3K8PC

Structural basis for vesicle tethering by the dsl1 complex
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
352
structure length
295
Chain Sequence
NIYTTLKFESMMQQRVIQIRSIPEEEYHELVSVQPIQVSVFVQSAAKVFTEFEQGCDTIGRSKVESIYLYKFNLLQTAFFAMVSEKVNDWTQLYKDVRYLYTENPKLLQLMELNSRRLDLNLNLIKKTIYKLVNDQLQELKDNERTPDWDITISSLLPYLKKTALPTLYKLEDNTILVALIRYIVHDLVIDNILHWRVISEKSSENLSEFIMLLLSGLEIPRLNLIETYRHSREKLGILSKILTAHLKDILEMFYEGEFFLFETDEIVQWIILLFADTPTRRDCIDEIRRVREEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein/transport protein
molecule keywords Dsl1
publication title A structure-based mechanism for vesicle capture by the multisubunit tethering complex Dsl1.
pubmed doi rcsb
source organism Kluyveromyces lactis
total genus 112
structure length 295
sequence length 352
ec nomenclature
pdb deposition date 2009-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF11989 Dsl1_C Retrograde transport protein Dsl1 C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.150 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor; domain 2 3k8pC02
1.20.58.1440 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3k8pC01
3K8PC
chains in the Genus database with same CATH superfamily
4F8HA 4TWFA 4QX8B 3TKLB 3PUXF 1KNZA 3UUXB 5ETWA 2MPKA 4JI1T 3PUVF 1ZP0A 2RP4A 4HN9A 4YSXA 4KMCA 1VRBA 4EYYR 2B76A 3ANWB 3NZPA 4ISSA 3LWJA 2BZBA 5AQOB 5KXJA 4AKLA 3W15B 3ETUA 1W09A 4JI5T 1U4QA 4TZ4C 3VVYA 2VVNA 3RC3A 3UU6A 2K48A 2Q9QB 2I59A 2QOPA 3AEEA 5CQGA 1YKHB 4IREA 2NOXA 1YQ4A 3B81A 4IIJE 1FMWA 1M7KA 5ABFA 4IL9A 4U2ZA 5FMNA 4U74A 1IZNB 4YJ2E 4N78D 1T33A 3ZYKA 3AEDA 5CFBA 1NWMX 2KT9A 3EAMA 2BVLA 5ABGA 2QCOA 4LF9T 4JEHB 4TV9E 1YQ3A 5AQFB 4DR7T 1I6ZA 3LG7A 2FX0A 2GFNA 1T98A 2SPCA 5AQJB 4HFCA 2BG9B 1ZOYA 3KV9A 1IJ6A 3L39A 4PK6A 4UDSA 2A72A 2DCFA 1J1JA 4UVAB 1SUMB 2WB5A 2LHNA 4QWNB 2XQ7A 2XAHB 2FD5A 4AQFA 2JQKA 3K3NA 2N9DA 4KI0F 1QPIA 2LSKA 3IUVA 3N9NA 1ZK8A 2VVSA 4GYRA 3RRWA 3C4XA 3PUYF 5EK4A 4ZI2C 2DNXA 3DTOA 3HKBE 4ZZBA 3CX8B 3UUBA 1N36T 4DMWA 2FQ4A 2OF7A 4D5CA 2D9DA 4TUYE 2QA7A 2V7IA 3PJAA 3UU5A 3QB5K 2WV1A 3Q0UA 3L3PA 3IH4A 2R7SA 3MJXA 2EH3A 2HN1A 4YJ3E 3H3MA 2YU2A 2CWYA 3RD3A 4Z8XA 2UXIA 2WUIA 2QGSA 5FL1A 2R7WA 2QRXA 2VQFT 1YD8G 1KK7A 3CKDA 4ZI3D 3LK2B 3C98B 3GMIA 2EHOD 4HGAA 4HEAA 3ZLIA 2FJEA 2K3WA 2AE9A 2XM2A 1Z77A 4I55E 5K7FA 4EZ4A 4AXPA 1XDOA 3HTIA 4IDOA 2V5DA 3IF8B 5ABFB 5A1LA 3UFGA 4AC6A 4JI3T 3ONJA 4AQFC 4QXHB 2HKUA 1VCSA 4UVBB 3O9XA 2OLTA 3KV6A 5F0HA 4W97A 2LHRA 2W0GA 2V26A 4O4LE 1Z0XA 2LSIA 5L4HA 4DV6T 4H9OC 3P9TA 2LSYA 2ZM6T 4DUYT 2ZM2A 2W61A 2G3BA 1JNRA 2ID3A 1L0VA 2CLYC 3N2OA 3OPCA 2K9AA 1SHZC 5FY1A 3ZT6A 4ASKA 4GCLA 1IBKT 3UT5E 1UUSA 4UEMA 4ABZA 5CA1E 2VQET 3AE1A 4ILCA 4DV7T 3MZKB 1MIYA 4P09A 3PU8A 3FK7A 3CPZA 4X65T 3VRBA 3ONLC 4D7MA 5LJNA 1T72A 3G1MA 3LOCA 1CUNA 1G8XA 4B3AA 5K7HA 2X0YA 3RIAA 1FMVA 2R7XA 4M3EA 2R6GF 4M3GA 3TLUA 1VCTA 4B3TT 1WR6A 4YFSA 2P9BA 1UX4A 2KLQA 2D0UA 3B57A 2UXPA 3G1OA 4O2AE 1JTYA 2YDSA 2W67A 2G7SA 5GP9A 4NUUA 2VKOA 4QH5A 3D0TA 2H88A 1NAFA 4CI3B 2YK0A 1HG2A 2K5BB 2CXDA 3JAEA 5DQVA 2KXPB 3NNRA 4U72A 1KNRA 5LMNT 2R7TA 3CQGB 3V6GA 4EZHA 2CXFA 5DJQC 2EHOB 2XQYA 3LJCA 4KX6A 4P0BA 4EB6E 5F27A 3ANPA 2FJBA 5CB4E 5IHYA 3ZN0B 4AIUA 4IDNA 5FKMA 2X51A 5DABA 2NP5A 3RYIE 1MMAA 2LSJA 4EXTA 2E9XD 3IHRA 2HXOA 5CXIA 3KZ9A 2QVAA 5LGTB 4IT4A 2O7OA 5FXZA 2XGDA 1HCIA 4UVCB 4X64T 1IBLT 4X1KE 4Z91A 4UF0A 3N9PA 4HWHA 5EK2A 1QVTA 4LMLA 2CXLA 5LHHB 4CQIA 3VTIA 3FB2A 5EZHA 4P1NA 5HWYA 1HX8A 5H6RB 2V7KA 3O8HA 3O1JA 3NRXA 3IBPA 3TP0A 1MIVA 5IWAT 2XQ4A 2XAFB 5GPAA 3CJDA 5IOZA 5EZGA 4EYUA 3VU7H 3KDSE 5EYRA 2X9WA 1NENA 2IBDA 4H9PC 2LKHA 1JTXA 2IC6A 3BT9A 2W4XA 2IHR1 3R84B 5HXHA 1UK5A 3MXZA 2BG9E 3Q9DA 5LCYA 3Q0WA 3EHZA 2FJAA 2M67A 3AEGA 3EUPA 2YKSA 2RPAA 5JDMA 1JT0A 4GK0E 1UCUA 2HHHT 4ISTA 2CBIA 2ZOYA 3VR9A 4MLKA 2NP9A 2ZCNA 1BR1A 2KINB 4HFHA 5H6QB 4OFZA 4OYKA 1OWAA 2ZM0A 4JV5T 3NWIA 3OYZA 3LBXB 2F4VT 3JCFA 5IPAA 2OERA 4DV0T 4G2AA 3I9YA 5CXGA 5BMVE 4DV4T 2JK3A 2OA5A 2LLYA 2XAJB 4OYJA 2UXXB 3ZJ2A 4DMVA 4MK6A 3U3IA 2E5VA 5JRCB 2QKOA 3BR2A 1GQEA 3C4ZA 2WDVA 3F0CA 2KMFA 4DR2T 3VOKA 2XTLA 5LYJE 4HKAA 5FKOA 2JQHA 2YVHA 4U7IA 2XUEA 2WY2A 2CHOA 2E9XB 3RHWA 4YLHA 2CM0A 3CK6A 2NP3A 3BCGA 4LF6T 4U7YA 1QVUA 1MMGA 5JH7E 3GEUA 4LF4T 2FUPA 4UV9B 1H7CA 3PUWF 2N1GA 4HWIB 1S94A 2XAQB 5EFYA 1KF6A 2R7QA 3NKZA 4KBMB 2MAWA 5AQKB 3HE0A 2QYWA 5HXCA 5F1JA 2VPRA 4DR3T 4YSZA 2X9XA 3BNIA 4ILBA 3AA6B 4XAXB 4I43B 1U9NA 4LMJA 3J7Yq 5FY0A 4DW6A 4U31A 4P0AA 4NXMT 1ZEEA 3CRJA 5LNKA 2XSAA 2JMHA 4KWAA 3BQZA 3RX6A 4AQGA 5FVLA 4O4IE 3B13A 4I4TE 2LOPA 3COLA 3ZMZB 3WHCA 5FKNA 3N2GE 1S35A 2C5JA 3KBTA 4DV3T 4IDPA 2BBJA 3DEWA 2VKEA 5JVDE 4HFEA 4C2MA 3B6AA 5FKYA 2LEHA 4I50E 3HTJA 3O1IA 5LBQB 2JMKA 3ON2A 1UURA 3ZYMA 4X1IE 2PFVA 3ABVA 3VW2A 3G7RA 3AVRA 3QKXA 1OXZA 3B6CA 3T1YT 5C8YE 3AE5A 2CBJA 3P7IA 3A7MA 3CQXC 4QXCB 4DR6T 3BQIA 2UUCT 3PE0A 4LF5T 1I94T 2Q24A 5L3GB 3O4XE 2OV9A 3OKQA 2Q9QC 4PXIA 3A8YC 4C90A 4F6RC 4B3RT 3Q5XA 5L4EA 4COFA 3AXJB 4JL3A 4IDQA 3LSJA 3P50A 4JI6T 5LHGB 1Z0PA 3UUMA 5HXRA 4QX7B 5DQWA 3ESLA 4TWHA 4AKGA 3DP7A 4JBWF 4IL4A 1T56A 3T8OA 