3FRQA

Structure of the macrolide biosensor protein, mphr(a), with erythromcyin
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
185
structure length
185
Chain Sequence
b'KLKSDDEVLEAATVVLKRCGPIEFTLSGVAKEVGLSRAALIQRFTNRDTLLVRMMERGVEQVRHYLNAIPIGAGPQGLWEFLQVLVRSMNTRNDFSVNYLISWYELQVPELRTLAIQRNRAVVEGIRKRLPPGAPAAAELLLHSVIAGATMQWAVDPDGELADHVLAQIAAILCLMFPEHDDFQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Repressor protein MphR(A)
publication title Structure and function of the macrolide biosensor protein, MphR(A), with and without erythromycin
pubmed doi rcsb
source organism Escherichia coli
molecule tags Dna binding protein
total genus 65
structure length 185
sequence length 185
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3frqA00
1RPWA 1ORKA 4AUXA 3NNRA 5J1RA 5K58A 2PBXA 4UDSA 2FJ1A 2Y31A 3G7RA 5GPCA 3BT9A 3O8GA 3VIBA 3HIMA 2VKVA 2QIBA 3RD3A 3LSJA 3S5RA 2Y30A 2REKA 5IPAA 4M3FA 2FX0A 1BJZA 4M3BA 3JSJA 4M3EA 2ZCMA 3WHCA 3C2BA 1JT0A 5FKMA 2ZB9A 5CXIA 3WHBA 3IH2A 4CGRA 2UXHA 3TP3A 3BR5A 3CRJA 2G7GA 1JUPA 4HKUA 4AF5A 3VW2A 4JL3A 2GUHA 2UXUA 3ZQHA 2X6OA 2QOPA 5J3LA 5AQCA 2PZ9A 3VOKA 3FK7A 2XGEA 5FKLA 2HYTA 1RKWA 3F1BA 2IEKA 3BQZA 3VPRA 1VI0A 2GBYA 4I76A 3G1MA 2XDNA 1ZKGA 3VW1A 2G7LA 2G7SA 1RKTA 2NS8A 5FKOA 2WV1A 1UI6A 5GPAA 3BR3A 4MK6A 3KKDA 3DPJA 2ID3A 3VP5A 3BTIA 5K7FA 4MO7A 3NXCA 3HTAA 5EFYA 1JUSA 3HTJA 1Z77A 2VPRA 3G1OA 2RASA 2NP5A 2XRLA 5K7ZA 5F0CA 4D7MA 3VVYA 3EGQA 2UXPA 3P9TA 2I10A 3LSPA 5IOYA 3DEWA 3CDLA 2O7TA 3QBMA 3ON4A 3ZQFA 5EZHA 3ZQGA 2D6YA 3ANPA 3FIWA 3KZ9A 2QTQA 4GCTA 3O8HA 3ON2A 5FGLA 2XB5A 3B6CA 2HYJA 5D1RA 5K7HA 3Q0VA 3MVPA 3BR0A 4X1EA 4B1RA 4GCKA 2HXOA 2ZCNA 3LWJA 3COLA 3IUVA 4B3AA 3SDGA 2HQ5A 3EUPA 5FHPA 5FKNA 2OF7A 4DW6A 1T56A 3VOXA 2FBQA 3HGGA 2IBDA 2ZCXA 3IH3A 5F0HA 3BJBA 3GEUA 3TP0A 4PXIA 3KKCA 3FRQA 3Q0UA 2G3BA 2ZOZA 3F0CA 3QPLA 2NX4A 4W97A 5FMPA 2DG8A 1QVTA 2O7OA 4JKZA 3Q3SA 2GFNA 3ZQIA 3O60A 1U9OA 5CXGA 2YVHA 2XPVA 3DCFA 1U9NA 3BRUA 4JNNA 4D5CA 3BR2A 4ABZA 5H9TA 1A6IA 3HTIA 1QPIA 5F08A 4KWAA 5GP9A 2GENA 3NI7A 4GCLA 2XGDA 2W53A 3IH4A 1QVUA 3G56A 3G1LA 5F04A 5D18A 3BNIA 3ZQLA 2OI8A 3KNWA 5J1UA 2EH3A 1T33A 1JTYA 2Y2ZA 3LJLA 4GFLA 5IOZA 5HAWA 3MNLA 3V78A 3CCYA 2G0EA 2UXIA 4I6ZA 2OERA 4AC0A 5F27A 3E7QA 