2HYJA

The crystal structure of a tetr-family transcriptional regulator from streptomyces coelicolor
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
193
structure length
193
Chain Sequence
b'AEAQATRGRILGRAAEIASEEGLDGITIGRLAEELEMSKSGVHKHFGTKETLQISTLDKAFVDFWHRVVEPALAEPPGLRRLRAVCANSVGYLEEPLLPGGCLLTAALSEYDGRPGRVRDAVAEVWSRWREQLRADLTAAVDKGELPAGFDVEQALFEIVAAGLALNAAMQLQHDRTAADRARRAIERALAQS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative tetR-family transcriptional regulator
publication title The crystal structure of a tetR-family transcriptional regulator from Streptomyces coelicolor
rcsb
source organism Streptomyces coelicolor
molecule tags Transcription
total genus 81
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 2006-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2hyjA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2hyjA02
3RKQA 5FKOA 4DW6A 5FKMA 2NOGA 2UXHA 1Z77A 1TWAJ 3BR1A 3VVYA 2YVEA 4MLOA 5FKLA 3BHQA 3OOUA 9ANTA 2MGQA 3S2DJ 2NP3A 2XPVA 2LR8A 2NVXJ 3S1QJ 2XSDC 5M3MJ 4BKXA 5DTDA 5E3MA 2NX4A 3CWRA 3O60A 4CGRA 1AHDP 2DA7A 3LJLA 3BR3A 1I50J 3SFIA 5EGOA 3IV5A 1P7IA 3BT9A 2IU5A 3JREA 2CJJA 5C4YA 3GTPJ 1B72B 2EZKA 2FX0A 3A02A 3IUVA 5IP9J 3A01B 2OF7A 5AQCA 2G0EA 1ZK8A 1FTZA 2XDNA 3T6NA 3O8GA 1X2MA 2ZCMA 3HGYA 2DMPA 4UUSA 3TEDA 2E2JJ 2HKUA 2GM4A 4GCLA 4MFDA 2E2IJ 4X6AJ 5EZHA 1VF9A 4A93J 5CXIA 4BY7J 5F08A 1JJ8C 1R9TJ 2HDDA 3PO2J 3ANPA 2Y0SN 3E7LA 2X6OA 3PPBA 1RR7A 2QWTA 4A3FJ 5EGOB 2WUIA 2JMWA 1MBHA 3ANGA 1Y1VJ 2YU9J 1K83J 1Q1VA 2DMTA 4QSHA 5J3LA 1FTTA 1XS9A 3I4MJ 2NS7A 3CRJA 1WI3A 2FJ1A 2RHAA 3SJMA 1JTXA 3ZQGA 1W0TA 1WCMJ 3MKLA 3HTJA 3CCYA 1LFBA 2QKOA 2UXIA 4UUSB 1U78A 3NRGA 1HCRA 3NI7A 3TP3A 2AO9A 4JX6A 2ID6A 5FLMJ 4A69C 4AC6A 3VOXA 2Y31A 3QPLA 2LD5A 4JKZA 1T56A 4AYBN 2CU7A 1BL0A 2LLKA 2V57A 3K2AA 1JUPA 2DN0A 1SFOJ 2DMUA 4A3JJ 4NELA 3BG5A 5HODA 1GUUA 3S1NJ 5C4JJ 3JRIA 4IHXA 4BXXJ 1HOMA 1NK2P 3BQZA 2DG7A 1U9NA 3LSJA 3GTLJ 1UG2A 5CXGA 5M3FJ 3S14J 2CUEA 3S16J 3KZ9A 3HIMA 3S5RA 4NDLA 3O8HA 3GTJJ 3ZQIA 1FEXA 3BG3A 5BNGA 1QVTA 2HXOA 1RETA 2TCTA 1RKTA 4GFBA 1IDZA 2W48A 2DTZA 4IEJA 2M8GX 4GFKA 1I3QJ 1ETKA 1XC5A 2NS8A 5GPAA 2H1KA 4YZEA 3S17J 1ITYA 2L9RA 5F27A 3LSRA 3HOVJ 4B4CA 2HOSA 4EEFG 5E3NA 4FE7A 1BJZA 2R92J 1MH3A 2GBYA 3FKIJ 3GTQJ 2UXUA 2Y9YA 5DS9A 2DJNA 5K58A 2WV1A 2K9NA 2XGCA 3A03A 3BNIA 1HDPA 4A3EJ 3ZQLA 1LE8A 2HOAA 2VPRA 1JTYA 3NARA 4XK4A 2Y9ZA 5FLVA 1QVUA 1IC8A 2I10A 5EEAA 2YVHA 3PASA 5IYDJ 1AKHA 1APLC 1NK3P 1RESA 1IG7A 2M0CA 5IYBJ 3GEUA 1P7JA 3S2HJ 3EUPA 1F36A 1VFCA 4DYCA 1VI0A 3M3YJ 3W6VA 4AUXA 5E3OA 3RZDJ 3LNQA 3UKGA 2KDZA 1G2HA 1W0UA 2G7SA 2M9HA 3HTIA 4Y7NJ 3LWJA 4UUTA 4XICA 5E3LA 2R7ZJ 2QTQA 1MH4A 2H8RA 5F0HA 2X9DA 3TW6A 1IJWC 2F07A 1VNDA 4MK6A 2Y2ZA 3COLA 2XB0X 3JRCA 2GLOA 5JLXA 2WAQN 4W97A 1POGA 1MBGA 2VKVA 3S1RJ 3VP5A 2JA7J 3HOYJ 3GTOJ 1UI6A 1IGNA 4A3KJ 3HKZN 5EYRA 4X1EA 3ZQHA 3IH2A 2PBXA 4AF5A 3G1OA 2GENA 2NVTJ 4RBOA 2DMQA 3OSFA 5M5YJ 3GTMJ 2COBA 4IHWA 1YRNA 2FD5A 5K7HA 1K61A 5HSZA 4XRMA 3NXCA 3QBMA 5DAJA 1UI5A 3ZOBA 2ZB9A 2JA8J 3RZOJ 1MNMC 3BG9A 1PUFA 1FJLA 2LVSA 1HLVA 4L5EA 3I4NJ 1ETXA 5EFYA 3K7AJ 3TW7A 1WH7A 4M3GA 4M3DA 1O4XA 2AHQA 2D6YA 2QF7A 1GT0C 2IAIA 1GV2A 2GUHA 3HTHA 2IBDA 3WHCA 1JGGA 1WGXA 3HB9A 4GFLA 4I76A 1EF4A 4M3BA 5IPAA 1YRNB 2HYTA 3EGQA 2L7MP 2R5YA 2Y30A 2M34A 1MBEA 2ELKA 1ENHA 2EZHA 4CYCA 1GDTA 2UXPA 3BCGA 4XIDA 5FKNA 4Y52J 4JL3A 3Q3SA 1MSEC 3BTJA 1PUFB 5GPCA 4IHYA 2ID3A 3JRFA 2WB1N 2G3BA 3G1LA 1JKPC 4J19A 5EZGA 3BRUA 3CJDA 2B63J 2XRLA 1U9OA 2D5VA 1TC3C 1GVDA 2R5ZA 2L7FP 1CQTA 4GCKA 3VW1A 5C44J 5C3EJ 3D1NI 3B6AA 5FJ8J 3Q0UA 2NVYJ 2JA5J 4BBRJ 3KKDA 2CRGA 5FMPA 1IDYA 2K9SA 2REKA 3GTKJ 2OPTA 2HXIA 4M6VA 5CW8A 4JP0A 3JR9A 2TRTA 5M5WJ 5H9TA 2R5YB 2QIBA 4CYCB 5FGLA 2LFBA 4FE4A 3RD3A 3HOWJ 2ECCA 4RDUA 4BY1J 3HOXJ 2VKEA 3ZQCA 1X2NA 2X48A 3NAUA 2CUFA 3Q0WA 1BA5A 3ON2A 3DPJA 4C3IJ 1UHSA 1OFCX 4B3AA 2R5ZB 2YS9A 4LOCA 5EG0A 2RASA 2L7ZA 1ZR4A 3ON4A 3KKCA 2LKXA 3KNWA 5D1RA 2XB5A 2K9QA 3F1BA 5D19A 2Q24A 3LOCA 4M3FA 4DZPA 3HTAA 3DCFA 3IH3A 3PM1A 4JX4A 4ME9A 2EQRA 5K7ZA 5F04A 4HKUA 3BJBA 3HEFA 4GCTA 2HI3A 2JK3A 4A3GJ 3AQTA 2PZ9A 1OCPA 3FISA 4BBSJ 3CQZJ 3VIBA 5C4XJ 1IUFA 4MIMA 3S1MJ 3JSJA 4A3DJ 1MBFA 3B6CA 3MVPA 5EG0B 4QIWN 2ME0A 1UMQA 4IHVA 3M4OJ 5IP6A 2EH3A 3VVZA 2VI6A 3VW0A 1TWGJ 2EZLA 1LE8B 5M5XJ 1A6IA 2LP0A 1X58A 4V2GA 5EDNA 3Q0VA 1IV6A 1QPIA 4JX5A 2XGDA 1FIPA 4V2FA 1NTCA 1AKHB 4L62A 1HDDC 2NP5A 3GTGJ 3HDDA 4QTRA 1GV5A 2UXOA 3L1PA 3A01A 3BTIA 1TWHJ 1SGMA 1ZTRA 1RKWA 3RQIA 3G1MA 1BW6A 3HBLA 3FIWA 5K7FA 4A3IJ 2G7LA 1WH5A 3RH2A 5J1RA 2QOPA 3BR6A 4FTHA 5F0CA 2DG8A 1Y1WJ 2DA2A 3QKXA 5HBUA 3E7QA 5FHPA 1LFUP 3IH4A 4AC0A 3PO3J 2DMNA 2R0QC 5GP9A 2IEKA 5IOYA 4A3MJ 2DA6A 5IOZA 2L0KA 1OCTC 4S0HB 3HOZJ 1ORKA 3CDLA 3GBGA 3HE0A 2XGEA 3V6GA 1JKQC 1DU0A 1I6HJ 3LSGA 1B8IA 2FQ4A 1FIAA 3BR2A 1ETQA 4C2MJ 3NNRA 2M2EA 2P81A 2QCOA 1AU7A 1ZR2A 2ZOZA 3JRHA 5JLWA 2MSYA 1U8BA 4I6ZA 2ZCXA 4C3HJ 3JRGA 1WPKA 1BW5A 4D5CA 3FRQA 4D5FA 2JJ7A 1ETYA 2OI8A 2HYJA 5FKKA 4UDSA 2DA5A 3BR5A 3FK7A 4DZJA 2LY9A 1E3OC 3MN2A 4NN1A 2XPUA 2CQXA 1S7EA 3S15J 1ZKGA 3H0GJ 3QPSA 4HNVA 2N8GA 5F0FA 1A5JA 2OERA 2RAEA 3OIOA 3G7RA 4PXIA 1B8IB 3V78A 4ABZA 3BTCA 3LHQA 2MG4A 3DEWA 4D7NA 1IRZA 1JKRC 1H89C 3VOKA 3HM5A 5EF6A 4A3LJ 3LSPA 1H8AC 3VUQA 2GFNA 2CQQA 2K40A 1ZGWA 2HQ5A 2NVQJ 3CMYA 1RPWA 2R93J 3BTLA 2LK2A 1OJLA 2DA3A 3MNLA 2PMZN 4D7MA 2O7TA 2EBIA 3TP0A 1MSFC 4ICHA 1MBJA 4XRSA 3B81A 2LTPA 1ETOA 2FBQA 1JUMA 1JT6A 5HAWA 2ECBA 4W1UA 2DA4A 1JT0A 3NPIA 3HGGA 3GZIA 3FK6A 4DYQA 4A3CJ 2JN6A 1MBKA 3VPRA 1D5YA 3JRDA 1ETVA 3BR0A 5IYCJ 2XPWA 4JYKA 1T33A 4FCYA 2JWTA 2YUSA 3BQYA 4ACIA 4MFEA 3P9TA 2O7OA 1XG1A 2ME6A 5IP7J 2E2HJ 3JRAA 2ZOYA 3F0CA 2E19A 3HOUJ 2EZIA 2O9LA 1TWFJ 4MO7A 4B1RA 2WGBA 2DA1A 4C3JJ 1JUSA 3C2BA 3WHBA 4FISA 3QQAA 4M3EA 4MXMA 1F43A 3G56A 3H3VK 2G7GA 2MW8A 4G12A 4DYRA 3JRBA 3OSGA 2O8KA 3ZQFA 1JKOC 4A3BJ 1JJ6C 2ZCNA 2E1OA 1SANA 3C07A 1Z0XA 1H88C 3AQSA 1ZQ3P 4KWAA 5D18A 3VVXA 5J1UA 1HF0A 2HOTA 3SDGA 3VW2A 5J1YA 1QRYA 1TWCJ 2JA6J 2W53A 4XRSG 1B72A 1DU6A 5F1JA 2VUMJ 4JNNA 2KT0A 1ETWA
chains in the Genus database with same CATH superfamily
2O5RA 1W4MA 3LQQA 1IRXA 3EYIA 5FKMA 3BR1A 3WG9A 1D1CA 3IP4B 4E4HA 3OOUA 1Y56A 9ANTA 2MGQA 4S05A 2F5VA 4HZFA 2COMA 1FP1D 5M3MJ 3O6BB 3ONQA 4IOAF 4ESJA 3J81Z 4DVYP 1AHDP 2DA7A 4U7BA 2ZJRF 3GZNB 3HZJA 1YX5A 3ZN0A 4CUGA 1UELB 3IV5A 3CCMI 3JREA 2CJJA 4KN4X 1BR1A 3WE3A 5C4YA 1K6YA 4U0WA 4U0VA 3KCCA 2A6TA 3CCLI 3OYKA 2CW7A 2FA5A 1N77A 4RB1A 5DD4A 2XDNA 1YS6A 4BYYA 2K3PA 1HKSA 3HGYA 3PIOF 3TEDA 2BE5F 2HKUA 2GM4A 4QWQA 1HSJA 4MFDA 2XKPA 4X6AJ 1FZPB 1D0ZA 1VF9A 5LGUA 3ANPA 3PO2J 2Y0SN 2X6OA 3JCUC 4CHUA 2GA2A 3E5QA 1R36A 2P6TA 3KP6A 5EGOB 3CCUI 4A3FJ 1T8IA 1KZHA 2JMWA 1MBHA 2D1HA 2VODA 3GUDA 3K1MA 4BQNA 3F8BA 4H0EA 2ZXWH 4Y15A 2OCCH 1FTTA 1TW2A 4E7ZA 1XS9A 2NS7A 3KLNA 3CRJA 4M9SA 3I59B 1GLNA 2FJ1A 3K9TA 1E0EA 3SJMA 2JQ7A 2RNJA 3J7ZI 3ZQGA 4DNCA 3V7SA 4YIFA 3CCYA 2LY2A 4XRFA 1ON1A 2BW3B 4WXHA 1LVAA 1HCRA 3NI7A 2AO9A 2MA3A 2P6SA 1VQNI 4OINF 1ZARA 2AXLA 5F6FA 3JTHA 2A2FX 3HOSA 3DBLB 5IT9K 1PYVA 2M7AA 4UB6C 1P9QC 4AYBN 1BL0A 2VKDA 2LRDA 4A3JJ 1QZZA 5TISC 1XN7A 4NELA 3F72A 1GUUA 3C1DA 5C4JJ 3S1NJ 1E3HA 3JRIA 4WWCA 4BXXJ 2RQPA 3J80Z 3G4SI 2M45A 2ELHA 4RMNA 1LEAA 3KZ9A 4NDLA 5FLXZ 1PJRA 3O8HA 1WRJA 1BI0A 2VQHA 1QVTA 1TQPA 2TCTA 2DJIA 1IDZA 2DTZA 4IEJA 3FHNA 1LFPA 4GFKA 1OQYA 5J6XA 5BQTA 4YG2F 2MBFA 3T8RA 4EMSA 2HPMA 1ITYA 5J47A 5F27A 2XSJC 2PMUA 2HOSA 4EEFG 5E3NA 2R92J 4RAYA 2CWEA 3GTQJ 2Y9YA 3BZKA 2XAJA 1MMNA 2NRAC 4V19K 1Y0NA 5E1ZB 3BNIA 3LA2A 4OD4A 5L3GA 3ZRGA 3ZQLA 3FHZA 4GYIA 1JTYA 5FLVA 5EEAA 4A12A 3PASA 2V9PA 3M1EA 3KLOA 4UNOA 4LGWA 2XF5A 1WZ2A 1FBUA 3GEUA 4ON0A 3UR3C 3EUPA 1VFCA 5EEGA 3SQNA 2KIUA 2VJ4A 3BCAA 3HPHA 5E3OA 1K78A 1IN8A 1LKXA 2ISYA 3RZDJ 2FE3A 2DK8A 2H8WA 4HQEA 3EPZA 1VTNC 3VEPA 4Y7NJ 3LWJA 5GTIC 3AG2H 5E3LA 1YOVB 1W7PA 2YPRA 2VBYA 3FMQA 2H8RA 1MMDA 1VNDA 3OL3A 3COLA 3HKZA 2I5UA 3VP5A 2JA7J 3HOYJ 2QENA 4RGSA 1UI6A 1IGNA 3LFKA 1O3RA 2EV0A 2W4SA 4GXOA 5HLGA 1IRFA 1XGSA 3PUFA 4GDFA 4HPQA 4TV7A 3S8PA 5D5VB 1LB2A 5M5YJ 3OYHA 3FM3A 2VJ5A 1VQOI 3C2GA 3PFYA 3BPXA 4XRMA 2K4JA 3IC7A 3M07A 2EK5A 3CO6C 3QBMA 4PJ0C 5DAJA 2DOFA 1UI5A 5B1AH 3E5UA 3RZOJ 1G4DA 4ZYEA 2XAUA 3BG9A 3RJPA 3TDUC 5D4SA 5DM7F 3RKXA 2IGOA 4G7ZF 1R6RA 2ZXHA 2BV6A 1UJ8A 4M3DA 2GWRA 4M3GA 1T98A 3BOQA 3DTEA 4OIOF 3BLYA 2D6YA 2QF7A 1FWZA 3WHCA 3CC7I 1WGXA 4I0AA 2KDOA 3V7CA 1DDNA 2JPBA 4I76A 4UVAA 1EF4A 1ZYRF 2VC0A 1R5HA 2HYTA 1D8JA 2KHMA 2R7UA 2R5YA 2Z1DA 1J2XA 2OQRA 3EQLF 5IY5H 5DCFA 3GFIA 2L9SA 4LIVA 4BQAA 2DFIA 1QO0D 4ESBA 4ZYHA 3JRFA 1YX3A 3LHQA 5EZGA 4CZCA 3CJDA 1U9OA 2D5VA 2CO5A 1CQTA 2IGKA 2A69F 3RQ4A 3F6OA 3MZHA 3B6AA 1QU3A 2MC4A 1Q1HA 2MFZA 4YFKF 4IRHA 4XLPF 1BBYA 4YELA 1MDMA 5FMPA 2K9SA 3BG7A 3GTKJ 3CF2A 1YIOA 2OPTA 1GXQA 2HXIA 4M6VA 1DGWY 3A2KA 4EJUA 1QPMA 3JW4A 3SWHA 4WXCA 4LLNA 2W00A 5H9TA 4KN7X 1I1SA 2XDVA 3HRTA 2VONA 5FGLA 3HOWJ 4RDUA 3HSFA 2X48A 3G73A 2PEXA 3ON2A 1D1BA 1R22A 2NS0A 1O3TA 2RVCA 2L7ZA 1IXSB 3KKCA 2BZTA 3KNWA 2KRCA 3I64A 3HTUA 3L7WA 4KISA 3QOPA 3F1BA 2GXBA 2Q24A 1AA7A 3LOCA 1Y8RB 4MTEA 4DZPA 3G3ZA 2HKOA 4EJTA 2XGXA 3HTAA 3PM1A 4JX4A 3KIOA 2CS3A 2IJLA 3H9JA 3MZ8A 2K9MA 2V4JC 2XAGA 5FB2A 2GAUA 4LB5A 2R7OA 2ELJA 4OIPF 3K4NA 3DEUA 3HEFA 4ANJA 3K0LA 4BAYA 4EGYA 4Z6YA 2JK3A 3L2WA 2PZ9A 3VFZA 2RGVA 4XNFA 3CQZJ 3HRMA 1O3SA 1RNLA 2IPQX 3JSJA 3ABKH 1QHGA 5ICCA 1BR4A 2O3FA 3HYIA 3QPTA 2B3WA 1T95A 2BY2A 2RNGA 1MNEA 1OCCH 5IP6A 4DGWB 2DO7A 2DT5A 2EZLA 1R23A 2HU9A 5M5XJ 4E70A 4II2A 1A6IA 2MLGA 1QPIA 3Q9SA 4L62A 1AKHB 4ZYGA 2Y0MA 1E2XA 3X2QH 5H6QA 4PJMA 3HDDA 5JVGF 4QTRA 4BE0A 2L9NA 4XKCA 3BTIA 2NAZA 2W25A 4Y3OA 1SAXA 1D1AA 5CYVA 5LLQA 1DQUA 