3VRAA 3L09A 4O4HE 1SE7A 4CI2B 3KV5A 5FXXA 4HTEA 2CRBA 2IAIA 2D0TA 1KNPA 4X5TA 3M3ZB 2WMOA 2NW7A 2CMRA 1D1BA 5JDNA 3ZMTB 3JC6C 2RAEA 4JNNA 1HFAA 4TNWA 3NPIA 2RHAA 2L9QA 5AQHB 5C3JA 5HXSA 2PJQA 2YU1A 3NBXX 5JQGE 2HYJA 2H7OA 4IRVA 5JDGA 3VIBA 3F57A 3K8PC 2N2NA 3R6NA 2V7LA 2JQ9A 3C64A 5LMUT 5F5WA 2KNDA 2YINA 2XY8B 2X67A 4DV5T 3MNLA 3J9X1 4AI6A 4NIQA 4ZXLA 5J1UA 1T7SA 4CXWA 2QIBA 2ACZA 5HEJA 3NS4A 3BR0A 4AUXA 5HSZA 2RA1A 5L2LA 3PPBA 2ID6A 3I0QA 3UU4A 2VKHA 4EOZB 3HTAA 1UX5A 3BQKA 1QSDA 3VW1A 4G63A 4IE4A 3PDYA 2V6YA 2BS3A 1JT6A 2UXHA 5HCJA 3VKHA 4J2CA 4AKHA 3A5XA 2VWAA 3UTKA 4DR4T 3LSRA 5JDHA 1MNDA 5JR9A 4ERRA 5AQGB 4LMKA 4GFLA 2XPVA 4IE6A 3IA3A 5HAXA 2LOSA 2K24A 4IHJE 3FIWA 4JYKA 3VVXA 4GCKA 4PFPA 5L3DB 2UUAT 1HNZT 2H89A 5FP3A 3ZEFB 2VK9A 3PTRB 4I0UA 4KUMB 2Y6XA 3FHNA 3BRUA 1X79A 3NZQA 4LF8T 2GENA 3BTJA 2WP9A 3N9OA 2J47A 4IE0A 2WAUA 2BBHA 3ZKRA 2FJ1A 2WBLA 3RH3A 5F3JA 3DPJA 2Y31A 2VASA 3BTLA 5AQMB 4H63H 3BR1A 2V1DB 3BQYA 4TN7B 1LVKA 1UI6A 3L8RA 4WW0A 4DV2T 3RC8A 4AC0A 5FXWA 4DBQA 4ZS2A 2KSRA 4ZHQE 3SDGA 3ZCJA 3K3OA 1WYBA 5JDFA 2C5IT 1RKTA 3AA7B 4JI4T 4ZS3A 3UU8A 4OD5A 2PZ9A 2YN6A 3PUAA 4HE8A 1YXRA 3T6NA 2IEKA 5JR9C 2RASA 2JQQA 3I9WA 5L47A 2LM9A 4DV1T 5AQIB 5HEHA 2R7OA 2XPUA 2I0MA 1Y01A 3RYHE 4HWDA 2MTQA 3QK6A 3N2KE 3FZMB 2LKGA 1OEDA 3VP5A 3X1DA 2OPTA 1G73A 5J1RA 5AQCA 4PJMA 1HNXT 2BVMA 4WIBA 1LRZA 5HCMA 5FXVA 1Z8UA 5BR8T 4YSYA 4WBOA 3AE6A 2VB6A 2IMLA 4O2BE 4PNIA 4WBNE 1O3XA 3HIMA 4ZI3C 5LG4A 3N9MA 2CEAA 4YHHT 2HQ5A 3CWRA 2EHOC 3KINB 4OX9T 5L3EB 2J4GA 3ONXA 3QC9A 2X9YA 4YZEA 4M3BA 4JUYA 1JUMA 1E7PA 3DJBA 3V5UA 4ILAA 3GA8A 3S4UA 2KWHA 1U5PA 3P4WA 4X1EA 2G7LA 2X9HA 3QBMA 2BS2A 2DWKA 3FK6A 2TRTA 5F04A 5L3CB 3G56A 5EZYE 1EZ3A 2E8IA 1RKWA 4X62T 4NPPA 3TLTA 4BJNA 4CN4A 1ZKGA 3QNUA 5IP6A 2XRLA 5FVKA 3RH2A 4B1RA 1JUPA 2WDRA 3ZMSB 3ZPOA 3BTCA 4MBQA 3VHLA 3O8GA 3VR8A 2IUBA 4H9SE 4DUZT 2DL1A 5LG3A 1OEDC 3FBZA 4QKNA 5J0ZA 3FZKB 3P4RA 3ZN1B 2NW8A 2LE8A 3AAIA 4GYSA 3HKDE 3Q5EA 3ON4A 4YTMA 2YVXA 3C50A 2NW9A 2XHEB 3WAKA 1BR0A 2KWIB 5LXTE 3QQAA 3GN5A 1W0AA 2XASB 4CN1A 1IAPA 3ZSSA 3RGLA 5K7ZA 2ZB9A 5LOVE 3NVOA 4MO7A 3B5MA 3FXEB 1XMQT 2WCAA 2D2SA 3LDQB 1VI0A 4GFKA 2WWVA 3P4PA 3KV4A 3AE2A 3I1AA 2Y2ZA 1D0YA 1UGOA 2YDQA 3NRYA 2E2AA 2V8SV 2JJ9A 2X0HA 2V57A 3SS1A 4BAYB 2ZCMA 5K58A 2HN2A 3RYCE 4M3DA 5FYMA 4BA9A 3V78A 5FMPA 2NX4A 3V5SA 3DCFA 2R7RA 2H7VC 3MK7C 4EEDA 3OTOT 4IGUA 1NEKA 3OYXA 4HWFA 2XB5A 5TAOA 2NTXA 5H9TA 4DIDB 1HG5A 5IUXA 3RKOA 3AAEB 2E9XC 1FIOA 2DG8A 2G0UA 2CE7A 2WS3A 2F07A 5KDMC 5CJ5A 4GK5E 3Q0VA 3AE7A 3C4WA 4U9NA 1JNZA 3ZMVB 4H9RC 2FJDA 2D6YA 4MHCA 3CX7B 1LVFA 2DWGA 1HS7A 4UF0B 2X6OA 2NS7A 1KFYA 2XQ5A 3ETVA 2G0EA 5LJMA 4A56A 3AEBA 1SA0E 3CIRA 1VOMA 3ANWA 3VOXA 5AQRB 3AEAA 3LSVA 2VKVA 5L3BB 3AA0B 1N32T 3ZT5A 1ZKEA 4L9IA 2GUHA 4HWCA 2FBQA 3WI3A 4IDZA 1SGMA 3G06A 3AQTA 3Q5DA 2Q9QA 2VURA 3I0OA 5IOYA 2WM9A 4HFVA 3RIUC 5C4YA 3FXDB 1FEWA 5F8PA 5F0CA 2YDRA 2DG7A 3NXCA 3RQUA 3ZJ1A 2UXOA 3AQSA 2DI4A 2MOZA 3H3AA 1D0XA 3ZQFA 3QPSA 2IC9A 4LF7T 3ZC0A 1XNQT 2XPWA 2D5UA 4C91A 3CDLA 5FNVE 2XGCA 2BG9A 4A5XA 1YKEB 3TLVA 5HWXA 3HA4A 3S5RA 4XBFB 2W00A 1W0BA 5M4YA 3AE8A 5IYZE 4CXXA 3DU5A 3ZQHA 3EUHA 3SRZA 4PJJA 3HGYA 4HFIA 4ICHA 2UXUA 2PTFA 3SFIA 5HXEA 1HR0T 2A9UA 2UXCT 3C51A 4DVDA 3NI7A 2XGEA 4KHPT 4JYAT 2IDOB 4MALA 3UU3A 3PU3A 3HR0A 4TV8E 3Q2MA 2LRKA 3FRQA 3ZQLA 3O1HA 5GPCA 1AJ3A 2WMNA 1D0ZA 2L3LA 3LHQA 3QPLA 2PBIA 5JTGA 3AE9A 2HH7A 4I76A 2UXBT 5J2TE 2A2FX 1R8IA 4ZI2D 2LSGA 3RF1A 2NR4A 3TP3A 3AB3B 5KMGP 4ZEYA 5J2UE 1MNEA 1US7B 3HKEE 3BK9A 4X66T 4YHJA 3RPUA 3TLWA 1N34T 3EDUA 4NUVA 4OD4A 4GIWA 5GONE 2WQYA 4D5FA 3HGGA 3DU6A 5ABHA 2XQ9A 4NN1A 2JJ7A 1KEYA 2VL0A 3UQ7A 2WGBA 3AEFA 3AAAB 3JSJA 3PUQA 2HPJA 5D1RA 5HYAA 2BG9C 3BR6A 1J5WA 4BJMA 2L8KA 5AQSB 4JLEA 2ACXA 1Y64B 3VVZA 3AA1B 3RI5A 1X9BA 3RYFE 2XQ6A 4ILUA 4EGWA 2QWTA 3QB5A 3LK3B 4ZZCA 2XQ3A 3KFWX 1ZHCA 2CCQA 4HKUA 2ZCXA 2B3WA 3ZT7A 2ZM8A 4L5GA 2DHRA 3VUQA 2H3RA 5LBMA 3BR3A 3MACA 2V7JA 5CGMA 2UXDT 3H37A 3WHBA 2CWOA 2Y30A 5AQTB 4B3MT 4YY3T 4GCTA 3AECA 2PG8A 4U33A 3SFDA 2ODUA 3Q5WA 1D1AA 2C5KT 4ZI7E 1WFDA 4E7ZA 3C2BA 4CI1B 4AKIA 1OEDE 4TX5A 2Y48B 3CWZB 3CX6B 3K3QC 4PJNA 2ZLYA 3PASA 1XNRT 5FKLA 3ZQGA 1ZV4X 4WYVA 3M65A 3E0ZA 2W2UA 4FJOA 4XZCA 1W9RA 2V5CA 2JPFA 2A3DA 4A97A 5ABEA 4DNDA 2JRKA 2BKOA 4K0KT 3HI2A 3P8CD 2HPLA 1HX1B 2DLRA 1FJGT 5AQUB 2IAKA 5FGLA 2X68A 4DO0A 1IBMT 3HL6A 4UV8B 5J1YA 4WNKA 2UU9T 3KKDA 4CGRA 2QTQA 5E0OA 1HTJF 2YOEA 5AQPB 2I6HA 4YTPA 2VKJA 4H9QC 4E7SA 3BR5A 5C2TA 2EHOA 4JI0T 2R7VA 3LSPA 5FY7A 3JADA 2R7UA 3KNWA 4CN6A 5AQLB 5LGNB 2UXNB 4JI8T 2IW5B 4UELA 3HKCE 4KP3C 3CCYA 2W66A 4AF5A 4YT0A 1E1HB 3KVAA 4TNVA 1WLXA 5AQNB 2V6XA 4JI2T 3UULA 2W63A 3BQLA 4MFRA 2BS4A 3SFEA 4U2YA 2VL8A 2LT3A 4H9NC 3KYLA 4DVYP 2XQ8A 1M62A 3OVUA 5JDLA 4A98A 4Z90A 4IE5A 4EIWA 3HTHA 2W62A 2ZMAA 4IE7A 5FHPA 2MBGA 3EI0A 3EABA 3KVBA 5HAWA 1YW0A 5AQVB 3FZFB 2V6YB 4PJLA 2XZEA 2CLYB 4PK4A 3BJBA 2YVEA 2JIWA 2PBXA 1V9DA 4KHZF 3FZLB 5HEOA 3QOFA 4DBRA 4U3CA 3PV0F 2GK9A 1XZYA 4AKRB 2Y8DA 3RQWA 1MMNA 4L62A 4V2FA 5JR9B 1BJZA 1RPWA 2OI8A 3U78A 2UUBT 1DU2A 2CPTA 3UQ4A 1WYCA 2IU5A 2FJI1 2WWUA 