4M3BA

Rapid and efficient design of new inhibitors of mycobacterium tuberculosis transcriptional repressor ethr using fragment growing, merging and linking approaches
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
190
structure length
185
Chain Sequence
RELAILATAENLLEDRPLADISVDDLAKGAGISRPTFYFYFPSKEAVLLTLLDRVVNQADMALQTLAEDRENMWRTGINVFFETFGSHKAVTRAGQAARATSVEVAELWSTFMQKWIAYTAAVIDAERDRGAAPRTLPAHELATALNLMNERTLFASFAGEQPSVPEARVLDTLVHIWVTSIYGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription repressor/inhibitor
molecule keywords HTH-type transcriptional regulator EthR
publication title Ligand Efficiency Driven Design of New Inhibitors of Mycobacterium tuberculosis Transcriptional Repressor EthR Using Fragment Growing, Merging, and Linking Approaches.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 79
structure length 185
sequence length 190
ec nomenclature
pdb deposition date 2013-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4m3bA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 4m3bA02
2OI8A 3QQAA 4ACIA 2L7ZA 4D7NA 1UG2A 2LKXA 3BTCA 3A01A 1BL0A 4C3HJ 1ETQA 3K7AJ 2D5VA 4GFBA 3S16J 1ETKA 2HOAA 5FJ8J 2M34A 3NI7A 3FK7A 4MIMA 1RR7A 4MLOA 4A3IJ 2YU9J 4CYCA 4AC6A 2X48A 2DA1A 3ZQFA 5J1YA 4D5FA 4A3GJ 4RBOA 1FJLA 3BCGA 2MG4A 4A3KJ 3GTKJ 1AU7A 3KKCA 2KDZA 3K2AA 3P9TA 5F0FA 4C3JJ 1OCPA 1A6IA 1LFBA 2X6OA 5IP9J 1FEXA 5E3MA 1JUSA 1BA5A 4GCTA 3D1NI 1YRNA 2LTPA 1ETVA 4IHVA 2H1KA 4GCLA 2PMZN 3JRIA 1LE8A 4DZJA 1UI5A 4V2GA 5C4XJ 2G7SA 1ETOA 5JLWA 2K9QA 1E3OC 3RD3A 2HYTA 4L62A 3VOXA 2QTQA 4XRSA 2ME6A 1MH4A 4A69C 2KT0A 2TRTA 4M3BA 3S2DJ 1XG1A 3HTIA 2ME0A 2FX0A 4MO7A 4L5EA 1JJ6C 2PBXA 5IP6A 2FD5A 2DA6A 1MBJA 2XPWA 3TP0A 2LFBA 4BBRJ 5E3OA 4YZEA 1HCRA 3ANGA 5EEAA 2V57A 3VW0A 3I4NJ 4MXMA 2E1OA 3GEUA 3T6NA 2N8GA 2XGDA 2ECCA 3BR0A 4JYKA 4UUTA 4QTRA 2WGBA 5GPAA 1MBFA 2E19A 3DCFA 2CQQA 3DEWA 2F07A 5FGLA 1W0UA 2EZKA 1ETWA 2MW8A 5E3NA 4B4CA 2MGQA 3RZDJ 5C44J 3BQYA 1AKHB 4A3FJ 3S1QJ 3SFIA 2EH3A 1XS9A 2CJJA 2NS7A 4FTHA 2DMUA 2QIBA 1BW5A 2YUSA 4DYQA 1MBKA 1IJWC 2Y30A 3QBMA 3MNLA 1H8AC 1B8IB 3ZOBA 2DA5A 3NNRA 2Q24A 3HM5A 4B3AA 3EGQA 3HGGA 5FLMJ 3RQIA 3ON2A 5E3LA 5K58A 2L0KA 3HIMA 3FISA 2M0CA 2Y0SN 2GM4A 3ZQCA 4AF5A 2FBQA 4IHWA 3B6AA 4A3LJ 5C4JJ 1WGXA 3CDLA 3BG3A 2DMTA 2DA4A 1HDPA 4G12A 1Y1WJ 2ELKA 1IRZA 3FIWA 4DW6A 4ABZA 4DYRA 3VVYA 2TCTA 1WCMJ 3SDGA 5F1JA 3JRFA 3S1RJ 2GENA 2LK2A 1I3QJ 1JKOC 2AO9A 2HQ5A 4JX5A 3BG5A 5IOYA 5M5XJ 1GDTA 2LLKA 2E2HJ 2QOPA 2VKEA 1QPIA 5IOZA 2VKVA 4M6VA 4S0HB 4BY7J 1UHSA 2NVXJ 1WI3A 2XPUA 2OPTA 4CYCB 2HXIA 3BT9A 3S17J 3M4OJ 1BW6A 2R5YB 2Y9ZA 4BBSJ 1JTYA 4FE4A 1PUFA 3GTJJ 2M9HA 1JUPA 4J19A 2H8RA 3CJDA 3VIBA 3GBGA 5EGOB 1ORKA 3AQTA 3VVZA 1RKTA 3HOWJ 4JP0A 4BKXA 2RHAA 1FTTA 1DU0A 4MK6A 1MNMC 2EZLA 3Q0UA 3BQZA 1RPWA 2DMNA 5GP9A 3GTLJ 3LSRA 2ZOYA 2NOGA 1U78A 2DG8A 3BHQA 1HDDC 4ICHA 1ZGWA 5JLXA 3ZQHA 3BTIA 5F0CA 1LE8B 2VPRA 2O8KA 2ZCXA 2D6YA 1GT0C 1X2MA 2DA3A 1CQTA 2ZCNA 5EDNA 3HOZJ 1K61A 5F04A 1T56A 1B72A 3HOXJ 5K7ZA 5EZHA 1NTCA 9ANTA 4AUXA 3JRAA 5DAJA 2AHQA 3WHCA 3VW1A 2NP5A 3O60A 1FIAA 2HI3A 4W97A 3RZOJ 5IP7J 2R5ZA 4X1EA 3OOUA 1ZR4A 1WH7A 4QSHA 2JA7J 3L1PA 1MBEA 3VUQA 4QIWN 5D1RA 2QCOA 2X9DA 1JKRC 5J3LA 1JJ8C 2LD5A 1FIPA 3BR3A 5EG0A 3KZ9A 3VVXA 2K40A 3BTJA 1LFUP 1R9TJ 1F43A 2YVEA 5HODA 2CQXA 4D7MA 3HBLA 2NVQJ 4XRMA 2I10A 1BJZA 4MFDA 1IC8A 5EYRA 1IV6A 1NK3P 1T33A 5IPAA 3OSGA 1JT0A 1JTXA 2IAIA 2EZHA 4UUSB 1I50J 3SJMA 1ITYA 5HBUA 1IUFA 2CUFA 2JMWA 1MSEC 3A02A 2QWTA 1ZR2A 3FKIJ 1A5JA 1Z0XA 1VNDA 3HTHA 4XK4A 1VF9A 1IDZA 5FKMA 2R0QC 4KWAA 3PASA 2IEKA 3S15J 5FKNA 2XGEA 1TWFJ 4LOCA 2VUMJ 2OF7A 2UXOA 2YVHA 2EQRA 5CW8A 3JRBA 2HOSA 4IHXA 1GUUA 4A93J 2UXIA 3BJBA 4ME9A 2WB1N 2DA2A 1Y1VJ 2JWTA 5D18A 3VOKA 3W6VA 1MBHA 4M3GA 1HOMA 2WV1A 2L7FP 4JL3A 3G1OA 5IYBJ 3UKGA 3VW2A 3BR2A 2EBIA 4IHYA 4C2MJ 3JREA 2QF7A 2Y2ZA 3HKZN 3DPJA 3IH2A 2R7ZJ 3EUPA 3ZQGA 2OERA 3QPLA 4M3EA 5F08A 2XB0X 3JSJA 3E7LA 1PUFB 2WAQN 1U9OA 5EFYA 2HOTA 2K9NA 1MH3A 3PO2J 2Y31A 2CU7A 4M3FA 5J1RA 3IV5A 3V78A 3H0GJ 3HOYJ 1S7EA 3LSGA 1UMQA 2Y9YA 3BR6A 2EZIA 3A01B 1VFCA 3VP5A 3JRGA 4JX6A 5HAWA 1D5YA 3Q3SA 3PO3J 1ZK8A 2COBA 5GPCA 2REKA 2L9RA 2RASA 2IBDA 5IYDJ 3HTAA 2NVYJ 2ZOZA 3LSJA 2XSDC 3G7RA 3S1MJ 3G1LA 3CMYA 1QVTA 2DA7A 1U9NA 5FKKA 1B8IA 5DS9A 2G7LA 3S1NJ 4FISA 1MSFC 3GZIA 2JK3A 3A03A 4BY1J 3TEDA 3M3YJ 3F1BA 3BR1A 3GTQJ 4Y52J 3V6GA 5HSZA 4M3DA 1YRNB 2O7OA 3KKDA 2FJ1A 1JKQC 4Y7NJ 4NDLA 3OIOA 1ETYA 5M3MJ 3PM1A 5FLVA 2HYJA 1ZKGA 2E2IJ 4RDUA 1IGNA 3LJLA 4EEFG 3F0CA 5EG0B 4XIDA 3OSFA 4W1UA 1ETXA 4IEJA 2GBYA 2JA8J 3G1MA 1QRYA 1DU6A 3C2BA 1G2HA 1XC5A 4A3BJ 5F27A 2IU5A 4HKUA 3O8HA 4B1RA 2XPVA 4FE7A 3BTLA 3NAUA 5M5YJ 5F0HA 1JUMA 4AC0A 1GV5A 3MKLA 1POGA 2UXUA 1X58A 2W53A 5H9TA 5CXIA 4X6AJ 2G3BA 2JA6J 2JJ7A 1TWHJ 2RAEA 4NELA 1SFOJ 4NN1A 2YS9A 4A3EJ 5D19A 2HDDA 2LR8A 2L7MP 2LY9A 2DJNA 2GFNA 1H89C 5C4YA 2R5YA 5EZGA 1GVDA 1VI0A 3HOUJ 5C3EJ 3JRCA 4DZPA 5IYCJ 3HTJA 5FHPA 3NXCA 4JNNA 5EGOA 3ON4A 1JT6A 3MN2A 1HF0A 3S2HJ 4HNVA 4I76A 1QVUA 4MFEA 2W48A 2NP3A 4CGRA 3CCYA 2XRLA 3BR5A 3B81A 4A3CJ 5CXGA 1P7IA 2LVSA 3JR9A 3ZQIA 3VPRA 2R92J 2FQ4A 5FKOA 3QKXA 4AYBN 4BXXJ 2K9SA 3NPIA 3MVPA 1H88C 2R93J 1I6HJ 1NK2P 4I6ZA 3E7QA 3HGYA 4JKZA 2LP0A 3IH4A 1FTZA 3LWJA 2DMQA 3WHBA 5K7FA 1OCTC 1AHDP 4V2FA 5FMPA 2G0EA 3JRDA 1K83J 3Q0VA 1ZQ3P 5AQCA 3S5RA 5M5WJ 2DG7A 1TWAJ 2P81A 4A3JJ 5BNGA 4XICA 1W0TA 2UXHA 1F36A 2XDNA 1RESA 1TWCJ 3GTGJ 2CRGA 1ZTRA 2GLOA 3PPBA 3RH2A 3H3VK 4C3IJ 3FK6A 1OJLA 1SGMA 1RKWA 1X2NA 3RKQA 3JRHA 3S14J 1SANA 5J1UA 3ZQLA 4XRSG 1UI6A 2JA5J 3BNIA 1O4XA 1WPKA 2PZ9A 3I4MJ 4GFLA 3BRUA 1EF4A 2XGCA 3C07A 2JN6A 3HDDA 1TWGJ 3COLA 3NARA 2HKUA 3HE0A 3IH3A 4UUSA 3TP3A 2ID3A 3LNQA 2QKOA 2B63J 3BG9A 5FKLA 1JGGA 1IG7A 3O8GA 1Z77A 3NRGA 4D5CA 2G7GA 3B6CA 2DMPA 5EF6A 3GTMJ 3GTPJ 2GUHA 3KNWA 1TC3C 3TW6A 2CUEA 3HB9A 1HLVA 2UXPA 2DN0A 5M3FJ 1AKHA 4A3MJ 1U8BA 3Q0WA 3CRJA 4PXIA 1OFCX 3LSPA 2ECBA 1APLC 2O7TA 1Q1VA 4UDSA 3G56A 1B72B 1WH5A 2HXOA 2ZB9A 3HEFA 1RETA 3FRQA 2XB5A 2O9LA 1ENHA 2NS8A 4A3DJ 4JX4A 3CWRA 3CQZJ 1MBGA 2M2EA 2M8GX 2R5ZB 2DTZA 3LOCA 1GV2A 1IDYA 2VI6A 3IUVA 3LHQA 1JKPC 3HOVJ 2E2JJ 4GFKA 2ID6A 3QPSA 2NX4A 3ANPA 1P7JA 3AQSA 2WUIA 4FCYA 4GCKA 2NVTJ 5K7HA 3GTOJ 4DYCA 2MSYA 5DTDA 3TW7A 2ZCMA
chains in the Genus database with same CATH superfamily
3QQAA 3REOA 4ACIA 1UG2A 3A01A 4WXHA 2L9VA 2QSFX 3A1YA 3EDPA 4G7OF 2HOAA 3S3OA 3NI7A 1J09A 1RR7A 4MLOA 2YU9J 5E8IA 2BHYA 3BPXA 2DA1A 4Q4ZF 3ZQFA 1KU3A 4ENKA 5J1YA 1WJFA 1FJLA 4KMFA 4BJ5C 3CP8A 3MKYB 3BCGA 1Z6TA 2EA4A 4A0ZA 3GTKJ 1UB9A 2IGMA 2ISYA 1FMVA 1P4XA 5F1RA 1MJBA 3P9TA 5B1BH 1OCPA 1VQ4I 5IP9J 1JUSA 3M8JA 3OYBA 1I1SA 3D1NI 4IVNA 1ETVA 4IHVA 2H1KA 3PFIA 3BG7A 1LE8A 4V2GA 3K2ZA 3AFHA 4MTEA 3HJEA 2LRDA 1E3OC 1J5YA 4N4OB 3OYAA 2W24A 4A69C 4BS9A 2OCCH 4M3BA 2A6HF 2YR2A 3ZR8X 1MNDA 3G73A 4BQOA 3GMEA 2EB7A 3HPGA 3ASOH 2VBZA 3R61A 2DA6A 2XPWA 3FXKA 3QU6A 3TP0A 4RAGA 4BBRJ 5E3OA 1R23A 3FX3A 5EEAA 2CUJA 1IN4A 2N8GA 3D5RC 1IXCA 3BR0A 4JYKA 1D1AA 1F9NA 1QNTA 4ZYHA 1ZH5A 2WGBA 1USTA 2E19A 2CQQA 4ZYGA 1W0UA 2MGQA 3RPUD 4PJMA 1AKHB 3WG9A 4XR6A 2L5QA 4P1WA 1R49A 2ICWG 1G6NA 2J5OA 5JI6A 4FTHA 1FSEA 2DMUA 1YJ9I 2QIBA 2X4HA 4U0WA 4OINF 5DD4A 3QBMA 5CYVA 3K4MA 1B8IB 2KLOA 2DA5A 2JVHA 2Q24A 3NNRA 4B3AA 2XRNA 3GFIA 3GEZA 3ON2A 3KP6A 2WC2A 3RQIA 3OL4A 5K58A 1N75A 3V7CA 5TGTA 1ZG1A 2GM4A 2Y0SN 2ZMEB 2ZFUA 2EINH 5BOXA 1VQKI 3NWSA 4LITA 2VE8A 1STZA 4U9NA 3B73A 2BXYA 5C4JJ 1WGXA 1R71A 5D4RA 2DJIA 2Y69H 4CICA 3F9KA 2JUCA 3BG3A 2DMTA 4M9ZA 4IO9F 2M87A 4PK4A 2IXSA 1Y1WJ 2JA2A 2ELKA 2KDOA 1G3WA 4LGWA 3W6JB 3JRFA 2UV1A 3U1DA 1JKOC 2PEXA 2AO9A 3O6BB 3BG5A 1WJEA 2E2HJ 5EEGA 4I99C 3CJNA 1BR2A 2VKVA 2CYYA 1K7AA 4I09A 5DCMA 4LIUA 4BY7J 3J80K 2VQCA 5D5XB 2WA0A 4LIVA 3M7GA 4UVBA 2KIMA 2XPUA 2OPTA 3HL2A 5E79C 4KN4X 2E1MB 2F4OB 2KP6A 1A31A 3DBRB 2Y9ZA 3K10A 1VQPI 4FE4A 4AWXB 1PUFA 2HYFA 1JUPA 5ICGA 3CJDA 3RDIA 3VIBA 3HYIA 3BLYA 3O2PE 1VTNC 4IHTA 1DU0A 4C9YA 1KYZA 1R4MB 2Z16A 3A4CA 3Q0UA 1H9GA 1KQ8A 2FUG2 1V3FA 3RKWA 2FU4A 5GP9A 1U78A 1FC3A 4EM2A 1HDDC 3H35A 3LAJA 1ULYA 4E6KG 1LE8B 2VPRA 1T98A 1Z21A 4G8XA 1GT0C 1CQTA 2E1MC 2GIVA 2VN2A 4U7BA 3ELKA 3LA2A 4WXDA 3CF2A 3LQRA 3PFYA 1ZGAA 4AIJA 5TRDA 1RUOA 1WJCA 3HOXJ 2BY0A 1YFHA 1ZARA 2OJED 2XAUA 3U21A 5GADJ 2O61A 3GFLA 1LVKA 1S6LA 3JRAA 3IUOA 5DAJA 2WAQA 3VW1A 3E6BA 2L4MA 4IKFA 2VKHA 4OIQF 2BZTA 5IP7J 4X1EA 2KZVA 3MZYA 3OOUA 4KIFA 1TNTA 4HF2A 3K1PA 4QSHA 3QP5A 2B9SA 3VUQA 3OV8A 4QIWN 5D1RA 2QCOA 2X9DA 1JJ8C 4BUPA 1FIPA 1ZAOA 3BR3A 4PFPA 2MLKA 4ENNA 1LFUP 1R9TJ 2ETHA 2MC3A 3DLAA 1RI7A 1S9HA 3GFMA 1XTAA 5KHDA 4GYGA 4XRMA 5EYRA 1LEBA 1IRFA 3PNVA 3UR3C 5IPAA 3H3ZA 4UUSB 2PJRA 2EZHA 4EJVA 1I50J 4DVYP 4KT5C 3A02A 5CKTA 4NC7A 4YFNF 1D5VA 1SFUA 4OD5A 3FKIJ 3TDUC 4EGZA 3TL4X 2TDXA 3RPQA 2KZGA 1VNDA 3HTHA 3KZYA 2ADUA 4RA2A 1YJWI 2QQ8A 2R7WA 1EA3A 3KP2A 1IO2A 4L9JA 5FKMA 3CC4I 2A05A 4KWAA 3CJQB 4XOTA 1YOVB 2XGEA 3ZN0A 4LOCA 2MH9A 5CW8A 3JRBA 4IHXA 4A93J 4ME9A 2WB1N 2DA2A 4L9NA 3F8MA 4KN7X 4XLEA 3M9AA 3MWMA 4V19K 2K02A 4G6QA 5IYBJ 2QBYB 1REPC 2IS2A 4F93B 1O7LA 3BR2A 4KFCA 4IHYA 1YLFA 4C2MJ 2DDBA 3V8JA 5FD6A 2AXLA 3KP7A 2OA4A 3HKZN 2KIQA 3K1MA 3DPJA 2EFPA 5KVRA 2XB0X 1E3HA 2ZO4A 4ESJA 4L5IA 1PUFB 3HRUA 2ZBKA 1R58A 2DU9A 1MH3A 1R1VA 2KRCA 2DK5A 2X1DA 2W4SA 4BE1A 1JXSA 3IV5A 4DBQA 3V78A 1S7EA 3K70C 2EFOA 2HWVA 4YIFA 3FXMA 2K27A 3BR6A 2W25A 3DTIA 3L00A 3E6CC 3VP5A 2LF8A 3OOPA 3VVYA 3DTEA 3Q3SA 2A2FX 1KYWA 1YJNI 3C2GA 5L3BA 4UB8C 1U5TA 2IBDA 5H6QA 1DP3A 1G3TA 4DIQA 1IZ1A 2LF7A 2NVYJ 3LSJA 3SYTA 1XD7A 5HLHA 1V5FA 4HX7A 4BYYA 2DA7A 2DPUA 2CV1A 1ZHFA 5DS9A 3S1NJ 3R6SA 2V26A 5CVUA 4FX0A 1LNWA 3M3YJ 4AM3A 2YX4A 2UZKA 2CS3A 4ZYEA 4MEXF 2DBBA 4IHSA 3GTQJ 4KDPA 1LFPA 3V6GA 3RYPA 4CCNA 