3KKCA

The crystal structure of tetr transcriptional regulator from streptococcus agalactiae 2603v
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
177
structure length
177
Chain Sequence
SNAMVKDRQIQKTKVAIYNAFISLLQENDYSKITVQDVIGLANVGRSTFYSHYESKEVLLKELCEDLFHHLFKQGRDVTFEEYLVHILKHFEQNQDSIATLLLSDDPYFLLRFRSELEHDVYPRLREEYITKVDIPEDFLKQFLLSSFIETLKWWLHQRQKMTVEDLLKYYLTMVER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure OF TetR transcriptional regulator from Streptococcus agalactiae 2603V
rcsb
source organism Streptococcus agalactiae 2603v/r
molecule tags Transcription regulator
molecule keywords TetR family Transcriptional regulator
total genus 64
structure length 177
sequence length 177
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF14278 TetR_C_8 Transcriptional regulator C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3kkcA01
3Q0VA 5IPAA 3BCGA 3Q0WA 2OERA 4V2FA 4NN1A 2HXIA 4MK6A 5IP6A 2G0EA 2OI8A 5EZHA 1ORKA 2IU5A 2RAEA 2UXPA 4JL3A 4I76A 1QPIA 3PPBA 2FD5A 2XDNA 3WHBA 4D5CA 5IOYA 4D7MA 2HQ5A 2IBDA 3VVXA 3BTLA 5FKOA 5K7FA 1UI6A 2Y2ZA 5EFYA 2XPUA 5FKMA 4B1RA 3TP3A 3BT9A 3NNRA 3CDLA 2QKOA 3BTJA 3MVPA 3G1OA 2PZ9A 2QIBA 2JJ7A 2DG8A 3FK6A 3ANGA 3PM1A 3BTIA 5HSZA 5FGLA 3CCYA 4AUXA 5F0CA 3VW1A 3GEUA 2ZB9A 3BHQA 2XGDA 3BR0A 1BJZA 3VVZA 4D5FA 3ZQFA 2O7TA 3QKXA 3CJDA 1JUPA 5K58A 3VPRA 3AQTA 2VKEA 3LOCA 2TRTA 2REKA 3ANPA 3NI7A 4JYKA 3V78A 2ZCMA 5J1UA 3HTIA 3C2BA 2WV1A 5FKNA 3ZQHA 1ZK8A 3BTCA 2JK3A 3G1MA 3WHCA 2Y31A 3B6CA 5FHPA 2VKVA 3KNWA 3S5RA 1U9NA 3HTHA 5D19A 3HGGA 2XB5A 3G1LA 2HYJA 4GFKA 2Q24A 1SGMA 3VW2A 1JUSA 4ACIA 3IUVA 4M3GA 4DW6A 4B3AA 3HE0A 4GCTA 2D6YA 3BJBA 5DAJA 3BR2A 3LSRA 3ZQGA 2G7LA 5IOZA 2Y30A 3B81A 3VOKA 4UDSA 3VUQA 2X9DA 3G7RA 3VVYA 4CGRA 5C4YA 3ON4A 2NS8A 1JT0A 3FRQA 2UXIA 3KKCA 5CXGA 4W97A 3NPIA 2RASA 3CWRA 3ON2A 2NX4A 2DG7A 5FKKA 1JTXA 4M3DA 3AQSA 2F07A 3JSJA 2WGBA 3F1BA 3PASA 4JNNA 3MNLA 5FKLA 5F27A 3CRJA 2HYTA 3GZIA 3FK7A 3KKDA 1Z0XA 3Q0UA 2IEKA 2GFNA 4JKZA 5J3LA 2FBQA 2YVHA 4ME9A 2VPRA 2RHAA 5GPCA 4L62A 3T6NA 2ZCNA 4AC0A 3BNIA 4GCKA 2W53A 2O7OA 1QVTA 3HTJA 3VIBA 5CXIA 2PBXA 3RH2A 2QOPA 4KWAA 5FMPA 3QPLA 2HKUA 4I6ZA 4GFLA 5H9TA 3BRUA 4YZEA 1UI5A 2GUHA 3Q3SA 4G12A 2ID3A 5F08A 4ICHA 2UXHA 1ZKGA 5HBUA 1JT6A 3IH2A 3VP5A 