4 I;  1VFC A;  5GAD J;  2ZXI A;  2CQN A;  3H5N A;  1DP7 P;  3CTA A;  2QQA A;  4XLE A;  3ZQF A;  3D5R C;  3GCM A;  5A2Q Z;  2IGK A;  5FLX Z;  4R8H A;  1QHG A;  1ZLJ A;  4AYB A;  2QEX I;  2L9N A;  2XGC A;  4L5E A;  3VIB A;  4XKB A;  2B7E A;  2VUM J;  1YYV A;  4HSR A;  1SFU A;  5E3L A;  2BY1 A;  3PUB A;  4CSW A;  3OYB A;  4HF1 A;  3JTG A;  3CC7 I;  1WGX A;  2XAJ A;  2D1H A;  1UMQ A;  3GLX A;  1T0F C;  3VPR A;  3CO7 C;  3U1D A;  3IKT A;  3OS0 A;  3L7W A;  3OMY A;  4BS9 A;  2DK5 A;  2KZG A;  5F04 A;  5H9T A;  1ZRC A;  2XAQ A;  2AS5 F;  2ZJ2 A;  3ZP5 A;  3WOD F;  1G59 A;  3FKI J;  1IGN A;  2VQH A;  1IJW C;  5KNL A;  4B1R A;  2GA1 A;  5M5X J;  3BCA A;  2XSD C;  2QYO A;  4GFK A;  2BYV E;  5L3F A;  1K79 A;  3F8F A;  2ID3 A;  1REP C;  3ZQC A;  4YFN F;  2Z5U A;  3J7Y J;  1FBQ A;  2MLG A;  2HI3 A;  2V26 A;  5KHD A;  1IRG A;  2VXZ A;  1J9I A;  2HQA A;  3SYT A;  5J47 A;  3GFM A;  1PUF B;  3BJB A;  3P9C A;  2OQG A;  3CDI A;  1K6O A;  1LDJ A;  2BY0 A;  2NS7 A;  5KVR A;  3ZRG A;  3PO3 J;  1G6N A;  2O61 A;  2LYC A;  3JRH A;  2WGB A;  5EG0 A;  3D5S C;  4LGW A;  1Z77 A;  2V1U A;  4G6T B;  4IPA A;  3UNG C;  1ENH A;  2Y0S N;  2QEN A;  3C2H A;  2E71 A;  5ED4 A;  1UHM A;  3E6D A;  4HX4 A;  4LIV A;  4EJT A;  1KYZ A;  4Y7N J;  4WXH A;  4GGG A;  3GBG A;  3MKY B;  1B8I B;  2UXH A;  3OYN A;  1XPX A;  2O7O A;  1X2N A;  2A5W A;  2ZFW A;  5F0C A;  5IPA A;  2IBD A;  1ONV A;  5E79 C;  3AG1 H;  4RB3 C;  4NC7 A;  4C9Y A;  3FHN A;  1L3L A;  2RC4 A;  1NHA A;  3B73 A;  4LJZ F;  5CKT A;  4XSX F;  1F36 A;  2OZU A;  4IEJ A;  1MBH A;  1G2H A;  1EV7 A;  2ZSI B;  3DPJ A;  2QTQ A;  2JZY A;  4R79 A;  3M07 A;  2VOO A;  3WU2 C;  3AFH A;  1K83 J;  2N8G A;  2ELJ A;  2R7T A;  3P7N A;  1MJA A;  1B4A A;  3HJE A;  2LOO A;  1IV8 A;  1YLF A;  1B9N A;  3GFJ A;  3S3N A;  1TWC J;  3GZI A;  5L3B A;  1DDN A;  1Z21 A;  3CCV I;  4HV6 A;  1JI8 A;  1R1V A;  3HOX J;  2DQR A;  5CJ9 A;  2K40 A;  3HBL A;  3NWS A;  1LEA A;  3CCU I;  3E3V A;  3FRQ A;  3FWE A;  4A3L J;  5M5W J;  1P4A A;  2V9P A;  2BE5 F;  3M7G A;  2Y2Z A;  4E70 A;  4CH7 A;  4UHT A;  1LNW A;  4A3I J;  4XN3 A;  1SD6 A;  1G8X A;  4KIT B;  2UZK A;  5FKL A;  2MGQ A;  5CQE A;  5BOX A;  3QPS A;  1R49 A;  1Q1V A;  1TLH B;  4O3M A;  5ICE A;  3SZP A;  2K85 A;  3OOU A;  2PFB A;  1KYW A;  3J7A O;  5LGT A;  1O3R A;  2NOG A;  1LKX A;  5LRS A;  1P4W A;  4I99 C;  1K6Y A;  3R4K A;  1FYK A;  2JA6 J;  4CO8 A;  4B4C A;  5DD4 A;  1JGG A;  1UG2 A;  5FRN A;  1F4K A;  1P92 A;  2EH3 A;  3ASN H;  3LSG A;  3KZY A;  2GXB A;  2WA0 A;  2HFH A;  5E20 A;  2DMN A;  4C3H J;  3CJD A;  2Y48 A;  2L01 A;  4UUT A;  4A12 A;  3GTP J;  3I9V 2;  1ON1 A;  4FCY A;  3ABT A;  1BC7 C;  3GTG J;  1WZ2 A;  4HQM A;  2E7X A;  4B09 A;  3RKW A;  5F08 A;  3ZMD A;  2LLK A;  4JBA A;  1WJC A;  2GA2 A;  3F3X A;  3QWL A;  2ZCN A;  3OL4 A;  4HEA 2;  2XAU A;  3WU1 B;  3BR6 A;  1WRJ A;  4I2O A;  4QPQ A;  2RDP A;  2VKE A;  4U7D A;  1XSX A;  4U7B A;  5FFZ A;  3OYC A;  2FBQ A;  2EWN A;  2X4H A;  4PGG A;  3BJ6 A;  2P7V B;  1TWG J;  3T8R A;  2Y0S A;  3H3V K;  4YFX F;  2CU7 A;  3IWZ A;  3KPH A;  3HOV J;  5EGO A;  1U5T B;  3DKY A;  2A3S A;  3VUQ A;  1ZG5 A;  4S04 A;  3SZG A;  1H0M A;  3NWT A;  4A3B J;  2DA1 A;  4ENM A;  4FE7 A;  2PJR A;  1YRN B;  2F4O B;  2L4M A;  4G6Q A;  4BJT A;  3I56 I;  2XB0 X;  5BPD A;  1FYL A;  3BTL A;  3QOD A;  1HDP A;  4B44 A;  2FBH A;  5CVJ A;  5ICF A;  5AIQ A;  1RR7 A;  4XKW A;  2FNA A;  2CUF A;  3ULQ B;  1XSD A;  3VSL A;  1WJ5 A;  5LBQ A;  2R7S A;  2QWT A;  2P81 A;  2K9N A;  3FBI B;  4KMF A;  4G7H F;  2ELH A;  1VQ8 I;  4DYQ A;  4CCK A;  3V78 A;  1OYW A;  4XQF A;  1V55 H;  3WTX C;  1MMN A;  2LK2 A;  3JRA A;  3HEF A;  3HTI A;  1NK3 P;  4M6Y A;  1UCR A;  1IN6 A;  1NG6 A;  2JMW A;  3LSP A;  4FTH A;  4RAF A;  5J3L A;  1BR1 A;  3QAH A;  2JT1 A;  5D5X B;  3F22 A;  3O6B B;  4U0V A;  1Z7U A;  1I6X A;  5EJC A;  3HXL A;  3VVZ A;  3WTZ A;  2QVO A;  3EQL F;  4KWA A;  3DPL C;  4BQQ A;  2G9W A;  2XIG A;  3V6G A;  1SD5 A;  2AHQ A;  2VBX A;  4TV7 A;  3SEZ A;  4K2E A;  4XKV A;  1WVR A;  3NEU A;  2LRE A;  3S1N J;  3JRD A;  2XKP A;  2IS1 A;  1OCO H;  2BVM A;  4MQ9 F;  3K6G A;  1I27 A;  1FIP A;  1V5E A;  2ZXJ A;  1R00 A;  1MDM A;  2DOD A;  2X0L A;  3KKD A;  3BPV A;  1TNS A;  2CWE A;  3I4P A;  2G7G A;  3OV8 A;  4AC6 A;  3NQO A;  1ZK8 A;  3IAM 