3FRQA

Structure of the macrolide biosensor protein, mphr(a), with erythromcyin
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
185
structure length
185
Chain Sequence
b'KLKSDDEVLEAATVVLKRCGPIEFTLSGVAKEVGLSRAALIQRFTNRDTLLVRMMERGVEQVRHYLNAIPIGAGPQGLWEFLQVLVRSMNTRNDFSVNYLISWYELQVPELRTLAIQRNRAVVEGIRKRLPPGAPAAAELLLHSVIAGATMQWAVDPDGELADHVLAQIAAILCLMFPEHDDFQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Repressor protein MphR(A)
publication title Structure and function of the macrolide biosensor protein, MphR(A), with and without erythromycin
pubmed doi rcsb
source organism Escherichia coli
molecule tags Dna binding protein
total genus 65
structure length 185
sequence length 185
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3frqA00
3BR1A 3KKCA 2HYTA 3Q3SA 5IP6A 2ID6A 5HBUA 3IH3A 4G12A 2QCOA 5HAWA 3CRJA 5GP9A 3VIBA 5EZGA 3LSPA 3VW2A 3PASA 3SDGA 5J1UA 5FMPA 1T56A 3KNWA 3FRQA 3TP3A 4NELA 1UI6A 3IH2A 3V6GA 3QPLA 3O8HA 2FD5A 2XB5A 3ON4A 2ZB9A 5FKKA 3QQAA 2OERA 3EGQA 3Q0UA 5D18A 3ANGA 4NN1A 3BR2A 3BTLA 5D19A 2Q24A 3VVYA 2ZCMA 2O7TA 2IEKA 3C2BA 2IU5A 3ZQLA 2YVHA 4I76A 3WHBA 2W53A 1RKWA 5IOYA 3ON2A 3NRGA 2NP3A 5F0HA 2FX0A 3AQSA 4D7NA 3PM1A 3GEUA 4M3DA 2HKUA 5D1RA 2Y2ZA 3BCGA 3P9TA 4M3EA 5F27A 4D7MA 3VVZA 4AF5A 5C4YA 4JKZA 2DG8A 3BQYA 5AQCA 3HTAA 3VPRA 5FKMA 3QPSA 5HSZA 2HXOA 2XGDA 1U9NA 1UI5A 3O60A 2FBQA 3IUVA 4M3BA 4V2GA 2XDNA 2FQ4A 4GFLA 3E7QA 1BJZA 5F0CA 3LSRA 3RH2A 1JUMA 2UXHA 3BR3A 3NI7A 3BR5A 4V2FA 3IH4A 2G7SA 4B3AA 2RAEA 3HGYA 2NP5A 2OI8A 3DCFA 4AC6A 4ME9A 2D6YA 2GUHA 4ABZA 2G0EA 5CXGA 3F0CA 3EUPA 4I6ZA 3MNLA 2EH3A 2UXUA 5F1JA 3BTJA 2X6OA 2JK3A 3FK6A 3VVXA 3BNIA 5EYRA 2QWTA 2QTQA 3CWRA 5J1YA 2UXIA 1RPWA 3ZQIA 2WGBA 3COLA 3VP5A 1U9OA 2ZCXA 3FK7A 3BJBA 2OF7A 4AC0A 3KZ9A 5F04A 1VI0A 3WHCA 3LWJA 4HKUA 3VOXA 3LOCA 2WV1A 3QBMA 2VKEA 1JTXA 3PPBA 3O8GA 1JUSA 3G1MA 2HQ5A 4MO7A 2RHAA 5H9TA 4GCLA 4D5CA 5FHPA 1SGMA 3CCYA 5CW8A 3C07A 3S5RA 2ZOZA 2XRLA 4UDSA 4CGRA 4W1UA 2Y31A 3V78A 1QPIA 1ORKA 4DW6A 3LHQA 3ANPA 2IAIA 2RASA 3VW0A 2X9DA 3BT9A 3HE0A 5K7HA 4ACIA 2NX4A 1Z0XA 3F1BA 5K58A 3Q0VA 5J1RA 3G1LA 3ZQGA 2XPVA 2F07A 2FJ1A 4ICHA 4AUXA 3HTIA 1JT6A 2PBXA 2QOPA 2Y30A 3G1OA 3DPJA 2YVEA 3MVPA 4GFKA 2NS8A 3RD3A 2GENA 1Z77A 1ZKGA 4PXIA 3FIWA 