2HYJA

The crystal structure of a tetr-family transcriptional regulator from streptomyces coelicolor
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
193
structure length
193
Chain Sequence
AEAQATRGRILGRAAEIASEEGLDGITIGRLAEELEMSKSGVHKHFGTKETLQISTLDKAFVDFWHRVVEPALAEPPGLRRLRAVCANSVGYLEEPLLPGGCLLTAALSEYDGRPGRVRDAVAEVWSRWREQLRADLTAAVDKGELPAGFDVEQALFEIVAAGLALNAAMQLQHDRTAADRARRAIERALAQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative tetR-family transcriptional regulator
publication title The crystal structure of a tetR-family transcriptional regulator from Streptomyces coelicolor
rcsb
source organism Streptomyces coelicolor
molecule tags Transcription
total genus 81
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 2006-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2hyjA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2hyjA02
1XG1A 5C4JJ 4C3HJ 4XRSA 3GTPJ 3BR6A 2UXPA 3TW6A 5J1YA 3PPBA 4M6VA 1BW5A 5F27A 1AU7A 1IG7A 2FJ1A 3S16J 3HEFA 3OSFA 1JUSA 2TCTA 2YS9A 1B72B 1TWHJ 4X1EA 3HIMA 2CUFA 2Y31A 4M3GA 4QIWN 4MLOA 2E1OA 5EG0B 2JMWA 3FRQA 2EH3A 3JRHA 1HLVA 3S17J 2ME6A 5C4YA 5HSZA 3HKZN 3CQZJ 1RR7A 2MGQA 4CGRA 1PUFA 1NK3P 2D5VA 1HDDC 2DG7A 5FKOA 1A6IA 3KNWA 4JYKA 1MBEA 3S15J 5F0CA 1X58A 4A3CJ 3JRIA 2DA6A 3Q0WA 2R93J 1YRNB 2XB0X 5EFYA 5GP9A 2QTQA 3HBLA 3BCGA 1Y1VJ 3A02A 3W6VA 5J3LA 1SFOJ 3RZOJ 2R5YA 2E2IJ 5FKKA 3HOYJ 1AKHA 1ENHA 1MBFA 3E7LA 4JX4A 3EGQA 1Z77A 3BJBA 5EGOA 1F36A 4GCTA 5DTDA 2AHQA 3VOXA 1MBHA 4QSHA 4JX5A 2GENA 5HAWA 2L0KA 3JRDA 2ZCXA 3NI7A 3HTIA 2E19A 3QPLA 4J19A 3IH2A 2G7LA 4FISA 2JJ7A 1ZR4A 4M3DA 4S0HB 4JL3A 2DA7A 2LVSA 2NS8A 2CU7A 5IP9J 4ABZA 2R7ZJ 1GV5A 1IDYA 3BR2A 5EYRA 1BA5A 4DYCA 1ETOA 2DA4A 3TEDA 3LJLA 1ETVA 1JKPC 3G56A 3QKXA 2M0CA 4XICA 1HDPA 3BR5A 1BJZA 4MO7A 4V2GA 2HI3A 2HQ5A 3FK7A 5FKMA 4A3IJ 3WHCA 1ITYA 4M3FA 2IEKA 1U8BA 2DMTA 4EEFG 4NELA 2XB5A 2HYJA 5AQCA 2Y9ZA 5IP7J 1POGA 2YVEA 1RESA 1K83J 4BBRJ 5JLXA 5FGLA 3S2DJ 3QBMA 1JKQC 1HF0A 2X48A 3JRFA 1APLC 2GFNA 1H88C 1QVTA 2LLKA 2XSDC 4XIDA 1K61A 2QF7A 3C07A 1JTYA 2IAIA 1NTCA 1TWCJ 2COBA 3NNRA 3HOUJ 1JJ6C 2DN0A 1U9OA 2LY9A 4NDLA 2K9NA 3KKCA 3HOZJ 2GLOA 2G0EA 2V57A 4XRMA 1UHSA 4D5CA 2WV1A 1JKOC 2NVTJ 1EF4A 1T33A 4V2FA 2GM4A 3G1MA 4IHVA 4I76A 3B6AA 3HTAA 5FLMJ 3HOWJ 2H1KA 5K7HA 1PUFB 4GFKA 2JA5J 3NARA 2P81A 1GUUA 4MIMA 3JRAA 2VUMJ 2IU5A 1MSEC 3FK6A 1NK2P 3NAUA 3GTQJ 2K40A 1LE8A 2ID3A 2OF7A 2HOTA 3MKLA 2JA6J 3GEUA 2GBYA 3I4MJ 3VW1A 4A69C 4IHXA 3GTOJ 2ZOYA 1JUMA 2EZIA 4FCYA 3CDLA 3K2AA 2HDDA 1FTZA 3ZQFA 2R5YB 2OI8A 1LFBA 2CJJA 4XK4A 2X6OA 4ACIA 1B8IB 4IEJA 1OCTC 1I3QJ 5DS9A 3O60A 5HBUA 3Q0UA 1ZGWA 4AF5A 5IPAA 1E3OC 3ON4A 4UUTA 5IOYA 2WB1N 4GFLA 3CJDA 4A3JJ 1MSFC 3HTHA 2YUSA 4W1UA 3V78A 3S5RA 2HOAA 4BBSJ 1MBGA 1U9NA 1JT6A 3F0CA 3JR9A 3LNQA 3SJMA 1UMQA 4DZJA 5F1JA 2MSYA 4ME9A 2G7SA 5C3EJ 4BXXJ 1QVUA 5BNGA 3TW7A 3AQSA 4GCLA 3GTMJ 2Y30A 3GZIA 4D7NA 2CUEA 1SGMA 2PZ9A 1FJLA 2UXHA 1ETXA 5DAJA 4B1RA 4CYCB 1ETKA 1ZR2A 3KZ9A 5E3LA 5EEAA 4A3FJ 2HYTA 5F04A 5CXIA 3BQYA 2W48A 3K7AJ 4MFDA 2GUHA 1ZQ3P 2NP3A 3G7RA 4Y52J 1OCPA 1P7JA 3BG9A 3A01A 4A3KJ 5FJ8J 2LTPA 2XPWA 3PO2J 3AQTA 1P7IA 2M2EA 3LOCA 3ZOBA 3ZQGA 3VP5A 2R5ZA 1AHDP 2O7OA 1ORKA 5M5WJ 1WGXA 2NVYJ 3LSGA 1MH4A 3S14J 5JLWA 3HB9A 5M5XJ 3S1NJ 1R9TJ 2R92J 5M3MJ 1XS9A 1BL0A 2EQRA 2HKUA 3VW0A 3G1LA 3Q3SA 2NVXJ 2O9LA 2L7ZA 1X2NA 5E3OA 2ELKA 1IJWC 3VW2A 2L7FP 1ZKGA 4X6AJ 2K9SA 1ETQA 4MXMA 1I50J 2HOSA 2WAQN 2FQ4A 2L7MP 4B3AA 4D5FA 4RDUA 1W0TA 3VVZA 3B81A 3DPJA 5FHPA 2W53A 2LKXA 2XRLA 3E7QA 2RHAA 3RQIA 2DG8A 9ANTA 3HGYA 1WCMJ 1JKRC 3IH3A 3VPRA 5D1RA 2DMNA 2ZOZA 1GDTA 4GCKA 1VF9A 1QRYA 2RASA 1B72A 1IRZA 4FE4A 1ETWA 3O8GA 5EG0A 5EZHA 3GTGJ 3IV5A 2NS7A 4D7MA 2KDZA 2DA1A 1F43A 3RH2A 4A3LJ 3DEWA 4UUSA 2Y0SN 4PXIA 3B6CA 5EDNA 5E3NA 2M8GX 2TRTA 2WGBA 5IP6A 4JKZA 4M3EA 1YRNA 2NX4A 1VI0A 3PO3J 2XDNA 5FMPA 1D5YA 3NPIA 2DJNA 2HXIA 1MBJA 5IYDJ 3KKDA 3ZQIA 3OIOA 2PBXA 2O7TA 4B4CA 3DCFA 5IOZA 3ANGA 1RKTA 5K7FA 4RBOA 3FIWA 3OSGA 2E2JJ 1JUPA 2EBIA 3CCYA 3BTLA 4IHYA 1RKWA 3VUQA 2NVQJ 2M9HA 3FISA 4A3BJ 3ON2A 2ECBA 3BR1A 4A3GJ 1ZK8A 3IUVA 2LFBA 3A01B 3BTJA 3A03A 2LR8A 2CRGA 4Y7NJ 2O8KA 1UI6A 3Q0VA 2G7GA 3OOUA 3JRBA 1TWGJ 1AKHB 4YZEA 5J1UA 3GBGA 3JSJA 5EGOB 2R5ZB 3PASA 2H8RA 1UG2A 1VFCA 3HGGA 4DYRA 2AO9A 2OPTA 3CWRA 2L9RA 2MW8A 4MK6A 3G1OA 3HTJA 1H8AC 1UI5A 1BW6A 5FKNA 5HODA 1RETA 2FX0A 2XGCA 2D6YA 3IH4A 4BY1J 1A5JA 2QKOA 5E3MA 2DMPA 2UXOA 2NP5A 3GTKJ 2ZCNA 1OJLA 1IC8A 4A3EJ 3S1QJ 2QOPA 3VOKA 2M34A 2K9QA 3LHQA 1G2HA 4KWAA 2JWTA 5K7ZA 3HOVJ 5GPAA 2OERA 1W0UA 4BKXA 4LOCA 2DA2A 3BT9A 3S1RJ 4AYBN 1IV6A 4JNNA 1OFCX 4I6ZA 3RZDJ 5F0FA 5D19A 3BG5A 4C3IJ 4XRSG 1GV2A 2FD5A 3VVXA 3JRGA 3ZQHA 3VIBA 2IBDA 2MG4A 1JGGA 1IUFA 2NOGA 1WI3A 1JTXA 2ZCMA 1Y1WJ 2YU9J 3CMYA 1FIAA 4M3BA 3BNIA 5IYBJ 4HNVA 2G3BA 4NN1A 1T56A 4UUSB 1MNMC 3BR3A 1ZTRA 4L5EA 1DU0A 3ZQCA 1JJ8C 1RPWA 1MBKA 5F08A 2JA8J 2PMZN 5EF6A 5F0HA 3GTJJ 3QPSA 4BY7J 1JT0A 4FTHA 3BHQA 3RD3A 3T6NA 4MFEA 1Q1VA 2ZB9A 5M5YJ 1FTTA 4IHWA 5CXGA 5CW8A 2XGEA 2N8GA 2EZLA 2LK2A 3HE0A 1B8IA 3SFIA 1TWAJ 3HOXJ 3BQZA 3LSPA 5IYCJ 3JREA 1GVDA 3BR0A 1LE8B 4A93J 3BTCA 4G12A 3H3VK 2VI6A 3V6GA 4JP0A 2EZKA 2RAEA 2ECCA 5J1RA 3LSJA 3QQAA 4ICHA 4HKUA 3I4NJ 2EZHA 4GFBA 2R0QC 1I6HJ 3EUPA 3TP0A 3P9TA 4DW6A 1HCRA 1WH5A 2DTZA 2FBQA 3H0GJ 1X2MA 4FE7A 3NRGA 3WHBA 5EZGA 2VKVA 1TC3C 4A3DJ 5H9TA 3TP3A 4AUXA 2UXIA 2YVHA 1O4XA 2CQQA 2VPRA 4CYCA 5C44J 3F1BA 2VKEA 2XGDA 3M4OJ 3FKIJ 4UDSA 3O8HA 1H89C 4DZPA 4W97A 1WH7A 1IDZA 3GTLJ 1LFUP 3LWJA 1GT0C 1WPKA 3PM1A 3MNLA 4AC0A 2Y9YA 3MVPA 2ME0A 3BG3A 4DYQA 1DU6A 1XC5A 1TWFJ 3HM5A 1U78A 2LD5A 2DA3A 2F07A 2DMUA 2B63J 2QIBA 2E2HJ 3CRJA 2KT0A 3ANPA 3NXCA 2HXOA 1CQTA 3LSRA 4C3JJ 2JN6A 1FIPA 3M3YJ 5FKLA 1HOMA 3S1MJ 2REKA 2Q24A 3UKGA 5K58A 3MN2A 2Y2ZA 3ZQLA 3S2HJ 2JA7J 5FLVA 2WUIA 4AC6A 2XPVA 4A3MJ 3BRUA 1S7EA 1Z0XA 2DMQA 3RKQA 2QWTA 3VVYA 2CQXA 4QTRA 1MH3A 3D1NI 1ETYA 1SANA 2ID6A 2QCOA 1VNDA 3SDGA 1QPIA 5C4XJ 1FEXA 1IGNA 2X9DA 3HDDA 2XPUA 4L62A 3JRCA 2DA5A 2UXUA 3L1PA 2I10A 2JK3A 5M3FJ 3C2BA 3BTIA 5GPCA 4C2MJ 4JX6A 2LP0A 3COLA 5D18A
chains in the Genus database with same CATH superfamily
1FYMA 4BGDA 4C3HJ 4E7SA 4RB2C 2IGMA 4XRSA 1D1AA 1R4MB 4IF4A 3BR6A 5B1AH 3PPBA 5F27A 3HEFA 3OSFA 1QHHD 4IRGA 5FLXZ 2DYSH 1B72B 2CUFA 5AIPA 4MLOA 2DK8A 2EH3A 3S17J 5DYMA 1LKXA 2E71A 3FM5A 1HDDC 2V9KA 2DG7A 3K9TA 5J4YA 5FKOA 3JTHA 4IOCF 3KNWA 1P4WA 2A61A 4L9JA 1WJAA 4A3CJ 2DA6A 2ZJRF 2R93J 2UZKA 3N97A 4CH7A 4CCOA 2PJRA 1TQMA 3A02A 3DPLC 1X3UA 2EV0A 4LLGF 1PVEA 3PSIA 5HDNA 2YPRA 1DP7P 5FKKA 4L0YB 1OISA 1MBFA 4JX4A 3BJBA 4GCTA 2LY1A 4OIRF 4QSHA 2GENA 5HAWA 3KYLA 2H09A 3BJAA 3T8RA 2DODA 1VQ8I 3HTIA 2HS5A 5J4VA 3QPLA 1R71A 3WTXC 2D2WA 5IP9J 1TTYA 2K3FA 4BHCA 3KX2A 1KU3A 4GRIA 2DA4A 4F93B 3LJLA 5HDGA 2EWNA 2H6BA 1LFPA 2V6CA 3G56A 4XSZF 3PIOF 2ZNZA 3ZQ7A 4XICA 1ACIA 1D0ZA 4Q5SF 1ERDA 3IRRA 4A3IJ 3WHCA 1J0RA 3ECHA 1WJEA 3FWEA 2KISA 1U8BA 1FSHA 1YO5C 1S7AA 2JSPA 3K4BA 1E17A 1K83J 1RESA 5ILSA 3IWFA 1LNWA 1IXCA 1XMAA 5DUIA 3J7AY 2X48A 3R0AA 3VYSB 2HVQA 1VQKI 1APLC 2OA4A 3SWHA 2XSDC 4XIDA 3C07A 4KIBA 2IAIA 2W84A 1ZYRF 2R7VA 2COBA 4YFNF 4RB0A 3I59B 4LK0F 3CO7C 4B09A 5D5XB 2GLOA 5FRNA 5BS6A 2EA2A 3GLLA 1UHSA 2WV1A 3QODA 1T33A 2ADUA 3N4MA 3Q9SA 1TNSA 3MAJA 4YFXF 4I76A 2E1MC 2K86A 3HOWJ 3H9QA 5GAEJ 3NARA 1GUUA 3JRAA 3ZPLA 2VUMJ 1NK2P 4ESJA 2HVSA 1B6AA 3PNVA 2CS3A 1XGMA 4M6XA 2H8WA 5H2FC 1PP7U 2JA6J 3FXKA 1SAUA 3I4MJ 3VW1A 1NHAA 4B43A 2ZOYA 3BC8A 3MD2A 2HDDA 1FTZA 3CC7I 1Z7UA 2R5YB 1KYWA 3EDPA 3H5NA 5TRDA 1L3LA 3WTYC 2Y48A 2RC4A 4AVPA 2L4MA 3O60A 5HBUA 1V54H 2VJIA 5IPAA 4RS8A 4UUTA 4C30A 4GFLA 3CJDA 3SXYA 3J80K 3KP2A 3CD6I 2LC2A 1XB4A 2HOAA 2P0WA 3GUDA 4BBSJ 3ASOH 1C0WA 1WWXA 4CYDA 3ABTA 2XV4S 3SJMA 2JUGA 1UMQA 1HC8A 2QVOA 2QYOA 3BZCA 1WSUA 2WAQA 1Z1DA 1J7KA 4YIRX 1MJAA 1LPQA 2Y30A 3LA2A 1BIAA 3HRTA 2KQRA 5DAJA 1ETKA 4WWCA 1W5CC 4P9FA 5E3LA 1D5VA 1FYKA 1KGSA 1MNEA 3LMMA 2Z1DA 3QOPA 1OCPA 3REOA 3PFYA 4ZZDA 3A01A 4A3KJ 4PUSA 4EJVA 2QSHX 2XPWA 1BM9A 1QQIA 2JZYA 2WTEA 3RPUA 5JVGF 1P7IA 1MMDA 3VP5A 2PQ8A 1ORKA 3TOBA 2NVYJ 1MH4A 2VQGA 2LBFA 4A12A 2ZJPF 3DKXA 5JLWA 5ILVA 2WY8Q 5M5XJ 5EJCA 2B7EA 3FZVA 2EV5A 2DLLA 5M3MJ 1LEAA 4HF2A 2EQRA 2M30A 2M4KA 1RNLA 2VB6A 3VW0A 2DFHA 1LVAA 4RB3C 4ZYAA 3SHFA 1R1VA 1R49A 3MQ0A 5E3OA 2EPFA 1IJWC 2GWRA 1PP8F 2WV0A 2K9SA 4MXMA 2R7FA 2E5NA 3IAS2 4RB1A 2PG4A 2WY7Q 1W0TA 4O3MA 2A3SA 2V1XA 2FU4A 4LG0B 2CO5A 3T0YA 3B81A 2XASA 5ED4A 2V6EA 4LB5A 2LKXA 2W53A 3P7NA 4QPOA 2A5YB 5CVUA 2DFIA 2L9NA 3IH3A 3VPRA 5GADJ 1SD4A 1W5SA 2V79A 1VF9A 1SD7A 2FMYA 3KE2A 2Z2SB 4Q48A 1HKQA 3L2QA 3O8GA 1FOKA 4ESFA 4I01A 2KZVA 3IV5A 3PJRA 3GTGJ 1ZN2A 1OPCA 3FHNA 5HNFA 4A3LJ 2EILH 4ENJA 2R7QA 2V26A 3B6CA 5E3NA 4BHPA 1AA7A 5FMPA 2XDNA 5HVQC 1V3FA 2HWVA 1LQ1A 4PSWA 2DTRA 1FC3A 1R1UA 3TO9A 3HL2A 2HPMA 5D5VB 1G3SA 3NPIA 2PBXA 4E7JA 1OYWA 1Y56A 3QPHA 1RKTA 1D1BA 1HW2A 2VJJA 2EBIA 4IHYA 2M87A 1FBSA 4KN4X 1CGPA 1KQ0A 2J5OA 2LH9A 3BR1A 3I53A 5D8KB 3IUVA 2HZTA 5E1ZB 4HX8A 4E4HA 3SDBA 3HRUA 3FHZA 3A03A 3N05A 2LR8A 3LSKA 2CYYA 2G7GA 3OOUA 2EFPA 4OOIA 4UV9A 2MBFA 1AKHB 4YZEA 1WJDA 5J1UA 2VBWA 3LSHA 3G71I 5EGOB 5KCMA 2R5ZB 4BQAA 4DQ2A 3MZHA 1R5GA 3BJOA 3CMMA 4M72A 1J75A 4ENMA 5CVVA 2OPTA 2L9RA 2R7SA 4NC6A 3HTJA 2ZMEC 1UI5A 4ZDPA 2R7RA 2XGCA 3C2HA 5CYVA 2D6YA 2UXOA 3VVZA 2ZCNA 4MQ9F 3HHHA 1OJLA 1IC8A 1Z67A 3VOKA 2L3DA 2M34A 1G2HA 2JWTA 1VQPI 5HLIA 4E7LA 2PMUA 1W0UA 4BKXA 2BHZA 1W36D 1K7AA 3WU2C 5LEKA 4AYBN 1IV6A 1OFCX 5F0FA 4B48A 1V4RA 3BG5A 4C3IJ 1DPRA 3VVXA 1D0YA 3JRGA 1QO0D 3M7GA 3ZQHA 3VIBA 2L5QA 3A0BC 3CDHA 2ZCMA 2QBYB 2OQRA 2Q1ZB 2YU9J 3B02A 4Y17A 3BNIA 1O3RA 1DPUA 2A69F 1HQCA 3K4NA 1CF7B 1ZG5A 4HOBA 3BR3A 4L5EA 1DU0A 4BS9A 1JJ8C 2E5ZA 1MBKA 3L00A 