3FRQA

Structure of the macrolide biosensor protein, mphr(a), with erythromcyin
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
185
structure length
185
Chain Sequence
KLKSDDEVLEAATVVLKRCGPIEFTLSGVAKEVGLSRAALIQRFTNRDTLLVRMMERGVEQVRHYLNAIPIGAGPQGLWEFLQVLVRSMNTRNDFSVNYLISWYELQVPELRTLAIQRNRAVVEGIRKRLPPGAPAAAELLLHSVIAGATMQWAVDPDGELADHVLAQIAAILCLMFPEHDDFQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Repressor protein MphR(A)
publication title Structure and function of the macrolide biosensor protein, MphR(A), with and without erythromycin
pubmed doi rcsb
source organism Escherichia coli
molecule tags Dna binding protein
total genus 65
structure length 185
sequence length 185
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3frqA00
4GCLA 3FK7A 3TP3A 2UXPA 4MXMA 4M3EA 4D7MA 3BT9A 3LSPA 4GFKA 3BR3A 3CWRA 4I6ZA 3HE0A 2QCOA 2X9DA 3QKXA 3ZQGA 2QOPA 1BJZA 2GFNA 4V2GA 3E7QA 3VVYA 2GUHA 3S5RA 2Y30A 5CXIA 3FRQA 2Y2ZA 1Z0XA 3KKCA 3ON2A 3DCFA 5CXGA 2QIBA 4MO7A 3LOCA 3MVPA 5H9TA 2RASA 3KNWA 3VP5A 2OF7A 2DTZA 3CDLA 5FGLA 2XPWA 2XPVA 3SFIA 3F1BA 3HTHA 3O8HA 1JTXA 3NRGA 3DEWA 4YZEA 2X6OA 3ZQHA 2G7SA 2XRLA 3RH2A 3TP0A 2HQ5A 3AQTA 3BTCA 5GPCA 4ABZA 2TRTA 5J1RA 1JUPA 2WV1A 3LSJA 1VI0A 3GZIA 2FQ4A 3Q0VA 2XB5A 5D19A 3HTIA 2G7GA 4NN1A 4AF5A 5CW8A 4W97A 2RAEA 1ZKGA 2IAIA 5K7ZA 3JSJA 5HBUA 3PASA 1JT0A 2VKEA 2XGDA 3B6AA 5HAWA 4D5FA 4I76A 3O60A 4KWAA 5IOYA 3NPIA 3G1MA 3O8GA 3BR0A 2ID3A 1UI6A 3Q0UA 2YVEA 5F04A 2VKVA 3BR1A 2DG7A 3RD3A 2NP5A 2ZB9A 5F1JA 2QKOA 2UXOA 3F0CA 3BCGA 3VUQA 4AC0A 1T56A 2XDNA 4GFLA 4MK6A 2TCTA 5GPAA 4JYKA 3QBMA 3KKDA 3ANPA 2UXIA 5K58A 5C4YA 5DAJA 2NS7A 3VW0A 2ZOZA 4JKZA 3LHQA 4PXIA 3KZ9A 2EH3A 5J3LA 3WHCA 2W53A 2FD5A 3Q3SA 1RKWA 2OPTA 5FKMA 1UI5A 4V2FA 1QVTA 2HKUA 2O7TA 2IBDA 3G7RA 2FBQA 3AQSA 4M3GA 3GEUA 3BR5A 3ZQLA 2IEKA 2XPUA 3VVZA 3BJBA 3IH2A 4ME9A 2HYTA 4D7NA 5FHPA 5K7FA 5IPAA 1SGMA 2ZCMA 1U9OA 3B6CA 3IH3A 3HGGA 2G0EA 1ZK8A 4GCTA 5IOZA 2UXUA 2F07A 2JK3A 2YVHA 3LWJA 5IP6A 2HYJA 5FKKA 2PBXA 2QTQA 3CCYA 4M3FA 2NP3A 3IH4A 2REKA 2OI8A 1JUMA 4D5CA 2GBYA 5F27A 3G1LA 2HXIA 2OERA 5FMPA 2G7LA 3C2BA 2ZCXA 4HKUA 2UXHA 3FIWA 5K7HA 5F0HA 4W1UA 3LSRA 1T33A 3P9TA 3QQAA 3LJLA 3COLA 2JJ7A 5HSZA 2ID6A 4G12A 4X1EA 3CRJA 4NELA 2ZCNA 1RPWA 