4U9NA

Structure of a membrane protein
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
177
structure length
177
Chain Sequence
VYSEAGPVALWLARVRWLVILILTGMVTSSILQGFESVLEAVTALAFYVPVLLGTGGNTGNQSATLIIRALATRDLDLRDWRRVFLKEMGVGLLLGLTLSFLLVGKVYWDGHPLLLPVVGVSLVLIVFFANLVGAMLPFLLRRLGVDPALVSNPLVATLSDVTGLLIYLSVARLLLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Magnesium transporter MgtE
publication title Structural basis for ion selectivity revealed by high-resolution crystal structure of Mg(2+) channel MgtE
pubmed doi rcsb
source organism Thermus thermophilus hb8
molecule tags Metal transport
total genus 69
structure length 177
sequence length 177
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01769 MgtE Divalent cation transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.20 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 SLC41 divalent cation transporters, integral membrane domain 4u9nA00
4U9NA 2ZY9A 2YVXA 4U9LA 4WIBA
chains in the Genus database with same CATH superfamily
3CRJA 4V2GA 4ME9A 2XPUA 2RHAA 3VVXA 1QVUA 1JT0A 2VKEA 4NN1A 2NP3A 3G1MA 3EUPA 3VW1A 2TRTA 2DTZA 4YZEA 2NX4A 3NXCA 3HTHA 4AC0A 4JKZA 2QKOA 4M3DA 3VUQA 4D7NA 2FD5A 3HTIA 3ZQGA 2R7TA 3HGGA 5K7ZA 1BJZA 2A2FX 1UI6A 3SFIA 2NS7A 2IEKA 4MK6A 5FKMA 2I10A 4OD4A 1JUSA 3PPBA 3ON2A 2VPRA 5DAJA 3BNIA 3IH3A 2YVXA 2G0EA 3BR2A 5IOYA 2UXIA 2R7UA 4PXIA 2XB5A 2B1EA 2WV1A 5HBUA 3WHCA 1RPWA 3BR0A 3QBMA 3DU5A 3VPRA 5CXIA 4L62A 2DG7A 2HQ5A 3LHQA 4MO7A 3KKDA 4M3FA 2QCOA 2R7OA 5FGLA 3LSPA 2GUHA 3AQSA 5GP9A 4WIBA 1JUMA 3PM1A 5J3LA 4MXMA 3P9TA 3NS4A 2GENA 3BR3A 4GCTA 3IH2A 3VW2A 3CDLA 2R7SA 2Y2ZA 3B6AA 2O7TA 2IU5A 3AQTA 3V78A 3LJLA 2OPTA 2R7XA 4C2MA 2VKVA 2R7VA 2UXUA 3S5RA 1RKWA 5CW8A 1UI5A 2XGDA 2IBDA 3VP5A 3NNRA 2ID6A 3G1OA 2W53A 2YVEA 4KWAA 1U9OA 5F08A 4G12A 4JNNA 5K7HA 3IH4A 3DPJA 2OERA 5HSZA 1JTYA 1Z77A 3RD3A 2HXOA 2ZCMA 2WGBA 2XPVA 4JL3A 2QIBA 2XGCA 4DW6A 3KKCA 2QTQA 4W97A 2G3BA 3VVYA 3Q3SA 3Q0WA 5EZHA 2F07A 5CXGA 2FJI1 3O60A 2X9DA 5J1UA 2HYTA 3TP0A 3EGQA 3F0CA 2TCTA 2FBQA 5AQCA 3Q0VA 3ZQLA 5EZGA 2XDNA 3VVZA 5D1RA 5GPCA 4AC6A 2OI8A 3E7QA 5K58A 5F0FA 3WHBA 3HGYA 1VI0A 3LSJA 3QKXA 3C07A 5IPAA 2IAIA 5J1RA 5GPAA 1ZKGA 4OD5A 1T33A 2PZ9A 4UDSA 5FHPA 5IP6A 2QWTA 3LOCA 2JJ7A 2EH3A 2ZOYA 5D19A 2B3WA 4W1UA 2ZY9A 2XPWA 4NELA 2D6YA 4D5FA 4ABZA 3KZ9A 4HKUA 3PASA 2XRLA 1JTXA 3G7RA 1JT6A 3BQYA 3IUVA 2R7RA 2OF7A 3BTJA 4ACIA 4XK4A 5IOZA 3ZQHA 3DCFA 3VOKA 3HTJA 3BHQA 4DVYP 5FKKA 3V6GA 3VTIA 