2ZB9A

Crystal structure of tetr family transcription regulator sco0332
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
188
structure length
188
Chain Sequence
b'GRRPAEEVRAEVLHAVGELLLTEGTAQLTFERVARVSGVSKTTLYKWWPSKGALALDGYFHAVEDTLAFPDTGDVRADLLAQLRAFTHVMTRTPGGRILTELIGAAQTDADLATAYRQLYSAQRRALAAERLRHARELGQIRPDVDVQVLVDQLWGAVYHRLLIPDEPVDDAFVTALVTNLLDGVCPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative transcriptional regulator
publication title Structural and functional analysis of the TetR-family transcriptional regulator SCO0332 from Streptomyces coelicolor
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Transcription
total genus 72
structure length 188
sequence length 188
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF16859 TetR_C_11 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2zb9A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2zb9A02
5HAWA 3BTLA 2CQXA 4MFEA 3ZQHA 1JJ6C 3DPJA 1JKQC 2LVSA 2GLOA 3UKGA 5GP9A 3LSGA 5C3EJ 3GZIA 5CXGA 2LLKA 3FKIJ 3ZQLA 4V2FA 3O8HA 4GFBA 4IHWA 2KT0A 1TWCJ 5M3MJ 4MK6A 2X48A 3QPLA 4I6ZA 2DMPA 4V2GA 4DYRA 1TC3C 1MH3A 4NDLA 5M5YJ 2NP3A 3OSFA 3LHQA 2R0QC 1JKRC 2UXUA 2P81A 4BY1J 3BR1A 4XK4A 1OCPA 1IDYA 2UXIA 3O8GA 1IV6A 2B63J 4MO7A 2ME6A 2JA5J 2XGEA 1AU7A 4BBSJ 1JKOC 3ON2A 1ITYA 3CRJA 4A3LJ 2DA4A 1XS9A 2D6YA 1JJ8C 2F07A 2UXPA 2EBIA 2Q24A 2R5ZB 4JL3A 3P9TA 2Y30A 3A03A 3HB9A 3PM1A 3A01A 4C2MJ 4AUXA 3GEUA 2REKA 2LY9A 5D19A 5EYRA 2ECCA 3VPRA 2LP0A 5IP9J 4JKZA 4S0HB 1WCMJ 2DTZA 2YU9J 1ZKGA 3NPIA 3S1QJ 2CU7A 1MBFA 1IUFA 4XIDA 4A3MJ 1RETA 2EZKA 3HKZN 3O60A 2DG8A 4XRSA 3BG5A 2L7ZA 5EF6A 1JT6A 1TWFJ 4LOCA 5D1RA 2YVEA 3MKLA 3HGGA 3Q3SA 2UXHA 1TWAJ 2QTQA 1BL0A 4IHXA 4DYQA 2QF7A 3VW0A 3JSJA 2FJ1A 5FKMA 5DTDA 2DG7A 4G12A 3F0CA 1QVTA 5D18A 5FGLA 4KWAA 2FD5A 3OSGA 2DA6A 1BA5A 3VW2A 2TRTA 3QBMA 2JA7J 1ETOA 2QIBA 3HOYJ 1I50J 4XRSG 5J1YA 1Z0XA 3NARA 5K7FA 1U9OA 3CJDA 2E1OA 3KKDA 1NTCA 3MNLA 1Q1VA 5F0FA 2MW8A 1I3QJ 3JRAA 1CQTA 1RPWA 1GV2A 3NAUA 3B6CA 1AHDP 3IH3A 3JR9A 2DA1A 2XB5A 3HBLA 3BRUA 3BT9A 1Z77A 2XGCA 4BKXA 1JGGA 2XPWA 2QCOA 3JRIA 4A3JJ 2QWTA 3G7RA 4X6AJ 2PMZN 3BR3A 3Q0UA 2PZ9A 3BCGA 5F27A 2ZB9A 3FISA 5EGOA 2YVHA 2DMUA 3VP5A 1IGNA 2XRLA 1U78A 4EEFG 3ZQGA 3BQZA 3GTMJ 2VUMJ 1DU0A 3ANGA 2ID6A 4JX4A 2EZHA 2GFNA 3B81A 4A3EJ 3M3YJ 2XPVA 3BR0A 3QQAA 5EGOB 3NXCA 1QVUA 3PASA 1Y1VJ 1POGA 1X2MA 1FTTA 3KKCA 3LSRA 2ZCXA 3OIOA 4L62A 3T6NA 3CCYA 1SANA 2OF7A 1ETWA 3HTHA 2ECBA 3LOCA 4B3AA 2GM4A 1JT0A 3HOVJ 1MBHA 2DA5A 3C2BA 1ZR2A 2HDDA 2IBDA 3GTJJ 4M3DA 3AQTA 1ENHA 1MBEA 3IH4A 5IPAA 4QTRA 2V57A 3BR6A 1QRYA 3WHCA 3S5RA 2LR8A 2M0CA 5FKNA 1FIPA 4ABZA 3W6VA 1A5JA 1UHSA 4FE4A 4A93J 3H0GJ 1U9NA 4A3DJ 2K40A 1K61A 3RH2A 5JLWA 4UUSB 2JWTA 2WAQN 2CUFA 4A3CJ 1G2HA 2OERA 3G1LA 5FHPA 1GUUA 5E3OA 2NP5A 3A02A 5IP7J 3D1NI 1B8IA 2WB1N 1OJLA 2LTPA 1MH4A 5FKKA 3SFIA 5HSZA 4DW6A 3SDGA 2WV1A 2QKOA 3GBGA 2R5ZA 1FTZA 1UG2A 2ID3A 2K9SA 5DAJA 4CGRA 1B8IB 4J19A 2EZLA 3S1NJ 2ELKA 3GTOJ 2RASA 1TWHJ 1R9TJ 2NX4A 2RAEA 3FK7A 3I4MJ 1ZK8A 1ETYA 5F08A 2FBQA 4JNNA 1MBKA 2H8RA 3JRBA 1LE8B 2XB0X 1X2NA 4AC0A 2VPRA 1RR7A 3RZDJ 3IUVA 5F0CA 2UXOA 1GVDA 2NVXJ 3HDDA 2E2JJ 2GUHA 1P7JA 1QPIA 3HM5A 3E7QA 3PO2J 2O8KA 2NOGA 3DEWA 1T33A 5K7HA 3QKXA 4XRMA 3V78A 1OFCX 2NVTJ 3JREA 5K7ZA 2HOSA 4MIMA 4M3FA 1B72A 3JRFA 2M34A 1IG7A 4GFKA 2O7OA 3NI7A 5IYCJ 1ZR4A 2EH3A 3F1BA 4ME9A 2DMQA 5FMPA 1APLC 3FIWA 5BNGA 3TEDA 1B72B 1VF9A 1JUMA 1ZGWA 3QPSA 2DN0A 3FK6A 1Y1WJ 2ME0A 1T56A 3HOXJ 5J1UA 3EGQA 4RDUA 2EQRA 4QIWN 4GCTA 2VKEA 4D7MA 3CWRA 2MSYA 5E3NA 3GTGJ 3G56A 1BJZA 1BW5A 2Y2ZA 2W48A 5EG0A 4CYCB 3TW7A 2Y9ZA 2PBXA 2HQ5A 1HF0A 4UDSA 1MSFC 5C4YA 1AKHB 4A3KJ 4NN1A 3AQSA 3FRQA 4XICA 2LFBA 1A6IA 5EG0B 1OCTC 4L5EA 4W1UA 3TP0A 3OOUA 3EUPA 2FX0A 1SGMA 2ZCMA 9ANTA 4MFDA 2CQQA 2R5YB 1UI5A 1WI3A 1IRZA 2G7GA 2LK2A 1X58A 4BBRJ 1W0TA 3ANPA 3S17J 3HE0A 3HEFA 3Q0VA 2O9LA 4AC6A 2JK3A 3B6AA 2HYJA 2OI8A 3LSJA 3BHQA 5IP6A 3CDLA 3V6GA 3ZQCA 3BG3A 2DMTA 4QSHA 1F43A 5IOZA 3CMYA 2GBYA 1RKWA 4X1EA 3ZOBA 1F36A 1TWGJ 5C44J 1MBGA 5IYBJ 1SFOJ 4DYCA 2HKUA 3L1PA 3RD3A 3HOUJ 5EZGA 3VOKA 1VNDA 3S2DJ 1JUSA 2XPUA 5C4XJ 4AYBN 4AF5A 4UUSA 1IJWC 1JTYA 1O4XA 4MLOA 4FCYA 2E19A 3VVXA 2NS7A 2XGDA 2JA8J 1NK2P 2DA7A 1HCRA 4FISA 1YRNA 2XDNA 2CJJA 1DU6A 1ETQA 4JP0A 5M3FJ 2R93J 2JA6J 3ZQIA 3GTKJ 2HI3A 4M3GA 2HOTA 4A3IJ 1S7EA 4FE7A 4GFLA 3LSPA 1YRNB 3BR2A 3VIBA 3SJMA 1EF4A 3JRCA 2ZOYA 1WPKA 1BW6A 4JYKA 1JTXA 4Y7NJ 5GPCA 3VOXA 3HGYA 2NVQJ 1WH7A 3BR5A 3GTPJ 2D5VA 1LE8A 2R7ZJ 3BTJA 3GTQJ 2O7TA 3VUQA 2M9HA 2NVYJ 5F04A 4ACIA 5H9TA 4M3EA 4MXMA 1GV5A 5J3LA 5DS9A 4GCKA 2TCTA 1HDDC 3RZOJ 2WGBA 3NRGA 3BNIA 3HIMA 5FKOA 5M5XJ 3ON4A 4C3IJ 1VFCA 2Y9YA 4B4CA 1LFUP 5FLMJ 5FJ8J 1H8AC 3M4OJ 4D5CA 1E3OC 3KNWA 2DMNA 2HXIA 4M3BA 2ZCNA 5K58A 3NNRA 1ETKA 4NELA 4BY7J 1FIAA 2LKXA 1WH5A 5IOYA 2HYTA 1JUPA 2DA3A 3TW6A 1P7IA 2RHAA 1IC8A 5EDNA 4D5FA 3JRDA 2COBA 3LWJA 2ZOZA 2NS8A 5F0HA 2XSDC 3S2HJ 1K83J 5JLXA 5E3LA 2AHQA 5IYDJ 3H3VK 3VVZA 1ZTRA 4A3FJ 2K9QA 3DCFA 4BXXJ 4ICHA 3E7LA 2N8GA 2VKVA 3G1MA 3S1MJ 4I76A 4DZPA 3BJBA 3IV5A 5C4JJ 3A01B 3S16J 3TP3A 5M5WJ 3S1RJ 1MNMC 3HTIA 2EZIA 5EFYA 1WGXA 2HOAA 4JX5A 4A69C 4CYCA 3ZQFA 1RESA 3JRHA 1UI6A 1AKHA 2YS9A 1ETVA 1D5YA 2Y0SN 5GPAA 2OPTA 5E3MA 1MBJA 3COLA 3VVYA 5EEAA 4HKUA 1FEXA 4B1RA 2W53A 1GT0C 3RKQA 5AQCA 3BQYA 3MVPA 4IHYA 3GTLJ 2HXOA 2MG4A 3HTAA 2L7MP 3LNQA 2R5YA 3VW1A 4A3GJ 4IHVA 1GDTA 1LFBA 2G7SA 2JJ7A 4Y52J 1H88C 3WHBA 4FTHA 1HLVA 1ETXA 1ORKA 3I4NJ 3HTJA 4C3HJ 2AO9A 3JRGA 3IH2A 1RKTA 1H89C 1UMQA 3CQZJ 3LJLA 2Y31A 3HOWJ 1HDPA 2QOPA 4DZJA 5CXIA 4UUTA 4PXIA 2I10A 3BTCA 2LD5A 4IEJA 2VI6A 1ZQ3P 2R92J 2E2IJ 3C07A 4RBOA 1NK3P 2K9NA 1HOMA 3Q0WA 2KDZA 2CRGA 1VI0A 3G1OA 1JKPC 3PO3J 3BG9A 5F1JA 4D7NA 2X9DA 2YUSA 3BTIA 3K7AJ 2G3BA 2L9RA 5HBUA 3S15J 4JX6A 3S14J 2GENA 4YZEA 1XC5A 2WUIA 2G0EA 1PUFA 1MSEC 2MGQA 3KZ9A 2X6OA 5FKLA 2DA2A 3K2AA 2L7FP 3MN2A 1W0UA 4M6VA 2IAIA 4A3BJ 5CW8A 1I6HJ 2E2HJ 2IEKA 4C3JJ 4HNVA 3PPBA 5J1RA 2JN6A 1PUFB 1IDZA 2DJNA 2L0KA 3RQIA 2M8GX 2H1KA 5EZHA 2FQ4A 5FLVA 2JMWA 1U8BA 5HODA 1FJLA 4GCLA 3HOZJ 2G7LA 2CUEA 2IU5A 2M2EA 1XG1A 4W97A
chains in the Genus database with same CATH superfamily
3ZMVA 2A05A 3B73A 5HAWA 3BTLA 1WJDA 4RGUA 4I7HA 1XPXA 5A2QK 3K1NA 3T0YA 5FFZA 3CUQB 5K5QA 2GLOA 4LK0F 2W7NA 3I4PA 4BEHA 3BG6A 2HDCA 4IX7A 1QPMA 1Z3XA 4GFBA 2KT0A 1TWCJ 4HZFA 1PJRA 4D9JA 5HOOA 2ZJRF 4WK8F 4I6ZA 2DMPA 1TC3C 4ENMA 2WAFA 5BQTA 3F8MA 5K5OA 1BC7C 2NVUB 2K85A 3WGHA 1A04A 4UNOA 3MAJA 2UXUA 2V9VA 2OC6A 1BOAA 1IW7F 1IV6A 4HX8A 3I71A 4L0YB 2BGCA 2JA5J 2XGEA 3ZP5A 2DFIA 3K0LA 1ITYA 3ON2A 2GXBA 1WHUA 2XF7A 4B47A 4G6DA 1FZPB 1WJ5A 1Y0UA 1DQUA 4QPOA 2R5ZB 3P9TA 4JL3A 3A01A 1T2KA 3G73A 1G3YA 2XAJA 3OMYA 4KYWA 2XRNA 2L7KA 2VOPA 2ECCA 2NS0A 2Z16A 2O61A 1J7KA 5IP9J 1ZLKA 1WCMJ 4IQ4A 2DTZA 2QYOA 2XF5A 2ICWG 3S1QJ 3DXJF 2G7HA 4OIQF 4F7ZA 4PSWA 1O7LA 4WX9A 4A3MJ 2CYYA 2E35A 2DG8A 2FBHA 3BG5A 3RDIA 2L7ZA 5EF6A 3CMAI 5BPIA 1TWFJ 3T5XA 1HXDA 1ON1A 5D5VB 3NQOA 2D2WA 4ZDPA 3MKLA 3CMEI 2UXHA 1TWAJ 2G9WA 1RUOA 1BL0A 2QTQA 2K9LA 4PJ0C 2P7VB 4OMYA 3C2HA 1N75A 4DYQA 2QQ9A 2ZSHB 4CCOA 3VW0A 2E36A 4XONA 3RCOA 3VYRB 2FJ1A 1UHMA 2DG7A 4G12A 2FD5A 1GXPA 3VW2A 4TV7A 2DI3A 2JA7J 5GAEJ 3HOYJ 4KN4X 4XOTA 2V7FA 1X3UA 1SFXA 1IN6A 1Y6IA 2HTSA 1BM9A 1SFUA 1K4TA 5K7FA 1S7OA 1TTYA 2OA4A 3PFYA 3BCBA 3CJDA 4XLCA 2BXYA 4HF0A 4MHGA 3CJQB 4XKWA 3WU2C 1I3QJ 2DK8A 3QPTA 1RPWA 3KEOA 1MZBA 3B6CA 3IH3A 2DA1A 4YIRX 2CS3A 3QP6A 1K79A 1Z77A 1X3ZB 5LHIA 1R1TA 2QCOA 3WTUC 3JRIA 1PP7U 1O3QA 2BY0A 1G4DA 2EV5A 1FPQA 3BCGA 4G7ZF 3FISA 4BAYA 4EM2A 2YVHA 3BPVA 1X1BA 3GTMJ 3GFJA 2VUMJ 3RKXA 2DAOA 2DBBA 4ZTFA 1TT0A 2QGUA 2WADA 3CDIA 2M4KA 1HSTA 3S93A 3FDYA 4BNCA 3PASA 1H0MA 3LSRA 2ZCXA 2IGOA 1SANA 2Y75A 1VZ0A 3ZN0A 3LOCA 4B3AA 2JTVA 2GM4A 3HG9A 1JT0A 5K5RA 1J59A 2IBDA 3GTJJ 4M3DA 4D1QA 4DGWB 1FT9A 3IH4A 3DF8A 3H3UA 3MD2A 2V57A 3BR6A 1QRYA 3NWTA 4XR6A 3MKZA 2K3FA 3K9TA 2UV1A 3TMOA 2M0CA 2IPQX 3W6VA 1V4RA 4ABZA 1UHSA 4FE4A 5DDGA 2CW8A 3U1DA 2CW0F 1XX5A 5JR3A 1U9NA 2WBMA 1MJ9A 3LSHA 3OYEA 5JLWA 2KPMA 1FP1D 4BXUA 4NC6A 2KKOA 2WAQN 2VE9A 3G1LA 2Y0MA 1D0ZA 5E3OA 2K02A 3CCVI 2HKXA 2LTPA 1MH4A 3IRRA 3WG7H 3MZHA 2DFFA 4Y15A 4CCJA 3TO9A 2ID3A 4J00A 3C1DA 2K9SA 2XASA 3Q9SA 2ZKZA 3GWZA 1ZELA 2C6YA 4RMNA 5AONA 2RAEA 4GO1A 3AL0C 2NX4A 1ETYA 2HZDA 4NBQA 5CVJA 5F08A 4PDKA 1MBKA 2M4GA 2H8RA 2XB0X 3KETA 2L2OA 2VPRA 2NYXA 3TQNA 2XDVA 2R7RA 1X4PA 1W7PA 3DTEA 4NC7A 3LSTA 2E2JJ 3CCMI 3REOA 1P7JA 3M1EA 3U21A 3SEQA 3E3VA 1ODDA 4BJTA 3F6VA 4E6KG 2O8KA 5DUKA 5ED4A 1J5YA 5K1YA 2OCCH 3I9V2 3OS1A 5K7ZA 3RPUA 4M73A 4M3FA 4CDGA 4XQFA 3JRFA 2MLGA 4UHTA 5IYCJ 2GIZA 1YFHA 4ME9A 2DMQA 2HQRA 2JZYA 3T8TA 3VYSB 2P5LC 3CUOA 2V9PA 3FXMA 4PGGA 1D3YA 3K4MA 2QENA 3DKXA 4AWXB 2NAZA 3HOXJ 2EQRA 3A2KA 3F23A 3CWRA 4HX7A 5E3NA 1VQPI 2KQRA 4O3MA 3GTGJ 1G3TA 2HGCA 1J75A 5ILUA 2QSHX 2Y9ZA 3RKWA 4G7OF 3TW7A 2FRHA 2F4OB 4UDSA 5D4RA 1MSFC 1LUJB 2QZ8A 4KNYA 2QSGX 2TDXA 2PG4A 3FRQA 1X1AA 5IT3A 4Q47A 1A6IA 4A6DA 2H27A 4L9NA 4A5MA 1RNLA 4KMFA 5E20A 4ZZLA 2KDOA 1Z7LA 2NNNA 2VKDA 1W5SA 4U0WA 1P2FA 2HVQA 4LLNA 1HA8A 1YQAA 4BBRJ 4BHPA 5LRSA 1KU2A 4E7JA 3ZMTA 1U2WA 1RR8C 3S17J 1L3LA 5CPRB 4AC6A 3B6AA 2HYJA 2MFZA 3I0TA 1R1UA 4LGWA 2HYFA 3CDLA 2CUJA 2BVMA 1VQLI 3CCQI 1F43A 4UXNA 3CMYA 4V19K 1RKWA 2FF4A 3L2CA 5C44J 2Q2EB 1SFOJ 4XMYA 1WJEA 2D1HA 3RIRA 5D5WB 1ZREA 5HDNA 1S8NA 2HZTA 2GA1A 2X6XA 5TJJA 4Z6YA 3KP2A 1MIJA 1ZLJA 4EJOA 1F1ZA 3BZ6A 2NS7A 3SEZA 3LA3A 2DA7A 3DPTA 1J9IA 3KP3A 3PUFA 4Q4ZF 4RM2A 3QODA 5HS8A 1D8JA 3RTRA 4KIFA 2GXAA 2OCEA 2HI3A 1Y56A 4A3IJ 2YX7A 4LG0A 4BJ5C 4GFLA 5HLIA 3LSPA 3VIBA 3I55I 3OOPA 5LGNA 1Y39A 3JRCA 1W7PD 4AM3A 4Y7NJ 1QQIA 1QHGA 2MA3A 2XC7A 3G2BA 1IV8A 3GMEA 3M8JA 4LG0B 2EPFA 1WH7A 