3WHCA

Crystal structure of a transcriptional regulator fadr from bacillus subtilis in complex with stearoyl-coa
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
190
structure length
190
Chain Sequence
KRPKYMQIIDAAVEVIAENGYHQSQVSKIAKQAGVADGTIYLYFKNKEDILISLFKEKMGQFIERMEEDIKEKATAKEKLALVISKHFSLLAGDHNLAIVTQLELRQSNLELRQKINEILKGYLNILDGILTEGIQSGEIKEGLDVRLARQMIFGTIDETVTTWVMNDQKYDLVALSNSVLELLVSGIHN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of a ligand-bound form of Bacillus subtilis FadR involved in the regulation of fatty acid degradation.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription
molecule keywords Fatty acid metabolism regulator protein
total genus 77
structure length 190
sequence length 190
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08359 TetR_C_4 YsiA-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3whcA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3whcA02
2W53A 3GEUA 3ZQLA 2ECBA 4MO7A 1UI5A 1NK2P 3WHCA 1JT6A 1U9NA 3HKZN 4Y52J 4EEFG 4AC6A 1TWCJ 3BQZA 2XPUA 3G56A 4QTRA 1HF0A 2JK3A 4NDLA 4G12A 5IOZA 4GCKA 1G2HA 3OSGA 1JKOC 3H3VK 2NOGA 3ZQIA 3C07A 2E2JJ 2XGCA 3GTLJ 2ELKA 1B8IA 3B81A 1FTZA 2CJJA 2LK2A 3BR2A 4L62A 3CQZJ 2ME0A 1LE8B 5E3NA 2JN6A 2K9SA 5K7HA 2WGBA 1SGMA 4D7MA 3Q0VA 3S2DJ 3VUQA 4CYCB 3H0GJ 5F0CA 2DA6A 3LSGA 2D5VA 3A03A 3I4NJ 2HKUA 3BRUA 1MBJA 1WH7A 2REKA 2PZ9A 4JKZA 1XC5A 2N8GA 5FHPA 2I10A 3S17J 4BKXA 3PASA 5IYBJ 2KT0A 2L7FP 2MG4A 2HOTA 1XS9A 1HDPA 4IHYA 3LHQA 3VW1A 4ICHA 1QVTA 3CJDA 1JUMA 2HDDA 2NVQJ 2EQRA 5FKNA 2CQQA 1MSEC 3HGYA 3QKXA 2L7MP 1K83J 2KDZA 5M5XJ 2QTQA 3G1OA 2FBQA 4A69C 3UKGA 2LP0A 4M3BA 2EZHA 1SANA 4DW6A 1ZGWA 3HOYJ 2LTPA 1UMQA 3A02A 1ETOA 3F1BA 2L0KA 1F36A 1JTXA 2GFNA 1IG7A 3JR9A 5CXIA 3IH3A 3V78A 2Y0SN 4W97A 1ETYA 3JRBA 4D7NA 2K40A 5IP6A 3D1NI 5DAJA 3RKQA 3BTLA 1ORKA 3G7RA 2V57A 1ETXA 2DMTA 4JX4A 3TEDA 2COBA 4D5CA 3GTQJ 3BTJA 1ETWA 2ID6A 2WB1N 5FKKA 5FMPA 2LLKA 2VI6A 1POGA 3A01B 2HI3A 4FTHA 1MBFA 1DU0A 3VOKA 4BXXJ 3FIWA 1JKPC 1F43A 3VP5A 3K2AA 3S1MJ 3S15J 4HKUA 2Q24A 4FE4A 2L7ZA 1ZR2A 2DN0A 2MSYA 3OSFA 2YU9J 4I6ZA 3V6GA 1DU6A 1O4XA 2XPVA 1A5JA 5HBUA 1T56A 1MNMC 3HOXJ 3RD3A 2AO9A 2JMWA 4V2FA 3P9TA 2GUHA 4MIMA 1MH4A 3QPSA 1IUFA 2Y2ZA 2GBYA 3NI7A 4MFDA 3PM1A 1LE8A 3IH4A 4LOCA 4CYCA 3ANPA 5EG0A 5AQCA 4UUSA 4BBRJ 1FJLA 2DA1A 1T33A 2NS7A 4ABZA 1NTCA 2G7GA 3NPIA 4FE7A 2E2IJ 2IBDA 1W0UA 1K61A 1VI0A 5C4XJ 4X6AJ 1BJZA 4IEJA 2O9LA 1BA5A 2OI8A 4GFBA 2Y9ZA 2IEKA 4A3BJ 1BW6A 4X1EA 2PMZN 4UUSB 2R5ZB 2VUMJ 2FD5A 5FGLA 2Y30A 1JJ6C 2EH3A 1TC3C 3GTMJ 1JJ8C 4BBSJ 3DPJA 3HB9A 1JUSA 1VNDA 5M3MJ 1SFOJ 2UXPA 1GV2A 3MNLA 4QSHA 2DJNA 2NX4A 1JT0A 2QKOA 2QF7A 2HYTA 5E3LA 2CRGA 2G7LA 5EYRA 2ME6A 1UG2A 1HLVA 5EF6A 4M3FA 2JA8J 2MW8A 3BNIA 5EFYA 3K7AJ 3QQAA 1VFCA 1IDYA 4A93J 2DA2A 3QPLA 2ZCXA 3FRQA 1B8IB 3E7LA 5H9TA 1TWFJ 1X58A 5IOYA 2ZB9A 4AUXA 2M9HA 2B63J 1ZKGA 2LVSA 3HEFA 4BY7J 5K7ZA 1UI6A 3RH2A 1JTYA 2E19A 3HTIA 1I50J 3SDGA 1RR7A 1UHSA 2M8GX 5EGOA 2JJ7A 1TWHJ 1ZTRA 2XSDC 3JREA 5GP9A 3BTCA 4DZPA 3JRIA 3JRHA 3W6VA 3GBGA 1PUFA 3FKIJ 2VKEA 3CWRA 1ENHA 2Y9YA 3ZQHA 3HDDA 2DA5A 1FIPA 4GCLA 1Z77A 2OERA 5FKOA 3LOCA 2DMQA 4IHXA 4IHVA 1ETVA 1AU7A 3JRCA 4FCYA 1U78A 1FTTA 3VVYA 1I3QJ 2EBIA 1IDZA 3JRDA 5FKLA 1IV6A 3KKDA 5K58A 2X6OA 4IHWA 9ANTA 1ZK8A 1LFBA 3I4MJ 4DYQA 3Q0UA 3QBMA 4A3DJ 4BY1J 1Q1VA 3GTKJ 2DMPA 3O8HA 3IH2A 4C2MJ 1U8BA 2G0EA 2VPRA 3CRJA 5F0FA 5HAWA 2OPTA 1TWAJ 1MBGA 2R5YA 1B72A 3HOWJ 5C44J 3BHQA 4GCTA 3BR5A 1E3OC 2HOSA 5JLWA 5K7FA 1LFUP 2HXOA 3PPBA 2ID3A 3JRFA 3CCYA 1BW5A 3PO2J 3NNRA 2K9NA 2M0CA 3M3YJ 3RZOJ 3O60A 3IV5A 1D5YA 4XRSA 4DYCA 5EDNA 1RKTA 1X2NA 5EZGA 4GFLA 1AKHA 4Y7NJ 5FJ8J 2X48A 1W0TA 2XB5A 1YRNB 5FKMA 1IGNA 2G7SA 5FLMJ 2ZCNA 3S5RA 3TP3A 3AQTA 3ON2A 1ETKA 1WPKA 3DCFA 1H89C 4J19A 3EGQA 3VW2A 1OCPA 3Q3SA 1MBKA 4D5FA 5M5WJ 4DYRA 3BR3A 2ZOYA 2YUSA 2DMUA 3BJBA 2K9QA 2JWTA 3JSJA 5D1RA 2UXHA 2DMNA 4NN1A 1WGXA 3COLA 2RAEA 4C3IJ 1ZR4A 2NVXJ 2WUIA 2GENA 2MGQA 1PUFB 2RASA 5J1YA 2XDNA 1FEXA 3HOUJ 1VF9A 5DTDA 3LSPA 3HTAA 1YRNA 4JP0A 1AHDP 2E1OA 4RBOA 3LSRA 4MLOA 2R92J 1H88C 2FX0A 1IJWC 4QIWN 2W48A 5EEAA 5M5YJ 1U9OA 4C3HJ 1QVUA 1HOMA 4W1UA 2R5ZA 3B6CA 2CU7A 5E3OA 2UXUA 2CUEA 5IYDJ 2O8KA 2DA4A 5IPAA 4UDSA 4A3CJ 1X2MA 2DA3A 3S1RJ 3HOVJ 5EZHA 4DZJA 4A3JJ 5FLVA 3FK6A 1OCTC 4AC0A 1JUPA 1P7JA 4JX6A 2IU5A 3B6AA 3VVZA 3T6NA 2M2EA 4CGRA 2YVHA 2XPWA 2F07A 1IC8A 1FIAA 5GPCA 3ON4A 2PBXA 3HM5A 2JA5J 5C3EJ 2NP5A 3BR6A 5EG0B 2FJ1A 1ITYA 2FQ4A 3FISA 2XGDA 5HSZA 4KWAA 1MSFC 3G1LA 2QOPA 1JKRC 1GDTA 3NXCA 1RESA 3SFIA 2H8RA 3FK7A 4XRSG 2UXIA 4ME9A 3AQSA 4FISA 4A3GJ 5F08A 2IAIA 3DEWA 3NARA 1BL0A 5BNGA 2O7OA 4M3GA 1TWGJ 5E3MA 5J3LA 1AKHB 2R93J 3A01A 3WHBA 3PO3J 4ACIA 3G1MA 3E7QA 2QWTA 4XRMA 3GZIA 1MBHA 5C4JJ 3TW6A 3VIBA 2O7TA 1JGGA 1WH5A 3S16J 1Y1VJ 4JX5A 5JLXA 3GTOJ 3VW0A 3Q0WA 2ZOZA 5J1RA 3HTHA 4A3IJ 3BG3A 4A3FJ 3JRGA 4MXMA 2WAQN 2CQXA 1P7IA 3O8GA 5F04A 3VOXA 2QIBA 3VPRA 1ZQ3P 5HODA 3BR0A 2ECCA 5C4YA 1R9TJ 3BR1A 3NAUA 5CW8A 2YS9A 2DA7A 3VVXA 3TP0A 4GFKA 2JA7J 2XRLA 1GT0C 3GTGJ 5D18A 3CDLA 5F27A 3S14J 2QCOA 2HXIA 2RHAA 4JNNA 4AYBN 3BQYA 5IYCJ 2TCTA 1GV5A 5IP7J 4XICA 3ZQGA 1Y1WJ 2XGEA 3OOUA 2H1KA 1EF4A 2EZLA 3L1PA 3ZQFA 4NELA 4A3MJ 2R0QC 2R5YB 1B72B 4JL3A 2LR8A 4HNVA 2L9RA 1I6HJ 1OJLA 5DS9A 3MKLA 2YVEA 3GTJJ 1RKWA 1CQTA 3S2HJ 4UUTA 2EZKA 4L5EA 5M3FJ 3S1NJ 3IUVA 2Y31A 3F0CA 3HBLA 2VKVA 1MH3A 2DTZA 3BT9A 4MFEA 3SJMA 1RETA 3OIOA 4B4CA 3KKCA 2D6YA 1QRYA 3ZQCA 4A3LJ 2E2HJ 4A3EJ 4YZEA 4MK6A 1GUUA 3HIMA 4B1RA 3MN2A 2LKXA 5GPAA 2ZCMA 2DG8A 3ANGA 2CUFA 1JKQC 3HE0A 3LNQA 3LSJA 2R7ZJ 2LFBA 1MBEA 1S7EA 3KNWA 1XG1A 3HOZJ 2LY9A 1GVDA 2P81A 2TRTA 4RDUA 5EGOB 2DG7A 4XK4A 2X9DA 5CXGA 4C3JJ 2GM4A 3MVPA 2NVYJ 1QPIA 2LD5A 4A3KJ 1HDDC 2OF7A 4M6VA 3HTJA 1H8AC 4M3DA 1WCMJ 3M4OJ 1HCRA 3C2BA 4B3AA 4JYKA 5IP9J 1WI3A 2WV1A 1OFCX 4S0HB 3LWJA 4I76A 2G3BA 3BG9A 3RQIA 1A6IA 3HGGA 5J1UA 1APLC 3CMYA 3GTPJ 3BCGA 2AHQA 1RPWA 2UXOA 3EUPA 2NS8A 3LJLA 3RZDJ 3TW7A 5F0HA 3BTIA 3JRAA 2M34A 4XIDA 2NVTJ 1NK3P 2HQ5A 4AF5A 2JA6J 3NRGA 4M3EA 3S1QJ 3ZOBA 3BG5A 1Z0XA 4V2GA 2GLOA 3KZ9A 2NP3A 5F1JA 1IRZA 2HYJA 2XB0X 1ETQA 5D19A 2HOAA 2EZIA 4PXIA
chains in the Genus database with same CATH superfamily
2W53A 3OS0A 2QSFX 1VQ5I 1BI1A 4MO7A 2CQ7A 2FBKA 3K1NA 1RNLA 5ICFA 3WHCA 3REOA 4PJJA 1STZA 2QSHX 1FP2A 5E8GA 1SAUA 4A0XA 2LBFA 4NDLA 5TJJA 4LK0F 4GCKA 3OSGA 2EIJH 3VB2A 2CW7A 3I53A 5H2FC 4UNOA 2NOGA 3KP7A 2R7DA 2XGCA 2ELKA 3GTLJ 1OR7A 2E1CA 3OL4A 2K02A 4G8XA 4MTEA 2YX7A 1B4AA 4L62A 3W2AA 2HKOA 3ABKH 1WJFA 2XC7A 3OWTA 4BQAA 4OU0A 3QYBA 2WGBA 2MH2A 2FXAA 3ABLH 4KJZA 1BN5A 4OIQF 1LPQA 3VUQA 3H1CA 2DK8A 3BJ6A 1ZRDA 5KHDA 2HKUA 2AS5F 2REKA 4JKZA 1R5HA 5FHPA 4OAZA 3RYPA 2BGCA 2I10A 3JAMZ 4R79A 4ZTFA 1YQAA 2Y0SA 3DLLF 4EGZA 1W7PA 2Z9OA 4E6KG 4ICHA 2IXSA 1JUMA 1E3PA 5DCMA 3S3OA 2R7VA 1FSEA 2X1DA 3R0JA 5M5XJ 1KYZA 1XMAA 4ZYHA 1ZYRF 2LP0A 1U5TB 2EZHA 1SANA 2E5NA 4DW6A 2HEOA 2DJIA 2EB7A 4G6TB 5D6FA 3ZMTA 1IG7A 3OYLA 1S8NA 1ZHFA 1S5LC 3MWMA 1BC7C 2A61A 3DPTA 4D7NA 1KA8A 3ECOA 2DBBA 1J59A 3KP2A 1GVJA 2PFVA 1MGTA 1JHFA 3E6BA 5BMZA 4JX4A 2COBA 3P7NA 2DFFA 1G6NA 3KEQA 5ICEA 1QZZA 2LLKA 1POGA 5CKTA 2HI3A 3A01B 1DU0A 4BNCA 3VOKA 2IS1A 3FIWA 2E5ZA 2V4JC 3GMEA 3PNTA 1VQKI 4UV9A 3HHGA 3BPXA 1QPMA 3OSFA 2NOJB 3K0LA 5KAIC 3V6GA 2HYFA 2ZBKA 1O7LA 3I0TA 3K4NA 3F9KA 3QU3A 1R49A 5GADJ 2HVRA 1Y56A 1Z7LA 3KPHA 2ZXWH 4UVCA 4LLGF 3J7YJ 1FOXA 1M1EB 1YG2A 5E8IA 1N75A 1X3ZB 1XGNA 4H0EA 1N25A 3NI7A 1USSA 2L01A 4CYCA 4HA8A 1RZ4A 4F92B 3HRUA 5HLTA 1T33A 3GXOA 4ABZA 1NTCA 3NPIA 2MD5A 4HRIA 1F9NA 5C4XJ 1BJZA 1SFXA 3NWTA 5JVTA 2GQQA 3OYGA 1BA5A 2LF8A 3EYIA 2DO7A 2MLGA 2JZYA 4GFBA 3FXOA 1QBJA 1BI0A 1R58A 4M72A 1ON1A 1OYWA 4FX0A 1R1TA 4P9FA 4HQEA 2FD5A 2Q2EA 5JI6A 2BXZA 3A0HC 1JJ6C 3GTMJ 1JJ8C 5FO5A 1VNDA 2DOFA 2KHMA 3GZNB 3CP2A 4AIKA 4RAZA 4I02A 3CDIA 5DDGA 4LLNA 1JT0A 2P7CB 2V1NA 2EFWA 1V4RA 3PIOF 3ERMA 2UUZA 1WI9A 3OYEA 2G7LA 1PP7U 4ZDOA 2ME6A 2OQRA 3HC7A 3H36A 2NNNA 3C3WA 2GAUA 2LY2A 1VFCA 2FOWA 3IL2A 3FRQA 2EA2A 4XKCA 4RA2A 4BQOA 1AA7A 3I59A 2ZB9A 3GFIA 2ZSHB 4WIBA 3TOAA 1LEBA 4HLXA 3N97A 2F2EA 4IRIA 2LVSA 4XOTA 1Z3YA 4BY7J 3CCRI 3HTIA 2XAFA 1I50J 4DBRA 4JBAA 1VQLI 4EM2A 3ZN1A 1TWHJ 3VDXA 1ZTRA 3FM5A 5LD2C 2QBYB 1LEAA 4L0ZB 2E34A 3BTCA 2GOXB 1LB2A 2A6EF 2DLLA 2DU9A 2QQAA 3PUBA 2D45A 3MAJA 3LA3A 4GRIA 2Y9YA 1VQMI 3CUQB 2DA5A 3HDDA 4GCLA 4OAYA 4ZZDA 2Y48A 4ESBA 3BJAA 5EEHA 3SFZA 2CMPA 3M7GA 1AU7A 1NHAA 4GXOA 3CCMI 1U78A 1I3QJ 3JRDA 2VQLA 3OMYA 1TQPA 5FKLA 1W36D 2JQ7A 5K58A 2X6OA 1JE8A 3DKYA 4AIJA 2YPRA 4DVYP 5GAGJ 3FHZA 1DDNA 4L9VA 2K85A 2VLAA 1FY7A 4CCJA 4C2MJ 2PMUA 3MCZA 2G0EA 4IX7A 3D5SC 3DU6A 1SEUA 2WC2A 3CMMA 1TWAJ 2VQHA 1MBGA 4XMYA 1B72A 1W5SA 4ZDLA 3LSTA 1E3OC 2HOSA 1K6OA 1ZRFA 3PPBA 4DBQA 1KZHA 2J5PA 3CCYA 4R1HA 5B5EC 4IRHA 3M3YJ 5CPRB 5LRSA 4DYCA 3DKWA 4GFLA 1AKHA 4YG2F 4Y7NJ 5LHGA 4HYEA 1YRNB 5D8LB 5FKMA 5FLMJ 1GLNA 3E6DA 4BUPA 5FLXZ 3H0DA 3ON2A 3DCFA 4BGDA 4LLLA 4E7LA 3ONQA 4YFKF 4CH7A 3F6OA 5H20A 2DDAA 3SQNA 3ZPLA 3V8LA 3I9V2 2MH9A 1I6XA 2V9PA 2ZOYA 1WJ5A 1FNNA 4HZFA 5EJCA 1OYYA 2DK5A 2BEOA 1UZCA 4LB6B 2IGNA 2MA3A 4YELA 1WGXA 2RAEA 1P4WA 1ZR4A 2WUIA 2XDNA 5J1YA 2QWWA 4S04A 1K78A 3HOUJ 1VF9A 3FM3A 1Z7UA 4MLOA 4HSTA 2FX0A 1WJDA 1H88C 3CO7C 4NQWA 1OISA 2KZVA 1HQCA 1HOMA 3SZGA 2CU7A 2O8KA 1T2KA 1X2MA 2M8EA 1X4OA 4PUSA 4MQ9F 3IWFA 3B6AA 4FHTA 1IC8A 3WODF 3RPUA 4XLAA 2DYRH 2A5WA 1X1BA 3L2VA 3CDHA 2XGDA 3W2WA 1A36A 5HSZA 1MNEA 3G1LA 2HPMA 2QOPA 2DI3A 3OYKA 1MMAA 1R71A 3LQQA 1RESA 4NHJA 4YIIA 3FXRA 4XRSG 4ME9A 2IW5A 4A3GJ 2ISYA 1BL0A 1E2XA 2O7OA 3DBHB 3JSPA 5KAFC 5J4VA 2MD0A 3V7CA 3PO3J 5DM7F 1TTYA 3G1MA 4KIBA 4QWQA 2O8XA 4E7IA 1MBHA 2ISZA 2PEXA 3VIBA 1JGGA 4M9SA 4Y13A 1DP7P 4NB5A 1R1UA 1Y1VJ 2JUGA 