3KKCA

The crystal structure of tetr transcriptional regulator from streptococcus agalactiae 2603v
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
177
structure length
177
Chain Sequence
SNAMVKDRQIQKTKVAIYNAFISLLQENDYSKITVQDVIGLANVGRSTFYSHYESKEVLLKELCEDLFHHLFKQGRDVTFEEYLVHILKHFEQNQDSIATLLLSDDPYFLLRFRSELEHDVYPRLREEYITKVDIPEDFLKQFLLSSFIETLKWWLHQRQKMTVEDLLKYYLTMVER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure OF TetR transcriptional regulator from Streptococcus agalactiae 2603V
rcsb
source organism Streptococcus agalactiae 2603v/r
molecule tags Transcription regulator
molecule keywords TetR family Transcriptional regulator
total genus 64
structure length 177
sequence length 177
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF14278 TetR_C_8 Transcriptional regulator C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3kkcA01
3GEUA 3VP5A 4JL3A 2HXOA 3MNLA 2XB5A 3HGGA 3F1BA 2ZOYA 4DW6A 2QIBA 3G1LA 3FK6A 3DCFA 4D5FA 4D7NA 2UXIA 3QPSA 2XDNA 2GENA 3BTJA 3HTJA 3FK7A 5F0HA 3TP0A 2GUHA 4ABZA 3BR0A 3ZQIA 2NX4A 4MK6A 2UXUA 3BTIA 2EH3A 4I76A 5GPAA 3CCYA 2WUIA 2FQ4A 3CJDA 2G7SA 5FHPA 3NXCA 2G7GA 2FX0A 3ZQLA 2JK3A 2G3BA 3VIBA 3VVZA 5C4YA 3V78A 3VUQA 3Q0VA 4AF5A 3BNIA 3RH2A 3NPIA 2FD5A 2HXIA 2W53A 3ON4A 2X9DA 3ANPA 2QWTA 4HKUA 2PBXA 3LSRA 3C07A 3BTLA 4AUXA 3S5RA 5F27A 3BQYA 2QKOA 4YZEA 5IP6A 3G1MA 3WHBA 3SFIA 4M3GA 4XK4A 3BJBA 3GZIA 2GBYA 2XGCA 2IEKA 4M3DA 3IH3A 4X1EA 3VW2A 2O7OA 3COLA 2NP5A 2JJ7A 5CXIA 3IH4A 2PZ9A 3PPBA 2XGDA 2RASA 5IOYA 5H9TA 2DG7A 2ID3A 4AC6A 2NS8A 2HYJA 4UDSA 4GFLA 4KWAA 2NS7A 5FKNA 4PXIA 4G12A 2HKUA 2XPWA 5FKMA 2HQ5A 4D5CA 3PASA 5F1JA 2UXHA 3G7RA 5EZGA 3BRUA 4ICHA 3BR2A 4NELA 1QVUA 4M3FA 4M3BA 4B1RA 2VPRA 1SGMA 3FIWA 4GCTA 2XPVA 5HSZA 2I10A 4GCKA 5GP9A 1A6IA 1JTYA 2VKEA 3O8HA 1JT0A 4I6ZA 5GPCA 3DPJA 4L62A 2RAEA 1ZK8A 1RPWA 2O7TA 2G0EA 5J1YA 3LJLA 1QVTA 5J3LA 3E7QA 3SDGA 4B3AA 1T56A 3BHQA 3BTCA 2V57A 1Z0XA 3HIMA 3G1OA 2IU5A 3IUVA 3B6AA 3QPLA 1JUPA 2TCTA 2G7LA 3MVPA 2VKVA 3RD3A 4JYKA 3LOCA 4M3EA 3EUPA 3VVYA 1QPIA 1Z77A 3ANGA 1VI0A 1RKWA 3VOXA 3Q0WA 1ORKA 2OERA 2ZCXA 2IAIA 3VPRA 3AQTA 5F0CA 3HTIA 3LHQA 4W1UA 4CGRA 3ON2A 3QQAA 3WHCA 5HAWA 3KNWA 4GCLA 3F0CA 3LWJA 2X6OA 1ZKGA 2QOPA 1T33A 4AC0A 4JKZA 2IBDA 5D18A 4GFKA 3BR1A 