5LRSA 5JHFA 2FJ1A 2LY1A 4Y7NJ 3S93A 2ZSHB 3OS1A 2R7UA 1ETYA 3ABUA 2P6SA 1DGRM 4KUMA 4RDUA 1U0JA 3LJLA 3ZMDA 2HQRA 2WAEA 3F0CA 1ETXA 2X6YA 2GBYA 2Q1ZB 3G1MA 2XAFA 1DU6A 3GWZA 2VT2A 3GFJA 1U6GA 4RS8A 1R6RA 2CW7A 2RGVA 4PSXA 3IRRA 3BCBA 4C30A 3NAUA 4I0BA 5LEJA 1JUMA 3MKLA 2CSOA 5H9TA 4RGRA 4X6AJ 2PJRB 2G3BA 3OYDA 3PSIA 4A3EJ 2L7MP 2X1EA 3J7ZI 3ZQ7A 2GFNA 1H89C 5C4YA 2K9MA 2MD5A 4OMZA 4DZPA 3FWEA 5FHPA 1ZELA 2PN6A 3EPZA 4EJTA 3DKYA 3FMRA 3GW2A 5EGOA 1WQ2A 1YTYA 2V1XA 4LJZF 4A6DA 3S2HJ 2IGOA 2ZY9A 4I76A 3C3WA 3ESWB 2NP3A 2XIGA 3I0TA 3BR5A 2PX9A 2MABA 3AG1H 1SFKA 3LA3A 2E7WA 2QLZA 2X6XA 2PI0A 2OQGA 3CP2A 4S04A 3J81K 1GHCA 3MVPA 1H88C 1K78A 1WSUA 1X1PA 2HPMA 3FXLA 1WJ5A 3I59B 4HPQA 3V4GA 5LBQA 3HGYA 3OYCA 1UHWA 1FTZA 2DMQA 3LMMA 5CJ9A 1WJDA 4UHTA 4V2FA 3H36A 3K0LA 2ZXWH 4XRFA 4CUGA 1K83J 3M8EA 1T08B 3QYFA 5FROA 2XF7A 2Z1DA 4E70A 5M5WJ 2PLYA 4A3JJ 2P81A 3C2HA 4N0BA 2EA2A 1A36A 1F36A 3CLQA 2XDNA 3G71I 1ZTRA 2ZXIA 2PFBA 1LDDA 1EH7A 3HIFA 4ZZLA 4RLFA 1AOYA 3C1DA 4C3IJ 3H3VK 2R7OA 1OJLA 1X2NA 3ERED 4LLGF 3RKQA 3S14J 5FFZA 2CFOA 2HPIA 3GZ6A 3QOEA 3H3UA 1P4WA 3RPUA 3ZMSA 1OKRA 2OUMA 3PNYA 2PZ9A 2DAOA 1XMAA 1EF4A 3U9GA 1W5SA 2CH0A 4AIHA 3F22A 3NARA 1KZHA 1QBJA 2WAFA 2HZDA 1Y39A 3LNQA 4AIDA 2DXIA 5DDGA 3SZPA 2RC4A 3D5SC 2IT0A 4FQGA 2NS0A 2XGXA 4BXFA 3OYEA 1LQ1A 2G7GA 2DMPA 3HUGB 3JCUC 1CGPA 2DOFA 2XHKA 1WI9A 1YE9A 1QHHD 1RR8C 1TC3C 3HB9A 2PBIA 3DKWA 4HDVA 2UXPA 1U5TC 1FZPB 2DN0A 2W85A 5B1AH 2XKPA 1OFCX 1YW9A 1S5LC 2VBXA 4UDSA 1Z9CA 5LRRA 3TMOA 2QEXI 3JTGA 1WKMA 2OD5A 4JX4A 4PJNA 2K85A 2EFQA 3U2RA 1HKSA 3HG9A 3F8NA 3CQZJ 2M2EA 3E0JB 1XSDA 1DP7P 4XSZF 3LHQA 4I01A 1SMTA 1GLNA 2M3AA 1TZLA 2E2JJ 1WZ2A 3IC7A 4GFKA 2ID6A 3QPSA 2E1NA 4RB2C 1N78A 2NX4A 2CO5A 1S7AA 2BBYA 1VQ6I 4CZZA 5K7HA 4IJAA 2BEOA 1LDJA 2LG4A 4P9UA 3ASNH 1XPXA 2KHMA 2L7ZA 2RREA 3HC7A 2VODA 2R7XA 4ZDLA 3WODF 4GFBA 2BY2A 2C6YA 2VIXA 3P7NA 2AS5F 4E7JA 2W82A 3BJAA 1IAWA 1K78B 4HA8A 4CYCA 4AC6A 1YW8A 2X48A 3K4BA 1RNLA 3BZ6A 1K4SA 3OY9A 1ZRFA 2MG4A 1T95A 4A3KJ 2IA1A 3HKZA 3K2AA 1FYKA 3F6OA 3CTAA 4RB1A 1LFBA 3P9KA 4XMYA 5E3MA 1BA5A 2EIKH 1HKTA 1YRNA 3IAS2 5LEKA 2PMZN 4HSRA 3TOAA 2HEOA 1EH6A 5C4XJ 1ETOA 3DP7A 3E5QA 1IN5A 2K9QA 2MBFA 2OAZA 3F3XA 2HYTA 4L62A 4HQMA 2RVCA 2TRTA 1Z6RA 1XG1A 4HG2A 5ED4A 5J40A 2VB6A 3DTKA 3JAMZ 2PMUA 1KU9A 4YZEA 1L0OC 1YX5A 1HCRA 2EV6A 1FLIA 3ABMH 4MNUA 3A0BC 2V57A 3I4NJ 1U2WA 4MXMA 2GZWA 3T6NA 2XGDA 1BI0A 3M8FA 2ECCA 3PUFA 2I8DA 3K4CA 2P5KA 5GPAA 4BQQA 1DDNA 2GIZA 5FGLA 2LSOA 4GXOA 2EZKA 4XKWA 5F6FA 4B4CA 1ZLJA 5E18F 3RZDJ 4BACA 3ONQA 3BQYA 3S1QJ 2VJIA 2EH3A 2CGPA 3MZHA 1FP1D 4G7HF 3TO6A 2YUSA 4DYQA 3PQJA 2GXBA 1YG2A 1Y6IA 4CCMA 1Y0NA 2E60A 2A6TA 3VYRB 3EGQA 5ICCA 3HSRA 2JSPA 1Y8RB 3HIMA 3FISA 2KISA 3KEYA 5IY5H 1DPRA 2WY7Q 2XAJA 4ANJA 2WTEA 3LSHA 1XB4A 3OR2C 1QQIA 3CDLA 4YFXF 2DA4A 1FBSA 5J8FA 1HDPA 4G12A 3FIWA 2VJJA 4DYRA 1HA8A 4MHGA 3S1RJ 3OYKA 5J6XA 1FWZA 4JX5A 1KQ0A 2LLKA 3FXOA 1K79A 4E4HA 2RQPA 2F2EA 2YX7A 2DDAA 3DWLE 4YFKF 3FBNB 1QPIA 3WGGA 2F48A 3ZPLA 1R7JA 2M5WA 3CMEI 1VQ7I 3CMAI 1MZBA 4PJJA 2H09A 4CYCB 3PUBA 3BT9A 1JTYA 5KCMA 3GTJJ 4FT8A 2IVMA 4XSXF 1ORKA 3I71A 4Y4RA 1RKTA 3IAM2 5EJCA 4JP0A 3HOWJ 2IW5A 3MCZA 3S3NA 1SVLA 3RQ4A 1O3TA 3E5XA 1BN5A 1MNMC 1UAAA 3K8PC 3BQZA 1B6AA 1RPWA 1NHAA 2QM3A 2FOKA 1FP2A 3LSRA 3GTLJ 3J7AY 4KNYA 1R4NB 2GA2A 5F0CA 5JVTA 3WE3A 2HQNA 4M73A 2OCEA 4R79A 3CJRB 3DU5A 4QPQA 2DFEA 1B72A 3G2BA 4CCOA 3MKZA 2STTA 2R7FA 5K7ZA 4PCQA 4L9VA 1NTCA 9ANTA 1YYVA 4WK8F 3CC7I 5ILSA 2AHQA 4J01A 3WHCA 5LFAA 2ZC2A 1FIAA 2VXDA 4W97A 3RZOJ 1S3JA 3BZCA 2Z99A 1ZRDA 2B0LA 4XKCA 2K40A 5FLXZ 1Z67A 2FXAA 4LK1F 1F43A 5DV5A 2Y75A 2CQXA 1LVAA 4D7MA 3HBLA 2I10A 4MFDA 1XMKA 2CQKA 1IV6A 1NK3P 3OSGA 3W3CA 1JTXA 1RUNA 5HBUA 4OIOF 3J7AO 1MSEC 2DFIA 5D4SA 2QWTA 1W7PA 1IRXA 2FNPA 4U88A 4H0EA 1ZR2A 1Z0XA 2OC6A 4HDUA 1YHQI 4Z2YA 3L09A 4Y13A 4XK4A 1V5GA 1IDZA 3I54A 3MFKA 2DFHA 1MMNA 3WTSC 2R0QC 3K4KA 3PASA 1UZCA 2IEKA 3S15J 4ETSA 3KZIC 5FKNA 2NYXA 1TWFJ 5HDNA 2OF7A 2HOSA 3CD6I 1SAXA 3Q9SA 5FB2A 2UXIA 3BJBA 1WWXA 3FMSA 4RGUA 3LQQA 4BNCA 1Y1VJ 3CUOA 1QO0D 3QPHA 1WFXA 4ZDPA 5CVRA 2L2OA 3W6VA 5K5OA 4KIGA 1HOMA 2L4AA 2DT6A 2JUGA 3K1NA 1PDNC 3VW2A 2CQ7A 1P4AA 3IKVA 2M1BA 3Q5FA 1L3LA 3JREA 2OTLI 4KA4A 1MDMA 2LOOA 1R5HA 4TV7A 5CQEA 1TLHB 4A0XA 1V55H 2R7ZJ 1E17A 2DQLA 3E7LA 3A2KA 2Q0OA 2Y0MA 4X0GA 2K9NA 2V1NA 3DLLF 3PO2J 4F52A 2O6GE 2CWEA 2FBHA 3AL0B 2RDPA 3HOYJ 3F6VA 2Y9YA 4BJTA 4U87A 2EZIA 4GYIA 1O3RA 3A01B 1W4MA 4A2UA 3JRGA 2BVMA 3KYLA 4AYBA 3PO3J 2FJI1 2COBA 3WTYC 2JRTA 2XDVA 4E7ZA 2YVXA 3SXYA 3G4SI 3K69A 3HTAA 1J59A 2P5LC 3G7RA 4M72A 2EWNA 2A07F 3G1LA 2ZJQF 3S1MJ 1QVTA 4U0YA 1U9NA 1I6XA 2ZJ2A 3GZIA 3AL0C 2JK3A 1XGNA 3TEDA 2W00A 3ZGKA 4NC8A 2HFHA 2V9KA 3LSKA 3HSFA 2FMYA 3QOPA 5LHHA 5DM7F 1JKQC 4OD4A 4RAFA 4P5OA 2KQRA 3KLOA 5M3MJ 4KICA 3V42A 2HYJA 5D5UB 3VOEA 1IGNA 1QZZA 4QPOA 1GVJA 3X2QH 3OSFA 2VPLA 4CA0A 1MMDA 4DOZA 3C2BA 1LPQA 4B1RA 1FYLA 2XPVA 4FE7A 1XMXA 5D5WB 4OOIA 5F0HA 1GV5A 2UXUA 1POGA 2W53A 4L0YB 3CDHA 4UV8A 5H6RA 4HQEA 1TWHJ 1SFOJ 4YELA 4ITVA 2LR8A 1SEUA 5E17F 2HTSA 3IWFA 2H8WA 3F8CA 2R5YA 5D8KB 3VWBA 2XC7A 5IYCJ 5F64A 3HTJA 2O8XA 3FM3A 2BE5F 3OYIA 3OYMA 1BR1A 3QAHA 2W1OA 2W48A 3CCYA 2XRLA 2A69F 2FQ3A 1JE8A 4G6DA 4PGHA 1NG6A 1TT0A 2FQ4A 3QKXA 4HOBA 1SC7A 1J2XA 3KX2A 1X19A 4I6ZA 5HLIA 3WG7H 1M1EB 1V5EA 4BL0B 5K7FA 5FMPA 1MDMB 4HX8A 4KYWA 3GYHX 1BIBA 2G0EA 4YG2F 3SFZA 2HNHA 3IKTA 3JRDA 1ZQ3P 1EV7A 3FZVA 5HDGA 4O3MA 5FRNA 4EM1A 2HS5A 2GOMA 2ESNA 2VE9A 1YITI 3WTTC 1W0TA 3I4PA 2R7QA 2K3PA 5B3SH 3GXOA 4ESBA 1RESA 1P92A 2ELJA 4CDGA 1AWCA 1TT5B 3GTGJ 4XQFA 2RNGA 4HF0A 1FT9A 2K5CA 5L3FA 3MAJA 1SGMA 1RKWA 3ECHA 3JRHA 1KONA 3JSPA 2IPQX 5J1UA 3HHGA 3ZQLA 2D45A 3KFWX 2A6EF 5DCMB 5LHIA 3B02A 1UI6A 2JA5J 2R7VA 1Z05A 3BNIA 3LAPA 2R7RA 3I3LA 3MMYB 2HDCA 3I4MJ 3PJRA 4GFLA 1W1WE 1HSTA 1FNNA 1MKMA 3FKJA 3C07A 4DNCA 4RB3C 3FHNA 2R7TA 3HE0A 3IH3A 2R7DA 5IT3A 2V9VA 4UXNA 5LGTA 2LBFA 2QKOA 5L3GA 1XGMA 3BG9A 4XORA 4U9LA 5FGMA 2LY2A 1CF7A 1FBQA 2LDUA 4D5CA 1HSJA 2DOEA 5EF6A 5FD5A 2HOEA 1R36A 3W2WA 3WE2A 4LG0A 1HLVA 4WF2A 2DI3A 5HDKA 1LDKB 1YIOA 3E1SA 2VLAA 4IF4A 1G4DA 2V6EA 1QU3A 3CRJA 4PXIA 2ECBA 4EMSA 2DYSH 5DCFA 2HGCA 2M30A 3ECOA 3H9JA 1WH5A 3CCRI 1ENHA 3A0HC 2NS8A 3J7YJ 3RCOA 1NH3A 2D2WA 2K86A 5HNFA 1ZYRF 3D0SA 2CUZA 4HV6A 2DTZA 3LOCA 1PYVA 2GWRA 1GV2A 2VKDA 1IDYA 2VI6A 3DEEA 3DKXA 3JSOA 4OAZA 5LHGA 1T2KA 3HTUA 1JKPC 1ZLKA 3I9V2 1YW7A 1FYMA 4BHCA 3ANPA 3AQSA 3KYCB 2WUIA 1MJ9A 1S29A 4N4NB 2IA0A 1OQYA 4IZZA 2NVTJ 3BOQA 5DTDA 2Z5UA 3QU3A 4ZJZA 2OZ6A 3T5XA 1TQPA 3ISPA 2LKXA 4G6TB 3K7AJ 2D5VA 2A68F 3S16J 1ETKA 1YQAA 3E6DA 5FJ8J 1HXDA 3CF5F 2JPBA 2M34A 2HKXA 5KAIC 5DYMA 4XKBA 4WWCA 4A3IJ 2Y0SA 4UVCA 1B9MA 2PFVA 1AU7A 3KKCA 3CZ6A 2KDZA 3I5UA 5GTHC 4KT6A 3WTVC 3MKWB 3L2QA 1A6IA 3F8FA 5HNHA 4I7HA 5BQTA 1TQMA 2E36A 2F5FA 4GCTA 3ZMUA 2LTPA 3M1EA 4II2A 2G7HA 1T8IA 4NUBA 4OU0A 3JRIA 4DZJA 1UI5A 2G7SA 3IL2A 4J00A 5AONA 3RKYA 5TJJA 3ROUA 1W7PD 4XNFA 3MZ8A 4F91B 2PQ8A 5B5EC 2ME6A 5CQGA 1HW5A 1HKQA 4B43A 1YS7A 1D1BA 2A3SA 2ME0A 3LWFA 3IHUA 1BI1A 2FX0A 4L5EA 4EATA 3ZCOA 3ERMA 3E97A 4MGRA 1MBJA 3VB2A 5B66C 2DTRA 1Z1DA 2WY8Q 2ZFWA 4I0AA 2E1OA 4ENMA 1WHUA 5JR3A 3KLNA 4IX7A 3GVAA 1CF7B 4EM0B 1IXSB 2H94A 4QTRA 3LA7A 5FRMA 5K5RA 4NNJA 1MBFA 1PP7U 2F07A 1SD5A 2KL4A 2MW8A 3L9FA 5DUIA 4BE2A 3OL3A 4XLFA 1U5TB 3F8BA 4A3FJ 3SFIA 4CO8A 2Z9OA 2NRAC 4Y33A 3WTZA 3V7SA 3COAC 4LD5A 1MBKA 4BEHA 5BS6A 1H8AC 1NG7A 4L5JA 3ZOBA 1EJ9A 3HGGA 5FLMJ 5E3LA 2L0KA 1DQUA 2M0CA 2EV5A 1K4TA 1MNEA 3ZQCA 2K4BA 3WGIA 4IHWA 3B6AA 2W84A 3LSMA 3QODA 2F4IA 1ZREA 4D0PA 1ZGJA 1SFEA 2I5UA 4M6XA 1IF1A 1IN6A 2DT7B 3EUKL 2LC2A 1IRZA 4DW6A 2MC4A 3M1CA 4ABZA 4I02A 1WCMJ 3SDGA 5F1JA 2GENA 1I3QJ 3AKZA 3D5LA 4RMNA 3VTIA 5DD8A 4CCKA 2QOPA 1S72I 4CYDA 2VKEA 1HC8A 1XGOA 1YS6A 1UHMA 2KRFA 2NVXJ 3FXJA 2OTJI 3OWTA 1YX3A 1WI3A 4CHUA 1R00A 5E1WA 1SMYF 2BYVE 2HXIA 4LK0F 3ABLH 1BW6A 3R60A 4IRHA 4JQFA 3E6MA 2H8RA 2CW8A 2JQ7A 2IA2A 3BPVA 3GBGA 3GLLA 4M74A 1I39A 2XUBA 2CV2A 5EGOB 3AQTA 4HW0A 3VVZA 1FTTA 4MK6A 4HEA2 1Q1HA 2EZLA 3OYHA 4EGYA 1O57A 2HTJA 1LEAA 1TBXA 2WB1A 1T38A 2DMNA 2LNBA 4MQVA 4Z6YA 4JK1X 2DG8A 2PJPA 4ICHA 4ZDOA 5JLXA 1B1BA 1OCZH 3Q9VA 2ZCXA 2D6YA 3MD2A 1X2MA 2DA3A 4EJOA 5H2FC 3N97A 5EDNA 5CVVA 3BWGA 4YEJA 3HOZJ 3ZXSA 2NNNA 4E7LA 3FMQA 5F04A 2H27A 1VQMI 2FBIA 5EZHA 4RM3A 1RC9A 4AUXA 4B09A 5BMZA 2NP5A 2V1DA 3K4LA 4XLAA 5LLQA 3O60A 2HI3A 1FBUA 2QVOA 1A6QA 2R5ZA 3BP8A 1ZR4A 4LLLA 4II3A 2Q2EA 4PJLA 5E1XA 3JAMK 1G59A 1MBEA 4MQ9F 2B1EA 1JKRC 1XDSA 3KZZA 5J3LA 4ASNA 2QKLB 2BY3A 4B8XA 2DW4A 3VVXA 3BTJA 1TNSA 4PGGA 2EPFA 3L2VA 1OMIA 3V8KA 2XAQA 3ZMVA 5HODA 1E3PA 2DYRH 1VQ5I 4P9FA 4XLPF 5LGNA 5GAEJ 2NVQJ 1IC8A 1MJAA 5HVQC 1T33A 1BOBA 3SEZA 1JT0A 3TBIA 5IT9Z 2IAIA 3SJMA 2E5ZA 1D3YA 1ITYA 1IUFA 2CUFA 3IRQA 3CCEI 2JMWA 5HS8A 1QA6A 1FOWA 1G3SA 3WU2C 5E20A 2ESHA 2KRHA 2NVUB 2VXZA 2KJBA 5ILVA 1I1GA 3HOTA 1KA8A 1FOKA 1BI2A 2EQRA 1GUUA 1MD0A 4A0YA 3M07A 3BJOA 1HBXG 4HAMA 1S8NA 3CCQI 2DO7A 2M7AA 2WV1A 5GAGJ 2COMA 2NOJB 5DM6F 4JL3A 2ZXHA 4B44A 2W57A 2A61A 2EBIA 3SDBA 3AG2H 1A35A 3KCCA 3QYBA 1PJRA 2KJCA 4IL6C 5ICFA 2VC0A 3IH2A 4NC6A 1X1DA 1T39A 1E2XA 3FXUA 1OCOH 3QPLA 1ACIA 2OERA 3JSJA 2WAQN 5EFYA 4B48A 1T6SA 2X6WA 2E5NA 2Y31A 3K9TA 4HNUA 1BC7C 2PG4A 2QSGX 1ERDA 3H0GJ 1D8KA 3S32A 3FBIB 2X51A 2RKHA 2PMHA 1VFCA 4IOCF 4UVAA 1D5YA 4GGGA 4R8HA 1Y56A 1IXRC 1JHHA 5GPCA 2REKA 4MEYF 2L9RA 2RASA 4U0VA 5FFXA 5A2QZ 4RM2A 4BQAA 2MD0A 1FPQA 1U8RA 3CESA 2X1CA 4M6YA 1ZRCA 2UUZA 2L54A 5FKKA 1B8IA 1BBYA 3KIOA 1X1BA 2F5EA 4M71A 2VL8A 2XKOA 4BY1J 3LL7A 3VYUB 3F1BA 2YU3A 3BR1A 3HRMA 2K3FA 2O03A 5HSZA 4M3DA 3VFZA 2ZMEA 1YRNB 1OYIA 1HQCA 1IUYA 3KKDA 4RAZA 2HR3A 6PAXA 2K7LA 2ZJRF 2Q2EB 4NQWA 2MYSA 5FLVA 4O5VA 2B7EA 