2WADA 5JLXA 3VYRB 1XTAA 3HTHA 4E7KA 4DGWB 3JRGA 1TT0A 3HRTA 2GA1A 2L4AA 4RB0A 3VPRA 1H0MA 1ZQ3P 5HODA 5DUKA 3DTEA 2LY1A 3ZMSA 3WTTC 3BR1A 3WU2C 5CW8A 2YS9A 3ZMVA 2DA7A 3ERED 4GYIA 3CCEI 2YSRA 3E0JB 2XDVA 1MJBA 2JA7J 3GTGJ 3DQVC 3S14J 4LG0B 3DU5A 5IYCJ 4KNYA 2TCTA 3MEXA 3ZQGA 3KZYA 3M1CA 3I55I 3LFKA 4J00A 4OD4A 2RGVA 4RM2A 1D1AA 4ESFA 3CO6C 2FJI1 2OUMA 2EZLA 3ZQFA 4BHPA 3A0BC 2ZFWA 3NRVA 3K1MA 5DCFA 2R5YB 4A3MJ 4HNVA 2BE5F 1I6HJ 2ESNA 2JSPA 3LSKA 3VTIA 4IKFA 3ELKA 2YVEA 3GTJJ 3BCAA 4DOZA 4ZYEA 1X1CA 3E97A 1HKTA 2EZKA 4L5EA 4RLFA 5H6QA 3S1NJ 5DUIA 3IUVA 1N77A 4F52A 3ZP5A 2FEZA 4U0WA 1EA3A 2EK5A 3OYIA 1RETA 4BEHB 4B4CA 4NC6A 2QSGX 2UXXA 4A3LJ 1BJAA 4YZEA 3HIMA 3CJRB 4B1RA 4II2A 1DPRA 2R7UA 1IZ1A 4Y33A 3ZMZA 1VZ0A 3ABTA 1EKEA 2IA1A 3JCUC 4CCLA 3OYFA 3KNWA 4IZZA 2CQKA 1T6SA 3U1DA 2TRTA 4D0PA 3VFZA 5EGOB 1I39A 2DG7A 2A6HF 2ADUA 2GM4A 3MVPA 2LD5A 2V1DA 3W2VA 2LDUA 4KITB 1ZLKA 4ZDPA 1WZ2A 5HLGA 1IUYA 2KJCA 3KETA 1PVEA 3WGHA 3M4OJ 1WI3A 4UB8C 1MJ9A 2WV1A 3DP7A 3H92A 1OFCX 4S0HB 3G73A 2L9NA 2CV0A 3HOSA 3LWJA 2QZ8A 2L5QA 3GTPJ 1MDMB 1G3TA 5LHIA 1JXSA 3S2WA 3UR3C 5L3BA 2Z5UA 4BE2A 1T0FC 3BTIA 2NVTJ 2HQ5A 2PLYA 4O5VA 3A4CA 5L3CA 2UZKA 1G3YA 1HSTA 2L2OA 3LFUA 3NRGA 5F64A 1FBQA 3RPUD 2MLKA 1MD0A 2X51A 4RLQA 4A6EA 5F1JA 3TMOA 2A3SA 2XB0X 1ETQA 3FMRA 5D19A 1ODDA 4CCMA 5DV5A 4DQ2A 1R4MB 1HW5A 3GEUA 4OINF 1UI5A 5DYMA 5IT9K 4EEFG 4AC6A 3BQZA 3LQRA 3K70D 4QTRA 1HF0A 2JK3A 3CD6I 3NWSA 4G12A 2VJ4A 2IS4A 5HDGA 4U9LA 2P8TA 2E2JJ 5K5OA 4ESJA 2ZMEA 3TO7A 1FYKA 2CJJA 2HKXA 2LK2A 4CA0A 3BR2A 1ONVA 2ME0A 3E5XA 2XF6A 3IAS2 2ZXHA 1V55H 2JN6A 5E3NA 2V6EA 4XKVA 2M0MA 4BAYA 1ZAOA 1SGMA 2GZWA 2JPBA 3S2DJ 4CYCB 2ZSIB 3BC8A 3TO6A 3GWZA 1DUXC 2DA6A 2HZTA 3A03A 2F5EA 4UV8A 3I4NJ 2JUCA 4OIOF 2N8GA 4KFCA 1SD4A 3BY6A 2DPDA 4BKXA 2DPUA 2KT0A 1J7KA 2L7FP 5IY5H 1I1SA 2MG4A 4P5OA 5H6RA 1XS9A 1HDPA 1P2FA 5DD4A 2UV1A 2VL8A 1FLIA 2WY7Q 3SZPA 3VYTB 1QVTA 1TQMA 3DTIA 1O3RA 2L3DA 3QRFF 3GFLA 2MBFA 1K7AA 2EQRA 4BDZA 4RMNA 2X4HA 3QKXA 4BQQA 2KDZA 2CV2A 3BDDA 3K4MA 3G1OA 5B3SH 4A69C 1WJBA 5EEGA 4PK4A 1ZGWA 4UVAA 4CXFA 3F1BA 3ZXSA 3JR9A 3IH3A 1VQOI 4PJLA 4W97A 2B3WA 2E35A 1TLHB 4YFNF 2CWEA 1Z21A 2XKPA 2R7SA 1A04A 3BTLA 1ORKA 1PDNC 2V57A 1TNTA 2M87A 1VQ7I 2BY2A 4BHCA 4D5CA 3BTJA 3T8TA 2ID6A 5FKKA 1ZGAA 1SFEA 4YEJA 4FTHA 4XR6A 4KA4A 1IXCA 3VP5A 2KP6A 1IO2A 3BOQA 2Q8KA 2DN0A 3L7WA 3DBLB 3BROA 1KU9A 4BJ5C 1HW2A 2YU9J 4I6ZA 2H1LA 3FMSA 5LGNA 3O6BB 1DU6A 4WXDA 4BXUA 2AO9A 2D2WA 2JMWA 3U21A 3LA2A 4D9JA 4MIMA 3WTSC 2GUHA 5JHFA 3QPSA 1SMYF 3V8KA 3EQLF 3KP4A 5A2QK 1LE8A 3CLOA 3IH4A 1VQ4I 5EG0A 2JTVA 1FJLA 1K4SA 1FSHA 3K70C 4FE7A 3UNGC 2IBDA 5LLQA 1K61A 2E2IJ 1XMKA 3L2RA 4X6AJ 4IEJA 3AG4H 3L00A 2O9LA 2DFEA 1R4NB 3FWEA 1ZH5A 2OI8A 2HNHA 3QP6A 2JPCA 2GOMA 4F3QA 4X1EA 1ZN2A 4P55A 4UUSB 4L18B 3OYDA 1J09A 2VUMJ 1OYIA 3DPJA 1BI3A 1JUSA 1SFOJ 3I54A 1GV2A 4HDUA 2X6WA 2VONA 3MNLA 5HDKA 4CGZA 2HVQA 3IC7A 3LSMA 3ZQQA 2XF7A 2QF7A 3G6EI 2VE8A 3JTGA 4HDVA 5E79C 3DKXA 2QQ8A 4L9JA 5KNLA 1F4KA 4JQFA 2LYCA 1UG2A 3MKYB 1ULYA 4ZYDA 2P0WA 1UFMA 3RKXA 4EVIA 2M7BA 2OTLI 2VIXA 1S72I 1IDYA 4A93J 4RS8A 2ZCXA 2XASA 4ASNA 1B8IB 5H9TA 1TWFJ 1MNDA 1QZEA 4G9YA 1YFHA 1Z6TA 1K6YA 2KISA 2OCCH 5K7ZA 1UI6A 3JAMK 1JTYA 2E19A 5AIPA 4I98B 3OY9A 1FOWA 4RGRA 3B02A 3OYNA 1KU2A 1WWXA 4KIFA 4XRFA 4YIFA 3J7ZI 5GP9A 5DM6F 3DPLC 3K4KA 1Z67A 1P4AA 1K78B 3W6VA 2HTJA 1PUFA 4RM3A 3DXJF 2VJJA 3HPHA 2IA2A 5K5QA 1ENHA 3KZIC 3MZYA 1FIPA 2KJBA 4XKWA 4FCYA 3VVYA 2KIUA 2EBIA 1XMXA 1UCRA 1QHHD 4LIUA 1S29A 1S3JA 1VQNI 2Q1ZB 1LFBA 3SEZA 1YW8A 3I4MJ 4DYQA 5L3DA 1T08B 3TL4X 1EJ9A 3QBMA 4Y17A 2DYSH 3I3LA 4BY1J 2DMPA 2ZXJA 2PI0A 3DBRB 3E3VA 1UG0A 1DP3A 3TKYA 1DPUA 1U8BA 5J4YA 2FOKA 4C30A 4GCVA 3CRJA 3P9IA 3P9CA 4K2EA 2R5YA 3M8JA 1Y0NA 2X6XA 4GCTA 3U2RA 5JLWA 5K7FA 3HJEA 5D5WB 1LFUP 2ID3A 4KYWA 1HKSA 2M4GA 4EQQA 5BPDA 1SAXA 3W3CA 2CH0A 5CQGA 1USTA 3O60A 4B48A 1BIBA 3IV5A 2ZJQF 3F6VA 2XAGA 1RKTA 2CSOA 3K69A 5EZGA 3GYHX 4ZC3A 4BEHA 3V7RA 4I0BA 1IGNA 2STTA 2Y0MA 3FX3A 5HDNA 1AOYA 3AQTA 1FMWA 2ZO4A 4ANJA 3K4CA 5BOXA 1W1WE 2ELJA 1H89C 4J19A 1FBUA 3N05A 4IL6C 3VW2A 1O3TA 4XNFA 2XSJC 4BL0B 1GHCA 2YUSA 1XGOA 2KKOA 4EJOA 4NUBA 1J0RA 2FF4A 2JWTA 3JSJA 5D1RA 4LG0A 2UXHA 2DMNA 2IJLA 3HYIA 3EPZA 4NC8A 3WTVC 2KL4A 3BG7A 3CF2A 1XB4A 2MGQA 5LFAA 5A2QZ 2RASA 4ENJA 3F8CA 1YRNA 1YJ9I 4JP0A 2E1OA 3LSRA 1IJWC 4QIWN 1KU7A 2W48A 4HNUA 2VT3A 4IXAA 4Y4RA 4V19K 5EEAA 1OR7C 3ESWB 1U9OA 1XCBA 3WG9A 1QVUA 5BQTA 4W1UA 2R5ZA 3B6CA 4TV7A 5JVGF 1JI8A 5IYDJ 1SD7A 4M6XA 5IPAA 4Q4ZF 1D1CA 4UDSA 1TT5B 5HNFA 1TNSA 3QOPA 3S1RJ 4A3CJ 3HOVJ 2A6TA 2BVMA 3A2KA 5B1AH 3FK6A 3VODA 3IRRA 1JUPA 1P7JA 2IU5A 3T6NA 2ZY9A 2EJRA 2LNBA 2M2EA 4CGRA 2XPWA 2F07A 3ON4A 1FIAA 1WVRA 2W1OA 2NP5A 2QQBA 1V5GA 1YW9A 4M9ZA 3SEQA 5EG0B 3J81K 3OYHA 3KP5A 4ZJZA 4KN4X 4J01A 3PL8A 4L0YB 1D5VA 5ILUA 4H4KC 1JKRC 3NXCA 2RKHA 3SFIA 4U0YA 2VC1A 2H8RA 3FK7A 2RN7A 3M1EA 2HYGD 2LH9A 1A35A 2LKPA 2LMDA 5F08A 2IAIA 2Z99A 4HOBA 2PFBA 1IRXA 2KRHA 1H9GA 1X1DA 4CYDA 1SMTA 5FLXK 2BXYA 3E7QA 2QWTA 4XRMA 3IWZA 1Z9CA 2O7TA 1D0XA 2FRHA 1WJCA 2JVGA 1YHQI 3CC2I 3HL2A 3GTOJ 3Q9SA 5J1RA 2V7FA 3BG3A 1RRJA 1X4PA 2OA4A 2WAQN 5E1ZB 1P7IA 1E3HA 2K27A 4HV5A 4OMZA 5LEJA 3GCMA 4BE0A 3BR0A 3CF5F 3D0SA 5C4YA 2B7EA 5DD8A 3RYRA 1R9TJ 2R7WA 2M5WA 4BHBA 1V5EA 1RR8C 1CF7B 1UHWA 2EILH 4XM3A 4PDKA 2F4OB 2JRMA 4XLFA 3FDYA 1GT0C 5E17F 5F27A 3HZJA 3R61A 2EA4A 2NVUB 4CCOA 1GV5A 4QPOA 2HS5A 4LG3A 5BPIA 2AXLA 2H1KA 2F5CA 3WU1B 2BV6A 2M45A 2STWA 2I5UA 2VB6A 3SYTA 4IHSA 3KFWX 4HF2A 2KLOA 3BCBA 3H35A 4IQ4A 1J9IA 2OQGA 3SZTA 2L9RA 3IKVA 3T0YA 3LSIA 2ZFUA 4RB1A 1YJNI 5CJ9A 2CFOA 4UUTA 5M3FJ 3V4GA 3F0CA 3HBLA 3RDIA 4PGGA 2X1CA 4AWXB 2VKVA 1MH3A 2G9WA 3BT9A 5JFRA 2D1VA 3K8PC 4MK6A 2G7HA 4B47A 3HPGA 2K9LA 5GPAA 3WG7H 2DG8A 2QKMB 2VPLA 3COAC 1J5YA 4C2MA 3CCUI 1JKQC 3HE0A 2BBYA 2HVSA 3CUQC 3LNQA 5J8FA 2R7ZJ 2LFBA 1MBEA 1S7EA 5JHUA 2ZMEC 1XG1A 3PSFA 3BP8A 4KDPA 2VXZA 2QM3A 3MMYB 2W7NA 5CXGA 3P9KA 4C3JJ 2WV0A 2O0YA 5GAEJ 4RGXA 4EM0B 4ETSA 1YTYA 3CC7I 1HDDC 4QPQA 4M6VA 3TDZC 1SVLA 5HS9A 4FASD 3CC4I 1HCRA 3C2BA 4B3AA 3L9FA 5TGTA 1BC8C 2DODA 4I76A 2G3BA 1O3QA 1CGPA 4IJAA 1A6IA 1Y8QB 5J1UA 3MKZA 1APLC 2UXOA 3EDPA 2NS8A 3TW7A 1E0EA 4L9TA 4KT6A 3JRAA 4IQJA 1YYVA 2M34A 3FBNB 3ZRGA 3R60A 2ZCWA 1UHMA 3J7AO 1QZYA 3VWBA 2P5KA 1FX7A 2YR2A 1RUNA 4WX9A 3S1QJ 1Z0XA 4V2GA 3BZKA 3F8BA 3KZ9A 2RQQA 4AM3A 1D8KA 4RAGA 2F4MB 3I58A 4PXIA 2UWMA 4ENNA 5LRRA 3ZQLA 2ECBA 3K4JA 2KFDA 2AXTC 1JT6A 1ZGJA 3HKZN 1TWCJ 3EUKL 2XPUA 1A31A 3G56A 2KIFA 1WKMA 4O6JA 4G6DA 3JSOA 5IOZA 2CGPA 2VOOA 3IAM2 4XORA 2IGOA 2GWRA 4Y15A 3ZQIA 3C07A 2WAFA 3CMEI 3CCJI 2M30A 1B8IA 4GDFA 1FTZA 3B81A 4NC7A 3FKJA 2R3SA 4BJ6C 2CQNA 2FMYA 3CQZJ 2E60A 1LE8B 2BZTA 4N9IA 1R22A 1U0JA 2A2FX 2WAEA 4XN3A 2KMUA 4D7MA 3QPTA 1L0OC 4XLPF 4ZH4F 1IAWA 2FQ3A 3H0GJ 1R5ID 3BZ6A 2GXGA 5D5VB 3TOBA 3LSGA 2D5VA 2EIMH 2HQNA 3AG2H 2BW3A 1KU3A 2A69F 4WXHA 1XGSA 2DFHA 1X1AA 1VQ9I 5D8KB 2PJPA 3PASA 5IYBJ 2ZKZA 3T5XA 4D1QA 4AU7A 1B6AA 4UXNA 4MHGA 3Q9VA 3ZMUA 3WTWC 3LHQA 3VW1A 1MW7A 4F7ZA 2HWVA 2R7OA 1NH3A 5KVRA 2HDDA 5FKNA 4M6YA 1XCVA 4C2UA 4P9UA 1MSEC 3HGYA 3RQ4A 1K83J 1IV8A 3BLYA 1B1BA 2KRCA 3PNVA 5FD6A 4CZCA 2OTJI 2FBQA 3DPUA 3CUOA 4IO9F 4KISA 2KZGA 4XSXF 1FOKA 3HOYJ 1Y6IA 3A02A 1ETOA 2L0KA 2GFNA 4HAMA 4E7SA 5CXIA 1UJ8A 2ICWG 3H3UA 4IRVA 3V78A 1ETYA 2GIZA 4IOAF 3IHUA 2Z2SB 2NS0A 3ZN0A 2K40A 3QODA 2PQ8A 2PX9A 3D1NI 2MC4A 3EYYA 4I99C 5TISC 5DAJA 5CVRA 3G7RA 1YO5C 1ETXA 3GTQJ 1PYVA 5B66C 1ETWA 1SC7A 2A07F 2WB1N 2JA2A 1YS6A 4HQMA 2VI6A 4B43A 1H9TA 1P9QC 5IT3A 3BPVA 3I5UA 4S05A 4B09A 2WY8Q 1JKPC 2M7AA 4LFUA 1R5GA 3S15J 4RAFA 3F8MA 3TQNA 3WTUC 3S1MJ 2Q24A 4HKUA 1E17A 2XV4S 1XSXA 4I01A 2MSYA 2VBZA 1Z91A 3J81Z 1A5JA 5HBUA 2EPFA 1SD6A 2IVMA 1JGSA 4LITA 2NRAC 1MNMC 3HOXJ 3RD3A 4YFXF 3CCLI 4V2FA 3P9TA 2CUZA 2V6CA 2DDBA 5HVQC 1FYLA 2QGUA 4JOMA 2DXIA 1R6RA 2MABA 4HLYA 3GUDA 2GBYA 5CVVA 2J5OA 4LOCA 3QYFA 3FHNA 1CF7A 2V9VA 5AQCA 1ZLJA 2AQEA 4UUSA 3MZ8A 2DA1A 3KYDB 4AD9A 3F21A 3PQKA 3S93A 1ACIA 2G7GA 3CCQI 1W0UA 3TDUC 1VI0A 1ZARA 4UVBA 2KDOA 1RUOA 1U3EM 1XX5A 2Y9ZA 2IEKA 3B73A 2M4KA 4PGHA 4KMUX 5HNHA 2PMZN 1MMDA 5FGLA 2KIMA 5F1RA 1ZG1A 1TC3C 2DTRA 1IRGA 5BS6A 5HLIA 1FP1D 2QYOA 3HB9A 4BBSJ 2LREA 5M3MJ 3K9TA 1Z05A 2HQAA 3ZMDA 2CG4A 3AL0C 2UXPA 2B9SA 2NX4A 2IRFG 4N4NB 4HNTA 4A6DA 3L09A 2HYTA 1RIOH 3KLNA 2CRGA 5E3LA 4XL9A 4MQVA 3J80Z 3GZ6A 4GGGA 4B8XA 5FROA 3TGNA 1LDDA 4XQFA 5EF6A 1SVOA 2MW8A 2XHKA 5EFYA 1ZRCA 3K1PA 3K7AJ 2VE9A 1WJAA 2ZJ2A 3G4SI 3E7LA 1X58A 5IOYA 3GVAA 2QENA 1V3FA 3OS2A 2VOPA 3M8FA 5LHHA 2QBYA 3OOPA 1P4XA 3HEFA 3EUAA 3RH2A 1IRFA 4N4OB 5GTHC 1MZBA 2KRFA 3HHHA 1W5TA 3SDGA 1UHSA 1RR7A 3ECHA 1XDSA 2QVOA 4G7HF 5J47A 1R36A 2H6CA 3JREA 4CZZA 3G71I 1D3YA 2R7QA 3H9QA 3JRHA 1IXRC 3I56I 2W25A 6PAXA 3GBGA 3FKIJ 2P6TA 1HXDA 1Z6RA 4Q5SF 1ON2A 2RC4A 4WF2A 4BQNA 1O57A 1W36C 2DMQA 4ZYAA 4IOCF 2FSWA 1XGMA 3JRCA 1FTTA 4PCQA 2OZUA 3WTZA 1K4TA 4BS9A 1IV6A 1I27A 4IHWA 9ANTA 3L2QA 1ZK8A 4XKBA 3I64A 4A3DJ 3OS1A 4U9NA 2XAUA 3GTKJ 2YX4A 3O8HA 4LD5A 3OR2C 5AIQA 1TW3A 2E1NA 3R6SA 2PJRA 2Z1DA 3HRMA 2DOEA 3RKWA 1SFUA 2VPRA 2EFQA 5HAWA 5K5RA 3FZVA 3SHFA 5C44J 1LJ9A 3BHQA 2K7LA 3OYAA 2F5DA 1WSUA 4WCGA 3PO2J 2RDPA 3NNRA 2K9NA 1SFKA 2VJIA 2HOEA 2HTSA 2E7XA 3RZOJ 1D5YA 3WGGA 5EDNA 4AVZA 4FQGA 3C7JA 4M74A 1K79A 3GZ5A 4U7BA 2LC2A 5FJ8J 2X48A 1W0TA 2ZC2A 3FXMA 5D5UB 2O61A 2G7SA 5HS8A 2H8WA 3S5RA 2VXDA 1O7FA 3IRQA 3S32A 4RGUA 3MD2A 3CJTB 2DT5A 3HKZA 5ED4A 1XD7A 4LK1F 4OWRB 3OR1C 1OCPA 4LIVA 2DCEA 1I3AA 3AFHA 3CUQA 1ERDA 1MBKA 3FXJA 1P6RA 1BR1A 2GXBA 3RSNA 2K9QA 1YX3A 4WXCA 2I8DA 1FBSA 3K6GA 3V42A 4NN1A 2EWNA 2XAJA 3ISPA 1HKQA 4C3IJ 2NVXJ 1PUFB 3RTRA 1UELB 2CS3A 3QWLA 1EH8A 3H5NA 5DTDA 3LSPA 4GYGA 4EJTA 3C2HA 1IN6A 