3WHCA

Crystal structure of a transcriptional regulator fadr from bacillus subtilis in complex with stearoyl-coa
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
190
structure length
190
Chain Sequence
KRPKYMQIIDAAVEVIAENGYHQSQVSKIAKQAGVADGTIYLYFKNKEDILISLFKEKMGQFIERMEEDIKEKATAKEKLALVISKHFSLLAGDHNLAIVTQLELRQSNLELRQKINEILKGYLNILDGILTEGIQSGEIKEGLDVRLARQMIFGTIDETVTTWVMNDQKYDLVALSNSVLELLVSGIHN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of a ligand-bound form of Bacillus subtilis FadR involved in the regulation of fatty acid degradation.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription
molecule keywords Fatty acid metabolism regulator protein
total genus 77
structure length 190
sequence length 190
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08359 TetR_C_4 YsiA-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3whcA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3whcA02
2HXIA 3D1NI 2JK3A 3LSJA 5F27A 3GEUA 3H0GJ 3T6NA 3BTJA 2D5VA 2O7OA 3RH2A 1AU7A 1UMQA 1DU0A 1JJ6C 2XB5A 5HSZA 1UG2A 5JLXA 4S0HB 2ECBA 3IH3A 5D1RA 5EGOA 1NK3P 5BNGA 1TWHJ 1WGXA 2QCOA 3VW2A 2RHAA 4CYCB 1W0UA 1HOMA 2G7LA 2TRTA 5F0FA 1WH7A 1IGNA 2HI3A 3M3YJ 2AHQA 1RESA 1TC3C 3HOVJ 2EBIA 2DA1A 2E2IJ 2DA2A 4X1EA 5FKMA 3S2HJ 1SGMA 3GTGJ 4HNVA 1MBGA 1HF0A 2ZCXA 1JKOC 2NP5A 5EF6A 2XB0X 3BG9A 2LTPA 5IOYA 2XDNA 3F0CA 1HDPA 1P7IA 3BR0A 3GTOJ 5DTDA 2OPTA 5C4YA 1Z77A 2XGDA 4NN1A 3V78A 3MN2A 2ME6A 2NVQJ 3NAUA 1SFOJ 2B63J 3S1QJ 2RASA 1CQTA 4EEFG 2QTQA 1JKPC 2M2EA 2V57A 2VPRA 3DEWA 1ETYA 4I76A 2CUFA 4DYCA 2LFBA 1FEXA 3HOWJ 3K7AJ 2FJ1A 1R9TJ 3GZIA 3ZQFA 3BR2A 1IDYA 3F1BA 3S5RA 2RAEA 1BW6A 2MSYA 5C4JJ 4MIMA 3HOXJ 1AHDP 1WCMJ 2H1KA 3S14J 5AQCA 1H88C 3IH4A 5FHPA 1TWGJ 2L7FP 2I10A 3S1RJ 2YUSA 3RQIA 3KZ9A 2L9RA 5FKKA 4M6VA 3TW7A 2LD5A 2LY9A 4X6AJ 3HTHA 1MBHA 3G1LA 1Z0XA 3S1MJ 4CYCA 1QPIA 4M3FA 2WV1A 5E3OA 2Y9ZA 3LHQA 4C3IJ 3BQYA 3A01A 1WI3A 1ZK8A 2NS8A 2QF7A 2P81A 4IHVA 3PM1A 1I50J 2GUHA 3B6CA 1RETA 4XRMA 3BR6A 4MO7A 4AC6A 3RKQA 5K7FA 5M3FJ 1HDDC 2G7SA 1YRNA 1IV6A 3LJLA 2LK2A 2R7ZJ 3C07A 3Q0VA 4JX4A 3Q0UA 1ORKA 3NPIA 5EG0B 1ETXA 4YZEA 5IP9J 2NVTJ 3CJDA 2K40A 1MBJA 3G56A 3IH2A 2GLOA 3QPSA 1DU6A 1VI0A 3ZQIA 4GCLA 4BBSJ 5CW8A 2DA5A 3OSFA 4CGRA 1ZR4A 2L0KA 1RKWA 5IP6A 4A3IJ 1B72A 3CCYA 2JA8J 2EZHA 5IP7J 2QIBA 1JKRC 5C4XJ 2HQ5A 2F07A 3NRGA 3KNWA 3CMYA 2R5YA 2MW8A 2M9HA 2IBDA 2WAQN 4W97A 3BRUA 3VVZA 3BG5A 5J1UA 2DN0A 5IPAA 2EZLA 3CDLA 2OERA 3BNIA 2NS7A 3H3VK 2YVHA 2JMWA 2O9LA 3HM5A 2CQXA 3ZQCA 1X58A 3BG3A 2UXIA 2Y9YA 5E3LA 3MVPA 3BJBA 2G3BA 5F04A 3BT9A 4GFBA 3HTAA 3FISA 4FE7A 2DMTA 5E3MA 4C3JJ 1MNMC 4A3GJ 1RPWA 5HBUA 2K9QA 5FLMJ 4A93J 1SANA 1BW5A 3HB9A 2LLKA 3CWRA 2XGEA 4L5EA 5D19A 3GTQJ 3A01B 2R5ZB 4JKZA 2NVXJ 3L1PA 5IOZA 3EGQA 3RZOJ 3HOZJ 1FIPA 2IAIA 2L7MP 4UUSB 1JTXA 4IHWA 3PPBA 4D5FA 2DMNA 4MFDA 2Y0SN 1W0TA 2M8GX 3VW0A 1IJWC 4DYQA 1YRNB 2EQRA 4BY7J 4JX6A 4D5CA 1JT0A 5IYBJ 1O4XA 4C2MJ 4A3LJ 2REKA 1T56A 4BXXJ 3ANPA 2E2HJ 1ITYA 3G1MA 3HBLA 2VUMJ 2CRGA 4A3FJ 4A69C 1GV2A 2TCTA 3GTMJ 2CQQA 2EZIA 4W1UA 2NP3A 1MH3A 1IC8A 2DA6A 4MXMA 3COLA 2X6OA 3EUPA 5CXIA 2KT0A 3JSJA 2X9DA 4NDLA 1FJLA 3BQZA 4A3DJ 2OF7A 3VUQA 3PO2J 2DTZA 5FLVA 1ZKGA 2Y30A 5EGOB 3RZDJ 2NX4A 1PUFB 9ANTA 1B8IB 1Q1VA 1Y1VJ 2H8RA 4GCKA 3FRQA 1UHSA 1ZQ3P 2DMPA 4JP0A 1APLC 3JR9A 1IUFA 3HGYA 3BTCA 2ZCNA 5K7ZA 3S1NJ 2W48A 3GTLJ 1ENHA 2O7TA 2HOTA 2LR8A 5C3EJ 1U9OA 3GTPJ 4B1RA 1JT6A 4A3EJ 2X48A 2CUEA 4JNNA 4IHXA 3S15J 1WH5A 2UXUA 1EF4A 2MGQA 2GFNA 3LSGA 3VVYA 5M5YJ 1QVUA 3GBGA 1F36A 5GP9A 4ABZA 1F43A 1H89C 2R5ZA 2ZB9A 2FQ4A 5D18A 5EFYA 2ME0A 3HGGA 4A3JJ 4UUSA 4XIDA 3BHQA 2FX0A 3VOKA 1JTYA 2UXOA 1ETOA 2HXOA 3E7LA 3QBMA 3MKLA 4Y52J 3O8GA 3O60A 3JRIA 1T33A 3WHBA 2G0EA 1MSFC 5DS9A 1NTCA 3JRHA 1VFCA 1FIAA 2UXHA 4M3GA 1IG7A 3MNLA 3G1OA 1U78A 4L62A 1XC5A 2GBYA 2XSDC 2AO9A 4DZJA 3CQZJ 2XGCA 4BY1J 4V2FA 5J1RA 3NNRA 1ETVA 3VIBA 1U9NA 2E1OA 3SJMA 2PMZN 1XG1A 4AYBN 5IYDJ 2WUIA 5K58A 2JA7J 1MH4A 3ANGA 3NXCA 2K9NA 5M3MJ 3RD3A 1NK2P 3Q3SA 2UXPA 1BL0A 5EEAA 2DJNA 3WHCA 2YVEA 1FTZA 2LP0A 3ZQGA 3ZQHA 1UI6A 1OCTC 1LFUP 1ZGWA 4M3EA 5CXGA 1K83J 4FISA 3LOCA 3IV5A 2VKVA 2HKUA 3LSPA 4GFKA 4PXIA 3BR1A 5EG0A 1GUUA 1IRZA 4MFEA 5H9TA 4B3AA 5C44J 5HODA 1Y1WJ 3QKXA 4AUXA 3QPLA 3TEDA 3TP3A 3HE0A 3A03A 1GVDA 3VW1A 2HYJA 3O8HA 3HTIA 4ME9A 2ID3A 2HDDA 2JN6A 3JRCA 1UI5A 2MG4A 4B4CA 1VF9A 2Y2ZA 2R5YB 3JRBA 2CU7A 4BBRJ 2FBQA 3DPJA 1A5JA 2M34A 2HOAA 4D7NA 3HTJA 2E19A 4JYKA 1JUMA 1XS9A 3JRGA 2O8KA 2M0CA 3HOUJ 1HCRA 2ZOZA 3AQSA 4UUTA 4JL3A 5EYRA 1I3QJ 3IUVA 2JA6J 2IEKA 2HOSA 2Y31A 1JUSA 4AC0A 5M5WJ 1E3OC 3W6VA 3JRFA 2R93J 1LE8A 3G7RA 4NELA 3HEFA 1TWAJ 3B6AA 4JX5A 2VKEA 3V6GA 1A6IA 1X2NA 2DG8A 2JWTA 5EZHA 4XICA 2QWTA 2HYTA 5M5XJ 1G2HA 1AKHB 2DMUA 2VI6A 1H8AC 5F0HA 4G12A 1ZR2A 3KKCA 5EDNA 1JKQC 1JGGA 1IDZA 3HKZN 4QSHA 2ZOYA 1MBKA 4XRSA 1JJ8C 4C3HJ 4FCYA 2K9SA 2YS9A 3PASA 3KKDA 2PBXA 2DMQA 4A3MJ 2DA7A 3OOUA 5F08A 5FKNA 3DCFA 1MBEA 1ZTRA 2NVYJ 1ETKA 4GFLA 1OCPA 4D7MA 2XRLA 2LKXA 1BA5A 3BCGA 4XRSG 2PZ9A 4RBOA 4V2GA 2R0QC 2E2JJ 3CRJA 3FK7A 4I6ZA 4AF5A 5J3LA 4DYRA 4DZPA 5FKLA 2Q24A 1P7JA 1TWFJ 1S7EA 2ELKA 2CJJA 4MK6A 2WB1N 2ZCMA 3A02A 4RDUA 3BTIA 3S16J 1ETWA 1QRYA 3M4OJ 3HDDA 4FTHA 4UDSA 2COBA 2QKOA 1WPKA 2ECCA 2JA5J 3ON4A 5FMPA 3BR3A 4IHYA 1TWCJ 2NOGA 1MSEC 1GT0C 5GPCA 3ON2A 5F1JA 3JRAA 2XPWA 1HLVA 3TW6A 3FIWA 3FKIJ 4Y7NJ 3GTKJ 1PUFA 2LVSA 5IYCJ 1B8IA 3TP0A 1U8BA 2YU9J 3C2BA 1LE8B 4XK4A 3NI7A 4GCTA 1B72B 1GV5A 5GPAA 3ZOBA 5K7HA 4ACIA 3LNQA 3Q0WA 3P9TA 4HKUA 5FJ8J 4IEJA 2DG7A 3PO3J 1AKHA 2KDZA 3S17J 3ZQLA 1BJZA 1VNDA 5E3NA 3OIOA 3JREA 5JLWA 5FGLA 1K61A 2QOPA 2IU5A 2GENA 1D5YA 4ICHA 5FKOA 3BR5A 3SFIA 4BKXA 3GTJJ 2EZKA 1POGA 3I4MJ 2XPVA 4FE4A 1FTTA 3K2AA 1I6HJ 2XPUA 4QIWN 1ETQA 3E7QA 3VOXA 5EZGA 3BTLA 1LFBA 5HAWA 2N8GA 4MLOA 2DA3A 3QQAA 2ID6A 1GDTA 3HIMA 4LOCA 1QVTA 3UKGA 3LWJA 3FK6A 4KWAA 3JRDA 2EH3A 2L7ZA 2D6YA 4A3CJ 3HOYJ 3VP5A 1OJLA 3AQTA 4M3BA 4A3KJ 3S2DJ 3I4NJ 2DA4A 3VPRA 1RKTA 5F0CA 3OSGA 2OI8A 1MBFA 1JUPA 3LSRA 1OFCX 1RR7A 3NARA 2G7GA 4DW6A 2JJ7A 4J19A 4A3BJ 2GM4A 3VVXA 3B81A 5J1YA 1X2MA 2FD5A 2WGBA 5DAJA 2R92J 3SDGA 2W53A 4M3DA 4QTRA
chains in the Genus database with same CATH superfamily
2HXIA 2HZTA 3HUGB 5F27A 5JHUA 3J80Z 3OYBA 3H0GJ 4OD4A 1BI0A 1Z3YA 1D3YA 2D5VA 4KNYA 3RH2A 1UMQA 3PNYA 5AIPA 3E5UA 1HSJA 1UG2A 1NG6A 3CP2A 3HPGA 3K4LA 4MEYF 3DBHB 3G71I 5EGOA 1NK3P 5BNGA 1WGXA 2H94A 1X1PA 2LYCA 2QCOA 2HOEA 4CYCB 1ZG1A 1GVJA 1SFXA 5F0FA 4XQFA 1FP2A 1DUXC 5DM7F 2FOKA 4IF4A 3CJQB 1O3RA 3I59A 1IV8A 2WY8Q 4GXOA 4BDZA 1QBJA 2FOWA 2PLYA 4X1EA 5FKMA 3KCCA 1SGMA 4L5IA 2BE5F 5E20A 2DFHA 2MABA 3LWFA 2ZCXA 1USTA 3RIRA 3GYHX 3KZZA 1JKOC 1KGSA 4CZCA 2PN6A 5IOYA 2XDNA 3F0CA 2CYYA 4HX4A 1FSEA 4Z6YA 2OPTA 3OS2A 5C4YA 4NN1A 3V78A 4CCMA 5HLTA 2ME6A 4XRFA 1JHHA 1FNNA 3ERED 1K79A 2D1HA 2EILH 4JQFA 4XOTA 3E3VA 4S04A 5CVRA 2M2EA 2RC4A 2V57A 1L3LA 5IY5H 3RTRA 2LFBA 3F6VA 4BQNA 1Z6RA 1GLNA 2FJ1A 3VYTB 1R9TJ 3BR2A 2QKMB 1G3TA 1ZRFA 2MSYA 3HOXJ 5DCMB 1AHDP 3SZGA 4CYDA 4FHTA 3IH4A 2LSOA 4HA8A 3S1RJ 1KA8A 1W5SA 2QQ8A 1N25A 3KZ9A 4M6VA 4RM3A 5E8GA 3TW7A 4HLYA 2LY9A 4WK8F 2LD5A 1SC7A 1DPUA 4PK4A 2KZVA 3FXQA 1H9TA 1Z0XA 4CYCA 4IJAA 5E3OA 2WV1A 2ZNZA 1MZBA 5J8FA 3EUHC 1KU9A 3E6CC 2JPBA 2F5VA 1WQ2A 2P81A 3M8EA 3PM1A 4GYGA 1REPC 5M3FJ 1D0YA 1D0ZA 4XN3A 3LJLA 3A2KA 3Q0VA 2BHZA 2A68F 1JHFA 4JX4A 5EG0B 2V6CA 3EUAA 5GTHC 2R7FA 2EIJH 1KQ8A 3RQ4A 1FZPB 3EDPA 3Q5FA 1FYLA 4BBSJ 1O7LA 5CW8A 2DA5A 1ZRDA 3H5NA 5HOOA 1ZR4A 2DK8A 1VQ7I 4DJAA 4A3IJ 1QZZA 4BHCA 2RQPA 5IP7J 2L2OA 3M8FA 5LGUA 3KNWA 5B1AH 3IWFA 2WAEA 3NRVA 2K4JA 4W97A 3BRUA 4B09A 3LAPA 3CCRI 3WGIA 1FBUA 1U5TA 1XMXA 3X2QH 3TMOA 2R7UA 4NQWA 2IRFG 2OERA 3BNIA 1XX5A 3CMMA 5KHDA 3KZIC 5FROA 3GFIA 1W5TA 4OIQF 2CQXA 3CUOA 2KDOA 3BG3A 5TGTA 3HOTA 5B1BH 2A61A 2KRCA 5E3LA 2M0MA 3MVPA 1R4NB 1X4PA 2G3BA 1YW8A 2KIFA 4U0WA 4GFBA 3HTAA 1LJ9A 3WTXC 3IL2A 3G73A 1MNMC 2STTA 5HBUA 5FLMJ 3QU6A 4G9YA 3HB9A 2XGEA 1LDKB 2QSHX 4WXCA 1B59A 4KUMA 3ZMDA 3A01B 2A5WA 3GTQJ 3DV8A 2L7MP 5ILSA 3FMQA 4UUSB 2Z5UA 1KZHA 2P6TA 1IJWC 4HX7A 4BY7J 4ETSA 1I1GA 2W4SA 3R0JA 4BEHB 4JX6A 4LD5A 5CVIA 2BBYA 2LBFB 3DPLC 3QRFF 4JBAA 4A0ZA 5TRDA 2E2HJ 5E17F 1MMGA 5CLSA 4A69C 3RPQA 1GV2A 3I5UA 2G9WA 4UB8C 1WFXA 2V79A 2GOMA 4MXMA 3COLA 4RGUA 3KLOA 4ENNA 5B5EC 5HDNA 2KT0A 5CXIA 1YW9A 4NDLA 1FMWA 3OS0A 1FJLA 3PO2J 2DTZA 1ZKGA 2VC1A 2FNPA 1IXRC 3LSMA 4O5VA 3CCLI 3CF5F 4NQWB 2H8RA 3VEPA 2F48A 3R6SA 1J7KA 4M9ZA 1APLC 2OU2A 3CC4I 3FZVA 1X3WB 3BTCA 5LGTA 1E3PA 1WJAA 3K6GA 1FBQA 2KMUA 5K7ZA 1DP7P 1YE9A 2LNBA 2W48A 1ENHA 2WAFA 5FFXA 4B1RA 1JT6A 3BJAA 2BY0A 2P5KA 4LLNA 2CUEA 4JNNA 1I27A 3MEXA 2UXUA 1TW3A 2A6EF 2GFNA 5M5YJ 1QVUA 4BE1A 2IT0A 1H89C 2JSCA 1F43A 2KPMA 4HPQA 3OYCA 2FQ4A 2EFNA 4EJUA 1RI7A 2ZXWH 1YJNI 4XIDA 3I58A 3NEUA 2C6YA 4IRVA 4BU2A 2XF6A 1A31A 1VQ8I 5EEGA 2HXOA 3K70D 1S72I 3O8GA 2A5YB 3O60A 1OR7C 5KK1A 3WHBA 2G0EA 4E7HA 1NTCA 3ABTA 1VFCA 3NS4A 4Y4RA 6PAXA 2Z9OA 3DLLF 3DFGA 4EM2A 1MMDA 2JVGA 3MNLA 2QQBA 4P9FA 2VJIA 4L62A 1R22A 5H6RA 1IRFA 1P92A 4Z2YA 2OAZA 4V2FA 4RA2A 4KITB 1SD4A 4ASNA 2E1OA 4N9HA 5L3DA 2JA7J 2F5FA 2F6CA 1A04A 1MH4A 3NXCA 4LG0B 5CJ9A 1KQ9A 1OISA 4O3MA 3H0DA 5ICGA 1UAAA 4DOZA 1BL0A 5EEAA 3HRTA 3QOPA 2XKPA 3WHCA 2KLOA 2YVEA 3HKZA 1FTZA 2L3DA 2ZMEB 3ABLH 4MNUA 5CXGA 1I39A 1YS6A 3BZ6A 4PXIA 2V26A 3LSPA 4GFKA 3LA3A 2X51A 3BR1A 2Q2EA 3T8TA 1XN7A 1Y1WJ 3QKXA 2RVCA 5KCMA 3L09A 3QPLA 3PSIA 2R7WA 3TEDA 3KEYA 4RGXA 3BROA 3VW1A 2QVOA 2W25A 2VPLA 5HLIA 1F5TA 5LRRA 3HTIA 4RS8A 2HDDA 3OYGA 1K7AA 4ZH4F 4FX0A 1QPMA 4J01A 4G94A 2VONA 1M1EB 2L02A 2R5YB 1PYVA 3S93A 4I98B 1A5JA 4YFXF 4E7JA 2WAQA 2LKSA 2JTVA 2EWNA 1JUMA 1XS9A 5LFAA 2M0CA 3SFZA 5EYRA 2ZXHA 1JUSA 1E3OC 3F22A 1LE8A 4XORA 