2BXZA 4EEFG 5LGUA 3QPTA 4XIDA 2HQAA 1VQOI 4W1UA 4FHTA 5D6FA 4IEJA 4BE0A 4PZJA 2JA8J 3QYEA 3ABTA 4A3BJ 3PNTA 5F27A 1WVRA 3VSLA 2IU5A 4UB6C 3BTLA 2QSHX 1W5TA 2HKOA 2L9NA 3H5RA 1X58A 5CXIA 3PL8A 1OR7A 3HZJA 5FLXK 2QKMB 2RAEA 4NELA 4LB5A 2XF5A 4ON0A 2R4GA 2VBYA 2DJNA 2F6CA 3AG3H 5EZGA 1VI0A 2CG4A 2EIJH 5C3EJ 2RQQA 4A5MA 1TQIA 3EQLF 2V1UA 2HU9A 4CGRA 2P7CB 3B81A 4H4KC 4A3CJ 3ZQIA 2LH9A 2CFXA 3DBHB 1QPMA 1VQLI 4LFUA 4BXXJ 5K1YA 1BM9A 4A6EA 1U3EM 2R93J 3OYNA 3E7QA 1USSA 4JKZA 2LP0A 3IH4A 3LWJA 4UUVA 1OCTC 3KP5A 1AHDP 4RGXA 2FNAA 2MLGA 1YI2I 3H9GA 1X4OA 1BOAA 3H1CA 3I53A 5AQCA 3S5RA 1Z91A 4BHBA 2DG7A 1TWAJ 5BNGA 1OYYA 2UXHA 1MMAA 2XROA 1F4KA 4HLXA 2ZJPF 3FXRA 1TWCJ 1OCCH 2GLOA 3PPBA 1XCBA 2O0YA 1EKEA 3FK6A 3SHFA 1GXQA 2BOLA 1SANA 3GZ5A 2QENA 1KU2A 1GXPA 4IPAA 2K9LA 3RKXA 2QUFA 2A5YB 4XRSG 2UWMA 4Q48A 4IRVA 5E8GA 1O7FA 1WPKA 2JRMA 3HRTA 1HW1A 4OWRB 4EJUA 2P7VB 2V9PA 2XGCA 2JN6A 2HDWA 1TWGJ 2H1LA 3MEXA 3ZMZA 3COLA 2HKUA 2F5CA 1AA7A 4HX4A 4UUSA 1Z7LA 1O3SA 2ID3A 1JGSA 3TO9A 3V8LA 4HZFA 1X1AA 2FRHA 2B63J 5FKLA 1JGGA 3CDIA 4XN3A 2BW3A 3NRGA 1OISA 1BC8C 3B6CA 4L9TA 2PMZA 4BU2A 1BIAA 4A5NA 3GTMJ 2EIMH 5HOOA 4NQWB 3ZMTA 1X1CA 3KNWA 3CJTB 2CUEA 1G8XA 1S7OA 2BV6A 3FHZA 5M3FJ 3Q0WA 3KE2A 1APLC 2O7TA 3ZP5A 1TP4A 1LB2A 1B72B 2ZB9A 3T1BA 4CXFA 2EV0A 2P4WA 3FRQA 4A3DJ 3IP4B 4Y3OA 3H0DA 3WTUC 3S3MA 2F4MB 2ZSIB 4AU7A 1D0YA 2QBYA 2CQNA 2ZMEC 2D1VA 3L2RA 2QWWA 1TL8A 2FBKA 1MBGA 2M8GX 5L3CA 3ULQB 1ZN2A 2HZTA 3R0AA 4AD9A 3CCMI 2GA1A 1QZEA 2VJ4A 4U7DA 3HOVJ 1X3UA 5CPRB 2IGKA 3J80Z 4GCKA 3L2CA 2MSYA 1BJAA 2B3WA 4F92B 1MW7A 2ZCMA 3I58A 2OI8A 4D7NA 4CZCA 4F3QA 3BTCA 4Y17A 1W36C 1BL0A 1UJ8A 1B4AA 1ETQA 1WRJA 4C3HJ 4D1QA 2OBPA 2HYGD 3VEPA 1OR7C 4DQ2A 4IQJA 3VODA 3FK7A 4MIMA 3CCLI 3DPUA 3WTXC 2M45A 3NRVA 4NBQA 4M9SA 3K6GA 3NS4A 5ICEA 5LD2C 3RIRA 3R4KA 1W7PB 4HLYA 4IOAF 4D5FA 4A3GJ 4RBOA 1P2FA 4HSTA 3SEQA 1LJ9A 3T8TA 3U1KA 2VONA 2IS1A 4EQQA 2ZNYA 1X3WB 1MMGA 2FEZA 3WU0A 4HNTA 5GTIC 5F0FA 2VQGA 4C3JJ 2BY1A 2DODA 2X6OA 1FOYA 2FMLA 4GO1A 4LMYA 4BH9A 1FEXA 2JTVA 2JSCA 2KFDA 1D0XA 1Y0UA 4WIBA 4QLCU 1D1CA 4ZYDA 4UY8I 4GCLA 1BR4A 1R1UA 4EVIA 2WWYA 3ML6A 2JVGA 3S2WA 4CSWA 5JLWA 1UCRA 5FO5A 3AAFA 3RD3A 3VOXA 3CUQA 4HV5A 4IXAA 2QTQA 3HSEA 4K2EA 4XRSA 2IS4A 1MH4A 2KT0A 2QA4I 5HS9A 3S2DJ 3HTIA 2JZYA 2QYOA 1HW2A 4XKVA 1I3AA 1K6YA 4MO7A 3C7JA 1JJ6C 2PBXA 5IP6A 2FD5A 2Q8KA 2QQ9A 3DFGA 2LFBA 3TKYA 3ANGA 3VW0A 4FX4A 2M7BA 4CCLA 3FM5A 3GEUA 2LKSA 3HRSA 1K6OA 2MH2A 1PVEA 3DV8A 2BW3B 3VYTB 2V6CA 1WJBA 3DBLB 1I27A 4UUTA 1VQ8I 2ZXJA 3DCFA 3DEWA 4OAYA 2GQQA 2XVCA 3ZRGA 2M4GA 1ETWA 5E3NA 3OIPA 4BXUA 2L3DA 3EYIA 5C44J 4L18B 2VASA 1DGWY 1XS9A 2CJJA 2NS7A 3L2WA 3EETA 1BW5A 2IGNA 4XN0A 1IJWC 2Y30A 2CV0A 2VOOA 3DPTA 2X85A 3H5NA 4ZTJA 3MNLA 3SQNA 3CC2I 2KPMA 3FF5A 4O6JA 5GAHJ 3HM5A 1FX7A 3I59A 4C2MA 2NAZA 5BPIA 3SZGA 2M8EA 3RYRA 4AF5A 1R1TA 2FBQA 2GXAA 4C2UA 2GOXB 4A3LJ 2H6BA 2L9SA 5AIQA 3ZN1A 2DLLA 4R1HA 2Z2SB 1N25A 5L3EA 4GDFA 3EYYA 4UNOA 4GRIA 3CO6C 1XSVA 2EJRA 2E34A 2P0WA 2TCTA 2IP2A 2XSJC 2YPRA 2Z3YA 4F55A 4AVPA 2A5WA 2LK2A 3W6KB 3RSNA 5IOYA 2HQ5A 1GDTA 5M5XJ 3RJPA 2QQBA 4Q47A 3RH2A 2FSWA 1DUXC 5IOZA 2F5DA 3OS2A 5BPDA 3OYGA 1MMSA 4M6VA 4E7KA 3C18A 4S0HB 4KMUX 2EFWA 1UHSA 2OZUA 3VSKA 2R3SA 2QGUA 3HPHA 4WX9A 2GAUA 3S17J 4IRGA 3S8PA 2LMDA 5DUKA 3M4OJ 3DEUA 2R5YB 4BBSJ 3P5JA 1XDUA 2J5PA 2M9HA 4J19A 4PDKA 3W2VA 1UG0A 3GF2A 4BKXA 2RHAA 2Y48A 2LREA 4HBLA 2EFNA 1P9QC 1W36D 4AVZA 3QWLA 2ZOYA 2NOGA 3HUGA 3BHQA 1TW2A 1ZGWA 3ZQHA 3BTIA 2O8KA 2KIFA 2WBMA 2ZCNA 3GZNB 3CUQB 3DQVC 1Z3XA 5HLTA 1D8JA 2QZ8A 2XASA 1K61A 2CW0F 2KMUA 2MFZA 1T56A 2G7UA 1UFMA 2OV7A 3GLXA 3H9QA 2ZKZA 2NXNB 3GO5A 4XLHA 5K5QA 1PUEE 3BCAA 2H6CA 2AQFA 3G3ZA 2W7NA 3CMMA 4G94A 4FASD 3I56I 1F1ZA 1WH7A 2WADA 1MGTA 4G9YA 2JA7J 3L1PA 3T0YA 4CGZA 4HF1A 3CUQC 3TQNA 1W5CC 1JHFA 1R5GA 2LD5A 1OCRH 3EUAA 5EG0A 4ZC3A 3G6EI 1G3YA 3KZ9A 2E35A 2YVEA 4XM3A 3LSIA 3QP6A 4HYEA 5JFRA 3BROA 5HLGA 4YRVA 1BJZA 4RAYA 1Z7UA 2Z33A 2K4JA 4DJAA 2LBFB 3HTSB 2YSRA 1E0EA 4KITB 3KP4A 5HS7A 1ONVA 4GCVA 3T8RA 3OMYA 4PSWA 1Y8QB 3PQKA 3OS0A 1A5JA 1OPCA 1J0RA 5CLSA 2VOPA 3KPHA 4E7SA 3OYJA 2M4KA 4B47A 3W2AA 1VF9A 2IRFG 2OQRA 1ON2A 3E5UA 4XLCA 4ENJA 4OIRF 3J81Z 4LG0B 3KEOA 3KYDB 2VQLA 1OYWA 3KP3A 2VUMJ 2DFFA 2UXOA 1QGPA 3I64A 4YIIA 4BDZA 1C0WA 2YVHA 3BC8A 3DXJF 5D8LB 1DPUA 1RZ4A 2FOWA 2JWTA 2ZCWA 1MIJA 4YIRX 5D18A 4N9HA 2X0LA 4B3XA 3VOKA 4M9XA 1MBHA 4M3GA 4BQNA 3CCUI 1IV8A 2L7FP 3HHHA 3G1OA 3R0JA 5KK1A 3P9CA 3UKGA 4AIKA 3BZKA 3RI4A 3K4NA 4OMYA 3F72A 4NHJA 4N9IA 2QF7A 2Y2ZA 1H0MA 3ZQGA 3EUPA 3JTHA 1ZG3A 2BHZA 4M3EA 5F08A 2G9WA 2P5VA 2GXGA 3DPLC 1X4PA 1U9OA 3AG4H 2HOTA 5CVIA 3BG6A 2CU7A 4P96A 4M3FA 4PJ0C 5J1RA 2FA5A 2XAGA 1VZ0A 3MQ0A 4WCGA 1J9IA 5EEHA 4LG3A 3K70D 3LSGA 1LUJB 1UMQA 1I5ZA 2D1HA 2KIUA 3SWHA 3SZTA 2O5RA 4JX6A 3VYSB 4JOMA 4E7IA 1IW7F 2ELHA 5HAWA 3L7WA 1O3QA 4RGSA 1ZK8A 3L2UA 2ZNZA 1Z3YA 3KETA 3F21A 2IS6A 3EUHA 3WTWC 2NNYA 5IYDJ 2ZOZA 1KU7A 2XSDC 2V7FA 2L02A 1T0FA 1SD6A 1FY7A 3CMYA 1QHGA 2UXNA 1XGSA 2STWA 2G7LA 2VC1A 4FISA 1MSFC 1B9NA 3A03A 3F23A 1X3ZB 3K4JA 2P8TA 2UXXA 3LFUA 2DPDA 2AXTC 4FETA 4BJ6C 4Y52J 1J75A 4ESFA 2O7OA 1ON1A 1IN8A 2BVLA 4I98B 3OYLA 2E1CA 1XX5A 3HXLA 2E7XA 3OIOA 4NDLA 4QWQA 1A04A 2O3FA 3PM1A 3PIPF 4E7HA 1RRJA 1VQ9I 1ZKGA 4PUSA 2E2IJ 1IRGA 1SVOA 2ACJA 4XLNF 5EG0B 4MTDA 2VT3A 1QRYA 2L01A 2HVSA 4XBFA 1G2HA 1XC5A 3CCSI 4HKUA 2DT5A 1XCVA 3LSTA 3O8HA 2FE3A 2VBWA 5M5YJ 4P55A 1YIJI 3NQOA 4AC0A 2P6TA 1PP8F 3JW4A 1OLTA 2RNJA 4ZH4F 3H5AA 1BI3A 1SFXA 4LLNA 2JA6J 2JJ7A 4NN1A 4I2OA 2YS9A 4OIPF 2VJ5A 2HDDA 5D19A 2LY9A 1B59A 4BHPA 3CCVI 3GX4X 1GVDA 1KGSA 2E71A 2WV0A 3ZQQA 3HOUJ 3JRCA 1SVMA 5IT9K 1H9TA 3DU6A 3NXCA 4JNNA 5KAFC 1EH8A 1JT6A 2XAHA 3ON4A 3MN2A 3NWTA 1HF0A 2F5VA 4HNVA 1QVUA 4KIBA 4MFEA 1XSXA 2V79A 5CXGA 3WU1B 1P7IA 2XF6A 2LVSA 3E3VA 3GCMA 3JR9A 3VPRA 5H20A 5JVGF 4PFOA 2R92J 2QQAA 5FKOA 4XOPA 2KKOA 4BEHB 4AYBN 1J7KA 2K9SA 4Y15A 3NPIA 2R7SA 1FSHA 1I6HJ 3CCJI 1NK2P 2OU2A 3KEQA 3N4MA 3H92A 3P9IA 4BDYA 4S05A 3WHBA 3I55I 1LKXA 4CCJA 2VQHA 3HOSA 3LFKA 5E1ZB 4EV0A 4Q5SF 3Q0VA 5JHUA 3FDYA 4UV9A 3QRFF 2HVQA 1VQNI 3TGNA 3O3KA 1ODDA 4BAYA 4BGDA 4XICA 5TISC 1D0ZA 1FOXA 4D9JA 1ZG5A 2CRGA 1P6RA 3IWZA 3ABKH 3WGHA 4XL9A 1WJAA 3PIOF 5KNLA 4IQ4A 3CLOA 1V54H 4F7ZA 2LYCA 2V4JC 5D6EA 1TW3A 4EJWA 5ILUA 3UNGC 2MA3A 1F5TA 2RV8A 1R5ID 2JPCA 3DF8A 4ZZDA 1O4XA 3V7RA 3BRUA 4WXCA 1N77A 4L0ZB 4ZTFA 3HDDA 4DBRA 2ISZA 3BDDA 1YO5C 3TDZC 2HVRA 1FMWA 4XONA 3TP3A 5DEQA 1SD7A 2AQEA 1TTYA 4CH7A 5A2QK 1IG7A 3CO7C 3O8GA 3FXQA 1JI8A 1Z77A 2CMPA 5J4YA 4IRIA 1RIOH 5AIPA 2EK5A 4C2TA 4G7ZF 2GUHA 3GTPJ 4RLQA 3VDXA 3TW6A 3TO7A 2M0MA 3EUHC 1IN7A 4ZYAA 1AKHA 4A3MJ 4NB5A 1U8BA 3NEUA 4JBAA 3OR1C 1T0FC 2IJLA 4KJZA 3LSPA 1Q1VA 2FF4A 2LKPA 2DK8A 3OYFA 4HRIA 3G56A 3GUDA 2HXOA 3HEFA 1RETA 3BY6A 5CVJA 2XB5A 4A12A 2O9LA 5D5VB 1QZYA 1V4RA 1R22A 1SD4A 4KISA 1XN7A 1SAUA 2BGCA 2JT1A 5J47A 3CWRA 2DCEA 1KQ9A 2R5ZB 3OIQA 2EILH 2DQRA 2L7KA 3IUVA 4DGWB 5L3DA 5J4VA 3BJ6A 3N05A 1P7JA 2DOAA 4LB6B 4FCYA 3RTRA 5J8CA 4RB0A 3GTOJ 4DYCA 2XV4S 3PSFA 5ERIA 3TOBA 3TW7A 2RN7A 1UELB
chains in the Genus database with same CATH topology
2OI8A 3QQAA 4ACIA 2L7ZA 4D7NA 1UG2A 2LKXA 3BTCA 3A01A 1BL0A 4C3HJ 1ETQA 3K7AJ 2D5VA 4GFBA 3S16J 1ETKA 2HOAA 5FJ8J 2M34A 3NI7A 3FK7A 4MIMA 1RR7A 4MLOA 4A3IJ 2YU9J 4CYCA 4AC6A 2X48A 2DA1A 3ZQFA 5J1YA 4D5FA 4A3GJ 4RBOA 1FJLA 3BCGA 2MG4A 4A3KJ 3GTKJ 1AU7A 3KKCA 2KDZA 3K2AA 3P9TA 5F0FA 4C3JJ 1OCPA 1A6IA 1LFBA 2X6OA 5IP9J 1FEXA 5E3MA 1JUSA 1BA5A 4GCTA 3D1NI 1YRNA 2LTPA 1ETVA 4IHVA 2H1KA 4GCLA 2PMZN 3JRIA 1LE8A 4DZJA 1UI5A 4V2GA 5C4XJ 2G7SA 1ETOA 5JLWA 2K9QA 1E3OC 3RD3A 2HYTA 4L62A 3VOXA 2QTQA 4XRSA 2ME6A 1MH4A 4A69C 2KT0A 2TRTA 4M3BA 3S2DJ 1XG1A 3HTIA 2ME0A 2FX0A 4MO7A 4L5EA 1JJ6C 2PBXA 5IP6A 2FD5A 2DA6A 1MBJA 2XPWA 3TP0A 2LFBA 4BBRJ 5E3OA 4YZEA 1HCRA 3ANGA 5EEAA 2V57A 3VW0A 3I4NJ 4MXMA 2E1OA 3GEUA 3T6NA 2N8GA 2XGDA 2ECCA 3BR0A 4JYKA 4UUTA 4QTRA 2WGBA 5GPAA 1MBFA 2E19A 3DCFA 2CQQA 3DEWA 2F07A 5FGLA 1W0UA 2EZKA 1ETWA 2MW8A 5E3NA 4B4CA 2MGQA 3RZDJ 5C44J 3BQYA 1AKHB 4A3FJ 3S1QJ 3SFIA 2EH3A 1XS9A 2CJJA 2NS7A 4FTHA 2DMUA 2QIBA 1BW5A 2YUSA 4DYQA 1MBKA 1IJWC 2Y30A 3QBMA 3MNLA 1H8AC 1B8IB 3ZOBA 2DA5A 3NNRA 2Q24A 3HM5A 4B3AA 3EGQA 3HGGA 5FLMJ 3RQIA 3ON2A 5E3LA 5K58A 2L0KA 3HIMA 3FISA 2M0CA 2Y0SN 2GM4A 3ZQCA 4AF5A 2FBQA 4IHWA 3B6AA 4A3LJ 5C4JJ 1WGXA 3CDLA 3BG3A 2DMTA 2DA4A 1HDPA 4G12A 1Y1WJ 2ELKA 1IRZA 3FIWA 4DW6A 4ABZA 4DYRA 3VVYA 2TCTA 1WCMJ 3SDGA 5F1JA 3JRFA 3S1RJ 2GENA 2LK2A 1I3QJ 1JKOC 2AO9A 2HQ5A 4JX5A 3BG5A 5IOYA 5M5XJ 1GDTA 2LLKA 2E2HJ 2QOPA 2VKEA 1QPIA 5IOZA 2VKVA 4M6VA 4S0HB 4BY7J 1UHSA 2NVXJ 1WI3A 2XPUA 2OPTA 4CYCB 2HXIA 3BT9A 3S17J 3M4OJ 1BW6A 2R5YB 2Y9ZA 4BBSJ 1JTYA 4FE4A 1PUFA 3GTJJ 2M9HA 1JUPA 4J19A 2H8RA 3CJDA 3VIBA 3GBGA 5EGOB 1ORKA 3AQTA 3VVZA 1RKTA 3HOWJ 4JP0A 4BKXA 2RHAA 1FTTA 1DU0A 4MK6A 1MNMC 2EZLA 3Q0UA 3BQZA 1RPWA 2DMNA 5GP9A 3GTLJ 3LSRA 2ZOYA 2NOGA 1U78A 2DG8A 3BHQA 1HDDC 4ICHA 1ZGWA 5JLXA 3ZQHA 3BTIA 5F0CA 1LE8B 2VPRA 2O8KA 2ZCXA 2D6YA 1GT0C 1X2MA 2DA3A 1CQTA 2ZCNA 5EDNA 3HOZJ 1K61A 5F04A 1T56A 1B72A 3HOXJ 5K7ZA 5EZHA 1NTCA 9ANTA 4AUXA 3JRAA 5DAJA 2AHQA 3WHCA 3VW1A 2NP5A 3O60A 1FIAA 2HI3A 4W97A 3RZOJ 5IP7J 2R5ZA 4X1EA 3OOUA 1ZR4A 1WH7A 4QSHA 2JA7J 3L1PA 1MBEA 3VUQA 4QIWN 5D1RA 2QCOA 2X9DA 1JKRC 5J3LA 1JJ8C 2LD5A 1FIPA 3BR3A 5EG0A 3KZ9A 3VVXA 2K40A 3BTJA 1LFUP 1R9TJ 1F43A 2YVEA 5HODA 2CQXA 4D7MA 3HBLA 2NVQJ 4XRMA 2I10A 1BJZA 4MFDA 1IC8A 5EYRA 1IV6A 1NK3P 1T33A 5IPAA 3OSGA 1JT0A 1JTXA 2IAIA 2EZHA 4UUSB 1I50J 3SJMA 1ITYA 5HBUA 1IUFA 2CUFA 2JMWA 1MSEC 3A02A 2QWTA 1ZR2A 3FKIJ 1A5JA 1Z0XA 1VNDA 3HTHA 4XK4A 1VF9A 1IDZA 5FKMA 2R0QC 4KWAA 3PASA 2IEKA 3S15J 5FKNA 2XGEA 1TWFJ 4LOCA 2VUMJ 2OF7A 2UXOA 2YVHA 2EQRA 5CW8A 3JRBA 