3FRQA

Structure of the macrolide biosensor protein, mphr(a), with erythromcyin
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
185
structure length
185
Chain Sequence
KLKSDDEVLEAATVVLKRCGPIEFTLSGVAKEVGLSRAALIQRFTNRDTLLVRMMERGVEQVRHYLNAIPIGAGPQGLWEFLQVLVRSMNTRNDFSVNYLISWYELQVPELRTLAIQRNRAVVEGIRKRLPPGAPAAAELLLHSVIAGATMQWAVDPDGELADHVLAQIAAILCLMFPEHDDFQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and function of the macrolide biosensor protein, MphR(A), with and without erythromycin
pubmed doi rcsb
source organism Escherichia coli
molecule tags Dna binding protein
molecule keywords Repressor protein MphR(A)
total genus 65
structure length 185
sequence length 185
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3frqA00
3QKXA 3G7RA 3ON2A 3PASA 3GEUA 5GPCA 2XGCA 3S5RA 2NP5A 2PBXA 2WUIA 3BRUA 2IBDA 3CDLA 3O8HA 3NNRA 4AC0A 1ORKA 3KZ9A 4MXMA 5F0FA 4I76A 3Q0UA 3BCGA 3RD3A 2GUHA 2HXOA 3NI7A 3BNIA 3FK7A 3O60A 1SGMA 1ZK8A 3ZQIA 3PM1A 3ZQFA 4GCLA 3ZQHA 3ZQLA 2XGDA 3V78A 3G1OA 4GCTA 2IU5A 4L62A 2G7LA 2JJ7A 3EGQA 3IH3A 4B3AA 5D18A 4V2GA 2QCOA 3VUQA 2G7GA 2ZCXA 3F1BA 4W1UA 3KKDA 2VPRA 3HTJA 1JT6A 2F07A 2REKA 5F08A 2HXIA 1QPIA 3VIBA 4JL3A 4NELA 5J1UA 4AC6A 3HGYA 4CGRA 3AQTA 1U9OA 3DPJA 3VVYA 4MO7A 2OPTA 1Z0XA 3WHCA 4D7MA 3Q0VA 3P9TA 2NS7A 2ZCNA 4PXIA 4M3DA 3LSJA 2TCTA 3ANPA 5C4YA 5FKMA 1RKTA 2Y2ZA 2ID3A 2PZ9A 3F0CA 4D5CA 3KNWA 3QPSA 4KWAA 1T56A 2FD5A 2IAIA 2VKEA 1QVTA 4GFLA 3HTIA 3IH4A 2XRLA 3LSRA 3VOXA 2QOPA 3BQZA 2RHAA 2UXHA 2QKOA 2ZCMA 3PPBA 5D1RA 4AUXA 4ACIA 3ON4A 5FGLA 3DEWA 5CXIA 2RAEA 3C07A 4M3FA 3VW0A 3BR2A 5K58A 1VI0A 1ZKGA 1JUSA 2OI8A 2RASA 5IOZA 5D19A 2XPUA 2YVHA 3V6GA 4JNNA 1JUMA 4X1EA 4GFKA 1BJZA 2GFNA 3BR3A 5FKOA 1QVUA 2XPVA 5EFYA 2FX0A 2G0EA 5EZGA 2I10A 4M3GA 5F0HA 2FQ4A 3QBMA 2Y30A 2OERA 2O7OA 2UXIA 5FHPA 3BTCA 2QIBA 3C2BA 2NP3A 5FKNA 3BR1A 3IH2A 5K7ZA 3QPLA 3LJLA 5J3LA 3ANGA 4M3EA 3BJBA 3LWJA 3BT9A 4V2FA 5FKKA 3ZQGA 3CJDA 2HKUA 3VOKA 5J1RA 3BQYA 2XPWA 4XK4A 3COLA 4YZEA 2ID6A 1T33A 2ZOYA 2WGBA 3Q3SA 3TP3A 2Q24A 2XB5A 2YVEA 2FJ1A 2FBQA 5IP6A 1UI6A 2TRTA 4G12A 3MNLA 2NS8A 3IUVA 4HKUA 2QTQA 2HYJA 5F0CA 4JKZA 3B6AA 3CWRA 5IOYA 3B6CA 3FIWA 3VPRA 5DAJA 2V57A 3VP5A 5K7HA 2Y31A 2X6OA 2QWTA 1U9NA 4MK6A 4NN1A 5AQCA 1JUPA 3BR6A 