4L62A 3VUQA 3RH2A 5CW8A 1ZK8A 2WGBA 1UI5A 3B6AA 4G12A 3LSRA 3LOCA 2Q24A 2QCOA 3HE0A 3QKXA 3T6NA 4NN1A 3AQTA 1JT6A 1SGMA 2DTZA 2IAIA 3CJDA 2V57A 4D5FA 3PM1A 3BR1A 2F07A 3V6GA 3FK6A 2FD5A 3PPBA 2NP3A 5FKKA 4YZEA 5HBUA 3BTCA 3CWRA 4V2GA 4V2FA 3QQAA 2TRTA 3LHQA 4ME9A 2HKUA 5J1YA 5F1JA 1JUMA 3BR6A 2HXIA 3C07A 4AC6A 4XK4A 1JTXA 1Z0XA 4GFKA 3NRGA 3QPSA 2FQ4A 2UXOA 4ICHA 3ANGA 2QWTA 5IP6A 2JJ7A 5HSZA 2WUIA 4JYKA 4M3DA 3GZIA 2NS7A 2RHAA 3BCGA 2RAEA 4NELA 2ID6A 3SFIA 2XPUA 3AQSA 3VW0A 3PASA 3VVXA 5D19A 3BQYA 3BTJA 3BTLA 3NPIA 3Q0WA 4M3GA 2XGCA 3BHQA 2YVEA 5F0FA 3VVZA 2QKOA 4W1UA 3HGYA 2JK3A 2OPTA 5EYRA 3B81A 4MXMA 2X9DA 5C4YA 5DAJA 2VKEA 5EZGA 2IU5A 4ACIA 4D7NA 2DG7A 2XPWA 2TCTA 2ZOYA 3HTHA
chains in the Genus database with same CATH superfamily
1RPWA 1ORKA 4AUXA 3NNRA 5J1RA 5K58A 2PBXA 4UDSA 2FJ1A 2Y31A 3G7RA 5GPCA 3BT9A 3O8GA 3VIBA 3HIMA 2VKVA 2QIBA 3RD3A 3LSJA 3S5RA 2Y30A 2REKA 5IPAA 4M3FA 2FX0A 1BJZA 4M3BA 3JSJA 4M3EA 2ZCMA 3WHCA 3C2BA 1JT0A 4IRVA 5FKMA 4U9NA 2ZB9A 4OD4A 5CXIA 3IH2A 3WHBA 4CGRA 2UXHA 3TP3A 3BR5A 3CRJA 2G7GA 1JUPA 4HKUA 4AF5A 3VW2A 4JL3A 2GUHA 2UXUA 3ZQHA 2X6OA 2QOPA 5J3LA 5AQCA 2PZ9A 3VOKA 3FK7A 2XGEA 5FKLA 2HYTA 1RKWA 3F1BA 2IEKA 3BQZA 3VPRA 1VI0A 2R7SA 2GBYA 4I76A 3G1MA 2XDNA 1ZKGA 3VW1A 2G7LA 2G7SA 1RKTA 2R7RA 2NS8A 5FKOA 2WV1A 1UI6A 5GPAA 3BR3A 4MK6A 5CQGA 3KKDA 3DPJA 2ID3A 3VP5A 3BTIA 5K7FA 4MO7A 3NXCA 3FHNA 2R7XA 3HTAA 5EFYA 1JUSA 2R7UA 3HTJA 1Z77A 2VPRA 3G1OA 2RASA 2NP5A 2XRLA 5K7ZA 5F0CA 4D7MA 3VVYA 3EGQA 2UXPA 3P9TA 2I10A 3LSPA 5IOYA 3DEWA 3CDLA 2O7TA 3QBMA 3ON4A 2R7VA 3DU6A 5EZHA 3ZQFA 3ZQGA 2D6YA 3ANPA 3FIWA 3KZ9A 2QTQA 4GCTA 3O8HA 3ON2A 5FGLA 2XB5A 3B6CA 2HYJA 5D1RA 5K7HA 3SWHA 3Q0VA 3MVPA 3BR0A 4X1EA 4B1RA 4GCKA 2HXOA 2ZCNA 3LWJA 3COLA 3IUVA 4B3AA 3SDGA 2HQ5A 4U9LA 3EUPA 5FHPA 5FKNA 2OF7A 4DW6A 1T56A 3VOXA 2FBQA 3HGGA 2IBDA 2ZCXA 4DVYP 3IH3A 5F0HA 3BJBA 4WIBA 3GEUA 3TP0A 4PXIA 3KKCA 3FRQA 3Q0UA 2G3BA 2ZOZA 3F0CA 3QPLA 2B3WA 2NX4A 4W97A 5FMPA 2DG8A 1QVTA 2B1EA 2O7OA 4JKZA 3Q3SA 2GFNA 3ZQIA 3O60A 1U9OA 4OD5A 5CXGA 2YVHA 2XPVA 3DCFA 1U9NA 3BRUA 4JNNA 4D5CA 3BR2A 4ABZA 5H9TA 1A6IA 3HTIA 1QPIA 5F08A 4KWAA 5GP9A 2GENA 3KYLA 3NI7A 4GCLA 2XGDA 2R7TA 2W53A 3IH4A 2PFVA 1QVUA 3G56A 2FJI1 3G1LA 5F04A 2R7QA 5D18A 3BNIA 