3KKCA

The crystal structure of tetr transcriptional regulator from streptococcus agalactiae 2603v
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
177
structure length
177
Chain Sequence
b'SNAMVKDRQIQKTKVAIYNAFISLLQENDYSKITVQDVIGLANVGRSTFYSHYESKEVLLKELCEDLFHHLFKQGRDVTFEEYLVHILKHFEQNQDSIATLLLSDDPYFLLRFRSELEHDVYPRLREEYITKVDIPEDFLKQFLLSSFIETLKWWLHQRQKMTVEDLLKYYLTMVER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TetR family Transcriptional regulator
molecule tags Transcription regulator
source organism Streptococcus agalactiae 2603v/r
publication title The crystal structure OF TetR transcriptional regulator from Streptococcus agalactiae 2603V
rcsb
total genus 64
structure length 177
sequence length 177
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF14278 TetR_C_8 Transcriptional regulator C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3kkcA01
2NP5A 2UXUA 3HTAA 4ME9A 1RPWA 3CDLA 3O8HA 5FKKA 5K7ZA 1QPIA 2GFNA 5F0FA 2W53A 2NS7A 3VP5A 1RKTA 3O8GA 1A6IA 4DW6A 4B1RA 5EZHA 4M3DA 2F07A 4ABZA 4PXIA 2OI8A 5GP9A 3LHQA 5F04A 2RHAA 3HTIA 1JUMA 3BCGA 3HTJA 3T6NA 2VKVA 3Q0UA 5F27A 2QKOA 5J3LA 3BTCA 1ZKGA 4M3FA 3DCFA 3Q3SA 2NS8A 2DTZA 2WUIA 3ZQFA 4MO7A 3Q0VA 2FD5A 1U9OA 2TCTA 4X1EA 2XPUA 3JSJA 3BR1A 2JJ7A 4GFLA 3BR5A 3COLA 2UXIA 2X6OA 3QKXA 2QOPA 5IP6A 2ZCNA 1ZK8A 1VI0A 4L62A 2RASA 4GCTA 4W1UA 3WHCA 5D1RA 4ICHA 4KWAA 1T56A 2Y31A 2XGCA 5CW8A 3BTIA 5F08A 2VKEA 3G1LA 3AQSA 4MK6A 4AC6A 5J1YA 2GBYA 2V57A 2G7LA 3CWRA 2XRLA 3FIWA 1JTXA 3LSPA 2FJ1A 3E7QA 2XDNA 3HGGA 3PPBA 2EH3A 3QQAA 3HTHA 3VW1A 3P9TA 3G7RA 3VPRA 3MVPA 4MXMA 5FKMA 2HQ5A 2ZCMA 3BRUA 3NRGA 4JYKA 3KKCA 3AQTA 3LSJA 5C4YA 5K7FA 3VVZA 3ON2A 4M3BA 1JTYA 2GUHA 3QPSA 3ANPA 3G1OA 5IOZA 4AC0A 1Z77A 5FKOA 3G56A 3O60A 4CGRA 2RAEA 5EFYA 4I76A 5FHPA 3VW0A 2DG8A 2YVHA 3RD3A 2G7SA 4V2FA 1SGMA 3BQZA 2HYTA 2VPRA 3BNIA 3VOKA 3F1BA 3LOCA 4XK4A 3NI7A 5F0CA 2QWTA 5F0HA 2Y2ZA 5CXGA 5F1JA 5FMPA 2D6YA 2IAIA 3EUPA 4D5FA 4GCKA 3IUVA 3BR2A 3RH2A 2TRTA 2FQ4A 1UI5A 5J1RA 5FKNA 2UXHA 3FRQA 3HIMA 3B6CA 3ZQIA 2HXOA 4UDSA 3LSRA 3BJBA 2FX0A 2G3BA 2HXIA 2XB5A 3VUQA 3GZIA 1JT6A 3S5RA 3BQYA 2QCOA 3C2BA 1U9NA 3ZQLA 3PASA 3CCYA 3KZ9A 2ZCXA 4YZEA 2Y30A 4B3AA 2HKUA 4AF5A 2PBXA 2JK3A 3G1MA 2NX4A 1QVUA 4D5CA 3QPLA 3V78A 3SFIA 