2HYJA

The crystal structure of a tetr-family transcriptional regulator from streptomyces coelicolor
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
193
structure length
193
Chain Sequence
AEAQATRGRILGRAAEIASEEGLDGITIGRLAEELEMSKSGVHKHFGTKETLQISTLDKAFVDFWHRVVEPALAEPPGLRRLRAVCANSVGYLEEPLLPGGCLLTAALSEYDGRPGRVRDAVAEVWSRWREQLRADLTAAVDKGELPAGFDVEQALFEIVAAGLALNAAMQLQHDRTAADRARRAIERALAQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of a tetR-family transcriptional regulator from Streptomyces coelicolor
rcsb
source organism Streptomyces coelicolor
molecule tags Transcription
molecule keywords Putative tetR-family transcriptional regulator
total genus 81
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 2006-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2hyjA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2hyjA02
4JX6A 1HCRA 2RAEA 3QBMA 4IHYA 1A6IA 1X2MA 1JT0A 2JA5J 3CRJA 3TW7A 2JN6A 2NS8A 2VI6A 3OIOA 2XPVA 3KNWA 4IHXA 2HQ5A 2Y0SN 3BQYA 4AUXA 1IJWC 3EUPA 3GTPJ 2CQXA 3BT9A 3MN2A 5GP9A 3LOCA 3HIMA 4B1RA 4M6VA 2KDZA 4QIWN 1W0TA 5IPAA 4MFEA 2D5VA 1UMQA 2E19A 1HDDC 2MW8A 3Q0VA 1Z0XA 4JP0A 1RR7A 2GUHA 4CGRA 5F1JA 5C4JJ 1IDZA 2CQQA 1ETQA 3KKCA 1XC5A 2QCOA 3WHCA 5DTDA 2HXIA 2NP5A 1F36A 2XB0X 2D6YA 2L7ZA 5CW8A 1GDTA 3FIWA 1Q1VA 3BG3A 4W1UA 5EG0B 5D19A 4JYKA 2XGDA 2CJJA 1JJ6C 3F1BA 1A5JA 3B6CA 2ID3A 3NNRA 2LFBA 4D7NA 5E3NA 2QKOA 3LWJA 1D5YA 5EG0A 3HTHA 3S15J 4GCKA 3LSGA 2VKVA 2X6OA 1F43A 2DMNA 4NDLA 2UXHA 3JRFA 1H89C 1BA5A 2RHAA 1I50J 5C3EJ 4MK6A 1GUUA 1TWHJ 3G56A 1Z77A 1PUFA 3JRBA 2K40A 3NRGA 3VOKA 2GBYA 3ANGA 3WHBA 2ID6A 3BTIA 5J1RA 3CDLA 4DYCA 1B72A 4XICA 1AKHA 1YRNA 2TRTA 3PO3J 2OI8A 1FTTA 3ZQLA 3JSJA 4M3FA 3RKQA 5CXGA 3BTJA 4Y7NJ 1ZTRA 5BNGA 2UXOA 3ON2A 4C3HJ 2LTPA 2Y9ZA 1BW6A 3O60A 5HBUA 3BG5A 3ZQGA 1S7EA 2ZOYA 4GFKA 5IYBJ 1JUPA 2R92J 2DJNA 5F0HA 1GT0C 5FMPA 3G1OA 5IOYA 4ACIA 4XRSG 5EDNA 3BJBA 5AQCA 1ZKGA 1OFCX 2DTZA 4M3DA 2UXIA 1RKWA 2DA2A 1LE8A 3PPBA 1I6HJ 2FJ1A 1FIPA 5IYDJ 2L7FP 1QPIA 1MBFA 1VI0A 3NPIA 3VUQA 3LJLA 3DPJA 2WAQN 2DG7A 4HNVA 5C4XJ 3TEDA 5EYRA 2K9SA 3BCGA 5FGLA 3IV5A 2I10A 3UKGA 4D7MA 2DN0A 2HDDA 3IH4A 4B3AA 1BJZA 2DMQA 3QQAA 2JA7J 5EZHA 2L7MP 1MBJA 2DA4A 2G7SA 3QPLA 1RPWA 2HYTA 1FTZA 4A3CJ 3HOUJ 4FE7A 3PM1A 2Y9YA 1LFUP 2MGQA 5EGOB 3GZIA 2QTQA 5M5YJ 1R9TJ 1HF0A 5HSZA 4Y52J 3VOXA 3BHQA 3RH2A 2MSYA 4I76A 2VUMJ 2LLKA 1ENHA 2DA7A 4YZEA 3MNLA 4JX5A 1K83J 1MH3A 4CYCA 2R5YB 1B8IB 3S5RA 5EGOA 1XS9A 3Q3SA 5IOZA 2JJ7A 3KKDA 1UI5A 3HOZJ 1SFOJ 1VFCA 2KT0A 3A03A 1FIAA 3C2BA 1VF9A 1POGA 1FJLA 4KWAA 1Y1WJ 5EZGA 2AO9A 5FLMJ 4NELA 4ME9A 2FX0A 2X48A 3GTJJ 2R7ZJ 3VVZA 2YU9J 1B8IA 2NVQJ 2CU7A 1E3OC 2OERA 4C3IJ 3IH2A 4BXXJ 4I6ZA 5M5XJ 2YUSA 3RZOJ 5D1RA 3LSPA 2DA5A 5F08A 1QVTA 2UXUA 1BW5A 5F04A 4AC0A 3H0GJ 4RDUA 3S14J 2ZOZA 2G0EA 2VPRA 5F27A 3NARA 1NK3P 1TC3C 3S17J 1T33A 4C3JJ 3PASA 3BRUA 4D5CA 4FCYA 1ETOA 3EGQA 2EBIA 2R5ZB 1IC8A 3L1PA 3HE0A 1HOMA 4A3KJ 2NVXJ 1JJ8C 3BR1A 3BR5A 1PUFB 4M3EA 5C44J 3T6NA 4ICHA 3O8GA 1RKTA 2Q24A 5K58A 1HLVA 2H1KA 2ECCA 4D5FA 2PMZN 2E2IJ 4DZJA 2XRLA 1TWAJ 1AU7A 3JREA 5K7ZA 1AKHB 1YRNB 3GBGA 2DG8A 3GTKJ 4AYBN 1LFBA 3FRQA 2O9LA 9ANTA 4DW6A 2LD5A 3F0CA 1XG1A 1IG7A 1GV5A 3I4MJ 3FK6A 3S1QJ 2G3BA 3VP5A 1UG2A 1MBHA 3B6AA 2FBQA 3CJDA 2GENA 4S0HB 1ETKA 1MNMC 2NX4A 2JA8J 2ME0A 3NXCA 4JKZA 5FHPA 1MSEC 3FISA 4RBOA 3GTOJ 3BG9A 1JTXA 2P81A 2DA6A 1TWCJ 2Y2ZA 3P9TA 2G7LA 1MBKA 1EF4A 5K7HA 3H3VK 5FKNA 5EFYA 3AQTA 5HODA 2DMPA 2YS9A 3ZQIA 5M5WJ 3JRGA 3DCFA 2PBXA 3HOVJ 5FKKA 2LVSA 3G1LA 1WI3A 4FE4A 2O7OA 3HOYJ 2HOAA 1SGMA 4GCTA 3CCYA 1ORKA 3K2AA 2XGEA 2HOSA 3A01B 2E1OA 2MG4A 3W6VA 2EZIA 5F0FA 3BTLA 5J1YA 4C2MJ 2L9RA 3V78A 3C07A 2IEKA 1T56A 2DMTA 3E7QA 2TCTA 1JKQC 3HEFA 4XRSA 4BBSJ 3GEUA 4UUTA 1P7IA 3JR9A 3O8HA 2FD5A 4MXMA 4FISA 1NK2P 5M3FJ 4W97A 1IV6A 3HB9A 4M3BA 4G12A 2GFNA 2G7GA 2UXPA 3FK7A 1RETA 2X9DA 4DZPA 4JL3A 3ZQFA 2NP3A 3HTIA 2CRGA 3COLA 5D18A 3BR2A 1GV2A 5F0CA 3VW2A 2WV1A 1UI6A 2V57A 4A3FJ 4XK4A 4L5EA 4BY7J 3PO2J 4GFBA 2E2HJ 3E7LA 3JRDA 1MBEA 3VVXA 2XDNA 5JLWA 1HDPA 3HBLA 5M3MJ 3TW6A 3HTJA 1IGNA 1ZGWA 1OJLA 4JX4A 1I3QJ 1U78A 2ZCXA 5E3LA 2GM4A 2DA3A 2EQRA 3HTAA 3I4NJ 5DS9A 1ZQ3P 2W48A 1WGXA 4QTRA 2FQ4A 2HOTA 2NVTJ 4IHWA 2HI3A 1JKOC 2LR8A 1P7JA 2NS7A 1MH4A 3V6GA 2XGCA 5IP6A 2M0CA 3JRCA 3VW0A 2XSDC 1RESA 2R0QC 3MKLA 2ME6A 3S1NJ 2IU5A 2ECBA 5J3LA 5HAWA 2CUFA 3JRAA 2OPTA 2K9QA 1WH7A 2LP0A 5FLVA 2WGBA 1O4XA 5C4YA 2K9NA 2L0KA 2QOPA 3NI7A 3SJMA 2LKXA 4AC6A 3VIBA 3GTMJ 1JKPC 3CQZJ 4M3GA 4XRMA 2ELKA 2R93J 1NTCA 3Q0UA 4UUSA 1DU0A 1SANA 3ZQHA 3M3YJ 2PZ9A 5EEAA 3TP0A 4A93J 3HM5A 4MFDA 2GLOA 4A3BJ 1AHDP 4IHVA 3BNIA 3S2DJ 4A3GJ 1ETVA 3AQSA 3FKIJ 3DEWA 2EZKA 2NOGA 1WH5A 2IAIA 5EF6A 1IDYA 4DYRA 5E3MA 3OSFA 2W53A 1ETWA 2QWTA 1OCPA 2HXOA 2LK2A 3ZQCA 3B81A 5J1UA 3RZDJ 5IP9J 4PXIA 3A02A 2EZHA 2COBA 1H8AC 1JUSA 2XB5A 1WPKA 3LSRA 1BL0A 4GFLA 1DU6A 5FJ8J 3KZ9A 3G1MA 5H9TA 2OF7A 3BR3A 2ZCMA 4NN1A 1GVDA 2JWTA 2EH3A 2M8GX 4GCLA 5DAJA 4ABZA 4A3DJ 3HOWJ 2N8GA 3OSGA 2E2JJ 1TWGJ 2QIBA 3LHQA 3A01A 2ZCNA 4QSHA 3RQIA 1CQTA 3BQZA 3CWRA 5FKOA 3S16J 2F07A 2RASA 2DMUA 2ZB9A 4FTHA 1U9OA 3G7RA 4UDSA 3S1MJ 3VPRA 4CYCB 2R5YA 3HDDA 3HGYA 3GTQJ 4A3IJ 3VW1A 3SFIA 1ZR4A 4IEJA 3LNQA 4HKUA 2LY9A 3IH3A 1X58A 3NAUA 4AF5A 2WUIA 4A3EJ 3BR0A 3VVYA 2WB1N 3LSJA 2HYJA 4J19A 2CUEA 2XPWA 1JKRC 1MSFC 5FKMA 5GPAA 2JA6J 5E3OA 4LOCA 1JUMA 4V2FA 3IUVA 1TWFJ 3BR6A 2H8RA 1K61A 2B63J 3RD3A 5IYCJ 1APLC 1IRZA 3D1NI 1B72B 4X6AJ 3GTLJ 1VNDA 4BBRJ 3JRHA 2R5ZA 3ON4A 4V2GA 1QRYA 3OOUA 4JNNA 1IUFA 3QKXA 2REKA 5K7FA 2O7TA 2EZLA 1Y1VJ 2IBDA 3SDGA 4DYQA 1UHSA 2YVHA 1MBGA 3S2HJ 1ITYA 1H88C 5CXIA 4B4CA 3ZOBA 4L62A 1ZK8A 2Y30A 2JMWA 5FKLA 2AHQA 1FEXA 3K7AJ 2O8KA 2NVYJ 4X1EA 2Y31A 2M9HA 1WCMJ 2QF7A 3Q0WA 3HOXJ 1JGGA 1JT6A 2XPUA 4EEFG 2VKEA 3S1RJ 1LE8B 1G2HA 2YVEA 1X2NA 2M2EA 4MLOA 1ETYA 2HKUA 2JK3A 5GPCA 3HGGA 4A3MJ 3QPSA 4BY1J 1U9NA 3HKZN 5JLXA 3MVPA 5IP7J 4A3JJ 1JTYA 1OCTC 4BKXA 3ANPA 2M34A 1QVUA 3JRIA 4A3LJ 4MO7A 4A69C 3M4OJ 3CMYA 3TP3A 2DA1A 3GTGJ 4MIMA 1ETXA 4UUSB 1W0UA 1ZR2A 1U8BA 4XIDA 3BTCA
chains in the Genus database with same CATH superfamily
3A4CA 4JX6A 1HCRA 2ETHA 4CZZA 2RAEA 4KMUX 3CDIA 4Y13A 2BW3A 2F2EA 4FT8A 2JA5J 2DFHA 3H5AA 2VBXA 2VI6A 2XPVA 3OIOA 4NUBA 4L9NA 5CPRB 3EUPA 1T2KA 3BT9A 1X3ZB 3KP6A 3EETA 2G7HA 3WGGA 4Y17A 2KDZA 4EGYA 2IA0A 1X3UA 2O3FA 3KEYA 1F1ZA 2E19A 1HDDC 2Z9OA 3WG7H 3I54A 2MH2A 4JP0A 1RR7A 1WRJA 2DK8A 1QZEA 4NQWA 3CCMI 1IDZA 3KX2A 1TZLA 5H2FC 1ETQA 1OMIA 2JT1A 1XC5A 3KKCA 4IHTA 2HXIA 3EQLF 1F36A 2DTRA 1FMWA 2ZC2A 1O57A 2K3FA 4BJTA 3W2VA 3K6GA 3ZR8X 2E7XA 2ICWG 2XKOA 4HF1A 3S93A 5D19A 4P96A 4JYKA 3IKVA 1K7AA 3VOEA 3F1BA 1D0ZA 3I59B 2GA2A 2Z99A 4AVPA 2XAHA 2ID3A 3AG3H 3NNRA 1Z9CA 4UUVA 5FLXK 5E3NA 2FMLA 5ERIA 4BQOA 3L2VA 2XC7A 2DT6A 1WVRA 1D5YA 1Q1HA 1XN7A 2KIQA 2X6OA 1OYIA 2BVMA 2ZMEA 3DPLC 3LWFA 2VODA 2UXHA 3CJRB 2XUBA 2EILH 1I50J 4CH7A 5AONA 2IXSA 4M73A 1P6RA 1PUFA 3L2CA 1YOVB 3JRBA 4HX4A 3NRGA 1LDKB 3OV8A 5HS7A 3RQ4A 3WHBA 1ZYRF 5F6FA 2AQFA 3BTIA 3W6JB 2XF7A 1J09A 5ICGA 3N97A 4XICA 5FD6A 1YRNA 5HDGA 4M3FA 3RKQA 2QBYB 2EJRA 2FNAA 1BN5A 4RAZA 4Y7NJ 1ZTRA 4WXHA 2D1HA 6PAXA 1BW6A 2O03A 4P9FA 2VBWA 1QHHD 3ASOH 1KONA 2V6EA 1K78B 3F8CA 4CCJA 1JUPA 4HLYA 1XGOA 4EM1A 5F0HA 2XAGA 3J81Z 4ACIA 3DLAA 2DTZA 4M3DA 4XLNF 5FRNA 4BEHB 1XSXA 2P5KA 2DA2A 4FX4A 1LE8A 3PPBA 1I6HJ 2W4SA 2R7SA 1U6GA 3OYLA 2VJ5A 3J80Z 1G8XA 3NPIA 1SD6A 3PSIA 3G2BA 4EJOA 5C4XJ 2R7VA 3CO7C 1BM9A 1FOXA 5FGLA 3IV5A 3HUGA 2A6EF 2DN0A 2HDDA 3GLXA 2JA7J 3WTVC 1SAXA 2G7SA 1WSUA 4AU7A 5LRSA 2GXBA 1D1BA 4XL9A 2ESHA 4HZFA 5L3DA 3PM1A 1MJAA 2MGQA 2XHKA 2FMYA 1R9TJ 4WWCA 1DP7P 5CQGA 2HQRA 2GWRA 4BXFA 4BHCA 2W24A 4I76A 3HJEA 2CW8A 2VUMJ 2LLKA 1L3LA 1U8RA 2X1EA 3OYDA 3WGIA 2W7NA 4QPQA 3CJQB 1B8IB 2K4BA 1XS9A 3Q3SA 1Y8RB 2K86A 1XPXA 2JJ7A 3KEQA 2UUZA 3ZRGA 5ILVA 4A2UA 1WKMA 4OAYA 3S2WA 2V9PA 3KZZA 1FJLA 2AO9A 2JRMA 2OQRA 2D1VA 2FBKA 1W36D 1HW2A 4NELA 2GXAA 2BXYA 3VSLA 1F4KA 1QA6A 2WA0A 3RKWA 3BJAA 1FX7A 1WJDA 5FD5A 4C3IJ 3IH2A 4I6ZA 1ULYA 3LSPA 5BMZA 1OLTA 2JPCA 1BW5A 2LY1A 1UB9A 4GGGA 5F04A 4RDUA 3ZGKA 1HA8A 3PIPF 3DTKA 2VPRA 2LDUA 1NK3P 1T33A 3BZ6A 3PASA 3I3LA 4D5CA 3KYDB 4ZDPA 1C0WA 3U9GA 4LMYA 1HOMA 3R4KA 2NVXJ 3WU1B 3HZJA 1JHHA 2DFFA 3W6KB 1PUFB 2A07F 4M3EA 1UFMA 2ZY9A 4PSWA 3V8JA 1G59A 1ZHFA 2H1KA 3FHZA 5D6FA 3CMEI 2IS2A 2ECCA 3CUQB 3V7RA 2PMZN 3ZN1A 1I39A 1DGRM 1OQYA 3GBGA 3GTKJ 1W7PB 5AIQA 5A2QZ 3OYKA 3G71I 2LD5A 3DKWA 3F0CA 3KZIC 1XG1A 1IG7A 1GV5A 3FK6A 2WADA 1MNEA 1LPQA 2FBQA 3E5UA 1I1GA 3LAPA 2LREA 4XQFA 4ZYHA 4ESJA 1MSEC 3FISA 4RBOA 1JTXA 2P81A 1QHGA 3P9TA 1B9MA 1YFHA 3DEUA 3IAS2 5FKNA 4ZZDA 2HKOA 2B7EA 3AQTA 2NYXA 1XGSA 5J8FA 5HNHA 4CHUA 1OCCH 2P5VA 3ZQIA 3GFMA 3R61A 4CCNA 3TDZC 2ZFWA 1T98A 3FDYA 4CDGA 3FBIB 3G1LA 3RJPA 4FE4A 5DUKA 2O7OA 2HOAA 1V55H 3K2AA 2JA2A 3A01B 3ONQA 2CH0A 1S7OA 3DXJF 3BTLA 1T95A 1ZRDA 2DJIA 2L9RA 3V78A 3C07A 2DMTA 2TCTA 3AFHA 4U7BA 3HUGB 3I53A 3E97A 2QENA 1J0RA 3C2HA 3L00A 1X1AA 1ZN2A 3BG7A 1P7IA 3JR9A 3ZP5A 4MXMA 4FISA 3KEOA 1HQCA 2LY2A 3FXQA 4U88A 3HXLA 2ZXJA 4L9JA 1IV6A 4AVZA 4M3BA 1SEUA 4G12A 2UXPA 3ZQFA 2Z33A 3HTIA 2CRGA 2DT7B 3K0LA 5CVJA 3TBIA 2KZGA 3J7YJ 2WV1A 3BZKA 3OS0A 1WJFA 3BLYA 2E2HJ 2VBZA 1A31A 2Y75A 1MBEA 3LSKA 5KNLA 2VE9A 2XDNA 1BIAA 4WIBA 1S29A 4CGZA 1GXQA 2YU3A 3OYNA 2O5RA 2K9LA 4I09A 3MWMA 1OCOH 2VL8A 4EMSA 3K1PA 4KICA 5E20A 4IVNA 1P4XA 4BACA 5J6XA 3I4NJ 3M7GA 2F5DA 3KLOA 4E70A 4IHWA 2DYRH 1JKOC 2KKOA 5IT9K 3BG6A 4I01A 2X51A 4UV9A 4CUGA 4DJAA 1STZA 2XAUA 2XSDC 3S1NJ 2IU5A 2ME6A 2R7UA 3F6VA 5D5VB 4OWRB 5HAWA 1LJ9A 4BE0A 4OIOF 3HSRA 3R6SA 1E2XA 3ELKA 2LP0A 3IC7A 1O4XA 2K9NA 2ZO4A 5HLTA 1U5TB 2LKXA 3CQZJ 3QPTA 3CLQA 5BPDA 3LA2A 5JVTA 2ELKA 2P6SA 