4JYKA 3NXCA 1UI5A 1A6IA 5H9TA 5EYRA 3EUPA 2EH3A 5F1JA 3FRQA 5GP9A 5FKLA 4I6ZA 5K7FA 3TP0A 2OF7A 2W53A 2O7TA 5CXGA 3KKCA 2DG7A 5J1YA 1RKWA 2G7SA 3T6NA 3DCFA 3HTHA 5HSZA 2GBYA 4D7NA 3GZIA 3VVXA 3LSPA 3HIMA 2NX4A 3BR5A 3LHQA 1RPWA 2JK3A 2WV1A 3G56A 3RH2A 3VVZA 2XDNA 3G1MA 3FK6A 3CCYA 3O8GA 5HBUA 3HGGA 2VKVA 3NRGA 3E7QA 4DW6A 1JT0A 3B81A 3QQAA 2X9DA 1JTXA 2HQ5A 2GENA 2ZOZA 4GCKA 2ZB9A 3SFIA 5F27A 3BHQA 5EZHA 4W97A 5FMPA 3BTIA 2UXPA 5IPAA 3NPIA 3LOCA 3CRJA 4M3BA 4B1RA 3VW1A 2XGEA 3HTAA 3BR0A 2DTZA 3JSJA 3MVPA 3BTLA 1JTYA 2IEKA 2G3BA 3G1LA 5HAWA 4AF5A 3BTJA 3Q0WA 4UDSA 2DG8A 5F04A 2UXUA 2UXOA 5CW8A 4D5FA 4ICHA 3WHBA 4ME9A 3SDGA 5GPAA 3AQSA 3VW2A 2D6YA 4ABZA 3HE0A 2HYTA 1Z77A
chains in the Genus database with same CATH superfamily
3QKXA 3G7RA 3ON2A 3PASA 3GEUA 5GPCA 2XGCA 3S5RA 2NP5A 2PBXA 2WUIA 3BRUA 2IBDA 3CDLA 3O8HA 3NNRA 4AC0A 4IRVA 1ORKA 3KZ9A 4MXMA 4C2MA 5F0FA 4I76A 3Q0UA 3BCGA 3RD3A 2GUHA 2HXOA 3NI7A 3BNIA 3FHNA 3FK7A 3O60A 1SGMA 3SWHA 1ZK8A 3ZQIA 3PM1A 3ZQFA 4GCLA 3ZQHA 3ZQLA 3DU5A 2XGDA 3V78A 2FJI1 3G1OA 4GCTA 2IU5A 4L62A 2G7LA 2JJ7A 3EGQA 2YVXA 3IH3A 4B3AA 5D18A 4V2GA 2QCOA 3VUQA 2G7GA 2ZCXA 2R7VA 3F1BA 4W1UA 3KKDA 2VPRA 3HTJA 1JT6A 2F07A 2REKA 5F08A 2HXIA 1QPIA 3VIBA 4JL3A 4NELA 5J1UA 4AC6A 3HGYA 4CGRA 3AQTA 1U9OA 3DPJA 3VVYA 4MO7A 2OPTA 1Z0XA 3WHCA 4D7MA 3Q0VA 3P9TA 4U9LA 2NS7A 2ZCNA 4PXIA 4M3DA 3LSJA 2TCTA 3ANPA 5C4YA 5FKMA 2A2FX 1RKTA 2Y2ZA 2ID3A 2PZ9A 3F0CA 4D5CA 3KNWA 2R7TA 3QPSA 4KWAA 1T56A 2FD5A 2IAIA 2VKEA 1QVTA 4GFLA 3HTIA 3IH4A 2XRLA 3LSRA 3VOXA 2QOPA 3BQZA 2RHAA 2UXHA 2QKOA 2ZCMA 3PPBA 5D1RA 4AUXA 4ACIA 3ON4A 5FGLA 3DEWA 3NS4A 3KYLA 5CXIA 2RAEA 3C07A 4M3FA 3VW0A 3BR2A 5K58A 1VI0A 1ZKGA 1JUSA 2OI8A 2RASA 5IOZA 5D19A 2XPUA 2R7OA 2YVHA 3V6GA 4JNNA 1JUMA 4X1EA 4GFKA 1BJZA 2GFNA 3BR3A 5FKOA 1QVUA 2XPVA 5EFYA 2PFVA 2FX0A 5CQGA 2G0EA 5EZGA 4OD5A 2I10A 4M3GA 5F0HA 2FQ4A 3QBMA 2Y30A 2OERA 2O7OA 3DU6A 2UXIA 5FHPA 3BTCA 2QIBA 2R7UA 3C2BA 2NP3A 5FKNA 3BR1A 3IH2A 5K7ZA 3QPLA 3LJLA 5J3LA 3ANGA 4M3EA 2R7WA 3BJBA 3LWJA 3BT9A 4V2FA 5FKKA 3ZQGA 3CJDA 2HKUA 3VOKA 5J1RA 4WIBA 3BQYA 2XPWA 4XK4A 3COLA 4YZEA 2ID6A 1T33A 2ZOYA 2WGBA 3Q3SA 2ZY9A 3TP3A 2Q24A 2XB5A 2YVEA 2FJ1A 2FBQA 5IP6A 2B3WA 1UI6A 2TRTA 4G12A 3MNLA 2NS8A 3IUVA 4HKUA 2QTQA 