3KKCA

The crystal structure of tetr transcriptional regulator from streptococcus agalactiae 2603v
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
177
structure length
177
Chain Sequence
b'SNAMVKDRQIQKTKVAIYNAFISLLQENDYSKITVQDVIGLANVGRSTFYSHYESKEVLLKELCEDLFHHLFKQGRDVTFEEYLVHILKHFEQNQDSIATLLLSDDPYFLLRFRSELEHDVYPRLREEYITKVDIPEDFLKQFLLSSFIETLKWWLHQRQKMTVEDLLKYYLTMVER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TetR family Transcriptional regulator
publication title The crystal structure OF TetR transcriptional regulator from Streptococcus agalactiae 2603V
rcsb
source organism Streptococcus agalactiae 2603v/r
molecule tags Transcription regulator
total genus 64
structure length 177
sequence length 177
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF14278 TetR_C_8 Transcriptional regulator C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3kkcA01
3LJLA 2HXOA 3BQZA 5C4YA 5HBUA 3BRUA 3LWJA 4V2FA 3G1OA 2PBXA 3DPJA 3EUPA 1A6IA 3HTAA 5EZHA 2ZB9A 3KKCA 3ZQHA 3KNWA 5K7FA 2UXOA 5F27A 3JSJA 3LOCA 3BHQA 2ZCXA 5FKKA 1VI0A 2UXPA 2NP5A 3CRJA 4MXMA 5EZGA 3IH2A 2YVHA 2XGEA 3NNRA 5F04A 3GEUA 2UXHA 3NI7A 5CXGA 1QVUA 3T6NA 2IAIA 2XDNA 3TP3A 2FQ4A 1ZK8A 3E7QA 2X9DA 4UDSA 3BTJA 3QBMA 3VVZA 3C07A 3RH2A 5F0FA 2F07A 3COLA 2FD5A 5D19A 4B1RA 2G7GA 5FKNA 5F0CA 3VW2A 3VW1A 3BJBA 3BTLA 2JJ7A 4GFKA 4AF5A 2UXIA 5H9TA 2RAEA 3HE0A 3RD3A 2GFNA 2XRLA 3MVPA 2W53A 2IU5A 2XB5A 5CW8A 3ANPA 3ZQFA 4B3AA 2DTZA 2XGDA 1U9NA 3S5RA 1JTXA 1QVTA 3DCFA 5J1RA 4JL3A 3BNIA 3ON4A 2D6YA 3FRQA 2G7LA 3BR0A 1RKWA 1UI5A 3Q0UA 1Z77A 2HQ5A 2FX0A 3V6GA 4V2GA 3O8GA 2OI8A 5HAWA 1UI6A 3F1BA 3NRGA 3Q0VA 1BJZA 3PPBA 3GZIA 4M3EA 2GENA 3IH3A 4I76A 2Q24A 3WHCA 4D7MA 4GCKA 2DG7A 2YVEA 3VOKA 3Q0WA 1ZKGA 2QIBA 3QPSA 2WGBA 3O60A 5J3LA 3IUVA 4GCLA 5FMPA 5F1JA 5FKLA 2G3BA 3FIWA 5GPAA 3BR5A 3PM1A 2JK3A 1SGMA 3EGQA 3VP5A 3AQSA 2HYTA 3B6CA 2XGCA 3QPLA 3BR6A 3F0CA 1JUPA 2QKOA 5EFYA 4X1EA 3QKXA 4M3DA 1T33A 3DEWA 2NS7A 3BR3A 2QWTA 1JT6A 3AQTA 2FJ1A 3G1LA 2NS8A 2OPTA 2I10A 5K58A 3B81A 4CGRA 3CCYA 3KZ9A 4M3BA 5FKOA 2O7TA 2VKEA 3PASA 3VVYA 4NELA 2NX4A 4I6ZA 2EH3A 2IEKA 3BTCA 2QOPA 1JUSA 4M3FA 3VOXA 2TCTA 4MO7A 4JKZA 1JTYA 3HTHA 2Y2ZA 3VVXA 5IPAA 4AC6A 5D18A 2VKVA 3HGYA 5HSZA 1U9OA 3BT9A 2GBYA 4JNNA 4MK6A 4YZEA 