2PZ9A 3ON4A 5IPAA 4I6ZA 2ID6A 2IEKA 3VVXA 2IU5A 3FK6A 5D18A 3ZQHA 2OERA 3BTLA 3KNWA 4NN1A 3QBMA 3VVYA 3VIBA 2WGBA 4JL3A 2IBDA 4D7NA 2ZOYA 3CRJA 1QVTA 5K7HA 3IH3A 3HE0A 4D7MA 3VW2A 5IOYA 2XGDA 2REKA 2QTQA 4W97A 2OF7A 2YVEA 3LWJA 3GEUA 3BR0A 3NPIA 5D19A 4JKZA 2G0EA 3F0CA 3BT9A 1ORKA 1T33A 2XPVA 2ZOZA 3TP0A 2Q24A 3BR6A 2UXPA 4V2GA 3Q0WA 2I10A 3B6AA 3ANGA 5FGLA 5GPCA 4G12A 2HYJA 3WHBA 3HGYA 2DG7A 4GCLA 3DPJA 3IH2A 2O7TA 1RKWA 3PM1A 3MNLA 3CJDA 1JUPA 4JNNA 5H9TA 1BJZA 3KKDA 3BTJA 5HSZA 2XPWA 2NP3A 3SDGA 5HBUA 2GENA 3DEWA 2OPTA 5EYRA 5FKLA 2X9DA 3FK7A 3EGQA 4GFKA 2O7OA 1JUSA 5K58A 4NELA 2ID3A 5DAJA 3C07A 4ACIA 4M3GA 4HKUA 3BR3A 3LJLA 2QIBA 1JT0A 4M3EA 2FBQA 5J1UA 4AUXA 3B81A 3NNRA 2UXOA 5CXIA 1UI6A 5HAWA 2XGEA 5EZGA 1Z0XA 5AQCA 3ZQGA 2WV1A 3IH4A 3TP3A 3V6GA 3VOXA 3NXCA 2G7GA 5GPAA 2ZB9A 3BHQA
chains in the Genus database with same CATH superfamily
2NP5A 2UXUA 3HTAA 4ME9A 2R7UA 1RPWA 3CDLA 3O8HA 5FKKA 5K7ZA 1QPIA 2GFNA 5F0FA 2W53A 2NS7A 3VP5A 1RKTA 3O8GA 1A6IA 4DW6A 4B1RA 5EZHA 4M3DA 2F07A 4ABZA 4PXIA 2PFVA 2OI8A 5GP9A 3LHQA 5F04A 2RHAA 3HTIA 1JUMA 3BCGA 2A2FX 3HTJA 3T6NA 2VKVA 3Q0UA 5F27A 2QKOA 5J3LA 3BTCA 1ZKGA 4M3FA 3DCFA 3Q3SA 2R7QA 2NS8A 2DTZA 2WUIA 3ZQFA 2R7RA 4MO7A 3Q0VA 2FD5A 1U9OA 2TCTA 4X1EA 2XPUA 3JSJA 3BR1A 2JJ7A 4GFLA 3BR5A 2B1EA 3COLA 2UXIA 2X6OA 3QKXA 2QOPA 5IP6A 2ZCNA 1ZK8A 1VI0A 4L62A 2RASA 4GCTA 4W1UA 3WHCA 5D1RA 4ICHA 4KWAA 1T56A 2Y31A 2XGCA 5CW8A 3BTIA 5F08A 2VKEA 3G1LA 3AQSA 4MK6A 4AC6A 5J1YA 2GBYA 3FHNA 2V57A 2G7LA 3CWRA 2XRLA 3FIWA 1JTXA 3LSPA 2FJ1A 3E7QA 2XDNA 3HGGA 3PPBA 2EH3A 3QQAA 3HTHA 3VW1A 4OD4A 3P9TA 3G7RA 3VPRA 3MVPA 4MXMA 5FKMA 2HQ5A 2ZCMA 3BRUA 3NRGA 4JYKA 3KKCA 3DU6A 3K8PC 3AQTA 3LSJA 5C4YA 5K7FA 3VVZA 3ON2A 4M3BA 1JTYA 2GUHA 3QPSA 3ANPA 3G1OA 5IOZA 4AC0A 1Z77A 5FKOA 3G56A 2FJI1 3KYLA 3O60A 3DU5A 4CGRA 2RAEA 5EFYA 4I76A 5FHPA 3VW0A 2DG8A 2YVXA 2YVHA 3RD3A 2ZY9A 2G7SA 4V2FA 1SGMA 3BQZA 2HYTA 2VPRA 3BNIA 3VOKA 3F1BA 3LOCA 4XK4A 3NI7A 5F0CA 2QWTA 5F0HA 2Y2ZA 5CXGA 5F1JA 5FMPA 2D6YA 3SWHA 2IAIA 3EUPA 4D5FA 4GCKA 3IUVA 3BR2A 3RH2A 2TRTA 2FQ4A 1UI5A 5J1RA 5FKNA 2UXHA 3FRQA 3HIMA 3B6CA 3ZQIA 2HXOA 4UDSA 3BJBA 3LSRA 2FX0A 2G3BA 2HXIA 2XB5A 3VUQA 3GZIA 1JT6A 3S5RA 3BQYA 2QCOA 3C2BA 1U9NA 3ZQLA 3PASA 3CCYA 3KZ9A 2ZCXA 4YZEA 2Y30A 