3K8PC

Structural basis for vesicle tethering by the dsl1 complex
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
352
structure length
295
Chain Sequence
NIYTTLKFESMMQQRVIQIRSIPEEEYHELVSVQPIQVSVFVQSAAKVFTEFEQGCDTIGRSKVESIYLYKFNLLQTAFFAMVSEKVNDWTQLYKDVRYLYTENPKLLQLMELNSRRLDLNLNLIKKTIYKLVNDQLQELKDNERTPDWDITISSLLPYLKKTALPTLYKLEDNTILVALIRYIVHDLVIDNILHWRVISEKSSENLSEFIMLLLSGLEIPRLNLIETYRHSREKLGILSKILTAHLKDILEMFYEGEFFLFETDEIVQWIILLFADTPTRRDCIDEIRRVREEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Dsl1
publication title A structure-based mechanism for vesicle capture by the multisubunit tethering complex Dsl1.
pubmed doi rcsb
source organism Kluyveromyces lactis
molecule tags Transport protein/transport protein
total genus 112
structure length 295
sequence length 352
ec nomenclature
pdb deposition date 2009-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF11989 Dsl1_C Retrograde transport protein Dsl1 C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.150 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor; domain 2 3k8pC02
1.20.58.1440 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3k8pC01
3K8PC
chains in the Genus database with same CATH superfamily
1BJZA 3KV5A 5JDFA 4X1EA 1ZEEA 3DTOA 1T33A 2B3WA 3Q0VA 4PXIA 2K9AA 2AXDS 2FJBA 2EHOB 3H3AA 1HNZT 2NR4A 3LSJA 4I0UA 3UUBA 2JQHA 3RC3A 5FHPA 4DBRA 2ZOYA 3NI7A 4QHOA 4IE0A 3P8CD 4DW6A 1MIWA 3RKOA 1KK7A 4K0KT 2W66A 1KFYA 4HFHA 4CN6A 2L3LA 1QSDA 2LOPA 2TCTA 5CXGA 2V1DB 2XQYA 4O8SA 4QKNA 3VRBA 4HWFA 1UX4A 3QQAA 4ASKA 2B1EA 3BCGA 5HEJA 3ANWB 4NXNT 2VKVA 4CGRA 3CWRA 4AF5A 5LHHB 3VOXA 2TRTA 2ID3A 4E7SA 1AJ3A 2QYWA 2GBYA 2OERA 4AC0A 4U7YA 3AE4A 4ILUA 2PBXA 2D2SA 2XJ7A 2CLYC 2C5KT 3AE2A 3L8RA 2XRLA 2WWVA 5IOZA 4IRVA 1JT0A 4P1NA 4ILCA 2MTQA 3E22E 2CA5A 5A1LA 2Q9QC 1MMAA 1MIVA 2XAHB 2HPLA 3AA7B 2K48A 2LLYA 4X20E 4WZXA 4YLHA 4G2AA 4LF6T 4BJNA 3KV6A 2YVHA 3CK6A 3JSJA 2QOPA 4XBFB 2G3BA 2XUEA 4JL3A 2FBQA 3G7RA 3GMIA 4AKGA 1KNPA 2DI4A 2ODUA 1ZHCA 2E9XD 5HCMA 4WW0A 3LJCA 5JQGE 1S94A 3NPIA 3DU6A 5AQNB 3L09A 3QKXA 3VW2A 4EZ4A 2L8KA 2XPVA 5ADXL 3BK9A 4U2ZA 4IL4A 1US7B 2EHOD 2XQAA 3RC8A 4MO7A 5FY1A 5CGMA 5FXXA 4D5CA 2MPKA 4DUYT 4PJNA 3IH4A 3QK6A 3BTLA 1MMNA 2X67A 2QIBA 2L9QA 3IUVA 3IA3A 5IUXA 3CDLA 3CQXC 3ZCIA 3ONLC 3O60A 3PUYF 3C2BA 4AKIA 3OYZA 3B57A 2X9DA 4H9QC 4YT0A 3CQCB 4GK5E 3IEEA 4UF0A 2CWOA 2KZ7B 3CX7B 4QXCB 4CI2B 5FKYA 1D1CA 2X0LB 3AEGA 1XDPA 2CXFA 4GYRA 1BR2A 4AISA 5CJ5A 2KINB 3LK3B 4TWHA 3VU7H 3A7MA 5AQKB 1KF6A 1SUMB 2YDRA 4L9IA 2JMHA 3LOCA 3G56A 3UUMA 3T1YT 4X1KE 5AQIB 4DVDA 2WS3A 2XAJB 3FZFB 1ZV4X 5CFBA 2BDEA 2KT9A 3QB5A 4QH5A 1W09A 3DPJA 2JQKA 2NP5A 4LF8T 5L3BB 5FY0A 3UUXB 3EABA 1D1BA 2KWIB 2E5VA 2LHNA 3JADA 4PJLA 3QB5K 2XZEA 5JDQA 3MACA 3ABVA 5FY7A 4ZI2D 2DG7A 4TNWA 3ESLA 4Z90A 1D0YA 2V7JA 4B3ST 3N5LA 2NS8A 2G7SA 3FK6A 4H9OC 2LRLA 3UT5E 4ZEYA 4V2FA 2VQFT 3KFWX 5HXSA 5D18A 1LKXA 3F1BA 2NWBA 3EUHA 3O1HA 2XQ3A 4XAXB 1ORKA 3HA4A 1VCTA 2YDQA 2ES0A 5J1GA 4C2MA 4KHPT 4P09A 2IIUA 5LHIB 5HAXA 2CMRA 2N1GA 5KXJA 2YDSA 2VPRA 2ZCXA 3ZQFA 4U2YA 2IUBA 3OTOT 5FVKA 3I9YA 3BR2A 3SS1A 1NAFA 5LB7B 2OLTA 2BG9C 3V5UA 2O7OA 2IDOB 4CXWA 2WU5A 5LGNB 2FUPA 2K5BB 3LFMA 4PJMA 2XTLA 4LFBT 3BJBA 1D1AA 3KINB 2X68A 2BKPA 3G1MA 2UUBT 3BQYA 1JNZA 2ODVA 2W00A 3JAFA 3TLUA 3WAKA 2XAGB 3UULA 3B13A 4V1Av 2J62A 5IOYA 1KEYA 1W0AA 2W2UA 3FBLA 4FJOA 3A5XA 1QPIA 3PUVF 3HIMA 2CE7A 3KKCA 4PK4A 2FJ1A 1ZK8A 2DHRA 5FNVE 5J0ZA 4HFCA 2XY8B 3ZQIA 2XHEB 4CI3B 2XGCA 3CX6B 5HEGA 4LFAT 2XGEA 4TWFA 2XQ5A 1T98A 3UTKA 3FXDB 4BA9A 2UXXB 2I0MA 2M6BA 4MFRA 1T56A 2W4XA 3LK42 4L5GA 3SOLA 5TAOA 5F1JA 2C5JA 5F3JA 2R6GF 1WCRA 4HEAA 2V7KA 4JI0T 4TNVA 2V6YA 5LXTE 2ZLYA 2D9DA 5CA1E 2WDQA 5L47A 3AEEA 2LSIA 2VVSA 4HFBA 2VB6A 2X51A 4HWDA 4PFOA 1WR6A 3DU5A 2IC6A 4U7IA 4D5FA 2BG9E 5KMGP 1UGOA 4DV6T 4DR6T 4MK6A 4N78D 3VHLA 5LG4A 2GENA 5LCYA 3V6GA 2UUAT 3ZCJA 4QWNB 2W62A 4HGAA 2X9WA 3ZQLA 5F04A 3B6AA 3ZT5A 