3FRQA

Structure of the macrolide biosensor protein, mphr(a), with erythromcyin
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
185
structure length
185
Chain Sequence
KLKSDDEVLEAATVVLKRCGPIEFTLSGVAKEVGLSRAALIQRFTNRDTLLVRMMERGVEQVRHYLNAIPIGAGPQGLWEFLQVLVRSMNTRNDFSVNYLISWYELQVPELRTLAIQRNRAVVEGIRKRLPPGAPAAAELLLHSVIAGATMQWAVDPDGELADHVLAQIAAILCLMFPEHDDFQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and function of the macrolide biosensor protein, MphR(A), with and without erythromycin
pubmed doi rcsb
source organism Escherichia coli
molecule tags Dna binding protein
molecule keywords Repressor protein MphR(A)
total genus 65
structure length 185
sequence length 185
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3frqA00
3T6NA 5GPCA 1JT0A 3MNLA 4M3GA 2NP3A 3BR2A 2FX0A 3IH3A 3BHQA 3HTIA 4NN1A 3NNRA 2HXOA 3BR0A 3G1MA 3QPLA 4GCLA 2WGBA 3PASA 4MO7A 5FHPA 2NS7A 3LSJA 4V2FA 3VVYA 3EUPA 2D6YA 5H9TA 3VW0A 3KZ9A 4GCKA 3BCGA 5EZGA 2HQ5A 3C2BA 3DPJA 4ICHA 1RKTA 3FRQA 3BTIA 2GUHA 5FKLA 5F0CA 3BTJA 4ME9A 3VPRA 5EYRA 5F0HA 3ZQGA 3HE0A 3RD3A 1Z0XA 1Z77A 1ORKA 4JL3A 1RPWA 5D1RA 2QIBA 2WUIA 4ACIA 3BR1A 3E7QA 5J1UA 3O8HA 3MVPA 2G7SA 2NP5A 1ZK8A 5CXIA 5FGLA 2VKVA 3NXCA 3P9TA 4I76A 2Y31A 3COLA 4M3BA 3VVXA 2DG8A 4HKUA 2QTQA 1ZKGA 4M3DA 4MK6A 2I10A 1JT6A 4B3AA 2XPWA 5F27A 2ID6A 4W97A 5FMPA 1U9OA 1U9NA 5HAWA 3BR5A 3CDLA 5K58A 3BJBA 3KKCA 2G7LA 2V57A 3WHBA 4GFKA 4CGRA 5F1JA 1T56A 2ZCNA 2O7TA 3VW2A 3NRGA 5CXGA 2G0EA 4DW6A 3S5RA 3IH4A 5F0FA 2QKOA 3ZQFA 3HIMA 5EZHA 3HTHA 3CCYA 3F1BA 3ON2A 2PZ9A 4D7NA 3Q0VA 3VP5A 3GEUA 3SDGA 2OF7A 3O8GA 2UXIA 4UDSA 4AF5A 2OPTA 3VOXA 2XPVA 3VOKA 3CRJA 5F04A 3JSJA 3Q0UA 2WV1A 5D18A 5FKOA 2GENA 4AUXA 4L62A 2XPUA 3QPSA 4D7MA 2HKUA 4YZEA 5IPAA 2FQ4A 3LOCA 3BQYA 2PBXA 5J3LA 3RH2A 2XB5A 4M3FA 2UXHA 3PM1A 5GP9A 3ANGA 2X9DA 3QBMA 3LSRA 2IEKA 5K7FA 3VVZA 3NPIA 3HTAA 2HYJA 4JNNA 5GPAA 1BJZA 3G56A 3VIBA 3LWJA 3ZQLA 2EH3A 1VI0A 2UXOA 1UI5A 3LHQA 3BRUA 2UXPA 3FK7A 2YVEA 3O60A 2XGEA 3FIWA 3QQAA 2NS8A 2HYTA 2JJ7A 3Q3SA 5F08A 5HBUA 2TCTA 1JUMA 3BTLA 5FKMA 2Q24A 3AQTA 1QPIA 2IU5A 3CJDA 1RKWA 3ANPA 3AQSA 3HTJA 2G7GA 3LJLA 2W53A 1QVUA 2REKA 3NI7A 4B1RA 2HXIA 4GCTA 5DAJA 3KKDA 1JUSA 2OERA 2ZCMA 3G1OA 4PXIA 3G1LA 2VPRA 3QKXA 3EGQA 1SGMA 