2PMZA 1ZAOA 3ZGKA 2VLAA 4HRIA 2Q1ZB 1Z1DA 4G6TB 3QYBA 3GUDA 5HS7A 4ACIA 2COMA 3EUHA 4GYGA 4DBQA 4Y4RA 3RPUD 3BNIA 5M5XJ 2Y9YA 4KISA 1IN4A 3IUOA 4M6YA 1YITI 5D6FA 3HRSA 3MFKA 2D1VA 4IRVA 3KIOA 2AXTC 3KNWA 2HVRA 1Y8QB 1T98A 3Q5FA 4M3BA 3M8EA 4C2UA 5K58A 3BC8A 3PFIA 4HV6A 2QQBA 1X1DA 3TKYA 4ENJA 2LKXA 1R6RA 1WH5A 3OL4A 1JUPA 2DA3A 1Z6RA 3IL2A 1P7IA 4YIFA 1MMGA 1CF7A 2CW7A 2W4SA 3CCSI 3OYJA 4DNCA 3CESA 3S2HJ 4RB1A 1FWZA 1K83J 3W6JB 2AHQA 5BMZA 3H3VK 4GRIA 2QKLB 1SVMA 2ZJQF 2VKVA 3CMMA 4N0BA 1R5ID 1YS7A 3BJBA 1I27A 2Q0OA 2OD5A 2VT2A 3WTWC 3S16J 2A3SA 3HTIA 5EFYA 2D45A 1OR7A 1YX5A 2HOAA 3GZ6A 4CYCA 3M9AA 1RESA 4CZZA 3OR1C 3ERMA 2V6CA 3BJAA 4BH9A 3QU3A 1D5YA 2XV4S 5E3MA 1EV7A 3OYNA 3LL7A 4B1RA 3H5NA 4OINF 4CUGA 2NNYA 1GT0C 4B3XA 3H35A 2LG4A 2MG4A 1HKSA 1KQ9A 2P5VA 4MEXF 4A3GJ 1GDTA 2LRDA 3GFIA 2NRAC 3WHBA 2R3SA 2ZMEA 4H0EA 4AU7A 2BYVE 3I4NJ 3CCLI 3JRGA 1RKTA 2R7FA 4O5VA 1VQ4I 1H9TA 1XDSA 1YO5C 3HZJA 4JQFA 4UUTA 4ZYHA 2VJIA 2CQKA 2HNHA 2ESHA 3BTCA 3C07A 4IEJA 2VI6A 4OIOF 2R92J 5B5EC 2ZXHA 5TISC 3PIOF 2CRGA 3H9QA 5EEGA 1VQ6I 3PO3J 2P8TA 3BG9A 1OISA 4DBRA 1N25A 4G94A 2YUSA 3K7AJ 2W82A 1TNTA 1X19A 5HBUA 4BACA 3S15J 3IP4B 4CHUA 3S14J 2WAEA 2IP2A 3BZKA 2AQFA 2WUIA 2G0EA 1MSEC 3KZ9A 1RC9A 2X6OA 1GHCA 4F52A 2DA2A 3K2AA 3QP5A 5FROA 1W0UA 2IGKA 2XAFA 2IEKA 2LY2A 3K8PC 1KQ0A 1JGSA 4EJUA 4G8XA 3HL2A 2CGPA 2B1EA 2DJNA 2L0KA 2H1KA 2H8WA 5EZHA 3WODF 2W84A 5HODA 1FJLA 3I5UA 4GCLA 1LB2A 2G7LA 4BQNA 3E6CC 2CUEA 3OYAA 2B9SA 3ZQHA 4GYIA 2FBKA 1K7AA 3CJTB 1V3FA 1U0JA 2L54A 1QGPA 1VQ9I 4MFEA 2KLOA 2LOOA 2EINH 2O5RA 4R1HA 2LVSA 3R61A 1YX3A 1FLIA 2VC1A 5IY5H 3BOQA 3O8HA 3RSNA 4V2GA 5HVQC 4OD5A 2LF7A 2EA4A 3L2UA 4NDLA 2NP3A 3OSFA 3LHQA 2K4JA 1JKRC 3O3KA 3DV8A 2P81A 3FZVA 4P1WA 1FBSA 4BY1J 3BR1A 1UCRA 3KYCB 1IAWA 3P7NA 2BXZA 2BV6A 2B63J 4P55A 4MO7A 3ZN1A 2DU9A 1AOYA 1FMWA 2LC2A 4S05A 1KQ8A 1JJ8C 3V8JA 2VONA 2EBIA 2HQNA 3WGGA 2DOFA 2Y30A 3HB9A 2DCEA 4B8XA 5LHHA 1BN5A 3QWLA 3OR2C 2R7VA 2E5ZA 3GEUA 5EYRA 3VPRA 2A6HF 3F8CA 3ZQQA 3NPIA 1SAXA 5EEHA 2CUZA 4I02A 3OYLA 4XSZF 3R4KA 4BU2A 1QA6A 3E6MA 1WVRA 4MQVA 2F5VA 4CCKA 4OWRB 2LBFB 4CCMA 1JT6A 1SD6A 1D0YA 1ULYA 2ZNYA 3X2QH 5D1RA 2YVEA 3HHHA 3HGGA 5LD2C 3Q3SA 1L0OC 3V7CA 2JQ7A 3ISPA 4IHXA 1HSJA 2KL4A 3VYUB 2Q8KA 2CH0A 1W36C 3OYMA 3KEQA 2V6EA 3PL8A 3MCZA 1QVTA 5H6RA 5D18A 5JVGF 3OSGA 3C7JA 3MMYB 2BY2A 3QBMA 3PQJA 1YYVA 5B1AH 1ACIA 3AL0B 1Z0XA 1W1WE 3D5SC 3V8LA 1Z21A 3NARA 1U5TC 3BZCA 1W4MA 1F5TA 1FMVA 1MMDA 1Q1VA 1EKEA 1MKMA 2O8XA 1ZG1A 3CZ6A 3JRAA 2YU3A 1AHDP 4RGSA 2FOWA 3OYKA 3HBLA 2ZCWA 1WSUA 5E1WA 3PNYA 3MZYA 2XAGA 3N97A 1JGGA 4LK1F 3G7RA 4IHTA 1B9NA 2PMZN 3BR3A 3Q0UA 3QAHA 2PQ8A 2PZ9A 2ZB9A 3SQNA 1U78A 3FXKA 3BQZA 1LVKA 3FBIB 4O6JA 1SFKA 2HU9A 1UZCA 4OMZA 2M30A 2M7BA 4A3EJ 3BR0A 3B81A 4I2OA 1XGMA 4EM0B 3J80Z 2LKSA 3AG4H 1POGA 1X2MA 4LJZF 3H9JA 5JHUA 3JAMK 4NHJA 3HC7A 3WTSC 3KKCA 2EV6A 3T6NA 4L62A 3I64A 4CCLA 2ACJA 1K4SA 1XGOA 1IXRC 3MZ8A 4ZZDA 3TBIA 4E4HA 2OTJI 2LF8A 3H3ZA 4Y33A 4CH7A 2ZJPF 4KN7X 5IPAA 2DTRA 4QTRA 2RREA 3A1YA 4N4NB 4HPQA 3W2WA 3WHCA 3S5RA 3ULQB 4LITA 4II2A 1XD7A 3MKYB 1VQOI 5ILSA 1FIPA 2ZFUA 4ESFA 4A93J 1YW7A 2BZTA 2K40A 2KIUA 2OJED 3FXUA 4KT5C 3W3CA 3KP7A 4A0XA 1N77A 3R6SA 3DBRB 3DU5A 3RH2A 2IJLA 4UUSB 2MH9A 1Z67A 1TW2A 2BHYA 3V42A 5CJ9A 1LFPA 2VASA 2CUFA 1R49A 1IO2A 1UAAA 5FHPA 1GUUA 4E7HA 1FYMA 4B09A 3D1NI 3QOEA 3DTKA 2WB1N 2DYSH 4PJMA 1BI0A 1J0RA 2H94A 3OL3A 4ZDLA 1XN7A 4DW6A 1N78A 2WV1A 2QKOA 3GBGA 4QLCU 2R5ZA 1FTZA 1YE9A 5B66C 3Q9VA 3OYBA 5H6QA 5DAJA 4CGRA 1D0XA 3S1NJ 2ELKA 5F6FA 3SXYA 5FGMA 3FK7A 3BLYA 2KIFA 1ZK8A 1JXSA 4XRFA 2FBQA 5TGTA 2STTA 2IW5A 4BE1A 1LE8B 3WTXC 4HDUA 1I5ZA 5F0CA 2BOLA 1GVDA 2HYGD 2KISA 1P4AA 3EQLF 3BG7A 3K6GA 1QPIA 1S9HA 1XCBA 1LKXA 2EIJH 3CLQA 1FOKA 1YIOA 1FBUA 2Z1DA 2HQAA 4PFPA 4PK4A 3JREA 4AVZA 4Y17A 2VE8A 4GFKA 2EH3A 3F1BA 2EFOA 2FNPA 3FKJA 5LLQA 5FMPA 4UVAA 3RYPA 4UVCA 5D4SA 1APLC 2QQAA 3FIWA 5BNGA 1MNDA 3HOSA 3NWSA 1ZGWA 2KJBA 1TQPA 3S3OA 2WY7Q 2QSFX 1O57A 1NHAA 3CF5F 4QIWN 4GCTA 4Y3OA 3MWMA 2MSYA 3HSFA 3G56A 1ON2A 2FU4A 5HLGA 2MD0A 4B44A 4XLEA 4LB5A 2PBXA 1MW7A 2HQ5A 4PFOA 1AKHB 4FX0A 1XSDA 4B48A 4FASD 1WKMA 3HJEA 5FFXA 3WG9A 3GVAA 1HQCA 4XICA 1USTA 3ML6A 3KX2A 4DJAA 3TP0A 3OOUA 3EUPA 3D0SA 3FMQA 3FXJA 3KP6A 4BQQA 3DKWA 4UVBA 2MC4A 2R5YB 2LY1A 3KZYA 2G7GA 2XKOA 2JPBA 4ENKA 3IWZA 2I8DA 3PUBA 3KZZA 4S04A 1WI9A 3HKZA 3F21A 1FSHA 2PFVA 4XLAA 2W57A 3ZMDA 5LGTA 3BG3A 2K4BA 1WJFA 3VOEA 3J81K 1T0FC 2GBYA 4X1EA 3ZOBA 2FSWA 2RQQA 3OYGA 3MKWB 1F36A 1TWGJ 1B59A 5IYBJ 4DYCA 2HKUA 2X4HA 3L1PA 5IT9K 3LWFA 5FLXZ 3DEUA 4KITB 1VNDA 4RB3C 3S2DJ 4WF2A 1JUSA 3OS2A 2XPUA 5C4XJ 3ONQA 3I3LA 4AIHA 2V4JC 1IJWC 1JTYA 3E5UA 5HLHA 1O4XA 4MLOA 1DP7P 4FCYA 2E19A 4JK1X 3VVXA 2JA8J 4U9LA 3ASNH 1HCRA 1REPC 2R7XA 2XDNA 1ETQA 1V5FA 4JP0A 2E34A 3ZQIA 2DPDA 4M3GA 2HOTA 4A0YA 4FE7A 4F55A 3HRMA 3CCEI 2QQ8A 1R4MB 3SJMA 2ZOYA 3LQQA 1EH6A 1WPKA 5BPDA 4JYKA 1JTXA 4BL0B 4BS9A 2GQQA 4HF2A 2DOEA 2Z3YA 3HTUA 2HTJA 1SD7A 3BR5A 4NQWB 2R7ZJ 2X6WA 5GAGJ 2O7TA 2M9HA 4RAGA 2CO5A 3KEYA 4E70A 2V9KA 5H9TA 2EB7A 1I39A 2TCTA 1YJ9I 1P92A 2DT7B 2CFXA 1WWXA 1UHWA 2R4GA 2GWRA 1LFUP 4PUSA 3ABMH 4D5CA 4WIBA 3PNVA 3L2RA 3JSOA 3HHGA 1XSVA 5EJCA 1ETKA 4U9NA 1HW5A 3WU1B 1V5GA 5IOYA 5FO5A 2QWWA 2PBIA 2VJ5A 3NRVA 1IC8A 5HNFA 2COBA 2ZOZA 1RUNA 2ADUA 2XSDC 3F8BA 3F6OA 3ZMZA 5J40A 3TGNA 1NH3A 5JLXA 1JI8A 1D5VA 4PCQA 2K9QA 3DCFA 2GA2A 2JVGA 3G1MA 2DJIA 3R0JA 3S1MJ 4LMYA 2LMDA 4DZPA 3IV5A 2ZXWH 4EJVA 4XKCA 3J7YJ 1OQYA 3BDDA 2ISZA 3GFMA 4XBFA 3S1RJ 1MNMC 2EZIA 3JTGA 4KFCA 3OIPA 2KZVA 1YLFA 2XHKA 3BY6A 4G7HF 1IUYA 1UI6A 2FJI1 4KIBA 2H6BA 5E1XA 4QWQA 1IXSB 3SHFA 1OYYA 1MBJA 1IRFA 2CSOA 5FD5A 3LMMA 4HKUA 3VFZA 2XROA 1YJNI 4RGRA 4P9UA 5AIPA 3GTLJ 2HXOA 4XKVA 4F93B 3S32A 4IHVA 2OQGA 5H20A 2JJ7A 2MC3A 4ZTJA 1S3JA 2OZ6A 4FT8A 2XF6A 5FRMA 1FC3A 3NS4A 1HLVA 2UXXA 2W85A 1YJWI 2VBZA 4L0ZB 3HTJA 3CJNA 5CVRA 3GCMA 1H89C 2M87A 2MYSA 2R7DA 3BPXA 2JUCA 3CQZJ 5CQGA 2VIXA 4CXFA 2QOPA 3ZXSA 2A61A 3R0AA 3W2VA 1XCVA 4GGGA 4DZJA 3FHZA 5CYVA 3H1CA 1QO0D 2VC0A 4BQOA 1ZQ3P 2Q2EA 4RBOA 3PQKA 1R7JA 1VQ7I 3Q0WA 2E7WA 3CUQC 3V4GA 3G1OA 4DIQA 3OV8A 5F1JA 4D7NA 2JRTA 1XGSA 2LREA 1SFEA 4IL6C 3BTIA 4IXAA 3KPHA 1FY7A 2L9RA 3HTSB 2W1OA 4JX6A 1BR1A 1J09A 4IPAA 2GENA 2IRFG 1XC5A 2UZKA 1PUFA 4HDVA 2MGQA 4N9IA 3FBNB 4A3BJ 2L7FP 4BGDA 5CW8A 1I6HJ 4MTEA 2E2HJ 4C3JJ 3HXLA 1U5TA 3QYFA 2Z99A 1PUFB 4K2EA 1KYZA 2XGXA 5FLVA 1U8BA 1BR2A 4HNUA 1VTNC 1U5TB 3KLOA 4KICA 2VBXA 5HDKA 2IU5A 4B43A 1BI1A 2M2EA 3CP2A 3IRQA 1XG1A 3JCUC 1TL8A 4IOCF 2OUMA 4RA2A 4M6XA 3I59B 3CC7I 1JKQC 4HX4A 3G3ZA 4KUMA 3UKGA 5HLTA 2IXSA 5GP9A 4V2FA 2BW3A 5M3MJ 4YEJA 4MK6A 1W5TA 3K4LA 3COAC 4DYRA 2OTLI 1MH3A 4RAZA 4JBAA 5M5YJ 2R0QC 2VBWA 2ZNZA 1P4WA 2BW3B 2M7AA 2XKPA 3DBHB 4XK4A 3FWEA 2UXIA 2PFBA 4J01A 1KU7A 1ZN2A 2H1LA 2ME6A 4NUBA 2CV2A 4U7BA 5DCMA 3VB2A 5LHGA 1AU7A 2A69F 2VXZA 4A3LJ 5ICFA 1Z7UA 2DA4A 2D6YA 2UXPA 3F8NA 2Q24A 3A03A 4IRHA 3E0JB 4C2MJ 4HNTA 4PJLA 5DCMB 1HKQA 1MGTA 1TZLA 2REKA 1A6QA 2LY9A 2STWA 5D19A 1HBXG 3ZR8X 2V1UA 4UV9A 1WFXA 2FOKA 2X85A 4S0HB 4JKZA 2YU9J 4OOIA 4PJNA 1ZKGA 2KRFA 3CDHA 3FXRA 2CU7A 3ASOH 1ZHFA 2IGNA 2KZGA 1IUFA 1P4XA 2VQGA 4XSXF 4XIDA 3HOTA 3HKZN 1MDMB 2O6GE 2IS6A 3O60A 1SD4A 4C2MA 4HF1A 5ICGA 4EJWA 2LNBA 1Z9CA 5E79C 4EGZA 2RDPA 3F72A 2DQRA 2VJJA 3DQVC 2L4MA 2PMHA 5CLSA 2QBYB 1B1BA 1ZG5A 2QF7A 1DGRM 1PUEE 3ROUA 5FKMA 4G9YA 1LEBA 1J2XA 1BA5A 1X1CA 2DA6A 1ERDA 2DT5A 1EH7A 1ETOA 5GADJ 4XRSG 5J1YA 3K70D 4C2TA 3D5LA 3DPUA 1U9OA 4DQ2A 1NTCA 2ISYA 3KKDA 2PMUA 5J6XA 3AAFA 3B02A 2ZY9A 1XMKA 2KP6A 2L9VA 1CQTA 1GV2A 4II3A 2XB5A 4I0AA 3TDUC 3BRUA 2XGCA 1D1CA 4BKXA 2PEXA 2Z2SB 1CGPA 1OCRH 1LNWA 1VQNI 2QWTA 1DUXC 1ZGJA 3K4KA 5A2QZ 3IC7A 5F27A 1YW8A 2X0LA 3RI4A 3VP5A 1IGNA 2XRLA 5LBQA 4YFXF 1DU0A 2EZHA 5ERIA 1GVJA 4ZYGA 4MEYF 3M3YJ 2XPVA 3TL4X 2E7XA 3L00A 3L7WA 2BVLA 2CWEA 5KK1A 3WGIA 1RIOH 2O03A 1Y1VJ 4RAFA 3OIOA 3K4JA 1T95A 2MD5A 2Y0SA 2OF7A 3E5XA 3VODA 4CSWA 1G3SA 1PYVA 3F8FA 4OAYA 2EFPA 4HQMA 2ELHA 4NB5A 1PP8F 2QUFA 4LIUA 4A2UA 1ZR2A 2HDDA 2ZJ2A 3AQTA 3IAM2 1UB9A 1ENHA 4WXDA 1BC8C 5GTHC 5LEKA 1WJCA 3JTHA 1S72I 3FF5A 3F22A 4CGZA 1IN8A 1A5JA 1MD0A 3LA2A 1R23A 3PIPF 4A3DJ 2ZBKA 3S8PA 2X1EA 4DOZA 5CVVA 3ABKH 3DTIA 3OYHA 4A3CJ 1OCCH 1G2HA 1JHHA 1E2XA 1B9MA 2NP5A 2DPUA 4EJTA 1D1BA 4WXCA 1VQMI 3O2PE 3E5QA 3DPLC 1V5EA 3EUAA 3TDZC 1Z91A 2QVOA 4J19A 2RASA 3K1PA 3GTOJ 2E1CA 1MMSA 3SFZA 4F92B 3I4MJ 1ZRDA 1UG0A 2IA0A 4HG2A 5L3BA 4JOMA 1FOYA 5E8GA 3JRBA 4AC0A 1X2NA 1RR7A 3RZDJ 3IUVA 2UXOA 2LBFA 4ON0A 3ELKA 2F5FA 2A07F 2XSJC 3K10A 4BUPA 3HM5A 3CF2A 1IZ1A 2PLYA 2GOMA 2UUZA 1TQMA 4XM3A 3GX4X 3PO2J 2FBIA 2YSRA 3P9CA 2HR3A 4IRGA 2XAUA 5E1ZB 2NOGA 1T33A 4HW0A 3QKXA 4XRMA 3G71I 3GLLA 2DFEA 1OFCX 3L2VA 1P9QC 5D8KB 3SDBA 4IHSA 2NXNB 2M34A 3A0BC 1TLHB 3NI7A 1FYKA 3EETA 1X1PA 4OIPF 1LJ9A 5DYMA 1HW2A 1Z05A 4IRIA 2Z5UA 4HV5A 4KIGA 4LB6B 3TOAA 1O7FA 4KMUX 3TEDA 3N4MA 1A35A 1VF9A 5B3SH 1JUMA 3FK6A 4NNJA 1Y1WJ 4H4KC 2FQ3A 1T56A 3EGQA 1G8XA 2WAQA 3DFGA 4BE2A 3AG2H 3AG1H 3ZQ7A 1X4OA 2EWNA 3K2ZA 3J81Z 2KFDA 3KCCA 3KLNA 4ZJZA 4XOPA 2Y2ZA 2W48A 2R7WA 1KONA 1HF0A 3C18A 3HUGA 3I54A 2IS1A 4A3KJ 2KIMA 3OYFA 2RGVA 3H36A 4NN1A 3ERED 3AQSA 4IZZA 1TBXA 1MJBA 3I58A 2LFBA 4L5EA 3FXQA 3HUGB 2GZWA 3NEUA 1SGMA 4N9HA 2ZCMA 5JHFA 4UUVA 3H9GA 3HPGA 1KA8A 1WI3A 2RV8A 1OMIA 2GXGA 4P96A 4IOAF 1UI5A 1FBQA 3KP4A 1U8RA 2LSOA 2F2EA 1W0TA 3ANPA 1K6OA 3HEFA 2VBYA 5E8IA 4L18B 2A5YB 1XB4A 3LSJA 3BHQA 3LAJA 3V6GA 3ZQCA 2DMTA 2P4WA 3GW2A 4QSHA 1WQ2A 5F64A 3LSMA 1LEAA 4I99C 5J8FA 2E1NA 4P9FA 3HOUJ 3VOKA 5D5UB 4IJAA 3HIFA 1LDJA 4EV0A 3EUHC 3O6BB 2DXIA 3WTZA 4UUSA 2KIQA 3OYCA 5DM7F 2BY3A 3U9GA 4L5JA 3PJRA 5JI6A 4CICA 1NK2P 4PZJA 3RQ4A 3V7SA 1YRNA 1DDNA 2CJJA 