2HYJA

The crystal structure of a tetr-family transcriptional regulator from streptomyces coelicolor
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
193
structure length
193
Chain Sequence
AEAQATRGRILGRAAEIASEEGLDGITIGRLAEELEMSKSGVHKHFGTKETLQISTLDKAFVDFWHRVVEPALAEPPGLRRLRAVCANSVGYLEEPLLPGGCLLTAALSEYDGRPGRVRDAVAEVWSRWREQLRADLTAAVDKGELPAGFDVEQALFEIVAAGLALNAAMQLQHDRTAADRARRAIERALAQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of a tetR-family transcriptional regulator from Streptomyces coelicolor
rcsb
source organism Streptomyces coelicolor
molecule tags Transcription
molecule keywords Putative tetR-family transcriptional regulator
total genus 81
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 2006-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2hyjA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2hyjA02
3ZQHA 1U8BA 2EZKA 3JRCA 3VIBA 5FHPA 1S7EA 4A3GJ 3DEWA 2AO9A 2XRLA 3HGYA 2OI8A 5M5WJ 2Y30A 3RH2A 1JTXA 1W0TA 2VUMJ 2K40A 3GTPJ 4C3JJ 1I3QJ 2DA2A 4W97A 5K58A 1WPKA 3BQYA 1FJLA 2NVYJ 4AYBN 1B8IB 1WH5A 2F07A 3HOWJ 1U9OA 1MSEC 9ANTA 2K9SA 4FISA 3JRGA 3A03A 1I50J 4IHWA 1WGXA 3S1QJ 1R9TJ 4XRSA 2M0CA 1JUMA 2CJJA 3HDDA 4DW6A 5E3OA 1JKOC 2E2IJ 1BW6A 1D5YA 1QVUA 3K2AA 3I4NJ 3TEDA 4JNNA 1AKHA 5E3LA 4M6VA 4RDUA 3NNRA 2UXIA 4A3FJ 2XSDC 4ACIA 5F0HA 3BNIA 2L7ZA 2O9LA 3VOXA 5M3MJ 4AUXA 5CXIA 4NDLA 5EGOA 2ZOZA 4B1RA 5EG0B 1JT0A 3S1NJ 1IDZA 2RHAA 3I4MJ 1IDYA 4JKZA 4A69C 2MW8A 1GV2A 5EGOB 1LFBA 3CCYA 3VVYA 3TP0A 5FLMJ 2L7FP 4DZPA 4PXIA 2G0EA 4GFBA 4MFEA 1FIAA 3HM5A 3OSGA 2V57A 3KKCA 4JL3A 4IHVA 2G3BA 1RKWA 4JP0A 2JA5J 3JRIA 5EEAA 4D5CA 3S15J 2HOTA 1UG2A 3BQZA 3AQSA 4EEFG 2UXUA 2GFNA 1UI6A 2LVSA 3NAUA 1HOMA 1RETA 3UKGA 2E19A 1XG1A 1VF9A 3BTCA 3EUPA 5AQCA 4A3EJ 3PO3J 1IRZA 2HOAA 1JTYA 1TWGJ 1OCPA 2K9NA 2Y9YA 4NN1A 3VOKA 1P7JA 4GCKA 5IPAA 2UXPA 2LR8A 2LY9A 3G7RA 3O60A 2EZHA 2YVEA 1MBJA 4XRMA 3DCFA 3LSJA 3BR6A 4MXMA 4GCTA 2P81A 4V2FA 1OCTC 3S14J 1T56A 2XB0X 3HOXJ 4FE7A 1K83J 4FCYA 3S2DJ 2UXOA 3SFIA 3ANPA 4I76A 1ZR4A 3L1PA 4M3DA 4D7NA 2XPWA 2QWTA 2VI6A 5FKNA 3HE0A 5IYCJ 5FKKA 4GCLA 1POGA 4NELA 2DTZA 2DA4A 2MSYA 2RAEA 1JT6A 1JKPC 1RPWA 3MKLA 5IOYA 5EF6A 5FKOA 5E3MA 4RBOA 3JRHA 3VP5A 5D1RA 3JR9A 3Q3SA 2QF7A 4IEJA 2LD5A 2KDZA 3VW1A 3ANGA 2QIBA 2CUFA 4QTRA 4A3KJ 3S1MJ 2XGEA 2ZB9A 2DA1A 2JK3A 2XGCA 3BTJA 3JSJA 2I10A 2L9RA 3HTHA 1NK3P 3GTMJ 4W1UA 4D7MA 1GDTA 3C2BA 4DYQA 2H8RA 2X48A 1HCRA 1QRYA 1Z77A 2DMNA 2YU9J 5IOZA 4BKXA 2GUHA 2ZOYA 1ZTRA 2X9DA 1ETQA 4UUSA 3JREA 2ME6A 2H1KA 4B4CA 4L5EA 4A93J 2PZ9A 3HKZN 2QKOA 3ZQCA 3A01B 4KWAA 3CMYA 1X2MA 2FQ4A 4UUSB 3LWJA 4A3IJ 1NTCA 5D18A 4HKUA 5HBUA 3IH4A 3TW7A 2XGDA 3V78A 3IV5A 5J1RA 2UXHA 1WCMJ 2XDNA 2OPTA 5IYBJ 4A3CJ 2M2EA 1ETXA 3Q0VA 1DU0A 2M34A 1TWHJ 2HYTA 2HXOA 3OSFA 2NVQJ 4D5FA 2ID3A 3BHQA 3K7AJ 2WV1A 3HOZJ 5EZHA 1B8IA 2ECBA 3VW0A 5C3EJ 3RZOJ 4BXXJ 4AC0A 1VNDA 2G7GA 3G1OA 4XRSG 3MN2A 3GTQJ 2QTQA 5IP6A 4XICA 3D1NI 4MK6A 3BR3A 3FK6A 3ZQFA 3BR2A 3S1RJ 4CYCA 1H89C 3GTGJ 2ID6A 2D6YA 2NS7A 1BW5A 2EQRA 3LSGA 3HTJA 2NS8A 1TWFJ 2ZCXA 3PASA 1JUPA 1O4XA 4M3GA 2M8GX 1JGGA 3JRDA 1K61A 2AHQA 2VKVA 3ZQIA 4A3BJ 1BJZA 2DG7A 5FMPA 4L62A 3S2HJ 4BBRJ 1FEXA 1ORKA 3HOVJ 3T6NA 4M3FA 1X58A 5DAJA 1AKHB 4UUTA 2NP5A 3S16J 3PPBA 3WHBA 2VKEA 3C07A 4Y52J 2CUEA 2OERA 2LLKA 4IHXA 2WUIA 3BR5A 4JX4A 3MNLA 1ZGWA 3LNQA 3QBMA 5M5XJ 3KNWA 3TP3A 2IU5A 4DYCA 3HEFA 4LOCA 1H8AC 1ETKA 3JRBA 2Y9ZA 3F1BA 1MBEA 2YUSA 4MO7A 3BG5A 3B81A 2E1OA 2Y0SN 5FJ8J 3KKDA 4A3DJ 2R5YA 3NXCA 1RESA 1U9NA 2ELKA 3WHCA 3IH3A 1VFCA 3VVZA 1T33A 1SFOJ 2KT0A 1A5JA 3QKXA 1ZK8A 2COBA 5HAWA 1ZR2A 1UI5A 2D5VA 4X1EA 5EYRA 3LOCA 3HTIA 3SDGA 1MBHA 2DMPA 1FTZA 2FD5A 2CQXA 5EDNA 3NRGA 1JJ6C 2NX4A 3ON4A 5CXGA 3JRFA 1MBGA 1B72B 4ABZA 3GTLJ 1XS9A 1IG7A 3BCGA 3VVXA 2JWTA 1LE8A 3HGGA 3JRAA 1HLVA 1BL0A 3MVPA 1JKRC 3QPSA 2DMTA 3EGQA 3FRQA 4HNVA 3V6GA 3TW6A 2MG4A 1APLC 3E7LA 5FKLA 1LE8B 4GFKA 1HDDC 3O8HA 1RR7A 3HTAA 2HXIA 4ME9A 3GEUA 2XPVA 5J1YA 2K9QA 3RQIA 4AC6A 1MBKA 3BTIA 3BG3A 2EZLA 3ZQGA 4QIWN 2GLOA 1PUFA 3GZIA 3M4OJ 1MSFC 2W53A 1A6IA 4S0HB 5IYDJ 2R92J 1OJLA 2R93J 2Y31A 5EFYA 1ENHA 3BT9A 4Y7NJ 3RZDJ 3O8GA 3P9TA 1DU6A 3BR1A 2G7LA 2MGQA 2LFBA 2TRTA 2NVXJ 1Y1WJ 2R7ZJ 4BY7J 4IHYA 2HQ5A 4FTHA 2DG8A 2O7OA 4MLOA 2ZCMA 5HODA 2CQQA 1G2HA 2R5ZB 2QCOA 2JA7J 2EBIA 1QVTA 5F04A 5DTDA 2DA5A 5C44J 4CYCB 5M3FJ 1F36A 2WAQN 2XPUA 1HDPA 2NVTJ 2L0KA 3ZOBA 5EG0A 1U78A 2R5ZA 3DPJA 2CRGA 5DS9A 4JX5A 4C3IJ 2JA6J 3FIWA 2ZCNA 3FISA 4C2MJ 5H9TA 1EF4A 2G7SA 4ICHA 3M3YJ 5FKMA 2GENA 4DZJA 2O7TA 2JMWA 5FLVA 3VPRA 2Q24A 5FGLA 4G12A 5GPCA 2JJ7A 2VPRA 2R5YB 3A01A 2DA7A 1MNMC 4A3MJ 2GM4A 1Z0XA 4C3HJ 5F27A 4I6ZA 2TCTA 3BTLA 2LK2A 2JA8J 3F0CA 3QPLA 3BRUA 1QPIA 1UHSA 2JN6A 2FX0A 3IUVA 4BY1J 2EZIA 1ETOA 3GBGA 3VW2A 2XB5A 1IGNA 1IUFA 3OIOA 4AF5A 2ME0A 2NP3A 1FIPA 2DA3A 1W0UA 1ETYA 4BBSJ 3NPIA 2REKA 5EZGA 4JX6A 3GTJJ 5C4JJ 2Y2ZA 1UMQA 3KZ9A 4M3EA 3NI7A 3E7QA 1TWAJ 1MH3A 3B6CA 3ON2A 3FK7A 5J1UA 2IBDA 2HDDA 2PBXA 1ZQ3P 3IH2A 3QQAA 2YVHA 2WGBA 1ETVA 1F43A 1OFCX 3GTKJ 2HKUA 2HI3A 3HB9A 5D19A 2R0QC 1P7IA 3FKIJ 1E3OC 3HIMA 3AQTA 5E3NA 3COLA 4X6AJ 2RASA 3RD3A 1TWCJ 2X6OA 3H3VK 1IJWC 1YRNA 1FTTA 4J19A 3H0GJ 5CW8A 3LJLA 2E2JJ 2GBYA 1YRNB 2DMUA 4JYKA 1SANA 2L7MP 2YS9A 1TC3C 1HF0A 3HOYJ 1VI0A 1AU7A 5F08A 1WH7A 1CQTA 3A02A 2IEKA 2FJ1A 3PM1A 3SJMA 3Q0WA 4QSHA 2HOSA 3Q0UA 3CRJA 1NK2P 2OF7A 1Y1VJ 5GPAA 1IV6A 2E2HJ 4A3LJ 1SGMA 5F1JA 4MFDA 2EH3A 3BG9A 4XK4A 1AHDP 1PUFB 2PMZN 4FE4A 1JUSA 1WI3A 3LHQA 4CGRA 2M9HA 3VUQA 3HBLA 1GV5A 3S5RA 5J3LA 2WB1N 4MIMA 5F0CA 3LSPA 1XC5A 5M5YJ 3NARA 4A3JJ 2N8GA 3B6AA 3S17J 3G1LA 1ETWA 5JLWA 4UDSA 1I6HJ 1GT0C 3G56A 5GP9A 1BA5A 1H88C 3HOUJ 3RKQA 1GVDA 2CU7A 4V2GA 2LKXA 3CDLA 2LP0A 5F0FA 5K7ZA 4M3BA 1LFUP 1JJ8C 2LTPA 1ITYA 3GTOJ 1MH4A 5IP7J 5IP9J 5C4XJ 2IAIA 1GUUA 4DYRA 3ZQLA 1B72A 2O8KA 4B3AA 2DA6A 2DMQA 2QOPA 4XIDA 2FBQA 3OOUA 5C4YA 5JLXA 1ZKGA 2DJNA 2ECCA 2DN0A 2W48A 4GFLA 3BR0A 2NOGA 3BJBA 3CJDA 5K7FA 3CWRA 1IC8A 3G1MA 5BNGA 1JKQC 2B63J 5K7HA 3LSRA 2HYJA 1Q1VA 4YZEA 3W6VA 5HSZA 1MBFA 3CQZJ 3PO2J 1X2NA 1RKTA
chains in the Genus database with same CATH superfamily
1P92A 2Z33A 3J7ZI 3VIBA 1R49A 1SMTA 2HKOA 4LJZF 4XLAA 3SXYA 5FRMA 4KIGA 5M5WJ 2EV6A 1J0RA 2KZGA 2VUMJ 3GTPJ 3OYAA 4W97A 2V26A 3F8MA 1F9NA 2ICWG 4AYBN 3WTTC 1HSTA 1WH5A 2IA2A 4HBLA 3E3VA 1SD4A 4BQQA 4L9NA 3J7YJ 2K85A 5EEGA 3L7WA 3P9KA 9ANTA 5DCMB 4CDGA 3CJQB 1FZPB 4IHWA 2ZY9A 3MZYA 4RM3A 1Z3YA 3KP2A 3U2RA 2CJJA 4G6QA 4DW6A 1D5YA 1QVUA 1BIAA 3K2AA 3I4NJ 4Y17A 2ESNA 3SWHA 2HZTA 1BJAA 4HEA2 2GA2A 4EJUA 4RDUA 1Z05A 5F0HA 1QHHD 2CQNA 4RAZA 4U0WA 1VQMI 2WB1A 3S1NJ 3OIPA 4XKCA 1JHHA 2LC2A 3P9CA 5ILUA 4A69C 1GV2A 2JZYA 2W82A 1LFBA 4I0BA 4PUSA 2ZJ2A 4KJZA 3KLNA 1R4MB 5TGTA 3HG9A 4KMUX 4GFBA 1BI2A 3HM5A 2DXIA 2CUJA 2JPCA 4AVPA 2G3BA 5F6FA 2JA5J 4Q5SF 3FKJA 3K9TA 2CYYA 4EEFG 2RVCA 2A05A 3L2UA 1UI6A 4KN4X 5DV5A 4QLCU 2HVRA 5FLXK 1HOMA 3R0AA 5CVVA 1UELB 2E19A 3BC8A 1XG1A 3RPUD 1VF9A 4NQWA 2XKPA 4A3EJ 1J5YA 1IRZA 2EINH 3TL4X 5K1YA 1JTYA 1TWGJ 2K9NA 4UVCA 4NN1A 5H2FC 1XDSA 4JK1X 2BVMA 2M45A 2WAQA 4GCKA 3SZPA 4AM3A 5IPAA 1TW3A 2MLKA 2LY9A 3O60A 2F4OB 4EQQA 2EZHA 1OYYA 4A6EA 3JTHA 5FD6A 3H0DA 3S8PA 2YVEA 2E1MB 3ERED 5TJJA 1Z7LA 3G71I 2HYFA 2P81A 2Z2SB 4RGXA 3TDZC 2QQ8A 1P2FA 1R1TA 2OC6A 2QM3A 2OJED 2R7DA 2E7XA 3SFIA 1UHWA 2HR3A 2VXDA 4M3DA 5FD5A 2HEOA 2F4MB 2M3AA 5J47A 2KMUA 1W5TA 2M7BA 1QA6A 1DGRM 2VC0A 1JT6A 1A36A 2DW4A 4MEYF 3GYHX 5FKOA 5TRDA 3R6SA 3OYMA 4CCOA 3JR9A 3PNVA 4PJ0C 2QF7A 3LSHA 3ZMVA 2B9SA 1R5ID 1TQMA 1R4NB 2QIBA 2CUFA 3KE2A 3DTIA 3DLLF 3CUOA 2L9RA 1NK3P 2XROA 3DF8A 2AQFA 1MMNA 2V1XA 4CZZA 1GDTA 4BACA 4DYQA 4F91B 2X48A 1D1BA 5D5UB 4G7HF 3TO9A 4BE2A 1GVJA 4I09A 1QRYA 3MEXA 2YU9J 5E1WA 2ZOYA 1WJBA 4PJLA 4XORA 5J40A 1WFXA 3ECOA 2X9DA 4JQFA 1T98A 4LLGF 3JREA 2ME6A 1ONVA 2PZ9A 2QKOA 1T95A 1V55H 5D5WB 4XSZF 2JA2A 2STTA 2ZFWA 3SEZA 3C7JA 1NTCA 5D18A 1YW7A 3BPVA 3CO7C 4A0ZA 1YHQI 4LMYA 3PSIA 3DXJF 3IV5A 5J1RA 2VIXA 2UXHA 3F8CA 3K70C 4OIQF 2G7HA 3DKYA 2M2EA 2X4HA 4R79A 3J80K 3Q0VA 5B5EC 3VTIA 3I54A 1FC3A 3M9AA 2DLLA 2PBIA 2NVQJ 1MNEA 3K0LA 4CO8A 3OMYA 1FYMA 1V5GA 2LSOA 1T39A 5EZHA 1B8IA 1REPC 2KIMA 3FWEA 2FMLA 3K4CA 1G3SA 3V7RA 2OV7A 3LL7A 3G1OA 1UJ8A 1W7PA 3VODA 2NVUB 1LQ1A 5E1ZB 3SHFA 5IP6A 3D1NI 2DT5A 3CMAI 2V6CA 3FK6A 4WWCA 3S1RJ 1KYZA 2B3WA 4GGGA 4IF4A 2D6YA 3BZ6A 4HQEA 2NS8A 1BOBA 1TWFJ 1NH3A 1K4SA 3JAMZ 1HKSA 1LDDA 1V5EA 3I0TA 3ZQIA 1TT0A 2JUGA 5J4VA 1J7KA 2QLZA 4L18B 4F93B 3S2HJ 4AWXB 1MMSA 3HOVJ 3T6NA 4CXFA 3CDIA 1EH8A 4EM2A 2RREA 3AG1H 1P6RA 3DKXA 3OYDA 3KIOA 4IO9F 2R7SA 1D0XA 2KLOA 2Y69H 1BOAA 4HRIA 4AYBA 2VKEA 3C07A 2HTJA 4XLFA 5CJ9A 4Y52J 3KCCA 2UV1A 3ERMA 4YIRX 4IHXA 1QO0D 1U5TB 2QQ9A 3BR5A 4HX7A 4IQJA 3ABLH 3MNLA 3FM3A 5L3FA 3LNQA 3KNWA 3TP3A 2LREA 2XGXA 1H8AC 2DDBA 3CP8A 3JRBA 3RPQA 4HF2A 1MBEA 2FE3A 3PFYA 3BG5A 2IW5A 2Y0SN 5FJ8J 3F22A 3FHNA 2W7NA 4U87A 2ELKA 3WHCA 2VOOA 3IH3A 2R7FA 3NRVA 5HAWA 1SMYF 2COBA 2LF8A 4B3XA 1N78A 2VBYA 1ZLJA 1FYLA 4M74A 3HTIA 2DJIA 3R61A 5JR3A 3KZIC 2X1EA 4N9IA 5BS6A 5CXGA 4LITA 1B72B 2DAOA 3VEPA 4ABZA 1XS9A 4MQVA 2JWTA 3JRAA 3SEQA 1HLVA 1BL0A 3BJ6A 1JKRC 3QPSA 2DMTA 3EGQA 1QQIA 2JQ7A 2ACJA 3V6GA 2MG4A 1JXSA 1APLC 5L3BA 3E7LA 2MABA 2PX9A 2QVOA 3KZYA 4N4OB 3ZPLA 2O03A 4BE0A 1E2XA 1RR7A 3KPHA 1YFHA 2GIVA 4ME9A 1P9QC 1T6SA 5JFRA 5J1YA 3LSMA 2I5UA 4FASD 2XASA 3ONQA 5D5XB 4AC6A 3BTIA 1W7PB 1ZAOA 2G7UA 4HV5A 4II3A 3UNGC 4KITB 4YG2F 2ZJRF 1RUOA 4DVYP 4QIWN 3RSNA 2BGCA 1MSFC 5J8FA 1DP7P 3KX2A 2R92J 2R93J 4HNTA 1XGMA 1USTA 2LBFA 5HLTA 1X3UA 3MCZA 3Q5FA 2CV0A 2O3FA 2LFBA 4Y4RA 2NVXJ 2XAQA 3OR1C 2DYRH 2HQ5A 4B43A 4OINF 2VJIA 2ZCMA 3QYBA 2CQQA 3K1MA 2DBBA 1G2HA 3OYIA 3QU3A 3S3MA 2EBIA 3ZXSA 5DTDA 3GEUA 3GLLA 