3ANPA 5F0CA 3JSJA 2PBXA 2V57A 3QQAA 3FIWA 3NRGA 2UXPA 2R7QA 2XGEA 3FHNA 5FKLA 2YVHA 5J1YA 3C2BA 3GZIA 2QOPA 2FQ4A 3NPIA 2G7SA 1ZK8A 3ANGA 5F27A 4AUXA 3COLA 3BTLA 3VOXA 5CQGA 4M3EA 3O8GA 3BTCA 4GCKA 1SGMA 2JK3A 3VIBA 3MNLA 1QVTA 3FRQA 3BR5A 5FKNA 5FMPA 2G7LA 5HAWA 2ZCNA 4U9LA 2DG8A 3HE0A 1Z0XA 3MVPA 4GFLA 5FKOA 5F1JA 2G7GA 3O8HA 2ZOZA 4B3AA 3ON4A 3CWRA 5F0HA 2HYJA 2UXOA 4X1EA 3BTIA 5K7FA 4IRVA 2UXHA 3FK6A 3RH2A 2GBYA 3DEWA 3BT9A 1JUPA 3BCGA 4GFKA 2R7WA 4AF5A 2X6OA 3HTAA 2ID3A 2ZCXA 1A6IA 3BRUA 4B1RA 3T6NA 2Y30A 2NS8A 5F04A 4ICHA 1T56A 3KYLA 1RKTA 5EYRA 2FJ1A 3CJDA 4JYKA 2PFVA 3DU6A 2NP5A 1U9NA 3G1LA 3ZQFA 2WUIA 3HIMA 3Q0UA 2ZB9A 3CCYA 1QPIA 3LSRA 1ORKA 3BJBA 3BR1A 3F1BA 3K8PC 2Y31A 4GCLA 3GEUA 3QPSA 3TP3A 2RASA 4M3GA 2HXIA 2GFNA 4I76A 3ZQIA 3B81A 3NI7A 2FX0A 2Q24A 3B6CA 5H9TA 4CGRA 3SDGA 5C4YA 2O7OA 2HKUA 3VW0A 4D7MA 5EFYA 2RAEA 4V2FA 3G56A 3QPLA 3KNWA 5D18A 2REKA 3SWHA 3BR6A 4M3BA 4U9NA 3FK7A 3BQZA 4I6ZA 4D5CA 3LWJA
chains in the Genus database with same CATH topology
4U9NA 2ZY9A 2YVXA 4U9LA 4WIBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U9N A;  2ZY9 A;  2YVX A;  4U9L A;  4WIB A; 
#chains in the Genus database with same CATH topology
 3CRJ A;  4V2G A;  4ME9 A;  2XPU A;  2RHA A;  3VVX A;  1QVU A;  1JT0 A;  2VKE A;  4NN1 A;  2NP3 A;  3G1M A;  3EUP A;  3VW1 A;  2TRT A;  2DTZ A;  4YZE A;  2NX4 A;  3NXC A;  3HTH A;  4AC0 A;  4JKZ A;  2QKO A;  4M3D A;  3VUQ A;  4D7N A;  2FD5 A;  3HTI A;  3ZQG A;  2R7T A;  3HGG A;  5K7Z A;  1BJZ A;  2A2F X;  1UI6 A;  3SFI A;  2NS7 A;  2IEK A;  4MK6 A;  5FKM A;  2I10 A;  4OD4 A;  1JUS A;  3PPB A;  3ON2 A;  2VPR A;  5DAJ A;  3BNI A;  3IH3 A;  2YVX A;  2G0E A;  3BR2 A;  5IOY A;  2UXI A;  2R7U A;  4PXI A;  2XB5 A;  2B1E A;  2WV1 A;  5HBU A;  3WHC A;  1RPW A;  3BR0 A;  3QBM A;  3DU5 A;  3VPR A;  5CXI A;  4L62 A;  2DG7 A;  2HQ5 A;  3LHQ A;  4MO7 A;  3KKD A;  4M3F A;  2QCO A;  2R7O A;  5FGL A;  3LSP A;  2GUH A;  3AQS A;  5GP9 A;  4WIB A;  1JUM A;  3PM1 A;  5J3L A;  4MXM A;  3P9T A;  3NS4 A;  2GEN A;  3BR3 A;  4GCT A;  3IH2 A;  3VW2 A;  3CDL A;  2R7S A;  2Y2Z A;  3B6A A;  2O7T A;  2IU5 A;  3AQT A;  3V78 A;  3LJL A;  2OPT A;  2R7X A;  4C2M A;  2VKV A;  2R7V A;  2UXU A;  3S5R A;  1RKW A;  5CW8 A;  1UI5 A;  2XGD A;  2IBD A;  3VP5 A;  3NNR A;  2ID6 A;  3G1O A;  2W53 A;  2YVE A;  4KWA A;  1U9O A;  5F08 A;  4G12 A;  4JNN A;  5K7H A;  3IH4 A;  3DPJ A;  2OER A;  5HSZ A;  1JTY A;  1Z77 A;  3RD3 A;  2HXO A;  2ZCM A;  2WGB A;  