3G7RA 4JYKA 3HGGA 3O8HA 5D1RA 2HKUA 4G12A 2REKA 3BTIA 1RKTA 3BQYA 1JT0A 3FK7A 3LSRA 2UXUA 4GCTA 3NXCA 3HIMA 3ANGA 3BCGA 5CXIA 2RHAA 4M3GA 1QPIA 3G56A 2G7SA 4D7NA 3ZQGA 3B6AA 2DG8A 1RPWA 2PZ9A 5K7ZA 5DAJA 5FHPA 3VIBA 3BR2A 4W97A 3IH4A 3BR1A 3CWRA 3ON2A 4D5CA 2ZCMA 4XK4A 2ZCNA 3CJDA 2Y30A 4D5FA 3KKDA 2OF7A 2ID6A 5AQCA 3V78A 5FGLA 2XPVA 4AC0A 3QQAA 3VUQA 2QCOA 4GFLA 3Q3SA 3LSPA 5IP6A 4ME9A 2ID3A 3MNLA 2G0EA 4ACIA 3LHQA 4AUXA 2OERA 3G1MA 4HKUA 2GUHA 1JUMA 3SDGA 3NPIA 2WV1A 5IOYA 5GPCA 2O7OA 3HTJA 4ICHA 5FKMA 3C2BA 1Z0XA 2VPRA 5J1YA 5J1UA 4W1UA 3P9TA 1ORKA 3TP0A 2ZOZA 4PXIA 2WUIA 5F0HA 2ZOYA 2RASA 2V57A 2XPUA 3HTIA 4ABZA 3VPRA 2IBDA 2HXIA 2QTQA 3SFIA 5F08A 3ZQIA 2NP3A 3FK6A 3VW0A 2Y31A 5GP9A 4KWAA 5IOZA 3CDLA 2XPWA 4L62A 2FBQA 3LSJA 2TRTA 2HYJA 5K7HA 4DW6A 4NN1A 5EYRA 3ZQLA 3WHBA 1T56A 2X6OA
chains in the Genus database with same CATH superfamily
3LJLA 2HXOA 3BQZA 5C4YA 5HBUA 3BRUA 2YVXA 3LWJA 4V2FA 3G1OA 2PBXA 3DPJA 3EUPA 1A6IA 3HTAA 5EZHA 2ZB9A 3KKCA 3ZQHA 3KNWA 5K7FA 2UXOA 5F27A 3JSJA 3LOCA 3BHQA 2ZCXA 5FKKA 1VI0A 2UXPA 2NP5A 3CRJA 4MXMA 5EZGA 3IH2A 2YVHA 2XGEA 3NNRA 5F04A 3GEUA 2UXHA 3NI7A 4WIBA 5CXGA 1QVUA 3T6NA 2IAIA 2XDNA 3TP3A 2FQ4A 1ZK8A 3E7QA 2X9DA 2B3WA 4UDSA 3BTJA 3QBMA 3VVZA 3C07A 3RH2A 5F0FA 2F07A 3COLA 2FD5A 5D19A 4B1RA 2G7GA 5FKNA 5F0CA 3VW2A 3VW1A 3BJBA 3BTLA 2JJ7A 4GFKA 4AF5A 2UXIA 5H9TA 2RAEA 3HE0A 3RD3A 2GFNA 2XRLA 3FHNA 3MVPA 2W53A 3DU5A 2IU5A 2XB5A 5CW8A 3ANPA 3ZQFA 2A2FX 4B3AA 2DTZA 2XGDA 1U9NA 3S5RA 1JTXA 1QVTA 3DCFA 5J1RA 4JL3A 3BNIA 3ON4A 2D6YA 3FRQA 2G7LA 3BR0A 1RKWA 1UI5A 3Q0UA 1Z77A 2HQ5A 2FX0A 2R7OA 3KYLA 3V6GA 4V2GA 3O8GA 2OI8A 5HAWA 1UI6A 4C2MA 3F1BA 3NRGA 3Q0VA 4OD5A 1BJZA 3PPBA 4OD4A 3GZIA 4M3EA 2GENA 3IH3A 4I76A 2Q24A 3WHCA 4D7MA 4GCKA 2DG7A 2YVEA 3VOKA 3Q0WA 1ZKGA 2QIBA 3QPSA 2WGBA 3O60A 5J3LA 3IUVA 4GCLA 5FMPA 2FJI1 5F1JA 2PFVA 5FKLA 2R7VA 2G3BA 3FIWA 5GPAA 3BR5A 3PM1A 2R7RA 2JK3A 1SGMA 3EGQA 3VP5A 3AQSA 2HYTA 3B6CA 2XGCA 3K8PC 3QPLA 3BR6A 2B1EA 3F0CA 1JUPA 2QKOA 5EFYA 4X1EA 3QKXA 4M3DA 1T33A 3DEWA 2NS7A 3BR3A 2QWTA 1JT6A 3AQTA 2FJ1A 3G1LA 2NS8A 2OPTA 2I10A 5K58A 3B81A 3VTIA 4CGRA 3CCYA 3KZ9A 4M3BA 5FKOA 2O7TA 2VKEA 3PASA 3VVYA 4NELA 2NX4A 4I6ZA 2EH3A 2IEKA 3NS4A 3BTCA 2QOPA 1JUSA 4M3FA 3VOXA 2TCTA 4MO7A 4JKZA 1JTYA 