2ZB9A

Crystal structure of tetr family transcription regulator sco0332
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
188
structure length
188
Chain Sequence
GRRPAEEVRAEVLHAVGELLLTEGTAQLTFERVARVSGVSKTTLYKWWPSKGALALDGYFHAVEDTLAFPDTGDVRADLLAQLRAFTHVMTRTPGGRILTELIGAAQTDADLATAYRQLYSAQRRALAAERLRHARELGQIRPDVDVQVLVDQLWGAVYHRLLIPDEPVDDAFVTALVTNLLDGVCPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative transcriptional regulator
publication title Structural and functional analysis of the TetR-family transcriptional regulator SCO0332 from Streptomyces coelicolor
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Transcription
total genus 72
structure length 188
sequence length 188
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF16859 TetR_C_11 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2zb9A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2zb9A02
1YRNA 4JNNA 2ECCA 1JTYA 4A3FJ 4V2GA 2M8GX 5E3LA 2DA3A 1WGXA 1UI6A 3FK6A 3QKXA 4BY7J 3TW6A 1LE8B 2E19A 2DA1A 4DZJA 4UUTA 3JRDA 1IG7A 3HOZJ 1I50J 2JN6A 2W53A 2X48A 3A01A 3BQZA 2DN0A 5F08A 1Q1VA 3LWJA 3A02A 2YUSA 3ZQFA 3S5RA 4X6AJ 1SGMA 4CYCB 5D19A 1JJ6C 4BXXJ 1ETVA 1B8IB 3C07A 4S0HB 1HF0A 2DTZA 1BW6A 4BKXA 2OERA 4EEFG 1APLC 1T56A 3QPSA 1OCPA 2IBDA 3EUPA 3LSRA 3HOUJ 3IH4A 3JRIA 3Q0UA 4ACIA 1AKHB 2ZOYA 1W0UA 2JJ7A 2UXHA 3GTPJ 4L5EA 2HOTA 2WV1A 4JX5A 2HDDA 1IUFA 3E7LA 2X6OA 2XGCA 3O60A 2TCTA 1MBKA 4J19A 2REKA 3BCGA 1GV5A 4GCKA 2LFBA 4IHWA 2Y31A 3IH3A 2VPRA 2WAQN 2FD5A 3JRHA 3FIWA 3D1NI 1ITYA 1JKRC 3HOYJ 3OSFA 2N8GA 4XRSG 5FMPA 4M3FA 3BNIA 3TW7A 3HTJA 3VOXA 3B6CA 3HTIA 2X9DA 4HNVA 3HKZN 1HCRA 4GFBA 3ZQCA 3LOCA 1Z77A 2LY9A 2D5VA 3ON2A 3S2HJ 2ELKA 1H89C 3RKQA 5EG0A 1X2MA 1WH7A 4C3JJ 3HTAA 5M5WJ 1RR7A 1JGGA 5IPAA 4C3HJ 2FBQA 3VIBA 1TWAJ 2XB5A 2O7TA 2YVHA 3BHQA 1JKQC 2Y2ZA 1MBHA 4A3EJ 5C4XJ 2G7SA 1JT6A 5DAJA 4M3BA 3MKLA 2YU9J 3CCYA 2EZHA 1H8AC 5CXIA 3JREA 3BG9A 1ZKGA 3HTHA 1LFBA 1QVUA 1NK2P 3AQTA 3KZ9A 2LTPA 4RDUA 2F07A 3BTCA 1I6HJ 4QSHA 3PO3J 1WCMJ 5IYCJ 2RHAA 2E2IJ 1TWFJ 2GUHA 3WHBA 2CJJA 1ETKA 3HGYA 5EDNA 4IHYA 3AQSA 3RQIA 4LOCA 2KDZA 3QBMA 1FIPA 4KWAA 3Q3SA 4I76A 4XRSA 1RESA 3HE0A 4L62A 3HEFA 2L7MP 3OOUA 5K7FA 3SJMA 3GTKJ 4M3GA 4DYRA 4GCLA 2ZB9A 2E1OA 2LK2A 2UXOA 2Y0SN 4Y7NJ 3DEWA 3G56A 2QCOA 2WUIA 1GV2A 5K58A 5IOYA 3I4NJ 4JP0A 2L0KA 2M0CA 3SDGA 3S1QJ 3BRUA 1JT0A 1Z0XA 1F43A 3BTJA 3HM5A 1FTZA 1QVTA 3JRCA 3JR9A 3HOWJ 1GDTA 3K2AA 4DW6A 2G0EA 1ZR2A 2XPUA 3IH2A 1XS9A 2VI6A 3K7AJ 1B8IA 3P9TA 4QIWN 3S1RJ 2H8RA 5FHPA 3KKDA 5FLMJ 4BY1J 3VW1A 4A69C 5FLVA 1OFCX 3O8HA 4V2FA 3NRGA 5EEAA 4XRMA 3NXCA 1EF4A 4MIMA 5F0HA 1AKHA 1FTTA 1HDPA 5J1UA 1DU6A 2CRGA 4DZPA 5IP7J 2WGBA 1ZR4A 2R92J 1QRYA 1SANA 3FISA 3G1OA 1WPKA 1ZK8A 3BR2A 1HOMA 2XGEA 3MVPA 2ZCXA 5K7ZA 4MFEA 2VUMJ 2DG8A 1UHSA 3MN2A 5F0FA 5EYRA 2MW8A 4A3MJ 5GP9A 1JKOC 1UG2A 1TWCJ 1VI0A 2DA6A 5F0CA 5D18A 4FE7A 2MG4A 3OIOA 4IEJA 5JLXA 2FX0A 3A03A 5FKLA 2HKUA 1VFCA 2K9NA 4AC0A 4A3LJ 5F27A 3CQZJ 2NVXJ 1U8BA 2ME0A 3BJBA 3C2BA 2ME6A 4I6ZA 3QPLA 5HAWA 3HB9A 2JWTA 3S16J 2Y30A 4W97A 3S1MJ 5GPAA 3FRQA 2B63J 3LJLA 2YVEA 3NNRA 4NELA 3RH2A 4M3DA 5CXGA 2QKOA 1PUFB 2DMNA 3EGQA 2G7LA 3B6AA 3JSJA 1IDYA 4MFDA 2EQRA 4NDLA 1MBFA 2JA5J 4JKZA 4UDSA 4AF5A 5K7HA 5IOZA 4AC6A 1ETYA 5BNGA 2L7ZA 4D5FA 1BL0A 4D7MA 3RZDJ 3UKGA 2R93J 4A93J 2IEKA 5E3OA 2EBIA 1IRZA 1ZQ3P 1JKPC 1DU0A 1FEXA 3BTIA 2GM4A 2DA7A 5FKKA 2QOPA 2XPVA 5HBUA 3SFIA 1ZGWA 4XK4A 3Q0WA 3GZIA 5FGLA 3HDDA 2DA5A 1ETQA 2YS9A 4GFLA 1RETA 2JA7J 3S2DJ 4A3IJ 2DA4A 1T33A 3KNWA 3M3YJ 2JA6J 5FKOA 1K83J 1AHDP 3ZOBA 4B3AA 2JK3A 1UI5A 2XPWA 2DMPA 1MSEC 1JUPA 2HXIA 3FKIJ 5HSZA 4AYBN 4ME9A 5JLWA 4MLOA 2IU5A 2CQXA 1FJLA 2ID3A 2NX4A 1I3QJ 1D5YA 2NP5A 1XG1A 5DTDA 1R9TJ 2EZLA 1JUSA 3CDLA 4MO7A 3PO2J 1BW5A 5D1RA 5E3MA 3HOXJ 1MBGA 2R5YB 1NK3P 4M6VA 1P7IA 2OI8A 2NVYJ 2LKXA 1FIAA 4G12A 2PBXA 1K61A 5EZGA 2PMZN 3FK7A 2JA8J 3I4MJ 2EZKA 3L1PA 2NS8A 1U9NA 3BR5A 1RKWA 5GPCA 4JL3A 3W6VA 1IDZA 1X58A 5IP6A 3BT9A 4A3JJ 3PASA 3H3VK 3KKCA 1MBEA 1H88C 3ZQGA 5C3EJ 4A3CJ 4DYCA 1IV6A 1XC5A 3WHCA 4MK6A 2V57A 1MH3A 2QIBA 3BQYA 5F1JA 3VUQA 4GFKA 2VKVA 3G1LA 2L9RA 3BR6A 4BBRJ 2D6YA 3LHQA 2HXOA 1UMQA 4A3BJ 3DCFA 4HKUA 1MSFC 2Y9ZA 4BBSJ 3HIMA 3VVYA 2G7GA 3B81A 2HYTA 1O4XA 2P81A 3TP3A 4A3DJ 1VNDA 3G1MA 3O8GA 3JRAA 4PXIA 2Y9YA 1MBJA 2LD5A 2ZOZA 3S17J 4ABZA 4D7NA 5AQCA 3RD3A 2DJNA 3JRBA 1IC8A 3GTQJ 4GCTA 5F04A 2DMUA 4JX4A 2QTQA 5EF6A 2M9HA 3BR3A 3S1NJ 2CU7A 2VKEA 3QQAA 3GTOJ 2LVSA 3ANGA 1X2NA 1TC3C 2CUEA 1RPWA 2QWTA 5EGOA 3E7QA 1ENHA 5J1YA 4UUSA 3MNLA 3COLA 2K9SA 2LR8A 1S7EA 3NAUA 3V78A 4X1EA 5M3FJ 5DS9A 3LSJA 2GBYA 2Q24A 1AU7A 2ZCMA 4MXMA 1ETWA 5HODA 5C4JJ 1PUFA 1MNMC 3BR1A 2HOAA 3DPJA 9ANTA 2ID6A 1JUMA 2ZCNA 2COBA 2I10A 2RAEA 2XRLA 2K40A 3Q0VA 2UXUA 1U78A 1B72B 3S14J 2UXPA 5M5XJ 1YRNB 1BA5A 5EGOB 1IJWC 4UUSB 2EZIA 5IP9J 2GLOA 1POGA 3GTMJ 5EZHA 4JYKA 2AO9A 3HGGA 4FE4A 2XSDC 3BG3A 3GTLJ 3S15J 4ICHA 5H9TA 3VW0A 4CGRA 1QPIA 2O7OA 5FJ8J 2NVTJ 3VPRA 4NN1A 3A01B 2E2JJ 3ANPA 2G3BA 2H1KA 3ZQIA 3F1BA 3IV5A 1OCTC 2TRTA 5FKNA 5M5YJ 1TWHJ 3VOKA 2DG7A 2FJ1A 2LLKA 3GTGJ 1JJ8C 4XICA 5EFYA 1BJZA 3VW2A 3NARA 2DA2A 3M4OJ 1F36A 2EH3A 1LFUP 4Y52J 3JRGA 4QTRA 3VVXA 4FCYA 4FISA 2O9LA 3HOVJ 5IYBJ 2MSYA 2R5YA 2GFNA 2UXIA 1NTCA 5C4YA 3NI7A 3TEDA 2R0QC 2E2HJ 3GBGA 2RASA 2W48A 1A6IA 1TWGJ 4A3GJ 1HDDC 1Y1VJ 2XGDA 1OJLA 1IGNA 3G7RA 4W1UA 1WI3A 2LP0A 4FTHA 4XIDA 1RKTA 2GENA 1HLVA 1JTXA 2HQ5A 2NS7A 5E3NA 2NP3A 2ECBA 2WB1N 5IYDJ 2OPTA 2PZ9A 4C2MJ 2O8KA 5J3LA 2HOSA 3CRJA 2M34A 3F0CA 3JRFA 1G2HA 1U9OA 1ZTRA 3TP0A 1A5JA 3CWRA 2R5ZA 5C44J 2CQQA 4M3EA 2DMQA 3LSPA 1MH4A 4RBOA 2AHQA 2XDNA 3HBLA 3PM1A 3GEUA 3H0GJ 2K9QA 3GTJJ 1CQTA 1GVDA 2KT0A 5EG0B 4A3KJ 4IHVA 2IAIA 4B1RA 4IHXA 1ETXA 3LNQA 3VVZA 5M3MJ 2DMTA 3OSGA 1P7JA 2R5ZB 3NPIA 3ON4A 2M2EA 4D5CA 3BG5A 3ZQHA 3RZOJ 3IUVA 5CW8A 2HYJA 1E3OC 3CMYA 4DYQA 1GT0C 3BTLA 4JX6A 1W0TA 2NOGA 2CUFA 3BR0A 2NVQJ 2JMWA 3ZQLA 3CJDA 3LSGA 3T6NA 1GUUA 2HI3A 1LE8A 1ETOA 5J1RA 3V6GA 4C3IJ 2QF7A 4YZEA 4B4CA 2L7FP 5FKMA 1ORKA 2FQ4A 1WH5A 1VF9A 2OF7A 4AUXA 2R7ZJ 2XB0X 3PPBA 1Y1WJ 1B72A 3VP5A 4CYCA 2MGQA 1SFOJ
chains in the Genus database with same CATH superfamily
3ZXSA 2FUG2 2ECCA 2QZ8A 3HG9A 4ZJZA 2W4SA 4A3FJ 2IPQX 2K9MA 2XAJA 1L3LA 4BJTA 1YOVB 4UY8I 1UI6A 3QKXA 4HQEA 3TW6A 2VBWA 1HSJA 3VDXA 5K1YA 1V5FA 2ZXIA 1LDKB 3S3MA 4HOBA 1IG7A 2L02A 3HOZJ 2MLGA 3ZMVA 1T38A 4XLPF 1I50J 2G7UA 3V8JA 4UXNA 3A01A 2DN0A 2GXAA 5F08A 3SDBA 2MABA 3LWJA 2YUSA 2GIVA 1JJ6C 1LDJA 2IP2A 2JSPA 3EUHC 3C07A 3K2ZA 3T8RA 4E7KA 1APLC 1T56A 5E8IA 1MJ9A 4RAFA 4A2UA 3EUPA 4G8XA 2FF4A 1S3JA 2ZOYA 2V1UA 3E5UA 2QA4I 5HS9A 5KVRA 3CCLI 3BLYA 4ESBA 4BNCA 1EA3A 2HDDA 2LDUA 4L0YB 2QENA 4B3XA 2QKLB 2K5CA 3BCGA 4V19K 3R0AA 2VPRA 2WAQN 2FD5A 3CUQA 3JRHA 1Z6TA 1UG0A 1SFOJ 4O6JA 3CDIA 5FMPA 3NRVA 4M3FA 4QPQA 4AWXB 3FKJA 3ABKH 4YFNF 4Q48A 2W1OA 2P5LC 2X9DA 1FLIA 5D6EA 1HCRA 3VWBA 2PFVA 4N0BA 3WTYC 1I27A 4IO9F 1Z77A 3BP8A 3E3VA 3I0TA 4OIOF 5AIPA 2M87A 2ELKA 3CMEI 2Z1DA 2XKOA 3SZTA 2BVLA 3KP5A 2XAQA 1N78A 1LFPA 2DT7B 3WTUC 3VIBA 3OYDA 2ISYA 2EIJH 1EH7A 2YVHA 1W7PA 1K79A 3T1BA 2OC6A 4RLFA 4RB3C 4A3EJ 2XF7A 1T0FC 4UB6C 2F5CA 4BUPA 1JT6A 4AYBA 1J5YA 3R4KA 3F21A 1MMAA 1WVRA 4F52A 3OYIA 3H1CA 1BM9A 3MCZA 2WY8Q 3HTHA 4IHSA 3K4MA 4XLFA 1RC9A 2F07A 3BTCA 1V3FA 2A68F 4QSHA 1PVEA 1B9NA 1TWFJ 2CJJA 5DM7F 5EDNA 4BDYA 2PMZA 3RQIA 2VJIA 1BJAA 2R7XA 4OINF 4FQGA 3M8JA 3HEFA 3OR2C 3RYRA 3WE3A 4GCLA 3FX3A 4S04A 1RNLA 3HPGA 2BVMA 2A6TA 2AQEA 5CVVA 3E6DA 3S3OA 3LSHA 1GV2A 4DJAA 2I5UA 1MD0A 4KISA 2MD5A 3VTIA 5HLHA 3RYPA 2IGOA 4OWRB 1D1AA 4UB8C 3E0JB 3HM5A 1F43A 4C30A 4B09A 2BYVE 4JK1X 1FYMA 3HOWJ 3K2AA 1Y8QB 4PJNA 2G0EA 2MLKA 2E35A 3K7AJ 2VBZA 3J7AO 3DTEA 1IXRC 3E6MA 1XCVA 4GCVA 4A5MA 2DDAA 3V7SA 5A2QK 1H0MA 4HLXA 2DOFA 5FLVA 1OFCX 1R1VA 3NRGA 1I6XA 4A12A 4MIMA 1MNEA 1IO2A 2P6SA 4MQ9F 4Q5SF 1DU6A 5IP7J 2WGBA 2R92J 1E0EA 3SYTA 3V8KA 1VQNI 1Z9CA 4RB1A 4OIPF 1S7AA 3BR2A 2ZJQF 3DU6A 4ZYHA 2QQBA 3O6BB 1U3EM 2K3PA 3CDHA 3PFIA 2Y0MA 1JKOC 1R7JA 2LH9A 2D1HA 1VI0A 4OAYA 2MG4A 1VQ9I 3J7AY 3H35A 1N25A 3K1PA 5F27A 2HS5A 2VT2A 5ERIA 2OJED 1OR7C 5HAWA 3HB9A 1MGTA 3TO9A 3NWSA 1FT9A 3LJLA 3G71I 2VBXA 2DFFA 3LFKA 2MA3A 3OS0A 1PUFB 1KGSA 5ICGA 2Y75A 1KZHA 4Y17A 3B6AA 4M9SA 1IDYA 2MBFA 4F55A 2D1VA 2JA5J 2DQRA 4JKZA 4OU0A 5IOZA 1FX7A 3U1KA 2B1EA 2KRHA 4LG3A 5BNGA 1K7AA 4AC6A 4A93J 4D7MA 5L3CA 3LFUA 2IEKA 2E1MB 2CFOA 2VN2A 3K69A 1XSVA 3PL8A 4H4KC 2J5PA 4M73A 1JKPC 5BPIA 2O0YA 3H3UA 1MKMA 1FEXA 2GA1A 1LEBA 1O3RA 3CESA 5FFZA 4M6YA 5ICCA 4WF2A 2DCEA 3FXUA 5ILUA 3RKXA 2QVOA 1ON1A 1MJBA 2DA5A 1HW1A 1RETA 3M1EA 4E7LA 4U9NA 1DGRM 2DA4A 4EJTA 4XOPA 2GXBA 3DV8A 4O5VA 2COMA 1AHDP 4B3AA 1UI5A 2QYOA 3LA3A 2V1XA 1C0WA 5HS8A 3TDZC 5HSZA 5L3EA 3AFHA 5D4SA 2K85A 5FRMA 5ICEA 4U0WA 3KLOA 2XIGA 4MNUA 1FP1D 1KYWA 4NC8A 3ZR8X 3PO2J 5D1RA 2X0LA 1WJ5A 4MTEA 1MBGA 1NK3P 4M6VA 1U5TA 2OI8A 4XRFA 2NVYJ 1MW7A 3KZZA 1JGSA 4ANJA 3HSRA 1K61A 1KQ8A 3N05A 1KU3A 2JA8J 3I4MJ 3L1PA 4EM2A 4AVPA 4EATA 4HA8A 1P4AA 2XV4S 3HOTA 1G6NA 3H92A 4IHTA 2F6CA 4DYCA 1XC5A 4EMSA 1ZREA 2V57A 2P7CB 4M9ZA 4YEJA 2VJJA 3KLNA 4IXAA 2QIBA 2K27A 3BQYA 4C2TA 2IJLA 1FZPB 2IGKA 1T95A 3BR6A 2G9WA 1U2WA 4BBRJ 4A3BJ 2LY1A 3DCFA 4HKUA 2G7GA 2JQ7A 4OD4A 4FASD 1Z05A 1VNDA 2IA2A 3G1MA 4MGRA 1DDNA 1F5TA 2Z3YA 2BY3A 3KZIC 2JUGA 5F04A 1HKSA 2LMDA 5L3BA 4B43A 2CU7A 4NHJA 2LVSA 3RIRA 4F91B 3H5NA 2STTA 3U21A 5EGOA 2HEOA 4YRVA 5E8GA 1ENHA 4U7DA 3W2WA 1DUXC 3COLA 2LR8A 3NAUA 3V78A 4X1EA 2O61A 5M3FJ 2V1NA 3H5RA 5DEQA 1ZAOA 2GBYA 5DS9A 1IZ1A 2LOOA 1PUFA 3BR1A 2LC2A 4K2EA 3DPJA 3A0HC 5D5WB 2VQLA 2JUCA 3FHNA 2CG4A 2O3FA 4Q47A 3RDIA 3V42A 3NS4A 4F92B 5DM6F 2FQ3A 1R5HA 1BI1A 2W00A 4ZTFA 3KEOA 3MMYB 3S14J 2CV2A 3RI4A 1LKXA 