4U9NA

Structure of a membrane protein
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
177
structure length
177
Chain Sequence
b'VYSEAGPVALWLARVRWLVILILTGMVTSSILQGFESVLEAVTALAFYVPVLLGTGGNTGNQSATLIIRALATRDLDLRDWRRVFLKEMGVGLLLGLTLSFLLVGKVYWDGHPLLLPVVGVSLVLIVFFANLVGAMLPFLLRRLGVDPALVSNPLVATLSDVTGLLIYLSVARLLLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Magnesium transporter MgtE
publication title Structural basis for ion selectivity revealed by high-resolution crystal structure of Mg(2+) channel MgtE
pubmed doi rcsb
source organism Thermus thermophilus hb8
molecule tags Metal transport
total genus 69
structure length 177
sequence length 177
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01769 MgtE Divalent cation transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.20 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 SLC41 divalent cation transporters, integral membrane domain 4u9nA00
2ZY9A 4U9NA 4WIBA 2YVXA 4U9LA
chains in the Genus database with same CATH superfamily
5FKLA 3CWRA 3P9TA 2HXIA 2G3BA 2TCTA 2RHAA 3DCFA 2R7XA 3QKXA 3NRGA 2QWTA 5D1RA 5HSZA 2F07A 3G1OA 3BRUA 4U9NA 2G7LA 3BR5A 1T56A 3RD3A 3VW2A 2NX4A 3HIMA 3NPIA 2VKVA 2XPUA 4MK6A 3F0CA 3C07A 1QVTA 3MNLA 1A6IA 5F27A 5EZHA 4JNNA 2UXOA 3LSJA 3VTIA 3B6AA 3BCGA 3EUPA 4D5CA 2IU5A 5FKMA 2UXPA 3VP5A 4KWAA 4JL3A 2EH3A 3LJLA 2X6OA 2VPRA 2NP5A 4AC6A 3VVYA 2G0EA 1ORKA 3G56A 3DU5A 3T6NA 3ZQGA 3ZQFA 3NS4A 3HTIA 2G7SA 5J3LA 4GFKA 2OI8A 4M3BA 5FMPA 5EYRA 4YZEA 2WUIA 3FK6A 5K58A 5K7ZA 3HTJA 3KZ9A 2D6YA 4M3FA 4JYKA 3VW1A 5F1JA 3GZIA 1JTYA 3ZQLA 3HGGA 2UXIA 2OERA 3FHNA 3SFIA 3O8GA 2GUHA 4DVYP 1U9NA 3BR6A 2XPWA 3EGQA 1UI5A 1Z0XA 3QQAA 2FQ4A 3NI7A 2UXUA 3ON4A 2RASA 2YVHA 3PPBA 4UDSA 5D19A 5F04A 4W1UA 3KKDA 2ZCNA 3BJBA 2GENA 3BT9A 3Q0VA 2Y2ZA 3DPJA 4V2GA 3B6CA 3KKCA 2ZB9A 2GFNA 3PM1A 4I76A 4ACIA 3BR0A 2ZY9A 3IUVA 2XB5A 5H9TA 2ID3A 4AUXA 4D5FA 1JTXA 3QPLA 3AQTA 3BQYA 3VPRA 4CGRA 5K7FA 2R7WA 3COLA 2W53A 3TP0A 5C4YA 3HTHA 2ZOZA 3NXCA 4MO7A 2OF7A 1Z77A 5IOYA 2R7RA 3VOXA 2JK3A 2O7OA 4M3EA 4WIBA 1BJZA 2X9DA 3Q0UA 4B1RA 5F0FA 2DG7A 3Q0WA 4NN1A 3VW0A 3O60A 3K8PC 5GPCA 3B81A 5FKNA 2NP3A 5EFYA 3VVZA 3BTIA 4NELA 3FK7A 2IAIA 4OD5A 5J1YA 3HTAA 5DAJA 3MVPA 3RH2A 3SWHA 4GCLA 2QKOA 3BTCA 2HQ5A 3LOCA 2ZCMA 3ANGA 2R7VA 4JKZA 2NS7A 3E7QA 2I10A 5GP9A 3LSPA 3CDLA 2REKA 4D7NA 3VVXA 4D7MA 3BNIA 3DU6A 4AC0A 2VKEA 4HKUA 3LWJA 4DW6A 2HKUA 3VIBA 2XPVA 5HBUA 2V57A 2PFVA 2YVEA 2RAEA 4GCKA 3G1LA 2FX0A 1JUPA 