3K8PC

Structural basis for vesicle tethering by the dsl1 complex
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
352
structure length
295
Chain Sequence
b'NIYTTLKFESMMQQRVIQIRSIPEEEYHELVSVQPIQVSVFVQSAAKVFTEFEQGCDTIGRSKVESIYLYKFNLLQTAFFAMVSEKVNDWTQLYKDVRYLYTENPKLLQLMELNSRRLDLNLNLIKKTIYKLVNDQLQELKDNERTPDWDITISSLLPYLKKTALPTLYKLEDNTILVALIRYIVHDLVIDNILHWRVISEKSSENLSEFIMLLLSGLEIPRLNLIETYRHSREKLGILSKILTAHLKDILEMFYEGEFFLFETDEIVQWIILLFADTPTRRDCIDEIRRVREEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Dsl1
publication title A structure-based mechanism for vesicle capture by the multisubunit tethering complex Dsl1.
pubmed doi rcsb
source organism Kluyveromyces lactis
molecule tags Transport protein/transport protein
total genus 112
structure length 295
sequence length 352
ec nomenclature
pdb deposition date 2009-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF11989 Dsl1_C Retrograde transport protein Dsl1 C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.150 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor; domain 2 3k8pC02
1.20.58.1440 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3k8pC01
3K8PC
chains in the Genus database with same CATH superfamily
1ZOYA 4IE0A 2D0UA 3PASA 3HTIA 3N9QA 5FYMA 2RA1A 4JI8T 5L47A 2FD5A 4DV3T 4L62A 2ZCNA 2XQYA 3RC8A 2V5CA 2OI8A 1UI5A 5F27A 5J0ZA 2MPKA 3AA0B 1GQEA 3UUBA 2VKJA 4YY3T 2Q9QB 3L39A 4IIJE 3PTRB 4JV5T 1AJ3A 2CLYC 1KNRA 5DQWA 3OYXA 3NZPA 2HN2A 2ZOZA 2CE7A 5HCMA 2HN1A 4XBFB 2TCTA 5D19A 1J1JA 2B3WA 2VK9A 4IDOA 5DQVA 5C8YE 3MK7C 3AAEB 4U31A 3ZC0A 4YLHA 1VOMA 3SWHA 1OEDE 3ZT5A 5AQFB 2QCOA 5LBMA 4Z8XA 2WS3A 3I9WA 2WAUA 5EFYA 3NKZA 2ZM8A 4LF9T 2DCFA 2EHOB 3KV5A 4HWFA 4OX9T 3PUGA 1M7KA 4B3AA 3IF8B 4KP3C 2YEVC 4TV9E 2KZ7B 3F1BA 4AKRB 3OTOT 3HKCE 1MIYA 3C64A 4YHJA 4G63A 2A2FX 2NP3A 2NP5A 3RH2A 4DV5T 4HFCA 4X20E 3ZQIA 4JI7T 4DR7T 3KKDA 2MBGA 2Q9QD 3G56A 2YVHA 2G0EA 5CW8A 4Q25A 2E8IA 3LK3B 5TAOA 1HNXT 3TLUA 4GFLA 5L3FB 4LF4T 1D1BA 2R7WA 2H7OA 5AQNB 3CWRA 3OYZA 3ZJ1A 3RYIE 2XGEA 5HCJA 4DBQA 1HCIA 3C51A 3PUVF 4W1UA 1IBMT 2UXIA 1QLBA 4DUZT 2XQ6A 1MIVA 2KSRA 2OV9A 2VKEA 4JLEA 3UULA 1QUUA 2QIBA 3ZMUB 4GCKA 3RF1A 2ACZA 2EHOD 3AE7A 2FJAA 1BJZA 3RX6A 4IDQA 2XAJB 5FKKA 1FJGT 4HFEA 2A3DA 3AEDA 2I59A 4ZZCA 1NENA 4MFRA 4EV6A 4QH1A 4TNVA 4F8HA 3S5RA 4JI5T 2FJDA 3N9PA 2A72A 3ZN1B 4C2MA 5FL0A 2CLYB 3NXCA 4UVBB 1Z8UA 2XAHB 2XSBA 3AB3B 2XTLA 2W4XA 3AECA 1JNZA 4A97A 2JQ9A 3RIAA 5FKMA 5LBQB 4L9IA 2WM9A 5H6QB 1I94T 3CX6B 4ISTA 3VW0A 2PBXA 5LA6E 3CJDA 4OK0A 5FHPA 1HR0T 3KYLA 1NEKA 3VP5A 4TZ4C 4JBWF 3RGLA 1WYBA 3UQ7A 1WLXA 2DG8A 5ABEA 1U5PA 2M6IA 2IDOB 2JIWA 1QVUA 5AQQB 4K0KT 2R7XA 3OJAA 2XPWA 5F8PA 5LNKA 5BR8T 4TN7B 2WB5A 1SGMA 4KX6A 3ZN0B 3BTLA 5HWYA 3F57A 3RLFF 5AQLB 4CN4A 2KNDA 2R7TA 2BG9E 2IAIA 4F6RC 4G12A 3LFMA 3HIMA 2BDEA 3I0OA 3KV9A 3BR2A 4X66T 2BVMA 4QX8B 3PE0A 4V1Av 3RIFA 1KEYA 1SUMB 2CHOA 4MHCA 4LMJA 1HG2A 3G1OA 3AQTA 2X9HA 1SA0E 3Q5EA 3ZT6A 5EZHA 5DAJA 1WR6A 5J3LA 5HXRA 5LMNT 1YQ3A 4KWAA 3B13A 4PJMA 1N36T 2WCAA 3VKHA 3KNWA 2JJ9A 1KK7A 5AQHB 3OPCA 4AKGA 4X1KE 2AXDS 1D0ZA 5J1RA 2LOSA 4E7SA 1XNRT 5HXCA 4KI0F 2ID6A 5JDLA 2H89A 1N33T 3QC9A 3HL6A 3GZIA 2CMRA 5AQIB 2UXXB 4LFCT 2MOZA 4NPPA 4ZI7E 2XASB 2YN6A 3DJBA 2QKOA 2WBLA 1V9DA 2X0HA 5AQRB 2XHEB 4EOZB 5FY7A 3FZMB 2LRKA 3VVYA 2DTZA 1U9OA 3C07A 1CUNA 4HGAA 3SRZA 2DLRA 2ES0A 3V78A 3FK7A 3CQXC 2NW7A 3AQSA 2QVAA 4EAHA 3AE5A 2LSJA 4IE4A 4G2AA 3ZQFA 3IBPA 5A1LA 3VW2A 2D2SA 4ZI3D 2V1DB 4HKAA 1XDOA 3KINB 3SFDA 2N9DA 3BQKA 3Q5WA 4P0BA 2XUEA 5DABA 4HWDA 3MZKB 2LOPA 3LSRA 3Q9DA 4IE5A 5HSZA 4EIWA 4JEUB 1ZEEA 1UURA 2XRLA 2CEAA 2W62A 2WZIA 5FMNA 2WWVA 3AXJA 3C98B 3ABVA 4TV8E 4KBMB 5L2LA 1W9RA 4AI6A 1LKXA 5FKLA 3LSVA 3ZT7A 4U33A 3NI7A 2CPTA 2RHAA 2LSKA 5KMGP 2CCQA 1O3XA 2DNXA 4HE8A 2VVNA 5JDGA 2CBIA 2UXBT 1HX8A 3BR1A 2ACXA 2VB6A 1OWAA 2R7QA 1WR0A 3ZQGA 4YFSA 2MAWA 3KBTA 2H7VC 3T1YT 4V2GA 2WV1A 3O8GA 5FKYA 2IBDA 2ZLYA 5JREA 3WAKA 2Y48B 3J9X1 4ASKA 3RQWA 3BT9A 3FZLB 2BKOA 4I76A 1J5ET 3P4QA 3LJCA 3UU4A 1MIWA 4JI6T 2VKDA 1MNDA 2FJI1 5EYRA 2VKHA 3CPZA 3QUJA 3LSPA 5AQGB 3WAJA 4ANJA 2RASA 3QQAA 4JEHB 4KHPT 4D5FA 1XWMA 5F0CA 3TKLB 2NX4A 2KT9A 2UUBT 2YDSA 4HN9A 3BNIA 5CXGA 4AKLA 2WY2A 2ZM2A 4DNDA 4ZI2D 4PAGA 3EVYA 4UXNB 5BMVE 3CDLA 4GFKA 2BBHA 4QX7B 4BAYB 3VVXA 4LF5T 2LEHA 3PPBA 3O1IA 4DUYT 3CQCB 3PV0F 3NBXX 3O60A 5CA1E 3CKDA 4P09A 2ODVA 3ZCIA 4OD5A 1KNPA 2UUCT 5K7ZA 1U9NA 2C5JA 2G0UA 1HF8A 4CN6A 1HNZT 3P4WA 3P8CD 3ZC1A 5CFBA 5EZGA 3OBVE 4COFA 4Z91A 2JMKA 4I4TE 3Q0WA 4OD4A 3G1MA 3HA4A 4U9LA 5J2UE 2LM9A 1YW0A 5GONE 4O4IE 4EYYR 2UXHA 5L3BB 3FB2A 3DP7A 3ANPA 3JC6C 4IL9A 4WBOA 3VIBA 2ZCMA 3AEEA 3I1AA 2CHNA 3AXJB 3AE1A 3KFWX 1D0YA 4LFBT 2Y2ZA 3ZPOA 3VR8A 4JI1T 1W09A 1BR2A 1QSDA 4ZZBA 3RYHE 1OEDC 3Q2MA 3EUPA 1Z0PA 5GPCA 2AE9A 4IDPA 5HXSA 1OEDA 4U72A 3SDGA 3RI5A 4ISSA 2WDVA 3VVZA 3I9YA 2JMHA 2G7SA 1JTXA 3QBMA 4IL4A 2Y6XA 4P0AA 2OPTA 4ILAA 3Q0VA 4DIDB 5J2TE 5F0FA 2PBIA 3K3NA 3RPUA 4YTNA 2QGSA 3B57A 4JI3T 1B7TA 1XDPA 3O1HA 3LK42 1E7PA 5IWAT 2LT3A 5M4YA 3SOLA 3LJLA 4QHOA 2XQ7A 4IDZA 2R7RA 3VOKA 3TP0A 1XNQT 2LKGA 1ZKGA 5DJQC 