4M3BA

Rapid and efficient design of new inhibitors of mycobacterium tuberculosis transcriptional repressor ethr using fragment growing, merging and linking approaches
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
190
structure length
185
Chain Sequence
RELAILATAENLLEDRPLADISVDDLAKGAGISRPTFYFYFPSKEAVLLTLLDRVVNQADMALQTLAEDRENMWRTGINVFFETFGSHKAVTRAGQAARATSVEVAELWSTFMQKWIAYTAAVIDAERDRGAAPRTLPAHELATALNLMNERTLFASFAGEQPSVPEARVLDTLVHIWVTSIYGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator EthR
publication title Ligand Efficiency Driven Design of New Inhibitors of Mycobacterium tuberculosis Transcriptional Repressor EthR Using Fragment Growing, Merging, and Linking Approaches.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription repressor/inhibitor
total genus 79
structure length 185
sequence length 190
ec nomenclature
pdb deposition date 2013-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4m3bA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 4m3bA02
1ENHA 5EF6A 2IU5A 2NVTJ 3W6VA 4MK6A 3SDGA 3NPIA 5JLWA 2LTPA 1B8IA 3BQYA 2D5VA 1Z77A 3HTHA 2MW8A 2PMZN 5F1JA 4JKZA 3HKZN 3JRAA 1WH5A 1MBEA 4IEJA 3BR6A 4XRSA 2OI8A 1I50J 4UDSA 2M9HA 3CRJA 3OIOA 1BW5A 5FMPA 3BQZA 1FIPA 2YS9A 2PZ9A 1R9TJ 2XB0X 4JX4A 2CQQA 3K7AJ 4ME9A 4J19A 3FISA 3OSGA 5D1RA 1VNDA 3JRBA 2M8GX 3NI7A 2FD5A 4KWAA 2DMPA 3OOUA 1IC8A 3VIBA 1ZR2A 3ON4A 1AKHA 2X6OA 2ZB9A 2ZCXA 4GCKA 2YUSA 1K83J 2JWTA 1MNMC 1AHDP 2FBQA 5F08A 2E2IJ 5EZHA 2O7OA 2V57A 1UI6A 3SJMA 4AF5A 1GVDA 2R93J 4MIMA 4JL3A 2RASA 2FX0A 3ON2A 1JGGA 5FJ8J 2XB5A 2AO9A 3JR9A 3BG9A 5HSZA 2HYTA 2LVSA 4I76A 3GTPJ 3VPRA 2R5ZB 2CJJA 3BRUA 2NP3A 3NXCA 3PASA 2UXUA 1IDZA 4DYCA 2EBIA 2CQXA 4JX5A 4M3GA 3JRFA 5C4YA 2XPVA 1HDPA 5F0HA 3A01A 1ZK8A 5J1YA 3HTJA 2XDNA 4RDUA 3DEWA 1U78A 3RZOJ 3IH4A 3UKGA 2LFBA 3BCGA 3VP5A 3LSRA 4A69C 2DN0A 1OCPA 3G1LA 1EF4A 3B81A 3CMYA 2JJ7A 4XRMA 5C44J 3O8HA 1ETWA 2FJ1A 3BJBA 3HGGA 1PUFA 5D19A 4UUSA 3JRGA 1BJZA 2KT0A 3VOXA 5K7HA 1GV5A 2CRGA 2WGBA 3VW2A 1H88C 3VW0A 1POGA 2TRTA 1ZGWA 2Y9ZA 2LY9A 1FJLA 1LE8B 3I4NJ 3JSJA 4AC6A 1T33A 2XPUA 4MFDA 1DU0A 2JMWA 4CYCA 4A3KJ 2JA8J 1TWFJ 3S1NJ 1RETA 2PBXA 1A5JA 3T6NA 4A3JJ 4W97A 3S5RA 2FQ4A 3HTIA 3HM5A 2G3BA 3QBMA 3HGYA 5EYRA 5EDNA 4QIWN 3TW6A 3HIMA 1JT6A 1BA5A 2HOAA 4PXIA 2DJNA 1ETYA 1U8BA 1ZR4A 1XG1A 1A6IA 1JUPA 2E1OA 2L7ZA 4FE7A 1NK2P 3QKXA 4NN1A 2ZOZA 3BTCA 3GTOJ 2R0QC 2Y30A 3Q0WA 4M3BA 1TC3C 3BR1A 3SFIA 5EG0B 1GDTA 2JA5J 1JUMA 4XIDA 4I6ZA 3MVPA 3BG3A 3AQSA 2NVXJ 4MXMA 5CXIA 2RHAA 2K9SA 2QTQA 5CXGA 3P9TA 5J1UA 4GCLA 1OFCX 1F43A 1PUFB 4UUSB 1QRYA 2Y31A 4D5FA 5E3OA 3BHQA 3HTAA 2QWTA 3BR0A 2O9LA 2X9DA 4GCTA 3EUPA 3HEFA 2CU7A 4L5EA 1P7IA 3RKQA 2W48A 2DA1A 1U9OA 3F0CA 3RZDJ 4XICA 2MG4A 2ZOYA 3G1OA 2LD5A 2ME6A 4XK4A 2QF7A 2QIBA 4FE4A 2NVQJ 5M5YJ 4V2FA 2JN6A 2D6YA 4YZEA 2DMNA 4GFBA 2JK3A 2UXHA 4CYCB 3HDDA 3Q3SA 2GM4A 2YVHA 3OSFA 1BL0A 1MSFC 4MO7A 5F0FA 3KZ9A 1MBFA 4X1EA 2H1KA 1MBGA 2HOSA 3S15J 5FKNA 2NVYJ 4EEFG 1XS9A 2XRLA 3Q0UA 1QPIA 1ZTRA 2LK2A 3ZQLA 1GT0C 2DG8A 5IOYA 2G7LA 3JRDA 4BBSJ 1RKWA 3FKIJ 1MBHA 1SFOJ 2K9QA 3PM1A 2NOGA 2B63J 5EEAA 5IP7J 1YRNA 3GTQJ 2DA2A 4FCYA 4A3EJ 3LSPA 2O8KA 2GBYA 3BR3A 3PO2J 3NAUA 3M4OJ 4AYBN 3JRIA 2ME0A 1VFCA 5HODA 1B8IB 2G0EA 2G7GA 2ID6A 3A03A 2RAEA 3CQZJ 3QPSA 3VW1A 5M3FJ 1UG2A 2LP0A 3GZIA 4S0HB 1IUFA 3FIWA 3QPLA 2HXIA 1JTXA 5EZGA 2KDZA 4BXXJ 5EGOA 3ZQCA 4C3HJ 3L1PA 4ABZA 3ANPA 3G7RA 3VVXA 5D18A 4A3DJ 4D7NA 5M5WJ 1K61A 3JREA 3NRGA 5GPAA 3O60A 3FRQA 3JRCA 2XPWA 1APLC 3LSGA 4G12A 2G7SA 3B6CA 3HOZJ 4AC0A 5JLXA 3C2BA 1GV2A 2ELKA 4RBOA 2UXIA 2HDDA 3FK7A 2O7TA 1P7JA 3F1BA 1NTCA 2JA7J 4GFLA 1AKHB 1JKQC 3S1MJ 3BTJA 1JT0A 1VF9A 4UUTA 1FEXA 1TWHJ 4A93J 9ANTA 1VI0A 2Y2ZA 5FHPA 3LOCA 3BTIA 5AQCA 2R5YA 1B72A 1WCMJ 1S7EA 1TWCJ 3HOVJ 2XSDC 2ECBA 1HLVA 1YRNB 2EQRA 3ZQIA 3NARA 2WB1N 2ZCNA 2K40A 5C4XJ 1E3OC 2Q24A 2DMTA 5F04A 2OF7A 1ORKA 5M3MJ 3LSJA 3IH2A 4B3AA 5FLMJ 3TEDA 1Y1WJ 3S1QJ 2COBA 2K9NA 1JKRC 2R92J 3HBLA 1FTZA 5K7ZA 1X2NA 1JJ6C 2JA6J 4DYQA 3CWRA 1RR7A 5DAJA 5K58A 2DMQA 3A02A 2VPRA 2DTZA 1ZQ3P 2QKOA 2NP5A 1ETXA 3BR2A 4IHXA 2ECCA 1ETOA 1U9NA 3G56A 2OPTA 2QCOA 3EGQA 3A01B 1UI5A 3VOKA 1X2MA 2F07A 4B4CA 5GPCA 2DA6A 1Y1VJ 1HDDC 2WV1A 1ITYA 1FIAA 2TCTA 3GTJJ 1IDYA 3K2AA 2M2EA 3WHBA 4DZPA 1H89C 4BY1J 1X58A 1HCRA 2XGDA 3S16J 5FGLA 3KKDA 3E7LA 2EZLA 2DA7A 4IHWA 5GP9A 3MNLA 1UMQA 2EZIA 3B6AA 1NK3P 1T56A 5FKMA 3IUVA 3HE0A 3NNRA 2M34A 4A3FJ 1W0TA 4DYRA 1WGXA 4Y52J 4L62A 3V78A 2GUHA 1ZKGA 5IYBJ 2Y9YA 5H9TA 3BG5A 1OCTC 3LHQA 5E3NA 5FKKA 4JNNA 4B1RA 2XGCA 4A3CJ 1G2HA 5FLVA 1JKOC 3AQTA 3DPJA 2UXOA 2IBDA 4NDLA 4DW6A 5K7FA 3WHCA 3C07A 2R5ZA 3S2HJ 1RESA 2MGQA 2ID3A 2EZKA 4AUXA 4BY7J 4D5CA 1HF0A 1ETKA 2UXPA 3H3VK 3I4MJ 1HOMA 3S2DJ 2GFNA 4C3JJ 3JRHA 5IP6A 3LNQA 2EZHA 2OERA 1JUSA 4M6VA 3BTLA 5DTDA 2LLKA 4NELA 3H0GJ 1SGMA 1MBKA 3ANGA 5EFYA 2AHQA 5HBUA 3M3YJ 4LOCA 4QTRA 2DA4A 2E2HJ 2X48A 3KKCA 3MKLA 2L7FP 2REKA 1ETQA 3HB9A 4IHYA 3GTMJ 2M0CA 2YU9J 5HAWA 5BNGA 3HOUJ 2NX4A 1WH7A 4A3LJ 4HNVA 5IPAA 3CCYA 3GEUA 2VKEA 4W1UA 5M5XJ 3KNWA 1JTYA 2L0KA 4X6AJ 1F36A 2L9RA 1O4XA 2HXOA 1W0UA 2VI6A 2QOPA 1UHSA 3GTLJ 5IOZA 3BR5A 3GBGA 1LE8A 2EH3A 2I10A 3TP3A 1MSEC 2CUFA 3RH2A 2IAIA 4JX6A 3RQIA 4MFEA 1MH4A 2N8GA 1AU7A 3E7QA 4JYKA 3CJDA 3CDLA 4ACIA 3COLA 3IV5A 4QSHA 1IV6A 1RPWA 3ZQGA 3BNIA 3S14J 2LR8A 4BBRJ 4FTHA 3VVZA 1TWAJ 5J1RA 2E19A 2NS7A 1Q1VA 5C3EJ 3VVYA 2DMUA 4MLOA 2ZCMA 1QVUA 3MN2A 4M3FA 3ZOBA 2H8RA 4BKXA 5E3MA 4D7MA 5IYCJ 3PO3J 1JJ8C 1IRZA 4HKUA 3TW7A 2VKVA 4C3IJ 1QVTA 3O8GA 1OJLA 4Y7NJ 4M3DA 5IYDJ 2LKXA 1RKTA 3QQAA 4A3IJ 5IP9J 5EG0A 2CUEA 1BW6A 4M3EA 3DCFA 4A3BJ 1IG7A 3D1NI 5C4JJ 1WI3A 3BT9A 4ICHA 2P81A 1LFBA 3HOWJ 3LJLA 5FKOA 1H8AC 2HOTA 5FKLA 2DG7A 1I6HJ 2E2JJ 5CW8A 5DS9A 3VUQA 1SANA 5EGOB 1WPKA 3FK6A 5F27A 4DZJA 2GLOA 1FTTA 3LWJA 1IJWC 1MH3A 2HI3A 3GTGJ 4A3MJ 2W53A 4XRSG 1I3QJ 3GTKJ 3HOXJ 1DU6A 2MSYA 3RD3A 4JP0A 5J3LA 4GFKA 1XC5A 4IHVA 2GENA 2VUMJ 2WUIA 3S17J 1CQTA 4V2GA 3Q0VA 5E3LA 2HKUA 3V6GA 1GUUA 3TP0A 2HQ5A 3HOYJ 1JKPC 1MBJA 5F0CA 4FISA 1LFUP 2HYJA 2DA5A 1TWGJ 2DA3A 1Z0XA 2R7ZJ 1IGNA 2XGEA 1ETVA 4C2MJ 2YVEA 2L7MP 4A3GJ 3G1MA 2IEKA 4CGRA 2R5YB 1B72B 3ZQHA 3ZQFA 3PPBA 2Y0SN 2NS8A 3IH3A 1D5YA 2WAQN 3S1RJ
chains in the Genus database with same CATH superfamily
1ENHA 2DTRA 4EJTA 2IU5A 3CCVI 1R23A 2NVTJ 3BP8A 3CJTB 1BR2A 2YX7A 1SMTA 4LJZF 4IHSA 1ZELA 2V1NA 1CF7B 2PMZN 3F8FA 4JKZA 1WH5A 2CW7A 3QP6A 3U1KA 3TL4X 3BR6A 1J7KA 4KNYA 2WB1A 4XRSA 4Y15A 2AXLA 3CDHA 3OIOA 3F21A 1HW2A 1U2WA 2DT5A 1LKXA 3W3CA 2DI3A 1SD5A 2M7AA 3CCQI 3CF2A 4XONA 1PYVA 4JX4A 3L7WA 4BDYA 4ME9A 4HW0A 1W7PD 4J19A 4II3A 3G6EI 3F72A 4ASNA 2VLAA 4RB2C 1VNDA 3JRBA 2WWYA 4ETSA 3NI7A 4HNUA 4EJVA 3KEOA 2X6YA 2JUGA 4KT5C 4B43A 3OOUA 4KJZA 2FE3A 3VIBA 3U2RA 2W4SA 3FXLA 2XF6A 5LBQA 3GO5A 2G7UA 4FASD 1LEBA 2CFOA 2B7EA 2XF7A 2KL4A 2PX9A 3GF2A 4IRGA 2E2IJ 1K79A 2V26A 1FWZA 1VQPI 2F5DA 2FEZA 3BJ6A 4YIFA 5DUKA 4M9XA 1V54H 3RSNA 1JGGA 5FJ8J 2XB5A 2OTLI 2HYTA 3F8BA 2NRAC 3AG3H 4I76A 1ON2A 2CJJA 2R5ZB 3BRUA 2ADUA 2ZC2A 1BC7C 5L3GA 2ZBKA 4IHTA 2A6EF 2XAUA 3JRFA 4M3GA 4XKVA 3KETA 4OIPF 2XPVA 1HDPA 4M74A 5EEGA 1XMAA 1ZK8A 5E17F 3HTJA 2DW4A 1KQ8A 2XC7A 3UKGA 2F5VA 2LFBA 1FYKA 3LSRA 1XGMA 3G1LA 1EF4A 3B81A 2P7VB 2LDUA 4XRMA 3V7RA 1V5GA 3GFIA 2NNNA 3WGHA 5J47A 2HVSA 3HGGA 1PUFA 1O3TA 3H3ZA 3JCUC 1X1DA 3JRGA 2KT0A 2F5CA 1XPXA 1K7AA 5K7HA 1GV5A 2CRGA 2WGBA 2VN2A 1H88C 3VW0A 3RDIA 2LY9A 5FROA 4MFDA 1WJEA 3K1MA 3A4CA 5JR3A 1UG0A 4ESBA 2GIVA 2JMWA 1R58A 1TWFJ 2E34A 4W97A 2RDPA 3IAM2 1TZLA 2G3BA 3QBMA 2JRMA 3PSFA 2QQ8A 3NEUA 1JT6A 3HIMA 5KHDA 1N77A 2AS5F 3G2BA 3LQRA 4HSRA 2ZMEB 3QKXA 1YO5C 3M8JA 3WTSC 5DEQA 2Z9OA 2Y30A 4OIRF 1VZ0A 5BPIA 1TC3C 1Q1HA 3HSRA 1GDTA 2JA5J 1W36C 4BS9A 2FNPA 3LL7A 4MXMA 3DTEA 4N9HA 4E4HA 5CXGA 1IRXA 5ILSA 1QRYA 2Y31A 3EQLF 3ERMA 1XGOA 2QQ9A 3AAFA 3BR0A 3OYMA 4AU7A 2X9DA 2P5VA 3NQOA 4GCTA 3HEFA 4MQ9F 1P7IA 3RKQA 4XICA 1KU9A 1R5HA 5DDGA 5DD8A 3IC7A 2PEXA 4FE4A 4H4KC 3I56I 2XRNA 1LFPA 1DP3A 3I59A 5CQEA 2JN6A 2D6YA 4YZEA 1PUEE 2DMNA 2PJPA 1R6RA 1J59A 3KYLA 3OL4A 4N4NB 4F92B 2DAOA 3IUOA 4HYEA 3HC7A 1BL0A 1MSFC 2ACJA 2V79A 4CSWA 2OUMA 4X1EA 4Y13A 3VEPA 2NVYJ 4EEFG 4BHCA 3KLOA 1L3LA 3FHZA 1X4PA 3DU5A 2VJJA 2MD0A 5GAGJ 3ZQLA 2DG8A 4QPQA 2G7LA 2PQ8A 1NH3A 3I4PA 3JRDA 1RKWA 5H6QA 4P5OA 1MBHA 2KMUA 2M30A 1SFOJ 1SD4A 2HU9A 5CPRB 4PK4A 3LAJA 4AIJA 2HDCA 2XVCA 3ZQQA 1BR4A 3H9JA 4A3EJ 1SD7A 1Y8RB 4UVAA 3G3ZA 3LSPA 3WGIA 1O3SA 3NAUA 3DTKA 3PSIA 2FMYA 2E5NA 3JRIA 4BL0B 5CYVA 3A03A 3WTTC 3VW1A 1UG2A 2LP0A 4S0HB 4ZYAA 5HOOA 3OYAA 2YPRA 4KYWA 1WSUA 1ZYRF 2KQRA 2LH9A 3ZRGA 3KP5A 3ML6A 4IKFA 1FY7A 4NC6A 4XKCA 1NG7A 3I71A 3DPUA 4ZH4F 1AWCA 2I8DA 4RS8A 1ERDA 5GPAA 1P4WA 5L3CA 1ZARA 4E7KA 5LHGA 3FRQA 3JRCA 2FU4A 1XTAA 2JPCA 4DVYP 4YFXF 1AOYA 1BJAA 2G7SA 5JVTA 3C2BA 1FLIA 2LSOA 4S04A 2JA7J 2LYCA 1KA8A 2VBWA 1FEXA 1TWHJ 4A93J 1IXRC 3RJPA 4HLXA 2CWEA 4K2EA 3LOCA 2VJ4A 1TLHB 2OQRA 1L0OC 3HOVJ 1FSHA 2EA4A 2EQRA 2XF5A 3NARA 3ZQIA 3IL2A 5HS7A 2MD5A 5HNFA 2Q8KA 4EM2A 2DMTA 5ERIA 3W6JB 3GVAA 2OF7A 2XUBA 5M3MJ 4L9VA 3LSJA 1X3UA 3S1QJ 1Y1WJ 2HVRA 4R79A 3RPUD 1VQNI 4M9ZA 2EWNA 1XN7A 1X2NA 3K4NA 3MCZA 1G59A 2JA6J 2QUFA 4DYQA 1TQPA 1TQIA 4LMYA 5DAJA 1BOBA 4JOMA 2DMQA 2CFXA 2HNHA 4CCLA 4C2UA 3LSKA 2QKOA 3V4GA 3BR2A 3SXYA 4RM2A 3TO7A 2GZWA 4E7IA 1ZRDA 3M1EA 2OPTA 4BJTA 3K9TA 2F07A 3BDDA 2DQLA 2RNJA 2VC0A 5D6FA 2DT7B 3V7SA 5FB2A 2DA6A 3SZGA 3LQQA 5GTHC 1HDDC 2P5LC 1WRJA 1OCOH 2QSGX 2W7NA 5HLHA 3GTJJ 2B0LA 1LUJB 4YEJA 4DZPA 2MFZA 4BJ5C 4EMSA 4BY1J 1X58A 3PL8A 3CO6C 3CMAI 1HCRA 1F4KA 3KKDA 4XLEA 2AQFA 3E7LA 3BZ6A 1RIOH 3MNLA 4RLFA 5LFAA 2EZIA 1B4AA 4BUPA 1YTYA 1NK3P 3IUVA 1FYLA 4MTDA 4UV9A 2M34A 2RV8A 1SVOA 4DYRA 4Y52J 3F3XA 2GUHA 1FP2A 3OOPA 