2V1DA 1X3WB 1ZTRA 3ISPA 4H4KC 1BW6A 4NUBA 3FIWA 3KE2A 4AU7A 5HNHA 2VPLA 2QOPA 3BR6A 4HX8A 3E7QA 2UV1A 2K9LA 4ENMA 5FHPA 4P1WA 3AL0C 4AC0A 3PO3J 3KYLA 1KU9A 1CF7A 2IEKA 5IOYA 5ICGA 1WKMA 3ULQB 5DDGA 4UB8C 4XLEA 1YHQI 2HQAA 4WX9A 3KYCB 1A6QA 2F48A 3V6GA 4HX7A 4B3XA 1I6HJ 3LSGA 3S3NA 3OYCA 1ETQA 2VOOA 2QCOA 2E35A 1AU7A 1KA8A 1ZR2A 2ZOZA 5DV5A 2HPIA 4CA0A 4CCOA 5JLWA 2MH9A 1U8BA 1IZ1A 2ZCXA 4CCJA 2K7LA 2PG4A 3CUOA 5L3CA 5ICFA 4KMFA 1QNTA 2Y0SA 3GCMA 3TO9A 4XKWA 4D5CA 3EUAA 1FOXA 2VKHA 1ZGAA 2OI8A 2HYJA 5FKKA 5GADJ 3FK7A 4XKBA 4HDUA 5KHDA 1SVLA 2LY9A 1E3OC 1J7KA 3QPSA 4HNVA 5F0FA 2LY1A 3KP4A 3OIOA 2OERA 4PSXA 2YX4A 2QQBA 2HZDA 3BTCA 2TDXA 3DV8A 4M6YA 3JAMK 5B3SH 1KQ0A 2A6HF 4HYEA 4A3LJ 3LSPA 1LEBA 1GHCA 1OCOH 1G3WA 2CQQA 2KMUA 2WBMA 2L9VA 1J9IA 2JPCA 2LK2A 3QPHA 3MNLA 1Z6RA 2IS6A 2LKPA 3CUQC 1EKEA 4U88A 3TP0A 1BC8C 4XRSA 4EQQA 1WJ5A 5AIQA 5JI6A 3WU1B 4QLCU 1V5EA 3OS0A 2OJED 2DA4A 1JT0A 3NPIA 3ASNH 4JBAA 2G9WA 4CCLA 3AAFA 2DXIA 4A3CJ 2CW0F 4ZTFA 3OS1A 2XAHA 3K4KA 4BNCA 2Y75A 3RI4A 2XVCA 4NC7A 3HG9A 5E8IA 4JYKA 3MZYA 1WJEA 1IN6A 1YQAA 1PP8F 3LA7A 3QYEA 3P9TA 2L4AA 5IT9Z 1NG7A 1J0RA 2ZOYA 2XIGA 3BZCA 2E19A 4XSZF 3KZIC 1PDNC 4KIGA 4XOTA 3HOUJ 5LHGA 1HBXG 1TWFJ 2VE8A 3P9CA 4MO7A 2O9LA 3S2WA 3VYRB 4C3JJ 2ZMEA 4ENKA 4FISA 2EA4A 5KK1A 5JR3A 2ZO4A 4MXMA 2BHYA 1FSHA 3S3MA 3G56A 2F2EA 1UAAA 1EH7A 2E60A 1X4PA 1WWXA 2QLZA 1JKOC 1TP4A 2UXXA 3KX2A 1JJ6C 3PUBA 2ZCNA 1SANA 4M74A 1Z0XA 2JSCA 2ZJPF 3C07A 1ZQ3P 4KWAA 2BHZA 2DW4A 1MKMA 4NBQA 1P4WA 5J1YA 1QRYA 3AFHA 3CP8A 3REOA 1DU6A 1S8NA 4MTDA 4JNNA 3HPGA 4UV9A 4OWRB 1EJ9A 2UXNA 2HNHA 4I99C 3FZVA 5FGMA 2DOEA 1YW8A 1BOAA 4XLHA 2F5CA 4OMZA 3RKQA 3P9KA 4DW6A 2NOGA 1IW7F 2DQRA 2KFDA 1Z77A 3H0DA 1F4KA 2CQNA 5FKLA 3BHQA 5CVIA 3S2DJ 4XLCA 1KU7A 1DP7P 2NP3A 3S1QJ 2VC1A 2XSDC 4BKXA 2HYFA 1UHWA 3DLLF 4CGRA 2K85A 3VTIA 2X1EA 2IGNA 3LJLA 3RKWA 3WGHA 3BR3A 2QKMB 5D5UB 2BYVE 3AKZA 3GTPJ 1B72B 1X1PA 4FASD 3CCSI 1FY7A 2FX0A 1T0FC 4XR6A 3I54A 4WXDA 2FBHA 2EINH 1ZRDA 3ZQ7A 1JXSA 2H94A 4AWXB 1Y8QB 4FQGA 2ZCMA 4CXFA 4PJJA 2DMPA 4B43A 2BOLA 4GCLA 5CKTA 2NVUB 3COAC 2DT6A 1U3EM 2B1EA 4A93J 4L18B 3M7GA 1STZA 5AIPA 4BY7J 1JJ8C 1R9TJ 5DM6F 3E7LA 1N78A 2DTRA 4RB2C 3J7YJ 5L3EA 2GXGA 3FMRA 3MD2A 4GYGA 1P6RA 1Z1DA 1ZG3A 1Y1VJ 3FM5A 1ZLKA 1XCBA 3WGGA 3OYEA 1YTYA 1Q1VA 4QSHA 1N25A 1SVOA 2FMYA 3OL4A 2RHAA 4MGRA 1LDJA 1JTXA 3GYHX 1WCMJ 4FETA 4KFCA 2UXIA 1U78A 2KZVA 3NRGA 3KP5A 1SFEA 1D0YA 4KYWA 3K6GA 5HDNA 2QWWA 3BWGA 1TBXA 3U21A 2E34A 3TO7A 4A69C 3QRFF 5CQGA 2W84A 3ROUA 1FOKA 3QPLA 4AVZA 4BQQA 2LF7A 1T56A 4JKZA 1XMXA 2HTJA 1D0XA 1RIOH 3P9IA 3MKWB 2VN2A 4BE2A 3ZMSA 4IHXA 2W82A 1NK2P 2EA2A 3FX3A 2DG7A 5M3FJ 2CUEA 3S16J 1M1EB 1BI1A 2X6YA 3F3XA 1W5CC 4HSRA 3OYAA 2FQ3A 3ZQIA 1W36D 3BG3A 2ZBKA 2HXOA 5HNFA 1RETA 2DODA 2QM3A 1RKTA 4ZYDA 2W48A 2UUZA 4HSTA 2M8GX 3W2VA 1ETKA 3OR2C 3S32A 4CH7A 3DP7A 1WJCA 3A0BC 4CSWA 1MH3A 2GBYA 4U87A 4LK0F 3K4LA 2Z2SB 5K58A 2ESHA 4JK1X 4QPOA 2XGCA 3A03A 1LE8A 2HGCA 2W24A 1X1DA 3ZP5A 3NARA 3HJEA 4EV0A 2Y9ZA 1QVUA 2Z3YA 2I10A 2OCEA 3LL7A 4UVBA 3MAJA 1APLC 4L0ZB 4O6JA 2I8DA 1IG7A 2M1BA 1YJWI 2IGMA 4XM3A 1HC8A 1F36A 3TOBA 5LRRA 3WTYC 2M5WA 2VT3A 3M3YJ 3RPQA 3MWMA 4U9LA 3W6VA 1X1BA 3L00A 4QPQA 4I98B 1Z7LA 1OCZH 3KZZA 1LUJB 1P4XA 1EV7A 3F8NA 3OYLA 1AOYA 2DBBA 4ETSA 2H09A 3UKGA 2KDZA 2XF7A 1W0UA 3IKTA 2G7SA 4UUTA 4DOZA 4B8XA 4E7JA 4XICA 1XGOA 4E7HA 3O3KA 3DXJF 3VB2A 2G7HA 4KA4A 2WADA 4WK8F 3MMYB 3RSNA 2WAQN 4W97A 1MJAA 1POGA 2VKVA 4ZDOA 1WQ2A 3I55I 3KETA 5GAHJ 5EYRA 2E7WA 3K4BA 4AF5A 3G1OA 2PX9A 4RM2A 2GOXB 3DU5A 2DMQA 4G6DA 4RBOA 3OSFA 5CVJA 4IRVA 1B9MA 2XC7A 4LD5A 3WU0A 3GEZA 3LMMA 1XSVA 1K78B 2XHKA 3C18A 3CLOA 4Y4RA 3NEUA 2OD5A 1VQKI 1W7PB 3DKXA 4GRIA 1Z67A 2M7BA 2WWYA 2DYSH 2NNYA 1YJNI 1ZH5A 1VQ4I 3MFKA 1J09A 4EM2A 3TGNA 1FT9A 2LVSA 2R7RA 4L5EA 3UNGC 3K7AJ 1WH7A 1RUNA 3CJNA 3CDIA 3F6VA 2AHQA 2W7NA 2E1MB 2BBYA 2C6YA 2IAIA 2ZY9A 2IBDA 2D1VA 3E6DA 3MQ0A 3TOAA 1JGGA 4XKVA 1XDSA 2NXNB 4GO1A 5IPAA 3L09A 4IOCF 2ZCWA 4OIRF 3CJRB 1SFXA 2LOOA 1R5ID 3EUKL 4O5VA 4CYCA 2ELKA 2EZHA 3M1CA 5H20A 2X6WA 2UXPA 4XIDA 1V54H 3BCGA 4JL3A 3M8EA 1MSEC 3BTJA 4BXUA 2L3DA 2W57A 2ID3A 2STWA 1G8XA 2A07F 4Z2YA 2WB1N 1B4AA 3G1LA 4G9YA 1JKPC 4J19A 2G3BA 3BRUA 3CP2A 2XRLA 3EETA 3E0JB 3DEEA 1TC3C 2OTLI 1GVDA 3ZMDA 4GCKA 4E7LA 3VW1A 5C44J 3ZPLA 4CO8A 2FBKA 2FBIA 4HBLA 4CCNA 1RR8C 1PP7U 2DT7B 2H1LA 2BVMA 5K5RA 4NC6A 2M8EA 4HA8A 2R5YB 4P5OA 4BJTA 2D45A 3SXYA 1U0JA 5FFZA 3LA3A 2HZTA 2ECCA 4P96A 4PK4A 3NAUA 4AIHA 2AXTC 3R0AA 4E7KA 3JAMZ 4NB5A 3ZCOA 4A2UA 3D5SC 1R1VA 1UHSA 2YVXA 4GGGA 4B3AA 1UFMA 3TBIA 3C3WA 5EG0A 4N4OB 1YYVA 1JI8A 1BR2A 4EJOA 1IN7A 3LSHA 4ZJZA 1MDMB 5D1RA 5DUIA 5D19A 3I53A 4E6KG 4IXAA 2B0LA 3IH3A 4KT6A 4ME9A 2EQRA 4LITA 5K7ZA 5E17F 3D0SA 5F04A 4I01A 4HKUA 3ABTA 3QYBA 1MJ9A 3E6MA 3AQTA 1VQPI 1OCPA 1V55H 3VSLA 5LBQA 5TGTA 4NC8A 3VIBA 1IUFA 2Q8KA 3S1MJ 3HTSB 4PSWA 4A3DJ 4LMYA 3MVPA 2ME0A 1XTAA 4B09A 2Y48A 5DD8A 4C2UA 1MMAA 3C7JA 3AL0B 3SYTA 1GXPA 3WTWC 3VW0A 2FXAA 2PJRA 4UUVA 3CMMA 3KP2A 1IUYA 2LP0A 1YS7A 3HXLA 5EDNA 3DWLE 4LK1F 5DEQA 2BY0A 3MEXA 2MD0A 4PZJA 1EH6A 3QP6A 5B66C 3KYDB 4IO9F 2UXOA 1WJAA 1FMVA 5DYMA 1ZN2A 4BJ5C 4Y13A 1S72I 3H9QA 2DYRH 4HF0A 2E7XA 1SGMA 2QVOA 4OU0A 3RH2A 1TQMA 1CGPA 1WH5A 1SD6A 2K86A 1R4NB 1I5ZA 2DG8A 2DA2A 3QKXA 5HBUA 3IH4A 4I2OA 2K3FA 5GP9A 4R1HA 3B73A 4A3MJ 4B48A 1J5YA 1ON2A 5IOZA 3KP3A 1HW1A 2L0KA 4S0HB 2E71A 4CGZA 2DPDA 3HE0A 2GOMA 4MEYF 1TNTA 1JKQC 3EUHC 2VXZA 3ABLH 1FIAA 3BR2A 3KEOA 2DCEA 2L2OA 2P81A 2F4MB 2Q0OA 1KYWA 3WTVC 3BCBA 3PIPF 2MSYA 3BZ6A 5HS9A 5TJJA 5E1XA 3DTKA 3T0YA 4C3HJ 2KP6A 1W36C 2M0MA 4P55A 3N97A 1BIBA 3GXOA 3W3CA 2WAEA 1MMGA 3RKYA 2OBPA 2FEZA 3U1DA 1BIAA 3GFJA 1CF7B 5CVVA 2E1CA 3R61A 1JE8A 3NS4A 3MN2A 1Z21A 3CCQI 4PCQA 4XLFA 2DLLA 3S15J 1NHAA 4A0ZA 2X1DA 2R7QA 1P2FA 3G7RA 4PXIA 2XROA 5CVUA 2R7XA 3CCJI 3E1SA 1VQ5I 2A5YB 4ABZA 3MKYB 1O57A 3VOKA 2Z16A 2L02A 4DJAA 3VUQA 2GFNA 3C2HA 4NHJA 4BQOA 1Z9CA 2JVGA 2PMZA 3LWFA 1U2WA 4IHSA 1XPXA 3ZMTA 1S6LA 5FRNA 2A61A 1WJBA 3DPUA 4IVNA 1V5GA 1ETOA 4HV6A 2QA4I 1S7OA 2B9SA 4W1UA 1I3AA 5FO5A 5H2FC 1NG6A 2F4OB 3FK6A 4DYQA 1TL8A 1B1BA 1LQ1A 4HLXA 5LD2C 2Q1ZB 2R3SA 3QYFA 3KP7A 3BR0A 2XPWA 2EFNA 3VODA 2YUSA 2HEOA 3KEQA 2H6CA 4BACA 2HKXA 3F9KA 3FWEA 4M71A 4YRVA 3BROA 5IP7J 2OZUA 2E2HJ 2NNNA 3V8LA 2E5ZA 2W85A 1FOWA 3PSIA 5ED4A 4IRGA 3DKYA 2LBFA 1FSEA 2W1OA 1R00A 1JUSA 3F8FA 2F5EA 2GA1A 4F52A 2V9KA 2ISZA 4M72A 4D9JA 5A2QK 1F43A 2YSRA 2VLAA 4WIBA 2G7GA 4G12A 5K1YA 3OSGA 2LNBA 1RC9A 4D0PA 1R49A 2E1OA 1FNNA 4I02A 5D18A 3E5XA 3KPHA 2HOTA 5B1BH 3A0HC 2XV4S 1TWCJ 3PNVA 3LSIA 3I56I 3R4KA 5JHUA 2P0WA 1HA8A 2EJRA 4XRSG 4C9YA 4DQ2A 2W53A 5F1JA 5LEKA 2KT0A 1ETWA 3ZQQA 2X51A 1OMIA 2ZMEB 4HF2A 3F8CA 2KRHA 5FKOA 5KVRA 1WFXA 3I3LA 1TWAJ 2NYXA 4OOIA 2YVEA 4HNTA 2WAQA 4LLGF 2X4HA 3K4MA 4GCVA 2EILH 2XPVA 2ZXIA 4DBQA 3ZMZA 2VBZA 3CUQA 2LG4A 1ZREA 2IT0A 2XRNA 3QWLA 1W5SA 3CWRA 3M9AA 2EV6A 3VYTB 4XOPA 4BJ6C 2KRFA 3SFIA 1I50J 3DTIA 5FRMA 4EVIA 1P7IA 2EFWA 3BT9A 2QQAA 2IU5A 2D2WA 5J40A 2EZKA 4A5NA 2ADUA 2OQGA 4UHTA 4YIIA 1OKRA 4JOMA 4F7ZA 4II3A 3LFUA 3A01B 1RZ4A 2LC2A 3K8PC 1UHMA 2M87A 1ZK8A 1Y0UA 4XORA 1FTZA 4L9TA 2P7CB 2MC3A 1Z3XA 4UUSA 3RYRA 2E2JJ 1YFHA 3U1KA 1YITI 2E2IJ 3D5LA 3HSRA 2EFPA 5LHIA 3NRVA 3OR1C 4RGXA 1WJDA 2LMDA 1TZLA 1RR7A 2IA0A 1BM9A 2KPMA 2AQFA 5ILUA 2IA1A 4Q5SF 2QWTA 1SMTA 1OR7A 4RB3C 4NQWA 1O7FA 1XB4A 2BY1A 1K83J 4LG0A 1Z7UA 4EATA 4HOBA 4BHBA 1IXCA 1T6SA 3I4MJ 1MW7A 1U5TA 1WI3A 3MKZA 5H6RA 4Q47A 1ZGJA 4KIBA 1SFKA 1X3ZB 2CG4A 3CTAA 1HXDA 1W0TA 2LF8A 2CUZA 1LFBA 4XMYA 1ZAOA 2KJBA 3TP3A 1FYMA 1V3FA 5FD5A 5FLMJ 4AYBA 2PLYA 3CD6I 3BP8A 1G59A 2Y31A 3U2RA 2H6BA 2K4BA 3H92A 2LD5A 2VXDA 2CU7A 1XCVA 1V4RA 2LLKA 3K2AA 1JUPA 3IRRA 1SFOJ 2DFHA 2PBIA 2PQ8A 5D6FA 1U9NA 3LSJA 1UG2A 2CFOA 5GAGJ 3HIMA 2PJPA 2ZJ2A 3L2RA 4BEHA 2STTA 2MH2A 4IZZA 1R4MB 4GFBA 1S29A 2WV0A 3V4GA 1S7AA 5HDGA 1XC5A 2NS8A 3FDYA 2DOAA 1T0FA 3S17J 3RDIA 3K4JA 4YZEA 1BI3A 3HOVJ 4B4CA 3PNYA 2V1UA 4ASNA 4FE7A 1BJZA 3I0TA 4L9NA 1A31A 2R7VA 2UXUA 5DS9A 4LLLA 2IVMA 3OMYA 2WV1A 1OR7C 3PNTA 1HDPA 2XF6A 4A3EJ 1REPC 1G3SA 2DDAA 2FU4A 3F23A 2LH9A 2HOAA 3W6JB 1U5TC 4XK4A 3TL4X 3P7NA 2HVRA 2BVLA 3NQOA 3K70C 1KONA 1V5FA 2P7VB 5IYDJ 4XONA 2FNAA 1AKHA 1NK3P 2RV8A 3JSPA 3S2HJ 1R7JA 1YI2I 6PAXA 3GLLA 4DYCA 1VI0A 2G7UA 2HS5A 4YFXF 2LREA 1QZYA 1Z3YA 3FXLA 3LNQA 3VWBA 1FLIA 3VOEA 2M9HA 3HTIA 4MQ9F 3ERED 3JTGA 2JSPA 2R7ZJ 1YO5C 2QTQA 1KQ8A 3KFWX 1IN4A 3E3VA 3LSTA 4PGGA 1MH4A 2BEOA 3TW6A 4IKFA 1R5GA 2GLOA 2F5FA 4PDKA 4XL9A 3SHFA 3TMOA 3S1RJ 3HHGA 2HFHA 3ML6A 4CYDA 5HLTA 2JRMA 1A04A 3GTOJ 4HG2A 3HKZN 3DKWA 5TRDA 4OD5A 3T5XA 3IH2A 2PBXA 2NVTJ 2LDUA 3CCEI 2EB7A 5L3DA 2F4IA 2QBYA 4ENNA 3HRSA 3PSFA 2DK5A 4IHWA 1USTA 3EDPA 2FD5A 3OOPA 1YRNA 1K61A 1UZCA 1RUOA 2IA2A 3NXCA 2WA0A 3IHUA 2NOJB 1R71A 3ZOBA 5KAIC 2KL4A 2M3AA 4KJZA 4B47A 5IT3A 1MNMC 4IQJA 1PUFA 2V6EA 1FJLA 1ZG1A 1R58A 3GF2A 2ZKZA 1XMAA 2E36A 3H36A 1IV8A 5EFYA 3TW7A 3HL2A 1FPQA 2HYGD 2YU3A 1O4XA 5K5OA 1YW7A 3SZGA 1KGSA 1GV2A 3JSOA 4HLYA 1LPQA 3HTHA 1DP3A 3IAS2 2CMPA 4R8HA 1IO2A 3WTUC 2QGUA 4F93B 3RCOA 1B59A 4JQFA 2BY3A 3FBNB 4KICA 1T38A 4RLQA 1UCRA 3EGQA 4CICA 3PQJA 2Y30A 2M34A 1MBEA 1OISA 5FKNA 1QHHD 5E1WA 2CUJA 3Q3SA 2QKLB 3AG3H 4CZZA 4IHYA 4CCMA 4A0YA 5CQEA 3K10A 2CSOA 3CC4I 2R5ZA 2L7FP 2FSWA 1IXRC 1S5LC 3D1NI 4OAZA 2IS4A 3Q0UA 2NVYJ 3CMEI 2FNPA 4BBRJ 3GVAA 4BDZA 1IDYA 4FHTA 1SFUA 2REKA 5KCMA 4XLAA 3G6EI 3GW2A 1FP2A 1YG2A 3PJRA 3IWFA 3M8FA 1YIJI 2YR2A 2DAOA 3CJQB 3L2CA 4CYCB 3K2ZA 1SMYF 4FE4A 3A1YA 1FX7A 3HOXJ 2VKEA 3TKYA 2OUMA 4EGZA 3DPJA 3OIPA 3OYDA 4C3IJ 2BXZA 2ETHA 2KIQA 3R0JA 2L54A 3ON4A 1X1AA 2MYSA 2PMHA 1DPUA 3ASOH 5J4YA 4OMYA 4HDVA 4OIQF 1HW5A 4M3FA 3BY6A 3ZR8X 3L2QA 1FC3A 