2ZB9A

Crystal structure of tetr family transcription regulator sco0332
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
188
structure length
188
Chain Sequence
GRRPAEEVRAEVLHAVGELLLTEGTAQLTFERVARVSGVSKTTLYKWWPSKGALALDGYFHAVEDTLAFPDTGDVRADLLAQLRAFTHVMTRTPGGRILTELIGAAQTDADLATAYRQLYSAQRRALAAERLRHARELGQIRPDVDVQVLVDQLWGAVYHRLLIPDEPVDDAFVTALVTNLLDGVCPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional analysis of the TetR-family transcriptional regulator SCO0332 from Streptomyces coelicolor
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Transcription
molecule keywords Putative transcriptional regulator
total genus 72
structure length 188
sequence length 188
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF16859 TetR_C_11 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2zb9A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2zb9A02
2DG7A 2L7FP 4JL3A 2G0EA 1U8BA 3CJDA 2AO9A 4M3BA 2KDZA 2LK2A 3O8HA 2JA7J 2XGCA 1DU6A 4ME9A 2CUFA 3BR3A 4FE4A 4YZEA 2Q24A 2D5VA 3TP0A 4J19A 3HOWJ 2OI8A 2LD5A 2DTZA 4MLOA 2VUMJ 3HOZJ 3BRUA 2ZOZA 3QQAA 1HCRA 2VPRA 2CJJA 3OIOA 1AU7A 3QPLA 5F0HA 4JX6A 1XS9A 4A3CJ 4M3FA 5FKLA 2EH3A 1SFOJ 3RD3A 3DCFA 2JN6A 1JT6A 3V6GA 3DPJA 2NP5A 3B81A 4GFLA 4FISA 4A3GJ 1D5YA 2UXUA 4A3BJ 1HOMA 3Q0WA 4XICA 2YVEA 4HNVA 2JA5J 3BQZA 1K83J 2XB5A 5EGOB 1HLVA 2PZ9A 3V78A 2M2EA 3HEFA 1NK3P 1JKPC 4MIMA 4UUSA 3WHBA 2XGDA 3JRCA 4XIDA 1WGXA 1GT0C 5E3NA 2HYTA 3L1PA 5HSZA 1NK2P 4C3JJ 4EEFG 2HKUA 2H1KA 4AC6A 3RZDJ 2XPUA 3NARA 1ETKA 5IOYA 2FJ1A 3JRDA 3HTJA 5FKNA 4FE7A 2E1OA 3S1MJ 5J1RA 5BNGA 2IAIA 4AC0A 1X2NA 2DA5A 1GUUA 1U9NA 3G1MA 3FK7A 4A3DJ 1FIAA 2Y9YA 1VNDA 4G12A 2JJ7A 4UUSB 1QVUA 2Y2ZA 5AQCA 3AQSA 3I4MJ 1POGA 3G56A 1IC8A 3NI7A 3VUQA 5EYRA 4XRSA 1U78A 3A02A 1O4XA 2QKOA 3JSJA 2ELKA 4KWAA 1ENHA 1BW5A 4JX4A 3DEWA 3OSFA 2XPVA 2K9QA 3FKIJ 3LWJA 2ZB9A 2X9DA 4XRMA 3A03A 4IEJA 2QIBA 2YU9J 2YS9A 4FCYA 3LOCA 1ZR4A 3RH2A 1I50J 3IH3A 5F08A 3ANPA 1B8IB 3PPBA 3JRGA 3BG9A 3BR1A 4W1UA 2H8RA 1P7IA 3GTJJ 1HDPA 3NPIA 4IHVA 2GENA 3HIMA 3ZQLA 2HOAA 2EZIA 5EZGA 2CRGA 2MG4A 2R5YA 2LR8A 3I4NJ 3H3VK 2PBXA 3MNLA 4CGRA 4A3LJ 3KKCA 3MN2A 1ZKGA 2R5ZA 1T56A 1ETQA 2EBIA 5EZHA 1IUFA 1W0TA 2G3BA 5D1RA 5IP6A 4QTRA 1A6IA 4IHYA 2OERA 3BHQA 1S7EA 2G7SA 5K7ZA 5FMPA 3VVXA 3SDGA 4XRSG 3UKGA 2UXPA 1GV2A 1APLC 4DZPA 4XK4A 1UI6A 2I10A 5DAJA 1UG2A 3OSGA 4JKZA 2LY9A 4BBSJ 2GUHA 5IPAA 3OOUA 3S16J 1F43A 2DMUA 3S1RJ 1I3QJ 2R7ZJ 2AHQA 2EZKA 4MO7A 3JREA 1Q1VA 1H89C 2ZCNA 4DYCA 4GCLA 3TEDA 4X6AJ 2NX4A 4NELA 5FLVA 2LLKA 1JJ8C 4I6ZA 3LJLA 3QBMA 5C4JJ 1JTXA 1JKRC 3FIWA 2E2JJ 3ON2A 1FTTA 4ABZA 1U9OA 4B3AA 2ZCMA 2HQ5A 1Z77A 2K40A 2XPWA 5IP7J 2QF7A 1MSFC 2DA7A 2EZLA 3GZIA 1ETVA 1ETXA 4UDSA 1YRNB 4V2GA 1UHSA 3LSGA 3A01B 2W53A 5F27A 3BJBA 1FTZA 3ZQHA 3BTJA 2Y31A 2O7OA 5CXIA 2CQQA 5M5YJ 5IYCJ 5FGLA 2O7TA 3HOYJ 2QCOA 3HTHA 4QSHA 3EUPA 1RKTA 1ZK8A 3BTCA 3G7RA 2QWTA 4JX5A 1B72B 2WAQN 2REKA 3BNIA 4DYQA 3LHQA 2KT0A 3EGQA 2GFNA 3FK6A 2EQRA 3MKLA 2X48A 4UUTA 2MGQA 5IOZA 1BJZA 1TWCJ 1IV6A 1ETOA 1LFBA 1JTYA 1G2HA 3GTLJ 5IP9J 1JUPA 1OFCX 1BL0A 1QVTA 3CDLA 3QPSA 2LFBA 2DA1A 2P81A 3BG5A 2CQXA 1JKOC 5K58A 3CRJA 5K7FA 3BQYA 5F1JA 2G7GA 5M5WJ 4CYCB 3D1NI 5C4XJ 4LOCA 4BBRJ 2R93J 5E3OA 2VKVA 3VW2A 4D5FA 3S2DJ 3VPRA 4JYKA 4B4CA 5C3EJ 3K2AA 3PO3J 1X2MA 5JLWA 3S2HJ 2XGEA 1MH4A 2WB1N 2R0QC 1YRNA 1PUFA 4C3IJ 2E2IJ 2HI3A 1LE8A 1IG7A 3BCGA 1JUMA 5C44J 3G1LA 5F0FA 5GPAA 3BR6A 2ME6A 3ZOBA 3F1BA 3C2BA 3M3YJ 2L0KA 3FISA 4MK6A 9ANTA 4BY1J 2G7LA 1OCTC 2YUSA 1GDTA 3KZ9A 3BR0A 1ZTRA 1HF0A 5EGOA 2NS8A 4AF5A 5K7HA 3P9TA 2F07A 4ICHA 3NXCA 3O60A 3T6NA 3NNRA 1WH7A 2JK3A 2OPTA 3VW1A 3KNWA 2HOSA 3E7LA 4RDUA 4GFKA 2GBYA 3BR5A 3CCYA 2JA8J 2Y30A 2M0CA 1EF4A 5C4YA 3M4OJ 3TW6A 4AYBN 3VIBA 5JLXA 5F04A 2XB0X 4A3KJ 1FEXA 2IU5A 4BXXJ 2WUIA 3S14J 3FRQA 3GBGA 1RETA 2NVQJ 3VVYA 2DMQA 3JRHA 4A93J 2TRTA 2XRLA 2L7ZA 3HB9A 4RBOA 5FHPA 3IUVA 1JUSA 2FX0A 5HBUA 4GCTA 2NVTJ 1MBFA 4FTHA 1FIPA 2R5YB 2TCTA 5J3LA 4M6VA 5EG0A 1ZQ3P 2JMWA 2XSDC 5CXGA 4GFBA 1MBJA 1ETWA 2FD5A 3JR9A 2DA4A 3GTKJ 2LP0A 2W48A 2UXHA 5DTDA 3COLA 2LKXA 2HOTA 3HKZN 4MFDA 4GCKA 4D7MA 3NAUA 1BW6A 4IHWA 3E7QA 3O8GA 1H88C 3RQIA 1BA5A 5E3LA 1HDDC 3PASA 4PXIA 2D6YA 1T33A 4Y52J 3IH2A 4A3FJ 1E3OC 2VI6A 3ZQIA 4A3IJ 2V57A 2GM4A 4DYRA 3HOUJ 1UI5A 3HGGA 5DS9A 1LFUP 3RZOJ 2DN0A 5D19A 1WH5A 2EZHA 1LE8B 2QOPA 1PUFB 3HOVJ 3ANGA 5M3MJ 1K61A 1RESA 3QKXA 3HGYA 1MH3A 5J1UA 3IV5A 2CUEA 1IDZA 3HBLA 1TWAJ 2HYJA 2X6OA 2YVHA 4M3GA 1IRZA 5GPCA 4D5CA 1F36A 3JRBA 2NP3A 4W97A 4CYCA 3LSPA 2FBQA 3NRGA 3SFIA 5IYBJ 3PO2J 3VP5A 4NDLA 2O8KA 2ID6A 5GP9A 4MXMA 3VW0A 4AUXA 4M3DA 1TWFJ 4B1RA 2DMNA 2N8GA 4X1EA 5HAWA 1IJWC 1B72A 2ECBA 5HODA 3K7AJ 5M3FJ 3C07A 2JA6J 1RKWA 5EG0B 4Y7NJ 3Q0VA 2FQ4A 1OJLA 4JP0A 3JRFA 3G1OA 4BKXA 2M34A 1NTCA 4M3EA 2JWTA 4I76A 1JGGA 5FKMA 3LNQA 3BTIA 2HXOA 3A01A 4V2FA 2E19A 1XC5A 4A3EJ 3HE0A 5EDNA 5CW8A 1SGMA 4DZJA 2DG8A 1A5JA 5EFYA 1VF9A 3GTGJ 2WGBA 5EF6A 4HKUA 2WV1A 1TWGJ 2HDDA 5IYDJ 4NN1A 1VFCA 5M5XJ 2L9RA 2DMTA 3PM1A 3GTPJ 1AHDP 2COBA 1JJ6C 4S0HB 2ZOYA 2OF7A 4D7NA 2DA3A 1SANA 3S1NJ 4JNNA 3BTLA 2O9LA 2B63J 2M9HA 3W6VA 1P7JA 4IHXA 2HXIA 3S1QJ 1QRYA 3S17J 5H9TA 1VI0A 4QIWN 3Q0UA 3TW7A 5FLMJ 3RKQA 3JRIA 3BG3A 3IH4A 3GTMJ 1MBHA 2MSYA 2GLOA 2DA6A 1I6HJ 1MBEA 1MSEC 4C2MJ 1Y1VJ 1QPIA 4A3JJ 1ITYA 1AKHB 1ETYA 1Y1WJ 4DW6A 5E3MA 1OCPA 2ECCA 2R5ZB 1FJLA 3HTIA 3ON4A 3Q3SA 3SJMA 5FJ8J 1UMQA 1WCMJ 3GEUA 1CQTA 2DJNA 1JT0A 1TWHJ 2LTPA 1ZGWA 3BR2A 3KKDA 3LSJA 2NOGA 1B8IA 2ME0A 2DA2A 1XG1A 3HTAA 2MW8A 2L7MP 4ACIA 1RR7A 3BT9A 2PMZN 5EEAA 3VVZA 2IBDA 3CQZJ 3GTOJ 2E2HJ 2LVSA 1GVDA 2M8GX 3TP3A 4A69C 2RHAA 2XDNA 3S5RA 3CMYA 3ZQGA 3GTQJ 3B6AA 1TC3C 5D18A 4L5EA 1X58A 3MVPA 4C3HJ 3VOXA 3VOKA 2Y9ZA 3WHCA 5F0CA 2Y0SN 2IEKA 3S15J 4BY7J 2R92J 4A3MJ 2NVYJ 2UXIA 5FKKA 1AKHA 1RPWA 3JRAA 3HOXJ 2ID3A 1MBGA 3HM5A 3F0CA 1JKQC 1Z0XA 2RASA 5J1YA 1IDYA 1MBKA 3H0GJ 2ZCXA 1R9TJ 1IGNA 1WI3A 1MNMC 2UXOA 2K9NA 3B6CA 1DU0A 2NVXJ 3AQTA 1ORKA 3CWRA 2CU7A 3HDDA 1H8AC 2NS7A 2K9SA 3LSRA 1ZR2A 4L62A 2DMPA 2VKEA 1WPKA 5FKOA 2QTQA 4MFEA 3ZQFA 2RAEA 3ZQCA 1W0UA 1GV5A
chains in the Genus database with same CATH superfamily
1T6SA 2XAGA 2G0EA 2JRMA 2P0WA 2VJ4A 1EH8A 5LGUA 2FJI1 2DOFA 2JA7J 2W7NA 2BY0A 3K0LA 4GGGA 3WTUC 3OYAA 5DUIA 3GYHX 4HDUA 4FETA 1FYKA 1X3WB 3HC7A 3TP0A 4I2OA 2LD5A 2WY7Q 1U2WA 3WODF 1QZZA 4F52A 2V6CA 3HOZJ 2J5OA 3WTWC 2P7VB 3KP3A 2ZJRF 3OIOA 5FD5A 3SZGA 3T8RA 1H0MA 3BY6A 2O0YA 3LSHA 1P2FA 4A3CJ 4BXFA 4U0WA 2OTLI 1ACIA 2A07F 2EH3A 5FD6A 1SFOJ 3ELKA 4XBFA 2OJED 1D1CA 1JT6A 2FF4A 4O5VA 4X0GA 3HL2A 3DPJA 4GFLA 4G8XA 3LA3A 4IHTA 4FISA 4EM0B 3I5UA 4XICA 2VBXA 4HV6A 4HNVA 2JA5J 3F72A 3KP6A 2K86A 2YX4A 3KX2A 1KQ8A 2X0LA 2M2EA 3M7GA 3FM5A 1NK3P 2DAOA 2XGDA 4HF0A 3S2WA 4XIDA 2GOXB 5E3NA 3ABTA 2HVQA 4N4NB 5KNLA 1SFUA 5E8GA 3CJRB 2MBFA 1FBUA 2X6YA 2VOOA 1R5GA 4C3JJ 2JTVA 2QYOA 4UV9A 2M7AA 4F92B 5H6RA 2HKUA 4N0BA 3SYTA 2XPUA 3RJPA 2MFZA 1ZG1A 3NWSA 2JPCA 2HTSA 2E1OA 2HZTA 5KHDA 4U9NA 1GUUA 4CA0A 3RKYA 2ZMEC 3V8JA 1FIAA 2Y9YA 1VNDA 4A3DJ 2WB1A 4I7HA 2YX7A 3I4MJ 1IC8A 2V1NA 4XLHA 4XRSA 1U78A 1O4XA 1KGSA 2DFIA 3LQRA 2ELKA 5E79C 5LHHA 2B3WA 1G3WA 2D1HA 2E35A 5TRDA 5EJCA 3PQJA 2K9QA 4R8HA 4RM2A 1FMVA 2QSFX 4XRMA 3GMEA 1X1AA 1DDNA 2YU9J 2L9VA 2YS9A 3GO5A 2V79A 3J80Z 1ZREA 3RH2A 1HXDA 2LF7A 5FGMA 1YITI 1WWXA 1B8IB 3PPBA 3FHZA 1BR1A 4G6TB 3GTJJ 2M0MA 2JQ7A 3GFMA 2KFDA 3CUOA 2W24A 5F64A 4IHVA 3HIMA 2QQ8A 5EZGA 4UHTA 2MD5A 2MG4A 2F5DA 2LR8A 3H3VK 2PBXA 2COMA 3M8JA 4EQQA 4A3LJ 3HRTA 1HA8A 2ZMEA 2A5WA 2QKMB 4L9NA 2CWEA 2R5ZA 4KFCA 3EUHC 1ETQA 1W0TA 3AG4H 4QTRA 1A6IA 4IHYA 1IN5A 4IVNA 5LHIA 2PMZA 1FPQA 5A2QK 3VVXA 3SDGA 4I0AA 3RQ4A 3OR2C 2JSCA 4KJZA 4JKZA 2LY9A 4O3MA 4AIHA 4YFNF 3BJAA 2DFEA 4G7ZF 1WZ2A 3CUQC 1SVOA 4GCLA 3WU1B 4DYCA 1EH7A 1YYVA 2XAJA 4B43A 3FXLA 1JGSA 1U8RA 2KKOA 2M7BA 3ZPLA 3QBMA 5C4JJ 1UHWA 1JTXA 5D5VB 2HQNA 3MQ0A 3ON2A 1D8KA 4CH7A 4ETSA 4ABZA 4B3AA 1FTTA 2ZCMA 2IPQX 1Z67A 2VC1A 4CCOA 2V7FA 2QF7A 4ZDLA 3GZIA 2B0LA 4Q4ZF 3ZN1A 1K78B 4I0BA 1YRNB 3TDZC 2W53A 2OCEA 4CSWA 2BXZA 4HEA2 4P5OA 3VYUB 4L18B 1V5EA 1YG2A 3BTJA 4HX8A 3PFIA 5IYCJ 1O3RA 2VIXA 3K4CA 3VB2A 2QCOA 3V4GA 2IT0A 3PSFA 2M4KA 4ZTFA 3FF5A 2OD5A 2R7RA 2OQRA 4QSHA 2BBYA 5FLXK 1ZK8A 3G7RA 3TKYA 2REKA 1H9GA 3CCSI 2DO7A 3LHQA 4OOIA 3EGQA 2GFNA 5IOZA 1TWCJ 2EFQA 2DQRA 5CVUA 3RPQA 1BC7C 1JTYA 4BU2A 1G2HA 4LIVA 3CDLA 3QPSA 4II2A 5K58A 2UZKA 4BEHA 3KYLA 1ULYA 1Y8RB 4XSZF 5ED4A 4PGHA 3EUAA 2VBWA 2D2WA 2CV0A 3P9CA 5CVVA 2R93J 2VKVA 4BUPA 2AQFA 3ZMZA 3DKYA 4D5FA 4AWXB 1WFXA 4MHGA 5C3EJ 3S2HJ 2XVCA 2WB1N 4C3IJ 3CZ6A 4ZC3A 4LLNA 1FT9A 4BACA 4L0ZB 3E0JB 3C2BA 3TO6A 3M3YJ 3I58A 4CO8A 3FISA 1QHHD 2G7LA 3BPXA 3CO6C 1L0OC 5KK1A 1HF0A 4RAGA 5K7HA 3QU6A 4ICHA 1D0YA 4GXOA 5BOXA 1DGRM 3F23A 1P92A 1F4KA 2DODA 3SWHA 5DCFA 3COAC 3VW1A 5HS7A 2VPLA 3KNWA 3BDDA 3E7LA 1SAXA 1SMYF 1XSDA 3HSFA 4M72A 4NUBA 4ENMA 3M4OJ 3V7SA 4AYBN 2CFOA 5F04A 1FEXA 4E7KA 4BXXJ 2FE3A 4PFPA 5LBQA 2PX9A 2HVSA 4ZYHA 3OWTA 4CCMA 1LQ1A 1R5ID 5J40A 2XRLA 4FT8A 1YQAA 2HFHA 4GCTA 3HTUA 2V1DA 2ZC2A 2GIVA 1MBFA 4FTHA 2GWRA 2R7QA 2KLOA 2TCTA 5EG0A 4Y3OA 3AAFA 4A12A 4UVAA 2XSDC 4GFBA 3R0JA 4RMNA 1N78A 2QEXI 2LP0A 2WAQA 3QWLA 3CF2A 1CGPA 2W48A 2UXHA 2EIMH 1TQMA 3R6SA 5D4RA 2E1CA 4L9VA 4QPQA 1C0WA 2DYRH 3AG2H 4MFDA 1I27A 4LLLA 4IHWA 3E7QA 5H6QA 3O8GA 4WF2A 3S3NA 3CUQB 1OYIA 4P9UA 1HDDC 2M87A 1J75A 3KETA 4L9JA 2RKHA 4AU7A 4A2UA 1KYZA 1YTYA 4A3IJ 2Z9OA 2DT7B 2K4BA 4DYRA 2PFVA 5K1YA 2ZNYA 3HOUJ 4BDZA 2DN0A 3OYNA 4PZJA 2LF8A 3MZHA 2W82A 5L3EA 5M3MJ 1K61A 4NNJA 1R22A 1YOVB 3DBRB 1R6RA 4XMYA 1IDZA 2HYJA 2BVMA 2X6OA 5HS8A 4D5CA 1F36A 3J81Z 2IGMA 2LY1A 4DBRA 3JRBA 4CYCA 2ESHA 4RAFA 3NRGA 3J81K 1QHGA 1VQMI 3J7YJ 2O8KA 4Q48A 1N75A 4AUXA 