2HYFA 2R3SA 5GAGJ 5F08A 4DGWB 3RPQA 3QYEA 4HEA2 5AONA 2F6CA 3I71A 4NC8A 3T6NA 3F6VA 3ZMZA 1GLNA 3RD3A 4MFEA 1Q1VA 3VUQA 5IY5H 4M73A 1NH3A 4CDGA 5L3FA 2HNHA 3DLLF 5E79C 4XONA 2FXAA 3HOXJ 2RDPA 1OKRA 3LSPA 3VTIA 1Z6TA 1GVDA 1LE8B 4G12A 2ZXWH 3J7YJ 4XLFA 1HKSA 2ECCA 5J1RA 5TGTA 4ICHA 2PFBA 4Y33A 1FYLA 3CF5F 1KQ9A 2KP6A 4AIKA 1MMSA 2P6SA 4DW6A 1BOBA 1SEUA 1YE9A 2FBQA 4XKCA 1A36A 1VQ4I 3ZN0A 1HBXG 1VQ6I 2VKVA 2QGUA 4RAFA 4D9JA 4A3DJ 2EA4A 3HYIA 1LVKA 3R60A 3TP3A 4AUXA 3FMQA 4IO9F 2YVHA 2FNAA 3P5JA 4CYCA 2DDBA 1TT0A 3F1BA 2VKEA 2O0YA 3M4OJ 2FOWA 3TOAA 4UDSA 1SFUA 1QPMA 1TNTA 2ICWG 4DZPA 4W97A 3GFMA 1LFUP 1SFXA 4GGGA 3OIPA 1XGNA 3OYEA 5LHGA 1J59A 3MNLA 1LUJB 4AC0A 5K5OA 3NWSA 3MVPA 2P6TA 4DYQA 3Q9VA 1U0JA 3TGNA 3BOQA 1TWFJ 3J80Z 2X6WA 2F07A 2B63J 4FETA 4H4KC 3FXMA 3CO6C 2XVCA 1K78A 2OQGA 3M8FA 2QIBA 1BN5A 3ANPA 4PCQA 3U1KA 2NNYA 1MMNA 4PK4A 1M1EB 3W2AA 4XR6A 1MD0A 1TBXA 3RYPA 2EFQA 3GF2A 4YIFA 1B9NA 2EFOA 3V7CA 3UKGA 4HF0A 3ZQLA 3S3NA 4E7HA 2ZSHB 3AG1H 4I0BA 3H92A 4DIQA 2XPVA 2OTLI 4CHUA 2CQXA 4BHBA 1MH3A 1T08B 5B1BH 2F5EA 1ZARA 3HSFA 1QPIA 1WJ5A 3HDDA 2XPUA 3JRCA 2PLYA 1OMIA 1O57A 1IN4A 2KFDA 3ECOA 3L1PA 2I10A 1QU3A 1Y8QB 1P4XA 2BY1A 3IWZA 2AXLA 3C2BA 3QAHA 2E35A 4WF2A 3AL0B 5GPCA 4C2MJ 1SMYF 4CSWA 4OIPF 1T6SA 4XKWA 3D0SA 2X1EA 4UHTA 2VT2A 1VQLI 2LP0A 4G7OF 3CCUI 5C4JJ 4HQEA 2LNBA 1FMVA 3GTPJ 1VQ7I 2F5FA 3HRSA 4HA8A 3TW6A 4F7ZA 1BW5A 2V7FA 4RAZA 2QQ9A 5LEJA 3FXJA 2CQ7A 4QIWN 3FRQA 3HIMA 1YTYA 4RM3A 2I8DA 3JRHA 3JSPA 5DM7F 5DCMB 5C4YA 1W7PB 3HKZN 2MGQA 3W3CA 1PUFA 1NK3P 2LSOA 3VSKA 4ZH4F 3RYRA 1A6IA 3S15J 1X58A 2BOLA 2VJ5A 1YJWI 1U5TB 1YRNB 1B4AA 3LQRA 1SD5A 5GP9A 5EFYA 4WK8F 3J81K 1MMGA 3RJPA 4M9SA 1ZRCA 1KYZA 5J3LA 3RZOJ 1Y0NA 3V8JA 4DNCA 1YW8A 2PJPA 3EGQA 1Z77A 5E1WA 1F36A 5L3DA 2ZXIA 3H5RA 4U7DA 2AHQA 1REPC 3VOXA 3WTTC 1A04A 2XAUA 4LJZF 2ZCXA 1HSJA 4OMZA 3DWLE 4CCNA 3I0TA 4BDZA 1VQ9I 4MQVA 3CUQA 1G59A 2JJ7A 3CC4I 3BZ6A 4S0HB 4JL3A 2XAQA 2DA7A 2NS8A 3HJEA 1GXPA 4NNJA 5D4RA 3BR2A 3FMSA 2DCEA 1ETOA 2R7DA 2X51A 3EQLF 3TEDA 3NQOA 1FY7A 4ZTJA 3K70D 5BMZA 4OD4A 1Z9CA 1E2XA 2ZCWA 3RIRA 3F23A 4NB5A 2FBKA 3BR5A 4A5NA 1BJZA 2HI3A 3GFLA 1ITYA 2L02A 4FQGA 4M3FA 5HS8A 1SVOA 1D8JA 2Z33A 3L09A 1XDUA 2XB5A 3M8JA 5AQCA 2EIKH 3HUGA 2NS0A 4ZC3A 2HQAA 5BOXA 5FB2A 3CF2A 3FXOA 4HRIA 3PSFA 2O61A 2MD5A 5FGLA 1VTNC 4AM3A 2WB1A 1JKQC 1DGRM 4HX7A 4UB8C 1HF0A 2VONA 1LDKB 3CJQB 2RKHA 4HG2A 1K4SA 2M3AA 3ZP5A 2GFNA 5HLGA 1H88C 1I39A 1K61A 5GAHJ 5JHUA 2ZXJA 1JTYA 2HTJA 3PUBA 4FX0A 4XORA 1O7LA 3BWGA 3HOUJ 2M8EA 4BEHB 1JJ6C 3HXLA 3OYHA 3F8FA 4NDLA 3IC7A 3HOZJ 1HW1A 4KMFA 2RQPA 3W2WA 3JAMK 5EEHA 1WZ2A 4XRMA 2F5CA 4IPAA 4D5CA 4IJAA 4UNOA 3K8PC 2E1MB 4V2FA 3TO6A 3G1MA 2R4GA 3M07A 4HDUA 2QM3A 3B6AA 3HTAA 1B9MA 3V7RA 2XHKA 2IGOA 2VLAA 4Q47A 3LA7A 4NQWA 2OC6A 2K40A 3H1CA 5HOOA 2ID3A 2OF7A 2HOTA 2DDAA 3MKLA 2KL4A 4XOPA 4IRVA 2B3WA 4C9YA 3I64A 1UAAA 1R6RA 2XGXA 5A2QK 2CWEA 2YSRA 2VXZA 3K2AA 4DBRA 3F8CA 2X6YA 2JPCA 1LFBA 2CJJA 4ACIA 2BY2A 1OCTC 3RQ4A 2W85A 4KN7X 4WXDA 3U1DA 3K4CA 4N4OB 1R4NB 3JTGA 3HTHA 3CJTB 3V7SA 4W1UA 3S5RA 1JI8A 3DPTA 1MBGA 1U9NA 2J5PA 3JR9A 2BY3A 3LNQA 5F1RA 2NRAC 5E17F 2VC0A 3QWLA 4XBFA 3VFZA 5F1JA 3TQNA 5C3EJ 1DUXC 3ZMSA 3COAC 5JR3A 1NG6A 3NRVA 4NUBA 5BNGA 3AQSA 1R00A 1BIBA 1H0MA 1FJLA 2UXHA 2WAFA 1R5HA 1RIOH 2CFXA 3KLOA 4B1RA 1N25A 3I9V2 4L5JA 3RCOA 5HS9A 1S6LA 2KKOA 5F04A 1KA8A 4MFDA 2E7WA 3CP8A 1ZQ3P 3CLQA 4Y52J 2F2EA 1P7JA 4XN3A 3P9IA 3ABLH 3K4LA 4XLCA 2RV8A 1ZELA 2IGNA 2OV7A 3AQTA 2CMPA 2Y0SA 3E5UA 4M9ZA 4U87A 2LRDA 4S05A 3OR1C 1AHDP 1MIJA 3M9AA 1FZPB 4L0ZB 2VJ4A 1YFHA 4MNUA 1EH7A 2DFFA 1LDJA 3ZGKA 4RGRA 2YVXA 3S1NJ 4LMYA 2FBHA 3SQNA 1R9TJ 1QZZA 1BL0A 2HKUA 2GA1A 4A0ZA 3MMYB 1UFMA 3OOPA 3Q3SA 2NVXJ 1PJRA 5DD8A 1IAWA 2L7ZA 2DPDA 1X2NA 4RAYA 1U8RA 3L2CA 2DOAA 2WBMA 3OR2C 1ODDA 1I50J 2F5DA 4B3AA 1UCRA 4RDUA 2FJI1 5JHFA 5GTHC 2Z5UA 2CUJA 3LAJA 5ICFA 4YFKF 2G7UA 2IGKA 2XRLA 3RQIA 4BJ5C 9ANTA 2V1DA 3HGYA 1JKRC 2DG8A 2HYGD 5D1RA 1K79A 2BXZA 1QZYA 2RASA 1QRYA 4Y15A 4AVZA 4WXCA 3VEPA 1B72A 4BU2A 4JBAA 4HDVA 4D7MA 4M71A 1RR8C 1ZGJA 3HG9A 3OYJA 4XL9A 2W7NA 4XQFA 5H6RA 4UUSA 4PXIA 5EDNA 4XSXF 2M8GX 4PGGA 3OYNA 1ZGAA 5IP6A 1OLTA 2HEOA 4JKZA 4M3EA 4DOZA 2JQ7A 3QYBA 2P7VB 4UV8A 1XX5A 3ELKA 1D5YA 2V1UA 3E6MA 1WJFA 4KISA 4XLPF 2AS5F 3OIOA 2O7TA 4HPQA 3U9GA 3SZGA 3KP7A 3ZMVA 2FOKA 2H94A 3FIWA 2E7XA 3BTLA 4EMSA 5LFAA 3K1MA 1J2XA 1FX7A 2M9HA 4A3BJ 5CJ9A 3V8KA 1G8XA 2ECBA 3IL2A 4CCMA 3S3MA 1QZEA 2HKXA 1TL8A 1HW5A 2QWWA 1X4OA 4O5VA 4EQQA 4ZYEA 3A01B 2QA4I 4HNUA 1YOVB 1STZA 4CO8A 3LA3A 4F52A 2BW3A 4LIVA 4ANJA 3DPUA 5CQGA 5FD5A 2H8RA 2XUBA 4BL0B 3F8NA 1I1SA 3GZ5A 2LBFB 3HPGA 2F5VA 3ML6A 2C6YA 2ZMEB 2MW8A 2FUG2 3G1OA 3CDIA 4PFPA 1GHCA 1SVMA 2LREA 5FKNA 5HODA 2GA2A 1W7PD 2P4WA 3S3OA 4KYWA 3OIQA 3S2WA 3IH4A 4BY1J 1A5JA 2QKOA 2DMPA 5BPDA 3A2KA 3CCQI 2X1DA 2P5KA 4KWAA 3V42A 1WVRA 4V19K 2MLGA 1XCBA 4OIQF 1P2FA 5LRRA 2VOPA 1J9IA 3HIFA 4LOCA 2DA2A 2YR2A 2EV6A 2KZGA 2IA1A 2XF5A 3BT9A 1B59A 3MWMA 3S1RJ 2STTA 2FEZA 3EUKL 2XAFA 3A4CA 4JNNA 2M5WA 1IRXA 3I59A 5D19A 4RGSA 5FROA 2CG4A 4A6DA 1OCRH 4OAZA 3PUFA 2NNNA 4A2UA 2YU3A 2IBDA 3HSRA 3I54A 3W6JB 1JGGA 3S32A 2NOGA 1WI3A 1FBQA 1JTXA 1YQAA 1FIAA 4M3BA 1R36A 1JHFA 2HTSA 2GIZA 4HNVA 3EUAA 1T56A 4XN0A 4AD9A 5B3SH 1MNMC 1ZTRA 5FO5A 3DU5A 4CICA 4D0PA 5LLQA 1ONVA 3OYFA 5IT9K 5KK1A 1FOWA 1BR4A 2JA8J 3OYAA 2PMZN 3LL7A 4IXAA 2ZJ2A 5EF6A 4RMNA 2DAOA 2DJIA 4PJNA 1JT0A 3BHQA 2OJED 2ZB9A 5M5YJ 1FTTA 1P4AA 4EJUA 2E60A 1FT9A 1G3TA 2DFEA 3IKTA 4IHWA 5CXGA 1Y39A 2N8GA 3LSIA 3RDIA 4YRVA 3OYIA 2R7XA 2W57A 3WG9A 3OYBA 5HNHA 5GTIC 4A93J 1ZHFA 2VI6A 1YITI 4BJTA 3ONQA 2A5WA 1S8NA 2RAEA 3U21A 3KPHA 2LDUA 4LG3A 3RKYA 2EZHA 3K10A 3NWTA 1I6HJ 2OZUA 2IA2A 3TP0A 2CGPA 4ASNA 5L3EA 2ZFWA 2YX7A 3NRGA 3WHBA 2GQQA 3I4PA 1MJBA 1OQYA 4BDYA 1F1ZA 1V5GA 2ESNA 3KP6A 2P8TA 1R22A 4ETSA 4N4NB 1TLHB 2CQQA 5C44J 4FX4A 3I5UA 2HDCA 1GVJA 3FX3A 1EKEA 3FKIJ 2LY2A 3FM3A 1Z6RA 2IXSA 1H89C 3ABKH 1WH7A 1IDZA 4EJOA 1IRFA 3GFJA 1WPKA 3AG2H 3QU3A 4BE1A 3X2QH 3DTKA 4HSRA 3ISPA 3BG3A 4GYIA 5LRSA 1XC5A 4WIBA 2F4OB 3ZN1A 2EFWA 2B0LA 2E2HJ 4DJAA 4NBQA 1NG7A 3DEUA 2OCEA 2ZXHA 3K2ZA 1CQTA 3VB2A 4BQNA 3AG3H 4C3JJ 2OUMA 3FF5A 3LSTA 3M3YJ 2IS1A 3BY6A 4AU7A 1XSDA 3GW2A 2REKA 1E3PA 4CZCA 5K58A 2Y2ZA 4YEJA 2LOOA 3GVAA 5FLVA 1ZREA 2JA7J 2XDVA 1S7EA 1Z0XA 3ZMTA 3RKQA 1QBJA 3VVYA 4HLYA 3FXLA 3D1NI 2IA0A 5C4XJ 5LGNA 1ULYA 2Y75A 3M1EA 4ENNA 1IGNA 3R4KA 3K1PA 3RSNA 1QGPA 4MHGA 4EGZA 3CCMI 3G2BA 3MFKA 3OMYA 3KFWX 1HXDA 3OYKA 4EJWA 3HOTA 3BTIA 4BE0A 2CH0A 3S8PA 2XSJC 5J8CA 5D18A 3HSEA 3NS4A 1B1BA 1IUYA 2PFVA 2M45A 3CCVI 2UXPA 1BI3A 5J1YA 2WC2A 1G4DA 2E36A 1JXSA 4BJ6C 3CJRB 2TCTA 1X4PA 2YS9A 4F92B 2Y31A 4M3GA 2FA5A 5DV5A 5EG0B 4IQJA 2BZTA 2JMWA 3IHUA 2A2FX 1XDSA 2Y69H 2ME6A 1WRJA 5HSZA 2AQEA 4B8XA 1WJCA 2LKPA 3CQZJ 2HPIA 2K27A 4IL6C 1UZCA 4C2MA 4JYKA 1MBEA 5TJJA 1UB9A 3PQKA 4GDFA 1TQPA 2LMDA 2RGVA 3JRIA 4I7HA 3Q0WA 2VQLA 2FMLA 2V9VA 2XB0X 3GCMA 3SEQA 4D1QA 4G6TB 2QTQA 2MYSA 4J00A 2K5CA 1IN7A 3PNYA 2ELHA 1SFOJ 2VL8A 3WTZA 3P9KA 3HOYJ 3GWZA 3K4MA 3W6KB 1AKHA 4S04A 1ENHA 1FPQA 3GYHX 5EGOA 2O5RA 2DK5A 5AIQA 4JX5A 2FRHA 3JRDA 3NI7A 5HLTA 1K78B 4JOMA 4XLHA 3DBLB 4E6KG 1W4MA 1F4KA 4J19A 1MKMA 4FISA 3VWBA 2A68F 2RREA 1VQNI 2LVSA 2CU7A 1IXRC 4ABZA 3KZYA 1GV5A 4PJ0C 3KEQA 1BA5A 5K1YA 1SFKA 3DFGA 5FLXK 4MTDA 3CJNA 1ETVA 5ICGA 1HKTA 4KIFA 2OZ6A 4HBLA 4OWRB 2JA2A 4XRFA 4MO7A 4V2GA 5FKMA 3KP5A 3FK7A 2HR3A 1Z91A 2JUCA 4EATA 3HTUA 3KLNA 5DEQA 2ESHA 2EIMH 4PJLA 5TISC 2IEKA 1QA6A 4Z2YA 1MDMB 2HGCA 2ZJQF 2LF7A 4EEFG 2HU9A 4F55A 2HYJA 2PBIA 2GOMA 3H9GA 3QP5A 4E70A 5D5WB 4N9HA 5IP7J 1POGA 4G7ZF 3QU6A 4BBRJ 2UV1A 5JLXA 3S2DJ 5CQEA 1DGWY 4K2EA 5JVTA 3DF8A 4QWQA 1PDNC 2QBYA 1VQOI 1QVTA 4IKFA 1OCOH 4GCVA 4J01A 1NTCA 1RUOA 3NNRA 2ZBKA 2LY9A 3MZYA 1N75A 4L5IA 2OAZA 1SAXA 4IHSA 2G0EA 3RPUD 1SVLA 3AKZA 3FMRA 1JKOC 4OAYA 2NVTJ 4EM0B 2XAGA 5EEGA 2GM4A 4IHVA 4ZTFA 5FLMJ 1U2WA 3WTWC 2X85A 1XD7A 3KCCA 1PUFB 2JA5J 3GEZA 3OYCA 3KIOA 4I2OA 1MSEC 3OYGA 3BG7A 3NAUA 2VODA 3WE2A 3RKWA 1ZRDA 4I0AA 1LE8A 2X6XA 3GEUA 3I58A 3G73A 3TMOA 1E0EA 4A69C 3CC2I 3GTOJ 1JUMA 2EZIA 5L3CA 3CDLA 1H9TA 2KPMA 1VZ0A 1A31A 1UJ8A 2BYVE 3ZMUA 1T2KA 1BOAA 4XK4A 2X6OA 1B8IB 4IEJA 1I3QJ 3RI4A 5DS9A 2G7HA 4HV6A 1ZGWA 3K4JA 1FBUA 1FSEA 4IX7A 1X1AA 3ON4A 5IOYA 2R7TA 4LGWA 3DKWA 3FXQA 4A3JJ 1IN6A 3F6OA 4RLFA 3V78A 1LB2A 4YIIA 4AIHA 3MCZA 3RKXA 1JT6A 3F0CA 1BC8C 5J8FA 1KU7A 2IT0A 4WCGA 2Z16A 1QVUA 4B44A 1Z21A 3TW7A 1X1PA 2DBBA 3ESWB 2CUEA 3CUOA 4D7NA 1X3ZB 3IKVA 2A6EF 3DU6A 2STWA 3KZ9A 2PX9A 5CPRB 4KT6A 4AWXB 5EEAA 3H36A 4A3FJ 2W48A 4MEXF 3T5XA 2NP3A 3G7RA 4NC7A 2LKSA 3BG9A 5HDKA 5FJ8J 1OCZH 2ZC2A 3TBIA 4XOTA 2JVHA 1F9NA 4BNCA 2M2EA 4Q4ZF 2KRHA 3ZOBA 3ZQGA 2UWMA 4WXHA 4GXOA 4U0WA 1WGXA 2Q2EB 3EYYA 3JCUC 4X0GA 3LSGA 4M9XA 1ZRFA 2BE5F 3C2GA 1XSXA 1KU9A 3LQQA 1RUNA 2DQRA 2R92J 1YS6A 5D6EA 1IF1A 3IRQA 4KA4A 5ICEA 3G1LA 3LFKA 5BPIA 2ELKA 2E34A 4IZZA 3VW2A 1ZKGA 2L7FP 3A1YA 1ETQA 2KRFA 2WAQN 2FQ4A 2QQBA 4HQMA 4D5FA 2K02A 5B5EC 3FBIB 3DPJA 2LYCA 5FHPA 2FNPA 1S9HA 2MD0A 2WWYA 3F9KA 4KIGA 4II3A 4ON0A 3VODA 4RGUA 3BROA 1H9GA 2X0LA 4GCKA 4C2TA 4IRHA 1IRZA 3H9JA 4EVIA 4OIOF 2NS7A 5DCMA 1W7PA 2H27A 1ON1A 3HTSB 2I5UA 1XSVA 1F43A 3RH2A 4IVNA 3FBNB 3DEWA 1J5YA 4UVAA 5KVRA 5KNLA 1ZAOA 1RRJA 1F5TA 4BXUA 2QUFA 1N78A 1IO2A 1U5TA 1YRNA 5K5RA 3PL8A 2VQHA 1VI0A 3FXRA 1UHWA 3SEZA 2P5VA 4XKBA 1IXSB 4E7ZA 2DJNA 1MBJA 4EGYA 3KKDA 3ZQIA 3FKJA 1JHHA 4B4CA 5IOZA 3ANGA 1MW7A 4AYBA 5K7FA 3J7AO 2E2JJ 1R7JA 4RGXA 3CCYA 1R5ID 2Q8KA 1RKWA 3LSMA 2PMHA 3GLXA 3FISA 3ON2A 1YW9A 3LAPA 1UHMA 4A3GJ 1ZK8A 4O6JA 3BDDA 2NYXA 3BJ6A 2PJRB 4A6EA 4PGHA 3ROUA 3BTJA 3D5RC 5F64A 4Y7NJ 3E5QA 4BQQA 3Q0VA 1UI6A 3F22A 3JRBA 4MEYF 