3ZQLA 2OI8A 2A2FX 3KNWA 5J1UA 2EH3A 1T33A 1JTYA 2Y2ZA 3LJLA 4GFLA 5IOZA 5HAWA 3MNLA 3V78A 3CCYA 3NS4A 2G0EA 2UXIA 4I6ZA 2OERA 4AC0A 5F27A 3E7QA 4L62A 3VUQA 3RH2A 5CW8A 1ZK8A 3VTIA 2WGBA 1UI5A 3B6AA 4G12A 3LSRA 3LOCA 2Q24A 4C2MA 2QCOA 3HE0A 3QKXA 3T6NA 4NN1A 3AQTA 1JT6A 1SGMA 2DTZA 2IAIA 3CJDA 2V57A 4D5FA 3PM1A 2R7WA 3BR1A 2R7OA 2F07A 3V6GA 3FK6A 2FD5A 3PPBA 2NP3A 5FKKA 4YZEA 5HBUA 3BTCA 3CWRA 4V2GA 4V2FA 3QQAA 2TRTA 3LHQA 4ME9A 2HKUA 5J1YA 5F1JA 1JUMA 3BR6A 2HXIA 3C07A 4AC6A 4XK4A 1JTXA 1Z0XA 4GFKA 3NRGA 3QPSA 2FQ4A 2UXOA 4ICHA 3DU5A 3ANGA 2QWTA 5IP6A 2JJ7A 5HSZA 2WUIA 4JYKA 4M3DA 2ZY9A 3GZIA 2NS7A 2RHAA 3BCGA 2RAEA 4NELA 2ID6A 3SFIA 2XPUA 3AQSA 3VW0A 3K8PC 3PASA 3VVXA 5D19A 3BQYA 3BTJA 3BTLA 3NPIA 3Q0WA 4M3GA 2XGCA 3BHQA 2YVEA 5F0FA 3VVZA 2QKOA 4W1UA 3HGYA 2JK3A 2OPTA 5EYRA 3B81A 4MXMA 2X9DA 5C4YA 5DAJA 2VKEA 2YVXA 5EZGA 2IU5A 4ACIA 4D7NA 2DG7A 2XPWA 2TCTA 2ZOYA 3HTHA
chains in the Genus database with same CATH topology
1RPWA 1ORKA 4AUXA 3NNRA 5J1RA 5K58A 2PBXA 4UDSA 2FJ1A 2Y31A 3G7RA 5GPCA 3BT9A 3O8GA 3VIBA 3HIMA 2VKVA 2QIBA 3RD3A 3LSJA 3S5RA 2Y30A 2REKA 5IPAA 4M3FA 2FX0A 1BJZA 4M3BA 3JSJA 4M3EA 2ZCMA 3WHCA 3C2BA 1JT0A 5FKMA 2ZB9A 5CXIA 3WHBA 3IH2A 4CGRA 2UXHA 3TP3A 3BR5A 3CRJA 2G7GA 1JUPA 4HKUA 4AF5A 3VW2A 4JL3A 2GUHA 2UXUA 3ZQHA 2X6OA 2QOPA 5J3LA 5AQCA 2PZ9A 3VOKA 3FK7A 2XGEA 5FKLA 2HYTA 1RKWA 3F1BA 2IEKA 3BQZA 3VPRA 1VI0A 2GBYA 4I76A 3G1MA 2XDNA 1ZKGA 3VW1A 2G7LA 2G7SA 1RKTA 2NS8A 5FKOA 2WV1A 1UI6A 5GPAA 3BR3A 4MK6A 3KKDA 3DPJA 2ID3A 3VP5A 3BTIA 5K7FA 4MO7A 3NXCA 3HTAA 5EFYA 1JUSA 3HTJA 1Z77A 2VPRA 3G1OA 2RASA 2NP5A 2XRLA 5K7ZA 5F0CA 4D7MA 3VVYA 3EGQA 2UXPA 3P9TA 2I10A 3LSPA 5IOYA 3DEWA 3CDLA 2O7TA 3QBMA 3ON4A 3ZQFA 5EZHA 3ZQGA 2D6YA 3ANPA 3FIWA 3KZ9A 2QTQA 4GCTA 3O8HA 3ON2A 5FGLA 2XB5A 3B6CA 2HYJA 5D1RA 5K7HA 3Q0VA 3MVPA 3BR0A 4X1EA 4B1RA 4GCKA 2HXOA 2ZCNA 3LWJA 3COLA 3IUVA 4B3AA 3SDGA 2HQ5A 3EUPA 5FHPA 5FKNA 2OF7A 4DW6A 1T56A 3VOXA 2FBQA 3HGGA 2IBDA 2ZCXA 3IH3A 5F0HA 3BJBA 3GEUA 3TP0A 4PXIA 3KKCA 3FRQA 3Q0UA 2G3BA 2ZOZA 3F0CA 3QPLA 2NX4A 4W97A 5FMPA 2DG8A 1QVTA 2O7OA 4JKZA 3Q3SA 2GFNA 3ZQIA 3O60A 1U9OA 5CXGA 2YVHA 2XPVA 3DCFA 1U9NA 3BRUA 4JNNA 4D5CA 3BR2A 4ABZA 5H9TA 1A6IA 3HTIA 1QPIA 5F08A 4KWAA 5GP9A 2GENA 3NI7A 4GCLA 2XGDA 