2HOSA 4IHXA 1GUUA 4A93J 2UXIA 3BJBA 4ME9A 2WB1N 2DA2A 1Y1VJ 2JWTA 5D18A 3VOKA 3W6VA 1MBHA 4M3GA 1HOMA 2WV1A 2L7FP 4JL3A 3G1OA 5IYBJ 3UKGA 3VW2A 3BR2A 2EBIA 4IHYA 4C2MJ 3JREA 2QF7A 2Y2ZA 3HKZN 3DPJA 3IH2A 2R7ZJ 3EUPA 3ZQGA 2OERA 3QPLA 4M3EA 5F08A 2XB0X 3JSJA 3E7LA 1PUFB 2WAQN 1U9OA 5EFYA 2HOTA 2K9NA 1MH3A 3PO2J 2Y31A 2CU7A 4M3FA 5J1RA 3IV5A 3V78A 3H0GJ 3HOYJ 1S7EA 3LSGA 1UMQA 2Y9YA 3BR6A 2EZIA 3A01B 1VFCA 3VP5A 3JRGA 4JX6A 5HAWA 1D5YA 3Q3SA 3PO3J 1ZK8A 2COBA 5GPCA 2REKA 2L9RA 2RASA 2IBDA 5IYDJ 3HTAA 2NVYJ 2ZOZA 3LSJA 2XSDC 3G7RA 3S1MJ 3G1LA 3CMYA 1QVTA 2DA7A 1U9NA 5FKKA 1B8IA 5DS9A 2G7LA 3S1NJ 4FISA 1MSFC 3GZIA 2JK3A 3A03A 4BY1J 3TEDA 3M3YJ 3F1BA 3BR1A 3GTQJ 4Y52J 3V6GA 5HSZA 4M3DA 1YRNB 2O7OA 3KKDA 2FJ1A 1JKQC 4Y7NJ 4NDLA 3OIOA 1ETYA 5M3MJ 3PM1A 5FLVA 2HYJA 1ZKGA 2E2IJ 4RDUA 1IGNA 3LJLA 4EEFG 3F0CA 5EG0B 4XIDA 3OSFA 4W1UA 1ETXA 4IEJA 2GBYA 2JA8J 3G1MA 1QRYA 1DU6A 3C2BA 1G2HA 1XC5A 4A3BJ 5F27A 2IU5A 4HKUA 3O8HA 4B1RA 2XPVA 4FE7A 3BTLA 3NAUA 5M5YJ 5F0HA 1JUMA 4AC0A 1GV5A 3MKLA 1POGA 2UXUA 1X58A 2W53A 5H9TA 5CXIA 4X6AJ 2G3BA 2JA6J 2JJ7A 1TWHJ 2RAEA 4NELA 1SFOJ 4NN1A 2YS9A 4A3EJ 5D19A 2HDDA 2LR8A 2L7MP 2LY9A 2DJNA 2GFNA 1H89C 5C4YA 2R5YA 5EZGA 1GVDA 1VI0A 3HOUJ 5C3EJ 3JRCA 4DZPA 5IYCJ 3HTJA 5FHPA 3NXCA 4JNNA 5EGOA 3ON4A 1JT6A 3MN2A 1HF0A 3S2HJ 4HNVA 4I76A 1QVUA 4MFEA 2W48A 2NP3A 4CGRA 3CCYA 2XRLA 3BR5A 3B81A 4A3CJ 5CXGA 1P7IA 2LVSA 3JR9A 3ZQIA 3VPRA 2R92J 2FQ4A 5FKOA 3QKXA 4AYBN 4BXXJ 2K9SA 3NPIA 3MVPA 1H88C 2R93J 1I6HJ 1NK2P 4I6ZA 3E7QA 3HGYA 4JKZA 2LP0A 3IH4A 1FTZA 3LWJA 2DMQA 3WHBA 5K7FA 1OCTC 1AHDP 4V2FA 5FMPA 2G0EA 3JRDA 1K83J 3Q0VA 1ZQ3P 5AQCA 3S5RA 5M5WJ 2DG7A 1TWAJ 2P81A 4A3JJ 5BNGA 4XICA 1W0TA 2UXHA 1F36A 2XDNA 1RESA 1TWCJ 3GTGJ 2CRGA 1ZTRA 2GLOA 3PPBA 3RH2A 3H3VK 4C3IJ 3FK6A 1OJLA 1SGMA 1RKWA 1X2NA 3RKQA 3JRHA 3S14J 1SANA 5J1UA 3ZQLA 4XRSG 1UI6A 2JA5J 3BNIA 1O4XA 1WPKA 2PZ9A 3I4MJ 4GFLA 3BRUA 1EF4A 2XGCA 3C07A 2JN6A 3HDDA 1TWGJ 3COLA 3NARA 2HKUA 3HE0A 3IH3A 4UUSA 3TP3A 2ID3A 3LNQA 2QKOA 2B63J 3BG9A 5FKLA 1JGGA 1IG7A 3O8GA 1Z77A 3NRGA 4D5CA 2G7GA 3B6CA 2DMPA 5EF6A 3GTMJ 3GTPJ 2GUHA 3KNWA 1TC3C 3TW6A 2CUEA 3HB9A 1HLVA 2UXPA 2DN0A 5M3FJ 1AKHA 4A3MJ 1U8BA 3Q0WA 3CRJA 4PXIA 1OFCX 3LSPA 2ECBA 1APLC 2O7TA 1Q1VA 4UDSA 3G56A 1B72B 1WH5A 2HXOA 2ZB9A 3HEFA 1RETA 3FRQA 2XB5A 2O9LA 1ENHA 2NS8A 4A3DJ 4JX4A 3CWRA 3CQZJ 1MBGA 2M2EA 2M8GX 2R5ZB 2DTZA 3LOCA 1GV2A 1IDYA 2VI6A 3IUVA 3LHQA 1JKPC 3HOVJ 2E2JJ 4GFKA 2ID6A 3QPSA 2NX4A 3ANPA 1P7JA 3AQSA 2WUIA 4FCYA 4GCKA 2NVTJ 5K7HA 3GTOJ 4DYCA 2MSYA 5DTDA 3TW7A 2ZCMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OI8 A;  3QQA A;  4ACI A;  2L7Z A;  4D7N A;  1UG2 A;  2LKX A;  3BTC A;  3A01 A;  1BL0 A;  4C3H J;  1ETQ A;  3K7A J;  2D5V A;  4GFB A;  3S16 J;  1ETK A;  2HOA A;  5FJ8 J;  2M34 A;  3NI7 A;  3FK7 A;  4MIM A;  1RR7 A;  4MLO A;  4A3I J;  2YU9 J;  4CYC A;  4AC6 A;  2X48 A;  2DA1 A;  3ZQF A;  5J1Y A;  4D5F A;  4A3G J;  4RBO A;  1FJL A;  3BCG A;  2MG4 A;  4A3K J;  3GTK J;  1AU7 A;  3KKC A;  2KDZ A;  3K2A A;  3P9T A;  5F0F A;  4C3J J;  1OCP A;  1A6I A;  1LFB A;  2X6O A;  5IP9 J;  1FEX A;  5E3M A;  1JUS A;  1BA5 A;  4GCT A;  3D1N I;  1YRN A;  2LTP A;  1ETV A;  4IHV A;  2H1K A;  4GCL A;  2PMZ N;  3JRI A;  1LE8 A;  4DZJ A;  1UI5 A;  4V2G A;  5C4X J;  2G7S A;  1ETO A;  5JLW A;  2K9Q A;  1E3O C;  3RD3 A;  2HYT A;  4L62 A;  3VOX A;  2QTQ A;  4XRS A;  2ME6 A;  1MH4 A;  4A69 C;  2KT0 A;  2TRT A;  4M3B A;  3S2D J;  1XG1 A;  3HTI A;  2ME0 A;  2FX0 A;  4MO7 A;  4L5E A;  1JJ6 C;  2PBX A;  5IP6 A;  2FD5 A;  2DA6 A;  1MBJ A;  2XPW A;  3TP0 A;  2LFB A;  4BBR J;  5E3O A;  4YZE A;  1HCR A;  3ANG A;  5EEA A;  2V57 A;  3VW0 A;  3I4N J;  4MXM A;  2E1O A;  3GEU A;  3T6N A;  2N8G A;  2XGD A;  2ECC A;  3BR0 A;  4JYK A;  4UUT A;  4QTR A;  2WGB A;  5GPA A;  1MBF A;  2E19 A;  3DCF A;  2CQQ A;  3DEW A;  2F07 A;  5FGL A;  1W0U A;  2EZK A;  1ETW A;  2MW8 A;  5E3N A;  4B4C A;  2MGQ A;  3RZD J;  5C44 J;  3BQY A;  1AKH B;  4A3F J;  3S1Q J;  3SFI A;  2EH3 A;  1XS9 A;  2CJJ A;  2NS7 A;  4FTH A;  2DMU A;  2QIB A;  1BW5 A;  2YUS A;  4DYQ A;  1MBK A;  1IJW C;  2Y30 A;  3QBM A;  3MNL A;  1H8A C;  1B8I B;  3ZOB A;  2DA5 A;  3NNR A;  2Q24 A;  3HM5 A;  4B3A A;  3EGQ A;  3HGG A;  5FLM J;  3RQI A;  3ON2 A;  5E3L A;  5K58 A;  2L0K A;  3HIM A;  3FIS A;  2M0C A;  2Y0S N;  2GM4 A;  3ZQC A;  4AF5 A;  2FBQ A;  4IHW A;  3B6A A;  4A3L J;  5C4J J;  1WGX A;  3CDL A;  3BG3 A;  2DMT A;  2DA4 A;  1HDP A;  4G12 A;  1Y1W J;  2ELK A;  1IRZ A;  3FIW A;  4DW6 A;  4ABZ A;  4DYR A;  3VVY A;  2TCT A;  1WCM J;  3SDG A;  5F1J A;  3JRF A;  3S1R J;  2GEN A;  2LK2 A;  1I3Q J;  1JKO C;  2AO9 A;  2HQ5 A;  4JX5 A;  3BG5 A;  5IOY A;  5M5X J;  1GDT A;  2LLK A;  2E2H J;  2QOP A;  2VKE A;  1QPI A;  5IOZ A;  2VKV A;  4M6V A;  4S0H B;  4BY7 J;  1UHS A;  2NVX J;  1WI3 A;  2XPU A;  2OPT A;  4CYC B;  2HXI A;  3BT9 A;  3S17 J;  3M4O J;  1BW6 A;  2R5Y B;  2Y9Z A;  4BBS J;  1JTY A;  4FE4 A;  1PUF A;  3GTJ J;  2M9H A;  1JUP A;  4J19 A;  2H8R A;  3CJD A;  3VIB A;  3GBG A;  5EGO B;  1ORK A;  3AQT A;  3VVZ A;  1RKT A;  3HOW J;  4JP0 A;  4BKX A;  2RHA A;  1FTT A;  1DU0 A;  4MK6 A;  1MNM C;  2EZL A;  3Q0U A;  3BQZ A;  1RPW A;  2DMN A;  5GP9 A;  3GTL J;  3LSR A;  2ZOY A;  2NOG A;  1U78 A;  2DG8 A;  3BHQ A;  1HDD C;  4ICH A;  1ZGW A;  5JLX A;  3ZQH A;  3BTI A;  5F0C A;  1LE8 B;  2VPR A;  2O8K A;  2ZCX A;  2D6Y A;  1GT0 C;  1X2M A;  2DA3 A;  1CQT A;  2ZCN A;  5EDN A;  3HOZ J;  1K61 A;  5F04 A;  1T56 A;  1B72 A;  3HOX J;  5K7Z A;  5EZH A;  1NTC A;  9ANT A;  4AUX A;  3JRA A;  5DAJ A;  2AHQ A;  3WHC A;  3VW1 A;  2NP5 A;  3O60 A;  1FIA A;  2HI3 A;  4W97 A;  3RZO J;  5IP7 J;  2R5Z A;  4X1E A;  3OOU A;  1ZR4 A;  1WH7 A;  4QSH A;  2JA7 J;  3L1P A;  1MBE A;  3VUQ A;  4QIW N;  5D1R A;  2QCO A;  2X9D A;  1JKR C;  5J3L A;  1JJ8 C;  2LD5 A;  1FIP A;  3BR3 A;  5EG0 A;  3KZ9 A;  3VVX A;  2K40 A;  3BTJ A;  1LFU P;  1R9T J;  1F43 A;  2YVE A;  5HOD A;  2CQX A;  4D7M A;  3HBL A;  2NVQ J;  4XRM A;  2I10 A;  1BJZ A;  4MFD A;  1IC8 A;  5EYR A;  1IV6 A;  1NK3 P;  1T33 A;  5IPA A;  3OSG A;  1JT0 A;  1JTX A;  2IAI A;  2EZH A;  4UUS B;  1I50 J;  3SJM A;  1ITY A;  5HBU A;  1IUF A;  2CUF A;  2JMW A;  1MSE C;  3A02 A;  2QWT A;  1ZR2 A;  3FKI J;  1A5J A;  1Z0X A;  1VND A;  3HTH A;  4XK4 A;  1VF9 A;  1IDZ A;  5FKM A;  2R0Q C;  4KWA A;  3PAS A;  2IEK A;  3S15 J;  5FKN A;  2XGE A;  1TWF J;  4LOC A;  2VUM J;  2OF7 A;  2UXO A;  2YVH A;  2EQR A;  5CW8 A;  3JRB A;  2HOS A;  4IHX A;  1GUU A;  4A93 J;  2UXI A;  3BJB A;  4ME9 A;  2WB1 N;  2DA2 A;  1Y1V J;  2JWT A;  5D18 A;  3VOK A;  3W6V A;  1MBH A;  4M3G A;  1HOM A;  2WV1 A;  2L7F P;  4JL3 A;  3G1O A;  5IYB J;  3UKG A;  3VW2 A;  3BR2 A;  2EBI A;  4IHY A;  4C2M J;  3JRE A;  2QF7 A;  2Y2Z A;  3HKZ N;  3DPJ A;  3IH2 A;  2R7Z J;  3EUP A;  3ZQG A;  2OER A;  3QPL A;  4M3E A;  5F08 A;  2XB0 X;  3JSJ A;  3E7L A;  1PUF B;  2WAQ N;  1U9O A;  5EFY A;  2HOT A;  2K9N A;  1MH3 A;  3PO2 J;  2Y31 A;  2CU7 A;  4M3F A;  5J1R A;  3IV5 A;  3V78 A;  3H0G J;  3HOY J;  1S7E A;  3LSG A;  1UMQ A;  2Y9Y A;  3BR6 A;  2EZI A;  3A01 B;  1VFC A;  3VP5 A;  3JRG A;  4JX6 A;  5HAW A;  1D5Y A;  3Q3S A;  3PO3 J;  1ZK8 A;  2COB A;  5GPC A;  2REK A;  2L9R A;  2RAS A;  2IBD A;  5IYD J;  3HTA A;  2NVY J;  2ZOZ A;  3LSJ A;  2XSD C;  3G7R A;  3S1M J;  3G1L A;  3CMY A;  1QVT A;  2DA7 A;  1U9N A;  5FKK A;  1B8I A;  5DS9 A;  2G7L A;  3S1N J;  4FIS A;  1MSF C;  3GZI A;  2JK3 A;  3A03 A;  4BY1 J;  3TED A;  3M3Y J;  3F1B A;  3BR1 A;  3GTQ J;  4Y52 J;  3V6G A;  5HSZ A;  4M3D A;  1YRN B;  2O7O A;  3KKD A;  2FJ1 A;  1JKQ C;  4Y7N J;  4NDL A;  3OIO A;  1ETY A;  5M3M J;  3PM1 A;  5FLV A;  2HYJ A;  1ZKG A;  2E2I J;  4RDU A;  1IGN A;  3LJL A;  4EEF G;  3F0C A;  5EG0 B;  4XID A;  3OSF A;  4W1U A;  1ETX A;  4IEJ A;  2GBY A;  2JA8 J;  3G1M A;  1QRY A;  1DU6 A;  3C2B A;  1G2H A;  1XC5 A;  4A3B J;  5F27 A;  2IU5 A;  4HKU A;  3O8H A;  4B1R A;  2XPV A;  4FE7 A;  3BTL A;  3NAU A;  5M5Y J;  5F0H A;  1JUM A;  4AC0 A;  1GV5 A;  3MKL A;  1POG A;  2UXU A;  1X58 A;  2W53 A;  5H9T A;  5CXI A;  4X6A J;  2G3B A;  2JA6 J;  2JJ7 A;  1TWH J;  2RAE A;  4NEL A;  1SFO J;  4NN1 A;  2YS9 A;  4A3E J;  5D19 A;  2HDD A;  2LR8 A;  2L7M P;  2LY9 A;  2DJN A;  2GFN A;  1H89 C;  5C4Y A;  2R5Y A;  5EZG A;  1GVD A;  1VI0 A;  3HOU J;  5C3E J;  3JRC A;  4DZP A;  5IYC J;  3HTJ A;  5FHP A;  3NXC A;  4JNN A;  5EGO A;  3ON4 A;  1JT6 A;  3MN2 A;  1HF0 A;  3S2H J;  4HNV A;  4I76 A;  1QVU A;  4MFE A;  2W48 A;  2NP3 A;  4CGR A;  3CCY A;  2XRL A;  3BR5 A;  3B81 A;  4A3C J;  5CXG A;  1P7I A;  2LVS A;  3JR9 A;  3ZQI A;  3VPR A;  2R92 J;  2FQ4 A;  5FKO A;  3QKX A;  4AYB N;  4BXX J;  2K9S A;  3NPI A;  3MVP A;  1H88 C;  2R93 J;  1I6H J;  1NK2 P;  4I6Z A;  3E7Q A;  3HGY A;  4JKZ A;  2LP0 A;  3IH4 A;  1FTZ A;  3LWJ A;  2DMQ A;  3WHB A;  5K7F A;  1OCT C;  1AHD P;  4V2F A;  5FMP A;  2G0E A;  3JRD A;  1K83 J;  3Q0V A;  1ZQ3 P;  5AQC A;  3S5R A;  5M5W J;  2DG7 A;  1TWA J;  2P81 A;  4A3J J;  5BNG A;  4XIC A;  1W0T A;  2UXH A;  1F36 A;  2XDN A;  1RES A;  1TWC J;  3GTG J;  2CRG A;  1ZTR A;  2GLO A;  3PPB A;  3RH2 A;  3H3V K;  4C3I J;  3FK6 A;  1OJL A;  1SGM A;  1RKW A;  1X2N A;  3RKQ A;  3JRH A;  3S14 J;  1SAN A;  5J1U A;  3ZQL A;  4XRS G;  1UI6 A;  2JA5 J;  3BNI A;  1O4X A;  1WPK A;  2PZ9 A;  3I4M J;  4GFL A;  3BRU A;  1EF4 A;  2XGC A;  3C07 A;  2JN6 A;  3HDD A;  1TWG J;  3COL A;  3NAR A;  2HKU A;  3HE0 A;  3IH3 A;  4UUS A;  3TP3 A;  2ID3 A;  3LNQ A;  2QKO A;  2B63 J;  3BG9 A;  5FKL A;  1JGG A;  1IG7 A;  3O8G A;  1Z77 A;  3NRG A;  4D5C A;  2G7G A;  3B6C A;  2DMP A;  5EF6 A;  3GTM J;  3GTP J;  2GUH A;  3KNW A;  1TC3 C;  3TW6 A;  2CUE A;  3HB9 A;  1HLV A;  2UXP A;  2DN0 A;  5M3F J;  1AKH A;  4A3M J;  1U8B A;  3Q0W A;  3CRJ A;  4PXI A;  1OFC X;  3LSP A;  2ECB A;  1APL C;  2O7T A;  1Q1V A;  4UDS A;  3G56 A;  1B72 B;  1WH5 A;  2HXO A;  2ZB9 A;  3HEF A;  1RET A;  3FRQ A;  2XB5 A;  2O9L A;  1ENH A;  2NS8 A;  4A3D J;  4JX4 A;  3CWR A;  3CQZ J;  1MBG A;  2M2E A;  2M8G X;  2R5Z B;  2DTZ A;  3LOC A;  1GV2 A;  1IDY A;  2VI6 A;  3IUV A;  3LHQ A;  1JKP C;  3HOV J;  2E2J J;  4GFK A;  2ID6 A;  3QPS A;  2NX4 A;  3ANP A;  1P7J A;  3AQS A;  2WUI A;  4FCY A;  4GCK A;  2NVT J;  5K7H A;  3GTO J;  4DYC A;  2MSY A;  5DTD A;  3TW7 A;  2ZCM A; 