2;  1X58 A;  4A5M A;  2DOE A;  4LIT A;  4WF2 A;  3K4J A;  3SQN A;  1XGM A;  3K4M A;  3ZGK A;  5D5U B;  1OKR A;  1RC9 A;  4BBR J;  1JHH A;  3IH3 A;  2ZME A;  2DYS H;  3JRC A;  4CCO A;  2JUG A;  4M6X A;  4JX6 A;  4HF0 A;  2UXN A;  3TED A;  1KGS A;  1IN7 A;  3HOY J;  2IW5 A;  2XC7 A;  3K1P A;  3V4G A;  4U87 A;  1FY7 A;  1RET A;  3S2D J;  1X2M A;  1DU6 A;  2A61 A;  3C18 A;  2YU3 A;  1XCV A;  3UR3 C;  4P1W A;  3MFK A;  4G12 A;  1W36 D;  5GAG J;  1G3W A;  1R22 A;  2M4G A;  1DU0 A;  3LSH A;  2PG4 A;  1B72 A;  2R7O A;  3TGN A;  2K9Q A;  1IAW A;  3AL0 B;  1RUN A;  1IF1 A;  2M0M A;  5HAW A;  2C6Y A;  2LKS A;  4DNC A;  3W2W A;  2QUF A;  2KPM A;  2QKL B;  1IXC A;  5HDN A;  1MSF C;  1QGP A;  1T33 A;  4LD5 A;  3REO A;  3RIR A;  3DEE A;  2H1K A;  1K7A A;  4MLO A;  3AAF A;  3A02 A;  2OTL I;  3IKV A;  4HX7 A;  5DAJ A;  5C4J J;  1R4M B;  2V1D A;  4L5J A;  1W0U A;  3PUF A;  4DIQ A;  4I76 A;  3OYL A;  1H88 C;  4KFC A;  1TWA J;  2F48 A;  3JRI A;  5HOD A;  3O3K A;  2GLO A;  1GT0 C;  2CQQ A;  3V7R A;  1TL8 A;  4UV9 A;  2DFI A;  4UXN A;  5EYR A;  5B66 C;  3ABK H;  2EK5 A;  3MZY A;  1MJB A;  3BZK A;  3Q0W A;  4PCQ A;  1KU7 A;  4U9L A;  2IVM A;  3HTA A;  4ESB A;  2BHY A;  5IP9 J;  3MKW B;  1UI5 A;  4ME9 A;  2WY8 Q;  3KLN A;  1YW7 A;  4OAZ A;  2M45 A;  2VI6 A;  2M5W A;  4CZZ A;  3LQQ A;  2HGC A;  2OCE A;  2GWR A;  1QZY A;  4WXC A;  1R5G A;  4Q48 A;  1IO2 A;  2KRF A;  2XAS A;  1WCM J;  3HPH A;  4AU7 A;  3IV5 A;  4ON0 A;  3HYI A;  3ONQ A;  1V3F A;  3E6B A;  1MMS A;  3RPU A;  3KZ9 A;  1JHF A;  2IAI A;  2DA7 A;  1OCZ H;  2HYJ A;  1QPI A;  3BT9 A;  5J4Y A;  1TQI A;  4B3X A;  2LMD A;  1YFH A;  3S2W A;  2EIL H;  2MG4 A;  3HHH A;  4ITV A;  4A6D A;  1U6G A;  4R1H A;  4A3K J;  1B6A A;  3BNI A;  2B3W A;  1OFC X;  2Y0M A;  9ANT A;  3CD6 I;  2M30 A;  2LBF B;  3W2V A;  3MKZ A;  2GOX B;  1R9T J;  1X1D A;  2DDA A;  2QF7 A;  4KIG A;  2MD0 A;  2M4K A;  3CJN A;  2O8K A;  1SMY F;  5JR3 A;  3I3L A;  4A69 C;  2OPT A;  2BGC A;  1D5V A;  1SFE A;  4CYC A;  2EJR A;  2HOT A;  5E8I A;  5CQG A;  3NI7 A;  3BG5 A;  2ICW G;  2X6X A;  3GTM J;  3CP8 A;  3GME A;  3R60 A;  2ESH A;  5H6R A;  2DT6 A;  3VYR B;  4X6A J;  3PSI A;  3TP0 A;  1XMX A;  1YTY A;  3HG9 A;  4BDZ A;  1Z3Y A;  2UXX A;  2NP3 A;  1WQ2 A;  4XLA A;  2DI3 A;  4RAZ A;  1EKE A;  4NQW A;  1J0R A;  5D8K B;  1VTN C;  5JHU A;  3WE2 A;  4MQV A;  2X51 A;  3SDG A;  4GCV A;  1WJB A;  4YIR X;  5IP6 A;  1ZTR A;  3H36 A;  5HS8 A;  5LEK A;  3GW2 A;  2FJ1 A;  2QQB A;  3I58 A;  3CES A;  3JW4 A;  4FQG A;  4I98 B;  2I8D A;  2ZSH B;  3S32 A;  4B47 A;  1TWF J;  3TO7 A;  1FSE A;  1YI2 I;  2VKV A;  2ZNZ A;  3DFG A;  5KCM A;  3OYH A;  2NX4 A;  1IG7 A;  1XGN A;  1T6S A;  4OAY A;  5F1R A;  2OCC H;  2O9L A;  1BR4 A;  2HDW A;  3VOD A;  4CCM A;  5ICC A;  5B5E C;  3BWG A;  3ABL H;  3CUQ C;  2DT7 B;  2F5V A;  2FOW A;  3IH4 A;  3E5U A;  5EG0 B;  3GEZ A;  1E3P A;  5LGU A;  5CXI A;  2ACJ A;  4RGX A;  1I39 A;  5FB2 A;  4Q4Z F;  3PNV A;  2L7M P;  5DUI A;  4ZTF A;  2VC0 A;  3HRM A;  1BW5 A;  2A6T A;  5HS7 A;  3I55 I;  2XPV A;  4L9J A;  2JA8 J;  1F43 A;  3S3M A;  3LA2 A;  3A0H C;  1RI7 A;  1MW7 A;  2L9V A;  1W36 C;  4C2M J;  1RZ4 A;  1UHS A;  1QQI A;  4PDK A;  4XKC A;  3S93 A;  1JKR C;  4V19 K;  4HA8 A;  1DQU A;  2K3P A;  2W24 A;  2F5D A;  4ZZD A;  3OSG A;  1VQN I;  2R0Q C;  2HTS A;  2GEN A;  1WI3 A;  1Y1V J;  1HXD A;  4ESF A;  3NPI A;  1A36 A;  1BR2 A;  1R5I D;  3QBM A;  3NAU A;  2RKH A;  3QU6 A;  4HLX A;  4BQN A;  1VQP I;  2OV7 A;  1P7J A;  3OYD A;  4I01 A;  4KA4 A;  3RPU D;  3WHC A;  4U88 A;  3K70 C;  1W7P A;  2K3F A;  2XVC A;  1ETY A;  3QPT A;  4O5V A;  5E17 F;  1X4O A;  1WJA A;  2H6B A;  1RES A;  2VC1 A;  3KLO A;  3CMM A;  1ACI A;  2GBY A;  2J5P A;  1ON2 A;  1MJ9 A;  2CFX A;  3M1E A;  4ENN A;  5J40 A;  1HSJ A;  5D4R A;  2KIS A;  4XOP A;  4XLC A;  4KUM A;  1YIT I;  3ECH A;  5IYB J;  1EF4 A;  3LL7 A;  4U0Y A;  4E7K A;  3HOU J;  1S7E A;  1K4S A;  5FKO A;  4KIB A;  3D1N I;  2ZXH A;  3HB9 A;  4QPO A;  2Q8K A;  1E17 A;  1X19 A;  2LP0 A;  3KP3 A;  2E1M B;  2E35 A;  2F2E A;  2VN2 A;  3J81 K;  2F07 A;  3MCZ A;  3RKY A;  3ZMV A;  1DGW Y;  1X1A A;  5DCM A;  1GV2 A;  2R92 J;  3FHZ A;  3MNL A;  4NDL A;  2LR8 A;  4GFL A;  3BOQ A;  3BR2 A;  5HNF A;  4NC8 A;  3DTI A;  3LOC A;  3PQJ A;  1FOY A;  3GXO A;  5LHH A;  4E7H