4NELA 1VQMI 1TWAJ 2R7DA 3B6AA 4JX5A 3OYJA 2HS5A 1X2NA 1UJ8A 3GZ5A 2QQ9A 4BL0B 1SFKA 5M5XJ 1AKHB 2E7WA 2VI6A 1ZR2A 3VSKA 3KKCA 4L0ZB 1HBXG 3F3XA 3KP3A 1IDZA 2M87A 3BOQA 3H92A 1MBKA 4XRSA 3W2WA 4P1WA 4FCYA 3LSTA 2OZUA 3WTVC 4HNUA 2DMQA 1OYWA 4A3MJ 2DA7A 3I53A 1QHGA 4OU0A 4RLFA 3IKVA 1R00A 1V3FA 4EJOA 5FB2A 2EIKH 4ZJZA 2DPDA 4BQOA 3DCFA 1MBEA 4WWCA 3RYPA 2X6WA 1ETKA 1OCPA 3L7WA 2XRLA 4D7MA 3OY9A 1BA5A 2NOJB 1T8IA 5GADJ 3HRMA 3CRJA 2R0QC 3FK7A 2WC2A 4AF5A 3BY6A 1K6OA 2Q0OA 3IUOA 5FKLA 1P7JA 2ELKA 1BBYA 1BM9A 2WB1N 2CGPA 3R4KA 2XRNA 1ZAOA 4ZZLA 4RB3C 3CCJI 2FBIA 2ECCA 4MQVA 1BN5A 3L9FA 1TWCJ 1BOAA 5D6EA 1GT0C 2PMUA 5GPCA 1LVKA 2MLGA 1Z9CA 3ELKA 1HLVA 4E4HA 1A36A 4LJZF 4LG3A 3GTKJ 3K9TA 1XSVA 3WTYC 1YLFA 3H5AA 2BV6A 3F9KA 4HBLA 2RREA 1Y0UA 3IAS2 4KICA 5GTIC 1LKXA 1KYWA 1ZLKA 4M73A 3D5RC 3TOBA 4HSTA 1KYZA 1TT0A 4UV9A 3ZOBA 1BC7C 3V7SA 4AM3A 5D6FA 4L9TA 2DQRA 3LFUA 2XF5A 3PNVA 3H36A 2OCCH 2QM3A 1VQOI 2BW3B 2K85A 2P5LC 3CESA 1IXCA 3HJEA 3OIOA 1E0EA 5JLWA 1O3TA 4EQQA 4BNCA 1WKMA 4ENJA 2X1EA 3E6MA 5E1XA 3FXLA 2GENA 4ICHA 2NVUB 4F91B 5FKOA 4CDGA 3A0HC 1ZHFA 1IN4A 2H09A 2P5VA 3BR5A 1FYKA 2ISZA 2KL4A 3SFIA 3KP4A 4R1HA 4BKXA 4H4KC 3WE3A 5JVTA 3GTJJ 1ZH5A 4IOAF 1X1BA 2BXZA 5CQEA 1HA8A 2P6SA 1HW5A 3W6KB 3P9CA 4OAZA 1FTTA 3WTUC 5HNFA 2XPUA 4QIWN 1ETQA 2A2FX 1QU3A 3CCSI 3OYNA 3VOXA 4KMUX 1SVMA 3CLQA 4KIBA 4U0VA 1MKMA 4AWXB 4LOCA 3LWJA 3DWLE 4KWAA 3AG4H 2EH3A 3VSLA 4S05A 2D6YA 3HOYJ 4YRVA 3QYEA 3AQTA 3O2PE 4I09A 3DKXA 5ICCA 4BEHA 3VPRA 2EFOA 3V8KA 1MDMA 2K9MA 1HKSA 3OSGA 3LSRA 1V5EA 1OFCX 2OZ6A 2ZMEC 4BJ5C 4DW6A 2W82A 3KIOA 4XONA 4J19A 2GM4A 4A2UA 4PFPA 2WGBA 2R92J 1Z7UA 3RKYA 2CMPA 1Z21A 4M3DA 4M72A 4IO9F 3D1NI 3JSJA 3LSJA 2HZDA 4UUVA 4J00A 2O7OA 2RKHA 1OCRH 1Z7LA 1JJ6C 5JLXA 4S0HB 5D1RA 1R36A 1PP7U 2BW3A 1K6YA 2DT7B 2OQRA 2V1DA 5BQTA 3CCVI 1K4TA 4LK0F 1HOMA 2P0WA 4C2MA 1BIAA 2CG4A 3SZTA 2UZKA 3OMYA 2P8TA 2HI3A 3M3YJ 2AQEA 2DA1A 2E7XA 3R61A 2E2IJ 2EPFA 3ERMA 3QPHA 3K4CA 4HNVA 4M71A 3K70C 1BI2A 4GGGA 4YIIA 2XSJC 3GMEA 2PMZA 4BHPA 1OPCA 5J4YA 2NS0A 2XB0X 4WXHA 5K1YA 2LTPA 4NUBA 4Q47A 3CCUI 4LLGF 1P7IA 3ASOH 4A5NA 1XSDA 4AIHA 2Q1ZB 2XGDA 4ENKA 2IP2A 2DOEA 3HRUA 3S1QJ 2DODA 1LNWA 3FXRA 4IQ4A 4EEFG 2RASA 3IRQA 4KFCA 3EYIA 4CUGA 4FASD 1JKPC 3OIQA 1Y6IA 3DEWA 1ETYA 4I76A 2CUFA 5H6QA 4DYCA 1FEXA 3V8JA 3HOWJ 2VKHA 2VQHA 3LL7A 1RRJA 1G59A 3UNGC 3S5RA 4WX9A 3QP5A 2RAEA 3FDYA 1D0XA 4C9YA 5C4JJ 2ISYA 2G7UA 3HHHA 1E17A 2XF7A 2H1KA 2VL8A 1BI3A 2OA4A 1O7FA 5FHPA 3M9AA 1TWGJ 2L7FP 2VJJA 1YIOA 3RQIA 3TQNA 2BY3A 4ZDOA 3CD6I 4RB0A 1Z05A 1Y8RB 1MBHA 1X1CA 4G6QA 4L9VA 3G1LA 1RIOH 4CO8A 3DEEA 3HTUA 3BP8A 2CWEA 3LHQA 1BR2A 2BVMA 2E71A 3C3WA 2EINH 3S3NA 2HQRA 2VC0A 1WI3A 3I56I 2NS8A 2QF7A 2M7BA 3B6CA 2VOOA 1RETA 1VTNC 2R7XA 2M30A 4AC6A 2IJLA 1HDDC 4HQEA 1X1DA 4KDPA 2G7SA 1YRNA 2DDBA 2LK2A 4KYWA 4DIQA 2EIMH 2VXZA 4NC7A 3CUQB 4C2TA 1GXPA 4NNJA 1X3ZB 1DU6A 3CC7I 4UVBA 1QZYA 5LEKA 2DCEA 2HKXA 2WADA 3OSFA 1QNTA 1OMIA 3J7AO 5F6FA 1W36C 2ZC2A 5IP6A 1MMSA 2LC2A 4XLFA 3CCYA 2JA8J 2EZHA 4RAFA 2DK5A 2E1MB 3OL4A 2QIBA 2NNYA 1TNTA 3DU5A 2F07A 3NRGA 4PFOA 3CMYA 2XC7A 3F23A 2IBDA 4UVCA 1LEAA 3BG5A 2JPCA 5F64A 3QU3A 2EZLA 2GIZA 3EETA 3MZ8A 3H3VK 2EFPA 2O61A 3HSEA 2RDPA 2XASA 3ZQCA 4EM0B 2UXIA 2Y9YA 3KEOA 5E1WA 3WU0A 4PSWA 3HIFA 4AD9A 1K78B 5A2QZ 3BJBA 4BXUA 2DPUA 4PGGA 1IAWA 3FISA 4FE7A 1FOYA 2IGOA 2LF7A 5E3MA 4C3JJ 2AQFA 1YIJI 4A3GJ 1V4RA 3J7YJ 2K9QA 1MNEA 5JVGF 2XVCA 2CFXA 1TZLA 1S6LA 1P9QC 2R5ZB 2A69F 5KVRA 3IAM2 5KNLA 4D1QA 3HOZJ 2IAIA 1JTXA 1QZEA 4IHWA 4XKBA 2M8GX 4Q4ZF 2DT5A 4DYQA 1SD6A 2EQRA 3OYLA 2K02A 2GXBA 5IYBJ 2Z3YA 1TBXA 4A3LJ 1V5FA 4YIFA 1LQ1A 3G1MA 3KP2A 3PUBA 3CCEI 2VUMJ 2NRAC 1FC3A 4GRIA 2CQQA 1IXSB 2LY1A 4CCKA 1DP3A 1MH3A 1IC8A 1S9HA 2WA0A 2DA6A 2M5WA 3TBIA 4UY8I 2OTJI 2CUZA 3VOEA 2MFZA 3ZMUA 2MD0A 2PJRB 4PJ0C 1OKRA 1DDNA 4A3DJ 3VUQA 2CV1A 3MFKA 4RM2A 4XLCA 1W7PD 2V9PA 5FLVA 1DGRM 2BYVE 5EGOB 1FWZA 4N4OB 5D4SA 4M6YA 1IRXA 1MGTA 2CH0A 3TKYA 2FBHA 1Q1VA 1Y1VJ 3FWEA 2IPQX 2FJI1 4GCKA 1IN8A 4DQ2A 3I59B 1WWXA 1IUFA 1TW2A 3T5XA 3JR9A 1DGWY 2WTEA 1R7JA 4ESBA 1Y8QB 4HLXA 2OCEA 3UR3C 3S1NJ 3E5XA 4CSWA 5C3EJ 3MKZA 3GTPJ 1X1AA 2E1MC 3CDHA 4A3EJ 3I3LA 2X48A 2ZJRF 4HYEA 3S15J 2MGQA 4DNCA 1F36A 3EYYA 3C2GA 1ZG5A 4EM1A 4A3JJ 5L3CA 4RAZA 2ZCWA 2BZTA 1JTYA 2UXOA 1ETOA 3CTAA 2W00A 5TISC 3PFIA 2H27A 1T95A 3W2AA 3JRIA 3FBIB 3WODF 5DS9A 1YS7A 3OYEA 3W2VA 4N4NB 4M3GA 3G1OA 3GF2A 4V19K 3F21A 2GBYA 4KJZA 3GLXA 5DCMA 5J40A 4LGWA 2XGCA 3C1DA 5J1RA 4BY1J 2KIQA 4I7HA 4ZYDA 3FXOA 5BS6A 2COMA 3PFYA 2JUCA 2PMZN 4AYBN 4MGRA 5IYDJ 2H6BA 3ANGA 1MIJA 1HKQA 4HAMA 3T8RA 2LH9A 1O3SA 2F5CA 1XB4A 4HDUA 3Q3SA 3ECHA 2HWVA 2DJNA 2QENA 2WV0A 1J75A 1XD7A 2LP0A 1BR4A 3NQOA 2DI3A 5CPRB 4UNOA 1PP8F 1ZGWA 3LOCA 3QODA 2X0LA 4U7DA 3IV5A 3QPTA 3D5LA 1OYIA 4EGZA 5EG0A 1GUUA 4LK1F 1RUOA 2RNJA 3F8NA 5H9TA 4B3AA 3LA2A 3RYRA 5C44J 3OR2C 1VQ5I 1KQ0A 2IA2A 4I99C 4XKVA 2DTRA 3HE0A 1EA3A 1GXQA 1ZG3A 2P7CB 3I54A 2HYJA 2L4AA 1DPRA 1SMYF 1MW7A 5HNHA 3DBRB 1T38A 1E3HA 2GQQA 4B4CA 1VF9A 3AG2H 3JRBA 2FBQA 1O57A 3QYFA 3CCMI 4D7NA 1V54H 2HFHA 2W1OA 2DQLA 2ETHA 3LSIA 2O8KA 4JL3A 2LY2A 4UUTA 1I3QJ 3OYAA 2ELJA 4F3QA 3IUVA 1T08B 5DYMA 2HOSA 3FF5A 5DV5A 5M5WJ 4L9NA 4HZFA 3KP5A 3G7RA 4XLHA 2L54A 4LMYA 3WGHA 3HEFA 3BLYA 1UG0A 2FF4A 4QWQA 3V6GA 1A6IA 2F4MB 2M3AA 4IRHA 1SEUA 2Z1DA 4XICA 1B1BA 3G2BA 1JXSA 1USSA 4RAGA 2PFVA 4F92B 2DMUA 3DKYA 1H8AC 5F0HA 3K4JA 2EA4A 3K1PA 4AVZA 3HPHA 2OQGA 4QSHA 2W85A 3H9JA 3LQQA 1VZ0A 4RGSA 1C0WA 1HKTA 3L2UA 2UV1A 3M1EA 4HNTA 1V5GA 4CZZA 4U9LA 2X6XA 2GOXB 1MJ9A 5FKNA 2VODA 3K1MA 1XGSA 5DCFA 1MNDA 2LBFA 4GFLA 2UWMA 3IRRA 2XAQA 4A0XA 4IX7A 1T2KA 3ESWB 4II2A 3TDUC 2IS2A 5CVUA 1TWFJ 2WY7Q 1S7EA 2JVHA 3A02A 5CYVA 3S16J 3ASNH 1QGPA 3PJRA 2HEOA 1HW1A 4K2EA 3K4MA 4OMZA 5D5VB 1SVOA 1WPKA 2JA5J 1GHCA 3ON4A 5FMPA 3BR3A 2EK5A 2K7LA 2NOGA 1E2XA 1L0OC 2KHMA 3JRAA 2XPWA 3HTSB 4HQMA 3KP7A 3OYMA 4E7IA 4OAYA 1D8KA 4TV7A 4F52A 1PUFA 4DBRA 4BQQA 2VB6A 2ZBKA 3TP0A 1S8NA 4JK1X 1CF7B 2VOPA 4ITVA 1CGPA 3OIPA 4XK4A 4GCTA 4XKWA 3BC8A 1B72B 3M8JA 1YJWI 5K7HA 4I0BA 1N75A 1V55H 3M07A 3LNQA 3Q0WA 1R23A 1UELB 5K5QA 3P9TA 4ACIA 1KU7A 2B3WA 5FJ8J 4PGHA 2KDZA 3S17J 2A6TA 3MKYB 1IN5A 1FPQA 1W7PA 2CW0F 1SMTA 4KIGA 3WU1B 2ESNA 4HV6A 3I0TA 5FGLA 1K61A 2IU5A 2QWWA 1D5YA 3DTIA 3CLOA 3HSFA 2AXLA 4XL9A 1W5CC 2O5RA 3RCOA 1BI1A 1IZ1A 4YFKF 3PUFA 2HQAA 2JRTA 5FFZA 3BCBA 1TQPA 5ERIA 4PJLA 2CQNA 1TT5B 2WB1A 1F4KA 3E7QA 1YX5A 1IF1A 1LFBA 1XMKA 1JE8A 2BHYA 2MC3A 3MAJA 3GO5A 2HNHA 1QVTA 3UKGA 1R1VA 5E79C 3LSHA 1Q1HA 3FXJA 3JRDA 3WTWC 1AWCA 2LMDA 2MH2A 3VP5A 2PMHA 3VB2A 3P9KA 4M3BA 3S2DJ 5GAGJ 4OIRF 2XHKA 2GA1A 2HYGD 4C30A 3FX3A 1RR7A 2J5PA 3NARA 2G7GA 3OYDA 2QSGX 2LF8A 4FT8A 1ON2A 3E1SA 3J81Z 3B81A 1X2MA 3CZ6A 3SDGA 1SD7A 3EPZA 3LFKA 1FY7A 2JK3A 3GEUA 4EJVA 1R4MB 3T6NA 3BTJA 2W57A 2CUJA 5A2QK 1FX7A 3U1KA 2FNAA 2JSPA 4KISA 2EB7A 2E60A 1EH7A 3IH3A 5HS9A 1D1AA 2V1NA 1W7PB 4BYYA 5LLQA 4ZYAA 2JUGA 3ZPLA 1T0FA 3VW2A 2RHAA 1SAXA 5FLXK 2G7LA 1WH7A 1FBSA 3HOVJ 2EBIA 3PIOF 3ZP5A 3H5RA 5H20A 5LGNA 3S2HJ 3GTGJ 4I01A 1QHHD 1MBGA 1TP4A 1PJRA 1HQCA 3CO6C 3K10A 3OS1A 3HRSA 5LEJA 3FHNA 3WGGA 3SQNA 5ICEA 2CO5A 1U3EM 2DYSH 2XAGA 5AIQA 1HDPA 3F8MA 2O03A 4KT6A 1Z77A 2JZYA 2IA0A 4ZYHA 3MN2A 2NVQJ 1SFOJ 3DF8A 2B63J 4WXDA 3BWGA 3O3KA 1CQTA 2QTQA 3SXYA 3COAC 3IKTA 4D9JA 2HDWA 4KT5C 4MEXF 2DYRH 2RNGA 3H3ZA 3DXJF 3KP6A 2KIUA 2IS6A 2CQ7A 1N77A 1MD0A 3CCQI 3ZQFA 2R7SA 1NG7A 3F1BA 2X6YA 2HTSA 1BW6A 1YHQI 1B4AA 1R5GA 4MIMA 2R4GA 3LA7A 4N0BA 4GDFA 2DFFA 3FMRA 1WCMJ 2K86A 4G6DA 4XLNF 3BPVA 3V8LA 5AQCA 1WJCA 3R60A 3GEZA 3BZCA 4CA0A 1J59A 2PFBA 2LREA 4X6AJ 2UXNA 3HYIA 2DFIA 4D0PA 1QPIA 1WHUA 4M3FA 1G3SA 2AS5F 1J0RA 1ZARA 3BQYA 4KN4X 3A01A 1ON1A 1WZ2A 1ZN2A 3JSPA 1ZK8A 4IRGA 1I50J 3TO7A 3LSKA 1KU3A 4XRMA 3BR6A 4MO7A 3RKQA 1J2XA 3K1NA 3EQLF 2R7ZJ 1FLIA 2K3PA 2EA2A 3Q0UA 3GXOA 3NPIA 1ETXA 4DGWB 4UXNA 4YZEA 4P96A 5IP9J 2NVTJ 5CVJA 3IH2A 2GLOA 2JT1A 2PI0A 4PDKA 1VI0A 2L9NA 4GCLA 3MD2A 2GIVA 1EH8A 2L0KA 4RGRA 3L2WA 1RKWA 2V4JC 2B7EA 1JKRC 5C4XJ 3BDDA 2MW8A 2M9HA 4EJTA 1G3YA 3F6OA 3G3ZA 1UFMA 4XSZF 2Z33A 1RUNA 2ZFWA 3HL2A 5IPAA 1IO2A 2NS7A 4PUSA 2YVHA 2JMWA 2X1CA 4CGZA 3HM5A 1SVLA 2BXYA 1X4OA 4EATA 3AG3H 4L9JA 2CQKA 5D8KB 1XPXA 3L2RA 5KAFC 4CCNA 2DMTA 3VDXA 4E70A 4PJJA 2QYOA 2Y48A 1FOWA 1BW5A 2E5ZA 1A35A 3ZR8X 2DXIA 4JKZA 2W24A 2NVXJ 2BEOA 2OJED 4P5OA 2KZGA 4PJNA 2AXTC 2DDAA 5IOZA 3EGQA 2F4IA 4B8XA 3ULQB 4D5FA 2DMNA 2Y0SN 3VW0A 3WU2C 4E6KG 2OD5A 4HF0A 2Y0SA 3ISPA 1SD5A 2HVRA 3SYTA 1G4DA 2IS4A 4D5CA 3FKJA 5FD5A 2ELHA 4OD5A 1O4XA 4C2MJ 1BJAA 3FBNB 3MQ0A 2REKA 2NAZA 2VE9A 3T1BA 4UB6C 1WJDA 3ONQA 3ANPA 2FUG2 3HBLA 2B1EA 4IVNA 2MD5A 4A3FJ 4EMSA 2TCTA 4ZC3A 3GTMJ 1W36D 2EZIA 5AONA 2NP3A 1ZLJA 2CV0A 2D45A 4U87A 4YEJA 1TQIA 5TJJA 3EUPA 3OWTA 1XGNA 3BQZA 3S8PA 2NXNB 2L7KA 1YG2A 3BPXA 5DD4A 3HC7A 4LLLA 5FRNA 2NX4A 2I5UA 1XCVA 2R7RA 1PUFB 9ANTA 2VN2A 1R1TA 3FRQA 4BHBA 1OR7A 1ZQ3P 2XV4S 4XKCA 2DMPA 4JP0A 1D1BA 4XR6A 2QUFA 2VIXA 3S3OA 3HGYA 1HC8A 4R79A 2ZCNA 3SEQA 4C2UA 4EV0A 3GTLJ 2RN7A 2O7TA 2H1LA 3ZQ7A 1LUJB 1XTAA 2LR8A 1LPQA 1FYMA 4Y17A 2ZY9A 2PQ8A 5HS8A 3U1DA 5GAHJ 3KE2A 4LB6B 4IHXA 4OIPF 3OYKA 3ROUA 1KU2A 5BPDA 1TL8A 1OCCH 3GBGA 5GP9A 3U21A 3VVYA 1N78A 3JAMZ 1OCOH 2H6CA 5D18A 4GO1A 4UUSA 1XGOA 2V7FA 2KJCA 3BHQA 4CICA 1Z67A 2FX0A 3VOKA 2V1XA 2E35A 3RPUD 5CKTA 1WJFA 4RMNA 1I6XA 1ZGJA 3GCMA 1P4AA 3Q9SA 5L3BA 5FGMA 5D5UB 4LB5A 2DFEA 3JRHA 4A0YA 3BG6A 4AIJA 3BJ6A 4FQGA 3S2WA 1FIAA 1G8XA 4YELA 2FU4A 1U78A 4RB1A 1TNSA 2XSDC 2AO9A 4DZJA 3CQZJ 3NNRA 1XMAA 4WIBA 1ETVA 3VIBA 2XAFA 2Q8KA 1U9NA 3SJMA 2WUIA 5K58A 3AFHA 3OYHA 2CW7A 2L5QA 3MCZA 1FSHA 2K9NA 2KISA 2VT3A 1NK2P 3A4CA 3RI4A 4EJWA 4AU7A 3E6BA 3GVAA 2XKOA 3WE2A 3RPUA 3ZQHA 