2V7MA 4M1PA 5EK4A 3LHQA 3AQSA 5DJQC 4B1RA 5HXCA 5DQWA 2J1DG 2YOEA 4PK6A 4NIQA 2KNDA 3ZQHA 5LMNT 2UUCT 1FMVA 5F08A 4Z8XA 4UIGA 3RGLA 4I76A 2Y2ZA 4WBOA 4ANJA 2V6YB 3AEBA 4GOUA 3ZQGA 4AKHA 4UELA 1QVTA 3HE0A 2R7TA 3ZJ1A 1D0XA 2XQ9A 5LMUT 3ZLIA 4IIJE 3PJAJ 2N9DA 4GK0E 4DR2T 2IU5A 4UXNB 3PUQA 4DV1T 2R7OA 2R7XA 3PUSA 3CIRA 5JVDE 3T8OA 3ETUA 5F5WA 3K3NA 3RIUA 2Y31A 4U31A 3DEWA 3BNIA 2WDRA 2LM9A 3VR8A 3VPRA 4H9NC 3ZYKA 4EB6E 4CXXA 1J5ET 4PK5A 1LRZA 3X1DA 4JKZA 3TLVA 3UU3A 5LA6E 3ZKRA 3LSRA 3J9X1 1N33T 4HFIA 2NTXA 4YY3T 3HTIA 3RYHE 4GFLA 2H88A 4TN7B 1JTXA 1ZKGA 4ILBA 3ONXA 1RKWA 3BQKA 3P7IA 3AA0B 2HH7A 5JDGA 1WRDA 5H6QB 2H7OA 3N2GE 2WM9A 5AQOB 5FMNA 4P0AA 2CCQA 3WI3A 1DU2A 1W0BA 1U9OA 5FVLA 2JJ9A 5LBQB 2ZMAA 1HTJF 4EIWA 3OPCA 3ANPA 4U9NA 3RYCE 2LOSA 3VVYA 5IWAT 2Y30A 1OEDC 4ZXLA 3FB2A 3N2KE 4LF9T 4YTPA 3UUNA 2UXPA 2J4GA 2FBWA 5LP6E 4XK4A 3KBUA 4IGUA 1E2AA 3K3OA 2C5IT 2D5UA 5JR9C 1A6IA 3P4RA 5L3EB 2FJDA 2XQ7A 4O4IE 1G73A 3QUJA 4OYKA 4IDNA 5F8PA 1JTYA 2NP3A 2XPWA 5L4EA 5J1YA 2Q24A 4UV8B 3PASA 3LJLA 4IT4A 3VVXA 3GWHA 4KUMB 3NKZA 1WYBA 3MJXA 3BR3A 1HNWT 2VK9A 3WHBA 5K7ZA 1X9BA 2MBGA 2IAIA 2AE9A 4DUZT 2G0UA 4CZZB 3LSPA 5FGLA 3JC6C 2F07A 5HBUA 5L4HA 3AAAB 4QH1A 1U4QA 2NW7A 4YJ3E 3VKGA 5CXIA 5BMVE 4JI2T 1U9NA 3RIFA 3FXEB 4UVBB 4OD4A 4F8HA 2LHRA 5H9TA 4ILAA 3TP3A 1SE7A 3UU8A 4AQFC 5EFYA 5F0FA 4I55E 3AE5A 2Q9QA 2XAFB 3GA8A 3EVYA 2W61A 2V7LA 2X66A 3D0TA 3F31A 1IBLT 2A72A 2BZBA 1ZP0A 1VCSA 5GONE 3OVUA 2DL1A 3UU5A 3EDVA 2V26A 3ZJ2A 3BRUA 4GYSA 2XQ4A 3ETVA 1KNZA 4HKAA 5JDLA 3AVRA 4X62T 4CXYA 4ZS2A 5FKNA 2CPTA 4DR1T 4QX7B 1YW0A 5DABA 4DV7T 1XZYA 1XDOA 4EXTA 2HYTA 3QPSA 3C64A 4ERRA 5IP6A 3RKGA 5FKOA 3VW1A 2PTFA 2XAQB 1HCIA 1OEDE 2MOZA 2JRKA 2CBJA 4DMWA 2CLYB 3P4WA 3VRAA 3AXJA 3SWHA 1XMQT 2KXPB 4TV8E 3KV4A 4U74A 2WB5A 2X6OA 3T1HT 4GKJT 4TWDA 2R7UA 2KSRA 2F4VT 2W0GA 3K3QC 3NXCA 4CI1B 2Q9QB 4TZ4C 3H37A 3ZC1A 4M3EA 4X1YE 3UFEA 1FEWA 3EAMA 5LG3A 2I6HA 3IH2A 4EYUA 1HF8A 1S35A 2RPAA 2ZM8A 4GFKA 3EHZA 2FJI1 5ETWA 2XPKA 3ZN0B 1YXRA 4M3DA 3BTCA 5LYJE 5FKMA 4PFPA 5LHGB 2G7GA 3E7QA 5EYRA 4EEDA 4E7ZA 4L62A 3P4SA 3KV9A 5AQTB 5JTGA 3FZKB 4UV9B 4KMCA 2ZM6T 4ISSA 2FD5A 3COLA 4DIDB 1X79A 5JREA 2K24A 4IDPA 1M62A 5LJMA 4DR4T 1BR4A 2V5CA 5D1RA 4H63H 2FQ4A 3CMLA 1E1HB 3CPZA 4UR9A 3C07A 3RX6A 2PFVA 2IMLA 5GPCA 4M3FA 4DR3T 3BT9A 3AXJB 5LGTB 4AKLA 4EV6A 3ON4A 1SHZC 4UEMA 5CB4E 3FIWA 4IDQA 3CCYA 3BR5A 3Q5EA 5FKLA 2QKOA 3PJAA 4UVCB 3ANGA 4H63V 2VKEA 1BR1A 5AQVB 2R7WA 2YK0A 3O4XE 1JUMA 2PBIA 3BR0A 4ZI3C 5ABFA 4U9LA 2QGSA 4HWHA 2ZCNA 2CM0A 5ABGA 1I6ZA 3HI2A 5FL1A 3P50A 4IE4A 1YD8G 1YQ3A 1BR0A 3QBMA 1MMGA 2NW9A 2PZ9A 2LKHA 2HQ5A 2DG8A 4COFA 4JNNA 2OF7A 3W15B 3O1JA 3NRXA 2D0TA 3O8GA 3BQZA 2BG9A 1CUNA 2X0HA 3V78A 4ISTA 2VASA 2LE8A 3TKLB 4LF7T 2VKOA 1WFDA 3FZLB 4B6XA 3ZEFB 3ZN1B 3PU3A 1YQ4A 3OKQA 4JI6T 5AQLB 5HEHA 2Q9QD 1QLBA 4AC6A 2V7IA 2XQ6A 3CRJA 2DWGA 3ZMZB 2IHR1 3KVBA 4TUYE 2RP4A 3E08A 5K58A 3AE3A 4OHFA 3I1AA 5ABFB 4I6ZA 3LG7A 2YVEA 3B5MA 4B3MT 3AE6A 4BAYB 2UU9T 2HXOA 2XM1A 2WZHA 3CWZB 5HWYA 2XDNA 4MLKA 4NUVA 2LSJA 3MA9A 3C4WA 3TLSA 5M4YA 2RASA 3U78A 3BTJA 2E5LT 4X5TA 3RYFE 3SFEA 5LNKA 2HN2A 4YXDA 5GP9A 3OJAA 2XB5A 3HTHA 3RRCA 4YTMA 3GN5A 2I59A 4YTNA 1HX1B 3PPBA 5AQCA 2R7QA 2BG9B 3I0QA 3BHQA 3PV0F 3NZPA 3Q2MA 1HX8A 1MMDA 3G06A 2VWAA 3IHRA 1SA0E 2P9BA 5AQGB 2WSSV 2KMFA 3NS4A 1Z0PA 3SRZA 1OWAA 2YU2A 2Y6XA 4X64T 4AQYT 1KNRA 4HFDA 4AUXA 3ZC0A 2VKJA 2WBLA 4JYAT 3QPLA 4A98A 2X9XA 5L3DB 3G1LA 3L39A 3J7Yq 2G0EA 3P4QA 3G1OA 3T6NA 3HKBE 3RRWA 3A8YC 5CA0E 3FBZA 4LMJA 4Q25A 3FRQA 3KDSE 4JUYA 4AQGA 3O1IA 2M6IA 4OD5A 2ZCMA 4H9RC 5EK2A 5LBMA 3FHNA 4U33A 3PUWF 4QH4A 2ZB9A 4L0RA 4JEHB 3F57A 4WIBA 5F27A 3KYLA 2CEAA 5J1RA 4Z91A 3N9OA 3P4PA 2E2AA 3LSVA 5HAWA 4GCLA 3ZMUB 2Z6EA 2HKUA 4ZHQE 2RA1A 4X1IE 4TX5A 5FYMA 3IF8B 2YVXA 3KNWA 2Y48B 3RLFF 4A5XA 4QXHB 3TP0A 1I94T 2W53A 3GN5B 3PUAA 3TLWA 5EZYE 2E9XC 4D7MA 5AQMB 4W97A 3Q9DA 3KKDA 3K1SA 3CKDA 4OX9T 4O4JE 3SFIA 4LMLA 2HYJA 