A;  1GV5 A;  4XMY A;  1FOW A;  3QRF F;  1K78 B;  2WAE A;  1WI9 A;  2LRD A;  1KON A;  4P9F A;  2X48 A;  2JK3 A;  1UG0 A;  2OBP A;  2BXZ A;  4A3F J;  4E7I A;  2WB1 N;  3FXK A;  4U0W A;  2ETH A;  5IOY A;  3TW6 A;  1TQP A;  3KCC A;  2KHM A;  2VBY A;  1Y0U A;  4CA0 A;  3I5U A;  2FD5 A;  2FBK A;  4YG2 F;  4XLP F;  3J7Z I;  3LHQ A;  2IS2 A;  3V7S A;  2ZJQ F;  3COL A;  2CUE A;  5FLV A;  4GYI A;  3S2H J;  2VON A;  3HPG A;  4QWQ A;  3OYF A;  3F8C A;  4GDF A;  1GDT A;  2DO7 A;  3D0S A;  1W5S A;  4PJN A;  4BXX J;  2OTJ I;  3T8T A;  1OQY A;  2LTP A;  1XGS A;  2JA5 J;  1YIO A;  3BG9 A;  3PO2 J;  2STT A;  3ESW B;  2CH0 A;  1Z6R A;  3H5A A;  4NN1 A;  4AWX B;  3ZQL A;  1TWH J;  3S8P A;  1ULY A;  2Y30 A;  1AOY A;  4XSZ F;  5FRM A;  3ERM A;  2P8T A;  3N4M A;  2YVE A;  3ANG A;  3JRF A;  1IN5 A;  4A5N A;  2PLY A;  2QIB A;  3FXM A;  3S1M J;  3FM3 A;  1R4N B;  1X1B A;  3OR1 C;  4D5F A;  4YZE A;  4M3D A;  4MEY F;  2CW0 F;  2EZL A;  4M3F A;  5FKN A;  3K4K A;  2P0W A;  3BZ6 A;  2JWT A;  1HF0 A;  4OIP F;  2R5Z A;  2YUS A;  5CYV A;  1HCR A;  4IL6 C;  2HYG D;  2ECC A;  2M8G X;  2MD5 A;  2R7R A;  2PJR B;  3G6E I;  5E1X A;  2FBI A;  3TDZ C;  2DPU A;  3KE2 A;  3WTU C;  1AKH A;  2XAG A;  1I6H J;  3G1M A;  1VQ6 I;  2E34 A;  5JFR A;  2PFV A;  1NG7 A;  1FOX A;  4P9U A;  1U8B A;  2FA5 A;  3BG7 A;  3M8J A;  4OMZ A;  3HOW J;  1MD0 A;  2XRO A;  1FJL A;  3L2V A;  5HBU A;  2L7K A;  3H9J A;  1FPQ A;  3FBN B;  4RAG A;  3S16 J;  2B1E A;  3Q0U A;  4D1Q A;  2JUC A;  3I71 A;  1JT6 A;  2KIU A;  3VYT B;  3S17 J;  4HV5 A;  5CVU A;  1GLN A;  3TOA A;  2R7D A;  3CJQ B;  4PJL A;  4RLQ A;  3C07 A;  1JE8 A;  4LK1 F;  3OS1 A;  5D1R A;  2PEX A;  3BR3 A;  1UST A;  2L5Q A;  4Y4R A;  4ENK A;  1X4P A;  3GWZ A;  3MZH A;  4UUS A;  2VT3 A;  1ITY A;  4HZF A;  1ZYR F;  2Y75 A;  4BE1 A;  2R5Y B;  2YS9 A;  3EGQ A;  2DYR H;  2W48 A;  4XLF A;  2DMQ A;  5D5V B;  2F4I A;  1OCR H;  3SJM A;  2FF4 A;  5F1J A;  4GXO A;  2HXO A;  2IP2 A;  2H8W A;  2ZCM A;  1QZZ A;  2EFP A;  2FOK A;  2W4S A;  1TW2 A;  1MDM B;  4E7L A;  3OL3 A;  2KIM A;  4CHU A;  1JGS A;  4I09 A;  1IDY A;  3L00 A;  1JKO C;  4Q5S F;  2XKO A;  3ABM H;  1RNL A;  2FQ3 A;  2L54 A;  3DU6 A;  2ZB9 A;  5F0H A;  1BIA A;  5HDG A;  3A01 A;  1W5C C;  4IF4 A;  2A6H F;  3IH2 A;  4HG2 A;  2JSP A;  4HKU A;  1LJ9 A;  1S6L A;  3DQV C;  5D19 A;  3VW0 A;  3F0C A;  1ETW A;  3HHG A;  2R7W A;  1XDS A;  1Z6T A;  5L3C A;  2XAH A;  1BM9 A;  3H9G A;  4IJA A;  1E3H A;  2WB1 A;  3BQZ A;  2QA4 I;  4DBR A;  1KU3 A;  3VSK A;  5K7H A;  1O3Q A;  4RBO A;  2WBM A;  4JX4 A;  1WSU A;  2ECB A;  4HW0 A;  2HKU A;  5B1B H;  1JKP C;  2A07 F;  2VXD A;  1U5T C;  4UDS A;  2R7V A;  4J00 A;  1FMV A;  4YEJ A;  2OC6 A;  3OR2 C;  4RM3 A;  1BL0 A;  3CJR B;  5ILU A;  1B72 B;  1BOB A;  1HST A;  2BY3 A;  1BC8 C;  3GF2 A;  4LLG F;  3T0Y A;  3FXU A;  4S05 A;  3CLO A;  4AIJ A;  3DTK A;  1OR7 C;  2CO5 A;  1ZR2 A;  1VQL I;  3RQI A;  2QLZ A;  3F23 A;  1PYV A;  4Y3O A;  1IUY A;  1DUX C;  3KFW X;  5HLH A;  1MH4 A;  2EB7 A;  3LSJ A;  2Z2S B;  2E5N A;  3FMS A;  3FXQ A;  4XNF A;  2OAZ A;  3Q0V A;  2JPB A;  3MD2 A;  1V54 H;  5J1Y A;  5TGT A;  1HKT A;  2KRC A;  3OY9 A;  1I1S A;  2RGV A;  3EYY A;  2FU4 A;  4RGU A;  3VTI A;  3TDU C;  2AQE A;  4PGH A;  4LLN A;  3WHB A;  3C2B A;  5K7F A;  4YRV A;  2EA4 A;  4HRI A;  3P5J A;  3SZT A;  2IU5 A;  5HLT A;  5DV5 A;  2BBY A;  1SFK A;  3VEP A;  1UAA A;  3K4L A;  1TTY A;  2HOE A;  4N9H A;  1KQ9 A;  1WHU A;  3AG2 H;  3DEU A;  3LST A;  1IUF A;  3IP4 B;  3KEO A;  2CQ7 A;  5K7Z A;  3OYJ A;  1MBJ A;  3J81 Z;  3FXJ A;  1MH3 A;  1JT0 A;  2F5F A;  2CSO A;  1A31 A;  1ODD A;  3L2Q A;  2CV2 A;  2NP5 A;  3CRJ A;  4RMN A;  1VQK I;  2LSO A;  5LEJ A;  4HF2 A;  1YOV B;  3WG7 H;  2KZV A;  2KKO A;  3GZN B;  3H3U A;  1QVU A;  2L9R A;  3IL2 A;  2K7L A;  1OMI A;  2DA3 A;  1SVO A;  4KT6 A;  2M8E A;  5F6F A;  1RIO H;  3KP6 A;  5EFY A;  2VJJ A;  3IRQ A;  1Z9C A;  2K9M A;  4CUG A;  1FP2 A;  1W4M A;  3RYP A;  2CS3 A;  5ILV A;  2MBF A;  1VI0 A;  4CYC B;  1YX3 A;  5DD8 A;  3MQ0 A;  3BZC A;  3PFI A;  1B59 A;  1R7J A;  4DOZ A;  3RPQ A;  4JKZ A;  2LKP A;  2CW7 A;  1I3Q J;  2CQX A;  3ANP A;  1UFM A;  4M73 A;  2HOA A;  3RYR A;  3ON2 A;  4L62 A;  3I53 A;  3AL0 C;  2FSW A;  2NRA C;  3M8E A;  1YE9 A;  4NQW B;  3E5Q A;  4IKF A;  5FRO A;  4BHP A;  2E7W A;  