4ME9A 2OF7A 3KKDA 5K7ZA 2ZCNA 3HTAA 5EFYA 5D1RA 2ZCMA 2UXOA 2WV1A 2HYTA 5AQCA 5IOZA 2WGBA 3P9TA 5J1RA 3BR3A 2FBQA 1JT6A 1BJZA 3HE0A 2TRTA 3QKXA 3B6CA 4V2FA 3Q0UA 3NI7A 1UI6A 3BQZA 3CWRA 1U9NA 1JUMA 3HGYA 5HBUA 3TP3A 3NNRA 3Q3SA 5FGLA 5F08A 3BR5A 5FMPA 2ID6A 2ZOZA 3O60A 3QBMA 2FJ1A 5DAJA 2D6YA 5K7FA 3EGQA 2DG8A 3VOKA 2YVEA 3CDLA 2ZB9A 2DTZA 2QCOA 1RKTA 1U9OA 3ZQHA 2XGEA 2OPTA 2NP3A 4MO7A 4D7MA 2Y31A 3V6GA 3KKCA 3VW0A 2UXPA 5J1UA 3JSJA 5D19A 2OI8A 3FRQA 5EYRA 3CRJA 3LSJA 4W97A 2QTQA 5CXGA 5K7HA 2F07A 1JTXA 2XPUA 3BCGA 3IH2A 2RHAA 3G56A 2Q24A 5FKKA 2REKA 5K58A 3PM1A 2YVHA 1UI5A 3B81A 5F04A 5EZHA 3HTHA 1JUSA 2GFNA 3C2BA 2Y2ZA 5FKOA 3BT9A 3O8GA 5FKLA 3VW1A 2XRLA 5F0FA 3BR6A 3DEWA 4JNNA 3ZQGA 4NN1A 4V2GA 3VVXA 3LSPA 3T6NA 3NRGA 5CW8A 2Y30A 3KZ9A 3ZQFA 3AQSA 5IPAA 4MXMA 4ACIA
chains in the Genus database with same CATH superfamily
3GEUA 3VP5A 4JL3A 2HXOA 3MNLA 2XB5A 3HGGA 3F1BA 2R7TA 2ZOYA 4DW6A 2QIBA 2R7WA 3G1LA 2R7VA 3FK6A 3DCFA 4D5FA 4D7NA 2UXIA 3QPSA 2XDNA 2GENA 4IRVA 3BTJA 3HTJA 3FK7A 5F0HA 3TP0A 2GUHA 4ABZA 3NS4A 3BR0A 2B1EA 3ZQIA 2NX4A 4MK6A 2UXUA 3BTIA 2EH3A 4I76A 5GPAA 3CCYA 2WUIA 2FQ4A 3CJDA 2G7SA 5FHPA 3NXCA 2G7GA 2FX0A 3ZQLA 2JK3A 2G3BA 3VTIA 3VIBA 3VVZA 5C4YA 3V78A 3VUQA 3Q0VA 4AF5A 3BNIA 3RH2A 3NPIA 2FD5A 2HXIA 2W53A 3ON4A 2X9DA 3ANPA 2QWTA 4HKUA 2PBXA 3LSRA 3C07A 4U9LA 3BTLA 4AUXA 3S5RA 5F27A 3BQYA 2QKOA 4YZEA 5IP6A 3G1MA 3WHBA 3SFIA 4M3GA 4XK4A 3DU6A 2YVXA 3BJBA 3GZIA 2GBYA 2XGCA 2IEKA 4M3DA 2R7SA 3IH3A 4X1EA 3VW2A 2O7OA 3COLA 2NP5A 2JJ7A 5CXIA 3IH4A 2PZ9A 3PPBA 4WIBA 2XGDA 2RASA 5IOYA 5H9TA 2DG7A 2ID3A 4AC6A 2NS8A 2HYJA 4UDSA 4GFLA 4KWAA 2NS7A 5FKNA 4PXIA 4G12A 2HKUA 2XPWA 5FKMA 2HQ5A 4D5CA 3PASA 5F1JA 2UXHA 3G7RA 5EZGA 3BRUA 4ICHA 3BR2A 4NELA 1QVUA 4M3FA 4M3BA 4B1RA 2VPRA 3FHNA 1SGMA 2R7UA 2R7OA 3FIWA 4GCTA 2XPVA 5HSZA 2I10A 4GCKA 5CQGA 5GP9A 4OD4A 1A6IA 3K8PC 1JTYA 4U9NA 2VKEA 3O8HA 1JT0A 4I6ZA 2R7RA 5GPCA 3DPJA 4L62A 2RAEA 1ZK8A 3SWHA 1RPWA 2O7TA 2G0EA 5J1YA 3LJLA 1QVTA 5J3LA 3E7QA 3SDGA 4B3AA 1T56A 3BHQA 3BTCA 2V57A 1Z0XA 3HIMA 3G1OA 2IU5A 3IUVA 3B6AA 3QPLA 1JUPA 2TCTA 2G7LA 3MVPA 2VKVA 3RD3A 4JYKA 3LOCA 4M3EA 3EUPA 3VVYA 1QPIA 1Z77A 3ANGA 1VI0A 1RKWA 3VOXA 3Q0WA 1ORKA 2OERA 2ZCXA 2IAIA 3VPRA 3AQTA 5F0CA 3HTIA 3LHQA 4W1UA 4CGRA 