4M3BA

Rapid and efficient design of new inhibitors of mycobacterium tuberculosis transcriptional repressor ethr using fragment growing, merging and linking approaches
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
190
structure length
185
Chain Sequence
RELAILATAENLLEDRPLADISVDDLAKGAGISRPTFYFYFPSKEAVLLTLLDRVVNQADMALQTLAEDRENMWRTGINVFFETFGSHKAVTRAGQAARATSVEVAELWSTFMQKWIAYTAAVIDAERDRGAAPRTLPAHELATALNLMNERTLFASFAGEQPSVPEARVLDTLVHIWVTSIYGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ligand Efficiency Driven Design of New Inhibitors of Mycobacterium tuberculosis Transcriptional Repressor EthR Using Fragment Growing, Merging, and Linking Approaches.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription repressor/inhibitor
molecule keywords HTH-type transcriptional regulator EthR
total genus 79
structure length 185
sequence length 190
ec nomenclature
pdb deposition date 2013-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4m3bA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 4m3bA02
1I6HJ 4M3FA 5IP6A 2GFNA 1JKRC 2XPVA 5M5YJ 3S1MJ 3NI7A 5FMPA 4I6ZA 3BG5A 1ETKA 3PO2J 2LKXA 4JL3A 3A01B 1GDTA 4UUSB 2CRGA 4Y52J 2HYTA 2NOGA 1VF9A 2XGEA 1P7JA 2DJNA 4XK4A 3HB9A 3JRDA 2EZKA 4FE7A 3RQIA 4C3HJ 2NS8A 4JKZA 1GVDA 3NXCA 5F0HA 3CMYA 1BL0A 2GM4A 5M3MJ 3HTIA 2E1OA 1W0UA 2DG7A 1PUFB 2MG4A 4XRSA 5K58A 2G7LA 2L7FP 5BNGA 4HNVA 3JRCA 1DU0A 4A3BJ 2EH3A 1IJWC 3GZIA 3A02A 2CJJA 5IYDJ 5FKMA 2X6OA 3OIOA 1QRYA 2DTZA 3G1LA 4M6VA 4RBOA 2JA5J 2FJ1A 2E2HJ 4A93J 2D6YA 2O7OA 1S7EA 2HXIA 4L5EA 2DG8A 1R9TJ 3HTHA 3HDDA 4HKUA 1WPKA 2Y0SN 3VOXA 2X48A 3I4MJ 4NN1A 2WB1N 5K7FA 3S1RJ 3KZ9A 1SFOJ 2DA3A 3C2BA 4J19A 4AYBN 1H89C 1OJLA 5EZGA 3KKDA 2FBQA 4MXMA 3HTAA 2LVSA 4B3AA 2HKUA 2ZCMA 3JRBA 2IU5A 3H0GJ 2E2IJ 2EZHA 2REKA 4DW6A 2Y9ZA 4CYCA 3CJDA 3HM5A 2L7ZA 3ZQIA 4M3DA 3A03A 3NARA 5DTDA 1ENHA 3RZOJ 4EEFG 1H88C 2DMQA 2YUSA 2YU9J 2GUHA 2DA5A 4JX5A 3MKLA 5D18A 2P81A 3S2HJ 1GV2A 1IG7A 1FIPA 3VW2A 3PM1A 4IHYA 1A6IA 3LSRA 1TWGJ 4JYKA 1OCTC 1RPWA 1HLVA 2TRTA 4XIDA 4JX6A 2YS9A 2OERA 3JRIA 3S16J 1LFBA 4ME9A 3PPBA 3HE0A 2WAQN 1F36A 1ETXA 4UUSA 2JK3A 5F08A 2GBYA 2JMWA 4BXXJ 2WV1A 4ACIA 2CQXA 2ZOYA 4DZPA 1W0TA 3EGQA 2X9DA 5K7HA 3W6VA 5EFYA 2UXHA 2ZOZA 3CCYA 4M3GA 5J1UA 1MBFA 3BNIA 5HODA 5FKNA 3BTIA 1O4XA 1LE8A 5F1JA 4QIWN 5IP7J 4JP0A 4X6AJ 3HOXJ 1JT6A 1JUMA 2R0QC 1AHDP 2JA7J 5K7ZA 2ZCXA 2ELKA 5EF6A 1JUPA 5J1RA 2NP3A 1BJZA 3K2AA 3IH4A 1NTCA 2HOTA 1RKTA 3E7QA 3TW6A 5C4JJ 1T33A 5IPAA 1G2HA 1VNDA 3HOYJ 4CYCB 2V57A 4MO7A 5FGLA 4BKXA 1CQTA 3EUPA 2CU7A 4GCKA 1UMQA 3HGYA 5GP9A 1MBHA 1WI3A 3LSJA 1RR7A 2EQRA 5IP9J 1K61A 3CQZJ 2HYJA 5IYBJ 2MSYA 2Y2ZA 3AQSA 3CWRA 3NAUA 3V6GA 2O9LA 2DA4A 3OOUA 2NVTJ 3ON2A 2VPRA 1YRNB 3O60A 3S5RA 4B1RA 3M3YJ 1JJ8C 1RKWA 2FQ4A 2ZCNA 5DAJA 4BBSJ 5EYRA 5IOZA 1AKHB 2CUFA 4L62A 3ON4A 2LD5A 2Y30A 5FJ8J 3Q0VA 3OSGA 5C4YA 3KNWA 3HOUJ 1MBEA 4YZEA 2YVHA 3LNQA 1MH4A 5FLMJ 2HDDA 2K9QA 4GFKA 3FIWA 3MVPA 1FEXA 4QTRA 2LLKA 2XPUA 4V2FA 4AF5A 1WH5A 3UKGA 4MFDA 3KKCA 5EDNA 2GLOA 4IHVA 2CQQA 3WHBA 4MK6A 2WUIA 1JTXA 3BR0A 3HBLA 1IV6A 2HOAA 3BT9A 2R92J 3LWJA 3JRFA 2JWTA 2M9HA 2B63J 1BW5A 1RESA 3DEWA 3DCFA 5IYCJ 2IBDA 3I4NJ 1HOMA 3VPRA 4I76A 3HOZJ 5HSZA 2XPWA 3GTMJ 2JA6J 2HOSA 4DYCA 3LSGA 4A3IJ 3VP5A 3BR2A 3A01A 2R7ZJ 3RZDJ 3HTJA 3NRGA 4PXIA 2YVEA 4A3LJ 1IRZA 3BQYA 2QTQA 3K7AJ 2OPTA 2VKVA 1X58A 5H9TA 5EZHA 3TP0A 1TWAJ 2LP0A 1IGNA 1OCPA 1XG1A 3IH3A 3T6NA 4DZJA 4S0HB 1SANA 4LOCA 2M8GX 5FLVA 2QWTA 5C3EJ 1JKQC 1AU7A 3JRAA 3TEDA 2ECCA 3QQAA 4FISA 5GPAA 3F1BA 2UXOA 1HF0A 3BG3A 1Z0XA 5D1RA 3VUQA 1ETWA 5EGOA 3RKQA 1FIAA 1HDPA 4MLOA 5FKOA 3F0CA 3ZOBA 3OSFA 1JUSA 1JJ6C 2ID6A 5F0CA 4XICA 1BW6A 4JX4A 1ZK8A 5FKLA 4C3IJ 4G12A 3GTLJ 2R5ZA 4A3EJ 4A3DJ 2QF7A 3ZQCA 2F07A 3ANPA 1GT0C 3SFIA 2ME0A 2NVYJ 5EG0A 1YRNA 3BHQA 2H1KA 1MH3A 3BR6A 2KT0A 4UUTA 2NS7A 4D7MA 2K9NA 1DU6A 2HXOA 1JT0A 3ZQFA 5M5XJ 3JRGA 1QVTA 1ZR2A 1MSEC 4M3BA 3PASA 3BTJA 1UI5A 3BCGA 4UDSA 4RDUA 4CGRA 1B72A 1JKPC 1MNMC 1SGMA 2MGQA 3ZQHA 2DA1A 3JRHA 4JNNA 2AHQA 2DMUA 1U9NA 1MSFC 2UXIA 3IUVA 5F0FA 4A3FJ 4BY7J 1RETA 5EGOB 1FTZA 3FKIJ 3BG9A 3AQTA 3QBMA 9ANTA 4M3EA 5D19A 4GCTA 2L0KA 4MFEA 2NVQJ 4KWAA 4IHWA 1I3QJ 3GTGJ 2EBIA 3VVXA 4V2GA 3IH2A 3BR5A 3SDGA 1ORKA 1FJLA 1H8AC 4MIMA 2IAIA 2R93J 3BJBA 5CXIA 3P9TA 3VVZA 3S15J 1QPIA 4A3KJ 2E2JJ 1EF4A 4C2MJ 4BY1J 3ANGA 3LSPA 4A3CJ 1WH7A 2NP5A 3VIBA 1TWCJ 2XB0X 2PMZN 1TWHJ 1ZKGA 1P7IA 1WGXA 1ETOA 5FKKA 1ZTRA 2QIBA 5HBUA 5CXGA 2Q24A 3D1NI 3JSJA 3O8GA 3B81A 2HI3A 1AKHA 1QVUA 4W97A 4D5FA 1U9OA 2ID3A 1HCRA 2DA7A 3COLA 5F04A 1K83J 1POGA 3HEFA 3ZQGA 5C44J 2D5VA 2VKEA 1Y1WJ 3CRJA 2KDZA 4IHXA 5J3LA 2UXUA 3GEUA 1Z77A 4IEJA 5C4XJ 2G7SA 3NPIA 2HQ5A 1JTYA 1WCMJ 2G0EA 2I10A 3B6AA 2LK2A 3BR1A 4FTHA 3FRQA 3GTJJ 1MBKA 1B72B 4D5CA 1UHSA 2W53A 3JR9A 2OI8A 2Y9YA 3V78A 2DA2A 3CDLA 3HOVJ 2XGDA 1TWFJ 1X2NA 4XRSG 3HOWJ 2K40A 2JA8J 5M5WJ 3NNRA 1NK2P 4AC6A 1ETVA 2Y31A 4GFBA 2R5YA 3RH2A 1F43A 1B8IB 3VOKA 2M0CA 2VI6A 3BR3A 2K9SA 3TW7A 2LY9A 1GUUA 3M4OJ 2COBA 3QKXA 2LTPA 4NDLA 5AQCA 4GCLA 1E3OC 1XC5A 3LJLA 5M3FJ 3WHCA 2G7GA 5HAWA 4ABZA 2UXPA 3PO3J 5EEAA 4D7NA 1JKOC 1Y1VJ 3VW1A 2QOPA 2ZB9A 3LHQA 2LFBA 1I50J 2QCOA 1VFCA 2M34A 4AUXA 5CW8A 2O8KA 3GTPJ 3QPSA 2WGBA 2TCTA 1JGGA 3QPLA 2ME6A 5EG0B 1PUFA 3FK6A 2H8RA 2NVXJ 1IDYA 3Q0UA 4AC0A 2RHAA 2DA6A 3E7LA 2R5ZB 2DN0A 1LE8B 1TC3C 3BQZA 3BTLA 4A3MJ 2AO9A 2DMTA 1IDZA 1IC8A 2MW8A 4A3GJ 4A69C 3L1PA 3DPJA 1GV5A 2VUMJ 1MBJA 2XRLA 4C3JJ 3H3VK 2QKOA 2XDNA 3GTKJ 3VW0A 4FE4A 5JLXA 2ECBA 1FTTA 2EZIA 4DYQA 2PZ9A 5E3LA 3G7RA 3LOCA 2RASA 3GTOJ 3VVYA 3MN2A 3B6CA 4BBRJ 1Q1VA 3G1MA 2FD5A 1A5JA 4A3JJ 3S1QJ 1T56A 5JLWA 3HIMA 1ZR4A 2JJ7A 1XS9A 3TP3A 3BRUA 5FHPA 3Q3SA 4DYRA 3FISA 4NELA 2RAEA 1HDDC 1UI6A 1OFCX 1UG2A 2IEKA 1APLC 2EZLA 3G56A 2FX0A 1IUFA 2CUEA 4Y7NJ 3FK7A 3SJMA 2E19A 3JREA 2GENA 5GPCA 3O8HA 3MNLA 3S2DJ 4XRMA 4B4CA 2OF7A 1ZGWA 2M2EA 2XB5A 4QSHA 1ETQA 1LFUP 1U8BA 3RD3A 2NX4A 3IV5A 3GBGA 1ETYA 5IOYA 5DS9A 3ZQLA 1D5YA 5E3OA 3BTCA 4FCYA 3Q0WA 2JN6A 2L7MP 2DMNA 5E3NA 1X2MA 2G3BA 2O7TA 5F27A 2L9RA 1ITYA 4ICHA 2N8GA 3HGGA 3HKZN 2LR8A 1ZQ3P 2XSDC 4X1EA 1B8IA 1BA5A 1MBGA 2R5YB 2DMPA 3GTQJ 4GFLA 1U78A 5E3MA 2XGCA 3S1NJ 4W1UA 1NK3P 3S17J 2PBXA 2W48A 3C07A 3G1OA 5J1YA 3S14J 1VI0A
chains in the Genus database with same CATH superfamily
1I6HJ 4M3FA 2W85A 4Y13A 1V5FA 3F8NA 4I01A 3N05A 4PJ0C 2GFNA 1TBXA 3S1MJ 2QVOA 3FXKA 3NI7A 2ADUA 5CVIA 4L0YB 4KFCA 1SMTA 2ZXJA 1WHUA 3QYEA 3W3CA 5F1RA 1K79A 1MJAA 3V42A 2YR2A 1VF9A 1ERDA 4XBFA 1I3AA 1OQYA 2IA1A 5KAFC 2M3AA 3EUAA 4KT6A 4C3HJ 4JKZA 3FBIB 2CW8A 2ESHA 2I8DA 3VSKA 3TO6A 3CP8A 5M3MJ 3LQQA 5TGTA 5JVTA 1N77A 4XRSA 3H1CA 3SZGA 1ZG5A 3F3XA 4U88A 1ULYA 3JRCA 2EH3A 1IJWC 2JPCA 4PGHA 5DEQA 1OCRH 2KJBA 4BJ5C 4U0YA 3OIOA 1QRYA 3RSNA 3GLXA 3VEPA 2E2HJ 2XKOA 3Q9VA 3ZMDA 2O7OA 4B09A 2VKDA 4L5EA 2HXIA 1U0JA 2KKOA 2X1CA 3CZ6A 4KIGA 1SVLA 4LIVA 2Z9OA 2W7NA 3U1DA 1R5ID 1WPKA 3DBRB 2EIJH 2Y0SN 2EFQA 3L2RA 4GYGA 3K0LA 3J7AY 4OMZA 5IY5H 5K7FA 4UHTA 3IKTA 3S1RJ 1ZLKA 3OL3A 1YIOA 3C2BA 3EQLF 4J19A 2PN6A 4ZJZA 5EZGA 2KIQA 4NNJA 2B1EA 5GAEJ 2HKUA 2ZCMA 2IU5A 2EZHA 3T5XA 4DW6A 2Y9ZA 4HPQA 3ZQIA 4M3DA 3NARA 1W4MA 2RQQA 2ZSIB 3RPUA 4LLNA 1ENHA 4PFPA 3GF2A 3CCUI 1YITI 2L9VA 2YU9J 2R7FA 2BVLA 3N97A 2X85A 4EV0A 1OR7A 2XKPA 2MLKA 3KEQA 2CH0A 4Y17A 3AG1H 3FMSA 4AIHA 1BN5A 2Z2SB 1UHWA 4JX6A 3S16J 5CKTA 1YJ9I 2P5LC 5LRRA 1XCBA 3DP7A 3FKJA 2E35A 2GBYA 1H9GA 3P9IA 2ZOYA 3ZPLA 3LA7A 3EGQA 3H35A 2HQAA 4ZYDA 4LB5A 1LNWA 3RKXA 2UXHA 3CCYA 4M3GA 1O3TA 5J1UA 2FQ3A 3KLOA 1IV8A 3L2QA 3F72A 4GRIA 1LE8A 1W36C 4KITB 4JP0A 3CC2I 3HOXJ 5K1YA 3SEZA 5LRSA 4HLYA 2H8WA 2ELKA 2QEXI 1J59A 2XVCA 4BH9A 2HPIA 4EATA 1FZPB 3LWFA 4Q5SF 3D5LA 3HRSA 3G3ZA 1A6QA 4HF1A 2QM3A 2CO5A 4HX7A 3GXOA 3M8JA 3OYMA 2WY8Q 3JW4A 5IPAA 4CO8A 1G2HA 2WB1A 4J00A 4YRVA 1RRJA 3HOYJ 2XROA 4MO7A 4Y4RA 5FGLA 1CQTA 3WTVC 3EUPA 2A5YB 2JVGA 4ZYEA 1UMQA 1W5SA 2HGCA 1R71A 3UR3C 2VBYA 4R8HA 3OR1C 4EJWA 5CVRA 2Y0MA 2CS3A 3WTWC 2JA2A 3ZGKA 3CQZJ 3HOSA 3KYDB 1A36A 2MABA 3BLYA 2Y2ZA 1BR1A 3CWRA 4LG0A 3V6GA 2ZJPF 4G8XA 2KRHA 3C3WA 3O60A 3J81Z 3M3YJ 2VE8A 2E5ZA 4BBSJ 4HQEA 5EYRA 5IOZA 2HYGD 1IN6A 2LD5A 2QA4I 4G7OF 4OAYA 1XCVA 4EM0B 2QBYB 4CZCA 4WIBA 4BUPA 2LBFA 3HOUJ 2V9PA 2P5VA 1YW7A 5HOOA 3H3UA 5FLXK 2K9QA 2YVHA 1FEXA 1H0MA 3DTIA 5J6XA 4V2FA 2ZMEC 4BGDA 4AF5A 5EDNA 3GCMA 5D6EA 2QLZA 5ILSA 1G3WA 1WJDA 4OAZA 1R4NB 1JTXA 2FE3A 2L4AA 3BT9A 2HZDA 2WV0A 3LWJA 4MTEA 4BHPA 3JRFA 2M9HA 2B63J 1DGRM 2EFWA 2IBDA 2G9WA 2HOSA 4PGGA 1Y8QB 1SD5A 2IT0A 3J7AO 3BR2A 3F6OA 3RZDJ 3HTJA 1XMXA 4RA2A 4ZZLA 3S93A 5FRMA 3PJRA 4A3LJ 3BQYA 1Y39A 1ODDA 1S7OA 3TP0A 1FBSA 2LP0A 3C2GA 2K02A 3IH3A 1C0WA 1JXSA 1FLIA 1S6LA 2QSGX 2VASA 5DYMA 2M8GX 4HEA2 1X1CA 2QWTA 5ICCA 3OY9A 5LBQA 1YQAA 4FISA 5DD4A 4Z6YA 2VBWA 1F9NA 2UXOA 1MNDA 1ETWA 5FFZA 5EGOA 3ZOBA 2MC3A 5L3BA 3L2UA 1HKQA 5ICGA 3LSMA 4XICA 3GZNB 3PSIA 1BW6A 3GTLJ 3H36A 5FKLA 4CCKA 2RKHA 3ZMUA 3K1MA 3ZQCA 5JVGF 2EK5A 4MEXF 3ANPA 1GT0C 2ME0A 5CPRB 4L9VA 2H1KA 3K4CA 4UUTA 2CV2A 4L5JA 4KDPA 5M5XJ 1X3UA 4BE2A 3FX3A 1PUEE 1DPRA 2F4IA 3BTJA 1T2KA 3KPHA 3VB2A 2FOKA 3VFZA 4CGRA 4P9UA 5L3GA 1B72A 2PJPA 1SGMA 1I27A 3JRHA 4KN4X 2DMUA 1U9NA 3NS4A 3QU3A 1K4TA 5F0FA 4A3FJ 1RETA 5EGOB 3CCLI 5D19A 4GCTA 3BROA 3GW2A 3QPHA 2K5CA 4MFEA 4L9NA 3V7CA 2NVQJ 1W1WE 4LLLA 2M7AA 2V79A 4ENNA 3GTGJ 2EBIA 3DLAA 4HX8A 5B5EC 1GHCA 3RDIA 2CFXA 2FBKA 3OIPA 2RGVA 5JFRA 3E6MA 1YOVB 4II2A 1SEUA 3ZCOA 2E1MB 1H8AC 3OMYA 3HYIA 4WWCA 3NWSA 4BHCA 4UVBA 4IKFA 4AIDA 5IT9K 3BJBA 5CXIA 2K85A 1EF4A 1NG7A 3GFLA 3OIQA 2XV4S 1IXCA 1TWCJ 2PMZN 2HEOA 1P7IA 5FKKA 2QWWA 1QU3A 3HRMA 1X19A 2OZUA 2Q24A 3KP7A 4XKVA 3D1NI 4NQWB 1IW7F 5AONA 5IT9Z 2PJRA 2M4KA 1X1AA 2P6SA 4UVCA 1FSEA 1QQIA 3K4MA 4U0VA 