2XROA 1X19A 2EFQA 3FM5A 1LFUP 2LRDA 4LIUA 2F2EA 2VKVA 2QGUA 1R1UA 4IRIA 5IT9Z 1B9MA 1YJ9I 4MFEA 4B48A 3GFJA 2CV2A 1VQ6I 4AUXA 1ODDA 3K2ZA 2XIGA 1UZCA 3O8HA 4HX8A 3M7GA 5JFRA 3JRCA 2E1CA 1UI5A 1QA6A 3VYRB 5FD6A 3JCUC 3M1CA 2Y2ZA 4UV8A 2YVXA 5J4VA 2CU7A 4BBRJ 1EJ9A 2V9VA 2M34A 2HOAA 3P5JA 1AOYA 3AKZA 2E19A 3HTJA 3K4BA 2XAJA 1KONA 3QAHA 3JRGA 1PDNC 1HCRA 3HOUJ 1U6GA 3VWBA 1Z91A 2Y31A 2TDXA 5HLHA 3DQVC 4A6DA 3W6VA 3JRFA 2R93J 3ZCOA 1YITI 2QSFX 3ECOA 1K78A 1U2WA 4L18B 2JWTA 2HPMA 2QWTA 3L2QA 2HPIA 3C7JA 1G2HA 2Y69H 1B9NA 3K69A 4G12A 3OR1C 4IXAA 2IVMA 3G6EI 3VTIA 2ZKZA 1JKQC 1JGGA 4ZTJA 2ZOYA 3FXKA 2W7NA 2EV5A 4C3HJ 2HVQA 2K9SA 3PASA 3D0SA 4M9SA 2PBXA 3GUDA 2X1DA 3F8BA 3DLAA 1ONVA 5BOXA 4N9IA 2GA2A 2LKPA 1ZTRA 2NVYJ 1ZYRF 2PBIA 1F9NA 3GX4X 2HQNA 2LKXA 5D5XB 4Y15A 4ZYGA 4B44A 1WJ5A 2PZ9A 3V7CA 2L9SA 2E2JJ 4I6ZA 2DO7A 5J3LA 4DYRA 2Q24A 1Z1DA 3JAMK 3BTIA 1IUYA 1QRYA 3M4OJ 3HDDA 4UDSA 1RR8C 2QKOA 4IHSA 5J47A 1BOBA 3EUHA 1Z3XA 2F4OB 1MSEC 2YX7A 1STZA 5ILVA 1ZELA 5F1JA 1TLHB 4U88A 1I5ZA 3ZN1A 3IHUA 4JOMA 3TW6A 3FIWA 3FKIJ 4Y7NJ 1B8IA 4MTEA 3HZJA 1Z6TA 5HS7A 1WJBA 2FBKA 3Q9VA 3KETA 5L3FA 4ZYEA 3C2BA 1LE8B 2PJPA 1YOVB 3ZXSA 4NB5A 4U7BA 2O8XA 1P6RA 4PSXA 2DBBA 2FXAA 4IEJA 3E6DA 2MLKA 2DG7A 1AKHA 1BC8C 1R5HA 3DPTA 2OUMA 2M1BA 4BJ6C 5IT3A 4YIRX 4U0YA 1VNDA 4HDVA 3JREA 4WCGA 2XAUA 2QOPA 3QP6A 5HVQC 2V9KA 2VKDA 5K5OA 2FMLA 2BY2A 1EV7A 3GFLA 3WG9A 3PQJA 2GXAA 2EZKA 2QBYA 5LBQA 2YSRA 4E7ZA 4E7KA 3WTZA 3OYIA 3PQKA 4IQJA 2LG4A 5LHGA 5HAWA 5EZGA 3BTLA 5DEQA 4AVPA 2N8GA 4MLOA 2ZFUA 3L2VA 3FM3A 1LEBA 2W84A 2ID6A 3HIMA 2WBMA 3W6JB 1R58A 2VLAA 1VQKI 3LQRA 3FK6A 2E34A 4B43A 4A5MA 4A3CJ 1OJLA 4A3KJ 3ZMSA 3I4NJ 2DA4A 3R0AA 2DLLA 2KKOA 2I8DA 5F0CA 3MKWB 2P7VB 2OI8A 3WTSC 3V7RA 1MBFA 3ZMTA 4CXFA 3N4MA 2STWA 2VQCA 5E1ZB 2A05A 2CFOA 3A0BC 4KA4A 3SHFA 2V6EA 3BZKA 2FD5A 5DAJA 1P4WA 2ESHA 4IL6C 3JSOA 5LD2C 1YO5C 1Y0NA 3DTEA 2RQQA 4HW0A 2NYXA 3I64A 2VXDA 4QTRA 1S7AA 4G7OF 1TQMA 1AU7A 2EV0A 1R49A 1DU0A 2XB5A 5HSZA 2ECBA 3H1CA 4ZZDA 3CF2A 2R7TA 2OTLI 2JQ7A 1TWHJ 1O3QA 4M9XA 5HDKA 2OBPA 2ACJA 4B3XA 1W0UA 2M45A 2TRTA 2V1UA 1TTYA 1IGNA 4XM3A 2FSWA 2ZO4A 2AHQA 1RESA 3OV8A 1TC3C 2DA2A 1OYYA 1HF0A 4CH7A 3KYLA 1YYVA 3CUQA 3GLLA 1BIBA 2K9LA 5FO5A 2NP5A 5EF6A 3DEUA 3H35A 3BG9A 4Y3OA 4XN0A 3BR0A 3GTOJ 3F72A 4XBFA 1HXDA 5DTDA 3AG1H 3BG7A 1FP1D 3NAUA 1U0JA 2UUZA 2UXXA 3ZQQA 2HU9A 3J7AY 2VPRA 3I71A 2YU3A 4PJMA 3HXLA 3RKWA 4EGYA 3K7AJ 3I4PA 3GZIA 2IXSA 2QA4I 1IDYA 3DKWA 5ED4A 1IRGA 1NHAA 2VJ4A 1YFHA 1HW2A 4OIOF 1ULYA 2YR2A 1H0MA 3S14J 1UHMA 1XCBA 1H88C 1ERDA 1QQIA 3MWMA 2I10A 3IC7A 5J8CA 2YUSA 2L9RA 2MBFA 5FKKA 1OCZH 3U9GA 5JI6A 4LG0A 1R5ID 2HDCA 1UCRA 3HTHA 3P7NA 1XSXA 3S1MJ 2Y9ZA 3DPUA 1XDUA 4C3IJ 2IS1A 3PSFA 1J5YA 3K4NA 1WJEA 4IHVA 4NC6A 3C18A 2GUHA 5LRSA 3P9IA 2ZXJA 3HOSA 2ZMEA 1LVAA 2HGCA 5K7FA 3C2HA 2R7VA 1IV6A 3C07A 2F5EA 1D1CA 3K0LA 2ZSIB 3OOPA 2IGNA 4BGDA 1ORKA 5F1RA 2IGKA 5L3GA 3CO7C 4DVYP 4UHTA 3MZHA 2Q2EB 3ZGKA 4OWRB 3CJDA 2K40A 1BR1A 1MBJA 3G56A 3GZ6A 4IHTA 3QPSA 4G8XA 2XUBA 1CF7A 3ZQIA 3LAJA 2L9VA 2QKLB 5DDGA 2EFWA 3CMEI 3RKXA 4CGRA 1B72A 3ABMH 2IGMA 3F8FA 1P4XA 2BGCA 2M4KA 2O6GE 4DBQA 5CQGA 2HQ5A 1XGMA 4BJTA 2R5YA 5IT9K 3VFZA 2WAQN 5J1UA 1YX3A 2DN0A 3J81K 4H0EA 3CDLA 3HG9A 2MC4A 1FMVA 4CCLA 2O9LA 1IN6A 2CSOA 2Y75A 2NNNA 3B73A 4ANJA 4A6EA 1U5TC 4YFNF 5E18F 2QZ8A 1K4SA 1LB2A 1X58A 5KAIC 3D5SC 1F1ZA 2KFDA 4YG2F 2OV7A 3KZYA 1SFEA 3ZN0A 4EVIA 4FX4A 5FRMA 4NBQA 3BT9A 5F04A 3CDIA 5HLGA 2HYFA 2X4HA 3PIPF 2XDVA 1RPWA 2WWYA 4A93J 3IP4B 1LDJA 1G6NA 1SANA 4BAYA 2LLKA 3CWRA 4L5EA 4M74A 5D19A 5HDGA 3L1PA 3U2RA 3RZOJ 1FIPA 2HVSA 3PPBA 4IZZA 4MFDA 1W0TA 2KRFA 1YRNB 2Z99A 4HRIA 1JT0A 3NWTA 2PG4A 5GAEJ 3H3UA 1T56A 3WG7H 3WTTC 4BQAA 3E0JB 4I02A 4BXXJ 1ITYA 3OL3A 3ABKH 2PX9A 2CRGA 3QYBA 5DD8A 2MH9A 3MZYA 2VBWA 3S3MA 4W1UA 1RNLA 1R71A 5CVVA 3H9GA 4II3A 3AL0C 3L2CA 3JTGA 3SEZA 3TO6A 1VQ9I 3K8PC 2G7HA 2VQGA 2X6OA 3HUGA 1WVRA 2X9DA 2IW5A 1EKEA 3ZRGA 3TDZC 3REOA 2OF7A 5H2FC 5B3SH 3CJNA 3I9V2 2HTJA 2DAOA 2Y30A 3QWLA 1ACIA 3RZDJ 3I55I 5E8IA 1FOXA 3A1YA 4PCQA 4HG2A 1B8IB 2VT2A 4I2OA 1UHSA 5ILUA 2M8EA 4XMYA 4G7ZF 5BPIA 1MMAA 3B02A 3PL8A 2ZJQF 3LMMA 3DP7A 3TOAA 4BE2A 3FHZA 1RC9A 4BDYA 2GWRA 2E5NA 2HOTA 1U9OA 2DJIA 2DU9A 1S29A 4E7SA 5DM6F 1UHWA 2MYSA 3CJRB 3RSNA 1WH5A 4OMYA 1EF4A 3G4SI 3LSGA 1OQYA 3L00A 4ABZA 2R5ZA 4BE0A 1VQLI 2ZB9A 5K5RA 1YQAA 5EFYA 2ME0A 1RZ4A 3HGGA 2DT6A 1J09A 3GWZA 4RB2C 3CMAI 2FE3A 1YTYA 1H9GA 4QLCU 2D1VA 2A6HF 3EUKL 2QBYB 1EH6A 3E7LA 1T6SA 4RLQA 3MKLA 4BUPA 4Y52J 3QBMA 3FXUA 1T33A 3J7ZI 4XLAA 3KYCB 1ZGAA 1MSFC 3FXMA 1WRJA 4E7LA 5LHIA 4R8HA 5J6XA 1I3AA 5D8LB 4ON0A 2UXHA 1IG7A 4ESJA 1XC5A 2M4GA 3N05A 2F5DA 3GZNB 4LITA 2XGXA 3FMSA 3AL0B 2K27A 5DUKA 4ENMA 4CHUA 4PZJA 1JGSA 1XG1A 2M7AA 4XLEA 2GXGA 4AIDA 1MDMB 2YX4A 2O0YA 5M3MJ 3RD3A 2MA3A 2ADUA 3J80K 3ZMVA 4KIFA 4GYIA 2OC6A 3E5QA 2UXPA 1ZREA 3KLNA 4HF1A 2EJRA 4LIVA 3CC2I 3ZQGA 1UI6A 2E36A 2GZWA 2R3SA 1OCTC 1I1SA 4I0AA 2EV6A 2K3FA 1QO0D 4M3EA 1K83J 1WI9A 4FISA 4O6JA 4OINF 2HKUA 4IPAA 1B6AA 4AIKA 2O3FA 1W4MA 1R6RA 1LDDA 4Y13A 2X85A 4IOCF 3AAFA 1IRZA 2L01A 5HODA 1S3JA 3VYSB 4GCVA 3TP3A 4CCJA 2BY1A 3A03A 1GVDA 4HEA2 3V42A 3S32A 2ICWG 1J9IA 3T0YA 4ME9A 2ID3A 3JW4A 2JN6A 2A3SA 2MG4A 4MTDA 4RAYA 2Z2SB 2FA5A 4M6XA 4HV5A 3DPJA 2KJBA 1LFPA 2RV8A 4JYKA 2QLZA 3VYUB 3ZMZA 1U5TB 3AQSA 2ZOZA 2KP6A 2JA6J 2IEKA 1SAUA 4AC0A 3VODA 1W1WE 4KMFA 2QQAA 3GFMA 4NC8A 4P9UA 1U8RA 2VBXA 4BH9A 2FRHA 5JR3A 3RDIA 4ZDPA 2VKEA 2FQ3A 4LFUA 4Y33A 2DG8A 5EZHA 2R7QA 1VQ4I 1Y56A 2QEXI 2HYTA 4G7HF 1SFUA 2KIMA 2LDUA 1NH3A 5EDNA 2YPRA 2FMYA 1IW7F 3HKZN 2LOOA 4QPQA 5B66C 1T39A 2BOLA 1JI8A 4F93B 5FLXZ 2ZSHB 1JJ8C 4NHJA 3TL4X 4L0YB 4HSRA 3KX2A 5D4RA 2YS9A 1AA7A 1WSUA 3KKDA 2HR3A 3CJTB 4HOBA 2JRMA 3OOUA 5F08A 3KYDB 2VE8A 4AYBA 5JHFA 4XNFA 2VJ5A 4U9NA 3SWHA 4F55A 5DUIA 5EJCA 4XSXF 4XRSG 3BCGA 3KPHA 3BJOA 3TO9A 4RBOA 3O6BB 4V2GA 2B9SA 2L4MA 3VVZA 4DZPA 2CJJA 2K5CA 4MK6A 2ZCMA 4RDUA 1ETWA 1PVEA 2GAUA 3CP8A 4XOPA 2KRHA 4FTHA 1VQNI 1MJAA 1S7OA 2COBA 4ESFA 4Q5SF 5LHHA 3E97A 2VBYA 3DTKA 4IHYA 3ABUA 2DOAA 2FEZA 3DU6A 2CS3A 4BACA 2ZJPF 1FT9A 3ON2A 1G3WA 1UB9A 3QOEA 4UVAA 2KQRA 3JTHA 3W3CA 2K4BA 2DOFA 3PNTA 2LVSA 4P55A 3TGNA 5IYCJ 4ZTFA 2E1NA 2Z16A 1U8BA 2YU9J 2JA2A 4G6TB 4KN7X 3NI7A 2CW8A 3HHGA 3K4KA 5EEHA 3H9QA 1GV5A 5GPAA 4IKFA 4OOIA 4QPOA 1MMNA 3MMYB 4HKUA 1S5LC 2D2WA 3PO3J 1P2FA 1IN7A 3ZQLA 2VBZA 3KEQA 3DBLB 1ZRCA 1BJZA 2Y0MA 1VQPI 2ZXIA 5E3NA 2R7OA 2J5OA 3ML6A 4XLPF 2VQLA 1YI2I 2H8WA 3IWZA 1OLTA 1HSTA 4X0GA 2XAHA 2BVLA 4MHGA 2VASA 3RJPA 2DW4A 4MQ9F 1POGA 3V4GA 3I4MJ 2XPVA 4FE4A 5L3EA 4A12A 1XDSA 5BMZA 2A07F 3HSRA 3K2AA 4FETA 1I6HJ 2HKOA 4WF2A 3OYFA 2B0LA 1X3UA 3CUQC 1T98A 1FOKA 2DA3A 3QQAA 5D5WB 3SZPA 3N97A 1GDTA 3KFWX 1A6QA 4BXFA 1D8JA 2L7ZA 4B47A 1D5VA 4CCOA 3F8CA 2RGVA 1T0FC 4BS9A 3GW2A 1RKTA 3BCAA 1MJBA 1DQUA 4F7ZA 1JUPA 2ZNYA 5ICFA 2ZJ2A 2JJ7A 3NWSA 3SDBA 4HF2A 4A3BJ 3VVXA 4ZDLA 5J1YA 1YW7A 4Q48A 2P4WA 1PUEE 1Y39A 2IA1A 2W53A 2PEXA 4L5JA 2PJRA
chains in the Genus database with same CATH topology
2HXIA 3D1NI 2JK3A 3LSJA 5F27A 3GEUA 3H0GJ 3T6NA 3BTJA 2D5VA 2O7OA 3RH2A 1AU7A 1UMQA 1DU0A 1JJ6C 2XB5A 5HSZA 1UG2A 5JLXA 4S0HB 2ECBA 3IH3A 5D1RA 5EGOA 1NK3P 5BNGA 1TWHJ 1WGXA 2QCOA 3VW2A 2RHAA 4CYCB 1W0UA 1HOMA 2G7LA 2TRTA 5F0FA 1WH7A 1IGNA 2HI3A 3M3YJ 2AHQA 1RESA 1TC3C 3HOVJ 2EBIA 2DA1A 2E2IJ 2DA2A 4X1EA 5FKMA 3S2HJ 1SGMA 3GTGJ 4HNVA 1MBGA 1HF0A 2ZCXA 1JKOC 2NP5A 5EF6A 2XB0X 3BG9A 2LTPA 5IOYA 2XDNA 3F0CA 1HDPA 1P7IA 3BR0A 3GTOJ 5DTDA 2OPTA 5C4YA 1Z77A 2XGDA 4NN1A 3V78A 3MN2A 2ME6A 2NVQJ 3NAUA 1SFOJ 2B63J 3S1QJ 2RASA 1CQTA 4EEFG 2QTQA 1JKPC 2M2EA 2V57A 2VPRA 3DEWA 1ETYA 4I76A 2CUFA 4DYCA 2LFBA 1FEXA 3HOWJ 3K7AJ 2FJ1A 1R9TJ 3GZIA 3ZQFA 3BR2A 1IDYA 3F1BA 3S5RA 2RAEA 1BW6A 2MSYA 5C4JJ 4MIMA 3HOXJ 1AHDP 1WCMJ 2H1KA 3S14J 5AQCA 1H88C 3IH4A 5FHPA 1TWGJ 2L7FP 2I10A 3S1RJ 2YUSA 3RQIA 3KZ9A 2L9RA 5FKKA 4M6VA 3TW7A 2LD5A 2LY9A 4X6AJ 3HTHA 1MBHA 3G1LA 1Z0XA 3S1MJ 4CYCA 1QPIA 4M3FA 2WV1A 5E3OA 2Y9ZA 3LHQA 4C3IJ 3BQYA 3A01A 1WI3A 1ZK8A 2NS8A 2QF7A 2P81A 4IHVA 3PM1A 1I50J 2GUHA 3B6CA 1RETA 4XRMA 3BR6A 4MO7A 4AC6A 3RKQA 5K7FA 5M3FJ 1HDDC 2G7SA 1YRNA 1IV6A 3LJLA 2LK2A 2R7ZJ 3C07A 3Q0VA 4JX4A 3Q0UA 1ORKA 3NPIA 5EG0B 1ETXA 4YZEA 5IP9J 2NVTJ 3CJDA 2K40A 1MBJA 3G56A 3IH2A 2GLOA 3QPSA 1DU6A 1VI0A 3ZQIA 4GCLA 4BBSJ 5CW8A 2DA5A 3OSFA 4CGRA 1ZR4A 2L0KA 1RKWA 5IP6A 4A3IJ 1B72A 3CCYA 2JA8J 2EZHA 5IP7J 2QIBA 1JKRC 5C4XJ 2HQ5A 2F07A 3NRGA 3KNWA 3CMYA 2R5YA 2MW8A 2M9HA 2IBDA 2WAQN 4W97A 3BRUA 3VVZA 3BG5A 5J1UA 2DN0A 5IPAA 2EZLA 3CDLA 2OERA 3BNIA 2NS7A 3H3VK 2YVHA 2JMWA 2O9LA 3HM5A 2CQXA 3ZQCA 1X58A 3BG3A 2UXIA 2Y9YA 5E3LA 3MVPA 3BJBA 2G3BA 5F04A 3BT9A 4GFBA 3HTAA 3FISA 4FE7A 2DMTA 5E3MA 4C3JJ 1MNMC 4A3GJ 1RPWA 5HBUA 2K9QA 5FLMJ 4A93J 1SANA 1BW5A 3HB9A 2LLKA 3CWRA 2XGEA 4L5EA 5D19A 3GTQJ 3A01B 2R5ZB 4JKZA 2NVXJ 3L1PA 5IOZA 3EGQA 3RZOJ 3HOZJ 1FIPA 2IAIA 2L7MP 4UUSB 1JTXA 4IHWA 3PPBA 4D5FA 2DMNA 4MFDA 2Y0SN 1W0TA 2M8GX 3VW0A 1IJWC 4DYQA 1YRNB 2EQRA 4BY7J 4JX6A 4D5CA 1JT0A 5IYBJ 1O4XA 4C2MJ 4A3LJ 2REKA 1T56A 4BXXJ 3ANPA 2E2HJ 1ITYA 3G1MA 3HBLA 2VUMJ 2CRGA 4A3FJ 4A69C 1GV2A 2TCTA 3GTMJ 2CQQA 2EZIA 4W1UA 2NP3A 1MH3A 1IC8A 2DA6A 4MXMA 3COLA 2X6OA 3EUPA 5CXIA 2KT0A 3JSJA 2X9DA 4NDLA 1FJLA 3BQZA 4A3DJ 2OF7A 3VUQA 3PO2J 2DTZA 5FLVA 1ZKGA 2Y30A 5EGOB 3RZDJ 2NX4A 1PUFB 9ANTA 1B8IB 1Q1VA 1Y1VJ 2H8RA 4GCKA 3FRQA 1UHSA 1ZQ3P 2DMPA 4JP0A 1APLC 3JR9A 1IUFA 3HGYA 3BTCA 2ZCNA 5K7ZA 3S1NJ 2W48A 3GTLJ 1ENHA 2O7TA 2HOTA 2LR8A 5C3EJ 1U9OA 3GTPJ 4B1RA 1JT6A 4A3EJ 2X48A 2CUEA 4JNNA 4IHXA 3S15J 1WH5A 2UXUA 1EF4A 2MGQA 2GFNA 3LSGA 3VVYA 5M5YJ 1QVUA 3GBGA 1F36A 5GP9A 4ABZA 1F43A 1H89C 2R5ZA 2ZB9A 2FQ4A 5D18A 5EFYA 2ME0A 3HGGA 4A3JJ 4UUSA 4XIDA 