3WHCA 3C07A 3CWRA 5EFYA 3VW1A 4AC0A 3TP0A 4G12A 2G3BA 2OI8A 2ZOYA 3GZIA 1T33A 3TP3A 2FJ1A 2NX4A 3BT9A 3V78A 3LSPA 4W1UA 2FD5A 5D19A 3B6AA 2GBYA 4ABZA 2O7OA 2XGDA 2FBQA 3BR3A 3KNWA 5C4YA 2F07A 2XDNA 4JYKA 3DEWA 5AQCA 2RASA 5IOZA 2X6OA 2DTZA 2ZCXA 3F0CA 4NELA 2IAIA 4KWAA 2XRLA 2ZOZA 3HGGA 2QWTA 3ZQHA 5J1YA 4D5CA 3FK6A 4I6ZA 2QOPA 3B81A 2UXUA 3V6GA 1JTYA 2QCOA 2Y2ZA 4V2GA 5FKKA 5K7HA 2RHAA 4MXMA 3B6CA 2Y30A 2XGCA 3BR6A 3BTCA 2ZB9A 1JTXA 2IBDA 2YVHA 3HGYA 3Q0WA 5CW8A 4XK4A 3IUVA 3PPBA 4AC6A 2GFNA 3IH2A 1UI6A 5IP6A 1JUPA 2JK3A 3G7RA 1A6IA 3VUQA 2RAEA 5J1RA 4GFLA 4JKZA 4X1EA 5HSZA 5IOYA 3SFIA 5FKNA 4D5FA 3BNIA 3BQZA 2TRTA 3DCFA 3ZQIA 1QVTA 2DG7A 2ID3A 5K7ZA 3ON4A 2VKEA 4M3EA
chains in the Genus database with same CATH superfamily
3T6NA 5GPCA 1JT0A 3MNLA 4M3GA 2NP3A 2YVXA 3BR2A 2FX0A 3IH3A 3BHQA 3HTIA 4NN1A 3NNRA 2HXOA 3BR0A 3G1MA 3QPLA 4GCLA 2WGBA 3PASA 4MO7A 5FHPA 2NS7A 3LSJA 4V2FA 3VVYA 3EUPA 2D6YA 5H9TA 3VW0A 3KZ9A 4GCKA 3BCGA 5EZGA 2HQ5A 3C2BA 3DPJA 4ICHA 1RKTA 3FRQA 3BTIA 2GUHA 2PFVA 5F0CA 5FKLA 3BTJA 4ME9A 3VPRA 5EYRA 5F0HA 3ZQGA 3HE0A 3RD3A 1Z0XA 1Z77A 5CQGA 1ORKA 4OD5A 4JL3A 1RPWA 5D1RA 2QIBA 2FJI1 2WUIA 4ACIA 3BR1A 3E7QA 5J1UA 3O8HA 3MVPA 3VTIA 3KYLA 2G7SA 2NP5A 1ZK8A 5CXIA 5FGLA 2VKVA 2B3WA 3NXCA 3P9TA 4I76A 2Y31A 3COLA 4U9LA 4M3BA 3VVXA 2DG8A 4HKUA 2QTQA 1ZKGA 4M3DA 4MK6A 2I10A 1JT6A 2R7WA 4B3AA 2XPWA 5F27A 3DU5A 2ID6A 4W97A 5FMPA 1U9OA 1U9NA 5HAWA 3BR5A 3CDLA 5K58A 3BJBA 3KKCA 2G7LA 2V57A 3WHBA 4GFKA 4CGRA 5F1JA 1T56A 2ZCNA 2O7TA 3VW2A 3NRGA 5CXGA 2G0EA 4DW6A 3S5RA 3DU6A 3IH4A 5F0FA 2QKOA 3ZQFA 5EZHA 3HIMA 3HTHA 3CCYA 3F1BA 3ON2A 2PZ9A 4D7NA 3Q0VA 3VP5A 2R7UA 3GEUA 3SDGA 2OF7A 3O8GA 2UXIA 4UDSA 4AF5A 2OPTA 3VOXA 2XPVA 3VOKA 3CRJA 5F04A 3JSJA 3Q0UA 4DVYP 2WV1A 5D18A 5FKOA 2GENA 4AUXA 4L62A 2XPUA 3QPSA 4D7MA 2HKUA 4YZEA 5IPAA 2FQ4A 3LOCA 3BQYA 2R7QA 2PBXA 5J3LA 2B1EA 3RH2A 2XB5A 4M3FA 2UXHA 3PM1A 5GP9A 3ANGA 2X9DA 3QBMA 3LSRA 2IEKA 5K7FA 3VVZA 3NPIA 3HTAA 2HYJA 4JNNA 5GPAA 1BJZA 3G56A 2R7RA 3K8PC 3FHNA 3VIBA 3LWJA 3ZQLA 2EH3A 1VI0A 2UXOA 1UI5A 3LHQA 3BRUA 2UXPA 3FK7A 2YVEA 3NS4A 3O60A 2XGEA 4C2MA 3FIWA 3QQAA 2NS8A 2HYTA 2JJ7A 3Q3SA 5F08A 5HBUA 2TCTA 1JUMA 3BTLA 5FKMA 2Q24A 3AQTA 1QPIA 2IU5A 3CJDA 1RKWA 3ANPA 3AQSA 3HTJA 2G7GA 