2HYJA 5F0CA 4JKZA 3B6AA 3CWRA 5IOYA 3B6CA 3FIWA 3VPRA 5DAJA 2V57A 3VP5A 5K7HA 2Y31A 4U9NA 2X6OA 2QWTA 1U9NA 4MK6A 4NN1A 5AQCA 1JUPA 3BR6A 4JYKA 3NXCA 1UI5A 1A6IA 5H9TA 5EYRA 3EUPA 2EH3A 5F1JA 3FRQA 5GP9A 5FKLA 4I6ZA 5K7FA 3TP0A 2OF7A 2W53A 2O7TA 2B1EA 5CXGA 3KKCA 2DG7A 5J1YA 1RKWA 2G7SA 3T6NA 3DCFA 3HTHA 5HSZA 4OD4A 2GBYA 4D7NA 3GZIA 3VVXA 3LSPA 3HIMA 2R7RA 2NX4A 3BR5A 3LHQA 1RPWA 2JK3A 2WV1A 3G56A 3RH2A 3VVZA 2XDNA 3G1MA 3FK6A 3CCYA 3O8GA 5HBUA 2R7XA 3HGGA 2VKVA 4DVYP 3NRGA 3E7QA 4DW6A 1JT0A 3B81A 3VTIA 3QQAA 2X9DA 2R7SA 1JTXA 2HQ5A 2GENA 2ZOZA 4GCKA 2ZB9A 3SFIA 5F27A 3BHQA 5EZHA 4W97A 5FMPA 3BTIA 2UXPA 5IPAA 3NPIA 2R7QA 3LOCA 3CRJA 4M3BA 4B1RA 3VW1A 2XGEA 3HTAA 3BR0A 2DTZA 3JSJA 3MVPA 3BTLA 1JTYA 2IEKA 2G3BA 3G1LA 3K8PC 5HAWA 4AF5A 3BTJA 3Q0WA 4UDSA 2DG8A 5F04A 2UXUA 2UXOA 5CW8A 4D5FA 4ICHA 3WHBA 4ME9A 3SDGA 5GPAA 3AQSA 3VW2A 2D6YA 4ABZA 3HE0A 2HYTA 1Z77A
chains in the Genus database with same CATH topology
3QKXA 3G7RA 3ON2A 3PASA 3GEUA 5GPCA 2XGCA 3S5RA 2NP5A 2PBXA 2WUIA 3BRUA 2IBDA 3CDLA 3O8HA 3NNRA 4AC0A 1ORKA 3KZ9A 4MXMA 5F0FA 4I76A 3Q0UA 3BCGA 3RD3A 2GUHA 2HXOA 3NI7A 3BNIA 3FK7A 3O60A 1SGMA 1ZK8A 3ZQIA 3PM1A 3ZQFA 4GCLA 3ZQHA 3ZQLA 2XGDA 3V78A 3G1OA 4GCTA 2IU5A 4L62A 2G7LA 2JJ7A 3EGQA 3IH3A 4B3AA 5D18A 4V2GA 2QCOA 3VUQA 2G7GA 2ZCXA 3F1BA 4W1UA 3KKDA 2VPRA 3HTJA 1JT6A 2F07A 2REKA 5F08A 2HXIA 1QPIA 3VIBA 4JL3A 4NELA 5J1UA 4AC6A 3HGYA 4CGRA 3AQTA 1U9OA 3DPJA 3VVYA 4MO7A 2OPTA 1Z0XA 3WHCA 4D7MA 3Q0VA 3P9TA 2NS7A 2ZCNA 4PXIA 4M3DA 3LSJA 2TCTA 3ANPA 5C4YA 5FKMA 1RKTA 2Y2ZA 2ID3A 2PZ9A 3F0CA 4D5CA 3KNWA 3QPSA 4KWAA 1T56A 2FD5A 2IAIA 2VKEA 1QVTA 4GFLA 3HTIA 3IH4A 2XRLA 3LSRA 3VOXA 2QOPA 3BQZA 2RHAA 2UXHA 2QKOA 2ZCMA 3PPBA 5D1RA 4AUXA 4ACIA 3ON4A 5FGLA 3DEWA 5CXIA 2RAEA 3C07A 4M3FA 3VW0A 3BR2A 5K58A 1VI0A 1ZKGA 1JUSA 2OI8A 2RASA 5IOZA 5D19A 2XPUA 2YVHA 3V6GA 4JNNA 1JUMA 4X1EA 4GFKA 1BJZA 2GFNA 3BR3A 5FKOA 1QVUA 2XPVA 5EFYA 2FX0A 2G0EA 5EZGA 2I10A 4M3GA 5F0HA 2FQ4A 3QBMA 2Y30A 2OERA 2O7OA 2UXIA 5FHPA 3BTCA 2QIBA 3C2BA 2NP3A 5FKNA 3BR1A 3IH2A 5K7ZA 3QPLA 3LJLA 5J3LA 3ANGA 4M3EA 3BJBA 3LWJA 3BT9A 4V2FA 5FKKA 3ZQGA 3CJDA 2HKUA 3VOKA 5J1RA 3BQYA 2XPWA 4XK4A 3COLA 4YZEA 2ID6A 1T33A 2ZOYA 2WGBA 3Q3SA 3TP3A 2Q24A 2XB5A 2YVEA 2FJ1A 2FBQA 5IP6A 