3O3KA 5DD4A 1YRNB 1BA5A 1XPXA 3GFIA 2FNPA 3RKYA 1EKEA 2EZIA 4R1HA 3WGGA 1POGA 2BY1A 4N4OB 4LJZF 3GMEA 2X51A 2DPDA 5E17F 3ML6A 2XSDC 3GTLJ 2LF8A 4ICHA 5H9TA 5D8LB 2H94A 1FNNA 3J81Z 2O7OA 3GLLA 4BS9A 4CICA 2UXNA 5HVQC 2NVTJ 3JW4A 2ETHA 3PNYA 3JSPA 2XDVA 3F6VA 4P96A 4BYYA 4M71A 2HVQA 2DG7A 2LLKA 2QEXI 5B1AH 1BJZA 3NARA 1Y8RB 3K10A 4Y52J 1LFUP 3HKZA 3FBIB 3JRGA 4KIGA 4KNYA 2M45A 5IYBJ 2MSYA 2KIMA 1NTCA 2W85A 2OAZA 2JA2A 1TWGJ 2KFDA 2XGDA 1I5ZA 3BPXA 3G7RA 4CHUA 4HQMA 2HWVA 3IWFA 4W1UA 2JRMA 3KFWX 2EFQA 2CV0A 2NS7A 5E3NA 3FMQA 2PI0A 2DAOA 1FOWA 2Z16A 5IYDJ 5LGUA 2R7DA 2ZCWA 1SD4A 3GFMA 3CRJA 3F0CA 3CWRA 3L2RA 5LRSA 3SQNA 4BDZA 4M3EA 4EVIA 3LSPA 4AIJA 1MH4A 2JVGA 3DEEA 1SVOA 2RREA 1XGMA 3ZQQA 1TQIA 3E5QA 1XGOA 2A5WA 2KT0A 5EG0B 3GO5A 4IHVA 1B4AA 1IN4A 3CCSI 4IHXA 4A0YA 3HPHA 4HSTA 2DMTA 5DUIA 1ON2A 1P92A 2VQGA 2R7RA 2M0MA 4II3A 3SHFA 1J2XA 2M2EA 2V9VA 2M7BA 5FO5A 4IRGA 1LNWA 3BG5A 4KDPA 3RZOJ 4IX7A 3IUVA 1U8RA 3SWHA 4AIHA 1R1UA 4XLAA 3BTLA 1W0TA 4NBQA 1J0RA 2CUFA 1X1BA 3BZKA 3H9QA 3LSGA 1N75A 2HR3A 3CUOA 1YO5C 3CC7I 3B73A 2Q2EB 2LBFB 2XKPA 1Z3XA 2CQ7A 4C3IJ 5D4RA 4LB5A 1GHCA 1H9TA 4YZEA 2EV5A 3AKZA 5E79C 1VQPI 2WA0A 1UCRA 1VF9A 4XM3A 4AUXA 1G3TA 2XB0X 1DQUA 4HNTA 3LA2A 2NXNB 4CYCA 2ZY9A 1B59A 1MZBA 4CH7A 1YRNA 2EINH 2VPLA 2XUBA 1MDMB 4BY7J 4GXOA 4L5IA 2VASA 1LE8B 1DP3A 3HIFA 3I54A 2GIZA 3KP3A 4NB5A 4IOCF 1UJ8A 3IKTA 4ENMA 1N77A 2F4IA 4KUMA 4HW0A 1ZH5A 2JN6A 4RM3A 2KHMA 4QLCU 1T6SA 1B9MA 1ZRFA 4E70A 5EJCA 5D19A 4BXXJ 3CLQA 3T8TA 3UNGC 3F8MA 1B8IB 3LQQA 2W25A 1MMGA 4OAZA 3V7RA 4CCNA 2DTZA 1QZYA 4AVZA 3S32A 1IF1A 2R7WA 1ZARA 2CV1A 4EJVA 3I58A 4AIDA 3LSRA 2WWYA 1REPC 1VQ8I 3HOUJ 3JRIA 2Y48A 3ESWB 1VQ4I 2WC2A 2KJBA 2HQAA 2RC4A 2O8XA 3F8CA 4C9YA 2JJ7A 2UXHA 3GTPJ 3PFYA 2WV1A 2ZMEB 2Y69H 5FLXZ 3F6OA 1SD6A 3VODA 3BY6A 3O60A 2TCTA 4GCKA 3DTIA 4J19A 2REKA 4Z2YA 2LFBA 2Y31A 5E1ZB 3IH3A 3GVAA 1ITYA 3D1NI 1UZCA 3ZN0A 1SFKA 4YG2F 1FOXA 2N8GA 3G73A 2QWWA 3BNIA 5FGMA 3HTJA 2JPBA 1Z21A 2Q8KA 2VODA 4KJZA 4LIVA 1D8JA 3HTIA 1PP8F 2HGCA 3BOQA 3LOCA 4P9FA 5BOXA 3CC4I 2R4GA 4HF1A 1T8IA 2D5VA 2XF6A 4HX8A 3IKVA 2PJRA 2K4JA 3S2HJ 3AL0B 3RKQA 1A04A 5EG0A 1G59A 4PCQA 3CUQB 3WTXC 4RGXA 1YW8A 1A35A 3D0SA 3MQ0A 3WTSC 3ERMA 2W57A 4XLHA 1QU3A 2NYXA 4P9UA 2ZBKA 2L9SA 4WX9A 1JKQC 1YG2A 1D1CA 2HTJA 1SFUA 5FB2A 1DPRA 5LGTA 1KU7A 4GYGA 2QQ9A 2ZJ2A 3NQOA 3DQVC 2Q0OA 3F8FA 4WXDA 2NVUB 3KP4A 4ZZLA 3W6JB 1BIAA 1R22A 2YU9J 1SVMA 2R7SA 3JREA 2YX7A 1LFBA 1QVUA 1NK2P 2LTPA 1YX3A 3DKWA 1RUNA 1JI8A 2C6YA 4IQ4A 3DKXA 4I09A 2LG4A 3FZVA 4A6EA 4DBQA 4KITB 3L2UA 2GUHA 1SFXA 3PQJA 1ETKA 4IHYA 2DBBA 2X1EA 5B1BH 3Q3SA 4I76A 4EJWA 1YYVA 4XRSA 3HE0A 5HS7A 5DUKA 4KMUX 2L7MP 1Z67A 3IWZA 5K7FA 2E71A 3HTSB 4PJJA 3A2KA 3CJNA 2QSHX 2ZB9A 2E1OA 4ZYDA 2XAGA 1S72I 1BIBA 1YQAA 4GYIA 2DT6A 3KE2A 2UXOA 3I71A 5DYMA 3DEWA 4XONA 1P2FA 4BQAA 1OQYA 4LG0A 4JQFA 2B0LA 1MMNA 2GOXB 3KCCA 3I53A 2L0KA 3W6KB 1NG7A 3JSOA 4QPOA 4HDVA 4MQVA 3BRUA 2X6XA 2CH0A 3QYEA 3BTJA 5GAGJ 3ABTA 3I9V2 3JRCA 2DODA 1GDTA 2XPUA 3IH2A 5FD5A 1KU2A 2A6EF 4BU2A 1B8IA 1FMVA 3Q9SA 3W3CA 4QIWN 2H8RA 5FHPA 2BHYA 2CS3A 4CXFA 2YU3A 3KX2A 2M4KA 1E3HA 1X1PA 3VW1A 2RV8A 2Z9OA 4L18B 3FMSA 4A69C 1WSUA 4IPAA 4KMFA 4V2FA 3DLLF 1YS6A 3QP5A 3I55I 1EF4A 2KJCA 5F0HA 1O57A 3IRRA 5J1UA 1IRXA 2HZTA 2V1DA 3W2AA 2DPUA 2F5FA 1H9GA 4LLLA 1ZR4A 2ZMEA 1QRYA 1FBSA 2ZFWA 1AOYA 1KQ0A 1O7LA 1WRJA 1WPKA 2DYRH 1VQ6I 1HOMA 1WKMA 4ZDPA 2EWNA 1TW2A 3IP4B 4JOMA 3GX4X 5GP9A 4A3MJ 1YS7A 3CCMI 1UG2A 5D18A 2EB7A 2HYGD 1JXSA 3Q9VA 4IEJA 3MZYA 2FX0A 5E1WA 4II2A 5E1XA 5LEKA 4EGYA 1F9NA 4A3LJ 1ZGJA 1A36A 2DFHA 3BWGA 4R8HA 3HUGB 4XBFA 1LDDA 4U88A 3C2BA 4PGHA 1S8NA 2ME6A 3CO7C 5GTIC 3BROA 5GPAA 2ZXHA 3DU5A 4NELA 3RH2A 4M3DA 4FETA 2HYFA 2PQ8A 3GFJA 5A2QZ 4MFDA 4UDSA 3RPUD 4ZYGA 2HQNA 3Q5FA 3KYCB 1BL0A 2H1LA 3RZDJ 2QBYB 4HSRA 3ZRGA 2HKXA 4BE1A 2EPFA 2EBIA 4BEHA 2HDWA 1VTNC 1ZQ3P 4P5OA 2WY7Q 3BTIA 3ECHA 1A31A 2XRNA 2QOPA 3QU6A 2V6EA 1MMDA 1ZGWA 4IRHA 4XK4A 3GZIA 5LFAA 3OY9A 3EYIA 1ETQA 4GFLA 3ELKA 3K1NA 3R0JA 5CPRB 3TBIA 3MWMA 4LD5A 3ZOBA 1PUEE 2JK3A 2WAFA 4UVCA 3DPTA 4L9VA 2DMPA 4I99C 1XDSA 2ESNA 3PIPF 4ENJA 1MSEC 3FKIJ 4IF4A 4BHPA 1HA8A 4ME9A 5JLWA 4MLOA 2K02A 3DPUA 2CQXA 3MD2A 3GZ5A 2ID3A 2B3WA 2Z99A 4Y13A 3RTRA 1BI2A 3AL0C 1BW5A 5E3MA 1HQCA 1FMWA 2L9VA 2ZSIB 1T2KA 4NQWA 1J59A 3CUQC 2LKXA 3K70C 4G12A 1J7KA 4YELA 1X4OA 2PBXA 2F5DA 2O6GE 3K70D 3RPQA 3F8BA 2PFBA 3FK7A 2K86A 3J80K 3V4GA 2FOWA 3BR5A 5GPCA 5B66C 4AIKA 1IN5A 2P8TA 3W6VA 3HZJA 1X58A 5IP6A 2M3AA 2V7FA 3BT9A 4PFOA 5D5XB 1RI7A 4A3CJ 1M1EB 2ELJA 2VQHA 3WHCA 2WBMA 4MK6A 3VYRB 1U5TB 4OOIA 2VJ4A 2DW4A 3CCUI 1IRFA 1FSEA 2KZVA 5F1JA 3PUFA 3FHZA 4GFKA 3G1LA 2L9RA 3FDYA 1UMQA 4CZZA 2Y9ZA 1W7PD 3HIMA 1WQ2A 1X1CA 1DGWY 5AIQA 1WJBA 3TP3A 2DXIA 2BY0A 2VXDA 3N97A 1GLNA 3O8GA 2EJRA 2ESHA 2EV0A 5ILVA 4P55A 2BXZA 3JRAA 1LPQA 2QSGX 1W5TA 2DYSH 2Y9YA 5JVTA 3S17J 3RD3A 3DTKA 2UV1A 1BC7C 2FBHA 3GTQJ 4GCTA 2DMUA 3K0LA 3SEZA 2M9HA 3GW2A 4KIFA 3LSKA 3S1NJ 3QQAA 3QOEA 3M7GA 3F72A 3EQLF 4LFUA 1X2NA 3FXLA 1TC3C 2CUEA 3HUGA 1RPWA 3DBHB 1HW2A 2HKOA 1YX5A 3L7WA 2L4AA 1IAWA 1S7EA 4CDGA 2E34A 2E36A 4MXMA 1UHWA 1AU7A 3P9KA 1W4MA 5HODA 1QO0D 2AQFA 4HEA2 1MNMC 5AONA 3X2QH 1P4WA 9ANTA 2X6YA 2COBA 2I10A 1QQIA 2K40A 2QBYA 2UXUA 1U78A 2BY2A 4XOTA 3M1CA 3VSLA 3ZMSA 5FRNA 1ONVA 2JVHA 2DK8A 5M5XJ 5EGOB 1IJWC 3O2PE 4AU7A 2P0WA 3WTZA 1SAUA 4PJLA 3BC8A 2GLOA 3BPVA 4HLYA 1PDNC 4JYKA 2XAFA 3HGGA 4BXFA 3BG3A 3LQRA 3VW0A 2E1NA 1G3YA 4CGRA 3M8EA 3WU1B 3VPRA 4NN1A 2VB6A 2DLLA 4M6XA 4XN3A 1X3ZB 2E2JJ 1V54H 3ZQIA 3F1BA 2FNAA 1XCBA 5E18F 3IV5A 3QRFF 3COAC 5CVRA 2D45A 5J4YA 4OMZA 2BBYA 2R7FA 4GGGA 1IXSB 1LVAA 4KA4A 3ABUA 3G3ZA 1P4XA 1R5ID 3FMRA 2Q1ZB 5EFYA 2DA2A 2FRHA 1LB2A 5HNHA 2O9LA 1JHHA 1ZG3A 2HOEA 5C4YA 5E20A 3NI7A 3VOEA 4O3MA 4A3GJ 5CVJA 1Y1VJ 3CCJI 2DT5A 3FXJA 3B02A 3W2VA 4EV0A 3K4JA 2LP0A 4FTHA 1F1ZA 2HVSA 1R6RA 3GYHX 2WB1N 4UNOA 5H2FC 5CYVA 2PZ9A 4C2MA 2KMUA 2KPMA 4IL6C 1G2HA 1U9OA 1ZTRA 1JHFA 3GZNB 2STWA 5C44J 1OYIA 2CQQA 1XDUA 3DPLC 4N9IA 2GOMA 2RGVA 4IRVA 1D0ZA 2PLYA 3C2HA 3OS1A 2ACJA 4I0AA 4XQFA 3H9JA 3HBLA 2XDNA 4KICA 2GA2A 1SFEA 3L00A 1D8KA 5KCMA 1O3SA 4LLGF 3MKWB 2D2WA 4XKCA 3S8PA 3OWTA 1GVDA 1OKRA 1ZN2A 2RDPA 3FM5A 2CSOA 4B1RA 3ZMUA 3CLOA 3LNQA 3FM3A 2XAHA 3CCRI 3OSGA 2YR2A 4CCOA 3BZCA 1KA8A 1X1AA 4D9JA 3FXMA 1D5VA 2A6HF 4ZZDA 2KQRA 4BQOA 3CMMA 4G7HF 1NHAA 4YIIA 3ERED 1XMAA 3C7JA 2FE3A 1DP7P 2JMWA 1D3YA 4LMYA 3ZQLA 1EH8A 5HOOA 3CJDA 5KK1A 2ADUA 3JTHA 3T6NA 1R58A 5J1RA 3AG4H 1YITI 2EFOA 4ZYAA 3OMYA 2QF7A 4B4CA 2L7FP 3K4CA 5FKMA 1Y0NA 2L01A 2PJPA 4E7HA 2R7ZJ 2PEXA 3NWTA 2KIQA 2ZXJA 1HKTA 2FJI1 1Y1WJ 2DDBA 2AXLA 5H6QA 1U5TC 5B3SH 4E7ZA 2H6CA 1JTYA 1R4MB 1D0YA 4RAYA 4FT8A 3OYKA 5E3LA 2H27A 1MIJA 1WGXA 5JHFA 2E19A 3JRDA 4KT5C 1B6AA 1HXDA 2BEOA 4B44A 2QUFA 2CQKA 3H9GA 3WTVC 1Q1HA 1WJDA 1X3UA 4XKVA 2W53A 3PUBA 3I5UA 2RQQA 1ZELA 4WCGA 2NNYA 1SD5A 2BOLA 3A02A 3F8NA 3ZQFA 1WJAA 3S5RA 4X6AJ 4CYCB 4ZYEA 4U9LA 1S6LA 3JAMZ 1ETVA 2UWMA 3C2GA 1HF0A 2KZGA 1BW6A 4CCMA 4IRIA 4EEFG 3KEQA 1MNDA 4UV9A 2IBDA 1RIOH 2V9KA 3AG3H 3IH4A 4EJUA 1AKHB 4CCJA 1WWXA 3LL7A 4JX5A 1I1GA 4XKWA 3LAPA 1TW3A 3K4LA 5LLQA 1PJRA 3E7LA 3IL2A 2KP6A 2X6OA 4PJMA 3ASOH 1MBKA 1W5SA 2A61A 3CCVI 4IHWA 3WGHA 1AWCA 2R7QA 3IHUA 1RUOA 2V26A 3FIWA 5IY5H 2IS6A 1JKRC 2HVRA 3OSFA 4XRSG 3OOPA 4ZDLA 3OYMA 3TW7A 1GVJA 1MMSA 2YPRA 5CQEA 3VOXA 3B6CA 1LEAA 1EV7A 1STZA 4GFBA 2DOEA 3OS2A 3OYNA 4HPQA 3BCAA 3LAJA 2LY9A 2ZXWH 2JT1A 4E4HA 2X1CA 3PNVA 1H89C 3F9KA 1X2MA 4C3JJ 1QNTA 5M5WJ 1JGGA 3GWZA 5IPAA 2E1MC 3GF2A 4C3HJ 2FBQA 3TOBA 4PUSA 2XB5A 4BJ5C 3C1DA 4LITA 2O7TA 2OTJI 2DFEA 2EK5A 2Y2ZA 1MBHA 2I8DA 2IS4A 1VQKI 1TBXA 5C4XJ 4B48A 3MKLA 5TISC 3CCYA 3DF8A 4RLQA 2MFZA 2PJRB 3KZYA 3ZQ7A 1H8AC 2KL4A 3BG9A 1ZKGA 3GUDA 3KZ9A 3AQTA 4RDUA 4OMYA 3AAFA 3PO3J 2EIKH 3FXRA 4UV8A 2DI3A 3WHBA 3F22A 1FYKA 3HGYA 4RB2C 3AQSA 3QBMA 2KDZA 1HBXG 1XMKA 1FIPA 2MYSA 1NG6A 2X4HA 4U0YA 3JAMK 1RESA 3QPHA 4L62A 5HLIA 2EA2A 2ZJRF 4EM1A 3SJMA 3WTTC 2E5ZA 1QA6A 5DD8A 2Y0SA 4ZTJA 2PX9A 3BJOA 1FSHA 2LK2A 1J75A 4Y7NJ 3G56A 2QKMB 2QCOA 1OLTA 5JHUA 4YIFA 2IGMA 3I4NJ 3ECOA 1KONA 1BI3A 1UELB 1Z7UA 3G2BA 3FXOA 3I59B 5FFXA 3CF2A 2A5YB 1WJCA 2OQGA 1R1TA 1JT0A 3MZ8A 1QVTA 1QHGA 2L5QA 3FF5A 4R79A 3IAM2 3P9IA 3DEUA 3A1YA 1K4SA 4D0PA 3IC7A 1XS9A 3P9TA 3DBRB 4HRIA 1R23A 3KKDA 1WJFA 2OZ6A 2FBIA 2CYYA 2IS1A 4LK0F 5BS6A 2QQ8A 4LG0B 3O8HA 1BBYA 1FBQA 2E5NA 2K9LA 2A3SA 4PFPA 5GAHJ 1W1WE 1TLHB 2OUMA 4HV6A 1AKHA 4BHBA 4RM2A 1S9HA 5DCFA 2KRFA 1SANA 4PGGA 3FISA 2LKPA 2DFIA 5F64A 1ZK8A 2M7AA 2HFHA 5K7ZA 4MFEA 2VE9A 2VUMJ 2L9NA 1OISA 1UHSA 2OBPA 3HHHA 3MN2A 2DG8A 4BXUA 1BR4A 5EYRA 3AG1H 5LEJA 1YJWI 6PAXA 4EM0B 1TWCJ 2DA6A 5F0CA 5KHDA 1BN5A 3E5XA 4FE7A 4BE0A 2OCCH 3A03A 5FKLA 2K4BA 4I0BA 1YTYA 5D8KB 4XL9A 1USSA 4DBRA 3ROUA 4N4NB 4I7HA 4UVAA 3GXOA 1CGPA 3RJPA 2ME0A 4IZZA 2NS0A 3BJBA 4XR6A 3TQNA 1NH3A 3I56I 2JWTA 4CGZA 3FRQA 1EH6A 2B63J 1BOBA 3TKYA 4HAMA 3C18A 3NNRA 3OYFA 2QKOA 2CMPA 4IKFA 1O3TA 3OR1C 2HPIA 4GDFA 3CCEI 3EGQA 3JSJA 2EIMH 2EQRA 4NDLA 1MBFA 3S3NA 4JBAA 1I1SA 5K7HA 2E60A 4AF5A 1ETYA 2R93J 2L7ZA 4D5FA 4XLEA 4ZH4F 3A0BC 4KYWA 4BE2A 1Z91A 1IRZA 2XSJC 4HX7A 1DU0A 2CW0F 2BGCA 2EFNA 2XPVA 5HBUA 3SFIA 4L9NA 5TGTA 5J47A 3TDUC 3C3WA 2X1DA 5LGNA 3J7ZI 4PDKA 1QZEA 5CJ9A 2YS9A 5GTHC 3OIPA 2KIFA 2W24A 1T33A 2W82A 4A3IJ 3R60A 3M3YJ 1HSTA 4YIRX 1RR8C 2JA6J 3CJRB 2VOOA 4QWQA 2XPWA 3T5XA 1JE8A 1L0OC 2GXGA 2VJ5A 4BEHB 5HDNA 3ZPLA 4AYBN 2XROA 2IU5A 2DJIA 1XX5A 1FJLA 2NAZA 2HU9A 2NX4A 1D5YA 1HW5A 1W5CC 3LMMA 1XG1A 2KLOA 1KQ9A 2EZLA 1JUSA 4MO7A 1E17A 1P9QC 3BJ6A 3I59A 4ESJA 1P7IA 2KKOA 5CKTA 3DWLE 4WWCA 2LF7A 2PMZN 2VONA 3VYTB 4XNFA 3HJEA 2YX4A 3DFGA 1TQMA 2DOAA 4B8XA 1RKWA 4JL3A 4PSWA 4RGRA 2GZWA 1ZGAA 