2ZB9A

Crystal structure of tetr family transcription regulator sco0332
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
188
structure length
188
Chain Sequence
GRRPAEEVRAEVLHAVGELLLTEGTAQLTFERVARVSGVSKTTLYKWWPSKGALALDGYFHAVEDTLAFPDTGDVRADLLAQLRAFTHVMTRTPGGRILTELIGAAQTDADLATAYRQLYSAQRRALAAERLRHARELGQIRPDVDVQVLVDQLWGAVYHRLLIPDEPVDDAFVTALVTNLLDGVCPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative transcriptional regulator
publication title Structural and functional analysis of the TetR-family transcriptional regulator SCO0332 from Streptomyces coelicolor
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Transcription
total genus 72
structure length 188
sequence length 188
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF16859 TetR_C_11 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2zb9A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2zb9A02
1MBJA 5F04A 4Y7NJ 4FCYA 3EUPA 5F27A 3G56A 3MKLA 2VPRA 4AF5A 3GZIA 2JMWA 2DMQA 5IYCJ 3G1LA 3GBGA 4GCKA 1PUFB 3VW2A 1VFCA 1B72A 1TWGJ 1CQTA 3FISA 5F0FA 1ENHA 1RKTA 3RQIA 2PZ9A 4W1UA 2HXOA 4A3MJ 3QPLA 4KWAA 4A3BJ 2ME6A 3LNQA 1JKOC 2TCTA 2YU9J 2ZCXA 4M3DA 1JT6A 2LP0A 4L5EA 3Q0VA 1AHDP 5D18A 2FQ4A 3DPJA 3JRHA 4CYCB 3GTQJ 5IOZA 4I6ZA 1IDZA 4IHXA 2ZCNA 2D5VA 2XB5A 3GTJJ 3CRJA 3S5RA 3LSRA 5FHPA 5IOYA 3RD3A 3RZDJ 3I4NJ 5EZHA 3OSFA 1ETKA 2Y0SN 2L7FP 3L1PA 2R0QC 3OIOA 2NP5A 3BNIA 3VVZA 3S2HJ 2N8GA 2OF7A 4DYCA 1MBEA 5E3MA 3Q3SA 1ETOA 4JL3A 2WB1N 3S1MJ 4D5CA 1HOMA 1ETXA 4AUXA 5HBUA 4AC6A 5K7FA 1HLVA 2QTQA 3K7AJ 3IUVA 4MXMA 2XGEA 4A3KJ 2JJ7A 1UG2A 1FIAA 2UXHA 3NNRA 3VOXA 2QF7A 3S1RJ 2B63J 4AYBN 1LE8A 4MFDA 3C2BA 3UKGA 2OPTA 1F43A 1H8AC 2FJ1A 3RZOJ 1VF9A 2WAQN 5M5XJ 2DG8A 4MLOA 3JRCA 3QQAA 5K7ZA 4QTRA 4PXIA 3O8GA 2O9LA 1JJ8C 2VKVA 2NP3A 5EYRA 1ZR4A 3BQZA 4M3GA 1U78A 4QIWN 3FRQA 2E2IJ 4FTHA 5FKLA 3CQZJ 2RASA 1H88C 2CU7A 2UXOA 3HTAA 1GVDA 4CYCA 3NAUA 2DA6A 5DAJA 3CMYA 4JX6A 3Q0UA 5C3EJ 1Z0XA 3MN2A 3F0CA 1B72B 5E3NA 3BJBA 3KZ9A 1NK2P 4JP0A 1K61A 4ICHA 1JTXA 3M3YJ 2QCOA 3HOVJ 4B3AA 4XRSG 3GTGJ 3HEFA 2DA3A 4D7NA 4MIMA 4V2FA 2V57A 3OOUA 1ORKA 3JRDA 1RKWA 3DCFA 1P7JA 2M0CA 3B6AA 2NX4A 4M3FA 4UDSA 3BR2A 1FTZA 2AHQA 2K9SA 2EQRA 1WH7A 1IGNA 4Y52J 4L62A 3JR9A 3ZQLA 1MH4A 3FIWA 1AU7A 2ELKA 3NXCA 3A01B 1T56A 2HOSA 2PMZN 2TRTA 3BTJA 3LOCA 3GTOJ 2G7GA 2GUHA 1JGGA 9ANTA 1RR7A 2R5ZB 1ETVA 3LWJA 2R5YB 1JTYA 4ME9A 3HM5A 1SFOJ 4JKZA 4BY7J 3TW6A 1X2MA 2XPUA 1D5YA 4A3GJ 3CCYA 3V78A 1FIPA 2WV1A 1GDTA 4A3LJ 4C3HJ 1W0TA 2JA7J 5BNGA 1EF4A 1HDPA 1QVUA 5D19A 5AQCA 1Y1WJ 2CUFA 3HTIA 4MK6A 2XDNA 5FMPA 1BJZA 4JX4A 4BXXJ 4A69C 4M3BA 1ZGWA 4HKUA 5M3FJ 3JRAA 2GFNA 1LE8B 3SJMA 3S17J 3I4MJ 2M34A 3ZQIA 4IHVA 4YZEA 3IH4A 1ZR2A 2OI8A 2XPWA 3T6NA 2LTPA 1UMQA 2CRGA 4A93J 2DJNA 2K9NA 2MSYA 1LFBA 2XPVA 5F08A 3IH2A 1MBKA 1RPWA 2NOGA 2FBQA 1POGA 3BG9A 3BT9A 2JWTA 1UI5A 2LY9A 3VPRA 3W6VA 4DZJA 4XK4A 1I50J 3TP0A 3BHQA 3BR1A 2XSDC 3HTHA 1APLC 2XGCA 3WHCA 1HF0A 3V6GA 3PO2J 2QWTA 3H0GJ 1F36A 1JJ6C 4GFBA 1MSEC 3ANPA 3A01A 4GCLA 4HNVA 2D6YA 1A6IA 4C3JJ 2ZB9A 4NELA 1P7IA 3NARA 3E7QA 2R5ZA 1WPKA 2GBYA 3VW0A 4DYRA 1U9NA 2R5YA 3O60A 4RDUA 2H1KA 1ZK8A 3S14J 2AO9A 2O7TA 4EEFG 2DN0A 1WI3A 2QKOA 4G12A 2EZKA 3GTMJ 5JLXA 2NVXJ 4A3IJ 2FX0A 5H9TA 3HOWJ 3S1QJ 1FJLA 1YRNA 1JKQC 4LOCA 4MO7A 1H89C 2M2EA 2X6OA 4JNNA 2LKXA 1BW6A 3G7RA 2K40A 5F1JA 1AKHB 2ZOZA 1SANA 3BR3A 1IG7A 1NTCA 2GENA 2ECCA 5E3OA 4D5FA 1A5JA 2FD5A 3HTJA 1TC3C 2LFBA 3EGQA 3JRBA 2LD5A 2GLOA 4BY1J 3RH2A 1OFCX 1TWFJ 5J3LA 2HYJA 3S16J 3NRGA 4FE4A 4ACIA 1Z77A 2IAIA 3BR5A 4C3IJ 3FK6A 4XIDA 3VOKA 3HGYA 5K7HA 5IP9J 2HOAA 1UI6A 3VUQA 2EZHA 5C4JJ 3FK7A 2YUSA 2UXIA 4M6VA 3LSPA 3LHQA 5J1UA 1ZKGA 2REKA 2HOTA 3ON2A 2LVSA 3NPIA 3PASA 1JKPC 3QPSA 5EZGA 2KT0A 5FLVA 3KKDA 5C44J 3JRIA 1W0UA 4DYQA 5CXGA 2UXPA 2ME0A 1ZTRA 1DU0A 2HDDA 3K2AA 2XRLA 2R92J 5IPAA 4RBOA 3B81A 4FISA 1QVTA 1WGXA 2G7SA 5HAWA 4FE7A 4D7MA 5GP9A 3PO3J 2EZIA 4A3CJ 2DA2A 2MG4A 4AC0A 2RAEA 4W97A 1ETQA 1AKHA 1ZQ3P 2EBIA 3H3VK 1GV5A 3TP3A 5IYBJ 1TWAJ 3B6CA 4X1EA 3SFIA 3KNWA 5CW8A 5D1RA 3JRFA 4UUTA 3GTLJ 3CJDA 1VNDA 2CQQA 1T33A 1MBFA 2CJJA 2K9QA 1U8BA 1O4XA 1E3OC 5K58A 3ANGA 3HB9A 2DMNA 2UXUA 1Y1VJ 3HGGA 3S15J 2EH3A 5C4XJ 5EGOB 3G1OA 1TWCJ 1YRNB 1VI0A 1Q1VA 5FLMJ 1JKRC 5HSZA 2ZOYA 3VVXA 2JA6J 5M5WJ 2X48A 2Q24A 3MNLA 3IH3A 4V2GA 2Y31A 4IEJA 3RKQA 4UUSA 1IRZA 5EFYA 5IP7J 1HCRA 2O8KA 2VKEA 3E7LA 2L0KA 5HODA 1DU6A 1OCTC 5EF6A 3OSGA 2YS9A 2G7LA 2DMTA 3P9TA 2VI6A 3VW1A 2VUMJ 3VVYA 1IUFA 3BTCA 1GV2A 2IU5A 3Q0WA 5EG0B 3AQTA 3WHBA 3ZOBA 2MW8A 3LSJA 2DMUA 4BBRJ 1IC8A 2WUIA 4JYKA 4C2MJ 2Y9ZA 1R9TJ 5E3LA 2EZLA 3TEDA 1MH3A 2M8GX 1JT0A 1XC5A 1MBGA 1X58A 4GFKA 5J1YA 1BW5A 4S0HB 3TW7A 1QRYA 2L7ZA 4NDLA 5DS9A 2NVQJ 1BA5A 4GCTA 1BL0A 3COLA 4A3FJ 5M3MJ 4BBSJ 2R7ZJ 3HE0A 3HIMA 1I3QJ 4CGRA 3A03A 2L9RA 2DA4A 1ETYA 3HBLA 2E2HJ 3M4OJ 2HKUA 1JUMA 3NI7A 1ETWA 5M5YJ 3PPBA 3ZQGA 5EGOA 4MFEA 3HDDA 4A3DJ 3HOXJ 1WH5A 2XB0X 3GTKJ 2I10A 3S2DJ 3ZQFA 3BQYA 4ABZA 2DA1A 2Y2ZA 5GPCA 2H8RA 2F07A 5EDNA 4B1RA 1SGMA 3CDLA 2CQXA 2PBXA 4IHWA 4DZPA 1FTTA 1S7EA 3BR6A 3GTPJ 3BCGA 1XS9A 3LJLA 1MBHA 2Y30A 3PM1A 4XRSA 2HXIA 4M3EA 2COBA 2W53A 5IP6A 4XICA 2HI3A 2O7OA 1U9OA 2YVHA 5EG0A 3BG5A 2RHAA 2WGBA 1OJLA 3ZQCA 1MSFC 1UHSA 1GT0C 1WCMJ 3G1MA 1PUFA 1B8IB 3SDGA 4DW6A 2L7MP 5FKMA 1RETA 2W48A 3HOYJ 2DMPA 4X6AJ 3F1BA 2M9HA 2NS8A 1IDYA 2G0EA 2LLKA 4J19A 2GM4A 3QKXA 4JX5A 5CXIA 5J1RA 1X2NA 3DEWA 3VP5A 1JUPA 4UUSB 1JUSA 2R93J 1ITYA 3BRUA 5EEAA 3BG3A 1QPIA 3CWRA 1NK3P 4I76A 2NS7A 5FKOA 3JREA 3VIBA 3JSJA 5FKKA 1G2HA 2E1OA 2JA5J 3HOZJ 2E2JJ 2NVYJ 2XGDA 2HQ5A 4XRMA 4IHYA 1LFUP 3O8HA 2JN6A 3IV5A 2IEKA 1HDDC 2HYTA 3QBMA 5IYDJ 5FKNA 5F0HA 1XG1A 1RESA 5DTDA 2JA8J 2NVTJ 3BR0A 3ON4A 1IJWC 5JLWA 1I6HJ 2YVEA 1IV6A 2ECBA 3BTLA 4A3JJ 2MGQA 2P81A 1TWHJ 4NN1A 4A3EJ 2LK2A 2X9DA 2ZCMA 3C07A 3MVPA 3BTIA 3HOUJ 2G3BA 1GUUA 5GPAA 3S1NJ 2E19A 1B8IA 2DA7A 2QOPA 5FJ8J 3A02A 2DTZA 5FGLA 2CUEA 3JRGA 2OERA 2DA5A 2IBDA 2JK3A 2LR8A 3KKCA 1FEXA 1K83J 3ZQHA 4B4CA 3LSGA 4GFLA 2QIBA 4BKXA 5F0CA 2KDZA 3D1NI 3HKZN 1MNMC 5C4YA 3FKIJ 1OCPA 2Y9YA 2ID3A 4QSHA 2DG7A 2ID6A 3AQSA 3GEUA
chains in the Genus database with same CATH superfamily
1MBJA 3K4MA 5F04A 4RAFA 3HRMA 4I0AA 2F6CA 3G56A 5F27A 2CG4A 3GZIA 2DFHA 2LH9A 1HKSA 3ISPA 3EUAA 4FETA 4EMSA 2NS0A 4GCKA 3CC4I 3KCCA 3VW2A 1R5ID 3DU5A 1CQTA 3VEPA 2BYVE 2RNJA 3FISA 5J4VA 1P2FA 4YG2F 3KE2A 1QNTA 4MHGA 3MZ8A 2PZ9A 1J75A 2HXOA 4U7DA 1FBSA 3AAFA 5CYVA 2DPUA 2E1MC 2EIJH 3RPUA 3QPLA 4MEXF 4L9NA 3M1EA 4PSWA 5J6XA 3TBIA 1W7PD 1WJBA 3HTUA 5CVRA 2ME6A 3LNQA 2QSGX 1FSHA 2LP0A 4L5EA 1WWXA 3L7WA 3CC2I 1YI2I 4AD9A 3CESA 2RV8A 3FBNB 2LF7A 2B9SA 3JRHA 2P6TA 1IDZA 4HPQA 1ZARA 1T6SA 1V54H 3CD6I 1U5TB 3DEUA 3LMMA 2IA1A 5KHDA 5IOYA 3LSRA 3S5RA 5L3GA 3RZDJ 4OAYA 3ZCOA 4HDUA 3I4NJ 1ZH5A 1ETKA 2STTA 1XPXA 3PNYA 2PQ8A 4DYCA 1ZREA 3Q3SA 2DYRH 4E6KG 3FXLA 5GADJ 1ONVA 2E5NA 4U88A 4BEHB 4BNCA 2PJPA 4AC6A 1EH6A 4P55A 1UFMA 1VQOI 2WADA 1G59A 2XGEA 2RQPA 3OYFA 1F5TA 4ENMA 1P92A 2F4IA 1FIAA 5GTIC 2BGCA 4ZZDA 3TGNA 2ELJA 4IPAA 2XVCA 1IW7F 4I7HA 3UKGA 2HYGD 2AXLA 4IZZA 3P5JA 3COAC 2P7CB 2ZY9A 2DG8A 3MQ0A 2VL8A 4PCQA 3JRCA 3QQAA 5DD4A 2WAFA 3GFIA 4ZTJA 1UAAA 4HF1A 4QTRA 2DOFA 5LHIA 2NP3A 2QGUA 4WWCA 5EYRA 3FMQA 3S3NA 2E2IJ 3LSMA 1YX5A 1FZPB 1H88C 2UXOA 1GVDA 2WV0A 3I53A 3K1MA 3RPUD 5A2QZ 4ESBA 4LLNA 1VQLI 3QP5A 2L9VA 4JX6A 3Q0UA 5BPIA 2GXGA 3ZN0A 5DCMA 5E3NA 2BY3A 4BDYA 4HF0A 1SD4A 4JP0A 4ICHA 5H6QA 4KT6A 2Q8KA 2LY1A 4HW0A 5ED4A 2C6YA 4B3AA 4ZDPA 1RR8C 3HEFA 1LDJA 2OCEA 4MIMA 1ORKA 3U9GA 3K70D 5HNHA 3BR2A 3DBRB 2KZVA 4I98B 2K4JA 1BIBA 2EQRA 4Y52J 2F5EA 4PZJA 2BHZA 2ELKA 3NXCA 1JGSA 3DFGA 3VYUB 1D0XA 1R7JA 3BCBA 1YJWI 3GTOJ 2G7GA 2A6EF 1JGGA 1RR7A 4EJOA 1LKXA 2D2WA 4YIFA 5EJCA 2OV7A 1IXRC 3TW6A 4EVIA 2EV5A 2MABA 4E70A 2QUFA 3VYRB 4HNUA 3F8MA 3F22A 2DFIA 4C3HJ 2JA7J 5BNGA 1EF4A 1IF1A 1QVUA 2OU2A 3CJNA 5AQCA 4XM3A 4YIIA 2XDNA 1BJZA 3PQJA 4JX4A 2IPQX 4ENNA 3L00A 1O3QA 2MA3A 1LE8B 3SJMA 2M34A 4YZEA 4I01A 1ZR2A 5JVGF 2WY7Q 3GVAA 1DPUA 1K6YA 1LFBA 3PUBA 4P5OA 2A05A 1MBKA 2NOGA 1UELB 1IN6A 2ZBKA 4KN4X 3BT9A 3RCOA 3ML6A 3VPRA 3W6VA 3EUHC 4PUSA 4CCNA 2F5CA 5D8KB 3PNTA 4WF2A 4PJNA 2E1CA 2WAEA 3VB2A 1K6OA 3WU0A 1XGMA 1JJ6C 2KHMA 1BI2A 3PIOF 1ON2A 4HNVA 4NQWA 4YIRX 4I02A 1WPKA 1ZAOA 2GBYA 3SXYA 1DQUA 4RAGA 1DGRM 3HSFA 4RDUA 2H1KA 1LB2A 1I3AA 3OS2A 1J7KA 2JVGA 2BY1A 3F21A 2O7TA 4ON0A 4OWRB 3M8EA 5ICGA 1QHHD 3LA7A 2NVXJ 3CZ6A 4N9HA 5H9TA 3HOWJ 4ZDOA 2VLAA 4B47A 2ZSIB 1P4WA 4CCJA 2W84A 1BR1A 4MO7A 1H89C 3GZNB 3BZ6A 5D4SA 2VN2A 4C2UA 1X19A 2MH9A 1HC8A 2OAZA 1NG6A 2Q0OA 2DW4A 2W57A 5F1JA 2DPDA 5FO5A 2Q2EB 4HG2A 5D4RA 1AKHB 1SANA 3KZYA 2GENA 5E3OA 3HTJA 2FD5A 3CUQB 4DQ2A 1TC3C 1YJNI 4LK0F 1K78A 2ISZA 3HYIA 3A2KA 2RGVA 3D0SA 5E79C 3CF2A 3FHNA 4FE4A 1LEAA 4F91B 3G2BA 1XX5A 2IAIA 1UB9A 3F9KA 3VOKA 1ULYA 3ABTA 3HGYA 2VQHA 2GQQA 2VQGA 2FOWA 2K3PA 2FMYA 3B73A 4LK1F 1Z3YA 1FMWA 1UI6A 1T0FC 3CF5F 2UXIA 3LSPA 4G7HF 1Z3XA 1YYVA 4GCVA 4ZDLA 3BG7A 2HOTA 2ZMEB 4KFCA 1H9TA 1Y6IA 5AIQA 2KT0A 1QZZA 1LDDA 4XNFA 3MEXA 4UUVA 3KKDA 4L9VA 2WBMA 2OZUA 2A68F 1FYMA 2UXPA 3GXOA 3I54A 2VC0A 1FP1D 1DU0A 1XN7A 2HDDA 3K2AA 1S3JA 2R92J 1J59A 3B81A 3OYKA 3FM3A 1KYZA 1ZGJA 4D7MA 4UVCA 1R1TA 3LFKA 3CJTB 2EZIA 3LSIA 4RMNA 3HTSB 1STZA 2ZNYA 3REOA 4A0YA 4BACA 3J81K 2IS2A 3EETA 2X0LA 2A5YB 4G6TB 2RAEA 1KU9A 1ETQA 4HF2A 1GV5A 3TP3A 5CW8A 3SFIA 3KNWA 3SEZA 2LSOA 3GMEA 1T33A 1D0YA 3ANGA 2ESNA 2P0WA 3HB9A 3GX4X 1PP7U 2DMNA 1XD7A 2UXUA 2W85A 2Y0SA 1YFHA 1TWCJ 1YRNB 3BC8A 2CSOA 2H09A 2J5OA 3IRRA 1QQIA 3IH3A 1FT9A 4IEJA 5B5EC 3K70C 1T39A 1DGWY 3KP3A 4ZYDA 4PJJA 4LG0B 1ZLJA 3H92A 2KIUA 4RS8A 2WWYA 1HCRA 3L9FA 4IKFA 2VKEA 4FQGA 2OZ6A 5K5OA 1DU6A 3K1PA 2YS9A 3VW1A 2F4MB 1T2KA 