1UI6A 2TRTA 4G12A 3MNLA 2NS8A 3IUVA 4HKUA 2QTQA 2HYJA 5F0CA 4JKZA 3B6AA 3CWRA 5IOYA 3B6CA 3FIWA 3VPRA 5DAJA 2V57A 3VP5A 5K7HA 2Y31A 2X6OA 2QWTA 1U9NA 4MK6A 4NN1A 5AQCA 1JUPA 3BR6A 4JYKA 3NXCA 1UI5A 1A6IA 5H9TA 5EYRA 3EUPA 2EH3A 5F1JA 3FRQA 5GP9A 5FKLA 4I6ZA 5K7FA 3TP0A 2OF7A 2W53A 2O7TA 5CXGA 3KKCA 2DG7A 5J1YA 1RKWA 2G7SA 3T6NA 3DCFA 3HTHA 5HSZA 2GBYA 4D7NA 3GZIA 3VVXA 3LSPA 3HIMA 2NX4A 3BR5A 3LHQA 1RPWA 2JK3A 2WV1A 3G56A 3RH2A 3VVZA 2XDNA 3G1MA 3FK6A 3CCYA 3O8GA 5HBUA 3HGGA 2VKVA 3NRGA 3E7QA 4DW6A 1JT0A 3B81A 3QQAA 2X9DA 1JTXA 2HQ5A 2GENA 2ZOZA 4GCKA 2ZB9A 3SFIA 5F27A 3BHQA 5EZHA 4W97A 5FMPA 3BTIA 2UXPA 5IPAA 3NPIA 3LOCA 3CRJA 4M3BA 4B1RA 3VW1A 2XGEA 3HTAA 3BR0A 2DTZA 3JSJA 3MVPA 3BTLA 1JTYA 2IEKA 2G3BA 3G1LA 5HAWA 4AF5A 3BTJA 3Q0WA 4UDSA 2DG8A 5F04A 2UXUA 2UXOA 5CW8A 4D5FA 4ICHA 3WHBA 4ME9A 3SDGA 5GPAA 3AQSA 3VW2A 2D6YA 4ABZA 3HE0A 2HYTA 1Z77A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QKX A;  3G7R A;  3ON2 A;  3PAS A;  3GEU A;  5GPC A;  2XGC A;  3S5R A;  2NP5 A;  2PBX A;  2WUI A;  3BRU A;  2IBD A;  3CDL A;  3O8H A;  3NNR A;  4AC0 A;  1ORK A;  3KZ9 A;  4MXM A;  5F0F A;  4I76 A;  3Q0U A;  3BCG A;  3RD3 A;  2GUH A;  2HXO A;  3NI7 A;  3BNI A;  3FK7 A;  3O60 A;  1SGM A;  1ZK8 A;  3ZQI A;  3PM1 A;  3ZQF A;  4GCL A;  3ZQH A;  3ZQL A;  2XGD A;  3V78 A;  3G1O A;  4GCT A;  2IU5 A;  4L62 A;  2G7L A;  2JJ7 A;  3EGQ A;  3IH3 A;  4B3A A;  5D18 A;  4V2G A;  2QCO A;  3VUQ A;  2G7G A;  2ZCX A;  3F1B A;  4W1U A;  3KKD A;  2VPR A;  3HTJ A;  1JT6 A;  2F07 A;  2REK A;  5F08 A;  2HXI A;  1QPI A;  3VIB A;  4JL3 A;  4NEL A;  5J1U A;  4AC6 A;  3HGY A;  4CGR A;  3AQT A;  1U9O A;  3DPJ A;  3VVY A;  4MO7 A;  2OPT A;  1Z0X A;  3WHC A;  4D7M A;  3Q0V A;  3P9T A;  2NS7 A;  2ZCN A;  4PXI A;  4M3D A;  3LSJ A;  2TCT A;  3ANP A;  5C4Y A;  5FKM A;  1RKT A;  2Y2Z A;  2ID3 A;  2PZ9 A;  3F0C A;  4D5C A;  3KNW A;  3QPS A;  4KWA A;  1T56 A;  2FD5 A;  2IAI A;  2VKE A;  1QVT A;  4GFL A;  3HTI A;  3IH4 A;  2XRL A;  3LSR A;  3VOX A;  2QOP A;  3BQZ A;  2RHA A;  2UXH A;  2QKO A;  2ZCM A;  3PPB A;  5D1R A;  4AUX A;  4ACI A;  3ON4 A;  5FGL A;  3DEW A;  5CXI A;  2RAE A;  3C07 A;  4M3F A;  3VW0 A;  3BR2 A;  5K58 A;  1VI0 A;  1ZKG A;  1JUS A;  2OI8 A;  2RAS A;  5IOZ A;  