4M3BA

Rapid and efficient design of new inhibitors of mycobacterium tuberculosis transcriptional repressor ethr using fragment growing, merging and linking approaches
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
190
structure length
185
Chain Sequence
RELAILATAENLLEDRPLADISVDDLAKGAGISRPTFYFYFPSKEAVLLTLLDRVVNQADMALQTLAEDRENMWRTGINVFFETFGSHKAVTRAGQAARATSVEVAELWSTFMQKWIAYTAAVIDAERDRGAAPRTLPAHELATALNLMNERTLFASFAGEQPSVPEARVLDTLVHIWVTSIYGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator EthR
publication title Ligand Efficiency Driven Design of New Inhibitors of Mycobacterium tuberculosis Transcriptional Repressor EthR Using Fragment Growing, Merging, and Linking Approaches.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription repressor/inhibitor
total genus 79
structure length 185
sequence length 190
ec nomenclature
pdb deposition date 2013-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4m3bA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 4m3bA02
5F08A 4AYBN 5K7FA 4XRSA 3IH4A 3W6VA 2NVXJ 3PASA 4MK6A 2EZHA 2VUMJ 2DG8A 2HDDA 2HOSA 1JTXA 1B72B 4A3CJ 2AO9A 2LK2A 4D7NA 1I50J 2XSDC 5C3EJ 3Q0UA 2XPUA 2YS9A 3ZQIA 3Q3SA 3I4MJ 5E3MA 2YU9J 1IUFA 4AUXA 2EH3A 4DZPA 3P9TA 3BTLA 2ECCA 3TW6A 4I6ZA 5HBUA 4A3EJ 2O9LA 2IBDA 1ZR4A 4B4CA 2I10A 3HEFA 2KDZA 1NTCA 1GV2A 1AU7A 1ORKA 4FISA 2R5ZA 4G12A 4JX4A 2IAIA 4A3GJ 2ZCNA 1O4XA 1IJWC 2NS7A 3V78A 3CRJA 2YVHA 1WH7A 4IHYA 5EFYA 2WGBA 1QPIA 1FIPA 5CXIA 2GUHA 3HGGA 1K83J 4JP0A 1FTTA 5J1YA 1ETQA 3S14J 3VVYA 1IRZA 2EBIA 2EZLA 3RZDJ 4PXIA 1RKTA 1TWGJ 2ID3A 3S17J 2Y0SN 2HI3A 1B72A 3QQAA 1UG2A 2QIBA 2NVQJ 2UXHA 1MBJA 2PMZN 1U78A 1YRNB 2Q24A 1ZGWA 3GTPJ 2XRLA 1GDTA 4BY1J 3S16J 2HXOA 5IPAA 3ANPA 3G56A 1W0UA 5CW8A 2VKVA 1WGXA 4IEJA 1IC8A 2K9NA 1ITYA 1JTYA 3Q0WA 2CUEA 3G1OA 1FIAA 2Y9YA 5K58A 2OPTA 1K61A 3CJDA 2G7SA 1AKHA 2XB0X 2FQ4A 4MLOA 3HOVJ 5FKNA 2V57A 2HOAA 3LNQA 3VP5A 3GEUA 2L9RA 2QWTA 4A93J 1OCPA 4MFDA 4A3FJ 1LE8B 2X9DA 3JRDA 3CMYA 2G0EA 1Z77A 3JRIA 1Y1VJ 4J19A 2DJNA 3G1LA 1UI6A 5AQCA 5M5YJ 4L62A 5IYDJ 5FKKA 2Y9ZA 5J3LA 2M2EA 1WPKA 3TEDA 2GBYA 4S0HB 4FTHA 4M3GA 3E7LA 5EZGA 1WCMJ 2X48A 3KKCA 3K2AA 1YRNA 3BR6A 4BKXA 3JRFA 1MBHA 3BJBA 4FE7A 1JJ8C 4B3AA 4GCKA 1HOMA 1GV5A 2DMUA 3CWRA 2ZB9A 3B6CA 4FE4A 1D5YA 1CQTA 5FLVA 1XG1A 2IEKA 2DA2A 3EUPA 2G7GA 4JYKA 4BBSJ 1QRYA 2D5VA 3S1NJ 4NELA 3RKQA 2AHQA 1H88C 1MSFC 4CYCB 2NOGA 2PZ9A 4XICA 3FISA 4C3IJ 5F0HA 2ZOZA 4W97A 3JRHA 1VF9A 1IDZA 3RZOJ 3OOUA 3CDLA 1ETXA 1JKPC 1BA5A 3BTIA 3PO3J 2JN6A 1FEXA 4BXXJ 4L5EA 5FMPA 3VW1A 4A3IJ 2NP3A 2XPWA 4MO7A 4HKUA 4ICHA 1TWCJ 3HB9A 3GBGA 3MVPA 3E7QA 1JGGA 2JA5J 1SGMA 2REKA 1XS9A 2ZCXA 1TWFJ 3VPRA 3JRCA 1ZR2A 2XPVA 1B8IB 4A3LJ 3NI7A 3HIMA 1I3QJ 1RESA 3LSGA 3LSRA 2O7OA 3VIBA 1UMQA 1ETVA 2XGDA 5GP9A 2L7MP 2L7ZA 2P81A 1HLVA 3K7AJ 3Q0VA 5J1RA 2HYTA 3HTIA 2VPRA 1BW6A 4M3DA 3A03A 5F1JA 1TC3C 2JA8J 5M3FJ 1JJ6C 5E3NA 3COLA 3A02A 3TP3A 1ETWA 5IYBJ 1QVUA 2ELKA 2COBA 2ECBA 3PPBA 3SJMA 3S2HJ 4MFEA 5EGOA 5D18A 5FKLA 5IYCJ 4XIDA 3QPSA 1HF0A 5HAWA 2WV1A 1BW5A 3IV5A 3B6AA 3A01A 1SFOJ 2LKXA 2CJJA 3BT9A 3F1BA 3C07A 2DN0A 2WB1N 4A3KJ 2M8GX 4UUSB 1XC5A 4X6AJ 2CUFA 4Y7NJ 5EG0B 3QKXA 5DAJA 3LSPA 3HTAA 1E3OC 5E3OA 3ZOBA 3G7RA 5HSZA 3GZIA 5DS9A 2LVSA 1B8IA 5GPCA 5M3MJ 4AF5A 2DA3A 2OF7A 3MKLA 3D1NI 5IP7J 3NRGA 5J1UA 3WHCA 2GM4A 3RQIA 4NDLA 4GFKA 4DYQA 3FIWA 2L7FP 2DA7A 3JSJA 3IUVA 3VW2A 1WH5A 1JUMA 3PM1A 3T6NA 5EYRA 2QF7A 4XK4A 5IP9J 1TWAJ 1BL0A 3BG5A 3BTCA 2NVTJ 3EGQA 2UXOA 1VNDA 2DMTA 5D1RA 2RHAA 5FJ8J 3HOZJ 3MNLA 1S7EA 1H89C 1MBKA 2G7LA 3AQSA 5HODA 1ZTRA 3CCYA 1EF4A 3I4NJ 2LP0A 4D5CA 1NK2P 3GTQJ 3S1QJ 1RR7A 1U8BA 1OFCX 3S1MJ 3LOCA 1JKQC 5F0FA 2WAQN 2PBXA 2KT0A 5CXGA 3RD3A 2LFBA 4JL3A 2R93J 1A6IA 1MNMC 2DA6A 4A3BJ 1OJLA 1BJZA 2FX0A 2JA7J 3BR3A 3G1MA 4QSHA 1JKRC 3OSGA 3ZQLA 1UHSA 2R5YB 2NX4A 5H9TA 2ID6A 2K40A 3HOUJ 1ENHA 1GUUA 3VW0A 4M6VA 4GCTA 2N8GA 3HE0A 5D19A 1W0TA 3O60A 1F43A 3KZ9A 1JT6A 2ME6A 3ZQCA 2JA6J 2FBQA 4IHWA 3VVZA 1ETKA 2WUIA 1JUPA 2TCTA 1Y1WJ 5C4YA 1VI0A 2IU5A 4YZEA 5C4JJ 4RBOA 5EF6A 3MN2A 2DA5A 3TW7A 5F0CA 3O8HA 2XDNA 3HOWJ 2B63J 3UKGA 4GFLA 3OSFA 2VKEA 3BR2A 1GVDA 1X58A 2GLOA 4DYRA 3FRQA 3H3VK 4UDSA 5JLWA 4C3JJ 4Y52J 4CGRA 1HDPA 2G3BA 3NARA 1LE8A 3CQZJ 2R0QC 2EZIA 3C2BA 4UUTA 2YVEA 3VOKA 1DU0A 4KWAA 1IG7A 3IH2A 2RAEA 4GCLA 4EEFG 1WI3A 1U9NA 3DEWA 2NVYJ 1RKWA 4AC0A 4B1RA 3JRGA 3S1RJ 4IHXA 4X1EA 3GTLJ 2LR8A 2HXIA 3BQZA 5DTDA 3HOXJ 3JREA 2R5ZB 2JJ7A 3WHBA 2XGCA 5C44J 1UI5A 5E3LA 4NN1A 1POGA 2MGQA 3HTHA 1Q1VA 3PO2J 2QKOA 1X2MA 3ANGA 4CYCA 3KNWA 4MXMA 3HM5A 4QIWN 2HQ5A 4C2MJ 5F27A 1SANA 2JWTA 2M34A 2K9QA 1OCTC 1TWHJ 3HBLA 3GTMJ 2HYJA 1MBEA 3ON4A 4D5FA 3JRBA 1PUFB 3VOXA 1P7IA 3BTJA 2W48A 1IGNA 2OI8A 4ME9A 3ZQGA 5FGLA 4JKZA 2DTZA 2W53A 3VVXA 2F07A 4M3FA 5FKMA 1ZQ3P 3HKZN 3NXCA 3F0CA 4JNNA 3SFIA 2YUSA 2HKUA 2E2IJ 2ZCMA 3BQYA 1MBFA 2M0CA 2E2JJ 1IV6A 1APLC 3IH3A 5M5WJ 2QOPA 1H8AC 1RETA 5GPAA 2LTPA 5IOYA 5FHPA 5FKOA 3TP0A 2MSYA 4M3EA 1AKHB 3ZQFA 2RASA 1T56A 1X2NA 3HGYA 2QCOA 1FTZA 2E1OA 4ABZA 3NNRA 4A3MJ 1MH3A 2Y2ZA 3BR5A 2QTQA 2Y30A 1PUFA 2ZOYA 2L0KA 3LSJA 3OIOA 4DZJA 3H0GJ 4QTRA 3AQTA 3GTJJ 4V2FA 4XRMA 2H1KA 3HTJA 4AC6A 5F04A 1T33A 1ETOA 1F36A 4V2GA 5IP6A 1HDDC 5EDNA 4ACIA 4UUSA 4M3BA 4JX6A 2DMQA 5EG0A 3S2DJ 1Z0XA 2CRGA 4A69C 4IHVA 1QVTA 3BNIA 2ME0A 1ZKGA 2LD5A 3BG9A 4I76A 3KKDA 2Y31A 3BCGA 5M5XJ 4RDUA 3GTKJ 3GTOJ 2D6YA 1I6HJ 3BRUA 3JR9A 2K9SA 2E2HJ 3NAUA 3BG3A 4HNVA 1LFBA 3BR0A 2H8RA 3M3YJ 3VUQA 5EZHA 2DG7A 2MG4A 1MBGA 3QPLA 1MSEC 2EZKA 2CQXA 1LFUP 5C4XJ 1JT0A 2VI6A 1G2HA 2GFNA 3FK6A 4JX5A 1MH4A 2E19A 3V6GA 1U9OA 1ETYA 2FJ1A 3BHQA 2EQRA 9ANTA 3SDGA 4DYCA 3O8GA 4A3JJ 1ZK8A 3GTGJ 4MIMA 4FCYA 2DMPA 2JMWA 4XRSG 3QBMA 2MW8A 5K7HA 1GT0C 3DPJA 3S15J 3FKIJ 2HOTA 3ON2A 1P7JA 2NS8A 4C3HJ 2DA1A 3NPIA 5K7ZA 1R9TJ 2XB5A 1AHDP 1JKOC 1JUSA 2O8KA 3HDDA 2R5YA 2FD5A 2CU7A 2LY9A 5FLMJ 2NP5A 2O7TA 2UXUA 2R92J 2X6OA 3M4OJ 1IDYA 3BR1A 5IOZA 2R7ZJ 2DMNA 1HCRA 2UXPA 5BNGA 4BBRJ 2JK3A 5EGOB 3DCFA 3JRAA 2M9HA 4D7MA 2TRTA 3LHQA 1NK3P 3LWJA 5EEAA 3S5RA 3B81A 1RPWA 3A01B 1DU6A 2OERA 2CQQA 4DW6A 2GENA 2UXIA 2XGEA 3ZQHA 3LJLA 4GFBA 4W1UA 1FJLA 4A3DJ 2DA4A 5JLXA 3L1PA 1A5JA 3HOYJ 4BY7J 3FK7A 3RH2A 4LOCA 2LLKA 1VFCA
chains in the Genus database with same CATH superfamily
4JQFA 5CVRA 5F08A 1R7JA 4AYBA 4AYBN 4XLPF 3KETA 1FPQA 4XRSA 3CMMA 3AL0B 4YELA 2ELJA 2HOSA 1B72B 4A3CJ 2LK2A 2W1OA 5J4YA 3Q9VA 5C3EJ 1TTYA 1ZRCA 3VWBA 2XPUA 3KIOA 4FQGA 2FNAA 1IUFA 3U1KA 4AUXA 2YU9J 4R79A 3PUFA 5CKTA 3P9TA 1LDDA 4BL0B 4XLEA 2O3FA 4I6ZA 1QA6A 2IBDA 2M7BA 3FM3A 4IVNA 1KU9A 1U3EM 2BXYA 2L4AA 2I10A 2BY2A 1NTCA 1GV2A 1U0JA 1L0OC 5FO5A 4EJOA 2ZCNA 2LG4A 5HDGA 5B5EC 2MC3A 3LSKA 4ASNA 5HS8A 1HC8A 2OTJI 4PJNA 4BJTA 2WGBA 4BQAA 1QPIA 5K5RA 2IVMA 1FIPA 5CXIA 3RPQA 1K83J 4PCQA 2ADUA 1FTTA 2H8WA 5J1YA 3VVYA 5DEQA 2EBIA 4I2OA 4ZYDA 4ZDOA 4PXIA 3PUBA 4BE0A 2F5DA 1TWGJ 2ID3A 2L54A 5TISC 1EH7A 2BVMA 3K9TA 4IRHA 3MZ8A 3E5UA 4XNFA 3R6SA 4D9JA 2XHKA 2PJRB 3N05A 4KA4A 1XSXA 1MMAA 3M8JA 2QIBA 2VQLA 5HLHA 3K0LA 2NVQJ 1XN7A 2ZFUA 2R3SA 1WHUA 3S16J 4KFCA 4BY1J 5F64A 5IPAA 1XSVA 3G56A 4OMYA 2JZYA 3IP4B 2LF8A 3J7YJ 2VKVA 5KHDA 4IEJA 3OYAA 3ERED 1IC8A 4CDGA 2K9NA 1VQPI 3EDPA 2CUEA 3G1OA 1FIAA 2Y9YA 2O6GE 5B3SH 1FBQA 5LHHA 2AS5F 3I54A 2HDWA 3HRSA 5FKNA 2DU9A 1MNEA 4HW0A 2R7DA 2KIMA 3HIFA 1OCPA 2X9DA 3S3NA 2G0EA 3QU3A 3C7JA 1YHQI 4BEHA 3A4CA 1Y1VJ 2LC2A 4J19A 5KAFC 1ZG3A 3QP5A 4NB5A 4L62A 5FKKA 3T0YA 3OYKA 5J3LA 4S0HB 3ZMTA 5J8FA 4M3GA 1KA8A 1BR4A 4HF1A 2A2FX 2IT0A 2RN7A 3KKCA 2Q2EA 3QYEA 2OJED 4EVIA 2CV2A 1D0XA 1Y0NA 4HG2A 3CWRA 3B6CA 1D5YA 2DT7B 1TW2A 3EYIA 4HNUA 1XG1A 3CTAA 1RZ4A 1B9NA 1QRYA 1Z05A 3GXOA 5ILSA 3WGHA 1R49A 3S1NJ 4IRVA 4NELA 1K79A 1SD5A 5LGTA 2NOGA 4XICA 3CDIA 3CCVI 1X4OA 2H6BA 2ZOZA 2ISYA 1IDZA 3OOUA 2L2OA 3CDLA 2IA2A 1BA5A 1F4KA 2HYGD 4RB1A 4BQOA 5CPRB 1U5TB 4A0XA 2H6CA 1MMDA 3ZCOA 4G6TB 1FEXA 3WTYC 4BYYA 4BXXJ 2CG4A 3WTXC 3BROA 3HZJA 4AM3A 5JVGF 1UB9A 2DODA 1TWFJ 1F5TA 3MZYA 2V1UA 1LB2A 1B8IB 4A3LJ 2O5RA 3DEEA 3LSRA 2O7OA 1SVMA 4AU7A 3RQ4A 2XGDA 2GAUA 2L7MP 1HLVA 2HYTA 4E7HA 2CH0A 1E3PA 3VYRB 3A03A 4GYGA 5L3FA 2LOOA 3COLA 2Z2SB 3A02A 3RKXA 1ETWA 4XONA 4Y17A 2COBA 2A3SA 4J01A 4KDPA 4NHJA 2CW0F 4JK1X 2DPUA 2EFPA 1WZ2A 3S2HJ 2HTSA 1X3ZB 5IYCJ 2MFZA 3FXMA 4U87A 3JAMZ 1FOXA 3AG2H 3IV5A 1PVEA 3BJAA 4P5OA 1SFOJ 2M87A 1CGPA 2CJJA 1BIAA 3T8TA 4A3KJ 3C07A 1YOVB 3R4KA 2V4JC 4M6YA 1XCBA 1HKTA 5DAJA 3L2CA 2W84A 5D6FA 3LQRA 5E3OA 3NWTA 2XF5A 1UAAA 1VQ6I 3VTIA 2OQRA 5HSZA 3LSMA 2GXBA 2GA2A 3P9KA 2VASA 3QODA 5AIPA 2OF7A 2GOXB 4NUBA 2KISA 3WHCA 2IW5A 4NDLA 4GFKA 2ETHA 2HKOA 2M4GA 3CJRB 4CO8A 1LVAA 3EYYA 4MQVA 5JI6A 4C2UA 4L0YB 2ZJPF 2QF7A 4XK4A 5JVTA 3E5QA 3ZQQA 2R7WA 3BG5A 1BC7C 2KZGA 2DMTA 2UXOA 2KMUA 3AQSA 2R4GA 3CCMI 3PNVA 1ZTRA 1A36A 1RUNA 4IQ4A 1EF4A 3F22A 3I4NJ 3H5RA 3KZZA 2IGMA 2ZSIB 4ITVA 5CJ9A 5HLIA 4GGGA 3TKYA 5CXGA 1MJBA 2LFBA 4OINF 1G4DA 2KFDA 2DA6A 4X0GA 1LQ1A 1R23A 2JA7J 3BR3A 1XGSA 1SMTA 5BS6A 3OYCA 3SXYA 1Z67A 4N9IA 1ZARA 1E17A 2ID6A 2K40A 4M6VA 2N8GA 4M71A 3O60A 4RS8A 2E35A 2QBYB 3ZQCA 2RVCA 2LNBA 2BHYA 3DBRB 4G6DA 3TGNA 4G6QA 5J40A 5LGUA 2Z9OA 3I5UA 2IU5A 4OIPF 5EF6A 3RKWA 3TW7A 3O8HA 1N75A 4UV8A 2RREA 4BE2A 2ISZA 3JTGA 3PSIA 3WGIA 1VQ4I 3ABUA 2HZDA 3S2WA 2X85A 4Y52J 1I27A 4PGHA 2YU3A 2HWVA 4R8HA 1ZRFA 1J7KA 2GXGA 1YI2I 1LE8A 2E7XA 3C2BA 2Y75A 1HSJA 2RC4A 3E6CC 4KWAA 1X1BA 3D5RC 3WU1B 2F4IA 2RAEA 4WF2A 4GCLA 2HZTA 3AAFA 4EEFG 4IHSA 1YTYA 1VQKI 3WG7H 2VPLA 4AC0A 3F6OA 2ZXWH 2VXDA 4BXFA 3JRGA 2VL8A 2BOLA 1E0EA 4IHXA 2MBFA 2GIVA 5E17F 4D1QA 4YEJA 3HOXJ 3EUKL 2EA4A 3JREA 4HF0A 2JJ7A 3WHBA 2XGCA 5L3EA 1FOYA 4XRFA 4LK0F 3U1DA 1POGA 2W82A 2W7NA 3QYBA 1XMKA 4I02A 1U8RA 3KNWA 2KZVA 4QIWN 1BR2A 3PSFA 4C2MJ 