4M3DA 3LA7A 1VQ9I 4YELA 3DU6A 2EWNA 1VQNI 3SZPA 1QQIA 4ESJA 4ESBA 3Q9VA 3JAMZ 2R7XA 1LDDA 1OQYA 4AYBA 4UB6C 2DT5A 3T8TA 3DXJF 1OYWA 3K7AJ 5HODA 3OYJA 5L3CA 3C07A 3VEPA 3GEZA 3Q0VA 3DBHB 3M1CA 4JP0A 1OJLA 3ZCOA 3JRFA 4BKXA 1J09A 2KL4A 4I76A 2QSGX 3BOQA 3CD6I 3LL7A 3TL4X 3A01A 3B73A 1WJDA 3FWEA 5GAHJ 1BBYA 3G3ZA 4II3A 1W4MA 4XLAA 1X1CA 3PL8A 1SGMA 2I5UA 2DG8A 1ZG3A 5EFYA 1VF9A 2KQRA 4HKUA 5EF6A 2WV1A 3I59B 4HYEA 4XKCA 4ZYDA 1U6GA 2LNBA 1KONA 1OCRH 1R1UA 3RIRA 5IYDJ 1P4AA 5CJ9A 2QBYB 4MNUA 5M5XJ 1LEAA 1R5HA 3PM1A 1SEUA 3L2UA 3I53A 2ZOYA 1ON2A 4LK0F 3PSIA 3Q5FA 3BTLA 5DEQA 1YW8A 2MH9A 2M9HA 1G8XA 3W6VA 4IHXA 3H0DA 3S1QJ 4YFXF 2DDBA 5FLMJ 3I4PA 3JRIA 3DKXA 3MWMA 4NC6A 2YPRA 3A2KA 2FMYA 1Y39A 2VC0A 1FLIA 4UB8C 5CLSA 2D45A 3OYMA 3RYPA 4A3JJ 1ITYA 4XLPF 1AKHB 2C6YA 4DW6A 4GCVA 5E3MA 2DU9A 4JQFA 1GXQA 1UCRA 2VBZA 3FXUA 3ON4A 3Q3SA 1F1ZA 3EUHA 5D8KB 1IF1A 4IXAA 3WE3A 2V4JC 3K4BA 1K4TA 1CQTA 2WWYA 4CCKA 1NG6A 3IAM2 3K8PC 3KKDA 1TW2A 4NQWB 4A0ZA 1W5CC 3RKWA 4B09A 5LD2C 3HTAA 3T5XA 4MEXF 3F8CA 1ZRFA 4ACIA 2PMZN 2JT1A 4ANJA 2IBDA 2UUZA 5FB2A 5FFXA 2PBIA 3D5SC 4CICA 2X4HA 3MKZA 2E2HJ 2OBPA 3K1NA 1JHFA 1KA8A 3S5RA 2RHAA 4ON0A 1SFKA 4PUSA 3BCAA 3GTQJ 4XLFA 1TC3C 2E60A 5D18A 2DOEA 1X58A 4C3HJ 3DPUA 1BR4A 3VOKA 3F6VA 4IF4A 5F0CA 2L3DA 4MEYF 2Y0SN 3OL4A 2GXGA 1ZGAA 1T38A 3ABUA 4M6XA 5FKKA 1AKHA 1RPWA 1JHHA 2L54A 4D9JA 2XROA 1MBGA 2VJJA 3LFKA 1T39A 4ZZLA 1X1DA 4ITVA 4ZJZA 4HQEA 2CUZA 1R9TJ 4WIBA 1FYLA 1XTAA 4S05A 1U0JA 3N97A 5ICCA 2VE9A 5CQGA 3VOEA 3CWRA 5E18F 1Y8QB 2EPFA 2K9SA 4L62A 3TOAA 1LEBA 4R1HA 5K5RA 2DMPA 1XMAA 1SFXA 2CO5A 4M73A 2O61A 4MFEA 2RAEA 3ZQCA 3G2BA 1GV5A 1ONVA 4IRVA 2VT3A 2ELHA 2NYXA 3CLQA 1T0FC 2AO9A 4M3BA 1XGOA 4XR6A 5EEHA 1DU6A 1VQ8I 2LREA 1K79A 4A6EA 4YZEA 1J59A 1ZAOA 2DLLA 3NEUA 1TT0A 1EV7A 4MLOA 2QGUA 4IJAA 2VUMJ 4DQ2A 2W57A 3BRUA 1MNDA 2ZOZA 2VPRA 4N4OB 1AU7A 3QPLA 3IKVA 4KMFA 3AL0B 5E20A 4KN7X 2F5CA 4M3FA 5D5XB 3HSRA 3DCFA 1BOBA 4BYYA 5LFAA 1YJNI 5A2QZ 2F5VA 3LQQA 3WTSC 1N25A 3CMMA 4A3BJ 3TOBA 3Q0WA 4KICA 1SD4A 3BQZA 1K83J 4EJTA 3IWZA 3QPTA 3FHNA 4OAZA 3MKYB 3P5JA 4MIMA 4UUSA 2RGVA 3WHBA 4AVPA 4Y17A 1LB2A 1WGXA 2P7CB 1IXCA 2HYTA 3IWFA 3LSKA 3LSTA 5FROA 2CQ7A 2DFHA 5HLHA 1Z9CA 1YS7A 2M5WA 1ETKA 2FJ1A 3U9GA 4F7ZA 3KP5A 4B44A 3S1MJ 5J1RA 4AC0A 1X2NA 2DA5A 2DPDA 1U9NA 1MDMB 1FOWA 2Z2SB 2XDVA 2JJ7A 1HKTA 1QVUA 3CF5F 3NI7A 2QLZA 4KWAA 4OD4A 2EFNA 4GRIA 3A0BC 5FRNA 4GDFA 1BW5A 4G9YA 2HS5A 1PDNC 2DI3A 3CUQA 2Q2EB 3FKIJ 4UY8I 2QQAA 2X9DA 3KLOA 1OKRA 2Y0SA 2VBYA 2MABA 4IEJA 3N4MA 5CQEA 4FCYA 1I50J 5F08A 2OA4A 3ZMDA 3JAMK 2H8RA 3L9FA 3ASNH 4KDPA 1HDPA 3OS2A 2QUFA 2GENA 1USSA 2HOAA 3BZKA 2CRGA 2R5YA 1IXSB 3I4NJ 2GZWA 4JBAA 4RLFA 3EDPA 5LRRA 3GZNB 2IXSA 1T56A 3FXKA 2G3BA 2AXLA 1IUFA 5D1RA 4HG2A 4M9ZA 3PNYA 4LITA 3BHQA 5FMPA 5KCMA 4YG2F 3DTKA 5K7ZA 1ZRDA 2RN7A 3UKGA 2UXPA 2NAZA 4BS9A 4XK4A 3PFYA 2EA4A 2I10A 5DAJA 4N9IA 3OSGA 3VFZA 5LGNA 4ESFA 4AIJA 1OPCA 4ENNA 2GUHA 2CV1A 4EJUA 3OOUA 4AD9A 1UELB 1F43A 5HLGA 2AHQA 3JREA 2KIFA 4A6DA 2VQCA 3TEDA 4ZDOA 2NX4A 5E8IA 4Z2YA 2BHYA 2LLKA 1ZYRF 2BHZA 3K1PA 1JJ8C 3LJLA 3GXOA 3MAJA 4BQQA 4HF1A 5GTIC 2V1XA 1REPC 1Z1DA 5IP7J 4J01A 1ETVA 1BR2A 1ETXA 4V2GA 5J47A 1TQPA 1YS6A 4C2MA 2FRHA 3BJBA 5TGTA 1FTZA 3ZQHA 2A2FX 1RNLA 2O7OA 1QZEA 2VQLA 4RAZA 4OMYA 1FZPB 3C18A 3TO7A 3I64A 3HTHA 3EUPA 3C7JA 2XKPA 1O3QA 1PUEE 1B72B 3BNIA 3QP5A 2XF6A 4DYQA 1LDJA 4WXCA 1XDSA 2KT0A 1M1EB 3FK6A 2EQRA 1J2XA 3OYEA 1GXPA 5E1ZB 1MZBA 4BAYA 2ZJ2A 1IV6A 5DUKA 3E5XA 1BL0A 1YJWI 2LFBA 5HNHA 2P81A 4U7DA 2K3PA 3BG5A 2W00A 1RRJA 1JKOC 3TGNA 3CRJA 3KP2A 5M5WJ 1IN6A 4FASD 4CYCB 5C4XJ 3K2ZA 4ZTJA 3AG1H 4BBRJ 2HU9A 5JVTA 1ZG5A 1AOYA 4JYKA 4C2UA 5JLWA 5AIPA 1MH4A 1YRNA 2HI3A 5DDGA 5C44J 1RUOA 2ME6A 5GPAA 3BR6A 5BPIA 1K7AA 3F1BA 1IN4A 3F22A 3I54A 2L0KA 2NRAC 1OCTC 2V6EA 2YUSA 3BR0A 3HRMA 2NS8A 4AF5A 5LRSA 4HBLA 3NNRA 1WH7A 2LC2A 2JK3A 2VXZA 4B8XA 3F6OA 3B02A 4FX0A 1SC7A 4YIIA 1QA6A 2GBYA 4U9LA 3BR5A 3CCYA 1BI1A 1Z05A 2JA8J 2IGNA 3REOA 4BE0A 3I9V2 2Q1ZB 3TW6A 4UUVA 2ZFWA 5JLXA 2XB0X 1HSTA 2LMDA 4G6DA 3ECOA 3S14J 3P9IA 3FRQA 2E1MC 3H9GA 3VDXA 3ERED 1T8IA 2DMQA 3W2AA 2QQ9A 2FOKA 3EQLF 1ZRCA 3OYKA 2TRTA 3HB9A 2JVHA 4ZDPA 1J7KA 2IS1A 1JUSA 3E5QA 3WG7H 2CGPA 5J3LA 1ZQ3P 1LVKA 3OYDA 4Y15A 5CXGA 3KZZA 4P96A 3ZMUA 1S3JA 2FD5A 1FBQA 3JR9A 1S9HA 4UV8A 2KIUA 3E5UA 1ODDA 3FX3A 4CCJA 1V4RA 5DTDA 2ZKZA 2QWWA 2LKXA 2DT6A 3HKZN 1QU3A 2CW0F 2BY2A 1BW6A 1R58A 2PQ8A 1H88C 2RV8A 3RKXA 3PASA 2BYVE 2Z16A 2IGOA 2D6YA 1BOAA 3K4JA 2MD0A 4Y52J 3GF2A 3IH2A 3K70D 1I3AA 4LD5A 4A5MA 2M1BA 3X2QH 2VI6A 3ZQIA 1O3SA 4F91B 5ICEA 1B6AA 3ABMH 3ASOH 4HOBA 3ZN0A 5HS9A 2DK5A 5DS9A 5D19A 4GYIA 5HLTA 2EZHA 1PUFB 3ANGA 5ILSA 2HZDA 2HWVA 2M45A 2JUCA 1IRGA 1E0EA 4XN3A 4PK4A 3IV5A 3FBNB 2KRCA 1I5ZA 4CCNA 4XNFA 1TWAJ 3KZIC 1D5VA 3CMAI 2HPMA 2A6HF 3TQNA 3E6BA 2FBHA 4W97A 3LSPA 1Z7UA 1E3HA 1FP2A 4BEHB 1QO0D 1R4NB 3TO9A 2ESNA 3FM3A 4EVIA 4NDLA 3FKJA 3JTHA 4MXMA 2L9SA 3I71A 3R0AA 4BNCA 2N8GA 1STZA 5J8CA 4LG0A 5JFRA 2IS2A 2ZO4A 1DGWY 5E1XA 5GTHC 1X19A 3ROUA 2ECBA 3BZCA 1E17A 2JA6J 1RKWA 3AKZA 1X3ZB 1A36A 1BJAA 3DTIA 3G1OA 2R4GA 3F8FA 3QYEA 3S3MA 2JWTA 3FXRA 1V5FA 1Y6IA 1D0ZA 3LNQA 3HKZA 1WHUA 2HXOA 3M1EA 2FSWA 1DP7P 1WVRA 3DF8A 4V2FA 3AL0C 2E19A 1XC5A 5EDNA 4Q5SF 2IA0A 2JA2A 3CDIA 4G6QA 2Z99A 4KT6A 4HZFA 4KIGA 3QPHA 4PGGA 3I3LA 4S04A 2VKHA 3ECHA 1VFCA 3CCMI 2DFFA 2F6CA 3GTPJ 1AHDP 2COBA 1JJ6C 3LMMA 5D6FA 4S0HB 1LPQA 1PYVA 4I09A 3CCVI 4LB5A 1SANA 3S1NJ 3M8EA 3CCJI 3J7AY 1S7AA 1QRYA 2DBBA 1XGNA 4BH9A 1GVJA 4ZH4F 2Z33A 2L02A 1SFEA 1VI0A 3DEEA 3Q0UA 3S17J 5H9TA 3ESWB 1RIOH 1BI3A 2DA6A 1MBEA 2KJBA 2P8TA 1ETYA 4PJNA 1W7PA 1OCPA 3UR3C 2OTJI 2KP6A 4MQ9F 4XSXF 1UZCA 1W7PD 2ECCA 2R5ZB 1FJLA 1XGSA 3EYIA 1K6YA 2PMHA 3ABLH 3OOPA 1U3EM 2ELJA 2STTA 1R7JA 2KZGA 1VQ4I 4H0EA 2P5VA 1JT0A 2G7HA 3BR2A 1LDKB 1B9NA 3L09A 3CTAA 4YFKF 4A0YA 3RPUA 4IRHA 3SDBA 1KYWA 2ISYA 4BHCA 4U0YA 1JE8A 1QZYA 5IT3A 3PUFA 4RB1A 3MZYA 3VVZA 3FMRA 3HTSB 3U1KA 4U7BA 3DU5A 3CQZJ 4OIPF 2PEXA 1IW7F 2Z1DA 3GZ5A 1LKXA 1P6RA 1SAUA 1FMWA 4RGRA 3HRSA 3B6AA 3BPVA 1V3FA 1ZN2A 2M3AA 3W3CA 1VTNC 2VOPA 2A3SA 2IS6A 2OZ6A 1LJ9A 3V7CA 2FOWA 2Y9ZA 4B48A 3KCCA 3NRVA 3S15J 3WTXC 4D0PA 5BMZA 2OV7A 4A3MJ 1TQIA 4BL0B 1HW2A 3F0CA 2RASA 3QYFA 3KEOA 2JVGA 4BDYA 1MBKA 2IW5A 3RDIA 3BLYA 2ICWG 2E7XA 4BQOA 2ZCXA 3AG3H 1W36D 2UXOA 4QWQA 2K9LA 3B6CA 4IQJA 3OYGA 2VJ5A 1ZLKA 2XC7A 3FXOA 4UVBA 3HDDA 3LSRA 4CUGA 3QODA 1G4DA 3IRQA 3VTIA 2VN2A 2VKEA 1WPKA 4KN4X 3QP6A 2DJIA 3ZQFA 2FXAA 2EV5A 4KYWA 2JUGA 2L7FP 4JL3A 3JW4A 2VE8A 1U8BA 3CJDA 2KDZA 1P9QC 3O8HA 3ZR8X 2XGCA 2FU4A 3PNTA 2K9MA 4ME9A 4I98B 3LSMA 2PN6A 4FE4A 2Y69H 3H5AA 1DPUA 3H1CA 2Q24A 2D5VA 1HSJA 5AIQA 1KU7A 2HTJA 1DP3A 1FNNA 4EMSA 4JOMA 4IRGA 1KZHA 2FUG2 3QQAA 1HCRA 2CJJA 4FX4A 2Y75A 3EYYA 3WTZA 1XS9A 4C30A 3HPGA 4IPAA 3MMYB 3RD3A 2JN6A 1WJ5A 4EM2A 3B81A 1D0XA 2OZUA 2RNGA 1D5YA 3C2GA 2UXUA 2PJRA 1YW7A 4LLGF 2XB5A 2PZ9A 3M07A 3V78A 4IX7A 2BE5F 1JKPC 2X1CA 5IY5H 1D1AA 3JRCA 4CCLA 3L2RA 1MDMA 3GVAA 1R00A 2XUBA 3L1PA 5HSZA 1G3TA 1BIBA 1NK2P 4EEFG 1R23A 2R7OA 5F1RA 2JPBA 2H1KA 4ENJA 4AC6A 2ADUA 3NARA 3RZDJ 4RGUA 4A5NA 5IOYA 1FSEA 1X1BA 3OY9A 4FQGA 3CC2I 3PJRA 1ZH5A 5BNGA 2IAIA 3CO7C 2R7VA 1S29A 3G1MA 5FFZA 3FK7A 1ZGJA 4G12A 2QSHX 4UUSB 2XSJC 2Y2ZA 2ZSHB 4IL6C 3G6EI 2B7EA 5DD8A 3AQSA 4BE1A 3A02A 5D5WB 2HKOA 2QKOA 3I0TA 2HDCA 1HW1A 3HIFA 4JX4A 2KMUA 2LY2A 3DEWA 4CDGA 2LBFA 4CZCA 3LWJA 2ZB9A 3HHHA 3D5RC 3A03A 2ZCWA 2Z5UA 3DFGA 1KQ9A 1B1BA 2LYCA 3WTYC 3LOCA 4C2TA 3P7NA 3FXQA 4A0XA 4PDKA 4XRFA 4E7JA 2QENA 3PNVA 3OS1A 2LSOA 3BG9A 5CYVA 4OU0A 2E1MB 2H94A 2IJLA 1W1WE 3NPIA 2EZIA 2MLGA 2F4IA 4BQNA 4CGRA 4LJZF 1P4XA 5K5QA 3IP4B 1AWCA 3KEQA 1ZKGA 3OYHA 3E1SA 5EZHA 1MNEA 4RGSA 5IP6A 2UXXA 2OERA 3VYTB 4YIRX 2H1LA 4HLYA 2R7SA 5ILUA 5BPDA 1GV2A 4NBQA 1APLC 3ZP5A 4XKWA 4DZPA 2XRNA 1F5TA 1UG2A 2FEZA 5LEKA 3L2VA 1YHQI 3BP8A 5IPAA 4F93B 2BV6A 1DQUA 2ISZA 3CCUI 3S16J 2DMUA 2EILH 3M8FA 2DYSH 1I3QJ 2HNHA 3H3ZA 4G7OF 5JVGF 3QRFF 1Q1VA 2ZCNA 2VASA 2XGXA 4B3XA 4CYDA 2EB7A 4NELA 2JRTA 1FBSA 3QYBA 2ZBKA 1ERDA 3FIWA 1RR8C 2E2JJ 4RLQA 2VQGA 1V55H 4RB2C 2HQ5A 4XLNF 2BGCA 5DYMA 4PJ0C 2XPWA 2X6WA 2YU3A 1MSFC 2DA7A 2W1OA 2AQEA 1CF7B 2EZLA 3A1YA 2IRFG 2V9KA 3RCOA 2E71A 2TDXA 4YIFA 4UDSA 3LSGA 2F4MB 2XIGA 3GLXA 3DP7A 4RA2A 2M30A 1TLHB 4OINF 2O6GE 2P4WA 3HOYJ 2VL8A 5ICFA 4BJ6C 5E17F 1EH6A 2M4GA 2KJCA 1IN7A 3HXLA 2MC3A 4B47A 4AIKA 3WU2C 1RKTA 2QWTA 2WAQN 1R36A 3CMEI 1O7FA 1A04A 3MKLA 2P6SA 2MGQA 1B9MA 5DCMB 3V7RA 1BJZA 1EA3A 3H9JA 4EJOA 1LFBA 3IAS2 2K4JA 5E1WA 3GTLJ 2Q2EA 4YEJA 5IP9J 1JUPA 1OFCX 1QVTA 4OAYA 4BHPA 3CJNA 2DA1A 4XONA 2W4SA 1YW9A 2V1UA 3KPHA 2CQXA 3PIOF 1FP1D 4XOTA 2W85A 3EUKL 5F1JA 4D1QA 2G7GA 1V5GA 3RPUD 1IZ1A 3ZXSA 3D1NI 3D5LA 4WX9A 2RC4A 3BC8A 2EINH 2RVCA 4EM1A 3T1BA 3VW2A 1D3YA 1WJAA 3HUGB 1NG7A 2MA3A 4HSRA 4PJLA 2L5QA 3H5NA 5D5UB 1X2MA 3U1DA 1WJEA 1PUFA 1WRJA 2NOJB 2E2IJ 4XLCA 1V54H 4L9TA 4G7HF 1LE8A 1JUMA 3BCGA 5FGLA 3G1LA 5F0FA 2EFPA 3ZOBA 1XDUA 2PG4A 2WAEA 1WJBA 3CP8A 1VQ7I 2GA1A 4BY1J 2Y0MA 4WWCA 2UV1A 2ZNZA 3KZ9A 1FSHA 2PFBA 5EGOA 1W5TA 2O03A 2H09A 3LA2A 4L5JA 3OR1C 3VSKA 3T6NA 1T95A 4HA8A 1E2XA 1AA7A 1G6NA 2AXTC 3HZJA 3SXYA 2E7WA 3IKTA 1OLTA 2Y30A 4M9SA 3VIBA 1T08B 2BW3A 1OR7A 2W25A 3IC7A 4CZZA 3GBGA 2NVQJ 3VVYA 2HR3A 4AIDA 1Q1HA 3JRHA 4P55A 4A93J 2QKLB 1Y0UA 4RBOA 3IUVA 3LAJA 2NVTJ 2PMUA 4XKVA 2FBIA 3DPTA 1FIPA 2R5YB 1YJ9I 1KU3A 3OYCA 1FY7A 2MYSA 1X3UA 1MBJA 3OV8A 3C3WA 4L0YB 1KU9A 1ZHFA 2DA4A 4I01A 5CXIA 2F48A 1OMIA 2A68F 4EV0A 5J6XA 4E7HA 3P9KA 2A6TA 4BQAA 4GCKA 1XSVA 1G3YA 4BXUA 5DM6F 4CGZA 2OUMA 3HG9A 3KP7A 1FOKA 1J9IA 1BA5A 1R71A 4NB5A 3PIPF 2CV2A 4O6JA 6PAXA 1YIOA 3GX4X 5AONA 5L3BA 3DWLE 3SFZA 4HDVA 2X6XA 4Q47A 1E3OC 3FXJA 