2XPV A;  4JL3 A;  2QIB A;  2XGC A;  4DW6 A;  3KKC A;  2QTQ A;  4W97 A;  2G3B A;  3VVY A;  3Q3S A;  3Q0W A;  5EZH A;  2F07 A;  5CXG A;  2FJI 1;  3O60 A;  2X9D A;  5J1U A;  2HYT A;  3TP0 A;  3EGQ A;  3F0C A;  2TCT A;  2FBQ A;  5AQC A;  3Q0V A;  3ZQL A;  5EZG A;  2XDN A;  3VVZ A;  5D1R A;  5GPC A;  4AC6 A;  2OI8 A;  3E7Q A;  5K58 A;  5F0F A;  3WHB A;  3HGY A;  1VI0 A;  3LSJ A;  3QKX A;  3C07 A;  5IPA A;  2IAI A;  5J1R A;  5GPA A;  1ZKG A;  4OD5 A;  1T33 A;  2PZ9 A;  4UDS A;  5FHP A;  5IP6 A;  2QWT A;  3LOC A;  2JJ7 A;  2EH3 A;  2ZOY A;  5D19 A;  2B3W A;  4W1U A;  2ZY9 A;  2XPW A;  4NEL A;  2D6Y A;  4D5F A;  4ABZ A;  3KZ9 A;  4HKU A;  3PAS A;  2XRL A;  1JTX A;  3G7R A;  1JT6 A;  3BQY A;  3IUV A;  2R7R A;  2OF7 A;  3BTJ A;  4ACI A;  4XK4 A;  5IOZ A;  3ZQH A;  3DCF A;  3VOK A;  3HTJ A;  3BHQ A;  4DVY P;  5FKK A;  3V6G A;  3VTI A;  3ANP A;  5F0C A;  3JSJ A;  2PBX A;  2V57 A;  3QQA A;  3FIW A;  3NRG A;  2UXP A;  2R7Q A;  2XGE A;  3FHN A;  5FKL A;  2YVH A;  5J1Y A;  3C2B A;  3GZI A;  2QOP A;  2FQ4 A;  3NPI A;  2G7S A;  1ZK8 A;  3ANG A;  5F27 A;  4AUX A;  3COL A;  3BTL A;  3VOX A;  5CQG A;  4M3E A;  3O8G A;  3BTC A;  4GCK A;  1SGM A;  2JK3 A;  3VIB A;  3MNL A;  1QVT A;  3FRQ A;  3BR5 A;  5FKN A;  5FMP A;  2G7L A;  5HAW A;  2ZCN A;  4U9L A;  2DG8 A;  3HE0 A;  1Z0X A;  3MVP A;  4GFL A;  5FKO A;  5F1J A;  2G7G A;  3O8H A;  2ZOZ A;  4B3A A;  3ON4 A;  3CWR A;  5F0H A;  2HYJ A;  2UXO A;  4X1E A;  3BTI A;  5K7F A;  4IRV A;  2UXH A;  3FK6 A;  3RH2 A;  2GBY A;  3DEW A;  3BT9 A;  1JUP A;  3BCG A;  4GFK A;  2R7W A;  4AF5 A;  2X6O A;  3HTA A;  2ID3 A;  2ZCX A;  1A6I A;  3BRU A;  4B1R A;  3T6N A;  2Y30 A;  2NS8 A;  5F04 A;  4ICH A;  1T56 A;  3KYL A;  1RKT A;  5EYR A;  2FJ1 A;  3CJD A;  4JYK A;  2PFV A;  3DU6 A;  2NP5 A;  1U9N A;  3G1L A;  3ZQF A;  2WUI A;  3HIM A;  3Q0U A;  2ZB9 A;  3CCY A;  1QPI A;  3LSR A;  1ORK A;  3BJB A;  3BR1 A;  3F1B A;  3K8P C;  2Y31 A;  4GCL A;  3GEU A;  3QPS A;  3TP3 A;  2RAS A;  4M3G A;  2HXI A;  2GFN A;  4I76 A;  3ZQI A;  3B81 A;  3NI7 A;  2FX0 A;  2Q24 A;  3B6C A;  5H9T A;  4CGR A;  3SDG A;  5C4Y A;  2O7O A;  2HKU A;  3VW0 A;  4D7M A;  5EFY A;  2RAE A;  4V2F A;  3G56 A;  3QPL A;  3KNW A;  5D18 A;  2REK A;  3SWH A;  3BR6 A;  4M3B A;  4U9N A;  3FK7 A;  3BQZ A;  4I6Z A;  4D5C A;  3LWJ A; 
#chains in the Genus database with same CATH homology
 4U9N A;  2ZY9 A;  2YVX A;  4U9L A;  4WIB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...