2GFNA 4D5FA 3BHQA 2V57A 1JTYA 3LJLA 3T6NA 2UXOA 3GZIA 4YZEA 4B1RA 5IPAA 3G56A 1T33A 3BTCA 3NNRA 2G7LA 2XGCA 4W97A 4GCTA 1RKTA 4X1EA 3BRUA 2ZOYA 3NXCA 2OPTA 2XPUA 2JJ7A 2G3BA 5J3LA 2NS7A 2GBYA 3BTIA 4MXMA 3B81A 5F08A 5IOZA 5GPCA 5CXIA 2O7OA 1A6IA 4MK6A 3VW1A 3VUQA 4JNNA 1JT0A 2PZ9A 3BR0A 5FGLA 2XGEA 3CJDA 2QKOA 2VPRA 4KWAA 4GCKA 3B6AA 5EZHA 3TP0A 3Q0WA 3VOKA 4L62A 2DTZA 5FKLA 5K7ZA 3ZQHA 1QVUA 1JUPA 2QIBA 4JYKA 3KKDA 2TRTA 3BR6A 3AQTA 2REKA 3CDLA 4M3FA 2I10A 5DAJA 1ZK8A 1QVTA 2WUIA 2IBDA 2ZCNA 2HYJA 4JL3A 3HIMA 2DG7A 3HTJA 4XK4A 2ID3A 3HTHA 4M3GA 3NPIA 2UXPA 3JSJA 5GPAA 3DEWA 5EFYA 3BQZA 2HXIA 3G7RA 3QKXA 3B6CA 3SFIA 5FKOA 2VKVA 5F0FA 2G7GA 2TCTA 5K7FA 3HGGA 3LSJA 5FKNA 3ZQFA 2XPWA
chains in the Genus database with same CATH superfamily
3K8PC 3BR1A 3KKCA 2HYTA 3Q3SA 4OD4A 5IP6A 2ID6A 5HBUA 3IH3A 4G12A 2QCOA 5HAWA 3CRJA 5GP9A 3VIBA 5EZGA 3ZQFA 3LSPA 3VW2A 3PASA 3SDGA 5J1UA 5FMPA 1T56A 3KNWA 3FRQA 3TP3A 4NELA 1UI6A 3IH2A 3V6GA 3QPLA 2YVXA 3O8HA 2FD5A 2XB5A 3ON4A 2ZB9A 5FKKA 3QQAA 2OERA 3EGQA 3Q0UA 5D18A 3ANGA 2R7SA 4NN1A 3BR2A 3BTLA 5D19A 2Q24A 3VVYA 2ZCMA 2O7TA 2IEKA 3C2BA 2IU5A 3ZQLA 2YVHA 2R7VA 4I76A 3WHBA 2W53A 1RKWA 5IOYA 3ON2A 3NRGA 3KYLA 2NP3A 5F0HA 2FX0A 3AQSA 4D7NA 3PM1A 3GEUA 4M3DA 5CQGA 2HKUA 5D1RA 2Y2ZA 3BCGA 3P9TA 4M3EA 5F27A 4D7MA 3VVZA 4AF5A 5C4YA 4JKZA 2DG8A 3BQYA 5AQCA 3HTAA 3VPRA 5FKMA 3QPSA 5HSZA 2HXOA 2XGDA 1U9NA 1UI5A 3O60A 2FBQA 3IUVA 4M3BA 4V2GA 2XDNA 2FQ4A 4OD5A 4GFLA 3E7QA 1BJZA 5F0CA 3LSRA 3RH2A 1JUMA 4DVYP 2UXHA 3BR3A 3NI7A 3BR5A 4V2FA 3IH4A 2G7SA 4B3AA 2RAEA 3SWHA 3HGYA 2NP5A 2OI8A 3DCFA 4AC6A 4ME9A 2D6YA 2GUHA 4ABZA 2G0EA 5CXGA 3F0CA 3EUPA 2R7OA 4I6ZA 3MNLA 2EH3A 2UXUA 5F1JA 4U9LA 2R7RA 3BTJA 2X6OA 2JK3A 3FK6A 3VVXA 3BNIA 5EYRA 2QWTA 2QTQA 3CWRA 5J1YA 2UXIA 1RPWA 3ZQIA 2R7QA 2WGBA 3COLA 4WIBA 3VP5A 3FHNA 1U9OA 2ZCXA 3FK7A 3BJBA 2OF7A 4AC0A 2R7XA 3KZ9A 5F04A 1VI0A 3WHCA 3LWJA 4HKUA 3VOXA 3LOCA 2WV1A 3QBMA 2VKEA 1JTXA 3PPBA 3O8GA 2R7TA 1JUSA 3G1MA 2HQ5A 4MO7A 2RHAA 5H9TA 4GCLA 4D5CA 5FHPA 1SGMA 3CCYA 5CW8A 3C07A 3S5RA 2ZOZA 2XRLA 4UDSA 4CGRA 4W1UA 2Y31A 3V78A 1QPIA 1ORKA 4IRVA 3VTIA 4DW6A 2ZY9A 3LHQA 3ANPA 2IAIA 2RASA 2X9DA 3VW0A 3BT9A 3HE0A 5K7HA 4ACIA 2NX4A 1Z0XA 2A2FX 3F1BA 5K58A 3Q0VA 5J1RA 3G1LA 3ZQGA 