3K8PC

Structural basis for vesicle tethering by the dsl1 complex
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
352
structure length
295
Chain Sequence
NIYTTLKFESMMQQRVIQIRSIPEEEYHELVSVQPIQVSVFVQSAAKVFTEFEQGCDTIGRSKVESIYLYKFNLLQTAFFAMVSEKVNDWTQLYKDVRYLYTENPKLLQLMELNSRRLDLNLNLIKKTIYKLVNDQLQELKDNERTPDWDITISSLLPYLKKTALPTLYKLEDNTILVALIRYIVHDLVIDNILHWRVISEKSSENLSEFIMLLLSGLEIPRLNLIETYRHSREKLGILSKILTAHLKDILEMFYEGEFFLFETDEIVQWIILLFADTPTRRDCIDEIRRVREEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Dsl1
publication title A structure-based mechanism for vesicle capture by the multisubunit tethering complex Dsl1.
pubmed doi rcsb
source organism Kluyveromyces lactis
molecule tags Transport protein/transport protein
total genus 112
structure length 295
sequence length 352
ec nomenclature
pdb deposition date 2009-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF11989 Dsl1_C Retrograde transport protein Dsl1 C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.150 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor; domain 2 3k8pC02
1.20.58.1440 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3k8pC01
3K8PC
chains in the Genus database with same CATH superfamily
3IHRA 2VK9A 3F1BA 4H9PC 5JR9A 4O2AE 2XPVA 1Y64B 4JKZA 2XJ7A 2Y31A 3OJAA 5A1LA 4I0UA 5F5WA 4TWHA 2IAIA 3IA3A 3CPZA 3SFIA 5GP9A 2YVHA 3E7QA 2K5BB 4YTPA 2MOZA 3BR5A 3QNUA 4IE0A 5FY7A 3O8HA 4H9QC 4ACIA 3AECA 2BS2A 3B57A 2W66A 2R7WA 4MLKA 3WHBA 2UXDT 2LHNA 3V5UA 3NWIA 5FMPA 4A5XA 2XDNA 2JQQA 5EZHA 2LE8A 2NR4A 4JNNA 4ICHA 4OD4A 3QK6A 4K0KT 3V6GA 3NS4A 4KP3C 4DR7T 4WIBA 5BR8T 2WU2A 5AQJB 3C4ZA 4U7YA 4KUMB 2F07A 3N2OA 3JAEA 3T6NA 2BG9A 2CCQA 4K0UA 1W09A 5CGMA 3AE8A 3JSJA 3KBTA 3UU4A 2IBDA 2IMLA 4IIJE 3UQ4A 2BBJA 2CRBA 4O4JE 5ADXL 4YXDA 4W1UA 1M62A 3PUGA 2EHOA 5JR9B 5K58A 1D0XA 2OPTA 3P4QA 3ON2A 2H89A 3IEEA 2IHR1 5L47A 3LG7A 2DCFA 4F6RC 1HG2A 2HN2A 3OKQA 3PUSA 3E22E 4ILAA 4QX7B 2KZ7B 4BJMA 3NVOA 4B3ST 1MMGA 4X1KE 4AKGA 3CDLA 2V6YA 4LF7T 3BR0A 2CM0A 1JUPA 3C07A 4X1IE 2HH7A 3HKCE 4YFSA 3DJBA 4DNDA 2R7RA 3AE4A 2CXDA 2ZCNA 4M3FA 3CIRA 1KFYA 4IL4A 3P4SA 4QKNA 4B3MT 5FNVE 3ZQFA 2WSSV 3AA7B 4QXHB 4DV3T 3PV0F 3ZMUB 3ZSTA 5AQCA 2BG9B 4UVCB 5IOYA 3MK7C 3ZMVB 4CZZB 2WCAA 1YQ3A 1I6ZA 3SFDA 5AQFB 2EHOB 3MA9A 4IDPA 2XQYA 3P4RA 4UVAB 1W0AA 4CI3B 1QVTA 1UI5A 4LF4T 1J5ET 1UUSA 3ZJ1A 5M4YA 4EXTA 4TWDA 4LF9T 1O3XA 3Q5DA 5EYRA 1HG5A 1IZNB 3BCGA 1LKXA 1XDPA 1SHZC 4MALA 2NW8A 3ETUA 5H6QB 4IDQA 3QQAA 2YU1A 1HFAA 2E9XB 2UXPA 4ILBA 3BR6A 3IUVA 3IH2A 4ZI3D 4XZCA 2UUAT 1D1CA 3LK42 2HYJA 5H9TA 3NRYA 2QKOA 3VR9A 3BNIA 3HTIA 4TNWA 2XQ3A 3VW0A 3UUBA 2QWTA 3BHQA 2FJI1 3GN5B 2YDRA 4IE6A 2XAFB 4AXPA 2XGEA 2HPJA 1D1AA 2NP5A 2B76A 2H88A 3P4WA 4YHHT 2XHEB 4X62T 1HX8A 2JMHA 2PBXA 4UV8B 4DW6A 5EZGA 5HWYA 2C5JA 2WMNA 3VKGA 2NW9A 3NI7A 2IAKA 5DJQC 2X9WA 3Q5XA 1N32T 3CWRA 4AUXA 1FEWA 2XAQB 3B6CA 4B6XA 5FY1A 2L3LA 5FYMA 3RX6A 3RIUA 4B3AA 3CJDA 2JJ7A 1UX4A 2X0LB 2EHOD 4OHFA 3BTJA 3FB2A 3NKZA 2B1EA 3RHWA 2IC9A 2XAGB 2V26A 2KINB 4C90A 2EH3A 2FJDA 4L0RA 2W0GA 1UGOA 2E2AA 4YSYA 2CPTA 3S4UA 5KXJA 4U2ZA 3AEDA 4CXWA 4MFRA 5LCYA 4EAHA 3B5MA 4YTNA 2MPKA 3GWHA 3T1YT 2J4GA 4X66T 3O8GA 2X0YA 2R7QA 5LXTE 1EZ3A 2ZB9A 4LF8T 3K8PC 3OYZA 3G7RA 5D18A 2Y2ZA 2E9XD 1UK5A 3BT9A 4X5TA 3N9MA 5EK4A 2VKHA 2I6HA 3AEBA 4GCKA 4QHOA 1G8XA 2ZM0A 4ME9A 4DR2T 4HFVA 2MAWA 2ODVA 4JI5T 2SPCA 2IU5A 5FXVA 5J1RA 5EK2A 2LRKA 2OF7A 3IF8B 1XNQT 3B13A 3SWHA 5LP6E 4M3EA 1KNZA 4TZ4C 4HWIB 5HEUA 3T8OA 4LMKA 4H63H 2D0UA 3CX8B 2BDEA 1XMQT 4Q25A 4UEMA 2KLQA 4PXIA 2K48A 5E0OA 3Q2MA 4AI6A 4L9IA 3C51A 2VQFT 4IL9A 1LRZA 5L3CB 3TP3A 1KNPA 2WM9A 2DWGA 2CXFA 5FKLA 4G2AA 2XUEA 3RC8A 2RHAA 2FBQA 5EK3A 1WR6A 5L3GB 3LSPA 2BKNA 2XRLA 1ZP0A 3IH4A 2X51A 2F4VT 2G7GA 1NAFA 3VRBA 1ZEEA 2LM2A 4MXMA 2G0UA 3HTHA 3EDUA 2LSIA 1HNXT 3KINB 2NP9A 2JQ9A 4DUZT 2Z6EA 3QKXA 4DR3T 3ON4A 3LSRA 4M3DA 2C5IT 4V2GA 5CXIA 2XM1A 2QVAA 5D19A 3ANWA 2V5DA 2Q9QB 5KDMC 2BKPA 4PAGA 2VKEA 4AC0A 4HFCA 2XTLA 2LOPA 5L4EA 3ONXA 4V2FA 4JI7T 3FIWA 5LGNB 5LMUT 4PK4A 3PTRB 2XSBA 1JUMA 1HCIA 3R6NA 2X67A 2LM9A 1WFDA 4XBFB 2PJQA 3ZN0B 5JDQA 2KXPB 3ONLC 1W9RA 4I43B 1QSDA 3LOCA 1ZV4X 3C98B 5AFUL 5GONE 2E5VA 4ZXLA 3WAJA 2G7SA 3BR2A 2NTXA 3LHQA 4YJ3E 3PU3A 1KF6A 1XWMA 2V5CA 3SOLA 4GKKT 5IWAT 4U33A 3FZHB 4IHJE 3H3AA 2FJAA 3HTAA 2VPRA 4ISSA 2ZM6T 1D0ZA 2MBGA 2WU5A 1ORKA 3ANWB 4KHPT 3P7IA 1WYCA 3NZQA 3TLVA 1HS7A 5LHHB 3TLTA 2WAUA 1XMOT 4O8SA 1YW0A 5CB4E 2CMRA 2NWBA 1MMNA 1ZKEA 5C3JA 3V5SA 4ERRA 3N5LA 3G1OA 3ZCJA 2PG8A 3AE7A 4F8HA 3N2KE 3RD3A 2UXCT 1G73A 3EHZA 1YQ4A 5CJ5A 5AQNB 4NUVA 5FKKA 3VPRA 3FK6A 3CMLA 2P9BA 2V7MA 4P09A 3C64A 3CK6A 4AQYT 5FY0A 5ABFB 2PTFA 1OEDC 3EDVA 3QB5K 2J47A 2ACZA 3BTLA 2Q9QD 3L3PA 1UX5A 4YSZA 2O7TA 5IOZA 2W00A 1X79A 5HEHA 4CI1B 2UXUA 3GA8A 4DV4T 2RA1A 5HXEA 3M3ZB 4H9RC 3QUJA 2D6YA 5C4YA 5J1GA 3FZKB 4YLHA 2QIBA 2D2SA 3VW1A 4PJNA 1QVUA 4I6ZA 2I0MA 4IE7A 4PJLA 4MHCA 2R7OA 4HKAA 3RYHE 3ANPA 3PUYF 3VHLA 2R7VA 5AQGB 3ABVA 4I76A 5JH7E 3F2EA 4B3RT 3VOKA 4ZZBA 2ZOYA 4O4IE 3LFMA 2A3DA 3IBPA 5LHIB 5CA1E 5AQUB 4EZHA 1FIOA 3ZYMA 2WUIA 4HFHA 3C50A 3P50A 2TRTA 