4B3AA 2HKUA 4AF5A 2PBXA 2R7XA 2JK3A 3G1MA 2NX4A 2R7SA 1QVUA 4WIBA 4D5CA 3QPLA 3V78A 3SFIA 2PZ9A 3ON4A 5IPAA 4IRVA 4I6ZA 2ID6A 2IEKA 5CQGA 4C2MA 3VVXA 2IU5A 3FK6A 4U9NA 5D18A 2OERA 3ZQHA 3BTLA 3KNWA 4NN1A 3QBMA 3VVYA 3VIBA 2WGBA 2R7VA 4JL3A 2IBDA 2R7WA 4D7NA 2ZOYA 3CRJA 1QVTA 5K7HA 3IH3A 3HE0A 4DVYP 4D7MA 3VW2A 5IOYA 2XGDA 2REKA 2QTQA 4W97A 2OF7A 2YVEA 3LWJA 3GEUA 3BR0A 2R7TA 3NPIA 5D19A 4JKZA 2G0EA 3F0CA 3BT9A 1ORKA 1T33A 2XPVA 2ZOZA 3TP0A 2Q24A 3BR6A 2UXPA 4V2GA 3Q0WA 2I10A 3B6AA 3ANGA 5FGLA 5GPCA 4G12A 2HYJA 3WHBA 3HGYA 2DG7A 4GCLA 3DPJA 3IH2A 2O7TA 1RKWA 3PM1A 3MNLA 3CJDA 1JUPA 4JNNA 5H9TA 1BJZA 3KKDA 3BTJA 5HSZA 2XPWA 2NP3A 3SDGA 5HBUA 2GENA 3DEWA 2OPTA 5EYRA 5FKLA 2X9DA 3FK7A 3NS4A 3EGQA 4GFKA 2O7OA 1JUSA 2R7OA 2B3WA 5K58A 4NELA 2ID3A 5DAJA 3C07A 4ACIA 4M3GA 4HKUA 3BR3A 3LJLA 2QIBA 1JT0A 4M3EA 2FBQA 5J1UA 4AUXA 3B81A 3NNRA 2UXOA 5CXIA 1UI6A 3VTIA 5HAWA 2XGEA 4OD5A 5EZGA 1Z0XA 5AQCA 3ZQGA 2WV1A 3IH4A 3TP3A 3V6GA 3VOXA 3NXCA 4U9LA 2G7GA 5GPAA 2ZB9A 3BHQA
chains in the Genus database with same CATH topology
2NP5A 2UXUA 3HTAA 4ME9A 1RPWA 3CDLA 3O8HA 5FKKA 5K7ZA 1QPIA 2GFNA 5F0FA 2W53A 2NS7A 3VP5A 1RKTA 3O8GA 1A6IA 4DW6A 4B1RA 5EZHA 4M3DA 2F07A 4ABZA 4PXIA 2OI8A 5GP9A 3LHQA 5F04A 2RHAA 3HTIA 1JUMA 3BCGA 3HTJA 3T6NA 2VKVA 3Q0UA 5F27A 2QKOA 5J3LA 3BTCA 1ZKGA 4M3FA 3DCFA 3Q3SA 2NS8A 2DTZA 2WUIA 3ZQFA 4MO7A 3Q0VA 2FD5A 1U9OA 2TCTA 4X1EA 2XPUA 3JSJA 3BR1A 2JJ7A 4GFLA 3BR5A 3COLA 2UXIA 2X6OA 3QKXA 2QOPA 5IP6A 2ZCNA 1ZK8A 1VI0A 4L62A 2RASA 4GCTA 4W1UA 3WHCA 5D1RA 4ICHA 4KWAA 1T56A 2Y31A 2XGCA 5CW8A 3BTIA 5F08A 2VKEA 3G1LA 3AQSA 4MK6A 4AC6A 5J1YA 2GBYA 2V57A 2G7LA 3CWRA 2XRLA 3FIWA 1JTXA 3LSPA 2FJ1A 3E7QA 2XDNA 3HGGA 3PPBA 2EH3A 3QQAA 3HTHA 3VW1A 3P9TA 3G7RA 3VPRA 3MVPA 4MXMA 5FKMA 2HQ5A 2ZCMA 3BRUA 3NRGA 4JYKA 3KKCA 3AQTA 3LSJA 5C4YA 5K7FA 3VVZA 3ON2A 4M3BA 1JTYA 2GUHA 3QPSA 3ANPA 3G1OA 5IOZA 4AC0A 1Z77A 5FKOA 3G56A 3O60A 4CGRA 2RAEA 5EFYA 4I76A 5FHPA 3VW0A 2DG8A 2YVHA 3RD3A 2G7SA 4V2FA 1SGMA 3BQZA 2HYTA 2VPRA 3BNIA 3VOKA 3F1BA 3LOCA 4XK4A 3NI7A 5F0CA 2QWTA 5F0HA 2Y2ZA 5CXGA 5F1JA 5FMPA 2D6YA 2IAIA 3EUPA 4D5FA 4GCKA 3IUVA 3BR2A 3RH2A 2TRTA 2FQ4A 1UI5A 5J1RA 5FKNA 2UXHA 3FRQA 3HIMA 3B6CA 3ZQIA 2HXOA 4UDSA 3LSRA 3BJBA 2FX0A 2G3BA 2HXIA 2XB5A 3VUQA 3GZIA 