3KKCA

The crystal structure of tetr transcriptional regulator from streptococcus agalactiae 2603v
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
177
structure length
177
Chain Sequence
SNAMVKDRQIQKTKVAIYNAFISLLQENDYSKITVQDVIGLANVGRSTFYSHYESKEVLLKELCEDLFHHLFKQGRDVTFEEYLVHILKHFEQNQDSIATLLLSDDPYFLLRFRSELEHDVYPRLREEYITKVDIPEDFLKQFLLSSFIETLKWWLHQRQKMTVEDLLKYYLTMVER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords TetR family Transcriptional regulator
publication title The crystal structure OF TetR transcriptional regulator from Streptococcus agalactiae 2603V
rcsb
source organism Streptococcus agalactiae 2603v/r
total genus 64
structure length 177
sequence length 177
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF14278 TetR_C_8 Transcriptional regulator C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3kkcA01
3KKDA 3FK6A 1UI5A 2ZOYA 4M3BA 5F27A 3ANPA 1ZK8A 3CDLA 2IU5A 4MXMA 5K58A 2FD5A 2GENA 1ZKGA 2XPUA 1JT6A 3TP0A 4GCLA 2QTQA 3HGYA 3VVYA 4I6ZA 3VOXA 1U9OA 3HTJA 3NNRA 3VVXA 3VW1A 3FIWA 2GUHA 2JJ7A 3PPBA 2RAEA 4B1RA 3QKXA 5EYRA 3BNIA 4HKUA 3O8GA 3C07A 3HTHA 5FKMA 4L62A 2QWTA 4V2GA 2X9DA 3T6NA 2NS7A 3BR3A 3BRUA 3RD3A 2G7LA 2HXOA 2FBQA 3Q0VA 3DCFA 4NELA 2RASA 4B3AA 4GFLA 2WUIA 1RKWA 3ZQIA 4D5FA 3G1LA 4NN1A 2GFNA 5J1RA 4MK6A 1JTXA 4D7MA 2O7TA 3BQZA 3BJBA 2XPVA 3VW2A 3O60A 2G7SA 5F0CA 2ZCMA 3V6GA 3NXCA 1UI6A 3QQAA 2ID3A 2OERA 3HTAA 2VKVA 4AC6A 2Q24A 3IH3A 3BQYA 3EGQA 2FJ1A 2HQ5A 4M3DA 4D7NA 2G7GA 5HSZA 2NX4A 3VVZA 2QIBA 3VOKA 2XGCA 2HYTA 2PZ9A 3HE0A 3SFIA 4W97A 5EFYA 2OI8A 3AQSA 2XDNA 5J1YA 2Y30A 2NS8A 3FRQA 1T33A 5GPCA 3LHQA 2XGDA 3CJDA 3LSJA 4UDSA 2YVHA 2WV1A 2O7OA 4M3EA 3DEWA 3GEUA 5IOYA 2DG7A 2DTZA 2F07A 2IBDA 5CW8A 3WHCA 3ZQHA 3G1MA 3EUPA 3MNLA 4JYKA 4XK4A 3B6CA 2QOPA 3B81A 4I76A 3QPLA 3WHBA 3ZQGA 3VUQA 3F1BA 2Y31A 2IAIA 2NP3A 4MO7A 2QCOA 3VW0A 2IEKA 5F0HA 4KWAA 3HGGA 3QPSA 1Z77A 3BR6A 2XGEA 3RH2A 5CXGA 2UXUA 5IP6A 1ORKA 3Q3SA 2FQ4A 3SDGA 3IH4A 2G3BA 3AQTA 3QBMA 4ABZA 3IH2A 2JK3A 3BTLA 2VPRA 3TP3A 3CRJA 5FMPA 3VP5A 3BTCA 3COLA 3BTIA 1Z0XA 5D1RA 4CGRA 3KZ9A 2XRLA 2VKEA 4D5CA 4GCKA 3B6AA 5K7FA 4JNNA 4YZEA 4W1UA 2I10A 5FHPA 3NPIA 2ID6A 3CWRA 3V78A 5HAWA 2TCTA 2PBXA 3Q0WA 5FKLA 2DG8A 2QKOA 5IOZA 5FGLA 3NI7A 1QVTA 2WGBA 3VPRA 