5AFUL 4OHFA 4ACIA 3SWHA 4B6XA 4QXBB 4M1PA 4NELA 2M6BA 3ZYLA 5ADXL 3LBXA 5JREA 2WZIA 4HFBA 3OJAA 2LJLA 2XDNA 2B1EA 3LJLA 3PUZF 4TWDA 3VW0A 4FI5A 5LB7B 1UI5A 2CA5A 2X9DA 2J62A 2LM2A 5JRCA 4UXNB 3N5LA 5FKKA 1WR0A 2FBWA 5CW8A 4CXYA 4OK0A 3MKDA 4O8SA 4XK4A 3N9QA 2XJ7A 3ZMUB 5HBUA 4I6ZA 3ANGA 4Q25A 3BTIA 1WCRA 3Q3SA 3E7QA 2HYTA 1MMDA 2E9XA 4X20E 2GBYA 3ZC1A 2NWBA 4NXNT 1JUSA 3LFMA 3P4QA 2XQAA 4YTNA 4JI7T 3FZHB 2C0SA 3AE3A 4ME9A 3K1SA 3F1BA 1N33T 4EEBA 2ZOZA 4AQYT 3EVYA 4ADZA 3NRGA 3IEEA 1B7TA 2YEVC 2CHNA 2VKDA 2BDEA 4HFDA 1HNWT 2ZY9A 3O60A 2X0LB 1U9OA 2XSBA 3UFEA 2X66A 3PUGA 3CVRA 1OEDB 4V1Av 4M3FA 2NTYA 4V2GA 3EGQA 2NS8A 2G7GA 3MVPA 4G12A 3ZSTA 3P4SA 4UR9A 4MXMA 2LRLA 3F2EA 2E5LT 4PAGA 3RIUA 1QUUA 3RIFA 1T8BA 2TCTA 1WRDA 1IJ5A 3E08A 2DTZA 5D19A 2XPKA 5LGUB 4LFBT 5D18A 4AISA 2MYSA 3GZIA 4YXDA 5L3FB 3QUJA 4PW8A 3ZCIA 2WSSV 1CHUA 4WZXA 1HF8A 4U9LA 5AQQB 5LA6E 1J5ET 3N9LA 4PFOA 3PUSA 5FL0A 3KKCA 3PURA 3PM1A 4LFAT 4L0RA 3VKGA 1MIWA 4GOUA 2WU2A 1BR2A 4H63V 1XWMA 2M6IA 4ZOLE 5CA0E 1ORKA 2ODVA 3T1HT 2REKA 2KZ7B 1XDPA 1LKXA 5EK3A 3SOLA 3EDVA 4DR5T 1QLBA 3PJAJ 5HEUA 3AXJA 3VPRA 4K0UA 4JEUB 2V7MA 5DAJA 3IH2A 3FBLA 2Q9QD 3TLSA 4EAHA 4CZZB 5HEGA 4UIGA 3CQCB 4DR1T 2WDQA 3RKGA 2XAGB 3GN5B 3RLFF 2BKNA 4JKZA 1E2AA 3BHQA 2HXIA 3JAFA 4QH4A 4B3ST 3CMLA 3E22E 3LK42 1D1CA 3GWHA 5J1GA 3KBUA 4EV6A 1XMOT 2BKPA 2AXDS 3UUNA 4PK5A 1BR4A 3JC6D 5LHIB 2WZHA 5F08A 4ANJA 4X1YE 3OBVE 2Z6EA 2W53A 2IIUA 3F31A 3AE4A 5JDQA 2J1DG 4GKKT 4QHOA 3G1LA 2ES0A 3IH3A 3MA9A 4QH1A 4LFCT 5F0FA 3AVSA 2XM1A 4D7NA 2I10A 4GKJT 3C07A 3WAJA 4W1UA 5KX5E 5J3LA 4O4JE 2WU5A 2O7TA 3ZQIA 3RRCA 1A6IA 5LP6E
chains in the Genus database with same CATH topology
3DJBA 3C4ZA 4QX8B 3TKLB 3V5UA 2IAKA 1KNZA 2X68A 4DO0A 2KMFA 3UUXB 3HL6A 5ETWA 4UV8B 3GA8A 2RP4A 2XTLA 3S4UA 5LYJE 2KWHA 4HKAA 4HN9A 1U5PA 4WNKA 2X9HA 4KMCA 1VRBA 5E0OA 4EYYR 2XUEA 3ANWB 3NZPA 4ISSA 2DWKA 1HTJF 2BZBA 2E9XB 4AKLA 3W15B 5L3CB 4YLHA 2CM0A 3ETUA 2VKJA 4H9QC 5EZYE 1EZ3A 2E8IA 4E7SA 1MMGA 1U4QA 4TZ4C 5JH7E 2EHOA 4UV9B 4BJNA 1H7CA 2R7VA 2N1GA 3RC3A 2K48A 5FY7A 1S94A 2R7UA 2XAQB 2Q9QB 2I59A 3ZMSB 3ZPOA 2R7QA 5LGNB 5CQGA 1YKHB 2UXNB 4KBMB 4MBQA 3VHLA 2NOXA 5HXCA 4H9SE 4IIJE 1FMWA 2X9XA 2IW5B 3FBZA 4QKNA 3AA6B 4XAXB 5FMNA 4UELA 4U74A 3ZN1B 2NW8A 3HKCE 2LE8A 1IZNB 4YJ2E 4N78D 4KP3C 4I43B 3J7Yq 3AAIA 3ZYKA 5FY0A 4GYSA 1NWMX 2KT9A 3HKDE 2BVLA 4JEHB 4TV9E 1E1HB 3C50A 3KVAA 2XHEB 2NW9A 4P0AA 1ZEEA 3WAKA 1BR0A 1WLXA 2KWIB 3LG7A 1T98A 3UULA 2W63A 3BQLA 4MFRA 5LNKA 2SPCA 5LXTE 2JMHA 2VL8A 2LT3A 4H9NC 3KYLA 3KV9A 1IJ6A 4DVYP 3GN5A 3RX6A 4PK6A 4AQGA 4O4IE 2XASB 2A72A 2DCFA 1IAPA 5JDLA 4IE5A 4EIWA 3B13A 4UVAB 2W62A 4I4TE 2LOPA 2ZMAA 4IE7A 5LOVE 2MBGA 3ZMZB 4QWNB 2LHNA 2XAHB 3FXEB 2D2SA 3KVBA 4AQFA 1YW0A 3N2GE 4PJLA 1S35A 3KV4A 2CLYB 3I1AA 4PK4A 2C5JA 1D0YA 3KBTA 3K3NA 2N9DA 1V9DA 5JVDE 4C2MA 2LSKA 3N9NA 3NRYA 4GYRA 2LEHA 2JJ9A 3O1IA 4I50E 5LBQB 3RRWA 3C4XA 4DBRA 2GK9A 2JMKA 5EK4A 4AKRB 3SS1A 2Y8DA 4BAYB 4ZI2C 2DNXA 3DTOA 3ZYMA 3HKBE 3RYCE 1MMNA 5FYMA 4BA9A 3CX8B 4X1IE 2PFVA 3V5SA 5JR9B 3AVRA 1OXZA 4DMWA 2R7RA 2H7VC 3MK7C 5C8YE 3U78A 4IGUA 3OYXA 1WYCA 4TUYE 3P7IA 5TAOA 2FJI1 2QA7A 2WWUA 2V7IA 2NTXA 5AFUL 4OHFA 1HG5A 3L3PA 3CQXC 4QXCB 3RKOA 3SWHA 2R7SA 3AAEB 3BQIA 2E9XC 4QXBB 4B6XA 1FIOA 3MJXA 4M1PA 3PE0A 4YJ3E 3ZYLA 2YU2A 5ADXL 2CWYA 2G0UA 3LBXA 4Z8XA 5JREA 5L3GB 2CE7A 3O4XE 2QGSA 2R7WA 5KDMC 3OJAA 2LJLA 4GK5E 5LP6E 2B1EA 3OKQA 2Q9QC 4C90A 1YD8G 1KK7A 4F6RC 4FI5A 3Q5XA 3CKDA 4ZI3D 3C4WA 3LK2B 2CA5A 3ZMVB 4H9RC 5JRCA 4UXNB 3N5LA 1Z0PA 3C98B 3GMIA 3CX7B 4MHCA 4QX7B 2EHOD 5DQWA 5HXRA 3UUMA 3ESLA 1LVFA 2DWGA 4HGAA 4HEAA 3ZLIA 4AKGA 1HS7A 4UF0B 3ETVA 4CXYA 5LJMA 4OK0A 4A56A 3DP7A 4I55E 4EZ4A 3MKDA 4O8SA 3ZMUB 3N9QA 4AXPA 1SA0E 3T8OA 1VOMA 3ANWA 3L09A 4O4HE 3IF8B 1MMDA 4CI2B 2E9XA 5A1LA 4X20E 5L3BB 3AA0B 3ZC1A 2NWBA 4AQFC 1ZKEA 4L9IA 4QXHB 3LFMA 3WI3A 3KV5A 5FXXA 4IDZA 4HTEA 4UVBB 3O9XA 2C0SA 2D0TA 2WMOA 2Q9QA 2NW7A 3KV6A 2CMRA 1D1BA 2LHRA 3I0OA 5JDNA 2W0GA 2WM9A 4HFVA 3JC6C 3ZMTB 2V26A 3FXDB 3EVYA 1FEWA 4O4LE 2LSIA 5F8PA 4ADZA 3IEEA 1B7TA 1HFAA 2YEVC 4H9OC 2VKDA 2L9QA 2BDEA 3ZJ1A 2LSYA 5HXSA 2PJQA 2ZM2A 2YU1A 3NBXX 5JQGE 2DI4A 2MOZA 2H7OA 3H3AA 4IRVA 2W61A 1D0XA 5JDGA 3F57A 3K8PC 2CLYC 2N2NA 3R6NA 2X0LB 3N2OA 2K9AA 1SHZC 3UFEA 5FY1A 2V7LA 2IC9A 2X66A 4ASKA 3C64A 3PUGA 3ZC0A 3UT5E 2KNDA 3CVRA 4UEMA 2YINA 4V1Av 5CA1E 2D5UA 4C91A 2X67A 3J9X1 2NTYA 4AI6A 3MZKB 1MIYA 4P09A 3PU8A 5FNVE 3CPZA 1YKEB 4CXWA 5LJNA 5HWXA 3HA4A 4XBFB 2W00A 3NS4A 5M4YA 3F2EA 5IYZE 4CXXA 4PAGA 2RA1A 5L2LA 3I0QA 1QUUA 1CUNA 1G8XA 2VKHA 3DU5A 3EUHA 4EOZB 3SRZA 4PJJA 1UX5A 1FMVA 3BQKA 1QSDA 2R7XA 4G63A 5HXEA 1WRDA 4IE4A 1IJ5A 3E08A 3PDYA 3C51A 4DVDA 5LGUB 1WR6A 2MYSA 4MALA 4YFSA 2P9BA 1UX4A 3VKHA 2KLQA 2D0UA 3HR0A 3PU3A 3QUJA 3Q2MA 3B57A 4J2CA 4TV8E 5L3FB 4AKHA 4O2AE 3O1HA 3A5XA 4PW8A 1AJ3A 2VWAA 2WMNA 3UTKA 3ZCIA 1D0ZA 4NUUA 5JDHA 2WSSV 2L3LA 2VKOA 1MNDA 1HF8A 5LA6E 3D0TA 5JR9A 4ERRA 1NAFA 4CI3B 2PBIA 3N9LA 2YK0A 4PFOA 1HG2A 3PUSA 2K5BB 3PURA 2CXDA 2HH7A 5DQVA 2KXPB 5J2TE 4L0RA 3VKGA 2A2FX 4U72A 1MIWA 4IE6A 5HAXA 4GOUA 1BR2A 4ZI2D 4H63V 