3KZYA 3R60A 4E70A 4IO9F 2XHKA 3LAPA 2GM4A 1IUYA 1G3SA 3WTTC 3ZQ7A 3RZOJ 2E36A 2WV0A 4H4KC 4QPOA 2VODA 4BGDA 1RESA 2F5EA 3QKXA 3HGYA 1MH3A 3KIOA 2CUEA 3HPHA 1BIAA 3ERMA 1J5YA 3ISPA 4HRIA 1A31A 3SHFA 3GFLA 1E3PA 1SD7A 2HKXA 2YVHA 1RI7A 1IRZA 5GPCA 2XAHA 2VLAA 5FO5A 3GWZA 2FBQA 4MTEA 3BROA 4EGYA 4FHTA 2CSOA 3FMQA 1IO2A 3CC7I 3VP5A 1IRXA 4HNUA 2ID6A 3QOEA 4IZZA 1ZELA 3CESA 2X51A 5B66C 4B1RA 2DMNA 1X1PA 2FBKA 2CQKA 3VWBA 4X1EA 3CJTB 2IGKA 2VQHA 1IJWC 4ZZDA 2DPUA 5LGTA 1B72A 3H9QA 1IV8A 5M3FJ 2E34A 2F2EA 2WBMA 1WJFA 5EG0B 3MD2A 4Y7NJ 1XGMA 2FQ4A 4BE2A 1U5TB 1NTCA 3CC4I 3BTIA 4DJAA 4ENKA 3FXMA 1OYYA 4A3EJ 1GHCA 3HE0A 2P5LC 5CW8A 1A5JA 1YE9A 2ACJA 5K5OA 3GTGJ 4K2EA 1XCVA 1UHMA 2O5RA 1O57A 2HDDA 1BI2A 4NN1A 3DPLC 2EV0A 3ZGKA 2RNJA 3DEUA 1S6LA 4KT5C 3GFIA 2OF7A 2DQLA 2MLKA 3S32A 5L3GA 2KDOA 3S93A 4D7NA 2DA3A 5JR3A 3WTVC 4JNNA 2O9LA 1RUNA 1P7JA 2R7UA 3GW2A 3F8BA 3LFUA 4HLXA 4KITB 4QIWN 5JI6A 3F9KA 3I59A 1VZ0A 3TW7A 4DGWB 1JXSA 3U2RA 3RKQA 3BG3A 3IH4A 5TJJA 4E7SA 2MC4A 3OYLA 2GLOA 1MGTA 2HEOA 1I6HJ 1X4OA 1MSEC 4C2MJ 1QPIA 2B1EA 4RB0A 1Y1WJ 3HOSA 1LFPA 1MJ9A 2EJRA 4DNCA 2K27A 3HTIA 2GXBA 5HDKA 3O3KA 4U88A 4BHBA 2KRHA 5FJ8J 2LRDA 4RGXA 1WCMJ 5J4VA 4LK1F 1TWHJ 1XSXA 4C9YA 2LTPA 1ZGWA 1MMSA 2HQAA 2NOGA 2LKSA 1XCBA 3L00A 2DA2A 1XG1A 3L2QA 1T0FA 2BOLA 3OYBA 5EEAA 3ZMVA 2KRFA 4MQVA 3TP3A 1RC9A 2UWMA 2XDNA 4CXFA 4ZYEA 1VQPI 1UFMA 1GLNA 1NHAA 3QOPA 4L5IA 4L5EA 2I8DA 3MVPA 1R4MB 2KPMA 3VOXA 2Q0OA 1I1SA 1B59A 4HX7A 5KVRA 1LNWA 1KU2A 3WHCA 1S72I 3ABKH 2KIMA 1YI2I 5KAIC 1K6OA 5CPRB 5HDGA 2A61A 2R92J 3BWGA 3HOXJ 1JKQC 3HM5A 1RZ4A 3G71I 5ILVA 1IDYA 5J1YA 3H0GJ 1IGNA 1HKSA 3OIQA 1PVEA 2ZXJA 4M6YA 1I1GA 2RREA 5F6FA 2K7LA 1LUJB 2NVXJ 1S8NA 3AQTA 1ORKA 2CFXA 3RYRA 2QM3A 4HPQA 4F55A 4I02A 2NS7A 2QA4I 1ZR2A 4Y4RA 3MCZA 3EPZA 5FKOA 2QTQA 4MTDA 1VQ6I 1MJBA 1HBXG 1TNTA 2DG7A 2L9NA 2J5PA 2L01A 2LK2A 3OYFA 3A0HC 2WADA 2RDPA 1BM9A 5CKTA 1Y0NA 2CUFA 3BR3A 4N9HA 4J19A 3HOWJ 2OI8A 3K10A 5D4SA 2ZXIA 1JI8A 2DTZA 3Q9SA 2VONA 3HOTA 2F4OB 4HNTA 2IS4A 4Y13A 1H9TA 1SMTA 2FNAA 5F0HA 5HOOA 4E7ZA 2XF7A 4JX6A 2DTRA 1F9NA 5GAEJ 1OR7C 1TP4A 1B4AA 5FKLA 3A4CA 4HAMA 2VXDA 3E6CC 1MMNA 3V6GA 3O6BB 2PLYA 3DKWA 3G4SI 1J0RA 2DXIA 2NP5A 4LMYA 4A3GJ 1XN7A 3K4KA 4QLCU 1TT5B 3NS4A 1VQOI 1HOMA 2YVEA 2HQRA 1G59A 3G73A 2X1EA 3WU0A 5H2FC 5EGOB 1HLVA 4UNOA 2O8XA 3IHUA 3C1DA 3HEFA 4PCQA 4IOAF 2PI0A 5L3DA 3F3XA 3V8LA 3GUDA 4LIUA 3MKWB 1GT0C 2VB6A 1YFHA 1WI9A 2K02A 2OCCH 3U21A 4PFOA 3JRDA 3HTJA 5FKNA 3ONQA 4FE7A 2JZYA 2ETHA 1YX5A 4OIQF 2IA2A 3WGGA 3V8KA 1QGPA 1FWZA 3K69A 3ZRGA 4EJWA 4PJJA 3J7AO 5AQCA 2KIQA 3WE2A 3G56A 1POGA 2ZY9A 3VUQA 5EYRA 3JSJA 1S5LC 3CJQB 1ENHA 3OS0A 1D8JA 4M71A 2E5NA 3OSFA 2XPVA 3I55I 2QVOA 4LB6B 2EA2A 2ZXWH 3SZTA 2H6CA 3EETA 2CMPA 2XAQA 3FBIB 3K70C 5DCMA 4E7LA 2QIBA 1PP8F 1ZR4A 2G9WA 3ZMSA 2G7UA 3IH3A 3O2PE 2CQNA 3ANPA 4DOZA 1R1TA 3JRGA 2DOAA 2GAUA 1PJRA 3BR1A 4NQWA 1P7IA 4W1UA 4Y33A 3KP4A 1ON1A 1EKEA 3VSLA 2YSRA 3ZQLA 3VYSB 3MNLA 2D1VA 3HSEA 3JSOA 3ZQQA 2DDAA 2ZXHA 4CHUA 4XQFA 1QNTA 4UXNA 1NH3A 3MN2A 4M9XA 3KKCA 4HQMA 1HQCA 2EBIA 1UB9A 4XORA 1S7EA 2G7SA 3S3OA 1SVMA 4XRSG 5HNFA 1W5SA 1CF7A 3CCRI 2BW3B 1UI6A 4UVCA 4BBSJ 4E4HA 4I99C 4IRIA 2F5FA 1I39A 3HJEA 3KYDB 1OCOH 2P5KA 5IT9K 3S1RJ 2R7ZJ 2EZKA 2BZTA 4MO7A 2HOEA 1UJ8A 1H89C 2HDWA 3H36A 1N77A 5DV5A 5J8FA 4X6AJ 4J00A 2WY8Q 3QU3A 5FLVA 3QAHA 4ZYAA 4I6ZA 3CCEI 2QBYA 1Y56A 2LDUA 1JKRC 2R7FA 4OWRB 1U9OA 2H6BA 1Z77A 2EIJH 3WG9A 2K40A 1MW7A 3KYCB 4BJTA 1BC8C 5GAGJ 2HYFA 3GFJA 5LHGA 2EK5A 4OIOF 1PP7U 4IHSA 3SEZA 2GXAA 1HW5A 1UHSA 2XF5A 3A01B 2WC2A 5F27A 3HUGA 1TBXA 3W6JB 2E1NA 4XM3A 1U5TA 2Y31A 1TTYA 4DBQA 2CQQA 2VJIA 3M9AA 3T0YA 2H8WA 3DTEA 5ERIA 5M5YJ 4KISA 1MMDA 2O7TA 1Z6TA 2NXNB 4HSTA 4LG3A 3OL3A 1XX5A 4KA4A 3K9TA 3L2CA 3L7WA 2A69F 3BTCA 4JX5A 4RAYA 1YX3A 1Z6RA 1ZLJA 3BCBA 2FMLA 1Z3YA 1HC8A 4TV7A 1UG0A 4HF2A 2X48A 4UUTA 2EIKH 5B5EC 2KHMA 1MMAA 5CVRA 5FRMA 2UXNA 3FMSA 1IXRC 1ETOA 3OIPA 1A35A 2P6TA 2GQQA 4RS8A 2BY3A 2Q8KA 2KISA 3BQYA 4LGWA 5K7FA 4E7IA 4EATA 1MJAA 1YIJI 4OD5A 2R7WA 1U5TC 4LOCA 5E3OA 2OAZA 3KFWX 2BY1A 1DUXC 2X85A 3S2DJ 5HDNA 5D6EA 3VPRA 4B4CA 3K2AA 5B1BH 3PO3J 2XGEA 2R0QC 4KMUX 4E6KG 3CDHA 2DCEA 1IG7A 2HGCA 1TNSA 3VYRB 3C2HA 4P1WA 1XMKA 2FA5A 2R7DA 3GCMA 4RM3A 2XASA 3BJ6A 2K5CA 4MK6A 2ZFUA 9ANTA 3FZVA 1GDTA 4XLEA 3H5RA 1ZTRA 1O7LA 3P9TA 4OIRF 2F07A 4GYGA 2DK8A 1TL8A 4U87A 4WXHA 3NXCA 3O60A 2IA1A 1MIJA 3TMOA 2OPTA 2L4AA 1A6QA 3H3UA 4RDUA 3J80K 2HOSA 4GFKA 1BI0A 1K4SA 5HLIA 1O3TA 1IRFA 2OU2A 2HYGD 3K4LA 2M0CA 3DQVC 1FC3A 1EF4A 5C4YA 4A3KJ 2IU5A 2WUIA 1SVLA 3W6KB 2A05A 4AVZA 1RETA 3HRUA 3MEXA 4P9FA 4ASNA 2L4MA 2L7ZA 2ZJQF 5BQTA 5FHPA 1XPXA 4NC8A 2FX0A 5HBUA 2VT2A 3ZMTA 2R3SA 4F3QA 1SD5A 4DIQA 2STWA 2GA2A 4KNYA 3F8MA 2H27A 4M6VA 2JMWA 4JK1X 1ZARA 3GLLA 4BJ5C 1ETWA 2B9SA 3GTKJ 2WA0A 4LFUA 4LG0B 3COLA 1SD6A 1TW3A 2O3FA 2HOTA 1FOYA 4D7MA 3DBLB 3NAUA 3BJOA 3TBIA 4XOPA 2LBFB 3RQIA 5E3LA 3L2WA 3OYIA 3GZ6A 3KE2A 4PXIA 4PSXA 1T33A 2A5YB 2R7TA 4A3FJ 3AFHA 1S7OA 3KEYA 2XKOA 1FYMA 2RQPA 3E3VA 4KIFA 4YRVA 2V57A 1T2KA 1MMGA 2Y48A 2CW8A 4HW0A 4DVYP 1DPRA 5L3FA 3DLAA 3TDUC 1UI5A 1XD7A 3HGGA 4R79A 1WSUA 1LFUP 1WJCA 1WH5A 3MZ8A 2YR2A 5ICGA 1LE8B 2QOPA 2XAUA 3HOVJ 5J1UA 4XL9A 4GO1A 5D8LB 3HBLA 1LVAA 1MKMA 4M3GA 5BS6A 2NP3A 2Z3YA 5J4YA 4HX4A 3SFIA 4IOCF 5IYBJ 3KLNA 3E6MA 4HV5A 5CVIA 3PO2J 1XB4A 3I56I 2PJRB 1IAWA 3LSIA 5GP9A 3VW0A 4Z6YA 1TWFJ 3V42A 1OCCH 1Z21A 2HVRA 2XV4S 4XN0A 2CH0A 1YLFA 1HKQA 5HAWA 4ZYGA 2ZSIB 3SEQA 2QZ8A 2NNNA 3J7ZI 2RQQA 1EJ9A 4NHJA 3WGIA 2WTEA 5LLQA 2W84A 1I6XA 3PQKA 3IUOA 3RTRA 2EFWA 4EGZA 4IKFA 2JSPA 3DLLF 1WQ2A 2M34A 1P4WA 4M3EA 1JGGA 4EJVA 2K85A 4PJMA 1OISA 3R61A 5FKMA 3LWFA 2L7KA 4WCGA 2A6EF 1K78A 4DZJA 2OC6A 3K4NA 1QBJA 3DV8A 2LOOA 3R4KA 2WGBA 1TWGJ 3NWTA 1MD0A 4V19K 5B1AH 2NS0A 2QQBA 2CUJA 5DM7F 2CG4A 3K6GA 2L9RA 2DMTA 2KZVA 3HYIA 5JHUA 3S8PA 1VQKI 3ULQB 1W36C 5IT9Z 3H35A 1T98A 2MH2A 2DW4A 2CS3A 2IP2A 2B63J 4U0VA 5JHFA 4KIBA 2HXIA 3RSNA 1IN8A 2FQ3A 1QPMA 5GADJ 3GTMJ 2YVXA 3N05A 1MBHA 2MSYA 2WAFA 2XAFA 2NNYA 1D1BA 1TZLA 1USTA 2OQGA 2EFOA 4IQ4A 1Y1VJ 3F8NA 1X4PA 3IRRA 1WKMA 2BVLA 5FLXZ 2V9VA 3JSPA 1OCZH 2ZMEB 4WK8F 1R1VA 3SJMA 1YO5C 1R49A 1UMQA 3CP2A 2CW7A 3CLOA 3PUBA 3GEUA 1Z91A 4WXDA 2DJNA 3JTGA 3LSJA 3BZ6A 2GIZA 2IVMA 3E6DA 1B8IA 1UAAA 2ME0A 5H20A 2MW8A 2L7MP 2VKDA 5B3SH 3NQOA 3E97A 3K1MA 1RR7A 3BT9A 1Z7LA 2E5ZA 2X1DA 3FDYA 3GTOJ 5HVQC 2M8GX 1GVDA 2LVSA 4A69C 2FNPA 2ZJPF 2BXYA 3CMYA 3ZQGA 1KQ0A 3F21A 4MGRA 3MFKA 2PJPA 5CVJA 1BN5A 2LKPA 3ML6A 2LH9A 3VODA 2BEOA 2IEKA 3H92A 1FX7A 4BY7J 3UNGC 3W2WA 3WGHA 5KAFC 4AM3A 1FOXA 2L2OA 3D0SA 2NVYJ 1W7PB 1VQLI 2UXIA 2K3FA 3JRAA 2ID3A 3K4MA 3SQNA 2V9PA 1Z0XA 3W2VA 4XKBA 2GOMA 2V26A 1L3LA 3IL2A 4PSWA 4NC7A 1WI3A 1MNMC 3BG7A 2K9NA 3HHGA 3CCQI 1DU0A 3BG6A 4G94A 5DD4A 4KUMA 2AS5F 1XMXA 2LG4A 4OMZA 1Z3XA 5EEGA 2CU7A 4RB3C 4M74A 1H8AC 2EV6A 3OMYA 2NVUB 1VQ5I 2M8EA 3RI4A 2CYYA 5LEJA 3CCLI 2HPIA 3JCUC 1W0UA 5TISC
chains in the Genus database with same CATH topology
2DG7A 2L7FP 4JL3A 2G0EA 1U8BA 3CJDA 2AO9A 4M3BA 2KDZA 2LK2A 3O8HA 2JA7J 2XGCA 1DU6A 4ME9A 2CUFA 3BR3A 4FE4A 4YZEA 2Q24A 2D5VA 3TP0A 4J19A 3HOWJ 2OI8A 2LD5A 2DTZA 4MLOA 2VUMJ 3HOZJ 3BRUA 2ZOZA 3QQAA 1HCRA 2VPRA 2CJJA 3OIOA 1AU7A 3QPLA 5F0HA 4JX6A 1XS9A 4A3CJ 4M3FA 5FKLA 2EH3A 1SFOJ 3RD3A 3DCFA 2JN6A 1JT6A 3V6GA 3DPJA 2NP5A 3B81A 4GFLA 4FISA 4A3GJ 1D5YA 2UXUA 4A3BJ 1HOMA 3Q0WA 4XICA 2YVEA 4HNVA 2JA5J 3BQZA 1K83J 2XB5A 5EGOB 1HLVA 2PZ9A 3V78A 2M2EA 3HEFA 1NK3P 1JKPC 4MIMA 4UUSA 3WHBA 2XGDA 3JRCA 4XIDA 1WGXA 1GT0C 5E3NA 2HYTA 3L1PA 5HSZA 1NK2P 4C3JJ 4EEFG 2HKUA 2H1KA 4AC6A 3RZDJ 2XPUA 3NARA 1ETKA 5IOYA 2FJ1A 3JRDA 3HTJA 5FKNA 4FE7A 2E1OA 3S1MJ 5J1RA 5BNGA 2IAIA 4AC0A 1X2NA 2DA5A 1GUUA 1U9NA 3G1MA 3FK7A 4A3DJ 1FIAA 2Y9YA 1VNDA 4G12A 2JJ7A 4UUSB 1QVUA 2Y2ZA 5AQCA 3AQSA 3I4MJ 1POGA 3G56A 1IC8A 3NI7A 3VUQA 5EYRA 4XRSA 1U78A 3A02A 1O4XA 2QKOA 3JSJA 2ELKA 4KWAA 1ENHA 1BW5A 4JX4A 3DEWA 3OSFA 2XPVA 2K9QA 3FKIJ 3LWJA 2ZB9A 2X9DA 4XRMA 3A03A 4IEJA 2QIBA 2YU9J 2YS9A 4FCYA 3LOCA 1ZR4A 3RH2A 1I50J 3IH3A 5F08A 3ANPA 1B8IB 3PPBA 3JRGA 3BG9A 3BR1A 4W1UA 2H8RA 1P7IA 3GTJJ 1HDPA 3NPIA 4IHVA 2GENA 3HIMA 3ZQLA 2HOAA 2EZIA 5EZGA 2CRGA 2MG4A 2R5YA 2LR8A 3I4NJ 3H3VK 2PBXA 3MNLA 4CGRA 4A3LJ 3KKCA 3MN2A 1ZKGA 2R5ZA 1T56A 1ETQA 2EBIA 5EZHA 1IUFA 1W0TA 2G3BA 5D1RA 5IP6A 4QTRA 1A6IA 4IHYA 2OERA 3BHQA 1S7EA 2G7SA 5K7ZA 5FMPA 3VVXA 3SDGA 4XRSG 3UKGA 2UXPA 1GV2A 1APLC 4DZPA 4XK4A 1UI6A 2I10A 5DAJA 1UG2A 3OSGA 4JKZA 2LY9A 4BBSJ 2GUHA 5IPAA 3OOUA 3S16J 1F43A 2DMUA 3S1RJ 1I3QJ 2R7ZJ 2AHQA 2EZKA 4MO7A 3JREA 1Q1VA 1H89C 2ZCNA 4DYCA 4GCLA 3TEDA 4X6AJ 2NX4A 4NELA 5FLVA 2LLKA 1JJ8C 4I6ZA 3LJLA 3QBMA 5C4JJ 1JTXA 1JKRC 3FIWA 2E2JJ 3ON2A 1FTTA 4ABZA 1U9OA 4B3AA 2ZCMA 2HQ5A 1Z77A 2K40A 2XPWA 5IP7J 2QF7A 1MSFC 2DA7A 2EZLA 3GZIA 1ETVA 1ETXA 4UDSA 1YRNB 4V2GA 1UHSA 3LSGA 3A01B 2W53A 5F27A 3BJBA 1FTZA 3ZQHA 3BTJA 2Y31A 2O7OA 5CXIA 2CQQA 5M5YJ 5IYCJ 5FGLA 2O7TA 3HOYJ 2QCOA 3HTHA 4QSHA 3EUPA 1RKTA 1ZK8A 3BTCA 3G7RA 2QWTA 4JX5A 1B72B 2WAQN 2REKA 3BNIA 4DYQA 3LHQA 2KT0A 3EGQA 2GFNA 3FK6A 2EQRA 3MKLA 2X48A 4UUTA 2MGQA 5IOZA 1BJZA 1TWCJ 1IV6A 1ETOA 1LFBA 1JTYA 1G2HA 3GTLJ 5IP9J 1JUPA 1OFCX 1BL0A 1QVTA 3CDLA 3QPSA 2LFBA 2DA1A 2P81A 3BG5A 2CQXA 1JKOC 5K58A 3CRJA 5K7FA 3BQYA 5F1JA 2G7GA 5M5WJ 4CYCB 3D1NI 5C4XJ 4LOCA 4BBRJ 2R93J 5E3OA 2VKVA 3VW2A 4D5FA 3S2DJ 3VPRA 4JYKA 4B4CA 5C3EJ 3K2AA 3PO3J 1X2MA 5JLWA 3S2HJ 2XGEA 1MH4A 2WB1N 2R0QC 1YRNA 1PUFA 4C3IJ 2E2IJ 2HI3A 1LE8A 1IG7A 3BCGA 1JUMA 5C44J 3G1LA 5F0FA 5GPAA 3BR6A 2ME6A 3ZOBA 3F1BA 3C2BA 3M3YJ 2L0KA 3FISA 4MK6A 9ANTA 4BY1J 2G7LA 1OCTC 2YUSA 1GDTA 3KZ9A 3BR0A 1ZTRA 1HF0A 5EGOA 2NS8A 4AF5A 5K7HA 3P9TA 2F07A 4ICHA 3NXCA 3O60A 3T6NA 