3HTJA 2FJBA 3M65A 2UUBT 4TX5A 3I1AA 3AB3B 3BQLA 2WV1A 5AQRB 1MIVA 1AJ3A 4HKUA 1HTJF 4JYAT 1JT0A 4AF5A 2FX0A 3QPLA 3QBMA 4B1RA 4TNVA 2JQHA 2K24A 3LDQB 3ZKRA 4U3CA 3SRZA 3MJXA 4HFDA 5FP3A 3P8CD 2RASA 2NP3A 2V7LA 4DV5T 4Z90A 2WBLA 2WMOA 4HGAA 4A56A 2ZOZA 1XDOA 2W4XA 3ZYKA 3ZPOA 4YTMA 5AQMB 3T1HT 3VU7H 2YVXA 3DU6A 5LJNA 3AEEA 5AQHB 2X9XA 4DIDB 2E8IA 3N9QA 1MMDA 2ID3A 2LHRA 4UDSA 2BBHA 2UU9T 3UQ7A 1IBLT 1ZHCA 4BJNA 5GPAA 5L2LA 2YN6A 2UXNB 2LOSA 4A98A 3AE9A 3KFWX 2VQET 3JAFA 4CXXA 1CHUA 3ZN1B 2CWYA 2QTQA 2KSRA 4TWFA 4UF0A 5FGLA 1W0BA 5JDLA 5IYZE 4GKJT 3K3NA 5J1UA 3AEAA 2HKUA 1LVKA 1JTXA 2XQ7A 2R7SA 4EZ4A 3TLWA 1T72A 1MNDA 4DV2T 1Z0PA 5FMNA 4AQFC 2A9UA 4IE4A 2R7TA 3RF1A 3RYCE 3DEWA 3ZMSB 4WBNE 2KWHA 2BG9E 3PUWF 3RQWA 3UUMA 2LT3A 3RKGA 2V6YB 2CHOA 3Q9DA 3EAMA 2ZM8A 5LBMA 2BS3A 2YDQA 4BAYB 1E2AA 3LSJA 2V7JA 3MXZA 3QOFA 3UU3A 4EYYR 2NS7A 5CW8A 3CQCB 5HXCA 5JDHA 4UXNB 3J9X1 1SA0E 4H9OC 4PFPA 2E9XC 5LNKA 3G06A 4ZS2A 3G56A 3MACA 2MYSA 3UFEA 5ABHA 3L8RA 1BR2A 3N2GE 1DU2A 4E7SA 4C2MA 3FBLA 4DVYP 5HBUA 4UF0B 5L3FB 2ES0A 3N9OA 4KHZF 2JIWA 1KK7A 4ZI2C 3WHCA 4HFIA 1J5WA 4EEDA 4HWHA 4DV7T 3IH3A 2KWIB 2LSKA 5DAJA 2G0EA 3H37A 4O2BE 3MVPA 1R8IA 2XY8B 5AQLB 1D0YA 1MIWA 2X68A 4D7NA 4YT0A 1HF8A 2X66A 4FI5A 2VKDA 2DTZA 2A2FX 4BA9A 2VKOA 3V78A 2ZMAA 3VTIA 3F31A 4DVDA 5JTGA 2M67A 2ACXA 1SGMA 1XNRT 3ZQHA 3ZJ2A 3BTCA 3QPSA 3VP5A 2CXLA 1FMVA 4KWAA 1HNWT 3QB5A 2LSJA 2XQ5A 4DV6T 4UIGA 4MO7A 5L3BB 3NRGA 2Y8DA 2CLYC 3PUXF 4H9NC 4IDNA 3O60A 2WS3A 1LVFA 1D1BA 4DR6T 4CQIA 3EGQA 2YK0A 4NXMT 1GQEA 3SS1A 2CEAA 4O4HE 3EABA 2KMFA 2ZM2A 4ZZCA 4LFAT 4JBWF 5HXSA 2GENA 1U4QA 3AA1B 1U9NA 5AQPB 2N9DA 3GZIA 5TAOA 2DHRA 4KMCA 3KYLA 2L9QA 3VR8A 3TKLB 1MMAA 3ZMZB 2O7OA 3RI5A 3NPIA 5HEOA 4DUYT 4QX8B 2XPUA 1M7KA 2WZHA 3KKCA 3E08A 2LSGA 3OPCA 2YOEA 3OTOT 4HFBA 4COFA 4JI3T 2WDVA 3KV9A 3J7Yq 4LMJA 2NX4A 2W53A 4HN9A 3UTKA 4NUUA 5ABEA 2CA5A 3O1HA 2AE9A 2CBJA 2D9DA 4AISA 2QOPA 3DU5A 1UURA 4JEUB 4TN7B 2KT9A 4I50E 3PUZF 2CWOA 5FXWA 2FUPA 2X9DA 3FK7A 3NNRA 3ZQGA 2MTQA 3KV6A 5DABA 2BS4A 2J62A 3WAKA 2DLRA 2PZ9A 1JUSA 3VVZA 3Q5WA 2VVNA 4IRVA 2QRXA 2ZLYA 2WQYA 2X6OA 4QH4A 5LBQB 3A5XA 4V1Av 3HE0A 4HEAA 3PJAJ 1JNRA 4DV1T 3R84B 4UV9B 4GIWA 3LBXA 2OLTA 5FKNA 2HYTA 5FHPA 1RKTA 3UU8A 2WDQA 4JLEA 2YVEA 2Y6XA 5J0ZA 5LA6E 4EYUA 1I94T 1NENA 2DG8A 1QUUA 3B81A 1T8BA 3CVRA 5FL0A 2B3WA 2QYWA 4O4LE 4X1YE 4ADZA 4NPPA 3DPJA 2J1DG 3AE5A 3I9WA 3KVAA 2Q9QC 3GMIA 2BVMA 4AKIA 3CQGB 4FJOA 4D7MA 5LMNT 2C5KT 2I59A 4JV5T 3COLA 3F57A 3RRWA 3RKOA 2XQAA 4QXCB 5J2TE 1IJ6A 2IEKA 4DBQA 3JC6D 2HHHT 4JI6T 4LFCT 1ZK8A 3DP7A 5CXGA 3BR1A 2NW7A 5AQVB 5J2UE 3LSVA 4OK0A 4PK6A 3LK3B 3RPUA 2H7OA 4E7ZA 3L39A 2H3RA 1B7TA 3K3QC 2RP4A 1OEDA 3UUXB 3HL6A 2KNDA 4IDOA 2JPFA 4ZS3A 4JI8T 4EEBA 5HAWA 4P1NA 5F8PA 2XPWA 4UR9A 4A97A 1UI6A 3H3MA 3LK2B 2ZCMA 3RH2A 5AQSB 3L09A 4U9LA 5ETWA 4JEHB 5L3EB 4HWCA 3DTOA 4GOUA 3ZT7A 4YY3T 5HCJA 4PJJA 3PJAA 4QWNB 4LF6T 5F0FA 2TCTA 3RQUA 4XK4A 3AE3A 5EZYE 2OERA 3U78A 4OX9T 2WGBA 4GFKA 5J3LA 5F08A 1NWMX 3N9PA 2LJLA 4EV6A 3HGYA 2FBWA 4H63V 5KMGP 2XAJB 2YEVC 4OFZA 2XZEA 2DL1A 2M6IA 4JYKA 4JI4T 2VL0A 4EOZB 2GBYA 3VOXA 3KZ9A 2UXBT 2YU2A 2LRLA 3PM1A 1CUNA 3RLFF 3BRUA 1J1JA 1S94A 4MBQA 3NZPA 4ZI7E 3EUHA 4U72A 1OEDB 2W67A 3VKHA 2D0TA 2QGSA 3KNWA 4YZEA 2NTYA 2BKOA 2LSYA 2VKVA 4X64T 2DWKA 3LJLA 2G3BA 4TV9E 1JTYA 2H7VC 1KEYA 4H9SE 5LHGB 3CX6B 3G1MA 3ZC0A 4GK5E 4WNKA 4J2CA 2VB6A 2LEHA 3TP0A 5LGUB 4NXNT 2AXDS 1BR4A 5LGTB 3FZMB 3K1SA 3A7MA 2A72A 2HXIA 1FJGT 1OEDE 3ZT6A 3AE2A 5AQOB 3C2BA 1WYBA 3HKDE 2XSAA 3NXCA 2X0HA 5K7ZA 4ANJA 3VIBA 2VWAA 4Z8XA 3PUVF 3K3OA 3AEGA 3HIMA 4ISTA 2YINA 4IREA 4KI0F 2REKA 2CE7A 3SDGA 1H7CA 1U5PA 3ZC1A 5ABGA 3ANGA 4JUYA 3X1DA 4DR5T 2WZIA 3ETVA 2VKJA 2FJ1A 5JR9C 4DMWA 4HWDA 4GK0E 4ZI3C 1ZKGA 4CGRA 3O1IA 3Q0WA 2ZY9A 3AVRA 5JVDE 3ZEFB 3PASA 2Q24A 4YJ2E 1FMWA 3OBVE 2R6GF 4AQFA 5JRCA 2L8KA 3UU6A 2XQ6A 4CXYA 3CQXC 1YD8G 3BQYA 5GPCA 3E0ZA 4CI2B 4ABZA 4LMLA 2W63A 5LOVE 5LG3A 3FBZA 3KDSE 3EVYA 2X9HA 2YDSA 3FZLB 3N9LA 4IE5A 3AAIA 3A8YC 2VVSA 3AAAB 5F1JA 2K9AA 2X9YA 3Q3SA 1QPIA 5F0CA 4N78D 3KV4A 2E9XA 4M3GA 5EFYA 2BZBA 4NN1A 2Y48B 1T33A 1RKWA 2BG9C 2UXOA 4NELA 5BMVE 2XB5A 3PDYA 1IBKT 4U74A 4EB6E 3HKBE 3TLSA 3UUNA 4OD5A 4GFLA 2EHOC 3JCFA 2I10A 3NRXA 5JQGE 3I0OA 3RIAA 1YKHB 2YKSA 3ZMTB 2XQ8A 3TLUA 3GN5A 2PBIA 2ID6A 4JI2T 3LJCA 3HGGA 5DQVA 4ZOLE 5JRCB 2WY2A 3AQSA 3Q0VA 4PJMA 3P9TA 1A6IA 2IIUA 2UUCT 2C0SA 4DR4T 1UCUA 4DBRA 2FJEA 1Y01A 2R7XA 2M6BA 3ONJA 5LYJE 1VRBA 5AQKB 2CBIA 4AKRB 1JT6A 1Z77A 1N33T 5LG4A 1HR0T 3RH3A 2DG7A 1T56A 2PFVA 3AXJA 3CKDA 3BQIA 3BQZA 3RYIE 4PNIA 4UVBB 5C2TA 3EI0A 4PK5A 4WBOA 4WZXA 3FHNA 3Q5EA 2XPKA 3ZQIA 3NBXX 2IUBA 4L62A 5JDNA 5IHYA 3VVXA 2RPAA 3PE0A 2IC6A 1SUMB 5F27A 3PURA 4OYKA 4ZHQE 2GK9A 1MIYA 4GYSA 4I4TE 3AE1A 1WLXA 2RAEA 2V7KA 5JREA 2ODUA 3W15B 2FD5A 4YHJA 3ZLIA 2G7LA 2UXXB 2OV9A 2K3WA 2V6XA 2XM2A 3QC9A 1OXZA 2HQ5A 2JRKA 4B3TT 1WCRA 5F04A 5HYAA 3KV5A 4UELA 3MNLA 2BVLA 4NIQA 1IAPA 1HNZT 3HR0A 1IBMT 3BJBA 1T7SA 5LJMA 2JMKA 5JDFA 4IGUA 3ZT5A 3U3IA 4EIWA 3AXJB 4G63A 3GEUA 1HX1B 1WR0A 3BR3A 5AQIB 5HEGA 1XZYA 2CLYB 3I0QA 3FRQA 1BR1A 2NS8A 