2ZB9A

Crystal structure of tetr family transcription regulator sco0332
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
188
structure length
188
Chain Sequence
GRRPAEEVRAEVLHAVGELLLTEGTAQLTFERVARVSGVSKTTLYKWWPSKGALALDGYFHAVEDTLAFPDTGDVRADLLAQLRAFTHVMTRTPGGRILTELIGAAQTDADLATAYRQLYSAQRRALAAERLRHARELGQIRPDVDVQVLVDQLWGAVYHRLLIPDEPVDDAFVTALVTNLLDGVCPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Putative transcriptional regulator
publication title Structural and functional analysis of the TetR-family transcriptional regulator SCO0332 from Streptomyces coelicolor
pubmed doi rcsb
source organism Streptomyces coelicolor
total genus 72
structure length 188
sequence length 188
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF16859 TetR_C_11 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2zb9A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2zb9A02
5IYBJ 4DZJA 3G1MA 2HQ5A 1ZQ3P 4AUXA 4A3KJ 2EBIA 2PBXA 1AU7A 4G12A 2MG4A 2NVXJ 1UI6A 4KWAA 3NRGA 1MBKA 4BXXJ 2DA5A 2B63J 5H9TA 5IOZA 1TC3C 2HOAA 2DMUA 2R7ZJ 1ZR4A 1W0UA 1OJLA 2YU9J 5FKLA 3VOXA 5IP9J 4DW6A 3JRFA 2K9NA 4IEJA 4D7MA 2V57A 4AC6A 2R5YB 5F27A 2ZCXA 5IP7J 4JX6A 3GTKJ 1IRZA 1R9TJ 3QKXA 1XS9A 1T33A 5DTDA 1JTXA 3FISA 5GPCA 5GP9A 2L0KA 2OPTA 5C4JJ 2LK2A 1OFCX 1TWHJ 3GBGA 3PM1A 2NS8A 3JRAA 1JUSA 2AO9A 2NP3A 3A03A 1UG2A 1MSFC 2XDNA 1WCMJ 3F0CA 2CJJA 4AYBN 1T56A 2FX0A 2KT0A 3JRBA 3S2DJ 2F07A 3RD3A 3GTMJ 1ENHA 2JA8J 2OI8A 4CYCA 1OCTC 2ID6A 1TWCJ 2R93J 1U8BA 2E1OA 1JUMA 1JKRC 4B1RA 2LR8A 2G0EA 3S15J 3GTJJ 3GEUA 3QBMA 1RESA 2YS9A 3Q0VA 4C3JJ 1GV5A 5EZHA 2JJ7A 2ZOYA 3K2AA 3GTQJ 1SGMA 2DN0A 4FTHA 3A02A 2XPVA 3V78A 2CU7A 3ANGA 4A3JJ 2YVEA 2VUMJ 3B6CA 2VKVA 4ICHA 2M9HA 3BR6A 2G3BA 1TWAJ 4UDSA 3Q0WA 4MXMA 2ELKA 3VUQA 2QOPA 5EEAA 1BJZA 2G7LA 2XGDA 1LE8B 2FD5A 3C2BA 2XB0X 3VIBA 3SFIA 3PPBA 2LTPA 3BG9A 3QPLA 1HLVA 3HGYA 1GUUA 1X2NA 4W1UA 3WHCA 4A3DJ 1Y1VJ 3S1NJ 4GCKA 5FHPA 2AHQA 1XG1A 4M3FA 2R0QC 2Y9ZA 1TWFJ 3S1RJ 3LJLA 1JUPA 3SDGA 5BNGA 3VW1A 1XC5A 4L5EA 2GUHA 3LSJA 1VFCA 4I76A 4ABZA 3K7AJ 4A3IJ 3ZQHA 1H8AC 4M3EA 5F04A 2ECBA 1IGNA 2NP5A 1P7JA 2TCTA 1SFOJ 3JREA 3FK6A 2GM4A 3RQIA 2DMTA 5HODA 2MSYA 1NK2P 5F0FA 2W48A 4XIDA 1JKPC 4IHVA 3LHQA 2CUEA 3IUVA 3ZQGA 3ZQFA 2E2JJ 2QWTA 1MBGA 1ZK8A 3S14J 5CXIA 1MBHA 3BTIA 1ETQA 3HE0A 2CQQA 1RETA 1YRNA 4IHYA 2EZIA 1RKWA 2EQRA 2QTQA 3JR9A 4D5FA 2DA4A 4GFBA 1MH4A 3O8GA 2GENA 1B72B 4HKUA 2HOTA 3F1BA 4M3BA 3FK7A 2M0CA 5E3OA 3LNQA 2JK3A 5FJ8J 2ME6A 4BY1J 3D1NI 3BTJA 2IU5A 1QRYA 2XPUA 1PUFA 5C44J 4RBOA 2DMPA 3OSFA 5FMPA 5IYDJ 3TEDA 2M34A 3VPRA 2LP0A 2ZOZA 4GFKA 3BHQA 2E2IJ 1B8IA 3KNWA 1U9OA 5M3MJ 3ZQLA 2DA3A 3JRHA 2LD5A 2VPRA 3FKIJ 3B81A 4MO7A 4B4CA 5HAWA 1I6HJ 2WB1N 1ZR2A 2LLKA 1H88C 2IBDA 2O8KA 4BBRJ 2CUFA 5J3LA 3SJMA 2HYJA 1VI0A 5FKNA 2K9SA 5EGOB 5EF6A 5HSZA 1ETYA 2XPWA 3VW0A 2UXIA 4DYQA 5EDNA 1HCRA 2FQ4A 1AKHA 3HOVJ 3JSJA 2LY9A 3S2HJ 3IH3A 5GPAA 3LSPA 3OSGA 4MIMA 1VNDA 3GTGJ 2IAIA 3GTPJ 3ZQIA 1JJ8C 4FISA 3O8HA 3JRIA 1CQTA 2JA5J 1BL0A 3BR5A 3O60A 4IHWA 4FE7A 5IP6A 4QIWN 2D5VA 1FTTA 1I50J 2X48A 5EFYA 5FLVA 3S5RA 1IG7A 1SANA 4QTRA 4A3EJ 3A01A 2WV1A 3G1OA 2N8GA 2UXOA 3KKCA 1TWGJ 1H89C 1W0TA 1UMQA 3Q3SA 2ZB9A 5M5WJ 2DG7A 5C4YA 1JGGA 1B8IB 2R5ZA 5EG0A 2YUSA 1D5YA 4XRSA 1FIPA 1POGA 3MKLA 2WAQN 2KDZA 3H3VK 3BR1A 2QIBA 1FJLA 3NPIA 1I3QJ 3CMYA 2UXPA 4A3BJ 5JLXA 3HDDA 2I10A 5DAJA 3BTCA 2PZ9A 3CDLA 4JX4A 2Y2ZA 2XSDC 1GT0C 4FCYA 4A93J 2WGBA 1ETKA 4JYKA 5FKOA 3MNLA 2E19A 1HF0A 4GCTA 1K61A 3G7RA 1ETVA 2RHAA 1WGXA 5FGLA 3PO2J 3CJDA 2IEKA 1E3OC 3VW2A 3JRDA 5K7HA 3EUPA 3VVXA 3HTIA 1X58A 3W6VA 3G56A 4NDLA 3S17J 3GTOJ 2L7FP 3VVYA 1S7EA 2EZHA 3CCYA 3BRUA 4B3AA 3BR3A 2TRTA 4QSHA 2NVTJ 2HKUA 2RASA 5JLWA 3TP3A 1ORKA 3HIMA 4NELA 2H8RA 1DU6A 2EZLA 3HOWJ 2XGEA 3NAUA 5FLMJ 5IYCJ 3BCGA 4CYCB 2JMWA 4DYRA 2ECCA 2Q24A 2L9RA 3PASA 3TW6A 3QPSA 3T6NA 1JTYA 2GBYA 3LSGA 4V2GA 3TW7A 2NX4A 2ZCNA 3L1PA 1QPIA 3FRQA 1LFUP 1APLC 4JKZA 2EH3A 1MNMC 3MVPA 3GTLJ 3I4NJ 4ME9A 2K40A 4UUTA 1RPWA 1RKTA 3BNIA 3Q0UA 3ON4A 3ON2A 2X9DA 1IDZA 4MFEA 3IH4A 3PO3J 4A3MJ 2NVQJ 3HM5A 1UI5A 3V6GA 2DJNA 3FIWA 1EF4A 4M3DA 3BTLA 5IPAA 3BR0A 3NI7A 1WH5A 3HBLA 4D5CA 1FTZA 1IDYA 4C3IJ 3BR2A 2UXUA 2M8GX 2X6OA 1IC8A 1GDTA 3BT9A 2R5YA 1IUFA 2QCOA 1NK3P 2H1KA 1Q1VA 2O7TA 1BW6A 2VI6A 5F0CA 5K7ZA 4A3CJ 2JA7J 2DG8A 5K58A 3ZOBA 1ZTRA 1ETWA 2M2EA 1QVUA 1A5JA 5FKKA 2REKA 4MLOA 3S16J 4A3FJ 2Y30A 5J1YA 3NNRA 4W97A 5AQCA 3RH2A 4UUSA 1OCPA 3G1LA 1WPKA 5M5XJ 3QQAA 3VP5A 2XRLA 1JT6A 3OIOA 1YRNB 2DTZA 2OF7A 2JWTA 1JKQC 1IJWC 2HI3A 3NARA 3RZDJ 3OOUA 3JRGA 1JJ6C 2WUIA 3RKQA 3HB9A 3BG5A 3BQYA 4RDUA 2HYTA 1FEXA 3LSRA 5M5YJ 3CRJA 1ZGWA 1PUFB 1JT0A 3S1MJ 1ZKGA 2LVSA 4ACIA 2L7ZA 2JA6J 3I4MJ 3C07A 2ME0A 5EZGA 4Y7NJ 3LOCA 2XB5A 2LKXA 3DEWA 5E3NA 2COBA 2HOSA 3HOUJ 1MSEC 3ANPA 1ETOA 2O7OA 1ETXA 3IH2A 3HTAA 3DCFA 2FJ1A 1O4XA 4HNVA 4FE4A 4BY7J 3HGGA 1X2MA 2CQXA 1QVTA 4EEFG 5C3EJ 1LE8A 3BQZA 5F08A 3RZOJ 5K7FA 3AQTA 4JNNA 1NTCA 2NS7A 2FBQA 2W53A 9ANTA 1GVDA 3HOXJ 3B6AA 3E7LA 1AKHB 3DPJA 5HBUA 4UUSB 3HKZN 2EZKA 2O9LA 5FKMA 4BKXA 1BW5A 2UXHA 5IOYA 5J1RA 4A69C 3M3YJ 4IHXA 2DA1A 2GLOA 3P9TA 1F36A 2ID3A 2E2HJ 4XICA 2P81A 2MGQA 3HOZJ 1HOMA 2R92J 1MH3A 3VOKA 3E7QA 5E3LA 3M4OJ 5M3FJ 3A01B 5D18A 4PXIA 1HDPA 3WHBA 2YVHA 2K9QA 3BJBA 5D1RA 3HTHA 3KZ9A 4M6VA 3TP0A 3CQZJ 2R5ZB 1MBFA 5EG0B 3MN2A 1UHSA 4JL3A 2DA2A 1F43A 2Y0SN 1IV6A 4MK6A 4V2FA 2MW8A 1K83J 4X1EA 4BBSJ 2QKOA 5CW8A 2LFBA 1B72A 4JX5A 3HTJA 3EGQA 2NVYJ 1Z0XA 4AF5A 3AQSA 4X6AJ 2D6YA 3NXCA 5D19A 3S1QJ 2DA7A 3CWRA 3ZQCA 3IV5A 4XK4A 2Y31A 2HDDA 2ZCMA 4GFLA 2CRGA 2DMQA 4AC0A 4GCLA 2DMNA 4I6ZA 2GFNA 3JRCA 4Y52J 2Y9YA 5CXGA 5F0HA 1WH7A 2DA6A 4DZPA 4L62A 2OERA 2HXOA 1U78A 1Z77A 3KKDA 4MFDA 2G7GA 1P7IA 5EGOA 1Y1WJ 1FIAA 1LFBA 1RR7A 4S0HB 2JN6A 3COLA 1HDDC 2QF7A 3BG3A 2VKEA 3LWJA 3H0GJ 2L7MP 4M3GA 3HOYJ 1G2HA 3HEFA 5F1JA 2HXIA 3GZIA 5J1UA 2PMZN 1GV2A 1ITYA 4J19A 3UKGA 4CGRA 1DU0A 4D7NA 4A3GJ 4XRMA 1BA5A 4YZEA 4JP0A 1A6IA 1WI3A 2RAEA 1VF9A 1U9NA 5EYRA 4C3HJ 1AHDP 4C2MJ 4DYCA 1JKOC 5DS9A 4LOCA 2G7SA 5E3MA 4A3LJ 1MBJA 4XRSG 3VVZA 4NN1A 2NOGA 1MBEA 2XGCA 5C4XJ
chains in the Genus database with same CATH superfamily
1ZYRF 5IYBJ 4A3KJ 2NOJB 2A3SA 2OV7A 1AU7A 4X0GA 5ICCA 2RQPA 2NVXJ 2W7NA 4BUPA 1UI6A 2EV5A 4LD5A 4KWAA 5H9TA 2XF5A 2DA5A 4OMZA 1ZR4A 3E6DA 1AOYA 1R22A 1MMDA 3DBRB 4E7HA 2ZCXA 2PMHA 1YW8A 2KJBA 2XSJC 1XS9A 5GPCA 1GHCA 3ZMTA 5GP9A 2L0KA 5TISC 5GTIC 3OS1A 1BOBA 1G3WA 1OFCX 2R7WA 2W1OA 5J40A 2M3AA 3AFHA 3A03A 5LGNA 1UG2A 4HA8A 3HRMA 1TBXA 2B1EA 2KT0A 3H0DA 2RVCA 2XAFA 1ENHA 4Y13A 2LRDA 4RMNA 3LSTA 2OI8A 1OCTC 2ID6A 1TWCJ 4XN0A 2E1OA 1Y0UA 2LOOA 2VN2A 2XV4S 3SWHA 2PX9A 2JJ7A 3ZPLA 5D6FA 2DN0A 3S93A 3F8CA 3ML6A 2DO7A 3A02A 3V78A 3CC7I 2VKVA 2M9HA 3FM5A 1UAAA 3GFJA 4L18B 4P55A 3IUOA 2H8WA 4IRIA 4IL6C 1BJZA 2CW0F 4IQJA 1USSA 4EQQA 1LE8B 2BW3B 4YIFA 4R1HA 3OYKA 4BJ5C 1HSTA 1X4OA 4RGUA 3LA2A 3RKXA 3OL3A 3DBLB 3D5RC 4LLLA 3U1KA 1MMSA 1UCRA 5FHPA 3RJPA 2AHQA 2BOLA 2CUJA 4AWXB 4IRGA 1Z67A 1WJAA 1LPQA 2G7UA 3WTWC 3GEZA 3S3MA 2Y9ZA 4E70A 1JUPA 2HDCA 1XC5A 4L5EA 5JI6A 2GUHA 4EJOA 1VFCA 4PJMA 3M8JA 2GIZA 2UXXA 1QBJA 4ABZA 4A3IJ 2RGVA 3ABUA 5F04A 2ECBA 1LB2A 3BROA 2F4MB 2ZFWA 2GM4A 3RQIA 4PSWA 4A0YA 3MZYA 3FXQA 4KIGA 2F48A 4IHVA 4EJWA 3BZ6A 1P9QC 2HWVA 3ZQGA 4BYYA 1ZK8A 2E34A 3WE3A 3S14J 4UB8C 4HF0A 1YIJI 1TTYA 1JE8A 2AS5F 5H20A 1RKWA 4GRIA 4YFNF 4HPQA 1U8RA 2DA4A 3KEQA 1UJ8A 3WTUC 1XDUA 2BZTA 2Y75A 2HOTA 3F1BA 1T2KA 2M0CA 3LNQA 2ELJA 3KLNA 1IW7F 3CMEI 5KHDA 2IU5A 1QRYA 4CCOA 4RBOA 4RLFA 3OSFA 1JI8A 5IYDJ 1ULYA 1R1UA 3J80K 3BC8A 3BLYA 2FBIA 2VQGA 2KFDA 1B8IA 1Y8RB 3OYDA 1U9OA 2XASA 3LMMA 3Q9SA 3KEOA 4HZFA 3CUOA 5GTHC 1I6HJ 1UELB 2O8KA 4BBRJ 2FJI1 4OIRF 2BHZA 3BWGA 2IGOA 4BJ6C 3AKZA 2HYJA 5FKNA 2PQ8A 3L9FA 1DDNA 4UUVA 2XPWA 5EDNA 3SXYA 2DI3A 1GVJA 4BEHA 5TRDA 3GTGJ 4FISA 3KFWX 1BL0A 3BR5A 3CCRI 4FE7A 1L3LA 4HQEA 5IP6A 5J47A 3C2HA 2FQ3A 2JUGA 3EUHC 3ONQA 4HNUA 3S3OA 5FLVA 2JRTA 1I3AA 2RDPA 1VQKI 3BDDA 2WV1A 1IXSB 4I01A 3KKCA 1W5CC 1W0TA 3M7GA 3WTVC 4JBAA 1UMQA 1YQAA 2ZB9A 1SD4A 1B8IB 3DEEA 2CMPA 2R5ZA 5EG0A 1D5YA 4XRSA 4KICA 2EFNA 2GXBA 2WAQN 2KDZA 2QIBA 3LQRA 1SD6A 4LJZF 2P4WA 3NPIA 3MKZA 2W25A 3COAC 2UXPA 4I99C 3C3WA 5DAJA 2FF4A 4RA2A 2PZ9A 1X3WB 3KZYA 2Y2ZA 2OUMA 1FWZA 4JYKA 2X0LA 4RAGA 4WWCA 1ETVA 2TDXA 4BEHB 3S2WA 4HEA2 2RHAA 1BI1A 5FGLA 3QYBA 2IEKA 4N9IA 4G7HF 2P7VB 1YG2A 3VW2A 3PQJA 3VVXA 3HTIA 1Z1DA 3G56A 4NDLA 1XPXA 2OC6A 2L7FP 1OCZH 3VVYA 3CCYA 2UXNA 3BR3A 4U9LA 4QSHA 2HKUA 2QWWA 4QWQA 4EJUA 3F8MA 1ORKA 4DNCA 1PP7U 3GXOA 2JSCA 4D0PA 1T95A 1O7FA 3NAUA 5FFXA 5FLMJ 4BQNA 5FD6A 2H94A 2IA2A 3T6NA 3WTTC 1NHAA 1ZLKA 1VQNI 4V2GA 3TO7A 1IZ1A 1BI3A 1QPIA 3CMAI 3KYDB 1LFUP 2KIUA 1MNMC 3EUHA 3GTLJ 1B4AA 4ME9A 3QWLA 2K40A 5DM6F 2MLGA 4PDKA 5HS8A 3K4CA 1VTNC 4CA0A 4ASNA 1A31A 3BNIA 3ON4A 4O3MA 3IHUA 1FMWA 2AQFA 3HTUA 5LHGA 1SAXA 3CCSI 1E2XA 1K4SA 4EM1A 4RM2A 4AD9A 2KZVA 2M30A 3QPHA 3V8KA 2M45A 6PAXA 2NVUB 3CJTB 1LNWA 1TL8A 4ZDOA 2LY1A 4XLPF 2P6SA 2V1DA 2IS1A 4F92B 3S8PA 2BGCA 1MNDA 1IDYA 3AG3H 4CZCA 2RC4A 5GAEJ 5FLXK 3NEUA 5DV5A 2UXUA 4PJNA 3KIOA 5LRRA 2R7UA 2R5YA 2H1KA 3QOEA 2DLLA 2O7TA 2BHYA 2UUZA 3ZQQA 4E7LA 2PG4A 5F0CA 1D8JA 5E20A 2WA0A 3P7NA 5K58A 3ZOBA 1ZTRA 1ETWA 2PMZA 3GLLA 4ESJA 3I4PA 2LBFB 1B1BA 1XMAA 2GQQA 4H4KC 4MHGA 2ISZA 4B44A 3K4KA 2DT5A 3K1PA 3FXKA 3H36A 1OCPA 5M5XJ 1NG6A 4XORA 3VP5A 2XRLA 3OYJA 5D5UB 3OYFA 3GLXA 1JKQC 4U0WA 4RB3C 3NARA 3W3CA 3JRGA 2KRFA 1JJ6C 1KU9A 3HB9A 3BQYA 3ECOA 4I2OA 2ESHA 4WXDA 2ESNA 3CRJA 1HXDA 3NWSA 2ETHA 5M5YJ 2V6EA 4XLNF 1ZGWA 1PUFB 3J7AY 2QQBA 1ZKGA 3WU0A 2V1NA 3C07A 3H9QA 2HVSA 1D0YA 2F5CA 3V7SA 3WU2C 2HOEA 3ZQ7A 3G4SI 3VYUB 3HOUJ 3ANPA 1ETOA 3QYFA 1VQOI 4IO9F 3DCFA 1ZG3A 3G73A 3LA3A 