2R7TA 3CQGB 2LSGA 4EZHA 2CXFA 2LOSA 5DJQC 5LHGB 3AB3B 4ZOLE 5KMGP 5CA0E 2EHOB 2K24A 2ODVA 4IHJE 5J2UE 2XQYA 1MNEA 3LJCA 4PFPA 5L3DB 1US7B 3HKEE 4P0BA 4EB6E 3BK9A 5CB4E 4YHJA 5IHYA 3ZN0B 2KZ7B 5FP3A 3RPUA 2X51A 3EDUA 4NUVA 5DABA 4OD4A 3ZEFB 5EK3A 1LKXA 4GIWA 3SOLA 5GONE 2VK9A 3RYIE 3EDVA 3PTRB 3DU6A 1MMAA 4KUMB 2LSJA 2Y6XA 3FHNA 4EXTA 1X79A 2E9XD 3NZQA 4K0UA 3IHRA 3N9OA 4JEUB 3AAAB 3PUQA 4IE0A 5FXZA 5LGTB 1HCIA 2HPJA 2V7MA 2WAUA 5HYAA 4UVCB 4BJMA 2WBLA 2L8KA 4X1KE 3RH3A 5F3JA 4UF0A 3N9PA 2VASA 5EK2A 3FBLA 2Q9QD 4H63H 4JLEA 2V1DB 4EAHA 4TN7B 1LVKA 2ACXA 4WW0A 1Y64B 2CXLA 4CZZB 5FXWA 4UIGA 3CQCB 4ZS2A 4DBQA 4ZHQE 5LHHB 4CQIA 3VTIA 3FB2A 3AA1B 5HWYA 1HX8A 5H6RB 3ZCJA 2V7KA 2XAGB 3K3OA 1WYBA 3O1JA 5JDFA 3GN5B 3NRXA 3IBPA 3RYFE 4ILUA 1MIVA 2XAFB 2C5IT 3AA7B 3LK3B 3KFWX 1ZHCA 2CCQA 4ZS3A 2B3WA 2ZM8A 4EYUA 4L5GA 2DHRA 3VU7H 4OD5A 3KDSE 2H3RA 5LBMA 2X9WA 3CMLA 3E22E 3PUAA 3LK42 4HE8A 3MACA 1D1CA 2V7JA 3GWHA 4H9PC 5J1GA 3H37A 3KBUA 2CWOA 2IC6A 5JR9C 3R84B 2JQQA 5HXHA 3UUNA 3I9WA 2LM9A 3MXZA 3Q9DA 4PK5A 5LCYA 2R7OA 2PG8A 1BR4A 2ODUA 3Q5WA 1D1AA 2M67A 3RYHE 3JC6D 2C5KT 5LHIB 2MTQA 3QK6A 3N2KE 4ZI7E 4ANJA 5JDMA 4GK0E 4X1YE 3OBVE 1UCUA 1G73A 4ISTA 4E7ZA 4CI1B 4AKIA 2Z6EA 3F31A 4PJMA 2Y48B 2BVMA 4TX5A 3CWZB 5JDQA 2J1DG 3CX6B 1LRZA 3K3QC 4MLKA 4PJNA 4QHOA 2NP9A 2ZLYA 2ES0A 1BR1A 1ZV4X 5FXVA 2KINB 3MA9A 3M65A 4WBOA 3E0ZA 5H6QB 4OFZA 4FJOA 4OYKA 1OWAA 2ZM0A 4XZCA 2VB6A 4O2BE 3AVSA 4PNIA 4WBNE 1O3XA 4ZI3C 5LG4A 3N9MA 3OYZA 2CEAA 3WAJA 2JPFA 3LBXB 5KX5E 2A3DA 2EHOC 4O4JE 4G2AA 4DNDA 3KINB 5L3EB 2JRKA 3ONXA 3I9YA 3HI2A 3QC9A 2X9YA 3P8CD 3RRCA 5BMVE 3RC8A 2HPLA 2OA5A 2XAJB 2DLRA 4OYJA 2UXXB 3ZJ2A 4DMVA 4JUYA 3U3IA 5JRCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K8P C; 
#chains in the Genus database with same CATH topology
 4F8H A;  4TWF A;  4QX8 B;  3TKL B;  3PUX F;  1KNZ A;  3UUX B;  5ETW A;  2MPK A;  4JI1 T;  3PUV F;  1ZP0 A;  2RP4 A;  4HN9 A;  4YSX A;  4KMC A;  1VRB A;  4EYY R;  2B76 A;  3ANW B;  3NZP A;  4ISS A;  3LWJ A;  2BZB A;  5AQO B;  5KXJ A;  4AKL A;  3W15 B;  3ETU A;  1W09 A;  4JI5 T;  1U4Q A;  4TZ4 C;  3VVY A;  2VVN A;  3RC3 A;  3UU6 A;  2K48 A;  2Q9Q B;  2I59 A;  2QOP A;  3AEE A;  5CQG A;  1YKH B;  4IRE A;  2NOX A;  1YQ4 A;  3B81 A;  4IIJ E;  1FMW A;  1M7K A;  5ABF A;  4IL9 A;  4U2Z A;  5FMN A;  4U74 A;  1IZN B;  4YJ2 E;  4N78 D;  1T33 A;  3ZYK A;  3AED A;  5CFB A;  1NWM X;  2KT9 A;  3EAM A;  2BVL A;  5ABG A;  2QCO A;  4LF9 T;  4JEH B;  4TV9 E;  1YQ3 A;  5AQF B;  4DR7 T;  1I6Z A;  3LG7 A;  2FX0 A;  2GFN A;  1T98 A;  2SPC A;  5AQJ B;  4HFC A;  2BG9 B;  1ZOY A;  3KV9 A;  1IJ6 A;  3L39 A;  4PK6 A;  4UDS A;  2A72 A;  2DCF A;  1J1J A;  4UVA B;  1SUM B;  2WB5 A;  2LHN A;  4QWN B;  2XQ7 A;  2XAH B;  2FD5 A;  4AQF A;  2JQK A;  3K3N A;  2N9D A;  4KI0 F;  1QPI A;  2LSK A;  3IUV A;  3N9N A;  1ZK8 A;  2VVS A;  4GYR A;  3RRW A;  3C4X A;  3PUY F;  5EK4 A;  4ZI2 C;  2DNX A;  3DTO A;  3HKB E;  4ZZB A;  3CX8 B;  3UUB A;  1N36 T;  4DMW A;  2FQ4 A;  2OF7 A;  4D5C A;  2D9D A;  4TUY E;  2QA7 A;  2V7I A;  3PJA A;  3UU5 A;  3QB5 K;  2WV1 A;  3Q0U A;  3L3P A;  3IH4 A;  2R7S A;  3MJX A;  2EH3 A;  2HN1 A;  4YJ3 E;  3H3M A;  2YU2 A;  2CWY A;  3RD3 A;  4Z8X A;  2UXI A;  2WUI A;  2QGS A;  5FL1 A;  2R7W A;  2QRX A;  2VQF T;  1YD8 G;  1KK7 A;  3CKD A;  4ZI3 D;  3LK2 B;  3C98 B;  3GMI A;  2EHO D;  4HGA A;  4HEA A;  3ZLI A;  2FJE A;  2K3W A;  2AE9 A;  2XM2 A;  1Z77 A;  4I55 E;  5K7F A;  4EZ4 A;  4AXP A;  1XDO A;  3HTI A;  4IDO A;  2V5D A;  3IF8 B;  5ABF B;  5A1L A;  3UFG A;  4AC6 A;  4JI3 T;  3ONJ A;  4AQF C;  4QXH B;  2HKU A;  1VCS A;  4UVB B;  3O9X A;  2OLT A;  3KV6 A;  5F0H A;  4W97 A;  2LHR A;  2W0G A;  2V26 A;  4O4L E;  1Z0X A;  2LSI A;  5L4H A;  4DV6 T;  4H9O C;  3P9T A;  2LSY A;  2ZM6 T;  4DUY T;  2ZM2 A;  2W61 A;  2G3B A;  1JNR A;  2ID3 A;  1L0V A;  2CLY C;  3N2O A;  3OPC A;  2K9A A;  1SHZ C;  5FY1 A;  3ZT6 A;  4ASK A;  4GCL A;  1IBK T;  3UT5 E;  1UUS A;  4UEM A;  4ABZ A;  5CA1 E;  2VQE T;  3AE1 A;  4ILC A;  4DV7 T;  3MZK B;  1MIY A;  4P09 A;  3PU8 A;  3FK7 A;  3CPZ A;  4X65 T;  3VRB A;  3ONL C;  4D7M A;  5LJN A;  1T72 A;  3G1M A;  3LOC A;  1CUN A;  1G8X A;  4B3A A;  5K7H A;  2X0Y A;  3RIA A;  1FMV A;  2R7X A;  4M3E A;  2R6G F;  4M3G A;  3TLU A;  1VCT A;  4B3T T;  1WR6 A;  4YFS A;  2P9B A;  1UX4 A;  2KLQ A;  2D0U A;  3B57 A;  2UXP A;  3G1O A;  4O2A E;  1JTY A;  2YDS A;  2W67 A;  2G7S A;  5GP9 A;  4NUU A;  2VKO A;  4QH5 A;  3D0T A;  2H88 A;  1NAF A;  4CI3 B;  2YK0 A;  1HG2 A;  2K5B B;  2CXD A;  3JAE A;  5DQV A;  2KXP B;  3NNR A;  4U72 A;  1KNR A;  5LMN T;  2R7T A;  3CQG B;  3V6G A;  4EZH A;  2CXF A;  5DJQ C;  2EHO B;  2XQY A;  3LJC A;  4KX6 A;  4P0B A;  4EB6 E;  5F27 A;  3ANP A;  2FJB A;  5CB4 E;  5IHY A;  3ZN0 B;  4AIU A;  4IDN A;  5FKM A;  2X51 A;  5DAB A;  2NP5 A;  3RYI E;  1MMA A;  2LSJ A;  4EXT A;  2E9X D;  3IHR A;  2HXO A;  5CXI A;  3KZ9 A;  2QVA A;  5LGT B;  4IT4 A;  2O7O A;  5FXZ A;  2XGD A;  1HCI A;  4UVC B;  4X64 T;  1IBL T;  4X1K E;  4Z91 A;  4UF0 A;  3N9P A;  4HWH A;  5EK2 A;  1QVT A;  4LML