1JT6A 3S5RA 3BQYA 2QCOA 3C2BA 1U9NA 3ZQLA 3PASA 3CCYA 3KZ9A 2ZCXA 4YZEA 2Y30A 4B3AA 2HKUA 4AF5A 2PBXA 2JK3A 3G1MA 2NX4A 1QVUA 4D5CA 3QPLA 3V78A 3SFIA 2PZ9A 3ON4A 5IPAA 4I6ZA 2ID6A 2IEKA 3VVXA 2IU5A 3FK6A 5D18A 3ZQHA 2OERA 3BTLA 3KNWA 4NN1A 3QBMA 3VVYA 3VIBA 2WGBA 4JL3A 2IBDA 4D7NA 2ZOYA 3CRJA 1QVTA 5K7HA 3IH3A 3HE0A 4D7MA 3VW2A 5IOYA 2XGDA 2REKA 2QTQA 4W97A 2OF7A 2YVEA 3LWJA 3GEUA 3BR0A 3NPIA 5D19A 4JKZA 2G0EA 3F0CA 3BT9A 1ORKA 1T33A 2XPVA 2ZOZA 3TP0A 2Q24A 3BR6A 2UXPA 4V2GA 3Q0WA 2I10A 3B6AA 3ANGA 5FGLA 5GPCA 4G12A 2HYJA 3WHBA 3HGYA 2DG7A 4GCLA 3DPJA 3IH2A 2O7TA 1RKWA 3PM1A 3MNLA 3CJDA 1JUPA 4JNNA 5H9TA 1BJZA 3KKDA 3BTJA 5HSZA 2XPWA 2NP3A 3SDGA 5HBUA 2GENA 3DEWA 2OPTA 5EYRA 5FKLA 2X9DA 3FK7A 3EGQA 4GFKA 2O7OA 1JUSA 5K58A 4NELA 2ID3A 5DAJA 3C07A 4ACIA 4M3GA 4HKUA 3BR3A 3LJLA 2QIBA 1JT0A 4M3EA 2FBQA 5J1UA 4AUXA 3B81A 3NNRA 2UXOA 5CXIA 1UI6A 5HAWA 2XGEA 5EZGA 1Z0XA 5AQCA 3ZQGA 2WV1A 3IH4A 3TP3A 3V6GA 3VOXA 3NXCA 2G7GA 5GPAA 2ZB9A 3BHQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NP5 A;  2UXU A;  3HTA A;  4ME9 A;  1RPW A;  3CDL A;  3O8H A;  5FKK A;  5K7Z A;  1QPI A;  2GFN A;  5F0F A;  2W53 A;  2NS7 A;  3VP5 A;  1RKT A;  3O8G A;  1A6I A;  4DW6 A;  4B1R A;  5EZH A;  4M3D A;  2F07 A;  4ABZ A;  4PXI A;  2OI8 A;  5GP9 A;  3LHQ A;  5F04 A;  2RHA A;  3HTI A;  1JUM A;  3BCG A;  3HTJ A;  3T6N A;  2VKV A;  3Q0U A;  5F27 A;  2QKO A;  5J3L A;  3BTC A;  1ZKG A;  4M3F A;  3DCF A;  3Q3S A;  2NS8 A;  2DTZ A;  2WUI A;  3ZQF A;  4MO7 A;  3Q0V A;  2FD5 A;  1U9O A;  2TCT A;  4X1E A;  2XPU A;  3JSJ A;  3BR1 A;  2JJ7 A;  4GFL A;  3BR5 A;  3COL A;  2UXI A;  2X6O A;  3QKX A;  2QOP A;  5IP6 A;  2ZCN A;  1ZK8 A;  1VI0 A;  4L62 A;  2RAS A;  4GCT A;  4W1U A;  3WHC A;  5D1R A;  4ICH A;  4KWA A;  1T56 A;  2Y31 A;  2XGC A;  5CW8 A;  3BTI A;  5F08 A;  2VKE A;  3G1L A;  3AQS A;  4MK6 A;  4AC6 A;  5J1Y A;  2GBY A;  2V57 A;  2G7L A;  3CWR A;  2XRL A;  3FIW A;  1JTX A;  3LSP A;  2FJ1 A;  3E7Q A;  2XDN A;  3HGG A;  3PPB A;  2EH3 A;  3QQA A;  3HTH A;  3VW1 A;  3P9T A;  3G7R A;  3VPR A;  3MVP A;  4MXM A;  5FKM A;  2HQ5 A;  2ZCM A;  3BRU A;  3NRG A;  4JYK A;  3KKC A;  3AQT A;  3LSJ A;  5C4Y A;  5K7F A;  3VVZ A;  3ON2 A;  4M3B A;  1JTY A;  2GUH A;  3QPS A;  3ANP A;  3G1O A;  5IOZ A;  4AC0 