2IGMA 1S5LC 1QVTA 4EEFG 5IY5H 4GYGA 3RZOJ 2KIQA 1YITI 3AQTA 1TT0A 2DOAA 1NTCA 4IKFA 4F7ZA 3B6AA 2V4JC 1AKHB 4CHUA 4IHSA 2EZKA 4AIDA 5FGMA 1O3RA 4BKXA 1BW5A 1ZAOA 1T8IA 2QKLB 4KITB 2E7WA 3M3YJ 2VLAA 2DA1A 3VTIA 2Q0OA 3ECHA 1F36A 3D0SA 1TQIA 3JSPA 5E18F 1QQIA 2W00A 2R92J 5DUKA 5E3LA 4NQWA 4UXNA 3P9KA 5L3FA 3BJBA 4NB5A 2A68F 3HTHA 2QQ8A 5TJJA 2OU2A 4QLCU 1SVMA 1UHSA 4J01A 1RI7A 1F43A 2XAQA 2Y0SN 1BIBA 1L0OC 1IV6A 1YS6A 2UZKA 4MK6A 3TKYA 3CZ6A 2VONA 2QKOA 4Z2YA 1D1BA 2LFBA 1B72A 3IL2A 3HTJA 2Y0MA 5D8LB 4AF5A 2V79A 4FX0A 4LIUA 1EH8A 2FA5A 4GDFA 1PP8F 3OIQA 1DGWY 1USTA 2HDWA 5KAIC 3AQSA 3NXCA 1MGTA 3S1QJ 2DA7A 5D19A 4Y4RA 1JHFA 3TBIA 4OIOF 1XGOA 1J7KA 4XK4A 1QU3A 2HDDA 3TQNA 2ZCMA 4PFOA 2DMQA 2K4BA 4CICA 4XLEA 1OMIA 2FEZA 3JRCA 3KZZA 3GUDA 5F0HA 3I56I 2QVOA 2WC2A 1F1ZA 5D4RA 3KP7A 3L2CA 2UWMA 3DFGA 4KN7X 2LG4A 2OBPA 2QF7A 2W85A 2IJLA 2A61A 3MKWB 2DT6A 5CVUA 2Q8KA 3LL7A 3E3VA 2LF8A 3GZIA 1BR4A 3RPQA 1GV2A 2XKOA 3W2AA 2P0WA 2IPQX 1DPUA 2X6WA 1DU0A 1MJAA 1YJ9I 1A6IA 4E7SA 5GAGJ 1BJAA 1YOVB 1QA6A 1KYZA 3LAJA 4G7OF 4LOCA 3E1SA 2DDBA 3JAMK 4LB6B 3WE2A 3BG6A 4XRSG 3VVZA 2O3FA 2V1XA 5JVTA 1XCBA 5K5OA 4NN1A 4E4HA 2VT2A 2BE5F 3OYMA 3C1DA 3OYHA 3CC2I 1HW1A 4M9SA 1RR8C 1ZGAA 2HEOA 2PBXA 4HYEA 2BXYA 2MG4A 2ZJPF 3FMSA 1YLFA 4BGDA 3GZ6A 2DK5A 4BXXJ 4NC6A 2ZXHA 2HOAA 3H5RA 3I64A 3WTZA 2R7ZJ 1Y56A 1W0UA 5FKLA 3VOEA 3VOXA 4TV7A 2K3FA 3BP8A 4ZDLA 4AC6A 5F27A 4JX6A 3ZMUA 1SFUA 3UR3C 2Q1ZB 1T33A 5C4JJ 3CD6I 1XN7A 1ZLJA 1YE9A 2OPTA 2LK2A 1K6OA 4AM3A 3M8EA 1TWHJ 3CO7C 3DTKA 5HLHA 1JUSA 4YIIA 2AO9A 3J7YJ 4PK4A 4A12A 3DPLC 3F0CA 4AYBN 2QZ8A 3LSIA 4B8XA 3ZRGA 3QYEA 4N4NB 3UNGC 2EFPA 2HYFA 2NYXA 1ZARA 2M0MA 4A6DA 2Z99A 2E71A 5E1WA 3GTMJ 3K70C 2GZWA 4XLHA 3AAFA 2L54A 2R93J 1JUMA 3HSRA 2V9KA 3OR2C 1MKMA 1O3TA 3MD2A 3RI4A 3J81K 4ZTJA 3S15J 2QA4I 3GTJJ 3GEUA 3MKYB 4BDYA 4C3JJ 3CUQC 1S7OA 5EZHA 3GTQJ 2BEOA 2K4JA 3HL2A 3CC4I 2XPVA 4GO1A 4A3JJ 1JHHA 1RIOH 2R7VA 2KZGA 2XGXA 4PJJA 2VOPA 3BR6A 3GZ5A 1TWAJ 3PUBA 3R60A 2DAOA 2ELKA 4MXMA 1ZELA 3VUQA 2QOPA 4RGRA 1RC9A 2G7LA 1QHHD 3I3LA 3VWBA 4MTEA 5KVRA 3FBNB 2F5FA 3VIBA 5CKTA 5JVGF 2F2EA 3AL0B 3PPBA 2LTPA 3BG9A 4XOPA 1GUUA 3WHCA 1VQ9I 5IT9Z 4M71A 3VSLA 3GYHX 1XG1A 1BN5A 1TWFJ 3S1RJ 5BNGA 3SDGA 3KP6A 1D8KA 1P6RA 1Z3YA 4I76A 1KQ8A 4DJAA 4YEJA 2VJIA 1H8AC 2ZJRF 4CUGA 2NP5A 2KRHA 1P7JA 2MC4A 2GIVA 3DLAA 2DMTA 4OAYA 5HODA 2MSYA 1OLTA 4MNUA 1JKPC 3LHQA 1U3EM 3IUVA 2E2JJ 2QWTA 4XM3A 4KFCA 2DFEA 4XSXF 1ETQA 2KHMA 1XMXA 1OCRH 2GA1A 1IXCA 1XDSA 2A6HF 5B3SH 5BQTA 5AIPA 2EFOA 3CCUI 4GFBA 2RQQA 1RUOA 3CCEI 3I53A 1BC7C 4CCKA 4M3BA 5E3OA 1SMTA 1S72I 2ME6A 1O57A 2IGKA 2KRCA 1CGPA 1WJDA 5KNLA 3KYCB 1FOYA 4MEYF 1O3QA 1C0WA 5CQGA 3B73A 1WKMA 3RKYA 3OYAA 1YHQI 1J0RA 3EQLF 3VPRA 4GFKA 2ZOZA 4B43A 2E2IJ 3OYNA 2ADUA 2W84A 5M3MJ 2DA3A 2WY8Q 3ZXSA 2LD5A 2VPRA 3FKIJ 3B81A 2QM3A 2M8EA 1IN5A 2WB1N 3OR1C 3K70D 1ZR2A 3ERMA 4XSZF 1ZG1A 1Z7UA 2CUFA 4IOAF 2DFFA 5J3LA 3SJMA 1VI0A 5L3BA 2VJ4A 1W7PB 3HSFA 5LEJA 5EGOB 3X2QH 1T0FA 1KONA 1HCRA 5J6XA 3S2HJ 5GPAA 3OYEA 1S7AA 1V5EA 2A5YB 2K5CA 2HKOA 2IAIA 2JT1A 3EYYA 3BCBA 1HC8A 3H9JA 4M74A 1XB4A 3NRVA 1BR1A 3E6CC 3DWLE 4A5MA 4AIHA 5B5EC 5LFAA 1BBYA 3EYIA 4Q5SF 3WTXC 4M6XA 2Z1DA 2OZ6A 1FTTA 5EFYA 3S5RA 1PDNC 2EJRA 1EH7A 1N75A 2Z2SB 5B1AH 3BOQA 3A01A 5F64A 4IQ4A 4LFUA 3G1OA 1R4MB 2JPCA 2LMDA 1H89C 3J80Z 2G9WA 2DG7A 4WCGA 1JGGA 3M9AA 4M72A 3CTAA 1X1DA 1Q1HA 3C7JA 2E1MB 5D5VB 5LD2C 1I3QJ 2QQ9A 4A3BJ 1XSXA 5JLXA 3HDDA 3J7AO 3CMMA 2BVMA 3CDLA 4M9XA 2XSDC 1GT0C 4FCYA 4A93J 2R7OA 4U0VA 3I59A 5A2QZ 2WGBA 2E19A 4HX8A 1O7LA 1VZ0A 3G71I 2COMA 1MJ9A 1P2FA 1PYVA 4PSXA 3PO2J 5E8IA 3LSMA 3PSIA 3FMQA 2ZMEA 4NC8A 3JRDA 4HF1A 3HKZA 2K27A 3WODF 4AYBA 1W36C 1EA3A 3W6VA 3I71A 3LFUA 3OL4A 1KQ0A 4B3AA 4I02A 4KYWA 2TRTA 3IKTA 5JLWA 3HIMA 4NELA 1B9MA 5JFRA 1WRJA 4IXAA 2F5VA 4EJTA 1SD7A 3HOWJ 2FNPA 3FX3A 5F1RA 5IYCJ 1SFEA 3BCGA 3OYLA 2ECCA 5J8FA 5L3GA 3PASA 3VSKA 3C2GA 3TW6A 1S6LA 2X51A 3CDIA 3TW7A 2E5NA 2WBMA 3CJNA 3F8FA 5F6FA 3MVPA 3I4NJ 4N9HA 2MFZA 2X6XA 2H6BA 4C2UA 2XAGA 1VQLI 1DGRM 1Z05A 1R00A 1RPWA 5FRMA 3V7CA 1RKTA 2EA2A 5E8GA 3Q0UA 4U88A 4F91B 3IRRA 4CSWA 3GFIA 3RYPA 1PUEE 1E17A 3IH4A 1R4NB 2JRMA 3HM5A 3M1CA 3V6GA 2VBXA 2DJNA 4M3DA 1N77A 1KU3A 3B02A 3W2VA 3K2ZA 4Z6YA 2JQ7A 5LLQA 5IPAA 3A0BC 5DCFA 4CXFA 1K7AA 5FFZA 2VQHA 4PCQA 5L3DA 1Y8QB 2YSRA 1ZRCA 2X6OA 2VXDA 1R58A 2CQ7A 3QP5A 3T0YA 1D1AA 3PL8A 4ZDPA 1IUFA 4CCNA 1NK3P 1X3ZB 2R3SA 1N25A 4S04A 3ZN1A 1BW6A 5FO5A 4QPQA 5K7ZA 4A3CJ 4BH9A 3RSNA 2JA7J 1IXRC 3GO5A 5CVRA 2M2EA 2QGUA 4ZYHA 5FKKA 4RB1A 4CZZA 4HG2A 1TQPA 4HW0A 5GAHJ 4A3FJ 1I1SA 3NNRA 4W97A 5AQCA 3H9GA 4I0BA 3LFKA 1JT6A 2KMUA 4XBFA 3L09A 3SFZA 1EJ9A 1IJWC 3FXMA 2QYOA 3H5AA 2FMYA 3OOUA 3FM3A 2O5RA 1W36D 2HYTA 2CGPA 4A2UA 1FEXA 1G3TA 1JT0A 3A4CA 1X1AA 2LVSA 1ZRDA 2DPUA 3L2UA 2QENA 4PGGA 3I4MJ 3ABMH 2DW4A 2EFWA 2JA2A 1X1CA 2XAJA 1I1GA 2XB5A 3M1EA 4UVBA 2LKXA 3DEWA 2MABA 3HIFA 1KA8A 1XGSA 1XMKA 5E3NA 1VQ8I 1KQ9A 5FLXZ 3O2PE 1MSEC 2L7KA 3FKJA 2X4HA 4BS9A 3HTAA 2FJ1A 3U1DA 4FASD 5FRNA 2EIJH 2M4KA 1I5ZA 3HTSB 4BY7J 1X2MA 2CW8A 4P9FA 5TGTA 5C3EJ 3SZPA 2ZY9A 5E79C 2JTVA 3H92A 5K7FA 3DLLF 2FBQA 2W53A 1K78A 1U6GA 3MCZA 9ANTA 3SQNA 3HRTA 3MZ8A 3HRSA 3C18A 5HBUA 3EPZA 2ZSHB 3GCMA 1LJ9A 4IPAA 2O9LA 5FKMA 1H9TA 2UXHA 1U5TC 1EH6A 4YFKF 4PJ0C 3CCVI 1ON2A 4Y3OA 1R23A 2GLOA 3TGNA 2ID3A 1Z7LA 2MLKA 4XICA 3BCAA 4IRHA 4H0EA 1AWCA 1HOMA 3HOZJ 2KIMA 2ZO4A 3VOKA 1MH3A 1TW2A 1JXSA 4ITVA 5J4YA 3M4OJ 1HDPA 3WHBA 2WV0A 2K9QA 3EUKL 5D1RA 3KZ9A 4M6VA 1HBXG 4G9YA 2ZC2A 4EM2A 5BS6A 4BQQA 1XGMA 3CQZJ 3KE2A 4XMYA 4RB2C 2R5ZB 2PBIA 3QOPA 3MN2A 1OCOH 5EG0B 4JL3A 3NWTA 3TOBA 4UB6C 2DTRA 1IN8A 3IAM2 5CVVA 2MW8A 4IVNA 3SHFA 3FXJA 3HPHA 4JQFA 2YPRA 4JX5A 3ZN0A 4OOIA 1YX3A 3ZR8X 2M7AA 1IF1A 3OMYA 2BYVE 1ODDA 4ESBA 4UY8I 3LSKA 3CDHA 4X6AJ 2D6YA 2IS2A 5CJ9A 4NNJA 4BAYA 5ILSA 3DKYA 1V4RA 2HU9A 3HJEA 3KP2A 5FROA 3ZQCA 3IV5A 2CO5A 3GFMA 1YS7A 2DFIA 5AONA 4GFLA 4UVAA 2CRGA 1CF7A 4AC0A 2DMNA 2HKXA 2DCEA 4L9VA 4BHPA 4DOZA 2OZUA 3F21A 4Y52J 4A0ZA 2BY2A 2OERA 4Y15A 3BZKA 1U78A 1Z77A 2M87A 4MFDA 1RR7A 1SC7A 2A07F 2QBYA 3COLA 1WI9A 1HDDC 4XR6A 3OIPA 2HQNA 1J2XA 3GW2A 4M3GA 3RIRA 5F1JA 1U5TA 2E60A 2IS4A 1T98A 5LEKA 1ITYA 1HSJA 2XF7A 5AIQA 4L9JA 3QAHA 2HNHA 1FYMA 1IUYA 4I98B 2E1NA 2FOWA 3R6SA 3W6JB 4CGRA 4II2A 2RAEA 1WI3A 4ENMA 1VF9A 4C3HJ 3ZMVA 4C2MJ 1VQ4I 4PGHA 2M5WA 3VODA 4ZZDA 4MQVA 2MD5A 1WZ2A 2G7SA 2IP2A 3E5QA 4A3LJ 1E3PA 5J8CA 4FHTA 5B66C 4B48A 2KL4A 4HV5A 3SEZA 4HBLA 2O0YA 2XRNA 2NOGA 2VC0A 2YR2A 4HDUA 1MBEA 5C4XJ 4EGYA 4DZJA 3TMOA 3QRFF 1ACIA 1OYYA 4K2EA 1HKSA 2EBIA 3DPTA 4G12A 1YTYA 5LBQA 4BDZA 1Y0NA 3NRGA 2B63J 2CH0A 5IOZA 2CQKA 1TC3C 1OYWA 3H35A 2OTLI 4HAMA 5IT3A 2XVCA 2YU9J 2CYYA 2KISA 4FQGA 4DW6A 4KMUX 2K9NA 2V57A 2R5YB 3GTKJ 2H27A 1R9TJ 5DTDA 4D9JA 1WFXA 1IN4A 1FT9A 1OYIA 2VKHA 3KCCA 1D0ZA 2EWNA 2DK8A 3K9TA 3GBGA 3PM1A 5DDGA 2NS8A 2GXGA 1G3YA 3JW4A 3E97A 1MMGA 1MSFC 1WCMJ 2CJJA 2IT0A 3JAMZ 1XSVA 1GXQA 3FXOA 3WTYC 2AQEA 3LSHA 4F3QA 3MAJA 3I55I 1FY7A 1T56A 1VQ5I 3EUAA 2F07A 4CYCA 3RKWA 2IXSA 1U8BA 1HQCA 4II3A 3D5LA 4B1RA 2LR8A 2G0EA 2EIMH 1XSDA 1RESA 2AXTC 2VPLA 2CFOA 4YIRX 2WAQA 3VFZA 4EGZA 2ZOYA 3K2AA 4O6JA 2PLYA 4ANJA 3QU3A 1X1BA 2NNNA 4IHTA 1LVAA 3ANGA 4HSTA 4XLAA 2IRFG 5L3EA 1OR7C 2OQGA 2ZCWA 2G3BA 5K1YA 4E7IA 1TP4A 2FOKA 3Q0WA 5L3CA 3M8FA 4HLXA 2PJRA 1KZHA 5EEAA 3OYCA 4EVIA 2DXIA 2P7CB 2FD5A 4HNTA 3CP8A 3DBHB 4KISA 3ASOH 3V4GA 3QPLA 1HLVA 2CV1A 3HGYA 4KA4A 4W1UA 4A3DJ 2NAZA 3OYIA 1V5FA 2ZSIB 3KPHA 3MMYB 1QNTA 3BY6A 2RNGA 2QUFA 3DQVC 2X1CA 1G4DA 2F6CA 5LHIA 2WWYA 1WSUA 3RCOA 1RRJA 3LSJA 3LAPA 3F6OA 2W4SA 2Z9OA 3T8TA 1BIAA 4UVCA 4M3EA 3J81Z 1IGNA 3PQKA 1SFOJ 3JREA 3FK6A 3AG2H 2O61A 4NQWB 4GGGA 4RLQA 3WGIA 3L00A 1NK2P 2XHKA 2W48A 4XIDA 3F3XA 4RM3A 4ENJA 3I58A 2CUEA 1E3HA 4XLFA 1DP7P 3ZQFA 2CW7A 5CXIA 3BTIA 1ZGJA 3HE0A 2F4IA 3Q9VA 2CQQA 2FMLA 2MA3A 2BBYA 3LWFA 3CCMI 2FU4A 5KK1A 4HF2A 1YRNA 1TLHB 2LF7A 4PZJA 3S32A 2EZIA 3JCUC 2QSFX 2VBWA 4BQAA 2QTQA 3DXJF 1FNNA 1WJ5A 2VODA 3JSOA 1J5YA 1B72B 1MJBA 1A36A 2JK3A 2K85A 5FJ8J 3O3KA 3HHGA 2GWRA 5C44J 4XNFA 1R6RA 1BI0A 2B9SA 2KLOA 4A5NA 3PIOF 3VYSB 4LB5A 1Z6TA 1QHGA 4GXOA 3KNWA 2HS5A 1OR7A 2VBZA 3ZQLA 4LK1F 5LGUA 1ZREA 4KT6A 4MO7A 1PJRA 1UHWA 3L7WA 2HVQA 2NXNB 1ZH5A 4S05A 1H88C 4LG0A 4KMFA 1FBUA 2XDVA 3SZGA 4BHBA 5GADJ 5HSZA 1F9NA 3VW0A 2HR3A 2UXIA 1G8XA 3HOVJ 2P5KA 2LY9A 5HLIA 2WAFA 3IH3A 3LSPA 3OSGA 1R5GA 1VNDA 2ZNYA 1JJ8C 4GCVA 5D5WB 3K69A 3JRIA 1CQTA 2JA5J 2P6TA 3O60A 2H6CA 2PI0A 2HQAA 3NQOA 2P5LC 1NH3A 1LEAA 5FB2A 4G6DA 2D5VA 2Q2EA 1I50J 2X48A 1XCVA 1G3SA 4BE0A 4HV6A 3Q5FA 2L5QA 1IG7A 1SANA 4QTRA 4A3EJ 1D3YA 3GFLA 4CCJA 4LLGF 2UXOA 1TWGJ 3N05A 3DF8A 3Q3SA 2CG4A 5M5WJ 4CYDA 1FOXA 2Z33A 1S29A 2K02A 3KETA 1T6SA 1FIPA 1TW3A 2ZFUA 3MKLA 3H3VK 3ZMZA 1FJLA 4OINF 3DU6A 3R4KA 2PEXA 2I10A 2WY7Q 2X85A 1ZN2A 3ZMSA 4EJVA 4MTDA 5DD4A 4PFPA 3BTCA 1WJCA 3CP2A 4E6KG 5D6EA 4RAYA 3OWTA 4MGRA 3H5NA 5FKOA 3MNLA 4GCTA 2CFXA 2PMUA 3G7RA 1DQUA 3ULQB 3MZHA 1WGXA 3HXLA 3N97A 1IAWA 1W4MA 1E3OC 1DP3A 4I09A 1BC8C 5K7HA 3EUPA 2EV0A 5EEGA 2DT7B 1X58A 2J5PA 4Y17A 2KPMA 5CPRB 5B1BH 2Q2EB 3S17J 3I54A 2I8DA 4HOBA 1YFHA 2Z5UA 1S7EA 2EZHA 2OD5A 1V5GA 2RN7A 3BRUA 3H3ZA 5DCMA 3DP7A 2ACJA 3CLOA 2R7RA 3E6BA 3WG9A 3BPXA 4YELA 2H8RA 1IRGA 3O6BB 5BOXA 1WJFA 2JMWA 2E1MC 3V8LA 4DYRA 1J59A 5DD8A 3QPSA 1BI2A 2W57A 3HPGA 2O6GE 4U7DA 2MC3A 2NX4A 2ZCNA 3HHHA 3L1PA 3FRQA 3G6EI 2Y0SA 1DPRA 2WTEA 2EH3A 5E1XA 4DGWB 3G3ZA 5CVIA 5LRSA 3PJRA 4JKZA 1VQ6I 3CCQI 2H1LA 1SVLA 1ON1A 2EIKH 2MH2A 1P4XA 1MDMA 2W82A 1R5ID 5HLGA 3RDIA 2FBHA 3ON2A 2VE8A 1FPQA 4BXFA 5DYMA 2X9DA 1KU2A 1MMAA 5JR3A 2FE3A 3F72A 1VQ7I 1IDZA 3P9CA 4L5IA 1Z3XA 2LNBA 3ABKH 2IA0A 1RZ4A 2Y69H 3W6KB 3PO3J 2B0LA 2NVQJ 