2NS8A 3ON4A 3ZQFA 3PPBA 5FKNA 3VW2A 5EYRA 3G1OA 3QPLA 3HIMA 5AQCA 5FKOA 4L62A 5J1UA 2I10A 3G56A 5D1RA 3IUVA 4XK4A 3BNIA 5F0FA 2GENA 4JNNA 2ZOYA 3NNRA 3ZQIA 3BQYA 2VPRA 3PM1A 1RKTA 3SDGA 1QPIA 2D6YA 2FX0A 3VIBA 3ANGA 3VW1A 2XGEA 5EZGA 4UDSA 3BRUA 5GP9A 4M3BA 4M3DA 3WHBA 5F0CA 2RHAA 3MNLA 4AC6A 2FJ1A 2WUIA 2HXOA 1QVUA 3EUPA 1JUSA 2Q24A 3FK6A 1ORKA 5EZHA 3CJDA 3VVXA 2NX4A 4B3AA 3B81A 3V78A 3HTAA 3VPRA 3HGYA 1JTYA 2O7OA 4GCKA 1U9NA 3DPJA 3V6GA 2V57A 3NXCA 2XGCA 2PZ9A 2Y31A 2DG8A 4B1RA 3Q0WA 5F08A 5J1YA 1Z77A 4ACIA 3C07A 5FKLA 1A6IA 3VOKA 4JL3A 3VOXA 3BR6A 3BTLA 2IU5A 3QPSA 4ICHA 4DW6A 2G3BA 5EFYA 3BR2A 3HTJA 3BQZA 2WGBA 2QWTA 3T6NA 5D18A 4AUXA 3EGQA 3BHQA 1JT6A 3BTJA 4CGRA 3BTIA 3NI7A
chains in the Genus database with same CATH superfamily
4GCLA 3FK7A 3TP3A 2UXPA 4MXMA 4M3EA 4D7MA 3BT9A 3LSPA 4GFKA 3BR3A 3CWRA 4I6ZA 3HE0A 2QCOA 2X9DA 3QKXA 3ZQGA 2QOPA 1BJZA 2GFNA 2R7WA 4V2GA 3E7QA 3VVYA 2GUHA 3K8PC 4U9LA 3S5RA 2Y30A 5CXIA 3FRQA 2Y2ZA 1Z0XA 3KKCA 3ON2A 3DCFA 5CXGA 2QIBA 4MO7A 3LOCA 3MVPA 5H9TA 2RASA 3DU6A 3KNWA 3VP5A 2OF7A 2DTZA 3CDLA 5FGLA 2XPWA 2XPVA 3SFIA 3F1BA 3HTHA 3O8HA 1JTXA 3NRGA 3DEWA 4YZEA 2X6OA 3ZQHA 2G7SA 2XRLA 3RH2A 3TP0A 2HQ5A 3AQTA 3BTCA 5GPCA 4ABZA 2TRTA 5J1RA 1JUPA 2WV1A 3LSJA 1VI0A 3GZIA 2FQ4A 3Q0VA 2XB5A 5D19A 2A2FX 4C2MA 3HTIA 3NS4A 2G7GA 4NN1A 4AF5A 5CW8A 2R7XA 4W97A 2RAEA 1ZKGA 2IAIA 5K7ZA 3JSJA 5HBUA 3PASA 1JT0A 2VKEA 2XGDA 3B6AA 5HAWA 4D5FA 4I76A 2PFVA 3O60A 4KWAA 5IOYA 3NPIA 3G1MA 3O8GA 3BR0A 2ID3A 1UI6A 3Q0UA 2YVEA 5F04A 2VKVA 2FJI1 3BR1A 2DG7A 3RD3A 2NP5A 2ZB9A 5F1JA 2QKOA 2UXOA 3F0CA 3BCGA 3VUQA 4AC0A 1T56A 2XDNA 4GFLA 4MK6A 2TCTA 5GPAA 4JYKA 3QBMA 3KKDA 3ANPA 2UXIA 5K58A 5CQGA 5C4YA 5DAJA 2NS7A 3VW0A 2ZOZA 4JKZA 3LHQA 4PXIA 3DU5A 3KZ9A 2EH3A 5J3LA 3WHCA 2W53A 2FD5A 3Q3SA 4DVYP 1RKWA 2OPTA 5FKMA 1UI5A 4V2FA 1QVTA 2HKUA 2O7TA 2IBDA 3G7RA 2FBQA 3AQSA 4M3GA 3GEUA 2R7SA 3BR5A 3ZQLA 2IEKA 2XPUA 3VVZA 3BJBA 3IH2A 4ME9A 2HYTA 4D7NA 5FHPA 5K7FA 5IPAA 1SGMA 2ZCMA 1U9OA 3B6CA 3IH3A 3HGGA 2G0EA 1ZK8A 4GCTA 5IOZA 2UXUA 2F07A 2JK3A 3KYLA 2YVHA 3LWJA 5IP6A 2HYJA 5FKKA 2PBXA 2QTQA 3CCYA 4M3FA 2NP3A 3IH4A 2REKA 2OI8A 1JUMA 4D5CA 2GBYA 5F27A 2R7RA 3G1LA 2HXIA 2OERA 5FMPA 2G7LA 3C2BA 2ZCXA 4HKUA 2UXHA 3FIWA 5K7HA 5F0HA 4W1UA 3LSRA 