A;  2CXL A;  5LHH B;  4CQI A;  3VTI A;  3FB2 A;  5EZH A;  4P1N A;  5HWY A;  1HX8 A;  5H6R B;  2V7K A;  3O8H A;  3O1J A;  3NRX A;  3IBP A;  3TP0 A;  1MIV A;  5IWA T;  2XQ4 A;  2XAF B;  5GPA A;  3CJD A;  5IOZ A;  5EZG A;  4EYU A;  3VU7 H;  3KDS E;  5EYR A;  2X9W A;  1NEN A;  2IBD A;  4H9P C;  2LKH A;  1JTX A;  2IC6 A;  3BT9 A;  2W4X A;  2IHR 1;  3R84 B;  5HXH A;  1UK5 A;  3MXZ A;  2BG9 E;  3Q9D A;  5LCY A;  3Q0W A;  3EHZ A;  2FJA A;  2M67 A;  3AEG A;  3EUP A;  2YKS A;  2RPA A;  5JDM A;  1JT0 A;  4GK0 E;  1UCU A;  2HHH T;  4IST A;  2CBI A;  2ZOY A;  3VR9 A;  4MLK A;  2NP9 A;  2ZCN A;  1BR1 A;  2KIN B;  4HFH A;  5H6Q B;  4OFZ A;  4OYK A;  1OWA A;  2ZM0 A;  4JV5 T;  3NWI A;  3OYZ A;  3LBX B;  2F4V T;  3JCF A;  5IPA A;  2OER A;  4DV0 T;  4G2A A;  3I9Y A;  5CXG A;  5BMV E;  4DV4 T;  2JK3 A;  2OA5 A;  2LLY A;  2XAJ B;  4OYJ A;  2UXX B;  3ZJ2 A;  4DMV A;  4MK6 A;  3U3I A;  2E5V A;  5JRC B;  2QKO A;  3BR2 A;  1GQE A;  3C4Z A;  2WDV A;  3F0C A;  2KMF A;  4DR2 T;  3VOK A;  2XTL A;  5LYJ E;  4HKA A;  5FKO A;  2JQH A;  2YVH A;  4U7I A;  2XUE A;  2WY2 A;  2CHO A;  2E9X B;  3RHW A;  4YLH A;  2CM0 A;  3CK6 A;  2NP3 A;  3BCG A;  4LF6 T;  4U7Y A;  1QVU A;  1MMG A;  5JH7 E;  3GEU A;  4LF4 T;  2FUP A;  4UV9 B;  1H7C A;  3PUW F;  2N1G A;  4HWI B;  1S94 A;  2XAQ B;  5EFY A;  1KF6 A;  2R7Q A;  3NKZ A;  4KBM B;  2MAW A;  5AQK B;  3HE0 A;  2QYW A;  5HXC A;  5F1J A;  2VPR A;  4DR3 T;  4YSZ A;  2X9X A;  3BNI A;  4ILB A;  3AA6 B;  4XAX B;  4I43 B;  1U9N A;  4LMJ A;  3J7Y q;  5FY0 A;  4DW6 A;  4U31 A;  4P0A A;  4NXM T;  1ZEE A;  3CRJ A;  5LNK A;  2XSA A;  2JMH A;  4KWA A;  3BQZ A;  3RX6 A;  4AQG A;  5FVL A;  4O4I E;  3B13 A;  4I4T E;  2LOP A;  3COL A;  3ZMZ B;  3WHC A;  5FKN A;  3N2G E;  1S35 A;  2C5J A;  3KBT A;  4DV3 T;  4IDP A;  2BBJ A;  3DEW A;  2VKE A;  5JVD E;  4HFE A;  4C2M A;  3B6A A;  5FKY A;  2LEH A;  4I50 E;  3HTJ A;  3O1I A;  5LBQ B;  2JMK A;  3ON2 A;  1UUR A;  3ZYM A;  4X1I E;  2PFV A;  3ABV A;  3VW2 A;  3G7R A;  3AVR A;  3QKX A;  1OXZ A;  3B6C A;  3T1Y T;  5C8Y E;  3AE5 A;  2CBJ A;  3P7I A;  3A7M A;  3CQX C;  4QXC B;  4DR6 T;  3BQI A;  2UUC T;  3PE0 A;  4LF5 T;  1I94 T;  2Q24 A;  5L3G B;  3O4X E;  2OV9 A;  3OKQ A;  2Q9Q C;  4PXI A;  3A8Y C;  4C90 A;  4F6R C;  4B3R T;  3Q5X A;  5L4E A;  4COF A;  3AXJ B;  4JL3 A;  4IDQ A;  3LSJ A;  3P50 A;  4JI6 T;  5LHG B;  1Z0P A;  3UUM A;  5HXR A;  4QX7 B;  5DQW A;  3ESL A;  4TWH A;  4AKG A;  3DP7 A;  4JBW F;  4IL4 A;  1T56 A;  3T8O A;  3VRA A;  3L09 A;  4O4H E;  1SE7 A;  4CI2 B;  3KV5 A;  5FXX A;  4HTE A;  2CRB A;  2IAI A;  2D0T A;  1KNP A;  4X5T A;  3M3Z B;  2WMO A;  2NW7 A;  2CMR A;  1D1B A;  5JDN A;  3ZMT B;  3JC6 C;  2RAE A;  4JNN A;  1HFA A;  4TNW A;  3NPI A;  2RHA A;  2L9Q A;  5AQH B;  5C3J A;  5HXS A;  2PJQ A;  2YU1 A;  3NBX X;  5JQG E;  2HYJ A;  2H7O A;  4IRV A;  5JDG A;  3VIB A;  3F57 A;  3K8P C;  2N2N A;  3R6N A;  2V7L A;  2JQ9 A;  3C64 A;  5LMU T;  5F5W A;  2KND A;  2YIN A;  2XY8 B;  2X67 A;  4DV5 T;  3MNL A;  3J9X 1;  4AI6 A;  4NIQ A;  4ZXL A;  5J1U A;  1T7S A;  4CXW A;  2QIB A;  2ACZ A;  5HEJ A;  3NS4 A;  3BR0 A;  4AUX A;  5HSZ A;  2RA1 A;  5L2L A;  3PPB A;  2ID6 A;  3I0Q A;  3UU4 A;  2VKH A;  4EOZ B;  3HTA A;  1UX5 A;  3BQK A;  1QSD A;  3VW1 A;  4G63 A;  4IE4 A;  3PDY A;  2V6Y A;  2BS3 A;  1JT6 A;  2UXH A;  5HCJ A;  3VKH A;  4J2C A;  4AKH A;  3A5X A;  2VWA A;  3UTK A;  4DR4 T;  3LSR A;  5JDH A;  1MND A;  5JR9 A;  4ERR A;  5AQG B;  4LMK A;  4GFL A;  2XPV A;  4IE6 A;  3IA3 A;  5HAX A;  2LOS A;  2K24 A;  4IHJ E;  3FIW A;  4JYK A;  3VVX A;  4GCK A;  4PFP A;  5L3D B;  2UUA T;  1HNZ T;  2H89 A;  5FP3 A;  3ZEF B;  2VK9 A;  3PTR B;  4I0U A;  4KUM B;  2Y6X A;  3FHN A;  3BRU A;  1X79 A;  3NZQ A;  4LF8 T;  2GEN A;  3BTJ A;  2WP9 A;  3N9O A;  2J47 A;  4IE0 A;  2WAU A;  2BBH A;  3ZKR A;  2FJ1 A;  2WBL A;  3RH3 A;  5F3J A;  3DPJ A;  2Y31 A;  2VAS A;  3BTL A;  5AQM B;  4H63 H;  3BR1 A;  2V1D B;  3BQY A;  4TN7 B;  1LVK A;  1UI6 A;  3L8R A;  4WW0 A;  4DV2 T;  3RC8 A;  4AC0 A;  5FXW A;  4DBQ A;  4ZS2 A;  2KSR A;  4ZHQ E;  3SDG A;  3ZCJ A;  3K3O A;  1WYB A;  5JDF A;  2C5I T;  1RKT A;  3AA7 B;  4JI4 T;  4ZS3 A;  3UU8 A;  4OD5 A;  2PZ9 A;  2YN6 A;  3PUA A;  4HE8 A;  1YXR A;  3T6N A;  2IEK A;  5JR9 C;  2RAS A;  2JQQ A;  3I9W A;  5L47 A;  2LM9 A;  4DV1 T;  5AQI B;  5HEH A;  2R7O A;  2XPU A;  2I0M A;  1Y01 A;  3RYH E;  4HWD A;  2MTQ A;  3QK6 A;  3N2K E;  3FZM B;  2LKG A;  1OED A;  3VP5 A;  3X1D A;  2OPT A;  1G73 A;  5J1R A;  5AQC A;  4PJM A;  1HNX T;  2BVM A;  4WIB A;  1LRZ A;  5HCM A;  5FXV A;  1Z8U A;  5BR8 T;  4YSY A;  4WBO A;  3AE6 A;  2VB6 A;  2IML A;  4O2B E;  4PNI A;  4WBN E;  1O3X A;  3HIM A;  4ZI3 C;  5LG4 A;  3N9M A;  2CEA A;  4YHH T;  2HQ5 A;  3CWR A;  2EHO C;  3KIN B;  4OX9 T;  5L3E B;  2J4G A;  3ONX A;  3QC9 A;  2X9Y A;  4YZE A;  4M3B A;  4JUY A;  1JUM A;  1E7P A;  3DJB A;  3V5U A;  4ILA A;  3GA8 A;  3S4U A;  2KWH A;  1U5P A;  3P4W A;  4X1E A;  2G7L A;  2X9H A;  3QBM A;  2BS2 A;  2DWK A;  3FK6 A;  2TRT A;  5F04 A;  5L3C B;  3G56 A;  5EZY E;  1EZ3 A;  