3WHCA

Crystal structure of a transcriptional regulator fadr from bacillus subtilis in complex with stearoyl-coa
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
190
structure length
190
Chain Sequence
b'KRPKYMQIIDAAVEVIAENGYHQSQVSKIAKQAGVADGTIYLYFKNKEDILISLFKEKMGQFIERMEEDIKEKATAKEKLALVISKHFSLLAGDHNLAIVTQLELRQSNLELRQKINEILKGYLNILDGILTEGIQSGEIKEGLDVRLARQMIFGTIDETVTTWVMNDQKYDLVALSNSVLELLVSGIHN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fatty acid metabolism regulator protein
publication title Structural characterization of a ligand-bound form of Bacillus subtilis FadR involved in the regulation of fatty acid degradation.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription
total genus 77
structure length 190
sequence length 190
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08359 TetR_C_4 YsiA-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3whcA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3whcA02
2R5ZA 1O4XA 2MSYA 1GT0C 4GFLA 1SGMA 4L5EA 2PZ9A 5IPAA 3H0GJ 4FE4A 2LKXA 3HDDA 5H9TA 1OCPA 4XICA 3LOCA 5F1JA 3TW7A 3Q0VA 3S14J 2CQXA 5IP6A 5HODA 1JJ8C 1JKRC 1S7EA 3T6NA 3SFIA 5JLWA 3O60A 2TRTA 3O8HA 1ZQ3P 2HQ5A 4DW6A 3VUQA 1I3QJ 4JYKA 2CRGA 2PBXA 2TCTA 1JTXA 2DMUA 2JN6A 1Y1WJ 2DMNA 1IDZA 3JRHA 1POGA 3S15J 3BR5A 1SANA 3GTOJ 1RPWA 2QCOA 5J1UA 3W6VA 2E2IJ 1H88C 2JA5J 1IDYA 2M0CA 3IH2A 2VPRA 1IRZA 2NS7A 2NS8A 1MSFC 3RQIA 4XRSG 2Y0SN 2HDDA 1HOMA 2OERA 3HTAA 4GFKA 2NVXJ 2YVHA 2WAQN 2RHAA 1QPIA 2XPVA 2P81A 2LFBA 1X2NA 2B63J 3P9TA 2K40A 3JR9A 1B8IA 3HEFA 4GFBA 2IEKA 3V6GA 1IUFA 4M6VA 5EEAA 2E2JJ 1NK2P 4I76A 1OJLA 3GTQJ 5F27A 2HKUA 5CW8A 1I50J 2ID3A 3KZ9A 5IYCJ 3A03A 4QSHA 1LE8A 1ETXA 3FKIJ 2CQQA 3MN2A 1IG7A 3O8GA 2JK3A 3JRDA 5M5WJ 3COLA 3HBLA 1ETWA 2ELKA 4FTHA 1APLC 1RETA 3JRFA 3MNLA 5F0FA 4JX4A 3HOZJ 2JMWA 2ECCA 2NVQJ 1ETYA 1JT6A 4D7NA 3OOUA 4AYBN 1XS9A 4C3IJ 2GUHA 2MGQA 3TP0A 5EG0B 3QKXA 4BY7J 2VKVA 3DPJA 4MK6A 3HGYA 3L1PA 4A3CJ 2EBIA 1BW5A 3NXCA 3BG3A 3HIMA 3I4NJ 2HI3A 4MFEA 4NELA 1U9NA 2ZB9A 3E7QA 2NVYJ 2VUMJ 3JRCA 4AC6A 3GTJJ 5DS9A 3IH3A 3I4MJ 3BR2A 1LFBA 1Q1VA 4CYCA 2AHQA 3PO3J 1TWGJ 4JNNA 1EF4A 4AUXA 3BG5A 2XGDA 3SJMA 3PM1A 1FTTA 3BNIA 5IYBJ 3OSGA 3CDLA 3BG9A 1P7JA 2DA3A 2DMPA 5EGOB 3ANPA 1ITYA 3HTHA 2UXOA 4M3EA 1WH7A 3HKZN 3NRGA 5EF6A 2QTQA 1P7IA 5HBUA 3OIOA 1BW6A 5F04A 3BHQA 4HKUA 2HOTA 1U8BA 2WB1N 3BT9A 3G1LA 1AU7A 4V2FA 2Q24A 2DA4A 4BXXJ 4D5CA 2WUIA 5FLVA 3IUVA 5HSZA 1R9TJ 3GTPJ 3E7LA 2ZCMA 1OCTC 2R93J 1HF0A 4NDLA 1W0TA 3SDGA 5J1RA 2LD5A 2IBDA 2LK2A 2Y9YA 2H8RA 2G3BA 1AKHB 2DG7A 3NPIA 2QF7A 2ID6A 1PUFB 3CMYA 4DYRA 3S1MJ 9ANTA 1HDDC 2LY9A 2O7TA 3K2AA 2E2HJ 2X6OA 2M9HA 1JT0A 5EFYA 1U9OA 3A01A 3JRIA 3VW2A 5K7ZA 5GPAA 2M8GX 5EZHA 2LP0A 3BTCA 3JRAA 3VVZA 1TWFJ 3TP3A 2XRLA 4B4CA 3CRJA 3UKGA 2Y2ZA 1T33A 1CQTA 2F07A 4GCLA 2GFNA 3C07A 4C3JJ 2W48A 3DCFA 5E3NA 5EYRA 3TEDA 3QPLA 1ETVA 2X9DA 2DA1A 5C4YA 5F08A 3HTJA 4A3BJ 2EZIA 3ANGA 1JUPA 4DYQA 4M3BA 2UXHA 1WH5A 2XB0X 3GTGJ 2MG4A 3HOYJ 1E3OC 2L7ZA 2X48A 3V78A 5J3LA 1GDTA 2QOPA 2QKOA 3AQTA 3JRGA 1ZR2A 5IP7J 4UUSB 5C4XJ 1MBKA 1IJWC 4JP0A 4MXMA 2XDNA 4DZJA 2DMTA 1X58A 2R5ZB 2HYJA 1MBFA 4QTRA 2M34A 1ZR4A 1MBJA 1WPKA 3VW1A 5FHPA 1F36A 1MBEA 3CCYA 3H3VK 1WCMJ 2OPTA 3A02A 2CU7A 4CGRA 3FK6A 3B6AA 2Y9ZA 4BY1J 4C2MJ 2E1OA 2JWTA 2M2EA 2YS9A 1B72A 3VPRA 5CXGA 2O7OA 5D1RA 1FIAA 1F43A 3CQZJ 4S0HB 2DA6A 3BCGA 2FD5A 3GTKJ 3HE0A 1XG1A 3CJDA 5E3LA 1JKOC 4XK4A 3ZQCA 3PO2J 2HYTA 1RKTA 1MH4A 3DEWA 2H1KA 2WV1A 1GV5A 3BR3A 4Y52J 4UDSA 2N8GA 3ON4A 3WHCA 3G56A 1TC3C 5D18A 2K9QA 1BL0A 3QQAA 5FMPA 3MKLA 4M3GA 3GTLJ 2DA2A 1B8IB 4X1EA 1ZK8A 3Q0WA 5GP9A 5FLMJ 1U78A 4IHYA 3CWRA 5IP9J 3IV5A 3BRUA 4FCYA 5IOYA 3RZOJ 4A3GJ 3D1NI 3B81A 3S16J 1WGXA 2XPWA 3ZQHA 5FKOA 1MSEC 4G12A 1MBHA 2L7FP 1LE8B 4M3DA 3HGGA 4A69C 5IOZA 5C4JJ 1QRYA 1G2HA 3PPBA 1A6IA 1GUUA 2R5YA 5K58A 2EZLA 4A3IJ 4D7MA 5DAJA 1ZTRA 2EQRA 1AHDP 3S17J 1LFUP 4W1UA 1HLVA 4A3DJ 4PXIA 3BTJA 5JLXA 1BA5A 3GBGA 4GCKA 2DMQA 5F0CA 3ON2A 1JKPC 3VIBA 2QIBA 1VFCA 5GPCA 2CUEA 2GM4A 2LR8A 2G7LA 3LHQA 4B3AA 1H89C 3HOVJ 2Y31A 3LNQA 4NN1A 3RZDJ 3G1MA 1MBGA 2EZHA 1QVTA 3FK7A 2VI6A 4IHXA 1YRNB 2UXIA 2NP3A 2GBYA 5M3MJ 4A3LJ 2RAEA 2FJ1A 4V2GA 1NTCA 3FIWA 2YU9J 2MW8A 2K9SA 4JL3A 3M3YJ 1WI3A 1ENHA 1JUSA 2K9NA 3BQYA 2GLOA 2JJ7A 1H8AC 2XGCA 4CYCB 2I10A 4MFDA 3LSRA 3C2BA 1HCRA 3NAUA 1IGNA 4X6AJ 3S1QJ 1UI5A 2RASA 4ME9A 2O9LA 5C44J 3KKDA 2L9RA 2LLKA 5EZGA 4BBSJ 5M5YJ 3OSFA 4C3HJ 1UI6A 1JKQC 5FKMA 2EZKA 1D5YA 1I6HJ 1FTZA 4MIMA 5FJ8J 2LTPA 3S5RA 1JUMA 3FRQA 3K7AJ 2HOSA 4IHVA 1FIPA 2DA5A 2EH3A 2XGEA 3ZQIA 3F0CA 3GEUA 4A3EJ 1Y1VJ 5HAWA 3LWJA 1W0UA 3KNWA 1A5JA 4JKZA 3M4OJ 2ZOYA 3ZQFA 2ZOZA 5DTDA 4A3JJ 2FX0A 4XIDA 4YZEA 1RR7A 2XB5A 5K7HA 5E3OA 1ETKA 2V57A 4IHWA 1JGGA 2D6YA 2GENA 2FQ4A 2QWTA 4A3KJ 1T56A 3HOXJ 4A3FJ 4JX5A 3S1RJ 3VOXA 1UHSA 1ZKGA 2LVSA 3F1BA 3ZQGA 3S1NJ 3WHBA 5BNGA 3BQZA 4DYCA 3A01B 2ZCXA 1ORKA 1K61A 5EG0A 5AQCA 3JREA 4Y7NJ 1UG2A 4EEFG 2FBQA 3G7RA 2CUFA 4IEJA 5F0HA 1Z77A 1RESA 4L62A 3HM5A 2CJJA 2UXPA 4FISA 4J19A 1NK3P 2NVTJ 1DU0A 1ETQA 2OF7A 3LJLA 2R7ZJ 4A3MJ 1IC8A 2E19A 3VP5A 4KWAA 3RKQA 3VOKA 3VW0A 3QPSA 3MVPA 2KDZA 3RH2A 1UMQA 2AO9A 4HNVA 2DA7A 5CXIA 3BTIA 5EDNA 1FEXA 2ME0A 3HB9A 3HOUJ 3IH4A 3VVYA 3TW6A 1VF9A 2G0EA 5EGOA 5J1YA 3KKCA 2YVEA 2O8KA 5FKLA 2DG8A 4AC0A 3JRBA 5FKKA 1TWHJ 4W97A 2OI8A 2JA7J 4GCTA 2R92J 2DN0A 5K7FA 2YUSA 4ABZA 2IAIA 3BR6A 1DU6A 2R0QC 4RDUA 4D5FA 1VNDA 1BJZA 2DJNA 3G1OA 1JTYA 4B1RA 1FJLA 5D19A 3VVXA 2DTZA 2L0KA 4UUTA 1YRNA 1RKWA 2Y30A 1AKHA 2NX4A 2G7SA 3BR0A 4LOCA 3GTMJ 2ME6A 4MLOA 3LSJA 1OFCX 3BR1A 1MH3A 1PUFA 2REKA 3EUPA 2HXIA 5M3FJ 5E3MA 1B72B 1TWCJ 1JJ6C 3S2HJ 2W53A 1MNMC 2XSDC 2HXOA 4ACIA 2UXUA 3S2DJ 4QIWN 2ECBA 3LSGA 3BTLA 3ZQLA 3RD3A 3HOWJ 1ETOA 1VI0A 4FE7A 1K83J 3Q0UA 1TWAJ 4ICHA 4DZPA 4AF5A 2IU5A 2COBA 2ZCNA 4RBOA 1SFOJ 2VKEA 1QVUA 3JSJA 1XC5A 4MO7A 3Q3SA 3LSPA 2KT0A 3B6CA 2JA8J 4XRSA 4A93J 1IV6A 4BBRJ 5C3EJ 1GVDA 1ZGWA 2PMZN 3NARA 2XPUA 2G7GA 1Z0XA 5FKNA 2HOAA 3QBMA 3NI7A 4XRMA 5FGLA 4JX6A 2WGBA 2NP5A 3GZIA 3PASA 2L7MP 4I6ZA 1GV2A 2D5VA 2R5YB 4UUSA 4M3FA 3BJBA 1X2MA 3FISA 1HDPA 2NOGA 3ZOBA 4BKXA 5IYDJ 3NNRA 3AQSA 3EGQA 2JA6J 5M5XJ 3HTIA
chains in the Genus database with same CATH superfamily
2Q2EB 2CUZA 2MSYA 1MKMA 1J7KA 3M1CA 4XONA 1MD0A 4ZTFA 2PZ9A 1K78B 4HA8A 1USSA 4FE4A 2FQ3A 3SDBA 3TO9A 3CCVI 1OCPA 3REOA 2LKXA 3TQNA 5F1JA 3Q0VA 2PI0A 3QYFA 3OYEA 4ZTJA 2PJRB 1S7EA 3T6NA 1YX5A 2R7OA 3EUKL 2K4JA 5ILVA 2CRGA 4E7LA 2TCTA 3KLNA 3KYCB 3AL0B 2DMUA 1WRJA 1VQ8I 4B48A 3I54A 2HQAA 3BR5A 3GTOJ 1R36A 1H88C 3J81Z 5CVJA 2PMZA 4WXDA 2WB1A 4H0EA 1ZLKA 2QSGX 3SFZA 4CDGA 1IRZA 1KU2A 3SZPA 1VZ0A 4XRSG 2OERA 2Y0SN 4WCGA 4GFKA 2YVHA 1ZRFA 1OYYA 5HLIA 3G71I 2EIJH 2LG4A 1I6XA 2LC2A 3CJNA 4AIDA 4OIPF 2V7FA 3B02A 3NQOA 4Z6YA 2B63J 2K40A 4IOAF 3OYMA 1XSVA 3JR9A 3RCOA 1ULYA 3A1YA 3HEFA 5EJCA 1X4OA 4F91B 4KMFA 2IEKA 2R4GA 4HDVA 2F5FA 1IUFA 4M6VA 5EEAA 4BNCA 2XDVA 1P4XA 3TDZC 3CMEI 1U3EM 2TDXA 1TTYA 4OU0A 2K86A 4HV5A 2L01A 2V1DA 4AD9A 2L9SA 2RDPA 2VB6A 4EVIA 3L7WA 5ICFA 1VQ6I 1PDNC 2CQQA 3MN2A 2QBYA 3O8GA 3JRDA 3DP7A 4CICA 3COLA 3I5UA 2XIGA 4F93B 4FHTA 3AG4H 1XGNA 4U88A 3DQVC 2WY7Q 1JE8A 2JMWA 2ECCA 5F6FA 1ETYA 2DK8A 5FFZA 1DQUA 1XS9A 2Z3YA 4BJ6C 1BOBA 2X6WA 3LSIA 4BXFA 2ISYA 3TP0A 4IRIA 4MK6A 2VKVA 1IF1A 4PK4A 5FFXA 3PL8A 3CUOA 1WFXA 4I7HA 3I4NJ 2MC3A 1XN7A 3E1SA 4KDPA 5FRNA 4F55A 2ZJPF 2QUFA 3E7QA 3H3ZA 2IS4A 1HQCA 2X1EA 4NQWB 1EH7A 5DS9A 1E3HA 1LDJA 5JVTA 4ENJA 3BR2A 2KRCA 1LFBA 5JR3A 2F6CA 1TWGJ 2X1DA 3Q9SA 1EF4A 2XGDA 2MBFA 2D1VA 1WJAA 1FTTA 3OYNA 4Y4RA 1TP4A 2IA0A 3QRFF 1U2WA 4B44A 2FBKA 5GTHC 2DA3A 5EGOB 4KUMA 1ITYA 4NC8A 3T8RA 1D1BA 1TBXA 4XLAA 4QPQA 4XLEA 2H6CA 2QTQA 3KP4A 1TQPA 1BW6A 4HPQA 5F04A 2IP2A 4I02A 2BXZA 3LAPA 3HOTA 4V2FA 4Y15A 4HG2A 4BXXJ 2WUIA 2PQ8A 4BHBA 1KGSA 4XKWA 3FM5A 1HKTA 4BUPA 3E7LA 3EYYA 2ZCMA 4NDLA 1MMDA 4ZZDA 1S3JA 1T2KA 2KJCA 4U7BA 3WTXC 2A61A 2IBDA 2QYOA 5CJ9A 5H6RA 1PUFB 3H9JA 4F52A 4OOIA 3CCMI 2XAFA 3DV8A 2I8DA 2O7TA 2NOJB 1U9OA 2Q8KA 3A01A 3JRIA 1WZ2A 5K7ZA 2GWRA 3GF2A 5GPAA 1BOAA 4N9HA 3KPHA 1IXSB 2D45A 5GAHJ 4C2UA 5DUIA 3MZ8A 2K3PA 2HKOA 4B4CA 2A6EF 2Y2ZA 4BAYA 4KT5C 4OWRB 1GXPA 1R5GA 3C7JA 3DU5A 3RKYA 2E1CA 2F07A 3VSKA 4M72A 1E2XA 2VN2A 1R71A 3T5XA 4C3JJ 2VOPA 1KYWA 2CV0A 4HDUA 3IAM2 3HJEA 3JAMZ 2X9DA 4N4OB 2CW0F 5C4YA 1IUYA 4A3BJ 3LSHA 1OCOH 5LGUA 2F4MB 4CCNA 2XB0X 2ZNYA 2RQPA 1P4WA 1BJAA 3E3VA 2L7ZA 2RV8A 3KEQA 4XLHA 4JQFA 1BM9A 3V78A 3BY6A 3DBLB 1LB2A 2QOPA 5ILSA 3HTSB 5C4XJ 1MBKA 2F48A 4EV0A 1FLIA 1B9MA 2GA2A 1OCZH 2FNPA 1FPQA 4AM3A 1I39A 4M74A 2KIUA 3KEYA 2M34A 3RPUD 1DP7P 2VBWA 1WPKA 2W25A 2XV4S 4O3MA 1FT9A 1V5FA 1RC9A 4NBQA 4KJZA 2P7VB 1QGPA 4BQOA 1X4PA 2K9MA 1K6YA 2QLZA 3K70C 1YHQI 3VPRA 2QQBA 3PJRA 4E6KG 2EFNA 4S0HB 4CCLA 2A5YB 4UHTA 1E17A 1XPXA 1XG1A 3ZQCA 2HYTA 3KP2A 1RKTA 5HVQC 3DEWA 2H1KA 2WV1A 3WTTC 3BR3A 4UDSA 3OR2C 4M9ZA 2JQ7A 4DQ2A 1XB4A 1DDNA 5LHHA 1BL0A 4RLQA 2DODA 4OAZA 2WV0A 1VQOI 1T0FC 2R7RA 3V8JA 1B8IB 2NRAC 4HQEA 1ZK8A 3IP4B 1U78A 1ZGJA 3L00A 5TGTA 4YRVA 2R7WA 2WY8Q 4B3XA 3E5XA 2GA1A 3OYCA 3D1NI 3KZIC 1T08B 3S16J 2I5UA 2LBFA 3FMQA 4FT8A 5FKOA 1MSEC 4Z2YA 1Z7UA 1HSJA 1FMVA 5JHFA 3EYIA 3ZMVA 2ZMEC 4EQQA 4G6DA 2MLGA 2L54A 4D7MA 3KYLA 3D5RC 2EQRA 1AHDP 4M9SA 3U9GA 4A3DJ 1RI7A 4ZJZA 2GZWA 5CKTA 3W2WA 4GCKA 2ADUA 4O5VA 4GO1A 1YI2I 2KIFA 3OYBA 2DLLA 2VE9A 3CC2I 3NRVA 3ELKA 3ROUA 1VFCA 2FBIA 5LFAA 1XSXA 4PSXA 1Z21A 3K4KA 2Y31A 4NC7A 1S8NA 4FX0A 5D4RA 4U9LA 5H20A 1QVTA 4UVAA 2HNHA 2EK5A 3FK7A 3W6JB 1W36D 4YG2F 4IHXA 4LK0F 4QPOA 2NVUB 4DGWB 1XTAA 1UFMA 2R7QA 2YU9J 1A6QA 2MW8A 2KIMA 1FC3A 2ZSHB 1JI8A 1Y56A 2JA2A 2VBYA 3J7ZI 2VC0A 4CCKA 1YW8A 2GLOA 2JJ7A 4RB1A 3LSRA 3F22A 5A2QZ 2EJRA 2BXYA 1U5TC 1I3AA 