3FRQA

Structure of the macrolide biosensor protein, mphr(a), with erythromcyin
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
185
structure length
185
Chain Sequence
KLKSDDEVLEAATVVLKRCGPIEFTLSGVAKEVGLSRAALIQRFTNRDTLLVRMMERGVEQVRHYLNAIPIGAGPQGLWEFLQVLVRSMNTRNDFSVNYLISWYELQVPELRTLAIQRNRAVVEGIRKRLPPGAPAAAELLLHSVIAGATMQWAVDPDGELADHVLAQIAAILCLMFPEHDDFQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Repressor protein MphR(A)
publication title Structure and function of the macrolide biosensor protein, MphR(A), with and without erythromycin
pubmed doi rcsb
source organism Escherichia coli
total genus 65
structure length 185
sequence length 185
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3frqA00
3TP0A 3VW1A 3KZ9A 3C07A 3ZQFA 1ZK8A 2OERA 2XDNA 5CW8A 4MO7A 3F1BA 2HQ5A 3HTJA 1JT0A 5F04A 5HAWA 5F1JA 3DEWA 2JK3A 1UI5A 5GPAA 4JL3A 3G1OA 4M3EA 3G7RA 2G7SA 3NNRA 4W97A 1ZKGA 3ANGA 3Q0VA 3BTJA 3T6NA 4ME9A 2NP5A 3V78A 1VI0A 2ZOYA 3G1LA 3Q0UA 2QWTA 3BQZA 3GZIA 2XRLA 3AQTA 4D7MA 1RKTA 3CDLA 3F0CA 5D1RA 1U9NA 3BCGA 5IOYA 3C2BA 3ANPA 3QPSA 2Q24A 2QKOA 3TP3A 5HBUA 2REKA 3DPJA 2QCOA 2ZCMA 5D19A 5F27A 2DG7A 4GCKA 4D5FA 3DCFA 2IU5A 5EYRA 2TCTA 5GPCA 3B6AA 2V57A 2Y2ZA 5FMPA 5FGLA 4B3AA 3BR5A 3QKXA 3PASA 4M3BA 3PM1A 4DW6A 3G56A 3CCYA 4PXIA 5J1UA 4AC6A 3HTAA 3KKDA 3VP5A 4L62A 4G12A 3BNIA 4V2GA 5AQCA 2EH3A 3IUVA 3NI7A 2O7OA 4JYKA 4KWAA 2IEKA 2IAIA 2HXOA 2WUIA 3LJLA 2RAEA 3IH3A 5K7FA 4XK4A 1T56A 4ICHA 2VPRA 2FD5A 4D7NA 3PPBA 3LSPA 2UXHA 3HTIA 3ON2A 2RASA 3QPLA 2G7LA 2OPTA 4CGRA 3NXCA 3VOKA 4AC0A 1JUSA 5CXIA 5F0FA 3BR1A 5FKKA 2O7TA 3BQYA 3BTIA 3MNLA 1T33A 2ID6A 2G3BA 2GFNA 2XB5A 3NPIA 2DG8A 3Q0WA 3RH2A 3CWRA 2HYJA 4JKZA 1RPWA 1SGMA 1JTXA 2QOPA 3EGQA 3FK6A 4AF5A 2VKEA 3BRUA 1QPIA 3G1MA 3FK7A 4W1UA 1A6IA 3Q3SA 2HKUA 3LWJA 3VIBA 1QVUA 2XPWA 3VW2A 5F08A 3ON4A 5FKMA 2XGDA 5EZHA 2I10A 5F0CA 4HKUA 5K7ZA 2XGEA 2YVHA 1QVTA 5HSZA 3MVPA 1Z0XA 1ORKA 2Y31A 2FBQA 4GCTA 1JTYA 2G0EA 3LSRA 3LOCA 2WGBA 3HE0A 2X6OA 5FHPA 4I6ZA 3COLA 1JUPA 4GCLA 1BJZA 3CRJA 5IOZA 3ZQIA 4YZEA 3ZQLA 2HXIA 5FKOA 4MXMA 2UXOA 4NN1A 4NELA 1Z77A 3LHQA 2W53A 2UXIA 4V2FA 3EUPA 2HYTA 3GEUA 2GUHA 5DAJA 5C4YA 2F07A 2GBYA 2XPUA 5EZGA 3RD3A 3BTCA 1JT6A 4MK6A 2NS8A 2ZB9A 2ID3A 3V6GA 5H9TA 