#chains in the Genus database with same CATH topology
 3QQA A;  3REO A;  4ACI A;  1UG2 A;  3A01 A;  4WXH A;  2L9V A;  2QSF X;  3A1Y A;  3EDP A;  4G7O F;  2HOA A;  3S3O A;  3NI7 A;  1J09 A;  1RR7 A;  4MLO A;  2YU9 J;  5E8I A;  2BHY A;  3BPX A;  2DA1 A;  4Q4Z F;  3ZQF A;  1KU3 A;  4ENK A;  5J1Y A;  1WJF A;  1FJL A;  4KMF A;  4BJ5 C;  3CP8 A;  3MKY B;  3BCG A;  1Z6T A;  2EA4 A;  4A0Z A;  3GTK J;  1UB9 A;  2IGM A;  2ISY A;  1FMV A;  1P4X A;  5F1R A;  1MJB A;  3P9T A;  5B1B H;  1OCP A;  1VQ4 I;  5IP9 J;  1JUS A;  3M8J A;  3OYB A;  1I1S A;  3D1N I;  4IVN A;  1ETV A;  4IHV A;  2H1K A;  3PFI A;  3BG7 A;  1LE8 A;  4V2G A;  3K2Z A;  3AFH A;  4MTE A;  3HJE A;  2LRD A;  1E3O C;  1J5Y A;  4N4O B;  3OYA A;  2W24 A;  4A69 C;  4BS9 A;  2OCC H;  4M3B A;  2A6H F;  2YR2 A;  3ZR8 X;  1MND A;  3G73 A;  4BQO A;  3GME A;  2EB7 A;  3HPG A;  3ASO H;  2VBZ A;  3R61 A;  2DA6 A;  2XPW A;  3FXK A;  3QU6 A;  3TP0 A;  4RAG A;  4BBR J;  5E3O A;  1R23 A;  3FX3 A;  5EEA A;  2CUJ A;  1IN4 A;  2N8G A;  3D5R C;  1IXC A;  3BR0 A;  4JYK A;  1D1A A;  1F9N A;  1QNT A;  4ZYH A;  1ZH5 A;  2WGB A;  1UST A;  2E19 A;  2CQQ A;  4ZYG A;  1W0U A;  2MGQ A;  3RPU D;  4PJM A;  1AKH B;  3WG9 A;  4XR6 A;  2L5Q A;  4P1W A;  1R49 A;  2ICW G;  1G6N A;  2J5O A;  5JI6 A;  4FTH A;  1FSE A;  2DMU A;  1YJ9 I;  2QIB A;  2X4H A;  4U0W A;  4OIN F;  5DD4 A;  3QBM A;  5CYV A;  3K4M A;  1B8I B;  2KLO A;  2DA5 A;  2JVH A;  2Q24 A;  3NNR A;  4B3A A;  2XRN A;  3GFI A;  3GEZ A;  3ON2 A;  3KP6 A;  2WC2 A;  3RQI A;  3OL4 A;  5K58 A;  1N75 A;  3V7C A;  5TGT A;  1ZG1 A;  2GM4 A;  2Y0S N;  2ZME B;  2ZFU A;  2EIN H;  5BOX A;  1VQK I;  3NWS A;  4LIT A;  2VE8 A;  1STZ A;  4U9N A;  3B73 A;  2BXY A;  5C4J J;  1WGX A;  1R71 A;  5D4R A;  2DJI A;  2Y69 H;  4CIC A;  3F9K A;  2JUC A;  3BG3 A;  2DMT A;  4M9Z A;  4IO9 F;  2M87 A;  4PK4 A;  2IXS A;  1Y1W J;  2JA2 A;  2ELK A;  2KDO A;  1G3W A;  4LGW A;  3W6J B;  3JRF A;  2UV1 A;  3U1D A;  1JKO C;  2PEX A;  2AO9 A;  3O6B B;  3BG5 A;  1WJE A;  2E2H J;  5EEG A;  4I99 C;  3CJN A;  1BR2 A;  2VKV A;  2CYY A;  1K7A A;  4I09 A;  5DCM A;  4LIU A;  4BY7 J;  3J80 K;  2VQC A;  5D5X B;  2WA0 A;  4LIV A;  3M7G A;  4UVB A;  2KIM A;  2XPU A;  2OPT A;  3HL2 A;  5E79 C;  4KN4 X;  2E1M B;  2F4O B;  2KP6 A;  1A31 A;  3DBR B;  2Y9Z A;  3K10 A;  1VQP I;  4FE4 A;  4AWX B;  1PUF A;  2HYF A;  1JUP A;  5ICG A;  3CJD A;  3RDI A;  3VIB A;  3HYI A;  3BLY A;  3O2P E;  1VTN C;  4IHT A;  1DU0 A;  4C9Y A;  1KYZ A;  1R4M B;  2Z16 A;  3A4C A;  3Q0U A;  1H9G A;  1KQ8 A;  2FUG 2;  1V3F A;  3RKW A;  2FU4 A;  5GP9 A;  1U78 A;  1FC3 A;  4EM2 A;  1HDD C;  3H35 A;  3LAJ A;  1ULY A;  4E6K G;  1LE8 B;  2VPR A;  1T98 A;  1Z21 A;  4G8X A;  1GT0 C;  1CQT A;  2E1M C;  2GIV A;  2VN2 A;  4U7B A;  3ELK A;  3LA2 A;  4WXD A;  3CF2 A;  3LQR A;  3PFY A;  1ZGA A;  4AIJ A;  5TRD A;  1RUO A;  1WJC A;  3HOX J;  2BY0 A;  1YFH A;  1ZAR A;  2OJE D;  2XAU A;  3U21 A;  5GAD J;  2O61 A;  3GFL A;  1LVK A;  1S6L A;  3JRA A;  3IUO A;  5DAJ A;  2WAQ A;  3VW1 A;  3E6B A;  2L4M A;  4IKF A;  2VKH A;  4OIQ F;  2BZT A;  5IP7 J;  4X1E A;  2KZV A;  3MZY A;  3OOU A;  4KIF A;  1TNT A;  4HF2 A;  3K1P A;  4QSH A;  3QP5 A;  2B9S A;  3VUQ A;  3OV8 A;  4QIW N;  5D1R A;  2QCO A;  2X9D A;  1JJ8 C;  4BUP A;  1FIP A;  1ZAO A;  3BR3 A;  4PFP A;  2MLK A;  4ENN A;  1LFU P;  1R9T J;  2ETH A;  2MC3 A;  3DLA A;  1RI7 A;  1S9H A;  3GFM A;  1XTA A;  5KHD A;  4GYG A;  4XRM A;  5EYR A;  1LEB A;  1IRF A;  3PNV A;  3UR3 C;  5IPA A;  3H3Z A;  4UUS B;  2PJR A;  2EZH A;  4EJV A;  1I50 J;  4DVY P;  4KT5 C;  3A02 A;  5CKT A;  4NC7 A;  4YFN F;  1D5V A;  1SFU A;  4OD5 A;  3FKI J;  3TDU C;  4EGZ A;  3TL4 X;  2TDX A;  3RPQ A;  2KZG A;  1VND A;  3HTH A;  3KZY A;  2ADU A;  4RA2 A;  1YJW I;  2QQ8 A;  2R7W A;  1EA3 A;  3KP2 A;  1IO2 A;  4L9J A;  5FKM A;  3CC4 I;  2A05 A;  4KWA A;  3CJQ B;  4XOT A;  1YOV B;  2XGE A;  3ZN0 A;  4LOC A;  2MH9 A;  5CW8 A;  3JRB A;  4IHX A;  4A93 J;  4ME9 A;  2WB1 N;  2DA2 A;  4L9N A;  3F8M A;  4KN7 X;  4XLE A;  3M9A A;  3MWM A;  4V19 K;  2K02 A;  4G6Q A;  5IYB J;  2QBY B;  1REP C;  2IS2 A;  4F93 B;  1O7L A;  3BR2 A;  4KFC A;  4IHY A;  1YLF A;  4C2M J;  2DDB A;  3V8J A;  5FD6 A;  2AXL A;  3KP7 A;  2OA4 A;  3HKZ N;  2KIQ A;  3K1M A;  3DPJ A;  2EFP A;  5KVR A;  2XB0 X;  1E3H A;  2ZO4 A;  4ESJ A;  4L5I A;  1PUF B;  3HRU A;  2ZBK A;  1R58 A;  2DU9 A;  1MH3 A;  1R1V A;  2KRC A;  2DK5 A;  2X1D A;  2W4S A;  4BE1 A;  1JXS A;  3IV5 A;  4DBQ A;  3V78 A;  1S7E A;  3K70 C;  2EFO A;  2HWV A;  4YIF A;  3FXM A;  2K27 A;  3BR6 A;  2W25 A;  3DTI A;  3L00 A;  3E6C C;  3VP5 A;  2LF8 A;  3OOP A;  3VVY A;  3DTE A;  3Q3S A;  2A2F X;  1KYW A;  1YJN I;  3C2G A;  5L3B A;  4UB8 C;  1U5T A;  2IBD A;  5H6Q A;  1DP3 A;  1G3T A;  4DIQ A;  1IZ1 A;  2LF7 A;  2NVY J;  3LSJ A;  3SYT A;  1XD7 A;  5HLH A;  1V5F A;  4HX7 A;  4BYY A;  2DA7 A;  2DPU A;  2CV1 A;  1ZHF A;  5DS9 A;  3S1N J;  3R6S A;  2V26 A;  5CVU A;  4FX0 A;  1LNW A;  3M3Y J;  4AM3 A;  2YX4 A;  2UZK A;  2CS3 A;  4ZYE A;  4MEX F;  2DBB A;  4IHS A;  3GTQ J;  4KDP A;  1LFP A;  3V6G A;  3RYP A;  4CCN A;  5LRS A;  5JHF A;  2FJ1 A;  2LY1 A;  4Y7N J;  3S93 A;  2ZSH B;  3OS1 A;  2R7U A;  1ETY A;  3ABU A;  2P6S A;  1DGR M;  4KUM A;  4RDU A;  1U0J A;  3LJL A;  3ZMD A;  2HQR A;  2WAE A;  3F0C A;  1ETX A;  2X6Y A;  2GBY A;  2Q1Z B;  3G1M A;  2XAF A;  1DU6 A;  3GWZ A;  2VT2 A;  3GFJ A;  1U6G A;  4RS8 A;  1R6R A;  2CW7 A;  2RGV A;  4PSX A;  3IRR A;  3BCB A;  4C30 A;  3NAU A;  4I0B A;  5LEJ A;  1JUM A;  3MKL A;  2CSO A;  5H9T A;  4RGR A;  4X6A J;  2PJR B;  2G3B A;  3OYD A;  3PSI A;  4A3E J;  2L7M P;  2X1E A;  3J7Z I;  3ZQ7 A;  2GFN A;  1H89 C;  5C4Y A;  2K9M A;  2MD5 A;  4OMZ A;  4DZP A;  3FWE A;  5FHP A;  1ZEL A;  2PN6 A;  3EPZ A;  4EJT A;  3DKY A;  3FMR A;  3GW2 A;  5EGO A;  1WQ2 A;  1YTY A;  2V1X A;  4LJZ F;  4A6D A;  3S2H J;  2IGO A;  2ZY9 A;  4I76 A;  3C3W A;  3ESW B;  2NP3 A;  2XIG A;  3I0T A;  3BR5 A;  2PX9 A;  2MAB A;  3AG1 H;  1SFK A;  3LA3 A;  2E7W A;  2QLZ A;  2X6X A;  2PI0 A;  2OQG A;  3CP2 A;  4S04 A;  3J81 K;  1GHC A;  3MVP A;  1H88 C;  1K78 A;  1WSU A;  1X1P A;  2HPM A;  3FXL A;  1WJ5 A;  3I59 B;  4HPQ A;  3V4G A;  5LBQ A;  3HGY A;  3OYC A;  1UHW A;  1FTZ A;  2DMQ A;  3LMM A;  5CJ9 A;  1WJD A;  4UHT A;  4V2F A;  3H36 A;  3K0L A;  2ZXW H;  4XRF A;  4CUG A;  1K83 J;  3M8E A;  1T08 B;  3QYF A;  5FRO A;  2XF7 A;  2Z1D A;  4E70 A;  5M5W J;  2PLY A;  4A3J J;  2P81 A;  3C2H A;  4N0B A;  2EA2 A;  1A36 A;  1F36 A;  3CLQ A;  2XDN A;  3G71 I;  1ZTR A;  2ZXI A;  2PFB A;  1LDD A;  1EH7 A;  3HIF A;  4ZZL A;  4RLF A;  1AOY A;  3C1D A;  4C3I J;  3H3V K;  2R7O A;  1OJL A;  1X2N A;  3ERE D;  4LLG F;  3RKQ A;  3S14 J;  5FFZ A;  2CFO A;  2HPI A;  3GZ6 A;  3QOE A;  3H3U A;  1P4W A;  3RPU A;  3ZMS A;  1OKR A;  2OUM A;  3PNY A;  2PZ9 A;  2DAO A;  1XMA A;  1EF4 A;  3U9G A;  1W5S A;  2CH0 A;  4AIH A;  3F22 A;  3NAR A;  1KZH A;  1QBJ A;  2WAF A;  2HZD A;  1Y39 A;  3LNQ A;  4AID A;  2DXI A;  5DDG A;  3SZP A;  2RC4 A;  3D5S C;  2IT0 A;  4FQG A;  2NS0 A;  2XGX A;  4BXF A;  3OYE A;  1LQ1 A;  2G7G A;  2DMP A;  3HUG B;  3JCU C;  1CGP A;  2DOF A;  2XHK A;  1WI9 A;  1YE9 A;  1QHH D;  1RR8 C;  1TC3 C;  3HB9 A;  2PBI A;  3DKW A;  4HDV A;  2UXP A;  1U5T C;  1FZP B;  2DN0 A;  2W85 A;  5B1A H;  2XKP A;  1OFC X;  1YW9 A;  1S5L C;  2VBX A;  4UDS A;  1Z9C A;  5LRR A;  3TMO A;  2QEX I;  3JTG A;  1WKM A;  2OD5 A;  4JX4 A;  4PJN A;  2K85 A;  2EFQ A;  3U2R A;  1HKS A;  3HG9 A;  3F8N A;  3CQZ J;  2M2E A;  3E0J B;  1XSD A;  1DP7 P;  4XSZ F;  3LHQ A;  4I01 A;  1SMT A;  1GLN A;  2M3A A;  1TZL A;  2E2J J;  1WZ2 A;  3IC7 A;  4GFK A;  2ID6 A;  3QPS A;  2E1N A;  4RB2 C;  1N78 A;  2NX4 A;  2CO5 A;  1S7A A;  2BBY A;  1VQ6 I;  4CZZ A;  5K7H A;  4IJA A;  2BEO A;  1LDJ A;  2LG4 A;  4P9U A;  3ASN H;  1XPX A;  2KHM A;  2L7Z A;  2RRE A;  3HC7 A;  2VOD A;  2R7X A;  4ZDL A;  3WOD F;  4GFB A;  2BY2 A;  2C6Y A;  2VIX A;  3P7N A;  2AS5 F;  4E7J A;  2W82 A;  3BJA A;  1IAW A;  1K78 B;  4HA8 A;  4CYC A;  4AC6 A;  1YW8 A;  2X48 A;  3K4B A;  1RNL A;  3BZ6 A;  1K4S A;  3OY9 A;  1ZRF A;  2MG4 A;  1T95 A;  4A3K J;  2IA1 A;  3HKZ A;  3K2A A;  1FYK A;  3F6O A;  3CTA A;  4RB1 A;  1LFB A;  3P9K A;  4XMY A;  5E3M A;  1BA5 A;  2EIK H;  1HKT A;  1YRN A;  3IAS 2;  5LEK A;  2PMZ N;  4HSR A;  3TOA A;  2HEO A;  1EH6 A;  5C4X J;  1ETO A;  3DP7 A;  3E5Q A;  1IN5 A;  2K9Q A;  2MBF A;  2OAZ A;  3F3X A;  2HYT A;  4L62 A;  4HQM A;  2RVC A;  2TRT A;  1Z6R A;  1XG1 A;  4HG2 A;  5ED4 A;  5J40 A;  2VB6 A;  3DTK A;  3JAM Z;  2PMU A;  1KU9 A;  4YZE A;  1L0O C;  1YX5 A;  1HCR A;  2EV6 A;  1FLI A;  3ABM H;  4MNU A;  3A0B C;  2V57 A;  3I4N J;  1U2W A;  4MXM A;  2GZW A;  3T6N A;  2XGD A;  1BI0 A;  3M8F A;  2ECC A;  3PUF A;  2I8D A;  3K4C A;  2P5K A;  5GPA A;  4BQQ A;  1DDN A;  2GIZ A;  5FGL A;  2LSO A;  4GXO A;  2EZK A;  4XKW A;  5F6F A;  4B4C A;  1ZLJ A;  5E18 F;  3RZD J;  4BAC A;  3ONQ A;  3BQY A;  3S1Q J;  2VJI A;  2EH3 