1TWGJ 4U9LA 2OCCH 4L9NA 2IS2A 3GBGA 3JSJA 3DXJF 2A05A 3MKYB 3PASA 3AG4H 1UG2A 3UNGC 1RZ4A 3VDXA 1W5TA 1VFCA 3HGGA 3ABUA 2AO9A 4DYRA 1KQ8A 3DP7A 1J09A 5B66C 2O3FA 5IT3A 3CWRA 4MK6A 2ZY9A 3CUQC 5LGTA 1H8AC 2LG4A 2XC7A 3Q5FA 2GOXB 1EA3A 1RETA 2FX0A 4G7HF 4RM2A 5E3MA 2DT5A 2NP5A 5DDGA 3R61A 3S1QJ 3CLOA 2AQFA 3LHQA 1D0XA 3E0JB 5E1XA 1G3WA 3HOVJ 1YIJI 5GPAA 3NEUA 1MJ9A 2OERA 4IQ4A 2L4AA 4HX4A 2EIJH 2D45A 2DI3A 2VBYA 1KU2A 4M6YA 4BEHA 1RI7A 3RZDJ 4DBQA 2JT1A 4Y13A 2IS4A 1Z3YA 1BR2A 2IRFG 4EM2A 1GV2A 2FD5A 3GZNB 2VBXA 4CCKA 2O6GE 3B73A 3T8TA 3CZ6A 2E1CA 1IUFA 4AIDA 1XGOA 3DQVC 1Z3XA 2OU2A 1FNNA 4KDPA 3HOSA 5IYBJ 2G3BA 3SFZA 2L9VA 3FDYA 5ILUA 4UUSB 2ZKZA 4U7BA 1RPWA 3JSOA 5J6XA 1U5TC 2BVMA 3S93A 2XF6A 2BXYA 3QYFA 3WE3A 1AWCA 3GTJJ 4FTHA 3C7JA 3KP3A 3K69A 4UXNA 5CW8A 3F21A 2XGEA 4KT5C 2EZLA 3VOEA 1TWAJ 1YLFA 2VXDA 3M8EA 3QOEA 4OD5A 3BQZA 5IYCJ 5L3BA 3BR0A 2X4HA 1BC7C 2L9SA 1DDNA 1ZLKA 4LITA 3H3VK 4XNFA 5DD4A 3V6GA 2JRTA 5DM6F 4BACA 3QQAA 4GFBA 4KNYA 2CW8A 3HHGA 2IJLA 1D3YA 3EUPA 1ZH5A 1FMWA 2PI0A 2RNGA 4KICA 2H1LA 3JW4A 1P6RA 2BW3B 1X2MA 2VC1A 4FE7A 5EZGA 3CMEI 3CCSI 5H9TA 2HFHA 2GAUA 3CCJI 3I55I 5H20A 4BXFA 4GYGA 4M74A 2FE3A 2MABA 3DTIA 2CV2A 3M1CA 2DQLA 1YJ9I 1IW7F 3EPZA 5LHIA 4CUGA 2DT6A 2HQRA 2DOEA 4BAYA 1Y0UA 3O8HA 4U0VA 1UG0A 4HNTA 2HOEA 1SC7A 3OYMA 4A0YA 3LWJA 2QKMB 3OWTA 2L7KA 2XKOA 3C1DA 5H6QA 2ISZA 4U88A 1A6QA 4HV5A 2P5LC 2F4MB 1XMXA 2DXIA 1K6YA 2KHMA 5F6FA 2EFNA 1U78A 3SZPA 2DA3A 4HAMA 3SZTA 2DMUA 3TKYA 2BGCA 2JSCA 2WA0A 4PFOA 5KHDA 3NXCA 3SYTA 2O03A 4RLQA 4Z6YA 3CCRI 1YS7A 2JN6A 3HKZA 5FKLA 4LFUA 5CLSA 3MN2A 5FFXA 4GO1A 3H35A 5HS7A 3S2HJ 5HLHA 4AC6A 2D1HA 3H5AA 1I5ZA 1USTA 1T95A 3O2PE 1SANA 2ID6A 2QCOA 4B47A 1OCCH 1VNDA 2M0MA 3BPXA 3SDGA 2VT3A 3J81Z 2BEOA 1I3AA 1E3HA 2FQ3A 4L62A 2UXUA 2K3PA 3WU0A 3ZRGA 2NVUB 1AOYA 1S5LC 1LJ9A 3DV8A 4Y3OA 2ACJA 2K7LA 3GMEA 2ETHA 2KIUA 1X19A 3T1BA 3COLA 4XLAA 3ULQB 1U6GA 1XG1A 3E6CC 2IPQX 3QP6A 4L9TA 3DTEA 1YYVA 2QENA 5E8IA 4M6VA 3DLAA 1AU7A 1IG7A 3CP2A 2FJ1A 2IS6A 3S16J 1JUSA 2DOFA 2UXXA 2Q0OA 1TWHJ 4R8HA 4X1EA 2AXTC 2KIMA 2E1OA 4F3QA 2WAEA 1HLVA 2WADA 3BLYA 1RR7A 4H0EA 4CGRA 2D5VA 4EJTA 2B9SA 3O6BB 4AIJA 5F0CA 4U0YA 4KITB 2R7UA 2RNJA 3CMAI 5ERIA 2YX4A 2IW5A 1ZLJA 1U3EM 2MA3A 4L9VA 4IOAF 4ZYGA 3KYDB 1W36C 3K0LA 3J7ZI 3HBLA 3BCGA 1Y1VJ 3L2VA 1MMAA 4BE2A 4U9NA 3W6VA 3KEYA 4P9UA 3MZ8A 2R5YA 3TL4X 2E2IJ 4HW0A 3HPHA 1SFEA 3QPTA 3E7LA 3F72A 3MKZA 1XPXA 1Y6IA 5DTDA 2EB7A 1MBHA 1W1WE 3PQJA 2L0KA 5JFRA 4ITVA 5J47A 3AFHA 3K1NA 2MC3A 1YJNI 2QQ8A 2E19A 3JAMZ 3RTRA 2G7LA 2ZMEA 3IH2A 1K6OA 1ZR4A 1BBYA 4M3DA 2VOOA 2R7ZJ 2M7AA 1BJAA 1RC9A 5FGMA 1IDYA 5EYRA 4DYCA 1Z7LA 2EJRA 2GIVA 2Z99A 3LFUA 1JKPC 1LDDA 2W24A 3BPVA 5D4SA 3QRFF 3QKXA 2M0CA 1O7FA 2VPLA 4DVYP 2F4IA 4P1WA 1IV8A 1S3JA 1GXQA 1HDPA 1X1CA 1WJBA 4IRIA 1FLIA 2HQ5A 4XLEA 3BCAA 2ZSIB 4LLNA 2K9MA 5A2QZ 1BI2A 1IN8A 3VYTB 1DQUA 2EINH 2DMTA 4NELA 2Y9ZA 1WQ2A 2RVCA 1Y8RB 5E20A 4BYYA 4PDKA 2CQKA 3F3XA 3CCEI 2YVEA 2Z9OA 2BV6A 2GXBA 3QBMA 4TV7A 2DU9A 3KYCB 1N77A 3JRFA 3D5SC 2KJBA 4R79A 4P5OA 3PFIA 2LLKA 1V55H 2HDWA 2QF7A 1G3YA 1TWCJ 2XROA 1WKMA 2DN0A 4N9IA 1U9OA 1VQMI 2K9NA 3KKCA 2W82A 5ICCA 1YG2A 2D1VA 2KIFA 1I6XA 1ZG3A 3IUOA 3BCBA 5E8GA 2P7CB 2V57A 4N0BA 4UB6C 3L2UA 1EF4A 5D5UB 4HLXA 2V4JC 1DP3A 4ZDLA 3G6EI 1WI9A 4ZYHA 1ZG1A 2DPUA 2JRMA 2H1KA 5K7HA 4GFKA 2BY0A 2P81A 4MIMA 1FOYA 4R1HA 2M4GA 2VASA 2IU5A 5CVRA 3FK6A 4P55A 3WTUC 3GTQJ 2R7WA 1EH6A 2X1CA 1Q1HA 3HRMA 1O3SA 1WFXA 4LG0A 2GBYA 4IHXA 3V8LA 3G4SI 2O8XA 4HF1A 3GO5A 4FCYA 3U2RA 3I56I 3ZQFA 2OI8A 4JQFA 3TDUC 3WGGA 1BR1A 3CESA 2LF8A 2FSWA 4HYEA 4I02A 3Q0UA 4AF5A 1QHGA 1X1BA 4I09A 5CVIA 5FFZA 3OS0A 1E3OC 3D5LA 2A6TA 2WB1N 2VN2A 1MSFC 4EM1A 4G8XA 2YUSA 3IAM2 4FHTA 5KAFC 1PYVA 4E7KA 2QEXI 1X3WB 4A0XA 1TQIA 2QQAA 2JTVA 2BBYA 3BP8A 1BI0A 2MH9A 4DZJA 4ME9A 2MSYA 2G7SA 2KMUA 4BXXJ 2V9PA 3CCLI 4GCLA 3GTMJ 1HA8A 3ASNH 3GZIA 1SGMA 2PZ9A 2PEXA 1ETXA 2W25A 3ZR8X 1ZR2A 4CYCB 4EV0A 2VKHA 2HYTA 4XKVA 5CXIA 3BQYA 1YI2I 3K7AJ 1WHUA 2GUHA 4YELA 2CW7A 4XM3A 3EYIA 4PZJA 2UXNA 2MFZA 3WGIA 1I27A 3MEXA 2LTPA 4FASD 1JE8A 1IRGA 2PN6A 3PO2J 2BHYA 1L0OC 3LOCA 4OINF 4BUPA 2R5ZA 2O7OA 5M5WJ 2IVMA 2RN7A 4LIUA 3ABMH 3L2WA 3S14J 2DW4A 3HB9A 3I3LA 1FP1D 3OYLA 1V5FA 3EUHA 1XS9A 5LGUA 3KZZA 2O9LA 2H6CA 3L7WA 1YW7A 4X6AJ 4B3XA 5LHHA 2K85A 3OS2A 2HOSA 3E5XA 2L7MP 4FT8A 2MC4A 3VYRB 4XMYA 2ELJA 4G6DA 2K4JA 4G9YA 1MNDA 3DBRB 1TT5B 1A35A 3DKYA 1G6NA 3E7QA 2RHAA 3WG7H 1WCMJ 3BG6A 2L01A 2DMNA 3L9FA 1GDTA 1T0FA 2ZOZA 2KLOA 2XAHA 3V4GA 4FE4A 1ETWA 5EG0A 4LD5A 1EV7A 5EZHA 3OS1A 2GZWA 1ON2A 3DBHB 4UVBA 3L2RA 2KDZA 3KZIC 2F48A 2DA1A 2QKLB 2W00A 5CVJA 1CF7A 1OYYA 1SMTA 3F8BA 2OD5A 4BH9A 1OYIA 2XAJA 2HZDA 2Y0SN 3H3ZA 3K70C 2A6HF 3O3KA 3OV8A 4KMUX 2WGBA 2TRTA 5D6FA 5DCFA 2NX4A 1I1GA 3PO3J 2ZO4A 1Z05A 5K5QA 3PIPF 1IN5A 1D1CA 4LLLA 5LD2C 4Y4RA 4C2UA 4KFCA 2DT7B 5J40A 1KZHA 2DYRH 4UVCA 2HXIA 5IYDJ 2HKOA 3GZ6A 1PUEE 3DCFA 4RBOA 3OSGA 1JUPA 2K4BA 2W1OA 3R0JA 2NVQJ 4MGRA 2M7BA 1YIOA 1MGTA 3G3ZA 3E6BA 1OR7A 1S29A 3WU1B 2LFBA 2V1NA 3WGHA 4CCJA 3TO7A 3TDZC 2GXGA 2CRGA 2O8KA 1XN7A 2MLKA 2NAZA 1P9QC 2VE9A 4HZFA 2CFOA 1HSTA 3K6GA 4YG2F 3C3WA 4KJZA 1FWZA 5BQTA 5IT9Z 4CZZA 4CA0A 2KJCA 2PMZA 3F8MA 4JK1X 2NXNB 3CUQB 4RA2A 3MKWB 4HSTA 3H0DA 1MDMA 1TZLA 3EUHC 2E1NA 1BW6A 2VKDA 3HC7A 1R1TA 3OL3A 2CSOA 3GXOA 5DUKA 4QPQA 4ENKA 3GTKJ 2QSFX 4A3EJ 2DO7A 2QOPA 2K9QA 4WX9A 3OYDA 5K7ZA 1XTAA 2JVGA 1EJ9A 3VYUB 1UELB 2FF4A 2KRCA 2NOJB 2OBPA 3WODF 3E97A 4QLCU 1SD6A 3E6DA 2K9LA 3OY9A 2HQNA 4A5MA 4I6ZA 3P9CA 3HUGB 4XRSG 1KONA 4LK1F 3UR3C 4P96A 4ZZLA 4CGZA 1XMKA 3W2VA 1T0FC 2MG4A 1S7OA 2M1BA 3ZCOA 2XF7A 3ZMDA 1Y1WJ 3AAFA 2MH2A 4BQOA 4LB6B 2ISYA 3CMYA 1X1DA 3GFIA 4NN1A 4XLNF 2QSGX 3KETA 2VBZA 4RAGA 1FOXA 3ZQCA 3DEEA 4G94A 4ESBA 1K4TA 2CV1A 1T8IA 4OMYA 1S72I 4ZDOA 1XGSA 1USSA 3OL4A 5F0HA 2OTJI 3QPSA 5CKTA 2R7OA 4BY7J 3C18A 1YHQI 4UY8I 3VSLA 1LEBA 4NHJA 2FBIA 2CW0F 2LK2A 3K4KA 4NQWB 3SFIA 1B8IA 3HE0A 3LWFA 1BI1A 3E3VA 3JREA 3ERED 2TDXA 4L18B 1YX3A 3BTCA 1R58A 4CCLA 1MZBA 2Z3YA 5FD6A 4JP0A 2EZKA 1FP2A 1V5EA 4G6QA 3LSJA 1OR7C 3E1SA 1R23A 3I4NJ 3IP4B 1QNTA 4HKUA 2XRNA 2R0QC 2Y0MA 4CXFA 3ZXSA 2L54A 3ERMA 3P9TA 1TW3A 1HCRA 1WH5A 2DTZA 3H0GJ 4UUVA 4I99C 1TC3C 2W4SA 2QLZA 2G9WA 2B1EA 2UXIA 1O4XA 1T38A 1EH8A 2VPRA 2CV0A 4PJMA 1O3QA 1JGSA 2XGDA 4PSXA 2ZNYA 4F91B 5E18F 2HVRA 2VIXA 3GTLJ 1TP4A 1GT0C 2IP2A 3R6SA 3WTVC 2VE8A 3PM1A 3BZKA 2Y9YA 1D8KA 2ME0A 4KUMA 1VQ5I 2XKPA 3WTSC 1DU6A 1YX5A 3HM5A 3PNTA 2LD5A 2COMA 2Q2EA 3HZJA 3CRJA 2KT0A 2JPBA 1T39A 2HXOA 3KP4A 2KIQA 2UUZA 3LSRA 2RQQA 1FIPA 3CTAA 1HOMA 3S1MJ 2L2OA 3ZQQA 2Q24A 4II2A 5D8LB 2WUIA 4I98B 4E7IA 3A0HC 5L3GA 1T98A 4A3MJ 3BRUA 2DMQA 2QWTA 4QTRA 1O3TA 3EETA 1ETYA 4ZYDA 4ZJZA 1TW2A 2GXAA 2VQCA 3FXUA 1FEXA 2ZFUA 1XCVA 2KDOA 2X9DA 2XIGA 5JI6A 5KAIC 2DA5A 6PAXA 2BVLA 2EK5A 4PJJA 2CUZA 2JK3A 5M3FJ 5FRMA 1P92A 5LBQA 3GX4X 1IZ1A 3H3UA 3AL0C 4JX6A 4IHTA 4OU0A 3KEOA 2CQNA 4MTEA 2A07F 2QZ8A
chains in the Genus database with same CATH topology
1XG1A 5C4JJ 4C3HJ 4XRSA 3GTPJ 3BR6A 2UXPA 3TW6A 5J1YA 3PPBA 4M6VA 1BW5A 5F27A 1AU7A 1IG7A 2FJ1A 3S16J 3HEFA 3OSFA 1JUSA 2TCTA 2YS9A 1B72B 1TWHJ 4X1EA 3HIMA 2CUFA 2Y31A 4M3GA 4QIWN 4MLOA 2E1OA 5EG0B 2JMWA 3FRQA 2EH3A 3JRHA 1HLVA 3S17J 2ME6A 5C4YA 5HSZA 3HKZN 3CQZJ 1RR7A 2MGQA 4CGRA 1PUFA 1NK3P 2D5VA 1HDDC 2DG7A 5FKOA 1A6IA 3KNWA 4JYKA 1MBEA 3S15J 5F0CA 1X58A 4A3CJ 3JRIA 2DA6A 3Q0WA 2R93J 1YRNB 2XB0X 5EFYA 5GP9A 2QTQA 3HBLA 3BCGA 1Y1VJ 3A02A 3W6VA 5J3LA 1SFOJ 3RZOJ 2R5YA 2E2IJ 5FKKA 3HOYJ 1AKHA 1ENHA 1MBFA 3E7LA 4JX4A 3EGQA 1Z77A 3BJBA 5EGOA 1F36A 4GCTA 5DTDA 2AHQA 3VOXA 1MBHA 4QSHA 4JX5A 2GENA 5HAWA 2L0KA 3JRDA 2ZCXA 3NI7A 3HTIA 2E19A 3QPLA 4J19A 3IH2A 2G7LA 4FISA 2JJ7A 1ZR4A 4M3DA 4S0HB 4JL3A 2DA7A 2LVSA 2NS8A 2CU7A 5IP9J 4ABZA 2R7ZJ 1GV5A 1IDYA 3BR2A 5EYRA 1BA5A 4DYCA 1ETOA 2DA4A 3TEDA 3LJLA 1ETVA 1JKPC 3G56A 3QKXA 2M0CA 4XICA 1HDPA 3BR5A 1BJZA 4MO7A 4V2GA 2HI3A 2HQ5A 3FK7A 5FKMA 4A3IJ 3WHCA 1ITYA 4M3FA 2IEKA 1U8BA 2DMTA 4EEFG 4NELA 2XB5A 2HYJA 5AQCA 2Y9ZA 5IP7J 1POGA 2YVEA 1RESA 1K83J 4BBRJ 5JLXA 5FGLA 3S2DJ 3QBMA 1JKQC 1HF0A 2X48A 3JRFA 1APLC 2GFNA 1H88C 1QVTA 2LLKA 2XSDC 4XIDA 1K61A 2QF7A 3C07A 1JTYA 2IAIA 1NTCA 1TWCJ 2COBA 3NNRA 3HOUJ 1JJ6C 2DN0A 1U9OA 2LY9A 4NDLA 2K9NA 3KKCA 3HOZJ 2GLOA 2G0EA 2V57A 4XRMA 1UHSA 4D5CA 2WV1A 1JKOC 2NVTJ 1EF4A 1T33A 4V2FA 2GM4A 3G1MA 4IHVA 4I76A 3B6AA 3HTAA 5FLMJ 3HOWJ 2H1KA 5K7HA 1PUFB 4GFKA 2JA5J 3NARA 2P81A 1GUUA 4MIMA 3JRAA 2VUMJ 2IU5A 1MSEC 3FK6A 1NK2P 3NAUA 3GTQJ 2K40A 1LE8A 2ID3A 2OF7A 2HOTA 3MKLA 2JA6J 3GEUA 2GBYA 3I4MJ 3VW1A 4A69C 4IHXA 3GTOJ 2ZOYA 1JUMA 2EZIA 4FCYA 3CDLA 3K2AA 2HDDA 1FTZA 3ZQFA 2R5YB 2OI8A 1LFBA 2CJJA 4XK4A 2X6OA 4ACIA 1B8IB 4IEJA 1OCTC 1I3QJ 5DS9A 3O60A 5HBUA 3Q0UA 1ZGWA 4AF5A 5IPAA 1E3OC 3ON4A 4UUTA 5IOYA 2WB1N 4GFLA 3CJDA 4A3JJ 1MSFC 3HTHA 2YUSA 4W1UA 3V78A 3S5RA 2HOAA 4BBSJ 1MBGA 1U9NA 1JT6A 3F0CA 3JR9A 3LNQA 3SJMA 1UMQA 4DZJA 5F1JA 2MSYA 4ME9A 2G7SA 5C3EJ 4BXXJ 1QVUA 5BNGA 3TW7A 3AQSA 4GCLA 3GTMJ 2Y30A 3GZIA 4D7NA 2CUEA 1SGMA 2PZ9A 1FJLA 2UXHA 1ETXA 5DAJA 4B1RA 4CYCB 1ETKA 1ZR2A 3KZ9A 5E3LA 5EEAA 4A3FJ 2HYTA 5F04A 5CXIA 3BQYA 2W48A 3K7AJ 4MFDA 2GUHA 1ZQ3P 2NP3A 3G7RA 4Y52J 1OCPA 1P7JA 3BG9A 3A01A 4A3KJ 5FJ8J 2LTPA 2XPWA 3PO2J 3AQTA 1P7IA 2M2EA 3LOCA 3ZOBA 3ZQGA 3VP5A 2R5ZA 1AHDP 2O7OA 1ORKA 5M5WJ 1WGXA 2NVYJ 3LSGA 1MH4A 3S14J 5JLWA 3HB9A 5M5XJ 3S1NJ 1R9TJ 2R92J 5M3MJ 1XS9A 1BL0A 2EQRA 2HKUA 3VW0A 3G1LA 3Q3SA 2NVXJ 2O9LA 2L7ZA 1X2NA 5E3OA 2ELKA 1IJWC 3VW2A 2L7FP 1ZKGA 4X6AJ 2K9SA 1ETQA 4MXMA 1I50J 2HOSA 2WAQN 2FQ4A 2L7MP 4B3AA 4D5FA 4RDUA 1W0TA 3VVZA 3B81A 3DPJA 5FHPA 2W53A 2LKXA 2XRLA 3E7QA 2RHAA 3RQIA 2DG8A 9ANTA 3HGYA 1WCMJ 1JKRC 3IH3A 3VPRA 5D1RA 2DMNA 