1X1BA 2FBHA 1SFXA 3LHQA 1X3ZB 2RKHA 4ZDPA 5CVIA 3W2WA 1R1TA 1P4AA 1HBXG 1I39A 2A5YB 4IPAA 2WAFA 1STZA 4A3CJ 1G2HA 5FLVA 4RGSA 3AQTA 2M1BA 3FX3A 4AVPA 2IBDA 3C07A 4HQMA 2STTA 3U21A 3S2HJ 2IA1A 3EUHC 3WE2A 4D5CA 1MMNA 4Z2YA 1ETKA 1WJDA 2VE9A 2A2FX 4I99C 3I4MJ 1TTYA 1J9IA 4CCJA 3MZHA 1OYIA 1OR7C 5K5QA 2EZHA 2K5CA 4EM0B 2OERA 3ASNH 2PN6A 2M3AA 1KZHA 3H35A 1SGMA 1MBKA 3ANGA 4OIOF 3M3YJ 1VQ8I 4ZYDA 2IT0A 3MKLA 3RKWA 3HB9A 3R6SA 3GTMJ 3LSIA 4OOIA 5HDGA 1Z1DA 2KP6A 3C3WA 2NX4A 4RGUA 3BCAA 1XMKA 4XR6A 4XN3A 3HG9A 3OL3A 1EJ9A 1B9NA 2KIMA 1D1CA 3WODF 4X6AJ 1UZCA 1R22A 2RREA 2XDVA 2ZJRF 3M9AA 5J8CA 2OBPA 3EUKL 4F55A 3GTLJ 4XMYA 2XAGA 2I10A 3ECOA 2CUFA 3QOPA 2IAIA 4JX6A 1G3TA 2VKHA 4GO1A 4HDUA 1JI8A 3I59B 4JYKA 2DLLA 4B44A 1BI0A 3R0AA 1PP8F 2DO7A 3OR1C 5KVRA 2KZGA 3BNIA 3OS0A 3AKZA 2WY7Q 4L5JA 1U5TA 1A04A 1N78A 1DQUA 4CZCA 2YVXA 2HQRA 4M73A 2E7WA 2P6TA 4M3FA 5DV5A 4BKXA 5KAFC 5E3MA 2H8RA 2HZDA 5IYCJ 2PMHA 4AWXB 3PO3J 2DOEA 1E0EA 3N4MA 1D0ZA 2VKVA 3EYYA 3DWLE 4Y7NJ 2LKXA 2F2EA 4LD5A 2DBBA 5EG0A 4M3EA 1Y8QB 4YIIA 2HYGD 1Z6RA 2E5ZA 3WG9A 3GW2A 1WI3A 3BT9A 2QEXI 2X6XA 1DGWY 3QWLA 4WXHA 1WHUA 2HTSA 1F5TA 2HDWA 2VQLA 3DXJF 3EUHA 1FYMA 1HA8A 3GX4X 1QZZA 3QP5A 2H6BA 2VBZA 1REPC 2HFHA 2UXXA 3DEEA 4M72A 4CO8A 2F4OB 3KX2A 2QYOA 4HPQA 3UR3C 3WU0A 4NB5A 3L2UA 4LITA 2FOWA 1DU6A 5E8IA 3P9CA 2MSYA 1T2KA 3RD3A 5J3LA 3L2QA 2JTVA 3AG4H 2F5FA 1I6XA 3M1CA 5E3LA 2GAUA 3V6GA 2WC2A 3MZYA 2BZTA 2JA2A 2OC6A 3ZMUA 2HQ5A 1OQYA 2H1LA 4RB0A 3A0HC 2E1CA 2RQQA 3E6MA 2O5RA 3GYHX 4U0VA 3PJRA 4O3MA 1YW9A 3KEQA 1R4MB 4LIUA 3MZ8A 4U0WA 2Z3YA 1IGNA 2XGEA 2ZMEC 2YVEA 3KPHA 2LF8A 2OV7A 3ABMH 5ED4A 2H09A 3J81K 4E7ZA 2OQGA 3IH3A 3S1RJ 3JTGA 2MLKA 3H5RA 3P7NA 1BBYA 5EF6A 1R49A 3E6CC 5D5WB 3W6VA 1KU3A 1YQAA 1EH7A 2CMPA 4NNJA 1IO2A 2P5KA 2E1NA 5D4SA 1B8IA 5TJJA 4F52A 3HTHA 2MW8A 1FMWA 3T8TA 3ECHA 3JRAA 4IEJA 3E5QA 2IS1A 2L54A 3HUGA 4B3XA 4O6JA 3CUQA 1I50J 1ZGAA 2DDBA 2M9HA 3CRJA 3DKXA 4IOCF 4ZYEA 1HXDA 2YS9A 4ZDOA 4U88A 3QYFA 2BW3A 1Z7LA 2CQQA 3BG6A 1TW2A 1UCRA 1SVMA 3BLYA 3K7AJ 5JFRA 2R7VA 3Q9SA 2X1CA 2XGXA 3OSGA 4CZZA 5KCMA 3AL0B 4KWAA 5D6EA 2R7FA 2D45A 2VB6A 4QLCU 1OLTA 4OWRB 1YITI 1BI3A 1S9HA 2AQEA 2ZB9A 2YUSA 2ZY9A 3KIOA 2EV0A 2JWTA 2EINH 5H2FC 1GVJA 3O3KA 5F08A 1AHDP 2I5UA 1W36D 1MNMC 2FBQA 2G7HA 4RA2A 4E7LA 1UI6A 1LDDA 3SJMA 4AF5A 1E2XA 4GYGA 3T8RA 5CVJA 5E1ZB 3PQKA 4OAYA 3JSPA 2R93J 1MJAA 5DCFA 4JL3A 2RASA 1YG2A 2FX0A 3I64A 1IXSB 4DJAA 2AO9A 3JR9A 3S3MA 3AG1H 2E60A 1P2FA 1MDMA 2WA0A 2VT3A 4HRIA 4L0ZB 2CQ7A 3D5RC 4IL6C 4CA0A 3NXCA 1LJ9A 4KICA 3E97A 4PSXA 3H92A 4DYCA 2K9MA 4BQOA 2VBXA 5ICCA 2K9LA 5J4YA 1V55H 3BCBA 5F0HA 4GDFA 1JHFA 2FBIA 2IA2A 2ELJA 2XAHA 4KFCA 3FXOA 1LPQA 3RZOJ 3CCMI 3BCGA 1D1AA 4OAZA 4A69C 1R1VA 1OCPA 1D0XA 3CMYA 2ZXJA 2JJ7A 3WTVC 1MMGA 1S8NA 3O8HA 2ZSIB 2FJ1A 1BN5A 1QA6A 3BJBA 1MJ9A 1Y56A 1KYWA 4G6TB 2VE8A 4B48A 1N25A 1SD6A 1U0JA 1W5SA 3TOAA 3BZCA 1BJZA 2C6YA 2IGOA 3J7AO 3H0DA 4EV0A 1POGA 2TRTA 1ZGWA 1XDSA 3LSMA 4RB1A 3W2VA 2W1OA 3I4NJ 1MMDA 2NXNB 2QGUA 2Z99A 3TO9A 1FP1D 2E1MB 1E3HA 1K78A 2JA8J 1OKRA 4WXDA 2XAJA 1IW7F 1A5JA 3S5RA 2E35A 3G73A 4ENMA 1U5TB 3HTIA 2UWMA 3HGYA 5EYRA 2OU2A 4QIWN 3TW6A 1BOAA 3X2QH 1BA5A 2DJNA 1U8BA 2Z1DA 1MKMA 1MW7A 2A6HF 2HS5A 3EDPA 6PAXA 4NN1A 2ZOZA 1GLNA 3KZIC 2R0QC 3KCCA 3MWMA 2Q2EA 3SFIA 5EG0B 4J00A 4FX4A 5AIPA 3N97A 4XIDA 4WIBA 1Z91A 5FFXA 2Z33A 2RHAA 3WE3A 2OD5A 4IO9F 2ESHA 5J1UA 5E3OA 1G3WA 4L5IA 4HF2A 2QWTA 5HS9A 1O57A 1WQ2A 4OINF 3GWZA 4G7HF 1IRFA 3PUBA 2O9LA 3HSEA 1IN7A 3C18A 4L5EA 3RZDJ 2HQAA 2ZOYA 3G1OA 4TV7A 1B1BA 2XV4S 2QIBA 2QF7A 4ZTJA 1D5VA 2ICWG 4HX7A 3E5XA 3QPHA 5B1BH 1IAWA 5E8GA 4RMNA 1MNDA 4HDVA 2W57A 4HF0A 2JK3A 5GAEJ 3HDDA 3ERED 2VASA 5L3BA 4XLAA 3SYTA 1ZRFA 1K4TA 2DPUA 2O61A 3H9GA 4RGRA 3BG7A 2GQQA 1LDKB 2IP2A 1MBFA 3S15J 3QPTA 5FKNA 3I53A 4S05A 1B9MA 4P55A 1XS9A 2VKDA 2XRLA 2R7OA 2BY3A 1ZREA 5IOYA 1KQ9A 3RKXA 1RC9A 3GCMA 2K9QA 3PM1A 4E70A 4CDGA 2EIKH 2EV5A 3PFYA 5IP7J 4F3QA 4EGYA 2IS4A 2JRTA 4CICA 1B8IB 2G0EA 4YIRX 2RAEA 2Y0SA 3FDYA 2A05A 1VQ4I 4ANJA 5J4VA 4HV5A 3HUGB 2LNBA 3FIWA 3CUQB 1OMIA 3LFKA 3CF5F 4G7ZF 2KDZA 2XHKA 3J80Z 3JSOA 4PFOA 1YX5A 2IRFG 5D18A 2PMZA 3L2CA 2BV6A 2BW3B 4D7NA 1WI9A 3OYKA 5M5WJ 3GZ6A 3JREA 5L3DA 1FBSA 2MABA 1APLC 4XLNF 2DFFA 1U8RA 3HOZJ 1YJWI 3RYRA 4RBOA 2FUG2 3BC8A 4IVNA 4CCOA 2O7TA 5DYMA 4U9LA 4E6KG 4GFLA 3CJQB 1JT0A 2CSOA 4UUTA 4ZC3A 1UHWA 2Y2ZA 5FHPA 3P5JA 2IS6A 5AQCA 1J5YA 1S7EA 2MYSA 1YYVA 3B02A 2ECBA 4EVIA 3PNYA 1YRNB 2MA3A 2KISA 4PFPA 2K40A 1P6RA 3FXJA 1E3OC 5LD2C 5IY5H 1WJFA 1X19A 2MC4A 3OYNA 3IH2A 3WTXC 4B3AA 5FLMJ 3S32A 3HRTA 3TEDA 1G8XA 2K4BA 3RCOA 2K9NA 1MDMB 5K5OA 3K70D 2HGCA 2V7FA 2WAEA 3CWRA 4ZDLA 4XSZF 4Y3OA 5K58A 2HVQA 2QZ8A 2COMA 2NP5A 1ETXA 4NQWB 2WV0A 1C0WA 5K1YA 1U9NA 4CH7A 3G56A 2QCOA 5CJ9A 3TDZC 3A0BC 2PFBA 3EGQA 2XKPA 1YIOA 4B4CA 1M1EB 5GPCA 3QODA 2WV1A 4XSXF 2TCTA 2CQKA 4I02A 3L9FA 2W24A 1YOVB 3KFWX 3WHBA 4G6QA 2R7DA 5FRNA 2EB7A 2XIGA 3DLAA 4A0YA 3CC4I 1UB9A 1ZRCA 2DA7A 3F8NA 4PZJA 4IHWA 2CYYA 2WTEA 5FKMA 2CW8A 3F6VA 1WGXA 1UHMA 4L62A 1WJBA 2Y9YA 3DBLB 3ROUA 2ZJPF 2BY2A 2XSJC 2M8EA 3JTHA 4MNUA 5J40A 1K78B 2FOKA 5FKKA 3KZYA 5FD5A 4JNNA 4PJ0C 2MH2A 2M7BA 4NDLA 3VSKA 1OCZH 2QM3A 4BQAA 1RESA 2MGQA 4LB5A 1GXQA 3CP8A 3HYIA 2UXPA 3GMEA 2V6CA 5F6FA 1X1AA 3TQNA 4C3JJ 2Y48A 3JRHA 4HOBA 4A6DA 5IP6A 5TRDA 3Q9VA 1XSXA 2Q2EB 2LLKA 3JAMZ 1Z3XA 1P4XA 1N75A 3VYSB 3IRRA 1JHHA 3GEZA 4MGRA 1EKEA 2X48A 3KKCA 3VODA 3J7ZI 3CJNA 1U3EM 2M0CA 5HAWA 5BNGA 4KDPA 3EYIA 1WH7A 2L7KA 4A3LJ 2L9SA 2X4HA 5CVUA 3HRMA 3CCYA 4Y33A 2VKEA 2YX4A 2B9SA 1GHCA 3GEUA 3W2AA 3KNWA 2L0KA 1F36A 2IJLA 1A6QA 5LHHA 1O4XA 2B1EA 3WTWC 1W0UA 1IZ1A 4ZJZA 3I9V2 5AONA 5IOZA 2EH3A 3RH2A 4Z6YA 2RGVA 2EFWA 1QU3A 4MFEA 3J7AY 2GXBA 4XKBA 4D9JA 2N8GA 3ASOH 1AU7A 2H6CA 3LSTA 3E7QA 3DV8A 4RAFA 3CJDA 3H3UA 4ACIA 1S6LA 3IV5A 2KIFA 1IV6A 1RPWA 4LLLA 3ZQGA 4ENNA 2HKXA 2LR8A 2X85A 5E20A 2R7RA 1TWAJ 5JVGF 2QSFX 1S7AA 1TBXA 2OA4A 2RNGA 3SEZA 5D8LB 1QVUA 4UXNA 2UV1A 5H6RA 2W82A 2CG4A 2X1DA 1R7JA 3R60A 4D7MA 3ZMTA 1ZLJA 3WTYC 4L18B 4HKUA 3TW7A 1VQMI 1QVTA 2FQ3A 2NVUB 4KMFA 3BOQA 1KONA 1YJNI 3OYDA 4R1HA 4HNTA 2JSPA 1RKTA 2X0LA 4KN4X 1LDJA 1R36A 3CCLI 3I3LA 2W25A 1BW6A 4C30A 3DCFA 3S93A 4A3BJ 4KIGA 2JZYA 1IG7A 2CUZA 4M9SA 3D1NI 2DOFA 3SZTA 3DPTA 4XLCA 4ICHA 2A07F 3KP4A 5D5UB 1T98A 1R5GA 1LFBA 2A68F 2EFOA 2FF4A 3ZGKA 4AVZA 1LVAA 3H5NA 3NWTA 4Q47A 4XLPF 3LA7A 3L2VA 4M71A 1H8AC 3K4MA 3ABLH 3BWGA 3KEYA 2ZCWA 3VDXA 5ICGA 2DG7A 2YSRA 1ULYA 1BIAA 1YW7A 2E2JJ 3S3NA 2FNAA 5CW8A 1HSJA 3VUQA 4HZFA 2CS3A 2OCEA 5BS6A 1WPKA 3U9GA 1FTTA 3GTGJ 4A3MJ 1J0RA 2L5QA 3DQVC 4BEHA 3HOXJ 3E6DA 2QLZA 3E3VA 1X1CA 4GFKA 3ZR8X 2GENA 1V3FA 1FNNA 1ZHFA 2NNYA 3FXMA 3N05A 3TP0A 4I0BA 3OYHA 2L4AA 2BY1A 1U5TC 1JKPC 3BY6A 4FISA 3DPLC 2DA5A 1TWGJ 3J80K 3OYLA 2X6WA 2R7ZJ 2K7LA 4B8XA 1ETVA 2L7MP 5A2QZ 2WADA 4PUSA 1IN4A 2OAZA 3GLLA 3ZQHA 2V1DA 4XKWA 2NS8A 3K4KA 1D5YA 5ICEA 2WAQN 1H9TA 1R4NB 5F1RA 1FZPB 1JXSA 3T0YA 2VJIA 1LB2A 3K1NA 1YX3A 3SDGA 5J8FA 3NPIA 2LTPA 3BQYA 1Z77A 4Y17A 4GYIA 2A69F 3VOEA 3HKZN 4LLNA 2P0WA 5BMZA 2HQNA 4CCMA 1YS7A 4N9IA 2JVHA 2LOOA 4JBAA 2IXSA 4IRHA 2M4GA 2DXIA 1BW5A 5AIQA 4WCGA 4DQ2A 1AA7A 2XB0X 4PJJA 3I58A 4ZYGA 1I5ZA 3SQNA 4AD9A 4NHJA 4G7OF 2PFVA 4FX0A 2M8GX 2FD5A 2X1EA 5FO5A 4KN7X 4NC8A 2IGNA 3BPXA 5HDKA 2EFNA 3K6GA 2E7XA 1W5CC 1ZR2A 1VQOI 2GIZA 3DFGA 1I3AA 2X6OA 4GCKA 1OCRH 2CH0A 2OZUA 1K83J 3ELKA 2K27A 2HZTA 1O3QA 4X0GA 2QKMB 4G6DA 3OIPA 3WU1B 3CCJI 4HAMA 3V7CA 2GXGA 1WVRA 2PMUA 1B59A 1GVDA 2LREA 3ON2A 4PJLA 5EJCA 1W7PA 2ZNZA 3FBIB 4C2MA 4IQ4A 5HSZA 1WJ5A 4BXFA 2LVSA 2VJ5A 3IAS2 3VPRA 1IDZA 4CUGA 5JHUA 2XASA 2EBIA 3IWZA 3LFUA 5B3SH 3CUQC 2KJCA 3CLQA 2BGCA 2VQCA 4JX5A 5C4YA 1D8JA 2LC2A 2FRHA 4XQFA 2JSCA 4KITB 5J1YA 1MZBA 3PFIA 3DEUA 1EV7A 1SAUA 1U78A 4R8HA 3U1DA 5CKTA 3ABUA 2CW0F 2KLOA 4PCQA 4O5VA 3DBRB 4XOTA 2KDOA 2V9PA 4BYYA 1S29A 3WU2C 3HIFA 1SFEA 3ZMDA 2ZJ2A 2VONA 2QVOA 3M8EA 3VOXA 3KP2A 1FT9A 3WG7H 3T5XA 2DODA 2A61A 3TGNA 4AYBA 3JAMK 4U7BA 1ZG3A 3JSJA 2PBIA 4M6XA 4AC6A 4F93B 2XPUA 3FHNA 2WY8Q 2XAQA 3EPZA 4DIQA 5LLQA 4IJAA 1W5TA 5JHFA 4A3KJ 3S1NJ 1MMSA 1RETA 2EV6A 3T6NA 3SFZA 1UFMA 2KRHA 4A3JJ 3M07A 2FQ4A 4D1QA 3HM5A 3RTRA 3OV8A 5EDNA 2M4KA 3FXQA 5HVQC 1SC7A 5B5EC 3GXOA 1ZR4A 1XG1A 1A6IA 1NG6A 4XLFA 3COAC 1NK2P 1T38A 2X51A 1YW8A 4I01A 4P9UA 5LGNA 1IUYA 4PSWA 3FXKA 4LK0F 4XRFA 1ON1A 1K6OA 3BR1A 2Y0MA 3LWFA 4GXOA 1H9GA 1XD7A 4I6ZA 3AQSA 1T8IA 2NVXJ 2K9SA 2UZKA 2ZFUA 2QTQA 3P9TA 4GCLA 1T6SA 1MGTA 1F43A 4UUSB 1BR1A 3GZNB 3HPHA 3MKYB 1R00A 1Y0NA 2QWWA 3PIPF 3EUPA 2CU7A 2LKPA 2ZFWA 2DA1A 1U9OA 3F0CA 4KMUX 2HYFA 5IT3A 3CUOA 2VIXA 2ZKZA 2DOAA 4IX7A 3ZPLA 1QO0D 1FOWA 4BEHB 4GFBA 3PNTA 4XOPA 1FMVA 4CYCB 1ZAOA 2KFDA 5KAIC 1ZG5A 3OSFA 2KZVA 4MO7A 5F0FA 4UVBA 3KZ9A 2H1KA 3VVZA 1MBGA 2HOSA 1NHAA 3EUAA 1XSVA 1QPIA 1ZTRA 4BBSJ 5J6XA 3S8PA 1XGSA 1TT0A 2K02A 2NOGA 3CJRB 2DK5A 1HC8A 1WZ2A 2IW5A 3NS4A 1YRNA 3HRUA 2OZ6A 2DA2A 4A5MA 2O8KA 2GBYA 2DK8A 3BR3A 4EGZA 1USTA 4L9JA 2ME0A 3ZN1A 1BI1A 5D5VB 5BOXA 2FMLA 2ID6A 3TO6A 4Q4ZF 1E17A 5M3FJ 3M7GA 1G4DA 3F6OA 3GZIA 5TGTA 1UELB 1TL8A 2PI0A 3HXLA 5D4RA 2KHMA 3QPLA 2HXIA 2R4GA 2ZO4A 4NQWA 5EZGA 4BXXJ 5EGOA 3ZQCA 3ANPA 4ABZA 1S7OA 2G9WA 4CHUA 3G7RA 1YE9A 1OYWA 2F6CA 4KT6A 3VVXA 3KP6A 3DP7A 3WTZA 4YRVA 1QBJA 3NRGA 4EM1A 1H0MA 1KQ0A 3OIQA 2ZXHA 4FHTA 5FGMA 2JT1A 2ELHA 1FPQA 3K8PC 3MMYB 1V5FA 2Q0OA 4NC7A 2XPWA 1ONVA 2O0YA 4G12A 3B6CA 3TOBA 4AC0A 4I7HA 5JLXA 5HNHA 2LF7A 4WX9A 2UXIA 2IGMA 5EEHA 5FFZA 1T95A 3R61A 1JKQC 2H94A 5L3FA 3S1MJ 1VF9A 2BOLA 4ZZLA 3BJOA 3R4KA 1VI0A 5ICFA 3BTIA 3KZZA 4OD4A 2R5YA 1E3PA 4BQNA 1TWCJ 3K4JA 3T1BA 2XSDC 1WWXA 5LRSA 3E0JB 3ZMZA 1HLVA 2ZCNA 2WB1N 1XMXA 3Q5FA 3ZXSA 2W84A 1JE8A 5ILUA 3C2HA 3CC7I 1I1SA 4F7ZA 