4UY8I 2R92J 1WJEA 4IHTA 1Y39A 1BR4A 2XVCA 1OQYA 2A5YB 5M5YJ 3A1YA 2ZNZA 3LMMA 2CUEA 3QP5A 3WE2A 5D6EA 3DEEA 2DA3A 3GFMA 4A3JJ 4G94A 4AC0A 3NQOA 4EJUA 2WTEA 4JX6A 2QQ9A 3VVZA 2Y75A 2R7TA 4A2UA 4N0BA 4U0VA 2OAZA 5GPCA 2P4WA 5C3EJ 2JA5J 2VBYA 5GAHJ 3BR6A 1U8RA 3F3XA 2FJ1A 3TO9A 1HC8A 3HG9A 1BIAA 2K3FA 3DTKA 2FQ4A 3KYCB 1DGWY 1MSFC 4HW0A 5AONA 1IW7F 1GDTA 2A05A 3AQSA 4FISA 2FUG2 2R7RA 3DEWA 3I59B 2XF5A 3NARA 4HG2A 4I7HA 5BNGA 4M3GA 3VSLA 1TWGJ 3DEUA 1XSDA 5E3MA 2H27A 5J3LA 2HQRA 3WHBA 5CVUA 4ACIA 1HBXG 1BOAA 3TBIA 5C4JJ 3TW6A 3KEYA 1WH5A 2O6GE 3S16J 4JX5A 5KK1A 3VW0A 3Q0WA 3HOTA 2HFHA 3WTYC 1BOBA 4A3FJ 3H9GA 1YJWI 3C2GA 4I0AA 4JK1X 2B0LA 1Q1HA 4FETA 2VBXA 3O8GA 2QIBA 5B1BH 2K4JA 4XLEA 2ECCA 1J2XA 2XIGA 3KP3A 4N9HA 3NAUA 2GIVA 2HDWA 2LRDA 3EUHC 2XGXA 3PFIA 1UAAA 3VVXA 4HBLA 2VODA 2LKSA 2DW4A 2IPQX 2LF7A 1VQ6I 2HXIA 1AWCA 3GLLA 3BQYA 3HUGB 3JW4A 5IP7J 4XICA 1Y0UA 4A5NA 2BHYA 3CESA 4IVNA 4OMYA 1TQIA 1BBYA 2DT7B 1X3WB 4MGRA 5CVIA 2V1XA 4CUGA 2OCEA 2R0QC 1LFPA 2LR8A 2V26A 4HX8A 1MMNA 2K9MA 3W6JB 5ICCA 5DS9A 1NG6A 1S9HA 3MKLA 5LGUA 4BDYA 1RKWA 1FWZA 3S2HJ 3BZCA 1I5ZA 1Y8RB 2KQRA 2Y31A 4EJVA 3LSHA 4ENKA 4MNUA 3MFKA 3AKZA 5E1WA 2DTZA 3GF2A 3SJMA 3OIOA 3AL0B 1WHUA 1QRYA 3BG6A 2WBMA 2E2HJ 4OOIA 4L9NA 1T98A 2MFZA 3J80K 4BYYA 1D0YA 1KGSA 2ZCMA 2HPIA 3AAFA 3ANGA 2CUFA 1SD5A 2Z33A 2WB1A 2L7KA 1OCCH 3LAJA 1YIOA 5JR3A 1LQ1A 3HOZJ 2LY9A 1GVDA 2P81A 2VN2A 2B1EA 4LJZF 3LL7A 4L5IA 4XSZF 1VQPI 2NVYJ 4FT8A 2OF7A 3L2WA 5F6FA 4CHUA 2E36A 1LVKA 2XKOA 4JYKA 3PSIA 3OYBA 2PG4A 2QEXI 1MIJA 1EH7A 2ETHA 3BG9A 3RQIA 3HGGA 3CMYA 2AHQA 3EUPA 3H9JA 3KP6A 2EV0A 1MKMA 3QPHA 5F0HA 3CJNA 2UXNA 4E7ZA 2CV1A 5D4RA 1BI2A 4XIDA 4F55A 5ICGA 2FMLA 1QNTA 4AF5A 4GO1A 5FB2A 4PSXA 4YRVA 2JA6J 2X6YA 3BG5A 2F5FA 2FA5A 4NNJA 3I4PA 2NP3A 4OIRF 4CDGA 2HYJA 3WU0A 5GTIC 2HOAA 2EZIA 3AG3H 1MMSA 2KIQA 5LEKA 3BJOA 3ML6A 2JT1A 1NK2P 4KUMA 2LBFB 1U9NA 4Y52J 1FYMA 2L9SA 2OBPA 5E18F 4B3XA 1EH6A 1U5TA 2GXAA 4C2TA 1G2HA 3KLOA 2BYVE 3E5QA 3CTAA 1JKOC 3H3VK 3K4BA 4A5MA 4DIQA 1QU3A 2YU3A 3CCVI 4E7HA 1Z1DA 3LA7A 2QLZA 3U9GA 4XONA 4Q47A 2L54A 2MYSA 2RVCA 4Y3OA 4I2OA 2K9SA 2W85A 3VYSB 5K7HA 3CZ6A 1LDJA 4U88A 1MDMA 3Q0VA 4C9YA 1FC3A 5F0CA 1L3LA 3WTXC 1OKRA 3BRUA 1R23A 2EV6A 1MBJA 1WH7A 3M07A 4CICA 2PZ9A 3P5JA 1XC5A 4AYBA 5L3EA 2CFXA 3S17J 4UHTA 1P92A 3LWFA 1BM9A 2HOTA 2E7WA 2XROA 4IHYA 4CCKA 2P7VB 4BACA 2ESHA 4PJNA 4BXFA 3CMAI 1FPQA 3CJDA 3Q5FA 5LBQA 2NVQJ 2FBHA 3DLAA 2CQQA 1BR2A 1I1GA 2L7MP 3K2ZA 1S7AA 3L2UA 1TL8A 2K86A 2QTQA 1ZG5A 2W57A 4WWCA 1IN8A 4F93B 3UKGA 4O3MA 3K4LA 3PNYA 4M3BA 3OIPA 4HX4A 3KE2A 4EMSA 2LTPA 1OCZH 2RREA 1UMQA 1HSJA 1F36A 1JTXA 3G2BA 1NG7A 2Y0SN 3JRBA 3ASNH 3K10A 2HGCA 1R1VA 4LMYA 2IS6A 5IP6A 1B9MA 3S8PA 2EV5A 3RKQA 5FFXA 2EIKH 4PFOA 1YW7A 1W5CC 2DMTA 3HSFA 3TEDA 4YIRX 1TBXA 1EV7A 2RV8A 4IF4A 4OD5A 5FMPA 1R7JA 1XN7A 2W00A 1G59A 1MBFA 4BXXJ 1F43A 3K2AA 3GO5A 4EATA 1DQUA 3VSKA 1LNWA 4RGSA 4FE4A 1GXPA 2L7ZA 1ZR2A 2DFIA 2H94A 1S7OA 4QLCU 2CUJA 1O4XA 2XPVA 1T56A 5L3FA 2H09A 4Z6YA 3MZHA 2GA2A 1JHHA 1MH4A 2W82A 1IUFA 2Y2ZA 3R0AA 4XLCA 4BH9A 1XSVA 2R7XA 4MFDA 3PM1A 3ANPA 1XPXA 2X1EA 1V54H 4BBRJ 5HOOA 2PN6A 2NS7A 1FZPB 2BY0A 2VQCA 3CP8A 4ON0A 3DFGA 3H5AA 3PQJA 2ACJA 2IA0A 2FU4A 1IN5A 1VTNC 3SDBA 1KQ9A 4RB3C 4A3BJ 1BW6A 3OYCA 2BVLA 3E5UA 3JTHA 2EINH 2R5ZB 2JSCA 2M1BA 2Y30A 5CVJA 2EH3A 2E71A 3GFJA 2VBWA 2PMHA 1OCOH 3QAHA 4QSHA 3HSEA 2DJNA 4XLNF 3SWHA 1KQ0A 4KICA 4KN7X 2QKOA 3EETA 4ZYGA 3RI4A 3C18A 1X19A 4PJMA 3AG1H 3H5RA 2HU9A 5EYRA 1D8JA 1LKXA 2LG4A 3ZR8X 3CCSI 2XAHA 3RKYA 1HLVA 1SVMA 2ZNYA 3X2QH 4M3FA 3MKWB 4A12A 2JA8J 3BNIA 3CJQB 3QQAA 2L9VA 2DA2A 2RNJA 3FF5A 3QPLA 4AVPA 4CCNA 2NNYA 2EFNA 1QHGA 2VT2A 1PUEE 4AUXA 2M9HA 1XDUA 3ZQ7A 1DGRM 5KCMA 2B63J 1ZKGA 3EUHA 2VQGA 3LAPA 2DQLA 2LSOA 3NS4A 3T8RA 2M8GX 1QGPA 1QQIA 2CO5A 5EGOA 2JJ7A 3F72A 3KZZA 3IKTA 2HR3A 5HS7A 1VQ8I 2M3AA 2XSDC 3W6KB 1B9NA 3BWGA 4LB5A 2CW0F 4MEYF 4DZPA 1WQ2A 3JRIA 3QOEA 2QKLB 1F1ZA 2VKEA 2V1UA 2OZ6A 5FD5A 4PJ0C 2HDCA 3CWRA 3D5RC 3ZQHA 2VC0A 3ZGKA 5DCMB 1Z77A 2OERA 4XLHA 4FX4A 1OLTA 5FKOA 3LOCA 1MMGA 4NQWB 3N4MA 4IHVA 4IHXA 3WE3A 3VEPA 1ETVA 2Y69H 3KCCA 2X85A 3E1SA 2RNGA 2D1HA 2IT0A 1IDZA 2PJRB 3HSRA 3KKDA 3ULQB 1X3UA 3DV8A 3ABMH 2WAQA 1A6QA 3Q0UA 5E1XA 1G3WA 2BW3B 3DF8A 1X1PA 1Q1VA 2LOOA 2HZDA 4EGYA 2NXNB 1KONA 2NYXA 3IH2A 2W4SA 2VKDA 2QA4I 3KX2A 1T38A 2L02A 2YVXA 4BU2A 2F48A 2OV7A 3KYLA 4PSWA 5F0FA 2OPTA 3WGIA 2IGMA 2ELHA 1T95A 3HOWJ 3NEUA 3FXUA 1OCRH 3BR5A 3FXLA 5J40A 1T39A 2HXOA 3JRFA 3V7SA 1PP8F 1BW5A 3QYEA 3RPQA 2DQRA 2M0CA 3FXKA 5FRNA 4G6QA 4E70A 2NAZA 1REPC 4XRSA 2W24A 3PUFA 3ROUA 4HEA2 4ZTJA 4EJWA 1YITI 1X2NA 3OIQA 5CQEA 2QUFA 3F8FA 4L5JA 1S6LA 2MC3A 5LGTA 2Z3YA 2XB5A 4A0YA 1G3SA 2F6CA 2ZCNA 1KYWA 4E7JA 3TP3A 1ETKA 1WPKA 3EGQA 3O2PE 1HA8A 1YE9A 2FE3A 3Q3SA 2WWYA 2COMA 4LGWA 4D5FA 3RIRA 1HW1A 3OYMA 5M5WJ 3FXQA 1RI7A 4DYRA 3D5LA 3BR3A 2DMUA 1MJAA 1QA6A 3KIOA 2DAOA 3BJBA 1G8XA 2ZJPF 3M9AA 5D4SA 2DOAA 3E6CC 4KMFA 4HSRA 2EFOA 3COLA 5HLHA 2OD5A 1D1BA 3R4KA 4HF0A 4II3A 2GENA 4DJAA 5FGMA 3HIFA 5D5XB 1FEXA 3OYJA 3HUGA 3HTAA 2F5VA 1AHDP 3HXLA 2CW8A 4KT5C 4RBOA 5IT9Z 3E6MA 5ILVA 1C0WA 1IN7A 4HX7A 4XN0A 2BY3A 1W4MA 4C3HJ 3L2CA 2UXUA 5E3OA 4U7DA 3F23A 1ZREA 2DA4A 3VOEA 1FT9A 4U87A 2ZMEB 3U1KA 4A0ZA 3ASOH 1Z3XA 1YS7A 3GEZA 4ZZLA 1F5TA 2TDXA 5EZHA 4DZJA 4XOPA 3PJRA 5FLVA 4G7ZF 1KQ8A 1FMVA 3T1BA 1O3SA 1OCTC 3J7AY 4BJTA 4RB2C 2YVHA 4B44A 4IRGA 3S3MA 2BY1A 3F22A 3HM5A 1W7PB 2X0LA 2PBXA 1GXQA 3M8EA 4X0GA 1YOVB 1ITYA 1IN4A 1WFXA 3FISA 4HV6A 2E1MC 2XAQA 4KWAA 3GX4X 4PZJA 3DWLE 3S3NA 2UXIA 5L3GA 4HF1A 3V8JA 2O5RA 4M9XA 1LDKB 1U2WA 3MQ0A 1D0ZA 1RC9A 1AKHB 2WA0A 1V5FA 3A01A 2R93J 1TP4A 3RCOA 5CLSA 3GZIA 2V9KA 4Q48A 2BHZA 3IP4B 2ZXIA 3CLQA 4EV0A 3I71A 2ZOZA 3H3ZA 3HTSB 4A3IJ 4ENMA 4MXMA 4P96A 2CQXA 3FBIB 2OC6A 2FNPA 3KEOA 5F04A 3VOXA 1LVAA 2IP2A 1LUJB 2R4GA 2FNAA 1FOYA 3G3ZA 3ZCOA 4G7OF 4AIHA 1YIJI 2F4IA 2P5LC 5E20A 2CYYA 2VJ5A 1YX5A 2PBIA 3TP0A 4GFKA 4BE1A 2XRLA 2Q0OA 5D18A 4EM1A 3CDLA 2QCOA 2RHAA 4JNNA 4AYBN 2O03A 2A68F 4XBFA 1Y1WJ 1W7PD 1ZELA 2KPMA 2G7UA 4RAYA 2XGEA 3OOUA 3ABUA 1YLFA 5ERIA 1OMIA 2ZJRF 3OL3A 4MEXF 2Z16A 1ZG3A 4UUVA 1EF4A 3L1PA 4F91B 2RQPA 4NELA 2O3FA 1B72B 4JL3A 5DEQA 1OJLA 2L4MA 5FFZA 2JRTA 1CQTA 3OV8A 3RJPA 4ITVA 2H6BA 4I09A 4M71A 1R00A 3VYUB 3GW2A 5CYVA 4MFEA 3KKCA 1PJRA 1IXSB 3ZQCA 2D6YA 4A3EJ 2VKHA 3F8NA 1GUUA 3IUOA 2AQFA 3MN2A 2LKXA 1T8IA 4KIGA 1TZLA 4E4HA 1U5TC 2EFPA 4NBQA 1U6GA 1WRJA 3LSJA 1G4DA 2IGKA 2PMZA 1J75A 3HTUA 2XUBA 2OU2A 4WK8F 2K3PA 1OPCA 2IS2A 4UB6C 5K1YA 4RDUA 1B59A 4XK4A 2X9DA 4DNCA 3FMQA 4M73A 1N78A 1QPIA 2R7FA 3GLXA 3SXYA 4A3KJ 5FRMA 1IF1A 3HTJA 2P6SA 1TW2A 4HPQA 1H8AC 4M3DA 1WCMJ 2BOLA 2E1MB 2W84A 3O3KA 2OJED 5IP9J 2V79A 2JVHA 2P5VA 4R8HA 5J6XA 5J8CA 3HRSA 4AIDA 4CSWA 5ILSA 2XRNA 4OIPF 3BCGA 3QU6A 1RPWA 1UB9A 3LJLA 3RZDJ 4Z2YA 2VASA 4MTDA 1NK3P 2Q2EB 2FBIA 1T0FA 2C6YA 2DT6A 2K4BA 4M3EA 1QO0D 4IPAA 3ZOBA 4CO8A 3PIPF 2GLOA 3C1DA 4P1WA 2K5CA 1IRZA 5TRDA 3PFYA 1YI2I 4PFPA
chains in the Genus database with same CATH topology
2W53A 3GEUA 3ZQLA 2ECBA 4MO7A 1UI5A 1NK2P 3WHCA 1JT6A 1U9NA 3HKZN 4Y52J 4EEFG 4AC6A 1TWCJ 3BQZA 2XPUA 3G56A 4QTRA 1HF0A 2JK3A 4NDLA 4G12A 5IOZA 4GCKA 1G2HA 3OSGA 1JKOC 3H3VK 2NOGA 3ZQIA 3C07A 2E2JJ 2XGCA 3GTLJ 2ELKA 1B8IA 3B81A 1FTZA 2CJJA 2LK2A 3BR2A 4L62A 3CQZJ 2ME0A 1LE8B 5E3NA 2JN6A 2K9SA 5K7HA 2WGBA 1SGMA 4D7MA 3Q0VA 3S2DJ 3VUQA 4CYCB 3H0GJ 5F0CA 2DA6A 3LSGA 2D5VA 3A03A 3I4NJ 2HKUA 3BRUA 1MBJA 1WH7A 2REKA 2PZ9A 4JKZA 1XC5A 2N8GA 5FHPA 2I10A 3S17J 4BKXA 3PASA 5IYBJ 2KT0A 2L7FP 2MG4A 2HOTA 1XS9A 1HDPA 4IHYA 3LHQA 3VW1A 4ICHA 1QVTA 3CJDA 1JUMA 2HDDA 2NVQJ 2EQRA 5FKNA 2CQQA 1MSEC 3HGYA 3QKXA 2L7MP 1K83J 2KDZA 5M5XJ 2QTQA 3G1OA 2FBQA 4A69C 3UKGA 2LP0A 4M3BA 2EZHA 1SANA 4DW6A 1ZGWA 3HOYJ 2LTPA 1UMQA 3A02A 1ETOA 3F1BA 2L0KA 1F36A 1JTXA 2GFNA 1IG7A 3JR9A 5CXIA 3IH3A 3V78A 2Y0SN 4W97A 1ETYA 3JRBA 4D7NA 2K40A 5IP6A 3D1NI 5DAJA 3RKQA 3BTLA 1ORKA 3G7RA 2V57A 1ETXA 2DMTA 4JX4A 3TEDA 2COBA 4D5CA 3GTQJ 3BTJA 1ETWA 2ID6A 2WB1N 5FKKA 5FMPA 2LLKA 2VI6A 1POGA 3A01B 2HI3A 4FTHA 1MBFA 1DU0A 3VOKA 4BXXJ 3FIWA 1JKPC 1F43A 3VP5A 3K2AA 3S1MJ 3S15J 4HKUA 2Q24A 4FE4A 2L7ZA 1ZR2A 2DN0A 2MSYA 3OSFA 2YU9J 4I6ZA 3V6GA 1DU6A 1O4XA 2XPVA 1A5JA 5HBUA 1T56A 1MNMC 3HOXJ 3RD3A 2AO9A 2JMWA 4V2FA 3P9TA 2GUHA 4MIMA 1MH4A 3QPSA 1IUFA 2Y2ZA 2GBYA 3NI7A 4MFDA 3PM1A 1LE8A 3IH4A 4LOCA 4CYCA 3ANPA 5EG0A 5AQCA 4UUSA 4BBRJ 1FJLA 2DA1A 1T33A 2NS7A 4ABZA 1NTCA 2G7GA 3NPIA 4FE7A 2E2IJ 2IBDA 1W0UA 1K61A 1VI0A 5C4XJ 4X6AJ 1BJZA 4IEJA 2O9LA 1BA5A 2OI8A 4GFBA 2Y9ZA 2IEKA 4A3BJ 1BW6A 4X1EA 2PMZN 4UUSB 2R5ZB 2VUMJ 2FD5A 5FGLA 2Y30A 1JJ6C 2EH3A 1TC3C 3GTMJ 1JJ8C 4BBSJ 3DPJA 3HB9A 1JUSA 1VNDA 5M3MJ 1SFOJ 2UXPA 1GV2A 3MNLA 4QSHA 2DJNA 2NX4A 1JT0A 2QKOA 2QF7A 2HYTA 5E3LA 2CRGA 2G7LA 5EYRA 2ME6A 1UG2A 1HLVA 5EF6A 4M3FA 2JA8J 2MW8A 3BNIA 5EFYA 3K7AJ 3QQAA 1VFCA 1IDYA 4A93J 2DA2A 3QPLA 2ZCXA 3FRQA 1B8IB 3E7LA 5H9TA 1TWFJ 1X58A 5IOYA 2ZB9A 4AUXA 2M9HA 2B63J 1ZKGA 2LVSA 3HEFA 4BY7J 5K7ZA 1UI6A 3RH2A 1JTYA 2E19A 3HTIA 1I50J 3SDGA 1RR7A 1UHSA 2M8GX 5EGOA 2JJ7A 1TWHJ 1ZTRA 2XSDC 3JREA 5GP9A 3BTCA 4DZPA 3JRIA 3JRHA 3W6VA 3GBGA 1PUFA 3FKIJ 2VKEA 3CWRA 1ENHA 2Y9YA 3ZQHA 3HDDA 2DA5A 1FIPA 4GCLA 1Z77A 2OERA 5FKOA 3LOCA 2DMQA 4IHXA 4IHVA 1ETVA 1AU7A 3JRCA 4FCYA 1U78A 1FTTA 3VVYA 1I3QJ 2EBIA 1IDZA 3JRDA 5FKLA 1IV6A 3KKDA 5K58A 2X6OA 4IHWA 9ANTA 1ZK8A 1LFBA 3I4MJ 4DYQA 3Q0UA 3QBMA 4A3DJ 4BY1J 1Q1VA 3GTKJ 2DMPA 3O8HA 3IH2A 4C2MJ 1U8BA 2G0EA 2VPRA 3CRJA 5F0FA 5HAWA 2OPTA 1TWAJ 1MBGA 2R5YA 1B72A 3HOWJ 5C44J 3BHQA 4GCTA 3BR5A 1E3OC 2HOSA 5JLWA 5K7FA 1LFUP 2HXOA 3PPBA 2ID3A 3JRFA 3CCYA 1BW5A 3PO2J 3NNRA 2K9NA 2M0CA 3M3YJ 3RZOJ 3O60A 3IV5A 1D5YA 4XRSA 4DYCA 5EDNA 