3LJLA 2W53A 1QVUA 2REKA 3NI7A 4B1RA 2HXIA 4GCTA 5DAJA 3KKDA 1JUSA 2OERA 2ZCMA 3G1OA 4PXIA 3G1LA 2VPRA 3QKXA 3EGQA 1SGMA 3WHCA 3C07A 3CWRA 5EFYA 3VW1A 4AC0A 2R7TA 3TP0A 4G12A 2G3BA 2OI8A 2ZOYA 3GZIA 1T33A 3TP3A 2FJ1A 2NX4A 3BT9A 3V78A 2R7OA 4WIBA 3LSPA 4W1UA 2FD5A 4IRVA 2R7XA 5D19A 3B6AA 2GBYA 4ABZA 2O7OA 2XGDA 2FBQA 3BR3A 4U9NA 3KNWA 5C4YA 2F07A 2XDNA 4JYKA 3DEWA 5AQCA 2RASA 3SWHA 5IOZA 2X6OA 2DTZA 2ZCXA 3F0CA 4NELA 2IAIA 4KWAA 2XRLA 2ZOZA 3HGGA 2QWTA 3ZQHA 5J1YA 4D5CA 3FK6A 4I6ZA 2QOPA 3B81A 2R7SA 2UXUA 3V6GA 4V2GA 1JTYA 2QCOA 2Y2ZA 4OD4A 5FKKA 5K7HA 2RHAA 4MXMA 3B6CA 2Y30A 2XGCA 3BR6A 3BTCA 2ZB9A 1JTXA 2IBDA 2YVHA 3HGYA 3Q0WA 5CW8A 4XK4A 3IUVA 3PPBA 4AC6A 2GFNA 3IH2A 1UI6A 2R7VA 5IP6A 1JUPA 2JK3A 3G7RA 2ZY9A 1A6IA 3VUQA 2RAEA 5J1RA 4GFLA 4JKZA 4X1EA 5HSZA 5IOYA 2A2FX 3SFIA 5FKNA 4D5FA 3BNIA 3BQZA 2TRTA 3DCFA 3ZQIA 1QVTA 2DG7A 2ID3A 5K7ZA 3ON4A 2VKEA 4M3EA
chains in the Genus database with same CATH topology
3T6NA 5GPCA 1JT0A 3MNLA 4M3GA 2NP3A 3BR2A 2FX0A 3IH3A 3BHQA 3HTIA 4NN1A 3NNRA 2HXOA 3BR0A 3G1MA 3QPLA 4GCLA 2WGBA 3PASA 4MO7A 5FHPA 2NS7A 3LSJA 4V2FA 3VVYA 3EUPA 2D6YA 5H9TA 3VW0A 3KZ9A 4GCKA 3BCGA 5EZGA 2HQ5A 3C2BA 3DPJA 4ICHA 1RKTA 3FRQA 3BTIA 2GUHA 5FKLA 5F0CA 3BTJA 4ME9A 3VPRA 5EYRA 5F0HA 3ZQGA 3HE0A 3RD3A 1Z0XA 1Z77A 1ORKA 4JL3A 1RPWA 5D1RA 2QIBA 2WUIA 4ACIA 3BR1A 3E7QA 5J1UA 3O8HA 3MVPA 2G7SA 2NP5A 1ZK8A 5CXIA 5FGLA 2VKVA 3NXCA 3P9TA 4I76A 2Y31A 3COLA 4M3BA 3VVXA 2DG8A 4HKUA 2QTQA 1ZKGA 4M3DA 4MK6A 2I10A 1JT6A 4B3AA 2XPWA 5F27A 2ID6A 4W97A 5FMPA 1U9OA 1U9NA 5HAWA 3BR5A 3CDLA 5K58A 3BJBA 3KKCA 2G7LA 2V57A 3WHBA 4GFKA 4CGRA 5F1JA 1T56A 2ZCNA 2O7TA 3VW2A 3NRGA 5CXGA 2G0EA 4DW6A 3S5RA 3IH4A 5F0FA 2QKOA 3ZQFA 3HIMA 5EZHA 3HTHA 3CCYA 3F1BA 3ON2A 2PZ9A 4D7NA 3Q0VA 3VP5A 3GEUA 3SDGA 2OF7A 3O8GA 2UXIA 4UDSA 4AF5A 2OPTA 3VOXA 2XPVA 3VOKA 3CRJA 5F04A 3JSJA 3Q0UA 2WV1A 5D18A 5FKOA 2GENA 4AUXA 4L62A 2XPUA 3QPSA 4D7MA 2HKUA 4YZEA 5IPAA 2FQ4A 3LOCA 3BQYA 2PBXA 5J3LA 3RH2A 2XB5A 4M3FA 2UXHA 3PM1A 5GP9A 3ANGA 2X9DA 3QBMA 3LSRA 2IEKA 5K7FA 3VVZA 3NPIA 3HTAA 2HYJA 4JNNA 5GPAA 1BJZA 3G56A 3VIBA 3LWJA 3ZQLA 2EH3A 1VI0A 2UXOA 1UI5A 3LHQA 3BRUA 2UXPA 3FK7A 2YVEA 3O60A 2XGEA 3FIWA 3QQAA 2NS8A 2HYTA 2JJ7A 3Q3SA 5F08A 5HBUA 2TCTA 1JUMA 3BTLA 5FKMA 