3KKCA

The crystal structure of tetr transcriptional regulator from streptococcus agalactiae 2603v
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
177
structure length
177
Chain Sequence
SNAMVKDRQIQKTKVAIYNAFISLLQENDYSKITVQDVIGLANVGRSTFYSHYESKEVLLKELCEDLFHHLFKQGRDVTFEEYLVHILKHFEQNQDSIATLLLSDDPYFLLRFRSELEHDVYPRLREEYITKVDIPEDFLKQFLLSSFIETLKWWLHQRQKMTVEDLLKYYLTMVER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TetR family Transcriptional regulator
publication title The crystal structure OF TetR transcriptional regulator from Streptococcus agalactiae 2603V
rcsb
source organism Streptococcus agalactiae 2603v/r
molecule tags Transcription regulator
total genus 64
structure length 177
sequence length 177
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF14278 TetR_C_8 Transcriptional regulator C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3kkcA01
4AC0A 1U9NA 3HTJA 4MO7A 2HXOA 3VVXA 3HIMA 3KKCA 2V57A 4GCKA 5K58A 3SFIA 5C4YA 2PZ9A 1RKTA 2DTZA 2W53A 4ABZA 3E7QA 4I6ZA 1JT6A 1VI0A 3BHQA 3Q3SA 3HGGA 2UXPA 3NI7A 2RHAA 2ID3A 4AF5A 1U9OA 4M3FA 3IH3A 3ZQHA 1BJZA 3SDGA 2ZOZA 3LOCA 5HBUA 3BT9A 5CW8A 5CXIA 3LHQA 2IU5A 5F0CA 1Z0XA 4M3DA 3PASA 5HAWA 3QBMA 3NRGA 5J1UA 3FK6A 3G7RA 3BJBA 3V78A 4D7MA 5EZHA 3V6GA 4PXIA 2NS8A 5F08A 4GFKA 4NN1A 3G1OA 2O7TA 1RPWA 3ON4A 4L62A 3ZQLA 2VKEA 4NELA 2ZCXA 3BR3A 3EUPA 3RH2A 2OI8A 2Y30A 2NP3A 5J1YA 5EFYA 4CGRA 2TRTA 5F0FA 4D5CA 5D19A 2G3BA 3ANPA 3PPBA 2WUIA 3O8HA 4KWAA 5FKMA 1JUPA 5FKNA 5FKLA 2HYTA 3CCYA 3EGQA 2XB5A 5IOYA 5IPAA 1SGMA 5F0HA 2GFNA 4V2FA 3BRUA 1ZKGA 2FQ4A 3TP3A 3KZ9A 3F1BA 3CWRA 4M3GA 3COLA 3BTLA 2HQ5A 2ZCNA 2WGBA 3S5RA 2G7LA 2XGEA 2ZB9A 2VKVA 4JYKA 3T6NA 2WV1A 2OF7A 3ZQFA 5HSZA 3GZIA 3HTHA 3LWJA 1UI6A 2I10A 5D1RA 3IUVA 5GPAA 3VVYA 4V2GA 3AQSA 2D6YA 1QPIA 3VOKA 1UI5A 1JT0A 3QQAA 2X6OA 5FHPA 3HE0A 3WHCA 2HYJA 2UXOA 3P9TA 2UXUA 3BTJA 2XGCA 3C07A 5EZGA 2QCOA 3Q0WA 5D18A 5GP9A 3NNRA 4YZEA 4MK6A 2XPWA 3C2BA 4GCLA 5F1JA 3ZQIA 3NPIA 3BR2A 1A6IA 5AQCA 3B81A 2HKUA 2EH3A 2F07A 4JNNA 3G56A 2DG7A 3G1MA 2GENA 3FK7A 5H9TA 5F04A 1JTYA 1QVUA 1ZK8A 3LJLA 3PM1A 3BR5A 2FBQA 2ZOYA 5IOZA 2XRLA 3CJDA 5FKKA 1JTXA 1JUSA 2NS7A 2OERA 2XDNA 5CXGA 2O7OA 1RKWA 2IAIA 3DPJA 3F0CA 3AQTA 5EYRA 3Q0UA 3VW0A 4X1EA 2QKOA 2Y31A 3HGYA 