1RKTA 1X2NA 5EZGA 4GFLA 1AKHA 4Y7NJ 5FJ8J 2X48A 1W0TA 2XB5A 1YRNB 5FKMA 1IGNA 2G7SA 5FLMJ 2ZCNA 3S5RA 3TP3A 3AQTA 3ON2A 1ETKA 1WPKA 3DCFA 1H89C 4J19A 3EGQA 3VW2A 1OCPA 3Q3SA 1MBKA 4D5FA 5M5WJ 4DYRA 3BR3A 2ZOYA 2YUSA 2DMUA 3BJBA 2K9QA 2JWTA 3JSJA 5D1RA 2UXHA 2DMNA 4NN1A 1WGXA 3COLA 2RAEA 4C3IJ 1ZR4A 2NVXJ 2WUIA 2GENA 2MGQA 1PUFB 2RASA 5J1YA 2XDNA 1FEXA 3HOUJ 1VF9A 5DTDA 3LSPA 3HTAA 1YRNA 4JP0A 1AHDP 2E1OA 4RBOA 3LSRA 4MLOA 2R92J 1H88C 2FX0A 1IJWC 4QIWN 2W48A 5EEAA 5M5YJ 1U9OA 4C3HJ 1QVUA 1HOMA 4W1UA 2R5ZA 3B6CA 2CU7A 5E3OA 2UXUA 2CUEA 5IYDJ 2O8KA 2DA4A 5IPAA 4UDSA 4A3CJ 1X2MA 2DA3A 3S1RJ 3HOVJ 5EZHA 4DZJA 4A3JJ 5FLVA 3FK6A 1OCTC 4AC0A 1JUPA 1P7JA 4JX6A 2IU5A 3B6AA 3VVZA 3T6NA 2M2EA 4CGRA 2YVHA 2XPWA 2F07A 1IC8A 1FIAA 5GPCA 3ON4A 2PBXA 3HM5A 2JA5J 5C3EJ 2NP5A 3BR6A 5EG0B 2FJ1A 1ITYA 2FQ4A 3FISA 2XGDA 5HSZA 4KWAA 1MSFC 3G1LA 2QOPA 1JKRC 1GDTA 3NXCA 1RESA 3SFIA 2H8RA 3FK7A 4XRSG 2UXIA 4ME9A 3AQSA 4FISA 4A3GJ 5F08A 2IAIA 3DEWA 3NARA 1BL0A 5BNGA 2O7OA 4M3GA 1TWGJ 5E3MA 5J3LA 1AKHB 2R93J 3A01A 3WHBA 3PO3J 4ACIA 3G1MA 3E7QA 2QWTA 4XRMA 3GZIA 1MBHA 5C4JJ 3TW6A 3VIBA 2O7TA 1JGGA 1WH5A 3S16J 1Y1VJ 4JX5A 5JLXA 3GTOJ 3VW0A 3Q0WA 2ZOZA 5J1RA 3HTHA 4A3IJ 3BG3A 4A3FJ 3JRGA 4MXMA 2WAQN 2CQXA 1P7IA 3O8GA 5F04A 3VOXA 2QIBA 3VPRA 1ZQ3P 5HODA 3BR0A 2ECCA 5C4YA 1R9TJ 3BR1A 3NAUA 5CW8A 2YS9A 2DA7A 3VVXA 3TP0A 4GFKA 2JA7J 2XRLA 1GT0C 3GTGJ 5D18A 3CDLA 5F27A 3S14J 2QCOA 2HXIA 2RHAA 4JNNA 4AYBN 3BQYA 5IYCJ 2TCTA 1GV5A 5IP7J 4XICA 3ZQGA 1Y1WJ 2XGEA 3OOUA 2H1KA 1EF4A 2EZLA 3L1PA 3ZQFA 4NELA 4A3MJ 2R0QC 2R5YB 1B72B 4JL3A 2LR8A 4HNVA 2L9RA 1I6HJ 1OJLA 5DS9A 3MKLA 2YVEA 3GTJJ 1RKWA 1CQTA 3S2HJ 4UUTA 2EZKA 4L5EA 5M3FJ 3S1NJ 3IUVA 2Y31A 3F0CA 3HBLA 2VKVA 1MH3A 2DTZA 3BT9A 4MFEA 3SJMA 1RETA 3OIOA 4B4CA 3KKCA 2D6YA 1QRYA 3ZQCA 4A3LJ 2E2HJ 4A3EJ 4YZEA 4MK6A 1GUUA 3HIMA 4B1RA 3MN2A 2LKXA 5GPAA 2ZCMA 2DG8A 3ANGA 2CUFA 1JKQC 3HE0A 3LNQA 3LSJA 2R7ZJ 2LFBA 1MBEA 1S7EA 3KNWA 1XG1A 3HOZJ 2LY9A 1GVDA 2P81A 2TRTA 4RDUA 5EGOB 2DG7A 4XK4A 2X9DA 5CXGA 4C3JJ 2GM4A 3MVPA 2NVYJ 1QPIA 2LD5A 4A3KJ 1HDDC 2OF7A 4M6VA 3HTJA 1H8AC 4M3DA 1WCMJ 3M4OJ 1HCRA 3C2BA 4B3AA 4JYKA 5IP9J 1WI3A 2WV1A 1OFCX 4S0HB 3LWJA 4I76A 2G3BA 3BG9A 3RQIA 1A6IA 3HGGA 5J1UA 1APLC 3CMYA 3GTPJ 3BCGA 2AHQA 1RPWA 2UXOA 3EUPA 2NS8A 3LJLA 3RZDJ 3TW7A 5F0HA 3BTIA 3JRAA 2M34A 4XIDA 2NVTJ 1NK3P 2HQ5A 4AF5A 2JA6J 3NRGA 4M3EA 3S1QJ 3ZOBA 3BG5A 1Z0XA 4V2GA 2GLOA 3KZ9A 2NP3A 5F1JA 1IRZA 2HYJA 2XB0X 1ETQA 5D19A 2HOAA 2EZIA 4PXIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W53 A;  3GEU A;  3ZQL A;  2ECB A;  4MO7 A;  1UI5 A;  1NK2 P;  3WHC A;  1JT6 A;  1U9N A;  3HKZ N;  4Y52 J;  4EEF G;  4AC6 A;  1TWC J;  3BQZ A;  2XPU A;  3G56 A;  4QTR A;  1HF0 A;  2JK3 A;  4NDL A;  4G12 A;  5IOZ A;  4GCK A;  1G2H A;  3OSG A;  1JKO C;  3H3V K;  2NOG A;  3ZQI A;  3C07 A;  2E2J J;  2XGC A;  3GTL J;  2ELK A;  1B8I A;  3B81 A;  1FTZ A;  2CJJ A;  2LK2 A;  3BR2 A;  4L62 A;  3CQZ J;  2ME0 A;  1LE8 B;  5E3N A;  2JN6 A;  2K9S A;  5K7H A;  2WGB A;  1SGM A;  4D7M A;  3Q0V A;  3S2D J;  3VUQ A;  4CYC B;  3H0G J;  5F0C A;  2DA6 A;  3LSG A;  2D5V A;  3A03 A;  3I4N J;  2HKU A;  3BRU A;  1MBJ A;  1WH7 A;  2REK A;  2PZ9 A;  4JKZ A;  1XC5 A;  2N8G A;  5FHP A;  2I10 A;  3S17 J;  4BKX A;  3PAS A;  5IYB J;  2KT0 A;  2L7F P;  2MG4 A;  2HOT A;  1XS9 A;  1HDP A;  4IHY A;  3LHQ A;  3VW1 A;  4ICH A;  1QVT A;  3CJD A;  1JUM A;  2HDD A;  2NVQ J;  2EQR A;  5FKN A;  2CQQ A;  1MSE C;  3HGY A;  3QKX A;  2L7M P;  1K83 J;  2KDZ A;  5M5X J;  2QTQ A;  3G1O A;  2FBQ A;  4A69 C;  3UKG A;  2LP0 A;  4M3B A;  2EZH A;  1SAN A;  4DW6 A;  1ZGW A;  3HOY J;  2LTP A;  1UMQ A;  3A02 A;  1ETO A;  3F1B A;  2L0K A;  1F36 A;  1JTX A;  2GFN A;  1IG7 A;  3JR9 A;  5CXI A;  3IH3 A;  3V78 A;  2Y0S N;  4W97 A;  1ETY A;  3JRB A;  4D7N A;  2K40 A;  5IP6 A;  3D1N I;  5DAJ A;  3RKQ A;  3BTL A;  1ORK A;  3G7R A;  2V57 A;  1ETX A;  2DMT A;  4JX4 A;  3TED A;  2COB A;  4D5C A;  3GTQ J;  3BTJ A;  1ETW A;  2ID6 A;  2WB1 N;  5FKK A;  5FMP A;  2LLK A;  2VI6 A;  1POG A;  3A01 B;  2HI3 A;  4FTH A;  1MBF A;  1DU0 A;  3VOK A;  4BXX J;  3FIW A;  1JKP C;  1F43 A;  3VP5 A;  3K2A A;  3S1M J;  3S15 J;  4HKU A;  2Q24 A;  4FE4 A;  2L7Z A;  1ZR2 A;  2DN0 A;  2MSY A;  3OSF A;  2YU9 J;  4I6Z A;  3V6G A;  1DU6 A;  1O4X A;  2XPV A;  1A5J A;  5HBU A;  1T56 A;  1MNM C;  3HOX J;  3RD3 A;  2AO9 A;  2JMW A;  4V2F A;  3P9T A;  2GUH A;  4MIM A;  1MH4 A;  3QPS A;  1IUF A;  2Y2Z A;  2GBY A;  3NI7 A;  4MFD A;  3PM1 A;  1LE8 A;  3IH4 A;  4LOC A;  4CYC A;  3ANP A;  5EG0 A;  5AQC A;  4UUS A;  4BBR J;  1FJL A;  2DA1 A;  1T33 A;  2NS7 A;  4ABZ A;  1NTC A;  2G7G A;  3NPI A;  4FE7 A;  2E2I J;  2IBD A;  1W0U A;  1K61 A;  1VI0 A;  5C4X J;  4X6A J;  1BJZ A;  4IEJ A;  2O9L A;  1BA5 A;  2OI8 A;  4GFB A;  2Y9Z A;  2IEK A;  4A3B J;  1BW6 A;  4X1E A;  2PMZ N;  4UUS B;  2R5Z B;  2VUM J;  2FD5 A;  5FGL A;  2Y30 A;  1JJ6 C;  2EH3 A;  1TC3 C;  3GTM J;  1JJ8 C;  4BBS J;  3DPJ A;  3HB9 A;  1JUS A;  1VND A;  5M3M J;  1SFO J;  2UXP A;  1GV2 A;  3MNL A;  4QSH A;  2DJN A;  2NX4 A;  1JT0 A;  2QKO A;  2QF7 A;  2HYT A;  5E3L A;  2CRG A;  2G7L A;  5EYR A;  2ME6 A;  1UG2 A;  1HLV A;  5EF6 A;  4M3F A;  2JA8 J;  2MW8 A;  3BNI A;  5EFY A;  3K7A J;  3QQA A;  1VFC A;  1IDY A;  4A93 J;  2DA2 A;  3QPL A;  2ZCX A;  3FRQ A;  1B8I B;  3E7L A;  5H9T A;  1TWF J;  1X58 A;  5IOY A;  2ZB9 A;  4AUX A;  2M9H A;  2B63 J;  1ZKG A;  2LVS A;  3HEF A;  4BY7 J;  5K7Z A;  1UI6 A;  3RH2 A;  1JTY A;  2E19 A;  3HTI A;  1I50 J;  3SDG A;  1RR7 A;  1UHS A;  2M8G X;  5EGO A;  2JJ7 A;  1TWH J;  1ZTR A;  2XSD C;  3JRE A;  5GP9 A;  3BTC A;  4DZP A;  3JRI A;  3JRH A;  3W6V A;  3GBG A;  1PUF A;  3FKI J;  2VKE A;  3CWR A;  1ENH A;  2Y9Y A;  3ZQH A;  3HDD A;  2DA5 A;  1FIP A;  4GCL A;  1Z77 A;  2OER A;  5FKO A;  3LOC A;  2DMQ A;  4IHX A;  4IHV A;  1ETV A;  1AU7 A;  3JRC A;  4FCY A;  1U78 A;  1FTT A;  3VVY A;  1I3Q J;  2EBI A;  1IDZ A;  3JRD A;  5FKL A;  1IV6 A;  3KKD A;  5K58 A;  2X6O A;  4IHW A;  9ANT A;  1ZK8 A;  1LFB A;  3I4M J;  4DYQ A;  3Q0U A;  3QBM A;  4A3D J;  4BY1 J;  1Q1V A;  3GTK J;  2DMP A;  3O8H A;  3IH2 A;  4C2M J;  1U8B A;  2G0E A;  2VPR A;  3CRJ A;  5F0F A;  5HAW A;  2OPT A;  1TWA J;  1MBG A;  2R5Y A;  1B72 A;  3HOW J;  5C44 J;  3BHQ A;  4GCT A;  3BR5 A;  1E3O C;  2HOS A;  5JLW A;  5K7F A;  1LFU P;  2HXO A;  3PPB A;  2ID3 A;  3JRF A;  3CCY A;  1BW5 A;  3PO2 J;  3NNR A;  2K9N A;  2M0C A;  3M3Y J;  3RZO J;  3O60 A;  3IV5 A;  1D5Y A;  4XRS A;  4DYC A;  5EDN A;  1RKT A;  1X2N A;  5EZG A;  4GFL A;  1AKH A;  4Y7N J;  5FJ8 J;  2X48 A;  1W0T A;  2XB5 A;  1YRN B;  5FKM A;  1IGN A;  2G7S A;  5FLM J;  2ZCN A;  3S5R A;  3TP3 A;  3AQT A;  3ON2 A;  1ETK A;  1WPK A;  3DCF A;  1H89 C;  4J19 A;  3EGQ A;  3VW2 A;  1OCP A;  3Q3S A;  1MBK A;  4D5F A;  5M5W J;  4DYR A;  3BR3 A;  2ZOY A;  2YUS A;  2DMU A;  3BJB A;  2K9Q A;  2JWT A;  3JSJ A;  5D1R A;  2UXH A;  2DMN A;  4NN1 A;  1WGX A;  3COL A;  2RAE A;  4C3I J;  1ZR4 A;  2NVX J;  2WUI A;  2GEN A;  2MGQ A;  1PUF B;  2RAS A;  5J1Y A;  2XDN A;  1FEX A;  3HOU J;  1VF9 A;  5DTD A;  3LSP A;  3HTA A;  1YRN A;  4JP0 A;  1AHD P;  2E1O A;  4RBO A;  3LSR A;  4MLO A;  2R92 J;  1H88 C;  2FX0 A;  1IJW C;  4QIW N;  2W48 A;  5EEA A;  5M5Y J;  1U9O A;  4C3H J;  1QVU A;  1HOM A;  4W1U A;  2R5Z A;  3B6C A;  2CU7 A;  5E3O A;  2UXU A;  2CUE A;  5IYD J;  2O8K A;  2DA4 A;  5IPA A;  4UDS A;  4A3C J;  1X2M A;  2DA3 A;  3S1R J;  3HOV J;  5EZH A;  4DZJ A;  4A3J J;  5FLV A;  3FK6 A;  1OCT C;  4AC0 A;  1JUP A;  1P7J A;  4JX6 A;  2IU5 A;  3B6A A;  3VVZ A;  3T6N A;  2M2E A;  4CGR A;  2YVH A;  2XPW A;  2F07 A;  1IC8 A;  1FIA A;  5GPC A;  3ON4 A;  2PBX A;  3HM5 A;  2JA5 J;  5C3E J;  2NP5 A;  3BR6 A;  5EG0 B;  2FJ1 A;  1ITY A;  2FQ4 A;  3FIS A;  2XGD A;  5HSZ A;  4KWA A;  1MSF C;  3G1L A;  2QOP A;  1JKR C;  1GDT A;  3NXC A;  1RES A;  3SFI A;  2H8R A;  3FK7 A;  4XRS G;  2UXI A;  4ME9 A;  3AQS A;  4FIS A;  4A3G J;  5F08 A;  2IAI A;  3DEW A;  3NAR A;  1BL0 A;  5BNG A;  2O7O A;  4M3G A;  1TWG J;  5E3M A;  5J3L A;  1AKH B;  2R93 J;  3A01 A;  3WHB A;  3PO3 J;  4ACI A;  3G1M A;  3E7Q A;  2QWT A;  4XRM A;  3GZI A;  1MBH A;  5C4J J;  3TW6 A;  3VIB A;  2O7T A;  1JGG A;  1WH5 A;  3S16 J;  1Y1V J;  4JX5 A;  5JLX A;  3GTO J;  3VW0 A;  3Q0W A;  2ZOZ A;  5J1R A;  3HTH A;  4A3I J;  3BG3 A;  4A3F J;  3JRG A;  4MXM A;  2WAQ N;  2CQX A;  1P7I A;  3O8G A;  5F04 A;  3VOX A;  2QIB A;  3VPR A;  1ZQ3 P;  5HOD A;  3BR0 A;  2ECC A;  5C4Y A;  1R9T J;  3BR1 A;  3NAU A;  5CW8 A;  2YS9 A;  2DA7 A;  3VVX A;  3TP0 A;  4GFK A;  2JA7 J;  2XRL A;  1GT0 C;  3GTG J;  5D18 A;  3CDL A;  5F27 A;  3S14 J;  2QCO A;  2HXI A;  2RHA A;  4JNN A;  4AYB N;  3BQY A;  5IYC J;  2TCT A;  1GV5 A;  5IP7 J;  4XIC A;  3ZQG A;  1Y1W J;  2XGE A;  3OOU A;  2H1K A;  1EF4 A;  2EZL A;  3L1P A;  3ZQF A;  4NEL A;  4A3M J;  2R0Q C;  2R5Y B;  1B72 B;  4JL3 A;  2LR8 A;  4HNV A;  2L9R A;  1I6H J;  1OJL A;  5DS9 A;  3MKL A;  2YVE A;  3GTJ J;  1RKW A;  1CQT A;  3S2H J;  4UUT A;  2EZK A;  4L5E A;  5M3F J;  3S1N J;  3IUV A;  2Y31 A;  3F0C A;  3HBL A;  2VKV A;  1MH3 A;  2DTZ A;  3BT9 A;  4MFE A;  3SJM A;  1RET A;  3OIO A;  4B4C A;  3KKC A;  2D6Y A;  1QRY A;  3ZQC A;  4A3L J;  2E2H J;  4A3E J;  4YZE A;  4MK6 A;  1GUU A;  3HIM A;  4B1R A;  3MN2 A;  2LKX A;  5GPA A;  2ZCM A;  2DG8 A;  3ANG A;  2CUF A;  1JKQ C;  3HE0 A;  3LNQ A;  3LSJ A;  2R7Z J;  2LFB A;  1MBE A;  1S7E A;  3KNW A;  1XG1 A;  3HOZ J;  2LY9 A;  1GVD A;  2P81 A;  2TRT A;  4RDU A;  5EGO B;  2DG7 A;  4XK4 A;  2X9D A;  5CXG A;  4C3J J;  2GM4 A;  3MVP A;  2NVY J;  1QPI A;  2LD5 A;  4A3K J;  1HDD C;  2OF7 A;  4M6V A;  3HTJ A;  1H8A C;  4M3D A;  1WCM J;  3M4O J;  1HCR A;  3C2B A;  4B3A A;  4JYK A;  5IP9 J;  1WI3 A;  2WV1 A;  1OFC X;  4S0H B;  3LWJ A;  4I76 A;  2G3B A;  3BG9 A;  3RQI A;  1A6I A;  3HGG A;  5J1U A;  1APL C;  3CMY A;  3GTP J;  3BCG A;  2AHQ A;  1RPW A;  2UXO A;  3EUP A;  2NS8 A;  3LJL A;  3RZD J;  3TW7 A;  5F0H A;  3BTI A;  3JRA A;  2M34 A;  4XID A;  2NVT J;  1NK3 P;  2HQ5 A;  4AF5 A;  2JA6 J;  3NRG A;  4M3E A;  3S1Q J;  3ZOB A;  3BG5 A;  1Z0X A;  4V2G A;  2GLO A;  3KZ9 A;  2NP3 A;  5F1J A;  1IRZ A;  2HYJ A;  2XB0 X;  1ETQ A;  5D19 A;  2HOA A;  2EZI A;  4PXI A; 
