3K8PC

Structural basis for vesicle tethering by the dsl1 complex
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
352
structure length
295
Chain Sequence
NIYTTLKFESMMQQRVIQIRSIPEEEYHELVSVQPIQVSVFVQSAAKVFTEFEQGCDTIGRSKVESIYLYKFNLLQTAFFAMVSEKVNDWTQLYKDVRYLYTENPKLLQLMELNSRRLDLNLNLIKKTIYKLVNDQLQELKDNERTPDWDITISSLLPYLKKTALPTLYKLEDNTILVALIRYIVHDLVIDNILHWRVISEKSSENLSEFIMLLLSGLEIPRLNLIETYRHSREKLGILSKILTAHLKDILEMFYEGEFFLFETDEIVQWIILLFADTPTRRDCIDEIRRVREEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A structure-based mechanism for vesicle capture by the multisubunit tethering complex Dsl1.
pubmed doi rcsb
source organism Kluyveromyces lactis
molecule tags Transport protein/transport protein
molecule keywords Dsl1
total genus 112
structure length 295
sequence length 352
ec nomenclature
pdb deposition date 2009-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF11989 Dsl1_C Retrograde transport protein Dsl1 C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.150 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor; domain 2 3k8pC02
1.20.58.1440 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3k8pC01
3K8PC
chains in the Genus database with same CATH superfamily
3AAAB 1OWAA 4AF5A 4L62A 5JDLA 3RD3A 3BTCA 2CPTA 4COFA 2JMKA 2FBWA 4IE5A 3F2EA 3Q2MA 3BT9A 4U9NA 3T1HT 3ZT5A 5J3LA 2V7LA 5AQMB 3P8CD 2PTFA 2P9BA 4H63V 2BKNA 5ABFA 2WMOA 5DQVA 4MFRA 5IWAT 3LSJA 4DW6A 5JDFA 4M1PA 5FXXA 1N34T 2LSJA 4PJLA 2FBQA 4NPPA 2XRLA 3BTIA 1JT6A 4QH1A 3CWRA 4CXWA 4ILBA 4QXHB 4E7ZA 4BJMA 3F57A 3RH2A 4IIJE 3UU8A 4YXDA 5LB7B 5K58A 5LYJE 2IMLA 2LSKA 4EGWA 4JI3T 4HTEA 2YINA 2NP5A 5HXSA 4AC6A 4F6RC 4CI2B 3N9LA 4GKKT 2KMFA 4M3FA 2CE7A 4YHJA 1QVTA 5FKNA 2X67A 3RIUA 3ZCJA 3RIAA 2R7RA 2CM0A 2LSGA 2WU5A 5FXWA 1UCUA 3RYCE 2XPVA 2DWGA 2CWYA 3L3PA 4JYKA 4HWIB 1T56A 5JR9C 3RYIE 4XAXB 3OYXA 4IT4A 3J7Yq 3KDSE 3NZPA 1MIVA 2X9HA 5EYRA 3A7MA 2D9DA 2OERA 4X20E 2UU9T 2CXFA 1FEWA 3WHCA 1OEDC 4YFSA 5C8YE 3QB5A 3EDUA 5EZGA 2YN6A 5GP9A 4U7YA 3NXCA 3EHZA 5FHPA 4CN4A 4DR7T 3PU3A 1HNXT 2GUHA 2J47A 2YVHA 3HL6A 3DU5A 3BQZA 4O4JE 3ANGA 5ABEA 2XQ5A 3K1SA 1Z77A 2UXHA 3IA3A 2I59A 3ETUA 2NP3A 5ABHA 3TLSA 3SS1A 4V2FA 5FXZA 5FXVA 3HIMA 2KSRA 4LFCT 2LOSA 3AB3B 1EZ3A 2OF7A 3J9X1 2XPKA 4NN1A 1KK7A 4UV8B 5LHHB 1D1AA 5LGUB 4KBMB 1UUSA 3VU7H 4U9LA 3MK7C 3ZEFB 2D5UA 5CXGA 1KNZA 1I94T 2F4VT 2L9QA 3VW2A 1MIWA 2HQ5A 3PUGA 3N9MA 1UGOA 5IP6A 3AXJB 3AXJA 2MBGA 2HPJA 5M4YA 3Q0VA 2XQ9A 3VHLA 2BG9E 1HCIA 2YK0A 5ABGA 1T72A 3F0CA 1UURA 4I50E 1BJZA 1JT0A 2IBDA 2ES0A 2GENA 2V5CA 4I43B 2BDEA 3FZFB 5LG3A 3G06A 4UF0B 3MVPA 3N2KE 4UF0A 3IHRA 3VOKA 4PW8A 2XDNA 3DP7A 2WGBA 5AQKB 5LHGB 3BQYA 2JRKA 2PZ9A 2ZMAA 3U78A 2E9XC 3BQLA 1S94A 3A8YC 4TWFA 4DV7T 4JI0T 3I1AA 4WYVA 3E22E 4IE0A 4U3CA 3PJAA 3P4WA 3PUYF 3N9QA 2UXNB 5AQPB 2X9XA 4EIWA 4WNKA 5FGLA 5LCYA 3UUXB 3AEAA 1SUMB 2ODVA 4LMJA 3BQKA 4GK0E 4CI3B 4CGRA 5K7HA 2ZCMA 1QLBA 2M67A 5IOZA 5L3GB 3KKDA 2N1GA 4HFIA 3SFDA 2VKJA 2VKVA 4HFBA 3KZ9A 3JC6D 5ABFB 4TNWA 3AQTA 1SHZC 3O1IA 3G1LA 1LKXA 4DVDA 5EZYE 4U2YA 5HCMA 2V8SV 4GOUA 3O1JA 3CK6A 2MAWA 2XQ7A 4PFOA 5HEHA 4DV5T 3RKGA 1E1HB 3COLA 4HGAA 1WR6A 4KX6A 1YQ4A 2R6GF 4UXNB 4C91A 5HXCA 4EYUA 2VL8A 3S4UA 4EV6A 1Z0XA 2LKHA 5K7FA 5DABA 1DU2A 4TUYE 1HR0T 4I0UA 5L4EA 2WWUA 2G7GA 2O7TA 3ZQFA 3R84B 2BS4A 3IH4A 4EZHA 3AE8A 3HKBE 4TX5A 1ZEEA 2LM9A 1Y64B 4YZEA 3H3AA 3MZKB 4IDNA 2XQAA 3VUQA 2YKSA 5IUXA 4F8HA 2GFNA 1KF6A 2N9DA 4ISTA 3RYHE 2DHRA 3GA8A 2I0MA 2YDQA 1NWMX 3VR9A 2I10A 4DUZT 1XNRT 3NBXX 4HE8A 2HHHT 3PUQA 5FNVE 4UVBB 2REKA 1BR4A 2R7OA 3UQ4A 4AKGA 1ZKEA 3C07A 4JI7T 5CXIA 3RHWA 1HX8A 3EAMA 1IBMT 2R7SA 1E7PA 2MYSA 1XZYA 4EOZB 5HEGA 2G3BA 1T98A 2KWHA 4PNIA 3ANWB 1IBLT 3N9OA 4DV2T 4P1NA 3AEFA 3Q3SA 2G0UA 4CI1B 2CLYB 4X62T 3K8PC 2XPWA 4X66T 1CUNA 2V6XA 4QH4A 3VOXA 1X9BA 4GCKA 5J0ZA 5GPCA 4WIBA 2WCAA 4DIDB 3HTHA 2DG8A 2YDRA 1T8BA 2XGCA 5FKOA 2LRLA 2XQ4A 4EXTA 2E9XB 2XM1A 2JQQA 4X5TA 5EK4A 4TWDA 4J2CA 4ZXLA 2WDRA 5IHYA 5L3BB 3BR0A 2XAJB 4AXPA 2M6IA 3B6AA 4D7NA 3BTLA 4EEDA 3AA0B 4PJMA 3C2BA 5EK3A 3IBPA 3DEWA 3U3IA 2Y8DA 3RRWA 2FJBA 2ZM2A 2MTQA 2V57A 3VR8A 5C3JA 3ZYMA 4O4HE 3AE7A 1D0ZA 3AVRA 5FVKA 2FQ4A 4TWHA 1RPWA 2WZIA 3SFEA 2C5IT 3NRYA 4QX8B 4ZOLE 2XQ8A 4NUUA 2E5LT 2E9XD 3ZMVB 2XAFB 3G1OA 1CHUA 3Q5XA 1J5ET 5FMPA 2FJI1 4WZXA 5AQNB 3N2OA 3C50A 3CPZA 2RPAA 4LF7T 4JNNA 2EHOD 2PFVA 3ANPA 2UUCT 2IUBA 2DG7A 5EFYA 3QPSA 2H88A 1HFAA 4MK6A 3ZC0A 2V26A 5BR8T 5LG4A 1IJ5A 3RLFF 2QGSA 3AEEA 3JAFA 5HXRA 5AQLB 1XDOA 2KINB 4IGUA 4AISA 3ZN1B 4DR2T 3JC6C 4ERRA 5F3JA 2CXLA 2GK9A 4ICHA 2FD5A 2JMHA 4DBQA 4ISSA 5DJQC 4XBFB 4UVCB 2DL1A 4U31A 2YVXA 3QOFA 3EABA 4DBRA 5JDHA 5KX5E 5IYZE 4P09A 5JDMA 1JNZA 2LSYA 4KWAA 3AAIA 3IUVA 2CHNA 3BQIA 5HEUA 1XMOT 4AC0A 1X79A 3AE9A 4NXMT 3KV4A 3ON4A 4IE6A 5JDQA 3RPUA 4DR1T 2X6OA 1GQEA 1VCSA 2BKPA 4AQYT 1MMGA 4QWNB 3ZJ2A 5FY1A 4YTMA 4LF5T 3KKCA 5HWXA 4LF6T 1IBKT 2ZM0A 4QX7B 1RKWA 1LRZA 3LJCA 4PAGA 4GCTA 3B57A 2IAIA 4B3AA 5CQGA 3BRUA 3QPLA 3C51A 4OK0A 4ILUA 4YJ2E 4MO7A 1HG2A 1WYCA 3P4QA 4LFBT 1BR0A 3HKDE 2NR4A 5D1RA 2HYTA 4WBOA 2LKGA 4HWCA 2ZM6T 1UK5A 5K7ZA 2W66A 2UXDT 