3HTHA 2Y2ZA 3VVXA 5IPAA 4AC6A 5D18A 2VKVA 3HGYA 5HSZA 1U9OA 3BT9A 2GBYA 4JNNA 4MK6A 2R7XA 4YZEA 3G7RA 4JYKA 3HGGA 3O8HA 5D1RA 2HKUA 4G12A 4U9NA 2REKA 3BTIA 1RKTA 3BQYA 1JT0A 4U9LA 3FK7A 3LSRA 2UXUA 4GCTA 3NXCA 3HIMA 3ANGA 3BCGA 5CXIA 2RHAA 4M3GA 4IRVA 1QPIA 3G56A 2G7SA 4D7NA 3ZQGA 2ZY9A 3B6AA 2DG8A 1RPWA 2PZ9A 5K7ZA 5DAJA 5FHPA 3VIBA 2R7WA 3BR2A 4W97A 3IH4A 4DVYP 3BR1A 3CWRA 3ON2A 4D5CA 2ZCMA 4XK4A 2ZCNA 3CJDA 2Y30A 4D5FA 3KKDA 2OF7A 2ID6A 5AQCA 3V78A 5FGLA 2XPVA 4AC0A 3QQAA 3VUQA 2QCOA 4GFLA 3Q3SA 3LSPA 5IP6A 4ME9A 2ID3A 3MNLA 2G0EA 4ACIA 3LHQA 4AUXA 2OERA 3G1MA 4HKUA 2GUHA 1JUMA 3SDGA 3NPIA 2WV1A 5IOYA 5GPCA 2O7OA 3HTJA 4ICHA 5FKMA 3C2BA 1Z0XA 2VPRA 5J1YA 5J1UA 4W1UA 3P9TA 1ORKA 3TP0A 2ZOZA 4PXIA 2WUIA 5F0HA 2ZOYA 3DU6A 2RASA 2R7TA 2V57A 3SWHA 2XPUA 3HTIA 4ABZA 3VPRA 2IBDA 2HXIA 2QTQA 3SFIA 5F08A 2R7UA 3ZQIA 2NP3A 3FK6A 3VW0A 2Y31A 5CQGA 5GP9A 2R7SA 4KWAA 5IOZA 3CDLA 2XPWA 4L62A 2FBQA 2R7QA 3LSJA 2TRTA 2HYJA 5K7HA 4DW6A 4NN1A 5EYRA 3ZQLA 3WHBA 1T56A 2X6OA
chains in the Genus database with same CATH topology
3LJLA 2HXOA 3BQZA 5C4YA 5HBUA 3BRUA 3LWJA 4V2FA 3G1OA 2PBXA 3DPJA 3EUPA 1A6IA 3HTAA 5EZHA 2ZB9A 3KKCA 3ZQHA 3KNWA 5K7FA 2UXOA 5F27A 3JSJA 3LOCA 3BHQA 2ZCXA 5FKKA 1VI0A 2UXPA 2NP5A 3CRJA 4MXMA 5EZGA 3IH2A 2YVHA 2XGEA 3NNRA 5F04A 3GEUA 2UXHA 3NI7A 5CXGA 1QVUA 3T6NA 2IAIA 2XDNA 3TP3A 2FQ4A 1ZK8A 3E7QA 2X9DA 4UDSA 3BTJA 3QBMA 3VVZA 3C07A 3RH2A 5F0FA 2F07A 3COLA 2FD5A 5D19A 4B1RA 2G7GA 5FKNA 5F0CA 3VW2A 3VW1A 3BJBA 3BTLA 2JJ7A 4GFKA 4AF5A 2UXIA 5H9TA 2RAEA 3HE0A 3RD3A 2GFNA 2XRLA 3MVPA 2W53A 2IU5A 2XB5A 5CW8A 3ANPA 3ZQFA 4B3AA 2DTZA 2XGDA 1U9NA 3S5RA 1JTXA 1QVTA 3DCFA 5J1RA 4JL3A 3BNIA 3ON4A 2D6YA 3FRQA 2G7LA 3BR0A 1RKWA 1UI5A 3Q0UA 1Z77A 2HQ5A 2FX0A 3V6GA 4V2GA 3O8GA 2OI8A 5HAWA 1UI6A 3F1BA 3NRGA 3Q0VA 1BJZA 3PPBA 3GZIA 4M3EA 2GENA 3IH3A 4I76A 2Q24A 3WHCA 4D7MA 4GCKA 2DG7A 2YVEA 3VOKA 3Q0WA 1ZKGA 2QIBA 3QPSA 2WGBA 3O60A 5J3LA 3IUVA 4GCLA 5FMPA 5F1JA 5FKLA 2G3BA 3FIWA 5GPAA 3BR5A 3PM1A 2JK3A 1SGMA 3EGQA 3VP5A 3AQSA 2HYTA 3B6CA 2XGCA 3QPLA 3BR6A 3F0CA 1JUPA 2QKOA 5EFYA 4X1EA 3QKXA 4M3DA 1T33A 3DEWA 2NS7A 3BR3A 2QWTA 1JT6A 3AQTA 2FJ1A 3G1LA 2NS8A 2OPTA 2I10A 5K58A 3B81A 4CGRA 3CCYA 3KZ9A 4M3BA 5FKOA 2O7TA 2VKEA 3PASA 3VVYA 4NELA 2NX4A 4I6ZA 2EH3A 