3KDSE 3IH3A 4XZCA 1ZP0A 3Q0UA 2D9DA 3A8YC 3V6GA 1D0XA 3N2OA 2G7GA 2RAEA 4LF7T 4OHFA 3B81A 2YVEA 3G7RA 2G7LA 3L8RA 5HXHA 1JUPA 1X79A 4MBQA 4EEDA 2IC9A 3MACA 1YD8G 5LXTE 1FMWA 4MO7A 3ZMSB 4ZHQE 4DO0A 1RKTA 3AE2A 3VRBA 1UX4A 5L3DB 2NW8A 3RRWA 2VKVA 3G1LA 4C91A 3RD3A 5L3CB 3UQ4A 3HE0A 2IHR1 4P1NA 1VCTA 2V6XA 4EZHA 3NRGA 4TUYE 5LGUB 3LWJA 2UXNB 1KFYA 2FJEA 1T33A 4U9NA 3ZYMA 2CXLA 2HYTA 2LSYA 5IYZE 2LHRA 3M65A 3T6NA 3CX8B 1HTJF 2VWAA 5JDFA 5AFUL 3AA7B 3ZMTB 2HHHT 1IJ6A 3Q5XA 4YXDA 2X9XA 3JCFA 4KHZF 1T7SA 3S4UA 2WMOA 4I43B 3BQIA 1WFDA 3ESLA 3QOFA 1MMAA 2W2UA 5KX5E 4I6ZA 4DR3T 2YDQA 1OEDB 5CB4E 5HAWA 2PFVA 4M3BA 5EK4A 4QKNA 1MNEA 2L8KA 4X1YE 2BS3A 4AC0A 1U4QA 2W00A 2HYJA 2NTYA 1UUSA 1Z77A 4ZXLA 4UV9B 2IEKA 1KF6A 4DV0T 4EYUA 5D1RA 4ZS2A 3AA1B 3N5LA 3CVRA 3QB5K 4HWCA 1S94A 2YU1A 2V26A 2XQAA 3J7Yq 4V2FA 4EB6E 4X5TA 2YKSA 5KXJA 3RC3A 4DV2T 2V8SV 3B6CA 2A9UA 3ZYKA 3I0QA 5IHYA 2XAGB 4H9SE 1OXZA 2BG9C 3BRUA 5HWXA 1BR4A 5JDQA 5IPAA 5LGTB 2BG9A 3BQLA 1Y01A 3EHZA 5LYJE 3PU8A 3HKEE 4H63V 4M3FA 2V7JA 2W66A 3VPRA 4PW8A 4GCLA 3C50A 3CWZB 4B6XA 4DR2T 4ABZA 1MMDA 2XM1A 2QTQA 3N9MA 4DV1T 4CXXA 2O7TA 3AE9A 4O2BE 4PJJA 4MK6A 2VL0A 3NVOA 2X0YA 3ZJ2A 4O4HE 1X9BA 4DV4T 4KMCA 3HTHA 3EGQA 1N34T 4HFIA 2CBJA 2YK0A 4UR9A 4NIQA 5JDHA 4PFPA 3ZMVB 5F08A 3QK6A 4MXMA 3C2BA 3ON2A 4GYSA 5LGNB 4I0UA 2LSIA 2NTXA 2QRXA 2GENA 4OYKA 4PK6A 4TX5A 4CN1A 4L5GA 3PUAA 3RKGA 4IE7A 2DWKA 3R6NA 2WSSV 4EXTA 4MLKA 2E9XC 5F04A 3O8HA 2HKUA 3VHLA 5FXZA 2E9XA 2FBQA 5LHHB 2FQ4A 4DMVA 2VL8A 3ZMZB 3UU8A 3NWIA 2BZBA 4EEBA 3FXDB 2VQFT 2XDNA 3DPJA 2IC6A 3AEBA 4U7YA 4PXIA 4JI2T 1JUSA 2KWIB 5AQCA 4DVYP 1HFAA 1ZKEA 3UUNA 3EAMA 4QWNB 2OF7A 4A56A 2WDRA 4YJ2E 4YSZA 1XZYA 5EK3A 1BR0A 2K5BB 2X67A 2YDRA 2H3RA 4NELA 3AAIA 5JDMA 3GMIA 3VW1A 4N78D 3DU5A 3K3OA 3HKBE 3ANGA 3N2KE 3ONLC 2K9AA 5ABGA 3KV4A 4HFHA 3MNLA 1MMNA 3BR5A 3AE8A 4LMLA 3FZFB 1W0BA 2REKA 4K0UA 4M3EA 4B3RT 4H9NC 3GN5A 2PZ9A 2QA7A 2BG9B 3BQYA 4JI4T 4AUXA 4Z90A 2LLYA 1DU2A 4DV7T 3LBXA 3HTJA 4UEMA 2ZB9A 2XAQB 5F5WA 4ZEYA 3LG7A 4U3CA 4TNWA 2ZY9A 3JAFA 2QOPA 4DMWA 3ZSTA 5AQUB 4NN1A 3QNUA 2Q9QC 3V5UA 2R7SA 2XSAA 3P4SA 2QWTA 3NS4A 4H9QC 4AKHA 2Q9QA 3ZQHA 1T56A 4AC6A 1LRZA 2VPRA 5L4EA 1BR1A 3A5XA 4CQIA 3NRXA 2WQYA 2XPUA 3AEFA 2C0SA 5L4HA 3NZQA 1CHUA 3FBZA 4CXWA 2D0TA 2Q24A 4ERRA 2UXCT 2HPLA 4EZ4A 5EK2A 1T98A 2WUIA 4YTPA 4X64T 3CCYA 2IW5B 2BBJA 2J47A 3MJXA 3BR6A 2KINB 2UUAT 2NS8A 2EHOC 4IGUA 5LMUT 2ID3A 2JQHA 3KVAA 4ACIA 1JT0A 4HTEA 2X9WA 5AQKB 5HEJA 3VRAA 3N9OA 2EHOA 3WHBA 1JT6A 4PJNA 4A5XA 2J1DG 5FY1A 5FKNA 2XM2A 4BA9A 2E9XB 4B3MT 3UFEA 2CXFA 4B3ST 3O1JA 3PJAA 2LJLA 3AAAB 2W63A 3TP3A 4HFBA 2OA5A 2WDQA 4OFZA 2TRTA 3L3PA 5J1GA 1ZHCA 2FX0A 4W97A 4O8SA 3PJAJ 2NP9A 3PUZF 1RKWA 3FHNA 3RRCA 2K24A 5CQGA 2I6HA 4IE6A 3E7QA 4JL3A 3P4RA 1D1CA 2XGDA 2SPCA 3PUSA 5J1YA 2HXIA 2V7LA 2W67A 1SE7A 5FNVE 3RQUA 2I10A 3R84B 1IJ5A 3Q5DA 1G8XA 4BJNA 3CMLA 3HGYA 1I6ZA 3AVRA 4J2CA 1JUMA 2NS7A 3UUXB 2LHNA 3LK2B 3FK6A 4GYRA 4MALA 5LG3A 4I50E 3IA3A 4DR4T 3P7IA 1YKEB 2CWYA 3RYCE 1EZ3A 3HKDE 2X9DA 3GN5B 5CA0E 3ZYLA 3BQZA 3LBXB 2CRBA 3H3AA 3ZEFB 3BTCA 3CK6A 4JKZA 3D0TA 4YSYA 2WU2A 3JAEA 4CI3B 2E9XD 2C5KT 2YVXA 2X51A 3ONXA 5K58A 2VVSA 4IRVA 2NR4A 4GIWA 2E5LT 4NUVA 3RYFE 5FP3A 4TWDA 4NUUA 2JQQA 3DTOA 1E1HB 5CGMA 2XY8B 3UFGA 1IZNB 4H63H 2MTQA 4O2AE 2IMLA 4WZXA 3IH4A 3SFEA 2DL1A 3QPSA 5HYAA 2ZOYA 3TLWA 5AQMB 2VKOA 2XB5A 2Y8DA 2ZM0A 3RKOA 2JQKA 5FMPA 5F3JA 3E22E 5FKOA 1VCSA 4ICHA 4DR6T 1FEWA 3EI0A 3CX7B 2DHRA 1HX1B 3LSJA 4EGWA 4GKJT 3ANWA 3LOCA 3WI3A 4IDNA 4U74A 4UF0A 3IHRA 1T72A 3PDYA 2E5VA 2W53A 4E7ZA 5C3JA 2N2NA 3BR3A 5AQSB 4M3DA 3AEGA 3GWHA 4AKIA 4QH5A 4WYVA 3RH3A 2V7IA 5FXWA 5JDNA 5HEHA 2LSGA 5HAXA 2X68A 2Y31A 3NRYA 2NOXA 1RPWA 3QKXA 2CWOA 4QH4A 5JH7E 3L09A 4X1EA 3K8PC 4L0RA 4ADZA 1UI6A 3P50A 2Z6EA 2GUHA 1ZK8A 2KMFA 5IP6A 5LB7B 3FXEB 3A7MA 5GPAA 3KV6A 2W61A 3RIUC 2WP9A 3VOXA 4ZI3C 2B76A 2PG8A 4XK4A 3ZQLA 4U2ZA 3RIUA 4FJOA 2VQET 4WNKA 1YKHB 2UXPA 2V5DA 1D1AA 4HKUA 1WRDA 1QVTA 3FBLA 4HFDA 3V5SA 1G73A 3HI2A 3T8OA 2G3BA 3N2GE 4AIUA 2DI4A 2MYSA 2KWHA 5IOYA 3IH2A 4ILBA 1L0VA 2R7VA 5LCYA 2K48A 3ON4A 5LHGB 3O4XE 3EABA 1YQ4A 3P4PA 5F0HA 2XQ9A 3MA9A 3UT5E 4WW0A 3FIWA 2XQ8A 2YOEA 2UXDT 2N1GA 4QXBB 3N9LA 5LOVE 1ZV4X 4YJ3E 4O4LE 4H9PC 3IUVA 2YU2A 4AQGA 3MVPA 3NPIA 4PNIA 2XJ7A 4YTMA 2ZM6T 3DCFA 4AQYT 4NXNT 1LVKA 4CZZB 3F0CA 3F2EA 4YSXA 1HG5A 5ETWA 3AE6A 1SHZC 4WIBA 2BVLA 2WZHA 5ABFA 5AQPB 5D18A 5K7HA 3BTIA 3JADA 1E2AA 5GP9A 3VKGA 1UGOA 5JR9C 1M62A 3ANWB 3PUXF 2YINA 1JNRA 3ETUA 5LJMA 4JI0T 5FL1A 5JR9A 5HEGA 4UF0B 2CXDA 2I0MA 3PUWF 3TLTA 3JC6D 1UX5A 3HR0A 4YZEA 2F07A 4AQFC 2H88A 5H6RB 2J4GA 2IAKA 2DWGA 4A98A 4CI2B 3ETVA 1IBKT 3OKQA 2IU5A 4KUMB 2FUPA 4AQFA 3EUHA 4XAXB 4ZS3A 4ZI2C 2LE8A 4PK4A 3PUYF 3CIRA 2M67A 3HGGA 2UXUA 4BJMA 2LRLA 3ZLIA 3TLVA 3U3IA 3T1HT 2EH3A 2ODUA 3SFIA 2V6YA 3BTJA 3ZKRA 3H37A 5FXXA 4B3TT 2UU9T 2XZEA 3COLA 4LFAT 2GK9A 2B1EA 5IOZA 2RP4A 4OYJA 4ME9A 2C5IT 3M3ZB 3K3QC 1Y64B 3K1SA 3MKDA 2WGBA 3MXZA 1NWMX 3LDQB 2P9BA 2X0LB 5JRCA 2D5UA 5C4YA 3W15B 3TLSA 4GKKT 2XPVA 4B1RA 5H9TA 4LF8T 3B6AA 2IUBA 5IUXA 4I55E 5LG4A 4NXMT 1NAFA 5FVLA 4WBNE 