#chains in the Genus database with same CATH topology
 2W53 A;  3OS0 A;  2QSF X;  1VQ5 I;  1BI1 A;  4MO7 A;  2CQ7 A;  2FBK A;  3K1N A;  1RNL A;  5ICF A;  3WHC A;  3REO A;  4PJJ A;  1STZ A;  2QSH X;  1FP2 A;  5E8G A;  1SAU A;  4A0X A;  2LBF A;  4NDL A;  5TJJ A;  4LK0 F;  4GCK A;  3OSG A;  2EIJ H;  3VB2 A;  2CW7 A;  3I53 A;  5H2F C;  4UNO A;  2NOG A;  3KP7 A;  2R7D A;  2XGC A;  2ELK A;  3GTL J;  1OR7 A;  2E1C A;  3OL4 A;  2K02 A;  4G8X A;  4MTE A;  2YX7 A;  1B4A A;  4L62 A;  3W2A A;  2HKO A;  3ABK H;  1WJF A;  2XC7 A;  3OWT A;  4BQA A;  4OU0 A;  3QYB A;  2WGB A;  2MH2 A;  2FXA A;  3ABL H;  4KJZ A;  1BN5 A;  4OIQ F;  1LPQ A;  3VUQ A;  3H1C A;  2DK8 A;  3BJ6 A;  1ZRD A;  5KHD A;  2HKU A;  2AS5 F;  2REK A;  4JKZ A;  1R5H A;  5FHP A;  4OAZ A;  3RYP A;  2BGC A;  2I10 A;  3JAM Z;  4R79 A;  4ZTF A;  1YQA A;  2Y0S A;  3DLL F;  4EGZ A;  1W7P A;  2Z9O A;  4E6K G;  4ICH A;  2IXS A;  1JUM A;  1E3P A;  5DCM A;  3S3O A;  2R7V A;  1FSE A;  2X1D A;  3R0J A;  5M5X J;  1KYZ A;  1XMA A;  4ZYH A;  1ZYR F;  2LP0 A;  1U5T B;  2EZH A;  1SAN A;  2E5N A;  4DW6 A;  2HEO A;  2DJI A;  2EB7 A;  4G6T B;  5D6F A;  3ZMT A;  1IG7 A;  3OYL A;  1S8N A;  1ZHF A;  1S5L C;  3MWM A;  1BC7 C;  2A61 A;  3DPT A;  4D7N A;  1KA8 A;  3ECO A;  2DBB A;  1J59 A;  3KP2 A;  1GVJ A;  2PFV A;  1MGT A;  1JHF A;  3E6B A;  5BMZ A;  4JX4 A;  2COB A;  3P7N A;  2DFF A;  1G6N A;  3KEQ A;  5ICE A;  1QZZ A;  2LLK A;  1POG A;  5CKT A;  2HI3 A;  3A01 B;  1DU0 A;  4BNC A;  3VOK A;  2IS1 A;  3FIW A;  2E5Z A;  2V4J C;  3GME A;  3PNT A;  1VQK I;  4UV9 A;  3HHG A;  3BPX A;  1QPM A;  3OSF A;  2NOJ B;  3K0L A;  5KAI C;  3V6G A;  2HYF A;  2ZBK A;  1O7L A;  3I0T A;  3K4N A;  3F9K A;  3QU3 A;  1R49 A;  5GAD J;  2HVR A;  1Y56 A;  1Z7L A;  3KPH A;  2ZXW H;  4UVC A;  4LLG F;  3J7Y J;  1FOX A;  1M1E B;  1YG2 A;  5E8I A;  1N75 A;  1X3Z B;  1XGN A;  4H0E A;  1N25 A;  3NI7 A;  1USS A;  2L01 A;  4CYC A;  4HA8 A;  1RZ4 A;  4F92 B;  3HRU A;  5HLT A;  1T33 A;  3GXO A;  4ABZ A;  1NTC A;  3NPI A;  2MD5 A;  4HRI A;  1F9N A;  5C4X J;  1BJZ A;  1SFX A;  3NWT A;  5JVT A;  2GQQ A;  3OYG A;  1BA5 A;  2LF8 A;  3EYI A;  2DO7 A;  2MLG A;  2JZY A;  4GFB A;  3FXO A;  1QBJ A;  1BI0 A;  1R58 A;  4M72 A;  1ON1 A;  1OYW A;  4FX0 A;  1R1T A;  4P9F A;  4HQE A;  2FD5 A;  2Q2E A;  5JI6 A;  2BXZ A;  3A0H C;  1JJ6 C;  3GTM J;  1JJ8 C;  5FO5 A;  1VND A;  2DOF A;  2KHM A;  3GZN B;  3CP2 A;  4AIK A;  4RAZ A;  4I02 A;  3CDI A;  5DDG A;  4LLN A;  1JT0 A;  2P7C B;  2V1N A;  2EFW A;  1V4R A;  3PIO F;  3ERM A;  2UUZ A;  1WI9 A;  3OYE A;  2G7L A;  1PP7 U;  4ZDO A;  2ME6 A;  2OQR A;  3HC7 A;  3H36 A;  2NNN A;  3C3W A;  2GAU A;  2LY2 A;  1VFC A;  2FOW A;  3IL2 A;  3FRQ A;  2EA2 A;  4XKC A;  4RA2 A;  4BQO A;  1AA7 A;  3I59 A;  2ZB9 A;  3GFI A;  2ZSH B;  4WIB A;  3TOA A;  1LEB A;  4HLX A;  3N97 A;  2F2E A;  4IRI A;  2LVS A;  4XOT A;  1Z3Y A;  4BY7 J;  3CCR I;  3HTI A;  2XAF A;  1I50 J;  4DBR A;  4JBA A;  1VQL I;  4EM2 A;  3ZN1 A;  1TWH J;  3VDX A;  1ZTR A;  3FM5 A;  5LD2 C;  2QBY B;  1LEA A;  4L0Z B;  2E34 A;  3BTC A;  2GOX B;  1LB2 A;  2A6E F;  2DLL A;  2DU9 A;  2QQA A;  3PUB A;  2D45 A;  3MAJ A;  3LA3 A;  4GRI A;  2Y9Y A;  1VQM I;  3CUQ B;  2DA5 A;  3HDD A;  4GCL A;  4OAY A;  4ZZD A;  2Y48 A;  4ESB A;  3BJA A;  5EEH A;  3SFZ A;  2CMP A;  3M7G A;  1AU7 A;  1NHA A;  4GXO A;  3CCM I;  1U78 A;  1I3Q J;  3JRD A;  2VQL A;  3OMY A;  1TQP A;  5FKL A;  1W36 D;  2JQ7 A;  5K58 A;  2X6O A;  1JE8 A;  3DKY A;  4AIJ A;  2YPR A;  4DVY P;  5GAG J;  3FHZ A;  1DDN A;  4L9V A;  2K85 A;  2VLA A;  1FY7 A;  4CCJ A;  4C2M J;  2PMU A;  3MCZ A;  2G0E A;  4IX7 A;  3D5S C;  3DU6 A;  1SEU A;  2WC2 A;  3CMM A;  1TWA J;  2VQH A;  1MBG A;  4XMY A;  1B72 A;  1W5S A;  4ZDL A;  3LST A;  1E3O C;  2HOS A;  1K6O A;  1ZRF A;  3PPB A;  4DBQ A;  1KZH A;  2J5P A;  3CCY A;  4R1H A;  5B5E C;  4IRH A;  3M3Y J;  5CPR B;  5LRS A;  4DYC A;  3DKW A;  4GFL A;  1AKH A;  4YG2 F;  4Y7N J;  5LHG A;  4HYE A;  1YRN B;  5D8L B;  5FKM A;  5FLM J;  1GLN A;  3E6D A;  4BUP A;  5FLX Z;  3H0D A;  3ON2 A;  3DCF A;  4BGD A;  4LLL A;  4E7L A;  3ONQ A;  4YFK F;  4CH7 A;  3F6O A;  5H20 A;  2DDA A;  3SQN A;  3ZPL A;  3V8L A;  3I9V 2;  2MH9 A;  1I6X A;  2V9P A;  2ZOY A;  1WJ5 A;  1FNN A;  4HZF A;  5EJC A;  1OYY A;  2DK5 A;  2BEO A;  1UZC A;  4LB6 B;  2IGN A;  2MA3 A;  4YEL A;  1WGX A;  2RAE A;  1P4W A;  1ZR4 A;  2WUI A;  2XDN A;  5J1Y A;  2QWW A;  4S04 A;  1K78 A;  3HOU J;  1VF9 A;  3FM3 A;  1Z7U A;  4MLO A;  4HST A;  2FX0 A;  1WJD A;  1H88 C;  3CO7 C;  4NQW A;  1OIS A;  2KZV A;  1HQC A;  1HOM A;  3SZG A;  2CU7 A;  2O8K A;  1T2K A;  1X2M A;  2M8E A;  1X4O A;  4PUS A;  4MQ9 F;  3IWF A;  3B6A A;  4FHT A;  1IC8 A;  3WOD F;  3RPU A;  4XLA A;  2DYR H;  2A5W A;  1X1B A;  3L2V A;  3CDH A;  2XGD A;  3W2W A;  1A36 A;  5HSZ A;  1MNE A;  3G1L A;  2HPM A;  2QOP A;  2DI3 A;  3OYK A;  1MMA A;  1R71 A;  3LQQ A;  1RES A;  4NHJ A;  4YII A;  3FXR A;  4XRS G;  4ME9 A;  2IW5 A;  4A3G J;  2ISY A;  1BL0 A;  1E2X A;  2O7O A;  3DBH B;  3JSP A;  5KAF C;  5J4V A;  2MD0 A;  3V7C A;  3PO3 J;  5DM7 F;  1TTY A;  3G1M A;  4KIB A;  4QWQ A;  2O8X A;  4E7I A;  1MBH A;  2ISZ A;  2PEX A;  3VIB A;  1JGG A;  4M9S A;  4Y13 A;  1DP7 P;  4NB5 A;  1R1U A;  1Y1V J;  2JUG A;  2WAD A;  5JLX A;  3VYR B;  1XTA A;  3HTH A;  4E7K A;  4DGW B;  3JRG A;  1TT0 A;  3HRT A;  2GA1 A;  2L4A A;  4RB0 A;  3VPR A;  1H0M A;  1ZQ3 P;  5HOD A;  5DUK A;  3DTE A;  2LY1 A;  3ZMS A;  3WTT C;  3BR1 A;  3WU2 C;  5CW8 A;  2YS9 A;  3ZMV A;  2DA7 A;  3ERE D;  4GYI A;  3CCE I;  2YSR A;  3E0J B;  2XDV A;  1MJB A;  2JA7 J;  3GTG J;  3DQV C;  3S14 J;  4LG0 B;  3DU5 A;  5IYC J;  4KNY A;  2TCT A;  3MEX A;  3ZQG A;  3KZY A;  3M1C A;  3I55 I;  3LFK A;  4J00 A;  4OD4 A;  2RGV A;  4RM2 A;  1D1A A;  4ESF A;  3CO6 C;  2FJI 1;  2OUM A;  2EZL A;  3ZQF A;  4BHP A;  3A0B C;  2ZFW A;  3NRV A;  3K1M A;  5DCF A;  2R5Y B;  4A3M J;  4HNV A;  2BE5 F;  1I6H J;  2ESN A;  2JSP A;  3LSK A;  3VTI A;  4IKF A;  3ELK A;  2YVE A;  3GTJ J;  3BCA A;  4DOZ A;  4ZYE A;  1X1C A;  3E97 A;  1HKT A;  2EZK A;  4L5E A;  4RLF A;  5H6Q A;  3S1N J;  5DUI A;  3IUV A;  1N77 A;  4F52 A;  3ZP5 A;  2FEZ A;  4U0W A;  1EA3 A;  2EK5 A;  3OYI A;  1RET A;  4BEH B;  4B4C A;  4NC6 A;  2QSG X;  2UXX A;  4A3L J;  1BJA A;  4YZE A;  3HIM A;  3CJR B;  4B1R A;  4II2 A;  1DPR A;  2R7U A;  1IZ1 A;  4Y33 A;  3ZMZ A;  1VZ0 A;  3ABT A;  1EKE A;  2IA1 A;  3JCU C;  4CCL A;  3OYF A;  3KNW A;  4IZZ A;  2CQK A;  1T6S A;  3U1D A;  2TRT A;  4D0P A;  3VFZ A;  5EGO B;  1I39 A;  2DG7 A;  2A6H F;  2ADU A;  2GM4 A;  3MVP A;  2LD5 A;  2V1D A;  3W2V A;  2LDU A;  4KIT B;  1ZLK A;  4ZDP A;  1WZ2 A;  5HLG A;  1IUY A;  2KJC A;  3KET A;  1PVE A;  3WGH A;  3M4O J;  1WI3 A;  4UB8 C;  1MJ9 A;  2WV1 A;  3DP7 A;  3H92 A;  1OFC X;  4S0H B;  3G73 A;  2L9N A;  2CV0 A;  3HOS A;  3LWJ A;  2QZ8 A;  2L5Q A;  3GTP J;  1MDM B;  1G3T A;  5LHI A;  1JXS A;  3S2W A;  3UR3 C;  5L3B A;  2Z5U A;  4BE2 A;  1T0F C;  3BTI A;  2NVT J;  2HQ5 A;  2PLY A;  4O5V A;  3A4C A;  5L3C A;  2UZK A;  1G3Y A;  1HST A;  2L2O A;  3LFU A;  3NRG A;  5F64 A;  1FBQ A;  3RPU D;  2MLK A;  1MD0 A;  2X51 A;  4RLQ A;  4A6E A;  5F1J A;  3TMO A;  2A3S A;  2XB0 X;  1ETQ A;  3FMR A;  5D19 A;  1ODD A;  4CCM A;  5DV5 A;  4DQ2 A;  1R4M B;  1HW5 A;  3GEU A;  4OIN F;  1UI5 A;  5DYM A;  5IT9 K;  4EEF G;  4AC6 A;  3BQZ A;  3LQR A;  3K70 D;  4QTR A;  1HF0 A;  2JK3 A;  3CD6 I;  3NWS A;  4G12 A;  2VJ4 A;  2IS4 A;  5HDG A;  4U9L A;  2P8T A;  2E2J J;  5K5O A;  4ESJ A;  2ZME A;  3TO7 A;  1FYK A;  2CJJ A;  2HKX A;  2LK2 A;  4CA0 A;  3BR2 A;  1ONV A;  2ME0 A;  3E5X A;  2XF6 A;  3IAS 2;  2ZXH A;  1V55 H;  2JN6 A;  5E3N A;  2V6E A;  4XKV A;  2M0M A;  4BAY A;  1ZAO A;  1SGM A;  2GZW A;  2JPB A;  3S2D J;  4CYC B;  2ZSI B;  3BC8 A;  3TO6 A;  3GWZ A;  1DUX C;  2DA6 A;  2HZT A;  3A03 A;  2F5E A;  4UV8 A;  3I4N J;  2JUC A;  4OIO F;  2N8G A;  4KFC A;  1SD4 A;  3BY6 A;  2DPD A;  4BKX A;  2DPU A;  2KT0 A;  1J7K A;  2L7F P;  5IY5 H;  1I1S A;  2MG4 A;  4P5O A;  5H6R A;  1XS9 A;  1HDP A;  1P2F A;  5DD4 A;  2UV1 A;  2VL8 A;  1FLI A;  2WY7 Q;  3SZP A;  3VYT B;  1QVT A;  1TQM A;  3DTI A;  1O3R A;  2L3D A;  3QRF F;  3GFL A;  2MBF A;  1K7A A;  2EQR A;  4BDZ A;  4RMN A;  2X4H A;  3QKX A;  4BQQ A;  2KDZ A;  2CV2 A;  3BDD A;  3K4M A;  3G1O A;  5B3S H;  4A69 C;  1WJB A;  5EEG A;  4PK4 A;  1ZGW A;  4UVA A;  4CXF A;  3F1B A;  3ZXS A;  3JR9 A;  3IH3 A;  1VQO I;  4PJL A;  4W97 A;  2B3W A;  2E35 A;  1TLH B;  4YFN F;  2CWE A;  1Z21 A;  2XKP A;  2R7S A;  1A04 A;  3BTL A;  1ORK A;  1PDN C;  2V57 A;  1TNT A;  2M87 A;  1VQ7 I;  2BY2 A;  4BHC A;  4D5C A;  3BTJ A;  3T8T A;  2ID6 A;  5FKK A;  1ZGA A;  1SFE A;  4YEJ A;  4FTH A;  4XR6 A;  4KA4 A;  1IXC A;  3VP5 A;  2KP6 A;  1IO2 A;  3BOQ A;  2Q8K A;  2DN0 A;  3L7W A;  3DBL B;  3BRO A;  1KU9 A;  4BJ5 C;  1HW2 A;  2YU9 J;  4I6Z A;  2H1L A;  3FMS A;  5LGN A;  3O6B B;  1DU6 A;  4WXD A;  4BXU A;  2AO9 A;  2D2W A;  2JMW A;  3U21 A;  3LA2 A;  4D9J A;  4MIM A;  3WTS C;  