1SA0E 1FIOA 2W4XA 4V1Av 3VVYA 5KXJA 1WLXA 4ABZA 5CB4E 3TKLB 3OVUA 3CX7B 3SWHA 3F1BA 4LF4T 2H7VC 5LGNB 2KT9A 4XK4A 2BKOA 2YOEA 2PJQA 3IF8B 4ADZA 3F31A 4B3ST 4ME9A 2DNXA 2ZOYA 3NKZA 5F1JA 2XAGB 2VL0A 1LVFA 2QA7A 4YSZA 2WV1A 1VCTA 2RASA 5FL0A 2ZCNA 5FY0A 3N5LA 3ZMUB 3VVZA 5F0FA 4HFCA 4IDPA 2C5KT 3AA6B 5C2TA 3L09A 3LHQA 3P7IA 3RRCA 2K24A 4HFDA 5JR9A 3AVSA 2H89A 2V7JA 2BVMA 1OEDE 2JPFA 4DMVA 4JI6T 1MMNA 4GKJT 3HTAA 4O2BE 5HWYA 1OXZA 2H7OA 4HFHA 4JLEA 3FZKB 2BBHA 3LK2B 3KBUA 5HSZA 3L39A 2DLRA 3NRGA 4UEMA 2UXCT 2KWIB 2W61A 3DCFA 1QUUA 3UULA 4LFAT 2A9UA 1HG5A 4DV6T 5GONE 5GPAA 2VB6A 3C4ZA 3Q0WA 4DV1T 4JV5T 3AE6A 3ZMZB 2LE8A 3PM1A 3OTOT 1MNEA 5LP6E 2EHOB 3GN5A 2R7WA 2WSSV 2RP4A 3QBMA 4EYYR 3EUPA 1UI5A 3VRAA 5J2UE 2W53A 1O3XA 3BTJA 4DR6T 2LRKA 3P50A 3RC3A 3ZMTB 2OA5A 5F5WA 3ZCIA 4IREA 1U5PA 3GMIA 3JCFA 2ODUA 2VVSA 1US7B 5JREA 1D1CA 2XTLA 3P9TA 3BR2A 3ONXA 1SE7A 1T7SA 4KUMB 3AE4A 4IE7A 4XZCA 1ORKA 4H9SE 3UUNA 3KVBA 2J4GA 4TV8E 1NAFA 4IDZA 5FP3A 3SDGA 2XSBA 2XZEA 3FBZA 2VVNA 2YU2A 4X1KE 5AQUB 3PUVF 4JKZA 3EGQA 4GYRA 3LJLA 1HTJF 1MMAA 4ZI2C 3BR6A 3KV5A 4NELA 1MMDA 3UU6A 4D7MA 2EH3A 2VQET 4A56A 3TP0A 3LBXA 4B3MT 4AKIA 3EDVA 1M7KA 2IIUA 2A2FX 4JI4T 2UXPA 4JEUB 3OBVE 4JL3A 2KLQA 3VRBA 5AQTB 3BK9A 4JI2T 3K3QC 4QHOA 3ANWA 3PUAA 5D19A 5L3EB 3CX8B 5LMNT 1HX1B 2LOPA 5LGTB 3FRQA 3CRJA 1LVKA 1AJ3A 3UFGA 1XWMA 4MBQA 3MKDA 4B3RT 2LSIA 4JBWF 4YLHA 4OFZA 3O4XE 3CQGB 2H3RA 3K3NA 3HE0A 4HWFA 2L3LA 2WM9A 4AKRB 1BR1A 4PK4A 4I6ZA 3O1HA 1N36T 2PBIA 2HXIA 5JH7E 5LMUT 4W1UA 2JK3A 4DO0A 3AECA 2Q24A 2Q9QB 2O7OA 1W09A 3FB2A 2XQ6A 4I55E 3R6NA 4JI1T 2V7MA 4DNDA 2WUIA 3ZQGA 5TAOA 3TLUA 5FKLA 2VK9A 3ZLIA 3T8OA 3QK6A 4CN6A 4O8SA 3AA7B 3MACA 5F8PA 4L0RA 3UT5E 4K0KT 2M6BA 1KNPA 3SRZA 2WQYA 5L3DB 3RC8A 4QXBB 3FXEB 2Y6XA 3Q5DA 4IDQA 1Y01A 3V6GA 2IAKA 3TP3A 2BG9A 3PUXF 5CA0E 2K3WA 3VKHA 2HH7A 2ACZA 4YT0A 4JYAT 1D1BA 3ETVA 5F27A 3FZHB 1N32T 2IU5A 5J1RA 2VPRA 4P0BA 2C5JA 5FKYA 4BJNA 3KV6A 3Q5WA 3CCYA 2WP9A 1J1JA 2W2UA 2X0LB 3O8GA 4HWDA 4HFVA 3DU6A 2YU1A 4KHPT 4YJ3E 4MXMA 5A1LA 3RF1A 3PE0A 4UV9B 2QWTA 5L47A 1S35A 3LK42 2V7IA 2JQ9A 2BZBA 2X9YA 3CQCB 2V6YB 4O4IE 4UDSA 5EZHA 5LXTE 4DR3T 2XUEA 3H3MA 1HS7A 2YDSA 2CRBA 2MPKA 2QOPA 2DI4A 3C64A 3LK3B 3VW1A 3E7QA 5AQRB 3C98B 4PXIA 2KZ7B 2B1EA 2DTZA 3UFEA 1L0VA 3CDLA 2XQ3A 4G63A 2QRXA 4YSYA 5HBUA 2SPCA 3WI3A 3NZQA 3BHQA 5FKMA 4ILCA 2A3DA 3K3OA 3FZLB 1G8XA 4X65T 4W97A 4NIQA 4IE4A 2Y48B 4IRVA 5HAXA 4ASKA 4I4TE 1IAPA 5AQIB 4OYJA 4QXCB 2CMRA 5KDMC 5AQVB 4HKUA 2EHOA 2NP9A 2JIWA 2KXPB 5HEJA 3B81A 5AFUL 3AEBA 4GIWA 3AEGA 4JEHB 1JTXA 2WB5A 3M3ZB 3RYFE 2W00A 4BAYB 3UUMA 1QVUA 1E2AA 3DTOA 3I0QA 4OX9T 2Q9QD 3W15B 4HN9A 3NRXA 1ZOYA 3PPBA 3QKXA 2FUPA 3HTIA 2D2SA 5LJMA 5D18A 2LM2A 3CJDA 4GFLA 2FX0A 3ABVA 3NNRA 5CA1E 2X0YA 5FY7A 1V9DA 4L5GA 2YVEA 3HTJA 3IEEA 5AQSB 1M62A 5FMNA 5J1YA 3MA9A 1JUPA 3I0OA 4GYSA 3PJAJ 2AE9A 4HWHA 1MNDA 1VI0A 5LBQB 4H9RC 2NW9A 2Y30A 5EK2A 4HEAA 2XAQB 3MNLA 4B6XA 3KVAA 4O4LE 3BCGA 2XB5A 5IPAA 3I9YA 5FVLA 3BR3A 4FJOA 2NTXA 3QB5K 5CW8A 5JDNA 2JJ7A 5FL1A 3QQAA 2E5VA 2Z6EA 3Q5EA 3UTKA 3O9XA 4MLKA 4ZZCA 5JDGA 1XNQT 3OYZA 4Z8XA 2XGEA 3N2GE 1FJGT 2NX4A 5AQJB 2LEHA 1YQ3A 2I6HA 2A72A 3WAJA 3FK7A 3AE3A 2R7UA 1YW0A 2RA1A 1R8IA 2F07A 2VQFT 3NI7A 3ONJA 3PUSA 5HEOA 3ZYLA 2XY8B 2NS7A 3CKDA 4OYKA 5JVDE 4JI8T 4TZ4C 4JI5T 1FMVA 3RH3A 3LSPA 4LF8T 4YTNA 2XGDA 3AE1A 1YD8G 2TRTA 4PFPA 2WZHA 2LLYA 2HN2A 2CBJA 2VURA 3EUHA 5JR9B 2IC6A 2W62A 5J1GA 2XQYA 1HNZT 2VWAA 1Z0PA 2JJ9A 1KEYA 1D0XA 3V5SA 2JQHA 3LSRA 3VW0A 5IOYA 4ACIA 2UXUA 3RIUC 4EZ4A 3N9NA 4EEBA 3B13A 4N78D 4V2GA 3KBTA 3G56A 2VKOA 4AKLA 3CMLA 3Q9DA 2CEAA 4U7IA 5H6RB 2KNDA 5JTGA 5CJ5A 1U9OA 3CQXC 4AKHA 2IDOB 4OHFA 1ZP0A 3ZQIA 1Z8UA 3UQ7A 5LNKA 1XMQT 4NXNT 4U2ZA 4G2AA 2ZOZA 1RKTA 2NW8A 4D5FA 3PTRB 4KMCA 3FZMB 2FJAA 3MJXA 4FI5A 3JADA 4CN1A 3OJAA 3HKEE 2E2AA 2HKUA 4PJJA 5CGMA 4AQFC 2CA5A 3AEDA 4C90A 3VTIA 3PUZF 1NENA 3SOLA 3O60A 4ZEYA 4CQIA 2VKDA 3FXDB 4EB6E 2G7LA 3UU3A 1HF8A 3VIBA 3PU8A 4KI0F 4QKNA 1B7TA 4PJNA 4ZHQE 2V7KA 4D5CA 3S5RA 4M3BA 3HGGA 2LHRA 4DR5T 3AAEB 4UR9A 2LHNA 4A97A 4TV9E 5FKKA 2MOZA 3AQSA 1UX4A 5HAWA 5KMGP 2VKEA 1ZV4X 2UXIA 2XM2A 4K0UA 3RI5A 3G7RA 5L3CB 4NUVA 4C2MA 4BA9A 4GK5E 1ZKGA 5J2TE 3LWJA 2ZM8A 2XSAA 3I9WA 4ZI3D 3NS4A 2ACXA 3HR0A 4Z90A 3EVYA 3JSJA 3G1MA 5ETWA 4X1EA 1OEDB 2LT3A 4EAHA 5HCJA 4TN7B 1XDPA 3PUWF 2RAEA 3ZT6A 3ZSTA 2HXOA 4HKAA 5ADXL 3H37A 2IEKA 5AQHB 3T1YT 4KP3C 2ZB9A 4GFKA 1ZHCA 4DVYP 3UU5A 2WU2A 1NEKA 4ZI7E 2CBIA 2Q9QA 3ZQLA 4DV4T 5L3FB 3AE5A 2OV9A 2WDVA 1UI6A 2BS3A 4X1YE 1KNRA 4X1IE 3ZC1A 1W9RA 4JUYA 3T6NA 3KFWX 2W67A 1H7CA 4PK5A 4U74A 3NWIA 1WCRA 3VKGA 3DPJA 4ZI2D 2E9XA 2QKOA 4A98A 2WWVA 4H9PC 1UX5A 5FYMA 3V5UA 2NS8A 3L8RA 2TCTA 2G0EA 2J62A 5DAJA 2WAUA 4B1RA 2WBLA 4PK6A 1YKHB 4IL4A 3A5XA 1U4QA 3CX6B 3CWZB 4ZS3A 3QUJA 3M65A 4CXXA 2GBYA 4A5XA 2K5BB 3BJBA 5JQGE 2W63A 5E0OA 3RIFA 3O8HA 1N33T 1YKEB 4YHHT 3C4XA 5F04A 2E8IA 2UXXB 3D0TA 4H63H 2QVAA 3ZPOA 2UXOA 3AA1B 1IJ6A 5L2LA 3WHBA 1JNRA 4IDOA 2WDQA 1HNWT 5BMVE 3PASA 3GWHA 4U33A 5LHIB 2G7SA 1D0YA 2FJDA 3ZT7A 1IZNB 3C4WA 5CFBA 2VKHA 1WFDA 4DV0T 3AE2A 2VASA 2V5DA 3VPRA 