3C07A 3HTAA 5F1JA 3DEWA 4AF5A 5K7HA 2NP5A 1A6IA 3BQZA 3BR3A 1QVUA 2TCTA 2ZOZA 5F0HA 5EYRA 4X1EA 5EZGA 4MO7A 3IH3A 1JTYA 3O8HA 3BR5A 3O8GA 2ID6A 3BQYA 2XPVA 3FIWA 3SFIA 3DPJA 5GPAA 2NP3A 3F0CA 2XGEA 1RPWA 1T33A 3LSPA 5AQCA 3QQAA 5J1RA 3P9TA 3NXCA 2NS7A 2YVEA 3DCFA 2FJ1A 2I10A 3KZ9A 1JUMA 2G7GA 4W1UA 2ZCXA 2OF7A 3O60A 1RKWA 3RD3A 3LWJA 5F0FA 4NELA 3B6AA 3VOXA 4V2GA 5F04A 2V57A 2OPTA 3EGQA 3LHQA 2XRLA 3IH4A 2GENA 3SDGA 1T56A 3ZQIA 2GBYA 4MXMA 4PXIA 1Z77A 4XK4A 4D7NA 2XPWA 5GP9A 3G56A 2G7SA 3QPSA 4ABZA 2EH3A 2FX0A 3LSJA 4AC6A 4HKUA 2QCOA 4M3EA 5CW8A 5K7ZA 3BR6A 1RKTA 1VI0A 5D18A 2FQ4A 3TP0A 4M3FA 3BR1A 3NRGA 4M3BA 5HAWA 2HXOA 2XGCA 3HIMA 3QBMA 3ZQLA 3E7QA 5D1RA 3LJLA 2QWTA 3V6GA 2X6OA 2UXUA 2UXOA 4GCLA 1U9OA 2ZOYA 2IAIA 2WUIA 3VW0A 2QTQA 3EUPA 2G3BA 5J1YA 3HGYA 2DTZA 3COLA
chains in the Genus database with same CATH superfamily
3Q0VA 5IPAA 3BCGA 3Q0WA 2OERA 4V2FA 4NN1A 2HXIA 2A2FX 4MK6A 5IP6A 2G0EA 2OI8A 5EZHA 1ORKA 2IU5A 3VTIA 2RAEA 2UXPA 4JL3A 4I76A 1QPIA 4OD5A 3PPBA 2FD5A 2XDNA 3WHBA 4D5CA 5IOYA 4D7MA 2HQ5A 2IBDA 3VVXA 3BTLA 5FKOA 5K7FA 1UI6A 2Y2ZA 5EFYA 2XPUA 5FKMA 4B1RA 3TP3A 2R7XA 3BT9A 3NNRA 3CDLA 2QKOA 3BTJA 3MVPA 3G1OA 2PZ9A 2QIBA 4C2MA 2JJ7A 2DG8A 3FK6A 3ANGA 5CQGA 3PM1A 3BTIA 5HSZA 5FGLA 3CCYA 4AUXA 3FHNA 5F0CA 3VW1A 3DU5A 3GEUA 2ZB9A 3BHQA 2XGDA 3BR0A 1BJZA 3VVZA 4D5FA 3ZQFA 2O7TA 3QKXA 3CJDA 1JUPA 3VPRA 5K58A 3AQTA 2VKEA 3LOCA 2TRTA 2REKA 3ANPA 3NI7A 4JYKA 3V78A 2ZCMA 2R7TA 5J1UA 3HTIA 3C2BA 2WV1A 5FKNA 3ZQHA 1ZK8A 3BTCA 2JK3A 3G1MA 3WHCA 2Y31A 3B6CA 5FHPA 2VKVA 3KNWA 3S5RA 1U9NA 3HTHA 5D19A 3HGGA 2XB5A 3G1LA 2HYJA 4GFKA 2Q24A 1SGMA 4IRVA 3VW2A 1JUSA 4ACIA 3IUVA 4M3GA 4DW6A 4OD4A 4B3AA 3HE0A 4GCTA 2R7UA 2D6YA 2R7VA 3BJBA 5DAJA 3BR2A 3LSRA 2R7WA 3ZQGA 2G7LA 5IOZA 2Y30A 3B81A 3VOKA 2R7OA 4UDSA 3VUQA 2X9DA 3G7RA 3VVYA 4CGRA 5C4YA 3ON4A 2NS8A 1JT0A 3FRQA 4DVYP 2UXIA 3KKCA 5CXGA 4W97A 3NPIA 2RASA 3CWRA 3ON2A 2NX4A 2DG7A 5FKKA 3DU6A 3KYLA 1JTXA 4M3DA 3AQSA 2F07A 2ZY9A 3JSJA 2WGBA 3F1BA 3PASA 4JNNA 3MNLA 5FKLA 5F27A 3CRJA 2HYTA 3FK7A 3KKDA 1Z0XA 3NS4A 3Q0UA 2IEKA 2GFNA 4JKZA 5J3LA 2FBQA 2YVHA 4ME9A 2VPRA 2RHAA 5GPCA 2DTZA 4L62A 3T6NA 2ZCNA 4AC0A 3BNIA 4GCKA 2W53A 2O7OA 1QVTA 3HTJA 3VIBA 5CXIA 2PBXA 3RH2A 2R7RA 2QOPA 4KWAA 5FMPA 3QPLA 2HKUA 