4U9NA

Structure of a membrane protein
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
177
structure length
177
Chain Sequence
VYSEAGPVALWLARVRWLVILILTGMVTSSILQGFESVLEAVTALAFYVPVLLGTGGNTGNQSATLIIRALATRDLDLRDWRRVFLKEMGVGLLLGLTLSFLLVGKVYWDGHPLLLPVVGVSLVLIVFFANLVGAMLPFLLRRLGVDPALVSNPLVATLSDVTGLLIYLSVARLLLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for ion selectivity revealed by high-resolution crystal structure of Mg(2+) channel MgtE
pubmed doi rcsb
source organism Thermus thermophilus hb8
molecule tags Metal transport
molecule keywords Magnesium transporter MgtE
total genus 69
structure length 177
sequence length 177
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01769 MgtE Divalent cation transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.20 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 SLC41 divalent cation transporters, integral membrane domain 4u9nA00
4WIBA 4U9LA 2YVXA 2ZY9A 4U9NA
chains in the Genus database with same CATH superfamily
5J3LA 2QKOA 4IRVA 4ICHA 3Q0VA 3BTIA 4GFLA 5AQCA 2QIBA 2G0EA 2Q24A 2Y31A 2RHAA 3HTHA 3VIBA 5EFYA 3RH2A 3G1LA 3T6NA 3WHCA 1UI5A 4OD4A 4MO7A 2Y30A 5F08A 5K7FA 3CJDA 5IOYA 3ZQFA 3E7QA 3B6AA 3G56A 3DEWA 2B1EA 5EZHA 3EUPA 4I6ZA 2O7TA 2PBXA 3PM1A 2NX4A 3C2BA 5FKNA 3BQZA 2NS7A 2ZCNA 3VVXA 2ZB9A 2OERA 1QVUA 2QCOA 2XPVA 2TCTA 5K7HA 5D18A 3JSJA 4NELA 1JT6A 3V78A 2ID6A 5D19A 2YVXA 3GZIA 3Q3SA 5FKOA 3ZQIA 2ZCMA 4GCTA 2OF7A 3LSJA 3VOKA 2HKUA 2QWTA 2TRTA 2B3WA 2PFVA 1ZK8A 2R7SA 3KZ9A 3FHNA 2VKEA 3HTAA 3BR1A 2IBDA 3PPBA 2R7RA 3ANGA 3VVZA 4MK6A 3BHQA 3EGQA 3DPJA 3QQAA 3LJLA 4ACIA 2QTQA 3NS4A 2HXIA 1JT0A 3CWRA 5K7ZA 3HTIA 3S5RA 2WUIA 4V2GA 2XGCA 4UDSA 4M3GA 3BR3A 5IPAA 2GBYA 2X9DA 3VOXA 4M3FA 5F27A 4G12A 2EH3A 3BR0A 3WHBA 1Z77A 5CW8A 1A6IA 4DVYP 3G1OA 2NP5A 2G7GA 2OPTA 5C4YA 4JL3A 4AUXA 3G7RA 5GPAA 2WGBA 4B1RA 4YZEA 5D1RA 2HYTA 3TP0A 5DAJA 3QPLA 4X1EA 5CXIA 3KNWA 4U9LA 1UI6A 2XGEA 3IH4A 5EYRA 4D5CA 1ZKGA 3VVYA 2PZ9A 2R7OA 5H9TA 2ZOZA 2ZY9A 3BR5A 3BQYA 5F0CA 4NN1A 2XDNA 1JTXA 3NRGA 2IU5A 4D7MA 3IUVA 2UXPA 2G7LA 2UXHA 3G1MA 1QPIA 4U9NA 1VI0A 2IAIA 3P9TA 2O7OA 2R7UA 2OI8A 3QBMA 2V57A 2D6YA 2IEKA 2RASA 5GPCA 5F0FA 5GP9A 4C2MA 4PXIA 4ME9A 3FRQA 1Z0XA 5IP6A 4V2FA 5FKLA 2JK3A 2HXOA 5F04A 2NP3A 2FQ4A 3BR6A 2DG7A 5IOZA 2R7VA 3O8GA 2QOPA 4KWAA 2JJ7A 2F07A 3CCYA 3Q0UA 4D5FA 3IH2A 3NXCA 3SWHA 5HSZA 4M3DA 4ABZA 2Y2ZA 3FK7A 5J1RA 4GCKA 3ANPA 3VUQA 1SGMA 2FBQA 3BT9A 1JUMA 2HQ5A 3B6CA 4MXMA 4DW6A 