1T33A 3P9TA 3SWHA 2B3WA 3QQAA 3LJLA 3COLA 2JJ7A 5HSZA 2ID6A 4G12A 4X1EA 3CRJA 4NELA 2ZCNA 1RPWA 2NS8A 3ON4A 3ZQFA 3PPBA 5FKNA 3VW2A 5EYRA 3G1OA 3QPLA 3HIMA 2R7UA 5AQCA 4U9NA 5FKOA 4L62A 5J1UA 2I10A 3G56A 5D1RA 3IUVA 4XK4A 3FHNA 3BNIA 5F0FA 2ZY9A 2GENA 4JNNA 2ZOYA 3NNRA 3ZQIA 3BQYA 4OD4A 2VPRA 3PM1A 1RKTA 3SDGA 1QPIA 2D6YA 2R7QA 2FX0A 3VIBA 3ANGA 3VTIA 3VW1A 2XGEA 5EZGA 4UDSA 3BRUA 5GP9A 4M3BA 4M3DA 3WHBA 5F0CA 2YVXA 2RHAA 3MNLA 4AC6A 2FJ1A 2WUIA 2HXOA 1QVUA 3EUPA 1JUSA 2Q24A 2R7OA 3FK6A 1ORKA 5EZHA 3CJDA 3VVXA 2NX4A 4B3AA 3B81A 3V78A 3HTAA 3VPRA 3HGYA 1JTYA 2B1EA 2O7OA 4GCKA 1U9NA 3DPJA 3V6GA 2V57A 4IRVA 4OD5A 2R7TA 3NXCA 2XGCA 2PZ9A 2Y31A 2DG8A 4B1RA 3Q0WA 5F08A 5J1YA 1Z77A 2R7VA 4ACIA 3C07A 5FKLA 1A6IA 3VOKA 4JL3A 3VOXA 3BR6A 3BTLA 2IU5A 3QPSA 4WIBA 4ICHA 4DW6A 2G3BA 5EFYA 3BR2A 3HTJA 3BQZA 2WGBA 2QWTA 3T6NA 5D18A 4AUXA 3EGQA 3BHQA 1JT6A 3BTJA 4CGRA 3BTIA 3NI7A
chains in the Genus database with same CATH topology
4GCLA 3FK7A 3TP3A 2UXPA 4MXMA 4M3EA 4D7MA 3BT9A 3LSPA 4GFKA 3BR3A 3CWRA 4I6ZA 3HE0A 2QCOA 2X9DA 3QKXA 3ZQGA 2QOPA 1BJZA 2GFNA 4V2GA 3E7QA 3VVYA 2GUHA 3S5RA 2Y30A 5CXIA 3FRQA 2Y2ZA 1Z0XA 3KKCA 3ON2A 3DCFA 5CXGA 2QIBA 4MO7A 3LOCA 3MVPA 5H9TA 2RASA 3KNWA 3VP5A 2OF7A 2DTZA 3CDLA 5FGLA 2XPWA 2XPVA 3SFIA 3F1BA 3HTHA 3O8HA 1JTXA 3NRGA 3DEWA 4YZEA 2X6OA 3ZQHA 2G7SA 2XRLA 3RH2A 3TP0A 2HQ5A 3AQTA 3BTCA 5GPCA 4ABZA 2TRTA 5J1RA 1JUPA 2WV1A 3LSJA 1VI0A 3GZIA 2FQ4A 3Q0VA 2XB5A 5D19A 3HTIA 2G7GA 4NN1A 4AF5A 5CW8A 4W97A 2RAEA 1ZKGA 2IAIA 5K7ZA 3JSJA 5HBUA 3PASA 1JT0A 2VKEA 2XGDA 3B6AA 5HAWA 4D5FA 4I76A 3O60A 4KWAA 5IOYA 3NPIA 3G1MA 3O8GA 3BR0A 2ID3A 1UI6A 3Q0UA 2YVEA 5F04A 2VKVA 3BR1A 2DG7A 3RD3A 2NP5A 2ZB9A 5F1JA 2QKOA 2UXOA 3F0CA 3BCGA 3VUQA 4AC0A 1T56A 2XDNA 4GFLA 4MK6A 2TCTA 5GPAA 4JYKA 3QBMA 3KKDA 3ANPA 2UXIA 5K58A 5C4YA 5DAJA 2NS7A 3VW0A 2ZOZA 4JKZA 3LHQA 4PXIA 3KZ9A 2EH3A 5J3LA 3WHCA 2W53A 2FD5A 3Q3SA 1RKWA 2OPTA 5FKMA 1UI5A 4V2FA 1QVTA 2HKUA 2O7TA 2IBDA 3G7RA 2FBQA 3AQSA 4M3GA 3GEUA 3BR5A 3ZQLA 2IEKA 2XPUA 3VVZA 3BJBA 3IH2A 4ME9A 2HYTA 4D7NA 5FHPA 5K7FA 5IPAA 1SGMA 2ZCMA 1U9OA 3B6CA 3IH3A 3HGGA 2G0EA 1ZK8A 4GCTA 5IOZA 2UXUA 2F07A 2JK3A 2YVHA 3LWJA 5IP6A 2HYJA 5FKKA 2PBXA 2QTQA 3CCYA 4M3FA 2NP3A 3IH4A 2REKA 2OI8A 1JUMA 4D5CA 2GBYA 