3WHBA 4ME9A 3VUQA 3JSJA 3VVZA 4B3AA 3QPLA 3QKXA 2QTQA 3BR1A 2RAEA 2UXHA 2DG8A 2ZCMA 3VW1A 3QPSA 4W97A 5GPCA 3O8GA 4UDSA 1QVTA 3MNLA 5J3LA 3KNWA 1T33A 2NP5A 2QOPA 3VPRA 2PBXA 4I76A 2RASA 3FIWA 2JJ7A 1T56A 3G1LA 3HTAA 2Q24A 3BNIA 2X9DA 3MVPA 3BTIA 5DAJA 3HTIA 5K7FA 2HXIA 2ID6A 2GUHA 2XGDA 3B6AA 4D5FA 4AC6A 3BR6A 3BR0A 3CRJA 2G0EA 3GEUA 4B1RA 4M3BA 2QWTA 4M3EA 4JL3A 3NXCA 5K7HA 5IP6A 2QIBA 2YVHA 1ORKA 2UXIA 3BQZA 4GFLA 2OPTA 4D7NA 2G7GA 3BQYA 3B6CA 2NX4A 3O60A 3TP0A 4G12A 2JK3A 2YVEA 3VIBA 3ON2A 3KKDA 3LSJA 4JKZA 3VW2A 3LSPA 3LSRA 4ICHA 3IH2A 2VPRA 3VOXA 3DCFA 2XPVA 2IEKA 3BTCA 5K7ZA 3FRQA 1Z77A 3ANGA 3ZQGA 4XK4A 2IBDA 2FX0A 1JUMA 4ACIA 5FGLA 4DW6A 3Q0VA 4AUXA 5FMPA 3DEWA 3IH4A 5F27A 2TCTA 2FD5A 2XPUA 4W1UA 3BCGA 2GBYA 3RD3A 4MXMA 5J1RA 3CDLA 2REKA 3VP5A 2FJ1A 4HKUA 2Y2ZA 5FKOA 2G7SA 4GCTA
chains in the Genus database with same CATH superfamily
4AC0A 1U9NA 3HTJA 4MO7A 2HXOA 3VVXA 3HIMA 4IRVA 3KKCA 4U9LA 2R7UA 2V57A 4GCKA 5K58A 3SFIA 5C4YA 2PZ9A 1RKTA 2DTZA 2W53A 4ABZA 3E7QA 4I6ZA 1JT6A 1VI0A 3BHQA 3Q3SA 3HGGA 2R7TA 2UXPA 3NI7A 2RHAA 2ID3A 4AF5A 1U9OA 4M3FA 3IH3A 3ZQHA 1BJZA 3SDGA 2ZOZA 3LOCA 5HBUA 3BT9A 5CW8A 5CXIA 3LHQA 2IU5A 5F0CA 1Z0XA 4M3DA 2R7SA 3PASA 5HAWA 3QBMA 3NRGA 5J1UA 3FK6A 3G7RA 3BJBA 3V78A 4D7MA 5EZHA 3V6GA 4DVYP 4PXIA 2NS8A 5F08A 4GFKA 4NN1A 3G1OA 2O7TA 1RPWA 3K8PC 2R7QA 3ON4A 4L62A 3ZQLA 4NELA 2VKEA 2ZCXA 3BR3A 3EUPA 3RH2A 2OI8A 2Y30A 2NP3A 5J1YA 5EFYA 4CGRA 2TRTA 5F0FA 4D5CA 5D19A 2G3BA 3ANPA 3PPBA 2WUIA 3O8HA 4KWAA 5FKMA 1JUPA 5FKNA 5FKLA 2HYTA 3CCYA 3EGQA 2XB5A 5IOYA 5IPAA 4C2MA 1SGMA 5F0HA 2GFNA 4V2FA 3BRUA 1ZKGA 2FQ4A 3TP3A 3KZ9A 3F1BA 3CWRA 4M3GA 3COLA 3BTLA 2HQ5A 2ZCNA 2WGBA 3S5RA 2G7LA 2XGEA 2ZB9A 2VKVA 4JYKA 2B3WA 3T6NA 2WV1A 2OF7A 3ZQFA 5HSZA 3GZIA 3HTHA 3LWJA 1UI6A 2I10A 5D1RA 3IUVA 5GPAA 3VVYA 4V2GA 3AQSA 2D6YA 1QPIA 3VOKA 1UI5A 1JT0A 3QQAA 2X6OA 5FHPA 2A2FX 3HE0A 3WHCA 3KYLA 2HYJA 2UXOA 3P9TA 3SWHA 3DU5A 2UXUA 3BTJA 2XGCA 3C07A 5EZGA 2QCOA 3Q0WA 5D18A 5GP9A 3NNRA 4YZEA 4MK6A 2XPWA 3C2BA 4GCLA 5F1JA 3ZQIA 3NPIA 3BR2A 1A6IA 5AQCA 3B81A 2HKUA 2EH3A 2F07A 4OD4A 4JNNA 3G56A 2DG7A 3G1MA 2GENA 2R7RA 3FK7A 5H9TA 5F04A 1JTYA 2PFVA 1QVUA 1ZK8A 3LJLA 3PM1A 3BR5A 2FBQA 2ZOYA 5IOZA 2XRLA 3CJDA 2R7XA 5FKKA 1JTXA 1JUSA 3FHNA 2NS7A 3VTIA 