4U9NA

Structure of a membrane protein
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
177
structure length
177
Chain Sequence
b'VYSEAGPVALWLARVRWLVILILTGMVTSSILQGFESVLEAVTALAFYVPVLLGTGGNTGNQSATLIIRALATRDLDLRDWRRVFLKEMGVGLLLGLTLSFLLVGKVYWDGHPLLLPVVGVSLVLIVFFANLVGAMLPFLLRRLGVDPALVSNPLVATLSDVTGLLIYLSVARLLLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Magnesium transporter MgtE
molecule tags Metal transport
source organism Thermus thermophilus hb8
publication title Structural basis for ion selectivity revealed by high-resolution crystal structure of Mg(2+) channel MgtE
pubmed doi rcsb
total genus 69
structure length 177
sequence length 177
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01769 MgtE Divalent cation transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.20 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 SLC41 divalent cation transporters, integral membrane domain 4u9nA00
4U9NA 4WIBA 2ZY9A 2YVXA 4U9LA
chains in the Genus database with same CATH superfamily
3SWHA 2XDNA 2RASA 3P9TA 3AQSA 3BHQA 5K7HA 4D7MA 2TRTA 2XPWA 3VW2A 2QIBA 4HKUA 3S5RA 2ZOZA 2R7OA 2XGCA 3BR5A 2FBQA 3BTLA 5CXGA 3V6GA 2R7XA 4M3FA 3VVZA 3WHBA 2ID6A 2DTZA 3DEWA 2UXOA 3VOKA 2IU5A 5HSZA 3KKCA 3SDGA 4U9NA 2WV1A 3T6NA 3QKXA 2XB5A 2RHAA 3TP3A 3BR2A 1JT0A 5AQCA 5FMPA 1UI6A 3LHQA 4WIBA 3HGGA 4W97A 5IPAA 3JSJA 5CXIA 5GP9A 2R7SA 4W1UA 2X9DA 2YVHA 5D1RA 5D19A 2ZCXA 3DU5A 2GFNA 5FGLA 3NS4A 5F27A 5CW8A 2ZOYA 3C07A 3E7QA 4JKZA 4KWAA 3BQZA 5GPCA 5DAJA 5EZGA 4M3EA 4C2MA 1U9OA 2YVXA 2REKA 2NP5A 5FKKA 3COLA 3AQTA 4GCTA 3G7RA 3TP0A 3GZIA 3HTAA 3O8GA 2B1EA 3LWJA 1RKTA 3BR1A 2IEKA 2XPUA 2GUHA 2HXOA 5IOYA 1ZKGA 2DG7A 4MXMA 3VW1A 5HBUA 4U9LA 2Y31A 2FJI1 1UI5A 2RAEA 3NNRA 2X6OA 3BCGA 2ZCMA 4M3BA 3B6CA 2R7WA 2NP3A 3RD3A 4CGRA 1QPIA 2PZ9A 2F07A 3QPLA 5FKOA 3VUQA 1BJZA 2G7SA 3MNLA 1JUSA 3VTIA 2R7VA 2IAIA 4GFLA 2G3BA 5CQGA 3NRGA 3PPBA 2XRLA 2R7QA 5F04A 3DPJA 2UXPA 3Q3SA 3VW0A 4I76A 5F1JA 5EZHA 5K58A 3DU6A 5D18A 3LJLA 1JTXA 5F0FA 1Z77A 3LSPA 3HE0A 2OI8A 2FX0A 4V2GA 2W53A 3NI7A 2WGBA 3PASA 5K7FA 2XGDA 1ZK8A 4B3AA 4L62A 3BR3A 2D6YA 2NX4A 1QVTA 1T33A 1SGMA 5J1UA 2HYJA 2QKOA 3BT9A 2UXUA 4ACIA 3HGYA 1JUMA 2EH3A 5FKNA 5FHPA 2UXIA 1JUPA 3KKDA 2YVEA 3O8HA 3F0CA 4X1EA 4M3DA 3IH2A 4PXIA 3F1BA 2XGEA 4GFKA 5FKLA 3EGQA 3FHNA 3BTJA 3EUPA 2Y30A 3HTJA 3GEUA 3LSRA 2ZB9A 4GCKA 2G7LA 3SFIA 2NS8A 3FK7A 1RKWA 4AC6A 2QOPA 3G56A 2IBDA 3ON2A 3VIBA 3IUVA 5GPAA 3ZQHA 3CJDA 3QBMA 3BTCA 3ANGA 