2CHNA 3D0TA 2UXHA 3C4WA 4DV0T 2XQ9A 3MKDA 2JJ9A 2HPLA 3RC3A 3ZQLA 5AQQB 1V9DA 2N1GA 3P4PA 2XGDA 2QCOA 2N2NA 3RIFA 3MZKB 1SE7A 4ZEYA 3RYFE 4MK6A 3ZSSA 3O1JA 2WWUA 3Q0UA 4AQGA 3JADA 4X1EA 3HI2A 4HWFA 3JC6C 2JQKA 2WB5A 4M3BA 3PUQA 3AAEB 4U7IA 2W62A 3SFEA 4W97A 2D5UA 2LKGA 2HXOA 5L4HA 2E5LT 5CQGA 1E1HB 3RRCA 3ZYLA 3RIUC 2WP9A 5JDGA 4CN6A 5JDMA 4QH1A 5L3DB 4Z91A 3BTIA 4ZI2D 4HFEA 2Q9QA 2XGCA 3KKDA 3OVUA 3AE6A 4PW8A 2WDRA 3PPBA 2VASA 5HXRA 1N34T 2HN1A 5AQTB 3AQTA 4X20E 3O9XA 5HSZA 4HTEA 2LLYA 3WI3A 5C8YE 4X65T 5LB7B 4ASKA 4U31A 4G12A 2DI4A 3UULA 4WW0A 2VURA 3OYXA 3VUQA 3PUAA 4KX6A 4U9NA 2W2UA 1WRDA 1ZOYA 5K7FA 3KVBA 3BK9A 4PFOA 2IDOB 4GCLA 3C4XA 5FVLA 1NEKA 1QLBA 4P0AA 4XAXB 2XQ4A 2WWVA 3VRAA 1Z8UA 3FXEB 3O4XE 1L0VA 1VCSA 5F0HA 1T98A 3AA0B 3EUPA 5FVKA 5CA0E 3UFGA 3CX7B 5HCMA 3I9YA 3FZFB 3B6AA 5HWXA 5FKYA 4CN4A 5FKOA 3HKEE 2IW5B 1E7PA 3BQKA 3ZCIA 5F3JA 2QA7A 4OYJA 5IPAA 3AVSA 2Y30A 5HXHA 4IDZA 2XAHB 2OI8A 2LKHA 2W61A 1KNRA 1VCTA 3HA4A 4LFBT 2NOXA 2ZCXA 4JL3A 4AC6A 4I55E 3G1LA 3VVYA 2R7UA 3LBXB 5J1YA 4C91A 5CFBA 1OWAA 2V7IA 1Z0XA 2OA5A 5H6RB 5K7HA 5ABFA 1VOMA 5D1RA 4D5FA 1X9BA 1RPWA 5HEJA 3DCFA 2VL8A 1YXRA 2GFNA 3AEFA 1MNEA 3N9NA 1JNZA 4TV8E 3FXDB 4ILCA 5IP6A 1S35A 3PU8A 5FKMA 4JI0T 3S5RA 5DQWA 3RGLA 2JK3A 4YSXA 2UXIA 1BJZA 4AKHA 4QXBB 3ESLA 4M1PA 2XASB 4EGWA 1U9OA 4U2YA 3CRJA 5IUXA 2V57A 4WYVA 1N36T 1YKEB 5FXZA 5FXXA 1IJ5A 4GCTA 2V1DB 4IT4A 3AA6B 3F0CA 4KBMB 5HAXA 4DR1T 3KBUA 5KX5E 1US7B 3CCYA 1VI0A 5FL1A 4DO0A 2GUHA 1BR0A 2FQ4A 3VW2A 4P0BA 4TUYE 3LWJA 4AIUA 4GYRA 2DNXA 4JI1T 4DMVA 4HE8A 4QH5A 4L5GA 3UU5A 4D5CA 4ILUA 3CWZB 2V8SV 4LF5T 3UT5E 4CN1A 4AKLA
chains in the Genus database with same CATH topology
2Y8DA 2Z6EA 2CLYC 3IHRA 2Y48B 2VK9A 4H9NC 4H9PC 5JR9A 4O2AE 1Y64B 1LVFA 1D1BA 5BMVE 4CQIA 2C5IT 2YK0A 3OJAA 3PDYA 4U74A 3SS1A 5A1LA 4EB6E 3ANWA 3HKBE 2CEAA 4O4HE 3UUNA 4OD5A 2Q9QB 2EHOC 5KDMC 3CPZA 2KMFA 3NRXA 4PAGA 5JQGE 2ZM2A 3I0OA 1YKHB 5HXSA 2XTLA 2LOPA 1U4QA 2K5BB 3AA1B 3ZMTB 2MOZA 4IE0A 5FY7A 3ONXA 3GN5A 2PBIA 4H9QC 2N9DA 3B57A 2R7WA 4MLKA 5LGNB 3LJCA 5TAOA 2DHRA 4PK4A 3PTRB 2LHNA 3V5UA 4KMCA 5DQVA 4ZOLE 3KYLA 2L9QA 5JRCB 1HCIA 3TKLB 3R6NA 1MMAA 3ZMZB 2JQQA 4PJMA 2LE8A 2X67A 4QX8B 2LM9A 2C0SA 4XBFB 1UCUA 2PJQA 4DBRA 3ZN0B 4OD4A 2R7XA 3E08A 2LSGA 5JDQA 5LYJE 1VRBA 4AKRB 2KXPB 3QK6A 4I43B 5LG4A 3NS4A 1QSDA 4KP3C 3KV9A 1ZV4X 3C98B 5AFUL 3RH3A 3J7Yq 5GONE 4HN9A 3UTKA 4NUUA 3C4ZA 3WAJA 2PFVA 4KUMB 2CA5A 3CKDA 3O1HA 3BQIA 3N2OA 2NTXA 3RYIE 2CCQA 4PNIA 4K0UA 4YJ3E 4UVBB 3KBTA 3PU3A 4IIJE 4PK5A 3SOLA 3DU5A 4JEUB 4TN7B 4WBOA 3FHNA 2KT9A 4I50E 2CWOA 4O4JE 4IHJE 3H3AA 3NBXX 5ADXL 5FXWA 3PUGA 2EHOA 5JDNA 5JR9B 4ISSA 5IHYA 1D0XA 2MTQA 3KV6A 5DABA 1D0ZA 3IEEA 2IC6A 3PE0A 3LG7A 2MBGA 3WAKA 2DCFA 2DLRA 3ANWB 4F6RC 1HG2A 3P7IA 3PURA 3Q5WA 1WYCA 3NZQA 4OYKA 3OKQA 5LHHB 1HS7A 3PUSA 3E22E 4IRVA 4ZHQE 2WAUA 2GK9A 4QX7B 1MIYA 1YW0A 4O8SA 2ZLYA 4GYSA 5CB4E 2KZ7B 4I4TE 5LBQB 4BJMA 2CMRA 3A5XA 2NWBA 1MMNA 1ZKEA 3V5SA 4V1Av 1WLXA 4HEAA 4ERRA 2V7KA 1MMGA 3N5LA 2ODUA 4X1KE 5JREA 3W15B 4AKGA 4YHJA 3R84B 3ZLIA 2UXXB 4UV9B 3ZCJA 2PG8A 4GIWA 3QC9A 1OXZA 2CM0A 3N2KE 2JRKA 3LBXA 5HYAA 3KV5A 4UELA 1G73A 4X1IE 2HH7A 2BVLA 3HKCE 4NUVA 5L3BB 1IAPA 4JLEA 2Y6XA 4YFSA 3CMLA 2P9BA 3DJBA 5LA6E 4EYUA 2V7MA 4DNDA 3HR0A 4P09A 3C64A 2R7RA 5LJMA 2JMKA 5FY0A 5JDFA 1QUUA 2CXDA 3CVRA 4IGUA 3EDVA 3U3IA 4QKNA 5FNVE 2WSSV 3AA7B 2Q9QD 2B3WA 3L3PA 4EIWA 4G63A 1UX5A 4QXHB 2W00A 1X79A 4O4LE 4X1YE 4ADZA 4CI1B 2CLYB 3GA8A 3I0QA 2RA1A 3ZMUB 5HXEA 2J1DG 4H9RC 1BR1A 3QUJA 3I9WA 4UVCB 3D0TA 3KVAA 5J1GA 3C4WA 3MK7C 3ZMVB 2Q9QC 3GMIA 2BVMA 4CZZB 4YLHA 4AKIA 3MKDA 3CQGB 2JJ9A 2D2SA 2HPLA 4FJOA 3RC3A 2C5KT 2I59A 4PJNA 1V9DA 2N1GA 2EHOB 3F57A 3MA9A 3RRWA 3RKOA 2N2NA 4IE7A 4QXCB 5J2TE 2XQYA 4PJLA 4MHCA 1IJ6A 3MZKB 4UVAB 2R7OA 4HKAA 3RYHE 3VHLA 4DBQA 2R7VA 3JC6D 3DP7A 4CI3B 5JH7E 3RYFE 3F2EA 3O1JA 4O4IE 2WWUA 3LFMA 2A3DA 3ZJ1A 5M4YA 4AQGA 3IBPA 4EXTA 2NW7A 5LHIB 5CA1E 3HI2A 3JC6C 5J2UE 4OK0A 1O3XA 4PK6A 4EZHA 3LK3B 1HG5A 1FIOA 3PUQA 3RPUA 3ZYMA 1IZNB 2H7OA 3AAEB 4E7ZA 3C50A 2H3RA 2W62A 3M65A 1LKXA 1SHZC 4MALA 1B7TA 3K3QC 2RP4A 4TX5A 3I1AA 2D5UA 2NW8A 3ETUA 5H6QB 3AB3B 3BQLA 3UUXB 3HL6A 2KNDA 2YU1A 1HFAA 2E9XB 1MIVA 5CQGA 1HTJF 1E1HB 1AJ3A 2JPFA 4ZS3A 3RRCA 3ZYLA 5F8PA 4ZI3D 5JDGA 5JDMA 3LK2B 5L3DB 4XZCA 2K24A 4ZI2D 1D1CA 3L09A 3LK42 2Q9QA 3SRZA 3NRYA 5ETWA 4JEHB 3MJXA 4PW8A 5FP3A 2VASA 5HXRA 3P8CD 5L3EB 3DTOA 4GOUA 4PJJA 4X20E 3O9XA 2V7LA 4QWNB 4HTEA 2WBLA 2WMOA 4HGAA 2FJI1 3GN5B 4A56A 4IE6A 2XAFB 3WI3A 4AXPA 5EZYE 5C8YE 3ZYKA 3U78A 2HPJA 4ASKA 3ZPOA 1D1AA 2DI4A 3UULA 1NWMX 3N9PA 3OYXA 4WW0A 2XHEB 3VU7H 2LJLA 1HX8A 3PUAA 3DU6A 4H63V 5KMGP 5LJNA 2JMHA 2XAJB 2X9XA 2YEVC 4OFZA 4UV8B 1WRDA 2E8IA 3N9QA 1MMDA 3KVBA 5HWYA 4EOZB 2LHRA 3BK9A 2C5JA 4PFOA 2WMNA 3C4XA 1ZHCA 3VKGA 2NW9A 2IAKA 4BJNA 2YU2A 4XAXB 5DJQC 4P0AA 5L2LA 2X9WA 3Q5XA 1CUNA 2UXNB 2LOSA 1FEWA 2XAQB 3FXEB 3KFWX 3O4XE 4B6XA 5FY1A 1S94A 2L3LA 5FYMA 4MBQA 3RX6A 3NZPA 4ZI7E 3EUHA 4CXXA 4U72A 3ZN1B 1T98A 2CWYA 3AA0B 5CA0E 3VKHA 3CX7B 1UX4A 2D0TA 2QGSA 4UF0A 5JDLA 2X0LB 5IYZE 2NTYA 2EHOD 4OHFA 3K3NA 