2K3PA 3CRJA 2P6TA 1WI9A 4IHXA 4RMNA 5BPDA 1KGSA 4BDZA 1K6OA 1Z77A 5C4XJ 2GIZA 5DD8A 2G7SA 3OYAA 1WJCA 3NPIA 3QODA 3ZR8X 2WAFA 3BR1A 3DWLE 3S3MA 2DDBA 2W00A 2W53A 1YJWI 3JR9A 4KIBA 3MEXA 4MHGA 2DQLA 4YFNF 3RPUD 2IGKA 3CUOA 3GUDA 4XKBA 1YE9A 3HOVJ 4ZDPA 2JRMA 4QPOA 5ERIA 1K7AA 2F4MB 2K40A 1SC7A 5M5WJ 3FWEA 1NK2P 4CDGA 3BZKA 1PDNC 3VOEA 4HZFA 2XGXA 2LC2A 2ZKZA 2M0CA 3BR3A 2Z5UA 3TBIA 3TW7A 4DJAA 2IVMA 2EILH 2COBA 4RAFA 3V7RA 4XOTA 2XAFA 5AQCA 1J0RA 1OCOH 1KA8A 1XC5A 4XN3A 4D9JA 1UG0A 4RB1A 3WHCA 5HNHA 2R7DA 2G7GA 5HAWA 2NYXA 3DPUA 3CO7C 2DXIA 5EEAA 2DLLA 2EIKH 4G6TB 1Y1VJ 1A31A 3VW1A 2X51A 2Y69H 2GQQA 2M7BA 4HX4A 4RM3A 2LDUA 4IQJA 1WRJA 2QENA 1VFCA 5D5UB 2IP2A 3V8KA 2MLGA 1PP7U 2P8TA 3FK6A 2NVXJ 3BJ6A 1Z6TA 4BDYA 2RHAA 2ISYA 2R5ZB 3Q9SA 1OR7C 1LE8B 3BQZA 2Q8KA 2AO9A 3C18A 2CV0A 3KX2A 1IDZA 1IC8A 1HBXG 4A3GJ 1VZ0A 1SAUA 2IJLA 2IS4A 4I2OA 2DTRA 2UUZA 4KMFA 3H3VK 2OA4A 1FOXA 2RV8A 3VW0A 1OPCA 2NXNB 2ECBA 3DXJF 1KQ0A 1WVRA 2EZIA 4MGRA 4XLPF 2F5CA 5FD5A 1ZRDA 2LKSA 2RASA 3HPGA 3VTIA 4BBRJ 5HVQC 3L2CA 1HA8A 2ISZA 2ZNZA 3BDDA 2LG4A 3BRUA 5D6FA 4NBQA 4XQFA 3FISA 4II3A 6PAXA 3FDYA 5JI6A 2X0LA 4RLQA 2EZLA 4O3MA 4UVAA 3H5RA 2E71A 5GPCA 1S72I 4IRGA 3O8HA 4UV8A 3S2DJ 3DPLC 5LLQA 4XRMA 4IOCF 1ZGWA 2RVCA 1LFUP 1IN7A 1P4WA 1SFXA 3ECOA 2LYCA 3RTRA 4XMYA 1PYVA 2WAEA 4A12A 4YEJA 4KN7X 3DTEA 4A0ZA 5IOYA 3OYFA 4XKCA 3KCCA 1T08B 4HA8A 5DUKA 4CCLA 2VQLA 1K4SA 4CYDA 3IUOA 3HOTA 2V1XA 3TO7A 5F27A 2L9RA 3WGGA 1REPC 2GOXB 1TL8A 1HW1A 2KMUA 2LR8A 4YIFA 3CC7I 2HFHA 1FP1D 1BI2A 4K2EA 3COAC 2DMPA 1BA5A 1H9TA 3GTQJ 4DIQA 4XLAA 1OYIA 3S1NJ 4P96A 4YELA 4BE1A 1N25A 3KYLA 4HNUA 2VT3A 1WWXA 3S14J 1B9MA 2DFHA 4NUBA 2X1DA 2ZMEA 2FNAA 4I6ZA 2HR3A 2V1UA 3BG5A 1ETKA 4C9YA 4JL3A 1XGSA 3I0TA 4GO1A 2GXBA 1GDTA 3HG9A 4BE0A 4JNNA 2ZJRF 2NOGA 3NQOA 3WU0A 1O7FA 1P7JA 2OCCH 2X4HA 3T0YA 3HB9A 3CMMA 2KRFA 3KP5A 1ON2A 4FE7A 3RQIA 2NS8A 4I0BA 2FBIA 2XRNA 1GVDA 2F48A 3SFZA 3VSLA 2YVXA 3NXCA 1VQNI 4E7IA 1GLNA 3CMYA 1N78A 1LB2A 2E7WA 1W0UA 3E5QA 2MG4A 1CF7B 1S7AA 4B47A 4XRFA 4BHBA 2LF7A 5BNGA 3CESA 1DU0A 4A3BJ 3CDIA 5D5WB 4RLFA 5FB2A 3TQNA 4ENJA 1F4KA 4WX9A 2DTZA 3G1LA 4M6VA 4RBOA 2FJ1A 3ABKH 1WQ2A 4AD9A 1S7EA 4N9HA 1V55H 2ZNYA 2F5DA 2K4JA 1R9TJ 1IXRC 3HTHA 3I5UA 1TT5B 2V1NA 1LVAA 3F23A 4NN1A 1W5TA 3RKYA 1RR8C 4NB5A 2DA3A 3HC7A 4AYBN 1SMYF 2BYVE 5D4SA 1H89C 4LD5A 3KIOA 4MXMA 3KEYA 3HTSB 5A2QZ 1R22A 3SQNA 2X1EA 1BIBA 2DI3A 1Y0NA 2P5KA 4MEYF 3WTXC 2L7ZA 3I9V2 4WK8F 1UJ8A 2E60A 2AXLA 1MW7A 3DU5A 3VWBA 3C7JA 2ZSHB 5DTDA 2KIUA 2B0LA 3DKWA 3S3OA 2YUSA 2GUHA 3WG7H 3H92A 2EV5A 5A2QK 2P81A 2GZWA 1GV2A 1MDMA 2A6EF 1R5HA 3PL8A 1FIPA 1XB4A 3TKYA 4BYYA 2WWYA 4KNYA 4M71A 2KQRA 2EFPA 3L00A 1EJ9A 1R00A 1HLVA 5KCMA 2YS9A 3AFHA 2OERA 4AM3A 1J7KA 1HKSA 3TDZC 2VXDA 3FM3A 3SHFA 3PPBA 3KP2A 2W1OA 3K1PA 2JSCA 3TGNA 3WODF 4UB8C 5LGUA 1JGSA 2IA2A 2HU9A 2O3FA 3MWMA 1PP8F 1FBQA 5GTIC 5K7HA 5E8GA 1P92A 1FSHA 1V5GA 2XDVA 2HKOA 1J09A 2IGMA 2K7LA 4LGWA 5HODA 2NNNA 2TDXA 1YG2A 5F6FA 4A0XA 3D5RC 3CUQB 5ILVA 1O4XA 4BNCA 4PJLA 5IP7J 4A0YA 1JUMA 5D5VB 2R0QC 2JA7J 5K7ZA 1DDNA 5FD6A 1IAWA 3FXMA 4LITA 5FROA 1T0FA 5J1RA 3K2AA 3LAJA 3E7QA 3IAS2 3KYCB 3TW6A 5C4JJ 2BY1A 4HSTA 1RI7A 2BVMA 4M72A 1MBHA 5GP9A 4A5NA 5BPIA 1MMAA 2EQRA 2K3FA 2K9LA 4LB6B 2H09A 3MZHA 2JVHA 5IP9J 3KP6A 4BQAA 1QNTA 3EUKL 3HTUA 3ABTA 3VYSB 1ZGJA 2IRFG 2ZXIA 3A4CA 3DBHB 3AG2H 4E4HA 3NAUA 4EJTA 5F64A 3AG4H 3MZ8A 2DOAA 4A6DA 2DA4A 4M6YA 3ON2A 1YRNB 1W7PA 4B1RA 1JJ8C 1RKWA 1TNTA 1PJRA 1JE8A 1LQ1A 1AKHB 1UAAA 1XN7A 4ETSA 1BOBA 4CCOA 4NC8A 2L4MA 3OSGA 2HZTA 2DPUA 5C4YA 4ESFA 2EINH 1VTNC 4ZTJA 3KNWA 3F22A 4PJMA 4YZEA 1TW3A 1WJBA 2K27A 2HYFA 1Z91A 1I5ZA 2MH9A 4LIUA 2DFEA 1R49A 2LLKA 2XPUA 3UKGA 4MFDA 4OD4A 1IRFA 2NS0A 1Z21A 2GLOA 4E7ZA 2CQQA 1WFXA 3K9TA 4IHVA 1VQ6I 4I7HA 5LEKA 4MK6A 1FOYA 1YS6A 2ESNA 1MKMA 2GAUA 4XR6A 5E8IA 1IV6A 2VOPA 3A0BC 2IGOA 2JWTA 1X4OA 3BWGA 3OYIA 1BW5A 2ZFUA 1RESA 1MDMB 2VLAA 3DEWA 4ITVA 1BBYA 5D4RA 5GAHJ 2XPWA 1HW5A 4DYCA 3LSGA 4EJVA 5H20A 3A01A 3OV8A 3HUGA 4UUVA 4AU7A 2QSFX 4Q47A 1SD6A 2D1HA 2L3DA 5AIPA 2VKVA 2ELJA 3GO5A 1X58A 3ASOH 3ISPA 5EZHA 2VE9A 1TWAJ 2XAJA 3F8CA 4OOIA 1YFHA 2DK8A 1IGNA 1OCPA 2FJI1 3T6NA 4DZJA 4TV7A 1D3YA 4S0HB 1AOYA 3JTHA 3L2VA 2OV7A 3PSFA 3I64A 3HHGA 2M5WA 2RREA 5LGTA 1VQ8I 3F1BA 4EM1A 3WE3A 4BEHB 2Q1ZB 3MKWB 5L3FA 1FIAA 3DV8A 4MLOA 2ZC2A 5FKOA 3ZQ7A 4XSZF 2BBYA 2LBFB 3OSFA 1JJ6C 2JSPA 2BY2A 2ID6A 5F0CA 2VJ5A 1T8IA 3MKZA 1XMAA 4CICA 2HDCA 4G12A 2K86A 2VPLA 4FETA 2L9SA 2F07A 5CJ9A 1TTYA 2L5QA 3KE2A 3OYKA 2FXAA 3VYRB 3I4PA 2EFNA 3BPVA 4IOAF 2NS7A 3F8FA 2K9NA 4BS9A 2PG4A 3PIOF 3DF8A 2O03A 3KZZA 2MC4A 2YPRA 3WTZA 3VODA 3ZN0A 2AXTC 2EWNA 1UI5A 3ONQA 3BCGA 3DEEA 2MYSA 4RDUA 2CQ7A 2L02A 4R1HA 4J01A 4B44A 2WBMA 4OIOF 2HNHA 4CUGA 1B6AA 2KL4A 4I98B 3GVAA 2UXIA 3ECHA 1YYVA 3AQTA 3PNVA 3FKIJ 3BG9A 1FTZA 3QBMA 9ANTA 1J5YA 2A6HF 4M3EA 5EEHA 2HKXA 4WXDA 5CVUA 3U1KA 4Q48A 3WTUC 2EV6A 3QP6A 4G6QA 3IH2A 3BR5A 4IRIA 3SDGA 1E17A 4BQNA 1N75A 2E1NA 2NVUB 2ETHA 2ZMEB 1QPIA 2XC7A 4BY1J 4DBRA 3ZQQA 1B4AA 3RI4A 2PQ8A 4G9YA 1WH7A 4IPAA 1U8RA 4A2UA 3HRUA 2CQKA 1R23A 4L18B 3VIBA 1WGXA 3K69A 1ETOA 2EPFA 5J4VA 2VC0A 2GXGA 4B43A 3B81A 4JOMA 5LHIA 1G3YA 4D5FA 1U9OA 4BJTA 1U2WA 1YI2I 2QQ9A 3LFUA 1WSUA 1AWCA 1HCRA 3COLA 1POGA 5C44J 4WF2A 3R6SA 4UY8I 2VKEA 3RQ4A 2A61A 2KHMA 5CVJA 4Q4ZF 1TQIA 3ABLH 4IO9F 3EETA 3WU1B 3CMAI 2LKPA 2VN2A 4PJJA 5J3LA 2UXUA 3GEUA 2VQCA 4M74A 3W2AA 2RDPA 2HQ5A 1JTYA 1WCMJ 1ZG1A 2G0EA 2I10A 1KYWA 3B6AA 2V1DA 1V4RA 3FRQA 1MBKA 2JUCA 2IS2A 3KP4A 2Y9YA 3V78A 1LFPA 4ESBA 4AVPA 1T39A 2V9VA 2STTA 1TWFJ 3WGHA 1X2NA 3HOWJ 4EGZA 3NNRA 4AC6A 2YX7A 2R5YA 1RUNA 4LG3A 3VOKA 1UHMA 5K5RA 4PSXA 2LTPA 1VQ7I 4Y33A 1G4DA 4GCLA 3J7ZI 2A05A 4CXFA 1O7LA 5TJJA 2ZXHA 2Y0SA 2QQBA 3FMRA 1MMDA 1KZHA 3GFJA 2QCOA 1U3EM 5H2FC 1R6RA 1CGPA 2CQNA 4DNCA 4LFUA 3GTPJ 2VIXA 3QPSA 2TCTA 1JGGA 2ME6A 4JBAA 3HPHA 3TDUC 5E1ZB 5GADJ 3CLQA 4LJZF 3ULQB 5EG0B 2JT1A 1IDYA 3Q0UA 1S3JA 2XHKA 2RNJA 1Z67A 1TC3C 3FXUA 3BTLA 3VYUB 1ZN2A 5KNLA 2DMTA 3X2QH 3GEZA 5HLTA 1GV5A 2DT6A 4CHUA 1MBJA 1EA3A 2DW4A 2XRLA 3ZMTA 2QKOA 5CVVA 5KK1A 2KIFA 2CMPA 1QBJA 4YIIA 5GTHC 2IW5A 2PZ9A 3G7RA 2A2FX 2V9KA 2CSOA 3LOCA 3GTOJ 5IT3A 1ZG3A 3MN2A 3OYCA 1Q1VA 4GXOA 4IHTA 2MH2A 5JLWA 1ZR4A 5FHPA 3Q3SA 3RYPA 3HHHA 4DYRA 1KQ8A 1OYYA 2V7FA 2H6CA 1OFCX 1UG2A 2IEKA 2PMZA 5E79C 3G56A 2UXXA 4ON0A 1IUFA 5TRDA 1IUYA 1FPQA 3SJMA 3D5SC 2E19A 1U5TA 3K4KA 4MQ9F 4CCMA 1XDSA 1O3SA 2WA0A 2GENA 4RB0A 4I09A 4B4CA 4QSHA 1ON1A 1D0YA 1IN8A 4YIRX 2NX4A 2DJIA 2LREA 3PUBA 4EGYA 3E5XA 1D5YA 5GAGJ 5BMZA 4BJ6C 3MZYA 5FFXA 4F3QA 2IA0A 5HS7A 3ML6A 2JN6A 2V4JC 2DMNA 1HKTA 5E3NA 2O7TA 2G3BA 2HTSA 3I55I 3O3KA 3HGGA 4HYEA 1XMKA 2Z99A 3HKZN 4C2MA 1R5GA 4NQWA 2R5YB 2BV6A 1XGNA 2E36A 2BW3A 3CO6C 3WG9A 3E3VA 2W48A 3CP2A 5H6RA 4U87A 3HRTA 5J1YA 1SFUA 4LMYA 2F5EA 5KAIC 1T38A 2JRTA 1ZH5A 4Z2YA 3ZMVA 3BG7A 4XONA 2DPDA 3H9GA 2PBIA 3N4MA 3G71I 5FMPA 3H5NA 4Y15A 4X0GA 3PO2J 4BU2A 3A01B 5D8LB 2IXSA 1R58A 2VONA 3ZRGA 1Z7UA 2CRGA 1QHGA 4Y52J 2HYTA 2BHYA 1QHHD 1A04A 1T98A 3TOBA 1J75A 3WGIA 2DJNA 4XK4A 2EZKA 3A2KA 3OYGA 1OISA 2FU4A 2M1BA 5F0HA 3K6GA 2ZJQF 2GM4A 2E1OA 2QQ8A 1LDKB 2DG7A 3LSKA 1PUFB 4BACA 3EDPA 3TL4X 1UB9A 5K58A 2L7FP 1LDJA 4HNVA 2IPQX 1BR4A 3GZIA 3R0AA 3BZCA 2VB6A 5IYDJ 5FKMA 1DPUA 2X6OA 1G59A 2JA5J 4ASNA 2KZVA 3R61A 1HC8A 2D6YA 1LEAA 4A93J 3KZYA 4I0AA 1BOAA 1SD7A 2DG8A 3PNYA 2HQNA 4RB3C 3G4SI 1SD4A 1MJBA 2X48A 4XL9A 3VOXA 1WJ5A 1HSJA 2HQRA 3KZ9A 1SFOJ 3OS2A 3F6VA 4F93B 3KKDA 1OJLA 2BZTA 1DGWY 2HVSA 3HTAA 4B3AA 4HV6A 1BC8C 3H0GJ 3I54A 2WY7Q 3C1DA 1VQ9I 4CYCA 3CJDA 1MNEA 2A6TA 3HM5A 3PQJA 2VODA 4QWQA 5KHDA 1VQ5I 1D8JA 4F92B 4EM2A 1T95A 3RZOJ 2DBBA 3ESWB 4OINF 4RM2A 2DA5A 4D1QA 5FGMA 3MKLA 2M4GA 3F21A 5D18A 2VC1A 3S2HJ 4U9NA 3UNGC 1YHQI 1K78A 1IG7A 1TP4A 3WTSC 2DDAA 3VW2A 3PM1A 2COMA 4IHYA 1A6IA 3LSRA 2F2EA 1TWGJ 2XUBA 3A0HC 5E17F 1OCTC 1G6NA 1R1TA 2D2WA 3D0SA 3IRRA 1Z05A 5FRNA 3JRIA 2BY3A 3GWZA 4MQVA 4ME9A 3HE0A 3GLLA 4HF2A 2FRHA 4UUSA 5F08A 1ZREA 1Y8RB 3ZMSA 3JAMZ 4CGZA 4BXXJ 2CQXA 2LRDA 4XOPA 3K4NA 4DZPA 4A5MA 2X9DA 4M9XA 4IJAA 3W6VA 5EFYA 2H6BA 2ZOZA 1X3ZB 4ZC3A 3RJPA 1MBFA 3FZVA 4AIKA 1WZ2A 3RKWA 4R79A 3P5JA 4BXUA 5F1JA 1YIJI 4X6AJ 3HUGB 1ZARA 3P9CA 1JT6A 4F91B 2ZCXA 3RPQA 2QQAA 1D1AA 3I53A 5EF6A 2LF8A 1BJZA 3DKYA 3AL0C 2VJJA 3IH4A 4ZDLA 1NTCA 3JSOA 2HOTA 1RKTA 3FBNB 4LG0B 2DOFA 1T33A 4PK4A 4HV5A 1DP7P 4CYCB 2V57A 4HDUA 2V6EA 1W7PD 3MQ0A 2EA2A 2QUFA 2KIMA 1IO2A 1RR7A 2HS5A 2QKMB 4PUSA 5B3SH 2F6CA 2OUMA 3HIFA 5J8CA 3K4JA 2Z33A 1SFEA 3H5AA 4LK1F 1M1EB 2AQFA 4WCGA 4G7HF 3IAM2 2R3SA 2NVTJ 4HSRA 1YTYA 4HAMA 3S5RA 1U6GA 5LFAA 4UXNA 2XF6A 5DAJA 4RAGA 4KIFA 4A6EA 3M1EA 3ON4A 2EJRA 2Y30A 3WTTC 5FJ8J 4HRIA 2WTEA 1USTA 2DFFA 3Q0VA 1NHAA 2DO7A 2P4WA 3R60A 2Z16A 1MBEA 1JHHA 1WJEA 1FC3A 1YJNI 4PDKA 1MH4A 5E1WA 5JHUA 4GFKA 3B02A 2Q2EB 4CSWA 3FIWA 3MVPA 4RS8A 3M8FA 2H94A 2KJCA 3OYDA 3JSPA 1KONA 3WHBA 3QYBA 3JCUC 3OYBA 2M45A 3CJRB 2WUIA 3BR0A 3FXQA 3HBLA 4E7SA 3K1NA 4U7BA 1LVKA 4KUMA 5IYCJ 1HOMA 1HW2A 3EYIA 2JA6J 2FF4A 3BCBA 5B66C 3L09A 3W6KB 3PNTA 4A3IJ 4PXIA 1P4AA 1OYWA 5L3DA 1Z7LA 1IRZA 1I6XA 2QTQA 3LFKA 3QPTA 2OPTA 2X6WA 5H9TA 2PMUA 1MZBA 1QO0D 1XG1A 1DQUA 4EMSA 2PFVA 4RAZA 1YW8A 3K4LA 3U2RA 3SXYA 2DAOA 3OYHA 5FLVA 5C3EJ 2R7OA 4L9JA 2FBHA 3MD2A 2KDOA 3TEDA 1VQ4I 2ECCA 3E5UA 1MD0A 3LA3A 3QQAA 5BS6A 3OYEA 2JQ7A 4GDFA 1R4MB 1R36A 2OU2A 2W84A 1HF0A 2LNBA 1Z0XA 3ZN1A 5D1RA 4EVIA 3VUQA 3RKQA 1HDPA 1E3PA 3F0CA 1FMWA 1JUSA 2W82A 3CJQB 2X6YA 4XKWA 3LMMA 1U5TC 1XSXA 2VT2A 1D1CA 2EA4A 5D5XB 2R5ZA 4A3EJ 4A3DJ 2QF7A 3JTGA 2PLYA 3FHNA 2VJ4A 2R7XA 1KQ9A 5EG0A 1MMSA 4V19K 3HL2A 4D7MA 2KT0A 2RN7A 4ZTFA 3ZQFA 3JRGA 5ILUA 1QVTA 1ZR2A 1MSEC 4M3BA 4KYWA 1HQCA 1I1SA 3PASA 2QZ8A 2V26A 