3K4JA 1SANA 2CFXA 2K9QA 3HBLA 3OV8A 2HYJA 4D5FA 1I1SA 2FMYA 2W48A 2DOEA 3DBLB 4NC8A 3J80Z 1UZCA 1MNDA 2ZNZA 1XMAA 3K4KA 4NNJA 3ERMA 4U9NA 3LQQA 2YVXA 3HUGA 1R22A 2WV0A 4HV5A 5E8IA 3SYTA 3FMQA 3CF5F 2KIFA 2BE5F 2E2IJ 2ZCMA 2PN6A 1H0MA 2GA1A 3A2KA 2VJIA 1VQLI 3H35A 2X1EA 2XASA 2MSYA 4CSWA 3E6MA 2X4HA 1TNTA 3KEYA 3ZQFA 2DPDA 4G7OF 1X2NA 5H2FC 2C6YA 1JI8A 2E1OA 4XM3A 1JHHA 2Z5UA 2BY1A 4XLFA 4A3MJ 1KGSA 2PQ8A 1REPC 4DBRA 3BZCA 2DAOA 2Y2ZA 4C9YA 3F8FA 1JHFA 2QTQA 3HPGA 2ZOYA 2L0KA 3DFGA 4BEHB 1P2FA 2KKOA 4DZJA 4ZJZA 3W6KB 4XRMA 3E97A 3HTJA 4F7ZA 2EIKH 4PFPA 1ETOA 4V2GA 2VOPA 2NAZA 3KEQA 2VOOA 1KQ9A 4KIFA 5L3GA 3F8BA 1Z0XA 4IHVA 2P6SA 4HZFA 4U0VA 1B59A 2WAFA 3DF8A 4KMUX 2G9WA 3ZP5A 2Q8KA 4I76A 2LD5A 1FOWA 3KKDA 3BCGA 1MMNA 4RDUA 2DYSH 3BWGA 2XF7A 3SHFA 4HDUA 2ZY9A 3NAUA 3IKTA 4CICA 2M30A 3SWHA 3LAJA 3MD2A 2IA0A 3S8PA 3I64A 4HLXA 1DP7P 3L2WA 2X6XA 4DIQA 3COAC 2CQXA 2X6YA 1JT0A 3WTSC 1JE8A 1DPRA 2E19A 4U7DA 1U9OA 1ETYA 2FJ1A 5E8GA 3V6GA 1FBUA 2IS4A 9ANTA 3O8GA 5J6XA 2VBXA 4QPQA 4CCOA 1QPMA 3GTGJ 4FCYA 3V8JA 2RKHA 4E7LA 2JMWA 3QBMA 2MW8A 3I55I 2ZBKA 3U2RA 1K6YA 3H36A 3DPJA 3FKIJ 2HOTA 2F6CA 4DNCA 2NS8A 3G73A 5TRDA 2B1EA 1IW7F 1D1CA 3FMRA 3JW4A 2P7VB 2FJI1 4BU2A 1Z7UA 3E1SA 5JHUA 4ESJA 1JKOC 2MLGA 4R1HA 1JUSA 2GZWA 4ZC3A 2R5YA 1T39A 1QGPA 2CU7A 3FX3A 1ZLKA 1DQUA 3BPXA 3M4OJ 2OC6A 3RYRA 2DMNA 1HCRA 2CMPA 2K5CA 2G7HA 5L3CA 1ZELA 2M9HA 4D7MA 3LWJA 2E7WA 3IAM2 5GAHJ 5EEAA 3L2UA 1DUXC 3B81A 4UHTA 2OERA 4DW6A 3GZNB 1A6QA 2VT2A 5TJJA 4GFBA 1G3WA 1TW3A 2X0LA 1FJLA 5JLXA 3FXLA 3IKVA 4BY7J 4LD5A 3FK7A 3RH2A 3ABTA 2LLKA 1OCZH 1QHGA 1TBXA 2Z33A 5K7FA 1B6AA 3W6VA 3VDXA 2NVXJ 5HNHA 1FC3A 1GHCA 4MQ9F 2FA5A 4BJ6C 5D5VB 1JTXA 2GXAA 1I50J 3OYBA 3ZPLA 3IWFA 2XSDC 1LJ9A 1Y39A 4C2TA 2H94A 2EH3A 4OAZA 3V8KA 5F1RA 3HTSB 2UZKA 4HQMA 6PAXA 5HBUA 1IRXA 2O9LA 1OCCH 4HOBA 4XLNF 2X1CA 2DO7A 2MLKA 3WU0A 2W25A 2KDZA 5E18F 2A07F 1E2XA 3TDUC 3X2QH 2XAQA 4M9SA 4AVZA 2IAIA 4BE1A 4A3GJ 1SFEA 4AWXB 2MH2A 4Y13A 3DPLC 1O4XA 3K4MA 1IJWC 2STTA 1WH7A 1GLNA 1Z6RA 2DFIA 4XR6A 1ZAOA 2D2WA 2GUHA 3HGGA 3T5XA 4BH9A 1ETQA 3ZGKA 2A5WA 3AFHA 2D1VA 3RZDJ 3MEXA 1RKTA 1BI2A 1KZHA 4NC6A 3S17J 1B1BA 2EINH 2VXZA 5H6RA 2V1XA 3QQAA 1XDSA 2Z99A 3I4PA 3FDYA 4EM1A 2QEXI 4HSRA 3AG4H 3IAS2 2A05A 4PJLA 1U2WA 3WODF 1LDJA 4RM3A 3K4CA 2PMZA 1MBJA 2PMZN 4I7HA 1U78A 3F23A 1OR7C 1STZA 1ZGWA 4KNYA 2HXOA 1VQNI 1G3SA 4C30A 4CCMA 2LKSA 1IXSB 2IA1A 2VE9A 2Q0OA 1JTYA 3Q0WA 4LLGF 5D8LB 4AIDA 5E20A 2VE8A 2FU4A 4PJMA 2OPTA 5IY5H 1K61A 1N25A 2GQQA 1KQ8A 3HSRA 1AKHA 4ESBA 2XB0X 3HOVJ 2VQCA 2V57A 2HOAA 3LNQA 4HBLA 1S72I 2BY0A 2L9RA 4A93J 4A3FJ 1LE8B 4G94A 1NH3A 4MEYF 3LL7A 1UI6A 3G1LA 3WTWC 1ACIA 1PDNC 2R7FA 5EZGA 4AD9A 2VB6A 3FKJA 4B43A 3K2AA 3TQNA 5LD2C 1YRNA 4Q5SF 4BKXA 4FE7A 4XSZF 1O3QA 2J5PA 4PGGA 2WADA 1QZEA 2B0LA 2HQNA 2ZB9A 4E4HA 4YIIA 1T0FC 4ZYGA 5DDGA 2IEKA 3DP7A 4BBSJ 2D5VA 2AHQA 1H88C 1MSFC 3LFUA 3P9IA 3GZ6A 4W97A 1XMXA 1ZGJA 1WI9A 2HPMA 2DDBA 1YIOA 2KRHA 3DEUA 2KLOA 4UY8I 4D0PA 2F48A 3PO3J 1VQ7I 3PFIA 4Y3OA 3VW1A 1FYMA 2HKXA 5DCMA 3HUGB 1HXDA 4MO7A 4E7KA 1Z9CA 2CV0A 3ZN1A 1R00A 4ENKA 3GX4X 3L7WA 1XS9A 2A6TA 2I8DA 2W57A 2ACJA 1DGWY 2XAHA 1J9IA 3NI7A 2KRFA 3HIMA 4IX7A 1UMQA 2K85A 4L9JA 3V7CA 1ETVA 5GP9A 2L7ZA 2V9VA 5J1RA 2P7CB 4BUPA 2VPRA 1BW6A 1TC3C 4HLYA 1JJ6C 2K4BA 3F8CA 4A6DA 1OYYA 2KHMA 4II2A 4LITA 5EJCA 5GTIC 1YS6A 1QVUA 1N77A 2ECBA 5EGOA 5D18A 2EA2A 5FKLA 2E60A 3GFLA 4XIDA 1FYKA 5GTHC 4ESFA 2VKHA 1BJAA 1VQ5I 4JBAA 3B6AA 3A01A 2BW3A 3QRFF 2CV1A 5LRRA 3WTTC 1JXSA 4X6AJ 2CUFA 4Y7NJ 3QKXA 4IKFA 3WE2A 3KP5A 2KJCA 3G7RA 2LRDA 4WIBA 2FNPA 3L2VA 3KYDB 3FXKA 1W7PD 2LVSA 4DVYP 1Z91A 1S3JA 5HDNA 4AF5A 2QSFX 4IF4A 1R71A 2AQEA 5IT9Z 5IP7J 3NRGA 5J1UA 2XF6A 2KP6A 5JFRA 1R5ID 3GW2A 3ZMSA 3VYTB 2L7FP 2DA7A 1XGOA 2FBIA 2HOEA 4N4OB 1WH5A 2O8XA 3FF5A 1JUMA 3PM1A 5EYRA 4MGRA 2W00A 1W36C 1CF7A 1TWAJ 3I53A 3D5SC 3VODA 2NVTJ 3GF2A 4HA8A 3E6DA 1VNDA 2EPFA 1BC8C 2RHAA 5FJ8J 3HOZJ 5D1RA 1H89C 1MBKA 1YO5C 4HYEA 5LGNA 2CQ7A 4OOIA 4BXUA 3CCUI 1R1TA 1W7PA 1NG6A 4RMNA 1YG2A 4D5CA 3GTQJ 3S1QJ 1TT0A 4KT5C 1V55H 3S1MJ 3I56I 4A12A 2K9LA 4F55A 2WAQA 2WAQN 3ZMUA 2KT0A 3U9GA 4AIKA 3T8RA 4IQJA 3O3KA 1A6IA 2OQGA 1S29A 2WAEA 1OJLA 1BJZA 2FX0A 4A3BJ 3G1MA 1JKRC 3VOEA 3OSGA 3ZQLA 2NXNB 2RDPA 1P92A 1UHSA 4P96A 3W2VA 4KT6A 3T1BA 2R5YB 5FRMA 4U9LA 1ENHA 4CZZA 3H9GA 4LMYA 5B1BH 4Q48A 1YJNI 5D19A 3OIPA 1O7FA 3LA7A 2IGOA 2WY8Q 3DTIA 4PDKA 4PZJA 4F3QA 3EUHC 1JT6A 4PSXA 3KZ9A 5DUKA 2OCEA 3IC7A 5EEHA 4B09A 4CCLA 1R58A 1EV7A 5CVIA 3CCJI 4ZYHA 2WBMA 4A0ZA 4FX0A 2TCTA 3BDDA 2IS1A 3P7NA 4YZEA 1X1PA 2NNNA 1FT9A 2EJRA 3CP8A 1WJBA 2DA5A 3RDIA 2CWEA 2WC2A 3ECHA 4L5JA 2P5VA 3VEPA 4HDVA 3UKGA 4GFLA 3LFKA 3CCEI 3BR2A 4P9FA 1GVDA 2GLOA 3FRQA 3H3VK 3J81Z 4HSTA 3C18A 4RB2C 4C3JJ 1MJAA 3LA2A 3NARA 3AL0C 3CQZJ 3HXLA 1WSUA 2YVEA 3TOAA 3BZ6A 4KIBA 1DU0A 1IG7A 5FROA 2XVCA 3ONQA 1WI3A 3DEWA 2NVYJ 3KE2A 2EB7A 1D8KA 4B1RA 3H9JA 1OR7A 3J81K 3E6BA 5FD6A 1V5GA 1SVOA 2PMHA 1USSA 2HXIA 1IF1A 5DTDA 1Z7LA 2ZFWA 4IL6C 5LHGA 5C44J 2QZ8A 2R7RA 1UI5A 1WFXA 4NN1A 3TO9A 1RUOA 5CQGA 1VQ8I 3PO2J 2XUBA 3HTHA 4MXMA 4E7IA 3BC8A 3BY6A 2HQ5A 5F27A 5LLQA 2M34A 1OCTC 3CUOA 1MBEA 3K1PA 3ON4A 5HVQC 3JRBA 3RCOA 2DW4A 1YJ9I 1KQ0A 3TO7A 3VOXA 1IGNA 4RA2A 2F4MB 4LGWA 3H5AA 2F07A 3ASNH 3HKZA 3IRQA 1Y8RB 1FBSA 2QYOA 3F0CA 3HKZN 4BACA 4NBQA 5ICFA 4UB8C 1GXPA 2YUSA 2A6EF 2VBZA 5CLSA 2JSCA 2FUG2 1OYWA 1MBFA 2F5FA 4YIFA 5HS7A 2L9VA 2E2JJ 3H3UA 3FXOA 1IV6A 4HEA2 1APLC 5LBQA 1IN7A 1LEBA 4OWRB 1FLIA 3JAMK 3EPZA 1USTA 3D5LA 1T0FA 2TDXA 5GPAA 3G71I 2LTPA 5B66C 3SFZA 4J00A 5H20A 5DM6F 3TP0A 3MQ0A 1AKHB 2GOMA 4EMSA 4WX9A 4E7JA 2OTLI 2QQ9A 5DUIA 2DJIA 3PJRA 4ABZA 2E36A 3NNRA 2EV6A 1D0ZA 2QGUA 4MNUA 4F93B 1FMWA 4KIGA 1ZN2A 1PUFA 3CC2I 3SZTA 3FBIB 4P55A 4A6EA 4QTRA 2F5EA 2EIJH 4V2FA 1QZYA 3M07A 5DCFA 1WWXA 1F36A 1TQPA 4QLCU 4XLCA 5IP6A 5EDNA 1HDDC 2BGCA 4ZZDA 4JX6A 5A2QZ 3HHGA 5EG0A 3WTZA 2UXXA 4A69C 3OYHA 4UNOA 1ON2A 4ZTFA 2ME0A 3FXJA 2V9KA 2K27A 4L5IA 3F8MA 4FETA 3GTOJ 2ZNYA 2M8EA 4RGUA 2LSOA 2EFOA 3BR0A 2V1DA 2M5WA 3WE3A 3EETA 4E6KG 5A2QK 1RIOH 3VUQA 1WJ5A 3E3VA 3FM5A 1RR8C 2V79A 3K4NA 5HLTA 2MA3A 1YW7A 1MBGA 1UHWA 2DOAA 4O3MA 5J8CA 3WTVC 1J75A 3ZN0A 3CCSI 3CCQI 1SD7A 3C1DA 2GFNA 1MH4A 1J59A 5EEGA 1HA8A 1BI3A 1W36D 4KITB 2QENA 3H3ZA 3KEOA 4KN4X 3ESWB 1I1GA 1FMVA 5K7HA 1UG0A 1VQ9I 2F2EA 1UELB 2XV4S 4NQWA 3OYIA 3NPIA 2Q1ZB 4KISA 4B47A 3L09A 2XB5A 1AHDP 2ZMEC 1AWCA 4LG3A 3FMSA 4RB0A 1TL8A 2FD5A 2H09A 1LVKA 2CS3A 4BDYA 3E5XA 1QO0D 1W5CC 4OAYA 1C0WA 2X6OA 2FSWA 2BXZA 1IDYA 3BR1A 2AXTC 1IXCA 2ESNA 1ZH5A 1FNNA 5EGOB 2JK3A 1A35A 3DCFA 3PL8A 2UUZA 4Y15A 2E34A 4Q4ZF 2QWWA 4RAGA 3A01B 4L9TA 2IS2A 2UXIA 4EATA 2PI0A 2XGEA 3ZQHA 1HW5A 3OYMA 3LJLA 1T08B 3W3CA 2DA4A 3ZQ7A 1A5JA 3HOYJ 2LF7A 5K5OA 3HYIA 1X1AA 3JSPA 1IAWA 3K69A 3IH4A 3PASA 4EGYA 2EZHA 3BPVA 3OS1A 2D45A 1N78A 2YPRA 2HDDA 2DG8A 4HX7A 4G8XA 4ENMA 1S5LC 4D7NA 3DTKA 3MCZA 1TLHB 1WKMA 3Q0UA 2YS9A 3ZQIA 3I4MJ 4EJUA 4G9YA 5E3MA 2IRFG 2UXNA 3ZXSA 4DZPA 1P9QC 3BTLA 2ECCA 3EUHA 2DT6A 3TW6A 2R7QA 4EM0B 4A3EJ 1CF7B 2EFWA 1QBJA 2IS6A 2W24A 1LEAA 3K10A 4B4CA 2RV8A 3ABMH 3LSTA 3J80K 1ZR4A 1K4TA 2X51A 3DU6A 5ILVA 1AU7A 4L18B 4G12A 4IRGA 1FOKA 4FT8A 3J7AY 3DPTA 2M3AA 2HQAA 3BG7A 3RI4A 1W7PB 3V78A 3CRJA 2E1NA 3SEQA 3PQJA 5EFYA 2CW8A 3QOEA 4Q47A 4LB5A 4LLNA 1OMIA 3BP8A 4LIUA 2VQGA 5CVVA 2EZLA 3M7GA 2PBIA 1S7AA 5LFAA 5L3BA 4HX4A 4A5NA 2Y0SA 3B73A 2Y0SN 2HI3A 3CUQC 4ZDLA 4FASD 2F5CA 1B72A 1HW1A 4B3XA 2JPCA 2MABA 2FXAA 3H9QA 4IPAA 4FHTA 3V42A 4ANJA 3S3MA 3I0TA 2OCCH 2DFFA 4XN0A 2Q2EB 2Q24A 3G2BA 3ANPA 1Z21A 3LWFA 1VTNC 3QYFA 2K3FA 5CW8A 3P9CA 2LBFA 4YFNF 1ITYA 3ISPA 5K58A 1ZRDA 3CJDA 5GAEJ 1ERDA 3KP7A 3W6JB 1O57A 2XAGA 4BNCA 2G7SA 1L3LA 4MLOA 2MD0A 4I0AA 1YITI 3GEUA 3OS0A 1LPQA 1DP3A 5AIQA 2P5LC 1R36A 2YX4A 4MFDA 2PFBA 5DM7F 3DKWA 4CA0A 3CMYA 1Y6IA 1Z77A 3JRIA 2O61A 4IHTA 2FMLA 2PJRA 5IYDJ 2Y9ZA 5KVRA 2M2EA 1S8NA 3TEDA 2GBYA 3HG9A 4AVPA 1WCMJ 2LREA 2X48A 2E71A 1OCOH 1R4MB 3BJBA 1MBHA 3V4GA 3H5NA 1OLTA 4GCKA 2KPMA 2DMUA 2IGKA 3V7SA 4FE4A 4F52A 2RNJA 5FLVA 1O7LA 1JGSA 2PMUA 1W5SA 3BJOA 2DLLA 3KP4A 2PZ9A 3FISA 3HJEA 2QQ8A 5F0HA 2JVHA 2RNGA 4XN3A 3JRHA 2QA4I 3R60A 1ETXA 2STWA 2DTRA 2QUFA 2DBBA 2IPQX 1BN5A 2BZTA 2JN6A 4GXOA 1ON1A 4II3A 5D8KB 2UV1A 2L7KA 2K7LA 2EFNA 1FY7A 3CLOA 2A6HF 4L5EA 1WJDA 2ZXJA 5DD8A 2QSGX 4HV6A 2QLZA 4A3IJ 1D8JA 3BJ6A 2HTJA 2HDCA 3CJTB 3E7QA 2KQRA 1UHMA 1W1WE 2IGNA 3N4MA 4XORA 1JGGA 2JA5J 2REKA 2ZCXA 2HNHA 3VPRA 3VSLA 4YFKF 3JRCA 4UXNA 1ZR2A 4XLAA 2XPVA 1BR1A 3CC4I 2E1MB 5CQEA 1Y0UA 1I3QJ 1PYVA 1RESA 1YLFA 2EIMH 4PJ0C 1Q1HA 3CO6C 3MFKA 5BPIA 2R7XA 4BS9A 2LY2A 2XSJC 3Q0VA 3HSEA 3UNGC 5F1JA 3LA3A 1S6LA 4CZCA 2DK5A 1MDMA 3TP3A 5D6EA 5ED4A 2ZJ2A 5IYBJ 1ULYA 4G7HF 2D1HA 2ELKA 3PPBA 3JCUC 2A68F 4MFEA 1HF0A 2W85A 3ZRGA 2K3PA 2XAFA 1IN8A 4UVBA 1YIJI 2A61A 1BW5A 5HAWA 3OS2A 2MH9A 1WJAA 4L0ZB 2M7AA 2OZ6A 2KJBA 4P1WA 3F1BA 1ZYRF 1XGMA 2DN0A 5TGTA 1SC7A 2M8GX 4L9NA 1XC5A 2L3DA 5FD5A 4OD4A 5EG0B 2JUGA 1QZZA 4O6JA 4RM2A 1E3OC 3ZOBA 4P9UA 3GZIA 3CESA 1B8IA 1E3HA 1FWZA 3M1EA 1ZG1A 1MMGA 4BJ5C 3J7AO 2VONA 2DA3A 2ZMEA 1T8IA 3MKLA 3D1NI 1BIBA 5D4RA 2GM4A 1D0YA 2J5OA 2HQRA 4DYQA 2DK8A 3FIWA 2WA0A 1QU3A 4F92B 1J2XA 3IUVA 3BCBA 3TOBA 1G3YA 4EJTA 5IP9J 2WWYA 1D5VA 4M6XA 4ZYAA 3EGQA 1I3AA 5CVUA 5LRSA 1S7EA 4IXAA 3SEZA 2G7LA 2L9SA 3OL4A 1K78A 3CF2A 1SFUA 3CMAI 5HODA 2R7TA 3CCYA 2DCEA 4QPOA 4OIRF 1ZG5A 1NK2P 3FHNA 1V5EA 4KJZA 5E1ZB 1OFCX 1Z6TA 3R61A 3ULQB 2E5NA 3LOCA 3KYCB 2ZJQF 5F0FA 4MHGA 3KZYA 1PJRA 3RD3A 4ON0A 4JL3A 3VSKA 1MNMC 2E1CA 3KP3A 2RQPA 3DXJF 2CQKA 1XPXA 1WJCA 5H9TA 2NX4A 1J0RA 3KLOA 2JRTA 4RAZA 4XL9A 3HOUJ 1GUUA 3VW0A 3OYEA 3I59A 4GCTA 1BBYA 1W0TA 4XOPA 1F43A 5D5WB 1IRFA 1YS7A 2JA6J 1P4XA 2K86A 