2GUH A;  5JHF A;  3QPS A;  1SMY F;  3V8K A;  3EQL F;  3KP4 A;  5A2Q K;  1LE8 A;  3CLO A;  3IH4 A;  1VQ4 I;  5EG0 A;  2JTV A;  1FJL A;  1K4S A;  1FSH A;  3K70 C;  4FE7 A;  3UNG C;  2IBD A;  5LLQ A;  1K61 A;  2E2I J;  1XMK A;  3L2R A;  4X6A J;  4IEJ A;  3AG4 H;  3L00 A;  2O9L A;  2DFE A;  1R4N B;  3FWE A;  1ZH5 A;  2OI8 A;  2HNH A;  3QP6 A;  2JPC A;  2GOM A;  4F3Q A;  4X1E A;  1ZN2 A;  4P55 A;  4UUS B;  4L18 B;  3OYD A;  1J09 A;  2VUM J;  1OYI A;  3DPJ A;  1BI3 A;  1JUS A;  1SFO J;  3I54 A;  1GV2 A;  4HDU A;  2X6W A;  2VON A;  3MNL A;  5HDK A;  4CGZ A;  2HVQ A;  3IC7 A;  3LSM A;  3ZQQ A;  2XF7 A;  2QF7 A;  3G6E I;  2VE8 A;  3JTG A;  4HDV A;  5E79 C;  3DKX A;  2QQ8 A;  4L9J A;  5KNL A;  1F4K A;  4JQF A;  2LYC A;  1UG2 A;  3MKY B;  1ULY A;  4ZYD A;  2P0W A;  1UFM A;  3RKX A;  4EVI A;  2M7B A;  2OTL I;  2VIX A;  1S72 I;  1IDY A;  4A93 J;  4RS8 A;  2ZCX A;  2XAS A;  4ASN A;  1B8I B;  5H9T A;  1TWF J;  1MND A;  1QZE A;  4G9Y A;  1YFH A;  1Z6T A;  1K6Y A;  2KIS A;  2OCC H;  5K7Z A;  1UI6 A;  3JAM K;  1JTY A;  2E19 A;  5AIP A;  4I98 B;  3OY9 A;  1FOW A;  4RGR A;  3B02 A;  3OYN A;  1KU2 A;  1WWX A;  4KIF A;  4XRF A;  4YIF A;  3J7Z I;  5GP9 A;  5DM6 F;  3DPL C;  3K4K A;  1Z67 A;  1P4A A;  1K78 B;  3W6V A;  2HTJ A;  1PUF A;  4RM3 A;  3DXJ F;  2VJJ A;  3HPH A;  2IA2 A;  5K5Q A;  1ENH A;  3KZI C;  3MZY A;  1FIP A;  2KJB A;  4XKW A;  4FCY A;  3VVY A;  2KIU A;  2EBI A;  1XMX A;  1UCR A;  1QHH D;  4LIU A;  1S29 A;  1S3J A;  1VQN I;  2Q1Z B;  1LFB A;  3SEZ A;  1YW8 A;  3I4M J;  4DYQ A;  5L3D A;  1T08 B;  3TL4 X;  1EJ9 A;  3QBM A;  4Y17 A;  2DYS H;  3I3L A;  4BY1 J;  2DMP A;  2ZXJ A;  2PI0 A;  3DBR B;  3E3V A;  1UG0 A;  1DP3 A;  3TKY A;  1DPU A;  1U8B A;  5J4Y A;  2FOK A;  4C30 A;  4GCV A;  3CRJ A;  3P9I A;  3P9C A;  4K2E A;  2R5Y A;  3M8J A;  1Y0N A;  2X6X A;  4GCT A;  3U2R A;  5JLW A;  5K7F A;  3HJE A;  5D5W B;  1LFU P;  2ID3 A;  4KYW A;  1HKS A;  2M4G A;  4EQQ A;  5BPD A;  1SAX A;  3W3C A;  2CH0 A;  5CQG A;  1UST A;  3O60 A;  4B48 A;  1BIB A;  3IV5 A;  2ZJQ F;  3F6V A;  2XAG A;  1RKT A;  2CSO A;  3K69 A;  5EZG A;  3GYH X;  4ZC3 A;  4BEH A;  3V7R A;  4I0B A;  1IGN A;  2STT A;  2Y0M A;  3FX3 A;  5HDN A;  1AOY A;  3AQT A;  1FMW A;  2ZO4 A;  4ANJ A;  3K4C A;  5BOX A;  1W1W E;  2ELJ A;  1H89 C;  4J19 A;  1FBU A;  3N05 A;  4IL6 C;  3VW2 A;  1O3T A;  4XNF A;  2XSJ C;  4BL0 B;  1GHC A;  2YUS A;  1XGO A;  2KKO A;  4EJO A;  4NUB A;  1J0R A;  2FF4 A;  2JWT A;  3JSJ A;  5D1R A;  4LG0 A;  2UXH A;  2DMN A;  2IJL A;  3HYI A;  3EPZ A;  4NC8 A;  3WTV C;  2KL4 A;  3BG7 A;  3CF2 A;  1XB4 A;  2MGQ A;  5LFA A;  5A2Q Z;  2RAS A;  4ENJ A;  3F8C A;  1YRN A;  1YJ9 I;  4JP0 A;  2E1O A;  3LSR A;  1IJW C;  4QIW N;  1KU7 A;  2W48 A;  4HNU A;  2VT3 A;  4IXA A;  4Y4R A;  4V19 K;  5EEA A;  1OR7 C;  3ESW B;  1U9O A;  1XCB A;  3WG9 A;  1QVU A;  5BQT A;  4W1U A;  2R5Z A;  3B6C A;  4TV7 A;  5JVG F;  1JI8 A;  5IYD J;  1SD7 A;  4M6X A;  5IPA A;  4Q4Z F;  1D1C A;  4UDS A;  1TT5 B;  5HNF A;  1TNS A;  3QOP A;  3S1R J;  4A3C J;  3HOV J;  2A6T A;  2BVM A;  3A2K A;  5B1A H;  3FK6 A;  3VOD A;  3IRR A;  1JUP A;  1P7J A;  2IU5 A;  3T6N A;  2ZY9 A;  2EJR A;  2LNB A;  2M2E A;  4CGR A;  2XPW A;  2F07 A;  3ON4 A;  1FIA A;  1WVR A;  2W1O A;  2NP5 A;  2QQB A;  1V5G A;  1YW9 A;  4M9Z A;  3SEQ A;  5EG0 B;  3J81 K;  3OYH A;  3KP5 A;  4ZJZ A;  4KN4 X;  4J01 A;  3PL8 A;  4L0Y B;  1D5V A;  5ILU A;  4H4K C;  1JKR C;  3NXC A;  2RKH A;  3SFI A;  4U0Y A;  2VC1 A;  2H8R A;  3FK7 A;  2RN7 A;  3M1E A;  2HYG D;  2LH9 A;  1A35 A;  2LKP A;  2LMD A;  5F08 A;  2IAI A;  2Z99 A;  4HOB A;  2PFB A;  1IRX A;  2KRH A;  1H9G A;  1X1D A;  4CYD A;  1SMT A;  5FLX K;  2BXY A;  3E7Q A;  2QWT A;  4XRM A;  3IWZ A;  1Z9C A;  2O7T A;  1D0X A;  2FRH A;  1WJC A;  2JVG A;  1YHQ I;  3CC2 I;  3HL2 A;  3GTO J;  3Q9S A;  5J1R A;  2V7F A;  3BG3 A;  1RRJ A;  1X4P A;  2OA4 A;  2WAQ N;  5E1Z B;  1P7I A;  1E3H A;  2K27 A;  4HV5 A;  4OMZ A;  5LEJ A;  3GCM A;  4BE0 A;  3BR0 A;  3CF5 F;  3D0S A;  5C4Y A;  2B7E A;  5DD8 A;  3RYR A;  1R9T J;  2R7W A;  2M5W A;  4BHB A;  1V5E A;  1RR8 C;  1CF7 B;  1UHW A;  2EIL H;  4XM3 A;  4PDK A;  2F4O B;  2JRM A;  4XLF A;  3FDY A;  1GT0 C;  5E17 F;  5F27 A;  3HZJ A;  3R61 A;  2EA4 A;  2NVU B;  4CCO A;  1GV5 A;  4QPO A;  2HS5 A;  4LG3 A;  5BPI A;  2AXL A;  2H1K A;  2F5C A;  3WU1 B;  2BV6 A;  2M45 A;  2STW A;  2I5U A;  2VB6 A;  3SYT A;  4IHS A;  3KFW X;  4HF2 A;  2KLO A;  3BCB A;  3H35 A;  4IQ4 A;  1J9I A;  2OQG A;  3SZT A;  2L9R A;  3IKV A;  3T0Y A;  3LSI A;  2ZFU A;  4RB1 A;  1YJN I;  5CJ9 A;  2CFO A;  4UUT A;  5M3F J;  3V4G A;  3F0C A;  3HBL A;  3RDI A;  4PGG A;  2X1C A;  4AWX B;  2VKV A;  1MH3 A;  2G9W A;  3BT9 A;  5JFR A;  2D1V A;  3K8P C;  4MK6 A;  2G7H A;  4B47 A;  3HPG A;  2K9L A;  5GPA A;  3WG7 H;  2DG8 A;  2QKM B;  2VPL A;  3COA C;  1J5Y A;  4C2M A;  3CCU I;  1JKQ C;  3HE0 A;  2BBY A;  2HVS A;  3CUQ C;  3LNQ A;  5J8F A;  2R7Z J;  2LFB A;  1MBE A;  1S7E A;  5JHU A;  2ZME C;  1XG1 A;  3PSF A;  3BP8 A;  4KDP A;  2VXZ A;  2QM3 A;  3MMY B;  2W7N A;  5CXG A;  3P9K A;  4C3J J;  2WV0 A;  2O0Y A;  5GAE J;  4RGX A;  4EM0 B;  4ETS A;  1YTY A;  3CC7 I;  1HDD C;  4QPQ A;  4M6V A;  3TDZ C;  1SVL A;  5HS9 A;  4FAS D;  3CC4 I;  1HCR A;  3C2B A;  4B3A A;  3L9F A;  5TGT A;  1BC8 C;  2DOD A;  4I76 A;  2G3B A;  1O3Q A;  1CGP A;  4IJA A;  1A6I A;  1Y8Q B;  5J1U A;  3MKZ A;  1APL C;  2UXO A;  3EDP A;  2NS8 A;  3TW7 A;  1E0E A;  4L9T A;  4KT6 A;  3JRA A;  4IQJ A;  1YYV A;  2M34 A;  3FBN B;  3ZRG A;  3R60 A;  2ZCW A;  1UHM A;  3J7A O;  1QZY A;  3VWB A;  2P5K A;  1FX7 A;  2YR2 A;  1RUN A;  4WX9 A;  3S1Q J;  1Z0X A;  4V2G A;  3BZK A;  3F8B A;  3KZ9 A;  2RQQ A;  4AM3 A;  1D8K A;  4RAG A;  2F4M B;  3I58 A;  4PXI A;  2UWM A;  4ENN A;  5LRR A;  3ZQL A;  2ECB A;  3K4J A;  2KFD A;  2AXT C;  1JT6 A;  1ZGJ A;  3HKZ N;  1TWC J;  3EUK L;  2XPU A;  1A31 A;  3G56 A;  2KIF A;  1WKM A;  4O6J A;  4G6D A;  3JSO A;  5IOZ A;  2CGP A;  2VOO A;  3IAM 2;  4XOR A;  2IGO A;  2GWR A;  4Y15 A;  3ZQI A;  3C07 A;  2WAF A;  3CME I;  3CCJ I;  2M30 A;  1B8I A;  4GDF A;  1FTZ A;  3B81 A;  4NC7 A;  3FKJ A;  2R3S A;  4BJ6 C;  2CQN A;  2FMY A;  3CQZ J;  2E60 A;  1LE8 B;  2BZT A;  4N9I A;  1R22 A;  1U0J A;  2A2F X;  2WAE A;  4XN3 A;  2KMU A;  4D7M A;  3QPT A;  1L0O C;  4XLP F;  4ZH4 F;  1IAW A;  2FQ3 A;  3H0G J;  1R5I D;  3BZ6 A;  2GXG A;  5D5V B;  3TOB A;  3LSG A;  2D5V A;  2EIM H;  2HQN A;  3AG2 H;  2BW3 A;  1KU3 A;  2A69 F;  4WXH A;  1XGS A;  2DFH A;  1X1A A;  1VQ9 I;  5D8K B;  2PJP A;  3PAS A;  5IYB J;  2ZKZ A;  3T5X A;  4D1Q A;  4AU7 A;  1B6A A;  4UXN A;  4MHG A;  3Q9V A;  3ZMU A;  3WTW C;  3LHQ A;  3VW1 A;  1MW7 A;  4F7Z A;  2HWV A;  2R7O A;  1NH3 A;  5KVR A;  2HDD A;  5FKN A;  4M6Y A;  1XCV A;  4C2U A;  4P9U A;  1MSE C;  3HGY A;  3RQ4 A;  1K83 J;  1IV8 A;  3BLY A;  1B1B A;  2KRC A;  3PNV A;  5FD6 A;  4CZC A;  2OTJ I;  2FBQ A;  3DPU A;  3CUO A;  4IO9 F;  4KIS A;  2KZG A;  4XSX F;  1FOK A;  3HOY J;  1Y6I A;  3A02 A;  1ETO A;  2L0K A;  2GFN A;  4HAM A;  4E7S A;  5CXI A;  1UJ8 A;  2ICW G;  3H3U A;  4IRV A;  3V78 A;  1ETY A;  2GIZ A;  4IOA F;  3IHU A;  2Z2S B;  2NS0 A;  3ZN0 A;  2K40 A;  3QOD A;  2PQ8 A;  2PX9 A;  3D1N I;  2MC4 A;  3EYY A;  4I99 C;  5TIS C;  5DAJ A;  5CVR A;  3G7R A;  1YO5 C;  1ETX A;  3GTQ J;  1PYV A;  5B66 C;  1ETW A;  1SC7 A;  2A07 F;  2WB1 N;  2JA2 A;  1YS6 A;  4HQM A;  2VI6 A;  4B43 A;  1H9T A;  1P9Q C;  5IT3 A;  3BPV A;  3I5U A;  4S05 A;  4B09 A;  2WY8 Q;  1JKP C;  2M7A A;  4LFU A;  1R5G A;  3S15 J;  4RAF A;  3F8M A;  3TQN A;  3WTU C;  3S1M J;  2Q24 A;  4HKU A;  1E17 A;  2XV4 S;  1XSX A;  4I01 A;  2MSY A;  2VBZ A;  1Z91 A;  3J81 Z;  1A5J A;  5HBU A;  2EPF A;  1SD6 A;  2IVM A;  1JGS A;  4LIT A;  2NRA C;  1MNM C;  3HOX J;  3RD3 A;  4YFX F;  3CCL I;  4V2F A;  3P9T A;  2CUZ A;  2V6C A;  2DDB A;  5HVQ C;  1FYL A;  2QGU A;  4JOM A;  2DXI A;  1R6R A;  2MAB A;  4HLY A;  3GUD A;  2GBY A;  5CVV A;  2J5O A;  4LOC A;  3QYF A;  3FHN A;  1CF7 A;  2V9V A;  5AQC A;  1ZLJ A;  2AQE A;  4UUS A;  3MZ8 A;  2DA1 A;  3KYD B;  4AD9 A;  3F21 A;  3PQK A;  3S93 A;  1ACI A;  2G7G A;  3CCQ I;  1W0U A;  3TDU C;  1VI0 A;  1ZAR A;  4UVB A;  2KDO A;  1RUO A;  1U3E M;  1XX5 A;  2Y9Z A;  2IEK A;  3B73 A;  2M4K A;  4PGH A;  4KMU X;  5HNH A;  2PMZ N;  1MMD A;  5FGL A;  2KIM A;  5F1R A;  1ZG1 A;  1TC3 C;  2DTR A;  1IRG A;  5BS6 A;  5HLI A;  1FP1 D;  2QYO A;  3HB9 A;  4BBS J;  2LRE A;  5M3M J;  3K9T A;  1Z05 A;  2HQA A;  3ZMD A;  2CG4 A;  3AL0 C;  2UXP A;  2B9S A;  2NX4 A;  2IRF G;  4N4N B;  4HNT A;  4A6D A;  3L09 A;  2HYT A;  1RIO H;  3KLN A;  2CRG A;  5E3L A;  4XL9 A;  4MQV A;  3J80 Z;  3GZ6 A;  4GGG A;  4B8X A;  5FRO A;  3TGN A;  1LDD A;  4XQF A;  5EF6 A;  1SVO A;  2MW8 A;  2XHK A;  5EFY A;  1ZRC A;  3K1P A;  3K7A J;  2VE9 A;  1WJA A;  2ZJ2 A;  3G4S I;  3E7L A;  1X58 A;  5IOY A;  3GVA A;  2QEN A;  1V3F A;  3OS2 A;  2VOP A;  3M8F A;  5LHH A;  2QBY A;  3OOP A;  1P4X A;  3HEF A;  3EUA A;  3RH2 A;  1IRF A;  4N4O B;  5GTH C;  1MZB A;  2KRF A;  3HHH A;  1W5T A;  3SDG A;  1UHS A;  1RR7 A;  3ECH A;  1XDS A;  2QVO A;  4G7H F;  5J47 A;  1R36 A;  2H6C A;  3JRE A;  4CZZ A;  3G71 I;  1D3Y A;  2R7Q A;  3H9Q A;  3JRH A;  1IXR C;  3I56 I;  2W25 A;  6PAX A;  3GBG A;  3FKI J;  2P6T A;  1HXD A;  1Z6R A;  4Q5S F;  1ON2 A;  2RC4 A;  4WF2 A;  4BQN A;  1O57 A;  1W36 C;  2DMQ A;  4ZYA A;  4IOC F;  2FSW A;  1XGM A;  3JRC A;  1FTT A;  4PCQ A;  2OZU A;  3WTZ A;  1K4T A;  4BS9 A;  1IV6 A;  1I27 A;  4IHW A;  9ANT A;  3L2Q A;  1ZK8 A;  4XKB A;  3I64 A;  4A3D J;  3OS1 A;  4U9N A;  2XAU A;  3GTK J;  2YX4 A;  