2E8I A;  1RKW A;  4X62 T;  4NPP A;  3TLT A;  4BJN A;  4CN4 A;  1ZKG A;  3QNU A;  5IP6 A;  2XRL A;  5FVK A;  3RH2 A;  4B1R A;  1JUP A;  2WDR A;  3ZMS B;  3ZPO A;  3BTC A;  4MBQ A;  3VHL A;  3O8G A;  3VR8 A;  2IUB A;  4H9S E;  4DUZ T;  2DL1 A;  5LG3 A;  1OED C;  3FBZ A;  4QKN A;  5J0Z A;  3FZK B;  3P4R A;  3ZN1 B;  2NW8 A;  2LE8 A;  3AAI A;  4GYS A;  3HKD E;  3Q5E A;  3ON4 A;  4YTM A;  2YVX A;  3C50 A;  2NW9 A;  2XHE B;  3WAK A;  1BR0 A;  2KWI B;  5LXT E;  3QQA A;  3GN5 A;  1W0A A;  2XAS B;  4CN1 A;  1IAP A;  3ZSS A;  3RGL A;  5K7Z A;  2ZB9 A;  5LOV E;  3NVO A;  4MO7 A;  3B5M A;  3FXE B;  1XMQ T;  2WCA A;  2D2S A;  3LDQ B;  1VI0 A;  4GFK A;  2WWV A;  3P4P A;  3KV4 A;  3AE2 A;  3I1A A;  2Y2Z A;  1D0Y A;  1UGO A;  2YDQ A;  3NRY A;  2E2A A;  2V8S V;  2JJ9 A;  2X0H A;  2V57 A;  3SS1 A;  4BAY B;  2ZCM A;  5K58 A;  2HN2 A;  3RYC E;  4M3D A;  5FYM A;  4BA9 A;  3V78 A;  5FMP A;  2NX4 A;  3V5S A;  3DCF A;  2R7R A;  2H7V C;  3MK7 C;  4EED A;  3OTO T;  4IGU A;  1NEK A;  3OYX A;  4HWF A;  2XB5 A;  5TAO A;  2NTX A;  5H9T A;  4DID B;  1HG5 A;  5IUX A;  3RKO A;  3AAE B;  2E9X C;  1FIO A;  2DG8 A;  2G0U A;  2CE7 A;  2WS3 A;  2F07 A;  5KDM C;  5CJ5 A;  4GK5 E;  3Q0V A;  3AE7 A;  3C4W A;  4U9N A;  1JNZ A;  3ZMV B;  4H9R C;  2FJD A;  2D6Y A;  4MHC A;  3CX7 B;  1LVF A;  2DWG A;  1HS7 A;  4UF0 B;  2X6O A;  2NS7 A;  1KFY A;  2XQ5 A;  3ETV A;  2G0E A;  5LJM A;  4A56 A;  3AEB A;  1SA0 E;  3CIR A;  1VOM A;  3ANW A;  3VOX A;  5AQR B;  3AEA A;  3LSV A;  2VKV A;  5L3B B;  3AA0 B;  1N32 T;  3ZT5 A;  1ZKE A;  4L9I A;  2GUH A;  4HWC A;  2FBQ A;  3WI3 A;  4IDZ A;  1SGM A;  3G06 A;  3AQT A;  3Q5D A;  2Q9Q A;  2VUR A;  3I0O A;  5IOY A;  2WM9 A;  4HFV A;  3RIU C;  5C4Y A;  3FXD B;  1FEW A;  5F8P A;  5F0C A;  2YDR A;  2DG7 A;  3NXC A;  3RQU A;  3ZJ1 A;  2UXO A;  3AQS A;  2DI4 A;  2MOZ A;  3H3A A;  1D0X A;  3ZQF A;  3QPS A;  2IC9 A;  4LF7 T;  3ZC0 A;  1XNQ T;  2XPW A;  2D5U A;  4C91 A;  3CDL A;  5FNV E;  2XGC A;  2BG9 A;  4A5X A;  1YKE B;  3TLV A;  5HWX A;  3HA4 A;  3S5R A;  4XBF B;  2W00 A;  1W0B A;  5M4Y A;  3AE8 A;  5IYZ E;  4CXX A;  3DU5 A;  3ZQH A;  3EUH A;  3SRZ A;  4PJJ A;  3HGY A;  4HFI A;  4ICH A;  2UXU A;  2PTF A;  3SFI A;  5HXE A;  1HR0 T;  2A9U A;  2UXC T;  3C51 A;  4DVD A;  3NI7 A;  2XGE A;  4KHP T;  4JYA T;  2IDO B;  4MAL A;  3UU3 A;  3PU3 A;  3HR0 A;  4TV8 E;  3Q2M A;  2LRK A;  3FRQ A;  3ZQL A;  3O1H A;  5GPC A;  1AJ3 A;  2WMN A;  1D0Z A;  2L3L A;  3LHQ A;  3QPL A;  2PBI A;  5JTG A;  3AE9 A;  2HH7 A;  4I76 A;  2UXB T;  5J2T E;  2A2F X;  1R8I A;  4ZI2 D;  2LSG A;  3RF1 A;  2NR4 A;  3TP3 A;  3AB3 B;  5KMG P;  4ZEY A;  5J2U E;  1MNE A;  1US7 B;  3HKE E;  3BK9 A;  4X66 T;  4YHJ A;  3RPU A;  3TLW A;  1N34 T;  3EDU A;  4NUV A;  4OD4 A;  4GIW A;  5GON E;  2WQY A;  4D5F A;  3HGG A;  3DU6 A;  5ABH A;  2XQ9 A;  4NN1 A;  2JJ7 A;  1KEY A;  2VL0 A;  3UQ7 A;  2WGB A;  3AEF A;  3AAA B;  3JSJ A;  3PUQ A;  2HPJ A;  5D1R A;  5HYA A;  2BG9 C;  3BR6 A;  1J5W A;  4BJM A;  2L8K A;  5AQS B;  4JLE A;  2ACX A;  1Y64 B;  3VVZ A;  3AA1 B;  3RI5 A;  1X9B A;  3RYF E;  2XQ6 A;  4ILU A;  4EGW A;  2QWT A;  3QB5 A;  3LK3 B;  4ZZC A;  2XQ3 A;  3KFW X;  1ZHC A;  2CCQ A;  4HKU A;  2ZCX A;  2B3W A;  3ZT7 A;  2ZM8 A;  4L5G A;  2DHR A;  3VUQ A;  2H3R A;  5LBM A;  3BR3 A;  3MAC A;  2V7J A;  5CGM A;  2UXD T;  3H37 A;  3WHB A;  2CWO A;  2Y30 A;  5AQT B;  4B3M T;  4YY3 T;  4GCT A;  3AEC A;  2PG8 A;  4U33 A;  3SFD A;  2ODU A;  3Q5W A;  1D1A A;  2C5K T;  4ZI7 E;  1WFD A;  4E7Z A;  3C2B A;  4CI1 B;  4AKI A;  1OED E;  4TX5 A;  2Y48 B;  3CWZ B;  3CX6 B;  3K3Q C;  4PJN A;  2ZLY A;  3PAS A;  1XNR T;  5FKL A;  3ZQG A;  1ZV4 X;  4WYV A;  3M65 A;  3E0Z A;  2W2U A;  4FJO A;  4XZC A;  1W9R A;  2V5C A;  2JPF A;  2A3D A;  4A97 A;  5ABE A;  4DND A;  2JRK A;  2BKO A;  4K0K T;  3HI2 A;  3P8C D;  2HPL A;  1HX1 B;  2DLR A;  1FJG T;  5AQU B;  2IAK A;  5FGL A;  2X68 A;  4DO0 A;  1IBM T;  3HL6 A;  4UV8 B;  5J1Y A;  4WNK A;  2UU9 T;  3KKD A;  4CGR A;  2QTQ A;  5E0O A;  1HTJ F;  2YOE A;  5AQP B;  2I6H A;  4YTP A;  2VKJ A;  4H9Q C;  4E7S A;  3BR5 A;  5C2T A;  2EHO A;  4JI0 T;  2R7V A;  3LSP A;  5FY7 A;  3JAD A;  2R7U A;  3KNW A;  4CN6 A;  5AQL B;  5LGN B;  2UXN B;  4JI8 T;  2IW5 B;  4UEL A;  3HKC E;  4KP3 C;  3CCY A;  2W66 A;  4AF5 A;  4YT0 A;  1E1H B;  3KVA A;  4TNV A;  1WLX A;  5AQN B;  2V6X A;  4JI2 T;  3UUL A;  2W63 A;  3BQL A;  4MFR A;  2BS4 A;  3SFE A;  4U2Y A;  2VL8 A;  2LT3 A;  4H9N C;  3KYL A;  4DVY P;  2XQ8 A;  1M62 A;  3OVU A;  5JDL A;  4A98 A;  4Z90 A;  4IE5 A;  4EIW A;  3HTH A;  2W62 A;  2ZMA A;  4IE7 A;  5FHP A;  2MBG A;  3EI0 A;  3EAB A;  3KVB A;  5HAW A;  1YW0 A;  5AQV B;  3FZF B;  2V6Y B;  4PJL A;  2XZE A;  2CLY B;  4PK4 A;  3BJB A;  2YVE A;  2JIW A;  2PBX A;  1V9D A;  4KHZ F;  3FZL B;  5HEO A;  3QOF A;  4DBR A;  4U3C A;  3PV0 F;  2GK9 A;  1XZY A;  4AKR B;  2Y8D A;  3RQW A;  1MMN A;  4L62 A;  4V2F A;  5JR9 B;  1BJZ A;  1RPW A;  2OI8 A;  3U78 A;  2UUB T;  1DU2 A;  2CPT A;  3UQ4 A;  1WYC A;  2IU5 A;  2FJI 1;  2WWU A;  5AFU L;  4OHF A;  4ACI A;  3SWH A;  