1P9QC 1ORKA 2QKLB 3S2WA 2Z2SB 5D5XB 4UY8I 4BNCA 1W7PB 2R92J 1JKRC 4LB6B 3HBLA 1FTZA 2RVCA 2VBYA 1JJ6C 2O03A 1XCBA 2V9VA 4BXUA 3CMEI 2VOPA 4BE0A 2NAZA 2LMDA 3A02A 3GFJA 1ZQ3P 3VYUB 4P9FA 2K3PA 1RI7A 1MNEA 1ETOA 1Z3YA 2GXAA 1UI5A 2HKOA 4PJMA 3VOKA 3L09A 4OMYA 2HR3A 2NOJB 2KPMA 1DDNA 2P6SA 5L3EA 2CO5A 3K2AA 3FBNB 3SWHA 3B73A 1F1ZA 5FGLA 5KK1A 1HKQA 3O2PE 2M45A 2KRFA 3HHHA 1UMQA 3RPUA 3J7YJ 4OD5A 3HPGA 3DF8A 3HE0A 3OWTA 2E36A 3NNRA 4A3FJ 1W0TA 3WTUC 1U6GA 2XAFA 4II2A 4BDZA 1S5LC 3V78A 5IYBJ 4DOZA 1DP7P 2KJBA 4I98B 1OCTC 3O6BB 3ULQB 2KIQA 1ZH5A 1DPUA 1WJAA 2BXYA 2DFIA 4BE1A 5DCMA 2CV1A 2R7QA 1JKOC 3DPJA 2DFEA 4DW6A 5K7FA 2GWRA 4U9NA 3GLXA 3VYTB 4XBFA 1Y0UA 2EZKA 4BY7J 3QU3A 3S2DJ 1HOMA 2GFNA 2K4JA 3FZVA 2IS2A 4HEA2 1RR8C 2K85A 4M6VA 3BTLA 5DTDA 4NELA 2CGPA 5EFYA 4RM3A 5LRRA 1IV8A 2ISYA 4YFKF 5HBUA 4LOCA 2DA4A 1YJ9I 2E2HJ 2REKA 4IHYA 3L00A 2STWA 1TNTA 2VPLA 1O7LA 4HLYA 1T0FA 5IPAA 1T08B 3GUDA 4W1UA 5M5XJ 1JTYA 2L9RA 2HXOA 4YELA 3TDUC 2VI6A 3HTUA 4IF4A 4CCNA 2Z5UA 5HLGA 3BR5A 3GBGA 1LE8A 1ZGJA 3TP3A 2MBFA 5E1WA 3H9QA 4B47A 4DGWB 3GFLA 4HV6A 1MSEC 1RZ4A 2OCCH 1A31A 1MH4A 4BU2A 1YFHA 3E1SA 3I5UA 3COLA 2PJRA 2HTJA 3VYRB 4GCVA 3LA2A 3S14J 2GA1A 5H20A 1FC3A 1D0YA 3D5SC 4V19K 1X4OA 1I1GA 2E19A 4HG2A 5C3EJ 1UAAA 2DMUA 4AIHA 2FSWA 3ZOBA 5HLTA 3HOSA 1IN6A 4EQQA 1OISA 1JJ8C 4P1WA 1IRZA 2L02A 4HX8A 4C3IJ 3RPQA 3O8GA 2QBYA 1OJLA 4LGWA 4M3DA 5IYDJ 2R7TA 4IZZA 3A2KA 2VXZA 3FM3A 5IP9J 2CUEA 4D0PA 4KA4A 2UUZA 2HWVA 4RGXA 3CC2I 2BVMA 3A1YA 4ITVA 1FX7A 2P81A 5ILVA 3OY9A 2DDAA 4FQGA 2DYSH 3RQ4A 1KU7A 4AM3A 3FMQA 2MC3A 2HOTA 2FJI1 5FKLA 1IN8A 4BAYA 1SANA 5EGOB 3QAHA 4DZJA 3DLLF 4ZZDA 2HI3A 1K4SA 1V5EA 5LGUA 4XRSG 3GTKJ 2JQ7A 2B3WA 4ZYHA 3PIOF 1R1UA 4IHVA 2WUIA 3I55I 1KYZA 2JVGA 3S17J 1CQTA 3Q0VA 4WF2A 1GUUA 2QENA 4L9TA 3CMMA 4LFUA 1BI2A 1WKMA 4OMZA 1PJRA 1OPCA 2R3SA 3HJEA 4MTEA 3PQJA 4EATA 5FLXZ 5F0CA 3K4BA 4A6EA 1KGSA 4YFNF 2HYJA 2WBMA 1IXCA 1Z0XA 1YIJI 3ZMVA 2BBYA 2NS0A 1OCCH 4C2MJ 2IEKA 4CGRA 2R5YB 4XLHA 3PPBA 1LEAA 2KIUA 4EJUA 3OR2C 4QPOA 3MKWB 3CP2A 3C1DA 4LG0B 4RAYA 4MK6A 5JI6A 2LBFA 3KE2A 5JLWA 2L9VA 4BE2A 4DBQA 3OYIA 2QQAA 4KIFA 3CCSI 5F1JA 4BQQA 2D5VA 3VFZA 1MBEA 2ZXWH 1XCVA 3FXRA 3H36A 4ZTFA 3BZKA 1O7FA 3K69A 4FT8A 4IOAF 2OI8A 1D3YA 3VWBA 3MAJA 3KLNA 4UDSA 3MQ0A 2F5EA 5FMPA 5LEKA 3BQZA 1FIPA 3ZMSA 2PZ9A 1R9TJ 4FETA 3F22A 3OS2A 1X1PA 5KNLA 4A12A 3P9KA 2V6EA 3FISA 3K1PA 4M6YA 3OYEA 5D1RA 5HS8A 3RIRA 3AL0C 1DGRM 4I0AA 2DMPA 1LVKA 1IC8A 5LEJA 3JW4A 1QZEA 2M5WA 3ON4A 2YR2A 1AKHA 5E79C 2ZCXA 1ZLKA 2HPIA 2VXDA 1ODDA 2PG4A 4UB6C 4PDKA 3IKTA 5EZHA 2O7OA 2V57A 4CYDA 4G94A 2HPMA 5IT9Z 3QU6A 2DJIA 3C2GA 3NRVA 2L3DA 3VTIA 1XDUA 1R71A 1IRGA 4MIMA 2ZSHB 4XM3A 5DCMB 3BG9A 1ACIA 3RKYA 4RLQA 3H1CA 4CCKA 1TNSA 3MKZA 3GZ5A 3GTPJ 1Z21A 4MEXF 1XB4A 1RRJA 2AXTC 3KP7A 1YI2I 2NP3A 2UXUA 2BE5F 3PASA 4AIKA 3NWSA 4RB3C 4I09A 1Y39A 1SFUA 2E71A 2V1UA 2CQXA 5E18F 2EFPA 5F64A 3A01A 2XDNA 4PJNA 4LK1F 3E6BA 2VQGA 3D0SA 4RDUA 3J81Z 3DEWA 1QZYA 3IH4A 3VP5A 4BACA 2DN0A 3OYBA 1QGPA 4ESJA 2FXAA 5GADJ 1J09A 5C44J 1G6NA 1ETWA 4U0YA 4MQVA 5D19A 4UUSA 1QHHD 4N0BA 1Z67A 2V1XA 5DM7F 3VW2A 2GA2A 4ESFA 2Y9ZA 5HDNA 1I27A 4NBQA 1Z05A 5B66C 1LE8B 2A5WA 1FJLA 4XL9A 1FBQA 2MH9A 2EFQA 1T33A 4UB8C 5CVVA 4UUVA 1DU0A 4HX4A 2L4MA 4CGZA 4CYCA 2E1MC 2PJRB 2PBXA 2K3FA 3EETA 3ZCOA 4AIDA 3HZJA 4U87A 2L2OA 1USSA 2UXNA 4HF1A 2HOAA 4PXIA 3MFKA 4IRVA 1ETYA 4HA8A 1JUPA 2E1OA 2L7ZA 4FE7A 5LHIA 1YHQI 1A36A 2P4WA 1DPRA 3FMSA 3BTCA 4OU0A 2QBYB 3GTOJ 3ABKH 5GTIC 3CESA 2H27A 3VSLA 3Q0WA 3CZ6A 4M3BA 3OYGA 1TW3A 3BJAA 1F9NA 1RUOA 3CLOA 4PGHA 1JUMA 4UVCA 1FOYA 2XKOA 3MVPA 3BG3A 3WGGA 3CCRI 5CXIA 2EJRA 3AG2H 4C9YA 2DPDA 4BHBA 3IKVA 2ZJQF 3ONQA 3CDIA 2TDXA 1OFCX 3BPVA 3K4LA 4LIVA 1PUFB 1VQ6I 2BY0A 3TKYA 4D5FA 3IWFA 3BHQA 3HTAA 1HW5A 4JK1X 1YS6A 2RN7A 2W48A 2F4MB 2HEOA 2MG4A 2LD5A 3R0JA 2EK5A 4PGGA 2ME6A 3V8JA 4XK4A 1VTNC 2NVQJ 3IHUA 5M5YJ 4V2FA 3D5LA 2KKOA 1SMYF 2HOEA 5TISC 1W4MA 2UXHA 3Q3SA 5B1AH 4C2TA 2GM4A 1EH8A 1GXPA 4IRIA 4G9YA 2YVHA 3F23A 1VQ9I 2D1VA 2CQNA 3OS1A 4XN0A 2YU3A 5HLIA 4E7SA 3Q0UA 2RC4A 2LK2A 1GT0C 4UV8A 2F48A 3FKIJ 3CCUI 5E1XA 1FSEA 2B63J 3F9KA 2CUJA 5EEAA 1J2XA 2DYRH 3GTQJ 3AFHA 1FBUA 4FCYA 1Y6IA 4HSTA 2A6TA 1MJBA 3PO2J 3M4OJ 1D8KA 1RUNA 2IPQX 2OJED 4AYBN 5FLXK 1BIBA 2BYVE 2J5PA 3KP3A 2LBFB 5HODA 3HOTA 1VFCA 2JUCA 3QOEA 2VL8A 2G7GA 3CQZJ 3QPSA 5CVRA 1MMAA 3RYPA 4RAZA 2WAQA 3BROA 5FRMA 1IUFA 3V8KA 2BEOA 2O8XA 3LMMA 4OIQF 1JTXA 2LY1A 1RNLA 4UNOA 1J75A 1HQCA 4C3HJ 2D1HA 3L1PA 1VQLI 2O3FA 3K70C 3ZN0A 2Y75A 3CCEI 3LA3A 2R7WA 3LSHA 3REOA 4WWCA 4A3DJ 3HKZA 2BVLA 1K61A 4LLGF 1QPMA 3KYCB 3I54A 3O60A 2L9NA 2CV2A 2Q1ZB 1WJCA 2BXZA 3DKYA 3ISPA 3LSGA 2KRCA 2JPBA 3M8FA 4E7JA 3K10A 2P7CB 3C7JA 1GV2A 2ELKA 3F1BA 2L01A 3FK7A 2MLGA 1IN5A 1P7JA 1NTCA 1SFKA 5D8KB 1IF1A 2HDDA 5DM6F 3DBHB 1AKHB 3CO7C 3SDBA 3BTJA 4GRIA 4E7HA 1PP7U 2ESNA 2RQPA 3TMOA 9ANTA 2QSHX 1B72A 1WCMJ 4N4OB 4L9NA 3FM5A 3F8CA 2BHYA 5C4XJ 1HKTA 4HBLA 1DUXC 1XSDA 2Q24A 5F04A 1TP4A 1A35A 3W6KB 5GAHJ 3IP4B 1LNWA 1OYYA 3SHFA 4MEYF 2COBA 2H8WA 3RI4A 1CF7A 2M0MA 5K7ZA 1PDNC 2GOMA 1KU2A 1RR7A 1S72I 2EPFA 3SZPA 5K5RA 2VPRA 2DTZA 4Q48A 5FD6A 3CD6I 1OR7A 2LY2A 4IHXA 2V9KA 2ECCA 1X3WB 5IT9K 1P92A 4UHTA 1D1BA 3A01B 2VC1A 1X2MA 1G3SA 3DTIA 1Y1VJ 1ZN2A 1BC8C 2V4JC 1FIAA 1ITYA 1K6YA 2EIMH 3E5UA 4XORA 4I2OA 1IDYA 2M2EA 1SEUA 2EIJH 1H89C 2LG4A 3HTSB 2ISZA 2W00A 1VQKI 2XGDA 3FWEA 3I0TA 3S16J 2EZLA 5GP9A 4A0ZA 2J5OA 3HHGA 3ZQ7A 3B6AA 4BGDA 1T56A 2FA5A 3ESWB 3SEQA 2XROA 4ENJA 1W1WE 4KIBA 3F8MA 4EJWA 2Z16A 4CXFA 1ZKGA 3VB2A 4A2UA 5BQTA 3OYJA 5H9TA 3BG5A 5BPDA 4RAGA 1R5ID 1MD0A 5E3NA 4B1RA 2XGCA 3FMRA 4F91B 3DKWA 4ON0A 3HL2A 2UXOA 1VQ7I 3WHCA 4A5NA 2R5ZA 2F4IA 2VT2A 1FOKA 2ID3A 4AUXA 1HF0A 4QWQA 3FXUA 3H3VK 1UJ8A 4WXCA 4KUMA 1Z7UA 2P8TA 4L0YB 3ABTA 1O3RA 4G8XA 3LNQA 3H5AA 2M87A 1XX5A 1JUSA 2OTJI 2Y69H 3H0GJ 1FOXA 2DT6A 2AHQA 4DBRA 2W85A 3G4SI 4Q5SF 2ZNYA 3HRSA 4QTRA 2PLYA 2L7FP 3HSFA 1G3YA 1MIJA 1ETQA 3DU6A 3FKJA 2YU9J 2VQHA 1YLFA 4A0XA 4H0EA 3HOUJ 3K4CA 4HNVA 1XGNA 3V42A 1HW1A 2VOOA 3K2ZA 3KYDB 4U7DA 4KISA 4BHPA 1SVLA 1EA3A 3FF5A 5A2QK 2QOPA 2EILH 2ZXIA 1UHSA 3G71I 1CGPA 4IXAA 3RQIA 2DFHA 1LQ1A 1WFXA 3OYFA 1QNTA 1PVEA 1S3JA 3CDLA 3K0LA 4IQJA 2DU9A 5LGTA 3S3OA 4QSHA 3ZP5A 1Z6TA 1QQIA 4BBRJ 4FTHA 1HSTA 5J1RA 2EA2A 1Q1VA 2NS7A 2O6GE 3VVYA 4MLOA 2ZCMA 3MN2A 4JQFA 4ENKA 1T39A 1EH6A 4J01A 2ZMEA 4BJ6C 2DQRA 1HKSA 4BH9A 2DCEA 3UNGC 3MD2A 1ZG1A 3QQAA 4A3IJ 1V4RA 2QA4I 2NYXA 2VODA 1SAXA 3QYEA 3V8LA 5C4JJ 4LG0A 2IA0A 1BM9A 1VQ5I 2ETHA 3HOWJ 4GGGA 3PNVA 3LJLA 3P9IA 5FKOA 2D2WA 4EJOA 2LRDA 1T0FC 4NUBA 4Y4RA 1I6HJ 3OYCA 2GOXB 2A3SA 1QHGA 5DS9A 1TT5B 5CLSA 5DUIA 3QRFF 3LWJA 3FK6A 4LG3A 5F27A 4YG2F 2GLOA 2IGKA 1MH3A 3OMYA 1IJWC 2LKSA 3GFMA 3QYBA 3L2WA 2W53A 1I3QJ 4JP0A 5CQGA 1XC5A 2VUMJ 3TBIA 2BHZA 2IVMA 2QQBA 4V2GA 3CTAA 2HKUA 2R7SA 2R7XA 3HOYJ 4HQEA 1MBJA 3PUFA 1B6AA 1TQMA 3LAPA 3MEXA 1LFUP 3IRQA 1JGSA 2DA3A 4B09A 1Z9CA 4XNFA 4MHGA 4A3GJ 3G1MA 3L2RA 4DNCA 4P96A 4WK8F 2K86A 3ZQFA 1B72B 5DD4A 2Y0SN 2CV0A 2FBKA 2R7UA
chains in the Genus database with same CATH topology
1ENHA 5EF6A 2IU5A 2NVTJ 3W6VA 4MK6A 3SDGA 3NPIA 5JLWA 2LTPA 1B8IA 3BQYA 2D5VA 1Z77A 3HTHA 2MW8A 2PMZN 5F1JA 4JKZA 3HKZN 3JRAA 1WH5A 1MBEA 4IEJA 3BR6A 4XRSA 2OI8A 1I50J 4UDSA 2M9HA 3CRJA 3OIOA 1BW5A 5FMPA 3BQZA 1FIPA 2YS9A 2PZ9A 1R9TJ 2XB0X 4JX4A 2CQQA 3K7AJ 4ME9A 4J19A 3FISA 3OSGA 5D1RA 1VNDA 3JRBA 2M8GX 3NI7A 2FD5A 4KWAA 2DMPA 3OOUA 1IC8A 3VIBA 1ZR2A 3ON4A 1AKHA 2X6OA 2ZB9A 2ZCXA 4GCKA 2YUSA 1K83J 2JWTA 1MNMC 1AHDP 2FBQA 5F08A 2E2IJ 5EZHA 2O7OA 2V57A 1UI6A 3SJMA 4AF5A 1GVDA 2R93J 4MIMA 4JL3A 2RASA 2FX0A 3ON2A 1JGGA 5FJ8J 2XB5A 2AO9A 3JR9A 3BG9A 5HSZA 2HYTA 2LVSA 4I76A 3GTPJ 3VPRA 2R5ZB 2CJJA 3BRUA 2NP3A 3NXCA 3PASA 2UXUA 1IDZA 4DYCA 2EBIA 2CQXA 4JX5A 4M3GA 3JRFA 5C4YA 2XPVA 1HDPA 5F0HA 3A01A 1ZK8A 5J1YA 3HTJA 2XDNA 4RDUA 3DEWA 1U78A 3RZOJ 3IH4A 3UKGA 2LFBA 3BCGA 3VP5A 3LSRA 4A69C 2DN0A 1OCPA 3G1LA 1EF4A 3B81A 3CMYA 2JJ7A 4XRMA 5C44J 3O8HA 1ETWA 2FJ1A 3BJBA 3HGGA 1PUFA 5D19A 4UUSA 3JRGA 1BJZA 2KT0A 3VOXA 5K7HA 1GV5A 2CRGA 2WGBA 3VW2A 1H88C 3VW0A 1POGA 2TRTA 1ZGWA 2Y9ZA 2LY9A 1FJLA 1LE8B 3I4NJ 3JSJA 4AC6A 1T33A 2XPUA 4MFDA 1DU0A 2JMWA 4CYCA 4A3KJ 2JA8J 1TWFJ 3S1NJ 1RETA 2PBXA 1A5JA 3T6NA 4A3JJ 4W97A 3S5RA 2FQ4A 3HTIA 3HM5A 2G3BA 3QBMA 3HGYA 5EYRA 5EDNA 4QIWN 3TW6A 3HIMA 1JT6A 1BA5A 2HOAA 4PXIA 2DJNA 1ETYA 1U8BA 1ZR4A 1XG1A 1A6IA 1JUPA 2E1OA 2L7ZA 4FE7A 1NK2P 3QKXA 4NN1A 2ZOZA 3BTCA 3GTOJ 2R0QC 2Y30A 3Q0WA 4M3BA 1TC3C 3BR1A 3SFIA 5EG0B 1GDTA 2JA5J 1JUMA 4XIDA 4I6ZA 3MVPA 3BG3A 3AQSA 2NVXJ 4MXMA 5CXIA 2RHAA 2K9SA 2QTQA 5CXGA 3P9TA 5J1UA 4GCLA 1OFCX 1F43A 1PUFB 4UUSB 1QRYA 2Y31A 4D5FA 5E3OA 3BHQA 3HTAA 2QWTA 3BR0A 2O9LA 2X9DA 4GCTA 3EUPA 3HEFA 2CU7A 4L5EA 1P7IA 3RKQA 2W48A 2DA1A 1U9OA 3F0CA 3RZDJ 4XICA 2MG4A 2ZOYA 3G1OA 2LD5A 2ME6A 4XK4A 2QF7A 2QIBA 4FE4A 2NVQJ 5M5YJ 4V2FA 2JN6A 2D6YA 4YZEA 2DMNA 4GFBA 2JK3A 2UXHA 4CYCB 3HDDA 3Q3SA 2GM4A 2YVHA 3OSFA 1BL0A 1MSFC 4MO7A 5F0FA 3KZ9A 1MBFA 4X1EA 2H1KA 1MBGA 2HOSA 3S15J 5FKNA 2NVYJ 4EEFG 1XS9A 2XRLA 3Q0UA 1QPIA 1ZTRA 2LK2A 3ZQLA 1GT0C 2DG8A 5IOYA 2G7LA 3JRDA 4BBSJ 1RKWA 3FKIJ 1MBHA 1SFOJ 2K9QA 3PM1A 2NOGA 2B63J 5EEAA 5IP7J 1YRNA 3GTQJ 2DA2A 4FCYA 4A3EJ 3LSPA 2O8KA 2GBYA 3BR3A 3PO2J 3NAUA 3M4OJ 4AYBN 3JRIA 2ME0A 1VFCA 5HODA 1B8IB 2G0EA 2G7GA 2ID6A 3A03A 2RAEA 3CQZJ 3QPSA 3VW1A 5M3FJ 1UG2A 2LP0A 3GZIA 4S0HB 1IUFA 3FIWA 3QPLA 2HXIA 1JTXA 5EZGA 2KDZA 4BXXJ 5EGOA 3ZQCA 4C3HJ 3L1PA 4ABZA 3ANPA 3G7RA 3VVXA 5D18A 4A3DJ 4D7NA 5M5WJ 1K61A 3JREA 3NRGA 5GPAA 3O60A 3FRQA 3JRCA 2XPWA 1APLC 3LSGA 4G12A 2G7SA 3B6CA 3HOZJ 4AC0A 5JLXA 3C2BA 1GV2A 2ELKA 4RBOA 2UXIA 2HDDA 3FK7A 2O7TA 1P7JA 3F1BA 1NTCA 2JA7J 4GFLA 1AKHB 1JKQC 