2PBXA 4X1EA 2WV1A 2NP3A 2DTZA 5CXGA 3ZQHA 5FKLA 5IP6A 2G7GA 3ZQGA 3O8HA 1JUMA 5GP9A 2X9DA 2ZCNA 3O8GA 3BT9A 4AUXA 3FRQA 5K7HA 2OI8A 2ZOZA 3S5RA 3B81A 3HTHA 4ACIA 3AQSA 3BR6A 3SDGA 3KKCA 4D5CA 3CJDA 3E7QA 3VVYA 2YVEA 2XPVA 2FQ4A 3B6CA 2D6YA 2PZ9A 2TRTA 4GFKA 4M3FA 3JSJA 3BHQA 4M3DA 4GFLA 3BTLA 2VKVA 1U9OA 2Y30A 3VVZA 2UXPA 3VW0A 2NX4A 2FJ1A 4I76A 3BR3A 2GENA 5IPAA 4B1RA 3BR2A 2QTQA 2QIBA 2RHAA 2ZCXA 3WHBA 3NRGA 3P9TA 2XGCA 5FKNA 2FX0A 3VVXA 3BJBA 3QQAA 4UDSA 5J1YA 3IH2A 1RKWA 2OF7A 4JNNA 3O60A 1UI6A 3LSJA 3HGGA 2UXUA 5J1RA 3BR0A 3FIWA 2IBDA 3QBMA 3IH4A 3WHCA 3VPRA 3VOXA 5D18A 3VUQA 3HIMA 5J3LA 5F0HA 5K58A 5EFYA 2NS7A 2JJ7A 3SFIA 4ABZA 3HGYA 3KNWA 4M3GA
chains in the Genus database with same CATH superfamily
3TP0A 3VW1A 3KZ9A 3C07A 3ZQFA 1ZK8A 2OERA 2XDNA 5CW8A 4MO7A 3F1BA 2HQ5A 3HTJA 1JT0A 5F04A 5HAWA 5F1JA 3DEWA 2JK3A 1UI5A 5GPAA 4JL3A 3G1OA 4M3EA 3G7RA 2G7SA 3NNRA 2B3WA 4W97A 1ZKGA 3ANGA 3Q0VA 3BTJA 3T6NA 4ME9A 2NP5A 3V78A 4WIBA 1VI0A 2ZOYA 3G1LA 3Q0UA 2R7QA 2QWTA 3BQZA 3GZIA 2XRLA 3AQTA 2YVXA 4D7MA 1RKTA 3CDLA 3F0CA 5D1RA 1U9NA 2A2FX 2R7OA 3BCGA 3C2BA 5IOYA 3ANPA 3QPSA 2Q24A 2QKOA 3TP3A 5HBUA 2REKA 3DPJA 2QCOA 2ZCMA 5D19A 5F27A 2DG7A 4GCKA 4D5FA 3DCFA 2IU5A 5EYRA 2R7SA 2TCTA 5GPCA 3B6AA 2V57A 2Y2ZA 5FMPA 2FJI1 5FGLA 4B3AA 3BR5A 3QKXA 3PASA 4M3BA 3PM1A 4DW6A 3G56A 3CCYA 4PXIA 5J1UA 4AC6A 3HTAA 3KKDA 3VP5A 4OD4A 4L62A 4G12A 3BNIA 4V2GA 5AQCA 2EH3A 3IUVA 3NI7A 2O7OA 4JYKA 4KWAA 2IEKA 2IAIA 2HXOA 2WUIA 3LJLA 2RAEA 3IH3A 5K7FA 4XK4A 1T56A 4ICHA 2VPRA 2FD5A 3SWHA 4D7NA 3PPBA 3LSPA 2UXHA 3HTIA 4C2MA 3ON2A 2RASA 3QPLA 2G7LA 2OPTA 4CGRA 4U9LA 3NXCA 4OD5A 3VOKA 4AC0A 4U9NA 1JUSA 5CXIA 5F0FA 3BR1A 5FKKA 2O7TA 3BQYA 3BTIA 3MNLA 1T33A 2ID6A 2G3BA 2GFNA 2XB5A 3KYLA 3NPIA 2DG8A 3Q0WA 3RH2A 3CWRA 2HYJA 4JKZA 1RPWA 1SGMA 1JTXA 2QOPA 3EGQA 3FK6A 4AF5A 2VKEA 3BRUA 1QPIA 3G1MA 3FK7A 4W1UA 1A6IA 3Q3SA 2HKUA 3LWJA 3VIBA 1QVUA 2XPWA 3VW2A 5F08A 3ON4A 5FKMA 2XGDA 5EZHA 2I10A 5F0CA 4HKUA 5K7ZA 2XGEA 2YVHA 1QVTA 5HSZA 3MVPA 1Z0XA 1ORKA 2Y31A 2FBQA 4GCTA 1JTYA 2G0EA 3LSRA 3LOCA 2WGBA 3HE0A 2X6OA 5FHPA 4I6ZA 2PFVA 3COLA 1JUPA 4GCLA 1BJZA 3CRJA 5IOZA 3ZQIA 4YZEA 3ZQLA 2HXIA 4IRVA 5FKOA 3DU6A 4MXMA 2UXOA 4NN1A 4NELA 1Z77A 3LHQA 2ZY9A 2W53A 2UXIA 4V2FA 3EUPA 