5JVDE 2X9YA 5CJ5A 1UK5A 5HEOA 3NNRA 2XQ3A 2FJBA 2V57A 2VASA 1IBLT 3H3MA 1S35A 3WHCA 2WWUA 4YHHT 3C4WA 2RPAA 2Y30A 2WMNA 5AQOB 3OVUA 1J5WA 3PM1A 3RHWA 2IIUA 2PTFA 1A6IA 2R6GF 3P9TA 3PU3A 2F4VT 3AE3A 5FVKA 3UTKA 1YXRA 4PK5A 2NW9A 2BS4A 2NWBA 3ZSSA 5HEUA 1VI0A 3GA8A 2KXPB 5CXIA 2FJ1A 2LKHA 2E2AA 5ADXL 4PJLA 5FGLA 4FI5A 2BKPA 3X1DA 5ABHA 4QXHB 5ABFB 2ZMAA 2XQ5A 3KKCA 5LHIB 2V7MA 2XQ4A 4TWFA 2HPJA 2V7KA 4X65T 1XMQT 3B5MA 4O4JE 1UCUA 3EDVA 2FBWA 1FMVA 3VTIA 1VRBA 2OLTA 3U78A 1H7CA 5JR9B 4D7NA 1R8IA 5AQJB 2OERA 3ONJA 1QPIA 4U2YA 4DBRA 4HWHA 3DEWA 1W0AA 4CI1B 5JTGA 1IAPA 4M1PA 2CM0A 3LHQA 4X1IE 3E08A 3KZ9A 2LM2A 2WU5A 2GFNA 2O7OA 4GK5E 3QB5A 4GK0E 2QYWA 3CRJA 5L3EB 3FZKB 4ILUA 5AQVB 5KDMC 2DG7A 3UU3A 3DU6A 1JTYA 3C4XA 3SS1A 3G06A 2HH7A 3UUMA 5E0OA 2V6YB 5JQGE 1ORKA 4UVCB 1XMOT 4AF5A 4DR5T 3AVSA 2BS2A 2R7OA 4JNNA 4PFOA 1FIOA 2M6BA 2R7UA 1US7B 5EZYE 4D5CA 4H9RC 3FRQA 1HS7A 2X6OA 3PUQA 1WYCA 3VUQA 2ZCXA 3C4ZA 4DV6T 5JRCB 4GCTA 4JYKA 3VU7H 5FY0A 3BCGA 3AA6B 3ZCJA 4HFVA 4IT4A 4UV8B 4JYAT 3BHQA 3JSJA 5J1UA 2KLQA 4U7IA 2HXOA 2BKNA 3VR9A 3UU6A 3IEEA 3GEUA 3UU5A 3EDUA 4LMKA 2UXOA 4LF6T 3BJBA 4C90A 3AEAA 4GOUA 3BK9A 3KVBA 5LP6E 2XGCA 2J62A 2JRKA 4M3GA 1MMGA 2L3LA 2JJ7A 1WCRA 4AISA 5F1JA 5L3GB 4DR1T 1LVFA 3FZHB 5FXVA 4X62T 3O9XA 4TWHA 4HEAA 2PJQA 5AQTB 3AE4A 2JK3A 4IHJE 2W0GA 4D7MA 3E0ZA 4ZOLE 4IREA 1KNZA 4YT0A 4CXYA 1HNWT 1N32T 4AXPA 4UVAB 2GBYA 1T8BA 5C2TA 4CGRA 4UIGA 2CA5A 2XAFB 2VURA 4ILCA 1Z0XA 4QXCB 3BR0A 3N9NA 3QPLA 3HTAA 2HQ5A 2D6YA 2JPFA 4UDSA 5K7FA 2K3WA 2XPKA 4H9OC 3F31A 2L9QA 3CQGB 5LJNA 3KBUA 3PURA 3Q3SA 4DW6A 5HBUA 5HXEA 4HWIB 4JUYA 4UELA 4DVDA 2X66A
chains in the Genus database with same CATH topology
2W61A 4AI6A 4IE0A 2D0UA 1LKXA 4ZI3C 2PG8A 3N9QA 5FYMA 2YK0A 2RA1A 2LSKA 5KMGP 2CCQA 1O3XA 2DNXA 4FJOA 4HE8A 5JDGA 1HX8A 4WNKA 1YKHB 5JDHA 2ACXA 2VB6A 1D1AA 1OWAA 4PFPA 2XQYA 3ZMVB 3RC8A 2R7QA 1WRDA 4YFSA 3KBTA 3FBLA 3QK6A 2H7VC 4GYSA 5LGNB 3AA0B 3V5SA 1G73A 2VKJA 3HI2A 2Q9QB 3T8OA 4IIJE 3PTRB 2ZLYA 3N2GE 2DI4A 2MYSA 2KWHA 1AJ3A 5JREA 2CLYC 2R7VA 2Y48B 5LCYA 3WAKA 2LSIA 2K48A 5DQWA 3J9X1 4ASKA 5LHGB 2NTXA 3OYXA 3NZPA 3O4XE 4OYKA 2CE7A 4PK6A 4TX5A 4XBFB 4L5GA 2B3WA 2VK9A 3MA9A 3PUAA 5DQVA 3UT5E 4WW0A 5C8YE 3MK7C 4IE7A 3LJCA 1MIWA 2DWKA 3R6NA 2VKDA 2WSSV 3AAEB 4EXTA 1MNDA 4MLKA 2E9XC 4YLHA 2N1GA 3ZC0A 1VOMA 3SWHA 4QXBB 2FJI1 5AFUL 3VHLA 3N9LA 2VKHA 5LOVE 5FXZA 1ZV4X 3CPZA 3QUJA 4YJ3E 5LBMA 2E9XA 4O4LE 4Z8XA 5LHHB 4H9PC 4ANJA 2YU2A 4DMVA 2VL8A 4AQGA 3WAJA 3ZMZB 3I9WA 2WAUA 4JEHB 4PNIA 3TKLB 2BZBA 2KT9A 2ZM8A 1LVKA 4HN9A 2DCFA 2EHOB 4CZZB 3FXDB 3F2EA 1HG5A 5ETWA 3KV5A 2IC6A 4KMCA 1SHZC 4AKLA 2BVLA 2ZM2A 4DNDA 3PUGA 2KWIB 4ZI2D 3IF8B 4KP3C 4PAGA 2YEVC 4DVYP 1HFAA 1ZKEA 3EVYA 4UXNB 3UUNA 4TV9E 4ZI3D 2KZ7B 5BMVE 4QWNB 4AKRB 3VKGA 4A56A 5JR9C 4QX7B 3HKCE 4YJ2E 3ANWB 1MIYA 2YINA 3C64A 4BAYB 3ETUA 4YHJA 5EK3A 5LJMA 1BR0A 2LEHA 3O1IA 2K5BB 4G63A 2A2FX 3CQCB 5JR9A 3NBXX 2CXDA 4UF0B 5CA1E 3CKDA 4P09A 2ODVA 3ZCIA 4OD5A 2X67A 3JC6D 2C5JA 1UX5A 2G0UA 2H3RA 1HF8A 3AAIA 3HR0A 4X20E 2MBGA 2Q9QD 3P8CD 5JDMA 4AQFC 5H6RB 2IAKA 3GMIA 2DWGA 4N78D 3ZC1A 4CI2B 3ETVA 3DU5A 3K3OA 3HKBE 2E8IA 3OBVE 3OKQA 4KUMB 4AQFA 2JMKA 3N2KE 3LK3B 5TAOA 2K9AA 3EUHA 3KV4A 4I4TE 4XAXB 1MMNA 4ZS3A 5L3FB 1D1BA 4ZI2C 2R7WA 2LE8A 2H7OA 4OD4A 4K0UA 3HA4A 3OYZA 4PK4A 3ZJ1A 2M67A 4H9NC 3RYIE 3GN5A 2QA7A 5J2UE 2LM9A 1HCIA 3C51A 4DBQA 4BJMA 3LBXA 1YW0A 3ZLIA 3U3IA 4UEMA 5GONE 2XAQB 2ODUA 4O4IE 4EYYR 3LG7A 3H37A 5FXXA 1MIVA 5L3BB 3FB2A 4JLEA 3UULA 1QUUA 3DP7A 4DMWA 2GK9A 2B1EA 3JC6C 4WBOA 2RP4A 3ZMUB 3I1AA 2Q9QC 3V5UA 2R7SA 4OYJA 3NS4A 2C5IT 3KFWX 3K3QC 1D0YA 1Y64B 4H9QC 3ZPOA 4AKHA 2Q9QA 3MKDA 2EHOD 1BR2A 3RX6A 1QSDA 1LRZA 3MXZA 1NWMX 1BR1A 3A5XA 4CQIA 2P9BA 2XAJB 3RYHE 3NRXA 2X0LB 5JRCA 3Q2MA 1Z0PA 2C0SA 2D5UA 3NZQA 3FBZA 3W15B 4CXWA 2D0TA 2A3DA 5HXSA 2I59A 4ERRA 4U72A 2HPLA 4MFRA 4ISSA 4EZ4A 5EK2A 3I9YA 1KNZA 1T98A 2JMHA 3N9PA 2A72A 2Y6XA 2IW5B 3ZN1B 4P0AA 4I55E 5LG4A 4C2MA 1NAFA 2CLYB 3MJXA 4WBNE 4UVBB 2XAHB 5JVDE 2KINB 2X9YA 5J2TE 3AB3B 2PBIA 2XTLA 2EHOC 3K3NA 4IGUA 3RPUA 3KVAA 4HTEA 2QGSA 2X9WA 3B57A 2VASA 3N9OA 2EHOA 1B7TA 1S35A 2WWUA 3C4WA 3O1HA 3LK42 4PJNA 2LT3A 2WMNA 5M4YA 5LBQB 2J1DG 3SOLA 4L9IA 5FY1A 2WM9A 4BA9A 2E9XB 4QHOA 3UFEA 2CXFA 4IDZA 2R7RA 3PU3A 3UTKA 4PK5A 3O1JA 5H6QB 2NW9A 2LJLA 2NWBA 3CX6B 3AAAB 3KDSE 5DJQC 2W63A 4ISTA 3GA8A 2KXPB 5LA6E 4XZCA 2OA5A 4OFZA 5J1GA 3L3PA 1ZHCA 4OK0A 4PJLA 5ADXL 4O8SA 3KYLA 4FI5A 4TZ4C 2NP9A 1D0XA 1WYBA 3N2OA 4QXHB 3FHNA 2ZMAA 3RRCA 2K24A 4OHFA 5LHIB 2V7MA 5CQGA 1WLXA 2HPJA 2V7KA 4IE6A 1U5PA 4O4JE 5HXHA 1UCUA 3EDVA 1X79A 4MBQA 1D1CA 2SPCA 1FMVA 3PUSA 3VTIA 2IC9A 1VRBA 2R7XA 3U78A 1H7CA 3MACA 3OJAA 1YD8G 2V7LA 5JR9B 5LXTE 1FMWA 5FNVE 5F8PA 5LNKA 3R84B 1IJ5A 3ZMSB 1G8XA 4TN7B 4BJNA 4ZHQE 4CI1B 4DBRA 4DO0A 1IAPA 3CMLA 3ZN0B 4M1PA 2CM0A 1UX4A 3AVRA 4J2CA 3F57A 5HWYA 2NW8A 5L3DB 3UUXB 4X1IE 2LHNA 3E08A 3LK2B 4GYRA 3RRWA 4MALA 4C91A 4I50E 2KNDA 3P7IA 1YKEB 2R7TA 2CWYA 4GK5E 3RYCE 5L3CB 4F6RC 4GK0E 3LFMA 2BDEA 3I0OA 5L3EB 3KV9A 1EZ3A 4ILUA 3HKDE 5KDMC 2BVMA 4EZHA 3GN5B 3DU6A 4TUYE 4QX8B 3C4XA 3SS1A 