1YIOA 2DU9A 5DCMB 1AA7A 4YRVA 3FIWA 4U9NA 4ZTFA 3ABTA 3CUQA 4UNOA 2M4GA 1D0XA 1FSHA 2O03A 3IRQA 1SD5A 1KU7A 4BACA 4HDVA 3BR2A 2OQRA 1QO0D 2KDOA 3BT9A 4IF4A 3IP4B 1QPMA 2QCOA 2P5VA 3FZVA 1Q1VA 2EV6A 3K4NA 1M1EB 2YVXA 4BE2A 5H6RA 2WAEA 2R7DA 1FP2A 1QVUA 3ZMDA 4G7ZF 4IRVA 2L2OA 3A0HC 4MLOA 2F5EA 2EB7A 1FBQA 1Y6IA 3OV8A 3S16J 2IS6A 1GXPA 3VYTB 2YX7A 2DYRH 3RH2A 4LGWA 2RV8A 5CYVA 4M9ZA 3FBIB 1FZPB 3QQAA 2V6CA 5JHUA 4C30A 4XOTA 3F8BA 1FMVA 3OIOA 2CS3A 4WXCA 4KN4X 3PSFA 1PVEA 2L3DA 2ZXJA 1LVKA 4UV8A 3RZDJ 1HKQA 3WTSC 4U7BA 3RKQA 3HG9A 2KKOA 2FXAA 2EA4A 3CUQB 3S1MJ 4ACIA 2LDUA 1Z21A 4NBQA 3G2BA 5EZGA 4Y7NJ 2G7HA 2COBA 4ETSA 1FBSA 3TO6A 2O7OA 1ETXA 2ELHA 1REPC 4L0ZB 2ISYA 2VIXA 5ICFA 3HGGA 1V55H 3BPVA 1LE8A 4F52A 2BW3A 3ASNH 4FX4A 4ENNA 5BMZA 1LDJA 1KGSA 3ERED 4MEXF 2C6YA 1T39A 4G6TB 4JNNA 2NS7A 4AIKA 3E7LA 1IO2A 2B7EA 5IT9K 3K8PC 3VYRB 2A2FX 3DPJA 2IW5A 1TZLA 3K0LA 2GA2A 3PNTA 4A69C 1DUXC 4LITA 2OA4A 4IHXA 2HTSA 2IA1A 4IX7A 2E2HJ 4BU2A 1XTAA 2P81A 3DTEA 2MGQA 1S8NA 5M3FJ 3A01B 2HGCA 5HDNA 3IC7A 1TNSA 1RUNA 1XGNA 2EFQA 4JOMA 3TP0A 1IV8A 4AIJA 1WJEA 2RKHA 2OCCH 1OISA 2QQAA 5HNHA 2HYGD 2E36A 2F5DA 2RREA 2XF6A 2UV1A 2DODA 4V2FA 1K83J 2IVMA 4X1EA 1SVOA 3FMRA 1MW7A 3CF2A 4FETA 5LGTA 5CW8A 3KZIC 3RPUA 2K7LA 4B3XA 3EGQA 1T38A 2D45A 3I59B 4HRIA 4JK1X 2LKPA 2DFHA 4BXUA 1W5SA 5E17F 2LYCA 2HPMA 2ZKZA 2ZMEB 4ZZLA 5H2FC 3FXUA 2CSOA 2A5WA 4I6ZA 2H09A 2MYSA 3F23A 4D1QA 3CJRB 3IKVA 4IOCF 3K1NA 3RPUD 1UG0A 4L62A 4DZPA 3OOPA 1X3UA 2HXOA 3K10A 3SEQA 1IRXA 4UV9A 2G7GA 1IN7A 1IRFA 1W1WE 1IN6A 1A04A 1LFBA 3JTHA 2K3PA 4S0HB 5LHHA 1O3SA 4XN3A 3V7RA 2K9LA 4B09A 4R8HA 2QSHX 2VKEA 3LWJA 2K86A 4Q47A 3H0GJ 1G2HA 1FC3A 2HXIA 2K9MA 3CF5F 4OMYA 5J1UA 4M73A 2PMZN 3VEPA 3MWMA 4J19A 2BV6A 2MD0A 4LIVA 4D7NA 1SEUA 4A3GJ 4XRMA 1BA5A 4YZEA 5EYRA 1AHDP 1TT5B 4UHTA 4DYCA 2ICWG 4BJTA 3V8JA 4I7HA 2D2WA 1YO5C 3K1MA 4OIQF 1LDKB 4C2MA 4YG2F 2WADA 3T5XA 4YFXF 1WJBA 1MBJA 5D8KB 2HFHA 4QPOA 1GLNA 2F4OB 1NG7A 1YJWI 2XGCA 1ZQ3P 3G1MA 2HQ5A 4FT8A 4EATA 3M07A 4AUXA 3MFKA 4CDGA 4KUMA 4OD4A 4CCMA 1A35A 1MIJA 3JTGA 5HS7A 2DOEA 4I0AA 1MBKA 1MNEA 4E7JA 2WB1A 5A2QK 2DMUA 1I6XA 1R7JA 1OJLA 5IP9J 4KDPA 1VQMI 4KT5C 2BY3A 4RAZA 3JRFA 2ZNZA 2ZXWH 4IEJA 4D7MA 2R7SA 3HRUA 1V54H 1K79A 5FD5A 5IP7J 3QPTA 1IRZA 3QKXA 3LQQA 5BPIA 1JTXA 1R1TA 1ZHFA 3FISA 3HUGA 1OPCA 4HSRA 3QODA 4NC7A 3JRAA 4Y33A 3VDXA 5BPDA 3CJQB 3F6VA 2NP3A 3RTRA 2XDNA 1YJNI 2LKSA 3K4MA 4PJLA 1B59A 1MD0A 5HVQC 1J75A 2FX0A 3JRBA 3S2DJ 3RD3A 2VB6A 2JA8J 1T08B 4XRFA 1OKRA 1WVRA 1JKRC 3BZCA 3QBMA 4BQOA 3DEUA 2YS9A 3Q0VA 1GV5A 1YW9A 3FDYA 1SGMA 1HKTA 4FTHA 4CO8A 5HOOA 4KJZA 4WK8F 2CU7A 3KP4A 2YVEA 3GVAA 1YW7A 2VUMJ 3B6CA 3KP5A 3BJAA 1X19A 4ICHA 1BR2A 2X1DA 5HDGA 4UDSA 3E5XA 4NUBA 1R49A 2R4GA 4DIQA 3WGHA 1BOAA 1ONVA 3HUGB 2XGDA 3HC7A 3C2BA 2XB0X 2BXZA 1BM9A 3QU6A 5EJCA 3SFIA 4ZH4F 4MQ9F 1K78B 2IGNA 1X2NA 2CQNA 1Y1VJ 3CO6C 1H9GA 3S1NJ 4GCKA 3BJ6A 5J4VA 2D1HA 3KX2A 3ABLH 2HZDA 1K4TA 4XKWA 4HLYA 2DOFA 4M3FA 2R0QC 3TDUC 3LJLA 4OWRB 1SMYF 2PN6A 3VW1A 1YX5A 3CESA 4ENKA 2EK5A 3MEXA 1W5TA 2P8TA 4RGXA 3K7AJ 3ZQHA 2VASA 2TCTA 2XIGA 3J7ZI 4Q48A 1RNLA 3FWEA 1HW5A 3TL4X 4BHCA 2L01A 5HS9A 5F0FA 2LBFA 1ZG5A 4L5JA 3SZTA 1MBGA 2EINH 3VB2A 1MBHA 4ESFA 5DEQA 3A1YA 2CWEA 2YU3A 1RETA 4V19K 2X1EA 4RS8A 4IHYA 2EQRA 1LKXA 3E6MA 3JR9A 4D5FA 3GF2A 1R5HA 1MMNA 1MH4A 1QZZA 3O8GA 1I39A 4XKBA 2GENA 4HKUA 3FK7A 1SFKA 4BY1J 3D1NI 3BTJA 2XPUA 1PUFA 5K5QA 3OY9A 4WIBA 2JUCA 2DMPA 5K5RA 1WHUA 3AG1H 2DJIA 3KP3A 5HNFA 5FMPA 2OCEA 3RYRA 3TEDA 2L9VA 2M34A 2LP0A 3FXLA 3BHQA 2OJED 3TOAA 3ZGKA 3FXRA 4A6EA 4LK0F 3JRHA 5HAWA 4B4CA 1CF7B 3P5JA 2LLKA 4Q4ZF 2IBDA 5E1ZB 3ROUA 2A05A 4L9NA 2AXLA 3FF5A 4CH7A 2L9NA 3W2WA 3OYGA 2GOXB 2K9SA 2HVRA 5EF6A 4B47A 2QBYB 1ETYA 4ZYDA 4XL9A 4DYQA 2X6YA 5DUIA 2FQ4A 4RAFA 1AKHA 3JSJA 1J9IA 4MIMA 5ICGA 1E0EA 3GTPJ 3ZQIA 3I0TA 3WG7H 1YYVA 1QZEA 1U5TB 3O8HA 3OYBA 3PFYA 2OTJI 4IHWA 2L9SA 2JSPA 4CGZA 4QIWN 1G6NA 3PUFA 5JHFA 3PIPF 2VQLA 5H6QA 2V1UA 1FLIA 4WXHA 4M6YA 2N8GA 2E7XA 2QEXI 2QLZA 2XKPA 1B6AA 2VQCA 4LLNA 5C4YA 2OAZA 4IJAA 2YUSA 1POGA 1B9NA 5D4SA 3BR1A 4OD5A 1U0JA 3U9GA 3CMYA 1WWXA 3TO9A 3R0AA 1H0MA 2KJCA 3T8RA 4JX4A 2V9VA 3FHZA 2STTA 2GOMA 1SAUA 1ETKA 1HF0A 5CVJA 3ISPA 1K61A 1F5TA 1R1VA 4KIBA 3CJDA 4F93B 2CV2A 2BY0A 4E7ZA 3DPUA 3IAS2 2VJJA 2DBBA 1LFPA 2XAUA 3HOSA 3K6GA 1JGSA 3GTOJ 1UHMA 4C2TA 3GWZA 4L0YB 1MZBA 3LA7A 5ED4A 2ZJQF 2DQRA 3S3NA 2NVTJ 4OU0A 4WF2A 2RASA 3DKWA 4EV0A 3TP3A 2FNAA 2V26A 2DDAA 2QSGX 2VL8A 1SFXA 1DU6A 2EZLA 2CV0A 3U21A 3L2RA 2XGEA 2A6TA 2MH9A 4P9UA 2FRHA 5HLTA 4HQMA 3PFIA 1I27A 1Y39A 4CYCB 2Z3YA 2Q24A 2NRAC 2L02A 1QGPA 2L9RA 1JTYA 3U2RA 4CCLA 3WGGA 2GBYA 2O8XA 3LSGA 4N4OB 3A2KA 4P5OA 3DKXA 3HOTA 2D1VA 3P9IA 1XX5A 3FHNA 1APLC 4KIFA 2LH9A 1LUJB 2HZTA 4UUTA 1ZRFA 3NS4A 5ERIA 5DM7F 2BVLA 3H1CA 2R7FA 2Y48A 3F22A 3MQ0A 4PUSA 1FOKA 2HPIA 2A6EF 2Z16A 3E0JB 3K4BA 2V9PA 2PJRB 4MFEA 1UB9A 4XONA 1S3JA 3CCJI 2FUG2 3I9V2 4A3MJ 3AL0C 2R7TA 4RB0A 1UI5A 4G94A 1EF4A 3DV8A 4XKCA 1FYKA 1STZA 3BTLA 4P96A 3BR0A 3NI7A 1LDDA 1WH5A 3HZJA 3HBLA 4D5CA 1G59A 1FTZA 3K4JA 4DBQA 4C3IJ 5CLSA 2I5UA 4DBRA 5ILVA 1FOWA 3L2WA 2M8GX 1IC8A 2JVHA 1GDTA 2DYSH 1P4WA 2L4MA 2VC1A 1XD7A 3OS0A 1V3FA 4GYIA 2VI6A 3EDPA 2DG8A 4XKVA 2B3WA 1A5JA 2PJPA 2FBKA 2HQRA 2REKA 4NHJA 3KLOA 2Y30A 5ICEA 1FSEA 5J1YA 2ZJ2A 1UFMA 4UUSA 1WPKA 3G1LA 3TDZC 1U2WA 1YRNB 3IWZA 2VKDA 2DTZA 2OF7A 2JWTA 2KP6A 4WX9A 1EV7A 4KNYA 2HI3A 2DPDA 2WUIA 2EPFA 1FP1D 3SDBA 3F9KA 3BG5A 4RDUA 2L4AA 5KAFC 3LSRA 1UZCA 2W24A 1D5VA 2L7ZA 2JA6J 2ME0A 3LOCA 2M7BA 2YX4A 2VOOA 3GZNB 3BG7A 2HOSA 2JVGA 3RQ4A 5ILUA 2STWA 1X1PA 2FSWA 3IH2A 4RGSA 2XROA 1EKEA 1O4XA 1A6QA 3F8NA 3ZCOA 4HNVA 4FE4A 1LEBA 4XLCA 4LG0B 2CQXA 3AG4H 3BQZA 1TNTA 5F08A 3SYTA 3OS2A 1OQYA 4L9TA 3GMEA 1GVDA 1WQ2A 5EEHA 3HOXJ 2GXAA 4U87A 3IWFA 5KCMA 4UUSB 3HKZN 2LC2A 1VQPI 2LSOA 3V42A 4AVPA 5IOYA 1P4AA 4ON0A 5J1RA 3L2VA 2A69F 3ZP5A 2J5OA 1P92A 4EM0B 2R7QA 3P9TA 4HX4A 2HTJA 4XQFA 3L2QA 2E5ZA 2VBYA 2E1CA 4BE1A 3T1BA 1D1CA 3EETA 2GAUA 3E7QA 5D18A 4PXIA 1LQ1A 4ZJZA 4BL0B 2YVHA 1R36A 3CCLI 4C9YA 4AVZA 2LREA 2JPBA 1S9HA 5CQEA 4ZYGA 4R79A 1F4KA 1N78A 3HYIA 1FYLA 1MBFA 1KYWA 2DA2A 1X4PA 1TQMA 4ZC3A 4OIPF 2ZBKA 3GX4X 4BBSJ 2V7FA 2JZYA 1ERDA 2NNYA 5HDKA 4J00A 1T0FC 2QKMB 2NVYJ 1Z0XA 4DVYP 4P1WA 2KQRA 3DU5A 2M1BA 4AU7A 5D5XB 1K6YA 4ZYEA 4LG3A 1Z9CA 3H3UA 3CWRA 3WU1B 2CUZA 3N4MA 2LY2A 3PNVA 1Z91A 3KYLA 3E5UA 2Y31A 4IZZA 2KIFA 2VXZA 3QP6A 4G6QA 4GCLA 3ESWB 3DTIA 2GFNA 2ZXIA 2Y9YA 2VT3A 5CXGA 1WH7A 2DA6A 3KKDA 1W7PA 4F55A 3BJOA 1P7IA 5EGOA 4U0YA 2XUBA 1FIAA 2VE9A 1Y1WJ 2JN6A 3CLQA 2R7XA 4OAZA 2VJ5A 1FX7A 2EILH 1R71A 3R0JA 3BG3A 1HA8A 4O5VA 4E7KA 2NS0A 2L7MP 4ZYAA 4BNCA 3HOYJ 1J09A 3R61A 3HEFA 2PFBA 1OCCH 2RNJA 3I5UA 3PNYA 4EMSA 1YI2I 2XC7A 3D5SC 3KEYA 2PFVA 3UKGA 4DQ2A 1Z6RA 4G8XA 2DQLA 4JP0A 1U9NA 3REOA 3ELKA 1JKOC 1HW2A 2E35A 1W7PD 5DS9A 4A0XA 1MDMB 1QZYA 5E3MA 4N0BA 3HSEA 4LMYA 2BY1A 2ZMEC 2MBFA 3K4LA 4HX7A 2XAHA
chains in the Genus database with same CATH topology
5IYBJ 4DZJA 3G1MA 2HQ5A 1ZQ3P 4AUXA 4A3KJ 2EBIA 2PBXA 1AU7A 4G12A 2MG4A 2NVXJ 1UI6A 4KWAA 3NRGA 1MBKA 4BXXJ 2DA5A 2B63J 5H9TA 5IOZA 1TC3C 2HOAA 2DMUA 2R7ZJ 1ZR4A 1W0UA 1OJLA 2YU9J 5FKLA 3VOXA 5IP9J 4DW6A 3JRFA 2K9NA 4IEJA 4D7MA 2V57A 4AC6A 2R5YB 5F27A 2ZCXA 5IP7J 4JX6A 3GTKJ 1IRZA 1R9TJ 3QKXA 1XS9A 1T33A 5DTDA 1JTXA 3FISA 5GPCA 5GP9A 2L0KA 2OPTA 5C4JJ 2LK2A 1OFCX 1TWHJ 3GBGA 3PM1A 2NS8A 3JRAA 1JUSA 2AO9A 2NP3A 3A03A 1UG2A 1MSFC 2XDNA 1WCMJ 3F0CA 2CJJA 4AYBN 1T56A 2FX0A 2KT0A 3JRBA 3S2DJ 2F07A 3RD3A 3GTMJ 1ENHA 2JA8J 2OI8A 4CYCA 1OCTC 2ID6A 1TWCJ 2R93J 1U8BA 2E1OA 1JUMA 1JKRC 4B1RA 2LR8A 2G0EA 3S15J 3GTJJ 3GEUA 3QBMA 1RESA 2YS9A 3Q0VA 4C3JJ 1GV5A 5EZHA 2JJ7A 2ZOYA 3K2AA 3GTQJ 1SGMA 2DN0A 4FTHA 3A02A 2XPVA 3V78A 2CU7A 3ANGA 4A3JJ 2YVEA 2VUMJ 3B6CA 2VKVA 4ICHA 2M9HA 3BR6A 2G3BA 1TWAJ 4UDSA 3Q0WA 4MXMA 2ELKA 3VUQA 2QOPA 5EEAA 1BJZA 2G7LA 2XGDA 1LE8B 2FD5A 3C2BA 2XB0X 3VIBA 3SFIA 3PPBA 2LTPA 3BG9A 3QPLA 1HLVA 3HGYA 1GUUA 1X2NA 4W1UA 3WHCA 4A3DJ 1Y1VJ 3S1NJ 4GCKA 5FHPA 2AHQA 1XG1A 4M3FA 2R0QC 2Y9ZA 1TWFJ 3S1RJ 3LJLA 1JUPA 3SDGA 5BNGA 3VW1A 1XC5A 4L5EA 2GUHA 3LSJA 1VFCA 4I76A 4ABZA 3K7AJ 4A3IJ 3ZQHA 1H8AC 4M3EA 5F04A 2ECBA 1IGNA 2NP5A 1P7JA 2TCTA 1SFOJ 3JREA 3FK6A 2GM4A 3RQIA 2DMTA 5HODA 2MSYA 1NK2P 5F0FA 2W48A 4XIDA 1JKPC 4IHVA 3LHQA 2CUEA 3IUVA 3ZQGA 3ZQFA 2E2JJ 2QWTA 1MBGA 1ZK8A 3S14J 5CXIA 1MBHA 3BTIA 1ETQA 3HE0A 2CQQA 1RETA 1YRNA 4IHYA 2EZIA 1RKWA 2EQRA 2QTQA 3JR9A 4D5FA 2DA4A 4GFBA 1MH4A 3O8GA 2GENA 1B72B 4HKUA 2HOTA 3F1BA 4M3BA 3FK7A 2M0CA 5E3OA 3LNQA 2JK3A 5FJ8J 2ME6A 4BY1J 3D1NI 3BTJA 2IU5A 1QRYA 2XPUA 1PUFA 5C44J 4RBOA 2DMPA 3OSFA 5FMPA 5IYDJ 3TEDA 2M34A 3VPRA 2LP0A 2ZOZA 4GFKA 3BHQA 2E2IJ 1B8IA 3KNWA 1U9OA 5M3MJ 3ZQLA 2DA3A 3JRHA 2LD5A 2VPRA 3FKIJ 3B81A 4MO7A 4B4CA 5HAWA 1I6HJ 2WB1N 1ZR2A 2LLKA 1H88C 2IBDA 2O8KA 4BBRJ 2CUFA 5J3LA 3SJMA 2HYJA 1VI0A 5FKNA 2K9SA 5EGOB 5EF6A 5HSZA 1ETYA 2XPWA 3VW0A 2UXIA 4DYQA 5EDNA 1HCRA 2FQ4A 1AKHA 3HOVJ 3JSJA 2LY9A 3S2HJ 3IH3A 5GPAA 3LSPA 3OSGA 4MIMA 1VNDA 3GTGJ 2IAIA 3GTPJ 3ZQIA 1JJ8C 4FISA 3O8HA 3JRIA 1CQTA 2JA5J 1BL0A 3BR5A 3O60A 4IHWA 4FE7A 5IP6A 4QIWN 2D5VA 1FTTA 1I50J 2X48A 5EFYA 5FLVA 3S5RA 1IG7A 1SANA 4QTRA 4A3EJ 3A01A 2WV1A 3G1OA 2N8GA 2UXOA 3KKCA 1TWGJ 1H89C 1W0TA 1UMQA 3Q3SA 2ZB9A 5M5WJ 2DG7A 5C4YA 1JGGA 1B8IB 2R5ZA 5EG0A 2YUSA 1D5YA 4XRSA 1FIPA 1POGA 3MKLA 2WAQN 2KDZA 3H3VK 3BR1A 2QIBA 1FJLA 3NPIA 1I3QJ 3CMYA 2UXPA 4A3BJ 5JLXA 3HDDA 2I10A 5DAJA 3BTCA 2PZ9A 3CDLA 4JX4A 2Y2ZA 2XSDC 1GT0C 4FCYA 4A93J 2WGBA 1ETKA 4JYKA 5FKOA 3MNLA 2E19A 1HF0A 4GCTA 1K61A 3G7RA 1ETVA 2RHAA 1WGXA 5FGLA 3PO2J 3CJDA 2IEKA 1E3OC 3VW2A 3JRDA 5K7HA 3EUPA 3VVXA 3HTIA 1X58A 3W6VA 3G56A 4NDLA 3S17J 