3ABKH 4KA4A 2W24A 3HYIA 2L9RA 1S72I 3CF5F 4WX9A 4MTEA 1JKQC 4L9NA 2M30A 1XMKA 1L3LA 3S5RA 4IJAA 1YLFA 4UV8A 2VJIA 4IHVA 1FIPA 4BJTA 5E1ZB 2Y75A 3G73A 4A3EJ 3BZ6A 3LWJA 3BG6A 4Y17A 2JT1A 4HOBA 3W3CA 3M4OJ 4M73A 2AS5F 3GCMA 1A5JA 4Q48A 3ZQFA 1I1SA 4JKZA 3G2BA 1QQIA 3K69A 4XIDA 5FRMA 3CUQA 5E3OA 2A07F 4I01A 1EH8A 4IHWA 2FQ4A 1T38A 3H3UA 3HOXJ 1ZKGA 3AL0C 3BJ6A 1G3TA 3W2AA 3ZRGA 3CCLI 2EWNA 2HVQA 2VQLA 5BNGA 3OYFA 1K6OA 3IL2A 2FUG2 2ZCXA 5LLQA 3CO7C 2CFOA 5AQCA 3IRQA 4RAZA 4EEFG 4XSXF 3KCCA 2IGMA 1S29A 2IJLA 3G7RA 2ESNA 2BBYA 3HM5A 3I59B 4CYDA 3TDUC 2OQRA 2UXPA 3AG2H 4FISA 3PUFA 3D5SC 2M7BA 1IRGA 3NS4A 3VEPA 2R7ZJ 3FHNA 2E19A 4OMZA 1IN8A 2BY2A 3RTRA 3BP8A 4XN0A 3AKZA 6PAXA 1SD6A 2WAFA 5K1YA 2GXBA 5TRDA 3QAHA 5EDNA 3OIQA 1V5EA 2LKPA 1YOVB 3I0TA 3VYSB 2O8KA 2M0MA 2JPBA 4HNUA 2F5CA 3JW4A 1PVEA 2P5VA 3DFGA 4XQFA 3S3MA 2W85A 2DYRH 3ZQQA 2R92J 3J7AO 4GCTA 3CO6C 1S9HA 5LRSA 5JVGF 2QA4I 2CS3A 1XGOA 1X1PA 1WWXA 4L0ZB 1JTYA 4B1RA 1EKEA 2IA2A 2K3FA 2DTZA 1FJLA 3E6DA 4Y13A 1WKMA 3LAJA 4ENKA 3WU1B 1KU7A 2NX4A 4BYYA 4LOCA 4MLOA 2X0LA 1OFCX 3LSJA 2WAQA 3GFLA 3F6OA 3V7RA 5M3FJ 2VBZA 3H36A 3E6BA 1G6NA 3N4MA 1AWCA 1MNMC 2HXOA 3LA2A 2PFBA 4RGSA 2DQLA 1TQMA 2P4WA 3RD3A 2LMDA 2MD0A 1ZRDA 4G6QA 3ZGKA 4OD5A 5BPDA 4DZPA 4UV9A 2IU5A 3ECHA 3KE2A 4PCQA 1V4RA 1FX7A 3BLYA 2K02A 1QVUA 3MMYB 2Z33A 4HF1A 5DCMA 5B1AH 1YS6A 2NAZA 3G4SI 1IV6A 3LL7A 5E17F 2YX7A 5C3EJ 1ZGWA 1J0RA 2PMZN 2XPUA 1MJ9A 2G7GA 2E36A 5FKNA 3ZN1A 5HLHA 1IAWA 4AYBA 3NI7A 2EFPA 2XAHA 4S05A 4RAYA 4WXCA 1X1BA 3OV8A 4II3A 3V7SA 2XASA 4CZZA 2F5VA 4I0BA 2A05A 1QBJA 2L7MP 4I6ZA 3PASA 3IKVA 3A4CA 4UUSA 1S7OA 4M3FA 3S32A 4NB5A 2RC4A 4R8HA 2GXGA 3HTIA 1RUOA 3C2HA 1GT0C 4GYGA 2OU2A 1PYVA 4ZDLA 2F5DA 3LFKA 2DI3A 4UY8I 1TNSA 2X51A 2KHMA 3H0GJ 4HX7A 5H9TA 4XICA 4CCJA 3ZP5A 2EILH 4BHCA 5BMZA 5HODA 5JLWA 4ENMA 3O60A 1D1CA 1SFKA 2HPIA 2YR2A 1TW3A 4OINF 3F8FA 1F4KA 2PBXA 2DOAA 1SC7A 3D0SA 1R1UA 3CCQI 2JN6A 4EJUA 1IXRC 1Y1WJ 2E7WA 3GX4X 3JRHA 3GYHX 1NHAA 3Q5FA 1SANA 3GVAA 1RPWA 2OCEA 2JA5J 2PN6A 1IDYA 3K9TA 3IH2A 4N0BA 3SEQA 2XVCA 1QZYA 2A6TA 2NVXJ 1YIJI 1QPIA 1HKSA 3GO5A 1T0FA 3S3NA 1MW7A 4U0WA 1X2NA 2IRFG 2Z9OA 1OYWA 2MC4A 5K5RA 1O3SA 1IO2A 3P7NA 1HW5A 4HLYA 4IXAA 1BC7C 1LFPA 1OJLA 3HRMA 5CW8A 3ERMA 2JZYA 2AQEA 4YIIA 2RREA 5IYCJ 2DXIA 4QSHA 3F23A 1LE8A 3KP6A 1WJCA 2PMHA 2CMPA 3K1MA 3S2WA 4RS8A 2R3SA 3CD6I 1ETWA 1APLC 1XDSA 2RQQA 3T0YA 1EJ9A 1USTA 4JX4A 5LD2C 4ETSA 1UHWA 1HSTA 1JT6A 2E5NA 3OOUA 4II2A 3FXUA 1LVAA 3WTZA 2EFQA 3GLLA 2DOFA 3GW2A 4BY7J 3WTUC 3HGYA 3F9KA 3R0AA 1WJBA 3BG3A 3CF2A 3H5NA 3HIMA 3KP3A 2HI3A 4MFEA 3CLOA 4AVPA 4NELA 4Q5SF 2Q1ZB 1NG7A 1UZCA 1VQPI 1A35A 5KAIC 4M71A 2HU9A 5CLSA 3TOBA 3JRCA 4AC6A 3GTJJ 3IH3A 3WG7H 3LSKA 2PEXA 1MNEA 1Q1VA 2L9VA 4CYCA 1TT0A 1WJEA 2AHQA 2CO5A 3F72A 4JNNA 2M7AA 5HNFA 4AUXA 1E3PA 5DM7F 1U5TA 4IZZA 3PM1A 3BNIA 3BG7A 5IYBJ 2LKSA 2BOLA 1Z6RA 4BHPA 3BG9A 2K4BA 2Y0MA 2KKOA 2VIXA 3PIOF 2DMPA 4M6XA 4M3EA 1UB9A 5LBQA 1STZA 3HKZN 3MCZA 3P9CA 5HBUA 3OIOA 3SZTA 3BHQA 4CO8A 4L9TA 1AU7A 2ZFUA 3RI4A 3BCBA 2FXAA 2IW5A 1LNWA 2DA4A 1XD7A 3ERED 5FLVA 1R9TJ 4A5NA 2H94A 3WTVC 1OCTC 3ONQA 4C2MA 5J1RA 4MTDA 3M07A 4D1QA 3FF5A 2HFHA 4WXHA 1ERDA 4ENNA 2FRHA 4A5MA 1AKHB 3NPIA 1MMAA 2ID6A 3JSOA 3ESWB 1IN6A 1FMWA 2A2FX 2YX4A 3V7CA 1UAAA 1H0MA 3VW2A 5EZHA 1DGWY 1YW9A 2LP0A 3BTCA 5L3BA 1LDDA 4YFNF 2V9PA 1JXSA 2MLKA 1U6GA 3R6SA 4AIHA 4A0YA 3JRAA 3VVZA 2EA2A 4PJLA 1XMAA 2UUZA 2KP6A 4B8XA 3A2KA 1W36C 1CQTA 2BW3B 4HW0A 5D5WB 3NWSA 1QNTA 1W7PD 2NXNB 3CDHA 4XRFA 1NH3A 2GFNA 2OV7A 4KN7X 2JPCA 3MAJA 5EYRA 2EV5A 2OTLI 1XCBA 1ZAOA 2KMUA 1PP8F 3IUOA 2KPMA 1R1VA 2DA1A 5D8KB 3LWFA 3JAMK 5FD6A 3HTJA 3ANGA 2VBXA 5CQGA 3LQQA 1DGRM 1JUPA 3GTGJ 3QWLA 2WAEA 2HDWA 2NS0A 3HSEA 3KEOA 2BVMA 3ULQB 1TL8A 4H4KC 1GDTA 2QKOA 2VL8A 3RDIA 1W7PB 2E1MB 2XGXA 4MXMA 1UCRA 1S5LC 2V6CA 1YJNI 3QU6A 4BE2A 5DEQA 2R7FA 4CZCA 3FWEA 2HYJA 4QTRA 2VC1A 3B73A 1MBJA 4MGRA 2FMLA 1F36A 1MBEA 1W5SA 1K79A 3H3VK 4OIOF 3ASNH 1WCMJ 2VQHA 3UNGC 4CGRA 2BHZA 2BHYA 3R0JA 5FO5A 4C2MJ 1B72A 5E79C 2KFDA 5IT3A 2QENA 1J9IA 1ONVA 5D5XB 5CXGA 1FIAA 3CQZJ 2MABA 1HXDA 3QP6A 4IF4A 2FSWA 5D5VB 5E3LA 2HTJA 3PO2J 2UXNA 1MH4A 5ICCA 1I5ZA 1BBYA 3K4JA 4UB8C 2N8GA 3VWBA 2JSPA 3G56A 1TC3C 5D18A 2K9QA 3QQAA 1KA8A 2DTRA 2O0YA 1J2XA 3MKLA 4M3GA 4ZYHA 3IKTA 4MEXF 3GTLJ 2DT5A 2DA2A 2M8EA 4YIFA 2M1BA 1SEUA 2AQFA 5GP9A 3I71A 5CQEA 3DKXA 3N05A 2BVLA 3GWZA 3FXOA 2CV1A 4G12A 1MBHA 3A0HC 3MKYB 4PJNA 3HGGA 5IOZA 1G2HA 1A6IA 2X6XA 5K58A 3G6EI 1YQAA 2QVOA 2EB7A 2L4AA 4UVBA 3GZNB 2UV1A 1HLVA 4PXIA 1HW1A 3EUHA 3BTJA 1BA5A 3GBGA 2KQRA 4P9FA 5CVVA 1ON2A 2DMQA 2ZXJA 3F8MA 3K8PC 3ON2A 4XLPF 1VTNC 4IKFA 3DEEA 2QIBA 5GPCA 2CUEA 2GM4A 4B3AA 3HOVJ 3I53A 1TZLA 3LNQA 4NN1A 2E5ZA 3FBIB 3G1MA 1MBGA 5KVRA 1Z6TA 4U87A 3L2UA 2FA5A 2LY2A 5LHIA 2UZKA 1P6RA 2NP3A 5F64A 4A3LJ 2J5PA 1CF7A 2RAEA 1XGSA 1NTCA 2M87A 2K9SA 4NUBA 4RLFA 2K9NA 1KU9A 4ZDPA 1OMIA 2VJ4A 1YS7A 5HLTA 2OTJI 2Z1DA 1ZLJA 5ICGA 1YO5C 1KQ9A 5L3GA 4E7IA 3LA7A 2ACJA 4ASNA 1F9NA 2V1NA 2XHKA 1IGNA 4X6AJ 1UI5A 1XGMA 4S04A 5A2QK 5C44J 3AAFA 4ME9A 1TQIA 4ESFA 3HG9A 3EDPA 4BJ5C 1WJFA 5FKMA 1I6HJ 1FOKA 1OKRA 2NNYA 1YIOA 1LEBA 5FD5A 3H1CA 2EINH 2R7UA 3H92A 3ZQIA 1DPRA 2KZVA 3V8LA 3QP5A 1W0UA 4K2EA 4PJMA 1QHGA 4LIUA 2ZOYA 2ZOZA 4AU7A 3WU2C 5DTDA 4A3JJ 1OR7C 2B0LA 1KYZA 5JFRA 2D6YA 2GENA 1T56A 3VOXA 1EA3A 2A3SA 3NWTA 4G8XA 4ZYGA 3ZQGA 3F1BA 2OJED 3WHBA 3L9FA 1SD4A 5DUKA 1BI3A 3R61A 3ZCOA 3BQZA 1TW2A 3A01B 1T8IA 1Y0NA 5B1BH 1K61A 5EG0A 2AXTC 1R1TA 3C18A 3QYBA 4HEA2 5L3FA 4Y7NJ 5DCFA 3R4KA 1QHHD 4OIQF 1RESA 1VQMI 1MMSA 1EV7A 2CJJA 2VE8A 1SVLA 2MD5A 3MQ0A 4L18B 3LJLA 2K5CA 2L9NA 1RUNA 2DFFA 4ZYAA 3PQJA 3P9KA 4XR6A 3U1KA 3F21A 2HVSA 3QPSA 3FXQA 2ZJ2A 3MVPA 4IPAA 1X3UA 3ZXSA 3X2QH 2KDZA 1YG2A 2FF4A 2AO9A 3BJOA 3DPUA 2B7EA 4HNVA 4LG0A 3BTIA 1FEXA 3CZ6A 4EATA 2EV0A 3VVYA 3TW6A 1ODDA 5K5OA 4PSWA 2YVEA 4PDKA 2LNBA 2BY1A 5FKKA 4W97A 2QKLB 2F5EA 4GDFA 2JA7J 4YFKF 3IC7A 1J75A 2XAUA 5GADJ 2DN0A 3M8EA 4YELA 2HGCA 5K7FA 2Z5UA 2E35A 2OCCH 2IAIA 3BR6A 2R0QC 3L2QA 4BS9A 3TKYA 1EH6A 3G1OA 4XBFA 5D19A 3VVXA 2L0KA 2DO7A 4DOZA 1LDKB 1RKWA 2Y30A 4B47A 4F92B 2QQ9A 2Y0SA 3GTMJ 2MH2A 3J7YJ 4G9YA 1R00A 2REKA 4OD4A 5E3MA 4CA0A 5LHGA 2MYSA 2JRTA 1SFUA 3WODF 2LDUA 3M8JA 4CHUA 4XKBA 3KETA 2L02A 1SFEA 2ECBA 3ZQLA 1Z1DA 2Y69H 3WGGA 3CTAA 1Y6IA 2COBA 2ELJA 4RBOA 2ZCNA 1BI1A 2JSCA 2BV6A 2VT3A 3JSJA 1XC5A 2HYGD 4ITVA 4IOCF 2R7DA 2VQGA 5HS9A 1VQ4I 3B6CA 4V19K 2QZ8A 2XAJA 1GVDA 1WJ5A 5CYVA 4J01A 4BE0A 2HOAA 3CDIA 1U0JA 3QBMA 3DLAA 3H9QA 3E6MA 1B4AA 1A04A 2W4SA 3R60A 2E71A 2NP5A 2WGBA 2XAQA 2DDAA 2DU9A 2DPDA 3BJBA 1X2MA 3FISA 2CGPA 2NOGA 3ZOBA 1SMTA 1IW7F 3EGQA 1G3SA 4E7HA 3ZMTA 2R5ZA 4BH9A 4GFLA 4XOTA 4L5EA 2WC2A 4MHGA 3KYDB 4KIFA 5BPIA 3KLOA 2BE5F 3S14J 3O2PE 3VOEA 1PP7U 1JJ8C 1JKRC 2O8XA 4TV7A 4KICA 3PIPF 5IT9K 2HQ5A 1FBUA 3VUQA 3PNTA 5DD8A 2CQ7A 4DBRA 4XM3A 4BEHA 2FU4A 4Q47A 2DMNA 4LJZF 2CW8A 1POGA 2KL4A 3VYRB 3VSLA 5J1UA 2HR3A 2E2IJ 5KK1A 4XMYA 4F7ZA 3VODA 2NS8A 3OOPA 3DEUA 3RQIA 2PJPA 1HOMA 3FXRA 4RGUA 4O6JA 2H6BA 1RR8C 2YU3A 1OLTA 1V54H 2LFBA 5DYMA 3CJTB 4PGGA 4DBQA 2E1MC 2DJIA 4GFBA 3V6GA 3I58A 4HF0A 1Z91A 2E2JJ 3GTQJ 1SAUA 2YPRA 4EM2A 2HKUA 1V55H 2ID3A 2ICWG 4RMNA 4AWXB 1O7LA 2KZGA 2ZXHA 1ETXA 2K7LA 3OYHA 3JTGA 3HUGA 3O6BB 3FHZA 1FSHA 3IWFA 2JK3A 5FGMA 3CUQB 5M5WJ 2R7TA 3E97A 1RETA 3JRFA 3CC4I 1KQ0A 1FP1D 4U7DA 3HOZJ 3RQ4A 4D7NA 2FOWA 3DBHB 3NEUA 2RKHA 2GUHA 4RM3A 3UR3C 3QKXA 1T39A 2HEOA 2P6TA 2DDBA 3L1PA 2OBPA 4A3CJ 2FBHA 3FDYA 4E7JA 3NXCA 4I0AA 4ON0A 2CG4A 2ZB9A 2JVGA 3GLXA 3OS1A 2PFVA 4LLNA 1YX3A 5FLXK 2NVYJ 3HHHA 1X1AA 2HOEA 1G4DA 4GCVA 4QLCU 1G59A 4CGZA 3VFZA 3PO3J 2E7XA 3HIFA 4MQVA 2KIQA 4KT6A 1Z67A 4BU2A 4M6YA 1MMGA 1MDMA 3ZMSA 3OSGA 2IS1A 3CDLA 5KAFC 2ZXIA 4DIQA 4XL9A 3QPHA 2JTVA 3HTHA 1WH7A 2P0WA 2BEOA 5BS6A 3FX3A 3WTWC 4PGHA 3NRGA 1JHHA 5EF6A 1P7IA 2E60A 2HWVA 3HL2A 2HOTA 2ZY9A 1U8BA 2WB1N 3BT9A 3G1LA 2Q24A 2UXXA 4D5CA 2XF7A 3SWHA 3IUVA 2EA4A 2B9SA 1Y8RB 3TO6A 4IQJA 1HF0A 2ZO4A 1R49A 1W0TA 3ZMUA 4ESJA 3JTHA 2H8RA 2Q0OA 4HSRA 2QSHX 2DG7A 4OAYA 3GFIA 3CMYA 4DYRA 2LY9A 3K2AA 2X6OA 3WU0A 4RAGA 3BCAA 2M8GX 3LA3A 2XAGA 4HBLA 1YTYA 3OMYA 1F1ZA 1G3WA 1SD5A 1FWZA 2QQ8A 5ICEA 1MZBA 1ZN2A 2L5QA 1H9GA 1MJBA 4WK8F 3TP3A 3PSIA 4RAFA 5IT9Z 3UKGA 1T33A 4GYIA 4GCLA 4RB0A 3CCUI 4PZJA 3C07A 2BYVE 3DCFA 3IHUA 4IRHA 5DCMB 4BGDA 1OYIA 2CV2A 2VLAA 3TEDA 1NG6A 1ETVA 2O03A 4C9YA 2OAZA 4BQNA 3DWLE 4GXOA 3OS0A 4E7ZA 5F1RA 5F08A 2EZIA 3K1PA 1W5TA 2LY1A 5HS8A 3CJRB 2L2OA 3K10A 4M3BA 2UXHA 4MEYF 3CMMA 2J5OA 2MG4A 1S6LA 1E3OC 2DYSH 4BXUA 2CH0A 2X48A 1Z3XA 4EM1A 4LLLA 1QZZA 3AQTA 4L9JA 2CSOA 4F3QA 5IP7J 4UUSB 3K70D 2DFEA 1IJWC 2BY3A 4JP0A 4KMUX 2XDNA 3IAS2 4BQQA 4DZJA 2ZSIB 3VB2A 4XSZF 3OYJA 1MBFA 2PLYA 5FHPA 1T95A 1FP2A 2ZMEA 2OPTA 2H8WA 3O3KA 3FK6A 2STWA 3EPZA 3B6AA 3OR1C 3ABMH 2OQGA 4KFCA 3S93A 2ISZA 2E1OA 2JWTA 3HRSA 4RGRA 4G94A 2W82A 5D1RA 2P7CB 1F43A 3TMOA 3BCGA 4U9NA 2DA6A 3GTKJ 3HE0A 1QZEA 1YYVA 4I99C 3CJDA 2F2EA 1JKOC 4XK4A 5KHDA 1UJ8A 3CESA 3OYDA 1FOYA 1H9TA 1VQKI 4Y52J 3ZN0A 4IRVA 3CCEI 3ON4A 3N97A 2UWMA 1V5GA 3QOPA 4ZH4F 2WBMA 5FLXZ 4IO9F 1IN7A 2OUMA 4P55A 4E4HA 5J8FA 3WE3A 4KIBA 2P6SA 3WTYC 4J00A 3TL4X 4HLXA 4OMYA 3FXMA 5FLMJ 1HBXG 4IHYA 3OYGA 4QWQA 2JUCA 4AIJA 5B5EC 5E20A 5IOYA 4FCYA 3RZOJ 3D5LA 1O57A 1WGXA 2XPWA 3ZQHA 1P2FA 4HX4A 1LVKA 2OZ6A 3FXKA 1ZARA 3DTEA 2L7FP 1W5CC 3COAC 2ZJRF 3GUDA 4M3DA 1LE8B 1GUUA 5TJJA 4XLNF 2R5YA 4A3IJ 2HKXA 2W84A 5DAJA 1ZTRA 1N25A 3S17J 1LFUP 4HAMA 2O5RA 3IRRA 5L3EA 5JLXA 2Q2EA 2OA4A 1VQ9I 5F0CA 3FMSA 1O3RA 2DFIA 1M1EB 5CVIA 1K78A 3VIBA 1Y0UA 4ZYEA 1N77A 1S7AA 1Z05A 1H89C 4PJJA 2XKPA 2KLOA 4B09A 2HVRA 2V1UA 2DW4A 4IX7A 2V9VA 2PJRA 3HSFA 2A5WA 2V26A 3DF8A 5B66C 5D6FA 