A;  1Z77 A;  5FKO A;  3G56 A;  3O60 A;  4CGR A;  2RAE A;  5EFY A;  4I76 A;  5FHP A;  3VW0 A;  2DG8 A;  2YVH A;  3RD3 A;  2G7S A;  4V2F A;  1SGM A;  3BQZ A;  2HYT A;  2VPR A;  3BNI A;  3VOK A;  3F1B A;  3LOC A;  4XK4 A;  3NI7 A;  5F0C A;  2QWT A;  5F0H A;  2Y2Z A;  5CXG A;  5F1J A;  5FMP A;  2D6Y A;  2IAI A;  3EUP A;  4D5F A;  4GCK A;  3IUV A;  3BR2 A;  3RH2 A;  2TRT A;  2FQ4 A;  1UI5 A;  5J1R A;  5FKN A;  2UXH A;  3FRQ A;  3HIM A;  3B6C A;  3ZQI A;  2HXO A;  4UDS A;  3LSR A;  3BJB A;  2FX0 A;  2G3B A;  2HXI A;  2XB5 A;  3VUQ A;  3GZI A;  1JT6 A;  3S5R A;  3BQY A;  2QCO A;  3C2B A;  1U9N A;  3ZQL A;  3PAS A;  3CCY A;  3KZ9 A;  2ZCX A;  4YZE A;  2Y30 A;  4B3A A;  2HKU A;  4AF5 A;  2PBX A;  2JK3 A;  3G1M A;  2NX4 A;  1QVU A;  4D5C A;  3QPL A;  3V78 A;  3SFI A;  2PZ9 A;  3ON4 A;  5IPA A;  4I6Z A;  2ID6 A;  2IEK A;  3VVX A;  2IU5 A;  3FK6 A;  5D18 A;  3ZQH A;  2OER A;  3BTL A;  3KNW A;  4NN1 A;  3QBM A;  3VVY A;  3VIB A;  2WGB A;  4JL3 A;  2IBD A;  4D7N A;  2ZOY A;  3CRJ A;  1QVT A;  5K7H A;  3IH3 A;  3HE0 A;  4D7M A;  3VW2 A;  5IOY A;  2XGD A;  2REK A;  2QTQ A;  4W97 A;  2OF7 A;  2YVE A;  3LWJ A;  3GEU A;  3BR0 A;  3NPI A;  5D19 A;  4JKZ A;  2G0E A;  3F0C A;  3BT9 A;  1ORK A;  1T33 A;  2XPV A;  2ZOZ A;  3TP0 A;  2Q24 A;  3BR6 A;  2UXP A;  4V2G A;  3Q0W A;  2I10 A;  3B6A A;  3ANG A;  5FGL A;  5GPC A;  4G12 A;  2HYJ A;  3WHB A;  3HGY A;  2DG7 A;  4GCL A;  3DPJ A;  3IH2 A;  2O7T A;  1RKW A;  3PM1 A;  3MNL A;  3CJD A;  1JUP A;  4JNN A;  5H9T A;  1BJZ A;  3KKD A;  3BTJ A;  5HSZ A;  2XPW A;  2NP3 A;  3SDG A;  5HBU A;  2GEN A;  3DEW A;  2OPT A;  5EYR A;  5FKL A;  2X9D A;  3FK7 A;  3EGQ A;  4GFK A;  2O7O A;  1JUS A;  5K58 A;  4NEL A;  2ID3 A;  5DAJ A;  3C07 A;  4ACI A;  4M3G A;  4HKU A;  3BR3 A;  3LJL A;  2QIB A;  1JT0 A;  4M3E A;  2FBQ A;  5J1U A;  4AUX A;  3B81 A;  3NNR A;  2UXO A;  5CXI A;  1UI6 A;  5HAW A;  2XGE A;  5EZG A;  1Z0X A;  5AQC A;  3ZQG A;  2WV1 A;  3IH4 A;  3TP3 A;  3V6G A;  3VOX A;  3NXC A;  2G7G A;  5GPA A;  2ZB9 A;  3BHQ A; 
#chains in the Genus database with same CATH topology