2GQQA 3HRTA 2JSCA 1OCRH 1MBEA 1R36A 1H88C 3ZQGA 3H3ZA 1TP4A 3PNTA 5LBQA 4GRIA 5HLTA 1W36C 4MTDA 4NQWB 4XKBA 4A5NA 1W36D 3EUHA 2OU2A 3ABMH 3VUQA 2VKVA 2MC4A 5F1RA 4BACA 4XSXF 1MSFC 1ODDA 3B81A 1OPCA 1K6OA 1ZLJA 2R7TA 5J8FA 2QSFX 4L5JA 2FU4A 5JR3A 2BXYA 2V9PA 1FY7A 3HRUA 4G7ZF 1CF7A 4KFCA 4UHTA 4PXIA 1MBJA 2ZOZA 2HQRA 3PSIA 4D7NA 5AQCA 2DJNA 3JRBA 1IXCA 2QTQA 2OA4A 5J8CA 3E6CC 1ACIA 4KIBA 3GTOJ 2ZNYA 3VB2A 2IA1A 1BR2A 2X6WA 4M74A 2M30A 5LD2C 3E7QA 5J1YA 4UUSA 2VOPA 3RPUA 3J80Z 1E2XA 5H6RA 4ETSA 4ASNA 2KDOA 2UZKA 3CC2I 3H0DA 3HRSA 2ID6A 2F48A 3CJTB 1BOAA 2ZCNA 2XASA 2XRLA 4U87A 3N4MA 2CW8A 1XD7A 3P5JA 2F5EA 1Z7LA 4M72A 2EFPA 3LSIA 4B47A 2HZDA 2UXXA 5IP9J 1S29A 4CCKA 2BW3A 5EZHA 2AO9A 3BG6A 1T0FA 3QYFA 1IN7A 4ITVA 1SAXA 4U0VA 3OYJA 2G3BA 4G94A 2H1KA 1IUYA 1OCZH 5KAFC 4Y15A 2W7NA 4BJ6C 2TRTA 5FKNA 3CJQB 4G6TB 3G4SI 1TNSA 4YFKF 1TWHJ 2ZMEC 3OV8A 2FJ1A 4BAYA 3S93A 3L2QA 3GTGJ 3U9GA 1JJ8C 4XICA 3VW2A 4LGWA 5ILSA 4G6DA 3M4OJ 3L2WA 3VVXA 4FCYA 4FISA 3JTGA 4AD9A 3HOVJ 1Y39A 2UXIA 2MH2A 2CUZA 2E2HJ 3GBGA 2RASA 2W48A 4RS8A 2VIXA 1G4DA 4EQQA 1Z6RA 5ED4A 3T0YA 2JPCA 4BQQA 4UVBA 2XGXA 1WI3A 4BGDA 4Q4ZF 4XIDA 3LSMA 4A0ZA 1HLVA 1JTXA 1VQ5I 3R61A 1V4RA 3WTWC 2OPTA 3PIOF 4FX0A 1BC8C 1K6YA 3ONQA 4XORA 2O8KA 2HOSA 5CLSA 5J4VA 4XSZF 3JRFA 1WZ2A 3TP0A 1ZLKA 2R5ZA 4AM3A 3SEQA 2DMQA 2R7UA 3A4CA 3V8LA 4RBOA 3CD6I 2F2EA 1YJ9I 3VFZA 1P6RA 1X3WB 3HTUA 2KIUA 1CQTA 2FMLA 1XTAA 1BR1A 4MEYF 4A3KJ 3MZHA 2IAIA 4OIQF 4KN4X 1XGSA 2FXAA 1ETXA 3VVZA 2DK5A 1PP7U 1P7JA 1FBUA 3ON4A 2PG4A 4CUGA 3MKYB 1EJ9A 4D5CA 1FYLA 2RNJA 2WV0A 4EJOA 5EEHA 2HYJA 3D5SC 1E3OC 2YVXA 3CMYA 3REOA 3ZMZA 2LKSA 1I3AA 3ZN1A 4DYQA 3SXYA 2VC0A 2L54A 1HKQA 2NOGA 2BHZA 3D5LA 1GUUA 1Y6IA 1R5GA 3TO6A 3E1SA 4NC7A 4D1QA 4NNJA 1VQ7I 1Y0UA 2QM3A 2QQAA 5L3GA 2FQ4A 5IT9Z 3CZ6A 1V5GA 4J00A 1OR7A 2OF7A 2ISZA 1S7OA 3L09A 3OL3A 1SMYF 3L9FA 4H0EA 2H09A 2MGQA 1J09A 2VT3A 5IT3A 4E7JA 4MEXF 4JNNA 4A0XA 2FOKA 3QP6A 3OYGA 4V2GA 2HDCA 1T08B 2M8GX 3WGIA 1F4KA 2DA3A 2ELHA 2LYCA 3FK6A 4GO1A 2DA1A 1I39A 4DZJA 4UUTA 4E6KG 2CQNA 3ASNH 1WFXA 5D6FA 4PZJA 2GWRA 4LK1F 2X48A 1YJNI 2P4WA 3BQZA 5D5UB 3OIQA 1Q1VA 4XLCA 3CCQI 1SGMA 1T98A 2NOJB 3WODF 2M1BA 1D1BA 1IRGA 2RKHA 4N9HA 2E7XA 4S0HB 3LWFA 3K8PC 3SZGA 1B1BA 2IW5A 4BKXA 2OERA 2IRFG 5LHHA 1QBJA 2RNGA 1LQ1A 3QPSA 1OCPA 1XGNA 4E7SA 1FP2A 2L3DA 4CZCA 1YFHA 1YIJI 3Q0UA 3DXJF 4ACIA 3HL2A 2P5KA 2WADA 2HNHA 5GAEJ 3LA7A 5L3DA 1W0UA 4RB0A 2CUJA 3K4NA 4L5EA 2HOTA 3EUAA 1SEUA 4HX4A 1IUFA 1TT0A 2WAQA 2XGCA 2IVMA 4L9TA 1GV5A 3MKZA 1YW9A 2VKDA 4HV5A 1AA7A 1ZRCA 1FC3A 2QGUA 4IQJA 3GLXA 3OYCA 1TTYA 2YSRA 2P7VB 3GCMA 3HOYJ 4NUBA 1G3SA 3L2VA 4G9YA 3K9TA 5B5EC 2A05A 3KIOA 2K3FA 4RGSA 4XN0A 3KP2A 1RZ4A 4HNVA 3HKZN 5BQTA 3ZQCA 4CA0A 3FBNB 2JZYA 2P6TA 3WE2A 3ON2A 4IOAF 2LSOA 1UFMA 2XC7A 3S2WA 1R49A 1WI9A 1WH7A 3HTAA 1RR7A 1USTA 2IXSA 3JCUC 5IT9K 4WXHA 3BCBA 3GZ6A 3HHGA 1TWAJ 2M8EA 3CMAI 3BHQA 2DQLA 2OZUA 4WIBA 3QOPA 2VC1A 3CP8A 4G6QA 3G6EI 5TRDA 5EEGA 2G7SA 4LLNA 5DAJA 3RCOA 3GEZA 4M3BA 1FPQA 1TQPA 1TL8A 2CW7A 2EZHA 3P7NA 1T39A 5K5OA 5HLGA 5CXIA 3DBLB 4IVNA 2CWEA 4BQNA 4ESFA 1I6HJ 3EETA 1WCMJ 5IYCJ 3E6BA 2RHAA 2E2IJ 2ZC2A 3TMOA 5DDGA 4KWAA 4LOCA 3FWEA 4ZDOA 3AG2H 3J7YJ 2AS5F 2LY2A 2Z2SB 2ZNZA 3OOUA 5JI6A 3SFZA 3GTKJ 2AXTC 4M3GA 4DYRA 5K5RA 2VLAA 5LRRA 2QLZA 3KEYA 1XN7A 5H20A 4BL0B 2WTEA 3NEUA 5BPDA 2Y0SN 1WHUA 1FWZA 2ZO4A 3OYAA 4DOZA 2VQCA 5DV5A 2WUIA 2Z5UA 3TOAA 1IN8A 2FEZA 4WK8F 2O5RA 5K58A 3HRMA 4I01A 5IOYA 1X4PA 4JP0A 2B7EA 2M0CA 3K1MA 2RVCA 5F6FA 2J5OA 3SDGA 3S1QJ 2ZSHB 4P1WA 4Z6YA 1QZZA 1Z0XA 4PSXA 1FTZA 3QWLA 3RKWA 3JR9A 4DW6A 1ZR2A 3KP6A 2VI6A 3S1RJ 2RN7A 2KISA 4RAZA 5FLMJ 4MHGA 4BY1J 2OCEA 3NXCA 5EEAA 4XRMA 3H36A 3OYEA 3F23A 4L0ZB 1HDPA 1FTTA 3MAJA 4CO8A 2HPMA 2CRGA 4DZPA 3BG7A 3L2CA 3K6GA 2VKHA 1IN6A 2EILH 3G1OA 5HNFA 2XGEA 3MVPA 2ZCXA 1R71A 3WU0A 2A2FX 4KN7X 5F0FA 2H8WA 1OYYA 2MW8A 1IW7F 3E97A 3ABLH 1X1DA 3WG9A 2F4OB 2O03A 4KT6A 5CVIA 4DIQA 3BJAA 2L7KA 3FXKA 3OIOA 2OD5A 5JLXA 3ZGKA 2HKUA 1VFCA 1SMTA 2K9NA 2EV6A 5CVUA 4AC0A 3ULQB 3I4PA 3KETA 4DGWB 1HC8A 3HC7A 4E7IA 3CQZJ 3K4KA 2NVXJ 2IS2A 1U8BA 1PYVA 4Y33A 5K5QA 1GXPA 2PMUA 2LNBA 2XVCA 3EYYA 4F3QA 2VE8A 4HBLA 3MFKA 3QPLA 4I6ZA 2FA5A 2FMYA 2ZFUA 3S16J 2Y30A 4CCLA 4C2UA 4W97A 3S1MJ 2YVEA 3CO6C 5CXGA 2F4MB 4NC6A 3GFLA 4CSWA 2DMNA 2G7LA 3KPHA 4LIUA 3U2RA 3LSTA 1ZRDA 1XMXA 3HXLA 1WJEA 3OYBA 5L3FA 2M5WA 1U0JA 2HTSA 3UKGA 3PQKA 4IJAA 5E3OA 3DLAA 4FX4A 3ISPA 1O3QA 2PMHA 2DA7A 2GM4A 5FKKA 2UUZA 3HSFA 5LHGA 3Q0WA 1YE9A 5FGLA 1ULYA 4HDUA 3IRQA 3U1DA 3HDDA 2DO7A 1V5EA 2JA7J 4Y3OA 3S2DJ 4HNUA 3KNWA 3ZMDA 1G8XA 2OV7A 5FKOA 4S05A 2WAEA 3F3XA 3ZP5A 4ENNA 1K83J 3EUKL 3KYDB 2BZTA 5FD6A 2X85A 2WB1A 2VBYA 3WU2C 5JFRA 3D5RC 2IGNA 1JUPA 2HXIA 1YI2I 3V7CA 1ZG5A 5LHIA 4BH9A 2Z33A 1X19A 4FHTA 1I3QJ 2XAUA 2NP5A 1TZLA 3P9CA 5DTDA 1R9TJ 3HOSA 3CDLA 1G3WA 2EA4A 2BV6A 1ZHFA 1QPMA 4Y4RA 3DKYA 3VYUB 3HOXJ 2R5YB 5JVGF 2R7VA 5HDGA 1RRJA 1FIAA 5DCMB 2EFWA 5EZGA 1IV8A 2EZKA 2MC3A 3QPTA 4PK4A 2NS8A 1U9NA 1IDZA 3M8FA 4ENKA 3OYLA 4TV7A 4A3JJ 1GXQA 3PASA 3H3VK 2TDXA 1OCOH 3HSEA 3KKCA 3QAHA 5C3EJ 1SC7A 5GADJ 2CO5A 5FROA 3KYLA 1IV6A 4OD5A 1MH3A 2LREA 3IUOA 5KNLA 5CQGA 2CGPA 1O7FA 1U6GA 1UAAA 1XSXA 1XB4A 2D6YA 3LHQA 2ZKZA 2HXOA 2R7OA 5BMZA 4BBSJ 3VVYA 2HYTA 4EGZA 1O4XA 2P81A 4A3DJ 2NNNA 3J81K 3DP7A 2VXZA 1VQOI 1LJ9A 3I64A 1Z1DA 3QYBA 2LD5A 3M9AA 4OIRF 3PSFA 4ABZA 1IC8A 2OTLI 4JX4A 5EF6A 3I3LA 1SVLA 3BR3A 2VKEA 1K78B 2MD0A 3ANGA 1VQMI 1BI0A 3SZPA 3WG7H 2QWTA 3M07A 3CP2A 3MNLA 1E3PA 1VQLI 2K9SA 4HF2A 2JTVA 4F7ZA 3QU3A 3LSJA 4YFXF 3HYIA 2L4MA 2W84A 4L9JA 2Q24A 3OYHA 5J40A 1K4TA 1ETWA 2ZCMA 1ZG1A 3KP7A 5C4JJ 1CF7B 2HOAA 3K4BA 1JUMA 2XHKA 2GAUA 1A6QA 3ZCOA 3TO7A 2RAEA 4RMNA 3Q0VA 2NRAC 4I02A 1B72B 4RAGA 1R4NB 5J6XA 4XLNF 2UXPA 4WXCA 3PJRA 2RQPA 1SD7A 3VYSB 1DPUA 4X0GA 4UUSB 4LB6B 3UR3C 3CF5F 4DQ2A 1KU9A 1ZYRF 3GTMJ 2PBIA 2H6BA 4FE4A 2P5VA 3S15J 1UHMA 3H5AA 1QHHD 1QPIA 5FJ8J 2IT0A 4HG2A 1TT5B 4U7BA 4G7OF 3A01B 4RGUA 3ANPA 2FSWA 2VL8A 1OCTC 5TJJA 4BHCA 1R00A 4DVYP 3BZ6A 5M5YJ 3VOKA 2B9SA 3VEPA 1KYZA 2FBKA 1V55H 2BW3B 2V6CA 1F36A 2EH3A 4QTRA 1XSDA 2L2OA 4F93B 2R5YA 2PN6A 2E7WA 4CYDA 5HDKA 4XMYA 1J9IA 2GFNA 3TEDA 1Y56A 3EDPA 2R0QC 4A6DA 2KRCA 2BE5F 4HYEA 1OYWA 5DCMA 1A6IA 1HDDC 1OJLA 1IGNA 1FOYA 1RKTA 2GENA 2HQ5A 2E1CA 2NP3A 2ECBA 3ZMTA 2A69F 4C2MJ 1VZ0A 2K7LA 5J3LA 2A07F 2M34A 3BDDA 1A5JA 1OCCH 4HZFA 2DTRA 3TGNA 2JRTA 2MH9A 4UUVA 2AHQA 4I2OA 2V4JC 1TNTA 4ON0A 4ZC3A 1D0XA 2M4GA 2OQRA 3PM1A 4I98B 3RSNA 2CFXA 4DNCA 3H0GJ 1S5LC 3GEUA 2K9QA 3GTJJ 2V79A 5KAIC 2XF5A 1QGPA 1OMIA 2DU9A 2Q2EA 2LBFA 3FXQA 5M3MJ 3CTAA 2ZJPF 2ICWG 4HF0A 2R5ZB 3NPIA 3OL4A 1W7PB 5ICFA 1YLFA 3ZQHA 5D5VB 1MJAA 1Z3YA 5CW8A 3MEXA 2IA0A 1UB9A 1K78A 3R6SA 1LVKA 1YHQI 1FOKA 4RA2A 3EPZA 1GT0C 3IAS2 4JX6A 3RQ4A 2F5VA 2G7HA 3BR0A 2NVQJ 1MDMA 2HI3A 1LE8A 1ETOA 3V6GA 1YW7A 1YIOA 2R3SA 1LUJB 4PJ0C 1ORKA 5FLXK 1WH5A 3TL4X 3VSKA 3PPBA 4M9XA 3QODA 1B72A 3VP5A 4J01A 1ERDA 2LRDA
chains in the Genus database with same CATH topology
1YRNA 4JNNA 2ECCA 1JTYA 4A3FJ 4V2GA 2M8GX 5E3LA 2DA3A 1WGXA 1UI6A 3FK6A 3QKXA 4BY7J 3TW6A 1LE8B 2E19A 2DA1A 4DZJA 4UUTA 3JRDA 1IG7A 3HOZJ 1I50J 2JN6A 2W53A 2X48A 3A01A 3BQZA 2DN0A 5F08A 1Q1VA 3LWJA 3A02A 2YUSA 3ZQFA 3S5RA 4X6AJ 1SGMA 4CYCB 5D19A 1JJ6C 4BXXJ 1ETVA 1B8IB 3C07A 4S0HB 1HF0A 2DTZA 1BW6A 4BKXA 2OERA 4EEFG 1APLC 1T56A 3QPSA 1OCPA 2IBDA 3EUPA 3LSRA 3HOUJ 3IH4A 3JRIA 3Q0UA 4ACIA 1AKHB 2ZOYA 1W0UA 2JJ7A 2UXHA 3GTPJ 4L5EA 2HOTA 2WV1A 4JX5A 2HDDA 1IUFA 3E7LA 2X6OA 2XGCA 3O60A 2TCTA 1MBKA 4J19A 2REKA 3BCGA 1GV5A 4GCKA 2LFBA 4IHWA 2Y31A 3IH3A 2VPRA 2WAQN 2FD5A 3JRHA 3FIWA 3D1NI 1ITYA 1JKRC 3HOYJ 3OSFA 2N8GA 4XRSG 5FMPA 4M3FA 3BNIA 3TW7A 3HTJA 3VOXA 3B6CA 3HTIA 2X9DA 4HNVA 3HKZN 1HCRA 4GFBA 3ZQCA 3LOCA 1Z77A 2LY9A 2D5VA 3ON2A 3S2HJ 2ELKA 1H89C 3RKQA 5EG0A 1X2MA 1WH7A 4C3JJ 3HTAA 5M5WJ 1RR7A 1JGGA 5IPAA 4C3HJ 2FBQA 3VIBA 1TWAJ 2XB5A 2O7TA 2YVHA 3BHQA 1JKQC 2Y2ZA 1MBHA 4A3EJ 5C4XJ 2G7SA 1JT6A 5DAJA 4M3BA 3MKLA 2YU9J 3CCYA 2EZHA 1H8AC 5CXIA 3JREA 3BG9A 1ZKGA 3HTHA 1LFBA 1QVUA 1NK2P 3AQTA 3KZ9A 2LTPA 4RDUA 2F07A 3BTCA 1I6HJ 4QSHA 3PO3J 1WCMJ 5IYCJ 2RHAA 2E2IJ 1TWFJ 2GUHA 3WHBA 2CJJA 1ETKA 3HGYA 5EDNA 4IHYA 3AQSA 3RQIA 4LOCA 2KDZA 3QBMA 1FIPA 4KWAA 3Q3SA 4I76A 4XRSA 1RESA 3HE0A 4L62A 3HEFA 2L7MP 3OOUA 5K7FA 3SJMA 3GTKJ 4M3GA 4DYRA 4GCLA 2ZB9A 2E1OA 2LK2A 2UXOA 2Y0SN 4Y7NJ 3DEWA 3G56A 2QCOA 2WUIA 1GV2A 5K58A 5IOYA 3I4NJ 4JP0A 2L0KA 2M0CA 3SDGA 3S1QJ 3BRUA 1JT0A 1Z0XA 1F43A 3BTJA 3HM5A 1FTZA 1QVTA 3JRCA 3JR9A 3HOWJ 1GDTA 3K2AA 4DW6A 2G0EA 1ZR2A 2XPUA 3IH2A 1XS9A 2VI6A 3K7AJ 1B8IA 3P9TA 4QIWN 3S1RJ 2H8RA 5FHPA 3KKDA 5FLMJ 4BY1J 3VW1A 4A69C 5FLVA 1OFCX 3O8HA 4V2FA 3NRGA 5EEAA 4XRMA 3NXCA 1EF4A 4MIMA 5F0HA 1AKHA 1FTTA 1HDPA 5J1UA 1DU6A 2CRGA 4DZPA 5IP7J 2WGBA 1ZR4A 2R92J 1QRYA 1SANA 3FISA 3G1OA 1WPKA 1ZK8A 3BR2A 1HOMA 2XGEA 3MVPA 2ZCXA 5K7ZA 4MFEA 2VUMJ 2DG8A 1UHSA 3MN2A 5F0FA 5EYRA 2MW8A 4A3MJ 5GP9A 1JKOC 1UG2A 1TWCJ 1VI0A 2DA6A 5F0CA 5D18A 4FE7A 2MG4A 3OIOA 4IEJA 5JLXA 2FX0A 3A03A 5FKLA 2HKUA 1VFCA 2K9NA 4AC0A 4A3LJ 5F27A 3CQZJ 2NVXJ 1U8BA 2ME0A 3BJBA 3C2BA 2ME6A 4I6ZA 3QPLA 5HAWA 3HB9A 2JWTA 3S16J 2Y30A 4W97A 3S1MJ 5GPAA 3FRQA 2B63J 3LJLA 2YVEA 3NNRA 4NELA 3RH2A 4M3DA 5CXGA 2QKOA 1PUFB 2DMNA 3EGQA 2G7LA 3B6AA 3JSJA 1IDYA 4MFDA 2EQRA 4NDLA 1MBFA 2JA5J 4JKZA 4UDSA 4AF5A 5K7HA 5IOZA 4AC6A 1ETYA 5BNGA 2L7ZA 4D5FA 1BL0A 4D7MA 3RZDJ 3UKGA 2R93J 4A93J 2IEKA 5E3OA 2EBIA 1IRZA 1ZQ3P 1JKPC 1DU0A 1FEXA 3BTIA 2GM4A 2DA7A 5FKKA 2QOPA 2XPVA 5HBUA 3SFIA 1ZGWA 4XK4A 3Q0WA 3GZIA 5FGLA 3HDDA 2DA5A 1ETQA 2YS9A 4GFLA 1RETA 2JA7J 3S2DJ 4A3IJ 2DA4A 1T33A 3KNWA 3M3YJ 2JA6J 5FKOA 1K83J 1AHDP 3ZOBA 4B3AA 2JK3A 1UI5A 2XPWA 2DMPA 1MSEC 1JUPA 