A;  2CGP A;  3MZH A;  1FP1 D;  4G7H F;  3TO6 A;  2YUS A;  4DYQ A;  3PQJ A;  2GXB A;  1YG2 A;  1Y6I A;  4CCM A;  1Y0N A;  2E60 A;  2A6T A;  3VYR B;  3EGQ A;  5ICC A;  3HSR A;  2JSP A;  1Y8R B;  3HIM A;  3FIS A;  2KIS A;  3KEY A;  5IY5 H;  1DPR A;  2WY7 Q;  2XAJ A;  4ANJ A;  2WTE A;  3LSH A;  1XB4 A;  3OR2 C;  1QQI A;  3CDL A;  4YFX F;  2DA4 A;  1FBS A;  5J8F A;  1HDP A;  4G12 A;  3FIW A;  2VJJ A;  4DYR A;  1HA8 A;  4MHG A;  3S1R J;  3OYK A;  5J6X A;  1FWZ A;  4JX5 A;  1KQ0 A;  2LLK A;  3FXO A;  1K79 A;  4E4H A;  2RQP A;  2F2E A;  2YX7 A;  2DDA A;  3DWL E;  4YFK F;  3FBN B;  1QPI A;  3WGG A;  2F48 A;  3ZPL A;  1R7J A;  2M5W A;  3CME I;  1VQ7 I;  3CMA I;  1MZB A;  4PJJ A;  2H09 A;  4CYC B;  3PUB A;  3BT9 A;  1JTY A;  5KCM A;  3GTJ J;  4FT8 A;  2IVM A;  4XSX F;  1ORK A;  3I71 A;  4Y4R A;  1RKT A;  3IAM 2;  5EJC A;  4JP0 A;  3HOW J;  2IW5 A;  3MCZ A;  3S3N A;  1SVL A;  3RQ4 A;  1O3T A;  3E5X A;  1BN5 A;  1MNM C;  1UAA A;  3K8P C;  3BQZ A;  1B6A A;  1RPW A;  1NHA A;  2QM3 A;  2FOK A;  1FP2 A;  3LSR A;  3GTL J;  3J7A Y;  4KNY A;  1R4N B;  2GA2 A;  5F0C A;  5JVT A;  3WE3 A;  2HQN A;  4M73 A;  2OCE A;  4R79 A;  3CJR B;  3DU5 A;  4QPQ A;  2DFE A;  1B72 A;  3G2B A;  4CCO A;  3MKZ A;  2STT A;  2R7F A;  5K7Z A;  4PCQ A;  4L9V A;  1NTC A;  9ANT A;  1YYV A;  4WK8 F;  3CC7 I;  5ILS A;  2AHQ A;  4J01 A;  3WHC A;  5LFA A;  2ZC2 A;  1FIA A;  2VXD A;  4W97 A;  3RZO J;  1S3J A;  3BZC A;  2Z99 A;  1ZRD A;  2B0L A;  4XKC A;  2K40 A;  5FLX Z;  1Z67 A;  2FXA A;  4LK1 F;  1F43 A;  5DV5 A;  2Y75 A;  2CQX A;  1LVA A;  4D7M A;  3HBL A;  2I10 A;  4MFD A;  1XMK A;  2CQK A;  1IV6 A;  1NK3 P;  3OSG A;  3W3C A;  1JTX A;  1RUN A;  5HBU A;  4OIO F;  3J7A O;  1MSE C;  2DFI A;  5D4S A;  2QWT A;  1W7P A;  1IRX A;  2FNP A;  4U88 A;  4H0E A;  1ZR2 A;  1Z0X A;  2OC6 A;  4HDU A;  1YHQ I;  4Z2Y A;  3L09 A;  4Y13 A;  4XK4 A;  1V5G A;  1IDZ A;  3I54 A;  3MFK A;  2DFH A;  1MMN A;  3WTS C;  2R0Q C;  3K4K A;  3PAS A;  1UZC A;  2IEK A;  3S15 J;  4ETS A;  3KZI C;  5FKN A;  2NYX A;  1TWF J;  5HDN A;  2OF7 A;  2HOS A;  3CD6 I;  1SAX A;  3Q9S A;  5FB2 A;  2UXI A;  3BJB A;  1WWX A;  3FMS A;  4RGU A;  3LQQ A;  4BNC A;  1Y1V J;  3CUO A;  1QO0 D;  3QPH A;  1WFX A;  4ZDP A;  5CVR A;  2L2O A;  3W6V A;  5K5O A;  4KIG A;  1HOM A;  2L4A A;  2DT6 A;  2JUG A;  3K1N A;  1PDN C;  3VW2 A;  2CQ7 A;  1P4A A;  3IKV A;  2M1B A;  3Q5F A;  1L3L A;  3JRE A;  2OTL I;  4KA4 A;  1MDM A;  2LOO A;  1R5H A;  4TV7 A;  5CQE A;  1TLH B;  4A0X A;  1V55 H;  2R7Z J;  1E17 A;  2DQL A;  3E7L A;  3A2K A;  2Q0O A;  2Y0M A;  4X0G A;  2K9N A;  2V1N A;  3DLL F;  3PO2 J;  4F52 A;  2O6G E;  2CWE A;  2FBH A;  3AL0 B;  2RDP A;  3HOY J;  3F6V A;  2Y9Y A;  4BJT A;  4U87 A;  2EZI A;  4GYI A;  1O3R A;  3A01 B;  1W4M A;  4A2U A;  3JRG A;  2BVM A;  3KYL A;  4AYB A;  3PO3 J;  2FJI 1;  2COB A;  3WTY C;  2JRT A;  2XDV A;  4E7Z A;  2YVX A;  3SXY A;  3G4S I;  3K69 A;  3HTA A;  1J59 A;  2P5L C;  3G7R A;  4M72 A;  2EWN A;  2A07 F;  3G1L A;  2ZJQ F;  3S1M J;  1QVT A;  4U0Y A;  1U9N A;  1I6X A;  2ZJ2 A;  3GZI A;  3AL0 C;  2JK3 A;  1XGN A;  3TED A;  2W00 A;  3ZGK A;  4NC8 A;  2HFH A;  2V9K A;  3LSK A;  3HSF A;  2FMY A;  3QOP A;  5LHH A;  5DM7 F;  1JKQ C;  4OD4 A;  4RAF A;  4P5O A;  2KQR A;  3KLO A;  5M3M J;  4KIC A;  3V42 A;  2HYJ A;  5D5U B;  3VOE A;  1IGN A;  1QZZ A;  4QPO A;  1GVJ A;  3X2Q H;  3OSF A;  2VPL A;  4CA0 A;  1MMD A;  4DOZ A;  3C2B A;  1LPQ A;  4B1R A;  1FYL A;  2XPV A;  4FE7 A;  1XMX A;  5D5W B;  4OOI A;  5F0H A;  1GV5 A;  2UXU A;  1POG A;  2W53 A;  4L0Y B;  3CDH A;  4UV8 A;  5H6R A;  4HQE A;  1TWH J;  1SFO J;  4YEL A;  4ITV A;  2LR8 A;  1SEU A;  5E17 F;  2HTS A;  3IWF A;  2H8W A;  3F8C A;  2R5Y A;  5D8K B;  3VWB A;  2XC7 A;  5IYC J;  5F64 A;  3HTJ A;  2O8X A;  3FM3 A;  2BE5 F;  3OYI A;  3OYM A;  1BR1 A;  3QAH A;  2W1O A;  2W48 A;  3CCY A;  2XRL A;  2A69 F;  2FQ3 A;  1JE8 A;  4G6D A;  4PGH A;  1NG6 A;  1TT0 A;  2FQ4 A;  3QKX A;  4HOB A;  1SC7 A;  1J2X A;  3KX2 A;  1X19 A;  4I6Z A;  5HLI A;  3WG7 H;  1M1E B;  1V5E A;  4BL0 B;  5K7F A;  5FMP A;  1MDM B;  4HX8 A;  4KYW A;  3GYH X;  1BIB A;  2G0E A;  4YG2 F;  3SFZ A;  2HNH A;  3IKT A;  3JRD A;  1ZQ3 P;  1EV7 A;  3FZV A;  5HDG A;  4O3M A;  5FRN A;  4EM1 A;  2HS5 A;  2GOM A;  2ESN A;  2VE9 A;  1YIT I;  3WTT C;  1W0T A;  3I4P A;  2R7Q A;  2K3P A;  5B3S H;  3GXO A;  4ESB A;  1RES A;  1P92 A;  2ELJ A;  4CDG A;  1AWC A;  1TT5 B;  3GTG J;  4XQF A;  2RNG A;  4HF0 A;  1FT9 A;  2K5C A;  5L3F A;  3MAJ A;  1SGM A;  1RKW A;  3ECH A;  3JRH A;  1KON A;  3JSP A;  2IPQ X;  5J1U A;  3HHG A;  3ZQL A;  2D45 A;  3KFW X;  2A6E F;  5DCM B;  5LHI A;  3B02 A;  1UI6 A;  2JA5 J;  2R7V A;  1Z05 A;  3BNI A;  3LAP A;  2R7R A;  3I3L A;  3MMY B;  2HDC A;  3I4M J;  3PJR A;  4GFL A;  1W1W E;  1HST A;  1FNN A;  1MKM A;  3FKJ A;  3C07 A;  4DNC A;  4RB3 C;  3FHN A;  2R7T A;  3HE0 A;  3IH3 A;  2R7D A;  5IT3 A;  2V9V A;  4UXN A;  5LGT A;  2LBF A;  2QKO A;  5L3G A;  1XGM A;  3BG9 A;  4XOR A;  4U9L A;  5FGM A;  2LY2 A;  1CF7 A;  1FBQ A;  2LDU A;  4D5C A;  1HSJ A;  2DOE A;  5EF6 A;  5FD5 A;  2HOE A;  1R36 A;  3W2W A;  3WE2 A;  4LG0 A;  1HLV A;  4WF2 A;  2DI3 A;  5HDK A;  1LDK B;  1YIO A;  3E1S A;  2VLA A;  4IF4 A;  1G4D A;  2V6E A;  1QU3 A;  3CRJ A;  4PXI A;  2ECB A;  4EMS A;  2DYS H;  5DCF A;  2HGC A;  2M30 A;  3ECO A;  3H9J A;  1WH5 A;  3CCR I;  1ENH A;  3A0H C;  2NS8 A;  3J7Y J;  3RCO A;  1NH3 A;  2D2W A;  2K86 A;  5HNF A;  1ZYR F;  3D0S A;  2CUZ A;  4HV6 A;  2DTZ A;  3LOC A;  1PYV A;  2GWR A;  1GV2 A;  2VKD A;  1IDY A;  2VI6 A;  3DEE A;  3DKX A;  3JSO A;  4OAZ A;  5LHG A;  1T2K A;  3HTU A;  1JKP C;  1ZLK A;  3I9V 2;  1YW7 A;  1FYM A;  4BHC A;  3ANP A;  3AQS A;  3KYC B;  2WUI A;  1MJ9 A;  1S29 A;  4N4N B;  2IA0 A;  1OQY A;  4IZZ A;  2NVT J;  3BOQ A;  5DTD A;  2Z5U A;  3QU3 A;  4ZJZ A;  2OZ6 A;  3T5X A;  1TQP A;  3ISP A;  2LKX A;  4G6T B;  3K7A J;  2D5V A;  2A68 F;  3S16 J;  1ETK A;  1YQA A;  3E6D A;  5FJ8 J;  1HXD A;  3CF5 F;  2JPB A;  2M34 A;  2HKX A;  5KAI C;  5DYM A;  4XKB A;  4WWC A;  4A3I J;  2Y0S A;  4UVC A;  1B9M A;  2PFV A;  1AU7 A;  3KKC A;  3CZ6 A;  2KDZ A;  3I5U A;  5GTH C;  4KT6 A;  3WTV C;  3MKW B;  3L2Q A;  1A6I A;  3F8F A;  5HNH A;  4I7H A;  5BQT A;  1TQM A;  2E36 A;  2F5F A;  4GCT A;  3ZMU A;  2LTP A;  3M1E A;  4II2 A;  2G7H A;  1T8I A;  4NUB A;  4OU0 A;  3JRI A;  4DZJ A;  1UI5 A;  2G7S A;  3IL2 A;  4J00 A;  5AON A;  3RKY A;  5TJJ A;  3ROU A;  1W7P D;  4XNF A;  3MZ8 A;  4F91 B;  2PQ8 A;  5B5E C;  2ME6 A;  5CQG A;  1HW5 A;  1HKQ A;  4B43 A;  1YS7 A;  1D1B A;  2A3S A;  2ME0 A;  3LWF A;  3IHU A;  1BI1 A;  2FX0 A;  4L5E A;  4EAT A;  3ZCO A;  3ERM A;  3E97 A;  4MGR A;  1MBJ A;  3VB2 A;  5B66 C;  2DTR A;  1Z1D A;  2WY8 Q;  2ZFW A;  4I0A A;  2E1O A;  4ENM A;  1WHU A;  5JR3 A;  3KLN A;  4IX7 A;  3GVA A;  1CF7 B;  4EM0 B;  1IXS B;  2H94 A;  4QTR A;  3LA7 A;  5FRM A;  5K5R A;  4NNJ A;  1MBF A;  1PP7 U;  2F07 A;  1SD5 A;  2KL4 A;  2MW8 A;  3L9F A;  5DUI A;  4BE2 A;  3OL3 A;  4XLF A;  1U5T B;  3F8B A;  4A3F J;  3SFI A;  4CO8 A;  2Z9O A;  2NRA C;  4Y33 A;  3WTZ A;  3V7S A;  3COA C;  4LD5 A;  1MBK A;  4BEH A;  5BS6 A;  1H8A C;  1NG7 A;  4L5J A;  3ZOB A;  1EJ9 A;  3HGG A;  5FLM J;  5E3L A;  2L0K A;  1DQU A;  2M0C A;  2EV5 A;  1K4T A;  1MNE A;  3ZQC A;  2K4B A;  3WGI A;  4IHW A;  3B6A A;  2W84 A;  3LSM A;  3QOD A;  2F4I A;  1ZRE A;  4D0P A;  1ZGJ A;  1SFE A;  2I5U A;  4M6X A;  1IF1 A;  1IN6 A;  2DT7 B;  3EUK L;  2LC2 A;  1IRZ A;  4DW6 A;  2MC4 A;  3M1C A;  4ABZ A;  4I02 A;  1WCM J;  3SDG A;  5F1J A;  2GEN A;  1I3Q J;  3AKZ A;  3D5L A;  4RMN A;  3VTI A;  5DD8 A;  4CCK A;  2QOP A;  1S72 I;  4CYD A;  2VKE A;  1HC8 A;  1XGO A;  1YS6 A;  1UHM A;  2KRF A;  2NVX J;  3FXJ A;  2OTJ I;  3OWT A;  1YX3 A;  1WI3 A;  4CHU A;  1R00 A;  5E1W A;  1SMY F;  2BYV E;  2HXI A;  4LK0 F;  3ABL H;  1BW6 A;  3R60 A;  4IRH A;  4JQF A;  3E6M A;  2H8R A;  2CW8 A;  2JQ7 A;  2IA2 A;  3BPV A;  3GBG A;  3GLL A;  4M74 A;  1I39 A;  2XUB A;  2CV2 A;  5EGO B;  3AQT A;  4HW0 A;  3VVZ A;  1FTT A;  4MK6 A;  4HEA 2;  1Q1H A;  2EZL A;  3OYH A;  4EGY A;  1O57 A;  2HTJ A;  1LEA A;  1TBX A;  2WB1 A;  1T38 A;  2DMN A;  2LNB A;  4MQV A;  4Z6Y A;  4JK1 X;  2DG8 A;  2PJP A;  4ICH A;  4ZDO A;  5JLX A;  1B1B A;  1OCZ H;  3Q9V A;  2ZCX A;  2D6Y A;  3MD2 A;  1X2M A;  2DA3 A;  4EJO A;  5H2F C;  3N97 A;  5EDN A;  5CVV A;  3BWG A;  4YEJ A;  3HOZ J;  3ZXS A;  2NNN A;  4E7L A;  3FMQ A;  5F04 A;  2H27 A;  1VQM I;  2FBI A;  5EZH A;  4RM3 A;  1RC9 A;  4AUX A;  4B09 A;  5BMZ A;  2NP5 A;  2V1D A;  3K4L A;  4XLA A;  5LLQ A;  3O60 A;  2HI3 A;  1FBU A;  2QVO A;  1A6Q A;  2R5Z A;  3BP8 A;  1ZR4 A;  4LLL A;  4II3 A;  2Q2E A;  4PJL A;  5E1X A;  3JAM K;  1G59 A;  1MBE A;  4MQ9 F;  2B1E A;  1JKR C;  1XDS A;  3KZZ A;  5J3L A;  4ASN A;  2QKL B;  2BY3 A;  4B8X A;  2DW4 A;  3VVX A;  3BTJ A;  1TNS A;  4PGG A;  2EPF A;  3L2V A;  1OMI A;  3V8K A;  2XAQ A;  3ZMV A;  5HOD A;  1E3P A;  2DYR H;  1VQ5 I;  4P9F A;  4XLP F;  5LGN A;  5GAE J;  2NVQ J;  1IC8 A;  1MJA A;  5HVQ C;  1T33 A;  1BOB A;  3SEZ A;  1JT0 A;  3TBI A;  5IT9 Z;  2IAI A;  3SJM A;  2E5Z A;  1D3Y A;  1ITY A;  1IUF A;  2CUF A;  3IRQ A;  3CCE I;  2JMW A;  5HS8 A;  1QA6 A;  1FOW A;  1G3S A;  3WU2 C;  5E20 A;  2ESH A;  2KRH A;  2NVU B;  2VXZ A;  2KJB A;  5ILV A;  1I1G A;  3HOT A;  1KA8 A;  1FOK A;  1BI2 A;  2EQR A;  1GUU A;  1MD0 A;  4A0Y A;  3M07 A;  3BJO A;  1HBX G;  4HAM A;  1S8N A;  3CCQ I;  2DO7 A;  2M7A A;  2WV1 A;  5GAG J;  2COM A;  2NOJ B;  5DM6 F;  4JL3 A;  2ZXH A;  4B44 A;  2W57 A;  2A61 A;  2EBI A;  3SDB A;  3AG2 H;  1A35 A;  3KCC A;  3QYB A;  