4DNCA 1IUFA 3VVYA 1V5EA 1PJRA 3ABKH 3ZOBA 3DF8A 4XMYA 2Y9ZA 3I56I 4M9SA 3ABMH 2EZLA 2DT7B 1XC5A 3F8NA 2BVMA 3FZVA 3TW7A 4E4HA 3ASOH 3H5AA 1ON1A 5ICCA 5DS9A 3CO6C 5LD2C 5J4YA 1JE8A 2PG4A 3OOPA 1CF7A 3CMMA 1T38A 3CMEI 3BROA 3COLA 3KETA 3EPZA 4CICA 3AKZA 4HOBA 1WVRA 4CGRA 3A03A 5HDGA 5K5QA 3NI7A 3PPBA 3AG2H 1MNDA 1K4TA 2FU4A 3IAM2 4RB2C 1SC7A 4HX7A 3HDDA 5DEQA 2DO7A 4RB0A 4BHCA 2CWEA 1SD5A 5L3CA 3PIPF 2V1UA 2XB0X 5FD6A 3HRTA 3OS0A 3AL0B 4EJTA 4ABZA 2Y2ZA 4B44A 1HA8A 3E6BA 2CQ7A 2H8RA 2F07A 2M8EA 2VT2A 2DOAA 3V7SA 3CDLA 3WG9A 1XGSA 4OMZA 4DZPA 3E6CC 1FTTA 2HZTA 3BR6A 1LDKB 5H2FC 4GXOA 1QPMA 3ZN1A 3IWZA 4HQMA 3LJLA 3CMAI 2Y30A 4KISA 4RLFA 2WY8Q 4NNJA 5D6FA 4XICA 2GIVA 2X1DA 3OIQA 1UHSA 1GT0C 4OIPF 4YFXF 1WCMJ 3E0JB 5TJJA 1B8IB 3SDGA 5FKMA 2XRNA 4L18B 4X6AJ 5HDNA 3HXLA 1EA3A 3F1BA 3SYTA 2B3WA 2KKOA 4ESFA 2LLKA 5CXIA 2M7AA 3VOEA 3W2VA 2V7FA 1D8KA 2BOLA 4Y33A 3K4JA 2CQNA 1JUSA 4ZYHA 1VQMI 1TL8A 4PK4A 5GAEJ 4BS9A 2HU9A 3BG3A 3HPHA 2QSFX 2R7OA 3NEUA 3PUFA 1H0MA 1SVOA 1NK3P 4XN0A 5FKOA 1MMSA 3K6GA 1FOWA 1R22A 5D5XB 5FKKA 1G2HA 2L4MA 2EIKH 2IP2A 2NVYJ 1WJEA 2HQ5A 1SAUA 2QLZA 3C2HA 2CMPA 2ZFWA 1T8IA 1REPC 4RGUA 1KA8A 1MMAA 1Z05A 3DTEA 2XF6A 3JAMK 1LQ1A 4HEA2 4NB5A 3WTYC 2IS6A 5JLWA 1RRJA 3LSKA 2MGQA 1YIOA 1TWHJ 4IHTA 5HS9A 1RI7A 4A3EJ 2E7XA 3C07A 3BTIA 1K79A 2R7DA 1GUUA 3AG4H 2L5QA 2E19A 2UXNA 2DA7A 4XSXF 5GPAA 2QOPA 1WI9A 4QPQA 2FEZA 1XMKA 3K4LA 2CUEA 1D1AA 4HLYA 1KU7A 3V8KA 4BKXA 5F0CA 5C4YA 1WSUA 3HG9A 4M9XA 1IRGA 1OCPA 5LLQA 2XAHA 2DG7A 2L01A 4XKBA 3PFYA 4P9UA 2NAZA 1PP8F 2PEXA 3OYLA 2HVRA 1OKRA 4FCYA 3EUPA 1P4AA 1UHMA 2VPRA 3VTIA 3ZMDA 2NNNA 1AOYA 3G1LA 4NC8A 3N97A 3QU6A 2YX4A 5CKTA 1PUFB 1N78A 3ZMSA 2EV0A 3WTZA 2HS5A 1ENHA 2DK5A 4XRFA 2EINH 1VQ4I 5CPRB 2H27A 1X3ZB 4A3MJ 1YIJI 2MFZA 3U21A 2EFNA 2TCTA 2X6WA 1AHDP 4J01A 4E7LA 5D18A 1DP7P 3DPJA 4BDZA 5J40A 5IOZA 1ERDA 5LHHA 4RGXA 4IHXA 1WZ2A 5E1WA 1A31A 2XB5A 2G7UA 2DQLA 3CLOA 3RD3A 2ICWG 3R61A 3G71I 1GHCA 5FLXZ 3WODF 4U87A 2YR2A 1MJ9A 1JXSA 2Y0SN 2R0QC 5DV5A 4ZYGA 1QZEA 1XDSA 1MBEA 2K7LA 2R4GA 3LL7A 2ESHA 1R23A 5HLHA 4JL3A 2WB1N 4G9YA 2QZ8A 3HSRA 5JHUA 1ETXA 3EUHA 5LFAA 1HLVA 3H36A 2K27A 3K7AJ 4N4NB 4GYIA 2JJ7A 3K1NA 3UNGC 2QF7A 1ZN2A 3BOQA 2ZKZA 3OYEA 3C2BA 4UVBA 4XOTA 4ESJA 2D45A 1YJ9I 1DPRA 1BC8C 1CGPA 2FJ1A 4L9TA 1VF9A 2M4GA 3QOEA 3QAHA 1YS7A 2JTVA 1K4SA 5LBQA 3WTWC 4DVYP 4AM3A 4PXIA 3O8GA 2O9LA 1B59A 2IJLA 2ZXIA 4M3GA 4G7OF 4CSWA 2X51A 5FKLA 3CDHA 3CQZJ 3OYNA 2CU7A 3SHFA 3HTAA 4F92B 1XSDA 2FSWA 3PJRA 2DA6A 2A07F 5DAJA 4F93B 3L2RA 1J2XA 1Z0XA 3K10A 3C7JA 1B72B 3R0AA 5BS6A 3BJBA 4XSZF 2R7UA 2CV0A 4QPOA 2ZXHA 3M3YJ 3V8LA 3MKZA 2WA0A 2V6CA 2PFVA 4D7NA 2V57A 4Z6YA 3JRDA 1U6GA 3B6AA 1P7JA 2M0CA 3BG6A 1YX3A 4M3FA 4XLAA 2AHQA 4Y4RA 1I5ZA 3N4MA 1XTAA 1WH7A 2NYXA 2FBHA 2A2FX 2PBIA 3ZQLA 1MH4A 3FIWA 1AU7A 1T56A 1TW2A 1SAXA 1ZRFA 3BTJA 2LC2A 4NQWB 1G3TA 4LD5A 2XC7A 1BR2A 1ETVA 4IF4A 3SZGA 4BY7J 4MGRA 3RSNA 1X2MA 2XPUA 3CCLI 4OD4A 1VQ9I 1B1BA 4A3GJ 3OYIA 3TO7A 4BHPA 3TO6A 4BQQA 5FROA 2KLOA 3OIPA 5LRRA 3P9KA 4PGGA 5D19A 2IGKA 1OLTA 2A3SA 2CUFA 2W25A 3HTIA 4MK6A 4Y15A 3OL4A 2VOOA 5FMPA 3S3MA 4UB8C 1Z6RA 3S2WA 2W82A 1ZG3A 4A69C 2NNYA 1FSEA 2GFNA 3S17J 3P9IA 4C9YA 1TT5B 1KQ8A 3ZQIA 4BUPA 4EM0B 3HOSA 1BJAA 3T8TA 1R00A 1BI3A 4JOMA 5KK1A 4A93J 4B8XA 4XR6A 2Y0MA 2K9NA 4BU2A 5F08A 3CJRB 3RI4A 3S32A 1JHHA 1IV8A 1POGA 4TV7A 1UI5A 3CC7I 1K78B 2EWNA 5DUKA 3TP0A 3L09A 2VKHA 3BHQA 3VSKA 3PSFA 3OR1C 3BR1A 5DUIA 3FXKA 2CGPA 2V1DA 1O7FA 2ZJRF 2IS1A 3JTHA 1HF0A 1C0WA 2GOMA 2IA0A 3KYLA 1WJFA 3F23A 3H0GJ 5E8GA 2K9MA 4S05A 2HFHA 1MSEC 4GFBA 3I58A 2PX9A 3A01A 3ANPA 2GA2A 3C3WA 3VFZA 4GCLA 2ZB9A 3NARA 2R5ZA 2E5ZA 3VW0A 1G6NA 1MMDA 3GW2A 2AXTC 4NUBA 3J80Z 1RUNA 3S14J 1LVKA 2A61A 2QKOA 3A0BC 5JLXA 4UB6C 1SVMA 2BHYA 3QRFF 2V6EA 4UXNA 2FBIA 2GA1A 2L4AA 2QQ9A 1A04A 1ZG5A 3KP6A 2BV6A 2M2EA 2QVOA 3FX3A 2LKSA 2M5WA 1FMVA 2LKXA 3LSTA 3R60A 3CDIA 1BW6A 2FBKA 3G7RA 1FPQA 2K40A 2P5LC 2R7XA 4IRIA 3J7YJ 1B9MA 1XGNA 1IG7A 2R7RA 5L3EA 1NTCA 2PI0A 2Y48A 2ECCA 5HDKA 2ETHA 1P4XA 2BVLA 2LFBA 2JSPA 2K5CA 2FE3A 4BY1J 2Y69H 3ZMUA 3RYPA 3NRGA 4ACIA 3BR5A 4C3IJ 2CFXA 2OJED 4CCMA 5K7HA 4BJTA 2K85A 4XLEA 3BY6A 3VUQA 2EZHA 2K02A 3PNVA 1W5CC 3FK7A 2YUSA 4I0BA 1KYWA 4ZC3A 4CZCA 3OYMA 5J1UA 2REKA 4Z2YA 3ON2A 2LVSA 5E20A 4II3A 3NPIA 3PASA 2UUZA 4ITVA 5EZGA 3DKXA 2OD5A 5FGMA 4OIRF 2HQRA 3CUOA 5C44J 2JUGA 1W0UA 1FYKA 1T95A 3NRVA 1I27A 1AWCA 1ZTRA 3F3XA 2R7TA 2X6XA 2XRLA 2L54A 3DXJF 4RBOA 3HIFA 2O61A 1Z7LA 1QVTA 1XMXA 3ZMZA 1LUJB 4FE7A 4A3DJ 3OYGA 1B4AA 3H0DA 2O0YA 3WGGA 4A3CJ 2IXSA 2MG4A 2ZMEC 3V42A 5KCMA 1Z9CA 1CF7B 4M73A 5F1RA 5D1RA 3EYIA 4FT8A 2VODA 1X1BA 4UUTA 3CJDA 2CQQA 1RZ4A 2CJJA 5B3SH 1E3OC 5K58A 4XLFA 4R8HA 4RAYA 5F6FA 4S04A 4E7HA 3HGGA 3S15J 2EH3A 4AIHA 5JFRA 4IL6C 2XUBA 4QWQA 1R58A 5FLMJ 1R5HA 3VVXA 2JA6J 5M5WJ 4EGZA 1IXCA 4ZH4F 5K5RA 4E7ZA 1GXPA 1HXDA 3V7RA 4RB3C 3RKQA 2QKMB 4GYGA 5B1AH 5K1YA 3BZCA 2XAUA 1OISA 5EFYA 2H6BA 1KONA 1W5TA 2KISA 4G6QA 2CW0F 4KIFA 2O8KA 3E7LA 2EJRA 2UZKA 5EEGA 3MZHA 2HEOA 5HODA 2XAQA 4RLQA 1OCTC 5EF6A 3P9TA 2X1EA 2VI6A 4G8XA 3H1CA 4Q47A 1FLIA 3BTCA 1GV2A 5KAFC 1I1SA 5CJ9A 3WHBA 3AQTA 4BBRJ 2DMUA 2DOEA 1BC7C 4JYKA 1MH3A 2O8XA 1JT0A 2UWMA 1BOBA 4M9ZA 4CCLA 1V55H 2HQAA 1EV7A 3K69A 4S0HB 2HWVA 2IGMA 4NDLA 4CDGA 2PJRA 4U9NA 2NVQJ 4ZZLA 1IN4A 3TMOA 1BA5A 4GCTA 1O3RA 2W00A 1EH8A 1XGOA 2LNBA 2R3SA 4WXCA 1UJ8A 2R7ZJ 4BQOA 3SZTA 3M4OJ 1N25A 1ETWA 2X1CA 1FOXA 3ZQGA 2H6CA 5EGOA 3BP8A 2NOJB 5FD5A 3QYBA 3SZPA 3V4GA 3S2DJ 2RC4A 4AIDA 3IP4B 2DA1A 3QWLA 5JI6A 1TNSA 4LITA 4IOAF 1Y0UA 4B1RA 1SGMA 3HHHA 2PBXA 1X3UA 4RAZA 1WJ5A 4BHBA 1VQKI 4EJUA 3DLAA 1FOKA 3BCGA 2PMZA 2CV1A 4XRSA 1FBQA 2DTRA 1T08B 5D6EA 4BYYA 4N9IA 2COBA 2HR3A 3WTVC 2HI3A 2E35A 1U9OA 2O7OA 4A5MA 1TBXA 3BG5A 3AL0C 2WGBA 4FASD 4PSXA 4R79A 4A0ZA 1TT0A 1IXSB 2KRCA 5E1ZB 2L7MP 5ILSA 1RETA 3WE2A 1UZCA 1YQAA 4BE0A 3HOYJ 5BMZA 1E17A 2IT0A 1IDYA 1MZBA 4HQEA 2GM4A 4J19A 3ROUA 2RREA 4UUSB 2STWA 4FHTA 3KFWX 4KICA 1D3YA 1HQCA 3CCMI 1QPIA 1XSXA 4IRVA 3OYJA 2ELHA 2PMUA 3KPHA 1YOVB 2VQLA 3JREA 1IN5A 1R36A 4M72A 3JSJA 4BL0B 1B9NA 2QWWA 2E2JJ 1VQNI 3HHGA 3PL8A 4ZYEA 2XGDA 1Z91A 2KZGA 1Y39A 1SFEA 1LFUP 2HYTA 4XBFA 1BIAA 2EA4A 5F0HA 2RDPA 3GEZA 3DV8A 5DTDA 2EFOA 1ACIA 2NVTJ 4G94A 3T8RA 3BR0A 3KZZA 3H9QA 4BEHA 1IJWC 2ECBA 4XQFA 2OBPA 2P81A 3ZMVA 1FP2A 3HJEA 2QSHX 4BE2A 3M9AA 4BQAA 3PFIA 2R7SA 2LK2A 5LHGA 2VE8A 4DIQA 2BW3A 3L2VA 3HOUJ 4Q48A 3DBHB 1SMYF 4KIGA 3S1NJ 3LQQA 1DUXC 2WB1A 1HBXG 3JRGA 2OERA 2DA5A 2LR8A 4XN3A 4B4CA 1PYVA 3JSOA 3CTAA 1FOYA 4L5IA 1F1ZA 3FKIJ 4IRGA 2ZJ2A 2VJIA 3X2QH 2ID6A 2DODA 1ZGAA 5IY5H 3AQSA 2V4JC 3FXMA 3GEUA 1X4PA 4YEJA 5ICFA 3F8CA 4Y7NJ 3DP7A 2KIMA 2KP6A 1IN7A 3I71A 2LYCA 3MKLA 1G3YA 1BN5A 3AG1H 2JMWA 2DMQA 5B1BH 4HZFA 1VQ6I 3GBGA 4KMFA 2K9LA 5GTHC 2XGXA 1VFCA 3MKWB 2FOKA 2YPRA 5F0FA 3I0TA 1OCZH 1RKTA 2M4KA 4XL9A 3W3CA 2W24A 2CUJA 2JSCA 4W1UA 3IL2A 4ETSA 2P7VB 3KYDB 4XONA 4GDFA 3ZMTA 4A3BJ 1MKMA 2XIGA 1NHAA 2JPBA 5E8IA 4EJWA 1Y8RB 3F8BA 2YU9J 1JT6A 5H20A 3IWFA 3FXUA 5DM6F 3H9GA 5E1XA 5CVIA 4B3XA 3GTQJ 4I6ZA 3MAJA 3GCMA 3Q5FA 2ZCNA 3CJQB 3QYFA 4HSRA 5DCFA 3GLXA 2D5VA 3JSPA 2CYYA 5FB2A 1YITI 2D1VA 1W7PB 3JW4A 3CCRI 1JHFA 3KEOA 3H3ZA 4AIKA 2LMDA 3OSFA 2QENA 2NP5A 3VVZA 3HC7A 3OIOA 4C2MA 4EM2A 3S2HJ 2N8GA 2OF7A 3HUGB 1W4MA 5E3MA 1ZRDA 4O6JA 5KAIC 2PFBA 2FJI1 3S1MJ 1XB4A 3HZJA 4UVAA 5HBUA 4NBQA 2MD0A 3M07A 2AQEA 1MNEA 4A12A 4A3KJ 1E2XA 1UG2A 1XMAA 3IHUA 2VXZA 5JHFA 1LE8A 3P7NA 4MFDA 5LEKA 3CO7C 3CCSI 2OUMA 2MLKA 2OPTA 2P6SA 1BI1A 4ASNA 1JI8A 5M5XJ 3G6EI 2VT3A 4LB6B 3DPLC 4EJVA 1PUEE 1R4NB 4E7IA 4MLOA 2P5KA 4WIBA 5TISC 1JJ8C 1ZR4A 1U78A 5CQEA 3FRQA 2KJBA 5BOXA 2JQ7A 3LA2A 3QP6A 4LIUA 2RASA 4E7JA 4C2TA 4JBAA 4CYCA 2P8TA 4A6DA 2M0MA 5IT3A 1R5GA 2BE5F 1YW7A 4LIVA 2HPMA 1D8JA 5C3EJ 2DLLA 3MN2A 3IUOA 3F0CA 1WJAA 1S7AA 2M45A 3R6SA 3KZ9A 3AG3H 2WTEA 4KT5C 3LAJA 2M30A 3OYHA 1YG2A 3O2PE 3E6DA 5EEHA 5TGTA 3MFKA 2LBFA 2IA2A 3GTGJ 2DA3A 2O6GE 3BPVA 1U0JA 3I4PA 1FTZA 2K9SA 4U0VA 3QODA 3DTIA 4HRIA 3CLQA 3CP2A 4L62A 3OY9A 2QQBA 3A01B 2HYFA 2PMZN 4BJ6C 2HKXA 4IQJA 2HDWA 2UV1A 2R5ZB 2K86A 1JTYA 1P9QC 2JZYA 3WU2C 3HM5A 4LB5A 1SFOJ 3BCAA 4JKZA 1FY7A 1KU3A 4L9JA 2LG4A 4YELA 3CCYA 1FIPA 3K9TA 3W2WA 1P6RA 4E7SA 5E17F 2DFEA 1RUOA 1GDTA 4A3LJ 3GZ6A 1D0ZA 1W0TA 4MTEA 2DQRA 3K8PC 4KJZA 1TTYA 1WFXA 3ZGKA 1U3EM 2VBWA 4HKUA 3JRAA 4CO8A 3I4MJ 3KZIC 5KNLA 3GF2A 4IHVA 3T6NA 3IH4A 2OI8A 5DDGA 2Z16A 1S8NA 2KQRA 2ZFUA 1WKMA 2ZMEA 2CRGA 3GYHX 2DJNA 1OR7C 2XPVA 3FDYA 3M1CA 3DBLB 3IH2A 4RGSA 1RPWA 1VQ5I 2FBQA 1MW7A 4X0GA 4CYDA 1OCCH 2LY9A 3VYSB 4L0ZB 4KUMA 2JA2A 3D5SC 4M6XA 4O3MA 3HTHA 1O3SA 1E3HA 1APLC 2XGCA 4FX4A 3O3KA 1G3SA 4PDKA 2QWTA 1IRFA 1VQ7I 3GZ5A 3S8PA 3T0YA 2QBYA 4DGWB 4C3JJ 2LREA 4IOCF 2D6YA 5DCMB 4A0XA 2EFQA 5L3BA 3E7QA 1TQPA 4HA8A 3RQ4A 2H8WA 1U9NA 4KMUX 4DYRA 2R5YA 1I6XA 1IAWA 1USSA 3DEEA 3D5LA 2DI3A 4EEFG 2DN0A 4G12A 2EZKA 2RKHA 2FX0A 2IVMA 3I5UA 1Z7UA 1FJLA 1YRNA 4IQ4A 1JKQC 4BAYA 1U5TC 4JNNA 3VYTB 4XOPA 4H0EA 1YW8A 1KGSA 2FMLA 2M7BA 5LRSA 1AA7A 4O5VA 2FXAA 1X3WB 2OCCH 5FFZA 4Y3OA 4F55A 2YX7A 2RNGA 4LG0A 4G7ZF 1RNLA 1KZHA 2E1NA 2GWRA 2KIFA 4D5FA 2VPLA 2LOOA 3EGQA 5D5VB 2XHKA 2LD5A 3RH2A 1OFCX 1TWFJ 3DWLE 5J3LA 3WTTC 3VWBA 1VZ0A 2HYJA 5IT9Z 1Z77A 4YFKF 3FK6A 4XIDA 4XLPF 1XCVA 1YW9A 2HOAA 5KVRA 3DQVC 2V1XA 1NH3A 2CO5A 3FXRA 4M6VA 2IGNA 2JUCA 1ZKGA 1SEUA 3H3UA 1ZRCA 3WTUC 1JKPC 2LF8A 4CZZA 2L9SA 3BLYA 3JRIA 4MTDA 4Y17A 1LPQA 2VQCA 5CXGA 2O5RA 2VJJA 1D1BA 5IPAA 2DXIA 5A2QK 4FISA 3PO3J 2CUZA 2CH0A 1E3PA 1O7LA 1J9IA 4JQFA 2GZWA 1T0FA 2R7FA 3GFJA 2JRMA 4AC0A 2OTJI 1TLHB 2PJRB 1MMNA 1EJ9A 5AIPA 2EBIA 3H3VK 3CCQI 1TWAJ 3B6CA 4X1EA 2DT6A 3SFZA 1V3FA 1VNDA 3A4CA 3CP8A 1MBFA 4ZTFA 3MCZA 4II2A 3OV8A 