3S1MJ 3BTJA 1JT0A 1VF9A 4UUTA 1FEXA 1TWHJ 4A93J 9ANTA 1VI0A 2Y2ZA 5FHPA 3LOCA 3BTIA 5AQCA 2R5YA 1B72A 1WCMJ 1S7EA 1TWCJ 3HOVJ 2XSDC 2ECBA 1HLVA 1YRNB 2EQRA 3ZQIA 3NARA 2WB1N 2ZCNA 2K40A 5C4XJ 1E3OC 2Q24A 2DMTA 5F04A 2OF7A 1ORKA 5M3MJ 3LSJA 3IH2A 4B3AA 5FLMJ 3TEDA 1Y1WJ 3S1QJ 2COBA 2K9NA 1JKRC 2R92J 3HBLA 1FTZA 5K7ZA 1X2NA 1JJ6C 2JA6J 4DYQA 3CWRA 1RR7A 5DAJA 5K58A 2DMQA 3A02A 2VPRA 2DTZA 1ZQ3P 2QKOA 2NP5A 1ETXA 3BR2A 4IHXA 2ECCA 1ETOA 1U9NA 3G56A 2OPTA 2QCOA 3EGQA 3A01B 1UI5A 3VOKA 1X2MA 2F07A 4B4CA 5GPCA 2DA6A 1Y1VJ 1HDDC 2WV1A 1ITYA 1FIAA 2TCTA 3GTJJ 1IDYA 3K2AA 2M2EA 3WHBA 4DZPA 1H89C 4BY1J 1X58A 1HCRA 2XGDA 3S16J 5FGLA 3KKDA 3E7LA 2EZLA 2DA7A 4IHWA 5GP9A 3MNLA 1UMQA 2EZIA 3B6AA 1NK3P 1T56A 5FKMA 3IUVA 3HE0A 3NNRA 2M34A 4A3FJ 1W0TA 4DYRA 1WGXA 4Y52J 4L62A 3V78A 2GUHA 1ZKGA 5IYBJ 2Y9YA 5H9TA 3BG5A 1OCTC 3LHQA 5E3NA 5FKKA 4JNNA 4B1RA 2XGCA 4A3CJ 1G2HA 5FLVA 1JKOC 3AQTA 3DPJA 2UXOA 2IBDA 4NDLA 4DW6A 5K7FA 3WHCA 3C07A 2R5ZA 3S2HJ 1RESA 2MGQA 2ID3A 2EZKA 4AUXA 4BY7J 4D5CA 1HF0A 1ETKA 2UXPA 3H3VK 3I4MJ 1HOMA 3S2DJ 2GFNA 4C3JJ 3JRHA 5IP6A 3LNQA 2EZHA 2OERA 1JUSA 4M6VA 3BTLA 5DTDA 2LLKA 4NELA 3H0GJ 1SGMA 1MBKA 3ANGA 5EFYA 2AHQA 5HBUA 3M3YJ 4LOCA 4QTRA 2DA4A 2E2HJ 2X48A 3KKCA 3MKLA 2L7FP 2REKA 1ETQA 3HB9A 4IHYA 3GTMJ 2M0CA 2YU9J 5HAWA 5BNGA 3HOUJ 2NX4A 1WH7A 4A3LJ 4HNVA 5IPAA 3CCYA 3GEUA 2VKEA 4W1UA 5M5XJ 3KNWA 1JTYA 2L0KA 4X6AJ 1F36A 2L9RA 1O4XA 2HXOA 1W0UA 2VI6A 2QOPA 1UHSA 3GTLJ 5IOZA 3BR5A 3GBGA 1LE8A 2EH3A 2I10A 3TP3A 1MSEC 2CUFA 3RH2A 2IAIA 4JX6A 3RQIA 4MFEA 1MH4A 2N8GA 1AU7A 3E7QA 4JYKA 3CJDA 3CDLA 4ACIA 3COLA 3IV5A 4QSHA 1IV6A 1RPWA 3ZQGA 3BNIA 3S14J 2LR8A 4BBRJ 4FTHA 3VVZA 1TWAJ 5J1RA 2E19A 2NS7A 1Q1VA 5C3EJ 3VVYA 2DMUA 4MLOA 2ZCMA 1QVUA 3MN2A 4M3FA 3ZOBA 2H8RA 4BKXA 5E3MA 4D7MA 5IYCJ 3PO3J 1JJ8C 1IRZA 4HKUA 3TW7A 2VKVA 4C3IJ 1QVTA 3O8GA 1OJLA 4Y7NJ 4M3DA 5IYDJ 2LKXA 1RKTA 3QQAA 4A3IJ 5IP9J 5EG0A 2CUEA 1BW6A 4M3EA 3DCFA 4A3BJ 1IG7A 3D1NI 5C4JJ 1WI3A 3BT9A 4ICHA 2P81A 1LFBA 3HOWJ 3LJLA 5FKOA 1H8AC 2HOTA 5FKLA 2DG7A 1I6HJ 2E2JJ 5CW8A 5DS9A 3VUQA 1SANA 5EGOB 1WPKA 3FK6A 5F27A 4DZJA 2GLOA 1FTTA 3LWJA 1IJWC 1MH3A 2HI3A 3GTGJ 4A3MJ 2W53A 4XRSG 1I3QJ 3GTKJ 3HOXJ 1DU6A 2MSYA 3RD3A 4JP0A 5J3LA 4GFKA 1XC5A 4IHVA 2GENA 2VUMJ 2WUIA 3S17J 1CQTA 4V2GA 3Q0VA 5E3LA 2HKUA 3V6GA 1GUUA 3TP0A 2HQ5A 3HOYJ 1JKPC 1MBJA 5F0CA 4FISA 1LFUP 2HYJA 2DA5A 1TWGJ 2DA3A 1Z0XA 2R7ZJ 1IGNA 2XGEA 1ETVA 4C2MJ 2YVEA 2L7MP 4A3GJ 3G1MA 2IEKA 4CGRA 2R5YB 1B72B 3ZQHA 3ZQFA 3PPBA 2Y0SN 2NS8A 3IH3A 1D5YA 2WAQN 3S1RJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ENH A;  5EF6 A;  2IU5 A;  2NVT J;  3W6V A;  4MK6 A;  3SDG A;  3NPI A;  5JLW A;  2LTP A;  1B8I A;  3BQY A;  2D5V A;  1Z77 A;  3HTH A;  2MW8 A;  2PMZ N;  5F1J A;  4JKZ A;  3HKZ N;  3JRA A;  1WH5 A;  1MBE A;  4IEJ A;  3BR6 A;  4XRS A;  2OI8 A;  1I50 J;  4UDS A;  2M9H A;  3CRJ A;  3OIO A;  1BW5 A;  5FMP A;  3BQZ A;  1FIP A;  2YS9 A;  2PZ9 A;  1R9T J;  2XB0 X;  4JX4 A;  2CQQ A;  3K7A J;  4ME9 A;  4J19 A;  3FIS A;  3OSG A;  5D1R A;  1VND A;  3JRB A;  2M8G X;  3NI7 A;  2FD5 A;  4KWA A;  2DMP A;  3OOU A;  1IC8 A;  3VIB A;  1ZR2 A;  3ON4 A;  1AKH A;  2X6O A;  2ZB9 A;  2ZCX A;  4GCK A;  2YUS A;  1K83 J;  2JWT A;  1MNM C;  1AHD P;  2FBQ A;  5F08 A;  2E2I J;  5EZH A;  2O7O A;  2V57 A;  1UI6 A;  3SJM A;  4AF5 A;  1GVD A;  2R93 J;  4MIM A;  4JL3 A;  2RAS A;  2FX0 A;  3ON2 A;  1JGG A;  5FJ8 J;  2XB5 A;  2AO9 A;  3JR9 A;  3BG9 A;  5HSZ A;  2HYT A;  2LVS A;  4I76 A;  3GTP J;  3VPR A;  2R5Z B;  2CJJ A;  3BRU A;  2NP3 A;  3NXC A;  3PAS A;  2UXU A;  1IDZ A;  4DYC A;  2EBI A;  2CQX A;  4JX5 A;  4M3G A;  3JRF A;  5C4Y A;  2XPV A;  1HDP A;  5F0H A;  3A01 A;  1ZK8 A;  5J1Y A;  3HTJ A;  2XDN A;  4RDU A;  3DEW A;  1U78 A;  3RZO J;  3IH4 A;  3UKG A;  2LFB A;  3BCG A;  3VP5 A;  3LSR A;  4A69 C;  2DN0 A;  1OCP A;  3G1L A;  1EF4 A;  3B81 A;  3CMY A;  2JJ7 A;  4XRM A;  5C44 J;  3O8H A;  1ETW A;  2FJ1 A;  3BJB A;  3HGG A;  1PUF A;  5D19 A;  4UUS A;  3JRG A;  1BJZ A;  2KT0 A;  3VOX A;  5K7H A;  1GV5 A;  2CRG A;  2WGB A;  3VW2 A;  1H88 C;  3VW0 A;  1POG A;  2TRT A;  1ZGW A;  2Y9Z A;  2LY9 A;  1FJL A;  1LE8 B;  3I4N J;  3JSJ A;  4AC6 A;  1T33 A;  2XPU A;  4MFD A;  1DU0 A;  2JMW A;  4CYC A;  4A3K J;  2JA8 J;  1TWF J;  3S1N J;  1RET A;  2PBX A;  1A5J A;  3T6N A;  4A3J J;  4W97 A;  3S5R A;  2FQ4 A;  3HTI A;  3HM5 A;  2G3B A;  3QBM A;  3HGY A;  5EYR A;  5EDN A;  4QIW N;  3TW6 A;  3HIM A;  1JT6 A;  1BA5 A;  2HOA A;  4PXI A;  2DJN A;  1ETY A;  1U8B A;  1ZR4 A;  1XG1 A;  1A6I A;  1JUP A;  2E1O A;  2L7Z A;  4FE7 A;  1NK2 P;  3QKX A;  4NN1 A;  2ZOZ A;  3BTC A;  3GTO J;  2R0Q C;  2Y30 A;  3Q0W A;  4M3B A;  1TC3 C;  3BR1 A;  3SFI A;  5EG0 B;  1GDT A;  2JA5 J;  1JUM A;  4XID A;  4I6Z A;  3MVP A;  3BG3 A;  3AQS A;  2NVX J;  4MXM A;  5CXI A;  2RHA A;  2K9S A;  2QTQ A;  5CXG A;  3P9T A;  5J1U A;  4GCL A;  1OFC X;  1F43 A;  1PUF B;  4UUS B;  1QRY A;  2Y31 A;  4D5F A;  5E3O A;  3BHQ A;  3HTA A;  2QWT A;  3BR0 A;  2O9L A;  2X9D A;  4GCT A;  3EUP A;  3HEF A;  2CU7 A;  4L5E A;  1P7I A;  3RKQ A;  2W48 A;  2DA1 A;  1U9O A;  3F0C A;  3RZD J;  4XIC A;  2MG4 A;  2ZOY A;  3G1O A;  2LD5 A;  2ME6 A;  4XK4 A;  2QF7 A;  2QIB A;  4FE4 A;  2NVQ J;  5M5Y J;  4V2F A;  2JN6 A;  2D6Y A;  4YZE A;  2DMN A;  4GFB A;  2JK3 A;  2UXH A;  4CYC B;  3HDD A;  3Q3S A;  2GM4 A;  2YVH A;  3OSF A;  1BL0 A;  1MSF C;  4MO7 A;  5F0F A;  3KZ9 A;  1MBF A;  4X1E A;  2H1K A;  1MBG A;  2HOS A;  3S15 J;  5FKN A;  2NVY J;  4EEF G;  1XS9 A;  2XRL A;  3Q0U A;  1QPI A;  1ZTR A;  2LK2 A;  3ZQL A;  1GT0 C;  2DG8 A;  5IOY A;  2G7L A;  3JRD A;  4BBS J;  1RKW A;  3FKI J;  1MBH A;  1SFO J;  2K9Q A;  3PM1 A;  2NOG A;  2B63 J;  5EEA A;  5IP7 J;  1YRN A;  3GTQ J;  2DA2 A;  4FCY A;  4A3E J;  3LSP A;  2O8K A;  2GBY A;  3BR3 A;  3PO2 J;  3NAU A;  3M4O J;  4AYB N;  3JRI A;  2ME0 A;  1VFC A;  5HOD A;  1B8I B;  2G0E A;  2G7G A;  2ID6 A;  3A03 A;  2RAE A;  3CQZ J;  3QPS A;  3VW1 A;  5M3F J;  1UG2 A;  2LP0 A;  3GZI A;  4S0H B;  1IUF A;  3FIW A;  3QPL A;  2HXI A;  1JTX A;  5EZG A;  2KDZ A;  4BXX J;  5EGO A;  3ZQC A;  4C3H J;  3L1P A;  4ABZ A;  3ANP A;  3G7R A;  3VVX A;  5D18 A;  4A3D J;  4D7N A;  5M5W J;  1K61 A;  3JRE A;  3NRG A;  5GPA A;  3O60 A;  3FRQ A;  3JRC A;  2XPW A;  1APL C;  3LSG A;  4G12 A;  2G7S A;  3B6C A;  3HOZ J;  4AC0 A;  5JLX A;  3C2B A;  1GV2 A;  2ELK A;  4RBO A;  2UXI A;  2HDD A;  3FK7 A;  2O7T A;  1P7J A;  3F1B A;  1NTC A;  2JA7 J;  4GFL A;  1AKH B;  1JKQ C;  3S1M J;  3BTJ A;  1JT0 A;  1VF9 A;  4UUT A;  1FEX A;  1TWH J;  4A93 J;  9ANT A;  1VI0 A;  2Y2Z A;  5FHP A;  3LOC A;  3BTI A;  5AQC A;  2R5Y A;  1B72 A;  1WCM J;  1S7E A;  1TWC J;  3HOV J;  2XSD C;  2ECB A;  1HLV A;  1YRN B;  2EQR A;  3ZQI A;  3NAR A;  2WB1 N;  2ZCN A;  2K40 A;  5C4X J;  1E3O C;  2Q24 A;  2DMT A;  5F04 A;  2OF7 A;  1ORK A;  5M3M J;  3LSJ A;  3IH2 A;  4B3A A;  5FLM J;  3TED A;  1Y1W J;  3S1Q J;  2COB A;  2K9N A;  1JKR C;  2R92 J;  3HBL A;  1FTZ A;  5K7Z A;  1X2N A;  1JJ6 C;  2JA6 J;  4DYQ A;  3CWR A;  1RR7 A;  5DAJ A;  5K58 A;  2DMQ A;  3A02 A;  2VPR A;  2DTZ A;  1ZQ3 P;  2QKO A;  2NP5 A;  1ETX A;  3BR2 A;  4IHX A;  2ECC A;  1ETO A;  1U9N A;  3G56 A;  2OPT A;  2QCO A;  3EGQ A;  3A01 B;  1UI5 A;  3VOK A;  1X2M A;  2F07 A;  4B4C A;  5GPC A;  2DA6 A;  1Y1V J;  1HDD C;  2WV1 A;  1ITY A;  1FIA A;  2TCT A;  3GTJ J;  1IDY A;  3K2A A;  2M2E A;  3WHB A;  4DZP A;  1H89 C;  4BY1 J;  1X58 A;  1HCR A;  2XGD A;  3S16 J;  5FGL A;  3KKD A;  3E7L A;  2EZL A;  2DA7 A;  4IHW A;  5GP9 A;  3MNL A;  1UMQ A;  2EZI A;  3B6A A;  1NK3 P;  1T56 A;  5FKM A;  3IUV A;  3HE0 A;  3NNR A;  2M34 A;  4A3F J;  1W0T A;  4DYR A;  1WGX A;  4Y52 J;  4L62 A;  3V78 A;  2GUH A;  1ZKG A;  5IYB J;  2Y9Y A;  5H9T A;  3BG5 A;  1OCT C;  3LHQ A;  5E3N A;  5FKK A;  4JNN A;  4B1R A;  2XGC A;  4A3C J;  1G2H A;  5FLV A;  1JKO C;  3AQT A;  3DPJ A;  2UXO A;  2IBD A;  4NDL A;  4DW6 A;  5K7F A;  3WHC A;  3C07 A;  2R5Z A;  3S2H J;  1RES A;  2MGQ A;  2ID3 A;  2EZK A;  4AUX A;  4BY7 J;  4D5C A;  1HF0 A;  1ETK A;  2UXP A;  3H3V K;  3I4M J;  1HOM A;  3S2D J;  2GFN A;  4C3J J;  3JRH A;  5IP6 A;  3LNQ A;  2EZH A;  2OER A;  1JUS A;  4M6V A;  3BTL A;  5DTD A;  2LLK A;  4NEL A;  3H0G J;  1SGM A;  1MBK A;  3ANG A;  5EFY A;  2AHQ A;  5HBU A;  3M3Y J;  4LOC A;  4QTR A;  2DA4 A;  2E2H J;  2X48 A;  3KKC A;  3MKL A;  2L7F P;  2REK A;  1ETQ A;  3HB9 A;  4IHY A;  3GTM J;  2M0C A;  2YU9 J;  5HAW A;  5BNG A;  3HOU J;  2NX4 A;  1WH7 A;  4A3L J;  4HNV A;  5IPA A;  3CCY A;  3GEU A;  2VKE A;  4W1U A;  5M5X J;  3KNW A;  1JTY A;  2L0K A;  4X6A J;  1F36 A;  2L9R A;  1O4X A;  2HXO A;  1W0U A;  2VI6 A;  2QOP A;  1UHS A;  3GTL J;  5IOZ A;  3BR5 A;  3GBG A;  1LE8 A;  2EH3 A;  2I10 A;  3TP3 A;  1MSE C;  2CUF A;  3RH2 A;  2IAI A;  4JX6 A;  3RQI A;  4MFE A;  1MH4 A;  2N8G A;  1AU7 A;  3E7Q A;  4JYK A;  3CJD A;  3CDL A;  4ACI A;  3COL A;  3IV5 A;  4QSH A;  1IV6 A;  1RPW A;  3ZQG A;  3BNI A;  3S14 J;  2LR8 A;  4BBR J;  4FTH A;  3VVZ A;  1TWA J;  5J1R A;  2E19 A;  2NS7 A;  1Q1V A;  5C3E J;  3VVY A;  2DMU A;  4MLO A;  2ZCM A;  1QVU A;  3MN2 A;  4M3F A;  3ZOB A;  2H8R A;  4BKX A;  5E3M A;  4D7M A;  5IYC J;  3PO3 J;  1JJ8 C;  1IRZ A;  4HKU A;  3TW7 A;  2VKV A;  4C3I J;  1QVT A;  3O8G A;  1OJL A;  4Y7N J;  4M3D A;  5IYD J;  2LKX A;  1RKT A;  3QQA A;  4A3I J;  5IP9 J;  5EG0 A;  2CUE A;  1BW6 A;  4M3E A;  3DCF A;  4A3B J;  1IG7 A;  3D1N I;  5C4J J;  1WI3 A;  3BT9 A;  4ICH A;  2P81 A;  1LFB A;  3HOW J;  3LJL A;  5FKO A;  1H8A C;  2HOT A;  5FKL A;  2DG7 A;  1I6H J;  2E2J J;  5CW8 A;  5DS9 A;  3VUQ A;  1SAN A;  5EGO B;  1WPK A;  3FK6 A;  5F27 A;  4DZJ A;  2GLO A;  1FTT A;  3LWJ A;  1IJW C;  1MH3 A;  2HI3 A;  3GTG J;  4A3M J;  2W53 A;  4XRS G;  1I3Q J;  3GTK J;  3HOX J;  1DU6 A;  2MSY A;  3RD3 A;  4JP0 A;  5J3L A;  4GFK A;  1XC5 A;  4IHV A;  2GEN A;  2VUM J;  2WUI A;  3S17 J;  1CQT A;  4V2G A;  3Q0V A;  5E3L A;  2HKU A;  3V6G A;  1GUU A;  3TP0 A;  2HQ5 A;  3HOY J;  1JKP C;  1MBJ A;  5F0C A;  4FIS A;  1LFU P;  2HYJ A;  2DA5 A;  1TWG J;  2DA3 A;  1Z0X A;  2R7Z J;  1IGN A;  2XGE A;  1ETV A;  4C2M J;  2YVE A;  2L7M P;  4A3G J;  3G1M A;  2IEK A;  4CGR A;  2R5Y B;  1B72 B;  3ZQH A;  3ZQF A;  3PPB A;  2Y0S N;  2NS8 A;  3IH3 A;  1D5Y A;  2WAQ N;  3S1R J; 