4B3TT 2YEVC 1WR0A 3IH2A 2K48A 2Y2ZA 3ZQHA 4H9OC 4OD4A 2BS2A 4TNVA 5H6QB 5HXEA 3P4SA 3DJBA 3FBLA 5AQFB 3HKCE 5J1UA 4LMLA 4ZS2A 3RQUA 2DWKA 3IH3A 5F0HA 4M3EA 2V6YA 4ANJA 5H9TA 3NVOA 2QYWA 3ZJ1A 1JUMA 2D0UA 2JQKA 2OI8A 1W0BA 1G73A 2CXDA 2UXBT 3BNIA 3V78A 1BR2A 3LFMA 2V1DB 4YSXA 1QPIA 3Q0UA 4U72A 2BG9C 2DCFA 2IHR1 5LJNA 2B3WA 5F0CA 3RX6A 2PG8A 3TLWA 2QCOA 2IC9A 3E08A 2XPUA 2D0TA 2XAHB 3B6CA 2CHOA 3JAEA 2D6YA 4WW0A 3KINB 2XJ7A 1VOMA 5C4YA 4G12A 3HA4A 3B5MA 4IL9A 2R7QA 3OPCA 2K9AA 3KYLA 2WY2A 2OPTA 2NOXA 1KFYA 2C0SA 4OD5A 2HYJA 2X66A 5HXHA 3GN5B 3FHNA 3RQWA 3ZYKA 5F08A 3KNWA 3N9PA 3CIRA 1I6ZA 3NPIA 4H9QC 4CZZB 2X9DA 5LA6E 4GCLA 3PURA 4X64T 2B76A 3ZN0B 4MALA 3RGLA 3P4PA 2FJEA 1W0AA 1VRBA 2L8KA 5AQCA 3VVXA 3MXZA 2ZCXA 3CVRA 3WAKA 4LF9T 3ONLC 3GZIA 3X1DA 4AUXA 4ZZBA 4Z91A 2QIBA 3TLTA 4Q25A 5LBMA 3LG7A 2Y31A 4WBNE 4P0AA 2IW5B 3ESLA 4UELA 5AQQB 2N2NA 3HGYA 4DV3T 2J1DG 2CLYC 3KV9A 3UUBA 1T33A 2W0GA 4L9IA 4ZI3C 1OEDA 2NTYA 5L4HA 5DQWA 3LBXB 1WRDA 4DUYT 2WS3A 2RHAA 4ILAA 4M3GA 5HYAA 3LDQB 2R7TA 3ZSSA 3ZMSB 2X68A 3BR1A 3LOCA 2R7XA 4HFEA 4UIGA 4E7SA 4CXYA 4H9NC 2WMNA 2Q9QC 1SGMA 4AI6A 2CCQA 2X0HA 3BR5A 3ON2A 1WYBA 3P4RA 3VP5A 4DR4T 3UU4A 3FIWA 3HI2A 4M3DA 4YTPA 4UVAB 5AQOB 3PV0F 4DMWA 5JRCB 4O2AE 3QNUA 1YXRA 5JRCA 3ZKRA 2UUBT 1JTYA 2OLTA 2NWBA 2EHOC 5LOVE 2ID6A 3SFIA 3LSVA 2R7VA 1MIYA 2BBJA 5AQGB 3QC9A 4KHZF 1A6IA 4QH5A 2QTQA 2LJLA 1FMWA 2XASB 2ZLYA 1J5WA 2BG9B 2NW7A 3E0ZA 2UUAT 2X51A 3RKOA 1U9NA 1QSDA 2HN1A 4MHCA 3PDYA 2FJ1A 3TLVA 1ZK8A 4I76A 4AQGA 3EI0A 3GEUA 4LMKA 3OKQA 2PBXA 2X9WA 2ZY9A 2ID3A 2AXDS 2CWOA 4AQFA 4IHJE 2BVLA 1JUSA 4YY3T 3FK6A 2XHEB 2HPLA 4AIUA
chains in the Genus database with same CATH topology
3AAAB 2LSIA 1OWAA 4YLHA 4OFZA 3O4XE 4CQIA 2VKDA 5JDLA 3CQGB 2H3RA 3FXDB 3K3NA 4EB6E 2JMKA 4IE5A 3F2EA 1HF8A 3Q2MA 3PU8A 2L3LA 2WM9A 4QKNA 1B7TA 4PJNA 4AKRB 1BR1A 4PK4A 4ZHQE 2V7KA 3O1HA 2PBIA 2V7LA 3P8CD 2LHRA 2P9BA 5JH7E 4H63V 4EXTA 2E9XB 4DO0A 3AAEB 2JQQA 2LHNA 2WMOA 2Q9QB 3FB2A 5DQVA 5EK4A 4J2CA 4TV9E 4I55E 5IHYA 2MOZA 4MFRA 3R6NA 1UX4A 5L3BB 5KMGP 1ZV4X 2V7MA 4DNDA 5JDFA 2XAJB 4K0UA 5TAOA 4M1PA 5L3CB 5FXXA 2VK9A 4AXPA 2LSJA 3ZLIA 4NUVA 4C2MA 4PJLA 3T8OA 4BA9A 3QK6A 4O8SA 3AA7B 3MACA 4GK5E 5F8PA 3AA0B 4CXWA 5J2TE 4L0RA 3UT5E 4QXHB 4E7ZA 2ZM8A 4PJMA 3I9WA 4BJMA 4ZI3D 3F57A 3SRZA 5L3DB 3NS4A 2ACXA 3HR0A 5EK3A 3RC8A 4IIJE 3EVYA 3IBPA 3U3IA 2Y8DA 4QXBB 5ETWA 3FXEB 3RRWA 2Y6XA 2LT3A 4EAHA 5LYJE 2IAKA 2ZM2A 2MTQA 2LSKA 3ZYMA 4TN7B 4O4HE 5CA0E 1D0ZA 3VKHA 3AVRA 2HH7A 4HTEA 2YINA 5HXSA 4F6RC 1D1BA 3ETVA 4CI2B 3N9LA 2C5IT 4HKAA 2KMFA 3NRYA 5ADXL 3H37A 2CE7A 4QX8B 4P0BA 2C5JA 4YHJA 4BJNA 4ZOLE 4NUUA 4KP3C 1ZHCA 3KV6A 2E9XD 3Q5WA 3ZMVB 4DVYP 2XAFB 3Q5XA 2X67A 4ZI7E 2X0LB 3ZCJA 2R7RA 4HFVA 2FJI1 3DU6A 2CM0A 2LSGA 2Q9QA 2YU1A 4YJ3E 5FXWA 3N2OA 3C50A 5L3FB 1UCUA 3RYCE 3CPZA 3PE0A 5A1LA 4UV9B 2DWGA 2CWYA 1S35A 3L3PA 3LK42 2V7IA 2EHOD 2PFVA 5JR9C 4X1YE 2BZBA 2X9YA 3CQCB 4XAXB 3RYIE 4X1IE 4O4IE 1HFAA 3ZC1A 3OYXA 3ZC0A 2V26A 3J7Yq 5LG4A 3KDSE 1IJ5A 3NZPA 4JUYA 5LXTE 1MIVA 2X9HA 2XUEA 3KFWX 2QGSA 1HS7A 1H7CA 4PK5A 4U74A 2DI4A 3C64A 4X20E 3LK3B 3VKGA 5HXRA 4ZI2D 2E9XA 3C98B 2CXFA 2KINB 1FEWA 3MKDA 4IGUA 3ZN1B 2KZ7B 2B1EA 4H9PC 1UX5A 3JC6C 5FYMA 4ERRA 3UFEA 3V5UA 2CXLA 5F3JA 4YFSA 2GK9A 4G63A 5C8YE 2WAUA 2WBLA 2JMHA 3EDUA 4DBQA 2SPCA 3WI3A 4PK6A 4ISSA 5DJQC 1YKHB 3NZQA 4XBFB 3A5XA 1U4QA 3CX6B 3CWZB 4UVCB 4ZS3A 3QUJA 3M65A 2A3DA 3PU3A 4CXXA 3K3OA 1G8XA 2K5BB 4DBRA 5JQGE 5JDHA 5KX5E 2W63A 4IE4A 5IYZE 2Y48B 5E0OA 4P09A 4IRVA 5HAXA 3HL6A 3DU5A 4I4TE 4ASKA 1IAPA 1YKEB 4O4JE 3C4XA 5JDMA 2E8IA 4OYJA 4QXCB 2UXXB 2CMRA 5KDMC 2LSYA 3D0TA 4H63H 3ZPOA 2I59A 3AA1B 2EHOA 1IJ6A 3AAIA 3ETUA 5L2LA 3BQIA 2NP9A 2KXPB 3SS1A 5AFUL 5BMVE 5FXZA 4GIWA 3GWHA 4JEHB 1X79A 5FXVA 5LHIB 1D0YA 3RYFE 2W00A 3KV4A 3C4WA 1IZNB 4BAYB 2LOSA 2VKHA 3AB3B 3UUMA 1EZ3A 3J9X1 4IE6A 5JDQA 3RPUA 2VASA 3DTOA 1KK7A 2YEVC 3I0QA 1D1AA 4UV8B 5LHHB 5LGUB 2Q9QD 1MMGA 2K48A 4KBMB 4QWNB 3W15B 4HN9A 3ZJ2A 3VU7H 5FY1A 3NRXA 3MK7C 3ZEFB 4H9OC 5HWXA 4OD4A 2D5UA 2D2SA 2ZM0A 5H6QB 4QX7B 5HXEA 5LJMA 1KNZA 3DJBA 3FBLA 2L9QA 1MIWA 1LRZA 3HKCE 3PUGA 3LJCA 3N9MA 4PAGA 4ZS2A 3B57A 2DWKA 2MBGA 2HPJA 5M4YA 3VHLA 5CQGA 1HCIA 2YK0A 4ANJA 3ZJ1A 2D0UA 5CA1E 3C51A 4OK0A 5FY7A 4ILUA 1V9DA 1HG2A 1WYCA 1G73A 4I50E 2CXDA 4L5GA 4YJ2E 1BR0A 3HKDE 1BR2A 3IEEA 3LFMA 2ES0A 2V1DB 4WBOA 4I43B 2BDEA 5FMNA 4U72A 3MA9A 3N2KE 2DCFA 1SA0E 4UF0B 4UF0A 5LJNA 2B3WA 1FIOA 3I0OA 4GYSA 4V1Av 3RX6A 2PG8A 1WLXA 3IHRA 5CB4E 3TKLB 3CX7B 4PW8A 3SWHA 1MNDA 2H7VC 2IC9A 2KT9A 3DP7A 3E08A 2D0TA 5LGNB 5LBQB 4H9RC 2XAHB 2NW9A 2PJQA 5LHGB 3IF8B 4ADZA 3F31A 4WW0A 3KINB 5EK2A 4HEAA 2JRKA 2DNXA 1VOMA 2XAQB 2ZMAA 4B6XA 3U78A 3HA4A 3KVAA 2E9XC 4O4LE 3BQLA 2R7QA 1S94A 2XAGB 3I1AA 1LVFA 3E22E 4IE0A 2K9AA 2QA7A 3KYLA 3I9YA 2NOXA 2C0SA 4OD5A 2X66A 4FJOA 3N5LA 5FY0A 5HXHA 3ZMUB 2NTXA 3N9QA 3GN5B 2UXNB 5JDNA 2C5KT 2X9XA 4EIWA 3FHNA 3AA6B 4WNKA 3L09A 3RRCA 3P7IA 2K24A 3ZYKA 5LCYA 3UUXB 2Z6EA 2ODVA 5JR9A 3BQKA 3N9PA 3UTKA 4GK0E 4CI3B 3O9XA 3AVSA 4H9QC 4MLKA 5JDGA 4CZZB 2V7JA 5LA6E 3OYZA 4Z8XA 3N2GE 2BVMA 3PURA 2M67A 2JPFA 