5F27A 3G1LA 2HXIA 2OERA 5FMPA 2G7LA 3C2BA 2ZCXA 4HKUA 2UXHA 3FIWA 5K7HA 5F0HA 4W1UA 3LSRA 1T33A 3P9TA 3QQAA 3LJLA 3COLA 2JJ7A 5HSZA 2ID6A 4G12A 4X1EA 3CRJA 4NELA 2ZCNA 1RPWA 2NS8A 3ON4A 3ZQFA 3PPBA 5FKNA 3VW2A 5EYRA 3G1OA 3QPLA 3HIMA 5AQCA 5FKOA 4L62A 5J1UA 2I10A 3G56A 5D1RA 3IUVA 4XK4A 3BNIA 5F0FA 2GENA 4JNNA 2ZOYA 3NNRA 3ZQIA 3BQYA 2VPRA 3PM1A 1RKTA 3SDGA 1QPIA 2D6YA 2FX0A 3VIBA 3ANGA 3VW1A 2XGEA 5EZGA 4UDSA 3BRUA 5GP9A 4M3BA 4M3DA 3WHBA 5F0CA 2RHAA 3MNLA 4AC6A 2FJ1A 2WUIA 2HXOA 1QVUA 3EUPA 1JUSA 2Q24A 3FK6A 1ORKA 5EZHA 3CJDA 3VVXA 2NX4A 4B3AA 3B81A 3V78A 3HTAA 3VPRA 3HGYA 1JTYA 2O7OA 4GCKA 1U9NA 3DPJA 3V6GA 2V57A 3NXCA 2XGCA 2PZ9A 2Y31A 2DG8A 4B1RA 3Q0WA 5F08A 5J1YA 1Z77A 4ACIA 3C07A 5FKLA 1A6IA 3VOKA 4JL3A 3VOXA 3BR6A 3BTLA 2IU5A 3QPSA 4ICHA 4DW6A 2G3BA 5EFYA 3BR2A 3HTJA 3BQZA 2WGBA 2QWTA 3T6NA 5D18A 4AUXA 3EGQA 3BHQA 1JT6A 3BTJA 4CGRA 3BTIA 3NI7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GCL A;  3FK7 A;  3TP3 A;  2UXP A;  4MXM A;  4M3E A;  4D7M A;  3BT9 A;  3LSP A;  4GFK A;  3BR3 A;  3CWR A;  4I6Z A;  3HE0 A;  2QCO A;  2X9D A;  3QKX A;  3ZQG A;  2QOP A;  1BJZ A;  2GFN A;  4V2G A;  3E7Q A;  3VVY A;  2GUH A;  3S5R A;  2Y30 A;  5CXI A;  3FRQ A;  2Y2Z A;  1Z0X A;  3KKC A;  3ON2 A;  3DCF A;  5CXG A;  2QIB A;  4MO7 A;  3LOC A;  3MVP A;  5H9T A;  2RAS A;  3KNW A;  3VP5 A;  2OF7 A;  2DTZ A;  3CDL A;  5FGL A;  2XPW A;  2XPV A;  3SFI A;  3F1B A;  3HTH A;  3O8H A;  1JTX A;  3NRG A;  3DEW A;  4YZE A;  2X6O A;  3ZQH A;  2G7S A;  2XRL A;  3RH2 A;  3TP0 A;  2HQ5 A;  3AQT A;  3BTC A;  5GPC A;  4ABZ A;  2TRT A;  5J1R A;  1JUP A;  2WV1 A;  3LSJ A;  1VI0 A;  3GZI A;  2FQ4 A;  3Q0V A;  2XB5 A;  5D19 A;  3HTI A;  2G7G A;  4NN1 A;  4AF5 A;  5CW8 A;  4W97 A;  2RAE A;  1ZKG A;  2IAI A;  5K7Z A;  3JSJ A;  5HBU A;  3PAS A;  1JT0 A;  2VKE A;  2XGD A;  3B6A A;  5HAW A;  4D5F A;  4I76 A;  3O60 A;  4KWA A;  5IOY A;  3NPI A;  3G1M A;  3O8G A;  3BR0 A;  2ID3 A;  1UI6 A;  3Q0U A;  2YVE A;  5F04 A;  2VKV A;  3BR1 A;  2DG7 A;  3RD3 A;  2NP5 A;  2ZB9 A;  5F1J A;  2QKO A;  2UXO A;  3F0C A;  3BCG A;  3VUQ A;  4AC0 A;  1T56 A;  2XDN A;  4GFL A;  4MK6 A;  2TCT A;  5GPA A;  4JYK A;  3QBM A;  3KKD A;  3ANP A;  2UXI A;  5K58 A;  5C4Y A;  5DAJ A;  2NS7 A;  