4B3XA 1IZ1A 4P1WA 4JQFA 3MFKA 3ERED 1OMIA 4MTDA 2PFBA 4HLXA 1F1ZA 3F9KA 3CCSI 5JR3A 5D8KB 2LY2A 1FX7A 2XAUA 1JKPC 1MNMC 3I56I 3ERMA 1SVOA 2DA1A 2MGQA 3EUHA 3ZQHA 2EFOA 3BPXA 2AHQA 4NC6A 4IZZA 2R7UA 4XLNF 1ACIA 4OD5A 4NC7A 4AIJA 3W2VA 3H3ZA 4JK1X 4PFOA 2ZO4A 2L0KA 4IHWA 5DV5A 1I3QJ 4V2GA 3T8TA 4OU0A 4XN0A 4OMYA 3BCAA 2BXZA 2ZBKA 1ORKA 4IRHA 1R1VA 2R93J 3E6DA 5J40A 3P9TA 2Q2EA 3FF5A 3S15J 4A3KJ 4M73A 3QRFF 2E2JJ 1X4PA 3IL2A 4C2MJ 4S04A 2DQRA 3J80Z 4OIQF 3B73A 3I58A 3L2WA 3LSPA 3LAPA 1TZLA 1TWHJ 3DFGA 1ZGAA 3DBLB 1QZYA 1ZTRA 3QOEA 4FHTA 3T8RA 5CXGA 5BOXA 3JSJA 3O8GA 2R4GA 1QVUA 1Z1DA 2ID3A 2M8EA 1ZRFA 2L2OA 3HEFA 4FQGA 4AYBA 3ZQGA 1L0OC 1GXPA 3GX4X 2MBFA 4XLCA 1HXDA 1YX3A 2KDZA 1XD7A 3LQRA 3CDHA 4IEJA 4OIPF 1K6YA 2UZKA 2CGPA 2W57A 1XX5A 2LK2A 3J7YJ 3FXLA 3SZPA 2OD5A 1UHSA 2RQPA 2XIGA 4D5CA 2KFDA 2OI8A 2DOEA 2BY0A 3CDLA 3PFIA 2O5RA 2ZFWA 4AVZA 3OR2C 5FLXZ 1B1BA 1FYKA 2JA8J 3SWHA 2CW7A 4ZDOA 4GFBA 2XSJC 1F43A 3FHZA 2XF5A 3BZ6A 3OYNA 3H9QA 2LY9A 5DDGA 1IN4A 4NDLA 4BQOA 2FNPA 2VKHA 1E3OC 2MFZA 1NH3A 5M3FJ 2MD5A 2CG4A 3K70D 2DT5A 3CJNA 5E20A 5HLGA 1JKOC 2QOPA 4DQ2A 3LHQA 2Y48A 4N0BA 2M34A 1ZAOA 1EV7A 4F55A 5CW8A 2O8KA 2O61A 1T6SA 3WE2A 5J47A 1TNSA 4HBLA 1PUFA 4FX4A 2FMYA 3HZJA 4HQMA 2QSHX 2DA6A 3E7LA 3MAJA 2DN0A 1DUXC 4A3MJ 2PEXA 4GCVA 2MW8A 4G94A 4A69C 3L1PA 4E70A 3LL7A 3MCZA 3DPJA 4U9LA 1I39A 3SYTA 3R0JA 1ZLJA 4WXCA 2XDNA 3GTKJ 4FE4A 4IVNA 5JLXA 4BL0B 1A35A 2NOJB 1IF1A 2KRCA 4U0WA 3CCVI 2R7QA 5E18F 2M0MA 1KU2A 5LEJA 3ZXSA 1Z9CA 1B9NA 3G1MA 4KISA 4A3JJ 3S1QJ 4P9FA 5TISC 2BGCA 2O0YA 2A69F 1XS9A 4HF0A 3AG3H 1J9IA 5DM7F 1HDDC 2WADA 1UI6A 2W4SA 1UZCA 2CUEA 3FK7A 3CC4I 1YX5A 1FT9A 3IP4B 4UNOA 5LGNA 3MNLA 4F7ZA 1ONVA 3BY6A 5L3EA 2DT7B 2CUZA 3FXJA 1FBUA 5B1BH 1U8BA 3IRQA 3BC8A 3U21A 3IV5A 2P7CB 5AIQA 3CTAA 5E1XA 5J4YA 1ETYA 4UV9A 1OLTA 1KU9A 3V7SA 2YU3A 4G6DA 2IS1A 1X1PA 4WXHA 2ACJA 3O6BB 3BTCA 1Z6RA 2K9MA 2FOWA 3IHUA 2C6YA 2OCEA 2K4BA 1VQMI 3LSTA 2L7MP 1X2MA 2G7UA 3I59B 5DCMB 2J5OA 1ITYA 5K5QA 3DEUA 5L3CA 1XDUA 2XSDC 3F8BA 4L9TA 4X1EA 1B8IA 5HDNA 1D0XA 1I1GA 4I99C 1LPQA 1D5VA 4GFLA 5E3MA 2XGCA 4O5VA 4W1UA 3H9JA 1NK3P 3S17J 1B59A 2R7TA 2PBXA 1MGTA 2H1LA 4ENMA 3TOAA 3G6EI 1VI0A 5IP6A 2JPBA 2XPVA 5M5YJ 1JKRC 2DFIA 2Z1DA 2E1CA 4ESJA 3TO9A 2LKXA 3H0DA 1J2XA 4H4KC 4HW0A 5LD2C 1VQKI 3PFYA 4UUSB 3FXRA 2LSOA 2VXZA 2XGEA 3HSFA 2NRAC 3KZIC 3FMQA 3K8PC 3AAFA 4RGSA 3NEUA 3JRDA 4HNTA 2A5WA 4L5IA 5ICEA 4DVYP 4P55A 2BHZA 4KICA 4GGGA 1K78B 1BL0A 3ASNH 3HTIA 2L54A 2NNYA 4M9SA 1S29A 3OS0A 2G7LA 1L3LA 3PIPF 1V54H 1YLFA 1FNNA 3A02A 2CJJA 4ZYGA 2A3SA 4FASD 2BW3B 4RGUA 2OTLI 2QBYA 1QGPA 2B7EA 1EH8A 1USSA 1VQOI 4XNFA 3RCOA 1U5TB 1JHFA 1RC9A 4IRVA 4N4NB 2GA1A 4HOBA 1IRXA 1W7PB 3CCRI 1XSVA 1XTAA 3HDDA 4C2TA 4XM3A 4HKUA 4PJNA 2Z3YA 5H6QA 2ZCWA 3OWTA 2STWA 3I4MJ 1ZRCA 2CYYA 1BIAA 2E1MC 2WB1N 2DCEA 2DODA 1Y56A 2HDWA 2R7WA 2GIVA 2W24A 1TQMA 3RIRA 2FBQA 3CD6I 2GA2A 2LVSA 2A07F 1ZHFA 2ZXWH 3JRBA 2H27A 4EQQA 2E2IJ 5FO5A 2REKA 3P7NA 3NWTA 3A03A 2VBZA 1LDDA 3EUHC 1QZEA 3M7GA 4EEFG 1RIOH 1H88C 2DMQA 3J81K 4JX5A 5EJCA 4E6KG 3IWZA 2MA3A 4N9IA 3KP3A 2L9NA 1STZA 4EJOA 4N4OB 2G7HA 4F52A 3ABUA 3CUQC 2DYSH 4O6JA 2W25A 4CCJA 2HTJA 4JYKA 2P7VB 2L7KA 1RPWA 4XSXF 3CF5F 2TRTA 4M6XA 4XIDA 5HNFA 2F5VA 5DCFA 1LFBA 2DYRH 2WAQN 1RUOA 3HSEA 4C30A 1F36A 4CCNA 3S3NA 1ETXA 2FUG2 2JK3A 3CMEI 3QYFA 2JMWA 4Y3OA 2WV1A 4ACIA 1EH6A 1LJ9A 3LSHA 1W0TA 4ZZDA 2I5UA 2FEZA 1OKRA 2OQGA 1RZ4A 2L01A 4ZYHA 3BNIA 5CLSA 5FKNA 3BTIA 1D1BA 4QIWN 3E0JB 1AHDP 4IF4A 4UB6C 2XAHA 4NHJA 2B3WA 2QKLB 1JUPA 2NP3A 2EIMH 3QAHA 4I02A 3G2BA 3DTKA 1MIJA 1BR2A 1VNDA 3KFWX 1D8KA 4BKXA 4E7KA 1O57A 2CU7A 4GCKA 4IL6C 3HGYA 1X3WB 1WI3A 2LOOA 3LSJA 3WTYC 1SAXA 3BJOA 1Y6IA 1S9HA 1W5CC 3CJTB 2M87A 1K61A 4RGRA 1QPMA 2HYJA 5IYBJ 2MSYA 3AQSA 1FOWA 3QU6A 4IQ4A 4FT8A 3IWFA 2O9LA 3OOUA 2VPRA 2ZY9A 2CV1A 2BXYA 3ROUA 4LLGF 3CF2A 3GFIA 2FQ4A 2ZCNA 1HSTA 2Y75A 4IHSA 1RNLA 3I71A 2CUFA 4L62A 1FWZA 3MMYB 1KU7A 3REOA 5DM6F 3CCEI 2AS5F 1ZYRF 3KETA 3EPZA 3SZTA 3C2HA 3V8JA 2O8XA 2YSRA 2CW0F 4BEHA 3GZ5A 2BE5F 4LK0F 4D0PA 3LNQA 5FLMJ 4E7LA 2R7SA 2KLOA 1UELB 1IRGA 3QP5A 2IS6A 2HDDA 1YO5C 1T0FC 1O3QA 1LEBA 1EKEA 4QTRA 2F5FA 1WH5A 4KT5C 3KEOA 3KKCA 4XLFA 1MJ9A 4BXFA 2XAQA 2XASA 3VDXA 1BI3A 2ZJ2A 2EB7A 2YX4A 2HOAA 2R92J 1XSDA 3CCMI 3R4KA 3DCFA 4XLHA 4B48A 3I4NJ 5HSZA 3VPRA 1AA7A 1YW9A 4I76A 1IXSB 1FOKA 3GTMJ 3HOZJ 1E2XA 2HVQA 3E97A 3VP5A 3P9KA 3NRGA 4EJUA 3LSIA 2R7ZJ 2YVEA 2E5NA 3JAMK 2FA5A 3K7AJ 2CWEA 2DU9A 5HLHA 2UXNA 1BI1A 2D1VA 2E7XA 1SANA 4LOCA 2OJED 2RC4A 3EYYA 4ENKA 4PZJA 1JKQC 1E0EA 1AU7A 3JRAA 4ANJA 3S8PA 5GPAA 3K4BA 2OBPA 3BG3A 3W2WA 2DK5A 2HPMA 3ABMH 2NAZA 2HOEA 2OTJI 3SEQA 2XAGA 4JX4A 1Y0UA 1ZK8A 4C3IJ 5BQTA 1E3HA 1Z3YA 3BHQA 3SFIA 2NVYJ 1YRNA 1MMNA 2GWRA 1JI8A 1MH3A 3BR6A 3BJAA 5B1AH 1DU6A 2HXOA 1JT0A 3AL0B 2R7VA 4DBQA 2AQEA 1V5EA 1TLHB 5HLIA 4UDSA 1G8XA 1KU3A 4FX0A 1P2FA 1F5TA 1YS7A 5HDGA 1BI0A 2IGNA 2LH9A 1MSFC 2QYOA 1DP3A 1IN5A 3IUVA 4C2UA 4BY7J 3V8LA 2VQHA 3M9AA 1P6RA 2OAZA 3S2WA 3OYJA 2O6GE 2WAQA 4KWAA 1TW2A 2WC2A 1XGMA 3SDBA 3O2PE 1WJFA 3VVXA 2GOMA 2JUGA 3WU2C 2A68F 3GYHX 2PJRB 3GZ6A 2M30A 1FP2A 1FJLA 3DQVC 4MIMA 2IAIA 5ICFA 3Q5FA 3VVZA 2E34A 2BOLA 4G7ZF 3NRVA 1EH7A 4BQQA 3ANGA 1LKXA 3K10A 4A3CJ 2NP5A 2XB0X 1SFKA 1ZKGA 3M8EA 2KISA 1VQLI 3FXOA 1FYLA 2QIBA 5HBUA 2VQGA 3ELKA 1WKMA 3GFMA 3CCJI 3T1BA 1BJAA 4HDVA 2HI3A 1AKHA 1D0ZA 2LMDA 4KA4A 1LUJB 4W97A 4B8XA 2DA7A 3ZP5A 5F04A 5HDKA 1K83J 1XGOA 5EEGA 2D5VA 1GVJA 4KJZA 4RGXA 3DKXA 4YFKF 1Y1WJ 4E7HA 4CZZA 2PX9A 2LY1A 2B9SA 4E7JA 1QZZA 1BC7C 3DPTA 3HSRA 4QPQA 4IX7A 2PMHA 4FTHA 1S8NA 3BP8A 3CLOA 1MMGA 3E1SA 3GTJJ 5KVRA 1B72B 5ED4A 1X1DA 2MD0A 2CFOA 2P0WA 2DA2A 3F8MA 2OZ6A 4P5OA 5CQEA 5J8FA 5JHFA 4S05A 2XGDA 1FMVA 4XORA 3ZMZA 4XRSG 3I3LA 1R1UA 2VL8A 2XF7A 1ETVA 1PVEA 2Y31A 3RH2A 1B8IB 2VI6A 4M9ZA 2K9SA 3RYRA 1O3RA 4PSWA 3HJEA 3K70C 1GUUA 3M4OJ 3QKXA 4CA0A 3E6CC 3J80K 3I59A 1G3TA 5DCMA 1X1BA 3LJLA 4YFXF 2UV1A 3QWLA 2ICWG 3QOPA 4ABZA 2UXPA 4H0EA 4RB2C 3PO3J 3OL4A 4OIRF 1Q1HA 2D45A 2F4OB 4D7NA 1V3FA 1OCCH 3OYLA 2HVRA 2ZB9A 1VQPI 4KMUX 2LFBA 1I50J 1ZELA 1QA6A 1Z3XA 4AUXA 3A1YA 3KLNA 2EV0A 4IXAA 5K5OA 2WGBA 3QPLA 2ELHA 2H8RA 2Q0OA 4AC0A 4QLCU 1KYZA 1R7JA 3CUQA 2JZYA 5DUIA 1TT0A 3GMEA 4XLEA 3E6BA 2KZGA 2X6XA 5LHHA 1XPXA 2HWVA 4DOZA 2VUMJ 3DLLF 4C3JJ 3BG6A 4BAYA 1SVMA 3LA2A 1FYMA 2OC6A 2FMLA 3CCQI 5HS8A 2GXAA 1UFMA 5LHGA 1FTTA 3L9FA 2CUJA 3V4GA 3MKYB 4DYQA 5E3LA 3W6JB 3OS1A 1S5LC 2VBXA 5CQGA 2R7RA 4L0ZB 3VVYA 4AWXB 3B6CA 3BOQA 2UWMA 2VJIA 2FD5A 2VOOA 1A5JA 1T56A 3HIMA 2BEOA 2JJ7A 3K2ZA 3L7WA 3TP3A 3M07A 2PI0A 2RAEA 2JTVA 4NELA 3U9GA 1APLC 4DGWB 3G73A 2FX0A 4ZH4F 2OQRA 3OOPA 3FM5A 4Y7NJ 1W36D 1G3SA 4ZYAA 3JREA 2KP6A 4HG2A 2OF7A 2M2EA 2XB5A 4GYIA 3TMOA 1ETQA 3S32A 5CYVA 2J5PA 1P9QC 3RD3A 1OCZH 3GBGA 1BM9A 2RNGA 3PUFA 4RAYA 4YG2F 5DS9A 1UCRA 3PQKA 3HKZA 1GXQA 4U7DA 4CH7A 3ZQLA 5E3OA 2FSWA 1NG6A 1WJAA 3IC7A 4FCYA 3DU6A 3Q0WA 2V6CA 4OWRB 3AKZA 3VYTB 1P4XA 2KPMA 1TQPA 4ICHA 2N8GA 3IKVA 2QGUA 4MNUA 4PCQA 1ZQ3P 1MBGA 3M1CA 1U78A 3HXLA 3C07A 5HS9A 3G1OA 1FY7A 1CF7A
chains in the Genus database with same CATH topology
1I6HJ 4M3FA 5IP6A 2GFNA 1JKRC 2XPVA 5M5YJ 3S1MJ 3NI7A 5FMPA 4I6ZA 3BG5A 1ETKA 3PO2J 2LKXA 4JL3A 3A01B 1GDTA 4UUSB 2CRGA 4Y52J 2HYTA 2NOGA 1VF9A 2XGEA 1P7JA 2DJNA 4XK4A 3HB9A 3JRDA 2EZKA 4FE7A 3RQIA 4C3HJ 2NS8A 4JKZA 1GVDA 3NXCA 5F0HA 3CMYA 1BL0A 2GM4A 5M3MJ 3HTIA 2E1OA 1W0UA 2DG7A 1PUFB 2MG4A 4XRSA 5K58A 2G7LA 2L7FP 5BNGA 4HNVA 3JRCA 1DU0A 4A3BJ 2EH3A 1IJWC 3GZIA 3A02A 2CJJA 5IYDJ 5FKMA 2X6OA 3OIOA 1QRYA 2DTZA 3G1LA 4M6VA 4RBOA 2JA5J 2FJ1A 2E2HJ 4A93J 2D6YA 2O7OA 1S7EA 2HXIA 4L5EA 2DG8A 1R9TJ 3HTHA 3HDDA 4HKUA 1WPKA 2Y0SN 3VOXA 2X48A 3I4MJ 4NN1A 2WB1N 5K7FA 3S1RJ 3KZ9A 1SFOJ 2DA3A 3C2BA 4J19A 4AYBN 1H89C 1OJLA 5EZGA 3KKDA 2FBQA 4MXMA 3HTAA 2LVSA 4B3AA 2HKUA 2ZCMA 3JRBA 2IU5A 3H0GJ 2E2IJ 2EZHA 2REKA 4DW6A 2Y9ZA 4CYCA 3CJDA 3HM5A 2L7ZA 3ZQIA 4M3DA 3A03A 3NARA 5DTDA 1ENHA 3RZOJ 4EEFG 1H88C 2DMQA 2YUSA 2YU9J 2GUHA 2DA5A 4JX5A 3MKLA 5D18A 2P81A 3S2HJ 1GV2A 1IG7A 1FIPA 3VW2A 3PM1A 4IHYA 1A6IA 3LSRA 1TWGJ 4JYKA 1OCTC 1RPWA 1HLVA 2TRTA 4XIDA 4JX6A 2YS9A 2OERA 3JRIA 3S16J 1LFBA 4ME9A 3PPBA 3HE0A 2WAQN 1F36A 1ETXA 4UUSA 2JK3A 5F08A 2GBYA 2JMWA 4BXXJ 2WV1A 4ACIA 2CQXA 2ZOYA 4DZPA 1W0TA 3EGQA 2X9DA 5K7HA 3W6VA 5EFYA 2UXHA 2ZOZA 3CCYA 4M3GA 5J1UA 1MBFA 3BNIA 5HODA 5FKNA 3BTIA 1O4XA 1LE8A 5F1JA 4QIWN 5IP7J 4JP0A 4X6AJ 3HOXJ 1JT6A 1JUMA 2R0QC 1AHDP 2JA7J 5K7ZA 2ZCXA 2ELKA 5EF6A 1JUPA 5J1RA 2NP3A 1BJZA 3K2AA 3IH4A 1NTCA 2HOTA 1RKTA 3E7QA 3TW6A 5C4JJ 1T33A 5IPAA 1G2HA 1VNDA 3HOYJ 4CYCB 2V57A 4MO7A 5FGLA 4BKXA 1CQTA 3EUPA 2CU7A 4GCKA 1UMQA 3HGYA 5GP9A 1MBHA 1WI3A 3LSJA 1RR7A 2EQRA 5IP9J 1K61A 3CQZJ 2HYJA 5IYBJ 2MSYA 2Y2ZA 3AQSA 3CWRA 3NAUA 3V6GA 2O9LA 2DA4A 3OOUA 2NVTJ 3ON2A 2VPRA 1YRNB 3O60A 3S5RA 4B1RA 3M3YJ 1JJ8C 1RKWA 2FQ4A 2ZCNA 5DAJA 4BBSJ 5EYRA 5IOZA 1AKHB 2CUFA 4L62A 3ON4A 2LD5A 2Y30A 5FJ8J 3Q0VA 3OSGA 5C4YA 3KNWA 3HOUJ 1MBEA 4YZEA 2YVHA 3LNQA 1MH4A 5FLMJ 2HDDA 2K9QA 4GFKA 3FIWA 3MVPA 1FEXA 4QTRA 2LLKA 2XPUA 4V2FA 4AF5A 1WH5A 3UKGA 4MFDA 3KKCA 5EDNA 2GLOA 4IHVA 2CQQA 3WHBA 4MK6A 2WUIA 1JTXA 3BR0A 3HBLA 1IV6A 2HOAA 3BT9A 2R92J 3LWJA 3JRFA 2JWTA 2M9HA 2B63J 1BW5A 1RESA 3DEWA 3DCFA 5IYCJ 2IBDA 3I4NJ 1HOMA 3VPRA 4I76A 3HOZJ 5HSZA 2XPWA 3GTMJ 2JA6J 2HOSA 4DYCA 3LSGA 4A3IJ 3VP5A 3BR2A 3A01A 2R7ZJ 3RZDJ 3HTJA 3NRGA 4PXIA 2YVEA 4A3LJ 1IRZA 3BQYA 2QTQA 3K7AJ 2OPTA 2VKVA 1X58A 5H9TA 5EZHA 3TP0A 1TWAJ 2LP0A 1IGNA 1OCPA 1XG1A 3IH3A 3T6NA 4DZJA 4S0HB 1SANA 4LOCA 2M8GX 5FLVA 2QWTA 5C3EJ 1JKQC 1AU7A 3JRAA 3TEDA 2ECCA 3QQAA 4FISA 5GPAA 3F1BA 2UXOA 1HF0A 3BG3A 1Z0XA 5D1RA 3VUQA 1ETWA 5EGOA 3RKQA 1FIAA 1HDPA 4MLOA 5FKOA 3F0CA 3ZOBA 3OSFA 1JUSA 1JJ6C 2ID6A 