4I4TE 4P0BA 2EHOC 3ZMVB 3DCFA 4YJ2E 2NS7A 2LKGA 2ZM0A 5K7FA 5FXZA 2V5DA 5FL0A 4X66T 3ZYMA 3UQ4A 2YINA 3AA6B 3Q5DA 4EZHA 4LMKA 3RI5A 1FJGT 3PU8A 2W67A 1LVFA 1UCUA 4H9SE 3N9NA 4JI5T 4D7NA 3WAJA 2NW8A 5FXVA 2QRXA 3RYIE 1N36T 2BVLA 2X9HA 4A56A 2BS3A 2G7LA 3HTAA 3CQGB 3B6CA 2XGDA 3LK2B 3IBPA 4EGWA 2FX0A 1GQEA 5CW8A 4DMVA 2ID6A 3ZMSB 4WBNE 3HR0A 1RPWA 3PURA 2JQ9A 4LFCT 4JV5T 1L0VA 5ABHA 3UU4A 5D19A 1Z0XA 4U72A 4DR5T 1H7CA 4B3AA 1Y01A 4F6RC 4YFSA 4PW8A 4GCTA 5EZGA 3LBXA 1IAPA 5J1UA 3C50A 2CXDA 1V9DA 4IL9A 4DV3T 4B3TT 3M65A 5DAJA 2IC9A 5CQGA 1JUPA 3RD3A 3C98B 3HGYA 4IREA 4AXPA 4DNDA 4ZI2C 4GIWA 5AQJB 4ABZA 4OFZA 2SPCA 1IJ6A 5ABEA 3KVAA 4I50E 1OEDA 2CHNA 3VVZA 2UXIA 2DWKA 2XSAA 3NNRA 3AAEB 4HN9A 2LJLA 2OI8A 2V6XA 5JR9A 4MALA 3FK7A 1N32T 3HGGA 4JI1T 1YKEB 3ON2A 4JI3T 3LWJA 2UXUA 1VI0A 3O9XA 1VOMA 5FKKA 3OYXA 3TLTA 2ZY9A 1UI5A 4EYYR 3BR1A 3PDYA 3U3IA 1WR0A 4NUUA 1XNRT 5JRCA 4O4HE 1IBKT 2DTZA 2NP9A 2KLQA 3GZIA 3MXZA 4C91A 2WGBA 3QNUA 3FZHB 2WWUA 3Q0UA 2YN6A 4G12A 3VR9A 4IE6A 3NZQA 1T72A 2IW5B 4AQFA 3HKEE 3LBXB 5JH7E 4NN1A 2B76A 2YEVC 2H7VC 1NEKA 2GUHA 2WY2A 4MBQA 2UXNB 4KP3C 5HSZA 4O4LE 5C2TA 3HKDE 2DLRA 2WV1A 3Q3SA 3N9QA 3ZSSA 2DCFA 1OEDB 3IH3A 4B3RT 3RHWA 4EEBA 1IBMT 2ACZA 3UFGA 1U5PA 2WQYA 3ZPOA 2H89A 1Z77A 3AEAA 5JR9B 2X9YA 3K8PC 4ACIA 2LT3A 5AQUB 5EZHA 2NTYA 1HG5A 2XASB 5IHYA 3AE8A 5J3LA 1HG2A 5AQSB 3VUQA 2OPTA 4DVYP 4DV2T 3UQ7A 3LDQB 3N9MA 5JRCB 1UX5A 5HEUA 3NRYA 1ZKEA 2JPFA 4C90A 5L3CB 1NENA 3AEDA 2BVMA 2JIWA 3V5SA 4YSZA 4QX8B 3VW0A 2WU2A 2LRKA 5AQRB 5HWXA 1JUSA 1YKHB 4DV5T 4KWAA 4JBWF 2W63A 1UURA 2XQ8A 3VIBA 4K0UA 3VOKA 4YHHT 4TV9E 2N2NA 5FMPA 4OYJA 1IZNB 2QCOA 3H3MA 1HFAA 4YSYA 2DNXA 3PTRB 3CX8B 4LF5T 1RKTA 2VVNA 4BJMA 2YU1A 5F0HA 3PE0A 3RH2A 3NWIA 2GK9A 4HFVA 4W1UA 3CJDA 3RQWA 2XSBA 4UVAB 4JI7T 3MK7C 2ACXA 2D0UA 2MAWA 2R7SA 2CBIA 3PUXF 5J2UE 2PJQA 2OA5A 2CWYA 4YHJA 2RHAA 1SGMA 3HTJA 3KBTA 2JJ7A 4IDOA 4ZS3A 3GEUA 4UDSA 2VKHA 3AE7A 4JI8T 2R7RA 3AB3B 2NX4A 5BR8T 1LVKA 3DP7A 1OXZA 3AE9A 3SDGA 3C51A 3Q5WA 5HXHA 4G63A 4ADZA 4JEUB 3Q0WA 3C4XA 3WHCA 4JYKA 2LSYA 3RH3A 4H9PC 3ONJA 1J5WA 3R84B 2UXCT 3JAEA 3NBXX 4YZEA 5AQFB 2WZIA 4XZCA 3VTIA 4ME9A 4KI0F 2I10A 2WCAA 5LGUB 3I9WA 2M67A 4GKKT 5LJNA 3MZKB 3BR6A 1WLXA 4NELA 1B7TA 1XNQT 2R7VA 5GPAA 4HKUA 5C8YE 3NVOA 5FP3A 3E0ZA 2CRBA 2JQQA 2A3DA 4UF0B 3EDUA 1VRBA 4IHJE 2HHHT 3AVSA 1N34T 3AEFA 5HYAA 1T8BA 2BS4A 1QVUA 4KHZF 3MNLA 1T7SA 5JDMA 2UXBT 3F0CA 4JLEA 3FZMB 4EAHA 4KX6A 5HXEA 3N2OA 3EUPA 1IJ5A 3JC6D 3MVPA 4O2BE 3RF1A 4HWIB 4HFEA 3AQTA 3AAIA 4U3CA 4X65T 2GFNA 4ZI7E 2QWTA 4NPPA 2ZM2A 1FIOA 5IPAA 4J2CA 2LEHA 4ZZCA 2BKNA 3R6NA 4KBMB 5AQPB 2VKDA 4O2AE 2CXLA 2QVAA 1UI6A 3HL6A 2WP9A 3CVRA 1HNXT 4HWCA 4WYVA 3RIAA 4DR7T 5L3FB 2WMOA 4ZOLE 1MNEA 5C3JA 4YSXA 2A9UA 4EOZB 3M3ZB 4CN1A 3SFDA 1XWMA 2C0SA 2H3RA 4JI4T 2HXIA 3P9TA 2LSKA 1UUSA 2EH3A 5IYZE 4QXBB 4M3GA 1NWMX 3QC9A 4PAGA 4PJJA 2MYSA 5HEOA 3RQUA 5F0CA 2REKA 1Z8UA 3JCFA 3ZT6A 1W9RA 5LOVE 2BBJA 2IAKA 5KX5E 4DV4T 3NRGA 2E8IA 3N9LA 2X0YA 2IBDA 1CHUA 1WYCA 3Q5XA 1XMOT 4WNKA 2QTQA 3ZYLA 3C4ZA 4M3BA 2HPJA 5L3GB 4ZZBA 3EI0A 3EGQA 5H6RB 4DO0A 3PUZF 2YKSA 1O3XA 2RAEA 4CN4A 2VL8A 4IE7A 4FI5A 4IE5A 2IEKA 3ZT7A 4DV0T 2WAUA 3AA1B 1HS7A 1MNDA 3ZSTA 3ZMTB 3OBVE 3KZ9A 5HXRA 1G8XA 2UXOA 2BS2A 2E9XA 3HKCE 3B81A 2PG8A 2VURA 4NXMT 3PUGA 3BQLA 1UK5A 4LF4T 1Y64B 2BKOA 2BBHA 4AIUA 5JDHA 2Y8DA 2EHOA 2VQET 5EK3A 5J2TE 5KDMC 2FJEA 2HN1A 4ZI3D 3UU6A 1JT6A 3BQIA 3DJBA 3S5RA 4DBQA 2FJAA 2J47A 2NOXA 2V8SV 1D0ZA 2UXDT 3VP5A 2ZOZA 5FXWA 5JDNA 1J1JA 5AQQB 3RPUA 4IDZA 3PM1A 4MXMA 3AECA 2VL0A 2QA7A 4V2GA 1ZOYA 4CQIA 1MIYA 2A2FX 2XPUA 2K3WA 1EZ3A 2KWHA 4OK0A 5AFUL 4PNIA 3VKHA 3S4UA 5C4YA 1HR0T 1R8IA 5K7HA 1QUUA 2O7TA 5AQHB 3RIUC 1JNRA 4A97A 3N9PA 1E7PA 4ICHA 3ANWA 2WMNA 3I0OA 2JMKA 2LM2A 5L2LA 5HCJA 3O8HA 4MHCA 2LSGA 2XM2A 4HE8A 3L3PA 2WDVA 4HTEA 5DQVA 4AI6A 3BTIA 1FMWA 2V57A 2D6YA 3AE1A 2UXHA 5E0OA 2WUIA 3QOFA 3F2EA 2JK3A 1M7KA 2E9XB 2CHOA 4GCKA 2OV9A 3MKDA 4I43B 4AKRB