1YO5C 1BOAA 4HYEA 5GAHJ 3WE3A 5DD8A 5ICEA 1J09A 5EGOB 2KJCA 3TOBA 3G1OA 3M8FA 2QYOA 5D8LB 1VI0A 1Q1VA 2FF4A 3WG7H 3CCUI 1JKRC 5HSZA 3SQNA 1SMTA 5D5UB 2X48A 3MNLA 4XKWA 4V2GA 3KLOA 3MMYB 4DJAA 2ZNZA 2H1LA 2HVSA 1W5SA 3LA3A 3VDXA 2PMHA 2RVCA 2DDAA 4AYBA 1E0EA 1XCBA 3HL2A 2L0KA 2QQ8A 3OSGA 1BI0A 2DMTA 2WAQA 1Y56A 3FBIB 5D5WB 3Q0WA 1VQ8I 1QA6A 4OAZA 1W36C 2MW8A 2O3FA 1S5LC 2WUIA 3M7GA 4C2MJ 3S3OA 1R9TJ 5E3LA 2M8GX 2V9PA 1WQ2A 2EFWA 3V8JA 1MBGA 1X58A 4GFKA 2MD5A 5HS7A 1QRYA 2VB6A 3V7CA 3BJAA 4PJLA 5J47A 3HSEA 4KA4A 3BWGA 1R1VA 2D1HA 1EH7A 3J7AO 2OQGA 1BL0A 1MJBA 4A3FJ 4A2UA 2Z2SB 4CHUA 5CLSA 3DKYA 3HIMA 3HE0A 2E36A 1ETYA 2DA4A 3HBLA 2E2HJ 2HQNA 1A35A 3GUDA 2XROA 4OIQF 2MH2A 3HOXJ 1WH5A 2ACJA 3ZQFA 1Z6TA 3I59A 1FYLA 2XKOA 1IO2A 1QHGA 2ZXWH 5EDNA 1Z67A 2PLYA 2MC4A 3E3VA 2CQXA 2JVHA 1QZYA 3F72A 3R4KA 4IHWA 3ABUA 1OCOH 2EFPA 1I39A 1MBHA 3PM1A 2KFDA 2XAJA 1OCRH 1U8RA 2HXIA 4M3EA 1MGTA 4UHTA 1X1CA 2MLGA 5H6RA 2W53A 2YVHA 3DLLF 5EG0A 2RHAA 4ZYAA 1TQMA 2QM3A 2BW3B 1OJLA 2W4SA 4RB1A 4HNTA 2QEXI 3C1DA 5CVVA 1PUFA 2KRFA 1L3LA 2W48A 2DMPA 5HLTA 2M9HA 3M8JA 4AVPA 2V9VA 2G0EA 3HRUA 3E1SA 4OMYA 2LKPA 1GLNA 3DEWA 1KQ9A 1X2NA 2K4BA 4D0PA 1IZ1A 4KITB 3FHZA 3CUQC 3R0JA 1R49A 2R93J 1ITYA 2CV2A 4IX7A 2YVXA 3BRUA 5EEAA 2FA5A 3MZYA 5HVQC 1OPCA 4KNYA 3CWRA 4I76A 3ZXSA 4Q5SF 2NS7A 3VIBA 1MDMA 4A6EA 5E18F 3HPGA 1LNWA 2E1OA 4OOIA 2G7HA 2JA5J 3HOZJ 4D9JA 5FFXA 4XRMA 2AQFA 4OIOF 2JN6A 2Q1ZB 3IV5A 2IEKA 1O3TA 3QBMA 5IYDJ 3DKWA 4XLCA 1HSTA 3DU6A 1OMIA 3ABLH 4P1WA 2F5VA 2ZC2A 3WGIA 3ON4A 1USTA 1I6HJ 1IV6A 3KP4A 1WHUA 1F4KA 5FRNA 4N4OB 4P9FA 2ZCMA 3QU3A 2L9NA 6PAXA 3KEYA 4KDPA 2W7NA 3A02A 2TDXA 2DTZA 4OINF 3KP7A 4B09A 4MQVA 4ENKA 3ONQA 3ZQHA 4GFLA 2QIBA 2IGOA 3ZR8X 3PSIA 1MNMC 3ZPLA 4E7KA 2IS4A 2Y9YA 2A5WA 2ID3A 4KIBA 2E1MB 2X6YA 5HAWA 4CGZA 3NWTA 4DBRA 4WCGA 3K0LA 2VC1A 3QYEA 4RGRA 3U1KA 3MWMA 1OYWA 2V26A 3G73A 1PDNC 2QKLB 1ZHFA 1NG7A 4AF5A 2MBFA 5IYCJ 3H5RA 1X1AA 1B72A 3J7ZI 2Z9OA 1TWGJ 4Y13A 5F64A 2UXXA 4XLNF 3OYDA 4F52A 3RQIA 4BXFA 1QO0D 4M74A 3A0HC 2H94A 1G8XA 4L0YB 4U9LA 3BZKA 4KWAA 4EM1A 1FC3A 2E71A 4MEYF 1JKOC 2YU3A 3E5QA 2KRHA 3B02A 2JPCA 3VODA 2L3DA 4M3DA 3TQNA 2ZCXA 2M87A 3Q0VA 4CA0A 3K4CA 2FQ4A 4L5JA 1G3WA 1TQIA 3QOPA 4CYCB 2XAGA 1M1EB 4GRIA 4C30A 1MD0A 3FMRA 1S6LA 2PN6A 1PVEA 3GTJJ 3CRJA 5FHPA 4AU7A 3TKYA 2CFOA 5EZHA 2XF7A 4XKCA 2L7FP 3L1PA 1W1WE 3BNIA 3EQLF 2BXYA 1OR7A 3RKWA 3RKYA 4LMYA 3KYCB 2LBFB 1ETOA 4A5NA 3TL4X 2VJ4A 5BQTA 5JVTA 4D5CA 3SDBA 1ODDA 2W1OA 4AUXA 4HX8A 1HOMA 5K7FA 2QTQA 4EGYA 1VTNC 3IUVA 1HW1A 2I8DA 4MXMA 5CQGA 4HLXA 2HKOA 2HGCA 3GO5A 2UXHA 3NNRA 3VOXA 3S1RJ 2B63J 3IKVA 4AYBN 1TP4A 3PQKA 2BY0A 1J0RA 4I09A 1YE9A 3CCEI 2ADUA 1SFXA 1F43A 1H8AC 1Z1DA 3RZOJ 2WAQN 3S93A 4G6DA 3FF5A 5DYMA 2O03A 1HW5A 4DOZA 5K7ZA 3IKTA 4IJAA 1HKQA 2G9WA 2VKVA 3BQZA 1J5YA 4QIWN 4GO1A 2GOXB 4FTHA 3LSHA 1D5VA 2OQRA 5ILVA 3I64A 2BXZA 1YS6A 3NAUA 1SD6A 5CVUA 4NC6A 1U2WA 3CMYA 2IW5A 3L2WA 1U5TA 1FNNA 2YSRA 1R1UA 2JRTA 3U1DA 1NK2P 4F7ZA 1RIOH 1SVLA 3CCVI 1K61A 3K2ZA 3ERMA 1JTXA 2FQ3A 4UY8I 2QCOA 2GXAA 4YFNF 3HOVJ 1MIJA 4XRSG 5JR3A 1MMGA 3LQRA 4V2FA 1WRJA 3OOUA 1V5GA 4PFOA 1RKWA 3DCFA 3H35A 3LFUA 3D5RC 4IVNA 4AIJA 2NX4A 4UDSA 1HSJA 3RKXA 1FX7A 3OYAA 2CW8A 4LLGF 1IGNA 2DYSH 3FXJA 3JR9A 2P5VA 2E60A 2VBZA 5L3DA 4XORA 2HOSA 1XDUA 2QBYB 2TRTA 3LOCA 4LG3A 2GUHA 2OC6A 1Z21A 9ANTA 3LWJA 4M6YA 4BXUA 2HTSA 3ZP5A 2R5YB 4ME9A 1ZG1A 4HV5A 2F48A 1D5YA 3V78A 2WV1A 3ELKA 1DP3A 2DJIA 4RM2A 1HDPA 2VKDA 1Y1WJ 1TW3A 3BPXA 1K7AA 2B0LA 4IRHA 4BXXJ 4M3BA 1ZGWA 5M3FJ 1YTYA 3GFLA 1BM9A 2ZJQF 3KLNA 3F6OA 3VSLA 1YHQI 2LDUA 2XPWA 1LEBA 1I1GA 3F8FA 1UG0A 2X85A 2B7EA 2VXDA 1UMQA 2LTPA 2Z5UA 3Q9SA 3TO9A 4CXFA 5DM7F 1ZLKA 2MSYA 2AS5F 3GWZA 2ZO4A 3E97A 2HZDA 3BG9A 1IRXA 2BZTA 2JWTA 4DZJA 2R7WA 4XK4A 1I50J 1DDNA 5FRMA 1R6RA 3TDUC 2XSDC 3K4NA 3WHCA 3V6GA 3PO2J 2KPMA 2V9KA 5HLGA 1XSVA 3U2RA 1F36A 2NRAC 2GXBA 1RC9A 3OWTA 2HNHA 2MC3A 1ZYRF 1A6IA 3KIOA 3ECOA 4F3QA 4I99C 3HOTA 4UNOA 4GGGA 4NELA 1P7IA 4HV6A 3O60A 2BEOA 2F5FA 2J5PA 1ZK8A 5LEJA 4PJ0C 2AO9A 1OYYA 1WJCA 1WI3A 4U0YA 3GTMJ 4CUGA 4A3IJ 4EATA 3S1QJ 4LOCA 3RDIA 4EQQA 2X6OA 4CCKA 4NC7A 4HAMA 1KU2A 4PFPA 5HNFA 2A6HF 3W2AA 5FLXK 1D1CA 3OYCA 3L2QA 3JCUC 1LFPA 2ZOZA 4U0WA 3IAS2 3BR3A 3WGHA 3OYBA 1A5JA 3TOAA 2NXNB 5J8FA 4H4KC 3JRBA 2GLOA 2HDCA 5BPDA 2VBXA 2VIXA 3OR2C 4M71A 1UHWA 2KMUA 3G4SI 3S16J 4B48A 3FWEA 3H5NA 3TDZC 3EYYA 3HKZA 5IP9J 4UV9A 4HDVA 3MD2A 3DTKA 5C4JJ 3C2GA 4RM3A 3LHQA 2V1NA 3T1BA 1GVJA 2HOEA 4BQNA 2HVQA 3CCJI 2JT1A 2XDVA 3J81Z 2CS3A 2XASA 3RJPA 3KX2A 3A1YA 3QPSA 5LGNA 2HPIA 4R1HA 5FLVA 2EPFA 4V19K 2L2OA 1SD7A 2DK8A 1A6QA 3WTSC 1FWZA 4DYQA 3RIRA 2RN7A 2ME0A 5IT9K 2KL4A 2FNAA 1VQPI 1WGXA 2G7SA 2EIMH 2DDBA 2ZJPF 5GP9A 5J8CA 3AFHA 2VOPA 1MJAA 3BJOA 3NS4A 3EDPA 2DU9A 2ISYA 4KN7X 1F9NA 3QPTA 4BGDA 4WK8F 2DA2A 2IRFG 3T5XA 1S7OA 4W97A 3ECHA 2A6TA 3JTGA 2RQQA 2Q2EA 1AKHA 1ZQ3P 2KDOA 4MNUA 1W36D 5IYBJ 3WU1B 4CH7A 3CUQA 3JRFA 3GTLJ 3SEQA 2K9QA 1O4XA 2F2EA 1U8BA 3J7AY 4J00A 3GLLA 3W6JB 2VE9A 5HOOA 2CQKA 2WC2A 1Y1VJ 2L7KA 5C4XJ 2ZCWA 4OD5A 3K4KA 4D1QA 2A69F 2E34A 3E6MA 3KEQA 1S29A 2MYSA 4K2EA 2ZOYA 3E5UA 4BE1A 3I59B 1QBJA 1S72I 2Q24A 2Y31A 3WTXC 3MKYB 4KYWA 2B1EA 4I2OA 4UUSA 3ZQ7A 2Z33A 1BBYA 1V5FA 1IRZA 2GAUA 3FMSA 4IHSA 5IP7J 3N05A 4DBQA 4ANJA 2LY2A 3EUKL 2Z3YA 2G7LA 1T98A 2VUMJ 3P9CA 3DPTA 4LLLA 2IU5A 4U7BA 5EG0B 2QA4I 3FKJA 1IUYA 3LSJA 5ILUA 3HRSA 4NHJA 1IC8A 3E5XA 1EKEA 1QU3A 4MQ9F 3TEDA 1N75A 1Y8QB 1IN8A 1ZELA 5J1YA 1BW5A 1X1DA 2BY2A 1Q1HA 2DCEA 2L7ZA 2XF5A 3ERED 4OU0A 1S9HA 3H9JA 1TNTA 2F4OB 3F6VA 5AONA 5M3MJ 4BBSJ 1I3QJ 5HS8A 2L9RA 5L3FA 2HKUA 3Q9VA 2GIZA 1JUMA 5M5YJ 1TZLA 1OYIA 5ERIA 1N77A 1MDMB 3FXQA 3BJ6A 4WX9A 4UV8A 2EILH 4MFEA 1HW2A 1LVAA 2VONA 3GTKJ 2I10A 4QLCU 3BQYA 1B6AA 2FNPA 3OMYA 5GPCA 4HSTA 3LAPA 2Y75A 1L0OC 4PJMA 3UR3C 2XV4S 3QPHA 1S7EA 3GFMA 3J80K 3GTPJ 1R4MB 2K3FA 1XS9A 4Q4ZF 4XKVA 4WXHA 3NQOA 1G4DA 2OA4A 4HBLA 5IP6A 3ASNH 3RPQA 2OTLI 1MSFC 1LJ9A 2DBBA 3ZQCA 4HX4A 1H9GA 4AVZA 3G1MA 3OS1A 3I55I 4DW6A 4BJ5C 3ZQQA 2NS8A 2P4WA 2DFFA 2XAFA 4RA2A 3QKXA 4JX5A 4P96A 5J1RA 2X4HA 1FBUA 3ESWB 2I5UA 5GAGJ 3VP5A 1JUPA 3IRQA 1BR4A 2ZXJA 4B43A 3JAMZ 2EV6A 1V4RA 2E7WA 3SWHA 2HTJA 1UCRA 3RYRA 2VJ5A 5LGTA 2COMA 3OL3A 4WXDA 1SFKA 4AWXB 3L2CA 1HKTA 2R7VA 2FRHA 3LWFA 2CW7A 2EB7A 2Z1DA 3O6BB 4FX0A 3I9V2 4LFUA 5HLIA 3ULQB 2FUG2 5TRDA 1W7PA 2NVUB 2R7QA 4IHYA 1A36A 1OQYA 3O8HA 2EA2A 4EV0A 4PGHA 1HDDC 5CVJA 2XKPA 4N0BA 5FKNA 1YLFA 1XG1A 3FM5A 3I3LA 4CCOA 1RESA 4YRVA 3HUGA 4XLHA 5B66C 2EK5A 3KP5A 3FXOA 2JA8J 2F5DA 4JK1X 4ZJZA 1R71A 2L02A 1O57A 2M1BA 2YVEA 4IO9F 3BTLA 3G3ZA 4A3JJ 2V79A 2VBYA 4NN1A 1QGPA 2KIQA 2Z99A 3RTRA 2X9DA 2DT5A 3KP2A 3MVPA 2QQAA 3K4BA 3W6KB 3ZRGA 1SFUA 2G3BA 2LRDA 2DAOA 1B8IA 1GXQA 3L2UA 5FJ8J 5FGLA 1X4OA 2IBDA 2JK3A 4LGWA 2XSJC 4LJZF 4ENJA 1K83J 3NWSA 3DPUA 3LSGA 1FEXA 3KKCA 1KQ0A 2VASA 4IXAA 4BH9A 1WJDA 2KDZA 3D1NI 3HKZN 1Y0NA 2BBYA 4QSHA 2M3AA 3IC7A 1X1PA 2ZSHB 3C18A 5LGUA 3BDDA
chains in the Genus database with same CATH topology
1MBJA 5F04A 4Y7NJ 4FCYA 3EUPA 5F27A 3G56A 3MKLA 2VPRA 4AF5A 3GZIA 2JMWA 2DMQA 5IYCJ 3G1LA 3GBGA 4GCKA 1PUFB 3VW2A 1VFCA 1B72A 1TWGJ 1CQTA 3FISA 5F0FA 1ENHA 1RKTA 3RQIA 2PZ9A 4W1UA 2HXOA 4A3MJ 3QPLA 4KWAA 4A3BJ 2ME6A 3LNQA 1JKOC 2TCTA 2YU9J 2ZCXA 4M3DA 1JT6A 2LP0A 4L5EA 3Q0VA 1AHDP 5D18A 2FQ4A 3DPJA 3JRHA 4CYCB 3GTQJ 5IOZA 4I6ZA 1IDZA 4IHXA 2ZCNA 2D5VA 2XB5A 3GTJJ 3CRJA 3S5RA 3LSRA 5FHPA 5IOYA 3RD3A 3RZDJ 3I4NJ 5EZHA 3OSFA 1ETKA 2Y0SN 2L7FP 3L1PA 2R0QC 3OIOA 2NP5A 3BNIA 3VVZA 3S2HJ 2N8GA 2OF7A 4DYCA 1MBEA 5E3MA 3Q3SA 1ETOA 4JL3A 2WB1N 3S1MJ 4D5CA 1HOMA 1ETXA 4AUXA 5HBUA 4AC6A 5K7FA 1HLVA 2QTQA 3K7AJ 3IUVA 4MXMA 2XGEA 4A3KJ 2JJ7A 1UG2A 1FIAA 2UXHA 3NNRA 3VOXA 2QF7A 3S1RJ 2B63J 4AYBN 1LE8A 4MFDA 3C2BA 3UKGA 2OPTA 1F43A 1H8AC 2FJ1A 3RZOJ 1VF9A 2WAQN 5M5XJ 2DG8A 4MLOA 3JRCA 3QQAA 5K7ZA 4QTRA 4PXIA 3O8GA 2O9LA 1JJ8C 2VKVA 2NP3A 5EYRA 1ZR4A 3BQZA 4M3GA 1U78A 4QIWN 3FRQA 2E2IJ 4FTHA 5FKLA 3CQZJ 2RASA 1H88C 2CU7A 2UXOA 3HTAA 1GVDA 4CYCA 3NAUA 2DA6A 5DAJA 3CMYA 4JX6A 3Q0UA 5C3EJ 1Z0XA 3MN2A 3F0CA 1B72B 5E3NA 3BJBA 3KZ9A 1NK2P 4JP0A 1K61A 4ICHA 1JTXA 3M3YJ 2QCOA 3HOVJ 4B3AA 4XRSG 3GTGJ 3HEFA 2DA3A 4D7NA 4MIMA 4V2FA 2V57A 3OOUA 1ORKA 3JRDA 1RKWA 3DCFA 1P7JA 2M0CA 3B6AA 2NX4A 4M3FA 4UDSA 3BR2A 1FTZA 2AHQA 2K9SA 2EQRA 1WH7A 1IGNA 4Y52J 4L62A 3JR9A 3ZQLA 1MH4A 3FIWA 1AU7A 2ELKA 3NXCA 3A01B 1T56A 2HOSA 2PMZN 2TRTA 3BTJA 3LOCA 3GTOJ 2G7GA 2GUHA 1JGGA 9ANTA 1RR7A 2R5ZB 1ETVA 3LWJA 2R5YB 1JTYA 4ME9A 3HM5A 1SFOJ 4JKZA 4BY7J 3TW6A 1X2MA 2XPUA 1D5YA 4A3GJ 3CCYA 3V78A 1FIPA 2WV1A 1GDTA 4A3LJ 4C3HJ 1W0TA 2JA7J 5BNGA 1EF4A 1HDPA 1QVUA 5D19A 5AQCA 1Y1WJ 2CUFA 3HTIA 4MK6A 2XDNA 5FMPA 1BJZA 4JX4A 4BXXJ 4A69C 4M3BA 1ZGWA 4HKUA 5M3FJ 3JRAA 2GFNA 1LE8B 3SJMA 3S17J 3I4MJ 2M34A 3ZQIA 4IHVA 4YZEA 3IH4A 1ZR2A 2OI8A 2XPWA 3T6NA 2LTPA 1UMQA 2CRGA 4A93J 2DJNA 2K9NA 2MSYA 1LFBA 2XPVA 5F08A 3IH2A 1MBKA 1RPWA 2NOGA 2FBQA 1POGA 3BG9A 3BT9A 2JWTA 1UI5A 2LY9A 3VPRA 3W6VA 4DZJA 4XK4A 1I50J 3TP0A 3BHQA 3BR1A 2XSDC 3HTHA 1APLC 2XGCA 3WHCA 1HF0A 3V6GA 3PO2J 2QWTA 3H0GJ 1F36A 1JJ6C 4GFBA 1MSEC 3ANPA 3A01A 4GCLA 4HNVA 2D6YA 1A6IA 4C3JJ 2ZB9A 4NELA 1P7IA 3NARA 3E7QA 2R5ZA 1WPKA 2GBYA 3VW0A 4DYRA 1U9NA 2R5YA 3O60A 4RDUA 2H1KA 1ZK8A 3S14J 2AO9A 2O7TA 4EEFG 2DN0A 1WI3A 2QKOA 4G12A 2EZKA 3GTMJ 5JLXA 2NVXJ 4A3IJ 2FX0A 5H9TA 3HOWJ 3S1QJ 1FJLA 1YRNA 1JKQC 4LOCA 4MO7A 1H89C 2M2EA 2X6OA 4JNNA 2LKXA 1BW6A 3G7RA 2K40A 5F1JA 1AKHB 2ZOZA 1SANA 3BR3A 1IG7A 1NTCA 2GENA 2ECCA 5E3OA 4D5FA 1A5JA 2FD5A 3HTJA 1TC3C 2LFBA 3EGQA 3JRBA 2LD5A 2GLOA 4BY1J 3RH2A 1OFCX 1TWFJ 5J3LA 2HYJA 3S16J 3NRGA 4FE4A 4ACIA 1Z77A 2IAIA 3BR5A 4C3IJ 3FK6A 4XIDA 3VOKA 3HGYA 5K7HA 5IP9J 2HOAA 1UI6A 3VUQA 