2Q24A 3AQTA 1QPIA 2IU5A 3CJDA 1RKWA 3ANPA 3AQSA 3HTJA 2G7GA 3LJLA 2W53A 1QVUA 2REKA 3NI7A 4B1RA 2HXIA 4GCTA 5DAJA 3KKDA 1JUSA 2OERA 2ZCMA 3G1OA 4PXIA 3G1LA 2VPRA 3QKXA 3EGQA 1SGMA 3WHCA 3C07A 3CWRA 5EFYA 3VW1A 4AC0A 3TP0A 4G12A 2G3BA 2OI8A 2ZOYA 3GZIA 1T33A 3TP3A 2FJ1A 2NX4A 3BT9A 3V78A 3LSPA 4W1UA 2FD5A 5D19A 3B6AA 2GBYA 4ABZA 2O7OA 2XGDA 2FBQA 3BR3A 3KNWA 5C4YA 2F07A 2XDNA 4JYKA 3DEWA 5AQCA 2RASA 5IOZA 2X6OA 2DTZA 2ZCXA 3F0CA 4NELA 2IAIA 4KWAA 2XRLA 2ZOZA 3HGGA 2QWTA 3ZQHA 5J1YA 4D5CA 3FK6A 4I6ZA 2QOPA 3B81A 2UXUA 3V6GA 1JTYA 2QCOA 2Y2ZA 4V2GA 5FKKA 5K7HA 2RHAA 4MXMA 3B6CA 2Y30A 2XGCA 3BR6A 3BTCA 2ZB9A 1JTXA 2IBDA 2YVHA 3HGYA 3Q0WA 5CW8A 4XK4A 3IUVA 3PPBA 4AC6A 2GFNA 3IH2A 1UI6A 5IP6A 1JUPA 2JK3A 3G7RA 1A6IA 3VUQA 2RAEA 5J1RA 4GFLA 4JKZA 4X1EA 5HSZA 5IOYA 3SFIA 5FKNA 4D5FA 3BNIA 3BQZA 2TRTA 3DCFA 3ZQIA 1QVTA 2DG7A 2ID3A 5K7ZA 3ON4A 2VKEA 4M3EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T6N A;  5GPC A;  1JT0 A;  3MNL A;  4M3G A;  2NP3 A;  3BR2 A;  2FX0 A;  3IH3 A;  3BHQ A;  3HTI A;  4NN1 A;  3NNR A;  2HXO A;  3BR0 A;  3G1M A;  3QPL A;  4GCL A;  2WGB A;  3PAS A;  4MO7 A;  5FHP A;  2NS7 A;  3LSJ A;  4V2F A;  3VVY A;  3EUP A;  2D6Y A;  5H9T A;  3VW0 A;  3KZ9 A;  4GCK A;  3BCG A;  5EZG A;  2HQ5 A;  3C2B A;  3DPJ A;  4ICH A;  1RKT A;  3FRQ A;  3BTI A;  2GUH A;  5FKL A;  5F0C A;  3BTJ A;  4ME9 A;  3VPR A;  5EYR A;  5F0H A;  3ZQG A;  3HE0 A;  3RD3 A;  1Z0X A;  1Z77 A;  1ORK A;  4JL3 A;  1RPW A;  5D1R A;  2QIB A;  2WUI A;  4ACI A;  3BR1 A;  3E7Q A;  5J1U A;  3O8H A;  3MVP A;  2G7S A;  2NP5 A;  1ZK8 A;  5CXI A;  5FGL A;  2VKV A;  3NXC A;  3P9T A;  4I76 A;  2Y31 A;  3COL A;  4M3B A;  3VVX A;  2DG8 A;  4HKU A;  2QTQ A;  1ZKG A;  4M3D A;  4MK6 A;  2I10 A;  1JT6 A;  4B3A A;  2XPW A;  5F27 A;  2ID6 A;  4W97 A;  5FMP A;  1U9O A;  1U9N A;  5HAW A;  3BR5 A;  3CDL A;  5K58 A;  3BJB A;  3KKC A;  2G7L A;  2V57 A;  3WHB A;  4GFK A;  4CGR A;  5F1J A;  1T56 A;  2ZCN A;  2O7T A;  3VW2 A;  3NRG A;  5CXG A;  2G0E A;  4DW6 A;  3S5R A;  3IH4 A;  5F0F A;  2QKO A;  3ZQF A;  3HIM A;  5EZH A;  3HTH A;  3CCY A;  3F1B A;  3ON2 A;  2PZ9 A;  4D7N A;  3Q0V A;  3VP5 A;  3GEU A;  3SDG A;  2OF7 A;  3O8G A;  2UXI A;  4UDS A;  4AF5 A;  2OPT A;  3VOX A;  2XPV A;  