2IEKA 3BTCA 2QOPA 1JUSA 4M3FA 3VOXA 2TCTA 4MO7A 4JKZA 1JTYA 3HTHA 2Y2ZA 3VVXA 5IPAA 4AC6A 5D18A 2VKVA 3HGYA 5HSZA 1U9OA 3BT9A 2GBYA 4JNNA 4MK6A 4YZEA 3G7RA 4JYKA 3HGGA 3O8HA 5D1RA 2HKUA 4G12A 2REKA 3BTIA 1RKTA 3BQYA 1JT0A 3FK7A 3LSRA 2UXUA 4GCTA 3NXCA 3HIMA 3ANGA 3BCGA 5CXIA 2RHAA 4M3GA 1QPIA 3G56A 2G7SA 4D7NA 3ZQGA 3B6AA 2DG8A 1RPWA 2PZ9A 5K7ZA 5DAJA 5FHPA 3VIBA 3BR2A 4W97A 3IH4A 3BR1A 3CWRA 3ON2A 4D5CA 2ZCMA 4XK4A 2ZCNA 3CJDA 2Y30A 4D5FA 3KKDA 2OF7A 2ID6A 5AQCA 3V78A 5FGLA 2XPVA 4AC0A 3QQAA 3VUQA 2QCOA 4GFLA 3Q3SA 3LSPA 5IP6A 4ME9A 2ID3A 3MNLA 2G0EA 4ACIA 3LHQA 4AUXA 2OERA 3G1MA 4HKUA 2GUHA 1JUMA 3SDGA 3NPIA 2WV1A 5IOYA 5GPCA 2O7OA 3HTJA 4ICHA 5FKMA 3C2BA 1Z0XA 2VPRA 5J1YA 5J1UA 4W1UA 3P9TA 1ORKA 3TP0A 2ZOZA 4PXIA 2WUIA 5F0HA 2ZOYA 2RASA 2V57A 2XPUA 3HTIA 4ABZA 3VPRA 2IBDA 2HXIA 2QTQA 3SFIA 5F08A 3ZQIA 2NP3A 3FK6A 3VW0A 2Y31A 5GP9A 4KWAA 5IOZA 3CDLA 2XPWA 4L62A 2FBQA 3LSJA 2TRTA 2HYJA 5K7HA 4DW6A 4NN1A 5EYRA 3ZQLA 3WHBA 1T56A 2X6OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LJL A;  2HXO A;  3BQZ A;  5C4Y A;  5HBU A;  3BRU A;  3LWJ A;  4V2F A;  3G1O A;  2PBX A;  3DPJ A;  3EUP A;  1A6I A;  3HTA A;  5EZH A;  2ZB9 A;  3KKC A;  3ZQH A;  3KNW A;  5K7F A;  2UXO A;  5F27 A;  3JSJ A;  3LOC A;  3BHQ A;  2ZCX A;  5FKK A;  1VI0 A;  2UXP A;  2NP5 A;  3CRJ A;  4MXM A;  5EZG A;  3IH2 A;  2YVH A;  2XGE A;  3NNR A;  5F04 A;  3GEU A;  2UXH A;  3NI7 A;  5CXG A;  1QVU A;  3T6N A;  2IAI A;  2XDN A;  3TP3 A;  2FQ4 A;  1ZK8 A;  3E7Q A;  2X9D A;  4UDS A;  3BTJ A;  3QBM A;  3VVZ A;  3C07 A;  3RH2 A;  5F0F A;  2F07 A;  3COL A;  2FD5 A;  5D19 A;  4B1R A;  2G7G A;  5FKN A;  5F0C A;  3VW2 A;  3VW1 A;  3BJB A;  3BTL A;  2JJ7 A;  4GFK A;  4AF5 A;  2UXI A;  5H9T A;  2RAE A;  3HE0 A;  3RD3 A;  2GFN A;  2XRL A;  3MVP A;  2W53 A;  2IU5 A;  2XB5 A;  5CW8 A;  3ANP A;  3ZQF A;  4B3A A;  2DTZ A;  2XGD A;  1U9N A;  3S5R A;  1JTX A;  1QVT A;  3DCF A;  5J1R A;  4JL3 A;  3BNI A;  3ON4 A;  2D6Y A;  3FRQ A;  2G7L A;  3BR0 A;  1RKW A;  1UI5 A;  3Q0U A;  1Z77 A;  2HQ5 A;  2FX0 A;  3V6G A;  4V2G A;  3O8G A;  2OI8 A;  5HAW A;  1UI6 A;  3F1B A;  3NRG A;  3Q0V A;  1BJZ A;  3PPB A;  3GZI A;  4M3E A;  2GEN A;  3IH3 A;  4I76 A;  2Q24 A;  3WHC A;  4D7M A;  4GCK A;  2DG7 A;  2YVE A;  3VOK A;  3Q0W