2W53A 3IH4A 1QVUA 3G56A 3G1LA 5F04A 5D18A 3BNIA 3ZQLA 2OI8A 3KNWA 5J1UA 2EH3A 1T33A 1JTYA 2Y2ZA 3LJLA 4GFLA 5IOZA 5HAWA 3MNLA 3V78A 3CCYA 2G0EA 2UXIA 4I6ZA 2OERA 4AC0A 5F27A 3E7QA 4L62A 3VUQA 3RH2A 5CW8A 1ZK8A 2WGBA 1UI5A 3B6AA 4G12A 3LSRA 3LOCA 2Q24A 2QCOA 3HE0A 3QKXA 3T6NA 4NN1A 3AQTA 1JT6A 1SGMA 2DTZA 2IAIA 3CJDA 2V57A 4D5FA 3PM1A 3BR1A 2F07A 3V6GA 3FK6A 2FD5A 3PPBA 2NP3A 5FKKA 4YZEA 5HBUA 3BTCA 3CWRA 4V2GA 4V2FA 3QQAA 2TRTA 3LHQA 4ME9A 2HKUA 5J1YA 5F1JA 1JUMA 3BR6A 2HXIA 3C07A 4AC6A 4XK4A 1JTXA 1Z0XA 4GFKA 3NRGA 3QPSA 2FQ4A 2UXOA 4ICHA 3ANGA 2QWTA 5IP6A 2JJ7A 5HSZA 2WUIA 4JYKA 4M3DA 3GZIA 2NS7A 2RHAA 3BCGA 2RAEA 4NELA 2ID6A 3SFIA 2XPUA 3AQSA 3VW0A 3PASA 3VVXA 5D19A 3BQYA 3BTJA 3BTLA 3NPIA 3Q0WA 4M3GA 2XGCA 3BHQA 2YVEA 5F0FA 3VVZA 2QKOA 4W1UA 3HGYA 2JK3A 2OPTA 5EYRA 3B81A 4MXMA 2X9DA 5C4YA 5DAJA 2VKEA 5EZGA 2IU5A 4ACIA 4D7NA 2DG7A 2XPWA 2TCTA 2ZOYA 3HTHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RPW A;  1ORK A;  4AUX A;  3NNR A;  5J1R A;  5K58 A;  2PBX A;  4UDS A;  2FJ1 A;  2Y31 A;  3G7R A;  5GPC A;  3BT9 A;  3O8G A;  3VIB A;  3HIM A;  2VKV A;  2QIB A;  3RD3 A;  3LSJ A;  3S5R A;  2Y30 A;  2REK A;  5IPA A;  4M3F A;  2FX0 A;  1BJZ A;  4M3B A;  3JSJ A;  4M3E A;  2ZCM A;  3WHC A;  3C2B A;  1JT0 A;  5FKM A;  2ZB9 A;  5CXI A;  3WHB A;  3IH2 A;  4CGR A;  2UXH A;  3TP3 A;  3BR5 A;  3CRJ A;  2G7G A;  1JUP A;  4HKU A;  4AF5 A;  3VW2 A;  4JL3 A;  2GUH A;  2UXU A;  3ZQH A;  2X6O A;  2QOP A;  5J3L A;  5AQC A;  2PZ9 A;  3VOK A;  3FK7 A;  2XGE A;  5FKL A;  2HYT A;  1RKW A;  3F1B A;  2IEK A;  3BQZ A;  3VPR A;  1VI0 A;  2GBY A;  4I76 A;  3G1M A;  2XDN A;  1ZKG A;  3VW1 A;  2G7L A;  2G7S A;  1RKT A;  2NS8 A;  5FKO A;  2WV1 A;  1UI6 A;  5GPA A;  3BR3 A;  4MK6 A;  3KKD A;  3DPJ A;  2ID3 A;  3VP5 A;  3BTI A;  5K7F A;  4MO7 A;  3NXC A;  3HTA A;  5EFY A;  1JUS A;  3HTJ A;  1Z77 A;  2VPR A;  3G1O A;  2RAS A;  2NP5 A;  2XRL A;  5K7Z A;  5F0C A;  4D7M A;  3VVY A;  3EGQ A;  2UXP A;  3P9T A;  2I10 A;  3LSP A;  5IOY A;  3DEW A;  3CDL A;  2O7T A;  3QBM A;  3ON4 A;  3ZQF A;  5EZH A;  3ZQG A;  2D6Y A;  3ANP A;  3FIW A;  3KZ9 A;  2QTQ A;  4GCT A;  3O8H A;  3ON2 A;  5FGL A;  2XB5 A;  3B6C A;  2HYJ A;  5D1R A;  5K7H A;  3Q0V A;  3MVP A;  3BR0 A;  4X1E A;  