3VOK A;  3CRJ A;  5F04 A;  3JSJ A;  3Q0U A;  2WV1 A;  5D18 A;  5FKO A;  2GEN A;  4AUX A;  4L62 A;  2XPU A;  3QPS A;  4D7M A;  2HKU A;  4YZE A;  5IPA A;  2FQ4 A;  3LOC A;  3BQY A;  2PBX A;  5J3L A;  3RH2 A;  2XB5 A;  4M3F A;  2UXH A;  3PM1 A;  5GP9 A;  3ANG A;  2X9D A;  3QBM A;  3LSR A;  2IEK A;  5K7F A;  3VVZ A;  3NPI A;  3HTA A;  2HYJ A;  4JNN A;  5GPA A;  1BJZ A;  3G56 A;  3VIB A;  3LWJ A;  3ZQL A;  2EH3 A;  1VI0 A;  2UXO A;  1UI5 A;  3LHQ A;  3BRU A;  2UXP A;  3FK7 A;  2YVE A;  3O60 A;  2XGE A;  3FIW A;  3QQA A;  2NS8 A;  2HYT A;  2JJ7 A;  3Q3S A;  5F08 A;  5HBU A;  2TCT A;  1JUM A;  3BTL A;  5FKM A;  2Q24 A;  3AQT A;  1QPI A;  2IU5 A;  3CJD A;  1RKW A;  3ANP A;  3AQS A;  3HTJ A;  2G7G A;  3LJL A;  2W53 A;  1QVU A;  2REK A;  3NI7 A;  4B1R A;  2HXI A;  4GCT A;  5DAJ A;  3KKD A;  1JUS A;  2OER A;  2ZCM A;  3G1O A;  4PXI A;  3G1L A;  2VPR A;  3QKX A;  3EGQ A;  1SGM A;  3WHC A;  3C07 A;  3CWR A;  5EFY A;  3VW1 A;  4AC0 A;  3TP0 A;  4G12 A;  2G3B A;  2OI8 A;  2ZOY A;  3GZI A;  1T33 A;  3TP3 A;  2FJ1 A;  2NX4 A;  3BT9 A;  3V78 A;  3LSP A;  4W1U A;  2FD5 A;  5D19 A;  3B6A A;  2GBY A;  4ABZ A;  2O7O A;  2XGD A;  2FBQ A;  3BR3 A;  3KNW A;  5C4Y A;  2F07 A;  2XDN A;  4JYK A;  3DEW A;  5AQC A;  2RAS A;  5IOZ A;  2X6O A;  2DTZ A;  2ZCX A;  3F0C A;  4NEL A;  2IAI A;  4KWA A;  2XRL A;  2ZOZ A;  3HGG A;  2QWT A;  3ZQH A;  5J1Y A;  4D5C A;  3FK6 A;  4I6Z A;  2QOP A;  3B81 A;  2UXU A;  3V6G A;  1JTY A;  2QCO A;  2Y2Z A;  4V2G A;  5FKK A;  5K7H A;  2RHA A;  4MXM A;  3B6C A;  2Y30 A;  2XGC A;  3BR6 A;  3BTC A;  2ZB9 A;  1JTX A;  2IBD A;  2YVH A;  3HGY A;  3Q0W A;  5CW8 A;  4XK4 A;  3IUV A;  3PPB A;  4AC6 A;  2GFN A;  3IH2 A;  1UI6 A;  5IP6 A;  1JUP A;  2JK3 A;  3G7R A;  1A6I A;  3VUQ A;  2RAE A;  5J1R A;  4GFL A;  4JKZ A;  4X1E A;  5HSZ A;  5IOY A;  3SFI A;  5FKN A;  4D5F A;  3BNI A;  3BQZ A;  2TRT A;  3DCF A;  3ZQI A;  1QVT A;  2DG7 A;  2ID3 A;  5K7Z A;  3ON4 A;  2VKE A;  4M3E A; 
#chains in the Genus database with same CATH topology
