4U9NA

Structure of a membrane protein
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
177
structure length
177
Chain Sequence
VYSEAGPVALWLARVRWLVILILTGMVTSSILQGFESVLEAVTALAFYVPVLLGTGGNTGNQSATLIIRALATRDLDLRDWRRVFLKEMGVGLLLGLTLSFLLVGKVYWDGHPLLLPVVGVSLVLIVFFANLVGAMLPFLLRRLGVDPALVSNPLVATLSDVTGLLIYLSVARLLLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for ion selectivity revealed by high-resolution crystal structure of Mg(2+) channel MgtE
pubmed doi rcsb
source organism Thermus thermophilus hb8
molecule tags Metal transport
molecule keywords Magnesium transporter MgtE
total genus 69
structure length 177
sequence length 177
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01769 MgtE Divalent cation transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.20 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 SLC41 divalent cation transporters, integral membrane domain 4u9nA00
4U9NA 2YVXA 2ZY9A 4U9LA 4WIBA
chains in the Genus database with same CATH superfamily
2XB5A 3BTCA 3BHQA 4V2FA 2R7XA 3QQAA 5CXGA 2ID6A 2R7UA 3BR1A 2HKUA 2WV1A 2QKOA 2FD5A 3HGGA 3B81A 3BJBA 3GZIA 3QKXA 2O7OA 2HXIA 5DAJA 4JYKA 3BR5A 3VVZA 3T6NA 4ICHA 3QPSA 4W1UA 1JT6A 3HTHA 2R7RA 3EGQA 3IH3A 3DCFA 3HE0A 5FKKA 3BR0A 4NN1A 2X9DA 3V78A 1ORKA 3QBMA 2FJI1 2OF7A 3K8PC 3B6CA 4OD4A 3BQYA 5FKMA 3KKDA 3DU6A 4M3EA 5J1YA 2D6YA 3B6AA 1Z77A 2TCTA 2OPTA 2DTZA 2UXUA 3SWHA 2NS7A 4AUXA 3ANGA 3CWRA 4KWAA 1JUMA 5CXIA 3BRUA 2RHAA 3ZQIA 1T56A 2ZCXA 5F27A 3S5RA 5FKNA 3ON2A 4AF5A 2R7VA 5K7ZA 1JUPA 3C2BA 4GFLA 5H9TA 2B1EA 4W97A 1SGMA 3VP5A 3KKCA 2DG8A 2UXIA 1BJZA 3Q0VA 4YZEA 3DPJA 2G3BA 3E7QA 3MNLA 3IUVA 3BR6A 2ZB9A 3VVXA 5F0CA 1T33A 3VW2A 5CQGA 3P9TA 2YVHA 3G7RA 1UI5A 2XPWA 3MVPA 3Q3SA 3QPLA 3VOKA 2Y2ZA 3ANPA 5FGLA 3ZQFA 2IU5A 3BR2A 5GP9A 3WHBA 4I6ZA 4C2MA 3Q0WA 2RASA 4PXIA 4OD5A 2Y31A 3BT9A 3CCYA 3NS4A 1ZK8A 2HYTA 3EUPA 2X6OA 2G0EA 1RKWA 4X1EA 2VKEA 3HTJA 2G7SA 3BCGA 3LWJA 5FHPA 2NP5A 3HIMA 3FHNA 4AC0A 3Q0UA 3BQZA 5IPAA 3C07A 2R7OA 5F1JA 3G1MA 2QWTA 3VUQA 2FQ4A 1RKTA 4GFKA 4U9LA 2VPRA 2R7SA 2OERA 2O7TA 2OI8A 3TP0A 2ZCMA 2UXOA 5D19A 3ZQHA 2V57A 2FX0A 1ZKGA 1UI6A 2ZY9A 1QPIA 5EFYA 4XK4A 4I76A 4UDSA 4AC6A 3WHCA 3FRQA 4B3AA 2PBXA 5GPAA 3PASA 2FJ1A 4D5CA 5HSZA 3BTIA 2XPUA 2XRLA 2GENA 4ACIA 3VPRA 3IH2A 2XGDA 4ABZA 2NX4A 2IAIA 3O8HA 4JL3A 2ID3A 3NRGA 1U9NA 4DW6A 2NS8A 2QIBA 2ZOYA 4D5FA 2PZ9A 4GCTA 3SDGA 2F07A 3O60A 5D18A 4JNNA 5HBUA 4NELA 5AQCA 2QTQA 5K7FA 3HGYA 2ZOZA 5GPCA 5F0FA 