chains in the Genus database with same CATH topology
2IC6A 1BR0A 4DVYP 1MMGA 3KV5A 5JDFA 2NW9A 1ZEEA 3DTOA 5KMGP 3N9MA 2B3WA 2K9AA 5JRCB 2EHOB 3H3AA 1UX5A 3NRYA 1ZKEA 2JPFA 4C90A 3W15B 4N78D 5L3CB 3VHLA 3O1JA 5LG4A 3NRXA 5LCYA 3RC3A 2BVMA 3V5SA 2D0TA 4QX8B 4DBRA 3ZCJA 5HWXA 1YKHB 4QWNB 2W62A 2W63A 4HGAA 4QHOA 1CUNA 4IE0A 3P8CD 2X9WA 4ISTA 2VASA 1MIWA 2LE8A 3RKOA 3TKLB 1KK7A 4K0UA 2V7MA 4M1PA 4TV9E 2VKOA 2N2NA 5EK4A 2L3LA 1QSDA 4OYJA 1IZNB 2LOPA 5DJQC 1HFAA 4B6XA 3ZEFB 2V1DB 2XQYA 5HXCA 3ZN1B 3PU3A 2DNXA 5DQWA 3PTRB 2J1DG 4O8SA 3CX8B 3OKQA 4PK6A 4QKNA 2KNDA 1UX4A 2Q9QD 4BJMA 2V7IA 2YU1A 1FMVA 4ASKA 2B1EA 3PE0A 3ANWB 2DWGA 3ZMZB 4Z8XA 5A1LA 2GK9A 3KVBA 4HFVA 4UIGA 5LHHB 4TUYE 2RP4A 3E08A 4WBOA 4ANJA 4E7SA 1AJ3A 4GOUA 4OHFA 3I1AA 4UVAB 3MK7C 2ACXA 2D0UA 4AKHA 4UELA 3LG7A 2R7SA 2R7TA 4BAYB 4ILUA 3ZJ1A 5J2UE 2D2SA 2PJQA 2OA5A 1D0XA 2CWYA 2CLYC 3ZLIA 4IIJE 4YHJA 3CWZB 5HWYA 3KBTA 2C5KT 2N9DA 4MLKA 4NUVA 2LSJA 4GK0E 4ZS3A 3MA9A 3C4WA 5M4YA 4UXNB 2VKHA 3PUQA 3U78A 2R7OA 2R7RA 3AB3B 4IRVA 2R7XA 3PUSA 1LVKA 5JVDE 3DP7A 3T8OA 1OXZA 3ETUA 3C51A 3K3NA 3RYFE 3Q5WA 5HXHA 5LNKA 2LM9A 4G63A 4ADZA 4JEUB 3C4XA 3OJAA 3RRCA 3GN5A 2I59A 4H9NC 2MTQA 3E22E 2CA5A 3ZYKA 2Q9QC 4CXXA 2R7QA 2LSYA 3I0QA 3RH3A 4EB6E 4PK5A 1LRZA 3NZPA 4H9PC 1MMAA 3R84B 3Q2MA 1MIVA 2XAHB 1HX8A 1MMDA 2HPLA 5LA6E 2VWAA 3AA7B 3IHRA 1SA0E 3NBXX 3J9X1 2P9BA 2K48A 2WSSV 2KMFA 2NTXA 3NS4A 1Z0PA 4XZCA 1OWAA 3SRZA 4X20E 3RYHE 4YLHA 2YU2A 4G2AA 3VTIA 2Y6XA 4BJNA 3KV6A 4TN7B 5LGUB 3ZC0A 2VKJA 2WBLA 3I9WA 4XBFB 2M67A 5LJNA 2X9XA 3MZKB 5L3DB 1WLXA 2XUEA 1B7TA 3GMIA 3ONXA 2R7VA 3J7Yq 4AKGA 5C8YE 5FP3A 3E0ZA 2JQQA 2DI4A 2A3DA 1ZHCA 2ODUA 3BQKA 3P7IA 3EDUA 4UF0B 1VRBA 2E9XD 3AA0B 3HKBE 4WW0A 3RRWA 4IHJE 3LJCA 2HH7A 5JQGE 5JDGA 3AVSA 5CA0E 1WRDA 3FBZA 5H6QB 2H7OA 3N2GE 1S94A 5HYAA 3DU6A 2WM9A 3L09A 4EZ4A 3KDSE 5JDMA 4JUYA 4AQGA 5FMNA 3O1IA 4P0AA 2L8KA 2CCQA 4OD5A 4JLEA 3WI3A 4EAHA 3BK9A 5ADXL 4H9RC 5HXEA 1US7B 2EHOD 5LBMA 3N2OA 5EK2A 3RC8A 3FHNA 1IJ5A 5FY1A 2JJ9A 5LBQB 3JC6D 5FXXA 4O2BE 2ZMAA 4L0RA 4JEHB 1HTJF 3F57A 4PJNA 2CEAA 3KYLA 1MMNA 3QK6A 3RYCE 4EIWA 3N9OA 2X67A 2LOSA 3ZMUB 2Z6EA 3AAIA 2L9QA 4ZHQE 3FB2A 3N2KE 2RA1A 3UUNA 3CQXC 3ZCIA 4X1IE 4ZI7E 5LP6E 3KBUA 4IGUA 4TX5A 3K3OA 2ZM2A 5FYMA 2C5IT 1FIOA 3IF8B 3OYZA 2D5UA 3B57A 5JR9C 4AKIA 2Y48B 4H9QC 4QXHB 3CQCB 4GK5E 3IEEA 4UF0A 2CWOA 2KZ7B 3GN5B 3CX7B 4J2CA 4QXCB 4CI2B 3PUAA 5L3EB 1D1CA 2X0LB 2LEHA 2CXFA 4GYRA 5EZYE 1BR2A 2E9XC 4O4IE 3R6NA 1G73A 4KBMB 3QUJA 4OYKA 5F8PA 2KINB 2VKDA 3LK3B 3Q9DA 3VU7H 4O2AE 4UV8B 3GWHA 4KUMB 2CXLA 1WYBA 3MJXA 3HL6A 3CKDA 4L9IA 2VK9A 3CVRA 2JMHA 4O4JE 3UUMA 2MBGA 4X1KE 4DVDA 4I4TE 4P0BA 2EHOC 3ZMVB 2G0UA 2XAJB 4CZZB 4YJ2E 2WMOA 5L3FB 4ZOLE 2ZM0A 1MNEA 1ZV4X 3JC6C 2BDEA 2KT9A 5FXZA 3AAAB 1U4QA 4EOZB 2NW7A 3ZYMA 4YJ3E 2YINA 3VKGA 3AA6B 5L3BB 5FY0A 4EZHA 5BMVE 3FXEB 3UUXB 4UVBB 4OD4A 3PU8A 1D1BA 2LHRA 1LVFA 2KWIB 2C0SA 2LHNA 1UCUA 4PJLA 2H3RA 4AQFC 4H9SE 2LSKA 3N9NA 5JDQA 3MACA 4I55E 5IYZE 5FY7A 2Q9QA 4QXBB 1NWMX 2XAFB 3GA8A 4ZI2D 3EVYA 3QC9A 4PAGA 2W61A 4PJJA 3WAJA 2NW8A 2MYSA 2V7LA 3ESLA 5FXVA 3RYIE 1D0YA 2BVLA 2V7JA 2X9HA 2X66A 3D0TA 4A56A 3CQGB 3F31A 2A72A 3N5LA 2BZBA 3LK2B 3IBPA 5GONE 5LOVE 3EDVA 4H9OC 2V26A 3UT5E 3ZJ2A 4GYSA 3KFWX 3ETVA 5HXSA 1KNZA 4HKAA 4DMVA 5JDLA 3AVRA 2IAKA 1LKXA 5KX5E 2NWBA 3ZMSB 3EUHA 4WBNE 3HR0A 3O1HA 3PURA 4CXYA 4ZS2A 4XAXB 2E8IA 3HA4A 3N9LA 4QX7B 1YW0A 2ES0A 5DABA 4U72A 1H7CA 5J1GA 1WYCA 4EXTA 4C2MA 3C64A 3Q5XA 4P09A 4ERRA 4F6RC 4YFSA 4WNKA 2XAQB 5LHIB 4PW8A 5HAXA 1HCIA 3ZYLA 3C4ZA 2MOZA 3LBXA 2HPJA 1IAPA 2CMRA 5L3GB 3C50A 2CXDA 1V9DA 2JRKA 2N1GA 3M65A 2IC9A 5CQGA 5H6RB 4DMWA 4DO0A 3C98B 4AXPA 4DNDA 4ZI2C 2CLYB 1O3XA 4GIWA 3SWHA 4OFZA 2SPCA 2VL8A 1IJ6A 2KXPB 3KVAA 4I50E 4FI5A 4IE7A 4TV8E 3KV4A 3I9YA 4U74A 3SS1A 2DWKA 1NAFA 4IE5A 3AAEB 4HN9A 2LJLA 3V5UA 5JR9A 2R7UA 4MALA 2W0GA 2WAUA 4CXWA 5LGNB 3K3QC 3AA1B 2K5BB 3LFMA 4PJMA 2XTLA 