4B6X A;  4QXB B;  4M1P A;  4NEL A;  2M6B A;  3ZYL A;  5ADX L;  3LBX A;  5JRE A;  2WZI A;  4HFB A;  3OJA A;  2LJL A;  2XDN A;  2B1E A;  3LJL A;  3PUZ F;  4TWD A;  3VW0 A;  4FI5 A;  5LB7 B;  1UI5 A;  2CA5 A;  2X9D A;  2J62 A;  2LM2 A;  5JRC A;  4UXN B;  3N5L A;  5FKK A;  1WR0 A;  2FBW A;  5CW8 A;  4CXY A;  4OK0 A;  3MKD A;  4O8S A;  4XK4 A;  3N9Q A;  2XJ7 A;  3ZMU B;  5HBU A;  4I6Z A;  3ANG A;  4Q25 A;  3BTI A;  1WCR A;  3Q3S A;  3E7Q A;  2HYT A;  1MMD A;  2E9X A;  4X20 E;  2GBY A;  3ZC1 A;  2NWB A;  4NXN T;  1JUS A;  3LFM A;  3P4Q A;  2XQA A;  4YTN A;  4JI7 T;  3FZH B;  2C0S A;  3AE3 A;  4ME9 A;  3K1S A;  3F1B A;  1N33 T;  4EEB A;  2ZOZ A;  4AQY T;  3EVY A;  4ADZ A;  3NRG A;  3IEE A;  1B7T A;  2YEV C;  2CHN A;  2VKD A;  2BDE A;  4HFD A;  1HNW T;  2ZY9 A;  3O60 A;  2X0L B;  1U9O A;  2XSB A;  3UFE A;  2X66 A;  3PUG A;  3CVR A;  1OED B;  4V1A v;  4M3F A;  2NTY A;  4V2G A;  3EGQ A;  2NS8 A;  2G7G A;  3MVP A;  4G12 A;  3ZST A;  3P4S A;  4UR9 A;  4MXM A;  2LRL A;  3F2E A;  2E5L T;  4PAG A;  3RIU A;  1QUU A;  3RIF A;  1T8B A;  2TCT A;  1WRD A;  1IJ5 A;  3E08 A;  2DTZ A;  5D19 A;  2XPK A;  5LGU B;  4LFB T;  5D18 A;  4AIS A;  2MYS A;  3GZI A;  4YXD A;  5L3F B;  3QUJ A;  4PW8 A;  3ZCI A;  2WSS V;  1CHU A;  4WZX A;  1HF8 A;  4U9L A;  5AQQ B;  5LA6 E;  1J5E T;  3N9L A;  4PFO A;  3PUS A;  5FL0 A;  3KKC A;  3PUR A;  3PM1 A;  4LFA T;  4L0R A;  3VKG A;  1MIW A;  4GOU A;  2WU2 A;  1BR2 A;  4H63 V;  1XWM A;  2M6I A;  4ZOL E;  5CA0 E;  1ORK A;  2ODV A;  3T1H T;  2REK A;  2KZ7 B;  1XDP A;  1LKX A;  5EK3 A;  3SOL A;  3EDV A;  4DR5 T;  1QLB A;  3PJA J;  5HEU A;  3AXJ A;  3VPR A;  4K0U A;  4JEU B;  2V7M A;  5DAJ A;  3IH2 A;  3FBL A;  2Q9Q D;  3TLS A;  4EAH A;  4CZZ B;  5HEG A;  4UIG A;  3CQC B;  4DR1 T;  2WDQ A;  3RKG A;  2XAG B;  3GN5 B;  3RLF F;  2BKN A;  4JKZ A;  1E2A A;  3BHQ A;  2HXI A;  3JAF A;  4QH4 A;  4B3S T;  3CML A;  3E22 E;  3LK4 2;  1D1C A;  3GWH A;  5J1G A;  3KBU A;  4EV6 A;  1XMO T;  2BKP A;  2AXD S;  3UUN A;  4PK5 A;  1BR4 A;  3JC6 D;  5LHI B;  2WZH A;  5F08 A;  4ANJ A;  4X1Y E;  3OBV E;  2Z6E A;  2W53 A;  2IIU A;  3F31 A;  3AE4 A;  5JDQ A;  2J1D G;  4GKK T;  4QHO A;  3G1L A;  2ES0 A;  3IH3 A;  3MA9 A;  4QH1 A;  4LFC T;  5F0F A;  3AVS A;  2XM1 A;  4D7N A;  2I10 A;  4GKJ T;  3C07 A;  3WAJ A;  4W1U A;  5KX5 E;  5J3L A;  4O4J E;  2WU5 A;  2O7T A;  3ZQI A;  3RRC A;  1A6I A;  5LP6 E; 
#chains in the Genus database with same CATH homology
 3DJB A;  3C4Z A;  4QX8 B;  3TKL B;  3V5U A;  2IAK A;  1KNZ A;  2X68 A;  4DO0 A;  2KMF A;  3UUX B;  3HL6 A;  5ETW A;  4UV8 B;  3GA8 A;  2RP4 A;  2XTL A;  3S4U A;  5LYJ E;  2KWH A;  4HKA A;  4HN9 A;  1U5P A;  4WNK A;  2X9H A;  4KMC A;  1VRB A;  5E0O A;  4EYY R;  2XUE A;  3ANW B;  3NZP A;  4ISS A;  2DWK A;  1HTJ F;  2BZB A;  2E9X B;  4AKL A;  3W15 B;  5L3C B;  4YLH A;  2CM0 A;  3ETU A;  2VKJ A;  4H9Q C;  5EZY E;  1EZ3 A;  2E8I A;  4E7S A;  1MMG A;  1U4Q A;  4TZ4 C;  5JH7 E;  2EHO A;  4UV9 B;  4BJN A;  1H7C A;  2R7V A;  2N1G A;  3RC3 A;  2K48 A;  5FY7 A;  1S94 A;  2R7U A;  2XAQ B;  2Q9Q B;  2I59 A;  3ZMS B;  3ZPO A;  2R7Q A;  5LGN B;  5CQG A;  1YKH B;  2UXN B;  4KBM B;  4MBQ A;  3VHL A;  2NOX A;  5HXC A;  4H9S E;  4IIJ E;  1FMW A;  2X9X A;  2IW5 B;  3FBZ A;  4QKN A;  3AA6 B;  4XAX B;  5FMN A;  4UEL A;  4U74 A;  3ZN1 B;  2NW8 A;  3HKC E;  2LE8 A;  1IZN B;  4YJ2 E;  4N78 D;  4KP3 C;  4I43 B;  3J7Y q;  3AAI A;  3ZYK A;  5FY0 A;  4GYS A;  1NWM X;  2KT9 A;  3HKD E;  2BVL A;  4JEH B;  4TV9 E;  1E1H B;  3C50 A;  3KVA A;  2XHE B;  2NW9 A;  4P0A A;  1ZEE A;  3WAK A;  1BR0 A;  1WLX A;  2KWI B;  3LG7 A;  1T98 A;  3UUL A;  2W63 A;  3BQL A;  4MFR A;  5LNK A;  2SPC A;  5LXT E;  2JMH A;  2VL8 A;  2LT3 A;  4H9N C;  3KYL A;  3KV9 A;  1IJ6 A;  4DVY P;  3GN5 A;  3RX6 A;  4PK6 A;  4AQG A;  4O4I E;  2XAS B;  2A72 A;  2DCF A;  1IAP A;  5JDL A;  4IE5 A;  4EIW A;  3B13 A;  4UVA B;  2W62 A;  4I4T E;  2LOP A;  2ZMA A;  4IE7 A;  5LOV E;  2MBG A;  3ZMZ B;  4QWN B;  2LHN A;  2XAH B;  3FXE B;  2D2S A;  3KVB A;  4AQF A;  1YW0 A;  3N2G E;  4PJL A;  1S35 A;  3KV4 A;  2CLY B;  3I1A A;  4PK4 A;  2C5J A;  1D0Y A;  3KBT A;  3K3N A;  2N9D A;  1V9D A;  5JVD E;  4C2M A;  2LSK A;  3N9N A;  3NRY A;  4GYR A;  2LEH A;  2JJ9 A;  3O1I A;  4I50 E;  5LBQ B;  3RRW A;  3C4X A;  4DBR A;  2GK9 A;  2JMK A;  5EK4 A;  4AKR B;  3SS1 A;  2Y8D A;  4BAY B;  4ZI2 C;  2DNX A;  3DTO A;  3ZYM A;  3HKB E;  3RYC E;  1MMN A;  5FYM A;  4BA9 A;  3CX8 B;  4X1I E;  2PFV A;  3V5S A;  5JR9 B;  3AVR A;  1OXZ A;  4DMW A;  2R7R A;  2H7V C;  3MK7 C;  5C8Y E;  3U78 A;  4IGU A;  3OYX A;  1WYC A;  4TUY E;  3P7I A;  5TAO A;  2FJI 1;  2QA7 A;  2WWU A;  2V7I A;  2NTX A;  5AFU L;  4OHF A;  1HG5 A;  3L3P A;  3CQX C;  4QXC B;  3RKO A;  3SWH A;  2R7S A;  3AAE B;  3BQI A;  2E9X C;  4QXB B;  4B6X A;  1FIO A;  3MJX A;  4M1P A;  3PE0 A;  4YJ3 E;  3ZYL A;  2YU2 A;  5ADX L;  2CWY A;  2G0U A;  3LBX A;  4Z8X A;  5JRE A;  5L3G B;  2CE7 A;  3O4X E;  2QGS A;  2R7W A;  5KDM C;  3OJA A;  2LJL A;  4GK5 E;  5LP6 E;  2B1E A;  3OKQ A;  2Q9Q C;  4C90 A;  1YD8 G;  