2LSYA 3FB2A 2B1EA 2DWKA 2IC9A 3I9YA 2XAGB 4TV9E 1LVKA 5HWXA 2H7VC 2V26A 2KINB 4C90A 4H9SE 2R7SA 4EZ4A 5LHGB 3CX6B 3HKEE 4L0RA 2W0GA 4GK5E 3ZC0A 4WNKA 4J2CA 1MNDA 2IW5B 2VB6A 1Z0PA 5FMNA 2LEHA 5LGUB 4AQFC 3BQKA 3ZCIA 5F3JA 4IE4A 3S4UA 2R7TA 1BR4A 4CXWA 2QA7A 4MFRA 5LGTB 4OYJA 3RYCE 5LCYA 3AVSA 4EAHA 3ZMSB 5HXHA 2A72A 4IDZA 4WBNE 2KWHA 3GWHA 3UUMA 2LT3A 2XAHB 2W61A 3HA4A 2R7QA 5LXTE 1EZ3A 1WYBA 3HKDE 2NOXA 4I55E 3K8PC 3OYZA 3Q9DA 2R7UA 2ZM8A 5LBMA 3LBXB 4ANJA 4BAYB 2VWAA 2V7JA 4C91A 2E9XD 1OWAA 3MXZA 4Z8XA 4EYYR 2V7IA 3K3OA 2OA5A 5H6RB 3N9MA 5EK4A 2VKHA 3CQCB 4ISTA 2YINA 5HXCA 4QHOA 5JDHA 1G8XA 1VOMA 2CE7A 2ZM0A 4UXNB 3J9X1 1H7CA 1SA0E 1U5PA 4HFVA 2VL8A 2ODVA 4H9OC 4PFPA 2SPCA 2E9XC 5LNKA 1MNEA 3N9NA 5FXVA 3ZC1A 5EK2A 3IF8B 4ZS2A 3MACA 3B13A 4TV8E 3SWHA 2MYSA 3FXDB 4JUYA 3UFEA 5LP6E 1KNZA 1BR2A 1S35A 3ETVA 3N2GE 3PU8A 2VKJA 4TZ4C 3T8OA 5JR9C 4DMWA 4E7SA 4GK0E 4H63H 5DQWA 4C2MA 2D0UA 4ZI3C 3CX8B 3FBLA 4DVYP 4QXBB 4AKHA 3ESLA 2BDEA 3O1IA 4M1PA 2XASB 4UF0B 5L3FB 2ES0A 3N9OA 1KK7A 4UEMA 2KLQA 4ZI2C 3AVRA 5JVDE 3ZEFB 2K48A 5E0OA 3Q2MA 4AI6A 1YKEB 4YJ2E 3KINB 1FMWA 3OBVE 5FXXA 1IJ5A 5FXZA 4AQFA 5JRCA 4L9IA 3C51A 2L8KA 2V1DB 4CXYA 3CQXC 1LRZA 5L3CB 3AA6B 2KWIB 2LSKA 1YD8G 4KBMB 2WM9A 2DWGA 5HAXA 3H37A 4O2BE 3E0ZA 4CI2B 3KBUA 2CXFA 5KX5E 1US7B 2W63A 4G2AA 2XUEA 1D0YA 5LOVE 1MIWA 2X68A 3RC8A 5EK3A 4DO0A 1BR0A 1HF8A 2X66A 3FBZA 4FI5A 1WR6A 2VKDA 2A2FX 3KDSE 2ZMAA 2VKOA 4P0BA 3EVYA 2X9HA 4BA9A 4TUYE 3VTIA 3F31A 4DVDA 5L3GB 2M67A 2ACXA 3N9LA 4IE5A 3AAIA 4GYRA 3ZJ2A 2DNXA 3AAAB 4DMVA 2K9AA 2X9YA 2CXLA 4HE8A 1FMVA 2X51A 1NAFA 4L5GA 4N78D 1ZEEA 2LSJA 4ILUA 3CWZB 3KV4A 2G0UA 2E9XA 3EDUA 4UIGA 2LSIA 3UT5E 2BZBA 2NP9A 4AKLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K8P C; 
#chains in the Genus database with same CATH topology
 3IHR A;  2VK9 A;  3F1B A;  4H9P C;  5JR9 A;  4O2A E;  2XPV A;  1Y64 B;  4JKZ A;  2XJ7 A;  2Y31 A;  3OJA A;  5A1L A;  4I0U A;  5F5W A;  4TWH A;  2IAI A;  3IA3 A;  3CPZ A;  3SFI A;  5GP9 A;  2YVH A;  3E7Q A;  2K5B B;  4YTP A;  2MOZ A;  3BR5 A;  3QNU A;  4IE0 A;  5FY7 A;  3O8H A;  4H9Q C;  4ACI A;  3AEC A;  2BS2 A;  3B57 A;  2W66 A;  2R7W A;  4MLK A;  3WHB A;  2UXD T;  2LHN A;  3V5U A;  3NWI A;  5FMP A;  4A5X A;  2XDN A;  2JQQ A;  5EZH A;  2LE8 A;  2NR4 A;  4JNN A;  4ICH A;  4OD4 A;  3QK6 A;  4K0K T;  3V6G A;  3NS4 A;  4KP3 C;  4DR7 T;  4WIB A;  5BR8 T;  2WU2 A;  5AQJ B;  3C4Z A;  4U7Y A;  4KUM B;  2F07 A;  3N2O A;  3JAE A;  3T6N A;  2BG9 A;  2CCQ A;  4K0U A;  1W09 A;  5CGM A;  3AE8 A;  3JSJ A;  3KBT A;  3UU4 A;  2IBD A;  2IML A;  4IIJ E;  3UQ4 A;  2BBJ A;  2CRB A;  4O4J E;  5ADX L;  4YXD A;  4W1U A;  1M62 A;  3PUG A;  2EHO A;  5JR9 B;  5K58 A;  1D0X A;  2OPT A;  3P4Q A;  3ON2 A;  2H89 A;  3IEE A;  2IHR 1;  5L47 A;  3LG7 A;  2DCF A;  4F6R C;  1HG2 A;  2HN2 A;  3OKQ A;  3PUS A;  3E22 E;  4ILA A;  4QX7 B;  2KZ7 B;  4BJM A;  3NVO A;  4B3S T;  1MMG A;  4X1K E;  4AKG A;  3CDL A;  2V6Y A;  4LF7 T;  3BR0 A;  2CM0 A;  1JUP A;  3C07 A;  4X1I E;  2HH7 A;  3HKC E;  4YFS A;  3DJB A;  4DND A;  2R7R A;  3AE4 A;  2CXD A;  2ZCN A;  4M3F A;  3CIR A;  1KFY A;  4IL4 A;  3P4S A;  4QKN A;  4B3M T;  5FNV E;  3ZQF A;  2WSS V;  3AA7 B;  4QXH B;  4DV3 T;  3PV0 F;  3ZMU B;  3ZST A;  5AQC A;  2BG9 B;  4UVC B;  5IOY A;  3MK7 C;  3ZMV B;  4CZZ B;  2WCA A;  1YQ3 A;  1I6Z A;  3SFD A;  5AQF B;  2EHO B;  3MA9 A;  4IDP A;  2XQY A;  3P4R A;  4UVA B;  1W0A A;  4CI3 B;  1QVT A;  1UI5 A;  4LF4 T;  1J5E T;  1UUS A;  3ZJ1 A;  5M4Y A;  4EXT A;  4TWD A;  4LF9 T;  1O3X A;  3Q5D A;  5EYR A;  1HG5 A;  1IZN B;  3BCG A;  1LKX A;  1XDP A;  1SHZ C;  4MAL A;  2NW8 A;  3ETU A;  5H6Q B;  4IDQ A;  3QQA A;  2YU1 A;  1HFA A;  2E9X B;  2UXP A;  4ILB A;  3BR6 A;  3IUV A;  3IH2 A;  4ZI3 D;  4XZC A;  2UUA T;  1D1C A;  3LK4 2;  2HYJ A;  5H9T A;  3NRY A;  2QKO A;  3VR9 A;  3BNI A;  3HTI A;  4TNW A;  2XQ3 A;  3VW0 A;  3UUB A;  2QWT A;  3BHQ A;  2FJI 1;  3GN5 B;  2YDR A;  4IE6 A;  2XAF B;  4AXP A;  2XGE A;  2HPJ A;  1D1A A;  2NP5 A;  2B76 A;  2H88 A;  3P4W A;  4YHH T;  2XHE B;  4X62 T;  1HX8 A;  2JMH A;  2PBX A;  4UV8 B;  4DW6 A;  5EZG A;  5HWY A;  2C5J A;  2WMN A;  3VKG A;  2NW9 A;  3NI7 A;  2IAK A;  5DJQ C;  2X9W A;  3Q5X A;  1N32 T;  3CWR A;  4AUX A;  1FEW A;  2XAQ B;  3B6C A;  4B6X A;  5FY1 A;  2L3L A;  5FYM A;  3RX6 A;  3RIU A;  4B3A A;  3CJD A;  2JJ7 A;  1UX4 A;  2X0L B;  2EHO D;  4OHF A;  3BTJ A;  3FB2 A;  3NKZ A;  2B1E A;  3RHW A;  2IC9 A;  2XAG B;  2V26 A;  2KIN B;  4C90 A;  2EH3 A;  2FJD A;  4L0R A;  2W0G A;  1UGO A;  2E2A A;  4YSY A;  2CPT A;  3S4U A;  5KXJ A;  4U2Z A;  3AED A;  4CXW A;  4MFR A;  5LCY A;  4EAH A;  3B5M A;  4YTN A;  2MPK A;  3GWH A;  3T1Y T;  2J4G A;  4X66 T;  3O8G A;  2X0Y A;  2R7Q A;  5LXT E;  1EZ3 A;  2ZB9 A;  4LF8 T;  3K8P C;  3OYZ A;  3G7R A;  5D18 A;  2Y2Z A;  2E9X D;  1UK5 A;  3BT9 A;  4X5T A;  3N9M A;  5EK4 A;  2VKH A;  2I6H A;  3AEB A;  4GCK A;  4QHO A;  1G8X A;  2ZM0 A;  4ME9 A;  4DR2 T;  4HFV A;  2MAW A;  2ODV A;  4JI5 T;  2SPC A;  2IU5 A;  5FXV A;  5J1R A;  5EK2 A;  2LRK A;  2OF7 A;  3IF8 B;  