2V6EA 2ELHA 4M9XA 1YRNB 2UXIA 5M3MJ 3CCJI 3L2WA 3E6CC 4V2GA 5D5UB 3FIWA 3M3YJ 3M9AA 4D0PA 1ENHA 2ZBKA 4I2OA 1ON1A 3CMAI 4ZC3A 2K9LA 5J40A 4G7HF 1H8AC 2BZTA 2XGCA 4CYCB 1QA6A 4MFDA 3C2BA 1FBQA 4E70A 1U5TB 4ZYDA 3S1QJ 3CP8A 4IHSA 2RASA 2O9LA 1V3FA 2EFOA 3KKDA 4B43A 5EZGA 1UI6A 5M5YJ 3OSFA 1LPQA 1WVRA 4N4NB 2X6YA 1GXQA 3GFMA 5DV5A 1WJDA 1VQ5I 2DBBA 2EZKA 1D5YA 2G7UA 5FJ8J 2LTPA 2M4KA 1P92A 1IN4A 2X4HA 4Y33A 5LEJA 2X85A 1JUMA 3FRQA 3BPVA 2DA5A 2XGEA 1SVOA 3OIPA 3GEUA 1Y1VJ 5J6XA 4LB5A 1O7FA 2V9KA 1HW2A 1SFXA 2Z16A 4PUSA 3V8KA 2DK5A 2FX0A 4ZDOA 4YZEA 1RR7A 3S8PA 3ISPA 3U21A 4CSWA 3J80Z 1ACIA 1ETKA 4NNJA 2V57A 1JGGA 2QWTA 3SQNA 4A0ZA 1UHSA 5E1WA 3KZYA 2LVSA 1GLNA 4DVYP 2L7KA 3RYPA 2CQKA 4DYCA 1WSUA 1D8JA 2DPUA 3RIRA 3FM3A 3H9GA 5D6EA 4UVCA 2LF7A 2GIZA 3U2RA 3JREA 2FBQA 1OCRH 1UELB 2CUFA 4IEJA 2FNAA 1Z77A 4KNYA 3V4GA 1FOWA 5E8GA 2IS6A 4L62A 3OL3A 3GZ6A 1NK3P 2NVTJ 2OF7A 1J5YA 4KIGA 4NQWA 4PFOA 4A3MJ 1IC8A 3WE2A 3VP5A 3MKZA 3RKQA 2FEZA 1TLHB 3RKXA 3HXLA 2IA1A 2P5LC 1YFHA 3HC7A 4IL6C 4UB6C 2ME0A 3HB9A 3HOUJ 3OYKA 3CUQC 3KX2A 5EGOA 3KKCA 3ASOH 3HRTA 1JGSA 1MIJA 4AC0A 1RRJA 2DG8A 5E18F 3BZKA 3JRBA 1TWHJ 3C3WA 2M5WA 3U1DA 1SVMA 1ZREA 3ML6A 2YUSA 4ABZA 3K6GA 3V42A 5BOXA 1BI2A 2WWYA 4D5FA 1X1CA 3BROA 3ZMDA 2G7SA 2QBYB 1PUFA 1B1BA 3BR1A 4Y3OA 2QKMB 3Q9VA 3EUPA 4IVNA 1F5TA 2HXIA 5J4YA 1RZ4A 1B72B 2EFWA 1JJ6C 4IQ4A 2W53A 2XSDC 4ACIA 4LG3A 2F4IA 2HYFA 4FETA 3LSGA 3BTLA 2DQRA 3HOWJ 4EMSA 1ETOA 4FE7A 4PJ0C 1K83J 4ICHA 1R7JA 1VQLI 5DD4A 3PUBA 3E5UA 4HX8A 4XORA 1SFOJ 1HA8A 1O3TA 4KISA 3DKWA 3S3OA 3Q3SA 4RB2C 1IZ1A 2KISA 3TGNA 3LSPA 5ERIA 2KT0A 3PSFA 1B9NA 2JA8J 1BC8C 4A93J 4YIRX 4BBRJ 4E7KA 3SYTA 3NARA 3I55I 2RGVA 2L3DA 2YSRA 2VOOA 4XRMA 5FGLA 3HOSA 5DM6F 2CFXA 5J8CA 5HOOA 3M1EA 1K4SA 1PJRA 1RNLA 2HS5A 2H1LA 3VDXA 3BDDA 3OYIA 3EETA 3NNRA 5CPRB 3AFHA 4ANJA 3AQSA 3SEZA 2M4GA 2IT0A 3FZVA 1O4XA 1D0YA 5H6QA 1SGMA 5AIQA 3M7GA 2B3WA 2ZKZA 5IPAA 2A68F 3HDDA 1Q1HA 1D3YA 2QGUA 3LOCA 4YEJA 3TW7A 3BOQA 1N78A 5J4VA 2CQXA 5IP6A 3MKWB 5AONA 3SFIA 5FB2A 2FMYA 3QYEA 2TRTA 3O8HA 1ZQ3P 1X19A 2WTEA 4DW6A 2M45A 1I3QJ 2IGNA 4JYKA 1CF7B 4YFXF 1JTXA 2DAOA 1XSDA 1BR4A 4RB3C 1TNTA 1IDZA 4WWCA 4P9UA 3S15J 2HZDA 2QCOA 3HKZA 2H27A 3W6VA 3RPUA 2HPMA 3HSRA 1B6AA 1LEAA 2CW7A 1ZG3A 4CXFA 1R58A 1IRXA 2M0CA 1SD7A 2HDCA 2CUJA 2VPRA 4I98B 2NS7A 4LIVA 1MSFC 2HDDA 3HTAA 4XKVA 2WAQN 2RHAA 3RPQA 2XPVA 1G8XA 2P81A 3P9TA 4RM2A 4XNFA 3GXOA 1PUEE 1B8IA 4KYWA 1R22A 2HQRA 1X1DA 1FYMA 3JCUC 5GTIC 1O3QA 1NK2P 4I76A 5F27A 3G3ZA 2EV6A 1I50J 1FNNA 4HZFA 3KZ9A 4EJVA 3A03A 2O3FA 4U0VA 4RGXA 5B3SH 3FKIJ 3ZMZA 5HNHA 3K4BA 2PG4A 1ZH5A 4LK1F 1IG7A 3L09A 3SHFA 3ABLH 3HBLA 2ELKA 4FTHA 2KJBA 1R6RA 4HNTA 4L5JA 3QPTA 3MNLA 5ILUA 5F0FA 1W4MA 2F4OB 4LB6B 2NVQJ 2IGOA 2RNJA 4AYBN 4C3IJ 3RKWA 1AOYA 3QOEA 2MGQA 5EG0B 1ZG5A 3DPJA 2W00A 4PFPA 1XX5A 2EBIA 1BW5A 2ZJQF 1Z3YA 3IWZA 1R4MB 3LQRA 2XROA 1U9NA 1Z9CA 2A6HF 4CCOA 3E0JB 2VUMJ 3KP5A 1R5ID 1REPC 3I4MJ 1DUXC 2W1OA 1BIAA 2VT2A 3HTUA 3WTSC 1LQ1A 3BG5A 4BL0B 3DPLC 4BDYA 3SJMA 1K7AA 4LG0B 5DDGA 2XSJC 2ETHA 1P7JA 1C0WA 2DFHA 3GFJA 4AIKA 2Y48A 4NC6A 1A31A 1XMXA 3ANPA 5HDGA 4CUGA 3WGIA 2CQNA 2UXOA 4KITB 3OS2A 3OYLA 3PNYA 2VPLA 4L9VA 4HKUA 1R4NB 3EQLF 2CWEA 2LH9A 3DXJF 3ZQ7A 1VQNI 2IPQX 3QODA 3MD2A 4A6EA 3MWMA 5D4SA 3GTPJ 5HSZA 2GOXB 2RNGA 2LBFB 1SMYF 2R93J 2DCEA 4XOPA 3SDGA 2XKOA 2LOOA 2LD5A 5FROA 1D0XA 2LK2A 2Y9YA 2MH9A 2G3BA 2DOEA 2HTSA 1AA7A 2QF7A 4UUVA 3HPGA 3S1MJ 9ANTA 4HV6A 1HDDC 5CVUA 3H5AA 2E2HJ 2M9HA 1D1AA 1JT0A 4A12A 3GMEA 4ESBA 5EFYA 2DT6A 1IRFA 4LFUA 2VONA 1FYKA 2KDOA 5AIPA 2VJJA 2O6GE 3T1BA 1D0ZA 3PQKA 1LJ9A 5E1XA 5E8IA 3ZPLA 3JSPA 1TWFJ 3I59A 4HSTA 2XRLA 1DPUA 3CRJA 3SZGA 2VQCA 4CCMA 3MZYA 5GAEJ 4AVZA 4X0GA 5H2FC 1BR2A 3GZ5A 1KZHA 2W48A 1WHUA 5E3NA 3J7AY 5HS7A 3KP7A 3OYAA 3PFIA 3QPLA 4LLGF 3I56I 1ZELA 3DBRB 4FX4A 1X3ZB 3OL4A 1YE9A 1L0OC 2L4MA 5L3CA 1E0EA 1T98A 1QPMA 4DYQA 3MEXA 1WH5A 1D8KA 3HOYJ 3BJAA 3F6VA 2STTA 5JI6A 4LMYA 5J3LA 3ECOA 4LD5A 3JRGA 1ZR2A 4WF2A 3BPXA 1LUJB 2O61A 2K27A 2ZCWA 2D2WA 4R79A 1YW7A 2DMTA 3P5JA 1X58A 3DTIA 4HYEA 1FYLA 1ZGAA 2R5ZB 3CLQA 1HKQA 1ZR4A 1N75A 1A36A 3VW1A 3CCYA 2XRNA 1KONA 2C6YA 4E7SA 3A02A 2CU7A 3I3LA 2W57A 4JOMA 1FSEA 2Y9ZA 4A6DA 3FXJA 4BY1J 1FY7A 2YS9A 2M2EA 2ESHA 1VQ7I 1YITI 2FJI1 2O7OA 2JRMA 2V1XA 4BEHB 2FD5A 2LRDA 3KZZA 2EIKH 4N9IA 3E5QA 3KFWX 1I27A 4BE1A 3HHGA 2HZTA 2M3AA 3TO7A 2IGKA 4LGWA 1GV5A 3TOAA 5D8LB 4GGGA 1YJ9I 3WHCA 3VYTB 4MNUA 5LEKA 1BIBA 1Z7LA 5FMPA 1IXCA 2LF8A 2ZFWA 3DPTA 1R23A 3EUAA 3BWGA 2K85A 1ZYRF 3A0BC 5EEGA 4X1EA 3Q0WA 3VYUB 3CWRA 5IP9J 3IV5A 3BRUA 4UXNA 2LYCA 1KU3A 4A3GJ 3B81A 3PFYA 1I1GA 1XCVA 2JVHA 2COMA 4FQGA 2XF6A 3BZCA 4A69C 5C4JJ 1QRYA 3PPBA 1X3WB 3HUGB 2EZLA 3ABUA 3K0LA 1U8RA 2E1NA 1IV8A 2VXZA 1HC8A 1GHCA 3H35A 1KQ8A 4W1UA 2OC6A 3I9V2 1OCCH 2E34A 1TT5B 2QSFX 4EGYA 2XUBA 1JKPC 3CP2A 1W1WE 4NHJA 3H0DA 2LR8A 2G7LA 3LHQA 2GOMA 5ED4A 3QU3A 4HF2A 2W7NA 4G6TB 5IY5H 3VTIA 3PNVA 4P96A 1OR7A 3RZDJ 3HZJA 2EZHA 2LREA 2VI6A 2NYXA 4D9JA 2GXAA 3OY9A 2GBYA 1J09A 4EJWA 2FJ1A 4C30A 2R7VA 4KN4X 2D1HA 4U0YA 4JL3A 3DLLF 1WI3A 1JUSA 1MGTA 3I4PA 1CGPA 3BQYA 2FOKA 4R1HA 4EJOA 4BQAA 5K5QA 5GAGJ 3DKYA 2Z99A 4BACA 2I10A 3KIOA 2RN7A 1HCRA 3NAUA 4DNCA 1QU3A 2IXSA 2Z2SB 3CJQB 1MDMB 4BBSJ 2LLKA 4C3HJ 4WIBA 3K4NA 2AXLA 1FTZA 4MIMA 3GEZA 4HRIA 1UHMA 2VASA 3RYRA 3EUHC 3K7AJ 2HOSA 1T6SA 1MNDA 3ABTA 2JUGA 3LMMA 2EH3A 3F0CA 5KCMA 5HAWA 2BGCA 2P8TA 2VXDA 3KNWA 3CCRI 2QWWA 1ZG1A 3T8TA 2CYYA 3ZR8X 2ZNZA 2V79A 1BI0A 2XB5A 3K4CA 4I09A 5K7HA 4IRGA 3CC7I 2BY0A 4GRIA 3DU6A 1DP3A 2X1CA 3J80K 5CVRA 4A3KJ 4A3FJ 3S1RJ 4JX5A 2IS2A 2H09A 2GIVA 2EIMH 3F3XA 1XDUA 3S1NJ 4G7OF 3H5RA 3LSMA 3C2GA 2MFZA 3C1DA 2KRHA 3F8CA 1ORKA 1J59A 1WI9A 3M8FA 2RVCA 1P4AA 3LFUA 1Y39A 1YJWI 2GQQA 1UG2A 3J81K 2HQNA 3I64A 4IHTA 5J47A 3AG1H 5F0HA 1BR1A 1FOXA 3FMRA 4J19A 1UG0A 4CH7A 2ZC2A 1SAXA 2VJ5A 2FE3A 3L2VA 3L2RA 4XKCA 1ETQA 1DU0A 2PX9A 2A69F 4FASD 4XLFA 4KWAA 1MMNA 2NNNA 3VW0A 5LRRA 3VOKA 3SXYA 3AG3H 1FZPB 1OISA 2R7SA 2QQAA 2XC7A 2G7HA 3RH2A 1UMQA 2DA7A 5CXIA 1WQ2A 2QM3A 4C2TA 1OQYA 1K4TA 3IH4A 2OZUA 1VF9A 2G0EA 5J1YA 3WGHA 1ZHFA 3FKJA 3HRUA 5FKLA 1Y8QB 3CCSI 2IVMA 3RSNA 2OI8A 2YVXA 1FBSA 4A0XA 4A2UA 4MQ9F 3DTKA 5L3DA 2G9WA 3MZHA 3HPHA 1QO0D 3K1NA 4JK1X 2GAUA 1DU6A 4RDUA 2VODA 2OD5A 1BN5A 1VNDA 1BJZA 4OIRF 2DJNA 1ZRCA 2ZMEB 5HDNA 3BC8A 4UUTA 1YRNA 2PMUA 4BDZA 1AKHA 4EJTA 2DT7B 3BR0A 2ME6A 3W2VA 5EEHA 1IN5A 5BQTA 1MH3A 2P5KA 4ZZLA 4XN3A 1R5HA 1TWCJ 5LGNA 3S2HJ 3K4MA 5KNLA 2UXUA 2B1EA 1LKXA 3S2DJ 3F8NA 4QIWN 5JHUA 4UNOA 1G3YA 4P1WA 2VKHA 4EM0B 1GVJA 3L2CA 1VI0A 4RA2A 3Q0UA 2EPFA 1TWAJ 4HQMA 2QEXI 4AF5A 3MFKA 4L0YB 4Q4ZF 1B59A 2BW3A 5LGTA 3RJPA 3LSTA 2VKEA 5HDKA 3K4LA 3OWTA 2KRFA 4LITA 3FBNB 4MO7A 4XLCA 1OPCA 2LSOA 2VKDA 2XF5A 2PBIA 5HLGA 4XRSA 3P9IA 3K2ZA 1RIOH 3FXLA 4P5OA 1Z0XA 4JBAA 4G7ZF 2MA3A 3F8BA 2V4JC 1D5VA 5TISC 1P9QC 2WA0A 3W6KB 3TBIA 2WADA 4JX6A 4L5IA 2ZXWH 3GZIA 1JHFA 2D5VA 1GV2A 2R5YB 2R7XA 1W7PA 1MJAA 4EGZA 1HDPA 4BKXA 5IYDJ 4DJAA 2JA6J 5M5XJ 3WG9A
chains in the Genus database with same CATH topology
2R5ZA 1O4XA 2MSYA 1GT0C 4GFLA 1SGMA 4L5EA 2PZ9A 5IPAA 3H0GJ 4FE4A 2LKXA 3HDDA 5H9TA 1OCPA 4XICA 3LOCA 5F1JA 3TW7A 3Q0VA 3S14J 2CQXA 5IP6A 5HODA 1JJ8C 1JKRC 1S7EA 3T6NA 3SFIA 5JLWA 3O60A 2TRTA 3O8HA 1ZQ3P 2HQ5A 4DW6A 3VUQA 1I3QJ 4JYKA 2CRGA 2PBXA 2TCTA 1JTXA 2DMUA 2JN6A 1Y1WJ 2DMNA 1IDZA 3JRHA 1POGA 3S15J 3BR5A 1SANA 3GTOJ 1RPWA 2QCOA 5J1UA 3W6VA 2E2IJ 1H88C 2JA5J 1IDYA 2M0CA 3IH2A 2VPRA 1IRZA 2NS7A 2NS8A 1MSFC 3RQIA 4XRSG 2Y0SN 2HDDA 1HOMA 2OERA 3HTAA 4GFKA 2NVXJ 2YVHA 2WAQN 2RHAA 1QPIA 2XPVA 2P81A 2LFBA 1X2NA 2B63J 3P9TA 2K40A 3JR9A 1B8IA 3HEFA 4GFBA 2IEKA 3V6GA 1IUFA 4M6VA 5EEAA 2E2JJ 1NK2P 4I76A 1OJLA 3GTQJ 5F27A 2HKUA 5CW8A 1I50J 2ID3A 3KZ9A 5IYCJ 3A03A 4QSHA 1LE8A 1ETXA 3FKIJ 2CQQA 3MN2A 1IG7A 3O8GA 2JK3A 3JRDA 5M5WJ 3COLA 3HBLA 1ETWA 2ELKA 4FTHA 1APLC 1RETA 3JRFA 3MNLA 5F0FA 4JX4A 3HOZJ 2JMWA 2ECCA 2NVQJ 1ETYA 1JT6A 4D7NA 3OOUA 4AYBN 1XS9A 4C3IJ 2GUHA 2MGQA 3TP0A 5EG0B 3QKXA 4BY7J 2VKVA 3DPJA 4MK6A 3HGYA 3L1PA 4A3CJ 2EBIA 1BW5A 3NXCA 3BG3A 3HIMA 3I4NJ 2HI3A 4MFEA 4NELA 1U9NA 2ZB9A 3E7QA 2NVYJ 2VUMJ 3JRCA 4AC6A 3GTJJ 5DS9A 3IH3A 3I4MJ 3BR2A 1LFBA 1Q1VA 4CYCA 2AHQA 3PO3J 1TWGJ 4JNNA 1EF4A 4AUXA 3BG5A 2XGDA 3SJMA 3PM1A 1FTTA 3BNIA 5IYBJ 3OSGA 3CDLA 3BG9A 1P7JA 2DA3A 2DMPA 5EGOB 3ANPA 1ITYA 3HTHA 2UXOA 4M3EA 1WH7A 3HKZN 3NRGA 5EF6A 2QTQA 1P7IA 5HBUA 3OIOA 1BW6A 5F04A 3BHQA 4HKUA 2HOTA 1U8BA 2WB1N 3BT9A 3G1LA 1AU7A 4V2FA 2Q24A 2DA4A 4BXXJ 4D5CA 2WUIA 5FLVA 3IUVA 5HSZA 1R9TJ 3GTPJ 3E7LA 2ZCMA 1OCTC 2R93J 1HF0A 4NDLA 1W0TA 3SDGA 5J1RA 2LD5A 2IBDA 2LK2A 2Y9YA 2H8RA 2G3BA 1AKHB 2DG7A 3NPIA 2QF7A 2ID6A 1PUFB 3CMYA 4DYRA 3S1MJ 9ANTA 1HDDC 2LY9A 2O7TA 3K2AA 2E2HJ 2X6OA 2M9HA 1JT0A 5EFYA 1U9OA 3A01A 3JRIA 3VW2A 5K7ZA 5GPAA 2M8GX 5EZHA 2LP0A 3BTCA 3JRAA 3VVZA 1TWFJ 3TP3A 2XRLA 4B4CA 3CRJA 3UKGA 2Y2ZA 1T33A 1CQTA 2F07A 4GCLA 2GFNA 3C07A 4C3JJ 2W48A 3DCFA 5E3NA 5EYRA 3TEDA 3QPLA 1ETVA 2X9DA 2DA1A 5C4YA 5F08A 3HTJA 4A3BJ 2EZIA 3ANGA 1JUPA 4DYQA 4M3BA 2UXHA 1WH5A 2XB0X 3GTGJ 2MG4A 3HOYJ 1E3OC 2L7ZA 2X48A 3V78A 5J3LA 1GDTA 2QOPA 2QKOA 3AQTA 3JRGA 1ZR2A 5IP7J 4UUSB 5C4XJ 1MBKA 1IJWC 4JP0A 4MXMA 2XDNA 4DZJA 2DMTA 1X58A 2R5ZB 2HYJA 1MBFA 4QTRA 2M34A 1ZR4A 1MBJA 1WPKA 3VW1A 5FHPA 1F36A 1MBEA 3CCYA 3H3VK 1WCMJ 2OPTA 3A02A 2CU7A 4CGRA 3FK6A 3B6AA 2Y9ZA 4BY1J 4C2MJ 2E1OA 2JWTA 2M2EA 2YS9A 1B72A 3VPRA 5CXGA 2O7OA 5D1RA 1FIAA 1F43A 3CQZJ 4S0HB 2DA6A 3BCGA 2FD5A 3GTKJ 3HE0A 1XG1A 3CJDA 5E3LA 1JKOC 4XK4A 3ZQCA 3PO2J 2HYTA 1RKTA 1MH4A 3DEWA 2H1KA 2WV1A 1GV5A 3BR3A 4Y52J 4UDSA 2N8GA 3ON4A 3WHCA 3G56A 1TC3C 5D18A 2K9QA 1BL0A 3QQAA 5FMPA 3MKLA 4M3GA 3GTLJ 2DA2A 1B8IB 4X1EA 1ZK8A 3Q0WA 5GP9A 5FLMJ 