 2NP5 A;  2UXU A;  3HTA A;  4ME9 A;  2R7U A;  1RPW A;  3CDL A;  3O8H A;  5FKK A;  5K7Z A;  1QPI A;  2GFN A;  5F0F A;  2W53 A;  2NS7 A;  3VP5 A;  1RKT A;  3O8G A;  1A6I A;  4DW6 A;  4B1R A;  5EZH A;  4M3D A;  2F07 A;  4ABZ A;  4PXI A;  2PFV A;  2OI8 A;  5GP9 A;  3LHQ A;  5F04 A;  2RHA A;  3HTI A;  1JUM A;  3BCG A;  2A2F X;  3HTJ A;  3T6N A;  2VKV A;  3Q0U A;  5F27 A;  2QKO A;  5J3L A;  3BTC A;  1ZKG A;  4M3F A;  3DCF A;  3Q3S A;  2R7Q A;  2NS8 A;  2DTZ A;  2WUI A;  3ZQF A;  2R7R A;  4MO7 A;  3Q0V A;  2FD5 A;  1U9O A;  2TCT A;  4X1E A;  2XPU A;  3JSJ A;  3BR1 A;  2JJ7 A;  4GFL A;  3BR5 A;  2B1E A;  3COL A;  2UXI A;  2X6O A;  3QKX A;  2QOP A;  5IP6 A;  2ZCN A;  1ZK8 A;  1VI0 A;  4L62 A;  2RAS A;  4GCT A;  4W1U A;  3WHC A;  5D1R A;  4ICH A;  4KWA A;  1T56 A;  2Y31 A;  2XGC A;  5CW8 A;  3BTI A;  5F08 A;  2VKE A;  3G1L A;  3AQS A;  4MK6 A;  4AC6 A;  5J1Y A;  2GBY A;  3FHN A;  2V57 A;  2G7L A;  3CWR A;  2XRL A;  3FIW A;  1JTX A;  3LSP A;  2FJ1 A;  3E7Q A;  2XDN A;  3HGG A;  3PPB A;  2EH3 A;  3QQA A;  3HTH A;  3VW1 A;  4OD4 A;  3P9T A;  3G7R A;  3VPR A;  3MVP A;  4MXM A;  5FKM A;  2HQ5 A;  2ZCM A;  3BRU A;  3NRG A;  4JYK A;  3KKC A;  3DU6 A;  3K8P C;  3AQT A;  3LSJ A;  5C4Y A;  5K7F A;  3VVZ A;  3ON2 A;  4M3B A;  1JTY A;  2GUH A;  3QPS A;  3ANP A;  3G1O A;  5IOZ A;  4AC0 A;  1Z77 A;  5FKO A;  3G56 A;  2FJI 1;  3KYL A;  3O60 A;  3DU5 A;  4CGR A;  2RAE A;  5EFY A;  4I76 A;  5FHP A;  3VW0 A;  2DG8 A;  2YVX A;  2YVH A;  3RD3 A;  2ZY9 A;  2G7S A;  4V2F A;  1SGM A;  3BQZ A;  2HYT A;  2VPR A;  3BNI A;  3VOK A;  3F1B A;  3LOC A;  4XK4 A;  3NI7 A;  5F0C A;  2QWT A;  5F0H A;  2Y2Z A;  5CXG A;  5F1J A;  5FMP A;  2D6Y A;  3SWH A;  2IAI A;  3EUP A;  4D5F A;  4GCK A;  3IUV A;  3BR2 A;  3RH2 A;  2TRT A;  2FQ4 A;  1UI5 A;  5J1R A;  5FKN A;  2UXH A;  3FRQ A;  3HIM A;  3B6C A;  3ZQI A;  2HXO A;  4UDS A;  3BJB A;  3LSR A;  2FX0 A;  2G3B A;  2HXI A;  2XB5 A;  3VUQ A;  3GZI A;  1JT6 A;  3S5R A;  3BQY A;  2QCO A;  3C2B A;  1U9N A;  3ZQL A;  3PAS A;  3CCY A;  3KZ9 A;  2ZCX A;  4YZE A;  2Y30 A;  4B3A A;  2HKU A;  4AF5 A;  2PBX A;  2R7X A;  2JK3 A;  3G1M A;  2NX4 A;  2R7S A;  1QVU A;  4WIB A;  4D5C A;  3QPL A;  3V78 A;  3SFI A;  2PZ9 A;  3ON4 A;  5IPA A;  4IRV A;  4I6Z A;  2ID6 A;  2IEK A;  5CQG A;  4C2M A;  3VVX A;  2IU5 A;  3FK6 A;  4U9N A;  5D18 A;  2OER A;  3ZQH A;  3BTL A;  3KNW A;  4NN1 A;  3QBM A;  3VVY A;  3VIB A;  2WGB A;  2R7V A;  