5CA0E 3ZYLA 3PE0A 5LGUB 3LBXB 4V1Av 2UXNB 2HH7A 3H3AA 3ZEFB 3UUMA 1HS7A 4MHCA 5E0OA 5JQGE 1HG2A 3D0TA 2X9HA 3ZYMA 2CXLA 4CI3B 4UVCB 1SA0E 2E9XD 2LSYA 5IYZE 2C5KT 3AVSA 1WR6A 2X51A 5HXRA 2R7OA 3ONXA 3B13A 4PJMA 4IRVA 4PFOA 1FIOA 2LHRA 3M65A 4GIWA 3CX8B 3VKHA 2R7UA 4NUVA 1US7B 5EZYE 5FP3A 3RYFE 2JJ9A 1HTJF 2VWAA 4H9RC 4NUUA 5JDFA 2JQQA 1KK7A 1E1HB 3AA7B 3DTOA 3ZMTB 1IJ6A 3PUQA 3Q5XA 1WYCA 2X9XA 4AKGA 1IZNB 4X1KE 4H63H 2MTQA 4O2AE 3S4UA 3C4ZA 2WMOA 4I43B 1D0ZA 3BQIA 5JRCB 3ESLA 1MMAA 3VU7H 5FY0A 2LOSA 4E7SA 5HYAA 5KX5E 5HXCA 2VKOA 3AA6B 5CB4E 2Y8DA 2ZM0A 3ZCJA 4HFVA 5JDLA 3RKOA 3QC9A 4UV8B 5F3JA 3E22E 3HL6A 2PFVA 2CMRA 5EK4A 4QKNA 2UXXB 2MOZA 1FEWA 1MNEA 2L8KA 4X1YE 4ZI7E 2XASB 2KLQA 1U4QA 3DJBA 3CX7B 2W00A 2WBLA 1V9DA 3IEEA 2DHRA 2NTYA 4UV9B 2XHEB 4ZS2A 4EYUA 3AA1B 3EDUA 3N5LA 4EOZB 3CVRA 5FY7A 4C90A 3ANWA 4GOUA 3WI3A 1S94A 3BK9A 3KVBA 4U74A 1CUNA 4HGAA 5LP6E 4UF0A 2YU1A 2JRKA 3IHRA 3SRZA 2V26A 1MMGA 2L3LA 2DLRA 2ES0A 3PDYA 5L3GB 3J7Yq 1LVFA 5FXVA 4E7ZA 3CQXC 3O9XA 4EB6E 2NW7A 4HEAA 2PJQA 4EAHA 3RC3A 2N2NA 2LSJA 4IHJE 3ZYKA 2W0GA 4IE4A 4G2AA 3IBPA 3GWHA 5A1LA 4AKIA 3E0ZA 3I0QA 5IHYA 2D2SA 4ZOLE 2V1DB 3RH3A 2XAGB 3KINB 2V7IA 4H9SE 1OXZA 2N9DA 4HKAA 5FXWA 4CXYA 3BQKA 5HWXA 5JDNA 1BR4A 4AXPA 3Q5WA 5JDQA 2LSGA 4UVAB 4P0BA 5HAXA 5LGTB 2XUEA 2X68A 5DABA 3BQLA 2CA5A 4UIGA 2XAFB 3MZKB 2LOPA 5LYJE 3PU8A 3NRYA 2NOXA 3HKEE 4H63V 4QXCB 2V7JA 3Q9DA 2CWOA 3N9NA 5JH7E 4IE5A 3L09A 4PW8A 2JPFA 4EIWA 3C50A 4JEUB 1ZEEA 2W62A 2CEAA 3CWZB 4B6XA 3K8PC 4H9OC 1MMDA 4L0RA 3F31A 2L9QA 3CQGB 3N9MA 5FMNA 4ADZA 5LJNA 2Z6EA 4CXXA 2KMFA 3KBUA 3PURA 4O2BE 4PJJA 3C98B 5HXEA 4TV8E 3ZJ2A 4JUYA 4O4HE 4UELA 3FXEB 4DVDA 4KBMB 2X66A 3KV6A 5L2LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K8P C; 
#chains in the Genus database with same CATH topology
 1ZOY A;  4IE0 A;  2D0U A;  3PAS A;  3HTI A;  3N9Q A;  5FYM A;  2RA1 A;  4JI8 T;  5L47 A;  2FD5 A;  4DV3 T;  4L62 A;  2ZCN A;  2XQY A;  3RC8 A;  2V5C A;  2OI8 A;  1UI5 A;  5F27 A;  5J0Z A;  2MPK A;  3AA0 B;  1GQE A;  3UUB A;  2VKJ A;  4YY3 T;  2Q9Q B;  3L39 A;  4IIJ E;  3PTR B;  4JV5 T;  1AJ3 A;  2CLY C;  1KNR A;  5DQW A;  3OYX A;  3NZP A;  2HN2 A;  2ZOZ A;  2CE7 A;  5HCM A;  2HN1 A;  4XBF B;  2TCT A;  5D19 A;  1J1J A;  2B3W A;  2VK9 A;  4IDO A;  5DQV A;  5C8Y E;  3MK7 C;  3AAE B;  4U31 A;  3ZC0 A;  4YLH A;  1VOM A;  3SWH A;  1OED E;  3ZT5 A;  5AQF B;  2QCO A;  5LBM A;  4Z8X A;  2WS3 A;  3I9W A;  2WAU A;  5EFY A;  3NKZ A;  2ZM8 A;  4LF9 T;  2DCF A;  2EHO B;  3KV5 A;  4HWF A;  4OX9 T;  3PUG A;  1M7K A;  4B3A A;  3IF8 B;  4KP3 C;  2YEV C;  4TV9 E;  2KZ7 B;  3F1B A;  4AKR B;  3OTO T;  3HKC E;  1MIY A;  3C64 A;  4YHJ A;  4G63 A;  2A2F X;  2NP3 A;  2NP5 A;  3RH2 A;  4DV5 T;  4HFC A;  4X20 E;  3ZQI A;  4JI7 T;  4DR7 T;  3KKD A;  2MBG A;  2Q9Q D;  3G56 A;  2YVH A;  2G0E A;  5CW8 A;  4Q25 A;  2E8I A;  3LK3 B;  5TAO A;  1HNX T;  3TLU A;  4GFL A;  5L3F B;  4LF4 T;  1D1B A;  2R7W A;  2H7O A;  5AQN B;  3CWR A;  3OYZ A;  3ZJ1 A;  3RYI E;  2XGE A;  5HCJ A;  4DBQ A;  1HCI A;  3C51 A;  3PUV F;  4W1U A;  1IBM T;  2UXI A;  1QLB A;  4DUZ T;  2XQ6 A;  1MIV A;  2KSR A;  2OV9 A;  2VKE A;  4JLE A;  3UUL A;  1QUU A;  2QIB A;  3ZMU B;  4GCK A;  3RF1 A;  2ACZ A;  2EHO D;  3AE7 A;  2FJA A;  1BJZ A;  3RX6 A;  4IDQ A;  2XAJ B;  5FKK A;  1FJG T;  4HFE A;  2A3D A;  3AED A;  2I59 A;  4ZZC A;  1NEN A;  4MFR A;  4EV6 A;  4QH1 A;  4TNV A;  4F8H A;  3S5R A;  4JI5 T;  2FJD A;  3N9P A;  2A72 A;  3ZN1 B;  4C2M A;  5FL0 A;  2CLY B;  3NXC A;  4UVB B;  1Z8U A;  2XAH B;  2XSB A;  3AB3 B;  2XTL A;  2W4X A;  3AEC A;  1JNZ A;  4A97 A;  2JQ9 A;  3RIA A;  5FKM A;  5LBQ B;  4L9I A;  2WM9 A;  5H6Q B;  1I94 T;  3CX6 B;  4IST A;  3VW0 A;  2PBX A;  5LA6 E;  3CJD A;  4OK0 A;  5FHP A;  1HR0 T;  3KYL A;  1NEK A;  3VP5 A;  4TZ4 C;  4JBW F;  3RGL A;  1WYB A;  3UQ7 A;  1WLX A;  2DG8 A;  5ABE A;  1U5P A;  2M6I A;  2IDO B;  2JIW A;  1QVU A;  5AQQ B;  4K0K T;  2R7X A;  3OJA A;  2XPW A;  5F8P A;  5LNK A;  5BR8 T;  4TN7 B;  2WB5 A;  1SGM A;  4KX6 A;  3ZN0 B;  3BTL A;  5HWY A;  3F57 A;  3RLF F;  5AQL B;  4CN4 A;  2KND A;  2R7T A;  2BG9 E;  2IAI A;  4F6R C;  4G12 A;  3LFM A;  3HIM A;  2BDE A;  3I0O A;  3KV9 A;  3BR2 A;  4X66 T;  2BVM A;  4QX8 B;  3PE0 A;  4V1A v;  3RIF A;  1KEY A;  1SUM B;  2CHO A;  4MHC A;  4LMJ A;  1HG2 A;  3G1O A;  3AQT A;  2X9H A;  1SA0 E;  3Q5E A;  3ZT6 A;  5EZH A;  5DAJ A;  1WR6 A;  5J3L A;  5HXR A;  5LMN T;  1YQ3 A;  4KWA A;  3B13 A;  4PJM A;  1N36 T;  2WCA A;  3VKH A;  3KNW A;  2JJ9 A;  1KK7 A;  5AQH B;  3OPC A;  4AKG A;  4X1K E;  2AXD S;  1D0Z A;  5J1R A;  2LOS A;  4E7S A;  1XNR T;  5HXC A;  4KI0 F;  2ID6 A;  5JDL A;  2H89 A;  1N33 T;  3QC9 A;  3HL6 A;  3GZI A;  2CMR A;  5AQI B;  2UXX B;  4LFC T;  2MOZ A;  4NPP A;  4ZI7 E;  2XAS B;  2YN6 A;  3DJB A;  2QKO A;  2WBL A;  1V9D A;  2X0H A;  5AQR B;  2XHE B;  4EOZ B;  5FY7 A;  3FZM B;  2LRK A;  3VVY A;  2DTZ A;  1U9O A;  3C07 A;  1CUN A;  4HGA A;  3SRZ A;  2DLR A;  2ES0 A;  3V78 A;  3FK7 A;  3CQX C;  2NW7 A;  3AQS A;  2QVA A;  4EAH A;  3AE5 A;  2LSJ A;  4IE4 