A;  1ZKG A;  2QIB A;  3QPS A;  2WGB A;  3O60 A;  5J3L A;  3IUV A;  4GCL A;  5FMP A;  5F1J A;  5FKL A;  2G3B A;  3FIW A;  5GPA A;  3BR5 A;  3PM1 A;  2JK3 A;  1SGM A;  3EGQ A;  3VP5 A;  3AQS A;  2HYT A;  3B6C A;  2XGC A;  3QPL A;  3BR6 A;  3F0C A;  1JUP A;  2QKO A;  5EFY A;  4X1E A;  3QKX A;  4M3D A;  1T33 A;  3DEW A;  2NS7 A;  3BR3 A;  2QWT A;  1JT6 A;  3AQT A;  2FJ1 A;  3G1L A;  2NS8 A;  2OPT A;  2I10 A;  5K58 A;  3B81 A;  4CGR A;  3CCY A;  3KZ9 A;  4M3B A;  5FKO A;  2O7T A;  2VKE A;  3PAS A;  3VVY A;  4NEL A;  2NX4 A;  4I6Z A;  2EH3 A;  2IEK A;  3BTC A;  2QOP A;  1JUS A;  4M3F A;  3VOX A;  2TCT A;  4MO7 A;  4JKZ A;  1JTY A;  3HTH A;  2Y2Z A;  3VVX A;  5IPA A;  4AC6 A;  5D18 A;  2VKV A;  3HGY A;  5HSZ A;  1U9O A;  3BT9 A;  2GBY A;  4JNN A;  4MK6 A;  4YZE A;  3G7R A;  4JYK A;  3HGG A;  3O8H A;  5D1R A;  2HKU A;  4G12 A;  2REK A;  3BTI A;  1RKT A;  3BQY A;  1JT0 A;  3FK7 A;  3LSR A;  2UXU A;  4GCT A;  3NXC A;  3HIM A;  3ANG A;  3BCG A;  5CXI A;  2RHA A;  4M3G A;  1QPI A;  3G56 A;  2G7S A;  4D7N A;  3ZQG A;  3B6A A;  2DG8 A;  1RPW A;  2PZ9 A;  5K7Z A;  5DAJ A;  5FHP A;  3VIB A;  3BR2 A;  4W97 A;  3IH4 A;  3BR1 A;  3CWR A;  3ON2 A;  4D5C A;  2ZCM A;  4XK4 A;  2ZCN A;  3CJD A;  2Y30 A;  4D5F A;  3KKD A;  2OF7 A;  2ID6 A;  5AQC A;  3V78 A;  5FGL A;  2XPV A;  4AC0 A;  3QQA A;  3VUQ A;  2QCO A;  4GFL A;  3Q3S A;  3LSP A;  5IP6 A;  4ME9 A;  2ID3 A;  3MNL A;  2G0E A;  4ACI A;  3LHQ A;  4AUX A;  2OER A;  3G1M A;  4HKU A;  2GUH A;  1JUM A;  3SDG A;  3NPI A;  2WV1 A;  5IOY A;  5GPC A;  2O7O A;  3HTJ A;  4ICH A;  5FKM A;  3C2B A;  1Z0X A;  2VPR A;  5J1Y A;  5J1U A;  4W1U A;  3P9T A;  1ORK A;  3TP0 A;  2ZOZ A;  4PXI A;  2WUI A;  5F0H A;  2ZOY A;  2RAS A;  2V57 A;  2XPU A;  3HTI A;  4ABZ A;  3VPR A;  2IBD A;  2HXI A;  2QTQ A;  3SFI A;  5F08 A;  3ZQI A;  2NP3 A;  3FK6 A;  3VW0 A;  2Y31 A;  5GP9 A;  4KWA A;  5IOZ A;  3CDL A;  2XPW A;  4L62 A;  2FBQ A;  3LSJ A;  2TRT A;  2HYJ A;  5K7H A;  4DW6 A;  4NN1 A;  5EYR A;  3ZQL A;  3WHB A;  1T56 A;  2X6O A; 
#chains in the Genus database with same CATH topology