4ZYDA 1S6LA 2ELJA 5M3FJ 2R93J 2JA6J 1VQ5I 5J47A 3CJRB 1YRNB 3BR2A 1EF4A 3KZIC 3F3XA 1BW6A 5GPCA 2W24A 2PJRA 2M45A 2NVQJ 2XAHA 2R7QA 3GTPJ 2D5VA 1LE8A 5FD6A 1RRJA 3BTJA 2E71A 2IA2A 3VUQA 5F04A 4MXMA 1GV5A 5J3LA 5DS9A 1I1SA 1HDDC 3RZOJ 2PJRB 4XLNF 3NRGA 1OCOH 5FKOA 4OIRF 5CVUA 1OR7C 4C3IJ 3ON4A 5FLMJ 1USSA 5FJ8J 1H8AC 4BEHB 3TO7A 1E3OC 4UB8C 3AKZA 2DMNA 2HXIA 2FMYA 2L01A 1MMAA 4BY7J 2K86A 1FIAA 2VL8A 2OQRA 3CO6C 2ZSIB 2HYTA 5DCFA 2DDBA 4UV8A 5EDNA 4D5FA 2J5OA 3JRDA 4C30A 2NS8A 2JPCA 5KCMA 1ZG3A 2LKPA 2KMUA 5F0HA 4RAYA 3V7RA 3W2AA 4I0BA 4KA4A 3K4CA 3GXOA 1ZTRA 2ZMEC 4U7DA 3FM3A 4ENNA 4ICHA 3E7LA 3M1CA 3ZRGA 4U88A 4XKBA 2R7TA 1STZA 2K7LA 3OWTA 4AVPA 3SZGA 5C4JJ 4DVYP 1H9GA 3A01B 2PN6A 3E6DA 4FX4A 1RZ4A 3TP3A 5M5WJ 4BJ6C 3GFLA 4JX5A 4A69C 4LFUA 4MQ9F 2RKHA 2JT1A 2ZFWA 3GO5A 1AKHA 2YS9A 1ETVA 1YHQI 3CC4I 2Y0SN 1SEUA 2HEOA 5GPAA 2MLKA 2EK5A 4CCNA 2OPTA 5JFRA 2KRHA 3J7AO 1W5CC 3VVYA 2Y48A 5EEAA 3PSIA 2P6TA 2ZXJA 2W53A 2MBFA 3VWBA 3BQYA 3MVPA 2VODA 2DOAA 2Z33A 3EYYA 2R5YA 1LFBA 1TT5B 1FYLA 4Y52J 1XTAA 2AQEA 3PSFA 1UJ8A 1NG6A 4HQEA 4FTHA 3ZCOA 4AIKA 1ORKA 3SYTA 5CQEA 4C3HJ 1B4AA 2OU2A 1G59A 2A2FX 2IS4A 3QYEA 1UMQA 2NOJB 1XGNA 5DD8A 3WE2A 1HDPA 5CXIA 3A4CA 5GTIC 4PXIA 3P5JA 2LYCA 2E2IJ 1QHHD 3I56I 3R60A 2MH2A 2K9NA 3H0DA 2KDZA 1JKPC 1IN7A 3OY9A 5KAFC 2QEXI 4ASNA 2F48A 1IRGA 4ZC3A 3VSLA 4BHCA 3J7ZI 4HA8A 2VQHA 3LFKA 2EJRA 3HRUA 4HYEA 1DPRA 3U2RA 2OAZA 1OPCA 2FMLA 2IAIA 3EYIA 1QZZA 4ZYEA 5HNHA 1V54H 3ESWB 4RB0A 1D1AA 5L3EA 5J1RA 2JN6A 2YR2A 1SC7A 3HYIA 4IVNA 1JE8A 5H2FC 2DQLA 2HPIA 5HDGA 4HBLA 5DD4A 1E3HA 2M8GX 3QRFF 1ZRCA 2JMWA 1YG2A 3H92A 3WTVC 3HOZJ 4NQWA 3M8FA 2AS5F 1XDUA 3KYDB 4RGXA 4ESJA 3ABLH 2CV0A 4CA0A 1LPQA 3HSEA 2E1MC 2CQXA 1JJ6C 3QOPA 2EILH 2QA4I 1YS6A 1K6YA 3DPJA 3E6BA 4OU0A 3GZIA 3LSGA 5C3EJ 5L3DA 4F91B 2LLKA 3FKIJ 3ZQLA 5CXGA 2CV1A 3FHNA 2B7EA 1Z3YA 1M1EB 4IHWA 2X48A 3QPLA 3K69A 2V1DA 3J80K 1K78A 2Y69H 1SMYF 4L9JA 3BJ6A 5DUIA 2V1NA 5B1BH 5FB2A 1OKRA 1OCPA 2RC4A 1IDYA 4LG3A 4RS8A 4YG2F 3C2GA 3O8GA 1BBYA 1K78B 2YVXA 2CG4A 4BBSJ 2RNJA 3OIQA 1JKOC 3J7AY 1VQKI 3CRJA 2ETHA 4EM1A 3ECHA 1XS9A 4RLFA 3S2WA 4WWCA 1O3TA 2F07A 4EQQA 4AYBA 3PM1A 2G7UA 3IWFA 2AXLA 4AUXA 1IRXA 4PGHA 1RI7A 3QPHA 3EUKL 4BDZA 3U1KA 1EJ9A 2LP0A 2CQ7A 2F5DA 3GYHX 5BOXA 3OYIA 2GAUA 4IF4A 3ABTA 2R7UA 1EH8A 2JVHA 1LVAA 1MBFA 2WA0A 2KJCA 1RETA 2EZKA 2X1DA 1FNNA 1P6RA 1QNTA 1W7PB 4XRSA 2R7SA 3MQ0A 2A5WA 1ZARA 2F5EA 4CZCA 2VQLA 5D5XB 5DV5A 4LOCA 1G6NA 1C0WA 1IN5A 2M5WA 1R4NB 2V26A 5JVTA 5ILVA 1DP3A 3SZTA 5KHDA 1R1VA 4ZDOA 4M9ZA 2FA5A 4Z2YA 2L3DA 3JSJA 1KU9A 2VJ4A 3DLAA 5DTDA 2IVMA 3F0CA 2EFQA 5FGLA 4Q48A 5KAIC 4KWAA 1T6SA 2BEOA 2TRTA 2OV7A 2QIBA 1I50J 5ICCA 4IQJA 2E60A 2L4AA 2RQPA 2WWYA 3GZ5A 2E1OA 2HPMA 3MNLA 5F0FA 2PI0A 2MW8A 3GLXA 2W25A 3LQRA 3LSIA 4U0VA 3T1BA 1Y8RB 4D0PA 4PSXA 1WZ2A 3CD6I 2UWMA 3NAUA 3CCJI 3ZMSA 3I53A 3JR9A 3DWLE 5DM6F 1A36A 3EPZA 3KE2A 3BT9A 4C9YA 3IKTA 2H6CA 1FP2A 1IF1A 2XPWA 1WJAA 3OYDA 1YW9A 4A3JJ 1ZH5A 2FEZA 1I1GA 4RLQA 4X6AJ 3UR3C 4BYYA 5EGOA 4F3QA 3DKYA 3EDPA 2DMUA 1QBJA 2K27A 4M71A 4EEFG 3ZQGA 1DGWY 2O3FA 2VOOA 3ANGA 2ID6A 4JX4A 2GFNA 4ESBA 1PDNC 3G6EI 1YTYA 3M7GA 2DT6A 3QQAA 3TOBA 5EGOB 3NXCA 1QVUA 1KU3A 1FTTA 2ZXIA 2JSPA 1BIBA 4XLHA 1E17A 2F4MB 3CCYA 2IS2A 4KT6A 2CMPA 1ETWA 2K9MA 3HTHA 2ECBA 2JSCA 3HOVJ 1MBHA 2DA5A 2XVCA 3C2BA 4GCVA 3VYTB 3I59A 3ECOA 4HLYA 1HKTA 1SVLA 3K4BA 1MBEA 5CVIA 3S3MA 5CKTA 4XLPF 3N05A 3WTTC 1DPUA 3KP5A 2LR8A 1QZEA 3LFUA 3H5RA 5FKNA 1FOXA 3CCRI 5J4YA 3H0GJ 4I09A 3DU6A 1K61A 4X0GA 4ITVA 2JWTA 5D8LB 4MTDA 2OERA 1XMXA 2YPRA 2HWVA 3SZPA 3D5RC 3A02A 1T39A 5IP7J 4M74A 1B8IA 5L3CA 1OJLA 2VT3A 2DODA 4HSTA 5FKKA 3SFIA 1Z6TA 5HSZA 1R00A 3SDGA 4HEA2 3BCAA 5ICEA 3ZMUA 1Y0NA 1UG2A 5D6EA 3BJOA 1B8IB 3WU0A 5FLXK 2DFHA 2EZLA 2EIMH 3ABUA 5HS9A 1TWHJ 1R9TJ 2WTEA 3V8KA 4YRVA 2M0MA 3KFWX 2BBYA 3FMRA 2DDAA 4JNNA 4XL9A 4A6EA 4E7SA 1MDMA 5KNLA 1FSEA 4HOBA 2NVXJ 3HDDA 2GUHA 2WC2A 3P9KA 3DLLF 2WY8Q 2X6YA 3E7QA 2HVSA 1SMTA 5J4VA 3LA7A 4LIVA 2M8EA 1FX7A 3L9FA 5LGUA 4N4OB 5K7HA 3DEWA 1S7AA 3V78A 2EIKH 2QBYA 1BI3A 5F1RA 2NVTJ 2V79A 2HOSA 2JUGA 4MIMA 1B72A 3IAS2 1ZRFA 5E17F 1IG7A 2O7OA 2X1CA 1BJAA 1ZR4A 4OD4A 3W6KB 3S3NA 4EATA 1CF7B 1OYIA 2IGMA 2M3AA 4FETA 4E7KA 1YIJI 1B72B 1BIAA 2L02A 2F4IA 3QPSA 6PAXA 2DN0A 3H5AA 2ME0A 1U3EM 2OBPA 4UY8I 2VPLA 5J1UA 4FHTA 5LRRA 4RDUA 2VKEA 4D7MA 3JAMZ 3A0HC 2WB1A 1BJZA 1W36D 1F4KA 4XLFA 1BW5A 2XIGA 4M9SA 2DK5A 5EG0A 2JA2A 4CYCB 2HDWA 2RN7A 3CC2I 1EA3A 5C4YA 2H09A 3C3WA 4NC8A 1I3AA 4Y13A 4YELA 4U87A 3FM5A 5E18F 3CO7C 5EG0B 1OCTC 4XORA 4W1UA 4ZYAA 5LFAA 4MNUA 1O3SA 3AFHA 4MGRA 1LQ1A 2FX0A 2O0YA 2FE3A 4HLXA 9ANTA 4MFDA 2CQQA 1AA7A 2IT0A 2VQCA 1IRZA 2LK2A 1X58A 2BY1A 1XSXA 4M72A 4E7LA 2F5CA 3HE0A 2ZMEB 3VSKA 3JW4A 3Q0VA 2O9LA 2JK3A 2OI8A 5IP6A 1R5GA 2HOEA 2L9SA 2P7CB 1Q1HA 4BE0A 2HFHA 2E5NA 5IOZA 1GXQA 1HC8A 2M1BA 4LD5A 1KZHA 1TP4A 3HPHA 1MBGA 4Q5SF 2L9NA 2B0LA 2KHMA 2ZC2A 2VB6A 4YFKF 4YFNF 3RD3A 1BI2A 5EZGA 3ZPLA 1E3PA 1F9NA 2R7OA 4ZH4F 4AYBN 1OLTA 3VDXA 3K1MA 3RYRA 4AF5A 2B3WA 2J5PA 4EVIA 2BE5F 3WE3A 3GF2A 1E0EA 2XGDA 1O3RA 2YX4A 2EFNA 4EMSA 4P5OA 4FISA 4BDYA 3TO6A 1DU6A 4BHBA 2QM3A 3DP7A 3GTKJ 3BWGA 1SD5A 1U6GA 2P0WA 2L5QA 1S7EA 1UFMA 4L9TA 5L3FA 4XNFA 2WV0A 1FOWA 1MNEA 2BHZA 4RB2C 4BXFA 1T0FA 4ANJA 3VOXA 3JSPA 3RKYA 1T8IA 1UELB 2I5UA 1WRJA 3DBLB 3HGYA 4U0YA 2LH9A 4AIJA 1SVOA 3LSKA 4PJJA 3GTQJ 4LLGF 2NVYJ 4M3EA 4GCKA 2WGBA 4UB6C 3HIMA 1X3WB 2LDUA 5LEJA 4YIIA 1VFCA 2P5KA 3CTAA 1S29A 4B4CA 2VKHA 3M4OJ 1A31A 1GLNA 4FQGA 4IKFA 4A5NA 3IHUA 3L2QA 3RJPA 1I6XA 2ZCNA 2EV0A 1MJAA 1KYWA 4LLLA 3NNRA 1XMAA 4NELA 3IKVA 1TNSA 1ZYRF 2ESNA 4HAMA 1WJBA 2OZUA 4M9XA 3TW6A 1QU3A 2RHAA 1HW1A 1JHFA 2W00A 1R22A 1OYWA 2EA2A 2X51A 3LWJA 3E97A 1LDDA 1ONVA 1T08B 2HKOA 3AG3H 4GXOA 5E3LA 1YOVB 4QPQA 3L09A 5IYDJ 1BR4A 1AWCA 3VVZA 4HSRA 4A3FJ 4L9VA 4BXXJ 4I01A 2HS5A 1R5HA 2N8GA 2FNAA 2VXDA 2GIVA 3FMSA 4WCGA 4I76A 1T38A 3OS0A 3SWHA 2E1MB 4AIDA 4OAZA 2XAQA 1WGXA 1YI2I 3VTIA 3ZQFA 4A0ZA 4XN0A 3JRHA 3WTYC 2A6EF 4A12A 3HRTA 3MEXA 1TQIA 3KYLA 3P9IA 3GZNB 2RVCA 1PVEA 2DYRH 4IO9F 3COLA 2DO7A 1G3WA 2JRMA 2UXNA 2V1XA 2GOXB 1FEXA 2DLLA 3UNGC 3VEPA 2VN2A 3HSRA 3T8RA 3RKQA 4BQAA 5AQCA 5GAHJ 1R71A 1KGSA 3K70C 4IHYA 5IT9Z 3HTAA 4WXHA 5DEQA 3M07A 2DW4A 2L7MP 4XN3A 3LNQA 3L2WA 4KDPA 3VW1A 2G7SA 3E1SA 4EGYA 1SAUA 2K5CA 2K3PA 2RNGA 3CP8A 1ZGAA 4RM3A 1BOBA 1H88C 2P6SA 4GDFA 3FXOA 1ETXA 3K4NA 4CYDA 5L3GA 3G4SI 3GEZA 5FRNA 2AO9A 3CCUI 1S5LC 1OCZH 3IH2A 3LJLA 2Y31A 2QKMB 3HOWJ 2PX9A 2I10A 3BROA 2LD5A 2MABA 1IXCA 2A6TA 1TW3A 1NK3P 1HOMA 1VI0A 5J8CA 4G6QA 4R8HA 2XUBA 2PJPA 2QLZA 5TRDA 4E7ZA 3LAPA 2F6CA 1MMNA 2X9DA 2G3BA 2A68F 3FXLA 2IA1A 1LDKB 4KJZA 1V55H 4YZEA 4L5IA 4E7IA 2Z9OA 2CQNA 3CLOA 5FKLA 2ZO4A 3FX3A 3MN2A 1VQ8I 4M6VA 1R36A 1B6AA 4HNVA 2CFOA 2FUG2 3RPQA 3PPBA 1NG7A 3DEEA 3PNTA 3QU6A 5KVRA 1QZYA 5AIQA 2EFWA 4ETSA 1IDZA 1R58A 4CO8A 4R79A 3BP8A 2FQ4A 3F9KA 5BS6A 2KRCA 2FXAA 4AD9A 4I98B 3CUQA 1D8KA 3RQIA 4W97A
chains in the Genus database with same CATH topology
5HAWA 3BTLA 2CQXA 4MFEA 3ZQHA 1JJ6C 3DPJA 1JKQC 2LVSA 2GLOA 3UKGA 5GP9A 3LSGA 5C3EJ 3GZIA 5CXGA 2LLKA 3FKIJ 3ZQLA 4V2FA 3O8HA 4GFBA 4IHWA 2KT0A 1TWCJ 5M3MJ 4MK6A 2X48A 3QPLA 4I6ZA 2DMPA 4V2GA 4DYRA 1TC3C 1MH3A 4NDLA 5M5YJ 2NP3A 3OSFA 3LHQA 2R0QC 1JKRC 2UXUA 2P81A 4BY1J 3BR1A 4XK4A 1OCPA 1IDYA 2UXIA 3O8GA 1IV6A 2B63J 4MO7A 2ME6A 2JA5J 2XGEA 1AU7A 4BBSJ 1JKOC 3ON2A 1ITYA 3CRJA 4A3LJ 2DA4A 1XS9A 2D6YA 1JJ8C 2F07A 2UXPA 2EBIA 2Q24A 2R5ZB 4JL3A 3P9TA 2Y30A 3A03A 3HB9A 3PM1A 3A01A 4C2MJ 4AUXA 3GEUA 2REKA 2LY9A 5D19A 5EYRA 2ECCA 3VPRA 2LP0A 5IP9J 4JKZA 4S0HB 1WCMJ 2DTZA 2YU9J 1ZKGA 3NPIA 3S1QJ 2CU7A 1MBFA 1IUFA 4XIDA 4A3MJ 1RETA 2EZKA 3HKZN 3O60A 2DG8A 4XRSA 3BG5A 2L7ZA 5EF6A 1JT6A 1TWFJ 4LOCA 5D1RA 2YVEA 3MKLA 3HGGA 3Q3SA 2UXHA 1TWAJ 2QTQA 1BL0A 4IHXA 4DYQA 2QF7A 3VW0A 3JSJA 2FJ1A 5FKMA 5DTDA 2DG7A 4G12A 3F0CA 1QVTA 5D18A 5FGLA 4KWAA 2FD5A 3OSGA 2DA6A 1BA5A 3VW2A 2TRTA 3QBMA 2JA7J 1ETOA 2QIBA 3HOYJ 1I50J 4XRSG 5J1YA 1Z0XA 3NARA 5K7FA 1U9OA 3CJDA 2E1OA 3KKDA 1NTCA 3MNLA 1Q1VA 5F0FA 2MW8A 1I3QJ 3JRAA 1CQTA 1RPWA 1GV2A 3NAUA 3B6CA 1AHDP 3IH3A 3JR9A 2DA1A 2XB5A 3HBLA 3BRUA 3BT9A 1Z77A 2XGCA 4BKXA 1JGGA 2XPWA 2QCOA 3JRIA 4A3JJ 2QWTA 3G7RA 4X6AJ 2PMZN 3BR3A 3Q0UA 2PZ9A 3BCGA 5F27A 2ZB9A 3FISA 5EGOA 2YVHA 2DMUA 3VP5A 1IGNA 2XRLA 1U78A 4EEFG 3ZQGA 3BQZA 3GTMJ 2VUMJ 1DU0A 3ANGA 2ID6A 4JX4A 2EZHA 2GFNA 3B81A 4A3EJ 3M3YJ 2XPVA 3BR0A 3QQAA 5EGOB 3NXCA 1QVUA 3PASA 1Y1VJ 1POGA 1X2MA 1FTTA 3KKCA 3LSRA 2ZCXA 3OIOA 4L62A 3T6NA 3CCYA 1SANA 2OF7A 1ETWA 3HTHA 2ECBA 3LOCA 4B3AA 2GM4A 1JT0A 3HOVJ 1MBHA 2DA5A 3C2BA 1ZR2A 2HDDA 2IBDA 3GTJJ 4M3DA 3AQTA 1ENHA 1MBEA 3IH4A 5IPAA 4QTRA 2V57A 3BR6A 1QRYA 3WHCA 3S5RA 2LR8A 2M0CA 5FKNA 1FIPA 4ABZA 3W6VA 1A5JA 1UHSA 4FE4A 4A93J 3H0GJ 1U9NA 4A3DJ 2K40A 1K61A 3RH2A 5JLWA 4UUSB 2JWTA 2WAQN 2CUFA 4A3CJ 1G2HA 2OERA 3G1LA 5FHPA 1GUUA 5E3OA 2NP5A 3A02A 5IP7J 3D1NI 1B8IA 2WB1N 1OJLA 2LTPA 1MH4A 5FKKA 3SFIA 5HSZA 4DW6A 3SDGA 2WV1A 2QKOA 3GBGA 2R5ZA 1FTZA 1UG2A 2ID3A 2K9SA 5DAJA 4CGRA 1B8IB 4J19A 2EZLA 3S1NJ 2ELKA 3GTOJ 2RASA 1TWHJ 1R9TJ 2NX4A 2RAEA 3FK7A 3I4MJ 1ZK8A 1ETYA 5F08A 2FBQA 4JNNA 1MBKA 2H8RA 3JRBA 1LE8B 2XB0X 1X2NA 4AC0A 2VPRA 1RR7A 3RZDJ 3IUVA 5F0CA 2UXOA 1GVDA 2NVXJ 3HDDA 2E2JJ 2GUHA 1P7JA 1QPIA 3HM5A 3E7QA 3PO2J 2O8KA 2NOGA 3DEWA 1T33A 5K7HA 3QKXA 4XRMA 3V78A 1OFCX 2NVTJ 3JREA 5K7ZA 2HOSA 4MIMA 4M3FA 1B72A 3JRFA 2M34A 1IG7A 4GFKA 2O7OA 3NI7A 5IYCJ 1ZR4A 2EH3A 3F1BA 4ME9A 2DMQA 5FMPA 1APLC 3FIWA 5BNGA 3TEDA 1B72B 1VF9A 1JUMA 1ZGWA 3QPSA 2DN0A 3FK6A 1Y1WJ 2ME0A 1T56A 3HOXJ 5J1UA 3EGQA 4RDUA 2EQRA 4QIWN 4GCTA 2VKEA 4D7MA 3CWRA 2MSYA 5E3NA 3GTGJ 3G56A 1BJZA 1BW5A 2Y2ZA 2W48A 5EG0A 4CYCB 3TW7A 2Y9ZA 