A;  4G2A A;  3ZQF A;  3IBP A;  5A1L A;  3VW2 A;  2D2S A;  4ZI3 D;  2V1D B;  4HKA A;  1XDO A;  3KIN B;  3SFD A;  2N9D A;  3BQK A;  3Q5W A;  4P0B A;  2XUE A;  5DAB A;  4HWD A;  3MZK B;  2LOP A;  3LSR A;  3Q9D A;  4IE5 A;  5HSZ A;  4EIW A;  4JEU B;  1ZEE A;  1UUR A;  2XRL A;  2CEA A;  2W62 A;  2WZI A;  5FMN A;  2WWV A;  3AXJ A;  3C98 B;  3ABV A;  4TV8 E;  4KBM B;  5L2L A;  1W9R A;  4AI6 A;  1LKX A;  5FKL A;  3LSV A;  3ZT7 A;  4U33 A;  3NI7 A;  2CPT A;  2RHA A;  2LSK A;  5KMG P;  2CCQ A;  1O3X A;  2DNX A;  4HE8 A;  2VVN A;  5JDG A;  2CBI A;  2UXB T;  1HX8 A;  3BR1 A;  2ACX A;  2VB6 A;  1OWA A;  2R7Q A;  1WR0 A;  3ZQG A;  4YFS A;  2MAW A;  3KBT A;  2H7V C;  3T1Y T;  4V2G A;  2WV1 A;  3O8G A;  5FKY A;  2IBD A;  2ZLY A;  5JRE A;  3WAK A;  2Y48 B;  3J9X 1;  4ASK A;  3RQW A;  3BT9 A;  3FZL B;  2BKO A;  4I76 A;  1J5E T;  3P4Q A;  3LJC A;  3UU4 A;  1MIW A;  4JI6 T;  2VKD A;  1MND A;  2FJI 1;  5EYR A;  2VKH A;  3CPZ A;  3QUJ A;  3LSP A;  5AQG B;  3WAJ A;  4ANJ A;  2RAS A;  3QQA A;  4JEH B;  4KHP T;  4D5F A;  1XWM A;  5F0C A;  3TKL B;  2NX4 A;  2KT9 A;  2UUB T;  2YDS A;  4HN9 A;  3BNI A;  5CXG A;  4AKL A;  2WY2 A;  2ZM2 A;  4DND A;  4ZI2 D;  4PAG A;  3EVY A;  4UXN B;  5BMV E;  3CDL A;  4GFK A;  2BBH A;  4QX7 B;  4BAY B;  3VVX A;  4LF5 T;  2LEH A;  3PPB A;  3O1I A;  4DUY T;  3CQC B;  3PV0 F;  3NBX X;  3O60 A;  5CA1 E;  3CKD A;  4P09 A;  2ODV A;  3ZCI A;  4OD5 A;  1KNP A;  2UUC T;  5K7Z A;  1U9N A;  2C5J A;  2G0U A;  1HF8 A;  4CN6 A;  1HNZ T;  3P4W A;  3P8C D;  3ZC1 A;  5CFB A;  5EZG A;  3OBV E;  4COF A;  4Z91 A;  2JMK A;  4I4T E;  3Q0W A;  4OD4 A;  3G1M A;  3HA4 A;  4U9L A;  5J2U E;  2LM9 A;  1YW0 A;  5GON E;  4O4I E;  4EYY R;  2UXH A;  5L3B B;  3FB2 A;  3DP7 A;  3ANP A;  3JC6 C;  4IL9 A;  4WBO A;  3VIB A;  2ZCM A;  3AEE A;  3I1A A;  2CHN A;  3AXJ B;  3AE1 A;  3KFW X;  1D0Y A;  4LFB T;  2Y2Z A;  3ZPO A;  3VR8 A;  4JI1 T;  1W09 A;  1BR2 A;  1QSD A;  4ZZB A;  3RYH E;  1OED C;  3Q2M A;  3EUP A;  1Z0P A;  5GPC A;  2AE9 A;  4IDP A;  5HXS A;  1OED A;  4U72 A;  3SDG A;  3RI5 A;  4ISS A;  2WDV A;  3VVZ A;  3I9Y A;  2JMH A;  2G7S A;  1JTX A;  3QBM A;  4IL4 A;  2Y6X A;  4P0A A;  2OPT A;  4ILA A;  3Q0V A;  4DID B;  5J2T E;  5F0F A;  2PBI A;  3K3N A;  3RPU A;  4YTN A;  2QGS A;  3B57 A;  4JI3 T;  1B7T A;  1XDP A;  3O1H A;  3LK4 2;  1E7P A;  5IWA T;  2LT3 A;  5M4Y A;  3SOL A;  3LJL A;  4QHO A;  2XQ7 A;  4IDZ A;  2R7R A;  3VOK A;  3TP0 A;  1XNQ T;  2LKG A;  1ZKG A;  5DJQ C;  3KDS E;  3IH3 A;  4XZC A;  1ZP0 A;  3Q0U A;  2D9D A;  3A8Y C;  3V6G A;  1D0X A;  3N2O A;  2G7G A;  2RAE A;  4LF7 T;  4OHF A;  3B81 A;  2YVE A;  3G7R A;  2G7L A;  3L8R A;  5HXH A;  1JUP A;  1X79 A;  4MBQ A;  4EED A;  2IC9 A;  3MAC A;  1YD8 G;  5LXT E;  1FMW A;  4MO7 A;  3ZMS B;  4ZHQ E;  4DO0 A;  1RKT A;  3AE2 A;  3VRB A;  1UX4 A;  5L3D B;  2NW8 A;  3RRW A;  2VKV A;  3G1L A;  4C91 A;  3RD3 A;  5L3C B;  3UQ4 A;  3HE0 A;  2IHR 1;  4P1N A;  1VCT A;  2V6X A;  4EZH A;  3NRG A;  4TUY E;  5LGU B;  3LWJ A;  2UXN B;  1KFY A;  2FJE A;  1T33 A;  4U9N A;  3ZYM A;  2CXL A;  2HYT A;  2LSY A;  5IYZ E;  2LHR A;  3M65 A;  3T6N A;  3CX8 B;  1HTJ F;  2VWA A;  5JDF A;  5AFU L;  3AA7 B;  3ZMT B;  2HHH T;  1IJ6 A;  3Q5X A;  4YXD A;  2X9X A;  3JCF A;  4KHZ F;  1T7S A;  3S4U A;  2WMO A;  4I43 B;  3BQI A;  1WFD A;  3ESL A;  3QOF A;  1MMA A;  2W2U A;  5KX5 E;  4I6Z A;  4DR3 T;  2YDQ A;  1OED B;  5CB4 E;  5HAW A;  2PFV A;  4M3B A;  5EK4 A;  4QKN A;  1MNE A;  2L8K A;  4X1Y E;  2BS3 A;  4AC0 A;  1U4Q A;  2W00 A;  2HYJ A;  2NTY A;  1UUS A;  1Z77 A;  4ZXL A;  4UV9 B;  2IEK A;  1KF6 A;  4DV0 T;  4EYU A;  5D1R A;  4ZS2 A;  3AA1 B;  3N5L A;  3CVR A;  3QB5 K;  4HWC A;  1S94 A;  2YU1 A;  2V26 A;  2XQA A;  3J7Y q;  4V2F A;  4EB6 E;  4X5T A;  2YKS A;  5KXJ A;  3RC3 A;  4DV2 T;  2V8S V;  3B6C A;  2A9U A;  3ZYK A;  3I0Q A;  5IHY A;  2XAG B;  4H9S E;  1OXZ A;  2BG9 C;  3BRU A;  5HWX A;  1BR4 A;  5JDQ A;  5IPA A;  5LGT B;  2BG9 A;  3BQL A;  1Y01 A;  3EHZ A;  5LYJ E;  3PU8 A;  3HKE E;  4H63 V;  4M3F A;  2V7J A;  2W66 A;  3VPR A;  4PW8 A;  4GCL A;  3C50 A;  3CWZ B;  4B6X A;  4DR2 T;  4ABZ A;  1MMD A;  2XM1 A;  2QTQ A;  3N9M A;  4DV1 T;  4CXX A;  2O7T A;  3AE9 A;  4O2B E;  4PJJ A;  4MK6 A;  2VL0 A;  3NVO A;  2X0Y A;  3ZJ2 A;  4O4H E;  1X9B A;  4DV4 T;  4KMC A;  3HTH A;  3EGQ A;  1N34 T;  4HFI A;  2CBJ A;  2YK0 A;  4UR9 A;  4NIQ A;  5JDH A;  4PFP A;  3ZMV B;  5F08 A;  3QK6 A;  4MXM A;  3C2B A;  3ON2 A;  4GYS A;  5LGN B;  4I0U A;  2LSI A;  2NTX A;  2QRX A;  2GEN A;  4OYK A;  4PK6 A;  4TX5 A;  4CN1 A;  4L5G A;  3PUA A;  3RKG A;  4IE7 A;  2DWK A;  3R6N A;  2WSS V;  4EXT A;  4MLK A;  2E9X C;  5F04 A;  3O8H A;  2HKU A;  3VHL A;  5FXZ A;  2E9X A;  2FBQ A;  5LHH B;  2FQ4 A;  4DMV A;  2VL8 A;  3ZMZ B;  3UU8 A;  3NWI A;  2BZB A;  4EEB A;  3FXD B;  2VQF T;  2XDN A;  3DPJ A;  2IC6 A;  3AEB A;  4U7Y A;  4PXI A;  4JI2 T;  1JUS A;  2KWI B;  5AQC A;  4DVY P;  1HFA A;  1ZKE A;  3UUN A;  3EAM A;  4QWN B;  2OF7 A;  4A56 A;  2WDR A;  4YJ2 E;  4YSZ A;  1XZY A;  5EK3 A;  1BR0 A;  2K5B B;  2X67 A;  2YDR