2HXIA 3FKIJ 5HSZA 4AYBN 4ME9A 5JLWA 4MLOA 2IU5A 2CQXA 1FJLA 2ID3A 2NX4A 1I3QJ 1D5YA 2NP5A 1XG1A 5DTDA 1R9TJ 2EZLA 1JUSA 3CDLA 4MO7A 3PO2J 1BW5A 5D1RA 5E3MA 3HOXJ 1MBGA 2R5YB 1NK3P 4M6VA 1P7IA 2OI8A 2NVYJ 2LKXA 1FIAA 4G12A 2PBXA 1K61A 5EZGA 2PMZN 3FK7A 2JA8J 3I4MJ 2EZKA 3L1PA 2NS8A 1U9NA 3BR5A 1RKWA 5GPCA 4JL3A 3W6VA 1IDZA 1X58A 5IP6A 3BT9A 4A3JJ 3PASA 3H3VK 3KKCA 1MBEA 1H88C 3ZQGA 5C3EJ 4A3CJ 4DYCA 1IV6A 1XC5A 3WHCA 4MK6A 2V57A 1MH3A 2QIBA 3BQYA 5F1JA 3VUQA 4GFKA 2VKVA 3G1LA 2L9RA 3BR6A 4BBRJ 2D6YA 3LHQA 2HXOA 1UMQA 4A3BJ 3DCFA 4HKUA 1MSFC 2Y9ZA 4BBSJ 3HIMA 3VVYA 2G7GA 3B81A 2HYTA 1O4XA 2P81A 3TP3A 4A3DJ 1VNDA 3G1MA 3O8GA 3JRAA 4PXIA 2Y9YA 1MBJA 2LD5A 2ZOZA 3S17J 4ABZA 4D7NA 5AQCA 3RD3A 2DJNA 3JRBA 1IC8A 3GTQJ 4GCTA 5F04A 2DMUA 4JX4A 2QTQA 5EF6A 2M9HA 3BR3A 3S1NJ 2CU7A 2VKEA 3QQAA 3GTOJ 2LVSA 3ANGA 1X2NA 1TC3C 2CUEA 1RPWA 2QWTA 5EGOA 3E7QA 1ENHA 5J1YA 4UUSA 3MNLA 3COLA 2K9SA 2LR8A 1S7EA 3NAUA 3V78A 4X1EA 5M3FJ 5DS9A 3LSJA 2GBYA 2Q24A 1AU7A 2ZCMA 4MXMA 1ETWA 5HODA 5C4JJ 1PUFA 1MNMC 3BR1A 2HOAA 3DPJA 9ANTA 2ID6A 1JUMA 2ZCNA 2COBA 2I10A 2RAEA 2XRLA 2K40A 3Q0VA 2UXUA 1U78A 1B72B 3S14J 2UXPA 5M5XJ 1YRNB 1BA5A 5EGOB 1IJWC 4UUSB 2EZIA 5IP9J 2GLOA 1POGA 3GTMJ 5EZHA 4JYKA 2AO9A 3HGGA 4FE4A 2XSDC 3BG3A 3GTLJ 3S15J 4ICHA 5H9TA 3VW0A 4CGRA 1QPIA 2O7OA 5FJ8J 2NVTJ 3VPRA 4NN1A 3A01B 2E2JJ 3ANPA 2G3BA 2H1KA 3ZQIA 3F1BA 3IV5A 1OCTC 2TRTA 5FKNA 5M5YJ 1TWHJ 3VOKA 2DG7A 2FJ1A 2LLKA 3GTGJ 1JJ8C 4XICA 5EFYA 1BJZA 3VW2A 3NARA 2DA2A 3M4OJ 1F36A 2EH3A 1LFUP 4Y52J 3JRGA 4QTRA 3VVXA 4FCYA 4FISA 2O9LA 3HOVJ 5IYBJ 2MSYA 2R5YA 2GFNA 2UXIA 1NTCA 5C4YA 3NI7A 3TEDA 2R0QC 2E2HJ 3GBGA 2RASA 2W48A 1A6IA 1TWGJ 4A3GJ 1HDDC 1Y1VJ 2XGDA 1OJLA 1IGNA 3G7RA 4W1UA 1WI3A 2LP0A 4FTHA 4XIDA 1RKTA 2GENA 1HLVA 1JTXA 2HQ5A 2NS7A 5E3NA 2NP3A 2ECBA 2WB1N 5IYDJ 2OPTA 2PZ9A 4C2MJ 2O8KA 5J3LA 2HOSA 3CRJA 2M34A 3F0CA 3JRFA 1G2HA 1U9OA 1ZTRA 3TP0A 1A5JA 3CWRA 2R5ZA 5C44J 2CQQA 4M3EA 2DMQA 3LSPA 1MH4A 4RBOA 2AHQA 2XDNA 3HBLA 3PM1A 3GEUA 3H0GJ 2K9QA 3GTJJ 1CQTA 1GVDA 2KT0A 5EG0B 4A3KJ 4IHVA 2IAIA 4B1RA 4IHXA 1ETXA 3LNQA 3VVZA 5M3MJ 2DMTA 3OSGA 1P7JA 2R5ZB 3NPIA 3ON4A 2M2EA 4D5CA 3BG5A 3ZQHA 3RZOJ 3IUVA 5CW8A 2HYJA 1E3OC 3CMYA 4DYQA 1GT0C 3BTLA 4JX6A 1W0TA 2NOGA 2CUFA 3BR0A 2NVQJ 2JMWA 3ZQLA 3CJDA 3LSGA 3T6NA 1GUUA 2HI3A 1LE8A 1ETOA 5J1RA 3V6GA 4C3IJ 2QF7A 4YZEA 4B4CA 2L7FP 5FKMA 1ORKA 2FQ4A 1WH5A 1VF9A 2OF7A 4AUXA 2R7ZJ 2XB0X 3PPBA 1Y1WJ 1B72A 3VP5A 4CYCA 2MGQA 1SFOJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YRN A;  4JNN A;  2ECC A;  1JTY A;  4A3F J;  4V2G A;  2M8G X;  5E3L A;  2DA3 A;  1WGX A;  1UI6 A;  3FK6 A;  3QKX A;  4BY7 J;  3TW6 A;  1LE8 B;  2E19 A;  2DA1 A;  4DZJ A;  4UUT A;  3JRD A;  1IG7 A;  3HOZ J;  1I50 J;  2JN6 A;  2W53 A;  2X48 A;  3A01 A;  3BQZ A;  2DN0 A;  5F08 A;  1Q1V A;  3LWJ A;  3A02 A;  2YUS A;  3ZQF A;  3S5R A;  4X6A J;  1SGM A;  4CYC B;  5D19 A;  1JJ6 C;  4BXX J;  1ETV A;  1B8I B;  3C07 A;  4S0H B;  1HF0 A;  2DTZ A;  1BW6 A;  4BKX A;  2OER A;  4EEF G;  1APL C;  1T56 A;  3QPS A;  1OCP A;  2IBD A;  3EUP A;  3LSR A;  3HOU J;  3IH4 A;  3JRI A;  3Q0U A;  4ACI A;  1AKH B;  2ZOY A;  1W0U A;  2JJ7 A;  2UXH A;  3GTP J;  4L5E A;  2HOT A;  2WV1 A;  4JX5 A;  2HDD A;  1IUF A;  3E7L A;  2X6O A;  2XGC A;  3O60 A;  2TCT A;  1MBK A;  4J19 A;  2REK A;  3BCG A;  1GV5 A;  4GCK A;  2LFB A;  4IHW A;  2Y31 A;  3IH3 A;  2VPR A;  2WAQ N;  2FD5 A;  3JRH A;  3FIW A;  3D1N I;  1ITY A;  1JKR C;  3HOY J;  3OSF A;  2N8G A;  4XRS G;  5FMP A;  4M3F A;  3BNI A;  3TW7 A;  3HTJ A;  3VOX A;  3B6C A;  3HTI A;  2X9D A;  4HNV A;  3HKZ N;  1HCR A;  4GFB A;  3ZQC A;  3LOC A;  1Z77 A;  2LY9 A;  2D5V A;  3ON2 A;  3S2H J;  2ELK A;  1H89 C;  3RKQ A;  5EG0 A;  1X2M A;  1WH7 A;  4C3J J;  3HTA A;  5M5W J;  1RR7 A;  1JGG A;  5IPA A;  4C3H J;  2FBQ A;  3VIB A;  1TWA J;  2XB5 A;  2O7T A;  2YVH A;  3BHQ A;  1JKQ C;  2Y2Z A;  1MBH A;  4A3E J;  5C4X J;  2G7S A;  1JT6 A;  5DAJ A;  4M3B A;  3MKL A;  2YU9 J;  3CCY A;  2EZH A;  1H8A C;  5CXI A;  3JRE A;  3BG9 A;  1ZKG A;  3HTH A;  1LFB A;  1QVU A;  1NK2 P;  3AQT A;  3KZ9 A;  2LTP A;  4RDU A;  2F07 A;  3BTC A;  1I6H J;  4QSH A;  3PO3 J;  1WCM J;  5IYC J;  2RHA A;  2E2I J;  1TWF J;  2GUH A;  3WHB A;  2CJJ A;  1ETK A;  3HGY A;  5EDN A;  4IHY A;  3AQS A;  3RQI A;  4LOC A;  2KDZ A;  3QBM A;  1FIP A;  4KWA A;  3Q3S A;  4I76 A;  4XRS A;  1RES A;  3HE0 A;  4L62 A;  3HEF A;  2L7M P;  3OOU A;  5K7F A;  3SJM A;  3GTK J;  4M3G A;  4DYR A;  4GCL A;  2ZB9 A;  2E1O A;  2LK2 A;  2UXO A;  2Y0S N;  4Y7N J;  3DEW A;  3G56 A;  2QCO A;  2WUI A;  1GV2 A;  5K58 A;  5IOY A;  3I4N J;  4JP0 A;  2L0K A;  2M0C A;  3SDG A;  3S1Q J;  3BRU A;  1JT0 A;  1Z0X A;  1F43 A;  3BTJ A;  3HM5 A;  1FTZ A;  1QVT A;  3JRC A;  3JR9 A;  3HOW J;  1GDT A;  3K2A A;  4DW6 A;  2G0E A;  1ZR2 A;  2XPU A;  3IH2 A;  1XS9 A;  2VI6 A;  3K7A J;  1B8I A;  3P9T A;  4QIW N;  3S1R J;  2H8R A;  5FHP A;  3KKD A;  5FLM J;  4BY1 J;  3VW1 A;  4A69 C;  5FLV A;  1OFC X;  3O8H A;  4V2F A;  3NRG A;  5EEA A;  4XRM A;  3NXC A;  1EF4 A;  4MIM A;  5F0H A;  1AKH A;  1FTT A;  1HDP A;  5J1U A;  1DU6 A;  2CRG A;  4DZP A;  5IP7 J;  2WGB A;  1ZR4 A;  2R92 J;  1QRY A;  1SAN A;  3FIS A;  3G1O A;  1WPK A;  1ZK8 A;  3BR2 A;  1HOM A;  2XGE A;  3MVP A;  2ZCX A;  5K7Z A;  4MFE A;  2VUM J;  2DG8 A;  1UHS A;  3MN2 A;  5F0F A;  5EYR A;  2MW8 A;  4A3M J;  5GP9 A;  1JKO C;  1UG2 A;  1TWC J;  1VI0 A;  2DA6 A;  5F0C A;  5D18 A;  4FE7 A;  2MG4 A;  3OIO A;  4IEJ A;  5JLX A;  2FX0 A;  3A03 A;  5FKL A;  2HKU A;  1VFC A;  2K9N A;  4AC0 A;  4A3L J;  5F27 A;  3CQZ J;  2NVX J;  1U8B A;  2ME0 A;  3BJB A;  3C2B A;  2ME6 A;  4I6Z A;  3QPL A;  5HAW A;  3HB9 A;  2JWT A;  3S16 J;  2Y30 A;  4W97 A;  3S1M J;  5GPA A;  3FRQ A;  2B63 J;  3LJL A;  2YVE A;  3NNR A;  4NEL A;  3RH2 A;  4M3D A;  5CXG A;  2QKO A;  1PUF B;  2DMN A;  3EGQ A;  2G7L A;  3B6A A;  3JSJ A;  1IDY A;  4MFD A;  2EQR A;  4NDL A;  1MBF A;  2JA5 J;  4JKZ A;  4UDS A;  4AF5 A;  5K7H A;  5IOZ A;  4AC6 A;  1ETY A;  5BNG A;  2L7Z A;  4D5F A;  1BL0 A;  4D7M A;  3RZD J;  3UKG A;  2R93 J;  4A93 J;  2IEK A;  5E3O A;  2EBI A;  1IRZ A;  1ZQ3 P;  1JKP C;  1DU0 A;  1FEX A;  3BTI A;  2GM4 A;  2DA7 A;  5FKK A;  2QOP A;  2XPV A;  5HBU A;  3SFI A;  1ZGW A;  4XK4 A;  3Q0W A;  3GZI A;  5FGL A;  3HDD A;  2DA5 A;  1ETQ A;  2YS9 A;  4GFL A;  1RET A;  2JA7 J;  3S2D J;  4A3I J;  2DA4 A;  1T33 A;  3KNW A;  3M3Y J;  2JA6 J;  5FKO A;  1K83 J;  1AHD P;  3ZOB A;  4B3A A;  2JK3 A;  1UI5 A;  2XPW A;  2DMP A;  1MSE C;  1JUP A;  2HXI A;  3FKI J;  5HSZ A;  4AYB N;  4ME9 A;  5JLW A;  4MLO A;  2IU5 A;  2CQX A;  1FJL A;  2ID3 A;  2NX4 A;  1I3Q J;  1D5Y A;  2NP5 A;  1XG1 A;  5DTD A;  1R9T J;  2EZL A;  1JUS A;  3CDL A;  4MO7 A;  3PO2 J;  1BW5 A;  5D1R A;  5E3M A;  3HOX J;  1MBG A;  2R5Y B;  1NK3 P;  4M6V A;  1P7I A;  2OI8 A;  2NVY J;  2LKX A;  1FIA A;  4G12 A;  2PBX A;  1K61 A;  5EZG A;  2PMZ N;  3FK7 A;  2JA8 J;  3I4M J;  2EZK A;  3L1P A;  2NS8 A;  1U9N A;  3BR5 A;  1RKW A;  5GPC A;  4JL3 A;  3W6V A;  1IDZ A;  1X58 A;  5IP6 A;  3BT9 A;  4A3J J;  3PAS A;  3H3V K;  3KKC A;  1MBE A;  1H88 C;  3ZQG A;  5C3E J;  4A3C J;  4DYC A;  1IV6 A;  1XC5 A;  3WHC A;  4MK6 A;  2V57 A;  1MH3 A;  2QIB A;  3BQY A;  5F1J A;  3VUQ A;  4GFK A;  2VKV A;  3G1L A;  2L9R A;  3BR6 A;  4BBR J;  2D6Y A;  3LHQ A;  2HXO A;  1UMQ A;  4A3B J;  3DCF A;  4HKU A;  1MSF C;  2Y9Z A;  4BBS J;  3HIM A;  3VVY A;  2G7G A;  3B81 A;  2HYT A;  1O4X A;  2P81 A;  3TP3 A;  4A3D J;  1VND A;  3G1M A;  3O8G A;  3JRA A;  4PXI A;  2Y9Y A;  1MBJ A;  2LD5 A;  2ZOZ A;  3S17 J;  4ABZ A;  4D7N A;  5AQC A;  3RD3 A;  2DJN A;  3JRB A;  1IC8 A;  3GTQ J;  4GCT A;  5F04 A;  2DMU A;  4JX4 A;  2QTQ A;  5EF6 A;  2M9H A;  3BR3 A;  3S1N J;  2CU7 A;  2VKE A;  3QQA A;  3GTO J;  2LVS A;  3ANG A;  1X2N A;  1TC3 C;  2CUE A;  1RPW A;  2QWT A;  5EGO A;  3E7Q A;  1ENH A;  5J1Y A;  4UUS A;  3MNL A;  3COL A;  2K9S A;  2LR8 A;  1S7E A;  3NAU A;  3V78 A;  4X1E A;  5M3F J;  5DS9 A;  3LSJ A;  2GBY A;  2Q24 A;  1AU7 A;  2ZCM A;  4MXM A;  1ETW A;  5HOD A;  5C4J J;  1PUF A;  1MNM C;  3BR1 A;  2HOA A;  3DPJ A;  9ANT A;  2ID6 A;  1JUM A;  2ZCN A;  2COB A;  2I10 A;  2RAE A;  2XRL A;  2K40 A;  3Q0V A;  2UXU A;  1U78 A;  1B72 B;  3S14 J;  2UXP A;  5M5X J;  1YRN B;  1BA5 A;  5EGO B;  1IJW C;  4UUS B;  2EZI A;  5IP9 J;  2GLO A;  1POG A;  3GTM J;  5EZH A;  4JYK A;  2AO9 A;  3HGG A;  4FE4 A;  2XSD C;  3BG3 A;  3GTL J;  3S15 J;  4ICH A;  5H9T A;  3VW0 A;  4CGR A;  1QPI A;  2O7O A;  5FJ8 J;  2NVT J;  3VPR A;  4NN1 A;  3A01 B;  2E2J J;  3ANP A;  2G3B A;  2H1K A;  3ZQI A;  3F1B A;  3IV5 A;  1OCT C;  2TRT A;  5FKN A;  5M5Y J;  1TWH J;  3VOK A;  2DG7 A;  2FJ1 A;  2LLK A;  3GTG J;  1JJ8 C;  4XIC A;  5EFY A;  1BJZ A;  3VW2 A;  3NAR A;  2DA2 A;  3M4O J;  1F36 A;  2EH3 A;  1LFU P;  4Y52 J;  3JRG A;  4QTR A;  3VVX A;  4FCY A;  4FIS A;  2O9L A;  3HOV J;  5IYB J;  2MSY A;  2R5Y A;  2GFN A;  2UXI A;  1NTC A;  5C4Y A;  3NI7 A;  3TED A;  2R0Q C;  2E2H J;  3GBG A;  2RAS A;  2W48 A;  1A6I A;  1TWG J;  4A3G J;  1HDD C;  1Y1V J;  2XGD A;  1OJL A;  1IGN A;  3G7R A;  4W1U A;  1WI3 A;  2LP0 A;  4FTH A;  4XID A;  1RKT A;  2GEN A;  1HLV A;  1JTX A;  2HQ5 A;  2NS7 A;  5E3N A;  2NP3 A;  2ECB A;  2WB1 N;  5IYD J;  2OPT A;  2PZ9 A;  4C2M J;  2O8K A;  5J3L A;  2HOS A;  3CRJ A;  2M34 A;  3F0C A;  3JRF A;  1G2H A;  1U9O A;  1ZTR A;  3TP0 A;  1A5J A;  3CWR A;  2R5Z A;  5C44 J;  2CQQ A;  4M3E A;  2DMQ A;  3LSP A;  1MH4 A;  4RBO A;  2AHQ A;  2XDN A;  3HBL A;  3PM1 A;  3GEU A;  3H0G J;  2K9Q A;  3GTJ J;  1CQT A;  1GVD A;  2KT0 A;  5EG0 B;  4A3K J;  4IHV A;  2IAI A;  4B1R A;  4IHX A;  1ETX A;  3LNQ A;  3VVZ A;  5M3M J;  2DMT A;  3OSG A;  1P7J A;  2R5Z B;  3NPI A;  3ON4 A;  2M2E A;  4D5C A;  3BG5 A;  3ZQH A;  3RZO J;  3IUV A;  5CW8 A;  2HYJ A;  1E3O C;  3CMY A;  4DYQ A;  1GT0 C;  3BTL A;  4JX6 A;  1W0T A;  2NOG A;  2CUF A;  3BR0 A;  2NVQ J;  2JMW A;  3ZQL A;  3CJD A;  3LSG A;  3T6N A;  1GUU A;  2HI3 A;  1LE8 A;  1ETO A;  5J1R A;  3V6G A;  4C3I J;  2QF7 A;  4YZE A;  4B4C A;  2L7F P;  5FKM A;  1ORK A;  2FQ4 A;  1WH5 A;  1VF9 A;  2OF7 A;  4AUX A;  2R7Z J;  2XB0 X;  3PPB A;  1Y1W J;  1B72 A;  3VP5 A;  4CYC A;  2MGQ A;  1SFO J; 