4IHWA 4EGZA 5KCMA 3PIOF 2O03A 1XDUA 4LLLA 4PFOA 2HPIA 1DPUA 3ROUA 5GADJ 1D1BA 3WG9A 5C4JJ 2R7UA 3MN2A 1VZ0A 3QPHA 1ODDA 3CJQB 5F0CA 3S32A 3HOWJ 3OOPA 3LSIA 3OSFA 3UR3C 2VKEA 4BHPA 1X19A 3WTUC 4DYRA 3C2HA 3OYJA 4UDSA 5K5QA 2O0YA 1J5YA 5JLWA 4RLQA 4RGRA 2PLYA 2R0QC 4AIJA 2EZIA 2WY7Q 4S05A 3DU5A 5FFXA 3CUQA 3HRUA 4HNTA 1SFKA 3IH2A 4PK4A 2YSRA 3KYLA 2QSHX 3M8FA 3V7RA 3HHHA 1O3RA 3S3OA 1MKMA 5HOOA 2QM3A 1X1CA 5ILUA 2OU2A 3GTLJ 3HOTA 1IN4A 2LR8A 1R5GA 1EH6A 1FSEA 4YRVA 1Z3YA 2XKOA 3BOQA 2FBKA 3OR2C 5E3LA 3DLAA 1YW8A 4Z6YA 2KIQA 3FHZA 2BY3A 1TP4A 2Y48A 5BQTA 1X2MA 4WCGA 4CYCA 1MJ9A 5HLGA 3GTMJ 3CMEI 2K4JA 1WJEA 1PP8F 4MTDA 2COMA 3VYUB 2OI8A 4ME9A 4C2MA 3NQOA 3TDZC 3JTHA 2Z16A 4CXFA 5FGLA 4I09A 4JKZA 5ICCA 1FP2A 2DTZA 4PUSA 4YIRX 3VVXA 2IP2A 2YX7A 2FOWA 5KK1A 4M3FA 5FKMA 4JNNA 1YJWI 4RGXA 2BV6A 2R7SA 1WVRA 3DLLF 2VBYA 3OYNA 2BBYA 1R1VA 2FF4A 3HC7A 3BQYA 3ZMVA 3GVAA 3K2ZA 3C2GA 1U6GA 3VYSB 3U21A 1G6NA 3IH3A 2W4SA 2DI3A 3RSNA 1HW2A 5M5WJ 2Z3YA 3E0JB 1H8AC 2LBFB 5E79C 1V4RA 2CGPA 2AQFA 1D1AA 2RQQA 5FKOA 4M3EA 4FX4A 1KYWA 4O5VA 2JA2A 2QCOA 3HOSA 1VQMI 2ZSHB 1FTZA 4M73A 1FYLA 2XGXA 3DBHB 3CD6I 1MH3A 5BOXA 3HL2A 1EJ9A 1LNWA 2Y30A 1F9NA 3Q9SA 3R0AA 1XCVA 3LSJA 3CC7I 3AQTA 5IT9K 3GTJJ 3IWZA 3GCMA 1F1ZA 4B8XA 5KAIC 1ZGAA 2DT5A 3K4BA 3ASOH 4UUSA 2DMQA 5D5XB 3S2DJ 1SFXA 3I71A 2XIGA 2CRGA 3GEZA 4QWQA 2OBPA 4KUMA 3BNIA 4BQQA 1ZKGA 3DV8A 3WU2C 3M8EA 4I98B 4IO9F 2DQLA 2Y31A 2L02A 3GTKJ 4ZDPA 2D6YA 4HRIA 2FE3A 1I6HJ 3K4LA 3OR1C 3OYLA 3JR9A 2VODA 2K9SA 2E2HJ 1Y8QB 1V5FA 4HNVA 3CLQA 4U0YA 3M3YJ 3CO7C 3MKWB 5EZHA 2MG4A 2VJ5A 4CCKA 2BYVE 3QPLA 2JT1A 5C4XJ 1LFUP 2LY1A 3F8NA 4KICA 3FK6A 3DKYA 2JTVA 1IUYA 4F91B 2HYFA 2VC1A 4DYCA 4A3JJ 1P4AA 4WK8F 1ZK8A 3L00A 4MIMA 3A0HC 4XRSG 1GT0C 4EQQA 2MD5A 3S15J 3GLLA 1TT5B 3HTUA 3AG3H 3F9KA 2OV7A 3R0JA 2CUJA 4YFXF 5E1WA 3JSOA 1RI7A 5K7ZA 2QVOA 1YFHA 3RIRA 3FWEA 3RTRA 4XKCA 3I3LA 3V8LA 2VLAA 2O8KA 3HDDA 2LYCA 3GZ5A 2XC7A 4CGZA 2LY9A 3VFZA 2XDVA 1TNSA 1OQYA 2CQNA 1IRGA 1MDMB 2R92J 4EV0A 3PFYA 3ABLH 4Y33A 1V3FA 2UXPA 3I9V2 4RAFA 3RPUD 4BBRJ 4IJAA 3FZVA 2TRTA 4OU0A 4XOTA 3LHQA 1IXRC 4HQEA 1NK3P 4ENJA 3F3XA 3S5RA 1W5TA 1MD0A 1RPWA 3GYHX 2HGCA 2CQQA 2NYXA 3IL2A 1IO2A 1OPCA 1K4SA 1GVJA 4CCJA 4W1UA 1SD6A 3L1PA 1XX5A 5GAGJ 3ZQGA 1VFCA 3K1MA 3KPHA 1G59A 4WWCA 2E5ZA 2QKMB 2L4MA 4BGDA 4OIQF 4LFUA 1LUJB 2NRAC 4MK6A 3MWMA 2VUMJ 1BOBA 2ZC2A 2ZMEB 2AO9A 2AXLA 2DFHA 3RPUA 3Q3SA 3TBIA 4M9ZA 3EQLF 1VQOI 3MKYB 3ZMDA 2R7OA 4WXDA 3IUOA 2ESHA 1B4AA 1XGNA 4IZZA 2M4KA 3HEFA 4EJWA 3W2WA 5HNFA 2V26A 2P5KA 1ORKA 4FISA 2R5ZA 4KN7X 4JX4A 1G8XA 2IJLA 1K78B 3S93A 2KIUA 3BLYA 5ICGA 3O6BB 5HS9A 2LH9A 2NS7A 1EH8A 2NS0A 2YVHA 2Z1DA 4IHYA 2FOKA 4A2UA 4M9XA 2JQ7A 4JP0A 1WJFA 3KZIC 3S14J 1EKEA 2JSPA 1IRZA 1T2KA 3SQNA 3IRRA 5FLXZ 3PNTA 4U0WA 3GFJA 2EK5A 3WGGA 1GXQA 1DGRM 1UG2A 3I59B 4XLHA 2M45A 2Y0MA 5CVJA 2UXHA 2V7FA 1D3YA 4K2EA 2UWMA 1YRNB 3GTPJ 2XRLA 4N0BA 1GDTA 2MYSA 5F6FA 4ZYEA 1W0UA 1V54H 3KX2A 5FLXK 1TQIA 1WGXA 2CUZA 2EWNA 3KP6A 1IN5A 1R6RA 1FP1D 3CDHA 2YR2A 2H1LA 2FQ4A 5IT3A 3VP5A 1LFPA 1BI1A 2QWTA 2A69F 1KU3A 3JRDA 2P8TA 1M1EB 1U5TC 4BAYA 5H6QA 3CUQB 2PEXA 5DCMB 2DJNA 4IOCF 5AQCA 5M5YJ 2KL4A 3QP6A 5FFZA 4M72A 1AA7A 1SAUA 2PG4A 4HAMA 3H1CA 2BHZA 1WPKA 1ONVA 4FTHA 1ZREA 3E7LA 4MTEA 1J09A 4LIVA 1Z3XA 2ZO4A 3HRTA 4LK1F 3P5JA 3BR6A 3JRFA 1TQMA 2ICWG 2L01A 3ZR8X 4OD5A 1JJ8C 1X4PA 4B3AA 3KFWX 1HOMA 1GV5A 4LG0A 1QQIA 3ECOA 3QU6A 2PX9A 4G7ZF 2DXIA 1CQTA 1SMYF 2DA2A 2FRHA 2G7GA 3EUPA 4JYKA 2XAUA 3W2AA 2K9MA 3RKQA 3DQVC 4CYCB 1MIJA 4C3IJ 2JUCA 2KRCA 1MW7A 1VF9A 3RZOJ 3DKXA 1BI0A 2GIZA 1JKPC 4GDFA 4YG2F 3BTIA 1YE9A 1FX7A 4NC7A 4TV7A 2VKDA 2OA4A 5D5UB 3OYDA 3BZKA 2BW3B 1LKXA 4ZTJA 5DV5A 3LSHA 3OY9A 5FMPA 3L9FA 4RLFA 4ENNA 4HKUA 2B7EA 2XPWA 4U7BA 2NP3A 4ICHA 1TWCJ 3HB9A 3MMYB 3GBGA 1MZBA 3MVPA 2CFOA 1SGMA 2HVSA 2NVUB 1XB4A 4RB3C 2P6TA 2GWRA 2DFEA 2ZCWA 2EFQA 4A5MA 4E7ZA 3DPUA 3LSGA 4I99C 2FBHA 3VIBA 1LDKB 2P81A 2OD5A 3C3WA 1QHHD 3K7AJ 1O3SA 3HTIA 4M3DA 4MEXF 3L2RA 3NWSA 2BVLA 2JA8J 3GLXA 5M3FJ 5E3NA 1O3TA 5ERIA 2V6EA 4XSXF 3EUAA 1G3TA 3SJMA 2OZUA 2VJ4A 5DD4A 1ZLJA 1YW9A 3SZPA 3QPSA 4BHCA 1H9TA 2WV1A 3I58A 1P4WA 3K6GA 2ZXHA 3GMEA 2LKXA 1HKQA 2WB1A 3BT9A 2WB1N 3AKZA 4BHBA 1RNLA 1R1UA 2A5YB 1IZ1A 4EJVA 4UUSB 1KYZA 1WQ2A 2HFHA 1W4MA 3LSPA 3HTAA 1OKRA 3D0SA 4GO1A 3ML6A 4XQFA 1UJ8A 5DS9A 3GFIA 5GPCA 2EV0A 5J47A 5K1YA 5M3MJ 3LMMA 3NRVA 4RAYA 1A04A 1HBXG 5CYVA 2ZKZA 1R4NB 2JVGA 3RQIA 1A31A 1XTAA 3JSJA 3O2PE 4RGSA 2HVRA 4DGWB 3VW2A 1ZHFA 3T6NA 4V19K 4U88A 1K7AA 2LKPA 3F21A 2XAJA 1BL0A 3BTCA 1I5ZA 3CCRI 4BQNA 2DOFA 3MNLA 3SZGA 2FEZA 5AONA 2LP0A 2CYYA 4IRIA 1RR7A 1U8BA 2L5QA 2M1BA 1JKQC 3K70C 4H4KC 4HX8A 1S7OA 2PBXA 1B9MA 1AOYA 2F4OB 1Y56A 4Y4RA 2R93J 1I6XA 4I0BA 4QSHA 4CCNA 3HPHA 1FSHA 5ICEA 1H9GA 2OUMA 4H0EA 2QKLB 1P6RA 1MMSA 5B1AH 2XRNA 4E70A 1R5HA 3HE0A 3PNYA 1KONA 2F5VA 2ME6A 1RC9A 2FBQA 4ZH4F 1T95A 2WTEA 3OMYA 4LB6B 4BDZA 1ETKA 3VVZA 2WUIA 1JUPA 3PIPF 2DDAA 2L9NA 1Y1WJ 5C4YA 1VI0A 3KCCA 4RBOA 1HKSA 4N9HA 3FXUA 4B44A 5LEJA 2XDNA 1S9HA 3GFMA 1OYIA 2VJJA 3HSFA 2B63J 3K1NA 3A1YA 1X58A 4HPQA 4N4NB 2HS5A 2CO5A 2CW7A 2HU9A 1T98A 2HVQA 3FXRA 3G4SI 4CGRA 1HDPA 4EM2A 3KLNA 2G3BA 3FBNB 3N97A 4UUTA 3VOKA 1TZLA 2X1DA 4ZZLA 3TMOA 2CSOA 3LAPA 5BMZA 2FQ3A 2LMDA 3NS4A 3PQKA 3B02A 4DJAA 1U9NA 4XKVA 1RKWA 3L2QA 3TL4X 2M0MA 4B48A 4S04A 1PUEE 3S1RJ 4X1EA 1K6OA 1BOAA 2XKPA 2R7VA 3AG1H 3BQZA 3OYFA 4DOZA 2R5ZB 3H0DA 2VN2A 1KU2A 4CYDA 3ELKA 2DQRA 3OYGA 2MC4A 1QNTA 3BCAA 4DBQA 2MGQA 1Q1VA 2QKOA 3ANGA 4JOMA 1UFMA 5FGMA 3HM5A 3F6VA 4XBFA 2KDOA 2JWTA 1BM9A 1TWHJ 4CHUA 1PUFB 4XKBA 2HR3A 1P7IA 3BTJA 3RYPA 2NNYA 1NG7A 3MZHA 5LHIA 1U5TA 5FB2A 4GCVA 4OMZA 2W53A 2VQHA 3OWTA 1HSTA 5JHFA 3Q5FA 3A0BC 1ZQ3P 3NXCA 1OISA 3SFIA 4GYIA 3RJPA 1YX3A 3F72A 2HKUA 3DTEA 2RGVA 2M0CA 1T38A 4IOAF 1SVLA 3OL3A 4E7SA 3RKYA 4AIHA 2NOJB 3M1CA 2QOPA 3REOA 1RETA 1RRJA 3GUDA 3ABKH 5DYMA 5IOYA 1XSDA 1SEUA 3GO5A 1PP7U 4CH7A 3FXQA 5FHPA 1YYVA 3QAHA 1EA3A 3TO6A 2K02A 2V6CA 2I5UA 2RASA 2VC0A 1T56A 2Y69H 4CUGA 4OIOF 1FZPB 3HGYA 1DDNA 1IV8A 1UCRA 4GRIA 3CCLI 3BR5A 1SAXA 4UVAA 3NEUA 3OIOA 3H0GJ 4KYWA 2ELHA 4ETSA 5HDKA 2P4WA 4WXCA 4HF2A 2XROA 1OCRH 2H1KA 2DYRH 4AC6A 3KP2A 5F04A 1T33A 2P0WA 5KNLA 4ACIA 3SDBA 2V1NA 4M3BA 2PFVA 4PSWA 1YQAA 1Z1DA 2BEOA 1QVTA 1X3UA 2IXSA 1SD4A 4NQWB 4LG0B 1YX5A 5J4VA 3BG9A 2JRMA 5M5XJ 3IHUA 3BRUA 2OAZA 4L9VA 2VT3A 3BG3A 2X6WA 3H92A 1LFBA 1HQCA 2H8RA 3CP2A 3CJNA 4DQ2A 2DG7A 4Z2YA 4UB6C 4PJJA 1MSEC 3K8PC 2EZKA 3DWLE 2VI6A 2QQBA 1G2HA 3QPTA 4XMYA 4JX5A 3QWLA 3BHQA 4XKWA 2VIXA 3MAJA 2EQRA 1T6SA 2B9SA 3SDGA 4LJZF 3GWZA 1X1DA 4UUVA 2DMPA 5FRNA 5L3DA 2PJPA 1X3WB 3ON2A 1P7JA 4C3HJ 2DA1A 2VBWA 2E1MC 1WRJA 1XD7A 5LEKA 2ZJRF 1R9TJ 4A0YA 2ZXIA 3G3ZA 3K70D 3ZMZA 2V9PA 4KMFA 1MGTA 4I01A 1NHAA 2EILH 5FLMJ 2NP5A 2O7TA 2UXUA 3VB2A 5BPDA 2JPBA 2HEOA 5IOZA 2R7ZJ 5E1XA 1KU7A 2QQAA 3OIQA 2QBYA 5JR3A 2EV5A 3BG6A 3QOPA 5BNGA 3JRAA 3J7ZI 2H27A 1I39A 4WXHA 3MKZA 2B3WA 2G7UA 4UVCA 1DU6A 3G6EI 4UV9A 2GENA 4A3DJ 3CZ6A 3M9AA 1IN6A 4LOCA 2LDUA 4M74A 5D4SA 3HRMA
chains in the Genus database with same CATH topology
5F08A 4AYBN 5K7FA 4XRSA 3IH4A 3W6VA 2NVXJ 3PASA 4MK6A 2EZHA 2VUMJ 2DG8A 2HDDA 2HOSA 1JTXA 1B72B 4A3CJ 2AO9A 2LK2A 4D7NA 1I50J 2XSDC 5C3EJ 3Q0UA 2XPUA 2YS9A 3ZQIA 3Q3SA 3I4MJ 5E3MA 2YU9J 1IUFA 4AUXA 2EH3A 4DZPA 3P9TA 3BTLA 2ECCA 3TW6A 4I6ZA 5HBUA 4A3EJ 2O9LA 2IBDA 1ZR4A 4B4CA 2I10A 3HEFA 2KDZA 1NTCA 1GV2A 1AU7A 1ORKA 4FISA 2R5ZA 4G12A 4JX4A 2IAIA 4A3GJ 2ZCNA 1O4XA 1IJWC 2NS7A 3V78A 3CRJA 2YVHA 1WH7A 4IHYA 5EFYA 2WGBA 1QPIA 1FIPA 5CXIA 2GUHA 3HGGA 1K83J 4JP0A 1FTTA 5J1YA 1ETQA 3S14J 3VVYA 1IRZA 2EBIA 2EZLA 3RZDJ 4PXIA 1RKTA 1TWGJ 2ID3A 3S17J 2Y0SN 2HI3A 1B72A 3QQAA 1UG2A 2QIBA 2NVQJ 2UXHA 1MBJA 2PMZN 1U78A 1YRNB 2Q24A 1ZGWA 3GTPJ 2XRLA 1GDTA 4BY1J 3S16J 2HXOA 5IPAA 3ANPA 3G56A 1W0UA 5CW8A 2VKVA 1WGXA 4IEJA 1IC8A 2K9NA 1ITYA 1JTYA 3Q0WA 2CUEA 3G1OA 1FIAA 2Y9YA 5K58A 2OPTA 1K61A 3CJDA 2G7SA 1AKHA 2XB0X 2FQ4A 4MLOA 3HOVJ 5FKNA 2V57A 2HOAA 3LNQA 3VP5A 3GEUA 2L9RA 2QWTA 4A93J 1OCPA 4MFDA 4A3FJ 1LE8B 2X9DA 3JRDA 3CMYA 2G0EA 1Z77A 3JRIA 1Y1VJ 4J19A 2DJNA 3G1LA 1UI6A 5AQCA 5M5YJ 4L62A 5IYDJ 5FKKA 2Y9ZA 5J3LA 2M2EA 1WPKA 3TEDA 2GBYA 4S0HB 4FTHA 4M3GA 3E7LA 5EZGA 1WCMJ 2X48A 3KKCA 3K2AA 1YRNA 3BR6A 4BKXA 3JRFA 1MBHA 3BJBA 4FE7A 1JJ8C 4B3AA 4GCKA 1HOMA 1GV5A 2DMUA 3CWRA 2ZB9A 3B6CA 4FE4A 1D5YA 1CQTA 5FLVA 1XG1A 2IEKA 2DA2A 3EUPA 2G7GA 4JYKA 4BBSJ 1QRYA 2D5VA 3S1NJ 4NELA 3RKQA 2AHQA 1H88C 1MSFC 4CYCB 2NOGA 2PZ9A 4XICA 3FISA 4C3IJ 5F0HA 2ZOZA 4W97A 3JRHA 1VF9A 1IDZA 3RZOJ 3OOUA 3CDLA 1ETXA 1JKPC 1BA5A 3BTIA 3PO3J 2JN6A 1FEXA 4BXXJ 4L5EA 5FMPA 3VW1A 4A3IJ 2NP3A 2XPWA 4MO7A 4HKUA 4ICHA 1TWCJ 3HB9A 3GBGA 3MVPA 3E7QA 1JGGA 2JA5J 1SGMA 2REKA 1XS9A 2ZCXA 1TWFJ 3VPRA 3JRCA 1ZR2A 2XPVA 1B8IB 4A3LJ 3NI7A 3HIMA 1I3QJ 1RESA 3LSGA 3LSRA 2O7OA 3VIBA 1UMQA 1ETVA 2XGDA 5GP9A 2L7MP 2L7ZA 2P81A 1HLVA 3K7AJ 3Q0VA 5J1RA 2HYTA 3HTIA 2VPRA 1BW6A 4M3DA 3A03A 5F1JA 1TC3C 2JA8J 5M3FJ 1JJ6C 5E3NA 3COLA 3A02A 3TP3A 1ETWA 5IYBJ 1QVUA 2ELKA 2COBA 2ECBA 3PPBA 3SJMA 3S2HJ 4MFEA 5EGOA 5D18A 5FKLA 5IYCJ 4XIDA 3QPSA 1HF0A 5HAWA 2WV1A 1BW5A 3IV5A 3B6AA 3A01A 1SFOJ 2LKXA 2CJJA 3BT9A 3F1BA 3C07A 2DN0A 2WB1N 4A3KJ 2M8GX 4UUSB 1XC5A 4X6AJ 2CUFA 4Y7NJ 5EG0B 3QKXA 5DAJA 3LSPA 3HTAA 1E3OC 5E3OA 3ZOBA 3G7RA 5HSZA 3GZIA 5DS9A 2LVSA 1B8IA 5GPCA 5M3MJ 4AF5A 2DA3A 2OF7A 3MKLA 3D1NI 5IP7J 3NRGA 5J1UA 3WHCA 2GM4A 3RQIA 4NDLA 4GFKA 4DYQA 3FIWA 2L7FP 2DA7A 3JSJA 3IUVA 3VW2A 1WH5A 1JUMA 3PM1A 3T6NA 5EYRA 2QF7A 4XK4A 5IP9J 1TWAJ 1BL0A 3BG5A 3BTCA 2NVTJ 3EGQA 2UXOA 1VNDA 2DMTA 5D1RA 2RHAA 5FJ8J 3HOZJ 3MNLA 1S7EA 1H89C 1MBKA 2G7LA 3AQSA 5HODA 1ZTRA 3CCYA 1EF4A 3I4NJ 2LP0A 4D5CA 1NK2P 3GTQJ 3S1QJ 1RR7A 1U8BA 1OFCX 