4U9NA 2OERA 2XDNA 5CXGA 2O7OA 1RKWA 2IAIA 3DPJA 3F0CA 3AQTA 5EYRA 3Q0UA 3VW0A 4X1EA 2QKOA 2Y31A 3HGYA 3WHBA 2ZY9A 4ME9A 3VUQA 3JSJA 3VVZA 2R7VA 4B3AA 3QPLA 3QKXA 2QTQA 3BR1A 2RAEA 2UXHA 2DG8A 2ZCMA 3VW1A 3QPSA 4W97A 5GPCA 3O8GA 4UDSA 1QVTA 3MNLA 5J3LA 4OD5A 3KNWA 2R7OA 1T33A 2NP5A 2QOPA 2PBXA 3VPRA 4I76A 2RASA 3FIWA 3DU6A 2JJ7A 1T56A 3G1LA 3HTAA 2Q24A 3BNIA 2X9DA 3MVPA 3BTIA 5DAJA 3HTIA 5K7FA 2HXIA 2ID6A 2GUHA 2XGDA 3B6AA 4D5FA 4AC6A 3BR6A 5CQGA 3BR0A 3CRJA 2G0EA 3GEUA 4B1RA 4M3BA 2QWTA 4M3EA 4JL3A 3NXCA 5K7HA 5IP6A 2QIBA 2YVHA 1ORKA 2UXIA 3BQZA 4GFLA 2OPTA 4D7NA 2G7GA 3BQYA 3B6CA 2NX4A 3O60A 3TP0A 4G12A 2JK3A 2YVEA 3VIBA 3ON2A 3KKDA 3LSJA 4JKZA 2R7WA 3VW2A 3LSPA 3LSRA 4ICHA 3IH2A 2FJI1 2VPRA 3VOXA 3DCFA 2XPVA 2IEKA 3BTCA 5K7ZA 3FRQA 1Z77A 3ANGA 3ZQGA 4XK4A 2IBDA 2FX0A 1JUMA 4ACIA 5FGLA 4DW6A 3Q0VA 4AUXA 5FMPA 3DEWA 3IH4A 5F27A 2TCTA 2FD5A 2XPUA 4W1UA 3BCGA 4WIBA 2GBYA 3RD3A 4MXMA 5J1RA 2YVXA 2REKA 3CDLA 3VP5A 2FJ1A 4HKUA 2Y2ZA 3NS4A 5FKOA 2G7SA 4GCTA 2B1EA
chains in the Genus database with same CATH topology
4AC0A 1U9NA 3HTJA 4MO7A 2HXOA 3VVXA 3HIMA 3KKCA 2V57A 4GCKA 5K58A 3SFIA 5C4YA 2PZ9A 1RKTA 2DTZA 2W53A 4ABZA 3E7QA 4I6ZA 1JT6A 1VI0A 3BHQA 3Q3SA 3HGGA 2UXPA 3NI7A 2RHAA 2ID3A 4AF5A 1U9OA 4M3FA 3IH3A 3ZQHA 1BJZA 3SDGA 2ZOZA 3LOCA 5HBUA 3BT9A 5CW8A 5CXIA 3LHQA 2IU5A 5F0CA 1Z0XA 4M3DA 3PASA 5HAWA 3QBMA 3NRGA 5J1UA 3FK6A 3G7RA 3BJBA 3V78A 4D7MA 5EZHA 3V6GA 4PXIA 2NS8A 5F08A 4GFKA 4NN1A 3G1OA 2O7TA 1RPWA 3ON4A 4L62A 3ZQLA 2VKEA 4NELA 2ZCXA 3BR3A 3EUPA 3RH2A 2OI8A 2Y30A 2NP3A 5J1YA 5EFYA 4CGRA 2TRTA 5F0FA 4D5CA 5D19A 2G3BA 3ANPA 3PPBA 2WUIA 3O8HA 4KWAA 5FKMA 1JUPA 5FKNA 5FKLA 2HYTA 3CCYA 3EGQA 2XB5A 5IOYA 5IPAA 1SGMA 5F0HA 2GFNA 4V2FA 3BRUA 1ZKGA 2FQ4A 3TP3A 3KZ9A 3F1BA 3CWRA 4M3GA 3COLA 3BTLA 2HQ5A 2ZCNA 2WGBA 3S5RA 2G7LA 2XGEA 2ZB9A 2VKVA 4JYKA 3T6NA 2WV1A 2OF7A 3ZQFA 5HSZA 3GZIA 3HTHA 3LWJA 1UI6A 2I10A 5D1RA 3IUVA 5GPAA 3VVYA 4V2GA 3AQSA 2D6YA 1QPIA 3VOKA 1UI5A 1JT0A 3QQAA 2X6OA 5FHPA 3HE0A 3WHCA 2HYJA 2UXOA 3P9TA 2UXUA 3BTJA 2XGCA 3C07A 5EZGA 2QCOA 3Q0WA 5D18A 5GP9A 3NNRA 4YZEA 4MK6A 2XPWA 3C2BA 4GCLA 5F1JA 3ZQIA 3NPIA 3BR2A 1A6IA 5AQCA 3B81A 2HKUA 2EH3A 2F07A 4JNNA 3G56A 2DG7A 3G1MA 2GENA 3FK7A 5H9TA 5F04A 1JTYA 1QVUA 1ZK8A 3LJLA 3PM1A 3BR5A 2FBQA 