2PBXA 2HQ5A 1HF0A 4UDSA 1MSFC 5C4YA 1AKHB 4A3KJ 4NN1A 3AQSA 3FRQA 4XICA 2LFBA 1A6IA 5EG0B 1OCTC 4L5EA 4W1UA 3TP0A 3OOUA 3EUPA 2FX0A 1SGMA 2ZCMA 9ANTA 4MFDA 2CQQA 2R5YB 1UI5A 1WI3A 1IRZA 2G7GA 2LK2A 1X58A 4BBRJ 1W0TA 3ANPA 3S17J 3HE0A 3HEFA 3Q0VA 2O9LA 4AC6A 2JK3A 3B6AA 2HYJA 2OI8A 3LSJA 3BHQA 5IP6A 3CDLA 3V6GA 3ZQCA 3BG3A 2DMTA 4QSHA 1F43A 5IOZA 3CMYA 2GBYA 1RKWA 4X1EA 3ZOBA 1F36A 1TWGJ 5C44J 1MBGA 5IYBJ 1SFOJ 4DYCA 2HKUA 3L1PA 3RD3A 3HOUJ 5EZGA 3VOKA 1VNDA 3S2DJ 1JUSA 2XPUA 5C4XJ 4AYBN 4AF5A 4UUSA 1IJWC 1JTYA 1O4XA 4MLOA 4FCYA 2E19A 3VVXA 2NS7A 2XGDA 2JA8J 1NK2P 2DA7A 1HCRA 4FISA 1YRNA 2XDNA 2CJJA 1DU6A 1ETQA 4JP0A 5M3FJ 2R93J 2JA6J 3ZQIA 3GTKJ 2HI3A 4M3GA 2HOTA 4A3IJ 1S7EA 4FE7A 4GFLA 3LSPA 1YRNB 3BR2A 3VIBA 3SJMA 1EF4A 3JRCA 2ZOYA 1WPKA 1BW6A 4JYKA 1JTXA 4Y7NJ 5GPCA 3VOXA 3HGYA 2NVQJ 1WH7A 3BR5A 3GTPJ 2D5VA 1LE8A 2R7ZJ 3BTJA 3GTQJ 2O7TA 3VUQA 2M9HA 2NVYJ 5F04A 4ACIA 5H9TA 4M3EA 4MXMA 1GV5A 5J3LA 5DS9A 4GCKA 2TCTA 1HDDC 3RZOJ 2WGBA 3NRGA 3BNIA 3HIMA 5FKOA 5M5XJ 3ON4A 4C3IJ 1VFCA 2Y9YA 4B4CA 1LFUP 5FLMJ 5FJ8J 1H8AC 3M4OJ 4D5CA 1E3OC 3KNWA 2DMNA 2HXIA 4M3BA 2ZCNA 5K58A 3NNRA 1ETKA 4NELA 4BY7J 1FIAA 2LKXA 1WH5A 5IOYA 2HYTA 1JUPA 2DA3A 3TW6A 1P7IA 2RHAA 1IC8A 5EDNA 4D5FA 3JRDA 2COBA 3LWJA 2ZOZA 2NS8A 5F0HA 2XSDC 3S2HJ 1K83J 5JLXA 5E3LA 2AHQA 5IYDJ 3H3VK 3VVZA 1ZTRA 4A3FJ 2K9QA 3DCFA 4BXXJ 4ICHA 3E7LA 2N8GA 2VKVA 3G1MA 3S1MJ 4I76A 4DZPA 3BJBA 3IV5A 5C4JJ 3A01B 3S16J 3TP3A 5M5WJ 3S1RJ 1MNMC 3HTIA 2EZIA 5EFYA 1WGXA 2HOAA 4JX5A 4A69C 4CYCA 3ZQFA 1RESA 3JRHA 1UI6A 1AKHA 2YS9A 1ETVA 1D5YA 2Y0SN 5GPAA 2OPTA 5E3MA 1MBJA 3COLA 3VVYA 5EEAA 4HKUA 1FEXA 4B1RA 2W53A 1GT0C 3RKQA 5AQCA 3BQYA 3MVPA 4IHYA 3GTLJ 2HXOA 2MG4A 3HTAA 2L7MP 3LNQA 2R5YA 3VW1A 4A3GJ 4IHVA 1GDTA 1LFBA 2G7SA 2JJ7A 4Y52J 1H88C 3WHBA 4FTHA 1HLVA 1ETXA 1ORKA 3I4NJ 3HTJA 4C3HJ 2AO9A 3JRGA 3IH2A 1RKTA 1H89C 1UMQA 3CQZJ 3LJLA 2Y31A 3HOWJ 1HDPA 2QOPA 4DZJA 5CXIA 4UUTA 4PXIA 2I10A 3BTCA 2LD5A 4IEJA 2VI6A 1ZQ3P 2R92J 2E2IJ 3C07A 4RBOA 1NK3P 2K9NA 1HOMA 3Q0WA 2KDZA 2CRGA 1VI0A 3G1OA 1JKPC 3PO3J 3BG9A 5F1JA 4D7NA 2X9DA 2YUSA 3BTIA 3K7AJ 2G3BA 2L9RA 5HBUA 3S15J 4JX6A 3S14J 2GENA 4YZEA 1XC5A 2WUIA 2G0EA 1PUFA 1MSEC 2MGQA 3KZ9A 2X6OA 5FKLA 2DA2A 3K2AA 2L7FP 3MN2A 1W0UA 4M6VA 2IAIA 4A3BJ 5CW8A 1I6HJ 2E2HJ 2IEKA 4C3JJ 4HNVA 3PPBA 5J1RA 2JN6A 1PUFB 1IDZA 2DJNA 2L0KA 3RQIA 2M8GX 2H1KA 5EZHA 2FQ4A 5FLVA 2JMWA 1U8BA 5HODA 1FJLA 4GCLA 3HOZJ 2G7LA 2CUEA 2IU5A 2M2EA 1XG1A 4W97A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HAW A;  3BTL A;  2CQX A;  4MFE A;  3ZQH A;  1JJ6 C;  3DPJ A;  1JKQ C;  2LVS A;  2GLO A;  3UKG A;  5GP9 A;  3LSG A;  5C3E J;  3GZI A;  5CXG A;  2LLK A;  3FKI J;  3ZQL A;  4V2F A;  3O8H A;  4GFB A;  4IHW A;  2KT0 A;  1TWC J;  5M3M J;  4MK6 A;  2X48 A;  3QPL A;  4I6Z A;  2DMP A;  4V2G A;  4DYR A;  1TC3 C;  1MH3 A;  4NDL A;  5M5Y J;  2NP3 A;  3OSF A;  3LHQ A;  2R0Q C;  1JKR C;  2UXU A;  2P81 A;  4BY1 J;  3BR1 A;  4XK4 A;  1OCP A;  1IDY A;  2UXI A;  3O8G A;  1IV6 A;  2B63 J;  4MO7 A;  2ME6 A;  2JA5 J;  2XGE A;  1AU7 A;  4BBS J;  1JKO C;  3ON2 A;  1ITY A;  3CRJ A;  4A3L J;  2DA4 A;  1XS9 A;  2D6Y A;  1JJ8 C;  2F07 A;  2UXP A;  2EBI A;  2Q24 A;  2R5Z B;  4JL3 A;  3P9T A;  2Y30 A;  3A03 A;  3HB9 A;  3PM1 A;  3A01 A;  4C2M J;  4AUX A;  3GEU A;  2REK A;  2LY9 A;  5D19 A;  5EYR A;  2ECC A;  3VPR A;  2LP0 A;  5IP9 J;  4JKZ A;  4S0H B;  1WCM J;  2DTZ A;  2YU9 J;  1ZKG A;  3NPI A;  3S1Q J;  2CU7 A;  1MBF A;  1IUF A;  4XID A;  4A3M J;  1RET A;  2EZK A;  3HKZ N;  3O60 A;  2DG8 A;  4XRS A;  3BG5 A;  2L7Z A;  5EF6 A;  1JT6 A;  1TWF J;  4LOC A;  5D1R A;  2YVE A;  3MKL A;  3HGG A;  3Q3S A;  2UXH A;  1TWA J;  2QTQ A;  1BL0 A;  4IHX A;  4DYQ A;  2QF7 A;  3VW0 A;  3JSJ A;  2FJ1 A;  5FKM A;  5DTD A;  2DG7 A;  4G12 A;  3F0C A;  1QVT A;  5D18 A;  5FGL A;  4KWA A;  2FD5 A;  3OSG A;  2DA6 A;  1BA5 A;  3VW2 A;  2TRT A;  3QBM A;  2JA7 J;  1ETO A;  2QIB A;  3HOY J;  1I50 J;  4XRS G;  5J1Y A;  1Z0X A;  3NAR A;  5K7F A;  1U9O A;  3CJD A;  2E1O A;  3KKD A;  1NTC A;  3MNL A;  1Q1V A;  5F0F A;  2MW8 A;  1I3Q J;  3JRA A;  1CQT A;  1RPW A;  1GV2 A;  3NAU A;  3B6C A;  1AHD P;  3IH3 A;  3JR9 A;  2DA1 A;  2XB5 A;  3HBL A;  3BRU A;  3BT9 A;  1Z77 A;  2XGC A;  4BKX A;  1JGG A;  2XPW A;  2QCO A;  3JRI A;  4A3J J;  2QWT A;  3G7R A;  4X6A J;  2PMZ N;  3BR3 A;  3Q0U A;  2PZ9 A;  3BCG A;  5F27 A;  2ZB9 A;  3FIS A;  5EGO A;  2YVH A;  2DMU A;  3VP5 A;  1IGN A;  2XRL A;  1U78 A;  4EEF G;  3ZQG A;  3BQZ A;  3GTM J;  2VUM J;  1DU0 A;  3ANG A;  2ID6 A;  4JX4 A;  2EZH A;  2GFN A;  3B81 A;  4A3E J;  3M3Y J;  2XPV A;  3BR0 A;  3QQA A;  5EGO B;  3NXC A;  1QVU A;  3PAS A;  1Y1V J;  1POG A;  1X2M A;  1FTT A;  3KKC A;  3LSR A;  2ZCX A;  3OIO A;  4L62 A;  3T6N A;  3CCY A;  1SAN A;  2OF7 A;  1ETW A;  3HTH A;  2ECB A;  3LOC A;  4B3A A;  2GM4 A;  1JT0 A;  3HOV J;  1MBH A;  2DA5 A;  3C2B A;  1ZR2 A;  2HDD A;  2IBD A;  3GTJ J;  4M3D A;  3AQT A;  1ENH A;  1MBE A;  3IH4 A;  5IPA A;  4QTR A;  2V57 A;  3BR6 A;  1QRY A;  3WHC A;  3S5R A;  2LR8 A;  2M0C A;  5FKN A;  1FIP A;  4ABZ A;  3W6V A;  1A5J A;  1UHS A;  4FE4 A;  4A93 J;  3H0G J;  1U9N A;  4A3D J;  2K40 A;  1K61 A;  3RH2 A;  5JLW A;  4UUS B;  2JWT A;  2WAQ N;  2CUF A;  4A3C J;  1G2H A;  2OER A;  3G1L A;  5FHP A;  1GUU A;  5E3O A;  2NP5 A;  3A02 A;  5IP7 J;  3D1N I;  1B8I A;  2WB1 N;  1OJL A;  2LTP A;  1MH4 A;  5FKK A;  3SFI A;  5HSZ A;  4DW6 A;  3SDG A;  2WV1 A;  2QKO A;  3GBG A;  2R5Z A;  1FTZ A;  1UG2 A;  2ID3 A;  2K9S A;  5DAJ A;  4CGR A;  1B8I B;  4J19 A;  2EZL A;  3S1N J;  2ELK A;  3GTO J;  2RAS A;  1TWH J;  1R9T J;  2NX4 A;  2RAE A;  3FK7 A;  3I4M J;  1ZK8 A;  1ETY A;  5F08 A;  2FBQ A;  4JNN A;  1MBK A;  2H8R A;  3JRB A;  1LE8 B;  2XB0 X;  1X2N A;  4AC0 A;  2VPR A;  1RR7 A;  3RZD J;  3IUV A;  5F0C A;  2UXO A;  1GVD A;  2NVX J;  3HDD A;  2E2J J;  2GUH A;  1P7J A;  1QPI A;  3HM5 A;  3E7Q A;  3PO2 J;  2O8K A;  2NOG A;  3DEW A;  1T33 A;  5K7H A;  3QKX A;  4XRM A;  3V78 A;  1OFC X;  2NVT J;  3JRE A;  5K7Z A;  2HOS A;  4MIM A;  4M3F A;  1B72 A;  3JRF A;  2M34 A;  1IG7 A;  4GFK A;  2O7O A;  3NI7 A;  5IYC J;  1ZR4 A;  2EH3 A;  3F1B A;  4ME9 A;  2DMQ A;  5FMP A;  1APL C;  3FIW A;  5BNG A;  3TED A;  1B72 B;  1VF9 A;  1JUM A;  1ZGW A;  3QPS A;  2DN0 A;  3FK6 A;  1Y1W J;  2ME0 A;  1T56 A;  3HOX J;  5J1U A;  3EGQ A;  4RDU A;  2EQR A;  4QIW N;  4GCT A;  2VKE A;  4D7M A;  3CWR A;  2MSY A;  5E3N A;  3GTG J;  3G56 A;  1BJZ A;  1BW5 A;  2Y2Z A;  2W48 A;  5EG0 A;  4CYC B;  3TW7 A;  2Y9Z A;  2PBX A;  2HQ5 A;  1HF0 A;  4UDS A;  1MSF C;  5C4Y A;  1AKH B;  4A3K J;  4NN1 A;  3AQS A;  3FRQ A;  4XIC A;  2LFB A;  1A6I A;  5EG0 B;  1OCT C;  4L5E A;  4W1U A;  3TP0 A;  3OOU A;  3EUP A;  2FX0 A;  1SGM A;  2ZCM A;  9ANT A;  4MFD A;  2CQQ A;  2R5Y B;  1UI5 A;  1WI3 A;  1IRZ A;  2G7G A;  2LK2 A;  1X58 A;  4BBR J;  1W0T A;  3ANP A;  3S17 J;  3HE0 A;  3HEF A;  3Q0V A;  2O9L A;  4AC6 A;  2JK3 A;  3B6A A;  2HYJ A;  2OI8 A;  3LSJ A;  3BHQ A;  5IP6 A;  3CDL A;  3V6G A;  3ZQC A;  3BG3 A;  2DMT A;  4QSH A;  1F43 A;  5IOZ A;  3CMY A;  2GBY A;  1RKW A;  4X1E A;  3ZOB A;  1F36 A;  1TWG J;  5C44 J;  1MBG A;  5IYB J;  1SFO J;  4DYC A;  2HKU A;  3L1P A;  3RD3 A;  3HOU J;  5EZG A;  3VOK A;  1VND A;  3S2D J;  1JUS A;  2XPU A;  5C4X J;  4AYB N;  4AF5 A;  4UUS A;  1IJW C;  1JTY A;  1O4X A;  4MLO A;  4FCY A;  2E19 A;  3VVX A;  2NS7 A;  2XGD A;  2JA8 J;  1NK2 P;  2DA7 A;  1HCR A;  4FIS A;  1YRN A;  2XDN A;  2CJJ A;  1DU6 A;  1ETQ A;  4JP0 A;  5M3F J;  2R93 J;  2JA6 J;  3ZQI A;  3GTK J;  2HI3 A;  4M3G A;  2HOT A;  4A3I J;  1S7E A;  4FE7 A;  4GFL A;  3LSP A;  1YRN B;  3BR2 A;  3VIB A;  3SJM A;  1EF4 A;  3JRC A;  2ZOY A;  1WPK A;  1BW6 A;  4JYK A;  1JTX A;  4Y7N J;  5GPC A;  3VOX A;  3HGY A;  2NVQ J;  1WH7 A;  3BR5 A;  3GTP J;  2D5V A;  1LE8 A;  2R7Z J;  3BTJ A;  3GTQ J;  2O7T A;  3VUQ A;  2M9H A;  2NVY J;  5F04 A;  4ACI A;  5H9T A;  4M3E A;  4MXM A;  1GV5 A;  5J3L A;  5DS9 A;  4GCK A;  2TCT A;  1HDD C;  3RZO J;  2WGB A;  3NRG A;  3BNI A;  3HIM A;  5FKO A;  5M5X J;  3ON4 A;  4C3I J;  1VFC A;  2Y9Y A;  4B4C A;  1LFU P;  5FLM J;  5FJ8 J;  1H8A C;  3M4O J;  4D5C A;  1E3O C;  3KNW A;  2DMN A;  2HXI A;  4M3B A;  2ZCN A;  5K58 A;  3NNR A;  1ETK A;  4NEL A;  4BY7 J;  1FIA A;  2LKX A;  1WH5 A;  5IOY A;  2HYT A;  1JUP A;  2DA3 A;  3TW6 A;  1P7I A;  2RHA A;  1IC8 A;  5EDN A;  4D5F A;  3JRD A;  2COB A;  3LWJ A;  2ZOZ A;  2NS8 A;  5F0H A;  2XSD C;  3S2H J;  1K83 J;  5JLX A;  5E3L A;  2AHQ A;  5IYD J;  3H3V K;  3VVZ A;  1ZTR A;  4A3F J;  2K9Q A;  3DCF A;  4BXX J;  4ICH A;  3E7L A;  2N8G A;  2VKV A;  3G1M A;  3S1M J;  4I76 A;  4DZP A;  3BJB A;  3IV5 A;  5C4J J;  3A01 B;  3S16 J;  3TP3 A;  5M5W J;  3S1R J;  1MNM C;  3HTI A;  2EZI A;  5EFY A;  1WGX A;  2HOA A;  4JX5 A;  4A69 C;  4CYC A;  3ZQF A;  1RES A;  3JRH A;  1UI6 A;  1AKH A;  2YS9 A;  1ETV A;  1D5Y A;  2Y0S N;  5GPA A;  2OPT A;  5E3M A;  1MBJ A;  3COL A;  3VVY A;  5EEA A;  4HKU A;  1FEX A;  4B1R A;  2W53 A;  1GT0 C;  3RKQ A;  5AQC A;  3BQY A;  3MVP A;  4IHY A;  3GTL J;  2HXO A;  2MG4 A;  3HTA A;  2L7M P;  3LNQ A;  2R5Y A;  3VW1 A;  4A3G J;  4IHV A;  1GDT A;  1LFB A;  2G7S A;  2JJ7 A;  4Y52 J;  1H88 C;  3WHB A;  4FTH A;  1HLV A;  1ETX A;  1ORK A;  3I4N J;  3HTJ A;  4C3H J;  2AO9 A;  3JRG A;  3IH2 A;  1RKT A;  1H89 C;  1UMQ A;  3CQZ J;  3LJL A;  2Y31 A;  3HOW J;  1HDP A;  2QOP A;  4DZJ A;  5CXI A;  4UUT A;  4PXI A;  2I10 A;  3BTC A;  2LD5 A;  4IEJ A;  2VI6 A;  1ZQ3 P;  2R92 J;  2E2I J;  3C07 A;  4RBO A;  1NK3 P;  2K9N A;  1HOM A;  3Q0W A;  2KDZ A;  2CRG A;  1VI0 A;  3G1O A;  1JKP C;  3PO3 J;  3BG9 A;  5F1J A;  4D7N A;  2X9D A;  2YUS A;  3BTI A;  3K7A J;  2G3B A;  2L9R A;  5HBU A;  3S15 J;  4JX6 A;  3S14 J;  2GEN A;  4YZE A;  1XC5 A;  2WUI A;  2G0E A;  1PUF A;  1MSE C;  2MGQ A;  3KZ9 A;  2X6O A;  5FKL A;  2DA2 A;  3K2A A;  2L7F P;  3MN2 A;  1W0U A;  4M6V A;  2IAI A;  4A3B J;  5CW8 A;  1I6H J;  2E2H J;  2IEK A;  4C3J J;  4HNV A;  3PPB A;  5J1R A;  2JN6 A;  1PUF B;  1IDZ A;  2DJN A;  2L0K A;  3RQI A;  2M8G X;  2H1K A;  5EZH A;  2FQ4 A;  5FLV A;  2JMW A;  1U8B A;  5HOD A;  1FJL A;  4GCL A;  3HOZ J;  2G7L A;  2CUE A;  2IU5 A;  2M2E A;  1XG1 A;  4W97 A; 