3S1MJ 3LOCA 1JKQC 5F0FA 2WAQN 2PBXA 2KT0A 5CXGA 3RD3A 2LFBA 4JL3A 2R93J 1A6IA 1MNMC 2DA6A 4A3BJ 1OJLA 1BJZA 2FX0A 2JA7J 3BR3A 3G1MA 4QSHA 1JKRC 3OSGA 3ZQLA 1UHSA 2R5YB 2NX4A 5H9TA 2ID6A 2K40A 3HOUJ 1ENHA 1GUUA 3VW0A 4M6VA 4GCTA 2N8GA 3HE0A 5D19A 1W0TA 3O60A 1F43A 3KZ9A 1JT6A 2ME6A 3ZQCA 2JA6J 2FBQA 4IHWA 3VVZA 1ETKA 2WUIA 1JUPA 2TCTA 1Y1WJ 5C4YA 1VI0A 2IU5A 4YZEA 5C4JJ 4RBOA 5EF6A 3MN2A 2DA5A 3TW7A 5F0CA 3O8HA 2XDNA 3HOWJ 2B63J 3UKGA 4GFLA 3OSFA 2VKEA 3BR2A 1GVDA 1X58A 2GLOA 4DYRA 3FRQA 3H3VK 4UDSA 5JLWA 4C3JJ 4Y52J 4CGRA 1HDPA 2G3BA 3NARA 1LE8A 3CQZJ 2R0QC 2EZIA 3C2BA 4UUTA 2YVEA 3VOKA 1DU0A 4KWAA 1IG7A 3IH2A 2RAEA 4GCLA 4EEFG 1WI3A 1U9NA 3DEWA 2NVYJ 1RKWA 4AC0A 4B1RA 3JRGA 3S1RJ 4IHXA 4X1EA 3GTLJ 2LR8A 2HXIA 3BQZA 5DTDA 3HOXJ 3JREA 2R5ZB 2JJ7A 3WHBA 2XGCA 5C44J 1UI5A 5E3LA 4NN1A 1POGA 2MGQA 3HTHA 1Q1VA 3PO2J 2QKOA 1X2MA 3ANGA 4CYCA 3KNWA 4MXMA 3HM5A 4QIWN 2HQ5A 4C2MJ 5F27A 1SANA 2JWTA 2M34A 2K9QA 1OCTC 1TWHJ 3HBLA 3GTMJ 2HYJA 1MBEA 3ON4A 4D5FA 3JRBA 1PUFB 3VOXA 1P7IA 3BTJA 2W48A 1IGNA 2OI8A 4ME9A 3ZQGA 5FGLA 4JKZA 2DTZA 2W53A 3VVXA 2F07A 4M3FA 5FKMA 1ZQ3P 3HKZN 3NXCA 3F0CA 4JNNA 3SFIA 2YUSA 2HKUA 2E2IJ 2ZCMA 3BQYA 1MBFA 2M0CA 2E2JJ 1IV6A 1APLC 3IH3A 5M5WJ 2QOPA 1H8AC 1RETA 5GPAA 2LTPA 5IOYA 5FHPA 5FKOA 3TP0A 2MSYA 4M3EA 1AKHB 3ZQFA 2RASA 1T56A 1X2NA 3HGYA 2QCOA 1FTZA 2E1OA 4ABZA 3NNRA 4A3MJ 1MH3A 2Y2ZA 3BR5A 2QTQA 2Y30A 1PUFA 2ZOYA 2L0KA 3LSJA 3OIOA 4DZJA 3H0GJ 4QTRA 3AQTA 3GTJJ 4V2FA 4XRMA 2H1KA 3HTJA 4AC6A 5F04A 1T33A 1ETOA 1F36A 4V2GA 5IP6A 1HDDC 5EDNA 4ACIA 4UUSA 4M3BA 4JX6A 2DMQA 5EG0A 3S2DJ 1Z0XA 2CRGA 4A69C 4IHVA 1QVTA 3BNIA 2ME0A 1ZKGA 2LD5A 3BG9A 4I76A 3KKDA 2Y31A 3BCGA 5M5XJ 4RDUA 3GTKJ 3GTOJ 2D6YA 1I6HJ 3BRUA 3JR9A 2K9SA 2E2HJ 3NAUA 3BG3A 4HNVA 1LFBA 3BR0A 2H8RA 3M3YJ 3VUQA 5EZHA 2DG7A 2MG4A 1MBGA 3QPLA 1MSEC 2EZKA 2CQXA 1LFUP 5C4XJ 1JT0A 2VI6A 1G2HA 2GFNA 3FK6A 4JX5A 1MH4A 2E19A 3V6GA 1U9OA 1ETYA 2FJ1A 3BHQA 2EQRA 9ANTA 3SDGA 4DYCA 3O8GA 4A3JJ 1ZK8A 3GTGJ 4MIMA 4FCYA 2DMPA 2JMWA 4XRSG 3QBMA 2MW8A 5K7HA 1GT0C 3DPJA 3S15J 3FKIJ 2HOTA 3ON2A 1P7JA 2NS8A 4C3HJ 2DA1A 3NPIA 5K7ZA 1R9TJ 2XB5A 1AHDP 1JKOC 1JUSA 2O8KA 3HDDA 2R5YA 2FD5A 2CU7A 2LY9A 5FLMJ 2NP5A 2O7TA 2UXUA 2R92J 2X6OA 3M4OJ 1IDYA 3BR1A 5IOZA 2R7ZJ 2DMNA 1HCRA 2UXPA 5BNGA 4BBRJ 2JK3A 5EGOB 3DCFA 3JRAA 2M9HA 4D7MA 2TRTA 3LHQA 1NK3P 3LWJA 5EEAA 3S5RA 3B81A 1RPWA 3A01B 1DU6A 2OERA 2CQQA 4DW6A 2GENA 2UXIA 2XGEA 3ZQHA 3LJLA 4GFBA 4W1UA 1FJLA 4A3DJ 2DA4A 5JLXA 3L1PA 1A5JA 3HOYJ 4BY7J 3FK7A 3RH2A 4LOCA 2LLKA 1VFCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F08 A;  4AYB N;  5K7F A;  4XRS A;  3IH4 A;  3W6V A;  2NVX J;  3PAS A;  4MK6 A;  2EZH A;  2VUM J;  2DG8 A;  2HDD A;  2HOS A;  1JTX A;  1B72 B;  4A3C J;  2AO9 A;  2LK2 A;  4D7N A;  1I50 J;  2XSD C;  5C3E J;  3Q0U A;  2XPU A;  2YS9 A;  3ZQI A;  3Q3S A;  3I4M J;  5E3M A;  2YU9 J;  1IUF A;  4AUX A;  2EH3 A;  4DZP A;  3P9T A;  3BTL A;  2ECC A;  3TW6 A;  4I6Z A;  5HBU A;  4A3E J;  2O9L A;  2IBD A;  1ZR4 A;  4B4C A;  2I10 A;  3HEF A;  2KDZ A;  1NTC A;  1GV2 A;  1AU7 A;  1ORK A;  4FIS A;  2R5Z A;  4G12 A;  4JX4 A;  2IAI A;  4A3G J;  2ZCN A;  1O4X A;  1IJW C;  2NS7 A;  3V78 A;  3CRJ A;  2YVH A;  1WH7 A;  4IHY A;  5EFY A;  2WGB A;  1QPI A;  1FIP A;  5CXI A;  2GUH A;  3HGG A;  1K83 J;  4JP0 A;  1FTT A;  5J1Y A;  1ETQ A;  3S14 J;  3VVY A;  1IRZ A;  2EBI A;  2EZL A;  3RZD J;  4PXI A;  1RKT A;  1TWG J;  2ID3 A;  3S17 J;  2Y0S N;  2HI3 A;  1B72 A;  3QQA A;  1UG2 A;  2QIB A;  2NVQ J;  2UXH A;  1MBJ A;  2PMZ N;  1U78 A;  1YRN B;  2Q24 A;  1ZGW A;  3GTP J;  2XRL A;  1GDT A;  4BY1 J;  3S16 J;  2HXO A;  5IPA A;  3ANP A;  3G56 A;  1W0U A;  5CW8 A;  2VKV A;  1WGX A;  4IEJ A;  1IC8 A;  2K9N A;  1ITY A;  1JTY A;  3Q0W A;  2CUE A;  3G1O A;  1FIA A;  2Y9Y A;  5K58 A;  2OPT A;  1K61 A;  3CJD A;  2G7S A;  1AKH A;  2XB0 X;  2FQ4 A;  4MLO A;  3HOV J;  5FKN A;  2V57 A;  2HOA A;  3LNQ A;  3VP5 A;  3GEU A;  2L9R A;  2QWT A;  4A93 J;  1OCP A;  4MFD A;  4A3F J;  1LE8 B;  2X9D A;  3JRD A;  3CMY A;  2G0E A;  1Z77 A;  3JRI A;  1Y1V J;  4J19 A;  2DJN A;  3G1L A;  1UI6 A;  5AQC A;  5M5Y J;  4L62 A;  5IYD J;  5FKK A;  2Y9Z A;  5J3L A;  2M2E A;  1WPK A;  3TED A;  2GBY A;  4S0H B;  4FTH A;  4M3G A;  3E7L A;  5EZG A;  1WCM J;  2X48 A;  3KKC A;  3K2A A;  1YRN A;  3BR6 A;  4BKX A;  3JRF A;  1MBH A;  3BJB A;  4FE7 A;  1JJ8 C;  4B3A A;  4GCK A;  1HOM A;  1GV5 A;  2DMU A;  3CWR A;  2ZB9 A;  3B6C A;  4FE4 A;  1D5Y A;  1CQT A;  5FLV A;  1XG1 A;  2IEK A;  2DA2 A;  3EUP A;  2G7G A;  4JYK A;  4BBS J;  1QRY A;  2D5V A;  3S1N J;  4NEL A;  3RKQ A;  2AHQ A;  1H88 C;  1MSF C;  4CYC B;  2NOG A;  2PZ9 A;  4XIC A;  3FIS A;  4C3I J;  5F0H A;  2ZOZ A;  4W97 A;  3JRH A;  1VF9 A;  1IDZ A;  3RZO J;  3OOU A;  3CDL A;  1ETX A;  1JKP C;  1BA5 A;  3BTI A;  3PO3 J;  2JN6 A;  1FEX A;  4BXX J;  4L5E A;  5FMP A;  3VW1 A;  4A3I J;  2NP3 A;  2XPW A;  4MO7 A;  4HKU A;  4ICH A;  1TWC J;  3HB9 A;  3GBG A;  3MVP A;  3E7Q A;  1JGG A;  2JA5 J;  1SGM A;  2REK A;  1XS9 A;  2ZCX A;  1TWF J;  3VPR A;  3JRC A;  1ZR2 A;  2XPV A;  1B8I B;  4A3L J;  3NI7 A;  3HIM A;  1I3Q J;  1RES A;  3LSG A;  3LSR A;  2O7O A;  3VIB A;  1UMQ A;  1ETV A;  2XGD A;  5GP9 A;  2L7M P;  2L7Z A;  2P81 A;  1HLV A;  3K7A J;  3Q0V A;  5J1R A;  2HYT A;  3HTI A;  2VPR A;  1BW6 A;  4M3D A;  3A03 A;  5F1J A;  1TC3 C;  2JA8 J;  5M3F J;  1JJ6 C;  5E3N A;  3COL A;  3A02 A;  3TP3 A;  1ETW A;  5IYB J;  1QVU A;  2ELK A;  2COB A;  2ECB A;  3PPB A;  3SJM A;  3S2H J;  4MFE A;  5EGO A;  5D18 A;  5FKL A;  5IYC J;  4XID A;  3QPS A;  1HF0 A;  5HAW A;  2WV1 A;  1BW5 A;  3IV5 A;  3B6A A;  3A01 A;  1SFO J;  2LKX A;  2CJJ A;  3BT9 A;  3F1B A;  3C07 A;  2DN0 A;  2WB1 N;  4A3K J;  2M8G X;  4UUS B;  1XC5 A;  4X6A J;  2CUF A;  4Y7N J;  5EG0 B;  3QKX A;  5DAJ A;  3LSP A;  3HTA A;  1E3O C;  5E3O A;  3ZOB A;  3G7R A;  5HSZ A;  3GZI A;  5DS9 A;  2LVS A;  1B8I A;  5GPC A;  5M3M J;  4AF5 A;  2DA3 A;  2OF7 A;  3MKL A;  3D1N I;  5IP7 J;  3NRG A;  5J1U A;  3WHC A;  2GM4 A;  3RQI A;  4NDL A;  4GFK A;  4DYQ A;  3FIW A;  2L7F P;  2DA7 A;  3JSJ A;  3IUV A;  3VW2 A;  1WH5 A;  1JUM A;  3PM1 A;  3T6N A;  5EYR A;  2QF7 A;  4XK4 A;  5IP9 J;  1TWA J;  1BL0 A;  3BG5 A;  3BTC A;  2NVT J;  3EGQ A;  2UXO A;  1VND A;  2DMT A;  5D1R A;  2RHA A;  5FJ8 J;  3HOZ J;  3MNL A;  1S7E A;  1H89 C;  1MBK A;  2G7L A;  3AQS A;  5HOD A;  1ZTR A;  3CCY A;  1EF4 A;  3I4N J;  2LP0 A;  4D5C A;  1NK2 P;  3GTQ J;  3S1Q J;  1RR7 A;  1U8B A;  1OFC X;  3S1M J;  3LOC A;  1JKQ C;  5F0F A;  2WAQ N;  2PBX A;  2KT0 A;  5CXG A;  3RD3 A;  2LFB A;  4JL3 A;  2R93 J;  1A6I A;  1MNM C;  2DA6 A;  4A3B J;  1OJL A;  1BJZ A;  2FX0 A;  2JA7 J;  3BR3 A;  3G1M A;  4QSH A;  1JKR C;  3OSG A;  3ZQL A;  1UHS A;  2R5Y B;  2NX4 A;  5H9T A;  2ID6 A;  2K40 A;  3HOU J;  1ENH A;  1GUU A;  3VW0 A;  4M6V A;  4GCT A;  2N8G A;  3HE0 A;  5D19 A;  1W0T A;  3O60 A;  1F43 A;  3KZ9 A;  1JT6 A;  2ME6 A;  3ZQC A;  2JA6 J;  2FBQ A;  4IHW A;  3VVZ A;  1ETK A;  2WUI A;  1JUP A;  2TCT A;  1Y1W J;  5C4Y A;  1VI0 A;  2IU5 A;  4YZE A;  5C4J J;  4RBO A;  5EF6 A;  3MN2 A;  2DA5 A;  3TW7 A;  5F0C A;  3O8H A;  2XDN A;  3HOW J;  2B63 J;  3UKG A;  4GFL A;  3OSF A;  2VKE A;  3BR2 A;  1GVD A;  1X58 A;  2GLO A;  4DYR A;  3FRQ A;  3H3V K;  4UDS A;  5JLW A;  4C3J J;  4Y52 J;  4CGR A;  1HDP A;  2G3B A;  3NAR A;  1LE8 A;  3CQZ J;  2R0Q C;  2EZI A;  3C2B A;  4UUT A;  2YVE A;  3VOK A;  1DU0 A;  4KWA A;  1IG7 A;  3IH2 A;  2RAE A;  4GCL A;  4EEF G;  1WI3 A;  1U9N A;  3DEW A;  2NVY J;  1RKW A;  4AC0 A;  4B1R A;  3JRG A;  3S1R J;  4IHX A;  4X1E A;  3GTL J;  2LR8 A;  2HXI A;  3BQZ A;  5DTD A;  3HOX J;  3JRE A;  2R5Z B;  2JJ7 A;  3WHB A;  2XGC A;  5C44 J;  1UI5 A;  5E3L A;  4NN1 A;  1POG A;  2MGQ A;  3HTH A;  1Q1V A;  3PO2 J;  2QKO A;  1X2M A;  3ANG A;  4CYC A;  3KNW A;  4MXM A;  3HM5 A;  4QIW N;  2HQ5 A;  4C2M J;  5F27 A;  1SAN A;  2JWT A;  2M34 A;  2K9Q A;  1OCT C;  1TWH J;  3HBL A;  3GTM J;  2HYJ A;  1MBE A;  3ON4 A;  4D5F A;  3JRB A;  1PUF B;  3VOX A;  1P7I A;  3BTJ A;  2W48 A;  1IGN A;  2OI8 A;  4ME9 A;  3ZQG A;  5FGL A;  4JKZ A;  2DTZ A;  2W53 A;  3VVX A;  2F07 A;  4M3F A;  5FKM A;  1ZQ3 P;  3HKZ N;  3NXC A;  3F0C A;  4JNN A;  3SFI A;  2YUS A;  2HKU A;  2E2I J;  2ZCM A;  3BQY A;  1MBF A;  2M0C A;  2E2J J;  1IV6 A;  1APL C;  3IH3 A;  5M5W J;  2QOP A;  1H8A C;  1RET A;  5GPA A;  2LTP A;  5IOY A;  5FHP A;  5FKO A;  3TP0 A;  2MSY A;  4M3E A;  1AKH B;  3ZQF A;  2RAS A;  1T56 A;  1X2N A;  3HGY A;  2QCO A;  1FTZ A;  2E1O A;  4ABZ A;  3NNR A;  4A3M J;  1MH3 A;  2Y2Z A;  3BR5 A;  2QTQ A;  2Y30 A;  1PUF A;  2ZOY A;  2L0K A;  3LSJ A;  3OIO A;  4DZJ A;  3H0G J;  4QTR A;  3AQT A;  3GTJ J;  4V2F A;  4XRM A;  2H1K A;  3HTJ A;  4AC6 A;  5F04 A;  1T33 A;  1ETO A;  1F36 A;  4V2G A;  5IP6 A;  1HDD C;  5EDN A;  4ACI A;  4UUS A;  4M3B A;  4JX6 A;  2DMQ A;  5EG0 A;  3S2D J;  1Z0X A;  2CRG A;  4A69 C;  4IHV A;  1QVT A;  3BNI A;  2ME0 A;  1ZKG A;  2LD5 A;  3BG9 A;  4I76 A;  3KKD A;  2Y31 A;  3BCG A;  5M5X J;  4RDU A;  3GTK J;  3GTO J;  2D6Y A;  1I6H J;  3BRU A;  3JR9 A;  2K9S A;  2E2H J;  3NAU A;  3BG3 A;  4HNV A;  1LFB A;  3BR0 A;  2H8R A;  3M3Y J;  3VUQ A;  5EZH A;  2DG7 A;  2MG4 A;  1MBG A;  3QPL A;  1MSE C;  2EZK A;  2CQX A;  1LFU P;  5C4X J;  1JT0 A;  2VI6 A;  1G2H A;  2GFN A;  3FK6 A;  4JX5 A;  1MH4 A;  2E19 A;  3V6G A;  1U9O A;  1ETY A;  2FJ1 A;  3BHQ A;  2EQR A;  9ANT A;  3SDG A;  4DYC A;  3O8G A;  4A3J J;  1ZK8 A;  3GTG J;  4MIM A;  4FCY A;  2DMP A;  2JMW A;  4XRS G;  3QBM A;  2MW8 A;  5K7H A;  1GT0 C;  3DPJ A;  3S15 J;  3FKI J;  2HOT A;  3ON2 A;  1P7J A;  2NS8 A;  4C3H J;  2DA1 A;  3NPI A;  5K7Z A;  1R9T J;  2XB5 A;  1AHD P;  1JKO C;  1JUS A;  2O8K A;  3HDD A;  2R5Y A;  2FD5 A;  2CU7 A;  2LY9 A;  5FLM J;  2NP5 A;  2O7T A;  2UXU A;  2R92 J;  2X6O A;  3M4O J;  1IDY A;  3BR1 A;  5IOZ A;  2R7Z J;  2DMN A;  1HCR A;  2UXP A;  5BNG A;  4BBR J;  2JK3 A;  5EGO B;  3DCF A;  3JRA A;  2M9H A;  4D7M A;  2TRT A;  3LHQ A;  1NK3 P;  3LWJ A;  5EEA A;  3S5R A;  3B81 A;  1RPW A;  3A01 B;  1DU6 A;  2OER A;  2CQQ A;  4DW6 A;  2GEN A;  2UXI A;  2XGE A;  3ZQH A;  3LJL A;  4GFB A;  4W1U A;  1FJL A;  4A3D J;  2DA4 A;  5JLX A;  3L1P A;  1A5J A;  3HOY J;  4BY7 J;  3FK7 A;  3RH2 A;  4LOC A;  2LLK A;  1VFC A; 