2ZOYA 5IOZA 2XRLA 3CJDA 5FKKA 1JTXA 1JUSA 2NS7A 2OERA 2XDNA 5CXGA 2O7OA 1RKWA 2IAIA 3DPJA 3F0CA 3AQTA 5EYRA 3Q0UA 3VW0A 4X1EA 2QKOA 2Y31A 3HGYA 3WHBA 4ME9A 3VUQA 3JSJA 3VVZA 4B3AA 3QPLA 3QKXA 2QTQA 3BR1A 2RAEA 2UXHA 2DG8A 2ZCMA 3VW1A 3QPSA 4W97A 5GPCA 3O8GA 4UDSA 1QVTA 3MNLA 5J3LA 3KNWA 1T33A 2NP5A 2QOPA 3VPRA 2PBXA 4I76A 2RASA 3FIWA 2JJ7A 1T56A 3G1LA 3HTAA 2Q24A 3BNIA 2X9DA 3MVPA 3BTIA 5DAJA 3HTIA 5K7FA 2HXIA 2ID6A 2GUHA 2XGDA 3B6AA 4D5FA 4AC6A 3BR6A 3BR0A 3CRJA 2G0EA 3GEUA 4B1RA 4M3BA 2QWTA 4M3EA 4JL3A 3NXCA 5K7HA 5IP6A 2QIBA 2YVHA 1ORKA 2UXIA 3BQZA 4GFLA 2OPTA 4D7NA 2G7GA 3BQYA 3B6CA 2NX4A 3O60A 3TP0A 4G12A 2JK3A 2YVEA 3VIBA 3ON2A 3KKDA 3LSJA 4JKZA 3VW2A 3LSPA 3LSRA 4ICHA 3IH2A 2VPRA 3VOXA 3DCFA 2XPVA 2IEKA 3BTCA 5K7ZA 3FRQA 1Z77A 3ANGA 3ZQGA 4XK4A 2IBDA 2FX0A 1JUMA 4ACIA 5FGLA 4DW6A 3Q0VA 4AUXA 5FMPA 3DEWA 3IH4A 5F27A 2TCTA 2FD5A 2XPUA 4W1UA 3BCGA 2GBYA 3RD3A 4MXMA 5J1RA 3CDLA 2REKA 3VP5A 2FJ1A 4HKUA 2Y2ZA 5FKOA 2G7SA 4GCTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AC0 A;  1U9N A;  3HTJ A;  4MO7 A;  2HXO A;  3VVX A;  3HIM A;  3KKC A;  2V57 A;  4GCK A;  5K58 A;  3SFI A;  5C4Y A;  2PZ9 A;  1RKT A;  2DTZ A;  2W53 A;  4ABZ A;  3E7Q A;  4I6Z A;  1JT6 A;  1VI0 A;  3BHQ A;  3Q3S A;  3HGG A;  2UXP A;  3NI7 A;  2RHA A;  2ID3 A;  4AF5 A;  1U9O A;  4M3F A;  3IH3 A;  3ZQH A;  1BJZ A;  3SDG A;  2ZOZ A;  3LOC A;  5HBU A;  3BT9 A;  5CW8 A;  5CXI A;  3LHQ A;  2IU5 A;  5F0C A;  1Z0X A;  4M3D A;  3PAS A;  5HAW A;  3QBM A;  3NRG A;  5J1U A;  3FK6 A;  3G7R A;  3BJB A;  3V78 A;  4D7M A;  5EZH A;  3V6G A;  4PXI A;  2NS8 A;  5F08 A;  4GFK A;  4NN1 A;  3G1O A;  2O7T A;  1RPW A;  3ON4 A;  4L62 A;  3ZQL A;  2VKE A;  4NEL A;  2ZCX A;  3BR3 A;  3EUP A;  3RH2 A;  2OI8 A;  2Y30 A;  2NP3 A;  5J1Y A;  5EFY A;  4CGR A;  2TRT A;  5F0F A;  4D5C A;  5D19 A;  2G3B A;  3ANP A;  3PPB A;  2WUI A;  3O8H A;  4KWA A;  5FKM A;  1JUP A;  5FKN A;  5FKL A;  2HYT A;  3CCY A;  3EGQ A;  2XB5 A;  5IOY A;  5IPA A;  1SGM A;  5F0H A;  2GFN A;  4V2F A;  3BRU A;  1ZKG A;  2FQ4 A;  3TP3 A;  3KZ9 A;  3F1B A;  3CWR A;  4M3G A;  3COL A;  3BTL A;  2HQ5 A;  2ZCN A;  2WGB A;  3S5R A;  2G7L A;  2XGE A;  2ZB9 A;  2VKV A;  4JYK A;  3T6N A;  2WV1 A;  2OF7 A;  3ZQF A;  5HSZ A;  3GZI A;  3HTH A;  3LWJ A;  1UI6 A;  2I10 A;  5D1R A;  3IUV A;  5GPA A;  3VVY A;  4V2G A;  3AQS A;  2D6Y A;  1QPI A;  3VOK A;  1UI5 A;  1JT0 A;  3QQA A;  2X6O A;  5FHP A;  3HE0 A;  3WHC A;  2HYJ A;  2UXO A;  3P9T A;  2UXU A;  3BTJ A;  2XGC A;  3C07 A;  5EZG A;  2QCO A;  3Q0W A;  5D18 A;  5GP9 A;  3NNR A;  4YZE A;  4MK6 A;  2XPW A;  3C2B A;  4GCL A;  5F1J A;  3ZQI A;  3NPI A;  3BR2 A;  1A6I A;  5AQC A;  3B81 A;  2HKU A;  2EH3 A;  2F07 A;  4JNN A;  3G56 A;  2DG7 A;  3G1M A;  2GEN A;  3FK7 A;  5H9T A;  5F04 A;  1JTY A;  1QVU A;  1ZK8 A;  3LJL A;  3PM1 A;  3BR5 A;  2FBQ A;  2ZOY A;  5IOZ A;  2XRL A;  3CJD A;  5FKK A;  1JTX A;  1JUS A;  2NS7 A;  2OER A;  2XDN A;  5CXG A;  2O7O A;  1RKW A;  2IAI A;  3DPJ A;  3F0C A;  3AQT A;  5EYR A;  3Q0U A;  3VW0 A;  4X1E A;  2QKO A;  2Y31 A;  3HGY A;  3WHB A;  4ME9 A;  3VUQ A;  3JSJ A;  3VVZ A;  4B3A A;  3QPL A;  3QKX A;  2QTQ A;  3BR1 A;  2RAE A;  2UXH A;  2DG8 A;  2ZCM A;  3VW1 A;  3QPS A;  4W97 A;  5GPC A;  3O8G A;  4UDS A;  1QVT A;  3MNL A;  5J3L A;  3KNW A;  1T33 A;  2NP5 A;  2QOP A;  3VPR A;  2PBX A;  4I76 A;  2RAS A;  3FIW A;  2JJ7 A;  1T56 A;  3G1L A;  3HTA A;  2Q24 A;  3BNI A;  2X9D A;  3MVP A;  3BTI A;  5DAJ A;  3HTI A;  5K7F A;  2HXI A;  2ID6 A;  2GUH A;  2XGD A;  3B6A A;  4D5F A;  4AC6 A;  3BR6 A;  3BR0 A;  3CRJ A;  2G0E A;  3GEU A;  4B1R A;  4M3B A;  2QWT A;  4M3E A;  4JL3 A;  3NXC A;  5K7H A;  5IP6 A;  2QIB A;  2YVH A;  1ORK A;  2UXI A;  3BQZ A;  4GFL A;  2OPT A;  4D7N A;  2G7G A;  3BQY A;  3B6C A;  2NX4 A;  3O60 A;  3TP0 A;  4G12 A;  2JK3 A;  2YVE A;  3VIB A;  3ON2 A;  3KKD A;  3LSJ A;  4JKZ A;  3VW2 A;  3LSP A;  3LSR A;  4ICH A;  3IH2 A;  2VPR A;  3VOX A;  3DCF A;  2XPV A;  2IEK A;  3BTC A;  5K7Z A;  3FRQ A;  1Z77 A;  3ANG A;  3ZQG A;  4XK4 A;  2IBD A;  2FX0 A;  1JUM A;  4ACI A;  5FGL A;  4DW6 A;  3Q0V A;  4AUX A;  5FMP A;  3DEW A;  3IH4 A;  5F27 A;  2TCT A;  2FD5 A;  2XPU A;  4W1U A;  3BCG A;  2GBY A;  3RD3 A;  4MXM A;  5J1R A;  3CDL A;  2REK A;  3VP5 A;  2FJ1 A;  4HKU A;  2Y2Z A;  5FKO A;  2G7S A;  4GCT A; 
#chains in the Genus database with same CATH topology