3ON4A 2UXIA 3G56A 5FKKA 2UXOA 5GP9A 4JL3A 3S5RA 3BCGA 2YVEA 5F1JA 2REKA 4JKZA 5J1UA 5K7ZA 1A6IA 2ZCNA 3C2BA 4M3GA 3P9TA 2Y2ZA 3JSJA 5HBUA 3FK7A 2ZOZA 2NP5A 5H9TA 3HIMA 5J3LA 3ON2A 5EZGA 2OPTA 4ME9A 2GBYA 3PM1A 5EZHA 3BR5A 5IPAA 3BR1A 2ZCXA 2UXPA 3ANGA 5DAJA 5FKNA 3E7QA 4DW6A 2W53A 3BT9A 2UXHA 3BR2A 3BR0A 3GZIA 3HTIA 5AQCA 3O8HA 4AC0A 2G0EA 4GFKA 3LSPA 2RHAA 2HYJA 2HXIA 5FKOA 5F08A 3G1OA 1JUPA 1SGMA 2XB5A 5F0FA 3G7RA 5CXIA 3LSRA 5D18A 2HKUA 4ACIA 4X1EA 1RKTA 3CCYA 1RPWA 5GPAA 5C4YA 2FX0A 3NRGA 5D19A 3ZQLA 5F04A 3VIBA 1JT0A 3MVPA 1BJZA 3BTJA 1JUSA 3PASA 3F0CA 3LJLA 5K7HA 1U9NA 3LOCA 2V57A 3BHQA 4AUXA 1QVUA 2XPWA 2X6OA 3IUVA 4PXIA 1VI0A 3Q0UA 2ZB9A 2EH3A 3LWJA 2OF7A 1JTYA 3ZQFA 4M3FA 3KNWA 4AF5A 2TRTA 1JUMA 4G12A 4V2FA 4GCTA 3DPJA 2D6YA 1QPIA 4ICHA 1T56A 3KKCA
chains in the Genus database with same CATH superfamily
3KKDA 3FK6A 1UI5A 2ZOYA 4M3BA 5F27A 3ANPA 2PFVA 2R7SA 1ZK8A 3CDLA 2IU5A 4MXMA 5K58A 2FD5A 2GENA 1ZKGA 2XPUA 1JT6A 3TP0A 4GCLA 2QTQA 3HGYA 3VVYA 4I6ZA 2YVXA 3VOXA 1U9OA 3HTJA 3NNRA 3VVXA 3VW1A 3FIWA 2GUHA 2JJ7A 3PPBA 2RAEA 4B1RA 3QKXA 5EYRA 3BNIA 4HKUA 3O8GA 3C07A 3HTHA 5FKMA 4L62A 2QWTA 4V2GA 2X9DA 4U9NA 3T6NA 2NS7A 3BR3A 3BRUA 3RD3A 2G7LA 2HXOA 2FBQA 3Q0VA 3DCFA 4IRVA 4NELA 2RASA 4B3AA 4GFLA 2WUIA 1RKWA 3ZQIA 4D5FA 3G1LA 4NN1A 2GFNA 5J1RA 4MK6A 1JTXA 4D7MA 2O7TA 3BQZA 4OD4A 3BJBA 2XPVA 3VW2A 3O60A 2G7SA 5F0CA 2ZCMA 3V6GA 3NXCA 1UI6A 3QQAA 2ID3A 2OERA 3HTAA 2VKVA 4AC6A 3KYLA 2Q24A 3IH3A 3BQYA 3EGQA 2FJ1A 2HQ5A 2R7RA 4M3DA 4D7NA 2G7GA 5HSZA 2NX4A 3VVZA 2QIBA 3VOKA 2XGCA 2HYTA 2PZ9A 3HE0A 3SFIA 4W97A 5EFYA 2OI8A 3AQSA 5CQGA 2XDNA 5J1YA 2Y30A 2NS8A 3FRQA 1T33A 5GPCA 3LHQA 2XGDA 3CJDA 3LSJA 4UDSA 2YVHA 2WV1A 2O7OA 4M3EA 3DEWA 3GEUA 5IOYA 2DG7A 2DTZA 2F07A 2IBDA 5CW8A 2R7QA 3WHCA 3ZQHA 3G1MA 3K8PC 3EUPA 2R7UA 3MNLA 4JYKA 4XK4A 3B6CA 2FJI1 2QOPA 3B81A 4I76A 2R7TA 3QPLA 3WHBA 3ZQGA 3VUQA 3F1BA 2Y31A 2IAIA 2NP3A 4MO7A 2QCOA 3VW0A 2IEKA 5F0HA 4KWAA 3HGGA 3QPSA 1Z77A 3BR6A 2XGEA 3RH2A 5CXGA 2UXUA 5IP6A 1ORKA 3Q3SA 2B1EA 2FQ4A 3SDGA 3IH4A 2G3BA 3AQTA 3QBMA 4ABZA 3IH2A 2JK3A 3BTLA 2VPRA 3TP3A 3CRJA 5FMPA 3VP5A 3BTCA 3COLA 3BTIA 1Z0XA 5D1RA 4CGRA 3KZ9A 2XRLA 2VKEA 4D5CA 4GCKA 3B6AA 5K7FA 3VTIA 4JNNA 4YZEA 4W1UA 2I10A 5FHPA 3NPIA 2ID6A 3CWRA 3V78A 