1HS7A 1YKEB 1MNDA 4CI1B 3ZMTB 2Q9QB 3OBVE 1D1AA 3KINB 2X68A 4TZ4C 5HXRA 1G8XA 3H37A 3ZC1A 2ODVA 2E9XA 3HKCE 2W00A 2PG8A 4X1YE 3WAKA 3UFEA 1FEWA 2XAGB 3PUGA 3UULA 3BQLA 3O9XA 3B13A 1VOMA 4V1Av 3OYXA 4EYUA 1Y64B 4EYYR 1HF8A 3PDYA 3U3IA 1S35A 5JRCA 4NUUA 2ZM8A 2Y8DA 2EHOA 4O4HE 5JDHA 3FBLA 2FJI1 4FJOA 5ETWA 5EK3A 5J2TE 3ZN0B 3A5XA 2NP9A 5KDMC 5LYJE 4ZI3D 4PFPA 5LHGB 3BQIA 2KLQA 3DJBA 4DBQA 4E7ZA 3MXZA 3KV9A 2NOXA 1D0ZA 4C91A 2CE7A 4UV9B 4KMCA 5FXWA 2WWUA 4ISSA 5JDNA 4PK4A 3RPUA 1X79A 5JREA 2K24A 4IDZA 4IE6A 2DHRA 3NZQA 5FNVE 2QA7A 5LJMA 4CQIA 2IW5B 4AQFA 1MIYA 3HKEE 1BR4A 3LBXB 2XHEB 2A2FX 4H63H 5JH7E 3CMLA 4CI3B 1EZ3A 2H7VC 2YEVC 3CX6B 1E1HB 3CPZA 2KWHA 3RX6A 4MBQA 2PFVA 2UXNB 4KP3C 4OK0A 1T98A 5AFUL 4PNIA 3VKHA 3S4UA 4O4LE 1QUUA 3HKDE 2DLRA 3UTKA 3FXDB 4BA9A 5LGTB 2UXXB 4MFRA 4AKLA 3LK42 3N9QA 1SHZC 4UEMA 2DCFA 3N9PA 5CB4E 4L5GA 3SOLA 5TAOA 3ANWA 2WMNA 1U5PA 3I0OA 2C5JA 2JMKA 5F3JA 5L2LA 3ZPOA 2LSGA 2V7KA 4HEAA 4MHCA 4H63V 4UVCB 4HE8A 3L3PA 5JR9B 1BR1A 2X9YA 3K8PC 4HTEA 2R7WA 5DQVA 2LT3A 2YK0A 3O4XE 4AI6A 2PBIA 1FMWA 4ZI3C 5LXTE 2ZLYA 2QGSA 5CA1E 2NTYA 5E0OA 2CM0A 3F2EA 3HI2A 2E9XB 2LSIA 1HG5A 2XASB 3MKDA 5IHYA 2VB6A 2X51A 4IE4A 4I43B 1HG2A 1YD8G 4AKRB 4PFOA 1WR6A 3DU5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K8P C; 
#chains in the Genus database with same CATH topology
 1BJZ A;  3KV5 A;  5JDF A;  4X1E A;  1ZEE A;  3DTO A;  1T33 A;  2B3W A;  3Q0V A;  4PXI A;  2K9A A;  2AXD S;  2FJB A;  2EHO B;  3H3A A;  1HNZ T;  2NR4 A;  3LSJ A;  4I0U A;  3UUB A;  2JQH A;  3RC3 A;  5FHP A;  4DBR A;  2ZOY A;  3NI7 A;  4QHO A;  4IE0 A;  3P8C D;  4DW6 A;  1MIW A;  3RKO A;  1KK7 A;  4K0K T;  2W66 A;  1KFY A;  4HFH A;  4CN6 A;  2L3L A;  1QSD A;  2LOP A;  2TCT A;  5CXG A;  2V1D B;  2XQY A;  4O8S A;  4QKN A;  3VRB A;  4HWF A;  1UX4 A;  3QQA A;  4ASK A;  2B1E A;  3BCG A;  5HEJ A;  3ANW B;  4NXN T;  2VKV A;  4CGR A;  3CWR A;  4AF5 A;  5LHH B;  3VOX A;  2TRT A;  2ID3 A;  4E7S A;  1AJ3 A;  2QYW A;  2GBY A;  2OER A;  4AC0 A;  4U7Y A;  3AE4 A;  4ILU A;  2PBX A;  2D2S A;  2XJ7 A;  2CLY C;  2C5K T;  3AE2 A;  3L8R A;  2XRL A;  2WWV A;  5IOZ A;  4IRV A;  1JT0 A;  4P1N A;  4ILC A;  2MTQ A;  3E22 E;  2CA5 A;  5A1L A;  2Q9Q C;  1MMA A;  1MIV A;  2XAH B;  2HPL A;  3AA7 B;  2K48 A;  2LLY A;  4X20 E;  4WZX A;  4YLH A;  4G2A A;  4LF6 T;  4BJN A;  3KV6 A;  2YVH A;  3CK6 A;  3JSJ A;  2QOP A;  4XBF B;  2G3B A;  2XUE A;  4JL3 A;  2FBQ A;  3G7R A;  3GMI A;  4AKG A;  1KNP A;  2DI4 A;  2ODU A;  1ZHC A;  2E9X D;  5HCM A;  4WW0 A;  3LJC A;  5JQG E;  1S94 A;  3NPI A;  3DU6 A;  5AQN B;  3L09 A;  3QKX A;  3VW2 A;  4EZ4 A;  2L8K A;  2XPV A;  5ADX L;  3BK9 A;  4U2Z A;  4IL4 A;  1US7 B;  2EHO D;  2XQA A;  3RC8 A;  4MO7 A;  5FY1 A;  5CGM A;  5FXX A;  4D5C A;  2MPK A;  4DUY T;  4PJN A;  3IH4 A;  3QK6 A;  3BTL A;  1MMN A;  2X67 A;  2QIB A;  2L9Q A;  3IUV A;  3IA3 A;  5IUX A;  3CDL A;  3CQX C;  3ZCI A;  3ONL C;  3O60 A;  3PUY F;  3C2B A;  4AKI A;  3OYZ A;  3B57 A;  2X9D A;  4H9Q C;  4YT0 A;  3CQC B;  4GK5 E;  3IEE A;  4UF0 A;  2CWO A;  2KZ7 B;  3CX7 B;  4QXC B;  4CI2 B;  5FKY A;  1D1C A;  2X0L B;  3AEG A;  1XDP A;  2CXF A;  4GYR A;  1BR2 A;  4AIS A;  5CJ5 A;  2KIN B;  3LK3 B;  4TWH A;  3VU7 H;  3A7M A;  5AQK B;  1KF6 A;  1SUM B;  2YDR A;  4L9I A;  2JMH A;  3LOC A;  3G56 A;  3UUM A;  3T1Y T;  4X1K E;  5AQI B;  4DVD A;  2WS3 A;  2XAJ B;  3FZF B;  1ZV4 X;  5CFB A;  2BDE A;  2KT9 A;  3QB5 A;  4QH5 A;  1W09 A;  3DPJ A;  2JQK A;  2NP5 A;  4LF8 T;  5L3B B;  5FY0 A;  3UUX B;  3EAB A;  1D1B A;  2KWI B;  2E5V A;  2LHN A;  3JAD A;  4PJL A;  3QB5 K;  2XZE A;  5JDQ A;  3MAC A;  3ABV A;  5FY7 A;  4ZI2 D;  2DG7 A;  4TNW A;  3ESL A;  4Z90 A;  1D0Y A;  2V7J A;  4B3S T;  3N5L A;  2NS8 A;  2G7S A;  3FK6 A;  4H9O C;  2LRL A;  3UT5 E;  4ZEY A;  4V2F A;  2VQF T;  3KFW X;  5HXS A;  5D18 A;  1LKX A;  3F1B A;  2NWB A;  3EUH A;  3O1H A;  2XQ3 A;  4XAX B;  1ORK A;  3HA4 A;  