1KYZA 3SZTA 1W7PD 3AG1H 2EFOA 3WTXC 3BJBA 4S04A 4IX7A 3HHHA 2KKOA 2IRFG 3IWZA 2WY8Q 3H5RA 2HI3A 4BH9A 4EJWA 3GMEA 5DCMA 1I39A 4XBFA 2OAZA 4IHTA 3FISA 5JVTA 5HS8A 4BBSJ 4A0XA 5C4XJ 5D5WB 3RIRA 3B6CA 5EG0B 4QIWN 3QP5A 3I5UA 2L01A 4NNJA 1UMQA 2BXYA 4OAYA 3B02A 3M4OJ 3VVZA 3GLXA 1TWGJ 2QQ9A 5J8CA 2GIZA 3CJTB 5BS6A 1X58A 3G2BA 4EM0B 1IV6A 2PFBA 2XGDA 4V2FA 5A2QZ 1NTCA 4KUMA 1HDDC 2VIXA 3GTGJ 4LB6B 1GV5A 3L1PA 1WVRA 4HEA2 1D8KA 1KU2A 1TWHJ 2DFFA 2F6CA 1U6GA 2A68F 3RQIA 1RKWA 2HVQA 4EJVA 5K7FA 3PQKA 5J1RA 3HUGA 2FF4A 2VBXA 3M8JA 4FTHA 4YFNF 4B44A 1OCRH 2VQCA 2O61A 2E1NA 3V7RA 2PJRB 3F21A 2DA6A 2VQGA 1OCTC 4U9NA 1ORKA 2LSOA 3CDLA 5ERIA 1TNSA 2WY7Q 3GBGA 2LKSA 3GO5A 3DPLC 4FX4A 2GIVA 1B8IA 4XSXF 3ERMA 1BN5A 3DPTA 2M2EA 5K5QA 4ZZLA 1OYYA 2IW5A 4I6ZA 5GTHC 1SEUA 4WCGA 2AS5F 2RQQA 1E17A 1WPKA 1BW5A 3FRQA 2Z5UA 4D5FA 1NH3A 2JJ7A 3IAM2 5CVRA 3WTTC 2DA5A 3GZ6A 4DZJA 5LHHA 2QSFX 1G3YA 4C2MA 1MNDA 1YJ9I 4NN1A 1SD4A 2CW8A 2XPUA 4YIRX 1ZKGA 2MD5A 2N8GA 4U7DA 1S9HA 2RAEA 3F8MA 3IKVA 4LFUA 2Q2EA 4AIJA 3FXUA 4KT5C 3WU2C 3DEWA 2LYCA 4C30A 4D7NA 5EF6A 2OV7A 2GXAA 1ZGWA 2HQ5A 4P9UA 5FROA 3CDHA 3CMYA 2V9VA 5CJ9A 1I1GA 2R93J 3BTLA 1XMKA 4FT8A 3WG7H 4M6XA 1VQ6I 1ODDA 2O7TA 4D7MA 4ICHA 4HF1A 3B81A 2FBQA 1JUMA 1SAUA 1JT6A 1K4TA 2R7SA 1O3QA 1IN5A 5KAFC 4MHGA 2WAFA 1P4AA 2OC6A 2ZFUA 4MEXF 1SD7A 4BS9A 2JN6A 3WTZA 1SD5A 4ITVA 1D5YA 3JRDA 1ETVA 5IYCJ 4FCYA 4HX4A 3BJOA 2L5QA 4X0GA 3O2PE 4MFEA 4ACIA 2O7OA 1XG1A 2ME6A 1LDDA 3I71A 3ZMUA 3JRAA 2HQNA 3F0CA 2K27A 1RI7A 4HW0A 3EUHA 1FOYA 2XKOA 3GX4X 3FMSA 1T08B 2CGPA 3WHBA 5HOOA 2O0YA 1L3LA 4M3EA 3CCRI 2KZGA 3FXRA 3BPVA 3FXQA 2P5KA 2MW8A 3JRBA 4DYRA 3K1NA 3SDBA 3RYPA 4A3BJ 2RDPA 2EWNA 3AQSA 1OLTA 3VVXA 3PL8A 5CLSA 1HF0A 5HLIA 2HDWA 3VW2A 1XSDA 2JA6J 1ZG5A 3SEZA 3H1CA 4BDYA 3HOTA 2LBFB 2R7WA 3J7AO 2AQEA 3ECHA 2M30A 2FOKA 4MNUA 3QU6A 2IS2A 2VE9A 2UXHA 3VVYA 2A3SA 5HDKA 4MLOA 1C0WA 4KITB 3CESA 1OYIA 2VT2A 3W2AA 1F1ZA 3TDZC 2EPFA 2L4MA 2LR8A 2NVXJ 2VOPA 5L3FA 5DTDA 5E3MA 1QA6A 2NX4A 5FD6A 3S3OA 3O60A 4N9HA 4U0YA 3DU6A 4BUPA 2ZSHB 3SEQA 2JA2A 2FUG2 2P8TA 3K70D 1U8RA 2OTJI 2CQKA 5EGOA 3OYIA 1EH8A 2E5NA 3V8KA 3ZGKA 5D4RA 4G7OF 3ZMVA 4ZYAA 3EYYA 3A02A 3IUVA 5IP9J 1WI9A 2OF7A 3E97A 1R1TA 3GFLA 3I59A 5AQCA 2G0EA 4IJAA 4F92B 2QQ8A 5LFAA 3DBHB 3T6NA 3O8GA 5FFXA 1X2MA 3CZ6A 1OPCA 3BC8A 4BHCA 2BW3A 4IRIA 1S3JA 5ILVA 5LEJA 3H35A 1I27A 5EZHA 5CXIA 3CUQB 5F08A 1VQLI 3VYUB 2HDDA 1DUXC 5B5EC 3ELKA 3PPBA 3FXOA 4Q48A 3OY9A 2WUIA 3OYNA 3ANGA 2YU9J 2ZSIB 4HV5A 2DMTA 5J3LA 4PJNA 4A6EA 4Y17A 5ILSA 4LG3A 2V6CA 4KMUX 4C2TA 1KQ9A 4UV8A 2HR3A 3K1PA 3MKLA 1K7AA 4KNYA 3HTJA 2P4WA 2QKOA 4UUSB 2F5DA 1ZHFA 1ZLJA 1BJAA 4JX6A 3IRQA 2ID6A 1T2KA 4AC6A 5BPDA 3VOXA 4O3MA 4F91B 2V26A 1YW9A 2CV2A 4E7SA 1Z05A 2E1MC 2O8XA 2V57A 5L3BA 2DN0A 2DMUA 3BG5A 5HODA 4NQWB 3SFZA 3E6BA 3FKJA 3U9GA 1HOMA 4LG0B 1G3TA 3BQZA 3GTLJ 5CXGA 1U5TB 3S14J 1MZBA 3S5RA 3CCVI 3IL2A 4A5MA 3GTJJ 1Y39A 2ZFWA 1FEXA 4PGHA 5BNGA 1SC7A 3CO7C 2CFXA 4AIKA 2QZ8A 1UB9A 1I3QJ 1TQIA 5CPRB 2V1XA 5GPAA 2A05A 1ONVA 2EIJH 2H1KA 1X19A 2L9RA 2KIFA 3LSRA 5J4VA 2V1NA 2VASA 4ZTJA 3DF8A 2CH0A 3FKIJ 4ZDPA 3LSMA 2DJNA 2J5OA 2K9NA 3HSEA 3PFIA 1VQ9I 2VPRA 3HRUA 2HOEA 3KEYA 5F64A 1IC8A 1G6NA 2YVHA 3V8JA 2FRHA 1IRGA 2ZC2A 5EJCA 4BEHB 1RESA 4M9ZA 2M0CA 5IYBJ 1SVMA 1P7JA 2XAQA 3BJ6A 4HAMA 5D6EA 4AM3A 4YEJA 4AUXA 3J81K 1TLHB 4ZH4F 1QGPA 2EIKH 1ZRFA 5KNLA 2KIMA 1JGSA 1QZEA 1H9GA 1G2HA 3BJAA 4R79A 2X0LA 5E20A 1HKQA 2M4KA 2PI0A 4KIFA 1ERDA 3OYJA 5F0HA 2X9DA 3DFGA 1IJWC 2F07A 1W1WE 2Y69H 2Y2ZA 4HRIA 2XB0X 4MK6A 3JRCA 3HIFA 5JLXA 4ESFA 2A6EF 1MBGA 5DUKA 3LAJA 4BE1A 3MCZA 4A3KJ 3ZQHA 4X1EA 1IAWA 3LSKA 3GFMA 2ACJA 2GENA 1QQIA 2QUFA 5JHFA 5E79C 3QAHA 2Z33A 2P5VA 3GTMJ 3CC2I 2OZ6A 2COBA 1T39A 5K7HA 3OS2A 4PJLA 2HTSA 1X3UA 1KU3A 5HSZA 2QSGX 2DU9A 1BI2A 3AG4H 4LIUA 2KQRA 2ZB9A 2JA8J 1GVJA 1ZRCA 3Q5FA 4Y33A 1HSTA 2HVSA 3QODA 5JFRA 3ZN1A 1HLVA 3I4NJ 4N9IA 4HNUA 1ETXA 2WTEA 4MQVA 3G71I 2O6GE 4J00A 4IF4A 1GT0C 5ICEA 2QBYB 3KZYA 1K6OA 2GUHA 1D3YA 1B6AA 3HB9A 4GFLA 3CMAI 2BGCA 2CQ7A 2YX7A 4L9VA 4M3BA 4ZZDA 1YRNB 1VQ8I 3CLQA 3OV8A 4IQ4A 4M9XA 4RGUA 4N4NB 2L7MP 3ABMH 4BGDA 4I09A 1ENHA 2QEXI 1GDTA 1MGTA 1VZ0A 3J80K 5E18F 4Y52J 2WB1A 2ZNZA 3WE2A 1PUFB 1VQ7I 5GPCA 3FBIB 4M73A 4G6TB 5FLXK 4BXFA 1EA3A 1TW3A 3LAPA 3RPUD 1H9TA 2B63J 5D5XB 2L7KA 2R7DA 5C3EJ 1FBQA 5FJ8J 3I4PA 1OYWA 2JA5J 5EEHA 3DLAA 1FBSA 3FXKA 2RKHA 4L9JA 3KKDA 2CRGA 3V42A 5LGNA 2ZNYA 5CW8A 4JP0A 4IPAA 5LRSA 2VL8A 1WJFA 4IL6C 3JR9A 2TRTA 3ABUA 2X1CA 5M5WJ 2QIBA 1O7LA 2JTVA 2CV1A 2KLOA 1LNWA 2LFBA 5F1RA 3RD3A 4RLFA 4BY1J 3RTRA 3ZQCA 1X2NA 4PFPA 2CUFA 3Q0WA 1BA5A 1PVEA 2X6XA 3QOEA 1H0MA 2KJCA 3K4CA 3H3ZA 1FMWA 1OFCX 1Z6TA 2IS1A 3GZ5A 2R5ZB 2YS9A 4LOCA 2RASA 1ZR4A 2XAFA 2LKXA 3F22A 4ENJA 4ZDLA 2XB5A 2K9QA 4RAFA 4XQFA 4XN0A 3DCFA 2JVHA 2HQRA 4BHPA 1N75A 4RAZA 4PFOA 4AIDA 4RM3A 2M4GA 2IP2A 3TO6A 5HLHA 1E3PA 1FYKA 4DBRA 2VBWA 4GCTA 4A3GJ 1B9NA 4BU2A 1YLFA 2O03A 4EM1A 3H5NA 1XD7A 2X85A 4RB0A 2XASA 4G7HF 4DIQA 2R7TA 4MIMA 1JHHA 3NWTA 1MBFA 2FOWA 1DGRM 3OWTA 1PUEE 3NWSA 1F5TA 1F9NA 3ZXSA 4AD9A 4IHVA 2P5LC 2EH3A 4UVCA 2VI6A 3L9FA 1LE8B 3FXMA 4V2GA 3E6CC 3Q0VA 3D5RC 3OYMA 4JX5A 4LJZF 1QBJA 1FIPA 3FF5A 3K69A 2NP5A 4G6QA 5BMZA 1MD0A 3ECOA 4L5JA 3A01A 3OYBA 2ZXJA 4G94A 3P5JA 1X1CA 5DCMB 5HS7A 5D8LB 2R4GA 3N05A 3R6SA 4A3IJ 3G1MA 3HBLA 2G7LA 3FXJA 1P92A 1TT0A 2KISA 5F0CA 1Y1WJ 3T1BA 2XUBA 3LQRA 1LFUP 2UZKA 1Z91A 2DMNA 2R0QC 4F3QA 4UXNA 3HOZJ 1LVKA 2K5CA 3CF5F 5BPIA 4XLNF 3DQVC 2XGEA 1J75A 1MIJA 1DU0A 1XX5A 1XSXA 2MLKA 2FQ4A 1BC7C 3NNRA 4C2MJ 3W6KB 2DDBA 2VJJA 1J59A 2ZMEC 1IF1A 3BDDA 5AONA 3JRHA 2K02A 1K79A 3I58A 2JUCA 2RC4A 1XGMA 1USSA 1AWCA 2QSHX 4K2EA 3JRGA 2RREA 3HUGB 2CV0A 3S93A 2RN7A 3WGIA 3T8TA 5HVQC 2GZWA 3OYFA 1ETYA 1WHUA 1BOBA 4UDSA 2HDCA 4RAGA 2DQLA 1R1UA 1XDUA 2JZYA 1Y6IA 3BR5A 1I6XA 2ICWG 4Q4ZF 2DPUA 2JRTA 1A36A 2B7EA 2Z9OA 2JT1A 2IXSA 2CQXA 1S7EA 3H0GJ 2MABA 1RRJA 1D5VA 4N0BA 1A5JA 2OU2A 4RA2A 1B8IB 3V78A 3ESWB 1TT5B 2DFEA 2MG4A 3VDXA 1IRZA 2H27A 1JKRC 5GAEJ 1W5TA 1H89C 1HKTA 3HM5A 3GWZA 1H8AC 3H5AA 3I9V2 1LJ9A 2K40A 3VSKA 4RGRA 1DPRA 3HC7A 2NVQJ 4P9FA 1L0OC 4I0BA 1RPWA 4D1QA 4I7HA 1HW2A 3VYSB 1OJLA 4FX0A 5BOXA 1K4SA 2DA3A 1ZELA 3H3UA 1JHFA 2PMZN 2EBIA 1MSFC 1ULYA 1MBJA 2WC2A 4L5IA 1MJBA 2LTPA 3Q9VA 2V79A 1A35A 5HAWA 2ECBA 3WTSC 2A5WA 1MMSA 3HGGA 4HQMA 4J01A 3GZIA 2CYYA 1X4OA 3DBRB 3N4MA 1MBKA 3VPRA 2Q2EB 2OA4A 2UWMA 2VB6A 5LGTA 4E7IA 1XGNA 4CCKA 1T33A 2JWTA 4UY8I 3R60A 3WODF 3OYGA 3BQYA 3RPUA 2R7FA 4AVPA 5D8KB 1WSUA 2VQLA 1FYLA 1HQCA 2ZJQF 2J5PA 2VJIA 3TQNA 3QU3A 3OIQA 4PUSA 4KDPA 2FJI1 3W2WA 2DI3A 2EZIA 4CDGA 3H9GA 1VQMI 4B1RA 2WGBA 2DA1A 2QYOA 1LDKB 4RS8A 3C2BA 4G8XA 3QQAA 2PN6A 2EIMH 3H3VK 2Z99A 2HWVA 2GQQA 3BG6A 2FMLA 4XN3A 4F55A 2O8KA 4L0YB 1TTYA 3J7AY 1ACIA 3ZQFA 2PFVA 4BL0B 1H88C 5J8FA 5E8GA 3IUOA 5J1UA 2EV5A 3SZPA 3L2UA 3SDGA 4ZC3A 2JUGA 1YE9A 2ESNA 2V7FA 1B72A 3A4CA 3L2VA 4A6DA 2VUMJ 1UG0A 2EFQA 4WF2A
chains in the Genus database with same CATH topology
3RKQA 5FKOA 4DW6A 5FKMA 2NOGA 2UXHA 1Z77A 1TWAJ 3BR1A 3VVYA 2YVEA 4MLOA 5FKLA 3BHQA 3OOUA 9ANTA 2MGQA 3S2DJ 2NP3A 2XPVA 2LR8A 2NVXJ 3S1QJ 2XSDC 5M3MJ 4BKXA 5DTDA 5E3MA 2NX4A 3CWRA 3O60A 4CGRA 1AHDP 2DA7A 3LJLA 3BR3A 1I50J 3SFIA 5EGOA 3IV5A 1P7IA 3BT9A 2IU5A 3JREA 2CJJA 5C4YA 3GTPJ 1B72B 2EZKA 2FX0A 3A02A 3IUVA 5IP9J 3A01B 2OF7A 5AQCA 2G0EA 1ZK8A 1FTZA 2XDNA 3T6NA 3O8GA 1X2MA 2ZCMA 3HGYA 2DMPA 4UUSA 3TEDA 2E2JJ 2HKUA 2GM4A 4GCLA 4MFDA 2E2IJ 4X6AJ 5EZHA 1VF9A 4A93J 5CXIA 4BY7J 5F08A 1JJ8C 1R9TJ 2HDDA 3PO2J 3ANPA 2Y0SN 3E7LA 2X6OA 3PPBA 1RR7A 2QWTA 4A3FJ 5EGOB 2WUIA 2JMWA 1MBHA 3ANGA 1Y1VJ 2YU9J 1K83J 1Q1VA 2DMTA 4QSHA 5J3LA 1FTTA 1XS9A 3I4MJ 2NS7A 3CRJA 1WI3A 2FJ1A 2RHAA 3SJMA 1JTXA 3ZQGA 1W0TA 1WCMJ 3MKLA 3HTJA 3CCYA 1LFBA 2QKOA 2UXIA 4UUSB 1U78A 3NRGA 1HCRA 3NI7A 3TP3A 2AO9A 4JX6A 2ID6A 5FLMJ 4A69C 4AC6A 3VOXA 2Y31A 3QPLA 2LD5A 4JKZA 1T56A 4AYBN 2CU7A 1BL0A 2LLKA 2V57A 3K2AA 1JUPA 2DN0A 1SFOJ 2DMUA 4A3JJ 4NELA 3BG5A 5HODA 1GUUA 3S1NJ 5C4JJ 3JRIA 4IHXA 4BXXJ 1HOMA 1NK2P 3BQZA 2DG7A 1U9NA 3LSJA 3GTLJ 1UG2A 5CXGA 5M3FJ 3S14J 2CUEA 3S16J 3KZ9A 3HIMA 3S5RA 4NDLA 3O8HA 3GTJJ 3ZQIA 1FEXA 3BG3A 5BNGA 1QVTA 2HXOA 1RETA 2TCTA 1RKTA 4GFBA 1IDZA 2W48A 2DTZA 4IEJA 2M8GX 4GFKA 1I3QJ 1ETKA 1XC5A 2NS8A 5GPAA 2H1KA 4YZEA 3S17J 1ITYA 2L9RA 5F27A 3LSRA 3HOVJ 4B4CA 2HOSA 4EEFG 5E3NA 4FE7A 1BJZA 2R92J 1MH3A 2GBYA 3FKIJ 3GTQJ 2UXUA 2Y9YA 5DS9A 2DJNA 5K58A 2WV1A 2K9NA 2XGCA 3A03A 3BNIA 1HDPA 4A3EJ 3ZQLA 1LE8A 2HOAA 2VPRA 1JTYA 3NARA 4XK4A 2Y9ZA 5FLVA 1QVUA 1IC8A 2I10A 5EEAA 2YVHA 3PASA 5IYDJ 1AKHA 1APLC 1NK3P 1RESA 1IG7A 2M0CA 5IYBJ 3GEUA 1P7JA 3S2HJ 3EUPA 1F36A 1VFCA 4DYCA 1VI0A 3M3YJ 3W6VA 4AUXA 5E3OA 3RZDJ 3LNQA 3UKGA 2KDZA 1G2HA 1W0UA 2G7SA 2M9HA 3HTIA 4Y7NJ 3LWJA 4UUTA 4XICA 5E3LA 2R7ZJ 2QTQA 1MH4A 2H8RA 5F0HA 2X9DA 3TW6A 1IJWC 2F07A 1VNDA 4MK6A 2Y2ZA 3COLA 2XB0X 3JRCA 2GLOA 5JLXA 2WAQN 4W97A 1POGA 1MBGA 2VKVA 3S1RJ 3VP5A 2JA7J 3HOYJ 3GTOJ 1UI6A 1IGNA 4A3KJ 3HKZN 5EYRA 4X1EA 3ZQHA 3IH2A 2PBXA 4AF5A 3G1OA 2GENA 2NVTJ 4RBOA 2DMQA 3OSFA 5M5YJ 3GTMJ 2COBA 4IHWA 1YRNA 2FD5A 5K7HA 1K61A 5HSZA 4XRMA 3NXCA 3QBMA 5DAJA 1UI5A 3ZOBA 2ZB9A 2JA8J 3RZOJ 1MNMC 3BG9A 1PUFA 1FJLA 2LVSA 1HLVA 4L5EA 3I4NJ 1ETXA 5EFYA 3K7AJ 3TW7A 1WH7A 4M3GA 4M3DA 1O4XA 2AHQA 2D6YA 2QF7A 1GT0C 2IAIA 1GV2A 2GUHA 3HTHA 2IBDA 3WHCA 1JGGA 1WGXA 3HB9A 4GFLA 4I76A 1EF4A 4M3BA 5IPAA 1YRNB 2HYTA 3EGQA 2L7MP 2R5YA 2Y30A 2M34A 1MBEA 2ELKA 1ENHA 2EZHA 4CYCA 1GDTA 2UXPA 3BCGA 4XIDA 5FKNA 4Y52J 4JL3A 3Q3SA 1MSEC 3BTJA 1PUFB 5GPCA 4IHYA 2ID3A 3JRFA 2WB1N 2G3BA 3G1LA 1JKPC 4J19A 5EZGA 3BRUA 3CJDA 2B63J 2XRLA 1U9OA 2D5VA 1TC3C 1GVDA 2R5ZA 2L7FP 1CQTA 4GCKA 3VW1A 5C44J 5C3EJ 3D1NI 3B6AA 5FJ8J 