1XNQ T;  3B13 A;  3SWH A;  5LP6 E;  4M3E A;  1KNZ A;  4TZ4 C;  4HWI B;  5HEU A;  3T8O A;  4LMK A;  4H63 H;  2D0U A;  3CX8 B;  2BDE A;  1XMQ T;  4Q25 A;  4UEM A;  2KLQ A;  4PXI A;  2K48 A;  5E0O A;  3Q2M A;  4AI6 A;  4L9I A;  3C51 A;  2VQF T;  4IL9 A;  1LRZ A;  5L3C B;  3TP3 A;  1KNP A;  2WM9 A;  2DWG A;  2CXF A;  5FKL A;  4G2A A;  2XUE A;  3RC8 A;  2RHA A;  2FBQ A;  5EK3 A;  1WR6 A;  5L3G B;  3LSP A;  2BKN A;  2XRL A;  1ZP0 A;  3IH4 A;  2X51 A;  2F4V T;  2G7G A;  1NAF A;  3VRB A;  1ZEE A;  2LM2 A;  4MXM A;  2G0U A;  3HTH A;  3EDU A;  2LSI A;  1HNX T;  3KIN B;  2NP9 A;  2JQ9 A;  4DUZ T;  2Z6E A;  3QKX A;  4DR3 T;  3ON4 A;  3LSR A;  4M3D A;  2C5I T;  4V2G A;  5CXI A;  2XM1 A;  2QVA A;  5D19 A;  3ANW A;  2V5D A;  2Q9Q B;  5KDM C;  2BKP A;  4PAG A;  2VKE A;  4AC0 A;  4HFC A;  2XTL A;  2LOP A;  5L4E A;  3ONX A;  4V2F A;  4JI7 T;  3FIW A;  5LGN B;  5LMU T;  4PK4 A;  3PTR B;  2XSB A;  1JUM A;  1HCI A;  3R6N A;  2X67 A;  2LM9 A;  1WFD A;  4XBF B;  2PJQ A;  3ZN0 B;  5JDQ A;  2KXP B;  3ONL C;  1W9R A;  4I43 B;  1QSD A;  3LOC A;  1ZV4 X;  3C98 B;  5AFU L;  5GON E;  2E5V A;  4ZXL A;  3WAJ A;  2G7S A;  3BR2 A;  2NTX A;  3LHQ A;  4YJ3 E;  3PU3 A;  1KF6 A;  1XWM A;  2V5C A;  3SOL A;  4GKK T;  5IWA T;  4U33 A;  3FZH B;  4IHJ E;  3H3A A;  2FJA A;  3HTA A;  2VPR A;  4ISS A;  2ZM6 T;  1D0Z A;  2MBG A;  2WU5 A;  1ORK A;  3ANW B;  4KHP T;  3P7I A;  1WYC A;  3NZQ A;  3TLV A;  1HS7 A;  5LHH B;  3TLT A;  2WAU A;  1XMO T;  4O8S A;  1YW0 A;  5CB4 E;  2CMR A;  2NWB A;  1MMN A;  1ZKE A;  5C3J A;  3V5S A;  4ERR A;  3N5L A;  3G1O A;  3ZCJ A;  2PG8 A;  3AE7 A;  4F8H A;  3N2K E;  3RD3 A;  2UXC T;  1G73 A;  3EHZ A;  1YQ4 A;  5CJ5 A;  5AQN B;  4NUV A;  5FKK A;  3VPR A;  3FK6 A;  3CML A;  2P9B A;  2V7M A;  4P09 A;  3C64 A;  3CK6 A;  4AQY T;  5FY0 A;  5ABF B;  2PTF A;  1OED C;  3EDV A;  3QB5 K;  2J47 A;  2ACZ A;  3BTL A;  2Q9Q D;  3L3P A;  1UX5 A;  4YSZ A;  2O7T A;  5IOZ A;  2W00 A;  1X79 A;  5HEH A;  4CI1 B;  2UXU A;  3GA8 A;  4DV4 T;  2RA1 A;  5HXE A;  3M3Z B;  4H9R C;  3QUJ A;  2D6Y A;  5C4Y A;  5J1G A;  3FZK B;  4YLH A;  2QIB A;  2D2S A;  3VW1 A;  4PJN A;  1QVU A;  4I6Z A;  2I0M A;  4IE7 A;  4PJL A;  4MHC A;  2R7O A;  4HKA A;  3RYH E;  3ANP A;  3PUY F;  3VHL A;  2R7V A;  5AQG B;  3ABV A;  4I76 A;  5JH7 E;  3F2E A;  4B3R T;  3VOK A;  4ZZB A;  2ZOY A;  4O4I E;  3LFM A;  2A3D A;  3IBP A;  5LHI B;  5CA1 E;  5AQU B;  4EZH A;  1FIO A;  3ZYM A;  2WUI A;  4HFH A;  3C50 A;  3P50 A;  2TRT A;  3HTJ A;  2FJB A;  3M65 A;  2UUB T;  4TX5 A;  3I1A A;  3AB3 B;  3BQL A;  2WV1 A;  5AQR B;  1MIV A;  1AJ3 A;  4HKU A;  1HTJ F;  4JYA T;  1JT0 A;  4AF5 A;  2FX0 A;  3QPL A;  3QBM A;  4B1R A;  4TNV A;  2JQH A;  2K24 A;  3LDQ B;  3ZKR A;  4U3C A;  3SRZ A;  3MJX A;  4HFD A;  5FP3 A;  3P8C D;  2RAS A;  2NP3 A;  2V7L A;  4DV5 T;  4Z90 A;  2WBL A;  2WMO A;  4HGA A;  4A56 A;  2ZOZ A;  1XDO A;  2W4X A;  3ZYK A;  3ZPO A;  4YTM A;  5AQM B;  3T1H T;  3VU7 H;  2YVX A;  3DU6 A;  5LJN A;  3AEE A;  5AQH B;  2X9X A;  4DID B;  2E8I A;  3N9Q A;  1MMD A;  2ID3 A;  2LHR A;  4UDS A;  2BBH A;  2UU9 T;  3UQ7 A;  1IBL T;  1ZHC A;  4BJN A;  5GPA A;  5L2L A;  2YN6 A;  2UXN B;  2LOS A;  4A98 A;  3AE9 A;  3KFW X;  2VQE T;  3JAF A;  4CXX A;  1CHU A;  3ZN1 B;  2CWY A;  2QTQ A;  2KSR A;  4TWF A;  4UF0 A;  5FGL A;  1W0B A;  5JDL A;  5IYZ E;  4GKJ T;  3K3N A;  5J1U A;  3AEA A;  2HKU A;  1LVK A;  1JTX A;  2XQ7 A;  2R7S A;  4EZ4 A;  3TLW A;  1T72 A;  1MND A;  4DV2 T;  1Z0P A;  5FMN A;  4AQF C;  2A9U A;  4IE4 A;  2R7T A;  3RF1 A;  3RYC E;  3DEW A;  3ZMS B;  4WBN E;  2KWH A;  2BG9 E;  3PUW F;  3RQW A;  3UUM A;  2LT3 A;  3RKG A;  2V6Y B;  2CHO A;  3Q9D A;  3EAM A;  2ZM8 A;  5LBM A;  2BS3 A;  2YDQ A;  4BAY B;  1E2A A;  3LSJ A;  2V7J A;  3MXZ A;  3QOF A;  3UU3 A;  4EYY R;  2NS7 A;  5CW8 A;  3CQC B;  5HXC A;  5JDH A;  4UXN B;  3J9X 1;  1SA0 E;  4H9O C;  4PFP A;  2E9X C;  5LNK A;  3G06 A;  4ZS2 A;  3G56 A;  3MAC A;  2MYS A;  3UFE A;  5ABH A;  3L8R A;  1BR2 A;  3N2G E;  1DU2 A;  4E7S A;  4C2M A;  3FBL A;  4DVY P;  5HBU A;  4UF0 B;  5L3F B;  2ES0 A;  3N9O A;  4KHZ F;  2JIW A;  1KK7 A;  4ZI2 C;  3WHC A;  4HFI A;  1J5W A;  4EED A;  4HWH A;  4DV7 T;  3IH3 A;  2KWI B;  2LSK A;  5DAJ A;  2G0E A;  3H37 A;  4O2B E;  3MVP A;  1R8I A;  2XY8 B;  5AQL B;  1D0Y A;  1MIW A;  2X68 A;  4D7N A;  4YT0 A;  1HF8 A;  2X66 A;  4FI5 A;  2VKD A;  2DTZ A;  2A2F X;  4BA9 A;  2VKO A;  3V78 A;  2ZMA A;  3VTI A;  3F31 A;  4DVD A;  5JTG A;  2M67 A;  2ACX A;  1SGM A;  1XNR T;  3ZQH A;  3ZJ2 A;  3BTC A;  3QPS A;  3VP5 A;  2CXL A;  1FMV A;  4KWA A;  1HNW T;  3QB5 A;  2LSJ A;  2XQ5 A;  4DV6 T;  4UIG A;  4MO7 A;  5L3B B;  3NRG A;  2Y8D A;  2CLY C;  3PUX F;  4H9N C;  4IDN A;  3O60 A;  2WS3 A;  1LVF A;  1D1B A;  4DR6 T;  4CQI A;  3EGQ A;  2YK0 A;  4NXM T;  1GQE A;  3SS1 A;  2CEA A;  4O4H E;  3EAB A;  2KMF A;  2ZM2 A;  4ZZC A;  4LFA T;  4JBW F;  5HXS A;  2GEN A;  1U4Q A;  3AA1 B;  1U9N A;  5AQP B;  2N9D A;  3GZI A;  5TAO A;  2DHR A;  4KMC A;  3KYL A;  2L9Q A;  3VR8 A;  3TKL B;  1MMA A;  3ZMZ B;  2O7O A;  3RI5 A;  