3VOXA 5H9TA 3O60A 2B3WA 5IP6A 3NPIA 1Z0XA 2PBXA 3BRUA 3CWRA 3PM1A 2G0EA 2FQ4A 3KNWA 3QQAA 2ID3A 1QVUA 2O7OA 3HIMA 2HKUA 1A6IA 3DCFA 4ICHA 3BR6A 3BTIA 4XK4A 4JL3A 3ZQLA 2V57A 2R7UA 4IRVA 5IOZA 2Q24A 1ORKA 3Q0VA 4YZEA 1JTYA 3BNIA 3HTHA 3C2BA 4OD5A 3BR0A 1JT6A 3LOCA 4NELA 3IH4A 1VI0A 2NS7A 5K7ZA 4AUXA 3LSJA 2O7TA 5C4YA 3VP5A 3CDLA 3ZQIA 3Q0UA 3V78A 2JJ7A 5F0CA 3CRJA 4MK6A 4G12A 3FK6A 3NXCA 2DG8A 2QCOA 3FIWA 3VVXA 3K8PC 4UDSA 5J3LA 4ME9A 3VPRA 5F0HA 2R7RA 2OPTA 3ANPA 2WUIA 5FKMA 2PFVA 2VKEA 5HAWA 3WHCA 3BJBA 3ZQGA 2ZY9A 4AC0A 3Q0WA 2I10A 3G1OA 3B6AA 3B81A 5J1YA 2QTQA 4MO7A 3KZ9A 3KYLA 3ZQFA 3CCYA 4M3GA 2XPVA 4AF5A 3QPSA 2A2FX 4JYKA 3FRQA 4JNNA 4OD4A 5F08A 4GCLA 2GBYA 4DVYP 3VVYA 5EFYA 3G1MA 2JK3A 3HTIA 1T56A 5J1RA 2OF7A 1RPWA 2HYTA 2FJ1A 4D7NA 4NN1A 2VKVA 3G1LA 2VPRA 2QWTA 2UXHA 4I6ZA 4D5CA 2R7TA 2HQ5A 1U9NA 4V2FA 2GENA 2Y2ZA 2OERA 5EYRA 2HXIA 4D5FA 3RH2A 4B1RA 2ZCNA 3IH3A 4DW6A 3MVPA 3ON4A 2G7GA 2TCTA 3BQYA 2FD5A 4ABZA
chains in the Genus database with same CATH topology
4U9NA 4WIBA 2ZY9A 2YVXA 4U9LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U9N A;  4WIB A;  2ZY9 A;  2YVX A;  4U9L A; 
#chains in the Genus database with same CATH topology
 3SWH A;  2XDN A;  2RAS A;  3P9T A;  3AQS A;  3BHQ A;  5K7H A;  4D7M A;  2TRT A;  2XPW A;  3VW2 A;  2QIB A;  4HKU A;  3S5R A;  2ZOZ A;  2R7O A;  2XGC A;  3BR5 A;  2FBQ A;  3BTL A;  5CXG A;  3V6G A;  2R7X A;  4M3F A;  3VVZ A;  3WHB A;  2ID6 A;  2DTZ A;  3DEW A;  2UXO A;  3VOK A;  2IU5 A;  5HSZ A;  3KKC A;  3SDG A;  4U9N A;  2WV1 A;  3T6N A;  3QKX A;  2XB5 A;  2RHA A;  3TP3 A;  3BR2 A;  1JT0 A;  5AQC A;  5FMP A;  1UI6 A;  3LHQ A;  4WIB A;  3HGG A;  4W97 A;  5IPA A;  3JSJ A;  5CXI A;  5GP9 A;  2R7S A;  4W1U A;  2X9D A;  2YVH A;  5D1R A;  5D19 A;  2ZCX A;  3DU5 A;  2GFN A;  5FGL A;  3NS4 A;  5F27 A;  5CW8 A;  2ZOY A;  3C07 A;  3E7Q A;  4JKZ A;  4KWA A;  3BQZ A;  5GPC A;  5DAJ A;  5EZG A;  4M3E A;  4C2M A;  1U9O A;  2YVX A;  2REK A;  2NP5 A;  5FKK A;  3COL A;  3AQT A;  4GCT A;  3G7R A;  3TP0 A;  3GZI A;  3HTA A;  3O8G A;  2B1E A;  3LWJ A;  1RKT A;  3BR1 A;  2IEK A;  2XPU A;  2GUH A;  2HXO A;  5IOY A;  1ZKG A;  2DG7 A;  4MXM A;  3VW1 A;  5HBU A;  4U9L A;  2Y31 A;  2FJI 1;  1UI5 A;  2RAE A;  3NNR A;  2X6O A;  3BCG A;  2ZCM A;  4M3B A;  3B6C A;  2R7W A;  2NP3 A;  3RD3 A;  4CGR A;  1QPI A;  2PZ9 A;  2F07 A;  3QPL A;  5FKO A;  3VUQ A;  1BJZ A;  2G7S A;  3MNL A;  1JUS A;  3VTI A;  2R7V A;  2IAI A;  4GFL A;  2G3B A;  