4C2MA 5HAWA 2TCTA 2PBXA 3Q0WA 5FKLA 2DG8A 2QKOA 5IOZA 4OD5A 5FGLA 3NI7A 1QVTA 2WGBA 3VPRA 3ON4A 2UXIA 3G56A 5FKKA 2R7XA 2UXOA 2R7VA 5GP9A 4JL3A 3S5RA 3DU5A 3BCGA 2YVEA 5F1JA 2REKA 4JKZA 4DVYP 5J1UA 5K7ZA 1A6IA 2ZCNA 3C2BA 4M3GA 3P9TA 2Y2ZA 3JSJA 5HBUA 3FK7A 2ZOZA 2NP5A 5H9TA 3HIMA 5J3LA 3ON2A 2B3WA 5EZGA 2OPTA 4ME9A 2GBYA 3PM1A 5EZHA 2R7WA 3NS4A 3BR5A 5IPAA 3BR1A 2ZCXA 2UXPA 3ANGA 2ZY9A 5DAJA 5FKNA 3E7QA 4DW6A 2W53A 4WIBA 3BT9A 2UXHA 3BR2A 3BR0A 3GZIA 3HTIA 5AQCA 3O8HA 4AC0A 2G0EA 4GFKA 3LSPA 2RHAA 2HYJA 2HXIA 5FKOA 5F08A 3G1OA 1JUPA 1SGMA 2XB5A 2A2FX 5F0FA 3G7RA 5CXIA 3LSRA 5D18A 2HKUA 4ACIA 4X1EA 1RKTA 2R7OA 3CCYA 1RPWA 5GPAA 5C4YA 2FX0A 3NRGA 5D19A 3ZQLA 5F04A 3VIBA 1JT0A 3SWHA 3MVPA 1BJZA 3DU6A 3BTJA 1JUSA 3PASA 3F0CA 3LJLA 5K7HA 1U9NA 3LOCA 2V57A 3BHQA 3FHNA 4AUXA 1QVUA 2XPWA 2X6OA 3IUVA 4PXIA 1VI0A 3Q0UA 2ZB9A 2EH3A 3LWJA 2OF7A 1JTYA 3ZQFA 4M3FA 3KNWA 4AF5A 4U9LA 2TRTA 1JUMA 4G12A 4V2FA 4GCTA 3DPJA 2D6YA 1QPIA 4ICHA 1T56A 3KKCA
chains in the Genus database with same CATH topology
3KKDA 3FK6A 1UI5A 2ZOYA 4M3BA 5F27A 3ANPA 1ZK8A 3CDLA 2IU5A 4MXMA 5K58A 2FD5A 2GENA 1ZKGA 2XPUA 1JT6A 3TP0A 4GCLA 2QTQA 3HGYA 3VVYA 4I6ZA 3VOXA 1U9OA 3HTJA 3NNRA 3VVXA 3VW1A 3FIWA 2GUHA 2JJ7A 3PPBA 2RAEA 4B1RA 3QKXA 5EYRA 3BNIA 4HKUA 3O8GA 3C07A 3HTHA 5FKMA 4L62A 2QWTA 4V2GA 2X9DA 3T6NA 2NS7A 3BR3A 3BRUA 3RD3A 2G7LA 2HXOA 2FBQA 3Q0VA 3DCFA 4NELA 2RASA 4B3AA 4GFLA 2WUIA 1RKWA 3ZQIA 4D5FA 3G1LA 4NN1A 2GFNA 5J1RA 4MK6A 1JTXA 4D7MA 2O7TA 3BQZA 3BJBA 2XPVA 3VW2A 3O60A 2G7SA 5F0CA 2ZCMA 3V6GA 3NXCA 1UI6A 3QQAA 2ID3A 2OERA 3HTAA 2VKVA 4AC6A 2Q24A 3IH3A 3BQYA 3EGQA 2FJ1A 2HQ5A 4M3DA 4D7NA 2G7GA 5HSZA 2NX4A 3VVZA 2QIBA 3VOKA 2XGCA 2HYTA 2PZ9A 3HE0A 3SFIA 4W97A 5EFYA 2OI8A 3AQSA 2XDNA 5J1YA 2Y30A 2NS8A 3FRQA 1T33A 5GPCA 3LHQA 2XGDA 3CJDA 3LSJA 4UDSA 2YVHA 2WV1A 2O7OA 4M3EA 3DEWA 3GEUA 5IOYA 2DG7A 2DTZA 2F07A 2IBDA 5CW8A 3WHCA 3ZQHA 3G1MA 3EUPA 3MNLA 4JYKA 4XK4A 3B6CA 2QOPA 3B81A 4I76A 3QPLA 3WHBA 3ZQGA 3VUQA 3F1BA 2Y31A 2IAIA 2NP3A 4MO7A 2QCOA 3VW0A 2IEKA 5F0HA 4KWAA 3HGGA 3QPSA 1Z77A 3BR6A 2XGEA 3RH2A 5CXGA 2UXUA 5IP6A 1ORKA 3Q3SA 2FQ4A 3SDGA 3IH4A 2G3BA 3AQTA 3QBMA 4ABZA 3IH2A 2JK3A 3BTLA 2VPRA 3TP3A 3CRJA 5FMPA 3VP5A 3BTCA 3COLA 3BTIA 1Z0XA 5D1RA 4CGRA 3KZ9A 2XRLA 2VKEA 