4I6ZA 4GFLA 5H9TA 3BRUA 4YZEA 1UI5A 2GUHA 3Q3SA 4G12A 2ID3A 5F08A 4ICHA 2UXHA 1ZKGA 5HBUA 1JT6A 3IH2A 3VP5A 3C07A 3HTAA 2PFVA 5F1JA 3DEWA 4AF5A 2R7SA 2NP5A 3BQZA 1A6IA 3BR3A 5K7HA 1QVUA 2TCTA 2ZOZA 5F0HA 5EYRA 4X1EA 5EZGA 4MO7A 3IH3A 1JTYA 3O8HA 3BR5A 3O8GA 2ID6A 3BQYA 2XPVA 3FIWA 3SFIA 3DPJA 5GPAA 2NP3A 3F0CA 2XGEA 1RPWA 1T33A 2YVXA 3LSPA 5AQCA 3QQAA 5J1RA 4U9LA 3P9TA 3NXCA 2NS7A 2YVEA 3DCFA 2FJ1A 2I10A 3KZ9A 1JUMA 2G7GA 4W1UA 2ZCXA 2OF7A 4U9NA 3O60A 1RKWA 3RD3A 3LWJA 5F0FA 4NELA 3B6AA 3VOXA 2B3WA 4V2GA 5F04A 2V57A 2OPTA 3EGQA 2FJI1 3LHQA 2XRLA 3IH4A 2GENA 3SDGA 1T56A 3ZQIA 2GBYA 4MXMA 4PXIA 1Z77A 3K8PC 4XK4A 4WIBA 4D7NA 2XPWA 5GP9A 3G56A 2B1EA 2G7SA 3QPSA 4ABZA 2EH3A 2FX0A 3LSJA 4AC6A 4HKUA 2QCOA 4M3EA 5CW8A 5K7ZA 3BR6A 1RKTA 1VI0A 5D18A 2FQ4A 3TP0A 4M3FA 3BR1A 3NRGA 4M3BA 5HAWA 2HXOA 2R7QA 2XGCA 3HIMA 3SWHA 3QBMA 3ZQLA 3E7QA 5D1RA 3LJLA 2QWTA 3V6GA 2X6OA 2UXUA 2UXOA 4GCLA 1U9OA 2ZOYA 2IAIA 2WUIA 3VW0A 2QTQA 3EUPA 2G3BA 5J1YA 3HGYA 3GZIA 3COLA
chains in the Genus database with same CATH topology
3Q0VA 5IPAA 3BCGA 3Q0WA 2OERA 4V2FA 4NN1A 2HXIA 4MK6A 5IP6A 2G0EA 2OI8A 5EZHA 1ORKA 2IU5A 2RAEA 2UXPA 4JL3A 4I76A 1QPIA 3PPBA 2FD5A 2XDNA 3WHBA 4D5CA 5IOYA 4D7MA 2HQ5A 2IBDA 3VVXA 3BTLA 5FKOA 5K7FA 1UI6A 2Y2ZA 5EFYA 2XPUA 5FKMA 4B1RA 3TP3A 3BT9A 3NNRA 3CDLA 2QKOA 3BTJA 3MVPA 3G1OA 2PZ9A 2QIBA 2JJ7A 2DG8A 3FK6A 3ANGA 3PM1A 3BTIA 5HSZA 5FGLA 3CCYA 4AUXA 5F0CA 3VW1A 3GEUA 2ZB9A 3BHQA 2XGDA 3BR0A 1BJZA 3VVZA 4D5FA 3ZQFA 2O7TA 3QKXA 3CJDA 1JUPA 5K58A 3VPRA 3AQTA 2VKEA 3LOCA 2TRTA 2REKA 3ANPA 3NI7A 4JYKA 3V78A 2ZCMA 5J1UA 3HTIA 3C2BA 2WV1A 5FKNA 3ZQHA 1ZK8A 3BTCA 2JK3A 3G1MA 3WHCA 2Y31A 3B6CA 5FHPA 2VKVA 3KNWA 3S5RA 1U9NA 3HTHA 5D19A 3HGGA 2XB5A 3G1LA 2HYJA 4GFKA 2Q24A 1SGMA 3VW2A 1JUSA 4ACIA 3IUVA 4M3GA 4DW6A 4B3AA 3HE0A 4GCTA 2D6YA 3BJBA 5DAJA 3BR2A 3LSRA 3ZQGA 2G7LA 5IOZA 2Y30A 3B81A 3VOKA 4UDSA 3VUQA 2X9DA 3G7RA 3VVYA 4CGRA 5C4YA 3ON4A 2NS8A 1JT0A 3FRQA 2UXIA 3KKCA 5CXGA 4W97A 3NPIA 2RASA 3CWRA 3ON2A 2NX4A 2DG7A 5FKKA 1JTXA 4M3DA 3AQSA 2F07A 3JSJA 2WGBA 3F1BA 3PASA 4JNNA 3MNLA 5FKLA 5F27A 3CRJA 2HYTA 3GZIA 3FK7A 3KKDA 1Z0XA 3Q0UA 2IEKA 2GFNA 4JKZA 5J3LA 2FBQA 2YVHA 4ME9A 2VPRA 2RHAA 5GPCA 4L62A 3T6NA 2ZCNA 4AC0A 3BNIA 4GCKA 2W53A 2O7OA 1QVTA 3HTJA 3VIBA 5CXIA 