2EZHA 5C4JJ 3FK7A 2YUSA 2UXIA 4M6VA 3LSPA 3LHQA 5J1UA 1ZKGA 2REKA 2HOTA 3ON2A 2LVSA 3NPIA 3PASA 1JKPC 3QPSA 5EZGA 2KT0A 5FLVA 3KKDA 5C44J 3JRIA 1W0UA 4DYQA 5CXGA 2UXPA 2ME0A 1ZTRA 1DU0A 2HDDA 3K2AA 2XRLA 2R92J 5IPAA 4RBOA 3B81A 4FISA 1QVTA 1WGXA 2G7SA 5HAWA 4FE7A 4D7MA 5GP9A 3PO3J 2EZIA 4A3CJ 2DA2A 2MG4A 4AC0A 2RAEA 4W97A 1ETQA 1AKHA 1ZQ3P 2EBIA 3H3VK 1GV5A 3TP3A 5IYBJ 1TWAJ 3B6CA 4X1EA 3SFIA 3KNWA 5CW8A 5D1RA 3JRFA 4UUTA 3GTLJ 3CJDA 1VNDA 2CQQA 1T33A 1MBFA 2CJJA 2K9QA 1U8BA 1O4XA 1E3OC 5K58A 3ANGA 3HB9A 2DMNA 2UXUA 1Y1VJ 3HGGA 3S15J 2EH3A 5C4XJ 5EGOB 3G1OA 1TWCJ 1YRNB 1VI0A 1Q1VA 5FLMJ 1JKRC 5HSZA 2ZOYA 3VVXA 2JA6J 5M5WJ 2X48A 2Q24A 3MNLA 3IH3A 4V2GA 2Y31A 4IEJA 3RKQA 4UUSA 1IRZA 5EFYA 5IP7J 1HCRA 2O8KA 2VKEA 3E7LA 2L0KA 5HODA 1DU6A 1OCTC 5EF6A 3OSGA 2YS9A 2G7LA 2DMTA 3P9TA 2VI6A 3VW1A 2VUMJ 3VVYA 1IUFA 3BTCA 1GV2A 2IU5A 3Q0WA 5EG0B 3AQTA 3WHBA 3ZOBA 2MW8A 3LSJA 2DMUA 4BBRJ 1IC8A 2WUIA 4JYKA 4C2MJ 2Y9ZA 1R9TJ 5E3LA 2EZLA 3TEDA 1MH3A 2M8GX 1JT0A 1XC5A 1MBGA 1X58A 4GFKA 5J1YA 1BW5A 4S0HB 3TW7A 1QRYA 2L7ZA 4NDLA 5DS9A 2NVQJ 1BA5A 4GCTA 1BL0A 3COLA 4A3FJ 5M3MJ 4BBSJ 2R7ZJ 3HE0A 3HIMA 1I3QJ 4CGRA 3A03A 2L9RA 2DA4A 1ETYA 3HBLA 2E2HJ 3M4OJ 2HKUA 1JUMA 3NI7A 1ETWA 5M5YJ 3PPBA 3ZQGA 5EGOA 4MFEA 3HDDA 4A3DJ 3HOXJ 1WH5A 2XB0X 3GTKJ 2I10A 3S2DJ 3ZQFA 3BQYA 4ABZA 2DA1A 2Y2ZA 5GPCA 2H8RA 2F07A 5EDNA 4B1RA 1SGMA 3CDLA 2CQXA 2PBXA 4IHWA 4DZPA 1FTTA 1S7EA 3BR6A 3GTPJ 3BCGA 1XS9A 3LJLA 1MBHA 2Y30A 3PM1A 4XRSA 2HXIA 4M3EA 2COBA 2W53A 5IP6A 4XICA 2HI3A 2O7OA 1U9OA 2YVHA 5EG0A 3BG5A 2RHAA 2WGBA 1OJLA 3ZQCA 1MSFC 1UHSA 1GT0C 1WCMJ 3G1MA 1PUFA 1B8IB 3SDGA 4DW6A 2L7MP 5FKMA 1RETA 2W48A 3HOYJ 2DMPA 4X6AJ 3F1BA 2M9HA 2NS8A 1IDYA 2G0EA 2LLKA 4J19A 2GM4A 3QKXA 4JX5A 5CXIA 5J1RA 1X2NA 3DEWA 3VP5A 1JUPA 4UUSB 1JUSA 2R93J 1ITYA 3BRUA 5EEAA 3BG3A 1QPIA 3CWRA 1NK3P 4I76A 2NS7A 5FKOA 3JREA 3VIBA 3JSJA 5FKKA 1G2HA 2E1OA 2JA5J 3HOZJ 2E2JJ 2NVYJ 2XGDA 2HQ5A 4XRMA 4IHYA 1LFUP 3O8HA 2JN6A 3IV5A 2IEKA 1HDDC 2HYTA 3QBMA 5IYDJ 5FKNA 5F0HA 1XG1A 1RESA 5DTDA 2JA8J 2NVTJ 3BR0A 3ON4A 1IJWC 5JLWA 1I6HJ 2YVEA 1IV6A 2ECBA 3BTLA 4A3JJ 2MGQA 2P81A 1TWHJ 4NN1A 4A3EJ 2LK2A 2X9DA 2ZCMA 3C07A 3MVPA 3BTIA 3HOUJ 2G3BA 1GUUA 5GPAA 3S1NJ 2E19A 1B8IA 2DA7A 2QOPA 5FJ8J 3A02A 2DTZA 5FGLA 2CUEA 3JRGA 2OERA 2DA5A 2IBDA 2JK3A 2LR8A 3KKCA 1FEXA 1K83J 3ZQHA 4B4CA 3LSGA 4GFLA 2QIBA 4BKXA 5F0CA 2KDZA 3D1NI 3HKZN 1MNMC 5C4YA 3FKIJ 1OCPA 2Y9YA 2ID3A 4QSHA 2DG7A 2ID6A 3AQSA 3GEUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MBJ A;  5F04 A;  4Y7N J;  4FCY A;  3EUP A;  5F27 A;  3G56 A;  3MKL A;  2VPR A;  4AF5 A;  3GZI A;  2JMW A;  2DMQ A;  5IYC J;  3G1L A;  3GBG A;  4GCK A;  1PUF B;  3VW2 A;  1VFC A;  1B72 A;  1TWG J;  1CQT A;  3FIS A;  5F0F A;  1ENH A;  1RKT A;  3RQI A;  2PZ9 A;  4W1U A;  2HXO A;  4A3M J;  3QPL A;  4KWA A;  4A3B J;  2ME6 A;  3LNQ A;  1JKO C;  2TCT A;  2YU9 J;  2ZCX A;  4M3D A;  1JT6 A;  2LP0 A;  4L5E A;  3Q0V A;  1AHD P;  5D18 A;  2FQ4 A;  3DPJ A;  3JRH A;  4CYC B;  3GTQ J;  5IOZ A;  4I6Z A;  1IDZ A;  4IHX A;  2ZCN A;  2D5V A;  2XB5 A;  3GTJ J;  3CRJ A;  3S5R A;  3LSR A;  5FHP A;  5IOY A;  3RD3 A;  3RZD J;  3I4N J;  5EZH A;  3OSF A;  1ETK A;  2Y0S N;  2L7F P;  3L1P A;  2R0Q C;  3OIO A;  2NP5 A;  3BNI A;  3VVZ A;  3S2H J;  2N8G A;  2OF7 A;  4DYC A;  1MBE A;  5E3M A;  3Q3S A;  1ETO A;  4JL3 A;  2WB1 N;  3S1M J;  4D5C A;  1HOM A;  1ETX A;  4AUX A;  5HBU A;  4AC6 A;  5K7F A;  1HLV A;  2QTQ A;  3K7A J;  3IUV A;  4MXM A;  2XGE A;  4A3K J;  2JJ7 A;  1UG2 A;  1FIA A;  2UXH A;  3NNR A;  3VOX A;  2QF7 A;  3S1R J;  2B63 J;  4AYB N;  1LE8 A;  4MFD A;  3C2B A;  3UKG A;  2OPT A;  1F43 A;  1H8A C;  2FJ1 A;  3RZO J;  1VF9 A;  2WAQ N;  5M5X J;  2DG8 A;  4MLO A;  3JRC A;  3QQA A;  5K7Z A;  4QTR A;  4PXI A;  3O8G A;  2O9L A;  1JJ8 C;  2VKV A;  2NP3 A;  5EYR A;  1ZR4 A;  3BQZ A;  4M3G A;  1U78 A;  4QIW N;  3FRQ A;  2E2I J;  4FTH A;  5FKL A;  3CQZ J;  2RAS A;  1H88 C;  2CU7 A;  2UXO A;  3HTA A;  1GVD A;  4CYC A;  3NAU A;  2DA6 A;  5DAJ A;  3CMY A;  4JX6 A;  3Q0U A;  5C3E J;  1Z0X A;  3MN2 A;  3F0C A;  1B72 B;  5E3N A;  3BJB A;  3KZ9 A;  1NK2 P;  4JP0 A;  1K61 A;  4ICH A;  1JTX A;  3M3Y J;  2QCO A;  3HOV J;  4B3A A;  4XRS G;  3GTG J;  3HEF A;  2DA3 A;  4D7N A;  4MIM A;  4V2F A;  2V57 A;  3OOU A;  1ORK A;  3JRD A;  1RKW A;  3DCF A;  1P7J A;  2M0C A;  3B6A A;  2NX4 A;  4M3F A;  4UDS A;  3BR2 A;  1FTZ A;  2AHQ A;  2K9S A;  2EQR A;  1WH7 A;  1IGN A;  4Y52 J;  4L62 A;  3JR9 A;  3ZQL A;  1MH4 A;  3FIW A;  1AU7 A;  2ELK A;  3NXC A;  3A01 B;  1T56 A;  2HOS A;  2PMZ N;  2TRT A;  3BTJ A;  3LOC A;  3GTO J;  2G7G A;  2GUH A;  1JGG A;  9ANT A;  1RR7 A;  2R5Z B;  1ETV A;  3LWJ A;  2R5Y B;  1JTY A;  4ME9 A;  3HM5 A;  1SFO J;  4JKZ A;  4BY7 J;  3TW6 A;  1X2M A;  2XPU A;  1D5Y A;  4A3G J;  3CCY A;  3V78 A;  1FIP A;  2WV1 A;  1GDT A;  4A3L J;  4C3H J;  1W0T A;  2JA7 J;  5BNG A;  1EF4 A;  1HDP A;  1QVU A;  5D19 A;  5AQC A;  1Y1W J;  2CUF A;  3HTI A;  4MK6 A;  2XDN A;  5FMP A;  1BJZ A;  4JX4 A;  4BXX J;  4A69 C;  4M3B A;  1ZGW A;  4HKU A;  5M3F J;  3JRA A;  2GFN A;  1LE8 B;  3SJM A;  3S17 J;  3I4M J;  2M34 A;  3ZQI A;  4IHV A;  4YZE A;  3IH4 A;  1ZR2 A;  2OI8 A;  2XPW A;  3T6N A;  2LTP A;  1UMQ A;  2CRG A;  4A93 J;  2DJN A;  2K9N A;  2MSY A;  1LFB A;  2XPV A;  5F08 A;  3IH2 A;  1MBK A;  1RPW A;  2NOG A;  2FBQ A;  1POG A;  3BG9 A;  3BT9 A;  2JWT A;  1UI5 A;  2LY9 A;  3VPR A;  3W6V A;  4DZJ A;  4XK4 A;  1I50 J;  3TP0 A;  3BHQ A;  3BR1 A;  2XSD C;  3HTH A;  1APL C;  2XGC A;  3WHC A;  1HF0 A;  3V6G A;  3PO2 J;  2QWT A;  3H0G J;  1F36 A;  1JJ6 C;  4GFB A;  1MSE C;  3ANP A;  3A01 A;  4GCL A;  4HNV A;  2D6Y A;  1A6I A;  4C3J J;  2ZB9 A;  4NEL A;  1P7I A;  3NAR A;  3E7Q A;  2R5Z A;  1WPK A;  2GBY A;  3VW0 A;  4DYR A;  1U9N A;  2R5Y A;  3O60 A;  4RDU A;  2H1K A;  1ZK8 A;  3S14 J;  2AO9 A;  2O7T A;  4EEF G;  2DN0 A;  1WI3 A;  2QKO A;  4G12 A;  2EZK A;  3GTM J;  5JLX A;  2NVX J;  4A3I J;  2FX0 A;  5H9T A;  3HOW J;  3S1Q J;  1FJL A;  1YRN A;  1JKQ C;  4LOC A;  4MO7 A;  1H89 C;  2M2E A;  2X6O A;  4JNN A;  2LKX A;  1BW6 A;  3G7R A;  2K40 A;  5F1J A;  1AKH B;  2ZOZ A;  1SAN A;  3BR3 A;  1IG7 A;  1NTC A;  2GEN A;  2ECC A;  5E3O A;  4D5F A;  1A5J A;  2FD5 A;  3HTJ A;  1TC3 C;  2LFB A;  3EGQ A;  3JRB A;  2LD5 A;  2GLO A;  4BY1 J;  3RH2 A;  1OFC X;  1TWF J;  5J3L A;  2HYJ A;  3S16 J;  3NRG A;  4FE4 A;  4ACI A;  1Z77 A;  2IAI A;  3BR5 A;  4C3I J;  3FK6 A;  4XID A;  3VOK A;  3HGY A;  5K7H A;  5IP9 J;  2HOA A;  1UI6 A;  3VUQ A;  2EZH A;  5C4J J;  3FK7 A;  2YUS A;  2UXI A;  4M6V A;  3LSP A;  3LHQ A;  5J1U A;  1ZKG A;  2REK A;  2HOT A;  3ON2 A;  2LVS A;  3NPI A;  3PAS A;  1JKP C;  3QPS A;  5EZG A;  2KT0 A;  5FLV A;  3KKD A;  5C44 J;  3JRI A;  1W0U A;  4DYQ A;  5CXG A;  2UXP A;  2ME0 A;  1ZTR A;  1DU0 A;  2HDD A;  3K2A A;  2XRL A;  2R92 J;  5IPA A;  4RBO A;  3B81 A;  4FIS A;  1QVT A;  1WGX A;  2G7S A;  5HAW A;  4FE7 A;  4D7M A;  5GP9 A;  3PO3 J;  2EZI A;  4A3C J;  2DA2 A;  2MG4 A;  4AC0 A;  2RAE A;  4W97 A;  1ETQ A;  1AKH A;  1ZQ3 P;  2EBI A;  3H3V K;  1GV5 A;  3TP3 A;  5IYB J;  1TWA J;  3B6C A;  4X1E A;  3SFI A;  3KNW A;  5CW8 A;  5D1R A;  3JRF A;  4UUT A;  3GTL J;  3CJD A;  1VND A;  2CQQ A;  1T33 A;  1MBF A;  2CJJ A;  2K9Q A;  1U8B A;  1O4X A;  1E3O C;  5K58 A;  3ANG A;  3HB9 A;  2DMN A;  2UXU A;  1Y1V J;  3HGG A;  3S15 J;  2EH3 A;  5C4X J;  5EGO B;  3G1O A;  1TWC J;  1YRN B;  1VI0 A;  1Q1V A;  5FLM J;  1JKR C;  5HSZ A;  2ZOY A;  3VVX A;  2JA6 J;  5M5W J;  2X48 A;  2Q24 A;  3MNL A;  3IH3 A;  4V2G A;  2Y31 A;  4IEJ A;  3RKQ A;  4UUS A;  1IRZ A;  5EFY A;  5IP7 J;  1HCR A;  2O8K A;  2VKE A;  3E7L A;  2L0K A;  5HOD A;  1DU6 A;  1OCT C;  5EF6 A;  3OSG A;  2YS9 A;  2G7L A;  2DMT A;  3P9T A;  2VI6 A;  3VW1 A;  2VUM J;  3VVY A;  1IUF A;  3BTC A;  1GV2 A;  2IU5 A;  3Q0W A;  5EG0 B;  3AQT A;  3WHB A;  3ZOB A;  2MW8 A;  3LSJ A;  2DMU A;  4BBR J;  1IC8 A;  2WUI A;  4JYK A;  4C2M J;  2Y9Z A;  1R9T J;  5E3L A;  2EZL A;  3TED A;  1MH3 A;  2M8G X;  1JT0 A;  1XC5 A;  1MBG A;  1X58 A;  4GFK A;  5J1Y A;  1BW5 A;  4S0H B;  3TW7 A;  1QRY A;  2L7Z A;  4NDL A;  5DS9 A;  2NVQ J;  1BA5 A;  4GCT A;  1BL0 A;  3COL A;  4A3F J;  5M3M J;  4BBS J;  2R7Z J;  3HE0 A;  3HIM A;  1I3Q J;  4CGR A;  3A03 A;  2L9R A;  2DA4 A;  1ETY A;  3HBL A;  2E2H J;  3M4O J;  2HKU A;  1JUM A;  3NI7 A;  1ETW A;  5M5Y J;  3PPB A;  3ZQG A;  5EGO A;  4MFE A;  3HDD A;  4A3D J;  3HOX J;  1WH5 A;  2XB0 X;  3GTK J;  2I10 A;  3S2D J;  3ZQF A;  3BQY A;  4ABZ A;  2DA1 A;  2Y2Z A;  5GPC A;  2H8R A;  2F07 A;  5EDN A;  4B1R A;  1SGM A;  3CDL A;  2CQX A;  2PBX A;  4IHW A;  4DZP A;  1FTT A;  1S7E A;  3BR6 A;  3GTP J;  3BCG A;  1XS9 A;  3LJL A;  1MBH A;  2Y30 A;  3PM1 A;  4XRS A;  2HXI A;  4M3E A;  2COB A;  2W53 A;  5IP6 A;  4XIC A;  2HI3 A;  2O7O A;  1U9O A;  2YVH A;  5EG0 A;  3BG5 A;  2RHA A;  2WGB A;  1OJL A;  3ZQC A;  1MSF C;  1UHS A;  1GT0 C;  1WCM J;  3G1M A;  1PUF A;  1B8I B;  3SDG A;  4DW6 A;  2L7M P;  5FKM A;  1RET A;  2W48 A;  3HOY J;  2DMP A;  4X6A J;  3F1B A;  2M9H A;  2NS8 A;  1IDY A;  2G0E A;  2LLK A;  4J19 A;  2GM4 A;  3QKX A;  4JX5 A;  5CXI A;  5J1R A;  1X2N A;  3DEW A;  3VP5 A;  1JUP A;  4UUS B;  1JUS A;  2R93 J;  1ITY A;  3BRU A;  5EEA A;  3BG3 A;  1QPI A;  3CWR A;  1NK3 P;  4I76 A;  2NS7 A;  5FKO A;  3JRE A;  3VIB A;  3JSJ A;  5FKK A;  1G2H A;  2E1O A;  2JA5 J;  3HOZ J;  2E2J J;  2NVY J;  2XGD A;  2HQ5 A;  4XRM A;  4IHY A;  1LFU P;  3O8H A;  2JN6 A;  3IV5 A;  2IEK A;  1HDD C;  2HYT A;  3QBM A;  5IYD J;  5FKN A;  5F0H A;  1XG1 A;  1RES A;  5DTD A;  2JA8 J;  2NVT J;  3BR0 A;  3ON4 A;  1IJW C;  5JLW A;  1I6H J;  2YVE A;  1IV6 A;  2ECB A;  3BTL A;  4A3J J;  2MGQ A;  2P81 A;  1TWH J;  4NN1 A;  4A3E J;  2LK2 A;  2X9D A;  2ZCM A;  3C07 A;  3MVP A;  3BTI A;  3HOU J;  2G3B A;  1GUU A;  5GPA A;  3S1N J;  2E19 A;  1B8I A;  2DA7 A;  2QOP A;  5FJ8 J;  3A02 A;  2DTZ A;  5FGL A;  2CUE A;  3JRG A;  2OER A;  2DA5 A;  2IBD A;  2JK3 A;  2LR8 A;  3KKC A;  1FEX A;  1K83 J;  3ZQH A;  4B4C A;  3LSG A;  4GFL A;  2QIB A;  4BKX A;  5F0C A;  2KDZ A;  3D1N I;  3HKZ N;  1MNM C;  5C4Y A;  3FKI J;  1OCP A;  2Y9Y A;  2ID3 A;  4QSH A;  2DG7 A;  2ID6 A;  3AQS A;  3GEU A; 