3F23A 2WAQN 2XPUA 2LF7A 4D9JA 3HUGA 1J9IA 2CQKA 3IWFA 1B9MA 5CVJA 3OOPA 4XMYA 1OISA 5DS9A 1QNTA 3FIWA 2Z9OA 4C2MJ 1STZA 2QZ8A 1EF4A 2G7SA 5FKMA 2YPRA 3BJOA 3M07A 2O7TA 4HX8A 1QZYA 1E0EA 1O3QA 5FGLA 2AXLA 2R5YB 1SC7A 3A01A 4XN3A 3I9V2 1MNMC 3ISPA 2GM4A 2IA0A 2TCTA 3QPLA 4EJVA 1UHSA 2JN6A 2FX0A 1QPIA 3GLXA 2XB5A 1FMWA 2WWYA 1IUFA 5HDKA 3OY9A 3QP5A 1USSA 3OIOA 4HV6A 4XLEA 3ULQB 3DBHB 4L0ZB 4AF5A 2JT1A 3K10A 4UVBA 3SZGA 3OS2A 4E7HA 4KFCA 1JI8A 1UMQA 3OYGA 3NI7A 1W5SA 1KU3A 5GAGJ 4F7ZA 3H3UA 3HHHA 4WIBA 2IBDA 2HDDA 5H6RA 3IH2A 2YVHA 2WGBA 3VB2A 1IO2A 4NHJA 4FQGA 1XGSA 4XLCA 2H27A 3RQ4A 3KEOA 2HKUA 4QWQA 4MTEA 1E3OC 2K27A 2EIMH 3ABTA 3HIMA 4JNNA 3K4LA 1Z91A 4ANJA 3EYIA 4CICA 4CUGA 4G7ZF 4R1HA 2E5ZA 3CCQI 3NWSA 2EIJH 4KICA 1Z9CA 2H6BA 4BXFA 3FXRA 3GFMA 1NG7A 3IKVA 3C2HA 1ON2A 1YRNB 2PJPA 4Q48A 4JYKA 2L7MP 3EQLF 3LFKA 4M9ZA 4G6DA 4LLLA 3F21A 1AU7A 1Y0UA 5F08A 5H6QA 1A04A 2HOSA 1LFPA 3L00A 4CCLA 3E0JB 4XKVA 3RKYA 1KA8A 4LB5A 4YEJA 2UXXA 2ZXWH 4BNCA 4EM1A 4U7BA 1JUSA 5FFZA 1KQ8A 2PI0A 3F8FA 3PUBA 1WJAA 1ZRFA 3S5RA 2EB7A 2WB1N 1F43A 5JLWA 2QEXI 5DDGA 4UDSA 2H94A 2EFOA 2V1NA 4OWRB 5CPRB 5LBQA 3LAPA 2V9KA 5FFXA 3FXMA 3CDLA 5K7ZA 5E8GA 1VQOI 2HTSA 1R1UA 2A68F 4M3BA 3PL8A 1U5TA 4F55A 1B1BA 2I8DA 1QU3A 2WY7Q 2XIGA 3WTXC 2EPFA 2V1UA 4BAYA 4DYRA 3ZQLA 1OCZH 3ECHA 4PCQA 1WJDA 1WRJA 2FBQA 3OOUA 4I2OA 5JLXA 2B0LA 5KAIC 5LLQA 2X6XA 3BJBA 1S6LA 1HW1A 5K7FA 4L9JA 4BQAA 3L09A 3CWRA 1LNWA 1WWXA 4FETA 2HYJA 2Y75A 1Q1VA 1S8NA 4NNJA 1EJ9A 2VE9A 3CD6I 1MBFA 3CQZJ 2A3SA 1X2NA 2MC3A 2MBFA 1QZZA 1RKTA 3DBRB 4XRSG 3ZQHA 3EUKL 2K86A 4A3GJ 3DEWA 2XRLA 3CF2A 4BUPA 4M6XA 2Y30A 4LLNA 4UY8I 4E7IA 4IPAA 1T08B 5K58A 1WPKA 3L9FA 1UAAA 3HKZA 1RNLA 5L3DA 2KRHA 2CS3A 3VOEA 3HIFA 4A0XA 3WGIA 1I6XA 3SFZA 1Y39A 2VOPA 2KFDA 2KP6A 1U9OA 2FF4A 1XSDA 2K9SA 4FISA 2CSOA 5ILSA 3PUFA 1HC8A 4DGWB 3I55I 3S1QJ 1R9TJ 4HG2A 2M0CA 1JUMA 2DTRA 3HDDA 3WU2C 1JKOC 1BW6A 2B7EA 3GWZA 1AKHA 1R23A 4HAMA 4M6VA 3MKZA 1IXSB 3HSEA 2XC7A 3OYKA 2BXZA 3H5NA 4PSXA 1D8KA 2EFWA 2LBFB 4AUXA 1X1PA 1YX3A 2IS1A 2BBYA 4NDLA 5EGOA 1L3LA 1F5TA 2ZOZA 5EG0B 3CMEI 5DD4A 3IUOA 1P4XA 2L4MA 4JKZA 2FRHA 2MW8A 3GW2A 3CCYA 3ROUA 1CF7B 3VVYA 3S93A 1RC9A 1BC8C 2HVQA 2RN7A 2F5FA 2W25A 2MA3A 3U1DA 4MFEA 4DQ2A 3ZCOA 1DDNA 4AIDA 3RI4A 3OSGA 2R7QA 2PMHA 1RKWA 4AD9A 3WTWC 3JRIA 3CCJI 4E4HA 2GFNA 3GZ6A 4WX9A 1IUYA 2ZSHB 2LVSA 3NAUA 4P5OA 1RETA 1V54H 1Y8RB 3AG4H 3WU1B 4LG0B 3BTCA 3PO3J 5JVTA 2XSJC 3CUQB 2PN6A 3LSTA 2HOAA 1X1AA 2GA1A 1MMGA 2LH9A 1P7JA 2L02A 3DTKA 2QQAA 1FSEA 3P9IA 1B4AA 3I4PA 1ULYA 1H0MA 3K1PA 3BG6A 2M87A 2IVMA 4Y15A 4XRMA 3A0BC 3DCFA 4I7HA 3K2ZA 3ZR8X 2E71A 4GCTA 2VJJA 4V2FA 1AA7A 2HQNA 3S14J 1T56A 2FMYA 4ZYAA 1L0OC 5ICFA 2RDPA 4FE7A 1O7FA 3S2DJ 4A12A 2MLGA 2UXOA 1FWZA 3ANPA 1H9GA 1ZR4A 2R7XA 2Z5UA 4CA0A 3IL2A 2DFFA 2QWWA 2FNPA 2QWTA 2FBIA 4RGUA 3LA7A 1N75A 3PIPF 1S7AA 5FKKA 4GCLA 4QPQA 1MJ9A 2DTZA 2VONA 1MD0A 2R4GA 3CC7I 2DCEA 3LQRA 1PP7U 1WVRA 3MKLA 3K4BA 4H4KC 2VBXA 3FMSA 1VTNC 1XMKA 3TOBA 3W6JB 2LY1A 4CH7A 4OD5A 3DTEA 2CH0A 3W2VA 3ZMUA 2LD5A 3AAFA 1ZG1A 1D5VA 1R7JA 3JSJA 2DA1A 2XGCA 2PJRA 4Q4ZF 4P55A 4W1UA 2VBWA 3RKXA 1CF7A 3H3ZA 5E8IA 1HCRA 3CJTB 2DMNA 4AU7A 1AWCA 4HPQA 1PP8F 3A2KA 1ZTRA 4UUSA 2DI3A 2Y48A 3FXQA 4ESBA 4B4CA 1DQUA 4A93J 1IN7A 2KPMA 3A01B 3CMYA 1X2MA 4U9LA 1TP4A 2X51A 2Q0OA 2K4JA 1TZLA 1SVMA 1TQPA 1ZLKA 2ZXIA 2Y0SA 2XGDA 5HNHA 2QSGX 4MHGA 3W3CA 1WCMJ 5CQEA 3OYHA 1ZRCA 2CQ7A 2XVCA 5IYBJ 2CFOA 1LVAA 5IT9K 1XDUA 1DU0A 2M34A 2GXGA 2ISYA 2X1DA 3M7GA 4PZJA 2STWA 3CUQA 2OCEA 3BHQA 3OYEA 5ICEA 2D2WA 3F6OA 4HSRA 3F9KA 2Q2EA 3BJAA 3RZOJ 2XAHA 2CG4A 3GTQJ 5DCMA 2ZKZA 3WGHA 2DYSH 3QRFF 2P6TA 3GFLA 3TKYA 4II2A 5HOOA 1QZEA 4MK6A 2J5PA 3BR3A 2K4BA 4CYCA 2ID6A 4XLPF 3CCSI 4ZJZA 2CV1A 2IA1A 2HPIA 3HTUA 3CCVI 4Z2YA 3LSGA 3WG7H 3C3WA 4RB2C 4OIOF 1K78A 2ZCXA 1O4XA 4Y13A 2M8GX 2XF7A 3JRDA 2P0WA 2VKVA 1VZ0A 2WY8Q 5DUKA 3K69A 1C0WA 4A3BJ 2DG7A 5FB2A 4IRIA 2ZNYA 4I0AA 1QBJA 4M3FA 4RB3C 1X58A 4UUTA 2FA5A 4GYIA 4A5MA 1JHFA 3WHBA 4C2MA 4YFKF 3WTSC 2OQRA 4BS9A 2WUIA 2NOJB 2OZ6A 1ZELA 5M5XJ 3QBMA 3MWMA 4DYCA 5CYVA 1SFXA 2VKHA 4L5IA 4XNFA 2DPDA 2Y9ZA 3F1BA 1XD7A 1VQ6I 2OA4A 3E6DA 4IKFA 1W7PD 3B81A 2F48A 2E1OA 3A4CA 3KKDA 4L9VA 2VJ5A 3VWBA 2NRAC 2DPUA 2HNHA 3D5LA 3M1EA 1SFOJ 1ZGJA 1GLNA 1ZK8A 2G9WA 1HA8A 2DO7A 3J81K 1FNNA 4X1EA 2WA0A 2RC4A 5EYRA 1QPMA 1RZ4A 1O57A 2ZNZA 2DMPA 3SDGA 1FTZA 2OD5A 3J7AY 3ON4A 2FBKA 1LVKA 1FOYA 2ELHA 3JRFA 1T8IA 2HFHA 3WE2A 3BCGA 3H1CA 4Y3OA 6PAXA 2XKOA 3VVXA 4UVAA 4ESFA 1T2KA 3OYFA 2BE5F 1MDMB 3FRQA 2VQGA 1JGSA 3BP8A 1LE8B 2VASA 1HDDC 1FMVA 3QPTA 3OL3A 4KIBA 2OAZA 3F72A 4IOAF 5H20A 3QU6A 4FX4A 2K9QA 2QKMB 3ZQ7A 1EA3A 4ASNA 2K7LA 2ETHA 2E60A 1PUFA 1IRGA 3GZIA 3M4OJ 5LFAA 1A6IA 1YOVB 4S0HB 2XDVA 3TDUC 4EVIA 1JE8A 2Y31A 2YX7A 2BHZA 3V8KA 4RGRA 5DD8A 3BT9A 2F5VA 5GAEJ 1B59A 3HC7A 2DODA 2G7LA 3BR1A 3P9TA 2O5RA 5CQGA 4BY7J 4IHYA 4BHBA 2QSHX 2DG8A 2YR2A 1X4PA 2WV0A 1TNSA 5BPDA 3O2PE 1QVTA 5F04A 3I71A 1FPQA 5C44J 3K4JA 1IV6A 1X1DA 4EGZA 4IRVA 2L0KA 4NC8A 2R5ZA 4LIVA 4EMSA 4EJWA 3OV8A 3SYTA 1U3EM 2E36A 4E7KA 2IS6A 4P1WA 3SQNA 4YIIA 2W24A 2L2OA 1XMAA 3KEYA 1KZHA 4QPOA 5FLVA 4RAFA 2Q24A 5GTHC 1DPUA 1FY7A 4G12A 1SD5A 5GPCA 2DA7A 4HNUA 4C3HJ 3BTLA 2LK2A 2JA8J 3BG7A 3REOA 3BRUA 4U7DA 4XSXF 4H0EA 3CLQA 2EZIA 1K7AA 2RKHA 3VW2A 5HDGA 2M1BA 3CP2A 4GRIA 4BXUA 1MMDA 4M73A 4MTDA 3RPUA 2NP3A 1UB9A 4RMNA 1ACIA 1W0UA 1ETYA 1BIBA 3NPIA 5EZGA 1OKRA 4JX6A 4BH9A 5C4JJ 3E7QA 2GIZA 2KRFA 1U6GA 4G94A 5J1UA 3QQAA 2UXNA 1X19A 5J8CA 3ASNH 2ZO4A 2FSWA 2BY0A 2IT0A 1E17A 5D19A 4R8HA 2V4JC 3FKIJ 5KCMA 1EH7A 4CCJA 5E3NA 2DOEA 1OYIA 4D1QA 2RASA 4UNOA 1TWCJ 2OQGA 2WAEA 1IJWC 1YRNA 1FTTA 5BOXA 4HF1A 3H0GJ 2MYSA 1X3ZB 2GBYA 3GUDA 1DGWY 2LDUA 1FBSA 4BDZA 4MEXF 1Z67A 1TC3C 2ZFUA 5K5RA 3P5JA 3DP7A 3KLOA 5LHHA 3M8JA 1MMAA 1VI0A 3IP4B 1WH7A 2WTEA 3A02A 2IEKA 1LB2A 3PM1A 3SJMA 3Q0WA 3DPTA 1OMIA 2HOEA 5HLIA 3IHUA 1YW9A 1Y1VJ 4P96A 5GPAA 5L3CA 2A2FX 1SGMA 3E6CC 4A3LJ 4KIFA 2EH3A 2JVGA 3BG9A 3F8BA 4XK4A 2H1LA 4M71A 3VDXA 3G4SI 2PMZN 5D5VB 3ZN0A 1WI3A 4BDYA 4ZDOA 1D0ZA 3E5UA 1GV5A 3HRUA 5J3LA 4A3JJ 3LSPA 1XC5A 3FF5A 2KJBA 2IPQX 3L2CA 1MGTA 1BA5A 3HOUJ 3RKQA 1GVDA 2CU7A 4NBQA 4I01A 3LA2A 5D6EA 2LP0A 2W00A 2V7FA 3LFUA 4RGSA 5B1AH 5L3EA 2ESHA 1JJ8C 2LTPA 2M5WA 3BY6A 1LPQA 3ABUA 2CW0F 1PDNC 5IP7J 5LGTA 5IP9J 2Z1DA 3AL0C 2IAIA 1GUUA 3HZJA 5E79C 1IW7F 3KYCB 3GMEA 2GOXB 2DA6A 1OCCH 3VSKA 2FUG2 3LWFA 2W48A 3WODF 2NOGA 3U9GA 3FXKA 3GEZA 3U21A 2W4SA 3LQQA 5ICGA 2P5LC 1RI7A 1KQ9A 1A31A 5BNGA 1JKQC 2B63J 5K7HA 4FT8A 5A2QZ 4PGHA 1YLFA 3W6VA 2ZSIB 1G8XA 2R7OA 4CYCB 2EZKA 2M4GA 3EUHA 3GXOA 4IJAA 4PJNA 1HW2A 2COMA 3HGYA 1R5GA 2OI8A 3RH2A 1W0TA 1O3RA 2K40A 2XV4S 4ON0A 2FOKA 4CCKA 4M9SA 3BQYA 1FJLA 3CO6C 2NVYJ 4RLQA 3ELKA 2K9MA 4A3KJ 4EGYA 2F07A 3HOWJ 3I3LA 4DBRA 1WJFA 1LDKB 2M7AA 3KP7A 3JRGA 3A1YA 3A03A 4CCNA 4BQNA 2OU2A 4XRSA 3WTUC 2IS4A 5DAJA 3FXOA 2JSPA 1VQ9I 3BPXA 1OLTA 2IGKA 3HOSA 2QKLB 1MW7A 3NNRA 1F4KA 2UXIA 3PIOF 1P4AA 4PGGA 1FOWA 2XSDC 4ACIA 3DFGA 1X3WB 2V9VA 1EKEA 1K6YA 4ZH4F 2RGVA 1BC7C 5M3MJ 1OPCA 1Y0NA 5B3SH 1W1WE 4MGRA 4C9YA 4B1RA 1IDZA 1N25A 4IXAA 2QYOA 3I4MJ 1IDYA 3TGNA 2QA4I 2R7TA 2QBYA 3TP0A 3ZRGA 1VQ8I 4PFOA 4LK1F 2G0EA 3KEQA 3PNTA 3VYSB 4C2TA 2EWNA 2H8WA 2LKPA 2V57A 3D5RC 3PQJA 1WSUA 4IHVA 3WTZA 2NYXA 3CDHA 4YFXF 5GTIC 1BBYA 5EEAA 1UG2A 1XGNA 3BQZA 3KFWX 1D1CA 4LG0A 3WE3A 4E70A 2UXUA 2LG4A 3AG2H 3AQSA 1SVOA 3DKWA 3V42A 1FBUA 3T8RA 2KJCA 3UKGA 4RB1A 2IRFG 1GHCA 1V3FA 2KRCA 3B02A 3EUPA 5GADJ 4HF0A 3VOKA 4EJOA 3KP3A 3FMQA 1SFEA 4ZTFA 2B1EA 3KP4A 3ZMTA 4CZCA 2UXPA 3G7RA 3CJNA 4RLFA 1A35A 1BM9A 1MBJA 2XUBA 2MFZA 4HDVA 1QGPA 4EM0B 1UZCA 1IZ1A 1IN5A 1R58A 4G8XA 4O6JA 1W36D 3G73A 3QPHA 1K83J 4PDKA 4FCYA 1FOKA 4XLHA 3S3OA 2X1CA 4I76A 3TO6A 4OAZA 3L1PA 3OYLA 2EFNA 4D7NA 4B8XA 3K4NA 2XPWA 4BU2A 1MZBA 2ZC2A 5FKNA 3HE0A 1Z3XA 2A5WA 1POGA 5E17F 3WG9A 4NELA 3OWTA 3GZNB 1D8JA 1VQPI 5IOYA 5E3MA 4RBOA 3KETA 3GFJA 3JRHA 3VP5A 3H36A 4FX0A 2IGMA 2A6HF 3C2GA 2HQRA 1T0FC 2A07F 3ANGA 4QTRA 3JCUC 2EA4A 3K70D 2XGEA 2ZBKA 2ZB9A 2JK3A 2XF5A 3BTJA 2R7WA 2ZJPF 3S1MJ 1WJ5A 3GTMJ 4NC7A 4D7MA 3V8LA 2O8XA 1R6RA 1FOXA 2PFVA 2LNBA 4E7LA 5IOZA 3V7CA 2GUHA 1D0YA 3EPZA 1FP2A 3I64A 5DCFA 4FHTA 3PFIA 1ETQA 1YS7A 2KZVA 2H1KA 4N0BA 4ITVA 4YELA 3HKZN 1YE9A 4KWAA 3EUAA 1HKTA 4XR6A 3LWJA 4B47A 2VQLA 4U0VA 3HRSA 4LG3A 1BI3A 2L4AA 4OMZA 3TW7A 2X6WA 1BN5A 3W6KB 2KIFA 1XTAA 4TV7A 3M8EA 5ED4A 3JAMK 2ADUA 2P4WA 3AKZA 3R4KA 4S05A 2EV5A 2CW8A 5E18F 2EV0A 3D5SC 1TWHJ 2HXOA 2AQEA 3HRTA 3OSFA 3RJPA 3QAHA 4D5FA 3ZN1A 1S29A 3X2QH 3K7AJ 2EFQA 2HS5A 2WV1A 3HOZJ 1IN8A 2VODA 2ECBA 1J2XA 3VW0A 5C3EJ 3OS0A 3FHZA 3I5UA 4BXXJ 4AC0A 4YFNF 3GCMA 2BEOA 2G7GA 3BLYA 2QTQA 5HLGA 4HOBA 4XICA 4C30A 3BR2A 2FOWA 4XKBA 4RS8A 1H89C 4IVNA 1V4RA 3MMYB 5DEQA 3HTJA 1ZN2A 2LOOA 3PASA 2JTVA 1IAWA 2DFIA 2F5CA 1JGGA 2AHQA 5CVIA 5FMPA 3RIRA 4L62A 4U88A 4B44A 1I39A 1YW8A 4BBRJ 3VSLA 4S04A 1N77A 1FEXA 5CKTA 4CSWA 1FLIA 3GF2A 4KMFA 2CFXA 3EETA 2EA2A 3T0YA 2PMZA 3DV8A 3LA3A 1KONA 1BR2A 1MJAA 1G3YA 2VKDA 4XLNF 4ZTJA 1Z1DA 4J00A 2OERA 2FQ3A 4JX4A 4ZDPA 3SZTA 3QOPA 1ZGWA 4CHUA 2IU5A 3IAM2 3EUHC 3HEFA 4F3QA 1YO5C 3FXJA 4AIKA 1ETKA 3IRQA 2FBHA 3CCMI 2PFBA 1IXCA 3OL4A 5AONA 4AIHA 3TQNA 3NXCA 3DLAA 4UV9A 2LMDA 3CMMA 1U9NA 3VVZA 1VFCA 1ZYRF 2D1HA 4HYEA 4RB0A 2CWEA 4XQFA 4JOMA 3QOEA 4O3MA 1UI5A 4ZZDA 1I1SA 4HQMA 3BOQA 3RYRA 2E1NA 1MNDA 3LOCA 4NB5A 3Q9VA 2BYVE 4KN7X 2NXNB 3FXLA 2FD5A 2EIKH 4E7SA 1S9HA 2CQXA 3ZMSA 3RKWA 5EDNA 1JJ6C 2HPMA 3NRGA 2P7VB 1XB4A 3GTLJ 2IXSA 3NWTA 1FT9A 2IGNA 3MVPA 2NNNA 1OR7A 3O3KA 4M9XA 1XPXA 2YU3A 1LJ9A 2F2EA 4HNVA 2CV2A 2R3SA 1XGOA 5FKLA 4KT5C 4UB6C 1TBXA 2ZMEA 3HTAA 2HXIA 1B9NA 2VT3A 4WXHA 4BJ6C 3RQIA 3CCEI 2FEZA 2M4KA 