2PBXA 3RH2A 2QOPA 4KWAA 5FMPA 3QPLA 2HKUA 4I6ZA 4GFLA 5H9TA 3BRUA 4YZEA 1UI5A 2GUHA 3Q3SA 4G12A 2ID3A 5F08A 4ICHA 2UXHA 1ZKGA 5HBUA 1JT6A 3IH2A 3VP5A 3C07A 3HTAA 5F1JA 3DEWA 4AF5A 5K7HA 2NP5A 1A6IA 3BQZA 3BR3A 1QVUA 2TCTA 2ZOZA 5F0HA 5EYRA 4X1EA 5EZGA 4MO7A 3IH3A 1JTYA 3O8HA 3BR5A 3O8GA 2ID6A 3BQYA 2XPVA 3FIWA 3SFIA 3DPJA 5GPAA 2NP3A 3F0CA 2XGEA 1RPWA 1T33A 3LSPA 5AQCA 3QQAA 5J1RA 3P9TA 3NXCA 2NS7A 2YVEA 3DCFA 2FJ1A 2I10A 3KZ9A 1JUMA 2G7GA 4W1UA 2ZCXA 2OF7A 3O60A 1RKWA 3RD3A 3LWJA 5F0FA 4NELA 3B6AA 3VOXA 4V2GA 5F04A 2V57A 2OPTA 3EGQA 3LHQA 2XRLA 3IH4A 2GENA 3SDGA 1T56A 3ZQIA 2GBYA 4MXMA 4PXIA 1Z77A 4XK4A 4D7NA 2XPWA 5GP9A 3G56A 2G7SA 3QPSA 4ABZA 2EH3A 2FX0A 3LSJA 4AC6A 4HKUA 2QCOA 4M3EA 5CW8A 5K7ZA 3BR6A 1RKTA 1VI0A 5D18A 2FQ4A 3TP0A 4M3FA 3BR1A 3NRGA 4M3BA 5HAWA 2HXOA 2XGCA 3HIMA 3QBMA 3ZQLA 3E7QA 5D1RA 3LJLA 2QWTA 3V6GA 2X6OA 2UXUA 2UXOA 4GCLA 1U9OA 2ZOYA 2IAIA 2WUIA 3VW0A 2QTQA 3EUPA 2G3BA 5J1YA 3HGYA 2DTZA 3COLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q0V A;  5IPA A;  3BCG A;  3Q0W A;  2OER A;  4V2F A;  4NN1 A;  2HXI A;  4MK6 A;  5IP6 A;  2G0E A;  2OI8 A;  5EZH A;  1ORK A;  2IU5 A;  2RAE A;  2UXP A;  4JL3 A;  4I76 A;  1QPI A;  3PPB A;  2FD5 A;  2XDN A;  3WHB A;  4D5C A;  5IOY A;  4D7M A;  2HQ5 A;  2IBD A;  3VVX A;  3BTL A;  5FKO A;  5K7F A;  1UI6 A;  2Y2Z A;  5EFY A;  2XPU A;  5FKM A;  4B1R A;  3TP3 A;  3BT9 A;  3NNR A;  3CDL A;  2QKO A;  3BTJ A;  3MVP A;  3G1O A;  2PZ9 A;  2QIB A;  2JJ7 A;  2DG8 A;  3FK6 A;  3ANG A;  3PM1 A;  3BTI A;  5HSZ A;  5FGL A;  3CCY A;  4AUX A;  5F0C A;  3VW1 A;  3GEU A;  2ZB9 A;  3BHQ A;  2XGD A;  3BR0 A;  1BJZ A;  3VVZ A;  4D5F A;  3ZQF A;  2O7T A;  3QKX A;  3CJD A;  1JUP A;  5K58 A;  3VPR A;  3AQT A;  2VKE A;  3LOC A;  2TRT A;  2REK A;  3ANP A;  3NI7 A;  4JYK A;  3V78 A;  2ZCM A;  5J1U A;  3HTI A;  3C2B A;  2WV1 A;  5FKN A;  3ZQH A;  1ZK8 A;  3BTC A;  2JK3 A;  3G1M A;  3WHC A;  2Y31 A;  3B6C A;  5FHP A;  2VKV A;  3KNW A;  3S5R A;  1U9N A;  3HTH A;  5D19 A;  3HGG A;  2XB5 A;  3G1L A;  2HYJ A;  4GFK A;  2Q24 A;  1SGM A;  3VW2 A;  1JUS A;  4ACI A;  3IUV A;  4M3G A;  4DW6 A;  4B3A A;  3HE0 A;  4GCT A;  2D6Y A;  3BJB A;  5DAJ A;  3BR2 A;  3LSR A;  3ZQG A;  2G7L A;  5IOZ A;  2Y30 A;  3B81 A;  3VOK A;  4UDS