1VCT A;  2YDQ A;  2ES0 A;  5J1G A;  4C2M A;  4KHP T;  4P09 A;  2IIU A;  5LHI B;  5HAX A;  2CMR A;  2N1G A;  5KXJ A;  2YDS A;  2VPR A;  2ZCX A;  3ZQF A;  4U2Y A;  2IUB A;  3OTO T;  5FVK A;  3I9Y A;  3BR2 A;  3SS1 A;  1NAF A;  5LB7 B;  2OLT A;  2BG9 C;  3V5U A;  2O7O A;  2IDO B;  4CXW A;  2WU5 A;  5LGN B;  2FUP A;  2K5B B;  3LFM A;  4PJM A;  2XTL A;  4LFB T;  3BJB A;  1D1A A;  3KIN B;  2X68 A;  2BKP A;  3G1M A;  2UUB T;  3BQY A;  1JNZ A;  2ODV A;  2W00 A;  3JAF A;  3TLU A;  3WAK A;  2XAG B;  3UUL A;  3B13 A;  4V1A v;  2J62 A;  5IOY A;  1KEY A;  1W0A A;  2W2U A;  3FBL A;  4FJO A;  3A5X A;  1QPI A;  3PUV F;  3HIM A;  2CE7 A;  3KKC A;  4PK4 A;  2FJ1 A;  1ZK8 A;  2DHR A;  5FNV E;  5J0Z A;  4HFC A;  2XY8 B;  3ZQI A;  2XHE B;  4CI3 B;  2XGC A;  3CX6 B;  5HEG A;  4LFA T;  2XGE A;  4TWF A;  2XQ5 A;  1T98 A;  3UTK A;  3FXD B;  4BA9 A;  2UXX B;  2I0M A;  2M6B A;  4MFR A;  1T56 A;  2W4X A;  3LK4 2;  4L5G A;  3SOL A;  5TAO A;  5F1J A;  2C5J A;  5F3J A;  2R6G F;  1WCR A;  4HEA A;  2V7K A;  4JI0 T;  4TNV A;  2V6Y A;  5LXT E;  2ZLY A;  2D9D A;  5CA1 E;  2WDQ A;  5L47 A;  3AEE A;  2LSI A;  2VVS A;  4HFB A;  2VB6 A;  2X51 A;  4HWD A;  4PFO A;  1WR6 A;  3DU5 A;  2IC6 A;  4U7I A;  4D5F A;  2BG9 E;  5KMG P;  1UGO A;  4DV6 T;  4DR6 T;  4MK6 A;  4N78 D;  3VHL A;  5LG4 A;  2GEN A;  5LCY A;  3V6G A;  2UUA T;  3ZCJ A;  4QWN B;  2W62 A;  4HGA A;  2X9W A;  3ZQL A;  5F04 A;  3B6A A;  3ZT5 A;  2V7M A;  4M1P A;  5EK4 A;  3LHQ A;  3AQS A;  5DJQ C;  4B1R A;  5HXC A;  5DQW A;  2J1D G;  2YOE A;  4PK6 A;  4NIQ A;  2KND A;  3ZQH A;  5LMN T;  2UUC T;  1FMV A;  5F08 A;  4Z8X A;  4UIG A;  3RGL A;  4I76 A;  2Y2Z A;  4WBO A;  4ANJ A;  2V6Y B;  3AEB A;  4GOU A;  3ZQG A;  4AKH A;  4UEL A;  1QVT A;  3HE0 A;  2R7T A;  3ZJ1 A;  1D0X A;  2XQ9 A;  5LMU T;  3ZLI A;  4IIJ E;  3PJA J;  2N9D A;  4GK0 E;  4DR2 T;  2IU5 A;  4UXN B;  3PUQ A;  4DV1 T;  2R7O A;  2R7X A;  3PUS A;  3CIR A;  5JVD E;  3T8O A;  3ETU A;  5F5W A;  3K3N A;  3RIU A;  2Y31 A;  4U31 A;  3DEW A;  3BNI A;  2WDR A;  2LM9 A;  3VR8 A;  3VPR A;  4H9N C;  3ZYK A;  4EB6 E;  4CXX A;  1J5E T;  4PK5 A;  1LRZ A;  3X1D A;  4JKZ A;  3TLV A;  3UU3 A;  5LA6 E;  3ZKR A;  3LSR A;  3J9X 1;  1N33 T;  4HFI A;  2NTX A;  4YY3 T;  3HTI A;  3RYH E;  4GFL A;  2H88 A;  4TN7 B;  1JTX A;  1ZKG A;  4ILB A;  3ONX A;  1RKW A;  3BQK A;  3P7I A;  3AA0 B;  2HH7 A;  5JDG A;  1WRD A;  5H6Q B;  2H7O A;  3N2G E;  2WM9 A;  5AQO B;  5FMN A;  4P0A A;  2CCQ A;  3WI3 A;  1DU2 A;  1W0B A;  1U9O A;  5FVL A;  2JJ9 A;  5LBQ B;  2ZMA A;  1HTJ F;  4EIW A;  3OPC A;  3ANP A;  4U9N A;  3RYC E;  2LOS A;  3VVY A;  5IWA T;  2Y30 A;  1OED C;  4ZXL A;  3FB2 A;  3N2K E;  4LF9 T;  4YTP A;  3UUN A;  2UXP A;  2J4G A;  2FBW A;  5LP6 E;  4XK4 A;  3KBU A;  4IGU A;  1E2A A;  3K3O A;  2C5I T;  2D5U A;  5JR9 C;  1A6I A;  3P4R A;  5L3E B;  2FJD A;  2XQ7 A;  4O4I E;  1G73 A;  3QUJ A;  4OYK A;  4IDN A;  5F8P A;  1JTY A;  2NP3 A;  2XPW A;  5L4E A;  5J1Y A;  2Q24 A;  4UV8 B;  3PAS A;  3LJL A;  4IT4 A;  3VVX A;  3GWH A;  4KUM B;  3NKZ A;  1WYB A;  3MJX A;  3BR3 A;  1HNW T;  2VK9 A;  3WHB A;  5K7Z A;  1X9B A;  2MBG A;  2IAI A;  2AE9 A;  4DUZ T;  2G0U A;  4CZZ B;  3LSP A;  5FGL A;  3JC6 C;  2F07 A;  5HBU A;  5L4H A;  3AAA B;  4QH1 A;  1U4Q A;  2NW7 A;  4YJ3 E;  3VKG A;  5CXI A;  5BMV E;  4JI2 T;  1U9N A;  3RIF A;  3FXE B;  4UVB B;  4OD4 A;  4F8H A;  2LHR A;  5H9T A;  4ILA A;  3TP3 A;  1SE7 A;  3UU8 A;  4AQF C;  5EFY A;  5F0F A;  4I55 E;  3AE5 A;  2Q9Q A;  2XAF B;  3GA8 A;  3EVY A;  2W61 A;  2V7L A;  2X66 A;  3D0T A;  3F31 A;  1IBL T;  2A72 A;  2BZB A;  1ZP0 A;  1VCS A;  5GON E;  3OVU A;  2DL1 A;  3UU5 A;  3EDV A;  2V26 A;  3ZJ2 A;  3BRU A;  4GYS A;  2XQ4 A;  3ETV A;  1KNZ A;  4HKA A;  5JDL A;  3AVR A;  4X62 T;  4CXY A;  4ZS2 A;  5FKN A;  2CPT A;  4DR1 T;  4QX7 B;  1YW0 A;  5DAB A;  4DV7 T;  1XZY A;  1XDO A;  4EXT A;  2HYT A;  3QPS A;  3C64 A;  4ERR A;  