3NPI A;  5HEO A;  4DUY T;  4QX8 B;  2XPU A;  1M7K A;  2WZH A;  3KKC A;  3E08 A;  2LSG A;  3OPC A;  2YOE A;  3OTO T;  4HFB A;  4COF A;  4JI3 T;  2WDV A;  3KV9 A;  3J7Y q;  4LMJ A;  2NX4 A;  2W53 A;  4HN9 A;  3UTK A;  4NUU A;  5ABE A;  2CA5 A;  3O1H A;  2AE9 A;  2CBJ A;  2D9D A;  4AIS A;  2QOP A;  3DU5 A;  1UUR A;  4JEU B;  4TN7 B;  2KT9 A;  4I50 E;  3PUZ F;  2CWO A;  5FXW A;  2FUP A;  2X9D A;  3FK7 A;  3NNR A;  3ZQG A;  2MTQ A;  3KV6 A;  5DAB A;  2BS4 A;  2J62 A;  3WAK A;  2DLR A;  2PZ9 A;  1JUS A;  3VVZ A;  3Q5W A;  2VVN A;  4IRV A;  2QRX A;  2ZLY A;  2WQY A;  2X6O A;  4QH4 A;  5LBQ B;  3A5X A;  4V1A v;  3HE0 A;  4HEA A;  3PJA J;  1JNR A;  4DV1 T;  3R84 B;  4UV9 B;  4GIW A;  3LBX A;  2OLT A;  5FKN A;  2HYT A;  5FHP A;  1RKT A;  3UU8 A;  2WDQ A;  4JLE A;  2YVE A;  2Y6X A;  5J0Z A;  5LA6 E;  4EYU A;  1I94 T;  1NEN A;  2DG8 A;  1QUU A;  3B81 A;  1T8B A;  3CVR A;  5FL0 A;  2B3W A;  2QYW A;  4O4L E;  4X1Y E;  4ADZ A;  4NPP A;  3DPJ A;  2J1D G;  3AE5 A;  3I9W A;  3KVA A;  2Q9Q C;  3GMI A;  2BVM A;  4AKI A;  3CQG B;  4FJO A;  4D7M A;  5LMN T;  2C5K T;  2I59 A;  4JV5 T;  3COL A;  3F57 A;  3RRW A;  3RKO A;  2XQA A;  4QXC B;  5J2T E;  1IJ6 A;  2IEK A;  4DBQ A;  3JC6 D;  2HHH T;  4JI6 T;  4LFC T;  1ZK8 A;  3DP7 A;  5CXG A;  3BR1 A;  2NW7 A;  5AQV B;  5J2U E;  3LSV A;  4OK0 A;  4PK6 A;  3LK3 B;  3RPU A;  2H7O A;  4E7Z A;  3L39 A;  2H3R A;  1B7T A;  3K3Q C;  2RP4 A;  1OED A;  3UUX B;  3HL6 A;  2KND A;  4IDO A;  2JPF A;  4ZS3 A;  4JI8 T;  4EEB A;  5HAW A;  4P1N A;  5F8P A;  2XPW A;  4UR9 A;  4A97 A;  1UI6 A;  3H3M A;  3LK2 B;  2ZCM A;  3RH2 A;  5AQS B;  3L09 A;  4U9L A;  5ETW A;  4JEH B;  5L3E B;  4HWC A;  3DTO A;  4GOU A;  3ZT7 A;  4YY3 T;  5HCJ A;  4PJJ A;  3PJA A;  4QWN B;  4LF6 T;  5F0F A;  2TCT A;  3RQU A;  4XK4 A;  3AE3 A;  5EZY E;  2OER A;  3U78 A;  4OX9 T;  2WGB A;  4GFK A;  5J3L A;  5F08 A;  1NWM X;  3N9P A;  2LJL A;  4EV6 A;  3HGY A;  2FBW A;  4H63 V;  5KMG P;  2XAJ B;  2YEV C;  4OFZ A;  2XZE A;  2DL1 A;  2M6I A;  4JYK A;  4JI4 T;  2VL0 A;  4EOZ B;  2GBY A;  3VOX A;  3KZ9 A;  2UXB T;  2YU2 A;  2LRL A;  3PM1 A;  1CUN A;  3RLF F;  3BRU A;  1J1J A;  1S94 A;  4MBQ A;  3NZP A;  4ZI7 E;  3EUH A;  4U72 A;  1OED B;  2W67 A;  3VKH A;  2D0T A;  2QGS A;  3KNW A;  4YZE A;  2NTY A;  2BKO A;  2LSY A;  2VKV A;  4X64 T;  2DWK A;  3LJL A;  2G3B A;  4TV9 E;  1JTY A;  2H7V C;  1KEY A;  4H9S E;  5LHG B;  3CX6 B;  3G1M A;  3ZC0 A;  4GK5 E;  4WNK A;  4J2C A;  2VB6 A;  2LEH A;  3TP0 A;  5LGU B;  4NXN T;  2AXD S;  1BR4 A;  5LGT B;  3FZM B;  3K1S A;  3A7M A;  2A72 A;  2HXI A;  1FJG T;  1OED E;  3ZT6 A;  3AE2 A;  5AQO B;  3C2B A;  1WYB A;  3HKD E;  2XSA A;  3NXC A;  2X0H A;  5K7Z A;  4ANJ A;  3VIB A;  2VWA A;  4Z8X A;  3PUV F;  3K3O A;  3AEG A;  3HIM A;  4IST A;  2YIN A;  4IRE A;  4KI0 F;  2REK A;  2CE7 A;  3SDG A;  1H7C A;  1U5P A;  3ZC1 A;  5ABG A;  3ANG A;  4JUY A;  3X1D A;  4DR5 T;  2WZI A;  3ETV A;  2VKJ A;  2FJ1 A;  5JR9 C;  4DMW A;  4HWD A;  4GK0 E;  4ZI3 C;  1ZKG A;  4CGR A;  3O1I A;  3Q0W A;  2ZY9 A;  3AVR A;  5JVD E;  3ZEF B;  3PAS A;  2Q24 A;  4YJ2 E;  1FMW A;  3OBV E;  2R6G F;  4AQF A;  5JRC A;  2L8K A;  3UU6 A;  2XQ6 A;  4CXY A;  3CQX C;  1YD8 G;  3BQY A;  5GPC A;  3E0Z A;  4CI2 B;  4ABZ A;  4LML A;  2W63 A;  5LOV E;  5LG3 A;  3FBZ A;  3KDS E;  3EVY A;  2X9H A;  2YDS A;  3FZL B;  3N9L A;  4IE5 A;  3AAI A;  3A8Y C;  2VVS A;  3AAA B;  5F1J A;  2K9A A;  2X9Y A;  3Q3S A;  1QPI A;  5F0C A;  4N78 D;  3KV4 A;  2E9X A;  4M3G A;  5EFY A;  2BZB A;  4NN1 A;  2Y48 B;  1T33 A;  1RKW A;  2BG9 C;  2UXO A;  4NEL A;  5BMV E;  2XB5 A;  3PDY A;  1IBK T;  4U74 A;  4EB6 E;  3HKB E;  3TLS A;  3UUN A;  4OD5 A;  4GFL A;  2EHO C;  3JCF A;  2I10 A;  3NRX A;  5JQG E;  3I0O A;  3RIA A;  1YKH B;  2YKS A;  3ZMT B;  2XQ8 A;  3TLU A;  3GN5 A;  2PBI A;  2ID6 A;  4JI2 T;  3LJC A;  3HGG A;  5DQV A;  4ZOL E;  5JRC B;  2WY2 A;  3AQS A;  3Q0V A;  4PJM A;  3P9T A;  1A6I A;  2IIU A;  2UUC T;  2C0S A;  4DR4 T;  1UCU A;  4DBR A;  2FJE A;  1Y01 A;  2R7X A;  2M6B A;  3ONJ A;  5LYJ E;  1VRB A;  5AQK B;  2CBI A;  4AKR B;  1JT6 A;  1Z77 A;  1N33 T;  5LG4 A;  1HR0 T;  3RH3 A;  2DG7 A;  1T56 A;  2PFV A;  3AXJ A;  3CKD A;  3BQI A;  3BQZ A;  3RYI E;  4PNI A;  4UVB B;  5C2T A;  3EI0 A;  4PK5 A;  4WBO A;  4WZX A;  3FHN A;  3Q5E A;  2XPK A;  3ZQI A;  3NBX X;  2IUB A;  4L62 A;  5JDN A;  5IHY A;  3VVX A;  2RPA A;  3PE0 A;  2IC6 A;  1SUM B;  5F27 A;  3PUR A;  4OYK A;  4ZHQ E;  2GK9 A;  1MIY A;  4GYS A;  4I4T E;  3AE1 A;  1WLX A;  2RAE A;  2V7K A;  5JRE A;  2ODU A;  3W15 B;  2FD5 A;  4YHJ A;  3ZLI A;  2G7L A;  2UXX B;  2OV9 A;  2K3W A;  2V6X A;  2XM2 A;  3QC9 A;  1OXZ A;  2HQ5 A;  2JRK A;  4B3T T;  1WCR A;  5F04 A;  5HYA A;  3KV5 A;  4UEL A;  3MNL A;  2BVL A;  4NIQ A;  1IAP A;  1HNZ T;  3HR0 A;  1IBM T;  3BJB A;  1T7S A;  5LJM A;  2JMK A;  5JDF A;  4IGU A;  3ZT5 A;  3U3I A;  4EIW A;  3AXJ B;  4G63 A;  3GEU A;  1HX1 B;  1WR0 A;  3BR3 A;  5AQI B;  5HEG A;  1XZY A;  2CLY B;  3I0Q A;  3FRQ A;  1BR1 A;  2NS8 A;  2CHN A;  3D0T A;  2UXH A;  3C4W A;  4DV0 T;  