3NXCA 3SFIA 3G1LA 2UXPA 1A6IA 3DEWA 3CDLA 3PM1A 4D7MA 3FK7A 1U9OA 4M3DA 2REKA 3HTIA 5FKOA 2Q24A 3FIWA 4M3FA 2JJ7A 3KZ9A 2I10A 3JSJA 1Z0XA 5IOZA 4MXMA 4G12A 4ME9A 3V6GA 2RAEA 2R7TA 1QVTA 2G7LA 3FK6A 4MO7A 5IOYA 5K7HA 3BNIA 1RPWA 2W53A 5EYRA 2FBQA 2ZCNA 3KYLA 3CJDA 3HTAA 2EH3A 2GBYA 2PFVA 3BTJA 2NP3A 4JKZA 3LSRA 2XGCA 4GCLA 2DG7A 4HKUA 3VTIA 5HAWA 3VW0A 3F0CA 3GEUA 5IP6A 5F0HA 5FKLA 5J1UA 2IEKA 1JTYA 3RH2A 3AQTA 3ON4A 2VKVA 4DVYP 4M3GA 3LJLA 2G7GA 3O8GA 5J1RA 4U9NA 3KNWA 3LSPA 2HXOA 5F08A 3BTLA 4MK6A 3COLA 4M3BA 4D7NA 5FMPA 3LSJA 1VI0A 2QCOA 3VIBA 3NI7A 2GUHA 2HQ5A 1QVUA 3LHQA 3AQSA 5F04A 3TP3A 2R7QA 2WGBA 2YVXA 5D1RA 2XGEA 2R7WA 3DU5A 2IBDA 5K58A 3LOCA 2JK3A 3VVYA 2XPVA 3BR3A 3G1OA 3F1BA 2A2FX 5CW8A 2UXHA 3RD3A 5J3LA 2Y30A 3CRJA 3IH4A 2QOPA 3PPBA 3G56A 4B1RA 4L62A 4V2GA 1JTXA 2YVEA 3ZQLA 5C4YA 2WUIA 2TRTA 1JT0A 4IRVA 5EZHA 3VOXA 4WIBA 3VW1A 2HYJA 4CGRA 4GCKA 3NPIA 3ZQGA 2B3WA 3NNRA 1JUSA 2GFNA 2XDNA 5EZGA
chains in the Genus database with same CATH topology
4U9NA 2YVXA 2ZY9A 4U9LA 4WIBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U9N A;  2YVX A;  2ZY9 A;  4U9L A;  4WIB A; 
#chains in the Genus database with same CATH topology
 2XB5 A;  3BTC A;  3BHQ A;  4V2F A;  2R7X A;  3QQA A;  5CXG A;  2ID6 A;  2R7U A;  3BR1 A;  2HKU A;  2WV1 A;  2QKO A;  2FD5 A;  3HGG A;  3B81 A;  3BJB A;  3GZI A;  3QKX A;  2O7O A;  2HXI A;  5DAJ A;  4JYK A;  3BR5 A;  3VVZ A;  3T6N A;  4ICH A;  3QPS A;  4W1U A;  1JT6 A;  3HTH A;  2R7R A;  3EGQ A;  3IH3 A;  3DCF A;  3HE0 A;  5FKK A;  3BR0 A;  4NN1 A;  2X9D A;  3V78 A;  1ORK A;  3QBM A;  2FJI 1;  2OF7 A;  3K8P C;  3B6C A;  4OD4 A;  3BQY A;  5FKM A;  3KKD A;  3DU6 A;  4M3E A;  5J1Y A;  2D6Y A;  3B6A A;  1Z77 A;  2TCT A;  2OPT A;  2DTZ A;  2UXU A;  3SWH A;  2NS7 A;  4AUX A;  3ANG A;  3CWR A;  4KWA A;  1JUM A;  5CXI A;  3BRU A;  2RHA A;  3ZQI A;  1T56 A;  2ZCX A;  5F27 A;  3S5R A;  5FKN A;  3ON2 A;  4AF5 A;  2R7V A;  5K7Z A;  1JUP A;  3C2B A;  4GFL A;  5H9T A;  2B1E A;  4W97 A;  1SGM A;  3VP5 A;  3KKC A;  2DG8 A;  2UXI A;  1BJZ A;  3Q0V A;  4YZE A;  3DPJ A;  2G3B A;  3E7Q A;  3MNL A;  3IUV A;  3BR6 A;  2ZB9 A;  3VVX A;  5F0C A;  1T33 A;  3VW2 A;  5CQG A;  3P9T A;  2YVH A;  3G7R A;  1UI5 A;  2XPW A;  3MVP A;  3Q3S A;  3QPL A;  3VOK A;  2Y2Z A;  3ANP A;  5FGL A;  3ZQF A;  2IU5 A;  3BR2 A;  5GP9 A;  3WHB A;  4I6Z A;  4C2M A;  3Q0W A;  2RAS A;  4PXI A;  4OD5 A;  2Y31 A;  3BT9 A;  3CCY A;  3NS4 A;  1ZK8 A;  2HYT A;  3EUP