2HYTA 3GEUA 2GUHA 5DAJA 5C4YA 2F07A 2GBYA 2XPUA 5EZGA 3RD3A 3FHNA 3BTCA 1JT6A 4MK6A 2NS8A 2ZB9A 2ID3A 2R7WA 3V6GA 5H9TA 2PBXA 4X1EA 2WV1A 2B1EA 5CQGA 2NP3A 2DTZA 3K8PC 5CXGA 3ZQHA 5FKLA 5IP6A 2G7GA 3ZQGA 3O8HA 1JUMA 5GP9A 2X9DA 2ZCNA 3O8GA 3BT9A 4AUXA 3FRQA 5K7HA 2OI8A 3DU5A 2ZOZA 3S5RA 3B81A 3HTHA 4ACIA 3AQSA 3BR6A 3SDGA 3KKCA 4D5CA 3CJDA 3E7QA 3VVYA 2YVEA 2XPVA 2FQ4A 3B6CA 2D6YA 2PZ9A 2TRTA 4GFKA 4M3FA 3JSJA 3BHQA 4M3DA 4GFLA 3BTLA 2VKVA 1U9OA 2Y30A 3VVZA 2R7RA 2UXPA 3VW0A 2R7UA 2NX4A 2FJ1A 4I76A 4DVYP 3BR3A 2GENA 5IPAA 4B1RA 3BR2A 2QTQA 2QIBA 2RHAA 2ZCXA 3WHBA 3NRGA 3P9TA 2XGCA 5FKNA 2FX0A 3VVXA 3BJBA 2R7VA 3QQAA 4UDSA 2R7TA 5J1YA 3IH2A 1RKWA 2OF7A 4JNNA 3O60A 1UI6A 3LSJA 3HGGA 2UXUA 5J1RA 3BR0A 3FIWA 2IBDA 3QBMA 3IH4A 2R7XA 3WHCA 3VPRA 3VOXA 5D18A 3VUQA 3HIMA 5J3LA 5F0HA 5K58A 5EFYA 2NS7A 2JJ7A 3SFIA 4ABZA 3NS4A 3HGYA 3KNWA 4M3GA 3VTIA
chains in the Genus database with same CATH topology
3TP0A 3VW1A 3KZ9A 3C07A 3ZQFA 1ZK8A 2OERA 2XDNA 5CW8A 4MO7A 3F1BA 2HQ5A 3HTJA 1JT0A 5F04A 5HAWA 5F1JA 3DEWA 2JK3A 1UI5A 5GPAA 4JL3A 3G1OA 4M3EA 3G7RA 2G7SA 3NNRA 4W97A 1ZKGA 3ANGA 3Q0VA 3BTJA 3T6NA 4ME9A 2NP5A 3V78A 1VI0A 2ZOYA 3G1LA 3Q0UA 2QWTA 3BQZA 3GZIA 2XRLA 3AQTA 4D7MA 1RKTA 3CDLA 3F0CA 5D1RA 1U9NA 3BCGA 5IOYA 3C2BA 3ANPA 3QPSA 2Q24A 2QKOA 3TP3A 5HBUA 2REKA 3DPJA 2QCOA 2ZCMA 5D19A 5F27A 2DG7A 4GCKA 4D5FA 3DCFA 2IU5A 5EYRA 2TCTA 5GPCA 3B6AA 2V57A 2Y2ZA 5FMPA 5FGLA 4B3AA 3BR5A 3QKXA 3PASA 4M3BA 3PM1A 4DW6A 3G56A 3CCYA 4PXIA 5J1UA 4AC6A 3HTAA 3KKDA 3VP5A 4L62A 4G12A 3BNIA 4V2GA 5AQCA 2EH3A 3IUVA 3NI7A 2O7OA 4JYKA 4KWAA 2IEKA 2IAIA 2HXOA 2WUIA 3LJLA 2RAEA 3IH3A 5K7FA 4XK4A 1T56A 4ICHA 2VPRA 2FD5A 4D7NA 3PPBA 3LSPA 2UXHA 3HTIA 3ON2A 2RASA 3QPLA 2G7LA 2OPTA 4CGRA 3NXCA 3VOKA 4AC0A 1JUSA 5CXIA 5F0FA 3BR1A 5FKKA 2O7TA 3BQYA 3BTIA 3MNLA 1T33A 2ID6A 2G3BA 2GFNA 2XB5A 3NPIA 2DG8A 3Q0WA 3RH2A 3CWRA 2HYJA 4JKZA 1RPWA 1SGMA 1JTXA 2QOPA 3EGQA 3FK6A 4AF5A 2VKEA 3BRUA 1QPIA 3G1MA 3FK7A 4W1UA 1A6IA 3Q3SA 2HKUA 3LWJA 3VIBA 1QVUA 2XPWA 3VW2A 5F08A 3ON4A 5FKMA 2XGDA 5EZHA 2I10A 5F0CA 4HKUA 5K7ZA 2XGEA 2YVHA 1QVTA 5HSZA 3MVPA 1Z0XA 1ORKA 2Y31A 2FBQA 4GCTA 1JTYA 2G0EA 3LSRA 3LOCA 2WGBA 3HE0A 2X6OA 5FHPA 4I6ZA 3COLA 1JUPA 4GCLA 1BJZA 3CRJA 5IOZA 3ZQIA 4YZEA 