4PZJA 4YRVA 1G3YA 2XDVA 3F9KA 3Q0UA 1U3EM 1YTYA 1MJ9A 3TP0A 1H0MA 3BPXA 2GLOA 1R4NB 1OCRH 5LHGA 5LRRA 3S2DJ 3TDUC 4LFUA 3W3CA 3FKIJ 4MQVA 3ZMZA 5DCMB 4DYRA 4A12A 2XV4S 1FSHA 1G3WA 2QWTA 3KP2A 2P4WA 1OPCA 1R36A 4U0WA 3OYEA 3B81A 2E60A 2RNJA 4EVIA 3RZDJ 1WJEA 5IP9J 1VTNC 1FPQA 3GLLA 4PXIA 1KYWA 2KRCA 3EUKL 3FM3A 1LVKA 5TRDA 2VC0A 3M07A 2X4HA 1YO5C 3EYIA 3LSRA 3GO5A 2XRNA 5E1XA 1UHMA 4HNUA 3OYGA 5H9TA 5ILSA 2OF7A 2VQGA 2ZCMA 2JWTA 2MC4A 1S9HA 3GZ6A 4M9XA 1V4RA 4A3DJ 5LLQA 3KETA 2XGXA 2O61A 2QIBA 3KYLA 3FXUA 3A01A 1UAAA 1TT0A 5FKOA 1SFUA 3H9QA 2DT5A 4FTHA 3I4PA 3HDDA 2L5QA 3G3ZA 3PNTA 3FXOA 3VW1A 1X4PA 4IRGA 2M8EA 1ZR4A 4IEJA 4CCLA 4OAZA 4J00A 2KZVA 5GAEJ 3MKWB 1Z3YA 2W84A 2WUIA 2HTJA 2GIVA 3QPHA 5K5QA 3NRVA 3M1CA 1X19A 2HYJA 4J19A 2XPWA 3KCCA 5H6RA 5GPAA 4FX0A 1KU2A 2PN6A 4LOCA 1QNTA 4V2FA 5HS8A 4A6EA 2M7AA 3L2RA 2B63J 3RD3A 1APLC 3O3KA 3FBNB 2OJED 1VNDA 3GTLJ 3CZ6A 2VXZA 1J75A 1HW5A 2QSGX 3ON4A 1VQMI 4JNNA 1LB2A 1IUFA 1ZLKA 3JTGA 1IN4A 1HC8A 2REKA 2IBDA 2DDAA 2OCCH 4B8XA 4K2EA 2V26A 3S2HJ 1ITYA 3VEPA 4B4CA 1E0EA 1W1WE 4UVBA 4L62A 1S5LC 1RRJA 4L0ZB 3F21A 1FEXA 3AG2H 2O8KA 2NVYJ 1V3FA 1OCZH 4X1EA 1VQPI 1K78A 3NWSA 3P9KA 1JT6A 4E7ZA 2VKEA 3ZPLA 5K5RA 1SVMA 2ZFUA 5D6EA 1LE8B 2FBHA 2YVEA 1A36A 2M2EA 4L9TA 5GPCA 4L9VA 4BE1A 1MZBA 4A3MJ 2OZ6A 4ENJA 2PFVA 4BY1J 1U9NA 1OCTC 3AL0B 3FX3A 1SFEA 5LGNA 5IY5H 1VQ8I 1ZELA 2VBYA 2CUJA 3MZ8A 4UB8C 3JRIA 4CCKA 4OD4A 1EA3A 1QGPA 3CMYA 1CGPA 2LBFB 3GTGJ 5ICFA 3F8MA 1Z6TA 1ETXA 2HYGD 1V54H 1W0UA 3PL8A 1U8BA 2PG4A 1UELB 4ASNA 2HWVA 5HNFA 1A6IA 1X2MA 2GIZA 1T8IA 2VQCA 4ZH4F 2LRDA 3L7WA 1NH3A 4CA0A 3KNWA 2DOAA 2WV0A 1XX5A 3GTPJ 1ZGJA 3MN2A 3HIMA 1RR8C 2EK5A 2OAZA 3AAFA 3REOA 3CMAI 4MFEA 2FNPA 2VOOA 1ZLJA 2LKSA 3TGNA 1Z0XA 5B66C 5LGTA 3EDPA 5CVUA 2GUHA 4HQMA 1FBQA 2KIMA 4ITVA 2FSWA 4Y4RA 3CCJI 3LSIA 5A2QK 2QCOA 3IP4B 3UNGC 2IPQX 2FUG2 2NXNB 2L7ZA 3AKZA 1EH6A 2JSPA 5CW8A 1M1EB 5BQTA 4LG3A 2JUGA 1KQ8A 5D8LB 3Q5FA 1Q1VA 4BNCA 1FP2A 1FSEA 1U2WA 4LG0B 2CJJA 2W85A 1JJ6C 4ZYDA 3R60A 3B6CA 2GAUA 2RREA 4V19K 5LD2C 4XM3A 5CKTA 4GCVA 1QQIA 1V5EA 2EFOA 2HYFA 3ZQ7A 3R0AA 3SZTA 1LNWA 3BC8A 1W36C 2HEOA 2RGVA 3E6CC 3DKYA 2QSFX 2OBPA 1SAUA 3K2ZA 4CICA 3GYHX 2DMNA 3VYSB 2V1UA 1H89C 1BA5A 2RHAA 1YX3A 3G56A 1J7KA 4BL0B 4WXCA 2IP2A 1ZH5A 4LB6B 3PQJA 1TL8A 1R22A 2STWA 4IL6C 2ID6A 1YJNI 5J1RA 3CDLA 3CP8A 4FETA 1B72A 4NB5A 3V4GA 2PJPA 2TRTA 3PO3J 1XCBA 3ZQLA 3OIPA 3JSJA 4PJNA 1BOBA 2CFXA 2EFNA 2MLKA 4BEHA 4D9JA 2LKPA 1AA7A 1Y0NA 3GMEA 4G6TB 2E35A 5EEGA 3QYEA 1S7EA 2ZOYA 3M9AA 5FMPA 1GT0C 2PJRA 5IOYA 3VYRB 3OS1A 3BJBA 2F5VA 2QSHX 2XF5A 1I1SA 2RQQA 3MMYB 4C30A 4BGDA 2WAEA 1FIPA 3ZQQA 2M4KA 2XKPA 1J59A 1QPIA 1SVOA 2O0YA 3LJLA 2WAQN 1U5TC 4M6YA 4I98B 2VT3A 3OMYA 2OUMA 4HNVA 3TEDA 5EYRA 2A5YB 1DQUA 4OIQF 3BCGA 1P4AA 2BV6A 3KYCB 4L5IA 4UV8A 1IW7F 2QKMB 4B3AA 2EV6A 4TV7A 2NVUB 2FE3A 2L7MP 5CVVA 3SDBA 1RUNA 2HYTA 1FTZA 4A3CJ 2ZSHB 2W25A 2UXXA 3ABKH 5EGOB 3GZIA 2Z1DA 3ZMSA 4MEYF 1JXSA 2HS5A 3DBLB 1HF0A 3CC7I 2VPLA 2E5NA 5HSZA 2WB1A 1LUJB 3FXRA 4Z6YA 3BHQA 1R58A 1FOKA 3I56I 2LC2A 1VQLI 3QYBA 5BS6A 4JX5A 5LGUA 1MH3A 2R5YB 4BH9A 5EGOA 1D0XA 5IOZA 4C2TA 3KKDA 3KPHA 1ZG5A 2QYOA 2HFHA 3QP6A 3IAM2 1IXSB 3A03A 1FIAA 3C2BA 4KWAA 1ODDA 2CQNA 5EZGA 4E7IA 1K6YA 4XOTA 5LFAA 1FP1D 2V1NA 3V8KA 2VJJA 2K27A 2V1DA 2IGOA 2CV0A 1B8IA 2YU9J 4HRIA 2CU7A 2OERA 4YEJA 3OYJA 1SD4A 1XTAA 5M5XJ 2YUSA 3CUOA 3I0TA 5B5EC 2H09A 3H1CA 1W5CC 3QU3A 3FWEA 1IF1A 2LNBA 4PSXA 4AC0A 1I5ZA 5LHHA 2VQHA 4RGSA 3H0GJ 3OOPA 4LG0A 1TNTA 4PFOA 4XSXF 5F27A 4Z2YA 1Z05A 1TC3C 4FCYA 1ETOA 4F91B 2VJIA 1NG7A 1IC8A 3EUAA 2M5WA 4I7HA 4A3KJ 1JJ8C 4OD5A 4P1WA 2ZNZA 1R71A 2BOLA 1R1TA 1S8NA 2ZJPF 3O8GA 4B3XA 1RKTA 3F8FA 2XAFA 3BCAA 1HLVA 4MNUA 2E2IJ 1AKHB 5K7ZA 2DG8A 4AYBN 1LFBA 3FRQA 5D4SA 1YX5A 3OYMA 2G3BA 5FO5A 3GF2A 3SYTA 3VP5A 1UG2A 3QRFF 3A2KA 4HNTA 3PFYA 4IRHA 2K9MA 4DIQA 2NX4A 2LBFA 3NXCA 3GTOJ 1I27A 2Y0MA 1BI2A 4B44A 2A6HF 1T0FC 4HEA2 1MBKA 3DV8A 5K7HA 3E6DA 3VODA 3H9JA 3E5QA 3LA7A 4IOAF 3MZHA 2DMPA 2L9NA 5DEQA 3CDHA 1GLNA 2B0LA 3CESA 3K4NA 3GWZA 2H6BA 3U1KA 3U2RA 3M1EA 2KFDA 1IV8A 1SGMA 3ASNH 3TKYA 2IJLA 2M3AA 2XGEA 2LMDA 5J4VA 4Q48A 3VSKA 2E1OA 1TP4A 1TW2A 1IN6A 2UV1A 2ZCWA 4BUPA 5ILUA 4N4NB 4NHJA 1XSDA 2ZJQF 3E7QA 4MQ9F 2OZUA 1GHCA 2KPMA 3GUDA 3HEFA 2EIMH 2DPUA 4UUTA 3O8HA 2FD5A 5DDGA 2DW4A 2VONA 1O7LA 2MYSA 2WBMA 1R1VA 3H3ZA 4I2OA 2RDPA 2FBIA 2GFNA 3UR3C 1VQKI 3K4LA 3COLA 5LHIA 5D18A 2L9VA 3JAMK 2BBYA 5DUIA 3VW2A 5F0CA 1VQ4I 1UI6A 4RAYA 4A3FJ 2X85A 2ZSIB 2H6CA 4BY7J 2R7OA 4DBQA 3O6BB 2NNYA 4GFBA 3E7LA 3JRDA 1BC7C 2ISZA 2NS0A 2HVRA 2OA4A 1TT5B 1BR1A 5M3MJ 1A6QA 3WTWC 4E7KA 4UY8I 1R49A 1WJBA 5CLSA 4ZTJA 1ZRFA 3L2UA 2BZTA 2L3DA 5FRMA 1OJLA 4JX4A 1WFXA 4HX8A 1I3QJ 3DLLF 5CVIA 4AIDA 2A3SA 4R1HA 3WTYC 2W48A 4Q5SF 4QTRA 2NVTJ 2HI3A 1FYLA 1TTYA 2LR8A 3E6BA 4G7HF 3WTTC 1U5TA 3V6GA 3BJOA 4UXNA 5IP6A 3WODF 1I3AA 3OL3A 2Z3YA 2R0QC 2HR3A 1XSVA 4XORA 3TMOA 3G4SI 4KJZA 1D3YA 2QZ8A 3S3NA 3RKXA 2L0KA 4G7OF 4U9NA 5HDNA 4WXDA 4HPQA 3VIBA 4M3GA 3BOQA 3QP5A 1EKEA 4GO1A 3M3YJ 1ZAOA 3ECOA 4KA4A 1AHDP 2R7RA 2YPRA 2EPFA 2KLOA 3QAHA 4I0BA 5DM7F 2COMA 3M8JA 2EZKA 3PQKA 2NOGA 3HPHA 1WQ2A 2MFZA 2IAIA 2EA4A 4XLAA 1IRFA 1JHFA 5E3MA 1N25A 1EV7A 2LK2A 3ZQCA 2CV1A 2ELJA 3IWFA 1OYYA 5J1UA 3SHFA 3S32A 2COBA 2V7FA 1NG6A 2RV8A 5E79C 3SEQA 3VYUB 1U0JA 2A2FX 3EUHC 1YJWI 3GFIA 2BXZA 1WPKA 1LEAA 1BL0A 2H8WA 2M1BA 1DU6A 3DQVC 4HW0A 3KZ9A 1IZ1A 1REPC 4M72A 1GVDA 2ZXHA 2R7XA 1A35A 5CYVA 1J2XA 5GTHC 2R7TA 2IW5A 4E7LA 1TWGJ 1X1DA 2W00A 3DTEA 4QSHA 3LL7A 1CQTA 3WE3A 2ZMEC 2X1DA 5K1YA 4I99C 4KISA 4UDSA 3S1MJ 3VPRA 2R5YA 4XSZF 3HGYA 1JI8A 4P5OA 1Z21A 1X58A 4AF5A 2CFOA 1XGNA 4O5VA 4H4KC 4A3EJ 2DI3A 3MCZA 3VVYA 4GYIA 2WB1N 3LSJA 2VOPA 2DBBA 2HNHA 4EM0B 4LIUA 1LFPA 3U21A 4O6JA 2OC6A 5KAFC 3F8NA 4PCQA 1TWFJ 3BZCA 3BR6A 2EWNA 2KDOA 3F23A 4R79A 3SEZA 1PUEE 4NC7A 3LA3A 3CJNA 3IWZA 3RI4A 1W5TA 4X0GA 4KFCA 2KL4A 2UZKA 1BC8C 4HLXA 1IAWA 2YVHA 4RGUA 1SD5A 1MBGA 2QQ8A 3CLOA 2PLYA 1Y0UA 1XDSA 3ZOBA 1ZK8A 2FA5A 3BY6A 2CG4A 3H5RA 4F93B 5BPIA 3K7AJ 4ETSA 2D2WA 4HX7A 1UCRA 3Q0WA 4ESBA 3HOXJ 3NS4A 2RN7A 5E18F 5TGTA 3CD6I 4LD5A 3RTRA 3S1RJ 4KN4X 2M4GA 1X2NA 5CJ9A 4MLOA 1MMDA 4HV6A 1OKRA 2ZNYA 1LQ1A 4L5JA 3KP7A 3H36A 4WF2A 5DCFA 5IP7J 4A3JJ 2ACJA 4HG2A 4XOPA 4BKXA 2ADUA 2DK5A 2IS6A 2J5OA 2BGCA 2MD5A 3RPQA 4A3LJ 1KGSA 3NQOA 5F64A 2OTJI 2K02A 2QQBA 3EPZA 1Y39A 3TO9A 3DP7A 2JSCA 3OR2C 4F55A 1ZR2A 1TQIA 2C6YA 3BTCA 2F4IA 5TISC 4ZJZA 3F22A 1O3SA 2JRTA 3H9GA 3P9CA 3QBMA 1JT0A 1AOYA 4HAMA 1WWXA 1HKSA 4MTEA 3CRJA 4RGXA 3TW7A 4M74A 2NS8A 4IRVA 4U0YA 2Y0SN 5D5UB 1B6AA 2F5CA 3VDXA 1WHUA 3BQYA 4AUXA 5HLHA 1IJWC 3F3XA 1O7FA 2P6TA 1VQ6I 3D0SA 4HSTA 5GP9A 2HKXA 4RGRA 4QIWN 1W0TA 3L9FA 1BR2A 2D5VA 3FXKA 1UMQA 4PK4A 2A5WA 2MW8A 4A5MA 4UVAA 4CCMA 4OU0A 4OOIA 1ERDA 1N77A 4O3MA 5F1JA 5C4JJ 4CGRA 1FNNA 3O2PE 4PGHA 3AL0C 5J4YA 5KHDA 1DPUA 2W1OA 3WHCA 3DU6A 2M45A 3S3MA 5DTDA 5DM6F 1R5ID 2Q2EA 3DEEA 2VXDA 3MZYA 5F1RA 1GDTA 4G7ZF 2KJCA 4A5NA 2DFEA 4XN3A 3BG3A 4W1UA 2KHMA 5TJJA 2V6CA 2ZMEB 2R7QA 1X1BA 2XGDA 2WAQA 4H0EA 3ZN0A 1A5JA 2E71A 4MGRA 1HBXG 3A0BC 2GA1A 4IHSA 3AG1H 2O6GE 2LFBA 2LOOA 3D5LA 4AWXB 3FHNA 2MLGA 2QKOA 3HRMA 1Z7LA 3T5XA 4G8XA 3LWJA 2VJ4A 4BDZA 3H3UA 1F43A 2VKVA 4G6QA 4ZYGA 2EINH 3MEXA 3Q9SA 4NDLA 4KUMA 2CS3A 4RM2A 1UHWA 3JRFA 3MKYB 3L2QA 1P2FA 1GUUA 1Z77A 4XMYA 3VOKA 4NBQA 4LITA 3V8LA 3GZ5A 3X2QH 3C7JA 3LFKA 3GFJA 2BE5F 1XGMA 3KP3A 3OIQA 4XRFA 1AKHA 2OI8A 5JFRA 1MMAA 1FTTA 4C2UA 2MA3A 5CXGA 1R4MB 4YFNF 2IGMA 4RMNA 4YELA 4EJWA 5DD8A 3ON2A 3CJTB 2LTPA 3E5XA 4HDUA 1LDJA 4IZZA 1B9NA 4IXAA 4BHBA 4ANJA 2MABA 2K5CA 2AQEA 2B3WA 1KZHA 2PMUA 1H9GA 2GOMA 4DGWB 2R92J 2DJNA 2LG4A 3G1OA 3MKZA 4XRSG 2PEXA 3W2WA 1ZKGA 1OFCX 2UXIA 2L4AA 1E17A 3WTXC 1YITI 2RC4A 3AG4H 3HC7A 2BHYA 2EIKH 1S6LA 2E7WA 5B1BH 5IYDJ 2L7FP 1O3TA 1MBFA 3QOEA 1L0OC 4HDVA 3WG9A 1WJ5A 1BI3A 2OCEA 1O3RA 4UHTA 2K9SA 1E3PA 3H35A 2MH9A 2I10A 1RC9A 3K4MA 1P9QC 5EZHA 4ENMA 2DA4A 3RCOA 3T8RA 1XDUA 1RPWA 2JPBA 3B02A 3QPLA 4FE7A 1YW9A 4YIRX 2F48A 3ESWB 2AXLA 4IJAA 2ZKZA 2XAQA 5M5YJ 3TO7A 3FXJA 2UXNA 2I5UA 1HSTA 4EJVA 4Y52J 3VOXA 3RH2A 2MSYA 1TQPA 1YJ9I 1ENHA 4QWQA 4ZC3A 2DYSH 1JE8A 1OISA 2L01A 1FZPB 1K83J 2E1MC 2QA4I 4AIHA 1IXRC 4YIFA 2YX4A 2PI0A 3CCSI 2F6CA 3L09A 1UI5A 3HOZJ 1EH8A 3TL4X 4EV0A 2XROA 1POGA 2Y69H 1XD7A 1UJ8A 3BROA 1VQ7I 3IHUA 5ED4A 1FY7A 2FX0A 3JSOA 2X48A 3GTJJ 2ZBKA 2R7ZJ 1VZ0A 1YW7A 1E3OC 1OR7C 3HIFA 3K10A 3OL4A 3P5JA 5D1RA 3RZOJ 3IRRA 4U87A 3DBRB 1QVTA 1OR7A 4PUSA 3C3WA 3RPUD 1KU9A 3CCRI 3HHGA 5H6QA 1D0YA 4DBRA 3LAJA 3MQ0A 1Z6RA 4B09A 5ICEA 2G0EA 4ZYEA 3NARA 3S17J 4C3JJ 3F8BA 3EGQA 3K4KA 2KIUA 4NC8A 3L1PA 1IN7A 3S3OA 3I5UA 3BR1A 2BY0A 4OMZA 2VLAA 3T6NA 2ZXWH 4EQQA 5HVQC 1T38A 2HVQA 2QWWA 2V9KA 2Q24A 4ICHA 5K58A 5ICCA 2XF6A 4IF4A 2L02A 3KZYA 4F52A 1YI2I 3R0JA 4D5FA 2G9WA 4NNJA 2XRLA 1TWAJ 4MTDA 3JREA 1Z91A 5GAHJ 3HKZA 4LLNA 4BYYA 4XKWA 2O9LA 4XLHA 9ANTA 4BHPA 2L7KA 5EEHA 3S1QJ 2Q1ZB 3NEUA 3K8PC 2V4JC 5E1ZB 4ZZLA 2VB6A 2LSOA 3B6AA 2PMHA 2DU9A 1T39A 2JQ7A 4E7JA 4M6XA 2KRFA 1MNMC 2JA8J 5LBQA 4EJUA 1ACIA 5FHPA 2M7BA 3BG9A 2CO5A 2DAOA 2DA6A 1TWCJ 2Y2ZA 1K79A 1FLIA 2IS4A 4OINF 1EF4A 3H3VK 2A6TA 2IVMA 3KLNA 5JVGF 5IT3A 3CTAA 4ZDLA 2V79A 5HODA 2YS9A 1PP8F 4FHTA 5M5WJ 1V5FA 3KE2A 3DCFA 4IQ4A 1R1UA 3HOVJ 4BU2A 2LVSA 3HRSA 3HOYJ 3JCUC 2DQRA 3CCYA 1ORKA 2HOSA 1RUOA 1MDMB 2ZJ2A 2MG4A 4F92B 2EZIA 4AIKA 5KCMA 4I0AA 5J1YA 2HDCA 1BR4A 2KRHA 1T56A 3ABUA 3I71A 3P7NA 4BE2A 1JKQC 2DQLA 1ZARA 2QQAA 4XRSA 4BBSJ 3GEUA 5HDKA 1DPRA 1MDMA 1K4SA 4BQAA 1FYMA 4W97A 3RPUA 2PMZA 2VKHA 3HB9A 2HU9A 5JR3A 3ISPA 2G7GA 3FK7A 1RETA 4JL3A 2FF4A 2NP3A 3BR2A 3EYYA 1SFXA 1K4TA 5H20A 2V57A 3DBHB 3I64A 1DDNA 4L5EA 3JW4A 3MAJA 2BHZA 1QBJA 3SWHA 4QLCU 1H9TA 3VVXA 1N75A 3CUQC 2OTLI 5FGMA 4RB2C 4E7SA 5JLWA 1HDPA 3HBLA 2OV7A 4N4OB 2KIFA 3HTJA 3A1YA 1AWCA 1IGNA 4GRIA 4E4HA 3TQNA 1FOYA 1SMTA 1IRGA 2ZCXA 1SC7A 5E3LA 2GM4A 2DA3A 1BBYA 5DS9A 4BQNA 3G73A 3A0HC 4OIPF 2FQ4A 5K5OA 2HOTA 2F4MB 2NS7A 1P7JA 1ONVA 2X6XA 4IRIA 3FM5A 1VQ5I 1MJBA 2Y48A 2OD5A 2D45A 2ECBA 2CV2A 3LSMA 1FT9A 2Z5UA 3CMMA 3VFZA 4DQ2A 2QLZA 2K9QA 1WH7A 5HS9A 3FMSA 5FLVA 2WGBA 1QZYA 3NI7A 1D5VA 5GADJ 3SJMA 4AC6A 4M9ZA 2IRFG 3GTMJ 2AXTC 4CSWA 3L2WA 3H0DA 4B47A 2P8TA 3G6EI 1NTCA 1HKTA 4UUSA 2R7WA 1LDDA 3ULQB 4AD9A 5JHFA 4AIJA 4IQJA 2PZ9A 3CUQA 4P9UA 3HM5A 4MFDA 4A93J 4A3BJ 2VIXA 4IHVA 4DOZA 3FMRA 3T0YA 2VT2A 3CO6C 1PP7U 4A3GJ 2CQ7A 3AQSA 2EFQA 5D5WB 4JBAA 3GFLA 4ENNA 3LQRA 1G3SA 3OSFA 1ETWA 1OCPA 4IOCF 2CQKA 3COAC 1D8KA 1FOWA 4PJMA 2EZHA 1H8AC 1JUSA 2BY2A 2XB5A 3QU6A 3HOSA 1VQOI 5E1WA 1G6NA 4KN7X 3J80K 5DCMA 5J47A 4RB0A 1CF7B 3G1MA 2EB7A 1MKMA 3BR3A 5FFXA 1J9IA 2M8GX 1QZZA 2J5PA 3RDIA 3SZGA 5DAJA 3QODA 2ISYA 2NOJB 2N8GA 3OSGA 4LIVA 2P7CB 1KU3A 1B59A 1YS6A 4BXUA 3HSEA 2B9SA 3LHQA 1RNLA 4PJ0C 3BQZA 3EUHA 3DWLE 1VQ9I 3PJRA 3N05A 3ZMVA 2ZB9A 1U9OA 2DDBA 4HF2A 3GTQJ 4XLCA 4KT5C 3LNQA 1O3QA 4LJZF 3F72A 3IH3A 3QYFA 3NAUA 3IL2A 4CYDA 3HTSB 3KFWX 4PDKA 5L3FA 5GAGJ 2CUEA 3Q9VA 3CC4I 4E6KG 1I6XA 2FJI1 4UB6C 3GW2A 5FKMA 4HF0A 2QM3A 5E3OA 2P5LC 1X4OA 3IUVA 2Y0SA 4Y15A 2A61A 1R6RA 5IYCJ 4XBFA 3J7AO 4WK8F 1HXDA 4JK1X 3WU0A 4B43A 2R5ZA 3KP4A 4X6AJ 2YX7A 2WAFA 1RI7A 5JHUA 4V2GA 1R5GA 1R00A 2Q0OA 1D8JA 3LSTA 3QKXA 2A69F 5K7FA 2O7TA 4ZDOA 3SDGA 4DYQA 1UHSA 4XKBA 1H88C 1YE9A 3ABLH 2Y30A 3DU5A 5FKLA 2AHQA 4QPOA 1ZG3A 2UWMA 2M9HA 4U9LA 2QF7A 1JGGA 1W7PA 1YYVA 1YQAA 2F5FA 3VB2A 2QEXI 1S72I 5B3SH 1YIJI 2WY8Q 1WJCA 3ERMA 1W5SA 1G2HA 5IT9Z 2HKUA 1ETYA 2WY7Q 2JK3A 2LYCA 3B73A 4L0YB 4HBLA 3HOTA 3QPSA 2CW0F 3C1DA 3MVPA 4EGZA 4RB3C 2MC3A 3IUOA 4ENKA 4FASD 1Z3XA 2M34A 4YIIA 2KMUA 4MO7A 4A69C 3CP2A 2DA1A 1G3TA 1TLHB 4KNYA 1HKQA 1Y56A 2E36A 4IPAA 3D5SC 1K6OA 1A04A 2IGKA 2MBFA 1WJAA 4CO8A 3SZPA 2YR2A 1IN5A 4F7ZA 2K7LA 3H5NA 4IHYA 2CMPA 4PJJA 1BJAA 4RM3A 1YS7A 2JN6A 1YG2A 3JSPA 4IHXA 2HQ5A 2QUFA 4A0XA 2DCEA 3K70D 2CQXA 1WZ2A 2QGUA 3LOCA 4B1RA 3WTSC 4M6VA 3DPUA 1YIOA 1MIJA 5IPAA 2GOXB 1MW7A 3DTIA 3Q0VA 1FBUA 3OYBA 4Q47A 2GQQA 2V1XA 4HA8A 1BI1A 1KQ0A 3SFZA 2CQQA 4BDYA 1LVAA 1CF7A 3SQNA 2FRHA 4AYBA 2HZTA 5DD4A 3FF5A 2NP5A 2FOKA 2XB0X 2DFIA 5KAIC 4BAYA 2HPMA 4N0BA 5EJCA 2D6YA 4P55A 3FIWA 2GXGA 1IUYA 5EG0B 3D5RC 2KQRA 1R7JA 3GXOA 3NWTA 4A0YA 4WCGA 1Y6IA 2B1EA 4XLFA 4D7NA 4R8HA 2L2OA 1IO2A 1SMYF 1W7PD 2RKHA 4MEXF 3DF8A 3T1BA 5EG0A 3QWLA 1LEBA 3HTHA 3S15J 4GCKA 3LSGA 3HSFA 1UG0A 1KU7A 1RIOH 2VQLA 3I59A 1DUXC 3KIOA 2TDXA 5C3EJ 4MK6A 1TWHJ 3VYTB 3HG9A 4UVCA 4HQEA 5L3CA 1QO0D 4Y3OA 3FXLA 2K40A 3C18A 3HYIA 4HYEA 4Y33A 1VQNI 2GBYA 3ANGA 4J01A 2DLLA 2X6YA 4N9HA 5GTIC 1S3JA 4Q4ZF 4DYCA 2GZWA 3BCBA 1T6SA 1BIBA 3BTJA 5BNGA 2HGCA 3ML6A 1T0FA 2WC2A 2UXOA 4C3HJ 2Y9ZA 4FQGA 2L4MA 4RLQA 4LB5A 3O60A 5HBUA 4C2MA 3BG5A 5CQEA 3ZQGA 2R3SA 2E5ZA 4GYGA 2QBYA 4GFKA 5IYBJ 2G7UA 3HL2A 5B1AH 3CCUI 5EDNA 5AQCA 2HZDA 2I8DA 5L3BA 1RKWA 3HHHA 2FJ1A 2JTVA 5E17F 2L9SA 3C2GA 4ZTFA 2FQ3A 1VI0A 1MD0A 3VUQA 3DPJA 2DG7A 3OR1C 1YHQI 1OYWA 1B4AA 3KP5A 1TNSA 1ZG1A 3WTZA 1RZ4A 3K4JA 4II3A 2R7DA 3UKGA 1E3HA 4D7MA 5LEJA 3IH4A 1BJZA 2DMQA 2EA2A 3QQAA 1ON2A 1ZGAA 4IKFA 1MBJA 4DVYP 3DPTA 4M71A 1J5YA 2PBIA 3HOUJ 3HTUA 3ERED 3DFGA 2Y9YA 4LLGF 4RS8A 1LFUP 3CF5F 2QTQA 4XKCA 4D1QA 2EFPA 1MMNA 3E6MA 2PX9A 3IRQA 4BQQA 4GDFA 4CXFA 2Z2SB 5HLIA 1BOAA 4G94A 2KP6A 4HSRA 4RLFA 2M87A 2LF7A 2DA7A 2QVOA 4YZEA 3MNLA 2V9VA 1TQMA 4CYCA 3S5RA 3LQQA 2NRAC 2CSOA 2QQ9A 2PQ8A 3OYCA 1TBXA 1SFOJ 3LFUA 5AIPA 2HTSA 2KT0A 1VFCA 1VF9A 1Y1WJ 5E8GA 5FLMJ 4ME9A 4ZYAA 4M9SA 3VVZA 2M0MA 4XLPF 3BJ6A 2NVQJ 1F9NA 2X0LA 4BXXJ 3N4MA 1NHAA 2DA5A 2K4JA 5F08A 3OY9A 2UXUA 2RVCA 3ZMTA 3BWGA 1FYKA 3S14J 2ZOZA 4XR6A 2HQAA 2A05A 3V7SA 2ZJRF 2XIGA 4LGWA 3BRUA 2EBIA 2R5ZB 2YSRA 3FKJA 1FWZA 3HE0A 1QPMA 4PGGA 1DGWY 3BR5A 2M30A 2X6WA 2RQPA 3I58A 3F6OA 4LK0F 5C44J 3M8FA 5D8KB 2CW7A 2E1NA 3ZXSA 1DP3A 2XVCA 2HVSA 3OWTA 4LK1F 2BY3A 4A6DA 4DZJA 5L3EA 1AU7A 4KDPA 1YRNB 4XN0A 1HSJA 4EM2A 3K70C 4YFXF 4DW6A 3PIOF 3I4MJ 4B48A 4PJLA 4KITB 2ESNA 1MBHA 2BYVE 1KYZA 1XMAA 4OMYA 3CJDA 2GENA 5FFZA 5J8CA 4PFPA 4S0HB 4C9YA 1ETKA 5BOXA 3ZMUA 3TOBA 2ME0A 4IO9F 4JKZA 2DXIA 1IN8A 1PDNC 2CUZA 4CZCA 4HV5A 5DYMA 1USTA 3BP8A 3ZMDA 2E1CA 2G7LA 3IKTA 5FLXZ 5EFYA 3U1DA 2LF8A 4BJ5C 1P92A 2KISA 2W82A 3ZCOA 2CGPA 3OYIA 3JRGA 2PBXA 4U7DA 2X1CA 2QKLB 5FKKA 5E8IA 1WI3A 1Z7UA 2W57A 5KK1A 3GX4X 2NNNA 4XNFA 4G9YA 4GCTA 3PFIA 2H27A 5DV5A 3W6VA 1SFKA 3J81K 5F0FA 3WE2A 5FROA 3RYRA 4C2MJ 2MD0A 3RKYA 2IEKA 2JZYA 4D0PA 4RAGA 4NQWB 3GEZA 1MGTA 1XCVA 4XLEA 5J40A 3W2AA 3HRTA 3LSHA 3CCQI 2VE8A 4BJ6C 1NK2P 3MFKA 5M3FJ 3FMQA 2OU2A 3PSFA 1R5HA 2XSJC 1GVJA 1B1BA 1KA8A 2X9DA 4DZPA 4JQFA 1V5GA 1WI9A 5CVRA 1GV2A 2JVHA 2Q2EB 3OYAA 1FC3A 4XK4A 3PO2J 1XMKA 2EV0A 2F5EA 2Z16A 4ON0A 1PVEA 3PUFA 3QOPA 3J7ZI 5FB2A 1P4WA 2PFBA 3TW6A 3H92A 1T08B 2P0WA 2OQGA 3HRUA 2VN2A 1ZGWA 4KIFA 4EJTA 2EFWA 1EH7A 3P9IA 3S8PA 1Z1DA 3GCMA 1U78A 2BEOA 2HPIA 3M8EA 2RNGA 2EV5A 2EQRA 3HTAA 2H94A 1XMXA 1ZQ3P 3WU2C 2FXAA 1R23A 4RA2A 1WGXA 2IT0A 3DKXA 1IRXA 4KIGA 1MH4A 4NC6A 3MD2A 4XKVA 2XGCA 3VW0A 2M0CA 3K4CA 3JAMZ 3JRCA 2HOEA 3K4BA 3K69A 4F3QA 1RESA 3CC2I 3MKLA 3GZNB 1ZRCA 3WTUC 2KJBA 5J3LA 2WWYA 4KYWA 2CUFA 2VC1A 3JRAA 2OPTA 5LEKA 2XASA 3T8TA 5C4YA 2IA1A 2DPDA 4KIBA 3J7AY 2QOPA 4YG2F 1MNDA 2XAJA 1JKPC 3CF2A 4XRMA 2R93J 2K3PA 1DU0A 1SANA 3ZQHA 1XB4A 5EEAA 3E3VA 2E34A 3BNIA 3SXYA 1FBSA 1ETVA 1LKXA 2BW3B 2H1LA 4S05A 3DEWA 1WH5A 5EF6A 1IDYA 4G6DA 1X1CA 1KQ9A 1N78A 1YW8A 3V7CA 1USSA 2DODA 2W53A 1X1PA 2HXOA 2L54A 1Z67A 2WTEA 3V42A 3A02A 3BPVA 4U0VA 1G4DA 2DOEA 4II2A 2YVXA 3TOAA 1BI0A 4GFLA 4AM3A 5FJ8J 2K85A 5HOOA 3PNYA 2NAZA 1S7AA 4NN1A 1PJRA 2EH3A 1MMGA 3VWBA 1HW1A 4GCLA 4YFKF 4OIRF 3CCVI 4ABZA 4S04A 3HOWJ 2CYYA 3TO6A 3CCEI 4E7HA 4BS9A 3JTHA 2E2JJ 1EJ9A 4DNCA 2CWEA 2ZCNA 3RQIA 2F4OB 3CWRA 3CCLI 3S16J 2F07A 2RASA 4MHGA 4HOBA 4ESFA 1IXCA 1ON1A 2DMUA 4WX9A 3OYFA 3G7RA 4CYCB 3ABMH 1W4MA 4A3IJ 3SFIA 1JGSA 4HKUA 2IS1A 2LY9A 2O8XA 2E1MB 4XONA 3I55I 3BR0A 2BVLA 1SVLA 1Y8QB 3I9V2 2IGNA 4LLLA 1JKRC 2IA2A 1MSFC 1D1AA 2FEZA 2STTA 2JA6J 5D4RA 4RB1A 1JUMA 4UNOA 2H8RA 1K61A 1IRZA 1YLFA 3D1NI 1B72B 2DOFA 4BBRJ 2A68F 3JRHA 2P7VB 2AS5F 3LMMA 3RSNA 1QRYA 2HQNA 3ECHA 3OOUA 2ELHA 2BY1A 2EZLA 1Y1VJ 2R7FA 3K1MA 1X3WB 5CXIA 2R4GA 2HDWA 2JVGA 1TW3A 3BDDA 4I02A 2JMWA 3VTIA 4N9IA 4L18B 5D5XB 3OYHA 2Y31A 1WCMJ 3PNVA 4IX7A 1QU3A 5JI6A 1MMSA 2VKDA 2XPUA 3ABTA 4JOMA 3ROUA 2DO7A 2FOWA 1UZCA 4EEFG 1D1CA 1GXPA 3PUBA 1PYVA 3GVAA 3K9TA 3HGGA 2PJRB 4KMFA 3E0JB 3RYPA 2LH9A 3HKZN 5JLXA 4KT6A 3WGHA 4RAFA 5KVRA 1JTYA 3K1NA 3OS2A 2VASA 1ZREA 3ANPA 5L3GA 4EATA 2FU4A 3FZVA 1QVUA 4A0ZA 3E1SA 3FXMA 3M4OJ 3RIRA 3TP3A 1FMVA 2EIJH 5HLGA 4MIMA 3HPGA 2ZXIA 1SD7A 4CCOA 4UUSB 1F5TA 2JUCA 4XIDA 4GXOA 2Q8KA
chains in the Genus database with same CATH topology
4JX6A 1HCRA 2RAEA 3QBMA 4IHYA 1A6IA 1X2MA 1JT0A 2JA5J 3CRJA 3TW7A 2JN6A 2NS8A 2VI6A 3OIOA 2XPVA 3KNWA 4IHXA 2HQ5A 2Y0SN 3BQYA 4AUXA 1IJWC 3EUPA 3GTPJ 2CQXA 3BT9A 3MN2A 5GP9A 3LOCA 3HIMA 4B1RA 4M6VA 2KDZA 4QIWN 1W0TA 5IPAA 4MFEA 2D5VA 1UMQA 2E19A 1HDDC 2MW8A 3Q0VA 1Z0XA 4JP0A 1RR7A 2GUHA 4CGRA 5F1JA 5C4JJ 1IDZA 2CQQA 1ETQA 3KKCA 1XC5A 2QCOA 3WHCA 5DTDA 2HXIA 2NP5A 1F36A 2XB0X 2D6YA 2L7ZA 5CW8A 1GDTA 3FIWA 1Q1VA 3BG3A 4W1UA 5EG0B 5D19A 4JYKA 2XGDA 2CJJA 1JJ6C 3F1BA 1A5JA 3B6CA 2ID3A 3NNRA 2LFBA 4D7NA 5E3NA 2QKOA 3LWJA 1D5YA 5EG0A 3HTHA 3S15J 4GCKA 3LSGA 2VKVA 2X6OA 1F43A 2DMNA 4NDLA 2UXHA 3JRFA 1H89C 1BA5A 2RHAA 1I50J 5C3EJ 4MK6A 1GUUA 1TWHJ 3G56A 1Z77A 1PUFA 3JRBA 2K40A 3NRGA 3VOKA 2GBYA 3ANGA 3WHBA 2ID6A 3BTIA 5J1RA 3CDLA 4DYCA 1B72A 4XICA 1AKHA 1YRNA 2TRTA 3PO3J 2OI8A 1FTTA 3ZQLA 3JSJA 4M3FA 3RKQA 5CXGA 3BTJA 4Y7NJ 1ZTRA 5BNGA 2UXOA 3ON2A 4C3HJ 2LTPA 2Y9ZA 1BW6A 3O60A 5HBUA 3BG5A 3ZQGA 1S7EA 2ZOYA 4GFKA 5IYBJ 1JUPA 2R92J 2DJNA 5F0HA 1GT0C 5FMPA 3G1OA 5IOYA 4ACIA 4XRSG 5EDNA 3BJBA 5AQCA 1ZKGA 1OFCX 2DTZA 4M3DA 2UXIA 1RKWA 2DA2A 1LE8A 3PPBA 1I6HJ 2FJ1A 1FIPA 5IYDJ 2L7FP 1QPIA 1MBFA 1VI0A 3NPIA 3VUQA 3LJLA 3DPJA 2WAQN 2DG7A 4HNVA 5C4XJ 3TEDA 5EYRA 2K9SA 3BCGA 5FGLA 3IV5A 2I10A 3UKGA 4D7MA 2DN0A 2HDDA 3IH4A 4B3AA 1BJZA 2DMQA 3QQAA 2JA7J 5EZHA 2L7MP 1MBJA 2DA4A 2G7SA 3QPLA 1RPWA 2HYTA 1FTZA 4A3CJ 3HOUJ 4FE7A 3PM1A 2Y9YA 1LFUP 2MGQA 5EGOB 3GZIA 2QTQA 5M5YJ 1R9TJ 1HF0A 5HSZA 4Y52J 3VOXA 3BHQA 3RH2A 2MSYA 4I76A 2VUMJ 2LLKA 1ENHA 2DA7A 4YZEA 3MNLA 4JX5A 1K83J 1MH3A 4CYCA 2R5YB 1B8IB 3S5RA 5EGOA 1XS9A 3Q3SA 5IOZA 2JJ7A 3KKDA 1UI5A 3HOZJ 1SFOJ 1VFCA 2KT0A 3A03A 1FIAA 3C2BA 1VF9A 1POGA 1FJLA 4KWAA 1Y1WJ 5EZGA 2AO9A 5FLMJ 4NELA 4ME9A 2FX0A 2X48A 3GTJJ 2R7ZJ 3VVZA 2YU9J 1B8IA 2NVQJ 2CU7A 1E3OC 2OERA 4C3IJ 3IH2A 4BXXJ 4I6ZA 5M5XJ 2YUSA 3RZOJ 5D1RA 3LSPA 2DA5A 5F08A 1QVTA 2UXUA 1BW5A 5F04A 4AC0A 3H0GJ 4RDUA 3S14J 2ZOZA 2G0EA 2VPRA 5F27A 3NARA 1NK3P 1TC3C 3S17J 1T33A 4C3JJ 3PASA 3BRUA 4D5CA 4FCYA 1ETOA 3EGQA 2EBIA 2R5ZB 1IC8A 3L1PA 3HE0A 1HOMA 4A3KJ 2NVXJ 1JJ8C 3BR1A 3BR5A 1PUFB 4M3EA 5C44J 3T6NA 4ICHA 3O8GA 1RKTA 2Q24A 5K58A 1HLVA 2H1KA 2ECCA 4D5FA 2PMZN 2E2IJ 4DZJA 2XRLA 1TWAJ 1AU7A 3JREA 5K7ZA 1AKHB 1YRNB 3GBGA 2DG8A 3GTKJ 4AYBN 1LFBA 3FRQA 2O9LA 9ANTA 4DW6A 2LD5A 3F0CA 1XG1A 1IG7A 1GV5A 3I4MJ 3FK6A 3S1QJ 2G3BA 3VP5A 1UG2A 1MBHA 3B6AA 2FBQA 3CJDA 2GENA 4S0HB 1ETKA 1MNMC 2NX4A 2JA8J 2ME0A 3NXCA 4JKZA 5FHPA 1MSEC 3FISA 4RBOA 3GTOJ 3BG9A 1JTXA 2P81A 2DA6A 1TWCJ 2Y2ZA 3P9TA 2G7LA 1MBKA 1EF4A 5K7HA 3H3VK 5FKNA 5EFYA 3AQTA 5HODA 2DMPA 2YS9A 3ZQIA 5M5WJ 3JRGA 3DCFA 2PBXA 3HOVJ 5FKKA 2LVSA 3G1LA 1WI3A 4FE4A 2O7OA 3HOYJ 2HOAA 1SGMA 4GCTA 3CCYA 1ORKA 3K2AA 