3ON2A 3DU5A 3QQAA 3WHCA 5HAWA 3KNWA 4GCLA 3F0CA 3LWJA 2X6OA 1ZKGA 2QOPA 1T33A 4AC0A 4JKZA 2IBDA 5D18A 4GFKA 3BR1A 4ME9A 2OF7A 3KKDA 2R7QA 5K7ZA 2ZCNA 3HTAA 5EFYA 2R7XA 5D1RA 2ZCMA 2UXOA 2WV1A 2HYTA 5AQCA 5IOZA 2WGBA 3P9TA 5J1RA 2FJI1 3BR3A 2FBQA 4OD5A 1JT6A 1BJZA 3HE0A 2TRTA 3QKXA 3B6CA 4V2FA 3Q0UA 3NI7A 1UI6A 4DVYP 3BQZA 3CWRA 1U9NA 2B3WA 1JUMA 3HGYA 5HBUA 3TP3A 3NNRA 3Q3SA 5FGLA 2PFVA 5F08A 3BR5A 5FMPA 2ID6A 2ZOZA 3O60A 3QBMA 2FJ1A 5DAJA 2D6YA 5K7FA 3EGQA 2DG8A 3VOKA 2YVEA 3CDLA 2ZB9A 2DTZA 2QCOA 1RKTA 1U9OA 3ZQHA 2XGEA 2OPTA 2NP3A 4MO7A 4D7MA 2Y31A 3V6GA 3KKCA 3VW0A 2UXPA 5J1UA 3JSJA 5D19A 2OI8A 3FRQA 5EYRA 3CRJA 3KYLA 2ZY9A 3LSJA 4W97A 2QTQA 5CXGA 2F07A 5K7HA 1JTXA 2XPUA 3BCGA 3IH2A 2RHAA 3G56A 2Q24A 5FKKA 2REKA 5K58A 3PM1A 2YVHA 4C2MA 1UI5A 3B81A 5F04A 5EZHA 3HTHA 1JUSA 2GFNA 2A2FX 3C2BA 2Y2ZA 5FKOA 3BT9A 3O8GA 5FKLA 3VW1A 2XRLA 5F0FA 3BR6A 3DEWA 4JNNA 3ZQGA 4NN1A 4V2GA 3VVXA 3LSPA 3T6NA 3NRGA 5CW8A 2Y30A 3KZ9A 3ZQFA 3AQSA 5IPAA 4MXMA 4ACIA
chains in the Genus database with same CATH topology
3GEUA 3VP5A 4JL3A 2HXOA 3MNLA 2XB5A 3HGGA 3F1BA 2ZOYA 4DW6A 2QIBA 3G1LA 3FK6A 3DCFA 4D5FA 4D7NA 2UXIA 3QPSA 2XDNA 2GENA 3BTJA 3HTJA 3FK7A 5F0HA 3TP0A 2GUHA 4ABZA 3BR0A 3ZQIA 2NX4A 4MK6A 2UXUA 3BTIA 2EH3A 4I76A 5GPAA 3CCYA 2WUIA 2FQ4A 3CJDA 2G7SA 5FHPA 3NXCA 2G7GA 2FX0A 3ZQLA 2JK3A 2G3BA 3VIBA 3VVZA 5C4YA 3V78A 3VUQA 3Q0VA 4AF5A 3BNIA 3RH2A 3NPIA 2FD5A 2HXIA 2W53A 3ON4A 2X9DA 3ANPA 2QWTA 4HKUA 2PBXA 3LSRA 3C07A 3BTLA 4AUXA 3S5RA 5F27A 3BQYA 2QKOA 4YZEA 5IP6A 3G1MA 3WHBA 3SFIA 4M3GA 4XK4A 3BJBA 3GZIA 2GBYA 2XGCA 2IEKA 4M3DA 3IH3A 4X1EA 3VW2A 2O7OA 3COLA 2NP5A 2JJ7A 5CXIA 3IH4A 2PZ9A 3PPBA 2XGDA 2RASA 5IOYA 5H9TA 2DG7A 2ID3A 4AC6A 2NS8A 2HYJA 4UDSA 4GFLA 4KWAA 2NS7A 5FKNA 4PXIA 4G12A 2HKUA 2XPWA 5FKMA 2HQ5A 4D5CA 3PASA 5F1JA 2UXHA 3G7RA 5EZGA 3BRUA 4ICHA 3BR2A 4NELA 1QVUA 4M3FA 4M3BA 4B1RA 2VPRA 1SGMA 3FIWA 4GCTA 2XPVA 5HSZA 2I10A 4GCKA 5GP9A 1A6IA 1JTYA 2VKEA 3O8HA 1JT0A 4I6ZA 5GPCA 3DPJA 4L62A 2RAEA 1ZK8A 1RPWA 2O7TA 2G0EA 5J1YA 3LJLA 1QVTA 5J3LA 3E7QA 3SDGA 4B3AA 1T56A 3BHQA 3BTCA 2V57A 1Z0XA 3HIMA 3G1OA 2IU5A 3IUVA 3B6AA 3QPLA 1JUPA 2TCTA 2G7LA 3MVPA 2VKVA 3RD3A 4JYKA 3LOCA 4M3EA 3EUPA 3VVYA 1QPIA 1Z77A 3ANGA 1VI0A 1RKWA 3VOXA 3Q0WA 1ORKA 2OERA 2ZCXA 2IAIA 