A;  2H3R A;  4NEL A;  3AAI A;  5JDM A;  3GMI A;  3VW1 A;  4N78 D;  3DU5 A;  3K3O A;  3HKB E;  3ANG A;  3N2K E;  3ONL C;  2K9A A;  5ABG A;  3KV4 A;  4HFH A;  3MNL A;  1MMN A;  3BR5 A;  3AE8 A;  4LML A;  3FZF B;  1W0B A;  2REK A;  4K0U A;  4M3E A;  4B3R T;  4H9N C;  3GN5 A;  2PZ9 A;  2QA7 A;  2BG9 B;  3BQY A;  4JI4 T;  4AUX A;  4Z90 A;  2LLY A;  1DU2 A;  4DV7 T;  3LBX A;  3HTJ A;  4UEM A;  2ZB9 A;  2XAQ B;  5F5W A;  4ZEY A;  3LG7 A;  4U3C A;  4TNW A;  2ZY9 A;  3JAF A;  2QOP A;  4DMW A;  3ZST A;  5AQU B;  4NN1 A;  3QNU A;  2Q9Q C;  3V5U A;  2R7S A;  2XSA A;  3P4S A;  2QWT A;  3NS4 A;  4H9Q C;  4AKH A;  2Q9Q A;  3ZQH A;  1T56 A;  4AC6 A;  1LRZ A;  2VPR A;  5L4E A;  1BR1 A;  3A5X A;  4CQI A;  3NRX A;  2WQY A;  2XPU A;  3AEF A;  2C0S A;  5L4H A;  3NZQ A;  1CHU A;  3FBZ A;  4CXW A;  2D0T A;  2Q24 A;  4ERR A;  2UXC T;  2HPL A;  4EZ4 A;  5EK2 A;  1T98 A;  2WUI A;  4YTP A;  4X64 T;  3CCY A;  2IW5 B;  2BBJ A;  2J47 A;  3MJX A;  3BR6 A;  2KIN B;  2UUA T;  2NS8 A;  2EHO C;  4IGU A;  5LMU T;  2ID3 A;  2JQH A;  3KVA A;  4ACI A;  1JT0 A;  4HTE A;  2X9W A;  5AQK B;  5HEJ A;  3VRA A;  3N9O A;  2EHO A;  3WHB A;  1JT6 A;  4PJN A;  4A5X A;  2J1D G;  5FY1 A;  5FKN A;  2XM2 A;  4BA9 A;  2E9X B;  4B3M T;  3UFE A;  2CXF A;  4B3S T;  3O1J A;  3PJA A;  2LJL A;  3AAA B;  2W63 A;  3TP3 A;  4HFB A;  2OA5 A;  2WDQ A;  4OFZ A;  2TRT A;  3L3P A;  5J1G A;  1ZHC A;  2FX0 A;  4W97 A;  4O8S A;  3PJA J;  2NP9 A;  3PUZ F;  1RKW A;  3FHN A;  3RRC A;  2K24 A;  5CQG A;  2I6H A;  4IE6 A;  3E7Q A;  4JL3 A;  3P4R A;  1D1C A;  2XGD A;  2SPC A;  3PUS A;  5J1Y A;  2HXI A;  2V7L A;  2W67 A;  1SE7 A;  5FNV E;  3RQU A;  2I10 A;  3R84 B;  1IJ5 A;  3Q5D A;  1G8X A;  4BJN A;  3CML A;  3HGY A;  1I6Z A;  3AVR A;  4J2C A;  1JUM A;  2NS7 A;  3UUX B;  2LHN A;  3LK2 B;  3FK6 A;  4GYR A;  4MAL A;  5LG3 A;  4I50 E;  3IA3 A;  4DR4 T;  3P7I A;  1YKE B;  2CWY A;  3RYC E;  1EZ3 A;  3HKD E;  2X9D A;  3GN5 B;  5CA0 E;  3ZYL A;  3BQZ A;  3LBX B;  2CRB A;  3H3A A;  3ZEF B;  3BTC A;  3CK6 A;  4JKZ A;  3D0T A;  4YSY A;  2WU2 A;  3JAE A;  4CI3 B;  2E9X D;  2C5K T;  2YVX A;  2X51 A;  3ONX A;  5K58 A;  2VVS A;  4IRV A;  2NR4 A;  4GIW A;  2E5L T;  4NUV A;  3RYF E;  5FP3 A;  4TWD A;  4NUU A;  2JQQ A;  3DTO A;  1E1H B;  5CGM A;  2XY8 B;  3UFG A;  1IZN B;  4H63 H;  2MTQ A;  4O2A E;  2IML A;  4WZX A;  3IH4 A;  3SFE A;  2DL1 A;  3QPS A;  5HYA A;  2ZOY A;  3TLW A;  5AQM B;  2VKO A;  2XB5 A;  2Y8D A;  2ZM0 A;  3RKO A;  2JQK A;  5FMP A;  5F3J A;  3E22 E;  5FKO A;  1VCS A;  4ICH A;  4DR6 T;  1FEW A;  3EI0 A;  3CX7 B;  2DHR A;  1HX1 B;  3LSJ A;  4EGW A;  4GKJ T;  3ANW A;  3LOC A;  3WI3 A;  4IDN A;  4U74 A;  4UF0 A;  3IHR A;  1T72 A;  3PDY A;  2E5V A;  2W53 A;  4E7Z A;  5C3J A;  2N2N A;  3BR3 A;  5AQS B;  4M3D A;  3AEG A;  3GWH A;  4AKI A;  4QH5 A;  4WYV A;  3RH3 A;  2V7I A;  5FXW A;  5JDN A;  5HEH A;  2LSG A;  5HAX A;  2X68 A;  2Y31 A;  3NRY A;  2NOX A;  1RPW A;  3QKX A;  2CWO A;  4QH4 A;  5JH7 E;  3L09 A;  4X1E A;  3K8P C;  4L0R A;  4ADZ A;  1UI6 A;  3P50 A;  2Z6E A;  2GUH A;  1ZK8 A;  2KMF A;  5IP6 A;  5LB7 B;  3FXE B;  3A7M A;  5GPA A;  3KV6 A;  2W61 A;  3RIU C;  2WP9 A;  3VOX A;  4ZI3 C;  2B76 A;  2PG8 A;  4XK4 A;  3ZQL A;  4U2Z A;  3RIU A;  4FJO A;  2VQE T;  4WNK A;  1YKH B;  2UXP A;  2V5D A;  1D1A A;  4HKU A;  1WRD A;  1QVT A;  3FBL A;  4HFD A;  3V5S A;  1G73 A;  3HI2 A;  3T8O A;  2G3B A;  3N2G E;  4AIU A;  2DI4 A;  2MYS A;  2KWH A;  5IOY A;  3IH2 A;  4ILB A;  1L0V A;  2R7V A;  5LCY A;  2K48 A;  3ON4 A;  5LHG B;  3O4X E;  3EAB A;  1YQ4 A;  3P4P A;  5F0H A;  2XQ9 A;  3MA9 A;  3UT5 E;  4WW0 A;  3FIW A;  2XQ8 A;  2YOE A;  2UXD T;  2N1G A;  4QXB B;  3N9L A;  5LOV E;  1ZV4 X;  4YJ3 E;  4O4L E;  4H9P C;  3IUV A;  2YU2 A;  4AQG A;  3MVP A;  3NPI A;  4PNI A;  2XJ7 A;  4YTM A;  2ZM6 T;  3DCF A;  4AQY T;  4NXN T;  1LVK A;  4CZZ B;  3F0C A;  3F2E A;  4YSX A;  1HG5 A;  5ETW A;  3AE6 A;  1SHZ C;  4WIB A;  2BVL A;  2WZH A;  5ABF A;  5AQP B;  5D18 A;  5K7H A;  3BTI A;  3JAD A;  1E2A A;  5GP9 A;  3VKG A;  1UGO A;  5JR9 C;  1M62 A;  3ANW B;  3PUX F;  2YIN A;  1JNR A;  3ETU A;  5LJM A;  4JI0 T;  5FL1 A;  5JR9 A;  5HEG A;  4UF0 B;  2CXD A;  2I0M A;  3PUW F;  3TLT A;  3JC6 D;  1UX5 A;  3HR0 A;  4YZE A;  2F07 A;  4AQF C;  2H88 A;  5H6R B;  2J4G A;  2IAK A;  2DWG A;  4A98 A;  4CI2 B;  3ETV A;  1IBK T;  3OKQ A;  2IU5 A;  4KUM B;  2FUP A;  4AQF A;  3EUH A;  4XAX B;  4ZS3 A;  4ZI2 C;  2LE8 A;  4PK4 A;  3PUY F;  3CIR A;  2M67 A;  3HGG A;  2UXU A;  4BJM A;  2LRL A;  3ZLI A;  3TLV A;  3U3I A;  3T1H T;  2EH3 A;  2ODU A;  3SFI A;  2V6Y A;  3BTJ A;  3ZKR A;  3H37 A;  5FXX A;  4B3T T;  2UU9 T;  2XZE A;  3COL A;  4LFA T;  2GK9 A;  2B1E A;  5IOZ A;  2RP4 A;  4OYJ A;  4ME9 A;  2C5I T;  3M3Z B;  3K3Q C;  1Y64 B;  3K1S A;  3MKD A;  2WGB A;  3MXZ A;  1NWM X;  3LDQ B;  2P9B A;  2X0L B;  5JRC A;  2D5U A;  5C4Y A;  3W15 B;  3TLS A;  4GKK T;  2XPV A;  4B1R A;  5H9T A;  4LF8 T;  3B6A A;  2IUB A;  5IUX A;  4I55 E;  5LG4 A;  4NXM T;  1NAF A;  5FVL A;  4WBN E;  5JVD E;  2X9Y A;  5CJ5 A;  1UK5 A;  5HEO