4B1R A;  4GCK A;  2HXO A;  2ZCN A;  3LWJ A;  3COL A;  3IUV A;  4B3A A;  3SDG A;  2HQ5 A;  3EUP A;  5FHP A;  5FKN A;  2OF7 A;  4DW6 A;  1T56 A;  3VOX A;  2FBQ A;  3HGG A;  2IBD A;  2ZCX A;  3IH3 A;  5F0H A;  3BJB A;  3GEU A;  3TP0 A;  4PXI A;  3KKC A;  3FRQ A;  3Q0U A;  2G3B A;  2ZOZ A;  3F0C A;  3QPL A;  2NX4 A;  4W97 A;  5FMP A;  2DG8 A;  1QVT A;  2O7O A;  4JKZ A;  3Q3S A;  2GFN A;  3ZQI A;  3O60 A;  1U9O A;  5CXG A;  2YVH A;  2XPV A;  3DCF A;  1U9N A;  3BRU A;  4JNN A;  4D5C A;  3BR2 A;  4ABZ A;  5H9T A;  1A6I A;  3HTI A;  1QPI A;  5F08 A;  4KWA A;  5GP9 A;  2GEN A;  3NI7 A;  4GCL A;  2XGD A;  2W53 A;  3IH4 A;  1QVU A;  3G56 A;  3G1L A;  5F04 A;  5D18 A;  3BNI A;  3ZQL A;  2OI8 A;  3KNW A;  5J1U A;  2EH3 A;  1T33 A;  1JTY A;  2Y2Z A;  3LJL A;  4GFL A;  5IOZ A;  5HAW A;  3MNL A;  3V78 A;  3CCY A;  2G0E A;  2UXI A;  4I6Z A;  2OER A;  4AC0 A;  5F27 A;  3E7Q A;  4L62 A;  3VUQ A;  3RH2 A;  5CW8 A;  1ZK8 A;  2WGB A;  1UI5 A;  3B6A A;  4G12 A;  3LSR A;  3LOC A;  2Q24 A;  2QCO A;  3HE0 A;  3QKX A;  3T6N A;  4NN1 A;  3AQT A;  1JT6 A;  1SGM A;  2DTZ A;  2IAI A;  3CJD A;  2V57 A;  4D5F A;  3PM1 A;  3BR1 A;  2F07 A;  3V6G A;  3FK6 A;  2FD5 A;  3PPB A;  2NP3 A;  5FKK A;  4YZE A;  5HBU A;  3BTC A;  3CWR A;  4V2G A;  4V2F A;  3QQA A;  2TRT A;  3LHQ A;  4ME9 A;  2HKU A;  5J1Y A;  5F1J A;  1JUM A;  3BR6 A;  2HXI A;  3C07 A;  4AC6 A;  4XK4 A;  1JTX A;  1Z0X A;  4GFK A;  3NRG A;  3QPS A;  2FQ4 A;  2UXO A;  4ICH A;  3ANG A;  2QWT A;  5IP6 A;  2JJ7 A;  5HSZ A;  2WUI A;  4JYK A;  4M3D A;  3GZI A;  2NS7 A;  2RHA A;  3BCG A;  2RAE A;  4NEL A;  2ID6 A;  3SFI A;  2XPU A;  3AQS A;  3VW0 A;  3PAS A;  3VVX A;  5D19 A;  3BQY A;  3BTJ A;  3BTL A;  3NPI A;  3Q0W A;  4M3G A;  2XGC A;  3BHQ A;  2YVE A;  5F0F A;  3VVZ A;  2QKO A;  4W1U A;  3HGY A;  2JK3 A;  2OPT A;  5EYR A;  3B81 A;  4MXM A;  2X9D A;  5C4Y A;  5DAJ A;  2VKE A;  5EZG A;  2IU5 A;  4ACI A;  4D7N A;  2DG7 A;  2XPW A;  2TCT A;  2ZOY A;  3HTH A; 
#chains in the Genus database with same CATH topology