3GTOJ 2L7FP 3VVYA 1S7EA 2EZHA 3CCYA 3BRUA 4B3AA 3BR3A 2TRTA 4QSHA 2NVTJ 2HKUA 2RASA 5JLWA 3TP3A 1ORKA 3HIMA 4NELA 2H8RA 1DU6A 2EZLA 3HOWJ 2XGEA 3NAUA 5FLMJ 5IYCJ 3BCGA 4CYCB 2JMWA 4DYRA 2ECCA 2Q24A 2L9RA 3PASA 3TW6A 3QPSA 3T6NA 1JTYA 2GBYA 3LSGA 4V2GA 3TW7A 2NX4A 2ZCNA 3L1PA 1QPIA 3FRQA 1LFUP 1APLC 4JKZA 2EH3A 1MNMC 3MVPA 3GTLJ 3I4NJ 4ME9A 2K40A 4UUTA 1RPWA 1RKTA 3BNIA 3Q0UA 3ON4A 3ON2A 2X9DA 1IDZA 4MFEA 3IH4A 3PO3J 4A3MJ 2NVQJ 3HM5A 1UI5A 3V6GA 2DJNA 3FIWA 1EF4A 4M3DA 3BTLA 5IPAA 3BR0A 3NI7A 1WH5A 3HBLA 4D5CA 1FTZA 1IDYA 4C3IJ 3BR2A 2UXUA 2M8GX 2X6OA 1IC8A 1GDTA 3BT9A 2R5YA 1IUFA 2QCOA 1NK3P 2H1KA 1Q1VA 2O7TA 1BW6A 2VI6A 5F0CA 5K7ZA 4A3CJ 2JA7J 2DG8A 5K58A 3ZOBA 1ZTRA 1ETWA 2M2EA 1QVUA 1A5JA 5FKKA 2REKA 4MLOA 3S16J 4A3FJ 2Y30A 5J1YA 3NNRA 4W97A 5AQCA 3RH2A 4UUSA 1OCPA 3G1LA 1WPKA 5M5XJ 3QQAA 3VP5A 2XRLA 1JT6A 3OIOA 1YRNB 2DTZA 2OF7A 2JWTA 1JKQC 1IJWC 2HI3A 3NARA 3RZDJ 3OOUA 3JRGA 1JJ6C 2WUIA 3RKQA 3HB9A 3BG5A 3BQYA 4RDUA 2HYTA 1FEXA 3LSRA 5M5YJ 3CRJA 1ZGWA 1PUFB 1JT0A 3S1MJ 1ZKGA 2LVSA 4ACIA 2L7ZA 2JA6J 3I4MJ 3C07A 2ME0A 5EZGA 4Y7NJ 3LOCA 2XB5A 2LKXA 3DEWA 5E3NA 2COBA 2HOSA 3HOUJ 1MSEC 3ANPA 1ETOA 2O7OA 1ETXA 3IH2A 3HTAA 3DCFA 2FJ1A 1O4XA 4HNVA 4FE4A 4BY7J 3HGGA 1X2MA 2CQXA 1QVTA 4EEFG 5C3EJ 1LE8A 3BQZA 5F08A 3RZOJ 5K7FA 3AQTA 4JNNA 1NTCA 2NS7A 2FBQA 2W53A 9ANTA 1GVDA 3HOXJ 3B6AA 3E7LA 1AKHB 3DPJA 5HBUA 4UUSB 3HKZN 2EZKA 2O9LA 5FKMA 4BKXA 1BW5A 2UXHA 5IOYA 5J1RA 4A69C 3M3YJ 4IHXA 2DA1A 2GLOA 3P9TA 1F36A 2ID3A 2E2HJ 4XICA 2P81A 2MGQA 3HOZJ 1HOMA 2R92J 1MH3A 3VOKA 3E7QA 5E3LA 3M4OJ 5M3FJ 3A01B 5D18A 4PXIA 1HDPA 3WHBA 2YVHA 2K9QA 3BJBA 5D1RA 3HTHA 3KZ9A 4M6VA 3TP0A 3CQZJ 2R5ZB 1MBFA 5EG0B 3MN2A 1UHSA 4JL3A 2DA2A 1F43A 2Y0SN 1IV6A 4MK6A 4V2FA 2MW8A 1K83J 4X1EA 4BBSJ 2QKOA 5CW8A 2LFBA 1B72A 4JX5A 3HTJA 3EGQA 2NVYJ 1Z0XA 4AF5A 3AQSA 4X6AJ 2D6YA 3NXCA 5D19A 3S1QJ 2DA7A 3CWRA 3ZQCA 3IV5A 4XK4A 2Y31A 2HDDA 2ZCMA 4GFLA 2CRGA 2DMQA 4AC0A 4GCLA 2DMNA 4I6ZA 2GFNA 3JRCA 4Y52J 2Y9YA 5CXGA 5F0HA 1WH7A 2DA6A 4DZPA 4L62A 2OERA 2HXOA 1U78A 1Z77A 3KKDA 4MFDA 2G7GA 1P7IA 5EGOA 1Y1WJ 1FIAA 1LFBA 1RR7A 4S0HB 2JN6A 3COLA 1HDDC 2QF7A 3BG3A 2VKEA 3LWJA 3H0GJ 2L7MP 4M3GA 3HOYJ 1G2HA 3HEFA 5F1JA 2HXIA 3GZIA 5J1UA 2PMZN 1GV2A 1ITYA 4J19A 3UKGA 4CGRA 1DU0A 4D7NA 4A3GJ 4XRMA 1BA5A 4YZEA 4JP0A 1A6IA 1WI3A 2RAEA 1VF9A 1U9NA 5EYRA 4C3HJ 1AHDP 4C2MJ 4DYCA 1JKOC 5DS9A 4LOCA 2G7SA 5E3MA 4A3LJ 1MBJA 4XRSG 3VVZA 4NN1A 2NOGA 1MBEA 2XGCA 5C4XJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IYB J;  4DZJ A;  3G1M A;  2HQ5 A;  1ZQ3 P;  4AUX A;  4A3K J;  2EBI A;  2PBX A;  1AU7 A;  4G12 A;  2MG4 A;  2NVX J;  1UI6 A;  4KWA A;  3NRG A;  1MBK A;  4BXX J;  2DA5 A;  2B63 J;  5H9T A;  5IOZ A;  1TC3 C;  2HOA A;  2DMU A;  2R7Z J;  1ZR4 A;  1W0U A;  1OJL A;  2YU9 J;  5FKL A;  3VOX A;  5IP9 J;  4DW6 A;  3JRF A;  2K9N A;  4IEJ A;  4D7M A;  2V57 A;  4AC6 A;  2R5Y B;  5F27 A;  2ZCX A;  5IP7 J;  4JX6 A;  3GTK J;  1IRZ A;  1R9T J;  3QKX A;  1XS9 A;  1T33 A;  5DTD A;  1JTX A;  3FIS A;  5GPC A;  5GP9 A;  2L0K A;  2OPT A;  5C4J J;  2LK2 A;  1OFC X;  1TWH J;  3GBG A;  3PM1 A;  2NS8 A;  3JRA A;  1JUS A;  2AO9 A;  2NP3 A;  3A03 A;  1UG2 A;  1MSF C;  2XDN A;  1WCM J;  3F0C A;  2CJJ A;  4AYB N;  1T56 A;  2FX0 A;  2KT0 A;  3JRB A;  3S2D J;  2F07 A;  3RD3 A;  3GTM J;  1ENH A;  2JA8 J;  2OI8 A;  4CYC A;  1OCT C;  2ID6 A;  1TWC J;  2R93 J;  1U8B A;  2E1O A;  1JUM A;  1JKR C;  4B1R A;  2LR8 A;  2G0E A;  3S15 J;  3GTJ J;  3GEU A;  3QBM A;  1RES A;  2YS9 A;  3Q0V A;  4C3J J;  1GV5 A;  5EZH A;  2JJ7 A;  2ZOY A;  3K2A A;  3GTQ J;  1SGM A;  2DN0 A;  4FTH A;  3A02 A;  2XPV A;  3V78 A;  2CU7 A;  3ANG A;  4A3J J;  2YVE A;  2VUM J;  3B6C A;  2VKV A;  4ICH A;  2M9H A;  3BR6 A;  2G3B A;  1TWA J;  4UDS A;  3Q0W A;  4MXM A;  2ELK A;  3VUQ A;  2QOP A;  5EEA A;  1BJZ A;  2G7L A;  2XGD A;  1LE8 B;  2FD5 A;  3C2B A;  2XB0 X;  3VIB A;  3SFI A;  3PPB A;  2LTP A;  3BG9 A;  3QPL A;  1HLV A;  3HGY A;  1GUU A;  1X2N A;  4W1U A;  3WHC A;  4A3D J;  1Y1V J;  3S1N J;  4GCK A;  5FHP A;  2AHQ A;  1XG1 A;  4M3F A;  2R0Q C;  2Y9Z A;  1TWF J;  3S1R J;  3LJL A;  1JUP A;  3SDG A;  5BNG A;  3VW1 A;  1XC5 A;  4L5E A;  2GUH A;  3LSJ A;  1VFC A;  4I76 A;  4ABZ A;  3K7A J;  4A3I J;  3ZQH A;  1H8A C;  4M3E A;  5F04 A;  2ECB A;  1IGN A;  2NP5 A;  1P7J A;  2TCT A;  1SFO J;  3JRE A;  3FK6 A;  2GM4 A;  3RQI A;  2DMT A;  5HOD A;  2MSY A;  1NK2 P;  5F0F A;  2W48 A;  4XID A;  1JKP C;  4IHV A;  3LHQ A;  2CUE A;  3IUV A;  3ZQG A;  3ZQF A;  2E2J J;  2QWT A;  1MBG A;  1ZK8 A;  3S14 J;  5CXI A;  1MBH A;  3BTI A;  1ETQ A;  3HE0 A;  2CQQ A;  1RET A;  1YRN A;  4IHY A;  2EZI A;  1RKW A;  2EQR A;  2QTQ A;  3JR9 A;  4D5F A;  2DA4 A;  4GFB A;  1MH4 A;  3O8G A;  2GEN A;  1B72 B;  4HKU A;  2HOT A;  3F1B A;  4M3B A;  3FK7 A;  2M0C A;  5E3O A;  3LNQ A;  2JK3 A;  5FJ8 J;  2ME6 A;  4BY1 J;  3D1N I;  3BTJ A;  2IU5 A;  1QRY A;  2XPU A;  1PUF A;  5C44 J;  4RBO A;  2DMP A;  3OSF A;  5FMP A;  5IYD J;  3TED A;  2M34 A;  3VPR A;  2LP0 A;  2ZOZ A;  4GFK A;  3BHQ A;  2E2I J;  1B8I A;  3KNW A;  1U9O A;  5M3M J;  3ZQL A;  2DA3 A;  3JRH A;  2LD5 A;  2VPR A;  3FKI J;  3B81 A;  4MO7 A;  4B4C A;  5HAW A;  1I6H J;  2WB1 N;  1ZR2 A;  2LLK A;  1H88 C;  2IBD A;  2O8K A;  4BBR J;  2CUF A;  5J3L A;  3SJM A;  2HYJ A;  1VI0 A;  5FKN A;  2K9S A;  5EGO B;  5EF6 A;  5HSZ A;  1ETY A;  2XPW A;  3VW0 A;  2UXI A;  4DYQ A;  5EDN A;  1HCR A;  2FQ4 A;  1AKH A;  3HOV J;  3JSJ A;  2LY9 A;  3S2H J;  3IH3 A;  5GPA A;  3LSP A;  3OSG A;  4MIM A;  1VND A;  3GTG J;  2IAI A;  3GTP J;  3ZQI A;  1JJ8 C;  4FIS A;  3O8H A;  3JRI A;  1CQT A;  2JA5 J;  1BL0 A;  3BR5 A;  3O60 A;  4IHW A;  4FE7 A;  5IP6 A;  4QIW N;  2D5V A;  1FTT A;  1I50 J;  2X48 A;  5EFY A;  5FLV A;  3S5R A;  1IG7 A;  1SAN A;  4QTR A;  4A3E J;  3A01 A;  2WV1 A;  3G1O A;  2N8G A;  2UXO A;  3KKC A;  1TWG J;  1H89 C;  1W0T A;  1UMQ A;  3Q3S A;  2ZB9 A;  5M5W J;  2DG7 A;  5C4Y A;  1JGG A;  1B8I B;  2R5Z A;  5EG0 A;  2YUS A;  1D5Y A;  4XRS A;  1FIP A;  1POG A;  3MKL A;  2WAQ N;  2KDZ A;  3H3V K;  3BR1 A;  2QIB A;  1FJL A;  3NPI A;  1I3Q J;  3CMY A;  2UXP A;  4A3B J;  5JLX A;  3HDD A;  2I10 A;  5DAJ A;  3BTC A;  2PZ9 A;  3CDL A;  4JX4 A;  2Y2Z A;  2XSD C;  1GT0 C;  4FCY A;  4A93 J;  2WGB A;  1ETK A;  4JYK A;  5FKO A;  3MNL A;  2E19 A;  1HF0 A;  4GCT A;  1K61 A;  3G7R A;  1ETV A;  2RHA A;  1WGX A;  5FGL A;  3PO2 J;  3CJD A;  2IEK A;  1E3O C;  3VW2 A;  3JRD A;  5K7H A;  3EUP A;  3VVX A;  3HTI A;  1X58 A;  3W6V A;  3G56 A;  4NDL A;  3S17 J;  3GTO J;  2L7F P;  3VVY A;  1S7E A;  2EZH A;  3CCY A;  3BRU A;  4B3A A;  3BR3 A;  2TRT A;  4QSH A;  2NVT J;  2HKU A;  2RAS A;  5JLW A;  3TP3 A;  1ORK A;  3HIM A;  4NEL A;  2H8R A;  1DU6 A;  2EZL A;  3HOW J;  2XGE A;  3NAU A;  5FLM J;  5IYC J;  3BCG A;  4CYC B;  2JMW A;  4DYR A;  2ECC A;  2Q24 A;  2L9R A;  3PAS A;  3TW6 A;  3QPS A;  3T6N A;  1JTY A;  2GBY A;  3LSG A;  4V2G A;  3TW7 A;  2NX4 A;  2ZCN A;  3L1P A;  1QPI A;  3FRQ A;  1LFU P;  1APL C;  4JKZ A;  2EH3 A;  1MNM C;  3MVP A;  3GTL J;  3I4N J;  4ME9 A;  2K40 A;  4UUT A;  1RPW A;  1RKT A;  3BNI A;  3Q0U A;  3ON4 A;  3ON2 A;  2X9D A;  1IDZ A;  4MFE A;  3IH4 A;  3PO3 J;  4A3M J;  2NVQ J;  3HM5 A;  1UI5 A;  3V6G A;  2DJN A;  3FIW A;  1EF4 A;  4M3D A;  3BTL A;  5IPA A;  3BR0 A;  3NI7 A;  1WH5 A;  3HBL A;  4D5C A;  1FTZ A;  1IDY A;  4C3I J;  3BR2 A;  2UXU A;  2M8G X;  2X6O A;  1IC8 A;  1GDT A;  3BT9 A;  2R5Y A;  1IUF A;  2QCO A;  1NK3 P;  2H1K A;  1Q1V A;  2O7T A;  1BW6 A;  2VI6 A;  5F0C A;  5K7Z A;  4A3C J;  2JA7 J;  2DG8 A;  5K58 A;  3ZOB A;  1ZTR A;  1ETW A;  2M2E A;  1QVU A;  1A5J A;  5FKK A;  2REK A;  4MLO A;  3S16 J;  4A3F J;  2Y30 A;  5J1Y A;  3NNR A;  4W97 A;  5AQC A;  3RH2 A;  4UUS A;  1OCP A;  3G1L A;  1WPK A;  5M5X J;  3QQA A;  3VP5 A;  2XRL A;  1JT6 A;  3OIO A;  1YRN B;  2DTZ A;  2OF7 A;  2JWT A;  1JKQ C;  1IJW C;  2HI3 A;  3NAR A;  3RZD J;  3OOU A;  3JRG A;  1JJ6 C;  2WUI A;  3RKQ A;  3HB9 A;  3BG5 A;  3BQY A;  4RDU A;  2HYT A;  1FEX A;  3LSR A;  5M5Y J;  3CRJ A;  1ZGW A;  1PUF B;  1JT0 A;  3S1M J;  1ZKG A;  2LVS A;  4ACI A;  2L7Z A;  2JA6 J;  3I4M J;  3C07 A;  2ME0 A;  5EZG A;  4Y7N J;  3LOC A;  2XB5 A;  2LKX A;  3DEW A;  5E3N A;  2COB A;  2HOS A;  3HOU J;  1MSE C;  3ANP A;  1ETO A;  2O7O A;  1ETX A;  3IH2 A;  3HTA A;  3DCF A;  2FJ1 A;  1O4X A;  4HNV A;  4FE4 A;  4BY7 J;  3HGG A;  1X2M A;  2CQX A;  1QVT A;  4EEF G;  5C3E J;  1LE8 A;  3BQZ A;  5F08 A;  3RZO J;  5K7F A;  3AQT A;  4JNN A;  1NTC A;  2NS7 A;  2FBQ A;  2W53 A;  9ANT A;  1GVD A;  3HOX J;  3B6A A;  3E7L A;  1AKH B;  3DPJ A;  5HBU A;  4UUS B;  3HKZ N;  2EZK A;  2O9L A;  5FKM A;  4BKX A;  1BW5 A;  2UXH A;  5IOY A;  5J1R A;  4A69 C;  3M3Y J;  4IHX A;  2DA1 A;  2GLO A;  3P9T A;  1F36 A;  2ID3 A;  2E2H J;  4XIC A;  2P81 A;  2MGQ A;  3HOZ J;  1HOM A;  2R92 J;  1MH3 A;  3VOK A;  3E7Q A;  5E3L A;  3M4O J;  5M3F J;  3A01 B;  5D18 A;  4PXI A;  1HDP A;  3WHB A;  2YVH A;  2K9Q A;  3BJB A;  5D1R A;  3HTH A;  3KZ9 A;  4M6V A;  3TP0 A;  3CQZ J;  2R5Z B;  1MBF A;  5EG0 B;  3MN2 A;  1UHS A;  4JL3 A;  2DA2 A;  1F43 A;  2Y0S N;  1IV6 A;  4MK6 A;  4V2F A;  2MW8 A;  1K83 J;  4X1E A;  4BBS J;  2QKO A;  5CW8 A;  2LFB A;  1B72 A;  4JX5 A;  3HTJ A;  3EGQ A;  2NVY J;  1Z0X A;  4AF5 A;  3AQS A;  4X6A J;  2D6Y A;  3NXC A;  5D19 A;  3S1Q J;  2DA7 A;  3CWR A;  3ZQC A;  3IV5 A;  4XK4 A;  2Y31 A;  2HDD A;  2ZCM A;  4GFL A;  2CRG A;  2DMQ A;  4AC0 A;  4GCL A;  2DMN A;  4I6Z A;  2GFN A;  3JRC A;  4Y52 J;  2Y9Y A;  5CXG A;  5F0H A;  1WH7 A;  2DA6 A;  4DZP A;  4L62 A;  2OER A;  2HXO A;  1U78 A;  1Z77 A;  3KKD A;  4MFD A;  2G7G A;  1P7I A;  5EGO A;  1Y1W J;  1FIA A;  1LFB A;  1RR7 A;  4S0H B;  2JN6 A;  3COL A;  1HDD C;  2QF7 A;  3BG3 A;  2VKE A;  3LWJ A;  3H0G J;  2L7M P;  4M3G A;  3HOY J;  1G2H A;  3HEF A;  5F1J A;  2HXI A;  3GZI A;  5J1U A;  2PMZ N;  1GV2 A;  1ITY A;  4J19 A;  3UKG A;  4CGR A;  1DU0 A;  4D7N A;  4A3G J;  4XRM A;  1BA5 A;  4YZE A;  4JP0 A;  1A6I A;  1WI3 A;  2RAE A;  1VF9 A;  1U9N A;  5EYR A;  4C3H J;  1AHD P;  4C2M J;  4DYC A;  1JKO C;  5DS9 A;  4LOC A;  2G7S A;  5E3M A;  4A3L J;  1MBJ A;  4XRS G;  3VVZ A;  4NN1 A;  2NOG A;  1MBE A;  2XGC A;  5C4X J; 