3ZQLA 2HXIA 5FKOA 4MXMA 2UXOA 4NN1A 4NELA 1Z77A 3LHQA 2W53A 2UXIA 4V2FA 3EUPA 2HYTA 3GEUA 2GUHA 5DAJA 5C4YA 2F07A 2GBYA 2XPUA 5EZGA 3RD3A 3BTCA 1JT6A 4MK6A 2NS8A 2ZB9A 2ID3A 3V6GA 5H9TA 2PBXA 4X1EA 2WV1A 2NP3A 2DTZA 5CXGA 3ZQHA 5FKLA 5IP6A 2G7GA 3ZQGA 3O8HA 1JUMA 5GP9A 2X9DA 2ZCNA 3O8GA 3BT9A 4AUXA 3FRQA 5K7HA 2OI8A 2ZOZA 3S5RA 3B81A 3HTHA 4ACIA 3AQSA 3BR6A 3SDGA 3KKCA 4D5CA 3CJDA 3E7QA 3VVYA 2YVEA 2XPVA 2FQ4A 3B6CA 2D6YA 2PZ9A 2TRTA 4GFKA 4M3FA 3JSJA 3BHQA 4M3DA 4GFLA 3BTLA 2VKVA 1U9OA 2Y30A 3VVZA 2UXPA 3VW0A 2NX4A 2FJ1A 4I76A 3BR3A 2GENA 5IPAA 4B1RA 3BR2A 2QTQA 2QIBA 2RHAA 2ZCXA 3WHBA 3NRGA 3P9TA 2XGCA 5FKNA 2FX0A 3VVXA 3BJBA 3QQAA 4UDSA 5J1YA 3IH2A 1RKWA 2OF7A 4JNNA 3O60A 1UI6A 3LSJA 3HGGA 2UXUA 5J1RA 3BR0A 3FIWA 2IBDA 3QBMA 3IH4A 3WHCA 3VPRA 3VOXA 5D18A 3VUQA 3HIMA 5J3LA 5F0HA 5K58A 5EFYA 2NS7A 2JJ7A 3SFIA 4ABZA 3HGYA 3KNWA 4M3GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TP0 A;  3VW1 A;  3KZ9 A;  3C07 A;  3ZQF A;  1ZK8 A;  2OER A;  2XDN A;  5CW8 A;  4MO7 A;  3F1B A;  2HQ5 A;  3HTJ A;  1JT0 A;  5F04 A;  5HAW A;  5F1J A;  3DEW A;  2JK3 A;  1UI5 A;  5GPA A;  4JL3 A;  3G1O A;  4M3E A;  3G7R A;  2G7S A;  3NNR A;  4W97 A;  1ZKG A;  3ANG A;  3Q0V A;  3BTJ A;  3T6N A;  4ME9 A;  2NP5 A;  3V78 A;  1VI0 A;  2ZOY A;  3G1L A;  3Q0U A;  2QWT A;  3BQZ A;  3GZI A;  2XRL A;  3AQT A;  4D7M A;  1RKT A;  3CDL A;  3F0C A;  5D1R A;  1U9N A;  3BCG A;  5IOY A;  3C2B A;  3ANP A;  3QPS A;  2Q24 A;  2QKO A;  3TP3 A;  5HBU A;  2REK A;  3DPJ A;  2QCO A;  2ZCM A;  5D19 A;  5F27 A;  2DG7 A;  4GCK A;  4D5F A;  3DCF A;  2IU5 A;  5EYR A;  2TCT A;  5GPC A;  3B6A A;  2V57 A;  2Y2Z A;  5FMP A;  5FGL A;  4B3A A;  3BR5 A;  3QKX A;  3PAS A;  4M3B A;  3PM1 A;  4DW6 A;  3G56 A;  3CCY A;  4PXI A;  5J1U A;  4AC6 A;  3HTA A;  3KKD A;  3VP5 A;  4L62 A;  4G12 A;  3BNI A;  4V2G A;  5AQC A;  2EH3 A;  3IUV A;  3NI7 A;  2O7O A;  4JYK A;  4KWA A;  2IEK A;  2IAI A;  2HXO A;  2WUI A;  3LJL A;  2RAE A;  3IH3 A;  5K7F A;  4XK4 A;  1T56 A;  4ICH A;  2VPR A;  2FD5 A;  4D7N A;  3PPB A;  3LSP A;  2UXH A;  3HTI A;  3ON2 A;  2RAS A;  3QPL A;  2G7L A;  2OPT A;  4CGR A;  3NXC A;  3VOK A;  4AC0 A;  1JUS A;  5CXI A;  5F0F A;  3BR1 A;  5FKK A;  2O7T A;  3BQY A;  3BTI A;  3MNL A;  