3NNRA 1WH7A 2JK3A 2OPTA 3VW1A 3KNWA 2HOSA 3E7LA 4RDUA 4GFKA 2GBYA 3BR5A 3CCYA 2JA8J 2Y30A 2M0CA 1EF4A 5C4YA 3M4OJ 3TW6A 4AYBN 3VIBA 5JLXA 5F04A 2XB0X 4A3KJ 1FEXA 2IU5A 4BXXJ 2WUIA 3S14J 3FRQA 3GBGA 1RETA 2NVQJ 3VVYA 2DMQA 3JRHA 4A93J 2TRTA 2XRLA 2L7ZA 3HB9A 4RBOA 5FHPA 3IUVA 1JUSA 2FX0A 5HBUA 4GCTA 2NVTJ 1MBFA 4FTHA 1FIPA 2R5YB 2TCTA 5J3LA 4M6VA 5EG0A 1ZQ3P 2JMWA 2XSDC 5CXGA 4GFBA 1MBJA 1ETWA 2FD5A 3JR9A 2DA4A 3GTKJ 2LP0A 2W48A 2UXHA 5DTDA 3COLA 2LKXA 2HOTA 3HKZN 4MFDA 4GCKA 4D7MA 3NAUA 1BW6A 4IHWA 3E7QA 3O8GA 1H88C 3RQIA 1BA5A 5E3LA 1HDDC 3PASA 4PXIA 2D6YA 1T33A 4Y52J 3IH2A 4A3FJ 1E3OC 2VI6A 3ZQIA 4A3IJ 2V57A 2GM4A 4DYRA 3HOUJ 1UI5A 3HGGA 5DS9A 1LFUP 3RZOJ 2DN0A 5D19A 1WH5A 2EZHA 1LE8B 2QOPA 1PUFB 3HOVJ 3ANGA 5M3MJ 1K61A 1RESA 3QKXA 3HGYA 1MH3A 5J1UA 3IV5A 2CUEA 1IDZA 3HBLA 1TWAJ 2HYJA 2X6OA 2YVHA 4M3GA 1IRZA 5GPCA 4D5CA 1F36A 3JRBA 2NP3A 4W97A 4CYCA 3LSPA 2FBQA 3NRGA 3SFIA 5IYBJ 3PO2J 3VP5A 4NDLA 2O8KA 2ID6A 5GP9A 4MXMA 3VW0A 4AUXA 4M3DA 1TWFJ 4B1RA 2DMNA 2N8GA 4X1EA 5HAWA 1IJWC 1B72A 2ECBA 5HODA 3K7AJ 5M3FJ 3C07A 2JA6J 1RKWA 5EG0B 4Y7NJ 3Q0VA 2FQ4A 1OJLA 4JP0A 3JRFA 3G1OA 4BKXA 2M34A 1NTCA 4M3EA 2JWTA 4I76A 1JGGA 5FKMA 3LNQA 3BTIA 2HXOA 3A01A 4V2FA 2E19A 1XC5A 4A3EJ 3HE0A 5EDNA 5CW8A 1SGMA 4DZJA 2DG8A 1A5JA 5EFYA 1VF9A 3GTGJ 2WGBA 5EF6A 4HKUA 2WV1A 1TWGJ 2HDDA 5IYDJ 4NN1A 1VFCA 5M5XJ 2L9RA 2DMTA 3PM1A 3GTPJ 1AHDP 2COBA 1JJ6C 4S0HB 2ZOYA 2OF7A 4D7NA 2DA3A 1SANA 3S1NJ 4JNNA 3BTLA 2O9LA 2B63J 2M9HA 3W6VA 1P7JA 4IHXA 2HXIA 3S1QJ 1QRYA 3S17J 5H9TA 1VI0A 4QIWN 3Q0UA 3TW7A 5FLMJ 3RKQA 3JRIA 3BG3A 3IH4A 3GTMJ 1MBHA 2MSYA 2GLOA 2DA6A 1I6HJ 1MBEA 1MSEC 4C2MJ 1Y1VJ 1QPIA 4A3JJ 1ITYA 1AKHB 1ETYA 1Y1WJ 4DW6A 5E3MA 1OCPA 2ECCA 2R5ZB 1FJLA 3HTIA 3ON4A 3Q3SA 3SJMA 5FJ8J 1UMQA 1WCMJ 3GEUA 1CQTA 2DJNA 1JT0A 1TWHJ 2LTPA 1ZGWA 3BR2A 3KKDA 3LSJA 2NOGA 1B8IA 2ME0A 2DA2A 1XG1A 3HTAA 2MW8A 2L7MP 4ACIA 1RR7A 3BT9A 2PMZN 5EEAA 3VVZA 2IBDA 3CQZJ 3GTOJ 2E2HJ 2LVSA 1GVDA 2M8GX 3TP3A 4A69C 2RHAA 2XDNA 3S5RA 3CMYA 3ZQGA 3GTQJ 3B6AA 1TC3C 5D18A 4L5EA 1X58A 3MVPA 4C3HJ 3VOXA 3VOKA 2Y9ZA 3WHCA 5F0CA 2Y0SN 2IEKA 3S15J 4BY7J 2R92J 4A3MJ 2NVYJ 2UXIA 5FKKA 1AKHA 1RPWA 3JRAA 3HOXJ 2ID3A 1MBGA 3HM5A 3F0CA 1JKQC 1Z0XA 2RASA 5J1YA 1IDYA 1MBKA 3H0GJ 2ZCXA 1R9TJ 1IGNA 1WI3A 1MNMC 2UXOA 2K9NA 3B6CA 1DU0A 2NVXJ 3AQTA 1ORKA 3CWRA 2CU7A 3HDDA 1H8AC 2NS7A 2K9SA 3LSRA 1ZR2A 4L62A 2DMPA 2VKEA 1WPKA 5FKOA 2QTQA 4MFEA 3ZQFA 2RAEA 3ZQCA 1W0UA 1GV5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DG7 A;  2L7F P;  4JL3 A;  2G0E A;  1U8B A;  3CJD A;  2AO9 A;  4M3B A;  2KDZ A;  2LK2 A;  3O8H A;  2JA7 J;  2XGC A;  1DU6 A;  4ME9 A;  2CUF A;  3BR3 A;  4FE4 A;  4YZE A;  2Q24 A;  2D5V A;  3TP0 A;  4J19 A;  3HOW J;  2OI8 A;  2LD5 A;  2DTZ A;  4MLO A;  2VUM J;  3HOZ J;  3BRU A;  2ZOZ A;  3QQA A;  1HCR A;  2VPR A;  2CJJ A;  3OIO A;  1AU7 A;  3QPL A;  5F0H A;  4JX6 A;  1XS9 A;  4A3C J;  4M3F A;  5FKL A;  2EH3 A;  1SFO J;  3RD3 A;  3DCF A;  2JN6 A;  1JT6 A;  3V6G A;  3DPJ A;  2NP5 A;  3B81 A;  4GFL A;  4FIS A;  4A3G J;  1D5Y A;  2UXU A;  4A3B J;  1HOM A;  3Q0W A;  4XIC A;  2YVE A;  4HNV A;  2JA5 J;  3BQZ A;  1K83 J;  2XB5 A;  5EGO B;  1HLV A;  2PZ9 A;  3V78 A;  2M2E A;  3HEF A;  1NK3 P;  1JKP C;  4MIM A;  4UUS A;  3WHB A;  2XGD A;  3JRC A;  4XID A;  1WGX A;  1GT0 C;  5E3N A;  2HYT A;  3L1P A;  5HSZ A;  1NK2 P;  4C3J J;  4EEF G;  2HKU A;  2H1K A;  4AC6 A;  3RZD J;  2XPU A;  3NAR A;  1ETK A;  5IOY A;  2FJ1 A;  3JRD A;  3HTJ A;  5FKN A;  4FE7 A;  2E1O A;  3S1M J;  5J1R A;  5BNG A;  2IAI A;  4AC0 A;  1X2N A;  2DA5 A;  1GUU A;  1U9N A;  3G1M A;  3FK7 A;  4A3D J;  1FIA A;  2Y9Y A;  1VND A;  4G12 A;  2JJ7 A;  4UUS B;  1QVU A;  2Y2Z A;  5AQC A;  3AQS A;  3I4M J;  1POG A;  3G56 A;  1IC8 A;  3NI7 A;  3VUQ A;  5EYR A;  4XRS A;  1U78 A;  3A02 A;  1O4X A;  2QKO A;  3JSJ A;  2ELK A;  4KWA A;  1ENH A;  1BW5 A;  4JX4 A;  3DEW A;  3OSF A;  2XPV A;  2K9Q A;  3FKI J;  3LWJ A;  2ZB9 A;  2X9D A;  4XRM A;  3A03 A;  4IEJ A;  2QIB A;  2YU9 J;  2YS9 A;  4FCY A;  3LOC A;  1ZR4 A;  3RH2 A;  1I50 J;  3IH3 A;  5F08 A;  3ANP A;  1B8I B;  3PPB A;  3JRG A;  3BG9 A;  3BR1 A;  4W1U A;  2H8R A;  1P7I A;  3GTJ J;  1HDP A;  3NPI A;  4IHV A;  2GEN A;  3HIM A;  3ZQL A;  2HOA A;  2EZI A;  5EZG A;  2CRG A;  2MG4 A;  2R5Y A;  2LR8 A;  3I4N J;  3H3V K;  2PBX A;  3MNL A;  4CGR A;  4A3L J;  3KKC A;  3MN2 A;  1ZKG A;  2R5Z A;  1T56 A;  1ETQ A;  2EBI A;  5EZH A;  1IUF A;  1W0T A;  2G3B A;  5D1R A;  5IP6 A;  4QTR A;  1A6I A;  4IHY A;  2OER A;  3BHQ A;  1S7E A;  2G7S A;  5K7Z A;  5FMP A;  3VVX A;  3SDG A;  4XRS G;  3UKG A;  2UXP A;  1GV2 A;  1APL C;  4DZP A;  4XK4 A;  1UI6 A;  2I10 A;  5DAJ A;  1UG2 A;  3OSG A;  4JKZ A;  2LY9 A;  4BBS J;  2GUH A;  5IPA A;  3OOU A;  3S16 J;  1F43 A;  2DMU A;  3S1R J;  1I3Q J;  2R7Z J;  2AHQ A;  2EZK A;  4MO7 A;  3JRE A;  1Q1V A;  1H89 C;  2ZCN A;  4DYC A;  4GCL A;  3TED A;  4X6A J;  2NX4 A;  4NEL A;  5FLV A;  2LLK A;  1JJ8 C;  4I6Z A;  3LJL A;  3QBM A;  5C4J J;  1JTX A;  1JKR C;  3FIW A;  2E2J J;  3ON2 A;  1FTT A;  4ABZ A;  1U9O A;  4B3A A;  2ZCM A;  2HQ5 A;  1Z77 A;  2K40 A;  2XPW A;  5IP7 J;  2QF7 A;  1MSF C;  2DA7 A;  2EZL A;  3GZI A;  1ETV A;  1ETX A;  4UDS A;  1YRN B;  4V2G A;  1UHS A;  3LSG A;  3A01 B;  2W53 A;  5F27 A;  3BJB A;  1FTZ A;  3ZQH A;  3BTJ A;  2Y31 A;  2O7O A;  5CXI A;  2CQQ A;  5M5Y J;  5IYC J;  5FGL A;  2O7T A;  3HOY J;  2QCO A;  3HTH A;  4QSH A;  3EUP A;  1RKT A;  1ZK8 A;  3BTC A;  3G7R A;  2QWT A;  4JX5 A;  1B72 B;  2WAQ N;  2REK A;  3BNI A;  4DYQ A;  3LHQ A;  2KT0 A;  3EGQ A;  2GFN A;  3FK6 A;  2EQR A;  3MKL A;  2X48 A;  4UUT A;  2MGQ A;  5IOZ A;  1BJZ A;  1TWC J;  1IV6 A;  1ETO A;  1LFB A;  1JTY A;  1G2H A;  3GTL J;  5IP9 J;  1JUP A;  1OFC X;  1BL0 A;  1QVT A;  3CDL A;  3QPS A;  2LFB A;  2DA1 A;  2P81 A;  3BG5 A;  2CQX A;  1JKO C;  5K58 A;  3CRJ A;  5K7F A;  3BQY A;  5F1J A;  2G7G A;  5M5W J;  4CYC B;  3D1N I;  5C4X J;  4LOC A;  4BBR J;  2R93 J;  5E3O A;  2VKV A;  3VW2 A;  4D5F A;  3S2D J;  3VPR A;  4JYK A;  4B4C A;  5C3E J;  3K2A A;  3PO3 J;  1X2M A;  5JLW A;  3S2H J;  2XGE A;  1MH4 A;  2WB1 N;  2R0Q C;  1YRN A;  1PUF A;  4C3I J;  2E2I J;  2HI3 A;  1LE8 A;  1IG7 A;  3BCG A;  1JUM A;  5C44 J;  3G1L A;  5F0F A;  5GPA A;  3BR6 A;  2ME6 A;  3ZOB A;  3F1B A;  3C2B A;  3M3Y J;  2L0K A;  3FIS A;  4MK6 A;  9ANT A;  4BY1 J;  2G7L A;  1OCT C;  2YUS A;  1GDT A;  3KZ9 A;  3BR0 A;  1ZTR A;  1HF0 A;  5EGO A;  2NS8 A;  4AF5 A;  5K7H A;  3P9T A;  2F07 A;  4ICH A;  3NXC A;  3O60 A;  3T6N A;  3NNR A;  1WH7 A;  2JK3 A;  2OPT A;  3VW1 A;  3KNW A;  2HOS A;  3E7L A;  4RDU A;  4GFK A;  2GBY A;  3BR5 A;  3CCY A;  2JA8 J;  2Y30 A;  2M0C A;  1EF4 A;  5C4Y A;  3M4O J;  3TW6 A;  4AYB N;  3VIB A;  5JLX A;  5F04 A;  2XB0 X;  4A3K J;  1FEX A;  2IU5 A;  4BXX J;  2WUI A;  3S14 J;  3FRQ A;  3GBG A;  1RET A;  2NVQ J;  3VVY A;  2DMQ A;  3JRH A;  4A93 J;  2TRT A;  2XRL A;  2L7Z A;  3HB9 A;  4RBO A;  5FHP A;  3IUV A;  1JUS A;  2FX0 A;  5HBU A;  4GCT A;  2NVT J;  1MBF A;  4FTH A;  1FIP A;  2R5Y B;  2TCT A;  5J3L A;  4M6V A;  5EG0 A;  1ZQ3 P;  2JMW A;  2XSD C;  5CXG A;  4GFB A;  1MBJ A;  1ETW A;  2FD5 A;  3JR9 A;  2DA4 A;  3GTK J;  2LP0 A;  2W48 A;  2UXH A;  5DTD A;  3COL A;  2LKX A;  2HOT A;  3HKZ N;  4MFD A;  4GCK A;  4D7M A;  3NAU A;  1BW6 A;  4IHW A;  3E7Q A;  3O8G A;  1H88 C;  3RQI A;  1BA5 A;  5E3L A;  1HDD C;  3PAS A;  4PXI A;  2D6Y A;  1T33 A;  4Y52 J;  3IH2 A;  4A3F J;  1E3O C;  2VI6 A;  3ZQI A;  4A3I J;  2V57 A;  2GM4 A;  4DYR A;  3HOU J;  1UI5 A;  3HGG A;  5DS9 A;  1LFU P;  3RZO J;  2DN0 A;  5D19 A;  1WH5 A;  2EZH A;  1LE8 B;  2QOP A;  1PUF B;  3HOV J;  3ANG A;  5M3M J;  1K61 A;  1RES A;  3QKX A;  3HGY A;  1MH3 A;  5J1U A;  3IV5 A;  2CUE A;  1IDZ A;  3HBL A;  1TWA J;  2HYJ A;  2X6O A;  2YVH A;  4M3G A;  1IRZ A;  5GPC A;  4D5C A;  1F36 A;  3JRB A;  2NP3 A;  4W97 A;  4CYC A;  3LSP A;  2FBQ A;  3NRG A;  3SFI A;  5IYB J;  3PO2 J;  3VP5 A;  4NDL A;  2O8K A;  2ID6 A;  5GP9 A;  4MXM A;  3VW0 A;  4AUX A;  4M3D A;  1TWF J;  4B1R A;  2DMN A;  2N8G A;  4X1E A;  5HAW A;  1IJW C;  1B72 A;  2ECB A;  5HOD A;  3K7A J;  5M3F J;  3C07 A;  2JA6 J;  1RKW A;  5EG0 B;  4Y7N J;  3Q0V A;  2FQ4 A;  1OJL A;  4JP0 A;  3JRF A;  3G1O A;  4BKX A;  2M34 A;  1NTC A;  4M3E A;  2JWT A;  4I76 A;  1JGG A;  5FKM A;  3LNQ A;  3BTI A;  2HXO A;  3A01 A;  4V2F A;  2E19 A;  1XC5 A;  4A3E J;  3HE0 A;  5EDN A;  5CW8 A;  1SGM A;  4DZJ A;  2DG8 A;  1A5J A;  5EFY A;  1VF9 A;  3GTG J;  2WGB A;  5EF6 A;  4HKU A;  2WV1 A;  1TWG J;  2HDD A;  5IYD J;  4NN1 A;  1VFC A;  5M5X J;  2L9R A;  2DMT A;  3PM1 A;  3GTP J;  1AHD P;  2COB A;  1JJ6 C;  4S0H B;  2ZOY A;  2OF7 A;  4D7N A;  2DA3 A;  1SAN A;  3S1N J;  4JNN A;  3BTL A;  2O9L A;  2B63 J;  2M9H A;  3W6V A;  1P7J A;  4IHX A;  2HXI A;  3S1Q J;  1QRY A;  3S17 J;  5H9T A;  1VI0 A;  4QIW N;  3Q0U A;  3TW7 A;  5FLM J;  3RKQ A;  3JRI A;  3BG3 A;  3IH4 A;  3GTM J;  1MBH A;  2MSY A;  2GLO A;  2DA6 A;  1I6H J;  1MBE A;  1MSE C;  4C2M J;  1Y1V J;  1QPI A;  4A3J J;  1ITY A;  1AKH B;  1ETY A;  1Y1W J;  4DW6 A;  5E3M A;  1OCP A;  2ECC A;  2R5Z B;  1FJL A;  3HTI A;  3ON4 A;  3Q3S A;  3SJM A;  5FJ8 J;  1UMQ A;  1WCM J;  3GEU A;  1CQT A;  2DJN A;  1JT0 A;  1TWH J;  2LTP A;  1ZGW A;  3BR2 A;  3KKD A;  3LSJ A;  2NOG A;  1B8I A;  2ME0 A;  2DA2 A;  1XG1 A;  3HTA A;  2MW8 A;  2L7M P;  4ACI A;  1RR7 A;  3BT9 A;  2PMZ N;  5EEA A;  3VVZ A;  2IBD A;  3CQZ J;  3GTO J;  2E2H J;  2LVS A;  1GVD A;  2M8G X;  3TP3 A;  4A69 C;  2RHA A;  2XDN A;  3S5R A;  3CMY A;  3ZQG A;  3GTQ J;  3B6A A;  1TC3 C;  5D18 A;  4L5E A;  1X58 A;  3MVP A;  4C3H J;  3VOX A;  3VOK A;  2Y9Z A;  3WHC A;  5F0C A;  2Y0S N;  2IEK A;  3S15 J;  4BY7 J;  2R92 J;  4A3M J;  2NVY J;  2UXI A;  5FKK A;  1AKH A;  1RPW A;  3JRA A;  3HOX J;  2ID3 A;  1MBG A;  3HM5 A;  3F0C A;  1JKQ C;  1Z0X A;  2RAS A;  5J1Y A;  1IDY A;  1MBK A;  3H0G J;  2ZCX A;  1R9T J;  1IGN A;  1WI3 A;  1MNM C;  2UXO A;  2K9N A;  3B6C A;  1DU0 A;  2NVX J;  3AQT A;  1ORK A;  3CWR A;  2CU7 A;  3HDD A;  1H8A C;  2NS7 A;  2K9S A;  3LSR A;  1ZR2 A;  4L62 A;  2DMP A;  2VKE A;  1WPK A;  5FKO A;  2QTQ A;  4MFE A;  3ZQF A;  2RAE A;  3ZQC A;  1W0U A;  1GV5 A; 