#chains in the Genus database with same CATH topology
 1ZYR F;  5IYB J;  4A3K J;  2NOJ B;  2A3S A;  2OV7 A;  1AU7 A;  4X0G A;  5ICC A;  2RQP A;  2NVX J;  2W7N A;  4BUP A;  1UI6 A;  2EV5 A;  4LD5 A;  4KWA A;  5H9T A;  2XF5 A;  2DA5 A;  4OMZ A;  1ZR4 A;  3E6D A;  1AOY A;  1R22 A;  1MMD A;  3DBR B;  4E7H A;  2ZCX A;  2PMH A;  1YW8 A;  2KJB A;  2XSJ C;  1XS9 A;  5GPC A;  1GHC A;  3ZMT A;  5GP9 A;  2L0K A;  5TIS C;  5GTI C;  3OS1 A;  1BOB A;  1G3W A;  1OFC X;  2R7W A;  2W1O A;  5J40 A;  2M3A A;  3AFH A;  3A03 A;  5LGN A;  1UG2 A;  4HA8 A;  3HRM A;  1TBX A;  2B1E A;  2KT0 A;  3H0D A;  2RVC A;  2XAF A;  1ENH A;  4Y13 A;  2LRD A;  4RMN A;  3LST A;  2OI8 A;  1OCT C;  2ID6 A;  1TWC J;  4XN0 A;  2E1O A;  1Y0U A;  2LOO A;  2VN2 A;  2XV4 S;  3SWH A;  2PX9 A;  2JJ7 A;  3ZPL A;  5D6F A;  2DN0 A;  3S93 A;  3F8C A;  3ML6 A;  2DO7 A;  3A02 A;  3V78 A;  3CC7 I;  2VKV A;  2M9H A;  3FM5 A;  1UAA A;  3GFJ A;  4L18 B;  4P55 A;  3IUO A;  2H8W A;  4IRI A;  4IL6 C;  1BJZ A;  2CW0 F;  4IQJ A;  1USS A;  4EQQ A;  1LE8 B;  2BW3 B;  4YIF A;  4R1H A;  3OYK A;  4BJ5 C;  1HST A;  1X4O A;  4RGU A;  3LA2 A;  3RKX A;  3OL3 A;  3DBL B;  3D5R C;  4LLL A;  3U1K A;  1MMS A;  1UCR A;  5FHP A;  3RJP A;  2AHQ A;  2BOL A;  2CUJ A;  4AWX B;  4IRG A;  1Z67 A;  1WJA A;  1LPQ A;  2G7U A;  3WTW C;  3GEZ A;  3S3M A;  2Y9Z A;  4E70 A;  1JUP A;  2HDC A;  1XC5 A;  4L5E A;  5JI6 A;  2GUH A;  4EJO A;  1VFC A;  4PJM A;  3M8J A;  2GIZ A;  2UXX A;  1QBJ A;  4ABZ A;  4A3I J;  2RGV A;  3ABU A;  5F04 A;  2ECB A;  1LB2 A;  3BRO A;  2F4M B;  2ZFW A;  2GM4 A;  3RQI A;  4PSW A;  4A0Y A;  3MZY A;  3FXQ A;  4KIG A;  2F48 A;  4IHV A;  4EJW A;  3BZ6 A;  1P9Q C;  2HWV A;  3ZQG A;  4BYY A;  1ZK8 A;  2E34 A;  3WE3 A;  3S14 J;  4UB8 C;  4HF0 A;  1YIJ I;  1TTY A;  1JE8 A;  2AS5 F;  5H20 A;  1RKW A;  4GRI A;  4YFN F;  4HPQ A;  1U8R A;  2DA4 A;  3KEQ A;  1UJ8 A;  3WTU C;  1XDU A;  2BZT A;  2Y75 A;  2HOT A;  3F1B A;  1T2K A;  2M0C A;  3LNQ A;  2ELJ A;  3KLN A;  1IW7 F;  3CME I;  5KHD A;  2IU5 A;  1QRY A;  4CCO A;  4RBO A;  4RLF A;  3OSF A;  1JI8 A;  5IYD J;  1ULY A;  1R1U A;  3J80 K;  3BC8 A;  3BLY A;  2FBI A;  2VQG A;  2KFD A;  1B8I A;  1Y8R B;  3OYD A;  1U9O A;  2XAS A;  3LMM A;  3Q9S A;  3KEO A;  4HZF A;  3CUO A;  5GTH C;  1I6H J;  1UEL B;  2O8K A;  4BBR J;  2FJI 1;  4OIR F;  2BHZ A;  3BWG A;  2IGO A;  4BJ6 C;  3AKZ A;  2HYJ A;  5FKN A;  2PQ8 A;  3L9F A;  1DDN A;  4UUV A;  2XPW A;  5EDN A;  3SXY A;  2DI3 A;  1GVJ A;  4BEH A;  5TRD A;  3GTG J;  4FIS A;  3KFW X;  1BL0 A;  3BR5 A;  3CCR I;  4FE7 A;  1L3L A;  4HQE A;  5IP6 A;  5J47 A;  3C2H A;  2FQ3 A;  2JUG A;  3EUH C;  3ONQ A;  4HNU A;  3S3O A;  5FLV A;  2JRT A;  1I3A A;  2RDP A;  1VQK I;  3BDD A;  2WV1 A;  1IXS B;  4I01 A;  3KKC A;  1W5C C;  1W0T A;  3M7G A;  3WTV C;  4JBA A;  1UMQ A;  1YQA A;  2ZB9 A;  1SD4 A;  1B8I B;  3DEE A;  2CMP A;  2R5Z A;  5EG0 A;  1D5Y A;  4XRS A;  4KIC A;  2EFN A;  2GXB A;  2WAQ N;  2KDZ A;  2QIB A;  3LQR A;  1SD6 A;  4LJZ F;  2P4W A;  3NPI A;  3MKZ A;  2W25 A;  3COA C;  2UXP A;  4I99 C;  3C3W A;  5DAJ A;  2FF4 A;  4RA2 A;  2PZ9 A;  1X3W B;  3KZY A;  2Y2Z A;  2OUM A;  1FWZ A;  4JYK A;  2X0L A;  4RAG A;  4WWC A;  1ETV A;  2TDX A;  4BEH B;  3S2W A;  4HEA 2;  2RHA A;  1BI1 A;  5FGL A;  3QYB A;  2IEK A;  4N9I A;  4G7H F;  2P7V B;  1YG2 A;  3VW2 A;  3PQJ A;  3VVX A;  3HTI A;  1Z1D A;  3G56 A;  4NDL A;  1XPX A;  2OC6 A;  2L7F P;  1OCZ H;  3VVY A;  3CCY A;  2UXN A;  3BR3 A;  4U9L A;  4QSH A;  2HKU A;  2QWW A;  4QWQ A;  4EJU A;  3F8M A;  1ORK A;  4DNC A;  1PP7 U;  3GXO A;  2JSC A;  4D0P A;  1T95 A;  1O7F A;  3NAU A;  5FFX A;  5FLM J;  4BQN A;  5FD6 A;  2H94 A;  2IA2 A;  3T6N A;  3WTT C;  1NHA A;  1ZLK A;  1VQN I;  4V2G A;  3TO7 A;  1IZ1 A;  1BI3 A;  1QPI A;  3CMA I;  3KYD B;  1LFU P;  2KIU A;  1MNM C;  3EUH A;  3GTL J;  1B4A A;  4ME9 A;  3QWL A;  2K40 A;  5DM6 F;  2MLG A;  4PDK A;  5HS8 A;  3K4C A;  1VTN C;  4CA0 A;  4ASN A;  1A31 A;  3BNI A;  3ON4 A;  4O3M A;  3IHU A;  1FMW A;  2AQF A;  3HTU A;  5LHG A;  1SAX A;  3CCS I;  1E2X A;  1K4S A;  4EM1 A;  4RM2 A;  4AD9 A;  2KZV A;  2M30 A;  3QPH A;  3V8K A;  2M45 A;  6PAX A;  2NVU B;  3CJT B;  1LNW A;  1TL8 A;  4ZDO A;  2LY1 A;  4XLP F;  2P6S A;  2V1D A;  2IS1 A;  4F92 B;  3S8P A;  2BGC A;  1MND A;  1IDY A;  3AG3 H;  4CZC A;  2RC4 A;  5GAE J;  5FLX K;  3NEU A;  5DV5 A;  2UXU A;  4PJN A;  3KIO A;  5LRR A;  2R7U A;  2R5Y A;  2H1K A;  3QOE A;  2DLL A;  2O7T A;  2BHY A;  2UUZ A;  3ZQQ A;  4E7L A;  2PG4 A;  5F0C A;  1D8J A;  5E20 A;  2WA0 A;  3P7N A;  5K58 A;  3ZOB A;  1ZTR A;  1ETW A;  2PMZ A;  3GLL A;  4ESJ A;  3I4P A;  2LBF B;  1B1B A;  1XMA A;  2GQQ A;  4H4K C;  4MHG A;  2ISZ A;  4B44 A;  3K4K A;  2DT5 A;  3K1P A;  3FXK A;  3H36 A;  1OCP A;  5M5X J;  1NG6 A;  4XOR A;  3VP5 A;  2XRL A;  3OYJ A;  5D5U B;  3OYF A;  3GLX A;  1JKQ C;  4U0W A;  4RB3 C;  3NAR A;  3W3C A;  3JRG A;  2KRF A;  1JJ6 C;  1KU9 A;  3HB9 A;  3BQY A;  3ECO A;  4I2O A;  2ESH A;  4WXD A;  2ESN A;  3CRJ A;  1HXD A;  3NWS A;  2ETH A;  5M5Y J;  2V6E A;  4XLN F;  1ZGW A;  1PUF B;  3J7A Y;  2QQB A;  1ZKG A;  3WU0 A;  2V1N A;  3C07 A;  3H9Q A;  2HVS A;  1D0Y A;  2F5C A;  3V7S A;  3WU2 C;  2HOE A;  3ZQ7 A;  3G4S I;  3VYU B;  3HOU J;  3ANP A;  1ETO A;  3QYF A;  1VQO I;  4IO9 F;  3DCF A;  1ZG3 A;  3G73 A;  3LA3 A;  2IGM A;  1S5L C;  1QVT A;  4EEF G;  5IY5 H;  4GYG A;  3RZO J;  2KIQ A;  1YIT I;  3AQT A;  1TT0 A;  2DOA A;  1NTC A;  4IKF A;  4F7Z A;  3B6A A;  2V4J C;  1AKH B;  4CHU A;  4IHS A;  2EZK A;  4AID A;  5FGM A;  1O3R A;  4BKX A;  1BW5 A;  1ZAO A;  1T8I A;  2QKL B;  4KIT B;  2E7W A;  3M3Y J;  2VLA A;  2DA1 A;  3VTI A;  2Q0O A;  3ECH A;  1F36 A;  3D0S A;  1TQI A;  3JSP A;  5E18 F;  1QQI A;  2W00 A;  2R92 J;  5DUK A;  5E3L A;  4NQW A;  4UXN A;  3P9K A;  5L3F A;  3BJB A;  4NB5 A;  2A68 F;  3HTH A;  2QQ8 A;  5TJJ A;  2OU2 A;  4QLC U;  1SVM A;  1UHS A;  4J01 A;  1RI7 A;  1F43 A;  2XAQ A;  2Y0S N;  1BIB A;  1L0O C;  1IV6 A;  1YS6 A;  2UZK A;  4MK6 A;  3TKY A;  3CZ6 A;  2VON A;  2QKO A;  4Z2Y A;  1D1B A;  2LFB A;  1B72 A;  3IL2 A;  3HTJ A;  2Y0M A;  5D8L B;  4AF5 A;  2V79 A;  4FX0 A;  4LIU A;  1EH8 A;  2FA5 A;  4GDF A;  1PP8 F;  3OIQ A;  1DGW Y;  1UST A;  2HDW A;  5KAI C;  3AQS A;  3NXC A;  1MGT A;  3S1Q J;  2DA7 A;  5D19 A;  4Y4R A;  1JHF A;  3TBI A;  4OIO F;  1XGO A;  1J7K A;  4XK4 A;  1QU3 A;  2HDD A;  3TQN A;  2ZCM A;  4PFO A;  2DMQ A;  2K4B A;  4CIC A;  4XLE A;  1OMI A;  2FEZ A;  3JRC A;  3KZZ A;  3GUD A;  5F0H A;  3I56 I;  2QVO A;  2WC2 A;  1F1Z A;  5D4R A;  3KP7 A;  3L2C A;  2UWM A;  3DFG A;  4KN7 X;  2LG4 A;  2OBP A;  2QF7 A;  2W85 A;  2IJL A;  2A61 A;  3MKW B;  2DT6 A;  5CVU A;  2Q8K A;  3LL7 A;  3E3V A;  2LF8 A;  3GZI A;  1BR4 A;  3RPQ A;  1GV2 A;  2XKO A;  3W2A A;  2P0W A;  2IPQ X;  1DPU A;  2X6W A;  1DU0 A;  1MJA A;  1YJ9 I;  1A6I A;  4E7S A;  5GAG J;  1BJA A;  1YOV B;  1QA6 A;  1KYZ A;  3LAJ A;  4G7O F;  4LOC A;  3E1S A;  2DDB A;  3JAM K;  4LB6 B;  3WE2 A;  3BG6 A;  4XRS G;  3VVZ A;  2O3F A;  2V1X A;  5JVT A;  1XCB A;  5K5O A;  4NN1 A;  4E4H A;  2VT2 A;  2BE5 F;  3OYM A;  3C1D A;  3OYH A;  3CC2 I;  1HW1 A;  4M9S A;  1RR8 C;  1ZGA A;  2HEO A;  2PBX A;  4HYE A;  2BXY A;  2MG4 A;  2ZJP F;  3FMS A;  1YLF A;  4BGD A;  3GZ6 A;  2DK5 A;  4BXX J;  4NC6 A;  2ZXH A;  2HOA A;  3H5R A;  3I64 A;  3WTZ A;  2R7Z J;  1Y56 A;  1W0U A;  5FKL A;  3VOE A;  3VOX A;  4TV7 A;  2K3F A;  3BP8 A;  4ZDL A;  4AC6 A;  5F27 A;  4JX6 A;  3ZMU A;  1SFU A;  3UR3 C;  2Q1Z B;  1T33 A;  5C4J J;  3CD6 I;  1XN7 A;  1ZLJ A;  1YE9 A;  2OPT A;  2LK2 A;  1K6O A;  4AM3 A;  3M8E A;  1TWH J;  3CO7 C;  3DTK A;  5HLH A;  1JUS A;  4YII A;  2AO9 A;  3J7Y J;  4PK4 A;  4A12 A;  3DPL C;  3F0C A;  4AYB N;  2QZ8 A;  3LSI A;  4B8X A;  3ZRG A;  3QYE A;  4N4N B;  3UNG C;  2EFP A;  2HYF A;  2NYX A;  1ZAR A;  2M0M A;  4A6D A;  2Z99 A;  2E71 A;  5E1W A;  3GTM J;  3K70 C;  2GZW A;  4XLH A;  3AAF A;  2L54 A;  2R93 J;  1JUM A;  3HSR A;  2V9K A;  3OR2 C;  1MKM A;  1O3T A;  3MD2 A;  3RI4 A;  3J81 K;  4ZTJ A;  3S15 J;  2QA4 I;  3GTJ J;  3GEU A;  3MKY B;  4BDY A;  4C3J J;  3CUQ C;  1S7O A;  5EZH A;  3GTQ J;  2BEO A;  2K4J A;  3HL2 A;  3CC4 I;  2XPV A;  4GO1 A;  4A3J J;  1JHH A;  1RIO H;  2R7V A;  2KZG A;  2XGX A;  4PJJ A;  2VOP A;  3BR6 A;  3GZ5 A;  1TWA J;  3PUB A;  3R60 A;  2DAO A;  2ELK A;  4MXM A;  1ZEL A;  3VUQ A;  2QOP A;  4RGR A;  1RC9 A;  2G7L A;  1QHH D;  3I3L A;  3VWB A;  4MTE A;  5KVR A;  3FBN B;  2F5F A;  3VIB A;  5CKT A;  5JVG F;  2F2E A;  3AL0 B;  3PPB A;  2LTP A;  3BG9 A;  4XOP A;  1GUU A;  3WHC A;  1VQ9 I;  5IT9 Z;  4M71 A;  3VSL A;  3GYH X;  1XG1 A;  1BN5 A;  1TWF J;  3S1R J;  5BNG A;  3SDG A;  3KP6 A;  1D8K A;  1P6R A;  1Z3Y A;  4I76 A;  1KQ8 A;  4DJA A;  4YEJ A;  2VJI A;  1H8A C;  2ZJR F;  4CUG A;  2NP5 A;  2KRH A;  1P7J A;  2MC4 A;  2GIV A;  3DLA A;  2DMT A;  4OAY A;  5HOD A;  2MSY A;  1OLT A;  4MNU A;  1JKP C;  3LHQ A;  1U3E M;  3IUV A;  2E2J J;  2QWT A;  4XM3 A;  4KFC A;  2DFE A;  4XSX F;  1ETQ A;  2KHM A;  1XMX A;  1OCR H;  