 1RPW A;  1ORK A;  4AUX A;  3NNR A;  5J1R A;  5K58 A;  2PBX A;  4UDS A;  2FJ1 A;  2Y31 A;  3G7R A;  5GPC A;  3BT9 A;  3O8G A;  3VIB A;  3HIM A;  2VKV A;  2QIB A;  3RD3 A;  3LSJ A;  3S5R A;  2Y30 A;  2REK A;  5IPA A;  4M3F A;  2FX0 A;  1BJZ A;  4M3B A;  3JSJ A;  4M3E A;  2ZCM A;  3WHC A;  3C2B A;  1JT0 A;  4IRV A;  5FKM A;  4U9N A;  2ZB9 A;  4OD4 A;  5CXI A;  3IH2 A;  3WHB A;  4CGR A;  2UXH A;  3TP3 A;  3BR5 A;  3CRJ A;  2G7G A;  1JUP A;  4HKU A;  4AF5 A;  3VW2 A;  4JL3 A;  2GUH A;  2UXU A;  3ZQH A;  2X6O A;  2QOP A;  5J3L A;  5AQC A;  2PZ9 A;  3VOK A;  3FK7 A;  2XGE A;  5FKL A;  2HYT A;  1RKW A;  3F1B A;  2IEK A;  3BQZ A;  3VPR A;  1VI0 A;  2R7S A;  2GBY A;  4I76 A;  3G1M A;  2XDN A;  1ZKG A;  3VW1 A;  2G7L A;  2G7S A;  1RKT A;  2R7R A;  2NS8 A;  5FKO A;  2WV1 A;  1UI6 A;  5GPA A;  3BR3 A;  4MK6 A;  5CQG A;  3KKD A;  3DPJ A;  2ID3 A;  3VP5 A;  3BTI A;  5K7F A;  4MO7 A;  3NXC A;  3FHN A;  2R7X A;  3HTA A;  5EFY A;  1JUS A;  2R7U A;  3HTJ A;  1Z77 A;  2VPR A;  3G1O A;  2RAS A;  2NP5 A;  2XRL A;  5K7Z A;  5F0C A;  4D7M A;  3VVY A;  3EGQ A;  2UXP A;  3P9T A;  2I10 A;  3LSP A;  5IOY A;  3DEW A;  3CDL A;  2O7T A;  3QBM A;  3ON4 A;  2R7V A;  3DU6 A;  5EZH A;  3ZQF A;  3ZQG A;  2D6Y A;  3ANP A;  3FIW A;  3KZ9 A;  2QTQ A;  4GCT A;  3O8H A;  3ON2 A;  5FGL A;  2XB5 A;  3B6C A;  2HYJ A;  5D1R A;  5K7H A;  3SWH A;  3Q0V A;  3MVP A;  3BR0 A;  4X1E A;  4B1R A;  4GCK A;  2HXO A;  2ZCN A;  3LWJ A;  3COL A;  3IUV A;  4B3A A;  3SDG A;  2HQ5 A;  4U9L A;  3EUP A;  5FHP A;  5FKN A;  2OF7 A;  4DW6 A;  1T56 A;  3VOX A;  2FBQ A;  3HGG A;  2IBD A;  2ZCX A;  4DVY P;  3IH3 A;  5F0H A;  3BJB A;  4WIB A;  3GEU A;  3TP0 A;  4PXI A;  3KKC A;  3FRQ A;  3Q0U A;  2G3B A;  2ZOZ A;  3F0C A;  3QPL A;  2B3W A;  2NX4 A;  4W97 A;  5FMP A;  2DG8 A;  1QVT A;  2B1E A;  2O7O A;  4JKZ A;  3Q3S A;  2GFN A;  3ZQI A;  3O60 A;  1U9O A;  4OD5 A;  5CXG A;  2YVH A;  2XPV A;  3DCF A;  1U9N A;  3BRU A;  4JNN A;  4D5C A;  3BR2 A;  4ABZ A;  5H9T A;  1A6I A;  3HTI A;  1QPI A;  5F08 A;  4KWA A;  5GP9 A;  2GEN A;  3KYL A;  3NI7 A;  4GCL A;  2XGD A;  2R7T A;  2W53 A;  3IH4 A;  2PFV A;  1QVU A;  3G56 A;  2FJI 1;  3G1L A;  5F04 A;  2R7Q A;  5D18 A;  3BNI A;  3ZQL A;  2OI8 A;  2A2F X;  3KNW A;  5J1U A;  2EH3 A;  1T33 A;  1JTY A;  2Y2Z A;  3LJL A;  4GFL A;  5IOZ A;  5HAW A;  3MNL A;  3V78 A;  3CCY A;  3NS4 A;  2G0E A;  2UXI A;  4I6Z A;  2OER A;  4AC0 A;  5F27 A;  3E7Q A;  4L62 A;  3VUQ A;  3RH2 A;  5CW8 