3ZQGA 2GLOA 1M1EB 3JW4A 5D4RA 4ZC3A 5HS9A 2W53A 4L5JA 2C6YA 3KZZA 1RR8C 1OJLA 1U0JA 3E97A 3WGGA 3I59A 2MH2A 1OCRH 5EFYA 1ENHA 1TTYA 2M30A 1RIOH 3O8GA 4Q47A 1DU6A 2ZCWA 2MGQA 3PJRA 1Y1WJ 3QYFA 4FTHA 1Y56A 1G59A 2O7OA 2VJ4A 3HPHA 2K02A 5HODA 1IXRC 1D1AA 3L2RA 2BY3A 2K9LA 2R5ZB 1K79A 4BQOA 3GO5A 2JA7J 4P9UA 2LKSA 2DA5A 3IWZA 1F36A 1HDPA 1ZHFA 3JSPA 5EG0A 2ZXHA 1YQAA 4G7OF 3BZKA 4L9TA 2GQQA 3KP6A 4I99C 1WQ2A 3BDDA 3DPLC 1UFMA 2ZCNA 1G6NA 3E5QA 2XAUA 3BZCA 3TBIA 2GENA 2ZXJA 4DZJA 1X1CA 1GXQA 4HX4A 3VPRA 2ELJA 1IV8A 2VPRA 1Z0XA 4I6ZA 4N9HA 4Y33A 1RUNA 3F0CA 2RV8A 5HS7A 2LY2A 4BY1J 3GBGA 4HLXA 3WU0A 5LRSA 5LGNA 5KK1A 3OYCA 2XAGA 3BCBA 2IGOA 4PK4A 4IOCF 2ME0A 4DOZA 4EV0A 4EJTA 4E6KG 4NC6A 4RA2A 5FRNA 2REKA 1R5HA 1VQKI 4M3EA 3FX3A 3UR3C 1TL8A 1K4TA 4WK8F 3ON2A 3FK7A 3H92A 1ZQ3P 1R71A 2GZWA 2DT7B 5KAFC 1W4MA 5CVUA 2E1MC 1OFCX 2UUZA 1O3SA 2VB6A 3GTKJ 3FXUA 1KU2A 1K78B 4HSTA 3A0HC 1Z6RA 2X6YA 3E5XA 2R0QC 2WAFA 3DQVC 4P9FA 2DOAA 4DNCA 4A5NA 3RD3A 3J80Z 3KYLA 3H5AA 5HVQC 3E6BA 4J19A 5CW8A 3W2AA 3LJLA 3JSOA 5LHIA 4HZFA 3N05A 2WC2A 1XX5A 3C1DA 2DMUA 2KHMA 1FX7A 1Z6TA 2VLAA 4PSWA 3HRMA 2A6TA 4UUVA 3ZMDA 1HF0A 4A6DA 3OR2C 3J81Z 1BR4A 2CO5A 1CQTA 3H35A 2FJ1A 2KISA 1XCVA 1Y6IA 4PFPA 3NS4A 4QSHA 3Q0UA 3AG3H 4RM2A 3PO2J 1NK2P 3VYRB 2TDXA 2YSRA 5F1JA 3VYTB 4MFDA 2VQCA 1AOYA 2OBPA 1AHDP 1PUFB 2P7CB 3HHGA 4WCGA 2DK5A 4LIUA 4FE4A 1WI9A 4CGRA 4BHPA 3VUQA 4RAYA 2LRDA 1YX5A 5F0CA 1ZRDA 5M5YJ 3NARA 2IP2A 2N8GA 3B6AA 3L2WA 3G1LA 1ETWA 4M72A 2QQBA 3BCAA 1I6HJ 2V9PA 1GT0C 2BW3A 1WHUA 3TMOA 3HYIA 4V2GA 2LKXA 5F0FA 2GWRA 1ITYA 5B66C 5DM6F 5LEJA 3Q9SA 2GXAA 1J09A 2HGCA 4D0PA 4KA4A 2R7RA 1GXPA 2O8KA 2DQRA 5AIQA 2VT2A 4B3AA 3CTAA 2A6EF 1I3AA 2DMQA 1KGSA 4ZYEA 1ZKGA 2DJNA 2DN0A 4IL6C 2XF6A 2X85A 1X1BA 3R60A 2BOLA 2KKOA 2OCCH 3IAS2 2CGPA 3PSFA 4XOTA 1IC8A 3G1MA 2X0LA 3LSRA 1NHAA 2L54A 5HSZA 1ZG5A 4HA8A 2ZMEC 1SD6A 2CW7A 1YI2I 1U8BA 3JRCA 2RQPA 1VQLI 5FHPA 4ETSA 1S7EA 2OTJI 2AO9A 4ENJA 2BZTA 1JTXA 1WJEA 4C3JJ 1I3QJ 2DA2A 2J5OA 3H9QA 1B8IB 3CC2I 1KQ0A 2BY1A 5CLSA 3RDIA 4E7ZA 1Z21A 1MSEC 1BI0A 3RCOA 2AS5F 1I50J 3MZHA 1WGXA 5E3OA 5CVRA 2E2IJ 2IS2A 3FMRA 1FBQA 3TEDA 1R22A 1ZREA 5DUIA 3S3NA 2W84A 4UV8A 5TISC 4UXNA 1MIJA 1BI1A 5E3LA 2VC1A 4KISA 4Z6YA 4A3FJ 1Y8QB 4O5VA 3BNIA 2L7ZA 1O3TA 2O9LA 1T0FA 3F3XA 4OIPF 1KU7A 2H6CA 3VOXA 2E5NA 3DEEA 5CXIA 3MD2A 1YJWI 1JT0A 5D8LB 2PQ8A 3LAJA 2RHAA 2Y0MA 4BJ5C 3HSFA 2JRTA 5EGOB 1J75A 1TNTA 3CCLI 5FLMJ 5D6FA 1SAUA 4J01A 2L7FP 1V5FA 4DZPA 3IRRA 4PXIA 3ZQQA 1PUEE 4PJMA 2E1CA 1FIAA 1IN6A 3KKCA 3G2BA 3I56I 4JL3A 1I5ZA 2ZMEB 4JP0A 2PMUA 3WTVC 3DWLE 4D5CA 4L0YB 3S15J 2HOTA 2F5EA 1VQ7I 4ESJA 1ON1A 1YYVA 1ZGAA 4KNYA 1E3HA 2K3PA 5AQCA 4HLYA 1OCPA 2Y9YA 1YIOA 1FP1D 3H9GA 4BE1A 3COAC 3OYNA 2V1DA 1YITI 1KU9A 5K5QA 1DUXC 2LR8A 1TW2A 3LSJA 3BR6A 4MXMA 3U1KA 1OCTC 2P5KA 2XB0X 3HOXJ 1HKQA 3D0SA 5JHFA 1K6OA 1S7OA 1X4OA 3CC4I 1TLHB 2Z16A 2KQRA 4IZZA 3LMMA 3K1NA 4PJJA 4IHSA 4NUBA 2E35A 4OU0A 2VI6A 3CZ6A 3MAJA 1TT5B 4IRGA 5IYCJ 3I59B 3M8FA 4C2UA 5LGUA 5ICCA 2V79A 2DA4A 2MSYA 1SFKA 2QGUA 2RAEA 5AIPA 1JKPC 2RNJA 3T8TA 2K5CA 1RPWA 1ODDA 5EF6A 3MKYB 2PJRB 5D1RA 3MZ8A 1TQIA 3Q3SA 4IEJA 2KDZA 3VW1A 2HWVA 2F6CA 2L7KA 2R7VA 1MKMA 2I10A 3HTHA 5J6XA 2A69F 2PG4A 3PQKA 3C2BA 2H8RA 2BXYA 4G9YA 3HL2A 3CF5F 4KDPA 1Z77A 4U0YA 1A6QA 4BKXA 4XKWA 3M1CA 2XRNA 5HNFA 4B09A 1FSHA 4E7JA 2QBYB 4IRHA 1O7LA 2P5VA 3FBNB 1SVLA 4L5EA 5HS8A 3ZQCA 3V7SA 2D45A 2MD0A 3T1BA 3S32A 2FQ4A 2KIQA 3OIQA 4UUSB 1YIJI 1HQCA 2VE8A 4A3IJ 3CESA 4HKUA 3HOTA 3QODA 2WADA 1OQYA 2MH9A 3GZ5A 3H9JA 3IH4A 5HBUA 2CUZA 3V78A 4KT6A 4BEHA 3N4MA 3KP5A 3K4KA 2DK8A 1SD7A 2XDNA 3P7NA 2OPTA 5FLXZ 4A3CJ 1ETXA 2OZUA 2PEXA 3NQOA 4KUMA 2HYTA 5IY5H 1IRFA 1WKMA 5J4YA 2EFPA 1OR7C 5JI6A 3DPUA 3LSKA 3T5XA 2ID3A 5BPIA 2IJLA 3G6EI 3GX4X 2O61A 3HSRA 5ILVA 3H5RA 3QP6A 3C18A 1VNDA 3FBIB 2FXAA 4LFUA 3MN2A 5LD2C 3HUGB 1I1GA 1KYWA 1SAXA 2VPLA 2FNAA 4YIFA 2HU9A 2L3DA 3ZQFA 3GTGJ 4HDUA 3MFKA 4CGZA 3RTRA 2NS7A 1BW5A 2NS0A 2EQRA 1S5LC 1JUPA 4M3GA 1VQNI 1K61A 2M8EA 1E3PA 2Q8KA 4I02A 3V8JA 5IT3A 1BJZA 2VBZA 4DBQA 2F5DA 2L9VA 2E7WA 5B1BH 1PJRA 1ORKA 3ZP5A 4ENKA 5EEHA 1AKHB 2EK5A 1IN4A 2VN2A 3FDYA 2NP5A 3HTSB 3S16J 3PPBA 3IC7A 4IQ4A 2RNGA 3O6BB 2DFEA 2PLYA 2CUEA 2DOFA 2QSFX 2EJRA 2LLKA 2VXZA 3WTYC 1ZH5A 4LOCA 1H9TA 2HDCA 5LHGA 3TOAA 1CGPA 2L5QA 2DU9A 2YUSA 4MO7A 3K6GA 4A3DJ 2BHYA 4OAYA 2KDOA 2R5YA 3ESWB 4GYGA 1RESA 1T33A 2KL4A 5E20A 2KT0A 5FROA 1A5JA 3QKXA 1S3JA 3DBLB 1ZR2A 2D5VA 4UB8C 1UHMA 2VQHA 3W2WA 4JBAA 5A2QK 3AL0B 3K8PC 4AVZA 1P4WA 1MBHA 3GFIA 1LEBA 1XSXA 4RAGA 4X0GA 3I58A 2HYGD 2NX4A 1IF1A 3CCRI 1OYWA 1MBGA 3DU5A 1IG7A 1HSJA 3GVAA 1LE8A 3HGGA 3FZVA 5KVRA 5GAHJ 1SEUA 1LDJA 2XAJA 3MQ0A 3TW6A 4ZYDA 3N97A 4GFKA 5FGMA 3ABMH 3O8HA 3ZMZA 2MD5A 2H09A 4LD5A 2XPVA 2OUMA 3AFHA 1Q1HA 2R7UA 1MBKA 2NAZA 3BG3A 4OIRF 2EZLA 2HVSA 3HXLA 4XBFA 2AXTC 1LEAA 4MNUA 5DM7F 2W1OA 2DT6A 4I98B 5BQTA 5IYDJ 2XAFA 5K5OA 5KHDA 1EV7A 3MKWB 2Q1ZB 1QHGA 4M6YA 2D1VA 4XRFA 5ERIA 4Y7NJ 3RZDJ 2DDAA 5EJCA 2TRTA 2R7ZJ 3NEUA 4BJTA 2L01A 3IKTA 4MLOA 2V6EA 1U5TC 2JVHA 3BROA 4U9NA 3I53A 2UWMA 2HQAA 2QCOA 4G6TB 1YG2A 1SFUA 2O6GE 5M3FJ 1W36C 3VFZA 4WXCA 2NVTJ 4ZDLA 1XCBA 3ZOBA 1VQ4I 5E1XA 2OTLI 4LK0F 1U78A 3DPJA 2CRGA 1G4DA 3L2QA 4JX5A 3ASOH 4C3IJ 2FJI1 1U8RA 2JA6J 2HZDA 3HJEA 3FISA 1WJCA 5H9TA 4KYWA 4ICHA 5D8KB 3M3YJ 4ENNA 5JHUA 3FM5A 4CCMA 2YX4A 1J59A 5HLHA 1YJNI 2JMWA 4NQWB 3JTGA 3ABKH 5FO5A 1I27A 1MJBA 3OYJA 2JRMA 2JJ7A 1DPRA 1G3WA 3QWLA 4LGWA 4XOPA 1UCRA 4DIQA 1U2WA 4A3MJ 2A5YB 3SDBA 2E34A 5F27A 3OS1A 4AIJA 2LYCA 4GO1A 3L2VA 1ERDA 2JPBA 3IUVA 4OMYA 1ETOA 3CJRB 2VL8A 1IGNA 1ZG3A 4ZYHA 2JUCA 2BY2A 1VQ5I 4CYDA 1RRJA 1FIPA 4LB6B 2Q2EB 3ZGKA 3BWGA 2DA3A 2HDWA 3HPGA 2F4IA 4BYYA 4BBSJ 2O0YA 3GTJJ 4ENMA 2Y2ZA 4B48A 3KZ9A 1YS6A 1TWAJ 1MH3A 2P6SA 3B6CA 5JVGF 1XMXA 2PBXA 4XONA 1R36A 1ETVA 1R00A 1R1VA 1D3YA 2HI3A 1UG0A 3HB9A 3VYUB 1P7IA 4K2EA 4XM3A 5DYMA 3TO7A 4XN0A 4GDFA 3AQTA 4BL0B 3COLA 4X6AJ 2L9SA 2RQQA 2X6OA 3CUQC 3DU6A 3H3VK 3LSIA 1XSVA 1HBXG 1YJ9I 5F64A 3E1SA 1Z7UA 1S72I 2E2JJ 1HXDA 2HKXA 2Z3YA 4IX7A 3J7AO 3EDPA 4ZYGA 4ZZLA 2QUFA 1SANA 2YS9A 4DJAA 2DQLA 3HOYJ 2L9NA 4XL9A 2MC4A 2Z99A 4MQ9F 3RYPA 4V19K 1DP3A 1LKXA 4HW0A 1F1ZA 1PYVA 2FU4A 4WF2A 5D4SA 3CRJA 3V4GA 3R0JA 2OF7A 2E2HJ 4OD4A 2ZJQF 4BGDA 1YTYA 1NG6A 2GOMA 4EATA 3CCUI 3ML6A 4A0YA 1T38A 2XHKA 5L3GA 4UHTA 2DFHA 5KNLA 1FYKA 4OOIA 3OYBA 3LHQA 2WBMA 2M9HA 4A2UA 3B73A 4GCVA 3HBLA 1HW5A 2BW3B 4MIMA 1B6AA 4F92B 3S17J 2BV6A 3K4MA 3G3ZA 3G56A 2BVLA 5GP9A 2M0MA 1H88C 1W5CC 5LRRA 1OCOH 1G3TA 2A61A 1BR1A 2QENA 3E6MA 1LFUP 3GTOJ 3F8NA 2KIUA 3CLOA 1MH4A 3KYDB 4F52A 5C4XJ 3F6VA 1B72A 2P8TA 1LUJB 5F1RA 3EYYA 4BEHB 2NNYA 4IHTA 2QOPA 4XIDA 1ZARA 2ISZA 5IT9Z 5C4YA 2JSCA 5LEKA 2ECCA 3PNYA 4N4NB 5BMZA 4GFLA 3BR0A 2W85A 4WXDA 5HDNA 1EH6A 2K3FA 2EILH 3CJDA 1WZ2A 2UZKA 1XN7A 2GAUA 3S2WA 3QYEA 3DEUA 1IRXA 4BHCA 2GXBA 1MDMA 4YZEA 2W57A 1PVEA 2YVXA 4GXOA 4YRVA 2CMPA
chains in the Genus database with same CATH topology
3ZQHA 1U8BA 2EZKA 3JRCA 3VIBA 5FHPA 1S7EA 4A3GJ 3DEWA 2AO9A 2XRLA 3HGYA 2OI8A 5M5WJ 2Y30A 3RH2A 1JTXA 1W0TA 2VUMJ 2K40A 3GTPJ 4C3JJ 1I3QJ 2DA2A 4W97A 5K58A 1WPKA 3BQYA 1FJLA 2NVYJ 4AYBN 1B8IB 1WH5A 2F07A 3HOWJ 1U9OA 1MSEC 9ANTA 2K9SA 4FISA 3JRGA 3A03A 1I50J 4IHWA 1WGXA 3S1QJ 1R9TJ 4XRSA 2M0CA 1JUMA 2CJJA 3HDDA 4DW6A 5E3OA 1JKOC 2E2IJ 1BW6A 1D5YA 1QVUA 3K2AA 3I4NJ 3TEDA 4JNNA 1AKHA 5E3LA 4M6VA 4RDUA 3NNRA 2UXIA 4A3FJ 2XSDC 4ACIA 5F0HA 3BNIA 2L7ZA 2O9LA 3VOXA 5M3MJ 4AUXA 5CXIA 4NDLA 5EGOA 2ZOZA 4B1RA 5EG0B 1JT0A 3S1NJ 1IDZA 2RHAA 3I4MJ 1IDYA 4JKZA 4A69C 2MW8A 1GV2A 5EGOB 1LFBA 3CCYA 3VVYA 3TP0A 5FLMJ 2L7FP 4DZPA 4PXIA 2G0EA 4GFBA 4MFEA 1FIAA 3HM5A 3OSGA 2V57A 3KKCA 4JL3A 4IHVA 2G3BA 1RKWA 4JP0A 2JA5J 3JRIA 5EEAA 4D5CA 3S15J 2HOTA 1UG2A 3BQZA 3AQSA 4EEFG 2UXUA 2GFNA 1UI6A 2LVSA 3NAUA 1HOMA 1RETA 3UKGA 2E19A 1XG1A 1VF9A 3BTCA 3EUPA 5AQCA 4A3EJ 3PO3J 1IRZA 2HOAA 1JTYA 1TWGJ 1OCPA 2K9NA 2Y9YA 4NN1A 3VOKA 1P7JA 4GCKA 5IPAA 2UXPA 2LR8A 2LY9A 3G7RA 3O60A 2EZHA 2YVEA 1MBJA 4XRMA 3DCFA 3LSJA 3BR6A 4MXMA 4GCTA 2P81A 4V2FA 1OCTC 3S14J 1T56A 2XB0X 3HOXJ 4FE7A 1K83J 4FCYA 3S2DJ 2UXOA 3SFIA 3ANPA 4I76A 1ZR4A 3L1PA 4M3DA 4D7NA 2XPWA 2QWTA 2VI6A 5FKNA 3HE0A 5IYCJ 5FKKA 4GCLA 1POGA 4NELA 2DTZA 2DA4A 2MSYA 2RAEA 1JT6A 1JKPC 1RPWA 3MKLA 5IOYA 5EF6A 5FKOA 5E3MA 4RBOA 3JRHA 3VP5A 5D1RA 3JR9A 3Q3SA 2QF7A 4IEJA 2LD5A 2KDZA 3VW1A 3ANGA 2QIBA 2CUFA 4QTRA 4A3KJ 3S1MJ 2XGEA 2ZB9A 2DA1A 2JK3A 2XGCA 3BTJA 3JSJA 2I10A 2L9RA 3HTHA 1NK3P 3GTMJ 4W1UA 4D7MA 1GDTA 3C2BA 4DYQA 2H8RA 2X48A 1HCRA 1QRYA 1Z77A 2DMNA 2YU9J 5IOZA 4BKXA 2GUHA 2ZOYA 1ZTRA 2X9DA 1ETQA 4UUSA 3JREA 2ME6A 2H1KA 4B4CA 4L5EA 4A93J 2PZ9A 3HKZN 2QKOA 3ZQCA 3A01B 4KWAA 3CMYA 1X2MA 2FQ4A 4UUSB 3LWJA 4A3IJ 1NTCA 5D18A 4HKUA 5HBUA 3IH4A 3TW7A 2XGDA 3V78A 3IV5A 5J1RA 2UXHA 1WCMJ 2XDNA 2OPTA 5IYBJ 4A3CJ 2M2EA 1ETXA 3Q0VA 1DU0A 2M34A 1TWHJ 2HYTA 2HXOA 3OSFA 2NVQJ 4D5FA 2ID3A 3BHQA 3K7AJ 2WV1A 3HOZJ 5EZHA 1B8IA 2ECBA 3VW0A 5C3EJ 3RZOJ 4BXXJ 4AC0A 1VNDA 2G7GA 3G1OA 4XRSG 3MN2A 3GTQJ 2QTQA 5IP6A 4XICA 3D1NI 4MK6A 3BR3A 3FK6A 3ZQFA 3BR2A 3S1RJ 4CYCA 1H89C 3GTGJ 2ID6A 2D6YA 2NS7A 1BW5A 2EQRA 3LSGA 3HTJA 2NS8A 1TWFJ 2ZCXA 3PASA 1JUPA 1O4XA 4M3GA 2M8GX 1JGGA 3JRDA 1K61A 2AHQA 2VKVA 3ZQIA 4A3BJ 1BJZA 2DG7A 5FMPA 4L62A 3S2HJ 4BBRJ 1FEXA 1ORKA 3HOVJ 3T6NA 4M3FA 1X58A 5DAJA 1AKHB 4UUTA 2NP5A 3S16J 3PPBA 3WHBA 2VKEA 3C07A 4Y52J 2CUEA 2OERA 2LLKA 4IHXA 2WUIA 3BR5A 4JX4A 3MNLA 1ZGWA 3LNQA 3QBMA 5M5XJ 3KNWA 3TP3A 2IU5A 4DYCA 3HEFA 4LOCA 1H8AC 1ETKA 3JRBA 2Y9ZA 3F1BA 1MBEA 2YUSA 4MO7A 3BG5A 3B81A 2E1OA 2Y0SN 5FJ8J 3KKDA 4A3DJ 2R5YA 3NXCA 1RESA 1U9NA 2ELKA 3WHCA 3IH3A 1VFCA 3VVZA 1T33A 1SFOJ 2KT0A 1A5JA 3QKXA 1ZK8A 2COBA 5HAWA 