2XGEA 2HOSA 3A01B 2E1OA 2MG4A 3W6VA 2EZIA 5F0FA 3BTLA 5J1YA 4C2MJ 2L9RA 3V78A 3C07A 2IEKA 1T56A 2DMTA 3E7QA 2TCTA 1JKQC 3HEFA 4XRSA 4BBSJ 3GEUA 4UUTA 1P7IA 3JR9A 3O8HA 2FD5A 4MXMA 4FISA 1NK2P 5M3FJ 4W97A 1IV6A 3HB9A 4M3BA 4G12A 2GFNA 2G7GA 2UXPA 3FK7A 1RETA 2X9DA 4DZPA 4JL3A 3ZQFA 2NP3A 3HTIA 2CRGA 3COLA 5D18A 3BR2A 1GV2A 5F0CA 3VW2A 2WV1A 1UI6A 2V57A 4A3FJ 4XK4A 4L5EA 4BY7J 3PO2J 4GFBA 2E2HJ 3E7LA 3JRDA 1MBEA 3VVXA 2XDNA 5JLWA 1HDPA 3HBLA 5M3MJ 3TW6A 3HTJA 1IGNA 1ZGWA 1OJLA 4JX4A 1I3QJ 1U78A 2ZCXA 5E3LA 2GM4A 2DA3A 2EQRA 3HTAA 3I4NJ 5DS9A 1ZQ3P 2W48A 1WGXA 4QTRA 2FQ4A 2HOTA 2NVTJ 4IHWA 2HI3A 1JKOC 2LR8A 1P7JA 2NS7A 1MH4A 3V6GA 2XGCA 5IP6A 2M0CA 3JRCA 3VW0A 2XSDC 1RESA 2R0QC 3MKLA 2ME6A 3S1NJ 2IU5A 2ECBA 5J3LA 5HAWA 2CUFA 3JRAA 2OPTA 2K9QA 1WH7A 2LP0A 5FLVA 2WGBA 1O4XA 5C4YA 2K9NA 2L0KA 2QOPA 3NI7A 3SJMA 2LKXA 4AC6A 3VIBA 3GTMJ 1JKPC 3CQZJ 4M3GA 4XRMA 2ELKA 2R93J 1NTCA 3Q0UA 4UUSA 1DU0A 1SANA 3ZQHA 3M3YJ 2PZ9A 5EEAA 3TP0A 4A93J 3HM5A 4MFDA 2GLOA 4A3BJ 1AHDP 4IHVA 3BNIA 3S2DJ 4A3GJ 1ETVA 3AQSA 3FKIJ 3DEWA 2EZKA 2NOGA 1WH5A 2IAIA 5EF6A 1IDYA 4DYRA 5E3MA 3OSFA 2W53A 1ETWA 2QWTA 1OCPA 2HXOA 2LK2A 3ZQCA 3B81A 5J1UA 3RZDJ 5IP9J 4PXIA 3A02A 2EZHA 2COBA 1H8AC 1JUSA 2XB5A 1WPKA 3LSRA 1BL0A 4GFLA 1DU6A 5FJ8J 3KZ9A 3G1MA 5H9TA 2OF7A 3BR3A 2ZCMA 4NN1A 1GVDA 2JWTA 2EH3A 2M8GX 4GCLA 5DAJA 4ABZA 4A3DJ 3HOWJ 2N8GA 3OSGA 2E2JJ 1TWGJ 2QIBA 3LHQA 3A01A 2ZCNA 4QSHA 3RQIA 1CQTA 3BQZA 3CWRA 5FKOA 3S16J 2F07A 2RASA 2DMUA 2ZB9A 4FTHA 1U9OA 3G7RA 4UDSA 3S1MJ 3VPRA 4CYCB 2R5YA 3HDDA 3HGYA 3GTQJ 4A3IJ 3VW1A 3SFIA 1ZR4A 4IEJA 3LNQA 4HKUA 2LY9A 3IH3A 1X58A 3NAUA 4AF5A 2WUIA 4A3EJ 3BR0A 3VVYA 2WB1N 3LSJA 2HYJA 4J19A 2CUEA 2XPWA 1JKRC 1MSFC 5FKMA 5GPAA 2JA6J 5E3OA 4LOCA 1JUMA 4V2FA 3IUVA 1TWFJ 3BR6A 2H8RA 1K61A 2B63J 3RD3A 5IYCJ 1APLC 1IRZA 3D1NI 1B72B 4X6AJ 3GTLJ 1VNDA 4BBRJ 3JRHA 2R5ZA 3ON4A 4V2GA 1QRYA 3OOUA 4JNNA 1IUFA 3QKXA 2REKA 5K7FA 2O7TA 2EZLA 1Y1VJ 2IBDA 3SDGA 4DYQA 1UHSA 2YVHA 1MBGA 3S2HJ 1ITYA 1H88C 5CXIA 4B4CA 3ZOBA 4L62A 1ZK8A 2Y30A 2JMWA 5FKLA 2AHQA 1FEXA 3K7AJ 2O8KA 2NVYJ 4X1EA 2Y31A 2M9HA 1WCMJ 2QF7A 3Q0WA 3HOXJ 1JGGA 1JT6A 2XPUA 4EEFG 2VKEA 3S1RJ 1LE8B 1G2HA 2YVEA 1X2NA 2M2EA 4MLOA 1ETYA 2HKUA 2JK3A 5GPCA 3HGGA 4A3MJ 3QPSA 4BY1J 1U9NA 3HKZN 5JLXA 3MVPA 5IP7J 4A3JJ 1JTYA 1OCTC 4BKXA 3ANPA 2M34A 1QVUA 3JRIA 4A3LJ 4MO7A 4A69C 3M4OJ 3CMYA 3TP3A 2DA1A 3GTGJ 4MIMA 1ETXA 4UUSB 1W0UA 1ZR2A 1U8BA 4XIDA 3BTCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JX6 A;  1HCR A;  2RAE A;  3QBM A;  4IHY A;  1A6I A;  1X2M A;  1JT0 A;  2JA5 J;  3CRJ A;  3TW7 A;  2JN6 A;  2NS8 A;  2VI6 A;  3OIO A;  2XPV A;  3KNW A;  4IHX A;  2HQ5 A;  2Y0S N;  3BQY A;  4AUX A;  1IJW C;  3EUP A;  3GTP J;  2CQX A;  3BT9 A;  3MN2 A;  5GP9 A;  3LOC A;  3HIM A;  4B1R A;  4M6V A;  2KDZ A;  4QIW N;  1W0T A;  5IPA A;  4MFE A;  2D5V A;  1UMQ A;  2E19 A;  1HDD C;  2MW8 A;  3Q0V A;  1Z0X A;  4JP0 A;  1RR7 A;  2GUH A;  4CGR A;  5F1J A;  5C4J J;  1IDZ A;  2CQQ A;  1ETQ A;  3KKC A;  1XC5 A;  2QCO A;  3WHC A;  5DTD A;  2HXI A;  2NP5 A;  1F36 A;  2XB0 X;  2D6Y A;  2L7Z A;  5CW8 A;  1GDT A;  3FIW A;  1Q1V A;  3BG3 A;  4W1U A;  5EG0 B;  5D19 A;  4JYK A;  2XGD A;  2CJJ A;  1JJ6 C;  3F1B A;  1A5J A;  3B6C A;  2ID3 A;  3NNR A;  2LFB A;  4D7N A;  5E3N A;  2QKO A;  3LWJ A;  1D5Y A;  5EG0 A;  3HTH A;  3S15 J;  4GCK A;  3LSG A;  2VKV A;  2X6O A;  1F43 A;  2DMN A;  4NDL A;  2UXH A;  3JRF A;  1H89 C;  1BA5 A;  2RHA A;  1I50 J;  5C3E J;  4MK6 A;  1GUU A;  1TWH J;  3G56 A;  1Z77 A;  1PUF A;  3JRB A;  2K40 A;  3NRG A;  3VOK A;  2GBY A;  3ANG A;  3WHB A;  2ID6 A;  3BTI A;  5J1R A;  3CDL A;  4DYC A;  1B72 A;  4XIC A;  1AKH A;  1YRN A;  2TRT A;  3PO3 J;  2OI8 A;  1FTT A;  3ZQL A;  3JSJ A;  4M3F A;  3RKQ A;  5CXG A;  3BTJ A;  4Y7N J;  1ZTR A;  5BNG A;  2UXO A;  3ON2 A;  4C3H J;  2LTP A;  2Y9Z A;  1BW6 A;  3O60 A;  5HBU A;  3BG5 A;  3ZQG A;  1S7E A;  2ZOY A;  4GFK A;  5IYB J;  1JUP A;  2R92 J;  2DJN A;  5F0H A;  1GT0 C;  5FMP A;  3G1O A;  5IOY A;  4ACI A;  4XRS G;  5EDN A;  3BJB A;  5AQC A;  1ZKG A;  1OFC X;  2DTZ A;  4M3D A;  2UXI A;  1RKW A;  2DA2 A;  1LE8 A;  3PPB A;  1I6H J;  2FJ1 A;  1FIP A;  5IYD J;  2L7F P;  1QPI A;  1MBF A;  1VI0 A;  3NPI A;  3VUQ A;  3LJL A;  3DPJ A;  2WAQ N;  2DG7 A;  4HNV A;  5C4X J;  3TED A;  5EYR A;  2K9S A;  3BCG A;  5FGL A;  3IV5 A;  2I10 A;  3UKG A;  4D7M A;  2DN0 A;  2HDD A;  3IH4 A;  4B3A A;  1BJZ A;  2DMQ A;  3QQA A;  2JA7 J;  5EZH A;  2L7M P;  1MBJ A;  2DA4 A;  2G7S A;  3QPL A;  1RPW A;  2HYT A;  1FTZ A;  4A3C J;  3HOU J;  4FE7 A;  3PM1 A;  2Y9Y A;  1LFU P;  2MGQ A;  5EGO B;  3GZI A;  2QTQ A;  5M5Y J;  1R9T J;  1HF0 A;  5HSZ A;  4Y52 J;  3VOX A;  3BHQ A;  3RH2 A;  2MSY A;  4I76 A;  2VUM J;  2LLK A;  1ENH A;  2DA7 A;  4YZE A;  3MNL A;  4JX5 A;  1K83 J;  1MH3 A;  4CYC A;  2R5Y B;  1B8I B;  3S5R A;  5EGO A;  1XS9 A;  3Q3S A;  5IOZ A;  2JJ7 A;  3KKD A;  1UI5 A;  3HOZ J;  1SFO J;  1VFC A;  2KT0 A;  3A03 A;  1FIA A;  3C2B A;  1VF9 A;  1POG A;  1FJL A;  4KWA A;  1Y1W J;  5EZG A;  2AO9 A;  5FLM J;  4NEL A;  4ME9 A;  2FX0 A;  2X48 A;  3GTJ J;  2R7Z J;  3VVZ A;  2YU9 J;  1B8I A;  2NVQ J;  2CU7 A;  1E3O C;  2OER A;  4C3I J;  3IH2 A;  4BXX J;  4I6Z A;  5M5X J;  2YUS A;  3RZO J;  5D1R A;  3LSP A;  2DA5 A;  5F08 A;  1QVT A;  2UXU A;  1BW5 A;  5F04 A;  4AC0 A;  3H0G J;  4RDU A;  3S14 J;  2ZOZ A;  2G0E A;  2VPR A;  5F27 A;  3NAR A;  1NK3 P;  1TC3 C;  3S17 J;  1T33 A;  4C3J J;  3PAS A;  3BRU A;  4D5C A;  4FCY A;  1ETO A;  3EGQ A;  2EBI A;  2R5Z B;  1IC8 A;  3L1P A;  3HE0 A;  1HOM A;  4A3K J;  2NVX J;  1JJ8 C;  3BR1 A;  3BR5 A;  1PUF B;  4M3E A;  5C44 J;  3T6N A;  4ICH A;  3O8G A;  1RKT A;  2Q24 A;  5K58 A;  1HLV A;  2H1K A;  2ECC A;  4D5F A;  2PMZ N;  2E2I J;  4DZJ A;  2XRL A;  1TWA J;  1AU7 A;  3JRE A;  5K7Z A;  1AKH B;  1YRN B;  3GBG A;  2DG8 A;  3GTK J;  4AYB N;  1LFB A;  3FRQ A;  2O9L A;  9ANT A;  4DW6 A;  2LD5 A;  3F0C A;  1XG1 A;  1IG7 A;  1GV5 A;  3I4M J;  3FK6 A;  3S1Q J;  2G3B A;  3VP5 A;  1UG2 A;  1MBH A;  3B6A A;  2FBQ A;  3CJD A;  2GEN A;  4S0H B;  1ETK A;  1MNM C;  2NX4 A;  2JA8 J;  2ME0 A;  3NXC A;  4JKZ A;  5FHP A;  1MSE C;  3FIS A;  4RBO A;  3GTO J;  3BG9 A;  1JTX A;  2P81 A;  2DA6 A;  1TWC J;  2Y2Z A;  3P9T A;  2G7L A;  1MBK A;  1EF4 A;  5K7H A;  3H3V K;  5FKN A;  5EFY A;  3AQT A;  5HOD A;  2DMP A;  2YS9 A;  3ZQI A;  5M5W J;  3JRG A;  3DCF A;  2PBX A;  3HOV J;  5FKK A;  2LVS A;  3G1L A;  1WI3 A;  4FE4 A;  2O7O A;  3HOY J;  2HOA A;  1SGM A;  4GCT A;  3CCY A;  1ORK A;  3K2A A;  2XGE A;  2HOS A;  3A01 B;  2E1O A;  2MG4 A;  3W6V A;  2EZI A;  5F0F A;  3BTL A;  5J1Y A;  4C2M J;  2L9R A;  3V78 A;  3C07 A;  2IEK A;  1T56 A;  2DMT A;  3E7Q A;  2TCT A;  1JKQ C;  3HEF A;  4XRS A;  4BBS J;  3GEU A;  4UUT A;  1P7I A;  3JR9 A;  3O8H A;  2FD5 A;  4MXM A;  4FIS A;  1NK2 P;  5M3F J;  4W97 A;  1IV6 A;  3HB9 A;  4M3B A;  4G12 A;  2GFN A;  2G7G A;  2UXP A;  3FK7 A;  1RET A;  2X9D A;  4DZP A;  4JL3 A;  3ZQF A;  2NP3 A;  3HTI A;  2CRG A;  3COL A;  5D18 A;  3BR2 A;  1GV2 A;  5F0C A;  3VW2 A;  2WV1 A;  1UI6 A;  2V57 A;  4A3F J;  4XK4 A;  4L5E A;  4BY7 J;  3PO2 J;  4GFB A;  2E2H J;  3E7L A;  3JRD A;  1MBE A;  3VVX A;  2XDN A;  5JLW A;  1HDP A;  3HBL A;  5M3M J;  3TW6 A;  3HTJ A;  1IGN A;  1ZGW A;  1OJL A;  4JX4 A;  1I3Q J;  1U78 A;  2ZCX A;  5E3L A;  2GM4 A;  2DA3 A;  2EQR A;  3HTA A;  3I4N J;  5DS9 A;  1ZQ3 P;  2W48 A;  1WGX A;  4QTR A;  2FQ4 A;  2HOT A;  2NVT J;  4IHW A;  2HI3 A;  1JKO C;  2LR8 A;  1P7J A;  2NS7 A;  1MH4 A;  3V6G A;  2XGC A;  5IP6 A;  2M0C A;  3JRC A;  3VW0 A;  2XSD C;  1RES A;  2R0Q C;  3MKL A;  2ME6 A;  3S1N J;  2IU5 A;  2ECB A;  5J3L A;  5HAW A;  2CUF A;  3JRA A;  2OPT A;  2K9Q A;  1WH7 A;  2LP0 A;  5FLV A;  2WGB A;  1O4X A;  5C4Y A;  2K9N A;  2L0K A;  2QOP A;  3NI7 A;  3SJM A;  2LKX A;  4AC6 A;  3VIB A;  3GTM J;  1JKP C;  3CQZ J;  4M3G A;  4XRM A;  2ELK A;  2R93 J;  1NTC A;  3Q0U A;  4UUS A;  1DU0 A;  1SAN A;  3ZQH A;  3M3Y J;  2PZ9 A;  5EEA A;  3TP0 A;  4A93 J;  3HM5 A;  4MFD A;  2GLO A;  4A3B J;  1AHD P;  4IHV A;  3BNI A;  3S2D J;  4A3G J;  1ETV A;  3AQS A;  3FKI J;  3DEW A;  2EZK A;  2NOG A;  1WH5 A;  2IAI A;  5EF6 A;  1IDY A;  4DYR A;  5E3M A;  3OSF A;  2W53 A;  1ETW A;  2QWT A;  1OCP A;  2HXO A;  2LK2 A;  3ZQC A;  3B81 A;  5J1U A;  3RZD J;  5IP9 J;  4PXI A;  3A02 A;  2EZH A;  2COB A;  1H8A C;  1JUS A;  2XB5 A;  1WPK A;  3LSR A;  1BL0 A;  4GFL A;  1DU6 A;  5FJ8 J;  3KZ9 A;  3G1M A;  5H9T A;  2OF7 A;  3BR3 A;  2ZCM A;  4NN1 A;  1GVD A;  2JWT A;  2EH3 A;  2M8G X;  4GCL A;  5DAJ A;  4ABZ A;  4A3D J;  3HOW J;  2N8G A;  3OSG A;  2E2J J;  1TWG J;  2QIB A;  3LHQ A;  3A01 A;  2ZCN A;  4QSH A;  3RQI A;  1CQT A;  3BQZ A;  3CWR A;  5FKO A;  3S16 J;  2F07 A;  2RAS A;  2DMU A;  2ZB9 A;  4FTH A;  1U9O A;  3G7R A;  4UDS A;  3S1M J;  3VPR A;  4CYC B;  2R5Y A;  3HDD A;  3HGY A;  3GTQ J;  4A3I J;  3VW1 A;  3SFI A;  1ZR4 A;  4IEJ A;  3LNQ A;  4HKU A;  2LY9 A;  3IH3 A;  1X58 A;  3NAU A;  4AF5 A;  2WUI A;  4A3E J;  3BR0 A;  3VVY A;  2WB1 N;  3LSJ A;  2HYJ A;  4J19 A;  2CUE A;  2XPW A;  1JKR C;  1MSF C;  5FKM A;  5GPA A;  2JA6 J;  5E3O A;  4LOC A;  1JUM A;  4V2F A;  3IUV A;  1TWF J;  3BR6 A;  2H8R A;  1K61 A;  2B63 J;  3RD3 A;  5IYC J;  1APL C;  1IRZ A;  3D1N I;  1B72 B;  4X6A J;  3GTL J;  1VND A;  4BBR J;  3JRH A;  2R5Z A;  3ON4 A;  4V2G A;  1QRY A;  3OOU A;  4JNN A;  1IUF A;  3QKX A;  2REK A;  5K7F A;  2O7T A;  2EZL A;  1Y1V J;  2IBD A;  3SDG A;  4DYQ A;  1UHS A;  2YVH A;  1MBG A;  3S2H J;  1ITY A;  1H88 C;  5CXI A;  4B4C A;  3ZOB A;  4L62 A;  1ZK8 A;  2Y30 A;  2JMW A;  5FKL A;  2AHQ A;  1FEX A;  3K7A J;  2O8K A;  2NVY J;  4X1E A;  2Y31 A;  2M9H A;  1WCM J;  2QF7 A;  3Q0W A;  3HOX J;  1JGG A;  1JT6 A;  2XPU A;  4EEF G;  2VKE A;  3S1R J;  1LE8 B;  1G2H A;  2YVE A;  1X2N A;  2M2E A;  4MLO A;  1ETY A;  2HKU A;  2JK3 A;  5GPC A;  3HGG A;  4A3M J;  3QPS A;  4BY1 J;  1U9N A;  3HKZ N;  5JLX A;  3MVP A;  5IP7 J;  4A3J J;  1JTY A;  1OCT C;  4BKX A;  3ANP A;  2M34 A;  1QVU A;  3JRI A;  4A3L J;  4MO7 A;  4A69 C;  3M4O J;  3CMY A;  3TP3 A;  2DA1 A;  3GTG J;  4MIM A;  1ETX A;  4UUS B;  1W0U A;  1ZR2 A;  1U8B A;  4XID A;  3BTC A; 