5F0CA 4XICA 1BW6A 4JX4A 1ZK8A 5FKLA 4C3IJ 4G12A 3GTLJ 2R5ZA 4A3EJ 4A3DJ 2QF7A 3ZQCA 2F07A 3ANPA 1GT0C 3SFIA 2ME0A 2NVYJ 5EG0A 1YRNA 3BHQA 2H1KA 1MH3A 3BR6A 2KT0A 4UUTA 2NS7A 4D7MA 2K9NA 1DU6A 2HXOA 1JT0A 3ZQFA 5M5XJ 3JRGA 1QVTA 1ZR2A 1MSEC 4M3BA 3PASA 3BTJA 1UI5A 3BCGA 4UDSA 4RDUA 4CGRA 1B72A 1JKPC 1MNMC 1SGMA 2MGQA 3ZQHA 2DA1A 3JRHA 4JNNA 2AHQA 2DMUA 1U9NA 1MSFC 2UXIA 3IUVA 5F0FA 4A3FJ 4BY7J 1RETA 5EGOB 1FTZA 3FKIJ 3BG9A 3AQTA 3QBMA 9ANTA 4M3EA 5D19A 4GCTA 2L0KA 4MFEA 2NVQJ 4KWAA 4IHWA 1I3QJ 3GTGJ 2EBIA 3VVXA 4V2GA 3IH2A 3BR5A 3SDGA 1ORKA 1FJLA 1H8AC 4MIMA 2IAIA 2R93J 3BJBA 5CXIA 3P9TA 3VVZA 3S15J 1QPIA 4A3KJ 2E2JJ 1EF4A 4C2MJ 4BY1J 3ANGA 3LSPA 4A3CJ 1WH7A 2NP5A 3VIBA 1TWCJ 2XB0X 2PMZN 1TWHJ 1ZKGA 1P7IA 1WGXA 1ETOA 5FKKA 1ZTRA 2QIBA 5HBUA 5CXGA 2Q24A 3D1NI 3JSJA 3O8GA 3B81A 2HI3A 1AKHA 1QVUA 4W97A 4D5FA 1U9OA 2ID3A 1HCRA 2DA7A 3COLA 5F04A 1K83J 1POGA 3HEFA 3ZQGA 5C44J 2D5VA 2VKEA 1Y1WJ 3CRJA 2KDZA 4IHXA 5J3LA 2UXUA 3GEUA 1Z77A 4IEJA 5C4XJ 2G7SA 3NPIA 2HQ5A 1JTYA 1WCMJ 2G0EA 2I10A 3B6AA 2LK2A 3BR1A 4FTHA 3FRQA 3GTJJ 1MBKA 1B72B 4D5CA 1UHSA 2W53A 3JR9A 2OI8A 2Y9YA 3V78A 2DA2A 3CDLA 3HOVJ 2XGDA 1TWFJ 1X2NA 4XRSG 3HOWJ 2K40A 2JA8J 5M5WJ 3NNRA 1NK2P 4AC6A 1ETVA 2Y31A 4GFBA 2R5YA 3RH2A 1F43A 1B8IB 3VOKA 2M0CA 2VI6A 3BR3A 2K9SA 3TW7A 2LY9A 1GUUA 3M4OJ 2COBA 3QKXA 2LTPA 4NDLA 5AQCA 4GCLA 1E3OC 1XC5A 3LJLA 5M3FJ 3WHCA 2G7GA 5HAWA 4ABZA 2UXPA 3PO3J 5EEAA 4D7NA 1JKOC 1Y1VJ 3VW1A 2QOPA 2ZB9A 3LHQA 2LFBA 1I50J 2QCOA 1VFCA 2M34A 4AUXA 5CW8A 2O8KA 3GTPJ 3QPSA 2WGBA 2TCTA 1JGGA 3QPLA 2ME6A 5EG0B 1PUFA 3FK6A 2H8RA 2NVXJ 1IDYA 3Q0UA 4AC0A 2RHAA 2DA6A 3E7LA 2R5ZB 2DN0A 1LE8B 1TC3C 3BQZA 3BTLA 4A3MJ 2AO9A 2DMTA 1IDZA 1IC8A 2MW8A 4A3GJ 4A69C 3L1PA 3DPJA 1GV5A 2VUMJ 1MBJA 2XRLA 4C3JJ 3H3VK 2QKOA 2XDNA 3GTKJ 3VW0A 4FE4A 5JLXA 2ECBA 1FTTA 2EZIA 4DYQA 2PZ9A 5E3LA 3G7RA 3LOCA 2RASA 3GTOJ 3VVYA 3MN2A 3B6CA 4BBRJ 1Q1VA 3G1MA 2FD5A 1A5JA 4A3JJ 3S1QJ 1T56A 5JLWA 3HIMA 1ZR4A 2JJ7A 1XS9A 3TP3A 3BRUA 5FHPA 3Q3SA 4DYRA 3FISA 4NELA 2RAEA 1HDDC 1UI6A 1OFCX 1UG2A 2IEKA 1APLC 2EZLA 3G56A 2FX0A 1IUFA 2CUEA 4Y7NJ 3FK7A 3SJMA 2E19A 3JREA 2GENA 5GPCA 3O8HA 3MNLA 3S2DJ 4XRMA 4B4CA 2OF7A 1ZGWA 2M2EA 2XB5A 4QSHA 1ETQA 1LFUP 1U8BA 3RD3A 2NX4A 3IV5A 3GBGA 1ETYA 5IOYA 5DS9A 3ZQLA 1D5YA 5E3OA 3BTCA 4FCYA 3Q0WA 2JN6A 2L7MP 2DMNA 5E3NA 1X2MA 2G3BA 2O7TA 5F27A 2L9RA 1ITYA 4ICHA 2N8GA 3HGGA 3HKZN 2LR8A 1ZQ3P 2XSDC 4X1EA 1B8IA 1BA5A 1MBGA 2R5YB 2DMPA 3GTQJ 4GFLA 1U78A 5E3MA 2XGCA 3S1NJ 4W1UA 1NK3P 3S17J 2PBXA 2W48A 3C07A 3G1OA 5J1YA 3S14J 1VI0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I6H J;  4M3F A;  5IP6 A;  2GFN A;  1JKR C;  2XPV A;  5M5Y J;  3S1M J;  3NI7 A;  5FMP A;  4I6Z A;  3BG5 A;  1ETK A;  3PO2 J;  2LKX A;  4JL3 A;  3A01 B;  1GDT A;  4UUS B;  2CRG A;  4Y52 J;  2HYT A;  2NOG A;  1VF9 A;  2XGE A;  1P7J A;  2DJN A;  4XK4 A;  3HB9 A;  3JRD A;  2EZK A;  4FE7 A;  3RQI A;  4C3H J;  2NS8 A;  4JKZ A;  1GVD A;  3NXC A;  5F0H A;  3CMY A;  1BL0 A;  2GM4 A;  5M3M J;  3HTI A;  2E1O A;  1W0U A;  2DG7 A;  1PUF B;  2MG4 A;  4XRS A;  5K58 A;  2G7L A;  2L7F P;  5BNG A;  4HNV A;  3JRC A;  1DU0 A;  4A3B J;  2EH3 A;  1IJW C;  3GZI A;  3A02 A;  2CJJ A;  5IYD J;  5FKM A;  2X6O A;  3OIO A;  1QRY A;  2DTZ A;  3G1L A;  4M6V A;  4RBO A;  2JA5 J;  2FJ1 A;  2E2H J;  4A93 J;  2D6Y A;  2O7O A;  1S7E A;  2HXI A;  4L5E A;  2DG8 A;  1R9T J;  3HTH A;  3HDD A;  4HKU A;  1WPK A;  2Y0S N;  3VOX A;  2X48 A;  3I4M J;  4NN1 A;  2WB1 N;  5K7F A;  3S1R J;  3KZ9 A;  1SFO J;  2DA3 A;  3C2B A;  4J19 A;  4AYB N;  1H89 C;  1OJL A;  5EZG A;  3KKD A;  2FBQ A;  4MXM A;  3HTA A;  2LVS A;  4B3A A;  2HKU A;  2ZCM A;  3JRB A;  2IU5 A;  3H0G J;  2E2I J;  2EZH A;  2REK A;  4DW6 A;  2Y9Z A;  4CYC A;  3CJD A;  3HM5 A;  2L7Z A;  3ZQI A;  4M3D A;  3A03 A;  3NAR A;  5DTD A;  1ENH A;  3RZO J;  4EEF G;  1H88 C;  2DMQ A;  2YUS A;  2YU9 J;  2GUH A;  2DA5 A;  4JX5 A;  3MKL A;  5D18 A;  2P81 A;  3S2H J;  1GV2 A;  1IG7 A;  1FIP A;  3VW2 A;  3PM1 A;  4IHY A;  1A6I A;  3LSR A;  1TWG J;  4JYK A;  1OCT C;  1RPW A;  1HLV A;  2TRT A;  4XID A;  4JX6 A;  2YS9 A;  2OER A;  3JRI A;  3S16 J;  1LFB A;  4ME9 A;  3PPB A;  3HE0 A;  2WAQ N;  1F36 A;  1ETX A;  4UUS A;  2JK3 A;  5F08 A;  2GBY A;  2JMW A;  4BXX J;  2WV1 A;  4ACI A;  2CQX A;  2ZOY A;  4DZP A;  1W0T A;  3EGQ A;  2X9D A;  5K7H A;  3W6V A;  5EFY A;  2UXH A;  2ZOZ A;  3CCY A;  4M3G A;  5J1U A;  1MBF A;  3BNI A;  5HOD A;  5FKN A;  3BTI A;  1O4X A;  1LE8 A;  5F1J A;  4QIW N;  5IP7 J;  4JP0 A;  4X6A J;  3HOX J;  1JT6 A;  1JUM A;  2R0Q C;  1AHD P;  2JA7 J;  5K7Z A;  2ZCX A;  2ELK A;  5EF6 A;  1JUP A;  5J1R A;  2NP3 A;  1BJZ A;  3K2A A;  3IH4 A;  1NTC A;  2HOT A;  1RKT A;  3E7Q A;  3TW6 A;  5C4J J;  1T33 A;  5IPA A;  1G2H A;  1VND A;  3HOY J;  4CYC B;  2V57 A;  4MO7 A;  5FGL A;  4BKX A;  1CQT A;  3EUP A;  2CU7 A;  4GCK A;  1UMQ A;  3HGY A;  5GP9 A;  1MBH A;  1WI3 A;  3LSJ A;  1RR7 A;  2EQR A;  5IP9 J;  1K61 A;  3CQZ J;  2HYJ A;  5IYB J;  2MSY A;  2Y2Z A;  3AQS A;  3CWR A;  3NAU A;  3V6G A;  2O9L A;  2DA4 A;  3OOU A;  2NVT J;  3ON2 A;  2VPR A;  1YRN B;  3O60 A;  3S5R A;  4B1R A;  3M3Y J;  1JJ8 C;  1RKW A;  2FQ4 A;  2ZCN A;  5DAJ A;  4BBS J;  5EYR A;  5IOZ A;  1AKH B;  2CUF A;  4L62 A;  3ON4 A;  2LD5 A;  2Y30 A;  5FJ8 J;  3Q0V A;  3OSG A;  5C4Y A;  3KNW A;  3HOU J;  1MBE A;  4YZE A;  2YVH A;  3LNQ A;  1MH4 A;  5FLM J;  2HDD A;  2K9Q A;  4GFK A;  3FIW A;  3MVP A;  1FEX A;  4QTR A;  2LLK A;  2XPU A;  4V2F A;  4AF5 A;  1WH5 A;  3UKG A;  4MFD A;  3KKC A;  5EDN A;  2GLO A;  4IHV A;  2CQQ A;  3WHB A;  4MK6 A;  2WUI A;  1JTX A;  3BR0 A;  3HBL A;  1IV6 A;  2HOA A;  3BT9 A;  2R92 J;  3LWJ A;  3JRF A;  2JWT A;  2M9H A;  2B63 J;  1BW5 A;  1RES A;  3DEW A;  3DCF A;  5IYC J;  2IBD A;  3I4N J;  1HOM A;  3VPR A;  4I76 A;  3HOZ J;  5HSZ A;  2XPW A;  3GTM J;  2JA6 J;  2HOS A;  4DYC A;  3LSG A;  4A3I J;  3VP5 A;  3BR2 A;  3A01 A;  2R7Z J;  3RZD J;  3HTJ A;  3NRG A;  4PXI A;  2YVE A;  4A3L J;  1IRZ A;  3BQY A;  2QTQ A;  3K7A J;  2OPT A;  2VKV A;  1X58 A;  5H9T A;  5EZH A;  3TP0 A;  1TWA J;  2LP0 A;  1IGN A;  1OCP A;  1XG1 A;  3IH3 A;  3T6N A;  4DZJ A;  4S0H B;  1SAN A;  4LOC A;  2M8G X;  5FLV A;  2QWT A;  5C3E J;  1JKQ C;  1AU7 A;  3JRA A;  3TED A;  2ECC A;  3QQA A;  4FIS A;  5GPA A;  3F1B A;  2UXO A;  1HF0 A;  3BG3 A;  1Z0X A;  5D1R A;  3VUQ A;  1ETW A;  5EGO A;  3RKQ A;  1FIA A;  1HDP A;  4MLO A;  5FKO A;  3F0C A;  3ZOB A;  3OSF A;  1JUS A;  1JJ6 C;  2ID6 A;  5F0C A;  4XIC A;  1BW6 A;  4JX4 A;  1ZK8 A;  5FKL A;  4C3I J;  4G12 A;  3GTL J;  2R5Z A;  4A3E J;  4A3D J;  2QF7 A;  3ZQC A;  2F07 A;  3ANP A;  1GT0 C;  3SFI A;  2ME0 A;  2NVY J;  5EG0 A;  1YRN A;  3BHQ A;  2H1K A;  1MH3 A;  3BR6 A;  2KT0 A;  4UUT A;  2NS7 A;  4D7M A;  2K9N A;  1DU6 A;  2HXO A;  1JT0 A;  3ZQF A;  5M5X J;  3JRG A;  1QVT A;  1ZR2 A;  1MSE C;  4M3B A;  3PAS A;  3BTJ A;  1UI5 A;  3BCG A;  4UDS A;  4RDU A;  4CGR A;  1B72 A;  1JKP C;  1MNM C;  1SGM A;  2MGQ A;  3ZQH A;  2DA1 A;  3JRH A;  4JNN A;  2AHQ A;  2DMU A;  1U9N A;  1MSF C;  2UXI A;  3IUV A;  5F0F A;  4A3F J;  4BY7 J;  1RET A;  5EGO B;  1FTZ A;  3FKI J;  3BG9 A;  3AQT A;  3QBM A;  9ANT A;  4M3E A;  5D19 A;  4GCT A;  2L0K A;  4MFE A;  2NVQ J;  4KWA A;  4IHW A;  1I3Q J;  3GTG J;  2EBI A;  3VVX A;  4V2G A;  3IH2 A;  3BR5 A;  3SDG A;  1ORK A;  1FJL A;  1H8A C;  4MIM A;  2IAI A;  2R93 J;  3BJB A;  5CXI A;  3P9T A;  3VVZ A;  3S15 J;  1QPI A;  4A3K J;  2E2J J;  1EF4 A;  4C2M J;  4BY1 J;  3ANG A;  3LSP A;  4A3C J;  1WH7 A;  2NP5 A;  3VIB A;  1TWC J;  2XB0 X;  2PMZ N;  1TWH J;  1ZKG A;  1P7I A;  1WGX A;  1ETO A;  5FKK A;  1ZTR A;  2QIB A;  5HBU A;  5CXG A;  2Q24 A;  3D1N I;  3JSJ A;  3O8G A;  3B81 A;  2HI3 A;  1AKH A;  1QVU A;  4W97 A;  4D5F A;  1U9O A;  2ID3 A;  1HCR A;  2DA7 A;  3COL A;  5F04 A;  1K83 J;  1POG A;  3HEF A;  3ZQG A;  5C44 J;  2D5V A;  2VKE A;  1Y1W J;  3CRJ A;  2KDZ A;  4IHX A;  5J3L A;  2UXU A;  3GEU A;  1Z77 A;  4IEJ A;  5C4X J;  2G7S A;  3NPI A;  2HQ5 A;  1JTY A;  1WCM J;  2G0E A;  2I10 A;  3B6A A;  2LK2 A;  3BR1 A;  4FTH A;  3FRQ A;  3GTJ J;  1MBK A;  1B72 B;  4D5C A;  1UHS A;  2W53 A;  3JR9 A;  2OI8 A;  2Y9Y A;  3V78 A;  2DA2 A;  3CDL A;  3HOV J;  2XGD A;  1TWF J;  1X2N A;  4XRS G;  3HOW J;  2K40 A;  2JA8 J;  5M5W J;  3NNR A;  1NK2 P;  4AC6 A;  1ETV A;  2Y31 A;  4GFB A;  2R5Y A;  3RH2 A;  1F43 A;  1B8I B;  3VOK A;  2M0C A;  2VI6 A;  3BR3 A;  2K9S A;  3TW7 A;  2LY9 A;  1GUU A;  3M4O J;  2COB A;  3QKX A;  2LTP A;  4NDL A;  5AQC A;  4GCL A;  1E3O C;  1XC5 A;  3LJL A;  5M3F J;  3WHC A;  2G7G A;  5HAW A;  4ABZ A;  2UXP A;  3PO3 J;  5EEA A;  4D7N A;  1JKO C;  1Y1V J;  3VW1 A;  2QOP A;  2ZB9 A;  3LHQ A;  2LFB A;  1I50 J;  2QCO A;  1VFC A;  2M34 A;  4AUX A;  5CW8 A;  2O8K A;  3GTP J;  3QPS A;  2WGB A;  2TCT A;  1JGG A;  3QPL A;  2ME6 A;  5EG0 B;  1PUF A;  3FK6 A;  2H8R A;  2NVX J;  1IDY A;  3Q0U A;  4AC0 A;  2RHA A;  2DA6 A;  3E7L A;  2R5Z B;  2DN0 A;  1LE8 B;  1TC3 C;  3BQZ A;  3BTL A;  4A3M J;  2AO9 A;  2DMT A;  1IDZ A;  1IC8 A;  2MW8 A;  4A3G J;  4A69 C;  3L1P A;  3DPJ A;  1GV5 A;  2VUM J;  1MBJ A;  2XRL A;  4C3J J;  3H3V K;  2QKO A;  2XDN A;  3GTK J;  3VW0 A;  4FE4 A;  5JLX A;  2ECB A;  1FTT A;  2EZI A;  4DYQ A;  2PZ9 A;  5E3L A;  3G7R A;  3LOC A;  2RAS A;  3GTO J;  3VVY A;  3MN2 A;  3B6C A;  4BBR J;  1Q1V A;  3G1M A;  2FD5 A;  1A5J A;  4A3J J;  3S1Q J;  1T56 A;  5JLW A;  3HIM A;  1ZR4 A;  2JJ7 A;  1XS9 A;  3TP3 A;  3BRU A;  5FHP A;  3Q3S A;  4DYR A;  3FIS A;  4NEL A;  2RAE A;  1HDD C;  1UI6 A;  1OFC X;  1UG2 A;  2IEK A;  1APL C;  2EZL A;  3G56 A;  2FX0 A;  1IUF A;  2CUE A;  4Y7N J;  3FK7 A;  3SJM A;  2E19 A;  3JRE A;  2GEN A;  5GPC A;  3O8H A;  3MNL A;  3S2D J;  4XRM A;  4B4C A;  2OF7 A;  1ZGW A;  2M2E A;  2XB5 A;  4QSH A;  1ETQ A;  1LFU P;  1U8B A;  3RD3 A;  2NX4 A;  3IV5 A;  3GBG A;  1ETY A;  5IOY A;  5DS9 A;  3ZQL A;  1D5Y A;  5E3O A;  3BTC A;  4FCY A;  3Q0W A;  2JN6 A;  2L7M P;  2DMN A;  5E3N A;  1X2M A;  2G3B A;  2O7T A;  5F27 A;  2L9R A;  1ITY A;  4ICH A;  2N8G A;  3HGG A;  3HKZ N;  2LR8 A;  1ZQ3 P;  2XSD C;  4X1E A;  1B8I A;  1BA5 A;  1MBG A;  2R5Y B;  2DMP A;  3GTQ J;  4GFL A;  1U78 A;  5E3M A;  2XGC A;  3S1N J;  4W1U A;  1NK3 P;  3S17 J;  2PBX A;  2W48 A;  3C07 A;  3G1O A;  5J1Y A;  3S14 J;  1VI0 A; 