4DMVA 5L3GB 3ZN0B 2LEHA 4MALA 1MMNA 2N1GA 4O2BE 5HWYA 1OXZA 2H7OA 2VKJA 4JLEA 2A72A 3WAJA 3JC6D 1VRBA 2L8KA 2R7UA 1SHZC 3MXZA 3O1IA 3LK2B 1LKXA 1YW0A 3CVRA 3KBUA 2RA1A 4DVDA 2DLRA 4UEMA 3WAKA 5EZYE 2KWIB 2W61A 4GOUA 3O1JA 3PUSA 1QUUA 3UULA 4PFOA 3ZYLA 3CKDA 1E1HB 4OYKA 1HG5A 3LG7A 4TZ4C 5JVDE 5LBMA 4WBNE 4P0AA 4HGAA 2IW5B 5GONE 3ESLA 2VB6A 1FMVA 4UELA 2N2NA 3C4ZA 3RH3A 2J1DG 1WR6A 2CLYC 3KV9A 2W0GA 4L9IA 4UXNB 4ZI3C 3ZMZB 4C91A 2LE8A 5HXCA 4EYUA 2VL8A 3S4UA 1MNEA 1YD8G 5LP6E 2NTYA 2EHOB 3GN5A 4PFPA 2R7WA 5DABA 2WSSV 5DQWA 3LBXB 2RP4A 1WRDA 4TUYE 4EYYR 2WWUA 3EUHA 5J2UE 1O3XA 5JR9B 5HYAA 2R7TA 3ZMSB 2IC6A 2X68A 2W62A 5J1GA 3R84B 2XQYA 4EZHA 2R7XA 2VWAA 3RC3A 4UIGA 3ZMTB 2OA5A 4E7SA 3HKBE 4CXYA 1Z0PA 2JJ9A 3ZCIA 4TX5A 4H9NC 1ZEEA 1D0XA 1U5PA 1Y64B 2LM9A 2Q9QC 2WMNA 3GMIA 3V5SA 3H3AA 2ODUA 4AI6A 2CCQA 1US7B 3SOLA 1WYBA 5JREA 3MZKB 1D1CA 4EZ4A 3N9NA 2XTLA 3HI2A 3ONXA 3B13A 4UVAB 4KUMB 4N78D 4DMWA 5JRCB 4O2AE 5JRCA 2N9DA 4ISTA 2DHRA 3GA8A 3KBTA 4IE7A 4XZCA 3RYHE 2VKOA 4AKLA 3CMLA 1NWMX 4H9SE 3Q9DA 2CEAA 3UUNA 2NWBA 5H6RB 2KNDA 3KVBA 3NBXX 4TV8E 2EHOC 5LOVE 4HE8A 2R7VA 1NAFA 3PUQA 3CQXC 4IDZA 5FP3A 4AKHA 5FNVE 3FBZA 1MIYA 2YU2A 4X1KE 4UVBB 1BR4A 4OHFA 2R7OA 3QC9A 4AKGA 1ZKEA 5LNKA 4GYRA 1HTJF 1MMAA 4ZI2C 1HX8A 1FMWA 2LJLA 2XASB 3KV5A 1MMDA 2R7SA 2ZLYA 4A56A 4G2AA 2NW7A 3LBXA 4AKIA 3E0ZA 3EDVA 2MYSA 2NW8A 2X51A 3RKOA 2A2FX 1QSDA 3PTRB 4EOZB 4JEUB 4KMCA 3OBVE 2KLQA 3MJXA 1T98A 2KWHA 4PNIA 3BK9A 4FI5A 4MHCA 3ANWB 3K3QC 3PDYA 4QHOA 3ANWA 3PUAA 5L3EB 3CX8B 3N9OA 3OJAA 4AQGA 3HKEE 2LOPA 5LGTB 4PJJA 3OKQA 2X9WA 4AQFC 2G0UA 4CI1B 2CA5A 2CWOA 4AQFA 4IHJE 4C90A 1LVKA 2CLYB 1AJ3A 3VTIA 3K8PC 2BVLA 2HPLA 2XHEB 4MBQA 1CUNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K8P C; 
#chains in the Genus database with same CATH topology
 3AAA B;  1OWA A;  4AF5 A;  4L62 A;  5JDL A;  3RD3 A;  3BTC A;  2CPT A;  4COF A;  2JMK A;  2FBW A;  4IE5 A;  3F2E A;  3Q2M A;  3BT9 A;  4U9N A;  3T1H T;  3ZT5 A;  5J3L A;  2V7L A;  5AQM B;  3P8C D;  2PTF A;  2P9B A;  4H63 V;  2BKN A;  5ABF A;  2WMO A;  5DQV A;  4MFR A;  5IWA T;  3LSJ A;  4DW6 A;  5JDF A;  4M1P A;  5FXX A;  1N34 T;  2LSJ A;  4PJL A;  2FBQ A;  4NPP A;  2XRL A;  3BTI A;  1JT6 A;  4QH1 A;  3CWR A;  4CXW A;  4ILB A;  4QXH B;  4E7Z A;  4BJM A;  3F57 A;  3RH2 A;  4IIJ E;  3UU8 A;  4YXD A;  5LB7 B;  5K58 A;  5LYJ E;  2IML A;  2LSK A;  4EGW A;  4JI3 T;  4HTE A;  2YIN A;  2NP5 A;  5HXS A;  4AC6 A;  4F6R C;  4CI2 B;  3N9L A;  4GKK T;  2KMF A;  4M3F A;  2CE7 A;  4YHJ A;  1QVT A;  5FKN A;  2X67 A;  3RIU A;  3ZCJ A;  3RIA A;  2R7R A;  2CM0 A;  2LSG A;  2WU5 A;  5FXW A;  1UCU A;  3RYC E;  2XPV A;  2DWG A;  2CWY A;  3L3P A;  4JYK A;  4HWI B;  1T56 A;  5JR9 C;  3RYI E;  4XAX B;  3OYX A;  4IT4 A;  3J7Y q;  3KDS E;  3NZP A;  1MIV A;  2X9H A;  5EYR A;  3A7M A;  2D9D A;  2OER A;  4X20 E;  2UU9 T;  2CXF A;  1FEW A;  3WHC A;  1OED C;  4YFS A;  5C8Y E;  3QB5 A;  3EDU A;  5EZG A;  2YN6 A;  5GP9 A;  4U7Y A;  3NXC A;  3EHZ A;  5FHP A;  4CN4 A;  4DR7 T;  3PU3 A;  1HNX T;  2GUH A;  2J47 A;  2YVH A;  3HL6 A;  3DU5 A;  3BQZ A;  4O4J E;  3ANG A;  5ABE A;  2XQ5 A;  3K1S A;  1Z77 A;  2UXH A;  3IA3 A;  2I59 A;  3ETU A;  2NP3 A;  5ABH A;  3TLS A;  3SS1 A;  4V2F A;  5FXZ A;  5FXV A;  3HIM A;  2KSR A;  4LFC T;  2LOS A;  3AB3 B;  1EZ3 A;  2OF7 A;  3J9X 1;  2XPK A;  4NN1 A;  1KK7 A;  4UV8 B;  5LHH B;  1D1A A;  5LGU B;  4KBM B;  1UUS A;  3VU7 H;  4U9L A;  3MK7 C;  3ZEF B;  2D5U A;  5CXG A;  1KNZ A;  1I94 T;  2F4V T;  2L9Q A;  3VW2 A;  1MIW A;  2HQ5 A;  3PUG A;  3N9M A;  1UGO A;  5IP6 A;  3AXJ B;  3AXJ A;  2MBG A;  2HPJ A;  5M4Y A;  3Q0V A;  2XQ9 A;  3VHL A;  2BG9 E;  1HCI A;  2YK0 A;  5ABG A;  1T72 A;  3F0C A;  1UUR A;  4I50 E;  1BJZ A;  1JT0 A;  2IBD A;  2ES0 A;  2GEN A;  2V5C A;  4I43 B;  2BDE A;  3FZF B;  5LG3 A;  3G06 A;  4UF0 B;  3MVP A;  3N2K E;  4UF0 A;  3IHR A;  3VOK A;  4PW8 A;  2XDN A;  3DP7 A;  2WGB A;  5AQK B;  5LHG B;  3BQY A;  2JRK A;  2PZ9 A;  2ZMA A;  3U78 A;  2E9X C;  3BQL A;  1S94 A;  3A8Y C;  4TWF A;  4DV7 T;  4JI0 T;  3I1A A;  4WYV A;  3E22 E;  4IE0 A;  4U3C A;  3PJA A;  3P4W A;  3PUY F;  3N9Q A;  2UXN B;  5AQP B;  2X9X A;  4EIW A;  4WNK A;  5FGL A;  5LCY A;  3UUX B;  3AEA A;  1SUM B;  2ODV A;  4LMJ A;  3BQK A;  4GK0 E;  4CI3 B;  4CGR A;  5K7H A;  2ZCM A;  1QLB A;  2M67 A;  5IOZ A;  5L3G B;  3KKD A;  2N1G A;  4HFI A;  3SFD A;  2VKJ A;  2VKV A;  4HFB A;  3KZ9 A;  3JC6 D;  5ABF B;  4TNW A;  3AQT A;  1SHZ C;  3O1I A;  3G1L A;  1LKX A;  4DVD A;  5EZY E;  4U2Y A;  5HCM A;  2V8S V;  4GOU A;  3O1J A;  3CK6 A;  2MAW A;  2XQ7 A;  4PFO A;  5HEH A;  4DV5 T;  3RKG A;  1E1H B;  3COL A;  4HGA A;  1WR6 A;  4KX6 A;  1YQ4 A;  2R6G F;  4UXN B;  4C91 A;  5HXC A;  4EYU A;  2VL8 A;  3S4U A;  4EV6 A;  1Z0X A;  2LKH A;  5K7F A;  5DAB A;  1DU2 A;  4TUY E;  1HR0 T;  4I0U A;  5L4E A;  2WWU A;  2G7G A;  2O7T A;  3ZQF A;  3R84 B;  2BS4 A;  3IH4 A;  4EZH A;  3AE8 A;  3HKB E;  4TX5 A;  1ZEE A;  2LM9 A;  1Y64 B;  4YZE A;  3H3A A;  3MZK B;  4IDN A;  2XQA A;  3VUQ A;  2YKS A;  5IUX A;  4F8H A;  2GFN A;  