3BHQA 2FX0A 3VOKA 1JTYA 2UXOA 1ETOA 2HXOA 3E7LA 3QBMA 3MKLA 4Y52J 3O8GA 3O60A 3JRIA 1T33A 3WHBA 2G0EA 1MSFC 5DS9A 1NTCA 3JRHA 1VFCA 1FIAA 2UXHA 4M3GA 1IG7A 3MNLA 3G1OA 1U78A 4L62A 1XC5A 2GBYA 2XSDC 2AO9A 4DZJA 3CQZJ 2XGCA 4BY1J 4V2FA 5J1RA 3NNRA 1ETVA 3VIBA 1U9NA 2E1OA 3SJMA 2PMZN 1XG1A 4AYBN 5IYDJ 2WUIA 5K58A 2JA7J 1MH4A 3ANGA 3NXCA 2K9NA 5M3MJ 3RD3A 1NK2P 3Q3SA 2UXPA 1BL0A 5EEAA 2DJNA 3WHCA 2YVEA 1FTZA 2LP0A 3ZQGA 3ZQHA 1UI6A 1OCTC 1LFUP 1ZGWA 4M3EA 5CXGA 1K83J 4FISA 3LOCA 3IV5A 2VKVA 2HKUA 3LSPA 4GFKA 4PXIA 3BR1A 5EG0A 1GUUA 1IRZA 4MFEA 5H9TA 4B3AA 5C44J 5HODA 1Y1WJ 3QKXA 4AUXA 3QPLA 3TEDA 3TP3A 3HE0A 3A03A 1GVDA 3VW1A 2HYJA 3O8HA 3HTIA 4ME9A 2ID3A 2HDDA 2JN6A 3JRCA 1UI5A 2MG4A 4B4CA 1VF9A 2Y2ZA 2R5YB 3JRBA 2CU7A 4BBRJ 2FBQA 3DPJA 1A5JA 2M34A 2HOAA 4D7NA 3HTJA 2E19A 4JYKA 1JUMA 1XS9A 3JRGA 2O8KA 2M0CA 3HOUJ 1HCRA 2ZOZA 3AQSA 4UUTA 4JL3A 5EYRA 1I3QJ 3IUVA 2JA6J 2IEKA 2HOSA 2Y31A 1JUSA 4AC0A 5M5WJ 1E3OC 3W6VA 3JRFA 2R93J 1LE8A 3G7RA 4NELA 3HEFA 1TWAJ 3B6AA 4JX5A 2VKEA 3V6GA 1A6IA 1X2NA 2DG8A 2JWTA 5EZHA 4XICA 2QWTA 2HYTA 5M5XJ 1G2HA 1AKHB 2DMUA 2VI6A 1H8AC 5F0HA 4G12A 1ZR2A 3KKCA 5EDNA 1JKQC 1JGGA 1IDZA 3HKZN 4QSHA 2ZOYA 1MBKA 4XRSA 1JJ8C 4C3HJ 4FCYA 2K9SA 2YS9A 3PASA 3KKDA 2PBXA 2DMQA 4A3MJ 2DA7A 3OOUA 5F08A 5FKNA 3DCFA 1MBEA 1ZTRA 2NVYJ 1ETKA 4GFLA 1OCPA 4D7MA 2XRLA 2LKXA 1BA5A 3BCGA 4XRSG 2PZ9A 4RBOA 4V2GA 2R0QC 2E2JJ 3CRJA 3FK7A 4I6ZA 4AF5A 5J3LA 4DYRA 4DZPA 5FKLA 2Q24A 1P7JA 1TWFJ 1S7EA 2ELKA 2CJJA 4MK6A 2WB1N 2ZCMA 3A02A 4RDUA 3BTIA 3S16J 1ETWA 1QRYA 3M4OJ 3HDDA 4FTHA 4UDSA 2COBA 2QKOA 1WPKA 2ECCA 2JA5J 3ON4A 5FMPA 3BR3A 4IHYA 1TWCJ 2NOGA 1MSEC 1GT0C 5GPCA 3ON2A 5F1JA 3JRAA 2XPWA 1HLVA 3TW6A 3FIWA 3FKIJ 4Y7NJ 3GTKJ 1PUFA 2LVSA 5IYCJ 1B8IA 3TP0A 1U8BA 2YU9J 3C2BA 1LE8B 4XK4A 3NI7A 4GCTA 1B72B 1GV5A 5GPAA 3ZOBA 5K7HA 4ACIA 3LNQA 3Q0WA 3P9TA 4HKUA 5FJ8J 4IEJA 2DG7A 3PO3J 1AKHA 2KDZA 3S17J 3ZQLA 1BJZA 1VNDA 5E3NA 3OIOA 3JREA 5JLWA 5FGLA 1K61A 2QOPA 2IU5A 2GENA 1D5YA 4ICHA 5FKOA 3BR5A 3SFIA 4BKXA 3GTJJ 2EZKA 1POGA 3I4MJ 2XPVA 4FE4A 1FTTA 3K2AA 1I6HJ 2XPUA 4QIWN 1ETQA 3E7QA 3VOXA 5EZGA 3BTLA 1LFBA 5HAWA 2N8GA 4MLOA 2DA3A 3QQAA 2ID6A 1GDTA 3HIMA 4LOCA 1QVTA 3UKGA 3LWJA 3FK6A 4KWAA 3JRDA 2EH3A 2L7ZA 2D6YA 4A3CJ 3HOYJ 3VP5A 1OJLA 3AQTA 4M3BA 4A3KJ 3S2DJ 3I4NJ 2DA4A 3VPRA 1RKTA 5F0CA 3OSGA 2OI8A 1MBFA 1JUPA 3LSRA 1OFCX 1RR7A 3NARA 2G7GA 4DW6A 2JJ7A 4J19A 4A3BJ 2GM4A 3VVXA 3B81A 5J1YA 1X2MA 2FD5A 2WGBA 5DAJA 2R92J 3SDGA 2W53A 4M3DA 4QTRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HXI A;  3D1N I;  2JK3 A;  3LSJ A;  5F27 A;  3GEU A;  3H0G J;  3T6N A;  3BTJ A;  2D5V A;  2O7O A;  3RH2 A;  1AU7 A;  1UMQ A;  1DU0 A;  1JJ6 C;  2XB5 A;  5HSZ A;  1UG2 A;  5JLX A;  4S0H B;  2ECB A;  3IH3 A;  5D1R A;  5EGO A;  1NK3 P;  5BNG A;  1TWH J;  1WGX A;  2QCO A;  3VW2 A;  2RHA A;  4CYC B;  1W0U A;  1HOM A;  2G7L A;  2TRT A;  5F0F A;  1WH7 A;  1IGN A;  2HI3 A;  3M3Y J;  2AHQ A;  1RES A;  1TC3 C;  3HOV J;  2EBI A;  2DA1 A;  2E2I J;  2DA2 A;  4X1E A;  5FKM A;  3S2H J;  1SGM A;  3GTG J;  4HNV A;  1MBG A;  1HF0 A;  2ZCX A;  1JKO C;  2NP5 A;  5EF6 A;  2XB0 X;  3BG9 A;  2LTP A;  5IOY A;  2XDN A;  3F0C A;  1HDP A;  1P7I A;  3BR0 A;  3GTO J;  5DTD A;  2OPT A;  5C4Y A;  1Z77 A;  2XGD A;  4NN1 A;  3V78 A;  3MN2 A;  2ME6 A;  2NVQ J;  3NAU A;  1SFO J;  2B63 J;  3S1Q J;  2RAS A;  1CQT A;  4EEF G;  2QTQ A;  1JKP C;  2M2E A;  2V57 A;  2VPR A;  3DEW A;  1ETY A;  4I76 A;  2CUF A;  4DYC A;  2LFB A;  1FEX A;  3HOW J;  3K7A J;  2FJ1 A;  1R9T J;  3GZI A;  3ZQF A;  3BR2 A;  1IDY A;  3F1B A;  3S5R A;  2RAE A;  1BW6 A;  2MSY A;  5C4J J;  4MIM A;  3HOX J;  1AHD P;  1WCM J;  2H1K A;  3S14 J;  5AQC A;  1H88 C;  3IH4 A;  5FHP A;  1TWG J;  2L7F P;  2I10 A;  3S1R J;  2YUS A;  3RQI A;  3KZ9 A;  2L9R A;  5FKK A;  4M6V A;  3TW7 A;  2LD5 A;  2LY9 A;  4X6A J;  3HTH A;  1MBH A;  3G1L A;  1Z0X A;  3S1M J;  4CYC A;  1QPI A;  4M3F A;  2WV1 A;  5E3O A;  2Y9Z A;  3LHQ A;  4C3I J;  3BQY A;  3A01 A;  1WI3 A;  1ZK8 A;  2NS8 A;  2QF7 A;  2P81 A;  4IHV A;  3PM1 A;  1I50 J;  2GUH A;  3B6C A;  1RET A;  4XRM A;  3BR6 A;  4MO7 A;  4AC6 A;  3RKQ A;  5K7F A;  5M3F J;  1HDD C;  2G7S A;  1YRN A;  1IV6 A;  3LJL A;  2LK2 A;  2R7Z J;  3C07 A;  3Q0V A;  4JX4 A;  3Q0U A;  1ORK A;  3NPI A;  5EG0 B;  1ETX A;  4YZE A;  5IP9 J;  2NVT J;  3CJD A;  2K40 A;  1MBJ A;  3G56 A;  3IH2 A;  2GLO A;  3QPS A;  1DU6 A;  1VI0 A;  3ZQI A;  4GCL A;  4BBS J;  5CW8 A;  2DA5 A;  3OSF A;  4CGR A;  1ZR4 A;  2L0K A;  1RKW A;  5IP6 A;  4A3I J;  1B72 A;  3CCY A;  2JA8 J;  2EZH A;  5IP7 J;  2QIB A;  1JKR C;  5C4X J;  2HQ5 A;  2F07 A;  3NRG A;  3KNW A;  3CMY A;  2R5Y A;  2MW8 A;  2M9H A;  2IBD A;  2WAQ N;  4W97 A;  3BRU A;  3VVZ A;  3BG5 A;  5J1U A;  2DN0 A;  5IPA A;  2EZL A;  3CDL A;  2OER A;  3BNI A;  2NS7 A;  3H3V K;  2YVH A;  2JMW A;  2O9L A;  3HM5 A;  2CQX A;  3ZQC A;  1X58 A;  3BG3 A;  2UXI A;  2Y9Y A;  5E3L A;  3MVP A;  3BJB A;  2G3B A;  5F04 A;  3BT9 A;  4GFB A;  3HTA A;  3FIS A;  4FE7 A;  2DMT A;  5E3M A;  4C3J J;  1MNM C;  4A3G J;  1RPW A;  5HBU A;  2K9Q A;  5FLM J;  4A93 J;  1SAN A;  1BW5 A;  3HB9 A;  2LLK A;  3CWR A;  2XGE A;  4L5E A;  5D19 A;  3GTQ J;  3A01 B;  2R5Z B;  4JKZ A;  2NVX J;  3L1P A;  5IOZ A;  3EGQ A;  3RZO J;  3HOZ J;  1FIP A;  2IAI A;  2L7M P;  4UUS B;  1JTX A;  4IHW A;  3PPB A;  4D5F A;  2DMN A;  4MFD A;  2Y0S N;  1W0T A;  2M8G X;  3VW0 A;  1IJW C;  4DYQ A;  1YRN B;  2EQR A;  4BY7 J;  4JX6 A;  4D5C A;  1JT0 A;  5IYB J;  1O4X A;  4C2M J;  4A3L J;  2REK A;  1T56 A;  4BXX J;  3ANP A;  2E2H J;  1ITY A;  3G1M A;  3HBL A;  2VUM J;  2CRG A;  4A3F J;  4A69 C;  1GV2 A;  2TCT A;  3GTM J;  2CQQ A;  2EZI A;  4W1U A;  2NP3 A;  1MH3 A;  1IC8 A;  2DA6 A;  4MXM A;  3COL A;  2X6O A;  3EUP A;  5CXI A;  2KT0 A;  3JSJ A;  2X9D A;  4NDL A;  1FJL A;  3BQZ A;  4A3D J;  2OF7 A;  3VUQ A;  3PO2 J;  2DTZ A;  5FLV A;  1ZKG A;  2Y30 A;  5EGO B;  3RZD J;  2NX4 A;  1PUF B;  9ANT A;  1B8I B;  1Q1V A;  1Y1V J;  2H8R A;  4GCK A;  3FRQ A;  1UHS A;  1ZQ3 P;  2DMP A;  4JP0 A;  1APL C;  3JR9 A;  1IUF A;  3HGY A;  3BTC A;  2ZCN A;  5K7Z A;  3S1N J;  2W48 A;  3GTL J;  1ENH A;  2O7T A;  2HOT A;  2LR8 A;  5C3E J;  1U9O A;  3GTP J;  4B1R A;  1JT6 A;  4A3E J;  2X48 A;  2CUE A;  4JNN A;  4IHX A;  3S15 J;  1WH5 A;  2UXU A;  1EF4 A;  2MGQ A;  2GFN A;  3LSG A;  3VVY A;  5M5Y J;  1QVU A;  3GBG A;  1F36 A;  5GP9 A;  4ABZ A;  1F43 A;  1H89 C;  2R5Z A;  2ZB9 A;  2FQ4 A;  5D18 A;  5EFY A;  2ME0 A;  3HGG A;  4A3J J;  4UUS A;  4XID A;  3BHQ A;  2FX0 A;  3VOK A;  1JTY A;  2UXO A;  1ETO A;  2HXO A;  3E7L A;  3QBM A;  3MKL A;  4Y52 J;  3O8G A;  3O60 A;  3JRI A;  1T33 A;  3WHB A;  2G0E A;  1MSF C;  5DS9 A;  1NTC A;  3JRH A;  1VFC A;  1FIA A;  2UXH A;  4M3G A;  1IG7 A;  3MNL A;  3G1O A;  1U78 A;  4L62 A;  1XC5 A;  2GBY A;  2XSD C;  2AO9 A;  4DZJ A;  3CQZ J;  2XGC A;  4BY1 J;  4V2F A;  5J1R A;  3NNR A;  1ETV A;  3VIB A;  1U9N A;  2E1O A;  3SJM A;  2PMZ N;  1XG1 A;  4AYB N;  5IYD J;  2WUI A;  5K58 A;  2JA7 J;  1MH4 A;  3ANG A;  3NXC A;  2K9N A;  5M3M J;  3RD3 A;  1NK2 P;  3Q3S A;  2UXP A;  1BL0 A;  5EEA A;  2DJN A;  3WHC A;  2YVE A;  1FTZ A;  2LP0 A;  3ZQG A;  3ZQH A;  1UI6 A;  1OCT C;  1LFU P;  1ZGW A;  4M3E A;  5CXG A;  1K83 J;  4FIS A;  3LOC A;  3IV5 A;  2VKV A;  2HKU A;  3LSP A;  4GFK A;  4PXI A;  3BR1 A;  5EG0 A;  1GUU A;  1IRZ A;  4MFE A;  5H9T A;  4B3A A;  5C44 J;  5HOD A;  1Y1W J;  3QKX A;  4AUX A;  3QPL A;  3TED A;  3TP3 A;  3HE0 A;  3A03 A;  1GVD A;  3VW1 A;  2HYJ A;  3O8H A;  3HTI A;  4ME9 A;  2ID3 A;  2HDD A;  2JN6 A;  3JRC A;  1UI5 A;  2MG4 A;  4B4C A;  1VF9 A;  2Y2Z A;  2R5Y B;  3JRB A;  2CU7 A;  4BBR J;  2FBQ A;  3DPJ A;  1A5J A;  2M34 A;  2HOA A;  4D7N A;  3HTJ A;  2E19 A;  4JYK A;  1JUM A;  1XS9 A;  3JRG A;  2O8K A;  2M0C A;  3HOU J;  1HCR A;  2ZOZ A;  3AQS A;  4UUT A;  4JL3 A;  5EYR A;  1I3Q J;  3IUV A;  2JA6 J;  2IEK A;  2HOS A;  2Y31 A;  1JUS A;  4AC0 A;  5M5W J;  1E3O C;  3W6V A;  3JRF A;  2R93 J;  1LE8 A;  3G7R A;  4NEL A;  3HEF A;  1TWA J;  3B6A A;  4JX5 A;  2VKE A;  3V6G A;  1A6I A;  1X2N A;  2DG8 A;  2JWT A;  5EZH A;  4XIC A;  2QWT A;  2HYT A;  5M5X J;  1G2H A;  1AKH B;  2DMU A;  2VI6 A;  1H8A C;  5F0H A;  4G12 A;  1ZR2 A;  3KKC A;  5EDN A;  1JKQ C;  1JGG A;  1IDZ A;  3HKZ N;  4QSH A;  2ZOY A;  1MBK A;  4XRS A;  1JJ8 C;  4C3H J;  4FCY A;  2K9S A;  2YS9 A;  3PAS A;  3KKD A;  2PBX A;  2DMQ A;  4A3M J;  2DA7 A;  3OOU A;  5F08 A;  5FKN A;  3DCF A;  1MBE A;  1ZTR A;  2NVY J;  1ETK A;  4GFL A;  1OCP A;  4D7M A;  2XRL A;  2LKX A;  1BA5 A;  3BCG A;  4XRS G;  2PZ9 A;  4RBO A;  4V2G A;  2R0Q C;  2E2J J;  3CRJ A;  3FK7 A;  4I6Z A;  4AF5 A;  5J3L A;  4DYR A;  4DZP A;  5FKL A;  2Q24 A;  1P7J A;  1TWF J;  1S7E A;  2ELK A;  2CJJ A;  4MK6 A;  2WB1 N;  2ZCM A;  3A02 A;  4RDU A;  3BTI A;  3S16 J;  1ETW A;  1QRY A;  3M4O J;  3HDD A;  4FTH A;  4UDS A;  2COB A;  2QKO A;  1WPK A;  2ECC A;  2JA5 J;  3ON4 A;  5FMP A;  3BR3 A;  4IHY A;  1TWC J;  2NOG A;  1MSE C;  1GT0 C;  5GPC A;  3ON2 A;  5F1J A;  3JRA A;  2XPW A;  1HLV A;  3TW6 A;  3FIW A;  3FKI J;  4Y7N J;  3GTK J;  1PUF A;  2LVS A;  5IYC J;  1B8I A;  3TP0 A;  1U8B A;  2YU9 J;  3C2B A;  1LE8 B;  4XK4 A;  3NI7 A;  4GCT A;  1B72 B;  1GV5 A;  5GPA A;  3ZOB A;  5K7H A;  4ACI A;  3LNQ A;  3Q0W A;  3P9T A;  4HKU A;  5FJ8 J;  4IEJ A;  2DG7 A;  3PO3 J;  1AKH A;  2KDZ A;  3S17 J;  3ZQL A;  1BJZ A;  1VND A;  5E3N A;  3OIO A;  3JRE A;  5JLW A;  5FGL A;  1K61 A;  2QOP A;  2IU5 A;  2GEN A;  1D5Y A;  4ICH A;  5FKO A;  3BR5 A;  3SFI A;  4BKX A;  3GTJ J;  2EZK A;  1POG A;  3I4M J;  2XPV A;  4FE4 A;  1FTT A;  3K2A A;  1I6H J;  2XPU A;  4QIW N;  1ETQ A;  3E7Q A;  3VOX A;  5EZG A;  3BTL A;  1LFB A;  5HAW A;  2N8G A;  4MLO A;  2DA3 A;  3QQA A;  2ID6 A;  1GDT A;  3HIM A;  4LOC A;  1QVT A;  3UKG A;  3LWJ A;  3FK6 A;  4KWA A;  3JRD A;  2EH3 A;  2L7Z A;  2D6Y A;  4A3C J;  3HOY J;  3VP5 A;  1OJL A;  3AQT A;  4M3B A;  4A3K J;  3S2D J;  3I4N J;  2DA4 A;  3VPR A;  1RKT A;  5F0C A;  3OSG A;  2OI8 A;  1MBF A;  1JUP A;  3LSR A;  1OFC X;  1RR7 A;  3NAR A;  2G7G A;  4DW6 A;  2JJ7 A;  4J19 A;  4A3B J;  2GM4 A;  3VVX A;  3B81 A;  5J1Y A;  1X2M A;  2FD5 A;  2WGB A;  5DAJ A;  2R92 J;  3SDG A;  2W53 A;  4M3D A;  4QTR A; 