#chains in the Genus database with same CATH topology
 4JQF A;  5CVR A;  5F08 A;  1R7J A;  4AYB A;  4AYB N;  4XLP F;  3KET A;  1FPQ A;  4XRS A;  3CMM A;  3AL0 B;  4YEL A;  2ELJ A;  2HOS A;  1B72 B;  4A3C J;  2LK2 A;  2W1O A;  5J4Y A;  3Q9V A;  5C3E J;  1TTY A;  1ZRC A;  3VWB A;  2XPU A;  3KIO A;  4FQG A;  2FNA A;  1IUF A;  3U1K A;  4AUX A;  2YU9 J;  4R79 A;  3PUF A;  5CKT A;  3P9T A;  1LDD A;  4BL0 B;  4XLE A;  2O3F A;  4I6Z A;  1QA6 A;  2IBD A;  2M7B A;  3FM3 A;  4IVN A;  1KU9 A;  1U3E M;  2BXY A;  2L4A A;  2I10 A;  2BY2 A;  1NTC A;  1GV2 A;  1U0J A;  1L0O C;  5FO5 A;  4EJO A;  2ZCN A;  2LG4 A;  5HDG A;  5B5E C;  2MC3 A;  3LSK A;  4ASN A;  5HS8 A;  1HC8 A;  2OTJ I;  4PJN A;  4BJT A;  2WGB A;  4BQA A;  1QPI A;  5K5R A;  2IVM A;  1FIP A;  5CXI A;  3RPQ A;  1K83 J;  4PCQ A;  2ADU A;  1FTT A;  2H8W A;  5J1Y A;  3VVY A;  5DEQ A;  2EBI A;  4I2O A;  4ZYD A;  4ZDO A;  4PXI A;  3PUB A;  4BE0 A;  2F5D A;  1TWG J;  2ID3 A;  2L54 A;  5TIS C;  1EH7 A;  2BVM A;  3K9T A;  4IRH A;  3MZ8 A;  3E5U A;  4XNF A;  3R6S A;  4D9J A;  2XHK A;  2PJR B;  3N05 A;  4KA4 A;  1XSX A;  1MMA A;  3M8J A;  2QIB A;  2VQL A;  5HLH A;  3K0L A;  2NVQ J;  1XN7 A;  2ZFU A;  2R3S A;  1WHU A;  3S16 J;  4KFC A;  4BY1 J;  5F64 A;  5IPA A;  1XSV A;  3G56 A;  4OMY A;  2JZY A;  3IP4 B;  2LF8 A;  3J7Y J;  2VKV A;  5KHD A;  4IEJ A;  3OYA A;  3ERE D;  1IC8 A;  4CDG A;  2K9N A;  1VQP I;  3EDP A;  2CUE A;  3G1O A;  1FIA A;  2Y9Y A;  2O6G E;  5B3S H;  1FBQ A;  5LHH A;  2AS5 F;  3I54 A;  2HDW A;  3HRS A;  5FKN A;  2DU9 A;  1MNE A;  4HW0 A;  2R7D A;  2KIM A;  3HIF A;  1OCP A;  2X9D A;  3S3N A;  2G0E A;  3QU3 A;  3C7J A;  1YHQ I;  4BEH A;  3A4C A;  1Y1V J;  2LC2 A;  4J19 A;  5KAF C;  1ZG3 A;  3QP5 A;  4NB5 A;  4L62 A;  5FKK A;  3T0Y A;  3OYK A;  5J3L A;  4S0H B;  3ZMT A;  5J8F A;  4M3G A;  1KA8 A;  1BR4 A;  4HF1 A;  2A2F X;  2IT0 A;  2RN7 A;  3KKC A;  2Q2E A;  3QYE A;  2OJE D;  4EVI A;  2CV2 A;  1D0X A;  1Y0N A;  4HG2 A;  3CWR A;  3B6C A;  1D5Y A;  2DT7 B;  1TW2 A;  3EYI A;  4HNU A;  1XG1 A;  3CTA A;  1RZ4 A;  1B9N A;  1QRY A;  1Z05 A;  3GXO A;  5ILS A;  3WGH A;  1R49 A;  3S1N J;  4IRV A;  4NEL A;  1K79 A;  1SD5 A;  5LGT A;  2NOG A;  4XIC A;  3CDI A;  3CCV I;  1X4O A;  2H6B A;  2ZOZ A;  2ISY A;  1IDZ A;  3OOU A;  2L2O A;  3CDL A;  2IA2 A;  1BA5 A;  1F4K A;  2HYG D;  4RB1 A;  4BQO A;  5CPR B;  1U5T B;  4A0X A;  2H6C A;  1MMD A;  3ZCO A;  4G6T B;  1FEX A;  3WTY C;  4BYY A;  4BXX J;  2CG4 A;  3WTX C;  3BRO A;  3HZJ A;  4AM3 A;  5JVG F;  1UB9 A;  2DOD A;  1TWF J;  1F5T A;  3MZY A;  2V1U A;  1LB2 A;  1B8I B;  4A3L J;  2O5R A;  3DEE A;  3LSR A;  2O7O A;  1SVM A;  4AU7 A;  3RQ4 A;  2XGD A;  2GAU A;  2L7M P;  1HLV A;  2HYT A;  4E7H A;  2CH0 A;  1E3P A;  3VYR B;  3A03 A;  4GYG A;  5L3F A;  2LOO A;  3COL A;  2Z2S B;  3A02 A;  3RKX A;  1ETW A;  4XON A;  4Y17 A;  2COB A;  2A3S A;  4J01 A;  4KDP A;  4NHJ A;  2CW0 F;  4JK1 X;  2DPU A;  2EFP A;  1WZ2 A;  3S2H J;  2HTS A;  1X3Z B;  5IYC J;  2MFZ A;  3FXM A;  4U87 A;  3JAM Z;  1FOX A;  3AG2 H;  3IV5 A;  1PVE A;  3BJA A;  4P5O A;  1SFO J;  2M87 A;  1CGP A;  2CJJ A;  1BIA A;  3T8T A;  4A3K J;  3C07 A;  1YOV B;  3R4K A;  2V4J C;  4M6Y A;  1XCB A;  1HKT A;  5DAJ A;  3L2C A;  2W84 A;  5D6F A;  3LQR A;  5E3O A;  3NWT A;  2XF5 A;  1UAA A;  1VQ6 I;  3VTI A;  2OQR A;  5HSZ A;  3LSM A;  2GXB A;  2GA2 A;  3P9K A;  2VAS A;  3QOD A;  5AIP A;  2OF7 A;  2GOX B;  4NUB A;  2KIS A;  3WHC A;  2IW5 A;  4NDL A;  4GFK A;  2ETH A;  2HKO A;  2M4G A;  3CJR B;  4CO8 A;  1LVA A;  3EYY A;  4MQV A;  5JI6 A;  4C2U A;  4L0Y B;  2ZJP F;  2QF7 A;  4XK4 A;  5JVT A;  3E5Q A;  3ZQQ A;  2R7W A;  3BG5 A;  1BC7 C;  2KZG A;  2DMT A;  2UXO A;  2KMU A;  3AQS A;  2R4G A;  3CCM I;  3PNV A;  1ZTR A;  1A36 A;  1RUN A;  4IQ4 A;  1EF4 A;  3F22 A;  3I4N J;  3H5R A;  3KZZ A;  2IGM A;  2ZSI B;  4ITV A;  5CJ9 A;  5HLI A;  4GGG A;  3TKY A;  5CXG A;  1MJB A;  2LFB A;  4OIN F;  1G4D A;  2KFD A;  2DA6 A;  4X0G A;  1LQ1 A;  1R23 A;  2JA7 J;  3BR3 A;  1XGS A;  1SMT A;  5BS6 A;  3OYC A;  3SXY A;  1Z67 A;  4N9I A;  1ZAR A;  1E17 A;  2ID6 A;  2K40 A;  4M6V A;  2N8G A;  4M71 A;  3O60 A;  4RS8 A;  2E35 A;  2QBY B;  3ZQC A;  2RVC A;  2LNB A;  2BHY A;  3DBR B;  4G6D A;  3TGN A;  4G6Q A;  5J40 A;  5LGU A;  2Z9O A;  3I5U A;  2IU5 A;  4OIP F;  5EF6 A;  3RKW A;  3TW7 A;  3O8H A;  1N75 A;  4UV8 A;  2RRE A;  4BE2 A;  2ISZ A;  3JTG A;  3PSI A;  3WGI A;  1VQ4 I;  3ABU A;  2HZD A;  3S2W A;  2X85 A;  4Y52 J;  1I27 A;  4PGH A;  2YU3 A;  2HWV A;  4R8H A;  1ZRF A;  1J7K A;  2GXG A;  1YI2 I;  1LE8 A;  2E7X A;  3C2B A;  2Y75 A;  1HSJ A;  2RC4 A;  3E6C C;  4KWA A;  1X1B A;  3D5R C;  3WU1 B;  2F4I A;  2RAE A;  4WF2 A;  4GCL A;  2HZT A;  3AAF A;  4EEF G;  4IHS A;  1YTY A;  1VQK I;  3WG7 H;  2VPL A;  4AC0 A;  3F6O A;  2ZXW H;  2VXD A;  4BXF A;  3JRG A;  2VL8 A;  2BOL A;  1E0E A;  4IHX A;  2MBF A;  2GIV A;  5E17 F;  4D1Q A;  4YEJ A;  3HOX J;  3EUK L;  2EA4 A;  3JRE A;  4HF0 A;  2JJ7 A;  3WHB A;  2XGC A;  5L3E A;  1FOY A;  4XRF A;  4LK0 F;  3U1D A;  1POG A;  2W82 A;  2W7N A;  3QYB A;  1XMK A;  4I02 A;  1U8R A;  3KNW A;  2KZV A;  4QIW N;  1BR2 A;  3PSF A;  4C2M J;  3K4J A;  1SAN A;  2CFX A;  2K9Q A;  3HBL A;  3OV8 A;  2HYJ A;  4D5F A;  1I1S A;  2FMY A;  2W48 A;  2DOE A;  3DBL B;  4NC8 A;  3J80 Z;  1UZC A;  1MND A;  2ZNZ A;  1XMA A;  3K4K A;  4NNJ A;  3ERM A;  4U9N A;  3LQQ A;  2YVX A;  3HUG A;  1R22 A;  2WV0 A;  4HV5 A;  5E8I A;  3SYT A;  3FMQ A;  3CF5 F;  2KIF A;  2BE5 F;  2E2I J;  2ZCM A;  2PN6 A;  1H0M A;  2GA1 A;  3A2K A;  2VJI A;  1VQL I;  3H35 A;  2X1E A;  2XAS A;  2MSY A;  4CSW A;  3E6M A;  2X4H A;  1TNT A;  3KEY A;  3ZQF A;  2DPD A;  4G7O F;  1X2N A;  5H2F C;  2C6Y A;  1JI8 A;  2E1O A;  4XM3 A;  1JHH A;  2Z5U A;  2BY1 A;  4XLF A;  4A3M J;  1KGS A;  2PQ8 A;  1REP C;  4DBR A;  3BZC A;  2DAO A;  2Y2Z A;  4C9Y A;  3F8F A;  1JHF A;  2QTQ A;  3HPG A;  2ZOY A;  2L0K A;  3DFG A;  4BEH B;  1P2F A;  2KKO A;  4DZJ A;  4ZJZ A;  3W6K B;  4XRM A;  3E97 A;  3HTJ A;  4F7Z A;  2EIK H;  4PFP A;  1ETO A;  4V2G A;  2VOP A;  2NAZ A;  3KEQ A;  2VOO A;  1KQ9 A;  4KIF A;  5L3G A;  3F8B A;  1Z0X A;  4IHV A;  2P6S A;  4HZF A;  4U0V A;  1B59 A;  2WAF A;  3DF8 A;  4KMU X;  2G9W A;  3ZP5 A;  2Q8K A;  4I76 A;  2LD5 A;  1FOW A;  3KKD A;  3BCG A;  1MMN A;  4RDU A;  2DYS H;  3BWG A;  2XF7 A;  3SHF A;  4HDU A;  2ZY9 A;  3NAU A;  3IKT A;  4CIC A;  2M30 A;  3SWH A;  3LAJ A;  3MD2 A;  2IA0 A;  3S8P A;  3I64 A;  4HLX A;  1DP7 P;  3L2W A;  2X6X A;  4DIQ A;  3COA C;  2CQX A;  2X6Y A;  1JT0 A;  3WTS C;  1JE8 A;  1DPR A;  2E19 A;  4U7D A;  1U9O A;  1ETY A;  2FJ1 A;  5E8G A;  3V6G A;  1FBU A;  2IS4 A;  9ANT A;  3O8G A;  5J6X A;  2VBX A;  4QPQ A;  4CCO A;  1QPM A;  3GTG J;  4FCY A;  3V8J A;  2RKH A;  4E7L A;  2JMW A;  3QBM A;  2MW8 A;  3I55 I;  2ZBK A;  3U2R A;  1K6Y A;  3H36 A;  3DPJ A;  3FKI J;  2HOT A;  2F6C A;  4DNC A;  2NS8 A;  3G73 A;  5TRD A;  2B1E A;  1IW7 F;  1D1C A;  3FMR A;  3JW4 A;  2P7V B;  2FJI 1;  4BU2 A;  1Z7U A;  3E1S A;  5JHU A;  4ESJ A;  1JKO C;  2MLG A;  4R1H A;  1JUS A;  2GZW A;  4ZC3 A;  2R5Y A;  1T39 A;  1QGP A;  2CU7 A;  3FX3 A;  1ZLK A;  1DQU A;  3BPX A;  3M4O J;  2OC6 A;  3RYR A;  2DMN A;  1HCR A;  2CMP A;  2K5C A;  2G7H A;  5L3C A;  1ZEL A;  2M9H A;  4D7M A;  3LWJ A;  2E7W A;  3IAM 2;  5GAH J;  5EEA A;  3L2U A;  1DUX C;  3B81 A;  4UHT A;  2OER A;  4DW6 A;  3GZN B;  1A6Q A;  2VT2 A;  5TJJ A;  4GFB A;  1G3W A;  1TW3 A;  2X0L A;  1FJL A;  5JLX A;  3FXL A;  3IKV A;  4BY7 J;  4LD5 A;  3FK7 A;  3RH2 A;  3ABT A;  2LLK A;  1OCZ H;  1QHG A;  1TBX A;  2Z33 A;  5K7F A;  1B6A A;  3W6V A;  3VDX A;  2NVX J;  5HNH A;  1FC3 A;  1GHC A;  4MQ9 F;  2FA5 A;  4BJ6 C;  5D5V B;  1JTX A;  2GXA A;  1I50 J;  3OYB A;  3ZPL A;  3IWF A;  2XSD C;  1LJ9 A;  1Y39 A;  4C2T A;  2H94 A;  2EH3 A;  4OAZ A;  3V8K A;  5F1R A;  3HTS B;  2UZK A;  4HQM A;  6PAX A;  5HBU A;  1IRX A;  2O9L A;  1OCC H;  4HOB A;  4XLN F;  2X1C A;  2DO7 A;  2MLK A;  3WU0 A;  2W25 A;  2KDZ A;  5E18 F;  2A07 F;  1E2X A;  3TDU C;  3X2Q H;  2XAQ A;  4M9S A;  4AVZ A;  2IAI A;  4BE1 A;  4A3G J;  1SFE A;  4AWX B;  2MH2 A;  4Y13 A;  3DPL C;  1O4X A;  3K4M A;  1IJW C;  2STT A;  1WH7 A;  1GLN A;  1Z6R A;  2DFI A;  4XR6 A;  1ZAO A;  2D2W A;  2GUH A;  3HGG A;  3T5X A;  4BH9 A;  1ETQ A;  3ZGK A;  2A5W A;  3AFH A;  2D1V A;  3RZD J;  3MEX A;  1RKT A;  1BI2 A;  1KZH A;  4NC6 A;  3S17 J;  1B1B A;  2EIN H;  2VXZ A;  5H6R A;  2V1X A;  3QQA A;  1XDS A;  2Z99 A;  3I4P A;  3FDY A;  4EM1 A;  2QEX I;  4HSR A;  3AG4 H;  3IAS 2;  2A05 A;  4PJL A;  1U2W A;  3WOD F;  1LDJ A;  4RM3 A;  3K4C A;  2PMZ A;  1MBJ A;  2PMZ N;  4I7H A;  1U78 A;  3F23 A;  1OR7 C;  1STZ A;  1ZGW A;  4KNY A;  2HXO A;  1VQN I;  1G3S A;  4C30 A;  4CCM A;  2LKS A;  1IXS B;  2IA1 A;  2VE9 A;  2Q0O A;  1JTY A;  3Q0W A;  4LLG F;  5D8L B;  4AID A;  5E20 A;  2VE8 A;  2FU4 A;  4PJM A;  2OPT A;  5IY5 H;  1K61 A;  1N25 A;  2GQQ A;  1KQ8 A;  3HSR A;  1AKH A;  4ESB A;  2XB0 X;  3HOV J;  