#chains in the Genus database with same CATH topology
 1MBJ A;  3K4M A;  5F04 A;  4RAF A;  3HRM A;  4I0A A;  2F6C A;  3G56 A;  5F27 A;  2CG4 A;  3GZI A;  2DFH A;  2LH9 A;  1HKS A;  3ISP A;  3EUA A;  4FET A;  4EMS A;  2NS0 A;  4GCK A;  3CC4 I;  3KCC A;  3VW2 A;  1R5I D;  3DU5 A;  1CQT A;  3VEP A;  2BYV E;  2RNJ A;  3FIS A;  5J4V A;  1P2F A;  4YG2 F;  3KE2 A;  1QNT A;  4MHG A;  3MZ8 A;  2PZ9 A;  1J75 A;  2HXO A;  4U7D A;  1FBS A;  3AAF A;  5CYV A;  2DPU A;  2E1M C;  2EIJ H;  3RPU A;  3QPL A;  4MEX F;  4L9N A;  3M1E A;  4PSW A;  5J6X A;  3TBI A;  1W7P D;  1WJB A;  3HTU A;  5CVR A;  2ME6 A;  3LNQ A;  2QSG X;  1FSH A;  2LP0 A;  4L5E A;  1WWX A;  3L7W A;  3CC2 I;  1YI2 I;  4AD9 A;  3CES A;  2RV8 A;  3FBN B;  2LF7 A;  2B9S A;  3JRH A;  2P6T A;  1IDZ A;  4HPQ A;  1ZAR A;  1T6S A;  1V54 H;  3CD6 I;  1U5T B;  3DEU A;  3LMM A;  2IA1 A;  5KHD A;  5IOY A;  3LSR A;  3S5R A;  5L3G A;  3RZD J;  4OAY A;  3ZCO A;  4HDU A;  3I4N J;  1ZH5 A;  1ETK A;  2STT A;  1XPX A;  3PNY A;  2PQ8 A;  4DYC A;  1ZRE A;  3Q3S A;  2DYR H;  4E6K G;  3FXL A;  5GAD J;  1ONV A;  2E5N A;  4U88 A;  4BEH B;  4BNC A;  2PJP A;  4AC6 A;  1EH6 A;  4P55 A;  1UFM A;  1VQO I;  2WAD A;  1G59 A;  2XGE A;  2RQP A;  3OYF A;  1F5T A;  4ENM A;  1P92 A;  2F4I A;  1FIA A;  5GTI C;  2BGC A;  4ZZD A;  3TGN A;  2ELJ A;  4IPA A;  2XVC A;  1IW7 F;  4I7H A;  3UKG A;  2HYG D;  2AXL A;  4IZZ A;  3P5J A;  3COA C;  2P7C B;  2ZY9 A;  2DG8 A;  3MQ0 A;  2VL8 A;  4PCQ A;  3JRC A;  3QQA A;  5DD4 A;  2WAF A;  3GFI A;  4ZTJ A;  1UAA A;  4HF1 A;  4QTR A;  2DOF A;  5LHI A;  2NP3 A;  2QGU A;  4WWC A;  5EYR A;  3FMQ A;  3S3N A;  2E2I J;  3LSM A;  1YX5 A;  1FZP B;  1H88 C;  2UXO A;  1GVD A;  2WV0 A;  3I53 A;  3K1M A;  3RPU D;  5A2Q Z;  4ESB A;  4LLN A;  1VQL I;  3QP5 A;  2L9V A;  4JX6 A;  3Q0U A;  5BPI A;  2GXG A;  3ZN0 A;  5DCM A;  5E3N A;  2BY3 A;  4BDY A;  4HF0 A;  1SD4 A;  4JP0 A;  4ICH A;  5H6Q A;  4KT6 A;  2Q8K A;  2LY1 A;  4HW0 A;  5ED4 A;  2C6Y A;  4B3A A;  4ZDP A;  1RR8 C;  3HEF A;  1LDJ A;  2OCE A;  4MIM A;  1ORK A;  3U9G A;  3K70 D;  5HNH A;  3BR2 A;  3DBR B;  2KZV A;  4I98 B;  2K4J A;  1BIB A;  2EQR A;  4Y52 J;  2F5E A;  4PZJ A;  2BHZ A;  2ELK A;  3NXC A;  1JGS A;  3DFG A;  3VYU B;  1D0X A;  1R7J A;  3BCB A;  1YJW I;  3GTO J;  2G7G A;  2A6E F;  1JGG A;  1RR7 A;  4EJO A;  1LKX A;  2D2W A;  4YIF A;  5EJC A;  2OV7 A;  1IXR C;  3TW6 A;  4EVI A;  2EV5 A;  2MAB A;  4E70 A;  2QUF A;  3VYR B;  4HNU A;  3F8M A;  3F22 A;  2DFI A;  4C3H J;  2JA7 J;  5BNG A;  1EF4 A;  1IF1 A;  1QVU A;  2OU2 A;  3CJN A;  5AQC A;  4XM3 A;  4YII A;  2XDN A;  1BJZ A;  3PQJ A;  4JX4 A;  2IPQ X;  4ENN A;  3L00 A;  1O3Q A;  2MA3 A;  1LE8 B;  3SJM A;  2M34 A;  4YZE A;  4I01 A;  1ZR2 A;  5JVG F;  2WY7 Q;  3GVA A;  1DPU A;  1K6Y A;  1LFB A;  3PUB A;  4P5O A;  2A05 A;  1MBK A;  2NOG A;  1UEL B;  1IN6 A;  2ZBK A;  4KN4 X;  3BT9 A;  3RCO A;  3ML6 A;  3VPR A;  3W6V A;  3EUH C;  4PUS A;  4CCN A;  2F5C A;  5D8K B;  3PNT A;  4WF2 A;  4PJN A;  2E1C A;  2WAE A;  3VB2 A;  1K6O A;  3WU0 A;  1XGM A;  1JJ6 C;  2KHM A;  1BI2 A;  3PIO F;  1ON2 A;  4HNV A;  4NQW A;  4YIR X;  4I02 A;  1WPK A;  1ZAO A;  2GBY A;  3SXY A;  1DQU A;  4RAG A;  1DGR M;  3HSF A;  4RDU A;  2H1K A;  1LB2 A;  1I3A A;  3OS2 A;  1J7K A;  2JVG A;  2BY1 A;  3F21 A;  2O7T A;  4ON0 A;  4OWR B;  3M8E A;  5ICG A;  1QHH D;  3LA7 A;  2NVX J;  3CZ6 A;  4N9H A;  5H9T A;  3HOW J;  4ZDO A;  2VLA A;  4B47 A;  2ZSI B;  1P4W A;  4CCJ A;  2W84 A;  1BR1 A;  4MO7 A;  1H89 C;  3GZN B;  3BZ6 A;  5D4S A;  2VN2 A;  4C2U A;  1X19 A;  2MH9 A;  1HC8 A;  2OAZ A;  1NG6 A;  2Q0O A;  2DW4 A;  2W57 A;  5F1J A;  2DPD A;  5FO5 A;  2Q2E B;  4HG2 A;  5D4R A;  1AKH B;  1SAN A;  3KZY A;  2GEN A;  5E3O A;  3HTJ A;  2FD5 A;  3CUQ B;  4DQ2 A;  1TC3 C;  1YJN I;  4LK0 F;  1K78 A;  2ISZ A;  3HYI A;  3A2K A;  2RGV A;  3D0S A;  5E79 C;  3CF2 A;  3FHN A;  4FE4 A;  1LEA A;  4F91 B;  3G2B A;  1XX5 A;  2IAI A;  1UB9 A;  3F9K A;  3VOK A;  1ULY A;  3ABT A;  3HGY A;  2VQH A;  2GQQ A;  2VQG A;  2FOW A;  2K3P A;  2FMY A;  3B73 A;  4LK1 F;  1Z3Y A;  1FMW A;  1UI6 A;  1T0F C;  3CF5 F;  2UXI A;  3LSP A;  4G7H F;  1Z3X A;  1YYV A;  4GCV A;  4ZDL A;  3BG7 A;  2HOT A;  2ZME B;  4KFC A;  1H9T A;  1Y6I A;  5AIQ A;  2KT0 A;  1QZZ A;  1LDD A;  4XNF A;  3MEX A;  4UUV A;  3KKD A;  4L9V A;  2WBM A;  2OZU A;  2A68 F;  1FYM A;  2UXP A;  3GXO A;  3I54 A;  2VC0 A;  1FP1 D;  1DU0 A;  1XN7 A;  2HDD A;  3K2A A;  1S3J A;  2R92 J;  1J59 A;  3B81 A;  3OYK A;  3FM3 A;  1KYZ A;  1ZGJ A;  4D7M A;  4UVC A;  1R1T A;  3LFK A;  3CJT B;  2EZI A;  3LSI A;  4RMN A;  3HTS B;  1STZ A;  2ZNY A;  3REO A;  4A0Y A;  4BAC A;  3J81 K;  2IS2 A;  3EET A;  2X0L A;  2A5Y B;  4G6T B;  2RAE A;  1KU9 A;  1ETQ A;  4HF2 A;  1GV5 A;  3TP3 A;  5CW8 A;  3SFI A;  3KNW A;  3SEZ A;  2LSO A;  3GME A;  1T33 A;  1D0Y A;  3ANG A;  2ESN A;  2P0W A;  3HB9 A;  3GX4 X;  1PP7 U;  2DMN A;  1XD7 A;  2UXU A;  2W85 A;  2Y0S A;  1YFH A;  1TWC J;  1YRN B;  3BC8 A;  2CSO A;  2H09 A;  2J5O A;  3IRR A;  1QQI A;  3IH3 A;  1FT9 A;  4IEJ A;  5B5E C;  3K70 C;  1T39 A;  1DGW Y;  3KP3 A;  4ZYD A;  4PJJ A;  4LG0 B;  1ZLJ A;  3H92 A;  2KIU A;  4RS8 A;  2WWY A;  1HCR A;  3L9F A;  4IKF A;  2VKE A;  4FQG A;  2OZ6 A;  5K5O A;  1DU6 A;  3K1P A;  2YS9 A;  3VW1 A;  2F4M B;  1T2K A;  4DNC A;  1IUF A;  3VVY A;  1V5E A;  1PJR A;  3ABK H;  3ZOB A;  3DF8 A;  4XMY A;  2Y9Z A;  3I56 I;  4M9S A;  3ABM H;  2EZL A;  2DT7 B;  1XC5 A;  3F8N A;  2BVM A;  3FZV A;  3TW7 A;  4E4H A;  3ASO H;  3H5A A;  1ON1 A;  5ICC A;  5DS9 A;  3CO6 C;  5LD2 C;  5J4Y A;  1JE8 A;  2PG4 A;  3OOP A;  1CF7 A;  3CMM A;  1T38 A;  3CME I;  3BRO A;  3COL A;  3KET A;  3EPZ A;  4CIC A;  3AKZ A;  4HOB A;  1WVR A;  4CGR A;  3A03 A;  5HDG A;  5K5Q A;  3NI7 A;  3PPB A;  3AG2 H;  1MND A;  1K4T A;  2FU4 A;  3IAM 2;  4RB2 C;  1SC7 A;  4HX7 A;  3HDD A;  5DEQ A;  2DO7 A;  4RB0 A;  4BHC A;  2CWE A;  1SD5 A;  5L3C A;  3PIP F;  2V1U A;  2XB0 X;  5FD6 A;  3HRT A;  3OS0 A;  3AL0 B;  4EJT A;  4ABZ A;  2Y2Z A;  4B44 A;  1HA8 A;  3E6B A;  2CQ7 A;  2H8R A;  2F07 A;  2M8E A;  2VT2 A;  2DOA A;  3V7S A;  3CDL A;  3WG9 A;  1XGS A;  4OMZ A;  4DZP A;  3E6C C;  1FTT A;  2HZT A;  3BR6 A;  1LDK B;  5H2F C;  4GXO A;  1QPM A;  3ZN1 A;  3IWZ A;  4HQM A;  3LJL A;  3CMA I;  2Y30 A;  4KIS A;  4RLF A;  2WY8 Q;  4NNJ A;  5D6F A;  4XIC A;  2GIV A;  2X1D A;  3OIQ A;  1UHS A;  1GT0 C;  4OIP F;  4YFX F;  1WCM J;  3E0J B;  5TJJ A;  1B8I B;  3SDG A;  5FKM A;  2XRN A;  4L18 B;  4X6A J;  5HDN A;  3HXL A;  1EA3 A;  3F1B A;  3SYT A;  2B3W A;  2KKO A;  4ESF A;  2LLK A;  5CXI A;  2M7A A;  3VOE A;  3W2V A;  2V7F A;  1D8K A;  2BOL A;  4Y33 A;  3K4J A;  2CQN A;  1JUS A;  4ZYH A;  1VQM I;  1TL8 A;  4PK4 A;  5GAE J;  4BS9 A;  2HU9 A;  3BG3 A;  3HPH A;  2QSF X;  2R7O A;  3NEU A;  3PUF A;  1H0M A;  1SVO A;  1NK3 P;  4XN0 A;  5FKO A;  1MMS A;  3K6G A;  1FOW A;  1R22 A;  5D5X B;  5FKK A;  1G2H A;  2L4M A;  2EIK H;  2IP2 A;  2NVY J;  1WJE A;  2HQ5 A;  1SAU A;  2QLZ A;  3C2H A;  2CMP A;  2ZFW A;  1T8I A;  1REP C;  4RGU A;  1KA8 A;  1MMA A;  1Z05 A;  3DTE A;  2XF6 A;  3JAM K;  1LQ1 A;  4HEA 2;  4NB5 A;  3WTY C;  2IS6 A;  5JLW A;  1RRJ A;  3LSK A;  2MGQ A;  1YIO A;  1TWH J;  4IHT A;  5HS9 A;  1RI7 A;  4A3E J;  2E7X A;  3C07 A;  3BTI A;  1K79 A;  2R7D A;  1GUU A;  3AG4 H;  2L5Q A;  2E19 A;  2UXN A;  2DA7 A;  4XSX F;  5GPA A;  2QOP A;  1WI9 A;  4QPQ A;  2FEZ A;  1XMK A;  3K4L A;  2CUE A;  1D1A A;  4HLY A;  1KU7 A;  3V8K A;  4BKX A;  5F0C A;  5C4Y A;  1WSU A;  3HG9 A;  4M9X A;  1IRG A;  1OCP A;  5LLQ A;  2XAH A;  2DG7 A;  2L01 A;  4XKB A;  3PFY A;  4P9U A;  2NAZ A;  1PP8 F;  2PEX A;  3OYL A;  2HVR A;  1OKR A;  4FCY A;  3EUP A;  1P4A A;  1UHM A;  2VPR A;  3VTI A;  3ZMD A;  2NNN A;  1AOY A;  3G1L A;  4NC8 A;  3N97 A;  3QU6 A;  2YX4 A;  5CKT A;  1PUF B;  1N78 A;  3ZMS A;  2EV0 A;  3WTZ A;  2HS5 A;  1ENH A;  2DK5 A;  4XRF A;  2EIN H;  1VQ4 I;  5CPR B;  2H27 A;  1X3Z B;  4A3M J;  1YIJ I;  2MFZ A;  3U21 A;  2EFN A;  2TCT A;  2X6W A;  1AHD P;  4J01 A;  4E7L A;  5D18 A;  1DP7 P;  3DPJ A;  4BDZ A;  5J40 A;  5IOZ A;  1ERD A;  5LHH A;  4RGX A;  4IHX A;  1WZ2 A;  5E1W A;  1A31 A;  2XB5 A;  2G7U A;  2DQL A;  3CLO A;  3RD3 A;  2ICW G;  3R61 A;  3G71 I;  1GHC A;  5FLX Z;  3WOD F;  4U87 A;  2YR2 A;  1MJ9 A;  1JXS A;  2Y0S N;  2R0Q C;  5DV5 A;  4ZYG A;  1QZE A;  1XDS A;  1MBE A;  2K7L A;  2R4G A;  3LL7 A;  2ESH A;  1R23 A;  5HLH A;  4JL3 A;  2WB1 N;  4G9Y A;  2QZ8 A;  3HSR A;  5JHU A;  1ETX A;  3EUH A;  5LFA A;  1HLV A;  3H36 A;  2K27 A;  3K7A J;  4N4N B;  4GYI A;  2JJ7 A;  3K1N A;  3UNG C;  2QF7 A;  1ZN2 A;  3BOQ A;  2ZKZ A;  3OYE A;  3C2B A;  4UVB A;  4XOT A;  4ESJ A;  2D45 A;  1YJ9 I;  1DPR A;  1BC8 C;  1CGP A;  2FJ1 A;  4L9T A;  1VF9 A;  2M4G A;  3QOE A;  3QAH A;  1YS7 A;  2JTV A;  1K4S A;  5LBQ A;  3WTW C;  4DVY P;  4AM3 A;  4PXI A;  3O8G A;  2O9L A;  1B59 A;  2IJL A;  2ZXI A;  4M3G A;  4G7O F;  4CSW A;  2X51 A;  5FKL A;  3CDH A;  3CQZ J;  3OYN A;  2CU7 A;  3SHF A;  3HTA A;  4F92 B;  1XSD