1ZR2A 1UI5A 2D5VA 4X1EA 5EYRA 3LOCA 3HTIA 3SDGA 1MBHA 2DMPA 1FTZA 2FD5A 2CQXA 5EDNA 3NRGA 1JJ6C 2NX4A 3ON4A 5CXGA 3JRFA 1MBGA 1B72B 4ABZA 3GTLJ 1XS9A 1IG7A 3BCGA 3VVXA 2JWTA 1LE8A 3HGGA 3JRAA 1HLVA 1BL0A 3MVPA 1JKRC 3QPSA 2DMTA 3EGQA 3FRQA 4HNVA 3V6GA 3TW6A 2MG4A 1APLC 3E7LA 5FKLA 1LE8B 4GFKA 1HDDC 3O8HA 1RR7A 3HTAA 2HXIA 4ME9A 3GEUA 2XPVA 5J1YA 2K9QA 3RQIA 4AC6A 1MBKA 3BTIA 3BG3A 2EZLA 3ZQGA 4QIWN 2GLOA 1PUFA 3GZIA 3M4OJ 1MSFC 2W53A 1A6IA 4S0HB 5IYDJ 2R92J 1OJLA 2R93J 2Y31A 5EFYA 1ENHA 3BT9A 4Y7NJ 3RZDJ 3O8GA 3P9TA 1DU6A 3BR1A 2G7LA 2MGQA 2LFBA 2TRTA 2NVXJ 1Y1WJ 2R7ZJ 4BY7J 4IHYA 2HQ5A 4FTHA 2DG8A 2O7OA 4MLOA 2ZCMA 5HODA 2CQQA 1G2HA 2R5ZB 2QCOA 2JA7J 2EBIA 1QVTA 5F04A 5DTDA 2DA5A 5C44J 4CYCB 5M3FJ 1F36A 2WAQN 2XPUA 1HDPA 2NVTJ 2L0KA 3ZOBA 5EG0A 1U78A 2R5ZA 3DPJA 2CRGA 5DS9A 4JX5A 4C3IJ 2JA6J 3FIWA 2ZCNA 3FISA 4C2MJ 5H9TA 1EF4A 2G7SA 4ICHA 3M3YJ 5FKMA 2GENA 4DZJA 2O7TA 2JMWA 5FLVA 3VPRA 2Q24A 5FGLA 4G12A 5GPCA 2JJ7A 2VPRA 2R5YB 3A01A 2DA7A 1MNMC 4A3MJ 2GM4A 1Z0XA 4C3HJ 5F27A 4I6ZA 2TCTA 3BTLA 2LK2A 2JA8J 3F0CA 3QPLA 3BRUA 1QPIA 1UHSA 2JN6A 2FX0A 3IUVA 4BY1J 2EZIA 1ETOA 3GBGA 3VW2A 2XB5A 1IGNA 1IUFA 3OIOA 4AF5A 2ME0A 2NP3A 1FIPA 2DA3A 1W0UA 1ETYA 4BBSJ 3NPIA 2REKA 5EZGA 4JX6A 3GTJJ 5C4JJ 2Y2ZA 1UMQA 3KZ9A 4M3EA 3NI7A 3E7QA 1TWAJ 1MH3A 3B6CA 3ON2A 3FK7A 5J1UA 2IBDA 2HDDA 2PBXA 1ZQ3P 3IH2A 3QQAA 2YVHA 2WGBA 1ETVA 1F43A 1OFCX 3GTKJ 2HKUA 2HI3A 3HB9A 5D19A 2R0QC 1P7IA 3FKIJ 1E3OC 3HIMA 3AQTA 5E3NA 3COLA 4X6AJ 2RASA 3RD3A 1TWCJ 2X6OA 3H3VK 1IJWC 1YRNA 1FTTA 4J19A 3H0GJ 5CW8A 3LJLA 2E2JJ 2GBYA 1YRNB 2DMUA 4JYKA 1SANA 2L7MP 2YS9A 1TC3C 1HF0A 3HOYJ 1VI0A 1AU7A 5F08A 1WH7A 1CQTA 3A02A 2IEKA 2FJ1A 3PM1A 3SJMA 3Q0WA 4QSHA 2HOSA 3Q0UA 3CRJA 1NK2P 2OF7A 1Y1VJ 5GPAA 1IV6A 2E2HJ 4A3LJ 1SGMA 5F1JA 4MFDA 2EH3A 3BG9A 4XK4A 1AHDP 1PUFB 2PMZN 4FE4A 1JUSA 1WI3A 3LHQA 4CGRA 2M9HA 3VUQA 3HBLA 1GV5A 3S5RA 5J3LA 2WB1N 4MIMA 5F0CA 3LSPA 1XC5A 5M5YJ 3NARA 4A3JJ 2N8GA 3B6AA 3S17J 3G1LA 1ETWA 5JLWA 4UDSA 1I6HJ 1GT0C 3G56A 5GP9A 1BA5A 1H88C 3HOUJ 3RKQA 1GVDA 2CU7A 4V2GA 2LKXA 3CDLA 2LP0A 5F0FA 5K7ZA 4M3BA 1LFUP 1JJ8C 2LTPA 1ITYA 3GTOJ 1MH4A 5IP7J 5IP9J 5C4XJ 2IAIA 1GUUA 4DYRA 3ZQLA 1B72A 2O8KA 4B3AA 2DA6A 2DMQA 2QOPA 4XIDA 2FBQA 3OOUA 5C4YA 5JLXA 1ZKGA 2DJNA 2ECCA 2DN0A 2W48A 4GFLA 3BR0A 2NOGA 3BJBA 3CJDA 5K7FA 3CWRA 1IC8A 3G1MA 5BNGA 1JKQC 2B63J 5K7HA 3LSRA 2HYJA 1Q1VA 4YZEA 3W6VA 5HSZA 1MBFA 3CQZJ 3PO2J 1X2NA 1RKTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZQH A;  1U8B A;  2EZK A;  3JRC A;  3VIB A;  5FHP A;  1S7E A;  4A3G J;  3DEW A;  2AO9 A;  2XRL A;  3HGY A;  2OI8 A;  5M5W J;  2Y30 A;  3RH2 A;  1JTX A;  1W0T A;  2VUM J;  2K40 A;  3GTP J;  4C3J J;  1I3Q J;  2DA2 A;  4W97 A;  5K58 A;  1WPK A;  3BQY A;  1FJL A;  2NVY J;  4AYB N;  1B8I B;  1WH5 A;  2F07 A;  3HOW J;  1U9O A;  1MSE C;  9ANT A;  2K9S A;  4FIS A;  3JRG A;  3A03 A;  1I50 J;  4IHW A;  1WGX A;  3S1Q J;  1R9T J;  4XRS A;  2M0C A;  1JUM A;  2CJJ A;  3HDD A;  4DW6 A;  5E3O A;  1JKO C;  2E2I J;  1BW6 A;  1D5Y A;  1QVU A;  3K2A A;  3I4N J;  3TED A;  4JNN A;  1AKH A;  5E3L A;  4M6V A;  4RDU A;  3NNR A;  2UXI A;  4A3F J;  2XSD C;  4ACI A;  5F0H A;  3BNI A;  2L7Z A;  2O9L A;  3VOX A;  5M3M J;  4AUX A;  5CXI A;  4NDL A;  5EGO A;  2ZOZ A;  4B1R A;  5EG0 B;  1JT0 A;  3S1N J;  1IDZ A;  2RHA A;  3I4M J;  1IDY A;  4JKZ A;  4A69 C;  2MW8 A;  1GV2 A;  5EGO B;  1LFB A;  3CCY A;  3VVY A;  3TP0 A;  5FLM J;  2L7F P;  4DZP A;  4PXI A;  2G0E A;  4GFB A;  4MFE A;  1FIA A;  3HM5 A;  3OSG A;  2V57 A;  3KKC A;  4JL3 A;  4IHV A;  2G3B A;  1RKW A;  4JP0 A;  2JA5 J;  3JRI A;  5EEA A;  4D5C A;  3S15 J;  2HOT A;  1UG2 A;  3BQZ A;  3AQS A;  4EEF G;  2UXU A;  2GFN A;  1UI6 A;  2LVS A;  3NAU A;  1HOM A;  1RET A;  3UKG A;  2E19 A;  1XG1 A;  1VF9 A;  3BTC A;  3EUP A;  5AQC A;  4A3E J;  3PO3 J;  1IRZ A;  2HOA A;  1JTY A;  1TWG J;  1OCP A;  2K9N A;  2Y9Y A;  4NN1 A;  3VOK A;  1P7J A;  4GCK A;  5IPA A;  2UXP A;  2LR8 A;  2LY9 A;  3G7R A;  3O60 A;  2EZH A;  2YVE A;  1MBJ A;  4XRM A;  3DCF A;  3LSJ A;  3BR6 A;  4MXM A;  4GCT A;  2P81 A;  4V2F A;  1OCT C;  3S14 J;  1T56 A;  2XB0 X;  3HOX J;  4FE7 A;  1K83 J;  4FCY A;  3S2D J;  2UXO A;  3SFI A;  3ANP A;  4I76 A;  1ZR4 A;  3L1P A;  4M3D A;  4D7N A;  2XPW A;  2QWT A;  2VI6 A;  5FKN A;  3HE0 A;  5IYC J;  5FKK A;  4GCL A;  1POG A;  4NEL A;  2DTZ A;  2DA4 A;  2MSY A;  2RAE A;  1JT6 A;  1JKP C;  1RPW A;  3MKL A;  5IOY A;  5EF6 A;  5FKO A;  5E3M A;  4RBO A;  3JRH A;  3VP5 A;  5D1R A;  3JR9 A;  3Q3S A;  2QF7 A;  4IEJ A;  2LD5 A;  2KDZ A;  3VW1 A;  3ANG A;  2QIB A;  2CUF A;  4QTR A;  4A3K J;  3S1M J;  2XGE A;  2ZB9 A;  2DA1 A;  2JK3 A;  2XGC A;  3BTJ A;  3JSJ A;  2I10 A;  2L9R A;  3HTH A;  1NK3 P;  3GTM J;  4W1U A;  4D7M A;  1GDT A;  3C2B A;  4DYQ A;  2H8R A;  2X48 A;  1HCR A;  1QRY A;  1Z77 A;  2DMN A;  2YU9 J;  5IOZ A;  4BKX A;  2GUH A;  2ZOY A;  1ZTR A;  2X9D A;  1ETQ A;  4UUS A;  3JRE A;  2ME6 A;  2H1K A;  4B4C A;  4L5E A;  4A93 J;  2PZ9 A;  3HKZ N;  2QKO A;  3ZQC A;  3A01 B;  4KWA A;  3CMY A;  1X2M A;  2FQ4 A;  4UUS B;  3LWJ A;  4A3I J;  1NTC A;  5D18 A;  4HKU A;  5HBU A;  3IH4 A;  3TW7 A;  2XGD A;  3V78 A;  3IV5 A;  5J1R A;  2UXH A;  1WCM J;  2XDN A;  2OPT A;  5IYB J;  4A3C J;  2M2E A;  1ETX A;  3Q0V A;  1DU0 A;  2M34 A;  1TWH J;  2HYT A;  2HXO A;  3OSF A;  2NVQ J;  4D5F A;  2ID3 A;  3BHQ A;  3K7A J;  2WV1 A;  3HOZ J;  5EZH A;  1B8I A;  2ECB A;  3VW0 A;  5C3E J;  3RZO J;  4BXX J;  4AC0 A;  1VND A;  2G7G A;  3G1O A;  4XRS G;  3MN2 A;  3GTQ J;  2QTQ A;  5IP6 A;  4XIC A;  3D1N I;  4MK6 A;  3BR3 A;  3FK6 A;  3ZQF A;  3BR2 A;  3S1R J;  4CYC A;  1H89 C;  3GTG J;  2ID6 A;  2D6Y A;  2NS7 A;  1BW5 A;  2EQR A;  3LSG A;  3HTJ A;  2NS8 A;  1TWF J;  2ZCX A;  3PAS A;  1JUP A;  1O4X A;  4M3G A;  2M8G X;  1JGG A;  3JRD A;  1K61 A;  2AHQ A;  2VKV A;  3ZQI A;  4A3B J;  1BJZ A;  2DG7 A;  5FMP A;  4L62 A;  3S2H J;  4BBR J;  1FEX A;  1ORK A;  3HOV J;  3T6N A;  4M3F A;  1X58 A;  5DAJ A;  1AKH B;  4UUT A;  2NP5 A;  3S16 J;  3PPB A;  3WHB A;  2VKE A;  3C07 A;  4Y52 J;  2CUE A;  2OER A;  2LLK A;  4IHX A;  2WUI A;  3BR5 A;  4JX4 A;  3MNL A;  1ZGW A;  3LNQ A;  3QBM A;  5M5X J;  3KNW A;  3TP3 A;  2IU5 A;  4DYC A;  3HEF A;  4LOC A;  1H8A C;  1ETK A;  3JRB A;  2Y9Z A;  3F1B A;  1MBE A;  2YUS A;  4MO7 A;  3BG5 A;  3B81 A;  2E1O A;  2Y0S N;  5FJ8 J;  3KKD A;  4A3D J;  2R5Y A;  3NXC A;  1RES A;  1U9N A;  2ELK A;  3WHC A;  3IH3 A;  1VFC A;  3VVZ A;  1T33 A;  1SFO J;  2KT0 A;  1A5J A;  3QKX A;  1ZK8 A;  2COB A;  5HAW A;  1ZR2 A;  1UI5 A;  2D5V A;  4X1E A;  5EYR A;  3LOC A;  3HTI A;  3SDG A;  1MBH A;  2DMP A;  1FTZ A;  2FD5 A;  2CQX A;  5EDN A;  3NRG A;  1JJ6 C;  2NX4 A;  3ON4 A;  5CXG A;  3JRF A;  1MBG A;  1B72 B;  4ABZ A;  3GTL J;  1XS9 A;  1IG7 A;  3BCG A;  3VVX A;  2JWT A;  1LE8 A;  3HGG A;  3JRA A;  1HLV A;  1BL0 A;  3MVP A;  1JKR C;  3QPS A;  2DMT A;  3EGQ A;  3FRQ A;  4HNV A;  3V6G A;  3TW6 A;  2MG4 A;  1APL C;  3E7L A;  5FKL A;  1LE8 B;  4GFK A;  1HDD C;  3O8H A;  1RR7 A;  3HTA A;  2HXI A;  4ME9 A;  3GEU A;  2XPV A;  5J1Y A;  2K9Q A;  3RQI A;  4AC6 A;  1MBK A;  3BTI A;  3BG3 A;  2EZL A;  3ZQG A;  4QIW N;  2GLO A;  1PUF A;  3GZI A;  3M4O J;  1MSF C;  2W53 A;  1A6I A;  4S0H B;  5IYD J;  2R92 J;  1OJL A;  2R93 J;  2Y31 A;  5EFY A;  1ENH A;  3BT9 A;  4Y7N J;  3RZD J;  3O8G A;  3P9T A;  1DU6 A;  3BR1 A;  2G7L A;  2MGQ A;  2LFB A;  2TRT A;  2NVX J;  1Y1W J;  2R7Z J;  4BY7 J;  4IHY A;  2HQ5 A;  4FTH A;  2DG8 A;  2O7O A;  4MLO A;  2ZCM A;  5HOD A;  2CQQ A;  1G2H A;  2R5Z B;  2QCO A;  2JA7 J;  2EBI A;  1QVT A;  5F04 A;  5DTD A;  2DA5 A;  5C44 J;  4CYC B;  5M3F J;  1F36 A;  2WAQ N;  2XPU A;  1HDP A;  2NVT J;  2L0K A;  3ZOB A;  5EG0 A;  1U78 A;  2R5Z A;  3DPJ A;  2CRG A;  5DS9 A;  4JX5 A;  4C3I J;  2JA6 J;  3FIW A;  2ZCN A;  3FIS A;  4C2M J;  5H9T A;  1EF4 A;  2G7S A;  4ICH A;  3M3Y J;  5FKM A;  2GEN A;  4DZJ A;  2O7T A;  2JMW A;  5FLV A;  3VPR A;  2Q24 A;  5FGL A;  4G12 A;  5GPC A;  2JJ7 A;  2VPR A;  2R5Y B;  3A01 A;  2DA7 A;  1MNM C;  4A3M J;  2GM4 A;  1Z0X A;  4C3H J;  5F27 A;  4I6Z A;  2TCT A;  3BTL A;  2LK2 A;  2JA8 J;  3F0C A;  3QPL A;  3BRU A;  1QPI A;  1UHS A;  2JN6 A;  2FX0 A;  3IUV A;  4BY1 J;  2EZI A;  1ETO A;  3GBG A;  3VW2 A;  2XB5 A;  1IGN A;  1IUF A;  3OIO A;  4AF5 A;  2ME0 A;  2NP3 A;  1FIP A;  2DA3 A;  1W0U A;  1ETY A;  4BBS J;  3NPI A;  2REK A;  5EZG A;  4JX6 A;  3GTJ J;  5C4J J;  2Y2Z A;  1UMQ A;  3KZ9 A;  4M3E A;  3NI7 A;  3E7Q A;  1TWA J;  1MH3 A;  3B6C A;  3ON2 A;  3FK7 A;  5J1U A;  2IBD A;  2HDD A;  2PBX A;  1ZQ3 P;  3IH2 A;  3QQA A;  2YVH A;  2WGB A;  1ETV A;  1F43 A;  1OFC X;  3GTK J;  2HKU A;  2HI3 A;  3HB9 A;  5D19 A;  2R0Q C;  1P7I A;  3FKI J;  1E3O C;  3HIM A;  3AQT A;  5E3N A;  3COL A;  4X6A J;  2RAS A;  3RD3 A;  1TWC J;  2X6O A;  3H3V K;  1IJW C;  1YRN A;  1FTT A;  4J19 A;  3H0G J;  5CW8 A;  3LJL A;  2E2J J;  2GBY A;  1YRN B;  2DMU A;  4JYK A;  1SAN A;  2L7M P;  2YS9 A;  1TC3 C;  1HF0 A;  3HOY J;  1VI0 A;  1AU7 A;  5F08 A;  1WH7 A;  1CQT A;  3A02 A;  2IEK A;  2FJ1 A;  3PM1 A;  3SJM A;  3Q0W A;  4QSH A;  2HOS A;  3Q0U A;  3CRJ A;  1NK2 P;  2OF7 A;  1Y1V J;  5GPA A;  1IV6 A;  2E2H J;  4A3L J;  1SGM A;  5F1J A;  4MFD A;  2EH3 A;  3BG9 A;  4XK4 A;  1AHD P;  1PUF B;  2PMZ N;  4FE4 A;  1JUS A;  1WI3 A;  3LHQ A;  4CGR A;  2M9H A;  3VUQ A;  3HBL A;  1GV5 A;  3S5R A;  5J3L A;  2WB1 N;  4MIM A;  5F0C A;  3LSP A;  1XC5 A;  5M5Y J;  3NAR A;  4A3J J;  2N8G A;  3B6A A;  3S17 J;  3G1L A;  1ETW A;  5JLW A;  4UDS A;  1I6H J;  1GT0 C;  3G56 A;  5GP9 A;  1BA5 A;  1H88 C;  3HOU J;  3RKQ A;  1GVD A;  2CU7 A;  4V2G A;  2LKX A;  3CDL A;  2LP0 A;  5F0F A;  5K7Z A;  4M3B A;  1LFU P;  1JJ8 C;  2LTP A;  1ITY A;  3GTO J;  1MH4 A;  5IP7 J;  5IP9 J;  5C4X J;  2IAI A;  1GUU A;  4DYR A;  3ZQL A;  1B72 A;  2O8K A;  4B3A A;  2DA6 A;  2DMQ A;  2QOP A;  4XID A;  2FBQ A;  3OOU A;  5C4Y A;  5JLX A;  1ZKG A;  2DJN A;  2ECC A;  2DN0 A;  2W48 A;  4GFL A;  3BR0 A;  2NOG A;  3BJB A;  3CJD A;  5K7F A;  3CWR A;  1IC8 A;  3G1M A;  5BNG A;  1JKQ C;  2B63 J;  5K7H A;  3LSR A;  2HYJ A;  1Q1V A;  4YZE A;  3W6V A;  5HSZ A;  1MBF A;  3CQZ J;  3PO2 J;  1X2N A;  1RKT A; 