#chains in the Genus database with same CATH topology
 2HXI A;  2HZT A;  3HUG B;  5F27 A;  5JHU A;  3J80 Z;  3OYB A;  3H0G J;  4OD4 A;  1BI0 A;  1Z3Y A;  1D3Y A;  2D5V A;  4KNY A;  3RH2 A;  1UMQ A;  3PNY A;  5AIP A;  3E5U A;  1HSJ A;  1UG2 A;  1NG6 A;  3CP2 A;  3HPG A;  3K4L A;  4MEY F;  3DBH B;  3G71 I;  5EGO A;  1NK3 P;  5BNG A;  1WGX A;  2H94 A;  1X1P A;  2LYC A;  2QCO A;  2HOE A;  4CYC B;  1ZG1 A;  1GVJ A;  1SFX A;  5F0F A;  4XQF A;  1FP2 A;  1DUX C;  5DM7 F;  2FOK A;  4IF4 A;  3CJQ B;  1O3R A;  3I59 A;  1IV8 A;  2WY8 Q;  4GXO A;  4BDZ A;  1QBJ A;  2FOW A;  2PLY A;  4X1E A;  5FKM A;  3KCC A;  1SGM A;  4L5I A;  2BE5 F;  5E20 A;  2DFH A;  2MAB A;  3LWF A;  2ZCX A;  1UST A;  3RIR A;  3GYH X;  3KZZ A;  1JKO C;  1KGS A;  4CZC A;  2PN6 A;  5IOY A;  2XDN A;  3F0C A;  2CYY A;  4HX4 A;  1FSE A;  4Z6Y A;  2OPT A;  3OS2 A;  5C4Y A;  4NN1 A;  3V78 A;  4CCM A;  5HLT A;  2ME6 A;  4XRF A;  1JHH A;  1FNN A;  3ERE D;  1K79 A;  2D1H A;  2EIL H;  4JQF A;  4XOT A;  3E3V A;  4S04 A;  5CVR A;  2M2E A;  2RC4 A;  2V57 A;  1L3L A;  5IY5 H;  3RTR A;  2LFB A;  3F6V A;  4BQN A;  1Z6R A;  1GLN A;  2FJ1 A;  3VYT B;  1R9T J;  3BR2 A;  2QKM B;  1G3T A;  1ZRF A;  2MSY A;  3HOX J;  5DCM B;  1AHD P;  3SZG A;  4CYD A;  4FHT A;  3IH4 A;  2LSO A;  4HA8 A;  3S1R J;  1KA8 A;  1W5S A;  2QQ8 A;  1N25 A;  3KZ9 A;  4M6V A;  4RM3 A;  5E8G A;  3TW7 A;  4HLY A;  2LY9 A;  4WK8 F;  2LD5 A;  1SC7 A;  1DPU A;  4PK4 A;  2KZV A;  3FXQ A;  1H9T A;  1Z0X A;  4CYC A;  4IJA A;  5E3O A;  2WV1 A;  2ZNZ A;  1MZB A;  5J8F A;  3EUH C;  1KU9 A;  3E6C C;  2JPB A;  2F5V A;  1WQ2 A;  2P81 A;  3M8E A;  3PM1 A;  4GYG A;  1REP C;  5M3F J;  1D0Y A;  1D0Z A;  4XN3 A;  3LJL A;  3A2K A;  3Q0V A;  2BHZ A;  2A68 F;  1JHF A;  4JX4 A;  5EG0 B;  2V6C A;  3EUA A;  5GTH C;  2R7F A;  2EIJ H;  1KQ8 A;  3RQ4 A;  1FZP B;  3EDP A;  3Q5F A;  1FYL A;  4BBS J;  1O7L A;  5CW8 A;  2DA5 A;  1ZRD A;  3H5N A;  5HOO A;  1ZR4 A;  2DK8 A;  1VQ7 I;  4DJA A;  4A3I J;  1QZZ A;  4BHC A;  2RQP A;  5IP7 J;  2L2O A;  3M8F A;  5LGU A;  3KNW A;  5B1A H;  3IWF A;  2WAE A;  3NRV A;  2K4J A;  4W97 A;  3BRU A;  4B09 A;  3LAP A;  3CCR I;  3WGI A;  1FBU A;  1U5T A;  1XMX A;  3X2Q H;  3TMO A;  2R7U A;  4NQW A;  2IRF G;  2OER A;  3BNI A;  1XX5 A;  3CMM A;  5KHD A;  3KZI C;  5FRO A;  3GFI A;  1W5T A;  4OIQ F;  2CQX A;  3CUO A;  2KDO A;  3BG3 A;  5TGT A;  3HOT A;  5B1B H;  2A61 A;  2KRC A;  5E3L A;  2M0M A;  3MVP A;  1R4N B;  1X4P A;  2G3B A;  1YW8 A;  2KIF A;  4U0W A;  4GFB A;  3HTA A;  1LJ9 A;  3WTX C;  3IL2 A;  3G73 A;  1MNM C;  2STT A;  5HBU A;  5FLM J;  3QU6 A;  4G9Y A;  3HB9 A;  2XGE A;  1LDK B;  2QSH X;  4WXC A;  1B59 A;  4KUM A;  3ZMD A;  3A01 B;  2A5W A;  3GTQ J;  3DV8 A;  2L7M P;  5ILS A;  3FMQ A;  4UUS B;  2Z5U A;  1KZH A;  2P6T A;  1IJW C;  4HX7 A;  4BY7 J;  4ETS A;  1I1G A;  2W4S A;  3R0J A;  4BEH B;  4JX6 A;  4LD5 A;  5CVI A;  2BBY A;  2LBF B;  3DPL C;  3QRF F;  4JBA A;  4A0Z A;  5TRD A;  2E2H J;  5E17 F;  1MMG A;  5CLS A;  4A69 C;  3RPQ A;  1GV2 A;  3I5U A;  2G9W A;  4UB8 C;  1WFX A;  2V79 A;  2GOM A;  4MXM A;  3COL A;  4RGU A;  3KLO A;  4ENN A;  5B5E C;  5HDN A;  2KT0 A;  5CXI A;  1YW9 A;  4NDL A;  1FMW A;  3OS0 A;  1FJL A;  3PO2 J;  2DTZ A;  1ZKG A;  2VC1 A;  2FNP A;  1IXR C;  3LSM A;  4O5V A;  3CCL I;  3CF5 F;  4NQW B;  2H8R A;  3VEP A;  2F48 A;  3R6S A;  1J7K A;  4M9Z A;  1APL C;  2OU2 A;  3CC4 I;  3FZV A;  1X3W B;  3BTC A;  5LGT A;  1E3P A;  1WJA A;  3K6G A;  1FBQ A;  2KMU A;  5K7Z A;  1DP7 P;  1YE9 A;  2LNB A;  2W48 A;  1ENH A;  2WAF A;  5FFX A;  4B1R A;  1JT6 A;  3BJA A;  2BY0 A;  2P5K A;  4LLN A;  2CUE A;  4JNN A;  1I27 A;  3MEX A;  2UXU A;  1TW3 A;  2A6E F;  2GFN A;  5M5Y J;  1QVU A;  4BE1 A;  2IT0 A;  1H89 C;  2JSC A;  1F43 A;  2KPM A;  4HPQ A;  3OYC A;  2FQ4 A;  2EFN A;  4EJU A;  1RI7 A;  2ZXW H;  1YJN I;  4XID A;  3I58 A;  3NEU A;  2C6Y A;  4IRV A;  4BU2 A;  2XF6 A;  1A31 A;  1VQ8 I;  5EEG A;  2HXO A;  3K70 D;  1S72 I;  3O8G A;  2A5Y B;  3O60 A;  1OR7 C;  5KK1 A;  3WHB A;  2G0E A;  4E7H A;  1NTC A;  3ABT A;  1VFC A;  3NS4 A;  4Y4R A;  6PAX A;  2Z9O A;  3DLL F;  3DFG A;  4EM2 A;  1MMD A;  2JVG A;  3MNL A;  2QQB A;  4P9F A;  2VJI A;  4L62 A;  1R22 A;  5H6R A;  1IRF A;  1P92 A;  4Z2Y A;  2OAZ A;  4V2F A;  4RA2 A;  4KIT B;  1SD4 A;  4ASN A;  2E1O A;  4N9H A;  5L3D A;  2JA7 J;  2F5F A;  2F6C A;  1A04 A;  1MH4 A;  3NXC A;  4LG0 B;  5CJ9 A;  1KQ9 A;  1OIS A;  4O3M A;  3H0D A;  5ICG A;  1UAA A;  4DOZ A;  1BL0 A;  5EEA A;  3HRT A;  3QOP A;  2XKP A;  3WHC A;  2KLO A;  2YVE A;  3HKZ A;  1FTZ A;  2L3D A;  2ZME B;  3ABL H;  4MNU A;  5CXG A;  1I39 A;  1YS6 A;  3BZ6 A;  4PXI A;  2V26 A;  3LSP A;  4GFK A;  3LA3 A;  2X51 A;  3BR1 A;  2Q2E A;  3T8T A;  1XN7 A;  1Y1W J;  3QKX A;  2RVC A;  5KCM A;  3L09 A;  3QPL A;  3PSI A;  2R7W A;  3TED A;  3KEY A;  4RGX A;  3BRO A;  3VW1 A;  2QVO A;  2W25 A;  2VPL A;  5HLI A;  1F5T A;  5LRR A;  3HTI A;  4RS8 A;  2HDD A;  3OYG A;  1K7A A;  4ZH4 F;  4FX0 A;  1QPM A;  4J01 A;  4G94 A;  2VON A;  1M1E B;  2L02 A;  2R5Y B;  1PYV A;  3S93 A;  4I98 B;  1A5J A;  4YFX F;  4E7J A;  2WAQ A;  2LKS A;  2JTV A;  2EWN A;  1JUM A;  1XS9 A;  5LFA A;  2M0C A;  3SFZ A;  5EYR A;  2ZXH A;  1JUS A;  1E3O C;  3F22 A;  1LE8 A;  4XOR A;  4NEL A;  1VQM I;  1TWA J;  2R7D A;  3B6A A;  4JX5 A;  3OYJ A;  2HS5 A;  1X2N A;  1UJ8 A;  3GZ5 A;  2QQ9 A;  4BL0 B;  1SFK A;  5M5X J;  1AKH B;  2E7W A;  2VI6 A;  1ZR2 A;  3VSK A;  3KKC A;  4L0Z B;  1HBX G;  3F3X A;  3KP3 A;  1IDZ A;  2M87 A;  3BOQ A;  3H92 A;  1MBK A;  4XRS A;  3W2W A;  4P1W A;  4FCY A;  3LST A;  2OZU A;  3WTV C;  4HNU A;  2DMQ A;  1OYW A;  4A3M J;  2DA7 A;  3I53 A;  1QHG A;  4OU0 A;  4RLF A;  3IKV A;  1R00 A;  1V3F A;  4EJO A;  5FB2 A;  2EIK H;  4ZJZ A;  2DPD A;  4BQO A;  3DCF A;  1MBE A;  4WWC A;  3RYP A;  2X6W A;  1ETK A;  1OCP A;  3L7W A;  2XRL A;  4D7M A;  3OY9 A;  1BA5 A;  2NOJ B;  1T8I A;  5GAD J;  3HRM A;  3CRJ A;  2R0Q C;  3FK7 A;  2WC2 A;  4AF5 A;  3BY6 A;  1K6O A;  2Q0O A;  3IUO A;  5FKL A;  1P7J A;  2ELK A;  1BBY A;  1BM9 A;  2WB1 N;  2CGP A;  3R4K A;  2XRN A;  1ZAO A;  4ZZL A;  4RB3 C;  3CCJ I;  2FBI A;  2ECC A;  4MQV A;  1BN5 A;  3L9F A;  1TWC J;  1BOA A;  5D6E A;  1GT0 C;  2PMU A;  5GPC A;  1LVK A;  2MLG A;  1Z9C A;  3ELK A;  1HLV A;  4E4H A;  1A36 A;  4LJZ F;  4LG3 A;  3GTK J;  3K9T A;  1XSV A;  3WTY C;  1YLF A;  3H5A A;  2BV6 A;  3F9K A;  4HBL A;  2RRE A;  1Y0U A;  3IAS 2;  4KIC A;  5GTI C;  1LKX A;  1KYW A;  1ZLK A;  4M73 A;  3D5R C;  3TOB A;  4HST A;  1KYZ A;  1TT0 A;  4UV9 A;  3ZOB A;  1BC7 C;  3V7S A;  4AM3 A;  5D6F A;  4L9T A;  2DQR A;  3LFU A;  2XF5 A;  3PNV A;  3H36 A;  2OCC H;  2QM3 A;  1VQO I;  2BW3 B;  2K85 A;  2P5L C;  3CES A;  1IXC A;  3HJE A;  3OIO A;  1E0E A;  5JLW A;  1O3T A;  4EQQ A;  4BNC A;  1WKM A;  4ENJ A;  2X1E A;  3E6M A;  5E1X A;  3FXL A;  2GEN A;  4ICH A;  2NVU B;  4F91 B;  5FKO A;  4CDG A;  3A0H C;  1ZHF A;  1IN4 A;  2H09 A;  2P5V A;  3BR5 A;  1FYK A;  2ISZ A;  2KL4 A;  3SFI A;  3KP4 A;  4R1H A;  4BKX A;  4H4K C;  3WE3 A;  5JVT A;  3GTJ J;  1ZH5 A;  4IOA F;  1X1B A;  2BXZ A;  5CQE A;  1HA8 A;  2P6S A;  1HW5 A;  3W6K B;  3P9C A;  4OAZ A;  1FTT A;  3WTU C;  5HNF A;  2XPU A;  4QIW N;  1ETQ A;  2A2F X;  1QU3 A;  3CCS I;  3OYN A;  3VOX A;  4KMU X;  1SVM A;  3CLQ A;  4KIB A;  4U0V A;  1MKM A;  4AWX B;  4LOC A;  3LWJ A;  3DWL E;  4KWA A;  3AG4 H;  2EH3 A;  3VSL A;  4S05 A;  2D6Y A;  3HOY J;  4YRV A;  3QYE A;  3AQT A;  3O2P E;  4I09 A;  3DKX A;  5ICC A;  4BEH A;  3VPR A;  2EFO A;  3V8K A;  1MDM A;  2K9M A;  1HKS A;  3OSG A;  3LSR A;  1V5E A;  1OFC X;  2OZ6 A;  2ZME C;  4BJ5 C;  4DW6 A;  2W82 A;  3KIO A;  4XON A;  4J19 A;  2GM4 A;  4A2U A;  4PFP A;  2WGB A;  2R92 J;  1Z7U A;  3RKY A;  2CMP A;  1Z21 A;  4M3D A;  4M72 A;  4IO9 F;  3D1N I;  3JSJ A;  3LSJ A;  2HZD A;  4UUV A;  4J00 A;  2O7O A;  2RKH A;  1OCR H;  1Z7L A;  1JJ6 C;  5JLX A;  4S0H B;  5D1R A;  1R36 A;  1PP7 U;  2BW3 A;  1K6Y A;  2DT7 B;  2OQR A;  2V1D A;  5BQT A;  3CCV I;  1K4T A;  4LK0 F;  1HOM A;  2P0W A;  4C2M A;  1BIA A;  2CG4 A;  3SZT A;  2UZK A;  3OMY A;  2P8T A;  2HI3 A;  3M3Y J;  2AQE A;  2DA1 A;  2E7X A;  3R61 A;  2E2I J;  2EPF A;  3ERM A;  3QPH A;  3K4C A;  4HNV A;  4M71 A;  3K70 C;  1BI2 A;  4GGG A;  4YII A;  2XSJ C;  3GME A;  2PMZ A;  4BHP A;  1OPC A;  5J4Y A;  2NS0 A;  2XB0 X;  4WXH A;  5K1Y A;  2LTP A;  4NUB A;  4Q47 A;  3CCU I;  4LLG F;  1P7I A;  3ASO H;  4A5N A;  1XSD A;  4AIH A;  2Q1Z B;  2XGD A;  4ENK A;  2IP2 A;  2DOE A;  3HRU A;  3S1Q J;  2DOD A;  1LNW A;  3FXR A;  4IQ4 A;  4EEF G;  2RAS A;  3IRQ A;  4KFC A;  3EYI A;  4CUG A;  4FAS D;  1JKP C;  3OIQ A;  1Y6I A;  3DEW A;  1ETY A;  4I76 A;  2CUF A;  5H6Q A;  4DYC A;  1FEX A;  3V8J A;  3HOW J;  2VKH A;  2VQH A;  3LL7 A;  1RRJ A;  1G59 A;  3UNG C;  3S5R A;  4WX9 A;  3QP5 A;  2RAE A;  3FDY A;  1D0X A;  4C9Y A;  5C4J J;  2ISY A;  2G7U A;  3HHH A;  1E17 A;  2XF7 A;  2H1K A;  2VL8 A;  1BI3 A;  2OA4 A;  1O7F A;  5FHP A;  3M9A A;  1TWG J;  2L7F P;  2VJJ A;  