A;  2FSW A;  3PJR A;  2DA6 A;  2A07 F;  5DAJ A;  4F93 B;  3L2R A;  1J2X A;  1Z0X A;  3K10 A;  3C7J A;  1B72 B;  3R0A A;  5BS6 A;  3BJB A;  4XSZ F;  2R7U A;  2CV0 A;  4QPO A;  2ZXH A;  3M3Y J;  3V8L A;  3MKZ A;  2WA0 A;  2V6C A;  2PFV A;  4D7N A;  2V57 A;  4Z6Y A;  3JRD A;  1U6G A;  3B6A A;  1P7J A;  2M0C A;  3BG6 A;  1YX3 A;  4M3F A;  4XLA A;  2AHQ A;  4Y4R A;  1I5Z A;  3N4M A;  1XTA A;  1WH7 A;  2NYX A;  2FBH A;  2A2F X;  2PBI A;  3ZQL A;  1MH4 A;  3FIW A;  1AU7 A;  1T56 A;  1TW2 A;  1SAX A;  1ZRF A;  3BTJ A;  2LC2 A;  4NQW B;  1G3T A;  4LD5 A;  2XC7 A;  1BR2 A;  1ETV A;  4IF4 A;  3SZG A;  4BY7 J;  4MGR A;  3RSN A;  1X2M A;  2XPU A;  3CCL I;  4OD4 A;  1VQ9 I;  1B1B A;  4A3G J;  3OYI A;  3TO7 A;  4BHP A;  3TO6 A;  4BQQ A;  5FRO A;  2KLO A;  3OIP A;  5LRR A;  3P9K A;  4PGG A;  5D19 A;  2IGK A;  1OLT A;  2A3S A;  2CUF A;  2W25 A;  3HTI A;  4MK6 A;  4Y15 A;  3OL4 A;  2VOO A;  5FMP A;  3S3M A;  4UB8 C;  1Z6R A;  3S2W A;  2W82 A;  1ZG3 A;  4A69 C;  2NNY A;  1FSE A;  2GFN A;  3S17 J;  3P9I A;  4C9Y A;  1TT5 B;  1KQ8 A;  3ZQI A;  4BUP A;  4EM0 B;  3HOS A;  1BJA A;  3T8T A;  1R00 A;  1BI3 A;  4JOM A;  5KK1 A;  4A93 J;  4B8X A;  4XR6 A;  2Y0M A;  2K9N A;  4BU2 A;  5F08 A;  3CJR B;  3RI4 A;  3S32 A;  1JHH A;  1IV8 A;  1POG A;  4TV7 A;  1UI5 A;  3CC7 I;  1K78 B;  2EWN A;  5DUK A;  3TP0 A;  3L09 A;  2VKH A;  3BHQ A;  3VSK A;  3PSF A;  3OR1 C;  3BR1 A;  5DUI A;  3FXK A;  2CGP A;  2V1D A;  1O7F A;  2ZJR F;  2IS1 A;  3JTH A;  1HF0 A;  1C0W A;  2GOM A;  2IA0 A;  3KYL A;  1WJF A;  3F23 A;  3H0G J;  5E8G A;  2K9M A;  4S05 A;  2HFH A;  1MSE C;  4GFB A;  3I58 A;  2PX9 A;  3A01 A;  3ANP A;  2GA2 A;  3C3W A;  3VFZ A;  4GCL A;  2ZB9 A;  3NAR A;  2R5Z A;  2E5Z A;  3VW0 A;  1G6N A;  1MMD A;  3GW2 A;  2AXT C;  4NUB A;  3J80 Z;  1RUN A;  3S14 J;  1LVK A;  2A61 A;  2QKO A;  3A0B C;  5JLX A;  4UB6 C;  1SVM A;  2BHY A;  3QRF F;  2V6E A;  4UXN A;  2FBI A;  2GA1 A;  2L4A A;  2QQ9 A;  1A04 A;  1ZG5 A;  3KP6 A;  2BV6 A;  2M2E A;  2QVO A;  3FX3 A;  2LKS A;  2M5W A;  1FMV A;  2LKX A;  3LST A;  3R60 A;  3CDI A;  1BW6 A;  2FBK A;  3G7R A;  1FPQ A;  2K40 A;  2P5L C;  2R7X A;  4IRI A;  3J7Y J;  1B9M A;  1XGN A;  1IG7 A;  2R7R A;  5L3E A;  1NTC A;  2PI0 A;  2Y48 A;  2ECC A;  5HDK A;  2ETH A;  1P4X A;  2BVL A;  2LFB A;  2JSP A;  2K5C A;  2FE3 A;  4BY1 J;  2Y69 H;  3ZMU A;  3RYP A;  3NRG A;  4ACI A;  3BR5 A;  4C3I J;  2CFX A;  2OJE D;  4CCM A;  5K7H A;  4BJT A;  2K85 A;  4XLE A;  3BY6 A;  3VUQ A;  2EZH A;  2K02 A;  3PNV A;  1W5C C;  3FK7 A;  2YUS A;  4I0B A;  1KYW A;  4ZC3 A;  4CZC A;  3OYM A;  5J1U A;  2REK A;  4Z2Y A;  3ON2 A;  2LVS A;  5E20 A;  4II3 A;  3NPI A;  3PAS A;  2UUZ A;  4ITV A;  5EZG A;  3DKX A;  2OD5 A;  5FGM A;  4OIR F;  2HQR A;  3CUO A;  5C44 J;  2JUG A;  1W0U A;  1FYK A;  1T95 A;  3NRV A;  1I27 A;  1AWC A;  1ZTR A;  3F3X A;  2R7T A;  2X6X A;  2XRL A;  2L54 A;  3DXJ F;  4RBO A;  3HIF A;  2O61 A;  1Z7L A;  1QVT A;  1XMX A;  3ZMZ A;  1LUJ B;  4FE7 A;  4A3D J;  3OYG A;  1B4A A;  3H0D A;  2O0Y A;  3WGG A;  4A3C J;  2IXS A;  2MG4 A;  2ZME C;  3V42 A;  5KCM A;  1Z9C A;  1CF7 B;  4M73 A;  5F1R A;  5D1R A;  3EYI A;  4FT8 A;  2VOD A;  1X1B A;  4UUT A;  3CJD A;  2CQQ A;  1RZ4 A;  2CJJ A;  5B3S H;  1E3O C;  5K58 A;  4XLF A;  4R8H A;  4RAY A;  5F6F A;  4S04 A;  4E7H A;  3HGG A;  3S15 J;  2EH3 A;  4AIH A;  5JFR A;  4IL6 C;  2XUB A;  4QWQ A;  1R58 A;  5FLM J;  1R5H A;  3VVX A;  2JA6 J;  5M5W J;  4EGZ A;  1IXC A;  4ZH4 F;  5K5R A;  4E7Z A;  1GXP A;  1HXD A;  3V7R A;  4RB3 C;  3RKQ A;  2QKM B;  4GYG A;  5B1A H;  5K1Y A;  3BZC A;  2XAU A;  1OIS A;  5EFY A;  2H6B A;  1KON A;  1W5T A;  2KIS A;  4G6Q A;  2CW0 F;  4KIF A;  2O8K A;  3E7L A;  2EJR A;  2UZK A;  5EEG A;  3MZH A;  2HEO A;  5HOD A;  2XAQ A;  4RLQ A;  1OCT C;  5EF6 A;  3P9T A;  2X1E A;  2VI6 A;  4G8X A;  3H1C A;  4Q47 A;  1FLI A;  3BTC A;  1GV2 A;  5KAF C;  1I1S A;  5CJ9 A;  3WHB A;  3AQT A;  4BBR J;  2DMU A;  2DOE A;  1BC7 C;  4JYK A;  1MH3 A;  2O8X A;  1JT0 A;  2UWM A;  1BOB A;  4M9Z A;  4CCL A;  1V55 H;  2HQA A;  1EV7 A;  3K69 A;  4S0H B;  2HWV A;  2IGM A;  4NDL A;  4CDG A;  2PJR A;  4U9N A;  2NVQ J;  4ZZL A;  1IN4 A;  3TMO A;  1BA5 A;  4GCT A;  1O3R A;  2W00 A;  1EH8 A;  1XGO A;  2LNB A;  2R3S A;  4WXC A;  1UJ8 A;  2R7Z J;  4BQO A;  3SZT A;  3M4O J;  1N25 A;  1ETW A;  2X1C A;  1FOX A;  3ZQG A;  2H6C A;  5EGO A;  3BP8 A;  2NOJ B;  5FD5 A;  3QYB A;  3SZP A;  3V4G A;  3S2D J;  2RC4 A;  4AID A;  3IP4 B;  2DA1 A;  3QWL A;  5JI6 A;  1TNS A;  4LIT A;  4IOA F;  1Y0U A;  4B1R A;  1SGM A;  3HHH A;  2PBX A;  1X3U A;  4RAZ A;  1WJ5 A;  4BHB A;  1VQK I;  4EJU A;  3DLA A;  1FOK A;  3BCG A;  2PMZ A;  2CV1 A;  4XRS A;  1FBQ A;  2DTR A;  1T08 B;  5D6E A;  4BYY A;  4N9I A;  2COB A;  2HR3 A;  3WTV C;  2HI3 A;  2E35 A;  1U9O A;  2O7O A;  4A5M A;  1TBX A;  3BG5 A;  3AL0 C;  2WGB A;  4FAS D;  4PSX A;  4R79 A;  4A0Z A;  1TT0 A;  1IXS B;  2KRC A;  5E1Z B;  2L7M P;  5ILS A;  1RET A;  3WE2 A;  1UZC A;  1YQA A;  4BE0 A;  3HOY J;  5BMZ A;  1E17 A;  2IT0 A;  1IDY A;  1MZB A;  4HQE A;  2GM4 A;  4J19 A;  3ROU A;  2RRE A;  4UUS B;  2STW A;  4FHT A;  3KFW X;  4KIC A;  1D3Y A;  1HQC A;  3CCM I;  1QPI A;  1XSX A;  4IRV A;  3OYJ A;  2ELH A;  2PMU A;  3KPH A;  1YOV B;  2VQL A;  3JRE A;  1IN5 A;  1R36 A;  4M72 A;  3JSJ A;  4BL0 B;  1B9N A;  2QWW A;  2E2J J;  1VQN I;  3HHG A;  3PL8 A;  4ZYE A;  2XGD A;  1Z91 A;  2KZG A;  1Y39 A;  1SFE A;  1LFU P;  2HYT A;  4XBF A;  1BIA A;  2EA4 A;  5F0H A;  2RDP A;  3GEZ A;  3DV8 A;  5DTD A;  2EFO A;  1ACI A;  2NVT J;  4G94 A;  3T8R A;  3BR0 A;  3KZZ A;  3H9Q A;  4BEH A;  1IJW C;  2ECB A;  4XQF A;  2OBP A;  2P81 A;  3ZMV A;  1FP2 A;  3HJE A;  2QSH X;  4BE2 A;  3M9A A;  4BQA A;  3PFI A;  2R7S A;  2LK2 A;  5LHG A;  2VE8 A;  4DIQ A;  2BW3 A;  3L2V A;  3HOU J;  4Q48 A;  3DBH B;  1SMY F;  4KIG A;  3S1N J;  3LQQ A;  1DUX C;  2WB1 A;  1HBX G;  3JRG A;  2OER A;  2DA5 A;  2LR8 A;  4XN3 A;  4B4C A;  1PYV A;  3JSO A;  3CTA A;  1FOY A;  4L5I A;  1F1Z A;  3FKI J;  4IRG A;  2ZJ2 A;  2VJI A;  3X2Q H;  2ID6 A;  2DOD A;  1ZGA A;  5IY5 H;  3AQS A;  2V4J C;  3FXM A;  3GEU A;  1X4P A;  4YEJ A;  5ICF A;  3F8C A;  4Y7N J;  3DP7 A;  2KIM A;  2KP6 A;  1IN7 A;  3I71 A;  2LYC A;  3MKL A;  1G3Y A;  1BN5 A;  3AG1 H;  2JMW A;  2DMQ A;  5B1B H;  4HZF A;  1VQ6 I;  3GBG A;  4KMF A;  2K9L A;  5GTH C;  2XGX A;  1VFC A;  3MKW B;  2FOK A;  2YPR A;  5F0F A;  3I0T A;  1OCZ H;  1RKT A;  2M4K A;  4XL9 A;  3W3C A;  2W24 A;  2CUJ A;  2JSC A;  4W1U A;  3IL2 A;  4ETS A;  2P7V B;  3KYD B;  4XON A;  4GDF A;  3ZMT A;  4A3B J;  1MKM A;  2XIG A;  1NHA A;  2JPB A;  5E8I A;  4EJW A;  1Y8R B;  3F8B A;  2YU9 J;  1JT6 A;  5H20 A;  3IWF A;  3FXU A;  5DM6 F;  3H9G A;  5E1X A;  5CVI A;  4B3X A;  3GTQ J;  4I6Z A;  3MAJ A;  3GCM A;  3Q5F A;  2ZCN A;  3CJQ B;  3QYF A;  4HSR A;  5DCF A;  3GLX A;  2D5V A;  3JSP A;  2CYY A;  5FB2 A;  1YIT I;  2D1V A;  1W7P B;  3JW4 A;  3CCR I;  1JHF A;  3KEO A;  3H3Z A;  4AIK A;  2LMD A;  3OSF A;  2QEN A;  2NP5 A;  3VVZ A;  3HC7 A;  3OIO A;  4C2M A;  4EM2 A;  3S2H J;  2N8G A;  2OF7 A;  3HUG B;  1W4M A;  5E3M A;  1ZRD A;  4O6J A;  5KAI C;  2PFB A;  2FJI 1;  3S1M J;  1XB4 A;  3HZJ A;  4UVA A;  5HBU A;  4NBQ A;  2MD0 A;  3M07 A;  2AQE A;  1MNE A;  4A12 A;  4A3K J;  1E2X A;  1UG2 A;  1XMA A;  3IHU A;  2VXZ A;  5JHF A;  1LE8 A;  3P7N A;  4MFD A;  5LEK A;  3CO7 C;  3CCS I;  2OUM A;  2MLK A;  2OPT A;  2P6S A;  1BI1 A;  4ASN A;  1JI8 A;  5M5X J;  3G6E I;  2VT3 A;  4LB6 B;  3DPL C;  4EJV A;  1PUE E;  1R4N B;  4E7I A;  4MLO A;  2P5K A;  4WIB A;  5TIS C;  1JJ8 C;  1ZR4 A;  1U78 A;  5CQE A;  3FRQ A;  2KJB A;  5BOX A;  2JQ7 A;  3LA2 A;  3QP6 A;  4LIU A;  2RAS A;  4E7J A;  4C2T A;  4JBA A;  4CYC A;  2P8T A;  4A6D A;  2M0M A;  5IT3 A;  1R5G A;  2BE5 F;  1YW7 A;  4LIV A;  2HPM A;  1D8J A;  5C3E J;  2DLL A;  3MN2 A;  3IUO A;  3F0C A;  1WJA A;  1S7A A;  2M45 A;  3R6S A;  3KZ9 A;  3AG3 H;  2WTE A;  4KT5 C;  3LAJ A;  2M30 A;  3OYH A;  1YG2 A;  3O2P E;  3E6D A;  5EEH A;  5TGT A;  3MFK A;  2LBF A;  2IA2 A;  3GTG J;  2DA3 A;  2O6G E;  3BPV A;  1U0J A;  3I4P A;  1FTZ A;  2K9S A;  4U0V A;  3QOD A;  3DTI A;  4HRI A;  3CLQ A;  3CP2 A;  4L62 A;  3OY9 A;  2QQB A;  3A01 B;  2HYF A;  2PMZ N;  4BJ6 C;  2HKX A;  4IQJ A;  2HDW A;  2UV1 A;  2R5Z B;  2K86 A;  1JTY A;  1P9Q C;  2JZY A;  3WU2 C;  3HM5 A;  4LB5 A;  1SFO J;  3BCA A;  4JKZ A;  1FY7 A;  1KU3 A;  4L9J A;  2LG4 A;  4YEL A;  3CCY A;  1FIP A;  3K9T A;  3W2W A;  1P6R A;  4E7S A;  5E17 F;  2DFE A;  1RUO A;  1GDT A;  4A3L J;  3GZ6 A;  1D0Z A;  1W0T A;  4MTE A;  2DQR A;  3K8P C;  4KJZ A;  1TTY A;  1WFX A;  3ZGK A;  1U3E M;  2VBW A;  4HKU A;  3JRA A;  4CO8 A;  3I4M J;  3KZI C;  5KNL A;  3GF2 A;  4IHV A;  3T6N A;  3IH4 A;  2OI8 A;  5DDG A;  2Z16 A;  1S8N A;  2KQR A;  2ZFU A;  1WKM A;  2ZME A;  2CRG A;  3GYH X;  2DJN A;  1OR7 C;  2XPV A;  3FDY A;  3M1C A;  3DBL B;  3IH2 A;  4RGS A;  1RPW A;  1VQ5 I;  2FBQ A;  1MW7 A;  4X0G A;  4CYD A;  1OCC H;  2LY9 A;  3VYS B;  4L0Z B;  4KUM A;  2JA2 A;  3D5S C;  4M6X A;  4O3M A;  3HTH A;  1O3S A;  1E3H A;  1APL C;  2XGC A;  4FX4 A;  3O3K A;  1G3S A;  4PDK A;  2QWT A;  1IRF A;  1VQ7 I;  3GZ5 A;  3S8P A;  3T0Y A;  2QBY A;  4DGW B;  4C3J J;  2LRE A;  4IOC F;  2D6Y A;  5DCM B;  4A0X A;  2EFQ A;  5L3B A;  3E7Q A;  1TQP A;  4HA8 A;  3RQ4 A;  2H8W A;  1U9N A;  4KMU X;  4DYR A;  2R5Y A;  1I6X A;  1IAW A;  1USS A;  3DEE A;  3D5L A;  2DI3 A;  4EEF G;  2DN0 A;  4G12 A;  2EZK A;  2RKH A;  2FX0 A;  2IVM A;  3I5U A;  1Z7U A;  1FJL A;  1YRN A;  4IQ4 A;  1JKQ C;  4BAY A;  1U5T C;  4JNN A;  3VYT B;  4XOP A;  