4U9NA

Structure of a membrane protein
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
177
structure length
177
Chain Sequence
VYSEAGPVALWLARVRWLVILILTGMVTSSILQGFESVLEAVTALAFYVPVLLGTGGNTGNQSATLIIRALATRDLDLRDWRRVFLKEMGVGLLLGLTLSFLLVGKVYWDGHPLLLPVVGVSLVLIVFFANLVGAMLPFLLRRLGVDPALVSNPLVATLSDVTGLLIYLSVARLLLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Metal transport
molecule keywords Magnesium transporter MgtE
publication title Structural basis for ion selectivity revealed by high-resolution crystal structure of Mg(2+) channel MgtE
pubmed doi rcsb
source organism Thermus thermophilus hb8
total genus 69
structure length 177
sequence length 177
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01769 MgtE Divalent cation transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.20 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 SLC41 divalent cation transporters, integral membrane domain 4u9nA00
2ZY9A 4WIBA 4U9LA 2YVXA 4U9NA
chains in the Genus database with same CATH superfamily
3SWHA 2DG7A 4GCTA 3HTJA 2JK3A 1JUPA 2XPVA 5HBUA 3BTLA 1RKTA 3BNIA 3FK6A 2X6OA 2UXHA 2ZCMA 2ID6A 5FMPA 2XPWA 3CCYA 5CQGA 3LJLA 3MVPA 3QKXA 3ZQGA 2NX4A 3LSJA 3NI7A 2QWTA 2REKA 3VP5A 3BTJA 3JSJA 4W1UA 3BCGA 2B1EA 2QKOA 3ANGA 2HXIA 5EZHA 3VTIA 3EUPA 2XB5A 2RAEA 4XK4A 1T56A 4W97A 3VW2A 3QPLA 3F1BA 4NN1A 2YVEA 3HGYA 5FKMA 2B3WA 2WGBA 4JYKA 2VKEA 3E7QA 2HYTA 4ACIA 2XGCA 3LOCA 5J1RA 5EFYA 2VPRA 3VVXA 3Q0UA 3V78A 2X9DA 2GENA 2EH3A 3BR0A 2PBXA 4GFKA 4IRVA 2GBYA 2ZY9A 4JKZA 2R7UA 3HGGA 3G1OA 1ORKA 3LSPA 1A6IA 3P9TA 2G7GA 5F0CA 2NS7A 5K7FA 4I6ZA 3VW1A 4MXMA 4OD5A 4MK6A 4D7MA 2NP3A 5HAWA 3GZIA 4D5CA 3IH3A 1QPIA 2R7WA 3FIWA 3C2BA 5H9TA 3CWRA 4JL3A 2HKUA 2Y30A 2R7TA 1QVTA 3CJDA 2FJI1 4U9LA 5CW8A 3VW0A 1JTXA 2WUIA 3B6CA 2OPTA 5FKNA 3IH4A 2Y2ZA 5EZGA 3HIMA 3BHQA 5FKLA 1QVUA 2I10A 4HKUA 1Z77A 2IAIA 5K7HA 4GCKA 4DVYP 3LHQA 1U9OA 2RASA 3KKCA 3VOXA 3Q3SA 1RPWA 3DEWA 2ZB9A 3GEUA 1RKWA 2G0EA 2ID3A 2O7TA 2UXPA 3KNWA 3ZQFA 3LWJA 2HQ5A 3G56A 3NRGA 3SDGA 2FJ1A 4GFLA 1ZK8A 3HTHA 2R7RA 2F07A 3BQYA 5IP6A 2QOPA 2UXUA 3QBMA 4B3AA 5EYRA 3FRQA 1SGMA 2Y31A 2FX0A 2NS8A 3KYLA 1T33A 2NP5A 3G1LA 5IOYA 5F27A 4U9NA 4MO7A 4GCLA 3NS4A 3PM1A 2YVXA 3RD3A 4D7NA 4WIBA 3S5RA 2R7VA 2IEKA 3TP0A 2FD5A 2OI8A 3VVYA 5D19A 2OF7A 4ABZA 2RHAA 2R7XA 2R7OA 3K8PC 4X1EA 2V57A 3BR1A 3MNLA 3TP3A 2GUHA 3BRUA 3G7RA 4I76A 3Q0WA 3B6AA 3VOKA 5IPAA 3COLA 5CXIA 3BR2A 4M3EA 3HE0A 3HTIA 2Q24A 4C2MA 5K7ZA 2TRTA 4DW6A 3ON4A 