2IEKA 3IH4A 5FGLA 4ME9A 5F0CA 5IPAA 2UXHA 5FHPA 2XDNA 2HYTA 3DEWA 3ZQHA 1QVUA 1SGMA 3O8HA 5J1UA 3BTLA 3QBMA 2OPTA 3SDGA 2WGBA 5IOZA 5EZGA 3CCYA 4M3DA 3BTJA 2QTQA 2R7UA 3Q3SA 2WV1A 2HXOA 5AQCA 2FD5A 3LSRA 5K7HA 3QPSA 1ZKGA 2JJ7A 4I6ZA 4L62A 4AF5A 3BR1A 3S5RA 3ANPA 4IRVA 3HGYA 2A2FX 2XGEA 2HYJA 3G7RA 2Y30A 2ZCXA 2G7GA 5CXIA 1U9OA 3FIWA 2DTZA 3BHQA 2R7OA 1RPWA 4XK4A 4G12A 3NNRA 3FRQA 2NS8A 5CW8A 1JT6A 3ZQIA 2FJ1A 4ICHA 5IP6A 3TP3A 5J1RA 2IBDA 1JUSA 5GPAA 4V2FA 2QOPA 3F1BA 3G1MA 3C2BA 5HAWA 2DG8A 3KYLA 3GEUA 2XGDA 4OD4A 5FKKA 2YVXA 2QIBA 3LHQA 4W97A 2B1EA 2ZOYA 5D18A 4ABZA 1JT0A 3WHBA 3BR2A 4B3AA 3CRJA 2PBXA 2GBYA 1RKWA 2B3WA 5FKOA 4X1EA 2Y31A 3CJDA 5CQGA 3VOKA 1VI0A 3KNWA 2QCOA 5F0HA 3PASA 1RKTA 3IH2A 2R7TA 2FJI1 1T33A 4C2MA 3V6GA 2XGCA 4GFLA 4M3GA 3V78A 2R7SA 2O7TA 1UI6A 2FBQA 4MXMA 2ID6A 2XRLA 1QPIA 2Q24A 4PXIA 3HE0A 3VUQA 3ON2A 3JSJA 3BQZA 2R7QA 2TRTA 3BR3A 4GCTA 3IH3A 1JUMA 4U9LA 2PZ9A 1ZK8A 5F08A 3AQSA 3WHCA 5CXGA
chains in the Genus database with same CATH topology
2ZY9A 4U9NA 4WIBA 2YVXA 4U9LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZY9 A;  4U9N A;  4WIB A;  2YVX A;  4U9L A; 
#chains in the Genus database with same CATH topology
 5FKL A;  3CWR A;  3P9T A;  2HXI A;  2G3B A;  2TCT A;  2RHA A;  3DCF A;  2R7X A;  3QKX A;  3NRG A;  2QWT A;  5D1R A;  5HSZ A;  2F07 A;  3G1O A;  3BRU A;  4U9N A;  2G7L A;  3BR5 A;  1T56 A;  3RD3 A;  3VW2 A;  2NX4 A;  3HIM A;  3NPI A;  2VKV A;  2XPU A;  4MK6 A;  3F0C A;  3C07 A;  1QVT A;  3MNL A;  1A6I A;  5F27 A;  5EZH A;  4JNN A;  2UXO A;  3LSJ A;  3VTI A;  3B6A A;  3BCG A;  3EUP A;  4D5C A;  2IU5 A;  5FKM A;  2UXP A;  3VP5 A;  4KWA A;  4JL3 A;  2EH3 A;  3LJL A;  2X6O A;  2VPR A;  2NP5 A;  4AC6 A;  3VVY A;  2G0E A;  1ORK A;  3G56 A;  3DU5 A;  3T6N A;  3ZQG A;  3ZQF A;  3NS4 A;  3HTI A;  2G7S A;  5J3L A;  4GFK A;  2OI8 A;  4M3B A;  5FMP A;  5EYR A;  4YZE A;  2WUI A;  3FK6 A;  5K58 A;  5K7Z A;  3HTJ A;  3KZ9 A;  2D6Y A;  4M3F A;  4JYK A;  3VW1 A;  5F1J A;  3GZI A;  1JTY A;  3ZQL A;  3HGG A;  2UXI A;  2OER A;  3FHN A;  3SFI A;  3O8G A;  2GUH A;  4DVY P;  1U9N A;  3BR6 A;  2XPW A;  3EGQ A;  1UI5 A;  1Z0X A;  3QQA A;  2FQ4 A;  3NI7 A;  2UXU A;  3ON4 A;  2RAS A;  2YVH A;  3PPB A;  4UDS A;  5D19 A;  5F04 A;  4W1U A;  3KKD A;  2ZCN A;  3BJB A;  2GEN A;  3BT9 A;  3Q0V A;  2Y2Z A;  3DPJ A;  4V2G A;  3B6C A;  3KKC A;  2ZB9 A;  2GFN A;  3PM1 A;  4I76 A;  4ACI A;  3BR0 A;  2ZY9 A;  3IUV A;  2XB5 A;  5H9T A;  2ID3 A;  