1U78A 4IHYA 3CWRA 5IP9J 3IV5A 3BRUA 4FCYA 5IOYA 3RZOJ 4A3GJ 3D1NI 3B81A 3S16J 1WGXA 2XPWA 3ZQHA 5FKOA 1MSEC 4G12A 1MBHA 2L7FP 1LE8B 4M3DA 3HGGA 4A69C 5IOZA 5C4JJ 1QRYA 1G2HA 3PPBA 1A6IA 1GUUA 2R5YA 5K58A 2EZLA 4A3IJ 4D7MA 5DAJA 1ZTRA 2EQRA 1AHDP 3S17J 1LFUP 4W1UA 1HLVA 4A3DJ 4PXIA 3BTJA 5JLXA 1BA5A 3GBGA 4GCKA 2DMQA 5F0CA 3ON2A 1JKPC 3VIBA 2QIBA 1VFCA 5GPCA 2CUEA 2GM4A 2LR8A 2G7LA 3LHQA 4B3AA 1H89C 3HOVJ 2Y31A 3LNQA 4NN1A 3RZDJ 3G1MA 1MBGA 2EZHA 1QVTA 3FK7A 2VI6A 4IHXA 1YRNB 2UXIA 2NP3A 2GBYA 5M3MJ 4A3LJ 2RAEA 2FJ1A 4V2GA 1NTCA 3FIWA 2YU9J 2MW8A 2K9SA 4JL3A 3M3YJ 1WI3A 1ENHA 1JUSA 2K9NA 3BQYA 2GLOA 2JJ7A 1H8AC 2XGCA 4CYCB 2I10A 4MFDA 3LSRA 3C2BA 1HCRA 3NAUA 1IGNA 4X6AJ 3S1QJ 1UI5A 2RASA 4ME9A 2O9LA 5C44J 3KKDA 2L9RA 2LLKA 5EZGA 4BBSJ 5M5YJ 3OSFA 4C3HJ 1UI6A 1JKQC 5FKMA 2EZKA 1D5YA 1I6HJ 1FTZA 4MIMA 5FJ8J 2LTPA 3S5RA 1JUMA 3FRQA 3K7AJ 2HOSA 4IHVA 1FIPA 2DA5A 2EH3A 2XGEA 3ZQIA 3F0CA 3GEUA 4A3EJ 1Y1VJ 5HAWA 3LWJA 1W0UA 3KNWA 1A5JA 4JKZA 3M4OJ 2ZOYA 3ZQFA 2ZOZA 5DTDA 4A3JJ 2FX0A 4XIDA 4YZEA 1RR7A 2XB5A 5K7HA 5E3OA 1ETKA 2V57A 4IHWA 1JGGA 2D6YA 2GENA 2FQ4A 2QWTA 4A3KJ 1T56A 3HOXJ 4A3FJ 4JX5A 3S1RJ 3VOXA 1UHSA 1ZKGA 2LVSA 3F1BA 3ZQGA 3S1NJ 3WHBA 5BNGA 3BQZA 4DYCA 3A01B 2ZCXA 1ORKA 1K61A 5EG0A 5AQCA 3JREA 4Y7NJ 1UG2A 4EEFG 2FBQA 3G7RA 2CUFA 4IEJA 5F0HA 1Z77A 1RESA 4L62A 3HM5A 2CJJA 2UXPA 4FISA 4J19A 1NK3P 2NVTJ 1DU0A 1ETQA 2OF7A 3LJLA 2R7ZJ 4A3MJ 1IC8A 2E19A 3VP5A 4KWAA 3RKQA 3VOKA 3VW0A 3QPSA 3MVPA 2KDZA 3RH2A 1UMQA 2AO9A 4HNVA 2DA7A 5CXIA 3BTIA 5EDNA 1FEXA 2ME0A 3HB9A 3HOUJ 3IH4A 3VVYA 3TW6A 1VF9A 2G0EA 5EGOA 5J1YA 3KKCA 2YVEA 2O8KA 5FKLA 2DG8A 4AC0A 3JRBA 5FKKA 1TWHJ 4W97A 2OI8A 2JA7J 4GCTA 2R92J 2DN0A 5K7FA 2YUSA 4ABZA 2IAIA 3BR6A 1DU6A 2R0QC 4RDUA 4D5FA 1VNDA 1BJZA 2DJNA 3G1OA 1JTYA 4B1RA 1FJLA 5D19A 3VVXA 2DTZA 2L0KA 4UUTA 1YRNA 1RKWA 2Y30A 1AKHA 2NX4A 2G7SA 3BR0A 4LOCA 3GTMJ 2ME6A 4MLOA 3LSJA 1OFCX 3BR1A 1MH3A 1PUFA 2REKA 3EUPA 2HXIA 5M3FJ 5E3MA 1B72B 1TWCJ 1JJ6C 3S2HJ 2W53A 1MNMC 2XSDC 2HXOA 4ACIA 2UXUA 3S2DJ 4QIWN 2ECBA 3LSGA 3BTLA 3ZQLA 3RD3A 3HOWJ 1ETOA 1VI0A 4FE7A 1K83J 3Q0UA 1TWAJ 4ICHA 4DZPA 4AF5A 2IU5A 2COBA 2ZCNA 4RBOA 1SFOJ 2VKEA 1QVUA 3JSJA 1XC5A 4MO7A 3Q3SA 3LSPA 2KT0A 3B6CA 2JA8J 4XRSA 4A93J 1IV6A 4BBRJ 5C3EJ 1GVDA 1ZGWA 2PMZN 3NARA 2XPUA 2G7GA 1Z0XA 5FKNA 2HOAA 3QBMA 3NI7A 4XRMA 5FGLA 4JX6A 2WGBA 2NP5A 3GZIA 3PASA 2L7MP 4I6ZA 1GV2A 2D5VA 2R5YB 4UUSA 4M3FA 3BJBA 1X2MA 3FISA 1HDPA 2NOGA 3ZOBA 4BKXA 5IYDJ 3NNRA 3AQSA 3EGQA 2JA6J 5M5XJ 3HTIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R5Z A;  1O4X A;  2MSY A;  1GT0 C;  4GFL A;  1SGM A;  4L5E A;  2PZ9 A;  5IPA A;  3H0G J;  4FE4 A;  2LKX A;  3HDD A;  5H9T A;  1OCP A;  4XIC A;  3LOC A;  5F1J A;  3TW7 A;  3Q0V A;  3S14 J;  2CQX A;  5IP6 A;  5HOD A;  1JJ8 C;  1JKR C;  1S7E A;  3T6N A;  3SFI A;  5JLW A;  3O60 A;  2TRT A;  3O8H A;  1ZQ3 P;  2HQ5 A;  4DW6 A;  3VUQ A;  1I3Q J;  4JYK A;  2CRG A;  2PBX A;  2TCT A;  1JTX A;  2DMU A;  2JN6 A;  1Y1W J;  2DMN A;  1IDZ A;  3JRH A;  1POG A;  3S15 J;  3BR5 A;  1SAN A;  3GTO J;  1RPW A;  2QCO A;  5J1U A;  3W6V A;  2E2I J;  1H88 C;  2JA5 J;  1IDY A;  2M0C A;  3IH2 A;  2VPR A;  1IRZ A;  2NS7 A;  2NS8 A;  1MSF C;  3RQI A;  4XRS G;  2Y0S N;  2HDD A;  1HOM A;  2OER A;  3HTA A;  4GFK A;  2NVX J;  2YVH A;  2WAQ N;  2RHA A;  1QPI A;  2XPV A;  2P81 A;  2LFB A;  1X2N A;  2B63 J;  3P9T A;  2K40 A;  3JR9 A;  1B8I A;  3HEF A;  4GFB A;  2IEK A;  3V6G A;  1IUF A;  4M6V A;  5EEA A;  2E2J J;  1NK2 P;  4I76 A;  1OJL A;  3GTQ J;  5F27 A;  2HKU A;  5CW8 A;  1I50 J;  2ID3 A;  3KZ9 A;  5IYC J;  3A03 A;  4QSH A;  1LE8 A;  1ETX A;  3FKI J;  2CQQ A;  3MN2 A;  1IG7 A;  3O8G A;  2JK3 A;  3JRD A;  5M5W J;  3COL A;  3HBL A;  1ETW A;  2ELK A;  4FTH A;  1APL C;  1RET A;  3JRF A;  3MNL A;  5F0F A;  4JX4 A;  3HOZ J;  2JMW A;  2ECC A;  2NVQ J;  1ETY A;  1JT6 A;  4D7N A;  3OOU A;  4AYB N;  1XS9 A;  4C3I J;  2GUH A;  2MGQ A;  3TP0 A;  5EG0 B;  3QKX A;  4BY7 J;  2VKV A;  3DPJ A;  4MK6 A;  3HGY A;  3L1P A;  4A3C J;  2EBI A;  1BW5 A;  3NXC A;  3BG3 A;  3HIM A;  3I4N J;  2HI3 A;  4MFE A;  4NEL A;  1U9N A;  2ZB9 A;  3E7Q A;  2NVY J;  2VUM J;  3JRC A;  4AC6 A;  3GTJ J;  5DS9 A;  3IH3 A;  3I4M J;  3BR2 A;  1LFB A;  1Q1V A;  4CYC A;  2AHQ A;  3PO3 J;  1TWG J;  4JNN A;  1EF4 A;  4AUX A;  3BG5 A;  2XGD A;  3SJM A;  3PM1 A;  1FTT A;  3BNI A;  5IYB J;  3OSG A;  3CDL A;  3BG9 A;  1P7J A;  2DA3 A;  2DMP A;  5EGO B;  3ANP A;  1ITY A;  3HTH A;  2UXO A;  4M3E A;  1WH7 A;  3HKZ N;  3NRG A;  5EF6 A;  2QTQ A;  1P7I A;  5HBU A;  3OIO A;  1BW6 A;  5F04 A;  3BHQ A;  4HKU A;  2HOT A;  1U8B A;  2WB1 N;  3BT9 A;  3G1L A;  1AU7 A;  4V2F A;  2Q24 A;  2DA4 A;  4BXX J;  4D5C A;  2WUI A;  5FLV A;  3IUV A;  5HSZ A;  1R9T J;  3GTP J;  3E7L A;  2ZCM A;  1OCT C;  2R93 J;  1HF0 A;  4NDL A;  1W0T A;  3SDG A;  5J1R A;  2LD5 A;  2IBD A;  2LK2 A;  2Y9Y A;  2H8R A;  2G3B A;  1AKH B;  2DG7 A;  3NPI A;  2QF7 A;  2ID6 A;  1PUF B;  3CMY A;  4DYR A;  3S1M J;  9ANT A;  1HDD C;  2LY9 A;  2O7T A;  3K2A A;  2E2H J;  2X6O A;  2M9H A;  1JT0 A;  5EFY A;  1U9O A;  3A01 A;  3JRI A;  3VW2 A;  5K7Z A;  5GPA A;  2M8G X;  5EZH A;  2LP0 A;  3BTC A;  3JRA A;  3VVZ A;  1TWF J;  3TP3 A;  2XRL A;  4B4C A;  3CRJ A;  3UKG A;  2Y2Z A;  1T33 A;  1CQT A;  2F07 A;  4GCL A;  2GFN A;  3C07 A;  4C3J J;  2W48 A;  3DCF A;  5E3N A;  5EYR A;  3TED A;  3QPL A;  1ETV A;  2X9D A;  2DA1 A;  5C4Y A;  5F08 A;  3HTJ A;  4A3B J;  2EZI A;  3ANG A;  1JUP A;  4DYQ A;  4M3B A;  2UXH A;  1WH5 A;  2XB0 X;  3GTG J;  2MG4 A;  3HOY J;  1E3O C;  2L7Z A;  2X48 A;  3V78 A;  5J3L A;  1GDT A;  2QOP A;  2QKO A;  3AQT A;  3JRG A;  1ZR2 A;  5IP7 J;  4UUS B;  5C4X J;  1MBK A;  1IJW C;  4JP0 A;  4MXM A;  2XDN A;  4DZJ A;  2DMT A;  1X58 A;  2R5Z B;  2HYJ A;  1MBF A;  4QTR A;  2M34 A;  1ZR4 A;  1MBJ A;  1WPK A;  3VW1 A;  5FHP A;  1F36 A;  1MBE A;  3CCY A;  3H3V K;  1WCM J;  2OPT A;  3A02 A;  2CU7 A;  4CGR A;  3FK6 A;  3B6A A;  2Y9Z A;  4BY1 J;  4C2M J;  2E1O A;  2JWT A;  2M2E A;  2YS9 A;  1B72 A;  3VPR A;  5CXG A;  2O7O A;  5D1R A;  1FIA A;  1F43 A;  3CQZ J;  4S0H B;  2DA6 A;  3BCG A;  2FD5 A;  3GTK J;  3HE0 A;  1XG1 A;  3CJD A;  5E3L A;  1JKO C;  4XK4 A;  3ZQC A;  3PO2 J;  2HYT A;  1RKT A;  1MH4 A;  3DEW A;  2H1K A;  2WV1 A;  1GV5 A;  3BR3 A;  4Y52 J;  4UDS A;  2N8G A;  3ON4 A;  3WHC A;  3G56 A;  1TC3 C;  5D18 A;  2K9Q A;  1BL0 A;  3QQA A;  5FMP A;  3MKL A;  4M3G A;  3GTL J;  2DA2 A;  1B8I B;  4X1E A;  1ZK8 A;  3Q0W A;  5GP9 A;  5FLM J;  1U78 A;  4IHY A;  3CWR A;  5IP9 J;  3IV5 A;  3BRU A;  4FCY A;  5IOY A;  3RZO J;  4A3G J;  3D1N I;  3B81 A;  3S16 J;  1WGX A;  2XPW A;  3ZQH A;  5FKO A;  1MSE C;  4G12 A;  1MBH A;  2L7F P;  1LE8 B;  4M3D A;  3HGG A;  4A69 C;  5IOZ A;  5C4J J;  1QRY A;  1G2H A;  3PPB A;  1A6I A;  1GUU A;  2R5Y A;  5K58 A;  2EZL A;  4A3I J;  4D7M A;  5DAJ A;  1ZTR A;  2EQR A;  1AHD P;  3S17 J;  1LFU P;  4W1U A;  1HLV A;  4A3D J;  4PXI A;  3BTJ A;  5JLX A;  1BA5 A;  3GBG A;  4GCK A;  2DMQ A;  5F0C A;  3ON2 A;  1JKP C;  3VIB A;  2QIB A;  1VFC A;  5GPC A;  2CUE A;  2GM4 A;  2LR8 A;  2G7L A;  3LHQ A;  4B3A A;  1H89 C;  3HOV J;  2Y31 A;  3LNQ A;  4NN1 A;  3RZD J;  3G1M A;  1MBG A;  2EZH A;  1QVT A;  3FK7 A;  2VI6 A;  4IHX A;  1YRN B;  2UXI A;  2NP3 A;  2GBY A;  5M3M J;  4A3L J;  2RAE A;  2FJ1 A;  4V2G A;  1NTC A;  3FIW A;  2YU9 J;  2MW8 A;  2K9S A;  4JL3 A;  3M3Y J;  1WI3 A;  1ENH A;  1JUS A;  2K9N A;  3BQY A;  2GLO A;  2JJ7 A;  1H8A C;  2XGC A;  4CYC B;  2I10 A;  4MFD A;  3LSR A;  3C2B A;  1HCR A;  3NAU A;  1IGN A;  4X6A J;  3S1Q J;  1UI5 A;  2RAS A;  4ME9 A;  2O9L A;  5C44 J;  3KKD A;  2L9R A;  2LLK A;  5EZG A;  4BBS J;  5M5Y J;  3OSF A;  4C3H J;  1UI6 A;  1JKQ C;  5FKM A;  2EZK A;  1D5Y A;  1I6H J;  1FTZ A;  4MIM A;  5FJ8 J;  2LTP A;  3S5R A;  1JUM A;  3FRQ A;  3K7A J;  2HOS A;  4IHV A;  1FIP A;  2DA5 A;  2EH3 A;  2XGE A;  3ZQI A;  3F0C A;  3GEU A;  4A3E J;  1Y1V J;  5HAW A;  3LWJ A;  1W0U A;  3KNW A;  1A5J A;  4JKZ A;  3M4O J;  2ZOY A;  3ZQF A;  2ZOZ A;  5DTD A;  4A3J J;  2FX0 A;  4XID A;  4YZE A;  1RR7 A;  2XB5 A;  5K7H A;  5E3O A;  1ETK A;  2V57 A;  4IHW A;  1JGG A;  2D6Y A;  2GEN A;  2FQ4 A;  2QWT A;  4A3K J;  1T56 A;  3HOX J;  4A3F J;  4JX5 A;  3S1R J;  3VOX A;  1UHS A;  1ZKG A;  2LVS A;  3F1B A;  3ZQG A;  3S1N J;  3WHB A;  5BNG A;  3BQZ A;  4DYC A;  3A01 B;  2ZCX A;  1ORK A;  1K61 A;  5EG0 A;  5AQC A;  3JRE A;  4Y7N J;  1UG2 A;  4EEF G;  2FBQ A;  3G7R A;  2CUF A;  4IEJ A;  5F0H A;  1Z77 A;  1RES A;  4L62 A;  3HM5 A;  2CJJ A;  2UXP A;  4FIS A;  4J19 A;  1NK3 P;  2NVT J;  1DU0 A;  1ETQ A;  2OF7 A;  3LJL A;  2R7Z J;  4A3M J;  1IC8 A;  2E19 A;  3VP5 A;  4KWA A;  3RKQ A;  3VOK A;  3VW0 A;  3QPS A;  3MVP A;  2KDZ A;  3RH2 A;  1UMQ A;  2AO9 A;  4HNV A;  2DA7 A;  5CXI A;  3BTI A;  5EDN A;  1FEX A;  2ME0 A;  3HB9 A;  3HOU J;  3IH4 A;  3VVY A;  3TW6 A;  1VF9 A;  2G0E A;  5EGO A;  5J1Y A;  3KKC A;  2YVE A;  2O8K A;  5FKL A;  2DG8 A;  4AC0 A;  3JRB A;  5FKK A;  1TWH J;  4W97 A;  2OI8 A;  2JA7 J;  4GCT A;  2R92 J;  2DN0 A;  5K7F A;  2YUS A;  4ABZ A;  2IAI A;  3BR6 A;  1DU6 A;  2R0Q C;  4RDU A;  4D5F A;  1VND A;  1BJZ A;  2DJN A;  3G1O A;  1JTY A;  4B1R A;  1FJL A;  5D19 A;  3VVX A;  2DTZ A;  2L0K A;  4UUT A;  1YRN A;  1RKW A;  2Y30 A;  1AKH A;  2NX4 A;  2G7S A;  3BR0 A;  4LOC A;  3GTM J;  2ME6 A;  4MLO A;  3LSJ A;  1OFC X;  3BR1 A;  1MH3 A;  1PUF A;  2REK A;  3EUP A;  2HXI A;  5M3F J;  5E3M A;  1B72 B;  1TWC J;  1JJ6 C;  3S2H J;  2W53 A;  1MNM C;  2XSD C;  2HXO A;  4ACI A;  2UXU A;  3S2D J;  4QIW N;  2ECB A;  3LSG A;  3BTL A;  3ZQL A;  3RD3 A;  3HOW J;  1ETO A;  1VI0 A;  4FE7 A;  1K83 J;  3Q0U A;  1TWA J;  4ICH A;  4DZP A;  4AF5 A;  2IU5 A;  2COB A;  2ZCN A;  4RBO A;  1SFO J;  2VKE A;  1QVU A;  3JSJ A;  1XC5 A;  4MO7 A;  3Q3S A;  3LSP A;  2KT0 A;  3B6C A;  2JA8 J;  4XRS A;  4A93 J;  1IV6 A;  4BBR J;  5C3E J;  1GVD A;  1ZGW A;  2PMZ N;  3NAR A;  2XPU A;  2G7G A;  1Z0X A;  5FKN A;  2HOA A;  3QBM A;  3NI7 A;  4XRM A;  5FGL A;  4JX6 A;  2WGB A;  2NP5 A;  3GZI A;  3PAS A;  2L7M P;  4I6Z A;  1GV2 A;  2D5V A;  2R5Y B;  4UUS A;  4M3F A;  3BJB A;  1X2M A;  3FIS A;  1HDP A;  2NOG A;  3ZOB A;  4BKX A;  5IYD J;  3NNR A;  3AQS A;  3EGQ A;  2JA6 J;  5M5X J;  3HTI A; 