1YIO A;  3RQI A;  3TQN A;  2BY3 A;  4ZDO A;  3CD6 I;  4RB0 A;  1Z05 A;  1Y8R B;  1MBH A;  1X1C A;  4G6Q A;  4L9V A;  3G1L A;  1RIO H;  4CO8 A;  3DEE A;  3HTU A;  3BP8 A;  2CWE A;  3LHQ A;  1BR2 A;  2BVM A;  2E71 A;  3C3W A;  2EIN H;  3S3N A;  2HQR A;  2VC0 A;  1WI3 A;  3I56 I;  2NS8 A;  2QF7 A;  2M7B A;  3B6C A;  2VOO A;  1RET A;  1VTN C;  2R7X A;  2M30 A;  4AC6 A;  2IJL A;  1HDD C;  4HQE A;  1X1D A;  4KDP A;  2G7S A;  1YRN A;  2DDB A;  2LK2 A;  4KYW A;  4DIQ A;  2EIM H;  2VXZ A;  4NC7 A;  3CUQ B;  4C2T A;  1GXP A;  4NNJ A;  1X3Z B;  1DU6 A;  3CC7 I;  4UVB A;  1QZY A;  5LEK A;  2DCE A;  2HKX A;  2WAD A;  3OSF A;  1QNT A;  1OMI A;  3J7A O;  5F6F A;  1W36 C;  2ZC2 A;  5IP6 A;  1MMS A;  2LC2 A;  4XLF A;  3CCY A;  2JA8 J;  2EZH A;  4RAF A;  2DK5 A;  2E1M B;  3OL4 A;  2QIB A;  2NNY A;  1TNT A;  3DU5 A;  2F07 A;  3NRG A;  4PFO A;  3CMY A;  2XC7 A;  3F23 A;  2IBD A;  4UVC A;  1LEA A;  3BG5 A;  2JPC A;  5F64 A;  3QU3 A;  2EZL A;  2GIZ A;  3EET A;  3MZ8 A;  3H3V K;  2EFP A;  2O61 A;  3HSE A;  2RDP A;  2XAS A;  3ZQC A;  4EM0 B;  2UXI A;  2Y9Y A;  3KEO A;  5E1W A;  3WU0 A;  4PSW A;  3HIF A;  4AD9 A;  1K78 B;  5A2Q Z;  3BJB A;  4BXU A;  2DPU A;  4PGG A;  1IAW A;  3FIS A;  4FE7 A;  1FOY A;  2IGO A;  2LF7 A;  5E3M A;  4C3J J;  2AQF A;  1YIJ I;  4A3G J;  1V4R A;  3J7Y J;  2K9Q A;  1MNE A;  5JVG F;  2XVC A;  2CFX A;  1TZL A;  1S6L A;  1P9Q C;  2R5Z B;  2A69 F;  5KVR A;  3IAM 2;  5KNL A;  4D1Q A;  3HOZ J;  2IAI A;  1JTX A;  1QZE A;  4IHW A;  4XKB A;  2M8G X;  4Q4Z F;  2DT5 A;  4DYQ A;  1SD6 A;  2EQR A;  3OYL A;  2K02 A;  2GXB A;  5IYB J;  2Z3Y A;  1TBX A;  4A3L J;  1V5F A;  4YIF A;  1LQ1 A;  3G1M A;  3KP2 A;  3PUB A;  3CCE I;  2VUM J;  2NRA C;  1FC3 A;  4GRI A;  2CQQ A;  1IXS B;  2LY1 A;  4CCK A;  1DP3 A;  1MH3 A;  1IC8 A;  1S9H A;  2WA0 A;  2DA6 A;  2M5W A;  3TBI A;  4UY8 I;  2OTJ I;  2CUZ A;  3VOE A;  2MFZ A;  3ZMU A;  2MD0 A;  2PJR B;  4PJ0 C;  1OKR A;  1DDN A;  4A3D J;  3VUQ A;  2CV1 A;  3MFK A;  4RM2 A;  4XLC A;  1W7P D;  2V9P A;  5FLV A;  1DGR M;  2BYV E;  5EGO B;  1FWZ A;  4N4O B;  5D4S A;  4M6Y A;  1IRX A;  1MGT A;  2CH0 A;  3TKY A;  2FBH A;  1Q1V A;  1Y1V J;  3FWE A;  2IPQ X;  2FJI 1;  4GCK A;  1IN8 A;  4DQ2 A;  3I59 B;  1WWX A;  1IUF A;  1TW2 A;  3T5X A;  3JR9 A;  1DGW Y;  2WTE A;  1R7J A;  4ESB A;  1Y8Q B;  4HLX A;  2OCE A;  3UR3 C;  3S1N J;  3E5X A;  4CSW A;  5C3E J;  3MKZ A;  3GTP J;  1X1A A;  2E1M C;  3CDH A;  4A3E J;  3I3L A;  2X48 A;  2ZJR F;  4HYE A;  3S15 J;  2MGQ A;  4DNC A;  1F36 A;  3EYY A;  3C2G A;  1ZG5 A;  4EM1 A;  4A3J J;  5L3C A;  4RAZ A;  2ZCW A;  2BZT A;  1JTY A;  2UXO A;  1ETO A;  3CTA A;  2W00 A;  5TIS C;  3PFI A;  2H27 A;  1T95 A;  3W2A A;  3JRI A;  3FBI B;  3WOD F;  5DS9 A;  1YS7 A;  3OYE A;  3W2V A;  4N4N B;  4M3G A;  3G1O A;  3GF2 A;  4V19 K;  3F21 A;  2GBY A;  4KJZ A;  3GLX A;  5DCM A;  5J40 A;  4LGW A;  2XGC A;  3C1D A;  5J1R A;  4BY1 J;  2KIQ A;  4I7H A;  4ZYD A;  3FXO A;  5BS6 A;  2COM A;  3PFY A;  2JUC A;  2PMZ N;  4AYB N;  4MGR A;  5IYD J;  2H6B A;  3ANG A;  1MIJ A;  1HKQ A;  4HAM A;  3T8R A;  2LH9 A;  1O3S A;  2F5C A;  1XB4 A;  4HDU A;  3Q3S A;  3ECH A;  2HWV A;  2DJN A;  2QEN A;  2WV0 A;  1J75 A;  1XD7 A;  2LP0 A;  1BR4 A;  3NQO A;  2DI3 A;  5CPR B;  4UNO A;  1PP8 F;  1ZGW A;  3LOC A;  3QOD A;  2X0L A;  4U7D A;  3IV5 A;  3QPT A;  3D5L A;  1OYI A;  4EGZ A;  5EG0 A;  1GUU A;  4LK1 F;  1RUO A;  2RNJ A;  3F8N A;  5H9T A;  4B3A A;  3LA2 A;  3RYR A;  5C44 J;  3OR2 C;  1VQ5 I;  1KQ0 A;  2IA2 A;  4I99 C;  4XKV A;  2DTR A;  3HE0 A;  1EA3 A;  1GXQ A;  1ZG3 A;  2P7C B;  3I54 A;  2HYJ A;  2L4A A;  1DPR A;  1SMY F;  1MW7 A;  5HNH A;  3DBR B;  1T38 A;  1E3H A;  2GQQ A;  4B4C A;  1VF9 A;  3AG2 H;  3JRB A;  2FBQ A;  1O57 A;  3QYF A;  3CCM I;  4D7N A;  1V54 H;  2HFH A;  2W1O A;  2DQL A;  2ETH A;  3LSI A;  2O8K A;  4JL3 A;  2LY2 A;  4UUT A;  1I3Q J;  3OYA A;  2ELJ A;  4F3Q A;  3IUV A;  1T08 B;  5DYM A;  2HOS A;  3FF5 A;  5DV5 A;  5M5W J;  4L9N A;  4HZF A;  3KP5 A;  3G7R A;  4XLH A;  2L54 A;  4LMY A;  3WGH A;  3HEF A;  3BLY A;  1UG0 A;  2FF4 A;  4QWQ A;  3V6G A;  1A6I A;  2F4M B;  2M3A A;  4IRH A;  1SEU A;  2Z1D A;  4XIC A;  1B1B A;  3G2B A;  1JXS A;  1USS A;  4RAG A;  2PFV A;  4F92 B;  2DMU A;  3DKY A;  1H8A C;  5F0H A;  3K4J A;  2EA4 A;  3K1P A;  4AVZ A;  3HPH A;  2OQG A;  4QSH A;  2W85 A;  3H9J A;  3LQQ A;  1VZ0 A;  4RGS A;  1C0W A;  1HKT A;  3L2U A;  2UV1 A;  3M1E A;  4HNT A;  1V5G A;  4CZZ A;  4U9L A;  2X6X A;  2GOX B;  1MJ9 A;  5FKN A;  2VOD A;  3K1M A;  1XGS A;  5DCF A;  1MND A;  2LBF A;  4GFL A;  2UWM A;  3IRR A;  2XAQ A;  4A0X A;  4IX7 A;  1T2K A;  3ESW B;  4II2 A;  3TDU C;  2IS2 A;  5CVU A;  1TWF J;  2WY7 Q;  1S7E A;  2JVH A;  3A02 A;  5CYV A;  3S16 J;  3ASN H;  1QGP A;  3PJR A;  2HEO A;  1HW1 A;  4K2E A;  3K4M A;  4OMZ A;  5D5V B;  1SVO A;  1WPK A;  2JA5 J;  1GHC A;  3ON4 A;  5FMP A;  3BR3 A;  2EK5 A;  2K7L A;  2NOG A;  1E2X A;  1L0O C;  2KHM A;  3JRA A;  2XPW A;  3HTS B;  4HQM A;  3KP7 A;  3OYM A;  4E7I A;  4OAY A;  1D8K A;  4TV7 A;  4F52 A;  1PUF A;  4DBR A;  4BQQ A;  2VB6 A;  2ZBK A;  3TP0 A;  1S8N A;  4JK1 X;  1CF7 B;  2VOP A;  4ITV A;  1CGP A;  3OIP A;  4XK4 A;  4GCT A;  4XKW A;  3BC8 A;  1B72 B;  3M8J A;  1YJW I;  5K7H A;  4I0B A;  1N75 A;  1V55 H;  3M07 A;  3LNQ A;  3Q0W A;  1R23 A;  1UEL B;  5K5Q A;  3P9T A;  4ACI A;  1KU7 A;  2B3W A;  5FJ8 J;  4PGH A;  2KDZ A;  3S17 J;  2A6T A;  3MKY B;  1IN5 A;  1FPQ A;  1W7P A;  2CW0 F;  1SMT A;  4KIG A;  3WU1 B;  2ESN A;  4HV6 A;  3I0T A;  5FGL A;  1K61 A;  2IU5 A;  2QWW A;  1D5Y A;  3DTI A;  3CLO A;  3HSF A;  2AXL A;  4XL9 A;  1W5C C;  2O5R A;  3RCO A;  1BI1 A;  1IZ1 A;  4YFK F;  3PUF A;  2HQA A;  2JRT A;  5FFZ A;  3BCB A;  1TQP A;  5ERI A;  4PJL A;  2CQN A;  1TT5 B;  2WB1 A;  1F4K A;  3E7Q A;  1YX5 A;  1IF1 A;  1LFB A;  1XMK A;  1JE8 A;  2BHY A;  2MC3 A;  3MAJ A;  3GO5 A;  2HNH A;  1QVT A;  3UKG A;  1R1V A;  5E79 C;  3LSH A;  1Q1H A;  3FXJ A;  3JRD A;  3WTW C;  1AWC A;  2LMD A;  2MH2 A;  3VP5 A;  2PMH A;  3VB2 A;  3P9K A;  4M3B A;  3S2D J;  5GAG J;  4OIR F;  2XHK A;  2GA1 A;  2HYG D;  4C30 A;  3FX3 A;  1RR7 A;  2J5P A;  3NAR A;  2G7G A;  3OYD A;  2QSG X;  2LF8 A;  4FT8 A;  1ON2 A;  3E1S A;  3J81 Z;  3B81 A;  1X2M A;  3CZ6 A;  3SDG A;  1SD7 A;  3EPZ A;  3LFK A;  1FY7 A;  2JK3 A;  3GEU A;  4EJV A;  1R4M B;  3T6N A;  3BTJ A;  2W57 A;  2CUJ A;  5A2Q K;  1FX7 A;  3U1K A;  2FNA A;  2JSP A;  4KIS A;  2EB7 A;  2E60 A;  1EH7 A;  3IH3 A;  5HS9 A;  1D1A A;  2V1N A;  1W7P B;  4BYY A;  5LLQ A;  4ZYA A;  2JUG A;  3ZPL A;  1T0F A;  3VW2 A;  2RHA A;  1SAX A;  5FLX K;  2G7L A;  1WH7 A;  1FBS A;  3HOV J;  2EBI A;  3PIO F;  3ZP5 A;  3H5R A;  5H20 A;  5LGN A;  3S2H J;  3GTG J;  4I01 A;  1QHH D;  1MBG A;  1TP4 A;  1PJR A;  1HQC A;  3CO6 C;  3K10 A;  3OS1 A;  3HRS A;  5LEJ A;  3FHN A;  3WGG A;  3SQN A;  5ICE A;  2CO5 A;  1U3E M;  2DYS H;  2XAG A;  5AIQ A;  1HDP A;  3F8M A;  2O03 A;  4KT6 A;  1Z77 A;  2JZY A;  2IA0 A;  4ZYH A;  3MN2 A;  2NVQ J;  1SFO J;  3DF8 A;  2B63 J;  4WXD A;  3BWG A;  3O3K A;  1CQT A;  2QTQ A;  3SXY A;  3COA C;  3IKT A;  4D9J A;  2HDW A;  4KT5 C;  4MEX F;  2DYR H;  2RNG A;  3H3Z A;  3DXJ F;  3KP6 A;  2KIU A;  2IS6 A;  2CQ7 A;  1N77 A;  1MD0 A;  3CCQ I;  3ZQF A;  2R7S A;  1NG7 A;  3F1B A;  2X6Y A;  2HTS A;  1BW6 A;  1YHQ I;  1B4A A;  1R5G A;  4MIM A;  2R4G A;  3LA7 A;  4N0B A;  4GDF A;  2DFF A;  3FMR A;  1WCM J;  2K86 A;  4G6D A;  4XLN F;  3BPV A;  3V8L A;  5AQC A;  1WJC A;  3R60 A;  3GEZ A;  3BZC A;  4CA0 A;  1J59 A;  2PFB A;  2LRE A;  4X6A J;  2UXN A;  3HYI A;  2DFI A;  4D0P A;  1QPI A;  1WHU A;  4M3F A;  1G3S A;  2AS5 F;  1J0R A;  1ZAR A;  3BQY A;  4KN4 X;  3A01 A;  1ON1 A;  1WZ2 A;  1ZN2 A;  3JSP A;  1ZK8 A;  4IRG A;  1I50 J;  3TO7 A;  3LSK A;  1KU3 A;  4XRM A;  3BR6 A;  4MO7 A;  3RKQ A;  1J2X A;  3K1N A;  3EQL F;  2R7Z J;  1FLI A;  2K3P A;  2EA2 A;  3Q0U A;  3GXO A;  3NPI A;  1ETX A;  4DGW B;  4UXN A;  4YZE A;  4P96 A;  5IP9 J;  2NVT J;  5CVJ A;  3IH2 A;  2GLO A;  2JT1 A;  2PI0 A;  4PDK A;  1VI0 A;  2L9N A;  4GCL A;  3MD2 A;  2GIV A;  1EH8 A;  2L0K A;  4RGR A;  3L2W A;  1RKW A;  2V4J C;  2B7E A;  1JKR C;  5C4X J;  3BDD A;  2MW8 A;  2M9H A;  4EJT A;  1G3Y A;  3F6O A;  3G3Z A;  1UFM A;  4XSZ F;  2Z33 A;  1RUN A;  2ZFW A;  3HL2 A;  5IPA A;  1IO2 A;  2NS7 A;  4PUS A;  2YVH A;  2JMW A;  2X1C A;  4CGZ A;  3HM5 A;  1SVL A;  2BXY A;  1X4O A;  4EAT A;  3AG3 H;  4L9J A;  2CQK A;  5D8K B;  1XPX A;  3L2R A;  5KAF C;  4CCN A;  2DMT A;  3VDX A;  4E70 A;  4PJJ A;  2QYO A;  2Y48 A;  1FOW A;  1BW5 A;  2E5Z A;  1A35 A;  3ZR8 X;  2DXI A;  4JKZ A;  2W24 A;  2NVX J;  2BEO A;  2OJE D;  4P5O A;  2KZG A;  4PJN A;  2AXT C;  2DDA A;  5IOZ A;  3EGQ A;  2F4I A;  4B8X A;  3ULQ B;  4D5F A;  2DMN A;  2Y0S N;  3VW0 A;  3WU2 C;  4E6K G;  2OD5 A;  4HF0 A;  2Y0S A;  3ISP A;  1SD5 A;  2HVR A;  3SYT A;  1G4D A;  2IS4 A;  4D5C A;  3FKJ A;  5FD5 A;  2ELH A;  4OD5 A;  1O4X A;  4C2M J;  1BJA A;  3FBN B;  3MQ0 A;  2REK A;  2NAZ A;  2VE9 A;  3T1B A;  4UB6 C;  1WJD A;  3ONQ A;  3ANP A;  2FUG 2;  3HBL A;  2B1E A;  4IVN A;  2MD5 A;  4A3F J;  4EMS A;  2TCT A;  4ZC3 A;  3GTM J;  1W36 D;  2EZI A;  5AON A;  2NP3 A;  1ZLJ A;  2CV0 A;  2D45 A;  4U87 A;  4YEJ A;  1TQI A;  5TJJ A;  3EUP A;  3OWT A;  1XGN A;  3BQZ A;  3S8P A;  2NXN B;  2L7K A;  1YG2 A;  3BPX A;  5DD4 A;  3HC7 A;  4LLL A;  5FRN A;  2NX4 A;  2I5U A;  1XCV A;  2R7R A;  1PUF B;  9ANT A;  2VN2 A;  1R1T A;  3FRQ A;  4BHB A;  1OR7 A;  1ZQ3 P;  2XV4 S;  4XKC A;  2DMP A;  4JP0 A;  1D1B A;  4XR6 A;  2QUF A;  2VIX A;  3S3O A;  3HGY A;  1HC8 A;  4R79 A;  2ZCN A;  