2GA1 A;  1IXC A;  1XDS A;  2A6H F;  5B3S H;  5BQT A;  5AIP A;  2EFO A;  3CCU I;  4GFB A;  2RQQ A;  1RUO A;  3CCE I;  3I53 A;  1BC7 C;  4CCK A;  4M3B A;  5E3O A;  1SMT A;  1S72 I;  2ME6 A;  1O57 A;  2IGK A;  2KRC A;  1CGP A;  1WJD A;  5KNL A;  3KYC B;  1FOY A;  4MEY F;  1O3Q A;  1C0W A;  5CQG A;  3B73 A;  1WKM A;  3RKY A;  3OYA A;  1YHQ I;  1J0R A;  3EQL F;  3VPR A;  4GFK A;  2ZOZ A;  4B43 A;  2E2I J;  3OYN A;  2ADU A;  2W84 A;  5M3M J;  2DA3 A;  2WY8 Q;  3ZXS A;  2LD5 A;  2VPR A;  3FKI J;  3B81 A;  2QM3 A;  2M8E A;  1IN5 A;  2WB1 N;  3OR1 C;  3K70 D;  1ZR2 A;  3ERM A;  4XSZ F;  1ZG1 A;  1Z7U A;  2CUF A;  4IOA F;  2DFF A;  5J3L A;  3SJM A;  1VI0 A;  5L3B A;  2VJ4 A;  1W7P B;  3HSF A;  5LEJ A;  5EGO B;  3X2Q H;  1T0F A;  1KON A;  1HCR A;  5J6X A;  3S2H J;  5GPA A;  3OYE A;  1S7A A;  1V5E A;  2A5Y B;  2K5C A;  2HKO A;  2IAI A;  2JT1 A;  3EYY A;  3BCB A;  1HC8 A;  3H9J A;  4M74 A;  1XB4 A;  3NRV A;  1BR1 A;  3E6C C;  3DWL E;  4A5M A;  4AIH A;  5B5E C;  5LFA A;  1BBY A;  3EYI A;  4Q5S F;  3WTX C;  4M6X A;  2Z1D A;  2OZ6 A;  1FTT A;  5EFY A;  3S5R A;  1PDN C;  2EJR A;  1EH7 A;  1N75 A;  2Z2S B;  5B1A H;  3BOQ A;  3A01 A;  5F64 A;  4IQ4 A;  4LFU A;  3G1O A;  1R4M B;  2JPC A;  2LMD A;  1H89 C;  3J80 Z;  2G9W A;  2DG7 A;  4WCG A;  1JGG A;  3M9A A;  4M72 A;  3CTA A;  1X1D A;  1Q1H A;  3C7J A;  2E1M B;  5D5V B;  5LD2 C;  1I3Q J;  2QQ9 A;  4A3B J;  1XSX A;  5JLX A;  3HDD A;  3J7A O;  3CMM A;  2BVM A;  3CDL A;  4M9X A;  2XSD C;  1GT0 C;  4FCY A;  4A93 J;  2R7O A;  4U0V A;  3I59 A;  5A2Q Z;  2WGB A;  2E19 A;  4HX8 A;  1O7L A;  1VZ0 A;  3G71 I;  2COM A;  1MJ9 A;  1P2F A;  1PYV A;  4PSX A;  3PO2 J;  5E8I A;  3LSM A;  3PSI A;  3FMQ A;  2ZME A;  4NC8 A;  3JRD A;  4HF1 A;  3HKZ A;  2K27 A;  3WOD F;  4AYB A;  1W36 C;  1EA3 A;  3W6V A;  3I71 A;  3LFU A;  3OL4 A;  1KQ0 A;  4B3A A;  4I02 A;  4KYW A;  2TRT A;  3IKT A;  5JLW A;  3HIM A;  4NEL A;  1B9M A;  5JFR A;  1WRJ A;  4IXA A;  2F5V A;  4EJT A;  1SD7 A;  3HOW J;  2FNP A;  3FX3 A;  5F1R A;  5IYC J;  1SFE A;  3BCG A;  3OYL A;  2ECC A;  5J8F A;  5L3G A;  3PAS A;  3VSK A;  3C2G A;  3TW6 A;  1S6L A;  2X51 A;  3CDI A;  3TW7 A;  2E5N A;  2WBM A;  3CJN A;  3F8F A;  5F6F A;  3MVP A;  3I4N J;  4N9H A;  2MFZ A;  2X6X A;  2H6B A;  4C2U A;  2XAG A;  1VQL I;  1DGR M;  1Z05 A;  1R00 A;  1RPW A;  5FRM A;  3V7C A;  1RKT A;  2EA2 A;  5E8G A;  3Q0U A;  4U88 A;  4F91 B;  3IRR A;  4CSW A;  3GFI A;  3RYP A;  1PUE E;  1E17 A;  3IH4 A;  1R4N B;  2JRM A;  3HM5 A;  3M1C A;  3V6G A;  2VBX A;  2DJN A;  4M3D A;  1N77 A;  1KU3 A;  3B02 A;  3W2V A;  3K2Z A;  4Z6Y A;  2JQ7 A;  5LLQ A;  5IPA A;  3A0B C;  5DCF A;  4CXF A;  1K7A A;  5FFZ A;  2VQH A;  4PCQ A;  5L3D A;  1Y8Q B;  2YSR A;  1ZRC A;  2X6O A;  2VXD A;  1R58 A;  2CQ7 A;  3QP5 A;  3T0Y A;  1D1A A;  3PL8 A;  4ZDP A;  1IUF A;  4CCN A;  1NK3 P;  1X3Z B;  2R3S A;  1N25 A;  4S04 A;  3ZN1 A;  1BW6 A;  5FO5 A;  4QPQ A;  5K7Z A;  4A3C J;  4BH9 A;  3RSN A;  2JA7 J;  1IXR C;  3GO5 A;  5CVR A;  2M2E A;  2QGU A;  4ZYH A;  5FKK A;  4RB1 A;  4CZZ A;  4HG2 A;  1TQP A;  4HW0 A;  5GAH J;  4A3F J;  1I1S A;  3NNR A;  4W97 A;  5AQC A;  3H9G A;  4I0B A;  3LFK A;  1JT6 A;  2KMU A;  4XBF A;  3L09 A;  3SFZ A;  1EJ9 A;  1IJW C;  3FXM A;  2QYO A;  3H5A A;  2FMY A;  3OOU A;  3FM3 A;  2O5R A;  1W36 D;  2HYT A;  2CGP A;  4A2U A;  1FEX A;  1G3T A;  1JT0 A;  3A4C A;  1X1A A;  2LVS A;  1ZRD A;  2DPU A;  3L2U A;  2QEN A;  4PGG A;  3I4M J;  3ABM H;  2DW4 A;  2EFW A;  2JA2 A;  1X1C A;  2XAJ A;  1I1G A;  2XB5 A;  3M1E A;  4UVB A;  2LKX A;  3DEW A;  2MAB A;  3HIF A;  1KA8 A;  1XGS A;  1XMK A;  5E3N A;  1VQ8 I;  1KQ9 A;  5FLX Z;  3O2P E;  1MSE C;  2L7K A;  3FKJ A;  2X4H A;  4BS9 A;  3HTA A;  2FJ1 A;  3U1D A;  4FAS D;  5FRN A;  2EIJ H;  2M4K A;  1I5Z A;  3HTS B;  4BY7 J;  1X2M A;  2CW8 A;  4P9F A;  5TGT A;  5C3E J;  3SZP A;  2ZY9 A;  5E79 C;  2JTV A;  3H92 A;  5K7F A;  3DLL F;  2FBQ A;  2W53 A;  1K78 A;  1U6G A;  3MCZ A;  9ANT A;  3SQN A;  3HRT A;  3MZ8 A;  3HRS A;  3C18 A;  5HBU A;  3EPZ A;  2ZSH B;  3GCM A;  1LJ9 A;  4IPA A;  2O9L A;  5FKM A;  1H9T A;  2UXH A;  1U5T C;  1EH6 A;  4YFK F;  4PJ0 C;  3CCV I;  1ON2 A;  4Y3O A;  1R23 A;  2GLO A;  3TGN A;  2ID3 A;  1Z7L A;  2MLK A;  4XIC A;  3BCA A;  4IRH A;  4H0E A;  1AWC A;  1HOM A;  3HOZ J;  2KIM A;  2ZO4 A;  3VOK A;  1MH3 A;  1TW2 A;  1JXS A;  4ITV A;  5J4Y A;  3M4O J;  1HDP A;  3WHB A;  2WV0 A;  2K9Q A;  3EUK L;  5D1R A;  3KZ9 A;  4M6V A;  1HBX G;  4G9Y A;  2ZC2 A;  4EM2 A;  5BS6 A;  4BQQ A;  1XGM A;  3CQZ J;  3KE2 A;  4XMY A;  4RB2 C;  2R5Z B;  2PBI A;  3QOP A;  3MN2 A;  1OCO H;  5EG0 B;  4JL3 A;  3NWT A;  3TOB A;  4UB6 C;  2DTR A;  1IN8 A;  3IAM 2;  5CVV A;  2MW8 A;  4IVN A;  3SHF A;  3FXJ A;  3HPH A;  4JQF A;  2YPR A;  4JX5 A;  3ZN0 A;  4OOI A;  1YX3 A;  3ZR8 X;  2M7A A;  1IF1 A;  3OMY A;  2BYV E;  1ODD A;  4ESB A;  4UY8 I;  3LSK A;  3CDH A;  4X6A J;  2D6Y A;  2IS2 A;  5CJ9 A;  4NNJ A;  4BAY A;  5ILS A;  3DKY A;  1V4R A;  2HU9 A;  3HJE A;  3KP2 A;  5FRO A;  3ZQC A;  3IV5 A;  2CO5 A;  3GFM A;  1YS7 A;  2DFI A;  5AON A;  4GFL A;  4UVA A;  2CRG A;  1CF7 A;  4AC0 A;  2DMN A;  2HKX A;  2DCE A;  4L9V A;  4BHP A;  4DOZ A;  2OZU A;  3F21 A;  4Y52 J;  4A0Z A;  2BY2 A;  2OER A;  4Y15 A;  3BZK A;  1U78 A;  1Z77 A;  2M87 A;  4MFD A;  1RR7 A;  1SC7 A;  2A07 F;  2QBY A;  3COL A;  1WI9 A;  1HDD C;  4XR6 A;  3OIP A;  2HQN A;  1J2X A;  3GW2 A;  4M3G A;  3RIR A;  5F1J A;  1U5T A;  2E60 A;  2IS4 A;  1T98 A;  5LEK A;  1ITY A;  1HSJ A;  2XF7 A;  5AIQ A;  4L9J A;  3QAH A;  2HNH A;  1FYM A;  1IUY A;  4I98 B;  2E1N A;  2FOW A;  3R6S A;  3W6J B;  4CGR A;  4II2 A;  2RAE A;  1WI3 A;  4ENM A;  1VF9 A;  4C3H J;  3ZMV A;  4C2M J;  1VQ4 I;  4PGH A;  2M5W A;  3VOD A;  4ZZD A;  4MQV A;  2MD5 A;  1WZ2 A;  2G7S A;  2IP2 A;  3E5Q A;  4A3L J;  1E3P A;  5J8C A;  4FHT A;  5B66 C;  4B48 A;  2KL4 A;  4HV5 A;  3SEZ A;  4HBL A;  2O0Y A;  2XRN A;  2NOG A;  2VC0 A;  2YR2 A;  4HDU A;  1MBE A;  5C4X J;  4EGY A;  4DZJ A;  3TMO A;  3QRF F;  1ACI A;  1OYY A;  4K2E A;  1HKS A;  2EBI A;  3DPT A;  4G12 A;  1YTY A;  5LBQ A;  4BDZ A;  1Y0N A;  3NRG A;  2B63 J;  2CH0 A;  5IOZ A;  2CQK A;  1TC3 C;  1OYW A;  3H35 A;  2OTL I;  4HAM A;  5IT3 A;  2XVC A;  2YU9 J;  2CYY A;  2KIS A;  4FQG A;  4DW6 A;  4KMU X;  2K9N A;  2V57 A;  2R5Y B;  3GTK J;  2H27 A;  1R9T J;  5DTD A;  4D9J A;  1WFX A;  1IN4 A;  1FT9 A;  1OYI A;  2VKH A;  3KCC A;  1D0Z A;  2EWN A;  2DK8 A;  3K9T A;  3GBG A;  3PM1 A;  5DDG A;  2NS8 A;  2GXG A;  1G3Y A;  3JW4 A;  3E97 A;  1MMG A;  1MSF C;  1WCM J;  2CJJ A;  2IT0 A;  3JAM Z;  1XSV A;  1GXQ A;  3FXO A;  3WTY C;  2AQE A;  3LSH A;  4F3Q A;  3MAJ A;  3I55 I;  1FY7 A;  1T56 A;  1VQ5 I;  3EUA A;  2F07 A;  4CYC A;  3RKW A;  2IXS A;  1U8B A;  1HQC A;  4II3 A;  3D5L A;  4B1R A;  2LR8 A;  2G0E A;  2EIM H;  1XSD A;  1RES A;  2AXT C;  2VPL A;  2CFO A;  4YIR X;  2WAQ A;  3VFZ A;  4EGZ A;  2ZOY A;  3K2A A;  4O6J A;  2PLY A;  4ANJ A;  3QU3 A;  1X1B A;  2NNN A;  4IHT A;  1LVA A;  3ANG A;  4HST A;  4XLA A;  2IRF G;  5L3E A;  1OR7 C;  2OQG A;  2ZCW A;  2G3B A;  5K1Y A;  4E7I A;  1TP4 A;  2FOK A;  3Q0W A;  5L3C A;  3M8F A;  4HLX A;  2PJR A;  1KZH A;  5EEA A;  3OYC A;  4EVI A;  2DXI A;  2P7C B;  2FD5 A;  4HNT A;  3CP8 A;  3DBH B;  4KIS A;  3ASO H;  3V4G A;  3QPL A;  1HLV A;  2CV1 A;  3HGY A;  4KA4 A;  4W1U A;  4A3D J;  2NAZ A;  3OYI A;  1V5F A;  2ZSI B;  3KPH A;  3MMY B;  1QNT A;  3BY6 A;  2RNG A;  2QUF A;  3DQV C;  2X1C A;  1G4D A;  2F6C A;  5LHI A;  2WWY A;  1WSU A;  3RCO A;  1RRJ A;  3LSJ A;  3LAP A;  3F6O A;  2W4S A;  2Z9O A;  3T8T A;  1BIA A;  4UVC A;  4M3E A;  3J81 Z;  1IGN A;  3PQK A;  1SFO J;  3JRE A;  3FK6 A;  3AG2 H;  2O61 A;  4NQW B;  4GGG A;  4RLQ A;  3WGI A;  3L00 A;  1NK2 P;  2XHK A;  2W48 A;  4XID A;  3F3X A;  4RM3 A;  4ENJ A;  3I58 A;  2CUE A;  1E3H A;  4XLF A;  1DP7 P;  3ZQF A;  2CW7 A;  5CXI A;  3BTI A;  1ZGJ A;  3HE0 A;  2F4I A;  3Q9V A;  2CQQ A;  2FML A;  2MA3 A;  2BBY A;  3LWF A;  3CCM I;  2FU4 A;  5KK1 A;  4HF2 A;  1YRN A;  1TLH B;  2LF7 A;  4PZJ A;  3S32 A;  2EZI A;  3JCU C;  2QSF X;  2VBW A;  4BQA A;  2QTQ A;  3DXJ F;  1FNN A;  1WJ5 A;  2VOD A;  3JSO A;  1J5Y A;  1B72 B;  1MJB A;  1A36 A;  2JK3 A;  2K85 A;  5FJ8 J;  3O3K A;  3HHG A;  2GWR A;  5C44 J;  4XNF A;  1R6R A;  1BI0 A;  2B9S A;  2KLO A;  4A5N A;  3PIO F;  3VYS B;  4LB5 A;  1Z6T A;  1QHG A;  4GXO A;  3KNW A;  2HS5 A;  1OR7 A;  2VBZ A;  3ZQL A;  4LK1 F;  5LGU A;  1ZRE A;  4KT6 A;  4MO7 A;  1PJR A;  1UHW A;  3L7W A;  2HVQ A;  2NXN B;  1ZH5 A;  4S05 A;  1H88 C;  4LG0 A;  4KMF A;  1FBU A;  2XDV A;  3SZG A;  4BHB A;  5GAD J;  5HSZ A;  1F9N A;  3VW0 A;  2HR3 A;  2UXI A;  1G8X A;  3HOV J;  2P5K A;  2LY9 A;  5HLI A;  2WAF A;  3IH3 A;  3LSP A;  3OSG A;  1R5G A;  1VND A;  2ZNY A;  1JJ8 C;  4GCV A;  5D5W B;  3K69 A;  3JRI A;  1CQT A;  2JA5 J;  2P6T A;  3O60 A;  2H6C A;  2PI0 A;  2HQA A;  3NQO A;  2P5L C;  1NH3 A;  1LEA A;  5FB2 A;  4G6D A;  2D5V A;  2Q2E A;  1I50 J;  2X48 A;  1XCV A;  1G3S A;  4BE0 A;  4HV6 A;  3Q5F A;  2L5Q A;  1IG7 A;  1SAN A;  4QTR A;  4A3E J;  1D3Y A;  3GFL A;  4CCJ A;  4LLG F;  2UXO A;  1TWG J;  3N05 A;  3DF8 A;  3Q3S A;  2CG4 A;  5M5W J;  4CYD A;  1FOX A;  2Z33 A;  1S29 A;  2K02 A;  3KET A;  1T6S A;  1FIP A;  1TW3 A;  2ZFU A;  3MKL A;  3H3V K;  3ZMZ A;  1FJL A;  4OIN F;  3DU6 A;  3R4K A;  2PEX A;  2I10 A;  2WY7 Q;  2X85 A;  1ZN2 A;  3ZMS A;  4EJV A;  4MTD A;  5DD4 A;  4PFP A;  3BTC A;  1WJC A;  3CP2 A;  4E6K G;  5D6E A;  4RAY A;  3OWT A;  4MGR A;  3H5N A;  5FKO A;  3MNL A;  4GCT A;  2CFX A;  2PMU A;  3G7R A;  1DQU A;  3ULQ B;  3MZH