#chains in the Genus database with same CATH topology
 3A4C A;  4JX6 A;  1HCR A;  2ETH A;  4CZZ A;  2RAE A;  4KMU X;  3CDI A;  4Y13 A;  2BW3 A;  2F2E A;  4FT8 A;  2JA5 J;  2DFH A;  3H5A A;  2VBX A;  2VI6 A;  2XPV A;  3OIO A;  4NUB A;  4L9N A;  5CPR B;  3EUP A;  1T2K A;  3BT9 A;  1X3Z B;  3KP6 A;  3EET A;  2G7H A;  3WGG A;  4Y17 A;  2KDZ A;  4EGY A;  2IA0 A;  1X3U A;  2O3F A;  3KEY A;  1F1Z A;  2E19 A;  1HDD C;  2Z9O A;  3WG7 H;  3I54 A;  2MH2 A;  4JP0 A;  1RR7 A;  1WRJ A;  2DK8 A;  1QZE A;  4NQW A;  3CCM I;  1IDZ A;  3KX2 A;  1TZL A;  5H2F C;  1ETQ A;  1OMI A;  2JT1 A;  1XC5 A;  3KKC A;  4IHT A;  2HXI A;  3EQL F;  1F36 A;  2DTR A;  1FMW A;  2ZC2 A;  1O57 A;  2K3F A;  4BJT A;  3W2V A;  3K6G A;  3ZR8 X;  2E7X A;  2ICW G;  2XKO A;  4HF1 A;  3S93 A;  5D19 A;  4P96 A;  4JYK A;  3IKV A;  1K7A A;  3VOE A;  3F1B A;  1D0Z A;  3I59 B;  2GA2 A;  2Z99 A;  4AVP A;  2XAH A;  2ID3 A;  3AG3 H;  3NNR A;  1Z9C A;  4UUV A;  5FLX K;  5E3N A;  2FML A;  5ERI A;  4BQO A;  3L2V A;  2XC7 A;  2DT6 A;  1WVR A;  1D5Y A;  1Q1H A;  1XN7 A;  2KIQ A;  2X6O A;  1OYI A;  2BVM A;  2ZME A;  3DPL C;  3LWF A;  2VOD A;  2UXH A;  3CJR B;  2XUB A;  2EIL H;  1I50 J;  4CH7 A;  5AON A;  2IXS A;  4M73 A;  1P6R A;  1PUF A;  3L2C A;  1YOV B;  3JRB A;  4HX4 A;  3NRG A;  1LDK B;  3OV8 A;  5HS7 A;  3RQ4 A;  3WHB A;  1ZYR F;  5F6F A;  2AQF A;  3BTI A;  3W6J B;  2XF7 A;  1J09 A;  5ICG A;  3N97 A;  4XIC A;  5FD6 A;  1YRN A;  5HDG A;  4M3F A;  3RKQ A;  2QBY B;  2EJR A;  2FNA A;  1BN5 A;  4RAZ A;  4Y7N J;  1ZTR A;  4WXH A;  2D1H A;  6PAX A;  1BW6 A;  2O03 A;  4P9F A;  2VBW A;  1QHH D;  3ASO H;  1KON A;  2V6E A;  1K78 B;  3F8C A;  4CCJ A;  1JUP A;  4HLY A;  1XGO A;  4EM1 A;  5F0H A;  2XAG A;  3J81 Z;  4ACI A;  3DLA A;  2DTZ A;  4M3D A;  4XLN F;  5FRN A;  4BEH B;  1XSX A;  2P5K A;  2DA2 A;  4FX4 A;  1LE8 A;  3PPB A;  1I6H J;  2W4S A;  2R7S A;  1U6G A;  3OYL A;  2VJ5 A;  3J80 Z;  1G8X A;  3NPI A;  1SD6 A;  3PSI A;  3G2B A;  4EJO A;  5C4X J;  2R7V A;  3CO7 C;  1BM9 A;  1FOX A;  5FGL A;  3IV5 A;  3HUG A;  2A6E F;  2DN0 A;  2HDD A;  3GLX A;  2JA7 J;  3WTV C;  1SAX A;  2G7S A;  1WSU A;  4AU7 A;  5LRS A;  2GXB A;  1D1B A;  4XL9 A;  2ESH A;  4HZF A;  5L3D A;  3PM1 A;  1MJA A;  2MGQ A;  2XHK A;  2FMY A;  1R9T J;  4WWC A;  1DP7 P;  5CQG A;  2HQR A;  2GWR A;  4BXF A;  4BHC A;  2W24 A;  4I76 A;  3HJE A;  2CW8 A;  2VUM J;  2LLK A;  1L3L A;  1U8R A;  2X1E A;  3OYD A;  3WGI A;  2W7N A;  4QPQ A;  3CJQ B;  1B8I B;  2K4B A;  1XS9 A;  3Q3S A;  1Y8R B;  2K86 A;  1XPX A;  2JJ7 A;  3KEQ A;  2UUZ A;  3ZRG A;  5ILV A;  4A2U A;  1WKM A;  4OAY A;  3S2W A;  2V9P A;  3KZZ A;  1FJL A;  2AO9 A;  2JRM A;  2OQR A;  2D1V A;  2FBK A;  1W36 D;  1HW2 A;  4NEL A;  2GXA A;  2BXY A;  3VSL A;  1F4K A;  1QA6 A;  2WA0 A;  3RKW A;  3BJA A;  1FX7 A;  1WJD A;  5FD5 A;  4C3I J;  3IH2 A;  4I6Z A;  1ULY A;  3LSP A;  5BMZ A;  1OLT A;  2JPC A;  1BW5 A;  2LY1 A;  1UB9 A;  4GGG A;  5F04 A;  4RDU A;  3ZGK A;  1HA8 A;  3PIP F;  3DTK A;  2VPR A;  2LDU A;  1NK3 P;  1T33 A;  3BZ6 A;  3PAS A;  3I3L A;  4D5C A;  3KYD B;  4ZDP A;  1C0W A;  3U9G A;  4LMY A;  1HOM A;  3R4K A;  2NVX J;  3WU1 B;  3HZJ A;  1JHH A;  2DFF A;  3W6K B;  1PUF B;  2A07 F;  4M3E A;  1UFM A;  2ZY9 A;  4PSW A;  3V8J A;  1G59 A;  1ZHF A;  2H1K A;  3FHZ A;  5D6F A;  3CME I;  2IS2 A;  2ECC A;  3CUQ B;  3V7R A;  2PMZ N;  3ZN1 A;  1I39 A;  1DGR M;  1OQY A;  3GBG A;  3GTK J;  1W7P B;  5AIQ A;  5A2Q Z;  3OYK A;  3G71 I;  2LD5 A;  3DKW A;  3F0C A;  3KZI C;  1XG1 A;  1IG7 A;  1GV5 A;  3FK6 A;  2WAD A;  1MNE A;  1LPQ A;  2FBQ A;  3E5U A;  1I1G A;  3LAP A;  2LRE A;  4XQF A;  4ZYH A;  4ESJ A;  1MSE C;  3FIS A;  4RBO A;  1JTX A;  2P81 A;  1QHG A;  3P9T A;  1B9M A;  1YFH A;  3DEU A;  3IAS 2;  5FKN A;  4ZZD A;  2HKO A;  2B7E A;  3AQT A;  2NYX A;  1XGS A;  5J8F A;  5HNH A;  4CHU A;  1OCC H;  2P5V A;  3ZQI A;  3GFM A;  3R61 A;  4CCN A;  3TDZ C;  2ZFW A;  1T98 A;  3FDY A;  4CDG A;  3FBI B;  3G1L A;  3RJP A;  4FE4 A;  5DUK A;  2O7O A;  2HOA A;  1V55 H;  3K2A A;  2JA2 A;  3A01 B;  3ONQ A;  2CH0 A;  1S7O A;  3DXJ F;  3BTL A;  1T95 A;  1ZRD A;  2DJI A;  2L9R A;  3V78 A;  3C07 A;  2DMT A;  2TCT A;  3AFH A;  4U7B A;  3HUG B;  3I53 A;  3E97 A;  2QEN A;  1J0R A;  3C2H A;  3L00 A;  1X1A A;  1ZN2 A;  3BG7 A;  1P7I A;  3JR9 A;  3ZP5 A;  4MXM A;  4FIS A;  3KEO A;  1HQC A;  2LY2 A;  3FXQ A;  4U88 A;  3HXL A;  2ZXJ A;  4L9J A;  1IV6 A;  4AVZ A;  4M3B A;  1SEU A;  4G12 A;  2UXP A;  3ZQF A;  2Z33 A;  3HTI A;  2CRG A;  2DT7 B;  3K0L A;  5CVJ A;  3TBI A;  2KZG A;  3J7Y J;  2WV1 A;  3BZK A;  3OS0 A;  1WJF A;  3BLY A;  2E2H J;  2VBZ A;  1A31 A;  2Y75 A;  1MBE A;  3LSK A;  5KNL A;  2VE9 A;  2XDN A;  1BIA A;  4WIB A;  1S29 A;  4CGZ A;  1GXQ A;  2YU3 A;  3OYN A;  2O5R A;  2K9L A;  4I09 A;  3MWM A;  1OCO H;  2VL8 A;  4EMS A;  3K1P A;  4KIC A;  5E20 A;  4IVN A;  1P4X A;  4BAC A;  5J6X A;  3I4N J;  3M7G A;  2F5D A;  3KLO A;  4E70 A;  4IHW A;  2DYR H;  1JKO C;  2KKO A;  5IT9 K;  3BG6 A;  4I01 A;  2X51 A;  4UV9 A;  4CUG A;  4DJA A;  1STZ A;  2XAU A;  2XSD C;  3S1N J;  2IU5 A;  2ME6 A;  2R7U A;  3F6V A;  5D5V B;  4OWR B;  5HAW A;  1LJ9 A;  4BE0 A;  4OIO F;  3HSR A;  3R6S A;  1E2X A;  3ELK A;  2LP0 A;  3IC7 A;  1O4X A;  2K9N A;  2ZO4 A;  5HLT A;  1U5T B;  2LKX A;  3CQZ J;  3QPT A;  3CLQ A;  5BPD A;  3LA2 A;  5JVT A;  2ELK A;  2P6S A;  4PZJ A;  4YRV A;  1G3Y A;  2XDV A;  3F9K A;  3Q0U A;  1U3E M;  1YTY A;  1MJ9 A;  3TP0 A;  1H0M A;  3BPX A;  2GLO A;  1R4N B;  1OCR H;  5LHG A;  5LRR A;  3S2D J;  3TDU C;  4LFU A;  3W3C A;  3FKI J;  4MQV A;  3ZMZ A;  5DCM B;  4DYR A;  4A12 A;  2XV4 S;  1FSH A;  1G3W A;  2QWT A;  3KP2 A;  2P4W A;  1OPC A;  1R36 A;  4U0W A;  3OYE A;  3B81 A;  2E60 A;  2RNJ A;  4EVI A;  3RZD J;  1WJE A;  5IP9 J;  1VTN C;  1FPQ A;  3GLL A;  4PXI A;  1KYW A;  2KRC A;  3EUK L;  3FM3 A;  1LVK A;  5TRD A;  2VC0 A;  3M07 A;  2X4H A;  1YO5 C;  3EYI A;  3LSR A;  3GO5 A;  2XRN A;  5E1X A;  1UHM A;  4HNU A;  3OYG A;  5H9T A;  5ILS A;  2OF7 A;  2VQG A;  2ZCM A;  2JWT A;  2MC4 A;  1S9H A;  3GZ6 A;  4M9X A;  1V4R A;  4A3D J;  5LLQ A;  3KET A;  2XGX A;  2O61 A;  2QIB A;  3KYL A;  3FXU A;  3A01 A;  1UAA A;  1TT0 A;  5FKO A;  1SFU A;  3H9Q A;  2DT5 A;  4FTH A;  3I4P A;  3HDD A;  2L5Q A;  3G3Z A;  3PNT A;  3FXO A;  3VW1 A;  1X4P A;  4IRG A;  2M8E A;  1ZR4 A;  4IEJ A;  4CCL A;  4OAZ A;  4J00 A;  2KZV A;  5GAE J;  3MKW B;  1Z3Y A;  2W84 A;  2WUI A;  2HTJ A;  2GIV A;  3QPH A;  5K5Q A;  3NRV A;  3M1C A;  1X19 A;  2HYJ A;  4J19 A;  2XPW A;  3KCC A;  5H6R A;  5GPA A;  4FX0 A;  1KU2 A;  2PN6 A;  4LOC A;  1QNT A;  4V2F A;  5HS8 A;  4A6E A;  2M7A A;  3L2R A;  2B63 J;  3RD3 A;  1APL C;  3O3K A;  3FBN B;  2OJE D;  1VND A;  3GTL J;  3CZ6 A;  2VXZ A;  1J75 A;  1HW5 A;  2QSG X;  3ON4 A;  1VQM I;  4JNN A;  1LB2 A;  1IUF A;  1ZLK A;  3JTG A;  1IN4 A;  1HC8 A;  2REK A;  2IBD A;  2DDA A;  2OCC H;  4B8X A;  4K2E A;  2V26 A;  3S2H J;  1ITY A;  3VEP A;  4B4C A;  1E0E A;  1W1W E;  4UVB A;  4L62 A;  1S5L C;  1RRJ A;  4L0Z B;  3F21 A;  1FEX A;  3AG2 H;  2O8K A;  2NVY J;  1V3F A;  1OCZ H;  4X1E A;  1VQP I;  1K78 A;  3NWS A;  3P9K A;  1JT6 A;  4E7Z A;  2VKE A;  3ZPL A;  5K5R A;  1SVM A;  2ZFU A;  5D6E A;  1LE8 B;  2FBH A;  2YVE A;  1A36 A;  2M2E A;  4L9T A;  5GPC A;  4L9V A;  4BE1 A;  1MZB A;  4A3M J;  2OZ6 A;  4ENJ A;  2PFV A;  4BY1 J;  1U9N A;  1OCT C;  3AL0 B;  3FX3 A;  1SFE A;  5LGN A;  5IY5 H;  1VQ8 I;  1ZEL A;  2VBY A;  2CUJ A;  3MZ8 A;  4UB8 C;  3JRI A;  4CCK A;  4OD4 A;  1EA3 A;  1QGP A;  3CMY A;  1CGP A;  2LBF B;  3GTG J;  5ICF A;  3F8M A;  1Z6T A;  1ETX A;  2HYG D;  1V54 H;  1W0U A;  3PL8 A;  1U8B A;  2PG4 A;  1UEL B;  4ASN A;  2HWV A;  5HNF A;  1A6I A;  1X2M A;  2GIZ A;  1T8I A;  2VQC A;  4ZH4 F;  2LRD A;  3L7W A;  1NH3 A;  4CA0 A;  3KNW A;  2DOA A;  2WV0 A;  1XX5 A;  3GTP J;  1ZGJ A;  3MN2 A;  3HIM A;  1RR8 C;  2EK5 A;  2OAZ A;  3AAF A;  3REO A;  3CMA I;  4MFE A;  2FNP A;  2VOO A;  1ZLJ A;  2LKS A;  3TGN A;  1Z0X A;  5B66 C;  5LGT A;  3EDP A;  5CVU A;  2GUH A;  4HQM A;  1FBQ A;  2KIM A;  4ITV A;  2FSW A;  4Y4R A;  3CCJ I;  3LSI A;  5A2Q K;  2QCO A;  3IP4 B;  3UNG C;  2IPQ X;  2FUG 2;  2NXN B;  2L7Z A;  3AKZ A;  1EH6 A;  2JSP A;  5CW8 A;  1M1E B;  5BQT A;  4LG3 A;  2JUG A;  1KQ8 A;  5D8L B;  3Q5F A;  1Q1V A;  4BNC A;  1FP2 A;  1FSE A;  1U2W A;  4LG0 B;  2CJJ A;  2W85 A;  1JJ6 C;  4ZYD A;  3R60 A;  3B6C A;  2GAU A;  2RRE A;  4V19 K;  5LD2 C;  4XM3 A;  5CKT A;  4GCV A;  1QQI A;  1V5E A;  2EFO A;  2HYF A;  3ZQ7 A;  3R0A A;  3SZT A;  1LNW A;  3BC8 A;  1W36 C;  2HEO A;  2RGV A;  3E6C C;  3DKY A;  2QSF X;  2OBP A;  1SAU A;  3K2Z A;  4CIC A;  3GYH X;  2DMN A;  3VYS B;  2V1U A;  1H89 C;  1BA5 A;  2RHA A;  1YX3 A;  3G56 A;  1J7K A;  4BL0 B;  4WXC A;  2IP2 A;  1ZH5 A;  4LB6 B;  3PQJ A;  1TL8 A;  1R22 A;  2STW A;  4IL6 C;  2ID6 A;  1YJN I;  5J1R A;  3CDL A;  3CP8 A;  4FET A;  1B72 A;  4NB5 A;  3V4G A;  2PJP A;  2TRT A;  3PO3 J;  1XCB A;  3ZQL A;  3OIP A;  3JSJ A;  4PJN A;  1BOB A;  2CFX A;  2EFN A;  2MLK A;  4BEH A;  