 3T6N A;  5GPC A;  1JT0 A;  3MNL A;  4M3G A;  2NP3 A;  2YVX A;  3BR2 A;  2FX0 A;  3IH3 A;  3BHQ A;  3HTI A;  4NN1 A;  3NNR A;  2HXO A;  3BR0 A;  3G1M A;  3QPL A;  4GCL A;  2WGB A;  3PAS A;  4MO7 A;  5FHP A;  2NS7 A;  3LSJ A;  4V2F A;  3VVY A;  3EUP A;  2D6Y A;  5H9T A;  3VW0 A;  3KZ9 A;  4GCK A;  3BCG A;  5EZG A;  2HQ5 A;  3C2B A;  3DPJ A;  4ICH A;  1RKT A;  3FRQ A;  3BTI A;  2GUH A;  2PFV A;  5F0C A;  5FKL A;  3BTJ A;  4ME9 A;  3VPR A;  5EYR A;  5F0H A;  3ZQG A;  3HE0 A;  3RD3 A;  1Z0X A;  1Z77 A;  5CQG A;  1ORK A;  4OD5 A;  4JL3 A;  1RPW A;  5D1R A;  2QIB A;  2FJI 1;  2WUI A;  4ACI A;  3BR1 A;  3E7Q A;  5J1U A;  3O8H A;  3MVP A;  3VTI A;  3KYL A;  2G7S A;  2NP5 A;  1ZK8 A;  5CXI A;  5FGL A;  2VKV A;  2B3W A;  3NXC A;  3P9T A;  4I76 A;  2Y31 A;  3COL A;  4U9L A;  4M3B A;  3VVX A;  2DG8 A;  4HKU A;  2QTQ A;  1ZKG A;  4M3D A;  4MK6 A;  2I10 A;  1JT6 A;  2R7W A;  4B3A A;  2XPW A;  5F27 A;  3DU5 A;  2ID6 A;  4W97 A;  5FMP A;  1U9O A;  1U9N A;  5HAW A;  3BR5 A;  3CDL A;  5K58 A;  3BJB A;  3KKC A;  2G7L A;  2V57 A;  3WHB A;  4GFK A;  4CGR A;  5F1J A;  1T56 A;  2ZCN A;  2O7T A;  3VW2 A;  3NRG A;  5CXG A;  2G0E A;  4DW6 A;  3S5R A;  3DU6 A;  3IH4 A;  5F0F A;  2QKO A;  3ZQF A;  5EZH A;  3HIM A;  3HTH A;  3CCY A;  3F1B A;  3ON2 A;  2PZ9 A;  4D7N A;  3Q0V A;  3VP5 A;  2R7U A;  3GEU A;  3SDG A;  2OF7 A;  3O8G A;  2UXI A;  4UDS A;  4AF5 A;  2OPT A;  3VOX A;  2XPV A;  3VOK A;  3CRJ A;  5F04 A;  3JSJ A;  3Q0U A;  4DVY P;  2WV1 A;  5D18 A;  5FKO A;  2GEN A;  4AUX A;  4L62 A;  2XPU A;  3QPS A;  4D7M A;  2HKU A;  4YZE A;  5IPA A;  2FQ4 A;  3LOC A;  3BQY A;  2R7Q A;  2PBX A;  5J3L A;  2B1E A;  3RH2 A;  2XB5 A;  4M3F A;  2UXH A;  3PM1 A;  5GP9 A;  3ANG A;  2X9D A;  3QBM A;  3LSR A;  2IEK A;  5K7F A;  3VVZ A;  3NPI A;  3HTA A;  2HYJ A;  4JNN A;  5GPA A;  1BJZ A;  3G56 A;  2R7R A;  3K8P C;  3FHN A;  3VIB A;  3LWJ A;  3ZQL A;  2EH3 A;  1VI0 A;  2UXO A;  1UI5 A;  3LHQ A;  3BRU A;  2UXP A;  3FK7 A;  2YVE A;  3NS4 A;  3O60 A;  2XGE A;  4C2M A;  3FIW A;  3QQA A;  2NS8 A;  2HYT A;  2JJ7 A;  3Q3S A;  5F08 A;  5HBU A;  2TCT A;  1JUM A;  3BTL A;  5FKM A;  2Q24 A;  3AQT A;  1QPI A;  2IU5 A;  3CJD A;  1RKW A;  3ANP A;  3AQS A;  3HTJ A;  2G7G A;  3LJL A;  2W53 A;  1QVU A;  2REK A;  3NI7 A;  4B1R A;  2HXI A;  4GCT A;  5DAJ A;  3KKD A;  1JUS A;  2OER A;  2ZCM A;  3G1O A;  4PXI A;  3G1L A;  2VPR A;  3QKX A;  3EGQ A;  1SGM A;  3WHC A;  3C07 A;  3CWR A;  5EFY A;  3VW1 A;  4AC0 