3VPRA 3AQTA 5F0CA 3HTIA 3LHQA 4W1UA 4CGRA 3ON2A 3QQAA 3WHCA 5HAWA 3KNWA 4GCLA 3F0CA 3LWJA 2X6OA 1ZKGA 2QOPA 1T33A 4AC0A 4JKZA 2IBDA 5D18A 4GFKA 3BR1A 4ME9A 2OF7A 3KKDA 5K7ZA 2ZCNA 3HTAA 5EFYA 5D1RA 2ZCMA 2UXOA 2WV1A 2HYTA 5AQCA 5IOZA 2WGBA 3P9TA 5J1RA 3BR3A 2FBQA 1JT6A 1BJZA 3HE0A 2TRTA 3QKXA 3B6CA 4V2FA 3Q0UA 3NI7A 1UI6A 3BQZA 3CWRA 1U9NA 1JUMA 3HGYA 5HBUA 3TP3A 3NNRA 3Q3SA 5FGLA 5F08A 3BR5A 5FMPA 2ID6A 2ZOZA 3O60A 3QBMA 2FJ1A 5DAJA 2D6YA 5K7FA 3EGQA 2DG8A 3VOKA 2YVEA 3CDLA 2ZB9A 2DTZA 2QCOA 1RKTA 1U9OA 3ZQHA 2XGEA 2OPTA 2NP3A 4MO7A 4D7MA 2Y31A 3V6GA 3KKCA 3VW0A 2UXPA 5J1UA 3JSJA 5D19A 2OI8A 3FRQA 5EYRA 3CRJA 3LSJA 4W97A 2QTQA 5CXGA 5K7HA 2F07A 1JTXA 2XPUA 3BCGA 3IH2A 2RHAA 3G56A 2Q24A 5FKKA 2REKA 5K58A 3PM1A 2YVHA 1UI5A 3B81A 5F04A 5EZHA 3HTHA 1JUSA 2GFNA 3C2BA 2Y2ZA 5FKOA 3BT9A 3O8GA 5FKLA 3VW1A 2XRLA 5F0FA 3BR6A 3DEWA 4JNNA 3ZQGA 4NN1A 4V2GA 3VVXA 3LSPA 3T6NA 3NRGA 5CW8A 2Y30A 3KZ9A 3ZQFA 3AQSA 5IPAA 4MXMA 4ACIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GEU A;  3VP5 A;  4JL3 A;  2HXO A;  3MNL A;  2XB5 A;  3HGG A;  3F1B A;  2ZOY A;  4DW6 A;  2QIB A;  3G1L A;  3FK6 A;  3DCF A;  4D5F A;  4D7N A;  2UXI A;  3QPS A;  2XDN A;  2GEN A;  3BTJ A;  3HTJ A;  3FK7 A;  5F0H A;  3TP0 A;  2GUH A;  4ABZ A;  3BR0 A;  3ZQI A;  2NX4 A;  4MK6 A;  2UXU A;  3BTI A;  2EH3 A;  4I76 A;  5GPA A;  3CCY A;  2WUI A;  2FQ4 A;  3CJD A;  2G7S A;  5FHP A;  3NXC A;  2G7G A;  2FX0 A;  3ZQL A;  2JK3 A;  2G3B A;  3VIB A;  3VVZ A;  5C4Y A;  3V78 A;  3VUQ A;  3Q0V A;  4AF5 A;  3BNI A;  3RH2 A;  3NPI A;  2FD5 A;  2HXI A;  2W53 A;  3ON4 A;  2X9D A;  3ANP A;  2QWT A;  4HKU A;  2PBX A;  3LSR A;  3C07 A;  3BTL A;  4AUX A;  3S5R A;  5F27 A;  3BQY A;  2QKO A;  4YZE A;  5IP6 A;  3G1M A;  3WHB A;  3SFI A;  4M3G A;  4XK4 A;  3BJB A;  3GZI A;  2GBY A;  2XGC A;  2IEK A;  4M3D A;  3IH3 A;  4X1E A;  3VW2 A;  2O7O A;  3COL A;  2NP5 A;  2JJ7 A;  5CXI A;  3IH4 A;  2PZ9 A;  3PPB A;  2XGD A;  2RAS A;  5IOY A;  5H9T A;  2DG7 A;  2ID3 A;  4AC6 A;  2NS8 A;  2HYJ A;  4UDS A;  4GFL A;  4KWA A;  2NS7 A;  5FKN A;  4PXI A;  4G12 A;  2HKU A;  2XPW A;  5FKM A;  2HQ5 A;  4D5C A;  3PAS A;  5F1J A;  2UXH A;  3G7R A;  5EZG A;  3BRU A;  4ICH A;  3BR2 A;  4NEL A;  1QVU A;  4M3F A;  4M3B A;  4B1R A;  2VPR