3DU5A 2XPVA 2F07A 2FJ1A 4ICHA 4AUXA 3HTIA 1JT6A 2PBXA 2QOPA 2Y30A 3G1OA 3DPJA 2YVEA 3MVPA 4GFKA 4C2MA 2NS8A 2PFVA 2GENA 3RD3A 1Z77A 1ZKGA 4PXIA 3FIWA 2GFNA 4D5FA 3BHQA 2V57A 1JTYA 3LJLA 3T6NA 2UXOA 3GZIA 4YZEA 4B1RA 5IPAA 3G56A 1T33A 3BTCA 2R7UA 3NNRA 2G7LA 2XGCA 4W97A 4GCTA 1RKTA 4X1EA 3BRUA 2ZOYA 3NS4A 3NXCA 2B1EA 2OPTA 2XPUA 2JJ7A 2G3BA 5J3LA 2NS7A 2GBYA 3BTIA 4MXMA 3B81A 5F08A 5IOZA 5GPCA 5CXIA 2O7OA 1A6IA 4MK6A 3VW1A 3VUQA 4JNNA 4U9NA 1JT0A 2PZ9A 3BR0A 5FGLA 2XGEA 3CJDA 2QKOA 2VPRA 4KWAA 4GCKA 3B6AA 5EZHA 3TP0A 3Q0WA 3VOKA 4L62A 2DTZA 5FKLA 5K7ZA 3ZQHA 1QVUA 1JUPA 2QIBA 4JYKA 3KKDA 2TRTA 3BR6A 3AQTA 2REKA 3CDLA 4M3FA 2I10A 5DAJA 1ZK8A 1QVTA 2WUIA 2IBDA 2ZCNA 2HYJA 4JL3A 3HIMA 2DG7A 3HTJA 4XK4A 2ID3A 3HTHA 4M3GA 3NPIA 2UXPA 3JSJA 5GPAA 3DEWA 3DU6A 5EFYA 2R7WA 3BQZA 2HXIA 3G7RA 3QKXA 3B6CA 3SFIA 5FKOA 2VKVA 5F0FA 2G7GA 2TCTA 5K7FA 3HGGA 3LSJA 5FKNA 2B3WA 2FJI1 2XPWA
chains in the Genus database with same CATH topology
3BR1A 3KKCA 2HYTA 3Q3SA 5IP6A 2ID6A 5HBUA 3IH3A 4G12A 2QCOA 5HAWA 3CRJA 5GP9A 3VIBA 5EZGA 3LSPA 3VW2A 3PASA 3SDGA 5J1UA 5FMPA 1T56A 3KNWA 3FRQA 3TP3A 4NELA 1UI6A 3IH2A 3V6GA 3QPLA 3O8HA 2FD5A 2XB5A 3ON4A 2ZB9A 5FKKA 3QQAA 2OERA 3EGQA 3Q0UA 5D18A 3ANGA 4NN1A 3BR2A 3BTLA 5D19A 2Q24A 3VVYA 2ZCMA 2O7TA 2IEKA 3C2BA 2IU5A 3ZQLA 2YVHA 4I76A 3WHBA 2W53A 1RKWA 5IOYA 3ON2A 3NRGA 2NP3A 5F0HA 2FX0A 3AQSA 4D7NA 3PM1A 3GEUA 4M3DA 2HKUA 5D1RA 2Y2ZA 3BCGA 3P9TA 4M3EA 5F27A 4D7MA 3VVZA 4AF5A 5C4YA 4JKZA 2DG8A 3BQYA 5AQCA 3HTAA 3VPRA 5FKMA 3QPSA 5HSZA 2HXOA 2XGDA 1U9NA 1UI5A 3O60A 2FBQA 3IUVA 4M3BA 4V2GA 2XDNA 2FQ4A 4GFLA 3E7QA 1BJZA 5F0CA 3LSRA 3RH2A 1JUMA 2UXHA 3BR3A 3NI7A 3BR5A 4V2FA 3IH4A 2G7SA 4B3AA 2RAEA 3HGYA 2NP5A 2OI8A 3DCFA 4AC6A 4ME9A 2D6YA 2GUHA 4ABZA 2G0EA 5CXGA 3F0CA 3EUPA 4I6ZA 3MNLA 2EH3A 2UXUA 5F1JA 3BTJA 2X6OA 2JK3A 3FK6A 3VVXA 3BNIA 5EYRA 2QWTA 2QTQA 3CWRA 5J1YA 2UXIA 1RPWA 3ZQIA 2WGBA 3COLA 3VP5A 1U9OA 2ZCXA 3FK7A 3BJBA 2OF7A 4AC0A 3KZ9A 5F04A 1VI0A 3WHCA 3LWJA 4HKUA 3VOXA 3LOCA 2WV1A 3QBMA 2VKEA 1JTXA 3PPBA 3O8GA 1JUSA 3G1MA 2HQ5A 4MO7A 2RHAA 5H9TA 4GCLA 4D5CA 5FHPA 1SGMA 3CCYA 5CW8A 3C07A 3S5RA 2ZOZA 2XRLA 4UDSA 4CGRA 4W1UA 2Y31A 3V78A 1QPIA 1ORKA 4DW6A 3LHQA 3ANPA 2IAIA 2RASA 3VW0A 2X9DA 3BT9A 3HE0A 5K7HA 4ACIA 