1PJR A;  2KJC A;  4IL6 C;  5ICF A;  2VC0 A;  3IH2 A;  4NC6 A;  1X1D A;  1T39 A;  1E2X A;  3FXU A;  1OCO H;  3QPL A;  1ACI A;  2OER A;  3JSJ A;  2WAQ N;  5EFY A;  4B48 A;  1T6S A;  2X6W A;  2E5N A;  2Y31 A;  3K9T A;  4HNU A;  1BC7 C;  2PG4 A;  2QSG X;  1ERD A;  3H0G J;  1D8K A;  3S32 A;  3FBI B;  2X51 A;  2RKH A;  2PMH A;  1VFC A;  4IOC F;  4UVA A;  1D5Y A;  4GGG A;  4R8H A;  1Y56 A;  1IXR C;  1JHH A;  5GPC A;  2REK A;  4MEY F;  2L9R A;  2RAS A;  4U0V A;  5FFX A;  5A2Q Z;  4RM2 A;  4BQA A;  2MD0 A;  1FPQ A;  1U8R A;  3CES A;  2X1C A;  4M6Y A;  1ZRC A;  2UUZ A;  2L54 A;  5FKK A;  1B8I A;  1BBY A;  3KIO A;  1X1B A;  2F5E A;  4M71 A;  2VL8 A;  2XKO A;  4BY1 J;  3LL7 A;  3VYU B;  3F1B A;  2YU3 A;  3BR1 A;  3HRM A;  2K3F A;  2O03 A;  5HSZ A;  4M3D A;  3VFZ A;  2ZME A;  1YRN B;  1OYI A;  1HQC A;  1IUY A;  3KKD A;  4RAZ A;  2HR3 A;  6PAX A;  2K7L A;  2ZJR F;  2Q2E B;  4NQW A;  2MYS A;  5FLV A;  4O5V A;  2B7E A;  2BXZ A;  4EEF G;  5LGU A;  3QPT A;  4XID A;  2HQA A;  1VQO I;  4W1U A;  4FHT A;  5D6F A;  4IEJ A;  4BE0 A;  4PZJ A;  2JA8 J;  3QYE A;  3ABT A;  4A3B J;  3PNT A;  5F27 A;  1WVR A;  3VSL A;  2IU5 A;  4UB6 C;  3BTL A;  2QSH X;  1W5T A;  2HKO A;  2L9N A;  3H5R A;  1X58 A;  5CXI A;  3PL8 A;  1OR7 A;  3HZJ A;  5FLX K;  2QKM B;  2RAE A;  4NEL A;  4LB5 A;  2XF5 A;  4ON0 A;  2R4G A;  2VBY A;  2DJN A;  2F6C A;  3AG3 H;  5EZG A;  1VI0 A;  2CG4 A;  2EIJ H;  5C3E J;  2RQQ A;  4A5M A;  1TQI A;  3EQL F;  2V1U A;  2HU9 A;  4CGR A;  2P7C B;  3B81 A;  4H4K C;  4A3C J;  3ZQI A;  2LH9 A;  2CFX A;  3DBH B;  1QPM A;  1VQL I;  4LFU A;  4BXX J;  5K1Y A;  1BM9 A;  4A6E A;  1U3E M;  2R93 J;  3OYN A;  3E7Q A;  1USS A;  4JKZ A;  2LP0 A;  3IH4 A;  3LWJ A;  4UUV A;  1OCT C;  3KP5 A;  1AHD P;  4RGX A;  2FNA A;  2MLG A;  1YI2 I;  3H9G A;  1X4O A;  1BOA A;  3H1C A;  3I53 A;  5AQC A;  3S5R A;  1Z91 A;  4BHB A;  2DG7 A;  1TWA J;  5BNG A;  1OYY A;  2UXH A;  1MMA A;  2XRO A;  1F4K A;  4HLX A;  2ZJP F;  3FXR A;  1TWC J;  1OCC H;  2GLO A;  3PPB A;  1XCB A;  2O0Y A;  1EKE A;  3FK6 A;  3SHF A;  1GXQ A;  2BOL A;  1SAN A;  3GZ5 A;  2QEN A;  1KU2 A;  1GXP A;  4IPA A;  2K9L A;  3RKX A;  2QUF A;  2A5Y B;  4XRS G;  2UWM A;  4Q48 A;  4IRV A;  5E8G A;  1O7F A;  1WPK A;  2JRM A;  3HRT A;  1HW1 A;  4OWR B;  4EJU A;  2P7V B;  2V9P A;  2XGC A;  2JN6 A;  2HDW A;  1TWG J;  2H1L A;  3MEX A;  3ZMZ A;  3COL A;  2HKU A;  2F5C A;  1AA7 A;  4HX4 A;  4UUS A;  1Z7L A;  1O3S A;  2ID3 A;  1JGS A;  3TO9 A;  3V8L A;  4HZF A;  1X1A A;  2FRH A;  2B63 J;  5FKL A;  1JGG A;  3CDI A;  4XN3 A;  2BW3 A;  3NRG A;  1OIS A;  1BC8 C;  3B6C A;  4L9T A;  2PMZ A;  4BU2 A;  1BIA A;  4A5N A;  3GTM J;  2EIM H;  5HOO A;  4NQW B;  3ZMT A;  1X1C A;  3KNW A;  3CJT B;  2CUE A;  1G8X A;  1S7O A;  2BV6 A;  3FHZ A;  5M3F J;  3Q0W A;  3KE2 A;  1APL C;  2O7T A;  3ZP5 A;  1TP4 A;  1LB2 A;  1B72 B;  2ZB9 A;  3T1B A;  4CXF A;  2EV0 A;  2P4W A;  3FRQ A;  4A3D J;  3IP4 B;  4Y3O A;  3H0D A;  3WTU C;  3S3M A;  2F4M B;  2ZSI B;  4AU7 A;  1D0Y A;  2QBY A;  2CQN A;  2ZME C;  2D1V A;  3L2R A;  2QWW A;  1TL8 A;  2FBK A;  1MBG A;  2M8G X;  5L3C A;  3ULQ B;  1ZN2 A;  2HZT A;  3R0A A;  4AD9 A;  3CCM I;  2GA1 A;  1QZE A;  2VJ4 A;  4U7D A;  3HOV J;  1X3U A;  5CPR B;  2IGK A;  3J80 Z;  4GCK A;  3L2C A;  2MSY A;  1BJA A;  2B3W A;  4F92 B;  1MW7 A;  2ZCM A;  3I58 A;  2OI8 A;  4D7N A;  4CZC A;  4F3Q A;  3BTC A;  4Y17 A;  1W36 C;  1BL0 A;  1UJ8 A;  1B4A A;  1ETQ A;  1WRJ A;  4C3H J;  4D1Q A;  2OBP A;  2HYG D;  3VEP A;  1OR7 C;  4DQ2 A;  4IQJ A;  3VOD A;  3FK7 A;  4MIM A;  3CCL I;  3DPU A;  3WTX C;  2M45 A;  3NRV A;  4NBQ A;  4M9S A;  3K6G A;  3NS4 A;  5ICE A;  5LD2 C;  3RIR A;  3R4K A;  1W7P B;  4HLY A;  4IOA F;  4D5F A;  4A3G J;  4RBO A;  1P2F A;  4HST A;  3SEQ A;  1LJ9 A;  3T8T A;  3U1K A;  2VON A;  2IS1 A;  4EQQ A;  2ZNY A;  1X3W B;  1MMG A;  2FEZ A;  3WU0 A;  4HNT A;  5GTI C;  5F0F A;  2VQG A;  4C3J J;  2BY1 A;  2DOD A;  2X6O A;  1FOY A;  2FML A;  4GO1 A;  4LMY A;  4BH9 A;  1FEX A;  2JTV A;  2JSC A;  2KFD A;  1D0X A;  1Y0U A;  4WIB A;  4QLC U;  1D1C A;  4ZYD A;  4UY8 I;  4GCL A;  1BR4 A;  1R1U A;  4EVI A;  2WWY A;  3ML6 A;  2JVG A;  3S2W A;  4CSW A;  5JLW A;  1UCR A;  5FO5 A;  3AAF A;  3RD3 A;  3VOX A;  3CUQ A;  4HV5 A;  4IXA A;  2QTQ A;  3HSE A;  4K2E A;  4XRS A;  2IS4 A;  1MH4 A;  2KT0 A;  2QA4 I;  5HS9 A;  3S2D J;  3HTI A;  2JZY A;  2QYO A;  1HW2 A;  4XKV A;  1I3A A;  1K6Y A;  4MO7 A;  3C7J A;  1JJ6 C;  2PBX A;  5IP6 A;  2FD5 A;  2Q8K A;  2QQ9 A;  3DFG A;  2LFB A;  3TKY A;  3ANG A;  3VW0 A;  4FX4 A;  2M7B A;  4CCL A;  3FM5 A;  3GEU A;  2LKS A;  3HRS A;  1K6O A;  2MH2 A;  1PVE A;  3DV8 A;  2BW3 B;  3VYT B;  2V6C A;  1WJB A;  3DBL B;  1I27 A;  4UUT A;  1VQ8 I;  2ZXJ A;  3DCF A;  3DEW A;  4OAY A;  2GQQ A;  2XVC A;  3ZRG A;  2M4G A;  1ETW A;  5E3N A;  3OIP A;  4BXU A;  2L3D A;  3EYI A;  5C44 J;  4L18 B;  2VAS A;  1DGW Y;  1XS9 A;  2CJJ A;  2NS7 A;  3L2W A;  3EET A;  1BW5 A;  2IGN A;  4XN0 A;  1IJW C;  2Y30 A;  2CV0 A;  2VOO A;  3DPT A;  2X85 A;  3H5N A;  4ZTJ A;  3MNL A;  3SQN A;  3CC2 I;  2KPM A;  3FF5 A;  4O6J A;  5GAH J;  3HM5 A;  1FX7 A;  3I59 A;  4C2M A;  2NAZ A;  5BPI A;  3SZG A;  2M8E A;  3RYR A;  4AF5 A;  1R1T A;  2FBQ A;  2GXA A;  4C2U A;  2GOX B;  4A3L J;  2H6B A;  2L9S A;  5AIQ A;  3ZN1 A;  2DLL A;  4R1H A;  2Z2S B;  1N25 A;  5L3E A;  4GDF A;  3EYY A;  4UNO A;  4GRI A;  3CO6 C;  1XSV A;  2EJR A;  2E34 A;  2P0W A;  2TCT A;  2IP2 A;  2XSJ C;  2YPR A;  2Z3Y A;  4F55 A;  4AVP A;  2A5W A;  2LK2 A;  3W6K B;  3RSN A;  5IOY A;  2HQ5 A;  1GDT A;  5M5X J;  3RJP A;  2QQB A;  4Q47 A;  3RH2 A;  2FSW A;  1DUX C;  5IOZ A;  2F5D A;  3OS2 A;  5BPD A;  3OYG A;  1MMS A;  4M6V A;  4E7K A;  3C18 A;  4S0H B;  4KMU X;  2EFW A;  1UHS A;  2OZU A;  3VSK A;  2R3S A;  2QGU A;  3HPH A;  4WX9 A;  2GAU A;  3S17 J;  4IRG A;  3S8P A;  2LMD A;  5DUK A;  3M4O J;  3DEU A;  2R5Y B;  4BBS J;  3P5J A;  1XDU A;  2J5P A;  2M9H A;  4J19 A;  4PDK A;  3W2V A;  1UG0 A;  3GF2 A;  4BKX A;  2RHA A;  2Y48 A;  2LRE A;  4HBL A;  2EFN A;  1P9Q C;  1W36 D;  4AVZ A;  3QWL A;  2ZOY A;  2NOG A;  3HUG A;  3BHQ A;  1TW2 A;  1ZGW A;  3ZQH A;  3BTI A;  2O8K A;  2KIF A;  2WBM A;  2ZCN A;  3GZN B;  3CUQ B;  3DQV C;  1Z3X A;  5HLT A;  1D8J A;  2QZ8 A;  2XAS A;  1K61 A;  2CW0 F;  2KMU A;  2MFZ A;  1T56 A;  2G7U A;  1UFM A;  2OV7 A;  3GLX A;  3H9Q A;  2ZKZ A;  2NXN B;  3GO5 A;  4XLH A;  5K5Q A;  1PUE E;  3BCA A;  2H6C A;  2AQF A;  3G3Z A;  2W7N A;  3CMM A;  4G94 A;  4FAS D;  3I56 I;  1F1Z A;  1WH7 A;  2WAD A;  1MGT A;  4G9Y A;  2JA7 J;  3L1P A;  3T0Y A;  4CGZ A;  4HF1 A;  3CUQ C;  3TQN A;  1W5C C;  1JHF A;  1R5G A;  2LD5 A;  1OCR H;  3EUA A;  5EG0 A;  4ZC3 A;  3G6E I;  1G3Y A;  3KZ9 A;  2E35 A;  2YVE A;  4XM3 A;  3LSI A;  3QP6 A;  4HYE A;  5JFR A;  3BRO A;  5HLG A;  4YRV A;  1BJZ A;  4RAY A;  1Z7U A;  2Z33 A;  2K4J A;  4DJA A;  2LBF B;  3HTS B;  2YSR A;  1E0E A;  4KIT B;  3KP4 A;  5HS7 A;  1ONV A;  4GCV A;  3T8R A;  3OMY A;  4PSW A;  1Y8Q B;  3PQK A;  3OS0 A;  1A5J A;  1OPC A;  1J0R A;  5CLS A;  2VOP A;  3KPH A;  4E7S A;  3OYJ A;  2M4K A;  4B47 A;  3W2A A;  1VF9 A;  2IRF G;  2OQR A;  1ON2 A;  3E5U A;  4XLC A;  4ENJ A;  4OIR F;  3J81 Z;  4LG0 B;  3KEO A;  3KYD B;  2VQL A;  1OYW A;  3KP3 A;  2VUM J;  2DFF A;  2UXO A;  1QGP A;  3I64 A;  4YII A;  4BDZ A;  1C0W A;  2YVH A;  3BC8 A;  3DXJ F;  5D8L B;  1DPU A;  1RZ4 A;  2FOW A;  2JWT A;  2ZCW A;  1MIJ A;  4YIR X;  5D18 A;  4N9H A;  2X0L A;  4B3X A;  3VOK A;  4M9X A;  1MBH A;  4M3G A;  4BQN A;  3CCU I;  1IV8 A;  2L7F P;  3HHH A;  3G1O A;  3R0J A;  5KK1 A;  3P9C A;  3UKG A;  4AIK A;  3BZK A;  3RI4 A;  3K4N A;  4OMY A;  3F72 A;  4NHJ A;  4N9I A;  2QF7 A;  2Y2Z A;  1H0M A;  3ZQG A;  3EUP A;  3JTH A;  1ZG3 A;  2BHZ A;  4M3E A;  5F08 A;  2G9W A;  2P5V A;  2GXG A;  3DPL C;  1X4P A;  1U9O A;  3AG4 H;  2HOT A;  5CVI A;  3BG6 A;  2CU7 A;  4P96 A;  4M3F A;  4PJ0 C;  5J1R A;  2FA5 A;  2XAG A;  1VZ0 A;  3MQ0 A;  4WCG A;  1J9I A;  5EEH A;  4LG3 A;  3K70 D;  3LSG A;  1LUJ B;  1UMQ A;  1I5Z A;  2D1H A;  2KIU A;  3SWH A;  3SZT A;  2O5R A;  4JX6 A;  3VYS B;  4JOM A;  4E7I A;  1IW7 F;  2ELH A;  5HAW A;  3L7W A;  1O3Q A;  4RGS A;  1ZK8 A;  3L2U A;  2ZNZ A;  1Z3Y A;  3KET A;  3F21 A;  2IS6 A;  3EUH A;  3WTW C;  2NNY A;  5IYD J;  2ZOZ A;  1KU7 A;  2XSD C;  2V7F A;  2L02 A;  1T0F A;  1SD6 A;  1FY7 A;  3CMY A;  1QHG A;  2UXN A;  1XGS A;  2STW A;  2G7L A;  2VC1 A;  4FIS A;  1MSF C;  1B9N A;  3A03 A;  3F23 A;  1X3Z B;  3K4J A;  2P8T A;  2UXX A;  3LFU A;  2DPD A;  2AXT C;  4FET A;  4BJ6 C;  4Y52 J;  1J75 A;  4ESF A;  2O7O A;  1ON1 A;  1IN8 A;  2BVL A;  4I98 B;  3OYL A;  2E1C A;  1XX5 A;  3HXL A;  2E7X A;  3OIO A;  4NDL A;  4QWQ A;  1A04 A;  2O3F A;  3PM1 A;  3PIP F;  4E7H A;  1RRJ A;  1VQ9 I;  1ZKG A;  4PUS A;  2E2I J;  1IRG A;  1SVO A;  2ACJ A;  4XLN F;  5EG0 B;  4MTD A;  2VT3 A;  1QRY A;  2L01 A;  2HVS A;  4XBF A;  1G2H A;  1XC5 A;  3CCS I;  4HKU A;  2DT5 A;  1XCV A;  3LST A;  3O8H A;  2FE3 A;  2VBW A;  5M5Y J;  4P55 A;  1YIJ I;  3NQO A;  4AC0 A;  2P6T A;  1PP8 F;  3JW4 A;  1OLT A;  2RNJ A;  4ZH4 F;  3H5A A;  1BI3 A;  1SFX A;  4LLN A;  2JA6 J;  2JJ7 A;  4NN1 A;  4I2O A;  2YS9 A;  4OIP F;  2VJ5 A;  2HDD A;  5D19 A;  2LY9 A;  1B59 A;  4BHP A;  3CCV I;  3GX4 X;  1GVD A;  1KGS A;  2E71 A;  2WV0 A;  3ZQQ A;  3HOU J;  3JRC A;  1SVM A;  5IT9 K;  1H9T A;  3DU6 A;  3NXC A;  4JNN A;  5KAF C;  1EH8 A;  1JT6 A;  2XAH A;  3ON4 A;  3MN2 A;  3NWT A;  1HF0 A;  2F5V A;  4HNV A;  1QVU A;  4KIB A;  4MFE A;  1XSX A;  2V79 A;  5CXG A;  3WU1 B;  1P7I A;  2XF6 A;  2LVS A;  3E3V A;  3GCM A;  3JR9 A;  3VPR A;  5H20 A;  