3Q0UA 2NVYJ 2JA5J 4BBRJ 3KKDA 2CRGA 5FMPA 1IDYA 2K9SA 2REKA 3GTKJ 2OPTA 2HXIA 4M6VA 5CW8A 4JP0A 3JR9A 2TRTA 5M5WJ 5H9TA 2R5YB 2QIBA 4CYCB 5FGLA 2LFBA 4FE4A 3RD3A 3HOWJ 2ECCA 4RDUA 4BY1J 3HOXJ 2VKEA 3ZQCA 1X2NA 2X48A 3NAUA 2CUFA 3Q0WA 1BA5A 3ON2A 3DPJA 4C3IJ 1UHSA 1OFCX 4B3AA 2R5ZB 2YS9A 4LOCA 5EG0A 2RASA 2L7ZA 1ZR4A 3ON4A 3KKCA 2LKXA 3KNWA 5D1RA 2XB5A 2K9QA 3F1BA 5D19A 2Q24A 3LOCA 4M3FA 4DZPA 3HTAA 3DCFA 3IH3A 3PM1A 4JX4A 4ME9A 2EQRA 5K7ZA 5F04A 4HKUA 3BJBA 3HEFA 4GCTA 2HI3A 2JK3A 4A3GJ 3AQTA 2PZ9A 1OCPA 3FISA 4BBSJ 3CQZJ 3VIBA 5C4XJ 1IUFA 4MIMA 3S1MJ 3JSJA 4A3DJ 1MBFA 3B6CA 3MVPA 5EG0B 4QIWN 2ME0A 1UMQA 4IHVA 3M4OJ 5IP6A 2EH3A 3VVZA 2VI6A 3VW0A 1TWGJ 2EZLA 1LE8B 5M5XJ 1A6IA 2LP0A 1X58A 4V2GA 5EDNA 3Q0VA 1IV6A 1QPIA 4JX5A 2XGDA 1FIPA 4V2FA 1NTCA 1AKHB 4L62A 1HDDC 2NP5A 3GTGJ 3HDDA 4QTRA 1GV5A 2UXOA 3L1PA 3A01A 3BTIA 1TWHJ 1SGMA 1ZTRA 1RKWA 3RQIA 3G1MA 1BW6A 3HBLA 3FIWA 5K7FA 4A3IJ 2G7LA 1WH5A 3RH2A 5J1RA 2QOPA 3BR6A 4FTHA 5F0CA 2DG8A 1Y1WJ 2DA2A 3QKXA 5HBUA 3E7QA 5FHPA 1LFUP 3IH4A 4AC0A 3PO3J 2DMNA 2R0QC 5GP9A 2IEKA 5IOYA 4A3MJ 2DA6A 5IOZA 2L0KA 1OCTC 4S0HB 3HOZJ 1ORKA 3CDLA 3GBGA 3HE0A 2XGEA 3V6GA 1JKQC 1DU0A 1I6HJ 3LSGA 1B8IA 2FQ4A 1FIAA 3BR2A 1ETQA 4C2MJ 3NNRA 2M2EA 2P81A 2QCOA 1AU7A 1ZR2A 2ZOZA 3JRHA 5JLWA 2MSYA 1U8BA 4I6ZA 2ZCXA 4C3HJ 3JRGA 1WPKA 1BW5A 4D5CA 3FRQA 4D5FA 2JJ7A 1ETYA 2OI8A 2HYJA 5FKKA 4UDSA 2DA5A 3BR5A 3FK7A 4DZJA 2LY9A 1E3OC 3MN2A 4NN1A 2XPUA 2CQXA 1S7EA 3S15J 1ZKGA 3H0GJ 3QPSA 4HNVA 2N8GA 5F0FA 1A5JA 2OERA 2RAEA 3OIOA 3G7RA 4PXIA 1B8IB 3V78A 4ABZA 3BTCA 3LHQA 2MG4A 3DEWA 4D7NA 1IRZA 1JKRC 1H89C 3VOKA 3HM5A 5EF6A 4A3LJ 3LSPA 1H8AC 3VUQA 2GFNA 2CQQA 2K40A 1ZGWA 2HQ5A 2NVQJ 3CMYA 1RPWA 2R93J 3BTLA 2LK2A 1OJLA 2DA3A 3MNLA 2PMZN 4D7MA 2O7TA 2EBIA 3TP0A 1MSFC 4ICHA 1MBJA 4XRSA 3B81A 2LTPA 1ETOA 2FBQA 1JUMA 1JT6A 5HAWA 2ECBA 4W1UA 2DA4A 1JT0A 3NPIA 3HGGA 3GZIA 3FK6A 4DYQA 4A3CJ 2JN6A 1MBKA 3VPRA 1D5YA 3JRDA 1ETVA 3BR0A 5IYCJ 2XPWA 4JYKA 1T33A 4FCYA 2JWTA 2YUSA 3BQYA 4ACIA 4MFEA 3P9TA 2O7OA 1XG1A 2ME6A 5IP7J 2E2HJ 3JRAA 2ZOYA 3F0CA 2E19A 3HOUJ 2EZIA 2O9LA 1TWFJ 4MO7A 4B1RA 2WGBA 2DA1A 4C3JJ 1JUSA 3C2BA 3WHBA 4FISA 3QQAA 4M3EA 4MXMA 1F43A 3G56A 3H3VK 2G7GA 2MW8A 4G12A 4DYRA 3JRBA 3OSGA 2O8KA 3ZQFA 1JKOC 4A3BJ 1JJ6C 2ZCNA 2E1OA 1SANA 3C07A 1Z0XA 1H88C 3AQSA 1ZQ3P 4KWAA 5D18A 3VVXA 5J1UA 1HF0A 2HOTA 3SDGA 3VW2A 5J1YA 1QRYA 1TWCJ 2JA6J 2W53A 4XRSG 1B72A 1DU6A 5F1JA 2VUMJ 4JNNA 2KT0A 1ETWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RKQ A;  5FKO A;  4DW6 A;  5FKM A;  2NOG A;  2UXH A;  1Z77 A;  1TWA J;  3BR1 A;  3VVY A;  2YVE A;  4MLO A;  5FKL A;  3BHQ A;  3OOU A;  9ANT A;  2MGQ A;  3S2D J;  2NP3 A;  2XPV A;  2LR8 A;  2NVX J;  3S1Q J;  2XSD C;  5M3M J;  4BKX A;  5DTD A;  5E3M A;  2NX4 A;  3CWR A;  3O60 A;  4CGR A;  1AHD P;  2DA7 A;  3LJL A;  3BR3 A;  1I50 J;  3SFI A;  5EGO A;  3IV5 A;  1P7I A;  3BT9 A;  2IU5 A;  3JRE A;  2CJJ A;  5C4Y A;  3GTP J;  1B72 B;  2EZK A;  2FX0 A;  3A02 A;  3IUV A;  5IP9 J;  3A01 B;  2OF7 A;  5AQC A;  2G0E A;  1ZK8 A;  1FTZ A;  2XDN A;  3T6N A;  3O8G A;  1X2M A;  2ZCM A;  3HGY A;  2DMP A;  4UUS A;  3TED A;  2E2J J;  2HKU A;  2GM4 A;  4GCL A;  4MFD A;  2E2I J;  4X6A J;  5EZH A;  1VF9 A;  4A93 J;  5CXI A;  4BY7 J;  5F08 A;  1JJ8 C;  1R9T J;  2HDD A;  3PO2 J;  3ANP A;  2Y0S N;  3E7L A;  2X6O A;  3PPB A;  1RR7 A;  2QWT A;  4A3F J;  5EGO B;  2WUI A;  2JMW A;  1MBH A;  3ANG A;  1Y1V J;  2YU9 J;  1K83 J;  1Q1V A;  2DMT A;  4QSH A;  5J3L A;  1FTT A;  1XS9 A;  3I4M J;  2NS7 A;  3CRJ A;  1WI3 A;  2FJ1 A;  2RHA A;  3SJM A;  1JTX A;  3ZQG A;  1W0T A;  1WCM J;  3MKL A;  3HTJ A;  3CCY A;  1LFB A;  2QKO A;  2UXI A;  4UUS B;  1U78 A;  3NRG A;  1HCR A;  3NI7 A;  3TP3 A;  2AO9 A;  4JX6 A;  2ID6 A;  5FLM J;  4A69 C;  4AC6 A;  3VOX A;  2Y31 A;  3QPL A;  2LD5 A;  4JKZ A;  1T56 A;  4AYB N;  2CU7 A;  1BL0 A;  2LLK A;  2V57 A;  3K2A A;  1JUP A;  2DN0 A;  1SFO J;  2DMU A;  4A3J J;  4NEL A;  3BG5 A;  5HOD A;  1GUU A;  3S1N J;  5C4J J;  3JRI A;  4IHX A;  4BXX J;  1HOM A;  1NK2 P;  3BQZ A;  2DG7 A;  1U9N A;  3LSJ A;  3GTL J;  1UG2 A;  5CXG A;  5M3F J;  3S14 J;  2CUE A;  3S16 J;  3KZ9 A;  3HIM A;  3S5R A;  4NDL A;  3O8H A;  3GTJ J;  3ZQI A;  1FEX A;  3BG3 A;  5BNG A;  1QVT A;  2HXO A;  1RET A;  2TCT A;  1RKT A;  4GFB A;  1IDZ A;  2W48 A;  2DTZ A;  4IEJ A;  2M8G X;  4GFK A;  1I3Q J;  1ETK A;  1XC5 A;  2NS8 A;  5GPA A;  2H1K A;  4YZE A;  3S17 J;  1ITY A;  2L9R A;  5F27 A;  3LSR A;  3HOV J;  4B4C A;  2HOS A;  4EEF G;  5E3N A;  4FE7 A;  1BJZ A;  2R92 J;  1MH3 A;  2GBY A;  3FKI J;  3GTQ J;  2UXU A;  2Y9Y A;  5DS9 A;  2DJN A;  5K58 A;  2WV1 A;  2K9N A;  2XGC A;  3A03 A;  3BNI A;  1HDP A;  4A3E J;  3ZQL A;  1LE8 A;  2HOA A;  2VPR A;  1JTY A;  3NAR A;  4XK4 A;  2Y9Z A;  5FLV A;  1QVU A;  1IC8 A;  2I10 A;  5EEA A;  2YVH A;  3PAS A;  5IYD J;  1AKH A;  1APL C;  1NK3 P;  1RES A;  1IG7 A;  2M0C A;  5IYB J;  3GEU A;  1P7J A;  3S2H J;  3EUP A;  1F36 A;  1VFC A;  4DYC A;  1VI0 A;  3M3Y J;  3W6V A;  4AUX A;  5E3O A;  3RZD J;  3LNQ A;  3UKG A;  2KDZ A;  1G2H A;  1W0U A;  2G7S A;  2M9H A;  3HTI A;  4Y7N J;  3LWJ A;  4UUT A;  4XIC A;  5E3L A;  2R7Z J;  2QTQ A;  1MH4 A;  2H8R A;  5F0H A;  2X9D A;  3TW6 A;  1IJW C;  2F07 A;  1VND A;  4MK6 A;  2Y2Z A;  3COL A;  2XB0 X;  3JRC A;  2GLO A;  5JLX A;  2WAQ N;  4W97 A;  1POG A;  1MBG A;  2VKV A;  3S1R J;  3VP5 A;  2JA7 J;  3HOY J;  3GTO J;  1UI6 A;  1IGN A;  4A3K J;  3HKZ N;  5EYR A;  4X1E A;  3ZQH A;  3IH2 A;  2PBX A;  4AF5 A;  3G1O A;  2GEN A;  2NVT J;  4RBO A;  2DMQ A;  3OSF A;  5M5Y J;  3GTM J;  2COB A;  4IHW A;  1YRN A;  2FD5 A;  5K7H A;  1K61 A;  5HSZ A;  4XRM A;  3NXC A;  3QBM A;  5DAJ A;  1UI5 A;  3ZOB A;  2ZB9 A;  2JA8 J;  3RZO J;  1MNM C;  3BG9 A;  1PUF A;  1FJL A;  2LVS A;  1HLV A;  4L5E A;  3I4N J;  1ETX A;  5EFY A;  3K7A J;  3TW7 A;  1WH7 A;  4M3G A;  4M3D A;  1O4X A;  2AHQ A;  2D6Y A;  2QF7 A;  1GT0 C;  2IAI A;  1GV2 A;  2GUH A;  3HTH A;  2IBD A;  3WHC A;  1JGG A;  1WGX A;  3HB9 A;  4GFL A;  4I76 A;  1EF4 A;  4M3B A;  5IPA A;  1YRN B;  2HYT A;  3EGQ A;  2L7M P;  2R5Y A;  2Y30 A;  2M34 A;  1MBE A;  2ELK A;  1ENH A;  2EZH A;  4CYC A;  1GDT A;  2UXP A;  3BCG A;  4XID A;  5FKN A;  4Y52 J;  4JL3 A;  3Q3S A;  1MSE C;  3BTJ A;  1PUF B;  5GPC A;  4IHY A;  2ID3 A;  3JRF A;  2WB1 N;  2G3B A;  3G1L A;  1JKP C;  4J19 A;  5EZG A;  3BRU A;  3CJD A;  2B63 J;  2XRL A;  1U9O A;  2D5V A;  1TC3 C;  1GVD A;  2R5Z A;  2L7F P;  1CQT A;  4GCK A;  3VW1 A;  5C44 J;  5C3E J;  3D1N I;  3B6A A;  5FJ8 J;  3Q0U A;  2NVY J;  2JA5 J;  4BBR J;  3KKD A;  2CRG A;  5FMP A;  1IDY A;  2K9S A;  2REK A;  3GTK J;  2OPT A;  2HXI A;  4M6V A;  5CW8 A;  4JP0 A;  3JR9 A;  2TRT A;  5M5W J;  5H9T A;  2R5Y B;  2QIB A;  4CYC B;  5FGL A;  2LFB A;  4FE4 A;  3RD3 A;  3HOW J;  2ECC A;  4RDU A;  4BY1 J;  3HOX J;  2VKE A;  3ZQC A;  1X2N A;  2X48 A;  3NAU A;  2CUF A;  3Q0W A;  1BA5 A;  3ON2 A;  3DPJ A;  4C3I J;  1UHS A;  1OFC X;  4B3A A;  2R5Z B;  2YS9 A;  4LOC A;  5EG0 A;  2RAS A;  2L7Z A;  1ZR4 A;  3ON4 A;  3KKC A;  2LKX A;  3KNW A;  5D1R A;  2XB5 A;  2K9Q A;  3F1B A;  5D19 A;  2Q24 A;  3LOC A;  4M3F A;  4DZP A;  3HTA A;  3DCF A;  3IH3 A;  3PM1 A;  4JX4 A;  4ME9 A;  2EQR A;  5K7Z A;  5F04 A;  4HKU A;  3BJB A;  3HEF A;  4GCT A;  2HI3 A;  2JK3 A;  4A3G J;  3AQT A;  2PZ9 A;  1OCP A;  3FIS A;  4BBS J;  3CQZ J;  3VIB A;  5C4X J;  1IUF A;  4MIM A;  3S1M J;  3JSJ A;  4A3D J;  1MBF A;  3B6C A;  3MVP A;  5EG0 B;  4QIW N;  2ME0 A;  1UMQ A;  4IHV A;  3M4O J;  5IP6 A;  2EH3 A;  3VVZ A;  2VI6 A;  3VW0 A;  1TWG J;  2EZL A;  1LE8 B;  5M5X J;  1A6I A;  2LP0 A;  1X58 A;  4V2G A;  5EDN A;  3Q0V A;  1IV6 A;  1QPI A;  4JX5 A;  2XGD A;  1FIP A;  4V2F A;  1NTC A;  1AKH B;  4L62 A;  1HDD C;  2NP5 A;  3GTG J;  3HDD A;  4QTR A;  1GV5 A;  2UXO A;  3L1P A;  3A01 A;  3BTI A;  1TWH J;  1SGM A;  1ZTR A;  1RKW A;  3RQI A;  3G1M A;  1BW6 A;  3HBL A;  3FIW A;  5K7F A;  4A3I J;  2G7L A;  1WH5 A;  3RH2 A;  5J1R A;  2QOP A;  3BR6 A;  4FTH A;  5F0C A;  2DG8 A;  1Y1W J;  2DA2 A;  3QKX A;  5HBU A;  3E7Q A;  5FHP A;  1LFU P;  3IH4 A;  4AC0 A;  3PO3 J;  2DMN A;  2R0Q C;  5GP9 A;  2IEK A;  5IOY A;  4A3M J;  2DA6 A;  5IOZ A;  2L0K A;  1OCT C;  4S0H B;  3HOZ J;  1ORK A;  3CDL A;  3GBG A;  3HE0 A;  2XGE A;  3V6G A;  1JKQ C;  1DU0 A;  1I6H J;  3LSG A;  1B8I A;  2FQ4 A;  1FIA A;  3BR2 A;  1ETQ A;  4C2M J;  3NNR A;  2M2E A;  2P81 A;  2QCO A;  1AU7 A;  1ZR2 A;  2ZOZ A;  3JRH A;  5JLW A;  2MSY A;  1U8B A;  4I6Z A;  2ZCX A;  4C3H J;  3JRG A;  1WPK A;  1BW5 A;  4D5C A;  3FRQ A;  4D5F A;  2JJ7 A;  1ETY A;  2OI8 A;  2HYJ A;  5FKK A;  4UDS A;  2DA5 A;  3BR5 A;  3FK7 A;  4DZJ A;  2LY9 A;  1E3O C;  3MN2 A;  4NN1 A;  2XPU A;  2CQX A;  1S7E A;  3S15 J;  1ZKG A;  3H0G J;  3QPS A;  4HNV A;  2N8G A;  5F0F A;  1A5J A;  2OER A;  2RAE A;  3OIO A;  3G7R A;  4PXI A;  1B8I B;  3V78 A;  4ABZ A;  3BTC A;  3LHQ A;  2MG4 A;  3DEW A;  4D7N A;  1IRZ A;  1JKR C;  1H89 C;  3VOK A;  3HM5 A;  5EF6 A;  4A3L J;  3LSP A;  1H8A C;  3VUQ A;  2GFN A;  2CQQ A;  2K40 A;  1ZGW A;  2HQ5 A;  2NVQ J;  3CMY A;  1RPW A;  2R93 J;  3BTL A;  2LK2 A;  1OJL A;  2DA3 A;  3MNL A;  2PMZ N;  4D7M A;  2O7T A;  2EBI A;  3TP0 A;  1MSF C;  4ICH A;  1MBJ A;  4XRS A;  3B81 A;  2LTP A;  1ETO A;  2FBQ A;  1JUM A;  1JT6 A;  5HAW A;  2ECB A;  4W1U A;  2DA4 A;  1JT0 A;  3NPI A;  3HGG A;  3GZI A;  3FK6 A;  4DYQ A;  4A3C J;  2JN6 A;  1MBK A;  3VPR A;  1D5Y A;  3JRD A;  1ETV A;  3BR0 A;  5IYC J;  2XPW A;  4JYK A;  1T33 A;  4FCY A;  2JWT A;  2YUS A;  3BQY A;  4ACI A;  4MFE A;  3P9T A;  2O7O A;  1XG1 A;  2ME6 A;  5IP7 J;  2E2H J;  3JRA A;  2ZOY A;  3F0C A;  2E19 A;  3HOU J;  2EZI A;  2O9L A;  1TWF J;  4MO7 A;  4B1R A;  2WGB A;  2DA1 A;  4C3J J;  1JUS A;  3C2B A;  3WHB A;  4FIS A;  3QQA A;  4M3E A;  4MXM A;  1F43 A;  3G56 A;  3H3V K;  2G7G A;  2MW8 A;  4G12 A;  4DYR A;  3JRB A;  3OSG A;  2O8K A;  3ZQF A;  1JKO C;  4A3B J;  1JJ6 C;  2ZCN A;  2E1O A;  1SAN A;  3C07 A;  1Z0X A;  1H88 C;  3AQS A;  1ZQ3 P;  4KWA A;  5D18 A;  3VVX A;  5J1U A;  1HF0 A;  2HOT A;  3SDG A;  3VW2 A;  5J1Y A;  1QRY A;  1TWC J;  2JA6 J;  2W53 A;  4XRS G;  1B72 A;  1DU6 A;  5F1J A;  2VUM J;  4JNN A;  2KT0 A;  1ETW A; 