5D19 A;  2XPU A;  2YVH A;  3V6G A;  4JNN A;  1JUM A;  4X1E A;  4GFK A;  1BJZ A;  2GFN A;  3BR3 A;  5FKO A;  1QVU A;  2XPV A;  5EFY A;  2FX0 A;  2G0E A;  5EZG A;  2I10 A;  4M3G A;  5F0H A;  2FQ4 A;  3QBM A;  2Y30 A;  2OER A;  2O7O A;  2UXI A;  5FHP A;  3BTC A;  2QIB A;  3C2B A;  2NP3 A;  5FKN A;  3BR1 A;  3IH2 A;  5K7Z A;  3QPL A;  3LJL A;  5J3L A;  3ANG A;  4M3E A;  3BJB A;  3LWJ A;  3BT9 A;  4V2F A;  5FKK A;  3ZQG A;  3CJD A;  2HKU A;  3VOK A;  5J1R A;  3BQY A;  2XPW A;  4XK4 A;  3COL A;  4YZE A;  2ID6 A;  1T33 A;  2ZOY A;  2WGB A;  3Q3S A;  3TP3 A;  2Q24 A;  2XB5 A;  2YVE A;  2FJ1 A;  2FBQ A;  5IP6 A;  1UI6 A;  2TRT A;  4G12 A;  3MNL A;  2NS8 A;  3IUV A;  4HKU A;  2QTQ A;  2HYJ A;  5F0C A;  4JKZ A;  3B6A A;  3CWR A;  5IOY A;  3B6C A;  3FIW A;  3VPR A;  5DAJ A;  2V57 A;  3VP5 A;  5K7H A;  2Y31 A;  2X6O A;  2QWT A;  1U9N A;  4MK6 A;  4NN1 A;  5AQC A;  1JUP A;  3BR6 A;  4JYK A;  3NXC A;  1UI5 A;  1A6I A;  5H9T A;  5EYR A;  3EUP A;  2EH3 A;  5F1J A;  3FRQ A;  5GP9 A;  5FKL A;  4I6Z A;  5K7F A;  3TP0 A;  2OF7 A;  2W53 A;  2O7T A;  5CXG A;  3KKC A;  2DG7 A;  5J1Y A;  1RKW A;  2G7S A;  3T6N A;  3DCF A;  3HTH A;  5HSZ A;  2GBY A;  4D7N A;  3GZI A;  3VVX A;  3LSP A;  3HIM A;  2NX4 A;  3BR5 A;  3LHQ A;  1RPW A;  2JK3 A;  2WV1 A;  3G56 A;  3RH2 A;  3VVZ A;  2XDN A;  3G1M A;  3FK6 A;  3CCY A;  3O8G A;  5HBU A;  3HGG A;  2VKV A;  3NRG A;  3E7Q A;  4DW6 A;  1JT0 A;  3B81 A;  3QQA A;  2X9D A;  1JTX A;  2HQ5 A;  2GEN A;  2ZOZ A;  4GCK A;  2ZB9 A;  3SFI A;  5F27 A;  3BHQ A;  5EZH A;  4W97 A;  5FMP A;  3BTI A;  2UXP A;  5IPA A;  3NPI A;  3LOC A;  3CRJ A;  4M3B A;  4B1R A;  3VW1 A;  2XGE A;  3HTA A;  3BR0 A;  2DTZ A;  3JSJ A;  3MVP A;  3BTL A;  1JTY A;  2IEK A;  2G3B A;  3G1L A;  5HAW A;  4AF5 A;  3BTJ A;  3Q0W A;  4UDS A;  2DG8 A;  5F04 A;  2UXU A;  2UXO A;  5CW8 A;  4D5F A;  4ICH A;  3WHB A;  4ME9 A;  3SDG A;  5GPA A;  3AQS A;  3VW2 A;  2D6Y A;  4ABZ A;  3HE0 A;  2HYT A;  1Z77 A; 
#chains in the Genus database with same CATH topology