5JVG F;  4PFO A;  2R92 J;  2QQA A;  5FKO A;  4XOP A;  2KKO A;  4BEH B;  4AYB N;  1J7K A;  2K9S A;  4Y15 A;  3NPI A;  2R7S A;  1FSH A;  1I6H J;  3CCJ I;  1NK2 P;  2OU2 A;  3KEQ A;  3N4M A;  3H92 A;  3P9I A;  4BDY A;  4S05 A;  3WHB A;  3I55 I;  1LKX A;  4CCJ A;  2VQH A;  3HOS A;  3LFK A;  5E1Z B;  4EV0 A;  4Q5S F;  3Q0V A;  5JHU A;  3FDY A;  4UV9 A;  3QRF F;  2HVQ A;  1VQN I;  3TGN A;  3O3K A;  1ODD A;  4BAY A;  4BGD A;  4XIC A;  5TIS C;  1D0Z A;  1FOX A;  4D9J A;  1ZG5 A;  2CRG A;  1P6R A;  3IWZ A;  3ABK H;  3WGH A;  4XL9 A;  1WJA A;  3PIO F;  5KNL A;  4IQ4 A;  3CLO A;  1V54 H;  4F7Z A;  2LYC A;  2V4J C;  5D6E A;  1TW3 A;  4EJW A;  5ILU A;  3UNG C;  2MA3 A;  1F5T A;  2RV8 A;  1R5I D;  2JPC A;  3DF8 A;  4ZZD A;  1O4X A;  3V7R A;  3BRU A;  4WXC A;  1N77 A;  4L0Z B;  4ZTF A;  3HDD A;  4DBR A;  2ISZ A;  3BDD A;  1YO5 C;  3TDZ C;  2HVR A;  1FMW A;  4XON A;  3TP3 A;  5DEQ A;  1SD7 A;  2AQE A;  1TTY A;  4CH7 A;  5A2Q K;  1IG7 A;  3CO7 C;  3O8G A;  3FXQ A;  1JI8 A;  1Z77 A;  2CMP A;  5J4Y A;  4IRI A;  1RIO H;  5AIP A;  2EK5 A;  4C2T A;  4G7Z F;  2GUH A;  3GTP J;  4RLQ A;  3VDX A;  3TW6 A;  3TO7 A;  2M0M A;  3EUH C;  1IN7 A;  4ZYA A;  1AKH A;  4A3M J;  4NB5 A;  1U8B A;  3NEU A;  4JBA A;  3OR1 C;  1T0F C;  2IJL A;  4KJZ A;  3LSP A;  1Q1V A;  2FF4 A;  2LKP A;  2DK8 A;  3OYF A;  4HRI A;  3G56 A;  3GUD A;  2HXO A;  3HEF A;  1RET A;  3BY6 A;  5CVJ A;  2XB5 A;  4A12 A;  2O9L A;  5D5V B;  1QZY A;  1V4R A;  1R22 A;  1SD4 A;  4KIS A;  1XN7 A;  1SAU A;  2BGC A;  2JT1 A;  5J47 A;  3CWR A;  2DCE A;  1KQ9 A;  2R5Z B;  3OIQ A;  2EIL H;  2DQR A;  2L7K A;  3IUV A;  4DGW B;  5L3D A;  5J4V A;  3BJ6 A;  3N05 A;  1P7J A;  2DOA A;  4LB6 B;  4FCY A;  3RTR A;  5J8C A;  4RB0 A;  3GTO J;  4DYC A;  2XV4 S;  3PSF A;  5ERI A;  3TOB A;  3TW7 A;  2RN7 A;  1UEL B; 
#chains in the Genus database with same CATH homology
 2OI8 A;  3QQA A;  4ACI A;  2L7Z A;  4D7N A;  1UG2 A;  2LKX A;  3BTC A;  3A01 A;  1BL0 A;  4C3H J;  1ETQ A;  3K7A J;  2D5V A;  4GFB A;  3S16 J;  1ETK A;  2HOA A;  5FJ8 J;  2M34 A;  3NI7 A;  3FK7 A;  4MIM A;  1RR7 A;  4MLO A;  4A3I J;  2YU9 J;  4CYC A;  4AC6 A;  2X48 A;  2DA1 A;  3ZQF A;  5J1Y A;  4D5F A;  4A3G J;  4RBO A;  1FJL A;  3BCG A;  2MG4 A;  4A3K J;  3GTK J;  1AU7 A;  3KKC A;  2KDZ A;  3K2A A;  3P9T A;  5F0F A;  4C3J J;  1OCP A;  1A6I A;  1LFB A;  2X6O A;  5IP9 J;  1FEX A;  5E3M A;  1JUS A;  1BA5 A;  4GCT A;  3D1N I;  1YRN A;  2LTP A;  1ETV A;  4IHV A;  2H1K A;  4GCL A;  2PMZ N;  3JRI A;  1LE8 A;  4DZJ A;  1UI5 A;  4V2G A;  5C4X J;  2G7S A;  1ETO A;  5JLW A;  2K9Q A;  1E3O C;  3RD3 A;  2HYT A;  4L62 A;  3VOX A;  2QTQ A;  4XRS A;  2ME6 A;  1MH4 A;  4A69 C;  2KT0 A;  2TRT A;  4M3B A;  3S2D J;  1XG1 A;  3HTI A;  2ME0 A;  2FX0 A;  4MO7 A;  4L5E A;  1JJ6 C;  2PBX A;  5IP6 A;  2FD5 A;  2DA6 A;  1MBJ A;  2XPW A;  3TP0 A;  2LFB A;  4BBR J;  5E3O A;  4YZE A;  1HCR A;  3ANG A;  5EEA A;  2V57 A;  3VW0 A;  3I4N J;  4MXM A;  2E1O A;  3GEU A;  3T6N A;  2N8G A;  2XGD A;  2ECC A;  3BR0 A;  4JYK A;  4UUT A;  4QTR A;  2WGB A;  5GPA A;  1MBF A;  2E19 A;  3DCF A;  2CQQ A;  3DEW A;  2F07 A;  5FGL A;  1W0U A;  2EZK A;  1ETW A;  2MW8 A;  5E3N A;  4B4C A;  2MGQ A;  3RZD J;  5C44 J;  3BQY A;  1AKH B;  4A3F J;  3S1Q J;  3SFI A;  2EH3 A;  1XS9 A;  2CJJ A;  2NS7 A;  4FTH A;  2DMU A;  2QIB A;  1BW5 A;  2YUS A;  4DYQ A;  1MBK A;  1IJW C;  2Y30 A;  3QBM A;  3MNL A;  1H8A C;  1B8I B;  3ZOB A;  2DA5 A;  3NNR A;  2Q24 A;  3HM5 A;  4B3A A;  3EGQ A;  3HGG A;  5FLM J;  3RQI A;  3ON2 A;  5E3L A;  5K58 A;  2L0K A;  3HIM A;  3FIS A;  2M0C A;  2Y0S N;  2GM4 A;  3ZQC A;  4AF5 A;  2FBQ A;  4IHW A;  3B6A A;  4A3L J;  5C4J J;  1WGX A;  3CDL A;  3BG3 A;  2DMT A;  2DA4 A;  1HDP A;  4G12 A;  1Y1W J;  2ELK A;  1IRZ A;  3FIW A;  4DW6 A;  4ABZ A;  4DYR A;  3VVY A;  2TCT A;  1WCM J;  3SDG A;  5F1J A;  3JRF A;  3S1R J;  2GEN A;  2LK2 A;  1I3Q J;  1JKO C;  2AO9 A;  2HQ5 A;  4JX5 A;  3BG5 A;  5IOY A;  5M5X J;  1GDT A;  2LLK A;  2E2H J;  2QOP A;  2VKE A;  1QPI A;  5IOZ A;  2VKV A;  4M6V A;  4S0H B;  4BY7 J;  1UHS A;  2NVX J;  1WI3 A;  2XPU A;  2OPT A;  4CYC B;  2HXI A;  3BT9 A;  3S17 J;  3M4O J;  1BW6 A;  2R5Y B;  2Y9Z A;  4BBS J;  1JTY A;  4FE4 A;  1PUF A;  3GTJ J;  2M9H A;  1JUP A;  4J19 A;  2H8R A;  3CJD A;  3VIB A;  3GBG A;  5EGO B;  1ORK A;  3AQT A;  3VVZ A;  1RKT A;  3HOW J;  4JP0 A;  4BKX A;  2RHA A;  1FTT A;  1DU0 A;  4MK6 A;  1MNM C;  2EZL A;  3Q0U A;  3BQZ A;  1RPW A;  2DMN A;  5GP9 A;  3GTL J;  3LSR A;  2ZOY A;  2NOG A;  1U78 A;  2DG8 A;  3BHQ A;  1HDD C;  4ICH A;  1ZGW A;  5JLX A;  3ZQH A;  3BTI A;  5F0C A;  1LE8 B;  2VPR A;  2O8K A;  2ZCX A;  2D6Y A;  1GT0 C;  1X2M A;  2DA3 A;  1CQT A;  2ZCN A;  5EDN A;  3HOZ J;  1K61 A;  5F04 A;  1T56 A;  1B72 A;  3HOX J;  5K7Z A;  5EZH A;  1NTC A;  9ANT A;  4AUX A;  3JRA A;  5DAJ A;  2AHQ A;  3WHC A;  3VW1 A;  2NP5 A;  3O60 A;  1FIA A;  2HI3 A;  4W97 A;  3RZO J;  5IP7 J;  2R5Z A;  4X1E A;  3OOU A;  1ZR4 A;  1WH7 A;  4QSH A;  2JA7 J;  3L1P A;  1MBE A;  3VUQ A;  4QIW N;  5D1R A;  2QCO A;  2X9D A;  1JKR C;  5J3L A;  1JJ8 C;  2LD5 A;  1FIP A;  3BR3 A;  5EG0 A;  3KZ9 A;  3VVX A;  2K40 A;  3BTJ A;  1LFU P;  1R9T J;  1F43 A;  2YVE A;  5HOD A;  2CQX A;  4D7M A;  3HBL A;  2NVQ J;  4XRM A;  2I10 A;  1BJZ A;  4MFD A;  1IC8 A;  5EYR A;  1IV6 A;  1NK3 P;  1T33 A;  5IPA A;  3OSG A;  1JT0 A;  1JTX A;  2IAI A;  2EZH A;  4UUS B;  1I50 J;  3SJM A;  1ITY A;  5HBU A;  1IUF A;  2CUF A;  2JMW A;  1MSE C;  3A02 A;  2QWT A;  1ZR2 A;  3FKI J;  1A5J A;  1Z0X A;  1VND A;  3HTH A;  4XK4 A;  1VF9 A;  1IDZ A;  5FKM A;  2R0Q C;  4KWA A;  3PAS A;  2IEK A;  3S15 J;  5FKN A;  2XGE A;  1TWF J;  4LOC A;  2VUM J;  2OF7 A;  2UXO A;  2YVH A;  2EQR A;  5CW8 A;  3JRB A;  2HOS A;  4IHX A;  1GUU A;  4A93 J;  2UXI A;  3BJB A;  4ME9 A;  2WB1 N;  2DA2 A;  1Y1V J;  2JWT A;  5D18 A;  3VOK A;  3W6V A;  1MBH A;  4M3G A;  1HOM A;  2WV1 A;  2L7F P;  4JL3 A;  3G1O A;  5IYB J;  3UKG A;  3VW2 A;  3BR2 A;  2EBI A;  4IHY A;  4C2M J;  3JRE A;  2QF7 A;  2Y2Z A;  3HKZ N;  3DPJ A;  3IH2 A;  2R7Z J;  3EUP A;  3ZQG A;  2OER A;  3QPL A;  4M3E A;  5F08 A;  2XB0 X;  3JSJ A;  3E7L A;  1PUF B;  2WAQ N;  1U9O A;  5EFY A;  2HOT A;  2K9N A;  1MH3 A;  3PO2 J;  2Y31 A;  2CU7 A;  4M3F A;  5J1R A;  3IV5 A;  3V78 A;  3H0G J;  3HOY J;  1S7E A;  3LSG A;  1UMQ A;  2Y9Y A;  3BR6 A;  2EZI A;  3A01 B;  1VFC A;  3VP5 A;  3JRG A;  4JX6 A;  5HAW A;  1D5Y A;  3Q3S A;  3PO3 J;  1ZK8 A;  2COB A;  5GPC A;  2REK A;  2L9R A;  2RAS A;  2IBD A;  5IYD J;  3HTA A;  2NVY J;  2ZOZ A;  3LSJ A;  2XSD C;  3G7R A;  3S1M J;  3G1L A;  3CMY A;  1QVT A;  2DA7 A;  1U9N A;  5FKK A;  1B8I A;  5DS9 A;  2G7L A;  3S1N J;  4FIS A;  1MSF C;  3GZI A;  2JK3 A;  3A03 A;  4BY1 J;  3TED A;  3M3Y J;  3F1B A;  3BR1 A;  3GTQ J;  4Y52 J;  3V6G A;  5HSZ A;  4M3D A;  1YRN B;  2O7O A;  3KKD A;  2FJ1 A;  1JKQ C;  4Y7N J;  4NDL A;  3OIO A;  1ETY A;  5M3M J;  3PM1 A;  5FLV A;  2HYJ A;  1ZKG A;  2E2I J;  4RDU A;  1IGN A;  3LJL A;  4EEF G;  3F0C A;  5EG0 B;  4XID A;  3OSF A;  4W1U A;  1ETX A;  4IEJ A;  2GBY A;  2JA8 J;  3G1M A;  1QRY A;  1DU6 A;  3C2B A;  1G2H A;  1XC5 A;  4A3B J;  5F27 A;  2IU5 A;  4HKU A;  3O8H A;  4B1R A;  2XPV A;  4FE7 A;  3BTL A;  3NAU A;  5M5Y J;  5F0H A;  1JUM A;  4AC0 A;  1GV5 A;  3MKL A;  1POG A;  2UXU A;  1X58 A;  2W53 A;  5H9T A;  5CXI A;  4X6A J;  2G3B A;  2JA6 J;  2JJ7 A;  1TWH J;  2RAE A;  4NEL A;  1SFO J;  4NN1 A;  2YS9 A;  4A3E J;  5D19 A;  2HDD A;  2LR8 A;  2L7M P;  2LY9 A;  2DJN A;  2GFN A;  1H89 C;  5C4Y A;  2R5Y A;  5EZG A;  1GVD A;  1VI0 A;  3HOU J;  5C3E J;  3JRC A;  4DZP A;  5IYC J;  3HTJ A;  5FHP A;  3NXC A;  4JNN A;  5EGO A;  3ON4 A;  1JT6 A;  3MN2 A;  1HF0 A;  3S2H J;  4HNV A;  4I76 A;  1QVU A;  4MFE A;  2W48 A;  2NP3 A;  4CGR A;  3CCY A;  2XRL A;  3BR5 A;  3B81 A;  4A3C J;  5CXG A;  1P7I A;  2LVS A;  3JR9 A;  3ZQI A;  3VPR A;  2R92 J;  2FQ4 A;  5FKO A;  3QKX A;  4AYB N;  4BXX J;  2K9S A;  3NPI A;  3MVP A;  1H88 C;  2R93 J;  1I6H J;  1NK2 P;  4I6Z A;  3E7Q A;  3HGY A;  4JKZ A;  2LP0 A;  3IH4 A;  1FTZ A;  3LWJ A;  2DMQ A;  3WHB A;  5K7F A;  1OCT C;  1AHD P;  4V2F A;  5FMP A;  2G0E A;  3JRD A;  1K83 J;  3Q0V A;  1ZQ3 P;  5AQC A;  3S5R A;  5M5W J;  2DG7 A;  1TWA J;  2P81 A;  4A3J J;  5BNG A;  4XIC A;  1W0T A;  2UXH A;  1F36 A;  2XDN A;  1RES A;  1TWC J;  3GTG J;  2CRG A;  1ZTR A;  2GLO A;  3PPB A;  3RH2 A;  3H3V K;  4C3I J;  3FK6 A;  1OJL A;  1SGM A;  1RKW A;  1X2N A;  3RKQ A;  3JRH A;  3S14 J;  1SAN A;  5J1U A;  3ZQL A;  4XRS G;  1UI6 A;  2JA5 J;  3BNI A;  1O4X A;  1WPK A;  2PZ9 A;  3I4M J;  4GFL A;  3BRU A;  1EF4 A;  2XGC A;  3C07 A;  2JN6 A;  3HDD A;  1TWG J;  3COL A;  3NAR A;  2HKU A;  3HE0 A;  3IH3 A;  4UUS A;  3TP3 A;  2ID3 A;  3LNQ A;  2QKO A;  2B63 J;  3BG9 A;  5FKL A;  1JGG A;  1IG7 A;  3O8G A;  1Z77 A;  3NRG A;  4D5C A;  2G7G A;  3B6C A;  2DMP A;  5EF6 A;  3GTM J;  3GTP J;  2GUH A;  3KNW A;  1TC3 C;  3TW6 A;  2CUE A;  3HB9 A;  1HLV A;  2UXP A;  2DN0 A;  5M3F J;  1AKH A;  4A3M J;  1U8B A;  3Q0W A;  3CRJ A;  4PXI A;  1OFC X;  3LSP A;  2ECB A;  1APL C;  2O7T A;  1Q1V A;  4UDS A;  3G56 A;  1B72 B;  1WH5 A;  2HXO A;  2ZB9 A;  3HEF A;  1RET A;  3FRQ A;  2XB5 A;  2O9L A;  1ENH A;  2NS8 A;  4A3D J;  4JX4 A;  3CWR A;  3CQZ J;  1MBG A;  2M2E A;  2M8G X;  2R5Z B;  2DTZ A;  3LOC A;  1GV2 A;  1IDY A;  2VI6 A;  3IUV A;  3LHQ A;  1JKP C;  3HOV J;  2E2J J;  4GFK A;  2ID6 A;  3QPS A;  2NX4 A;  3ANP A;  1P7J A;  3AQS A;  2WUI A;  4FCY A;  4GCK A;  2NVT J;  5K7H A;  3GTO J;  4DYC A;  2MSY A;  5DTD A;  3TW7 A;  2ZCM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...