#chains in the Genus database with same CATH topology
 1P92 A;  2Z33 A;  3J7Z I;  3VIB A;  1R49 A;  1SMT A;  2HKO A;  4LJZ F;  4XLA A;  3SXY A;  5FRM A;  4KIG A;  5M5W J;  2EV6 A;  1J0R A;  2KZG A;  2VUM J;  3GTP J;  3OYA A;  4W97 A;  2V26 A;  3F8M A;  1F9N A;  2ICW G;  4AYB N;  3WTT C;  1HST A;  1WH5 A;  2IA2 A;  4HBL A;  3E3V A;  1SD4 A;  4BQQ A;  4L9N A;  3J7Y J;  2K85 A;  5EEG A;  3L7W A;  3P9K A;  9ANT A;  5DCM B;  4CDG A;  3CJQ B;  1FZP B;  4IHW A;  2ZY9 A;  3MZY A;  4RM3 A;  1Z3Y A;  3KP2 A;  3U2R A;  2CJJ A;  4G6Q A;  4DW6 A;  1D5Y A;  1QVU A;  1BIA A;  3K2A A;  3I4N J;  4Y17 A;  2ESN A;  3SWH A;  2HZT A;  1BJA A;  4HEA 2;  2GA2 A;  4EJU A;  4RDU A;  1Z05 A;  5F0H A;  1QHH D;  2CQN A;  4RAZ A;  4U0W A;  1VQM I;  2WB1 A;  3S1N J;  3OIP A;  4XKC A;  1JHH A;  2LC2 A;  3P9C A;  5ILU A;  4A69 C;  1GV2 A;  2JZY A;  2W82 A;  1LFB A;  4I0B A;  4PUS A;  2ZJ2 A;  4KJZ A;  3KLN A;  1R4M B;  5TGT A;  3HG9 A;  4KMU X;  4GFB A;  1BI2 A;  3HM5 A;  2DXI A;  2CUJ A;  2JPC A;  4AVP A;  2G3B A;  5F6F A;  2JA5 J;  4Q5S F;  3FKJ A;  3K9T A;  2CYY A;  4EEF G;  2RVC A;  2A05 A;  3L2U A;  1UI6 A;  4KN4 X;  5DV5 A;  4QLC U;  2HVR A;  5FLX K;  1HOM A;  3R0A A;  5CVV A;  1UEL B;  2E19 A;  3BC8 A;  1XG1 A;  3RPU D;  1VF9 A;  4NQW A;  2XKP A;  4A3E J;  1J5Y A;  1IRZ A;  2EIN H;  3TL4 X;  5K1Y A;  1JTY A;  1TWG J;  2K9N A;  4UVC A;  4NN1 A;  5H2F C;  1XDS A;  4JK1 X;  2BVM A;  2M45 A;  2WAQ A;  4GCK A;  3SZP A;  4AM3 A;  5IPA A;  1TW3 A;  2MLK A;  2LY9 A;  3O60 A;  2F4O B;  4EQQ A;  2EZH A;  1OYY A;  4A6E A;  3JTH A;  5FD6 A;  3H0D A;  3S8P A;  2YVE A;  2E1M B;  3ERE D;  5TJJ A;  1Z7L A;  3G71 I;  2HYF A;  2P81 A;  2Z2S B;  4RGX A;  3TDZ C;  2QQ8 A;  1P2F A;  1R1T A;  2OC6 A;  2QM3 A;  2OJE D;  2R7D A;  2E7X A;  3SFI A;  1UHW A;  2HR3 A;  2VXD A;  4M3D A;  5FD5 A;  2HEO A;  2F4M B;  2M3A A;  5J47 A;  2KMU A;  1W5T A;  2M7B A;  1QA6 A;  1DGR M;  2VC0 A;  1JT6 A;  1A36 A;  2DW4 A;  4MEY F;  3GYH X;  5FKO A;  5TRD A;  3R6S A;  3OYM A;  4CCO A;  3JR9 A;  3PNV A;  4PJ0 C;  2QF7 A;  3LSH A;  3ZMV A;  2B9S A;  1R5I D;  1TQM A;  1R4N B;  2QIB A;  2CUF A;  3KE2 A;  3DTI A;  3DLL F;  3CUO A;  2L9R A;  1NK3 P;  2XRO A;  3DF8 A;  2AQF A;  1MMN A;  2V1X A;  4CZZ A;  1GDT A;  4BAC A;  4DYQ A;  4F91 B;  2X48 A;  1D1B A;  5D5U B;  4G7H F;  3TO9 A;  4BE2 A;  1GVJ A;  4I09 A;  1QRY A;  3MEX A;  2YU9 J;  5E1W A;  2ZOY A;  1WJB A;  4PJL A;  4XOR A;  5J40 A;  1WFX A;  3ECO A;  2X9D A;  4JQF A;  1T98 A;  4LLG F;  3JRE A;  2ME6 A;  1ONV A;  2PZ9 A;  2QKO A;  1T95 A;  1V55 H;  5D5W B;  4XSZ F;  2JA2 A;  2STT A;  2ZFW A;  3SEZ A;  3C7J A;  1NTC A;  5D18 A;  1YW7 A;  3BPV A;  3CO7 C;  4A0Z A;  1YHQ I;  4LMY A;  3PSI A;  3DXJ F;  3IV5 A;  5J1R A;  2VIX A;  2UXH A;  3F8C A;  3K70 C;  4OIQ F;  2G7H A;  3DKY A;  2M2E A;  2X4H A;  4R79 A;  3J80 K;  3Q0V A;  5B5E C;  3VTI A;  3I54 A;  1FC3 A;  3M9A A;  2DLL A;  2PBI A;  2NVQ J;  1MNE A;  3K0L A;  4CO8 A;  3OMY A;  1FYM A;  1V5G A;  2LSO A;  1T39 A;  5EZH A;  1B8I A;  1REP C;  2KIM A;  3FWE A;  2FML A;  3K4C A;  1G3S A;  3V7R A;  2OV7 A;  3LL7 A;  3G1O A;  1UJ8 A;  1W7P A;  3VOD A;  2NVU B;  1LQ1 A;  5E1Z B;  3SHF A;  5IP6 A;  3D1N I;  2DT5 A;  3CMA I;  2V6C A;  3FK6 A;  4WWC A;  3S1R J;  1KYZ A;  2B3W A;  4GGG A;  4IF4 A;  2D6Y A;  3BZ6 A;  4HQE A;  2NS8 A;  1BOB A;  1TWF J;  1NH3 A;  1K4S A;  3JAM Z;  1HKS A;  1LDD A;  1V5E A;  3I0T A;  3ZQI A;  1TT0 A;  2JUG A;  5J4V A;  1J7K A;  2QLZ A;  4L18 B;  4F93 B;  3S2H J;  4AWX B;  1MMS A;  3HOV J;  3T6N A;  4CXF A;  3CDI A;  1EH8 A;  4EM2 A;  2RRE A;  3AG1 H;  1P6R A;  3DKX A;  3OYD A;  3KIO A;  4IO9 F;  2R7S A;  1D0X A;  2KLO A;  2Y69 H;  1BOA A;  4HRI A;  4AYB A;  2VKE A;  3C07 A;  2HTJ A;  4XLF A;  5CJ9 A;  4Y52 J;  3KCC A;  2UV1 A;  3ERM A;  4YIR X;  4IHX A;  1QO0 D;  1U5T B;  2QQ9 A;  3BR5 A;  4HX7 A;  4IQJ A;  3ABL H;  3MNL A;  3FM3 A;  5L3F A;  3LNQ A;  3KNW A;  3TP3 A;  2LRE A;  2XGX A;  1H8A C;  2DDB A;  3CP8 A;  3JRB A;  3RPQ A;  4HF2 A;  1MBE A;  2FE3 A;  3PFY A;  3BG5 A;  2IW5 A;  2Y0S N;  5FJ8 J;  3F22 A;  3FHN A;  2W7N A;  4U87 A;  2ELK A;  3WHC A;  2VOO A;  3IH3 A;  2R7F A;  3NRV A;  5HAW A;  1SMY F;  2COB A;  2LF8 A;  4B3X A;  1N78 A;  2VBY A;  1ZLJ A;  1FYL A;  4M74 A;  3HTI A;  2DJI A;  3R61 A;  5JR3 A;  3KZI C;  2X1E A;  4N9I A;  5BS6 A;  5CXG A;  4LIT A;  1B72 B;  2DAO A;  3VEP A;  4ABZ A;  1XS9 A;  4MQV A;  2JWT A;  3JRA A;  3SEQ A;  1HLV A;  1BL0 A;  3BJ6 A;  1JKR C;  3QPS A;  2DMT A;  3EGQ A;  1QQI A;  2JQ7 A;  2ACJ A;  3V6G A;  2MG4 A;  1JXS A;  1APL C;  5L3B A;  3E7L A;  2MAB A;  2PX9 A;  2QVO A;  3KZY A;  4N4O B;  3ZPL A;  2O03 A;  4BE0 A;  1E2X A;  1RR7 A;  3KPH A;  1YFH A;  2GIV A;  4ME9 A;  1P9Q C;  1T6S A;  5JFR A;  5J1Y A;  3LSM A;  2I5U A;  4FAS D;  2XAS A;  3ONQ A;  5D5X B;  4AC6 A;  3BTI A;  1W7P B;  1ZAO A;  2G7U A;  4HV5 A;  4II3 A;  3UNG C;  4KIT B;  4YG2 F;  2ZJR F;  1RUO A;  4DVY P;  4QIW N;  3RSN A;  2BGC A;  1MSF C;  5J8F A;  1DP7 P;  3KX2 A;  2R92 J;  2R93 J;  4HNT A;  1XGM A;  1UST A;  2LBF A;  5HLT A;  1X3U A;  3MCZ A;  3Q5F A;  2CV0 A;  2O3F A;  2LFB A;  4Y4R A;  2NVX J;  2XAQ A;  3OR1 C;  2DYR H;  2HQ5 A;  4B43 A;  4OIN F;  2VJI A;  2ZCM A;  3QYB A;  2CQQ A;  3K1M A;  2DBB A;  1G2H A;  3OYI A;  3QU3 A;  3S3M A;  2EBI A;  3ZXS A;  5DTD A;  3GEU A;  3GLL A;  3F23 A;  2WAQ N;  2XPU A;  2LF7 A;  4D9J A;  3HUG A;  1J9I A;  2CQK A;  3IWF A;  1B9M A;  5CVJ A;  3OOP A;  4XMY A;  1OIS A;  5DS9 A;  1QNT A;  3FIW A;  2Z9O A;  4C2M J;  1STZ A;  2QZ8 A;  1EF4 A;  2G7S A;  5FKM A;  2YPR A;  3BJO A;  3M07 A;  2O7T A;  4HX8 A;  1QZY A;  1E0E A;  1O3Q A;  5FGL A;  2AXL A;  2R5Y B;  1SC7 A;  3A01 A;  4XN3 A;  3I9V 2;  1MNM C;  3ISP A;  2GM4 A;  2IA0 A;  2TCT A;  3QPL A;  4EJV A;  1UHS A;  2JN6 A;  2FX0 A;  1QPI A;  3GLX A;  2XB5 A;  1FMW A;  2WWY A;  1IUF A;  5HDK A;  3OY9 A;  3QP5 A;  1USS A;  3OIO A;  4HV6 A;  4XLE A;  3ULQ B;  3DBH B;  4L0Z B;  4AF5 A;  2JT1 A;  3K10 A;  4UVB A;  3SZG A;  3OS2 A;  4E7H A;  4KFC A;  1JI8 A;  1UMQ A;  3OYG A;  3NI7 A;  1W5S A;  1KU3 A;  5GAG J;  4F7Z A;  3H3U A;  3HHH A;  4WIB A;  2IBD A;  2HDD A;  5H6R A;  3IH2 A;  2YVH A;  2WGB A;  3VB2 A;  1IO2 A;  4NHJ A;  4FQG A;  1XGS A;  4XLC A;  2H27 A;  3RQ4 A;  3KEO A;  2HKU A;  4QWQ A;  4MTE A;  1E3O C;  2K27 A;  2EIM H;  3ABT A;  3HIM A;  4JNN A;  3K4L A;  1Z91 A;  4ANJ A;  3EYI A;  4CIC A;  4CUG A;  4G7Z F;  4R1H A;  2E5Z A;  3CCQ I;  3NWS A;  2EIJ H;  4KIC A;  1Z9C A;  2H6B A;  4BXF A;  3FXR A;  3GFM A;  1NG7 A;  3IKV A;  3C2H A;  1ON2 A;  1YRN B;  2PJP A;  4Q48 A;  4JYK A;  2L7M P;  3EQL F;  3LFK A;  4M9Z A;  4G6D A;  4LLL A;  3F21 A;  1AU7 A;  1Y0U A;  5F08 A;  5H6Q A;  1A04 A;  2HOS A;  1LFP A;  3L00 A;  4CCL A;  3E0J B;  4XKV A;  3RKY A;  1KA8 A;  4LB5 A;  4YEJ A;  2UXX A;  2ZXW H;  4BNC A;  4EM1 A;  4U7B A;  1JUS A;  5FFZ A;  1KQ8 A;  2PI0 A;  3F8F A;  3PUB A;  1WJA A;  1ZRF A;  3S5R A;  2EB7 A;  2WB1 N;  1F43 A;  5JLW A;  2QEX I;  5DDG A;  4UDS A;  2H94 A;  2EFO A;  2V1N A;  4OWR B;  5CPR B;  5LBQ A;  3LAP A;  2V9K A;  5FFX A;  3FXM A;  3CDL A;  5K7Z A;  5E8G A;  1VQO I;  2HTS A;  1R1U A;  2A68 F;  4M3B A;  3PL8 A;  1U5T A;  4F55 A;  1B1B A;  2I8D A;  1QU3 A;  2WY7 Q;  2XIG A;  3WTX C;  2EPF A;  2V1U A;  4BAY A;  4DYR A;  3ZQL A;  1OCZ H;  3ECH A;  4PCQ A;  1WJD A;  1WRJ A;  2FBQ A;  3OOU A;  4I2O A;  5JLX A;  2B0L A;  5KAI C;  5LLQ A;  2X6X A;  3BJB A;  1S6L A;  1HW1 A;  5K7F A;  4L9J A;  4BQA A;  3L09 A;  3CWR A;  1LNW A;  1WWX A;  4FET A;  2HYJ A;  2Y75 A;  1Q1V A;  1S8N A;  4NNJ A;  1EJ9 A;  2VE9 A;  3CD6 I;  1MBF A;  3CQZ J;  2A3S A;  1X2N A;  2MC3 A;  2MBF A;  1QZZ A;  1RKT A;  3DBR B;  4XRS G;  3ZQH A;  3EUK L;  2K86 A;  4A3G J;  3DEW A;  2XRL A;  3CF2 A;  4BUP A;  4M6X A;  2Y30 A;  4LLN A;  4UY8 I;  4E7I A;  4IPA A;  1T08 B;  5K58 A;  1WPK A;  3L9F A;  1UAA A;  3HKZ A;  1RNL A;  5L3D A;  2KRH A;  2CS3 A;  3VOE A;  3HIF A;  4A0X A;  3WGI A;  1I6X A;  3SFZ A;  1Y39 A;  2VOP A;  2KFD A;  2KP6 A;  1U9O A;  2FF4 A;  1XSD A;  2K9S A;  4FIS A;  2CSO A;  5ILS A;  3PUF A;  1HC8 A;  4DGW B;  3I55 I;  3S1Q J;  1R9T J;  4HG2 A;  2M0C A;  1JUM A;  2DTR A;  3HDD A;  3WU2 C;  1JKO C;  1BW6 A;  2B7E A;  3GWZ A;  1AKH A;  1R23 A;  4HAM A;  4M6V A;  3MKZ A;  1IXS B;  3HSE A;  2XC7 A;  3OYK A;  2BXZ A;  3H5N A;  4PSX A;  1D8K A;  2EFW A;  2LBF B;  4AUX A;  1X1P A;  1YX3 A;  2IS1 A;  2BBY A;  4NDL A;  5EGO A;  1L3L A;  1F5T A;  2ZOZ A;  5EG0 B;  3CME I;  5DD4 A;  3IUO A;  1P4X A;  2L4M A;  4JKZ A;  2FRH A;  2MW8 A;  3GW2 A;  3CCY A;  3ROU A;  1CF7 B;  3VVY A;  3S93 A;  1RC9 A;  1BC8 C;  2HVQ A;  2RN7 A;  2F5F A;  2W25 A;  2MA3 A;  3U1D A;  4MFE A;  4DQ2 A;  3ZCO A;  1DDN A;  4AID A;  3RI4 A;  3OSG A;  2R7Q A;  2PMH A;  1RKW A;  4AD9 A;  3WTW C;  3JRI A;  3CCJ I;  4E4H A;  2GFN A;  3GZ6 A;  4WX9 A;  1IUY A;  2ZSH B;  2LVS A;  3NAU A;  4P5O A;  1RET A;  1V54 H;  1Y8R B;  3AG4 H;  3WU1 B;  4LG0 B;  3BTC A;  3PO3 J;  5JVT A;  2XSJ C;  3CUQ B;  2PN6 A;  3LST A;  2HOA A;  1X1A A;  2GA1 A;  1MMG A;  2LH9 A;  1P7J A;  2L02 A;  3DTK A;  2QQA A;  1FSE A;  3P9I A;  1B4A A;  3I4P A;  1ULY A;  1H0M A;  3K1P A;  3BG6 A;  2M87 A;  2IVM A;  4Y15 A;  4XRM A;  3A0B C;  3DCF A;  4I7H A;  3K2Z A;  3ZR8 X;  2E71 A;  4GCT A;  2VJJ A;  4V2F A;  1AA7 A;  2HQN A;  3S14 J;  1T56 A;  2FMY A;  4ZYA A;  1L0O C;  5ICF A;  2RDP A;  4FE7 A;  1O7F A;  3S2D J;  4A12 A;  2MLG A;  2UXO A;  1FWZ A;  3ANP A;  1H9G A;  1ZR4 A;  2R7X A;  2Z5U A;  4CA0 A;  3IL2 A;  2DFF A;  2QWW A;  2FNP A;  2QWT A;  2FBI A;  4RGU A;  3LA7 A;  1N75 A;  3PIP F;  1S7A A;  5FKK A;  4GCL A;  4QPQ A;  1MJ9 A;  2DTZ A;  2VON A;  1MD0 A;  2R4G A;  3CC7 I;  2DCE A;  3LQR A;  1PP7 U;  1WVR A;  3MKL A;  3K4B A;  4H4K C;  2VBX A;  3FMS A;  1VTN C;  1XMK A;  3TOB A;  3W6J B;  2LY1 A;  4CH7 A;  4OD5 A;  3DTE A;  2CH0 A;  3W2V A;  3ZMU A;  2LD5 A;  3AAF A;  1ZG1 A;  1D5V A;  1R7J A;  3JSJ A;  2DA1 A;  2XGC A;  2PJR A;  4Q4Z F;  4P55 A;  4W1U A;  2VBW A;  3RKX A;  1CF7 A;  3H3Z A;  5E8I A;  1HCR A;  3CJT B;  2DMN A;  4AU7 A;  1AWC A;  4HPQ A;  1PP8 F;  3A2K A;  1ZTR A;  4UUS A;  2DI3 A;  2Y48 A;  3FXQ A;  4ESB A;  4B4C A;  1DQU A;  4A93 J;  1IN7 A;  2KPM A;  3A01 B;  3CMY A;  1X2M A;  4U9L A;  1TP4 A;  2X51 A;  2Q0O A;  2K4J A;  1TZL A;  1SVM A;  1TQP A;  1ZLK A;  2ZXI A;  2Y0S A;  2XGD A;  5HNH A;  2QSG X;  4MHG A;  3W3C A;  1WCM J;  5CQE A;  3OYH A;  1ZRC A;  2CQ7 A;  2XVC A;  5IYB J;  2CFO A;  1LVA A;  5IT9 K;  1XDU A;  1DU0 A;  2M34 A;  2GXG A;  2ISY A;  2X1D A;  3M7G A;  4PZJ A;  2STW A;  3CUQ A;  2OCE A;  3BHQ A;  3OYE A;  5ICE A;  2D2W A;  3F6O A;  4HSR A;  3F9K A;  2Q2E A;  3BJA A;  3RZO J;  2XAH A;  2CG4 A;  3GTQ J;  5DCM A;  2ZKZ A;  3WGH A;  2DYS H;  3QRF F;  2P6T A;  3GFL A;  3TKY A;  4II2 A;  5HOO A;  1QZE A;  4MK6 A;  2J5P A;  3BR3 A;  2K4B A;  4CYC A;  2ID6 A;  4XLP F;  3CCS I;  4ZJZ A;  2CV1 A;  2IA1 A;  2HPI A;  3HTU A;  3CCV I;  4Z2Y A;  3LSG A;  3WG7 H;  3C3W A;  4RB2 C;  4OIO F;  1K78 A;  2ZCX A;  1O4X A;  4Y13 A;  2M8G X;  2XF7 A;  3JRD A;  2P0W A;  2VKV A;  1VZ0 A;  2WY8 Q;  5DUK A;  3K69 A;  1C0W A;  4A3B J;  2DG7 A;  5FB2 A;  4IRI A;  2ZNY A;  4I0A A;  1QBJ A;  4M3F A;  4RB3 C;  1X58 A;  4UUT A;  2FA5 A;  4GYI A;  4A5M A;  1JHF A;  3WHB A;  4C2M A;  4YFK F;  3WTS C;  2OQR A;  4BS9 A;  2WUI A;  2NOJ B;  2OZ6 A;  1ZEL A;  5M5X J;  3QBM A;  3MWM A;  4DYC A;  5CYV A;  1SFX A;  2VKH A;  4L5I A;  4XNF A;  2DPD A;  2Y9Z A;  3F1B A;  1XD7 A;  1VQ6 I;  2OA4 A;  3E6D A;  4IKF A;  1W7P D;  3B81 A;  2F48 A;  2E1O A;  3A4C A;  3KKD A;  4L9V A;  2VJ5 A;  3VWB A;  2NRA C;  2DPU A;  2HNH A;  3D5L A;  3M1E A;  1SFO J;  1ZGJ A;  1GLN A;  1ZK8 A;  2G9W A;  1HA8 A;  2DO7 A;  3J81 K;  1FNN A;  4X1E A;  2WA0 A;  2RC4 A;  5EYR A;  1QPM A;  1RZ4 A;  1O57 A;  2ZNZ A;  2DMP A;  3SDG A;  1FTZ A;  2OD5 A;  3J7A Y;  3ON4 A;  2FBK A;  1LVK A;  1FOY A;  2ELH A;  3JRF A;  1T8I A;  2HFH A;  3WE2 A;  3BCG A;  3H1C A;  4Y3O A;  6PAX A;  2XKO A;  3VVX A;  4UVA A;  4ESF A;  1T2K A;  3OYF A;  2BE5 F;  1MDM B;  3FRQ A;  2VQG A;  1JGS A;  3BP8 A;  1LE8 B;  2VAS A;  1HDD C;  1FMV A;  3QPT A;  3OL3 A;  4KIB A;  2OAZ A;  3F72 A;  4IOA F;  5H20 A;  3QU6 A;  4FX4 A;  2K9Q A;  2QKM B;  3ZQ7 A;  1EA3 A;  4ASN A;  2K7L A;  2ETH A;  2E60 A;  1PUF A;  1IRG A;  3GZI A;  3M4O J;  5LFA A;  1A6I A;  1YOV B;  4S0H B;  2XDV A;  3TDU C;  4EVI A;  1JE8 A;  2Y31 A;  2YX7 A;  2BHZ A;  3V8K A;  4RGR A;  5DD8 A;  3BT9 A;  2F5V A;  5GAE J;  1B59 A;  3HC7 A;  2DOD A;  2G7L A;  3BR1 A;  3P9T A;  2O5R A;  5CQG A;  4BY7 J;  4IHY A;  4BHB A;  2QSH X;  2DG8 A;  2YR2 A;  1X4P A;  2WV0 A;  1TNS A;  5BPD A;  3O2P E;  1QVT A;  5F04 A;  3I71 A;  1FPQ A;  5C44 J;  3K4J A;  1IV6 A;  1X1D A;  4EGZ A;  4IRV A;  2L0K A;  4NC8 A;  2R5Z A;  4LIV A;  4EMS A;  4EJW A;  3OV8 A;  3SYT A;  1U3E M;  2E36 A;  4E7K A;  2IS6 A;  4P1W A;  3SQN A;  4YII A;  2W24 A;  2L2O A;  1XMA A;  3KEY A;  1KZH A;  4QPO A;  5FLV A;  4RAF A;  2Q24 A;  5GTH C;  1DPU A;  1FY7 A;  4G12 A;  1SD5 A;  5GPC A;  2DA7 A;  4HNU A;  4C3H J;  3BTL A;  2LK2 A;  2JA8 J;  3BG7 A;  3REO A;  3BRU A;  4U7D A;  4XSX F;  4H0E A;  3CLQ A;  2EZI A;  1K7A A;  2RKH A;  3VW2 A;  5HDG A;  2M1B A;  3CP2 A;  4GRI A;  4BXU A;  1MMD A;  4M73 A;  4MTD A;  3RPU A;  2NP3 A;  1UB9 A;  4RMN A;  1ACI A;  1W0U A;  1ETY A;  1BIB A;  3NPI A;  5EZG A;  1OKR A;  4JX6 A;  4BH9 A;  5C4J J;  3E7Q A;  2GIZ A;  2KRF A;  1U6G A;  4G94 A;  5J1U A;  3QQA A;  2UXN A;  1X19 A;  5J8C A;  3ASN H;  2ZO4 A;  2FSW A;  2BY0 A;  2IT0 A;  1E17 A;  5D19 A;  4R8H A;  2V4J C;  3FKI J;  5KCM A;  1EH7 A;  4CCJ A;  5E3N A;  2DOE A;  1OYI A;  4D1Q A;  2RAS A;  4UNO A;  1TWC J;  2OQG A;  2WAE A;  1IJW C;  1YRN A;  1FTT A;  5BOX A;  4HF1 A;  3H0G J;  2MYS A;  1X3Z B;  2GBY A;  3GUD A;  1DGW Y;  2LDU A;  1FBS A;  4BDZ A;  4MEX F;  1Z67 A;  1TC3 C;  2ZFU A;  5K5R A;  3P5J A;  3DP7 A;  3KLO A;  5LHH A;  3M8J A;  1MMA A;  1VI0 A;  3IP4 B;  1WH7 A;  2WTE A;  3A02 A;  2IEK A;  1LB2 A;  3PM1 A;  3SJM A;  3Q0W A;  3DPT A;  1OMI A;  2HOE A;  5HLI A;  3IHU A;  1YW9 A;  1Y1V J;  4P96 A;  5GPA A;  5L3C A;  2A2F X;  1SGM A;  3E6C C;  4A3L J;  4KIF A;  2EH3 A;  2JVG A;  3BG9 A;  3F8B A;  4XK4 A;  2H1L A;  4M71 A;  3VDX A;  3G4S I;  2PMZ N;  5D5V B;  3ZN0 A;  1WI3 A;  4BDY A;  4ZDO A;  1D0Z A;  3E5U A;  1GV5 A;  3HRU A;  5J3L A;  4A3J J;  3LSP A;  1XC5 A;  3FF5 A;  2KJB A;  2IPQ X;  3L2C A;  1MGT A;  1BA5 A;  3HOU J;  3RKQ A;  1GVD A;  2CU7 A;  4NBQ A;  4I01 A;  3LA2 A;  5D6E A;  2LP0 A;  2W00 A;  2V7F A;  3LFU A;  4RGS A;  5B1A H;  5L3E A;  2ESH A;  1JJ8 C;  2LTP A;  2M5W A;  3BY6 A;  1LPQ A;  3ABU A;  2CW0 F;  1PDN C;  5IP7 J;  5LGT A;  5IP9 J;  2Z1D A;  3AL0 C;  2IAI A;  1GUU A;  3HZJ A;  5E79 C;  1IW7 F;  3KYC B;  3GME A;  2GOX B;  2DA6 A;  1OCC H;  3VSK A;  2FUG 2;  3LWF A;  2W48 A;  3WOD F;  2NOG A;  3U9G A;  3FXK A;  3GEZ A;  3U21 A;  2W4S A;  3LQQ A;  5ICG A;  2P5L C;  1RI7 A;  1KQ9 A;  1A31 A;  5BNG A;  1JKQ C;  2B63 J;  5K7H A;  4FT8 A;  5A2Q Z;  4PGH A;  1YLF A;  3W6V A;  2ZSI B;  1G8X A;  2R7O A;  4CYC B;  2EZK A;  2M4G A;  3EUH A;  3GXO A;  4IJA A;  4PJN A;  1HW2 A;  2COM A;  3HGY A;  1R5G A;  2OI8 A;  3RH2 A;  1W0T A;  1O3R A;  2K40 A;  2XV4 S;  4ON0 A;  2FOK A;  4CCK A;  4M9S A;  3BQY A;  1FJL A;  3CO6 C;  2NVY J;  4RLQ A;  3ELK A;  2K9M A;  4A3K J;  4EGY A;  2F07 A;  3HOW J;  3I3L A;  4DBR A;  1WJF A;  1LDK B;  2M7A A;  3KP7 A;  3JRG A;  3A1Y A;  3A03 A;  4CCN A;  4BQN A;  2OU2 A;  4XRS A;  3WTU C;  2IS4 A;  5DAJ A;  3FXO A;  2JSP A;  1VQ9 I;  3BPX A;  1OLT A;  2IGK A;  3HOS A;  2QKL B;  1MW7 A;  3NNR A;  1F4K A;  2UXI A;  3PIO F;  1P4A A;  4PGG A;  1FOW A;  2XSD C;  4ACI A;  3DFG A;  1X3W B;  2V9V A;  1EKE A;  1K6Y A;  4ZH4 F;  2RGV A;  1BC7 C;  5M3M J;  1OPC A;  1Y0N A;  5B3S H;  1W1W E;  4MGR A;  4C9Y A;  4B1R A;  1IDZ A;  1N25 A;  4IXA A;  2QYO A;  3I4M J;  1IDY A;  3TGN A;  2QA4 I;  2R7T A;  2QBY A;  3TP0 A;  3ZRG A;  1VQ8 I;  4PFO A;  4LK1 F;  2G0E A;  3KEQ A;  3PNT A;  3VYS B;  4C2T A;  2EWN A;  2H8W A;  2LKP A;  2V57 A;  3D5R C;  3PQJ A;  1WSU A;  4IHV A;  3WTZ A;  2NYX A;  3CDH A;  4YFX F;  5GTI C;  1BBY A;  5EEA A;  1UG2 A;  1XGN A;  3BQZ A;  3KFW X;  1D1C A;  4LG0 A;  3WE3 A;  4E70 A;  2UXU A;  2LG4 A;  3AG2 H;  3AQS A;  1SVO A;  3DKW A;  3V42 A;  1FBU A;  3T8R A;  2KJC A;  3UKG A;  4RB1 A;  2IRF G;  1GHC A;  1V3F A;  2KRC A;  3B02 A;  3EUP A;  5GAD J;  4HF0 A;  3VOK A;  4EJO A;  3KP3 A;  3FMQ A;  1SFE A;  4ZTF A;  2B1E A;  3KP4 A;  3ZMT A;  4CZC A;  2UXP A;  3G7R A;  3CJN A;  4RLF A;  1A35 A;  1BM9 A;  1MBJ A;  2XUB A;  2MFZ A;  4HDV A;  1QGP A;  4EM0 B;  1UZC A;  1IZ1 A;  1IN5 A;  1R58 A;  4G8X A;  4O6J A;  1W36 D;  3G73 A;  3QPH A;  1K83 J;  4PDK A;  4FCY A;  1FOK A;  4XLH A;  3S3O A;  2X1C A;  4I76 A;  3TO6 A;  4OAZ A;  3L1P A;  3OYL A;  2EFN A;  4D7N A;  4B8X A;  3K4N A;  2XPW A;  4BU2 A;  1MZB A;  2ZC2 A;  5FKN A;  3HE0 A;  1Z3X A;  2A5W A;  1POG A;  5E17 F;  3WG9 A;  4NEL A;  3OWT A;  3GZN B;  1D8J A;  1VQP I;  5IOY A;  5E3M A;  4RBO A;  3KET A;  3GFJ A;  3JRH A;  3VP5 A;  3H36 A;  4FX0 A;  2IGM A;  2A6H F;  3C2G A;  2HQR A;  1T0F C;  2A07 F;  3ANG A;  4QTR A;  3JCU C;  2EA4 A;  3K70 D;  2XGE A;  2ZBK A;  2ZB9 A;  2JK3 A;  2XF5 A;  3BTJ A;  2R7W A;  2ZJP F;  3S1M J;  1WJ5 A;  3GTM J;  4NC7 A;  4D7M A;  3V8L A;  2O8X A;  1R6R A;  1FOX A;  2PFV A;  2LNB A;  4E7L A;  5IOZ A;  3V7C A;  2GUH A;  1D0Y A;  3EPZ A;  1FP2 A;  3I64 A;  5DCF A;  4FHT A;  3PFI A;  1ETQ A;  1YS7 A;  2KZV A;  2H1K A;  4N0B A;  4ITV A;  4YEL A;  3HKZ N;  1YE9 A;  4KWA A;  3EUA A;  1HKT A;  4XR6 A;  3LWJ A;  4B47 A;  2VQL A;  4U0V A;  3HRS A;  4LG3 A;  1BI3 A;  2L4A A;  4OMZ A;  3TW7 A;  2X6W A;  1BN5 A;  3W6K B;  2KIF A;  1XTA A;  4TV7 A;  3M8E A;  5ED4 A;  3JAM K;  2ADU A;  2P4W A;  3AKZ A;  3R4K A;  4S05 A;  2EV5 A;  2CW8 A;  5E18 F;  2EV0 A;  3D5S C;  1TWH J;  2HXO A;  2AQE A;  3HRT A;  3OSF A;  3RJP A;  3QAH A;  4D5F A;  3ZN1 A;  1S29 A;  3X2Q H;  3K7A J;  2EFQ A;  2HS5 A;  2WV1 A;  3HOZ J;  1IN8 A;  2VOD A;  2ECB A;  1J2X A;  3VW0 A;  5C3E J;  3OS0 A;  3FHZ A;  3I5U A;  4BXX J;  4AC0 A;  4YFN F;  3GCM A;  2BEO A;  2G7G A;  3BLY A;  2QTQ A;  5HLG A;  4HOB A;  4XIC A;  4C30 A;  3BR2 A;  2FOW A;  4XKB A;  4RS8 A;  1H89 C;  4IVN A;  1V4R A;  3MMY B;  5DEQ A;  3HTJ A;  1ZN2 A;  2LOO A;  3PAS A;  2JTV A;  1IAW A;  2DFI A;  2F5C A;  1JGG A;  2AHQ A;  5CVI A;  5FMP A;  3RIR A;  4L62 A;  4U88 A;  4B44 A;  1I39 A;  1YW8 A;  4BBR J;  3VSL A;  4S04 A;  1N77 A;  1FEX A;  5CKT A;  4CSW A;  1FLI A;  3GF2 A;  4KMF