3SEQ A;  4C2U A;  4EV0 A;  3GTL J;  2RN7 A;  2O7T A;  2H1L A;  3ZQ7 A;  1LUJ B;  1XTA A;  2LR8 A;  1LPQ A;  1FYM A;  4Y17 A;  2ZY9 A;  2PQ8 A;  5HS8 A;  3U1D A;  5GAH J;  3KE2 A;  4LB6 B;  4IHX A;  4OIP F;  3OYK A;  3ROU A;  1KU2 A;  5BPD A;  1TL8 A;  1OCC H;  3GBG A;  5GP9 A;  3U21 A;  3VVY A;  1N78 A;  3JAM Z;  1OCO H;  2H6C A;  5D18 A;  4GO1 A;  4UUS A;  1XGO A;  2V7F A;  2KJC A;  3BHQ A;  4CIC A;  1Z67 A;  2FX0 A;  3VOK A;  2V1X A;  2E35 A;  3RPU D;  5CKT A;  1WJF A;  4RMN A;  1I6X A;  1ZGJ A;  3GCM A;  1P4A A;  3Q9S A;  5L3B A;  5FGM A;  5D5U B;  4LB5 A;  2DFE A;  3JRH A;  4A0Y A;  3BG6 A;  4AIJ A;  3BJ6 A;  4FQG A;  3S2W A;  1FIA A;  1G8X A;  4YEL A;  2FU4 A;  1U78 A;  4RB1 A;  1TNS A;  2XSD C;  2AO9 A;  4DZJ A;  3CQZ J;  3NNR A;  1XMA A;  4WIB A;  1ETV A;  3VIB A;  2XAF A;  2Q8K A;  1U9N A;  3SJM A;  2WUI A;  5K58 A;  3AFH A;  3OYH A;  2CW7 A;  2L5Q A;  3MCZ A;  1FSH A;  2K9N A;  2KIS A;  2VT3 A;  1NK2 P;  3A4C A;  3RI4 A;  4EJW A;  4AU7 A;  3E6B A;  3GVA A;  2XKO A;  3WE2 A;  3RPU A;  3ZQH A;  2XRO A;  1X19 A;  2EFQ A;  3FM5 A;  1LFU P;  2LRD A;  4LIU A;  2F2E A;  2VKV A;  2QGU A;  1R1U A;  4IRI A;  5IT9 Z;  1B9M A;  1YJ9 I;  4MFE A;  4B48 A;  3GFJ A;  2CV2 A;  1VQ6 I;  4AUX A;  1ODD A;  3K2Z A;  2XIG A;  1UZC A;  3O8H A;  4HX8 A;  3M7G A;  5JFR A;  3JRC A;  2E1C A;  1UI5 A;  1QA6 A;  3VYR B;  5FD6 A;  3JCU C;  3M1C A;  2Y2Z A;  4UV8 A;  2YVX A;  5J4V A;  2CU7 A;  4BBR J;  1EJ9 A;  2V9V A;  2M34 A;  2HOA A;  3P5J A;  1AOY A;  3AKZ A;  2E19 A;  3HTJ A;  3K4B A;  2XAJ A;  1KON A;  3QAH A;  3JRG A;  1PDN C;  1HCR A;  3HOU J;  1U6G A;  3VWB A;  1Z91 A;  2Y31 A;  2TDX A;  5HLH A;  3DQV C;  4A6D A;  3W6V A;  3JRF A;  2R93 J;  3ZCO A;  1YIT I;  2QSF X;  3ECO A;  1K78 A;  1U2W A;  4L18 B;  2JWT A;  2HPM A;  2QWT A;  3L2Q A;  2HPI A;  3C7J A;  1G2H A;  2Y69 H;  1B9N A;  3K69 A;  4G12 A;  3OR1 C;  4IXA A;  2IVM A;  3G6E I;  3VTI A;  2ZKZ A;  1JKQ C;  1JGG A;  4ZTJ A;  2ZOY A;  3FXK A;  2W7N A;  2EV5 A;  4C3H J;  2HVQ A;  2K9S A;  3PAS A;  3D0S A;  4M9S A;  2PBX A;  3GUD A;  2X1D A;  3F8B A;  3DLA A;  1ONV A;  5BOX A;  4N9I A;  2GA2 A;  2LKP A;  1ZTR A;  2NVY J;  1ZYR F;  2PBI A;  1F9N A;  3GX4 X;  2HQN A;  2LKX A;  5D5X B;  4Y15 A;  4ZYG A;  4B44 A;  1WJ5 A;  2PZ9 A;  3V7C A;  2L9S A;  2E2J J;  4I6Z A;  2DO7 A;  5J3L A;  4DYR A;  2Q24 A;  1Z1D A;  3JAM K;  3BTI A;  1IUY A;  1QRY A;  3M4O J;  3HDD A;  4UDS A;  1RR8 C;  2QKO A;  4IHS A;  5J47 A;  1BOB A;  3EUH A;  1Z3X A;  2F4O B;  1MSE C;  2YX7 A;  1STZ A;  5ILV A;  1ZEL A;  5F1J A;  1TLH B;  4U88 A;  1I5Z A;  3ZN1 A;  3IHU A;  4JOM A;  3TW6 A;  3FIW A;  3FKI J;  4Y7N J;  1B8I A;  4MTE A;  3HZJ A;  1Z6T A;  5HS7 A;  1WJB A;  2FBK A;  3Q9V A;  3KET A;  5L3F A;  4ZYE A;  3C2B A;  1LE8 B;  2PJP A;  1YOV B;  3ZXS A;  4NB5 A;  4U7B A;  2O8X A;  1P6R A;  4PSX A;  2DBB A;  2FXA A;  4IEJ A;  3E6D A;  2MLK A;  2DG7 A;  1AKH A;  1BC8 C;  1R5H A;  3DPT A;  2OUM A;  2M1B A;  4BJ6 C;  5IT3 A;  4YIR X;  4U0Y A;  1VND A;  4HDV A;  3JRE A;  4WCG A;  2XAU A;  2QOP A;  3QP6 A;  5HVQ C;  2V9K A;  2VKD A;  5K5O A;  2FML A;  2BY2 A;  1EV7 A;  3GFL A;  3WG9 A;  3PQJ A;  2GXA A;  2EZK A;  2QBY A;  5LBQ A;  2YSR A;  4E7Z A;  4E7K A;  3WTZ A;  3OYI A;  3PQK A;  4IQJ A;  2LG4 A;  5LHG A;  5HAW A;  5EZG A;  3BTL A;  5DEQ A;  4AVP A;  2N8G A;  4MLO A;  2ZFU A;  3L2V A;  3FM3 A;  1LEB A;  2W84 A;  2ID6 A;  3HIM A;  2WBM A;  3W6J B;  1R58 A;  2VLA A;  1VQK I;  3LQR A;  3FK6 A;  2E34 A;  4B43 A;  4A5M A;  4A3C J;  1OJL A;  4A3K J;  3ZMS A;  3I4N J;  2DA4 A;  3R0A A;  2DLL A;  2KKO A;  2I8D A;  5F0C A;  3MKW B;  2P7V B;  2OI8 A;  3WTS C;  3V7R A;  1MBF A;  3ZMT A;  4CXF A;  3N4M A;  2STW A;  2VQC A;  5E1Z B;  2A05 A;  2CFO A;  3A0B C;  4KA4 A;  3SHF A;  2V6E A;  3BZK A;  2FD5 A;  5DAJ A;  1P4W A;  2ESH A;  4IL6 C;  3JSO A;  5LD2 C;  1YO5 C;  1Y0N A;  3DTE A;  2RQQ A;  4HW0 A;  2NYX A;  3I64 A;  2VXD A;  4QTR A;  1S7A A;  4G7O F;  1TQM A;  1AU7 A;  2EV0 A;  1R49 A;  1DU0 A;  2XB5 A;  5HSZ A;  2ECB A;  3H1C A;  4ZZD A;  3CF2 A;  2R7T A;  2OTL I;  2JQ7 A;  1TWH J;  1O3Q A;  4M9X A;  5HDK A;  2OBP A;  2ACJ A;  4B3X A;  1W0U A;  2M45 A;  2TRT A;  2V1U A;  1TTY A;  1IGN A;  4XM3 A;  2FSW A;  2ZO4 A;  2AHQ A;  1RES A;  3OV8 A;  1TC3 C;  2DA2 A;  1OYY A;  1HF0 A;  4CH7 A;  3KYL A;  1YYV A;  3CUQ A;  3GLL A;  1BIB A;  2K9L A;  5FO5 A;  2NP5 A;  5EF6 A;  3DEU A;  3H35 A;  3BG9 A;  4Y3O A;  4XN0 A;  3BR0 A;  3GTO J;  3F72 A;  4XBF A;  1HXD A;  5DTD A;  3AG1 H;  3BG7 A;  1FP1 D;  3NAU A;  1U0J A;  2UUZ A;  2UXX A;  3ZQQ A;  2HU9 A;  3J7A Y;  2VPR A;  3I71 A;  2YU3 A;  4PJM A;  3HXL A;  3RKW A;  4EGY A;  3K7A J;  3I4P A;  3GZI A;  2IXS A;  2QA4 I;  1IDY A;  3DKW A;  5ED4 A;  1IRG A;  1NHA A;  2VJ4 A;  1YFH A;  1HW2 A;  4OIO F;  1ULY A;  2YR2 A;  1H0M A;  3S14 J;  1UHM A;  1XCB A;  1H88 C;  1ERD A;  1QQI A;  3MWM A;  2I10 A;  3IC7 A;  5J8C A;  2YUS A;  2L9R A;  2MBF A;  5FKK A;  1OCZ H;  3U9G A;  5JI6 A;  4LG0 A;  1R5I D;  2HDC A;  1UCR A;  3HTH A;  3P7N A;  1XSX A;  3S1M J;  2Y9Z A;  3DPU A;  1XDU A;  4C3I J;  2IS1 A;  3PSF A;  1J5Y A;  3K4N A;  1WJE A;  4IHV A;  4NC6 A;  3C18 A;  2GUH A;  5LRS A;  3P9I A;  2ZXJ A;  3HOS A;  2ZME A;  1LVA A;  2HGC A;  5K7F A;  3C2H A;  2R7V A;  1IV6 A;  3C07 A;  2F5E A;  1D1C A;  3K0L A;  2ZSI B;  3OOP A;  2IGN A;  4BGD A;  1ORK A;  5F1R A;  2IGK A;  5L3G A;  3CO7 C;  4DVY P;  4UHT A;  3MZH A;  2Q2E B;  3ZGK A;  4OWR B;  3CJD A;  2K40 A;  1BR1 A;  1MBJ A;  3G56 A;  3GZ6 A;  4IHT A;  3QPS A;  4G8X A;  2XUB A;  1CF7 A;  3ZQI A;  3LAJ A;  2L9V A;  2QKL B;  5DDG A;  2EFW A;  3CME I;  3RKX A;  4CGR A;  1B72 A;  3ABM H;  2IGM A;  3F8F A;  1P4X A;  2BGC A;  2M4K A;  2O6G E;  4DBQ A;  5CQG A;  2HQ5 A;  1XGM A;  4BJT A;  2R5Y A;  5IT9 K;  3VFZ A;  2WAQ N;  5J1U A;  1YX3 A;  2DN0 A;  3J81 K;  4H0E A;  3CDL A;  3HG9 A;  2MC4 A;  1FMV A;  4CCL A;  2O9L A;  1IN6 A;  2CSO A;  2Y75 A;  2NNN A;  3B73 A;  4ANJ A;  4A6E A;  1U5T C;  4YFN F;  5E18 F;  2QZ8 A;  1K4S A;  1LB2 A;  1X58 A;  5KAI C;  3D5S C;  1F1Z A;  2KFD A;  4YG2 F;  2OV7 A;  3KZY A;  1SFE A;  3ZN0 A;  4EVI A;  4FX4 A;  5FRM A;  4NBQ A;  3BT9 A;  5F04 A;  3CDI A;  5HLG A;  2HYF A;  2X4H A;  3PIP F;  2XDV A;  1RPW A;  2WWY A;  4A93 J;  3IP4 B;  1LDJ A;  1G6N A;  1SAN A;  4BAY A;  2LLK A;  3CWR A;  4L5E A;  4M74 A;  5D19 A;  5HDG A;  3L1P A;  3U2R A;  3RZO J;  1FIP A;  2HVS A;  3PPB A;  4IZZ A;  4MFD A;  1W0T A;  2KRF A;  1YRN B;  2Z99 A;  4HRI A;  1JT0 A;  3NWT A;  2PG4 A;  5GAE J;  3H3U A;  1T56 A;  3WG7 H;  3WTT C;  4BQA A;  3E0J B;  4I02 A;  4BXX J;  1ITY A;  3OL3 A;  3ABK H;  2PX9 A;  2CRG A;  3QYB A;  5DD8 A;  2MH9 A;  3MZY A;  2VBW A;  3S3M A;  4W1U A;  1RNL A;  1R71 A;  5CVV A;  3H9G A;  4II3 A;  3AL0 C;  3L2C A;  3JTG A;  3SEZ A;  3TO6 A;  1VQ9 I;  3K8P C;  2G7H A;  2VQG A;  2X6O A;  3HUG A;  1WVR A;  2X9D A;  2IW5 A;  1EKE A;  3ZRG A;  3TDZ C;  3REO A;  2OF7 A;  5H2F C;  5B3S H;  3CJN A;  3I9V 2;  2HTJ A;  2DAO A;  2Y30 A;  3QWL A;  1ACI A;  3RZD J;  3I55 I;  5E8I A;  1FOX A;  3A1Y A;  4PCQ A;  4HG2 A;  1B8I B;  2VT2 A;  4I2O A;  1UHS A;  5ILU A;  2M8E A;  4XMY A;  4G7Z F;  5BPI A;  1MMA A;  3B02 A;  3PL8 A;  2ZJQ F;  3LMM A;  3DP7 A;  3TOA A;  4BE2 A;  3FHZ A;  1RC9 A;  4BDY A;  2GWR A;  2E5N A;  2HOT A;  1U9O A;  2DJI A;  2DU9 A;  1S29 A;  4E7S A;  5DM6 F;  1UHW A;  2MYS A;  3CJR B;  3RSN A;  1WH5 A;  4OMY A;  1EF4 A;  3G4S I;  3LSG A;  1OQY A;  3L00 A;  4ABZ A;  2R5Z A;  4BE0 A;  1VQL I;  2ZB9 A;  5K5R A;  1YQA A;  5EFY A;  2ME0 A;  1RZ4 A;  3HGG A;  2DT6 A;  1J09 A;  3GWZ A;  4RB2 C;  3CMA I;  2FE3 A;  1YTY A;  1H9G A;  4QLC U;  2D1V A;  2A6H F;  3EUK L;  2QBY B;  1EH6 A;  3E7L A;  1T6S A;  4RLQ A;  3MKL A;  4BUP A;  4Y52 J;  3QBM A;  3FXU A;  1T33 A;  3J7Z I;  4XLA A;  3KYC B;  1ZGA A;  1MSF C;  3FXM A;  1WRJ A;  4E7L A;  5LHI A;  4R8H A;  5J6X A;  1I3A A;  5D8L B;  4ON0 A;  2UXH A;  1IG7 A;  4ESJ A;  1XC5 A;  2M4G A;  3N05 A;  2F5D A;  3GZN B;  4LIT A;  2XGX A;  3FMS A;  3AL0 B;  2K27 A;  5DUK A;  4ENM A;  4CHU A;  4PZJ A;  1JGS A;  1XG1 A;  2M7A A;  4XLE A;  2GXG A;  4AID A;  1MDM B;  2YX4 A;  2O0Y A;  5M3M J;  3RD3 A;  2MA3 A;  2ADU A;  3J80 K;  3ZMV A;  4KIF A;  4GYI A;  2OC6 A;  3E5Q A;  2UXP A;  1ZRE A;  3KLN A;  4HF1 A;  2EJR A;  4LIV A;  3CC2 I;  3ZQG A;  1UI6 A;  2E36 A;  2GZW A;  2R3S A;  1OCT C;  1I1S A;  4I0A A;  2EV6 A;  2K3F A;  1QO0 D;  4M3E A;  1K83 J;  1WI9 A;  4FIS A;  4O6J A;  4OIN F;  2HKU A;  4IPA A;  1B6A A;  4AIK A;  2O3F A;  1W4M A;  1R6R A;  1LDD A;  4Y13 A;  2X85 A;  4IOC F;  3AAF A;  1IRZ A;  2L01 A;  5HOD A;  1S3J A;  3VYS B;  4GCV A;  3TP3 A;  4CCJ A;  2BY1 A;  3A03 A;  1GVD A;  4HEA 2;  3V42 A;  3S32 A;  2ICW G;  1J9I A;  3T0Y A;  4ME9 A;  2ID3 A;  3JW4 A;  2JN6 A;  2A3S A;  2MG4 A;  4MTD A;  4RAY A;  2Z2S B;  2FA5 A;  4M6X A;  4HV5 A;  3DPJ A;  2KJB A;  1LFP A;  2RV8 A;  4JYK A;  2QLZ A;  3VYU B;  3ZMZ A;  1U5T B;  3AQS A;  2ZOZ A;  2KP6 A;  2JA6 J;  2IEK A;  1SAU A;  4AC0 A;  3VOD A;  1W1W E;  4KMF A;  2QQA A;  3GFM A;  4NC8 A;  4P9U A;  1U8R A;  2VBX A;  4BH9 A;  2FRH A;  5JR3 A;  3RDI A;  4ZDP A;  2VKE A;  2FQ3 A;  4LFU A;  4Y33 A;  2DG8 A;  5EZH A;  2R7Q A;  1VQ4 I;  1Y56 A;  2QEX I;  2HYT A;  4G7H F;  1SFU A;  2KIM A;  2LDU A;  1NH3 A;  5EDN A;  2YPR A;  2FMY A;  1IW7 F;  3HKZ N;  2LOO A;  4QPQ A;  5B66 C;  1T39 A;  2BOL A;  1JI8 A;  4F93 B;  5FLX Z;  2ZSH B;  1JJ8 C;  4NHJ A;  3TL4 X;  4L0Y B;  4HSR A;  3KX2 A;  5D4R A;  2YS9 A;  1AA7 A;  1WSU A;  3KKD A;  2HR3 A;  3CJT B;  4HOB A;  2JRM A;  3OOU A;  5F08 