5EZG A;  1AU7 A;  2Z9O A;  3VOK A;  2IS6 A;  3LJL A;  4F92 B;  1JJ8 C;  2HPI A;  5EEA A;  1RR8 C;  2VOP A;  1BI1 A;  3M1C A;  1QU3 A;  3R6S A;  2MFZ A;  2XGX A;  3LFU A;  4J01 A;  3CO6 C;  2O3F A;  4UVC A;  1FOK A;  1YX5 A;  3MAJ A;  2ZJR F;  3EUH C;  2DA4 A;  2JN6 A;  2CYY A;  3L2C A;  5DM7 F;  4UB6 C;  3G7R A;  4BDY A;  2O5R A;  2H09 A;  1I3A A;  1O7L A;  1R58 A;  2HR3 A;  2K9L A;  3OYM A;  1W0T A;  3AQS A;  5C4Y A;  2R7U A;  1Z91 A;  3KP4 A;  4A0Y A;  3Q9S A;  3G1L A;  1SD7 A;  3S3O A;  4RB1 A;  2K4J A;  3DEW A;  3BG6 A;  3HSF A;  2JSC A;  3GO5 A;  3TL4 X;  1G3S A;  4GCK A;  4LB6 B;  4ANJ A;  1BJZ A;  1HW1 A;  1GXQ A;  2A05 A;  4O6J A;  3W6J B;  3ZQ7 A;  3OYG A;  3GTJ J;  1YJW I;  4V2F A;  5FGM A;  4BHB A;  5J8F A;  4WWC A;  2Z33 A;  5IT9 K;  1V4R A;  4HNT A;  3WTY C;  3HKZ N;  1V5G A;  2KIF A;  2DU9 A;  5GPA A;  2W7N A;  2L2O A;  2E19 A;  3CDH A;  3V8J A;  1N75 A;  2E1C A;  2HQR A;  2EIJ H;  2Z1D A;  3DKW A;  3A1Y A;  1UJ8 A;  1U9N A;  4A3J J;  3NS4 A;  3FX3 A;  2YX7 A;  4ZYH A;  2KL4 A;  4Y17 A;  3TMO A;  1STZ A;  2DFF A;  1MBF A;  1QNT A;  3O60 A;  2BV6 A;  2MAB A;  2AO9 A;  5TIS C;  5FKM A;  3WGI A;  5DTD A;  4A3C J;  4CCJ A;  2CW8 A;  1U0J A;  5F0F A;  1ETK A;  3EET A;  1HBX G;  2HZD A;  2HKX A;  4MHG A;  4IQ4 A;  2M7A A;  4B8X A;  2Q2E A;  2R4G A;  1KQ8 A;  3AKZ A;  3KKC A;  1ETQ A;  3IUV A;  1H9T A;  1W7P B;  1P9Q C;  1T39 A;  2GM4 A;  2NVU B;  2QKM B;  3I4N J;  1T56 A;  4HPQ A;  1HDD C;  2XRL A;  1AA7 A;  2FJI 1;  2DMU A;  1W1W E;  4LK0 F;  1S3J A;  4LB5 A;  1SC7 A;  3FXO A;  2XDN A;  1P7I A;  2WWY A;  3FK6 A;  5E8G A;  1DPR A;  2HNH A;  2RN7 A;  2LD5 A;  2R7Q A;  1LE8 B;  1FMW A;  2X85 A;  5TJJ A;  3VYU B;  1YS6 A;  2LF8 A;  1IC8 A;  2MC3 A;  1MBK A;  4XON A;  2G7S A;  2PMZ N;  2F4M B;  2WTE A;  1TP4 A;  2WC2 A;  2STW A;  1QHH D;  2ELK A;  2QQ9 A;  2F5C A;  2QSG X;  1A35 A;  1QRY A;  2HEO A;  1MND A;  3WG9 A;  1X3Z B;  3CC2 I;  2X6O A;  3GFL A;  5DCM B;  4BKX A;  2EA2 A;  2HVS A;  2W82 A;  4XK4 A;  5DCF A;  1TW3 A;  4GYG A;  1QBJ A;  5J1U A;  2XF6 A;  5B1A H;  4LFU A;  2JTV A;  3G2B A;  2L02 A;  2CG4 A;  3E97 A;  3IHU A;  5F64 A;  1T0F A;  2G7L A;  1T95 A;  1KQ0 A;  3K69 A;  5FMP A;  5CLS A;  3OIO A;  2RHA A;  2XF5 A;  3CQZ J;  3U21 A;  4IX7 A;  2OUM A;  3DBR B;  3TQN A;  4B43 A;  1S9H A;  4E7Z A;  4MTE A;  1QPM A;  2HQ5 A;  4AC0 A;  1R1U A;  2UXI A;  3J80 K;  2Y31 A;  1WFX A;  3VOE A;  2YPR A;  3ZMZ A;  2LNB A;  4L9N A;  4MTD A;  2JA2 A;  4IHW A;  3NNR A;  4QSH A;  2GOM A;  3ZMT A;  3L2R A;  4I6Z A;  3QYB A;  3H0D A;  4RGS A;  4WXD A;  1AWC A;  1UHW A;  1IZ1 A;  4QLC U;  1XB4 A;  4BJ5 C;  3L2U A;  4JNN A;  4IHT A;  3CMY A;  2VB6 A;  1B1B A;  4Q47 A;  3RJP A;  3WTT C;  1QA6 A;  3MMY B;  2VE8 A;  1IXR C;  5KAI C;  4CDG A;  4E4H A;  2QOP A;  1BA5 A;  1HW5 A;  2EQR A;  3QYE A;  2HZT A;  1QVT A;  1OCT C;  1G3T A;  3BQY A;  3CCE I;  4AUX A;  3K0L A;  3EUP A;  3R0A A;  4MEX F;  4GCT A;  1D3Y A;  3KIO A;  1UEL B;  1ZGJ A;  5EF6 A;  2FUG 2;  3PIP F;  4CXF A;  3OS2 A;  2TDX A;  4XLN F;  4YFK F;  4L0Z B;  4A0X A;  3HKZ A;  2R5Z B;  4Y52 J;  1PP7 U;  3VP5 A;  3U2R A;  3HM5 A;  1Y6I A;  2FXA A;  2AXT C;  4OIR F;  4W97 A;  1E0E A;  3BLY A;  1SD4 A;  1B9M A;  1PVE A;  3ZN0 A;  5DS9 A;  2YU9 J;  4I0B A;  2ISZ A;  1HKS A;  1U8R A;  2H6C A;  1AKH B;  3L9F A;  3TO6 A;  2W84 A;  2QQ8 A;  1YG2 A;  4BAC A;  5K58 A;  2E1M C;  2FX0 A;  4JX5 A;  4FIS A;  1IRF A;  2HU9 A;  4BL0 B;  2E2I J;  3G73 A;  2IA1 A;  4C2T A;  5J8C A;  4BYY A;  3I59 A;  3M4O J;  4N4O B;  5K5Q A;  4OD5 A;  4BQO A;  2A68 F;  3FF5 A;  1Z7L A;  2ZBK A;  4G6D A;  1GVJ A;  4OIN F;  4LG0 A;  5D4S A;  2VIX A;  3WU0 A;  3ZMU A;  1ORK A;  3TW7 A;  3TP3 A;  1ZGW A;  3QU3 A;  4RA2 A;  2H94 A;  4I0A A;  3FK7 A;  5H2F C;  1ZH5 A;  2VQC A;  3V8L A;  3H5R A;  3OSF A;  4MFE A;  4OD4 A;  4KIS A;  1S7A A;  1K61 A;  4M3G A;  3KYD B;  3QP6 A;  4C3J J;  5JVT A;  4UUS B;  2COM A;  3LFK A;  3FIW A;  2DN0 A;  3DLA A;  3QPH A;  2JRT A;  3M9A A;  1MSE C;  2DG7 A;  2KLO A;  3HSE A;  1ZRD A;  3P9I A;  5E1W A;  1SEU A;  3SFZ A;  4PSW A;  2Q1Z B;  5BQT A;  4BJ6 C;  1D0Z A;  2XRN A;  3F8N A;  3B6A A;  4M74 A;  2IEK A;  4EMS A;  2EFN A;  4RGR A;  5KK1 A;  3K8P C;  2RVC A;  1LUJ B;  1JJ6 C;  2UXP A;  4OU0 A;  2OU2 A;  1WH7 A;  4AYB N;  4PJJ A;  