4D5CA 4GCKA 3B6AA 5K7FA 4JNNA 4YZEA 4W1UA 2I10A 5FHPA 3NPIA 2ID6A 3CWRA 3V78A 5HAWA 2TCTA 2PBXA 3Q0WA 5FKLA 2DG8A 2QKOA 5IOZA 5FGLA 3NI7A 1QVTA 2WGBA 3VPRA 3ON4A 2UXIA 3G56A 5FKKA 2UXOA 5GP9A 4JL3A 3S5RA 3BCGA 2YVEA 5F1JA 2REKA 4JKZA 5J1UA 5K7ZA 1A6IA 2ZCNA 3C2BA 4M3GA 3P9TA 2Y2ZA 3JSJA 5HBUA 3FK7A 2ZOZA 2NP5A 5H9TA 3HIMA 5J3LA 3ON2A 5EZGA 2OPTA 4ME9A 2GBYA 3PM1A 5EZHA 3BR5A 5IPAA 3BR1A 2ZCXA 2UXPA 3ANGA 5DAJA 5FKNA 3E7QA 4DW6A 2W53A 3BT9A 2UXHA 3BR2A 3BR0A 3GZIA 3HTIA 5AQCA 3O8HA 4AC0A 2G0EA 4GFKA 3LSPA 2RHAA 2HYJA 2HXIA 5FKOA 5F08A 3G1OA 1JUPA 1SGMA 2XB5A 5F0FA 3G7RA 5CXIA 3LSRA 5D18A 2HKUA 4ACIA 4X1EA 1RKTA 3CCYA 1RPWA 5GPAA 5C4YA 2FX0A 3NRGA 5D19A 3ZQLA 5F04A 3VIBA 1JT0A 3MVPA 1BJZA 3BTJA 1JUSA 3PASA 3F0CA 3LJLA 5K7HA 1U9NA 3LOCA 2V57A 3BHQA 4AUXA 1QVUA 2XPWA 2X6OA 3IUVA 4PXIA 1VI0A 3Q0UA 2ZB9A 2EH3A 3LWJA 2OF7A 1JTYA 3ZQFA 4M3FA 3KNWA 4AF5A 2TRTA 1JUMA 4G12A 4V2FA 4GCTA 3DPJA 2D6YA 1QPIA 4ICHA 1T56A 3KKCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KKD A;  3FK6 A;  1UI5 A;  2ZOY A;  4M3B A;  5F27 A;  3ANP A;  1ZK8 A;  3CDL A;  2IU5 A;  4MXM A;  5K58 A;  2FD5 A;  2GEN A;  1ZKG A;  2XPU A;  1JT6 A;  3TP0 A;  4GCL A;  2QTQ A;  3HGY A;  3VVY A;  4I6Z A;  3VOX A;  1U9O A;  3HTJ A;  3NNR A;  3VVX A;  3VW1 A;  3FIW A;  2GUH A;  2JJ7 A;  3PPB A;  2RAE A;  4B1R A;  3QKX A;  5EYR A;  3BNI A;  4HKU A;  3O8G A;  3C07 A;  3HTH A;  5FKM A;  4L62 A;  2QWT A;  4V2G A;  2X9D A;  3T6N A;  2NS7 A;  3BR3 A;  3BRU A;  3RD3 A;  2G7L A;  2HXO A;  2FBQ A;  3Q0V A;  3DCF A;  4NEL A;  2RAS A;  4B3A A;  4GFL A;  2WUI A;  1RKW A;  3ZQI A;  4D5F A;  3G1L A;  4NN1 A;  2GFN A;  5J1R A;  4MK6 A;  1JTX A;  4D7M A;  2O7T A;  3BQZ A;  3BJB A;  2XPV A;  3VW2 A;  3O60 A;  2G7S A;  5F0C A;  2ZCM A;  3V6G A;  3NXC A;  1UI6 A;  3QQA A;  2ID3 A;  2OER A;  3HTA A;  2VKV A;  4AC6 A;  2Q24 A;  3IH3 A;  3BQY A;  3EGQ A;  2FJ1 A;  2HQ5 A;  4M3D A;  4D7N A;  2G7G A;  5HSZ A;  2NX4 A;  3VVZ A;  2QIB A;  3VOK A;  2XGC A;  2HYT A;  2PZ9 A;  3HE0 A;  3SFI A;  4W97 A;  5EFY A;  2OI8 A;  3AQS A;  2XDN A;  5J1Y A;  2Y30 A;  2NS8 A;  3FRQ A;  1T33 A;  5GPC A;  3LHQ A;  2XGD A;  3CJD A;  3LSJ A;  4UDS A;  2YVH A;  2WV1 A;  2O7O A;  4M3E A;  3DEW A;  3GEU A;  5IOY A;  2DG7 A;  2DTZ A;  