#chains in the Genus database with same CATH topology
 2O5R A;  1W4M A;  3LQQ A;  1IRX A;  3EYI A;  5FKM A;  3BR1 A;  3WG9 A;  1D1C A;  3IP4 B;  4E4H A;  3OOU A;  1Y56 A;  9ANT A;  2MGQ A;  4S05 A;  2F5V A;  4HZF A;  2COM A;  1FP1 D;  5M3M J;  3O6B B;  3ONQ A;  4IOA F;  4ESJ A;  3J81 Z;  4DVY P;  1AHD P;  2DA7 A;  4U7B A;  2ZJR F;  3GZN B;  3HZJ A;  1YX5 A;  3ZN0 A;  4CUG A;  1UEL B;  3IV5 A;  3CCM I;  3JRE A;  2CJJ A;  4KN4 X;  1BR1 A;  3WE3 A;  5C4Y A;  1K6Y A;  4U0W A;  4U0V A;  3KCC A;  2A6T A;  3CCL I;  3OYK A;  2CW7 A;  2FA5 A;  1N77 A;  4RB1 A;  5DD4 A;  2XDN A;  1YS6 A;  4BYY A;  2K3P A;  1HKS A;  3HGY A;  3PIO F;  3TED A;  2BE5 F;  2HKU A;  2GM4 A;  4QWQ A;  1HSJ A;  4MFD A;  2XKP A;  4X6A J;  1FZP B;  1D0Z A;  1VF9 A;  5LGU A;  3ANP A;  3PO2 J;  2Y0S N;  2X6O A;  3JCU C;  4CHU A;  2GA2 A;  3E5Q A;  1R36 A;  2P6T A;  3KP6 A;  5EGO B;  3CCU I;  4A3F J;  1T8I A;  1KZH A;  2JMW A;  1MBH A;  2D1H A;  2VOD A;  3GUD A;  3K1M A;  4BQN A;  3F8B A;  4H0E A;  2ZXW H;  4Y15 A;  2OCC H;  1FTT A;  1TW2 A;  4E7Z A;  1XS9 A;  2NS7 A;  3KLN A;  3CRJ A;  4M9S A;  3I59 B;  1GLN A;  2FJ1 A;  3K9T A;  1E0E A;  3SJM A;  2JQ7 A;  2RNJ A;  3J7Z I;  3ZQG A;  4DNC A;  3V7S A;  4YIF A;  3CCY A;  2LY2 A;  4XRF A;  1ON1 A;  2BW3 B;  4WXH A;  1LVA A;  1HCR A;  3NI7 A;  2AO9 A;  2MA3 A;  2P6S A;  1VQN I;  4OIN F;  1ZAR A;  2AXL A;  5F6F A;  3JTH A;  2A2F X;  3HOS A;  3DBL B;  5IT9 K;  1PYV A;  2M7A A;  4UB6 C;  1P9Q C;  4AYB N;  1BL0 A;  2VKD A;  2LRD A;  4A3J J;  1QZZ A;  5TIS C;  1XN7 A;  4NEL A;  3F72 A;  1GUU A;  3C1D A;  5C4J J;  3S1N J;  1E3H A;  3JRI A;  4WWC A;  4BXX J;  2RQP A;  3J80 Z;  3G4S I;  2M45 A;  2ELH A;  4RMN A;  1LEA A;  3KZ9 A;  4NDL A;  5FLX Z;  1PJR A;  3O8H A;  1WRJ A;  1BI0 A;  2VQH A;  1QVT A;  1TQP A;  2TCT A;  2DJI A;  1IDZ A;  2DTZ A;  4IEJ A;  3FHN A;  1LFP A;  4GFK A;  1OQY A;  5J6X A;  5BQT A;  4YG2 F;  2MBF A;  3T8R A;  4EMS A;  2HPM A;  1ITY A;  5J47 A;  5F27 A;  2XSJ C;  2PMU A;  2HOS A;  4EEF G;  5E3N A;  2R92 J;  4RAY A;  2CWE A;  3GTQ J;  2Y9Y A;  3BZK A;  2XAJ A;  1MMN A;  2NRA C;  4V19 K;  1Y0N A;  5E1Z B;  3BNI A;  3LA2 A;  4OD4 A;  5L3G A;  3ZRG A;  3ZQL A;  3FHZ A;  4GYI A;  1JTY A;  5FLV A;  5EEA A;  4A12 A;  3PAS A;  2V9P A;  3M1E A;  3KLO A;  4UNO A;  4LGW A;  2XF5 A;  1WZ2 A;  1FBU A;  3GEU A;  4ON0 A;  3UR3 C;  3EUP A;  1VFC A;  5EEG A;  3SQN A;  2KIU A;  2VJ4 A;  3BCA A;  3HPH A;  5E3O A;  1K78 A;  1IN8 A;  1LKX A;  2ISY A;  3RZD J;  2FE3 A;  2DK8 A;  2H8W A;  4HQE A;  3EPZ A;  1VTN C;  3VEP A;  4Y7N J;  3LWJ A;  5GTI C;  3AG2 H;  5E3L A;  1YOV B;  1W7P A;  2YPR A;  2VBY A;  3FMQ A;  2H8R A;  1MMD A;  1VND A;  3OL3 A;  3COL A;  3HKZ A;  2I5U A;  3VP5 A;  2JA7 J;  3HOY J;  2QEN A;  4RGS A;  1UI6 A;  1IGN A;  3LFK A;  1O3R A;  2EV0 A;  2W4S A;  4GXO A;  5HLG A;  1IRF A;  1XGS A;  3PUF A;  4GDF A;  4HPQ A;  4TV7 A;  3S8P A;  5D5V B;  1LB2 A;  5M5Y J;  3OYH A;  3FM3 A;  2VJ5 A;  1VQO I;  3C2G A;  3PFY A;  3BPX A;  4XRM A;  2K4J A;  3IC7 A;  3M07 A;  2EK5 A;  3CO6 C;  3QBM A;  4PJ0 C;  5DAJ A;  2DOF A;  1UI5 A;  5B1A H;  3E5U A;  3RZO J;  1G4D A;  4ZYE A;  2XAU A;  3BG9 A;  3RJP A;  3TDU C;  5D4S A;  5DM7 F;  3RKX A;  2IGO A;  4G7Z F;  1R6R A;  2ZXH A;  2BV6 A;  1UJ8 A;  4M3D A;  2GWR A;  4M3G A;  1T98 A;  3BOQ A;  3DTE A;  4OIO F;  3BLY A;  2D6Y A;  2QF7 A;  1FWZ A;  3WHC A;  3CC7 I;  1WGX A;  4I0A A;  2KDO A;  3V7C A;  1DDN A;  2JPB A;  4I76 A;  4UVA A;  1EF4 A;  1ZYR F;  2VC0 A;  1R5H A;  2HYT A;  1D8J A;  2KHM A;  2R7U A;  2R5Y A;  2Z1D A;  1J2X A;  2OQR A;  3EQL F;  5IY5 H;  5DCF A;  3GFI A;  2L9S A;  4LIV A;  4BQA A;  2DFI A;  1QO0 D;  4ESB A;  4ZYH A;  3JRF A;  1YX3 A;  3LHQ A;  5EZG A;  4CZC A;  3CJD A;  1U9O A;  2D5V A;  2CO5 A;  1CQT A;  2IGK A;  2A69 F;  3RQ4 A;  3F6O A;  3MZH A;  3B6A A;  1QU3 A;  2MC4 A;  1Q1H A;  2MFZ A;  4YFK F;  4IRH A;  4XLP F;  1BBY A;  4YEL A;  1MDM A;  5FMP A;  2K9S A;  3BG7 A;  3GTK J;  3CF2 A;  1YIO A;  2OPT A;  1GXQ A;  2HXI A;  4M6V A;  1DGW Y;  3A2K A;  4EJU A;  1QPM A;  3JW4 A;  3SWH A;  4WXC A;  4LLN A;  2W00 A;  5H9T A;  4KN7 X;  1I1S A;  2XDV A;  3HRT A;  2VON A;  5FGL A;  3HOW J;  4RDU A;  3HSF A;  2X48 A;  3G73 A;  2PEX A;  3ON2 A;  1D1B A;  1R22 A;  2NS0 A;  1O3T A;  2RVC A;  2L7Z A;  1IXS B;  3KKC A;  2BZT A;  3KNW A;  2KRC A;  3I64 A;  3HTU A;  3L7W A;  4KIS A;  3QOP A;  3F1B A;  2GXB A;  2Q24 A;  1AA7 A;  3LOC A;  1Y8R B;  4MTE A;  4DZP A;  3G3Z A;  2HKO A;  4EJT A;  2XGX A;  3HTA A;  3PM1 A;  4JX4 A;  3KIO A;  2CS3 A;  2IJL A;  3H9J A;  3MZ8 A;  2K9M A;  2V4J C;  2XAG A;  5FB2 A;  2GAU A;  4LB5 A;  2R7O A;  2ELJ A;  4OIP F;  3K4N A;  3DEU A;  3HEF A;  4ANJ A;  3K0L A;  4BAY A;  4EGY A;  4Z6Y A;  2JK3 A;  3L2W A;  2PZ9 A;  3VFZ A;  2RGV A;  4XNF A;  3CQZ J;  3HRM A;  1O3S A;  1RNL A;  2IPQ X;  3JSJ A;  3ABK H;  1QHG A;  5ICC A;  1BR4 A;  2O3F A;  3HYI A;  3QPT A;  2B3W A;  1T95 A;  2BY2 A;  2RNG A;  1MNE A;  1OCC H;  5IP6 A;  4DGW B;  2DO7 A;  2DT5 A;  2EZL A;  1R23 A;  2HU9 A;  5M5X J;  4E70 A;  4II2 A;  1A6I A;  2MLG A;  1QPI A;  3Q9S A;  4L62 A;  1AKH B;  4ZYG A;  2Y0M A;  1E2X A;  3X2Q H;  5H6Q A;  4PJM A;  3HDD A;  5JVG F;  4QTR A;  4BE0 A;  2L9N A;  4XKC A;  3BTI A;  2NAZ A;  2W25 A;  4Y3O A;  1SAX A;  1D1A A;  5CYV A;  5LLQ A;  1DQU A;  2V1D A;  1X3W B;  1ZTR A;  3ISP A;  4H4K C;  1BW6 A;  4NUB A;  3FIW A;  3KE2 A;  4AU7 A;  5HNH A;  2VPL A;  2QOP A;  3BR6 A;  4HX8 A;  3E7Q A;  2UV1 A;  2K9L A;  4ENM A;  5FHP A;  4P1W A;  3AL0 C;  4AC0 A;  3PO3 J;  3KYL A;  1KU9 A;  1CF7 A;  2IEK A;  5IOY A;  5ICG A;  1WKM A;  3ULQ B;  5DDG A;  4UB8 C;  4XLE A;  1YHQ I;  2HQA A;  4WX9 A;  3KYC B;  1A6Q A;  2F48 A;  3V6G A;  4HX7 A;  4B3X A;  1I6H J;  3LSG A;  3S3N A;  3OYC A;  1ETQ A;  2VOO A;  2QCO A;  2E35 A;  1AU7 A;  1KA8 A;  1ZR2 A;  2ZOZ A;  5DV5 A;  2HPI A;  4CA0 A;  4CCO A;  5JLW A;  2MH9 A;  1U8B A;  1IZ1 A;  2ZCX A;  4CCJ A;  2K7L A;  2PG4 A;  3CUO A;  5L3C A;  5ICF A;  4KMF A;  1QNT A;  2Y0S A;  3GCM A;  3TO9 A;  4XKW A;  4D5C A;  3EUA A;  1FOX A;  2VKH A;  1ZGA A;  2OI8 A;  2HYJ A;  5FKK A;  5GAD J;  3FK7 A;  4XKB A;  4HDU A;  5KHD A;  1SVL A;  2LY9 A;  1E3O C;  1J7K A;  3QPS A;  4HNV A;  5F0F A;  2LY1 A;  3KP4 A;  3OIO A;  2OER A;  4PSX A;  2YX4 A;  2QQB A;  2HZD A;  3BTC A;  2TDX A;  3DV8 A;  4M6Y A;  3JAM K;  5B3S H;  1KQ0 A;  2A6H F;  4HYE A;  4A3L J;  3LSP A;  1LEB A;  1GHC A;  1OCO H;  1G3W A;  2CQQ A;  2KMU A;  2WBM A;  2L9V A;  1J9I A;  2JPC A;  2LK2 A;  3QPH A;  3MNL A;  1Z6R A;  2IS6 A;  2LKP A;  3CUQ C;  1EKE A;  4U88 A;  3TP0 A;  1BC8 C;  4XRS A;  4EQQ A;  1WJ5 A;  5AIQ A;  5JI6 A;  3WU1 B;  4QLC U;  1V5E A;  3OS0 A;  2OJE D;  2DA4 A;  1JT0 A;  3NPI A;  3ASN H;  4JBA A;  2G9W A;  4CCL A;  3AAF A;  2DXI A;  4A3C J;  2CW0 F;  4ZTF A;  3OS1 A;  2XAH A;  3K4K A;  4BNC A;  2Y75 A;  3RI4 A;  2XVC A;  4NC7 A;  3HG9 A;  5E8I A;  4JYK A;  3MZY A;  1WJE A;  1IN6 A;  1YQA A;  1PP8 F;  3LA7 A;  3QYE A;  3P9T A;  2L4A A;  5IT9 Z;  1NG7 A;  1J0R A;  2ZOY A;  2XIG A;  3BZC A;  2E19 A;  4XSZ F;  3KZI C;  1PDN C;  4KIG A;  4XOT A;  3HOU J;  5LHG A;  1HBX G;  1TWF J;  2VE8 A;  3P9C A;  4MO7 A;  2O9L A;  3S2W A;  3VYR B;  4C3J J;  2ZME A;  4ENK A;  4FIS A;  2EA4 A;  5KK1 A;  5JR3 A;  2ZO4 A;  4MXM A;  2BHY A;  1FSH A;  3S3M A;  3G56 A;  2F2E A;  1UAA A;  1EH7 A;  2E60 A;  1X4P A;  1WWX A;  2QLZ A;  1JKO C;  1TP4 A;  2UXX A;  3KX2 A;  1JJ6 C;  3PUB A;  2ZCN A;  1SAN A;  4M74 A;  1Z0X A;  2JSC A;  2ZJP F;  3C07 A;  1ZQ3 P;  4KWA A;  2BHZ A;  2DW4 A;  1MKM A;  4NBQ A;  1P4W A;  5J1Y A;  1QRY A;  3AFH A;  3CP8 A;  3REO A;  1DU6 A;  1S8N A;  4MTD A;  4JNN A;  3HPG A;  4UV9 A;  4OWR B;  1EJ9 A;  2UXN A;  2HNH A;  4I99 C;  3FZV A;  5FGM A;  2DOE A;  1YW8 A;  1BOA A;  4XLH A;  2F5C A;  4OMZ A;  3RKQ A;  3P9K A;  4DW6 A;  2NOG A;  1IW7 F;  2DQR A;  2KFD A;  1Z77 A;  3H0D A;  1F4K A;  2CQN A;  5FKL A;  3BHQ A;  5CVI A;  3S2D J;  4XLC A;  1KU7 A;  1DP7 P;  2NP3 A;  3S1Q J;  2VC1 A;  2XSD C;  4BKX A;  2HYF A;  1UHW A;  3DLL F;  4CGR A;  2K85 A;  3VTI A;  2X1E A;  2IGN A;  3LJL A;  3RKW A;  3WGH A;  3BR3 A;  2QKM B;  5D5U B;  2BYV E;  3AKZ A;  3GTP J;  1B72 B;  1X1P A;  4FAS D;  3CCS I;  1FY7 A;  2FX0 A;  1T0F C;  4XR6 A;  3I54 A;  4WXD A;  2FBH A;  2EIN H;  1ZRD A;  3ZQ7 A;  1JXS A;  2H94 A;  4AWX B;  1Y8Q B;  4FQG A;  2ZCM A;  4CXF A;  4PJJ A;  2DMP A;  4B43 A;  2BOL A;  4GCL A;  5CKT A;  2NVU B;  3COA C;  2DT6 A;  1U3E M;  2B1E A;  4A93 J;  4L18 B;  3M7G A;  1STZ A;  5AIP A;  4BY7 J;  1JJ8 C;  1R9T J;  5DM6 F;  3E7L A;  1N78 A;  2DTR A;  4RB2 C;  3J7Y J;  5L3E A;  2GXG A;  3FMR A;  3MD2 A;  4GYG A;  1P6R A;  1Z1D A;  1ZG3 A;  1Y1V J;  3FM5 A;  1ZLK A;  1XCB A;  3WGG A;  3OYE A;  1YTY A;  1Q1V A;  4QSH A;  1N25 A;  1SVO A;  2FMY A;  3OL4 A;  2RHA A;  4MGR A;  1LDJ A;  1JTX A;  3GYH X;  1WCM J;  4FET A;  4KFC A;  2UXI A;  1U78 A;  2KZV A;  3NRG A;  3KP5 A;  1SFE A;  1D0Y A;  4KYW A;  3K6G A;  5HDN A;  2QWW A;  3BWG A;  1TBX A;  