2HYJA

The crystal structure of a tetr-family transcriptional regulator from streptomyces coelicolor
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
193
structure length
193
Chain Sequence
AEAQATRGRILGRAAEIASEEGLDGITIGRLAEELEMSKSGVHKHFGTKETLQISTLDKAFVDFWHRVVEPALAEPPGLRRLRAVCANSVGYLEEPLLPGGCLLTAALSEYDGRPGRVRDAVAEVWSRWREQLRADLTAAVDKGELPAGFDVEQALFEIVAAGLALNAAMQLQHDRTAADRARRAIERALAQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Putative tetR-family transcriptional regulator
publication title The crystal structure of a tetR-family transcriptional regulator from Streptomyces coelicolor
rcsb
source organism Streptomyces coelicolor
total genus 81
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 2006-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2hyjA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2hyjA02
4ACIA 3HOUJ 4DYCA 3HGYA 4FISA 2Y9YA 3S14J 2M8GX 3G56A 1JKQC 2NOGA 4AC6A 3I4NJ 4MFDA 3KKCA 5FLMJ 2E1OA 4CYCB 1RETA 5DS9A 1CQTA 2XPWA 2HOTA 3S15J 5EEAA 5C4YA 3HEFA 1JJ8C 1ETXA 5EG0A 2LY9A 1P7IA 3A01B 2E2IJ 2AHQA 2DG8A 2W53A 3H3VK 1YRNB 3WHCA 3VW1A 3H0GJ 3K2AA 2DMPA 5F08A 2D5VA 2HI3A 3FIWA 2DA7A 1GV5A 2GENA 4JKZA 5CW8A 2DG7A 4JX6A 4XRSG 1JUSA 3L1PA 1AKHA 1UHSA 2M0CA 3B6CA 3M4OJ 1X58A 5E3OA 3Q0VA 5M5WJ 3A03A 1WH5A 1RPWA 4IEJA 1U9OA 5M5YJ 1RESA 1ZKGA 2RASA 1TWCJ 1QVTA 3ON4A 5K7HA 2Y0SN 1MBJA 3GTQJ 4J19A 3HTAA 3VP5A 3BTLA 4FE7A 2OERA 2YVEA 2MGQA 1JUPA 3RZDJ 3MVPA 2PZ9A 1HDPA 2NX4A 2FQ4A 4FE4A 1GUUA 5K7FA 3GTGJ 1S7EA 5IPAA 1IDZA 2OI8A 3BR5A 1I3QJ 2O9LA 5DTDA 3CDLA 3HGGA 2HOSA 2XB0X 2JA6J 4XIDA 3BR6A 4BY1J 2LP0A 3ON2A 5JLWA 2IEKA 1OJLA 2XGDA 4A3DJ 4Y52J 5EZHA 2CQQA 3IV5A 2YVHA 3C07A 2IBDA 1HLVA 3IH4A 2LVSA 2L0KA 3GTKJ 5M5XJ 1ZQ3P 1ETOA 3S1RJ 2EH3A 4EEFG 3ZQFA 4QIWN 4IHXA 2DMNA 3NARA 3HTIA 2HDDA 2DA2A 1I6HJ 4MLOA 2CU7A 1TWHJ 2LR8A 2HXIA 2VI6A 3BR1A 2M9HA 3IH2A 1Y1VJ 3O8HA 1FTTA 2O7OA 3GTOJ 3S16J 1TWGJ 3QBMA 3S2DJ 3LSPA 1JTYA 3Q3SA 5HAWA 1FTZA 3CCYA 2L7ZA 3WHBA 1BA5A 2P81A 2TRTA 2FX0A 2ZOZA 3VW0A 2JA8J 4D7MA 2EQRA 3JRCA 2LKXA 3BNIA 2HYJA 4JNNA 4JL3A 4Y7NJ 3LNQA 3DPJA 3IUVA 5EG0B 1TWFJ 3UKGA 4A3KJ 5IP6A 3HE0A 1F43A 3LSGA 2JA5J 5AQCA 2JK3A 1OCTC 1U8BA 4GCKA 1K83J 1IC8A 5H9TA 4XRSA 4DYRA 3RQIA 2VPRA 3LSRA 2IU5A 3KZ9A 1HDDC 3GBGA 2QTQA 3I4MJ 1ETKA 2K9QA 1AKHB 2HOAA 1IRZA 2DA6A 1JJ6C 2COBA 3CRJA 3S5RA 1H88C 3TP0A 4BY7J 3GTJJ 1K61A 4AUXA 2ME6A 5F0HA 3ANPA 1LE8A 3HDDA 2R7ZJ 1B72A 1EF4A 4A3EJ 3VUQA 3SJMA 3CWRA 4X6AJ 3HOVJ 4D5FA 1XG1A 1A5JA 3NXCA 4BKXA 1IV6A 3EGQA 5J1RA 3BR2A 4ABZA 1MBKA 2ZOYA 5IP9J 2B63J 4YZEA 2G3BA 4MFEA 1UMQA 1OCPA 1POGA 1ETYA 1JKPC 5GPAA 1JGGA 2KT0A 1FEXA 5F04A 1LFBA 3E7LA 2G7SA 1QPIA 2O7TA 3F1BA 2R92J 3S2HJ 3OSGA 2OF7A 2XDNA 5FGLA 3Q0WA 4M3DA 5EGOA 2KDZA 2ZCNA 5J1YA 4M6VA 2EZKA 2TCTA 3VVXA 4DZJA 4DZPA 4A3IJ 4X1EA 3VVZA 1X2NA 3BQYA 4JX5A 2DTZA 2K9NA 5J3LA 1UG2A 2R5ZA 2GUHA 2FD5A 4W1UA 2XRLA 4A3MJ 3PPBA 4MIMA 1RKWA 3BT9A 2F07A 3LWJA 3LJLA 2DA4A 5J1UA 3MNLA 2NVXJ 1T56A 5CXIA 1JT0A 5HBUA 3T6NA 3O60A 1RR7A 3JR9A 5IYBJ 5C4JJ 4IHVA 2DMTA 3JRHA 2NP3A 2DN0A 1JKOC 2XPUA 2HYTA 1ZGWA 4PXIA 1MBGA 1ETVA 3K7AJ 3BRUA 3JRGA 2LD5A 2PBXA 3BR0A 5IYDJ 3IH3A 3GZIA 4NELA 2QCOA 1MNMC 3S1QJ 3ZOBA 5M3FJ 3OSFA 2JJ7A 2H8RA 4L62A 2O8KA 3Q0UA 3BTJA 3VIBA 3FISA 2VKEA 1JUMA 4M3FA 3VOXA 4RBOA 1BW5A 4QTRA 1HCRA 3CJDA 3GTPJ 3HB9A 4RDUA 4C3HJ 1Y1WJ 1LE8B 4UUTA 1B72B 4FTHA 3QKXA 1BW6A 2L7MP 2Y30A 4IHYA 1R9TJ 1IG7A 5HODA 4A3FJ 4HNVA 3VOKA 1XC5A 2HQ5A 4FCYA 1W0UA 3G1LA 2REKA 2VUMJ 2WB1N 3KKDA 2NVYJ 1XS9A 1G2HA 1LFUP 4UDSA 5K58A 1Z0XA 2IAIA 5FJ8J 5F1JA 5EFYA 1MH3A 5E3NA 2H1KA 2ME0A 4JX4A 1MBEA 1BL0A 2Y2ZA 2YUSA 3S1NJ 1NK2P 4GFKA 3HOYJ 1NK3P 2X48A 3NPIA 1ETWA 2NP5A 2EZIA 4V2GA 2JWTA 3JRBA 5IYCJ 5EGOB 3G7RA 4A3CJ 1JTXA 1SANA 3A02A 3MKLA 1HF0A 3V78A 3QQAA 1D5YA 4HKUA 5JLXA 3BQZA 3QPSA 2R5ZB 5F27A 1H8AC 2MSYA 3ANGA 4ICHA 3DCFA 3HTJA 2UXUA 3G1MA 1ZR4A 5F0CA 2NVQJ 1AU7A 2LLKA 1VNDA 2R93J 2L9RA 3HBLA 3ZQIA 3JSJA 1QVUA 1F36A 3BG3A 2M34A 1GDTA 3TW7A 5IOZA 1PUFA 3B6AA 1B8IA 1IGNA 5FMPA 4GFLA 2UXPA 1VF9A 3NAUA 1WI3A 1AHDP 2R5YA 2EZHA 5F0FA 3O8GA 5GPCA 5EZGA 3VPRA 3PO2J 3JRDA 3PASA 2HKUA 3KNWA 3G1OA 1ENHA 1P7JA 2LK2A 5EYRA 2DA1A 5FKKA 4A3GJ 2G0EA 2XGEA 4AC0A 2OPTA 2UXOA 1E3OC 3ZQGA 2V57A 3GEUA 5EDNA 3ZQCA 1WCMJ 4A93J 3V6GA 1WH7A 2YS9A 5C44J 2ZCXA 2NVTJ 2X6OA 3PO3J 3BCGA 1GT0C 3BTIA 1ZTRA 4I6ZA 5FKNA 4A69C 5FKOA 3S17J 2WUIA 3TW6A 2DA5A 1MBHA 3HOXJ 4W97A 9ANTA 4AYBN 3BJBA 1IJWC 4GFBA 4QSHA 1VI0A 1O4XA 3C2BA 2DMUA 1VFCA 4XICA 2ZCMA 2QOPA 1OFCX 1UI5A 3JREA 1WGXA 3AQTA 1H89C 3FK7A 5IP7J 3HM5A 2QKOA 4JP0A 2R0QC 2WV1A 2G7LA 2JMWA 3QPLA 2JA7J 2MG4A 3AQSA 4MK6A 4DW6A 3P9TA 1WPKA 2LTPA 2E2HJ 1NTCA 1TC3C 5FKMA 3OOUA 3HIMA 4C3IJ 2K9SA 1ZK8A 4D7NA 1DU6A 3BHQA 3JRIA 2LFBA 4GCLA 2QIBA 2E19A 4B4CA 4C2MJ 1FIAA 4M3EA 3NI7A 5FHPA 2DMQA 2WAQN 1T33A 3HOWJ 2ZB9A 3TEDA 1SGMA 1I50J 2X9DA 4V2FA 2CRGA 1MBFA 2M2EA 4GCTA 2QF7A 4NDLA 2FJ1A 3HTHA 5FLVA 1PUFB 1B8IB 4BBRJ 2RAEA 1FJLA 4I76A 3GTMJ 5GP9A 2XB5A 2ECBA 4UUSA 3S1MJ 2R5YB 2JN6A 1U78A 2GM4A 2ID3A 3RKQA 2GLOA 5C4XJ 1UI6A 2DJNA 1HOMA 2WGBA 1W0TA 1Q1VA 2FBQA 3HKZN 3LSJA 1IUFA 4A3BJ 4XK4A 3ZQLA 1ITYA 4KWAA 1TWAJ 5D1RA 3LOCA 4C3JJ 1MSEC 2UXIA 1SFOJ 1MSFC 3SDGA 3ZQHA 3JRAA 3COLA 3VW2A 2Q24A 2L7FP 4CYCA 2Y9ZA 3NNRA 4NN1A 3BR3A 4D5CA 5E3MA 4M3BA 1DU0A 1ETQA 2N8GA 4XRMA 2NS8A 2RHAA 3A01A 1QRYA 2E2JJ 5HSZA 2QWTA 4M3GA 4S0HB 3LHQA 3F0CA 5IOYA 3BTCA 4IHWA 2CJJA 1YRNA 3HOZJ 1Z77A 4JYKA 3SFIA 4AF5A 2XPVA 3B81A 2CUEA 5DAJA 5D19A 3FK6A 4BXXJ 3RD3A 1BJZA 3VVYA 4CGRA 1FIPA 1ZR2A 2AO9A 3FKIJ 4ME9A 2NS7A 2HXOA 4G12A 4B1RA 4B3AA 2GBYA 2W48A 2EZLA 3RZOJ 2EBIA 5K7ZA 2MW8A 3DEWA 1ORKA 5FKLA 2XGCA 1U9NA 4BBSJ 2UXHA 1RKTA 3D1NI 3FRQA 3RH2A 4DYQA 2ECCA 3BG5A 2K40A 3W6VA 4LOCA 1JKRC 1APLC 2YU9J 5CXGA 1GV2A 4MO7A 5E3LA 1MH4A 4A3LJ 2CQXA 3CQZJ 1IDYA 2ID6A 2Y31A 5D18A 2CUFA 1JT6A 5M3MJ 3EUPA 2D6YA 1A6IA 4UUSB 2GFNA 2I10A 4L5EA 2G7GA 5C3EJ 3M3YJ 3GTLJ 1GVDA 1X2MA 4MXMA 2ELKA 5BNGA 2VKVA 3CMYA 2PMZN 2DA3A 3MN2A 3NRGA 3PM1A 3JRFA 3BG9A 2XSDC 3TP3A 3OIOA 4A3JJ 5EF6A 3E7QA
chains in the Genus database with same CATH superfamily
3HGYA 2ESHA 4Y4RA 2Y9YA 3AL0C 1WRJA 2DU9A 4AC6A 3KKCA 4CYCB 2HOTA 3PFIA 4UVBA 4EJOA 1SD6A 4U7DA 3CC2I 2YU3A 2AXTC 4IRVA 4GDFA 3HEFA 1P9QC 1TNSA 2E1MC 3BG6A 2VODA 1P7IA 2H27A 4PJNA 5CPRB 2EFWA 1FOYA 2Z5UA 3PSFA 4EMSA 2X6WA 3K2AA 4A0YA 1WKMA 3OR1C 2D5VA 2DA7A 3EQLF 4NUBA 2XAHA 4JKZA 2CFXA 2L9VA 4XN3A 2DG7A 1JUSA 3Q9SA 1E17A 2X0LA 1UHSA 3M8JA 1U0JA 1X58A 5E3OA 4KIFA 4LIVA 4RGXA 1IXSB 1FMWA 4NNJA 5M5YJ 1U9OA 5L3EA 1ZKGA 1CF7A 2HQRA 2VL8A 1FC3A 1QVTA 1TWCJ 1JE8A 3ON4A 2H94A 4ENNA 4A0XA 5JHFA 3K4BA 5H20A 2K5CA 4BJTA 1N25A 4LFUA 3CCQI 2NX4A 4FE4A 4ETSA 3DKXA 1J75A 1YOVB 1UG0A 3WE3A 5IPAA 1IDZA 2OI8A 2KQRA 2ELJA 1X3ZB 3DTEA 4IRGA 4ON0A 3H3UA 5DTDA 5D6FA 3CDLA 4D9JA 2XB0X 2DLLA 4PDKA 3OYBA 2LP0A 5LLQA 2LKSA 3NQOA 2XGDA 1V5GA 5EZHA 3JSPA 2K4JA 3E6DA 3K1MA 3PNVA 4DOZA 2E34A 2L54A 1ETOA 2EH3A 5HLIA 2DQLA 1WJCA 4CXFA 5IT9Z 2DT7B 1BI1A 3HTIA 1T0FC 1YS7A 3VSKA 2DA2A 1ZHFA 2MH2A 3QOPA 4L5IA 4KMFA 3K8PC 1TWHJ 3T8RA 2XAJA 2HXIA 3IH2A 2M9HA 1Y1VJ 4CCJA 4G6DA 1FTTA 2O7OA 2IPQX 1EH7A 4DIQA 3LSPA 3SXYA 3GCMA 1A36A 4BXUA 3GW2A 1FTZA 3CCJI 2QSGX 1A04A 2JA8J 5H6QA 4L18B 3HPHA 2ETHA 2LBFA 2DFIA 2FNPA 4KIBA 4A5NA 4Z6YA 2OU2A 4HEA2 1OCTC 2V9PA 1SFXA 4YG2F 2A69F 5H9TA 2I8DA 2PX9A 2J5OA 1E0EA 3OS0A 3G73A 2K86A 2OCCH 1DP3A 3H3ZA 4P5OA 1ETKA 3H36A 3HKZA 4LMYA 2VOPA 1JJ6C 1V3FA 2KLOA 1FY7A 3QOEA 3S5RA 2H1LA 4HAMA 2OQRA 2JQ7A 4AUXA 4IRHA 2ME6A 1CF7B 2B7EA 3ANPA 2AS5F 1TW3A 2WY8Q 3VUQA 1MMDA 4ENJA 3TOAA 3HOVJ 3HYIA 2CUJA 1XG1A 4BKXA 1IV6A 4C2UA 5CKTA 3EGQA 5JVGF 2FE3A 1D3YA 1PUEE 1ON1A 3IRRA 3BR2A 3OIPA 2A6TA 2X6YA 1D0XA 2DO7A 2EIJH 1UMQA 4Q47A 2LKPA 1JKPC 2QLZA 5GPAA 1JGGA 2KT0A 2G7SA 1LFBA 2CUZA 3HIFA 3CUQA 5TRDA 3F3XA 2FMLA 3OYHA 2OF7A 3OSGA 5J1YA 4MEXF 2QM3A 3VVXA 2TCTA 2HU9A 2WBMA 3FKJA 3S3NA 2OCEA 1X2NA 1PJRA 3BQYA 4JX5A 2DTZA 5J3LA 3MAJA 2JVGA 1P4AA 2R5ZA 1JGSA 2FD5A 2GUHA 4CCOA 3VYUB 2PLYA 3PPBA 1Y0UA 2KRCA 3BT9A 5B66C 2V1UA 3LJLA 1YFHA 4WXHA 5CVVA 3K70C 1B9MA 2EINH 1JT0A 4HF0A 1RR7A 4MGRA 4IHVA 2DT6A 2DMTA 4MHGA 2DN0A 2HYTA 1K4TA 2LBFB 3R4KA 1ETVA 3BRUA 2LD5A 5J6XA 2CSOA 1WQ2A 3GZIA 1LEBA 4F7ZA 2FRHA 4AIHA 1YLFA 3ZOBA 1LNWA 2WWYA 2H8RA 1D5VA 1KGSA 3PFYA 5DUKA 3E3VA 3SEQA 2O8KA 3BTJA 3VIBA 3FISA 4RS8A 1B9NA 4E7HA 4M3FA 1JHFA 3IUOA 4ENKA 3IRQA 4PZJA 2DI3A 3L09A 3GTPJ 3QRFF 2ZMEA 4PSWA 3OYFA 4HA8A 2QA4I 3QKXA 2IS2A 2PN6A 2IGNA 2D1VA 3ZMVA 1QU3A 1OCCH 2L7MP 2OBPA 1ODDA 3LQQA 2STWA 2V6CA 1IG7A 5HODA 2OC6A 5E1WA 4A3FJ 1XC5A 4OOIA 4XMYA 3MMYB 3DTKA 4ZYGA 1IW7F 4H4KC 1XS9A 1OR7C 4UDSA 4CO8A 2KJCA 5K58A 1OMIA 2KZGA 2Y0MA 5LGUA 1D0ZA 2YUSA 3S1NJ 4K2EA 1K4SA 3GZ6A 2E60A 2ELHA 1XCBA 3CUQB 1ETWA 2FQ3A 2NP5A 4ZYAA 5BS6A 1FYLA 4V2GA 4KIGA 3JRBA 4KICA 2VLAA 4A3CJ 1SFUA 3KP7A 3WODF 3A02A 4UVAA 3QQAA 4HKUA 3V78A 5LFAA 3GUDA 4KUMA 2NNYA 1K78A 2R5ZB 1J2XA 3M8FA 2MSYA 2ZJRF 2EB7A 2BHYA 5GADJ 2UXUA 1NH3A 3KP2A 3JSJA 1V5EA 4KA4A 4XLHA 4EVIA 1PUFA 3B6AA 2MC4A 5CQGA 4D1QA 5FMPA 4LIUA 2GQQA 4HQMA 3WGHA 3ZQQA 1ZG1A 5JVTA 2IA2A 1MMSA 1P2FA 1UFMA 1XGNA 3V8JA 2LK2A 5D8LB 1X1PA 2B9SA 4FHTA 3DV8A 4DJAA 2XGEA 1ZN2A 2F5VA 4JBAA 3L2CA 3DU6A 1VQ5I 3FDYA 2LG4A 1R1TA 3KP6A 1RIOH 2XIGA 2VJ5A 4LG3A 2VT2A 1A6QA 4CCNA 5H2FC 3PNYA 2ZMEB 2XASA 1XX5A 1JHHA 3K0LA 3BCGA 3GX4X 1Z67A 4KYWA 3FHZA 9ANTA 4MTEA 1YJNI 4HYEA 4XLAA 1IJWC 5L3DA 1I1SA 2XKPA 4R8HA 1Z9CA 4J01A 3G6EI 2DMUA 3VODA 2ZCMA 4BDYA 4P9FA 3O2PE 3HHGA 2RKHA 3AQTA 3P9CA 3EUHA 4H0EA 1LJ9A 3HM5A 3CF2A 3E1SA 1SD4A 3CCVI 4U0WA 3DEEA 1IN6A 2JUCA 2DFHA 4XL9A 2G7LA 2HKXA 2EWNA 2MG4A 4DW6A 2K3PA 1R5ID 3NWSA 4FX4A 3JAMZ 3HIMA 2O6GE 1K78B 4CDGA 4D7NA 1TL8A 