2VQC A;  2V57 A;  2HOA A;  3LNQ A;  4HBL A;  1S72 I;  2BY0 A;  2L9R A;  4A93 J;  4A3F J;  1LE8 B;  4G94 A;  1NH3 A;  4MEY F;  3LL7 A;  1UI6 A;  3G1L A;  3WTW C;  1ACI A;  1PDN C;  2R7F A;  5EZG A;  4AD9 A;  2VB6 A;  3FKJ A;  4B43 A;  3K2A A;  3TQN A;  5LD2 C;  1YRN A;  4Q5S F;  4BKX A;  4FE7 A;  4XSZ F;  1O3Q A;  2J5P A;  4PGG A;  2WAD A;  1QZE A;  2B0L A;  2HQN A;  2ZB9 A;  4E4H A;  4YII A;  1T0F C;  4ZYG A;  5DDG A;  2IEK A;  3DP7 A;  4BBS J;  2D5V A;  2AHQ A;  1H88 C;  1MSF C;  3LFU A;  3P9I A;  3GZ6 A;  4W97 A;  1XMX A;  1ZGJ A;  1WI9 A;  2HPM A;  2DDB A;  1YIO A;  2KRH A;  3DEU A;  2KLO A;  4UY8 I;  4D0P A;  2F48 A;  3PO3 J;  1VQ7 I;  3PFI A;  4Y3O A;  3VW1 A;  1FYM A;  2HKX A;  5DCM A;  3HUG B;  1HXD A;  4MO7 A;  4E7K A;  1Z9C A;  2CV0 A;  3ZN1 A;  1R00 A;  4ENK A;  3GX4 X;  3L7W A;  1XS9 A;  2A6T A;  2I8D A;  2W57 A;  2ACJ A;  1DGW Y;  2XAH A;  1J9I A;  3NI7 A;  2KRF A;  3HIM A;  4IX7 A;  1UMQ A;  2K85 A;  4L9J A;  3V7C A;  1ETV A;  5GP9 A;  2L7Z A;  2V9V A;  5J1R A;  2P7C B;  4BUP A;  2VPR A;  1BW6 A;  1TC3 C;  4HLY A;  1JJ6 C;  2K4B A;  3F8C A;  4A6D A;  1OYY A;  2KHM A;  4II2 A;  4LIT A;  5EJC A;  5GTI C;  1YS6 A;  1QVU A;  1N77 A;  2ECB A;  5EGO A;  5D18 A;  2EA2 A;  5FKL A;  2E60 A;  3GFL A;  4XID A;  1FYK A;  5GTH C;  4ESF A;  2VKH A;  1BJA A;  1VQ5 I;  4JBA A;  3B6A A;  3A01 A;  2BW3 A;  3QRF F;  2CV1 A;  5LRR A;  3WTT C;  1JXS A;  4X6A J;  2CUF A;  4Y7N J;  3QKX A;  4IKF A;  3WE2 A;  3KP5 A;  2KJC A;  3G7R A;  2LRD A;  4WIB A;  2FNP A;  3L2V A;  3KYD B;  3FXK A;  1W7P D;  2LVS A;  4DVY P;  1Z91 A;  1S3J A;  5HDN A;  4AF5 A;  2QSF X;  4IF4 A;  1R71 A;  2AQE A;  5IT9 Z;  5IP7 J;  3NRG A;  5J1U A;  2XF6 A;  2KP6 A;  5JFR A;  1R5I D;  3GW2 A;  3ZMS A;  3VYT B;  2L7F P;  2DA7 A;  1XGO A;  2FBI A;  2HOE A;  4N4O B;  1WH5 A;  2O8X A;  3FF5 A;  1JUM A;  3PM1 A;  5EYR A;  4MGR A;  2W00 A;  1W36 C;  1CF7 A;  1TWA J;  3I53 A;  3D5S C;  3VOD A;  2NVT J;  3GF2 A;  4HA8 A;  3E6D A;  1VND A;  2EPF A;  1BC8 C;  2RHA A;  5FJ8 J;  3HOZ J;  5D1R A;  1H89 C;  1MBK A;  1YO5 C;  4HYE A;  5LGN A;  2CQ7 A;  4OOI A;  4BXU A;  3CCU I;  1R1T A;  1W7P A;  1NG6 A;  4RMN A;  1YG2 A;  4D5C A;  3GTQ J;  3S1Q J;  1TT0 A;  4KT5 C;  1V55 H;  3S1M J;  3I56 I;  4A12 A;  2K9L A;  4F55 A;  2WAQ A;  2WAQ N;  3ZMU A;  2KT0 A;  3U9G A;  4AIK A;  3T8R A;  4IQJ A;  3O3K A;  1A6I A;  2OQG A;  1S29 A;  2WAE A;  1OJL A;  1BJZ A;  2FX0 A;  4A3B J;  3G1M A;  1JKR C;  3VOE A;  3OSG A;  3ZQL A;  2NXN B;  2RDP A;  1P92 A;  1UHS A;  4P96 A;  3W2V A;  4KT6 A;  3T1B A;  2R5Y B;  5FRM A;  4U9L A;  1ENH A;  4CZZ A;  3H9G A;  4LMY A;  5B1B H;  4Q48 A;  1YJN I;  5D19 A;  3OIP A;  1O7F A;  3LA7 A;  2IGO A;  2WY8 Q;  3DTI A;  4PDK A;  4PZJ A;  4F3Q A;  3EUH C;  1JT6 A;  4PSX A;  3KZ9 A;  5DUK A;  2OCE A;  3IC7 A;  5EEH A;  4B09 A;  4CCL A;  1R58 A;  1EV7 A;  5CVI A;  3CCJ I;  4ZYH A;  2WBM A;  4A0Z A;  4FX0 A;  2TCT A;  3BDD A;  2IS1 A;  3P7N A;  4YZE A;  1X1P A;  2NNN A;  1FT9 A;  2EJR A;  3CP8 A;  1WJB A;  2DA5 A;  3RDI A;  2CWE A;  2WC2 A;  3ECH A;  4L5J A;  2P5V A;  3VEP A;  4HDV A;  3UKG A;  4GFL A;  3LFK A;  3CCE I;  3BR2 A;  4P9F A;  1GVD A;  2GLO A;  3FRQ A;  3H3V K;  3J81 Z;  4HST A;  3C18 A;  4RB2 C;  4C3J J;  1MJA A;  3LA2 A;  3NAR A;  3AL0 C;  3CQZ J;  3HXL A;  1WSU A;  2YVE A;  3TOA A;  3BZ6 A;  4KIB A;  1DU0 A;  1IG7 A;  5FRO A;  2XVC A;  3ONQ A;  1WI3 A;  3DEW A;  2NVY J;  3KE2 A;  2EB7 A;  1D8K A;  4B1R A;  3H9J A;  1OR7 A;  3J81 K;  3E6B A;  5FD6 A;  1V5G A;  1SVO A;  2PMH A;  1USS A;  2HXI A;  1IF1 A;  5DTD A;  1Z7L A;  2ZFW A;  4IL6 C;  5LHG A;  5C44 J;  2QZ8 A;  2R7R A;  1UI5 A;  1WFX A;  4NN1 A;  3TO9 A;  1RUO A;  5CQG A;  1VQ8 I;  3PO2 J;  2XUB A;  3HTH A;  4MXM A;  4E7I A;  3BC8 A;  3BY6 A;  2HQ5 A;  5F27 A;  5LLQ A;  2M34 A;  1OCT C;  3CUO A;  1MBE A;  3K1P A;  3ON4 A;  5HVQ C;  3JRB A;  3RCO A;  2DW4 A;  1YJ9 I;  1KQ0 A;  3TO7 A;  3VOX A;  1IGN A;  4RA2 A;  2F4M B;  4LGW A;  3H5A A;  2F07 A;  3ASN H;  3HKZ A;  3IRQ A;  1Y8R B;  1FBS A;  2QYO A;  3F0C A;  3HKZ N;  4BAC A;  4NBQ A;  5ICF A;  4UB8 C;  1GXP A;  2YUS A;  2A6E F;  2VBZ A;  5CLS A;  2JSC A;  2FUG 2;  1OYW A;  1MBF A;  2F5F A;  4YIF A;  5HS7 A;  2L9V A;  2E2J J;  3H3U A;  3FXO A;  1IV6 A;  4HEA 2;  1APL C;  5LBQ A;  1IN7 A;  1LEB A;  4OWR B;  1FLI A;  3JAM K;  3EPZ A;  1UST A;  3D5L A;  1T0F A;  2TDX A;  5GPA A;  3G71 I;  2LTP A;  5B66 C;  3SFZ A;  4J00 A;  5H20 A;  5DM6 F;  3TP0 A;  3MQ0 A;  1AKH B;  2GOM A;  4EMS A;  4WX9 A;  4E7J A;  2OTL I;  2QQ9 A;  5DUI A;  2DJI A;  3PJR A;  4ABZ A;  2E36 A;  3NNR A;  2EV6 A;  1D0Z A;  2QGU A;  4MNU A;  4F93 B;  1FMW A;  4KIG A;  1ZN2 A;  1PUF A;  3CC2 I;  3SZT A;  3FBI B;  4P55 A;  4A6E A;  4QTR A;  2F5E A;  2EIJ H;  4V2F A;  1QZY A;  3M07 A;  5DCF A;  1WWX A;  1F36 A;  1TQP A;  4QLC U;  4XLC A;  5IP6 A;  5EDN A;  1HDD C;  2BGC A;  4ZZD A;  4JX6 A;  5A2Q Z;  3HHG A;  5EG0 A;  3WTZ A;  2UXX A;  4A69 C;  3OYH A;  4UNO A;  1ON2 A;  4ZTF A;  2ME0 A;  3FXJ A;  2V9K A;  2K27 A;  4L5I A;  3F8M A;  4FET A;  3GTO J;  2ZNY A;  2M8E A;  4RGU A;  2LSO A;  2EFO A;  3BR0 A;  2V1D A;  2M5W A;  3WE3 A;  3EET A;  4E6K G;  5A2Q K;  1RIO H;  3VUQ A;  1WJ5 A;  3E3V A;  3FM5 A;  1RR8 C;  2V79 A;  3K4N A;  5HLT A;  2MA3 A;  1YW7 A;  1MBG A;  1UHW A;  2DOA A;  4O3M A;  5J8C A;  3WTV C;  1J75 A;  3ZN0 A;  3CCS I;  3CCQ I;  1SD7 A;  3C1D A;  2GFN A;  1MH4 A;  1J59 A;  5EEG A;  1HA8 A;  1BI3 A;  1W36 D;  4KIT B;  2QEN A;  3H3Z A;  3KEO A;  4KN4 X;  3ESW B;  1I1G A;  1FMV A;  5K7H A;  1UG0 A;  1VQ9 I;  2F2E A;  1UEL B;  2XV4 S;  4NQW A;  3OYI A;  3NPI A;  2Q1Z B;  4KIS A;  4B47 A;  3L09 A;  2XB5 A;  1AHD P;  2ZME C;  1AWC A;  4LG3 A;  3FMS A;  4RB0 A;  1TL8 A;  2FD5 A;  2H09 A;  1LVK A;  2CS3 A;  4BDY A;  3E5X A;  1QO0 D;  1W5C C;  4OAY A;  1C0W A;  2X6O A;  2FSW A;  2BXZ A;  1IDY A;  3BR1 A;  2AXT C;  1IXC A;  2ESN A;  1ZH5 A;  1FNN A;  5EGO B;  2JK3 A;  1A35 A;  3DCF A;  3PL8 A;  2UUZ A;  4Y15 A;  2E34 A;  4Q4Z F;  2QWW A;  4RAG A;  3A01 B;  4L9T A;  2IS2 A;  2UXI A;  4EAT A;  2PI0 A;  2XGE A;  3ZQH A;  1HW5 A;  3OYM A;  3LJL A;  1T08 B;  3W3C A;  2DA4 A;  3ZQ7 A;  1A5J A;  3HOY J;  2LF7 A;  5K5O A;  3HYI A;  1X1A A;  3JSP A;  1IAW A;  3K69 A;  3IH4 A;  3PAS A;  4EGY A;  2EZH A;  3BPV A;  3OS1 A;  2D45 A;  1N78 A;  2YPR A;  2HDD A;  2DG8 A;  4HX7 A;  4G8X A;  4ENM A;  1S5L C;  4D7N A;  3DTK A;  3MCZ A;  1TLH B;  1WKM A;  3Q0U A;  2YS9 A;  3ZQI A;  3I4M J;  4EJU A;  4G9Y A;  5E3M A;  2IRF G;  2UXN A;  3ZXS A;  4DZP A;  1P9Q C;  3BTL A;  2ECC A;  3EUH A;  2DT6 A;  3TW6 A;  2R7Q A;  4EM0 B;  4A3E J;  1CF7 B;  2EFW A;  1QBJ A;  2IS6 A;  2W24 A;  1LEA A;  3K10 A;  4B4C A;  2RV8 A;  3ABM H;  3LST A;  3J80 K;  1ZR4 A;  1K4T A;  2X51 A;  3DU6 A;  5ILV A;  1AU7 A;  4L18 B;  4G12 A;  4IRG A;  1FOK A;  4FT8 A;  3J7A Y;  3DPT A;  2M3A A;  2HQA A;  3BG7 A;  3RI4 A;  1W7P B;  3V78 A;  3CRJ A;  2E1N A;  3SEQ A;  3PQJ A;  5EFY A;  2CW8 A;  3QOE A;  4Q47 A;  4LB5 A;  4LLN A;  1OMI A;  3BP8 A;  4LIU A;  2VQG A;  5CVV A;  2EZL A;  3M7G A;  2PBI A;  1S7A A;  5LFA A;  5L3B A;  4HX4 A;  4A5N A;  2Y0S A;  3B73 A;  2Y0S N;  2HI3 A;  3CUQ C;  4ZDL A;  4FAS D;  2F5C A;  1B72 A;  1HW1 A;  4B3X A;  2JPC A;  2MAB A;  2FXA A;  3H9Q A;  4IPA A;  4FHT A;  3V42 A;  4ANJ A;  3S3M A;  3I0T A;  2OCC H;  2DFF A;  4XN0 A;  2Q2E B;  2Q24 A;  3G2B A;  3ANP A;  1Z21 A;  3LWF A;  1VTN C;  3QYF A;  2K3F A;  5CW8 A;  3P9C A;  2LBF A;  4YFN F;  1ITY A;  3ISP A;  5K58 A;  1ZRD A;  3CJD A;  5GAE J;  1ERD A;  3KP7 A;  3W6J B;  1O57 A;  2XAG A;  4BNC A;  2G7S A;  1L3L A;  4MLO A;  2MD0 A;  4I0A A;  1YIT I;  3GEU A;  3OS0 A;  1LPQ A;  1DP3 A;  5AIQ A;  2P5L C;  1R36 A;  2YX4 A;  4MFD A;  2PFB A;  5DM7 F;  3DKW A;  4CA0 A;  3CMY A;  1Y6I A;  1Z77 A;  3JRI A;  2O61 A;  4IHT A;  2FML A;  2PJR A;  5IYD J;  2Y9Z A;  5KVR A;  2M2E A;  1S8N A;  3TED A;  2GBY A;  3HG9 A;  4AVP A;  1WCM J;  2LRE A;  2X48 A;  2E71 A;  1OCO H;  1R4M B;  3BJB A;  1MBH A;  3V4G A;  3H5N A;  1OLT A;  4GCK A;  2KPM A;  2DMU A;  2IGK A;  3V7S A;  4FE4 A;  4F52 A;  2RNJ A;  5FLV A;  1O7L A;  1JGS A;  2PMU A;  1W5S A;  3BJO A;  2DLL A;  3KP4 A;  2PZ9 A;  3FIS A;  3HJE A;  2QQ8 A;  5F0H A;  2JVH A;  2RNG A;  4XN3 A;  3JRH A;  2QA4 I;  3R60 A;  1ETX A;  2STW A;  2DTR A;  2QUF A;  2DBB A;  2IPQ X;  1BN5 A;  2BZT A;  2JN6 A;  4GXO A;  1ON1 A;  4II3 A;  5D8K B;  2UV1 A;  2L7K A;  2K7L A;  2EFN A;  1FY7 A;  3CLO A;  2A6H F;  4L5E A;  1WJD A;  2ZXJ A;  5DD8 A;  2QSG X;  4HV6 A;  2QLZ A;  4A3I J;  1D8J A;  3BJ6 A;  2HTJ A;  2HDC A;  3CJT B;  3E7Q A;  2KQR A;  1UHM A;  1W1W E;  2IGN A;  3N4M A;  4XOR A;  1JGG A;  2JA5 J;  2REK A;  2ZCX A;  2HNH A;  3VPR A;  3VSL A;  4YFK F;  3JRC A;  4UXN A;  1ZR2 A;  4XLA A;  2XPV A;  1BR1 A;  3CC4 I;  2E1M B;  5CQE A;  1Y0U A;  1I3Q J;  1PYV A;  1RES A;  1YLF A;  2EIM H;  4PJ0 C;  1Q1H A;  3CO6 C;  3MFK A;  5BPI A;  2R7X A;  4BS9 A;  2LY2 A;  2XSJ C;  3Q0V A;  3HSE A;  3UNG C;  5F1J A;  3LA3 A;  1S6L A;  4CZC A;  2DK5 A;  1MDM A;  3TP3 A;  5D6E A;  5ED4 A;  2ZJ2 A;  5IYB J;  1ULY A;  4G7H F;  2D1H A;  2ELK A;  3PPB A;  3JCU C;  2A68 F;  4MFE A;  1HF0 A;  2W85 A;  3ZRG A;  2K3P A;  2XAF A;  1IN8 A;  4UVB A;  1YIJ I;  2A61 A;  1BW5 A;  5HAW A;  3OS2 A;  2MH9 A;  1WJA A;  4L0Z B;  2M7A A;  2OZ6 A;  2KJB A;  4P1W A;  3F1B A;  1ZYR F;  1XGM A;  2DN0 A;  5TGT A;  1SC7 A;  2M8G X;  4L9N A;  1XC5 A;  2L3D A;  5FD5 A;  4OD4 A;  5EG0 B;  2JUG A;  1QZZ A;  4O6J A;  4RM2 A;  1E3O C;  3ZOB A;  4P9U A;  3GZI A;  3CES A;  1B8I A;  1E3H A;  1FWZ A;  3M1E A;  