3U21 A;  2E34 A;  3TO7 A;  4A69 C;  3QRF F;  5CQG A;  2W84 A;  3ROU A;  1FOK A;  3QPL A;  4AVZ A;  4BQQ A;  2LF7 A;  1T56 A;  4JKZ A;  1XMX A;  2HTJ A;  1D0X A;  1RIO H;  3P9I A;  3MKW B;  2VN2 A;  4BE2 A;  3ZMS A;  4IHX A;  2W82 A;  1NK2 P;  2EA2 A;  3FX3 A;  2DG7 A;  5M3F J;  2CUE A;  3S16 J;  1M1E B;  1BI1 A;  2X6Y A;  3F3X A;  1W5C C;  4HSR A;  3OYA A;  2FQ3 A;  3ZQI A;  1W36 D;  3BG3 A;  2ZBK A;  2HXO A;  5HNF A;  1RET A;  2DOD A;  2QM3 A;  1RKT A;  4ZYD A;  2W48 A;  2UUZ A;  4HST A;  2M8G X;  3W2V A;  1ETK A;  3OR2 C;  3S32 A;  4CH7 A;  3DP7 A;  1WJC A;  3A0B C;  4CSW A;  1MH3 A;  2GBY A;  4U87 A;  4LK0 F;  3K4L A;  2Z2S B;  5K58 A;  2ESH A;  4JK1 X;  4QPO A;  2XGC A;  3A03 A;  1LE8 A;  2HGC A;  2W24 A;  1X1D A;  3ZP5 A;  3NAR A;  3HJE A;  4EV0 A;  2Y9Z A;  1QVU A;  2Z3Y A;  2I10 A;  2OCE A;  3LL7 A;  4UVB A;  3MAJ A;  1APL C;  4L0Z B;  4O6J A;  2I8D A;  1IG7 A;  2M1B A;  1YJW I;  2IGM A;  4XM3 A;  1HC8 A;  1F36 A;  3TOB A;  5LRR A;  3WTY C;  2M5W A;  2VT3 A;  3M3Y J;  3RPQ A;  3MWM A;  4U9L A;  3W6V A;  1X1B A;  3L00 A;  4QPQ A;  4I98 B;  1Z7L A;  1OCZ H;  3KZZ A;  1LUJ B;  1P4X A;  1EV7 A;  3F8N A;  3OYL A;  1AOY A;  2DBB A;  4ETS A;  2H09 A;  3UKG A;  2KDZ A;  2XF7 A;  1W0U A;  3IKT A;  2G7S A;  4UUT A;  4DOZ A;  4B8X A;  4E7J A;  4XIC A;  1XGO A;  4E7H A;  3O3K A;  3DXJ F;  3VB2 A;  2G7H A;  4KA4 A;  2WAD A;  4WK8 F;  3MMY B;  3RSN A;  2WAQ N;  4W97 A;  1MJA A;  1POG A;  2VKV A;  4ZDO A;  1WQ2 A;  3I55 I;  3KET A;  5GAH J;  5EYR A;  2E7W A;  3K4B A;  4AF5 A;  3G1O A;  2PX9 A;  4RM2 A;  2GOX B;  3DU5 A;  2DMQ A;  4G6D A;  4RBO A;  3OSF A;  5CVJ A;  4IRV A;  1B9M A;  2XC7 A;  4LD5 A;  3WU0 A;  3GEZ A;  3LMM A;  1XSV A;  1K78 B;  2XHK A;  3C18 A;  3CLO A;  4Y4R A;  3NEU A;  2OD5 A;  1VQK I;  1W7P B;  3DKX A;  4GRI A;  1Z67 A;  2M7B A;  2WWY A;  2DYS H;  2NNY A;  1YJN I;  1ZH5 A;  1VQ4 I;  3MFK A;  1J09 A;  4EM2 A;  3TGN A;  1FT9 A;  2LVS A;  2R7R A;  4L5E A;  3UNG C;  3K7A J;  1WH7 A;  1RUN A;  3CJN A;  3CDI A;  3F6V A;  2AHQ A;  2W7N A;  2E1M B;  2BBY A;  2C6Y A;  2IAI A;  2ZY9 A;  2IBD A;  2D1V A;  3E6D A;  3MQ0 A;  3TOA A;  1JGG A;  4XKV A;  1XDS A;  2NXN B;  4GO1 A;  5IPA A;  3L09 A;  4IOC F;  2ZCW A;  4OIR F;  3CJR B;  1SFX A;  2LOO A;  1R5I D;  3EUK L;  4O5V A;  4CYC A;  2ELK A;  2EZH A;  3M1C A;  5H20 A;  2X6W A;  2UXP A;  4XID A;  1V54 H;  3BCG A;  4JL3 A;  3M8E A;  1MSE C;  3BTJ A;  4BXU A;  2L3D A;  2W57 A;  2ID3 A;  2STW A;  1G8X A;  2A07 F;  4Z2Y A;  2WB1 N;  1B4A A;  3G1L A;  4G9Y A;  1JKP C;  4J19 A;  2G3B A;  3BRU A;  3CP2 A;  2XRL A;  3EET A;  3E0J B;  3DEE A;  1TC3 C;  2OTL I;  1GVD A;  3ZMD A;  4GCK A;  4E7L A;  3VW1 A;  5C44 J;  3ZPL A;  4CO8 A;  2FBK A;  2FBI A;  4HBL A;  4CCN A;  1RR8 C;  1PP7 U;  2DT7 B;  2H1L A;  2BVM A;  5K5R A;  4NC6 A;  2M8E A;  4HA8 A;  2R5Y B;  4P5O A;  4BJT A;  2D45 A;  3SXY A;  1U0J A;  5FFZ A;  3LA3 A;  2HZT A;  2ECC A;  4P96 A;  4PK4 A;  3NAU A;  4AIH A;  2AXT C;  3R0A A;  4E7K A;  3JAM Z;  4NB5 A;  3ZCO A;  4A2U A;  3D5S C;  1R1V A;  1UHS A;  2YVX A;  4GGG A;  4B3A A;  1UFM A;  3TBI A;  3C3W A;  5EG0 A;  4N4O B;  1YYV A;  1JI8 A;  1BR2 A;  4EJO A;  1IN7 A;  3LSH A;  4ZJZ A;  1MDM B;  5D1R A;  5DUI A;  5D19 A;  3I53 A;  4E6K G;  4IXA A;  2B0L A;  3IH3 A;  4KT6 A;  4ME9 A;  2EQR A;  4LIT A;  5K7Z A;  5E17 F;  3D0S A;  5F04 A;  4I01 A;  4HKU A;  3ABT A;  3QYB A;  1MJ9 A;  3E6M A;  3AQT A;  1VQP I;  1OCP A;  1V55 H;  3VSL A;  5LBQ A;  5TGT A;  4NC8 A;  3VIB A;  1IUF A;  2Q8K A;  3S1M J;  3HTS B;  4PSW A;  4A3D J;  4LMY A;  3MVP A;  2ME0 A;  1XTA A;  4B09 A;  2Y48 A;  5DD8 A;  4C2U A;  1MMA A;  3C7J A;  3AL0 B;  3SYT A;  1GXP A;  3WTW C;  3VW0 A;  2FXA A;  2PJR A;  4UUV A;  3CMM A;  3KP2 A;  1IUY A;  2LP0 A;  1YS7 A;  3HXL A;  5EDN A;  3DWL E;  4LK1 F;  5DEQ A;  2BY0 A;  3MEX A;  2MD0 A;  4PZJ A;  1EH6 A;  3QP6 A;  5B66 C;  3KYD B;  4IO9 F;  2UXO A;  1WJA A;  1FMV A;  5DYM A;  1ZN2 A;  4BJ5 C;  4Y13 A;  1S72 I;  3H9Q A;  2DYR H;  4HF0 A;  2E7X A;  1SGM A;  2QVO A;  4OU0 A;  3RH2 A;  1TQM A;  1CGP A;  1WH5 A;  1SD6 A;  2K86 A;  1R4N B;  1I5Z A;  2DG8 A;  2DA2 A;  3QKX A;  5HBU A;  3IH4 A;  4I2O A;  2K3F A;  5GP9 A;  4R1H A;  3B73 A;  4A3M J;  4B48 A;  1J5Y A;  1ON2 A;  5IOZ A;  3KP3 A;  1HW1 A;  2L0K A;  4S0H B;  2E71 A;  4CGZ A;  2DPD A;  3HE0 A;  2GOM A;  4MEY F;  1TNT A;  1JKQ C;  3EUH C;  2VXZ A;  3ABL H;  1FIA A;  3BR2 A;  3KEO A;  2DCE A;  2L2O A;  2P81 A;  2F4M B;  2Q0O A;  1KYW A;  3WTV C;  3BCB A;  3PIP F;  2MSY A;  3BZ6 A;  5HS9 A;  5TJJ A;  5E1X A;  3DTK A;  3T0Y A;  4C3H J;  2KP6 A;  1W36 C;  2M0M A;  4P55 A;  3N97 A;  1BIB A;  3GXO A;  3W3C A;  2WAE A;  1MMG A;  3RKY A;  2OBP A;  2FEZ A;  3U1D A;  1BIA A;  3GFJ A;  1CF7 B;  5CVV A;  2E1C A;  3R61 A;  1JE8 A;  3NS4 A;  3MN2 A;  1Z21 A;  3CCQ I;  4PCQ A;  4XLF A;  2DLL A;  3S15 J;  1NHA A;  4A0Z A;  2X1D A;  2R7Q A;  1P2F A;  3G7R A;  4PXI A;  2XRO A;  5CVU A;  2R7X A;  3CCJ I;  3E1S A;  1VQ5 I;  2A5Y B;  4ABZ A;  3MKY B;  1O57 A;  3VOK A;  2Z16 A;  2L02 A;  4DJA A;  3VUQ A;  2GFN A;  3C2H A;  4NHJ A;  4BQO A;  1Z9C A;  2JVG A;  2PMZ A;  3LWF A;  1U2W A;  4IHS A;  1XPX A;  3ZMT A;  1S6L A;  5FRN A;  2A61 A;  1WJB A;  3DPU A;  4IVN A;  1V5G A;  1ETO A;  4HV6 A;  2QA4 I;  1S7O A;  2B9S A;  4W1U A;  1I3A A;  5FO5 A;  5H2F C;  1NG6 A;  2F4O B;  3FK6 A;  4DYQ A;  1TL8 A;  1B1B A;  1LQ1 A;  4HLX A;  5LD2 C;  2Q1Z B;  2R3S A;  3QYF A;  3KP7 A;  3BR0 A;  2XPW A;  2EFN A;  3VOD A;  2YUS A;  2HEO A;  3KEQ A;  2H6C A;  4BAC A;  2HKX A;  3F9K A;  3FWE A;  4M71 A;  4YRV A;  3BRO A;  5IP7 J;  2OZU A;  2E2H J;  2NNN A;  3V8L A;  2E5Z A;  2W85 A;  1FOW A;  3PSI A;  5ED4 A;  4IRG A;  3DKY A;  2LBF A;  1FSE A;  2W1O A;  1R00 A;  1JUS A;  3F8F A;  2F5E A;  2GA1 A;  4F52 A;  2V9K A;  2ISZ A;  4M72 A;  4D9J A;  5A2Q K;  1F43 A;  2YSR A;  2VLA A;  4WIB A;  2G7G A;  4G12 A;  5K1Y A;  3OSG A;  2LNB A;  1RC9 A;  4D0P A;  1R49 A;  2E1O A;  1FNN A;  4I02 A;  5D18 A;  3E5X A;  3KPH A;  2HOT A;  5B1B H;  3A0H C;  2XV4 S;  1TWC J;  3PNV A;  3LSI A;  3I56 I;  3R4K A;  5JHU A;  2P0W A;  1HA8 A;  2EJR A;  4XRS G;  4C9Y A;  4DQ2 A;  2W53 A;  5F1J A;  5LEK A;  2KT0 A;  1ETW A;  3ZQQ A;  2X51 A;  1OMI A;  2ZME B;  4HF2 A;  3F8C A;  2KRH A;  5FKO A;  5KVR A;  1WFX A;  3I3L A;  1TWA J;  2NYX A;  4OOI A;  2YVE A;  4HNT A;  2WAQ A;  4LLG F;  2X4H A;  3K4M A;  4GCV A;  2EIL H;  2XPV A;  2ZXI A;  4DBQ A;  3ZMZ A;  2VBZ A;  3CUQ A;  2LG4 A;  1ZRE A;  2IT0 A;  2XRN A;  3QWL A;  1W5S A;  3CWR A;  3M9A A;  2EV6 A;  3VYT B;  4XOP A;  4BJ6 C;  2KRF A;  3SFI A;  1I50 J;  3DTI A;  5FRM A;  4EVI A;  1P7I A;  2EFW A;  3BT9 A;  2QQA A;  2IU5 A;  2D2W A;  5J40 A;  2EZK A;  4A5N A;  2ADU A;  2OQG A;  4UHT A;  4YII A;  1OKR A;  4JOM A;  4F7Z A;  4II3 A;  3LFU A;  3A01 B;  1RZ4 A;  2LC2 A;  3K8P C;  1UHM A;  2M87 A;  1ZK8 A;  1Y0U A;  4XOR A;  1FTZ A;  4L9T A;  2P7C B;  2MC3 A;  1Z3X A;  4UUS A;  3RYR A;  2E2J J;  1YFH A;  3U1K A;  1YIT I;  2E2I J;  3D5L A;  3HSR A;  2EFP A;  5LHI A;  3NRV A;  3OR1 C;  4RGX A;  1WJD A;  2LMD A;  1TZL A;  1RR7 A;  2IA0 A;  1BM9 A;  2KPM A;  2AQF A;  5ILU A;  2IA1 A;  4Q5S F;  2QWT A;  1SMT A;  1OR7 A;  4RB3 C;  4NQW A;  1O7F A;  1XB4 A;  2BY1 A;  1K83 J;  4LG0 A;  1Z7U A;  4EAT A;  4HOB A;  4BHB A;  1IXC A;  1T6S A;  3I4M J;  1MW7 A;  1U5T A;  1WI3 A;  3MKZ A;  5H6R A;  4Q47 A;  1ZGJ A;  4KIB A;  1SFK A;  1X3Z B;  2CG4 A;  3CTA A;  1HXD A;  1W0T A;  2LF8 A;  2CUZ A;  1LFB A;  4XMY A;  1ZAO A;  2KJB A;  3TP3 A;  1FYM A;  1V3F A;  5FD5 A;  5FLM J;  4AYB A;  2PLY A;  3CD6 I;  3BP8 A;  1G59 A;  2Y31 A;  3U2R A;  2H6B A;  2K4B A;  3H92 A;  2LD5 A;  2VXD A;  2CU7 A;  1XCV A;  1V4R A;  2LLK A;  3K2A A;  1JUP A;  3IRR A;  1SFO J;  2DFH A;  2PBI A;  2PQ8 A;  5D6F A;  1U9N A;  3LSJ A;  1UG2 A;  2CFO A;  5GAG J;  3HIM A;  2PJP A;  2ZJ2 A;  3L2R A;  4BEH A;  2STT A;  2MH2 A;  4IZZ A;  1R4M B;  4GFB A;  1S29 A;  2WV0 A;  3V4G A;  1S7A A;  5HDG A;  1XC5 A;  2NS8 A;  3FDY A;  2DOA A;  1T0F A;  3S17 J;  3RDI A;  3K4J A;  4YZE A;  1BI3 A;  3HOV J;  4B4C A;  3PNY A;  2V1U A;  4ASN A;  4FE7 A;  1BJZ A;  3I0T A;  4L9N A;  1A31 A;  2R7V A;  2UXU A;  5DS9 A;  4LLL A;  2IVM A;  3OMY A;  2WV1 A;  1OR7 C;  3PNT A;  1HDP A;  2XF6 A;  4A3E J;  1REP C;  1G3S A;  2DDA A;  2FU4 A;  3F23 A;  2LH9 A;  2HOA A;  3W6J B;  1U5T C;  4XK4 A;  3TL4 X;  3P7N A;  2HVR A;  2BVL A;  3NQO A;  3K70 C;  1KON A;  1V5F A;  2P7V B;  5IYD J;  4XON A;  2FNA A;  1AKH A;  1NK3 P;  2RV8 A;  3JSP A;  3S2H J;  1R7J A;  1YI2 I;  6PAX A;  3GLL A;  4DYC A;  1VI0 A;  2G7U A;  2HS5 A;  4YFX F;  2LRE A;  1QZY A;  1Z3Y A;  3FXL A;  3LNQ A;  3VWB A;  1FLI A;  3VOE A;  2M9H A;  3HTI A;  4MQ9 F;  3ERE D;  3JTG A;  2JSP A;  2R7Z J;  1YO5 C;  2QTQ A;  1KQ8 A;  3KFW X;  1IN4 A;  3E3V A;  3LST A;  4PGG A;  1MH4 A;  2BEO A;  3TW6 A;  4IKF A;  1R5G A;  2GLO A;  2F5F A;  4PDK A;  4XL9 A;  3SHF A;  3TMO A;  3S1R J;  3HHG A;  2HFH A;  3ML6 A;  4CYD A;  5HLT A;  2JRM A;  1A04 A;  3GTO J;  4HG2 A;  3HKZ N;  3DKW A;  5TRD A;  4OD5 A;  3T5X A;  3IH2 A;  2PBX A;  2NVT J;  2LDU A;  3CCE I;  2EB7 A;  5L3D A;  2F4I A;  2QBY A;  4ENN A;  3HRS A;  3PSF A;  2DK5 A;  4IHW A;  1UST A;  3EDP A;  2FD5 A;  3OOP A;  1YRN A;  1K61 A;  1UZC A;  1RUO A;  2IA2 A;  3NXC A;  2WA0 A;  3IHU A;  2NOJ B;  1R71 A;  3ZOB A;  5KAI C;  2KL4 A;  2M3A A;  4KJZ A;  4B47 A;  5IT3 A;  1MNM C;  4IQJ A;  1PUF A;  2V6E A;  1FJL A;  1ZG1 A;  1R58 A;  3GF2 A;  2ZKZ A;  1XMA A;  2E36 A;  3H36 A;  1IV8 A;  5EFY A;  3TW7 A;  3HL2 A;  1FPQ A;  2HYG D;  2YU3 