2F07 A;  2IBD A;  5CW8 A;  3WHC A;  3ZQH A;  3G1M A;  3EUP A;  3MNL A;  4JYK A;  4XK4 A;  3B6C A;  2QOP A;  3B81 A;  4I76 A;  3QPL A;  3WHB A;  3ZQG A;  3VUQ A;  3F1B A;  2Y31 A;  2IAI A;  2NP3 A;  4MO7 A;  2QCO A;  3VW0 A;  2IEK A;  5F0H A;  4KWA A;  3HGG A;  3QPS A;  1Z77 A;  3BR6 A;  2XGE A;  3RH2 A;  5CXG A;  2UXU A;  5IP6 A;  1ORK A;  3Q3S A;  2FQ4 A;  3SDG A;  3IH4 A;  2G3B A;  3AQT A;  3QBM A;  4ABZ A;  3IH2 A;  2JK3 A;  3BTL A;  2VPR A;  3TP3 A;  3CRJ A;  5FMP A;  3VP5 A;  3BTC A;  3COL A;  3BTI A;  1Z0X A;  5D1R A;  4CGR A;  3KZ9 A;  2XRL A;  2VKE A;  4D5C A;  4GCK A;  3B6A A;  5K7F A;  4JNN A;  4YZE A;  4W1U A;  2I10 A;  5FHP A;  3NPI A;  2ID6 A;  3CWR A;  3V78 A;  5HAW A;  2TCT A;  2PBX A;  3Q0W A;  5FKL A;  2DG8 A;  2QKO A;  5IOZ A;  5FGL A;  3NI7 A;  1QVT A;  2WGB A;  3VPR A;  3ON4 A;  2UXI A;  3G56 A;  5FKK A;  2UXO A;  5GP9 A;  4JL3 A;  3S5R A;  3BCG A;  2YVE A;  5F1J A;  2REK A;  4JKZ A;  5J1U A;  5K7Z A;  1A6I A;  2ZCN A;  3C2B A;  4M3G A;  3P9T A;  2Y2Z A;  3JSJ A;  5HBU A;  3FK7 A;  2ZOZ A;  2NP5 A;  5H9T A;  3HIM A;  5J3L A;  3ON2 A;  5EZG A;  2OPT A;  4ME9 A;  2GBY A;  3PM1 A;  5EZH A;  3BR5 A;  5IPA A;  3BR1 A;  2ZCX A;  2UXP A;  3ANG A;  5DAJ A;  5FKN A;  3E7Q A;  4DW6 A;  2W53 A;  3BT9 A;  2UXH A;  3BR2 A;  3BR0 A;  3GZI A;  3HTI A;  5AQC A;  3O8H A;  4AC0 A;  2G0E A;  4GFK A;  3LSP A;  2RHA A;  2HYJ A;  2HXI A;  5FKO A;  5F08 A;  3G1O A;  1JUP A;  1SGM A;  2XB5 A;  5F0F A;  3G7R A;  5CXI A;  3LSR A;  5D18 A;  2HKU A;  4ACI A;  4X1E A;  1RKT A;  3CCY A;  1RPW A;  5GPA A;  5C4Y A;  2FX0 A;  3NRG A;  5D19 A;  3ZQL A;  5F04 A;  3VIB A;  1JT0 A;  3MVP A;  1BJZ A;  3BTJ A;  1JUS A;  3PAS A;  3F0C A;  3LJL A;  5K7H A;  1U9N A;  3LOC A;  2V57 A;  3BHQ A;  4AUX A;  1QVU A;  2XPW A;  2X6O A;  3IUV A;  4PXI A;  1VI0 A;  3Q0U A;  2ZB9 A;  2EH3 A;  3LWJ A;  2OF7 A;  1JTY A;  3ZQF A;  4M3F A;  3KNW A;  4AF5 A;  2TRT A;  1JUM A;  4G12 A;  4V2F A;  4GCT A;  3DPJ A;  2D6Y A;  1QPI A;  4ICH A;  1T56 A;  3KKC A; 
#chains in the Genus database with same CATH topology