3O8H A;  4LD5 A;  3OR2 C;  5AIQ A;  1TW3 A;  2E1N A;  3R6S A;  2PJR A;  2Z1D A;  3HRM A;  2DOE A;  3RKW A;  1SFU A;  2VPR A;  2EFQ A;  5HAW A;  5K5R A;  3FZV A;  3SHF A;  5C44 J;  1LJ9 A;  3BHQ A;  2K7L A;  3OYA A;  2F5D A;  1WSU A;  4WCG A;  3PO2 J;  2RDP A;  3NNR A;  2K9N A;  1SFK A;  2VJI A;  2HOE A;  2HTS A;  2E7X A;  3RZO J;  1D5Y A;  3WGG A;  5EDN A;  4AVZ A;  4FQG A;  3C7J A;  4M74 A;  1K79 A;  3GZ5 A;  4U7B A;  2LC2 A;  5FJ8 J;  2X48 A;  1W0T A;  2ZC2 A;  3FXM A;  5D5U B;  2O61 A;  2G7S A;  5HS8 A;  2H8W A;  3S5R A;  2VXD A;  1O7F A;  3IRQ A;  3S32 A;  4RGU A;  3MD2 A;  3CJT B;  2DT5 A;  3HKZ A;  5ED4 A;  1XD7 A;  4LK1 F;  4OWR B;  3OR1 C;  1OCP A;  4LIV A;  2DCE A;  1I3A A;  3AFH A;  3CUQ A;  1ERD A;  1MBK A;  3FXJ A;  1P6R A;  1BR1 A;  2GXB A;  3RSN A;  2K9Q A;  1YX3 A;  4WXC A;  2I8D A;  1FBS A;  3K6G A;  3V42 A;  4NN1 A;  2EWN A;  2XAJ A;  3ISP A;  1HKQ A;  4C3I J;  2NVX J;  1PUF B;  3RTR A;  1UEL B;  2CS3 A;  3QWL A;  1EH8 A;  3H5N A;  5DTD A;  3LSP A;  4GYG A;  4EJT A;  3C2H A;  1IN6 A;  4UY8 I;  2R92 J;  1WJE A;  4IHT A;  1Y39 A;  1BR4 A;  2XVC A;  1OQY A;  2A5Y B;  5M5Y J;  3A1Y A;  2ZNZ A;  3LMM A;  2CUE A;  3QP5 A;  3WE2 A;  5D6E A;  3DEE A;  2DA3 A;  3GFM A;  4A3J J;  4G94 A;  4AC0 A;  3NQO A;  4EJU A;  2WTE A;  4JX6 A;  2QQ9 A;  3VVZ A;  2Y75 A;  2R7T A;  4A2U A;  4N0B A;  4U0V A;  2OAZ A;  5GPC A;  2P4W A;  5C3E J;  2JA5 J;  2VBY A;  5GAH J;  3BR6 A;  1U8R A;  3F3X A;  2FJ1 A;  3TO9 A;  1HC8 A;  3HG9 A;  1BIA A;  2K3F A;  3DTK A;  2FQ4 A;  3KYC B;  1DGW Y;  1MSF C;  4HW0 A;  5AON A;  1IW7 F;  1GDT A;  2A05 A;  3AQS A;  4FIS A;  2FUG 2;  2R7R A;  3DEW A;  3I59 B;  2XF5 A;  3NAR A;  4HG2 A;  4I7H A;  5BNG A;  4M3G A;  3VSL A;  1TWG J;  3DEU A;  1XSD A;  5E3M A;  2H27 A;  5J3L A;  2HQR A;  3WHB A;  5CVU A;  4ACI A;  1HBX G;  1BOA A;  3TBI A;  5C4J J;  3TW6 A;  3KEY A;  1WH5 A;  2O6G E;  3S16 J;  4JX5 A;  5KK1 A;  3VW0 A;  3Q0W A;  3HOT A;  2HFH A;  3WTY C;  1BOB A;  4A3F J;  3H9G A;  1YJW I;  3C2G A;  4I0A A;  4JK1 X;  2B0L A;  1Q1H A;  4FET A;  2VBX A;  3O8G A;  2QIB A;  5B1B H;  2K4J A;  4XLE A;  2ECC A;  1J2X A;  2XIG A;  3KP3 A;  4N9H A;  3NAU A;  2GIV A;  2HDW A;  2LRD A;  3EUH C;  2XGX A;  3PFI A;  1UAA A;  3VVX A;  4HBL A;  2VOD A;  2LKS A;  2DW4 A;  2IPQ X;  2LF7 A;  1VQ6 I;  2HXI A;  1AWC A;  3GLL A;  3BQY A;  3HUG B;  3JW4 A;  5IP7 J;  4XIC A;  1Y0U A;  4A5N A;  2BHY A;  3CES A;  4IVN A;  4OMY A;  1TQI A;  1BBY A;  2DT7 B;  1X3W B;  4MGR A;  5CVI A;  2V1X A;  4CUG A;  2OCE A;  2R0Q C;  1LFP A;  2LR8 A;  2V26 A;  4HX8 A;  1MMN A;  2K9M A;  3W6J B;  5ICC A;  5DS9 A;  1NG6 A;  1S9H A;  3MKL A;  5LGU A;  4BDY A;  1RKW A;  1FWZ A;  3S2H J;  3BZC A;  1I5Z A;  1Y8R B;  2KQR A;  2Y31 A;  4EJV A;  3LSH A;  4ENK A;  4MNU A;  3MFK A;  3AKZ A;  5E1W A;  2DTZ A;  3GF2 A;  3SJM A;  3OIO A;  3AL0 B;  1WHU A;  1QRY A;  3BG6 A;  2WBM A;  2E2H J;  4OOI A;  4L9N A;  1T98 A;  2MFZ A;  3J80 K;  4BYY A;  1D0Y A;  1KGS A;  2ZCM A;  2HPI A;  3AAF A;  3ANG A;  2CUF A;  1SD5 A;  2Z33 A;  2WB1 A;  2L7K A;  1OCC H;  3LAJ A;  1YIO A;  5JR3 A;  1LQ1 A;  3HOZ J;  2LY9 A;  1GVD A;  2P81 A;  2VN2 A;  2B1E A;  4LJZ F;  3LL7 A;  4L5I A;  4XSZ F;  1VQP I;  2NVY J;  4FT8 A;  2OF7 A;  3L2W A;  5F6F A;  4CHU A;  2E36 A;  1LVK A;  2XKO A;  4JYK A;  3PSI A;  3OYB A;  2PG4 A;  2QEX I;  1MIJ A;  1EH7 A;  2ETH A;  3BG9 A;  3RQI A;  3HGG A;  3CMY A;  2AHQ A;  3EUP A;  3H9J A;  3KP6 A;  2EV0 A;  1MKM A;  3QPH A;  5F0H A;  3CJN A;  2UXN A;  4E7Z A;  2CV1 A;  5D4R A;  1BI2 A;  4XID A;  4F55 A;  5ICG A;  2FML A;  1QNT A;  4AF5 A;  4GO1 A;  5FB2 A;  4PSX A;  4YRV A;  2JA6 J;  2X6Y A;  3BG5 A;  2F5F A;  2FA5 A;  4NNJ A;  3I4P A;  2NP3 A;  4OIR F;  4CDG A;  2HYJ A;  3WU0 A;  5GTI C;  2HOA A;  2EZI A;  3AG3 H;  1MMS A;  2KIQ A;  5LEK A;  3BJO A;  3ML6 A;  2JT1 A;  1NK2 P;  4KUM A;  2LBF B;  1U9N A;  4Y52 J;  1FYM A;  2L9S A;  2OBP A;  5E18 F;  4B3X A;  1EH6 A;  1U5T A;  2GXA A;  4C2T A;  1G2H A;  3KLO A;  2BYV E;  3E5Q A;  3CTA A;  1JKO C;  3H3V K;  3K4B A;  4A5M A;  4DIQ A;  1QU3 A;  2YU3 A;  3CCV I;  4E7H A;  1Z1D A;  3LA7 A;  2QLZ A;  3U9G A;  4XON A;  4Q47 A;  2L54 A;  2MYS A;  2RVC A;  4Y3O A;  4I2O A;  2K9S A;  2W85 A;  3VYS B;  5K7H A;  3CZ6 A;  1LDJ A;  4U88 A;  1MDM A;  3Q0V A;  4C9Y A;  1FC3 A;  5F0C A;  1L3L A;  3WTX C;  1OKR A;  3BRU A;  1R23 A;  2EV6 A;  1MBJ A;  1WH7 A;  3M07 A;  4CIC A;  2PZ9 A;  3P5J A;  1XC5 A;  4AYB A;  5L3E A;  2CFX A;  3S17 J;  4UHT A;  1P92 A;  3LWF A;  1BM9 A;  2HOT A;  2E7W A;  2XRO A;  4IHY A;  4CCK A;  2P7V B;  4BAC A;  2ESH A;  4PJN A;  4BXF A;  3CMA I;  1FPQ A;  3CJD A;  3Q5F A;  5LBQ A;  2NVQ J;  2FBH A;  3DLA A;  2CQQ A;  1BR2 A;  1I1G A;  2L7M P;  3K2Z A;  1S7A A;  3L2U A;  1TL8 A;  2K86 A;  2QTQ A;  1ZG5 A;  2W57 A;  4WWC A;  1IN8 A;  4F93 B;  3UKG A;  4O3M A;  3K4L A;  3PNY A;  4M3B A;  3OIP A;  4HX4 A;  3KE2 A;  4EMS A;  2LTP A;  1OCZ H;  2RRE A;  1UMQ A;  1HSJ A;  1F36 A;  1JTX A;  3G2B A;  1NG7 A;  2Y0S N;  3JRB A;  3ASN H;  3K10 A;  2HGC A;  1R1V A;  4LMY A;  2IS6 A;  5IP6 A;  1B9M A;  3S8P A;  2EV5 A;  3RKQ A;  5FFX A;  2EIK H;  4PFO A;  1YW7 A;  1W5C C;  2DMT A;  3HSF A;  3TED A;  4YIR X;  1TBX A;  1EV7 A;  2RV8 A;  4IF4 A;  4OD5 A;  5FMP A;  1R7J A;  1XN7 A;  2W00 A;  1G59 A;  1MBF A;  4BXX J;  1F43 A;  3K2A A;  3GO5 A;  4EAT A;  1DQU A;  3VSK A;  1LNW A;  4RGS A;  4FE4 A;  1GXP A;  2L7Z A;  1ZR2 A;  2DFI A;  2H94 A;  1S7O A;  4QLC U;  2CUJ A;  1O4X A;  2XPV A;  1T56 A;  5L3F A;  2H09 A;  4Z6Y A;  3MZH A;  2GA2 A;  1JHH A;  1MH4 A;  2W82 A;  1IUF A;  2Y2Z A;  3R0A A;  4XLC A;  4BH9 A;  1XSV A;  2R7X A;  4MFD A;  3PM1 A;  3ANP A;  1XPX A;  2X1E A;  1V54 H;  4BBR J;  5HOO A;  2PN6 A;  2NS7 A;  1FZP B;  2BY0 A;  2VQC A;  3CP8 A;  4ON0 A;  3DFG A;  3H5A A;  3PQJ A;  2ACJ A;  2IA0 A;  2FU4 A;  1IN5 A;  1VTN C;  3SDB A;  1KQ9 A;  4RB3 C;  4A3B J;  1BW6 A;  3OYC A;  2BVL A;  3E5U A;  3JTH A;  2EIN H;  2R5Z B;  2JSC A;  2M1B A;  2Y30 A;  5CVJ A;  2EH3 A;  2E71 A;  3GFJ A;  2VBW A;  2PMH A;  1OCO H;  3QAH A;  4QSH A;  3HSE A;  2DJN A;  4XLN F;  3SWH A;  1KQ0 A;  4KIC A;  4KN7 X;  2QKO A;  3EET A;  4ZYG A;  3RI4 A;  3C18 A;  1X19 A;  4PJM A;  3AG1 H;  3H5R A;  2HU9 A;  5EYR A;  1D8J A;  1LKX A;  2LG4 A;  3ZR8 X;  3CCS I;  2XAH A;  3RKY A;  1HLV A;  1SVM A;  2ZNY A;  3X2Q H;  4M3F A;  3MKW B;  4A12 A;  2JA8 J;  3BNI A;  3CJQ B;  3QQA A;  2L9V A;  2DA2 A;  2RNJ A;  3FF5 A;  3QPL A;  4AVP A;  4CCN A;  2NNY A;  2EFN A;  1QHG A;  2VT2 A;  1PUE E;  4AUX A;  2M9H A;  1XDU A;  3ZQ7 A;  1DGR M;  5KCM A;  2B63 J;  1ZKG A;  3EUH A;  2VQG A;  3LAP A;  2DQL A;  2LSO A;  3NS4 A;  3T8R A;  2M8G X;  1QGP A;  1QQI A;  2CO5 A;  5EGO A;  2JJ7 A;  3F72 A;  3KZZ A;  3IKT A;  2HR3 A;  5HS7 A;  1VQ8 I;  2M3A A;  2XSD C;  3W6K B;  1B9N A;  3BWG A;  4LB5 A;  2CW0 F;  4MEY F;  4DZP A;  1WQ2 A;  3JRI A;  3QOE A;  2QKL B;  1F1Z A;  2VKE A;  2V1U A;  2OZ6 A;  5FD5 A;  4PJ0 C;  2HDC A;  3CWR A;  3D5R C;  3ZQH A;  2VC0 A;  3ZGK A;  5DCM B;  1Z77 A;  2OER A;  4XLH A;  4FX4 A;  1OLT A;  5FKO A;  3LOC A;  1MMG A;  4NQW B;  3N4M A;  4IHV A;  4IHX A;  3WE3 A;  3VEP A;  1ETV A;  2Y69 H;  3KCC A;  2X85 A;  3E1S A;  2RNG A;  2D1H A;  2IT0 A;  1IDZ A;  2PJR B;  3HSR A;  3KKD A;  3ULQ B;  1X3U A;  3DV8 A;  3ABM H;  2WAQ A;  1A6Q A;  3Q0U A;  5E1X A;  1G3W A;  2BW3 B;  3DF8 A;  1X1P A;  1Q1V A;  2LOO A;  2HZD A;  4EGY A;  2NXN B;  1KON A;  2NYX A;  3IH2 A;  2W4S A;  2VKD A;  2QA4 I;  3KX2 A;  1T38 A;  2L02 A;  2YVX A;  4BU2 A;  2F48 A;  2OV7 A;  3KYL A;  4PSW A;  5F0F A;  2OPT A;  3WGI A;  2IGM A;  2ELH A;  1T95 A;  3HOW J;  3NEU A;  3FXU A;  1OCR H;  3BR5 A;  3FXL A;  5J40 A;  1T39 A;  2HXO A;  3JRF A;  3V7S A;  1PP8 F;  1BW5 A;  3QYE A;  3RPQ A;  2DQR A;  2M0C A;  3FXK A;  5FRN A;  4G6Q A;  4E70 A;  2NAZ A;  1REP C;  4XRS A;  2W24 A;  3PUF A;  3ROU A;  4HEA 2;  4ZTJ A;  4EJW A;  1YIT I;  1X2N A;  3OIQ A;  5CQE A;  2QUF A;  3F8F A;  4L5J A;  1S6L A;  2MC3 A;  5LGT A;  2Z3Y A;  2XB5 A;  4A0Y A;  1G3S A;  2F6C A;  2ZCN A;  1KYW A;  4E7J A;  3TP3 A;  1ETK A;  1WPK A;  3EGQ A;  3O2P E;  1HA8 A;  1YE9 A;  2FE3 A;  3Q3S A;  2WWY A;  2COM A;  4LGW A;  4D5F A;  3RIR A;  1HW1 A;  3OYM A;  5M5W J;  3FXQ A;  1RI7 A;  4DYR A;  3D5L A;  3BR3 A;  2DMU A;  1MJA A;  1QA6 A;  3KIO A;  2DAO A;  3BJB A;  1G8X A;  2ZJP F;  3M9A A;  5D4S A;  2DOA A;  3E6C C;  4KMF A;  4HSR A;  2EFO A;  3COL A;  5HLH A;  2OD5 A;  1D1B A;  3R4K A;  4HF0 A;  4II3 A;  2GEN A;  4DJA A;  5FGM A;  3HIF A;  5D5X B;  1FEX A;  3OYJ A;  3HUG A;  3HTA A;  2F5V A;  1AHD P;  3HXL A;  2CW8 A;  4KT5 C;  4RBO A;  5IT9 Z;  3E6M A;  5ILV A;  1C0W A;  1IN7 A;  4HX7 A;  4XN0 A;  2BY3 A;  1W4M A;  4C3H J;  3L2C A;  2UXU A;  5E3O A;  4U7D A;  3F23 A;  1ZRE A;  2DA4 A;  3VOE A;  1FT9 A;  4U87 A;  2ZME B;  3U1K A;  4A0Z A;  3ASO H;  1Z3X A;  1YS7 A;  3GEZ A;  4ZZL A;  1F5T A;  2TDX A;  5EZH A;  4DZJ A;  4XOP A;  3PJR A;  5FLV A;  4G7Z F;  1KQ8 A;  1FMV A;  3T1B A;  1O3S A;  1OCT C;  3J7A Y;  4BJT A;  4RB2 C;  2YVH A;  4B44 A;  4IRG A;  3S3M A;  2BY1 A;  3F22 A;  3HM5 A;  1W7P B;  2X0L A;  2PBX A;  1GXQ A;  3M8E A;  4X0G A;  1YOV B;  1ITY A;  1IN4 A;  1WFX A;  3FIS A;  4HV6 A;  2E1M C;  2XAQ A;  4KWA A;  3GX4 X;  4PZJ A;  3DWL E;  3S3N A;  2UXI A;  5L3G A;  4HF1 A;  3V8J A;  2O5R A;  4M9X A;  1LDK B;  1U2W A;  3MQ0 A;  1D0Z A;  1RC9 A;  1AKH B;  2WA0 A;  1V5F A;  3A01 A;  2R93 J;  1TP4 A;  3RCO A;  5CLS A;  3GZI A;  2V9K A;  4Q48 A;  2BHZ A;  3IP4 B;  2ZXI A;  3CLQ A;  4EV0 A;  3I71 A;  2ZOZ A;  3H3Z A;  3HTS B;  4A3I