4JL3 A;  2IBD A;  2R7W A;  4D7N A;  2ZOY A;  3CRJ A;  1QVT A;  5K7H A;  3IH3 A;  3HE0 A;  4DVY P;  4D7M A;  3VW2 A;  5IOY A;  2XGD A;  2REK A;  2QTQ A;  4W97 A;  2OF7 A;  2YVE A;  3LWJ A;  3GEU A;  3BR0 A;  2R7T A;  3NPI A;  5D19 A;  4JKZ A;  2G0E A;  3F0C A;  3BT9 A;  1ORK A;  1T33 A;  2XPV A;  2ZOZ A;  3TP0 A;  2Q24 A;  3BR6 A;  2UXP A;  4V2G A;  3Q0W A;  2I10 A;  3B6A A;  3ANG A;  5FGL A;  5GPC A;  4G12 A;  2HYJ A;  3WHB A;  3HGY A;  2DG7 A;  4GCL A;  3DPJ A;  3IH2 A;  2O7T A;  1RKW A;  3PM1 A;  3MNL A;  3CJD A;  1JUP A;  4JNN A;  5H9T A;  1BJZ A;  3KKD A;  3BTJ A;  5HSZ A;  2XPW A;  2NP3 A;  3SDG A;  5HBU A;  2GEN A;  3DEW A;  2OPT A;  5EYR A;  5FKL A;  2X9D A;  3FK7 A;  3NS4 A;  3EGQ A;  4GFK A;  2O7O A;  1JUS A;  2R7O A;  2B3W A;  5K58 A;  4NEL A;  2ID3 A;  5DAJ A;  3C07 A;  4ACI A;  4M3G A;  4HKU A;  3BR3 A;  3LJL A;  2QIB A;  1JT0 A;  4M3E A;  2FBQ A;  5J1U A;  4AUX A;  3B81 A;  3NNR A;  2UXO A;  5CXI A;  1UI6 A;  3VTI A;  5HAW A;  2XGE A;  4OD5 A;  5EZG A;  1Z0X A;  5AQC A;  3ZQG A;  2WV1 A;  3IH4 A;  3TP3 A;  3V6G A;  3VOX A;  3NXC A;  4U9L A;  2G7G A;  5GPA A;  2ZB9 A;  3BHQ A; 
#chains in the Genus database with same CATH homology
 2NP5 A;  2UXU A;  3HTA A;  4ME9 A;  1RPW A;  3CDL A;  3O8H A;  5FKK A;  5K7Z A;  1QPI A;  2GFN A;  5F0F A;  2W53 A;  2NS7 A;  3VP5 A;  1RKT A;  3O8G A;  1A6I A;  4DW6 A;  4B1R A;  5EZH A;  4M3D A;  2F07 A;  4ABZ A;  4PXI A;  2OI8 A;  5GP9 A;  3LHQ A;  5F04 A;  2RHA A;  3HTI A;  1JUM A;  3BCG A;  3HTJ A;  3T6N A;  2VKV A;  3Q0U A;  5F27 A;  2QKO A;  5J3L A;  3BTC A;  1ZKG A;  4M3F A;  3DCF A;  3Q3S A;  2NS8 A;  2DTZ A;  2WUI A;  3ZQF A;  4MO7 A;  3Q0V A;  2FD5 A;  1U9O A;  2TCT A;  4X1E A;  2XPU A;  3JSJ A;  3BR1 A;  2JJ7 A;  4GFL A;  3BR5 A;  3COL A;  2UXI A;  2X6O A;  3QKX A;  2QOP A;  5IP6 A;  2ZCN A;  1ZK8 A;  1VI0 A;  4L62 A;  2RAS A;  4GCT A;  4W1U A;  3WHC A;  5D1R A;  4ICH A;  4KWA A;  1T56 A;  2Y31 A;  2XGC A;  5CW8 A;  3BTI A;  5F08 A;  2VKE A;  3G1L A;  3AQS A;  4MK6 A;  4AC6 A;  5J1Y A;  2GBY A;  2V57 A;  2G7L A;  3CWR A;  2XRL A;  3FIW A;  1JTX A;  3LSP A;  2FJ1 A;  3E7Q A;  2XDN A;  3HGG A;  3PPB A;  2EH3 A;  3QQA A;  3HTH A;  3VW1 A;  3P9T A;  3G7R A;  3VPR A;  3MVP A;  4MXM A;  5FKM A;  2HQ5 