4H0E A;  1YW8 A;  1KGS A;  2FML A;  2M7B A;  5LRS A;  1AA7 A;  4O5V A;  2FXA A;  1X3W B;  2OCC H;  5FFZ A;  4Y3O A;  4F55 A;  2YX7 A;  2RNG A;  4LG0 A;  4G7Z F;  1RNL A;  1KZH A;  2E1N A;  2GWR A;  2KIF A;  4D5F A;  2VPL A;  2LOO A;  3EGQ A;  5D5V B;  2XHK A;  2LD5 A;  3RH2 A;  1OFC X;  1TWF J;  3DWL E;  5J3L A;  3WTT C;  3VWB A;  1VZ0 A;  2HYJ A;  5IT9 Z;  1Z77 A;  4YFK F;  3FK6 A;  4XID A;  4XLP F;  1XCV A;  1YW9 A;  2HOA A;  5KVR A;  3DQV C;  2V1X A;  1NH3 A;  2CO5 A;  3FXR A;  4M6V A;  2IGN A;  2JUC A;  1ZKG A;  1SEU A;  3H3U A;  1ZRC A;  3WTU C;  1JKP C;  2LF8 A;  4CZZ A;  2L9S A;  3BLY A;  3JRI A;  4MTD A;  4Y17 A;  1LPQ A;  2VQC A;  5CXG A;  2O5R A;  2VJJ A;  1D1B A;  5IPA A;  2DXI A;  5A2Q K;  4FIS A;  3PO3 J;  2CUZ A;  2CH0 A;  1E3P A;  1O7L A;  1J9I A;  4JQF A;  2GZW A;  1T0F A;  2R7F A;  3GFJ A;  2JRM A;  4AC0 A;  2OTJ I;  1TLH B;  2PJR B;  1MMN A;  1EJ9 A;  5AIP A;  2EBI A;  3H3V K;  3CCQ I;  1TWA J;  3B6C A;  4X1E A;  2DT6 A;  3SFZ A;  1V3F A;  1VND A;  3A4C A;  3CP8 A;  1MBF A;  4ZTF A;  3MCZ A;  4II2 A;  3OV8 A;  1YO5 C;  1BOA A;  4HYE A;  5GAH J;  3WE3 A;  5DD8 A;  5ICE A;  1J09 A;  5EGO B;  2KJC A;  3TOB A;  3G1O A;  3M8F A;  2QYO A;  5D8L B;  1VI0 A;  1Q1V A;  2FF4 A;  3WG7 H;  3CCU I;  1JKR C;  5HSZ A;  3SQN A;  1SMT A;  5D5U B;  2X48 A;  3MNL A;  4XKW A;  4V2G A;  3KLO A;  3MMY B;  4DJA A;  2ZNZ A;  2H1L A;  2HVS A;  1W5S A;  3LA3 A;  3VDX A;  2PMH A;  2RVC A;  2DDA A;  4AYB A;  1E0E A;  1XCB A;  3HL2 A;  2L0K A;  2QQ8 A;  3OSG A;  1BI0 A;  2DMT A;  2WAQ A;  1Y56 A;  3FBI B;  5D5W B;  3Q0W A;  1VQ8 I;  1QA6 A;  4OAZ A;  1W36 C;  2MW8 A;  2O3F A;  1S5L C;  2WUI A;  3M7G A;  4C2M J;  3S3O A;  1R9T J;  5E3L A;  2M8G X;  2V9P A;  1WQ2 A;  2EFW A;  3V8J A;  1MBG A;  1X58 A;  4GFK A;  2MD5 A;  5HS7 A;  1QRY A;  2VB6 A;  3V7C A;  3BJA A;  4PJL A;  5J47 A;  3HSE A;  4KA4 A;  3BWG A;  1R1V A;  2D1H A;  1EH7 A;  3J7A O;  2OQG A;  1BL0 A;  1MJB A;  4A3F J;  4A2U A;  2Z2S B;  4CHU A;  5CLS A;  3DKY A;  3HIM A;  3HE0 A;  2E36 A;  1ETY A;  2DA4 A;  3HBL A;  2E2H J;  2HQN A;  1A35 A;  3GUD A;  2XRO A;  4OIQ F;  2MH2 A;  3HOX J;  1WH5 A;  2ACJ A;  3ZQF A;  1Z6T A;  3I59 A;  1FYL A;  2XKO A;  1IO2 A;  1QHG A;  2ZXW H;  5EDN A;  1Z67 A;  2PLY A;  2MC4 A;  3E3V A;  2CQX A;  2JVH A;  1QZY A;  3F72 A;  3R4K A;  4IHW A;  3ABU A;  1OCO H;  2EFP A;  1I39 A;  1MBH A;  3PM1 A;  2KFD A;  2XAJ A;  1OCR H;  1U8R A;  2HXI A;  4M3E A;  1MGT A;  4UHT A;  1X1C A;  2MLG A;  5H6R A;  2W53 A;  2YVH A;  3DLL F;  5EG0 A;  2RHA A;  4ZYA A;  1TQM A;  2QM3 A;  2BW3 B;  1OJL A;  2W4S A;  4RB1 A;  4HNT A;  2QEX I;  3C1D A;  5CVV A;  1PUF A;  2KRF A;  1L3L A;  2W48 A;  2DMP A;  5HLT A;  2M9H A;  3M8J A;  4AVP A;  2V9V A;  2G0E A;  3HRU A;  3E1S A;  4OMY A;  2LKP A;  1GLN A;  3DEW A;  1KQ9 A;  1X2N A;  2K4B A;  4D0P A;  1IZ1 A;  4KIT B;  3FHZ A;  3CUQ C;  3R0J A;  1R49 A;  2R93 J;  1ITY A;  2CV2 A;  4IX7 A;  2YVX A;  3BRU A;  5EEA A;  2FA5 A;  3MZY A;  5HVQ C;  1OPC A;  4KNY A;  3CWR A;  4I76 A;  3ZXS A;  4Q5S F;  2NS7 A;  3VIB A;  1MDM A;  4A6E A;  5E18 F;  3HPG A;  1LNW A;  2E1O A;  4OOI A;  2G7H A;  2JA5 J;  3HOZ J;  4D9J A;  5FFX A;  4XRM A;  2AQF A;  4OIO F;  2JN6 A;  2Q1Z B;  3IV5 A;  2IEK A;  1O3T A;  3QBM A;  5IYD J;  3DKW A;  4XLC A;  1HST A;  3DU6 A;  1OMI A;  3ABL H;  4P1W A;  2F5V A;  2ZC2 A;  3WGI A;  3ON4 A;  1UST A;  1I6H J;  1IV6 A;  3KP4 A;  1WHU A;  1F4K A;  5FRN A;  4N4O B;  4P9F A;  2ZCM A;  3QU3 A;  2L9N A;  6PAX A;  3KEY A;  4KDP A;  2W7N A;  3A02 A;  2TDX A;  2DTZ A;  4OIN F;  3KP7 A;  4B09 A;  4MQV A;  4ENK A;  3ONQ A;  3ZQH A;  4GFL A;  2QIB A;  2IGO A;  3ZR8 X;  3PSI A;  1MNM C;  3ZPL A;  4E7K A;  2IS4 A;  2Y9Y A;  2A5W A;  2ID3 A;  4KIB A;  2E1M B;  2X6Y A;  5HAW A;  4CGZ A;  3NWT A;  4DBR A;  4WCG A;  3K0L A;  2VC1 A;  3QYE A;  4RGR A;  3U1K A;  3MWM A;  1OYW A;  2V26 A;  3G73 A;  1PDN C;  2QKL B;  1ZHF A;  1NG7 A;  4AF5 A;  2MBF A;  5IYC J;  3H5R A;  1X1A A;  1B72 A;  3J7Z I;  2Z9O A;  1TWG J;  4Y13 A;  5F64 A;  2UXX A;  4XLN F;  3OYD A;  4F52 A;  3RQI A;  4BXF A;  1QO0 D;  4M74 A;  3A0H C;  2H94 A;  1G8X A;  4L0Y B;  4U9L A;  3BZK A;  4KWA A;  4EM1 A;  1FC3 A;  2E71 A;  4MEY F;  1JKO C;  2YU3 A;  3E5Q A;  2KRH A;  3B02 A;  2JPC A;  3VOD A;  2L3D A;  4M3D A;  3TQN A;  2ZCX A;  2M87 A;  3Q0V A;  4CA0 A;  3K4C A;  2FQ4 A;  4L5J A;  1G3W A;  1TQI A;  3QOP A;  4CYC B;  2XAG A;  1M1E B;  4GRI A;  4C30 A;  1MD0 A;  3FMR A;  1S6L A;  2PN6 A;  1PVE A;  3GTJ J;  3CRJ A;  5FHP A;  4AU7 A;  3TKY A;  2CFO A;  5EZH A;  2XF7 A;  4XKC A;  2L7F P;  3L1P A;  1W1W E;  3BNI A;  3EQL F;  2BXY A;  1OR7 A;  3RKW A;  3RKY A;  4LMY A;  3KYC B;  2LBF B;  1ETO A;  4A5N A;  3TL4 X;  2VJ4 A;  5BQT A;  5JVT A;  4D5C A;  3SDB A;  1ODD A;  2W1O A;  4AUX A;  4HX8 A;  1HOM A;  5K7F A;  2QTQ A;  4EGY A;  1VTN C;  3IUV A;  1HW1 A;  2I8D A;  4MXM A;  5CQG A;  4HLX A;  2HKO A;  2HGC A;  3GO5 A;  2UXH A;  3NNR A;  3VOX A;  3S1R J;  2B63 J;  3IKV A;  4AYB N;  1TP4 A;  3PQK A;  2BY0 A;  1J0R A;  4I09 A;  1YE9 A;  3CCE I;  2ADU A;  1SFX A;  1F43 A;  1H8A C;  1Z1D A;  3RZO J;  2WAQ N;  3S93 A;  4G6D A;  3FF5 A;  5DYM A;  2O03 A;  1HW5 A;  4DOZ A;  5K7Z A;  3IKT A;  4IJA A;  1HKQ A;  2G9W A;  2VKV A;  3BQZ A;  1J5Y A;  4QIW N;  4GO1 A;  2GOX B;  4FTH A;  3LSH A;  1D5V A;  2OQR A;  5ILV A;  3I64 A;  2BXZ A;  1YS6 A;  3NAU A;  1SD6 A;  5CVU A;  4NC6 A;  1U2W A;  3CMY A;  2IW5 A;  3L2W A;  1U5T A;  1FNN A;  2YSR A;  1R1U A;  2JRT A;  3U1D A;  1NK2 P;  4F7Z A;  1RIO H;  1SVL A;  3CCV I;  1K61 A;  3K2Z A;  3ERM A;  1JTX A;  2FQ3 A;  4UY8 I;  2QCO A;  2GXA A;  4YFN F;  3HOV J;  1MIJ A;  4XRS G;  5JR3 A;  1MMG A;  3LQR A;  4V2F A;  1WRJ A;  3OOU A;  1V5G A;  4PFO A;  1RKW A;  3DCF A;  3H35 A;  3LFU A;  3D5R C;  4IVN A;  4AIJ A;  2NX4 A;  4UDS A;  1HSJ A;  3RKX A;  1FX7 A;  3OYA A;  2CW8 A;  4LLG F;  1IGN A;  2DYS H;  3FXJ A;  3JR9 A;  2P5V A;  2E60 A;  2VBZ A;  5L3D A;  4XOR A;  2HOS A;  1XDU A;  2QBY B;  2TRT A;  3LOC A;  4LG3 A;  2GUH A;  2OC6 A;  1Z21 A;  9ANT A;  3LWJ A;  4M6Y A;  4BXU A;  2HTS A;  3ZP5 A;  2R5Y B;  4ME9 A;  1ZG1 A;  4HV5 A;  2F48 A;  1D5Y A;  3V78 A;  2WV1 A;  3ELK A;  1DP3 A;  2DJI A;  4RM2 A;  1HDP A;  2VKD A;  1Y1W J;  1TW3 A;  3BPX A;  1K7A A;  2B0L A;  4IRH A;  4BXX J;  4M3B A;  1ZGW A;  5M3F J;  1YTY A;  3GFL A;  1BM9 A;  2ZJQ F;  3KLN A;  3F6O A;  3VSL A;  1YHQ I;  2LDU A;  2XPW A;  1LEB A;  1I1G A;  3F8F A;  1UG0 A;  2X85 A;  2B7E A;  2VXD A;  1UMQ A;  2LTP A;  2Z5U A;  3Q9S A;  3TO9 A;  4CXF A;  5DM7 F;  1ZLK A;  2MSY A;  2AS5 F;  3GWZ A;  2ZO4 A;  3E97 A;  2HZD A;  3BG9 A;  1IRX A;  2BZT A;  2JWT A;  4DZJ A;  2R7W A;  4XK4 A;  1I50 J;  1DDN A;  5FRM A;  1R6R A;  3TDU C;  2XSD C;  3K4N A;  3WHC A;  3V6G A;  3PO2 J;  2KPM A;  2V9K A;  5HLG A;  1XSV A;  3U2R A;  1F36 A;  2NRA C;  2GXB A;  1RC9 A;  3OWT A;  2HNH A;  2MC3 A;  1ZYR F;  1A6I A;  3KIO A;  3ECO A;  4F3Q A;  4I99 C;  3HOT A;  4UNO A;  4GGG A;  4NEL A;  1P7I A;  4HV6 A;  3O60 A;  2BEO A;  2F5F A;  2J5P A;  1ZK8 A;  5LEJ A;  4PJ0 C;  2AO9 A;  1OYY A;  1WJC A;  1WI3 A;  4U0Y A;  3GTM J;  4CUG A;  4A3I J;  4EAT A;  3S1Q J;  4LOC A;  3RDI A;  4EQQ A;  2X6O A;  4CCK A;  4NC7 A;  4HAM A;  1KU2 A;  4PFP A;  5HNF A;  2A6H F;  3W2A A;  5FLX K;  1D1C A;  3OYC A;  3L2Q A;  3JCU C;  1LFP A;  2ZOZ A;  4U0W A;  3IAS 2;  3BR3 A;  3WGH A;  3OYB A;  1A5J A;  3TOA A;  2NXN B;  5J8F A;  4H4K C;  3JRB A;  2GLO A;  2HDC A;  5BPD A;  2VBX A;  2VIX A;  3OR2 C;  4M71 A;  1UHW A;  2KMU A;  3G4S I;  3S16 J;  4B48 A;  3FWE A;  3H5N A;  3TDZ C;  3EYY A;  3HKZ A;  5IP9 J;  4UV9 A;  4HDV A;  3MD2 A;  3DTK A;  5C4J J;  3C2G A;  4RM3 A;  3LHQ A;  2V1N A;  3T1B A;  1GVJ A;  2HOE A;  4BQN A;  2HVQ A;  3CCJ I;  2JT1 A;  2XDV A;  3J81 Z;  2CS3 A;  2XAS A;  3RJP A;  3KX2 A;  3A1Y A;  3QPS A;  5LGN A;  2HPI A;  4R1H A;  5FLV A;  2EPF A;  4V19 K;  2L2O A;  1SD7 A;  2DK8 A;  1A6Q A;  3WTS C;  1FWZ A;  4DYQ A;  3RIR A;  2RN7 A;  2ME0 A;  5IT9 K;  2KL4 A;  2FNA A;  1VQP I;  1WGX A;  2G7S A;  2EIM H;  2DDB A;  2ZJP F;  5GP9 A;  5J8C A;  3AFH A;  2VOP A;  1MJA A;  3BJO A;  3NS4 A;  3EDP A;  2DU9 A;  2ISY A;  4KN7 X;  1F9N A;  3QPT A;  4BGD A;  4WK8 F;  2DA2 A;  2IRF G;  3T5X A;  1S7O A;  4W97 A;  3ECH A;  2A6T A;  3JTG A;  2RQQ A;  2Q2E A;  1AKH A;  1ZQ3 P;  2KDO A;  4MNU A;  1W36 D;  5IYB J;  3WU1 B;  4CH7 A;  3CUQ A;  3JRF A;  3GTL J;  3SEQ A;  2K9Q A;  1O4X A;  2F2E A;  1U8B A;  3J7A Y;  4J00 A;  3GLL A;  3W6J B;  2VE9 A;  5HOO A;  2CQK A;  2WC2 A;  1Y1V J;  2L7K A;  5C4X J;  2ZCW A;  4OD5 A;  3K4K A;  4D1Q A;  2A69 F;  2E34 A;  3E6M A;  3KEQ A;  1S29 A;  2MYS A;  4K2E A;  2ZOY A;  3E5U A;  4BE1 A;  3I59 B;  1QBJ A;  1S72 I;  2Q24 A;  2Y31 A;  3WTX C;  3MKY B;  4KYW A;  2B1E A;  4I2O A;  4UUS A;  3ZQ7 A;  2Z33 A;  1BBY A;  1V5F A;  1IRZ A;  2GAU A;  3FMS A;  4IHS A;  5IP7 J;  3N05 A;  4DBQ A;  4ANJ A;  2LY2 A;  3EUK L;  2Z3Y A;  2G7L A;  1T98 A;  2VUM J;  3P9C A;  3DPT A;  4LLL A;  2IU5 A;  4U7B A;  5EG0 B;  2QA4 I;  3FKJ A;  1IUY A;  3LSJ A;  5ILU A;  3HRS A;  4NHJ A;  1IC8 A;  3E5X A;  1EKE A;  1QU3 A;  4MQ9 F;  3TED A;  1N75 A;  1Y8Q B;  1IN8 A;  1ZEL A;  5J1Y A;  1BW5 A;  1X1D A;  2BY2 A;  1Q1H A;  2DCE A;  2L7Z A;  2XF5 A;  3ERE D;  4OU0 A;  1S9H A;  3H9J A;  1TNT A;  2F4O B;  3F6V A;  5AON A;  5M3M J;  4BBS J;  1I3Q J;  5HS8 A;  2L9R A;  5L3F A;  2HKU A;  3Q9V A;  2GIZ A;  1JUM A;  5M5Y J;  1TZL A;  1OYI A;  5ERI A;  1N77 A;  1MDM B;  3FXQ A;  3BJ6 A;  4WX9 A;  4UV8 A;  2EIL H;  4MFE A;  1HW2 A;  1LVA A;  2VON A;  3GTK J;  2I10 A;  4QLC U;  3BQY A;  1B6A A;  2FNP A;  3OMY A;  5GPC A;  4HST A;  3LAP A;  2Y75 A;  1L0O C;  4PJM A;  3UR3 C;  2XV4 S;  3QPH A;  1S7E A;  3GFM A;  3J80 K;  3GTP J;  1R4M B;  2K3F A;  1XS9 A;  4Q4Z F;  4XKV A;  4WXH A;  3NQO A;  1G4D A;  2OA4 A;  4HBL A;  5IP6 A;  3ASN H;  3RPQ A;  2OTL I;  1MSF C;  1LJ9 A;  2DBB A;  3ZQC A;  4HX4 A;  1H9G A;  4AVZ A;  3G1M A;  3OS1 A;  3I55 I;  4DW6 A;  4BJ5 C;  3ZQQ A;  2NS8 A;  2P4W A;  2DFF A;  2XAF A;  4RA2 A;  3QKX A;  4JX5 A;  4P96 A;  5J1R A;  2X4H A;  1FBU A;  3ESW B;  2I5U A;  5GAG J;  3VP5 A;  1JUP A;  3IRQ A;  1BR4 A;  2ZXJ A;  4B43 A;  3JAM Z;  2EV6 A;  1V4R A;  2E7W A;  3SWH A;  2HTJ A;  1UCR A;  3RYR A;  2VJ5 A;  5LGT A;  2COM A;  3OL3 A;  4WXD A;  1SFK A;  4AWX B;  3L2C A;  1HKT A;  2R7V A;  2FRH A;  3LWF A;  2CW7 A;  2EB7 A;  2Z1D A;  3O6B B;  4FX0 A;  3I9V 2;  4LFU A;  5HLI A;  3ULQ B;  2FUG 2;  5TRD A;  1W7P A;  2NVU B;  2R7Q A;  4IHY A;  1A36 A;  1OQY A;  3O8H A;  2EA2 A;  4EV0 A;  4PGH A;  1HDD C;  5CVJ A;  2XKP A;  4N0B A;  5FKN A;  1YLF A;  1XG1 A;  3FM5 A;  3I3L A;  4CCO A;  1RES A;  4YRV A;  3HUG A;  4XLH A;  5B66 C;  2EK5 A;  3KP5 A;  3FXO A;  2JA8 J;  2F5D A;  4JK1 X;  4ZJZ A;  1R71 A;  2L02 A;  1O57 A;  2M1B A;  2YVE A;  4IO9 F;  3BTL A;  3G3Z A;  4A3J J;  2V79 A;  2VBY A;  4NN1 A;  1QGP A;  2KIQ A;  2Z99 A;  3RTR A;  2X9D A;  2DT5 A;  3KP2 A;  3MVP A;  2QQA A;  3K4B A;  3W6K B;  3ZRG A;  1SFU A;  2G3B A;  2LRD A;  2DAO A;  1B8I A;  1GXQ A;  3L2U A;  5FJ8 J;  5FGL A;  1X4O A;  2IBD A;  2JK3 A;  4LGW A;  2XSJ C;  4LJZ F;  4ENJ A;  1K83 J;  3NWS A;  3DPU A;  3LSG A;  1FEX A;  3KKC A;  1KQ0 A;  2VAS A;  4IXA A;  4BH9 A;  1WJD A;  2KDZ A;  3D1N I;  3HKZ N;  1Y0N A;  2BBY A;  4QSH A;  2M3A A;  3IC7 A;  1X1P A;  2ZSH B;  3C18 A;  5LGU A;  3BDD A; 
#chains in the Genus database with same CATH homology
 1MBJ A;  5F04 A;  4Y7N J;  4FCY A;  3EUP A;  5F27 A;  3G56 A;  3MKL A;  2VPR A;  4AF5 A;  3GZI A;  2JMW A;  2DMQ A;  5IYC J;  3G1L A;  3GBG A;  4GCK A;  1PUF B;  3VW2 A;  1VFC A;  1B72 A;  1TWG J;  1CQT A;  3FIS A;  5F0F A;  1ENH A;  1RKT A;  3RQI A;  2PZ9 A;  4W1U A;  2HXO A;  4A3M J;  3QPL A;  4KWA A;  4A3B J;  2ME6 A;  3LNQ A;  1JKO C;  2TCT A;  2YU9 J;  2ZCX A;  4M3D A;  1JT6 A;  2LP0 A;  4L5E A;  3Q0V A;  1AHD P;  5D18 A;  2FQ4 A;  3DPJ A;  3JRH A;  4CYC B;  3GTQ J;  5IOZ A;  4I6Z A;  1IDZ A;  4IHX A;  2ZCN A;  2D5V A;  2XB5 A;  3GTJ J;  3CRJ A;  3S5R A;  3LSR A;  5FHP A;  5IOY A;  3RD3 A;  3RZD J;  3I4N J;  5EZH A;  3OSF A;  1ETK A;  2Y0S N;  2L7F P;  3L1P A;  2R0Q C;  3OIO A;  2NP5 A;  3BNI A;  3VVZ A;  3S2H J;  2N8G A;  2OF7 A;  4DYC A;  1MBE A;  5E3M A;  3Q3S A;  1ETO A;  4JL3 A;  2WB1 N;  3S1M J;  4D5C A;  1HOM A;  1ETX A;  4AUX A;  5HBU A;  4AC6 A;  5K7F A;  1HLV A;  2QTQ A;  3K7A J;  3IUV A;  4MXM A;  2XGE A;  4A3K J;  2JJ7 A;  1UG2 A;  1FIA A;  2UXH A;  3NNR A;  3VOX A;  2QF7 A;  3S1R J;  2B63 J;  4AYB N;  1LE8 A;  4MFD A;  3C2B A;  3UKG A;  2OPT A;  1F43 A;  1H8A C;  2FJ1 A;  3RZO J;  1VF9 A;  2WAQ N;  5M5X J;  2DG8 A;  4MLO A;  3JRC A;  3QQA A;  5K7Z A;  4QTR A;  4PXI A;  3O8G A;  2O9L A;  1JJ8 C;  2VKV A;  2NP3 A;  5EYR A;  1ZR4 A;  3BQZ A;  4M3G A;  1U78 A;  4QIW N;  3FRQ A;  2E2I J;  4FTH A;  5FKL A;  3CQZ J;  2RAS A;  1H88 C;  2CU7 A;  2UXO A;  3HTA A;  1GVD A;  4CYC A;  3NAU A;  2DA6 A;  5DAJ A;  3CMY A;  4JX6 A;  3Q0U A;  5C3E J;  1Z0X A;  3MN2 A;  3F0C A;  1B72 B;  5E3N A;  3BJB A;  3KZ9 A;  1NK2 P;  4JP0 A;  1K61 A;  4ICH A;  1JTX A;  3M3Y J;  2QCO A;  3HOV J;  4B3A A;  4XRS G;  3GTG J;  3HEF A;  2DA3 A;  4D7N A;  4MIM A;  4V2F A;  2V57 A;  3OOU A;  1ORK A;  3JRD A;  1RKW A;  3DCF A;  1P7J A;  2M0C A;  3B6A A;  2NX4 A;  4M3F A;  4UDS A;  3BR2 A;  1FTZ A;  2AHQ A;  2K9S A;  2EQR A;  1WH7 A;  1IGN A;  4Y52 J;  4L62 A;  3JR9 A;  3ZQL A;  1MH4 A;  3FIW A;  1AU7 A;  2ELK A;  3NXC A;  3A01 B;  1T56 A;  2HOS A;  2PMZ N;  2TRT A;  3BTJ A;  3LOC A;  3GTO J;  2G7G A;  2GUH A;  1JGG A;  9ANT A;  1RR7 A;  2R5Z B;  1ETV A;  3LWJ A;  2R5Y B;  1JTY A;  4ME9 A;  3HM5 A;  1SFO J;  4JKZ A;  4BY7 J;  3TW6 A;  1X2M A;  2XPU A;  1D5Y A;  4A3G J;  3CCY A;  3V78 A;  1FIP A;  2WV1 A;  1GDT A;  4A3L J;  4C3H J;  1W0T A;  2JA7 J;  5BNG A;  1EF4 A;  1HDP A;  1QVU A;  5D19 A;  5AQC A;  1Y1W J;  2CUF A;  3HTI A;  4MK6 A;  2XDN A;  5FMP A;  1BJZ A;  4JX4 A;  4BXX J;  4A69 C;  4M3B A;  1ZGW A;  4HKU A;  5M3F J;  3JRA A;  2GFN A;  1LE8 B;  3SJM A;  3S17 J;  3I4M J;  2M34 A;  3ZQI A;  4IHV A;  4YZE A;  3IH4 A;  1ZR2 A;  2OI8 A;  2XPW A;  3T6N A;  2LTP A;  1UMQ A;  2CRG A;  4A93 J;  2DJN A;  2K9N A;  2MSY A;  1LFB A;  2XPV A;  5F08 A;  3IH2 A;  1MBK A;  1RPW A;  2NOG A;  2FBQ A;  1POG A;  3BG9 A;  3BT9 A;  2JWT A;  1UI5 A;  2LY9 A;  3VPR A;  3W6V A;  4DZJ A;  4XK4 A;  1I50 J;  3TP0 A;  3BHQ A;  3BR1 A;  2XSD C;  3HTH A;  1APL C;  2XGC A;  3WHC A;  1HF0 A;  3V6G A;  3PO2 J;  2QWT A;  3H0G J;  1F36 A;  1JJ6 C;  4GFB A;  1MSE C;  3ANP A;  3A01 A;  4GCL A;  4HNV A;  2D6Y A;  1A6I A;  4C3J J;  2ZB9 A;  4NEL A;  1P7I A;  3NAR A;  3E7Q A;  2R5Z A;  1WPK A;  2GBY A;  3VW0 A;  4DYR A;  1U9N A;  2R5Y A;  3O60 A;  4RDU A;  2H1K A;  1ZK8 A;  3S14 J;  2AO9 A;  2O7T A;  4EEF G;  2DN0 A;  1WI3 A;  2QKO A;  4G12 A;  2EZK A;  3GTM J;  5JLX A;  2NVX J;  4A3I J;  2FX0 A;  5H9T A;  3HOW J;  3S1Q J;  1FJL A;  1YRN A;  1JKQ C;  4LOC A;  4MO7 A;  1H89 C;  2M2E A;  2X6O A;  4JNN A;  2LKX A;  1BW6 A;  3G7R A;  2K40 A;  5F1J A;  1AKH B;  2ZOZ A;  1SAN A;  3BR3 A;  1IG7 A;  1NTC A;  2GEN A;  2ECC A;  5E3O A;  4D5F A;  1A5J A;  2FD5 A;  3HTJ A;  1TC3 C;  2LFB A;  3EGQ A;  3JRB A;  2LD5 A;  2GLO A;  4BY1 J;  3RH2 A;  1OFC X;  1TWF J;  5J3L A;  2HYJ A;  3S16 J;  3NRG A;  4FE4 A;  4ACI A;  1Z77 A;  2IAI A;  3BR5 A;  4C3I J;  3FK6 A;  4XID A;  3VOK A;  3HGY A;  5K7H A;  5IP9 J;  2HOA A;  1UI6 A;  3VUQ A;  2EZH A;  5C4J J;  3FK7 A;  2YUS A;  2UXI A;  4M6V A;  3LSP A;  3LHQ A;  5J1U A;  1ZKG A;  2REK A;  2HOT A;  3ON2 A;  2LVS A;  3NPI A;  3PAS A;  1JKP C;  3QPS A;  5EZG A;  2KT0 A;  5FLV A;  3KKD A;  5C44 J;  3JRI A;  1W0U A;  4DYQ A;  5CXG A;  2UXP A;  2ME0 A;  1ZTR A;  1DU0 A;  2HDD A;  3K2A A;  2XRL A;  2R92 J;  5IPA A;  4RBO A;  3B81 A;  4FIS A;  1QVT A;  1WGX A;  2G7S A;  5HAW A;  4FE7 A;  4D7M A;  5GP9 A;  3PO3 J;  2EZI A;  4A3C J;  2DA2 A;  2MG4 A;  4AC0 A;  2RAE A;  4W97 A;  1ETQ A;  1AKH A;  1ZQ3 P;  2EBI A;  3H3V K;  1GV5 A;  3TP3 A;  5IYB J;  1TWA J;  3B6C A;  4X1E A;  3SFI A;  3KNW A;  5CW8 A;  5D1R A;  3JRF A;  4UUT A;  3GTL J;  3CJD A;  1VND A;  2CQQ A;  1T33 A;  1MBF A;  2CJJ A;  2K9Q A;  1U8B A;  1O4X A;  1E3O C;  5K58 A;  3ANG A;  3HB9 A;  2DMN A;  2UXU A;  1Y1V J;  3HGG A;  3S15 J;  2EH3 A;  5C4X J;  5EGO B;  3G1O A;  1TWC J;  1YRN B;  1VI0 A;  1Q1V A;  5FLM J;  1JKR C;  5HSZ A;  2ZOY A;  3VVX A;  2JA6 J;  5M5W J;  2X48 A;  2Q24 A;  3MNL A;  3IH3 A;  4V2G A;  2Y31 A;  4IEJ A;  3RKQ A;  4UUS A;  1IRZ A;  5EFY A;  5IP7 J;  1HCR A;  2O8K A;  2VKE A;  3E7L A;  2L0K A;  5HOD A;  1DU6 A;  1OCT C;  5EF6 A;  3OSG A;  2YS9 A;  2G7L A;  2DMT A;  3P9T A;  2VI6 A;  3VW1 A;  2VUM J;  3VVY A;  1IUF A;  3BTC A;  1GV2 A;  2IU5 A;  3Q0W A;  5EG0 B;  3AQT A;  3WHB A;  3ZOB A;  2MW8 A;  3LSJ A;  2DMU A;  4BBR J;  1IC8 A;  2WUI A;  4JYK A;  4C2M J;  2Y9Z A;  1R9T J;  5E3L A;  2EZL A;  3TED A;  1MH3 A;  2M8G X;  1JT0 A;  1XC5 A;  1MBG A;  1X58 A;  4GFK A;  5J1Y A;  1BW5 A;  4S0H B;  3TW7 A;  1QRY A;  2L7Z A;  4NDL A;  5DS9 A;  2NVQ J;  1BA5 A;  4GCT A;  1BL0 A;  3COL A;  4A3F J;  5M3M J;  4BBS J;  2R7Z J;  3HE0 A;  3HIM A;  1I3Q J;  4CGR A;  3A03 A;  2L9R A;  2DA4 A;  1ETY A;  3HBL A;  2E2H J;  3M4O J;  2HKU A;  1JUM A;  3NI7 A;  1ETW A;  5M5Y J;  3PPB A;  3ZQG A;  5EGO A;  4MFE A;  3HDD A;  4A3D J;  3HOX J;  1WH5 A;  2XB0 X;  3GTK J;  2I10 A;  3S2D J;  3ZQF A;  3BQY A;  4ABZ A;  2DA1 A;  2Y2Z A;  5GPC A;  2H8R A;  2F07 A;  5EDN A;  4B1R A;  1SGM A;  3CDL A;  2CQX A;  2PBX A;  4IHW A;  4DZP A;  1FTT A;  1S7E A;  3BR6 A;  3GTP J;  3BCG A;  1XS9 A;  3LJL A;  1MBH A;  2Y30 A;  3PM1 A;  4XRS A;  2HXI A;  4M3E A;  2COB A;  2W53 A;  5IP6 A;  4XIC A;  2HI3 A;  2O7O A;  1U9O A;  2YVH A;  5EG0 A;  3BG5 A;  2RHA A;  2WGB A;  1OJL A;  3ZQC A;  1MSF C;  1UHS A;  1GT0 C;  1WCM J;  3G1M A;  1PUF A;  1B8I B;  3SDG A;  4DW6 A;  2L7M P;  5FKM A;  1RET A;  2W48 A;  3HOY J;  2DMP A;  4X6A J;  3F1B A;  2M9H A;  2NS8 A;  1IDY A;  2G0E A;  2LLK A;  4J19 A;  2GM4 A;  3QKX A;  4JX5 A;  5CXI A;  5J1R A;  1X2N A;  3DEW A;  3VP5 A;  1JUP A;  4UUS B;  1JUS A;  2R93 J;  1ITY A;  3BRU A;  5EEA A;  3BG3 A;  1QPI A;  3CWR A;  1NK3 P;  4I76 A;  2NS7 A;  5FKO A;  3JRE A;  3VIB A;  3JSJ A;  5FKK A;  1G2H A;  2E1O A;  2JA5 J;  3HOZ J;  2E2J J;  2NVY J;  2XGD A;  2HQ5 A;  4XRM A;  4IHY A;  1LFU P;  3O8H A;  2JN6 A;  3IV5 A;  2IEK A;  1HDD C;  2HYT A;  3QBM A;  5IYD J;  5FKN A;  5F0H A;  1XG1 A;  1RES A;  5DTD A;  2JA8 J;  2NVT J;  3BR0 A;  3ON4 A;  1IJW C;  5JLW A;  1I6H J;  2YVE A;  1IV6 A;  2ECB A;  3BTL A;  4A3J J;  2MGQ A;  2P81 A;  1TWH J;  4NN1 A;  4A3E J;  2LK2 A;  2X9D A;  2ZCM A;  3C07 A;  3MVP A;  3BTI A;  3HOU J;  2G3B A;  1GUU A;  5GPA A;  3S1N J;  2E19 A;  1B8I A;  2DA7 A;  2QOP A;  5FJ8 J;  3A02 A;  2DTZ A;  5FGL A;  2CUE A;  3JRG A;  2OER A;  2DA5 A;  2IBD A;  2JK3 A;  2LR8 A;  3KKC A;  1FEX A;  1K83 J;  3ZQH A;  4B4C A;  3LSG A;  4GFL A;  2QIB A;  4BKX A;  5F0C A;  2KDZ A;  3D1N I;  3HKZ N;  1MNM C;  5C4Y A;  3FKI J;  1OCP A;  2Y9Y A;  2ID3 A;  4QSH A;  2DG7 A;  2ID6 A;  3AQS A;  3GEU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...