 3KKD A;  3FK6 A;  1UI5 A;  2ZOY A;  4M3B A;  5F27 A;  3ANP A;  2PFV A;  2R7S A;  1ZK8 A;  3CDL A;  2IU5 A;  4MXM A;  5K58 A;  2FD5 A;  2GEN A;  1ZKG A;  2XPU A;  1JT6 A;  3TP0 A;  4GCL A;  2QTQ A;  3HGY A;  3VVY A;  4I6Z A;  2YVX A;  3VOX A;  1U9O A;  3HTJ A;  3NNR A;  3VVX A;  3VW1 A;  3FIW A;  2GUH A;  2JJ7 A;  3PPB A;  2RAE A;  4B1R A;  3QKX A;  5EYR A;  3BNI A;  4HKU A;  3O8G A;  3C07 A;  3HTH A;  5FKM A;  4L62 A;  2QWT A;  4V2G A;  2X9D A;  4U9N A;  3T6N A;  2NS7 A;  3BR3 A;  3BRU A;  3RD3 A;  2G7L A;  2HXO A;  2FBQ A;  3Q0V A;  3DCF A;  4IRV A;  4NEL A;  2RAS A;  4B3A A;  4GFL A;  2WUI A;  1RKW A;  3ZQI A;  4D5F A;  3G1L A;  4NN1 A;  2GFN A;  5J1R A;  4MK6 A;  1JTX A;  4D7M A;  2O7T A;  3BQZ A;  4OD4 A;  3BJB A;  2XPV A;  3VW2 A;  3O60 A;  2G7S A;  5F0C A;  2ZCM A;  3V6G A;  3NXC A;  1UI6 A;  3QQA A;  2ID3 A;  2OER A;  3HTA A;  2VKV A;  4AC6 A;  3KYL A;  2Q24 A;  3IH3 A;  3BQY A;  3EGQ A;  2FJ1 A;  2HQ5 A;  2R7R A;  4M3D A;  4D7N A;  2G7G A;  5HSZ A;  2NX4 A;  3VVZ A;  2QIB A;  3VOK A;  2XGC A;  2HYT A;  2PZ9 A;  3HE0 A;  3SFI A;  4W97 A;  5EFY A;  2OI8 A;  3AQS A;  5CQG A;  2XDN A;  5J1Y A;  2Y30 A;  2NS8 A;  3FRQ A;  1T33 A;  5GPC A;  3LHQ A;  2XGD A;  3CJD A;  3LSJ A;  4UDS A;  2YVH A;  2WV1 A;  2O7O A;  4M3E A;  3DEW A;  3GEU A;  5IOY A;  2DG7 A;  2DTZ A;  2F07 A;  2IBD A;  5CW8 A;  2R7Q A;  3WHC A;  3ZQH A;  3G1M A;  3K8P C;  3EUP A;  2R7U A;  3MNL A;  4JYK A;  4XK4 A;  3B6C A;  2FJI 1;  2QOP A;  3B81 A;  4I76 A;  2R7T A;  3QPL A;  3WHB A;  3ZQG A;  3VUQ A;  3F1B A;  2Y31 A;  2IAI A;  2NP3 A;  4MO7 A;  2QCO A;  3VW0 A;  2IEK A;  5F0H A;  4KWA A;  3HGG A;  3QPS A;  1Z77 A;  3BR6 A;  2XGE A;  3RH2 A;  5CXG A;  2UXU A;  5IP6 A;  1ORK A;  3Q3S A;  2B1E A;  2FQ4 A;  3SDG A;  3IH4 A;  2G3B A;  3AQT A;  3QBM A;  4ABZ A;  3IH2 A;  2JK3 A;  3BTL A;  2VPR A;  3TP3 A;  3CRJ A;  5FMP A;  3VP5 A;  3BTC A;  3COL A;  3BTI A;  1Z0X A;  5D1R A;  4CGR A;  3KZ9 A;  2XRL A;  2VKE A;  4D5C A;  4GCK A;  3B6A A;  5K7F A;  3VTI A;  4JNN A;  4YZE A;  4W1U A;  2I10 A;  5FHP A;  3NPI A;  2ID6 A;  3CWR A;  3V78 A;  4C2M A;  5HAW A;  2TCT A;  2PBX A;  3Q0W A;  5FKL A;  2DG8 A;  2QKO A;  5IOZ A;  4OD5 A;  5FGL A;  3NI7 A;  1QVT A;  2WGB A;  3VPR A;  3ON4 A;  2UXI A;  3G56 A;  5FKK A;  2R7X A;  2UXO A;  2R7V A;  5GP9 A;  4JL3 A;  3S5R A;  3DU5 A;  3BCG A;  2YVE A;  5F1J A;  2REK A;  4JKZ A;  4DVY P;  5J1U A;  5K7Z A;  1A6I A;  2ZCN A;  