2ZOZA 1GDTA 4GCKA 1VF9A 1QRYA 2RASA 1B72A 1IRZA 4FE4A 1ETWA 3O8GA 5EG0A 5EZHA 3GTGJ 3IV5A 2NS7A 4D7MA 2KDZA 2DA1A 1F43A 3RH2A 4A3LJ 3DEWA 4UUSA 2Y0SN 4PXIA 3B6CA 5EDNA 5E3NA 2M8GX 2TRTA 2WGBA 5IP6A 4JKZA 4M3EA 1YRNA 2NX4A 1VI0A 3PO3J 2XDNA 5FMPA 1D5YA 3NPIA 2DJNA 2HXIA 1MBJA 5IYDJ 3KKDA 3ZQIA 3OIOA 2PBXA 2O7TA 4B4CA 3DCFA 5IOZA 3ANGA 1RKTA 5K7FA 4RBOA 3FIWA 3OSGA 2E2JJ 1JUPA 2EBIA 3CCYA 3BTLA 4IHYA 1RKWA 3VUQA 2NVQJ 2M9HA 3FISA 4A3BJ 3ON2A 2ECBA 3BR1A 4A3GJ 1ZK8A 3IUVA 2LFBA 3A01B 3BTJA 3A03A 2LR8A 2CRGA 4Y7NJ 2O8KA 1UI6A 3Q0VA 2G7GA 3OOUA 3JRBA 1TWGJ 1AKHB 4YZEA 5J1UA 3GBGA 3JSJA 5EGOB 2R5ZB 3PASA 2H8RA 1UG2A 1VFCA 3HGGA 4DYRA 2AO9A 2OPTA 3CWRA 2L9RA 2MW8A 4MK6A 3G1OA 3HTJA 1H8AC 1UI5A 1BW6A 5FKNA 5HODA 1RETA 2FX0A 2XGCA 2D6YA 3IH4A 4BY1J 1A5JA 2QKOA 5E3MA 2DMPA 2UXOA 2NP5A 3GTKJ 2ZCNA 1OJLA 1IC8A 4A3EJ 3S1QJ 2QOPA 3VOKA 2M34A 2K9QA 3LHQA 1G2HA 4KWAA 2JWTA 5K7ZA 3HOVJ 5GPAA 2OERA 1W0UA 4BKXA 4LOCA 2DA2A 3BT9A 3S1RJ 4AYBN 1IV6A 4JNNA 1OFCX 4I6ZA 3RZDJ 5F0FA 5D19A 3BG5A 4C3IJ 4XRSG 1GV2A 2FD5A 3VVXA 3JRGA 3ZQHA 3VIBA 2IBDA 2MG4A 1JGGA 1IUFA 2NOGA 1WI3A 1JTXA 2ZCMA 1Y1WJ 2YU9J 3CMYA 1FIAA 4M3BA 3BNIA 5IYBJ 4HNVA 2G3BA 4NN1A 1T56A 4UUSB 1MNMC 3BR3A 1ZTRA 4L5EA 1DU0A 3ZQCA 1JJ8C 1RPWA 1MBKA 5F08A 2JA8J 2PMZN 5EF6A 5F0HA 3GTJJ 3QPSA 4BY7J 1JT0A 4FTHA 3BHQA 3RD3A 3T6NA 4MFEA 1Q1VA 2ZB9A 5M5YJ 1FTTA 4IHWA 5CXGA 5CW8A 2XGEA 2N8GA 2EZLA 2LK2A 3HE0A 1B8IA 3SFIA 1TWAJ 3HOXJ 3BQZA 3LSPA 5IYCJ 3JREA 1GVDA 3BR0A 1LE8B 4A93J 3BTCA 4G12A 3H3VK 2VI6A 3V6GA 4JP0A 2EZKA 2RAEA 2ECCA 5J1RA 3LSJA 3QQAA 4ICHA 4HKUA 3I4NJ 2EZHA 4GFBA 2R0QC 1I6HJ 3EUPA 3TP0A 3P9TA 4DW6A 1HCRA 1WH5A 2DTZA 2FBQA 3H0GJ 1X2MA 4FE7A 3NRGA 3WHBA 5EZGA 2VKVA 1TC3C 4A3DJ 5H9TA 3TP3A 4AUXA 2UXIA 2YVHA 1O4XA 2CQQA 2VPRA 4CYCA 5C44J 3F1BA 2VKEA 2XGDA 3M4OJ 3FKIJ 4UDSA 3O8HA 1H89C 4DZPA 4W97A 1WH7A 1IDZA 3GTLJ 1LFUP 3LWJA 1GT0C 1WPKA 3PM1A 3MNLA 4AC0A 2Y9YA 3MVPA 2ME0A 3BG3A 4DYQA 1DU6A 1XC5A 1TWFJ 3HM5A 1U78A 2LD5A 2DA3A 2F07A 2DMUA 2B63J 2QIBA 2E2HJ 3CRJA 2KT0A 3ANPA 3NXCA 2HXOA 1CQTA 3LSRA 4C3JJ 2JN6A 1FIPA 3M3YJ 5FKLA 1HOMA 3S1MJ 2REKA 2Q24A 3UKGA 5K58A 3MN2A 2Y2ZA 3ZQLA 3S2HJ 2JA7J 5FLVA 2WUIA 4AC6A 2XPVA 4A3MJ 3BRUA 1S7EA 1Z0XA 2DMQA 3RKQA 2QWTA 3VVYA 2CQXA 4QTRA 1MH3A 3D1NI 1ETYA 1SANA 2ID6A 2QCOA 1VNDA 3SDGA 1QPIA 5C4XJ 1FEXA 1IGNA 2X9DA 3HDDA 2XPUA 4L62A 3JRCA 2DA5A 2UXUA 3L1PA 2I10A 2JK3A 5M3FJ 3C2BA 3BTIA 5GPCA 4C2MJ 4JX6A 2LP0A 3COLA 5D18A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XG1 A;  5C4J J;  4C3H J;  4XRS A;  3GTP J;  3BR6 A;  2UXP A;  3TW6 A;  5J1Y A;  3PPB A;  4M6V A;  1BW5 A;  5F27 A;  1AU7 A;  1IG7 A;  2FJ1 A;  3S16 J;  3HEF A;  3OSF A;  1JUS A;  2TCT A;  2YS9 A;  1B72 B;  1TWH J;  4X1E A;  3HIM A;  2CUF A;  2Y31 A;  4M3G A;  4QIW N;  4MLO A;  2E1O A;  5EG0 B;  2JMW A;  3FRQ A;  2EH3 A;  3JRH A;  1HLV A;  3S17 J;  2ME6 A;  5C4Y A;  5HSZ A;  3HKZ N;  3CQZ J;  1RR7 A;  2MGQ A;  4CGR A;  1PUF A;  1NK3 P;  2D5V A;  1HDD C;  2DG7 A;  5FKO A;  1A6I A;  3KNW A;  4JYK A;  1MBE A;  3S15 J;  5F0C A;  1X58 A;  4A3C J;  3JRI A;  2DA6 A;  3Q0W A;  2R93 J;  1YRN B;  2XB0 X;  5EFY A;  5GP9 A;  2QTQ A;  3HBL A;  3BCG A;  1Y1V J;  3A02 A;  3W6V A;  5J3L A;  1SFO J;  3RZO J;  2R5Y A;  2E2I J;  5FKK A;  3HOY J;  1AKH A;  1ENH A;  1MBF A;  3E7L A;  4JX4 A;  3EGQ A;  1Z77 A;  3BJB A;  5EGO A;  1F36 A;  4GCT A;  5DTD A;  2AHQ A;  3VOX A;  1MBH A;  4QSH A;  4JX5 A;  2GEN A;  5HAW A;  2L0K A;  3JRD A;  2ZCX A;  3NI7 A;  3HTI A;  2E19 A;  3QPL A;  4J19 A;  3IH2 A;  2G7L A;  4FIS A;  2JJ7 A;  1ZR4 A;  4M3D A;  4S0H B;  4JL3 A;  2DA7 A;  2LVS A;  2NS8 A;  2CU7 A;  5IP9 J;  4ABZ A;  2R7Z J;  1GV5 A;  1IDY A;  3BR2 A;  5EYR A;  1BA5 A;  4DYC A;  1ETO A;  2DA4 A;  3TED A;  3LJL A;  1ETV A;  1JKP C;  3G56 A;  3QKX A;  2M0C A;  4XIC A;  1HDP A;  3BR5 A;  1BJZ A;  4MO7 A;  4V2G A;  2HI3 A;  2HQ5 A;  3FK7 A;  5FKM A;  4A3I J;  3WHC A;  1ITY A;  4M3F A;  2IEK A;  1U8B A;  2DMT A;  4EEF G;  4NEL A;  2XB5 A;  2HYJ A;  5AQC A;  2Y9Z A;  5IP7 J;  1POG A;  2YVE A;  1RES A;  1K83 J;  4BBR J;  5JLX A;  5FGL A;  3S2D J;  3QBM A;  1JKQ C;  1HF0 A;  2X48 A;  3JRF A;  1APL C;  2GFN A;  1H88 C;  1QVT A;  2LLK A;  2XSD C;  4XID A;  1K61 A;  2QF7 A;  3C07 A;  1JTY A;  2IAI A;  1NTC A;  1TWC J;  2COB A;  3NNR A;  3HOU J;  1JJ6 C;  2DN0 A;  1U9O A;  2LY9 A;  4NDL A;  2K9N A;  3KKC A;  3HOZ J;  2GLO A;  2G0E A;  2V57 A;  4XRM A;  1UHS A;  4D5C A;  2WV1 A;  1JKO C;  2NVT J;  1EF4 A;  1T33 A;  4V2F A;  2GM4 A;  3G1M A;  4IHV A;  4I76 A;  3B6A A;  3HTA A;  5FLM J;  3HOW J;  2H1K A;  5K7H A;  1PUF B;  4GFK A;  2JA5 J;  3NAR A;  2P81 A;  1GUU A;  4MIM A;  3JRA A;  2VUM J;  2IU5 A;  1MSE C;  3FK6 A;  1NK2 P;  3NAU A;  3GTQ J;  2K40 A;  1LE8 A;  2ID3 A;  2OF7 A;  2HOT A;  3MKL A;  2JA6 J;  3GEU A;  2GBY A;  3I4M J;  3VW1 A;  4A69 C;  4IHX A;  3GTO J;  2ZOY A;  1JUM A;  2EZI A;  4FCY A;  3CDL A;  3K2A A;  2HDD A;  1FTZ A;  3ZQF A;  2R5Y B;  2OI8 A;  1LFB A;  2CJJ A;  4XK4 A;  2X6O A;  4ACI A;  1B8I B;  4IEJ A;  1OCT C;  1I3Q J;  5DS9 A;  3O60 A;  5HBU A;  3Q0U A;  1ZGW A;  4AF5 A;  5IPA A;  1E3O C;  3ON4 A;  4UUT A;  5IOY A;  2WB1 N;  4GFL A;  3CJD A;  4A3J J;  1MSF C;  3HTH A;  2YUS A;  4W1U A;  3V78 A;  3S5R A;  2HOA A;  4BBS J;  1MBG A;  1U9N A;  1JT6 A;  3F0C A;  3JR9 A;  3LNQ A;  3SJM A;  1UMQ A;  4DZJ A;  5F1J A;  2MSY A;  4ME9 A;  2G7S A;  5C3E J;  4BXX J;  1QVU A;  5BNG A;  3TW7 A;  3AQS A;  4GCL A;  3GTM J;  2Y30 A;  3GZI A;  4D7N A;  2CUE A;  1SGM A;  2PZ9 A;  1FJL A;  2UXH A;  1ETX A;  5DAJ A;  4B1R A;  4CYC B;  1ETK A;  1ZR2 A;  3KZ9 A;  5E3L A;  5EEA A;  4A3F J;  2HYT A;  5F04 A;  5CXI A;  3BQY A;  2W48 A;  3K7A J;  4MFD A;  2GUH A;  1ZQ3 P;  2NP3 A;  3G7R A;  4Y52 J;  1OCP A;  1P7J A;  3BG9 A;  3A01 A;  4A3K J;  5FJ8 J;  2LTP A;  2XPW A;  3PO2 J;  3AQT A;  1P7I A;  2M2E A;  3LOC A;  3ZOB A;  3ZQG A;  3VP5 A;  2R5Z A;  1AHD P;  2O7O A;  1ORK A;  5M5W J;  1WGX A;  2NVY J;  3LSG A;  1MH4 A;  3S14 J;  5JLW A;  3HB9 A;  5M5X J;  3S1N J;  1R9T J;  2R92 J;  5M3M J;  1XS9 A;  1BL0 A;  2EQR A;  2HKU A;  3VW0 A;  3G1L A;  3Q3S A;  2NVX J;  2O9L A;  2L7Z A;  1X2N A;  5E3O A;  2ELK A;  1IJW C;  3VW2 A;  2L7F P;  1ZKG A;  4X6A J;  2K9S A;  1ETQ A;  4MXM A;  1I50 J;  2HOS A;  2WAQ N;  2FQ4 A;  2L7M P;  4B3A A;  4D5F A;  4RDU A;  1W0T A;  3VVZ A;  3B81 A;  3DPJ A;  5FHP A;  2W53 A;  2LKX A;  2XRL A;  3E7Q A;  2RHA A;  3RQI A;  2DG8 A;  9ANT A;  3HGY A;  1WCM J;  1JKR C;  3IH3 A;  3VPR A;  5D1R A;  2DMN A;  2ZOZ A;  1GDT A;  4GCK A;  1VF9 A;  1QRY A;  2RAS A;  1B72 A;  1IRZ A;  4FE4 A;  1ETW A;  3O8G A;  5EG0 A;  5EZH A;  3GTG J;  3IV5 A;  2NS7 A;  4D7M A;  2KDZ A;  2DA1 A;  1F43 A;  3RH2 A;  4A3L J;  3DEW A;  4UUS A;  2Y0S N;  4PXI A;  3B6C A;  5EDN A;  5E3N A;  2M8G X;  2TRT A;  2WGB A;  5IP6 A;  4JKZ A;  4M3E A;  1YRN A;  2NX4 A;  1VI0 A;  3PO3 J;  2XDN A;  5FMP A;  1D5Y A;  3NPI A;  2DJN A;  2HXI A;  1MBJ A;  5IYD J;  3KKD A;  3ZQI A;  3OIO A;  2PBX A;  2O7T A;  4B4C A;  3DCF A;  5IOZ A;  3ANG A;  1RKT A;  5K7F A;  4RBO A;  3FIW A;  3OSG A;  2E2J J;  1JUP A;  2EBI A;  3CCY A;  3BTL A;  4IHY A;  1RKW A;  3VUQ A;  2NVQ J;  2M9H A;  3FIS A;  4A3B J;  3ON2 A;  2ECB A;  3BR1 A;  4A3G J;  1ZK8 A;  3IUV A;  2LFB A;  3A01 B;  3BTJ A;  3A03 A;  2LR8 A;  2CRG A;  4Y7N J;  2O8K A;  1UI6 A;  3Q0V A;  2G7G A;  3OOU A;  3JRB A;  1TWG J;  1AKH B;  4YZE A;  5J1U A;  3GBG A;  3JSJ A;  5EGO B;  2R5Z B;  3PAS A;  2H8R A;  1UG2 A;  1VFC A;  3HGG A;  4DYR A;  2AO9 A;  2OPT A;  3CWR A;  2L9R A;  2MW8 A;  4MK6 A;  3G1O A;  3HTJ A;  1H8A C;  1UI5 A;  1BW6 A;  5FKN A;  5HOD A;  1RET A;  2FX0 A;  2XGC A;  2D6Y A;  3IH4 A;  4BY1 J;  1A5J A;  2QKO A;  5E3M A;  2DMP A;  2UXO A;  2NP5 A;  3GTK J;  2ZCN A;  1OJL A;  1IC8 A;  4A3E J;  3S1Q J;  2QOP A;  3VOK A;  2M34 A;  2K9Q A;  3LHQ A;  1G2H A;  4KWA A;  2JWT A;  5K7Z A;  3HOV J;  5GPA A;  2OER A;  1W0U A;  4BKX A;  4LOC A;  2DA2 A;  3BT9 A;  3S1R J;  4AYB N;  1IV6 A;  4JNN A;  1OFC X;  4I6Z A;  3RZD J;  5F0F A;  5D19 A;  3BG5 A;  4C3I J;  4XRS G;  1GV2 A;  2FD5 A;  3VVX A;  3JRG A;  3ZQH A;  3VIB A;  2IBD A;  2MG4 A;  1JGG A;  1IUF A;  2NOG A;  1WI3 A;  1JTX A;  2ZCM A;  1Y1W J;  2YU9 J;  3CMY A;  1FIA A;  4M3B A;  3BNI A;  5IYB J;  4HNV A;  2G3B A;  4NN1 A;  1T56 A;  4UUS B;  1MNM C;  3BR3 A;  1ZTR A;  4L5E A;  1DU0 A;  3ZQC A;  1JJ8 C;  1RPW A;  1MBK A;  5F08 A;  2JA8 J;  2PMZ N;  5EF6 A;  5F0H A;  3GTJ J;  3QPS A;  4BY7 J;  1JT0 A;  4FTH A;  3BHQ A;  3RD3 A;  3T6N A;  4MFE A;  1Q1V A;  2ZB9 A;  5M5Y J;  1FTT A;  4IHW A;  5CXG A;  5CW8 A;  2XGE A;  2N8G A;  2EZL A;  2LK2 A;  3HE0 A;  1B8I A;  3SFI A;  1TWA J;  3HOX J;  3BQZ A;  3LSP A;  5IYC J;  3JRE A;  1GVD A;  3BR0 A;  1LE8 B;  4A93 J;  3BTC A;  4G12 A;  3H3V K;  2VI6 A;  3V6G A;  4JP0 A;  2EZK A;  2RAE A;  2ECC A;  5J1R A;  3LSJ A;  3QQA A;  4ICH A;  4HKU A;  3I4N J;  2EZH A;  4GFB A;  2R0Q C;  1I6H J;  3EUP A;  3TP0 A;  3P9T A;  4DW6 A;  1HCR A;  1WH5 A;  2DTZ A;  2FBQ A;  3H0G J;  1X2M A;  4FE7 A;  3NRG A;  3WHB A;  5EZG A;  2VKV A;  1TC3 C;  4A3D J;  5H9T A;  3TP3 A;  4AUX A;  2UXI A;  2YVH A;  1O4X A;  2CQQ A;  2VPR A;  4CYC A;  5C44 J;  3F1B A;  2VKE A;  2XGD A;  3M4O J;  3FKI J;  4UDS A;  3O8H A;  1H89 C;  4DZP A;  4W97 A;  1WH7 A;  1IDZ A;  3GTL J;  1LFU P;  3LWJ A;  1GT0 C;  1WPK A;  3PM1 A;  3MNL A;  4AC0 A;  2Y9Y A;  3MVP A;  2ME0 A;  3BG3 A;  4DYQ A;  1DU6 A;  1XC5 A;  1TWF J;  3HM5 A;  1U78 A;  2LD5 A;  2DA3 A;  2F07 A;  2DMU A;  2B63 J;  2QIB A;  2E2H J;  3CRJ A;  2KT0 A;  3ANP A;  3NXC A;  2HXO A;  1CQT A;  3LSR A;  4C3J J;  2JN6 A;  1FIP A;  3M3Y J;  5FKL A;  1HOM A;  3S1M J;  2REK A;  2Q24 A;  3UKG A;  5K58 A;  3MN2 A;  2Y2Z A;  3ZQL A;  3S2H J;  2JA7 J;  5FLV A;  2WUI A;  4AC6 A;  2XPV A;  4A3M J;  3BRU A;  1S7E A;  1Z0X A;  2DMQ A;  3RKQ A;  2QWT A;  3VVY A;  2CQX A;  4QTR A;  1MH3 A;  3D1N I;  1ETY A;  1SAN A;  2ID6 A;  2QCO A;  1VND A;  3SDG A;  1QPI A;  5C4X J;  1FEX A;  1IGN A;  2X9D A;  3HDD A;  2XPU A;  4L62 A;  3JRC A;  2DA5 A;  2UXU A;  3L1P A;  2I10 A;  2JK3 A;  5M3F J;  3C2B A;  3BTI A;  5GPC A;  4C2M J;  4JX6 A;  2LP0 A;  3COL A;  5D18 A; 