1KF6 A;  2N9D A;  4IST A;  3RYH E;  2DHR A;  3GA8 A;  2I0M A;  2YDQ A;  1NWM X;  3VR9 A;  2I10 A;  4DUZ T;  1XNR T;  3NBX X;  4HE8 A;  2HHH T;  3PUQ A;  5FNV E;  4UVB B;  2REK A;  1BR4 A;  2R7O A;  3UQ4 A;  4AKG A;  1ZKE A;  3C07 A;  4JI7 T;  5CXI A;  3RHW A;  1HX8 A;  3EAM A;  1IBM T;  2R7S A;  1E7P A;  2MYS A;  1XZY A;  4EOZ B;  5HEG A;  2G3B A;  1T98 A;  2KWH A;  4PNI A;  3ANW B;  1IBL T;  3N9O A;  4DV2 T;  4P1N A;  3AEF A;  3Q3S A;  2G0U A;  4CI1 B;  2CLY B;  4X62 T;  3K8P C;  2XPW A;  4X66 T;  1CUN A;  2V6X A;  4QH4 A;  3VOX A;  1X9B A;  4GCK A;  5J0Z A;  5GPC A;  4WIB A;  2WCA A;  4DID B;  3HTH A;  2DG8 A;  2YDR A;  1T8B A;  2XGC A;  5FKO A;  2LRL A;  2XQ4 A;  4EXT A;  2E9X B;  2XM1 A;  2JQQ A;  4X5T A;  5EK4 A;  4TWD A;  4J2C A;  4ZXL A;  2WDR A;  5IHY A;  5L3B B;  3BR0 A;  2XAJ B;  4AXP A;  2M6I A;  3B6A A;  4D7N A;  3BTL A;  4EED A;  3AA0 B;  4PJM A;  3C2B A;  5EK3 A;  3IBP A;  3DEW A;  3U3I A;  2Y8D A;  3RRW A;  2FJB A;  2ZM2 A;  2MTQ A;  2V57 A;  3VR8 A;  5C3J A;  3ZYM A;  4O4H E;  3AE7 A;  1D0Z A;  3AVR A;  5FVK A;  2FQ4 A;  4TWH A;  1RPW A;  2WZI A;  3SFE A;  2C5I T;  3NRY A;  4QX8 B;  4ZOL E;  2XQ8 A;  4NUU A;  2E5L T;  2E9X D;  3ZMV B;  2XAF B;  3G1O A;  1CHU A;  3Q5X A;  1J5E T;  5FMP A;  2FJI 1;  4WZX A;  5AQN B;  3N2O A;  3C50 A;  3CPZ A;  2RPA A;  4LF7 T;  4JNN A;  2EHO D;  2PFV A;  3ANP A;  2UUC T;  2IUB A;  2DG7 A;  5EFY A;  3QPS A;  2H88 A;  1HFA A;  4MK6 A;  3ZC0 A;  2V26 A;  5BR8 T;  5LG4 A;  1IJ5 A;  3RLF F;  2QGS A;  3AEE A;  3JAF A;  5HXR A;  5AQL B;  1XDO A;  2KIN B;  4IGU A;  4AIS A;  3ZN1 B;  4DR2 T;  3JC6 C;  4ERR A;  5F3J A;  2CXL A;  2GK9 A;  4ICH A;  2FD5 A;  2JMH A;  4DBQ A;  4ISS A;  5DJQ C;  4XBF B;  4UVC B;  2DL1 A;  4U31 A;  2YVX A;  3QOF A;  3EAB A;  4DBR A;  5JDH A;  5KX5 E;  5IYZ E;  4P09 A;  5JDM A;  1JNZ A;  2LSY A;  4KWA A;  3AAI A;  3IUV A;  2CHN A;  3BQI A;  5HEU A;  1XMO T;  4AC0 A;  1X79 A;  3AE9 A;  4NXM T;  3KV4 A;  3ON4 A;  4IE6 A;  5JDQ A;  3RPU A;  4DR1 T;  2X6O A;  1GQE A;  1VCS A;  2BKP A;  4AQY T;  1MMG A;  4QWN B;  3ZJ2 A;  5FY1 A;  4YTM A;  4LF5 T;  3KKC A;  5HWX A;  4LF6 T;  1IBK T;  2ZM0 A;  4QX7 B;  1RKW A;  1LRZ A;  3LJC A;  4PAG A;  4GCT A;  3B57 A;  2IAI A;  4B3A A;  5CQG A;  3BRU A;  3QPL A;  3C51 A;  4OK0 A;  4ILU A;  4YJ2 E;  4MO7 A;  1HG2 A;  1WYC A;  3P4Q A;  4LFB T;  1BR0 A;  3HKD E;  2NR4 A;  5D1R A;  2HYT A;  4WBO A;  2LKG A;  4HWC A;  2ZM6 T;  1UK5 A;  5K7Z A;  2W66 A;  2UXD T;  1SA0 E;  1FIO A;  2W4X A;  4V1A v;  3VVY A;  5KXJ A;  1WLX A;  4ABZ A;  5CB4 E;  3TKL B;  3OVU A;  3CX7 B;  3SWH A;  3F1B A;  4LF4 T;  2H7V C;  5LGN B;  2KT9 A;  4XK4 A;  2BKO A;  2YOE A;  2PJQ A;  3IF8 B;  4ADZ A;  3F31 A;  4B3S T;  4ME9 A;  2DNX A;  2ZOY A;  3NKZ A;  5F1J A;  2XAG B;  2VL0 A;  1LVF A;  2QA7 A;  4YSZ A;  2WV1 A;  1VCT A;  2RAS A;  5FL0 A;  2ZCN A;  5FY0 A;  3N5L A;  3ZMU B;  3VVZ A;  5F0F A;  4HFC A;  4IDP A;  2C5K T;  3AA6 B;  5C2T A;  3L09 A;  3LHQ A;  3P7I A;  3RRC A;  2K24 A;  4HFD A;  5JR9 A;  3AVS A;  2H89 A;  2V7J A;  2BVM A;  1OED E;  2JPF A;  4DMV A;  4JI6 T;  1MMN A;  4GKJ T;  3HTA A;  4O2B E;  5HWY A;  1OXZ A;  2H7O A;  4HFH A;  4JLE A;  3FZK B;  2BBH A;  3LK2 B;  3KBU A;  5HSZ A;  3L39 A;  2DLR A;  3NRG A;  4UEM A;  2UXC T;  2KWI B;  2W61 A;  3DCF A;  1QUU A;  3UUL A;  4LFA T;  2A9U A;  1HG5 A;  4DV6 T;  5GON E;  5GPA A;  2VB6 A;  3C4Z A;  3Q0W A;  4DV1 T;  4JV5 T;  3AE6 A;  3ZMZ B;  2LE8 A;  3PM1 A;  3OTO T;  1MNE A;  5LP6 E;  2EHO B;  3GN5 A;  2R7W A;  2WSS V;  2RP4 A;  3QBM A;  4EYY R;  3EUP A;  1UI5 A;  3VRA A;  5J2U E;  2W53 A;  1O3X A;  3BTJ A;  4DR6 T;  2LRK A;  3P50 A;  3RC3 A;  3ZMT B;  2OA5 A;  5F5W A;  3ZCI A;  4IRE A;  1U5P A;  3GMI A;  3JCF A;  2ODU A;  2VVS A;  1US7 B;  5JRE A;  1D1C A;  2XTL A;  3P9T A;  3BR2 A;  3ONX A;  1SE7 A;  1T7S A;  4KUM B;  3AE4 A;  4IE7 A;  4XZC A;  1ORK A;  4H9S E;  3UUN A;  3KVB A;  2J4G A;  4TV8 E;  1NAF A;  4IDZ A;  5FP3 A;  3SDG A;  2XSB A;  2XZE A;  3FBZ A;  2VVN A;  2YU2 A;  4X1K E;  5AQU B;  3PUV F;  4JKZ A;  3EGQ A;  4GYR A;  3LJL A;  1HTJ F;  1MMA A;  4ZI2 C;  3BR6 A;  3KV5 A;  4NEL A;  1MMD A;  3UU6 A;  4D7M A;  2EH3 A;  2VQE T;  4A56 A;  3TP0 A;  3LBX A;  4B3M T;  4AKI A;  3EDV A;  1M7K A;  2IIU A;  2A2F X;  4JI4 T;  2UXP A;  4JEU B;  3OBV E;  4JL3 A;  2KLQ A;  3VRB A;  5AQT B;  3BK9 A;  4JI2 T;  3K3Q C;  4QHO A;  3ANW A;  3PUA A;  5D19 A;  5L3E B;  3CX8 B;  5LMN T;  1HX1 B;  2LOP A;  5LGT B;  3FRQ A;  3CRJ A;  1LVK A;  1AJ3 A;  3UFG A;  1XWM A;  4MBQ A;  3MKD A;  4B3R T;  2LSI A;  4JBW F;  4YLH A;  4OFZ A;  3O4X E;  3CQG B;  2H3R A;  3K3N A;  3HE0 A;  4HWF A;  2L3L A;  2WM9 A;  4AKR B;  1BR1 A;  4PK4 A;  4I6Z A;  3O1H A;  1N36 T;  2PBI A;  2HXI A;  5JH7 E;  5LMU T;  4W1U A;  2JK3 A;  4DO0 A;  3AEC A;  2Q24 A;  2Q9Q B;  2O7O A;  1W09 A;  3FB2 A;  2XQ6 A;  4I55 E;  3R6N A;  4JI1 T;  2V7M A;  4DND A;  2WUI A;  3ZQG A;  5TAO A;  3TLU A;  5FKL A;  2VK9 A;  3ZLI A;  3T8O A;  3QK6 A;  4CN6 A;  4O8S A;  3AA7 B;  3MAC A;  5F8P A;  4L0R A;  3UT5 E;  4K0K T;  