2NX4A 1Z0XA 3F1BA 5K58A 3Q0VA 5J1RA 3G1LA 3ZQGA 2XPVA 2F07A 2FJ1A 4ICHA 4AUXA 3HTIA 1JT6A 2PBXA 2QOPA 2Y30A 3G1OA 3DPJA 2YVEA 3MVPA 4GFKA 2NS8A 3RD3A 2GENA 1Z77A 1ZKGA 4PXIA 3FIWA 2GFNA 4D5FA 3BHQA 2V57A 1JTYA 3LJLA 3T6NA 2UXOA 3GZIA 4YZEA 4B1RA 5IPAA 3G56A 1T33A 3BTCA 3NNRA 2G7LA 2XGCA 4W97A 4GCTA 1RKTA 4X1EA 3BRUA 2ZOYA 3NXCA 2OPTA 2XPUA 2JJ7A 2G3BA 5J3LA 2NS7A 2GBYA 3BTIA 4MXMA 3B81A 5F08A 5IOZA 5GPCA 5CXIA 2O7OA 1A6IA 4MK6A 3VW1A 3VUQA 4JNNA 1JT0A 2PZ9A 3BR0A 5FGLA 2XGEA 3CJDA 2QKOA 2VPRA 4KWAA 4GCKA 3B6AA 5EZHA 3TP0A 3Q0WA 3VOKA 4L62A 2DTZA 5FKLA 5K7ZA 3ZQHA 1QVUA 1JUPA 2QIBA 4JYKA 3KKDA 2TRTA 3BR6A 3AQTA 2REKA 3CDLA 4M3FA 2I10A 5DAJA 1ZK8A 1QVTA 2WUIA 2IBDA 2ZCNA 2HYJA 4JL3A 3HIMA 2DG7A 3HTJA 4XK4A 2ID3A 3HTHA 4M3GA 3NPIA 2UXPA 3JSJA 5GPAA 3DEWA 5EFYA 3BQZA 2HXIA 3G7RA 3QKXA 3B6CA 3SFIA 5FKOA 2VKVA 5F0FA 2G7GA 2TCTA 5K7FA 3HGGA 3LSJA 5FKNA 3ZQFA 2XPWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BR1 A;  3KKC A;  2HYT A;  3Q3S A;  5IP6 A;  2ID6 A;  5HBU A;  3IH3 A;  4G12 A;  2QCO A;  5HAW A;  3CRJ A;  5GP9 A;  3VIB A;  5EZG A;  3LSP A;  3VW2 A;  3PAS A;  3SDG A;  5J1U A;  5FMP A;  1T56 A;  3KNW A;  3FRQ A;  3TP3 A;  4NEL A;  1UI6 A;  3IH2 A;  3V6G A;  3QPL A;  3O8H A;  2FD5 A;  2XB5 A;  3ON4 A;  2ZB9 A;  5FKK A;  3QQA A;  2OER A;  3EGQ A;  3Q0U A;  5D18 A;  3ANG A;  4NN1 A;  3BR2 A;  3BTL A;  5D19 A;  2Q24 A;  3VVY A;  2ZCM A;  2O7T A;  2IEK A;  3C2B A;  2IU5 A;  3ZQL A;  2YVH A;  4I76 A;  3WHB A;  2W53 A;  1RKW A;  5IOY A;  3ON2 A;  3NRG A;  2NP3 A;  5F0H A;  2FX0 A;  3AQS A;  4D7N A;  3PM1 A;  3GEU A;  4M3D A;  2HKU A;  5D1R A;  2Y2Z A;  3BCG A;  3P9T A;  4M3E A;  5F27 A;  4D7M A;  3VVZ A;  4AF5 A;  5C4Y A;  4JKZ A;  2DG8 A;  3BQY A;  5AQC A;  3HTA A;  3VPR A;  5FKM A;  3QPS A;  5HSZ A;  2HXO A;  2XGD A;  1U9N A;  1UI5 A;  3O60 A;  2FBQ A;  3IUV A;  4M3B A;  4V2G A;  2XDN A;  2FQ4 A;  4GFL A;  3E7Q A;  1BJZ A;  5F0C A;  3LSR A;  3RH2 A;  1JUM A;  2UXH A;  3BR3 A;  3NI7 A;  3BR5 A;  4V2F A;  3IH4 A;  2G7S A;  4B3A A;  2RAE A;  3HGY A;  2NP5 A;  2OI8 A;  3DCF A;  4AC6 A;  4ME9 A;  2D6Y A;  2GUH A;  4ABZ A;  2G0E A;  5CXG A;  3F0C A;  3EUP A;  4I6Z A;  3MNL A;  2EH3 A;  2UXU A;  5F1J A;  3BTJ A;  2X6O A;  2JK3 A;  3FK6 A;  