5CQG A;  3NRG A;  3PPB A;  2XRL A;  2R7Q A;  5F04 A;  3DPJ A;  2UXP A;  3Q3S A;  3VW0 A;  4I76 A;  5F1J A;  5EZH A;  5K58 A;  3DU6 A;  5D18 A;  3LJL A;  1JTX A;  5F0F A;  1Z77 A;  3LSP A;  3HE0 A;  2OI8 A;  2FX0 A;  4V2G A;  2W53 A;  3NI7 A;  2WGB A;  3PAS A;  5K7F A;  2XGD A;  1ZK8 A;  4B3A A;  4L62 A;  3BR3 A;  2D6Y A;  2NX4 A;  1QVT A;  1T33 A;  1SGM A;  5J1U A;  2HYJ A;  2QKO A;  3BT9 A;  2UXU A;  4ACI A;  3HGY A;  1JUM A;  2EH3 A;  5FKN A;  5FHP A;  2UXI A;  1JUP A;  3KKD A;  2YVE A;  3O8H A;  3F0C A;  4X1E A;  4M3D A;  3IH2 A;  4PXI A;  3F1B A;  2XGE A;  4GFK A;  5FKL A;  3EGQ A;  3FHN A;  3BTJ A;  3EUP A;  2Y30 A;  3HTJ A;  3GEU A;  3LSR A;  2ZB9 A;  4GCK A;  2G7L A;  3SFI A;  2NS8 A;  3FK7 A;  1RKW A;  4AC6 A;  2QOP A;  3G56 A;  2IBD A;  3ON2 A;  3VIB A;  3IUV A;  5GPA A;  3ZQH A;  3CJD A;  3QBM A;  3BTC A;  3ANG A;  3VOX A;  5H9T A;  3O60 A;  2B3W A;  5IP6 A;  3NPI A;  1Z0X A;  2PBX A;  3BRU A;  3CWR A;  3PM1 A;  2G0E A;  2FQ4 A;  3KNW A;  3QQA A;  2ID3 A;  1QVU A;  2O7O A;  3HIM A;  2HKU A;  1A6I A;  3DCF A;  4ICH A;  3BR6 A;  3BTI A;  4XK4 A;  4JL3 A;  3ZQL A;  2V57 A;  2R7U A;  4IRV A;  5IOZ A;  2Q24 A;  1ORK A;  3Q0V A;  4YZE A;  1JTY A;  3BNI A;  3HTH A;  3C2B A;  4OD5 A;  3BR0 A;  1JT6 A;  3LOC A;  4NEL A;  3IH4 A;  1VI0 A;  2NS7 A;  5K7Z A;  4AUX A;  3LSJ A;  2O7T A;  5C4Y A;  3VP5 A;  3CDL A;  3ZQI A;  3Q0U A;  3V78 A;  2JJ7 A;  5F0C A;  3CRJ A;  4MK6 A;  4G12 A;  3FK6 A;  3NXC A;  2DG8 A;  2QCO A;  3FIW A;  3VVX A;  3K8P C;  4UDS A;  5J3L A;  4ME9 A;  3VPR A;  5F0H A;  2R7R A;  2OPT A;  3ANP A;  2WUI A;  5FKM A;  2PFV A;  2VKE A;  5HAW A;  3WHC A;  3BJB A;  3ZQG A;  2ZY9 A;  4AC0 A;  3Q0W A;  2I10 A;  3G1O A;  3B6A A;  3B81 A;  5J1Y A;  2QTQ A;  4MO7 A;  3KZ9 A;  3KYL A;  3ZQF A;  3CCY A;  4M3G A;  2XPV A;  4AF5 A;  3QPS A;  2A2F X;  4JYK A;  3FRQ A;  4JNN A;  4OD4 A;  5F08 A;  4GCL A;  2GBY A;  4DVY P;  3VVY A;  5EFY A;  3G1M A;  2JK3 A;  3HTI A;  1T56 A;  5J1R A;  2OF7 A;  1RPW A;  2HYT A;  2FJ1 A;  4D7N A;  4NN1 A;  2VKV A;  3G1L A;  2VPR A;  2QWT A;  2UXH A;  4I6Z A;  4D5C A;  2R7T A;  2HQ5 A;  1U9N A;  4V2F A;  2GEN A;  2Y2Z A;  2OER A;  5EYR A;  2HXI A;  4D5F A;  3RH2 A;  4B1R A;  2ZCN A;  3IH3 A;  4DW6 A;  3MVP A;  3ON4 A;  2G7G A;  2TCT A;  3BQY A;  2FD5 A;  4ABZ A; 
#chains in the Genus database with same CATH homology
 4U9N A;  4WIB A;  2ZY9 A;  2YVX A;  4U9L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...