1MD0A 1KZHA 1KU3A 2IVMA 5J8FA 4B4CA 2D1HA 4AD9A 1OLTA 4HX8A 1IUYA 3KFWX 5HS9A 4PFOA 5DEQA 2X9DA 4V2FA 2A05A 3ERED 4BQOA 4RGRA 2M2EA 3QYFA 2L3DA 4UUVA 4M6XA 4NDLA 4U0YA 2VE9A 3RPQA 5L3GA 1PUFB 4I76A 2KIQA 4OMZA 1N75A 2ECBA 2DQRA 1EJ9A 2EFPA 3S1MJ 3W2VA 4ZTJA 1HKSA 2GM4A 2ID3A 2MFZA 1TTYA 3OL4A 2GLOA 1UI6A 4M9SA 2FBHA 4NQWA 3L2RA 2VB6A 1W5SA 1W0TA 2FJI1 3NS4A 4GRIA 2M3AA 3LSJA 4A3BJ 3ZQLA 3DFGA 1TWAJ 3IC7A 2BYVE 5D1RA 3M1CA 1RI7A 1X3WB 4MEYF 3C18A 3TMOA 3COLA 1JI8A 1OCOH 1S9HA 3ROUA 2KDOA 2FSWA 3C2HA 5CYVA 4JK1X 2Y9ZA 4C9YA 4D5CA 3K2ZA 3K4KA 1ETQA 1B1BA 4E70A 3DLLF 1R1VA 3WG7H 4ZTFA 4PJ0C 1SC7A 3IKVA 5DCMA 2E2JJ 4J00A 4S0HB 1KONA 5FGMA 2ZJ2A 1YRNA 1G4DA 2EFQA 1SAUA 2HKOA 1WWXA 4AF5A 2YX4A 3FMSA 4FQGA 3B81A 1DPUA 1QNTA 3RD3A 2ZXWH 3VVYA 3VWBA 4HF1A 1R6RA 1FIPA 1ZR2A 2AO9A 3DPTA 2IS6A 2LYCA 3OYCA 3AFHA 3DQVC 4L9JA 2W48A 2Q2EA 1MKMA 1O7FA 3RZOJ 4CUGA 1SEUA 3DEWA 4XLEA 3TGNA 1U9NA 4BBSJ 2XVCA 2LRDA 4PCQA 2X1CA 2VT3A 3W6VA 3QP5A 2Z2SB 5CXGA 2D45A 3M9AA 4LD5A 4MO7A 2QVOA 2CQXA 2ID6A 3QP6A 2CWEA 2ISYA 2XGXA 5M3MJ 1WJDA 3I55I 5AIQA 4HDVA 4CZZA 4LITA 4L5EA 2CGPA 3M3YJ 1HW5A 1GVDA 4ZYDA 2VKVA 4NQWB 3GMEA 2B1EA 3I3LA 3NRGA 1QQIA 3JW4A 3OYIA 3OOPA 1YS6A 1BR2A 2JVHA 5EF6A 1YX5A 3HOUJ 4I09A 2HZTA 4OAZA 4FISA 4EJUA 2JRMA 2RNGA 1A31A 1IO2A 2NOGA 3ULQB 1RNLA 1MZBA 2CW0F 2GWRA 4EGYA 2X1EA 1RETA 1CQTA 2JSPA 2XPWA 3E5QA 5GAEJ 5EEAA 3W2AA 5C4YA 4A6EA 3CO7C 5K5OA 4HNUA 2VONA 1ETXA 1IRGA 5F64A 4HBLA 2LY9A 1LVAA 1UZCA 1ZARA 2AHQA 5DCMB 1YG2A 1XDSA 2HVQA 3BP8A 4HOBA 2DG8A 4AVZA 1YRNB 3WHCA 3VW1A 3H1CA 4HLYA 5J4VA 1XN7A 2VBXA 5LHGA 1YTYA 4BXFA 1DP7P 3BWGA 3FIWA 2Q0OA 4KN4X 3EYIA 4YFNF 4JX6A 3I64A 1G8XA 3RYRA 3CF5F 4BE2A 1AKHA 4E7LA 3M4OJ 2RQPA 3SYTA 1UELB 1RPWA 4IEJA 3HXLA 5ICEA 4L0YB 1RESA 2I5UA 1RRJA 1QZZA 2Q2EB 3GF2A 4C2TA 3QAHA 3GTQJ 2V7FA 2FOKA 4OMYA 4BE0A 3SHFA 2MGQA 2CW8A 4XNFA 2QSFX 3RDIA 3AG4H 3DBHB 5K7FA 3GTGJ 4S05A 3BR5A 3CTAA 3J80K 5TJJA 3FX3A 1R23A 3UNGC 2JA6J 1FOWA 2P8TA 2GIVA 2IEKA 2BBYA 5GAGJ 2YVHA 3KYLA 5BOXA 3W3CA 2L4MA 1TQMA 1HLVA 2BE5F 2LVSA 1LDDA 2L0KA 1OKRA 4I0BA 5D5WB 2XF7A 5GTIC 2DMNA 1V54H 4AWXB 3MZ8A 2YPRA 4X0GA 2M1BA 3KZZA 1UHWA 3O8HA 3CDIA 1ZLKA 4M9ZA 3S16J 1TWGJ 2E1NA 3LSTA 3TDZC 4V19K 3S2DJ 3HSEA 1HXDA 5HAWA 3ECHA 3WHBA 1BA5A 1H9GA 2P81A 2FX0A 2TRTA 2ZSHB 1FSHA 3CLQA 2HEOA 2ZOZA 3VW0A 3JRCA 3F72A 4U87A 4JNNA 3OL3A 3PSIA 3LNQA 2BY3A 3IUVA 5TISC 2Y75A 4QPQA 3S3MA 5E18F 2XDVA 1WVRA 3Q9VA 2JA5J 5AQCA 2JK3A 1MJBA 4ANJA 1U8BA 1K83J 3FXRA 1ON2A 2LOOA 2QENA 2VPRA 2V6EA 1J5YA 2L7KA 4XBFA 3KZ9A 2VQGA 3LWFA 3CC4I 2A2FX 3FZVA 2YVXA 1AKHB 2VN2A 2HOAA 1IRZA 2Y48A 4KMUX 4N0BA 1D1BA 3E6CC 4BH9A 2XUBA 3R0JA 3WTZA 3CJTB 4BY7J 1K61A 1HKQA 2QKMB 2HFHA 1PP7U 1VQLI 5F0HA 3J7AO 1EF4A 4A3EJ 4YFKF 3CWRA 4X6AJ 1WZ2A 4I0AA 3NXCA 3L2QA 3K70D 1GXQA 2QYOA 4ABZA 3ELKA 2YR2A 5CQEA 4HF2A 2HOEA 4M74A 5IP9J 5ED4A 2RGVA 2A07F 2B63J 4MFEA 2P7CB 2HPIA 3LSMA 3MWMA 1ETYA 2EK5A 1PP8F 1RZ4A 5KAFC 2OTLI 5F04A 2R92J 4RB1A 3CUOA 4EM1A 1XGMA 4M3DA 5EGOA 2HDWA 4LK1F 3WU1B 3ZQ7A 2FEZA 2KDZA 2HYGD 1O57A 1R71A 2EZKA 2NS0A 3ZMZA 4DZJA 4DZPA 4XSZF 3VVZA 1DUXC 4DQ2A 2BOLA 4N9IA 1X1DA 1UG2A 5DDGA 3WTTC 3QYBA 4W1UA 2F07A 3QODA 3GFJA 4Y13A 2DA4A 2DJIA 3RI4A 1TP4A 3U1KA 3T6NA 5HBUA 2ZNYA 4FX0A 5C4JJ 2F6CA 4U7BA 3F8CA 4E4HA 2CG4A 3KLOA 1O3RA 5KNLA 3K7AJ 3K4MA 3TQNA 4CCKA 5B3SH 4JOMA 3KE2A 5IYDJ 3IH3A 2LNBA 2R7OA 2EFNA 4U0VA 3DU5A 1IN8A 1U5TC 2UXNA 4DBRA 1KQ9A 4YFXF 5M3FJ 2JJ7A 4B44A 1BOBA 4HNTA 1EV7A 4UY8I 4NC7A 4IRIA 5B1AH 3AG1H 5FLXK 1SMTA 2VKEA 1JUMA 2V1XA 1S6LA 2E36A 1SVLA 2M30A 1FSEA 4EJVA 3ZXSA 1Z1DA 1Z7UA 2XRNA 4UUTA 3U21A 2VOOA 3RTRA 3L2UA 1BW6A 2F4MB 1D8KA 3EUAA 2QBYA 1R9TJ 4IHYA 1QHHD 4PK4A 3LMMA 5DM7F 2JT1A 2OZ6A 2FMYA 2KISA 2Z99A 1XSVA 2HQ5A 2QGUA 1W0UA 3G1LA 1YIJI 2REKA 1K79A 2WB1N 2L9SA 2K27A 2ZXIA 1Z0XA 5FJ8J 5EFYA 4JX4A 3KYCB 3AKZA 2BVMA 3VTIA 1TNTA 4G7OF 4ZH4F 2WV0A 4IXAA 2BW3A 2Q8KA 5FRNA 3SZTA 2HWVA 2C6YA 2M7BA 5IYCJ 5EGOB 1ZELA 1HF0A 1K6OA 2HVSA 2B0LA 4P1WA 3QPSA 1PDNC 2F4IA 2XAFA 5F27A 4E7IA 3RCOA 1YI2I 2IGKA 4WX9A 1WFXA 2P5VA 1ZR4A 3EETA 5F0CA 2LLKA 2LREA 2KIUA 1VNDA 3HBLA 3OYAA 4OIOF 2OTJI 1QVUA 2JA2A 4G6QA 4EM2A 3BG3A 1GDTA 4M73A 3WTWC 4GFLA 1VF9A 1WI3A 2R5YA 5EJCA 3WG9A 2OAZA 3PASA 2HKUA 1BOAA 2CMPA 1R36A 5EYRA 1OYWA 4OU0A 2XF6A 5HNFA 3RYPA 2G0EA 3DBRB 3PIOF 4Z2YA 2GXGA 3KEOA 2UXOA 1VQ8I 5E79C 1MMNA 1BBYA 2VXZA 1W4MA 5HLGA 1WCMJ 1Y8QB 1AOYA 4A93J 3V6GA 1WH7A 1S29A 2VASA 3R61A 3DKYA 3LA3A 4YIIA 2NVTJ 3PO3J 2M4KA 1GT0C 1ZTRA 4I6ZA 5FKNA 4XQFA 1O3TA 5FKOA 3S17J 3TW6A 1MBHA 2BY1A 2QBYB 2XKOA 4AYBN 2WAFA 1XMXA 2FA5A 3P9IA 4F91B 2WADA 4QSHA 5CVUA 2H8WA 4XLNF 1VFCA 4XICA 2K9MA 4DVYP 1UI5A 2VQLA 1XGSA 3BROA 4F55A 2MD5A 3ZRGA 5JFRA 2L2OA 2QQ8A 4E7ZA 3FK7A 5IP7J 1GXPA 1SD5A 2K02A 3DWLE 2R0QC 2VQHA 4BQQA 1IF1A 2W84A 1SFKA 2BW3B 3D5RC 2ESNA 4ZC3A 2JMWA 3QPTA 4RB2C 3HRTA 3I58A 2JA7J 3OR2C 5KHDA 4E7SA 4EGZA 1YYVA 1U2WA 1TC3C 5FKMA 3V8KA 1X4OA 4HG2A 1DU6A 4GCLA 3FXOA 2QIBA 1FOXA 2G7HA 5FHPA 4XSXF 3KEQA 1T33A 5ILSA 2K9LA 2ZC2A 3OYJA 1HQCA 3TEDA 5TGTA 3HOWJ 3FXMA 2CRGA 4RB0A 2PJRB 2IXSA 2PMZA 3DXJF 4U88A 4GCTA 2XAGA 4IPAA 3C2GA 1NG7A 4MQVA 2STTA 4BBRJ 1P4XA 1FJLA 3GTMJ 2CH0A 5ICGA 1FX7A 2RQQA 2XB5A 5GP9A 3RIRA 1D0YA 4TV7A 2R5YB 2JN6A 1U78A 2OZUA 4L5JA 4RAZA 5FFXA 3RKQA 4D0PA 2DBBA 2WGBA 2FBQA 4KWAA 1ONVA 1IUFA 4XK4A 3N97A 3SWHA 4C3JJ 1MSEC 1OYIA 1W36D 2JPCA 3K4JA 3SQNA 1MSFC 1Z6RA 3JRAA 2BXZA 2KRHA 4BNCA 3VW2A 2EJRA 2L7FP 1DQUA 2P7VB 4UB6C 1F5TA 1J9IA 4IX7A 1TBXA 3WTVC 4F92B 2KMUA 5AIPA 3NNRA 1W7PD 4PFPA 1WI9A 2DFEA 2EA4A 5E3MA 3I71A 1W7PA 2IT0A 5KK1A 1FBUA 3E6BA 3K69A 2N8GA 1P4WA 2BGCA 1MGTA 4WWCA 2R7QA 2QWTA 4M3GA 1R22A 5IOYA 5LHIA 1FBQA 4BL0B 3RKXA 1T2KA 2FBKA 4IO9F 2GZWA 4Y3OA 3FXUA 3VB2A 4CGRA 1J59A 2WY7Q 2WTEA 4ME9A 1OCZH 4NC6A 2NS7A 2HXOA 4B3AA 2HR3A 2IA1A 3ZN1A 1EH8A 2BY2A 2Z16A 1T95A 4I2OA 4B3XA 3KPHA 2E5NA 1FZPB 1VQNI 5E8IA 2KRFA 1ZAOA 5K7ZA 5LEJA 1G3TA 3FM5A 3GLXA 2BEOA 1TQIA 3D1NI 1TLHB 2Z33A 4NHJA 1M1EB 2YU9J 1MH4A 3LAJA 1YJ9I 1IDYA 2E1CA 5D18A 1OCRH 2UXXA 1QGPA 2NXNB 1MMGA 2D6YA 2GFNA 2I10A 2G7GA 5C3EJ 1J09A 1CGPA 3GTLJ 4MXMA 3ESWB 3CJQB 2YSRA 1AWCA 4PSXA 4C2MA 2Z3YA 2DA3A 3MN2A 3VOEA 4E7JA 1O3QA 3TP3A 3OV8A 4RMNA 2RREA 1S7AA 3NEUA 4G9YA 3F8MA 4DYCA 4XLPF 1BIAA 3FMRA 1BR4A 3G56A 2RVCA 4XOPA 3R60A 2CS3A 1KA8A 4XORA 2E1OA 3HHHA 3VEPA 2VBWA 5DS9A 3X2QH 1W7PB 3BPXA 3REOA 1WHUA 4JQFA 4HX4A 2A5WA 2VKHA 1D1CA 3E5UA 2O5RA 3FXLA 4ESJA 2VJ4A 4HW0A 2E2IJ 3K10A 2W53A 1L3LA 3H3VK 5A2QK 3H0GJ 2DT5A 2ZJPF 2RC4A 3CLOA 2DMPA 5F08A 3V4GA 2HI3A 4M9XA 2GENA 5AONA 3C3WA 1KQ0A 5CW8A 4XRSG 3L1PA 2L02A 2JZYA 3RQ4A 2R7UA 2M0CA 3B6CA 5F6FA 4HLXA 3KZYA 5M5WJ 4U9LA 3A03A 3EDPA 1GLNA 2LSOA 2RASA 4DGWB 1WJBA 3HTAA 1XPXA 3CUQC 2X4HA 4M71A 5FO5A 5D8KB 2LC2A 3BJOA 3OYLA 2OERA 3QU6A 5E20A 3RZDJ 1IN5A 1BI2A 2QZ8A 1YW8A 1LUJB 3C1DA 3CMMA 1JXSA 1GUUA 1MJAA 4YEJA 2P5KA 2F2EA 1YW9A 3U2RA 4PJMA 5LGTA 1I3QJ 2GXBA 2O9LA 5LHHA 4MNUA 2ZBKA 1ERDA 3ON2A 5JLWA 1OJLA 4P55A 4Y52J 4KISA 3IV5A 2CQQA 1V4RA 3HUGB 3C07A 2IBDA 4ZZDA 4O3MA 3MCZA 3OWTA 4G7HF 3H0DA 3GTKJ 3S2WA 3PNTA 1EA3A 3OMYA 2W00A 4EEFG 2GAUA 3I9V2 3ZQFA 3M7GA 4IHXA 3NWTA 3NARA 3TO9A 2NAZA 1IRXA 1VTNC 2RDPA 3BG7A 1I3AA 1I6HJ 2LR8A 3BR1A 2FOWA 4ITVA 1LDJA 3F8NA 2ZFUA 3ML6A 1ZGAA 3WTYC 3QBMA 1YQAA 3ECOA 4RLQA 4GYGA 4LB5A 3OY9A 4IOCF 5JI6A 3AG2H 2GIZA 2TDXA 2OA4A 1FP2A 4F93B 2UUZA 4D7MA 1PYVA 4Q48A 1FBSA 3F6OA 3ZMUA 2HYJA 5CLSA 5HDGA 1SMYF 3GZNB 1VQ9I 1I6XA 4Y33A 1TWFJ 3BLYA 1BN5A 2X6XA 5IP6A 3CCUI 3UKGA 3HRSA 3CZ6A 3CJRB 1G59A 2ZMEC 2VIXA 1W5CC 2BXYA 3LAPA 3GVAA 2BY0A 3LSGA 5LD2C 4LLNA 1WJFA 3D5LA 2ZO4A 1LQ1A 2LY1A 2NRAC 4DYRA 3RQIA 1G6NA 3M8EA 3LSRA 2IU5A 1HDDC 3GBGA 2QTQA 2MABA 4N4NB 1ACIA 3RPUD 5FD5A 3WGGA 2M45A 3U1DA 3RPUA 4KFCA 3IL2A 3CRJA 4PUSA 1H88C 2W24A 2EV6A 3ERMA 1H9TA 1LE8A 3HDDA 2R7ZJ 4ZYHA 2EIMH 4E6KG 3SJMA 3K6GA 1A5JA 3HRMA 4IOAF 3AAFA 1ZYRF 2DOFA 3HRUA 1G3WA 3LSIA 2ZSIB 1MBKA 2HPMA 2DW4A 2G3BA 4GCVA 3J81K 1Z7LA 2BVLA 2G7UA 5DCFA 2W57A 5FRMA 1IN7A 3J7YJ 2O7TA 1QPIA 1X4PA 4HZFA 1ZRDA 2M4GA 1IRFA 1ZLJA 1HC8A 5FGLA 1Y6IA 4BHCA 3Q0WA 2KIMA 4HDUA 3ZP5A 5FD6A 4LGWA 3VSLA 1YIOA 3CCEI 4A3IJ 4OD5A 4XLCA 4X1EA 4P9UA 3GEZA 4PJJA 2H6CA 2P6TA 3U9GA 2XV4S 1HKTA 2PBIA 3WU2C 2XRLA 4MIMA 1RKWA 2VBZA 3N4MA 4RB3C 3LWJA 2PEXA 3BCAA 5J1UA 3LSKA 3W2WA 3MNLA 2NVXJ 5CXIA 3I59A 3KP4A 3O60A 5IYBJ 1V55H 3GFLA 2NP3A 5HS8A 3G3ZA 2IS1A 4BYYA 3G4SI 3RKYA 3RKWA 1DDNA 4PXIA 1T0FA 1DPRA 1STZA 2OD5A 5F1RA 3MZYA 2R7XA 1ZRCA 3S93A 1HSTA 1F9NA 3LQRA 2VJJA 3PUBA 1MNMC 3AL0B 3OSFA 4AM3A 1KYWA 4XM3A 5JR3A 3FHNA 5HLHA 1EKEA 2JPBA 5HS7A 1BC8C 2JTVA 4I7HA 3Q0UA 2GXAA 4DNCA 2ZCWA 3L2VA 2O8XA 4UNOA 4BS9A 4RAGA 1T98A 3B02A 3H35A 3OYGA 2E1MB 4RBOA 1XSDA 5LGNA 3CJDA 4RA2A 3WU0A 3EUHC 1E3HA 2EIKH 4NB5A 4C3HJ 2A61A 2ISZA 4MQ9F 1LE8B 3H5RA 1VZ0A 4FTHA 2H6BA 5BQTA 1O3SA 1PVEA 4XRFA 2ZXHA 3H5AA 4B8XA 2Y30A 3OIOA 2VKDA 3I53A 3CDHA 4IJAA 2WAEA 2EV5A 3HG9A 5E1ZB 3RSNA 1LFPA 1UAAA 3VOKA 5KAIC 2VUMJ 2M8EA 4G7ZF 1G2HA 3FXJA 1QZEA 1U6GA 1MH3A 2F5EA 4RAFA 5E3NA 2H1KA 1MBEA 2K4BA 4EV0A 1ZRFA 2KJBA 4GFKA 3HOYJ 4KNYA 2HS5A 3BPVA 4F52A 2OQGA 3ONQA 2G9WA 2P4WA 2VBYA 4LK0F 3F23A 3A0BC 1JTXA 3BCBA 1SANA 3MKLA 3W6JB 1FLIA 2L9NA 4OIRF 5DV5A 3HPGA 1DGRM 4OINF 3M1EA 1LPQA 1R58A 1H8AC 3MD2A 2RV8A 4ICHA 3HTJA 1ZGJA 1X1AA 3G1MA 3MKZA 3DLAA 3E0JB 2NVQJ 1QO0D 3I59B 3ZMTA 1GHCA 1L0OC 2Z9OA 2QQAA 2HQAA 1YO5C 4RLFA 1F36A 4XOTA 2M34A 1QHGA 5IOZA 3CP2A 1B8IA 2Z1DA 2A5YB 1IGNA 4BE1A 2UXPA 3NAUA 4HSTA 2MLKA 4CHUA 5F0FA 4PJLA 5J40A 3HOSA 3VPRA 2PJPA 3L00A 3JRDA 3PO2J 2B3WA 1ENHA 2EPFA 5FKKA 1LB2A 4BGDA 4A3GJ 5ILUA 3T5XA 1YW7A 1VQ6I 4G6TB 3SZGA 5H6RA 2FU4A 1ZH5A 1H0MA 1REPC 2FNAA 2R7WA 2X51A 5EDNA 3A0HC 3ABKH 5D4RA 