1ZG1 A;  1MMG A;  4BJ5 C;  3J7A O;  2VON A;  2DA3 A;  2ZME A;  1T8I A;  3MKL A;  3D1N I;  1BIB A;  5D4R A;  2GM4 A;  1D0Y A;  2J5O A;  2HQR A;  4DYQ A;  2DK8 A;  3FIW A;  2WA0 A;  1QU3 A;  4F92 B;  1J2X A;  3IUV A;  3BCB A;  3TOB A;  1G3Y A;  4EJT A;  5IP9 J;  2WWY A;  1D5V A;  4M6X A;  4ZYA A;  3EGQ A;  1I3A A;  5CVU A;  5LRS A;  1S7E A;  4IXA A;  3SEZ A;  2G7L A;  2L9S A;  3OL4 A;  1K78 A;  3CF2 A;  1SFU A;  3CMA I;  5HOD A;  2R7T A;  3CCY A;  2DCE A;  4QPO A;  4OIR F;  1ZG5 A;  1NK2 P;  3FHN A;  1V5E A;  4KJZ A;  5E1Z B;  1OFC X;  1Z6T A;  3R61 A;  3ULQ B;  2E5N A;  3LOC A;  3KYC B;  2ZJQ F;  5F0F A;  4MHG A;  3KZY A;  1PJR A;  3RD3 A;  4ON0 A;  4JL3 A;  3VSK A;  1MNM C;  2E1C A;  3KP3 A;  2RQP A;  3DXJ F;  2CQK A;  1XPX A;  1WJC A;  5H9T A;  2NX4 A;  1J0R A;  3KLO A;  2JRT A;  4RAZ A;  4XL9 A;  3HOU J;  1GUU A;  3VW0 A;  3OYE A;  3I59 A;  4GCT A;  1BBY A;  1W0T A;  4XOP A;  1F43 A;  5D5W B;  1IRF A;  1YS7 A;  2JA6 J;  1P4X A;  2K86 A;  4IHW A;  4EGZ A;  5KCM A;  3PIO F;  2O03 A;  1XDU A;  4LLL A;  4PFO A;  2HPI A;  1DPU A;  3ROU A;  5GAD J;  1D1B A;  3WG9 A;  5C4J J;  2R7U A;  3MN2 A;  1VZ0 A;  3QPH A;  1ODD A;  3CJQ B;  5F0C A;  3S32 A;  3HOW J;  3OOP A;  3LSI A;  3OSF A;  3UR3 C;  2VKE A;  4BHP A;  1X19 A;  3WTU C;  4DYR A;  3C2H A;  3OYJ A;  4UDS A;  5K5Q A;  2O0Y A;  1J5Y A;  5JLW A;  4RLQ A;  4RGR A;  2PLY A;  2R0Q C;  4AIJ A;  2EZI A;  2WY7 Q;  4S05 A;  3DU5 A;  5FFX A;  3CUQ A;  3HRU A;  4HNT A;  1SFK A;  3IH2 A;  4PK4 A;  2YSR A;  3KYL A;  2QSH X;  3M8F A;  3V7R A;  3HHH A;  1O3R A;  3S3O A;  1MKM A;  5HOO A;  2QM3 A;  1X1C A;  5ILU A;  2OU2 A;  3GTL J;  3HOT A;  1IN4 A;  2LR8 A;  1R5G A;  1EH6 A;  1FSE A;  4YRV A;  1Z3Y A;  2XKO A;  3BOQ A;  2FBK A;  3OR2 C;  5E3L A;  3DLA A;  1YW8 A;  4Z6Y A;  2KIQ A;  3FHZ A;  2BY3 A;  1TP4 A;  2Y48 A;  5BQT A;  1X2M A;  4WCG A;  4CYC A;  1MJ9 A;  5HLG A;  3GTM J;  3CME I;  2K4J A;  1WJE A;  1PP8 F;  4MTD A;  2COM A;  3VYU B;  2OI8 A;  4ME9 A;  4C2M A;  3NQO A;  3TDZ C;  3JTH A;  2Z16 A;  4CXF A;  5FGL A;  4I09 A;  4JKZ A;  5ICC A;  1FP2 A;  2DTZ A;  4PUS A;  4YIR X;  3VVX A;  2IP2 A;  2YX7 A;  2FOW A;  5KK1 A;  4M3F A;  5FKM A;  4JNN A;  1YJW I;  4RGX A;  2BV6 A;  2R7S A;  1WVR A;  3DLL F;  2VBY A;  3OYN A;  2BBY A;  1R1V A;  2FF4 A;  3HC7 A;  3BQY A;  3ZMV A;  3GVA A;  3K2Z A;  3C2G A;  1U6G A;  3VYS B;  3U21 A;  1G6N A;  3IH3 A;  2W4S A;  2DI3 A;  3RSN A;  1HW2 A;  5M5W J;  2Z3Y A;  3E0J B;  1H8A C;  2LBF B;  5E79 C;  1V4R A;  2CGP A;  2AQF A;  1D1A A;  2RQQ A;  5FKO A;  4M3E A;  4FX4 A;  1KYW A;  4O5V A;  2JA2 A;  2QCO A;  3HOS A;  1VQM I;  2ZSH B;  1FTZ A;  4M73 A;  1FYL A;  2XGX A;  3DBH B;  3CD6 I;  1MH3 A;  5BOX A;  3HL2 A;  1EJ9 A;  1LNW A;  2Y30 A;  1F9N A;  3Q9S A;  3R0A A;  1XCV A;  3LSJ A;  3CC7 I;  3AQT A;  5IT9 K;  3GTJ J;  3IWZ A;  3GCM A;  1F1Z A;  4B8X A;  5KAI C;  1ZGA A;  2DT5 A;  3K4B A;  3ASO H;  4UUS A;  2DMQ A;  5D5X B;  3S2D J;  1SFX A;  3I71 A;  2XIG A;  2CRG A;  3GEZ A;  4QWQ A;  2OBP A;  4KUM A;  3BNI A;  4BQQ A;  1ZKG A;  3DV8 A;  3WU2 C;  3M8E A;  4I98 B;  4IO9 F;  2DQL A;  2Y31 A;  2L02 A;  3GTK J;  4ZDP A;  2D6Y A;  4HRI A;  2FE3 A;  1I6H J;  3K4L A;  3OR1 C;  3OYL A;  3JR9 A;  2VOD A;  2K9S A;  2E2H J;  1Y8Q B;  1V5F A;  4HNV A;  3CLQ A;  4U0Y A;  3M3Y J;  3CO7 C;  3MKW B;  5EZH A;  2MG4 A;  2VJ5 A;  4CCK A;  2BYV E;  3QPL A;  2JT1 A;  5C4X J;  1LFU P;  2LY1 A;  3F8N A;  4KIC A;  3FK6 A;  3DKY A;  2JTV A;  1IUY A;  4F91 B;  2HYF A;  2VC1 A;  4DYC A;  4A3J J;  1P4A A;  4WK8 F;  1ZK8 A;  3L00 A;  4MIM A;  3A0H C;  4XRS G;  1GT0 C;  4EQQ A;  2MD5 A;  3S15 J;  3GLL A;  1TT5 B;  3HTU A;  3AG3 H;  3F9K A;  2OV7 A;  3R0J A;  2CUJ A;  4YFX F;  5E1W A;  3JSO A;  1RI7 A;  5K7Z A;  2QVO A;  1YFH A;  3RIR A;  3FWE A;  3RTR A;  4XKC A;  3I3L A;  3V8L A;  2VLA A;  2O8K A;  3HDD A;  2LYC A;  3GZ5 A;  2XC7 A;  4CGZ A;  2LY9 A;  3VFZ A;  2XDV A;  1TNS A;  1OQY A;  2CQN A;  1IRG A;  1MDM B;  2R92 J;  4EV0 A;  3PFY A;  3ABL H;  4Y33 A;  1V3F A;  2UXP A;  3I9V 2;  4RAF A;  3RPU D;  4BBR J;  4IJA A;  3FZV A;  2TRT A;  4OU0 A;  4XOT A;  3LHQ A;  1IXR C;  4HQE A;  1NK3 P;  4ENJ A;  3F3X A;  3S5R A;  1W5T A;  1MD0 A;  1RPW A;  3GYH X;  2HGC A;  2CQQ A;  2NYX A;  3IL2 A;  1IO2 A;  1OPC A;  1K4S A;  1GVJ A;  4CCJ A;  4W1U A;  1SD6 A;  3L1P A;  1XX5 A;  5GAG J;  3ZQG A;  1VFC A;  3K1M A;  3KPH A;  1G59 A;  4WWC A;  2E5Z A;  2QKM B;  2L4M A;  4BGD A;  4OIQ F;  4LFU A;  1LUJ B;  2NRA C;  4MK6 A;  3MWM A;  2VUM J;  1BOB A;  2ZC2 A;  2ZME B;  2AO9 A;  2AXL A;  2DFH A;  3RPU A;  3Q3S A;  3TBI A;  4M9Z A;  3EQL F;  1VQO I;  3MKY B;  3ZMD A;  2R7O A;  4WXD A;  3IUO A;  2ESH A;  1B4A A;  1XGN A;  4IZZ A;  2M4K A;  3HEF A;  4EJW A;  3W2W A;  5HNF A;  2V26 A;  2P5K A;  1ORK A;  4FIS A;  2R5Z A;  4KN7 X;  4JX4 A;  1G8X A;  2IJL A;  1K78 B;  3S93 A;  2KIU A;  3BLY A;  5ICG A;  3O6B B;  5HS9 A;  2LH9 A;  2NS7 A;  1EH8 A;  2NS0 A;  2YVH A;  2Z1D A;  4IHY A;  2FOK A;  4A2U A;  4M9X A;  2JQ7 A;  4JP0 A;  1WJF A;  3KZI C;  3S14 J;  1EKE A;  2JSP A;  1IRZ A;  1T2K A;  3SQN A;  3IRR A;  5FLX Z;  3PNT A;  4U0W A;  3GFJ A;  2EK5 A;  3WGG A;  1GXQ A;  1DGR M;  1UG2 A;  3I59 B;  4XLH A;  2M45 A;  2Y0M A;  5CVJ A;  2UXH A;  2V7F A;  1D3Y A;  4K2E A;  2UWM A;  1YRN B;  3GTP J;  2XRL A;  4N0B A;  1GDT A;  2MYS A;  5F6F A;  4ZYE A;  1W0U A;  1V54 H;  3KX2 A;  5FLX K;  1TQI A;  1WGX A;  2CUZ A;  2EWN A;  3KP6 A;  1IN5 A;  1R6R A;  1FP1 D;  3CDH A;  2YR2 A;  2H1L A;  2FQ4 A;  5IT3 A;  3VP5 A;  1LFP A;  1BI1 A;  2QWT A;  2A69 F;  1KU3 A;  3JRD A;  2P8T A;  1M1E B;  1U5T C;  4BAY A;  5H6Q A;  3CUQ B;  2PEX A;  5DCM B;  2DJN A;  4IOC F;  5AQC A;  5M5Y J;  2KL4 A;  3QP6 A;  5FFZ A;  4M72 A;  1AA7 A;  1SAU A;  2PG4 A;  4HAM A;  3H1C A;  2BHZ A;  1WPK A;  1ONV A;  4FTH A;  1ZRE A;  3E7L A;  4MTE A;  1J09 A;  4LIV A;  1Z3X A;  2ZO4 A;  3HRT A;  4LK1 F;  3P5J A;  3BR6 A;  3JRF A;  1TQM A;  2ICW G;  2L01 A;  3ZR8 X;  4OD5 A;  1JJ8 C;  1X4P A;  4B3A A;  3KFW X;  1HOM A;  1GV5 A;  4LG0 A;  1QQI A;  3ECO A;  3QU6 A;  2PX9 A;  4G7Z F;  2DXI A;  1CQT A;  1SMY F;  2DA2 A;  2FRH A;  2G7G A;  3EUP A;  4JYK A;  2XAU A;  3W2A A;  2K9M A;  3RKQ A;  3DQV C;  4CYC B;  1MIJ A;  4C3I J;  2JUC A;  2KRC A;  1MW7 A;  1VF9 A;  3RZO J;  3DKX A;  1BI0 A;  2GIZ A;  1JKP C;  4GDF A;  4YG2 F;  3BTI A;  1YE9 A;  1FX7 A;  4NC7 A;  4TV7 A;  2VKD A;  2OA4 A;  5D5U B;  3OYD A;  3BZK A;  2BW3 B;  1LKX A;  4ZTJ A;  5DV5 A;  3LSH A;  3OY9 A;  5FMP A;  3L9F A;  4RLF A;  4ENN A;  4HKU A;  2B7E A;  2XPW A;  4U7B A;  2NP3 A;  4ICH A;  1TWC J;  3HB9 A;  3MMY B;  3GBG A;  1MZB A;  3MVP A;  2CFO A;  1SGM A;  2HVS A;  2NVU B;  1XB4 A;  4RB3 C;  2P6T A;  2GWR A;  2DFE A;  2ZCW A;  2EFQ A;  4A5M A;  4E7Z A;  3DPU A;  3LSG A;  4I99 C;  2FBH A;  3VIB A;  1LDK B;  2P81 A;  2OD5 A;  3C3W A;  1QHH D;  3K7A J;  1O3S A;  3HTI A;  4M3D A;  4MEX F;  3L2R A;  3NWS A;  2BVL A;  2JA8 J;  3GLX A;  5M3F J;  5E3N A;  1O3T A;  5ERI A;  2V6E A;  4XSX F;  3EUA A;  1G3T A;  3SJM A;  2OZU A;  2VJ4 A;  5DD4 A;  1ZLJ A;  1YW9 A;  3SZP A;  3QPS A;  4BHC A;  1H9T A;  2WV1 A;  3I58 A;  1P4W A;  3K6G A;  2ZXH A;  3GME A;  2LKX A;  1HKQ A;  2WB1 A;  3BT9 A;  2WB1 N;  3AKZ A;  4BHB A;  1RNL A;  1R1U A;  2A5Y B;  1IZ1 A;  4EJV A;  4UUS B;  1KYZ A;  1WQ2 A;  2HFH A;  1W4M A;  3LSP A;  3HTA A;  1OKR A;  3D0S A;  4GO1 A;  3ML6 A;  4XQF A;  1UJ8 A;  5DS9 A;  3GFI A;  5GPC A;  2EV0 A;  5J47 A;  5K1Y A;  5M3M J;  3LMM A;  3NRV A;  4RAY A;  1A04 A;  1HBX G;  5CYV A;  2ZKZ A;  1R4N B;  2JVG A;  3RQI A;  1A31 A;  1XTA A;  3JSJ A;  3O2P E;  4RGS A;  2HVR A;  4DGW B;  3VW2 A;  1ZHF A;  3T6N A;  4V19 K;  4U88 A;  1K7A A;  2LKP A;  3F21 A;  2XAJ A;  1BL0 A;  3BTC A;  1I5Z A;  3CCR I;  4BQN A;  2DOF A;  3MNL A;  3SZG A;  2FEZ A;  5AON A;  2LP0 A;  2CYY A;  4IRI A;  1RR7 A;  1U8B A;  2L5Q A;  2M1B A;  1JKQ C;  3K70 C;  4H4K C;  4HX8 A;  1S7O A;  2PBX A;  1B9M A;  1AOY A;  2F4O B;  1Y56 A;  4Y4R A;  2R93 J;  1I6X A;  4I0B A;  4QSH A;  4CCN A;  3HPH A;  1FSH A;  5ICE A;  1H9G A;  2OUM A;  4H0E A;  2QKL B;  1P6R A;  1MMS A;  5B1A H;  2XRN A;  4E70 A;  1R5H A;  3HE0 A;  3PNY A;  1KON A;  2F5V A;  2ME6 A;  1RC9 A;  2FBQ A;  4ZH4 F;  1T95 A;  2WTE A;  3OMY A;  4LB6 B;  4BDZ A;  1ETK A;  3VVZ A;  2WUI A;  1JUP A;  3PIP F;  2DDA A;  2L9N A;  1Y1W J;  5C4Y A;  1VI0 A;  3KCC A;  4RBO A;  1HKS A;  4N9H A;  3FXU A;  4B44 A;  5LEJ A;  2XDN A;  1S9H A;  3GFM A;  1OYI A;  2VJJ A;  3HSF A;  2B63 J;  3K1N A;  3A1Y A;  1X58 A;  4HPQ A;  4N4N B;  2HS5 A;  2CO5 A;  2CW7 A;  2HU9 A;  1T98 A;  2HVQ A;  3FXR A;  3G4S I;  4CGR A;  1HDP A;  4EM2 A;  3KLN A;  2G3B A;  3FBN B;  3N97 A;  4UUT A;  3VOK A;  1TZL A;  2X1D A;  4ZZL A;  3TMO A;  2CSO A;  3LAP A;  5BMZ A;  2FQ3 A;  2LMD A;  3NS4 A;  3PQK A;  3B02 A;  4DJA A;  1U9N A;  4XKV A;  1RKW A;  3L2Q A;  3TL4 X;  2M0M A;  4B48 A;  4S04 A;  1PUE E;  3S1R J;  4X1E A;  1K6O A;  1BOA A;  2XKP A;  2R7V A;  3AG1 H;  3BQZ A;  3OYF A;  4DOZ A;  2R5Z B;  3H0D A;  2VN2 A;  1KU2 A;  4CYD A;  3ELK A;  2DQR A;  3OYG A;  2MC4 A;  1QNT A;  3BCA A;  4DBQ A;  2MGQ A;  1Q1V A;  2QKO A;  3ANG A;  4JOM A;  1UFM A;  5FGM A;  3HM5 A;  3F6V A;  4XBF A;  2KDO A;  2JWT A;  1BM9 A;  1TWH J;  4CHU A;  1PUF B;  4XKB A;  2HR3 A;  1P7I A;  3BTJ A;  3RYP A;  2NNY A;  1NG7 A;  3MZH A;  5LHI A;  1U5T A;  5FB2 A;  4GCV A;  4OMZ A;  2W53 A;  2VQH A;  3OWT A;  1HST A;  5JHF A;  3Q5F A;  3A0B C;  1ZQ3 P;  3NXC A;  1OIS A;  3SFI A;  4GYI A;  3RJP A;  1YX3 A;  3F72 A;  2HKU A;  3DTE A;  2RGV A;  2M0C A;  1T38 A;  4IOA F;  1SVL