A;  2R7T A;  3TP0 A;  4G12 A;  2G3B A;  2OI8 A;  2ZOY A;  3GZI A;  1T33 A;  3TP3 A;  2FJ1 A;  2NX4 A;  3BT9 A;  3V78 A;  2R7O A;  4WIB A;  3LSP A;  4W1U A;  2FD5 A;  4IRV A;  2R7X A;  5D19 A;  3B6A A;  2GBY A;  4ABZ A;  2O7O A;  2XGD A;  2FBQ A;  3BR3 A;  4U9N A;  3KNW A;  5C4Y A;  2F07 A;  2XDN A;  4JYK A;  3DEW A;  5AQC A;  2RAS A;  3SWH A;  5IOZ A;  2X6O A;  2DTZ A;  2ZCX A;  3F0C A;  4NEL A;  2IAI A;  4KWA A;  2XRL A;  2ZOZ A;  3HGG A;  2QWT A;  3ZQH A;  5J1Y A;  4D5C A;  3FK6 A;  4I6Z A;  2QOP A;  3B81 A;  2R7S A;  2UXU A;  3V6G A;  4V2G A;  1JTY A;  2QCO A;  2Y2Z A;  4OD4 A;  5FKK A;  5K7H A;  2RHA A;  4MXM A;  3B6C A;  2Y30 A;  2XGC A;  3BR6 A;  3BTC A;  2ZB9 A;  1JTX A;  2IBD A;  2YVH A;  3HGY A;  3Q0W A;  5CW8 A;  4XK4 A;  3IUV A;  3PPB A;  4AC6 A;  2GFN A;  3IH2 A;  1UI6 A;  2R7V A;  5IP6 A;  1JUP A;  2JK3 A;  3G7R A;  2ZY9 A;  1A6I A;  3VUQ A;  2RAE A;  5J1R A;  4GFL A;  4JKZ A;  4X1E A;  5HSZ A;  5IOY A;  2A2F X;  3SFI A;  5FKN A;  4D5F A;  3BNI A;  3BQZ A;  2TRT A;  3DCF A;  3ZQI A;  1QVT A;  2DG7 A;  2ID3 A;  5K7Z A;  3ON4 A;  2VKE A;  4M3E A; 
#chains in the Genus database with same CATH homology
 3T6N A;  5GPC A;  1JT0 A;  3MNL A;  4M3G A;  2NP3 A;  3BR2 A;  2FX0 A;  3IH3 A;  3BHQ A;  3HTI A;  4NN1 A;  3NNR A;  2HXO A;  3BR0 A;  3G1M A;  3QPL A;  4GCL A;  2WGB A;  3PAS A;  4MO7 A;  5FHP A;  2NS7 A;  3LSJ A;  4V2F A;  3VVY A;  3EUP A;  2D6Y A;  5H9T A;  3VW0 A;  3KZ9 A;  4GCK A;  3BCG A;  5EZG A;  2HQ5 A;  3C2B A;  3DPJ A;  4ICH A;  1RKT A;  3FRQ A;  3BTI A;  2GUH A;  5FKL A;  5F0C A;  3BTJ A;  4ME9 A;  3VPR A;  5EYR A;  5F0H A;  3ZQG A;  3HE0 A;  3RD3 A;  1Z0X A;  1Z77 A;  1ORK A;  4JL3 A;  1RPW A;  5D1R A;  2QIB A;  2WUI A;  4ACI A;  3BR1 A;  3E7Q A;  5J1U A;  3O8H A;  3MVP A;  2G7S A;  2NP5 A;  1ZK8 A;  5CXI A;  5FGL A;  2VKV A;  3NXC A;  3P9T A;  4I76 A;  2Y31 A;  3COL A;  4M3B A;  3VVX A;  2DG8 A;  4HKU A;  2QTQ A;  1ZKG A;  4M3D A;  4MK6 A;  2I10 A;  1JT6 A;  4B3A A;  2XPW A;  5F27 A;  2ID6 A;  4W97 A;  5FMP A;  1U9O A;  1U9N A;  5HAW A;  3BR5 A;  3CDL A;  5K58 A;  3BJB A;  3KKC A;  2G7L A;  2V57 A;  3WHB A;  4GFK A;  4CGR A;  5F1J A;  1T56 A;  2ZCN A;  2O7T A;  3VW2 A;  3NRG A;  5CXG A;  2G0E A;  4DW6 A;  3S5R