1XMKA 4S04A 5IT9K 2O61A 2YS9A 5DYMA 5C44J 2ZCXA 2NYXA 2X6OA 1J7KA 1Z3XA 3J80Z 1TQPA 2E7XA 4F3QA 2R7DA 3F22A 1Z21A 1QPMA 2DA5A 2WUIA 3HOXJ 4W97A 2K3FA 2DPUA 3HOTA 2PG4A 4GFBA 4ZDPA 1KU7A 5J4YA 3K4LA 2QOPA 1XMAA 4Y17A 1OFCX 5ILVA 3PIPF 3JREA 2KPMA 2DYSH 3OS2A 3A1YA 4ASNA 3PQJA 2QKOA 4AIDA 2WV1A 2KFDA 3IP4B 1Z91A 3KIOA 3GLLA 5D5XB 3COAC 5BPIA 2CQNA 2OV7A 1IXCA 1FT9A 2RN7A 2LH9A 4LLLA 3AQSA 4MK6A 3OIQA 1WPKA 2P0WA 4WCGA 4FETA 3ABTA 5LEKA 4CICA 4GYIA 1D8JA 3OOUA 2KIFA 1MIJA 1OR7A 4C3IJ 5ICCA 2ZKZA 3BHQA 2AQEA 4AU7A 2HVRA 1I5ZA 4C2MJ 3NI7A 1FIAA 3P9KA 4M3EA 1VQKI 1S72I 4OIPF 2WAQN 3HJEA 1F1ZA 3BY6A 4AVPA 2QF7A 1X1CA 2FJ1A 3H5NA 4HSRA 4RGSA 3PJRA 1S3JA 1B8IB 1USSA 2RAEA 1EH6A 3ZCOA 2F5DA 2UWMA 4CA0A 1P6RA 2ADUA 2VE8A 2W1OA 2DJNA 2KZVA 1HOMA 4UV8A 1IAWA 3CD6I 2PFBA 2R7TA 3K1PA 3LOCA 3WGIA 4L9NA 2WC2A 2UXIA 1WJ5A 1Y39A 1SFOJ 2A3SA 5CJ9A 3SDGA 3ZQHA 5EEHA 2Q24A 2ZFWA 2K7LA 1YITI 3KLNA 4NN1A 4CZCA 2DPDA 4ENMA 2NOJB 3KETA 2L01A 2GOMA 5IT3A 1TT5B 1DU0A 3KP3A 4LLGF 4IQJA 3A2KA 5HLTA 4XN0A 3VFZA 2ZY9A 2RHAA 3K4CA 2O3FA 3A01A 5HSZA 4L9TA 3LHQA 1NG6A 4IHWA 2CJJA 4ESBA 2O03A 3SFIA 4R1HA 5CVRA 4B47A 5B5EC 4ZDOA 4BAYA 1G3YA 1HBXG 5DAJA 3FK6A 1IZ1A 2W7NA 1BJZA 3KYDB 3FBNB 4ZJZA 2PJRA 5FROA 4UV9A 5DD8A 2QSHX 2UZKA 1D1AA 1G3SA 3JTHA 1LVKA 1MNDA 3HL2A 1WSUA 3BOQA 2BV6A 1ORKA 1FMVA 2XGCA 5FKLA 1XCVA 2O0YA 3BC8A 4P96A 1RUNA 1RKTA 3RH2A 4ZZLA 2M7AA 4YIRX 2DK5A 1AA7A 1ZREA 1GV2A 5E3LA 4A3LJ 3CQZJ 4BACA 2Y31A 3GO5A 3HSFA 5FFZA 1JT6A 3T0YA 4IL6C 1QA6A 2FXAA 1E3PA 2H09A 1T8IA 4BQNA 1A6IA 2CQ7A 4KITB 4QLCU 5FLXZ 1X2MA 2ELKA 5BNGA 2X1DA 3CMYA 3OYDA 3Q5FA 3JRFA 4BEHA 1FOKA 2LF8A 2VPLA 1YHQI 3D5SC 5HDNA 1FYMA 3I54A 1BW5A 3E7QA 4G8XA 2IRFG 4ACIA 1TW2A 2QWWA 2IGMA 4BJ5C 3S14J 3KX2A 2M8GX 2P5LC 1JKQC 3ASOH 3I4NJ 5D6EA 4MFDA 1Y8RB 3VYRB 5FLMJ 2OJED 1S7OA 3S15J 1YE9A 3GWZA 4XKBA 3GYHX 5LRRA 2EA2A 3OYEA 1MMAA 1ULYA 3R6SA 5HOOA 3LL7A 2BHZA 5K5RA 3MFKA 1JJ8C 5EG0A 4IHTA 2MLGA 3A01B 5JHUA 3CC7I 1HSJA 1W1WE 4I99C 2J5PA 2FF4A 1FWZA 2HTSA 3HZJA 3T8TA 2CV1A 2QUFA 1WJEA 1XDUA 3CMAI 1U3EM 1GV5A 5HNHA 2DOAA 1KQ8A 4GGGA 2CYYA 5CVIA 1IV8A 2DXIA 1B6AA 2AXLA 2DK8A 3Q0VA 3JSOA 2MH9A 1UB9A 2XROA 1WH5A 4U9NA 1MW7A 1S8NA 1V5FA 5K5QA 5K7HA 2Y0SN 1MBJA 3F8BA 5E1XA 5B1BH 4J19A 3S3OA 2IW5A 3VYTB 4O6JA 1X1BA 2WA0A 3VP5A 3BTLA 4FE7A 2DDAA 4YIFA 3HTUA 2YVEA 1JUPA 2PZ9A 3MVPA 1HDPA 5DUIA 2XAUA 1K7AA 2FQ4A 2IA0A 3BZKA 2CQKA 1S7EA 3WTXC 1Z05A 1W5TA 3F21A 4Q4ZF 4RM3A 5DM6F 3HGGA 2HOSA 4XIDA 3BR6A 4BY1J 1XD7A 4A3DJ 3IWFA 3IH4A 2V1NA 3QPHA 5M5XJ 1BI0A 4KT6A 4IZZA 1ZQ3P 3S1RJ 4QIWN 1OPCA 3IWZA 4I02A 2HDDA 3CESA 4BEHB 5IY5H 4MLOA 1KYZA 2CU7A 3JTGA 2LF7A 2VI6A 3LFUA 4E7KA 3GTOJ 1VQOI 3VYSB 3I5UA 3SZPA 2ZJQF 4WK8F 1JTYA 1YJWI 2PI0A 3Q3SA 3P5JA 3CCYA 2L7ZA 4R79A 1S5LC 4ZDLA 3JAMK 2LKXA 2EQRA 3BNIA 2AQFA 2WAQA 3CCRI 3K4NA 4Y7NJ 3DPJA 4JL3A 2CO5A 3C7JA 4LB6B 5EG0B 2R7RA 4A3KJ 5E8GA 1SD7A 3GFIA 5K1YA 1F43A 2V1DA 2L5QA 3IAS2 4GCKA 4OD4A 1IC8A 1Z6TA 4XRSA 2HQNA 3ABUA 2D2WA 1IN4A 3I56I 3A4CA 4WXCA 3I4MJ 2K85A 2K9QA 3BDDA 4AIKA 4HQEA 2DA6A 3FF5A 4FASD 4CSWA 2QQ9A 3MQ0A 4WXDA 2DAOA 2COBA 3ASNH 3FM3A 3J7ZI 3TP0A 3GTJJ 2WB1A 2R7SA 1QZYA 2LY2A 3HUGA 1SVMA 4II2A 3CCMI 1B72A 3R0AA 2V79A 3CCLI 2R7FA 2IP2A 3ISPA 4D5FA 3FXQA 4EM0B 2W25A 2XC7A 4A0ZA 3G71I 3K1NA 1T6SA 5J1RA 3ABMH 2HZDA 3W6KB 3KCCA 4B48A 2ZOYA 5L3CA 4YZEA 3EPZA 1OCPA 3VDXA 4BUPA 3H9JA 1POGA 2VQCA 1XTAA 1FEXA 3E7LA 3TDUC 5BMZA 1NHAA 3B73A 1Q1HA 3CCSI 3F1BA 2Q1ZB 3S2HJ 2XDNA 2IGOA 3E5XA 2ZCNA 4XONA 1XSXA 4M6VA 3D0SA 2F48A 4A3JJ 5D5VB 1XGOA 4CGZA 4BQAA 3KEYA 2A6HF 2K9NA 2OUMA 4A3MJ 1GVJA 1R5GA 1B59A 2CW7A 3KZIC 5KCMA 1T56A 2W82A 3TBIA 2E7WA 5L3FA 2L4AA 2FBIA 3JR9A 2GA2A 1F4KA 4EJWA 4IF4A 3JRHA 2EFOA 2HTJA 3LFKA 1JKOC 2KHMA 2XPUA 2F5FA 3J7AY 4N4OB 1ZGWA 2IJLA 3BJ6A 1MBGA 1BIBA 3ZMDA 3JRGA 2HDCA 4EQQA 2PBXA 3BR0A 3HTSB 4KJZA 4M6YA 4NELA 4IQ4A 1OQYA 2QCOA 2PMUA 3S1QJ 5E17F 4KDPA 2COMA 1I1GA 1MJ9A 4NC8A 3T1BA 5KVRA 1P92A 4L62A 4G94A 1KU9A 3OYNA 1R4MB 4QWQA 2XHKA 4MTDA 3H92A 4AYBA 4UVCA 2E5ZA 3MZHA 3SEZA 1T39A 3VOXA 2M87A 4N9HA 4QTRA 1HCRA 2HGCA 3HB9A 5LRSA 4RDUA 4I98B 1Y1WJ 4GXOA 4YELA 4A6DA 1A35A 2V4JC 4WIBA 2M0MA 1B72B 3EYYA 2XF5A 1X19A 2JUGA 2R4GA 3H9QA 3V8LA 2ACJA 4ESFA 3EUKL 2IS4A 4HNVA 4FCYA 3SFZA 2A68F 4RM2A 3KKDA 2NVYJ 3I4PA 3FWEA 4IVNA 1LFUP 3KP5A 1OYYA 1WJAA 2EV0A 2IAIA 4WF2A 5F1JA 1BR1A 5ERIA 2ME0A 4KT5C 1BL0A 1VQ4I 2Y2ZA 2R7VA 3WTUC 1NK2P 2CV0A 4OWRB 3V7CA 3CO6C 1USTA 1NK3P 2X48A 4UHTA 3NPIA 1HA8A 2JRTA 2EZIA 3DPUA 4A5MA 2JWTA 3G7RA 4DBQA 4C30A 2XAQA 1FPQA 3F9KA 1D5YA 3FMQA 5JLXA 2CFOA 2KKOA 3BQZA 1XB4A 5J47A 2NVUB 2PMHA 4NBQA 2Y0SA 2R3SA 3DCFA 3ANGA 4PGHA 4O5VA 4BU2A 4OAYA 3TOBA 3MKYB 3IHUA 1AU7A 3TO7A 2R93J 5A2QZ 2L9RA 3ZQIA 3CMEI 1W36C 2BZTA 1E2XA 3TKYA 2E71A 3MKWB 3TW7A 1SVOA 4FT8A 1C0WA 3N05A 3UR3C 3L2WA 3ZPLA 1AHDP 2V9VA 2EZHA 3O8GA 1R7JA 1Y0NA 5GPCA 5EZGA 1IXRC 3E97A 3KNWA 3G1OA 4A2UA 1P7JA 2DA1A 2MBFA 3RJPA 1MDMA 3DEUA 3AG3H 3V42A 4BHPA 4AC0A 2OPTA 3L7WA 3BZ6A 2CV2A 1E3OC 4QPOA 3HSRA 3ZGKA 3ZQGA 3G2BA 1VQ7I 3ZQCA 2V57A 3GEUA 4XKWA 2HYFA 1LDKB 3P7NA 1RC9A 2MA3A 2XSJC 3LSHA 4CCLA 4LG0A 3QYEA 3TO6A 4BJ6C 3BTIA 4IHSA 4EATA 3NRVA 1ZG5A 2ZXJA 4A69C 2MC3A 3OYMA 1U5TA 2V26A 1UJ8A 4I01A 2LMDA 2DYRH 2JSCA 3BJBA 4B43A 4B09A 3WTSC 3OS1A 4KN7X 1VI0A 1R1UA 2DCEA 2DTRA 1O4XA 1X3UA 3C2BA 4CH7A 1YX3A 2NNNA 4HV5A 1WGXA 3M07A 1UCRA 2YX7A 2DDBA 3I0TA 1O7LA 1H89C 3MEXA 2LDUA 2MYSA 4JP0A 1QBJA 1R4NB 4XLFA 1I27A 1Z3YA 1HW2A 5GTHC 3QPLA 2HNHA 5D4SA 3DTIA 3P9TA 4CCMA 4RGUA 2LTPA 4XKCA 2E2HJ 1NTCA 2QQBA 5EEGA 2Y69H 1BJAA 1U8RA 2K9SA 1ZK8A 5D5UB 2QEXI 1VQPI 3JRIA 2LFBA 4AIJA 3IKTA 2F5CA 2E19A 4HRIA 2DMQA 4PGGA 4BDZA 2W4SA 2E35A 2ZB9A 1SGMA 1I50J 4BHBA 1MBFA 6PAXA 1KU2A 3HTHA 5FLVA 2VJIA 3QWLA 5GAHJ 1FYKA 4UUSA 2UV1A 5DD4A 3DPLC 3CJNA 4ZYEA 3DP7A 5C4XJ 3F8FA 4M72A 1Q1VA 1J0RA 2P6SA 3HKZN 1MDMB 1LKXA 1ITYA 3CP8A 2QKLB 2MD0A 2EILH 4II3A 3OYKA 3GZ5A 4HX7A 3BZCA 4HV6A 1BM9A 5CVJA 3DBLB 5J8CA 2VC1A 2W85A 3LA7A 4UB8C 4CYCA 3WE2A 3BR3A 3GFMA 1ZG3A 3QU3A 4LG0B 4Y15A 4M3BA 4L9VA 3J81Z 1U5TB 2V9KA 3LA2A 4XRMA 5ICFA 2NS8A 2X85A 1QRYA 1BC7C 5LBQA 2ZNZA 4CYDA 3F0CA 3BTCA 3PL8A 3HOZJ 2PQ8A 3S32A 3K9TA 1Z77A 4JYKA 2KP6A 2M5WA 2XPVA 1Y56A 4IKFA 2CUEA 2GOXB 4Q5SF 3L9FA 5D19A 1TT0A 4BXXJ 1LEAA 1RR8C 1VQMI 3FBIB 5BPDA 2F4OB 1R49A 2ICWG 3F6VA 2RNJA 3FKIJ 3H9GA 4GO1A 4G12A 4B1RA 1FNNA 2GBYA 3ZR8X 4A12A 3FXKA 5HVQC 1B4AA 3PQKA 2EZLA 4UXNA 3ZN0A 2DFFA 1I39A 2EBIA 3ABLH 5HDKA 2MW8A 3BJAA 1BI3A 2KL4A 1R00A 1OISA 3PUFA 4XKVA 1T38A 1HW1A 2UXHA 1K6YA 3GXOA 1RUOA 3FRQA 3IAM2 2ECCA 2VXDA 3BG5A 4DYQA 1N77A 2K40A 2A6EF 3O6BB 4LOCA 1JKRC 1APLC 3DKWA 1R5HA 3HC7A 3DF8A 2CUFA 1TZLA 2DOEA 3O3KA 3JCUC 3S8PA 4XR6A 5L3BA 4YRVA 3EUPA 3SDBA 2DODA 4EJTA 1DGWY 4UUSB 5FB2A 1FP1D 4HPQA 3TL4X 3ZMSA 1SAXA 4L0ZB 3E6MA 2PFVA 1UHMA 1MNEA 4OIQF 3V7SA 2VC0A 2GA1A 2PMZN 1N78A 3PM1A 4LJZF 1T08B 1SFEA 3BG9A 2XSDC 3HE0A 2FUG2 3V7RA 4RAYA
chains in the Genus database with same CATH topology
4ACIA 3HOUJ 4DYCA 3HGYA 4FISA 2Y9YA 3S14J 2M8GX 3G56A 1JKQC 2NOGA 4AC6A 3I4NJ 4MFDA 3KKCA 5FLMJ 2E1OA 4CYCB 1RETA 5DS9A 1CQTA 2XPWA 2HOTA 3S15J 5EEAA 5C4YA 3HEFA 1JJ8C 1ETXA 5EG0A 2LY9A 1P7IA 3A01B 2E2IJ 2AHQA 2DG8A 2W53A 3H3VK 1YRNB 3WHCA 3VW1A 3H0GJ 3K2AA 2DMPA 5F08A 2D5VA 2HI3A 3FIWA 2DA7A 1GV5A 2GENA 4JKZA 5CW8A 2DG7A 4JX6A 4XRSG 1JUSA 3L1PA 1AKHA 1UHSA 2M0CA 3B6CA 3M4OJ 1X58A 5E3OA 3Q0VA 5M5WJ 3A03A 1WH5A 1RPWA 4IEJA 1U9OA 5M5YJ 1RESA 1ZKGA 2RASA 1TWCJ 1QVTA 3ON4A 5K7HA 2Y0SN 1MBJA 3GTQJ 4J19A 3HTAA 3VP5A 3BTLA 4FE7A 2OERA 2YVEA 2MGQA 1JUPA 3RZDJ 3MVPA 2PZ9A 1HDPA 2NX4A 2FQ4A 4FE4A 1GUUA 5K7FA 3GTGJ 1S7EA 5IPAA 1IDZA 2OI8A 3BR5A 1I3QJ 2O9LA 5DTDA 3CDLA 3HGGA 2HOSA 2XB0X 2JA6J 4XIDA 3BR6A 4BY1J 2LP0A 3ON2A 5JLWA 2IEKA 1OJLA 2XGDA 4A3DJ 4Y52J 5EZHA 2CQQA 3IV5A 2YVHA 3C07A 2IBDA 1HLVA 3IH4A 2LVSA 2L0KA 3GTKJ 5M5XJ 1ZQ3P 1ETOA 3S1RJ 2EH3A 4EEFG 3ZQFA 4QIWN 4IHXA 2DMNA 3NARA 3HTIA 2HDDA 2DA2A 1I6HJ 4MLOA 2CU7A 1TWHJ 2LR8A 2HXIA 2VI6A 3BR1A 2M9HA 3IH2A 1Y1VJ 3O8HA 1FTTA 2O7OA 3GTOJ 3S16J 1TWGJ 3QBMA 3S2DJ 3LSPA 1JTYA 3Q3SA 5HAWA 1FTZA 3CCYA 2L7ZA 3WHBA 1BA5A 2P81A 2TRTA 2FX0A 2ZOZA 3VW0A 2JA8J 4D7MA 2EQRA 3JRCA 2LKXA 3BNIA 2HYJA 4JNNA 4JL3A 4Y7NJ 3LNQA 3DPJA 3IUVA 5EG0B 1TWFJ 3UKGA 4A3KJ 5IP6A 3HE0A 1F43A 3LSGA 2JA5J 5AQCA 2JK3A 1OCTC 1U8BA 4GCKA 1K83J 1IC8A 5H9TA 4XRSA 4DYRA 3RQIA 2VPRA 3LSRA 2IU5A 3KZ9A 1HDDC 3GBGA 2QTQA 3I4MJ 1ETKA 2K9QA 1AKHB 2HOAA 1IRZA 2DA6A 1JJ6C 2COBA 3CRJA 3S5RA 1H88C 3TP0A 4BY7J 3GTJJ 1K61A 4AUXA 2ME6A 5F0HA 3ANPA 1LE8A 3HDDA 2R7ZJ 1B72A 1EF4A 4A3EJ 3VUQA 3SJMA 3CWRA 4X6AJ 3HOVJ 4D5FA 1XG1A 1A5JA 3NXCA 4BKXA 1IV6A 3EGQA 5J1RA 3BR2A 4ABZA 1MBKA 2ZOYA 5IP9J 2B63J 4YZEA 2G3BA 4MFEA 1UMQA 1OCPA 1POGA 1ETYA 1JKPC 5GPAA 1JGGA 2KT0A 1FEXA 5F04A 1LFBA 3E7LA 2G7SA 1QPIA 2O7TA 3F1BA 2R92J 3S2HJ 3OSGA 2OF7A 2XDNA 5FGLA 3Q0WA 4M3DA 5EGOA 2KDZA 2ZCNA 5J1YA 4M6VA 2EZKA 2TCTA 3VVXA 4DZJA 4DZPA 4A3IJ 4X1EA 3VVZA 1X2NA 3BQYA 4JX5A 2DTZA 2K9NA 5J3LA 1UG2A 2R5ZA 2GUHA 2FD5A 4W1UA 2XRLA 4A3MJ 3PPBA 4MIMA 1RKWA 3BT9A 2F07A 3LWJA 3LJLA 2DA4A 5J1UA 3MNLA 2NVXJ 1T56A 5CXIA 1JT0A 5HBUA 3T6NA 3O60A 1RR7A 3JR9A 5IYBJ 5C4JJ 4IHVA 2DMTA 3JRHA 2NP3A 2DN0A 1JKOC 2XPUA 2HYTA 1ZGWA 4PXIA 1MBGA 1ETVA 3K7AJ 3BRUA 3JRGA 2LD5A 2PBXA 3BR0A 5IYDJ 3IH3A 3GZIA 4NELA 2QCOA 1MNMC 3S1QJ 3ZOBA 5M3FJ 3OSFA 2JJ7A 2H8RA 4L62A 2O8KA 3Q0UA 3BTJA 3VIBA 3FISA 2VKEA 1JUMA 4M3FA 3VOXA 4RBOA 1BW5A 4QTRA 1HCRA 3CJDA 3GTPJ 3HB9A 4RDUA 4C3HJ 1Y1WJ 1LE8B 4UUTA 1B72B 4FTHA 3QKXA 1BW6A 2L7MP 2Y30A 4IHYA 1R9TJ 1IG7A 5HODA 4A3FJ 4HNVA 3VOKA 1XC5A 2HQ5A 4FCYA 1W0UA 3G1LA 2REKA 2VUMJ 2WB1N 3KKDA 2NVYJ 1XS9A 1G2HA 1LFUP 4UDSA 5K58A 1Z0XA 2IAIA 5FJ8J 5F1JA 5EFYA 1MH3A 5E3NA 2H1KA 