A;  1ZK8 A;  3VTI A;  2WGB A;  1UI5 A;  3B6A A;  4G12 A;  3LSR A;  3LOC A;  2Q24 A;  4C2M A;  2QCO A;  3HE0 A;  3QKX A;  3T6N A;  4NN1 A;  3AQT A;  1JT6 A;  1SGM A;  2DTZ A;  2IAI A;  3CJD A;  2V57 A;  4D5F A;  3PM1 A;  2R7W A;  3BR1 A;  2R7O A;  2F07 A;  3V6G A;  3FK6 A;  2FD5 A;  3PPB A;  2NP3 A;  5FKK A;  4YZE A;  5HBU A;  3BTC A;  3CWR A;  4V2G A;  4V2F A;  3QQA A;  2TRT A;  3LHQ A;  4ME9 A;  2HKU A;  5J1Y A;  5F1J A;  1JUM A;  3BR6 A;  2HXI A;  3C07 A;  4AC6 A;  4XK4 A;  1JTX A;  1Z0X A;  4GFK A;  3NRG A;  3QPS A;  2FQ4 A;  2UXO A;  4ICH A;  3DU5 A;  3ANG A;  2QWT A;  5IP6 A;  2JJ7 A;  5HSZ A;  2WUI A;  4JYK A;  4M3D A;  2ZY9 A;  3GZI A;  2NS7 A;  2RHA A;  3BCG A;  2RAE A;  4NEL A;  2ID6 A;  3SFI A;  2XPU A;  3AQS A;  3VW0 A;  3K8P C;  3PAS A;  3VVX A;  5D19 A;  3BQY A;  3BTJ A;  3BTL A;  3NPI A;  3Q0W A;  4M3G A;  2XGC A;  3BHQ A;  2YVE A;  5F0F A;  3VVZ A;  2QKO A;  4W1U A;  3HGY A;  2JK3 A;  2OPT A;  5EYR A;  3B81 A;  4MXM A;  2X9D A;  5C4Y A;  5DAJ A;  2VKE A;  2YVX A;  5EZG A;  2IU5 A;  4ACI A;  4D7N A;  2DG7 A;  2XPW A;  2TCT A;  2ZOY A;  3HTH A; 
#chains in the Genus database with same CATH homology
 1RPW A;  1ORK A;  4AUX A;  3NNR A;  5J1R A;  5K58 A;  2PBX A;  4UDS A;  2FJ1 A;  2Y31 A;  3G7R A;  5GPC A;  3BT9 A;  3O8G A;  3VIB A;  3HIM A;  2VKV A;  2QIB A;  3RD3 A;  3LSJ A;  3S5R A;  2Y30 A;  2REK A;  5IPA A;  4M3F A;  2FX0 A;  1BJZ A;  4M3B A;  3JSJ A;  4M3E A;  2ZCM A;  3WHC A;  3C2B A;  1JT0 A;  5FKM A;  2ZB9 A;  5CXI A;  3WHB A;  3IH2 A;  4CGR A;  2UXH A;  3TP3 A;  3BR5 A;  3CRJ A;  2G7G A;  1JUP A;  4HKU A;  4AF5 A;  3VW2 A;  4JL3 A;  2GUH A;  2UXU A;  3ZQH A;  2X6O A;  2QOP A;  5J3L A;  5AQC A;  2PZ9 A;  3VOK A;  3FK7 A;  2XGE A;  5FKL A;  2HYT A;  1RKW A;  3F1B A;  2IEK A;  3BQZ A;  3VPR A;  1VI0 A;  2GBY A;  4I76 A;  3G1M A;  2XDN A;  1ZKG A;  3VW1 A;  2G7L A;  2G7S A;  1RKT A;  2NS8 A;  5FKO A;  2WV1 A;  1UI6 A;  5GPA A;  3BR3 A;  4MK6 A;  3KKD A;  3DPJ A;  2ID3 A;  3VP5 A;  3BTI A;  5K7F A;  4MO7 A;  3NXC A;  3HTA A;  5EFY A;  1JUS A;  3HTJ A;  1Z77 A;  2VPR A;  3G1O A;  2RAS A;  2NP5 A;  2XRL A;  5K7Z A;  5F0C A;  4D7M A;  3VVY A;  3EGQ A;  2UXP A;  3P9T A;  2I10 A;  3LSP A;  5IOY A;  3DEW A;  3CDL A;  2O7T