#chains in the Genus database with same CATH topology
 1T6S A;  2XAG A;  2G0E A;  2JRM A;  2P0W A;  2VJ4 A;  1EH8 A;  5LGU A;  2FJI 1;  2DOF A;  2JA7 J;  2W7N A;  2BY0 A;  3K0L A;  4GGG A;  3WTU C;  3OYA A;  5DUI A;  3GYH X;  4HDU A;  4FET A;  1FYK A;  1X3W B;  3HC7 A;  3TP0 A;  4I2O A;  2LD5 A;  2WY7 Q;  1U2W A;  3WOD F;  1QZZ A;  4F52 A;  2V6C A;  3HOZ J;  2J5O A;  3WTW C;  2P7V B;  3KP3 A;  2ZJR F;  3OIO A;  5FD5 A;  3SZG A;  3T8R A;  1H0M A;  3BY6 A;  2O0Y A;  3LSH A;  1P2F A;  4A3C J;  4BXF A;  4U0W A;  2OTL I;  1ACI A;  2A07 F;  2EH3 A;  5FD6 A;  1SFO J;  3ELK A;  4XBF A;  2OJE D;  1D1C A;  1JT6 A;  2FF4 A;  4O5V A;  4X0G A;  3HL2 A;  3DPJ A;  4GFL A;  4G8X A;  3LA3 A;  4IHT A;  4FIS A;  4EM0 B;  3I5U A;  4XIC A;  2VBX A;  4HV6 A;  4HNV A;  2JA5 J;  3F72 A;  3KP6 A;  2K86 A;  2YX4 A;  3KX2 A;  1KQ8 A;  2X0L A;  2M2E A;  3M7G A;  3FM5 A;  1NK3 P;  2DAO A;  2XGD A;  4HF0 A;  3S2W A;  4XID A;  2GOX B;  5E3N A;  3ABT A;  2HVQ A;  4N4N B;  5KNL A;  1SFU A;  5E8G A;  3CJR B;  2MBF A;  1FBU A;  2X6Y A;  2VOO A;  1R5G A;  4C3J J;  2JTV A;  2QYO A;  4UV9 A;  2M7A A;  4F92 B;  5H6R A;  2HKU A;  4N0B A;  3SYT A;  2XPU A;  3RJP A;  2MFZ A;  1ZG1 A;  3NWS A;  2JPC A;  2HTS A;  2E1O A;  2HZT A;  5KHD A;  4U9N A;  1GUU A;  4CA0 A;  3RKY A;  2ZME C;  3V8J A;  1FIA A;  2Y9Y A;  1VND A;  4A3D J;  2WB1 A;  4I7H A;  2YX7 A;  3I4M J;  1IC8 A;  2V1N A;  4XLH A;  4XRS A;  1U78 A;  1O4X A;  1KGS A;  2DFI A;  3LQR A;  2ELK A;  5E79 C;  5LHH A;  2B3W A;  1G3W A;  2D1H A;  2E35 A;  5TRD A;  5EJC A;  3PQJ A;  2K9Q A;  4R8H A;  4RM2 A;  1FMV A;  2QSF X;  4XRM A;  3GME A;  1X1A A;  1DDN A;  2YU9 J;  2L9V A;  2YS9 A;  3GO5 A;  2V79 A;  3J80 Z;  1ZRE A;  3RH2 A;  1HXD A;  2LF7 A;  5FGM A;  1YIT I;  1WWX A;  1B8I B;  3PPB A;  3FHZ A;  1BR1 A;  4G6T B;  3GTJ J;  2M0M A;  2JQ7 A;  3GFM A;  2KFD A;  3CUO A;  2W24 A;  5F64 A;  4IHV A;  3HIM A;  2QQ8 A;  5EZG A;  4UHT A;  2MD5 A;  2MG4 A;  2F5D A;  2LR8 A;  3H3V K;  2PBX A;  2COM A;  3M8J A;  4EQQ A;  4A3L J;  3HRT A;  1HA8 A;  2ZME A;  2A5W A;  2QKM B;  4L9N A;  2CWE A;  2R5Z A;  4KFC A;  3EUH C;  1ETQ A;  1W0T A;  3AG4 H;  4QTR A;  1A6I A;  4IHY A;  1IN5 A;  4IVN A;  5LHI A;  2PMZ A;  1FPQ A;  5A2Q K;  3VVX A;  3SDG A;  4I0A A;  3RQ4 A;  3OR2 C;  2JSC A;  4KJZ A;  4JKZ A;  2LY9 A;  4O3M A;  4AIH A;  4YFN F;  3BJA A;  2DFE A;  4G7Z F;  1WZ2 A;  3CUQ C;  1SVO A;  4GCL A;  3WU1 B;  4DYC A;  1EH7 A;  1YYV A;  2XAJ A;  4B43 A;  3FXL A;  1JGS A;  1U8R A;  2KKO A;  2M7B A;  3ZPL A;  3QBM A;  5C4J J;  1UHW A;  1JTX A;  5D5V B;  2HQN A;  3MQ0 A;  3ON2 A;  1D8K A;  4CH7 A;  4ETS A;  4ABZ A;  4B3A A;  1FTT A;  2ZCM A;  2IPQ X;  1Z67 A;  2VC1 A;  4CCO A;  2V7F A;  2QF7 A;  4ZDL A;  3GZI A;  2B0L A;  4Q4Z F;  3ZN1 A;  1K78 B;  4I0B A;  1YRN B;  3TDZ C;  2W53 A;  2OCE A;  4CSW A;  2BXZ A;  4HEA 2;  4P5O A;  3VYU B;  4L18 B;  1V5E A;  1YG2 A;  3BTJ A;  4HX8 A;  3PFI A;  5IYC J;  1O3R A;  2VIX A;  3K4C A;  3VB2 A;  2QCO A;  3V4G A;  2IT0 A;  3PSF A;  2M4K A;  4ZTF A;  3FF5 A;  2OD5 A;  2R7R A;  2OQR A;  4QSH A;  2BBY A;  5FLX K;  1ZK8 A;  3G7R A;  3TKY A;  2REK A;  1H9G A;  3CCS I;  2DO7 A;  3LHQ A;  4OOI A;  3EGQ A;  2GFN A;  5IOZ A;  1TWC J;  2EFQ A;  2DQR A;  5CVU A;  3RPQ A;  1BC7 C;  1JTY A;  4BU2 A;  1G2H A;  4LIV A;  3CDL A;  3QPS A;  4II2 A;  5K58 A;  2UZK A;  4BEH A;  3KYL A;  1ULY A;  1Y8R B;  4XSZ F;  5ED4 A;  4PGH A;  3EUA A;  2VBW A;  2D2W A;  2CV0 A;  3P9C A;  5CVV A;  2R93 J;  2VKV A;  4BUP A;  2AQF A;  3ZMZ A;  3DKY A;  4D5F A;  4AWX B;  1WFX A;  4MHG A;  5C3E J;  3S2H J;  2XVC A;  2WB1 N;  4C3I J;  3CZ6 A;  4ZC3 A;  4LLN A;  1FT9 A;  4BAC A;  4L0Z B;  3E0J B;  3C2B A;  3TO6 A;  3M3Y J;  3I58 A;  4CO8 A;  3FIS A;  1QHH D;  2G7L A;  3BPX A;  3CO6 C;  1L0O C;  5KK1 A;  1HF0 A;  4RAG A;  5K7H A;  3QU6 A;  4ICH A;  1D0Y A;  4GXO A;  5BOX A;  1DGR M;  3F23 A;  1P92 A;  1F4K A;  2DOD A;  3SWH A;  5DCF A;  3COA C;  3VW1 A;  5HS7 A;  2VPL A;  3KNW A;  3BDD A;  3E7L A;  1SAX A;  1SMY F;  1XSD A;  3HSF A;  4M72 A;  4NUB A;  4ENM A;  3M4O J;  3V7S A;  4AYB N;  2CFO A;  5F04 A;  1FEX A;  4E7K A;  4BXX J;  2FE3 A;  4PFP A;  5LBQ A;  2PX9 A;  2HVS A;  4ZYH A;  3OWT A;  4CCM A;  1LQ1 A;  1R5I D;  5J40 A;  2XRL A;  4FT8 A;  1YQA A;  2HFH A;  4GCT A;  3HTU A;  2V1D A;  2ZC2 A;  2GIV A;  1MBF A;  4FTH A;  2GWR A;  2R7Q A;  2KLO A;  2TCT A;  5EG0 A;  4Y3O A;  3AAF A;  4A12 A;  4UVA A;  2XSD C;  4GFB A;  3R0J A;  4RMN A;  1N78 A;  2QEX I;  2LP0 A;  2WAQ A;  3QWL A;  3CF2 A;  1CGP A;  2W48 A;  2UXH A;  2EIM H;  1TQM A;  3R6S A;  5D4R A;  2E1C A;  4L9V A;  4QPQ A;  1C0W A;  2DYR H;  3AG2 H;  4MFD A;  1I27 A;  4LLL A;  4IHW A;  3E7Q A;  5H6Q A;  3O8G A;  4WF2 A;  3S3N A;  3CUQ B;  1OYI A;  4P9U A;  1HDD C;  2M87 A;  1J75 A;  3KET A;  4L9J A;  2RKH A;  4AU7 A;  4A2U A;  1KYZ A;  1YTY A;  4A3I J;  2Z9O A;  2DT7 B;  2K4B A;  4DYR A;  2PFV A;  5K1Y A;  2ZNY A;  3HOU J;  4BDZ A;  2DN0 A;  3OYN A;  4PZJ A;  2LF8 A;  3MZH A;  2W82 A;  5L3E A;  5M3M J;  1K61 A;  4NNJ A;  1R22 A;  1YOV B;  3DBR B;  1R6R A;  4XMY A;  1IDZ A;  2HYJ A;  2BVM A;  2X6O A;  5HS8 A;  4D5C A;  1F36 A;  3J81 Z;  2IGM A;  2LY1 A;  4DBR A;  3JRB A;  4CYC A;  2ESH A;  4RAF A;  3NRG A;  3J81 K;  1QHG A;  1VQM I;  3J7Y J;  2O8K A;  4Q48 A;  1N75 A;  4AUX A;  4M3D A;  3LA7 A;  1VQ9 I;  4YEL A;  3DU6 A;  2EWN A;  1VQN I;  3SZP A;  1QQI A;  4ESJ A;  4ESB A;  3Q9V A;  3JAM Z;  2R7X A;  1LDD A;  1OQY A;  4AYB A;  4UB6 C;  2DT5 A;  3T8T A;  3DXJ F;  1OYW A;  3K7A J;  5HOD A;  3OYJ A;  5L3C A;  3C07 A;  3VEP A;  3GEZ A;  3Q0V A;  3DBH B;  3M1C A;  4JP0 A;  1OJL A;  3ZCO A;  3JRF A;  4BKX A;  1J09 A;  2KL4 A;  4I76 A;  2QSG X;  3BOQ A;  3CD6 I;  3LL7 A;  3TL4 X;  3A01 A;  3B73 A;  1WJD A;  3FWE A;  5GAH J;  1BBY A;  3G3Z A;  4II3 A;  1W4M A;  4XLA A;  1X1C A;  3PL8 A;  1SGM A;  2I5U A;  2DG8 A;  1ZG3 A;  5EFY A;  1VF9 A;  2KQR A;  4HKU A;  5EF6 A;  2WV1 A;  3I59 B;  4HYE A;  4XKC A;  4ZYD A;  1U6G A;  2LNB A;  1KON A;  1OCR H;  1R1U A;  3RIR A;  5IYD J;  1P4A A;  5CJ9 A;  2QBY B;  4MNU A;  5M5X J;  1LEA A;  1R5H A;  3PM1 A;  1SEU A;  3L2U A;  3I53 A;  2ZOY A;  1ON2 A;  4LK0 F;  3PSI A;  3Q5F A;  3BTL A;  5DEQ A;  1YW8 A;  2MH9 A;  2M9H A;  1G8X A;  3W6V A;  4IHX A;  3H0D A;  3S1Q J;  4YFX F;  2DDB A;  5FLM J;  3I4P A;  3JRI A;  3DKX A;  3MWM A;  4NC6 A;  2YPR A;  3A2K A;  2FMY A;  1Y39 A;  2VC0 A;  1FLI A;  4UB8 C;  5CLS A;  2D45 A;  3OYM A;  3RYP A;  4A3J J;  1ITY A;  4XLP F;  1AKH B;  2C6Y A;  4DW6 A;  4GCV A;  5E3M A;  2DU9 A;  4JQF A;  1GXQ A;  1UCR A;  2VBZ A;  3FXU A;  3ON4 A;  3Q3S A;  1F1Z A;  3EUH A;  5D8K B;  1IF1 A;  4IXA A;  3WE3 A;  2V4J C;  3K4B A;  1K4T A;  1CQT A;  2WWY A;  4CCK A;  1NG6 A;  3IAM 2;  3K8P C;  3KKD A;  1TW2 A;  4NQW B;  4A0Z A;  1W5C C;  3RKW A;  4B09 A;  5LD2 C;  3HTA A;  3T5X A;  4MEX F;  3F8C A;  1ZRF A;  4ACI A;  2PMZ N;  2JT1 A;  4ANJ A;  2IBD A;  2UUZ A;  5FB2 A;  5FFX A;  2PBI A;  3D5S C;  4CIC A;  2X4H A;  3MKZ A;  2E2H J;  2OBP A;  3K1N A;  1JHF A;  1KA8 A;  3S5R A;  2RHA A;  4ON0 A;  1SFK A;  4PUS A;  3BCA A;  3GTQ J;  4XLF A;  1TC3 C;  2E60 A;  5D18 A;  2DOE A;  1X58 A;  4C3H J;  3DPU A;  1BR4 A;  3VOK A;  3F6V A;  4IF4 A;  5F0C A;  2L3D A;  4MEY F;  2Y0S N;  3OL4 A;  2GXG A;  1ZGA A;  1T38 A;  3ABU A;  4M6X A;  5FKK A;  1AKH A;  1RPW A;  1JHH A;  2L54 A;  4D9J A;  2XRO A;  1MBG A;  2VJJ A;  3LFK A;  1T39 A;  4ZZL A;  1X1D A;  4ITV A;  4ZJZ A;  4HQE A;  2CUZ A;  1R9T J;  4WIB A;  1FYL A;  1XTA A;  4S05 A;  1U0J A;  3N97 A;  5ICC A;  2VE9 A;  5CQG A;  3VOE A;  3CWR A;  5E18 F;  1Y8Q B;  2EPF A;  2K9S A;  4L62 A;  3TOA A;  1LEB A;  4R1H A;  5K5R A;  2DMP A;  1XMA A;  1SFX A;  2CO5 A;  4M73 A;  2O61 A;  4MFE A;  2RAE A;  3ZQC A;  3G2B A;  1GV5 A;  1ONV A;  4IRV A;  2VT3 A;  2ELH A;  2NYX A;  3CLQ A;  1T0F C;  2AO9 A;  4M3B A;  1XGO A;  4XR6 A;  5EEH A;  1DU6 A;  1VQ8 I;  2LRE A;  1K79 A;  4A6E A;  4YZE A;  1J59 A;  1ZAO A;  2DLL A;  3NEU A;  1TT0 A;  1EV7 A;  4MLO A;  2QGU A;  4IJA A;  2VUM J;  4DQ2 A;  2W57 A;  3BRU A;  1MND A;  2ZOZ A;  2VPR A;  4N4O B;  1AU7 A;  3QPL A;  3IKV A;  4KMF A;  3AL0 B;  5E20 A;  4KN7 X;  2F5C A;  4M3F A;  5D5X B;  3HSR A;  3DCF A;  1BOB A;  4BYY A;  5LFA A;  1YJN I;  5A2Q Z;  2F5V A;  3LQQ A;  3WTS C;  1N25 A;  3CMM A;  4A3B J;  3TOB A;  3Q0W A;  4KIC A;  1SD4 A;  3BQZ A;  1K83 J;  4EJT A;  3IWZ A;  3QPT A;  3FHN A;  4OAZ A;  3MKY B;  3P5J A;  4MIM A;  4UUS A;  2RGV A;  3WHB A;  4AVP A;  4Y17 A;  1LB2 A;  1WGX A;  2P7C B;  1IXC A;  2HYT A;  3IWF A;  3LSK A;  3LST A;  5FRO A;  2CQ7 A;  2DFH A;  5HLH A;  1Z9C A;  1YS7 A;  2M5W A;  1ETK A;  2FJ1 A;  3U9G A;  4F7Z A;  3KP5 A;  4B44 A;  3S1M J;  5J1R A;  4AC0 A;  1X2N A;  2DA5 A;  2DPD A;  1U9N A;  1MDM B;  1FOW A;  2Z2S B;  2XDV A;  2JJ7 A;  1HKT A;  1QVU A;  3CF5 F;  3NI7 A;  2QLZ A;  4KWA A;  4OD4 A;  2EFN A;  4GRI A;  3A0B C;  5FRN A;  4GDF A;  1BW5 A;  4G9Y A;  2HS5 A;  1PDN C;  2DI3 A;  3CUQ A;  2Q2E B;  3FKI J;  4UY8 I;  2QQA A;  2X9D A;  3KLO A;  1OKR A;  2Y0S A;  2VBY A;  2MAB A;  4IEJ A;  3N4M A;  5CQE A;  4FCY A;  1I50 J;  5F08 A;  2OA4 A;  3ZMD A;  3JAM K;  2H8R A;  3L9F A;  3ASN H;  4KDP A;  1HDP A;  3OS2 A;  2QUF A;  2GEN A;  1USS A;  2HOA A;  3BZK A;  2CRG A;  2R5Y A;  1IXS B;  3I4N J;  2GZW A;  4JBA A;  4RLF A;  3EDP A;  5LRR A;  3GZN B;  2IXS A;  1T56 A;  3FXK A;  2G3B A;  2AXL A;  1IUF A;  5D1R A;  4HG2 A;  4M9Z A;  3PNY A;  4LIT A;  3BHQ A;  5FMP A;  5KCM A;  4YG2 F;  3DTK A;  5K7Z A;  1ZRD A;  2RN7 A;  3UKG A;  2UXP A;  2NAZ A;  4BS9 A;  4XK4 A;  3PFY A;  2EA4 A;  2I10 A;  5DAJ A;  4N9I A;  3OSG A;  3VFZ A;  5LGN A;  4ESF A;  4AIJ A;  1OPC A;  4ENN A;  2GUH A;  2CV1 A;  4EJU A;  3OOU A;  4AD9 A;  1UEL B;  1F43 A;  5HLG A;  2AHQ A;  3JRE A;  2KIF A;  4A6D A;  2VQC A;  3TED A;  4ZDO A;  2NX4 A;  5E8I A;  4Z2Y A;  2BHY A;  2LLK A;  1ZYR F;  2BHZ A;  3K1P A;  1JJ8 C;  3LJL A;  3GXO A;  3MAJ A;  4BQQ A;  4HF1 A;  5GTI C;  2V1X A;  1REP C;  1Z1D A;  5IP7 J;  4J01 A;  1ETV A;  1BR2 A;  1ETX A;  4V2G A;  5J47 A;  1TQP A;  1YS6 A;  4C2M A;  2FRH A;  3BJB A;  5TGT A;  1FTZ A;  3ZQH A;  2A2F X;  1RNL A;  2O7O A;  1QZE A;  2VQL A;  4RAZ A;  4OMY A;  1FZP B;  3C18 A;  3TO7 A;  3I64 A;  3HTH A;  3EUP A;  3C7J A;  2XKP A;  1O3Q A;  1PUE E;  1B72 B;  3BNI A;  3QP5 A;  2XF6 A;  4DYQ A;  1LDJ A;  4WXC A;  1XDS A;  2KT0 A;  1M1E B;  3FK6 A;  2EQR A;  1J2X A;  3OYE A;  1GXP A;  5E1Z B;  1MZB A;  4BAY A;  2ZJ2 A;  1IV6 A;  5DUK A;  3E5X A;  1BL0 A;  1YJW I;  2LFB A;  5HNH A;  2P81 A;  4U7D A;  2K3P A;  3BG5 A;  2W00 A;  1RRJ A;  1JKO C;  3TGN A;  3CRJ A;  3KP2 A;  5M5W J;  1IN6 A;  4FAS D;  4CYC B;  5C4X J;  3K2Z A;  4ZTJ A;  3AG1 H;  4BBR J;  2HU9 A;  5JVT A;  1ZG5 A;  1AOY A;  4JYK A;  4C2U A;  5JLW A;  5AIP A;  1MH4 A;  1YRN A;  2HI3 A;  5DDG A;  5C44 J;  1RUO A;  2ME6 A;  5GPA A;  3BR6 A;  5BPI A;  1K7A A;  3F1B A;  1IN4 A;  3F22 A;  3I54 A;  2L0K A;  2NRA C;  1OCT C;  2V6E A;  2YUS A;  3BR0 A;  3HRM A;  2NS8 A;  4AF5 A;  5LRS A;  4HBL A;  3NNR A;  1WH7 A;  2LC2 A;  2JK3 A;  2VXZ A;  4B8X A;  3F6O A;  3B02 A;  4FX0 A;  1SC7 A;  4YII A;  1QA6 A;  2GBY A;  4U9L A;  3BR5 A;  3CCY A;  1BI1 A;  1Z05 A;  2JA8 J;  2IGN A;  3REO A;  4BE0 A;  3I9V 2;  2Q1Z B;  3TW6 A;  4UUV A;  2ZFW A;  5JLX A;  2XB0 X;  1HST A;  2LMD A;  4G6D A;  3ECO A;  3S14 J;  3P9I A;  3FRQ A;  2E1M C;  3H9G A;  3VDX A;  3ERE D;  1T8I A;  2DMQ A;  3W2A A;  2QQ9 A;  2FOK A;  3EQL F;  1ZRC A;  3OYK A;  2TRT A;  3HB9 A;  2JVH A;  4ZDP A;  1J7K A;  2IS1 A;  1JUS A;  3E5Q A;  3WG7 H;  2CGP A;  5J3L A;  1ZQ3 P;  1LVK A;  3OYD A;  4Y15 A;  5CXG A;  3KZZ A;  4P96 A;  3ZMU A;  1S3J A;  2FD5 A;  1FBQ A;  3JR9 A;  1S9H A;  4UV8 A;  2KIU A;  3E5U A;  1ODD A;  3FX3 A;  4CCJ A;  1V4R A;  5DTD A;  2ZKZ A;  2QWW A;  2LKX A;  2DT6 A;  3HKZ N;  1QU3 A;  2CW0 F;  2BY2 A;  1BW6 A;  1R58 A;  2PQ8 A;  1H88 C;  2RV8 A;  3RKX A;  3PAS A;  2BYV E;  2Z16 A;  2IGO A;  2D6Y A;  1BOA A;  3K4J A;  2MD0 A;  4Y52 J;  3GF2 A;  3IH2 A;  3K70 D;  1I3A A;  4LD5 A;  4A5M A;  2M1B A;  3X2Q H;  2VI6 A;  3ZQI A;  1O3S A;  4F91 B;  5ICE A;  1B6A A;  3ABM H;  3ASO H;  4HOB A;  3ZN0 A;  5HS9 A;  2DK5 A;  5DS9 A;  5D19 A;  4GYI A;  5HLT A;  2EZH A;  1PUF B;  3ANG A;  5ILS A;  2HZD A;  2HWV A;  2M45 A;  2JUC A;  1IRG A;  1E0E A;  4XN3 A;  4PK4 A;  3IV5 A;  3FBN B;  2KRC A;  1I5Z A;  4CCN A;  4XNF A;  1TWA J;  3KZI C;  1D5V A;  3CMA I;  2HPM A;  2A6H F;  3TQN A;  3E6B A;  2FBH A;  4W97 A;  3LSP A;  1Z7U A;  1E3H A;  1FP2 A;  4BEH B;  1QO0 D;  1R4N B;  3TO9 A;  2ESN A;  3FM3 A;  4EVI A;  4NDL A;  3FKJ A;  3JTH A;  4MXM A;  2L9S A;  3I71 A;  3R0A A;  4BNC A;  2N8G A;  1STZ A;  5J8C A;  4LG0 A;  5JFR A;  2IS2 A;  2ZO4 A;  1DGW Y;  5E1X A;  5GTH C;  1X19 A;  3ROU A;  2ECB A;  3BZC A;  1E17 A;  2JA6 J;  1RKW A;  3AKZ A;  1X3Z B;  1A36 A;  1BJA A;  3DTI A;  3G1O A;  2R4G A;  3F8F A;  3QYE A;  3S3M A;  2JWT A;  3FXR A;  1V5F A;  1Y6I A;  1D0Z A;  3LNQ A;  3HKZ A;  1WHU A;  2HXO A;  3M1E A;  2FSW A;  1DP7 P;  1WVR A;  3DF8 A;  4V2F A;  3AL0 C;  2E19 A;  1XC5 A;  5EDN A;  4Q5S F;  2IA0 A;  2JA2 A;  3CDI A;  4G6Q A;  2Z99 A;  4KT6 A;  4HZF A;  4KIG A;  3QPH A;  4PGG A;  3I3L A;  4S04 A;  2VKH A;  3ECH A;  1VFC A;  3CCM I;  2DFF A;  2F6C A;  3GTP J;  1AHD P;  2COB A;  1JJ6 C;  3LMM A;  5D6F A;  4S0H B;  1LPQ A;  1PYV A;  4I09 A;  3CCV I;  4LB5 A;  1SAN A;  3S1N J;  3M8E A;  3CCJ I;  3J7A Y;  1S7A A;  1QRY A;  2DBB A;  1XGN A;  4BH9 A;  1GVJ A;  4ZH4 F;  2Z33 A;  2L02 A;  1SFE A;  1VI0 A;  3DEE A;  3Q0U A;  3S17 J;  5H9T A;  3ESW B;  1RIO H;  1BI3 A;  2DA6 A;  1MBE A;  2KJB A;  2P8T A;  1ETY A;  4PJN A;  1W7P A;  1OCP A;  3UR3 C;  2OTJ I;  2KP6 A;  4MQ9 F;  4XSX F;  1UZC A;  1W7P D;  2ECC A;  2R5Z B;  1FJL A;  1XGS A;  3EYI A;  1K6Y A;  2PMH A;  3ABL H;  3OOP A;  1U3E M;  2ELJ A;  2STT A;  1R7J A;  2KZG A;  1VQ4 I;  4H0E A;  2P5V A;  1JT0 A;  2G7H A;  3BR2 A;  1LDK B;  1B9N A;  3L09 A;  3CTA A;  4YFK F;  4A0Y A;  3RPU A;  4IRH A;  3SDB A;  1KYW A;  2ISY A;  4BHC A;  4U0Y A;  1JE8 A;  1QZY A;  5IT3 A;  3PUF A;  4RB1 A;  3MZY A;  3VVZ A;  3FMR A;  3HTS B;  3U1K A;  4U7B A;  3DU5 A;  3CQZ J;  4OIP F;  2PEX A;  1IW7 F;  2Z1D A;  3GZ5 A;  1LKX A;  1P6R A;  1SAU A;  1FMW A;  4RGR A;  3HRS A;  3B6A A;  3BPV A;  1V3F A;  1ZN2 A;  2M3A A;  3W3C A;  1VTN C;  2VOP A;  2A3S A;  2IS6 A;  2OZ6 A;  1LJ9 A;  3V7C A;  2FOW A;  2Y9Z A;  4B48 A;  3KCC A;  3NRV A;  3S15 J;  3WTX C;  4D0P A;  5BMZ A;  2OV7 A;  4A3M J;  1TQI A;  4BL0 B;  1HW2 A;  3F0C A;  2RAS A;  3QYF A;  3KEO A;  2JVG A;  4BDY A;  1MBK A;  2IW5 A;  3RDI A;  3BLY A;  2ICW G;  2E7X A;  4BQO A;  2ZCX A;  3AG3 H;  1W36 D;  2UXO A;  4QWQ A;  2K9L A;  3B6C A;  4IQJ A;  3OYG A;  2VJ5 A;  1ZLK A;  2XC7 A;  3FXO A;  4UVB A;  3HDD A;  3LSR A;  4CUG A;  3QOD A;  1G4D A;  3IRQ A;  3VTI A;  2VN2 A;  2VKE A;  1WPK A;  4KN4 X;  3QP6 A;  2DJI A;  3ZQF A;  2FXA A;  2EV5 A;  4KYW A;  2JUG A;  2L7F P;  4JL3 A;  3JW4 A;  2VE8 A;  1U8B A;  3CJD A;  2KDZ A;  1P9Q C;  3O8H A;  3ZR8 X;  2XGC A;  2FU4 A;  3PNT A;  2K9M A;  4ME9 A;  4I98 B;  3LSM A;  2PN6 A;  4FE4 A;  2Y69 H;  3H5A A;  1DPU A;  3H1C A;  2Q24 A;  2D5V A;  1HSJ A;  5AIQ A;  1KU7 A;  2HTJ A;  1DP3 A;  1FNN A;  4EMS A;  4JOM A;  4IRG A;  1KZH A;  2FUG 2;  3QQA A;  1HCR A;  2CJJ A;  4FX4 A;  2Y75 A;  3EYY A;  3WTZ A;  1XS9 A;  4C30 A;  3HPG A;  4IPA A;  3MMY B;  3RD3 A;  2JN6 A;  1WJ5 A;  4EM2 A;  3B81 A;  1D0X A;  2OZU A;  2RNG A;  1D5Y A;  3C2G A;  2UXU A;  2PJR A;  1YW7 A;  4LLG F;  2XB5 A;  2PZ9 A;  3M07 A;  3V78 A;  4IX7 A;  2BE5 F;  1JKP C;  2X1C A;  5IY5 H;  1D1A A;  3JRC A;  4CCL A;  3L2R A;  1MDM A;  3GVA A;  1R00 A;  2XUB A;  3L1P A;  5HSZ A;  1G3T A;  1BIB A;  1NK2 P;  4EEF G;  1R23 A;  2R7O A;  5F1R A;  2JPB A;  2H1K A;  4ENJ A;  4AC6 A;  2ADU A;  3NAR A;  3RZD J;  4RGU A;  4A5N A;  5IOY A;  1FSE A;  1X1B A;  3OY9 A;  4FQG A;  3CC2 I;  3PJR A;  1ZH5 A;  5BNG A;  2IAI A;  3CO7 C;  2R7V A;  1S29 A;  3G1M A;  5FFZ A;  3FK7 A;  1ZGJ A;  4G12 A;  2QSH X;  4UUS B;  2XSJ C;  2Y2Z A;  2ZSH B;  4IL6 C;  3G6E I;  2B7E A;  5DD8 A;  3AQS A;  4BE1 A;  3A02 A;  5D5W B;  2HKO A;  2QKO A;  3I0T A;  2HDC A;  1HW1 A;  3HIF A;  4JX4 A;  2KMU A;  2LY2 A;  3DEW A;  4CDG A;  2LBF A;  4CZC A;  3LWJ A;  2ZB9 A;  3HHH A;  3D5R C;  3A03 A;  2ZCW A;  2Z5U A;  3DFG A;  1KQ9 A;  1B1B A;  2LYC A;  3WTY C;  3LOC A;  4C2T A;  3P7N A;  3FXQ A;  4A0X A;  4PDK A;  4XRF A;  4E7J A;  2QEN A;  3PNV A;  3OS1 A;  2LSO A;  3BG9 A;  5CYV A;  4OU0 A;  2E1M B;  2H94 A;  2IJL A;  1W1W E;  3NPI A;  2EZI A;  2MLG A;  2F4I A;  4BQN A;  4CGR A;  4LJZ F;  1P4X A;  5K5Q A;  3IP4 B;  1AWC A;  3KEQ A;  1ZKG A;  3OYH A;  3E1S A;  5EZH A;  1MNE A;  4RGS A;  5IP6 A;  2UXX A;  2OER A;  3VYT B;  4YIR X;  2H1L A;  4HLY A;  2R7S A;  5ILU A;  5BPD A;  1GV2 A;  4NBQ A;  1APL C;  3ZP5 A;  4XKW A;  4DZP A;  2XRN A;  1F5T A;  1UG2 A;  2FEZ A;  5LEK A;  3L2V A;  1YHQ I;  3BP8 A;  5IPA A;  4F93 B;  2BV6 A;  1DQU A;  2ISZ A;  3CCU I;  3S16 J;  2DMU A;  2EIL H;  3M8F A;  2DYS H;  1I3Q J;  2HNH A;  3H3Z A;  4G7O F;  5JVG F;  3QRF F;  1Q1V A;  2ZCN A;  2VAS A;  2XGX A;  4B3X A;  4CYD A;  2EB7 A;  4NEL A;  2JRT A;  1FBS A;  3QYB A;  2ZBK A;  1ERD A;  3FIW A;  1RR8 C;  2E2J J;  4RLQ A;  2VQG A;  1V55 H;  4RB2 C;  2HQ5 A;  4XLN F;  2BGC A;  5DYM A;  4PJ0 C;  2XPW A;  2X6W A;  2YU3 A;  1MSF C;  2DA7 A;  2W1O A;  2AQE A;  1CF7 B;  2EZL A;  3A1Y A;  2IRF G;  2V9K A;  3RCO A;  2E71 A;  2TDX A;  4YIF A;  4UDS A;  3LSG A;  2F4M B;  2XIG A;  3GLX A;  3DP7 A;  4RA2 A;  2M30 A;  1TLH B;  4OIN F;  2O6G E;  2P4W A;  3HOY J;  2VL8 A;  5ICF A;  4BJ6 C;  5E17 F;  1EH6 A;  2M4G A;  2KJC A;  1IN7 A;  3HXL A;  2MC3 A;  4B47 A;  4AIK A;  3WU2 C;  1RKT A;  2QWT A;  2WAQ N;  1R36 A;  3CME I;  1O7F A;  1A04 A;  3MKL A;  2P6S A;  2MGQ A;  1B9M A;  5DCM B;  3V7R A;  1BJZ A;  1EA3 A;  3H9J A;  4EJO A;  1LFB A;  3IAS 2;  2K4J A;  5E1W A;  3GTL J;  2Q2E A;  4YEJ A;  5IP9 J;  1JUP A;  1OFC X;  1QVT A;  4OAY A;  4BHP A;  3CJN A;  2DA1 A;  4XON A;  2W4S A;  1YW9 A;  2V1U A;  3KPH A;  2CQX A;  3PIO F;  1FP1 D;  4XOT A;  2W85 A;  3EUK L;  5F1J A;  4D1Q A;  2G7G A;  1V5G A;  3RPU D;  1IZ1 A;  3ZXS A;  3D1N I;  3D5L A;  4WX9 A;  2RC4 A;  3BC8 A;  2EIN H;  2RVC A;  4EM1 A;  3T1B A;  3VW2 A;  1D3Y A;  1WJA A;  3HUG B;  1NG7 A;  2MA3 A;  4HSR A;  4PJL A;  2L5Q A;  3H5N A;  5D5U B;  1X2M A;  3U1D A;  1WJE A;  1PUF A;  1WRJ A;  2NOJ B;  2E2I J;  4XLC A;  1V54 H;  4L9T A;  4G7H F;  1LE8 A;  1JUM A;  3BCG A;  5FGL A;  3G1L A;  5F0F A;  2EFP A;  3ZOB