3VVX A;  3BNI A;  5EYR A;  2QWT A;  2QTQ A;  3CWR A;  5J1Y A;  2UXI A;  1RPW A;  3ZQI A;  2WGB A;  3COL A;  3VP5 A;  1U9O A;  2ZCX A;  3FK7 A;  3BJB A;  2OF7 A;  4AC0 A;  3KZ9 A;  5F04 A;  1VI0 A;  3WHC A;  3LWJ A;  4HKU A;  3VOX A;  3LOC A;  2WV1 A;  3QBM A;  2VKE A;  1JTX A;  3PPB A;  3O8G A;  1JUS A;  3G1M A;  2HQ5 A;  4MO7 A;  2RHA A;  5H9T A;  4GCL A;  4D5C A;  5FHP A;  1SGM A;  3CCY A;  5CW8 A;  3C07 A;  3S5R A;  2ZOZ A;  2XRL A;  4UDS A;  4CGR A;  4W1U A;  2Y31 A;  3V78 A;  1QPI A;  1ORK A;  4DW6 A;  3LHQ A;  3ANP A;  2IAI A;  2RAS A;  3VW0 A;  2X9D A;  3BT9 A;  3HE0 A;  5K7H A;  4ACI A;  2NX4 A;  1Z0X A;  3F1B A;  5K58 A;  3Q0V A;  5J1R A;  3G1L A;  3ZQG A;  2XPV A;  2F07 A;  2FJ1 A;  4ICH A;  4AUX A;  3HTI A;  1JT6 A;  2PBX A;  2QOP A;  2Y30 A;  3G1O A;  3DPJ A;  2YVE A;  3MVP A;  4GFK A;  2NS8 A;  3RD3 A;  2GEN A;  1Z77 A;  1ZKG A;  4PXI A;  3FIW A;  2GFN A;  4D5F A;  3BHQ A;  2V57 A;  1JTY A;  3LJL A;  3T6N A;  2UXO A;  3GZI A;  4YZE A;  4B1R A;  5IPA A;  3G56 A;  1T33 A;  3BTC A;  3NNR A;  2G7L A;  2XGC A;  4W97 A;  4GCT A;  1RKT A;  4X1E A;  3BRU A;  2ZOY A;  3NXC A;  2OPT A;  2XPU A;  2JJ7 A;  2G3B A;  5J3L A;  2NS7 A;  2GBY A;  3BTI A;  4MXM A;  3B81 A;  5F08 A;  5IOZ A;  5GPC A;  5CXI A;  2O7O A;  1A6I A;  4MK6 A;  3VW1 A;  3VUQ A;  4JNN A;  1JT0 A;  2PZ9 A;  3BR0 A;  5FGL A;  2XGE A;  3CJD A;  2QKO A;  2VPR A;  4KWA A;  4GCK A;  3B6A A;  5EZH A;  3TP0 A;  3Q0W A;  3VOK A;  4L62 A;  2DTZ A;  5FKL A;  5K7Z A;  3ZQH A;  1QVU A;  1JUP A;  2QIB A;  4JYK A;  3KKD A;  2TRT A;  3BR6 A;  3AQT A;  2REK A;  3CDL A;  4M3F A;  2I10 A;  5DAJ A;  1ZK8 A;  1QVT A;  2WUI A;  2IBD A;  2ZCN A;  2HYJ A;  4JL3 A;  3HIM A;  2DG7 A;  3HTJ A;  4XK4 A;  2ID3 A;  3HTH A;  4M3G A;  3NPI A;  2UXP A;  3JSJ A;  5GPA A;  3DEW A;  5EFY A;  3BQZ A;  2HXI A;  3G7R A;  3QKX A;  3B6C A;  3SFI A;  5FKO A;  2VKV A;  5F0F A;  2G7G A;  2TCT A;  5K7F A;  3HGG A;  3LSJ A;  5FKN A;  3ZQF A;  2XPW A; 
#chains in the Genus database with same CATH topology