A;  1SGM A;  3FIW A;  4GCT A;  2XPV A;  5HSZ A;  2I10 A;  4GCK A;  5GP9 A;  1A6I A;  1JTY A;  2VKE A;  3O8H A;  1JT0 A;  4I6Z A;  5GPC A;  3DPJ A;  4L62 A;  2RAE A;  1ZK8 A;  1RPW A;  2O7T A;  2G0E A;  5J1Y A;  3LJL A;  1QVT A;  5J3L A;  3E7Q A;  3SDG A;  4B3A A;  1T56 A;  3BHQ A;  3BTC A;  2V57 A;  1Z0X A;  3HIM A;  3G1O A;  2IU5 A;  3IUV A;  3B6A A;  3QPL A;  1JUP A;  2TCT A;  2G7L A;  3MVP A;  2VKV A;  3RD3 A;  4JYK A;  3LOC A;  4M3E A;  3EUP A;  3VVY A;  1QPI A;  1Z77 A;  3ANG A;  1VI0 A;  1RKW A;  3VOX A;  3Q0W A;  1ORK A;  2OER A;  2ZCX A;  2IAI A;  3VPR A;  3AQT A;  5F0C A;  3HTI A;  3LHQ A;  4W1U A;  4CGR A;  3ON2 A;  3QQA A;  3WHC A;  5HAW A;  3KNW A;  4GCL A;  3F0C A;  3LWJ A;  2X6O A;  1ZKG A;  2QOP A;  1T33 A;  4AC0 A;  4JKZ A;  2IBD A;  5D18 A;  4GFK A;  3BR1 A;  4ME9 A;  2OF7 A;  3KKD A;  5K7Z A;  2ZCN A;  3HTA A;  5EFY A;  5D1R A;  2ZCM A;  2UXO A;  2WV1 A;  2HYT A;  5AQC A;  5IOZ A;  2WGB A;  3P9T A;  5J1R A;  3BR3 A;  2FBQ A;  1JT6 A;  1BJZ A;  3HE0 A;  2TRT A;  3QKX A;  3B6C A;  4V2F A;  3Q0U A;  3NI7 A;  1UI6 A;  3BQZ A;  3CWR A;  1U9N A;  1JUM A;  3HGY A;  5HBU A;  3TP3 A;  3NNR A;  3Q3S A;  5FGL A;  5F08 A;  3BR5 A;  5FMP A;  2ID6 A;  2ZOZ A;  3O60 A;  3QBM A;  2FJ1 A;  5DAJ A;  2D6Y A;  5K7F A;  3EGQ A;  2DG8 A;  3VOK A;  2YVE A;  3CDL A;  2ZB9 A;  2DTZ A;  2QCO A;  1RKT A;  1U9O A;  3ZQH A;  2XGE A;  2OPT A;  2NP3 A;  4MO7 A;  4D7M A;  2Y31 A;  3V6G A;  3KKC A;  3VW0 A;  2UXP A;  5J1U A;  3JSJ A;  5D19 A;  2OI8 A;  3FRQ A;  5EYR A;  3CRJ A;  3LSJ A;  4W97 A;  2QTQ A;  5CXG A;  5K7H A;  2F07 A;  1JTX A;  2XPU A;  3BCG A;  3IH2 A;  2RHA A;  3G56 A;  2Q24 A;  5FKK A;  2REK A;  5K58 A;  3PM1 A;  2YVH A;  1UI5 A;  3B81 A;  5F04 A;  5EZH A;  3HTH A;  1JUS A;  2GFN A;  3C2B A;  2Y2Z A;  5FKO A;  3BT9 A;  3O8G A;  5FKL A;  3VW1 A;  2XRL A;  5F0F A;  3BR6 A;  3DEW A;  4JNN A;  3ZQG A;  4NN1 A;  4V2G A;  3VVX A;  3LSP A;  3T6N A;  3NRG A;  5CW8 A;  2Y30 A;  3KZ9 A;  3ZQF A;  3AQS A;  5IPA A;  4MXM A;  4ACI A; 
#chains in the Genus database with same CATH topology