3VW0 A;  2ZOZ A;  4JKZ A;  3LHQ A;  4PXI A;  3KZ9 A;  2EH3 A;  5J3L A;  3WHC A;  2W53 A;  2FD5 A;  3Q3S A;  1RKW A;  2OPT A;  5FKM A;  1UI5 A;  4V2F A;  1QVT A;  2HKU A;  2O7T A;  2IBD A;  3G7R A;  2FBQ A;  3AQS A;  4M3G A;  3GEU A;  3BR5 A;  3ZQL A;  2IEK A;  2XPU A;  3VVZ A;  3BJB A;  3IH2 A;  4ME9 A;  2HYT A;  4D7N A;  5FHP A;  5K7F A;  5IPA A;  1SGM A;  2ZCM A;  1U9O A;  3B6C A;  3IH3 A;  3HGG A;  2G0E A;  1ZK8 A;  4GCT A;  5IOZ A;  2UXU A;  2F07 A;  2JK3 A;  2YVH A;  3LWJ A;  5IP6 A;  2HYJ A;  5FKK A;  2PBX A;  2QTQ A;  3CCY A;  4M3F A;  2NP3 A;  3IH4 A;  2REK A;  2OI8 A;  1JUM A;  4D5C A;  2GBY A;  5F27 A;  3G1L A;  2HXI A;  2OER A;  5FMP A;  2G7L A;  3C2B A;  2ZCX A;  4HKU A;  2UXH A;  3FIW A;  5K7H A;  5F0H A;  4W1U A;  3LSR A;  1T33 A;  3P9T A;  3QQA A;  3LJL A;  3COL A;  2JJ7 A;  5HSZ A;  2ID6 A;  4G12 A;  4X1E A;  3CRJ A;  4NEL A;  2ZCN A;  1RPW A;  2NS8 A;  3ON4 A;  3ZQF A;  3PPB A;  5FKN A;  3VW2 A;  5EYR A;  3G1O A;  3QPL A;  3HIM A;  5AQC A;  5FKO A;  4L62 A;  5J1U A;  2I10 A;  3G56 A;  5D1R A;  3IUV A;  4XK4 A;  3BNI A;  5F0F A;  2GEN A;  4JNN A;  2ZOY A;  3NNR A;  3ZQI A;  3BQY A;  2VPR A;  3PM1 A;  1RKT A;  3SDG A;  1QPI A;  2D6Y A;  2FX0 A;  3VIB A;  3ANG A;  3VW1 A;  2XGE A;  5EZG A;  4UDS A;  3BRU A;  5GP9 A;  4M3B A;  4M3D A;  3WHB A;  5F0C A;  2RHA A;  3MNL A;  4AC6 A;  2FJ1 A;  2WUI A;  2HXO A;  1QVU A;  3EUP A;  1JUS A;  2Q24 A;  3FK6 A;  1ORK A;  5EZH A;  3CJD A;  3VVX A;  2NX4 A;  4B3A A;  3B81 A;  3V78 A;  3HTA A;  3VPR A;  3HGY A;  1JTY A;  2O7O A;  4GCK A;  1U9N A;  3DPJ A;  3V6G A;  2V57 A;  3NXC A;  2XGC A;  2PZ9 A;  2Y31 A;  2DG8 A;  4B1R A;  3Q0W A;  5F08 A;  5J1Y A;  1Z77 A;  4ACI A;  3C07 A;  5FKL A;  1A6I A;  3VOK A;  4JL3 A;  3VOX A;  3BR6 A;  3BTL A;  2IU5 A;  3QPS A;  4ICH A;  4DW6 A;  2G3B A;  5EFY A;  3BR2 A;  3HTJ A;  3BQZ A;  2WGB A;  2QWT A;  3T6N A;  5D18 A;  4AUX A;  3EGQ A;  3BHQ A;  1JT6 A;  3BTJ A;  4CGR A;  3BTI A;  3NI7 A; 
#chains in the Genus database with same CATH topology