A;  3VUQ A;  2X9D A;  3G7R A;  3VVY A;  4CGR A;  5C4Y A;  3ON4 A;  2NS8 A;  1JT0 A;  3FRQ A;  2UXI A;  3KKC A;  5CXG A;  4W97 A;  3NPI A;  2RAS A;  3CWR A;  3ON2 A;  2NX4 A;  2DG7 A;  5FKK A;  1JTX A;  4M3D A;  3AQS A;  2F07 A;  3JSJ A;  2WGB A;  3F1B A;  3PAS A;  4JNN A;  3MNL A;  5FKL A;  5F27 A;  3CRJ A;  2HYT A;  3GZI A;  3FK7 A;  3KKD A;  1Z0X A;  3Q0U A;  2IEK A;  2GFN A;  4JKZ A;  5J3L A;  2FBQ A;  2YVH A;  4ME9 A;  2VPR A;  2RHA A;  5GPC A;  4L62 A;  3T6N A;  2ZCN A;  4AC0 A;  3BNI A;  4GCK A;  2W53 A;  2O7O A;  1QVT A;  3HTJ A;  3VIB A;  5CXI A;  2PBX A;  3RH2 A;  2QOP A;  4KWA A;  5FMP A;  3QPL A;  2HKU A;  4I6Z A;  4GFL A;  5H9T A;  3BRU A;  4YZE A;  1UI5 A;  2GUH A;  3Q3S A;  4G12 A;  2ID3 A;  5F08 A;  4ICH A;  2UXH A;  1ZKG A;  5HBU A;  1JT6 A;  3IH2 A;  3VP5 A;  3C07 A;  3HTA A;  5F1J A;  3DEW A;  4AF5 A;  5K7H A;  2NP5 A;  1A6I A;  3BQZ A;  3BR3 A;  1QVU A;  2TCT A;  2ZOZ A;  5F0H A;  5EYR A;  4X1E A;  5EZG A;  4MO7 A;  3IH3 A;  1JTY A;  3O8H A;  3BR5 A;  3O8G A;  2ID6 A;  3BQY A;  2XPV A;  3FIW A;  3SFI A;  3DPJ A;  5GPA A;  2NP3 A;  3F0C A;  2XGE A;  1RPW A;  1T33 A;  3LSP A;  5AQC A;  3QQA A;  5J1R A;  3P9T A;  3NXC A;  2NS7 A;  2YVE A;  3DCF A;  2FJ1 A;  2I10 A;  3KZ9 A;  1JUM A;  2G7G A;  4W1U A;  2ZCX A;  2OF7 A;  3O60 A;  1RKW A;  3RD3 A;  3LWJ A;  5F0F A;  4NEL A;  3B6A A;  3VOX A;  4V2G A;  5F04 A;  2V57 A;  2OPT A;  3EGQ A;  3LHQ A;  2XRL A;  3IH4 A;  2GEN A;  3SDG A;  1T56 A;  3ZQI A;  2GBY A;  4MXM A;  4PXI A;  1Z77 A;  4XK4 A;  4D7N A;  2XPW A;  5GP9 A;  3G56 A;  2G7S A;  3QPS A;  4ABZ A;  2EH3 A;  2FX0 A;  3LSJ A;  4AC6 A;  4HKU A;  2QCO A;  4M3E A;  5CW8 A;  5K7Z A;  3BR6 A;  1RKT A;  1VI0 A;  5D18 A;  2FQ4 A;  3TP0 A;  4M3F A;  3BR1 A;  3NRG A;  4M3B A;  5HAW A;  2HXO A;  2XGC A;  3HIM A;  3QBM A;  3ZQL A;  3E7Q A;  5D1R A;  3LJL A;  2QWT A;  3V6G A;  2X6O A;  2UXU A;  2UXO A;  4GCL A;  1U9O A;  2ZOY A;  2IAI A;  2WUI A;  3VW0 A;  2QTQ A;  3EUP A;  2G3B A;  5J1Y A;  3HGY A;  2DTZ A;  3COL A; 
#chains in the Genus database with same CATH topology