A;  1XDU A;  2PG4 A;  2WAE A;  1WJB A;  3CP8 A;  1VQ7 I;  2GA1 A;  4BY1 J;  2Y0M A;  4WWC A;  2UV1 A;  2ZNZ A;  3KZ9 A;  1FSH A;  2PFB A;  5EGO A;  1W5T A;  2O03 A;  2H09 A;  3LA2 A;  4L5J A;  3OR1 C;  3VSK A;  3T6N A;  1T95 A;  4HA8 A;  1E2X A;  1AA7 A;  1G6N A;  2AXT C;  3HZJ A;  3SXY A;  2E7W A;  3IKT A;  1OLT A;  2Y30 A;  4M9S A;  3VIB A;  1T08 B;  2BW3 A;  1OR7 A;  2W25 A;  3IC7 A;  4CZZ A;  3GBG A;  2NVQ J;  3VVY A;  2HR3 A;  4AID A;  1Q1H A;  3JRH A;  4P55 A;  4A93 J;  2QKL B;  1Y0U A;  4RBO A;  3IUV A;  3LAJ A;  2NVT J;  2PMU A;  4XKV A;  2FBI A;  3DPT A;  1FIP A;  2R5Y B;  1YJ9 I;  1KU3 A;  3OYC A;  1FY7 A;  2MYS A;  1X3U A;  1MBJ A;  3OV8 A;  3C3W A;  4L0Y B;  1KU9 A;  1ZHF A;  2DA4 A;  4I01 A;  5CXI A;  2F48 A;  1OMI A;  2A68 F;  4EV0 A;  5J6X A;  4E7H A;  3P9K A;  2A6T A;  4BQA A;  4GCK A;  1XSV A;  1G3Y A;  4BXU A;  5DM6 F;  4CGZ A;  2OUM A;  3HG9 A;  3KP7 A;  1FOK A;  1J9I A;  1BA5 A;  1R71 A;  4NB5 A;  3PIP F;  2CV2 A;  4O6J A;  6PAX A;  1YIO A;  3GX4 X;  5AON A;  5L3B A;  3DWL E;  3SFZ A;  4HDV A;  2X6X A;  4Q47 A;  1E3O C;  3FXJ A;  3KZY A;  3R60 A;  4E70 A;  4IO9 F;  2XHK A;  3LAP A;  2GM4 A;  1IUY A;  1G3S A;  3WTT C;  3ZQ7 A;  3RZO J;  2E36 A;  2WV0 A;  4H4K C;  4QPO A;  2VOD A;  4BGD A;  1RES A;  2F5E A;  3QKX A;  3HGY A;  1MH3 A;  3KIO A;  2CUE A;  3HPH A;  1BIA A;  3ERM A;  1J5Y A;  3ISP A;  4HRI A;  1A31 A;  3SHF A;  3GFL A;  1E3P A;  1SD7 A;  2HKX A;  2YVH A;  1RI7 A;  1IRZ A;  5GPC A;  2XAH A;  2VLA A;  5FO5 A;  3GWZ A;  2FBQ A;  4MTE A;  3BRO A;  4EGY A;  4FHT A;  2CSO A;  3FMQ A;  1IO2 A;  3CC7 I;  3VP5 A;  1IRX A;  4HNU A;  2ID6 A;  3QOE A;  4IZZ A;  1ZEL A;  3CES A;  2X51 A;  5B66 C;  4B1R A;  2DMN A;  1X1P A;  2FBK A;  2CQK A;  3VWB A;  4X1E A;  3CJT B;  2IGK A;  2VQH A;  1IJW C;  4ZZD A;  2DPU A;  5LGT A;  1B72 A;  3H9Q A;  1IV8 A;  5M3F J;  2E34 A;  2F2E A;  2WBM A;  1WJF A;  5EG0 B;  3MD2 A;  4Y7N J;  1XGM A;  2FQ4 A;  4BE2 A;  1U5T B;  1NTC A;  3CC4 I;  3BTI A;  4DJA A;  4ENK A;  3FXM A;  1OYY A;  4A3E J;  1GHC A;  3HE0 A;  2P5L C;  5CW8 A;  1A5J A;  1YE9 A;  2ACJ A;  5K5O A;  3GTG J;  4K2E A;  1XCV A;  1UHM A;  2O5R A;  1O57 A;  2HDD A;  1BI2 A;  4NN1 A;  3DPL C;  2EV0 A;  3ZGK A;  2RNJ A;  3DEU A;  1S6L A;  4KT5 C;  3GFI A;  2OF7 A;  2DQL A;  2MLK A;  3S32 A;  5L3G A;  2KDO A;  3S93 A;  4D7N A;  2DA3 A;  5JR3 A;  3WTV C;  4JNN A;  2O9L A;  1RUN A;  1P7J A;  2R7U A;  3GW2 A;  3F8B A;  3LFU A;  4HLX A;  4KIT B;  4QIW N;  5JI6 A;  3F9K A;  3I59 A;  1VZ0 A;  3TW7 A;  4DGW B;  1JXS A;  3U2R A;  3RKQ A;  3BG3 A;  3IH4 A;  5TJJ A;  4E7S A;  2MC4 A;  3OYL A;  2GLO A;  1MGT A;  2HEO A;  1I6H J;  1X4O A;  1MSE C;  4C2M J;  1QPI A;  2B1E A;  4RB0 A;  1Y1W J;  3HOS A;  1LFP A;  1MJ9 A;  2EJR A;  4DNC A;  2K27 A;  3HTI A;  2GXB A;  5HDK A;  3O3K A;  4U88 A;  4BHB A;  2KRH A;  5FJ8 J;  2LRD A;  4RGX A;  1WCM J;  5J4V A;  4LK1 F;  1TWH J;  1XSX A;  4C9Y A;  2LTP A;  1ZGW A;  1MMS A;  2HQA A;  2NOG A;  2LKS A;  1XCB A;  3L00 A;  2DA2 A;  1XG1 A;  3L2Q A;  1T0F A;  2BOL A;  3OYB A;  5EEA A;  3ZMV A;  2KRF A;  4MQV A;  3TP3 A;  1RC9 A;  2UWM A;  2XDN A;  4CXF A;  4ZYE A;  1VQP I;  1UFM A;  1GLN A;  1NHA A;  3QOP A;  4L5I A;  4L5E A;  2I8D A;  3MVP A;  1R4M B;  2KPM A;  3VOX A;  2Q0O A;  1I1S A;  1B59 A;  4HX7 A;  5KVR A;  1LNW A;  1KU2 A;  3WHC A;  1S72 I;  3ABK H;  2KIM A;  1YI2 I;  5KAI C;  1K6O A;  5CPR B;  5HDG A;  2A61 A;  2R92 J;  3BWG A;  3HOX J;  1JKQ C;  3HM5 A;  1RZ4 A;  3G71 I;  5ILV A;  1IDY A;  5J1Y A;  3H0G J;  1IGN A;  1HKS A;  3OIQ A;  1PVE A;  2ZXJ A;  4M6Y A;  1I1G A;  2RRE A;  5F6F A;  2K7L A;  1LUJ B;  2NVX J;  1S8N A;  3AQT A;  1ORK A;  2CFX A;  3RYR A;  2QM3 A;  4HPQ A;  4F55 A;  4I02 A;  2NS7 A;  2QA4 I;  1ZR2 A;  4Y4R A;  3MCZ A;  3EPZ A;  5FKO A;  2QTQ A;  4MTD A;  1VQ6 I;  1MJB A;  1HBX G;  1TNT A;  2DG7 A;  2L9N A;  2J5P A;  2L01 A;  2LK2 A;  3OYF A;  3A0H C;  2WAD A;  2RDP A;  1BM9 A;  5CKT A;  1Y0N A;  2CUF A;  3BR3 A;  4N9H A;  4J19 A;  3HOW J;  2OI8 A;  3K10 A;  5D4S A;  2ZXI A;  1JI8 A;  2DTZ A;  3Q9S A;  2VON A;  3HOT A;  2F4O B;  4HNT A;  2IS4 A;  4Y13 A;  1H9T A;  1SMT A;  2FNA A;  5F0H A;  5HOO A;  4E7Z A;  2XF7 A;  4JX6 A;  2DTR A;  1F9N A;  5GAE J;  1OR7 C;  1TP4 A;  1B4A A;  5FKL A;  3A4C A;  4HAM A;  2VXD A;  3E6C C;  1MMN A;  3V6G A;  3O6B B;  2PLY A;  3DKW A;  3G4S I;  1J0R A;  2DXI A;  2NP5 A;  4LMY A;  4A3G J;  1XN7 A;  3K4K A;  4QLC U;  1TT5 B;  3NS4 A;  1VQO I;  1HOM A;  2YVE A;  2HQR A;  1G59 A;  3G73 A;  2X1E A;  3WU0 A;  5H2F C;  5EGO B;  1HLV A;  4UNO A;  2O8X A;  3IHU A;  3C1D A;  3HEF A;  4PCQ A;  4IOA F;  2PI0 A;  5L3D A;  3F3X A;  3V8L A;  3GUD A;  4LIU A;  3MKW B;  1GT0 C;  2VB6 A;  1YFH A;  1WI9 A;  2K02 A;  2OCC H;  3U21 A;  4PFO A;  3JRD A;  3HTJ A;  5FKN A;  3ONQ A;  4FE7 A;  2JZY A;  2ETH A;  1YX5 A;  4OIQ F;  2IA2 A;  3WGG A;  3V8K A;  1QGP A;  1FWZ A;  3K69 A;  3ZRG A;  4EJW A;  4PJJ A;  3J7A O;  5AQC A;  2KIQ A;  3WE2 A;  3G56 A;  1POG A;  2ZY9 A;  3VUQ A;  5EYR A;  3JSJ A;  1S5L C;  3CJQ B;  1ENH A;  3OS0 A;  1D8J A;  4M71 A;  2E5N A;  3OSF A;  2XPV A;  3I55 I;  2QVO A;  4LB6 B;  2EA2 A;  2ZXW H;  3SZT A;  2H6C A;  3EET A;  2CMP A;  2XAQ A;  3FBI B;  3K70 C;  5DCM A;  4E7L A;  2QIB A;  1PP8 F;  1ZR4 A;  2G9W A;  3ZMS A;  2G7U A;  3IH3 A;  3O2P E;  2CQN A;  3ANP A;  4DOZ A;  1R1T A;  3JRG A;  2DOA A;  2GAU A;  1PJR A;  3BR1 A;  4NQW A;  1P7I A;  4W1U A;  4Y33 A;  3KP4 A;  1ON1 A;  1EKE A;  3VSL A;  2YSR A;  3ZQL A;  3VYS B;  3MNL A;  2D1V A;  3HSE A;  3JSO A;  3ZQQ A;  2DDA A;  2ZXH A;  4CHU A;  4XQF A;  1QNT A;  4UXN A;  1NH3 A;  3MN2 A;  4M9X A;  3KKC A;  4HQM A;  1HQC A;  2EBI A;  1UB9 A;  4XOR A;  1S7E A;  2G7S A;  3S3O A;  1SVM A;  4XRS G;  5HNF A;  1W5S A;  1CF7 A;  3CCR I;  2BW3 B;  1UI6 A;  4UVC A;  4BBS J;  4E4H A;  4I99 C;  4IRI A;  2F5F A;  1I39 A;  3HJE A;  3KYD B;  1OCO H;  2P5K A;  5IT9 K;  3S1R J;  2R7Z J;  2EZK A;  2BZT A;  4MO7 A;  2HOE A;  1UJ8 A;  1H89 C;  2HDW A;  3H36 A;  1N77 A;  5DV5 A;  5J8F A;  4X6A J;  4J00 A;  2WY8 Q;  3QU3 A;  5FLV A;  3QAH A;  4ZYA A;  4I6Z A;  3CCE I;  2QBY A;  1Y56 A;  2LDU A;  1JKR C;  2R7F A;  4OWR B;  1U9O A;  2H6B A;  1Z77 A;  2EIJ H;  3WG9 A;  2K40 A;  1MW7 A;  3KYC B;  4BJT A;  1BC8 C;  5GAG J;  2HYF A;  3GFJ A;  5LHG A;  2EK5 A;  4OIO F;  1PP7 U;  4IHS A;  3SEZ A;  2GXA A;  1HW5 A;  1UHS A;  2XF5 A;  3A01 B;  2WC2 A;  5F27 A;  3HUG A;  1TBX A;  3W6J B;  2E1N A;  4XM3 A;  1U5T A;  2Y31 A;  1TTY A;  4DBQ A;  2CQQ A;  2VJI A;  3M9A A;  3T0Y A;  2H8W A;  3DTE A;  5ERI A;  5M5Y J;  4KIS A;  1MMD A;  2O7T A;  1Z6T A;  2NXN B;  4HST A;  4LG3 A;  3OL3 A;  1XX5 A;  4KA4 A;  3K9T A;  3L2C A;  3L7W A;  2A69 F;  3BTC A;  4JX5 A;  4RAY A;  1YX3 A;  1Z6R A;  1ZLJ A;  3BCB A;  2FML A;  1Z3Y A;  1HC8 A;  4TV7 A;  1UG0 A;  4HF2 A;  2X48 A;  4UUT A;  2EIK H;  5B5E C;  2KHM A;  1MMA A;  5CVR A;  5FRM A;  2UXN A;  3FMS A;  1IXR C;  1ETO A;  3OIP A;  1A35 A;  2P6T A;  2GQQ A;  4RS8 A;  2BY3 A;  2Q8K A;  2KIS A;  3BQY A;  4LGW A;  5K7F A;  4E7I A;  4EAT A;  1MJA A;  1YIJ I;  4OD5 A;  2R7W A;  1U5T C;  4LOC A;  5E3O A;  2OAZ A;  3KFW X;  2BY1 A;  1DUX C;  2X85 A;  3S2D J;  5HDN A;  5D6E A;  3VPR A;  4B4C A;  3K2A A;  5B1B H;  3PO3 J;  2XGE A;  2R0Q C;  4KMU X;  4E6K G;  3CDH A;  2DCE A;  1IG7 A;  2HGC A;  1TNS A;  3VYR B;  3C2H A;  4P1W A;  1XMK A;  2FA5 A;  2R7D A;  3GCM A;  4RM3 A;  2XAS A;  3BJ6 A;  2K5C A;  4MK6 A;  2ZFU A;  9ANT A;  3FZV A;  1GDT A;  4XLE A;  3H5R A;  1ZTR A;  1O7L A;  3P9T A;  4OIR F;  2F07 A;  4GYG A;  2DK8 A;  1TL8 A;  4U87 A;  4WXH A;  3NXC A;  3O60 A;  2IA1 A;  1MIJ A;  3TMO A;  2OPT A;  2L4A A;  1A6Q A;  3H3U A;  4RDU A;  3J80 K;  2HOS A;  4GFK A;  1BI0 A;  1K4S A;  5HLI A;  1O3T A;  1IRF A;  2OU2 A;  2HYG D;  3K4L A;  2M0C A;  3DQV C;  1FC3 A;  1EF4 A;  5C4Y A;  4A3K J;  2IU5 A;  2WUI A;  1SVL A;  3W6K B;  2A05 A;  4AVZ A;  1RET A;  3HRU A;  3MEX A;  4P9F A;  4ASN A;  2L4M A;  2L7Z A;  2ZJQ F;  5BQT A;  5FHP A;  1XPX A;  4NC8 A;  2FX0 A;  5HBU A;  2VT2 A;  3ZMT A;  2R3S A;  4F3Q A;  1SD5 A;  4DIQ A;  2STW A;  2GA2 A;  4KNY A;  3F8M A;  2H27 A;  4M6V A;  2JMW A;  4JK1 X;  1ZAR A;  3GLL A;  4BJ5 C;  1ETW A;  2B9S A;  3GTK J;  2WA0 A;  4LFU A;  4LG0 B;  3COL A;  1SD6 A;  1TW3 A;  2O3F A;  2HOT A;  1FOY A;  4D7M A;  3DBL B;  3NAU A;  3BJO A;  3TBI A;  4XOP A;  2LBF B;  3RQI A;  5E3L A;  3L2W A;  3OYI A;  3GZ6 A;  3KE2 A;  4PXI A;  4PSX A;  1T33 A;  2A5Y B;  2R7T A;  4A3F J;  3AFH A;  1S7O A;  3KEY A;  2XKO A;  1FYM A;  2RQP A;  3E3V A;  4KIF A;  4YRV A;  2V57 A;  1T2K A;  1MMG A;  2Y48 A;  2CW8 A;  4HW0 A;  4DVY P;  1DPR A;  5L3F A;  3DLA A;  3TDU C;  1UI5 A;  1XD7 A;  3HGG A;  4R79 A;  1WSU A;  1LFU P;  1WJC A;  1WH5 A;  3MZ8 A;  2YR2 A;  5ICG A;  1LE8 B;  2QOP A;  2XAU A;  3HOV J;  5J1U A;  4XL9 A;  4GO1 A;  5D8L B;  3HBL A;  1LVA A;  1MKM A;  4M3G A;  5BS6 A;  2NP3 A;  2Z3Y A;  5J4Y A;  4HX4 A;  3SFI A;  4IOC F;  5IYB J;  3KLN A;  3E6M A;  4HV5 A;  5CVI A;  3PO2 J;  1XB4 A;  3I56 I;  2PJR B;  1IAW A;  3LSI A;  5GP9 A;  3VW0 A;  4Z6Y A;  1TWF J;  3V42 A;  1OCC H;  1Z21 A;  2HVR A;  2XV4 S;  4XN0 A;  2CH0 A;  1YLF A;  1HKQ A;  5HAW A;  4ZYG A;  2ZSI B;  3SEQ A;  2QZ8 A;  2NNN A;  3J7Z I;  2RQQ A;  1EJ9 A;  4NHJ A;  3WGI A;  2WTE A;  5LLQ A;  2W84 A;  1I6X A;  3PQK A;  3IUO A;  3RTR A;  2EFW A;  4EGZ A;  4IKF A;  2JSP A;  3DLL F;  1WQ2 A;  2M34 A;  1P4W A;  4M3E A;  1JGG A;  4EJV A;  2K85 A;  4PJM A;  1OIS A;  3R61 A;  5FKM A;  3LWF A;  2L7K A;  4WCG A;  2A6E F;  1K78 A;  4DZJ A;  2OC6 A;  