3C2B A;  4M3G A;  3P9T A;  2Y2Z A;  3JSJ A;  5HBU A;  3FK7 A;  2ZOZ A;  2NP5 A;  5H9T A;  3HIM A;  5J3L A;  3ON2 A;  2B3W A;  5EZG A;  2OPT A;  4ME9 A;  2GBY A;  3PM1 A;  5EZH A;  2R7W A;  3NS4 A;  3BR5 A;  5IPA A;  3BR1 A;  2ZCX A;  2UXP A;  3ANG A;  2ZY9 A;  5DAJ A;  5FKN A;  3E7Q A;  4DW6 A;  2W53 A;  4WIB A;  3BT9 A;  2UXH A;  3BR2 A;  3BR0 A;  3GZI A;  3HTI A;  5AQC A;  3O8H A;  4AC0 A;  2G0E A;  4GFK A;  3LSP A;  2RHA A;  2HYJ A;  2HXI A;  5FKO A;  5F08 A;  3G1O A;  1JUP A;  1SGM A;  2XB5 A;  2A2F X;  5F0F A;  3G7R A;  5CXI A;  3LSR A;  5D18 A;  2HKU A;  4ACI A;  4X1E A;  1RKT A;  2R7O A;  3CCY A;  1RPW A;  5GPA A;  5C4Y A;  2FX0 A;  3NRG A;  5D19 A;  3ZQL A;  5F04 A;  3VIB A;  1JT0 A;  3SWH A;  3MVP A;  1BJZ A;  3DU6 A;  3BTJ A;  1JUS A;  3PAS A;  3F0C A;  3LJL A;  5K7H A;  1U9N A;  3LOC A;  2V57 A;  3BHQ A;  3FHN A;  4AUX A;  1QVU A;  2XPW A;  2X6O A;  3IUV A;  4PXI A;  1VI0 A;  3Q0U A;  2ZB9 A;  2EH3 A;  3LWJ A;  2OF7 A;  1JTY A;  3ZQF A;  4M3F A;  3KNW A;  4AF5 A;  4U9L A;  2TRT A;  1JUM A;  4G12 A;  4V2F A;  4GCT A;  3DPJ A;  2D6Y A;  1QPI A;  4ICH A;  1T56 A;  3KKC A; 
#chains in the Genus database with same CATH homology
 3KKD A;  3FK6 A;  1UI5 A;  2ZOY A;  4M3B A;  5F27 A;  3ANP A;  1ZK8 A;  3CDL A;  2IU5 A;  4MXM A;  5K58 A;  2FD5 A;  2GEN A;  1ZKG A;  2XPU A;  1JT6 A;  3TP0 A;  4GCL A;  2QTQ A;  3HGY A;  3VVY A;  4I6Z A;  3VOX A;  1U9O A;  3HTJ A;  3NNR A;  3VVX A;  3VW1 A;  3FIW A;  2GUH A;  2JJ7 A;  3PPB A;  2RAE A;  4B1R A;  3QKX A;  5EYR A;  3BNI A;  4HKU A;  3O8G A;  3C07 A;  3HTH A;  5FKM A;  4L62 A;  2QWT A;  4V2G A;  2X9D A;  3T6N A;  2NS7 A;  3BR3 A;  3BRU A;  3RD3 A;  2G7L A;  2HXO A;  2FBQ A;  3Q0V A;  3DCF A;  4NEL A;  2RAS A;  4B3A A;  4GFL A;  2WUI A;  1RKW A;  3ZQI A;  4D5F A;  3G1L A;  4NN1 A;  2GFN A;  5J1R A;  4MK6 A;  1JTX A;  4D7M A;  2O7T A;  3BQZ A;  3BJB A;  2XPV A;  3VW2 A;  3O60 A;  2G7S A;  5F0C A;  2ZCM A;  3V6G A;  3NXC A;  1UI6 A;  3QQA A;  2ID3 A;  2OER A;  3HTA A;  2VKV A;  4AC6 A;  2Q24 A;  3IH3 A;  3BQY A;  3EGQ A;  2FJ1 A;  2HQ5 A;  4M3D A;  4D7N A;  2G7G A;  5HSZ A;  2NX4 A;  3VVZ A;  2QIB A;  3VOK A;  2XGC A;  2HYT A;  2PZ9 A;  3HE0 A;  3SFI A;  4W97 A;  5EFY A;  2OI8 A;  3AQS A;  2XDN A;  