 3Q0V A;  5IPA A;  3BCG A;  3Q0W A;  2OER A;  4V2F A;  4NN1 A;  2HXI A;  2A2F X;  4MK6 A;  5IP6 A;  2G0E A;  2OI8 A;  5EZH A;  1ORK A;  2IU5 A;  3VTI A;  2RAE A;  2UXP A;  4JL3 A;  4I76 A;  1QPI A;  4OD5 A;  3PPB A;  2FD5 A;  2XDN A;  3WHB A;  4D5C A;  5IOY A;  4D7M A;  2HQ5 A;  2IBD A;  3VVX A;  3BTL A;  5FKO A;  5K7F A;  1UI6 A;  2Y2Z A;  5EFY A;  2XPU A;  5FKM A;  4B1R A;  3TP3 A;  2R7X A;  3BT9 A;  3NNR A;  3CDL A;  2QKO A;  3BTJ A;  3MVP A;  3G1O A;  2PZ9 A;  2QIB A;  4C2M A;  2JJ7 A;  2DG8 A;  3FK6 A;  3ANG A;  5CQG A;  3PM1 A;  3BTI A;  5HSZ A;  5FGL A;  3CCY A;  4AUX A;  3FHN A;  5F0C A;  3VW1 A;  3DU5 A;  3GEU A;  2ZB9 A;  3BHQ A;  2XGD A;  3BR0 A;  1BJZ A;  3VVZ A;  4D5F A;  3ZQF A;  2O7T A;  3QKX A;  3CJD A;  1JUP A;  3VPR A;  5K58 A;  3AQT A;  2VKE A;  3LOC A;  2TRT A;  2REK A;  3ANP A;  3NI7 A;  4JYK A;  3V78 A;  2ZCM A;  2R7T A;  5J1U A;  3HTI A;  3C2B A;  2WV1 A;  5FKN A;  3ZQH A;  1ZK8 A;  3BTC A;  2JK3 A;  3G1M A;  3WHC A;  2Y31 A;  3B6C A;  5FHP A;  2VKV A;  3KNW A;  3S5R A;  1U9N A;  3HTH A;  5D19 A;  3HGG A;  2XB5 A;  3G1L A;  2HYJ A;  4GFK A;  2Q24 A;  1SGM A;  4IRV A;  3VW2 A;  1JUS A;  4ACI A;  3IUV A;  4M3G A;  4DW6 A;  4OD4 A;  4B3A A;  3HE0 A;  4GCT A;  2R7U A;  2D6Y A;  2R7V A;  3BJB A;  5DAJ A;  3BR2 A;  3LSR A;  2R7W A;  3ZQG A;  2G7L A;  5IOZ A;  2Y30 A;  3B81 A;  3VOK A;  2R7O A;  4UDS A;  3VUQ A;  2X9D A;  3G7R A;  3VVY A;  4CGR A;  5C4Y A;  3ON4 A;  2NS8 A;  1JT0 A;  3FRQ A;  4DVY P;  2UXI A;  3KKC A;  5CXG A;  4W97 A;  3NPI A;  2RAS A;  3CWR A;  3ON2 A;  2NX4 A;  2DG7 A;  5FKK A;  3DU6 A;  3KYL A;  1JTX A;  4M3D A;  3AQS A;  2F07 A;  2ZY9 A;  3JSJ A;  2WGB A;  3F1B A;  3PAS A;  4JNN A;  3MNL A;  5FKL A;  5F27 A;  3CRJ A;  2HYT A;  3FK7 A;  3KKD A;  1Z0X A;  3NS4 A;  3Q0U A;  2IEK A;  2GFN A;  4JKZ A;  5J3L A;  2FBQ A;  2YVH A;  4ME9 A;  2VPR A;  2RHA A;  5GPC A;  2DTZ A;  4L62 A;  3T6N A;  2ZCN A;  4AC0 A;  3BNI A;  4GCK A;  2W53 A;  2O7O A;  1QVT A;  3HTJ A;  3VIB A;  5CXI A;  2PBX A;  3RH2 A;  2R7R A;  2QOP A;  4KWA A;  5FMP A;  3QPL A;  2HKU A;  4I6Z A;  4GFL A;  5H9T A;  3BRU A;  4YZE A;  1UI5 A;  2GUH A;  3Q3S A;  4G12 A;  2ID3 A;  5F08 A;  4ICH A;  2UXH A;  1ZKG A;  5HBU A;  1JT6 A;  3IH2 A;  3VP5 A;  3C07 A;  3HTA A;  2PFV A;  5F1J A;  3DEW A;  4AF5 A;  2R7S A;  2NP5 A;  3BQZ A;  1A6I A;  3BR3 A;  5K7H A;  1QVU A;  2TCT A;  2ZOZ A;  5F0H A;  5EYR A;  4X1E A;  5EZG A;  4MO7 