 4AC0 A;  1U9N A;  3HTJ A;  4MO7 A;  2HXO A;  3VVX A;  3HIM A;  4IRV A;  3KKC A;  4U9L A;  2R7U A;  2V57 A;  4GCK A;  5K58 A;  3SFI A;  5C4Y A;  2PZ9 A;  1RKT A;  2DTZ A;  2W53 A;  4ABZ A;  3E7Q A;  4I6Z A;  1JT6 A;  1VI0 A;  3BHQ A;  3Q3S A;  3HGG A;  2R7T A;  2UXP A;  3NI7 A;  2RHA A;  2ID3 A;  4AF5 A;  1U9O A;  4M3F A;  3IH3 A;  3ZQH A;  1BJZ A;  3SDG A;  2ZOZ A;  3LOC A;  5HBU A;  3BT9 A;  5CW8 A;  5CXI A;  3LHQ A;  2IU5 A;  5F0C A;  1Z0X A;  4M3D A;  2R7S A;  3PAS A;  5HAW A;  3QBM A;  3NRG A;  5J1U A;  3FK6 A;  3G7R A;  3BJB A;  3V78 A;  4D7M A;  5EZH A;  3V6G A;  4DVY P;  4PXI A;  2NS8 A;  5F08 A;  4GFK A;  4NN1 A;  3G1O A;  2O7T A;  1RPW A;  3K8P C;  2R7Q A;  3ON4 A;  4L62 A;  3ZQL A;  4NEL A;  2VKE A;  2ZCX A;  3BR3 A;  3EUP A;  3RH2 A;  2OI8 A;  2Y30 A;  2NP3 A;  5J1Y A;  5EFY A;  4CGR A;  2TRT A;  5F0F A;  4D5C A;  5D19 A;  2G3B A;  3ANP A;  3PPB A;  2WUI A;  3O8H A;  4KWA A;  5FKM A;  1JUP A;  5FKN A;  5FKL A;  2HYT A;  3CCY A;  3EGQ A;  2XB5 A;  5IOY A;  5IPA A;  4C2M A;  1SGM A;  5F0H A;  2GFN A;  4V2F A;  3BRU A;  1ZKG A;  2FQ4 A;  3TP3 A;  3KZ9 A;  3F1B A;  3CWR A;  4M3G A;  3COL A;  3BTL A;  2HQ5 A;  2ZCN A;  2WGB A;  3S5R A;  2G7L A;  2XGE A;  2ZB9 A;  2VKV A;  4JYK A;  2B3W A;  3T6N A;  2WV1 A;  2OF7 A;  3ZQF A;  5HSZ A;  3GZI A;  3HTH A;  3LWJ A;  1UI6 A;  2I10 A;  5D1R A;  3IUV A;  5GPA A;  3VVY A;  4V2G A;  3AQS A;  2D6Y A;  1QPI A;  3VOK A;  1UI5 A;  1JT0 A;  3QQA A;  2X6O A;  5FHP A;  2A2F X;  3HE0 A;  3WHC A;  3KYL A;  2HYJ A;  2UXO A;  3P9T A;  3SWH A;  3DU5 A;  2UXU A;  3BTJ A;  2XGC A;  3C07 A;  5EZG A;  2QCO A;  3Q0W A;  5D18 A;  5GP9 A;  3NNR A;  4YZE A;  4MK6 A;  2XPW A;  3C2B A;  4GCL A;  5F1J A;  3ZQI A;  3NPI A;  3BR2 A;  1A6I A;  5AQC A;  3B81 A;  2HKU A;  2EH3 A;  2F07 A;  4OD4 A;  4JNN A;  3G56 A;  2DG7 A;  3G1M A;  2GEN A;  2R7R A;  3FK7 A;  5H9T A;  5F04 A;  1JTY A;  2PFV A;  1QVU A;  1ZK8 A;  3LJL A;  3PM1 A;  3BR5 A;  2FBQ A;  2ZOY A;  5IOZ A;  2XRL A;  3CJD A;  2R7X A;  5FKK A;  1JTX A;  1JUS A;  3FHN A;  2NS7 A;  3VTI A;  4U9N A;  2OER A;  2XDN A;  5CXG A;  2O7O A;  1RKW A;  2IAI A;  3DPJ A;  3F0C A;  3AQT A;  5EYR A;  3Q0U A;  3VW0 A;  4X1E A;  2QKO A;  2Y31 A;  3HGY A;  3WHB A;  2ZY9 A;  4ME9 A;  3VUQ A;  3JSJ A;  3VVZ A;  2R7V A;  4B3A A;  3QPL A;  3QKX A;  2QTQ A;  3BR1 A;  2RAE A;  2UXH A;  2DG8 A;  2ZCM A;  3VW1 A;  3QPS A;  4W97 A;  5GPC A;  3O8G A;  4UDS A;  