5IP6 A;  3RKG A;  5FKO A;  3VW1 A;  2PTF A;  2XAQ B;  1HCI A;  1OED E;  2MOZ A;  2JRK A;  2CBJ A;  4DMW A;  2CLY B;  3P4W A;  3VRA A;  3AXJ A;  3SWH A;  1XMQ T;  2KXP B;  4TV8 E;  3KV4 A;  4U74 A;  2WB5 A;  2X6O A;  3T1H T;  4GKJ T;  4TWD A;  2R7U A;  2KSR A;  2F4V T;  2W0G A;  3K3Q C;  3NXC A;  4CI1 B;  2Q9Q B;  4TZ4 C;  3H37 A;  3ZC1 A;  4M3E A;  4X1Y E;  3UFE A;  1FEW A;  3EAM A;  5LG3 A;  2I6H A;  3IH2 A;  4EYU A;  1HF8 A;  1S35 A;  2RPA A;  2ZM8 A;  4GFK A;  3EHZ A;  2FJI 1;  5ETW A;  2XPK A;  3ZN0 B;  1YXR A;  4M3D A;  3BTC A;  5LYJ E;  5FKM A;  4PFP A;  5LHG B;  2G7G A;  3E7Q A;  5EYR A;  4EED A;  4E7Z A;  4L62 A;  3P4S A;  3KV9 A;  5AQT B;  5JTG A;  3FZK B;  4UV9 B;  4KMC A;  2ZM6 T;  4ISS A;  2FD5 A;  3COL A;  4DID B;  1X79 A;  5JRE A;  2K24 A;  4IDP A;  1M62 A;  5LJM A;  4DR4 T;  1BR4 A;  2V5C A;  5D1R A;  4H63 H;  2FQ4 A;  3CML A;  1E1H B;  3CPZ A;  4UR9 A;  3C07 A;  3RX6 A;  2PFV A;  2IML A;  5GPC A;  4M3F A;  4DR3 T;  3BT9 A;  3AXJ B;  5LGT B;  4AKL A;  4EV6 A;  3ON4 A;  1SHZ C;  4UEM A;  5CB4 E;  3FIW A;  4IDQ A;  3CCY A;  3BR5 A;  3Q5E A;  5FKL A;  2QKO A;  3PJA A;  4UVC B;  3ANG A;  4H63 V;  2VKE A;  1BR1 A;  5AQV B;  2R7W A;  2YK0 A;  3O4X E;  1JUM A;  2PBI A;  3BR0 A;  4ZI3 C;  5ABF A;  4U9L A;  2QGS A;  4HWH A;  2ZCN A;  2CM0 A;  5ABG A;  1I6Z A;  3HI2 A;  5FL1 A;  3P50 A;  4IE4 A;  1YD8 G;  1YQ3 A;  1BR0 A;  3QBM A;  1MMG A;  2NW9 A;  2PZ9 A;  2LKH A;  2HQ5 A;  2DG8 A;  4COF A;  4JNN A;  2OF7 A;  3W15 B;  3O1J A;  3NRX A;  2D0T A;  3O8G A;  3BQZ A;  2BG9 A;  1CUN A;  2X0H A;  3V78 A;  4IST A;  2VAS A;  2LE8 A;  3TKL B;  4LF7 T;  2VKO A;  1WFD A;  3FZL B;  4B6X A;  3ZEF B;  3ZN1 B;  3PU3 A;  1YQ4 A;  3OKQ A;  4JI6 T;  5AQL B;  5HEH A;  2Q9Q D;  1QLB A;  4AC6 A;  2V7I A;  2XQ6 A;  3CRJ A;  2DWG A;  3ZMZ B;  2IHR 1;  3KVB A;  4TUY E;  2RP4 A;  3E08 A;  5K58 A;  3AE3 A;  4OHF A;  3I1A A;  5ABF B;  4I6Z A;  3LG7 A;  2YVE A;  3B5M A;  4B3M T;  3AE6 A;  4BAY B;  2UU9 T;  2HXO A;  2XM1 A;  2WZH A;  3CWZ B;  5HWY A;  2XDN A;  4MLK A;  4NUV A;  2LSJ A;  3MA9 A;  3C4W A;  3TLS A;  5M4Y A;  2RAS A;  3U78 A;  3BTJ A;  2E5L T;  4X5T A;  3RYF E;  3SFE A;  5LNK A;  2HN2 A;  4YXD A;  5GP9 A;  3OJA A;  2XB5 A;  3HTH A;  3RRC A;  4YTM A;  3GN5 A;  2I59 A;  4YTN A;  1HX1 B;  3PPB A;  5AQC A;  2R7Q A;  2BG9 B;  3I0Q A;  3BHQ A;  3PV0 F;  3NZP A;  3Q2M A;  1HX8 A;  1MMD A;  3G06 A;  2VWA A;  3IHR A;  1SA0 E;  2P9B A;  5AQG B;  2WSS V;  2KMF A;  3NS4 A;  1Z0P A;  3SRZ A;  1OWA A;  2YU2 A;  2Y6X A;  4X64 T;  4AQY T;  1KNR A;  4HFD A;  4AUX A;  3ZC0 A;  2VKJ A;  2WBL A;  4JYA T;  3QPL A;  4A98 A;  2X9X A;  5L3D B;  3G1L A;  3L39 A;  3J7Y q;  2G0E A;  3P4Q A;  3G1O A;  3T6N A;  3HKB E;  3RRW A;  3A8Y C;  5CA0 E;  3FBZ A;  4LMJ A;  4Q25 A;  3FRQ A;  3KDS E;  4JUY A;  4AQG A;  3O1I A;  2M6I A;  4OD5 A;  2ZCM A;  4H9R C;  5EK2 A;  5LBM A;  3FHN A;  4U33 A;  3PUW F;  4QH4 A;  2ZB9 A;  4L0R A;  4JEH B;  3F57 A;  4WIB A;  5F27 A;  3KYL A;  2CEA A;  5J1R A;  4Z91 A;  3N9O A;  3P4P A;  2E2A A;  3LSV A;  5HAW A;  4GCL A;  3ZMU B;  2Z6E A;  2HKU A;  4ZHQ E;  2RA1 A;  4X1I E;  4TX5 A;  5FYM A;  3IF8 B;  2YVX A;  3KNW A;  2Y48 B;  3RLF F;  4A5X A;  4QXH B;  3TP0 A;  1I94 T;  2W53 A;  3GN5 B;  3PUA A;  3TLW A;  5EZY E;  2E9X C;  4D7M A;  5AQM B;  4W97 A;  3Q9D A;  3KKD A;  3K1S A;  3CKD A;  4OX9 T;  4O4J E;  3SFI A;  4LML A;  2HYJ A;  4I4T E;  4P0B A;  2EHO C;  3ZMV B;  3DCF A;  4YJ2 E;  2NS7 A;  2LKG A;  2ZM0 A;  5K7F A;  5FXZ A;  2V5D A;  5FL0 A;  4X66 T;  3ZYM A;  3UQ4 A;  2YIN A;  3AA6 B;  3Q5D A;  4EZH A;  4LMK A;  3RI5 A;  1FJG T;  3PU8 A;  2W67 A;  1LVF A;  1UCU A;  4H9S E;  3N9N A;  4JI5 T;  4D7N A;  3WAJ A;  2NW8 A;  5FXV A;  2QRX A;  3RYI E;  1N36 T;  2BVL A;  2X9H A;  4A56 A;  2BS3 A;  2G7L A;  3HTA A;  3CQG B;  3B6C A;  2XGD A;  3LK2 B;  3IBP A;  4EGW A;  2FX0 A;  1GQE A;  5CW8 A;  4DMV A;  2ID6 A;  