2ME0A 4JX4A 1MBEA 1BL0A 2Y2ZA 2YUSA 3S1NJ 1NK2P 4GFKA 3HOYJ 1NK3P 2X48A 3NPIA 1ETWA 2NP5A 2EZIA 4V2GA 2JWTA 3JRBA 5IYCJ 5EGOB 3G7RA 4A3CJ 1JTXA 1SANA 3A02A 3MKLA 1HF0A 3V78A 3QQAA 1D5YA 4HKUA 5JLXA 3BQZA 3QPSA 2R5ZB 5F27A 1H8AC 2MSYA 3ANGA 4ICHA 3DCFA 3HTJA 2UXUA 3G1MA 1ZR4A 5F0CA 2NVQJ 1AU7A 2LLKA 1VNDA 2R93J 2L9RA 3HBLA 3ZQIA 3JSJA 1QVUA 1F36A 3BG3A 2M34A 1GDTA 3TW7A 5IOZA 1PUFA 3B6AA 1B8IA 1IGNA 5FMPA 4GFLA 2UXPA 1VF9A 3NAUA 1WI3A 1AHDP 2R5YA 2EZHA 5F0FA 3O8GA 5GPCA 5EZGA 3VPRA 3PO2J 3JRDA 3PASA 2HKUA 3KNWA 3G1OA 1ENHA 1P7JA 2LK2A 5EYRA 2DA1A 5FKKA 4A3GJ 2G0EA 2XGEA 4AC0A 2OPTA 2UXOA 1E3OC 3ZQGA 2V57A 3GEUA 5EDNA 3ZQCA 1WCMJ 4A93J 3V6GA 1WH7A 2YS9A 5C44J 2ZCXA 2NVTJ 2X6OA 3PO3J 3BCGA 1GT0C 3BTIA 1ZTRA 4I6ZA 5FKNA 4A69C 5FKOA 3S17J 2WUIA 3TW6A 2DA5A 1MBHA 3HOXJ 4W97A 9ANTA 4AYBN 3BJBA 1IJWC 4GFBA 4QSHA 1VI0A 1O4XA 3C2BA 2DMUA 1VFCA 4XICA 2ZCMA 2QOPA 1OFCX 1UI5A 3JREA 1WGXA 3AQTA 1H89C 3FK7A 5IP7J 3HM5A 2QKOA 4JP0A 2R0QC 2WV1A 2G7LA 2JMWA 3QPLA 2JA7J 2MG4A 3AQSA 4MK6A 4DW6A 3P9TA 1WPKA 2LTPA 2E2HJ 1NTCA 1TC3C 5FKMA 3OOUA 3HIMA 4C3IJ 2K9SA 1ZK8A 4D7NA 1DU6A 3BHQA 3JRIA 2LFBA 4GCLA 2QIBA 2E19A 4B4CA 4C2MJ 1FIAA 4M3EA 3NI7A 5FHPA 2DMQA 2WAQN 1T33A 3HOWJ 2ZB9A 3TEDA 1SGMA 1I50J 2X9DA 4V2FA 2CRGA 1MBFA 2M2EA 4GCTA 2QF7A 4NDLA 2FJ1A 3HTHA 5FLVA 1PUFB 1B8IB 4BBRJ 2RAEA 1FJLA 4I76A 3GTMJ 5GP9A 2XB5A 2ECBA 4UUSA 3S1MJ 2R5YB 2JN6A 1U78A 2GM4A 2ID3A 3RKQA 2GLOA 5C4XJ 1UI6A 2DJNA 1HOMA 2WGBA 1W0TA 1Q1VA 2FBQA 3HKZN 3LSJA 1IUFA 4A3BJ 4XK4A 3ZQLA 1ITYA 4KWAA 1TWAJ 5D1RA 3LOCA 4C3JJ 1MSEC 2UXIA 1SFOJ 1MSFC 3SDGA 3ZQHA 3JRAA 3COLA 3VW2A 2Q24A 2L7FP 4CYCA 2Y9ZA 3NNRA 4NN1A 3BR3A 4D5CA 5E3MA 4M3BA 1DU0A 1ETQA 2N8GA 4XRMA 2NS8A 2RHAA 3A01A 1QRYA 2E2JJ 5HSZA 2QWTA 4M3GA 4S0HB 3LHQA 3F0CA 5IOYA 3BTCA 4IHWA 2CJJA 1YRNA 3HOZJ 1Z77A 4JYKA 3SFIA 4AF5A 2XPVA 3B81A 2CUEA 5DAJA 5D19A 3FK6A 4BXXJ 3RD3A 1BJZA 3VVYA 4CGRA 1FIPA 1ZR2A 2AO9A 3FKIJ 4ME9A 2NS7A 2HXOA 4G12A 4B1RA 4B3AA 2GBYA 2W48A 2EZLA 3RZOJ 2EBIA 5K7ZA 2MW8A 3DEWA 1ORKA 5FKLA 2XGCA 1U9NA 4BBSJ 2UXHA 1RKTA 3D1NI 3FRQA 3RH2A 4DYQA 2ECCA 3BG5A 2K40A 3W6VA 4LOCA 1JKRC 1APLC 2YU9J 5CXGA 1GV2A 4MO7A 5E3LA 1MH4A 4A3LJ 2CQXA 3CQZJ 1IDYA 2ID6A 2Y31A 5D18A 2CUFA 1JT6A 5M3MJ 3EUPA 2D6YA 1A6IA 4UUSB 2GFNA 2I10A 4L5EA 2G7GA 5C3EJ 3M3YJ 3GTLJ 1GVDA 1X2MA 4MXMA 2ELKA 5BNGA 2VKVA 3CMYA 2PMZN 2DA3A 3MN2A 3NRGA 3PM1A 3JRFA 3BG9A 2XSDC 3TP3A 3OIOA 4A3JJ 5EF6A 3E7QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ACI A;  3HOU J;  4DYC A;  3HGY A;  4FIS A;  2Y9Y A;  3S14 J;  2M8G X;  3G56 A;  1JKQ C;  2NOG A;  4AC6 A;  3I4N J;  4MFD A;  3KKC A;  5FLM J;  2E1O A;  4CYC B;  1RET A;  5DS9 A;  1CQT A;  2XPW A;  2HOT A;  3S15 J;  5EEA A;  5C4Y A;  3HEF A;  1JJ8 C;  1ETX A;  5EG0 A;  2LY9 A;  1P7I A;  3A01 B;  2E2I J;  2AHQ A;  2DG8 A;  2W53 A;  3H3V K;  1YRN B;  3WHC A;  3VW1 A;  3H0G J;  3K2A A;  2DMP A;  5F08 A;  2D5V A;  2HI3 A;  3FIW A;  2DA7 A;  1GV5 A;  2GEN A;  4JKZ A;  5CW8 A;  2DG7 A;  4JX6 A;  4XRS G;  1JUS A;  3L1P A;  1AKH A;  1UHS A;  2M0C A;  3B6C A;  3M4O J;  1X58 A;  5E3O A;  3Q0V A;  5M5W J;  3A03 A;  1WH5 A;  1RPW A;  4IEJ A;  1U9O A;  5M5Y J;  1RES A;  1ZKG A;  2RAS A;  1TWC J;  1QVT A;  3ON4 A;  5K7H A;  2Y0S N;  1MBJ A;  3GTQ J;  4J19 A;  3HTA A;  3VP5 A;  3BTL A;  4FE7 A;  2OER A;  2YVE A;  2MGQ A;  1JUP A;  3RZD J;  3MVP A;  2PZ9 A;  1HDP A;  2NX4 A;  2FQ4 A;  4FE4 A;  1GUU A;  5K7F A;  3GTG J;  1S7E A;  5IPA A;  1IDZ A;  2OI8 A;  3BR5 A;  1I3Q J;  2O9L A;  5DTD A;  3CDL A;  3HGG A;  2HOS A;  2XB0 X;  2JA6 J;  4XID A;  3BR6 A;  4BY1 J;  2LP0 A;  3ON2 A;  5JLW A;  2IEK A;  1OJL A;  2XGD A;  4A3D J;  4Y52 J;  5EZH A;  2CQQ A;  3IV5 A;  2YVH A;  3C07 A;  2IBD A;  1HLV A;  3IH4 A;  2LVS A;  2L0K A;  3GTK J;  5M5X J;  1ZQ3 P;  1ETO A;  3S1R J;  2EH3 A;  4EEF G;  3ZQF A;  4QIW N;  4IHX A;  2DMN A;  3NAR A;  3HTI A;  2HDD A;  2DA2 A;  1I6H J;  4MLO A;  2CU7 A;  1TWH J;  2LR8 A;  2HXI A;  2VI6 A;  3BR1 A;  2M9H A;  3IH2 A;  1Y1V J;  3O8H A;  1FTT A;  2O7O A;  3GTO J;  3S16 J;  1TWG J;  3QBM A;  3S2D J;  3LSP A;  1JTY A;  3Q3S A;  5HAW A;  1FTZ A;  3CCY A;  2L7Z A;  3WHB A;  1BA5 A;  2P81 A;  2TRT A;  2FX0 A;  2ZOZ A;  3VW0 A;  2JA8 J;  4D7M A;  2EQR A;  3JRC A;  2LKX A;  3BNI A;  2HYJ A;  4JNN A;  4JL3 A;  4Y7N J;  3LNQ A;  3DPJ A;  3IUV A;  5EG0 B;  1TWF J;  3UKG A;  4A3K J;  5IP6 A;  3HE0 A;  1F43 A;  3LSG A;  2JA5 J;  5AQC A;  2JK3 A;  1OCT C;  1U8B A;  4GCK A;  1K83 J;  1IC8 A;  5H9T A;  4XRS A;  4DYR A;  3RQI A;  2VPR A;  3LSR A;  2IU5 A;  3KZ9 A;  1HDD C;  3GBG A;  2QTQ A;  3I4M J;  1ETK A;  2K9Q A;  1AKH B;  2HOA A;  1IRZ A;  2DA6 A;  1JJ6 C;  2COB A;  3CRJ A;  3S5R A;  1H88 C;  3TP0 A;  4BY7 J;  3GTJ J;  1K61 A;  4AUX A;  2ME6 A;  5F0H A;  3ANP A;  1LE8 A;  3HDD A;  2R7Z J;  1B72 A;  1EF4 A;  4A3E J;  3VUQ A;  3SJM A;  3CWR A;  4X6A J;  3HOV J;  4D5F A;  1XG1 A;  1A5J A;  3NXC A;  4BKX A;  1IV6 A;  3EGQ A;  5J1R A;  3BR2 A;  4ABZ A;  1MBK A;  2ZOY A;  5IP9 J;  2B63 J;  4YZE A;  2G3B A;  4MFE A;  1UMQ A;  1OCP A;  1POG A;  1ETY A;  1JKP C;  5GPA A;  1JGG A;  2KT0 A;  1FEX A;  5F04 A;  1LFB A;  3E7L A;  2G7S A;  1QPI A;  2O7T A;  3F1B A;  2R92 J;  3S2H J;  3OSG A;  2OF7 A;  2XDN A;  5FGL A;  3Q0W A;  4M3D A;  5EGO A;  2KDZ A;  2ZCN A;  5J1Y A;  4M6V A;  2EZK A;  2TCT A;  3VVX A;  4DZJ A;  4DZP A;  4A3I J;  4X1E A;  3VVZ A;  1X2N A;  3BQY A;  4JX5 A;  2DTZ A;  2K9N A;  5J3L A;  1UG2 A;  2R5Z A;  2GUH A;  2FD5 A;  4W1U A;  2XRL A;  4A3M J;  3PPB A;  4MIM A;  1RKW A;  3BT9 A;  2F07 A;  3LWJ A;  3LJL A;  2DA4 A;  5J1U A;  3MNL A;  2NVX J;  1T56 A;  5CXI A;  1JT0 A;  5HBU A;  3T6N A;  3O60 A;  1RR7 A;  3JR9 A;  5IYB J;  5C4J J;  4IHV A;  2DMT A;  3JRH A;  2NP3 A;  2DN0 A;  1JKO C;  2XPU A;  2HYT A;  1ZGW A;  4PXI A;  1MBG A;  1ETV A;  3K7A J;  3BRU A;  3JRG A;  2LD5 A;  2PBX A;  3BR0 A;  5IYD J;  3IH3 A;  3GZI A;  4NEL A;  2QCO A;  1MNM C;  3S1Q J;  3ZOB A;  5M3F J;  3OSF A;  2JJ7 A;  2H8R A;  4L62 A;  2O8K A;  3Q0U A;  3BTJ A;  3VIB A;  3FIS A;  2VKE A;  1JUM A;  4M3F A;  3VOX A;  4RBO A;  1BW5 A;  4QTR A;  1HCR A;  3CJD A;  3GTP J;  3HB9 A;  4RDU A;  4C3H J;  1Y1W J;  1LE8 B;  4UUT A;  1B72 B;  4FTH A;  3QKX A;  1BW6 A;  2L7M P;  2Y30 A;  4IHY A;  1R9T J;  1IG7 A;  5HOD A;  4A3F J;  4HNV A;  3VOK A;  1XC5 A;  2HQ5 A;  4FCY A;  1W0U A;  3G1L A;  2REK A;  2VUM J;  2WB1 N;  3KKD A;  2NVY J;  1XS9 A;  1G2H A;  1LFU P;  4UDS A;  5K58 A;  1Z0X A;  2IAI A;  5FJ8 J;  5F1J A;  5EFY A;  1MH3 A;  5E3N A;  2H1K A;  2ME0 A;  4JX4 A;  1MBE A;  1BL0 A;  2Y2Z A;  2YUS A;  3S1N J;  1NK2 P;  4GFK A;  3HOY J;  1NK3 P;  2X48 A;  3NPI A;  1ETW A;  2NP5 A;  2EZI A;  4V2G A;  2JWT A;  3JRB A;  5IYC J;  5EGO B;  3G7R A;  4A3C J;  1JTX A;  1SAN A;  3A02 A;  3MKL A;  1HF0 A;  3V78 A;  3QQA A;  1D5Y A;  4HKU A;  5JLX A;  3BQZ A;  3QPS A;  2R5Z B;  5F27 A;  1H8A C;  2MSY A;  3ANG A;  4ICH A;  3DCF A;  3HTJ A;  2UXU A;  3G1M A;  1ZR4 A;  5F0C A;  2NVQ J;  1AU7 A;  2LLK A;  1VND A;  2R93 J;  2L9R A;  3HBL A;  3ZQI A;  3JSJ A;  1QVU A;  1F36 A;  3BG3 A;  2M34 A;  1GDT A;  3TW7 A;  5IOZ A;  1PUF A;  3B6A A;  1B8I A;  1IGN A;  5FMP A;  4GFL A;  2UXP A;  1VF9 A;  3NAU A;  1WI3 A;  1AHD P;  2R5Y A;  2EZH A;  5F0F A;  3O8G A;  5GPC A;  5EZG A;  3VPR A;  3PO2 J;  3JRD A;  3PAS A;  2HKU A;  3KNW A;  3G1O A;  1ENH A;  1P7J A;  2LK2 A;  5EYR A;  2DA1 A;  5FKK A;  4A3G J;  2G0E A;  2XGE A;  4AC0 A;  2OPT A;  2UXO A;  1E3O C;  3ZQG A;  2V57 A;  3GEU A;  5EDN A;  3ZQC A;  1WCM J;  4A93 J;  3V6G A;  1WH7 A;  2YS9 A;  5C44 J;  2ZCX A;  2NVT J;  2X6O A;  3PO3 J;  3BCG A;  1GT0 C;  3BTI A;  1ZTR A;  4I6Z A;  5FKN A;  4A69 C;  5FKO A;  3S17 J;  2WUI A;  3TW6 A;  2DA5 A;  1MBH A;  3HOX J;  4W97 A;  9ANT A;  4AYB N;  3BJB A;  1IJW C;  4GFB A;  4QSH A;  1VI0 A;  1O4X A;  3C2B A;  2DMU A;  1VFC A;  4XIC A;  2ZCM A;  2QOP A;  1OFC X;  1UI5 A;  3JRE A;  1WGX A;  3AQT A;  1H89 C;  3FK7 A;  5IP7 J;  3HM5 A;  2QKO A;  4JP0 A;  2R0Q C;  2WV1 A;  2G7L A;  2JMW A;  3QPL A;  2JA7 J;  2MG4 A;  3AQS A;  4MK6 A;  4DW6 A;  3P9T A;  1WPK A;  2LTP A;  2E2H J;  1NTC A;  1TC3 C;  5FKM A;  3OOU A;  3HIM A;  4C3I J;  2K9S A;  1ZK8 A;  4D7N A;  1DU6 A;  3BHQ A;  3JRI A;  2LFB A;  4GCL A;  2QIB A;  2E19 A;  4B4C A;  4C2M J;  1FIA A;  4M3E A;  3NI7 A;  5FHP A;  2DMQ A;  2WAQ N;  1T33 A;  3HOW J;  2ZB9 A;  3TED A;  1SGM A;  1I50 J;  2X9D A;  4V2F A;  2CRG A;  1MBF A;  2M2E A;  4GCT A;  2QF7 A;  4NDL A;  2FJ1 A;  3HTH A;  5FLV A;  1PUF B;  1B8I B;  4BBR J;  2RAE A;  1FJL A;  4I76 A;  3GTM J;  5GP9 A;  2XB5 A;  2ECB A;  4UUS A;  3S1M J;  2R5Y B;  2JN6 A;  1U78 A;  2GM4 A;  2ID3 A;  3RKQ A;  2GLO A;  5C4X J;  1UI6 A;  2DJN A;  1HOM A;  2WGB A;  1W0T A;  1Q1V A;  2FBQ A;  3HKZ N;  3LSJ A;  1IUF A;  4A3B J;  4XK4 A;  3ZQL A;  1ITY A;  4KWA A;  1TWA J;  5D1R A;  3LOC A;  4C3J J;  1MSE C;  2UXI A;  1SFO J;  1MSF C;  3SDG A;  3ZQH A;  3JRA A;  3COL A;  3VW2 A;  2Q24 A;  2L7F P;  4CYC A;  2Y9Z A;  3NNR A;  4NN1 A;  3BR3 A;  4D5C A;  5E3M A;  4M3B A;  1DU0 A;  1ETQ A;  2N8G A;  4XRM A;  2NS8 A;  2RHA A;  3A01 A;  1QRY A;  2E2J J;  5HSZ A;  2QWT A;  4M3G A;  4S0H B;  3LHQ A;  3F0C A;  5IOY A;  3BTC A;  4IHW A;  2CJJ A;  1YRN A;  3HOZ J;  1Z77 A;  4JYK A;  3SFI A;  4AF5 A;  2XPV A;  3B81 A;  2CUE A;  5DAJ A;  5D19 A;  3FK6 A;  4BXX J;  3RD3 A;  1BJZ A;  3VVY A;  4CGR A;  1FIP A;  1ZR2 A;  2AO9 A;  3FKI J;  4ME9 A;  2NS7 A;  2HXO A;  4G12 A;  4B1R A;  4B3A A;  2GBY A;  2W48 A;  2EZL A;  3RZO J;  2EBI A;  5K7Z A;  2MW8 A;  3DEW A;  1ORK A;  5FKL A;  2XGC A;  1U9N A;  4BBS J;  2UXH A;  1RKT A;  3D1N I;  3FRQ A;  3RH2 A;  4DYQ A;  2ECC A;  3BG5 A;  2K40 A;  3W6V A;  4LOC A;  1JKR C;  1APL C;  2YU9 J;  5CXG A;  1GV2 A;  4MO7 A;  5E3L A;  1MH4 A;  4A3L J;  2CQX A;  3CQZ J;  1IDY A;  2ID6 A;  2Y31 A;  5D18 A;  2CUF A;  1JT6 A;  5M3M J;  3EUP A;  2D6Y A;  1A6I A;  4UUS B;  2GFN A;  2I10 A;  4L5E A;  2G7G A;  5C3E J;  3M3Y J;  3GTL J;  1GVD A;  1X2M A;  4MXM A;  2ELK A;  5BNG A;  2VKV A;  3CMY A;  2PMZ N;  2DA3 A;  3MN2 A;  3NRG A;  3PM1 A;  3JRF A;  3BG9 A;  2XSD C;  3TP3 A;  3OIO A;  4A3J J;  5EF6 A;  3E7Q A; 