A;  3IH3 A;  1JTY A;  3O8H A;  3BR5 A;  3O8G A;  2ID6 A;  3BQY A;  2XPV A;  3FIW A;  3SFI A;  3DPJ A;  5GPA A;  2NP3 A;  3F0C A;  2XGE A;  1RPW A;  1T33 A;  2YVX A;  3LSP A;  5AQC A;  3QQA A;  5J1R A;  4U9L A;  3P9T A;  3NXC A;  2NS7 A;  2YVE A;  3DCF A;  2FJ1 A;  2I10 A;  3KZ9 A;  1JUM A;  2G7G A;  4W1U A;  2ZCX A;  2OF7 A;  4U9N A;  3O60 A;  1RKW A;  3RD3 A;  3LWJ A;  5F0F A;  4NEL A;  3B6A A;  3VOX A;  2B3W A;  4V2G A;  5F04 A;  2V57 A;  2OPT A;  3EGQ A;  2FJI 1;  3LHQ A;  2XRL A;  3IH4 A;  2GEN A;  3SDG A;  1T56 A;  3ZQI A;  2GBY A;  4MXM A;  4PXI A;  1Z77 A;  3K8P C;  4XK4 A;  4WIB A;  4D7N A;  2XPW A;  5GP9 A;  3G56 A;  2B1E A;  2G7S A;  3QPS A;  4ABZ A;  2EH3 A;  2FX0 A;  3LSJ A;  4AC6 A;  4HKU A;  2QCO A;  4M3E A;  5CW8 A;  5K7Z A;  3BR6 A;  1RKT A;  1VI0 A;  5D18 A;  2FQ4 A;  3TP0 A;  4M3F A;  3BR1 A;  3NRG A;  4M3B A;  5HAW A;  2HXO A;  2R7Q A;  2XGC A;  3HIM A;  3SWH A;  3QBM A;  3ZQL A;  3E7Q A;  5D1R A;  3LJL A;  2QWT A;  3V6G A;  2X6O A;  2UXU A;  2UXO A;  4GCL A;  1U9O A;  2ZOY A;  2IAI A;  2WUI A;  3VW0 A;  2QTQ A;  3EUP A;  2G3B A;  5J1Y A;  3HGY A;  3GZI A;  3COL A; 
#chains in the Genus database with same CATH homology
 3Q0V A;  5IPA A;  3BCG A;  3Q0W A;  2OER A;  4V2F A;  4NN1 A;  2HXI A;  4MK6 A;  5IP6 A;  2G0E A;  2OI8 A;  5EZH A;  1ORK A;  2IU5 A;  2RAE A;  2UXP A;  4JL3 A;  4I76 A;  1QPI A;  3PPB A;  2FD5 A;  2XDN A;  3WHB A;  4D5C A;  5IOY A;  4D7M A;  2HQ5 A;  2IBD A;  3VVX A;  3BTL A;  5FKO A;  5K7F A;  1UI6 A;  2Y2Z A;  5EFY A;  2XPU A;  5FKM A;  4B1R A;  3TP3 A;  3BT9 A;  3NNR A;  3CDL A;  2QKO A;  3BTJ A;  3MVP A;  3G1O A;  2PZ9 A;  2QIB A;  2JJ7 A;  2DG8 A;  3FK6 A;  3ANG A;  3PM1 A;  3BTI A;  5HSZ A;  5FGL A;  3CCY A;  4AUX A;  5F0C A;  3VW1 A;  3GEU A;  2ZB9 A;  3BHQ A;  2XGD A;  3BR0 A;  1BJZ A;  3VVZ A;  4D5F A;  3ZQF A;  2O7T A;  3QKX A;  3CJD A;  1JUP A;  5K58 A;  3VPR A;  3AQT A;  2VKE A;  3LOC A;  2TRT A;  2REK A;  3ANP A;  3NI7 A;  4JYK A;  3V78 A;  2ZCM A;  5J1U A;  3HTI A;  3C2B A;  2WV1 A;  5FKN A;  3ZQH A;  1ZK8 A;  3BTC A;  2JK3 A;  3G1M A;  3WHC A;  2Y31 A;  3B6C A;  5FHP A;  2VKV A;  3KNW A;  3S5R A;  1U9N A;  3HTH A;  5D19 A;  3HGG A;  2XB5 A;  3G1L A;  2HYJ A;  4GFK A;  2Q24 A;  1SGM A;  3VW2 A;  