3ZQLA 3NNRA 3LWJA 2YVEA 3HGGA 3BCGA 2VKVA 2R7QA 1BJZA 3RD3A 2UXUA 2XRLA 1T33A 2HYJA 3ON4A 4OD5A 5EZGA 3V6GA 3NI7A 3BTJA 4CGRA 4XK4A 2FD5A 3VW0A 2VPRA 3ON2A 5F1JA 1ORKA 3LSRA 2REKA 2XPWA 4D7NA 3LSPA 2R7XA 5FMPA 4W1UA 1JUPA 2R7WA 3ZQGA 2FJ1A 4M3EA 2G7SA 2DTZA 3HTJA 3DU6A 3ZQHA 3C07A 2I10A 3BNIA 3COLA 2XB5A 3BTCA 5CXGA 5FGLA 3FIWA 3HIMA 3HE0A 2XGDA 5FHPA 3BRUA 3BR2A 4I76A 3FK6A 2X6OA 1U9OA 3LHQA 5FKMA 1QVTA 4JYKA 1U9NA 3NPIA 4GCLA 3VW1A 3MVPA 4AC6A 5J1UA 2ID3A 3IH3A 2A2FX 2RAEA 4B3AA 2ZCXA 3VP5A 5FKKA 3KKDA 2NS8A 2UXOA 5J1YA 3BJBA 3F1BA 3DCFA 3VPRA 3K8PC 4L62A 3KYLA 4AC0A 1JUSA 5HAWA 3GEUA 3DU5A 1JTYA 4JNNA 3LOCA 5K58A 1RPWA 1RKWA 3O60A 1RKTA 3QPSA 4HKUA 3B81A 3BTLA 3F0CA 2GFNA 3MNLA 4WIBA 3AQSA 1T56A 4AF5A 3SFIA 2GUHA 3CDLA 2FX0A 2W53A 3O8HA 3AQTA 2ZOYA 4GFKA 2YVHA 5CQGA 3CRJA 2GENA 5F0HA 3TP3A 3HGYA 2XPUA 2G3BA 3PASA 3KKCA 4M3BA 3Q0WA 2FJI1 2UXIA 2R7TA 3VW2A 2WV1A 4JKZA 3SDGA 3VTIA 4W97A 2DG8A 5HBUA 3QKXA
chains in the Genus database with same CATH topology
4WIBA 4U9LA 2YVXA 2ZY9A 4U9NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WIB A;  4U9L A;  2YVX A;  2ZY9 A;  4U9N A; 
#chains in the Genus database with same CATH topology
 5J3L A;  2QKO A;  4IRV A;  4ICH A;  3Q0V A;  3BTI A;  4GFL A;  5AQC A;  2QIB A;  2G0E A;  2Q24 A;  2Y31 A;  2RHA A;  3HTH A;  3VIB A;  5EFY A;  3RH2 A;  3G1L A;  3T6N A;  3WHC A;  1UI5 A;  4OD4 A;  4MO7 A;  2Y30 A;  5F08 A;  5K7F A;  3CJD A;  5IOY A;  3ZQF A;  3E7Q A;  3B6A A;  3G56 A;  3DEW A;  2B1E A;  5EZH A;  3EUP A;  4I6Z A;  2O7T A;  2PBX A;  3PM1 A;  2NX4 A;  3C2B A;  5FKN A;  3BQZ A;  2NS7 A;  2ZCN A;  3VVX A;  2ZB9 A;  2OER A;  1QVU A;  2QCO A;  2XPV A;  2TCT A;  5K7H A;  5D18 A;  3JSJ A;  4NEL A;  1JT6 A;  3V78 A;  2ID6 A;  5D19 A;  2YVX A;  3GZI A;  3Q3S A;  5FKO A;  3ZQI A;  2ZCM A;  4GCT A;  2OF7 A;  3LSJ A;  3VOK A;  2HKU A;  2QWT A;  2TRT A;  2B3W A;  2PFV A;  1ZK8 A;  2R7S A;  3KZ9 A;  3FHN A;  2VKE A;  3HTA A;  3BR1 A;  2IBD A;  3PPB A;  2R7R A;  3ANG A;  3VVZ A;  4MK6 A;  3BHQ A;  3EGQ A;  3DPJ A;  3QQA A;  3LJL A;  4ACI A;  2QTQ A;  3NS4 A;  2HXI A;  1JT0 A;  3CWR A;  5K7Z A;  3HTI A;  3S5R A;  2WUI A;  4V2G A;  2XGC A;  4UDS A;  4M3G A;  3BR3 A;  5IPA A;  2GBY A;  2X9D A;  3VOX A;  4M3F A;  5F27 A;  4G12 A;  2EH3 A;  3BR0 A;  3WHB A;  1Z77 A;  5CW8 A;  1A6I A;  4DVY P;  3G1O A;  2NP5 A;  2G7G A;  2OPT A;  5C4Y A;  4JL3 A;  4AUX A;  3G7R A;  5GPA A;  2WGB A;  4B1R A;  4YZE A;  5D1R A;  2HYT