A;  1WGX A;  3HXL A;  3N97 A;  1IAW A;  1W4M A;  1E3O C;  1DP3 A;  4I09 A;  1BC8 C;  5K7H A;  3EUP A;  2EV0 A;  5EEG A;  2DT7 B;  1X58 A;  2J5P A;  4Y17 A;  2KPM A;  5CPR B;  5B1B H;  2Q2E B;  3S17 J;  3I54 A;  2I8D A;  4HOB A;  1YFH A;  2Z5U A;  1S7E A;  2EZH A;  2OD5 A;  1V5G A;  2RN7 A;  3BRU A;  3H3Z A;  5DCM A;  3DP7 A;  2ACJ A;  3CLO A;  2R7R A;  3E6B A;  3WG9 A;  3BPX A;  4YEL A;  2H8R A;  1IRG A;  3O6B B;  5BOX A;  1WJF A;  2JMW A;  2E1M C;  3V8L A;  4DYR A;  1J59 A;  5DD8 A;  3QPS A;  1BI2 A;  2W57 A;  3HPG A;  2O6G E;  4U7D A;  2MC3 A;  2NX4 A;  2ZCN A;  3HHH A;  3L1P A;  3FRQ A;  3G6E I;  2Y0S A;  1DPR A;  2WTE A;  2EH3 A;  5E1X A;  4DGW B;  3G3Z A;  5CVI A;  5LRS A;  3PJR A;  4JKZ A;  1VQ6 I;  3CCQ I;  2H1L A;  1SVL A;  1ON1 A;  2EIK H;  2MH2 A;  1P4X A;  1MDM A;  2W82 A;  1R5I D;  5HLG A;  3RDI A;  2FBH A;  3ON2 A;  2VE8 A;  1FPQ A;  4BXF A;  5DYM A;  2X9D A;  1KU2 A;  1MMA A;  5JR3 A;  2FE3 A;  3F72 A;  1VQ7 I;  1IDZ A;  3P9C A;  4L5I A;  1Z3X A;  2LNB A;  3ABK H;  2IA0 A;  1RZ4 A;  2Y69 H;  3W6K B;  3PO3 J;  2B0L A;  2NVQ J;  1YIO A;  2DU9 A;  5DCM B;  1AA7 A;  4YRV A;  3FIW A;  4U9N A;  4ZTF A;  3ABT A;  3CUQ A;  4UNO A;  2M4G A;  1D0X A;  1FSH A;  2O03 A;  3IRQ A;  1SD5 A;  1KU7 A;  4BAC A;  4HDV A;  3BR2 A;  2OQR A;  1QO0 D;  2KDO A;  3BT9 A;  4IF4 A;  3IP4 B;  1QPM A;  2QCO A;  2P5V A;  3FZV A;  1Q1V A;  2EV6 A;  3K4N A;  1M1E B;  2YVX A;  4BE2 A;  5H6R A;  2WAE A;  2R7D A;  1FP2 A;  1QVU A;  3ZMD A;  4G7Z F;  4IRV A;  2L2O A;  3A0H C;  4MLO A;  2F5E A;  2EB7 A;  1FBQ A;  1Y6I A;  3OV8 A;  3S16 J;  2IS6 A;  1GXP A;  3VYT B;  2YX7 A;  2DYR H;  3RH2 A;  4LGW A;  2RV8 A;  5CYV A;  4M9Z A;  3FBI B;  1FZP B;  3QQA A;  2V6C A;  5JHU A;  4C30 A;  4XOT A;  3F8B A;  1FMV A;  3OIO A;  2CS3 A;  4WXC A;  4KN4 X;  3PSF A;  1PVE A;  2L3D A;  2ZXJ A;  1LVK A;  4UV8 A;  3RZD J;  1HKQ A;  3WTS C;  4U7B A;  3RKQ A;  3HG9 A;  2KKO A;  2FXA A;  2EA4 A;  3CUQ B;  3S1M J;  4ACI A;  2LDU A;  1Z21 A;  4NBQ A;  3G2B A;  5EZG A;  4Y7N J;  2G7H A;  2COB A;  4ETS A;  1FBS A;  3TO6 A;  2O7O A;  1ETX A;  2ELH A;  1REP C;  4L0Z B;  2ISY A;  2VIX A;  5ICF A;  3HGG A;  1V55 H;  3BPV A;  1LE8 A;  4F52 A;  2BW3 A;  3ASN H;  4FX4 A;  4ENN A;  5BMZ A;  1LDJ A;  1KGS A;  3ERE D;  4MEX F;  2C6Y A;  1T39 A;  4G6T B;  4JNN A;  2NS7 A;  4AIK A;  3E7L A;  1IO2 A;  2B7E A;  5IT9 K;  3K8P C;  3VYR B;  2A2F X;  3DPJ A;  2IW5 A;  1TZL A;  3K0L A;  2GA2 A;  3PNT A;  4A69 C;  1DUX C;  4LIT A;  2OA4 A;  4IHX A;  2HTS A;  2IA1 A;  4IX7 A;  2E2H J;  4BU2 A;  1XTA A;  2P81 A;  3DTE A;  2MGQ A;  1S8N A;  5M3F J;  3A01 B;  2HGC A;  5HDN A;  3IC7 A;  1TNS A;  1RUN A;  1XGN A;  2EFQ A;  4JOM A;  3TP0 A;  1IV8 A;  4AIJ A;  1WJE A;  2RKH A;  2OCC H;  1OIS A;  2QQA A;  5HNH A;  2HYG D;  2E36 A;  2F5D A;  2RRE A;  2XF6 A;  2UV1 A;  2DOD A;  4V2F A;  1K83 J;  2IVM A;  4X1E A;  1SVO A;  3FMR A;  1MW7 A;  3CF2 A;  4FET A;  5LGT A;  5CW8 A;  3KZI C;  3RPU A;  2K7L A;  4B3X A;  3EGQ A;  1T38 A;  2D45 A;  3I59 B;  4HRI A;  4JK1 X;  2LKP A;  2DFH A;  4BXU A;  1W5S A;  5E17 F;  2LYC A;  2HPM A;  2ZKZ A;  2ZME B;  4ZZL A;  5H2F C;  3FXU A;  2CSO A;  2A5W A;  4I6Z A;  2H09 A;  2MYS A;  3F23 A;  4D1Q A;  3CJR B;  3IKV A;  4IOC F;  3K1N A;  3RPU D;  1UG0 A;  4L62 A;  4DZP A;  3OOP A;  1X3U A;  2HXO A;  3K10 A;  3SEQ A;  1IRX A;  4UV9 A;  2G7G A;  1IN7 A;  1IRF A;  1W1W E;  1IN6 A;  1A04 A;  1LFB A;  3JTH A;  2K3P A;  4S0H B;  5LHH A;  1O3S A;  4XN3 A;  3V7R A;  2K9L A;  4B09 A;  4R8H A;  2QSH X;  2VKE A;  3LWJ A;  2K86 A;  4Q47 A;  3H0G J;  1G2H A;  1FC3 A;  2HXI A;  2K9M A;  3CF5 F;  4OMY A;  5J1U A;  4M73 A;  2PMZ N;  3VEP A;  3MWM A;  4J19 A;  2BV6 A;  2MD0 A;  4LIV A;  4D7N A;  1SEU A;  4A3G J;  4XRM A;  1BA5 A;  4YZE A;  5EYR A;  1AHD P;  1TT5 B;  4UHT A;  4DYC A;  2ICW G;  4BJT A;  3V8J A;  4I7H A;  2D2W A;  1YO5 C;  3K1M A;  4OIQ F;  1LDK B;  4C2M A;  4YG2 F;  2WAD A;  3T5X A;  4YFX F;  1WJB A;  1MBJ A;  5D8K B;  2HFH A;  4QPO A;  1GLN A;  2F4O B;  1NG7 A;  1YJW I;  2XGC A;  1ZQ3 P;  3G1M A;  2HQ5 A;  4FT8 A;  4EAT A;  3M07 A;  4AUX A;  3MFK A;  4CDG A;  4KUM A;  4OD4 A;  4CCM A;  1A35 A;  1MIJ A;  3JTG A;  5HS7 A;  2DOE A;  4I0A A;  1MBK A;  1MNE A;  4E7J A;  2WB1 A;  5A2Q K;  2DMU A;  1I6X A;  1R7J A;  1OJL A;  5IP9 J;  4KDP A;  1VQM I;  4KT5 C;  2BY3 A;  4RAZ A;  3JRF A;  2ZNZ A;  2ZXW H;  4IEJ A;  4D7M A;  2R7S A;  3HRU A;  1V54 H;  1K79 A;  5FD5 A;  5IP7 J;  3QPT A;  1IRZ A;  3QKX A;  3LQQ A;  5BPI A;  1JTX A;  1R1T A;  1ZHF A;  3FIS A;  3HUG A;  1OPC A;  4HSR A;  3QOD A;  4NC7 A;  3JRA A;  4Y33 A;  3VDX A;  5BPD A;  3CJQ B;  3F6V A;  2NP3 A;  3RTR A;  2XDN A;  1YJN I;  2LKS A;  3K4M A;  4PJL A;  1B59 A;  1MD0 A;  5HVQ C;  1J75 A;  2FX0 A;  3JRB A;  3S2D J;  3RD3 A;  2VB6 A;  2JA8 J;  1T08 B;  4XRF A;  1OKR A;  1WVR A;  1JKR C;  3BZC A;  3QBM A;  4BQO A;  3DEU A;  2YS9 A;  3Q0V A;  1GV5 A;  1YW9 A;  3FDY A;  1SGM A;  1HKT A;  4FTH A;  4CO8 A;  5HOO A;  4KJZ A;  4WK8 F;  2CU7 A;  3KP4 A;  2YVE A;  3GVA A;  1YW7 A;  2VUM J;  3B6C A;  3KP5 A;  3BJA A;  1X19 A;  4ICH A;  1BR2 A;  2X1D A;  5HDG A;  4UDS A;  3E5X A;  4NUB A;  1R49 A;  2R4G A;  4DIQ A;  3WGH A;  1BOA A;  1ONV A;  3HUG B;  2XGD A;  3HC7 A;  3C2B A;  2XB0 X;  2BXZ A;  1BM9 A;  3QU6 A;  5EJC A;  3SFI A;  4ZH4 F;  4MQ9 F;  1K78 B;  2IGN A;  1X2N A;  2CQN A;  1Y1V J;  3CO6 C;  1H9G A;  3S1N J;  4GCK A;  3BJ6 A;  5J4V A;  2D1H A;  3KX2 A;  3ABL H;  2HZD A;  1K4T A;  4XKW A;  4HLY A;  2DOF A;  4M3F A;  2R0Q C;  3TDU C;  3LJL A;  4OWR B;  1SMY F;  2PN6 A;  3VW1 A;  1YX5 A;  3CES A;  4ENK A;  2EK5 A;  3MEX A;  1W5T A;  2P8T A;  4RGX A;  3K7A J;  3ZQH A;  2VAS A;  2TCT A;  2XIG A;  3J7Z I;  4Q48 A;  1RNL A;  3FWE A;  1HW5 A;  3TL4 X;  4BHC A;  2L01 A;  5HS9 A;  5F0F A;  2LBF A;  1ZG5 A;  4L5J A;  3SZT A;  1MBG A;  2EIN H;  3VB2 A;  1MBH A;  4ESF A;  5DEQ A;  3A1Y A;  2CWE A;  2YU3 A;  1RET A;  4V19 K;  2X1E A;  4RS8 A;  4IHY A;  2EQR A;  1LKX A;  3E6M A;  3JR9 A;  4D5F A;  3GF2 A;  1R5H A;  1MMN A;  1MH4 A;  1QZZ A;  3O8G A;  1I39 A;  4XKB A;  2GEN A;  4HKU A;  3FK7 A;  1SFK A;  4BY1 J;  3D1N I;  3BTJ A;  2XPU A;  1PUF A;  5K5Q A;  3OY9 A;  4WIB A;  2JUC A;  2DMP A;  5K5R A;  1WHU A;  3AG1 H;  2DJI A;  3KP3 A;  5HNF A;  5FMP A;  2OCE A;  3RYR A;  3TED A;  2L9V A;  2M34 A;  2LP0 A;  3FXL A;  3BHQ A;  2OJE D;  3TOA A;  3ZGK A;  3FXR A;  4A6E A;  4LK0 F;  3JRH A;  5HAW A;  4B4C A;  1CF7 B;  3P5J A;  2LLK A;  4Q4Z F;  2IBD A;  5E1Z B;  3ROU A;  2A05 A;  4L9N A;  2AXL A;  3FF5 A;  4CH7 A;  2L9N A;  3W2W A;  3OYG A;  2GOX B;  2K9S A;  2HVR A;  5EF6 A;  4B47 A;  2QBY B;  1ETY A;  4ZYD A;  4XL9 A;  4DYQ A;  2X6Y A;  5DUI A;  2FQ4 A;  4RAF A;  1AKH A;  3JSJ A;  1J9I A;  4MIM A;  5ICG A;  1E0E A;  3GTP J;  3ZQI A;  3I0T A;  3WG7 H;  1YYV A;  1QZE A;  1U5T B;  3O8H A;  3OYB A;  3PFY A;  2OTJ I;  4IHW A;  2L9S A;  2JSP A;  4CGZ A;  4QIW N;  1G6N A;  3PUF A;  5JHF A;  3PIP F;  2VQL A;  5H6Q A;  2V1U A;  1FLI A;  4WXH A;  4M6Y A;  2N8G A;  2E7X A;  2QEX I;  2QLZ A;  2XKP A;  1B6A A;  2VQC A;  4LLN A;  5C4Y A;  2OAZ A;  4IJA A;  2YUS A;  1POG A;  1B9N A;  5D4S A;  3BR1 A;  4OD5 A;  1U0J A;  3U9G A;  3CMY A;  1WWX A;  3TO9 A;  3R0A A;  1H0M A;  2KJC A;  3T8R A;  4JX4 A;  2V9V A;  3FHZ A;  2STT A;  2GOM A;  1SAU A;  1ETK A;  1HF0 A;  5CVJ A;  3ISP A;  1K61 A;  1F5T A;  1R1V A;  4KIB A;  3CJD A;  4F93 B;  2CV2 A;  2BY0 A;  4E7Z A;  3DPU A;  3IAS 2;  2VJJ A;  2DBB A;  1LFP A;  2XAU A;  3HOS A;  3K6G A;  1JGS A;  3GTO J;  1UHM A;  4C2T A;  3GWZ A;  4L0Y B;  1MZB A;  3LA7 A;  5ED4 A;  2ZJQ F;  2DQR A;  3S3N A;  2NVT J;  4OU0 A;  4WF2 A;  2RAS A;  3DKW A;  4EV0 A;  3TP3 A;  2FNA A;  2V26 A;  2DDA A;  2QSG X;  2VL8 A;  1SFX A;  1DU6 A;  2EZL A;  2CV0 A;  3U21 A;  3L2R A;  2XGE A;  2A6T A;  2MH9 A;  4P9U A;  2FRH A;  5HLT A;  4HQM A;  3PFI A;  1I27 A;  1Y39 A;  4CYC B;  2Z3Y A;  2Q24 A;  2NRA C;  2L02 A;  1QGP A;  2L9R A;  1JTY A;  3U2R A;  4CCL A;  3WGG A;  2GBY A;  2O8X A;  3LSG A;  4N4O B;  3A2K A;  4P5O A;  3DKX A;  3HOT A;  2D1V A;  3P9I A;  1XX5 A;  3FHN A;  1APL C;  4KIF A;  2LH9 A;  1LUJ B;  2HZT A;  4UUT A;  1ZRF A;  3NS4 A;  5ERI A;  5DM7 F;  2BVL A;  3H1C A;  2R7F A;  2Y48 A;  3F22 A;  3MQ0 A;  4PUS A;  1FOK A;  2HPI A;  2A6E F;  2Z16 A;  3E0J B;  3K4B A;  2V9P A;  2PJR B;  4MFE A;  1UB9 A;  4XON A;  1S3J A;  3CCJ I;  2FUG 2;  3I9V 2;  4A3M J;  3AL0 C;  2R7T A;  4RB0 A;  1UI5 A;  4G94 A;  1EF4 A;  3DV8 A;  4XKC A;  1FYK A;  1STZ A;  3BTL A;  4P96 A;  3BR0 A;  3NI7 A;  1LDD A;  1WH5 A;  3HZJ A;  3HBL A;  4D5C A;  1G59 A;  1FTZ A;  3K4J A;  4DBQ A;  4C3I J;  5CLS A;  2I5U A;  4DBR A;  5ILV A;  1FOW A;  3L2W A;  2M8G X;  1IC8 A;  2JVH A;  1GDT A;  2DYS H;  1P4W A;  2L4M A;  2VC1 A;  1XD7 A;  3OS0 A;  1V3F A;  4GYI A;  2VI6 A;  3EDP A;  2DG8 A;  4XKV A;  2B3W A;  1A5J A;  2PJP A;  2FBK A;  2HQR A;  2REK A;  4NHJ A;  3KLO A;  2Y30 A;  5ICE A;  1FSE A;  5J1Y A;  2ZJ2 A;  1UFM A;  4UUS A;  1WPK A;  3G1L A;  3TDZ C;  1U2W A;  1YRN B;  3IWZ A;  2VKD A;  2DTZ A;  2OF7 A;  2JWT A;  2KP6 A;  4WX9 A;  1EV7 A;  4KNY A;  2HI3 A;  2DPD A;  2WUI A;  2EPF A;  1FP1 D;  3SDB A;  3F9K A;  3BG5 A;  4RDU A;  2L4A A;  5KAF C;  3LSR A;  1UZC A;  2W24 A;  1D5V A;  2L7Z A;  2JA6 J;  2ME0 A;  3LOC A;  2M7B A;  2YX4 A;  2VOO A;  3GZN B;  3BG7 A;  2HOS A;  2JVG A;  3RQ4 A;  5ILU A;  2STW A;  1X1P A;  2FSW A;  3IH2 A;  4RGS A;  2XRO A;  1EKE A;  1O4X A;  1A6Q A;  3F8N A;  3ZCO A;  4HNV A;  4FE4 A;  1LEB A;  4XLC A;  4LG0 B;  2CQX A;  3AG4 H;  3BQZ A;  1TNT A;  5F08 