#chains in the Genus database with same CATH topology
 1FYM A;  4BGD A;  4C3H J;  4E7S A;  4RB2 C;  2IGM A;  4XRS A;  1D1A A;  1R4M B;  4IF4 A;  3BR6 A;  5B1A H;  3PPB A;  5F27 A;  3HEF A;  3OSF A;  1QHH D;  4IRG A;  5FLX Z;  2DYS H;  1B72 B;  2CUF A;  5AIP A;  4MLO A;  2DK8 A;  2EH3 A;  3S17 J;  5DYM A;  1LKX A;  2E71 A;  3FM5 A;  1HDD C;  2V9K A;  2DG7 A;  3K9T A;  5J4Y A;  5FKO A;  3JTH A;  4IOC F;  3KNW A;  1P4W A;  2A61 A;  4L9J A;  1WJA A;  4A3C J;  2DA6 A;  2ZJR F;  2R93 J;  2UZK A;  3N97 A;  4CH7 A;  4CCO A;  2PJR A;  1TQM A;  3A02 A;  3DPL C;  1X3U A;  2EV0 A;  4LLG F;  1PVE A;  3PSI A;  5HDN A;  2YPR A;  1DP7 P;  5FKK A;  4L0Y B;  1OIS A;  1MBF A;  4JX4 A;  3BJB A;  4GCT A;  2LY1 A;  4OIR F;  4QSH A;  2GEN A;  5HAW A;  3KYL A;  2H09 A;  3BJA A;  3T8R A;  2DOD A;  1VQ8 I;  3HTI A;  2HS5 A;  5J4V A;  3QPL A;  1R71 A;  3WTX C;  2D2W A;  5IP9 J;  1TTY A;  2K3F A;  4BHC A;  3KX2 A;  1KU3 A;  4GRI A;  2DA4 A;  4F93 B;  3LJL A;  5HDG A;  2EWN A;  2H6B A;  1LFP A;  2V6C A;  3G56 A;  4XSZ F;  3PIO F;  2ZNZ A;  3ZQ7 A;  4XIC A;  1ACI A;  1D0Z A;  4Q5S F;  1ERD A;  3IRR A;  4A3I J;  3WHC A;  1J0R A;  3ECH A;  1WJE A;  3FWE A;  2KIS A;  1U8B A;  1FSH A;  1YO5 C;  1S7A A;  2JSP A;  3K4B A;  1E17 A;  1K83 J;  1RES A;  5ILS A;  3IWF A;  1LNW A;  1IXC A;  1XMA A;  5DUI A;  3J7A Y;  2X48 A;  3R0A A;  3VYS B;  2HVQ A;  1VQK I;  1APL C;  2OA4 A;  3SWH A;  2XSD C;  4XID A;  3C07 A;  4KIB A;  2IAI A;  2W84 A;  1ZYR F;  2R7V A;  2COB A;  4YFN F;  4RB0 A;  3I59 B;  4LK0 F;  3CO7 C;  4B09 A;  5D5X B;  2GLO A;  5FRN A;  5BS6 A;  2EA2 A;  3GLL A;  1UHS A;  2WV1 A;  3QOD A;  1T33 A;  2ADU A;  3N4M A;  3Q9S A;  1TNS A;  3MAJ A;  4YFX F;  4I76 A;  2E1M C;  2K86 A;  3HOW J;  3H9Q A;  5GAE J;  3NAR A;  1GUU A;  3JRA A;  3ZPL A;  2VUM J;  1NK2 P;  4ESJ A;  2HVS A;  1B6A A;  3PNV A;  2CS3 A;  1XGM A;  4M6X A;  2H8W A;  5H2F C;  1PP7 U;  2JA6 J;  3FXK A;  1SAU A;  3I4M J;  3VW1 A;  1NHA A;  4B43 A;  2ZOY A;  3BC8 A;  3MD2 A;  2HDD A;  1FTZ A;  3CC7 I;  1Z7U A;  2R5Y B;  1KYW A;  3EDP A;  3H5N A;  5TRD A;  1L3L A;  3WTY C;  2Y48 A;  2RC4 A;  4AVP A;  2L4M A;  3O60 A;  5HBU A;  1V54 H;  2VJI A;  5IPA A;  4RS8 A;  4UUT A;  4C30 A;  4GFL A;  3CJD A;  3SXY A;  3J80 K;  3KP2 A;  3CD6 I;  2LC2 A;  1XB4 A;  2HOA A;  2P0W A;  3GUD A;  4BBS J;  3ASO H;  1C0W A;  1WWX A;  4CYD A;  3ABT A;  2XV4 S;  3SJM A;  2JUG A;  1UMQ A;  1HC8 A;  2QVO A;  2QYO A;  3BZC A;  1WSU A;  2WAQ A;  1Z1D A;  1J7K A;  4YIR X;  1MJA A;  1LPQ A;  2Y30 A;  3LA2 A;  1BIA A;  3HRT A;  2KQR A;  5DAJ A;  1ETK A;  4WWC A;  1W5C C;  4P9F A;  5E3L A;  1D5V A;  1FYK A;  1KGS A;  1MNE A;  3LMM A;  2Z1D A;  3QOP A;  1OCP A;  3REO A;  3PFY A;  4ZZD A;  3A01 A;  4A3K J;  4PUS A;  4EJV A;  2QSH X;  2XPW A;  1BM9 A;  1QQI A;  2JZY A;  2WTE A;  3RPU A;  5JVG F;  1P7I A;  1MMD A;  3VP5 A;  2PQ8 A;  1ORK A;  3TOB A;  2NVY J;  1MH4 A;  2VQG A;  2LBF A;  4A12 A;  2ZJP F;  3DKX A;  5JLW A;  5ILV A;  2WY8 Q;  5M5X J;  5EJC A;  2B7E A;  3FZV A;  2EV5 A;  2DLL A;  5M3M J;  1LEA A;  4HF2 A;  2EQR A;  2M30 A;  2M4K A;  1RNL A;  2VB6 A;  3VW0 A;  2DFH A;  1LVA A;  4RB3 C;  4ZYA A;  3SHF A;  1R1V A;  1R49 A;  3MQ0 A;  5E3O A;  2EPF A;  1IJW C;  2GWR A;  1PP8 F;  2WV0 A;  2K9S A;  4MXM A;  2R7F A;  2E5N A;  3IAS 2;  4RB1 A;  2PG4 A;  2WY7 Q;  1W0T A;  4O3M A;  2A3S A;  2V1X A;  2FU4 A;  4LG0 B;  2CO5 A;  3T0Y A;  3B81 A;  2XAS A;  5ED4 A;  2V6E A;  4LB5 A;  2LKX A;  2W53 A;  3P7N A;  4QPO A;  2A5Y B;  5CVU A;  2DFI A;  2L9N A;  3IH3 A;  3VPR A;  5GAD J;  1SD4 A;  1W5S A;  2V79 A;  1VF9 A;  1SD7 A;  2FMY A;  3KE2 A;  2Z2S B;  4Q48 A;  1HKQ A;  3L2Q A;  3O8G A;  1FOK A;  4ESF A;  4I01 A;  2KZV A;  3IV5 A;  3PJR A;  3GTG J;  1ZN2 A;  1OPC A;  3FHN A;  5HNF A;  4A3L J;  2EIL H;  4ENJ A;  2R7Q A;  2V26 A;  3B6C A;  5E3N A;  4BHP A;  1AA7 A;  5FMP A;  2XDN A;  5HVQ C;  1V3F A;  2HWV A;  1LQ1 A;  4PSW A;  2DTR A;  1FC3 A;  1R1U A;  3TO9 A;  3HL2 A;  2HPM A;  5D5V B;  1G3S A;  3NPI A;  2PBX A;  4E7J A;  1OYW A;  1Y56 A;  3QPH A;  1RKT A;  1D1B A;  1HW2 A;  2VJJ A;  2EBI A;  4IHY A;  2M87 A;  1FBS A;  4KN4 X;  1CGP A;  1KQ0 A;  2J5O A;  2LH9 A;  3BR1 A;  3I53 A;  5D8K B;  3IUV A;  2HZT A;  5E1Z B;  4HX8 A;  4E4H A;  3SDB A;  3HRU A;  3FHZ A;  3A03 A;  3N05 A;  2LR8 A;  3LSK A;  2CYY A;  2G7G A;  3OOU A;  2EFP A;  4OOI A;  4UV9 A;  2MBF A;  1AKH B;  4YZE A;  1WJD A;  5J1U A;  2VBW A;  3LSH A;  3G71 I;  5EGO B;  5KCM A;  2R5Z B;  4BQA A;  4DQ2 A;  3MZH A;  1R5G A;  3BJO A;  3CMM A;  4M72 A;  1J75 A;  4ENM A;  5CVV A;  2OPT A;  2L9R A;  2R7S A;  4NC6 A;  3HTJ A;  2ZME C;  1UI5 A;  4ZDP A;  2R7R A;  2XGC A;  3C2H A;  5CYV A;  2D6Y A;  2UXO A;  3VVZ A;  2ZCN A;  4MQ9 F;  3HHH A;  1OJL A;  1IC8 A;  1Z67 A;  3VOK A;  2L3D A;  2M34 A;  1G2H A;  2JWT A;  1VQP I;  5HLI A;  4E7L A;  2PMU A;  1W0U A;  4BKX A;  2BHZ A;  1W36 D;  1K7A A;  3WU2 C;  5LEK A;  4AYB N;  1IV6 A;  1OFC X;  5F0F A;  4B48 A;  1V4R A;  3BG5 A;  4C3I J;  1DPR A;  3VVX A;  1D0Y A;  3JRG A;  1QO0 D;  3M7G A;  3ZQH A;  3VIB A;  2L5Q A;  3A0B C;  3CDH A;  2ZCM A;  2QBY B;  2OQR A;  2Q1Z B;  2YU9 J;  3B02 A;  4Y17 A;  3BNI A;  1O3R A;  1DPU A;  2A69 F;  1HQC A;  3K4N A;  1CF7 B;  1ZG5 A;  4HOB A;  3BR3 A;  4L5E A;  1DU0 A;  4BS9 A;  1JJ8 C;  2E5Z A;  1MBK A;  3L00 A;  2HYF A;  2R3S A;  5GAG J;  5F08 A;  4DGW B;  3RPQ A;  3QYE A;  4HEA 2;  5AON A;  2F6C A;  3I71 A;  4NC8 A;  3T6N A;  3F6V A;  3ZMZ A;  1GLN A;  3RD3 A;  4MFE A;  1Q1V A;  3VUQ A;  5IY5 H;  4M73 A;  1NH3 A;  4CDG A;  5L3F A;  2HNH A;  3DLL F;  5E79 C;  4XON A;  2FXA A;  3HOX J;  2RDP A;  1OKR A;  3LSP A;  3VTI A;  1Z6T A;  1GVD A;  1LE8 B;  4G12 A;  2ZXW H;  3J7Y J;  4XLF A;  1HKS A;  2ECC A;  5J1R A;  5TGT A;  4ICH A;  2PFB A;  4Y33 A;  1FYL A;  3CF5 F;  1KQ9 A;  2KP6 A;  4AIK A;  1MMS A;  2P6S A;  4DW6 A;  1BOB A;  1SEU A;  1YE9 A;  2FBQ A;  4XKC A;  1A36 A;  1VQ4 I;  3ZN0 A;  1HBX G;  1VQ6 I;  2VKV A;  2QGU A;  4RAF A;  4D9J A;  4A3D J;  2EA4 A;  3HYI A;  1LVK A;  3R60 A;  3TP3 A;  4AUX A;  3FMQ A;  4IO9 F;  2YVH A;  2FNA A;  3P5J A;  4CYC A;  2DDB A;  1TT0 A;  3F1B A;  2VKE A;  2O0Y A;  3M4O J;  2FOW A;  3TOA A;  4UDS A;  1SFU A;  1QPM A;  1TNT A;  2ICW G;  4DZP A;  4W97 A;  3GFM A;  1LFU P;  1SFX A;  4GGG A;  3OIP A;  1XGN A;  3OYE A;  5LHG A;  1J59 A;  3MNL A;  1LUJ B;  4AC0 A;  5K5O A;  3NWS A;  3MVP A;  2P6T A;  4DYQ A;  3Q9V A;  1U0J A;  3TGN A;  3BOQ A;  1TWF J;  3J80 Z;  2X6W A;  2F07 A;  2B63 J;  4FET A;  4H4K C;  3FXM A;  3CO6 C;  2XVC A;  1K78 A;  2OQG A;  3M8F A;  2QIB A;  1BN5 A;  3ANP A;  4PCQ A;  3U1K A;  2NNY A;  1MMN A;  4PK4 A;  1M1E B;  3W2A A;  4XR6 A;  1MD0 A;  1TBX A;  3RYP A;  2EFQ A;  3GF2 A;  4YIF A;  1B9N A;  2EFO A;  3V7C A;  3UKG A;  4HF0 A;  3ZQL A;  3S3N A;  4E7H A;  2ZSH B;  3AG1 H;  4I0B A;  3H92 A;  4DIQ A;  2XPV A;  2OTL I;  4CHU A;  2CQX A;  4BHB A;  1MH3 A;  1T08 B;  5B1B H;  2F5E A;  1ZAR A;  3HSF A;  1QPI A;  1WJ5 A;  3HDD A;  2XPU A;  3JRC A;  2PLY A;  1OMI A;  1O57 A;  1IN4 A;  2KFD A;  3ECO A;  3L1P A;  2I10 A;  1QU3 A;  1Y8Q B;  1P4X A;  2BY1 A;  3IWZ A;  2AXL A;  3C2B A;  3QAH A;  2E35 A;  4WF2 A;  3AL0 B;  5GPC A;  4C2M J;  1SMY F;  4CSW A;  4OIP F;  1T6S A;  4XKW A;  3D0S A;  2X1E A;  4UHT A;  2VT2 A;  1VQL I;  2LP0 A;  4G7O F;  3CCU I;  5C4J J;  4HQE A;  2LNB A;  1FMV A;  3GTP J;  1VQ7 I;  2F5F A;  3HRS A;  4HA8 A;  3TW6 A;  4F7Z A;  1BW5 A;  2V7F A;  4RAZ A;  2QQ9 A;  5LEJ A;  3FXJ A;  2CQ7 A;  4QIW N;  3FRQ A;  3HIM A;  1YTY A;  4RM3 A;  2I8D A;  3JRH A;  3JSP A;  5DM7 F;  5DCM B;  5C4Y A;  1W7P B;  3HKZ N;  2MGQ A;  3W3C A;  1PUF A;  1NK3 P;  2LSO A;  3VSK A;  4ZH4 F;  3RYR A;  1A6I A;  3S15 J;  1X58 A;  2BOL A;  2VJ5 A;  1YJW I;  1U5T B;  1YRN B;  1B4A A;  3LQR A;  1SD5 A;  5GP9 A;  5EFY A;  4WK8 F;  3J81 K;  1MMG A;  3RJP A;  4M9S A;  1ZRC A;  1KYZ A;  5J3L A;  3RZO J;  1Y0N A;  3V8J A;  4DNC A;  1YW8 A;  2PJP A;  3EGQ A;  1Z77 A;  5E1W A;  1F36 A;  5L3D A;  2ZXI A;  3H5R A;  4U7D A;  2AHQ A;  1REP C;  3VOX A;  3WTT C;  1A04 A;  2XAU A;  4LJZ F;  2ZCX A;  1HSJ A;  4OMZ A;  3DWL E;  4CCN A;  3I0T A;  4BDZ A;  1VQ9 I;  4MQV A;  3CUQ A;  1G59 A;  2JJ7 A;  3CC4 I;  3BZ6 A;  4S0H B;  4JL3 A;  2XAQ A;  2DA7 A;  2NS8 A;  3HJE A;  1GXP A;  4NNJ A;  5D4R A;  3BR2 A;  3FMS A;  2DCE A;  1ETO A;  2R7D A;  2X51 A;  3EQL F;  3TED A;  3NQO A;  1FY7 A;  4ZTJ A;  3K70 D;  5BMZ A;  4OD4 A;  1Z9C A;  1E2X A;  2ZCW A;  3RIR A;  3F23 A;  4NB5 A;  2FBK A;  3BR5 A;  4A5N A;  1BJZ A;  2HI3 A;  3GFL A;  1ITY A;  2L02 A;  4FQG A;  4M3F A;  5HS8 A;  1SVO A;  1D8J A;  2Z33 A;  3L09 A;  1XDU A;  2XB5 A;  3M8J A;  5AQC A;  2EIK H;  3HUG A;  2NS0 A;  4ZC3 A;  2HQA A;  5BOX A;  5FB2 A;  3CF2 A;  3FXO A;  4HRI A;  3PSF A;  2O61 A;  2MD5 A;  5FGL A;  1VTN C;  4AM3 A;  2WB1 A;  1JKQ C;  1DGR M;  4HX7 A;  4UB8 C;  1HF0 A;  2VON A;  1LDK B;  3CJQ B;  2RKH A;  4HG2 A;  1K4S A;  2M3A A;  3ZP5 A;  2GFN A;  5HLG A;  1H88 C;  1I39 A;  1K61 A;  5GAH J;  5JHU