A;  2X6O A;  2G0E A;  1RKW A;  4X1E A;  2VKE A;  3HTJ A;  2G7S A;  3BCG A;  3LWJ A;  5FHP A;  2NP5 A;  3HIM A;  3FHN A;  4AC0 A;  3Q0U A;  3BQZ A;  5IPA A;  3C07 A;  2R7O A;  5F1J A;  3G1M A;  2QWT A;  3VUQ A;  2FQ4 A;  1RKT A;  4GFK A;  4U9L A;  2VPR A;  2R7S A;  2OER A;  2O7T A;  2OI8 A;  3TP0 A;  2ZCM A;  2UXO A;  5D19 A;  3ZQH A;  2V57 A;  2FX0 A;  1ZKG A;  1UI6 A;  2ZY9 A;  1QPI A;  5EFY A;  4XK4 A;  4I76 A;  4UDS A;  4AC6 A;  3WHC A;  3FRQ A;  4B3A A;  2PBX A;  5GPA A;  3PAS A;  2FJ1 A;  4D5C A;  5HSZ A;  3BTI A;  2XPU A;  2XRL A;  2GEN A;  4ACI A;  3VPR A;  3IH2 A;  2XGD A;  4ABZ A;  2NX4 A;  2IAI A;  3O8H A;  4JL3 A;  2ID3 A;  3NRG A;  1U9N A;  4DW6 A;  2NS8 A;  2QIB A;  2ZOY A;  4D5F A;  2PZ9 A;  4GCT A;  3SDG A;  2F07 A;  3O60 A;  5D18 A;  4JNN A;  5HBU A;  4NEL A;  5AQC A;  2QTQ A;  5K7F A;  3HGY A;  2ZOZ A;  5GPC A;  5F0F A;  3NXC A;  3SFI A;  3G1L A;  2UXP A;  1A6I A;  3DEW A;  3CDL A;  3PM1 A;  4D7M A;  3FK7 A;  1U9O A;  4M3D A;  2REK A;  3HTI A;  5FKO A;  2Q24 A;  3FIW A;  4M3F A;  2JJ7 A;  3KZ9 A;  2I10 A;  3JSJ A;  1Z0X A;  5IOZ A;  4MXM A;  4G12 A;  4ME9 A;  3V6G A;  2RAE A;  2R7T A;  1QVT A;  2G7L A;  3FK6 A;  4MO7 A;  5IOY A;  5K7H A;  3BNI A;  1RPW A;  2W53 A;  5EYR A;  2FBQ A;  2ZCN A;  3KYL A;  3CJD A;  3HTA A;  2EH3 A;  2GBY A;  2PFV A;  3BTJ A;  2NP3 A;  4JKZ A;  3LSR A;  2XGC A;  4GCL A;  2DG7 A;  4HKU A;  3VTI A;  5HAW A;  3VW0 A;  3F0C A;  3GEU A;  5IP6 A;  5F0H A;  5FKL A;  5J1U A;  2IEK A;  1JTY A;  3RH2 A;  3AQT A;  3ON4 A;  2VKV A;  4DVY P;  4M3G A;  3LJL A;  2G7G A;  3O8G A;  5J1R A;  4U9N A;  3KNW A;  3LSP A;  2HXO A;  5F08 A;  3BTL A;  4MK6 A;  3COL A;  4M3B A;  4D7N A;  5FMP A;  3LSJ A;  1VI0 A;  2QCO A;  3VIB A;  3NI7 A;  2GUH A;  2HQ5 A;  1QVU A;  3LHQ A;  3AQS A;  5F04 A;  3TP3 A;  2R7Q A;  2WGB A;  2YVX A;  5D1R A;  2XGE A;  2R7W A;  3DU5 A;  2IBD A;  5K58 A;  3LOC A;  2JK3 A;  3VVY A;  2XPV A;  3BR3 A;  3G1O A;  3F1B A;  2A2F X;  5CW8 A;  2UXH A;  3RD3 A;  5J3L A;  2Y30 A;  3CRJ A;  3IH4 A;  2QOP A;  3PPB A;  3G56 A;  4B1R A;  4L62 A;  4V2G A;  1JTX A;  2YVE A;  3ZQL A;  5C4Y A;  2WUI A;  2TRT A;  1JT0 A;  4IRV A;  5EZH A;  3VOX A;  4WIB A;  3VW1 A;  2HYJ A;  4CGR A;  4GCK A;  3NPI A;  3ZQG A;  2B3W A;  3NNR A;  1JUS A;  2GFN A;  2XDN A;  5EZG A; 
#chains in the Genus database with same CATH homology
 4U9N A;  2YVX A;  2ZY9 A;  4U9L A;  4WIB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...