#chains in the Genus database with same CATH topology
 1ENH A;  2DTR A;  4EJT A;  2IU5 A;  3CCV I;  1R23 A;  2NVT J;  3BP8 A;  3CJT B;  1BR2 A;  2YX7 A;  1SMT A;  4LJZ F;  4IHS A;  1ZEL A;  2V1N A;  1CF7 B;  2PMZ N;  3F8F A;  4JKZ A;  1WH5 A;  2CW7 A;  3QP6 A;  3U1K A;  3TL4 X;  3BR6 A;  1J7K A;  4KNY A;  2WB1 A;  4XRS A;  4Y15 A;  2AXL A;  3CDH A;  3OIO A;  3F21 A;  1HW2 A;  1U2W A;  2DT5 A;  1LKX A;  3W3C A;  2DI3 A;  1SD5 A;  2M7A A;  3CCQ I;  3CF2 A;  4XON A;  1PYV A;  4JX4 A;  3L7W A;  4BDY A;  4ME9 A;  4HW0 A;  1W7P D;  4J19 A;  4II3 A;  3G6E I;  3F72 A;  4ASN A;  2VLA A;  4RB2 C;  1VND A;  3JRB A;  2WWY A;  4ETS A;  3NI7 A;  4HNU A;  4EJV A;  3KEO A;  2X6Y A;  2JUG A;  4KT5 C;  4B43 A;  3OOU A;  4KJZ A;  2FE3 A;  3VIB A;  3U2R A;  2W4S A;  3FXL A;  2XF6 A;  5LBQ A;  3GO5 A;  2G7U A;  4FAS D;  1LEB A;  2CFO A;  2B7E A;  2XF7 A;  2KL4 A;  2PX9 A;  3GF2 A;  4IRG A;  2E2I J;  1K79 A;  2V26 A;  1FWZ A;  1VQP I;  2F5D A;  2FEZ A;  3BJ6 A;  4YIF A;  5DUK A;  4M9X A;  1V54 H;  3RSN A;  1JGG A;  5FJ8 J;  2XB5 A;  2OTL I;  2HYT A;  3F8B A;  2NRA C;  3AG3 H;  4I76 A;  1ON2 A;  2CJJ A;  2R5Z B;  3BRU A;  2ADU A;  2ZC2 A;  1BC7 C;  5L3G A;  2ZBK A;  4IHT A;  2A6E F;  2XAU A;  3JRF A;  4M3G A;  4XKV A;  3KET A;  4OIP F;  2XPV A;  1HDP A;  4M74 A;  5EEG A;  1XMA A;  1ZK8 A;  5E17 F;  3HTJ A;  2DW4 A;  1KQ8 A;  2XC7 A;  3UKG A;  2F5V A;  2LFB A;  1FYK A;  3LSR A;  1XGM A;  3G1L A;  1EF4 A;  3B81 A;  2P7V B;  2LDU A;  4XRM A;  3V7R A;  1V5G A;  3GFI A;  2NNN A;  3WGH A;  5J47 A;  2HVS A;  3HGG A;  1PUF A;  1O3T A;  3H3Z A;  3JCU C;  1X1D A;  3JRG A;  2KT0 A;  2F5C A;  1XPX A;  1K7A A;  5K7H A;  1GV5 A;  2CRG A;  2WGB A;  2VN2 A;  1H88 C;  3VW0 A;  3RDI A;  2LY9 A;  5FRO A;  4MFD A;  1WJE A;  3K1M A;  3A4C A;  5JR3 A;  1UG0 A;  4ESB A;  2GIV A;  2JMW A;  1R58 A;  1TWF J;  2E34 A;  4W97 A;  2RDP A;  3IAM 2;  1TZL A;  2G3B A;  3QBM A;  2JRM A;  3PSF A;  2QQ8 A;  3NEU A;  1JT6 A;  3HIM A;  5KHD A;  1N77 A;  2AS5 F;  3G2B A;  3LQR A;  4HSR A;  2ZME B;  3QKX A;  1YO5 C;  3M8J A;  3WTS C;  5DEQ A;  2Z9O A;  2Y30 A;  4OIR F;  1VZ0 A;  5BPI A;  1TC3 C;  1Q1H A;  3HSR A;  1GDT A;  2JA5 J;  1W36 C;  4BS9 A;  2FNP A;  3LL7 A;  4MXM A;  3DTE A;  4N9H A;  4E4H A;  5CXG A;  1IRX A;  5ILS A;  1QRY A;  2Y31 A;  3EQL F;  3ERM A;  1XGO A;  2QQ9 A;  3AAF A;  3BR0 A;  3OYM A;  4AU7 A;  2X9D A;  2P5V A;  3NQO A;  4GCT A;  3HEF A;  4MQ9 F;  1P7I A;  3RKQ A;  4XIC A;  1KU9 A;  1R5H A;  5DDG A;  5DD8 A;  3IC7 A;  2PEX A;  4FE4 A;  4H4K C;  3I56 I;  2XRN A;  1LFP A;  1DP3 A;  3I59 A;  5CQE A;  2JN6 A;  2D6Y A;  4YZE A;  1PUE E;  2DMN A;  2PJP A;  1R6R A;  1J59 A;  3KYL A;  3OL4 A;  4N4N B;  4F92 B;  2DAO A;  3IUO A;  4HYE A;  3HC7 A;  1BL0 A;  1MSF C;  2ACJ A;  2V79 A;  4CSW A;  2OUM A;  4X1E A;  4Y13 A;  3VEP A;  2NVY J;  4EEF G;  4BHC A;  3KLO A;  1L3L A;  3FHZ A;  1X4P A;  3DU5 A;  2VJJ A;  2MD0 A;  5GAG J;  3ZQL A;  2DG8 A;  4QPQ A;  2G7L A;  2PQ8 A;  1NH3 A;  3I4P A;  3JRD A;  1RKW A;  5H6Q A;  4P5O A;  1MBH A;  2KMU A;  2M30 A;  1SFO J;  1SD4 A;  2HU9 A;  5CPR B;  4PK4 A;  3LAJ A;  4AIJ A;  2HDC A;  2XVC A;  3ZQQ A;  1BR4 A;  3H9J A;  4A3E J;  1SD7 A;  1Y8R B;  4UVA A;  3G3Z A;  3LSP A;  3WGI A;  1O3S A;  3NAU A;  3DTK A;  3PSI A;  2FMY A;  2E5N A;  3JRI A;  4BL0 B;  5CYV A;  3A03 A;  3WTT C;  3VW1 A;  1UG2 A;  2LP0 A;  4S0H B;  4ZYA A;  5HOO A;  3OYA A;  2YPR A;  4KYW A;  1WSU A;  1ZYR F;  2KQR A;  2LH9 A;  3ZRG A;  3KP5 A;  3ML6 A;  4IKF A;  1FY7 A;  4NC6 A;  4XKC A;  1NG7 A;  3I71 A;  3DPU A;  4ZH4 F;  1AWC A;  2I8D A;  4RS8 A;  1ERD A;  5GPA A;  1P4W A;  5L3C A;  1ZAR A;  4E7K A;  5LHG A;  3FRQ A;  3JRC A;  2FU4 A;  1XTA A;  2JPC A;  4DVY P;  4YFX F;  1AOY A;  1BJA A;  2G7S A;  5JVT A;  3C2B A;  1FLI A;  2LSO A;  4S04 A;  2JA7 J;  2LYC A;  1KA8 A;  2VBW A;  1FEX A;  1TWH J;  4A93 J;  1IXR C;  3RJP A;  4HLX A;  2CWE A;  4K2E A;  3LOC A;  2VJ4 A;  1TLH B;  2OQR A;  1L0O C;  3HOV J;  1FSH A;  2EA4 A;  2EQR A;  2XF5 A;  3NAR A;  3ZQI A;  3IL2 A;  5HS7 A;  2MD5 A;  5HNF A;  2Q8K A;  4EM2 A;  2DMT A;  5ERI A;  3W6J B;  3GVA A;  2OF7 A;  2XUB A;  5M3M J;  4L9V A;  3LSJ A;  1X3U A;  3S1Q J;  1Y1W J;  2HVR A;  4R79 A;  3RPU D;  1VQN I;  4M9Z A;  2EWN A;  1XN7 A;  1X2N A;  3K4N A;  3MCZ A;  1G59 A;  2JA6 J;  2QUF A;  4DYQ A;  1TQP A;  1TQI A;  4LMY A;  5DAJ A;  1BOB A;  4JOM A;  2DMQ A;  2CFX A;  2HNH A;  4CCL A;  4C2U A;  3LSK A;  2QKO A;  3V4G A;  3BR2 A;  3SXY A;  4RM2 A;  3TO7 A;  2GZW A;  4E7I A;  1ZRD A;  3M1E A;  2OPT A;  4BJT A;  3K9T A;  2F07 A;  3BDD A;  2DQL A;  2RNJ A;  2VC0 A;  5D6F A;  2DT7 B;  3V7S A;  5FB2 A;  2DA6 A;  3SZG A;  3LQQ A;  5GTH C;  1HDD C;  2P5L C;  1WRJ A;  1OCO H;  2QSG X;  2W7N A;  5HLH A;  3GTJ J;  2B0L A;  1LUJ B;  4YEJ A;  4DZP A;  2MFZ A;  4BJ5 C;  4EMS A;  4BY1 J;  1X58 A;  3PL8 A;  3CO6 C;  3CMA I;  1HCR A;  1F4K A;  3KKD A;  4XLE A;  2AQF A;  3E7L A;  3BZ6 A;  1RIO H;  3MNL A;  4RLF A;  5LFA A;  2EZI A;  1B4A A;  4BUP A;  1YTY A;  1NK3 P;  3IUV A;  1FYL A;  4MTD A;  4UV9 A;  2M34 A;  2RV8 A;  1SVO A;  4DYR A;  4Y52 J;  3F3X A;  2GUH A;  1FP2 A;  3OOP A;  1X1B A;  2FBH A;  1SFX A;  3LHQ A;  1X3Z B;  2RKH A;  4ZDP A;  5CVI A;  3W2W A;  1R1T A;  1P4A A;  1HBX G;  1I39 A;  2A5Y B;  4IPA A;  2WAF A;  1STZ A;  4A3C J;  1G2H A;  5FLV A;  4RGS A;  3AQT A;  2M1B A;  3FX3 A;  4AVP A;  2IBD A;  3C07 A;  4HQM A;  2STT A;  3U21 A;  3S2H J;  2IA1 A;  3EUH C;  3WE2 A;  4D5C A;  1MMN A;  4Z2Y A;  1ETK A;  1WJD A;  2VE9 A;  2A2F X;  4I99 C;  3I4M J;  1TTY A;  1J9I A;  4CCJ A;  3MZH A;  1OYI A;  1OR7 C;  5K5Q A;  2EZH A;  2K5C A;  4EM0 B;  2OER A;  3ASN H;  2PN6 A;  2M3A A;  1KZH A;  3H35 A;  1SGM A;  1MBK A;  3ANG A;  4OIO F;  3M3Y J;  1VQ8 I;  4ZYD A;  2IT0 A;  3MKL A;  3RKW A;  3HB9 A;  3R6S A;  3GTM J;  3LSI A;  4OOI A;  5HDG A;  1Z1D A;  2KP6 A;  3C3W A;  2NX4 A;  4RGU A;  3BCA A;  1XMK A;  4XR6 A;  4XN3 A;  3HG9 A;  3OL3 A;  1EJ9 A;  1B9N A;  2KIM A;  1D1C A;  3WOD F;  4X6A J;  1UZC A;  1R22 A;  2RRE A;  2XDV A;  2ZJR F;  3M9A A;  5J8C A;  2OBP A;  3EUK L;  4F55 A;  3GTL J;  4XMY A;  2XAG A;  2I10 A;  3ECO A;  2CUF A;  3QOP A;  2IAI A;  4JX6 A;  1G3T A;  2VKH A;  4GO1 A;  4HDU A;  1JI8 A;  3I59 B;  4JYK A;  2DLL A;  4B44 A;  1BI0 A;  3R0A A;  1PP8 F;  2DO7 A;  3OR1 C;  5KVR A;  2KZG A;  3BNI A;  3OS0 A;  3AKZ A;  2WY7 Q;  4L5J A;  1U5T A;  1A04 A;  1N78 A;  1DQU A;  4CZC A;  2YVX A;  2HQR A;  4M73 A;  2E7W A;  2P6T A;  4M3F A;  5DV5 A;  4BKX A;  5KAF C;  5E3M A;  2H8R A;  2HZD A;  5IYC J;  2PMH A;  4AWX B;  3PO3 J;  2DOE A;  1E0E A;  3N4M A;  1D0Z A;  2VKV A;  3EYY A;  3DWL E;  4Y7N J;  2LKX A;  2F2E A;  4LD5 A;  2DBB A;  5EG0 A;  4M3E A;  1Y8Q B;  4YII A;  2HYG D;  1Z6R A;  2E5Z A;  3WG9 A;  3GW2 A;  1WI3 A;  3BT9 A;  2QEX I;  2X6X A;  1DGW Y;  3QWL A;  4WXH A;  1WHU A;  2HTS A;  1F5T A;  2HDW A;  2VQL A;  3DXJ F;  3EUH A;  1FYM A;  1HA8 A;  3GX4 X;  1QZZ A;  3QP5 A;  2H6B A;  2VBZ A;  1REP C;  2HFH A;  2UXX A;  3DEE A;  4M72 A;  4CO8 A;  2F4O B;  3KX2 A;  2QYO A;  4HPQ A;  3UR3 C;  3WU0 A;  4NB5 A;  3L2U A;  4LIT A;  2FOW A;  1DU6 A;  5E8I A;  3P9C A;  2MSY A;  1T2K A;  3RD3 A;  5J3L A;  3L2Q A;  2JTV A;  3AG4 H;  2F5F A;  1I6X A;  3M1C A;  5E3L A;  2GAU A;  3V6G A;  2WC2 A;  3MZY A;  2BZT A;  2JA2 A;  2OC6 A;  3ZMU A;  2HQ5 A;  1OQY A;  2H1L A;  4RB0 A;  3A0H C;  2E1C A;  2RQQ A;  3E6M A;  2O5R A;  3GYH X;  4U0V A;  3PJR A;  4O3M A;  1YW9 A;  3KEQ A;  1R4M B;  4LIU A;  3MZ8 A;  4U0W A;  2Z3Y A;  1IGN A;  2XGE A;  2ZME C;  2YVE A;  3KPH A;  2LF8 A;  2OV7 A;  3ABM H;  5ED4 A;  2H09 A;  3J81 K;  4E7Z A;  2OQG A;  3IH3 A;  3S1R J;  3JTG A;  2MLK A;  3H5R A;  3P7N A;  1BBY A;  5EF6 A;  1R49 A;  3E6C C;  5D5W B;  3W6V A;  1KU3 A;  1YQA A;  1EH7 A;  2CMP A;  4NNJ A;  1IO2 A;  2P5K A;  2E1N A;  5D4S A;  1B8I A;  5TJJ A;  4F52 A;  3HTH A;  2MW8 A;  1FMW A;  3T8T A;  3ECH A;  3JRA A;  4IEJ A;  3E5Q A;  2IS1 A;  2L54 A;  3HUG A;  4B3X A;  4O6J A;  3CUQ A;  1I50 J;  1ZGA A;  2DDB A;  2M9H A;  3CRJ A;  3DKX A;  4IOC F;  4ZYE A;  1HXD A;  2YS9 A;  4ZDO A;  4U88 A;  3QYF A;  2BW3 A;  1Z7L A;  2CQQ A;  3BG6 A;  1TW2 A;  1UCR A;  1SVM A;  3BLY A;  3K7A J;  5JFR A;  2R7V A;  3Q9S A;  2X1C A;  2XGX A;  3OSG A;  4CZZ A;  5KCM A;  3AL0 B;  4KWA A;  5D6E A;  2R7F A;  2D45 A;  2VB6 A;  4QLC U;  1OLT A;  4OWR B;  1YIT I;  1BI3 A;  1S9H A;  2AQE A;  2ZB9 A;  2YUS A;  2ZY9 A;  3KIO A;  2EV0 A;  2JWT A;  2EIN H;  5H2F C;  1GVJ A;  3O3K A;  5F08 A;  1AHD P;  2I5U A;  1W36 D;  1MNM C;  2FBQ A;  2G7H A;  4RA2 A;  4E7L A;  1UI6 A;  1LDD A;  3SJM A;  4AF5 A;  1E2X A;  4GYG A;  3T8R A;  5CVJ A;  5E1Z B;  3PQK A;  4OAY A;  3JSP A;  2R93 J;  1MJA A;  5DCF A;  4JL3 A;  2RAS A;  1YG2 A;  2FX0 A;  3I64 A;  1IXS B;  4DJA A;  2AO9 A;  3JR9 A;  3S3M A;  3AG1 H;  2E60 A;  1P2F A;  1MDM A;  2WA0 A;  2VT3 A;  4HRI A;  4L0Z B;  2CQ7 A;  3D5R C;  4IL6 C;  4CA0 A;  3NXC A;  1LJ9 A;  4KIC A;  