#chains in the Genus database with same CATH topology
 1I6H J;  4M3F A;  2W85 A;  4Y13 A;  1V5F A;  3F8N A;  4I01 A;  3N05 A;  4PJ0 C;  2GFN A;  1TBX A;  3S1M J;  2QVO A;  3FXK A;  3NI7 A;  2ADU A;  5CVI A;  4L0Y B;  4KFC A;  1SMT A;  2ZXJ A;  1WHU A;  3QYE A;  3W3C A;  5F1R A;  1K79 A;  1MJA A;  3V42 A;  2YR2 A;  1VF9 A;  1ERD A;  4XBF A;  1I3A A;  1OQY A;  2IA1 A;  5KAF C;  2M3A A;  3EUA A;  4KT6 A;  4C3H J;  4JKZ A;  3FBI B;  2CW8 A;  2ESH A;  2I8D A;  3VSK A;  3TO6 A;  3CP8 A;  5M3M J;  3LQQ A;  5TGT A;  5JVT A;  1N77 A;  4XRS A;  3H1C A;  3SZG A;  1ZG5 A;  3F3X A;  4U88 A;  1ULY A;  3JRC A;  2EH3 A;  1IJW C;  2JPC A;  4PGH A;  5DEQ A;  1OCR H;  2KJB A;  4BJ5 C;  4U0Y A;  3OIO A;  1QRY A;  3RSN A;  3GLX A;  3VEP A;  2E2H J;  2XKO A;  3Q9V A;  3ZMD A;  2O7O A;  4B09 A;  2VKD A;  4L5E A;  2HXI A;  1U0J A;  2KKO A;  2X1C A;  3CZ6 A;  4KIG A;  1SVL A;  4LIV A;  2Z9O A;  2W7N A;  3U1D A;  1R5I D;  1WPK A;  3DBR B;  2EIJ H;  2Y0S N;  2EFQ A;  3L2R A;  4GYG A;  3K0L A;  3J7A Y;  4OMZ A;  5IY5 H;  5K7F A;  4UHT A;  3IKT A;  3S1R J;  1ZLK A;  3OL3 A;  1YIO A;  3C2B A;  3EQL F;  4J19 A;  2PN6 A;  4ZJZ A;  5EZG A;  2KIQ A;  4NNJ A;  2B1E A;  5GAE J;  2HKU A;  2ZCM A;  2IU5 A;  2EZH A;  3T5X A;  4DW6 A;  2Y9Z A;  4HPQ A;  3ZQI A;  4M3D A;  3NAR A;  1W4M A;  2RQQ A;  2ZSI B;  3RPU A;  4LLN A;  1ENH A;  4PFP A;  3GF2 A;  3CCU I;  1YIT I;  2L9V A;  2YU9 J;  2R7F A;  2BVL A;  3N97 A;  2X85 A;  4EV0 A;  1OR7 A;  2XKP A;  2MLK A;  3KEQ A;  2CH0 A;  4Y17 A;  3AG1 H;  3FMS A;  4AIH A;  1BN5 A;  2Z2S B;  1UHW A;  4JX6 A;  3S16 J;  5CKT A;  1YJ9 I;  2P5L C;  5LRR A;  1XCB A;  3DP7 A;  3FKJ A;  2E35 A;  2GBY A;  1H9G A;  3P9I A;  2ZOY A;  3ZPL A;  3LA7 A;  3EGQ A;  3H35 A;  2HQA A;  4ZYD A;  4LB5 A;  1LNW A;  3RKX A;  2UXH A;  3CCY A;  4M3G A;  1O3T A;  5J1U A;  2FQ3 A;  3KLO A;  1IV8 A;  3L2Q A;  3F72 A;  4GRI A;  1LE8 A;  1W36 C;  4KIT B;  4JP0 A;  3CC2 I;  3HOX J;  5K1Y A;  3SEZ A;  5LRS A;  4HLY A;  2H8W A;  2ELK A;  2QEX I;  1J59 A;  2XVC A;  4BH9 A;  2HPI A;  4EAT A;  1FZP B;  3LWF A;  4Q5S F;  3D5L A;  3HRS A;  3G3Z A;  1A6Q A;  4HF1 A;  2QM3 A;  2CO5 A;  4HX7 A;  3GXO A;  3M8J A;  3OYM A;  2WY8 Q;  3JW4 A;  5IPA A;  4CO8 A;  1G2H A;  2WB1 A;  4J00 A;  4YRV A;  1RRJ A;  3HOY J;  2XRO A;  4MO7 A;  4Y4R A;  5FGL A;  1CQT A;  3WTV C;  3EUP A;  2A5Y B;  2JVG A;  4ZYE A;  1UMQ A;  1W5S A;  2HGC A;  1R71 A;  3UR3 C;  2VBY A;  4R8H A;  3OR1 C;  4EJW A;  5CVR A;  2Y0M A;  2CS3 A;  3WTW C;  2JA2 A;  3ZGK A;  3CQZ J;  3HOS A;  3KYD B;  1A36 A;  2MAB A;  3BLY A;  2Y2Z A;  1BR1 A;  3CWR A;  4LG0 A;  3V6G A;  2ZJP F;  4G8X A;  2KRH A;  3C3W A;  3O60 A;  3J81 Z;  3M3Y J;  2VE8 A;  2E5Z A;  4BBS J;  4HQE A;  5EYR A;  5IOZ A;  2HYG D;  1IN6 A;  2LD5 A;  2QA4 I;  4G7O F;  4OAY A;  1XCV A;  4EM0 B;  2QBY B;  4CZC A;  4WIB A;  4BUP A;  2LBF A;  3HOU J;  2V9P A;  2P5V A;  1YW7 A;  5HOO A;  3H3U A;  5FLX K;  2K9Q A;  2YVH A;  1FEX A;  1H0M A;  3DTI A;  5J6X A;  4V2F A;  2ZME C;  4BGD A;  4AF5 A;  5EDN A;  3GCM A;  5D6E A;  2QLZ A;  5ILS A;  1G3W A;  1WJD A;  4OAZ A;  1R4N B;  1JTX A;  2FE3 A;  2L4A A;  3BT9 A;  2HZD A;  2WV0 A;  3LWJ A;  4MTE A;  4BHP A;  3JRF A;  2M9H A;  2B63 J;  1DGR M;  2EFW A;  2IBD A;  2G9W A;  2HOS A;  4PGG A;  1Y8Q B;  1SD5 A;  2IT0 A;  3J7A O;  3BR2 A;  3F6O A;  3RZD J;  3HTJ A;  1XMX A;  4RA2 A;  4ZZL A;  3S93 A;  5FRM A;  3PJR A;  4A3L J;  3BQY A;  1Y39 A;  1ODD A;  1S7O A;  3TP0 A;  1FBS A;  2LP0 A;  3C2G A;  2K02 A;  3IH3 A;  1C0W A;  1JXS A;  1FLI A;  1S6L A;  2QSG X;  2VAS A;  5DYM A;  2M8G X;  4HEA 2;  1X1C A;  2QWT A;  5ICC A;  3OY9 A;  5LBQ A;  1YQA A;  4FIS A;  5DD4 A;  4Z6Y A;  2VBW A;  1F9N A;  2UXO A;  1MND A;  1ETW A;  5FFZ A;  5EGO A;  3ZOB A;  2MC3 A;  5L3B A;  3L2U A;  1HKQ A;  5ICG A;  3LSM A;  4XIC A;  3GZN B;  3PSI A;  1BW6 A;  3GTL J;  3H36 A;  5FKL A;  4CCK A;  2RKH A;  3ZMU A;  3K1M A;  3ZQC A;  5JVG F;  2EK5 A;  4MEX F;  3ANP A;  1GT0 C;  2ME0 A;  5CPR B;  4L9V A;  2H1K A;  3K4C A;  4UUT A;  2CV2 A;  4L5J A;  4KDP A;  5M5X J;  1X3U A;  4BE2 A;  3FX3 A;  1PUE E;  1DPR A;  2F4I A;  3BTJ A;  1T2K A;  3KPH A;  3VB2 A;  2FOK A;  3VFZ A;  4CGR A;  4P9U A;  5L3G A;  1B72 A;  2PJP A;  1SGM A;  1I27 A;  3JRH A;  4KN4 X;  2DMU A;  1U9N A;  3NS4 A;  3QU3 A;  1K4T A;  5F0F A;  4A3F J;  1RET A;  5EGO B;  3CCL I;  5D19 A;  4GCT A;  3BRO A;  3GW2 A;  3QPH A;  2K5C A;  4MFE A;  4L9N A;  3V7C A;  2NVQ J;  1W1W E;  4LLL A;  2M7A A;  2V79 A;  4ENN A;  3GTG J;  2EBI A;  3DLA A;  4HX8 A;  5B5E C;  1GHC A;  3RDI A;  2CFX A;  2FBK A;  3OIP A;  2RGV A;  5JFR A;  3E6M A;  1YOV B;  4II2 A;  1SEU A;  3ZCO A;  2E1M B;  1H8A C;  3OMY A;  3HYI A;  4WWC A;  3NWS A;  4BHC A;  4UVB A;  4IKF A;  4AID A;  5IT9 K;  3BJB A;  5CXI A;  2K85 A;  1EF4 A;  1NG7 A;  3GFL A;  3OIQ A;  2XV4 S;  1IXC A;  1TWC J;  2PMZ N;  2HEO A;  1P7I A;  5FKK A;  2QWW A;  1QU3 A;  3HRM A;  1X19 A;  2OZU A;  2Q24 A;  3KP7 A;  4XKV A;  3D1N I;  4NQW B;  1IW7 F;  5AON A;  5IT9 Z;  2PJR A;  2M4K A;  1X1A A;  2P6S A;  4UVC A;  1FSE A;  1QQI A;  3K4M A;  4U0V A;  2K3P A;  3CRJ A;  2P6T A;  1WI9 A;  4IHX A;  4RMN A;  5BPD A;  1KGS A;  4BDZ A;  1K6O A;  1Z77 A;  5C4X J;  2GIZ A;  5DD8 A;  2G7S A;  3OYA A;  1WJC A;  3NPI A;  3QOD A;  3ZR8 X;  2WAF A;  3BR1 A;  3DWL E;  3S3M A;  2DDB A;  2W00 A;  2W53 A;  1YJW I;  3JR9 A;  4KIB A;  3MEX A;  4MHG A;  2DQL A;  4YFN F;  3RPU D;  2IGK A;  3CUO A;  3GUD A;  4XKB A;  1YE9 A;  3HOV J;  4ZDP A;  2JRM A;  4QPO A;  5ERI A;  1K7A A;  2F4M B;  2K40 A;  1SC7 A;  5M5W J;  3FWE A;  1NK2 P;  4CDG A;  3BZK A;  1PDN C;  3VOE A;  4HZF A;  2XGX A;  2LC2 A;  2ZKZ A;  2M0C A;  3BR3 A;  2Z5U A;  3TBI A;  3TW7 A;  4DJA A;  2IVM A;  2EIL H;  2COB A;  4RAF A;  3V7R A;  4XOT A;  2XAF A;  5AQC A;  1J0R A;  1OCO H;  1KA8 A;  1XC5 A;  4XN3 A;  4D9J A;  1UG0 A;  4RB1 A;  3WHC A;  5HNH A;  2R7D A;  2G7G A;  5HAW A;  2NYX A;  3DPU A;  3CO7 C;  2DXI A;  5EEA A;  2DLL A;  2EIK H;  4G6T B;  1Y1V J;  1A31 A;  3VW1 A;  2X51 A;  2Y69 H;  2GQQ A;  2M7B A;  4HX4 A;  4RM3 A;  2LDU A;  4IQJ A;  1WRJ A;  2QEN A;  1VFC A;  5D5U B;  2IP2 A;  3V8K A;  2MLG A;  1PP7 U;  2P8T A;  3FK6 A;  2NVX J;  3BJ6 A;  1Z6T A;  4BDY A;  2RHA A;  2ISY A;  2R5Z B;  3Q9S A;  1OR7 C;  1LE8 B;  3BQZ A;  2Q8K A;  2AO9 A;  3C18 A;  2CV0 A;  3KX2 A;  1IDZ A;  1IC8 A;  1HBX G;  4A3G J;  1VZ0 A;  1SAU A;  2IJL A;  2IS4 A;  4I2O A;  2DTR A;  2UUZ A;  4KMF A;  3H3V K;  2OA4 A;  1FOX A;  2RV8 A;  3VW0 A;  1OPC A;  2NXN B;  2ECB A;  3DXJ F;  1KQ0 A;  1WVR A;  2EZI A;  4MGR A;  4XLP F;  2F5C A;  5FD5 A;  1ZRD A;  2LKS A;  2RAS A;  3HPG A;  3VTI A;  4BBR J;  5HVQ C;  3L2C A;  1HA8 A;  2ISZ A;  2ZNZ A;  3BDD A;  2LG4 A;  3BRU A;  5D6F A;  4NBQ A;  4XQF A;  3FIS A;  4II3 A;  6PAX A;  3FDY A;  5JI6 A;  2X0L A;  4RLQ A;  2EZL A;  4O3M A;  4UVA A;  3H5R A;  2E71 A;  5GPC A;  1S72 I;  4IRG A;  3O8H A;  4UV8 A;  3S2D J;  3DPL C;  5LLQ A;  4XRM A;  4IOC F;  1ZGW A;  2RVC A;  1LFU P;  1IN7 A;  1P4W A;  1SFX A;  3ECO A;  2LYC A;  3RTR A;  4XMY A;  1PYV A;  2WAE A;  4A12 A;  4YEJ A;  4KN7 X;  3DTE A;  4A0Z A;  5IOY A;  3OYF A;  4XKC A;  3KCC A;  1T08 B;  4HA8 A;  5DUK A;  4CCL A;  2VQL A;  1K4S A;  4CYD A;  3IUO A;  3HOT A;  2V1X A;  3TO7 A;  5F27 A;  2L9R A;  3WGG A;  1REP C;  2GOX B;  1TL8 A;  1HW1 A;  2KMU A;  2LR8 A;  4YIF A;  3CC7 I;  2HFH A;  1FP1 D;  1BI2 A;  4K2E A;  3COA C;  2DMP A;  1BA5 A;  1H9T A;  3GTQ J;  4DIQ A;  4XLA A;  1OYI A;  3S1N J;  4P96 A;  4YEL A;  4BE1 A;  1N25 A;  3KYL A;  4HNU A;  2VT3 A;  1WWX A;  3S14 J;  1B9M A;  2DFH A;  4NUB A;  2X1D A;  2ZME A;  2FNA A;  4I6Z A;  2HR3 A;  2V1U A;  3BG5 A;  1ETK A;  4C9Y A;  4JL3 A;  1XGS A;  3I0T A;  4GO1 A;  2GXB A;  1GDT A;  3HG9 A;  4BE0 A;  4JNN A;  2ZJR F;  2NOG A;  3NQO A;  3WU0 A;  1O7F A;  1P7J A;  2OCC H;  2X4H A;  3T0Y A;  3HB9 A;  3CMM A;  2KRF A;  3KP5 A;  1ON2 A;  4FE7 A;  3RQI A;  2NS8 A;  4I0B A;  2FBI A;  2XRN A;  1GVD A;  2F48 A;  3SFZ A;  3VSL A;  2YVX A;  3NXC A;  1VQN I;  4E7I A;  1GLN A;  3CMY A;  1N78 A;  1LB2 A;  2E7W A;  1W0U A;  3E5Q A;  2MG4 A;  1CF7 B;  1S7A A;  4B47 A;  4XRF A;  4BHB A;  2LF7 A;  5BNG A;  3CES A;  1DU0 A;  4A3B J;  3CDI A;  5D5W B;  4RLF A;  5FB2 A;  3TQN A;  4ENJ A;  1F4K A;  4WX9 A;  2DTZ A;  3G1L A;  4M6V A;  4RBO A;  2FJ1 A;  3ABK H;  1WQ2 A;  4AD9 A;  1S7E A;  4N9H A;  1V55 H;  2ZNY A;  2F5D A;  2K4J A;  1R9T J;  1IXR C;  3HTH A;  3I5U A;  1TT5 B;  2V1N A;  1LVA A;  3F23 A;  4NN1 A;  1W5T A;  3RKY A;  1RR8 C;  4NB5 A;  2DA3 A;  3HC7 A;  4AYB N;  1SMY F;  2BYV E;  5D4S A;  1H89 C;  4LD5 A;  3KIO A;  4MXM A;  3KEY A;  3HTS B;  5A2Q Z;  1R22 A;  3SQN A;  2X1E A;  1BIB A;  2DI3 A;  1Y0N A;  2P5K A;  4MEY F;  3WTX C;  2L7Z A;  3I9V 2;  4WK8 F;  1UJ8 A;  2E60 A;  2AXL A;  1MW7 A;  3DU5 A;  3VWB A;  3C7J A;  2ZSH B;  5DTD A;  2KIU A;  2B0L A;  3DKW A;  3S3O A;  2YUS A;  2GUH A;  3WG7 H;  3H92 A;  2EV5 A;  5A2Q