 3K8P C;  3BR1 A;  3KKC A;  2HYT A;  3Q3S A;  4OD4 A;  5IP6 A;  2ID6 A;  5HBU A;  3IH3 A;  4G12 A;  2QCO A;  5HAW A;  3CRJ A;  5GP9 A;  3VIB A;  5EZG A;  3ZQF A;  3LSP A;  3VW2 A;  3PAS A;  3SDG A;  5J1U A;  5FMP A;  1T56 A;  3KNW A;  3FRQ A;  3TP3 A;  4NEL A;  1UI6 A;  3IH2 A;  3V6G A;  3QPL A;  2YVX A;  3O8H A;  2FD5 A;  2XB5 A;  3ON4 A;  2ZB9 A;  5FKK A;  3QQA A;  2OER A;  3EGQ A;  3Q0U A;  5D18 A;  3ANG A;  2R7S A;  4NN1 A;  3BR2 A;  3BTL A;  5D19 A;  2Q24 A;  3VVY A;  2ZCM A;  2O7T A;  2IEK A;  3C2B A;  2IU5 A;  3ZQL A;  2YVH A;  2R7V A;  4I76 A;  3WHB A;  2W53 A;  1RKW A;  5IOY A;  3ON2 A;  3NRG A;  3KYL A;  2NP3 A;  5F0H A;  2FX0 A;  3AQS A;  4D7N A;  3PM1 A;  3GEU A;  4M3D A;  5CQG A;  2HKU A;  5D1R A;  2Y2Z A;  3BCG A;  3P9T A;  4M3E A;  5F27 A;  4D7M A;  3VVZ A;  4AF5 A;  5C4Y A;  4JKZ A;  2DG8 A;  3BQY A;  5AQC A;  3HTA A;  3VPR A;  5FKM A;  3QPS A;  5HSZ A;  2HXO A;  2XGD A;  1U9N A;  1UI5 A;  3O60 A;  2FBQ A;  3IUV A;  4M3B A;  4V2G A;  2XDN A;  2FQ4 A;  4OD5 A;  4GFL A;  3E7Q A;  1BJZ A;  5F0C A;  3LSR A;  3RH2 A;  1JUM A;  4DVY P;  2UXH A;  3BR3 A;  3NI7 A;  3BR5 A;  4V2F A;  3IH4 A;  2G7S A;  4B3A A;  2RAE A;  3SWH A;  3HGY A;  2NP5 A;  2OI8 A;  3DCF A;  4AC6 A;  4ME9 A;  2D6Y A;  2GUH A;  4ABZ A;  2G0E A;  5CXG A;  3F0C A;  3EUP A;  2R7O A;  4I6Z A;  3MNL A;  2EH3 A;  2UXU A;  5F1J A;  4U9L A;  2R7R A;  3BTJ A;  2X6O A;  2JK3 A;  3FK6 A;  3VVX A;  3BNI A;  5EYR A;  2QWT A;  2QTQ A;  3CWR A;  5J1Y A;  2UXI A;  1RPW A;  3ZQI A;  2R7Q A;  2WGB A;  3COL A;  4WIB A;  3VP5 A;  3FHN A;  1U9O A;  2ZCX A;  3FK7 A;  3BJB A;  2OF7 A;  4AC0 A;  2R7X A;  3KZ9 A;  5F04 A;  1VI0 A;  3WHC A;  3LWJ A;  4HKU A;  3VOX A;  3LOC A;  2WV1 A;  3QBM A;  2VKE A;  1JTX A;  3PPB A;  3O8G A;  2R7T A;  1JUS A;  3G1M A;  2HQ5 A;  4MO7 A;  2RHA A;  5H9T A;  4GCL A;  4D5C A;  5FHP A;  1SGM A;  3CCY A;  5CW8 A;  3C07 A;  3S5R A;  2ZOZ A;  2XRL A;  4UDS A;  4CGR A;  4W1U A;  2Y31 A;  3V78 A;  1QPI A;  1ORK A;  4IRV A;  3VTI A;  4DW6 A;  2ZY9 A;  3LHQ A;  3ANP A;  2IAI A;  2RAS A;  2X9D A;  3VW0 A;  3BT9 A;  3HE0 A;  5K7H A;  4ACI A;  2NX4 A;  1Z0X A;  2A2F X;  3F1B A;  5K58 A;  3Q0V A;  5J1R A;  3G1L A;  3ZQG A;  3DU5 A;  2XPV A;  2F07 A;  2FJ1 A;  4ICH A;  4AUX A;  3HTI A;  1JT6 A;  2PBX A;  2QOP A;  2Y30 A;  3G1O A;  3DPJ A;  2YVE A;  3MVP A;  4GFK A;  4C2M A;  2NS8 A;  2PFV A;  2GEN A;  3RD3 A;  1Z77 A;  1ZKG A;  4PXI A;  3FIW A;  2GFN A;  4D5F A;  3BHQ A;  2V57 A;  1JTY A;  3LJL A;  3T6N A;  2UXO A;  3GZI A;  4YZE A;  4B1R A;  5IPA A;  3G56 A;  1T33 A;  3BTC A;  2R7U A;  3NNR A;  2G7L A;  2XGC A;  4W97 A;  4GCT A;  1RKT A;  4X1E A;  3BRU A;  2ZOY A;  3NS4 A;  3NXC A;  2B1E A;  2OPT A;  2XPU A;  2JJ7 A;  2G3B A;  5J3L A;  2NS7 A;  2GBY A;  3BTI A;  4MXM A;  3B81 A;  5F08 A;  5IOZ A;  5GPC A;  5CXI A;  2O7O A;  1A6I A;  4MK6 A;  3VW1 A;  3VUQ A;  4JNN A;  4U9N A;  1JT0 A;  2PZ9 A;  3BR0 A;  5FGL A;  2XGE A;  3CJD A;  2QKO A;  2VPR A;  4KWA A;  4GCK A;  3B6A A;  5EZH A;  3TP0 A;  3Q0W A;  3VOK A;  4L62 A;  2DTZ A;  5FKL A;  5K7Z A;  3ZQH A;  1QVU A;  1JUP A;  2QIB A;  4JYK A;  3KKD A;  2TRT A;  3BR6 A;  3AQT A;  2REK A;  3CDL A;  4M3F A;  2I10 A;  5DAJ A;  1ZK8 A;  1QVT A;  2WUI A;  2IBD A;  2ZCN A;  2HYJ A;  4JL3 A;  3HIM A;  2DG7 A;  3HTJ A;  4XK4 A;  2ID3 A;  3HTH A;  4M3G A;  3NPI A;  2UXP A;  3JSJ A;  5GPA A;  3DEW A;  3DU6 A;  5EFY A;  2R7W A;  3BQZ A;  2HXI A;  3G7R A;  3QKX A;  3B6C A;  3SFI A;  5FKO A;  2VKV A;  5F0F A;  2G7G A;  2TCT A;  5K7F A;  3HGG A;  3LSJ A;  5FKN A;  2B3W A;  2FJI 1;  2XPW A; 
#chains in the Genus database with same CATH homology
 3BR1 A;  3KKC A;  2HYT A;  3Q3S A;  5IP6 A;  2ID6 A;  5HBU A;  3IH3 A;  4G12 A;  2QCO A;  5HAW A;  3CRJ A;  5GP9 A;  3VIB A;  5EZG A;  3LSP A;  3VW2 A;  3PAS A;  3SDG A;  5J1U A;  5FMP A;  1T56 A;  3KNW A;  3FRQ A;  3TP3 A;  4NEL A;  1UI6 A;  3IH2 A;  3V6G A;  3QPL A;  3O8H A;  2FD5 A;  2XB5 A;  3ON4 A;  2ZB9 A;  5FKK A;  3QQA A;  2OER A;  3EGQ A;  3Q0U A;  5D18 A;  3ANG A;  4NN1 A;  3BR2 A;  3BTL A;  5D19 A;  2Q24 A;  3VVY A;  2ZCM A;  2O7T A;  2IEK A;  3C2B A;  2IU5 A;  3ZQL A;  2YVH A;  4I76 A;  3WHB A;  2W53 A;  1RKW A;  5IOY A;  3ON2 A;  3NRG A;  2NP3 A;  5F0H A;  2FX0 A;  3AQS A;  4D7N A;  3PM1 A;  3GEU A;  4M3D A;  2HKU A;  5D1R A;  2Y2Z A;  3BCG A;  3P9T A;  4M3E A;  5F27 A;  4D7M A;  3VVZ A;  4AF5 A;  5C4Y A;  4JKZ A;  2DG8 A;  3BQY A;  5AQC A;  3HTA A;  3VPR A;  5FKM A;  3QPS A;  5HSZ A;  2HXO A;  2XGD A;  1U9N A;  1UI5 A;  3O60 A;  2FBQ A;  3IUV A;  4M3B A;  4V2G A;  2XDN A;  2FQ4 A;  4GFL A;  3E7Q A;  1BJZ A;  5F0C A;  3LSR A;  3RH2 A;  1JUM A;  2UXH A;  3BR3 A;  3NI7 A;  3BR5 A;  4V2F A;  3IH4 A;  2G7S A;  4B3A