A;  1O4X A;  5K5O A;  1YW7 A;  3SZG A;  1KGS A;  1GV2 A;  3JSO A;  4HLY A;  1LPQ A;  3HTH A;  1DP3 A;  3IAS 2;  2CMP A;  4R8H A;  1IO2 A;  3WTU C;  2QGU A;  4F93 B;  3RCO A;  1B59 A;  4JQF A;  2BY3 A;  3FBN B;  4KIC A;  1T38 A;  4RLQ A;  1UCR A;  3EGQ A;  4CIC A;  3PQJ A;  2Y30 A;  2M34 A;  1MBE A;  1OIS A;  5FKN A;  1QHH D;  5E1W A;  2CUJ A;  3Q3S A;  2QKL B;  3AG3 H;  4CZZ A;  4IHY A;  4CCM A;  4A0Y A;  5CQE A;  3K10 A;  2CSO A;  3CC4 I;  2R5Z A;  2L7F P;  2FSW A;  1IXR C;  1S5L C;  3D1N I;  4OAZ A;  2IS4 A;  3Q0U A;  2NVY J;  3CME I;  2FNP A;  4BBR J;  3GVA A;  4BDZ A;  1IDY A;  4FHT A;  1SFU A;  2REK A;  5KCM A;  4XLA A;  3G6E I;  3GW2 A;  1FP2 A;  1YG2 A;  3PJR A;  3IWF A;  3M8F A;  1YIJ I;  2YR2 A;  2DAO A;  3CJQ B;  3L2C A;  4CYC B;  3K2Z A;  1SMY F;  4FE4 A;  3A1Y A;  1FX7 A;  3HOX J;  2VKE A;  3TKY A;  2OUM A;  4EGZ A;  3DPJ A;  3OIP A;  3OYD A;  4C3I J;  2BXZ A;  2ETH A;  2KIQ A;  3R0J A;  2L54 A;  3ON4 A;  1X1A A;  2MYS A;  2PMH A;  1DPU A;  3ASO H;  5J4Y A;  4OMY A;  4HDV A;  4OIQ F;  1HW5 A;  4M3F A;  3BY6 A;  3ZR8 X;  3L2Q A;  1FC3 A;  1KYZ A;  3SZT A;  1W7P D;  3AG1 H;  2EFO A;  3WTX C;  3BJB A;  4S04 A;  4IX7 A;  3HHH A;  2KKO A;  2IRF G;  3IWZ A;  2WY8 Q;  3H5R A;  2HI3 A;  4BH9 A;  4EJW A;  3GME A;  5DCM A;  1I39 A;  4XBF A;  2OAZ A;  4IHT A;  3FIS A;  5JVT A;  5HS8 A;  4BBS J;  4A0X A;  5C4X J;  5D5W B;  3RIR A;  3B6C A;  5EG0 B;  4QIW N;  3QP5 A;  3I5U A;  2L01 A;  4NNJ A;  1UMQ A;  2BXY A;  4OAY A;  3B02 A;  3M4O J;  3VVZ A;  3GLX A;  1TWG J;  2QQ9 A;  5J8C A;  2GIZ A;  3CJT B;  5BS6 A;  1X58 A;  3G2B A;  4EM0 B;  1IV6 A;  2PFB A;  2XGD A;  4V2F A;  5A2Q Z;  1NTC A;  4KUM A;  1HDD C;  2VIX A;  3GTG J;  4LB6 B;  1GV5 A;  3L1P A;  1WVR A;  4HEA 2;  1D8K A;  1KU2 A;  1TWH J;  2DFF A;  2F6C A;  1U6G A;  2A68 F;  3RQI A;  1RKW A;  2HVQ A;  4EJV A;  5K7F A;  3PQK A;  5J1R A;  3HUG A;  2FF4 A;  2VBX A;  3M8J A;  4FTH A;  4YFN F;  4B44 A;  1OCR H;  2VQC A;  2O61 A;  2E1N A;  3V7R A;  2PJR B;  3F21 A;  2DA6 A;  2VQG A;  1OCT C;  4U9N A;  1ORK A;  2LSO A;  3CDL A;  5ERI A;  1TNS A;  2WY7 Q;  3GBG A;  2LKS A;  3GO5 A;  3DPL C;  4FX4 A;  2GIV A;  1B8I A;  4XSX F;  3ERM A;  1BN5 A;  3DPT A;  2M2E A;  5K5Q A;  4ZZL A;  1OYY A;  2IW5 A;  4I6Z A;  5GTH C;  1SEU A;  4WCG A;  2AS5 F;  2RQQ A;  1E17 A;  1WPK A;  1BW5 A;  3FRQ A;  2Z5U A;  4D5F A;  1NH3 A;  2JJ7 A;  3IAM 2;  5CVR A;  3WTT C;  2DA5 A;  3GZ6 A;  4DZJ A;  5LHH A;  2QSF X;  1G3Y A;  4C2M A;  1MND A;  1YJ9 I;  4NN1 A;  1SD4 A;  2CW8 A;  2XPU A;  4YIR X;  1ZKG A;  2MD5 A;  2N8G A;  4U7D A;  1S9H A;  2RAE A;  3F8M A;  3IKV A;  4LFU A;  2Q2E A;  4AIJ A;  3FXU A;  4KT5 C;  3WU2 C;  3DEW A;  2LYC A;  4C30 A;  4D7N A;  5EF6 A;  2OV7 A;  2GXA A;  1ZGW A;  2HQ5 A;  4P9U A;  5FRO A;  3CDH A;  3CMY A;  2V9V A;  5CJ9 A;  1I1G A;  2R93 J;  3BTL A;  1XMK A;  4FT8 A;  3WG7 H;  4M6X A;  1VQ6 I;  1ODD A;  2O7T A;  4D7M A;  4ICH A;  4HF1 A;  3B81 A;  2FBQ A;  1JUM A;  1SAU A;  1JT6 A;  1K4T A;  2R7S A;  1O3Q A;  1IN5 A;  5KAF C;  4MHG A;  2WAF A;  1P4A A;  2OC6 A;  2ZFU A;  4MEX F;  1SD7 A;  4BS9 A;  2JN6 A;  3WTZ A;  1SD5 A;  4ITV A;  1D5Y A;  3JRD A;  1ETV A;  5IYC J;  4FCY A;  4HX4 A;  3BJO A;  2L5Q A;  4X0G A;  3O2P E;  4MFE A;  4ACI A;  2O7O A;  1XG1 A;  2ME6 A;  1LDD A;  3I71 A;  3ZMU A;  3JRA A;  2HQN A;  3F0C A;  2K27 A;  1RI7 A;  4HW0 A;  3EUH A;  1FOY A;  2XKO A;  3GX4 X;  3FMS A;  1T08 B;  2CGP A;  3WHB A;  5HOO A;  2O0Y A;  1L3L A;  4M3E A;  3CCR I;  2KZG A;  3FXR A;  3BPV A;  3FXQ A;  2P5K A;  2MW8 A;  3JRB A;  4DYR A;  3K1N A;  3SDB A;  3RYP A;  4A3B J;  2RDP A;  2EWN A;  3AQS A;  1OLT A;  3VVX A;  3PL8 A;  5CLS A;  1HF0 A;  5HLI A;  2HDW A;  3VW2 A;  1XSD A;  2JA6 J;  1ZG5 A;  3SEZ A;  3H1C A;  4BDY A;  3HOT A;  2LBF B;  2R7W A;  3J7A O;  2AQE A;  3ECH A;  2M30 A;  2FOK A;  4MNU A;  3QU6 A;  2IS2 A;  2VE9 A;  2UXH A;  3VVY A;  2A3S A;  5HDK A;  4MLO A;  1C0W A;  4KIT B;  3CES A;  1OYI A;  2VT2 A;  3W2A A;  1F1Z A;  3TDZ C;  2EPF A;  2L4M A;  2LR8 A;  2NVX J;  2VOP A;  5L3F A;  5DTD A;  5E3M A;  1QA6 A;  2NX4 A;  5FD6 A;  3S3O A;  3O60 A;  4N9H A;  4U0Y A;  3DU6 A;  4BUP A;  2ZSH B;  3SEQ A;  2JA2 A;  2FUG 2;  2P8T A;  3K70 D;  1U8R A;  2OTJ I;  2CQK A;  5EGO A;  3OYI A;  1EH8 A;  2E5N A;  3V8K A;  3ZGK A;  5D4R A;  4G7O F;  3ZMV A;  4ZYA A;  3EYY A;  3A02 A;  3IUV A;  5IP9 J;  1WI9 A;  2OF7 A;  3E97 A;  1R1T A;  3GFL A;  3I59 A;  5AQC A;  2G0E A;  4IJA A;  4F92 B;  2QQ8 A;  5LFA A;  3DBH B;  3T6N A;  3O8G A;  5FFX A;  1X2M A;  3CZ6 A;  1OPC A;  3BC8 A;  4BHC A;  2BW3 A;  4IRI A;  1S3J A;  5ILV A;  5LEJ A;  3H35 A;  1I27 A;  5EZH A;  5CXI A;  3CUQ B;  5F08 A;  1VQL I;  3VYU B;  2HDD A;  1DUX C;  5B5E C;  3ELK A;  3PPB A;  3FXO A;  4Q48 A;  3OY9 A;  2WUI A;  3OYN A;  3ANG A;  2YU9 J;  2ZSI B;  4HV5 A;  2DMT A;  5J3L A;  4PJN A;  4A6E A;  4Y17 A;  5ILS A;  4LG3 A;  2V6C A;  4KMU X;  4C2T A;  1KQ9 A;  4UV8 A;  2HR3 A;  3K1P A;  3MKL A;  1K7A A;  4KNY A;  3HTJ A;  2P4W A;  2QKO A;  4UUS B;  2F5D A;  1ZHF A;  1ZLJ A;  1BJA A;  4JX6 A;  3IRQ A;  2ID6 A;  1T2K A;  4AC6 A;  5BPD A;  3VOX A;  4O3M A;  4F91 B;  2V26 A;  1YW9 A;  2CV2 A;  4E7S A;  1Z05 A;  2E1M C;  2O8X A;  2V57 A;  5L3B A;  2DN0 A;  2DMU A;  3BG5 A;  5HOD A;  4NQW B;  3SFZ A;  3E6B A;  3FKJ A;  3U9G A;  1HOM A;  4LG0 B;  1G3T A;  3BQZ A;  3GTL J;  5CXG A;  1U5T B;  3S14 J;  1MZB A;  3S5R A;  3CCV I;  3IL2 A;  4A5M A;  3GTJ J;  1Y39 A;  2ZFW A;  1FEX A;  4PGH A;  5BNG A;  1SC7 A;  3CO7 C;  2CFX A;  4AIK A;  2QZ8 A;  1UB9 A;  1I3Q J;  1TQI A;  5CPR B;  2V1X A;  5GPA A;  2A05 A;  1ONV A;  2EIJ H;  2H1K A;  1X19 A;  2L9R A;  2KIF A;  3LSR A;  5J4V A;  2V1N A;  2VAS A;  4ZTJ A;  3DF8 A;  2CH0 A;  3FKI J;  4ZDP A;  3LSM A;  2DJN A;  2J5O A;  2K9N A;  3HSE A;  3PFI A;  1VQ9 I;  2VPR A;  3HRU A;  2HOE A;  3KEY A;  5F64 A;  1IC8 A;  1G6N A;  2YVH A;  3V8J A;  2FRH A;  1IRG A;  2ZC2 A;  5EJC A;  4BEH B;  1RES A;  4M9Z A;  2M0C A;  5IYB J;  1SVM A;  1P7J A;  2XAQ A;  3BJ6 A;  4HAM A;  5D6E A;  4AM3 A;  4YEJ A;  4AUX A;  3J81 K;  1TLH B;  4ZH4 F;  1QGP A;  2EIK H;  1ZRF A;  5KNL A;  2KIM A;  1JGS A;  1QZE A;  1H9G A;  1G2H A;  3BJA A;  4R79 A;  2X0L A;  5E20 A;  1HKQ A;  2M4K A;  2PI0 A;  4KIF A;  1ERD A;  3OYJ A;  5F0H A;  2X9D A;  3DFG A;  1IJW C;  2F07 A;  1W1W E;  2Y69 H;  2Y2Z A;  4HRI A;  2XB0 X;  4MK6 A;  3JRC A;  3HIF A;  5JLX A;  4ESF A;  2A6E F;  1MBG A;  5DUK A;  3LAJ A;  4BE1 A;  3MCZ A;  4A3K J;  3ZQH A;  4X1E A;  1IAW A;  3LSK A;  3GFM A;  2ACJ A;  2GEN A;  1QQI A;  2QUF A;  5JHF A;  5E79 C;  3QAH A;  2Z33 A;  2P5V A;  3GTM J;  3CC2 I;  2OZ6 A;  2COB A;  1T39 A;  5K7H A;  3OS2 A;  4PJL A;  2HTS A;  1X3U A;  1KU3 A;  5HSZ A;  2QSG X;  2DU9 A;  1BI2 A;  3AG4 H;  4LIU A;  2KQR A;  2ZB9 A;  2JA8 J;  1GVJ A;  1ZRC A;  3Q5F A;  4Y33 A;  1HST A;  2HVS A;  3QOD A;  5JFR A;  3ZN1 A;  1HLV A;  3I4N J;  4N9I A;  4HNU A;  1ETX A;  2WTE A;  4MQV A;  3G71 I;  2O6G E;  4J00 A;  4IF4 A;  1GT0 C;  5ICE A;  2QBY B;  3KZY A;  1K6O A;  2GUH A;  1D3Y A;  1B6A A;  3HB9 A;  4GFL A;  3CMA I;  2BGC A;  2CQ7 A;  2YX7 A;  4L9V A;  4M3B A;  4ZZD A;  1YRN B;  1VQ8 I;  3CLQ A;  3OV8 A;  4IQ4 A;  4M9X A;  4RGU A;  4N4N B;  2L7M P;  3ABM H;  4BGD A;  4I09 A;  1ENH A;  2QEX I;  1GDT A;  1MGT A;  1VZ0 A;  3J80 K;  5E18 F;  4Y52 J;  2WB1 A;  2ZNZ A;  3WE2 A;  1PUF B;  1VQ7 I;  5GPC A;  3FBI B;  4M73 A;  4G6T B;  5FLX K;  4BXF A;  1EA3 A;  1TW3 A;  3LAP A;  3RPU D;  1H9T A;  2B63 J;  5D5X B;  2L7K A;  2R7D A;  5C3E J;  1FBQ A;  5FJ8 J;  3I4P A;  1OYW A;  2JA5 J;  5EEH A;  3DLA A;  1FBS A;  3FXK A;  2RKH A;  4L9J A;  3KKD A;  2CRG A;  3V42 A;  5LGN A;  2ZNY A;  5CW8 A;  4JP0 A;  4IPA A;  5LRS A;  2VL8 A;  1WJF A;  4IL6 C;  3JR9 A;  2TRT A;  3ABU A;  2X1C A;  5M5W J;  2QIB A;  1O7L A;  2JTV A;  2CV1 A;  2KLO A;  1LNW A;  2LFB A;  5F1R A;  3RD3 A;  4RLF A;  4BY1 J;  3RTR A;  3ZQC A;  1X2N A;  4PFP A;  2CUF A;  3Q0W A;  1BA5 A;  1PVE A;  2X6X A;  3QOE A;  1H0M A;  2KJC A;  3K4C A;  3H3Z A;  1FMW A;  1OFC X;  1Z6T A;  2IS1 A;  3GZ5 A;  2R5Z B;  2YS9 A;  4LOC A;  2RAS A;  1ZR4 A;  2XAF A;  2LKX A;  3F22 A;  4ENJ A;  4ZDL A;  2XB5 A;  2K9Q A;  4RAF A;  4XQF A;  4XN0 A;  3DCF A;  2JVH A;  2HQR A;  4BHP A;  1N75 A;  4RAZ A;  4PFO A;  4AID A;  4RM3 A;  2M4G A;  2IP2 A;  3TO6 A;  5HLH A;  1E3P A;  1FYK A;  4DBR A;  2VBW A;  4GCT A;  4A3G J;  1B9N A;  4BU2 A;  1YLF A;  2O03 A;  4EM1 A;  3H5N A;  1XD7 A;  2X85 A;  4RB0 A;  2XAS A;  4G7H F;  4DIQ A;  2R7T A;  4MIM A;  1JHH A;  3NWT A;  1MBF A;  2FOW A;  1DGR M;  3OWT A;  1PUE E;  3NWS A;  1F5T A;  1F9N A;  3ZXS A;  4AD9 A;  4IHV A;  2P5L C;  2EH3 A;  4UVC A;  2VI6 A;  3L9F A;  1LE8 B;  3FXM A;  4V2G A;  3E6C C;  3Q0V A;  3D5R C;  3OYM A;  4JX5 A;  4LJZ F;  1QBJ A;  1FIP A;  3FF5 A;  3K69 A;  2NP5 A;  4G6Q A;  5BMZ A;  1MD0 A;  3ECO A;  4L5J A;  3A01 A;  3OYB A;  2ZXJ A;  4G94 A;  3P5J A;  1X1C A;  5DCM B;  5HS7 A;  5D8L B;  2R4G A;  3N05 A;  3R6S A;  4A3I J;  3G1M A;  3HBL A;  2G7L A;  3FXJ A;  1P92 A;  1TT0 A;  2KIS A;  5F0C A;  1Y1W J;  3T1B A;  2XUB A;  3LQR A;  1LFU P;  2UZK A;  1Z91 A;  2DMN A;  2R0Q C;  4F3Q A;  4UXN A;  3HOZ J;  1LVK A;  2K5C A;  3CF5 F;  5BPI A;  4XLN F;  3DQV C;  2XGE A;  1J75 A;  1MIJ A;  1DU0 A;  1XX5 A;  1XSX A;  2MLK A;  2FQ4 A;  1BC7 C;  3NNR A;  4C2M J;  3W6K B;  2DDB A;  2VJJ A;  1J59 A;  2ZME C;  1IF1 A;  3BDD A;  5AON A;  3JRH A;  2K02 A;  1K79 A;  3I58 A;  2JUC A;  2RC4 A;  1XGM A;  1USS A;  1AWC A;  2QSH X;  4K2E A;  3JRG A;  2RRE A;  3HUG B;  2CV0 A;  3S93 A;  2RN7 A;  