1QVT A;  3MNL A;  5J3L A;  4OD5 A;  3KNW A;  2R7O A;  1T33 A;  2NP5 A;  2QOP A;  2PBX A;  3VPR A;  4I76 A;  2RAS A;  3FIW A;  3DU6 A;  2JJ7 A;  1T56 A;  3G1L A;  3HTA A;  2Q24 A;  3BNI A;  2X9D A;  3MVP A;  3BTI A;  5DAJ A;  3HTI A;  5K7F A;  2HXI A;  2ID6 A;  2GUH A;  2XGD A;  3B6A A;  4D5F A;  4AC6 A;  3BR6 A;  5CQG A;  3BR0 A;  3CRJ A;  2G0E A;  3GEU A;  4B1R A;  4M3B A;  2QWT A;  4M3E A;  4JL3 A;  3NXC A;  5K7H A;  5IP6 A;  2QIB A;  2YVH A;  1ORK A;  2UXI A;  3BQZ A;  4GFL A;  2OPT A;  4D7N A;  2G7G A;  3BQY A;  3B6C A;  2NX4 A;  3O60 A;  3TP0 A;  4G12 A;  2JK3 A;  2YVE A;  3VIB A;  3ON2 A;  3KKD A;  3LSJ A;  4JKZ A;  2R7W A;  3VW2 A;  3LSP A;  3LSR A;  4ICH A;  3IH2 A;  2FJI 1;  2VPR A;  3VOX A;  3DCF A;  2XPV A;  2IEK A;  3BTC A;  5K7Z A;  3FRQ A;  1Z77 A;  3ANG A;  3ZQG A;  4XK4 A;  2IBD A;  2FX0 A;  1JUM A;  4ACI A;  5FGL A;  4DW6 A;  3Q0V A;  4AUX A;  5FMP A;  3DEW A;  3IH4 A;  5F27 A;  2TCT A;  2FD5 A;  2XPU A;  4W1U A;  3BCG A;  4WIB A;  2GBY A;  3RD3 A;  4MXM A;  5J1R A;  2YVX A;  2REK A;  3CDL A;  3VP5 A;  2FJ1 A;  4HKU A;  2Y2Z A;  3NS4 A;  5FKO A;  2G7S A;  4GCT A;  2B1E A; 
#chains in the Genus database with same CATH homology
 4AC0 A;  1U9N A;  3HTJ A;  4MO7 A;  2HXO A;  3VVX A;  3HIM A;  3KKC A;  2V57 A;  4GCK A;  5K58 A;  3SFI A;  5C4Y A;  2PZ9 A;  1RKT A;  2DTZ A;  2W53 A;  4ABZ A;  3E7Q A;  4I6Z A;  1JT6 A;  1VI0 A;  3BHQ A;  3Q3S A;  3HGG A;  2UXP A;  3NI7 A;  2RHA A;  2ID3 A;  4AF5 A;  1U9O A;  4M3F A;  3IH3 A;  3ZQH A;  1BJZ A;  3SDG A;  2ZOZ A;  3LOC A;  5HBU A;  3BT9 A;  5CW8 A;  5CXI A;  3LHQ A;  2IU5 A;  5F0C A;  1Z0X A;  4M3D A;  3PAS A;  5HAW A;  3QBM A;  3NRG A;  5J1U A;  3FK6 A;  3G7R A;  3BJB A;  3V78 A;  4D7M A;  5EZH A;  3V6G A;  4PXI A;  2NS8 A;  5F08 A;  4GFK A;  4NN1 A;  3G1O A;  2O7T A;  1RPW A;  3ON4 A;  4L62 A;  3ZQL A;  2VKE A;  4NEL A;  2ZCX A;  3BR3 A;  3EUP A;  3RH2 A;  2OI8 A;  2Y30 A;  2NP3 A;  5J1Y A;  5EFY A;  4CGR A;  2TRT A;  5F0F A;  4D5C A;  5D19 A;  2G3B A;  3ANP A;  3PPB A;  2WUI A;  3O8H A;  4KWA A;  5FKM A;  1JUP A;  5FKN A;  5FKL A;  2HYT A;  3CCY A;  3EGQ A;  2XB5 A;  5IOY A;  5IPA A;  1SGM A;  5F0H A;  2GFN A;  4V2F A;  3BRU A;  1ZKG A;  2FQ4 A;  3TP3 A;  3KZ9 A;  3F1B A;  3CWR A;  4M3G A;  