3K4N A;  1QBJ A;  3DV8 A;  2LOO A;  3R4K A;  2WGB A;  1TWG J;  3NWT A;  1MD0 A;  4V19 K;  5B1A H;  2NS0 A;  2QQB A;  2CUJ A;  5DM7 F;  2CG4 A;  3K6G A;  2L9R A;  2DMT A;  2KZV A;  3HYI A;  5JHU A;  3S8P A;  1VQK I;  3ULQ B;  1W36 C;  5IT9 Z;  3H35 A;  1T98 A;  2MH2 A;  2DW4 A;  2CS3 A;  2IP2 A;  2B63 J;  4U0V A;  5JHF A;  4KIB A;  2HXI A;  3RSN A;  1IN8 A;  2FQ3 A;  1QPM A;  5GAD J;  3GTM J;  2YVX A;  3N05 A;  1MBH A;  2MSY A;  2WAF A;  2XAF A;  2NNY A;  1D1B A;  1TZL A;  1UST A;  2OQG A;  2EFO A;  4IQ4 A;  1Y1V J;  3F8N A;  1X4P A;  3IRR A;  1WKM A;  2BVL A;  5FLX Z;  2V9V A;  3JSP A;  1OCZ H;  2ZME B;  4WK8 F;  1R1V A;  3SJM A;  1YO5 C;  1R49 A;  1UMQ A;  3CP2 A;  2CW7 A;  3CLO A;  3PUB A;  3GEU A;  1Z91 A;  4WXD A;  2DJN A;  3JTG A;  3LSJ A;  3BZ6 A;  2GIZ A;  2IVM A;  3E6D A;  1B8I A;  1UAA A;  2ME0 A;  5H20 A;  2MW8 A;  2L7M P;  2VKD A;  5B3S H;  3NQO A;  3E97 A;  3K1M A;  1RR7 A;  3BT9 A;  1Z7L A;  2E5Z A;  2X1D A;  3FDY A;  3GTO J;  5HVQ C;  2M8G X;  1GVD A;  2LVS A;  4A69 C;  2FNP A;  2ZJP F;  2BXY A;  3CMY A;  3ZQG A;  1KQ0 A;  3F21 A;  4MGR A;  3MFK A;  2PJP A;  5CVJ A;  1BN5 A;  2LKP A;  3ML6 A;  2LH9 A;  3VOD A;  2BEO A;  2IEK A;  3H92 A;  1FX7 A;  4BY7 J;  3UNG C;  3W2W A;  3WGH A;  5KAF C;  4AM3 A;  1FOX A;  2L2O A;  3D0S A;  2NVY J;  1W7P B;  1VQL I;  2UXI A;  2K3F A;  3JRA A;  2ID3 A;  3K4M A;  3SQN A;  2V9P A;  1Z0X A;  3W2V A;  4XKB A;  2GOM A;  2V26 A;  1L3L A;  3IL2 A;  4PSW A;  4NC7 A;  1WI3 A;  1MNM C;  3BG7 A;  2K9N A;  3HHG A;  3CCQ I;  1DU0 A;  3BG6 A;  4G94 A;  5DD4 A;  4KUM A;  2AS5 F;  1XMX A;  2LG4 A;  4OMZ A;  1Z3X A;  5EEG A;  2CU7 A;  4RB3 C;  4M74 A;  1H8A C;  2EV6 A;  3OMY A;  2NVU B;  1VQ5 I;  2M8E A;  3RI4 A;  2CYY A;  5LEJ A;  3CCL I;  2HPI A;  3JCU C;  1W0U A;  5TIS C; 
#chains in the Genus database with same CATH homology
 2DG7 A;  2L7F P;  4JL3 A;  2G0E A;  1U8B A;  3CJD A;  2AO9 A;  4M3B A;  2KDZ A;  2LK2 A;  3O8H A;  2JA7 J;  2XGC A;  1DU6 A;  4ME9 A;  2CUF A;  3BR3 A;  4FE4 A;  4YZE A;  2Q24 A;  2D5V A;  3TP0 A;  4J19 A;  3HOW J;  2OI8 A;  2LD5 A;  2DTZ A;  4MLO A;  2VUM J;  3HOZ J;  3BRU A;  2ZOZ A;  3QQA A;  1HCR A;  2VPR A;  2CJJ A;  3OIO A;  1AU7 A;  3QPL A;  5F0H A;  4JX6 A;  1XS9 A;  4A3C J;  4M3F A;  5FKL A;  2EH3 A;  1SFO J;  3RD3 A;  3DCF A;  2JN6 A;  1JT6 A;  3V6G A;  3DPJ A;  2NP5 A;  3B81 A;  4GFL A;  4FIS A;  4A3G J;  1D5Y A;  2UXU A;  4A3B J;  1HOM A;  3Q0W A;  4XIC A;  2YVE A;  4HNV A;  2JA5 J;  3BQZ A;  1K83 J;  2XB5 A;  5EGO B;  1HLV A;  2PZ9 A;  3V78 A;  2M2E A;  3HEF A;  1NK3 P;  1JKP C;  4MIM A;  4UUS A;  3WHB A;  2XGD A;  3JRC A;  4XID A;  1WGX A;  1GT0 C;  5E3N A;  2HYT A;  3L1P A;  5HSZ A;  1NK2 P;  4C3J J;  4EEF G;  2HKU A;  2H1K A;  4AC6 A;  3RZD J;  2XPU A;  3NAR A;  1ETK A;  5IOY A;  2FJ1 A;  3JRD A;  3HTJ A;  5FKN A;  4FE7 A;  2E1O A;  3S1M J;  5J1R A;  5BNG A;  2IAI A;  4AC0 A;  1X2N A;  2DA5 A;  1GUU A;  1U9N A;  3G1M A;  3FK7 A;  4A3D J;  1FIA A;  2Y9Y A;  1VND A;  4G12 A;  2JJ7 A;  4UUS B;  1QVU A;  2Y2Z A;  5AQC A;  3AQS A;  3I4M J;  1POG A;  3G56 A;  1IC8 A;  3NI7 A;  3VUQ A;  5EYR A;  4XRS A;  1U78 A;  3A02 A;  1O4X A;  2QKO A;  3JSJ A;  2ELK A;  4KWA A;  1ENH A;  1BW5 A;  4JX4 A;  3DEW A;  3OSF A;  2XPV A;  2K9Q A;  3FKI J;  3LWJ A;  2ZB9 A;  2X9D A;  4XRM A;  3A03 A;  4IEJ A;  2QIB A;  2YU9 J;  2YS9 A;  4FCY A;  3LOC A;  1ZR4 A;  3RH2 A;  1I50 J;  3IH3 A;  5F08 A;  3ANP A;  1B8I B;  3PPB A;  3JRG A;  3BG9 A;  3BR1 A;  4W1U A;  2H8R A;  1P7I A;  3GTJ J;  1HDP A;  3NPI A;  4IHV A;  2GEN A;  3HIM A;  3ZQL A;  2HOA A;  2EZI A;  5EZG A;  2CRG A;  2MG4 A;  2R5Y A;  2LR8 A;  3I4N J;  3H3V K;  2PBX A;  3MNL A;  4CGR A;  4A3L J;  3KKC A;  3MN2 A;  1ZKG A;  2R5Z A;  1T56 A;  1ETQ A;  2EBI A;  5EZH A;  1IUF A;  1W0T A;  2G3B A;  5D1R A;  5IP6 A;  4QTR A;  1A6I A;  4IHY A;  2OER A;  3BHQ A;  1S7E A;  2G7S A;  5K7Z A;  5FMP A;  3VVX A;  3SDG A;  4XRS G;  3UKG A;  2UXP A;  1GV2 A;  1APL C;  4DZP A;  4XK4 A;  1UI6 A;  2I10 A;  5DAJ A;  1UG2 A;  3OSG A;  4JKZ A;  2LY9 A;  4BBS J;  2GUH A;  5IPA A;  3OOU A;  3S16 J;  1F43 A;  2DMU A;  3S1R J;  1I3Q J;  2R7Z J;  2AHQ A;  2EZK A;  4MO7 A;  3JRE A;  1Q1V A;  1H89 C;  2ZCN A;  4DYC A;  4GCL A;  3TED A;  4X6A J;  2NX4 A;  4NEL A;  5FLV A;  2LLK A;  1JJ8 C;  4I6Z A;  3LJL A;  3QBM A;  5C4J J;  1JTX A;  1JKR C;  3FIW A;  2E2J J;  3ON2 A;  1FTT A;  4ABZ A;  1U9O A;  4B3A A;  2ZCM A;  2HQ5 A;  1Z77 A;  2K40 A;  2XPW A;  5IP7 J;  2QF7 A;  1MSF C;  2DA7 A;  2EZL A;  3GZI A;  1ETV A;  1ETX A;  4UDS A;  1YRN B;  4V2G A;  1UHS A;  3LSG A;  3A01 B;  2W53 A;  5F27 A;  3BJB A;  1FTZ A;  3ZQH A;  3BTJ A;  2Y31 A;  2O7O A;  5CXI A;  2CQQ A;  5M5Y J;  5IYC J;  5FGL A;  2O7T A;  3HOY J;  2QCO A;  3HTH A;  4QSH A;  3EUP A;  1RKT A;  1ZK8 A;  3BTC A;  3G7R A;  2QWT A;  4JX5 A;  1B72 B;  2WAQ N;  2REK A;  3BNI A;  4DYQ A;  3LHQ A;  2KT0 A;  3EGQ A;  2GFN A;  3FK6 A;  2EQR A;  3MKL A;  2X48 A;  4UUT A;  2MGQ A;  5IOZ A;  1BJZ A;  1TWC J;  1IV6 A;  1ETO A;  1LFB A;  1JTY A;  1G2H A;  3GTL J;  5IP9 J;  1JUP A;  1OFC X;  1BL0 A;  1QVT A;  3CDL A;  3QPS A;  2LFB A;  2DA1 A;  2P81 A;  3BG5 A;  2CQX A;  1JKO C;  5K58 A;  3CRJ A;  5K7F A;  3BQY A;  5F1J A;  2G7G A;  5M5W J;  4CYC B;  3D1N I;  5C4X J;  4LOC A;  4BBR J;  2R93 J;  5E3O A;  2VKV A;  3VW2 A;  4D5F A;  3S2D J;  3VPR A;  4JYK A;  4B4C A;  5C3E J;  3K2A A;  3PO3 J;  1X2M A;  5JLW A;  3S2H J;  2XGE A;  1MH4 A;  2WB1 N;  2R0Q C;  1YRN A;  1PUF A;  4C3I J;  2E2I J;  2HI3 A;  1LE8 A;  1IG7 A;  3BCG A;  1JUM A;  5C44 J;  3G1L A;  5F0F A;  5GPA A;  3BR6 A;  2ME6 A;  3ZOB A;  3F1B A;  3C2B A;  3M3Y J;  2L0K A;  3FIS A;  4MK6 A;  9ANT A;  4BY1 J;  2G7L A;  1OCT C;  2YUS A;  1GDT A;  3KZ9 A;  3BR0 A;  1ZTR A;  1HF0 A;  5EGO A;  2NS8 A;  4AF5 A;  5K7H A;  3P9T A;  2F07 A;  4ICH A;  3NXC A;  3O60 A;  3T6N A;  3NNR A;  1WH7 A;  2JK3 A;  2OPT A;  3VW1 A;  3KNW A;  2HOS A;  3E7L A;  4RDU A;  4GFK A;  2GBY A;  3BR5 A;  3CCY A;  2JA8 J;  2Y30 A;  2M0C A;  1EF4 A;  5C4Y A;  3M4O J;  3TW6 A;  4AYB N;  3VIB A;  5JLX A;  5F04 A;  2XB0 X;  4A3K J;  1FEX A;  2IU5 A;  4BXX J;  2WUI A;  3S14 J;  3FRQ A;  3GBG A;  1RET A;  2NVQ J;  3VVY A;  2DMQ A;  3JRH A;  4A93 J;  2TRT A;  2XRL A;  2L7Z A;  3HB9 A;  4RBO A;  5FHP A;  3IUV A;  1JUS A;  2FX0 A;  5HBU A;  4GCT A;  2NVT J;  1MBF A;  4FTH A;  1FIP A;  2R5Y B;  2TCT A;  5J3L A;  4M6V A;  5EG0 A;  1ZQ3 P;  2JMW A;  2XSD C;  5CXG A;  4GFB A;  1MBJ A;  1ETW A;  2FD5 A;  3JR9 A;  2DA4 A;  3GTK J;  2LP0 A;  2W48 A;  2UXH A;  5DTD A;  3COL A;  2LKX A;  2HOT A;  3HKZ N;  4MFD A;  4GCK A;  4D7M A;  3NAU A;  1BW6 A;  4IHW A;  3E7Q A;  3O8G A;  1H88 C;  3RQI A;  1BA5 A;  5E3L A;  1HDD C;  3PAS A;  4PXI A;  2D6Y A;  1T33 A;  4Y52 J;  3IH2 A;  4A3F J;  1E3O C;  2VI6 A;  3ZQI A;  4A3I J;  2V57 A;  2GM4 A;  4DYR A;  3HOU J;  1UI5 A;  3HGG A;  5DS9 A;  1LFU P;  3RZO J;  2DN0 A;  5D19 A;  1WH5 A;  2EZH A;  1LE8 B;  2QOP A;  1PUF B;  3HOV J;  3ANG A;  5M3M J;  1K61 A;  1RES A;  3QKX A;  3HGY A;  1MH3 A;  5J1U A;  3IV5 A;  2CUE A;  1IDZ A;  3HBL A;  1TWA J;  2HYJ A;  2X6O A;  2YVH A;  4M3G A;  1IRZ A;  5GPC A;  4D5C A;  1F36 A;  3JRB A;  2NP3 A;  4W97 A;  4CYC A;  3LSP A;  2FBQ A;  3NRG A;  3SFI A;  5IYB J;  3PO2 J;  3VP5 A;  4NDL A;  2O8K A;  2ID6 A;  5GP9 A;  4MXM A;  3VW0 A;  4AUX A;  4M3D A;  1TWF J;  4B1R A;  2DMN A;  2N8G A;  4X1E A;  5HAW A;  1IJW C;  1B72 A;  2ECB A;  5HOD A;  3K7A J;  5M3F J;  3C07 A;  2JA6 J;  1RKW A;  5EG0 B;  4Y7N J;  3Q0V A;  2FQ4 A;  1OJL A;  4JP0 A;  3JRF A;  3G1O A;  4BKX A;  2M34 A;  1NTC A;  4M3E A;  2JWT A;  4I76 A;  1JGG A;  5FKM A;  3LNQ A;  3BTI A;  2HXO A;  3A01 A;  4V2F A;  2E19 A;  1XC5 A;  4A3E J;  3HE0 A;  5EDN A;  5CW8 A;  1SGM A;  4DZJ A;  2DG8 A;  1A5J A;  5EFY A;  1VF9 A;  3GTG J;  2WGB A;  5EF6 A;  4HKU A;  2WV1 A;  1TWG J;  2HDD A;  5IYD J;  4NN1 A;  1VFC A;  5M5X J;  2L9R A;  2DMT A;  3PM1 A;  3GTP J;  1AHD P;  2COB A;  1JJ6 C;  4S0H B;  2ZOY A;  2OF7 A;  4D7N A;  2DA3 A;  1SAN A;  3S1N J;  4JNN A;  3BTL A;  2O9L A;  2B63 J;  2M9H A;  3W6V A;  1P7J A;  4IHX A;  2HXI A;  3S1Q J;  1QRY A;  3S17 J;  5H9T A;  1VI0 A;  4QIW N;  3Q0U A;  3TW7 A;  5FLM J;  3RKQ A;  3JRI A;  3BG3 A;  3IH4 A;  3GTM J;  1MBH A;  2MSY A;  2GLO A;  2DA6 A;  1I6H J;  1MBE A;  1MSE C;  4C2M J;  1Y1V J;  1QPI A;  4A3J J;  1ITY A;  1AKH B;  1ETY A;  1Y1W J;  4DW6 A;  5E3M A;  1OCP A;  2ECC A;  2R5Z B;  1FJL A;  3HTI A;  3ON4 A;  3Q3S A;  3SJM A;  5FJ8 J;  1UMQ A;  1WCM J;  3GEU A;  1CQT A;  2DJN A;  1JT0 A;  1TWH J;  2LTP A;  1ZGW A;  3BR2 A;  3KKD A;  3LSJ A;  2NOG A;  1B8I A;  2ME0 A;  2DA2 A;  1XG1 A;  3HTA A;  2MW8 A;  2L7M P;  4ACI A;  1RR7 A;  3BT9 A;  2PMZ N;  5EEA A;  3VVZ A;  2IBD A;  3CQZ J;  3GTO J;  2E2H J;  2LVS A;  1GVD A;  2M8G X;  3TP3 A;  4A69 C;  2RHA A;  2XDN A;  3S5R A;  3CMY A;  3ZQG A;  3GTQ J;  3B6A A;  1TC3 C;  5D18 A;  4L5E A;  1X58 A;  3MVP A;  4C3H J;  3VOX A;  3VOK A;  2Y9Z A;  3WHC A;  5F0C A;  2Y0S N;  2IEK A;  3S15 J;  4BY7 J;  2R92 J;  4A3M J;  2NVY J;  2UXI A;  5FKK A;  1AKH A;  1RPW A;  3JRA A;  3HOX J;  2ID3 A;  1MBG A;  3HM5 A;  3F0C A;  1JKQ C;  1Z0X A;  2RAS A;  5J1Y A;  1IDY A;  1MBK A;  3H0G J;  2ZCX A;  1R9T J;  1IGN A;  1WI3 A;  1MNM C;  2UXO A;  2K9N A;  3B6C A;  1DU0 A;  2NVX J;  3AQT A;  1ORK A;  3CWR A;  2CU7 A;  3HDD A;  1H8A C;  2NS7 A;  2K9S A;  3LSR A;  1ZR2 A;  4L62 A;  2DMP A;  2VKE A;  1WPK A;  5FKO A;  2QTQ A;  4MFE A;  3ZQF A;  2RAE A;  3ZQC A;  1W0U A;  1GV5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...