#chains in the Genus database with same CATH topology
 2Q2E B;  2CUZ A;  2MSY A;  1MKM A;  1J7K A;  3M1C A;  4XON A;  1MD0 A;  4ZTF A;  2PZ9 A;  1K78 B;  4HA8 A;  1USS A;  4FE4 A;  2FQ3 A;  3SDB A;  3TO9 A;  3CCV I;  1OCP A;  3REO A;  2LKX A;  3TQN A;  5F1J A;  3Q0V A;  2PI0 A;  3QYF A;  3OYE A;  4ZTJ A;  2PJR B;  1S7E A;  3T6N A;  1YX5 A;  2R7O A;  3EUK L;  2K4J A;  5ILV A;  2CRG A;  4E7L A;  2TCT A;  3KLN A;  3KYC B;  3AL0 B;  2DMU A;  1WRJ A;  1VQ8 I;  4B48 A;  3I54 A;  2HQA A;  3BR5 A;  3GTO J;  1R36 A;  1H88 C;  3J81 Z;  5CVJ A;  2PMZ A;  4WXD A;  2WB1 A;  4H0E A;  1ZLK A;  2QSG X;  3SFZ A;  4CDG A;  1IRZ A;  1KU2 A;  3SZP A;  1VZ0 A;  4XRS G;  2OER A;  2Y0S N;  4WCG A;  4GFK A;  2YVH A;  1ZRF A;  1OYY A;  5HLI A;  3G71 I;  2EIJ H;  2LG4 A;  1I6X A;  2LC2 A;  3CJN A;  4AID A;  4OIP F;  2V7F A;  3B02 A;  3NQO A;  4Z6Y A;  2B63 J;  2K40 A;  4IOA F;  3OYM A;  1XSV A;  3JR9 A;  3RCO A;  1ULY A;  3A1Y A;  3HEF A;  5EJC A;  1X4O A;  4F91 B;  4KMF A;  2IEK A;  2R4G A;  4HDV A;  2F5F A;  1IUF A;  4M6V A;  5EEA A;  4BNC A;  2XDV A;  1P4X A;  3TDZ C;  3CME I;  1U3E M;  2TDX A;  1TTY A;  4OU0 A;  2K86 A;  4HV5 A;  2L01 A;  2V1D A;  4AD9 A;  2L9S A;  2RDP A;  2VB6 A;  4EVI A;  3L7W A;  5ICF A;  1VQ6 I;  1PDN C;  2CQQ A;  3MN2 A;  2QBY A;  3O8G A;  3JRD A;  3DP7 A;  4CIC A;  3COL A;  3I5U A;  2XIG A;  4F93 B;  4FHT A;  3AG4 H;  1XGN A;  4U88 A;  3DQV C;  2WY7 Q;  1JE8 A;  2JMW A;  2ECC A;  5F6F A;  1ETY A;  2DK8 A;  5FFZ A;  1DQU A;  1XS9 A;  2Z3Y A;  4BJ6 C;  1BOB A;  2X6W A;  3LSI A;  4BXF A;  2ISY A;  3TP0 A;  4IRI A;  4MK6 A;  2VKV A;  1IF1 A;  4PK4 A;  5FFX A;  3PL8 A;  3CUO A;  1WFX A;  4I7H A;  3I4N J;  2MC3 A;  1XN7 A;  3E1S A;  4KDP A;  5FRN A;  4F55 A;  2ZJP F;  2QUF A;  3E7Q A;  3H3Z A;  2IS4 A;  1HQC A;  2X1E A;  4NQW B;  1EH7 A;  5DS9 A;  1E3H A;  1LDJ A;  5JVT A;  4ENJ A;  3BR2 A;  2KRC A;  1LFB A;  5JR3 A;  2F6C A;  1TWG J;  2X1D A;  3Q9S A;  1EF4 A;  2XGD A;  2MBF A;  2D1V A;  1WJA A;  1FTT A;  3OYN A;  4Y4R A;  1TP4 A;  2IA0 A;  3QRF F;  1U2W A;  4B44 A;  2FBK A;  5GTH C;  2DA3 A;  5EGO B;  4KUM A;  1ITY A;  4NC8 A;  3T8R A;  1D1B A;  1TBX A;  4XLA A;  4QPQ A;  4XLE A;  2H6C A;  2QTQ A;  3KP4 A;  1TQP A;  1BW6 A;  4HPQ A;  5F04 A;  2IP2 A;  4I02 A;  2BXZ A;  3LAP A;  3HOT A;  4V2F A;  4Y15 A;  4HG2 A;  4BXX J;  2WUI A;  2PQ8 A;  4BHB A;  1KGS A;  4XKW A;  3FM5 A;  1HKT A;  4BUP A;  3E7L A;  3EYY A;  2ZCM A;  4NDL A;  1MMD A;  4ZZD A;  1S3J A;  1T2K A;  2KJC A;  4U7B A;  3WTX C;  2A61 A;  2IBD A;  2QYO A;  5CJ9 A;  5H6R A;  1PUF B;  3H9J A;  4F52 A;  4OOI A;  3CCM I;  2XAF A;  3DV8 A;  2I8D A;  2O7T A;  2NOJ B;  1U9O A;  2Q8K A;  3A01 A;  3JRI A;  1WZ2 A;  5K7Z A;  2GWR A;  3GF2 A;  5GPA A;  1BOA A;  4N9H A;  3KPH A;  1IXS B;  2D45 A;  5GAH J;  4C2U A;  5DUI A;  3MZ8 A;  2K3P A;  2HKO A;  4B4C A;  2A6E F;  2Y2Z A;  4BAY A;  4KT5 C;  4OWR B;  1GXP A;  1R5G A;  3C7J A;  3DU5 A;  3RKY A;  2E1C A;  2F07 A;  3VSK A;  4M72 A;  1E2X A;  2VN2 A;  1R71 A;  3T5X A;  4C3J J;  2VOP A;  1KYW A;  2CV0 A;  4HDU A;  3IAM 2;  3HJE A;  3JAM Z;  2X9D A;  4N4O B;  2CW0 F;  5C4Y A;  1IUY A;  4A3B J;  3LSH A;  1OCO H;  5LGU A;  2F4M B;  4CCN A;  2XB0 X;  2ZNY A;  2RQP A;  1P4W A;  1BJA A;  3E3V A;  2L7Z A;  2RV8 A;  3KEQ A;  4XLH A;  4JQF A;  1BM9 A;  3V78 A;  3BY6 A;  3DBL B;  1LB2 A;  2QOP A;  5ILS A;  3HTS B;  5C4X J;  1MBK A;  2F48 A;  4EV0 A;  1FLI A;  1B9M A;  2GA2 A;  1OCZ H;  2FNP A;  1FPQ A;  4AM3 A;  1I39 A;  4M74 A;  2KIU A;  3KEY A;  2M34 A;  3RPU D;  1DP7 P;  2VBW A;  1WPK A;  2W25 A;  2XV4 S;  4O3M A;  1FT9 A;  1V5F A;  1RC9 A;  4NBQ A;  4KJZ A;  2P7V B;  1QGP A;  4BQO A;  1X4P A;  2K9M A;  1K6Y A;  2QLZ A;  3K70 C;  1YHQ I;  3VPR A;  2QQB A;  3PJR A;  4E6K G;  2EFN A;  4S0H B;  4CCL A;  2A5Y B;  4UHT A;  1E17 A;  1XPX A;  1XG1 A;  3ZQC A;  2HYT A;  3KP2 A;  1RKT A;  5HVQ C;  3DEW A;  2H1K A;  2WV1 A;  3WTT C;  3BR3 A;  4UDS A;  3OR2 C;  4M9Z A;  2JQ7 A;  4DQ2 A;  1XB4 A;  1DDN A;  5LHH A;  1BL0 A;  4RLQ A;  2DOD A;  4OAZ A;  2WV0 A;  1VQO I;  1T0F C;  2R7R A;  3V8J A;  1B8I B;  2NRA C;  4HQE A;  1ZK8 A;  3IP4 B;  1U78 A;  1ZGJ A;  3L00 A;  5TGT A;  4YRV A;  2R7W A;  2WY8 Q;  4B3X A;  3E5X A;  2GA1 A;  3OYC A;  3D1N I;  3KZI C;  1T08 B;  3S16 J;  2I5U A;  2LBF A;  3FMQ A;  4FT8 A;  5FKO A;  1MSE C;  4Z2Y A;  1Z7U A;  1HSJ A;  1FMV A;  5JHF A;  3EYI A;  3ZMV A;  2ZME C;  4EQQ A;  4G6D A;  2MLG A;  2L54 A;  4D7M A;  3KYL A;  3D5R C;  2EQR A;  1AHD P;  4M9S A;  3U9G A;  4A3D J;  1RI7 A;  4ZJZ A;  2GZW A;  5CKT A;  3W2W A;  4GCK A;  2ADU A;  4O5V A;  4GO1 A;  1YI2 I;  2KIF A;  3OYB A;  2DLL A;  2VE9 A;  3CC2 I;  3NRV A;  3ELK A;  3ROU A;  1VFC A;  2FBI A;  5LFA A;  1XSX A;  4PSX A;  1Z21 A;  3K4K A;  2Y31 A;  4NC7 A;  1S8N A;  4FX0 A;  5D4R A;  4U9L A;  5H20 A;  1QVT A;  4UVA A;  2HNH A;  2EK5 A;  3FK7 A;  3W6J B;  1W36 D;  4YG2 F;  4IHX A;  4LK0 F;  4QPO A;  2NVU B;  4DGW B;  1XTA A;  1UFM A;  2R7Q A;  2YU9 J;  1A6Q A;  2MW8 A;  2KIM A;  1FC3 A;  2ZSH B;  1JI8 A;  1Y56 A;  2JA2 A;  2VBY A;  3J7Z I;  2VC0 A;  4CCK A;  1YW8 A;  2GLO A;  2JJ7 A;  4RB1 A;  3LSR A;  3F22 A;  5A2Q Z;  2EJR A;  2BXY A;  1U5T C;  1I3A A;  3ABK H;  4KA4 A;  2W24 A;  3HYI A;  2L9R A;  1S72 I;  3CF5 F;  4WX9 A;  4MTE A;  1JKQ C;  4L9N A;  2M30 A;  1XMK A;  1L3L A;  3S5R A;  4IJA A;  1YLF A;  4UV8 A;  2VJI A;  4IHV A;  1FIP A;  4BJT A;  5E1Z B;  2Y75 A;  3G73 A;  4A3E J;  3BZ6 A;  3LWJ A;  3BG6 A;  4Y17 A;  2JT1 A;  4HOB A;  3W3C A;  3M4O J;  4M73 A;  2AS5 F;  3GCM A;  1A5J A;  4Q48 A;  3ZQF A;  1I1S A;  4JKZ A;  3G2B A;  1QQI A;  3K69 A;  4XID A;  5FRM A;  3CUQ A;  5E3O A;  2A07 F;  4I01 A;  1EH8 A;  4IHW A;  2FQ4 A;  1T38 A;  3H3U A;  3HOX J;  1ZKG A;  3AL0 C;  3BJ6 A;  1G3T A;  3W2A A;  3ZRG A;  3CCL I;  2EWN A;  2HVQ A;  2VQL A;  5BNG A;  3OYF A;  1K6O A;  3IL2 A;  2FUG 2;  2ZCX A;  5LLQ A;  3CO7 C;  2CFO A;  5AQC A;  3IRQ A;  4RAZ A;  4EEF G;  4XSX F;  3KCC A;  2IGM A;  1S29 A;  2IJL A;  3G7R A;  2ESN A;  2BBY A;  3HM5 A;  3I59 B;  4CYD A;  3TDU C;  2OQR A;  2UXP A;  3AG2 H;  4FIS A;  3PUF A;  3D5S C;  2M7B A;  1IRG A;  3NS4 A;  3VEP A;  2R7Z J;  3FHN A;  2E19 A;  4OMZ A;  1IN8 A;  2BY2 A;  3RTR A;  3BP8 A;  4XN0 A;  3AKZ A;  6PAX A;  1SD6 A;  2WAF A;  5K1Y A;  2GXB A;  5TRD A;  3QAH A;  5EDN A;  3OIQ A;  1V5E A;  2LKP A;  1YOV B;  3I0T A;  3VYS B;  2O8K A;  2M0M A;  2JPB A;  4HNU A;  2F5C A;  3JW4 A;  1PVE A;  2P5V A;  3DFG A;  4XQF A;  3S3M A;  2W85 A;  2DYR H;  3ZQQ A;  2R92 J;  3J7A O;  4GCT A;  3CO6 C;  1S9H A;  5LRS A;  5JVG F;  2QA4 I;  2CS3 A;  1XGO A;  1X1P A;  1WWX A;  4L0Z B;  1JTY A;  4B1R A;  1EKE A;  2IA2 A;  2K3F A;  2DTZ A;  1FJL A;  3E6D A;  4Y13 A;  1WKM A;  3LAJ A;  4ENK A;  3WU1 B;  1KU7 A;  2NX4 A;  4BYY A;  4LOC A;  4MLO A;  2X0L A;  1OFC X;  3LSJ A;  2WAQ A;  3GFL A;  3F6O A;  3V7R A;  5M3F J;  2VBZ A;  3H36 A;  3E6B A;  1G6N A;  3N4M A;  1AWC A;  1MNM C;  2HXO A;  3LA2 A;  2PFB A;  4RGS A;  2DQL A;  1TQM A;  2P4W A;  3RD3 A;  2LMD A;  2MD0 A;  1ZRD A;  4G6Q A;  3ZGK A;  4OD5 A;  5BPD A;  4DZP A;  4UV9 A;  2IU5 A;  3ECH A;  3KE2 A;  4PCQ A;  1V4R A;  1FX7 A;  3BLY A;  2K02 A;  1QVU A;  3MMY B;  2Z33 A;  4HF1 A;  5DCM A;  5B1A H;  1YS6 A;  2NAZ A;  3G4S I;  1IV6 A;  3LL7 A;  5E17 F;  2YX7 A;  5C3E J;  1ZGW A;  1J0R A;  2PMZ N;  2XPU A;  1MJ9 A;  2G7G A;  2E36 A;  5FKN A;  3ZN1 A;  5HLH A;  1IAW A;  4AYB A;  3NI7 A;  2EFP A;  2XAH A;  4S05 A;  4RAY A;  4WXC A;  1X1B A;  3OV8 A;  4II3 A;  3V7S A;  2XAS A;  4CZZ A;  2F5V A;  4I0B A;  2A05 A;  1QBJ A;  2L7M P;  4I6Z A;  3PAS A;  3IKV A;  3A4C A;  4UUS A;  1S7O A;  4M3F A;  3S32 A;  4NB5 A;  2RC4 A;  4R8H A;  2GXG A;  3HTI A;  1RUO A;  3C2H A;  1GT0 C;  4GYG A;  2OU2 A;  1PYV A;  4ZDL A;  2F5D A;  3LFK A;  2DI3 A;  4UY8 I;  1TNS A;  2X51 A;  2KHM A;  3H0G J;  4HX7 A;  5H9T A;  4XIC A;  4CCJ A;  3ZP5 A;  2EIL H;  4BHC A;  5BMZ A;  5HOD A;  5JLW A;  4ENM A;  3O60 A;  1D1C A;  1SFK A;  2HPI A;  2YR2 A;  1TW3 A;  4OIN F;  3F8F A;  1F4K A;  2PBX A;  2DOA A;  1SC7 A;  3D0S A;  1R1U A;  3CCQ I;  2JN6 A;  4EJU A;  1IXR C;  1Y1W J;  2E7W A;  3GX4 X;  3JRH A;  3GYH X;  1NHA A;  3Q5F A;  1SAN A;  3GVA A;  1RPW A;  2OCE A;  2JA5 J;  2PN6 A;  1IDY A;  3K9T A;  3IH2 A;  4N0B A;  3SEQ A;  2XVC A;  1QZY A;  2A6T A;  2NVX J;  1YIJ I;  1QPI A;  1HKS A;  3GO5 A;  1T0F A;  3S3N A;  1MW7 A;  4U0W A;  1X2N A;  2IRF G;  2Z9O A;  1OYW A;  2MC4 A;  5K5R A;  1O3S A;  1IO2 A;  3P7N A;  1HW5 A;  4HLY A;  4IXA A;  1BC7 C;  1LFP A;  1OJL A;  3HRM A;  5CW8 A;  3ERM A;  2JZY A;  2AQE A;  4YII A;  2RRE A;  5IYC J;  2DXI A;  4QSH A;  3F23 A;  1LE8 A;  3KP6 A;  1WJC A;  2PMH A;  2CMP A;  3K1M A;  3S2W A;  4RS8 A;  2R3S A;  3CD6 I;  1ETW A;  1APL C;  1XDS A;  2RQQ A;  3T0Y A;  1EJ9 A;  1UST A;  4JX4 A;  5LD2 C;  4ETS A;  1UHW A;  1HST A;  1JT6 A;  2E5N A;  3OOU A;  4II2 A;  3FXU A;  1LVA A;  3WTZ A;  2EFQ A;  3GLL A;  2DOF A;  3GW2 A;  4BY7 J;  3WTU