 3GEU A;  3VP5 A;  4JL3 A;  2HXO A;  3MNL A;  2XB5 A;  3HGG A;  3F1B A;  2R7T A;  2ZOY A;  4DW6 A;  2QIB A;  2R7W A;  3G1L A;  2R7V A;  3FK6 A;  3DCF A;  4D5F A;  4D7N A;  2UXI A;  3QPS A;  2XDN A;  2GEN A;  4IRV A;  3BTJ A;  3HTJ A;  3FK7 A;  5F0H A;  3TP0 A;  2GUH A;  4ABZ A;  3NS4 A;  3BR0 A;  2B1E A;  3ZQI A;  2NX4 A;  4MK6 A;  2UXU A;  3BTI A;  2EH3 A;  4I76 A;  5GPA A;  3CCY A;  2WUI A;  2FQ4 A;  3CJD A;  2G7S A;  5FHP A;  3NXC A;  2G7G A;  2FX0 A;  3ZQL A;  2JK3 A;  2G3B A;  3VTI A;  3VIB A;  3VVZ A;  5C4Y A;  3V78 A;  3VUQ A;  3Q0V A;  4AF5 A;  3BNI A;  3RH2 A;  3NPI A;  2FD5 A;  2HXI A;  2W53 A;  3ON4 A;  2X9D A;  3ANP A;  2QWT A;  4HKU A;  2PBX A;  3LSR A;  3C07 A;  4U9L A;  3BTL A;  4AUX A;  3S5R A;  5F27 A;  3BQY A;  2QKO A;  4YZE A;  5IP6 A;  3G1M A;  3WHB A;  3SFI A;  4M3G A;  4XK4 A;  3DU6 A;  2YVX A;  3BJB A;  3GZI A;  2GBY A;  2XGC A;  2IEK A;  4M3D A;  2R7S A;  3IH3 A;  4X1E A;  3VW2 A;  2O7O A;  3COL A;  2NP5 A;  2JJ7 A;  5CXI A;  3IH4 A;  2PZ9 A;  3PPB A;  4WIB A;  2XGD A;  2RAS A;  5IOY A;  5H9T A;  2DG7 A;  2ID3 A;  4AC6 A;  2NS8 A;  2HYJ A;  4UDS A;  4GFL A;  4KWA A;  2NS7 A;  5FKN A;  4PXI A;  4G12 A;  2HKU A;  2XPW A;  5FKM A;  2HQ5 A;  4D5C A;  3PAS A;  5F1J A;  2UXH A;  3G7R A;  5EZG A;  3BRU A;  4ICH A;  3BR2 A;  4NEL A;  1QVU A;  4M3F A;  4M3B A;  4B1R A;  2VPR A;  3FHN A;  1SGM A;  2R7U A;  2R7O A;  3FIW A;  4GCT A;  2XPV A;  5HSZ A;  2I10 A;  4GCK A;  5CQG A;  5GP9 A;  4OD4 A;  1A6I A;  3K8P C;  1JTY A;  4U9N A;  2VKE A;  3O8H A;  1JT0 A;  4I6Z A;  2R7R A;  5GPC A;  3DPJ A;  4L62 A;  2RAE A;  1ZK8 A;  3SWH A;  1RPW A;  2O7T A;  2G0E A;  5J1Y A;  3LJL A;  1QVT A;  5J3L A;  3E7Q A;  3SDG A;  4B3A A;  1T56 A;  3BHQ A;  3BTC A;  2V57 A;  1Z0X A;  3HIM A;  3G1O A;  2IU5 A;  3IUV A;  3B6A A;  3QPL A;  1JUP A;  2TCT A;  2G7L A;  3MVP A;  2VKV A;  3RD3 A;  4JYK A;  3LOC A;  4M3E A;  3EUP A;  3VVY A;  1QPI A;  1Z77 A;  3ANG A;  1VI0 A;  1RKW A;  3VOX A;  3Q0W A;  1ORK A;  2OER A;  2ZCX A;  2IAI A;  3VPR A;  3AQT A;  5F0C A;  3HTI A;  3LHQ A;  4W1U A;  4CGR A;  3ON2 A;  3DU5 A;  3QQA A;  3WHC A;  5HAW A;  3KNW A;  4GCL A;  3F0C A;  3LWJ A;  2X6O A;  1ZKG A;  2QOP A;  1T33 A;  4AC0 A;  4JKZ A;  2IBD A;  5D18 A;  4GFK A;  3BR1 A;  4ME9 A;  2OF7 A;  3KKD A;  2R7Q A;  5K7Z A;  2ZCN A;  3HTA A;  5EFY A;  2R7X A;  5D1R A;  2ZCM A;  2UXO A;  2WV1 A;  2HYT A;  5AQC A;  5IOZ A;  2WGB A;  3P9T A;  5J1R