#chains in the Genus database with same CATH topology
 3HGY A;  2ESH A;  4Y4R A;  2Y9Y A;  3AL0 C;  1WRJ A;  2DU9 A;  4AC6 A;  3KKC A;  4CYC B;  2HOT A;  3PFI A;  4UVB A;  4EJO A;  1SD6 A;  4U7D A;  3CC2 I;  2YU3 A;  2AXT C;  4IRV A;  4GDF A;  3HEF A;  1P9Q C;  1TNS A;  2E1M C;  3BG6 A;  2VOD A;  1P7I A;  2H27 A;  4PJN A;  5CPR B;  2EFW A;  1FOY A;  2Z5U A;  3PSF A;  4EMS A;  2X6W A;  3K2A A;  4A0Y A;  1WKM A;  3OR1 C;  2D5V A;  2DA7 A;  3EQL F;  4NUB A;  2XAH A;  4JKZ A;  2CFX A;  2L9V A;  4XN3 A;  2DG7 A;  1JUS A;  3Q9S A;  1E17 A;  2X0L A;  1UHS A;  3M8J A;  1U0J A;  1X58 A;  5E3O A;  4KIF A;  4LIV A;  4RGX A;  1IXS B;  1FMW A;  4NNJ A;  5M5Y J;  1U9O A;  5L3E A;  1ZKG A;  1CF7 A;  2HQR A;  2VL8 A;  1FC3 A;  1QVT A;  1TWC J;  1JE8 A;  3ON4 A;  2H94 A;  4ENN A;  4A0X A;  5JHF A;  3K4B A;  5H20 A;  2K5C A;  4BJT A;  1N25 A;  4LFU A;  3CCQ I;  2NX4 A;  4FE4 A;  4ETS A;  3DKX A;  1J75 A;  1YOV B;  1UG0 A;  3WE3 A;  5IPA A;  1IDZ A;  2OI8 A;  2KQR A;  2ELJ A;  1X3Z B;  3DTE A;  4IRG A;  4ON0 A;  3H3U A;  5DTD A;  5D6F A;  3CDL A;  4D9J A;  2XB0 X;  2DLL A;  4PDK A;  3OYB A;  2LP0 A;  5LLQ A;  2LKS A;  3NQO A;  2XGD A;  1V5G A;  5EZH A;  3JSP A;  2K4J A;  3E6D A;  3K1M A;  3PNV A;  4DOZ A;  2E34 A;  2L54 A;  1ETO A;  2EH3 A;  5HLI A;  2DQL A;  1WJC A;  4CXF A;  5IT9 Z;  2DT7 B;  1BI1 A;  3HTI A;  1T0F C;  1YS7 A;  3VSK A;  2DA2 A;  1ZHF A;  2MH2 A;  3QOP A;  4L5I A;  4KMF A;  3K8P C;  1TWH J;  3T8R A;  2XAJ A;  2HXI A;  3IH2 A;  2M9H A;  1Y1V J;  4CCJ A;  4G6D A;  1FTT A;  2O7O A;  2IPQ X;  1EH7 A;  4DIQ A;  3LSP A;  3SXY A;  3GCM A;  1A36 A;  4BXU A;  3GW2 A;  1FTZ A;  3CCJ I;  2QSG X;  1A04 A;  2JA8 J;  5H6Q A;  4L18 B;  3HPH A;  2ETH A;  2LBF A;  2DFI A;  2FNP A;  4KIB A;  4A5N A;  4Z6Y A;  2OU2 A;  4HEA 2;  1OCT C;  2V9P A;  1SFX A;  4YG2 F;  2A69 F;  5H9T A;  2I8D A;  2PX9 A;  2J5O A;  1E0E A;  3OS0 A;  3G73 A;  2K86 A;  2OCC H;  1DP3 A;  3H3Z A;  4P5O A;  1ETK A;  3H36 A;  3HKZ A;  4LMY A;  2VOP A;  1JJ6 C;  1V3F A;  2KLO A;  1FY7 A;  3QOE A;  3S5R A;  2H1L A;  4HAM A;  2OQR A;  2JQ7 A;  4AUX A;  4IRH A;  2ME6 A;  1CF7 B;  2B7E A;  3ANP A;  2AS5 F;  1TW3 A;  2WY8 Q;  3VUQ A;  1MMD A;  4ENJ A;  3TOA A;  3HOV J;  3HYI A;  2CUJ A;  1XG1 A;  4BKX A;  1IV6 A;  4C2U A;  5CKT A;  3EGQ A;  5JVG F;  2FE3 A;  1D3Y A;  1PUE E;  1ON1 A;  3IRR A;  3BR2 A;  3OIP A;  2A6T A;  2X6Y A;  1D0X A;  2DO7 A;  2EIJ H;  1UMQ A;  4Q47 A;  2LKP A;  1JKP C;  2QLZ A;  5GPA A;  1JGG A;  2KT0 A;  2G7S A;  1LFB A;  2CUZ A;  3HIF A;  3CUQ A;  5TRD A;  3F3X A;  2FML A;  3OYH A;  2OF7 A;  3OSG A;  5J1Y A;  4MEX F;  2QM3 A;  3VVX A;  2TCT A;  2HU9 A;  2WBM A;  3FKJ A;  3S3N A;  2OCE A;  1X2N A;  1PJR A;  3BQY A;  4JX5 A;  2DTZ A;  5J3L A;  3MAJ A;  2JVG A;  1P4A A;  2R5Z A;  1JGS A;  2FD5 A;  2GUH A;  4CCO A;  3VYU B;  2PLY A;  3PPB A;  1Y0U A;  2KRC A;  3BT9 A;  5B66 C;  2V1U A;  3LJL A;  1YFH A;  4WXH A;  5CVV A;  3K70 C;  1B9M A;  2EIN H;  1JT0 A;  4HF0 A;  1RR7 A;  4MGR A;  4IHV A;  2DT6 A;  2DMT A;  4MHG A;  2DN0 A;  2HYT A;  1K4T A;  2LBF B;  3R4K A;  1ETV A;  3BRU A;  2LD5 A;  5J6X A;  2CSO A;  1WQ2 A;  3GZI A;  1LEB A;  4F7Z A;  2FRH A;  4AIH A;  1YLF A;  3ZOB A;  1LNW A;  2WWY A;  2H8R A;  1D5V A;  1KGS A;  3PFY A;  5DUK A;  3E3V A;  3SEQ A;  2O8K A;  3BTJ A;  3VIB A;  3FIS A;  4RS8 A;  1B9N A;  4E7H A;  4M3F A;  1JHF A;  3IUO A;  4ENK A;  3IRQ A;  4PZJ A;  2DI3 A;  3L09 A;  3GTP J;  3QRF F;  2ZME A;  4PSW A;  3OYF A;  4HA8 A;  2QA4 I;  3QKX A;  2IS2 A;  2PN6 A;  2IGN A;  2D1V A;  3ZMV A;  1QU3 A;  1OCC H;  2L7M P;  2OBP A;  1ODD A;  3LQQ A;  2STW A;  2V6C A;  1IG7 A;  5HOD A;  2OC6 A;  5E1W A;  4A3F J;  1XC5 A;  4OOI A;  4XMY A;  3MMY B;  3DTK A;  4ZYG A;  1IW7 F;  4H4K C;  1XS9 A;  1OR7 C;  4UDS A;  4CO8 A;  2KJC A;  5K58 A;  1OMI A;  2KZG A;  2Y0M A;  5LGU A;  1D0Z A;  2YUS A;  3S1N J;  4K2E A;  1K4S A;  3GZ6 A;  2E60 A;  2ELH A;  1XCB A;  3CUQ B;  1ETW A;  2FQ3 A;  2NP5 A;  4ZYA A;  5BS6 A;  1FYL A;  4V2G A;  4KIG A;  3JRB A;  4KIC A;  2VLA A;  4A3C J;  1SFU A;  3KP7 A;  3WOD F;  3A02 A;  4UVA A;  3QQA A;  4HKU A;  3V78 A;  5LFA A;  3GUD A;  4KUM A;  2NNY A;  1K78 A;  2R5Z B;  1J2X A;  3M8F A;  2MSY A;  2ZJR F;  2EB7 A;  2BHY A;  5GAD J;  2UXU A;  1NH3 A;  3KP2 A;  3JSJ A;  1V5E A;  4KA4 A;  4XLH A;  4EVI A;  1PUF A;  3B6A A;  2MC4 A;  5CQG A;  4D1Q A;  5FMP A;  4LIU A;  2GQQ A;  4HQM A;  3WGH A;  3ZQQ A;  1ZG1 A;  5JVT A;  2IA2 A;  1MMS A;  1P2F A;  1UFM A;  1XGN A;  3V8J A;  2LK2 A;  5D8L B;  1X1P A;  2B9S A;  4FHT A;  3DV8 A;  4DJA A;  2XGE A;  1ZN2 A;  2F5V A;  4JBA A;  3L2C A;  3DU6 A;  1VQ5 I;  3FDY A;  2LG4 A;  1R1T A;  3KP6 A;  1RIO H;  2XIG A;  2VJ5 A;  4LG3 A;  2VT2 A;  1A6Q A;  4CCN A;  5H2F C;  3PNY A;  2ZME B;  2XAS A;  1XX5 A;  1JHH A;  3K0L A;  3BCG A;  3GX4 X;  1Z67 A;  4KYW A;  3FHZ A;  9ANT A;  4MTE A;  1YJN I;  4HYE A;  4XLA A;  1IJW C;  5L3D A;  1I1S A;  2XKP A;  4R8H A;  1Z9C A;  4J01 A;  3G6E I;  2DMU A;  3VOD A;  2ZCM A;  4BDY A;  4P9F A;  3O2P E;  3HHG A;  2RKH A;  3AQT A;  3P9C A;  3EUH A;  4H0E A;  1LJ9 A;  3HM5 A;  3CF2 A;  3E1S A;  1SD4 A;  3CCV I;  4U0W A;  3DEE A;  1IN6 A;  2JUC A;  2DFH A;  4XL9 A;  2G7L A;  2HKX A;  2EWN A;  2MG4 A;  4DW6 A;  2K3P A;  1R5I D;  3NWS A;  4FX4 A;  3JAM Z;  3HIM A;  2O6G E;  1K78 B;  4CDG A;  4D7N A;  1TL8 A;  1MD0 A;  1KZH A;  1KU3 A;  2IVM A;  5J8F A;  4B4C A;  2D1H A;  4AD9 A;  1OLT A;  4HX8 A;  1IUY A;  3KFW X;  5HS9 A;  4PFO A;  5DEQ A;  2X9D A;  4V2F A;  2A05 A;  3ERE D;  4BQO A;  4RGR A;  2M2E A;  3QYF A;  2L3D A;  4UUV A;  4M6X A;  4NDL A;  4U0Y A;  2VE9 A;  3RPQ A;  5L3G A;  1PUF B;  4I76 A;  2KIQ A;  4OMZ A;  1N75 A;  2ECB A;  2DQR A;  1EJ9 A;  2EFP A;  3S1M J;  3W2V A;  4ZTJ A;  1HKS A;  2GM4 A;  2ID3 A;  2MFZ A;  1TTY A;  3OL4 A;  2GLO A;  1UI6 A;  4M9S A;  2FBH A;  4NQW A;  3L2R A;  2VB6 A;  1W5S A;  1W0T A;  2FJI 1;  3NS4 A;  4GRI A;  2M3A A;  3LSJ A;  4A3B J;  3ZQL A;  3DFG A;  1TWA J;  3IC7 A;  2BYV E;  5D1R A;  3M1C A;  1RI7 A;  1X3W B;  4MEY F;  3C18 A;  3TMO A;  3COL A;  1JI8 A;  1OCO H;  1S9H A;  3ROU A;  2KDO A;  2FSW A;  3C2H A;  5CYV A;  4JK1 X;  2Y9Z A;  4C9Y A;  4D5C A;  3K2Z A;  3K4K A;  1ETQ A;  1B1B A;  4E70 A;  3DLL F;  1R1V A;  3WG7 H;  4ZTF A;  4PJ0 C;  1SC7 A;  3IKV A;  5DCM A;  2E2J J;  4J00 A;  4S0H B;  1KON A;  5FGM A;  2ZJ2 A;  1YRN A;  1G4D A;  2EFQ A;  1SAU A;  2HKO A;  1WWX A;  4AF5 A;  2YX4 A;  3FMS A;  4FQG A;  3B81 A;  1DPU A;  1QNT A;  3RD3 A;  2ZXW H;  3VVY A;  3VWB A;  4HF1 A;  1R6R A;  1FIP A;  1ZR2 A;  2AO9 A;  3DPT A;  2IS6 A;  2LYC A;  3OYC A;  3AFH A;  3DQV C;  4L9J A;  2W48 A;  2Q2E A;  1MKM A;  1O7F A;  3RZO J;  4CUG A;  1SEU A;  3DEW A;  4XLE A;  3TGN A;  1U9N A;  4BBS J;  2XVC A;  2LRD A;  4PCQ A;  2X1C A;  2VT3 A;  3W6V A;  3QP5 A;  2Z2S B;  5CXG A;  2D45 A;  3M9A A;  4LD5 A;  4MO7 A;  2QVO A;  2CQX A;  2ID6 A;  3QP6 A;  2CWE A;  2ISY A;  2XGX A;  5M3M J;  1WJD A;  3I55 I;  5AIQ A;  4HDV A;  4CZZ A;  4LIT A;  4L5E A;  2CGP A;  3M3Y J;  1HW5 A;  1GVD A;  4ZYD A;  2VKV A;  4NQW B;  3GME A;  2B1E A;  3I3L A;  3NRG A;  1QQI A;  3JW4 A;  3OYI A;  3OOP A;  1YS6 A;  1BR2 A;  2JVH A;  5EF6 A;  1YX5 A;  3HOU J;  4I09 A;  2HZT A;  4OAZ A;  4FIS A;  4EJU A;  2JRM A;  2RNG A;  1A31 A;  1IO2 A;  2NOG A;  3ULQ B;  1RNL A;  1MZB A;  2CW0 F;  2GWR A;  4EGY A;  2X1E A;  1RET A;  1CQT A;  2JSP A;  2XPW A;  3E5Q A;  5GAE J;  5EEA A;  3W2A A;  5C4Y A;  4A6E A;  3CO7 C;  5K5O A;  4HNU A;  2VON A;  1ETX A;  1IRG A;  5F64 A;  4HBL A;  2LY9 A;  1LVA A;  1UZC A;  1ZAR A;  2AHQ A;  5DCM B;  1YG2 A;  1XDS A;  2HVQ A;  3BP8 A;  4HOB A;  2DG8 A;  4AVZ A;  1YRN B;  3WHC A;  3VW1 A;  3H1C A;  4HLY A;  5J4V A;  1XN7 A;  2VBX A;  5LHG A;  1YTY A;  4BXF A;  1DP7 P;  3BWG A;  3FIW A;  2Q0O A;  4KN4 X;  3EYI A;  4YFN F;  4JX6 A;  3I64 A;  1G8X A;  3RYR A;  3CF5 F;  4BE2 A;  1AKH A;  4E7L A;  3M4O J;  2RQP A;  3SYT A;  1UEL B;  1RPW A;  4IEJ A;  3HXL A;  5ICE A;  4L0Y B;  1RES A;  2I5U A;  1RRJ A;  1QZZ A;  2Q2E B;  3GF2 A;  4C2T A;  3QAH A;  3GTQ J;  2V7F A;  2FOK A;  4OMY A;  4BE0 A;  3SHF A;  2MGQ A;  2CW8 A;  4XNF A;  2QSF X;  3RDI A;  3AG4 H;  3DBH B;  5K7F A;  3GTG J;  4S05 A;  3BR5 A;  3CTA A;  3J80 K;  5TJJ A;  3FX3 A;  1R23 A;  3UNG C;  2JA6 J;  1FOW A;  2P8T A;  2GIV A;  2IEK A;  2BBY A;  5GAG J;  2YVH A;  3KYL A;  5BOX A;  3W3C A;  2L4M A;  1TQM A;  1HLV A;  2BE5 F;  2LVS A;  1LDD A;  2L0K A;  1OKR A;  4I0B A;  5D5W B;  2XF7 A;  5GTI C;  2DMN A;  1V54 H;  4AWX B;  3MZ8 A;  2YPR A;  4X0G A;  2M1B A;  3KZZ A;  1UHW A;  3O8H A;  3CDI A;  1ZLK A;  4M9Z A;  3S16 J;  1TWG J;  2E1N A;  3LST A;  3TDZ C;  4V19 K;  3S2D J;  3HSE A;  1HXD A;  5HAW A;  3ECH A;  3WHB A;  1BA5 A;  1H9G A;  2P81 A;  2FX0 A;  2TRT A;  2ZSH B;  1FSH A;  3CLQ A;  2HEO A;  2ZOZ A;  3VW0 A;  3JRC A;  3F72 A;  4U87 A;  4JNN A;  3OL3 A;  3PSI A;  3LNQ A;  2BY3 A;  3IUV A;  5TIS C;  2Y75 A;  4QPQ A;  3S3M A;  5E18 F;  2XDV A;  1WVR A;  3Q9V A;  2JA5 J;  5AQC A;  2JK3 