 3LJL A;  2HXO A;  3BQZ A;  5C4Y A;  5HBU A;  3BRU A;  2YVX A;  3LWJ A;  4V2F A;  3G1O A;  2PBX A;  3DPJ A;  3EUP A;  1A6I A;  3HTA A;  5EZH A;  2ZB9 A;  3KKC A;  3ZQH A;  3KNW A;  5K7F A;  2UXO A;  5F27 A;  3JSJ A;  3LOC A;  3BHQ A;  2ZCX A;  5FKK A;  1VI0 A;  2UXP A;  2NP5 A;  3CRJ A;  4MXM A;  5EZG A;  3IH2 A;  2YVH A;  2XGE A;  3NNR A;  5F04 A;  3GEU A;  2UXH A;  3NI7 A;  4WIB A;  5CXG A;  1QVU A;  3T6N A;  2IAI A;  2XDN A;  3TP3 A;  2FQ4 A;  1ZK8 A;  3E7Q A;  2X9D A;  2B3W A;  4UDS A;  3BTJ A;  3QBM A;  3VVZ A;  3C07 A;  3RH2 A;  5F0F A;  2F07 A;  3COL A;  2FD5 A;  5D19 A;  4B1R A;  2G7G A;  5FKN A;  5F0C A;  3VW2 A;  3VW1 A;  3BJB A;  3BTL A;  2JJ7 A;  4GFK A;  4AF5 A;  2UXI A;  5H9T A;  2RAE A;  3HE0 A;  3RD3 A;  2GFN A;  2XRL A;  3FHN A;  3MVP A;  2W53 A;  3DU5 A;  2IU5 A;  2XB5 A;  5CW8 A;  3ANP A;  3ZQF A;  2A2F X;  4B3A A;  2DTZ A;  2XGD A;  1U9N A;  3S5R A;  1JTX A;  1QVT A;  3DCF A;  5J1R A;  4JL3 A;  3BNI A;  3ON4 A;  2D6Y A;  3FRQ A;  2G7L A;  3BR0 A;  1RKW A;  1UI5 A;  3Q0U A;  1Z77 A;  2HQ5 A;  2FX0 A;  2R7O A;  3KYL A;  3V6G A;  4V2G A;  3O8G A;  2OI8 A;  5HAW A;  1UI6 A;  4C2M A;  3F1B A;  3NRG A;  3Q0V A;  4OD5 A;  1BJZ A;  3PPB A;  4OD4 A;  3GZI A;  4M3E A;  2GEN A;  3IH3 A;  4I76 A;  2Q24 A;  3WHC A;  4D7M A;  4GCK A;  2DG7 A;  2YVE A;  3VOK A;  3Q0W A;  1ZKG A;  2QIB A;  3QPS A;  2WGB A;  3O60 A;  5J3L A;  3IUV A;  4GCL A;  5FMP A;  2FJI 1;  5F1J A;  2PFV A;  5FKL A;  2R7V A;  2G3B A;  3FIW A;  5GPA A;  3BR5 A;  3PM1 A;  2R7R A;  2JK3 A;  1SGM A;  3EGQ A;  3VP5 A;  3AQS A;  2HYT A;  3B6C A;  2XGC A;  3K8P C;  3QPL A;  3BR6 A;  2B1E A;  3F0C A;  1JUP A;  2QKO A;  5EFY A;  4X1E A;  3QKX A;  4M3D A;  1T33 A;  3DEW A;  2NS7 A;  3BR3 A;  2QWT A;  1JT6 A;  3AQT A;  2FJ1 A;  3G1L A;  2NS8 A;  2OPT A;  2I10 A;  5K58 A;  3B81 A;  3VTI A;  4CGR A;  3CCY A;  3KZ9 A;  4M3B A;  5FKO A;  2O7T A;  2VKE A;  3PAS A;  3VVY A;  4NEL A;  2NX4 A;  4I6Z A;  2EH3 A;  2IEK A;  3NS4 A;  3BTC A;  2QOP A;  1JUS A;  4M3F A;  3VOX A;  2TCT A;  4MO7 A;  4JKZ A;  1JTY A;  3HTH A;  2Y2Z A;  3VVX A;  5IPA A;  4AC6 A;  5D18 A;  2VKV A;  3HGY A;  5HSZ A;  1U9O A;  3BT9 A;  2GBY A;  4JNN A;  4MK6 A;  2R7X A;  4YZE A;  3G7R A;  4JYK A;  3HGG A;  3O8H A;  5D1R A;  2HKU A;  4G12 A;  4U9N A;  2REK A;  3BTI A;  1RKT A;  3BQY A;  1JT0 A;  4U9L A;  3FK7 A;  3LSR A;  2UXU A;  4GCT A;  3NXC A;  3HIM A;  3ANG A;  3BCG A;  5CXI A;  