 4GCL A;  3FK7 A;  3TP3 A;  2UXP A;  4MXM A;  4M3E A;  4D7M A;  3BT9 A;  3LSP A;  4GFK A;  3BR3 A;  3CWR A;  4I6Z A;  3HE0 A;  2QCO A;  2X9D A;  3QKX A;  3ZQG A;  2QOP A;  1BJZ A;  2GFN A;  2R7W A;  4V2G A;  3E7Q A;  3VVY A;  2GUH A;  3K8P C;  4U9L A;  3S5R A;  2Y30 A;  5CXI A;  3FRQ A;  2Y2Z A;  1Z0X A;  3KKC A;  3ON2 A;  3DCF A;  5CXG A;  2QIB A;  4MO7 A;  3LOC A;  3MVP A;  5H9T A;  2RAS A;  3DU6 A;  3KNW A;  3VP5 A;  2OF7 A;  2DTZ A;  3CDL A;  5FGL A;  2XPW A;  2XPV A;  3SFI A;  3F1B A;  3HTH A;  3O8H A;  1JTX A;  3NRG A;  3DEW A;  4YZE A;  2X6O A;  3ZQH A;  2G7S A;  2XRL A;  3RH2 A;  3TP0 A;  2HQ5 A;  3AQT A;  3BTC A;  5GPC A;  4ABZ A;  2TRT A;  5J1R A;  1JUP A;  2WV1 A;  3LSJ A;  1VI0 A;  3GZI A;  2FQ4 A;  3Q0V A;  2XB5 A;  5D19 A;  2A2F X;  4C2M A;  3HTI A;  3NS4 A;  2G7G A;  4NN1 A;  4AF5 A;  5CW8 A;  2R7X A;  4W97 A;  2RAE A;  1ZKG A;  2IAI A;  5K7Z A;  3JSJ A;  5HBU A;  3PAS A;  1JT0 A;  2VKE A;  2XGD A;  3B6A A;  5HAW A;  4D5F A;  4I76 A;  2PFV A;  3O60 A;  4KWA A;  5IOY A;  3NPI A;  3G1M A;  3O8G A;  3BR0 A;  2ID3 A;  1UI6 A;  3Q0U A;  2YVE A;  5F04 A;  2VKV A;  2FJI 1;  3BR1 A;  2DG7 A;  3RD3 A;  2NP5 A;  2ZB9 A;  5F1J A;  2QKO A;  2UXO A;  3F0C A;  3BCG A;  3VUQ A;  4AC0 A;  1T56 A;  2XDN A;  4GFL A;  4MK6 A;  2TCT A;  5GPA A;  4JYK A;  3QBM A;  3KKD A;  3ANP A;  2UXI A;  5K58 A;  5CQG A;  5C4Y A;  5DAJ A;  2NS7 A;  3VW0 A;  2ZOZ A;  4JKZ A;  3LHQ A;  4PXI A;  3DU5 A;  3KZ9 A;  2EH3 A;  5J3L A;  3WHC A;  2W53 A;  2FD5 A;  3Q3S A;  4DVY P;  1RKW A;  2OPT A;  5FKM A;  1UI5 A;  4V2F A;  1QVT A;  2HKU A;  2O7T A;  2IBD A;  3G7R A;  2FBQ A;  3AQS A;  4M3G A;  3GEU A;  2R7S A;  3BR5 A;  3ZQL A;  2IEK A;  2XPU A;  3VVZ A;  3BJB A;  3IH2 A;  4ME9 A;  2HYT A;  4D7N A;  5FHP A;  5K7F A;  5IPA A;  1SGM A;  2ZCM A;  1U9O A;  3B6C A;  3IH3 A;  3HGG A;  2G0E A;  1ZK8 A;  4GCT A;  5IOZ A;  2UXU A;  2F07 A;  2JK3 A;  3KYL A;  2YVH A;  3LWJ A;  5IP6 A;  2HYJ A;  5FKK A;  2PBX A;  2QTQ A;  3CCY A;  4M3F A;  2NP3 A;  3IH4 A;  2REK A;  2OI8 A;  1JUM A;  4D5C A;  2GBY A;  5F27 A;  2R7R A;  3G1L A;  2HXI A;  2OER A;  5FMP A;  2G7L A;  3C2B A;  2ZCX A;  4HKU A;  2UXH A;  3FIW A;  5K7H A;  5F0H A;  4W1U A;  3LSR A;  1T33 A;  3P9T A;  3SWH A;  2B3W A;  3QQA A;  3LJL A;  3COL A;  2JJ7 A;  5HSZ A;  2ID6 A;  4G12 A;  4X1E A;  3CRJ A;  4NEL A;  2ZCN A;  1RPW A;  2NS8 A;  3ON4 A;  3ZQF A;  3PPB A;  5FKN A;  3VW2 A;  5EYR A;  3G1O A;  3QPL A;  3HIM A;  2R7U