#chains in the Genus database with same CATH topology
 3ZXS A;  2FUG 2;  2ECC A;  2QZ8 A;  3HG9 A;  4ZJZ A;  2W4S A;  4A3F J;  2IPQ X;  2K9M A;  2XAJ A;  1L3L A;  4BJT A;  1YOV B;  4UY8 I;  1UI6 A;  3QKX A;  4HQE A;  3TW6 A;  2VBW A;  1HSJ A;  3VDX A;  5K1Y A;  1V5F A;  2ZXI A;  1LDK B;  3S3M A;  4HOB A;  1IG7 A;  2L02 A;  3HOZ J;  2MLG A;  3ZMV A;  1T38 A;  4XLP F;  1I50 J;  2G7U A;  3V8J A;  4UXN A;  3A01 A;  2DN0 A;  2GXA A;  5F08 A;  3SDB A;  2MAB A;  3LWJ A;  2YUS A;  2GIV A;  1JJ6 C;  1LDJ A;  2IP2 A;  2JSP A;  3EUH C;  3C07 A;  3K2Z A;  3T8R A;  4E7K A;  1APL C;  1T56 A;  5E8I A;  1MJ9 A;  4RAF A;  4A2U A;  3EUP A;  4G8X A;  2FF4 A;  1S3J A;  2ZOY A;  2V1U A;  3E5U A;  2QA4 I;  5HS9 A;  5KVR A;  3CCL I;  3BLY A;  4ESB A;  4BNC A;  1EA3 A;  2HDD A;  2LDU A;  4L0Y B;  2QEN A;  4B3X A;  2QKL B;  2K5C A;  3BCG A;  4V19 K;  3R0A A;  2VPR A;  2WAQ N;  2FD5 A;  3CUQ A;  3JRH A;  1Z6T A;  1UG0 A;  1SFO J;  4O6J A;  3CDI A;  5FMP A;  3NRV A;  4M3F A;  4QPQ A;  4AWX B;  3FKJ A;  3ABK H;  4YFN F;  4Q48 A;  2W1O A;  2P5L C;  2X9D A;  1FLI A;  5D6E A;  1HCR A;  3VWB A;  2PFV A;  4N0B A;  3WTY C;  1I27 A;  4IO9 F;  1Z77 A;  3BP8 A;  3E3V A;  3I0T A;  4OIO F;  5AIP A;  2M87 A;  2ELK A;  3CME I;  2Z1D A;  2XKO A;  3SZT A;  2BVL A;  3KP5 A;  2XAQ A;  1N78 A;  1LFP A;  2DT7 B;  3WTU C;  3VIB A;  3OYD A;  2ISY A;  2EIJ H;  1EH7 A;  2YVH A;  1W7P A;  1K79 A;  3T1B A;  2OC6 A;  4RLF A;  4RB3 C;  4A3E J;  2XF7 A;  1T0F C;  4UB6 C;  2F5C A;  4BUP A;  1JT6 A;  4AYB A;  1J5Y A;  3R4K A;  3F21 A;  1MMA A;  1WVR A;  4F52 A;  3OYI A;  3H1C A;  1BM9 A;  3MCZ A;  2WY8 Q;  3HTH A;  4IHS A;  3K4M A;  4XLF A;  1RC9 A;  2F07 A;  3BTC A;  1V3F A;  2A68 F;  4QSH A;  1PVE A;  1B9N A;  1TWF J;  2CJJ A;  5DM7 F;  5EDN A;  4BDY A;  2PMZ A;  3RQI A;  2VJI A;  1BJA A;  2R7X A;  4OIN F;  4FQG A;  3M8J A;  3HEF A;  3OR2 C;  3RYR A;  3WE3 A;  4GCL A;  3FX3 A;  4S04 A;  1RNL A;  3HPG A;  2BVM A;  2A6T A;  2AQE A;  5CVV A;  3E6D A;  3S3O A;  3LSH A;  1GV2 A;  4DJA A;  2I5U A;  1MD0 A;  4KIS A;  2MD5 A;  3VTI A;  5HLH A;  3RYP A;  2IGO A;  4OWR B;  1D1A A;  4UB8 C;  3E0J B;  3HM5 A;  1F43 A;  4C30 A;  4B09 A;  2BYV E;  4JK1 X;  1FYM A;  3HOW J;  3K2A A;  1Y8Q B;  4PJN A;  2G0E A;  2MLK A;  2E35 A;  3K7A J;  2VBZ A;  3J7A O;  3DTE A;  1IXR C;  3E6M A;  1XCV A;  4GCV A;  4A5M A;  2DDA A;  3V7S A;  5A2Q K;  1H0M A;  4HLX A;  2DOF A;  5FLV A;  1OFC X;  1R1V A;  3NRG A;  1I6X A;  4A12 A;  4MIM A;  1MNE A;  1IO2 A;  2P6S A;  4MQ9 F;  4Q5S F;  1DU6 A;  5IP7 J;  2WGB A;  2R92 J;  1E0E A;  3SYT A;  3V8K A;  1VQN I;  1Z9C A;  4RB1 A;  4OIP F;  1S7A A;  3BR2 A;  2ZJQ F;  3DU6 A;  4ZYH A;  2QQB A;  3O6B B;  1U3E M;  2K3P A;  3CDH A;  3PFI A;  2Y0M A;  1JKO C;  1R7J A;  2LH9 A;  2D1H A;  1VI0 A;  4OAY A;  2MG4 A;  1VQ9 I;  3J7A Y;  3H35 A;  1N25 A;  3K1P A;  5F27 A;  2HS5 A;  2VT2 A;  5ERI A;  2OJE D;  1OR7 C;  5HAW A;  3HB9 A;  1MGT A;  3TO9 A;  3NWS A;  1FT9 A;  3LJL A;  3G71 I;  2VBX A;  2DFF A;  3LFK A;  2MA3 A;  3OS0 A;  1PUF B;  1KGS A;  5ICG A;  2Y75 A;  1KZH A;  4Y17 A;  3B6A A;  4M9S A;  1IDY A;  2MBF A;  4F55 A;  2D1V A;  2JA5 J;  2DQR A;  4JKZ A;  4OU0 A;  5IOZ A;  1FX7 A;  3U1K A;  2B1E A;  2KRH A;  4LG3 A;  5BNG A;  1K7A A;  4AC6 A;  4A93 J;  4D7M A;  5L3C A;  3LFU A;  2IEK A;  2E1M B;  2CFO A;  2VN2 A;  3K69 A;  1XSV A;  3PL8 A;  4H4K C;  2J5P A;  4M73 A;  1JKP C;  5BPI A;  2O0Y A;  3H3U A;  1MKM A;  1FEX A;  2GA1 A;  1LEB A;  1O3R A;  3CES A;  5FFZ A;  4M6Y A;  5ICC A;  4WF2 A;  2DCE A;  3FXU A;  5ILU A;  3RKX A;  2QVO A;  1ON1 A;  1MJB A;  2DA5 A;  1HW1 A;  1RET A;  3M1E A;  4E7L A;  4U9N A;  1DGR M;  2DA4 A;  4EJT A;  4XOP A;  2GXB A;  3DV8 A;  4O5V A;  2COM A;  1AHD P;  4B3A A;  1UI5 A;  2QYO A;  3LA3 A;  2V1X A;  1C0W A;  5HS8 A;  3TDZ C;  5HSZ A;  5L3E A;  3AFH A;  5D4S A;  2K85 A;  5FRM A;  5ICE A;  4U0W A;  3KLO A;  2XIG A;  4MNU A;  1FP1 D;  1KYW A;  4NC8 A;  3ZR8 X;  3PO2 J;  5D1R A;  2X0L A;  1WJ5 A;  4MTE A;  1MBG A;  1NK3 P;  4M6V A;  1U5T A;  2OI8 A;  4XRF A;  2NVY J;  1MW7 A;  3KZZ A;  1JGS A;  4ANJ A;  3HSR A;  1K61 A;  1KQ8 A;  3N05 A;  1KU3 A;  2JA8 J;  3I4M J;  3L1P A;  4EM2 A;  4AVP A;  4EAT A;  4HA8 A;  1P4A A;  2XV4 S;  3HOT A;  1G6N A;  3H92 A;  4IHT A;  2F6C A;  4DYC A;  1XC5 A;  4EMS A;  1ZRE A;  2V57 A;  2P7C B;  4M9Z A;  4YEJ A;  2VJJ A;  3KLN A;  4IXA A;  2QIB A;  2K27 A;  3BQY A;  4C2T A;  2IJL A;  1FZP B;  2IGK A;  1T95 A;  3BR6 A;  2G9W A;  1U2W A;  4BBR J;  4A3B J;  2LY1 A;  3DCF A;  4HKU A;  2G7G A;  2JQ7 A;  4OD4 A;  4FAS D;  1Z05 A;  1VND A;  2IA2 A;  3G1M A;  4MGR A;  1DDN A;  1F5T A;  2Z3Y A;  2BY3 A;  3KZI C;  2JUG A;  5F04 A;  1HKS A;  2LMD A;  5L3B A;  4B43 A;  2CU7 A;  4NHJ A;  2LVS A;  3RIR A;  4F91 B;  3H5N A;  2STT A;  3U21 A;  5EGO A;  2HEO A;  4YRV A;  5E8G A;  1ENH A;  4U7D A;  3W2W A;  1DUX C;  3COL A;  2LR8 A;  3NAU A;  3V78 A;  4X1E A;  2O61 A;  5M3F J;  2V1N A;  3H5R A;  5DEQ A;  1ZAO A;  2GBY A;  5DS9 A;  1IZ1 A;  2LOO A;  1PUF A;  3BR1 A;  2LC2 A;  4K2E A;  3DPJ A;  3A0H C;  5D5W B;  2VQL A;  2JUC A;  3FHN A;  2CG4 A;  2O3F A;  4Q47 A;  3RDI A;  3V42 A;  3NS4 A;  4F92 B;  5DM6 F;  2FQ3 A;  1R5H A;  1BI1 A;  2W00 A;  4ZTF A;  3KEO A;  3MMY B;  3S14 J;  2CV2 A;  3RI4 A;  1LKX A;  3O3K A;  5DD4 A;  1YRN B;  1BA5 A;  1XPX A;  3GFI A;  2FNP A;  3RKY A;  1EKE A;  2EZI A;  4R1H A;  3WGG A;  1POG A;  2BY1 A;  4N4O B;  4LJZ F;  3GME A;  2X51 A;  2DPD A;  5E17 F;  3ML6 A;  2XSD C;  3GTL J;  2LF8 A;  4ICH A;  5H9T A;  5D8L B;  2H94 A;  1FNN A;  3J81 Z;  2O7O A;  3GLL A;  4BS9 A;  4CIC A;  2UXN A;  5HVQ C;  2NVT J;  3JW4 A;  2ETH A;  3PNY A;  3JSP A;  2XDV A;  3F6V A;  4P96 A;  4BYY A;  4M71 A;  2HVQ A;  2DG7 A;  2LLK A;  2QEX I;  5B1A H;  1BJZ A;  3NAR A;  1Y8R B;  3K10 A;  4Y52 J;  1LFU P;  3HKZ A;  3FBI B;  3JRG A;  4KIG A;  4KNY A;  2M45 A;  5IYB J;  2MSY A;  2KIM A;  1NTC A;  2W85 A;  2OAZ A;  2JA2 A;  1TWG J;  2KFD A;  2XGD A;  1I5Z A;  3BPX A;  3G7R A;  4CHU A;  4HQM A;  2HWV A;  3IWF A;  4W1U A;  2JRM A;  3KFW X;  2EFQ A;  2CV0 A;  2NS7 A;  5E3N A;  3FMQ A;  2PI0 A;  2DAO A;  1FOW A;  2Z16 A;  5IYD J;  5LGU A;  2R7D A;  2ZCW A;  1SD4 A;  3GFM A;  3CRJ A;  3F0C A;  3CWR A;  3L2R A;  5LRS A;  3SQN A;  4BDZ A;  4M3E A;  4EVI A;  3LSP A;  4AIJ A;  1MH4 A;  2JVG A;  3DEE A;  1SVO A;  2RRE A;  1XGM A;  3ZQQ A;  1TQI A;  3E5Q A;  1XGO A;  2A5W A;  2KT0 A;  5EG0 B;  3GO5 A;  4IHV A;  1B4A A;  1IN4 A;  3CCS I;  4IHX A;  4A0Y A;  3HPH A;  4HST A;  2DMT A;  5DUI A;  1ON2 A;  1P92 A;  2VQG A;  2R7R A;  2M0M A;  4II3 A;  3SHF A;  1J2X A;  2M2E A;  2V9V A;  2M7B A;  5FO5 A;  4IRG A;  1LNW A;  3BG5 A;  4KDP A;  3RZO J;  4IX7 A;  3IUV A;  1U8R A;  3SWH A;  4AIH A;  1R1U A;  4XLA A;  3BTL A;  1W0T A;  4NBQ A;  1J0R A;  2CUF A;  1X1B A;  3BZK A;  3H9Q A;  3LSG A;  1N75 A;  2HR3 A;  3CUO A;  1YO5 C;  3CC7 I;  3B73 A;  2Q2E B;  2LBF B;  2XKP A;  1Z3X A;  2CQ7 A;  4C3I J;  5D4R A;  4LB5 A;  1GHC A;  1H9T A;  4YZE A;  2EV5 A;  3AKZ A;  5E79 C;  1VQP I;  2WA0 A;  1UCR A;  1VF9 A;  4XM3 A;  4AUX A;  1G3T A;  2XB0 X;  1DQU A;  4HNT A;  3LA2 A;  2NXN B;  4CYC A;  2ZY9 A;  1B59 A;  1MZB A;  4CH7 A;  1YRN A;  2EIN H;  2VPL A;  2XUB A;  1MDM B;  4BY7 J;  4GXO A;  4L5I A;  2VAS A;  1LE8 B;  1DP3 A;  3HIF A;  3I54 A;  2GIZ A;  3KP3 A;  4NB5 A;  4IOC F;  1UJ8 A;  3IKT A;  4ENM A;  1N77 A;  2F4I A;  4KUM A;  4HW0 A;  1ZH5 A;  2JN6 A;  4RM3 A;  2KHM A;  4QLC U;  1T6S A;  1B9M A;  1ZRF A;  4E70 A;  5EJC A;  5D19 A;  4BXX J;  3CLQ A;  3T8T A;  3UNG C;  3F8M A;  1B8I B;  3LQQ A;  2W25 A;  1MMG A;  4OAZ A;  3V7R A;  4CCN A;  2DTZ A;  1QZY A;  4AVZ A;  3S32 A;  1IF1 A;  2R7W A;  1ZAR A;  2CV1 A;  4EJV A;  3I58 A;  4AID A;  3LSR A;  2WWY A;  1REP C;  1VQ8 I;  3HOU J;  3JRI A;  2Y48 A;  3ESW B;  1VQ4 I;  2WC2 A;  2KJB A;  2HQA A;  2RC4 A;  2O8X A;  3F8C A;  4C9Y A;  2JJ7 A;  2UXH A;  3GTP J;  3PFY A;  2WV1 A;  2ZME B;  2Y69 H;  5FLX Z;  3F6O A;  1SD6 A;  3VOD A;  3BY6 A;  3O60 A;  2TCT A;  4GCK A;  3DTI A;  4J19 A;  2REK A;  4Z2Y A;  2LFB A;  2Y31 A;  5E1Z B;  3IH3 A;  3GVA A;  1ITY A;  3D1N I;  1UZC A;  3ZN0 A;  1SFK A;  4YG2 F;  1FOX A;  2N8G A;  3G73 A;  2QWW A;  3BNI A;  5FGM A;  3HTJ A;  2JPB A;  1Z21 A;  2Q8K A;  2VOD A;  4KJZ A;  4LIV A;  1D8J A;  3HTI A;  1PP8 F;  2HGC A;  3BOQ A;  3LOC A;  4P9F A;  5BOX A;  3CC4 I;  2R4G A;  4HF1 A;  1T8I A;  2D5V A;  2XF6 A;  4HX8 A;  3IKV A;  2PJR A;  2K4J A;  3S2H J;  3AL0 B;  3RKQ A;  1A04 A;  5EG0 A;  1G59 A;  4PCQ A;  3CUQ B;  3WTX C;  4RGX A;  1YW8 A;  1A35 A;  3D0S A;  3MQ0 A;  3WTS C;  3ERM A;  2W57 A;  4XLH A;  1QU3 A;  2NYX A;  4P9U A;  2ZBK A;  2L9S A;  4WX9 A;  1JKQ C;  1YG2 A;  1D1C A;  2HTJ A;  1SFU A;  5FB2 A;  1DPR A;  5LGT A;  1KU7 A;  4GYG A;  2QQ9 A;  2ZJ2 A;  3NQO A;  3DQV C;  2Q0O A;  3F8F A;  4WXD A;  2NVU B;  3KP4 A;  4ZZL A;  3W6J B;  1BIA A;  1R22 A;  2YU9 J;  1SVM A;  2R7S A;  3JRE A;  2YX7 A;  1LFB A;  1QVU A;  1NK2 P;  2LTP A;  1YX3 A;  3DKW