2RHA A;  4M3G A;  4IRV A;  1QPI A;  3G56 A;  2G7S A;  4D7N A;  3ZQG A;  2ZY9 A;  3B6A A;  2DG8 A;  1RPW A;  2PZ9 A;  5K7Z A;  5DAJ A;  5FHP A;  3VIB A;  2R7W A;  3BR2 A;  4W97 A;  3IH4 A;  4DVY P;  3BR1 A;  3CWR A;  3ON2 A;  4D5C A;  2ZCM A;  4XK4 A;  2ZCN A;  3CJD A;  2Y30 A;  4D5F A;  3KKD A;  2OF7 A;  2ID6 A;  5AQC A;  3V78 A;  5FGL A;  2XPV A;  4AC0 A;  3QQA A;  3VUQ A;  2QCO A;  4GFL A;  3Q3S A;  3LSP A;  5IP6 A;  4ME9 A;  2ID3 A;  3MNL A;  2G0E A;  4ACI A;  3LHQ A;  4AUX A;  2OER A;  3G1M A;  4HKU A;  2GUH A;  1JUM A;  3SDG A;  3NPI A;  2WV1 A;  5IOY A;  5GPC A;  2O7O A;  3HTJ A;  4ICH A;  5FKM A;  3C2B A;  1Z0X A;  2VPR A;  5J1Y A;  5J1U A;  4W1U A;  3P9T A;  1ORK A;  3TP0 A;  2ZOZ A;  4PXI A;  2WUI A;  5F0H A;  2ZOY A;  3DU6 A;  2RAS A;  2R7T A;  2V57 A;  3SWH A;  2XPU A;  3HTI A;  4ABZ A;  3VPR A;  2IBD A;  2HXI A;  2QTQ A;  3SFI A;  5F08 A;  2R7U A;  3ZQI A;  2NP3 A;  3FK6 A;  3VW0 A;  2Y31 A;  5CQG A;  5GP9 A;  2R7S A;  4KWA A;  5IOZ A;  3CDL A;  2XPW A;  4L62 A;  2FBQ A;  2R7Q A;  3LSJ A;  2TRT A;  2HYJ A;  5K7H A;  4DW6 A;  4NN1 A;  5EYR A;  3ZQL A;  3WHB A;  1T56 A;  2X6O A; 
#chains in the Genus database with same CATH homology
 3LJL A;  2HXO A;  3BQZ A;  5C4Y A;  5HBU A;  3BRU A;  3LWJ A;  4V2F A;  3G1O A;  2PBX A;  3DPJ A;  3EUP A;  1A6I A;  3HTA A;  5EZH A;  2ZB9 A;  3KKC A;  3ZQH A;  3KNW A;  5K7F A;  2UXO A;  5F27 A;  3JSJ A;  3LOC A;  3BHQ A;  2ZCX A;  5FKK A;  1VI0 A;  2UXP A;  2NP5 A;  3CRJ A;  4MXM A;  5EZG A;  3IH2 A;  2YVH A;  2XGE A;  3NNR A;  5F04 A;  3GEU A;  2UXH A;  3NI7 A;  5CXG A;  1QVU A;  3T6N A;  2IAI A;  2XDN A;  3TP3 A;  2FQ4 A;  1ZK8 A;  3E7Q A;  2X9D A;  4UDS A;  3BTJ A;  3QBM A;  3VVZ A;  3C07 A;  3RH2 A;  5F0F A;  2F07 A;  3COL A;  2FD5 A;  5D19 A;  4B1R A;  2G7G A;  5FKN A;  5F0C A;  3VW2 A;  3VW1 A;  3BJB A;  3BTL A;  2JJ7 A;  4GFK A;  4AF5 A;  2UXI A;  5H9T A;  2RAE A;  3HE0 A;  3RD3 A;  2GFN A;  2XRL A;  3MVP A;  2W53 A;  2IU5 A;  2XB5 A;  5CW8 A;  3ANP A;  3ZQF A;  4B3A A;  2DTZ A;  2XGD A;  1U9N A;  3S5R A;  1JTX A;  1QVT A;  3DCF A;  5J1R A;  4JL3 A;  3BNI A;  3ON4 A;  2D6Y A;  3FRQ A;  2G7L A;  3BR0 A;  1RKW A;  1UI5 A;  3Q0U A;  1Z77 A;  2HQ5 A;  2FX0 A;  3V6G A;  4V2G A;  3O8G A;  2OI8 A;  5HAW