A;  2ZXJ A;  1JTY A;  2HTJ A;  3PUB A;  4FX0 A;  4XOR A;  1O7L A;  3BWG A;  3HOU J;  2M8E A;  4BEH B;  1JJ6 C;  3HXL A;  3OYH A;  3F8F A;  4NDL A;  3IC7 A;  3HOZ J;  1HW1 A;  4KMF A;  2RQP A;  3W2W A;  3JAM K;  5EEH A;  1WZ2 A;  4XRM A;  2F5C A;  4IPA A;  4D5C A;  4IJA A;  4UNO A;  3K8P C;  2E1M B;  4V2F A;  3TO6 A;  3G1M A;  2R4G A;  3M07 A;  4HDU A;  2QM3 A;  3B6A A;  3HTA A;  1B9M A;  3V7R A;  2XHK A;  2IGO A;  2VLA A;  4Q47 A;  3LA7 A;  4NQW A;  2OC6 A;  2K40 A;  3H1C A;  5HOO A;  2ID3 A;  2OF7 A;  2HOT A;  2DDA A;  3MKL A;  2KL4 A;  4XOP A;  4IRV A;  2B3W A;  4C9Y A;  3I64 A;  1UAA A;  1R6R A;  2XGX A;  5A2Q K;  2CWE A;  2YSR A;  2VXZ A;  3K2A A;  4DBR A;  3F8C A;  2X6Y A;  2JPC A;  1LFB A;  2CJJ A;  4ACI A;  2BY2 A;  1OCT C;  3RQ4 A;  2W85 A;  4KN7 X;  4WXD A;  3U1D A;  3K4C A;  4N4O B;  1R4N B;  3JTG A;  3HTH A;  3CJT B;  3V7S A;  4W1U A;  3S5R A;  1JI8 A;  3DPT A;  1MBG A;  1U9N A;  2J5P A;  3JR9 A;  2BY3 A;  3LNQ A;  5F1R A;  2NRA C;  5E17 F;  2VC0 A;  3QWL A;  4XBF A;  3VFZ A;  5F1J A;  3TQN A;  5C3E J;  1DUX C;  3ZMS A;  3COA C;  5JR3 A;  1NG6 A;  3NRV A;  4NUB A;  5BNG A;  3AQS A;  1R00 A;  1BIB A;  1H0M A;  1FJL A;  2UXH A;  2WAF A;  1R5H A;  1RIO H;  2CFX A;  3KLO A;  4B1R A;  1N25 A;  3I9V 2;  4L5J A;  3RCO A;  5HS9 A;  1S6L A;  2KKO A;  5F04 A;  1KA8 A;  4MFD A;  2E7W A;  3CP8 A;  1ZQ3 P;  3CLQ A;  4Y52 J;  2F2E A;  1P7J A;  4XN3 A;  3P9I A;  3ABL H;  3K4L A;  4XLC A;  2RV8 A;  1ZEL A;  2IGN A;  2OV7 A;  3AQT A;  2CMP A;  2Y0S A;  3E5U A;  4M9Z A;  4U87 A;  2LRD A;  4S05 A;  3OR1 C;  1AHD P;  1MIJ A;  3M9A A;  1FZP B;  4L0Z B;  2VJ4 A;  1YFH A;  4MNU A;  1EH7 A;  2DFF A;  1LDJ A;  3ZGK A;  4RGR A;  2YVX A;  3S1N J;  4LMY A;  2FBH A;  3SQN A;  1R9T J;  1QZZ A;  1BL0 A;  2HKU A;  2GA1 A;  4A0Z A;  3MMY B;  1UFM A;  3OOP A;  3Q3S A;  2NVX J;  1PJR A;  5DD8 A;  1IAW A;  2L7Z A;  2DPD A;  1X2N A;  4RAY A;  1U8R A;  3L2C A;  2DOA A;  2WBM A;  3OR2 C;  1ODD A;  1I50 J;  2F5D A;  4B3A A;  1UCR A;  4RDU A;  2FJI 1;  5JHF A;  5GTH C;  2Z5U A;  2CUJ A;  3LAJ A;  5ICF A;  4YFK F;  2G7U A;  2IGK A;  2XRL A;  3RQI A;  4BJ5 C;  9ANT A;  2V1D A;  3HGY A;  1JKR C;  2DG8 A;  2HYG D;  5D1R A;  1K79 A;  2BXZ A;  1QZY A;  2RAS A;  1QRY A;  4Y15 A;  4AVZ A;  4WXC A;  3VEP A;  1B72 A;  4BU2 A;  4JBA A;  4HDV A;  4D7M A;  4M71 A;  1RR8 C;  1ZGJ A;  3HG9 A;  3OYJ A;  4XL9 A;  2W7N A;  4XQF A;  5H6R A;  4UUS A;  4PXI A;  5EDN A;  4XSX F;  2M8G X;  4PGG A;  3OYN A;  1ZGA A;  5IP6 A;  1OLT A;  2HEO A;  4JKZ A;  4M3E A;  4DOZ A;  2JQ7 A;  3QYB A;  2P7V B;  4UV8 A;  1XX5 A;  3ELK A;  1D5Y A;  2V1U A;  3E6M A;  1WJF A;  4KIS A;  4XLP F;  2AS5 F;  3OIO A;  2O7T A;  4HPQ A;  3U9G A;  3SZG A;  3KP7 A;  3ZMV A;  2FOK A;  2H94 A;  3FIW A;  2E7X A;  3BTL A;  4EMS A;  5LFA A;  3K1M A;  1J2X A;  1FX7 A;  2M9H A;  4A3B J;  5CJ9 A;  3V8K A;  1G8X A;  2ECB A;  3IL2 A;  4CCM A;  3S3M A;  1QZE A;  2HKX A;  1TL8 A;  1HW5 A;  2QWW A;  1X4O A;  4O5V A;  4EQQ A;  4ZYE A;  3A01 B;  2QA4 I;  4HNU A;  1YOV B;  1STZ A;  4CO8 A;  3LA3 A;  4F52 A;  2BW3 A;  4LIV A;  4ANJ A;  3DPU A;  5CQG A;  5FD5 A;  2H8R A;  2XUB A;  4BL0 B;  3F8N A;  1I1S A;  3GZ5 A;  2LBF B;  3HPG A;  2F5V A;  3ML6 A;  2C6Y A;  2ZME B;  2MW8 A;  2FUG 2;  3G1O A;  3CDI A;  4PFP A;  1GHC A;  1SVM A;  2LRE A;  5FKN A;  5HOD A;  2GA2 A;  1W7P D;  2P4W A;  3S3O A;  4KYW A;  3OIQ A;  3S2W A;  3IH4 A;  4BY1 J;  1A5J A;  2QKO A;  2DMP A;  5BPD A;  3A2K A;  3CCQ I;  2X1D A;  2P5K A;  4KWA A;  3V42 A;  1WVR A;  4V19 K;  2MLG A;  1XCB A;  4OIQ F;  1P2F A;  5LRR A;  2VOP A;  1J9I A;  3HIF A;  4LOC A;  2DA2 A;  2YR2 A;  2EV6 A;  2KZG A;  2IA1 A;  2XF5 A;  3BT9 A;  1B59 A;  3MWM A;  3S1R J;  2STT A;  2FEZ A;  3EUK L;  2XAF A;  3A4C A;  4JNN A;  2M5W A;  1IRX A;  3I59 A;  5D19 A;  4RGS A;  5FRO A;  2CG4 A;  4A6D A;  1OCR H;  4OAZ A;  3PUF A;  2NNN A;  4A2U A;  2YU3 A;  2IBD A;  3HSR A;  3I54 A;  3W6J B;  1JGG A;  3S32 A;  2NOG A;  1WI3 A;  1FBQ A;  1JTX A;  1YQA A;  1FIA A;  4M3B A;  1R36 A;  1JHF A;  2HTS A;  2GIZ A;  4HNV A;  3EUA A;  1T56 A;  4XN0 A;  4AD9 A;  5B3S H;  1MNM C;  1ZTR A;  5FO5 A;  3DU5 A;  4CIC A;  4D0P A;  5LLQ A;  1ONV A;  3OYF A;  5IT9 K;  5KK1 A;  1FOW A;  1BR4 A;  2JA8 J;  3OYA A;  2PMZ N;  3LL7 A;  4IXA A;  2ZJ2 A;  5EF6 A;  4RMN A;  2DAO A;  2DJI A;  4PJN A;  1JT0 A;  3BHQ A;  2OJE D;  2ZB9 A;  5M5Y J;  1FTT A;  1P4A A;  4EJU A;  2E60 A;  1FT9 A;  1G3T A;  2DFE A;  3IKT A;  4IHW A;  5CXG A;  1Y39 A;  2N8G A;  3LSI A;  3RDI A;  4YRV A;  3OYI A;  2R7X A;  2W57 A;  3WG9 A;  3OYB A;  5HNH A;  5GTI C;  4A93 J;  1ZHF A;  2VI6 A;  1YIT I;  4BJT A;  3ONQ A;  2A5W A;  1S8N A;  2RAE A;  3U21 A;  3KPH A;  2LDU A;  4LG3 A;  3RKY A;  2EZH A;  3K10 A;  3NWT A;  1I6H J;  2OZU A;  2IA2 A;  3TP0 A;  2CGP A;  4ASN A;  5L3E A;  2ZFW A;  2YX7 A;  3NRG A;  3WHB A;  2GQQ A;  3I4P A;  1MJB A;  1OQY A;  4BDY A;  1F1Z A;  1V5G A;  2ESN A;  3KP6 A;  2P8T A;  1R22 A;  4ETS A;  4N4N B;  1TLH B;  2CQQ A;  5C44 J;  4FX4 A;  3I5U A;  2HDC A;  1GVJ A;  3FX3 A;  1EKE A;  3FKI J;  2LY2 A;  3FM3 A;  1Z6R A;  2IXS A;  1H89 C;  3ABK H;  1WH7 A;  1IDZ A;  4EJO A;  1IRF A;  3GFJ A;  1WPK A;  3AG2 H;  3QU3 A;  4BE1 A;  3X2Q H;  3DTK A;  4HSR A;  3ISP A;  3BG3 A;  4GYI A;  5LRS A;  1XC5 A;  4WIB A;  2F4O B;  3ZN1 A;  2EFW A;  2B0L A;  2E2H J;  4DJA A;  4NBQ A;  1NG7 A;  3DEU A;  2OCE A;  2ZXH A;  3K2Z A;  1CQT A;  3VB2 A;  4BQN A;  3AG3 H;  4C3J J;  2OUM A;  3FF5 A;  3LST A;  3M3Y J;  2IS1 A;  3BY6 A;  4AU7 A;  1XSD A;  3GW2 A;  2REK A;  1E3P A;  4CZC A;  5K58 A;  2Y2Z A;  4YEJ A;  2LOO A;  3GVA A;  5FLV A;  1ZRE A;  2JA7 J;  2XDV A;  1S7E A;  1Z0X A;  3ZMT A;  3RKQ A;  1QBJ A;  3VVY A;  4HLY A;  3FXL A;  3D1N I;  2IA0 A;  5C4X J;  5LGN A;  1ULY A;  2Y75 A;  3M1E A;  4ENN A;  1IGN A;  3R4K A;  3K1P A;  3RSN A;  1QGP A;  4MHG A;  4EGZ A;  3CCM I;  3G2B A;  3MFK A;  3OMY A;  3KFW X;  1HXD A;  3OYK A;  4EJW A;  3HOT A;  3BTI A;  4BE0 A;  2CH0 A;  3S8P A;  2XSJ C;  5J8C A;  5D18 A;  3HSE A;  3NS4 A;  1B1B A;  1IUY A;  2PFV A;  2M45 A;  3CCV I;  2UXP A;  1BI3 A;  5J1Y A;  2WC2 A;  1G4D A;  2E36 A;  1JXS A;  4BJ6 C;  3CJR B;  2TCT A;  1X4P A;  2YS9 A;  4F92 B;  2Y31 A;  4M3G A;  2FA5 A;  5DV5 A;  5EG0 B;  4IQJ A;  2BZT A;  2JMW A;  3IHU A;  2A2F X;  1XDS A;  2Y69 H;  2ME6 A;  1WRJ A;  5HSZ A;  2AQE A;  4B8X A;  1WJC A;  2LKP A;  3CQZ J;  2HPI A;  2K27 A;  4IL6 C;  1UZC A;  4C2M A;  4JYK A;  1MBE A;  5TJJ A;  1UB9 A;  3PQK A;  4GDF A;  1TQP A;  2LMD A;  2RGV A;  3JRI A;  4I7H A;  3Q0W A;  2VQL A;  2FML A;  2V9V A;  2XB0 X;  3GCM A;  3SEQ A;  4D1Q A;  4G6T B;  2QTQ A;  2MYS A;  4J00 A;  2K5C A;  1IN7 A;  3PNY A;  2ELH A;  1SFO J;  2VL8 A;  3WTZ A;  3P9K A;  3HOY J;  3GWZ A;  3K4M A;  3W6K B;  1AKH A;  4S04 A;  1ENH A;  1FPQ A;  3GYH X;  5EGO A;  2O5R A;  2DK5 A;  5AIQ A;  4JX5 A;  2FRH A;  3JRD A;  3NI7 A;  5HLT A;  1K78 B;  4JOM A;  4XLH A;  3DBL B;  4E6K G;  1W4M A;  1F4K A;  4J19 A;  1MKM A;  4FIS A;  3VWB A;  2A68 F;  2RRE A;  1VQN I;  2LVS A;  2CU7 A;  1IXR C;  4ABZ A;  3KZY A;  1GV5 A;  4PJ0 C;  3KEQ A;  1BA5 A;  5K1Y A;  1SFK A;  3DFG A;  5FLX K;  4MTD A;  3CJN A;  1ETV A;  5ICG A;  1HKT A;  4KIF A;  2OZ6 A;  4HBL A;  4OWR B;  2JA2 A;  4XRF A;  4MO7 A;  4V2G A;  5FKM A;  3KP5 A;  3FK7 A;  2HR3 A;  1Z91 A;  2JUC A;  4EAT A;  3HTU A;  3KLN A;  5DEQ A;  2ESH A;  2EIM H;  4PJL A;  5TIS C;  2IEK A;  1QA6 A;  4Z2Y A;  1MDM B;  2HGC A;  2ZJQ F;  2LF7 A;  4EEF G;  2HU9 A;  4F55 A;  2HYJ A;  2PBI A;  2GOM A;  3H9G A;  3QP5 A;  4E70 A;  5D5W B;  4N9H A;  5IP7 J;  1POG A;  4G7Z F;  3QU6 A;  4BBR J;  2UV1 A;  5JLX A;  3S2D J;  5CQE A;  1DGW Y;  4K2E A;  5JVT A;  3DF8 A;  4QWQ A;  1PDN C;  2QBY A;  1VQO I;  1QVT A;  4IKF A;  1OCO H;  4GCV A;  4J01 A;  1NTC A;  1RUO A;  3NNR A;  2ZBK A;  2LY9 A;  3MZY A;  1N75 A;  4L5I A;  2OAZ A;  1SAX A;  4IHS A;  2G0E A;  3RPU D;  1SVL A;  3AKZ A;  3FMR A;  1JKO C;  4OAY A;  2NVT J;  4EM0 B;  2XAG A;  5EEG A;  2GM4 A;  4IHV A;  4ZTF A;  5FLM J;  1U2W A;  3WTW C;  2X85 A;  1XD7 A;  3KCC A;  1PUF B;  2JA5 J;  3GEZ A;  3OYC A;  3KIO A;  4I2O A;  1MSE C;  3OYG A;  3BG7 A;  3NAU A;  2VOD A;  3WE2 A;  3RKW A;  1ZRD A;  4I0A A;  1LE8 A;  2X6X A;  3GEU A;  3I58 A;  3G73 A;  3TMO A;  1E0E A;  4A69 C;  3CC2 I;  3GTO J;  1JUM A;  2EZI A;  5L3C A;  3CDL A;  1H9T A;  2KPM A;  1VZ0 A;  1A31 A;  1UJ8 A;  2BYV E;  3ZMU A;  1T2K A;  1BOA A;  4XK4 A;  2X6O A;  1B8I B;  4IEJ A;  1I3Q J;  3RI4 A;  5DS9 A;  2G7H A;  4HV6 A;  1ZGW A;  3K4J A;  1FBU A;  1FSE A;  4IX7 A;  1X1A A;  3ON4 A;  5IOY A;  2R7T A;  4LGW A;  3DKW A;  3FXQ A;  4A3J J;  1IN6 A;  3F6O A;  4RLF A;  3V78 A;  1LB2 A;  4YII A;  4AIH A;  3MCZ A;  3RKX A;  1JT6 A;  3F0C A;  1BC8 C;  5J8F A;  1KU7 A;  2IT0 A;  4WCG A;  2Z16 A;  1QVU A;  4B44 A;  1Z21 A;  3TW7 A;  1X1P A;  2DBB A;  3ESW B;  2CUE A;  3CUO A;  4D7N A;  1X3Z B;  3IKV A;  2A6E F;  3DU6 A;  2STW A;  3KZ9 A;  2PX9 A;  5CPR B;  4KT6 A;  4AWX B;  5EEA A;  3H36 A;  4A3F J;  2W48 A;  4MEX F;  3T5X A;  2NP3 A;  3G7R A;  4NC7 A;  2LKS A;  3BG9 A;  5HDK A;  5FJ8 J;  1OCZ H;  2ZC2 A;  3TBI A;  4XOT A;  2JVH A;  1F9N A;  4BNC A;  2M2E A;  4Q4Z F;  2KRH A;  3ZOB A;  3ZQG A;  2UWM A;  4WXH A;  4GXO A;  4U0W A;  1WGX A;  2Q2E B;  3EYY A;  3JCU C;  4X0G A;  3LSG A;  4M9X A;  1ZRF A;  2BE5 F;  3C2G A;  1XSX A;  1KU9 A;  3LQQ A;  1RUN A;  2DQR A;  2R92 J;  1YS6 A;  5D6E A;  1IF1 A;  3IRQ A;  4KA4 A;  5ICE A;  3G1L A;  3LFK A;  5BPI A;  2ELK A;  2E34 A;  4IZZ A;  3VW2 A;  1ZKG A;  2L7F P;  3A1Y A;  1ETQ A;  2KRF A;  