#chains in the Genus database with same CATH topology
 3ZMV A;  2A05 A;  3B73 A;  5HAW A;  3BTL A;  1WJD A;  4RGU A;  4I7H A;  1XPX A;  5A2Q K;  3K1N A;  3T0Y A;  5FFZ A;  3CUQ B;  5K5Q A;  2GLO A;  4LK0 F;  2W7N A;  3I4P A;  4BEH A;  3BG6 A;  2HDC A;  4IX7 A;  1QPM A;  1Z3X A;  4GFB A;  2KT0 A;  1TWC J;  4HZF A;  1PJR A;  4D9J A;  5HOO A;  2ZJR F;  4WK8 F;  4I6Z A;  2DMP A;  1TC3 C;  4ENM A;  2WAF A;  5BQT A;  3F8M A;  5K5O A;  1BC7 C;  2NVU B;  2K85 A;  3WGH A;  1A04 A;  4UNO A;  3MAJ A;  2UXU A;  2V9V A;  2OC6 A;  1BOA A;  1IW7 F;  1IV6 A;  4HX8 A;  3I71 A;  4L0Y B;  2BGC A;  2JA5 J;  2XGE A;  3ZP5 A;  2DFI A;  3K0L A;  1ITY A;  3ON2 A;  2GXB A;  1WHU A;  2XF7 A;  4B47 A;  4G6D A;  1FZP B;  1WJ5 A;  1Y0U A;  1DQU A;  4QPO A;  2R5Z B;  3P9T A;  4JL3 A;  3A01 A;  1T2K A;  3G73 A;  1G3Y A;  2XAJ A;  3OMY A;  4KYW A;  2XRN A;  2L7K A;  2VOP A;  2ECC A;  2NS0 A;  2Z16 A;  2O61 A;  1J7K A;  5IP9 J;  1ZLK A;  1WCM J;  4IQ4 A;  2DTZ A;  2QYO A;  2XF5 A;  2ICW G;  3S1Q J;  3DXJ F;  2G7H A;  4OIQ F;  4F7Z A;  4PSW A;  1O7L A;  4WX9 A;  4A3M J;  2CYY A;  2E35 A;  2DG8 A;  2FBH A;  3BG5 A;  3RDI A;  2L7Z A;  5EF6 A;  3CMA I;  5BPI A;  1TWF J;  3T5X A;  1HXD A;  1ON1 A;  5D5V B;  3NQO A;  2D2W A;  4ZDP A;  3MKL A;  3CME I;  2UXH A;  1TWA J;  2G9W A;  1RUO A;  1BL0 A;  2QTQ A;  2K9L A;  4PJ0 C;  2P7V B;  4OMY A;  3C2H A;  1N75 A;  4DYQ A;  2QQ9 A;  2ZSH B;  4CCO A;  3VW0 A;  2E36 A;  4XON A;  3RCO A;  3VYR B;  2FJ1 A;  1UHM A;  2DG7 A;  4G12 A;  2FD5 A;  1GXP A;  3VW2 A;  4TV7 A;  2DI3 A;  2JA7 J;  5GAE J;  3HOY J;  4KN4 X;  4XOT A;  2V7F A;  1X3U A;  1SFX A;  1IN6 A;  1Y6I A;  2HTS A;  1BM9 A;  1SFU A;  1K4T A;  5K7F A;  1S7O A;  1TTY A;  2OA4 A;  3PFY A;  3BCB A;  3CJD A;  4XLC A;  2BXY A;  4HF0 A;  4MHG A;  3CJQ B;  4XKW A;  3WU2 C;  1I3Q J;  2DK8 A;  3QPT A;  1RPW A;  3KEO A;  1MZB A;  3B6C A;  3IH3 A;  2DA1 A;  4YIR X;  2CS3 A;  3QP6 A;  1K79 A;  1Z77 A;  1X3Z B;  5LHI A;  1R1T A;  2QCO A;  3WTU C;  3JRI A;  1PP7 U;  1O3Q A;  2BY0 A;  1G4D A;  2EV5 A;  1FPQ A;  3BCG A;  4G7Z F;  3FIS A;  4BAY A;  4EM2 A;  2YVH A;  3BPV A;  1X1B A;  3GTM J;  3GFJ A;  2VUM J;  3RKX A;  2DAO A;  2DBB A;  4ZTF A;  1TT0 A;  2QGU A;  2WAD A;  3CDI A;  2M4K A;  1HST A;  3S93 A;  3FDY A;  4BNC A;  3PAS A;  1H0M A;  3LSR A;  2ZCX A;  2IGO A;  1SAN A;  2Y75 A;  1VZ0 A;  3ZN0 A;  3LOC A;  4B3A A;  2JTV A;  2GM4 A;  3HG9 A;  1JT0 A;  5K5R A;  1J59 A;  2IBD A;  3GTJ J;  4M3D A;  4D1Q A;  4DGW B;  1FT9 A;  3IH4 A;  3DF8 A;  3H3U A;  3MD2 A;  2V57 A;  3BR6 A;  1QRY A;  3NWT A;  4XR6 A;  3MKZ A;  2K3F A;  3K9T A;  2UV1 A;  3TMO A;  2M0C A;  2IPQ X;  3W6V A;  1V4R A;  4ABZ A;  1UHS A;  4FE4 A;  5DDG A;  2CW8 A;  3U1D A;  2CW0 F;  1XX5 A;  5JR3 A;  1U9N A;  2WBM A;  1MJ9 A;  3LSH A;  3OYE A;  5JLW A;  2KPM A;  1FP1 D;  4BXU A;  4NC6 A;  2KKO A;  2WAQ N;  2VE9 A;  3G1L A;  2Y0M A;  1D0Z A;  5E3O A;  2K02 A;  3CCV I;  2HKX A;  2LTP A;  1MH4 A;  3IRR A;  3WG7 H;  3MZH A;  2DFF A;  4Y15 A;  4CCJ A;  3TO9 A;  2ID3 A;  4J00 A;  3C1D A;  2K9S A;  2XAS A;  3Q9S A;  2ZKZ A;  3GWZ A;  1ZEL A;  2C6Y A;  4RMN A;  5AON A;  2RAE A;  4GO1 A;  3AL0 C;  2NX4 A;  1ETY A;  2HZD A;  4NBQ A;  5CVJ A;  5F08 A;  4PDK A;  1MBK A;  2M4G A;  2H8R A;  2XB0 X;  3KET A;  2L2O A;  2VPR A;  2NYX A;  3TQN A;  2XDV A;  2R7R A;  1X4P A;  1W7P A;  3DTE A;  4NC7 A;  3LST A;  2E2J J;  3CCM I;  3REO A;  1P7J A;  3M1E A;  3U21 A;  3SEQ A;  3E3V A;  1ODD A;  4BJT A;  3F6V A;  4E6K G;  2O8K A;  5DUK A;  5ED4 A;  1J5Y A;  5K1Y A;  2OCC H;  3I9V 2;  3OS1 A;  5K7Z A;  3RPU A;  4M73 A;  4M3F A;  4CDG A;  4XQF A;  3JRF A;  2MLG A;  4UHT A;  5IYC J;  2GIZ A;  1YFH A;  4ME9 A;  2DMQ A;  2HQR A;  2JZY A;  3T8T A;  3VYS B;  2P5L C;  3CUO A;  2V9P A;  3FXM A;  4PGG A;  1D3Y A;  3K4M A;  2QEN A;  3DKX A;  4AWX B;  2NAZ A;  3HOX J;  2EQR A;  3A2K A;  3F23 A;  3CWR A;  4HX7 A;  5E3N A;  1VQP I;  2KQR A;  4O3M A;  3GTG J;  1G3T A;  2HGC A;  1J75 A;  5ILU A;  2QSH X;  2Y9Z A;  3RKW A;  4G7O F;  3TW7 A;  2FRH A;  2F4O B;  4UDS A;  5D4R A;  1MSF C;  1LUJ B;  2QZ8 A;  4KNY A;  2QSG X;  2TDX A;  2PG4 A;  3FRQ A;  1X1A A;  5IT3 A;  4Q47 A;  1A6I A;  4A6D A;  2H27 A;  4L9N A;  4A5M A;  1RNL A;  4KMF A;  5E20 A;  4ZZL A;  2KDO A;  1Z7L A;  2NNN A;  2VKD A;  1W5S A;  4U0W A;  1P2F A;  2HVQ A;  4LLN A;  1HA8 A;  1YQA A;  4BBR J;  4BHP A;  5LRS A;  1KU2 A;  4E7J A;  3ZMT A;  1U2W A;  1RR8 C;  3S17 J;  1L3L A;  5CPR B;  4AC6 A;  3B6A A;  2HYJ A;  2MFZ A;  3I0T A;  1R1U A;  4LGW A;  2HYF A;  3CDL A;  2CUJ A;  2BVM A;  1VQL I;  3CCQ I;  1F43 A;  4UXN A;  3CMY A;  4V19 K;  1RKW A;  2FF4 A;  3L2C A;  5C44 J;  2Q2E B;  1SFO J;  4XMY A;  1WJE A;  2D1H A;  3RIR A;  5D5W B;  1ZRE A;  5HDN A;  1S8N A;  2HZT A;  2GA1 A;  2X6X A;  5TJJ A;  4Z6Y A;  3KP2 A;  1MIJ A;  1ZLJ A;  4EJO A;  1F1Z A;  3BZ6 A;  2NS7 A;  3SEZ A;  3LA3 A;  2DA7 A;  3DPT A;  1J9I A;  3KP3 A;  3PUF A;  4Q4Z F;  4RM2 A;  3QOD A;  5HS8 A;  1D8J A;  3RTR A;  4KIF A;  2GXA A;  2OCE A;  2HI3 A;  1Y56 A;  4A3I J;  2YX7 A;  4LG0 A;  4BJ5 C;  4GFL A;  5HLI A;  3LSP A;  3VIB A;  3I55 I;  3OOP A;  5LGN A;  1Y39 A;  3JRC A;  1W7P D;  4AM3 A;  4Y7N J;  1QQI A;  1QHG A;  2MA3 A;  2XC7 A;  3G2B A;  1IV8 A;  3GME A;  3M8J A;  4LG0 B;  2EPF A;  1WH7 A;  2PMZ A;  1ZAO A;  3ZGK A;  2VLA A;  4HRI A;  2Q1Z B;  1Z1D A;  4G6T B;  3QYB A;  3GUD A;  5HS7 A;  4ACI A;  2COM A;  3EUH A;  4GYG A;  4DBQ A;  4Y4R A;  3RPU D;  3BNI A;  5M5X J;  2Y9Y A;  4KIS A;  1IN4 A;  3IUO A;  4M6Y A;  1YIT I;  5D6F A;  3HRS A;  3MFK A;  2D1V A;  4IRV A;  3KIO A;  2AXT C;  3KNW A;  2HVR A;  1Y8Q B;  1T98 A;  3Q5F A;  4M3B A;  3M8E A;  4C2U A;  5K58 A;  3BC8 A;  3PFI A;  4HV6 A;  2QQB A;  1X1D A;  3TKY A;  4ENJ A;  2LKX A;  1R6R A;  1WH5 A;  3OL4 A;  1JUP A;  2DA3 A;  1Z6R A;  3IL2 A;  1P7I A;  4YIF A;  1MMG A;  1CF7 A;  2CW7 A;  2W4S A;  3CCS I;  3OYJ A;  4DNC A;  3CES A;  3S2H J;  4RB1 A;  1FWZ A;  1K83 J;  3W6J B;  2AHQ A;  5BMZ A;  3H3V K;  4GRI A;  2QKL B;  1SVM A;  2ZJQ F;  2VKV A;  3CMM A;  4N0B A;  1R5I D;  1YS7 A;  3BJB A;  1I27 A;  2Q0O A;  2OD5 A;  2VT2 A;  3WTW C;  3S16 J;  2A3S A;  3HTI A;  5EFY A;  2D45 A;  1OR7 A;  1YX5 A;  2HOA A;  3GZ6 A;  4CYC A;  3M9A A;  1RES A;  4CZZ A;  3OR1 C;  3ERM A;  2V6C A;  3BJA A;  4BH9 A;  3QU3 A;  1D5Y A;  2XV4 S;  5E3M A;  1EV7 A;  3OYN A;  3LL7 A;  4B1R A;  3H5N A;  4OIN F;  4CUG A;  2NNY A;  1GT0 C;  4B3X A;  3H35 A;  2LG4 A;  2MG4 A;  1HKS A;  1KQ9 A;  2P5V A;  4MEX F;  4A3G J;  1GDT A;  2LRD A;  3GFI A;  2NRA C;  3WHB A;  2R3S A;  2ZME A;  4H0E A;  4AU7 A;  2BYV E;  3I4N J;  3CCL I;  3JRG A;  1RKT A;  2R7F A;  4O5V A;  1VQ4 I;  1H9T A;  1XDS A;  1YO5 C;  3HZJ A;  4JQF A;  4UUT A;  4ZYH A;  2VJI A;  2CQK A;  2HNH A;  2ESH A;  3BTC A;  3C07 A;  4IEJ A;  2VI6 A;  4OIO F;  2R92 J;  5B5E C;  2ZXH A;  5TIS C;  3PIO F;  2CRG A;  3H9Q A;  5EEG A;  1VQ6 I;  3PO3 J;  2P8T A;  3BG9 A;  1OIS A;  4DBR A;  1N25 A;  4G94 A;  2YUS A;  3K7A J;  2W82 A;  1TNT A;  1X19 A;  5HBU A;  4BAC A;  3S15 J;  3IP4 B;  4CHU A;  3S14 J;  2WAE A;  2IP2 A;  3BZK A;  2AQF A;  2WUI A;  2G0E A;  1MSE C;  3KZ9 A;  1RC9 A;  2X6O A;  1GHC A;  4F52 A;  2DA2 A;  3K2A A;  3QP5 A;  5FRO A;  1W0U A;  2IGK A;  2XAF A;  2IEK A;  2LY2 A;  3K8P C;  1KQ0 A;  1JGS A;  4EJU A;  4G8X A;  3HL2 A;  2CGP A;  2B1E A;  2DJN A;  2L0K A;  2H1K A;  2H8W A;  5EZH A;  3WOD F;  2W84 A;  5HOD A;  1FJL A;  3I5U A;  4GCL A;  1LB2 A;  2G7L A;  4BQN A;  3E6C C;  2CUE A;  3OYA A;  2B9S A;  3ZQH A;  4GYI A;  2FBK A;  1K7A A;  3CJT B;  1V3F A;  1U0J A;  2L54 A;  1QGP A;  1VQ9 I;  4MFE A;  2KLO A;  2LOO A;  2EIN H;  2O5R A;  4R1H A;  2LVS A;  3R61 A;  1YX3 A;  1FLI A;  2VC1 A;  5IY5 H;  3BOQ A;  3O8H A;  3RSN A;  4V2G A;  5HVQ C;  4OD5 A;  2LF7 A;  2EA4 A;  3L2U A;  4NDL A;  2NP3 A;  3OSF A;  3LHQ A;  2K4J A;  1JKR C;  3O3K A;  3DV8 A;  2P81 A;  3FZV A;  4P1W A;  1FBS A;  4BY1 J;  3BR1 A;  1UCR A;  3KYC B;  1IAW A;  3P7N A;  2BXZ A;  2BV6 A;  2B63 J;  4P55 A;  4MO7 A;  3ZN1 A;  2DU9 A;  1AOY A;  1FMW A;  2LC2 A;  4S05 A;  1KQ8 A;  1JJ8 C;  3V8J A;  2VON A;  2EBI A;  2HQN A;  3WGG A;  2DOF A;  2Y30 A;  3HB9 A;  2DCE A;  4B8X A;  5LHH A;  1BN5 A;  3QWL A;  3OR2 C;  2R7V A;  2E5Z A;  3GEU A;  5EYR A;  3VPR A;  2A6H F;  3F8C A;  3ZQQ A;  3NPI A;  1SAX A;  5EEH A;  2CUZ A;  4I02 A;  3OYL A;  4XSZ F;  3R4K A;  4BU2 A;  1QA6 A;  3E6M A;  1WVR A;  4MQV A;  2F5V A;  4CCK A;  4OWR B;  2LBF B;  4CCM A;  1JT6 A;  1SD6 A;  1D0Y A;  1ULY A;  2ZNY A;  3X2Q H;  5D1R A;  2YVE A;  3HHH A;  3HGG A;  5LD2 C;  3Q3S A;  1L0O C;  3V7C A;  2JQ7 A;  3ISP A;  4IHX A;  1HSJ A;  2KL4 A;  3VYU B;  2Q8K A;  2CH0 A;  1W36 C;  3OYM A;  3KEQ A;  2V6E A;  3PL8 A;  3MCZ A;  1QVT A;  5H6R A;  5D18 A;  5JVG F;  3OSG A;  3C7J A;  3MMY B;  2BY2 A;  3QBM A;  3PQJ A;  1YYV A;  5B1A H;  1ACI A;  3AL0 B;  1Z0X A;  1W1W E;  3D5S C;  3V8L A;  1Z21 A;  3NAR A;  1U5T C;  3BZC A;  1W4M A;  1F5T A;  1FMV A;  1MMD A;  1Q1V A;  1EKE A;  1MKM