4D9J A;  2LKP A;  1AA7 A;  1Y0N A;  3GME A;  4G6T B;  2E35 A;  5EEG A;  3QYE A;  1S7E A;  2ZOY A;  3M9A A;  5FMP A;  1GT0 C;  2PJR A;  5IOY A;  3VYR B;  3OS1 A;  3BJB A;  2F5V A;  2QSH X;  2XF5 A;  1I1S A;  2RQQ A;  3MMY B;  4C30 A;  4BGD A;  2WAE A;  1FIP A;  3ZQQ A;  2M4K A;  2XKP A;  1J59 A;  1QPI A;  1SVO A;  2O0Y A;  3LJL A;  2WAQ N;  1U5T C;  4M6Y A;  4I98 B;  2VT3 A;  3OMY A;  2OUM A;  4HNV A;  3TED A;  5EYR A;  2A5Y B;  1DQU A;  4OIQ F;  3BCG A;  1P4A A;  2BV6 A;  3KYC B;  4L5I A;  4UV8 A;  1IW7 F;  2QKM B;  4B3A A;  2EV6 A;  4TV7 A;  2NVU B;  2FE3 A;  2L7M P;  5CVV A;  3SDB A;  1RUN A;  2HYT A;  1FTZ A;  4A3C J;  2ZSH B;  2W25 A;  2UXX A;  3ABK H;  5EGO B;  3GZI A;  2Z1D A;  3ZMS A;  4MEY F;  1JXS A;  2HS5 A;  3DBL B;  1HF0 A;  3CC7 I;  2VPL A;  2E5N A;  5HSZ A;  2WB1 A;  1LUJ B;  3FXR A;  4Z6Y A;  3BHQ A;  1R58 A;  1FOK A;  3I56 I;  2LC2 A;  1VQL I;  3QYB A;  5BS6 A;  4JX5 A;  5LGU A;  1MH3 A;  2R5Y B;  4BH9 A;  5EGO A;  1D0X A;  5IOZ A;  4C2T A;  3KKD A;  3KPH A;  1ZG5 A;  2QYO A;  2HFH A;  3QP6 A;  3IAM 2;  1IXS B;  3A03 A;  1FIA A;  3C2B A;  4KWA A;  1ODD A;  2CQN A;  5EZG A;  4E7I A;  1K6Y A;  4XOT A;  5LFA A;  1FP1 D;  2V1N A;  3V8K A;  2VJJ A;  2K27 A;  2V1D A;  2IGO A;  2CV0 A;  1B8I A;  2YU9 J;  4HRI A;  2CU7 A;  2OER A;  4YEJ A;  3OYJ A;  1SD4 A;  1XTA A;  5M5X J;  2YUS A;  3CUO A;  3I0T A;  5B5E C;  2H09 A;  3H1C A;  1W5C C;  3QU3 A;  3FWE A;  1IF1 A;  2LNB A;  4PSX A;  4AC0 A;  1I5Z A;  5LHH A;  2VQH A;  4RGS A;  3H0G J;  3OOP A;  4LG0 A;  1TNT A;  4PFO A;  4XSX F;  5F27 A;  4Z2Y A;  1Z05 A;  1TC3 C;  4FCY A;  1ETO A;  4F91 B;  2VJI A;  1NG7 A;  1IC8 A;  3EUA A;  2M5W A;  4I7H A;  4A3K J;  1JJ8 C;  4OD5 A;  4P1W A;  2ZNZ A;  1R71 A;  2BOL A;  1R1T A;  1S8N A;  2ZJP F;  3O8G A;  4B3X A;  1RKT A;  3F8F A;  2XAF A;  3BCA A;  1HLV A;  4MNU A;  2E2I J;  1AKH B;  5K7Z A;  2DG8 A;  4AYB N;  1LFB A;  3FRQ A;  5D4S A;  1YX5 A;  3OYM A;  2G3B A;  5FO5 A;  3GF2 A;  3SYT A;  3VP5 A;  1UG2 A;  3QRF F;  3A2K A;  4HNT A;  3PFY A;  4IRH A;  2K9M A;  4DIQ A;  2NX4 A;  2LBF A;  3NXC A;  3GTO J;  1I27 A;  2Y0M A;  1BI2 A;  4B44 A;  2A6H F;  1T0F C;  4HEA 2;  1MBK A;  3DV8 A;  5K7H A;  3E6D A;  3VOD A;  3H9J A;  3E5Q A;  3LA7 A;  4IOA F;  3MZH A;  2DMP A;  2L9N A;  5DEQ A;  3CDH A;  1GLN A;  2B0L A;  3CES A;  3K4N A;  3GWZ A;  2H6B A;  3U1K A;  3U2R A;  3M1E A;  2KFD A;  1IV8 A;  1SGM A;  3ASN H;  3TKY A;  2IJL A;  2M3A A;  2XGE A;  2LMD A;  5J4V A;  4Q48 A;  3VSK A;  2E1O A;  1TP4 A;  1TW2 A;  1IN6 A;  2UV1 A;  2ZCW A;  4BUP A;  5ILU A;  4N4N B;  4NHJ A;  1XSD A;  2ZJQ F;  3E7Q A;  4MQ9 F;  2OZU A;  1GHC A;  2KPM A;  3GUD A;  3HEF A;  2EIM H;  2DPU A;  4UUT A;  3O8H A;  2FD5 A;  5DDG A;  2DW4 A;  2VON A;  1O7L A;  2MYS A;  2WBM A;  1R1V A;  3H3Z A;  4I2O A;  2RDP A;  2FBI A;  2GFN A;  3UR3 C;  1VQK I;  3K4L A;  3COL A;  5LHI A;  5D18 A;  2L9V A;  3JAM K;  2BBY A;  5DUI A;  3VW2 A;  5F0C A;  1VQ4 I;  1UI6 A;  4RAY A;  4A3F J;  2X85 A;  2ZSI B;  2H6C A;  4BY7 J;  2R7O A;  4DBQ A;  3O6B B;  2NNY A;  4GFB A;  3E7L A;  3JRD A;  1BC7 C;  2ISZ A;  2NS0 A;  2HVR A;  2OA4 A;  1TT5 B;  1BR1 A;  5M3M J;  1A6Q A;  3WTW C;  4E7K A;  4UY8 I;  1R49 A;  1WJB A;  5CLS A;  4ZTJ A;  1ZRF A;  3L2U A;  2BZT A;  2L3D A;  5FRM A;  1OJL A;  4JX4 A;  1WFX A;  4HX8 A;  1I3Q J;  3DLL F;  5CVI A;  4AID A;  2A3S A;  4R1H A;  3WTY C;  2W48 A;  4Q5S F;  4QTR A;  2NVT J;  2HI3 A;  1FYL A;  1TTY A;  2LR8 A;  3E6B A;  4G7H F;  3WTT C;  1U5T A;  3V6G A;  3BJO A;  4UXN A;  5IP6 A;  3WOD F;  1I3A A;  3OL3 A;  2Z3Y A;  2R0Q C;  2HR3 A;  1XSV A;  4XOR A;  3TMO A;  3G4S I;  4KJZ A;  1D3Y A;  2QZ8 A;  3S3N A;  3RKX A;  2L0K A;  4G7O F;  4U9N A;  5HDN A;  4WXD A;  4HPQ A;  3VIB A;  4M3G A;  3BOQ A;  3QP5 A;  1EKE A;  4GO1 A;  3M3Y J;  1ZAO A;  3ECO A;  4KA4 A;  1AHD P;  2R7R A;  2YPR A;  2EPF A;  2KLO A;  3QAH A;  4I0B A;  5DM7 F;  2COM A;  3M8J A;  2EZK A;  3PQK A;  2NOG A;  3HPH A;  1WQ2 A;  2MFZ A;  2IAI A;  2EA4 A;  4XLA A;  1IRF A;  1JHF A;  5E3M A;  1N25 A;  1EV7 A;  2LK2 A;  3ZQC A;  2CV1 A;  2ELJ A;  3IWF A;  1OYY A;  5J1U A;  3SHF A;  3S32 A;  2COB A;  2V7F A;  1NG6 A;  2RV8 A;  5E79 C;  3SEQ A;  3VYU B;  1U0J A;  2A2F X;  3EUH C;  1YJW I;  3GFI A;  2BXZ A;  1WPK A;  1LEA A;  1BL0 A;  2H8W A;  2M1B A;  1DU6 A;  3DQV C;  4HW0 A;  3KZ9 A;  1IZ1 A;  1REP C;  4M72 A;  1GVD A;  2ZXH A;  2R7X A;  1A35 A;  5CYV A;  1J2X A;  5GTH C;  2R7T A;  2IW5 A;  4E7L A;  1TWG J;  1X1D A;  2W00 A;  3DTE A;  4QSH A;  3LL7 A;  1CQT A;  3WE3 A;  2ZME C;  2X1D A;  5K1Y A;  4I99 C;  4KIS A;  4UDS A;  3S1M J;  3VPR A;  2R5Y A;  4XSZ F;  3HGY A;  1JI8 A;  4P5O A;  1Z21 A;  1X58 A;  4AF5 A;  2CFO A;  1XGN A;  4O5V A;  4H4K C;  4A3E J;  2DI3 A;  3MCZ A;  3VVY A;  4GYI A;  2WB1 N;  3LSJ A;  2VOP A;  2DBB A;  2HNH A;  4EM0 B;  4LIU A;  1LFP A;  3U21 A;  4O6J A;  2OC6 A;  5KAF C;  3F8N A;  4PCQ A;  1TWF J;  3BZC A;  3BR6 A;  2EWN A;  2KDO A;  3F23 A;  4R79 A;  3SEZ A;  1PUE E;  4NC7 A;  3LA3 A;  3CJN A;  3IWZ A;  3RI4 A;  1W5T A;  4X0G A;  4KFC A;  2KL4 A;  2UZK A;  1BC8 C;  4HLX A;  1IAW A;  2YVH A;  4RGU A;  1SD5 A;  1MBG A;  2QQ8 A;  3CLO A;  2PLY A;  1Y0U A;  1XDS A;  3ZOB A;  1ZK8 A;  2FA5 A;  3BY6 A;  2CG4 A;  3H5R A;  4F93 B;  5BPI A;  3K7A J;  4ETS A;  2D2W A;  4HX7 A;  1UCR A;  3Q0W A;  4ESB A;  3HOX J;  3NS4 A;  2RN7 A;  5E18 F;  5TGT A;  3CD6 I;  4LD5 A;  3RTR A;  3S1R J;  4KN4 X;  2M4G A;  1X2N A;  5CJ9 A;  4MLO A;  1MMD A;  4HV6 A;  1OKR A;  2ZNY A;  1LQ1 A;  4L5J A;  3KP7 A;  3H36 A;  4WF2 A;  5DCF A;  5IP7 J;  4A3J J;  2ACJ A;  4HG2 A;  4XOP A;  4BKX A;  2ADU A;  2DK5 A;  2IS6 A;  2J5O A;  2BGC A;  2MD5 A;  3RPQ A;  4A3L J;  1KGS A;  3NQO A;  5F64 A;  2OTJ I;  2K02 A;  2QQB A;  3EPZ A;  1Y39 A;  3TO9 A;  3DP7 A;  2JSC A;  3OR2 C;  4F55 A;  1ZR2 A;  1TQI A;  2C6Y A;  3BTC A;  2F4I A;  5TIS C;  4ZJZ A;  3F22 A;  1O3S A;  2JRT A;  3H9G A;  3P9C A;  3QBM A;  1JT0 A;  1AOY A;  4HAM A;  1WWX A;  1HKS A;  4MTE A;  3CRJ A;  4RGX A;  3TW7 A;  4M74 A;  2NS8 A;  4IRV A;  4U0Y A;  2Y0S N;  5D5U B;  1B6A A;  2F5C A;  3VDX A;  1WHU A;  3BQY A;  4AUX A;  5HLH A;  1IJW C;  3F3X A;  1O7F A;  2P6T A;  1VQ6 I;  3D0S A;  4HST A;  5GP9 A;  2HKX A;  4RGR A;  4QIW N;  1W0T A;  3L9F A;  1BR2 A;  2D5V A;  3FXK A;  1UMQ A;  4PK4 A;  2A5W A;  2MW8 A;  4A5M A;  4UVA A;  4CCM A;  4OU0 A;  4OOI A;  1ERD A;  1N77 A;  4O3M A;  5F1J A;  5C4J J;  4CGR A;  1FNN A;  3O2P E;  4PGH A;  3AL0 C;  5J4Y A;  5KHD A;  1DPU A;  2W1O A;  3WHC A;  3DU6 A;  2M45 A;  3S3M A;  5DTD A;  5DM6 F;  1R5I D;  2Q2E A;  3DEE A;  2VXD A;  3MZY A;  5F1R A;  1GDT A;  4G7Z F;  2KJC A;  4A5N A;  2DFE A;  4XN3 A;  3BG3 A;  4W1U A;  2KHM A;  5TJJ A;  2V6C A;  2ZME B;  2R7Q A;  1X1B A;  2XGD A;  2WAQ A;  4H0E A;  3ZN0 A;  1A5J A;  2E71 A;  4MGR A;  1HBX G;  3A0B C;  2GA1 A;  4IHS A;  3AG1 H;  2O6G E;  2LFB A;  2LOO A;  3D5L A;  4AWX B;  3FHN A;  2MLG A;  2QKO A;  3HRM A;  1Z7L A;  3T5X A;  4G8X A;  3LWJ A;  2VJ4 A;  4BDZ A;  3H3U A;  1F43 A;  2VKV A;  4G6Q A;  4ZYG A;  2EIN H;  3MEX A;  3Q9S A;  4NDL A;  4KUM A;  2CS3 A;  4RM2 A;  1UHW A;  3JRF A;  3MKY B;  3L2Q A;  1P2F A;  1GUU A;  1Z77 A;  4XMY A;  3VOK A;  4NBQ A;  4LIT A;  3V8L A;  3GZ5 A;  3X2Q H;  3C7J A;  3LFK A;  3GFJ A;  2BE5 F;  1XGM A;  3KP3 A;  3OIQ A;  4XRF A;  1AKH A;  2OI8 A;  5JFR A;  1MMA A;  1FTT A;  4C2U A;  2MA3 A;  5CXG A;  1R4M B;  4YFN F;  2IGM A;  4RMN A;  4YEL A;  4EJW A;  5DD8 A;  3ON2 A;  3CJT B;  2LTP A;  3E5X A;  4HDU A;  1LDJ A;  4IZZ A;  1B9N A;  4IXA A;  4BHB A;  4ANJ A;  2MAB A;  2K5C A;  2AQE A;  2B3W A;  1KZH A;  2PMU A;  1H9G A;  2GOM A;  4DGW B;  2R92 J;  2DJN A;  2LG4 A;  3G1O A;  3MKZ A;  4XRS G;  2PEX A;  3W2W A;  1ZKG A;  1OFC X;  2UXI A;  2L4A A;  1E17 A;  3WTX C;  1YIT I;  2RC4 A;  3AG4 H;  3HC7 A;  2BHY A;  2EIK H;  1S6L A;  2E7W A;  5B1B H;  5IYD J;  2L7F P;  1O3T A;  1MBF A;  3QOE A;  1L0O C;  4HDV A;  3WG9 A;  1WJ5 A;  1BI3 A;  2OCE A;  1O3R A;  4UHT A;  2K9S A;  1E3P A;  3H35 A;  2MH9 A;  2I10 A;  1RC9 A;  3K4M A;  1P9Q C;  5EZH A;  4ENM A;  2DA4 A;  3RCO A;  3T8R A;  1XDU A;  1RPW A;  2JPB A;  3B02 A;  3QPL A;  4FE7 A;  1YW9 A;  4YIR X;  2F48 A;  3ESW B;  2AXL A;  4IJA A;  2ZKZ A;  2XAQ A;  5M5Y J;  3TO7 A;  3FXJ A;  2UXN A;  2I5U A;  1HST A;  4EJV A;  4Y52 J;  3VOX A;  3RH2 A;  2MSY A;  1TQP A;  1YJ9 I;  1ENH A;  4QWQ A;  4ZC3 A;  2DYS H;  1JE8 A;  1OIS A;  2L01 A;  1FZP B;  1K83 J;  2E1M C;  2QA4 I;  4AIH A;  1IXR C;  4YIF A;  2YX4 A;  2PI0 A;  3CCS I;  2F6C A;  3L09 A;  1UI5 A;  3HOZ J;  1EH8 A;  3TL4 X;  4EV0 A;  2XRO A;  1POG A;  2Y69 H;  1XD7 A;  1UJ8 A;  3BRO A;  1VQ7 I;  3IHU A;  5ED4 A;  1FY7 A;  2FX0 A;  3JSO A;  2X48 A;  3GTJ J;  2ZBK A;  2R7Z J;  1VZ0 A;  1YW7 A;  1E3O C;  1OR7 C;  3HIF A;  3K10 A;  3OL4 A;  3P5J A;  5D1R A;  3RZO J;  3IRR A;  4U87 A;  3DBR B;  1QVT A;  1OR7 A;  4PUS A;  3C3W A;  3RPU D;  1KU9 A;  3CCR I;  3HHG A;  5H6Q A;  1D0Y A;  4DBR A;  3LAJ A;  3MQ0 A;  1Z6R A;  4B09 A;  5ICE A;  2G0E A;  4ZYE A;  3NAR A;  3S17 J;  4C3J J;  3F8B A;  3EGQ A;  3K4K A;  2KIU A;  4NC8 A;  3L1P A;  1IN7 A;  3S3O A;  3I5U A;  3BR1 A;  2BY0 A;  4OMZ A;  2VLA A;  3T6N A;  2ZXW H;  4EQQ A;  5HVQ C;  1T38 A;  2HVQ A;  2QWW A;  2V9K A;  2Q24 A;  4ICH A;  5K58 A;  5ICC A;  2XF6 A;  4IF4 A;  2L02 A;  3KZY A;  4F52 A;  1YI2 I;  3R0J A;  4D5F A;  2G9W A;  4NNJ A;  2XRL A;  1TWA J;  4MTD A;  3JRE A;  1Z91 A;  5GAH J;  3HKZ A;  4LLN A;  4BYY A;  4XKW A;  2O9L A;  4XLH A;  9ANT A;  4BHP A;  2L7K A;  5EEH A;  3S1Q J;  2Q1Z B;  3NEU A;  3K8P