A;  2FJI 1;  3BR3 A;  2FBQ A;  4OD5 A;  1JT6 A;  1BJZ A;  3HE0 A;  2TRT A;  3QKX A;  3B6C A;  4V2F A;  3Q0U A;  3NI7 A;  1UI6 A;  4DVY P;  3BQZ A;  3CWR A;  1U9N A;  2B3W A;  1JUM A;  3HGY A;  5HBU A;  3TP3 A;  3NNR A;  3Q3S A;  5FGL A;  2PFV A;  5F08 A;  3BR5 A;  5FMP A;  2ID6 A;  2ZOZ A;  3O60 A;  3QBM A;  2FJ1 A;  5DAJ A;  2D6Y A;  5K7F A;  3EGQ A;  2DG8 A;  3VOK A;  2YVE A;  3CDL A;  2ZB9 A;  2DTZ A;  2QCO A;  1RKT A;  1U9O A;  3ZQH A;  2XGE A;  2OPT A;  2NP3 A;  4MO7 A;  4D7M A;  2Y31 A;  3V6G A;  3KKC A;  3VW0 A;  2UXP A;  5J1U A;  3JSJ A;  5D19 A;  2OI8 A;  3FRQ A;  5EYR A;  3CRJ A;  3KYL A;  2ZY9 A;  3LSJ A;  4W97 A;  2QTQ A;  5CXG A;  2F07 A;  5K7H A;  1JTX A;  2XPU A;  3BCG A;  3IH2 A;  2RHA A;  3G56 A;  2Q24 A;  5FKK A;  2REK A;  5K58 A;  3PM1 A;  2YVH A;  4C2M A;  1UI5 A;  3B81 A;  5F04 A;  5EZH A;  3HTH A;  1JUS A;  2GFN A;  2A2F X;  3C2B A;  2Y2Z A;  5FKO A;  3BT9 A;  3O8G A;  5FKL A;  3VW1 A;  2XRL A;  5F0F A;  3BR6 A;  3DEW A;  4JNN A;  3ZQG A;  4NN1 A;  4V2G A;  3VVX A;  3LSP A;  3T6N A;  3NRG A;  5CW8 A;  2Y30 A;  3KZ9 A;  3ZQF A;  3AQS A;  5IPA A;  4MXM A;  4ACI A; 
#chains in the Genus database with same CATH homology
 3GEU A;  3VP5 A;  4JL3 A;  2HXO A;  3MNL A;  2XB5 A;  3HGG A;  3F1B A;  2ZOY A;  4DW6 A;  2QIB A;  3G1L A;  3FK6 A;  3DCF A;  4D5F A;  4D7N A;  2UXI A;  3QPS A;  2XDN A;  2GEN A;  3BTJ A;  3HTJ A;  3FK7 A;  5F0H A;  3TP0 A;  2GUH A;  4ABZ A;  3BR0 A;  3ZQI A;  2NX4 A;  4MK6 A;  2UXU A;  3BTI A;  2EH3 A;  4I76 A;  5GPA A;  3CCY A;  2WUI A;  2FQ4 A;  3CJD A;  2G7S A;  5FHP A;  3NXC A;  2G7G A;  2FX0 A;  3ZQL A;  2JK3 A;  2G3B A;  3VIB A;  3VVZ A;  5C4Y A;  3V78 A;  3VUQ A;  3Q0V A;  4AF5 A;  3BNI A;  3RH2 A;  3NPI A;  2FD5 A;  2HXI A;  2W53 A;  3ON4 A;  2X9D A;  3ANP A;  2QWT A;  4HKU A;  2PBX A;  3LSR A;  3C07 A;  3BTL A;  4AUX A;  3S5R A;  5F27 A;  3BQY A;  2QKO A;  4YZE A;  5IP6 A;  3G1M A;  3WHB A;  3SFI A;  4M3G A;  4XK4 A;  3BJB A;  3GZI A;  2GBY A;  2XGC A;  2IEK A;  4M3D A;  3IH3 A;  4X1E A;  3VW2 A;  2O7O A;  3COL A;  2NP5 A;  2JJ7 A;  5CXI A;  3IH4 A;  2PZ9 A;  3PPB A;  2XGD A;  2RAS A;  5IOY A;  5H9T A;  2DG7 A;  2ID3 A;  4AC6 A;  2NS8 A;  2HYJ A;  4UDS A;  4GFL A;  4KWA A;  2NS7 A;  5FKN A;  4PXI A;  