 3QKX A;  3G7R A;  3ON2 A;  3PAS A;  3GEU A;  5GPC A;  2XGC A;  3S5R A;  2NP5 A;  2PBX A;  2WUI A;  3BRU A;  2IBD A;  3CDL A;  3O8H A;  3NNR A;  4AC0 A;  4IRV A;  1ORK A;  3KZ9 A;  4MXM A;  4C2M A;  5F0F A;  4I76 A;  3Q0U A;  3BCG A;  3RD3 A;  2GUH A;  2HXO A;  3NI7 A;  3BNI A;  3FHN A;  3FK7 A;  3O60 A;  1SGM A;  3SWH A;  1ZK8 A;  3ZQI A;  3PM1 A;  3ZQF A;  4GCL A;  3ZQH A;  3ZQL A;  3DU5 A;  2XGD A;  3V78 A;  2FJI 1;  3G1O A;  4GCT A;  2IU5 A;  4L62 A;  2G7L A;  2JJ7 A;  3EGQ A;  2YVX A;  3IH3 A;  4B3A A;  5D18 A;  4V2G A;  2QCO A;  3VUQ A;  2G7G A;  2ZCX A;  2R7V A;  3F1B A;  4W1U A;  3KKD A;  2VPR A;  3HTJ A;  1JT6 A;  2F07 A;  2REK A;  5F08 A;  2HXI A;  1QPI A;  3VIB A;  4JL3 A;  4NEL A;  5J1U A;  4AC6 A;  3HGY A;  4CGR A;  3AQT A;  1U9O A;  3DPJ A;  3VVY A;  4MO7 A;  2OPT A;  1Z0X A;  3WHC A;  4D7M A;  3Q0V A;  3P9T A;  4U9L A;  2NS7 A;  2ZCN A;  4PXI A;  4M3D A;  3LSJ A;  2TCT A;  3ANP A;  5C4Y A;  5FKM A;  2A2F X;  1RKT A;  2Y2Z A;  2ID3 A;  2PZ9 A;  3F0C A;  4D5C A;  3KNW A;  2R7T A;  3QPS A;  4KWA A;  1T56 A;  2FD5 A;  2IAI A;  2VKE A;  1QVT A;  4GFL A;  3HTI A;  3IH4 A;  2XRL A;  3LSR A;  3VOX A;  2QOP A;  3BQZ A;  2RHA A;  2UXH A;  2QKO A;  2ZCM A;  3PPB A;  5D1R A;  4AUX A;  4ACI A;  3ON4 A;  5FGL A;  3DEW A;  3NS4 A;  3KYL A;  5CXI A;  2RAE A;  3C07 A;  4M3F A;  3VW0 A;  3BR2 A;  5K58 A;  1VI0 A;  1ZKG A;  1JUS A;  2OI8 A;  2RAS A;  5IOZ A;  5D19 A;  2XPU A;  2R7O A;  2YVH A;  3V6G A;  4JNN A;  1JUM A;  4X1E A;  4GFK A;  1BJZ A;  2GFN A;  3BR3 A;  5FKO A;  1QVU A;  2XPV A;  5EFY A;  2PFV A;  2FX0 A;  5CQG A;  2G0E A;  5EZG A;  4OD5 A;  2I10 A;  4M3G A;  5F0H A;  2FQ4 A;  3QBM A;  2Y30 A;  2OER A;  2O7O A;  3DU6 A;  2UXI A;  5FHP A;  3BTC A;  2QIB A;  2R7U A;  3C2B A;  2NP3 A;  5FKN A;  3BR1 A;  3IH2 A;  5K7Z A;  3QPL A;  3LJL A;  5J3L A;  3ANG A;  4M3E A;  2R7W A;  3BJB A;  3LWJ A;  3BT9 A;  4V2F A;  5FKK A;  3ZQG A;  3CJD A;  2HKU A;  3VOK A;  5J1R A;  4WIB A;  3BQY A;  2XPW A;  4XK4 A;  3COL A;  4YZE A;  2ID6 A;  1T33 A;  2ZOY A;  2WGB A;  3Q3S A;  2ZY9 A;  3TP3 A;  2Q24 A;  2XB5 A;  2YVE A;  2FJ1 A;  2FBQ A;  5IP6 A;  2B3W A;  1UI6 A;  2TRT A;  4G12 A;  3MNL A;  2NS8 A;  3IUV A;  4HKU A;  2QTQ A;  2HYJ A;  5F0C A;  4JKZ A;  3B6A A;  3CWR A;  5IOY A;  3B6C A;  3FIW A;  3VPR A;  5DAJ A;  2V57 A;  3VP5 A;  5K7H A;  2Y31 A;  4U9N A;  2X6O A;  2QWT A;  1U9N A;  4MK6 A;  4NN1 A;  5AQC A;  1JUP A;  3BR6 A;  4JYK A;  3NXC A;  1UI5 A;  