4KWAA 2R7SA 5D1RA 3ANPA 3FK7A 5IOZA 3HTAA 3C07A 4YZEA 3VUQA 4AC0A 3WHCA 5HSZA 3T6NA 3NXCA 2UXOA 5J3LA 2IU5A 2HXOA 3KKDA 3ON2A 5GPAA 3BR5A 1JTYA 3AQSA 1ZKGA 2ZCNA 3O60A 5FKKA 5K58A 3BT9A 3PASA 2W53A 4AUXA 3BJBA 3VIBA 3F0CA 1JT6A 2O7OA 3VVZA 3BTCA 2UXIA 2DTZA 3ZQHA 3VPRA 3IUVA 1JUSA 2XPUA 2IBDA 5FGLA 3B81A 2GFNA 2TCTA 3BR3A 2R7QA 1UI5A 5F0HA 2ZOZA 3DPJA 2JJ7A 4CGRA 5CXGA 2HYJA 4L62A 4ICHA 4AF5A 5AQCA 1JT0A 5D18A 2FQ4A 1BJZA 2FBQA 4M3DA 2VKVA 2DG8A 3WHBA 2G7SA 1VI0A 4M3GA 3DCFA 5C4YA 3PPBA 2ZOYA 4B1RA 3O8GA 4PXIA 3BR6A 5J1YA 2QIBA 2ZCXA 3NNRA 3G1MA 3KZ9A 2YVHA 5J1UA 5F0FA 3V6GA 4ME9A 3NPIA 2G7LA 5FHPA 3DU5A 4OD4A 1Z0XA 3BTIA 3FHNA 4JNNA 3O8HA 3BQZA 3RH2A 2PFVA 3EGQA 1UI6A 5F1JA 4M3FA 3ZQLA 3QPSA 4G12A 5GP9A 3CRJA 2XGDA 1JUMA 3IH2A 2QTQA 4V2GA 2G3BA 3AQTA 2D6YA 2QCOA 3Q0VA 5DAJA 3CDLA 4D5FA 2XGEA 5GPCA 3QQAA 3ZQIA 4AC6A 4M3BA 3SFIA 5F04A 2OERA 4V2FA 2XDNA 1U9NA 2WV1A 2XRLA 5F08A 4NELA 3LSRA 3DU6A 2A2FX 2PZ9A 5FKOA 4UDSA
chains in the Genus database with same CATH topology
2ZY9A 4WIBA 4U9LA 2YVXA 4U9NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZY9 A;  4WIB A;  4U9L A;  2YVX A;  4U9N A; 
#chains in the Genus database with same CATH topology
 3SWH A;  2DG7 A;  4GCT A;  3HTJ A;  2JK3 A;  1JUP A;  2XPV A;  5HBU A;  3BTL A;  1RKT A;  3BNI A;  3FK6 A;  2X6O A;  2UXH A;  2ZCM A;  2ID6 A;  5FMP A;  2XPW A;  3CCY A;  5CQG A;  3LJL A;  3MVP A;  3QKX A;  3ZQG A;  2NX4 A;  3LSJ A;  3NI7 A;  2QWT A;  2REK A;  3VP5 A;  3BTJ A;  3JSJ A;  4W1U A;  3BCG A;  2B1E A;  2QKO A;  3ANG A;  2HXI A;  5EZH A;  3VTI A;  3EUP A;  2XB5 A;  2RAE A;  4XK4 A;  1T56 A;  4W97 A;  3VW2 A;  3QPL A;  3F1B A;  4NN1 A;  2YVE A;  3HGY A;  5FKM A;  2B3W A;  2WGB A;  4JYK A;  2VKE A;  3E7Q A;  2HYT A;  4ACI A;  2XGC A;  3LOC A;  5J1R A;  5EFY A;  2VPR A;  3VVX A;  3Q0U A;  3V78 A;  2X9D A;  2GEN A;  2EH3 A;  3BR0 A;  2PBX A;  4GFK A;  4IRV A;  2GBY A;  2ZY9 A;  4JKZ A;  2R7U A;  3HGG A;  3G1O A;  1ORK A;  3LSP A;  1A6I A;  3P9T A;  2G7G A;  5F0C A;  2NS7 A;  5K7F A;  4I6Z A;  3VW1 A;  4MXM A;  4OD5 A;  4MK6 A;  4D7M A;  2NP3 A;  5HAW A;  3GZI A;  4D5C A;  3IH3 A;  1QPI A;  2R7W A;  3FIW A;  3C2B A;  5H9T A;  3CWR A;  4JL3 A;  2HKU A;  2Y30 A;  2R7T A;  1QVT A;  3CJD A;  2FJI 1;  4U9L A;  5CW8 A;  3VW0 A;  1JTX A;  2WUI A;  3B6C A;  2OPT A;  5FKN A;  3IH4 A;  2Y2Z A;  5EZG A;  3HIM A;  3BHQ A;  5FKL A;  1QVU A;  2I10 A;  4HKU A;  1Z77 A;  2IAI A;  5K7H A;  4GCK A;  4DVY P;  3LHQ A;  1U9O A;  2RAS A;  3KKC A;  3VOX A;  3Q3S A;  1RPW A;  3DEW A;  2ZB9 A;  3GEU A;  1RKW A;  2G0E A;  2ID3 A;  2O7T A;  2UXP A;  3KNW A;  3ZQF A;  3LWJ A;  2HQ5 A;  3G56 A;  3NRG A;  3SDG A;  2FJ1 A;  4GFL A;  1ZK8 A;  3HTH A;  2R7R A;  2F07 A;  3BQY A;  5IP6 A;  2QOP A;  2UXU A;  3QBM A;  4B3A A;  5EYR A;  3FRQ A;  1SGM A;  2Y31 A;  2FX0 A;  2NS8 A;  3KYL A;  1T33 A;  2NP5 A;  3G1L A;  5IOY A;  5F27 A;  4U9N A;  4MO7 A;  4GCL A;  3NS4 A;  3PM1 A;  2YVX A;  3RD3 A;  4D7N A;  4WIB A;  3S5R A;  2R7V A;  2IEK A;  3TP0 A;  2FD5 A;  2OI8 A;  3VVY A;  5D19 A;  2OF7 A;  4ABZ A;  2RHA A;  2R7X A;  2R7O A;  3K8P C;  4X1E A;  2V57 A;  3BR1 A;  3MNL A;  3TP3 A;  2GUH A;  3BRU A;  3G7R A;  4I76 A;  3Q0W A;  3B6A A;  3VOK A;  5IPA A;  3COL A;  5CXI A;  3BR2 A;  4M3E A;  3HE0 A;  3HTI A;  2Q24 A;  4C2M A;  5K7Z A;  2TRT A;  4DW6 A;  3ON4 A;  4KWA A;  2R7S A;  5D1R A;  3ANP A;  3FK7 A;  5IOZ A;  3HTA A;  3C07 A;  4YZE A;  3VUQ A;  4AC0 A;  3WHC A;  5HSZ A;  3T6N A;  3NXC A;  2UXO A;  5J3L A;  2IU5 A;  2HXO A;  3KKD A;  3ON2 A;  5GPA A;  3BR5 A;  1JTY A;  3AQS A;  1ZKG A;  2ZCN A;  3O60 A;  5FKK A;  5K58 A;  3BT9 A;  3PAS A;  2W53 A;  4AUX A;  3BJB A;  3VIB A;  3F0C A;  1JT6 A;  2O7O A;  3VVZ A;  3BTC A;  2UXI A;  2DTZ A;  3ZQH A;  3VPR A;  3IUV A;  1JUS A;  2XPU A;  2IBD A;  5FGL A;  3B81 A;  2GFN A;  2TCT A;  3BR3 A;  2R7Q A;  1UI5 A;  5F0H A;  2ZOZ A;  3DPJ A;  2JJ7 A;  4CGR A;  5CXG A;  2HYJ A;  4L62 A;  4ICH A;  4AF5 A;  5AQC A;  1JT0 A;  5D18 A;  2FQ4 A;  1BJZ A;  2FBQ A;  4M3D A;  2VKV A;  2DG8 A;  3WHB A;  2G7S A;  1VI0 A;  4M3G A;  3DCF A;  5C4Y A;  3PPB A;  2ZOY A;  4B1R A;  3O8G A;  4PXI A;  3BR6 A;  5J1Y A;  2QIB A;  2ZCX A;  3NNR A;  3G1M A;  3KZ9 A;  2YVH A;  5J1U A;  5F0F A;  3V6G A;  4ME9 A;  3NPI A;  2G7L A;  5FHP A;  3DU5 A;  4OD4 A;  1Z0X A;  3BTI A;  3FHN A;  4JNN A;  3O8H A;  3BQZ A;  3RH2 A;  2PFV A;  3EGQ A;  1UI6 A;  5F1J A;  4M3F A;  3ZQL A;  3QPS A;  4G12 A;  5GP9 A;  3CRJ A;  2XGD A;  1JUM A;  3IH2 A;  2QTQ A;  4V2G A;  2G3B A;  3AQT A;  2D6Y A;  2QCO A;  3Q0V A;  5DAJ A;  3CDL A;  4D5F A;  2XGE A;  5GPC A;  3QQA A;  3ZQI A;  4AC6 A;  4M3B A;  3SFI A;  5F04 A;  2OER A;  4V2F A;  2XDN A;  1U9N A;  2WV1 A;  2XRL A;  5F08 A;  4NEL A;  3LSR A;  3DU6 A;  2A2F X;  2PZ9 A;  5FKO A;  4UDS A; 
#chains in the Genus database with same CATH homology
 2ZY9 A;  4WIB A;  4U9L A;  2YVX A;  4U9N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...