3WGI A;  3T8T A;  5HVQ C;  2GZW A;  3OYF A;  1ETY A;  1WHU A;  1BOB A;  4UDS A;  2HDC A;  4RAG A;  2DQL A;  1R1U A;  1XDU A;  2JZY A;  1Y6I A;  3BR5 A;  1I6X A;  2ICW G;  4Q4Z F;  2DPU A;  2JRT A;  1A36 A;  2B7E A;  2Z9O A;  2JT1 A;  2IXS A;  2CQX A;  1S7E A;  3H0G J;  2MAB A;  1RRJ A;  1D5V A;  4N0B A;  1A5J A;  2OU2 A;  4RA2 A;  1B8I B;  3V78 A;  3ESW B;  1TT5 B;  2DFE A;  2MG4 A;  3VDX A;  1IRZ A;  2H27 A;  1JKR C;  5GAE J;  1W5T A;  1H89 C;  1HKT A;  3HM5 A;  3GWZ A;  1H8A C;  3H5A A;  3I9V 2;  1LJ9 A;  2K40 A;  3VSK A;  4RGR A;  1DPR A;  3HC7 A;  2NVQ J;  4P9F A;  1L0O C;  4I0B A;  1RPW A;  4D1Q A;  4I7H A;  1HW2 A;  3VYS B;  1OJL A;  4FX0 A;  5BOX A;  1K4S A;  2DA3 A;  1ZEL A;  3H3U A;  1JHF A;  2PMZ N;  2EBI A;  1MSF C;  1ULY A;  1MBJ A;  2WC2 A;  4L5I A;  1MJB A;  2LTP A;  3Q9V A;  2V79 A;  1A35 A;  5HAW A;  2ECB A;  3WTS C;  2A5W A;  1MMS A;  3HGG A;  4HQM A;  4J01 A;  3GZI A;  2CYY A;  1X4O A;  3DBR B;  3N4M A;  1MBK A;  3VPR A;  2Q2E B;  2OA4 A;  2UWM A;  2VB6 A;  5LGT A;  4E7I A;  1XGN A;  4CCK A;  1T33 A;  2JWT A;  4UY8 I;  3R60 A;  3WOD F;  3OYG A;  3BQY A;  3RPU A;  2R7F A;  4AVP A;  5D8K B;  1WSU A;  2VQL A;  1FYL A;  1HQC A;  2ZJQ F;  2J5P A;  2VJI A;  3TQN A;  3QU3 A;  3OIQ A;  4PUS A;  4KDP A;  2FJI 1;  3W2W A;  2DI3 A;  2EZI A;  4CDG A;  3H9G A;  1VQM I;  4B1R A;  2WGB A;  2DA1 A;  2QYO A;  1LDK B;  4RS8 A;  3C2B A;  4G8X A;  3QQA A;  2PN6 A;  2EIM H;  3H3V K;  2Z99 A;  2HWV A;  2GQQ A;  3BG6 A;  2FML A;  4XN3 A;  4F55 A;  2O8K A;  4L0Y B;  1TTY A;  3J7A Y;  1ACI A;  3ZQF A;  2PFV A;  4BL0 B;  1H88 C;  5J8F A;  5E8G A;  3IUO A;  5J1U A;  2EV5 A;  3SZP A;  3L2U A;  3SDG A;  4ZC3 A;  2JUG A;  1YE9 A;  2ESN A;  2V7F A;  1B72 A;  3A4C A;  3L2V A;  4A6D A;  2VUM J;  1UG0 A;  2EFQ A;  4WF2 A; 
#chains in the Genus database with same CATH homology
 3RKQ A;  5FKO A;  4DW6 A;  5FKM A;  2NOG A;  2UXH A;  1Z77 A;  1TWA J;  3BR1 A;  3VVY A;  2YVE A;  4MLO A;  5FKL A;  3BHQ A;  3OOU A;  9ANT A;  2MGQ A;  3S2D J;  2NP3 A;  2XPV A;  2LR8 A;  2NVX J;  3S1Q J;  2XSD C;  5M3M J;  4BKX A;  5DTD A;  5E3M A;  2NX4 A;  3CWR A;  3O60 A;  4CGR A;  1AHD P;  2DA7 A;  3LJL A;  3BR3 A;  1I50 J;  3SFI A;  5EGO A;  3IV5 A;  1P7I A;  3BT9 A;  2IU5 A;  3JRE A;  2CJJ A;  5C4Y A;  3GTP J;  1B72 B;  2EZK A;  2FX0 A;  3A02 A;  3IUV A;  5IP9 J;  3A01 B;  2OF7 A;  5AQC A;  2G0E A;  1ZK8 A;  1FTZ A;  2XDN A;  3T6N A;  3O8G A;  1X2M A;  2ZCM A;  3HGY A;  2DMP A;  4UUS A;  3TED A;  2E2J J;  2HKU A;  2GM4 A;  4GCL A;  4MFD A;  2E2I J;  4X6A J;  5EZH A;  1VF9 A;  4A93 J;  5CXI A;  4BY7 J;  5F08 A;  1JJ8 C;  1R9T J;  2HDD A;  3PO2 J;  3ANP A;  2Y0S N;  3E7L A;  2X6O A;  3PPB A;  1RR7 A;  2QWT A;  4A3F J;  5EGO B;  2WUI A;  2JMW A;  1MBH A;  3ANG A;  1Y1V J;  2YU9 J;  1K83 J;  1Q1V A;  2DMT A;  4QSH A;  5J3L A;  1FTT A;  1XS9 A;  3I4M J;  2NS7 A;  3CRJ A;  1WI3 A;  2FJ1 A;  2RHA A;  3SJM A;  1JTX A;  3ZQG A;  1W0T A;  1WCM J;  3MKL A;  3HTJ A;  3CCY A;  1LFB A;  2QKO A;  2UXI A;  4UUS B;  1U78 A;  3NRG A;  1HCR A;  3NI7 A;  3TP3 A;  2AO9 A;  4JX6 A;  2ID6 A;  5FLM J;  4A69 C;  4AC6 A;  3VOX A;  2Y31 A;  3QPL A;  2LD5 A;  4JKZ A;  1T56 A;  4AYB N;  2CU7 A;  1BL0 A;  2LLK A;  2V57 A;  3K2A A;  1JUP A;  2DN0 A;  1SFO J;  2DMU A;  4A3J J;  4NEL A;  3BG5 A;  5HOD A;  1GUU A;  3S1N J;  5C4J J;  3JRI A;  4IHX A;  4BXX J;  1HOM A;  1NK2 P;  3BQZ A;  2DG7 A;  1U9N A;  3LSJ A;  3GTL J;  1UG2 A;  5CXG A;  5M3F J;  3S14 J;  2CUE A;  3S16 J;  3KZ9 A;  3HIM A;  3S5R A;  4NDL A;  3O8H A;  3GTJ J;  3ZQI A;  1FEX A;  3BG3 A;  5BNG A;  1QVT A;  2HXO A;  1RET A;  2TCT A;  1RKT A;  4GFB A;  1IDZ A;  2W48 A;  2DTZ A;  4IEJ A;  2M8G X;  4GFK A;  1I3Q J;  1ETK A;  1XC5 A;  2NS8 A;  5GPA A;  2H1K A;  4YZE A;  3S17 J;  1ITY A;  2L9R A;  5F27 A;  3LSR A;  3HOV J;  4B4C A;  2HOS A;  4EEF G;  5E3N A;  4FE7 A;  1BJZ A;  2R92 J;  1MH3 A;  2GBY A;  3FKI J;  3GTQ J;  2UXU A;  2Y9Y A;  5DS9 A;  2DJN A;  5K58 A;  2WV1 A;  2K9N A;  2XGC A;  3A03 A;  3BNI A;  1HDP A;  4A3E J;  3ZQL A;  1LE8 A;  2HOA A;  2VPR A;  1JTY A;  3NAR A;  4XK4 A;  2Y9Z A;  5FLV A;  1QVU A;  1IC8 A;  2I10 A;  5EEA A;  2YVH A;  3PAS A;  5IYD J;  1AKH A;  1APL C;  1NK3 P;  1RES A;  1IG7 A;  2M0C A;  5IYB J;  3GEU A;  1P7J A;  3S2H J;  3EUP A;  1F36 A;  1VFC A;  4DYC A;  1VI0 A;  3M3Y J;  3W6V A;  4AUX A;  5E3O A;  3RZD J;  3LNQ A;  3UKG A;  2KDZ A;  1G2H A;  1W0U A;  2G7S A;  2M9H A;  3HTI A;  4Y7N J;  3LWJ A;  4UUT A;  4XIC A;  5E3L A;  2R7Z J;  2QTQ A;  1MH4 A;  2H8R A;  5F0H A;  2X9D A;  3TW6 A;  1IJW C;  2F07 A;  1VND A;  4MK6 A;  2Y2Z A;  3COL A;  2XB0 X;  3JRC A;  2GLO A;  5JLX A;  2WAQ N;  4W97 A;  1POG A;  1MBG A;  2VKV A;  3S1R J;  3VP5 A;  2JA7 J;  3HOY J;  3GTO J;  1UI6 A;  1IGN A;  4A3K J;  3HKZ N;  5EYR A;  4X1E A;  3ZQH A;  3IH2 A;  2PBX A;  4AF5 A;  3G1O A;  2GEN A;  2NVT J;  4RBO A;  2DMQ A;  3OSF A;  5M5Y J;  3GTM J;  2COB A;  4IHW A;  1YRN A;  2FD5 A;  5K7H A;  1K61 A;  5HSZ A;  4XRM A;  3NXC A;  3QBM A;  5DAJ A;  1UI5 A;  3ZOB A;  2ZB9 A;  2JA8 J;  3RZO J;  1MNM C;  3BG9 A;  1PUF A;  1FJL A;  2LVS A;  1HLV A;  4L5E A;  3I4N J;  1ETX A;  5EFY A;  3K7A J;  3TW7 A;  1WH7 A;  4M3G A;  4M3D A;  1O4X A;  2AHQ A;  2D6Y A;  2QF7 A;  1GT0 C;  2IAI A;  1GV2 A;  2GUH A;  3HTH A;  2IBD A;  3WHC A;  1JGG A;  1WGX A;  3HB9 A;  4GFL A;  4I76 A;  1EF4 A;  4M3B A;  5IPA A;  1YRN B;  2HYT A;  3EGQ A;  2L7M P;  2R5Y A;  2Y30 A;  2M34 A;  1MBE A;  2ELK A;  1ENH A;  2EZH A;  4CYC A;  1GDT A;  2UXP A;  3BCG A;  4XID A;  5FKN A;  4Y52 J;  4JL3 A;  3Q3S A;  1MSE C;  3BTJ A;  1PUF B;  5GPC A;  4IHY A;  2ID3 A;  3JRF A;  2WB1 N;  2G3B A;  3G1L A;  1JKP C;  4J19 A;  5EZG A;  3BRU A;  3CJD A;  2B63 J;  2XRL A;  1U9O A;  2D5V A;  1TC3 C;  1GVD A;  2R5Z A;  2L7F P;  1CQT A;  4GCK A;  3VW1 A;  5C44 J;  5C3E J;  3D1N I;  3B6A A;  5FJ8 J;  3Q0U A;  2NVY J;  2JA5 J;  4BBR J;  3KKD A;  2CRG A;  5FMP A;  1IDY A;  2K9S A;  2REK A;  3GTK J;  2OPT A;  2HXI A;  4M6V A;  5CW8 A;  4JP0 A;  3JR9 A;  2TRT A;  5M5W J;  5H9T A;  2R5Y B;  2QIB A;  4CYC B;  5FGL A;  2LFB A;  4FE4 A;  3RD3 A;  3HOW J;  2ECC A;  4RDU A;  4BY1 J;  3HOX J;  2VKE A;  3ZQC A;  1X2N A;  2X48 A;  3NAU A;  2CUF A;  3Q0W A;  1BA5 A;  3ON2 A;  3DPJ A;  4C3I J;  1UHS A;  1OFC X;  4B3A A;  2R5Z B;  2YS9 A;  4LOC A;  5EG0 A;  2RAS A;  2L7Z A;  1ZR4 A;  3ON4 A;  3KKC A;  2LKX A;  3KNW A;  5D1R A;  2XB5 A;  2K9Q A;  3F1B A;  5D19 A;  2Q24 A;  3LOC A;  4M3F A;  4DZP A;  3HTA A;  3DCF A;  3IH3 A;  3PM1 A;  4JX4 A;  4ME9 A;  2EQR A;  5K7Z A;  5F04 A;  4HKU A;  3BJB A;  3HEF A;  4GCT A;  2HI3 A;  2JK3 A;  4A3G J;  3AQT A;  2PZ9 A;  1OCP A;  3FIS A;  4BBS J;  3CQZ J;  3VIB A;  5C4X J;  1IUF A;  4MIM A;  3S1M J;  3JSJ A;  4A3D J;  1MBF A;  3B6C A;  3MVP A;  5EG0 B;  4QIW N;  2ME0 A;  1UMQ A;  4IHV A;  3M4O J;  5IP6 A;  2EH3 A;  3VVZ A;  2VI6 A;  3VW0 A;  1TWG J;  2EZL A;  1LE8 B;  5M5X J;  1A6I A;  2LP0 A;  1X58 A;  4V2G A;  5EDN A;  3Q0V A;  1IV6 A;  1QPI A;  4JX5 A;  2XGD A;  1FIP A;  4V2F A;  1NTC A;  1AKH B;  4L62 A;  1HDD C;  2NP5 A;  3GTG J;  3HDD A;  4QTR A;  1GV5 A;  2UXO A;  3L1P A;  3A01 A;  3BTI A;  1TWH J;  1SGM A;  1ZTR A;  1RKW A;  3RQI A;  3G1M A;  1BW6 A;  3HBL A;  3FIW A;  5K7F A;  4A3I J;  2G7L A;  1WH5 A;  3RH2 A;  5J1R A;  2QOP A;  3BR6 A;  4FTH A;  5F0C A;  2DG8 A;  1Y1W J;  2DA2 A;  3QKX A;  5HBU A;  3E7Q A;  5FHP A;  1LFU P;  3IH4 A;  4AC0 A;  3PO3 J;  2DMN A;  2R0Q C;  5GP9 A;  2IEK A;  5IOY A;  4A3M J;  2DA6 A;  5IOZ A;  2L0K A;  1OCT C;  4S0H B;  3HOZ J;  1ORK A;  3CDL A;  3GBG A;  3HE0 A;  2XGE A;  3V6G A;  1JKQ C;  1DU0 A;  1I6H J;  3LSG A;  1B8I A;  2FQ4 A;  1FIA A;  3BR2 A;  1ETQ A;  4C2M J;  3NNR A;  2M2E A;  2P81 A;  2QCO A;  1AU7 A;  1ZR2 A;  2ZOZ A;  3JRH A;  5JLW A;  2MSY A;  1U8B A;  4I6Z A;  2ZCX A;  4C3H J;  3JRG A;  1WPK A;  1BW5 A;  4D5C A;  3FRQ A;  4D5F A;  2JJ7 A;  1ETY A;  2OI8 A;  2HYJ A;  5FKK A;  4UDS A;  2DA5 A;  3BR5 A;  3FK7 A;  4DZJ A;  2LY9 A;  1E3O C;  3MN2 A;  4NN1 A;  2XPU A;  2CQX A;  1S7E A;  3S15 J;  1ZKG A;  3H0G J;  3QPS A;  4HNV A;  2N8G A;  5F0F A;  1A5J A;  2OER A;  2RAE A;  3OIO A;  3G7R A;  4PXI A;  1B8I B;  3V78 A;  4ABZ A;  3BTC A;  3LHQ A;  2MG4 A;  3DEW A;  4D7N A;  1IRZ A;  1JKR C;  1H89 C;  3VOK A;  3HM5 A;  5EF6 A;  4A3L J;  3LSP A;  1H8A C;  3VUQ A;  2GFN A;  2CQQ A;  2K40 A;  1ZGW A;  2HQ5 A;  2NVQ J;  3CMY A;  1RPW A;  2R93 J;  3BTL A;  2LK2 A;  1OJL A;  2DA3 A;  3MNL A;  2PMZ N;  4D7M A;  2O7T A;  2EBI A;  3TP0 A;  1MSF C;  4ICH A;  1MBJ A;  4XRS A;  3B81 A;  2LTP A;  1ETO A;  2FBQ A;  1JUM A;  1JT6 A;  5HAW A;  2ECB A;  4W1U A;  2DA4 A;  1JT0 A;  3NPI A;  3HGG A;  3GZI A;  3FK6 A;  4DYQ A;  4A3C J;  2JN6 A;  1MBK A;  3VPR A;  1D5Y A;  3JRD A;  1ETV A;  3BR0 A;  5IYC J;  2XPW A;  4JYK A;  1T33 A;  4FCY A;  2JWT A;  2YUS A;  3BQY A;  4ACI A;  4MFE A;  3P9T A;  2O7O A;  1XG1 A;  2ME6 A;  5IP7 J;  2E2H J;  3JRA A;  2ZOY A;  3F0C A;  2E19 A;  3HOU J;  2EZI A;  2O9L A;  1TWF J;  4MO7 A;  4B1R A;  2WGB A;  2DA1 A;  4C3J J;  1JUS A;  3C2B A;  3WHB A;  4FIS A;  3QQA A;  4M3E A;  4MXM A;  1F43 A;  3G56 A;  3H3V K;  2G7G A;  2MW8 A;  4G12 A;  4DYR A;  3JRB A;  3OSG A;  2O8K A;  3ZQF A;  1JKO C;  4A3B J;  1JJ6 C;  2ZCN A;  2E1O A;  1SAN A;  3C07 A;  1Z0X A;  1H88 C;  3AQS A;  1ZQ3 P;  4KWA A;  5D18 A;  3VVX A;  5J1U A;  1HF0 A;  2HOT A;  3SDG A;  3VW2 A;  5J1Y A;  1QRY A;  1TWC J;  2JA6 J;  2W53 A;  4XRS G;  1B72 A;  1DU6 A;  5F1J A;  2VUM J;  4JNN A;  2KT0 A;  1ETW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...