2XQ9 A;  3MKD A;  2JJ9 A;  2HPL A;  3RC3 A;  3ZQL A;  5AQQ B;  1V9D A;  2N1G A;  3P4P A;  2XGD A;  2QCO A;  2N2N A;  3RIF A;  3MZK B;  1SE7 A;  4ZEY A;  3RYF E;  4MK6 A;  3ZSS A;  3O1J A;  2WWU A;  3Q0U A;  4AQG A;  3JAD A;  4X1E A;  3HI2 A;  4HWF A;  3JC6 C;  2JQK A;  2WB5 A;  4M3B A;  3PUQ A;  3AAE B;  4U7I A;  2W62 A;  3SFE A;  4W97 A;  2D5U A;  2LKG A;  2HXO A;  5L4H A;  2E5L T;  5CQG A;  1E1H B;  3RRC A;  3ZYL A;  3RIU C;  2WP9 A;  5JDG A;  4CN6 A;  5JDM A;  4QH1 A;  5L3D B;  4Z91 A;  3BTI A;  4ZI2 D;  4HFE A;  2Q9Q A;  2XGC A;  3KKD A;  3OVU A;  3AE6 A;  4PW8 A;  2WDR A;  3PPB A;  2VAS A;  5HXR A;  1N34 T;  2HN1 A;  5AQT B;  3AQT A;  4X20 E;  3O9X A;  5HSZ A;  4HTE A;  2LLY A;  3WI3 A;  5C8Y E;  4X65 T;  5LB7 B;  4ASK A;  4U31 A;  4G12 A;  2DI4 A;  3UUL A;  4WW0 A;  2VUR A;  3OYX A;  3VUQ A;  3PUA A;  4KX6 A;  4U9N A;  2W2U A;  1WRD A;  1ZOY A;  5K7F A;  3KVB A;  3BK9 A;  4PFO A;  2IDO B;  4GCL A;  3C4X A;  5FVL A;  1NEK A;  1QLB A;  4P0A A;  4XAX B;  2XQ4 A;  2WWV A;  3VRA A;  1Z8U A;  3FXE B;  3O4X E;  1L0V A;  1VCS A;  5F0H A;  1T98 A;  3AA0 B;  3EUP A;  5FVK A;  5CA0 E;  3UFG A;  3CX7 B;  5HCM A;  3I9Y A;  3FZF B;  3B6A A;  5HWX A;  5FKY A;  4CN4 A;  5FKO A;  3HKE E;  2IW5 B;  1E7P A;  3BQK A;  3ZCI A;  5F3J A;  2QA7 A;  4OYJ A;  5IPA A;  3AVS A;  2Y30 A;  5HXH A;  4IDZ A;  2XAH B;  2OI8 A;  2LKH A;  2W61 A;  1KNR A;  1VCT A;  3HA4 A;  4LFB T;  2NOX A;  2ZCX A;  4JL3 A;  4AC6 A;  4I55 E;  3G1L A;  3VVY A;  2R7U A;  3LBX B;  5J1Y A;  4C91 A;  5CFB A;  1OWA A;  2V7I A;  1Z0X A;  2OA5 A;  5H6R B;  5K7H A;  5ABF A;  1VOM A;  5D1R A;  4D5F A;  1X9B A;  1RPW A;  5HEJ A;  3DCF A;  2VL8 A;  1YXR A;  2GFN A;  3AEF A;  1MNE A;  3N9N A;  1JNZ A;  4TV8 E;  3FXD B;  4ILC A;  5IP6 A;  1S35 A;  3PU8 A;  5FKM A;  4JI0 T;  3S5R A;  5DQW A;  3RGL A;  2JK3 A;  4YSX A;  2UXI A;  1BJZ A;  4AKH A;  4QXB B;  3ESL A;  4M1P A;  2XAS B;  4EGW A;  1U9O A;  4U2Y A;  3CRJ A;  5IUX A;  2V57 A;  4WYV A;  1N36 T;  1YKE B;  5FXZ A;  5FXX A;  1IJ5 A;  4GCT A;  2V1D B;  4IT4 A;  3AA6 B;  3F0C A;  4KBM B;  5HAX A;  4DR1 T;  3KBU A;  5KX5 E;  1US7 B;  3CCY A;  1VI0 A;  5FL1 A;  4DO0 A;  2GUH A;  1BR0 A;  2FQ4 A;  3VW2 A;  4P0B A;  4TUY E;  3LWJ A;  4AIU A;  4GYR A;  2DNX A;  4JI1 T;  4DMV A;  4HE8 A;  4QH5 A;  4L5G A;  3UU5 A;  4D5C A;  4ILU A;  3CWZ B;  2V8S V;  4LF5 T;  3UT5 E;  4CN1 A;  4AKL A; 
#chains in the Genus database with same CATH homology
 2Y8D A;  2Z6E A;  2CLY C;  3IHR A;  2Y48 B;  2VK9 A;  4H9N C;  4H9P C;  5JR9 A;  4O2A E;  1Y64 B;  1LVF A;  1D1B A;  5BMV E;  4CQI A;  2C5I T;  2YK0 A;  3OJA A;  3PDY A;  4U74 A;  3SS1 A;  5A1L A;  4EB6 E;  3ANW A;  3HKB E;  2CEA A;  4O4H E;  3UUN A;  4OD5 A;  2Q9Q B;  2EHO C;  5KDM C;  3CPZ A;  2KMF A;  3NRX A;  4PAG A;  5JQG E;  2ZM2 A;  3I0O A;  1YKH B;  5HXS A;  2XTL A;  2LOP A;  1U4Q A;  2K5B B;  3AA1 B;  3ZMT B;  2MOZ A;  4IE0 A;  5FY7 A;  3ONX A;  3GN5 A;  2PBI A;  4H9Q C;  2N9D A;  3B57 A;  2R7W A;  4MLK A;  5LGN B;  3LJC A;  5TAO A;  2DHR A;  4PK4 A;  3PTR B;  2LHN A;  3V5U A;  4KMC A;  5DQV A;  4ZOL E;  3KYL A;  2L9Q A;  5JRC B;  1HCI A;  3TKL B;  3R6N A;  1MMA A;  3ZMZ B;  2JQQ A;  4PJM A;  2LE8 A;  2X67 A;  4QX8 B;  2LM9 A;  2C0S A;  4XBF B;  1UCU A;  2PJQ A;  4DBR A;  3ZN0 B;  4OD4 A;  2R7X A;  3E08 A;  2LSG A;  5JDQ A;  5LYJ E;  1VRB A;  4AKR B;  2KXP B;  3QK6 A;  4I43 B;  5LG4 A;  3NS4 A;  1QSD A;  4KP3 C;  3KV9 A;  1ZV4 X;  3C98 B;  5AFU L;  3RH3 A;  3J7Y q;  5GON E;  4HN9 A;  3UTK A;  4NUU A;  3C4Z A;  3WAJ A;  2PFV A;  4KUM B;  2CA5 A;  3CKD A;  3O1H A;  3BQI A;  3N2O A;  2NTX A;  3RYI E;  2CCQ A;  4PNI A;  4K0U A;  4YJ3 E;  4UVB B;  3KBT A;  3PU3 A;  4IIJ E;  4PK5 A;  3SOL A;  3DU5 A;  4JEU B;  4TN7 B;  4WBO A;  3FHN A;  2KT9 A;  4I50 E;  2CWO A;  4O4J E;  4IHJ E;  3H3A A;  3NBX X;  5ADX L;  5FXW A;  3PUG A;  2EHO A;  5JDN A;  5JR9 B;  4ISS A;  5IHY A;  1D0X A;  2MTQ A;  3KV6 A;  5DAB A;  1D0Z A;  3IEE A;  2IC6 A;  3PE0 A;  3LG7 A;  2MBG A;  3WAK A;  2DCF A;  2DLR A;  3ANW B;  4F6R C;  1HG2 A;  3P7I A;  3PUR A;  3Q5W A;  1WYC A;  3NZQ A;  4OYK A;  3OKQ A;  5LHH B;  1HS7 A;  3PUS A;  3E22 E;  4IRV A;  4ZHQ E;  2WAU A;  2GK9 A;  4QX7 B;  1MIY A;  1YW0 A;  4O8S A;  2ZLY A;  4GYS A;  5CB4 E;  2KZ7 B;  4I4T E;  5LBQ B;  4BJM A;  2CMR A;  3A5X A;  2NWB A;  1MMN A;  1ZKE A;  3V5S A;  4V1A v;  1WLX A;  4HEA A;  4ERR A;  2V7K A;  1MMG A;  3N5L A;  2ODU A;  4X1K E;  5JRE A;  3W15 B;  4AKG A;  4YHJ A;  3R84 B;  3ZLI A;  2UXX B;  4UV9 B;  3ZCJ A;  2PG8 A;  4GIW A;  3QC9 A;  1OXZ A;  2CM0 A;  3N2K E;  2JRK A;  3LBX A;  5HYA A;  3KV5 A;  4UEL A;  1G73 A;  4X1I E;  2HH7 A;  2BVL A;  3HKC E;  4NUV A;  5L3B B;  1IAP A;  4JLE A;  2Y6X A;  4YFS A;  3CML A;  2P9B A;  3DJB A;  5LA6 E;  4EYU A;  2V7M A;  4DND A;  3HR0 A;  4P09 A;  3C64 A;  2R7R A;  5LJM A;  2JMK A;  5FY0 A;  5JDF A;  1QUU A;  2CXD A;  3CVR A;  4IGU A;  3EDV A;  3U3I A;  4QKN A;  5FNV E;  2WSS V;  3AA7 B;  2Q9Q D;  2B3W A;  3L3P A;  4EIW A;  4G63 A;  1UX5 A;  4QXH B;  2W00 A;  1X79 A;  4O4L