A;  2CFX A;  3EET A;  2EA2 A;  3T0Y A;  2PMZ A;  3DV8 A;  3LA3 A;  1KON A;  1BR2 A;  1MJA A;  1G3Y A;  2VKD A;  4XLN F;  4ZTJ A;  1Z1D A;  4J00 A;  2OER A;  2FQ3 A;  4JX4 A;  4ZDP A;  3SZT A;  3QOP A;  1ZGW A;  4CHU A;  2IU5 A;  3IAM 2;  3EUH C;  3HEF A;  4F3Q A;  1YO5 C;  3FXJ A;  4AIK A;  1ETK A;  3IRQ A;  2FBH A;  3CCM I;  2PFB A;  1IXC A;  3OL4 A;  5AON A;  4AIH A;  3TQN A;  3NXC A;  3DLA A;  4UV9 A;  2LMD A;  3CMM A;  1U9N A;  3VVZ A;  1VFC A;  1ZYR F;  2D1H A;  4HYE A;  4RB0 A;  2CWE A;  4XQF A;  4JOM A;  3QOE A;  4O3M A;  1UI5 A;  4ZZD A;  1I1S A;  4HQM A;  3BOQ A;  3RYR A;  2E1N A;  1MND A;  3LOC A;  4NB5 A;  3Q9V A;  2BYV E;  4KN7 X;  2NXN B;  3FXL A;  2FD5 A;  2EIK H;  4E7S A;  1S9H A;  2CQX A;  3ZMS A;  3RKW A;  5EDN A;  1JJ6 C;  2HPM A;  3NRG A;  2P7V B;  1XB4 A;  3GTL J;  2IXS A;  3NWT A;  1FT9 A;  2IGN A;  3MVP A;  2NNN A;  1OR7 A;  3O3K A;  4M9X A;  1XPX A;  2YU3 A;  1LJ9 A;  2F2E A;  4HNV A;  2CV2 A;  2R3S A;  1XGO A;  5FKL A;  4KT5 C;  4UB6 C;  1TBX A;  2ZME A;  3HTA A;  2HXI A;  1B9N A;  2VT3 A;  4WXH A;  4BJ6 C;  3RQI A;  3CCE I;  2FEZ A;  2M4K A;  3ZQG A;  2GLO A;  1M1E B;  3JW4 A;  5D4R A;  4ZC3 A;  5HS9 A;  2W53 A;  4L5J A;  2C6Y A;  3KZZ A;  1RR8 C;  1OJL A;  1U0J A;  3E97 A;  3WGG A;  3I59 A;  2MH2 A;  1OCR H;  5EFY A;  1ENH A;  1TTY A;  2M30 A;  1RIO H;  3O8G A;  4Q47 A;  1DU6 A;  2ZCW A;  2MGQ A;  3PJR A;  1Y1W J;  3QYF A;  4FTH A;  1Y56 A;  1G59 A;  2O7O A;  2VJ4 A;  3HPH A;  2K02 A;  5HOD A;  1IXR C;  1D1A A;  3L2R A;  2BY3 A;  2K9L A;  2R5Z B;  1K79 A;  4BQO A;  3GO5 A;  2JA7 J;  4P9U A;  2LKS A;  2DA5 A;  3IWZ A;  1F36 A;  1HDP A;  1ZHF A;  3JSP A;  5EG0 A;  2ZXH A;  1YQA A;  4G7O F;  3BZK A;  4L9T A;  2GQQ A;  3KP6 A;  4I99 C;  1WQ2 A;  3BDD A;  3DPL C;  1UFM A;  2ZCN A;  1G6N A;  3E5Q A;  2XAU A;  3BZC A;  3TBI A;  2GEN A;  2ZXJ A;  4DZJ A;  1X1C A;  1GXQ A;  4HX4 A;  3VPR A;  2ELJ A;  1IV8 A;  2VPR A;  1Z0X A;  4I6Z A;  4N9H A;  4Y33 A;  1RUN A;  3F0C A;  2RV8 A;  5HS7 A;  2LY2 A;  4BY1 J;  3GBG A;  4HLX A;  3WU0 A;  5LRS A;  5LGN A;  5KK1 A;  3OYC A;  2XAG A;  3BCB A;  2IGO A;  4PK4 A;  4IOC F;  2ME0 A;  4DOZ A;  4EV0 A;  4EJT A;  4E6K G;  4NC6 A;  4RA2 A;  5FRN A;  2REK A;  1R5H A;  1VQK I;  4M3E A;  3FX3 A;  3UR3 C;  1TL8 A;  1K4T A;  4WK8 F;  3ON2 A;  3FK7 A;  3H92 A;  1ZQ3 P;  1R71 A;  2GZW A;  2DT7 B;  5KAF C;  1W4M A;  5CVU A;  2E1M C;  1OFC X;  2UUZ A;  1O3S A;  2VB6 A;  3GTK J;  3FXU A;  1KU2 A;  1K78 B;  4HST A;  3A0H C;  1Z6R A;  2X6Y A;  3E5X A;  2R0Q C;  2WAF A;  3DQV C;  4P9F A;  2DOA A;  4DNC A;  4A5N A;  3RD3 A;  3J80 Z;  3KYL A;  3H5A A;  5HVQ C;  3E6B A;  4J19 A;  5CW8 A;  3W2A A;  3LJL A;  3JSO A;  5LHI A;  4HZF A;  3N05 A;  2WC2 A;  1XX5 A;  3C1D A;  2DMU A;  2KHM A;  1FX7 A;  1Z6T A;  2VLA A;  4PSW A;  3HRM A;  2A6T A;  4UUV A;  3ZMD A;  1HF0 A;  4A6D A;  3OR2 C;  3J81 Z;  1BR4 A;  2CO5 A;  1CQT A;  3H35 A;  2FJ1 A;  2KIS A;  1XCV A;  1Y6I A;  4PFP A;  3NS4 A;  4QSH A;  3Q0U A;  3AG3 H;  4RM2 A;  3PO2 J;  1NK2 P;  3VYR B;  2TDX A;  2YSR A;  5F1J A;  3VYT B;  4MFD A;  2VQC A;  1AOY A;  2OBP A;  1AHD P;  1PUF B;  2P7C B;  3HHG A;  4WCG A;  2DK5 A;  4LIU A;  4FE4 A;  1WI9 A;  4CGR A;  4BHP A;  3VUQ A;  4RAY A;  2LRD A;  1YX5 A;  5F0C A;  1ZRD A;  5M5Y J;  3NAR A;  2IP2 A;  2N8G A;  3B6A A;  3L2W A;  3G1L A;  1ETW A;  4M72 A;  2QQB A;  3BCA A;  1I6H J;  2V9P A;  1GT0 C;  2BW3 A;  1WHU A;  3TMO A;  3HYI A;  4V2G A;  2LKX A;  5F0F A;  2GWR A;  1ITY A;  5B66 C;  5DM6 F;  5LEJ A;  3Q9S A;  2GXA A;  1J09 A;  2HGC A;  4D0P A;  4KA4 A;  2R7R A;  1GXP A;  2O8K A;  2DQR A;  5AIQ A;  2VT2 A;  4B3A A;  3CTA A;  2A6E F;  1I3A A;  2DMQ A;  1KGS A;  4ZYE A;  1ZKG A;  2DJN A;  2DN0 A;  4IL6 C;  2XF6 A;  2X85 A;  1X1B A;  3R60 A;  2BOL A;  2KKO A;  2OCC H;  3IAS 2;  2CGP A;  3PSF A;  4XOT A;  1IC8 A;  3G1M A;  2X0L A;  3LSR A;  1NHA A;  2L54 A;  5HSZ A;  1ZG5 A;  4HA8 A;  2ZME C;  1SD6 A;  2CW7 A;  1YI2 I;  1U8B A;  3JRC A;  2RQP A;  1VQL I;  5FHP A;  4ETS A;  1S7E A;  2OTJ I;  2AO9 A;  4ENJ A;  2BZT A;  1JTX A;  1WJE A;  4C3J J;  1I3Q J;  2DA2 A;  2J5O A;  3H9Q A;  1B8I B;  3CC2 I;  1KQ0 A;  2BY1 A;  5CLS A;  3RDI A;  4E7Z A;  1Z21 A;  1MSE C;  1BI0 A;  3RCO A;  2AS5 F;  1I50 J;  3MZH A;  1WGX A;  5E3O A;  5CVR A;  2E2I J;  2IS2 A;  3FMR A;  1FBQ A;  3TED A;  1R22 A;  1ZRE A;  5DUI A;  3S3N A;  2W84 A;  4UV8 A;  5TIS C;  4UXN A;  1MIJ A;  1BI1 A;  5E3L A;  2VC1 A;  4KIS A;  4Z6Y A;  4A3F J;  1Y8Q B;  4O5V A;  3BNI A;  2L7Z A;  1O3T A;  2O9L A;  1T0F A;  3F3X A;  4OIP F;  1KU7 A;  2H6C A;  3VOX A;  2E5N A;  3DEE A;  5CXI A;  3MD2 A;  1YJW I;  1JT0 A;  5D8L B;  2PQ8 A;  3LAJ A;  2RHA A;  2Y0M A;  4BJ5 C;  3HSF A;  2JRT A;  5EGO B;  1J75 A;  1TNT A;  3CCL I;  5FLM J;  5D6F A;  1SAU A;  4J01 A;  2L7F P;  1V5F A;  4DZP A;  3IRR A;  4PXI A;  3ZQQ A;  1PUE E;  4PJM A;  2E1C A;  1FIA A;  1IN6 A;  3KKC A;  3G2B A;  3I56 I;  4JL3 A;  1I5Z A;  2ZME B;  4JP0 A;  2PMU A;  3WTV C;  3DWL E;  4D5C A;  4L0Y B;  3S15 J;  2HOT A;  2F5E A;  1VQ7 I;  4ESJ A;  1ON1 A;  1YYV A;  1ZGA A;  4KNY A;  1E3H A;  2K3P A;  5AQC A;  4HLY A;  1OCP A;  2Y9Y A;  1YIO A;  1FP1 D;  3H9G A;  4BE1 A;  3COA C;  3OYN A;  2V1D A;  1YIT I;  1KU9 A;  5K5Q A;  1DUX C;  2LR8 A;  1TW2 A;  3LSJ A;  3BR6 A;  4MXM A;  3U1K A;  1OCT C;  2P5K A;  2XB0 X;  3HOX J;  1HKQ A;  3D0S A;  5JHF A;  1K6O A;  1S7O A;  1X4O A;  3CC4 I;  1TLH B;  2Z16 A;  2KQR A;  4IZZ A;  3LMM A;  3K1N A;  4PJJ A;  4IHS A;  4NUB A;  2E35 A;  4OU0 A;  2VI6 A;  3CZ6 A;  3MAJ A;  1TT5 B;  4IRG A;  5IYC J;  3I59 B;  3M8F A;  4C2U A;  5LGU A;  5ICC A;  2V79 A;  2DA4 A;  2MSY A;  1SFK A;  2QGU A;  2RAE A;  5AIP A;  1JKP C;  2RNJ A;  3T8T A;  2K5C A;  1RPW A;  1ODD A;  5EF6 A;  3MKY B;  2PJR B;  5D1R A;  3MZ8 A;  1TQI A;  3Q3S A;  4IEJ A;  2KDZ A;  3VW1 A;  2HWV A;  2F6C A;  2L7K A;  2R7V A;  1MKM A;  2I10 A;  3HTH A;  5J6X A;  2A69 F;  2PG4 A;  3PQK A;  3C2B A;  2H8R A;  2BXY A;  4G9Y A;  3HL2 A;  3CF5 F;  4KDP A;  1Z77 A;  4U0Y A;  1A6Q A;  4BKX A;  4XKW A;  3M1C A;  2XRN A;  5HNF A;  4B09 A;  1FSH A;  4E7J A;  2QBY B;  4IRH A;  1O7L A;  2P5V A;  3FBN B;  1SVL A;  4L5E A;  5HS8 A;  3ZQC A;  3V7S A;  2D45 A;  2MD0 A;  3T1B A;  3S32 A;  2FQ4 A;  2KIQ A;  3OIQ A;  4UUS B;  1YIJ I;  1HQC A;  2VE8 A;  4A3I J;  3CES A;  4HKU A;  3HOT A;  3QOD A;  2WAD A;  1OQY A;  2MH9 A;  3GZ5 A;  3H9J A;  3IH4 A;  5HBU A;  2CUZ A;  3V78 A;  4KT6 A;  4BEH A;  3N4M A;  3KP5 A;  3K4K A;  2DK8 A;  1SD7 A;  2XDN A;  3P7N A;  2OPT A;  5FLX Z;  4A3C J;  1ETX A;  2OZU A;  2PEX A;  3NQO A;  4KUM A;  2HYT A;  5IY5 H;  1IRF A;  1WKM A;  5J4Y A;  2EFP A;  1OR7 C;  5JI6 A;  3DPU A;  3LSK A;  3T5X A;  2ID3 A;  5BPI A;  2IJL A;  3G6E I;  3GX4 X;  2O61 A;  3HSR A;  5ILV A;  3H5R A;  3QP6 A;  3C18 A;  1VND A;  3FBI B;  2FXA A;  4LFU A;  3MN2 A;  5LD2 C;  3HUG B;  1I1G A;  1KYW A;  1SAX A;  2VPL A;  2FNA A;  4YIF A;  2HU9 A;  2L3D A;  3ZQF A;  3GTG J;  4HDU A;  3MFK A;  4CGZ A;  3RTR A;  2NS7 A;  1BW5 A;  2NS0 A;  2EQR A;  1S5L C;  1JUP A;  4M3G A;  1VQN I;  1K61 A;  2M8E A;  1E3P A;  2Q8K A;  4I02 A;  3V8J A;  5IT3 A;  1BJZ A;  2VBZ A;  4DBQ A;  2F5D A;  2L9V A;  2E7W A;  5B1B H;  1PJR A;  1ORK A;  3ZP5 A;  4ENK A;  5EEH A;  1AKH B;  2EK5 A;  1IN4 A;  2VN2 A;  3FDY A;  2NP5 A;  3HTS B;  3S16 J;  3PPB A;  3IC7 A;  4IQ4 A;  2RNG A;  3O6B B;  2DFE A;  2PLY A;  2CUE A;  2DOF A;  2QSF X;  2EJR A;  2LLK A;  2VXZ A;  3WTY C;  1ZH5 A;  4LOC A;  1H9T A;  2HDC A;  5LHG A;  3TOA A;  1CGP A;  2L5Q A;  2DU9 A;  2YUS A;  4MO7 A;  3K6G A;  4A3D J;  2BHY A;  4OAY A;  2KDO A;  2R5Y A;  3ESW B;  4GYG A;  1RES A;  1T33 A;  2KL4 A;  5E20 A;  2KT0 A;  5FRO A;  1A5J A;  3QKX A;  1S3J A;  3DBL B;  1ZR2 A;  2D5V A;  4UB8 C;  1UHM A;  2VQH A;  3W2W A;  4JBA A;  5A2Q K;  3AL0 B;  3K8P C;  4AVZ A;  1P4W A;  1MBH A;  3GFI A;  1LEB A;  1XSX A;  4RAG A;  4X0G A;  3I58 A;  2HYG D;  2NX4 A;  1IF1 A;  3CCR I;  1OYW A;  1MBG A;  3DU5 A;  1IG7 A;  1HSJ A;  3GVA A;  1LE8 A;  3HGG A;  3FZV A;  5KVR A;  5GAH J;  1SEU A;  1LDJ A;  2XAJ A;  3MQ0 A;  3TW6 A;  4ZYD A;  3N97 A;  4GFK A;  5FGM A;  3ABM H;  3O8H A;  3ZMZ A;  2MD5 A;  2H09 A;  4LD5 A;  2XPV A;  2OUM A;  3AFH A;  1Q1H A;  2R7U A;  1MBK A;  2NAZ A;  3BG3 A;  4OIR F;  2EZL A;  2HVS A;  3HXL A;  4XBF A;  2AXT C;  1LEA A;  4MNU A;  5DM7 F;  2W1O A;  2DT6 A;  4I98 B;  5BQT A;  5IYD J;  2XAF A;  5K5O A;  5KHD A;  1EV7 A;  3MKW B;  2Q1Z B;  1QHG A;  4M6Y A;  2D1V A;  4XRF A;  5ERI A;  4Y7N J;  3RZD J;  2DDA A;  5EJC A;  2TRT A;  2R7Z J;  3NEU A;  4BJT A;  2L01 A;  3IKT A;  4MLO A;  2V6E A;  1U5T C;  2JVH A;  3BRO A;  4U9N A;  3I53 A;  2UWM A;  2HQA A;  2QCO A;  4G6T B;  1YG2 A;  1SFU A;  2O6G E;  5M3F J;  1W36 C;  3VFZ A;  4WXC A;  2NVT J;  4ZDL A;  1XCB A;  3ZOB A;  1VQ4 I;  5E1X A;  2OTL I;  4LK0 F;  1U78 A;  3DPJ A;  2CRG A;  1G4D A;  3L2Q A;  4JX5 A;  3ASO H;  4C3I J;  2FJI 1;  1U8R A;  2JA6 J;  2HZD A;  3HJE A;  3FIS A;  1WJC A;  5H9T A;  4KYW A;  4ICH A;  5D8K B;  3M3Y J;  4ENN A;  5JHU A;  3FM5 A;  4CCM A;  2YX4 A;  1J59 A;  5HLH A;  1YJN I;  2JMW A;  4NQW B;  3JTG A;  3ABK H;  5FO5 A;  1I27 A;  1MJB A;  3OYJ A;  2JRM A;  2JJ7 A;  1DPR A;  1G3W A;  3QWL A;  4LGW A;  4XOP A;  1UCR A;  4DIQ A;  1U2W A;  4A3M J;  2A5Y B;  3SDB A;  2E34 A;  5F27 A;  3OS1 A;  4AIJ A;  2LYC A;  4GO1 A;  3L2V A;  1ERD A;  2JPB A;  3IUV A;  4OMY A;  1ETO A;  3CJR B;  2VL8 A;  1IGN A;  1ZG3 A;  4ZYH A;  2JUC A;  2BY2 A;  1VQ5 I;  4CYD A;  1RRJ A;  1FIP A;  4LB6 B;  2Q2E B;  3ZGK A;  3BWG A;  2DA3 A;  2HDW A;  3HPG