1A6I A;  5H9T A;  5EYR A;  3EUP A;  2EH3 A;  5F1J A;  3FRQ A;  5GP9 A;  5FKL A;  4I6Z A;  5K7F A;  3TP0 A;  2OF7 A;  2W53 A;  2O7T A;  2B1E A;  5CXG A;  3KKC A;  2DG7 A;  5J1Y A;  1RKW A;  2G7S A;  3T6N A;  3DCF A;  3HTH A;  5HSZ A;  4OD4 A;  2GBY A;  4D7N A;  3GZI A;  3VVX A;  3LSP A;  3HIM A;  2R7R A;  2NX4 A;  3BR5 A;  3LHQ A;  1RPW A;  2JK3 A;  2WV1 A;  3G56 A;  3RH2 A;  3VVZ A;  2XDN A;  3G1M A;  3FK6 A;  3CCY A;  3O8G A;  5HBU A;  2R7X A;  3HGG A;  2VKV A;  4DVY P;  3NRG A;  3E7Q A;  4DW6 A;  1JT0 A;  3B81 A;  3VTI A;  3QQA A;  2X9D A;  2R7S A;  1JTX A;  2HQ5 A;  2GEN A;  2ZOZ A;  4GCK A;  2ZB9 A;  3SFI A;  5F27 A;  3BHQ A;  5EZH A;  4W97 A;  5FMP A;  3BTI A;  2UXP A;  5IPA A;  3NPI A;  2R7Q A;  3LOC A;  3CRJ A;  4M3B A;  4B1R A;  3VW1 A;  2XGE A;  3HTA A;  3BR0 A;  2DTZ A;  3JSJ A;  3MVP A;  3BTL A;  1JTY A;  2IEK A;  2G3B A;  3G1L A;  3K8P C;  5HAW A;  4AF5 A;  3BTJ A;  3Q0W A;  4UDS A;  2DG8 A;  5F04 A;  2UXU A;  2UXO A;  5CW8 A;  4D5F A;  4ICH A;  3WHB A;  4ME9 A;  3SDG A;  5GPA A;  3AQS A;  3VW2 A;  2D6Y A;  4ABZ A;  3HE0 A;  2HYT A;  1Z77 A; 
#chains in the Genus database with same CATH homology
 3QKX A;  3G7R A;  3ON2 A;  3PAS A;  3GEU A;  5GPC A;  2XGC A;  3S5R A;  2NP5 A;  2PBX A;  2WUI A;  3BRU A;  2IBD A;  3CDL A;  3O8H A;  3NNR A;  4AC0 A;  1ORK A;  3KZ9 A;  4MXM A;  5F0F A;  4I76 A;  3Q0U A;  3BCG A;  3RD3 A;  2GUH A;  2HXO A;  3NI7 A;  3BNI A;  3FK7 A;  3O60 A;  1SGM A;  1ZK8 A;  3ZQI A;  3PM1 A;  3ZQF A;  4GCL A;  3ZQH A;  3ZQL A;  2XGD A;  3V78 A;  3G1O A;  4GCT A;  2IU5 A;  4L62 A;  2G7L A;  2JJ7 A;  3EGQ A;  3IH3 A;  4B3A A;  5D18 A;  4V2G A;  2QCO A;  3VUQ A;  2G7G A;  2ZCX A;  3F1B A;  4W1U A;  3KKD A;  2VPR A;  3HTJ A;  1JT6 A;  2F07 A;  2REK A;  5F08 A;  2HXI A;  1QPI A;  3VIB A;  4JL3 A;  4NEL A;  5J1U A;  4AC6 A;  3HGY A;  4CGR A;  3AQT A;  1U9O A;  3DPJ A;  3VVY A;  4MO7 A;  2OPT A;  1Z0X A;  3WHC A;  4D7M A;  3Q0V A;  3P9T A;  2NS7 A;  2ZCN A;  4PXI A;  4M3D A;  3LSJ A;  2TCT A;  3ANP A;  5C4Y A;  5FKM A;  1RKT A;  2Y2Z A;  2ID3 A;  2PZ9 A;  3F0C A;  4D5C A;  3KNW A;  3QPS A;  4KWA A;  1T56 A;  2FD5 A;  2IAI A;  2VKE A;  1QVT A;  4GFL A;  3HTI A;  3IH4 A;  2XRL A;  3LSR A;  3VOX A;  2QOP A;  3BQZ A;  2RHA A;  2UXH A;  2QKO A;  2ZCM A;  3PPB A;  5D1R A;  4AUX A;  4ACI A;  3ON4 A;  5FGL A;  3DEW A;  5CXI A;  2RAE A;  3C07 A;  4M3F A;  3VW0 A;  3BR2 A;  5K58 A;  1VI0 A;  1ZKG A;  1JUS A;  2OI8 A;  2RAS A;  5IOZ A;  5D19 A;  2XPU A;  2YVH A;  3V6G A;  4JNN A;  1JUM A;  4X1E A;  4GFK A;  1BJZ A;  2GFN A;  3BR3 A;  5FKO A;  1QVU A;  2XPV A;  5EFY A;  2FX0 A;  2G0E A;  5EZG A;  2I10 A;  4M3G A;  5F0H A;  2FQ4 A;  3QBM A;  2Y30 A;  2OER A;  2O7O A;  2UXI A;  5FHP A;  3BTC A;  2QIB A;  3C2B A;  2NP3 A;  5FKN A;  3BR1 A;  3IH2 A;  5K7Z A;  3QPL A;  3LJL A;  5J3L A;  3ANG A;  4M3E A;  3BJB A;  3LWJ A;  3BT9 A;  4V2F A;  5FKK A;  3ZQG A;  3CJD A;  2HKU A;  3VOK A;  5J1R A;  3BQY A;  2XPW A;  4XK4 A;  3COL A;  4YZE A;  2ID6 A;  1T33 A;  2ZOY A;  2WGB A;  3Q3S A;  3TP3 A;  2Q24 A;  2XB5 A;  2YVE A;  2FJ1 A;  2FBQ A;  5IP6 A;  1UI6 A;  2TRT A;  4G12 A;  3MNL A;  2NS8 A;  3IUV A;  4HKU A;  2QTQ A;  2HYJ A;  5F0C A;  4JKZ A;  3B6A A;  3CWR A;  5IOY A;  3B6C A;  3FIW A;  3VPR A;  5DAJ A;  2V57 A;  3VP5 A;  5K7H A;  2Y31 A;  2X6O A;  2QWT A;  1U9N A;  4MK6 A;  4NN1 A;  5AQC A;  1JUP A;  3BR6 A;  4JYK A;  3NXC A;  1UI5 A;  1A6I A;  5H9T A;  5EYR A;  3EUP A;  2EH3 A;  5F1J A;  3FRQ A;  5GP9 A;  5FKL A;  4I6Z A;  5K7F A;  3TP0 A;  2OF7 A;  2W53 A;  2O7T A;  5CXG A;  3KKC A;  2DG7 A;  5J1Y A;  1RKW A;  2G7S A;  3T6N A;  3DCF A;  3HTH A;  5HSZ A;  2GBY A;  4D7N A;  3GZI A;  3VVX A;  3LSP A;  3HIM A;  2NX4 A;  3BR5 A;  3LHQ A;  1RPW A;  2JK3 A;  2WV1 A;  3G56 A;  3RH2 A;  3VVZ A;  2XDN A;  3G1M A;  3FK6 A;  3CCY A;  3O8G A;  5HBU A;  3HGG A;  2VKV A;  3NRG A;  3E7Q A;  4DW6 A;  1JT0 A;  3B81 A;  3QQA A;  2X9D A;  1JTX A;  2HQ5 A;  2GEN A;  2ZOZ A;  4GCK A;  2ZB9 A;  3SFI A;  5F27 A;  3BHQ A;  5EZH A;  4W97 A;  5FMP A;  3BTI A;  2UXP A;  5IPA A;  3NPI A;  3LOC A;  3CRJ A;  4M3B A;  4B1R A;  3VW1 A;  2XGE A;  3HTA A;  3BR0 A;  2DTZ A;  3JSJ A;  3MVP A;  3BTL A;  1JTY A;  2IEK A;  2G3B A;  3G1L A;  5HAW A;  4AF5 A;  3BTJ A;  3Q0W A;  4UDS A;  2DG8 A;  5F04 A;  2UXU A;  2UXO A;  5CW8 A;  4D5F A;  4ICH A;  3WHB A;  4ME9 A;  3SDG A;  5GPA A;  3AQS A;  3VW2 A;  2D6Y A;  4ABZ A;  3HE0 A;  2HYT A;  1Z77 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...