A;  2O8X A;  1ZG1 A;  3CZ6 A;  3JRA A;  2YU3 A;  1AHD P;  4RGS A;  2FOW A;  3OYK A;  3HBL A;  2ZCW A;  1WSU A;  5E1W A;  3PNY A;  3MZY A;  2XAG A;  3N97 A;  1JGG A;  4LK1 F;  3G7R A;  4IHT A;  1B9N A;  2PMZ N;  3BR3 A;  3Q0U A;  3QAH A;  2PQ8 A;  2PZ9 A;  2ZB9 A;  3SQN A;  1U78 A;  3FXK A;  3BQZ A;  1LVK A;  3FBI B;  4O6J A;  1SFK A;  2HU9 A;  1UZC A;  4OMZ A;  2M30 A;  2M7B A;  4A3E J;  3BR0 A;  3B81 A;  4I2O A;  1XGM A;  4EM0 B;  3J80 Z;  2LKS A;  3AG4 H;  1POG A;  1X2M A;  4LJZ F;  3H9J A;  5JHU A;  3JAM K;  4NHJ A;  3HC7 A;  3WTS C;  3KKC A;  2EV6 A;  3T6N A;  4L62 A;  3I64 A;  4CCL A;  2ACJ A;  1K4S A;  1XGO A;  1IXR C;  3MZ8 A;  4ZZD A;  3TBI A;  4E4H A;  2OTJ I;  2LF8 A;  3H3Z A;  4Y33 A;  4CH7 A;  2ZJP F;  4KN7 X;  5IPA A;  2DTR A;  4QTR A;  2RRE A;  3A1Y A;  4N4N B;  4HPQ A;  3W2W A;  3WHC A;  3S5R A;  3ULQ B;  4LIT A;  4II2 A;  1XD7 A;  3MKY B;  1VQO I;  5ILS A;  1FIP A;  2ZFU A;  4ESF A;  4A93 J;  1YW7 A;  2BZT A;  2K40 A;  2KIU A;  2OJE D;  3FXU A;  4KT5 C;  3W3C A;  3KP7 A;  4A0X A;  1N77 A;  3R6S A;  3DBR B;  3DU5 A;  3RH2 A;  2IJL A;  4UUS B;  2MH9 A;  1Z67 A;  1TW2 A;  2BHY A;  3V42 A;  5CJ9 A;  1LFP A;  2VAS A;  2CUF A;  1R49 A;  1IO2 A;  1UAA A;  5FHP A;  1GUU A;  4E7H A;  1FYM A;  4B09 A;  3D1N I;  3QOE A;  3DTK A;  2WB1 N;  2DYS H;  4PJM A;  1BI0 A;  1J0R A;  2H94 A;  3OL3 A;  4ZDL A;  1XN7 A;  4DW6 A;  1N78 A;  2WV1 A;  2QKO A;  3GBG A;  4QLC U;  2R5Z A;  1FTZ A;  1YE9 A;  5B66 C;  3Q9V A;  3OYB A;  5H6Q A;  5DAJ A;  4CGR A;  1D0X A;  3S1N J;  2ELK A;  5F6F A;  3SXY A;  5FGM A;  3FK7 A;  3BLY A;  2KIF A;  1ZK8 A;  1JXS A;  4XRF A;  2FBQ A;  5TGT A;  2STT A;  2IW5 A;  4BE1 A;  1LE8 B;  3WTX C;  4HDU A;  1I5Z A;  5F0C A;  2BOL A;  1GVD A;  2HYG D;  2KIS A;  1P4A A;  3EQL F;  3BG7 A;  3K6G A;  1QPI A;  1S9H A;  1XCB A;  1LKX A;  2EIJ H;  3CLQ A;  1FOK A;  1YIO A;  1FBU A;  2Z1D A;  2HQA A;  4PFP A;  4PK4 A;  3JRE A;  4AVZ A;  4Y17 A;  2VE8 A;  4GFK A;  2EH3 A;  3F1B A;  2EFO A;  2FNP A;  3FKJ A;  5LLQ A;  5FMP A;  4UVA A;  3RYP A;  4UVC A;  5D4S A;  1APL C;  2QQA A;  3FIW A;  5BNG A;  1MND A;  3HOS A;  3NWS A;  1ZGW A;  2KJB A;  1TQP A;  3S3O A;  2WY7 Q;  2QSF X;  1O57 A;  1NHA A;  3CF5 F;  4QIW N;  4GCT A;  4Y3O A;  3MWM A;  2MSY A;  3HSF A;  3G56 A;  1ON2 A;  2FU4 A;  5HLG A;  2MD0 A;  4B44 A;  4XLE A;  4LB5 A;  2PBX A;  1MW7 A;  2HQ5 A;  4PFO A;  1AKH B;  4FX0 A;  1XSD A;  4B48 A;  4FAS D;  1WKM A;  3HJE A;  5FFX A;  3WG9 A;  3GVA A;  1HQC A;  4XIC A;  1UST A;  3ML6 A;  3KX2 A;  4DJA A;  3TP0 A;  3OOU A;  3EUP A;  3D0S A;  3FMQ A;  3FXJ A;  3KP6 A;  4BQQ A;  3DKW A;  4UVB A;  2MC4 A;  2R5Y B;  2LY1 A;  3KZY A;  2G7G A;  2XKO A;  2JPB A;  4ENK A;  3IWZ A;  2I8D A;  3PUB A;  3KZZ A;  4S04 A;  1WI9 A;  3HKZ A;  3F21 A;  1FSH A;  2PFV A;  4XLA A;  2W57 A;  3ZMD A;  5LGT A;  3BG3 A;  2K4B A;  1WJF A;  3VOE A;  3J81 K;  1T0F C;  2GBY A;  4X1E A;  3ZOB A;  2FSW A;  2RQQ A;  3OYG A;  3MKW B;  1F36 A;  1TWG J;  1B59 A;  5IYB J;  4DYC A;  2HKU A;  2X4H A;  3L1P A;  5IT9 K;  3LWF A;  5FLX Z;  3DEU A;  4KIT B;  1VND A;  4RB3 C;  3S2D J;  4WF2 A;  1JUS A;  3OS2 A;  2XPU A;  5C4X J;  3ONQ A;  3I3L A;  4AIH A;  2V4J C;  1IJW C;  1JTY A;  3E5U A;  5HLH A;  1O4X A;  4MLO A;  1DP7 P;  4FCY A;  2E19 A;  4JK1 X;  3VVX A;  2JA8 J;  4U9L A;  3ASN H;  1HCR A;  1REP C;  2R7X A;  2XDN A;  1ETQ A;  1V5F A;  4JP0 A;  2E34 A;  3ZQI A;  2DPD A;  4M3G A;  2HOT A;  4A0Y A;  4FE7 A;  4F55 A;  3HRM A;  3CCE I;  2QQ8 A;  1R4M B;  3SJM A;  2ZOY A;  3LQQ A;  1EH6 A;  1WPK A;  5BPD A;  4JYK A;  1JTX A;  4BL0 B;  4BS9 A;  2GQQ A;  4HF2 A;  2DOE A;  2Z3Y A;  3HTU A;  2HTJ A;  1SD7 A;  3BR5 A;  4NQW B;  2R7Z J;  2X6W A;  5GAG J;  2O7T A;  2M9H A;  4RAG A;  2CO5 A;  3KEY A;  4E70 A;  2V9K A;  5H9T A;  2EB7 A;  1I39 A;  2TCT A;  1YJ9 I;  1P92 A;  2DT7 B;  2CFX A;  1WWX A;  1UHW A;  2R4G A;  2GWR A;  1LFU P;  4PUS A;  3ABM H;  4D5C A;  4WIB A;  3PNV A;  3L2R A;  3JSO A;  3HHG A;  1XSV A;  5EJC A;  1ETK A;  4U9N A;  1HW5 A;  3WU1 B;  1V5G A;  5IOY A;  5FO5 A;  2QWW A;  2PBI A;  2VJ5 A;  3NRV A;  1IC8 A;  5HNF A;  2COB A;  2ZOZ A;  1RUN A;  2ADU A;  2XSD C;  3F8B A;  3F6O A;  3ZMZ A;  5J40 A;  3TGN A;  1NH3 A;  5JLX A;  1JI8 A;  1D5V A;  4PCQ A;  2K9Q A;  3DCF A;  2GA2 A;  2JVG A;  3G1M A;  2DJI A;  3R0J A;  3S1M J;  4LMY A;  2LMD A;  4DZP A;  3IV5 A;  2ZXW H;  4EJV A;  4XKC A;  3J7Y J;  1OQY A;  3BDD A;  2ISZ A;  3GFM A;  4XBF A;  3S1R J;  1MNM C;  2EZI A;  3JTG A;  4KFC A;  3OIP A;  2KZV A;  1YLF A;  2XHK A;  3BY6 A;  4G7H F;  1IUY A;  1UI6 A;  2FJI 1;  4KIB A;  2H6B A;  5E1X A;  4QWQ A;  1IXS B;  3SHF A;  1OYY A;  1MBJ A;  1IRF A;  2CSO A;  5FD5 A;  3LMM A;  4HKU A;  3VFZ A;  2XRO A;  1YJN I;  4RGR A;  4P9U A;  5AIP A;  3GTL J;  2HXO A;  4XKV A;  4F93 B;  3S32 A;  4IHV A;  2OQG A;  5H20 A;  2JJ7 A;  2MC3 A;  4ZTJ A;  1S3J A;  2OZ6 A;  4FT8 A;  2XF6 A;  5FRM A;  1FC3 A;  3NS4 A;  1HLV A;  2UXX A;  2W85 A;  1YJW I;  2VBZ A;  4L0Z B;  3HTJ A;  3CJN A;  5CVR A;  3GCM A;  1H89 C;  2M87 A;  2MYS A;  2R7D A;  3BPX A;  2JUC A;  3CQZ J;  5CQG A;  2VIX A;  4CXF A;  2QOP A;  3ZXS A;  2A61 A;  3R0A A;  3W2V A;  1XCV A;  4GGG A;  4DZJ A;  3FHZ A;  5CYV A;  3H1C A;  1QO0 D;  2VC0 A;  4BQO A;  1ZQ3 P;  2Q2E A;  4RBO A;  3PQK A;  1R7J A;  1VQ7 I;  3Q0W A;  2E7W A;  3CUQ C;  3V4G A;  3G1O A;  4DIQ A;  3OV8 A;  5F1J A;  4D7N A;  2JRT A;  1XGS A;  2LRE A;  1SFE A;  4IL6 C;  3BTI A;  4IXA A;  3KPH A;  1FY7 A;  2L9R A;  3HTS B;  2W1O A;  4JX6 A;  1BR1 A;  1J09 A;  4IPA A;  2GEN A;  2IRF G;  1XC5 A;  2UZK A;  1PUF A;  4HDV A;  2MGQ A;  4N9I A;  3FBN B;  4A3B J;  2L7F P;  4BGD A;  5CW8 A;  1I6H J;  4MTE A;  2E2H J;  4C3J J;  3HXL A;  1U5T A;  3QYF A;  2Z99 A;  1PUF B;  4K2E A;  1KYZ A;  2XGX A;  5FLV A;  1U8B A;  1BR2 A;  4HNU A;  1VTN C;  1U5T B;  3KLO A;  4KIC A;  2VBX A;  5HDK A;  2IU5 A;  4B43 A;  1BI1 A;  2M2E A;  3CP2 A;  3IRQ A;  1XG1 A;  3JCU C;  1TL8 A;  4IOC F;  2OUM A;  4RA2 A;  4M6X A;  3I59 B;  3CC7 I;  1JKQ C;  4HX4 A;  3G3Z A;  4KUM A;  3UKG A;  5HLT A;  2IXS A;  5GP9 A;  4V2F A;  2BW3 A;  5M3M J;  4YEJ A;  4MK6 A;  1W5T A;  3K4L A;  3COA C;  4DYR A;  2OTL I;  1MH3 A;  4RAZ A;  4JBA A;  5M5Y J;  2R0Q C;  2VBW A;  2ZNZ A;  1P4W A;  2BW3 B;  2M7A A;  2XKP A;  3DBH B;  4XK4 A;  3FWE A;  2UXI A;  2PFB A;  4J01 A;  1KU7 A;  1ZN2 A;  2H1L A;  2ME6 A;  4NUB A;  2CV2 A;  4U7B A;  5DCM A;  3VB2 A;  5LHG A;  1AU7 A;  2A69 F;  2VXZ A;  4A3L J;  5ICF A;  1Z7U A;  2DA4 A;  2D6Y A;  2UXP A;  3F8N A;  2Q24 A;  3A03 A;  4IRH A;  3E0J B;  4C2M J;  4HNT A;  4PJL A;  5DCM B;  1HKQ A;  1MGT A;  1TZL A;  2REK A;  1A6Q A;  2LY9 A;  2STW A;  5D19 A;  1HBX G;  3ZR8 X;  2V1U A;  4UV9 A;  1WFX A;  2FOK A;  2X85 A;  4S0H B;  4JKZ A;  2YU9 J;  4OOI A;  4PJN A;  1ZKG A;  2KRF A;  3CDH A;  3FXR A;  2CU7 A;  3ASO H;  1ZHF A;  2IGN A;  2KZG A;  1IUF A;  1P4X A;  2VQG A;  4XSX F;  4XID A;  3HOT A;  3HKZ N;  1MDM B;  2O6G E;  2IS6 A;  3O60 A;  1SD4 A;  4C2M A;  4HF1 A;  5ICG A;  4EJW A;  2LNB A;  1Z9C A;  5E79 C;  4EGZ A;  2RDP A;  3F72 A;  2DQR A;  2VJJ A;  3DQV C;  2L4M A;  2PMH A;  5CLS A;  2QBY B;  1B1B A;  1ZG5 A;  2QF7 A;  1DGR M;  1PUE E;  3ROU A;  5FKM A;  4G9Y A;  1LEB A;  1J2X A;  1BA5 A;  1X1C A;  2DA6 A;  1ERD A;  2DT5 A;  1EH7 A;  1ETO A;  5GAD J;  4XRS G;  5J1Y A;  3K70 D;  4C2T A;  3D5L A;  3DPU A;  1U9O A;  4DQ2 A;  1NTC A;  2ISY A;  3KKD A;  2PMU A;  5J6X A;  3AAF A;  3B02 A;  2ZY9 A;  1XMK A;  2KP6 A;  2L9V A;  1CQT A;  1GV2 A;  4II3 A;  2XB5 A;  4I0A A;  3TDU C;  3BRU A;  2XGC A;  1D1C A;  4BKX A;  2PEX A;  2Z2S B;  1CGP A;  1OCR H;  1LNW A;  1VQN I;  2QWT A;  1DUX C;  1ZGJ A;  3K4K A;  5A2Q Z;  3IC7 A;  5F27 A;  1YW8 A;  2X0L A;  3RI4 A;  3VP5 A;  1IGN A;  2XRL A;  5LBQ A;  4YFX F;  1DU0 A;  2EZH A;  5ERI A;  1GVJ A;  4ZYG A;  4MEY F;  3M3Y J;  2XPV A;  3TL4 X;  2E7X A;  3L00 A;  3L7W A;  2BVL A;  2CWE A;  5KK1 A;  3WGI A;  1RIO H;  2O03 A;  1Y1V J;  4RAF A;  3OIO A;  3K4J A;  1T95 A;  2MD5 A;  2Y0S A;  2OF7 A;  3E5X A;  3VOD A;  4CSW A;  1G3S A;  1PYV A;  3F8F A;  4OAY A;  2EFP A;  4HQM A;  2ELH A;  4NB5 A;  1PP8 F;  2QUF A;  4LIU A;  4A2U A;  1ZR2 A;  2HDD A;  2ZJ2 A;  3AQT A;  3IAM 2;  1UB9 A;  1ENH A;  4WXD A;  1BC8 C;  5GTH C;  5LEK A;  1WJC A;  3JTH A;  1S72 I;  3FF5 A;  3F22 A;  4CGZ A;  1IN8 A;  1A5J A;  1MD0 A;  3LA2 A;  1R23 A;  3PIP F;  4A3D J;  2ZBK A;  3S8P A;  2X1E A;  4DOZ A;  5CVV A;  3ABK H;  3DTI A;  3OYH A;  4A3C J;  1OCC H;  1G2H A;  1JHH A;  1E2X A;  1B9M A;  2NP5 A;  2DPU A;  4EJT A;  1D1B A;  4WXC A;  1VQM I;  3O2P E;  3E5Q A;  3DPL C;  1V5E A;  3EUA A;  3TDZ C;  1Z91 A;  2QVO A;  4J19 A;  2RAS A;  3K1P A;  3GTO J;  2E1C A;  1MMS A;  3SFZ A;  4F92 B;  3I4M J;  1ZRD A;  1UG0 A;  2IA0 A;  4HG2 A;  5L3B A;  4JOM A;  1FOY A;  5E8G A;  3JRB A;  4AC0 A;  1X2N A;  1RR7 A;  3RZD J;  3IUV A;  2UXO A;  2LBF A;  4ON0 A;  3ELK A;  2F5F A;  2A07 F;  2XSJ C;  3K10 A;  4BUP A;  3HM5 A;  3CF2 A;  1IZ1 A;  2PLY A;  2GOM A;  2UUZ A;  1TQM A;  4XM3 A;  3GX4 X;  3PO2 J;  2FBI A;  2YSR A;  3P9C A;  2HR3 A;  4IRG A;  2XAU A;  5E1Z B;  2NOG A;  1T33 A;  4HW0 A;  3QKX A;  4XRM A;  3G71 I;  3GLL A;  2DFE A;  1OFC X;  3L2V A;  1P9Q C;  5D8K B;  3SDB A;  4IHS A;  2NXN B;  2M34 A;  3A0B C;  1TLH B;  3NI7 A;  1FYK A;  3EET A;  1X1P A;  4OIP F;  1LJ9 A;  5DYM A;  1HW2 A;  1Z05 A;  4IRI A;  2Z5U A;  4HV5 A;  4KIG A;  4LB6 B;  3TOA A;  1O7F A;  4KMU X;  3TED A;  3N4M A;  1A35 A;  1VF9 A;  5B3S H;  1JUM A;  3FK6 A;  4NNJ A;  1Y1W J;  4H4K C;  2FQ3 A;  1T56 A;  3EGQ A;  1G8X A;  