1KK7 A;  4F6R C;  4FI5 A;  3Q5X A;  3CKD A;  4ZI3 D;  3C4W A;  3LK2 B;  2CA5 A;  3ZMV B;  4H9R C;  5JRC A;  4UXN B;  3N5L A;  1Z0P A;  3C98 B;  3GMI A;  3CX7 B;  4MHC A;  4QX7 B;  2EHO D;  5DQW A;  5HXR A;  3UUM A;  3ESL A;  1LVF A;  2DWG A;  4HGA A;  4HEA A;  3ZLI A;  4AKG A;  1HS7 A;  4UF0 B;  3ETV A;  4CXY A;  5LJM A;  4OK0 A;  4A56 A;  3DP7 A;  4I55 E;  4EZ4 A;  3MKD A;  4O8S A;  3ZMU B;  3N9Q A;  4AXP A;  1SA0 E;  3T8O A;  1VOM A;  3ANW A;  3L09 A;  4O4H E;  3IF8 B;  1MMD A;  4CI2 B;  2E9X A;  5A1L A;  4X20 E;  5L3B B;  3AA0 B;  3ZC1 A;  2NWB A;  4AQF C;  1ZKE A;  4L9I A;  4QXH B;  3LFM A;  3WI3 A;  3KV5 A;  5FXX A;  4IDZ A;  4HTE A;  4UVB B;  3O9X A;  2C0S A;  2D0T A;  2WMO A;  2Q9Q A;  2NW7 A;  3KV6 A;  2CMR A;  1D1B A;  2LHR A;  3I0O A;  5JDN A;  2W0G A;  2WM9 A;  4HFV A;  3JC6 C;  3ZMT B;  2V26 A;  3FXD B;  3EVY A;  1FEW A;  4O4L E;  2LSI A;  5F8P A;  4ADZ A;  3IEE A;  1B7T A;  1HFA A;  2YEV C;  4H9O C;  2VKD A;  2L9Q A;  2BDE A;  3ZJ1 A;  2LSY A;  5HXS A;  2PJQ A;  2ZM2 A;  2YU1 A;  3NBX X;  5JQG E;  2DI4 A;  2MOZ A;  2H7O A;  3H3A A;  4IRV A;  2W61 A;  1D0X A;  5JDG A;  3F57 A;  3K8P C;  2CLY C;  2N2N A;  3R6N A;  2X0L B;  3N2O A;  2K9A A;  1SHZ C;  3UFE A;  5FY1 A;  2V7L A;  2IC9 A;  2X66 A;  4ASK A;  3C64 A;  3PUG A;  3ZC0 A;  3UT5 E;  2KND A;  3CVR A;  4UEM A;  2YIN A;  4V1A v;  5CA1 E;  2D5U A;  4C91 A;  2X67 A;  3J9X 1;  2NTY A;  4AI6 A;  3MZK B;  1MIY A;  4P09 A;  3PU8 A;  5FNV E;  3CPZ A;  1YKE B;  4CXW A;  5LJN A;  5HWX A;  3HA4 A;  4XBF B;  2W00 A;  3NS4 A;  5M4Y A;  3F2E A;  5IYZ E;  4CXX A;  4PAG A;  2RA1 A;  5L2L A;  3I0Q A;  1QUU A;  1CUN A;  1G8X A;  2VKH A;  3DU5 A;  3EUH A;  4EOZ B;  3SRZ A;  4PJJ A;  1UX5 A;  1FMV A;  3BQK A;  1QSD A;  2R7X A;  4G63 A;  5HXE A;  1WRD A;  4IE4 A;  1IJ5 A;  3E08 A;  3PDY A;  3C51 A;  4DVD A;  5LGU B;  1WR6 A;  2MYS A;  4MAL A;  4YFS A;  2P9B A;  1UX4 A;  3VKH A;  2KLQ A;  2D0U A;  3HR0 A;  3PU3 A;  3QUJ A;  3Q2M A;  3B57 A;  4J2C A;  4TV8 E;  5L3F B;  4AKH A;  4O2A E;  3O1H A;  3A5X A;  4PW8 A;  1AJ3 A;  2VWA A;  2WMN A;  3UTK A;  3ZCI A;  1D0Z A;  4NUU A;  5JDH A;  2WSS V;  2L3L A;  2VKO A;  1MND A;  1HF8 A;  5LA6 E;  3D0T A;  5JR9 A;  4ERR A;  1NAF A;  4CI3 B;  2PBI A;  3N9L A;  2YK0 A;  4PFO A;  1HG2 A;  3PUS A;  2K5B B;  3PUR A;  2CXD A;  2HH7 A;  5DQV A;  2KXP B;  5J2T E;  4L0R A;  3VKG A;  2A2F X;  4U72 A;  1MIW A;  4IE6 A;  5HAX A;  4GOU A;  1BR2 A;  4ZI2 D;  4H63 V;  2R7T A;  3CQG B;  2LSG A;  4EZH A;  2CXF A;  2LOS A;  5DJQ C;  5LHG B;  3AB3 B;  4ZOL E;  5KMG P;  5CA0 E;  2EHO B;  2K24 A;  2ODV A;  4IHJ E;  5J2U E;  2XQY A;  1MNE A;  3LJC A;  4PFP A;  5L3D B;  1US7 B;  3HKE E;  4P0B A;  4EB6 E;  3BK9 A;  5CB4 E;  4YHJ A;  5IHY A;  3ZN0 B;  2KZ7 B;  5FP3 A;  3RPU A;  2X51 A;  3EDU A;  4NUV A;  5DAB A;  4OD4 A;  3ZEF B;  5EK3 A;  1LKX A;  4GIW A;  3SOL A;  5GON E;  2VK9 A;  3RYI E;  3EDV A;  3PTR B;  3DU6 A;  1MMA A;  4KUM B;  2LSJ A;  2Y6X A;  3FHN A;  4EXT A;  1X79 A;  2E9X D;  3NZQ A;  4K0U A;  3IHR A;  3N9O A;  4JEU B;  3AAA B;  3PUQ A;  4IE0 A;  5FXZ A;  5LGT B;  1HCI A;  2HPJ A;  2V7M A;  2WAU A;  5HYA A;  4UVC B;  4BJM A;  2WBL A;  2L8K A;  4X1K E;  3RH3 A;  5F3J A;  4UF0 A;  3N9P A;  2VAS A;  5EK2 A;  3FBL A;  2Q9Q D;  4H63 H;  4JLE A;  2V1D B;  4EAH A;  4TN7 B;  1LVK A;  2ACX A;  4WW0 A;  1Y64 B;  2CXL A;  4CZZ B;  5FXW A;  4UIG A;  3CQC B;  4ZS2 A;  4DBQ A;  4ZHQ E;  5LHH B;  4CQI A;  3VTI A;  3FB2 A;  3AA1 B;  5HWY A;  1HX8 A;  5H6R B;  3ZCJ A;  2V7K A;  2XAG B;  3K3O A;  1WYB A;  3O1J A;  5JDF A;  3GN5 B;  3NRX A;  3IBP A;  3RYF E;  4ILU A;  1MIV A;  2XAF B;  2C5I T;  3AA7 B;  3LK3 B;  3KFW X;  1ZHC A;  2CCQ A;  4ZS3 A;  2B3W A;  2ZM8 A;  4EYU A;  4L5G A;  2DHR A;  3VU7 H;  4OD5 A;  3KDS E;  2H3R A;  5LBM A;  2X9W A;  3CML A;  3E22 E;  3PUA A;  3LK4 2;  4HE8 A;  3MAC A;  1D1C A;  2V7J A;  3GWH A;  4H9P C;  5J1G A;  3H37 A;  3KBU A;  2CWO A;  2IC6 A;  5JR9 C;  3R84 B;  2JQQ A;  5HXH A;  3UUN A;  3I9W A;  2LM9 A;  3MXZ A;  3Q9D A;  4PK5 A;  5LCY A;  2R7O A;  2PG8 A;  1BR4 A;  2ODU A;  3Q5W A;  1D1A A;  2M67 A;  3RYH E;  3JC6 D;  2C5K T;  5LHI B;  2MTQ A;  3QK6 A;  3N2K E;  4ZI7 E;  4ANJ A;  5JDM A;  4GK0 E;  4X1Y E;  3OBV E;  1UCU A;  1G73 A;  4IST A;  4E7Z A;  4CI1 B;  4AKI A;  2Z6E A;  3F31 A;  4PJM A;  2Y48 B;  2BVM A;  4TX5 A;  3CWZ B;  5JDQ A;  2J1D G;  3CX6 B;  1LRZ A;  3K3Q C;  4MLK A;  4PJN A;  4QHO A;  2NP9 A;  2ZLY A;  2ES0 A;  1BR1 A;  1ZV4 X;  5FXV A;  2KIN B;  3MA9 A;  3M65 A;  4WBO A;  3E0Z A;  5H6Q B;  4OFZ A;  4FJO A;  4OYK A;  1OWA A;  2ZM0 A;  4XZC A;  2VB6 A;  4O2B E;  3AVS A;  4PNI A;  4WBN E;  1O3X A;  4ZI3 C;  5LG4 A;  3N9M A;  3OYZ A;  2CEA A;  3WAJ A;  2JPF A;  3LBX B;  5KX5 E;  2A3D A;  2EHO C;  4O4J E;  4G2A A;  4DND A;  3KIN B;  5L3E B;  2JRK A;  3ONX A;  3I9Y A;  3HI2 A;  3QC9 A;  2X9Y A;  3P8C D;  3RRC A;  5BMV E;  3RC8 A;  2HPL A;  2OA5 A;  2XAJ B;  2DLR A;  4OYJ A;  2UXX B;  3ZJ2 A;  4DMV A;  4JUY A;  3U3I A;  5JRC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...