K;  2P81 A;  2GZW A;  1GV2 A;  1MDM A;  2A6E F;  1R5H A;  3PL8 A;  1FIP A;  1XB4 A;  3TKY A;  4BYY A;  2WWY A;  4KNY A;  4M71 A;  2KQR A;  2EFP A;  3L00 A;  1EJ9 A;  1R00 A;  1HLV A;  5KCM A;  2YS9 A;  3AFH A;  2OER A;  4AM3 A;  1J7K A;  1HKS A;  3TDZ C;  2VXD A;  3FM3 A;  3SHF A;  3PPB A;  3KP2 A;  2W1O A;  3K1P A;  2JSC A;  3TGN A;  3WOD F;  4UB8 C;  5LGU A;  1JGS A;  2IA2 A;  2HU9 A;  2O3F A;  3MWM A;  1PP8 F;  1FBQ A;  5GTI C;  5K7H A;  5E8G A;  1P92 A;  1FSH A;  1V5G A;  2XDV A;  2HKO A;  1J09 A;  2IGM A;  2K7L A;  4LGW A;  5HOD A;  2NNN A;  2TDX A;  1YG2 A;  5F6F A;  4A0X A;  3D5R C;  3CUQ B;  5ILV A;  1O4X A;  4BNC A;  4PJL A;  5IP7 J;  4A0Y A;  1JUM A;  5D5V B;  2R0Q C;  2JA7 J;  5K7Z A;  1DDN A;  5FD6 A;  1IAW A;  3FXM A;  4LIT A;  5FRO A;  1T0F A;  5J1R A;  3K2A A;  3LAJ A;  3E7Q A;  3IAS 2;  3KYC B;  3TW6 A;  5C4J J;  2BY1 A;  4HST A;  1RI7 A;  2BVM A;  4M72 A;  1MBH A;  5GP9 A;  4A5N A;  5BPI A;  1MMA A;  2EQR A;  2K3F A;  2K9L A;  4LB6 B;  2H09 A;  3MZH A;  2JVH A;  5IP9 J;  3KP6 A;  4BQA A;  1QNT A;  3EUK L;  3HTU A;  3ABT A;  3VYS B;  1ZGJ A;  2IRF G;  2ZXI A;  3A4C A;  3DBH B;  3AG2 H;  4E4H A;  3NAU A;  4EJT A;  5F64 A;  3AG4 H;  3MZ8 A;  2DOA A;  4A6D A;  2DA4 A;  4M6Y A;  3ON2 A;  1YRN B;  1W7P A;  4B1R A;  1JJ8 C;  1RKW A;  1TNT A;  1PJR A;  1JE8 A;  1LQ1 A;  1AKH B;  1UAA A;  1XN7 A;  4ETS A;  1BOB A;  4CCO A;  4NC8 A;  2L4M A;  3OSG A;  2HZT A;  2DPU A;  5C4Y A;  4ESF A;  2EIN H;  1VTN C;  4ZTJ A;  3KNW A;  3F22 A;  4PJM A;  4YZE A;  1TW3 A;  1WJB A;  2K27 A;  2HYF A;  1Z91 A;  1I5Z A;  2MH9 A;  4LIU A;  2DFE A;  1R49 A;  2LLK A;  2XPU A;  3UKG A;  4MFD A;  4OD4 A;  1IRF A;  2NS0 A;  1Z21 A;  2GLO A;  4E7Z A;  2CQQ A;  1WFX A;  3K9T A;  4IHV A;  1VQ6 I;  4I7H A;  5LEK A;  4MK6 A;  1FOY A;  1YS6 A;  2ESN A;  1MKM A;  2GAU A;  4XR6 A;  5E8I A;  1IV6 A;  2VOP A;  3A0B C;  2IGO A;  2JWT A;  1X4O A;  3BWG A;  3OYI A;  1BW5 A;  2ZFU A;  1RES A;  1MDM B;  2VLA A;  3DEW A;  4ITV A;  1BBY A;  5D4R A;  5GAH J;  2XPW A;  1HW5 A;  4DYC A;  3LSG A;  4EJV A;  5H20 A;  3A01 A;  3OV8 A;  3HUG A;  4UUV A;  4AU7 A;  2QSF X;  4Q47 A;  1SD6 A;  2D1H A;  2L3D A;  5AIP A;  2VKV A;  2ELJ A;  3GO5 A;  1X58 A;  3ASO H;  3ISP A;  5EZH A;  2VE9 A;  1TWA J;  2XAJ A;  3F8C A;  4OOI A;  1YFH A;  2DK8 A;  1IGN A;  1OCP A;  2FJI 1;  3T6N A;  4DZJ A;  4TV7 A;  1D3Y A;  4S0H B;  1AOY A;  3JTH A;  3L2V A;  2OV7 A;  3PSF A;  3I64 A;  3HHG A;  2M5W A;  2RRE A;  5LGT A;  1VQ8 I;  3F1B A;  4EM1 A;  3WE3 A;  4BEH B;  2Q1Z B;  3MKW B;  5L3F A;  1FIA A;  3DV8 A;  4MLO A;  2ZC2 A;  5FKO A;  3ZQ7 A;  4XSZ F;  2BBY A;  2LBF B;  3OSF A;  1JJ6 C;  2JSP A;  2BY2 A;  2ID6 A;  5F0C A;  2VJ5 A;  1T8I A;  3MKZ A;  1XMA A;  4CIC A;  2HDC A;  4G12 A;  2K86 A;  2VPL A;  4FET A;  2L9S A;  2F07 A;  5CJ9 A;  1TTY A;  2L5Q A;  3KE2 A;  3OYK A;  2FXA A;  3VYR B;  3I4P A;  2EFN A;  3BPV A;  4IOA F;  2NS7 A;  3F8F A;  2K9N A;  4BS9 A;  2PG4 A;  3PIO F;  3DF8 A;  2O03 A;  3KZZ A;  2MC4 A;  2YPR A;  3WTZ A;  3VOD A;  3ZN0 A;  2AXT C;  2EWN A;  1UI5 A;  3ONQ A;  3BCG A;  3DEE A;  2MYS A;  4RDU A;  2CQ7 A;  2L02 A;  4R1H A;  4J01 A;  4B44 A;  2WBM A;  4OIO F;  2HNH A;  4CUG A;  1B6A A;  2KL4 A;  4I98 B;  3GVA A;  2UXI A;  3ECH A;  1YYV A;  3AQT A;  3PNV A;  3FKI J;  3BG9 A;  1FTZ A;  3QBM A;  9ANT A;  1J5Y A;  2A6H F;  4M3E A;  5EEH A;  2HKX A;  4WXD A;  5CVU A;  3U1K A;  4Q48 A;  3WTU C;  2EV6 A;  3QP6 A;  4G6Q A;  3IH2 A;  3BR5 A;  4IRI A;  3SDG A;  1E17 A;  4BQN A;  1N75 A;  2E1N A;  2NVU B;  2ETH A;  2ZME B;  1QPI A;  2XC7 A;  4BY1 J;  4DBR A;  3ZQQ A;  1B4A A;  3RI4 A;  2PQ8 A;  4G9Y A;  1WH7 A;  4IPA A;  1U8R A;  4A2U A;  3HRU A;  2CQK A;  1R23 A;  4L18 B;  3VIB A;  1WGX A;  3K69 A;  1ETO A;  2EPF A;  5J4V A;  2VC0 A;  2GXG A;  4B43 A;  3B81 A;  4JOM A;  5LHI A;  1G3Y A;  4D5F A;  1U9O A;  4BJT A;  1U2W A;  1YI2 I;  2QQ9 A;  3LFU A;  1WSU A;  1AWC A;  1HCR A;  3COL A;  1POG A;  5C44 J;  4WF2 A;  3R6S A;  4UY8 I;  2VKE A;  3RQ4 A;  2A61 A;  2KHM A;  5CVJ A;  4Q4Z F;  1TQI A;  3ABL H;  4IO9 F;  3EET A;  3WU1 B;  3CMA I;  2LKP A;  2VN2 A;  4PJJ A;  5J3L A;  2UXU A;  3GEU A;  2VQC A;  4M74 A;  3W2A A;  2RDP A;  2HQ5 A;  1JTY A;  1WCM J;  1ZG1 A;  2G0E A;  2I10 A;  1KYW A;  3B6A A;  2V1D A;  1V4R A;  3FRQ A;  1MBK A;  2JUC A;  2IS2 A;  3KP4 A;  2Y9Y A;  3V78 A;  1LFP A;  4ESB A;  4AVP A;  1T39 A;  2V9V A;  2STT A;  1TWF J;  3WGH A;  1X2N A;  3HOW J;  4EGZ A;  3NNR A;  4AC6 A;  2YX7 A;  2R5Y A;  1RUN A;  4LG3 A;  3VOK A;  1UHM A;  5K5R A;  4PSX A;  2LTP A;  1VQ7 I;  4Y33 A;  1G4D A;  4GCL A;  3J7Z I;  2A05 A;  4CXF A;  1O7L A;  5TJJ A;  2ZXH A;  2Y0S A;  2QQB A;  3FMR A;  1MMD A;  1KZH A;  3GFJ A;  2QCO A;  1U3E M;  5H2F C;  1R6R A;  1CGP A;  2CQN A;  4DNC A;  4LFU A;  3GTP J;  2VIX A;  3QPS A;  2TCT A;  1JGG A;  2ME6 A;  4JBA A;  3HPH A;  3TDU C;  5E1Z B;  5GAD J;  3CLQ A;  4LJZ F;  3ULQ B;  5EG0 B;  2JT1 A;  1IDY A;  3Q0U A;  1S3J A;  2XHK A;  2RNJ A;  1Z67 A;  1TC3 C;  3FXU A;  3BTL A;  3VYU B;  1ZN2 A;  5KNL A;  2DMT A;  3X2Q H;  3GEZ A;  5HLT A;  1GV5 A;  2DT6 A;  4CHU A;  1MBJ A;  1EA3 A;  2DW4 A;  2XRL A;  3ZMT A;  2QKO A;  5CVV A;  5KK1 A;  2KIF A;  2CMP A;  1QBJ A;  4YII A;  5GTH C;  2IW5 A;  2PZ9 A;  3G7R A;  2A2F X;  2V9K A;  2CSO A;  3LOC A;  3GTO J;  5IT3 A;  1ZG3 A;  3MN2 A;  3OYC A;  1Q1V A;  4GXO A;  4IHT A;  2MH2 A;  5JLW A;  1ZR4 A;  5FHP A;  3Q3S A;  3RYP A;  3HHH A;  4DYR A;  1KQ8 A;  1OYY A;  2V7F A;  2H6C A;  1OFC X;  1UG2 A;  2IEK A;  2PMZ A;  5E79 C;  3G56 A;  2UXX A;  4ON0 A;  1IUF A;  5TRD A;  1IUY A;  1FPQ A;  3SJM A;  3D5S C;  2E19 A;  1U5T A;  3K4K A;  4MQ9 F;  4CCM A;  1XDS A;  1O3S A;  2WA0 A;  2GEN A;  4RB0 A;  4I09 A;  4B4C A;  4QSH A;  1ON1 A;  1D0Y A;  1IN8 A;  4YIR X;  2NX4 A;  2DJI A;  2LRE A;  3PUB A;  4EGY A;  3E5X A;  1D5Y A;  5GAG J;  5BMZ A;  4BJ6 C;  3MZY A;  5FFX A;  4F3Q A;  2IA0 A;  5HS7 A;  3ML6 A;  2JN6 A;  2V4J C;  2DMN A;  1HKT A;  5E3N A;  2O7T A;  2G3B A;  2HTS A;  3I55 I;  3O3K A;  3HGG A;  4HYE A;  1XMK A;  2Z99 A;  3HKZ N;  4C2M A;  1R5G A;  4NQW A;  2R5Y B;  2BV6 A;  1XGN A;  2E36 A;  2BW3 A;  3CO6 C;  3WG9 A;  3E3V A;  2W48 A;  3CP2 A;  5H6R A;  4U87 A;  3HRT A;  5J1Y A;  1SFU A;  4LMY A;  2F5E A;  5KAI C;  1T38 A;  2JRT A;  1ZH5 A;  4Z2Y A;  3ZMV A;  3BG7 A;  4XON A;  2DPD A;  3H9G A;  2PBI A;  3N4M A;  3G71 I;  5FMP A;  3H5N A;  4Y15 A;  4X0G A;  3PO2 J;  4BU2 A;  3A01 B;  5D8L B;  2IXS A;  1R58 A;  2VON A;  3ZRG A;  1Z7U A;  2CRG A;  1QHG A;  4Y52 J;  2HYT A;  2BHY A;  1QHH D;  1A04 A;  1T98 A;  3TOB A;  1J75 A;  3WGI A;  2DJN A;  4XK4 A;  2EZK A;  3A2K A;  3OYG A;  1OIS A;  2FU4 A;  2M1B A;  5F0H A;  3K6G A;  2ZJQ F;  2GM4 A;  2E1O A;  2QQ8 A;  1LDK B;  2DG7 A;  3LSK A;  1PUF B;  4BAC A;  3EDP A;  3TL4 X;  1UB9 A;  5K58 A;  2L7F P;  1LDJ A;  4HNV A;  2IPQ X;  1BR4 A;  3GZI A;  3R0A A;  3BZC A;  2VB6 A;  5IYD J;  5FKM A;  1DPU A;  2X6O A;  1G59 A;  2JA5 J;  4ASN A;  2KZV A;  3R61 A;  1HC8 A;  2D6Y A;  1LEA A;  4A93 J;  3KZY A;  4I0A A;  1BOA A;  1SD7 A;  2DG8 A;  3PNY A;  2HQN A;  4RB3 C;  3G4S I;  1SD4 A;  1MJB A;  2X48 A;  4XL9 A;  3VOX A;  1WJ5 A;  1HSJ A;  2HQR A;  3KZ9 A;  1SFO J;  3OS2 A;  3F6V A;  4F93 B;  3KKD A;  1OJL A;  2BZT A;  1DGW Y;  2HVS A;  3HTA A;  4B3A A;  4HV6 A;  1BC8 C;  3H0G J;  3I54 A;  2WY7 Q;  3C1D A;  1VQ9 I;  4CYC A;  3CJD A;  1MNE A;  2A6T A;  3HM5 A;  3PQJ A;  2VOD A;  4QWQ A;  5KHD A;  1VQ5 I;  1D8J A;  4F92 B;  4EM2 A;  1T95 A;  3RZO J;  2DBB A;  3ESW B;  4OIN F;  4RM2 A;  2DA5 A;  4D1Q A;  5FGM A;  3MKL A;  2M4G A;  3F21 A;  5D18 A;  2VC1 A;  3S2H J;  4U9N A;  3UNG C;  1YHQ I;  1K78 A;  1IG7 A;  1TP4 A;  3WTS C;  2DDA A;  3VW2 A;  3PM1 A;  2COM A;  4IHY A;  1A6I A;  3LSR A;  2F2E A;  1TWG J;  2XUB A;  3A0H C;  5E17 F;  1OCT C;  1G6N A;  1R1T A;  2D2W A;  3D0S A;  3IRR A;  1Z05 A;  5FRN A;  3JRI A;  2BY3 A;  3GWZ A;  4MQV A;  4ME9 A;  3HE0 A;  3GLL A;  4HF2 A;  2FRH A;  4UUS A;  5F08 A;  1ZRE A;  1Y8R B;  3ZMS A;  3JAM Z;  4CGZ A;  4BXX J;  2CQX A;  2LRD A;  4XOP A;  3K4N A;  4DZP A;  4A5M A;  2X9D A;  4M9X A;  4IJA A;  3W6V A;  5EFY A;  2H6B A;  2ZOZ A;  1X3Z B;  4ZC3 A;  3RJP A;  1MBF A;  3FZV A;  4AIK A;  1WZ2 A;  3RKW A;  4R79 A;  3P5J A;  4BXU A;  5F1J A;  1YIJ I;  4X6A J;  3HUG B;  1ZAR A;  3P9C A;  1JT6 A;  4F91 B;  2ZCX A;  3RPQ A;  2QQA A;  1D1A A;  3I53 A;  5EF6 A;  2LF8 A;  1BJZ A;  3DKY A;  3AL0 C;  2VJJ A;  3IH4 A;  4ZDL A;  1NTC A;  3JSO A;  2HOT A;  1RKT A;  3FBN B;  4LG0 B;  2DOF A;  1T33 A;  4PK4 A;  4HV5 A;  1DP7 P;  4CYC B;  2V57 A;  4HDU A;  2V6E A;  1W7P D;  3MQ0 A;  2EA2 A;  2QUF A;  2KIM A;  1IO2 A;  1RR7 A;  2HS5 A;  2QKM B;  4PUS A;  5B3S H;  2F6C A;  2OUM A;  3HIF A;  5J8C A;  3K4J A;  2Z33 A;  1SFE A;  3H5A A;  4LK1 F;  1M1E B;  2AQF A;  4WCG A;  4G7H F;  3IAM 2;  2R3S A;  2NVT J;  4HSR A;  1YTY A;  4HAM A;  3S5R A;  1U6G A;  5LFA A;  4UXN A;  2XF6 A;  5DAJ A;  4RAG A;  4KIF A;  4A6E A;  3M1E A;  3ON4 A;  2EJR A;  2Y30 A;  3WTT C;  5FJ8 J;  4HRI A;  2WTE A;  1UST A;  2DFF A;  3Q0V A;  1NHA A;  2DO7 A;  2P4W A;  3R60 A;  2Z16 A;  1MBE A;  1JHH A;  1WJE A;  1FC3 A;  1YJN I;  4PDK A;  1MH4 A;  5E1W A;  5JHU A;  4GFK A;  3B02 A;  2Q2E B;  4CSW A;  3FIW A;  3MVP A;  4RS8 A;  3M8F A;  2H94 A;  2KJC A;  3OYD A;  3JSP A;  1KON A;  3WHB A;  3QYB A;  3JCU C;  3OYB A;  2M45 A;  3CJR B;  2WUI A;  3BR0 A;  3FXQ A;  3HBL A;  4E7S A;  3K1N A;  4U7B A;  1LVK A;  4KUM A;  5IYC J;  1HOM A;  1HW2 A;  3EYI A;  2JA6 J;  2FF4 A;  3BCB A;  5B66 C;  3L09 A;  3W6K B;  3PNT A;  4A3I J;  4PXI A;  1P4A A;  1OYW A;  5L3D A;  1Z7L A;  1IRZ A;  1I6X A;  2QTQ A;  3LFK A;  3QPT A;  2OPT A;  2X6W A;  5H9T A;  2PMU A;  1MZB A;  1QO0 D;  1XG1 A;  1DQU A;  4EMS A;  2PFV A;  4RAZ A;  1YW8 A;  3K4L A;  3U2R A;  3SXY A;  2DAO A;  3OYH A;  5FLV A;  5C3E J;  2R7O A;  4L9J A;  2FBH A;  3MD2 A;  2KDO A;  3TED A;  1VQ4 I;  2ECC A;  3E5U A;  1MD0 A;  3LA3 A;  3QQA A;  5BS6 A;  3OYE A;  2JQ7 A;  4GDF A;  1R4M B;  1R36 A;  2OU2 A;  2W84 A;  1HF0 A;  2LNB A;  1Z0X A;  3ZN1 A;  5D1R A;  4EVI A;  3VUQ A;  3RKQ A;  1HDP A;  1E3P A;  3F0C A;  1FMW A;  1JUS A;  2W82 A;  3CJQ B;  2X6Y A;  4XKW A;  3LMM A;  1U5T C;  1XSX A;  2VT2 A;  1D1C A;  2EA4 A;  5D5X B;  2R5Z A;  4A3E J;  4A3D J;  2QF7 A;  3JTG A;  2PLY A;  3FHN A;  2VJ4 A;  2R7X A;  1KQ9 A;  5EG0 A;  1MMS A;  4V19 K;  3HL2 A;  4D7M A;  2KT0 A;  2RN7 A;  4ZTF A;  3ZQF A;  3JRG A;  5ILU A;  1QVT A;  1ZR2 A;  1MSE C;  4M3B A;  4KYW A;  1HQC A;  1I1S A;  3PAS A;  2QZ8 A;  2V26 A;  4B3X A;  1IZ1 A;  4P1W A;  4JQF A;  3MFK A;  3ERE D;  1OMI A;  4MTD A;  2PFB A;  4HLX A;  1F1Z A;  3F9K A;  3CCS I;  5JR3 A;  5D8K B;  2LY2 A;  1FX7 A;  2XAU A;  1JKP C;  1MNM C;  3I56 I;  3ERM A;  1SVO A;  2DA1 A;  2MGQ A;  3EUH A;  3ZQH A;  2EFO A;  3BPX A;  2AHQ A;  4NC6 A;  4IZZ A;  2R7U A;  4XLN F;  1ACI A;  4OD5 A;  4NC7 A;  4AIJ A;  3W2V A;  3H3Z A;  4JK1 X;  4PFO A;  2ZO4 A;  2L0K A;  4IHW A;  5DV5 A;  1I3Q J;  4V2G A;  3T8T A;  4OU0 A;  4XN0 A;  4OMY A;  3BCA A;  2BXZ A;  2ZBK A;  1ORK A;  4IRH A;  1R1V A;  2R93 J;  3E6D A;  5J40 A;  3P9T A;  2Q2E A;  3FF5 A;  3S15 J;  4A3K J;  4M73 A;  3QRF F;  2E2J J;  1X4P A;  3IL2 A;  4C2M J;  4S04 A;  2DQR A;  3J80 Z;  4OIQ F;  3B73 A;  3I58 A;  3L2W A;  3LSP A;  3LAP A;  1TZL A;  1TWH J;  3DFG A;  1ZGA A;  3DBL B;  1QZY A;  1ZTR A;  3QOE A;  4FHT A;  3T8R A;  5CXG A;  5BOX A;  3JSJ A;  3O8G A;  2R4G A;  1QVU A;  1Z1D A;  2ID3 A;  2M8E A;  1ZRF A;  2L2O A;  3HEF A;  4FQG A;  4AYB A;  3ZQG A;  1L0O C;  1GXP A;  3GX4 X;  2MBF A;  4XLC A;  1HXD A;  1YX3 A;  2KDZ A;  1XD7 A;  3LQR A;  3CDH A;  4IEJ A;  4OIP F;  1K6Y A;  2UZK A;  2CGP A;  2W57 A;  1XX5 A;  2LK2 A;  3J7Y J;  3FXL A;  3SZP A;  2OD5 A;  1UHS A;  2RQP A;  2XIG A;  4D5C A;  2KFD A;  2OI8 A;  2DOE A;  2BY0 A;  3CDL A;  3PFI A;  2O5R A;  2ZFW A;  4AVZ A;  3OR2 C;  5FLX Z;  1B1B A;  1FYK A;  2JA8 J;  3SWH A;  2CW7 A;  4ZDO A;  4GFB A;  2XSJ C;  1F43 A;  3FHZ A;  2XF5 A;  3BZ6 A;  3OYN A;  3H9Q A;  2LY9 A;  5DDG A;  1IN4 A;  4NDL A;  4BQO A;  2FNP A;  2VKH A;  1E3O C;  2MFZ A;  1NH3 A;  5M3F J;  2MD5 A;  2CG4 A;  3K70 D;  2DT5 A;  3CJN A;  5E20 A;  5HLG A;  1JKO C;  2QOP A;  4DQ2 A;  3LHQ A;  2Y48 A;  4N0B A;  2M34 A;  1ZAO A;  1EV7 A;  4F55 A;  5CW8 A;  2O8K A;  2O61 A;  1T6S A;  3WE2 A;  5J47 A;  1TNS A;  4HBL A;  1PUF A;  4FX4 A;  2FMY A;  3HZJ A;  4HQM A;  2QSH X;  2DA6 A;  3E7L A;  3MAJ A;  2DN0 A;  1DUX C;  4A3M J;  2PEX A;  4GCV A;  2MW8 A;  4G94 A;  4A69 C;  3L1P A;  4E70 A;  3LL7 A;  3MCZ A;  3DPJ A;  4U9L A;  1I39 A;  3SYT A;  3R0J A;  1ZLJ A;  4WXC A;  2XDN A;  3GTK J;  4FE4 A;  4IVN A;  5JLX A;  4BL0 B;  1A35 A;  2NOJ B;  1IF1 A;  2KRC A;  4U0W A;  3CCV I;  2R7Q A;  5E18 F;  2M0M A;  1KU2 A;  5LEJ A;  3ZXS A;  1Z9C A;  1B9N A;  3G1M A;  4KIS A;  4A3J J;  3S1Q J;  4P9F A;  5TIS C;  2BGC A;  2O0Y A;  2A69 F;  1XS9 A;  4HF0 A;  3AG3 H;  1J9I A;  5DM7 F;  1HDD C;  2WAD A;  1UI6 A;  2W4S A;  1UZC A;  2CUE A;  3FK7 A;  3CC4 I;  1YX5 A;  1FT9 A;  3IP4 B;  4UNO A;  5LGN A;  3MNL A;  4F7Z A;  1ONV A;  3BY6 A;  5L3E A;  2DT7 B;  2CUZ A;  3FXJ A;  1FBU A;  5B1B H;  1U8B A;  3IRQ A;  3BC8 A;  3U21 A;  3IV5 A;  2P7C B;  5AIQ A;  3CTA A;  5E1X A;  5J4Y A;  1ETY A;  4UV9 A;  1OLT A;  1KU9 A;  3V7S A;  2YU3 A;  4G6D A;  2IS1 A;  1X1P A;  4WXH A;  2ACJ A;  3O6B B;  3BTC A;  1Z6R A;  2K9M A;  2FOW A;  3IHU A;  2C6Y A;  2OCE A;  2K4B A;  1VQM I;  3LST A;  2L7M P;  1X2M A;  2G7U A;  3I59 B;  5DCM B;  2J5O A;  1ITY A;  5K5Q A;  3DEU A;  5L3C A;  1XDU A;  2XSD C;  3F8B A;  4L9T A;  4X1E A;  1B8I A;  5HDN A;  1D0X A;  1I1G A;  4I99 C;  1LPQ A;  1D5V A;  4GFL A;  5E3M A;  2XGC A;  4O5V A;  4W1U A;  3H9J A;  1NK3 P;  3S17 J;  1B59 A;  2R7T A;  2PBX A;  1MGT A;  2H1L A;  4ENM A;  3TOA A;  3G6E I;  1VI0 A;  5IP6 A;  2JPB A;  2XPV A;  5M5Y J;  1JKR C;  2DFI A;  2Z1D A;  2E1C A;  4ESJ A;  3TO9 A;  2LKX A;  3H0D A;  1J2X A;  4H4K C;  4HW0 A;  5LD2 C;  1VQK I;  3PFY A;  4UUS B;  3FXR A;  2LSO A;  2VXZ A;  2XGE A;  3HSF A;  2NRA C;  3KZI C;  3FMQ A;  3K8P C;  3AAF A;  4RGS A;  3NEU A;  3JRD A;  4HNT A;  2A5W A;  4L5I A;  5ICE A;  4DVY P;  4P55 A;  2BHZ A;  4KIC A;  4GGG A;  1K78 B;  1BL0 A;  3ASN H;  3HTI A;  2L54 A;  2NNY A;  4M9S A;  1S29 A;  3OS0 A;  2G7L A;  1L3L A;  3PIP F;  1V54 H;  1YLF A;  1FNN A;  3A02 A;  2CJJ A;  4ZYG A;  2A3S A;  4FAS D;  2BW3 B;  4RGU A;  2OTL I;  2QBY A;  1QGP A;  2B7E A;  1EH8 A;  1USS A;  1VQO I;  4XNF A;  3RCO A;  1U5T B;  1JHF A;  1RC9 A;  4IRV A;  4N4N B;  2GA1 A;  4HOB A;  1IRX A;  1W7P B;  3CCR I;  1XSV A;  1XTA A;  3HDD A;  4C2T A;  4XM3 A;  4HKU A;  4PJN A;  2Z3Y A;  5H6Q A;  2ZCW A;  3OWT A;  2STW A;  3I4M J;  1ZRC A;  2CYY A;  1BIA A;  2E1M C;  2WB1 N;  2DCE A;  2DOD A;  1Y56 A;  2HDW A;  2R7W A;  2GIV A;  2W24 A;  1TQM A;  3RIR A;  2FBQ A;  3CD6 I;  2GA2 A;  2LVS A;  2A07 F;  1ZHF A;  2ZXW H;  3JRB A;  2H27 A;  4EQQ A;  2E2I J;  5FO5 A;  2REK A;  3P7N A;  3NWT A;  3A03 A;  2VBZ A;  1LDD A;  3EUH C;  1QZE A;  3M7G A;  4EEF G;  1RIO H;  1H88 C;  2DMQ A;  3J81 K;  4JX5 A;  5EJC A;  4E6K G;  3IWZ A;  2MA3 A;  4N9I A;  3KP3 A;  2L9N A;  1STZ A;  4EJO A;  4N4O B;  2G7H A;  4F52 A;  3ABU A;  3CUQ C;  2DYS H;  4O6J A;  2W25 A;  4CCJ A;  2HTJ A;  4JYK A;  2P7V B;  2L7K A;  1RPW A;  4XSX F;  3CF5 F;  2TRT A;  4M6X A;  4XID A;  5HNF A;  2F5V A;  5DCF A;  1LFB A;  2DYR H;  2WAQ N;  1RUO A;  3HSE A;  4C30 A;  1F36 A;  4CCN A;  3S3N A;  1ETX A;  2FUG 2;  2JK3 A;  3CME I;  3QYF A;  2JMW A;  4Y3O A;  2WV1 A;  4ACI A;  1EH6 A;  1LJ9 A;  3LSH A;  1W0T A;  4ZZD A;  2I5U A;  2FEZ A;  1OKR A;  2OQG A;  1RZ4 A;  2L01 A;  4ZYH A;  3BNI A;  5CLS A;  5FKN A;  3BTI A;  1D1B A;  4QIW N;  3E0J B;  1AHD P;  4IF4 A;  4UB6 C;  2XAH A;  4NHJ A;  2B3W A;  2QKL B;  1JUP A;  2NP3 A;  2EIM H;  3QAH A;  4I02 A;  3G2B A;  3DTK A;  1MIJ A;  1BR2 A;  1VND A;  3KFW X;  1D8K A;  4BKX A;  4E7K A;  1O57 A;  2CU7 A;  4GCK A;  4IL6 C;  3HGY A;  1X3W B;  1WI3 A;  2LOO A;  3LSJ A;  3WTY C;  1SAX A;  3BJO A;  1Y6I A;  1S9H A;  1W5C C;  3CJT B;  2M87 A;  1K61 A;  4RGR A;  1QPM A;  2HYJ A;  5IYB J;  2MSY A;  3AQS A;  1FOW A;  3QU6 A;  4IQ4 A;  4FT8 A;  3IWF A;  2O9L A;  3OOU A;  2VPR A;  2ZY9 A;  2CV1 A;  2BXY A;  3ROU A;  4LLG F;  3CF2 A;  3GFI A;  2FQ4 A;  2ZCN A;  1HST A;  2Y75 A;  4IHS A;  1RNL A;  3I71 A;  2CUF A;  4L62 A;  1FWZ A;  3MMY B;  1KU7 A;  3REO A;  5DM6 F;  3CCE I;  2AS5 F;  1ZYR F;  3KET A;  3EPZ A;  3SZT A;  3C2H A;  3V8J A;  2O8X A;  2YSR A;  2CW0 F;  4BEH A;  3GZ5 A;  2BE5 F;  4LK0 F;  4D0P A;  3LNQ A;  5FLM J;  4E7L A;  2R7S A;  2KLO A;  1UEL B;  1IRG A;  3QP5 A;  2IS6 A;  2HDD A;  1YO5 C;  1T0F C;  1O3Q A;  1LEB A;  1EKE A;  4QTR A;  2F5F A;  1WH5 A;  4KT5 C;  3KEO A;  3KKC A;  4XLF A;  1MJ9 A;  4BXF A;  2XAQ A;  2XAS A;  3VDX A;  1BI3 A;  2ZJ2 A;  2EB7 A;  2YX4 A;  2HOA A;  2R92 J;  1XSD A;  3CCM I;  3R4K A;  3DCF A;  4XLH A;  4B48 A;  3I4N J;  5HSZ A;  3VPR A;  1AA7 A;  1YW9 A;  4I76 A;  1IXS B;  1FOK A;  3GTM J;  3HOZ J;  1E2X A;  2HVQ A;  3E97 A;  3VP5 A;  3P9K A;  3NRG A;  4EJU A;  3LSI A;  2R7Z J;  2YVE A;  2E5N A;  3JAM K;  2FA5 A;  3K7A J;  2CWE A;  2DU9 A;  5HLH A;  2UXN A;  1BI1 A;  2D1V A;  2E7X A;  1SAN A;  4LOC A;  2OJE D;  2RC4 A;  3EYY A;  4ENK A;  4PZJ A;  1JKQ C;  1E0E A;  1AU7 A;  3JRA A;  4ANJ A;  3S8P A;  5GPA A;  3K4B A;  2OBP A;  3BG3 A;  3W2W A;  2DK5 A;  2HPM A;  3ABM H;  2NAZ A;  2HOE A;  2OTJ I;  3SEQ A;  2XAG A;  4JX4 A;  1Y0U A;  1ZK8 A;  4C3I J;  5BQT A;  1E3H A;  1Z3Y A;  3BHQ A;  3SFI A;  2NVY J;  1YRN A;  1MMN A;  2GWR A;  1JI8 A;  1MH3 A;  3BR6 A;  3BJA A;  5B1A H;  1DU6 A;  2HXO A;  1JT0 A;  3AL0 B;  2R7V A;  4DBQ A;  2AQE A;  1V5E A;  1TLH B;  5HLI A;  4UDS A;  1G8X A;  1KU3 A;  4FX0 A;  1P2F A;  1F5T A;  1YS7 A;  5HDG A;  1BI0 A;  2IGN A;  2LH9 A;  1MSF C;  2QYO A;  1DP3 A;  1IN5 A;  3IUV A;  4C2U A;  4BY7 J;  3V8L A;  2VQH A;  3M9A A;  1P6R A;  2OAZ A;  3S2W A;  3OYJ A;  2O6G E;  2WAQ A;  4KWA A;  1TW2 A;  2WC2 A;  1XGM A;  3SDB A;  3O2P E;  1WJF A;  3VVX A;  2GOM A;  2JUG A;  3WU2 C;  2A68 F;  3GYH X;  2PJR B;  3GZ6 A;  2M30 A;  1FP2 A;  1FJL A;  3DQV C;  4MIM A;  2IAI A;  5ICF A;  3Q5F A;  3VVZ A;  2E34 A;  2BOL A;  4G7Z F;  3NRV A;  1EH7 A;  4BQQ A;  3ANG A;  1LKX A;  3K10 A;  4A3C J;  2NP5 A;  2XB0 X;  1SFK A;  1ZKG A;  3M8E A;  2KIS A;  1VQL I;  3FXO A;  1FYL A;  2QIB A;  5HBU A;  2VQG A;  3ELK A;  1WKM A;  3GFM A;  3CCJ I;  3T1B A;  1BJA A;  4HDV A;  2HI3 A;  1AKH A;  1D0Z A;  2LMD A;  4KA4 A;  1LUJ B;  4W97 A;  4B8X A;  2DA7 A;  3ZP5 A;  5F04 A;  5HDK A;  1K83 J;  1XGO A;  5EEG A;  2D5V A;  1GVJ A;  4KJZ A;  4RGX A;  3DKX A;  4YFK F;  1Y1W J;  4E7H A;  4CZZ A;  2PX9 A;  2LY1 A;  2B9S A;  4E7J A;  1QZZ A;  1BC7 C;  3DPT A;  3HSR A;  4QPQ A;  4IX7 A;  2PMH A;  4FTH A;  1S8N A;  3BP8 A;  3CLO A;  1MMG A;  3E1S A;  3GTJ J;  5KVR A;  1B72 B;  5ED4 A;  1X1D A;  2MD0 A;  2CFO A;  2P0W A;  2DA2 A;  3F8M A;  2OZ6 A;  4P5O A;  5CQE A;  5J8F A;  5JHF A;  4S05 A;  2XGD A;  1FMV A;  4XOR A;  3ZMZ A;  4XRS G;  3I3L A;  1R1U A;  2VL8 A;  2XF7 A;  1ETV A;  1PVE A;  2Y31 A;  3RH2 A;  1B8I B;  2VI6 A;  4M9Z A;  2K9S A;  