3E97 A;  4PSX A;  3H92 A;  4DYC A;  2K9M A;  4BQO A;  2VBX A;  5ICC A;  2K9L A;  5J4Y A;  1V55 H;  3BCB A;  5F0H A;  4GDF A;  1JHF A;  2FBI A;  2IA2 A;  2ELJ A;  2XAH A;  4KFC A;  3FXO A;  1LPQ A;  3RZO J;  3CCM I;  3BCG A;  1D1A A;  4OAZ A;  4A69 C;  1R1V A;  1OCP A;  1D0X A;  3CMY A;  2ZXJ A;  2JJ7 A;  3WTV C;  1MMG A;  1S8N A;  3O8H A;  2ZSI B;  2FJ1 A;  1BN5 A;  1QA6 A;  3BJB A;  1MJ9 A;  1Y56 A;  1KYW A;  4G6T B;  2VE8 A;  4B48 A;  1N25 A;  1SD6 A;  1U0J A;  1W5S A;  3TOA A;  3BZC A;  1BJZ A;  2C6Y A;  2IGO A;  3J7A O;  3H0D A;  4EV0 A;  1POG A;  2TRT A;  1ZGW A;  1XDS A;  3LSM A;  4RB1 A;  3W2V A;  2W1O A;  3I4N J;  1MMD A;  2NXN B;  2QGU A;  2Z99 A;  3TO9 A;  1FP1 D;  2E1M B;  1E3H A;  1K78 A;  2JA8 J;  1OKR A;  4WXD A;  2XAJ A;  1IW7 F;  1A5J A;  3S5R A;  2E35 A;  3G73 A;  4ENM A;  1U5T B;  3HTI A;  2UWM A;  3HGY A;  5EYR A;  2OU2 A;  4QIW N;  3TW6 A;  1BOA A;  3X2Q H;  1BA5 A;  2DJN A;  1U8B A;  2Z1D A;  1MKM A;  1MW7 A;  2A6H F;  2HS5 A;  3EDP A;  6PAX A;  4NN1 A;  2ZOZ A;  1GLN A;  3KZI C;  2R0Q C;  3KCC A;  3MWM A;  2Q2E A;  3SFI A;  5EG0 B;  4J00 A;  4FX4 A;  5AIP A;  3N97 A;  4XID A;  4WIB A;  1Z91 A;  5FFX A;  2Z33 A;  2RHA A;  3WE3 A;  2OD5 A;  4IO9 F;  2ESH A;  5J1U A;  5E3O A;  1G3W A;  4L5I A;  4HF2 A;  2QWT A;  5HS9 A;  1O57 A;  1WQ2 A;  4OIN F;  3GWZ A;  4G7H F;  1IRF A;  3PUB A;  2O9L A;  3HSE A;  1IN7 A;  3C18 A;  4L5E A;  3RZD J;  2HQA A;  2ZOY A;  3G1O A;  4TV7 A;  1B1B A;  2XV4 S;  2QIB A;  2QF7 A;  4ZTJ A;  1D5V A;  2ICW G;  4HX7 A;  3E5X A;  3QPH A;  5B1B H;  1IAW A;  5E8G A;  4RMN A;  1MND A;  4HDV A;  2W57 A;  4HF0 A;  2JK3 A;  5GAE J;  3HDD A;  3ERE D;  2VAS A;  5L3B A;  4XLA A;  3SYT A;  1ZRF A;  1K4T A;  2DPU A;  2O61 A;  3H9G A;  4RGR A;  3BG7 A;  2GQQ A;  1LDK B;  2IP2 A;  1MBF A;  3S15 J;  3QPT A;  5FKN A;  3I53 A;  4S05 A;  1B9M A;  4P55 A;  1XS9 A;  2VKD A;  2XRL A;  2R7O A;  2BY3 A;  1ZRE A;  5IOY A;  1KQ9 A;  3RKX A;  1RC9 A;  3GCM A;  2K9Q A;  3PM1 A;  4E70 A;  4CDG A;  2EIK H;  2EV5 A;  3PFY A;  5IP7 J;  4F3Q A;  4EGY A;  2IS4 A;  2JRT A;  4CIC A;  1B8I B;  2G0E A;  4YIR X;  2RAE A;  2Y0S A;  3FDY A;  2A05 A;  1VQ4 I;  4ANJ A;  5J4V A;  4HV5 A;  3HUG B;  2LNB A;  3FIW A;  3CUQ B;  1OMI A;  3LFK A;  3CF5 F;  4G7Z F;  2KDZ A;  2XHK A;  3J80 Z;  3JSO A;  4PFO A;  1YX5 A;  2IRF G;  5D18 A;  2PMZ A;  3L2C A;  2BV6 A;  2BW3 B;  4D7N A;  1WI9 A;  3OYK A;  5M5W J;  3GZ6 A;  3JRE A;  5L3D A;  1FBS A;  2MAB A;  1APL C;  4XLN F;  2DFF A;  1U8R A;  3HOZ J;  1YJW I;  3RYR A;  4RBO A;  2FUG 2;  3BC8 A;  4IVN A;  4CCO A;  2O7T A;  5DYM A;  4U9L A;  4E6K G;  4GFL A;  3CJQ B;  1JT0 A;  2CSO A;  4UUT A;  4ZC3 A;  1UHW A;  2Y2Z A;  5FHP A;  3P5J A;  2IS6 A;  5AQC A;  1J5Y A;  1S7E A;  2MYS A;  1YYV A;  3B02 A;  2ECB A;  4EVI A;  3PNY A;  1YRN B;  2MA3 A;  2KIS A;  4PFP A;  2K40 A;  1P6R A;  3FXJ A;  1E3O C;  5LD2 C;  5IY5 H;  1WJF A;  1X19 A;  2MC4 A;  3OYN A;  3IH2 A;  3WTX C;  4B3A A;  5FLM J;  3S32 A;  3HRT A;  3TED A;  1G8X A;  2K4B A;  3RCO A;  2K9N A;  1MDM B;  5K5O A;  3K70 D;  2HGC A;  2V7F A;  2WAE A;  3CWR A;  4ZDL A;  4XSZ F;  4Y3O A;  5K58 A;  2HVQ A;  2QZ8 A;  2COM A;  2NP5 A;  1ETX A;  4NQW B;  2WV0 A;  1C0W A;  5K1Y A;  1U9N A;  4CH7 A;  3G56 A;  2QCO A;  5CJ9 A;  3TDZ C;  3A0B C;  2PFB A;  3EGQ A;  2XKP A;  1YIO A;  4B4C A;  1M1E B;  5GPC A;  3QOD A;  2WV1 A;  4XSX F;  2TCT A;  2CQK A;  4I02 A;  3L9F A;  2W24 A;  1YOV B;  3KFW X;  3WHB A;  4G6Q A;  2R7D A;  5FRN A;  2EB7 A;  2XIG A;  3DLA A;  4A0Y A;  3CC4 I;  1UB9 A;  1ZRC A;  2DA7 A;  3F8N A;  4PZJ A;  4IHW A;  2CYY A;  2WTE A;  5FKM A;  2CW8 A;  3F6V A;  1WGX A;  1UHM A;  4L62 A;  1WJB A;  2Y9Y A;  3DBL B;  3ROU A;  2ZJP F;  2BY2 A;  2XSJ C;  2M8E A;  3JTH A;  4MNU A;  5J40 A;  1K78 B;  2FOK A;  5FKK A;  3KZY A;  5FD5 A;  4JNN A;  4PJ0 C;  2MH2 A;  2M7B A;  4NDL A;  3VSK A;  1OCZ H;  2QM3 A;  4BQA A;  1RES A;  2MGQ A;  4LB5 A;  1GXQ A;  3CP8 A;  3HYI A;  2UXP A;  3GME A;  2V6C A;  5F6F A;  1X1A A;  3TQN A;  4C3J J;  2Y48 A;  3JRH A;  4HOB A;  4A6D A;  5IP6 A;  5TRD A;  3Q9V A;  1XSX A;  2Q2E B;  2LLK A;  3JAM Z;  1Z3X A;  1P4X A;  1N75 A;  3VYS B;  3IRR A;  1JHH A;  3GEZ A;  4MGR A;  1EKE A;  2X48 A;  3KKC A;  3VOD A;  3J7Z I;  3CJN A;  1U3E M;  2M0C A;  5HAW A;  5BNG A;  4KDP A;  3EYI A;  1WH7 A;  2L7K A;  4A3L J;  2L9S A;  2X4H A;  5CVU A;  3HRM A;  3CCY A;  4Y33 A;  2VKE A;  2YX4 A;  2B9S A;  1GHC A;  3GEU A;  3W2A A;  3KNW A;  2L0K A;  1F36 A;  2IJL A;  1A6Q A;  5LHH A;  1O4X A;  2B1E A;  3WTW C;  1W0U A;  1IZ1 A;  4ZJZ A;  3I9V 2;  5AON A;  5IOZ A;  2EH3 A;  3RH2 A;  4Z6Y A;  2RGV A;  2EFW A;  1QU3 A;  4MFE A;  3J7A Y;  2GXB A;  4XKB A;  4D9J A;  2N8G A;  3ASO H;  1AU7 A;  2H6C A;  3LST A;  3E7Q A;  3DV8 A;  4RAF A;  3CJD A;  3H3U A;  4ACI A;  1S6L A;  3IV5 A;  2KIF A;  1IV6 A;  1RPW A;  4LLL A;  3ZQG A;  4ENN A;  2HKX A;  2LR8 A;  2X85 A;  5E20 A;  2R7R A;  1TWA J;  5JVG F;  2QSF X;  1S7A A;  1TBX A;  2OA4 A;  2RNG A;  3SEZ A;  5D8L B;  1QVU A;  4UXN A;  2UV1 A;  5H6R A;  2W82 A;  2CG4 A;  2X1D A;  1R7J A;  3R60 A;  4D7M A;  3ZMT A;  1ZLJ A;  3WTY C;  4L18 B;  4HKU A;  3TW7 A;  1VQM I;  1QVT A;  2FQ3 A;  2NVU B;  4KMF A;  3BOQ A;  1KON A;  1YJN I;  3OYD A;  4R1H A;  4HNT A;  2JSP A;  1RKT A;  2X0L A;  4KN4 X;  1LDJ A;  1R36 A;  3CCL I;  3I3L A;  2W25 A;  1BW6 A;  4C30 A;  3DCF A;  3S93 A;  4A3B J;  4KIG A;  2JZY A;  1IG7 A;  2CUZ A;  4M9S A;  3D1N I;  2DOF A;  3SZT A;  3DPT A;  4XLC A;  4ICH A;  2A07 F;  3KP4 A;  5D5U B;  1T98 A;  1R5G A;  1LFB A;  2A68 F;  2EFO A;  2FF4 A;  3ZGK A;  4AVZ A;  1LVA A;  3H5N A;  3NWT A;  4Q47 A;  4XLP F;  3LA7 A;  3L2V A;  4M71 A;  1H8A C;  3K4M A;  3ABL H;  3BWG A;  3KEY A;  2ZCW A;  3VDX A;  5ICG A;  2DG7 A;  2YSR A;  1ULY A;  1BIA A;  1YW7 A;  2E2J J;  3S3N A;  2FNA A;  5CW8 A;  1HSJ A;  3VUQ A;  4HZF A;  2CS3 A;  2OCE A;  5BS6 A;  1WPK A;  3U9G A;  1FTT A;  3GTG J;  4A3M J;  1J0R A;  2L5Q A;  3DQV C;  4BEH A;  3HOX J;  3E6D A;  2QLZ A;  3E3V A;  1X1C A;  4GFK A;  3ZR8 X;  2GEN A;  1V3F A;  1FNN A;  1ZHF A;  2NNY A;  3FXM A;  3N05 A;  3TP0 A;  4I0B A;  3OYH A;  2L4A A;  2BY1 A;  1U5T C;  1JKP C;  3BY6 A;  4FIS A;  3DPL C;  2DA5 A;  1TWG J;  3J80 K;  3OYL A;  2X6W A;  2R7Z J;  2K7L A;  4B8X A;  1ETV A;  2L7M P;  5A2Q Z;  2WAD A;  4PUS A;  1IN4 A;  2OAZ A;  3GLL A;  3ZQH A;  2V1D A;  4XKW A;  2NS8 A;  3K4K A;  1D5Y A;  5ICE A;  2WAQ N;  1H9T A;  1R4N B;  5F1R A;  1FZP B;  1JXS A;  3T0Y A;  2VJI A;  1LB2 A;  3K1N A;  1YX3 A;  3SDG A;  5J8F A;  3NPI A;  2LTP A;  3BQY A;  1Z77 A;  4Y17 A;  4GYI A;  2A69 F;  3VOE A;  3HKZ N;  4LLN A;  2P0W A;  5BMZ A;  2HQN A;  4CCM A;  1YS7 A;  4N9I A;  2JVH A;  2LOO A;  4JBA A;  2IXS A;  4IRH A;  2M4G A;  2DXI A;  1BW5 A;  5AIQ A;  4WCG A;  4DQ2 A;  1AA7 A;  2XB0 X;  4PJJ A;  3I58 A;  4ZYG A;  1I5Z A;  3SQN A;  4AD9 A;  4NHJ A;  4G7O F;  2PFV A;  4FX0 A;  2M8G X;  2FD5 A;  2X1E A;  5FO5 A;  4KN7 X;  4NC8 A;  2IGN A;  3BPX A;  5HDK A;  2EFN A;  3K6G A;  2E7X A;  1W5C C;  1ZR2 A;  1VQO I;  2GIZ A;  3DFG A;  1I3A A;  2X6O A;  4GCK A;  1OCR H;  2CH0 A;  2OZU A;  1K83 J;  3ELK A;  2K27 A;  2HZT A;  1O3Q A;  4X0G A;  2QKM B;  4G6D A;  3OIP A;  3WU1 B;  3CCJ I;  4HAM A;  3V7C A;  2GXG A;  1WVR A;  2PMU A;  1B59 A;  1GVD A;  2LRE A;  3ON2 A;  4PJL A;  5EJC A;  1W7P A;  2ZNZ A;  3FBI B;  4C2M A;  4IQ4 A;  5HSZ A;  1WJ5 A;  4BXF A;  2LVS A;  2VJ5 A;  3IAS 2;  3VPR A;  1IDZ A;  4CUG A;  5JHU A;  2XAS A;  2EBI A;  3IWZ A;  3LFU A;  5B3S H;  3CUQ C;  2KJC A;  3CLQ A;  2BGC A;  2VQC A;  4JX5 A;  5C4Y A;  1D8J A;  2LC2 A;  2FRH A;  4XQF A;  2JSC A;  4KIT B;  5J1Y A;  1MZB A;  3PFI A;  3DEU A;  1EV7 A;  1SAU A;  1U78 A;  4R8H A;  3U1D A;  5CKT A;  3ABU A;  2CW0 F;  2KLO A;  4PCQ A;  4O5V A;  3DBR B;  4XOT A;  2KDO A;  2V9P A;  4BYY A;  1S29 A;  3WU2 C;  3HIF A;  1SFE A;  3ZMD A;  2ZJ2 A;  2VON A;  2QVO A;  3M8E A;  3VOX A;  3KP2 A;  1FT9 A;  3WG7 H;  3T5X A;  2DOD A;  2A61 A;  3TGN A;  4AYB A;  3JAM K;  4U7B A;  1ZG3 A;  3JSJ A;  2PBI A;  4M6X A;  4AC6 A;  4F93 B;  2XPU A;  3FHN A;  2WY8 Q;  2XAQ A;  3EPZ A;  4DIQ A;  5LLQ A;  4IJA A;  1W5T A;  5JHF A;  4A3K J;  3S1N J;  1MMS A;  1RET A;  2EV6 A;  3T6N A;  3SFZ A;  1UFM A;  2KRH A;  4A3J J;  3M07 A;  2FQ4 A;  4D1Q A;  3HM5 A;  3RTR A;  3OV8 A;  5EDN A;  2M4K A;  3FXQ A;  5HVQ C;  1SC7 A;  5B5E C;  3GXO A;  1ZR4 A;  1XG1 A;  1A6I A;  1NG6 A;  4XLF A;  3COA C;  1NK2 P;  1T38 A;  2X51 A;  1YW8 A;  4I01 A;  4P9U A;  5LGN A;  1IUY A;  4PSW A;  3FXK A;  4LK0 F;  4XRF A;  1ON1 A;  1K6O A;  3BR1 A;  2Y0M A;  3LWF A;  4GXO A;  1H9G A;  1XD7 A;  4I6Z A;  3AQS A;  1T8I A;  2NVX J;  2K9S A;  2UZK A;  2ZFU A;  2QTQ A;  3P9T A;  4GCL A;  1T6S A;  1MGT A;  1F43 A;  4UUS B;  1BR1 A;  3GZN B;  3HPH A;  3MKY B;  1R00 A;  1Y0N A;  2QWW A;  3PIP F;  3EUP A;  2CU7 A;  2LKP A;  2ZFW A;  2DA1 A;  1U9O A;  3F0C A;  4KMU X;  2HYF A;  5IT3 A;  3CUO A;  2VIX A;  2ZKZ A;  2DOA A;  4IX7 A;  3ZPL A;  1QO0 D;  1FOW A;  4BEH B;  4GFB A;  3PNT A;  4XOP A;  1FMV A;  4CYC B;  1ZAO A;  2KFD A;  5KAI C;  1ZG5 A;  3OSF A;  2KZV A;  4MO7 A;  5F0F A;  4UVB A;  3KZ9 A;  2H1K A;  3VVZ A;  1MBG A;  2HOS A;  1NHA A;  3EUA A;  1XSV A;  1QPI A;  1ZTR A;  4BBS J;  5J6X A;  3S8P A;  1XGS A;  1TT0 A;  2K02 A;  2NOG A;  3CJR B;  2DK5 A;  1HC8 A;  1WZ2 A;  2IW5 A;  3NS4 A;  1YRN A;  3HRU A;  2OZ6 A;  2DA2 A;  4A5M A;  2O8K A;  2GBY A;  2DK8 A;  3BR3 A;  4EGZ A;  1UST A;  4L9J A;  2ME0 A;  3ZN1 A;  1BI1 A;  5D5V B;  5BOX A;  2FML A;  2ID6 A;  3TO6 A;  4Q4Z F;  1E17 A;  5M3F J;  3M7G A;  1G4D A;  3F6O