A;  1RUN A;  1JI8 A;  2C6Y A;  4IQ4 A;  3DKX A;  4I09 A;  2LG4 A;  3FZV A;  4A6E A;  4DBQ A;  4KIT B;  3L2U A;  2GUH A;  1SFX A;  3PQJ A;  1ETK A;  4IHY A;  2DBB A;  2X1E A;  5B1B H;  3Q3S A;  4I76 A;  4EJW A;  1YYV A;  4XRS A;  3HE0 A;  5HS7 A;  5DUK A;  4KMU X;  2L7M P;  1Z67 A;  3IWZ A;  5K7F A;  2E71 A;  3HTS B;  4PJJ A;  3A2K A;  3CJN A;  2QSH X;  2ZB9 A;  2E1O A;  4ZYD A;  2XAG A;  1S72 I;  1BIB A;  1YQA A;  4GYI A;  2DT6 A;  3KE2 A;  2UXO A;  3I71 A;  5DYM A;  3DEW A;  4XON A;  1P2F A;  4BQA A;  1OQY A;  4LG0 A;  4JQF A;  2B0L A;  1MMN A;  2GOX B;  3KCC A;  3I53 A;  2L0K A;  3W6K B;  1NG7 A;  3JSO A;  4QPO A;  4HDV A;  4MQV A;  3BRU A;  2X6X A;  2CH0 A;  3QYE A;  3BTJ A;  5GAG J;  3ABT A;  3I9V 2;  3JRC A;  2DOD A;  1GDT A;  2XPU A;  3IH2 A;  5FD5 A;  1KU2 A;  2A6E F;  4BU2 A;  1B8I A;  1FMV A;  3Q9S A;  3W3C A;  4QIW N;  2H8R A;  5FHP A;  2BHY A;  2CS3 A;  4CXF A;  2YU3 A;  3KX2 A;  2M4K A;  1E3H A;  1X1P A;  3VW1 A;  2RV8 A;  2Z9O A;  4L18 B;  3FMS A;  4A69 C;  1WSU A;  4IPA A;  4KMF A;  4V2F A;  3DLL F;  1YS6 A;  3QP5 A;  3I55 I;  1EF4 A;  2KJC A;  5F0H A;  1O57 A;  3IRR A;  5J1U A;  1IRX A;  2HZT A;  2V1D A;  3W2A A;  2DPU A;  2F5F A;  1H9G A;  4LLL A;  1ZR4 A;  2ZME A;  1QRY A;  1FBS A;  2ZFW A;  1AOY A;  1KQ0 A;  1O7L A;  1WRJ A;  1WPK A;  2DYR H;  1VQ6 I;  1HOM A;  1WKM A;  4ZDP A;  2EWN A;  1TW2 A;  3IP4 B;  4JOM A;  3GX4 X;  5GP9 A;  4A3M J;  1YS7 A;  3CCM I;  1UG2 A;  5D18 A;  2EB7 A;  2HYG D;  1JXS A;  3Q9V A;  4IEJ A;  3MZY A;  2FX0 A;  5E1W A;  4II2 A;  5E1X A;  5LEK A;  4EGY A;  1F9N A;  4A3L J;  1ZGJ A;  1A36 A;  2DFH A;  3BWG A;  4R8H A;  3HUG B;  4XBF A;  1LDD A;  4U88 A;  3C2B A;  4PGH A;  1S8N A;  2ME6 A;  3CO7 C;  5GTI C;  3BRO A;  5GPA A;  2ZXH A;  3DU5 A;  4NEL A;  3RH2 A;  4M3D A;  4FET A;  2HYF A;  2PQ8 A;  3GFJ A;  5A2Q Z;  4MFD A;  4UDS A;  3RPU D;  4ZYG A;  2HQN A;  3Q5F A;  3KYC B;  1BL0 A;  2H1L A;  3RZD J;  2QBY B;  4HSR A;  3ZRG A;  2HKX A;  4BE1 A;  2EPF A;  2EBI A;  4BEH A;  2HDW A;  1VTN C;  1ZQ3 P;  4P5O A;  2WY7 Q;  3BTI A;  3ECH A;  1A31 A;  2XRN A;  2QOP A;  3QU6 A;  2V6E A;  1MMD A;  1ZGW A;  4IRH A;  4XK4 A;  3GZI A;  5LFA A;  3OY9 A;  3EYI A;  1ETQ A;  4GFL A;  3ELK A;  3K1N A;  3R0J A;  5CPR B;  3TBI A;  3MWM A;  4LD5 A;  3ZOB A;  1PUE E;  2JK3 A;  2WAF A;  4UVC A;  3DPT A;  4L9V A;  2DMP A;  4I99 C;  1XDS A;  2ESN A;  3PIP F;  4ENJ A;  1MSE C;  3FKI J;  4IF4 A;  4BHP A;  1HA8 A;  4ME9 A;  5JLW A;  4MLO A;  2K02 A;  3DPU A;  2CQX A;  3MD2 A;  3GZ5 A;  2ID3 A;  2B3W A;  2Z99 A;  4Y13 A;  3RTR A;  1BI2 A;  3AL0 C;  1BW5 A;  5E3M A;  1HQC A;  1FMW A;  2L9V A;  2ZSI B;  1T2K A;  4NQW A;  1J59 A;  3CUQ C;  2LKX A;  3K70 C;  4G12 A;  1J7K A;  4YEL A;  1X4O A;  2PBX A;  2F5D A;  2O6G E;  3K70 D;  3RPQ A;  3F8B A;  2PFB A;  3FK7 A;  2K86 A;  3J80 K;  3V4G A;  2FOW A;  3BR5 A;  5GPC A;  5B66 C;  4AIK A;  1IN5 A;  2P8T A;  3W6V A;  3HZJ A;  1X58 A;  5IP6 A;  2M3A A;  2V7F A;  3BT9 A;  4PFO A;  5D5X B;  1RI7 A;  4A3C J;  1M1E B;  2ELJ A;  2VQH A;  3WHC A;  2WBM A;  4MK6 A;  3VYR B;  1U5T B;  4OOI A;  2VJ4 A;  2DW4 A;  3CCU I;  1IRF A;  1FSE A;  2KZV A;  5F1J A;  3PUF A;  3FHZ A;  4GFK A;  3G1L A;  2L9R A;  3FDY A;  1UMQ A;  4CZZ A;  2Y9Z A;  1W7P D;  3HIM A;  1WQ2 A;  1X1C A;  1DGW Y;  5AIQ A;  1WJB A;  3TP3 A;  2DXI A;  2BY0 A;  2VXD A;  3N97 A;  1GLN A;  3O8G A;  2EJR A;  2ESH A;  2EV0 A;  5ILV A;  4P55 A;  2BXZ A;  3JRA A;  1LPQ A;  2QSG X;  1W5T A;  2DYS H;  2Y9Y A;  5JVT A;  3S17 J;  3RD3 A;  3DTK A;  2UV1 A;  1BC7 C;  2FBH A;  3GTQ J;  4GCT A;  2DMU A;  3K0L A;  3SEZ A;  2M9H A;  3GW2 A;  4KIF A;  3LSK A;  3S1N J;  3QQA A;  3QOE A;  3M7G A;  3F72 A;  3EQL F;  4LFU A;  1X2N A;  3FXL A;  1TC3 C;  2CUE A;  3HUG A;  1RPW A;  3DBH B;  1HW2 A;  2HKO A;  1YX5 A;  3L7W A;  2L4A A;  1IAW A;  1S7E A;  4CDG A;  2E34 A;  2E36 A;  4MXM A;  1UHW A;  1AU7 A;  3P9K A;  1W4M A;  5HOD A;  1QO0 D;  2AQF A;  4HEA 2;  1MNM C;  5AON A;  3X2Q H;  1P4W A;  9ANT A;  2X6Y A;  2COB A;  2I10 A;  1QQI A;  2K40 A;  2QBY A;  2UXU A;  1U78 A;  2BY2 A;  4XOT A;  3M1C A;  3VSL A;  3ZMS A;  5FRN A;  1ONV A;  2JVH A;  2DK8 A;  5M5X J;  5EGO B;  1IJW C;  3O2P E;  4AU7 A;  2P0W A;  3WTZ A;  1SAU A;  4PJL A;  3BC8 A;  2GLO A;  3BPV A;  4HLY A;  1PDN C;  4JYK A;  2XAF A;  3HGG A;  4BXF A;  3BG3 A;  3LQR A;  3VW0 A;  2E1N A;  1G3Y A;  4CGR A;  3M8E A;  3WU1 B;  3VPR A;  4NN1 A;  2VB6 A;  2DLL A;  4M6X A;  4XN3 A;  1X3Z B;  2E2J J;  1V54 H;  3ZQI A;  3F1B A;  2FNA A;  1XCB A;  5E18 F;  3IV5 A;  3QRF F;  3COA C;  5CVR A;  2D45 A;  5J4Y A;  4OMZ A;  2BBY A;  2R7F A;  4GGG A;  1IXS B;  1LVA A;  4KA4 A;  3ABU A;  3G3Z A;  1P4X A;  1R5I D;  3FMR A;  2Q1Z B;  5EFY A;  2DA2 A;  2FRH A;  1LB2 A;  5HNH A;  2O9L A;  1JHH A;  1ZG3 A;  2HOE A;  5C4Y A;  5E20 A;  3NI7 A;  3VOE A;  4O3M A;  4A3G J;  5CVJ A;  1Y1V J;  3CCJ I;  2DT5 A;  3FXJ A;  3B02 A;  3W2V A;  4EV0 A;  3K4J A;  2LP0 A;  4FTH A;  1F1Z A;  2HVS A;  1R6R A;  3GYH X;  2WB1 N;  4UNO A;  5H2F C;  5CYV A;  2PZ9 A;  4C2M A;  2KMU A;  2KPM A;  4IL6 C;  1G2H A;  1U9O A;  1ZTR A;  1JHF A;  3GZN B;  2STW A;  5C44 J;  1OYI A;  2CQQ A;  1XDU A;  3DPL C;  4N9I A;  2GOM A;  2RGV A;  4IRV A;  1D0Z A;  2PLY A;  3C2H A;  3OS1 A;  2ACJ A;  4I0A A;  4XQF A;  3H9J A;  3HBL A;  2XDN A;  4KIC A;  2GA2 A;  1SFE A;  3L00 A;  1D8K A;  5KCM A;  1O3S A;  4LLG F;  3MKW B;  2D2W A;  4XKC A;  3S8P A;  3OWT A;  1GVD A;  1OKR A;  1ZN2 A;  2RDP A;  3FM5 A;  2CSO A;  4B1R A;  3ZMU A;  3CLO A;  3LNQ A;  3FM3 A;  2XAH A;  3CCR I;  3OSG A;  2YR2 A;  4CCO A;  3BZC A;  1KA8 A;  1X1A A;  4D9J A;  3FXM A;  1D5V A;  2A6H F;  4ZZD A;  2KQR A;  4BQO A;  3CMM A;  4G7H F;  1NHA A;  4YII A;  3ERE D;  1XMA A;  3C7J A;  2FE3 A;  1DP7 P;  2JMW A;  1D3Y A;  4LMY A;  3ZQL A;  1EH8 A;  5HOO A;  3CJD A;  5KK1 A;  2ADU A;  3JTH A;  3T6N A;  1R58 A;  5J1R A;  3AG4 H;  1YIT I;  2EFO A;  4ZYA A;  3OMY A;  2QF7 A;  4B4C A;  2L7F P;  3K4C A;  5FKM A;  1Y0N A;  2L01 A;  2PJP A;  4E7H A;  2R7Z J;  2PEX A;  3NWT A;  2KIQ A;  2ZXJ A;  1HKT A;  2FJI 1;  1Y1W J;  2DDB A;  2AXL A;  5H6Q A;  1U5T C;  5B3S H;  4E7Z A;  2H6C A;  1JTY A;  1R4M B;  1D0Y A;  4RAY A;  4FT8 A;  3OYK A;  5E3L A;  2H27 A;  1MIJ A;  1WGX A;  5JHF A;  2E19 A;  3JRD A;  4KT5 C;  1B6A A;  1HXD A;  2BEO A;  4B44 A;  2QUF A;  2CQK A;  3H9G A;  3WTV C;  1Q1H A;  1WJD A;  1X3U A;  4XKV A;  2W53 A;  3PUB A;  3I5U A;  2RQQ A;  1ZEL A;  4WCG A;  2NNY A;  1SD5 A;  2BOL A;  3A02 A;  3F8N A;  3ZQF A;  1WJA A;  3S5R A;  4X6A J;  4CYC B;  4ZYE A;  4U9L A;  1S6L A;  3JAM Z;  1ETV A;  2UWM A;  3C2G A;  1HF0 A;  2KZG A;  1BW6 A;  4CCM A;  4IRI A;  4EEF G;  3KEQ A;  1MND A;  4UV9 A;  2IBD A;  1RIO H;  2V9K A;  3AG3 H;  3IH4 A;  4EJU A;  1AKH B;  4CCJ A;  1WWX A;  3LL7 A;  4JX5 A;  1I1G A;  4XKW A;  3LAP A;  1TW3 A;  3K4L A;  5LLQ A;  1PJR A;  3E7L A;  3IL2 A;  2KP6 A;  2X6O A;  4PJM A;  3ASO H;  1MBK A;  1W5S A;  2A61 A;  3CCV I;  4IHW A;  3WGH A;  1AWC A;  2R7Q A;  3IHU A;  1RUO A;  2V26 A;  3FIW A;  5IY5 H;  2IS6 A;  1JKR C;  2HVR A;  3OSF A;  4XRS G;  3OOP A;  4ZDL A;  3OYM A;  3TW7 A;  1GVJ A;  1MMS A;  2YPR A;  5CQE A;  3VOX A;  3B6C A;  1LEA A;  1EV7 A;  1STZ A;  4GFB A;  2DOE A;  3OS2 A;  3OYN A;  4HPQ A;  3BCA A;  3LAJ A;  2LY9 A;  2ZXW H;  2JT1 A;  4E4H A;  2X1C A;  3PNV A;  1H89 C;  3F9K A;  1X2M A;  4C3J J;  1QNT A;  5M5W J;  1JGG A;  3GWZ A;  5IPA A;  2E1M C;  3GF2 A;  4C3H J;  2FBQ A;  3TOB A;  4PUS A;  2XB5 A;  4BJ5 C;  3C1D A;  4LIT A;  2O7T A;  2OTJ I;  2DFE A;  2EK5 A;  2Y2Z A;  1MBH A;  2I8D A;  2IS4 A;  1VQK I;  1TBX A;  5C4X J;  4B48 A;  3MKL A;  5TIS C;  3CCY A;  3DF8 A;  4RLQ A;  2MFZ A;  2PJR B;  3KZY A;  3ZQ7 A;  1H8A C;  2KL4 A;  3BG9 A;  1ZKG A;  3GUD A;  3KZ9 A;  3AQT A;  4RDU A;  4OMY A;  3AAF A;  3PO3 J;  2EIK H;  3FXR A;  4UV8 A;  2DI3 A;  3WHB A;  3F22 A;  1FYK A;  3HGY A;  4RB2 C;  3AQS A;  3QBM A;  2KDZ A;  1HBX G;  1XMK A;  1FIP A;  2MYS A;  1NG6 A;  2X4H A;  4U0Y A;  3JAM K;  1RES A;  3QPH A;  4L62 A;  5HLI A;  2EA2 A;  2ZJR F;  4EM1 A;  3SJM A;  3WTT C;  2E5Z A;  1QA6 A;  5DD8 A;  2Y0S A;  4ZTJ A;  2PX9 A;  3BJO A;  1FSH A;  2LK2 A;  1J75 A;  4Y7N J;  3G56 A;  2QKM B;  2QCO A;  1OLT A;  5JHU A;  4YIF A;  2IGM A;  3I4N J;  3ECO A;  1KON A;  1BI3 A;  1UEL B;  1Z7U A;  3G2B A;  3FXO A;  3I59 B;  5FFX A;  3CF2 A;  2A5Y B;  1WJC A;  2OQG A;  1R1T A;  1JT0 A;  3MZ8 A;  1QVT A;  1QHG A;  2L5Q A;  3FF5 A;  4R79 A;  3IAM 2;  3P9I A;  3DEU A;  3A1Y A;  1K4S A;  4D0P A;  3IC7 A;  1XS9 A;  3P9T A;  3DBR B;  4HRI A;  1R23 A;  3KKD A;  1WJF A;  2OZ6 A;  2FBI A;  2CYY A;  2IS1 A;  4LK0 F;  5BS6 A;  2QQ8 A;  4LG0 B;  3O8H A;  1BBY A;  1FBQ A;  2E5N A;  2K9L A;  2A3S A;  4PFP A;  5GAH J;  1W1W E;  1TLH B;  2OUM A;  4HV6 A;  1AKH A;  4BHB A;  4RM2 A;  1S9H A;  5DCF A;  2KRF A;  1SAN A;  4PGG A;  3FIS A;  2LKP A;  2DFI A;  5F64 A;  1ZK8 A;  2M7A A;  2HFH A;  5K7Z A;  4MFE A;  2VE9 A;  2VUM J;  2L9N A;  1OIS A;  1UHS A;  2OBP A;  3HHH A;  3MN2 A;  2DG8 A;  4BXU A;  1BR4 A;  5EYR A;  3AG1 H;  5LEJ A;  1YJW I;  6PAX A;  4EM0 B;  1TWC J;  2DA6 A;  5F0C A;  5KHD A;  1BN5 A;  3E5X A;  4FE7 A;  4BE0 A;  2OCC H;  3A03 A;  5FKL A;  2K4B A;  4I0B A;  1YTY A;  5D8K B;  4XL9 A;  1USS A;  4DBR A;  3ROU A;  4N4N B;  4I7H A;  4UVA A;  3GXO A;  1CGP A;  3RJP A;  2ME0 A;  4IZZ A;  2NS0 A;  3BJB A;  4XR6 A;  3TQN A;  1NH3 A;  3I56 I;  2JWT A;  4CGZ A;  3FRQ A;  1EH6 A;  2B63 J;  1BOB A;  3TKY A;  4HAM A;  3C18 A;  3NNR A;  3OYF A;  2QKO A;  2CMP A;  4IKF A;  1O3T A;  3OR1 C;  2HPI A;  4GDF