A;  3QBM A;  3ON4 A;  3ZQF A;  5EZH A;  3ZQG A;  2D6Y A;  3ANP A;  3FIW A;  3KZ9 A;  2QTQ A;  4GCT A;  3O8H A;  3ON2 A;  5FGL A;  2XB5 A;  3B6C A;  2HYJ A;  5D1R A;  5K7H A;  3Q0V A;  3MVP A;  3BR0 A;  4X1E A;  4B1R A;  4GCK A;  2HXO A;  2ZCN A;  3LWJ A;  3COL A;  3IUV A;  4B3A A;  3SDG A;  2HQ5 A;  3EUP A;  5FHP A;  5FKN A;  2OF7 A;  4DW6 A;  1T56 A;  3VOX A;  2FBQ A;  3HGG A;  2IBD A;  2ZCX A;  3IH3 A;  5F0H A;  3BJB A;  3GEU A;  3TP0 A;  4PXI A;  3KKC A;  3FRQ A;  3Q0U A;  2G3B A;  2ZOZ A;  3F0C A;  3QPL A;  2NX4 A;  4W97 A;  5FMP A;  2DG8 A;  1QVT A;  2O7O A;  4JKZ A;  3Q3S A;  2GFN A;  3ZQI A;  3O60 A;  1U9O A;  5CXG A;  2YVH A;  2XPV A;  3DCF A;  1U9N A;  3BRU A;  4JNN A;  4D5C A;  3BR2 A;  4ABZ A;  5H9T A;  1A6I A;  3HTI A;  1QPI A;  5F08 A;  4KWA A;  5GP9 A;  2GEN A;  3NI7 A;  4GCL A;  2XGD A;  2W53 A;  3IH4 A;  1QVU A;  3G56 A;  3G1L A;  5F04 A;  5D18 A;  3BNI A;  3ZQL A;  2OI8 A;  3KNW A;  5J1U A;  2EH3 A;  1T33 A;  1JTY A;  2Y2Z A;  3LJL A;  4GFL A;  5IOZ A;  5HAW A;  3MNL A;  3V78 A;  3CCY A;  2G0E A;  2UXI A;  4I6Z A;  2OER A;  4AC0 A;  5F27 A;  3E7Q A;  4L62 A;  3VUQ A;  3RH2 A;  5CW8 A;  1ZK8 A;  2WGB A;  1UI5 A;  3B6A A;  4G12 A;  3LSR A;  3LOC A;  2Q24 A;  2QCO A;  3HE0 A;  3QKX A;  3T6N A;  4NN1 A;  3AQT A;  1JT6 A;  1SGM A;  2DTZ A;  2IAI A;  3CJD A;  2V57 A;  4D5F A;  3PM1 A;  3BR1 A;  2F07 A;  3V6G A;  3FK6 A;  2FD5 A;  3PPB A;  2NP3 A;  5FKK A;  4YZE A;  5HBU A;  3BTC A;  3CWR A;  4V2G A;  4V2F A;  3QQA A;  2TRT A;  3LHQ A;  4ME9 A;  2HKU A;  5J1Y A;  5F1J A;  1JUM A;  3BR6 A;  2HXI A;  3C07 A;  4AC6 A;  4XK4 A;  1JTX A;  1Z0X A;  4GFK A;  3NRG A;  3QPS A;  2FQ4 A;  2UXO A;  4ICH A;  3ANG A;  2QWT A;  5IP6 A;  2JJ7 A;  5HSZ A;  2WUI A;  4JYK A;  4M3D A;  3GZI A;  2NS7 A;  2RHA A;  3BCG A;  2RAE A;  4NEL A;  2ID6 A;  3SFI A;  2XPU A;  3AQS A;  3VW0 A;  3PAS A;  3VVX A;  5D19 A;  3BQY A;  3BTJ A;  3BTL A;  3NPI A;  3Q0W A;  4M3G A;  2XGC A;  3BHQ A;  2YVE A;  5F0F A;  3VVZ A;  2QKO A;  4W1U A;  3HGY A;  2JK3 A;  2OPT A;  5EYR A;  3B81 A;  4MXM A;  2X9D A;  5C4Y A;  5DAJ A;  2VKE A;  5EZG A;  2IU5 A;  4ACI A;  4D7N A;  2DG7 A;  2XPW A;  2TCT A;  2ZOY A;  3HTH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...