C;  3HGY A;  3F9K A;  3R0A A;  1WJB A;  3BG3 A;  3CF2 A;  3H5N A;  3HIM A;  3KP3 A;  2HI3 A;  4MFE A;  3CLO A;  4AVP A;  4NEL A;  4Q5S F;  2Q1Z B;  1NG7 A;  1UZC A;  1VQP I;  1A35 A;  5KAI C;  4M71 A;  2HU9 A;  5CLS A;  3TOB A;  3JRC A;  4AC6 A;  3GTJ J;  3IH3 A;  3WG7 H;  3LSK A;  2PEX A;  1MNE A;  1Q1V A;  2L9V A;  4CYC A;  1TT0 A;  1WJE A;  2AHQ A;  2CO5 A;  3F72 A;  4JNN A;  2M7A A;  5HNF A;  4AUX A;  1E3P A;  5DM7 F;  1U5T A;  4IZZ A;  3PM1 A;  3BNI A;  3BG7 A;  5IYB J;  2LKS A;  2BOL A;  1Z6R A;  4BHP A;  3BG9 A;  2K4B A;  2Y0M A;  2KKO A;  2VIX A;  3PIO F;  2DMP A;  4M6X A;  4M3E A;  1UB9 A;  5LBQ A;  1STZ A;  3HKZ N;  3MCZ A;  3P9C A;  5HBU A;  3OIO A;  3SZT A;  3BHQ A;  4CO8 A;  4L9T A;  1AU7 A;  2ZFU A;  3RI4 A;  3BCB A;  2FXA A;  2IW5 A;  1LNW A;  2DA4 A;  1XD7 A;  3ERE D;  5FLV A;  1R9T J;  4A5N A;  2H94 A;  3WTV C;  1OCT C;  3ONQ A;  4C2M A;  5J1R A;  4MTD A;  3M07 A;  4D1Q A;  3FF5 A;  2HFH A;  4WXH A;  1ERD A;  4ENN A;  2FRH A;  4A5M A;  1AKH B;  3NPI A;  1MMA A;  2ID6 A;  3JSO A;  3ESW B;  1IN6 A;  1FMW A;  2A2F X;  2YX4 A;  3V7C A;  1UAA A;  1H0M A;  3VW2 A;  5EZH A;  1DGW Y;  1YW9 A;  2LP0 A;  3BTC A;  5L3B A;  1LDD A;  4YFN F;  2V9P A;  1JXS A;  2MLK A;  1U6G A;  3R6S A;  4AIH A;  4A0Y A;  3JRA A;  3VVZ A;  2EA2 A;  4PJL A;  1XMA A;  2UUZ A;  2KP6 A;  4B8X A;  3A2K A;  1W36 C;  1CQT A;  2BW3 B;  4HW0 A;  5D5W B;  3NWS A;  1QNT A;  1W7P D;  2NXN B;  3CDH A;  4XRF A;  1NH3 A;  2GFN A;  2OV7 A;  4KN7 X;  2JPC A;  3MAJ A;  5EYR A;  2EV5 A;  2OTL I;  1XCB A;  1ZAO A;  2KMU A;  1PP8 F;  3IUO A;  2KPM A;  1R1V A;  2DA1 A;  5D8K B;  3LWF A;  3JAM K;  5FD6 A;  3HTJ A;  3ANG A;  2VBX A;  5CQG A;  3LQQ A;  1DGR M;  1JUP A;  3GTG J;  3QWL A;  2WAE A;  2HDW A;  2NS0 A;  3HSE A;  3KEO A;  2BVM A;  3ULQ B;  1TL8 A;  4H4K C;  1GDT A;  2QKO A;  2VL8 A;  3RDI A;  1W7P B;  2E1M B;  2XGX A;  4MXM A;  1UCR A;  1S5L C;  2V6C A;  1YJN I;  3QU6 A;  4BE2 A;  5DEQ A;  2R7F A;  4CZC A;  3FWE A;  2HYJ A;  4QTR A;  2VC1 A;  3B73 A;  1MBJ A;  4MGR A;  2FML A;  1F36 A;  1MBE A;  1W5S A;  1K79 A;  3H3V K;  4OIO F;  3ASN H;  1WCM J;  2VQH A;  3UNG C;  4CGR A;  2BHZ A;  2BHY A;  3R0J A;  5FO5 A;  4C2M J;  1B72 A;  5E79 C;  2KFD A;  5IT3 A;  2QEN A;  1J9I A;  1ONV A;  5D5X B;  5CXG A;  1FIA A;  3CQZ J;  2MAB A;  1HXD A;  3QP6 A;  4IF4 A;  2FSW A;  5D5V B;  5E3L A;  2HTJ A;  3PO2 J;  2UXN A;  1MH4 A;  5ICC A;  1I5Z A;  1BBY A;  3K4J A;  4UB8 C;  2N8G A;  3VWB A;  2JSP A;  3G56 A;  1TC3 C;  5D18 A;  2K9Q A;  3QQA A;  1KA8 A;  2DTR A;  2O0Y A;  1J2X A;  3MKL A;  4M3G A;  4ZYH A;  3IKT A;  4MEX F;  3GTL J;  2DT5 A;  2DA2 A;  2M8E A;  4YIF A;  2M1B A;  1SEU A;  2AQF A;  5GP9 A;  3I71 A;  5CQE A;  3DKX A;  3N05 A;  2BVL A;  3GWZ A;  3FXO A;  2CV1 A;  4G12 A;  1MBH A;  3A0H C;  3MKY B;  4PJN A;  3HGG A;  5IOZ A;  1G2H A;  1A6I A;  2X6X A;  5K58 A;  3G6E I;  1YQA A;  2QVO A;  2EB7 A;  2L4A A;  4UVB A;  3GZN B;  2UV1 A;  1HLV A;  4PXI A;  1HW1 A;  3EUH A;  3BTJ A;  1BA5 A;  3GBG A;  2KQR A;  4P9F A;  5CVV A;  1ON2 A;  2DMQ A;  2ZXJ A;  3F8M A;  3K8P C;  3ON2 A;  4XLP F;  1VTN C;  4IKF A;  3DEE A;  2QIB A;  5GPC A;  2CUE A;  2GM4 A;  4B3A A;  3HOV J;  3I53 A;  1TZL A;  3LNQ A;  4NN1 A;  2E5Z A;  3FBI B;  3G1M A;  1MBG A;  5KVR A;  1Z6T A;  4U87 A;  3L2U A;  2FA5 A;  2LY2 A;  5LHI A;  2UZK A;  1P6R A;  2NP3 A;  5F64 A;  4A3L J;  2J5P A;  1CF7 A;  2RAE A;  1XGS A;  1NTC A;  2M87 A;  2K9S A;  4NUB A;  4RLF A;  2K9N A;  1KU9 A;  4ZDP A;  1OMI A;  2VJ4 A;  1YS7 A;  5HLT A;  2OTJ I;  2Z1D A;  1ZLJ A;  5ICG A;  1YO5 C;  1KQ9 A;  5L3G A;  4E7I A;  3LA7 A;  2ACJ A;  4ASN A;  1F9N A;  2V1N A;  2XHK A;  1IGN A;  4X6A J;  1UI5 A;  1XGM A;  4S04 A;  5A2Q K;  5C44 J;  3AAF A;  4ME9 A;  1TQI A;  4ESF A;  3HG9 A;  3EDP A;  4BJ5 C;  1WJF A;  5FKM A;  1I6H J;  1FOK A;  1OKR A;  2NNY A;  1YIO A;  1LEB A;  5FD5 A;  3H1C A;  2EIN H;  2R7U A;  3H92 A;  3ZQI A;  1DPR A;  2KZV A;  3V8L A;  3QP5 A;  1W0U A;  4K2E A;  4PJM A;  1QHG A;  4LIU A;  2ZOY A;  2ZOZ A;  4AU7 A;  3WU2 C;  5DTD A;  4A3J J;  1OR7 C;  2B0L A;  1KYZ A;  5JFR A;  2D6Y A;  2GEN A;  1T56 A;  3VOX A;  1EA3 A;  2A3S A;  3NWT A;  4G8X A;  4ZYG A;  3ZQG A;  3F1B A;  2OJE D;  3WHB A;  3L9F A;  1SD4 A;  5DUK A;  1BI3 A;  3R61 A;  3ZCO A;  3BQZ A;  1TW2 A;  3A01 B;  1T8I A;  1Y0N A;  5B1B H;  1K61 A;  5EG0 A;  2AXT C;  1R1T A;  3C18 A;  3QYB A;  4HEA 2;  5L3F A;  4Y7N J;  5DCF A;  3R4K A;  1QHH D;  4OIQ F;  1RES A;  1VQM I;  1MMS A;  1EV7 A;  2CJJ A;  2VE8 A;  1SVL A;  2MD5 A;  3MQ0 A;  4L18 B;  3LJL A;  2K5C A;  2L9N A;  1RUN A;  2DFF A;  4ZYA A;  3PQJ A;  3P9K A;  4XR6 A;  3U1K A;  3F21 A;  2HVS A;  3QPS A;  3FXQ A;  2ZJ2 A;  3MVP A;  4IPA A;  1X3U A;  3ZXS A;  3X2Q H;  2KDZ A;  1YG2 A;  2FF4 A;  2AO9 A;  3BJO A;  3DPU A;  2B7E A;  4HNV A;  4LG0 A;  3BTI A;  1FEX A;  3CZ6 A;  4EAT A;  2EV0 A;  3VVY A;  3TW6 A;  1ODD A;  5K5O A;  4PSW A;  2YVE A;  4PDK A;  2LNB A;  2BY1 A;  5FKK A;  4W97 A;  2QKL B;  2F5E A;  4GDF A;  2JA7 J;  4YFK F;  3IC7 A;  1J75 A;  2XAU A;  5GAD J;  2DN0 A;  3M8E A;  4YEL A;  2HGC A;  5K7F A;  2Z5U A;  2E35 A;  2OCC H;  2IAI A;  3BR6 A;  2R0Q C;  3L2Q A;  4BS9 A;  3TKY A;  1EH6 A;  3G1O A;  4XBF A;  5D19 A;  3VVX A;  2L0K A;  2DO7 A;  4DOZ A;  1LDK B;  1RKW A;  2Y30 A;  4B47 A;  4F92 B;  2QQ9 A;  2Y0S A;  3GTM J;  2MH2 A;  3J7Y J;  4G9Y A;  1R00 A;  2REK A;  4OD4 A;  5E3M A;  4CA0 A;  5LHG A;  2MYS A;  2JRT A;  1SFU A;  3WOD F;  2LDU A;  3M8J A;  4CHU A;  4XKB A;  3KET A;  2L02 A;  1SFE A;  2ECB A;  3ZQL A;  1Z1D A;  2Y69 H;  3WGG A;  3CTA A;  1Y6I A;  2COB A;  2ELJ A;  4RBO A;  2ZCN A;  1BI1 A;  2JSC A;  2BV6 A;  2VT3 A;  3JSJ A;  1XC5 A;  2HYG D;  4ITV A;  4IOC F;  2R7D A;  2VQG A;  5HS9 A;  1VQ4 I;  3B6C A;  4V19 K;  2QZ8 A;  2XAJ A;  1GVD A;  1WJ5 A;  5CYV A;  4J01 A;  4BE0 A;  2HOA A;  3CDI A;  1U0J A;  3QBM A;  3DLA A;  3H9Q A;  3E6M A;  1B4A A;  1A04 A;  2W4S A;  3R60 A;  2E71 A;  2NP5 A;  2WGB A;  2XAQ A;  2DDA A;  2DU9 A;  2DPD A;  3BJB A;  1X2M A;  3FIS A;  2CGP A;  2NOG A;  3ZOB A;  1SMT A;  1IW7 F;  3EGQ A;  1G3S A;  4E7H A;  3ZMT A;  2R5Z A;  4BH9 A;  4GFL A;  4XOT A;  4L5E A;  2WC2 A;  4MHG A;  3KYD B;  4KIF A;  5BPI A;  3KLO A;  2BE5 F;  3S14 J;  3O2P E;  3VOE A;  1PP7 U;  1JJ8 C;  1JKR C;  2O8X A;  4TV7 A;  4KIC A;  3PIP F;  5IT9 K;  2HQ5 A;  1FBU A;  3VUQ A;  3PNT A;  5DD8 A;  2CQ7 A;  4DBR A;  4XM3 A;  4BEH A;  2FU4 A;  4Q47 A;  2DMN A;  4LJZ F;  2CW8 A;  1POG A;  2KL4 A;  3VYR B;  3VSL A;  5J1U A;  2HR3 A;  2E2I J;  5KK1 A;  4XMY A;  4F7Z A;  3VOD A;  2NS8 A;  3OOP A;  3DEU A;  3RQI A;  2PJP A;  1HOM A;  3FXR A;  4RGU A;  4O6J A;  2H6B A;  1RR8 C;  2YU3 A;  1OLT A;  1V54 H;  2LFB A;  5DYM A;  3CJT B;  4PGG A;  4DBQ A;  2E1M C;  2DJI A;  4GFB A;  3V6G A;  3I58 A;  4HF0 A;  1Z91 A;  2E2J J;  3GTQ J;  1SAU A;  2YPR A;  4EM2 A;  2HKU A;  1V55 H;  2ID3 A;  2ICW G;  4RMN A;  4AWX B;  1O7L A;  2KZG A;  2ZXH A;  1ETX A;  2K7L A;  3OYH A;  3JTG A;  3HUG A;  3O6B B;  3FHZ A;  1FSH A;  3IWF A;  2JK3 A;  5FGM A;  3CUQ B;  5M5W J;  2R7T A;  3E97 A;  1RET A;  3JRF A;  3CC4 I;  1KQ0 A;  1FP1 D;  4U7D A;  3HOZ J;  3RQ4 A;  4D7N A;  2FOW A;  3DBH B;  3NEU A;  2RKH A;  2GUH A;  4RM3 A;  3UR3 C;  3QKX A;  1T39 A;  2HEO A;  2P6T A;  2DDB A;  3L1P A;  2OBP A;  4A3C J;  2FBH A;  3FDY A;  4E7J A;  3NXC A;  4I0A A;  4ON0 A;  2CG4 A;  2ZB9 A;  2JVG A;  3GLX A;  3OS1 A;  2PFV A;  4LLN A;  1YX3 A;  5FLX K;  2NVY J;  3HHH A;  1X1A A;  2HOE A;  1G4D A;  4GCV A;  4QLC U;  1G59 A;  4CGZ A;  3VFZ A;  3PO3 J;  2E7X A;  3HIF A;  4MQV A;  2KIQ A;  4KT6 A;  1Z67 A;  4BU2 A;  4M6Y A;  1MMG A;  1MDM A;  3ZMS A;  3OSG A;  2IS1 A;  3CDL A;  5KAF C;  2ZXI A;  4DIQ A;  4XL9 A;  3QPH A;  2JTV A;  3HTH A;  1WH7 A;  2P0W A;  2BEO A;  5BS6 A;  3FX3 A;  3WTW C;  4PGH A;  3NRG A;  1JHH A;  5EF6 A;  1P7I A;  2E60 A;  2HWV A;  3HL2 A;  2HOT A;  2ZY9 A;  1U8B A;  2WB1 N;  3BT9 A;  3G1L A;  2Q24 A;  2UXX A;  4D5C A;  2XF7 A;  3SWH A;  3IUV A;  2EA4 A;  2B9S A;  1Y8R B;  3TO6 A;  4IQJ A;  1HF0 A;  2ZO4 A;  1R49 A;  1W0T A;  3ZMU A;  4ESJ A;  3JTH A;  2H8R A;  2Q0O A;  4HSR A;  2QSH X;  2DG7 A;  4OAY A;  3GFI A;  3CMY A;  4DYR A;  2LY9 A;  3K2A A;  2X6O A;  3WU0 A;  4RAG A;  3BCA A;  2M8G X;  3LA3 A;  2XAG A;  4HBL A;  1YTY A;  3OMY A;  1F1Z A;  1G3W A;  1SD5 A;  1FWZ A;  2QQ8 A;  5ICE A;  1MZB A;  1ZN2 A;  2L5Q A;  1H9G A;  1MJB A;  4WK8 F;  3TP3 A;  3PSI A;  4RAF A;  5IT9 Z;  3UKG A;  1T33 A;  4GYI A;  4GCL A;  4RB0 A;  3CCU I;  4PZJ A;  3C07 A;  2BYV E;  3DCF A;  3IHU A;  4IRH A;  5DCM B;  4BGD A;  1OYI A;  2CV2 A;  2VLA A;  3TED A;  1NG6 A;  1ETV A;  2O03 A;  4C9Y A;  2OAZ A;  4BQN A;  3DWL E;  4GXO A;  3OS0 A;  4E7Z A;  5F1R A;  5F08 A;  2EZI A;  3K1P A;  1W5T A;  2LY1 A;  5HS8 A;  3CJR B;  2L2O A;  3K10 A;  4M3B A;  2UXH A;  4MEY F;  3CMM A;  2J5O A;  2MG4 A;  1S6L A;  1E3O C;  2DYS H;  4BXU A;  2CH0 A;  2X48 A;  1Z3X A;  4EM1 A;  4LLL A;  1QZZ A;  3AQT A;  4L9J A;  2CSO A;  4F3Q A;  5IP7 J;  4UUS B;  3K70 D;  2DFE A;  1IJW C;  2BY3 A;  4JP0 A;  4KMU X;  2XDN A;  3IAS 2;  4BQQ A;  4DZJ A;  2ZSI B;  3VB2 A;  4XSZ F;  3OYJ A;  1MBF A;  2PLY A;  5FHP A;  1T95 A;  1FP2 A;  2ZME A;  2OPT A;  2H8W A;  3O3K A;  3FK6 A;  2STW A;  3EPZ A;  3B6A A;  3OR1 C;  3ABM H;  2OQG A;  4KFC A;  3S93 A;  2ISZ A;  2E1O A;  2JWT A;  3HRS A;  4RGR A;  4G94 A;  2W82 A;  5D1R A;  2P7C B;  1F43 A;  3TMO A;  3BCG A;  4U9N A;  2DA6 A;  3GTK J;  3HE0 A;  1QZE A;  1YYV A;  4I99 C;  3CJD A;  2F2E A;  1JKO C;  4XK4 A;  5KHD A;  1UJ8 A;  3CES A;  3OYD A;  1FOY A;  1H9T