A;  3IH4 A;  5F0F A;  2QKO A;  3ZQF A;  3HIM A;  5EZH A;  3HTH A;  3CCY A;  3F1B A;  3ON2 A;  2PZ9 A;  4D7N A;  3Q0V A;  3VP5 A;  3GEU A;  3SDG A;  2OF7 A;  3O8G A;  2UXI A;  4UDS A;  4AF5 A;  2OPT A;  3VOX A;  2XPV A;  3VOK A;  3CRJ A;  5F04 A;  3JSJ A;  3Q0U A;  2WV1 A;  5D18 A;  5FKO A;  2GEN A;  4AUX A;  4L62 A;  2XPU A;  3QPS A;  4D7M A;  2HKU A;  4YZE A;  5IPA A;  2FQ4 A;  3LOC A;  3BQY A;  2PBX A;  5J3L A;  3RH2 A;  2XB5 A;  4M3F A;  2UXH A;  3PM1 A;  5GP9 A;  3ANG A;  2X9D A;  3QBM A;  3LSR A;  2IEK A;  5K7F A;  3VVZ A;  3NPI A;  3HTA A;  2HYJ A;  4JNN A;  5GPA A;  1BJZ A;  3G56 A;  3VIB A;  3LWJ A;  3ZQL A;  2EH3 A;  1VI0 A;  2UXO A;  1UI5 A;  3LHQ A;  3BRU A;  2UXP A;  3FK7 A;  2YVE A;  3O60 A;  2XGE A;  3FIW A;  3QQA A;  2NS8 A;  2HYT A;  2JJ7 A;  3Q3S A;  5F08 A;  5HBU A;  2TCT A;  1JUM A;  3BTL A;  5FKM A;  2Q24 A;  3AQT A;  1QPI A;  2IU5 A;  3CJD A;  1RKW A;  3ANP A;  3AQS A;  3HTJ A;  2G7G A;  3LJL A;  2W53 A;  1QVU A;  2REK A;  3NI7 A;  4B1R A;  2HXI A;  4GCT A;  5DAJ A;  3KKD A;  1JUS A;  2OER A;  2ZCM A;  3G1O A;  4PXI A;  3G1L A;  2VPR A;  3QKX A;  3EGQ A;  1SGM A;  3WHC A;  3C07 A;  3CWR A;  5EFY A;  3VW1 A;  4AC0 A;  3TP0 A;  4G12 A;  2G3B A;  2OI8 A;  2ZOY A;  3GZI A;  1T33 A;  3TP3 A;  2FJ1 A;  2NX4 A;  3BT9 A;  3V78 A;  3LSP A;  4W1U A;  2FD5 A;  5D19 A;  3B6A A;  2GBY A;  4ABZ A;  2O7O A;  2XGD A;  2FBQ A;  3BR3 A;  3KNW A;  5C4Y A;  2F07 A;  2XDN A;  4JYK A;  3DEW A;  5AQC A;  2RAS A;  5IOZ A;  2X6O A;  2DTZ A;  2ZCX A;  3F0C A;  4NEL A;  2IAI A;  4KWA A;  2XRL A;  2ZOZ A;  3HGG A;  2QWT A;  3ZQH A;  5J1Y A;  4D5C A;  3FK6 A;  4I6Z A;  2QOP A;  3B81 A;  2UXU A;  3V6G A;  1JTY A;  2QCO A;  2Y2Z A;  4V2G A;  5FKK A;  5K7H A;  2RHA A;  4MXM A;  3B6C A;  2Y30 A;  2XGC A;  3BR6 A;  3BTC A;  2ZB9 A;  1JTX A;  2IBD A;  2YVH A;  3HGY A;  3Q0W A;  5CW8 A;  4XK4 A;  3IUV A;  3PPB A;  4AC6 A;  2GFN A;  3IH2 A;  1UI6 A;  5IP6 A;  1JUP A;  2JK3 A;  3G7R A;  1A6I A;  3VUQ A;  2RAE A;  5J1R A;  4GFL A;  4JKZ A;  4X1E A;  5HSZ A;  5IOY A;  3SFI A;  5FKN A;  4D5F A;  3BNI A;  3BQZ A;  2TRT A;  3DCF A;  3ZQI A;  1QVT A;  2DG7 A;  2ID3 A;  5K7Z A;  3ON4 A;  2VKE A;  4M3E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...