3E7L A;  1IDZ A;  4AIH A;  2GAU A;  1VQM I;  4OWR B;  5HOO A;  3A01 B;  1O3T A;  1YS7 A;  2O8X A;  4IOA F;  4AID A;  3KNW A;  1BW6 A;  4EGY A;  1CQT A;  4AM3 A;  4A3D J;  2M87 A;  5FHP A;  4CIC A;  1QO0 D;  3FZV A;  3HRU A;  2IRF G;  2R7X A;  5IT9 Z;  4D7M A;  1KZH A;  3RKX A;  1KA8 A;  3U1K A;  4ZJZ A;  4KDP A;  1EJ9 A;  4E7J A;  4BU2 A;  1ETV A;  2W00 A;  1R5H A;  3DP7 A;  2JVG A;  2QCO A;  4DJA A;  2E1O A;  2L0K A;  2VPL A;  4PZJ A;  3PAS A;  4IRV A;  2VJI A;  4AD9 A;  3LQR A;  4KMU X;  3GTQ J;  2YR2 A;  5IP7 J;  2V9V A;  1HC8 A;  2Z99 A;  3OIQ A;  3NAR A;  4UV8 A;  4BY1 J;  2WUI A;  1WH5 A;  3JRG A;  1ZAR A;  3CLQ A;  5KAF C;  4IOC F;  4C2M A;  2V1X A;  4M9S A;  2QWW A;  1XS9 A;  2XUB A;  2DW4 A;  2K02 A;  1RKT A;  5AIP A;  1MMG A;  2EV0 A;  1P6R A;  2PN6 A;  3OOP A;  4HNU A;  4BGD A;  4CCL A;  3PIO F;  3VW2 A;  5J4V A;  3HGY A;  1G3Y A;  1CF7 A;  2B0L A;  2LY1 A;  2DA2 A;  3K4C A;  1XD7 A;  3SWH A;  4BBS J;  4CZC A;  1PP8 F;  4EVI A;  3K1N A;  2QBY A;  2ZXW H;  4HST A;  2GUH A;  2OI8 A;  2EIM H;  3E1S A;  1J7K A;  4ZZL A;  3M8F A;  1MMD A;  3I0T A;  2G3B A;  1SFX A;  2L3D A;  3VFZ A;  2TCT A;  3ML6 A;  4PJM A;  1ZGA A;  4LMY A;  5J1R A;  1D1A A;  2V79 A;  4P55 A;  3TKY A;  1OYI A;  2HXI A;  3NRG A;  1FC3 A;  4UVA A;  2OF7 A;  1VQ7 I;  3ZN1 A;  3JTH A;  3ABU A;  5M3M J;  3FXR A;  2A69 F;  5D8L B;  4A93 J;  1DP3 A;  3VW1 A;  4DBQ A;  3T5X A;  1GHC A;  2P6S A;  2XB5 A;  3LMM A;  2QGU A;  1EA3 A;  3CDL A;  2PI0 A;  1SVL A;  3S1R J;  1DPU A;  3N05 A;  1R71 A;  2ZOY A;  2VJ5 A;  5AON A;  1N25 A;  2CJJ A;  3BR1 A;  3BRO A;  2DAO A;  1SFO J;  3H9Q A;  2NVQ J;  3FMR A;  2JA7 J;  2W85 A;  3HUG A;  2ZC2 A;  5E3O A;  4CGZ A;  3WTS C;  4N0B A;  3HIF A;  2NNY A;  2EZH A;  4L5I A;  3WGG A;  3MVP A;  4W1U A;  2XHK A;  4X0G A;  1FTT A;  2O6G E;  4EM1 A;  4AIK A;  4II2 A;  1MNE A;  2RQQ A;  2XV4 S;  3J80 Z;  5EEH A;  4KT5 C;  1OCP A;  1BJA A;  2D6Y A;  4ZYE A;  1V5F A;  4DZP A;  5C4X J;  1JUP A;  2DXI A;  3BC8 A;  1C0W A;  3QKX A;  1MMA A;  3FKJ A;  3V8K A;  5K1Y A;  2VOD A;  4AVZ A;  4IHS A;  1Y8Q B;  3JRB A;  2R7Z J;  1MBG A;  2ZKZ A;  3VVX A;  2VL8 A;  3G3Z A;  4S0H B;  5EGO B;  4C30 A;  4IO9 F;  1ETO A;  4D5C A;  2LG4 A;  2LBF A;  4KJZ A;  5EEG A;  4ENJ A;  1BIB A;  2XF7 A;  1VF9 A;  3LWF A;  3LA7 A;  2B63 J;  3KP2 A;  4BEH A;  2X1D A;  4ZYA A;  3LSI A;  3LAJ A;  2BW3 A;  1SAX A;  4NEL A;  1W7P D;  3HSR A;  1BN5 A;  3RKQ A;  1IW7 F;  2NVY J;  3RQ4 A;  4L9T A;  4BQA A;  3ZQQ A;  1LDD A;  5JLW A;  4JYK A;  4G8X A;  4M72 A;  3SDB A;  2BZT A;  3DLL F;  1N77 A;  1XDU A;  4E7S A;  2LC2 A;  1BI0 A;  2UXO A;  2O03 A;  1SGM A;  2AQF A;  1USS A;  2DPD A;  1POG A;  2Y9Y A;  5TRD A;  1Y0N A;  3PL8 A;  2IJL A;  4A0Z A;  1OYY A;  3GZ6 A;  2HDC A;  3CWR A;  1XSV A;  4RDU A;  4ZH4 F;  2CRG A;  2HKO A;  3P9K A;  4DW6 A;  2EBI A;  5BS6 A;  3MZ8 A;  3OYK A;  1ZG1 A;  3X2Q H;  2ZY9 A;  3DBH B;  4G7Z F;  1YHQ I;  1SAN A;  3MN2 A;  2O0Y A;  4ACI A;  2B9S A;  4LLL A;  3QYF A;  4ZDO A;  3RI4 A;  4KIF A;  1J59 A;  3LSM A;  3MWM A;  2K9S A;  3O8G A;  2HTJ A;  3F72 A;  4PSX A;  2V1N A;  4XR6 A;  3ZMS A;  2KT0 A;  2RAE A;  1TNT A;  3B6C A;  3RCO A;  4A2U A;  3PNT A;  1Y8R B;  5FKK A;  2AXL A;  3K4B A;  2P5L C;  2XGD A;  2DFE A;  3PSF A;  1J09 A;  4NNJ A;  2LVS A;  2ZNY A;  3BTC A;  3DKX A;  1U9O A;  3BJA A;  3JAM K;  2P5K A;  3BTJ A;  1VZ0 A;  5D5W B;  3G71 I;  4NC6 A;  4IHY A;  2NYX A;  1UZC A;  1X3W B;  3DWL E;  2E2J J;  2FEZ A;  4ETS A;  1Z3X A;  5HVQ C;  3CCS I;  3QQA A;  1XN7 A;  4XRS G;  3IRR A;  1A5J A;  4PK4 A;  2KJB A;  3S14 J;  1LVA A;  2G0E A;  2MYS A;  3SXY A;  4HBL A;  5FJ8 J;  1Z0X A;  4I7H A;  2MH9 A;  2CV0 A;  3E6C C;  2K5C A;  1G4D A;  2DJI A;  2Q2E B;  3ON4 A;  2ZME B;  2M7B A;  2V9K A;  3HE0 A;  5JLX A;  3C3W A;  2IGN A;  4F52 A;  3ZCO A;  4F93 B;  1D8J A;  4M9X A;  5GTH C;  3RD3 A;  4JK1 X;  1BI2 A;  2ZFU A;  5DM6 F;  4BXU A;  4UY8 I;  3JSJ A;  5FLM J;  3KZI C;  4DYR A;  1F5T A;  1HA8 A;  1H89 C;  3PFY A;  2EPF A;  3A4C A;  1S72 I;  3F8B A;  3CP2 A;  2KDZ A;  2D2W A;  2KMU A;  1ZKG A;  2NVT J;  1SMT A;  2D45 A;  4RB2 C;  3GEU A;  1FLI A;  2V6E A;  4N9I A;  3Q9V A;  2DA5 A;  2ZOZ A;  3E6M A;  1M1E B;  1FYM A;  4LG3 A;  2V4J C;  4PXI A;  2X6Y A;  3HTJ A;  2VBW A;  2P5V A;  3K4N A;  4XN0 A;  