J;  4ENM A;  4MXM A;  4P96 A;  2CQX A;  3FBI B;  2OC6 A;  2FNP A;  3KEO A;  5F04 A;  3VOX A;  1LVA A;  2IP2 A;  1LUJ B;  2R4G A;  2FNA A;  1FOY A;  3G3Z A;  3ZCO A;  4G7O F;  4AIH A;  1YIJ I;  2F4I A;  2P5L C;  5E20 A;  2CYY A;  2VJ5 A;  1YX5 A;  2PBI A;  3TP0 A;  4GFK A;  4BE1 A;  2XRL A;  2Q0O A;  5D18 A;  4EM1 A;  3CDL A;  2QCO A;  2RHA A;  4JNN A;  4AYB N;  2O03 A;  2A68 F;  4XBF A;  1Y1W J;  1W7P D;  1ZEL A;  2KPM A;  2G7U A;  4RAY A;  2XGE A;  3OOU A;  3ABU A;  1YLF A;  5ERI A;  1OMI A;  2ZJR F;  3OL3 A;  4MEX F;  2Z16 A;  1ZG3 A;  4UUV A;  1EF4 A;  3L1P A;  4F91 B;  2RQP A;  4NEL A;  2O3F A;  1B72 B;  4JL3 A;  5DEQ A;  1OJL A;  2L4M A;  5FFZ A;  2JRT A;  1CQT A;  3OV8 A;  3RJP A;  4ITV A;  2H6B A;  4I09 A;  4M71 A;  1R00 A;  3VYU B;  3GW2 A;  5CYV A;  4MFE A;  3KKC A;  1PJR A;  1IXS B;  3ZQC A;  2D6Y A;  4A3E J;  2VKH A;  3F8N A;  1GUU A;  3IUO A;  2AQF A;  3MN2 A;  2LKX A;  1T8I A;  4KIG A;  1TZL A;  4E4H A;  1U5T C;  2EFP A;  4NBQ A;  1U6G A;  1WRJ A;  3LSJ A;  1G4D A;  2IGK A;  2PMZ A;  1J75 A;  3HTU A;  2XUB A;  2OU2 A;  4WK8 F;  2K3P A;  1OPC A;  2IS2 A;  4UB6 C;  5K1Y A;  4RDU A;  1B59 A;  4XK4 A;  2X9D A;  4DNC A;  3FMQ A;  4M73 A;  1N78 A;  1QPI A;  2R7F A;  3GLX A;  3SXY A;  4A3K J;  5FRM A;  1IF1 A;  3HTJ A;  2P6S A;  1TW2 A;  4HPQ A;  1H8A C;  4M3D A;  1WCM J;  2BOL A;  2E1M B;  2W84 A;  3O3K A;  2OJE D;  5IP9 J;  2V79 A;  2JVH A;  2P5V A;  4R8H A;  5J6X A;  5J8C A;  3HRS A;  4AID A;  4CSW A;  5ILS A;  2XRN A;  4OIP F;  3BCG A;  3QU6 A;  1RPW A;  1UB9 A;  3LJL A;  3RZD J;  4Z2Y A;  2VAS A;  4MTD A;  1NK3 P;  2Q2E B;  2FBI A;  1T0F A;  2C6Y A;  2DT6 A;  2K4B A;  4M3E A;  1QO0 D;  4IPA A;  3ZOB A;  4CO8 A;  3PIP F;  2GLO A;  3C1D A;  4P1W A;  2K5C A;  1IRZ A;  5TRD A;  3PFY A;  1YI2 I;  4PFP A; 
#chains in the Genus database with same CATH homology
 2W53 A;  3GEU A;  3ZQL A;  2ECB A;  4MO7 A;  1UI5 A;  1NK2 P;  3WHC A;  1JT6 A;  1U9N A;  3HKZ N;  4Y52 J;  4EEF G;  4AC6 A;  1TWC J;  3BQZ A;  2XPU A;  3G56 A;  4QTR A;  1HF0 A;  2JK3 A;  4NDL A;  4G12 A;  5IOZ A;  4GCK A;  1G2H A;  3OSG A;  1JKO C;  3H3V K;  2NOG A;  3ZQI A;  3C07 A;  2E2J J;  2XGC A;  3GTL J;  2ELK A;  1B8I A;  3B81 A;  1FTZ A;  2CJJ A;  2LK2 A;  3BR2 A;  4L62 A;  3CQZ J;  2ME0 A;  1LE8 B;  5E3N A;  2JN6 A;  2K9S A;  5K7H A;  2WGB A;  1SGM A;  4D7M A;  3Q0V A;  3S2D J;  3VUQ A;  4CYC B;  3H0G J;  5F0C A;  2DA6 A;  3LSG A;  2D5V A;  3A03 A;  3I4N J;  2HKU A;  3BRU A;  1MBJ A;  1WH7 A;  2REK A;  2PZ9 A;  4JKZ A;  1XC5 A;  2N8G A;  5FHP A;  2I10 A;  3S17 J;  4BKX A;  3PAS A;  5IYB J;  2KT0 A;  2L7F P;  2MG4 A;  2HOT A;  1XS9 A;  1HDP A;  4IHY A;  3LHQ A;  3VW1 A;  4ICH A;  1QVT A;  3CJD A;  1JUM A;  2HDD A;  2NVQ J;  2EQR A;  5FKN A;  2CQQ A;  1MSE C;  3HGY A;  3QKX A;  2L7M P;  1K83 J;  2KDZ A;  5M5X J;  2QTQ A;  3G1O A;  2FBQ A;  4A69 C;  3UKG A;  2LP0 A;  4M3B A;  2EZH A;  1SAN A;  4DW6 A;  1ZGW A;  3HOY J;  2LTP A;  1UMQ A;  3A02 A;  1ETO A;  3F1B A;  2L0K A;  1F36 A;  1JTX A;  2GFN A;  1IG7 A;  3JR9 A;  5CXI A;  3IH3 A;  3V78 A;  2Y0S N;  4W97 A;  1ETY A;  3JRB A;  4D7N A;  2K40 A;  5IP6 A;  3D1N I;  5DAJ A;  3RKQ A;  3BTL A;  1ORK A;  3G7R A;  2V57 A;  1ETX A;  2DMT A;  4JX4 A;  3TED A;  2COB A;  4D5C A;  3GTQ J;  3BTJ A;  1ETW A;  2ID6 A;  2WB1 N;  5FKK A;  5FMP A;  2LLK A;  2VI6 A;  1POG A;  3A01 B;  2HI3 A;  4FTH A;  1MBF A;  1DU0 A;  3VOK A;  4BXX J;  3FIW A;  1JKP C;  1F43 A;  3VP5 A;  3K2A A;  3S1M J;  3S15 J;  4HKU A;  2Q24 A;  4FE4 A;  2L7Z A;  1ZR2 A;  2DN0 A;  2MSY A;  3OSF A;  2YU9 J;  4I6Z A;  3V6G A;  1DU6 A;  1O4X A;  2XPV A;  1A5J A;  5HBU A;  1T56 A;  1MNM C;  3HOX J;  3RD3 A;  2AO9 A;  2JMW A;  4V2F A;  3P9T A;  2GUH A;  4MIM A;  1MH4 A;  3QPS A;  1IUF A;  2Y2Z A;  2GBY A;  3NI7 A;  4MFD A;  3PM1 A;  1LE8 A;  3IH4 A;  4LOC A;  4CYC A;  3ANP A;  5EG0 A;  5AQC A;  4UUS A;  4BBR J;  1FJL A;  2DA1 A;  1T33 A;  2NS7 A;  4ABZ A;  1NTC A;  2G7G A;  3NPI A;  4FE7 A;  2E2I J;  2IBD A;  1W0U A;  1K61 A;  1VI0 A;  5C4X J;  4X6A J;  1BJZ A;  4IEJ A;  2O9L A;  1BA5 A;  2OI8 A;  4GFB A;  2Y9Z A;  2IEK A;  4A3B J;  1BW6 A;  4X1E A;  2PMZ N;  4UUS B;  2R5Z B;  2VUM J;  2FD5 A;  5FGL A;  2Y30 A;  1JJ6 C;  2EH3 A;  1TC3 C;  3GTM J;  1JJ8 C;  4BBS J;  3DPJ A;  3HB9 A;  1JUS A;  1VND A;  5M3M J;  1SFO J;  2UXP A;  1GV2 A;  3MNL A;  4QSH A;  2DJN A;  2NX4 A;  1JT0 A;  2QKO A;  2QF7 A;  2HYT A;  5E3L A;  2CRG A;  2G7L A;  5EYR A;  2ME6 A;  1UG2 A;  1HLV A;  5EF6 A;  4M3F A;  2JA8 J;  2MW8 A;  3BNI A;  5EFY A;  3K7A J;  3QQA A;  1VFC A;  1IDY A;  4A93 J;  2DA2 A;  3QPL A;  2ZCX A;  3FRQ A;  1B8I B;  3E7L A;  5H9T A;  1TWF J;  1X58 A;  5IOY A;  2ZB9 A;  4AUX A;  2M9H A;  2B63 J;  1ZKG A;  2LVS A;  3HEF A;  4BY7 J;  5K7Z A;  1UI6 A;  3RH2 A;  1JTY A;  2E19 A;  3HTI A;  1I50 J;  3SDG A;  1RR7 A;  1UHS A;  2M8G X;  5EGO A;  2JJ7 A;  1TWH J;  1ZTR A;  2XSD C;  3JRE A;  5GP9 A;  3BTC A;  4DZP A;  3JRI A;  3JRH A;  3W6V A;  3GBG A;  1PUF A;  3FKI J;  2VKE A;  3CWR A;  1ENH A;  2Y9Y A;  3ZQH A;  3HDD A;  2DA5 A;  1FIP A;  4GCL A;  1Z77 A;  2OER A;  5FKO A;  3LOC A;  2DMQ A;  4IHX A;  4IHV A;  1ETV A;  1AU7 A;  3JRC A;  4FCY A;  1U78 A;  1FTT A;  3VVY A;  1I3Q J;  2EBI A;  1IDZ A;  3JRD A;  5FKL A;  1IV6 A;  3KKD A;  5K58 A;  2X6O A;  4IHW A;  9ANT A;  1ZK8 A;  1LFB A;  3I4M J;  4DYQ A;  3Q0U A;  3QBM A;  4A3D J;  4BY1 J;  1Q1V A;  3GTK J;  2DMP A;  3O8H A;  3IH2 A;  4C2M J;  1U8B A;  2G0E A;  2VPR A;  3CRJ A;  5F0F A;  5HAW A;  2OPT A;  1TWA J;  1MBG A;  2R5Y A;  1B72 A;  3HOW J;  5C44 J;  3BHQ A;  4GCT A;  3BR5 A;  1E3O C;  2HOS A;  5JLW A;  5K7F A;  1LFU P;  2HXO A;  3PPB A;  2ID3 A;  3JRF A;  3CCY A;  1BW5 A;  3PO2 J;  3NNR A;  2K9N A;  2M0C A;  3M3Y J;  3RZO J;  3O60 A;  3IV5 A;  1D5Y A;  4XRS A;  4DYC A;  5EDN A;  1RKT A;  1X2N A;  5EZG A;  4GFL A;  1AKH A;  4Y7N J;  5FJ8 J;  2X48 A;  1W0T A;  2XB5 A;  1YRN B;  5FKM A;  1IGN A;  2G7S A;  5FLM J;  2ZCN A;  3S5R A;  3TP3 A;  3AQT A;  3ON2 A;  1ETK A;  1WPK A;  3DCF A;  1H89 C;  4J19 A;  3EGQ A;  3VW2 A;  1OCP A;  3Q3S A;  1MBK A;  4D5F A;  5M5W J;  4DYR A;  3BR3 A;  2ZOY A;  2YUS A;  2DMU A;  3BJB A;  2K9Q A;  2JWT A;  3JSJ A;  5D1R A;  2UXH A;  2DMN A;  4NN1 A;  1WGX A;  3COL A;  2RAE A;  4C3I J;  1ZR4 A;  2NVX J;  2WUI A;  2GEN A;  2MGQ A;  1PUF B;  2RAS A;  5J1Y A;  2XDN A;  1FEX A;  3HOU J;  1VF9 A;  5DTD A;  3LSP A;  3HTA A;  1YRN A;  4JP0 A;  1AHD P;  2E1O A;  4RBO A;  3LSR A;  4MLO A;  2R92 J;  1H88 C;  2FX0 A;  1IJW C;  4QIW N;  2W48 A;  5EEA A;  5M5Y J;  1U9O A;  4C3H J;  1QVU A;  1HOM A;  4W1U A;  2R5Z A;  3B6C A;  2CU7 A;  5E3O A;  2UXU A;  2CUE A;  5IYD J;  2O8K A;  2DA4 A;  5IPA A;  4UDS A;  4A3C J;  1X2M A;  2DA3 A;  3S1R J;  3HOV J;  5EZH A;  4DZJ A;  4A3J J;  5FLV A;  3FK6 A;  1OCT C;  4AC0 A;  1JUP A;  1P7J A;  4JX6 A;  2IU5 A;  3B6A A;  3VVZ A;  3T6N A;  2M2E A;  4CGR A;  2YVH A;  2XPW A;  2F07 A;  1IC8 A;  1FIA A;  5GPC A;  3ON4 A;  2PBX A;  3HM5 A;  2JA5 J;  5C3E J;  2NP5 A;  3BR6 A;  5EG0 B;  2FJ1 A;  1ITY A;  2FQ4 A;  3FIS A;  2XGD A;  5HSZ A;  4KWA A;  1MSF C;  3G1L A;  2QOP A;  1JKR C;  1GDT A;  3NXC A;  1RES A;  3SFI A;  2H8R A;  3FK7 A;  4XRS G;  2UXI A;  4ME9 A;  3AQS A;  4FIS A;  4A3G J;  5F08 A;  2IAI A;  3DEW A;  3NAR A;  1BL0 A;  5BNG A;  2O7O A;  4M3G A;  1TWG J;  5E3M A;  5J3L A;  1AKH B;  2R93 J;  3A01 A;  3WHB A;  3PO3 J;  4ACI A;  3G1M A;  3E7Q A;  2QWT A;  4XRM A;  3GZI A;  1MBH A;  5C4J J;  3TW6 A;  3VIB A;  2O7T A;  1JGG A;  1WH5 A;  3S16 J;  1Y1V J;  4JX5 A;  5JLX A;  3GTO J;  3VW0 A;  3Q0W A;  2ZOZ A;  5J1R A;  3HTH A;  4A3I J;  3BG3 A;  4A3F J;  3JRG A;  4MXM A;  2WAQ N;  2CQX A;  1P7I A;  3O8G A;  5F04 A;  3VOX A;  2QIB A;  3VPR A;  1ZQ3 P;  5HOD A;  3BR0 A;  2ECC A;  5C4Y A;  1R9T J;  3BR1 A;  3NAU A;  5CW8 A;  2YS9 A;  2DA7 A;  3VVX A;  3TP0 A;  4GFK A;  2JA7 J;  2XRL A;  1GT0 C;  3GTG J;  5D18 A;  3CDL A;  5F27 A;  3S14 J;  2QCO A;  2HXI A;  2RHA A;  4JNN A;  4AYB N;  3BQY A;  5IYC J;  2TCT A;  1GV5 A;  5IP7 J;  4XIC A;  3ZQG A;  1Y1W J;  2XGE A;  3OOU A;  2H1K A;  1EF4 A;  2EZL A;  3L1P A;  3ZQF A;  4NEL A;  4A3M J;  2R0Q C;  2R5Y B;  1B72 B;  4JL3 A;  2LR8 A;  4HNV A;  2L9R A;  1I6H J;  1OJL A;  5DS9 A;  3MKL A;  2YVE A;  3GTJ J;  1RKW A;  1CQT A;  3S2H J;  4UUT A;  2EZK A;  4L5E A;  5M3F J;  3S1N J;  3IUV A;  2Y31 A;  3F0C A;  3HBL A;  2VKV A;  1MH3 A;  2DTZ A;  3BT9 A;  4MFE A;  3SJM A;  1RET A;  3OIO A;  4B4C A;  3KKC A;  2D6Y A;  1QRY A;  3ZQC A;  4A3L J;  2E2H J;  4A3E J;  4YZE A;  4MK6 A;  1GUU A;  3HIM A;  4B1R A;  3MN2 A;  2LKX A;  5GPA A;  2ZCM A;  2DG8 A;  3ANG A;  2CUF A;  1JKQ C;  3HE0 A;  3LNQ A;  3LSJ A;  2R7Z J;  2LFB A;  1MBE A;  1S7E A;  3KNW A;  1XG1 A;  3HOZ J;  2LY9 A;  1GVD A;  2P81 A;  2TRT A;  4RDU A;  5EGO B;  2DG7 A;  4XK4 A;  2X9D A;  5CXG A;  4C3J J;  2GM4 A;  3MVP A;  2NVY J;  1QPI A;  2LD5 A;  4A3K J;  1HDD C;  2OF7 A;  4M6V A;  3HTJ A;  1H8A C;  4M3D A;  1WCM J;  3M4O J;  1HCR A;  3C2B A;  4B3A A;  4JYK A;  5IP9 J;  1WI3 A;  2WV1 A;  1OFC X;  4S0H B;  3LWJ A;  4I76 A;  2G3B A;  3BG9 A;  3RQI A;  1A6I A;  3HGG A;  5J1U A;  1APL C;  3CMY A;  3GTP J;  3BCG A;  2AHQ A;  1RPW A;  2UXO A;  3EUP A;  2NS8 A;  3LJL A;  3RZD J;  3TW7 A;  5F0H A;  3BTI A;  3JRA A;  2M34 A;  4XID A;  2NVT J;  1NK3 P;  2HQ5 A;  4AF5 A;  2JA6 J;  3NRG A;  4M3E A;  3S1Q J;  3ZOB A;  3BG5 A;  1Z0X A;  4V2G A;  2GLO A;  3KZ9 A;  2NP3 A;  5F1J A;  1IRZ A;  2HYJ A;  2XB0 X;  1ETQ A;  5D19 A;  2HOA A;  2EZI A;  4PXI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...