A;  2RAE A;  3HGY A;  2NP5 A;  2OI8 A;  3DCF A;  4AC6 A;  4ME9 A;  2D6Y A;  2GUH A;  4ABZ A;  2G0E A;  5CXG A;  3F0C A;  3EUP A;  4I6Z A;  3MNL A;  2EH3 A;  2UXU A;  5F1J A;  3BTJ A;  2X6O A;  2JK3 A;  3FK6 A;  3VVX A;  3BNI A;  5EYR A;  2QWT A;  2QTQ A;  3CWR A;  5J1Y A;  2UXI A;  1RPW A;  3ZQI A;  2WGB A;  3COL A;  3VP5 A;  1U9O A;  2ZCX A;  3FK7 A;  3BJB A;  2OF7 A;  4AC0 A;  3KZ9 A;  5F04 A;  1VI0 A;  3WHC A;  3LWJ A;  4HKU A;  3VOX A;  3LOC A;  2WV1 A;  3QBM A;  2VKE A;  1JTX A;  3PPB A;  3O8G A;  1JUS A;  3G1M A;  2HQ5 A;  4MO7 A;  2RHA A;  5H9T A;  4GCL A;  4D5C A;  5FHP A;  1SGM A;  3CCY A;  5CW8 A;  3C07 A;  3S5R A;  2ZOZ A;  2XRL A;  4UDS A;  4CGR A;  4W1U A;  2Y31 A;  3V78 A;  1QPI A;  1ORK A;  4DW6 A;  3LHQ A;  3ANP A;  2IAI A;  2RAS A;  3VW0 A;  2X9D A;  3BT9 A;  3HE0 A;  5K7H A;  4ACI A;  2NX4 A;  1Z0X A;  3F1B A;  5K58 A;  3Q0V A;  5J1R A;  3G1L A;  3ZQG A;  2XPV A;  2F07 A;  2FJ1 A;  4ICH A;  4AUX A;  3HTI A;  1JT6 A;  2PBX A;  2QOP A;  2Y30 A;  3G1O A;  3DPJ A;  2YVE A;  3MVP A;  4GFK A;  2NS8 A;  3RD3 A;  2GEN A;  1Z77 A;  1ZKG A;  4PXI A;  3FIW A;  2GFN A;  4D5F A;  3BHQ A;  2V57 A;  1JTY A;  3LJL A;  3T6N A;  2UXO A;  3GZI A;  4YZE A;  4B1R A;  5IPA A;  3G56 A;  1T33 A;  3BTC A;  3NNR A;  2G7L A;  2XGC A;  4W97 A;  4GCT A;  1RKT A;  4X1E A;  3BRU A;  2ZOY A;  3NXC A;  2OPT A;  2XPU A;  2JJ7 A;  2G3B A;  5J3L A;  2NS7 A;  2GBY A;  3BTI A;  4MXM A;  3B81 A;  5F08 A;  5IOZ A;  5GPC A;  5CXI A;  2O7O A;  1A6I A;  4MK6 A;  3VW1 A;  3VUQ A;  4JNN A;  1JT0 A;  2PZ9 A;  3BR0 A;  5FGL A;  2XGE A;  3CJD A;  2QKO A;  2VPR A;  4KWA A;  4GCK A;  3B6A A;  5EZH A;  3TP0 A;  3Q0W A;  3VOK A;  4L62 A;  2DTZ A;  5FKL A;  5K7Z A;  3ZQH A;  1QVU A;  1JUP A;  2QIB A;  4JYK A;  3KKD A;  2TRT A;  3BR6 A;  3AQT A;  2REK A;  3CDL A;  4M3F A;  2I10 A;  5DAJ A;  1ZK8 A;  1QVT A;  2WUI A;  2IBD A;  2ZCN A;  2HYJ A;  4JL3 A;  3HIM A;  2DG7 A;  3HTJ A;  4XK4 A;  2ID3 A;  3HTH A;  4M3G A;  3NPI A;  2UXP A;  3JSJ A;  5GPA A;  3DEW A;  5EFY A;  3BQZ A;  2HXI A;  3G7R A;  3QKX A;  3B6C A;  3SFI A;  5FKO A;  2VKV A;  5F0F A;  2G7G A;  2TCT A;  5K7F A;  3HGG A;  3LSJ A;  5FKN A;  3ZQF A;  2XPW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...