A;  5AQC A;  4U9N A;  5FKO A;  4L62 A;  5J1U A;  2I10 A;  3G56 A;  5D1R A;  3IUV A;  4XK4 A;  3FHN A;  3BNI A;  5F0F A;  2ZY9 A;  2GEN A;  4JNN A;  2ZOY A;  3NNR A;  3ZQI A;  3BQY A;  4OD4 A;  2VPR A;  3PM1 A;  1RKT A;  3SDG A;  1QPI A;  2D6Y A;  2R7Q A;  2FX0 A;  3VIB A;  3ANG A;  3VTI A;  3VW1 A;  2XGE A;  5EZG A;  4UDS A;  3BRU A;  5GP9 A;  4M3B A;  4M3D A;  3WHB A;  5F0C A;  2YVX A;  2RHA A;  3MNL A;  4AC6 A;  2FJ1 A;  2WUI A;  2HXO A;  1QVU A;  3EUP A;  1JUS A;  2Q24 A;  2R7O A;  3FK6 A;  1ORK A;  5EZH A;  3CJD A;  3VVX A;  2NX4 A;  4B3A A;  3B81 A;  3V78 A;  3HTA A;  3VPR A;  3HGY A;  1JTY A;  2B1E A;  2O7O A;  4GCK A;  1U9N A;  3DPJ A;  3V6G A;  2V57 A;  4IRV A;  4OD5 A;  2R7T A;  3NXC A;  2XGC A;  2PZ9 A;  2Y31 A;  2DG8 A;  4B1R A;  3Q0W A;  5F08 A;  5J1Y A;  1Z77 A;  2R7V A;  4ACI A;  3C07 A;  5FKL A;  1A6I A;  3VOK A;  4JL3 A;  3VOX A;  3BR6 A;  3BTL A;  2IU5 A;  3QPS A;  4WIB A;  4ICH A;  4DW6 A;  2G3B A;  5EFY A;  3BR2 A;  3HTJ A;  3BQZ A;  2WGB A;  2QWT A;  3T6N A;  5D18 A;  4AUX A;  3EGQ A;  3BHQ A;  1JT6 A;  3BTJ A;  4CGR A;  3BTI A;  3NI7 A; 
#chains in the Genus database with same CATH homology
 4GCL A;  3FK7 A;  3TP3 A;  2UXP A;  4MXM A;  4M3E A;  4D7M A;  3BT9 A;  3LSP A;  4GFK A;  3BR3 A;  3CWR A;  4I6Z A;  3HE0 A;  2QCO A;  2X9D A;  3QKX A;  3ZQG A;  2QOP A;  1BJZ A;  2GFN A;  4V2G A;  3E7Q A;  3VVY A;  2GUH A;  3S5R A;  2Y30 A;  5CXI A;  3FRQ A;  2Y2Z A;  1Z0X A;  3KKC A;  3ON2 A;  3DCF A;  5CXG A;  2QIB A;  4MO7 A;  3LOC A;  3MVP A;  5H9T A;  2RAS A;  3KNW A;  3VP5 A;  2OF7 A;  2DTZ A;  3CDL A;  5FGL A;  2XPW A;  2XPV A;  3SFI A;  3F1B A;  3HTH A;  3O8H A;  1JTX A;  3NRG A;  3DEW A;  4YZE A;  2X6O A;  3ZQH A;  2G7S A;  2XRL A;  3RH2 A;  3TP0 A;  2HQ5 A;  3AQT A;  3BTC A;  5GPC A;  4ABZ A;  2TRT A;  5J1R A;  1JUP A;  2WV1 A;  3LSJ A;  1VI0 A;  3GZI A;  2FQ4 A;  3Q0V A;  2XB5 A;  5D19 A;  3HTI A;  2G7G A;  4NN1 A;  4AF5 A;  5CW8 A;  4W97 A;  2RAE A;  1ZKG A;  2IAI A;  5K7Z A;  3JSJ A;  5HBU A;  3PAS A;  1JT0 A;  2VKE A;  2XGD A;  3B6A A;  5HAW A;  4D5F A;  4I76 A;  3O60 A;  4KWA A;  5IOY A;  3NPI A;  3G1M A;  3O8G A;  3BR0 A;  2ID3 A;  1UI6 A;  3Q0U A;  2YVE A;  5F04 A;  2VKV A;  3BR1 A;  2DG7 A;  3RD3 A;  2NP5 