A;  2F4I A;  4BYY A;  4BBS J;  2O0Y A;  3GTJ J;  4ENM A;  2Y2Z A;  4B48 A;  3KZ9 A;  1YS6 A;  1TWA J;  1MH3 A;  2P6S A;  3B6C A;  5JVG F;  1XMX A;  2PBX A;  4XON A;  1R36 A;  1ETV A;  1R00 A;  1R1V A;  1D3Y A;  2HI3 A;  1UG0 A;  3HB9 A;  3VYU B;  1P7I A;  4K2E A;  4XM3 A;  5DYM A;  3TO7 A;  4XN0 A;  4GDF A;  3AQT A;  4BL0 B;  3COL A;  4X6A J;  2L9S A;  2RQQ A;  2X6O A;  3CUQ C;  3DU6 A;  3H3V K;  3LSI A;  1XSV A;  1HBX G;  1YJ9 I;  5F64 A;  3E1S A;  1Z7U A;  1S72 I;  2E2J J;  1HXD A;  2HKX A;  2Z3Y A;  4IX7 A;  3J7A O;  3EDP A;  4ZYG A;  4ZZL A;  2QUF A;  1SAN A;  2YS9 A;  4DJA A;  2DQL A;  3HOY J;  2L9N A;  4XL9 A;  2MC4 A;  2Z99 A;  4MQ9 F;  3RYP A;  4V19 K;  1DP3 A;  1LKX A;  4HW0 A;  1F1Z A;  1PYV A;  2FU4 A;  4WF2 A;  5D4S A;  3CRJ A;  3V4G A;  3R0J A;  2OF7 A;  2E2H J;  4OD4 A;  2ZJQ F;  4BGD A;  1YTY A;  1NG6 A;  2GOM A;  4EAT A;  3CCU I;  3ML6 A;  4A0Y A;  1T38 A;  2XHK A;  5L3G A;  4UHT A;  2DFH A;  5KNL A;  1FYK A;  4OOI A;  3OYB A;  3LHQ A;  2WBM A;  2M9H A;  4A2U A;  3B73 A;  4GCV A;  3HBL A;  1HW5 A;  2BW3 B;  4MIM A;  1B6A A;  4F92 B;  3S17 J;  2BV6 A;  3K4M A;  3G3Z A;  3G56 A;  2BVL A;  5GP9 A;  2M0M A;  1H88 C;  1W5C C;  5LRR A;  1OCO H;  1G3T A;  2A61 A;  1BR1 A;  2QEN A;  3E6M A;  1LFU P;  3GTO J;  3F8N A;  2KIU A;  3CLO A;  1MH4 A;  3KYD B;  4F52 A;  5C4X J;  3F6V A;  1B72 A;  2P8T A;  1LUJ B;  5F1R A;  3EYY A;  4BEH B;  2NNY A;  4IHT A;  2QOP A;  4XID A;  1ZAR A;  2ISZ A;  5IT9 Z;  5C4Y A;  2JSC A;  5LEK A;  2ECC A;  3PNY A;  4N4N B;  5BMZ A;  4GFL A;  3BR0 A;  2W85 A;  4WXD A;  5HDN A;  1EH6 A;  2K3F A;  2EIL H;  3CJD A;  1WZ2 A;  2UZK A;  1XN7 A;  2GAU A;  3S2W A;  3QYE A;  3DEU A;  1IRX A;  4BHC A;  2GXB A;  1MDM A;  4YZE A;  2W57 A;  1PVE A;  2YVX A;  4GXO A;  4YRV A;  2CMP A; 
#chains in the Genus database with same CATH homology
 3ZQH A;  1U8B A;  2EZK A;  3JRC A;  3VIB A;  5FHP A;  1S7E A;  4A3G J;  3DEW A;  2AO9 A;  2XRL A;  3HGY A;  2OI8 A;  5M5W J;  2Y30 A;  3RH2 A;  1JTX A;  1W0T A;  2VUM J;  2K40 A;  3GTP J;  4C3J J;  1I3Q J;  2DA2 A;  4W97 A;  5K58 A;  1WPK A;  3BQY A;  1FJL A;  2NVY J;  4AYB N;  1B8I B;  1WH5 A;  2F07 A;  3HOW J;  1U9O A;  1MSE C;  9ANT A;  2K9S A;  4FIS A;  3JRG A;  3A03 A;  1I50 J;  4IHW A;  1WGX A;  3S1Q J;  1R9T J;  4XRS A;  2M0C A;  1JUM A;  2CJJ A;  3HDD A;  4DW6 A;  5E3O A;  1JKO C;  2E2I J;  1BW6 A;  1D5Y A;  1QVU A;  3K2A A;  3I4N J;  3TED A;  4JNN A;  1AKH A;  5E3L A;  4M6V A;  4RDU A;  3NNR A;  2UXI A;  4A3F J;  2XSD C;  4ACI A;  5F0H A;  3BNI A;  2L7Z A;  2O9L A;  3VOX A;  5M3M J;  4AUX A;  5CXI A;  4NDL A;  5EGO A;  2ZOZ A;  4B1R A;  5EG0 B;  1JT0 A;  3S1N J;  1IDZ A;  2RHA A;  3I4M J;  1IDY A;  4JKZ A;  4A69 C;  2MW8 A;  1GV2 A;  5EGO B;  1LFB A;  3CCY A;  3VVY A;  3TP0 A;  5FLM J;  2L7F P;  4DZP A;  4PXI A;  2G0E A;  4GFB A;  4MFE A;  1FIA A;  3HM5 A;  3OSG A;  2V57 A;  3KKC A;  4JL3 A;  4IHV A;  2G3B A;  1RKW A;  4JP0 A;  2JA5 J;  3JRI A;  5EEA A;  4D5C A;  3S15 J;  2HOT A;  1UG2 A;  3BQZ A;  3AQS A;  4EEF G;  2UXU A;  2GFN A;  1UI6 A;  2LVS A;  3NAU A;  1HOM A;  1RET A;  3UKG A;  2E19 A;  1XG1 A;  1VF9 A;  3BTC A;  3EUP A;  5AQC A;  4A3E J;  3PO3 J;  1IRZ A;  2HOA A;  1JTY A;  1TWG J;  1OCP A;  2K9N A;  2Y9Y A;  4NN1 A;  3VOK A;  1P7J A;  4GCK A;  5IPA A;  2UXP A;  2LR8 A;  2LY9 A;  3G7R A;  3O60 A;  2EZH A;  2YVE A;  1MBJ A;  4XRM A;  3DCF A;  3LSJ A;  3BR6 A;  4MXM A;  4GCT A;  2P81 A;  4V2F A;  1OCT C;  3S14 J;  1T56 A;  2XB0 X;  3HOX J;  4FE7 A;  1K83 J;  4FCY A;  3S2D J;  2UXO A;  3SFI A;  3ANP A;  4I76 A;  1ZR4 A;  3L1P A;  4M3D A;  4D7N A;  2XPW A;  2QWT A;  2VI6 A;  5FKN A;  3HE0 A;  5IYC J;  5FKK A;  4GCL A;  1POG A;  4NEL A;  2DTZ A;  2DA4 A;  2MSY A;  2RAE A;  1JT6 A;  1JKP C;  1RPW A;  3MKL A;  5IOY A;  5EF6 A;  5FKO A;  5E3M A;  4RBO A;  3JRH A;  3VP5 A;  5D1R A;  3JR9 A;  3Q3S A;  2QF7 A;  4IEJ A;  2LD5 A;  2KDZ A;  3VW1 A;  3ANG A;  2QIB A;  2CUF A;  4QTR A;  4A3K J;  3S1M J;  2XGE A;  2ZB9 A;  2DA1 A;  2JK3 A;  2XGC A;  3BTJ A;  3JSJ A;  2I10 A;  2L9R A;  3HTH A;  1NK3 P;  3GTM J;  4W1U A;  4D7M A;  1GDT A;  3C2B A;  4DYQ A;  2H8R A;  2X48 A;  1HCR A;  1QRY A;  1Z77 A;  2DMN A;  2YU9 J;  5IOZ A;  4BKX A;  2GUH A;  2ZOY A;  1ZTR A;  2X9D A;  1ETQ A;  4UUS A;  3JRE A;  2ME6 A;  2H1K A;  4B4C A;  4L5E A;  4A93 J;  2PZ9 A;  3HKZ N;  2QKO A;  3ZQC A;  3A01 B;  4KWA A;  3CMY A;  1X2M A;  2FQ4 A;  4UUS B;  3LWJ A;  4A3I J;  1NTC A;  5D18 A;  4HKU A;  5HBU A;  3IH4 A;  3TW7 A;  2XGD A;  3V78 A;  3IV5 A;  5J1R A;  2UXH A;  1WCM J;  2XDN A;  2OPT A;  5IYB J;  4A3C J;  2M2E A;  1ETX A;  3Q0V A;  1DU0 A;  2M34 A;  1TWH J;  2HYT A;  2HXO A;  3OSF A;  2NVQ J;  4D5F A;  2ID3 A;  3BHQ A;  3K7A J;  2WV1 A;  3HOZ J;  5EZH A;  1B8I A;  2ECB A;  3VW0 A;  5C3E J;  3RZO J;  4BXX J;  4AC0 A;  1VND A;  2G7G A;  3G1O A;  4XRS G;  3MN2 A;  3GTQ J;  2QTQ A;  5IP6 A;  4XIC A;  3D1N I;  4MK6 A;  3BR3 A;  3FK6 A;  3ZQF A;  3BR2 A;  3S1R J;  4CYC A;  1H89 C;  3GTG J;  2ID6 A;  2D6Y A;  2NS7 A;  1BW5 A;  2EQR A;  3LSG A;  3HTJ A;  2NS8 A;  1TWF J;  2ZCX A;  3PAS A;  1JUP A;  1O4X A;  4M3G A;  2M8G X;  1JGG A;  3JRD A;  1K61 A;  2AHQ A;  2VKV A;  3ZQI A;  4A3B J;  1BJZ A;  2DG7 A;  5FMP A;  4L62 A;  3S2H J;  4BBR J;  1FEX A;  1ORK A;  3HOV J;  3T6N A;  4M3F A;  1X58 A;  5DAJ A;  1AKH B;  4UUT A;  2NP5 A;  3S16 J;  3PPB A;  3WHB A;  2VKE A;  3C07 A;  4Y52 J;  2CUE A;  2OER A;  2LLK A;  4IHX A;  2WUI A;  3BR5 A;  4JX4 A;  3MNL A;  1ZGW A;  3LNQ A;  3QBM A;  5M5X J;  3KNW A;  3TP3 A;  2IU5 A;  4DYC A;  3HEF A;  4LOC A;  1H8A C;  1ETK A;  3JRB A;  2Y9Z A;  3F1B A;  1MBE A;  2YUS A;  4MO7 A;  3BG5 A;  3B81 A;  2E1O A;  2Y0S N;  5FJ8 J;  3KKD A;  4A3D J;  2R5Y A;  3NXC A;  1RES A;  1U9N A;  2ELK A;  3WHC A;  3IH3 A;  1VFC A;  3VVZ A;  1T33 A;  1SFO J;  2KT0 A;  1A5J A;  3QKX A;  1ZK8 A;  2COB A;  5HAW A;  1ZR2 A;  1UI5 A;  2D5V A;  4X1E A;  5EYR A;  3LOC A;  3HTI A;  3SDG A;  1MBH A;  2DMP A;  1FTZ A;  2FD5 A;  2CQX A;  5EDN A;  3NRG A;  1JJ6 C;  2NX4 A;  3ON4 A;  5CXG A;  3JRF A;  1MBG A;  1B72 B;  4ABZ A;  3GTL J;  1XS9 A;  1IG7 A;  3BCG A;  3VVX A;  2JWT A;  1LE8 A;  3HGG A;  3JRA A;  1HLV A;  1BL0 A;  3MVP A;  1JKR C;  3QPS A;  2DMT A;  3EGQ A;  3FRQ A;  4HNV A;  3V6G A;  3TW6 A;  2MG4 A;  1APL C;  3E7L A;  5FKL A;  1LE8 B;  4GFK A;  1HDD C;  3O8H A;  1RR7 A;  3HTA A;  2HXI A;  4ME9 A;  3GEU A;  2XPV A;  5J1Y A;  2K9Q A;  3RQI A;  4AC6 A;  1MBK A;  3BTI A;  3BG3 A;  2EZL A;  3ZQG A;  4QIW N;  2GLO A;  1PUF A;  3GZI A;  3M4O J;  1MSF C;  2W53 A;  1A6I A;  4S0H B;  5IYD J;  2R92 J;  1OJL A;  2R93 J;  2Y31 A;  5EFY A;  1ENH A;  3BT9 A;  4Y7N J;  3RZD J;  3O8G A;  3P9T A;  1DU6 A;  3BR1 A;  2G7L A;  2MGQ A;  2LFB A;  2TRT A;  2NVX J;  1Y1W J;  2R7Z J;  4BY7 J;  4IHY A;  2HQ5 A;  4FTH A;  2DG8 A;  2O7O A;  4MLO A;  2ZCM A;  5HOD A;  2CQQ A;  1G2H A;  2R5Z B;  2QCO A;  2JA7 J;  2EBI A;  1QVT A;  5F04 A;  5DTD A;  2DA5 A;  5C44 J;  4CYC B;  5M3F J;  1F36 A;  2WAQ N;  2XPU A;  1HDP A;  2NVT J;  2L0K A;  3ZOB A;  5EG0 A;  1U78 A;  2R5Z A;  3DPJ A;  2CRG A;  5DS9 A;  4JX5 A;  4C3I J;  2JA6 J;  3FIW A;  2ZCN A;  3FIS A;  4C2M J;  5H9T A;  1EF4 A;  2G7S A;  4ICH A;  3M3Y J;  5FKM A;  2GEN A;  4DZJ A;  2O7T A;  2JMW A;  5FLV A;  3VPR A;  2Q24 A;  5FGL A;  4G12 A;  5GPC A;  2JJ7 A;  2VPR A;  2R5Y B;  3A01 A;  2DA7 A;  1MNM C;  4A3M J;  2GM4 A;  1Z0X A;  4C3H J;  5F27 A;  4I6Z A;  2TCT A;  3BTL A;  2LK2 A;  2JA8 J;  3F0C A;  3QPL A;  3BRU A;  1QPI A;  1UHS A;  2JN6 A;  2FX0 A;  3IUV A;  4BY1 J;  2EZI A;  1ETO A;  3GBG A;  3VW2 A;  2XB5 A;  1IGN A;  1IUF A;  3OIO A;  4AF5 A;  2ME0 A;  2NP3 A;  1FIP A;  2DA3 A;  1W0U A;  1ETY A;  4BBS J;  3NPI A;  2REK A;  5EZG A;  4JX6 A;  3GTJ J;  5C4J J;  2Y2Z A;  1UMQ A;  3KZ9 A;  4M3E A;  3NI7 A;  3E7Q A;  1TWA J;  1MH3 A;  3B6C A;  3ON2 A;  3FK7 A;  5J1U A;  2IBD A;  2HDD A;  2PBX A;  1ZQ3 P;  3IH2 A;  3QQA A;  2YVH A;  2WGB A;  1ETV A;  1F43 A;  1OFC X;  3GTK J;  2HKU A;  2HI3 A;  3HB9 A;  5D19 A;  2R0Q C;  1P7I A;  3FKI J;  1E3O C;  3HIM A;  3AQT A;  5E3N A;  3COL A;  4X6A J;  2RAS A;  3RD3 A;  1TWC J;  2X6O A;  3H3V K;  1IJW C;  1YRN A;  1FTT A;  4J19 A;  3H0G J;  5CW8 A;  3LJL A;  2E2J J;  2GBY A;  1YRN B;  2DMU A;  4JYK A;  1SAN A;  2L7M P;  2YS9 A;  1TC3 C;  1HF0 A;  3HOY J;  1VI0 A;  1AU7 A;  5F08 A;  1WH7 A;  1CQT A;  3A02 A;  2IEK A;  2FJ1 A;  3PM1 A;  3SJM A;  3Q0W A;  4QSH A;  2HOS A;  3Q0U A;  3CRJ A;  1NK2 P;  2OF7 A;  1Y1V J;  5GPA A;  1IV6 A;  2E2H J;  4A3L J;  1SGM A;  5F1J A;  4MFD A;  2EH3 A;  3BG9 A;  4XK4 A;  1AHD P;  1PUF B;  2PMZ N;  4FE4 A;  1JUS A;  1WI3 A;  3LHQ A;  4CGR A;  2M9H A;  3VUQ A;  3HBL A;  1GV5 A;  3S5R A;  5J3L A;  2WB1 N;  4MIM A;  5F0C A;  3LSP A;  1XC5 A;  5M5Y J;  3NAR A;  4A3J J;  2N8G A;  3B6A A;  3S17 J;  3G1L A;  1ETW A;  5JLW A;  4UDS A;  1I6H J;  1GT0 C;  3G56 A;  5GP9 A;  1BA5 A;  1H88 C;  3HOU J;  3RKQ A;  1GVD A;  2CU7 A;  4V2G A;  2LKX A;  3CDL A;  2LP0 A;  5F0F A;  5K7Z A;  4M3B A;  1LFU P;  1JJ8 C;  2LTP A;  1ITY A;  3GTO J;  1MH4 A;  5IP7 J;  5IP9 J;  5C4X J;  2IAI A;  1GUU A;  4DYR A;  3ZQL A;  1B72 A;  2O8K A;  4B3A A;  2DA6 A;  2DMQ A;  2QOP A;  4XID A;  2FBQ A;  3OOU A;  5C4Y A;  5JLX A;  1ZKG A;  2DJN A;  2ECC A;  2DN0 A;  2W48 A;  4GFL A;  3BR0 A;  2NOG A;  3BJB A;  3CJD A;  5K7F A;  3CWR A;  1IC8 A;  3G1M A;  5BNG A;  1JKQ C;  2B63 J;  5K7H A;  3LSR A;  2HYJ A;  1Q1V A;  4YZE A;  3W6V A;  5HSZ A;  1MBF A;  3CQZ J;  3PO2 J;  1X2N A;  1RKT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...