A;  1MJB A;  4ANJ A;  1U8B A;  1K83 J;  3FXR A;  1ON2 A;  2LOO A;  2QEN A;  2VPR A;  2V6E A;  1J5Y A;  2L7K A;  4XBF A;  3KZ9 A;  2VQG A;  3LWF A;  3CC4 I;  2A2F X;  3FZV A;  2YVX A;  1AKH B;  2VN2 A;  2HOA A;  1IRZ A;  2Y48 A;  4KMU X;  4N0B A;  1D1B A;  3E6C C;  4BH9 A;  2XUB A;  3R0J A;  3WTZ A;  3CJT B;  4BY7 J;  1K61 A;  1HKQ A;  2QKM B;  2HFH A;  1PP7 U;  1VQL I;  5F0H A;  3J7A O;  1EF4 A;  4A3E J;  4YFK F;  3CWR A;  4X6A J;  1WZ2 A;  4I0A A;  3NXC A;  3L2Q A;  3K70 D;  1GXQ A;  2QYO A;  4ABZ A;  3ELK A;  2YR2 A;  5CQE A;  4HF2 A;  2HOE A;  4M74 A;  5IP9 J;  5ED4 A;  2RGV A;  2A07 F;  2B63 J;  4MFE A;  2P7C B;  2HPI A;  3LSM A;  3MWM A;  1ETY A;  2EK5 A;  1PP8 F;  1RZ4 A;  5KAF C;  2OTL I;  5F04 A;  2R92 J;  4RB1 A;  3CUO A;  4EM1 A;  1XGM A;  4M3D A;  5EGO A;  2HDW A;  4LK1 F;  3WU1 B;  3ZQ7 A;  2FEZ A;  2KDZ A;  2HYG D;  1O57 A;  1R71 A;  2EZK A;  2NS0 A;  3ZMZ A;  4DZJ A;  4DZP A;  4XSZ F;  3VVZ A;  1DUX C;  4DQ2 A;  2BOL A;  4N9I A;  1X1D A;  1UG2 A;  5DDG A;  3WTT C;  3QYB A;  4W1U A;  2F07 A;  3QOD A;  3GFJ A;  4Y13 A;  2DA4 A;  2DJI A;  3RI4 A;  1TP4 A;  3U1K A;  3T6N A;  5HBU A;  2ZNY A;  4FX0 A;  5C4J J;  2F6C A;  4U7B A;  3F8C A;  4E4H A;  2CG4 A;  3KLO A;  1O3R A;  5KNL A;  3K7A J;  3K4M A;  3TQN A;  4CCK A;  5B3S H;  4JOM A;  3KE2 A;  5IYD J;  3IH3 A;  2LNB A;  2R7O A;  2EFN A;  4U0V A;  3DU5 A;  1IN8 A;  1U5T C;  2UXN A;  4DBR A;  1KQ9 A;  4YFX F;  5M3F J;  2JJ7 A;  4B44 A;  1BOB A;  4HNT A;  1EV7 A;  4UY8 I;  4NC7 A;  4IRI A;  5B1A H;  3AG1 H;  5FLX K;  1SMT A;  2VKE A;  1JUM A;  2V1X A;  1S6L A;  2E36 A;  1SVL A;  2M30 A;  1FSE A;  4EJV A;  3ZXS A;  1Z1D A;  1Z7U A;  2XRN A;  4UUT A;  3U21 A;  2VOO A;  3RTR A;  3L2U A;  1BW6 A;  2F4M B;  1D8K A;  3EUA A;  2QBY A;  1R9T J;  4IHY A;  1QHH D;  4PK4 A;  3LMM A;  5DM7 F;  2JT1 A;  2OZ6 A;  2FMY A;  2KIS A;  2Z99 A;  1XSV A;  2HQ5 A;  2QGU A;  1W0U A;  3G1L A;  1YIJ I;  2REK A;  1K79 A;  2WB1 N;  2L9S A;  2K27 A;  2ZXI A;  1Z0X A;  5FJ8 J;  5EFY A;  4JX4 A;  3KYC B;  3AKZ A;  2BVM A;  3VTI A;  1TNT A;  4G7O F;  4ZH4 F;  2WV0 A;  4IXA A;  2BW3 A;  2Q8K A;  5FRN A;  3SZT A;  2HWV A;  2C6Y A;  2M7B A;  5IYC J;  5EGO B;  1ZEL A;  1HF0 A;  1K6O A;  2HVS A;  2B0L A;  4P1W A;  3QPS A;  1PDN C;  2F4I A;  2XAF A;  5F27 A;  4E7I A;  3RCO A;  1YI2 I;  2IGK A;  4WX9 A;  1WFX A;  2P5V A;  1ZR4 A;  3EET A;  5F0C A;  2LLK A;  2LRE A;  2KIU A;  1VND A;  3HBL A;  3OYA A;  4OIO F;  2OTJ I;  1QVU A;  2JA2 A;  4G6Q A;  4EM2 A;  3BG3 A;  1GDT A;  4M73 A;  3WTW C;  4GFL A;  1VF9 A;  1WI3 A;  2R5Y A;  5EJC A;  3WG9 A;  2OAZ A;  3PAS A;  2HKU A;  1BOA A;  2CMP A;  1R36 A;  5EYR A;  1OYW A;  4OU0 A;  2XF6 A;  5HNF A;  3RYP A;  2G0E A;  3DBR B;  3PIO F;  4Z2Y A;  2GXG A;  3KEO A;  2UXO A;  1VQ8 I;  5E79 C;  1MMN A;  1BBY A;  2VXZ A;  1W4M A;  5HLG A;  1WCM J;  1Y8Q B;  1AOY A;  4A93 J;  3V6G A;  1WH7 A;  1S29 A;  2VAS A;  3R61 A;  3DKY A;  3LA3 A;  4YII A;  2NVT J;  3PO3 J;  2M4K A;  1GT0 C;  1ZTR A;  4I6Z A;  5FKN A;  4XQF A;  1O3T A;  5FKO A;  3S17 J;  3TW6 A;  1MBH A;  2BY1 A;  2QBY B;  2XKO A;  4AYB N;  2WAF A;  1XMX A;  2FA5 A;  3P9I A;  4F91 B;  2WAD A;  4QSH A;  5CVU A;  2H8W A;  4XLN F;  1VFC A;  4XIC A;  2K9M A;  4DVY P;  1UI5 A;  2VQL A;  1XGS A;  3BRO A;  4F55 A;  2MD5 A;  3ZRG A;  5JFR A;  2L2O A;  2QQ8 A;  4E7Z A;  3FK7 A;  5IP7 J;  1GXP A;  1SD5 A;  2K02 A;  3DWL E;  2R0Q C;  2VQH A;  4BQQ A;  1IF1 A;  2W84 A;  1SFK A;  2BW3 B;  3D5R C;  2ESN A;  4ZC3 A;  2JMW A;  3QPT A;  4RB2 C;  3HRT A;  3I58 A;  2JA7 J;  3OR2 C;  5KHD A;  4E7S A;  4EGZ A;  1YYV A;  1U2W A;  1TC3 C;  5FKM A;  3V8K A;  1X4O A;  4HG2 A;  1DU6 A;  4GCL A;  3FXO A;  2QIB A;  1FOX A;  2G7H A;  5FHP A;  4XSX F;  3KEQ A;  1T33 A;  5ILS A;  2K9L A;  2ZC2 A;  3OYJ A;  1HQC A;  3TED A;  5TGT A;  3HOW J;  3FXM A;  2CRG A;  4RB0 A;  2PJR B;  2IXS A;  2PMZ A;  3DXJ F;  4U88 A;  4GCT A;  2XAG A;  4IPA A;  3C2G A;  1NG7 A;  4MQV A;  2STT A;  4BBR J;  1P4X A;  1FJL A;  3GTM J;  2CH0 A;  5ICG A;  1FX7 A;  2RQQ A;  2XB5 A;  5GP9 A;  3RIR A;  1D0Y A;  4TV7 A;  2R5Y B;  2JN6 A;  1U78 A;  2OZU A;  4L5J A;  4RAZ A;  5FFX A;  3RKQ A;  4D0P A;  2DBB A;  2WGB A;  2FBQ A;  4KWA A;  1ONV A;  1IUF A;  4XK4 A;  3N97 A;  3SWH A;  4C3J J;  1MSE C;  1OYI A;  1W36 D;  2JPC A;  3K4J A;  3SQN A;  1MSF C;  1Z6R A;  3JRA A;  2BXZ A;  2KRH A;  4BNC A;  3VW2 A;  2EJR A;  2L7F P;  1DQU A;  2P7V B;  4UB6 C;  1F5T A;  1J9I A;  4IX7 A;  1TBX A;  3WTV C;  4F92 B;  2KMU A;  5AIP A;  3NNR A;  1W7P D;  4PFP A;  1WI9 A;  2DFE A;  2EA4 A;  5E3M A;  3I71 A;  1W7P A;  2IT0 A;  5KK1 A;  1FBU A;  3E6B A;  3K69 A;  2N8G A;  1P4W A;  2BGC A;  1MGT A;  4WWC A;  2R7Q A;  2QWT A;  4M3G A;  1R22 A;  5IOY A;  5LHI A;  1FBQ A;  4BL0 B;  3RKX A;  1T2K A;  2FBK A;  4IO9 F;  2GZW A;  4Y3O A;  3FXU A;  3VB2 A;  4CGR A;  1J59 A;  2WY7 Q;  2WTE A;  4ME9 A;  1OCZ H;  4NC6 A;  2NS7 A;  2HXO A;  4B3A A;  2HR3 A;  2IA1 A;  3ZN1 A;  1EH8 A;  2BY2 A;  2Z16 A;  1T95 A;  4I2O A;  4B3X A;  3KPH A;  2E5N A;  1FZP B;  1VQN I;  5E8I A;  2KRF A;  1ZAO A;  5K7Z A;  5LEJ A;  1G3T A;  3FM5 A;  3GLX A;  2BEO A;  1TQI A;  3D1N I;  1TLH B;  2Z33 A;  4NHJ A;  1M1E B;  2YU9 J;  1MH4 A;  3LAJ A;  1YJ9 I;  1IDY A;  2E1C A;  5D18 A;  1OCR H;  2UXX A;  1QGP A;  2NXN B;  1MMG A;  2D6Y A;  2GFN A;  2I10 A;  2G7G A;  5C3E J;  1J09 A;  1CGP A;  3GTL J;  4MXM A;  3ESW B;  3CJQ B;  2YSR A;  1AWC A;  4PSX A;  4C2M A;  2Z3Y A;  2DA3 A;  3MN2 A;  3VOE A;  4E7J A;  1O3Q A;  3TP3 A;  3OV8 A;  4RMN A;  2RRE A;  1S7A A;  3NEU A;  4G9Y A;  3F8M A;  4DYC A;  4XLP F;  1BIA A;  3FMR A;  1BR4 A;  3G56 A;  2RVC A;  4XOP A;  3R60 A;  2CS3 A;  1KA8 A;  4XOR A;  2E1O A;  3HHH A;  3VEP A;  2VBW A;  5DS9 A;  3X2Q H;  1W7P B;  3BPX A;  3REO A;  1WHU A;  4JQF A;  4HX4 A;  2A5W A;  2VKH A;  1D1C A;  3E5U A;  2O5R A;  3FXL A;  4ESJ A;  2VJ4 A;  4HW0 A;  2E2I J;  3K10 A;  2W53 A;  1L3L A;  3H3V K;  5A2Q K;  3H0G J;  2DT5 A;  2ZJP F;  2RC4 A;  3CLO A;  2DMP A;  5F08 A;  3V4G A;  2HI3 A;  4M9X A;  2GEN A;  5AON A;  3C3W A;  1KQ0 A;  5CW8 A;  4XRS G;  3L1P A;  2L02 A;  2JZY A;  3RQ4 A;  2R7U A;  2M0C A;  3B6C A;  5F6F A;  4HLX A;  3KZY A;  5M5W J;  4U9L A;  3A03 A;  3EDP A;  1GLN A;  2LSO A;  2RAS A;  4DGW B;  1WJB A;  3HTA A;  1XPX A;  3CUQ C;  2X4H A;  4M71 A;  5FO5 A;  5D8K B;  2LC2 A;  3BJO A;  3OYL A;  2OER A;  3QU6 A;  5E20 A;  3RZD J;  1IN5 A;  1BI2 A;  2QZ8 A;  1YW8 A;  1LUJ B;  3C1D A;  3CMM A;  1JXS A;  1GUU A;  1MJA A;  4YEJ A;  2P5K A;  2F2E A;  1YW9 A;  3U2R A;  4PJM A;  5LGT A;  1I3Q J;  2GXB A;  2O9L A;  5LHH A;  4MNU A;  2ZBK A;  1ERD A;  3ON2 A;  5JLW A;  1OJL A;  4P55 A;  4Y52 J;  4KIS A;  3IV5 A;  2CQQ A;  1V4R A;  3HUG B;  3C07 A;  2IBD A;  4ZZD A;  4O3M A;  3MCZ A;  3OWT A;  4G7H F;  3H0D A;  3GTK J;  3S2W A;  3PNT A;  1EA3 A;  3OMY A;  2W00 A;  4EEF G;  2GAU A;  3I9V 2;  3ZQF A;  3M7G A;  4IHX A;  3NWT A;  3NAR A;  3TO9 A;  2NAZ A;  1IRX A;  1VTN C;  2RDP A;  3BG7 A;  1I3A A;  1I6H J;  2LR8 A;  3BR1 A;  2FOW A;  4ITV A;  1LDJ A;  3F8N A;  2ZFU A;  3ML6 A;  1ZGA A;  3WTY C;  3QBM A;  1YQA A;  3ECO A;  4RLQ A;  4GYG A;  4LB5 A;  3OY9 A;  4IOC F;  5JI6 A;  3AG2 H;  2GIZ A;  2TDX A;  2OA4 A;  1FP2 A;  4F93 B;  2UUZ A;  4D7M A;  1PYV A;  4Q48 A;  1FBS A;  3F6O A;  3ZMU A;  2HYJ A;  5CLS A;  5HDG A;  1SMY F;  3GZN B;  1VQ9 I;  1I6X A;  4Y33 A;  1TWF J;  3BLY A;  1BN5 A;  2X6X A;  5IP6 A;  3CCU I;  3UKG A;  3HRS A;  3CZ6 A;  3CJR B;  1G59 A;  2ZME C;  2VIX A;  1W5C C;  2BXY A;  3LAP A;  3GVA A;  2BY0 A;  3LSG A;  5LD2 C;  4LLN A;  1WJF A;  3D5L A;  2ZO4 A;  1LQ1 A;  2LY1 A;  2NRA C;  4DYR A;  3RQI A;  1G6N A;  3M8E A;  3LSR A;  2IU5 A;  1HDD C;  3GBG A;  2QTQ A;  2MAB A;  4N4N B;  1ACI A;  3RPU D;  5FD5 A;  3WGG A;  2M45 A;  3U1D A;  3RPU A;  4KFC A;  3IL2 A;  3CRJ A;  4PUS A;  1H88 C;  2W24 A;  2EV6 A;  3ERM A;  1H9T A;  1LE8 A;  3HDD A;  2R7Z J;  4ZYH A;  2EIM H;  4E6K G;  3SJM A;  3K6G A;  1A5J A;  3HRM A;  4IOA F;  3AAF A;  1ZYR F;  2DOF A;  3HRU A;  1G3W A;  3LSI A;  2ZSI B;  1MBK A;  2HPM A;  2DW4 A;  2G3B A;  4GCV A;  3J81 K;  1Z7L A;  2BVL A;  2G7U A;  5DCF A;  2W57 A;  5FRM A;  1IN7 A;  3J7Y J;  2O7T A;  1QPI A;  1X4P A;  4HZF A;  1ZRD A;  2M4G A;  1IRF A;  1ZLJ A;  1HC8 A;  5FGL A;  1Y6I A;  4BHC A;  3Q0W A;  2KIM A;  4HDU A;  3ZP5 A;  5FD6 A;  4LGW A;  3VSL A;  1YIO A;  3CCE I;  4A3I J;  4OD5 A;  4XLC A;  4X1E A;  4P9U A;  3GEZ A;  4PJJ A;  2H6C A;  2P6T A;  3U9G A;  2XV4 S;  1HKT A;  2PBI A;  3WU2 C;  2XRL A;  4MIM A;  1RKW A;  2VBZ A;  3N4M A;  4RB3 C;  3LWJ A;  2PEX A;  3BCA A;  5J1U A;  3LSK A;  3W2W A;  3MNL A;  2NVX J;  5CXI A;  3I59 A;  3KP4 A;  3O60 A;  5IYB J;  1V55 H;  3GFL A;  2NP3 A;  5HS8 A;  3G3Z A;  2IS1 A;  4BYY A;  3G4S I;  3RKY A;  3RKW A;  1DDN A;  4PXI A;  1T0F A;  1DPR A;  1STZ A;  2OD5 A;  5F1R A;  3MZY A;  2R7X A;  1ZRC A;  3S93 A;  1HST A;  1F9N A;  3LQR A;  2VJJ A;  3PUB A;  1MNM C;  3AL0 B;  3OSF A;  4AM3 A;  1KYW A;  4XM3 A;  5JR3 A;  3FHN A;  5HLH A;  1EKE A;  2JPB A;  5HS7 A;  1BC8 C;  2JTV A;  4I7H A;  3Q0U A;  2GXA A;  4DNC A;  2ZCW A;  3L2V A;  2O8X A;  4UNO A;  4BS9 A;  4RAG A;  1T98 A;  3B02 A;  3H35 A;  3OYG A;  2E1M B;  4RBO A;  1XSD A;  5LGN A;  3CJD A;  4RA2 A;  3WU0 A;  3EUH C;  1E3H A;  2EIK H;  4NB5 A;  4C3H J;  2A61 A;  2ISZ A;  4MQ9 F;  1LE8 B;  3H5R A;  1VZ0 A;  4FTH A;  2H6B A;  5BQT A;  1O3S A;  1PVE A;  4XRF A;  2ZXH A;  3H5A A;  4B8X A;  2Y30 A;  3OIO A;  2VKD A;  3I53 A;  3CDH A;  4IJA A;  2WAE A;  2EV5 A;  3HG9 A;  5E1Z B;  3RSN A;  1LFP A;  1UAA