1D0X A;  2PX9 A;  5ILS A;  3PPB A;  4EV0 A;  1JUS A;  1ZHF A;  3K2Z A;  3DF8 A;  4U9N A;  4C2U A;  1WKM A;  3KYC B;  2XAF A;  3K2A A;  4XOT A;  4HDV A;  3IWF A;  2XPU A;  2P6T A;  2CMP A;  3QOE A;  4F55 A;  3BR5 A;  1D1C A;  4BAY A;  5J6X A;  4AVP A;  3ZQI A;  1I1G A;  3ZQG A;  4A6E A;  3GZ5 A;  3QPL A;  3GTL J;  1OJL A;  4RAY A;  6PAX A;  4HAM A;  4HYE A;  2W53 A;  2YX4 A;  3CF5 F;  4ASN A;  1IRZ A;  2HVR A;  3VWB A;  4F91 B;  2QM3 A;  5LGN A;  2H8R A;  2NXN B;  3CCJ I;  5CVI A;  1T8I A;  2NNN A;  2FRH A;  1XC5 A;  3S15 J;  2WY7 Q;  1S8N A;  2DT5 A;  4QTR A;  1LQ1 A;  3CUO A;  3E5X A;  2H1L A;  3EPZ A;  2GIV A;  4LOC A;  4KIC A;  3HRT A;  5HSZ A;  5BPI A;  1WJF A;  2VE9 A;  2DTR A;  1S7O A;  1XX5 A;  1T98 A;  2KIQ A;  3IAS 2;  2GXA A;  3BRU A;  2FML A;  1WJD A;  3VB2 A;  2BY2 A;  3H92 A;  3GTO J;  5IOZ A;  4PFO A;  1ZG3 A;  1K78 A;  4L0Y B;  4P96 A;  1ZQ3 P;  2DFH A;  3BCB A;  2CFO A;  3KYL A;  3VOX A;  3WGH A;  3HGG A;  5CVV A;  1GVD A;  2X1C A;  2L7Z A;  5AQC A;  1R1T A;  2KRH A;  1PUE E;  4GFB A;  3W6V A;  3BTI A;  2EZK A;  4RB0 A;  1JUM A;  1WWX A;  3O8H A;  4DZJ A;  5LRR A;  4XOR A;  4WCG A;  1NK2 P;  5DEQ A;  3CUQ A;  2E36 A;  4II3 A;  1U2W A;  2LH9 A;  3OYI A;  2DCE A;  4F3Q A;  1HOM A;  5HNH A;  5D6F A;  1T2K A;  4ZYG A;  3LWJ A;  1OIS A;  1Q1H A;  4IRG A;  1YQA A;  1RUO A;  2EFO A;  3V7C A;  1D5Y A;  4CYD A;  2EV5 A;  1APL C;  1I5Z A;  1O57 A;  2EIN H;  2M2E A;  3G4S I;  1HW2 A;  5E3N A;  3ZPL A;  5H20 A;  4OIQ F;  3K9T A;  2XPW A;  3RSN A;  1NTC A;  2Q0O A;  3A0B C;  1OPC A;  1XTA A;  3BG3 A;  4EJO A;  3G56 A;  3KZZ A;  2DG8 A;  5EZH A;  2V6C A;  2O7T A;  3W2A A;  1BI3 A;  4M71 A;  5FD5 A;  1IXS B;  4L9V A;  3ASO H;  3JCU C;  2FNP A;  3D5L A;  3ISP A;  2CQK A;  2Z3Y A;  4WX9 A;  2DTZ A;  1HQC A;  5FD6 A;  1R6R A;  3I59 B;  2REK A;  4Z2Y A;  2TRT A;  5B3S H;  3S1Q J;  1FSH A;  2K86 A;  3JSO A;  3HOZ J;  1RPW A;  3F1B A;  2W57 A;  3BY6 A;  3QP5 A;  3ZQH A;  3DXJ F;  2MLK A;  4ESJ A;  3FM5 A;  4LG0 B;  4DYC A;  3KX2 A;  2VT2 A;  3CCR I;  2E5Z A;  4BUP A;  3CZ6 A;  1YW8 A;  2FMY A;  3K7A J;  1ZLK A;  1VQ9 I;  2WAD A;  3H35 A;  1A04 A;  3H0G J;  2DMP A;  3AG4 H;  2LF7 A;  2DOF A;  4IHV A;  4EM2 A;  2W1O A;  4G9Y A;  2YVX A;  1EH6 A;  3ECO A;  1TBX A;  2CV1 A;  1IRX A;  1VQ5 I;  4B48 A;  2A5Y B;  3LA3 A;  4FT8 A;  3HTS B;  4RLF A;  1Y1W J;  1FWZ A;  5DDG A;  4YEL A;  4IHX A;  1JXS A;  4XL9 A;  1LPQ A;  3HIM A;  2BXY A;  5JI6 A;  3R0J A;  2JVH A;  3EDP A;  1PUF A;  2X6W A;  4JL3 A;  3DU5 A;  3EUA A;  2COB A;  2K27 A;  3K1M A;  3CCM I;  3IUO A;  4M3B A;  4BHC A;  1J75 A;  5FO5 A;  3GYH X;  5LHG A;  1F1Z A;  2LDU A;  2VAS A;  5HLI A;  2OER A;  3TO9 A;  3ZXS A;  1ZN2 A;  5C44 J;  3HC7 A;  5GAE J;  1ZRE A;  2LY9 A;  4ZTJ A;  2R5Y A;  1FZP B;  3E0J B;  3RH2 A;  3BP8 A;  4EJW A;  1B8I A;  4MNU A;  1H8A C;  3H3Z A;  1X3U A;  2JQ7 A;  3JSP A;  5CPR B;  3JAM Z;  1BBY A;  1SVM A;  3JRE A;  2M34 A;  2EV6 A;  1P2F A;  2HWV A;  1FP1 D;  1R36 A;  5LLQ A;  4D9J A;  2ISY A;  3COA C;  2QZ8 A;  1A6Q A;  2GZW A;  3CME I;  4MXM A;  4UB8 C;  1O7F A;  3LNQ A;  4A3G J;  1TZL A;  2F6C A;  3KEQ A;  1R23 A;  3KP5 A;  4JP0 A;  5K5O A;  1RRJ A;  1HLV A;  1CF7 B;  1FIA A;  2X1E A;  4BE2 A;  5D6E A;  4Y13 A;  4DVY P;  2RV8 A;  2DBB A;  4BH9 A;  4GRI A;  2E1N A;  5FFX A;  2A2F X;  4EGZ A;  3OYA A;  2OQR A;  2QBY B;  3P9T A;  2IGO A;  3FIS A;  2HOS A;  3RDI A;  2IA0 A;  4OIO F;  2DLL A;  4RS8 A;  4UVB A;  4MK6 A;  3HOT A;  1FBU A;  2LFB A;  3L1P A;  1TT0 A;  3Q5F A;  4DQ2 A;  1EH8 A;  1X1P A;  2DQL A;  2PBI A;  1MZB A;  1LFP A;  2VKH A;  5GPC A;  3WTW C;  4KNY A;  3PJR A;  1RKW A;  3OIP A;  2A6E F;  2QSH X;  2IPQ X;  4IRI A;  2MA3 A;  2LKX A;  2DA6 A;  2I10 A;  1LFU P;  3K70 D;  3FDY A;  3ZR8 X;  5L3G A;  2IT0 A;  3FMQ A;  3KP7 A;  3VYS B;  2I5U A;  5CVR A;  1OLT A;  2CUZ A;  3BHQ A;  2GIZ A;  3F21 A;  1ETX A;  2JJ7 A;  4XM3 A;  3N97 A;  1I50 J;  4Z6Y A;  2MH2 A;  1VND A;  2RNJ A;  1K4T A;  4FX4 A;  3F6O A;  4ZC3 A;  2HYF A;  1WJE A;  3CF2 A;  3SEQ A;  3HUG B;  3LAP A;  4DGW B;  5EDN A;  2NAZ A;  3I54 A;  3OWT A;  3F8M A;  1D1B A;  4NB5 A;  1N78 A;  2KQR A;  5HS9 A;  3MEX A;  4WK8 F;  1XMK A;  2WV0 A;  4XID A;  4F7Z A;  5A2Q K;  5E3M A;  2Y9Z A;  5FLX K;  4CCN A;  4M9Z A;  3E7Q A;  4YII A;  2FE3 A;  2IXS