5J1Y A;  2Y30 A;  2NS8 A;  3FRQ A;  1T33 A;  5GPC A;  3LHQ A;  2XGD A;  3CJD A;  3LSJ A;  4UDS A;  2YVH A;  2WV1 A;  2O7O A;  4M3E A;  3DEW A;  3GEU A;  5IOY A;  2DG7 A;  2DTZ A;  2F07 A;  2IBD A;  5CW8 A;  3WHC A;  3ZQH A;  3G1M A;  3EUP A;  3MNL A;  4JYK A;  4XK4 A;  3B6C A;  2QOP A;  3B81 A;  4I76 A;  3QPL A;  3WHB A;  3ZQG A;  3VUQ A;  3F1B A;  2Y31 A;  2IAI A;  2NP3 A;  4MO7 A;  2QCO A;  3VW0 A;  2IEK A;  5F0H A;  4KWA A;  3HGG A;  3QPS A;  1Z77 A;  3BR6 A;  2XGE A;  3RH2 A;  5CXG A;  2UXU A;  5IP6 A;  1ORK A;  3Q3S A;  2FQ4 A;  3SDG A;  3IH4 A;  2G3B A;  3AQT A;  3QBM A;  4ABZ A;  3IH2 A;  2JK3 A;  3BTL A;  2VPR A;  3TP3 A;  3CRJ A;  5FMP A;  3VP5 A;  3BTC A;  3COL A;  3BTI A;  1Z0X A;  5D1R A;  4CGR A;  3KZ9 A;  2XRL A;  2VKE A;  4D5C A;  4GCK A;  3B6A A;  5K7F A;  4JNN A;  4YZE A;  4W1U A;  2I10 A;  5FHP A;  3NPI A;  2ID6 A;  3CWR A;  3V78 A;  5HAW A;  2TCT A;  2PBX A;  3Q0W A;  5FKL A;  2DG8 A;  2QKO A;  5IOZ A;  5FGL A;  3NI7 A;  1QVT A;  2WGB A;  3VPR A;  3ON4 A;  2UXI A;  3G56 A;  5FKK A;  2UXO A;  5GP9 A;  4JL3 A;  3S5R A;  3BCG A;  2YVE A;  5F1J A;  2REK A;  4JKZ A;  5J1U A;  5K7Z A;  1A6I A;  2ZCN A;  3C2B A;  4M3G A;  3P9T A;  2Y2Z A;  3JSJ A;  5HBU A;  3FK7 A;  2ZOZ A;  2NP5 A;  5H9T A;  3HIM A;  5J3L A;  3ON2 A;  5EZG A;  2OPT A;  4ME9 A;  2GBY A;  3PM1 A;  5EZH A;  3BR5 A;  5IPA A;  3BR1 A;  2ZCX A;  2UXP A;  3ANG A;  5DAJ A;  5FKN A;  3E7Q A;  4DW6 A;  2W53 A;  3BT9 A;  2UXH A;  3BR2 A;  3BR0 A;  3GZI A;  3HTI A;  5AQC A;  3O8H A;  4AC0 A;  2G0E A;  4GFK A;  3LSP A;  2RHA A;  2HYJ A;  2HXI A;  5FKO A;  5F08 A;  3G1O A;  1JUP A;  1SGM A;  2XB5 A;  5F0F A;  3G7R A;  5CXI A;  3LSR A;  5D18 A;  2HKU A;  4ACI A;  4X1E A;  1RKT A;  3CCY A;  1RPW A;  5GPA A;  5C4Y A;  2FX0 A;  3NRG A;  5D19 A;  3ZQL A;  5F04 A;  3VIB A;  1JT0 A;  3MVP A;  1BJZ A;  3BTJ A;  1JUS A;  3PAS A;  3F0C A;  3LJL A;  5K7H A;  1U9N A;  3LOC A;  2V57 A;  3BHQ A;  4AUX A;  1QVU A;  2XPW A;  2X6O A;  3IUV A;  4PXI A;  1VI0 A;  3Q0U A;  2ZB9 A;  2EH3 A;  3LWJ A;  2OF7 A;  1JTY A;  3ZQF A;  4M3F A;  3KNW A;  4AF5 A;  2TRT A;  1JUM A;  4G12 A;  4V2F A;  4GCT A;  3DPJ A;  2D6Y A;  1QPI A;  4ICH A;  1T56 A;  3KKC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...