2M6B A;  1KNP A;  3SRZ A;  2WQY A;  5L3D B;  3RC8 A;  4QXB B;  3FXE B;  2Y6X A;  3Q5D A;  4IDQ A;  1Y01 A;  3V6G A;  2IAK A;  3TP3 A;  2BG9 A;  3PUX F;  5CA0 E;  2K3W A;  3VKH A;  2HH7 A;  2ACZ A;  4YT0 A;  4JYA T;  1D1B A;  3ETV A;  5F27 A;  3FZH B;  1N32 T;  2IU5 A;  5J1R A;  2VPR A;  4P0B A;  2C5J A;  5FKY A;  4BJN A;  3KV6 A;  3Q5W A;  3CCY A;  2WP9 A;  1J1J A;  2W2U A;  2X0L B;  3O8G A;  4HWD A;  4HFV A;  3DU6 A;  2YU1 A;  4KHP T;  4YJ3 E;  4MXM A;  5A1L A;  3RF1 A;  3PE0 A;  4UV9 B;  2QWT A;  5L47 A;  1S35 A;  3LK4 2;  2V7I A;  2JQ9 A;  2BZB A;  2X9Y A;  3CQC B;  2V6Y B;  4O4I E;  4UDS A;  5EZH A;  5LXT E;  4DR3 T;  2XUE A;  3H3M A;  1HS7 A;  2YDS A;  2CRB A;  2MPK A;  2QOP A;  2DI4 A;  3C64 A;  3LK3 B;  3VW1 A;  3E7Q A;  5AQR B;  3C98 B;  4PXI A;  2KZ7 B;  2B1E A;  2DTZ A;  3UFE A;  1L0V A;  3CDL A;  2XQ3 A;  4G63 A;  2QRX A;  4YSY A;  5HBU A;  2SPC A;  3WI3 A;  3NZQ A;  3BHQ A;  5FKM A;  4ILC A;  2A3D A;  3K3O A;  3FZL B;  1G8X A;  4X65 T;  4W97 A;  4NIQ A;  4IE4 A;  2Y48 B;  4IRV A;  5HAX A;  4ASK A;  4I4T E;  1IAP A;  5AQI B;  4OYJ A;  4QXC B;  2CMR A;  5KDM C;  5AQV B;  4HKU A;  2EHO A;  2NP9 A;  2JIW A;  2KXP B;  5HEJ A;  3B81 A;  5AFU L;  3AEB A;  4GIW A;  3AEG A;  4JEH B;  1JTX A;  2WB5 A;  3M3Z B;  3RYF E;  2W00 A;  4BAY B;  3UUM A;  1QVU A;  1E2A A;  3DTO A;  3I0Q A;  4OX9 T;  2Q9Q D;  3W15 B;  4HN9 A;  3NRX A;  1ZOY A;  3PPB A;  3QKX A;  2FUP A;  3HTI A;  2D2S A;  5LJM A;  5D18 A;  2LM2 A;  3CJD A;  4GFL A;  2FX0 A;  3ABV A;  3NNR A;  5CA1 E;  2X0Y A;  5FY7 A;  1V9D A;  4L5G A;  2YVE A;  3HTJ A;  3IEE A;  5AQS B;  1M62 A;  5FMN A;  5J1Y A;  3MA9 A;  1JUP A;  3I0O A;  4GYS A;  3PJA J;  2AE9 A;  4HWH A;  1MND A;  1VI0 A;  5LBQ B;  4H9R C;  2NW9 A;  2Y30 A;  5EK2 A;  4HEA A;  2XAQ B;  3MNL A;  4B6X A;  3KVA A;  4O4L E;  3BCG A;  2XB5 A;  5IPA A;  3I9Y A;  5FVL A;  3BR3 A;  4FJO A;  2NTX A;  3QB5 K;  5CW8 A;  5JDN A;  2JJ7 A;  5FL1 A;  3QQA A;  2E5V A;  2Z6E A;  3Q5E A;  3UTK A;  3O9X A;  4MLK A;  4ZZC A;  5JDG A;  1XNQ T;  3OYZ A;  4Z8X A;  2XGE A;  3N2G E;  1FJG T;  2NX4 A;  5AQJ B;  2LEH A;  1YQ3 A;  2I6H A;  2A72 A;  3WAJ A;  3FK7 A;  3AE3 A;  2R7U A;  1YW0 A;  2RA1 A;  1R8I A;  2F07 A;  2VQF T;  3NI7 A;  3ONJ A;  3PUS A;  5HEO A;  3ZYL A;  2XY8 B;  2NS7 A;  3CKD A;  4OYK A;  5JVD E;  4JI8 T;  4TZ4 C;  4JI5 T;  1FMV A;  3RH3 A;  3LSP A;  4LF8 T;  4YTN A;  2XGD A;  3AE1 A;  1YD8 G;  2TRT A;  4PFP A;  2WZH A;  2LLY A;  2HN2 A;  2CBJ A;  2VUR A;  3EUH A;  5JR9 B;  2IC6 A;  2W62 A;  5J1G A;  2XQY A;  1HNZ T;  2VWA A;  1Z0P A;  2JJ9 A;  1KEY A;  1D0X A;  3V5S A;  2JQH A;  3LSR A;  3VW0 A;  5IOY A;  4ACI A;  2UXU A;  3RIU C;  4EZ4 A;  3N9N A;  4EEB A;  3B13 A;  4N78 D;  4V2G A;  3KBT A;  3G56 A;  2VKO A;  4AKL A;  3CML A;  3Q9D A;  2CEA A;  4U7I A;  5H6R B;  2KND A;  5JTG A;  5CJ5 A;  1U9O A;  3CQX C;  4AKH A;  2IDO B;  4OHF A;  1ZP0 A;  3ZQI A;  1Z8U A;  3UQ7 A;  5LNK A;  1XMQ T;  4NXN T;  4U2Z A;  4G2A A;  2ZOZ A;  1RKT A;  2NW8 A;  4D5F A;  3PTR B;  4KMC A;  3FZM B;  2FJA A;  3MJX A;  4FI5 A;  3JAD A;  4CN1 A;  3OJA A;  3HKE E;  2E2A A;  2HKU A;  4PJJ A;  5CGM A;  4AQF C;  2CA5 A;  3AED A;  4C90 A;  3VTI A;  3PUZ F;  1NEN A;  3SOL A;  3O60 A;  4ZEY A;  4CQI A;  2VKD A;  3FXD B;  4EB6 E;  2G7L A;  3UU3 A;  1HF8 A;  3VIB A;  3PU8 A;  4KI0 F;  4QKN A;  1B7T A;  4PJN A;  4ZHQ E;  2V7K A;  4D5C A;  3S5R A;  4M3B A;  3HGG A;  2LHR A;  4DR5 T;  3AAE B;  4UR9 A;  2LHN A;  4A97 A;  4TV9 E;  5FKK A;  2MOZ A;  3AQS A;  1UX4 A;  5HAW A;  5KMG P;  2VKE A;  1ZV4 X;  2UXI A;  2XM2 A;  4K0U A;  3RI5 A;  3G7R A;  5L3C B;  4NUV A;  4C2M A;  4BA9 A;  4GK5 E;  1ZKG A;  5J2T E;  3LWJ A;  2ZM8 A;  2XSA A;  3I9W A;  4ZI3 D;  3NS4 A;  2ACX A;  3HR0 A;  4Z90 A;  3EVY A;  3JSJ A;  3G1M A;  5ETW A;  4X1E A;  1OED B;  2LT3 A;  4EAH A;  5HCJ A;  4TN7 B;  1XDP A;  3PUW F;  2RAE A;  3ZT6 A;  3ZST A;  2HXO A;  4HKA A;  5ADX L;  3H37 A;  2IEK A;  5AQH B;  3T1Y T;  4KP3 C;  2ZB9 A;  4GFK A;  1ZHC A;  4DVY P;  3UU5 A;  2WU2 A;  1NEK A;  4ZI7 E;  2CBI A;  2Q9Q A;  3ZQL A;  4DV4 T;  5L3F B;  3AE5 A;  2OV9 A;  2WDV A;  1UI6 A;  2BS3 A;  4X1Y E;  1KNR A;  4X1I E;  3ZC1 A;  1W9R A;  4JUY A;  3T6N A;  3KFW X;  2W67 A;  1H7C A;  4PK5 A;  4U74 A;  3NWI A;  1WCR A;  3VKG A;  3DPJ A;  4ZI2 D;  2E9X A;  2QKO A;  4A98 A;  2WWV A;  4H9P C;  1UX5 A;  5FYM A;  3V5U A;  2NS8 A;  3L8R A;  2TCT A;  2G0E A;  2J62 A;  5DAJ A;  2WAU A;  4B1R A;  2WBL A;  4PK6 A;  1YKH B;  4IL4 A;  3A5X A;  1U4Q A;  3CX6 B;  3CWZ B;  4ZS3 A;  3QUJ A;  3M65 A;  4CXX A;  2GBY A;  4A5X A;  2K5B B;  3BJB A;  5JQG E;  2W63 A;  5E0O A;  3RIF A;  3O8H A;  1N33 T;  1YKE B;  4YHH T;  3C4X A;  5F04 A;  2E8I A;  2UXX B;  3D0T A;  4H63 H;  2QVA A;  3ZPO A;  2UXO A;  3AA1 B;  1IJ6 A;  5L2L A;  3WHB A;  1JNR A;  4IDO A;  2WDQ A;  1HNW T;  5BMV E;  3PAS A;  3GWH A;  4U33 A;  5LHI B;  2G7S A;  1D0Y A;  2FJD A;  3ZT7 A;  1IZN B;  3C4W A;  5CFB A;  2VKH A;  1WFD A;  4DV0 T;  3AE2 A;  2VAS A;  2V5D A;  3VPR A;  4B3T T;  2YEV C;  1WR0 A;  3IH2 A;  2K48 A;  