A;  3GZI A;  5TGT A;  1UEL B;  1TL8 A;  2PI0 A;  3HXL A;  5D4R A;  2KHM A;  3QPL A;  2HXI A;  2R4G A;  2ZO4 A;  4NQW A;  5EZG A;  4BXX J;  5EGO A;  3ZQC A;  3ANP A;  4ABZ A;  1S7O A;  2G9W A;  4CHU A;  3G7R A;  1YE9 A;  1OYW A;  2F6C A;  4KT6 A;  3VVX A;  3KP6 A;  3DP7 A;  3WTZ A;  4YRV A;  1QBJ A;  3NRG A;  4EM1 A;  1H0M A;  1KQ0 A;  3OIQ A;  2ZXH A;  4FHT A;  5FGM A;  2JT1 A;  2ELH A;  1FPQ A;  3K8P C;  3MMY B;  1V5F A;  2Q0O A;  4NC7 A;  2XPW A;  1ONV A;  2O0Y A;  4G12 A;  3B6C A;  3TOB A;  4AC0 A;  4I7H A;  5JLX A;  5HNH A;  2LF7 A;  4WX9 A;  2UXI A;  2IGM A;  5EEH A;  5FFZ A;  1T95 A;  3R61 A;  1JKQ C;  2H94 A;  5L3F A;  3S1M J;  1VF9 A;  2BOL A;  4ZZL A;  3BJO A;  3R4K A;  1VI0 A;  5ICF A;  3BTI A;  3KZZ A;  4OD4 A;  2R5Y A;  1E3P A;  4BQN A;  1TWC J;  3K4J A;  3T1B A;  2XSD C;  1WWX A;  5LRS A;  3E0J B;  3ZMZ A;  1HLV A;  2ZCN A;  2WB1 N;  1XMX A;  3Q5F A;  3ZXS A;  2W84 A;  1JE8 A;  5ILU A;  3C2H A;  3CC7 I;  1I1S A;  4F7Z A;  1P9Q C;  1ORK A;  2QKL B;  3S2W A;  2Z2S B;  5D5X B;  4UY8 I;  4BNC A;  1W7P B;  2R92 J;  1JKR C;  4LB6 B;  3HBL A;  1FTZ A;  2RVC A;  2VBY A;  1JJ6 C;  2O03 A;  1XCB A;  2V9V A;  4BXU A;  3CME I;  2VOP A;  4BE0 A;  2NAZ A;  2LMD A;  3A02 A;  3GFJ A;  1ZQ3 P;  3VYU B;  4P9F A;  2K3P A;  1RI7 A;  1MNE A;  1ETO A;  1Z3Y A;  2GXA A;  1UI5 A;  2HKO A;  4PJM A;  3VOK A;  3L09 A;  4OMY A;  2HR3 A;  2NOJ B;  2KPM A;  1DDN A;  2P6S A;  5L3E A;  2CO5 A;  3K2A A;  3FBN B;  3SWH A;  3B73 A;  1F1Z A;  5FGL A;  5KK1 A;  1HKQ A;  3O2P E;  2M45 A;  2KRF A;  3HHH A;  1UMQ A;  3RPU A;  3J7Y J;  4OD5 A;  3HPG A;  3DF8 A;  3HE0 A;  3OWT A;  2E36 A;  3NNR A;  4A3F J;  1W0T A;  3WTU C;  1U6G A;  2XAF A;  4II2 A;  4BDZ A;  1S5L C;  3V78 A;  5IYB J;  4DOZ A;  1DP7 P;  2KJB A;  4I98 B;  1OCT C;  3O6B B;  3ULQ B;  2KIQ A;  1ZH5 A;  1DPU A;  1WJA A;  2BXY A;  2DFI A;  4BE1 A;  5DCM A;  2CV1 A;  2R7Q A;  1JKO C;  3DPJ A;  2DFE A;  4DW6 A;  5K7F A;  2GWR A;  4U9N A;  3GLX A;  3VYT B;  4XBF A;  1Y0U A;  2EZK A;  4BY7 J;  3QU3 A;  3S2D J;  1HOM A;  2GFN A;  2K4J A;  3FZV A;  2IS2 A;  4HEA 2;  1RR8 C;  2K85 A;  4M6V A;  3BTL A;  5DTD A;  4NEL A;  2CGP A;  5EFY A;  4RM3 A;  5LRR A;  1IV8 A;  2ISY A;  4YFK F;  5HBU A;  4LOC A;  2DA4 A;  1YJ9 I;  2E2H J;  2REK A;  4IHY A;  3L00 A;  2STW A;  1TNT A;  2VPL A;  1O7L A;  4HLY A;  1T0F A;  5IPA A;  1T08 B;  3GUD A;  4W1U A;  5M5X J;  1JTY A;  2L9R A;  2HXO A;  4YEL A;  3TDU C;  2VI6 A;  3HTU A;  4IF4 A;  4CCN A;  2Z5U A;  5HLG A;  3BR5 A;  3GBG A;  1LE8 A;  1ZGJ A;  3TP3 A;  2MBF A;  5E1W A;  3H9Q A;  4B47 A;  4DGW B;  3GFL A;  4HV6 A;  1MSE C;  1RZ4 A;  2OCC H;  1A31 A;  1MH4 A;  4BU2 A;  1YFH A;  3E1S A;  3I5U A;  3COL A;  2PJR A;  2HTJ A;  3VYR B;  4GCV A;  3LA2 A;  3S14 J;  2GA1 A;  5H20 A;  1FC3 A;  1D0Y A;  3D5S C;  4V19 K;  1X4O A;  1I1G A;  2E19 A;  4HG2 A;  5C3E J;  1UAA A;  2DMU A;  4AIH A;  2FSW A;  3ZOB A;  5HLT A;  3HOS A;  1IN6 A;  4EQQ A;  1OIS A;  1JJ8 C;  4P1W A;  1IRZ A;  2L02 A;  4HX8 A;  4C3I J;  3RPQ A;  3O8G A;  2QBY A;  1OJL A;  4LGW A;  4M3D A;  5IYD J;  2R7T A;  4IZZ A;  3A2K A;  2VXZ A;  3FM3 A;  5IP9 J;  2CUE A;  4D0P A;  4KA4 A;  2UUZ A;  2HWV A;  4RGX A;  3CC2 I;  2BVM A;  3A1Y A;  4ITV A;  1FX7 A;  2P81 A;  5ILV A;  3OY9 A;  2DDA A;  4FQG A;  2DYS H;  3RQ4 A;  1KU7 A;  4AM3 A;  3FMQ A;  2MC3 A;  2HOT A;  2FJI 1;  5FKL A;  1IN8 A;  4BAY A;  1SAN A;  5EGO B;  3QAH A;  4DZJ A;  3DLL F;  4ZZD A;  2HI3 A;  1K4S A;  1V5E A;  5LGU A;  4XRS G;  3GTK J;  2JQ7 A;  2B3W A;  4ZYH A;  3PIO F;  1R1U A;  4IHV A;  2WUI A;  3I55 I;  1KYZ A;  2JVG A;  3S17 J;  1CQT A;  3Q0V A;  4WF2 A;  1GUU A;  2QEN A;  4L9T A;  3CMM A;  4LFU A;  1BI2 A;  1WKM A;  4OMZ A;  1PJR A;  1OPC A;  2R3S A;  3HJE A;  4MTE A;  3PQJ A;  4EAT A;  5FLX Z;  5F0C A;  3K4B A;  4A6E A;  1KGS A;  4YFN F;  2HYJ A;  2WBM A;  1IXC A;  1Z0X A;  1YIJ I;  3ZMV A;  2BBY A;  2NS0 A;  1OCC H;  4C2M J;  2IEK A;  4CGR A;  2R5Y B;  4XLH A;  3PPB A;  1LEA A;  2KIU A;  4EJU A;  3OR2 C;  4QPO A;  3MKW B;  3CP2 A;  3C1D A;  4LG0 B;  4RAY A;  4MK6 A;  5JI6 A;  2LBF A;  3KE2 A;  5JLW A;  2L9V A;  4BE2 A;  4DBQ A;  3OYI A;  2QQA A;  4KIF A;  3CCS I;  5F1J A;  4BQQ A;  2D5V A;  3VFZ A;  1MBE A;  2ZXW H;  1XCV A;  3FXR A;  3H36 A;  4ZTF A;  3BZK A;  1O7F A;  3K69 A;  4FT8 A;  4IOA F;  2OI8 A;  1D3Y A;  3VWB A;  3MAJ A;  3KLN A;  4UDS A;  3MQ0 A;  2F5E A;  5FMP A;  5LEK A;  3BQZ A;  1FIP A;  3ZMS A;  2PZ9 A;  1R9T J;  4FET A;  3F22 A;  3OS2 A;  1X1P A;  5KNL A;  4A12 A;  3P9K A;  2V6E A;  3FIS A;  3K1P A;  4M6Y A;  3OYE A;  5D1R A;  5HS8 A;  3RIR A;  3AL0 C;  1DGR M;  4I0A A;  2DMP A;  1LVK A;  1IC8 A;  5LEJ A;  3JW4 A;  1QZE A;  2M5W A;  3ON4 A;  2YR2 A;  1AKH A;  5E79 C;  2ZCX A;  1ZLK A;  2HPI A;  2VXD A;  1ODD A;  2PG4 A;  4UB6 C;  4PDK A;  3IKT A;  5EZH A;  2O7O A;  2V57 A;  4CYD A;  4G94 A;  2HPM A;  5IT9 Z;  3QU6 A;  2DJI A;  3C2G A;  3NRV A;  2L3D A;  3VTI A;  1XDU A;  1R71 A;  1IRG A;  4MIM A;  2ZSH B;  4XM3 A;  5DCM B;  3BG9 A;  1ACI A;  3RKY A;  4RLQ A;  3H1C A;  4CCK A;  1TNS A;  3MKZ A;  3GZ5 A;  3GTP J;  1Z21 A;  4MEX F;  1XB4 A;  1RRJ A;  2AXT C;  3KP7 A;  1YI2 I;  2NP3 A;  2UXU A;  2BE5 F;  3PAS A;  4AIK A;  3NWS A;  4RB3 C;  4I09 A;  1Y39 A;  1SFU A;  2E71 A;  2V1U A;  2CQX A;  5E18 F;  2EFP A;  5F64 A;  3A01 A;  2XDN A;  4PJN A;  4LK1 F;  3E6B A;  2VQG A;  3D0S A;  4RDU A;  3J81 Z;  3DEW A;  1QZY A;  3IH4 A;  3VP5 A;  4BAC A;  2DN0 A;  3OYB A;  1QGP A;  4ESJ A;  2FXA A;  5GAD J;  1J09 A;  5C44 J;  1G6N A;  1ETW A;  4U0Y A;  4MQV A;  5D19 A;  4UUS A;  1QHH D;  4N0B A;  1Z67 A;  2V1X A;  5DM7 F;  3VW2 A;  2GA2 A;  4ESF A;  2Y9Z A;  5HDN A;  1I27 A;  4NBQ A;  1Z05 A;  5B66 C;  1LE8 B;  2A5W A;  1FJL A;  4XL9 A;  1FBQ A;  2MH9 A;  2EFQ A;  1T33 A;  4UB8 C;  5CVV A;  4UUV A;  1DU0 A;  4HX4 A;  2L4M A;  4CGZ A;  4CYC A;  2E1M C;  2PJR B;  2PBX A;  2K3F A;  3EET A;  3ZCO A;  4AID A;  3HZJ A;  4U87 A;  2L2O A;  1USS A;  2UXN A;  4HF1 A;  2HOA A;  4PXI A;  3MFK A;  4IRV A;  1ETY A;  4HA8 A;  1JUP A;  2E1O A;  2L7Z A;  4FE7 A;  5LHI A;  1YHQ I;  1A36 A;  2P4W A;  1DPR A;  3FMS A;  3BTC A;  4OU0 A;  2QBY B;  3GTO J;  3ABK H;  5GTI C;  3CES A;  2H27 A;  3VSL A;  3Q0W A;  3CZ6 A;  4M3B A;  3OYG A;  1TW3 A;  3BJA A;  1F9N A;  1RUO A;  3CLO A;  4PGH A;  1JUM A;  4UVC A;  1FOY A;  2XKO A;  3MVP A;  3BG3 A;  3WGG A;  3CCR I;  5CXI A;  2EJR A;  3AG2 H;  4C9Y A;  2DPD A;  4BHB A;  3IKV A;  2ZJQ F;  3ONQ A;  3CDI A;  2TDX A;  1OFC X;  3BPV A;  3K4L A;  4LIV A;  1PUF B;  1VQ6 I;  2BY0 A;  3TKY A;  4D5F A;  3IWF A;  3BHQ A;  3HTA A;  1HW5 A;  4JK1 X;  1YS6 A;  2RN7 A;  2W48 A;  2F4M B;  2HEO A;  2MG4 A;  2LD5 A;  3R0J A;  2EK5 A;  4PGG A;  2ME6 A;  3V8J A;  4XK4 A;  1VTN C;  2NVQ J;  3IHU A;  5M5Y J;  4V2F A;  3D5L A;  2KKO A;  1SMY F;  2HOE A;  5TIS C;  1W4M A;  2UXH A;  3Q3S A;  5B1A H;  4C2T A;  2GM4 A;  1EH8 A;  1GXP A;  4IRI A;  4G9Y A;  2YVH A;  3F23 A;  1VQ9 I;  2D1V A;  2CQN A;  3OS1 A;  4XN0 A;  2YU3 A;  5HLI A;  4E7S A;  3Q0U A;  2RC4 A;  2LK2 A;  1GT0 C;  4UV8 A;  2F48 A;  3FKI J;  3CCU I;  5E1X A;  1FSE A;  2B63 J;  3F9K A;  2CUJ A;  5EEA A;  1J2X A;  2DYR H;  3GTQ J;  3AFH A;  1FBU A;  4FCY A;  1Y6I A;  4HST A;  2A6T A;  1MJB A;  3PO2 J;  3M4O J;  1D8K A;  1RUN A;  2IPQ X;  2OJE D;  4AYB N;  5FLX K;  1BIB A;  2BYV E;  2J5P A;  3KP3 A;  2LBF B;  5HOD A;  3HOT A;  1VFC A;  2JUC A;  3QOE A;  2VL8 A;  2G7G A;  3CQZ J;  3QPS A;  5CVR A;  1MMA A;  3RYP A;  4RAZ A;  2WAQ A;  3BRO A;  5FRM A;  1IUF A;  3V8K A;  2BEO A;  2O8X A;  3LMM A;  4OIQ F;  1JTX A;  2LY1 A;  1RNL A;  4UNO A;  1J75 A;  1HQC A;  4C3H J;  2D1H A;  3L1P A;  1VQL I;  2O3F A;  3K70 C;  3ZN0 A;  2Y75 A;  3CCE I;  3LA3 A;  2R7W A;  3LSH A;  3REO A;  4WWC A;  4A3D J;  3HKZ A;  2BVL A;  1K61 A;  4LLG F;  1QPM A;  3KYC B;  3I54 A;  3O60 A;  2L9N A;  2CV2 A;  2Q1Z B;  1WJC A;  2BXZ A;  3DKY A;  3ISP A;  3LSG A;  2KRC A;  2JPB A;  3M8F A;  4E7J A;  3K10 A;  2P7C B;  3C7J A;  1GV2 A;  2ELK A;  3F1B A;  2L01 A;  3FK7 A;  2MLG A;  1IN5 A;  1P7J A;  1NTC A;  1SFK A;  5D8K B;  1IF1 A;  2HDD A;  5DM6 F;  3DBH B;  1AKH B;  3CO7 C;  3SDB A;  3BTJ A;  4GRI A;  4E7H A;  1PP7 U;  2ESN A;  2RQP A;  3TMO A;  9ANT A;  2QSH X;  1B72 A;  1WCM J;  4N4O B;  4L9N A;  3FM5 A;  3F8C A;  2BHY A;  5C4X J;  1HKT A;  4HBL A;  1DUX C;  1XSD A;  2Q24 A;  5F04 A;  1TP4 A;  1A35 A;  3W6K B;  5GAH J;  3IP4 B;  1LNW A;  1OYY A;  3SHF A;  4MEY F;  2COB A;  2H8W A;  3RI4 A;  1CF7 A;  2M0M A;  5K7Z A;  1PDN C;  2GOM A;  1KU2 A;  1RR7 A;  1S72 I;  2EPF A;  3SZP A;  5K5R A;  2VPR A;  2DTZ A;  4Q48 A;  5FD6 A;  3CD6 I;  1OR7 A;  2LY2 A;  4IHX A;  2V9K A;  2ECC A;  1X3W B;  5IT9 K;  1P92 A;  4UHT A;  1D1B A;  3A01 B;  2VC1 A;  1X2M A;  1G3S A;  3DTI A;  1Y1V J;  1ZN2 A;  1BC8 C;  2V4J C;  1FIA A;  1ITY A;  1K6Y A;  2EIM H;  3E5U A;  4XOR A;  4I2O A;  1IDY A;  2M2E A;  1SEU A;  2EIJ H;  1H89 C;  2LG4 A;  3HTS B;  2ISZ A;  2W00 A;  1VQK I;  2XGD A;  3FWE A;  3I0T A;  3S16 J;  2EZL A;  5GP9 A;  4A0Z A;  2J5O A;  3HHG A;  3ZQ7 A;  3B6A A;  4BGD A;  1T56 A;  2FA5 A;  3ESW B;  3SEQ A;  2XRO A;  4ENJ A;  1W1W E;  4KIB A;  3F8M A;  4EJW A;  2Z16 A;  4CXF A;  1ZKG A;  3VB2 A;  4A2U A;  5BQT A;  3OYJ A;  5H9T A;  3BG5 A;  5BPD A;  4RAG A;  1R5I D;  1MD0 A;  5E3N A;  4B1R A;  2XGC A;  3FMR A;  4F91 B;  3DKW A;  4ON0 A;  3HL2 A;  2UXO A;  1VQ7 I;  3WHC A;  4A5N A;  2R5Z A;  2F4I A;  2VT2 A;  1FOK A;  2ID3 A;  4AUX A;  1HF0 A;  4QWQ A;  3FXU A;  3H3V K;  1UJ8 A;  4WXC A;  4KUM A;  1Z7U A;  2P8T A;  4L0Y B;  3ABT A;  1O3R A;  4G8X