A;  2ZB9 A;  5F1J A;  2QKO A;  2UXO A;  3F0C A;  3BCG A;  3VUQ A;  4AC0 A;  1T56 A;  2XDN A;  4GFL A;  4MK6 A;  2TCT A;  5GPA A;  4JYK A;  3QBM A;  3KKD A;  3ANP A;  2UXI A;  5K58 A;  5C4Y A;  5DAJ A;  2NS7 A;  3VW0 A;  2ZOZ A;  4JKZ A;  3LHQ A;  4PXI A;  3KZ9 A;  2EH3 A;  5J3L A;  3WHC A;  2W53 A;  2FD5 A;  3Q3S A;  1RKW A;  2OPT A;  5FKM A;  1UI5 A;  4V2F A;  1QVT A;  2HKU A;  2O7T A;  2IBD A;  3G7R A;  2FBQ A;  3AQS A;  4M3G A;  3GEU A;  3BR5 A;  3ZQL A;  2IEK A;  2XPU A;  3VVZ A;  3BJB A;  3IH2 A;  4ME9 A;  2HYT A;  4D7N A;  5FHP A;  5K7F A;  5IPA A;  1SGM A;  2ZCM A;  1U9O A;  3B6C A;  3IH3 A;  3HGG A;  2G0E A;  1ZK8 A;  4GCT A;  5IOZ A;  2UXU A;  2F07 A;  2JK3 A;  2YVH A;  3LWJ A;  5IP6 A;  2HYJ A;  5FKK A;  2PBX A;  2QTQ A;  3CCY A;  4M3F A;  2NP3 A;  3IH4 A;  2REK A;  2OI8 A;  1JUM A;  4D5C A;  2GBY A;  5F27 A;  3G1L A;  2HXI A;  2OER A;  5FMP A;  2G7L A;  3C2B A;  2ZCX A;  4HKU A;  2UXH A;  3FIW A;  5K7H A;  5F0H A;  4W1U A;  3LSR A;  1T33 A;  3P9T A;  3QQA A;  3LJL A;  3COL A;  2JJ7 A;  5HSZ A;  2ID6 A;  4G12 A;  4X1E A;  3CRJ A;  4NEL A;  2ZCN A;  1RPW A;  2NS8 A;  3ON4 A;  3ZQF A;  3PPB A;  5FKN A;  3VW2 A;  5EYR A;  3G1O A;  3QPL A;  3HIM A;  5AQC A;  5FKO A;  4L62 A;  5J1U A;  2I10 A;  3G56 A;  5D1R A;  3IUV A;  4XK4 A;  3BNI A;  5F0F A;  2GEN A;  4JNN A;  2ZOY A;  3NNR A;  3ZQI A;  3BQY A;  2VPR A;  3PM1 A;  1RKT A;  3SDG A;  1QPI A;  2D6Y A;  2FX0 A;  3VIB A;  3ANG A;  3VW1 A;  2XGE A;  5EZG A;  4UDS A;  3BRU A;  5GP9 A;  4M3B A;  4M3D A;  3WHB A;  5F0C A;  2RHA A;  3MNL A;  4AC6 A;  2FJ1 A;  2WUI A;  2HXO A;  1QVU A;  3EUP A;  1JUS A;  2Q24 A;  3FK6 A;  1ORK A;  5EZH A;  3CJD A;  3VVX A;  2NX4 A;  4B3A A;  3B81 A;  3V78 A;  3HTA A;  3VPR A;  3HGY A;  1JTY A;  2O7O A;  4GCK A;  1U9N A;  3DPJ A;  3V6G A;  2V57 A;  3NXC A;  2XGC A;  2PZ9 A;  2Y31 A;  2DG8 A;  4B1R A;  3Q0W A;  5F08 A;  5J1Y A;  1Z77 A;  4ACI A;  3C07 A;  5FKL A;  1A6I A;  3VOK A;  4JL3 A;  3VOX A;  3BR6 A;  3BTL A;  2IU5 A;  3QPS A;  4ICH A;  4DW6 A;  2G3B A;  5EFY A;  3BR2 A;  3HTJ A;  3BQZ A;  2WGB A;  2QWT A;  3T6N A;  5D18 A;  4AUX A;  3EGQ A;  3BHQ A;  1JT6 A;  3BTJ A;  4CGR A;  3BTI A;  3NI7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...