E;  4X1Y E;  4ADZ A;  4CI1 B;  2CLY B;  3GA8 A;  3I0Q A;  2RA1 A;  3ZMU B;  5HXE A;  2J1D G;  4H9R C;  1BR1 A;  3QUJ A;  3I9W A;  4UVC B;  3D0T A;  3KVA A;  5J1G A;  3C4W A;  3MK7 C;  3ZMV B;  2Q9Q C;  3GMI A;  2BVM A;  4CZZ B;  4YLH A;  4AKI A;  3MKD A;  3CQG B;  2JJ9 A;  2D2S A;  2HPL A;  4FJO A;  3RC3 A;  2C5K T;  2I59 A;  4PJN A;  1V9D A;  2N1G A;  2EHO B;  3F57 A;  3MA9 A;  3RRW A;  3RKO A;  2N2N A;  4IE7 A;  4QXC B;  5J2T E;  2XQY A;  4PJL A;  4MHC A;  1IJ6 A;  3MZK B;  4UVA B;  2R7O A;  4HKA A;  3RYH E;  3VHL A;  4DBQ A;  2R7V A;  3JC6 D;  3DP7 A;  4CI3 B;  5JH7 E;  3RYF E;  3F2E A;  3O1J A;  4O4I E;  2WWU A;  3LFM A;  2A3D A;  3ZJ1 A;  5M4Y A;  4AQG A;  3IBP A;  4EXT A;  2NW7 A;  5LHI B;  5CA1 E;  3HI2 A;  3JC6 C;  5J2U E;  4OK0 A;  1O3X A;  4PK6 A;  4EZH A;  3LK3 B;  1HG5 A;  1FIO A;  3PUQ A;  3RPU A;  3ZYM A;  1IZN B;  2H7O A;  3AAE B;  4E7Z A;  3C50 A;  2H3R A;  2W62 A;  3M65 A;  1LKX A;  1SHZ C;  4MAL A;  1B7T A;  3K3Q C;  2RP4 A;  4TX5 A;  3I1A A;  2D5U A;  2NW8 A;  3ETU A;  5H6Q B;  3AB3 B;  3BQL A;  3UUX B;  3HL6 A;  2KND A;  2YU1 A;  1HFA A;  2E9X B;  1MIV A;  5CQG A;  1HTJ F;  1E1H B;  1AJ3 A;  2JPF A;  4ZS3 A;  3RRC A;  3ZYL A;  5F8P A;  4ZI3 D;  5JDG A;  5JDM A;  3LK2 B;  5L3D B;  4XZC A;  2K24 A;  4ZI2 D;  1D1C A;  3L09 A;  3LK4 2;  2Q9Q A;  3SRZ A;  3NRY A;  5ETW A;  4JEH B;  3MJX A;  4PW8 A;  5FP3 A;  2VAS A;  5HXR A;  3P8C D;  5L3E B;  3DTO A;  4GOU A;  4PJJ A;  4X20 E;  3O9X A;  2V7L A;  4QWN B;  4HTE A;  2WBL A;  2WMO A;  4HGA A;  2FJI 1;  3GN5 B;  4A56 A;  4IE6 A;  2XAF B;  3WI3 A;  4AXP A;  5EZY E;  5C8Y E;  3ZYK A;  3U78 A;  2HPJ A;  4ASK A;  3ZPO A;  1D1A A;  2DI4 A;  3UUL A;  1NWM X;  3N9P A;  3OYX A;  4WW0 A;  2XHE B;  3VU7 H;  2LJL A;  1HX8 A;  3PUA A;  3DU6 A;  4H63 V;  5KMG P;  5LJN A;  2JMH A;  2XAJ B;  2X9X A;  2YEV C;  4OFZ A;  4UV8 B;  1WRD A;  2E8I A;  3N9Q A;  1MMD A;  3KVB A;  5HWY A;  4EOZ B;  2LHR A;  3BK9 A;  2C5J A;  4PFO A;  2WMN A;  3C4X A;  1ZHC A;  3VKG A;  2NW9 A;  2IAK A;  4BJN A;  2YU2 A;  4XAX B;  5DJQ C;  4P0A A;  5L2L A;  2X9W A;  3Q5X A;  1CUN A;  2UXN B;  2LOS A;  1FEW A;  2XAQ B;  3FXE B;  3KFW X;  3O4X E;  4B6X A;  5FY1 A;  1S94 A;  2L3L A;  5FYM A;  4MBQ A;  3RX6 A;  3NZP A;  4ZI7 E;  3EUH A;  4CXX A;  4U72 A;  3ZN1 B;  1T98 A;  2CWY A;  3AA0 B;  5CA0 E;  3VKH A;  3CX7 B;  1UX4 A;  2D0T A;  2QGS A;  4UF0 A;  5JDL A;  2X0L B;  5IYZ E;  2NTY A;  2EHO D;  4OHF A;  3K3N A;  2LSY A;  3FB2 A;  2B1E A;  2DWK A;  2IC9 A;  3I9Y A;  2XAG B;  4TV9 E;  1LVK A;  5HWX A;  2H7V C;  2V26 A;  2KIN B;  4C90 A;  4H9S E;  2R7S A;  4EZ4 A;  5LHG B;  3CX6 B;  3HKE E;  4L0R A;  2W0G A;  4GK5 E;  3ZC0 A;  4WNK A;  4J2C A;  1MND A;  2IW5 B;  2VB6 A;  1Z0P A;  5FMN A;  2LEH A;  5LGU B;  4AQF C;  3BQK A;  3ZCI A;  5F3J A;  4IE4 A;  3S4U A;  2R7T A;  1BR4 A;  4CXW A;  2QA7 A;  4MFR A;  5LGT B;  4OYJ A;  3RYC E;  5LCY A;  3AVS A;  4EAH A;  3ZMS B;  5HXH A;  2A72 A;  4IDZ A;  4WBN E;  2KWH A;  3GWH A;  3UUM A;  2LT3 A;  2XAH B;  2W61 A;  3HA4 A;  2R7Q A;  5LXT E;  1EZ3 A;  1WYB A;  3HKD E;  2NOX A;  4I55 E;  3K8P C;  3OYZ A;  3Q9D A;  2R7U A;  2ZM8 A;  5LBM A;  3LBX B;  4ANJ A;  4BAY B;  2VWA A;  2V7J A;  4C91 A;  2E9X D;  1OWA A;  3MXZ A;  4Z8X A;  4EYY R;  2V7I A;  3K3O A;  2OA5 A;  5H6R B;  3N9M A;  5EK4 A;  2VKH A;  3CQC B;  4IST A;  2YIN A;  5HXC A;  4QHO A;  5JDH A;  1G8X A;  1VOM A;  2CE7 A;  2ZM0 A;  4UXN B;  3J9X 1;  1H7C A;  1SA0 E;  1U5P A;  4HFV A;  2VL8 A;  2ODV A;  4H9O C;  4PFP A;  2SPC A;  2E9X C;  5LNK A;  1MNE A;  3N9N A;  5FXV A;  3ZC1 A;  5EK2 A;  3IF8 B;  4ZS2 A;  3MAC A;  3B13 A;  4TV8 E;  3SWH A;  2MYS A;  3FXD B;  4JUY A;  3UFE A;  5LP6 E;  1KNZ A;  1BR2 A;  1S35 A;  3ETV A;  3N2G E;  3PU8 A;  2VKJ A;  4TZ4 C;  3T8O A;  5JR9 C;  4DMW A;  4E7S A;  4GK0 E;  4H63 H;  5DQW A;  4C2M A;  2D0U A;  4ZI3 C;  3CX8 B;  3FBL A;  4DVY P;  4QXB B;  4AKH A;  3ESL A;  2BDE A;  3O1I A;  4M1P A;  2XAS B;  4UF0 B;  5L3F B;  2ES0 A;  3N9O A;  1KK7 A;  4UEM A;  2KLQ A;  4ZI2 C;  3AVR A;  5JVD E;  3ZEF B;  2K48 A;  5E0O A;  3Q2M A;  4AI6 A;  1YKE B;  4YJ2 E;  3KIN B;  1FMW A;  3OBV E;  5FXX A;  1IJ5 A;  5FXZ A;  4AQF A;  5JRC A;  4L9I A;  3C51 A;  2L8K A;  2V1D B;  4CXY A;  3CQX C;  1LRZ A;  5L3C B;  3AA6 B;  2KWI B;  2LSK A;  1YD8 G;  4KBM B;  2WM9 A;  2DWG A;  5HAX A;  3H37 A;  4O2B E;  3E0Z A;  4CI2 B;  3KBU A;  2CXF A;  5KX5 E;  1US7 B;  2W63 A;  4G2A A;  2XUE A;  1D0Y A;  5LOV E;  1MIW A;  2X68 A;  3RC8 A;  5EK3 A;  4DO0 A;  1BR0 A;  1HF8 A;  2X66 A;  3FBZ A;  4FI5 A;  1WR6 A;  2VKD A;  2A2F X;  3KDS E;  2ZMA A;  2VKO A;  4P0B A;  3EVY A;  2X9H A;  4BA9 A;  4TUY E;  3VTI A;  3F31 A;  4DVD A;  5L3G B;  2M67 A;  2ACX A;  3N9L A;  4IE5 A;  3AAI A;  4GYR A;  3ZJ2 A;  2DNX A;  3AAA B;  4DMV A;  2K9A A;  2X9Y A;  2CXL A;  4HE8 A;  1FMV A;  2X51 A;  1NAF A;  4L5G A;  4N78 D;  1ZEE A;  2LSJ A;  4ILU A;  3CWZ B;  3KV4 A;  2G0U A;  2E9X A;  3EDU A;  4UIG A;  2LSI A;  3UT5 E;  2BZB A;  2NP9 A;  4AKL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...