A;  3CCE I;  3EGQ A;  3JSJ A;  2EIM H;  2EQR A;  4NDL A;  1MBF A;  3S3N A;  4JBA A;  1I1S A;  5K7H A;  2E60 A;  4AF5 A;  1ETY A;  2R93 J;  2L7Z A;  4D5F A;  4XLE A;  4ZH4 F;  3A0B C;  4KYW A;  4BE2 A;  1Z91 A;  1IRZ A;  2XSJ C;  4HX7 A;  1DU0 A;  2CW0 F;  2BGC A;  2EFN A;  2XPV A;  5HBU A;  3SFI A;  4L9N A;  5TGT A;  5J47 A;  3TDU C;  3C3W A;  2X1D A;  5LGN A;  3J7Z I;  4PDK A;  1QZE A;  5CJ9 A;  2YS9 A;  5GTH C;  3OIP A;  2KIF A;  2W24 A;  1T33 A;  2W82 A;  4A3I J;  3R60 A;  3M3Y J;  1HST A;  4YIR X;  1RR8 C;  2JA6 J;  3CJR B;  2VOO A;  4QWQ A;  2XPW A;  3T5X A;  1JE8 A;  1L0O C;  2GXG A;  2VJ5 A;  4BEH B;  5HDN A;  3ZPL A;  4AYB N;  2XRO A;  2IU5 A;  2DJI A;  1XX5 A;  1FJL A;  2NAZ A;  2HU9 A;  2NX4 A;  1D5Y A;  1HW5 A;  1W5C C;  3LMM A;  1XG1 A;  2KLO A;  1KQ9 A;  2EZL A;  1JUS A;  4MO7 A;  1E17 A;  1P9Q C;  3BJ6 A;  3I59 A;  4ESJ A;  1P7I A;  2KKO A;  5CKT A;  3DWL E;  4WWC A;  2LF7 A;  2PMZ N;  2VON A;  3VYT B;  4XNF A;  3HJE A;  2YX4 A;  3DFG A;  1TQM A;  2DOA A;  4B8X A;  1RKW A;  4JL3 A;  4PSW A;  4RGR A;  2GZW A;  1ZGA A;  2GQQ A;  3HRT A;  2JSC A;  1OCR H;  1MBE A;  1R36 A;  1H88 C;  3ZQG A;  3H3Z A;  1TP4 A;  3PNT A;  5LBQ A;  4GRI A;  5HLT A;  1W36 C;  4MTD A;  4NQW B;  4XKB A;  4A5N A;  1W36 D;  3EUH A;  2OU2 A;  3ABM H;  3VUQ A;  2VKV A;  2MC4 A;  5F1R A;  4BAC A;  4XSX F;  1MSF C;  1ODD A;  3B81 A;  1OPC A;  1K6O A;  1ZLJ A;  2R7T A;  5J8F A;  2QSF X;  4L5J A;  2FU4 A;  5JR3 A;  2BXY A;  2V9P A;  1FY7 A;  3HRU A;  4G7Z F;  1CF7 A;  4KFC A;  4UHT A;  4PXI A;  1MBJ A;  2ZOZ A;  2HQR A;  3PSI A;  4D7N A;  5AQC A;  2DJN A;  3JRB A;  1IXC A;  2QTQ A;  2OA4 A;  5J8C A;  3E6C C;  1ACI A;  4KIB A;  3GTO J;  2ZNY A;  3VB2 A;  2IA1 A;  1BR2 A;  2X6W A;  4M74 A;  2M30 A;  5LD2 C;  3E7Q A;  5J1Y A;  4UUS A;  2VOP A;  3RPU A;  3J80 Z;  1E2X A;  5H6R A;  4ETS A;  4ASN A;  2KDO A;  2UZK A;  3CC2 I;  3H0D A;  3HRS A;  2ID6 A;  2F48 A;  3CJT B;  1BOA A;  2ZCN A;  2XAS A;  2XRL A;  4U87 A;  3N4M A;  2CW8 A;  1XD7 A;  3P5J A;  2F5E A;  1Z7L A;  4M72 A;  2EFP A;  3LSI A;  4B47 A;  2HZD A;  2UXX A;  5IP9 J;  1S29 A;  4CCK A;  2BW3 A;  5EZH A;  2AO9 A;  3BG6 A;  1T0F A;  3QYF A;  1IN7 A;  4ITV A;  1SAX A;  4U0V A;  3OYJ A;  2G3B A;  4G94 A;  2H1K A;  1IUY A;  1OCZ H;  5KAF C;  4Y15 A;  2W7N A;  4BJ6 C;  2TRT A;  5FKN A;  3CJQ B;  4G6T B;  3G4S I;  1TNS A;  4YFK F;  1TWH J;  2ZME C;  3OV8 A;  2FJ1 A;  4BAY A;  3S93 A;  3L2Q A;  3GTG J;  3U9G A;  1JJ8 C;  4XIC A;  3VW2 A;  4LGW A;  5ILS A;  4G6D A;  3M4O J;  3L2W A;  3VVX A;  4FCY A;  4FIS A;  3JTG A;  4AD9 A;  3HOV J;  1Y39 A;  2UXI A;  2MH2 A;  2CUZ A;  2E2H J;  3GBG A;  2RAS A;  2W48 A;  4RS8 A;  2VIX A;  1G4D A;  4EQQ A;  1Z6R A;  5ED4 A;  3T0Y A;  2JPC A;  4BQQ A;  4UVB A;  2XGX A;  1WI3 A;  4BGD A;  4Q4Z F;  4XID A;  3LSM A;  4A0Z A;  1HLV A;  1JTX A;  1VQ5 I;  3R61 A;  1V4R A;  3WTW C;  2OPT A;  3PIO F;  4FX0 A;  1BC8 C;  1K6Y A;  3ONQ A;  4XOR A;  2O8K A;  2HOS A;  5CLS A;  5J4V A;  4XSZ F;  3JRF A;  1WZ2 A;  3TP0 A;  1ZLK A;  2R5Z A;  4AM3 A;  3SEQ A;  2DMQ A;  2R7U A;  3A4C A;  3V8L A;  4RBO A;  3CD6 I;  2F2E A;  1YJ9 I;  3VFZ A;  1P6R A;  1X3W B;  3HTU A;  2KIU A;  1CQT A;  2FML A;  1XTA A;  1BR1 A;  4MEY F;  4A3K J;  3MZH A;  2IAI A;  4OIQ F;  4KN4 X;  1XGS A;  2FXA A;  1ETX A;  3VVZ A;  2DK5 A;  1PP7 U;  1P7J A;  1FBU A;  3ON4 A;  2PG4 A;  4CUG A;  3MKY B;  1EJ9 A;  4D5C A;  1FYL A;  2RNJ A;  2WV0 A;  4EJO A;  5EEH A;  2HYJ A;  3D5S C;  1E3O C;  2YVX A;  3CMY A;  3REO A;  3ZMZ A;  2LKS A;  1I3A A;  3ZN1 A;  4DYQ A;  3SXY A;  2VC0 A;  2L54 A;  1HKQ A;  2NOG A;  2BHZ A;  3D5L A;  1GUU A;  1Y6I A;  1R5G A;  3TO6 A;  3E1S A;  4NC7 A;  4D1Q A;  4NNJ A;  1VQ7 I;  1Y0U A;  2QM3 A;  2QQA A;  5L3G A;  2FQ4 A;  5IT9 Z;  3CZ6 A;  1V5G A;  4J00 A;  1OR7 A;  2OF7 A;  2ISZ A;  1S7O A;  3L09 A;  3OL3 A;  1SMY F;  3L9F A;  4H0E A;  2H09 A;  2MGQ A;  1J09 A;  2VT3 A;  5IT3 A;  4E7J A;  4MEX F;  4JNN A;  4A0X A;  2FOK A;  3QP6 A;  3OYG A;  4V2G A;  2HDC A;  1T08 B;  2M8G X;  3WGI A;  1F4K A;  2DA3 A;  2ELH A;  2LYC A;  3FK6 A;  4GO1 A;  2DA1 A;  1I39 A;  4DZJ A;  4UUT A;  4E6K G;  2CQN A;  3ASN H;  1WFX A;  5D6F A;  4PZJ A;  2GWR A;  4LK1 F;  2X48 A;  1YJN I;  2P4W A;  3BQZ A;  5D5U B;  3OIQ A;  1Q1V A;  4XLC A;  3CCQ I;  1SGM A;  1T98 A;  2NOJ B;  3WOD F;  2M1B A;  1D1B A;  1IRG A;  2RKH A;  4N9H A;  2E7X A;  4S0H B;  3LWF A;  3K8P C;  3SZG A;  1B1B A;  2IW5 A;  4BKX A;  2OER A;  2IRF G;  5LHH A;  1QBJ A;  2RNG A;  1LQ1 A;  3QPS A;  1OCP A;  1XGN A;  4E7S A;  1FP2 A;  2L3D A;  4CZC A;  1YFH A;  1YIJ I;  3Q0U A;  3DXJ F;  4ACI A;  3HL2 A;  2P5K A;  2WAD A;  2HNH A;  5GAE J;  3LA7 A;  5L3D A;  1W0U A;  4RB0 A;  2CUJ A;  3K4N A;  4L5E A;  2HOT A;  3EUA A;  1SEU A;  4HX4 A;  1IUF A;  1TT0 A;  2WAQ A;  2XGC A;  2IVM A;  4L9T A;  1GV5 A;  3MKZ A;  1YW9 A;  2VKD A;  4HV5 A;  1AA7 A;  1ZRC A;  1FC3 A;  2QGU A;  4IQJ A;  3GLX A;  3OYC A;  1TTY A;  2YSR A;  2P7V B;  3GCM A;  3HOY J;  4NUB A;  1G3S A;  3L2V A;  4G9Y A;  3K9T A;  5B5E C;  2A05 A;  3KIO A;  2K3F A;  4RGS A;  4XN0 A;  3KP2 A;  1RZ4 A;  4HNV A;  3HKZ N;  5BQT A;  3ZQC A;  4CA0 A;  3FBN B;  2JZY A;  2P6T A;  3WE2 A;  3ON2 A;  4IOA F;  2LSO A;  1UFM A;  2XC7 A;  3S2W A;  1R49 A;  1WI9 A;  1WH7 A;  3HTA A;  1RR7 A;  1UST A;  2IXS A;  3JCU C;  5IT9 K;  4WXH A;  3BCB A;  3GZ6 A;  3HHG A;  1TWA J;  2M8E A;  3CMA I;  3BHQ A;  2DQL A;  2OZU A;  4WIB A;  3QOP A;  2VC1 A;  3CP8 A;  4G6Q A;  3G6E I;  5TRD A;  5EEG A;  2G7S A;  4LLN A;  5DAJ A;  3RCO A;  3GEZ A;  4M3B A;  1FPQ A;  1TQP A;  1TL8 A;  2CW7 A;  2EZH A;  3P7N A;  1T39 A;  5K5O A;  5HLG A;  5CXI A;  3DBL B;  4IVN A;  2CWE A;  4BQN A;  4ESF A;  1I6H J;  3EET A;  1WCM J;  5IYC J;  3E6B A;  2RHA A;  2E2I J;  2ZC2 A;  3TMO A;  5DDG A;  4KWA A;  4LOC A;  3FWE A;  4ZDO A;  3AG2 H;  3J7Y J;  2AS5 F;  2LY2 A;  2Z2S B;  2ZNZ A;  3OOU A;  5JI6 A;  3SFZ A;  3GTK J;  2AXT C;  4M3G A;  4DYR A;  5K5R A;  2VLA A;  5LRR A;  2QLZ A;  3KEY A;  1XN7 A;  5H20 A;  4BL0 B;  2WTE A;  3NEU A;  5BPD A;  2Y0S N;  1WHU A;  1FWZ A;  2ZO4 A;  3OYA A;  4DOZ A;  2VQC A;  5DV5 A;  2WUI A;  2Z5U A;  3TOA A;  1IN8 A;  2FEZ A;  4WK8 F;  2O5R A;  5K58 A;  3HRM A;  4I01 A;  5IOY A;  1X4P A;  4JP0 A;  2B7E A;  2M0C A;  3K1M A;  2RVC A;  5F6F A;  2J5O A;  3SDG A;  3S1Q J;  2ZSH B;  4P1W A;  4Z6Y A;  1QZZ A;  1Z0X A;  4PSX A;  1FTZ A;  3QWL A;  3RKW A;  3JR9 A;  4DW6 A;  1ZR2 A;  3KP6 A;  2VI6 A;  3S1R J;  2RN7 A;  2KIS A;  4RAZ A;  5FLM J;  4MHG A;  4BY1 J;  2OCE A;  3NXC A;  5EEA A;  4XRM A;  3H36 A;  3OYE A;  3F23 A;  4L0Z B;  1HDP A;  1FTT A;  3MAJ A;  4CO8 A;  2HPM A;  2CRG A;  4DZP A;  3BG7 A;  3L2C A;  3K6G A;  2VKH A;  1IN6 A;  2EIL H;  3G1O A;  5HNF A;  2XGE A;  3MVP A;  2ZCX A;  1R71 A;  3WU0 A;  2A2F X;  4KN7 X;  5F0F A;  2H8W A;  1OYY A;  2MW8 A;  1IW7 F;  3E97 A;  3ABL H;  1X1D A;  3WG9 A;  2F4O B;  2O03 A;  4KT6 A;  5CVI A;  4DIQ A;  3BJA A;  2L7K A;  3FXK A;  3OIO A;  2OD5 A;  5JLX A;  3ZGK A;  2HKU A;  1VFC A;  1SMT A;  2K9N A;  2EV6 A;  5CVU A;  4AC0 A;  3ULQ B;  3I4P A;  3KET A;  4DGW B;  1HC8 A;  3HC7 A;  4E7I A;  3CQZ J;  3K4K A;  2NVX J;  2IS2 A;  1U8B A;  1PYV A;  4Y33 A;  5K5Q A;  1GXP A;  2PMU A;  2LNB A;  2XVC A;  3EYY A;  4F3Q A;  2VE8 A;  4HBL A;  3MFK A;  3QPL A;  4I6Z A;  2FA5 A;  2FMY A;  2ZFU A;  3S16 J;  2Y30 A;  4CCL A;  4C2U A;  4W97 A;  3S1M J;  2YVE A;  3CO6 C;  5CXG A;  2F4M B;  4NC6 A;  3GFL A;  4CSW A;  2DMN A;  2G7L A;  3KPH A;  4LIU A;  3U2R A;  3LST A;  1ZRD A;  1XMX A;  3HXL A;  1WJE A;  3OYB A;  5L3F A;  2M5W A;  1U0J A;  2HTS A;  3UKG A;  3PQK A;  4IJA A;  5E3O A;  3DLA A;  4FX4 A;  3ISP A;  1O3Q A;  2PMH A;  2DA7 A;  2GM4 A;  5FKK A;  2UUZ A;  3HSF A;  5LHG A;  3Q0W A;  1YE9 A;  5FGL A;  1ULY A;  4HDU A;  3IRQ A;  3U1D A;  3HDD A;  2DO7 A;  1V5E A;  2JA7 J;  4Y3O A;  3S2D J;  4HNU A;  3KNW A;  3ZMD A;  1G8X A;  2OV7 A;  5FKO A;  4S05 A;  2WAE A;  3F3X A;  3ZP5 A;  4ENN A;  1K83 J;  3EUK L;  3KYD B;  2BZT A;  5FD6 A;  2X85 A;  2WB1 A;  2VBY A;  3WU2 C;  5JFR A;  3D5R C;  2IGN A;  1JUP A;  2HXI A;  1YI2 I;  3V7C A;  1ZG5 A;  5LHI A;  4BH9 A;  2Z33 A;  1X19 A;  4FHT A;  1I3Q J;  2XAU A;  2NP5 A;  1TZL A;  3P9C A;  5DTD A;  1R9T J;  3HOS A;  3CDL A;  1G3W A;  2EA4 A;  2BV6 A;  1ZHF A;  1QPM A;  4Y4R A;  3DKY A;  3VYU B;  3HOX J;  2R5Y B;  5JVG F;  2R7V A;  5HDG A;  1RRJ A;  1FIA A;  5DCM B;  2EFW A;  5EZG A;  1IV8 A;  2EZK A;  2MC3 A;  3QPT A;  4PK4 A;  2NS8 A;  1U9N A;  1IDZ A;  3M8F A;  4ENK A;  3OYL A;  4TV7 A;  4A3J J;  1GXQ A;  3PAS A;  3H3V K;  2TDX A;  1OCO H;  3HSE A;  3KKC A;  3QAH A;  5C3E J;  1SC7 A;  5GAD J;  2CO5 A;  5FRO A;  3KYL A;  1IV6 A;  4OD5 A;  1MH3 A;  2LRE A;  3IUO A;  5KNL A;  5CQG A;  2CGP A;  1O7F A;  1U6G A;  1UAA A;  1XSX A;  1XB4 A;  2D6Y A;  3LHQ A;  2ZKZ A;  2HXO A;  2R7O A;  5BMZ A;  4BBS J;  3VVY A;  2HYT A;  4EGZ A;  1O4X A;  2P81 A;  4A3D J;  2NNN A;  3J81 K;  3DP7 A;  2VXZ A;  1VQO I;  1LJ9 A;  3I64 A;  1Z1D A;  3QYB A;  2LD5 A;  3M9A A;  4OIR F;  3PSF A;  4ABZ A;  1IC8 A;  2OTL I;  4JX4 A;  5EF6 A;  3I3L A;  1SVL A;  3BR3 A;  2VKE A;  1K78 B;  2MD0 A;  3ANG A;  1VQM I;  1BI0 A;  3SZP A;  3WG7 H;  2QWT A;  3M07 A;  3CP2 A;  3MNL A;  1E3P A;  1VQL I;  2K9S A;  4HF2 A;  2JTV A;  4F7Z A;  3QU3 A;  3LSJ A;  4YFX F;  3HYI A;  2L4M A;  2W84 A;  4L9J A;  2Q24 A;  3OYH A;  5J40 A;  1K4T A;  1ETW A;  2ZCM A;  1ZG1 A;  3KP7 A;  5C4J J;  1CF7 B;  2HOA A;  3K4B A;  1JUM A;  2XHK A;  2GAU A;  1A6Q A;  3ZCO A;  3TO7 A;  2RAE A;  4RMN A;  3Q0V A;  2NRA C;  4I02 A;  