1T33 A;  2ID6 A;  2G3B A;  2GFN A;  2XB5 A;  3NPI A;  2DG8 A;  3Q0W A;  3RH2 A;  3CWR A;  2HYJ A;  4JKZ A;  1RPW A;  1SGM A;  1JTX A;  2QOP A;  3EGQ A;  3FK6 A;  4AF5 A;  2VKE A;  3BRU A;  1QPI A;  3G1M A;  3FK7 A;  4W1U A;  1A6I A;  3Q3S A;  2HKU A;  3LWJ A;  3VIB A;  1QVU A;  2XPW A;  3VW2 A;  5F08 A;  3ON4 A;  5FKM A;  2XGD A;  5EZH A;  2I10 A;  5F0C A;  4HKU A;  5K7Z A;  2XGE A;  2YVH A;  1QVT A;  5HSZ A;  3MVP A;  1Z0X A;  1ORK A;  2Y31 A;  2FBQ A;  4GCT A;  1JTY A;  2G0E A;  3LSR A;  3LOC A;  2WGB A;  3HE0 A;  2X6O A;  5FHP A;  4I6Z A;  3COL A;  1JUP A;  4GCL A;  1BJZ A;  3CRJ A;  5IOZ A;  3ZQI A;  4YZE A;  3ZQL A;  2HXI A;  5FKO A;  4MXM A;  2UXO A;  4NN1 A;  4NEL A;  1Z77 A;  3LHQ A;  2W53 A;  2UXI A;  4V2F A;  3EUP A;  2HYT A;  3GEU A;  2GUH A;  5DAJ A;  5C4Y A;  2F07 A;  2GBY A;  2XPU A;  5EZG A;  3RD3 A;  3BTC A;  1JT6 A;  4MK6 A;  2NS8 A;  2ZB9 A;  2ID3 A;  3V6G A;  5H9T A;  2PBX A;  4X1E A;  2WV1 A;  2NP3 A;  2DTZ A;  5CXG A;  3ZQH A;  5FKL A;  5IP6 A;  2G7G A;  3ZQG A;  3O8H A;  1JUM A;  5GP9 A;  2X9D A;  2ZCN A;  3O8G A;  3BT9 A;  4AUX A;  3FRQ A;  5K7H A;  2OI8 A;  2ZOZ A;  3S5R A;  3B81 A;  3HTH A;  4ACI A;  3AQS A;  3BR6 A;  3SDG A;  3KKC A;  4D5C A;  3CJD A;  3E7Q A;  3VVY A;  2YVE A;  2XPV A;  2FQ4 A;  3B6C A;  2D6Y A;  2PZ9 A;  2TRT A;  4GFK A;  4M3F A;  3JSJ A;  3BHQ A;  4M3D A;  4GFL A;  3BTL A;  2VKV A;  1U9O A;  2Y30 A;  3VVZ A;  2UXP A;  3VW0 A;  2NX4 A;  2FJ1 A;  4I76 A;  3BR3 A;  2GEN A;  5IPA A;  4B1R A;  3BR2 A;  2QTQ A;  2QIB A;  2RHA A;  2ZCX A;  3WHB A;  3NRG A;  3P9T A;  2XGC A;  5FKN A;  2FX0 A;  3VVX A;  3BJB A;  3QQA A;  4UDS A;  5J1Y A;  3IH2 A;  1RKW A;  2OF7 A;  4JNN A;  3O60 A;  1UI6 A;  3LSJ A;  3HGG A;  2UXU A;  5J1R A;  3BR0 A;  3FIW A;  2IBD A;  3QBM A;  3IH4 A;  3WHC A;  3VPR A;  3VOX A;  5D18 A;  3VUQ A;  3HIM A;  5J3L A;  5F0H A;  5K58 A;  5EFY A;  2NS7 A;  2JJ7 A;  3SFI A;  4ABZ A;  3HGY A;  3KNW A;  4M3G A; 
#chains in the Genus database with same CATH topology