A;  4PJ0 C;  4H0E A;  1TQM A;  4C3I J;  1O4X A;  2PMH A;  4LIU A;  4XLH A;  1IN8 A;  1U78 A;  1UI6 A;  4ZDP A;  2ESN A;  4JQF A;  3L2W A;  2RRE A;  1J2X A;  2HVQ A;  3W3C A;  2OD5 A;  1PJR A;  4N4N B;  4EAT A;  1JTY A;  2NS0 A;  1Z1D A;  4BNC A;  4HX8 A;  1FT9 A;  4IRH A;  3GLL A;  5BMZ A;  1HKQ A;  2DJN A;  2XGE A;  1EH7 A;  2XDV A;  2QKO A;  2NOJ B;  2DDB A;  4GO1 A;  1LB2 A;  3PM1 A;  4NUB A;  4HNV A;  4A3M J;  4YIF A;  2PQ8 A;  3L09 A;  4BEH B;  3HTH A;  4FHT A;  2YVH A;  4BXF A;  2UUZ A;  1IN4 A;  4EM0 B;  1S5L C;  2RNG A;  2BW3 B;  4HDU A;  2KFD A;  3B02 A;  3F9K A;  4EEF G;  4A3E J;  5M3F J;  4OMY A;  1FTZ A;  2UXU A;  2V7F A;  4M6V A;  4XBF A;  1KU2 A;  4EJV A;  3ELK A;  5DUK A;  1DGR M;  3VDX A;  1BOA A;  3GVA A;  1LVK A;  3T6N A;  2MW8 A;  5IYD J;  2PZ9 A;  3I64 A;  3HL2 A;  3BDD A;  2K4B A;  3I4M J;  3BPX A; 
#chains in the Genus database with same CATH homology
 4W1U A;  1FTT A;  1MH4 A;  3S1N J;  3LSJ A;  3JRD A;  2HYT A;  1FIP A;  3Q0V A;  3Q3S A;  1YRN A;  1GUU A;  3UKG A;  3KKD A;  4V2G A;  3B81 A;  2G7G A;  5J1Y A;  4AC6 A;  1OCP A;  1ZK8 A;  2WAQ N;  5D18 A;  2D6Y A;  1X58 A;  3JR9 A;  4DZP A;  5C4X J;  1JUP A;  2FQ4 A;  2NVX J;  3QKX A;  4BBR J;  5CW8 A;  1IV6 A;  3IH3 A;  3JRB A;  1FEX A;  2R7Z J;  3JRC A;  1MBG A;  3VVX A;  3WHB A;  2EZI A;  3C2B A;  4JX6 A;  5K7F A;  4S0H B;  5EGO B;  2IU5 A;  3TED A;  5GP9 A;  1ETO A;  3HOY J;  3RZO J;  1MNM C;  4BY7 J;  4D5C A;  1IUF A;  1RET A;  3HDD A;  3S2D J;  1X2M A;  1DU6 A;  1VF9 A;  2ZCX A;  5K7Z A;  4MFD A;  2B63 J;  1MBJ A;  3GTK J;  3M3Y J;  1MH3 A;  4G12 A;  4X1E A;  1JT0 A;  2VPR A;  4NEL A;  2WV1 A;  1DU0 A;  3DCF A;  2NP5 A;  3RKQ A;  2NVY J;  1B72 A;  3CRJ A;  2K9Q A;  5JLW A;  4JYK A;  4FE4 A;  2UXO A;  5HAW A;  1SGM A;  1POG A;  2Y9Y A;  2RAS A;  3CWR A;  1QVU A;  2L9R A;  4RDU A;  4D7N A;  2DA3 A;  2CRG A;  4MO7 A;  4DW6 A;  1T33 A;  4QIW N;  2EBI A;  1MSF C;  4AF5 A;  5EFY A;  1AHD P;  2H1K A;  4MLO A;  1SAN A;  3MN2 A;  3A02 A;  4M3E A;  5DAJ A;  4ACI A;  3RZD J;  5C4J J;  1W0U A;  4I76 A;  1H88 C;  2R93 J;  1TWA J;  3JRI A;  5HOD A;  2GLO A;  1GT0 C;  1VI0 A;  4CYC B;  2CQQ A;  2K9S A;  1JTX A;  4MIM A;  3O8G A;  5EYR A;  2HDD A;  1JKQ C;  1TC3 C;  2KT0 A;  2RAE A;  3B6C A;  4JKZ A;  3Q0W A;  1XG1 A;  2V57 A;  1I3Q J;  2CQX A;  1ZR4 A;  5FKK A;  3SFI A;  3ANP A;  3S5R A;  3HTA A;  2HOA A;  3ON2 A;  4L62 A;  2XGD A;  5IP9 J;  2LVS A;  3ZOB A;  3BTC A;  1U9O A;  5FGL A;  3BCG A;  3BTJ A;  1UI5 A;  4ME9 A;  1AU7 A;  5EZG A;  4IHY A;  3VOK A;  2VI6 A;  5BNG A;  3LJL A;  1JJ8 C;  5EEA A;  2E2J J;  4GCL A;  3QQA A;  5F27 A;  4XRS G;  1A5J A;  1WCM J;  4ABZ A;  3IV5 A;  2D5V A;  3S14 J;  2G0E A;  3AQT A;  5FJ8 J;  1E3O C;  1LE8 A;  1Z0X A;  3KZ9 A;  2ME0 A;  2DMT A;  2DA4 A;  2DA7 A;  2HYJ A;  2IAI A;  2JN6 A;  1QPI A;  3BT9 A;  3ON4 A;  3G7R A;  3HE0 A;  5JLX A;  2PBX A;  2MG4 A;  5M5Y J;  3RD3 A;  4XIC A;  4A3K J;  3BNI A;  1W0T A;  3AQS A;  1MBE A;  3JSJ A;  1OFC X;  5FLM J;  4DYR A;  9ANT A;  3A03 A;  5C4Y A;  1H89 C;  4XRS A;  1R9T J;  3G1L A;  2L7F P;  2QF7 A;  3DEW A;  2NS8 A;  2KDZ A;  1ZKG A;  2M0C A;  2NVT J;  2O8K A;  3GEU A;  4GCK A;  4A69 C;  2DA5 A;  2ZOZ A;  2OPT A;  4XRM A;  3GTJ J;  1BJZ A;  4PXI A;  3HTJ A;  4V2F A;  4CYC A;  2HOT A;  2ME6 A;  1WPK A;  2ID6 A;  3NI7 A;  3BG5 A;  3PPB A;  3HKZ N;  1A6I A;  1JUS A;  5IYC J;  3LSR A;  5GPA A;  3GTM J;  2E19 A;  1LFB A;  3CCY A;  3K2A A;  4X6A J;  3TP0 A;  2XPU A;  4A3J J;  1U9N A;  2NP3 A;  3MKL A;  4J19 A;  3BR5 A;  5CXG A;  3G1O A;  3ZQI A;  1MBF A;  3NXC A;  3ZQG A;  3SDG A;  3QPL A;  3GTL J;  3O60 A;  1OJL A;  2AO9 A;  4B3A A;  2E2H J;  3VVY A;  5FKM A;  2Q24 A;  5DTD A;  1ZTR A;  5IP6 A;  2M9H A;  4A3C J;  2W53 A;  1IRZ A;  2FJ1 A;  5C3E J;  3BR0 A;  5F0F A;  2H8R A;  1ETK A;  1TWF J;  2MSY A;  2X9D A;  2GFN A;  4CGR A;  4ICH A;  2VKV A;  2NX4 A;  3KKC A;  1XC5 A;  1IG7 A;  3S15 J;  1ETQ A;  3IUV A;  4QTR A;  1VFC A;  2GM4 A;  2O9L A;  4LOC A;  5HSZ A;  3I4N J;  1T56 A;  1HDD C;  2XRL A;  3ZQF A;  2DMU A;  2XDN A;  1P7I A;  3FK6 A;  3BRU A;  3IH4 A;  5EG0 B;  3GTO J;  5IOZ A;  2XGC A;  4L5E A;  2LD5 A;  3VIB A;  5CXI A;  2VUM J;  1LE8 B;  5E3L A;  1ZQ3 P;  1IC8 A;  1MBK A;  2L7M P;  3VOX A;  2G7S A;  3HGG A;  1GVD A;  2PMZ N;  2L7Z