A;  3VOK A;  5KAI C;  2VUM J;  2M8E A;  4G7Z F;  1G2H A;  3FXJ A;  1QZE A;  1U6G A;  1MH3 A;  2F5E A;  4RAF A;  5E3N A;  2H1K A;  1MBE A;  2K4B A;  4EV0 A;  1ZRF A;  2KJB A;  4GFK A;  3HOY J;  4KNY A;  2HS5 A;  3BPV A;  4F52 A;  2OQG A;  3ONQ A;  2G9W A;  2P4W A;  2VBY A;  4LK0 F;  3F23 A;  3A0B C;  1JTX A;  3BCB A;  1SAN A;  3MKL A;  3W6J B;  1FLI A;  2L9N A;  4OIR F;  5DV5 A;  3HPG A;  1DGR M;  4OIN F;  3M1E A;  1LPQ A;  1R58 A;  1H8A C;  3MD2 A;  2RV8 A;  4ICH A;  3HTJ A;  1ZGJ A;  1X1A A;  3G1M A;  3MKZ A;  3DLA A;  3E0J B;  2NVQ J;  1QO0 D;  3I59 B;  3ZMT A;  1GHC A;  1L0O C;  2Z9O A;  2QQA A;  2HQA A;  1YO5 C;  4RLF A;  1F36 A;  4XOT A;  2M34 A;  1QHG A;  5IOZ A;  3CP2 A;  1B8I A;  2Z1D A;  2A5Y B;  1IGN A;  4BE1 A;  2UXP A;  3NAU A;  4HST A;  2MLK A;  4CHU A;  5F0F A;  4PJL A;  5J40 A;  3HOS A;  3VPR A;  2PJP A;  3L00 A;  3JRD A;  3PO2 J;  2B3W A;  1ENH A;  2EPF A;  5FKK A;  1LB2 A;  4BGD A;  4A3G J;  5ILU A;  3T5X A;  1YW7 A;  1VQ6 I;  4G6T B;  3SZG A;  5H6R A;  2FU4 A;  1ZH5 A;  1H0M A;  1REP C;  2FNA A;  2R7W A;  2X51 A;  5EDN A;  3A0H C;  3ABK H;  5D4R A;  1XMK A;  4S04 A;  5IT9 K;  2O61 A;  2YS9 A;  5DYM A;  5C44 J;  2ZCX A;  2NYX A;  2X6O A;  1J7K A;  1Z3X A;  3J80 Z;  1TQP A;  2E7X A;  4F3Q A;  2R7D A;  3F22 A;  1Z21 A;  1QPM A;  2DA5 A;  2WUI A;  3HOX J;  4W97 A;  2K3F A;  2DPU A;  3HOT A;  2PG4 A;  4GFB A;  4ZDP A;  1KU7 A;  5J4Y A;  3K4L A;  2QOP A;  1XMA A;  4Y17 A;  1OFC X;  5ILV A;  3PIP F;  3JRE A;  2KPM A;  2DYS H;  3OS2 A;  3A1Y A;  4ASN A;  3PQJ A;  2QKO A;  4AID A;  2WV1 A;  2KFD A;  3IP4 B;  1Z91 A;  3KIO A;  3GLL A;  5D5X B;  3COA C;  5BPI A;  2CQN A;  2OV7 A;  1IXC A;  1FT9 A;  2RN7 A;  2LH9 A;  4LLL A;  3AQS A;  4MK6 A;  3OIQ A;  1WPK A;  2P0W A;  4WCG A;  4FET A;  3ABT A;  5LEK A;  4CIC A;  4GYI A;  1D8J A;  3OOU A;  2KIF A;  1MIJ A;  1OR7 A;  4C3I J;  5ICC A;  2ZKZ A;  3BHQ A;  2AQE A;  4AU7 A;  2HVR A;  1I5Z A;  4C2M J;  3NI7 A;  1FIA A;  3P9K A;  4M3E A;  1VQK I;  1S72 I;  4OIP F;  2WAQ N;  3HJE A;  1F1Z A;  3BY6 A;  4AVP A;  2QF7 A;  1X1C A;  2FJ1 A;  3H5N A;  4HSR A;  4RGS A;  3PJR A;  1S3J A;  1B8I B;  1USS A;  2RAE A;  1EH6 A;  3ZCO A;  2F5D A;  2UWM A;  4CA0 A;  1P6R A;  2ADU A;  2VE8 A;  2W1O A;  2DJN A;  2KZV A;  1HOM A;  4UV8 A;  1IAW A;  3CD6 I;  2PFB A;  2R7T A;  3K1P A;  3LOC A;  3WGI A;  4L9N A;  2WC2 A;  2UXI A;  1WJ5 A;  1Y39 A;  1SFO J;  2A3S A;  5CJ9 A;  3SDG A;  3ZQH A;  5EEH A;  2Q24 A;  2ZFW A;  2K7L A;  1YIT I;  3KLN A;  4NN1 A;  4CZC A;  2DPD A;  4ENM A;  2NOJ B;  3KET A;  2L01 A;  2GOM A;  5IT3 A;  1TT5 B;  1DU0 A;  3KP3 A;  4LLG F;  4IQJ A;  3A2K A;  5HLT A;  4XN0 A;  3VFZ A;  2ZY9 A;  2RHA A;  3K4C A;  2O3F A;  3A01 A;  5HSZ A;  4L9T A;  3LHQ A;  1NG6 A;  4IHW A;  2CJJ A;  4ESB A;  2O03 A;  3SFI A;  4R1H A;  5CVR A;  4B47 A;  5B5E C;  4ZDO A;  4BAY A;  1G3Y A;  1HBX G;  5DAJ A;  3FK6 A;  1IZ1 A;  2W7N A;  1BJZ A;  3KYD B;  3FBN B;  4ZJZ A;  2PJR A;  5FRO A;  4UV9 A;  5DD8 A;  2QSH X;  2UZK A;  1D1A A;  1G3S A;  3JTH A;  1LVK A;  1MND A;  3HL2 A;  1WSU A;  3BOQ A;  2BV6 A;  1ORK A;  1FMV A;  2XGC A;  5FKL A;  1XCV A;  2O0Y A;  3BC8 A;  4P96 A;  1RUN A;  1RKT A;  3RH2 A;  4ZZL A;  2M7A A;  4YIR X;  2DK5 A;  1AA7 A;  1ZRE A;  1GV2 A;  5E3L A;  4A3L J;  3CQZ J;  4BAC A;  2Y31 A;  3GO5 A;  3HSF A;  5FFZ A;  1JT6 A;  3T0Y A;  4IL6 C;  1QA6 A;  2FXA A;  1E3P A;  2H09 A;  1T8I A;  4BQN A;  1A6I A;  2CQ7 A;  4KIT B;  4QLC U;  5FLX Z;  1X2M A;  2ELK A;  5BNG A;  2X1D A;  3CMY A;  3OYD A;  3Q5F A;  3JRF A;  4BEH A;  1FOK A;  2LF8 A;  2VPL A;  1YHQ I;  3D5S C;  5HDN A;  1FYM A;  3I54 A;  1BW5 A;  3E7Q A;  4G8X A;  2IRF G;  4ACI A;  1TW2 A;  2QWW A;  2IGM A;  4BJ5 C;  3S14 J;  3KX2 A;  2M8G X;  2P5L C;  1JKQ C;  3ASO H;  3I4N J;  5D6E A;  4MFD A;  1Y8R B;  3VYR B;  5FLM J;  2OJE D;  1S7O A;  3S15 J;  1YE9 A;  3GWZ A;  4XKB A;  3GYH X;  5LRR A;  2EA2 A;  3OYE A;  1MMA A;  1ULY A;  3R6S A;  5HOO A;  3LL7 A;  2BHZ A;  5K5R A;  3MFK A;  1JJ8 C;  5EG0 A;  4IHT A;  2MLG A;  3A01 B;  5JHU A;  3CC7 I;  1HSJ A;  1W1W E;  4I99 C;  2J5P A;  2FF4 A;  1FWZ A;  2HTS A;  3HZJ A;  3T8T A;  2CV1 A;  2QUF A;  1WJE A;  1XDU A;  3CMA I;  1U3E M;  1GV5 A;  5HNH A;  2DOA A;  1KQ8 A;  4GGG A;  2CYY A;  5CVI A;  1IV8 A;  2DXI A;  1B6A A;  2AXL A;  2DK8 A;  3Q0V A;  3JSO A;  2MH9 A;  1UB9 A;  2XRO A;  1WH5 A;  4U9N A;  1MW7 A;  1S8N A;  1V5F A;  5K5Q A;  5K7H A;  2Y0S N;  1MBJ A;  3F8B A;  5E1X A;  5B1B H;  4J19 A;  3S3O A;  2IW5 A;  3VYT B;  4O6J A;  1X1B A;  2WA0 A;  3VP5 A;  3BTL A;  4FE7 A;  2DDA A;  4YIF A;  3HTU A;  2YVE A;  1JUP A;  2PZ9 A;  3MVP A;  1HDP A;  5DUI A;  2XAU A;  1K7A A;  2FQ4 A;  2IA0 A;  3BZK A;  2CQK A;  1S7E A;  3WTX C;  1Z05 A;  1W5T A;  3F21 A;  4Q4Z F;  4RM3 A;  5DM6 F;  3HGG A;  2HOS A;  4XID A;  3BR6 A;  4BY1 J;  1XD7 A;  4A3D J;  3IWF A;  3IH4 A;  2V1N A;  3QPH A;  5M5X J;  1BI0 A;  4KT6 A;  4IZZ A;  1ZQ3 P;  3S1R J;  4QIW N;  1OPC A;  3IWZ A;  4I02 A;  2HDD A;  3CES A;  4BEH B;  5IY5 H;  4MLO A;  1KYZ A;  2CU7 A;  3JTG A;  2LF7 A;  2VI6 A;  3LFU A;  4E7K A;  3GTO J;  1VQO I;  3VYS B;  3I5U A;  3SZP A;  2ZJQ F;  4WK8 F;  1JTY A;  1YJW I;  2PI0 A;  3Q3S A;  3P5J A;  3CCY A;  2L7Z A;  4R79 A;  1S5L C;  4ZDL A;  3JAM K;  2LKX A;  2EQR A;  3BNI A;  2AQF A;  2WAQ A;  3CCR I;  3K4N A;  4Y7N J;  3DPJ A;  4JL3 A;  2CO5 A;  3C7J A;  4LB6 B;  5EG0 B;  2R7R A;  4A3K J;  5E8G A;  1SD7 A;  3GFI A;  5K1Y A;  1F43 A;  2V1D A;  2L5Q A;  3IAS 2;  4GCK A;  4OD4 A;  1IC8 A;  1Z6T A;  4XRS A;  2HQN A;  3ABU A;  2D2W A;  1IN4 A;  3I56 I;  3A4C A;  4WXC A;  3I4M J;  2K85 A;  2K9Q A;  3BDD A;  4AIK A;  4HQE A;  2DA6 A;  3FF5 A;  4FAS D;  4CSW A;  2QQ9 A;  3MQ0 A;  4WXD A;  2DAO A;  2COB A;  3ASN H;  3FM3 A;  3J7Z I;  3TP0 A;  3GTJ J;  2WB1 A;  2R7S A;  1QZY A;  2LY2 A;  3HUG A;  1SVM A;  4II2 A;  3CCM I;  1B72 A;  3R0A A;  2V79 A;  3CCL I;  2R7F A;  2IP2 A;  3ISP A;  4D5F A;  3FXQ A;  4EM0 B;  2W25 A;  2XC7 A;  4A0Z A;  3G71 I;  3K1N A;  1T6S A;  5J1R A;  3ABM H;  2HZD A;  3W6K B;  3KCC A;  4B48 A;  2ZOY A;  5L3C A;  4YZE A;  3EPZ A;  1OCP A;  3VDX A;  4BUP A;  3H9J A;  1POG A;  2VQC A;  1XTA A;  1FEX A;  3E7L A;  3TDU C;  5BMZ A;  1NHA A;  3B73 A;  1Q1H A;  3CCS I;  3F1B A;  2Q1Z B;  3S2H J;  2XDN A;  2IGO A;  3E5X A;  2ZCN A;  4XON A;  1XSX A;  4M6V A;  3D0S A;  2F48 A;  4A3J J;  5D5V B;  1XGO A;  4CGZ A;  4BQA A;  3KEY A;  2A6H F;  2K9N A;  2OUM A;  4A3M J;  1GVJ A;  1R5G A;  1B59 A;  2CW7 A;  3KZI C;  5KCM A;  1T56 A;  2W82 A;  3TBI A;  2E7W A;  5L3F A;  2L4A A;  2FBI A;  3JR9 A;  2GA2 A;  1F4K A;  4EJW A;  4IF4 A;  3JRH A;  2EFO A;  2HTJ A;  3LFK A;  1JKO C;  2KHM A;  2XPU A;  2F5F A;  3J7A Y;  4N4O B;  1ZGW A;  2IJL A;  3BJ6 A;  1MBG A;  1BIB A;  3ZMD A;  3JRG A;  2HDC A;  4EQQ A;  2PBX A;  3BR0 A;  3HTS B;  4KJZ A;  4M6Y A;  4NEL A;  4IQ4 A;  1OQY A;  2QCO A;  2PMU A;  3S1Q J;  5E17 F;  4KDP A;  2COM A;  1I1G A;  1MJ9 A;  4NC8 A;  3T1B A;  5KVR A;  1P92 A;  4L62 A;  4G94 A;  1KU9 A;  3OYN A;  1R4M B;  4QWQ A;  2XHK A;  4MTD A;  3H92 A;  4AYB A;  4UVC A;  2E5Z A;  3MZH A;  3SEZ A;  1T39 A;  3VOX A;  2M87 A;  4N9H A;  4QTR A;  1HCR A;  2HGC A;  3HB9 A;  5LRS A;  4RDU A;  4I98 B;  1Y1W J;  4GXO A;  4YEL A;  4A6D A;  1A35 A;  2V4J C;  4WIB A;  2M0M A;  1B72 B;  3EYY A;  2XF5 A;  1X19 A;  2JUG A;  2R4G A;  3H9Q A;  3V8L A;  2ACJ A;  4ESF A;  3EUK L;  2IS4 A;  4HNV A;  4FCY A;  3SFZ A;  2A68 F;  4RM2 A;  3KKD A;  2NVY J;  3I4P A;  3FWE A;  4IVN A;  1LFU P;  3KP5 A;  1OYY A;  1WJA A;  2EV0 A;  2IAI A;  4WF2 A;  5F1J A;  1BR1 A;  5ERI A;  2ME0 A;  4KT5 C;  1BL0 A;  1VQ4 I;  2Y2Z A;  2R7V A;  3WTU C;  1NK2 P;  2CV0 A;  4OWR B;  3V7C A;  3CO6 C;  1UST A;  1NK3 P;  2X48 A;  4UHT A;  3NPI A;  1HA8 A;  2JRT A;  2EZI A;  3DPU A;  4A5M A;  2JWT A;  3G7R A;  4DBQ A;  4C30 A;  2XAQ A;  1FPQ A;  3F9K A;  1D5Y A;  3FMQ A;  5JLX A;  2CFO A;  2KKO A;  3BQZ A;  1XB4 A;  5J47 A;  2NVU B;  2PMH A;  4NBQ A;  2Y0S A;  2R3S A;  3DCF A;  3ANG A;  4PGH A;  4O5V A;  4BU2 A;  4OAY A;  3TOB A;  3MKY B;  3IHU A;  1AU7 A;  3TO7 A;  2R93 J;  5A2Q Z;  2L9R A;  3ZQI A;  3CME I;  1W36 C;  2BZT A;  1E2X A;  3TKY A;  2E71 A;  3MKW B;  3TW7 A;  1SVO A;  4FT8 A;  1C0W A;  3N05 A;  3UR3 C;  3L2W A;  3ZPL A;  1AHD P;  2V9V A;  2EZH A;  3O8G A;  1R7J A;  1Y0N A;  5GPC A;  5EZG A;  1IXR C;  3E97 A;  3KNW A;  3G1O A;  4A2U A;  1P7J A;  2DA1 A;  2MBF A;  3RJP A;  1MDM A;  3DEU A;  3AG3 H;  3V42 A;  4BHP A;  4AC0 A;  2OPT A;  3L7W A;  3BZ6 A;  2CV2 A;  1E3O C;  4QPO A;  3HSR A;  3ZGK A;  3ZQG A;  3G2B A;  1VQ7 I;  3ZQC A;  2V57 A;  3GEU A;  4XKW A;  2HYF A;  1LDK B;  3P7N A;  1RC9 A;  2MA3 A;  2XSJ C;  3LSH A;  4CCL A;  4LG0 A;  3QYE A;  3TO6 A;  4BJ6 C;  3BTI A;  4IHS A;  4EAT A;  3NRV A;  1ZG5 A;  2ZXJ A;  4A69 C;  2MC3 A;  3OYM A;  1U5T A;  2V26 A;  1UJ8 A;  4I01 A;  2LMD A;  2DYR H;  2JSC A;  3BJB A;  4B43 A;  4B09 A;  3WTS C;  3OS1 A;  4KN7 X;  1VI0 A;  1R1U A;  2DCE A;  2DTR A;  1O4X A;  1X3U A;  3C2B A;  4CH7 A;  1YX3 A;  2NNN A;  4HV5 A;  1WGX A;  3M07 A;  1UCR A;  2YX7 A;  2DDB A;  3I0T A;  1O7L A;  1H89 C;  3MEX A;  2LDU A;  2MYS A;  4JP0 A;  1QBJ A;  1R4N B;  4XLF A;  1I27 A;  1Z3Y A;  1HW2 A;  5GTH C;  3QPL A;  2HNH A;  5D4S A;  3DTI A;  3P9T A;  4CCM A;  4RGU A;  2LTP A;  4XKC A;  2E2H J;  1NTC A;  2QQB A;  5EEG A;  2Y69 H;  1BJA A;  1U8R A;  2K9S A;  1ZK8 A;  5D5U B;  2QEX I;  1VQP I;  3JRI A;  2LFB A;  4AIJ A;  3IKT A;  2F5C A;  2E19 A;  4HRI A;  2DMQ A;  4PGG A;  4BDZ A;  2W4S A;  2E35 A;  2ZB9 A;  1SGM A;  1I50 J;  4BHB