2WAQ N;  2FQ4 A;  2QQB A;  4HQM A;  4D5F A;  2K02 A;  5B5E C;  3FBI B;  3DPJ A;  2LYC A;  5FHP A;  2FNP A;  1S9H A;  2MD0 A;  2WWY A;  3F9K A;  4KIG A;  4II3 A;  4ON0 A;  3VOD A;  4RGU A;  3BRO A;  1H9G A;  2X0L A;  4GCK A;  4C2T A;  4IRH A;  1IRZ A;  3H9J A;  4EVI A;  4OIO F;  2NS7 A;  5DCM A;  1W7P A;  2H27 A;  1ON1 A;  3HTS B;  2I5U A;  1XSV A;  1F43 A;  3RH2 A;  4IVN A;  3FBN B;  3DEW A;  1J5Y A;  4UVA A;  5KVR A;  5KNL A;  1ZAO A;  1RRJ A;  1F5T A;  4BXU A;  2QUF A;  1N78 A;  1IO2 A;  1U5T A;  1YRN A;  5K5R A;  3PL8 A;  2VQH A;  1VI0 A;  3FXR A;  1UHW A;  3SEZ A;  2P5V A;  4XKB A;  1IXS B;  4E7Z A;  2DJN A;  1MBJ A;  4EGY A;  3KKD A;  3ZQI A;  3FKJ A;  1JHH A;  4B4C A;  5IOZ A;  3ANG A;  1MW7 A;  4AYB A;  5K7F A;  3J7A O;  2E2J J;  1R7J A;  4RGX A;  3CCY A;  1R5I D;  2Q8K A;  1RKW A;  3LSM A;  2PMH A;  3GLX A;  3FIS A;  3ON2 A;  1YW9 A;  3LAP A;  1UHM A;  4A3G J;  1ZK8 A;  4O6J A;  3BDD A;  2NYX A;  3BJ6 A;  2PJR B;  4A6E A;  4PGH A;  3ROU A;  3BTJ A;  3D5R C;  5F64 A;  4Y7N J;  3E5Q A;  4BQQ A;  3Q0V A;  1UI6 A;  3F22 A;  3JRB A;  4MEY F;  1TWG J;  4U9L A;  2OCC H;  4L9N A;  2IS2 A;  3GBG A;  3JSJ A;  3DXJ F;  2A05 A;  3MKY B;  3PAS A;  3AG4 H;  1UG2 A;  3UNG C;  1RZ4 A;  3VDX A;  1W5T A;  1VFC A;  3HGG A;  3ABU A;  2AO9 A;  4DYR A;  1KQ8 A;  3DP7 A;  1J09 A;  5B66 C;  2O3F A;  5IT3 A;  3CWR A;  4MK6 A;  2ZY9 A;  3CUQ C;  5LGT A;  1H8A C;  2LG4 A;  2XC7 A;  3Q5F A;  2GOX B;  1EA3 A;  1RET A;  2FX0 A;  4G7H F;  4RM2 A;  5E3M A;  2DT5 A;  2NP5 A;  5DDG A;  3R61 A;  3S1Q J;  3CLO A;  2AQF A;  3LHQ A;  1D0X A;  3E0J B;  5E1X A;  1G3W A;  3HOV J;  1YIJ I;  5GPA A;  3NEU A;  1MJ9 A;  2OER A;  4IQ4 A;  2L4A A;  4HX4 A;  2EIJ H;  2D45 A;  2DI3 A;  2VBY A;  1KU2 A;  4M6Y A;  4BEH A;  1RI7 A;  3RZD J;  4DBQ A;  2JT1 A;  4Y13 A;  2IS4 A;  1Z3Y A;  1BR2 A;  2IRF G;  4EM2 A;  1GV2 A;  2FD5 A;  3GZN B;  2VBX A;  4CCK A;  2O6G E;  3B73 A;  3T8T A;  3CZ6 A;  2E1C A;  1IUF A;  4AID A;  1XGO A;  3DQV C;  1Z3X A;  2OU2 A;  1FNN A;  4KDP A;  3HOS A;  5IYB J;  2G3B A;  3SFZ A;  2L9V A;  3FDY A;  5ILU A;  4UUS B;  2ZKZ A;  4U7B A;  1RPW A;  3JSO A;  5J6X A;  1U5T C;  2BVM A;  3S93 A;  2XF6 A;  2BXY A;  3QYF A;  3WE3 A;  1AWC A;  3GTJ J;  4FTH A;  3C7J A;  3KP3 A;  3K69 A;  4UXN A;  5CW8 A;  3F21 A;  2XGE A;  4KT5 C;  2EZL A;  3VOE A;  1TWA J;  1YLF A;  2VXD A;  3M8E A;  3QOE A;  4OD5 A;  3BQZ A;  5IYC J;  5L3B A;  3BR0 A;  2X4H A;  1BC7 C;  2L9S A;  1DDN A;  1ZLK A;  4LIT A;  3H3V K;  4XNF A;  5DD4 A;  3V6G A;  2JRT A;  5DM6 F;  4BAC A;  3QQA A;  4GFB A;  4KNY A;  2CW8 A;  3HHG A;  2IJL A;  1D3Y A;  3EUP A;  1ZH5 A;  1FMW A;  2PI0 A;  2RNG A;  4KIC A;  2H1L A;  3JW4 A;  1P6R A;  2BW3 B;  1X2M A;  2VC1 A;  4FE7 A;  5EZG A;  3CME I;  3CCS I;  5H9T A;  2HFH A;  2GAU A;  3CCJ I;  3I55 I;  5H20 A;  4BXF A;  4GYG A;  4M74 A;  2FE3 A;  2MAB A;  3DTI A;  2CV2 A;  3M1C A;  2DQL A;  1YJ9 I;  1IW7 F;  3EPZ A;  5LHI A;  4CUG A;  2DT6 A;  2HQR A;  2DOE A;  4BAY A;  1Y0U A;  3O8H A;  4U0V A;  1UG0 A;  4HNT A;  2HOE A;  1SC7 A;  3OYM A;  4A0Y A;  3LWJ A;  2QKM B;  3OWT A;  2L7K A;  2XKO A;  3C1D A;  5H6Q A;  2ISZ A;  4U88 A;  1A6Q A;  4HV5 A;  2P5L C;  2F4M B;  1XMX A;  2DXI A;  1K6Y A;  2KHM A;  5F6F A;  2EFN A;  1U78 A;  3SZP A;  2DA3 A;  4HAM A;  3SZT A;  2DMU A;  3TKY A;  2BGC A;  2JSC A;  2WA0 A;  4PFO A;  5KHD A;  3NXC A;  3SYT A;  2O03 A;  4RLQ A;  4Z6Y A;  3CCR I;  1YS7 A;  2JN6 A;  3HKZ A;  5FKL A;  4LFU A;  5CLS A;  3MN2 A;  5FFX A;  4GO1 A;  3H35 A;  5HS7 A;  3S2H J;  5HLH A;  4AC6 A;  2D1H A;  3H5A A;  1I5Z A;  1UST A;  1T95 A;  3O2P E;  1SAN A;  2ID6 A;  2QCO A;  4B47 A;  1OCC H;  1VND A;  2M0M A;  3BPX A;  3SDG A;  2VT3 A;  3J81 Z;  2BEO A;  1I3A A;  1E3H A;  2FQ3 A;  4L62 A;  2UXU A;  2K3P A;  3WU0 A;  3ZRG A;  2NVU B;  1AOY A;  1S5L C;  1LJ9 A;  3DV8 A;  4Y3O A;  2ACJ A;  2K7L A;  3GME A;  2ETH A;  2KIU A;  1X19 A;  3T1B A;  3COL A;  4XLA A;  3ULQ B;  1U6G A;  1XG1 A;  3E6C C;  2IPQ X;  3QP6 A;  4L9T A;  3DTE A;  1YYV A;  2QEN A;  5E8I A;  4M6V A;  3DLA A;  1AU7 A;  1IG7 A;  3CP2 A;  2FJ1 A;  2IS6 A;  3S16 J;  1JUS A;  2DOF A;  2UXX A;  2Q0O A;  1TWH J;  4R8H A;  4X1E A;  2AXT C;  2KIM A;  2E1O A;  4F3Q A;  2WAE A;  1HLV A;  2WAD A;  3BLY A;  1RR7 A;  4H0E A;  4CGR A;  2D5V A;  4EJT A;  2B9S A;  3O6B B;  4AIJ A;  5F0C A;  4U0Y A;  4KIT B;  2R7U A;  2RNJ A;  3CMA I;  5ERI A;  2YX4 A;  2IW5 A;  1ZLJ A;  1U3E M;  2MA3 A;  4L9V A;  4IOA F;  4ZYG A;  3KYD B;  1W36 C;  3K0L A;  3J7Z I;  3HBL A;  3BCG A;  1Y1V J;  3L2V A;  1MMA A;  4BE2 A;  4U9N A;  3W6V A;  3KEY A;  4P9U A;  3MZ8 A;  2R5Y A;  3TL4 X;  2E2I J;  4HW0 A;  3HPH A;  1SFE A;  3QPT A;  3E7L A;  3F72 A;  3MKZ A;  1XPX A;  1Y6I A;  5DTD A;  2EB7 A;  1MBH A;  1W1W E;  3PQJ A;  2L0K A;  5JFR A;  4ITV A;  5J47 A;  3AFH A;  3K1N A;  2MC3 A;  1YJN I;  2QQ8 A;  2E19 A;  3JAM Z;  3RTR A;  2G7L A;  2ZME A;  3IH2 A;  1K6O A;  1ZR4 A;  1BBY A;  4M3D A;  2VOO A;  2R7Z J;  2M7A A;  1BJA A;  1RC9 A;  5FGM A;  1IDY A;  5EYR A;  4DYC A;  1Z7L A;  2EJR A;  2GIV A;  2Z99 A;  3LFU A;  1JKP C;  1LDD A;  2W24 A;  3BPV A;  5D4S A;  3QRF F;  3QKX A;  2M0C A;  1O7F A;  2VPL A;  4DVY P;  2F4I A;  4P1W A;  1IV8 A;  1S3J A;  1GXQ A;  1HDP A;  1X1C A;  1WJB A;  4IRI A;  1FLI A;  2HQ5 A;  4XLE A;  3BCA A;  2ZSI B;  4LLN A;  2K9M A;  5A2Q Z;  1BI2 A;  1IN8 A;  3VYT B;  1DQU A;  2EIN H;  2DMT A;  4NEL A;  2Y9Z A;  1WQ2 A;  2RVC A;  1Y8R B;  5E20 A;  4BYY A;  4PDK A;  2CQK A;  3F3X A;  3CCE I;  2YVE A;  2Z9O A;  2BV6 A;  2GXB A;  3QBM A;  4TV7 A;  2DU9 A;  3KYC B;  1N77 A;  3JRF A;  3D5S C;  2KJB A;  4R79 A;  4P5O A;  3PFI A;  2LLK A;  1V55 H;  2HDW A;  2QF7 A;  1G3Y A;  1TWC J;  2XRO A;  1WKM A;  2DN0 A;  4N9I A;  1U9O A;  1VQM I;  2K9N A;  3KKC A;  2W82 A;  5ICC A;  1YG2 A;  2D1V A;  2KIF A;  1I6X A;  1ZG3 A;  3IUO A;  3BCB A;  5E8G A;  2P7C B;  2V57 A;  4N0B A;  4UB6 C;  3L2U A;  1EF4 A;  5D5U B;  4HLX A;  2V4J C;  1DP3 A;  4ZDL A;  3G6E I;  1WI9 A;  4ZYH A;  1ZG1 A;  2DPU A;  2JRM A;  2H1K A;  5K7H A;  4GFK A;  2BY0 A;  2P81 A;  4MIM A;  1FOY A;  4R1H A;  2M4G A;  2VAS A;  2IU5 A;  5CVR A;  3FK6 A;  4P55 A;  3WTU C;  3GTQ J;  2R7W A;  1EH6 A;  2X1C A;  1Q1H A;  3HRM A;  1O3S A;  1WFX A;  4LG0 A;  2GBY A;  4IHX A;  3V8L A;  3G4S I;  2O8X A;  4HF1 A;  3GO5 A;  4FCY A;  3U2R A;  3I56 I;  3ZQF A;  2OI8 A;  4JQF A;  3TDU C;  3WGG A;  1BR1 A;  3CES A;  2LF8 A;  2FSW A;  4HYE A;  4I02 A;  3Q0U A;  4AF5 A;  1QHG A;  1X1B A;  4I09 A;  5CVI A;  5FFZ A;  3OS0 A;  1E3O C;  3D5L A;  2A6T A;  2WB1 N;  2VN2 A;  1MSF C;  4EM1 A;  4G8X A;  2YUS A;  3IAM 2;  4FHT A;  5KAF C;  1PYV A;  4E7K A;  2QEX I;  1X3W B;  4A0X A;  1TQI A;  2QQA A;  2JTV A;  2BBY A;  3BP8 A;  1BI0 A;  2MH9 A;  4DZJ A;  4ME9 A;  2MSY A;  2G7S A;  2KMU A;  4BXX J;  2V9P A;  3CCL I;  4GCL A;  3GTM J;  1HA8 A;  3ASN H;  3GZI A;  1SGM A;  2PZ9 A;  2PEX A;  1ETX A;  2W25 A;  3ZR8 X;  1ZR2 A;  4CYC B;  4EV0 A;  2VKH A;  2HYT A;  4XKV A;  5CXI A;  3BQY A;  1YI2 I;  3K7A J;  1WHU A;  2GUH A;  4YEL A;  2CW7 A;  4XM3 A;  3EYI A;  4PZJ A;  2UXN A;  2MFZ A;  3WGI A;  1I27 A;  3MEX A;  2LTP A;  4FAS D;  1JE8 A;  1IRG A;  2PN6 A;  3PO2 J;  2BHY A;  1L0O C;  3LOC A;  4OIN F;  4BUP A;  2R5Z A;  2O7O A;  5M5W J;  2IVM A;  2RN7 A;  4LIU A;  3ABM H;  3L2W A;  3S14 J;  2DW4 A;  3HB9 A;  3I3L A;  1FP1 D;  3OYL A;  1V5F A;  3EUH A;  1XS9 A;  5LGU A;  3KZZ A;  2O9L A;  2H6C A;  3L7W A;  1YW7 A;  4X6A J;  4B3X A;  5LHH A;  2K85 A;  3OS2 A;  2HOS A;  3E5X A;  2L7M P;  4FT8 A;  2MC4 A;  3VYR B;  4XMY A;  2ELJ A;  4G6D A;  2K4J A;  4G9Y A;  1MND A;  3DBR B;  1TT5 B;  1A35 A;  3DKY A;  1G6N A;  3E7Q A;  2RHA A;  3WG7 H;  1WCM J;  3BG6 A;  2L01 A;  2DMN A;  3L9F A;  1GDT A;  1T0F A;  2ZOZ A;  2KLO A;  2XAH A;  3V4G A;  4FE4 A;  1ETW A;  5EG0 A;  4LD5 A;  1EV7 A;  5EZH A;  3OS1 A;  2GZW A;  1ON2 A;  3DBH B;  4UVB A;  3L2R A;  2KDZ A;  3KZI C;  2F48 A;  2DA1 A;  2QKL B;  2W00 A;  5CVJ A;  1CF7 A;  1OYY A;  1SMT A;  3F8B A;  2OD5 A;  4BH9 A;  1OYI A;  2XAJ A;  2HZD A;  2Y0S N;  3H3Z A;  3K70 C;  2A6H F;  3O3K A;  3OV8 A;  4KMU X;  2WGB A;  2TRT A;  5D6F A;  5DCF A;  2NX4 A;  1I1G A;  3PO3 J;  2ZO4 A;  1Z05 A;  5K5Q A;  3PIP F;  1IN5 A;  1D1C A;  4LLL A;  5LD2 C;  4Y4R A;  4C2U A;  4KFC A;  2DT7 B;  5J40 A;  1KZH A;  2DYR H;  4UVC A;  2HXI A;  5IYD J;  2HKO A;  3GZ6 A;  1PUE E;  3DCF A;  4RBO A;  3OSG A;  1JUP A;  2K4B A;  2W1O A;  3R0J A;  2NVQ J;  4MGR A;  2M7B A;  1YIO A;  1MGT A;  3G3Z A;  3E6B A;  1OR7 A;  1S29 A;  3WU1 B;  2LFB A;  2V1N A;  3WGH A;  4CCJ A;  3TO7 A;  3TDZ C;  2GXG A;  2CRG A;  2O8K A;  1XN7 A;  2MLK A;  2NAZ A;  1P9Q C;  2VE9 A;  4HZF A;  2CFO A;  1HST A;  3K6G A;  4YG2 F;  3C3W A;  4KJZ A;  1FWZ A;  5BQT A;  5IT9 Z;  4CZZ A;  4CA0 A;  2KJC A;  2PMZ A;  3F8M A;  4JK1 X;  2NXN B;  3CUQ B;  4RA2 A;  3MKW B;  4HST A;  3H0D A;  1MDM A;  1TZL A;  3EUH C;  2E1N A;  1BW6 A;  2VKD A;  3HC7 A;  1R1T A;  3OL3 A;  2CSO A;  3GXO A;  5DUK A;  4QPQ A;  4ENK A;  3GTK J;  2QSF X;  4A3E J;  2DO7 A;  2QOP A;  2K9Q A;  4WX9 A;  3OYD A;  5K7Z A;  1XTA A;  2JVG A;  1EJ9 A;  3VYU B;  1UEL B;  2FF4 A;  2KRC A;  2NOJ B;  2OBP A;  3WOD F;  3E97 A;  4QLC U;  1SD6 A;  3E6D A;  2K9L A;  3OY9 A;  2HQN A;  4A5M A;  4I6Z A;  3P9C A;  3HUG B;  4XRS G;  1KON A;  4LK1 F;  3UR3 C;  4P96 A;  4ZZL A;  4CGZ A;  1XMK A;  3W2V A;  1T0F C;  2MG4 A;  1S7O A;  2M1B A;  3ZCO A;  2XF7 A;  3ZMD A;  1Y1W J;  3AAF A;  2MH2 A;  4BQO A;  4LB6 B;  2ISY A;  3CMY A;  1X1D A;  3GFI A;  4NN1 A;  4XLN F;  2QSG X;  3KET A;  2VBZ A;  4RAG A;  1FOX A;  3ZQC A;  3DEE A;  4G94 A;  4ESB A;  1K4T A;  2CV1 A;  1T8I A;  4OMY A;  1S72 I;  4ZDO A;  1XGS A;  1USS A;  3OL4 A;  5F0H A;  2OTJ I;  3QPS A;  5CKT A;  2R7O A;  4BY7 J;  3C18 A;  1YHQ I;  4UY8 I;  3VSL A;  1LEB A;  4NHJ A;  2FBI A;  2CW0 F;  2LK2 A;  3K4K A;  4NQW B;  3SFI A;  1B8I A;  3HE0 A;  3LWF A;  1BI1 A;  3E3V A;  3JRE A;  3ERE D;  2TDX A;  4L18 B;  1YX3 A;  3BTC A;  1R58 A;  4CCL A;  1MZB A;  2Z3Y A;  5FD6 A;  4JP0 A;  2EZK A;  1FP2 A;  1V5E A;  4G6Q A;  3LSJ A;  1OR7 C;  3E1S A;  1R23 A;  3I4N J;  3IP4 B;  1QNT A;  4HKU A;  2XRN A;  2R0Q C;  2Y0M A;  4CXF A;  3ZXS A;  2L54 A;  3ERM A;  3P9T A;  1TW3 A;  1HCR A;  1WH5 A;  2DTZ A;  3H0G J;  4UUV A;  4I99 C;  1TC3 C;  2W4S A;  2QLZ A;  2G9W A;  2B1E A;  2UXI A;  1O4X A;  1T38 A;  1EH8 A;  2VPR A;  2CV0 A;  4PJM A;  1O3Q A;  1JGS A;  2XGD A;  4PSX A;  2ZNY A;  4F91 B;  5E18 F;  2HVR A;  2VIX A;  3GTL J;  1TP4 A;  1GT0 C;  2IP2 A;  3R6S A;  3WTV C;  2VE8 A;  3PM1 A;  3BZK A;  2Y9Y A;  1D8K A;  2ME0 A;  4KUM A;  1VQ5 I;  2XKP A;  3WTS C;  1DU6 A;  1YX5 A;  3HM5 A;  3PNT A;  2LD5 A;  2COM A;  2Q2E A;  3HZJ A;  3CRJ A;  2KT0 A;  2JPB A;  1T39 A;  2HXO A;  3KP4 A;  2KIQ A;  2UUZ A;  3LSR A;  2RQQ A;  1FIP A;  3CTA A;  1HOM A;  3S1M J;  2L2O A;  3ZQQ A;  2Q24 A;  4II2 A;  5D8L B;  2WUI A;  4I98 B;  4E7I A;  3A0H C;  5L3G A;  1T98 A;  4A3M J;  3BRU A;  2DMQ A;  2QWT A;  4QTR A;  1O3T A;  3EET A;  1ETY A;  4ZYD A;  4ZJZ A;  1TW2 A;  2GXA A;  2VQC A;  3FXU A;  1FEX A;  2ZFU A;  1XCV A;  2KDO A;  2X9D A;  2XIG A;  5JI6 A;  5KAI C;  2DA5 A;  6PAX A;  2BVL A;  2EK5 A;  4PJJ A;  2CUZ A;  2JK3 A;  5M3F J;  5FRM A;  1P92 A;  5LBQ A;  3GX4 X;  1IZ1 A;  3H3U A;  3AL0 C;  4JX6 A;  4IHT A;  4OU0 A;  3KEO A;  2CQN A;  4MTE A;  2A07 F;  2QZ8 A; 
#chains in the Genus database with same CATH homology
 1XG1 A;  5C4J J;  4C3H J;  4XRS A;  3GTP J;  3BR6 A;  2UXP A;  3TW6 A;  5J1Y A;  3PPB A;  4M6V A;  1BW5 A;  5F27 A;  1AU7 A;  1IG7 A;  2FJ1 A;  3S16 J;  3HEF A;  3OSF A;  1JUS A;  2TCT A;  2YS9 A;  1B72 B;  1TWH J;  4X1E A;  3HIM A;  2CUF A;  2Y31 A;  4M3G A;  4QIW N;  4MLO A;  2E1O A;  5EG0 B;  2JMW A;  3FRQ A;  2EH3 A;  3JRH A;  1HLV A;  3S17 J;  2ME6 A;  5C4Y A;  5HSZ A;  3HKZ N;  3CQZ J;  1RR7 A;  2MGQ A;  4CGR A;  1PUF A;  1NK3 P;  2D5V A;  1HDD C;  2DG7 A;  5FKO A;  1A6I A;  3KNW A;  4JYK A;  1MBE A;  3S15 J;  5F0C A;  1X58 A;  4A3C J;  3JRI A;  2DA6 A;  3Q0W A;  2R93 J;  1YRN B;  2XB0 X;  5EFY A;  5GP9 A;  2QTQ A;  3HBL A;  3BCG A;  1Y1V J;  3A02 A;  3W6V A;  5J3L A;  1SFO J;  3RZO J;  2R5Y A;  2E2I J;  5FKK A;  3HOY J;  1AKH A;  1ENH A;  1MBF A;  3E7L A;  4JX4 A;  3EGQ A;  1Z77 A;  3BJB A;  5EGO A;  1F36 A;  4GCT A;  5DTD A;  2AHQ A;  3VOX A;  1MBH A;  4QSH A;  4JX5 A;  2GEN A;  5HAW A;  2L0K A;  3JRD A;  2ZCX A;  3NI7 A;  3HTI A;  2E19 A;  3QPL A;  4J19 A;  3IH2 A;  2G7L A;  4FIS A;  2JJ7 A;  1ZR4 A;  4M3D A;  4S0H B;  4JL3 A;  2DA7 A;  2LVS A;  2NS8 A;  2CU7 A;  5IP9 J;  4ABZ A;  2R7Z J;  1GV5 A;  1IDY A;  3BR2 A;  5EYR A;  1BA5 A;  4DYC A;  1ETO A;  2DA4 A;  3TED A;  3LJL A;  1ETV A;  1JKP C;  3G56 A;  3QKX A;  2M0C A;  4XIC A;  1HDP A;  3BR5 A;  1BJZ A;  4MO7 A;  4V2G A;  2HI3 A;  2HQ5 A;  3FK7 A;  5FKM A;  4A3I J;  3WHC A;  1ITY A;  4M3F A;  2IEK A;  1U8B A;  2DMT A;  4EEF G;  4NEL A;  2XB5 A;  2HYJ A;  5AQC A;  2Y9Z A;  5IP7 J;  1POG A;  2YVE A;  1RES A;  1K83 J;  4BBR J;  5JLX A;  5FGL A;  3S2D J;  3QBM A;  1JKQ C;  1HF0 A;  2X48 A;  3JRF A;  1APL C;  2GFN A;  1H88 C;  1QVT A;  2LLK A;  2XSD C;  4XID A;  1K61 A;  2QF7 A;  3C07 A;  1JTY A;  2IAI A;  1NTC A;  1TWC J;  2COB A;  3NNR A;  3HOU J;  1JJ6 C;  2DN0 A;  1U9O A;  2LY9 A;  4NDL A;  2K9N A;  3KKC A;  3HOZ J;  2GLO A;  2G0E A;  2V57 A;  4XRM A;  1UHS A;  4D5C A;  2WV1 A;  1JKO C;  2NVT J;  1EF4 A;  1T33 A;  4V2F A;  2GM4 A;  3G1M A;  4IHV A;  4I76 A;  3B6A A;  3HTA A;  5FLM J;  3HOW J;  2H1K A;  5K7H A;  1PUF B;  4GFK A;  2JA5 J;  3NAR A;  2P81 A;  1GUU A;  4MIM A;  3JRA A;  2VUM J;  2IU5 A;  1MSE C;  3FK6 A;  1NK2 P;  3NAU A;  3GTQ J;  2K40 A;  1LE8 A;  2ID3 A;  2OF7 A;  2HOT A;  3MKL A;  2JA6 J;  3GEU A;  2GBY A;  3I4M J;  3VW1 A;  4A69 C;  4IHX A;  3GTO J;  2ZOY A;  1JUM A;  2EZI A;  4FCY A;  3CDL A;  3K2A A;  2HDD A;  1FTZ A;  3ZQF A;  2R5Y B;  2OI8 A;  1LFB A;  2CJJ A;  4XK4 A;  2X6O A;  4ACI A;  1B8I B;  4IEJ A;  1OCT C;  1I3Q J;  5DS9 A;  3O60 A;  5HBU A;  3Q0U A;  1ZGW A;  4AF5 A;  5IPA A;  1E3O C;  3ON4 A;  4UUT A;  5IOY A;  2WB1 N;  4GFL A;  3CJD A;  4A3J J;  1MSF C;  3HTH A;  2YUS A;  4W1U A;  3V78 A;  3S5R A;  2HOA A;  4BBS J;  1MBG A;  1U9N A;  1JT6 A;  3F0C A;  3JR9 A;  3LNQ A;  3SJM A;  1UMQ A;  4DZJ A;  5F1J A;  2MSY A;  4ME9 A;  2G7S A;  5C3E J;  4BXX J;  1QVU A;  5BNG A;  3TW7 A;  3AQS A;  4GCL A;  3GTM J;  2Y30 A;  3GZI A;  4D7N A;  2CUE A;  1SGM A;  2PZ9 A;  1FJL A;  2UXH A;  1ETX A;  5DAJ A;  4B1R A;  4CYC B;  1ETK A;  1ZR2 A;  3KZ9 A;  5E3L A;  5EEA A;  4A3F J;  2HYT A;  5F04 A;  5CXI A;  3BQY A;  2W48 A;  3K7A J;  4MFD A;  2GUH A;  1ZQ3 P;  2NP3 A;  3G7R A;  4Y52 J;  1OCP A;  1P7J A;  3BG9 A;  3A01 A;  4A3K J;  5FJ8 J;  2LTP A;  2XPW A;  3PO2 J;  3AQT A;  1P7I A;  2M2E A;  3LOC A;  3ZOB A;  3ZQG A;  3VP5 A;  2R5Z A;  1AHD P;  2O7O A;  1ORK A;  5M5W J;  1WGX A;  2NVY J;  3LSG A;  1MH4 A;  3S14 J;  5JLW A;  3HB9 A;  5M5X J;  3S1N J;  1R9T J;  2R92 J;  5M3M J;  1XS9 A;  1BL0 A;  2EQR A;  2HKU A;  3VW0 A;  3G1L A;  3Q3S A;  2NVX J;  2O9L A;  2L7Z A;  1X2N A;  5E3O A;  2ELK A;  1IJW C;  3VW2 A;  2L7F P;  1ZKG A;  4X6A J;  2K9S A;  1ETQ A;  4MXM A;  1I50 J;  2HOS A;  2WAQ N;  2FQ4 A;  2L7M P;  4B3A A;  4D5F A;  4RDU A;  1W0T A;  3VVZ A;  3B81 A;  3DPJ A;  5FHP A;  2W53 A;  2LKX A;  2XRL A;  3E7Q A;  2RHA A;  3RQI A;  2DG8 A;  9ANT A;  3HGY A;  1WCM J;  1JKR C;  3IH3 A;  3VPR A;  5D1R A;  2DMN A;  2ZOZ A;  1GDT A;  4GCK A;  1VF9 A;  1QRY A;  2RAS A;  1B72 A;  1IRZ A;  4FE4 A;  1ETW A;  3O8G A;  5EG0 A;  5EZH A;  3GTG J;  3IV5 A;  2NS7 A;  4D7M A;  2KDZ A;  2DA1 A;  1F43 A;  3RH2 A;  4A3L J;  3DEW A;  4UUS A;  2Y0S N;  4PXI A;  3B6C A;  5EDN A;  5E3N A;  2M8G X;  2TRT A;  2WGB A;  5IP6 A;  4JKZ A;  4M3E A;  1YRN A;  2NX4 A;  1VI0 A;  3PO3 J;  2XDN A;  5FMP A;  1D5Y A;  3NPI A;  2DJN A;  2HXI A;  1MBJ A;  5IYD J;  3KKD A;  3ZQI A;  3OIO A;  2PBX A;  2O7T A;  4B4C A;  3DCF A;  5IOZ A;  3ANG A;  1RKT A;  5K7F A;  4RBO A;  3FIW A;  3OSG A;  2E2J J;  1JUP A;  2EBI A;  3CCY A;  3BTL A;  4IHY A;  1RKW A;  3VUQ A;  2NVQ J;  2M9H A;  3FIS A;  4A3B J;  3ON2 A;  2ECB A;  3BR1 A;  4A3G J;  1ZK8 A;  3IUV A;  2LFB A;  3A01 B;  3BTJ A;  3A03 A;  2LR8 A;  2CRG A;  4Y7N J;  2O8K A;  1UI6 A;  3Q0V A;  2G7G A;  3OOU A;  3JRB A;  1TWG J;  1AKH B;  4YZE A;  5J1U A;  3GBG A;  3JSJ A;  5EGO B;  2R5Z B;  3PAS A;  2H8R A;  1UG2 A;  1VFC A;  3HGG A;  4DYR A;  2AO9 A;  2OPT A;  3CWR A;  2L9R A;  2MW8 A;  4MK6 A;  3G1O A;  3HTJ A;  1H8A C;  1UI5 A;  1BW6 A;  5FKN A;  5HOD A;  1RET A;  2FX0 A;  2XGC A;  2D6Y A;  3IH4 A;  4BY1 J;  1A5J A;  2QKO A;  5E3M A;  2DMP A;  2UXO A;  2NP5 A;  3GTK J;  2ZCN A;  1OJL A;  1IC8 A;  4A3E J;  3S1Q J;  2QOP A;  3VOK A;  2M34 A;  2K9Q A;  3LHQ A;  1G2H A;  4KWA A;  2JWT A;  5K7Z A;  3HOV J;  5GPA A;  2OER A;  1W0U A;  4BKX A;  4LOC A;  2DA2 A;  3BT9 A;  3S1R J;  4AYB N;  1IV6 A;  4JNN A;  1OFC X;  4I6Z A;  3RZD J;  5F0F A;  5D19 A;  3BG5 A;  4C3I J;  4XRS G;  1GV2 A;  2FD5 A;  3VVX A;  3JRG A;  3ZQH A;  3VIB A;  2IBD A;  2MG4 A;  1JGG A;  1IUF A;  2NOG A;  1WI3 A;  1JTX A;  2ZCM A;  1Y1W J;  2YU9 J;  3CMY A;  1FIA A;  4M3B A;  3BNI A;  5IYB J;  4HNV A;  2G3B A;  4NN1 A;  1T56 A;  4UUS B;  1MNM C;  3BR3 A;  1ZTR A;  4L5E A;  1DU0 A;  3ZQC A;  1JJ8 C;  1RPW A;  1MBK A;  5F08 A;  2JA8 J;  2PMZ N;  5EF6 A;  5F0H A;  3GTJ J;  3QPS A;  4BY7 J;  1JT0 A;  4FTH A;  3BHQ A;  3RD3 A;  3T6N A;  4MFE A;  1Q1V A;  2ZB9 A;  5M5Y J;  1FTT A;  4IHW A;  5CXG A;  5CW8 A;  2XGE A;  2N8G A;  2EZL A;  2LK2 A;  3HE0 A;  1B8I A;  3SFI A;  1TWA J;  3HOX J;  3BQZ A;  3LSP A;  5IYC J;  3JRE A;  1GVD A;  3BR0 A;  1LE8 B;  4A93 J;  3BTC A;  4G12 A;  3H3V K;  2VI6 A;  3V6G A;  4JP0 A;  2EZK A;  2RAE A;  2ECC A;  5J1R A;  3LSJ A;  3QQA A;  4ICH A;  4HKU A;  3I4N J;  2EZH A;  4GFB A;  2R0Q C;  1I6H J;  3EUP A;  3TP0 A;  3P9T A;  4DW6 A;  1HCR A;  1WH5 A;  2DTZ A;  2FBQ A;  3H0G J;  1X2M A;  4FE7 A;  3NRG A;  3WHB A;  5EZG A;  2VKV A;  1TC3 C;  4A3D J;  5H9T A;  3TP3 A;  4AUX A;  2UXI A;  2YVH A;  1O4X A;  2CQQ A;  2VPR A;  4CYC A;  5C44 J;  3F1B A;  2VKE A;  2XGD A;  3M4O J;  3FKI J;  4UDS A;  3O8H A;  1H89 C;  4DZP A;  4W97 A;  1WH7 A;  1IDZ A;  3GTL J;  1LFU P;  3LWJ A;  1GT0 C;  1WPK A;  3PM1 A;  3MNL A;  4AC0 A;  2Y9Y A;  3MVP A;  2ME0 A;  3BG3 A;  4DYQ A;  1DU6 A;  1XC5 A;  1TWF J;  3HM5 A;  1U78 A;  2LD5 A;  2DA3 A;  2F07 A;  2DMU A;  2B63 J;  2QIB A;  2E2H J;  3CRJ A;  2KT0 A;  3ANP A;  3NXC A;  2HXO A;  1CQT A;  3LSR A;  4C3J J;  2JN6 A;  1FIP A;  3M3Y J;  5FKL A;  1HOM A;  3S1M J;  2REK A;  2Q24 A;  3UKG A;  5K58 A;  3MN2 A;  2Y2Z A;  3ZQL A;  3S2H J;  2JA7 J;  5FLV A;  2WUI A;  4AC6 A;  2XPV A;  4A3M J;  3BRU A;  1S7E A;  1Z0X A;  2DMQ A;  3RKQ A;  2QWT A;  3VVY A;  2CQX A;  4QTR A;  1MH3 A;  3D1N I;  1ETY A;  1SAN A;  2ID6 A;  2QCO A;  1VND A;  3SDG A;  1QPI A;  5C4X J;  1FEX A;  1IGN A;  2X9D A;  3HDD A;  2XPU A;  4L62 A;  3JRC A;  2DA5 A;  2UXU A;  3L1P A;  2I10 A;  2JK3 A;  5M3F J;  3C2B A;  3BTI A;  5GPC A;  4C2M J;  4JX6 A;  2LP0 A;  3COL A;  5D18 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...