A;  3SYT A;  3OS2 A;  1OQY A;  4L9T A;  3GME A;  1GVD A;  1WQ2 A;  5EEH A;  3HOX J;  2GXA A;  4U87 A;  3IWF A;  5KCM A;  4UUS B;  3HKZ N;  2LC2 A;  1VQP I;  2LSO A;  3V42 A;  4AVP A;  5IOY A;  1P4A A;  4ON0 A;  5J1R A;  3L2V A;  2A69 F;  3ZP5 A;  2J5O A;  1P92 A;  4EM0 B;  2R7Q A;  3P9T A;  4HX4 A;  2HTJ A;  4XQF A;  3L2Q A;  2E5Z A;  2VBY A;  2E1C A;  4BE1 A;  3T1B A;  1D1C A;  3EET A;  2GAU A;  3E7Q A;  5D18 A;  4PXI A;  1LQ1 A;  4ZJZ A;  4BL0 B;  2YVH A;  1R36 A;  3CCL I;  4C9Y A;  4AVZ A;  2LRE A;  2JPB A;  1S9H A;  5CQE A;  4ZYG A;  4R79 A;  1F4K A;  1N78 A;  3HYI A;  1FYL A;  1MBF A;  1KYW A;  2DA2 A;  1X4P A;  1TQM A;  4ZC3 A;  4OIP F;  2ZBK A;  3GX4 X;  4BBS J;  2V7F A;  2JZY A;  1ERD A;  2NNY A;  5HDK A;  4J00 A;  1T0F C;  2QKM B;  2NVY J;  1Z0X A;  4DVY P;  4P1W A;  2KQR A;  3DU5 A;  2M1B A;  4AU7 A;  5D5X B;  1K6Y A;  4ZYE A;  4LG3 A;  1Z9C A;  3H3U A;  3CWR A;  3WU1 B;  2CUZ A;  3N4M A;  2LY2 A;  3PNV A;  1Z91 A;  3KYL A;  3E5U A;  2Y31 A;  4IZZ A;  2KIF A;  2VXZ A;  3QP6 A;  4G6Q A;  4GCL A;  3ESW B;  3DTI A;  2GFN A;  2ZXI A;  2Y9Y A;  2VT3 A;  5CXG A;  1WH7 A;  2DA6 A;  3KKD A;  1W7P A;  4F55 A;  3BJO A;  1P7I A;  5EGO A;  4U0Y A;  2XUB A;  1FIA A;  2VE9 A;  1Y1W J;  2JN6 A;  3CLQ A;  2R7X A;  4OAZ A;  2VJ5 A;  1FX7 A;  2EIL H;  1R71 A;  3R0J A;  3BG3 A;  1HA8 A;  4O5V A;  4E7K A;  2NS0 A;  2L7M P;  4ZYA A;  4BNC A;  3HOY J;  1J09 A;  3R61 A;  3HEF A;  2PFB A;  1OCC H;  2RNJ A;  3I5U A;  3PNY A;  4EMS A;  1YI2 I;  2XC7 A;  3D5S C;  3KEY A;  2PFV A;  3UKG A;  4DQ2 A;  1Z6R A;  4G8X A;  2DQL A;  4JP0 A;  1U9N A;  3REO A;  3ELK A;  1JKO C;  1HW2 A;  2E35 A;  1W7P D;  5DS9 A;  4A0X A;  1MDM B;  1QZY A;  5E3M A;  4N0B A;  3HSE A;  4LMY A;  2BY1 A;  2ZME C;  2MBF A;  3K4L A;  4HX7 A;  2XAH A; 
#chains in the Genus database with same CATH homology
 5IYB J;  4DZJ A;  3G1M A;  2HQ5 A;  1ZQ3 P;  4AUX A;  4A3K J;  2EBI A;  2PBX A;  1AU7 A;  4G12 A;  2MG4 A;  2NVX J;  1UI6 A;  4KWA A;  3NRG A;  1MBK A;  4BXX J;  2DA5 A;  2B63 J;  5H9T A;  5IOZ A;  1TC3 C;  2HOA A;  2DMU A;  2R7Z J;  1ZR4 A;  1W0U A;  1OJL A;  2YU9 J;  5FKL A;  3VOX A;  5IP9 J;  4DW6 A;  3JRF A;  2K9N A;  4IEJ A;  4D7M A;  2V57 A;  4AC6 A;  2R5Y B;  5F27 A;  2ZCX A;  5IP7 J;  4JX6 A;  3GTK J;  1IRZ A;  1R9T J;  3QKX A;  1XS9 A;  1T33 A;  5DTD A;  1JTX A;  3FIS A;  5GPC A;  5GP9 A;  2L0K A;  2OPT A;  5C4J J;  2LK2 A;  1OFC X;  1TWH J;  3GBG A;  3PM1 A;  2NS8 A;  3JRA A;  1JUS A;  2AO9 A;  2NP3 A;  3A03 A;  1UG2 A;  1MSF C;  2XDN A;  1WCM J;  3F0C A;  2CJJ A;  4AYB N;  1T56 A;  2FX0 A;  2KT0 A;  3JRB A;  3S2D J;  2F07 A;  3RD3 A;  3GTM J;  1ENH A;  2JA8 J;  2OI8 A;  4CYC A;  1OCT C;  2ID6 A;  1TWC J;  2R93 J;  1U8B A;  2E1O A;  1JUM A;  1JKR C;  4B1R A;  2LR8 A;  2G0E A;  3S15 J;  3GTJ J;  3GEU A;  3QBM A;  1RES A;  2YS9 A;  3Q0V A;  4C3J J;  1GV5 A;  5EZH A;  2JJ7 A;  2ZOY A;  3K2A A;  3GTQ J;  1SGM A;  2DN0 A;  4FTH A;  3A02 A;  2XPV A;  3V78 A;  2CU7 A;  3ANG A;  4A3J J;  2YVE A;  2VUM J;  3B6C A;  2VKV A;  4ICH A;  2M9H A;  3BR6 A;  2G3B A;  1TWA J;  4UDS A;  3Q0W A;  4MXM A;  2ELK A;  3VUQ A;  2QOP A;  5EEA A;  1BJZ A;  2G7L A;  2XGD A;  1LE8 B;  2FD5 A;  3C2B A;  2XB0 X;  3VIB A;  3SFI A;  3PPB A;  2LTP A;  3BG9 A;  3QPL A;  1HLV A;  3HGY A;  1GUU A;  1X2N A;  4W1U A;  3WHC A;  4A3D J;  1Y1V J;  3S1N J;  4GCK A;  5FHP A;  2AHQ A;  1XG1 A;  4M3F A;  2R0Q C;  2Y9Z A;  1TWF J;  3S1R J;  3LJL A;  1JUP A;  3SDG A;  5BNG A;  3VW1 A;  1XC5 A;  4L5E A;  2GUH A;  3LSJ A;  1VFC A;  4I76 A;  4ABZ A;  3K7A J;  4A3I J;  3ZQH A;  1H8A C;  4M3E A;  5F04 A;  2ECB A;  1IGN A;  2NP5 A;  1P7J A;  2TCT A;  1SFO J;  3JRE A;  3FK6 A;  2GM4 A;  3RQI A;  2DMT A;  5HOD A;  2MSY A;  1NK2 P;  5F0F A;  2W48 A;  4XID A;  1JKP C;  4IHV A;  3LHQ A;  2CUE A;  3IUV A;  3ZQG A;  3ZQF A;  2E2J J;  2QWT A;  1MBG A;  1ZK8 A;  3S14 J;  5CXI A;  1MBH A;  3BTI A;  1ETQ A;  3HE0 A;  2CQQ A;  1RET A;  1YRN A;  4IHY A;  2EZI A;  1RKW A;  2EQR A;  2QTQ A;  3JR9 A;  4D5F A;  2DA4 A;  4GFB A;  1MH4 A;  3O8G A;  2GEN A;  1B72 B;  4HKU A;  2HOT A;  3F1B A;  4M3B A;  3FK7 A;  2M0C A;  5E3O A;  3LNQ A;  2JK3 A;  5FJ8 J;  2ME6 A;  4BY1 J;  3D1N I;  3BTJ A;  2IU5 A;  1QRY A;  2XPU A;  1PUF A;  5C44 J;  4RBO A;  2DMP A;  3OSF A;  5FMP A;  5IYD J;  3TED A;  2M34 A;  3VPR A;  2LP0 A;  2ZOZ A;  4GFK A;  3BHQ A;  2E2I J;  1B8I A;  3KNW A;  1U9O A;  5M3M J;  3ZQL A;  2DA3 A;  3JRH A;  2LD5 A;  2VPR A;  3FKI J;  3B81 A;  4MO7 A;  4B4C A;  5HAW A;  1I6H J;  2WB1 N;  1ZR2 A;  2LLK A;  1H88 C;  2IBD A;  2O8K A;  4BBR J;  2CUF A;  5J3L A;  3SJM A;  2HYJ A;  1VI0 A;  5FKN A;  2K9S A;  5EGO B;  5EF6 A;  5HSZ A;  1ETY A;  2XPW A;  3VW0 A;  2UXI A;  4DYQ A;  5EDN A;  1HCR A;  2FQ4 A;  1AKH A;  3HOV J;  3JSJ A;  2LY9 A;  3S2H J;  3IH3 A;  5GPA A;  3LSP A;  3OSG A;  4MIM A;  1VND A;  3GTG J;  2IAI A;  3GTP J;  3ZQI A;  1JJ8 C;  4FIS A;  3O8H A;  3JRI A;  1CQT A;  2JA5 J;  1BL0 A;  3BR5 A;  3O60 A;  4IHW A;  4FE7 A;  5IP6 A;  4QIW N;  2D5V A;  1FTT A;  1I50 J;  2X48 A;  5EFY A;  5FLV A;  3S5R A;  1IG7 A;  1SAN A;  4QTR A;  4A3E J;  3A01 A;  2WV1 A;  3G1O A;  2N8G A;  2UXO A;  3KKC A;  1TWG J;  1H89 C;  1W0T A;  1UMQ A;  3Q3S A;  2ZB9 A;  5M5W J;  2DG7 A;  5C4Y A;  1JGG A;  1B8I B;  2R5Z A;  5EG0 A;  2YUS A;  1D5Y A;  4XRS A;  1FIP A;  1POG A;  3MKL A;  2WAQ N;  2KDZ A;  3H3V K;  3BR1 A;  2QIB A;  1FJL A;  3NPI A;  1I3Q J;  3CMY A;  2UXP A;  4A3B J;  5JLX A;  3HDD A;  2I10 A;  5DAJ A;  3BTC A;  2PZ9 A;  3CDL A;  4JX4 A;  2Y2Z A;  2XSD C;  1GT0 C;  4FCY A;  4A93 J;  2WGB A;  1ETK A;  4JYK A;  5FKO A;  3MNL A;  2E19 A;  1HF0 A;  4GCT A;  1K61 A;  3G7R A;  1ETV A;  2RHA A;  1WGX A;  5FGL A;  3PO2 J;  3CJD A;  2IEK A;  1E3O C;  3VW2 A;  3JRD A;  5K7H A;  3EUP A;  3VVX A;  3HTI A;  1X58 A;  3W6V A;  3G56 A;  4NDL A;  3S17 J;  3GTO J;  2L7F P;  3VVY A;  1S7E A;  2EZH A;  3CCY A;  3BRU A;  4B3A A;  3BR3 A;  2TRT A;  4QSH A;  2NVT J;  2HKU A;  2RAS A;  5JLW A;  3TP3 A;  1ORK A;  3HIM A;  4NEL A;  2H8R A;  1DU6 A;  2EZL A;  3HOW J;  2XGE A;  3NAU A;  5FLM J;  5IYC J;  3BCG A;  4CYC B;  2JMW A;  4DYR A;  2ECC A;  2Q24 A;  2L9R A;  3PAS A;  3TW6 A;  3QPS A;  3T6N A;  1JTY A;  2GBY A;  3LSG A;  4V2G A;  3TW7 A;  2NX4 A;  2ZCN A;  3L1P A;  1QPI A;  3FRQ A;  1LFU P;  1APL C;  4JKZ A;  2EH3 A;  1MNM C;  3MVP A;  3GTL J;  3I4N J;  4ME9 A;  2K40 A;  4UUT A;  1RPW A;  1RKT A;  3BNI A;  3Q0U A;  3ON4 A;  3ON2 A;  2X9D A;  1IDZ A;  4MFE A;  3IH4 A;  3PO3 J;  4A3M J;  2NVQ J;  3HM5 A;  1UI5 A;  3V6G A;  2DJN A;  3FIW A;  1EF4 A;  4M3D A;  3BTL A;  5IPA A;  3BR0 A;  3NI7 A;  1WH5 A;  3HBL A;  4D5C A;  1FTZ A;  1IDY A;  4C3I J;  3BR2 A;  2UXU A;  2M8G X;  2X6O A;  1IC8 A;  1GDT A;  3BT9 A;  2R5Y A;  1IUF A;  2QCO A;  1NK3 P;  2H1K A;  1Q1V A;  2O7T A;  1BW6 A;  2VI6 A;  5F0C A;  5K7Z A;  4A3C J;  2JA7 J;  2DG8 A;  5K58 A;  3ZOB A;  1ZTR A;  1ETW A;  2M2E A;  1QVU A;  1A5J A;  5FKK A;  2REK A;  4MLO A;  3S16 J;  4A3F J;  2Y30 A;  5J1Y A;  3NNR A;  4W97 A;  5AQC A;  3RH2 A;  4UUS A;  1OCP A;  3G1L A;  1WPK A;  5M5X J;  3QQA A;  3VP5 A;  2XRL A;  1JT6 A;  3OIO A;  1YRN B;  2DTZ A;  2OF7 A;  2JWT A;  1JKQ C;  1IJW C;  2HI3 A;  3NAR A;  3RZD J;  3OOU A;  3JRG A;  1JJ6 C;  2WUI A;  3RKQ A;  3HB9 A;  3BG5 A;  3BQY A;  4RDU A;  2HYT A;  1FEX A;  3LSR A;  5M5Y J;  3CRJ A;  1ZGW A;  1PUF B;  1JT0 A;  3S1M J;  1ZKG A;  2LVS A;  4ACI A;  2L7Z A;  2JA6 J;  3I4M J;  3C07 A;  2ME0 A;  5EZG A;  4Y7N J;  3LOC A;  2XB5 A;  2LKX A;  3DEW A;  5E3N A;  2COB A;  2HOS A;  3HOU J;  1MSE C;  3ANP A;  1ETO A;  2O7O A;  1ETX A;  3IH2 A;  3HTA A;  3DCF A;  2FJ1 A;  1O4X A;  4HNV A;  4FE4 A;  4BY7 J;  3HGG A;  1X2M A;  2CQX A;  1QVT A;  4EEF G;  5C3E J;  1LE8 A;  3BQZ A;  5F08 A;  3RZO J;  5K7F A;  3AQT A;  4JNN A;  1NTC A;  2NS7 A;  2FBQ A;  2W53 A;  9ANT A;  1GVD A;  3HOX J;  3B6A A;  3E7L A;  1AKH B;  3DPJ A;  5HBU A;  4UUS B;  3HKZ N;  2EZK A;  2O9L A;  5FKM A;  4BKX A;  1BW5 A;  2UXH A;  5IOY A;  5J1R A;  4A69 C;  3M3Y J;  4IHX A;  2DA1 A;  2GLO A;  3P9T A;  1F36 A;  2ID3 A;  2E2H J;  4XIC A;  2P81 A;  2MGQ A;  3HOZ J;  1HOM A;  2R92 J;  1MH3 A;  3VOK A;  3E7Q A;  5E3L A;  3M4O J;  5M3F J;  3A01 B;  5D18 A;  4PXI A;  1HDP A;  3WHB A;  2YVH A;  2K9Q A;  3BJB A;  5D1R A;  3HTH A;  3KZ9 A;  4M6V A;  3TP0 A;  3CQZ J;  2R5Z B;  1MBF A;  5EG0 B;  3MN2 A;  1UHS A;  4JL3 A;  2DA2 A;  1F43 A;  2Y0S N;  1IV6 A;  4MK6 A;  4V2F A;  2MW8 A;  1K83 J;  4X1E A;  4BBS J;  2QKO A;  5CW8 A;  2LFB A;  1B72 A;  4JX5 A;  3HTJ A;  3EGQ A;  2NVY J;  1Z0X A;  4AF5 A;  3AQS A;  4X6A J;  2D6Y A;  3NXC A;  5D19 A;  3S1Q J;  2DA7 A;  3CWR A;  3ZQC A;  3IV5 A;  4XK4 A;  2Y31 A;  2HDD A;  2ZCM A;  4GFL A;  2CRG A;  2DMQ A;  4AC0 A;  4GCL A;  2DMN A;  4I6Z A;  2GFN A;  3JRC A;  4Y52 J;  2Y9Y A;  5CXG A;  5F0H A;  1WH7 A;  2DA6 A;  4DZP A;  4L62 A;  2OER A;  2HXO A;  1U78 A;  1Z77 A;  3KKD A;  4MFD A;  2G7G A;  1P7I A;  5EGO A;  1Y1W J;  1FIA A;  1LFB A;  1RR7 A;  4S0H B;  2JN6 A;  3COL A;  1HDD C;  2QF7 A;  3BG3 A;  2VKE A;  3LWJ A;  3H0G J;  2L7M P;  4M3G A;  3HOY J;  1G2H A;  3HEF A;  5F1J A;  2HXI A;  3GZI A;  5J1U A;  2PMZ N;  1GV2 A;  1ITY A;  4J19 A;  3UKG A;  4CGR A;  1DU0 A;  4D7N A;  4A3G J;  4XRM A;  1BA5 A;  4YZE A;  4JP0 A;  1A6I A;  1WI3 A;  2RAE A;  1VF9 A;  1U9N A;  5EYR A;  4C3H J;  1AHD P;  4C2M J;  4DYC A;  1JKO C;  5DS9 A;  4LOC A;  2G7S A;  5E3M A;  4A3L J;  1MBJ A;  4XRS G;  3VVZ A;  4NN1 A;  2NOG A;  1MBE A;  2XGC A;  5C4X J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...