1JUS A;  4ACI A;  3IUV A;  4M3G A;  4DW6 A;  4B3A A;  3HE0 A;  4GCT A;  2D6Y A;  3BJB A;  5DAJ A;  3BR2 A;  3LSR A;  3ZQG A;  2G7L A;  5IOZ A;  2Y30 A;  3B81 A;  3VOK A;  4UDS A;  3VUQ A;  2X9D A;  3G7R A;  3VVY A;  4CGR A;  5C4Y A;  3ON4 A;  2NS8 A;  1JT0 A;  3FRQ A;  2UXI A;  3KKC A;  5CXG A;  4W97 A;  3NPI A;  2RAS A;  3CWR A;  3ON2 A;  2NX4 A;  2DG7 A;  5FKK A;  1JTX A;  4M3D A;  3AQS A;  2F07 A;  3JSJ A;  2WGB A;  3F1B A;  3PAS A;  4JNN A;  3MNL A;  5FKL A;  5F27 A;  3CRJ A;  2HYT A;  3GZI A;  3FK7 A;  3KKD A;  1Z0X A;  3Q0U A;  2IEK A;  2GFN A;  4JKZ A;  5J3L A;  2FBQ A;  2YVH A;  4ME9 A;  2VPR A;  2RHA A;  5GPC A;  4L62 A;  3T6N A;  2ZCN A;  4AC0 A;  3BNI A;  4GCK A;  2W53 A;  2O7O A;  1QVT A;  3HTJ A;  3VIB A;  5CXI A;  2PBX A;  3RH2 A;  2QOP A;  4KWA A;  5FMP A;  3QPL A;  2HKU A;  4I6Z A;  4GFL A;  5H9T A;  3BRU A;  4YZE A;  1UI5 A;  2GUH A;  3Q3S A;  4G12 A;  2ID3 A;  5F08 A;  4ICH A;  2UXH A;  1ZKG A;  5HBU A;  1JT6 A;  3IH2 A;  3VP5 A;  3C07 A;  3HTA A;  5F1J A;  3DEW A;  4AF5 A;  5K7H A;  2NP5 A;  1A6I A;  3BQZ A;  3BR3 A;  1QVU A;  2TCT A;  2ZOZ A;  5F0H A;  5EYR A;  4X1E A;  5EZG A;  4MO7 A;  3IH3 A;  1JTY A;  3O8H A;  3BR5 A;  3O8G A;  2ID6 A;  3BQY A;  2XPV A;  3FIW A;  3SFI A;  3DPJ A;  5GPA A;  2NP3 A;  3F0C A;  2XGE A;  1RPW A;  1T33 A;  3LSP A;  5AQC A;  3QQA A;  5J1R A;  3P9T A;  3NXC A;  2NS7 A;  2YVE A;  3DCF A;  2FJ1 A;  2I10 A;  3KZ9 A;  1JUM A;  2G7G A;  4W1U A;  2ZCX A;  2OF7 A;  3O60 A;  1RKW A;  3RD3 A;  3LWJ A;  5F0F A;  4NEL A;  3B6A A;  3VOX A;  4V2G A;  5F04 A;  2V57 A;  2OPT A;  3EGQ A;  3LHQ A;  2XRL A;  3IH4 A;  2GEN A;  3SDG A;  1T56 A;  3ZQI A;  2GBY A;  4MXM A;  4PXI A;  1Z77 A;  4XK4 A;  4D7N A;  2XPW A;  5GP9 A;  3G56 A;  2G7S A;  3QPS A;  4ABZ A;  2EH3 A;  2FX0 A;  3LSJ A;  4AC6 A;  4HKU A;  2QCO A;  4M3E A;  5CW8 A;  5K7Z A;  3BR6 A;  1RKT A;  1VI0 A;  5D18 A;  2FQ4 A;  3TP0 A;  4M3F A;  3BR1 A;  3NRG A;  4M3B A;  5HAW A;  2HXO A;  2XGC A;  3HIM A;  3QBM A;  3ZQL A;  3E7Q A;  5D1R A;  3LJL A;  2QWT A;  3V6G A;  2X6O A;  2UXU A;  2UXO A;  4GCL A;  1U9O A;  2ZOY A;  2IAI A;  2WUI A;  3VW0 A;  2QTQ A;  3EUP A;  2G3B A;  5J1Y A;  3HGY A;  2DTZ A;  3COL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...