A;  1WGX A;  4GFB A;  1BW5 A;  1UMQ A;  5AQC A;  3W6V A;  3BTI A;  2EZK A;  3VPR A;  2ELK A;  2XPV A;  1JUM A;  2JA8 J;  1F43 A;  3O8H A;  4DZJ A;  1QRY A;  1NK2 P;  5F04 A;  5H9T A;  2X6O A;  4C2M J;  1UHS A;  4BKX A;  1JKR C;  3FKI J;  4XK4 A;  1IGN A;  1IJW C;  1HOM A;  3OSG A;  4B1R A;  5M5X J;  2R0Q C;  5J1U A;  2XSD C;  2GEN A;  1WI3 A;  1Y1V J;  3LWJ A;  3NPI A;  4GFK A;  3QBM A;  1D5Y A;  2G7L A;  3NAU A;  5FMP A;  2ID3 A;  3ZQC A;  1APL C;  2M2E A;  1P7J A;  2HI3 A;  3OIO A;  5E3N A;  2RHA A;  3I4M J;  3CQZ J;  2XPW A;  1NTC A;  3WHC A;  3BG3 A;  1PUF B;  4AC0 A;  2HQ5 A;  3BJB A;  2DG8 A;  2UXI A;  1ETY A;  3G56 A;  2Y31 A;  5EZH A;  1RES A;  2O7T A;  2GBY A;  2NS7 A;  4IHW A;  3NNR A;  4QSH A;  3PO3 J;  3JRH A;  4I6Z A;  2WGB A;  2DTZ A;  5EG0 A;  1Z77 A;  2REK A;  2TRT A;  1ENH A;  5IYB J;  3S1Q J;  1EF4 A;  3HOZ J;  2Y0S N;  1RPW A;  3F1B A;  3ZQH A;  1S7E A;  3HOU J;  4JNN A;  3CMY A;  5FKO A;  4DYC A;  3D1N I;  3HB9 A;  4Y7N J;  1B8I B;  3GBG A;  2LP0 A;  2UXH A;  2O7O A;  3K7A J;  1X2N A;  2F07 A;  5F0C A;  5IPA A;  2IBD A;  2QOP A;  1BA5 A;  1GV2 A;  3H0G J;  2EQR A;  2DMP A;  2R92 J;  3MNL A;  4NDL A;  1QVT A;  2LR8 A;  4GFL A;  3BR2 A;  1OCT C;  3BQY A;  3LOC A;  4IHV A;  4AUX A;  3EUP A;  1GV5 A;  4GCT A;  5EF6 A;  2X48 A;  4Y52 J;  2JK3 A;  3VP5 A;  2R5Z B;  4A3F J;  3HM5 A;  4IHX A;  1Y1W J;  4W97 A;  3HIM A;  1F36 A;  2WB1 N;  4IEJ A;  1MBH A;  1G2H A;  5IOY A;  5DS9 A;  2YU9 J;  3DPJ A;  2QTQ A;  1PUF A;  3TW6 A;  1AKH B;  4JL3 A;  1K83 J;  2N8G A;  2FD5 A;  2COB A;  5K58 A;  2FX0 A;  4M3B A;  3LHQ A;  4JX5 A;  4FIS A;  2E2I J;  3COL A;  2CUE A;  5FLV A;  3S2H J;  2OER A;  1TWC J;  3GZI A;  5C44 J;  1GDT A;  3M4O J;  2LY9 A;  4BXX J;  2R5Y A;  2LTP A;  3HOX J;  2JA5 J;  3RH2 A;  2K40 A;  3HBL A;  3BG9 A;  3PO2 J;  1ORK A;  3TW7 A;  1B8I A;  3TP3 A;  4NN1 A;  3FRQ A;  1H8A C;  3ZQL A;  1TWH J;  4A3L J;  1ZGW A;  5M5W J;  3FK7 A;  2Y30 A;  2Y2Z A;  3OSF A;  4MFE A;  3JRE A;  2M34 A;  4A3I J;  2YVE A;  3ANG A;  3JRF A;  1K61 A;  4M3G A;  2QIB A;  3S1M J;  4C3J J;  4UUS B;  5FKL A;  4D5F A;  3FIW A;  4M3D A;  2DN0 A;  2MGQ A;  4YZE A;  2EZL A;  4M3F A;  5FKN A;  3QPS A;  1MSE C;  1Q1V A;  4MXM A;  2DG7 A;  2JWT A;  3LNQ A;  1HF0 A;  2R5Z A;  2YUS A;  4A3G J;  3OOU A;  4JP0 A;  1HLV A;  1HCR A;  1FIA A;  2ECC A;  2M8G X;  2NOG A;  3B6A A;  2IEK A;  1JJ6 C;  1AKH A;  2UXP A;  3P9T A;  1I6H J;  1WH7 A;  4AYB N;  2JA6 J;  3E7L A;  1IDZ A;  3FIS A;  3G1M A;  2HOS A;  4B4C A;  4MK6 A;  2LFB A;  3L1P A;  3A01 B;  1U8B A;  1JGG A;  1UG2 A;  3KNW A;  2EH3 A;  1BW6 A;  3LSG A;  1CQT A;  3HOW J;  4A3D J;  2DMN A;  5GPC A;  5FHP A;  4C3H J;  3CJD A;  4UUT A;  4D7M A;  3GTP J;  1RKW A;  4FCY A;  1FJL A;  5HBU A;  1ETV A;  3GTG J;  3S16 J;  3Q0U A;  2LKX A;  2QCO A;  2DA6 A;  2E1O A;  2L0K A;  2I10 A;  1LFU P;  3PAS A;  1JT6 A;  5F08 A;  2LLK A;  3GTQ J;  3S17 J;  5IP7 J;  3BHQ A;  3NAR A;  2ZCN A;  1ETX A;  2JJ7 A;  4BY1 J;  2WUI A;  3C07 A;  1WH5 A;  5D1R A;  1I50 J;  3BR6 A;  3JRG A;  3BR3 A;  2VKE A;  1VND A;  1XS9 A;  2FBQ A;  4UUS A;  1ITY A;  1RKT A;  1TWG J;  2R5Y B;  2YS9 A;  3EGQ A;  5EDN A;  3H3V K;  2CU7 A;  2W48 A;  3HOV J;  2DMQ A;  3VW2 A;  5EGO A;  3HGY A;  3SJM A;  3VUQ A;  5F1J A;  4A3B J;  2DA1 A;  2HXO A;  4XID A;  2DA2 A;  4FE7 A;  5E3M A;  1YRN B;  4BBS J;  2Y9Z A;  2ZCM A;  2XB0 X;  3E7Q A;  3BTL A;  1HDP A;  1IDY A;  1JKO C;  2GUH A;  4C3I J;  2OI8 A;  1RR7 A;  1O4X A;  1U78 A;  1UI6 A;  2ZB9 A;  5F0H A;  3A01 A;  2CUF A;  2G3B A;  3IH2 A;  4HKU A;  2TCT A;  2QWT A;  5D19 A;  3VW0 A;  3F0C A;  1JTY A;  2P81 A;  1ETW A;  5J1R A;  2K9N A;  2HXI A;  4DYQ A;  3NRG A;  2DJN A;  2XGE A;  3V78 A;  2OF7 A;  2QKO A;  3BQZ A;  5K7H A;  4RBO A;  3PM1 A;  4HNV A;  4A3M J;  5M3M J;  4JX4 A;  2ECB A;  2HKU A;  2LK2 A;  1JKP C;  4UDS A;  3JRA A;  3HTH A;  3HEF A;  4A93 J;  3HTI A;  1NK3 P;  3VW1 A;  2YVH A;  4FTH A;  2JMW A;  3LSP A;  5J3L A;  2XB5 A;  3CDL A;  1BL0 A;  4EEF G;  4A3E J;  3S1R J;  3VVZ A;  1B72 B;  2ZOY A;  5M3F J;  2UXU A;  1FTZ A;  4M6V A;  3BR1 A;  2CJJ A;  1SFO J;  4KWA A;  2NVQ J;  2JA7 J;  3T6N A;  2MW8 A;  5IYD J;  2PZ9 A;  3V6G A;  2AHQ A;  5E3O A;  1ZR2 A;  2EZH A;  3RQI A;  3MVP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...