A;  1MBF A;  6PAX A;  1KU2 A;  3HTH A;  5FLV A;  2VJI A;  3QWL A;  5GAH J;  1FYK A;  4UUS A;  2UV1 A;  5DD4 A;  3DPL C;  3CJN A;  4ZYE A;  3DP7 A;  5C4X J;  3F8F A;  4M72 A;  1Q1V A;  1J0R A;  2P6S A;  3HKZ N;  1MDM B;  1LKX A;  1ITY A;  3CP8 A;  2QKL B;  2MD0 A;  2EIL H;  4II3 A;  3OYK A;  3GZ5 A;  4HX7 A;  3BZC A;  4HV6 A;  1BM9 A;  5CVJ A;  3DBL B;  5J8C A;  2VC1 A;  2W85 A;  3LA7 A;  4UB8 C;  4CYC A;  3WE2 A;  3BR3 A;  3GFM A;  1ZG3 A;  3QU3 A;  4LG0 B;  4Y15 A;  4M3B A;  4L9V A;  3J81 Z;  1U5T B;  2V9K A;  3LA2 A;  4XRM A;  5ICF A;  2NS8 A;  2X85 A;  1QRY A;  1BC7 C;  5LBQ A;  2ZNZ A;  4CYD A;  3F0C A;  3BTC A;  3PL8 A;  3HOZ J;  2PQ8 A;  3S32 A;  3K9T A;  1Z77 A;  4JYK A;  2KP6 A;  2M5W A;  2XPV A;  1Y56 A;  4IKF A;  2CUE A;  2GOX B;  4Q5S F;  3L9F A;  5D19 A;  1TT0 A;  4BXX J;  1LEA A;  1RR8 C;  1VQM I;  3FBI B;  5BPD A;  2F4O B;  1R49 A;  2ICW G;  3F6V A;  2RNJ A;  3FKI J;  3H9G A;  4GO1 A;  4G12 A;  4B1R A;  1FNN A;  2GBY A;  3ZR8 X;  4A12 A;  3FXK A;  5HVQ C;  1B4A A;  3PQK A;  2EZL A;  4UXN A;  3ZN0 A;  2DFF A;  1I39 A;  2EBI A;  3ABL H;  5HDK A;  2MW8 A;  3BJA A;  1BI3 A;  2KL4 A;  1R00 A;  1OIS A;  3PUF A;  4XKV A;  1T38 A;  1HW1 A;  2UXH A;  1K6Y A;  3GXO A;  1RUO A;  3FRQ A;  3IAM 2;  2ECC A;  2VXD A;  3BG5 A;  4DYQ A;  1N77 A;  2K40 A;  2A6E F;  3O6B B;  4LOC A;  1JKR C;  1APL C;  3DKW A;  1R5H A;  3HC7 A;  3DF8 A;  2CUF A;  1TZL A;  2DOE A;  3O3K A;  3JCU C;  3S8P A;  4XR6 A;  5L3B A;  4YRV A;  3EUP A;  3SDB A;  2DOD A;  4EJT A;  1DGW Y;  4UUS B;  5FB2 A;  1FP1 D;  4HPQ A;  3TL4 X;  3ZMS A;  1SAX A;  4L0Z B;  3E6M A;  2PFV A;  1UHM A;  1MNE A;  4OIQ F;  3V7S A;  2VC0 A;  2GA1 A;  2PMZ N;  1N78 A;  3PM1 A;  4LJZ F;  1T08 B;  1SFE A;  3BG9 A;  2XSD C;  3HE0 A;  2FUG 2;  3V7R A;  4RAY A; 
#chains in the Genus database with same CATH homology
 4ACI A;  3HOU J;  4DYC A;  3HGY A;  4FIS A;  2Y9Y A;  3S14 J;  2M8G X;  3G56 A;  1JKQ C;  2NOG A;  4AC6 A;  3I4N J;  4MFD A;  3KKC A;  5FLM J;  2E1O A;  4CYC B;  1RET A;  5DS9 A;  1CQT A;  2XPW A;  2HOT A;  3S15 J;  5EEA A;  5C4Y A;  3HEF A;  1JJ8 C;  1ETX A;  5EG0 A;  2LY9 A;  1P7I A;  3A01 B;  2E2I J;  2AHQ A;  2DG8 A;  2W53 A;  3H3V K;  1YRN B;  3WHC A;  3VW1 A;  3H0G J;  3K2A A;  2DMP A;  5F08 A;  2D5V A;  2HI3 A;  3FIW A;  2DA7 A;  1GV5 A;  2GEN A;  4JKZ A;  5CW8 A;  2DG7 A;  4JX6 A;  4XRS G;  1JUS A;  3L1P A;  1AKH A;  1UHS A;  2M0C A;  3B6C A;  3M4O J;  1X58 A;  5E3O A;  3Q0V A;  5M5W J;  3A03 A;  1WH5 A;  1RPW A;  4IEJ A;  1U9O A;  5M5Y J;  1RES A;  1ZKG A;  2RAS A;  1TWC J;  1QVT A;  3ON4 A;  5K7H A;  2Y0S N;  1MBJ A;  3GTQ J;  4J19 A;  3HTA A;  3VP5 A;  3BTL A;  4FE7 A;  2OER A;  2YVE A;  2MGQ A;  1JUP A;  3RZD J;  3MVP A;  2PZ9 A;  1HDP A;  2NX4 A;  2FQ4 A;  4FE4 A;  1GUU A;  5K7F A;  3GTG J;  1S7E A;  5IPA A;  1IDZ A;  2OI8 A;  3BR5 A;  1I3Q J;  2O9L A;  5DTD A;  3CDL A;  3HGG A;  2HOS A;  2XB0 X;  2JA6 J;  4XID A;  3BR6 A;  4BY1 J;  2LP0 A;  3ON2 A;  5JLW A;  2IEK A;  1OJL A;  2XGD A;  4A3D J;  4Y52 J;  5EZH A;  2CQQ A;  3IV5 A;  2YVH A;  3C07 A;  2IBD A;  1HLV A;  3IH4 A;  2LVS A;  2L0K A;  3GTK J;  5M5X J;  1ZQ3 P;  1ETO A;  3S1R J;  2EH3 A;  4EEF G;  3ZQF A;  4QIW N;  4IHX A;  2DMN A;  3NAR A;  3HTI A;  2HDD A;  2DA2 A;  1I6H J;  4MLO A;  2CU7 A;  1TWH J;  2LR8 A;  2HXI A;  2VI6 A;  3BR1 A;  2M9H A;  3IH2 A;  1Y1V J;  3O8H A;  1FTT A;  2O7O A;  3GTO J;  3S16 J;  1TWG J;  3QBM A;  3S2D J;  3LSP A;  1JTY A;  3Q3S A;  5HAW A;  1FTZ A;  3CCY A;  2L7Z A;  3WHB A;  1BA5 A;  2P81 A;  2TRT A;  2FX0 A;  2ZOZ A;  3VW0 A;  2JA8 J;  4D7M A;  2EQR A;  3JRC A;  2LKX A;  3BNI A;  2HYJ A;  4JNN A;  4JL3 A;  4Y7N J;  3LNQ A;  3DPJ A;  3IUV A;  5EG0 B;  1TWF J;  3UKG A;  4A3K J;  5IP6 A;  3HE0 A;  1F43 A;  3LSG A;  2JA5 J;  5AQC A;  2JK3 A;  1OCT C;  1U8B A;  4GCK A;  1K83 J;  1IC8 A;  5H9T A;  4XRS A;  4DYR A;  3RQI A;  2VPR A;  3LSR A;  2IU5 A;  3KZ9 A;  1HDD C;  3GBG A;  2QTQ A;  3I4M J;  1ETK A;  2K9Q A;  1AKH B;  2HOA A;  1IRZ A;  2DA6 A;  1JJ6 C;  2COB A;  3CRJ A;  3S5R A;  1H88 C;  3TP0 A;  4BY7 J;  3GTJ J;  1K61 A;  4AUX A;  2ME6 A;  5F0H A;  3ANP A;  1LE8 A;  3HDD A;  2R7Z J;  1B72 A;  1EF4 A;  4A3E J;  3VUQ A;  3SJM A;  3CWR A;  4X6A J;  3HOV J;  4D5F A;  1XG1 A;  1A5J A;  3NXC A;  4BKX A;  1IV6 A;  3EGQ A;  5J1R A;  3BR2 A;  4ABZ A;  1MBK A;  2ZOY A;  5IP9 J;  2B63 J;  4YZE A;  2G3B A;  4MFE A;  1UMQ A;  1OCP A;  1POG A;  1ETY A;  1JKP C;  5GPA A;  1JGG A;  2KT0 A;  1FEX A;  5F04 A;  1LFB A;  3E7L A;  2G7S A;  1QPI A;  2O7T A;  3F1B A;  2R92 J;  3S2H J;  3OSG A;  2OF7 A;  2XDN A;  5FGL A;  3Q0W A;  4M3D A;  5EGO A;  2KDZ A;  2ZCN A;  5J1Y A;  4M6V A;  2EZK A;  2TCT A;  3VVX A;  4DZJ A;  4DZP A;  4A3I J;  4X1E A;  3VVZ A;  1X2N A;  3BQY A;  4JX5 A;  2DTZ A;  2K9N A;  5J3L A;  1UG2 A;  2R5Z A;  2GUH A;  2FD5 A;  4W1U A;  2XRL A;  4A3M J;  3PPB A;  4MIM A;  1RKW A;  3BT9 A;  2F07 A;  3LWJ A;  3LJL A;  2DA4 A;  5J1U A;  3MNL A;  2NVX J;  1T56 A;  5CXI A;  1JT0 A;  5HBU A;  3T6N A;  3O60 A;  1RR7 A;  3JR9 A;  5IYB J;  5C4J J;  4IHV A;  2DMT A;  3JRH A;  2NP3 A;  2DN0 A;  1JKO C;  2XPU A;  2HYT A;  1ZGW A;  4PXI A;  1MBG A;  1ETV A;  3K7A J;  3BRU A;  3JRG A;  2LD5 A;  2PBX A;  3BR0 A;  5IYD J;  3IH3 A;  3GZI A;  4NEL A;  2QCO A;  1MNM C;  3S1Q J;  3ZOB A;  5M3F J;  3OSF A;  2JJ7 A;  2H8R A;  4L62 A;  2O8K A;  3Q0U A;  3BTJ A;  3VIB A;  3FIS A;  2VKE A;  1JUM A;  4M3F A;  3VOX A;  4RBO A;  1BW5 A;  4QTR A;  1HCR A;  3CJD A;  3GTP J;  3HB9 A;  4RDU A;  4C3H J;  1Y1W J;  1LE8 B;  4UUT A;  1B72 B;  4FTH A;  3QKX A;  1BW6 A;  2L7M P;  2Y30 A;  4IHY A;  1R9T J;  1IG7 A;  5HOD A;  4A3F J;  4HNV A;  3VOK A;  1XC5 A;  2HQ5 A;  4FCY A;  1W0U A;  3G1L A;  2REK A;  2VUM J;  2WB1 N;  3KKD A;  2NVY J;  1XS9 A;  1G2H A;  1LFU P;  4UDS A;  5K58 A;  1Z0X A;  2IAI A;  5FJ8 J;  5F1J A;  5EFY A;  1MH3 A;  5E3N A;  2H1K A;  2ME0 A;  4JX4 A;  1MBE A;  1BL0 A;  2Y2Z A;  2YUS A;  3S1N J;  1NK2 P;  4GFK A;  3HOY J;  1NK3 P;  2X48 A;  3NPI A;  1ETW A;  2NP5 A;  2EZI A;  4V2G A;  2JWT A;  3JRB A;  5IYC J;  5EGO B;  3G7R A;  4A3C J;  1JTX A;  1SAN A;  3A02 A;  3MKL A;  1HF0 A;  3V78 A;  3QQA A;  1D5Y A;  4HKU A;  5JLX A;  3BQZ A;  3QPS A;  2R5Z B;  5F27 A;  1H8A C;  2MSY A;  3ANG A;  4ICH A;  3DCF A;  3HTJ A;  2UXU A;  3G1M A;  1ZR4 A;  5F0C A;  2NVQ J;  1AU7 A;  2LLK A;  1VND A;  2R93 J;  2L9R A;  3HBL A;  3ZQI A;  3JSJ A;  1QVU A;  1F36 A;  3BG3 A;  2M34 A;  1GDT A;  3TW7 A;  5IOZ A;  1PUF A;  3B6A A;  1B8I A;  1IGN A;  5FMP A;  4GFL A;  2UXP A;  1VF9 A;  3NAU A;  1WI3 A;  1AHD P;  2R5Y A;  2EZH A;  5F0F A;  3O8G A;  5GPC A;  5EZG A;  3VPR A;  3PO2 J;  3JRD A;  3PAS A;  2HKU A;  3KNW A;  3G1O A;  1ENH A;  1P7J A;  2LK2 A;  5EYR A;  2DA1 A;  5FKK A;  4A3G J;  2G0E A;  2XGE A;  4AC0 A;  2OPT A;  2UXO A;  1E3O C;  3ZQG A;  2V57 A;  3GEU A;  5EDN A;  3ZQC A;  1WCM J;  4A93 J;  3V6G A;  1WH7 A;  2YS9 A;  5C44 J;  2ZCX A;  2NVT J;  2X6O A;  3PO3 J;  3BCG A;  1GT0 C;  3BTI A;  1ZTR A;  4I6Z A;  5FKN A;  4A69 C;  5FKO A;  3S17 J;  2WUI A;  3TW6 A;  2DA5 A;  1MBH A;  3HOX J;  4W97 A;  9ANT A;  4AYB N;  3BJB A;  1IJW C;  4GFB A;  4QSH A;  1VI0 A;  1O4X A;  3C2B A;  2DMU A;  1VFC A;  4XIC A;  2ZCM A;  2QOP A;  1OFC X;  1UI5 A;  3JRE A;  1WGX A;  3AQT A;  1H89 C;  3FK7 A;  5IP7 J;  3HM5 A;  2QKO A;  4JP0 A;  2R0Q C;  2WV1 A;  2G7L A;  2JMW A;  3QPL A;  2JA7 J;  2MG4 A;  3AQS A;  4MK6 A;  4DW6 A;  3P9T A;  1WPK A;  2LTP A;  2E2H J;  1NTC A;  1TC3 C;  5FKM A;  3OOU A;  3HIM A;  4C3I J;  2K9S A;  1ZK8 A;  4D7N A;  1DU6 A;  3BHQ A;  3JRI A;  2LFB A;  4GCL A;  2QIB A;  2E19 A;  4B4C A;  4C2M J;  1FIA A;  4M3E A;  3NI7 A;  5FHP A;  2DMQ A;  2WAQ N;  1T33 A;  3HOW J;  2ZB9 A;  3TED A;  1SGM A;  1I50 J;  2X9D A;  4V2F A;  2CRG A;  1MBF A;  2M2E A;  4GCT A;  2QF7 A;  4NDL A;  2FJ1 A;  3HTH A;  5FLV A;  1PUF B;  1B8I B;  4BBR J;  2RAE A;  1FJL A;  4I76 A;  3GTM J;  5GP9 A;  2XB5 A;  2ECB A;  4UUS A;  3S1M J;  2R5Y B;  2JN6 A;  1U78 A;  2GM4 A;  2ID3 A;  3RKQ A;  2GLO A;  5C4X J;  1UI6 A;  2DJN A;  1HOM A;  2WGB A;  1W0T A;  1Q1V A;  2FBQ A;  3HKZ N;  3LSJ A;  1IUF A;  4A3B J;  4XK4 A;  3ZQL A;  1ITY A;  4KWA A;  1TWA J;  5D1R A;  3LOC A;  4C3J J;  1MSE C;  2UXI A;  1SFO J;  1MSF C;  3SDG A;  3ZQH A;  3JRA A;  3COL A;  3VW2 A;  2Q24 A;  2L7F P;  4CYC A;  2Y9Z A;  3NNR A;  4NN1 A;  3BR3 A;  4D5C A;  5E3M A;  4M3B A;  1DU0 A;  1ETQ A;  2N8G A;  4XRM A;  2NS8 A;  2RHA A;  3A01 A;  1QRY A;  2E2J J;  5HSZ A;  2QWT A;  4M3G A;  4S0H B;  3LHQ A;  3F0C A;  5IOY A;  3BTC A;  4IHW A;  2CJJ A;  1YRN A;  3HOZ J;  1Z77 A;  4JYK A;  3SFI A;  4AF5 A;  2XPV A;  3B81 A;  2CUE A;  5DAJ A;  5D19 A;  3FK6 A;  4BXX J;  3RD3 A;  1BJZ A;  3VVY A;  4CGR A;  1FIP A;  1ZR2 A;  2AO9 A;  3FKI J;  4ME9 A;  2NS7 A;  2HXO A;  4G12 A;  4B1R A;  4B3A A;  2GBY A;  2W48 A;  2EZL A;  3RZO J;  2EBI A;  5K7Z A;  2MW8 A;  3DEW A;  1ORK A;  5FKL A;  2XGC A;  1U9N A;  4BBS J;  2UXH A;  1RKT A;  3D1N I;  3FRQ A;  3RH2 A;  4DYQ A;  2ECC A;  3BG5 A;  2K40 A;  3W6V A;  4LOC A;  1JKR C;  1APL C;  2YU9 J;  5CXG A;  1GV2 A;  4MO7 A;  5E3L A;  1MH4 A;  4A3L J;  2CQX A;  3CQZ J;  1IDY A;  2ID6 A;  2Y31 A;  5D18 A;  2CUF A;  1JT6 A;  5M3M J;  3EUP A;  2D6Y A;  1A6I A;  4UUS B;  2GFN A;  2I10 A;  4L5E A;  2G7G A;  5C3E J;  3M3Y J;  3GTL J;  1GVD A;  1X2M A;  4MXM A;  2ELK A;  5BNG A;  2VKV A;  3CMY A;  2PMZ N;  2DA3 A;  3MN2 A;  3NRG A;  3PM1 A;  3JRF A;  3BG9 A;  2XSD C;  3TP3 A;  3OIO A;  4A3J J;  5EF6 A;  3E7Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...