A;  3KYD B;  2VE8 A;  4AYB A;  5JHF A;  4XNF A;  2VJ5 A;  4U9N A;  3SWH A;  4F55 A;  5DUI A;  5EJC A;  4XSX F;  4XRS G;  3BCG A;  3KPH A;  3BJO A;  3TO9 A;  4RBO A;  3O6B B;  4V2G A;  2B9S A;  2L4M A;  3VVZ A;  4DZP A;  2CJJ A;  2K5C A;  4MK6 A;  2ZCM A;  4RDU A;  1ETW A;  1PVE A;  2GAU A;  3CP8 A;  4XOP A;  2KRH A;  4FTH A;  1VQN I;  1MJA A;  1S7O A;  2COB A;  4ESF A;  4Q5S F;  5LHH A;  3E97 A;  2VBY A;  3DTK A;  4IHY A;  3ABU A;  2DOA A;  2FEZ A;  3DU6 A;  2CS3 A;  4BAC A;  2ZJP F;  1FT9 A;  3ON2 A;  1G3W A;  1UB9 A;  3QOE A;  4UVA A;  2KQR A;  3JTH A;  3W3C A;  2K4B A;  2DOF A;  3PNT A;  2LVS A;  4P55 A;  3TGN A;  5IYC J;  4ZTF A;  2E1N A;  2Z16 A;  1U8B A;  2YU9 J;  2JA2 A;  4G6T B;  4KN7 X;  3NI7 A;  2CW8 A;  3HHG A;  3K4K A;  5EEH A;  3H9Q A;  1GV5 A;  5GPA A;  4IKF A;  4OOI A;  4QPO A;  1MMN A;  3MMY B;  4HKU A;  1S5L C;  2D2W A;  3PO3 J;  1P2F A;  1IN7 A;  3ZQL A;  2VBZ A;  3KEQ A;  3DBL B;  1ZRC A;  1BJZ A;  2Y0M A;  1VQP I;  2ZXI A;  5E3N A;  2R7O A;  2J5O A;  3ML6 A;  4XLP F;  2VQL A;  1YI2 I;  2H8W A;  3IWZ A;  1OLT A;  1HST A;  4X0G A;  2XAH A;  2BVL A;  4MHG A;  2VAS A;  3RJP A;  2DW4 A;  4MQ9 F;  1POG A;  3V4G A;  3I4M J;  2XPV A;  4FE4 A;  5L3E A;  4A12 A;  1XDS A;  5BMZ A;  2A07 F;  3HSR A;  3K2A A;  4FET A;  1I6H J;  2HKO A;  4WF2 A;  3OYF A;  2B0L A;  1X3U A;  3CUQ C;  1T98 A;  1FOK A;  2DA3 A;  3QQA A;  5D5W B;  3SZP A;  3N97 A;  1GDT A;  3KFW X;  1A6Q A;  4BXF A;  1D8J A;  2L7Z A;  4B47 A;  1D5V A;  4CCO A;  3F8C A;  2RGV A;  1T0F C;  4BS9 A;  3GW2 A;  1RKT A;  3BCA A;  1MJB A;  1DQU A;  4F7Z A;  1JUP A;  2ZNY A;  5ICF A;  2ZJ2 A;  2JJ7 A;  3NWS A;  3SDB A;  4HF2 A;  4A3B J;  3VVX A;  4ZDL A;  5J1Y A;  1YW7 A;  4Q48 A;  2P4W A;  1PUE E;  1Y39 A;  2IA1 A;  2W53 A;  2PEX A;  4L5J A;  2PJR A; 
#chains in the Genus database with same CATH homology
 2HXI A;  3D1N I;  2JK3 A;  3LSJ A;  5F27 A;  3GEU A;  3H0G J;  3T6N A;  3BTJ A;  2D5V A;  2O7O A;  3RH2 A;  1AU7 A;  1UMQ A;  1DU0 A;  1JJ6 C;  2XB5 A;  5HSZ A;  1UG2 A;  5JLX A;  4S0H B;  2ECB A;  3IH3 A;  5D1R A;  5EGO A;  1NK3 P;  5BNG A;  1TWH J;  1WGX A;  2QCO A;  3VW2 A;  2RHA A;  4CYC B;  1W0U A;  1HOM A;  2G7L A;  2TRT A;  5F0F A;  1WH7 A;  1IGN A;  2HI3 A;  3M3Y J;  2AHQ A;  1RES A;  1TC3 C;  3HOV J;  2EBI A;  2DA1 A;  2E2I J;  2DA2 A;  4X1E A;  5FKM A;  3S2H J;  1SGM A;  3GTG J;  4HNV A;  1MBG A;  1HF0 A;  2ZCX A;  1JKO C;  2NP5 A;  5EF6 A;  2XB0 X;  3BG9 A;  2LTP A;  5IOY A;  2XDN A;  3F0C A;  1HDP A;  1P7I A;  3BR0 A;  3GTO J;  5DTD A;  2OPT A;  5C4Y A;  1Z77 A;  2XGD A;  4NN1 A;  3V78 A;  3MN2 A;  2ME6 A;  2NVQ J;  3NAU A;  1SFO J;  2B63 J;  3S1Q J;  2RAS A;  1CQT A;  4EEF G;  2QTQ A;  1JKP C;  2M2E A;  2V57 A;  2VPR A;  3DEW A;  1ETY A;  4I76 A;  2CUF A;  4DYC A;  2LFB A;  1FEX A;  3HOW J;  3K7A J;  2FJ1 A;  1R9T J;  3GZI A;  3ZQF A;  3BR2 A;  1IDY A;  3F1B A;  3S5R A;  2RAE A;  1BW6 A;  2MSY A;  5C4J J;  4MIM A;  3HOX J;  1AHD P;  1WCM J;  2H1K A;  3S14 J;  5AQC A;  1H88 C;  3IH4 A;  5FHP A;  1TWG J;  2L7F P;  2I10 A;  3S1R J;  2YUS A;  3RQI A;  3KZ9 A;  2L9R A;  5FKK A;  4M6V A;  3TW7 A;  2LD5 A;  2LY9 A;  4X6A J;  3HTH A;  1MBH A;  3G1L A;  1Z0X A;  3S1M J;  4CYC A;  1QPI A;  4M3F A;  2WV1 A;  5E3O A;  2Y9Z A;  3LHQ A;  4C3I J;  3BQY A;  3A01 A;  1WI3 A;  1ZK8 A;  2NS8 A;  2QF7 A;  2P81 A;  4IHV A;  3PM1 A;  1I50 J;  2GUH A;  3B6C A;  1RET A;  4XRM A;  3BR6 A;  4MO7 A;  4AC6 A;  3RKQ A;  5K7F A;  5M3F J;  1HDD C;  2G7S A;  1YRN A;  1IV6 A;  3LJL A;  2LK2 A;  2R7Z J;  3C07 A;  3Q0V A;  4JX4 A;  3Q0U A;  1ORK A;  3NPI A;  5EG0 B;  1ETX A;  4YZE A;  5IP9 J;  2NVT J;  3CJD A;  2K40 A;  1MBJ A;  3G56 A;  3IH2 A;  2GLO A;  3QPS A;  1DU6 A;  1VI0 A;  3ZQI A;  4GCL A;  4BBS J;  5CW8 A;  2DA5 A;  3OSF A;  4CGR A;  1ZR4 A;  2L0K A;  1RKW A;  5IP6 A;  4A3I J;  1B72 A;  3CCY A;  2JA8 J;  2EZH A;  5IP7 J;  2QIB A;  1JKR C;  5C4X J;  2HQ5 A;  2F07 A;  3NRG A;  3KNW A;  3CMY A;  2R5Y A;  2MW8 A;  2M9H A;  2IBD A;  2WAQ N;  4W97 A;  3BRU A;  3VVZ A;  3BG5 A;  5J1U A;  2DN0 A;  5IPA A;  2EZL A;  3CDL A;  2OER A;  3BNI A;  2NS7 A;  3H3V K;  2YVH A;  2JMW A;  2O9L A;  3HM5 A;  2CQX A;  3ZQC A;  1X58 A;  3BG3 A;  2UXI A;  2Y9Y A;  5E3L A;  3MVP A;  3BJB A;  2G3B A;  5F04 A;  3BT9 A;  4GFB A;  3HTA A;  3FIS A;  4FE7 A;  2DMT A;  5E3M A;  4C3J J;  1MNM C;  4A3G J;  1RPW A;  5HBU A;  2K9Q A;  5FLM J;  4A93 J;  1SAN A;  1BW5 A;  3HB9 A;  2LLK A;  3CWR A;  2XGE A;  4L5E A;  5D19 A;  3GTQ J;  3A01 B;  2R5Z B;  4JKZ A;  2NVX J;  3L1P A;  5IOZ A;  3EGQ A;  3RZO J;  3HOZ J;  1FIP A;  2IAI A;  2L7M P;  4UUS B;  1JTX A;  4IHW A;  3PPB A;  4D5F A;  2DMN A;  4MFD A;  2Y0S N;  1W0T A;  2M8G X;  3VW0 A;  1IJW C;  4DYQ A;  1YRN B;  2EQR A;  4BY7 J;  4JX6 A;  4D5C A;  1JT0 A;  5IYB J;  1O4X A;  4C2M J;  4A3L J;  2REK A;  1T56 A;  4BXX J;  3ANP A;  2E2H J;  1ITY A;  3G1M A;  3HBL A;  2VUM J;  2CRG A;  4A3F J;  4A69 C;  1GV2 A;  2TCT A;  3GTM J;  2CQQ A;  2EZI A;  4W1U A;  2NP3 A;  1MH3 A;  1IC8 A;  2DA6 A;  4MXM A;  3COL A;  2X6O A;  3EUP A;  5CXI A;  2KT0 A;  3JSJ A;  2X9D A;  4NDL A;  1FJL A;  3BQZ A;  4A3D J;  2OF7 A;  3VUQ A;  3PO2 J;  2DTZ A;  5FLV A;  1ZKG A;  2Y30 A;  5EGO B;  3RZD J;  2NX4 A;  1PUF B;  9ANT A;  1B8I B;  1Q1V A;  1Y1V J;  2H8R A;  4GCK A;  3FRQ A;  1UHS A;  1ZQ3 P;  2DMP A;  4JP0 A;  1APL C;  3JR9 A;  1IUF A;  3HGY A;  3BTC A;  2ZCN A;  5K7Z A;  3S1N J;  2W48 A;  3GTL J;  1ENH A;  2O7T A;  2HOT A;  2LR8 A;  5C3E J;  1U9O A;  3GTP J;  4B1R A;  1JT6 A;  4A3E J;  2X48 A;  2CUE A;  4JNN A;  4IHX A;  3S15 J;  1WH5 A;  2UXU A;  1EF4 A;  2MGQ A;  2GFN A;  3LSG A;  3VVY A;  5M5Y J;  1QVU A;  3GBG A;  1F36 A;  5GP9 A;  4ABZ A;  1F43 A;  1H89 C;  2R5Z A;  2ZB9 A;  2FQ4 A;  5D18 A;  5EFY A;  2ME0 A;  3HGG A;  4A3J J;  4UUS A;  4XID A;  3BHQ A;  2FX0 A;  3VOK A;  1JTY A;  2UXO A;  1ETO A;  2HXO A;  3E7L A;  3QBM A;  3MKL A;  4Y52 J;  3O8G A;  3O60 A;  3JRI A;  1T33 A;  3WHB A;  2G0E A;  1MSF C;  5DS9 A;  1NTC A;  3JRH A;  1VFC A;  1FIA A;  2UXH A;  4M3G A;  1IG7 A;  3MNL A;  3G1O A;  1U78 A;  4L62 A;  1XC5 A;  2GBY A;  2XSD C;  2AO9 A;  4DZJ A;  3CQZ J;  2XGC A;  4BY1 J;  4V2F A;  5J1R A;  3NNR A;  1ETV A;  3VIB A;  1U9N A;  2E1O A;  3SJM A;  2PMZ N;  1XG1 A;  4AYB N;  5IYD J;  2WUI A;  5K58 A;  2JA7 J;  1MH4 A;  3ANG A;  3NXC A;  2K9N A;  5M3M J;  3RD3 A;  1NK2 P;  3Q3S A;  2UXP A;  1BL0 A;  5EEA A;  2DJN A;  3WHC A;  2YVE A;  1FTZ A;  2LP0 A;  3ZQG A;  3ZQH A;  1UI6 A;  1OCT C;  1LFU P;  1ZGW A;  4M3E A;  5CXG A;  1K83 J;  4FIS A;  3LOC A;  3IV5 A;  2VKV A;  2HKU A;  3LSP A;  4GFK A;  4PXI A;  3BR1 A;  5EG0 A;  1GUU A;  1IRZ A;  4MFE A;  5H9T A;  4B3A A;  5C44 J;  5HOD A;  1Y1W J;  3QKX A;  4AUX A;  3QPL A;  3TED A;  3TP3 A;  3HE0 A;  3A03 A;  1GVD A;  3VW1 A;  2HYJ A;  3O8H A;  3HTI A;  4ME9 A;  2ID3 A;  2HDD A;  2JN6 A;  3JRC A;  1UI5 A;  2MG4 A;  4B4C A;  1VF9 A;  2Y2Z A;  2R5Y B;  3JRB A;  2CU7 A;  4BBR J;  2FBQ A;  3DPJ A;  1A5J A;  2M34 A;  2HOA A;  4D7N A;  3HTJ A;  2E19 A;  4JYK A;  1JUM A;  1XS9 A;  3JRG A;  2O8K A;  2M0C A;  3HOU J;  1HCR A;  2ZOZ A;  3AQS A;  4UUT A;  4JL3 A;  5EYR A;  1I3Q J;  3IUV A;  2JA6 J;  2IEK A;  2HOS A;  2Y31 A;  1JUS A;  4AC0 A;  5M5W J;  1E3O C;  3W6V A;  3JRF A;  2R93 J;  1LE8 A;  3G7R A;  4NEL A;  3HEF A;  1TWA J;  3B6A A;  4JX5 A;  2VKE A;  3V6G A;  1A6I A;  1X2N A;  2DG8 A;  2JWT A;  5EZH A;  4XIC A;  2QWT A;  2HYT A;  5M5X J;  1G2H A;  1AKH B;  2DMU A;  2VI6 A;  1H8A C;  5F0H A;  4G12 A;  1ZR2 A;  3KKC A;  5EDN A;  1JKQ C;  1JGG A;  1IDZ A;  3HKZ N;  4QSH A;  2ZOY A;  1MBK A;  4XRS A;  1JJ8 C;  4C3H J;  4FCY A;  2K9S A;  2YS9 A;  3PAS A;  3KKD A;  2PBX A;  2DMQ A;  4A3M J;  2DA7 A;  3OOU A;  5F08 A;  5FKN A;  3DCF A;  1MBE A;  1ZTR A;  2NVY J;  1ETK A;  4GFL A;  1OCP A;  4D7M A;  2XRL A;  2LKX A;  1BA5 A;  3BCG A;  4XRS G;  2PZ9 A;  4RBO A;  4V2G A;  2R0Q C;  2E2J J;  3CRJ A;  3FK7 A;  4I6Z A;  4AF5 A;  5J3L A;  4DYR A;  4DZP A;  5FKL A;  2Q24 A;  1P7J A;  1TWF J;  1S7E A;  2ELK A;  2CJJ A;  4MK6 A;  2WB1 N;  2ZCM A;  3A02 A;  4RDU A;  3BTI A;  3S16 J;  1ETW A;  1QRY A;  3M4O J;  3HDD A;  4FTH A;  4UDS A;  2COB A;  2QKO A;  1WPK A;  2ECC A;  2JA5 J;  3ON4 A;  5FMP A;  3BR3 A;  4IHY A;  1TWC J;  2NOG A;  1MSE C;  1GT0 C;  5GPC A;  3ON2 A;  5F1J A;  3JRA A;  2XPW A;  1HLV A;  3TW6 A;  3FIW A;  3FKI J;  4Y7N J;  3GTK J;  1PUF A;  2LVS A;  5IYC J;  1B8I A;  3TP0 A;  1U8B A;  2YU9 J;  3C2B A;  1LE8 B;  4XK4 A;  3NI7 A;  4GCT A;  1B72 B;  1GV5 A;  5GPA A;  3ZOB A;  5K7H A;  4ACI A;  3LNQ A;  3Q0W A;  3P9T A;  4HKU A;  5FJ8 J;  4IEJ A;  2DG7 A;  3PO3 J;  1AKH A;  2KDZ A;  3S17 J;  3ZQL A;  1BJZ A;  1VND A;  5E3N A;  3OIO A;  3JRE A;  5JLW A;  5FGL A;  1K61 A;  2QOP A;  2IU5 A;  2GEN A;  1D5Y A;  4ICH A;  5FKO A;  3BR5 A;  3SFI A;  4BKX A;  3GTJ J;  2EZK A;  1POG A;  3I4M J;  2XPV A;  4FE4 A;  1FTT A;  3K2A A;  1I6H J;  2XPU A;  4QIW N;  1ETQ A;  3E7Q A;  3VOX A;  5EZG A;  3BTL A;  1LFB A;  5HAW A;  2N8G A;  4MLO A;  2DA3 A;  3QQA A;  2ID6 A;  1GDT A;  3HIM A;  4LOC A;  1QVT A;  3UKG A;  3LWJ A;  3FK6 A;  4KWA A;  3JRD A;  2EH3 A;  2L7Z A;  2D6Y A;  4A3C J;  3HOY J;  3VP5 A;  1OJL A;  3AQT A;  4M3B A;  4A3K J;  3S2D J;  3I4N J;  2DA4 A;  3VPR A;  1RKT A;  5F0C A;  3OSG A;  2OI8 A;  1MBF A;  1JUP A;  3LSR A;  1OFC X;  1RR7 A;  3NAR A;  2G7G A;  4DW6 A;  2JJ7 A;  4J19 A;  4A3B J;  2GM4 A;  3VVX A;  3B81 A;  5J1Y A;  1X2M A;  2FD5 A;  2WGB A;  5DAJ A;  2R92 J;  3SDG A;  2W53 A;  4M3D A;  4QTR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...