C;  2V4J C;  5E1Z B;  4ZZL A;  2VB6 A;  2LSO A;  3B6A A;  2PMH A;  2DU9 A;  1T39 A;  2JQ7 A;  4E7J A;  4M6X A;  2KRF A;  1MNM C;  2JA8 J;  5LBQ A;  4EJU A;  1ACI A;  5FHP A;  2M7B A;  3BG9 A;  2CO5 A;  2DAO A;  2DA6 A;  1TWC J;  2Y2Z A;  1K79 A;  1FLI A;  2IS4 A;  4OIN F;  1EF4 A;  3H3V K;  2A6T A;  2IVM A;  3KLN A;  5JVG F;  5IT3 A;  3CTA A;  4ZDL A;  2V79 A;  5HOD A;  2YS9 A;  1PP8 F;  4FHT A;  5M5W J;  1V5F A;  3KE2 A;  3DCF A;  4IQ4 A;  1R1U A;  3HOV J;  4BU2 A;  2LVS A;  3HRS A;  3HOY J;  3JCU C;  2DQR A;  3CCY A;  1ORK A;  2HOS A;  1RUO A;  1MDM B;  2ZJ2 A;  2MG4 A;  4F92 B;  2EZI A;  4AIK A;  5KCM A;  4I0A A;  5J1Y A;  2HDC A;  1BR4 A;  2KRH A;  1T56 A;  3ABU A;  3I71 A;  3P7N A;  4BE2 A;  1JKQ C;  2DQL A;  1ZAR A;  2QQA A;  4XRS A;  4BBS J;  3GEU A;  5HDK A;  1DPR A;  1MDM A;  1K4S A;  4BQA A;  1FYM A;  4W97 A;  3RPU A;  2PMZ A;  2VKH A;  3HB9 A;  2HU9 A;  5JR3 A;  3ISP A;  2G7G A;  3FK7 A;  1RET A;  4JL3 A;  2FF4 A;  2NP3 A;  3BR2 A;  3EYY A;  1SFX A;  1K4T A;  5H20 A;  2V57 A;  3DBH B;  3I64 A;  1DDN A;  4L5E A;  3JW4 A;  3MAJ A;  2BHZ A;  1QBJ A;  3SWH A;  4QLC U;  1H9T A;  3VVX A;  1N75 A;  3CUQ C;  2OTL I;  5FGM A;  4RB2 C;  4E7S A;  5JLW A;  1HDP A;  3HBL A;  2OV7 A;  4N4O B;  2KIF A;  3HTJ A;  3A1Y A;  1AWC A;  1IGN A;  4GRI A;  4E4H A;  3TQN A;  1FOY A;  1SMT A;  1IRG A;  2ZCX A;  1SC7 A;  5E3L A;  2GM4 A;  2DA3 A;  1BBY A;  5DS9 A;  4BQN A;  3G73 A;  3A0H C;  4OIP F;  2FQ4 A;  5K5O A;  2HOT A;  2F4M B;  2NS7 A;  1P7J A;  1ONV A;  2X6X A;  4IRI A;  3FM5 A;  1VQ5 I;  1MJB A;  2Y48 A;  2OD5 A;  2D45 A;  2ECB A;  2CV2 A;  3LSM A;  1FT9 A;  2Z5U A;  3CMM A;  3VFZ A;  4DQ2 A;  2QLZ A;  2K9Q A;  1WH7 A;  5HS9 A;  3FMS A;  5FLV A;  2WGB A;  1QZY A;  3NI7 A;  1D5V A;  5GAD J;  3SJM A;  4AC6 A;  4M9Z A;  2IRF G;  3GTM J;  2AXT C;  4CSW A;  3L2W A;  3H0D A;  4B47 A;  2P8T A;  3G6E I;  1NTC A;  1HKT A;  4UUS A;  2R7W A;  1LDD A;  3ULQ B;  4AD9 A;  5JHF A;  4AIJ A;  4IQJ A;  2PZ9 A;  3CUQ A;  4P9U A;  3HM5 A;  4MFD A;  4A93 J;  4A3B J;  2VIX A;  4IHV A;  4DOZ A;  3FMR A;  3T0Y A;  2VT2 A;  3CO6 C;  1PP7 U;  4A3G J;  2CQ7 A;  3AQS A;  2EFQ A;  5D5W B;  4JBA A;  3GFL A;  4ENN A;  3LQR A;  1G3S A;  3OSF A;  1ETW A;  1OCP A;  4IOC F;  2CQK A;  3COA C;  1D8K A;  1FOW A;  4PJM A;  2EZH A;  1H8A C;  1JUS A;  2BY2 A;  2XB5 A;  3QU6 A;  3HOS A;  1VQO I;  5E1W A;  1G6N A;  4KN7 X;  3J80 K;  5DCM A;  5J47 A;  4RB0 A;  1CF7 B;  3G1M A;  2EB7 A;  1MKM A;  3BR3 A;  5FFX A;  1J9I A;  2M8G X;  1QZZ A;  2J5P A;  3RDI A;  3SZG A;  5DAJ A;  3QOD A;  2ISY A;  2NOJ B;  2N8G A;  3OSG A;  4LIV A;  2P7C B;  1KU3 A;  1B59 A;  1YS6 A;  4BXU A;  3HSE A;  2B9S A;  3LHQ A;  1RNL A;  4PJ0 C;  3BQZ A;  3EUH A;  3DWL E;  1VQ9 I;  3PJR A;  3N05 A;  3ZMV A;  2ZB9 A;  1U9O A;  2DDB A;  4HF2 A;  3GTQ J;  4XLC A;  4KT5 C;  3LNQ A;  1O3Q A;  4LJZ F;  3F72 A;  3IH3 A;  3QYF A;  3NAU A;  3IL2 A;  4CYD A;  3HTS B;  3KFW X;  4PDK A;  5L3F A;  5GAG J;  2CUE A;  3Q9V A;  3CC4 I;  4E6K G;  1I6X A;  2FJI 1;  4UB6 C;  3GW2 A;  5FKM A;  4HF0 A;  2QM3 A;  5E3O A;  2P5L C;  1X4O A;  3IUV A;  2Y0S A;  4Y15 A;  2A61 A;  1R6R A;  5IYC J;  4XBF A;  3J7A O;  4WK8 F;  1HXD A;  4JK1 X;  3WU0 A;  4B43 A;  2R5Z A;  3KP4 A;  4X6A J;  2YX7 A;  2WAF A;  1RI7 A;  5JHU A;  4V2G A;  1R5G A;  1R00 A;  2Q0O A;  1D8J A;  3LST A;  3QKX A;  2A69 F;  5K7F A;  2O7T A;  4ZDO A;  3SDG A;  4DYQ A;  1UHS A;  4XKB A;  1H88 C;  1YE9 A;  3ABL H;  2Y30 A;  3DU5 A;  5FKL A;  2AHQ A;  4QPO A;  1ZG3 A;  2UWM A;  2M9H A;  4U9L A;  2QF7 A;  1JGG A;  1W7P A;  1YYV A;  1YQA A;  2F5F A;  3VB2 A;  2QEX I;  1S72 I;  5B3S H;  1YIJ I;  2WY8 Q;  1WJC A;  3ERM A;  1W5S A;  1G2H A;  5IT9 Z;  2HKU A;  1ETY A;  2WY7 Q;  2JK3 A;  2LYC A;  3B73 A;  4L0Y B;  4HBL A;  3HOT A;  3QPS A;  2CW0 F;  3C1D A;  3MVP A;  4EGZ A;  4RB3 C;  2MC3 A;  3IUO A;  4ENK A;  4FAS D;  1Z3X A;  2M34 A;  4YII A;  2KMU A;  4MO7 A;  4A69 C;  3CP2 A;  2DA1 A;  1G3T A;  1TLH B;  4KNY A;  1HKQ A;  1Y56 A;  2E36 A;  4IPA A;  3D5S C;  1K6O A;  1A04 A;  2IGK A;  2MBF A;  1WJA A;  4CO8 A;  3SZP A;  2YR2 A;  1IN5 A;  4F7Z A;  2K7L A;  3H5N A;  4IHY A;  2CMP A;  4PJJ A;  1BJA A;  4RM3 A;  1YS7 A;  2JN6 A;  1YG2 A;  3JSP A;  4IHX A;  2HQ5 A;  2QUF A;  4A0X A;  2DCE A;  3K70 D;  2CQX A;  1WZ2 A;  2QGU A;  3LOC A;  4B1R A;  3WTS C;  4M6V A;  3DPU A;  1YIO A;  1MIJ A;  5IPA A;  2GOX B;  1MW7 A;  3DTI A;  3Q0V A;  1FBU A;  3OYB A;  4Q47 A;  2GQQ A;  2V1X A;  4HA8 A;  1BI1 A;  1KQ0 A;  3SFZ A;  2CQQ A;  4BDY A;  1LVA A;  1CF7 A;  3SQN A;  2FRH A;  4AYB A;  2HZT A;  5DD4 A;  3FF5 A;  2NP5 A;  2FOK A;  2XB0 X;  2DFI A;  5KAI C;  4BAY A;  2HPM A;  4N0B A;  5EJC A;  2D6Y A;  4P55 A;  3FIW A;  2GXG A;  1IUY A;  5EG0 B;  3D5R C;  2KQR A;  1R7J A;  3GXO A;  3NWT A;  4A0Y A;  4WCG A;  1Y6I A;  2B1E A;  4XLF A;  4D7N A;  4R8H A;  2L2O A;  1IO2 A;  1SMY F;  1W7P D;  2RKH A;  4MEX F;  3DF8 A;  3T1B A;  5EG0 A;  3QWL A;  1LEB A;  3HTH A;  3S15 J;  4GCK A;  3LSG A;  3HSF A;  1UG0 A;  1KU7 A;  1RIO H;  2VQL A;  3I59 A;  1DUX C;  3KIO A;  2TDX A;  5C3E J;  4MK6 A;  1TWH J;  3VYT B;  3HG9 A;  4UVC A;  4HQE A;  5L3C A;  1QO0 D;  4Y3O A;  3FXL A;  2K40 A;  3C18 A;  3HYI A;  4HYE A;  4Y33 A;  1VQN I;  2GBY A;  3ANG A;  4J01 A;  2DLL A;  2X6Y A;  4N9H A;  5GTI C;  1S3J A;  4Q4Z F;  4DYC A;  2GZW A;  3BCB A;  1T6S A;  1BIB A;  3BTJ A;  5BNG A;  2HGC A;  3ML6 A;  1T0F A;  2WC2 A;  2UXO A;  4C3H J;  2Y9Z A;  4FQG A;  2L4M A;  4RLQ A;  4LB5 A;  3O60 A;  5HBU A;  4C2M A;  3BG5 A;  5CQE A;  3ZQG A;  2R3S A;  2E5Z A;  4GYG A;  2QBY A;  4GFK A;  5IYB J;  2G7U A;  3HL2 A;  5B1A H;  3CCU I;  5EDN A;  5AQC A;  2HZD A;  2I8D A;  5L3B A;  1RKW A;  3HHH A;  2FJ1 A;  2JTV A;  5E17 F;  2L9S A;  3C2G A;  4ZTF A;  2FQ3 A;  1VI0 A;  1MD0 A;  3VUQ A;  3DPJ A;  2DG7 A;  3OR1 C;  1YHQ I;  1OYW A;  1B4A A;  3KP5 A;  1TNS A;  1ZG1 A;  3WTZ A;  1RZ4 A;  3K4J A;  4II3 A;  2R7D A;  3UKG A;  1E3H A;  4D7M A;  5LEJ A;  3IH4 A;  1BJZ A;  2DMQ A;  2EA2 A;  3QQA A;  1ON2 A;  1ZGA A;  4IKF A;  1MBJ A;  4DVY P;  3DPT A;  4M71 A;  1J5Y A;  2PBI A;  3HOU J;  3HTU A;  3ERE D;  3DFG A;  2Y9Y A;  4LLG F;  4RS8 A;  1LFU P;  3CF5 F;  2QTQ A;  4XKC A;  4D1Q A;  2EFP A;  1MMN A;  3E6M A;  2PX9 A;  3IRQ A;  4BQQ A;  4GDF A;  4CXF A;  2Z2S B;  5HLI A;  1BOA A;  4G94 A;  2KP6 A;  4HSR A;  4RLF A;  2M87 A;  2LF7 A;  2DA7 A;  2QVO A;  4YZE A;  3MNL A;  2V9V A;  1TQM A;  4CYC A;  3S5R A;  3LQQ A;  2NRA C;  2CSO A;  2QQ9 A;  2PQ8 A;  3OYC A;  1TBX A;  1SFO J;  3LFU A;  5AIP A;  2HTS A;  2KT0 A;  1VFC A;  1VF9 A;  1Y1W J;  5E8G A;  5FLM J;  4ME9 A;  4ZYA A;  4M9S A;  3VVZ A;  2M0M A;  4XLP F;  3BJ6 A;  2NVQ J;  1F9N A;  2X0L A;  4BXX J;  3N4M A;  1NHA A;  2DA5 A;  2K4J A;  5F08 A;  3OY9 A;  2UXU A;  2RVC A;  3ZMT A;  3BWG A;  1FYK A;  3S14 J;  2ZOZ A;  4XR6 A;  2HQA A;  2A05 A;  3V7S A;  2ZJR F;  2XIG A;  4LGW A;  3BRU A;  2EBI A;  2R5Z B;  2YSR A;  3FKJ A;  1FWZ A;  3HE0 A;  1QPM A;  4PGG A;  1DGW Y;  3BR5 A;  2M30 A;  2X6W A;  2RQP A;  3I58 A;  3F6O A;  4LK0 F;  5C44 J;  3M8F A;  5D8K B;  2CW7 A;  2E1N A;  3ZXS A;  1DP3 A;  2XVC A;  2HVS A;  3OWT A;  4LK1 F;  2BY3 A;  4A6D A;  4DZJ A;  5L3E A;  1AU7 A;  4KDP A;  1YRN B;  4XN0 A;  1HSJ A;  4EM2 A;  3K70 C;  4YFX F;  4DW6 A;  3PIO F;  3I4M J;  4B48 A;  4PJL A;  4KIT B;  2ESN A;  1MBH A;  2BYV E;  1KYZ A;  1XMA A;  4OMY A;  3CJD A;  2GEN A;  5FFZ A;  5J8C A;  4PFP A;  4S0H B;  4C9Y A;  1ETK A;  5BOX A;  3ZMU A;  3TOB A;  2ME0 A;  4IO9 F;  4JKZ A;  2DXI A;  1IN8 A;  1PDN C;  2CUZ A;  4CZC A;  4HV5 A;  5DYM A;  1UST A;  3BP8 A;  3ZMD A;  2E1C A;  2G7L A;  3IKT A;  5FLX Z;  5EFY A;  3U1D A;  2LF8 A;  4BJ5 C;  1P92 A;  2KIS A;  2W82 A;  3ZCO A;  2CGP A;  3OYI A;  3JRG A;  2PBX A;  4U7D A;  2X1C A;  2QKL B;  5FKK A;  5E8I A;  1WI3 A;  1Z7U A;  2W57 A;  5KK1 A;  3GX4 X;  2NNN A;  4XNF A;  4G9Y A;  4GCT A;  3PFI A;  2H27 A;  5DV5 A;  3W6V A;  1SFK A;  3J81 K;  5F0F A;  3WE2 A;  5FRO A;  3RYR A;  4C2M J;  2MD0 A;  3RKY A;  2IEK A;  2JZY A;  4D0P A;  4RAG A;  4NQW B;  3GEZ A;  1MGT A;  1XCV A;  4XLE A;  5J40 A;  3W2A A;  3HRT A;  3LSH A;  3CCQ I;  2VE8 A;  4BJ6 C;  1NK2 P;  3MFK A;  5M3F J;  3FMQ A;  2OU2 A;  3PSF A;  1R5H A;  2XSJ C;  1GVJ A;  1B1B A;  1KA8 A;  2X9D A;  4DZP A;  4JQF A;  1V5G A;  1WI9 A;  5CVR A;  1GV2 A;  2JVH A;  2Q2E B;  3OYA A;  1FC3 A;  4XK4 A;  3PO2 J;  1XMK A;  2EV0 A;  2F5E A;  2Z16 A;  4ON0 A;  1PVE A;  3PUF A;  3QOP A;  3J7Z I;  5FB2 A;  1P4W A;  2PFB A;  3TW6 A;  3H92 A;  1T08 B;  2P0W A;  2OQG A;  3HRU A;  2VN2 A;  1ZGW A;  4KIF A;  4EJT A;  2EFW A;  1EH7 A;  3P9I A;  3S8P A;  1Z1D A;  3GCM A;  1U78 A;  2BEO A;  2HPI A;  3M8E A;  2RNG A;  2EV5 A;  2EQR A;  3HTA A;  2H94 A;  1XMX A;  1ZQ3 P;  3WU2 C;  2FXA A;  1R23 A;  4RA2 A;  1WGX A;  2IT0 A;  3DKX A;  1IRX A;  4KIG A;  1MH4 A;  4NC6 A;  3MD2 A;  4XKV A;  2XGC A;  3VW0 A;  2M0C A;  3K4C A;  3JAM Z;  3JRC A;  2HOE A;  3K4B A;  3K69 A;  4F3Q A;  1RES A;  3CC2 I;  3MKL A;  3GZN B;  1ZRC A;  3WTU C;  2KJB A;  5J3L A;  2WWY A;  4KYW A;  2CUF A;  2VC1 A;  3JRA A;  2OPT A;  5LEK A;  2XAS A;  3T8T A;  5C4Y A;  2IA1 A;  2DPD A;  4KIB A;  3J7A Y;  2QOP A;  4YG2 F;  1MND A;  2XAJ A;  1JKP C;  3CF2 A;  4XRM A;  2R93 J;  2K3P A;  1DU0 A;  1SAN A;  3ZQH A;  1XB4 A;  5EEA A;  3E3V A;  2E34 A;  3BNI A;  3SXY A;  1FBS A;  1ETV A;  1LKX A;  2BW3 B;  2H1L A;  4S05 A;  3DEW A;  1WH5 A;  5EF6 A;  1IDY A;  4G6D A;  1X1C A;  1KQ9 A;  1N78 A;  1YW8 A;  3V7C A;  1USS A;  2DOD A;  2W53 A;  1X1P A;  2HXO A;  2L54 A;  1Z67 A;  2WTE