A;  3LNQ A;  3H5A A;  2M87 A;  1XX5 A;  1JUS A;  2OTJ I;  2Y69 H;  3H0G J;  1FOX A;  2DT6 A;  2AHQ A;  4DBR A;  2W85 A;  3G4S I;  4Q5S F;  2ZNY A;  3HRS A;  4QTR A;  2PLY A;  2L7F P;  3HSF A;  1G3Y A;  1MIJ A;  1ETQ A;  3DU6 A;  3FKJ A;  2YU9 J;  2VQH A;  1YLF A;  4A0X A;  4H0E A;  3HOU J;  3K4C A;  4HNV A;  1XGN A;  3V42 A;  1HW1 A;  2VOO A;  3K2Z A;  3KYD B;  4U7D A;  4KIS A;  4BHP A;  1SVL A;  1EA3 A;  3FF5 A;  5A2Q K;  2QOP A;  2EIL H;  2ZXI A;  1UHS A;  3G71 I;  1CGP A;  4IXA A;  3RQI A;  2DFH A;  1LQ1 A;  1WFX A;  3OYF A;  1QNT A;  1PVE A;  1S3J A;  3CDL A;  3K0L A;  4IQJ A;  2DU9 A;  5LGT A;  3S3O A;  4QSH A;  3ZP5 A;  1Z6T A;  1QQI A;  4BBR J;  4FTH A;  1HST A;  5J1R A;  2EA2 A;  1Q1V A;  2NS7 A;  2O6G E;  3VVY A;  4MLO A;  2ZCM A;  3MN2 A;  4JQF A;  4ENK A;  1T39 A;  1EH6 A;  4J01 A;  2ZME A;  4BJ6 C;  2DQR A;  1HKS A;  4BH9 A;  2DCE A;  3UNG C;  3MD2 A;  1ZG1 A;  3QQA A;  4A3I J;  1V4R A;  2QA4 I;  2NYX A;  2VOD A;  1SAX A;  3QYE A;  3V8L A;  5C4J J;  4LG0 A;  2IA0 A;  1BM9 A;  1VQ5 I;  2ETH A;  3HOW J;  4GGG A;  3PNV A;  3LJL A;  3P9I A;  5FKO A;  2D2W A;  4EJO A;  2LRD A;  1T0F C;  4NUB A;  4Y4R A;  1I6H J;  3OYC A;  2GOX B;  2A3S A;  1QHG A;  5DS9 A;  1TT5 B;  5CLS A;  5DUI A;  3QRF F;  3LWJ A;  3FK6 A;  4LG3 A;  5F27 A;  4YG2 F;  2GLO A;  2IGK A;  1MH3 A;  3OMY A;  1IJW C;  2LKS A;  3GFM A;  3QYB A;  3L2W A;  2W53 A;  1I3Q J;  4JP0 A;  5CQG A;  1XC5 A;  2VUM J;  3TBI A;  2BHZ A;  2IVM A;  2QQB A;  4V2G A;  3CTA A;  2HKU A;  2R7S A;  2R7X A;  3HOY J;  4HQE A;  1MBJ A;  3PUF A;  1B6A A;  1TQM A;  3LAP A;  3MEX A;  1LFU P;  3IRQ A;  1JGS A;  2DA3 A;  4B09 A;  1Z9C A;  4XNF A;  4MHG A;  4A3G J;  3G1M A;  3L2R A;  4DNC A;  4P96 A;  4WK8 F;  2K86 A;  3ZQF A;  1B72 B;  5DD4 A;  2Y0S N;  2CV0 A;  2FBK A;  2R7U A; 
#chains in the Genus database with same CATH homology
 1ENH A;  5EF6 A;  2IU5 A;  2NVT J;  3W6V A;  4MK6 A;  3SDG A;  3NPI A;  5JLW A;  2LTP A;  1B8I A;  3BQY A;  2D5V A;  1Z77 A;  3HTH A;  2MW8 A;  2PMZ N;  5F1J A;  4JKZ A;  3HKZ N;  3JRA A;  1WH5 A;  1MBE A;  4IEJ A;  3BR6 A;  4XRS A;  2OI8 A;  1I50 J;  4UDS A;  2M9H A;  3CRJ A;  3OIO A;  1BW5 A;  5FMP A;  3BQZ A;  1FIP A;  2YS9 A;  2PZ9 A;  1R9T J;  2XB0 X;  4JX4 A;  2CQQ A;  3K7A J;  4ME9 A;  4J19 A;  3FIS A;  3OSG A;  5D1R A;  1VND A;  3JRB A;  2M8G X;  3NI7 A;  2FD5 A;  4KWA A;  2DMP A;  3OOU A;  1IC8 A;  3VIB A;  1ZR2 A;  3ON4 A;  1AKH A;  2X6O A;  2ZB9 A;  2ZCX A;  4GCK A;  2YUS A;  1K83 J;  2JWT A;  1MNM C;  1AHD P;  2FBQ A;  5F08 A;  2E2I J;  5EZH A;  2O7O A;  2V57 A;  1UI6 A;  3SJM A;  4AF5 A;  1GVD A;  2R93 J;  4MIM A;  4JL3 A;  2RAS A;  2FX0 A;  3ON2 A;  1JGG A;  5FJ8 J;  2XB5 A;  2AO9 A;  3JR9 A;  3BG9 A;  5HSZ A;  2HYT A;  2LVS A;  4I76 A;  3GTP J;  3VPR A;  2R5Z B;  2CJJ A;  3BRU A;  2NP3 A;  3NXC A;  3PAS A;  2UXU A;  1IDZ A;  4DYC A;  2EBI A;  2CQX A;  4JX5 A;  4M3G A;  3JRF A;  5C4Y A;  2XPV A;  1HDP A;  5F0H A;  3A01 A;  1ZK8 A;  5J1Y A;  3HTJ A;  2XDN A;  4RDU A;  3DEW A;  1U78 A;  3RZO J;  3IH4 A;  3UKG A;  2LFB A;  3BCG A;  3VP5 A;  3LSR A;  4A69 C;  2DN0 A;  1OCP A;  3G1L A;  1EF4 A;  3B81 A;  3CMY A;  2JJ7 A;  4XRM A;  5C44 J;  3O8H A;  1ETW A;  2FJ1 A;  3BJB A;  3HGG A;  1PUF A;  5D19 A;  4UUS A;  3JRG A;  1BJZ A;  2KT0 A;  3VOX A;  5K7H A;  1GV5 A;  2CRG A;  2WGB A;  3VW2 A;  1H88 C;  3VW0 A;  1POG A;  2TRT A;  1ZGW A;  2Y9Z A;  2LY9 A;  1FJL A;  1LE8 B;  3I4N J;  3JSJ A;  4AC6 A;  1T33 A;  2XPU A;  4MFD A;  1DU0 A;  2JMW A;  4CYC A;  4A3K J;  2JA8 J;  1TWF J;  3S1N J;  1RET A;  2PBX A;  1A5J A;  3T6N A;  4A3J J;  4W97 A;  3S5R A;  2FQ4 A;  3HTI A;  3HM5 A;  2G3B A;  3QBM A;  3HGY A;  5EYR A;  5EDN A;  4QIW N;  3TW6 A;  3HIM A;  1JT6 A;  1BA5 A;  2HOA A;  4PXI A;  2DJN A;  1ETY A;  1U8B A;  1ZR4 A;  1XG1 A;  1A6I A;  1JUP A;  2E1O A;  2L7Z A;  4FE7 A;  1NK2 P;  3QKX A;  4NN1 A;  2ZOZ A;  3BTC A;  3GTO J;  2R0Q C;  2Y30 A;  3Q0W A;  4M3B A;  1TC3 C;  3BR1 A;  3SFI A;  5EG0 B;  1GDT A;  2JA5 J;  1JUM A;  4XID A;  4I6Z A;  3MVP A;  3BG3 A;  3AQS A;  2NVX J;  4MXM A;  5CXI A;  2RHA A;  2K9S A;  2QTQ A;  5CXG A;  3P9T A;  5J1U A;  4GCL A;  1OFC X;  1F43 A;  1PUF B;  4UUS B;  1QRY A;  2Y31 A;  4D5F A;  5E3O A;  3BHQ A;  3HTA A;  2QWT A;  3BR0 A;  2O9L A;  2X9D A;  4GCT A;  3EUP A;  3HEF A;  2CU7 A;  4L5E A;  1P7I A;  3RKQ A;  2W48 A;  2DA1 A;  1U9O A;  3F0C A;  3RZD J;  4XIC A;  2MG4 A;  2ZOY A;  3G1O A;  2LD5 A;  2ME6 A;  4XK4 A;  2QF7 A;  2QIB A;  4FE4 A;  2NVQ J;  5M5Y J;  4V2F A;  2JN6 A;  2D6Y A;  4YZE A;  2DMN A;  4GFB A;  2JK3 A;  2UXH A;  4CYC B;  3HDD A;  3Q3S A;  2GM4 A;  2YVH A;  3OSF A;  1BL0 A;  1MSF C;  4MO7 A;  5F0F A;  3KZ9 A;  1MBF A;  4X1E A;  2H1K A;  1MBG A;  2HOS A;  3S15 J;  5FKN A;  2NVY J;  4EEF G;  1XS9 A;  2XRL A;  3Q0U A;  1QPI A;  1ZTR A;  2LK2 A;  3ZQL A;  1GT0 C;  2DG8 A;  5IOY A;  2G7L A;  3JRD A;  4BBS J;  1RKW A;  3FKI J;  1MBH A;  1SFO J;  2K9Q A;  3PM1 A;  2NOG A;  2B63 J;  5EEA A;  5IP7 J;  1YRN A;  3GTQ J;  2DA2 A;  4FCY A;  4A3E J;  3LSP A;  2O8K A;  2GBY A;  3BR3 A;  3PO2 J;  3NAU A;  3M4O J;  4AYB N;  3JRI A;  2ME0 A;  1VFC A;  5HOD A;  1B8I B;  2G0E A;  2G7G A;  2ID6 A;  3A03 A;  2RAE A;  3CQZ J;  3QPS A;  3VW1 A;  5M3F J;  1UG2 A;  2LP0 A;  3GZI A;  4S0H B;  1IUF A;  3FIW A;  3QPL A;  2HXI A;  1JTX A;  5EZG A;  2KDZ A;  4BXX J;  5EGO A;  3ZQC A;  4C3H J;  3L1P A;  4ABZ A;  3ANP A;  3G7R A;  3VVX A;  5D18 A;  4A3D J;  4D7N A;  5M5W J;  1K61 A;  3JRE A;  3NRG A;  5GPA A;  3O60 A;  3FRQ A;  3JRC A;  2XPW A;  1APL C;  3LSG A;  4G12 A;  2G7S A;  3B6C A;  3HOZ J;  4AC0 A;  5JLX A;  3C2B A;  1GV2 A;  2ELK A;  4RBO A;  2UXI A;  2HDD A;  3FK7 A;  2O7T A;  1P7J A;  3F1B A;  1NTC A;  2JA7 J;  4GFL A;  1AKH B;  1JKQ C;  3S1M J;  3BTJ A;  1JT0 A;  1VF9 A;  4UUT A;  1FEX A;  1TWH J;  4A93 J;  9ANT A;  1VI0 A;  2Y2Z A;  5FHP A;  3LOC A;  3BTI A;  5AQC A;  2R5Y A;  1B72 A;  1WCM J;  1S7E A;  1TWC J;  3HOV J;  2XSD C;  2ECB A;  1HLV A;  1YRN B;  2EQR A;  3ZQI A;  3NAR A;  2WB1 N;  2ZCN A;  2K40 A;  5C4X J;  1E3O C;  2Q24 A;  2DMT A;  5F04 A;  2OF7 A;  1ORK A;  5M3M J;  3LSJ A;  3IH2 A;  4B3A A;  5FLM J;  3TED A;  1Y1W J;  3S1Q J;  2COB A;  2K9N A;  1JKR C;  2R92 J;  3HBL A;  1FTZ A;  5K7Z A;  1X2N A;  1JJ6 C;  2JA6 J;  4DYQ A;  3CWR A;  1RR7 A;  5DAJ A;  5K58 A;  2DMQ A;  3A02 A;  2VPR A;  2DTZ A;  1ZQ3 P;  2QKO A;  2NP5 A;  1ETX A;  3BR2 A;  4IHX A;  2ECC A;  1ETO A;  1U9N A;  3G56 A;  2OPT A;  2QCO A;  3EGQ A;  3A01 B;  1UI5 A;  3VOK A;  1X2M A;  2F07 A;  4B4C A;  5GPC A;  2DA6 A;  1Y1V J;  1HDD C;  2WV1 A;  1ITY A;  1FIA A;  2TCT A;  3GTJ J;  1IDY A;  3K2A A;  2M2E A;  3WHB A;  4DZP A;  1H89 C;  4BY1 J;  1X58 A;  1HCR A;  2XGD A;  3S16 J;  5FGL A;  3KKD A;  3E7L A;  2EZL A;  2DA7 A;  4IHW A;  5GP9 A;  3MNL A;  1UMQ A;  2EZI A;  3B6A A;  1NK3 P;  1T56 A;  5FKM A;  3IUV A;  3HE0 A;  3NNR A;  2M34 A;  4A3F J;  1W0T A;  4DYR A;  1WGX A;  4Y52 J;  4L62 A;  3V78 A;  2GUH A;  1ZKG A;  5IYB J;  2Y9Y A;  5H9T A;  3BG5 A;  1OCT C;  3LHQ A;  5E3N A;  5FKK A;  4JNN A;  4B1R A;  2XGC A;  4A3C J;  1G2H A;  5FLV A;  1JKO C;  3AQT A;  3DPJ A;  2UXO A;  2IBD A;  4NDL A;  4DW6 A;  5K7F A;  3WHC A;  3C07 A;  2R5Z A;  3S2H J;  1RES A;  2MGQ A;  2ID3 A;  2EZK A;  4AUX A;  4BY7 J;  4D5C A;  1HF0 A;  1ETK A;  2UXP A;  3H3V K;  3I4M J;  1HOM A;  3S2D J;  2GFN A;  4C3J J;  3JRH A;  5IP6 A;  3LNQ A;  2EZH A;  2OER A;  1JUS A;  4M6V A;  3BTL A;  5DTD A;  2LLK A;  4NEL A;  3H0G J;  1SGM A;  1MBK A;  3ANG A;  5EFY A;  2AHQ A;  5HBU A;  3M3Y J;  4LOC A;  4QTR A;  2DA4 A;  2E2H J;  2X48 A;  3KKC A;  3MKL A;  2L7F P;  2REK A;  1ETQ A;  3HB9 A;  4IHY A;  3GTM J;  2M0C A;  2YU9 J;  5HAW A;  5BNG A;  3HOU J;  2NX4 A;  1WH7 A;  4A3L J;  4HNV A;  5IPA A;  3CCY A;  3GEU A;  2VKE A;  4W1U A;  5M5X J;  3KNW A;  1JTY A;  2L0K A;  4X6A J;  1F36 A;  2L9R A;  1O4X A;  2HXO A;  1W0U A;  2VI6 A;  2QOP A;  1UHS A;  3GTL J;  5IOZ A;  3BR5 A;  3GBG A;  1LE8 A;  2EH3 A;  2I10 A;  3TP3 A;  1MSE C;  2CUF A;  3RH2 A;  2IAI A;  4JX6 A;  3RQI A;  4MFE A;  1MH4 A;  2N8G A;  1AU7 A;  3E7Q A;  4JYK A;  3CJD A;  3CDL A;  4ACI A;  3COL A;  3IV5 A;  4QSH A;  1IV6 A;  1RPW A;  3ZQG A;  3BNI A;  3S14 J;  2LR8 A;  4BBR J;  4FTH A;  3VVZ A;  1TWA J;  5J1R A;  2E19 A;  2NS7 A;  1Q1V A;  5C3E J;  3VVY A;  2DMU A;  4MLO A;  2ZCM A;  1QVU A;  3MN2 A;  4M3F A;  3ZOB A;  2H8R A;  4BKX A;  5E3M A;  4D7M A;  5IYC J;  3PO3 J;  1JJ8 C;  1IRZ A;  4HKU A;  3TW7 A;  2VKV A;  4C3I J;  1QVT A;  3O8G A;  1OJL A;  4Y7N J;  4M3D A;  5IYD J;  2LKX A;  1RKT A;  3QQA A;  4A3I J;  5IP9 J;  5EG0 A;  2CUE A;  1BW6 A;  4M3E A;  3DCF A;  4A3B J;  1IG7 A;  3D1N I;  5C4J J;  1WI3 A;  3BT9 A;  4ICH A;  2P81 A;  1LFB A;  3HOW J;  3LJL A;  5FKO A;  1H8A C;  2HOT A;  5FKL A;  2DG7 A;  1I6H J;  2E2J J;  5CW8 A;  5DS9 A;  3VUQ A;  1SAN A;  5EGO B;  1WPK A;  3FK6 A;  5F27 A;  4DZJ A;  2GLO A;  1FTT A;  3LWJ A;  1IJW C;  1MH3 A;  2HI3 A;  3GTG J;  4A3M J;  2W53 A;  4XRS G;  1I3Q J;  3GTK J;  3HOX J;  1DU6 A;  2MSY A;  3RD3 A;  4JP0 A;  5J3L A;  4GFK A;  1XC5 A;  4IHV A;  2GEN A;  2VUM J;  2WUI A;  3S17 J;  1CQT A;  4V2G A;  3Q0V A;  5E3L A;  2HKU A;  3V6G A;  1GUU A;  3TP0 A;  2HQ5 A;  3HOY J;  1JKP C;  1MBJ A;  5F0C A;  4FIS A;  1LFU P;  2HYJ A;  2DA5 A;  1TWG J;  2DA3 A;  1Z0X A;  2R7Z J;  1IGN A;  2XGE A;  1ETV A;  4C2M J;  2YVE A;  2L7M P;  4A3G J;  3G1M A;  2IEK A;  4CGR A;  2R5Y B;  1B72 B;  3ZQH A;  3ZQF A;  3PPB A;  2Y0S N;  2NS8 A;  3IH3 A;  1D5Y A;  2WAQ N;  3S1R J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...