4AUX A;  4D5F A;  1JTX A;  3QPL A;  3AQT A;  3BQY A;  3VPR A;  4CGR A;  5K7F A;  2R7W A;  3COL A;  2W53 A;  3TP0 A;  5C4Y A;  3HTH A;  2ZOZ A;  3NXC A;  4MO7 A;  2OF7 A;  1Z77 A;  5IOY A;  2R7R A;  3VOX A;  2JK3 A;  2O7O A;  4M3E A;  4WIB A;  1BJZ A;  2X9D A;  3Q0U A;  4B1R A;  5F0F A;  2DG7 A;  3Q0W A;  4NN1 A;  3VW0 A;  3O60 A;  3K8P C;  5GPC A;  3B81 A;  5FKN A;  2NP3 A;  5EFY A;  3VVZ A;  3BTI A;  4NEL A;  3FK7 A;  2IAI A;  4OD5 A;  5J1Y A;  3HTA A;  5DAJ A;  3MVP A;  3RH2 A;  3SWH A;  4GCL A;  2QKO A;  3BTC A;  2HQ5 A;  3LOC A;  2ZCM A;  3ANG A;  2R7V A;  4JKZ A;  2NS7 A;  3E7Q A;  2I10 A;  5GP9 A;  3LSP A;  3CDL A;  2REK A;  4D7N A;  3VVX A;  4D7M A;  3BNI A;  3DU6 A;  4AC0 A;  2VKE A;  4HKU A;  3LWJ A;  4DW6 A;  2HKU A;  3VIB A;  2XPV A;  5HBU A;  2V57 A;  2PFV A;  2YVE A;  2RAE A;  4GCK A;  3G1L A;  2FX0 A;  1JUP A;  2IEK A;  3IH4 A;  5FGL A;  4ME9 A;  5F0C A;  5IPA A;  2UXH A;  5FHP A;  2XDN A;  2HYT A;  3DEW A;  3ZQH A;  1QVU A;  1SGM A;  3O8H A;  5J1U A;  3BTL A;  3QBM A;  2OPT A;  3SDG A;  2WGB A;  5IOZ A;  5EZG A;  3CCY A;  4M3D A;  3BTJ A;  2QTQ A;  2R7U A;  3Q3S A;  2WV1 A;  2HXO A;  5AQC A;  2FD5 A;  3LSR A;  5K7H A;  3QPS A;  1ZKG A;  2JJ7 A;  4I6Z A;  4L62 A;  4AF5 A;  3BR1 A;  3S5R A;  3ANP A;  4IRV A;  3HGY A;  2A2F X;  2XGE A;  2HYJ A;  3G7R A;  2Y30 A;  2ZCX A;  2G7G A;  5CXI A;  1U9O A;  3FIW A;  2DTZ A;  3BHQ A;  2R7O A;  1RPW A;  4XK4 A;  4G12 A;  3NNR A;  3FRQ A;  2NS8 A;  5CW8 A;  1JT6 A;  3ZQI A;  2FJ1 A;  4ICH A;  5IP6 A;  3TP3 A;  5J1R A;  2IBD A;  1JUS A;  5GPA A;  4V2F A;  2QOP A;  3F1B A;  3G1M A;  3C2B A;  5HAW A;  2DG8 A;  3KYL A;  3GEU A;  2XGD A;  4OD4 A;  5FKK A;  2YVX A;  2QIB A;  3LHQ A;  4W97 A;  2B1E A;  2ZOY A;  5D18 A;  4ABZ A;  1JT0 A;  3WHB A;  3BR2 A;  4B3A A;  3CRJ A;  2PBX A;  2GBY A;  1RKW A;  2B3W A;  5FKO A;  4X1E A;  2Y31 A;  3CJD A;  5CQG A;  3VOK A;  1VI0 A;  3KNW A;  2QCO A;  5F0H A;  3PAS A;  1RKT A;  3IH2 A;  2R7T A;  2FJI 1;  1T33 A;  4C2M A;  3V6G A;  2XGC A;  4GFL A;  4M3G A;  3V78 A;  2R7S A;  2O7T A;  1UI6 A;  2FBQ A;  4MXM A;  2ID6 A;  2XRL A;  1QPI A;  2Q24 A;  4PXI A;  3HE0 A;  3VUQ A;  3ON2 A;  3JSJ A;  3BQZ A;  2R7Q A;  2TRT A;  3BR3 A;  4GCT A;  3IH3 A;  1JUM A;  4U9L A;  2PZ9 A;  1ZK8 A;  5F08 A;  3AQS A;  3WHC A;  5CXG A; 
#chains in the Genus database with same CATH homology
 2ZY9 A;  4U9N A;  4WIB A;  2YVX A;  4U9L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...