 3TP0 A;  3VW1 A;  3KZ9 A;  3C07 A;  3ZQF A;  1ZK8 A;  2OER A;  2XDN A;  5CW8 A;  4MO7 A;  3F1B A;  2HQ5 A;  3HTJ A;  1JT0 A;  5F04 A;  5HAW A;  5F1J A;  3DEW A;  2JK3 A;  1UI5 A;  5GPA A;  4JL3 A;  3G1O A;  4M3E A;  3G7R A;  2G7S A;  3NNR A;  2B3W A;  4W97 A;  1ZKG A;  3ANG A;  3Q0V A;  3BTJ A;  3T6N A;  4ME9 A;  2NP5 A;  3V78 A;  4WIB A;  1VI0 A;  2ZOY A;  3G1L A;  3Q0U A;  2R7Q A;  2QWT A;  3BQZ A;  3GZI A;  2XRL A;  3AQT A;  2YVX A;  4D7M A;  1RKT A;  3CDL A;  3F0C A;  5D1R A;  1U9N A;  2A2F X;  2R7O A;  3BCG A;  3C2B A;  5IOY A;  3ANP A;  3QPS A;  2Q24 A;  2QKO A;  3TP3 A;  5HBU A;  2REK A;  3DPJ A;  2QCO A;  2ZCM A;  5D19 A;  5F27 A;  2DG7 A;  4GCK A;  4D5F A;  3DCF A;  2IU5 A;  5EYR A;  2R7S A;  2TCT A;  5GPC A;  3B6A A;  2V57 A;  2Y2Z A;  5FMP A;  2FJI 1;  5FGL A;  4B3A A;  3BR5 A;  3QKX A;  3PAS A;  4M3B A;  3PM1 A;  4DW6 A;  3G56 A;  3CCY A;  4PXI A;  5J1U A;  4AC6 A;  3HTA A;  3KKD A;  3VP5 A;  4OD4 A;  4L62 A;  4G12 A;  3BNI A;  4V2G A;  5AQC A;  2EH3 A;  3IUV A;  3NI7 A;  2O7O A;  4JYK A;  4KWA A;  2IEK A;  2IAI A;  2HXO A;  2WUI A;  3LJL A;  2RAE A;  3IH3 A;  5K7F A;  4XK4 A;  1T56 A;  4ICH A;  2VPR A;  2FD5 A;  3SWH A;  4D7N A;  3PPB A;  3LSP A;  2UXH A;  3HTI A;  4C2M A;  3ON2 A;  2RAS A;  3QPL A;  2G7L A;  2OPT A;  4CGR A;  4U9L A;  3NXC A;  4OD5 A;  3VOK A;  4AC0 A;  4U9N A;  1JUS A;  5CXI A;  5F0F A;  3BR1 A;  5FKK A;  2O7T A;  3BQY A;  3BTI A;  3MNL A;  1T33 A;  2ID6 A;  2G3B A;  2GFN A;  2XB5 A;  3KYL A;  3NPI A;  2DG8 A;  3Q0W A;  3RH2 A;  3CWR A;  2HYJ A;  4JKZ A;  1RPW A;  1SGM A;  1JTX A;  2QOP A;  3EGQ A;  3FK6 A;  4AF5 A;  2VKE A;  3BRU A;  1QPI A;  3G1M A;  3FK7 A;  4W1U A;  1A6I A;  3Q3S A;  2HKU A;  3LWJ A;  3VIB A;  1QVU A;  2XPW A;  3VW2 A;  5F08 A;  3ON4 A;  5FKM A;  2XGD A;  5EZH A;  2I10 A;  5F0C A;  4HKU A;  5K7Z A;  2XGE A;  2YVH A;  1QVT A;  5HSZ A;  3MVP A;  1Z0X A;  1ORK A;  2Y31 A;  2FBQ A;  4GCT A;  1JTY A;  2G0E A;  3LSR A;  3LOC A;  2WGB A;  3HE0 A;  2X6O A;  5FHP A;  4I6Z A;  2PFV A;  3COL A;  1JUP A;  4GCL A;  1BJZ A;  3CRJ A;  5IOZ A;  3ZQI A;  4YZE A;  3ZQL A;  2HXI A;  4IRV A;  5FKO A;  3DU6 A;  4MXM A;  2UXO A;  4NN1 A;  4NEL A;  1Z77 A;  3LHQ A;  2ZY9 A;  2W53 A;  2UXI A;  4V2F A;  3EUP A;  2HYT A;  3GEU A;  2GUH A;  5DAJ A;  5C4Y A;  2F07 A;  2GBY A;  2XPU A;  5EZG A;  3RD3 A;  3FHN A;  3BTC A;  1JT6 A;  4MK6 A;  2NS8 A;  2ZB9 A;  2ID3 A;  2R7W A;  3V6G A;  5H9T A;  2PBX A;  4X1E A;  2WV1 A;  2B1E