A;  2ZCM A;  3BRU A;  3NRG A;  4JYK A;  3KKC A;  3AQT A;  3LSJ A;  5C4Y A;  5K7F A;  3VVZ A;  3ON2 A;  4M3B A;  1JTY A;  2GUH A;  3QPS A;  3ANP A;  3G1O A;  5IOZ A;  4AC0 A;  1Z77 A;  5FKO A;  3G56 A;  3O60 A;  4CGR A;  2RAE A;  5EFY A;  4I76 A;  5FHP A;  3VW0 A;  2DG8 A;  2YVH A;  3RD3 A;  2G7S A;  4V2F A;  1SGM A;  3BQZ A;  2HYT A;  2VPR A;  3BNI A;  3VOK A;  3F1B A;  3LOC A;  4XK4 A;  3NI7 A;  5F0C A;  2QWT A;  5F0H A;  2Y2Z A;  5CXG A;  5F1J A;  5FMP A;  2D6Y A;  2IAI A;  3EUP A;  4D5F A;  4GCK A;  3IUV A;  3BR2 A;  3RH2 A;  2TRT A;  2FQ4 A;  1UI5 A;  5J1R A;  5FKN A;  2UXH A;  3FRQ A;  3HIM A;  3B6C A;  3ZQI A;  2HXO A;  4UDS A;  3LSR A;  3BJB A;  2FX0 A;  2G3B A;  2HXI A;  2XB5 A;  3VUQ A;  3GZI A;  1JT6 A;  3S5R A;  3BQY A;  2QCO A;  3C2B A;  1U9N A;  3ZQL A;  3PAS A;  3CCY A;  3KZ9 A;  2ZCX A;  4YZE A;  2Y30 A;  4B3A A;  2HKU A;  4AF5 A;  2PBX A;  2JK3 A;  3G1M A;  2NX4 A;  1QVU A;  4D5C A;  3QPL A;  3V78 A;  3SFI A;  2PZ9 A;  3ON4 A;  5IPA A;  4I6Z A;  2ID6 A;  2IEK A;  3VVX A;  2IU5 A;  3FK6 A;  5D18 A;  3ZQH A;  2OER A;  3BTL A;  3KNW A;  4NN1 A;  3QBM A;  3VVY A;  3VIB A;  2WGB A;  4JL3 A;  2IBD A;  4D7N A;  2ZOY A;  3CRJ A;  1QVT A;  5K7H A;  3IH3 A;  3HE0 A;  4D7M A;  3VW2 A;  5IOY A;  2XGD A;  2REK A;  2QTQ A;  4W97 A;  2OF7 A;  2YVE A;  3LWJ A;  3GEU A;  3BR0 A;  3NPI A;  5D19 A;  4JKZ A;  2G0E A;  3F0C A;  3BT9 A;  1ORK A;  1T33 A;  2XPV A;  2ZOZ A;  3TP0 A;  2Q24 A;  3BR6 A;  2UXP A;  4V2G A;  3Q0W A;  2I10 A;  3B6A A;  3ANG A;  5FGL A;  5GPC A;  4G12 A;  2HYJ A;  3WHB A;  3HGY A;  2DG7 A;  4GCL A;  3DPJ A;  3IH2 A;  2O7T A;  1RKW A;  3PM1 A;  3MNL A;  3CJD A;  1JUP A;  4JNN A;  5H9T A;  1BJZ A;  3KKD A;  3BTJ A;  5HSZ A;  2XPW A;  2NP3 A;  3SDG A;  5HBU A;  2GEN A;  3DEW A;  2OPT A;  5EYR A;  5FKL A;  2X9D A;  3FK7 A;  3EGQ A;  4GFK A;  2O7O A;  1JUS A;  5K58 A;  4NEL A;  2ID3 A;  5DAJ A;  3C07 A;  4ACI A;  4M3G A;  4HKU A;  3BR3 A;  3LJL A;  2QIB A;  1JT0 A;  4M3E A;  2FBQ A;  5J1U A;  4AUX A;  3B81 A;  3NNR A;  2UXO A;  5CXI A;  1UI6 A;  5HAW A;  2XGE A;  5EZG A;  1Z0X A;  5AQC A;  3ZQG A;  2WV1 A;  3IH4 A;  3TP3 A;  3V6G A;  3VOX A;  3NXC A;  2G7G A;  5GPA A;  2ZB9 A;  3BHQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...