3COL A;  3BTL A;  2HQ5 A;  2ZCN A;  2WGB A;  3S5R A;  2G7L A;  2XGE A;  2ZB9 A;  2VKV A;  4JYK A;  3T6N A;  2WV1 A;  2OF7 A;  3ZQF A;  5HSZ A;  3GZI A;  3HTH A;  3LWJ A;  1UI6 A;  2I10 A;  5D1R A;  3IUV A;  5GPA A;  3VVY A;  4V2G A;  3AQS A;  2D6Y A;  1QPI A;  3VOK A;  1UI5 A;  1JT0 A;  3QQA A;  2X6O A;  5FHP A;  3HE0 A;  3WHC A;  2HYJ A;  2UXO A;  3P9T A;  2UXU A;  3BTJ A;  2XGC A;  3C07 A;  5EZG A;  2QCO A;  3Q0W A;  5D18 A;  5GP9 A;  3NNR A;  4YZE A;  4MK6 A;  2XPW A;  3C2B A;  4GCL A;  5F1J A;  3ZQI A;  3NPI A;  3BR2 A;  1A6I A;  5AQC A;  3B81 A;  2HKU A;  2EH3 A;  2F07 A;  4JNN A;  3G56 A;  2DG7 A;  3G1M A;  2GEN A;  3FK7 A;  5H9T A;  5F04 A;  1JTY A;  1QVU A;  1ZK8 A;  3LJL A;  3PM1 A;  3BR5 A;  2FBQ A;  2ZOY A;  5IOZ A;  2XRL A;  3CJD A;  5FKK A;  1JTX A;  1JUS A;  2NS7 A;  2OER A;  2XDN A;  5CXG A;  2O7O A;  1RKW A;  2IAI A;  3DPJ A;  3F0C A;  3AQT A;  5EYR A;  3Q0U A;  3VW0 A;  4X1E A;  2QKO A;  2Y31 A;  3HGY A;  3WHB A;  4ME9 A;  3VUQ A;  3JSJ A;  3VVZ A;  4B3A A;  3QPL A;  3QKX A;  2QTQ A;  3BR1 A;  2RAE A;  2UXH A;  2DG8 A;  2ZCM A;  3VW1 A;  3QPS A;  4W97 A;  5GPC A;  3O8G A;  4UDS A;  1QVT A;  3MNL A;  5J3L A;  3KNW A;  1T33 A;  2NP5 A;  2QOP A;  3VPR A;  2PBX A;  4I76 A;  2RAS A;  3FIW A;  2JJ7 A;  1T56 A;  3G1L A;  3HTA A;  2Q24 A;  3BNI A;  2X9D A;  3MVP A;  3BTI A;  5DAJ A;  3HTI A;  5K7F A;  2HXI A;  2ID6 A;  2GUH A;  2XGD A;  3B6A A;  4D5F A;  4AC6 A;  3BR6 A;  3BR0 A;  3CRJ A;  2G0E A;  3GEU A;  4B1R A;  4M3B A;  2QWT A;  4M3E A;  4JL3 A;  3NXC A;  5K7H A;  5IP6 A;  2QIB A;  2YVH A;  1ORK A;  2UXI A;  3BQZ A;  4GFL A;  2OPT A;  4D7N A;  2G7G A;  3BQY A;  3B6C A;  2NX4 A;  3O60 A;  3TP0 A;  4G12 A;  2JK3 A;  2YVE A;  3VIB A;  3ON2 A;  3KKD A;  3LSJ A;  4JKZ A;  3VW2 A;  3LSP A;  3LSR A;  4ICH A;  3IH2 A;  2VPR A;  3VOX A;  3DCF A;  2XPV A;  2IEK A;  3BTC A;  5K7Z A;  3FRQ A;  1Z77 A;  3ANG A;  3ZQG A;  4XK4 A;  2IBD A;  2FX0 A;  1JUM A;  4ACI A;  5FGL A;  4DW6 A;  3Q0V A;  4AUX A;  5FMP A;  3DEW A;  3IH4 A;  5F27 A;  2TCT A;  2FD5 A;  2XPU A;  4W1U A;  3BCG A;  2GBY A;  3RD3 A;  4MXM A;  5J1R A;  3CDL A;  2REK A;  3VP5 A;  2FJ1 A;  4HKU A;  2Y2Z A;  5FKO A;  2G7S A;  4GCT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...