A;  3V42 A;  3A02 A;  3BPV A;  4U0V A;  1G4D A;  2DOE A;  4II2 A;  2YVX A;  3TOA A;  1BI0 A;  4GFL A;  4AM3 A;  5FJ8 J;  2K85 A;  5HOO A;  3PNY A;  2NAZ A;  1S7A A;  4NN1 A;  1PJR A;  2EH3 A;  1MMG A;  3VWB A;  1HW1 A;  4GCL A;  4YFK F;  4OIR F;  3CCV I;  4ABZ A;  4S04 A;  3HOW J;  2CYY A;  3TO6 A;  3CCE I;  4E7H A;  4BS9 A;  3JTH A;  2E2J J;  1EJ9 A;  4DNC A;  2CWE A;  2ZCN A;  3RQI A;  2F4O B;  3CWR A;  3CCL I;  3S16 J;  2F07 A;  2RAS A;  4MHG A;  4HOB A;  4ESF A;  1IXC A;  1ON1 A;  2DMU A;  4WX9 A;  3OYF A;  3G7R A;  4CYC B;  3ABM H;  1W4M A;  4A3I J;  3SFI A;  1JGS A;  4HKU A;  2IS1 A;  2LY9 A;  2O8X A;  2E1M B;  4XON A;  3I55 I;  3BR0 A;  2BVL A;  1SVL A;  1Y8Q B;  3I9V 2;  2IGN A;  4LLL A;  1JKR C;  2IA2 A;  1MSF C;  1D1A A;  2FEZ A;  2STT A;  2JA6 J;  5D4R A;  4RB1 A;  1JUM A;  4UNO A;  2H8R A;  1K61 A;  1IRZ A;  1YLF A;  3D1N I;  1B72 B;  2DOF A;  4BBR J;  2A68 F;  3JRH A;  2P7V B;  2AS5 F;  3LMM A;  3RSN A;  1QRY A;  2HQN A;  3ECH A;  3OOU A;  2ELH A;  2BY1 A;  2EZL A;  1Y1V J;  2R7F A;  3K1M A;  1X3W B;  5CXI A;  2R4G A;  2HDW A;  2JVG A;  1TW3 A;  3BDD A;  4I02 A;  2JMW A;  3VTI A;  4N9I A;  4L18 B;  5D5X B;  3OYH A;  2Y31 A;  1WCM J;  3PNV A;  4IX7 A;  1QU3 A;  5JI6 A;  1MMS A;  2VKD A;  2XPU A;  3ABT A;  4JOM A;  3ROU A;  2DO7 A;  2FOW A;  1UZC A;  4EEF G;  1D1C A;  1GXP A;  3PUB A;  1PYV A;  3GVA A;  3K9T A;  3HGG A;  2PJR B;  4KMF A;  3E0J B;  3RYP A;  2LH9 A;  3HKZ N;  5JLX A;  4KT6 A;  3WGH A;  4RAF A;  5KVR A;  1JTY A;  3K1N A;  3OS2 A;  2VAS A;  1ZRE A;  3ANP A;  5L3G A;  4EAT A;  2FU4 A;  3FZV A;  1QVU A;  4A0Z A;  3E1S A;  3FXM A;  3M4O J;  3RIR A;  3TP3 A;  1FMV A;  2EIJ H;  5HLG A;  4MIM A;  3HPG A;  2ZXI A;  1SD7 A;  4CCO A;  4UUS B;  1F5T A;  2JUC A;  4XID A;  4GXO A;  2Q8K A; 
#chains in the Genus database with same CATH homology
 4JX6 A;  1HCR A;  2RAE A;  3QBM A;  4IHY A;  1A6I A;  1X2M A;  1JT0 A;  2JA5 J;  3CRJ A;  3TW7 A;  2JN6 A;  2NS8 A;  2VI6 A;  3OIO A;  2XPV A;  3KNW A;  4IHX A;  2HQ5 A;  2Y0S N;  3BQY A;  4AUX A;  1IJW C;  3EUP A;  3GTP J;  2CQX A;  3BT9 A;  3MN2 A;  5GP9 A;  3LOC A;  3HIM A;  4B1R A;  4M6V A;  2KDZ A;  4QIW N;  1W0T A;  5IPA A;  4MFE A;  2D5V A;  1UMQ A;  2E19 A;  1HDD C;  2MW8 A;  3Q0V A;  1Z0X A;  4JP0 A;  1RR7 A;  2GUH A;  4CGR A;  5F1J A;  5C4J J;  1IDZ A;  2CQQ A;  1ETQ A;  3KKC A;  1XC5 A;  2QCO A;  3WHC A;  5DTD A;  2HXI A;  2NP5 A;  1F36 A;  2XB0 X;  2D6Y A;  2L7Z A;  5CW8 A;  1GDT A;  3FIW A;  1Q1V A;  3BG3 A;  4W1U A;  5EG0 B;  5D19 A;  4JYK A;  2XGD A;  2CJJ A;  1JJ6 C;  3F1B A;  1A5J A;  3B6C A;  2ID3 A;  3NNR A;  2LFB A;  4D7N A;  5E3N A;  2QKO A;  3LWJ A;  1D5Y A;  5EG0 A;  3HTH A;  3S15 J;  4GCK A;  3LSG A;  2VKV A;  2X6O A;  1F43 A;  2DMN A;  4NDL A;  2UXH A;  3JRF A;  1H89 C;  1BA5 A;  2RHA A;  1I50 J;  5C3E J;  4MK6 A;  1GUU A;  1TWH J;  3G56 A;  1Z77 A;  1PUF A;  3JRB A;  2K40 A;  3NRG A;  3VOK A;  2GBY A;  3ANG A;  3WHB A;  2ID6 A;  3BTI A;  5J1R A;  3CDL A;  4DYC A;  1B72 A;  4XIC A;  1AKH A;  1YRN A;  2TRT A;  3PO3 J;  2OI8 A;  1FTT A;  3ZQL A;  3JSJ A;  4M3F A;  3RKQ A;  5CXG A;  3BTJ A;  4Y7N J;  1ZTR A;  5BNG A;  2UXO A;  3ON2 A;  4C3H J;  2LTP A;  2Y9Z A;  1BW6 A;  3O60 A;  5HBU A;  3BG5 A;  3ZQG A;  1S7E A;  2ZOY A;  4GFK A;  5IYB J;  1JUP A;  2R92 J;  2DJN A;  5F0H A;  1GT0 C;  5FMP A;  3G1O A;  5IOY A;  4ACI A;  4XRS G;  5EDN A;  3BJB A;  5AQC A;  1ZKG A;  1OFC X;  2DTZ A;  4M3D A;  2UXI A;  1RKW A;  2DA2 A;  1LE8 A;  3PPB A;  1I6H J;  2FJ1 A;  1FIP A;  5IYD J;  2L7F P;  1QPI A;  1MBF A;  1VI0 A;  3NPI A;  3VUQ A;  3LJL A;  3DPJ A;  2WAQ N;  2DG7 A;  4HNV A;  5C4X J;  3TED A;  5EYR A;  2K9S A;  3BCG A;  5FGL A;  3IV5 A;  2I10 A;  3UKG A;  4D7M A;  2DN0 A;  2HDD A;  3IH4 A;  4B3A A;  1BJZ A;  2DMQ A;  3QQA A;  2JA7 J;  5EZH A;  2L7M P;  1MBJ A;  2DA4 A;  2G7S A;  3QPL A;  1RPW A;  2HYT A;  1FTZ A;  4A3C J;  3HOU J;  4FE7 A;  3PM1 A;  2Y9Y A;  1LFU P;  2MGQ A;  5EGO B;  3GZI A;  2QTQ A;  5M5Y J;  1R9T J;  1HF0 A;  5HSZ A;  4Y52 J;  3VOX A;  3BHQ A;  3RH2 A;  2MSY A;  4I76 A;  2VUM J;  2LLK A;  1ENH A;  2DA7 A;  4YZE A;  3MNL A;  4JX5 A;  1K83 J;  1MH3 A;  4CYC A;  2R5Y B;  1B8I B;  3S5R A;  5EGO A;  1XS9 A;  3Q3S A;  5IOZ A;  2JJ7 A;  3KKD A;  1UI5 A;  3HOZ J;  1SFO J;  1VFC A;  2KT0 A;  3A03 A;  1FIA A;  3C2B A;  1VF9 A;  1POG A;  1FJL A;  4KWA A;  1Y1W J;  5EZG A;  2AO9 A;  5FLM J;  4NEL A;  4ME9 A;  2FX0 A;  2X48 A;  3GTJ J;  2R7Z J;  3VVZ A;  2YU9 J;  1B8I A;  2NVQ J;  2CU7 A;  1E3O C;  2OER A;  4C3I J;  3IH2 A;  4BXX J;  4I6Z A;  5M5X J;  2YUS A;  3RZO J;  5D1R A;  3LSP A;  2DA5 A;  5F08 A;  1QVT A;  2UXU A;  1BW5 A;  5F04 A;  4AC0 A;  3H0G J;  4RDU A;  3S14 J;  2ZOZ A;  2G0E A;  2VPR A;  5F27 A;  3NAR A;  1NK3 P;  1TC3 C;  3S17 J;  1T33 A;  4C3J J;  3PAS A;  3BRU A;  4D5C A;  4FCY A;  1ETO A;  3EGQ A;  2EBI A;  2R5Z B;  1IC8 A;  3L1P A;  3HE0 A;  1HOM A;  4A3K J;  2NVX J;  1JJ8 C;  3BR1 A;  3BR5 A;  1PUF B;  4M3E A;  5C44 J;  3T6N A;  4ICH A;  3O8G A;  1RKT A;  2Q24 A;  5K58 A;  1HLV A;  2H1K A;  2ECC A;  4D5F A;  2PMZ N;  2E2I J;  4DZJ A;  2XRL A;  1TWA J;  1AU7 A;  3JRE A;  5K7Z A;  1AKH B;  1YRN B;  3GBG A;  2DG8 A;  3GTK J;  4AYB N;  1LFB A;  3FRQ A;  2O9L A;  9ANT A;  4DW6 A;  2LD5 A;  3F0C A;  1XG1 A;  1IG7 A;  1GV5 A;  3I4M J;  3FK6 A;  3S1Q J;  2G3B A;  3VP5 A;  1UG2 A;  1MBH A;  3B6A A;  2FBQ A;  3CJD A;  2GEN A;  4S0H B;  1ETK A;  1MNM C;  2NX4 A;  2JA8 J;  2ME0 A;  3NXC A;  4JKZ A;  5FHP A;  1MSE C;  3FIS A;  4RBO A;  3GTO J;  3BG9 A;  1JTX A;  2P81 A;  2DA6 A;  1TWC J;  2Y2Z A;  3P9T A;  2G7L A;  1MBK A;  1EF4 A;  5K7H A;  3H3V K;  5FKN A;  5EFY A;  3AQT A;  5HOD A;  2DMP A;  2YS9 A;  3ZQI A;  5M5W J;  3JRG A;  3DCF A;  2PBX A;  3HOV J;  5FKK A;  2LVS A;  3G1L A;  1WI3 A;  4FE4 A;  2O7O A;  3HOY J;  2HOA A;  1SGM A;  4GCT A;  3CCY A;  1ORK A;  3K2A A;  2XGE A;  2HOS A;  3A01 B;  2E1O A;  2MG4 A;  3W6V A;  2EZI A;  5F0F A;  3BTL A;  5J1Y A;  4C2M J;  2L9R A;  3V78 A;  3C07 A;  2IEK A;  1T56 A;  2DMT A;  3E7Q A;  2TCT A;  1JKQ C;  3HEF A;  4XRS A;  4BBS J;  3GEU A;  4UUT A;  1P7I A;  3JR9 A;  3O8H A;  2FD5 A;  4MXM A;  4FIS A;  1NK2 P;  5M3F J;  4W97 A;  1IV6 A;  3HB9 A;  4M3B A;  4G12 A;  2GFN A;  2G7G A;  2UXP A;  3FK7 A;  1RET A;  2X9D A;  4DZP A;  4JL3 A;  3ZQF A;  2NP3 A;  3HTI A;  2CRG A;  3COL A;  5D18 A;  3BR2 A;  1GV2 A;  5F0C A;  3VW2 A;  2WV1 A;  1UI6 A;  2V57 A;  4A3F J;  4XK4 A;  4L5E A;  4BY7 J;  3PO2 J;  4GFB A;  2E2H J;  3E7L A;  3JRD A;  1MBE A;  3VVX A;  2XDN A;  5JLW A;  1HDP A;  3HBL A;  5M3M J;  3TW6 A;  3HTJ A;  1IGN A;  1ZGW A;  1OJL A;  4JX4 A;  1I3Q J;  1U78 A;  2ZCX A;  5E3L A;  2GM4 A;  2DA3 A;  2EQR A;  3HTA A;  3I4N J;  5DS9 A;  1ZQ3 P;  2W48 A;  1WGX A;  4QTR A;  2FQ4 A;  2HOT A;  2NVT J;  4IHW A;  2HI3 A;  1JKO C;  2LR8 A;  1P7J A;  2NS7 A;  1MH4 A;  3V6G A;  2XGC A;  5IP6 A;  2M0C A;  3JRC A;  3VW0 A;  2XSD C;  1RES A;  2R0Q C;  3MKL A;  2ME6 A;  3S1N J;  2IU5 A;  2ECB A;  5J3L A;  5HAW A;  2CUF A;  3JRA A;  2OPT A;  2K9Q A;  1WH7 A;  2LP0 A;  5FLV A;  2WGB A;  1O4X A;  5C4Y A;  2K9N A;  2L0K A;  2QOP A;  3NI7 A;  3SJM A;  2LKX A;  4AC6 A;  3VIB A;  3GTM J;  1JKP C;  3CQZ J;  4M3G A;  4XRM A;  2ELK A;  2R93 J;  1NTC A;  3Q0U A;  4UUS A;  1DU0 A;  1SAN A;  3ZQH A;  3M3Y J;  2PZ9 A;  5EEA A;  3TP0 A;  4A93 J;  3HM5 A;  4MFD A;  2GLO A;  4A3B J;  1AHD P;  4IHV A;  3BNI A;  3S2D J;  4A3G J;  1ETV A;  3AQS A;  3FKI J;  3DEW A;  2EZK A;  2NOG A;  1WH5 A;  2IAI A;  5EF6 A;  1IDY A;  4DYR A;  5E3M A;  3OSF A;  2W53 A;  1ETW A;  2QWT A;  1OCP A;  2HXO A;  2LK2 A;  3ZQC A;  3B81 A;  5J1U A;  3RZD J;  5IP9 J;  4PXI A;  3A02 A;  2EZH A;  2COB A;  1H8A C;  1JUS A;  2XB5 A;  1WPK A;  3LSR A;  1BL0 A;  4GFL A;  1DU6 A;  5FJ8 J;  3KZ9 A;  3G1M A;  5H9T A;  2OF7 A;  3BR3 A;  2ZCM A;  4NN1 A;  1GVD A;  2JWT A;  2EH3 A;  2M8G X;  4GCL A;  5DAJ A;  4ABZ A;  4A3D J;  3HOW J;  2N8G A;  3OSG A;  2E2J J;  1TWG J;  2QIB A;  3LHQ A;  3A01 A;  2ZCN A;  4QSH A;  3RQI A;  1CQT A;  3BQZ A;  3CWR A;  5FKO A;  3S16 J;  2F07 A;  2RAS A;  2DMU A;  2ZB9 A;  4FTH A;  1U9O A;  3G7R A;  4UDS A;  3S1M J;  3VPR A;  4CYC B;  2R5Y A;  3HDD A;  3HGY A;  3GTQ J;  4A3I J;  3VW1 A;  3SFI A;  1ZR4 A;  4IEJ A;  3LNQ A;  4HKU A;  2LY9 A;  3IH3 A;  1X58 A;  3NAU A;  4AF5 A;  2WUI A;  4A3E J;  3BR0 A;  3VVY A;  2WB1 N;  3LSJ A;  2HYJ A;  4J19 A;  2CUE A;  2XPW A;  1JKR C;  1MSF C;  5FKM A;  5GPA A;  2JA6 J;  5E3O A;  4LOC A;  1JUM A;  4V2F A;  3IUV A;  1TWF J;  3BR6 A;  2H8R A;  1K61 A;  2B63 J;  3RD3 A;  5IYC J;  1APL C;  1IRZ A;  3D1N I;  1B72 B;  4X6A J;  3GTL J;  1VND A;  4BBR J;  3JRH A;  2R5Z A;  3ON4 A;  4V2G A;  1QRY A;  3OOU A;  4JNN A;  1IUF A;  3QKX A;  2REK A;  5K7F A;  2O7T A;  2EZL A;  1Y1V J;  2IBD A;  3SDG A;  4DYQ A;  1UHS A;  2YVH A;  1MBG A;  3S2H J;  1ITY A;  1H88 C;  5CXI A;  4B4C A;  3ZOB A;  4L62 A;  1ZK8 A;  2Y30 A;  2JMW A;  5FKL A;  2AHQ A;  1FEX A;  3K7A J;  2O8K A;  2NVY J;  4X1E A;  2Y31 A;  2M9H A;  1WCM J;  2QF7 A;  3Q0W A;  3HOX J;  1JGG A;  1JT6 A;  2XPU A;  4EEF G;  2VKE A;  3S1R J;  1LE8 B;  1G2H A;  2YVE A;  1X2N A;  2M2E A;  4MLO A;  1ETY A;  2HKU A;  2JK3 A;  5GPC A;  3HGG A;  4A3M J;  3QPS A;  4BY1 J;  1U9N A;  3HKZ N;  5JLX A;  3MVP A;  5IP7 J;  4A3J J;  1JTY A;  1OCT C;  4BKX A;  3ANP A;  2M34 A;  1QVU A;  3JRI A;  4A3L J;  4MO7 A;  4A69 C;  3M4O J;  3CMY A;  3TP3 A;  2DA1 A;  3GTG J;  4MIM A;  1ETX A;  4UUS B;  1W0U A;  1ZR2 A;  1U8B A;  4XID A;  3BTC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...