2Y2Z A;  3ZQH A;  4H9O C;  4OD4 A;  2BS2 A;  4TNV A;  5H6Q B;  5HXE A;  3P4S A;  3DJB A;  3FBL A;  5AQF B;  3HKC E;  5J1U A;  4LML A;  4ZS2 A;  3RQU A;  2DWK A;  3IH3 A;  5F0H A;  4M3E A;  2V6Y A;  4ANJ A;  5H9T A;  3NVO A;  2QYW A;  3ZJ1 A;  1JUM A;  2D0U A;  2JQK A;  2OI8 A;  1W0B A;  1G73 A;  2CXD A;  2UXB T;  3BNI A;  3V78 A;  1BR2 A;  3LFM A;  2V1D B;  4YSX A;  1QPI A;  3Q0U A;  4U72 A;  2BG9 C;  2DCF A;  2IHR 1;  5LJN A;  2B3W A;  5F0C A;  3RX6 A;  2PG8 A;  3TLW A;  2QCO A;  2IC9 A;  3E08 A;  2XPU A;  2D0T A;  2XAH B;  3B6C A;  2CHO A;  3JAE A;  2D6Y A;  4WW0 A;  3KIN B;  2XJ7 A;  1VOM A;  5C4Y A;  4G12 A;  3HA4 A;  3B5M A;  4IL9 A;  2R7Q A;  3OPC A;  2K9A A;  3KYL A;  2WY2 A;  2OPT A;  2NOX A;  1KFY A;  2C0S A;  4OD5 A;  2HYJ A;  2X66 A;  5HXH A;  3GN5 B;  3FHN A;  3RQW A;  3ZYK A;  5F08 A;  3KNW A;  3N9P A;  3CIR A;  1I6Z A;  3NPI A;  4H9Q C;  4CZZ B;  2X9D A;  5LA6 E;  4GCL A;  3PUR A;  4X64 T;  2B76 A;  3ZN0 B;  4MAL A;  3RGL A;  3P4P A;  2FJE A;  1W0A A;  1VRB A;  2L8K A;  5AQC A;  3VVX A;  3MXZ A;  2ZCX A;  3CVR A;  3WAK A;  4LF9 T;  3ONL C;  3GZI A;  3X1D A;  4AUX A;  4ZZB A;  4Z91 A;  2QIB A;  3TLT A;  4Q25 A;  5LBM A;  3LG7 A;  2Y31 A;  4WBN E;  4P0A A;  2IW5 B;  3ESL A;  4UEL A;  5AQQ B;  2N2N A;  3HGY A;  4DV3 T;  2J1D G;  2CLY C;  3KV9 A;  3UUB A;  1T33 A;  2W0G A;  4L9I A;  4ZI3 C;  1OED A;  2NTY A;  5L4H A;  5DQW A;  3LBX B;  1WRD A;  4DUY T;  2WS3 A;  2RHA A;  4ILA A;  4M3G A;  5HYA A;  3LDQ B;  2R7T A;  3ZSS A;  3ZMS B;  2X68 A;  3BR1 A;  3LOC A;  2R7X A;  4HFE A;  4UIG A;  4E7S A;  4CXY A;  4H9N C;  2WMN A;  2Q9Q C;  1SGM A;  4AI6 A;  2CCQ A;  2X0H A;  3BR5 A;  3ON2 A;  1WYB A;  3P4R A;  3VP5 A;  4DR4 T;  3UU4 A;  3FIW A;  3HI2 A;  4M3D A;  4YTP A;  4UVA B;  5AQO B;  3PV0 F;  4DMW A;  5JRC B;  4O2A E;  3QNU A;  1YXR A;  5JRC A;  3ZKR A;  2UUB T;  1JTY A;  2OLT A;  2NWB A;  2EHO C;  5LOV E;  2ID6 A;  3SFI A;  3LSV A;  2R7V A;  1MIY A;  2BBJ A;  5AQG B;  3QC9 A;  4KHZ F;  1A6I A;  4QH5 A;  2QTQ A;  2LJL A;  1FMW A;  2XAS B;  2ZLY A;  1J5W A;  2BG9 B;  2NW7 A;  3E0Z A;  2UUA T;  2X51 A;  3RKO A;  1U9N A;  1QSD A;  2HN1 A;  4MHC A;  3PDY A;  2FJ1 A;  3TLV A;  1ZK8 A;  4I76 A;  4AQG A;  3EI0 A;  3GEU A;  4LMK A;  3OKQ A;  2PBX A;  2X9W A;  2ZY9 A;  2ID3 A;  2AXD S;  2CWO A;  4AQF A;  4IHJ E;  2BVL A;  1JUS A;  4YY3 T;  3FK6 A;  2XHE B;  2HPL A;  4AIU A; 
#chains in the Genus database with same CATH homology
 3AAA B;  2LSI A;  1OWA A;  4YLH A;  4OFZ A;  3O4X E;  4CQI A;  2VKD A;  5JDL A;  3CQG B;  2H3R A;  3FXD B;  3K3N A;  4EB6 E;  2JMK A;  4IE5 A;  3F2E A;  1HF8 A;  3Q2M A;  3PU8 A;  2L3L A;  2WM9 A;  4QKN A;  1B7T A;  4PJN A;  4AKR B;  1BR1 A;  4PK4 A;  4ZHQ E;  2V7K A;  3O1H A;  2PBI A;  2V7L A;  3P8C D;  2LHR A;  2P9B A;  5JH7 E;  4H63 V;  4EXT A;  2E9X B;  4DO0 A;  3AAE B;  2JQQ A;  2LHN A;  2WMO A;  2Q9Q B;  3FB2 A;  5DQV A;  5EK4 A;  4J2C A;  4TV9 E;  4I55 E;  5IHY A;  2MOZ A;  4MFR A;  3R6N A;  1UX4 A;  5L3B B;  5KMG P;  1ZV4 X;  2V7M A;  4DND A;  5JDF A;  2XAJ B;  4K0U A;  5TAO A;  4M1P A;  5L3C B;  5FXX A;  2VK9 A;  4AXP A;  2LSJ A;  3ZLI A;  4NUV A;  4C2M A;  4PJL A;  3T8O A;  4BA9 A;  3QK6 A;  4O8S A;  3AA7 B;  3MAC A;  4GK5 E;  5F8P A;  3AA0 B;  4CXW A;  5J2T E;  4L0R A;  3UT5 E;  4QXH B;  4E7Z A;  2ZM8 A;  4PJM A;  3I9W A;  4BJM A;  4ZI3 D;  3F57 A;  3SRZ A;  5L3D B;  3NS4 A;  2ACX A;  3HR0 A;  5EK3 A;  3RC8 A;  4IIJ E;  3EVY A;  3IBP A;  3U3I A;  2Y8D A;  4QXB B;  5ETW A;  3FXE B;  3RRW A;  2Y6X A;  2LT3 A;  4EAH A;  5LYJ E;  2IAK A;  2ZM2 A;  2MTQ A;  2LSK A;  3ZYM A;  4TN7 B;  4O4H E;  5CA0 E;  1D0Z A;  3VKH A;  3AVR A;  2HH7 A;  4HTE A;  2YIN A;  5HXS A;  4F6R C;  1D1B A;  3ETV A;  4CI2 B;  3N9L A;  2C5I T;  4HKA A;  2KMF A;  3NRY A;  5ADX L;  3H37 A;  2CE7 A;  4QX8 B;  4P0B A;  2C5J A;  4YHJ A;  4BJN A;  4ZOL E;  4NUU A;  4KP3 C;  1ZHC A;  3KV6 A;  2E9X D;  3Q5W A;  3ZMV B;  4DVY P;  2XAF B;  3Q5X A;  2X67 A;  4ZI7 E;  2X0L B;  3ZCJ A;  2R7R A;  4HFV A;  2FJI 1;  3DU6 A;  2CM0 A;  2LSG A;  2Q9Q A;  2YU1 A;  4YJ3 E;  5FXW A;  3N2O A;  3C50 A;  5L3F B;  1UCU A;  3RYC E;  3CPZ A;  3PE0 A;  5A1L A;  4UV9 B;  2DWG A;  2CWY A;  1S35 A;  3L3P A;  3LK4 2;  2V7I A;  2EHO D;  2PFV A;  5JR9 C;  4X1Y E;  2BZB A;  2X9Y A;  3CQC B;  4XAX B;  3RYI E;  4X1I E;  4O4I E;  1HFA A;  3ZC1 A;  3OYX A;  3ZC0 A;  2V26 A;  3J7Y q;  5LG4 A;  3KDS E;  1IJ5 A;  3NZP A;  4JUY A;  5LXT E;  1MIV A;  2X9H A;  2XUE A;  3KFW X;  2QGS A;  1HS7 A;  1H7C A;  4PK5 A;  4U74 A;  2DI4 A;  3C64 A;  4X20 E;  3LK3 B;  3VKG A;  5HXR A;  4ZI2 D;  2E9X A;  3C98 B;  2CXF A;  2KIN B;  1FEW A;  3MKD A;  4IGU A;  3ZN1 B;  2KZ7 B;  2B1E A;  4H9P C;  1UX5 A;  3JC6 C;  5FYM A;  4ERR A;  3UFE A;  3V5U A;  2CXL A;  5F3J A;  4YFS A;  2GK9 A;  4G63 A;  5C8Y E;  2WAU A;  2WBL A;  2JMH A;  3EDU A;  4DBQ A;  2SPC A;  3WI3 A;  4PK6 A;  4ISS A;  5DJQ C;  1YKH B;  3NZQ A;  4XBF B;  3A5X A;  1U4Q A;  3CX6 B;  3CWZ B;  4UVC B;  4ZS3 A;  3QUJ A;  3M65 A;  2A3D A;  3PU3 A;  4CXX A;  3K3O A;  1G8X A;  2K5B