3RYR A;  1O3R A;  4PSW A;  3HJE A;  3K70 C;  1GUU A;  3M4O J;  3QKX A;  4CA0 A;  3E6C C;  3J80 K;  3I59 A;  1G3T A;  5DCM A;  1X1B A;  3LJL A;  4YFX F;  2UV1 A;  3QWL A;  2ICW G;  3QOP A;  4ABZ A;  2UXP A;  4H0E A;  4RB2 C;  3PO3 J;  3OL4 A;  4OIR F;  1Q1H A;  2D45 A;  2F4O B;  4D7N A;  1V3F A;  1OCC H;  3OYL A;  2HVR A;  2ZB9 A;  1VQP I;  4KMU X;  2LFB A;  1I50 J;  1ZEL A;  1QA6 A;  1Z3X A;  4AUX A;  3A1Y A;  3KLN A;  2EV0 A;  4IXA A;  5K5O A;  2WGB A;  3QPL A;  2ELH A;  2H8R A;  2Q0O A;  4AC0 A;  4QLC U;  1KYZ A;  1R7J A;  3CUQ A;  2JZY A;  5DUI A;  1TT0 A;  3GME A;  4XLE A;  3E6B A;  2KZG A;  2X6X A;  5LHH A;  1XPX A;  2HWV A;  4DOZ A;  2VUM J;  3DLL F;  4C3J J;  3BG6 A;  4BAY A;  1SVM A;  3LA2 A;  1FYM A;  2OC6 A;  2FML A;  3CCQ I;  5HS8 A;  2GXA A;  1UFM A;  5LHG A;  1FTT A;  3L9F A;  2CUJ A;  3V4G A;  3MKY B;  4DYQ A;  5E3L A;  3W6J B;  3OS1 A;  1S5L C;  2VBX A;  5CQG A;  2R7R A;  4L0Z B;  3VVY A;  4AWX B;  3B6C A;  3BOQ A;  2UWM A;  2VJI A;  2FD5 A;  2VOO A;  1A5J A;  1T56 A;  3HIM A;  2BEO A;  2JJ7 A;  3K2Z A;  3L7W A;  3TP3 A;  3M07 A;  2PI0 A;  2RAE A;  2JTV A;  4NEL A;  3U9G A;  1APL C;  4DGW B;  3G73 A;  2FX0 A;  4ZH4 F;  2OQR A;  3OOP A;  3FM5 A;  4Y7N J;  1W36 D;  1G3S A;  4ZYA A;  3JRE A;  2KP6 A;  4HG2 A;  2OF7 A;  2M2E A;  2XB5 A;  4GYI A;  3TMO A;  1ETQ A;  3S32 A;  5CYV A;  2J5P A;  1P9Q C;  3RD3 A;  1OCZ H;  3GBG A;  1BM9 A;  2RNG A;  3PUF A;  4RAY A;  4YG2 F;  5DS9 A;  1UCR A;  3PQK A;  3HKZ A;  1GXQ A;  4U7D A;  4CH7 A;  3ZQL A;  5E3O A;  2FSW A;  1NG6 A;  1WJA A;  3IC7 A;  4FCY A;  3DU6 A;  3Q0W A;  2V6C A;  4OWR B;  3AKZ A;  3VYT B;  1P4X A;  2KPM A;  1TQP A;  4ICH A;  2N8G A;  3IKV A;  2QGU A;  4MNU A;  4PCQ A;  1ZQ3 P;  1MBG A;  3M1C A;  1U78 A;  3HXL A;  3C07 A;  5HS9 A;  3G1O A;  1FY7 A;  1CF7 A; 
#chains in the Genus database with same CATH homology
 1I6H J;  4M3F A;  5IP6 A;  2GFN A;  1JKR C;  2XPV A;  5M5Y J;  3S1M J;  3NI7 A;  5FMP A;  4I6Z A;  3BG5 A;  1ETK A;  3PO2 J;  2LKX A;  4JL3 A;  3A01 B;  1GDT A;  4UUS B;  2CRG A;  4Y52 J;  2HYT A;  2NOG A;  1VF9 A;  2XGE A;  1P7J A;  2DJN A;  4XK4 A;  3HB9 A;  3JRD A;  2EZK A;  4FE7 A;  3RQI A;  4C3H J;  2NS8 A;  4JKZ A;  1GVD A;  3NXC A;  5F0H A;  3CMY A;  1BL0 A;  2GM4 A;  5M3M J;  3HTI A;  2E1O A;  1W0U A;  2DG7 A;  1PUF B;  2MG4 A;  4XRS A;  5K58 A;  2G7L A;  2L7F P;  5BNG A;  4HNV A;  3JRC A;  1DU0 A;  4A3B J;  2EH3 A;  1IJW C;  3GZI A;  3A02 A;  2CJJ A;  5IYD J;  5FKM A;  2X6O A;  3OIO A;  1QRY A;  2DTZ A;  3G1L A;  4M6V A;  4RBO A;  2JA5 J;  2FJ1 A;  2E2H J;  4A93 J;  2D6Y A;  2O7O A;  1S7E A;  2HXI A;  4L5E A;  2DG8 A;  1R9T J;  3HTH A;  3HDD A;  4HKU A;  1WPK A;  2Y0S N;  3VOX A;  2X48 A;  3I4M J;  4NN1 A;  2WB1 N;  5K7F A;  3S1R J;  3KZ9 A;  1SFO J;  2DA3 A;  3C2B A;  4J19 A;  4AYB N;  1H89 C;  1OJL A;  5EZG A;  3KKD A;  2FBQ A;  4MXM A;  3HTA A;  2LVS A;  4B3A A;  2HKU A;  2ZCM A;  3JRB A;  2IU5 A;  3H0G J;  2E2I J;  2EZH A;  2REK A;  4DW6 A;  2Y9Z A;  4CYC A;  3CJD A;  3HM5 A;  2L7Z A;  3ZQI A;  4M3D A;  3A03 A;  3NAR A;  5DTD A;  1ENH A;  3RZO J;  4EEF G;  1H88 C;  2DMQ A;  2YUS A;  2YU9 J;  2GUH A;  2DA5 A;  4JX5 A;  3MKL A;  5D18 A;  2P81 A;  3S2H J;  1GV2 A;  1IG7 A;  1FIP A;  3VW2 A;  3PM1 A;  4IHY A;  1A6I A;  3LSR A;  1TWG J;  4JYK A;  1OCT C;  1RPW A;  1HLV A;  2TRT A;  4XID A;  4JX6 A;  2YS9 A;  2OER A;  3JRI A;  3S16 J;  1LFB A;  4ME9 A;  3PPB A;  3HE0 A;  2WAQ N;  1F36 A;  1ETX A;  4UUS A;  2JK3 A;  5F08 A;  2GBY A;  2JMW A;  4BXX J;  2WV1 A;  4ACI A;  2CQX A;  2ZOY A;  4DZP A;  1W0T A;  3EGQ A;  2X9D A;  5K7H A;  3W6V A;  5EFY A;  2UXH A;  2ZOZ A;  3CCY A;  4M3G A;  5J1U A;  1MBF A;  3BNI A;  5HOD A;  5FKN A;  3BTI A;  1O4X A;  1LE8 A;  5F1J A;  4QIW N;  5IP7 J;  4JP0 A;  4X6A J;  3HOX J;  1JT6 A;  1JUM A;  2R0Q C;  1AHD P;  2JA7 J;  5K7Z A;  2ZCX A;  2ELK A;  5EF6 A;  1JUP A;  5J1R A;  2NP3 A;  1BJZ A;  3K2A A;  3IH4 A;  1NTC A;  2HOT A;  1RKT A;  3E7Q A;  3TW6 A;  5C4J J;  1T33 A;  5IPA A;  1G2H A;  1VND A;  3HOY J;  4CYC B;  2V57 A;  4MO7 A;  5FGL A;  4BKX A;  1CQT A;  3EUP A;  2CU7 A;  4GCK A;  1UMQ A;  3HGY A;  5GP9 A;  1MBH A;  1WI3 A;  3LSJ A;  1RR7 A;  2EQR A;  5IP9 J;  1K61 A;  3CQZ J;  2HYJ A;  5IYB J;  2MSY A;  2Y2Z A;  3AQS A;  3CWR A;  3NAU A;  3V6G A;  2O9L A;  2DA4 A;  3OOU A;  2NVT J;  3ON2 A;  2VPR A;  1YRN B;  3O60 A;  3S5R A;  4B1R A;  3M3Y J;  1JJ8 C;  1RKW A;  2FQ4 A;  2ZCN A;  5DAJ A;  4BBS J;  5EYR A;  5IOZ A;  1AKH B;  2CUF A;  4L62 A;  3ON4 A;  2LD5 A;  2Y30 A;  5FJ8 J;  3Q0V A;  3OSG A;  5C4Y A;  3KNW A;  3HOU J;  1MBE A;  4YZE A;  2YVH A;  3LNQ A;  1MH4 A;  5FLM J;  2HDD A;  2K9Q A;  4GFK A;  3FIW A;  3MVP A;  1FEX A;  4QTR A;  2LLK A;  2XPU A;  4V2F A;  4AF5 A;  1WH5 A;  3UKG A;  4MFD A;  3KKC A;  5EDN A;  2GLO A;  4IHV A;  2CQQ A;  3WHB A;  4MK6 A;  2WUI A;  1JTX A;  3BR0 A;  3HBL A;  1IV6 A;  2HOA A;  3BT9 A;  2R92 J;  3LWJ A;  3JRF A;  2JWT A;  2M9H A;  2B63 J;  1BW5 A;  1RES A;  3DEW A;  3DCF A;  5IYC J;  2IBD A;  3I4N J;  1HOM A;  3VPR A;  4I76 A;  3HOZ J;  5HSZ A;  2XPW A;  3GTM J;  2JA6 J;  2HOS A;  4DYC A;  3LSG A;  4A3I J;  3VP5 A;  3BR2 A;  3A01 A;  2R7Z J;  3RZD J;  3HTJ A;  3NRG A;  4PXI A;  2YVE A;  4A3L J;  1IRZ A;  3BQY A;  2QTQ A;  3K7A J;  2OPT A;  2VKV A;  1X58 A;  5H9T A;  5EZH A;  3TP0 A;  1TWA J;  2LP0 A;  1IGN A;  1OCP A;  1XG1 A;  3IH3 A;  3T6N A;  4DZJ A;  4S0H B;  1SAN A;  4LOC A;  2M8G X;  5FLV A;  2QWT A;  5C3E J;  1JKQ C;  1AU7 A;  3JRA A;  3TED A;  2ECC A;  3QQA A;  4FIS A;  5GPA A;  3F1B A;  2UXO A;  1HF0 A;  3BG3 A;  1Z0X A;  5D1R A;  3VUQ A;  1ETW A;  5EGO A;  3RKQ A;  1FIA A;  1HDP A;  4MLO A;  5FKO A;  3F0C A;  3ZOB A;  3OSF A;  1JUS A;  1JJ6 C;  2ID6 A;  5F0C A;  4XIC A;  1BW6 A;  4JX4 A;  1ZK8 A;  5FKL A;  4C3I J;  4G12 A;  3GTL J;  2R5Z A;  4A3E J;  4A3D J;  2QF7 A;  3ZQC A;  2F07 A;  3ANP A;  1GT0 C;  3SFI A;  2ME0 A;  2NVY J;  5EG0 A;  1YRN A;  3BHQ A;  2H1K A;  1MH3 A;  3BR6 A;  2KT0 A;  4UUT A;  2NS7 A;  4D7M A;  2K9N A;  1DU6 A;  2HXO A;  1JT0 A;  3ZQF A;  5M5X J;  3JRG A;  1QVT A;  1ZR2 A;  1MSE C;  4M3B A;  3PAS A;  3BTJ A;  1UI5 A;  3BCG A;  4UDS A;  4RDU A;  4CGR A;  1B72 A;  1JKP C;  1MNM C;  1SGM A;  2MGQ A;  3ZQH A;  2DA1 A;  3JRH A;  4JNN A;  2AHQ A;  2DMU A;  1U9N A;  1MSF C;  2UXI A;  3IUV A;  5F0F A;  4A3F J;  4BY7 J;  1RET A;  5EGO B;  1FTZ A;  3FKI J;  3BG9 A;  3AQT A;  3QBM A;  9ANT A;  4M3E A;  5D19 A;  4GCT A;  2L0K A;  4MFE A;  2NVQ J;  4KWA A;  4IHW A;  1I3Q J;  3GTG J;  2EBI A;  3VVX A;  4V2G A;  3IH2 A;  3BR5 A;  3SDG A;  1ORK A;  1FJL A;  1H8A C;  4MIM A;  2IAI A;  2R93 J;  3BJB A;  5CXI A;  3P9T A;  3VVZ A;  3S15 J;  1QPI A;  4A3K J;  2E2J J;  1EF4 A;  4C2M J;  4BY1 J;  3ANG A;  3LSP A;  4A3C J;  1WH7 A;  2NP5 A;  3VIB A;  1TWC J;  2XB0 X;  2PMZ N;  1TWH J;  1ZKG A;  1P7I A;  1WGX A;  1ETO A;  5FKK A;  1ZTR A;  2QIB A;  5HBU A;  5CXG A;  2Q24 A;  3D1N I;  3JSJ A;  3O8G A;  3B81 A;  2HI3 A;  1AKH A;  1QVU A;  4W97 A;  4D5F A;  1U9O A;  2ID3 A;  1HCR A;  2DA7 A;  3COL A;  5F04 A;  1K83 J;  1POG A;  3HEF A;  3ZQG A;  5C44 J;  2D5V A;  2VKE A;  1Y1W J;  3CRJ A;  2KDZ A;  4IHX A;  5J3L A;  2UXU A;  3GEU A;  1Z77 A;  4IEJ A;  5C4X J;  2G7S A;  3NPI A;  2HQ5 A;  1JTY A;  1WCM J;  2G0E A;  2I10 A;  3B6A A;  2LK2 A;  3BR1 A;  4FTH A;  3FRQ A;  3GTJ J;  1MBK A;  1B72 B;  4D5C A;  1UHS A;  2W53 A;  3JR9 A;  2OI8 A;  2Y9Y A;  3V78 A;  2DA2 A;  3CDL A;  3HOV J;  2XGD A;  1TWF J;  1X2N A;  4XRS G;  3HOW J;  2K40 A;  2JA8 J;  5M5W J;  3NNR A;  1NK2 P;  4AC6 A;  1ETV A;  2Y31 A;  4GFB A;  2R5Y A;  3RH2 A;  1F43 A;  1B8I B;  3VOK A;  2M0C A;  2VI6 A;  3BR3 A;  2K9S A;  3TW7 A;  2LY9 A;  1GUU A;  3M4O J;  2COB A;  3QKX A;  2LTP A;  4NDL A;  5AQC A;  4GCL A;  1E3O C;  1XC5 A;  3LJL A;  5M3F J;  3WHC A;  2G7G A;  5HAW A;  4ABZ A;  2UXP A;  3PO3 J;  5EEA A;  4D7N A;  1JKO C;  1Y1V J;  3VW1 A;  2QOP A;  2ZB9 A;  3LHQ A;  2LFB A;  1I50 J;  2QCO A;  1VFC A;  2M34 A;  4AUX A;  5CW8 A;  2O8K A;  3GTP J;  3QPS A;  2WGB A;  2TCT A;  1JGG A;  3QPL A;  2ME6 A;  5EG0 B;  1PUF A;  3FK6 A;  2H8R A;  2NVX J;  1IDY A;  3Q0U A;  4AC0 A;  2RHA A;  2DA6 A;  3E7L A;  2R5Z B;  2DN0 A;  1LE8 B;  1TC3 C;  3BQZ A;  3BTL A;  4A3M J;  2AO9 A;  2DMT A;  1IDZ A;  1IC8 A;  2MW8 A;  4A3G J;  4A69 C;  3L1P A;  3DPJ A;  1GV5 A;  2VUM J;  1MBJ A;  2XRL A;  4C3J J;  3H3V K;  2QKO A;  2XDN A;  3GTK J;  3VW0 A;  4FE4 A;  5JLX A;  2ECB A;  1FTT A;  2EZI A;  4DYQ A;  2PZ9 A;  5E3L A;  3G7R A;  3LOC A;  2RAS A;  3GTO J;  3VVY A;  3MN2 A;  3B6C A;  4BBR J;  1Q1V A;  3G1M A;  2FD5 A;  1A5J A;  4A3J J;  3S1Q J;  1T56 A;  5JLW A;  3HIM A;  1ZR4 A;  2JJ7 A;  1XS9 A;  3TP3 A;  3BRU A;  5FHP A;  3Q3S A;  4DYR A;  3FIS A;  4NEL A;  2RAE A;  1HDD C;  1UI6 A;  1OFC X;  1UG2 A;  2IEK A;  1APL C;  2EZL A;  3G56 A;  2FX0 A;  1IUF A;  2CUE A;  4Y7N J;  3FK7 A;  3SJM A;  2E19 A;  3JRE A;  2GEN A;  5GPC A;  3O8H A;  3MNL A;  3S2D J;  4XRM A;  4B4C A;  2OF7 A;  1ZGW A;  2M2E A;  2XB5 A;  4QSH A;  1ETQ A;  1LFU P;  1U8B A;  3RD3 A;  2NX4 A;  3IV5 A;  3GBG A;  1ETY A;  5IOY A;  5DS9 A;  3ZQL A;  1D5Y A;  5E3O A;  3BTC A;  4FCY A;  3Q0W A;  2JN6 A;  2L7M P;  2DMN A;  5E3N A;  1X2M A;  2G3B A;  2O7T A;  5F27 A;  2L9R A;  1ITY A;  4ICH A;  2N8G A;  3HGG A;  3HKZ N;  2LR8 A;  1ZQ3 P;  2XSD C;  4X1E A;  1B8I A;  1BA5 A;  1MBG A;  2R5Y B;  2DMP A;  3GTQ J;  4GFL A;  1U78 A;  5E3M A;  2XGC A;  3S1N J;  4W1U A;  1NK3 P;  3S17 J;  2PBX A;  2W48 A;  3C07 A;  3G1O A;  5J1Y A;  3S14 J;  1VI0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...