A;  1VQK I;  4Y52 J;  3ZN0 A;  4IRV A;  3CCE I;  3ON4 A;  3N97 A;  2UWM A;  1V5G A;  3QOP A;  4ZH4 F;  2WBM A;  5FLX Z;  4IO9 F;  1IN7 A;  2OUM A;  4P55 A;  4E4H A;  5J8F A;  3WE3 A;  4KIB A;  2P6S A;  3WTY C;  4J00 A;  3TL4 X;  4HLX A;  4OMY A;  3FXM A;  5FLM J;  1HBX G;  4IHY A;  3OYG A;  4QWQ A;  2JUC A;  4AIJ A;  5B5E C;  5E20 A;  5IOY A;  4FCY A;  3RZO J;  3D5L A;  1O57 A;  1WGX A;  2XPW A;  3ZQH A;  1P2F A;  4HX4 A;  1LVK A;  2OZ6 A;  3FXK A;  1ZAR A;  3DTE A;  2L7F P;  1W5C C;  3COA C;  2ZJR F;  3GUD A;  4M3D A;  1LE8 B;  1GUU A;  5TJJ A;  4XLN F;  2R5Y A;  4A3I J;  2HKX A;  2W84 A;  5DAJ A;  1ZTR A;  1N25 A;  3S17 J;  1LFU P;  4HAM A;  2O5R A;  3IRR A;  5L3E A;  5JLX A;  2Q2E A;  2OA4 A;  1VQ9 I;  5F0C A;  3FMS A;  1O3R A;  2DFI A;  1M1E B;  5CVI A;  1K78 A;  3VIB A;  1Y0U A;  4ZYE A;  1N77 A;  1S7A A;  1Z05 A;  1H89 C;  4PJJ A;  2XKP A;  2KLO A;  4B09 A;  2HVR A;  2V1U A;  2DW4 A;  4IX7 A;  2V9V A;  2PJR A;  3HSF A;  2A5W A;  2V26 A;  3DF8 A;  5B66 C;  5D6F A;  2V6E A;  2ELH A;  4M9X A;  1YRN B;  2UXI A;  5M3M J;  3CCJ I;  3L2W A;  3E6C C;  4V2G A;  5D5U B;  3FIW A;  3M3Y J;  3M9A A;  4D0P A;  1ENH A;  2ZBK A;  4I2O A;  1ON1 A;  3CMA I;  4ZC3 A;  2K9L A;  5J40 A;  4G7H F;  1H8A C;  2BZT A;  2XGC A;  4CYC B;  1QA6 A;  4MFD A;  3C2B A;  1FBQ A;  4E70 A;  1U5T B;  4ZYD A;  3S1Q J;  3CP8 A;  4IHS A;  2RAS A;  2O9L A;  1V3F A;  2EFO A;  3KKD A;  4B43 A;  5EZG A;  1UI6 A;  5M5Y J;  3OSF A;  1LPQ A;  1WVR A;  4N4N B;  2X6Y A;  1GXQ A;  3GFM A;  5DV5 A;  1WJD A;  1VQ5 I;  2DBB A;  2EZK A;  1D5Y A;  2G7U A;  5FJ8 J;  2LTP A;  2M4K A;  1P92 A;  1IN4 A;  2X4H A;  4Y33 A;  5LEJ A;  2X85 A;  1JUM A;  3FRQ A;  3BPV A;  2DA5 A;  2XGE A;  1SVO A;  3OIP A;  3GEU A;  1Y1V J;  5J6X A;  4LB5 A;  1O7F A;  2V9K A;  1HW2 A;  1SFX A;  2Z16 A;  4PUS A;  3V8K A;  2DK5 A;  2FX0 A;  4ZDO A;  4YZE A;  1RR7 A;  3S8P A;  3ISP A;  3U21 A;  4CSW A;  3J80 Z;  1ACI A;  1ETK A;  4NNJ A;  2V57 A;  1JGG A;  2QWT A;  3SQN A;  4A0Z A;  1UHS A;  5E1W A;  3KZY A;  2LVS A;  1GLN A;  4DVY P;  2L7K A;  3RYP A;  2CQK A;  4DYC A;  1WSU A;  1D8J A;  2DPU A;  3RIR A;  3FM3 A;  3H9G A;  5D6E A;  4UVC A;  2LF7 A;  2GIZ A;  3U2R A;  3JRE A;  2FBQ A;  1OCR H;  1UEL B;  2CUF A;  4IEJ A;  2FNA A;  1Z77 A;  4KNY A;  3V4G A;  1FOW A;  5E8G A;  2IS6 A;  4L62 A;  3OL3 A;  3GZ6 A;  1NK3 P;  2NVT J;  2OF7 A;  1J5Y A;  4KIG A;  4NQW A;  4PFO A;  4A3M J;  1IC8 A;  3WE2 A;  3VP5 A;  3MKZ A;  3RKQ A;  2FEZ A;  1TLH B;  3RKX A;  3HXL A;  2IA1 A;  2P5L C;  1YFH A;  3HC7 A;  4IL6 C;  4UB6 C;  2ME0 A;  3HB9 A;  3HOU J;  3OYK A;  3CUQ C;  3KX2 A;  5EGO A;  3KKC A;  3ASO H;  3HRT A;  1JGS A;  1MIJ A;  4AC0 A;  1RRJ A;  2DG8 A;  5E18 F;  3BZK A;  3JRB A;  1TWH J;  3C3W A;  2M5W A;  3U1D A;  1SVM A;  1ZRE A;  3ML6 A;  2YUS A;  4ABZ A;  3K6G A;  3V42 A;  5BOX A;  1BI2 A;  2WWY A;  4D5F A;  1X1C A;  3BRO A;  3ZMD A;  2G7S A;  2QBY B;  1PUF A;  1B1B A;  3BR1 A;  4Y3O A;  2QKM B;  3Q9V A;  3EUP A;  4IVN A;  1F5T A;  2HXI A;  5J4Y A;  1RZ4 A;  1B72 B;  2EFW A;  1JJ6 C;  4IQ4 A;  2W53 A;  2XSD C;  4ACI A;  4LG3 A;  2F4I A;  2HYF A;  4FET A;  3LSG A;  3BTL A;  2DQR A;  3HOW J;  4EMS A;  1ETO A;  4FE7 A;  4PJ0 C;  1K83 J;  4ICH A;  1R7J A;  1VQL I;  5DD4 A;  3PUB A;  3E5U A;  4HX8 A;  4XOR A;  1SFO J;  1HA8 A;  1O3T A;  4KIS A;  3DKW A;  3S3O A;  3Q3S A;  4RB2 C;  1IZ1 A;  2KIS A;  3TGN A;  3LSP A;  5ERI A;  2KT0 A;  3PSF A;  1B9N A;  2JA8 J;  1BC8 C;  4A93 J;  4YIR X;  4BBR J;  4E7K A;  3SYT A;  3NAR A;  3I55 I;  2RGV A;  2L3D A;  2YSR A;  2VOO A;  4XRM A;  5FGL A;  3HOS A;  5DM6 F;  2CFX A;  5J8C A;  5HOO A;  3M1E A;  1K4S A;  1PJR A;  1RNL A;  2HS5 A;  2H1L A;  3VDX A;  3BDD A;  3OYI A;  3EET A;  3NNR A;  5CPR B;  3AFH A;  4ANJ A;  3AQS A;  3SEZ A;  2M4G A;  2IT0 A;  3FZV A;  1O4X A;  1D0Y A;  5H6Q A;  1SGM A;  5AIQ A;  3M7G A;  2B3W A;  2ZKZ A;  5IPA A;  2A68 F;  3HDD A;  1Q1H A;  1D3Y A;  2QGU A;  3LOC A;  4YEJ A;  3TW7 A;  3BOQ A;  1N78 A;  5J4V A;  2CQX A;  5IP6 A;  3MKW B;  5AON A;  3SFI A;  5FB2 A;  2FMY A;  3QYE A;  2TRT A;  3O8H A;  1ZQ3 P;  1X19 A;  2WTE A;  4DW6 A;  2M45 A;  1I3Q J;  2IGN A;  4JYK A;  1CF7 B;  4YFX F;  1JTX A;  2DAO A;  1XSD A;  1BR4 A;  4RB3 C;  1TNT A;  1IDZ A;  4WWC A;  4P9U A;  3S15 J;  2HZD A;  2QCO A;  3HKZ A;  2H27 A;  3W6V A;  3RPU A;  2HPM A;  3HSR A;  1B6A A;  1LEA A;  2CW7 A;  1ZG3 A;  4CXF A;  1R58 A;  1IRX A;  2M0C A;  1SD7 A;  2HDC A;  2CUJ A;  2VPR A;  4I98 B;  2NS7 A;  4LIV A;  1MSF C;  2HDD A;  3HTA A;  4XKV A;  2WAQ N;  2RHA A;  3RPQ A;  2XPV A;  1G8X A;  2P81 A;  3P9T A;  4RM2 A;  4XNF A;  3GXO A;  1PUE E;  1B8I A;  4KYW A;  1R22 A;  2HQR A;  1X1D A;  1FYM A;  3JCU C;  5GTI C;  1O3Q A;  1NK2 P;  4I76 A;  5F27 A;  3G3Z A;  2EV6 A;  1I50 J;  1FNN A;  4HZF A;  3KZ9 A;  4EJV A;  3A03 A;  2O3F A;  4U0V A;  4RGX A;  5B3S H;  3FKI J;  3ZMZ A;  5HNH A;  3K4B A;  2PG4 A;  1ZH5 A;  4LK1 F;  1IG7 A;  3L09 A;  3SHF A;  3ABL H;  3HBL A;  2ELK A;  4FTH A;  2KJB A;  1R6R A;  4HNT A;  4L5J A;  3QPT A;  3MNL A;  5ILU A;  5F0F A;  1W4M A;  2F4O B;  4LB6 B;  2NVQ J;  2IGO A;  2RNJ A;  4AYB N;  4C3I J;  3RKW A;  1AOY A;  3QOE A;  2MGQ A;  5EG0 B;  1ZG5 A;  3DPJ A;  2W00 A;  4PFP A;  1XX5 A;  2EBI A;  1BW5 A;  2ZJQ F;  1Z3Y A;  3IWZ A;  1R4M B;  3LQR A;  2XRO A;  1U9N A;  1Z9C A;  2A6H F;  4CCO A;  3E0J B;  2VUM J;  3KP5 A;  1R5I D;  1REP C;  3I4M J;  1DUX C;  2W1O A;  1BIA A;  2VT2 A;  3HTU A;  3WTS C;  1LQ1 A;  3BG5 A;  4BL0 B;  3DPL C;  4BDY A;  3SJM A;  1K7A A;  4LG0 B;  5DDG A;  2XSJ C;  2ETH A;  1P7J A;  1C0W A;  2DFH A;  3GFJ A;  4AIK A;  2Y48 A;  4NC6 A;  1A31 A;  1XMX A;  3ANP A;  5HDG A;  4CUG A;  3WGI A;  2CQN A;  2UXO A;  4KIT B;  3OS2 A;  3OYL A;  3PNY A;  2VPL A;  4L9V A;  4HKU A;  1R4N B;  3EQL F;  2CWE A;  2LH9 A;  3DXJ F;  3ZQ7 A;  1VQN I;  2IPQ X;  3QOD A;  3MD2 A;  4A6E A;  3MWM A;  5D4S A;  3GTP J;  5HSZ A;  2GOX B;  2RNG A;  2LBF B;  1SMY F;  2R93 J;  2DCE A;  4XOP A;  3SDG A;  2XKO A;  2LOO A;  2LD5 A;  5FRO A;  1D0X A;  2LK2 A;  2Y9Y A;  2MH9 A;  2G3B A;  2DOE A;  2HTS A;  1AA7 A;  2QF7 A;  4UUV A;  3HPG A;  3S1M J;  9ANT A;  4HV6 A;  1HDD C;  5CVU A;  3H5A A;  2E2H J;  2M9H A;  1D1A A;  1JT0 A;  4A12 A;  3GME A;  4ESB A;  5EFY A;  2DT6 A;  1IRF A;  4LFU A;  2VON A;  1FYK A;  2KDO A;  5AIP A;  2VJJ A;  2O6G E;  3T1B A;  1D0Z A;  3PQK A;  1LJ9 A;  5E1X A;  5E8I A;  3ZPL A;  3JSP A;  1TWF J;  3I59 A;  4HST A;  2XRL A;  1DPU A;  3CRJ A;  3SZG A;  2VQC A;  4CCM A;  3MZY A;  5GAE J;  4AVZ A;  4X0G A;  5H2F C;  1BR2 A;  3GZ5 A;  1KZH A;  2W48 A;  1WHU A;  5E3N A;  3J7A Y;  5HS7 A;  3KP7 A;  3OYA A;  3PFI A;  3QPL A;  4LLG F;  3I56 I;  1ZEL A;  3DBR B;  4FX4 A;  1X3Z B;  3OL4 A;  1YE9 A;  1L0O C;  2L4M A;  5L3C A;  1E0E A;  1T98 A;  1QPM A;  4DYQ A;  3MEX A;  1WH5 A;  1D8K A;  3HOY J;  3BJA A;  3F6V A;  2STT A;  5JI6 A;  4LMY A;  5J3L A;  3ECO A;  4LD5 A;  3JRG A;  1ZR2 A;  4WF2 A;  3BPX A;  1LUJ B;  2O61 A;  2K27 A;  2ZCW A;  2D2W A;  4R79 A;  1YW7 A;  2DMT A;  3P5J A;  1X58 A;  3DTI A;  4HYE A;  1FYL A;  1ZGA A;  2R5Z B;  3CLQ A;  1HKQ A;  1ZR4 A;  1N75 A;  1A36 A;  3VW1 A;  3CCY A;  2XRN A;  1KON A;  2C6Y A;  4E7S A;  3A02 A;  2CU7 A;  3I3L A;  2W57 A;  4JOM A;  1FSE A;  2Y9Z A;  4A6D A;  3FXJ A;  4BY1 J;  1FY7 A;  2YS9 A;  2M2E A;  2ESH A;  1VQ7 I;  1YIT I;  2FJI 1;  2O7O A;  2JRM A;  2V1X A;  4BEH B;  2FD5 A;  2LRD A;  3KZZ A;  2EIK H;  4N9I A;  3E5Q A;  3KFW X;  1I27 A;  4BE1 A;  3HHG A;  2HZT A;  2M3A A;  3TO7 A;  2IGK A;  4LGW A;  1GV5 A;  3TOA A;  5D8L B;  4GGG A;  1YJ9 I;  3WHC A;  3VYT B;  4MNU A;  5LEK A;  1BIB A;  1Z7L A;  5FMP A;  1IXC A;  2LF8 A;  2ZFW A;  3DPT A;  1R23 A;  3EUA A;  3BWG A;  2K85 A;  1ZYR F;  3A0B C;  5EEG A;  4X1E A;  3Q0W A;  3VYU B;  3CWR A;  5IP9 J;  3IV5 A;  3BRU A;  4UXN A;  2LYC A;  1KU3 A;  4A3G J;  3B81 A;  3PFY A;  1I1G A;  1XCV A;  2JVH A;  2COM A;  4FQG A;  2XF6 A;  3BZC A;  4A69 C;  5C4J J;  1QRY A;  3PPB A;  1X3W B;  3HUG B;  2EZL A;  3ABU A;  3K0L A;  1U8R A;  2E1N A;  1IV8 A;  2VXZ A;  1HC8 A;  1GHC A;  3H35 A;  1KQ8 A;  4W1U A;  2OC6 A;  3I9V 2;  1OCC H;  2E34 A;  1TT5 B;  2QSF X;  4EGY A;  2XUB A;  1JKP C;  3CP2 A;  1W1W E;  4NHJ A;  3H0D A;  2LR8 A;  2G7L A;  3LHQ A;  2GOM A;  5ED4 A;  3QU3 A;  4HF2 A;  2W7N A;  4G6T B;  5IY5 H;  3VTI A;  3PNV A;  4P96 A;  1OR7 A;  3RZD J;  3HZJ A;  2EZH A;  2LRE A;  2VI6 A;  2NYX A;  4D9J A;  2GXA A;  3OY9 A;  2GBY A;  1J09 A;  4EJW A;  2FJ1 A;  4C30 A;  2R7V A;  4KN4 X;  2D1H A;  4U0Y A;  4JL3 A;  3DLL F;  1WI3 A;  1JUS A;  1MGT A;  3I4P A;  1CGP A;  3BQY A;  2FOK A;  4R1H A;  4EJO A;  4BQA A;  5K5Q A;  5GAG J;  3DKY A;  2Z99 A;  4BAC A;  2I10 A;  3KIO A;  2RN7 A;  1HCR A;  3NAU A;  4DNC A;  1QU3 A;  2IXS A;  2Z2S B;  3CJQ B;  1MDM B;  4BBS J;  2LLK A;  4C3H J;  4WIB A;  3K4N A;  2AXL A;  1FTZ A;  4MIM A;  3GEZ A;  4HRI A;  1UHM A;  2VAS A;  3RYR A;  3EUH C;  3K7A J;  2HOS A;  1T6S A;  1MND A;  3ABT A;  2JUG A;  3LMM A;  2EH3 A;  3F0C A;  5KCM A;  5HAW A;  2BGC A;  2P8T A;  2VXD A;  3KNW A;  3CCR I;  2QWW A;  1ZG1 A;  3T8T A;  2CYY A;  3ZR8 X;  2ZNZ A;  2V79 A;  1BI0 A;  2XB5 A;  3K4C A;  4I09 A;  5K7H A;  4IRG A;  3CC7 I;  2BY0 A;  4GRI A;  3DU6 A;  1DP3 A;  2X1C A;  3J80 K;  5CVR A;  4A3K J;  4A3F J;  3S1R J;  4JX5 A;  2IS2 A;  2H09 A;  2GIV A;  2EIM H;  3F3X A;  1XDU A;  3S1N J;  4G7O F;  3H5R A;  3LSM A;  3C2G A;  2MFZ A;  3C1D A;  2KRH A;  3F8C A;  1ORK A;  1J59 A;  1WI9 A;  3M8F A;  2RVC A;  1P4A A;  3LFU A;  1Y39 A;  1YJW I;  2GQQ A;  1UG2 A;  3J81 K;  2HQN A;  3I64 A;  