1B72 B;  4RAG A;  1R4N B;  5J6X A;  4XLN F;  2UXP A;  4WXC A;  3PJR A;  2RQP A;  1SD7 A;  3VYS B;  1DPU A;  4X0G A;  4UUS B;  4LB6 B;  3UR3 C;  3CF5 F;  4DQ2 A;  1KU9 A;  1ZYR F;  3GTM J;  2PBI A;  2H6B A;  4FE4 A;  2P5V A;  3S15 J;  1UHM A;  3H5A A;  1QHH D;  1QPI A;  5FJ8 J;  2IT0 A;  4HG2 A;  1TT5 B;  4U7B A;  4G7O F;  3A01 B;  4RGU A;  3ANP A;  2FSW A;  2VL8 A;  1OCT C;  5TJJ A;  4BHC A;  1R00 A;  4DVY P;  3BZ6 A;  5M5Y J;  3VOK A;  2B9S A;  3VEP A;  1KYZ A;  2FBK A;  1V55 H;  2BW3 B;  2V6C A;  1F36 A;  2EH3 A;  4QTR A;  1XSD A;  2L2O A;  4F93 B;  2R5Y A;  2PN6 A;  2E7W A;  4CYD A;  5HDK A;  4XMY A;  1J9I A;  2GFN A;  3TED A;  1Y56 A;  3EDP A;  2R0Q C;  4A6D A;  2KRC A;  2BE5 F;  4HYE A;  1OYW A;  5DCM A;  1A6I A;  1HDD C;  1OJL A;  1IGN A;  1FOY A;  1RKT A;  2GEN A;  2HQ5 A;  2E1C A;  2NP3 A;  2ECB A;  3ZMT A;  2A69 F;  4C2M J;  1VZ0 A;  2K7L A;  5J3L A;  2A07 F;  2M34 A;  3BDD A;  1A5J A;  1OCC H;  4HZF A;  2DTR A;  3TGN A;  2JRT A;  2MH9 A;  4UUV A;  2AHQ A;  4I2O A;  2V4J C;  1TNT A;  4ON0 A;  4ZC3 A;  1D0X A;  2M4G A;  2OQR A;  3PM1 A;  4I98 B;  3RSN A;  2CFX A;  4DNC A;  3H0G J;  1S5L C;  3GEU A;  2K9Q A;  3GTJ J;  2V79 A;  5KAI C;  2XF5 A;  1QGP A;  1OMI A;  2DU9 A;  2Q2E A;  2LBF A;  3FXQ A;  5M3M J;  3CTA A;  2ZJP F;  2ICW G;  4HF0 A;  2R5Z B;  3NPI A;  3OL4 A;  1W7P B;  5ICF A;  1YLF A;  3ZQH A;  5D5V B;  1MJA A;  1Z3Y A;  5CW8 A;  3MEX A;  2IA0 A;  1UB9 A;  1K78 A;  3R6S A;  1LVK A;  1YHQ I;  1FOK A;  4RA2 A;  3EPZ A;  1GT0 C;  3IAS 2;  4JX6 A;  3RQ4 A;  2F5V A;  2G7H A;  3BR0 A;  2NVQ J;  1MDM A;  2HI3 A;  1LE8 A;  1ETO A;  3V6G A;  1YW7 A;  1YIO A;  2R3S A;  1LUJ B;  4PJ0 C;  1ORK A;  5FLX K;  1WH5 A;  3TL4 X;  3VSK A;  3PPB A;  4M9X A;  3QOD A;  1B72 A;  3VP5 A;  4J01 A;  1ERD A;  2LRD A; 
#chains in the Genus database with same CATH homology
 1YRN A;  4JNN A;  2ECC A;  1JTY A;  4A3F J;  4V2G A;  2M8G X;  5E3L A;  2DA3 A;  1WGX A;  1UI6 A;  3FK6 A;  3QKX A;  4BY7 J;  3TW6 A;  1LE8 B;  2E19 A;  2DA1 A;  4DZJ A;  4UUT A;  3JRD A;  1IG7 A;  3HOZ J;  1I50 J;  2JN6 A;  2W53 A;  2X48 A;  3A01 A;  3BQZ A;  2DN0 A;  5F08 A;  1Q1V A;  3LWJ A;  3A02 A;  2YUS A;  3ZQF A;  3S5R A;  4X6A J;  1SGM A;  4CYC B;  5D19 A;  1JJ6 C;  4BXX J;  1ETV A;  1B8I B;  3C07 A;  4S0H B;  1HF0 A;  2DTZ A;  1BW6 A;  4BKX A;  2OER A;  4EEF G;  1APL C;  1T56 A;  3QPS A;  1OCP A;  2IBD A;  3EUP A;  3LSR A;  3HOU J;  3IH4 A;  3JRI A;  3Q0U A;  4ACI A;  1AKH B;  2ZOY A;  1W0U A;  2JJ7 A;  2UXH A;  3GTP J;  4L5E A;  2HOT A;  2WV1 A;  4JX5 A;  2HDD A;  1IUF A;  3E7L A;  2X6O A;  2XGC A;  3O60 A;  2TCT A;  1MBK A;  4J19 A;  2REK A;  3BCG A;  1GV5 A;  4GCK A;  2LFB A;  4IHW A;  2Y31 A;  3IH3 A;  2VPR A;  2WAQ N;  2FD5 A;  3JRH A;  3FIW A;  3D1N I;  1ITY A;  1JKR C;  3HOY J;  3OSF A;  2N8G A;  4XRS G;  5FMP A;  4M3F A;  3BNI A;  3TW7 A;  3HTJ A;  3VOX A;  3B6C A;  3HTI A;  2X9D A;  4HNV A;  3HKZ N;  1HCR A;  4GFB A;  3ZQC A;  3LOC A;  1Z77 A;  2LY9 A;  2D5V A;  3ON2 A;  3S2H J;  2ELK A;  1H89 C;  3RKQ A;  5EG0 A;  1X2M A;  1WH7 A;  4C3J J;  3HTA A;  5M5W J;  1RR7 A;  1JGG A;  5IPA A;  4C3H J;  2FBQ A;  3VIB A;  1TWA J;  2XB5 A;  2O7T A;  2YVH A;  3BHQ A;  1JKQ C;  2Y2Z A;  1MBH A;  4A3E J;  5C4X J;  2G7S A;  1JT6 A;  5DAJ A;  4M3B A;  3MKL A;  2YU9 J;  3CCY A;  2EZH A;  1H8A C;  5CXI A;  3JRE A;  3BG9 A;  1ZKG A;  3HTH A;  1LFB A;  1QVU A;  1NK2 P;  3AQT A;  3KZ9 A;  2LTP A;  4RDU A;  2F07 A;  3BTC A;  1I6H J;  4QSH A;  3PO3 J;  1WCM J;  5IYC J;  2RHA A;  2E2I J;  1TWF J;  2GUH A;  3WHB A;  2CJJ A;  1ETK A;  3HGY A;  5EDN A;  4IHY A;  3AQS A;  3RQI A;  4LOC A;  2KDZ A;  3QBM A;  1FIP A;  4KWA A;  3Q3S A;  4I76 A;  4XRS A;  1RES A;  3HE0 A;  4L62 A;  3HEF A;  2L7M P;  3OOU A;  5K7F A;  3SJM A;  3GTK J;  4M3G A;  4DYR A;  4GCL A;  2ZB9 A;  2E1O A;  2LK2 A;  2UXO A;  2Y0S N;  4Y7N J;  3DEW A;  3G56 A;  2QCO A;  2WUI A;  1GV2 A;  5K58 A;  5IOY A;  3I4N J;  4JP0 A;  2L0K A;  2M0C A;  3SDG A;  3S1Q J;  3BRU A;  1JT0 A;  1Z0X A;  1F43 A;  3BTJ A;  3HM5 A;  1FTZ A;  1QVT A;  3JRC A;  3JR9 A;  3HOW J;  1GDT A;  3K2A A;  4DW6 A;  2G0E A;  1ZR2 A;  2XPU A;  3IH2 A;  1XS9 A;  2VI6 A;  3K7A J;  1B8I A;  3P9T A;  4QIW N;  3S1R J;  2H8R A;  5FHP A;  3KKD A;  5FLM J;  4BY1 J;  3VW1 A;  4A69 C;  5FLV A;  1OFC X;  3O8H A;  4V2F A;  3NRG A;  5EEA A;  4XRM A;  3NXC A;  1EF4 A;  4MIM A;  5F0H A;  1AKH A;  1FTT A;  1HDP A;  5J1U A;  1DU6 A;  2CRG A;  4DZP A;  5IP7 J;  2WGB A;  1ZR4 A;  2R92 J;  1QRY A;  1SAN A;  3FIS A;  3G1O A;  1WPK A;  1ZK8 A;  3BR2 A;  1HOM A;  2XGE A;  3MVP A;  2ZCX A;  5K7Z A;  4MFE A;  2VUM J;  2DG8 A;  1UHS A;  3MN2 A;  5F0F A;  5EYR A;  2MW8 A;  4A3M J;  5GP9 A;  1JKO C;  1UG2 A;  1TWC J;  1VI0 A;  2DA6 A;  5F0C A;  5D18 A;  4FE7 A;  2MG4 A;  3OIO A;  4IEJ A;  5JLX A;  2FX0 A;  3A03 A;  5FKL A;  2HKU A;  1VFC A;  2K9N A;  4AC0 A;  4A3L J;  5F27 A;  3CQZ J;  2NVX J;  1U8B A;  2ME0 A;  3BJB A;  3C2B A;  2ME6 A;  4I6Z A;  3QPL A;  5HAW A;  3HB9 A;  2JWT A;  3S16 J;  2Y30 A;  4W97 A;  3S1M J;  5GPA A;  3FRQ A;  2B63 J;  3LJL A;  2YVE A;  3NNR A;  4NEL A;  3RH2 A;  4M3D A;  5CXG A;  2QKO A;  1PUF B;  2DMN A;  3EGQ A;  2G7L A;  3B6A A;  3JSJ A;  1IDY A;  4MFD A;  2EQR A;  4NDL A;  1MBF A;  2JA5 J;  4JKZ A;  4UDS A;  4AF5 A;  5K7H A;  5IOZ A;  4AC6 A;  1ETY A;  5BNG A;  2L7Z A;  4D5F A;  1BL0 A;  4D7M A;  3RZD J;  3UKG A;  2R93 J;  4A93 J;  2IEK A;  5E3O A;  2EBI A;  1IRZ A;  1ZQ3 P;  1JKP C;  1DU0 A;  1FEX A;  3BTI A;  2GM4 A;  2DA7 A;  5FKK A;  2QOP A;  2XPV A;  5HBU A;  3SFI A;  1ZGW A;  4XK4 A;  3Q0W A;  3GZI A;  5FGL A;  3HDD A;  2DA5 A;  1ETQ A;  2YS9 A;  4GFL A;  1RET A;  2JA7 J;  3S2D J;  4A3I J;  2DA4 A;  1T33 A;  3KNW A;  3M3Y J;  2JA6 J;  5FKO A;  1K83 J;  1AHD P;  3ZOB A;  4B3A A;  2JK3 A;  1UI5 A;  2XPW A;  2DMP A;  1MSE C;  1JUP A;  2HXI A;  3FKI J;  5HSZ A;  4AYB N;  4ME9 A;  5JLW A;  4MLO A;  2IU5 A;  2CQX A;  1FJL A;  2ID3 A;  2NX4 A;  1I3Q J;  1D5Y A;  2NP5 A;  1XG1 A;  5DTD A;  1R9T J;  2EZL A;  1JUS A;  3CDL A;  4MO7 A;  3PO2 J;  1BW5 A;  5D1R A;  5E3M A;  3HOX J;  1MBG A;  2R5Y B;  1NK3 P;  4M6V A;  1P7I A;  2OI8 A;  2NVY J;  2LKX A;  1FIA A;  4G12 A;  2PBX A;  1K61 A;  5EZG A;  2PMZ N;  3FK7 A;  2JA8 J;  3I4M J;  2EZK A;  3L1P A;  2NS8 A;  1U9N A;  3BR5 A;  1RKW A;  5GPC A;  4JL3 A;  3W6V A;  1IDZ A;  1X58 A;  5IP6 A;  3BT9 A;  4A3J J;  3PAS A;  3H3V K;  3KKC A;  1MBE A;  1H88 C;  3ZQG A;  5C3E J;  4A3C J;  4DYC A;  1IV6 A;  1XC5 A;  3WHC A;  4MK6 A;  2V57 A;  1MH3 A;  2QIB A;  3BQY A;  5F1J A;  3VUQ A;  4GFK A;  2VKV A;  3G1L A;  2L9R A;  3BR6 A;  4BBR J;  2D6Y A;  3LHQ A;  2HXO A;  1UMQ A;  4A3B J;  3DCF A;  4HKU A;  1MSF C;  2Y9Z A;  4BBS J;  3HIM A;  3VVY A;  2G7G A;  3B81 A;  2HYT A;  1O4X A;  2P81 A;  3TP3 A;  4A3D J;  1VND A;  3G1M A;  3O8G A;  3JRA A;  4PXI A;  2Y9Y A;  1MBJ A;  2LD5 A;  2ZOZ A;  3S17 J;  4ABZ A;  4D7N A;  5AQC A;  3RD3 A;  2DJN A;  3JRB A;  1IC8 A;  3GTQ J;  4GCT A;  5F04 A;  2DMU A;  4JX4 A;  2QTQ A;  5EF6 A;  2M9H A;  3BR3 A;  3S1N J;  2CU7 A;  2VKE A;  3QQA A;  3GTO J;  2LVS A;  3ANG A;  1X2N A;  1TC3 C;  2CUE A;  1RPW A;  2QWT A;  5EGO A;  3E7Q A;  1ENH A;  5J1Y A;  4UUS A;  3MNL A;  3COL A;  2K9S A;  2LR8 A;  1S7E A;  3NAU A;  3V78 A;  4X1E A;  5M3F J;  5DS9 A;  3LSJ A;  2GBY A;  2Q24 A;  1AU7 A;  2ZCM A;  4MXM A;  1ETW A;  5HOD A;  5C4J J;  1PUF A;  1MNM C;  3BR1 A;  2HOA A;  3DPJ A;  9ANT A;  2ID6 A;  1JUM A;  2ZCN A;  2COB A;  2I10 A;  2RAE A;  2XRL A;  2K40 A;  3Q0V A;  2UXU A;  1U78 A;  1B72 B;  3S14 J;  2UXP A;  5M5X J;  1YRN B;  1BA5 A;  5EGO B;  1IJW C;  4UUS B;  2EZI A;  5IP9 J;  2GLO A;  1POG A;  3GTM J;  5EZH A;  4JYK A;  2AO9 A;  3HGG A;  4FE4 A;  2XSD C;  3BG3 A;  3GTL J;  3S15 J;  4ICH A;  5H9T A;  3VW0 A;  4CGR A;  1QPI A;  2O7O A;  5FJ8 J;  2NVT J;  3VPR A;  4NN1 A;  3A01 B;  2E2J J;  3ANP A;  2G3B A;  2H1K A;  3ZQI A;  3F1B A;  3IV5 A;  1OCT C;  2TRT A;  5FKN A;  5M5Y J;  1TWH J;  3VOK A;  2DG7 A;  2FJ1 A;  2LLK A;  3GTG J;  1JJ8 C;  4XIC A;  5EFY A;  1BJZ A;  3VW2 A;  3NAR A;  2DA2 A;  3M4O J;  1F36 A;  2EH3 A;  1LFU P;  4Y52 J;  3JRG A;  4QTR A;  3VVX A;  4FCY A;  4FIS A;  2O9L A;  3HOV J;  5IYB J;  2MSY A;  2R5Y A;  2GFN A;  2UXI A;  1NTC A;  5C4Y A;  3NI7 A;  3TED A;  2R0Q C;  2E2H J;  3GBG A;  2RAS A;  2W48 A;  1A6I A;  1TWG J;  4A3G J;  1HDD C;  1Y1V J;  2XGD A;  1OJL A;  1IGN A;  3G7R A;  4W1U A;  1WI3 A;  2LP0 A;  4FTH A;  4XID A;  1RKT A;  2GEN A;  1HLV A;  1JTX A;  2HQ5 A;  2NS7 A;  5E3N A;  2NP3 A;  2ECB A;  2WB1 N;  5IYD J;  2OPT A;  2PZ9 A;  4C2M J;  2O8K A;  5J3L A;  2HOS A;  3CRJ A;  2M34 A;  3F0C A;  3JRF A;  1G2H A;  1U9O A;  1ZTR A;  3TP0 A;  1A5J A;  3CWR A;  2R5Z A;  5C44 J;  2CQQ A;  4M3E A;  2DMQ A;  3LSP A;  1MH4 A;  4RBO A;  2AHQ A;  2XDN A;  3HBL A;  3PM1 A;  3GEU A;  3H0G J;  2K9Q A;  3GTJ J;  1CQT A;  1GVD A;  2KT0 A;  5EG0 B;  4A3K J;  4IHV A;  2IAI A;  4B1R A;  4IHX A;  1ETX A;  3LNQ A;  3VVZ A;  5M3M J;  2DMT A;  3OSG A;  1P7J A;  2R5Z B;  3NPI A;  3ON4 A;  2M2E A;  4D5C A;  3BG5 A;  3ZQH A;  3RZO J;  3IUV A;  5CW8 A;  2HYJ A;  1E3O C;  3CMY A;  4DYQ A;  1GT0 C;  3BTL A;  4JX6 A;  1W0T A;  2NOG A;  2CUF A;  3BR0 A;  2NVQ J;  2JMW A;  3ZQL A;  3CJD A;  3LSG A;  3T6N A;  1GUU A;  2HI3 A;  1LE8 A;  1ETO A;  5J1R A;  3V6G A;  4C3I J;  2QF7 A;  4YZE A;  4B4C A;  2L7F P;  5FKM A;  1ORK A;  2FQ4 A;  1WH5 A;  1VF9 A;  2OF7 A;  4AUX A;  2R7Z J;  2XB0 X;  3PPB A;  1Y1W J;  1B72 A;  3VP5 A;  4CYC A;  2MGQ A;  1SFO J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...