A;  5CQG A;  2NP3 A;  2DTZ A;  3K8P C;  5CXG A;  3ZQH A;  5FKL A;  5IP6 A;  2G7G A;  3ZQG A;  3O8H A;  1JUM A;  5GP9 A;  2X9D A;  2ZCN A;  3O8G A;  3BT9 A;  4AUX A;  3FRQ A;  5K7H A;  2OI8 A;  3DU5 A;  2ZOZ A;  3S5R A;  3B81 A;  3HTH A;  4ACI A;  3AQS A;  3BR6 A;  3SDG A;  3KKC A;  4D5C A;  3CJD A;  3E7Q A;  3VVY A;  2YVE A;  2XPV A;  2FQ4 A;  3B6C A;  2D6Y A;  2PZ9 A;  2TRT A;  4GFK A;  4M3F A;  3JSJ A;  3BHQ A;  4M3D A;  4GFL A;  3BTL A;  2VKV A;  1U9O A;  2Y30 A;  3VVZ A;  2R7R A;  2UXP A;  3VW0 A;  2R7U A;  2NX4 A;  2FJ1 A;  4I76 A;  4DVY P;  3BR3 A;  2GEN A;  5IPA A;  4B1R A;  3BR2 A;  2QTQ A;  2QIB A;  2RHA A;  2ZCX A;  3WHB A;  3NRG A;  3P9T A;  2XGC A;  5FKN A;  2FX0 A;  3VVX A;  3BJB A;  2R7V A;  3QQA A;  4UDS A;  2R7T A;  5J1Y A;  3IH2 A;  1RKW A;  2OF7 A;  4JNN A;  3O60 A;  1UI6 A;  3LSJ A;  3HGG A;  2UXU A;  5J1R A;  3BR0 A;  3FIW A;  2IBD A;  3QBM A;  3IH4 A;  2R7X A;  3WHC A;  3VPR A;  3VOX A;  5D18 A;  3VUQ A;  3HIM A;  5J3L A;  5F0H A;  5K58 A;  5EFY A;  2NS7 A;  2JJ7 A;  3SFI A;  4ABZ A;  3NS4 A;  3HGY A;  3KNW A;  4M3G A;  3VTI A; 
#chains in the Genus database with same CATH homology
 3TP0 A;  3VW1 A;  3KZ9 A;  3C07 A;  3ZQF A;  1ZK8 A;  2OER A;  2XDN A;  5CW8 A;  4MO7 A;  3F1B A;  2HQ5 A;  3HTJ A;  1JT0 A;  5F04 A;  5HAW A;  5F1J A;  3DEW A;  2JK3 A;  1UI5 A;  5GPA A;  4JL3 A;  3G1O A;  4M3E A;  3G7R A;  2G7S A;  3NNR A;  4W97 A;  1ZKG A;  3ANG A;  3Q0V A;  3BTJ A;  3T6N A;  4ME9 A;  2NP5 A;  3V78 A;  1VI0 A;  2ZOY A;  3G1L A;  3Q0U A;  2QWT A;  3BQZ A;  3GZI A;  2XRL A;  3AQT A;  4D7M A;  1RKT A;  3CDL A;  3F0C A;  5D1R A;  1U9N A;  3BCG A;  5IOY A;  3C2B A;  3ANP A;  3QPS A;  2Q24 A;  2QKO A;  3TP3 A;  5HBU A;  2REK A;  3DPJ A;  2QCO A;  2ZCM A;  5D19 A;  5F27 A;  2DG7 A;  4GCK A;  4D5F A;  3DCF A;  2IU5 A;  5EYR A;  2TCT A;  5GPC A;  3B6A A;  2V57 A;  2Y2Z A;  5FMP A;  5FGL A;  4B3A A;  3BR5 A;  3QKX A;  3PAS A;  4M3B A;  3PM1 A;  4DW6 A;  3G56 A;  3CCY A;  4PXI A;  5J1U A;  4AC6 A;  3HTA A;  3KKD A;  3VP5 A;  4L62 A;  4G12 A;  3BNI A;  4V2G A;  5AQC A;  2EH3 A;  3IUV A;  3NI7 A;  2O7O A;  4JYK A;  4KWA A;  2IEK A;  2IAI A;  2HXO A;  2WUI A;  3LJL A;  2RAE A;  3IH3 A;  5K7F A;  4XK4 A;  1T56 A;  4ICH A;  