A;  1UI6 A;  3F1B A;  3NRG A;  3Q0V A;  1BJZ A;  3PPB A;  3GZI A;  4M3E A;  2GEN A;  3IH3 A;  4I76 A;  2Q24 A;  3WHC A;  4D7M A;  4GCK A;  2DG7 A;  2YVE A;  3VOK A;  3Q0W A;  1ZKG A;  2QIB A;  3QPS A;  2WGB A;  3O60 A;  5J3L A;  3IUV A;  4GCL A;  5FMP A;  5F1J A;  5FKL A;  2G3B A;  3FIW A;  5GPA A;  3BR5 A;  3PM1 A;  2JK3 A;  1SGM A;  3EGQ A;  3VP5 A;  3AQS A;  2HYT A;  3B6C A;  2XGC A;  3QPL A;  3BR6 A;  3F0C A;  1JUP A;  2QKO A;  5EFY A;  4X1E A;  3QKX A;  4M3D A;  1T33 A;  3DEW A;  2NS7 A;  3BR3 A;  2QWT A;  1JT6 A;  3AQT A;  2FJ1 A;  3G1L A;  2NS8 A;  2OPT A;  2I10 A;  5K58 A;  3B81 A;  4CGR A;  3CCY A;  3KZ9 A;  4M3B A;  5FKO A;  2O7T A;  2VKE A;  3PAS A;  3VVY A;  4NEL A;  2NX4 A;  4I6Z A;  2EH3 A;  2IEK A;  3BTC A;  2QOP A;  1JUS A;  4M3F A;  3VOX A;  2TCT A;  4MO7 A;  4JKZ A;  1JTY A;  3HTH A;  2Y2Z A;  3VVX A;  5IPA A;  4AC6 A;  5D18 A;  2VKV A;  3HGY A;  5HSZ A;  1U9O A;  3BT9 A;  2GBY A;  4JNN A;  4MK6 A;  4YZE A;  3G7R A;  4JYK A;  3HGG A;  3O8H A;  5D1R A;  2HKU A;  4G12 A;  2REK A;  3BTI A;  1RKT A;  3BQY A;  1JT0 A;  3FK7 A;  3LSR A;  2UXU A;  4GCT A;  3NXC A;  3HIM A;  3ANG A;  3BCG A;  5CXI A;  2RHA A;  4M3G A;  1QPI A;  3G56 A;  2G7S A;  4D7N A;  3ZQG A;  3B6A A;  2DG8 A;  1RPW A;  2PZ9 A;  5K7Z A;  5DAJ A;  5FHP A;  3VIB A;  3BR2 A;  4W97 A;  3IH4 A;  3BR1 A;  3CWR A;  3ON2 A;  4D5C A;  2ZCM A;  4XK4 A;  2ZCN A;  3CJD A;  2Y30 A;  4D5F A;  3KKD A;  2OF7 A;  2ID6 A;  5AQC A;  3V78 A;  5FGL A;  2XPV A;  4AC0 A;  3QQA A;  3VUQ A;  2QCO A;  4GFL A;  3Q3S A;  3LSP A;  5IP6 A;  4ME9 A;  2ID3 A;  3MNL A;  2G0E A;  4ACI A;  3LHQ A;  4AUX A;  2OER A;  3G1M A;  4HKU A;  2GUH A;  1JUM A;  3SDG A;  3NPI A;  2WV1 A;  5IOY A;  5GPC A;  2O7O A;  3HTJ A;  4ICH A;  5FKM A;  3C2B A;  1Z0X A;  2VPR A;  5J1Y A;  5J1U A;  4W1U A;  3P9T A;  1ORK A;  3TP0 A;  2ZOZ A;  4PXI A;  2WUI A;  5F0H A;  2ZOY A;  2RAS A;  2V57 A;  2XPU A;  3HTI A;  4ABZ A;  3VPR A;  2IBD A;  2HXI A;  2QTQ A;  3SFI A;  5F08 A;  3ZQI A;  2NP3 A;  3FK6 A;  3VW0 A;  2Y31 A;  5GP9 A;  4KWA A;  5IOZ A;  3CDL A;  2XPW A;  4L62 A;  2FBQ A;  3LSJ A;  2TRT A;  2HYJ A;  5K7H A;  4DW6 A;  4NN1 A;  5EYR A;  3ZQL A;  3WHB A;  1T56 A;  2X6O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...