A;  3NNR A;  2XQ3 A;  2FJB A;  2V57 A;  2VAS A;  1IBL T;  3H3M A;  1S35 A;  3WHC A;  2WWU A;  4YHH T;  3C4W A;  2RPA A;  2Y30 A;  2WMN A;  5AQO B;  3OVU A;  1J5W A;  3PM1 A;  3RHW A;  2IIU A;  2PTF A;  1A6I A;  2R6G F;  3P9T A;  3PU3 A;  2F4V T;  3AE3 A;  5FVK A;  3UTK A;  1YXR A;  4PK5 A;  2NW9 A;  2BS4 A;  2NWB A;  3ZSS A;  5HEU A;  1VI0 A;  3GA8 A;  2KXP B;  5CXI A;  2FJ1 A;  2LKH A;  2E2A A;  5ADX L;  4PJL A;  5FGL A;  4FI5 A;  2BKP A;  3X1D A;  5ABH A;  4QXH B;  5ABF B;  2ZMA A;  2XQ5 A;  3KKC A;  5LHI B;  2V7M A;  2XQ4 A;  4TWF A;  2HPJ A;  2V7K A;  4X65 T;  1XMQ T;  3B5M A;  4O4J E;  1UCU A;  3EDV A;  2FBW A;  1FMV A;  3VTI A;  1VRB A;  2OLT A;  3U78 A;  1H7C A;  5JR9 B;  4D7N A;  1R8I A;  5AQJ B;  2OER A;  3ONJ A;  1QPI A;  4U2Y A;  4DBR A;  4HWH A;  3DEW A;  1W0A A;  4CI1 B;  5JTG A;  1IAP A;  4M1P A;  2CM0 A;  3LHQ A;  4X1I E;  3E08 A;  3KZ9 A;  2LM2 A;  2WU5 A;  2GFN A;  2O7O A;  4GK5 E;  3QB5 A;  4GK0 E;  2QYW A;  3CRJ A;  5L3E B;  3FZK B;  4ILU A;  5AQV B;  5KDM C;  2DG7 A;  3UU3 A;  3DU6 A;  1JTY A;  3C4X A;  3SS1 A;  3G06 A;  2HH7 A;  3UUM A;  5E0O A;  2V6Y B;  5JQG E;  1ORK A;  4UVC B;  1XMO T;  4AF5 A;  4DR5 T;  3AVS A;  2BS2 A;  2R7O A;  4JNN A;  4PFO A;  1FIO A;  2M6B A;  2R7U A;  1US7 B;  5EZY E;  4D5C A;  4H9R C;  3FRQ A;  1HS7 A;  2X6O A;  3PUQ A;  1WYC A;  3VUQ A;  2ZCX A;  3C4Z A;  4DV6 T;  5JRC B;  4GCT A;  4JYK A;  3VU7 H;  5FY0 A;  3BCG A;  3AA6 B;  3ZCJ A;  4HFV A;  4IT4 A;  4UV8 B;  4JYA T;  3BHQ A;  3JSJ A;  5J1U A;  2KLQ A;  4U7I A;  2HXO A;  2BKN A;  3VR9 A;  3UU6 A;  3IEE A;  3GEU A;  3UU5 A;  3EDU A;  4LMK A;  2UXO A;  4LF6 T;  3BJB A;  4C90 A;  3AEA A;  4GOU A;  3BK9 A;  3KVB A;  5LP6 E;  2XGC A;  2J62 A;  2JRK A;  4M3G A;  1MMG A;  2L3L A;  2JJ7 A;  1WCR A;  4AIS A;  5F1J A;  5L3G B;  4DR1 T;  1LVF A;  3FZH B;  5FXV A;  4X62 T;  3O9X A;  4TWH A;  4HEA A;  2PJQ A;  5AQT B;  3AE4 A;  2JK3 A;  4IHJ E;  2W0G A;  4D7M A;  3E0Z A;  4ZOL E;  4IRE A;  1KNZ A;  4YT0 A;  4CXY A;  1HNW T;  1N32 T;  4AXP A;  4UVA B;  2GBY A;  1T8B A;  5C2T A;  4CGR A;  4UIG A;  2CA5 A;  2XAF B;  2VUR A;  4ILC A;  1Z0X A;  4QXC B;  3BR0 A;  3N9N A;  3QPL A;  3HTA A;  2HQ5 A;  2D6Y A;  2JPF A;  4UDS A;  5K7F A;  2K3W A;  2XPK A;  4H9O C;  3F31 A;  2L9Q A;  3CQG B;  5LJN A;  3KBU A;  3PUR A;  3Q3S A;  4DW6 A;  5HBU A;  5HXE A;  4HWI B;  4JUY A;  4UEL A;  4DVD A;  2X66 A; 
#chains in the Genus database with same CATH homology
 2W61 A;  4AI6 A;  4IE0 A;  2D0U A;  1LKX A;  4ZI3 C;  2PG8 A;  3N9Q A;  5FYM A;  2YK0 A;  2RA1 A;  2LSK A;  5KMG P;  2CCQ A;  1O3X A;  2DNX A;  4FJO A;  4HE8 A;  5JDG A;  1HX8 A;  4WNK A;  1YKH B;  5JDH A;  2ACX A;  2VB6 A;  1D1A A;  1OWA A;  4PFP A;  2XQY A;  3ZMV B;  3RC8 A;  2R7Q A;  1WRD A;  4YFS A;  3KBT A;  3FBL A;  3QK6 A;  2H7V C;  4GYS A;  5LGN B;  3AA0 B;  3V5S A;  1G73 A;  2VKJ A;  3HI2 A;  2Q9Q B;  3T8O A;  4IIJ E;  3PTR B;  2ZLY A;  3N2G E;  2DI4 A;  2MYS A;  2KWH A;  1AJ3 A;  5JRE A;  2CLY C;  2R7V A;  2Y48 B;  5LCY A;  3WAK A;  2LSI A;  2K48 A;  5DQW A;  3J9X 1;  4ASK A;  5LHG B;  2NTX A;  3OYX A;  3NZP A;  3O4X E;  4OYK A;  2CE7 A;  4PK6 A;  4TX5 A;  4XBF B;  4L5G A;  2B3W A;  2VK9 A;  3MA9 A;  3PUA A;  5DQV A;  3UT5 E;  4WW0 A;  5C8Y E;  3MK7 C;  4IE7 A;  3LJC A;  1MIW A;  2DWK A;  3R6N A;  2VKD A;  2WSS V;  3AAE B;  4EXT A;  1MND A;  4MLK A;  2E9X C;  4YLH A;  2N1G A;  3ZC0 A;  1VOM A;  3SWH A;  4QXB B;  2FJI 1;  5AFU L;  3VHL A;  3N9L A;  2VKH A;  5LOV E;  5FXZ A;  1ZV4 X;  3CPZ A;  3QUJ A;  4YJ3 E;  5LBM A;  2E9X A;  4O4L E;  4Z8X A;  5LHH B;  4H9P C;  4ANJ A;  2YU2 A;  4DMV A;  2VL8 A;  4AQG A;  3WAJ A;  3ZMZ B;  3I9W A;  2WAU A;  4JEH B;  4PNI A;  3TKL B;  2BZB A;  2KT9 A;  2ZM8 A;  1LVK A;  4HN9 A;  2DCF A;  2EHO B;  4CZZ B;  3FXD B;  3F2E A;  1HG5 A;  5ETW A;  3KV5 A;  2IC6 A;  4KMC A;  1SHZ C;  4AKL A;  2BVL A;  2ZM2 A;  4DND A;  3PUG A;  2KWI B;  4ZI2 D;  3IF8 B;  4KP3 C;  4PAG A;  2YEV C;  4DVY P;  1HFA A;  1ZKE A;  3EVY A;  4UXN B;  3UUN A;  4TV9 E;  4ZI3 D;  2KZ7 B;  5BMV E;  4QWN B;  4AKR B;  3VKG A;  4A56 A;  5JR9 C;  4QX7 B;  3HKC E;  4YJ2 E;  3ANW B;  1MIY A;  2YIN A;  3C64 A;  4BAY B;  3ETU A;  4YHJ A;  5EK3 A;  5LJM A;  1BR0 A;  2LEH A;  3O1I A;  2K5B B;  4G63 A;  2A2F X;  3CQC B;  5JR9 A;  3NBX X;  2CXD A;  4UF0 B;  5CA1 E;  3CKD A;  4P09 A;  2ODV A;  3ZCI A;  4OD5 A;  2X67 A;  3JC6 D;  2C5J A;  1UX5 A;  2G0U A;  2H3R A;  1HF8 A;  3AAI A;  3HR0 A;  4X20 E;  2MBG A;  2Q9Q D;  3P8C D;  5JDM A;  4AQF C;  5H6R B;  2IAK A;  3GMI A;  2DWG A;  4N78 D;  3ZC1 A;  4CI2 B;  3ETV A;  3DU5 A;  3K3O A;  3HKB E;  2E8I A;  3OBV E;  3OKQ A;  4KUM B;  4AQF A;  2JMK A;  3N2K E;  3LK3 B;  5TAO A;  2K9A A;  3EUH A;  3KV4 A;  4I4T E;  4XAX B;  1MMN A;  4ZS3 A;  5L3F B;  1D1B A;  4ZI2 C;  2R7W A;  2LE8 A;  2H7O A;  4OD4 A;  4K0U A;  3HA4 A;  3OYZ A;  4PK4 A;  3ZJ1 A;  2M67 A;  4H9N C;  3RYI E;  3GN5 A;  2QA7 A;  5J2U E;  2LM9 A;  1HCI A;  3C51 A;  4DBQ A;  4BJM A;  3LBX A;  1YW0 A;  3ZLI A;  3U3I A;  4UEM A;  5GON E;  2XAQ B;  2ODU A;  4O4I