B;  4DBR A;  5JQG E;  5JDH A;  5KX5 E;  2W63 A;  4IE4 A;  5IYZ E;  2Y48 B;  5E0O A;  4P09 A;  4IRV A;  5HAX A;  3HL6 A;  3DU5 A;  4I4T E;  4ASK A;  1IAP A;  1YKE B;  4O4J E;  3C4X A;  5JDM A;  2E8I A;  4OYJ A;  4QXC B;  2UXX B;  2CMR A;  5KDM C;  2LSY A;  3D0T A;  4H63 H;  3ZPO A;  2I59 A;  3AA1 B;  2EHO A;  1IJ6 A;  3AAI A;  3ETU A;  5L2L A;  3BQI A;  2NP9 A;  2KXP B;  3SS1 A;  5AFU L;  5BMV E;  5FXZ A;  4GIW A;  3GWH A;  4JEH B;  1X79 A;  5FXV A;  5LHI B;  1D0Y A;  3RYF E;  2W00 A;  3KV4 A;  3C4W A;  1IZN B;  4BAY B;  2LOS A;  2VKH A;  3AB3 B;  3UUM A;  1EZ3 A;  3J9X 1;  4IE6 A;  5JDQ A;  3RPU A;  2VAS A;  3DTO A;  1KK7 A;  2YEV C;  3I0Q A;  1D1A A;  4UV8 B;  5LHH B;  5LGU B;  2Q9Q D;  1MMG A;  2K48 A;  4KBM B;  4QWN B;  3W15 B;  4HN9 A;  3ZJ2 A;  3VU7 H;  5FY1 A;  3NRX A;  3MK7 C;  3ZEF B;  4H9O C;  5HWX A;  4OD4 A;  2D5U A;  2D2S A;  2ZM0 A;  5H6Q B;  4QX7 B;  5HXE A;  5LJM A;  1KNZ A;  3DJB A;  3FBL A;  2L9Q A;  1MIW A;  1LRZ A;  3HKC E;  3PUG A;  3LJC A;  3N9M A;  4PAG A;  4ZS2 A;  3B57 A;  2DWK A;  2MBG A;  2HPJ A;  5M4Y A;  3VHL A;  5CQG A;  1HCI A;  2YK0 A;  4ANJ A;  3ZJ1 A;  2D0U A;  5CA1 E;  3C51 A;  4OK0 A;  5FY7 A;  4ILU A;  1V9D A;  1HG2 A;  1WYC A;  1G73 A;  4I50 E;  2CXD A;  4L5G A;  4YJ2 E;  1BR0 A;  3HKD E;  1BR2 A;  3IEE A;  3LFM A;  2ES0 A;  2V1D B;  4WBO A;  4I43 B;  2BDE A;  5FMN A;  4U72 A;  3MA9 A;  3N2K E;  2DCF A;  1SA0 E;  4UF0 B;  4UF0 A;  5LJN A;  2B3W A;  1FIO A;  3I0O A;  4GYS A;  4V1A v;  3RX6 A;  2PG8 A;  1WLX A;  3IHR A;  5CB4 E;  3TKL B;  3CX7 B;  4PW8 A;  3SWH A;  1MND A;  2H7V C;  2IC9 A;  2KT9 A;  3DP7 A;  3E08 A;  2D0T A;  5LGN B;  5LBQ B;  4H9R C;  2XAH B;  2NW9 A;  2PJQ A;  5LHG B;  3IF8 B;  4ADZ A;  3F31 A;  4WW0 A;  3KIN B;  5EK2 A;  4HEA A;  2JRK A;  2DNX A;  1VOM A;  2XAQ B;  2ZMA A;  4B6X A;  3U78 A;  3HA4 A;  3KVA A;  2E9X C;  4O4L E;  3BQL A;  2R7Q A;  1S94 A;  2XAG B;  3I1A A;  1LVF A;  3E22 E;  4IE0 A;  2K9A A;  2QA7 A;  3KYL A;  3I9Y A;  2NOX A;  2C0S A;  4OD5 A;  2X66 A;  4FJO A;  3N5L A;  5FY0 A;  5HXH A;  3ZMU B;  2NTX A;  3N9Q A;  3GN5 B;  2UXN B;  5JDN A;  2C5K T;  2X9X A;  4EIW A;  3FHN A;  3AA6 B;  4WNK A;  3L09 A;  3RRC A;  3P7I A;  2K24 A;  3ZYK A;  5LCY A;  3UUX B;  2Z6E A;  2ODV A;  5JR9 A;  3BQK A;  3N9P A;  3UTK A;  4GK0 E;  4CI3 B;  3O9X A;  3AVS A;  4H9Q C;  4MLK A;  5JDG A;  4CZZ B;  2V7J A;  5LA6 E;  3OYZ A;  4Z8X A;  3N2G E;  2BVM A;  3PUR A;  2M67 A;  2JPF A;  4DMV A;  5L3G B;  3ZN0 B;  2LEH A;  4MAL A;  1MMN A;  2N1G A;  4O2B E;  5HWY A;  1OXZ A;  2H7O A;  2VKJ A;  4JLE A;  2A72 A;  3WAJ A;  3JC6 D;  1VRB A;  2L8K A;  2R7U A;  1SHZ C;  3MXZ A;  3O1I A;  3LK2 B;  1LKX A;  1YW0 A;  3CVR A;  3KBU A;  2RA1 A;  4DVD A;  2DLR A;  4UEM A;  3WAK A;  5EZY E;  2KWI B;  2W61 A;  4GOU A;  3O1J A;  3PUS A;  1QUU A;  3UUL A;  4PFO A;  3ZYL A;  3CKD A;  1E1H B;  4OYK A;  1HG5 A;  3LG7 A;  4TZ4 C;  5JVD E;  5LBM A;  4WBN E;  4P0A A;  4HGA A;  2IW5 B;  5GON E;  3ESL A;  2VB6 A;  1FMV A;  4UEL A;  2N2N A;  3C4Z A;  3RH3 A;  2J1D G;  1WR6 A;  2CLY C;  3KV9 A;  2W0G A;  4L9I A;  4UXN B;  4ZI3 C;  3ZMZ B;  4C91 A;  2LE8 A;  5HXC A;  4EYU A;  2VL8 A;  3S4U A;  1MNE A;  1YD8 G;  5LP6 E;  2NTY A;  2EHO B;  3GN5 A;  4PFP A;  2R7W A;  5DAB A;  2WSS V;  5DQW A;  3LBX B;  2RP4 A;  1WRD A;  4TUY E;  4EYY R;  2WWU A;  3EUH A;  5J2U E;  1O3X A;  5JR9 B;  5HYA A;  2R7T A;  3ZMS B;  2IC6 A;  2X68 A;  2W62 A;  5J1G A;  3R84 B;  2XQY A;  4EZH A;  2R7X A;  2VWA A;  3RC3 A;  4UIG A;  3ZMT B;  2OA5 A;  4E7S A;  3HKB E;  4CXY A;  1Z0P A;  2JJ9 A;  3ZCI A;  4TX5 A;  4H9N C;  1ZEE A;  1D0X A;  1U5P A;  1Y64 B;  2LM9 A;  2Q9Q C;  2WMN A;  3GMI A;  3V5S A;  3H3A A;  2ODU A;  4AI6 A;  2CCQ A;  1US7 B;  3SOL A;  1WYB A;  5JRE A;  3MZK B;  1D1C A;  4EZ4 A;  3N9N A;  2XTL A;  3HI2 A;  3ONX A;  3B13 A;  4UVA B;  4KUM B;  4N78 D;  4DMW A;  5JRC B;  4O2A E;  5JRC A;  2N9D A;  4IST A;  2DHR A;  3GA8 A;  3KBT A;  4IE7 A;  4XZC A;  3RYH E;  2VKO A;  4AKL A;  3CML A;  1NWM X;  4H9S E;  3Q9D A;  2CEA A;  3UUN A;  2NWB A;  5H6R B;  2KND A;  3KVB A;  3NBX X;  4TV8 E;  2EHO C;  5LOV E;  4HE8 A;  2R7V A;  1NAF A;  3PUQ A;  3CQX C;  4IDZ A;  5FP3 A;  4AKH A;  5FNV E;  3FBZ A;  1MIY A;  2YU2 A;  4X1K E;  4UVB B;  1BR4 A;  4OHF A;  2R7O A;  3QC9 A;  4AKG A;  1ZKE A;  5LNK A;  4GYR A;  1HTJ F;  1MMA A;  4ZI2 C;  1HX8 A;  1FMW A;  2LJL A;  2XAS B;  3KV5 A;  1MMD A;  2R7S A;  2ZLY A;  4A56 A;  4G2A A;  2NW7 A;  3LBX A;  4AKI A;  3E0Z A;  3EDV A;  2MYS A;  2NW8 A;  2X51 A;  3RKO A;  2A2F X;  1QSD A;  3PTR B;  4EOZ B;  4JEU B;  4KMC A;  3OBV E;  2KLQ A;  3MJX A;  1T98 A;  2KWH A;  4PNI A;  3BK9 A;  4FI5 A;  4MHC A;  3ANW B;  3K3Q C;  3PDY A;  4QHO A;  3ANW A;  3PUA A;  5L3E B;  3CX8 B;  3N9O A;  3OJA A;  4AQG A;  3HKE E;  2LOP A;  5LGT B;  4PJJ A;  3OKQ A;  2X9W A;  4AQF C;  2G0U A;  4CI1 B;  2CA5 A;  2CWO A;  4AQF A;  4IHJ E;  4C90 A;  1LVK A;  2CLY B;  1AJ3 A;  3VTI A;  3K8P C;  2BVL A;  2HPL A;  2XHE B;  4MBQ A;  1CUN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...