2WAQ A;  3DFG A;  4BE2 A;  3AG2 H;  3AG1 H;  3ZQ7 A;  1X4O A;  2EWN A;  3K2Z A;  3J81 Z;  2KFD A;  3KCC A;  3KLN A;  4ZJZ A;  4XOP A;  2Y2Z A;  2W48 A;  2R7W A;  1KON A;  1HF0 A;  3C18 A;  3HUG A;  3I54 A;  2IS1 A;  4A3K J;  2KIM A;  3OYF A;  2RGV A;  3H36 A;  4NN1 A;  3ERE D;  3AQS A;  4IZZ A;  1TBX A;  1MJB A;  3I58 A;  2LFB A;  4L5E A;  3FXQ A;  3HUG B;  2GZW A;  3NEU A;  1SGM A;  4N9H A;  2ZCM A;  5JHF A;  4UUV A;  3H9G A;  3HPG A;  1KA8 A;  1WI3 A;  2RV8 A;  1OMI A;  2GXG A;  4P96 A;  4IOA F;  1UI5 A;  1FBQ A;  3KP4 A;  1U8R A;  2LSO A;  2F2E A;  1W0T A;  3ANP A;  1K6O A;  3HEF A;  2VBY A;  5E8I A;  4L18 B;  2A5Y B;  1XB4 A;  3LSJ A;  3BHQ A;  3LAJ A;  3V6G A;  3ZQC A;  2DMT A;  2P4W A;  3GW2 A;  4QSH A;  1WQ2 A;  5F64 A;  3LSM A;  1LEA A;  4I99 C;  5J8F A;  2E1N A;  4P9F A;  3HOU J;  3VOK A;  5D5U B;  4IJA A;  3HIF A;  1LDJ A;  4EV0 A;  3EUH C;  3O6B B;  2DXI A;  3WTZ A;  4UUS A;  2KIQ A;  3OYC A;  5DM7 F;  2BY3 A;  3U9G A;  4L5J A;  3PJR A;  5JI6 A;  4CIC A;  1NK2 P;  4PZJ A;  3RQ4 A;  3V7S A;  1YRN A;  1DDN A;  2CJJ A;  4ZYD A;  1S6L A;  2ELJ A;  5M3F J;  2R93 J;  2JA6 J;  1VQ5 I;  5J47 A;  3CJR B;  1YRN B;  3BR2 A;  1EF4 A;  3KZI C;  3F3X A;  1BW6 A;  5GPC A;  2W24 A;  2PJR A;  2M45 A;  2NVQ J;  2XAH A;  2R7Q A;  3GTP J;  2D5V A;  1LE8 A;  5FD6 A;  1RRJ A;  3BTJ A;  2E71 A;  2IA2 A;  3VUQ A;  5F04 A;  4MXM A;  1GV5 A;  5J3L A;  5DS9 A;  1I1S A;  1HDD C;  3RZO J;  2PJR B;  4XLN F;  3NRG A;  1OCO H;  5FKO A;  4OIR F;  5CVU A;  1OR7 C;  4C3I J;  3ON4 A;  5FLM J;  1USS A;  5FJ8 J;  1H8A C;  4BEH B;  3TO7 A;  1E3O C;  4UB8 C;  3AKZ A;  2DMN A;  2HXI A;  2FMY A;  2L01 A;  1MMA A;  4BY7 J;  2K86 A;  1FIA A;  2VL8 A;  2OQR A;  3CO6 C;  2ZSI B;  2HYT A;  5DCF A;  2DDB A;  4UV8 A;  5EDN A;  4D5F A;  2J5O A;  3JRD A;  4C30 A;  2NS8 A;  2JPC A;  5KCM A;  1ZG3 A;  2LKP A;  2KMU A;  5F0H A;  4RAY A;  3V7R A;  3W2A A;  4I0B A;  4KA4 A;  3K4C A;  3GXO A;  1ZTR A;  2ZME C;  4U7D A;  3FM3 A;  4ENN A;  4ICH A;  3E7L A;  3M1C A;  3ZRG A;  4U88 A;  4XKB A;  2R7T A;  1STZ A;  2K7L A;  3OWT A;  4AVP A;  3SZG A;  5C4J J;  4DVY P;  1H9G A;  3A01 B;  2PN6 A;  3E6D A;  4FX4 A;  1RZ4 A;  3TP3 A;  5M5W J;  4BJ6 C;  3GFL A;  4JX5 A;  4A69 C;  4LFU A;  4MQ9 F;  2RKH A;  2JT1 A;  2ZFW A;  3GO5 A;  1AKH A;  2YS9 A;  1ETV A;  1YHQ I;  3CC4 I;  2Y0S N;  1SEU A;  2HEO A;  5GPA A;  2MLK A;  2EK5 A;  4CCN A;  2OPT A;  5JFR A;  2KRH A;  3J7A O;  1W5C C;  3VVY A;  2Y48 A;  5EEA A;  3PSI A;  2P6T A;  2ZXJ A;  2W53 A;  2MBF A;  3VWB A;  3BQY A;  3MVP A;  2VOD A;  2DOA A;  2Z33 A;  3EYY A;  2R5Y A;  1LFB A;  1TT5 B;  1FYL A;  4Y52 J;  1XTA A;  2AQE A;  3PSF A;  1UJ8 A;  1NG6 A;  4HQE A;  4FTH A;  3ZCO A;  4AIK A;  1ORK A;  3SYT A;  5CQE A;  4C3H J;  1B4A A;  2OU2 A;  1G59 A;  2A2F X;  2IS4 A;  3QYE A;  1UMQ A;  2NOJ B;  1XGN A;  5DD8 A;  3WE2 A;  1HDP A;  5CXI A;  3A4C A;  5GTI C;  4PXI A;  3P5J A;  2LYC A;  2E2I J;  1QHH D;  3I56 I;  3R60 A;  2MH2 A;  2K9N A;  3H0D A;  2KDZ A;  1JKP C;  1IN7 A;  3OY9 A;  5KAF C;  2QEX I;  4ASN A;  2F48 A;  1IRG A;  4ZC3 A;  3VSL A;  4BHC A;  3J7Z I;  4HA8 A;  2VQH A;  3LFK A;  2EJR A;  3HRU A;  4HYE A;  1DPR A;  3U2R A;  2OAZ A;  1OPC A;  2FML A;  2IAI A;  3EYI A;  1QZZ A;  4ZYE A;  5HNH A;  1V54 H;  3ESW B;  4RB0 A;  1D1A A;  5L3E A;  5J1R A;  2JN6 A;  2YR2 A;  1SC7 A;  3HYI A;  4IVN A;  1JE8 A;  5H2F C;  2DQL A;  2HPI A;  5HDG A;  4HBL A;  5DD4 A;  1E3H A;  2M8G X;  3QRF F;  1ZRC A;  2JMW A;  1YG2 A;  3H92 A;  3WTV C;  3HOZ J;  4NQW A;  3M8F A;  2AS5 F;  1XDU A;  3KYD B;  4RGX A;  4ESJ A;  3ABL H;  2CV0 A;  4CA0 A;  1LPQ A;  3HSE A;  2E1M C;  2CQX A;  1JJ6 C;  3QOP A;  2EIL H;  2QA4 I;  1YS6 A;  1K6Y A;  3DPJ A;  3E6B A;  4OU0 A;  3GZI A;  3LSG A;  5C3E J;  5L3D A;  4F91 B;  2LLK A;  3FKI J;  3ZQL A;  5CXG A;  2CV1 A;  3FHN A;  2B7E A;  1Z3Y A;  1M1E B;  4IHW A;  2X48 A;  3QPL A;  3K69 A;  2V1D A;  3J80 K;  1K78 A;  2Y69 H;  1SMY F;  4L9J A;  3BJ6 A;  5DUI A;  2V1N A;  5B1B H;  5FB2 A;  1OKR A;  1OCP A;  2RC4 A;  1IDY A;  4LG3 A;  4RS8 A;  4YG2 F;  3C2G A;  3O8G A;  1BBY A;  1K78 B;  2YVX A;  2CG4 A;  4BBS J;  2RNJ A;  3OIQ A;  1JKO C;  3J7A Y;  1VQK I;  3CRJ A;  2ETH A;  4EM1 A;  3ECH A;  1XS9 A;  4RLF A;  3S2W A;  4WWC A;  1O3T A;  2F07 A;  4EQQ A;  4AYB A;  3PM1 A;  2G7U A;  3IWF A;  2AXL A;  4AUX A;  1IRX A;  4PGH A;  1RI7 A;  3QPH A;  3EUK L;  4BDZ A;  3U1K A;  1EJ9 A;  2LP0 A;  2CQ7 A;  2F5D A;  3GYH X;  5BOX A;  3OYI A;  2GAU A;  4IF4 A;  3ABT A;  2R7U A;  1EH8 A;  2JVH A;  1LVA A;  1MBF A;  2WA0 A;  2KJC A;  1RET A;  2EZK A;  2X1D A;  1FNN A;  1P6R A;  1QNT A;  1W7P B;  4XRS A;  2R7S A;  3MQ0 A;  2A5W A;  1ZAR A;  2F5E A;  4CZC A;  2VQL A;  5D5X B;  5DV5 A;  4LOC A;  1G6N A;  1C0W A;  1IN5 A;  2M5W A;  1R4N B;  2V26 A;  5JVT A;  5ILV A;  1DP3 A;  3SZT A;  5KHD A;  1R1V A;  4ZDO A;  4M9Z A;  2FA5 A;  4Z2Y A;  2L3D A;  3JSJ A;  1KU9 A;  2VJ4 A;  3DLA A;  5DTD A;  2IVM A;  3F0C A;  2EFQ A;  5FGL A;  4Q48 A;  5KAI C;  4KWA A;  1T6S A;  2BEO A;  2TRT A;  2OV7 A;  2QIB A;  1I50 J;  5ICC A;  4IQJ A;  2E60 A;  2L4A A;  2RQP A;  2WWY A;  3GZ5 A;  2E1O A;  2HPM A;  3MNL A;  5F0F A;  2PI0 A;  2MW8 A;  3GLX A;  2W25 A;  3LQR A;  3LSI A;  4U0V A;  3T1B A;  1Y8R B;  4D0P A;  4PSX A;  1WZ2 A;  3CD6 I;  2UWM A;  3NAU A;  3CCJ I;  3ZMS A;  3I53 A;  3JR9 A;  3DWL E;  5DM6 F;  1A36 A;  3EPZ A;  3KE2 A;  3BT9 A;  4C9Y A;  3IKT A;  2H6C A;  1FP2 A;  1IF1 A;  2XPW A;  1WJA A;  3OYD A;  1YW9 A;  4A3J J;  1ZH5 A;  2FEZ A;  1I1G A;  4RLQ A;  4X6A J;  3UR3 C;  4BYY A;  5EGO A;  4F3Q A;  3DKY A;  3EDP A;  2DMU A;  1QBJ A;  2K27 A;  4M71 A;  4EEF G;  3ZQG A;  1DGW Y;  2O3F A;  2VOO A;  3ANG A;  2ID6 A;  4JX4 A;  2GFN A;  4ESB A;  1PDN C;  3G6E I;  1YTY A;  3M7G A;  2DT6 A;  3QQA A;  3TOB A;  5EGO B;  3NXC A;  1QVU A;  1KU3 A;  1FTT A;  2ZXI A;  2JSP A;  1BIB A;  4XLH A;  1E17 A;  2F4M B;  3CCY A;  2IS2 A;  4KT6 A;  2CMP A;  1ETW A;  2K9M A;  3HTH A;  2ECB A;  2JSC A;  3HOV J;  1MBH A;  2DA5 A;  2XVC A;  3C2B A;  4GCV A;  3VYT B;  3I59 A;  3ECO A;  4HLY A;  1HKT A;  1SVL A;  3K4B A;  1MBE A;  5CVI A;  3S3M A;  5CKT A;  4XLP F;  3N05 A;  3WTT C;  1DPU A;  3KP5 A;  2LR8 A;  1QZE A;  3LFU A;  3H5R A;  5FKN A;  1FOX A;  3CCR I;  5J4Y A;  3H0G J;  4I09 A;  3DU6 A;  1K61 A;  4X0G A;  4ITV A;  2JWT A;  5D8L B;  4MTD A;  2OER A;  1XMX A;  2YPR A;  2HWV A;  3SZP A;  3D5R C;  3A02 A;  1T39 A;  5IP7 J;  4M74 A;  1B8I A;  5L3C A;  1OJL A;  2VT3 A;  2DOD A;  4HST A;  5FKK A;  3SFI A;  1Z6T A;  5HSZ A;  1R00 A;  3SDG A;  4HEA 2;  3BCA A;  5ICE A;  3ZMU A;  1Y0N A;  1UG2 A;  5D6E A;  3BJO A;  1B8I B;  3WU0 A;  5FLX K;  2DFH A;  2EZL A;  2EIM H;  3ABU A;  5HS9 A;  1TWH J;  1R9T J;  2WTE A;  3V8K A;  4YRV A;  2M0M A;  3KFW X;  2BBY A;  3FMR A;  2DDA A;  4JNN A;  4XL9 A;  4A6E A;  4E7S A;  1MDM A;  5KNL A;  1FSE A;  4HOB A;  2NVX J;  3HDD A;  2GUH A;  2WC2 A;  3P9K A;  3DLL F;  2WY8 Q;  2X6Y A;  3E7Q A;  2HVS A;  1SMT A;  5J4V A;  3LA7 A;  4LIV A;  2M8E A;  1FX7 A;  3L9F A;  5LGU A;  4N4O B;  5K7H A;  3DEW A;  1S7A A;  3V78 A;  2EIK H;  2QBY A;  1BI3 A;  5F1R A;  2NVT J;  2V79 A;  2HOS A;  2JUG A;  4MIM A;  1B72 A;  3IAS 2;  1ZRF A;  5E17 F;  1IG7 A;  2O7O A;  2X1C A;  1BJA A;  1ZR4 A;  4OD4 A;  3W6K B;  3S3N A;  4EAT A;  1CF7 B;  1OYI A;  2IGM A;  2M3A A;  4FET A;  4E7K A;  1YIJ I;  1B72 B;  1BIA A;  2L02 A;  2F4I A;  3QPS A;  6PAX A;  2DN0 A;  3H5A A;  2ME0 A;  1U3E M;  2OBP A;  4UY8 I;  2VPL A;  5J1U A;  4FHT A;  5LRR A;  4RDU A;  2VKE A;  4D7M A;  3JAM Z;  3A0H C;  2WB1 A;  1BJZ A;  1W36 D;  1F4K A;  4XLF A;  1BW5 A;  2XIG A;  4M9S A;  2DK5 A;  5EG0 A;  2JA2 A;  4CYC B;  2HDW A;  2RN7 A;  3CC2 I;  1EA3 A;  5C4Y A;  2H09 A;  3C3W A;  4NC8 A;  1I3A A;  4Y13 A;  4YEL A;  4U87 A;  3FM5 A;  5E18 F;  3CO7 C;  5EG0 B;  1OCT C;  4XOR A;  4W1U A;  4ZYA A;  5LFA A;  4MNU A;  1O3S A;  3AFH A;  4MGR A;  1LQ1 A;  2FX0 A;  2O0Y A;  2FE3 A;  4HLX A;  9ANT A;  4MFD A;  2CQQ A;  1AA7 A;  2IT0 A;  2VQC A;  1IRZ A;  2LK2 A;  1X58 A;  2BY1 A;  1XSX A;  4M72 A;  4E7L A;  2F5C A;  3HE0 A;  2ZME B;  3VSK A;  3JW4 A;  3Q0V A;  2O9L A;  2JK3 A;  2OI8 A;  5IP6 A;  1R5G A;  2HOE A;  2L9S A;  2P7C B;  1Q1H A;  4BE0 A;  2HFH A;  2E5N A;  5IOZ A;  1GXQ A;  1HC8 A;  2M1B A;  4LD5 A;  1KZH A;  1TP4 A;  3HPH A;  1MBG A;  4Q5S F;  2L9N A;  2B0L A;  2KHM A;  2ZC2 A;  2VB6 A;  4YFK F;  4YFN F;  3RD3 A;  1BI2 A;  5EZG A;  3ZPL A;  1E3P A;  1F9N A;  2R7O A;  4ZH4 F;  4AYB N;  1OLT A;  3VDX A;  3K1M A;  3RYR A;  4AF5 A;  2B3W A;  2J5P A;  4EVI A;  2BE5 F;  3WE3 A;  3GF2 A;  1E0E A;  2XGD A;  1O3R A;  2YX4 A;  2EFN A;  4EMS A;  4P5O A;  4FIS A;  4BDY A;  3TO6 A;  1DU6 A;  4BHB A;  2QM3 A;  3DP7 A;  3GTK J;  3BWG A;  1SD5 A;  1U6G A;  2P0W A;  2L5Q A;  1S7E A;  1UFM A;  4L9T A;  5L3F A;  4XNF A;  2WV0 A;  1FOW A;  1MNE A;  2BHZ A;  4RB2 C;  4BXF A;  1T0F A;  4ANJ A;  3VOX A;  3JSP A;  3RKY A;  1T8I A;  1UEL B;  2I5U A;  1WRJ A;  3DBL B;  3HGY A;  4U0Y A;  2LH9 A;  4AIJ A;  1SVO A;  3LSK A;  4PJJ A;  3GTQ J;  4LLG F;  2NVY J;  4M3E A;  4GCK A;  2WGB A;  4UB6 C;  3HIM A;  1X3W B;  2LDU A;  5LEJ A;  4YII A;  1VFC A;  2P5K A;  3CTA A;  1S29 A;  4B4C A;  2VKH A;  3M4O J;  1A31 A;  1GLN A;  4FQG A;  4IKF A;  4A5N A;  3IHU A;  3L2Q A;  3RJP A;  1I6X A;  2ZCN A;  2EV0 A;  1MJA A;  1KYW A;  4LLL A;  3NNR A;  1XMA A;  4NEL A;  3IKV A;  1TNS A;  1ZYR F;  2ESN A;  4HAM A;  1WJB A;  2OZU A;  4M9X A;  3TW6 A;  1QU3 A;  2RHA A;  1HW1 A;  1JHF A;  2W00 A;  1R22 A;  1OYW A;  2EA2 A;  2X51 A;  3LWJ A;  3E97 A;  1LDD A;  