A;  3TP0 A;  5DAJ A;  3QPL A;  4X1E A;  5CXI A;  3KNW A;  4U9L A;  1UI6 A;  2XGE A;  3IH4 A;  5EYR A;  4D5C A;  1ZKG A;  3VVY A;  2PZ9 A;  2R7O A;  5H9T A;  2ZOZ A;  2ZY9 A;  3BR5 A;  3BQY A;  5F0C A;  4NN1 A;  2XDN A;  1JTX A;  3NRG A;  2IU5 A;  4D7M A;  3IUV A;  2UXP A;  2G7L A;  2UXH A;  3G1M A;  1QPI A;  4U9N A;  1VI0 A;  2IAI A;  3P9T A;  2O7O A;  2R7U A;  2OI8 A;  3QBM A;  2V57 A;  2D6Y A;  2IEK A;  2RAS A;  5GPC A;  5F0F A;  5GP9 A;  4C2M A;  4PXI A;  4ME9 A;  3FRQ A;  1Z0X A;  5IP6 A;  4V2F A;  5FKL A;  2JK3 A;  2HXO A;  5F04 A;  2NP3 A;  2FQ4 A;  3BR6 A;  2DG7 A;  5IOZ A;  2R7V A;  3O8G A;  2QOP A;  4KWA A;  2JJ7 A;  2F07 A;  3CCY A;  3Q0U A;  4D5F A;  3IH2 A;  3NXC A;  3SWH A;  5HSZ A;  4M3D A;  4ABZ A;  2Y2Z A;  3FK7 A;  5J1R A;  4GCK A;  3ANP A;  3VUQ A;  1SGM A;  2FBQ A;  3BT9 A;  1JUM A;  2HQ5 A;  3B6C A;  4MXM A;  4DW6 A;  3ZQL A;  3NNR A;  3LWJ A;  2YVE A;  3HGG A;  3BCG A;  2VKV A;  2R7Q A;  1BJZ A;  3RD3 A;  2UXU A;  2XRL A;  1T33 A;  2HYJ A;  3ON4 A;  4OD5 A;  5EZG A;  3V6G A;  3NI7 A;  3BTJ A;  4CGR A;  4XK4 A;  2FD5 A;  3VW0 A;  2VPR A;  3ON2 A;  5F1J A;  1ORK A;  3LSR A;  2REK A;  2XPW A;  4D7N A;  3LSP A;  2R7X A;  5FMP A;  4W1U A;  1JUP A;  2R7W A;  3ZQG A;  2FJ1 A;  4M3E A;  2G7S A;  2DTZ A;  3HTJ A;  3DU6 A;  3ZQH A;  3C07 A;  2I10 A;  3BNI A;  3COL A;  2XB5 A;  3BTC A;  5CXG A;  5FGL A;  3FIW A;  3HIM A;  3HE0 A;  2XGD A;  5FHP A;  3BRU A;  3BR2 A;  4I76 A;  3FK6 A;  2X6O A;  1U9O A;  3LHQ A;  5FKM A;  1QVT A;  4JYK A;  1U9N A;  3NPI A;  4GCL A;  3VW1 A;  3MVP A;  4AC6 A;  5J1U A;  2ID3 A;  3IH3 A;  2A2F X;  2RAE A;  4B3A A;  2ZCX A;  3VP5 A;  5FKK A;  3KKD A;  2NS8 A;  2UXO A;  5J1Y A;  3BJB A;  3F1B A;  3DCF A;  3VPR A;  3K8P C;  4L62 A;  3KYL A;  4AC0 A;  1JUS A;  5HAW A;  3GEU A;  3DU5 A;  1JTY A;  4JNN A;  3LOC A;  5K58 A;  1RPW A;  1RKW A;  3O60 A;  1RKT A;  3QPS A;  4HKU A;  3B81 A;  3BTL A;  3F0C A;  2GFN A;  3MNL A;  4WIB A;  3AQS A;  1T56 A;  4AF5 A;  3SFI A;  2GUH A;  3CDL A;  2FX0 A;  2W53 A;  3O8H A;  3AQT A;  2ZOY A;  4GFK A;  2YVH A;  5CQG A;  3CRJ A;  2GEN A;  5F0H A;  3TP3 A;  3HGY A;  2XPU A;  2G3B A;  3PAS A;  3KKC A;  4M3B A;  3Q0W A;  2FJI 1;  2UXI A;  2R7T A;  3VW2 A;  2WV1 A;  4JKZ A;  3SDG A;  3VTI A;  4W97 A;  2DG8 A;  5HBU A;  3QKX A; 
#chains in the Genus database with same CATH homology
 4WIB A;  4U9L A;  2YVX A;  2ZY9 A;  4U9N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...