2VPR A;  2FD5 A;  4D7N A;  3PPB A;  3LSP A;  2UXH A;  3HTI A;  3ON2 A;  2RAS A;  3QPL A;  2G7L A;  2OPT A;  4CGR A;  3NXC A;  3VOK A;  4AC0 A;  1JUS A;  5CXI A;  5F0F A;  3BR1 A;  5FKK A;  2O7T A;  3BQY A;  3BTI A;  3MNL A;  1T33 A;  2ID6 A;  2G3B A;  2GFN A;  2XB5 A;  3NPI A;  2DG8 A;  3Q0W A;  3RH2 A;  3CWR A;  2HYJ A;  4JKZ A;  1RPW A;  1SGM A;  1JTX A;  2QOP A;  3EGQ A;  3FK6 A;  4AF5 A;  2VKE A;  3BRU A;  1QPI A;  3G1M A;  3FK7 A;  4W1U A;  1A6I A;  3Q3S A;  2HKU A;  3LWJ A;  3VIB A;  1QVU A;  2XPW A;  3VW2 A;  5F08 A;  3ON4 A;  5FKM A;  2XGD A;  5EZH A;  2I10 A;  5F0C A;  4HKU A;  5K7Z A;  2XGE A;  2YVH A;  1QVT A;  5HSZ A;  3MVP A;  1Z0X A;  1ORK A;  2Y31 A;  2FBQ A;  4GCT A;  1JTY A;  2G0E A;  3LSR A;  3LOC A;  2WGB A;  3HE0 A;  2X6O A;  5FHP A;  4I6Z A;  3COL A;  1JUP A;  4GCL A;  1BJZ A;  3CRJ A;  5IOZ A;  3ZQI A;  4YZE A;  3ZQL A;  2HXI A;  5FKO A;  4MXM A;  2UXO A;  4NN1 A;  4NEL A;  1Z77 A;  3LHQ A;  2W53 A;  2UXI A;  4V2F A;  3EUP A;  2HYT A;  3GEU A;  2GUH A;  5DAJ A;  5C4Y A;  2F07 A;  2GBY A;  2XPU A;  5EZG A;  3RD3 A;  3BTC A;  1JT6 A;  4MK6 A;  2NS8 A;  2ZB9 A;  2ID3 A;  3V6G A;  5H9T A;  2PBX A;  4X1E A;  2WV1 A;  2NP3 A;  2DTZ A;  5CXG A;  3ZQH A;  5FKL A;  5IP6 A;  2G7G A;  3ZQG A;  3O8H A;  1JUM A;  5GP9 A;  2X9D A;  2ZCN A;  3O8G A;  3BT9 A;  4AUX A;  3FRQ A;  5K7H A;  2OI8 A;  2ZOZ A;  3S5R A;  3B81 A;  3HTH A;  4ACI A;  3AQS A;  3BR6 A;  3SDG A;  3KKC A;  4D5C A;  3CJD A;  3E7Q A;  3VVY A;  2YVE A;  2XPV A;  2FQ4 A;  3B6C A;  2D6Y A;  2PZ9 A;  2TRT A;  4GFK A;  4M3F A;  3JSJ A;  3BHQ A;  4M3D A;  4GFL A;  3BTL A;  2VKV A;  1U9O A;  2Y30 A;  3VVZ A;  2UXP A;  3VW0 A;  2NX4 A;  2FJ1 A;  4I76 A;  3BR3 A;  2GEN A;  5IPA A;  4B1R A;  3BR2 A;  2QTQ A;  2QIB A;  2RHA A;  2ZCX A;  3WHB A;  3NRG A;  3P9T A;  2XGC A;  5FKN A;  2FX0 A;  3VVX A;  3BJB A;  3QQA A;  4UDS A;  5J1Y A;  3IH2 A;  1RKW A;  2OF7 A;  4JNN A;  3O60 A;  1UI6 A;  3LSJ A;  3HGG A;  2UXU A;  5J1R A;  3BR0 A;  3FIW A;  2IBD A;  3QBM A;  3IH4 A;  3WHC A;  3VPR A;  3VOX A;  5D18 A;  3VUQ A;  3HIM A;  5J3L A;  5F0H A;  5K58 A;  5EFY A;  2NS7 A;  2JJ7 A;  3SFI A;  4ABZ A;  3HGY A;  3KNW A;  4M3G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...