A;  3OL3 A;  4E7S A;  3RKY A;  4AIH A;  2NOJ B;  3M1C A;  2QOP A;  3REO A;  1RET A;  1RRJ A;  3GUD A;  3ABK H;  5DYM A;  5IOY A;  1XSD A;  1SEU A;  3GO5 A;  1PP7 U;  4CH7 A;  3FXQ A;  5FHP A;  1YYV A;  3QAH A;  1EA3 A;  3TO6 A;  2K02 A;  2V6C A;  2I5U A;  2RAS A;  2VC0 A;  1T56 A;  2Y69 H;  4CUG A;  4OIO F;  1FZP B;  3HGY A;  1DDN A;  1IV8 A;  1UCR A;  4GRI A;  3CCL I;  3BR5 A;  1SAX A;  4UVA A;  3NEU A;  3OIO A;  3H0G J;  4KYW A;  2ELH A;  4ETS A;  5HDK A;  2P4W A;  4WXC A;  4HF2 A;  2XRO A;  1OCR H;  2H1K A;  2DYR H;  4AC6 A;  3KP2 A;  5F04 A;  1T33 A;  2P0W A;  5KNL A;  4ACI A;  3SDB A;  2V1N A;  4M3B A;  2PFV A;  4PSW A;  1YQA A;  1Z1D A;  2BEO A;  1QVT A;  1X3U A;  2IXS A;  1SD4 A;  4NQW B;  4LG0 B;  1YX5 A;  5J4V A;  3BG9 A;  2JRM A;  5M5X J;  3IHU A;  3BRU A;  2OAZ A;  4L9V A;  2VT3 A;  3BG3 A;  2X6W A;  3H92 A;  1LFB A;  1HQC A;  2H8R A;  3CP2 A;  3CJN A;  4DQ2 A;  2DG7 A;  4Z2Y A;  4UB6 C;  4PJJ A;  1MSE C;  3K8P C;  2EZK A;  3DWL E;  2VI6 A;  2QQB A;  1G2H A;  3QPT A;  4XMY A;  4JX5 A;  3QWL A;  3BHQ A;  4XKW A;  2VIX A;  3MAJ A;  2EQR A;  1T6S A;  2B9S A;  3SDG A;  4LJZ F;  3GWZ A;  1X1D A;  4UUV A;  2DMP A;  5FRN A;  5L3D A;  2PJP A;  1X3W B;  3ON2 A;  1P7J A;  4C3H J;  2DA1 A;  2VBW A;  2E1M C;  1WRJ A;  1XD7 A;  5LEK A;  2ZJR F;  1R9T J;  4A0Y A;  2ZXI A;  3G3Z A;  3K70 D;  3ZMZ A;  2V9P A;  4KMF A;  1MGT A;  4I01 A;  1NHA A;  2EIL H;  5FLM J;  2NP5 A;  2O7T A;  2UXU A;  3VB2 A;  5BPD A;  2JPB A;  2HEO A;  5IOZ A;  2R7Z J;  5E1X A;  1KU7 A;  2QQA A;  3OIQ A;  2QBY A;  5JR3 A;  2EV5 A;  3BG6 A;  3QOP A;  5BNG A;  3JRA A;  3J7Z I;  2H27 A;  1I39 A;  4WXH A;  3MKZ A;  2B3W A;  2G7U A;  4UVC A;  1DU6 A;  3G6E I;  4UV9 A;  2GEN A;  4A3D J;  3CZ6 A;  3M9A A;  1IN6 A;  4LOC A;  2LDU A;  4M74 A;  5D4S A;  3HRM A; 
#chains in the Genus database with same CATH homology
 5F08 A;  4AYB N;  5K7F A;  4XRS A;  3IH4 A;  3W6V A;  2NVX J;  3PAS A;  4MK6 A;  2EZH A;  2VUM J;  2DG8 A;  2HDD A;  2HOS A;  1JTX A;  1B72 B;  4A3C J;  2AO9 A;  2LK2 A;  4D7N A;  1I50 J;  2XSD C;  5C3E J;  3Q0U A;  2XPU A;  2YS9 A;  3ZQI A;  3Q3S A;  3I4M J;  5E3M A;  2YU9 J;  1IUF A;  4AUX A;  2EH3 A;  4DZP A;  3P9T A;  3BTL A;  2ECC A;  3TW6 A;  4I6Z A;  5HBU A;  4A3E J;  2O9L A;  2IBD A;  1ZR4 A;  4B4C A;  2I10 A;  3HEF A;  2KDZ A;  1NTC A;  1GV2 A;  1AU7 A;  1ORK A;  4FIS A;  2R5Z A;  4G12 A;  4JX4 A;  2IAI A;  4A3G J;  2ZCN A;  1O4X A;  1IJW C;  2NS7 A;  3V78 A;  3CRJ A;  2YVH A;  1WH7 A;  4IHY A;  5EFY A;  2WGB A;  1QPI A;  1FIP A;  5CXI A;  2GUH A;  3HGG A;  1K83 J;  4JP0 A;  1FTT A;  5J1Y A;  1ETQ A;  3S14 J;  3VVY A;  1IRZ A;  2EBI A;  2EZL A;  3RZD J;  4PXI A;  1RKT A;  1TWG J;  2ID3 A;  3S17 J;  2Y0S N;  2HI3 A;  1B72 A;  3QQA A;  1UG2 A;  2QIB A;  2NVQ J;  2UXH A;  1MBJ A;  2PMZ N;  1U78 A;  1YRN B;  2Q24 A;  1ZGW A;  3GTP J;  2XRL A;  1GDT A;  4BY1 J;  3S16 J;  2HXO A;  5IPA A;  3ANP A;  3G56 A;  1W0U A;  5CW8 A;  2VKV A;  1WGX A;  4IEJ A;  1IC8 A;  2K9N A;  1ITY A;  1JTY A;  3Q0W A;  2CUE A;  3G1O A;  1FIA A;  2Y9Y A;  5K58 A;  2OPT A;  1K61 A;  3CJD A;  2G7S A;  1AKH A;  2XB0 X;  2FQ4 A;  4MLO A;  3HOV J;  5FKN A;  2V57 A;  2HOA A;  3LNQ A;  3VP5 A;  3GEU A;  2L9R A;  2QWT A;  4A93 J;  1OCP A;  4MFD A;  4A3F J;  1LE8 B;  2X9D A;  3JRD A;  3CMY A;  2G0E A;  1Z77 A;  3JRI A;  1Y1V J;  4J19 A;  2DJN A;  3G1L A;  1UI6 A;  5AQC A;  5M5Y J;  4L62 A;  5IYD J;  5FKK A;  2Y9Z A;  5J3L A;  2M2E A;  1WPK A;  3TED A;  2GBY A;  4S0H B;  4FTH A;  4M3G A;  3E7L A;  5EZG A;  1WCM J;  2X48 A;  3KKC A;  3K2A A;  1YRN A;  3BR6 A;  4BKX A;  3JRF A;  1MBH A;  3BJB A;  4FE7 A;  1JJ8 C;  4B3A A;  4GCK A;  1HOM A;  1GV5 A;  2DMU A;  3CWR A;  2ZB9 A;  3B6C A;  4FE4 A;  1D5Y A;  1CQT A;  5FLV A;  1XG1 A;  2IEK A;  2DA2 A;  3EUP A;  2G7G A;  4JYK A;  4BBS J;  1QRY A;  2D5V A;  3S1N J;  4NEL A;  3RKQ A;  2AHQ A;  1H88 C;  1MSF C;  4CYC B;  2NOG A;  2PZ9 A;  4XIC A;  3FIS A;  4C3I J;  5F0H A;  2ZOZ A;  4W97 A;  3JRH A;  1VF9 A;  1IDZ A;  3RZO J;  3OOU A;  3CDL A;  1ETX A;  1JKP C;  1BA5 A;  3BTI A;  3PO3 J;  2JN6 A;  1FEX A;  4BXX J;  4L5E A;  5FMP A;  3VW1 A;  4A3I J;  2NP3 A;  2XPW A;  4MO7 A;  4HKU A;  4ICH A;  1TWC J;  3HB9 A;  3GBG A;  3MVP A;  3E7Q A;  1JGG A;  2JA5 J;  1SGM A;  2REK A;  1XS9 A;  2ZCX A;  1TWF J;  3VPR A;  3JRC A;  1ZR2 A;  2XPV A;  1B8I B;  4A3L J;  3NI7 A;  3HIM A;  1I3Q J;  1RES A;  3LSG A;  3LSR A;  2O7O A;  3VIB A;  1UMQ A;  1ETV A;  2XGD A;  5GP9 A;  2L7M P;  2L7Z A;  2P81 A;  1HLV A;  3K7A J;  3Q0V A;  5J1R A;  2HYT A;  3HTI A;  2VPR A;  1BW6 A;  4M3D A;  3A03 A;  5F1J A;  1TC3 C;  2JA8 J;  5M3F J;  1JJ6 C;  5E3N A;  3COL A;  3A02 A;  3TP3 A;  1ETW A;  5IYB J;  1QVU A;  2ELK A;  2COB A;  2ECB A;  3PPB A;  3SJM A;  3S2H J;  4MFE A;  5EGO A;  5D18 A;  5FKL A;  5IYC J;  4XID A;  3QPS A;  1HF0 A;  5HAW A;  2WV1 A;  1BW5 A;  3IV5 A;  3B6A A;  3A01 A;  1SFO J;  2LKX A;  2CJJ A;  3BT9 A;  3F1B A;  3C07 A;  2DN0 A;  2WB1 N;  4A3K J;  2M8G X;  4UUS B;  1XC5 A;  4X6A J;  2CUF A;  4Y7N J;  5EG0 B;  3QKX A;  5DAJ A;  3LSP A;  3HTA A;  1E3O C;  5E3O A;  3ZOB A;  3G7R A;  5HSZ A;  3GZI A;  5DS9 A;  2LVS A;  1B8I A;  5GPC A;  5M3M J;  4AF5 A;  2DA3 A;  2OF7 A;  3MKL A;  3D1N I;  5IP7 J;  3NRG A;  5J1U A;  3WHC A;  2GM4 A;  3RQI A;  4NDL A;  4GFK A;  4DYQ A;  3FIW A;  2L7F P;  2DA7 A;  3JSJ A;  3IUV A;  3VW2 A;  1WH5 A;  1JUM A;  3PM1 A;  3T6N A;  5EYR A;  2QF7 A;  4XK4 A;  5IP9 J;  1TWA J;  1BL0 A;  3BG5 A;  3BTC A;  2NVT J;  3EGQ A;  2UXO A;  1VND A;  2DMT A;  5D1R A;  2RHA A;  5FJ8 J;  3HOZ J;  3MNL A;  1S7E A;  1H89 C;  1MBK A;  2G7L A;  3AQS A;  5HOD A;  1ZTR A;  3CCY A;  1EF4 A;  3I4N J;  2LP0 A;  4D5C A;  1NK2 P;  3GTQ J;  3S1Q J;  1RR7 A;  1U8B A;  1OFC X;  3S1M J;  3LOC A;  1JKQ C;  5F0F A;  2WAQ N;  2PBX A;  2KT0 A;  5CXG A;  3RD3 A;  2LFB A;  4JL3 A;  2R93 J;  1A6I A;  1MNM C;  2DA6 A;  4A3B J;  1OJL A;  1BJZ A;  2FX0 A;  2JA7 J;  3BR3 A;  3G1M A;  4QSH A;  1JKR C;  3OSG A;  3ZQL A;  1UHS A;  2R5Y B;  2NX4 A;  5H9T A;  2ID6 A;  2K40 A;  3HOU J;  1ENH A;  1GUU A;  3VW0 A;  4M6V A;  4GCT A;  2N8G A;  3HE0 A;  5D19 A;  1W0T A;  3O60 A;  1F43 A;  3KZ9 A;  1JT6 A;  2ME6 A;  3ZQC A;  2JA6 J;  2FBQ A;  4IHW A;  3VVZ A;  1ETK A;  2WUI A;  1JUP A;  2TCT A;  1Y1W J;  5C4Y A;  1VI0 A;  2IU5 A;  4YZE A;  5C4J J;  4RBO A;  5EF6 A;  3MN2 A;  2DA5 A;  3TW7 A;  5F0C A;  3O8H A;  2XDN A;  3HOW J;  2B63 J;  3UKG A;  4GFL A;  3OSF A;  2VKE A;  3BR2 A;  1GVD A;  1X58 A;  2GLO A;  4DYR A;  3FRQ A;  3H3V K;  4UDS A;  5JLW A;  4C3J J;  4Y52 J;  4CGR A;  1HDP A;  2G3B A;  3NAR A;  1LE8 A;  3CQZ J;  2R0Q C;  2EZI A;  3C2B A;  4UUT A;  2YVE A;  3VOK A;  1DU0 A;  4KWA A;  1IG7 A;  3IH2 A;  2RAE A;  4GCL A;  4EEF G;  1WI3 A;  1U9N A;  3DEW A;  2NVY J;  1RKW A;  4AC0 A;  4B1R A;  3JRG A;  3S1R J;  4IHX A;  4X1E A;  3GTL J;  2LR8 A;  2HXI A;  3BQZ A;  5DTD A;  3HOX J;  3JRE A;  2R5Z B;  2JJ7 A;  3WHB A;  2XGC A;  5C44 J;  1UI5 A;  5E3L A;  4NN1 A;  1POG A;  2MGQ A;  3HTH A;  1Q1V A;  3PO2 J;  2QKO A;  1X2M A;  3ANG A;  4CYC A;  3KNW A;  4MXM A;  3HM5 A;  4QIW N;  2HQ5 A;  4C2M J;  5F27 A;  1SAN A;  2JWT A;  2M34 A;  2K9Q A;  1OCT C;  1TWH J;  3HBL A;  3GTM J;  2HYJ A;  1MBE A;  3ON4 A;  4D5F A;  3JRB A;  1PUF B;  3VOX A;  1P7I A;  3BTJ A;  2W48 A;  1IGN A;  2OI8 A;  4ME9 A;  3ZQG A;  5FGL A;  4JKZ A;  2DTZ A;  2W53 A;  3VVX A;  2F07 A;  4M3F A;  5FKM A;  1ZQ3 P;  3HKZ N;  3NXC A;  3F0C A;  4JNN A;  3SFI A;  2YUS A;  2HKU A;  2E2I J;  2ZCM A;  3BQY A;  1MBF A;  2M0C A;  2E2J J;  1IV6 A;  1APL C;  3IH3 A;  5M5W J;  2QOP A;  1H8A C;  1RET A;  5GPA A;  2LTP A;  5IOY A;  5FHP A;  5FKO A;  3TP0 A;  2MSY A;  4M3E A;  1AKH B;  3ZQF A;  2RAS A;  1T56 A;  1X2N A;  3HGY A;  2QCO A;  1FTZ A;  2E1O A;  4ABZ A;  3NNR A;  4A3M J;  1MH3 A;  2Y2Z A;  3BR5 A;  2QTQ A;  2Y30 A;  1PUF A;  2ZOY A;  2L0K A;  3LSJ A;  3OIO A;  4DZJ A;  3H0G J;  4QTR A;  3AQT A;  3GTJ J;  4V2F A;  4XRM A;  2H1K A;  3HTJ A;  4AC6 A;  5F04 A;  1T33 A;  1ETO A;  1F36 A;  4V2G A;  5IP6 A;  1HDD C;  5EDN A;  4ACI A;  4UUS A;  4M3B A;  4JX6 A;  2DMQ A;  5EG0 A;  3S2D J;  1Z0X A;  2CRG A;  4A69 C;  4IHV A;  1QVT A;  3BNI A;  2ME0 A;  1ZKG A;  2LD5 A;  3BG9 A;  4I76 A;  3KKD A;  2Y31 A;  3BCG A;  5M5X J;  4RDU A;  3GTK J;  3GTO J;  2D6Y A;  1I6H J;  3BRU A;  3JR9 A;  2K9S A;  2E2H J;  3NAU A;  3BG3 A;  4HNV A;  1LFB A;  3BR0 A;  2H8R A;  3M3Y J;  3VUQ A;  5EZH A;  2DG7 A;  2MG4 A;  1MBG A;  3QPL A;  1MSE C;  2EZK A;  2CQX A;  1LFU P;  5C4X J;  1JT0 A;  2VI6 A;  1G2H A;  2GFN A;  3FK6 A;  4JX5 A;  1MH4 A;  2E19 A;  3V6G A;  1U9O A;  1ETY A;  2FJ1 A;  3BHQ A;  2EQR A;  9ANT A;  3SDG A;  4DYC A;  3O8G A;  4A3J J;  1ZK8 A;  3GTG J;  4MIM A;  4FCY A;  2DMP A;  2JMW A;  4XRS G;  3QBM A;  2MW8 A;  5K7H A;  1GT0 C;  3DPJ A;  3S15 J;  3FKI J;  2HOT A;  3ON2 A;  1P7J A;  2NS8 A;  4C3H J;  2DA1 A;  3NPI A;  5K7Z A;  1R9T J;  2XB5 A;  1AHD P;  1JKO C;  1JUS A;  2O8K A;  3HDD A;  2R5Y A;  2FD5 A;  2CU7 A;  2LY9 A;  5FLM J;  2NP5 A;  2O7T A;  2UXU A;  2R92 J;  2X6O A;  3M4O J;  1IDY A;  3BR1 A;  5IOZ A;  2R7Z J;  2DMN A;  1HCR A;  2UXP A;  5BNG A;  4BBR J;  2JK3 A;  5EGO B;  3DCF A;  3JRA A;  2M9H A;  4D7M A;  2TRT A;  3LHQ A;  1NK3 P;  3LWJ A;  5EEA A;  3S5R A;  3B81 A;  1RPW A;  3A01 B;  1DU6 A;  2OER A;  2CQQ A;  4DW6 A;  2GEN A;  2UXI A;  2XGE A;  3ZQH A;  3LJL A;  4GFB A;  4W1U A;  1FJL A;  4A3D J;  2DA4 A;  5JLX A;  3L1P A;  1A5J A;  3HOY J;  4BY7 J;  3FK7 A;  3RH2 A;  4LOC A;  2LLK A;  1VFC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...