4IHT A;  5J47 A;  3AG1 H;  5F0H A;  1BR1 A;  1FOX A;  3FMR A;  4J19 A;  1UG0 A;  4CH7 A;  2ZC2 A;  1SAX A;  2VJ5 A;  2FE3 A;  3L2V A;  3L2R A;  4XKC A;  1ETQ A;  1DU0 A;  2PX9 A;  2A69 F;  4FAS D;  4XLF A;  4KWA A;  1MMN A;  2NNN A;  3VW0 A;  5LRR A;  3VOK A;  3SXY A;  3AG3 H;  1FZP B;  1OIS A;  2R7S A;  2QQA A;  2XC7 A;  2G7H A;  3RH2 A;  1UMQ A;  2DA7 A;  5CXI A;  1WQ2 A;  2QM3 A;  4C2T A;  1OQY A;  1K4T A;  3IH4 A;  2OZU A;  1VF9 A;  2G0E A;  5J1Y A;  3WGH A;  1ZHF A;  3FKJ A;  3HRU A;  5FKL A;  1Y8Q B;  3CCS I;  2IVM A;  3RSN A;  2OI8 A;  2YVX A;  1FBS A;  4A0X A;  4A2U A;  4MQ9 F;  3DTK A;  5L3D A;  2G9W A;  3MZH A;  3HPH A;  1QO0 D;  3K1N A;  4JK1 X;  2GAU A;  1DU6 A;  4RDU A;  2VOD A;  2OD5 A;  1BN5 A;  1VND A;  1BJZ A;  4OIR F;  2DJN A;  1ZRC A;  2ZME B;  5HDN A;  3BC8 A;  4UUT A;  1YRN A;  2PMU A;  4BDZ A;  1AKH A;  4EJT A;  2DT7 B;  3BR0 A;  2ME6 A;  3W2V A;  5EEH A;  1IN5 A;  5BQT A;  1MH3 A;  2P5K A;  4ZZL A;  4XN3 A;  1R5H A;  1TWC J;  5LGN A;  3S2H J;  3K4M A;  5KNL A;  2UXU A;  2B1E A;  1LKX A;  3S2D J;  3F8N A;  4QIW N;  5JHU A;  4UNO A;  1G3Y A;  4P1W A;  2VKH A;  4EM0 B;  1GVJ A;  3L2C A;  1VI0 A;  4RA2 A;  3Q0U A;  2EPF A;  1TWA J;  4HQM A;  2QEX I;  4AF5 A;  3MFK A;  4L0Y B;  4Q4Z F;  1B59 A;  2BW3 A;  5LGT A;  3RJP A;  3LST A;  2VKE A;  5HDK A;  3K4L A;  3OWT A;  2KRF A;  4LIT A;  3FBN B;  4MO7 A;  4XLC A;  1OPC A;  2LSO A;  2VKD A;  2XF5 A;  2PBI A;  5HLG A;  4XRS A;  3P9I A;  3K2Z A;  1RIO H;  3FXL A;  4P5O A;  1Z0X A;  4JBA A;  4G7Z F;  2MA3 A;  3F8B A;  2V4J C;  1D5V A;  5TIS C;  1P9Q C;  2WA0 A;  3W6K B;  3TBI A;  2WAD A;  4JX6 A;  4L5I A;  2ZXW H;  3GZI A;  1JHF A;  2D5V A;  1GV2 A;  2R5Y B;  2R7X A;  1W7P A;  1MJA A;  4EGZ A;  1HDP A;  4BKX A;  5IYD J;  4DJA A;  2JA6 J;  5M5X J;  3WG9 A; 
#chains in the Genus database with same CATH homology
 2R5Z A;  1O4X A;  2MSY A;  1GT0 C;  4GFL A;  1SGM A;  4L5E A;  2PZ9 A;  5IPA A;  3H0G J;  4FE4 A;  2LKX A;  3HDD A;  5H9T A;  1OCP A;  4XIC A;  3LOC A;  5F1J A;  3TW7 A;  3Q0V A;  3S14 J;  2CQX A;  5IP6 A;  5HOD A;  1JJ8 C;  1JKR C;  1S7E A;  3T6N A;  3SFI A;  5JLW A;  3O60 A;  2TRT A;  3O8H A;  1ZQ3 P;  2HQ5 A;  4DW6 A;  3VUQ A;  1I3Q J;  4JYK A;  2CRG A;  2PBX A;  2TCT A;  1JTX A;  2DMU A;  2JN6 A;  1Y1W J;  2DMN A;  1IDZ A;  3JRH A;  1POG A;  3S15 J;  3BR5 A;  1SAN A;  3GTO J;  1RPW A;  2QCO A;  5J1U A;  3W6V A;  2E2I J;  1H88 C;  2JA5 J;  1IDY A;  2M0C A;  3IH2 A;  2VPR A;  1IRZ A;  2NS7 A;  2NS8 A;  1MSF C;  3RQI A;  4XRS G;  2Y0S N;  2HDD A;  1HOM A;  2OER A;  3HTA A;  4GFK A;  2NVX J;  2YVH A;  2WAQ N;  2RHA A;  1QPI A;  2XPV A;  2P81 A;  2LFB A;  1X2N A;  2B63 J;  3P9T A;  2K40 A;  3JR9 A;  1B8I A;  3HEF A;  4GFB A;  2IEK A;  3V6G A;  1IUF A;  4M6V A;  5EEA A;  2E2J J;  1NK2 P;  4I76 A;  1OJL A;  3GTQ J;  5F27 A;  2HKU A;  5CW8 A;  1I50 J;  2ID3 A;  3KZ9 A;  5IYC J;  3A03 A;  4QSH A;  1LE8 A;  1ETX A;  3FKI J;  2CQQ A;  3MN2 A;  1IG7 A;  3O8G A;  2JK3 A;  3JRD A;  5M5W J;  3COL A;  3HBL A;  1ETW A;  2ELK A;  4FTH A;  1APL C;  1RET A;  3JRF A;  3MNL A;  5F0F A;  4JX4 A;  3HOZ J;  2JMW A;  2ECC A;  2NVQ J;  1ETY A;  1JT6 A;  4D7N A;  3OOU A;  4AYB N;  1XS9 A;  4C3I J;  2GUH A;  2MGQ A;  3TP0 A;  5EG0 B;  3QKX A;  4BY7 J;  2VKV A;  3DPJ A;  4MK6 A;  3HGY A;  3L1P A;  4A3C J;  2EBI A;  1BW5 A;  3NXC A;  3BG3 A;  3HIM A;  3I4N J;  2HI3 A;  4MFE A;  4NEL A;  1U9N A;  2ZB9 A;  3E7Q A;  2NVY J;  2VUM J;  3JRC A;  4AC6 A;  3GTJ J;  5DS9 A;  3IH3 A;  3I4M J;  3BR2 A;  1LFB A;  1Q1V A;  4CYC A;  2AHQ A;  3PO3 J;  1TWG J;  4JNN A;  1EF4 A;  4AUX A;  3BG5 A;  2XGD A;  3SJM A;  3PM1 A;  1FTT A;  3BNI A;  5IYB J;  3OSG A;  3CDL A;  3BG9 A;  1P7J A;  2DA3 A;  2DMP A;  5EGO B;  3ANP A;  1ITY A;  3HTH A;  2UXO A;  4M3E A;  1WH7 A;  3HKZ N;  3NRG A;  5EF6 A;  2QTQ A;  1P7I A;  5HBU A;  3OIO A;  1BW6 A;  5F04 A;  3BHQ A;  4HKU A;  2HOT A;  1U8B A;  2WB1 N;  3BT9 A;  3G1L A;  1AU7 A;  4V2F A;  2Q24 A;  2DA4 A;  4BXX J;  4D5C A;  2WUI A;  5FLV A;  3IUV A;  5HSZ A;  1R9T J;  3GTP J;  3E7L A;  2ZCM A;  1OCT C;  2R93 J;  1HF0 A;  4NDL A;  1W0T A;  3SDG A;  5J1R A;  2LD5 A;  2IBD A;  2LK2 A;  2Y9Y A;  2H8R A;  2G3B A;  1AKH B;  2DG7 A;  3NPI A;  2QF7 A;  2ID6 A;  1PUF B;  3CMY A;  4DYR A;  3S1M J;  9ANT A;  1HDD C;  2LY9 A;  2O7T A;  3K2A A;  2E2H J;  2X6O A;  2M9H A;  1JT0 A;  5EFY A;  1U9O A;  3A01 A;  3JRI A;  3VW2 A;  5K7Z A;  5GPA A;  2M8G X;  5EZH A;  2LP0 A;  3BTC A;  3JRA A;  3VVZ A;  1TWF J;  3TP3 A;  2XRL A;  4B4C A;  3CRJ A;  3UKG A;  2Y2Z A;  1T33 A;  1CQT A;  2F07 A;  4GCL A;  2GFN A;  3C07 A;  4C3J J;  2W48 A;  3DCF A;  5E3N A;  5EYR A;  3TED A;  3QPL A;  1ETV A;  2X9D A;  2DA1 A;  5C4Y A;  5F08 A;  3HTJ A;  4A3B J;  2EZI A;  3ANG A;  1JUP A;  4DYQ A;  4M3B A;  2UXH A;  1WH5 A;  2XB0 X;  3GTG J;  2MG4 A;  3HOY J;  1E3O C;  2L7Z A;  2X48 A;  3V78 A;  5J3L A;  1GDT A;  2QOP A;  2QKO A;  3AQT A;  3JRG A;  1ZR2 A;  5IP7 J;  4UUS B;  5C4X J;  1MBK A;  1IJW C;  4JP0 A;  4MXM A;  2XDN A;  4DZJ A;  2DMT A;  1X58 A;  2R5Z B;  2HYJ A;  1MBF A;  4QTR A;  2M34 A;  1ZR4 A;  1MBJ A;  1WPK A;  3VW1 A;  5FHP A;  1F36 A;  1MBE A;  3CCY A;  3H3V K;  1WCM J;  2OPT A;  3A02 A;  2CU7 A;  4CGR A;  3FK6 A;  3B6A A;  2Y9Z A;  4BY1 J;  4C2M J;  2E1O A;  2JWT A;  2M2E A;  2YS9 A;  1B72 A;  3VPR A;  5CXG A;  2O7O A;  5D1R A;  1FIA A;  1F43 A;  3CQZ J;  4S0H B;  2DA6 A;  3BCG A;  2FD5 A;  3GTK J;  3HE0 A;  1XG1 A;  3CJD A;  5E3L A;  1JKO C;  4XK4 A;  3ZQC A;  3PO2 J;  2HYT A;  1RKT A;  1MH4 A;  3DEW A;  2H1K A;  2WV1 A;  1GV5 A;  3BR3 A;  4Y52 J;  4UDS A;  2N8G A;  3ON4 A;  3WHC A;  3G56 A;  1TC3 C;  5D18 A;  2K9Q A;  1BL0 A;  3QQA A;  5FMP A;  3MKL A;  4M3G A;  3GTL J;  2DA2 A;  1B8I B;  4X1E A;  1ZK8 A;  3Q0W A;  5GP9 A;  5FLM J;  1U78 A;  4IHY A;  3CWR A;  5IP9 J;  3IV5 A;  3BRU A;  4FCY A;  5IOY A;  3RZO J;  4A3G J;  3D1N I;  3B81 A;  3S16 J;  1WGX A;  2XPW A;  3ZQH A;  5FKO A;  1MSE C;  4G12 A;  1MBH A;  2L7F P;  1LE8 B;  4M3D A;  3HGG A;  4A69 C;  5IOZ A;  5C4J J;  1QRY A;  1G2H A;  3PPB A;  1A6I A;  1GUU A;  2R5Y A;  5K58 A;  2EZL A;  4A3I J;  4D7M A;  5DAJ A;  1ZTR A;  2EQR A;  1AHD P;  3S17 J;  1LFU P;  4W1U A;  1HLV A;  4A3D J;  4PXI A;  3BTJ A;  5JLX A;  1BA5 A;  3GBG A;  4GCK A;  2DMQ A;  5F0C A;  3ON2 A;  1JKP C;  3VIB A;  2QIB A;  1VFC A;  5GPC A;  2CUE A;  2GM4 A;  2LR8 A;  2G7L A;  3LHQ A;  4B3A A;  1H89 C;  3HOV J;  2Y31 A;  3LNQ A;  4NN1 A;  3RZD J;  3G1M A;  1MBG A;  2EZH A;  1QVT A;  3FK7 A;  2VI6 A;  4IHX A;  1YRN B;  2UXI A;  2NP3 A;  2GBY A;  5M3M J;  4A3L J;  2RAE A;  2FJ1 A;  4V2G A;  1NTC A;  3FIW A;  2YU9 J;  2MW8 A;  2K9S A;  4JL3 A;  3M3Y J;  1WI3 A;  1ENH A;  1JUS A;  2K9N A;  3BQY A;  2GLO A;  2JJ7 A;  1H8A C;  2XGC A;  4CYC B;  2I10 A;  4MFD A;  3LSR A;  3C2B A;  1HCR A;  3NAU A;  1IGN A;  4X6A J;  3S1Q J;  1UI5 A;  2RAS A;  4ME9 A;  2O9L A;  5C44 J;  3KKD A;  2L9R A;  2LLK A;  5EZG A;  4BBS J;  5M5Y J;  3OSF A;  4C3H J;  1UI6 A;  1JKQ C;  5FKM A;  2EZK A;  1D5Y A;  1I6H J;  1FTZ A;  4MIM A;  5FJ8 J;  2LTP A;  3S5R A;  1JUM A;  3FRQ A;  3K7A J;  2HOS A;  4IHV A;  1FIP A;  2DA5 A;  2EH3 A;  2XGE A;  3ZQI A;  3F0C A;  3GEU A;  4A3E J;  1Y1V J;  5HAW A;  3LWJ A;  1W0U A;  3KNW A;  1A5J A;  4JKZ A;  3M4O J;  2ZOY A;  3ZQF A;  2ZOZ A;  5DTD A;  4A3J J;  2FX0 A;  4XID A;  4YZE A;  1RR7 A;  2XB5 A;  5K7H A;  5E3O A;  1ETK A;  2V57 A;  4IHW A;  1JGG A;  2D6Y A;  2GEN A;  2FQ4 A;  2QWT A;  4A3K J;  1T56 A;  3HOX J;  4A3F J;  4JX5 A;  3S1R J;  3VOX A;  1UHS A;  1ZKG A;  2LVS A;  3F1B A;  3ZQG A;  3S1N J;  3WHB A;  5BNG A;  3BQZ A;  4DYC A;  3A01 B;  2ZCX A;  1ORK A;  1K61 A;  5EG0 A;  5AQC A;  3JRE A;  4Y7N J;  1UG2 A;  4EEF G;  2FBQ A;  3G7R A;  2CUF A;  4IEJ A;  5F0H A;  1Z77 A;  1RES A;  4L62 A;  3HM5 A;  2CJJ A;  2UXP A;  4FIS A;  4J19 A;  1NK3 P;  2NVT J;  1DU0 A;  1ETQ A;  2OF7 A;  3LJL A;  2R7Z J;  4A3M J;  1IC8 A;  2E19 A;  3VP5 A;  4KWA A;  3RKQ A;  3VOK A;  3VW0 A;  3QPS A;  3MVP A;  2KDZ A;  3RH2 A;  1UMQ A;  2AO9 A;  4HNV A;  2DA7 A;  5CXI A;  3BTI A;  5EDN A;  1FEX A;  2ME0 A;  3HB9 A;  3HOU J;  3IH4 A;  3VVY A;  3TW6 A;  1VF9 A;  2G0E A;  5EGO A;  5J1Y A;  3KKC A;  2YVE A;  2O8K A;  5FKL A;  2DG8 A;  4AC0 A;  3JRB A;  5FKK A;  1TWH J;  4W97 A;  2OI8 A;  2JA7 J;  4GCT A;  2R92 J;  2DN0 A;  5K7F A;  2YUS A;  4ABZ A;  2IAI A;  3BR6 A;  1DU6 A;  2R0Q C;  4RDU A;  4D5F A;  1VND A;  1BJZ A;  2DJN A;  3G1O A;  1JTY A;  4B1R A;  1FJL A;  5D19 A;  3VVX A;  2DTZ A;  2L0K A;  4UUT A;  1YRN A;  1RKW A;  2Y30 A;  1AKH A;  2NX4 A;  2G7S A;  3BR0 A;  4LOC A;  3GTM J;  2ME6 A;  4MLO A;  3LSJ A;  1OFC X;  3BR1 A;  1MH3 A;  1PUF A;  2REK A;  3EUP A;  2HXI A;  5M3F J;  5E3M A;  1B72 B;  1TWC J;  1JJ6 C;  3S2H J;  2W53 A;  1MNM C;  2XSD C;  2HXO A;  4ACI A;  2UXU A;  3S2D J;  4QIW N;  2ECB A;  3LSG A;  3BTL A;  3ZQL A;  3RD3 A;  3HOW J;  1ETO A;  1VI0 A;  4FE7 A;  1K83 J;  3Q0U A;  1TWA J;  4ICH A;  4DZP A;  4AF5 A;  2IU5 A;  2COB A;  2ZCN A;  4RBO A;  1SFO J;  2VKE A;  1QVU A;  3JSJ A;  1XC5 A;  4MO7 A;  3Q3S A;  3LSP A;  2KT0 A;  3B6C A;  2JA8 J;  4XRS A;  4A93 J;  1IV6 A;  4BBR J;  5C3E J;  1GVD A;  1ZGW A;  2PMZ N;  3NAR A;  2XPU A;  2G7G A;  1Z0X A;  5FKN A;  2HOA A;  3QBM A;  3NI7 A;  4XRM A;  5FGL A;  4JX6 A;  2WGB A;  2NP5 A;  3GZI A;  3PAS A;  2L7M P;  4I6Z A;  1GV2 A;  2D5V A;  2R5Y B;  4UUS A;  4M3F A;  3BJB A;  1X2M A;  3FIS A;  1HDP A;  2NOG A;  3ZOB A;  4BKX A;  5IYD J;  3NNR A;  3AQS A;  3EGQ A;  2JA6 J;  5M5X J;  3HTI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...