4G12 A;  2HKU A;  2XPW A;  5FKM A;  2HQ5 A;  4D5C A;  3PAS A;  5F1J A;  2UXH A;  3G7R A;  5EZG A;  3BRU A;  4ICH A;  3BR2 A;  4NEL A;  1QVU A;  4M3F A;  4M3B A;  4B1R A;  2VPR A;  1SGM A;  3FIW A;  4GCT A;  2XPV A;  5HSZ A;  2I10 A;  4GCK A;  5GP9 A;  1A6I A;  1JTY A;  2VKE A;  3O8H A;  1JT0 A;  4I6Z A;  5GPC A;  3DPJ A;  4L62 A;  2RAE A;  1ZK8 A;  1RPW A;  2O7T A;  2G0E A;  5J1Y A;  3LJL A;  1QVT A;  5J3L A;  3E7Q A;  3SDG A;  4B3A A;  1T56 A;  3BHQ A;  3BTC A;  2V57 A;  1Z0X A;  3HIM A;  3G1O A;  2IU5 A;  3IUV A;  3B6A A;  3QPL A;  1JUP A;  2TCT A;  2G7L A;  3MVP A;  2VKV A;  3RD3 A;  4JYK A;  3LOC A;  4M3E A;  3EUP A;  3VVY A;  1QPI A;  1Z77 A;  3ANG A;  1VI0 A;  1RKW A;  3VOX A;  3Q0W A;  1ORK A;  2OER A;  2ZCX A;  2IAI A;  3VPR A;  3AQT A;  5F0C A;  3HTI A;  3LHQ A;  4W1U A;  4CGR A;  3ON2 A;  3QQA A;  3WHC A;  5HAW A;  3KNW A;  4GCL A;  3F0C A;  3LWJ A;  2X6O A;  1ZKG A;  2QOP A;  1T33 A;  4AC0 A;  4JKZ A;  2IBD A;  5D18 A;  4GFK A;  3BR1 A;  4ME9 A;  2OF7 A;  3KKD A;  5K7Z A;  2ZCN A;  3HTA A;  5EFY A;  5D1R A;  2ZCM A;  2UXO A;  2WV1 A;  2HYT A;  5AQC A;  5IOZ A;  2WGB A;  3P9T A;  5J1R A;  3BR3 A;  2FBQ A;  1JT6 A;  1BJZ A;  3HE0 A;  2TRT A;  3QKX A;  3B6C A;  4V2F A;  3Q0U A;  3NI7 A;  1UI6 A;  3BQZ A;  3CWR A;  1U9N A;  1JUM A;  3HGY A;  5HBU A;  3TP3 A;  3NNR A;  3Q3S A;  5FGL A;  5F08 A;  3BR5 A;  5FMP A;  2ID6 A;  2ZOZ A;  3O60 A;  3QBM A;  2FJ1 A;  5DAJ A;  2D6Y A;  5K7F A;  3EGQ A;  2DG8 A;  3VOK A;  2YVE A;  3CDL A;  2ZB9 A;  2DTZ A;  2QCO A;  1RKT A;  1U9O A;  3ZQH A;  2XGE A;  2OPT A;  2NP3 A;  4MO7 A;  4D7M A;  2Y31 A;  3V6G A;  3KKC A;  3VW0 A;  2UXP A;  5J1U A;  3JSJ A;  5D19 A;  2OI8 A;  3FRQ A;  5EYR A;  3CRJ A;  3LSJ A;  4W97 A;  2QTQ A;  5CXG A;  5K7H A;  2F07 A;  1JTX A;  2XPU A;  3BCG A;  3IH2 A;  2RHA A;  3G56 A;  2Q24 A;  5FKK A;  2REK A;  5K58 A;  3PM1 A;  2YVH A;  1UI5 A;  3B81 A;  5F04 A;  5EZH A;  3HTH A;  1JUS A;  2GFN A;  3C2B A;  2Y2Z A;  5FKO A;  3BT9 A;  3O8G A;  5FKL A;  3VW1 A;  2XRL A;  5F0F A;  3BR6 A;  3DEW A;  4JNN A;  3ZQG A;  4NN1 A;  4V2G A;  3VVX A;  3LSP A;  3T6N A;  3NRG A;  5CW8 A;  2Y30 A;  3KZ9 A;  3ZQF A;  3AQS A;  5IPA A;  4MXM A;  4ACI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...