E;  4EYY R;  3LG7 A;  3H37 A;  5FXX A;  1MIV A;  5L3B B;  3FB2 A;  4JLE A;  3UUL A;  1QUU A;  3DP7 A;  4DMW A;  2GK9 A;  2B1E A;  3JC6 C;  4WBO A;  2RP4 A;  3ZMU B;  3I1A A;  2Q9Q C;  3V5U A;  2R7S A;  4OYJ A;  3NS4 A;  2C5I T;  3KFW X;  3K3Q C;  1D0Y A;  1Y64 B;  4H9Q C;  3ZPO A;  4AKH A;  2Q9Q A;  3MKD A;  2EHO D;  1BR2 A;  3RX6 A;  1QSD A;  1LRZ A;  3MXZ A;  1NWM X;  1BR1 A;  3A5X A;  4CQI A;  2P9B A;  2XAJ B;  3RYH E;  3NRX A;  2X0L B;  5JRC A;  3Q2M A;  1Z0P A;  2C0S A;  2D5U A;  3NZQ A;  3FBZ A;  3W15 B;  4CXW A;  2D0T A;  2A3D A;  5HXS A;  2I59 A;  4ERR A;  4U72 A;  2HPL A;  4MFR A;  4ISS A;  4EZ4 A;  5EK2 A;  3I9Y A;  1KNZ A;  1T98 A;  2JMH A;  3N9P A;  2A72 A;  2Y6X A;  2IW5 B;  3ZN1 B;  4P0A A;  4I55 E;  5LG4 A;  4C2M A;  1NAF A;  2CLY B;  3MJX A;  4WBN E;  4UVB B;  2XAH B;  5JVD E;  2KIN B;  2X9Y A;  5J2T E;  3AB3 B;  2PBI A;  2XTL A;  2EHO C;  3K3N A;  4IGU A;  3RPU A;  3KVA A;  4HTE A;  2QGS A;  2X9W A;  3B57 A;  2VAS A;  3N9O A;  2EHO A;  1B7T A;  1S35 A;  2WWU A;  3C4W A;  3O1H A;  3LK4 2;  4PJN A;  2LT3 A;  2WMN A;  5M4Y A;  5LBQ B;  2J1D G;  3SOL A;  4L9I A;  5FY1 A;  2WM9 A;  4BA9 A;  2E9X B;  4QHO A;  3UFE A;  2CXF A;  4IDZ A;  2R7R A;  3PU3 A;  3UTK A;  4PK5 A;  3O1J A;  5H6Q B;  2NW9 A;  2LJL A;  2NWB A;  3CX6 B;  3AAA B;  3KDS E;  5DJQ C;  2W63 A;  4IST A;  3GA8 A;  2KXP B;  5LA6 E;  4XZC A;  2OA5 A;  4OFZ A;  5J1G A;  3L3P A;  1ZHC A;  4OK0 A;  4PJL A;  5ADX L;  4O8S A;  3KYL A;  4FI5 A;  4TZ4 C;  2NP9 A;  1D0X A;  1WYB A;  3N2O A;  4QXH B;  3FHN A;  2ZMA A;  3RRC A;  2K24 A;  4OHF A;  5LHI B;  2V7M A;  5CQG A;  1WLX A;  2HPJ A;  2V7K A;  4IE6 A;  1U5P A;  4O4J E;  5HXH A;  1UCU A;  3EDV A;  1X79 A;  4MBQ A;  1D1C A;  2SPC A;  1FMV A;  3PUS A;  3VTI A;  2IC9 A;  1VRB A;  2R7X A;  3U78 A;  1H7C A;  3MAC A;  3OJA A;  1YD8 G;  2V7L A;  5JR9 B;  5LXT E;  1FMW A;  5FNV E;  5F8P A;  5LNK A;  3R84 B;  1IJ5 A;  3ZMS B;  1G8X A;  4TN7 B;  4BJN A;  4ZHQ E;  4CI1 B;  4DBR A;  4DO0 A;  1IAP A;  3CML A;  3ZN0 B;  4M1P A;  2CM0 A;  1UX4 A;  3AVR A;  4J2C A;  3F57 A;  5HWY A;  2NW8 A;  5L3D B;  3UUX B;  4X1I E;  2LHN A;  3E08 A;  3LK2 B;  4GYR A;  3RRW A;  4MAL A;  4C91 A;  4I50 E;  2KND A;  3P7I A;  1YKE B;  2R7T A;  2CWY A;  4GK5 E;  3RYC E;  5L3C B;  4F6R C;  4GK0 E;  3LFM A;  2BDE A;  3I0O A;  5L3E B;  3KV9 A;  1EZ3 A;  4ILU A;  3HKD E;  5KDM C;  2BVM A;  4EZH A;  3GN5 B;  3DU6 A;  4TUY E;  4QX8 B;  3C4X A;  3SS1 A;  5CA0 E;  3ZYL A;  3PE0 A;  5LGU B;  3LBX B;  4V1A v;  2UXN B;  2HH7 A;  3H3A A;  3ZEF B;  3UUM A;  1HS7 A;  4MHC A;  5E0O A;  5JQG E;  1HG2 A;  3D0T A;  2X9H A;  3ZYM A;  2CXL A;  4CI3 B;  4UVC B;  1SA0 E;  2E9X D;  2LSY A;  5IYZ E;  2C5K T;  3AVS A;  1WR6 A;  2X51 A;  5HXR A;  2R7O A;  3ONX A;  3B13 A;  4PJM A;  4IRV A;  4PFO A;  1FIO A;  2LHR A;  3M65 A;  4GIW A;  3CX8 B;  3VKH A;  2R7U A;  4NUV A;  1US7 B;  5EZY E;  5FP3 A;  3RYF E;  2JJ9 A;  1HTJ F;  2VWA A;  4H9R C;  4NUU A;  5JDF A;  2JQQ A;  1KK7 A;  1E1H B;  3AA7 B;  3DTO A;  3ZMT B;  1IJ6 A;  3PUQ A;  3Q5X A;  1WYC A;  2X9X A;  4AKG A;  1IZN B;  4X1K E;  4H63 H;  2MTQ A;  4O2A E;  3S4U A;  3C4Z A;  2WMO A;  4I43 B;  1D0Z A;  3BQI A;  5JRC B;  3ESL A;  1MMA A;  3VU7 H;  5FY0 A;  2LOS A;  4E7S A;  5HYA A;  5KX5 E;  5HXC A;  2VKO A;  3AA6 B;  5CB4 E;  2Y8D A;  2ZM0 A;  3ZCJ A;  4HFV A;  5JDL A;  3RKO A;  3QC9 A;  4UV8 B;  5F3J A;  3E22 E;  3HL6 A;  2PFV A;  2CMR A;  5EK4 A;  4QKN A;  2UXX B;  2MOZ A;  1FEW A;  1MNE A;  2L8K A;  4X1Y E;  4ZI7 E;  2XAS B;  2KLQ A;  1U4Q A;  3DJB A;  3CX7 B;  2W00 A;  2WBL A;  1V9D A;  3IEE A;  2DHR A;  2NTY A;  4UV9 B;  2XHE B;  4ZS2 A;  4EYU A;  3AA1 B;  3EDU A;  3N5L A;  4EOZ B;  3CVR A;  5FY7 A;  4C90 A;  3ANW A;  4GOU A;  3WI3 A;  1S94 A;  3BK9 A;  3KVB A;  4U74 A;  1CUN A;  4HGA A;  5LP6 E;  4UF0 A;  2YU1 A;  2JRK A;  3IHR A;  3SRZ A;  2V26 A;  1MMG A;  2L3L A;  2DLR A;  2ES0 A;  3PDY A;  5L3G B;  3J7Y q;  1LVF A;  5FXV A;  4E7Z A;  3CQX C;  3O9X A;  4EB6 E;  2NW7 A;  4HEA A;  2PJQ A;  4EAH A;  3RC3 A;  2N2N A;  2LSJ A;  4IHJ E;  3ZYK A;  2W0G A;  4IE4 A;  4G2A A;  3IBP A;  3GWH A;  5A1L A;  4AKI A;  3E0Z A;  3I0Q A;  5IHY A;  2D2S A;  4ZOL E;  2V1D B;  3RH3 A;  2XAG B;  3KIN B;  2V7I A;  4H9S E;  1OXZ A;  2N9D A;  4HKA A;  5FXW A;  4CXY A;  3BQK A;  5HWX A;  5JDN A;  1BR4 A;  4AXP A;  3Q5W A;  5JDQ A;  2LSG A;  4UVA B;  4P0B A;  5HAX A;  5LGT B;  2XUE A;  2X68 A;  5DAB A;  3BQL A;  2CA5 A;  4UIG A;  2XAF B;  3MZK B;  2LOP A;  5LYJ E;  3PU8 A;  3NRY A;  2NOX A;  3HKE E;  4H63 V;  4QXC B;  2V7J A;  3Q9D A;  2CWO A;  3N9N A;  5JH7 E;  4IE5 A;  3L09 A;  4PW8 A;  2JPF A;  4EIW A;  3C50 A;  4JEU B;  1ZEE A;  2W62 A;  2CEA A;  3CWZ B;  4B6X A;  3K8P C;  4H9O C;  1MMD A;  4L0R A;  3F31 A;  2L9Q A;  3CQG B;  3N9M A;  5FMN A;  4ADZ A;  5LJN A;  2Z6E A;  4CXX A;  2KMF A;  3KBU A;  3PUR A;  4O2B E;  4PJJ A;  3C98 B;  5HXE A;  4TV8 E;  3ZJ2 A;  4JUY A;  4O4H E;  4UEL A;  3FXE B;  4DVD A;  4KBM B;  2X66 A;  3KV6 A;  5L2L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...