1ONV A;  1T08 B;  2HKO A;  3AG3 H;  4GXO A;  5E3L A;  1YOV B;  4QPQ A;  3L09 A;  5IYD J;  1BR4 A;  1AWC A;  3VVZ A;  4HSR A;  4A3F J;  4L9V A;  4BXX J;  4I01 A;  2HS5 A;  1R5H A;  2N8G A;  2FNA A;  2VXD A;  2GIV A;  3FMS A;  4WCG A;  4I76 A;  1T38 A;  3OS0 A;  3SWH A;  2E1M B;  4AID A;  4OAZ A;  2XAQ A;  1WGX A;  1YI2 I;  3VTI A;  3ZQF A;  4A0Z A;  4XN0 A;  3JRH A;  3WTY C;  2A6E F;  4A12 A;  3HRT A;  3MEX A;  1TQI A;  3KYL A;  3P9I A;  3GZN B;  2RVC A;  1PVE A;  2DYR H;  4IO9 F;  3COL A;  2DO7 A;  1G3W A;  2JRM A;  2UXN A;  2V1X A;  2GOX B;  1FEX A;  2DLL A;  3UNG C;  3VEP A;  2VN2 A;  3HSR A;  3T8R A;  3RKQ A;  4BQA A;  5AQC A;  5GAH J;  1R71 A;  1KGS A;  3K70 C;  4IHY A;  5IT9 Z;  3HTA A;  4WXH A;  5DEQ A;  3M07 A;  2DW4 A;  2L7M P;  4XN3 A;  3LNQ A;  3L2W A;  4KDP A;  3VW1 A;  2G7S A;  3E1S A;  4EGY A;  1SAU A;  2K5C A;  2K3P A;  2RNG A;  3CP8 A;  1ZGA A;  4RM3 A;  1BOB A;  1H88 C;  2P6S A;  4GDF A;  3FXO A;  1ETX A;  3K4N A;  4CYD A;  5L3G A;  3G4S I;  3GEZ A;  5FRN A;  2AO9 A;  3CCU I;  1S5L C;  1OCZ H;  3IH2 A;  3LJL A;  2Y31 A;  2QKM B;  3HOW J;  2PX9 A;  2I10 A;  3BRO A;  2LD5 A;  2MAB A;  1IXC A;  2A6T A;  1TW3 A;  1NK3 P;  1HOM A;  1VI0 A;  5J8C A;  4G6Q A;  4R8H A;  2XUB A;  2PJP A;  2QLZ A;  5TRD A;  4E7Z A;  3LAP A;  2F6C A;  1MMN A;  2X9D A;  2G3B A;  2A68 F;  3FXL A;  2IA1 A;  1LDK B;  4KJZ A;  1V55 H;  4YZE A;  4L5I A;  4E7I A;  2Z9O A;  2CQN A;  3CLO A;  5FKL A;  2ZO4 A;  3FX3 A;  3MN2 A;  1VQ8 I;  4M6V A;  1R36 A;  1B6A A;  4HNV A;  2CFO A;  2FUG 2;  3RPQ A;  3PPB A;  1NG7 A;  3DEE A;  3PNT A;  3QU6 A;  5KVR A;  1QZY A;  5AIQ A;  2EFW A;  4ETS A;  1IDZ A;  1R58 A;  4CO8 A;  4R79 A;  3BP8 A;  2FQ4 A;  3F9K A;  5BS6 A;  2KRC A;  2FXA A;  4AD9 A;  4I98 B;  3CUQ A;  1D8K A;  3RQI A;  4W97 A; 
#chains in the Genus database with same CATH homology
 5HAW A;  3BTL A;  2CQX A;  4MFE A;  3ZQH A;  1JJ6 C;  3DPJ A;  1JKQ C;  2LVS A;  2GLO A;  3UKG A;  5GP9 A;  3LSG A;  5C3E J;  3GZI A;  5CXG A;  2LLK A;  3FKI J;  3ZQL A;  4V2F A;  3O8H A;  4GFB A;  4IHW A;  2KT0 A;  1TWC J;  5M3M J;  4MK6 A;  2X48 A;  3QPL A;  4I6Z A;  2DMP A;  4V2G A;  4DYR A;  1TC3 C;  1MH3 A;  4NDL A;  5M5Y J;  2NP3 A;  3OSF A;  3LHQ A;  2R0Q C;  1JKR C;  2UXU A;  2P81 A;  4BY1 J;  3BR1 A;  4XK4 A;  1OCP A;  1IDY A;  2UXI A;  3O8G A;  1IV6 A;  2B63 J;  4MO7 A;  2ME6 A;  2JA5 J;  2XGE A;  1AU7 A;  4BBS J;  1JKO C;  3ON2 A;  1ITY A;  3CRJ A;  4A3L J;  2DA4 A;  1XS9 A;  2D6Y A;  1JJ8 C;  2F07 A;  2UXP A;  2EBI A;  2Q24 A;  2R5Z B;  4JL3 A;  3P9T A;  2Y30 A;  3A03 A;  3HB9 A;  3PM1 A;  3A01 A;  4C2M J;  4AUX A;  3GEU A;  2REK A;  2LY9 A;  5D19 A;  5EYR A;  2ECC A;  3VPR A;  2LP0 A;  5IP9 J;  4JKZ A;  4S0H B;  1WCM J;  2DTZ A;  2YU9 J;  1ZKG A;  3NPI A;  3S1Q J;  2CU7 A;  1MBF A;  1IUF A;  4XID A;  4A3M J;  1RET A;  2EZK A;  3HKZ N;  3O60 A;  2DG8 A;  4XRS A;  3BG5 A;  2L7Z A;  5EF6 A;  1JT6 A;  1TWF J;  4LOC A;  5D1R A;  2YVE A;  3MKL A;  3HGG A;  3Q3S A;  2UXH A;  1TWA J;  2QTQ A;  1BL0 A;  4IHX A;  4DYQ A;  2QF7 A;  3VW0 A;  3JSJ A;  2FJ1 A;  5FKM A;  5DTD A;  2DG7 A;  4G12 A;  3F0C A;  1QVT A;  5D18 A;  5FGL A;  4KWA A;  2FD5 A;  3OSG A;  2DA6 A;  1BA5 A;  3VW2 A;  2TRT A;  3QBM A;  2JA7 J;  1ETO A;  2QIB A;  3HOY J;  1I50 J;  4XRS G;  5J1Y A;  1Z0X A;  3NAR A;  5K7F A;  1U9O A;  3CJD A;  2E1O A;  3KKD A;  1NTC A;  3MNL A;  1Q1V A;  5F0F A;  2MW8 A;  1I3Q J;  3JRA A;  1CQT A;  1RPW A;  1GV2 A;  3NAU A;  3B6C A;  1AHD P;  3IH3 A;  3JR9 A;  2DA1 A;  2XB5 A;  3HBL A;  3BRU A;  3BT9 A;  1Z77 A;  2XGC A;  4BKX A;  1JGG A;  2XPW A;  2QCO A;  3JRI A;  4A3J J;  2QWT A;  3G7R A;  4X6A J;  2PMZ N;  3BR3 A;  3Q0U A;  2PZ9 A;  3BCG A;  5F27 A;  2ZB9 A;  3FIS A;  5EGO A;  2YVH A;  2DMU A;  3VP5 A;  1IGN A;  2XRL A;  1U78 A;  4EEF G;  3ZQG A;  3BQZ A;  3GTM J;  2VUM J;  1DU0 A;  3ANG A;  2ID6 A;  4JX4 A;  2EZH A;  2GFN A;  3B81 A;  4A3E J;  3M3Y J;  2XPV A;  3BR0 A;  3QQA A;  5EGO B;  3NXC A;  1QVU A;  3PAS A;  1Y1V J;  1POG A;  1X2M A;  1FTT A;  3KKC A;  3LSR A;  2ZCX A;  3OIO A;  4L62 A;  3T6N A;  3CCY A;  1SAN A;  2OF7 A;  1ETW A;  3HTH A;  2ECB A;  3LOC A;  4B3A A;  2GM4 A;  1JT0 A;  3HOV J;  1MBH A;  2DA5 A;  3C2B A;  1ZR2 A;  2HDD A;  2IBD A;  3GTJ J;  4M3D A;  3AQT A;  1ENH A;  1MBE A;  3IH4 A;  5IPA A;  4QTR A;  2V57 A;  3BR6 A;  1QRY A;  3WHC A;  3S5R A;  2LR8 A;  2M0C A;  5FKN A;  1FIP A;  4ABZ A;  3W6V A;  1A5J A;  1UHS A;  4FE4 A;  4A93 J;  3H0G J;  1U9N A;  4A3D J;  2K40 A;  1K61 A;  3RH2 A;  5JLW A;  4UUS B;  2JWT A;  2WAQ N;  2CUF A;  4A3C J;  1G2H A;  2OER A;  3G1L A;  5FHP A;  1GUU A;  5E3O A;  2NP5 A;  3A02 A;  5IP7 J;  3D1N I;  1B8I A;  2WB1 N;  1OJL A;  2LTP A;  1MH4 A;  5FKK A;  3SFI A;  5HSZ A;  4DW6 A;  3SDG A;  2WV1 A;  2QKO A;  3GBG A;  2R5Z A;  1FTZ A;  1UG2 A;  2ID3 A;  2K9S A;  5DAJ A;  4CGR A;  1B8I B;  4J19 A;  2EZL A;  3S1N J;  2ELK A;  3GTO J;  2RAS A;  1TWH J;  1R9T J;  2NX4 A;  2RAE A;  3FK7 A;  3I4M J;  1ZK8 A;  1ETY A;  5F08 A;  2FBQ A;  4JNN A;  1MBK A;  2H8R A;  3JRB A;  1LE8 B;  2XB0 X;  1X2N A;  4AC0 A;  2VPR A;  1RR7 A;  3RZD J;  3IUV A;  5F0C A;  2UXO A;  1GVD A;  2NVX J;  3HDD A;  2E2J J;  2GUH A;  1P7J A;  1QPI A;  3HM5 A;  3E7Q A;  3PO2 J;  2O8K A;  2NOG A;  3DEW A;  1T33 A;  5K7H A;  3QKX A;  4XRM A;  3V78 A;  1OFC X;  2NVT J;  3JRE A;  5K7Z A;  2HOS A;  4MIM A;  4M3F A;  1B72 A;  3JRF A;  2M34 A;  1IG7 A;  4GFK A;  2O7O A;  3NI7 A;  5IYC J;  1ZR4 A;  2EH3 A;  3F1B A;  4ME9 A;  2DMQ A;  5FMP A;  1APL C;  3FIW A;  5BNG A;  3TED A;  1B72 B;  1VF9 A;  1JUM A;  1ZGW A;  3QPS A;  2DN0 A;  3FK6 A;  1Y1W J;  2ME0 A;  1T56 A;  3HOX J;  5J1U A;  3EGQ A;  4RDU A;  2EQR A;  4QIW N;  4GCT A;  2VKE A;  4D7M A;  3CWR A;  2MSY A;  5E3N A;  3GTG J;  3G56 A;  1BJZ A;  1BW5 A;  2Y2Z A;  2W48 A;  5EG0 A;  4CYC B;  3TW7 A;  2Y9Z A;  2PBX A;  2HQ5 A;  1HF0 A;  4UDS A;  1MSF C;  5C4Y A;  1AKH B;  4A3K J;  4NN1 A;  3AQS A;  3FRQ A;  4XIC A;  2LFB A;  1A6I A;  5EG0 B;  1OCT C;  4L5E A;  4W1U A;  3TP0 A;  3OOU A;  3EUP A;  2FX0 A;  1SGM A;  2ZCM A;  9ANT A;  4MFD A;  2CQQ A;  2R5Y B;  1UI5 A;  1WI3 A;  1IRZ A;  2G7G A;  2LK2 A;  1X58 A;  4BBR J;  1W0T A;  3ANP A;  3S17 J;  3HE0 A;  3HEF A;  3Q0V A;  2O9L A;  4AC6 A;  2JK3 A;  3B6A A;  2HYJ A;  2OI8 A;  3LSJ A;  3BHQ A;  5IP6 A;  3CDL A;  3V6G A;  3ZQC A;  3BG3 A;  2DMT A;  4QSH A;  1F43 A;  5IOZ A;  3CMY A;  2GBY A;  1RKW A;  4X1E A;  3ZOB A;  1F36 A;  1TWG J;  5C44 J;  1MBG A;  5IYB J;  1SFO J;  4DYC A;  2HKU A;  3L1P A;  3RD3 A;  3HOU J;  5EZG A;  3VOK A;  1VND A;  3S2D J;  1JUS A;  2XPU A;  5C4X J;  4AYB N;  4AF5 A;  4UUS A;  1IJW C;  1JTY A;  1O4X A;  4MLO A;  4FCY A;  2E19 A;  3VVX A;  2NS7 A;  2XGD A;  2JA8 J;  1NK2 P;  2DA7 A;  1HCR A;  4FIS A;  1YRN A;  2XDN A;  2CJJ A;  1DU6 A;  1ETQ A;  4JP0 A;  5M3F J;  2R93 J;  2JA6 J;  3ZQI A;  3GTK J;  2HI3 A;  4M3G A;  2HOT A;  4A3I J;  1S7E A;  4FE7 A;  4GFL A;  3LSP A;  1YRN B;  3BR2 A;  3VIB A;  3SJM A;  1EF4 A;  3JRC A;  2ZOY A;  1WPK A;  1BW6 A;  4JYK A;  1JTX A;  4Y7N J;  5GPC A;  3VOX A;  3HGY A;  2NVQ J;  1WH7 A;  3BR5 A;  3GTP J;  2D5V A;  1LE8 A;  2R7Z J;  3BTJ A;  3GTQ J;  2O7T A;  3VUQ A;  2M9H A;  2NVY J;  5F04 A;  4ACI A;  5H9T A;  4M3E A;  4MXM A;  1GV5 A;  5J3L A;  5DS9 A;  4GCK A;  2TCT A;  1HDD C;  3RZO J;  2WGB A;  3NRG A;  3BNI A;  3HIM A;  5FKO A;  5M5X J;  3ON4 A;  4C3I J;  1VFC A;  2Y9Y A;  4B4C A;  1LFU P;  5FLM J;  5FJ8 J;  1H8A C;  3M4O J;  4D5C A;  1E3O C;  3KNW A;  2DMN A;  2HXI A;  4M3B A;  2ZCN A;  5K58 A;  3NNR A;  1ETK A;  4NEL A;  4BY7 J;  1FIA A;  2LKX A;  1WH5 A;  5IOY A;  2HYT A;  1JUP A;  2DA3 A;  3TW6 A;  1P7I A;  2RHA A;  1IC8 A;  5EDN A;  4D5F A;  3JRD A;  2COB A;  3LWJ A;  2ZOZ A;  2NS8 A;  5F0H A;  2XSD C;  3S2H J;  1K83 J;  5JLX A;  5E3L A;  2AHQ A;  5IYD J;  3H3V K;  3VVZ A;  1ZTR A;  4A3F J;  2K9Q A;  3DCF A;  4BXX J;  4ICH A;  3E7L A;  2N8G A;  2VKV A;  3G1M A;  3S1M J;  4I76 A;  4DZP A;  3BJB A;  3IV5 A;  5C4J J;  3A01 B;  3S16 J;  3TP3 A;  5M5W J;  3S1R J;  1MNM C;  3HTI A;  2EZI A;  5EFY A;  1WGX A;  2HOA A;  4JX5 A;  4A69 C;  4CYC A;  3ZQF A;  1RES A;  3JRH A;  1UI6 A;  1AKH A;  2YS9 A;  1ETV A;  1D5Y A;  2Y0S N;  5GPA A;  2OPT A;  5E3M A;  1MBJ A;  3COL A;  3VVY A;  5EEA A;  4HKU A;  1FEX A;  4B1R A;  2W53 A;  1GT0 C;  3RKQ A;  5AQC A;  3BQY A;  3MVP A;  4IHY A;  3GTL J;  2HXO A;  2MG4 A;  3HTA A;  2L7M P;  3LNQ A;  2R5Y A;  3VW1 A;  4A3G J;  4IHV A;  1GDT A;  1LFB A;  2G7S A;  2JJ7 A;  4Y52 J;  1H88 C;  3WHB A;  4FTH A;  1HLV A;  1ETX A;  1ORK A;  3I4N J;  3HTJ A;  4C3H J;  2AO9 A;  3JRG A;  3IH2 A;  1RKT A;  1H89 C;  1UMQ A;  3CQZ J;  3LJL A;  2Y31 A;  3HOW J;  1HDP A;  2QOP A;  4DZJ A;  5CXI A;  4UUT A;  4PXI A;  2I10 A;  3BTC A;  2LD5 A;  4IEJ A;  2VI6 A;  1ZQ3 P;  2R92 J;  2E2I J;  3C07 A;  4RBO A;  1NK3 P;  2K9N A;  1HOM A;  3Q0W A;  2KDZ A;  2CRG A;  1VI0 A;  3G1O A;  1JKP C;  3PO3 J;  3BG9 A;  5F1J A;  4D7N A;  2X9D A;  2YUS A;  3BTI A;  3K7A J;  2G3B A;  2L9R A;  5HBU A;  3S15 J;  4JX6 A;  3S14 J;  2GEN A;  4YZE A;  1XC5 A;  2WUI A;  2G0E A;  1PUF A;  1MSE C;  2MGQ A;  3KZ9 A;  2X6O A;  5FKL A;  2DA2 A;  3K2A A;  2L7F P;  3MN2 A;  1W0U A;  4M6V A;  2IAI A;  4A3B J;  5CW8 A;  1I6H J;  2E2H J;  2IEK A;  4C3J J;  4HNV A;  3PPB A;  5J1R A;  2JN6 A;  1PUF B;  1IDZ A;  2DJN A;  2L0K A;  3RQI A;  2M8G X;  2H1K A;  5EZH A;  2FQ4 A;  5FLV A;  2JMW A;  1U8B A;  5HOD A;  1FJL A;  4GCL A;  3HOZ J;  2G7L A;  2CUE A;  2IU5 A;  2M2E A;  1XG1 A;  4W97 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...