3ZMS B;  4WBN E;  3HR0 A;  1RPW A;  3PUR A;  2JQ9 A;  4LFC T;  4JV5 T;  1L0V A;  5ABH A;  3UU4 A;  5D19 A;  1Z0X A;  4U72 A;  4DR5 T;  1H7C A;  4B3A A;  1Y01 A;  4F6R C;  4YFS A;  4PW8 A;  4GCT A;  5EZG A;  3LBX A;  1IAP A;  5J1U A;  3C50 A;  2CXD A;  1V9D A;  4IL9 A;  4DV3 T;  4B3T T;  3M65 A;  5DAJ A;  2IC9 A;  5CQG A;  1JUP A;  3RD3 A;  3C98 B;  3HGY A;  4IRE A;  4AXP A;  4DND A;  4ZI2 C;  4GIW A;  5AQJ B;  4ABZ A;  4OFZ A;  2SPC A;  1IJ6 A;  5ABE A;  3KVA A;  4I50 E;  1OED A;  2CHN A;  3VVZ A;  2UXI A;  2DWK A;  2XSA A;  3NNR A;  3AAE B;  4HN9 A;  2LJL A;  2OI8 A;  2V6X A;  5JR9 A;  4MAL A;  3FK7 A;  1N32 T;  3HGG A;  4JI1 T;  1YKE B;  3ON2 A;  4JI3 T;  3LWJ A;  2UXU A;  1VI0 A;  3O9X A;  1VOM A;  5FKK A;  3OYX A;  3TLT A;  2ZY9 A;  1UI5 A;  4EYY R;  3BR1 A;  3PDY A;  3U3I A;  1WR0 A;  4NUU A;  1XNR T;  5JRC A;  4O4H E;  1IBK T;  2DTZ A;  2NP9 A;  2KLQ A;  3GZI A;  3MXZ A;  4C91 A;  2WGB A;  3QNU A;  3FZH B;  2WWU A;  3Q0U A;  2YN6 A;  4G12 A;  3VR9 A;  4IE6 A;  3NZQ A;  1T72 A;  2IW5 B;  4AQF A;  3HKE E;  3LBX B;  5JH7 E;  4NN1 A;  2B76 A;  2YEV C;  2H7V C;  1NEK A;  2GUH A;  2WY2 A;  4MBQ A;  2UXN B;  4KP3 C;  5HSZ A;  4O4L E;  5C2T A;  3HKD E;  2DLR A;  2WV1 A;  3Q3S A;  3N9Q A;  3ZSS A;  2DCF A;  1OED B;  3IH3 A;  4B3R T;  3RHW A;  4EEB A;  1IBM T;  2ACZ A;  3UFG A;  1U5P A;  2WQY A;  3ZPO A;  2H89 A;  1Z77 A;  3AEA A;  5JR9 B;  2X9Y A;  3K8P C;  4ACI A;  2LT3 A;  5AQU B;  5EZH A;  2NTY A;  1HG5 A;  2XAS B;  5IHY A;  3AE8 A;  5J3L A;  1HG2 A;  5AQS B;  3VUQ A;  2OPT A;  4DVY P;  4DV2 T;  3UQ7 A;  3LDQ B;  3N9M A;  5JRC B;  1UX5 A;  5HEU A;  3NRY A;  1ZKE A;  2JPF A;  4C90 A;  5L3C B;  1NEN A;  3AED A;  2BVM A;  2JIW A;  3V5S A;  4YSZ A;  4QX8 B;  3VW0 A;  2WU2 A;  2LRK A;  5AQR B;  5HWX A;  1JUS A;  1YKH B;  4DV5 T;  4KWA A;  4JBW F;  2W63 A;  1UUR A;  2XQ8 A;  3VIB A;  4K0U A;  3VOK A;  4YHH T;  4TV9 E;  2N2N A;  5FMP A;  4OYJ A;  1IZN B;  2QCO A;  3H3M A;  1HFA A;  4YSY A;  2DNX A;  3PTR B;  3CX8 B;  4LF5 T;  1RKT A;  2VVN A;  4BJM A;  2YU1 A;  5F0H A;  3PE0 A;  3RH2 A;  3NWI A;  2GK9 A;  4HFV A;  4W1U A;  3CJD A;  3RQW A;  2XSB A;  4UVA B;  4JI7 T;  3MK7 C;  2ACX A;  2D0U A;  2MAW A;  2R7S A;  2CBI A;  3PUX F;  5J2U E;  2PJQ A;  2OA5 A;  2CWY A;  4YHJ A;  2RHA A;  1SGM A;  3HTJ A;  3KBT A;  2JJ7 A;  4IDO A;  4ZS3 A;  3GEU A;  4UDS A;  2VKH A;  3AE7 A;  4JI8 T;  2R7R A;  3AB3 B;  2NX4 A;  5BR8 T;  1LVK A;  3DP7 A;  1OXZ A;  3AE9 A;  3SDG A;  3C51 A;  3Q5W A;  5HXH A;  4G63 A;  4ADZ A;  4JEU B;  3Q0W A;  3C4X A;  3WHC A;  4JYK A;  2LSY A;  3RH3 A;  4H9P C;  3ONJ A;  1J5W A;  3R84 B;  2UXC T;  3JAE A;  3NBX X;  4YZE A;  5AQF B;  2WZI A;  4XZC A;  3VTI A;  4ME9 A;  4KI0 F;  2I10 A;  2WCA A;  5LGU B;  3I9W A;  2M67 A;  4GKK T;  5LJN A;  3MZK B;  3BR6 A;  1WLX A;  4NEL A;  1B7T A;  1XNQ T;  2R7V A;  5GPA A;  4HKU A;  5C8Y E;  3NVO A;  5FP3 A;  3E0Z A;  2CRB A;  2JQQ A;  2A3D A;  4UF0 B;  3EDU A;  1VRB A;  4IHJ E;  2HHH T;  3AVS A;  1N34 T;  3AEF A;  5HYA A;  1T8B A;  2BS4 A;  1QVU A;  4KHZ F;  3MNL A;  1T7S A;  5JDM A;  2UXB T;  3F0C A;  4JLE A;  3FZM B;  4EAH A;  4KX6 A;  5HXE A;  3N2O A;  3EUP A;  1IJ5 A;  3JC6 D;  3MVP A;  4O2B E;  3RF1 A;  4HWI B;  4HFE A;  3AQT A;  3AAI A;  4U3C A;  4X65 T;  2GFN A;  4ZI7 E;  2QWT A;  4NPP A;  2ZM2 A;  1FIO A;  5IPA A;  4J2C A;  2LEH A;  4ZZC A;  2BKN A;  3R6N A;  4KBM B;  5AQP B;  2VKD A;  4O2A E;  2CXL A;  2QVA A;  1UI6 A;  3HL6 A;  2WP9 A;  3CVR A;  1HNX T;  4HWC A;  4WYV A;  3RIA A;  4DR7 T;  5L3F B;  2WMO A;  4ZOL E;  1MNE A;  5C3J A;  4YSX A;  2A9U A;  4EOZ B;  3M3Z B;  4CN1 A;  3SFD A;  1XWM A;  2C0S A;  2H3R A;  4JI4 T;  2HXI A;  3P9T A;  2LSK A;  1UUS A;  2EH3 A;  5IYZ E;  4QXB B;  4M3G A;  1NWM X;  3QC9 A;  4PAG A;  4PJJ A;  2MYS A;  5HEO A;  3RQU A;  5F0C A;  2REK A;  1Z8U A;  3JCF A;  3ZT6 A;  1W9R A;  5LOV E;  2BBJ A;  2IAK A;  5KX5 E;  4DV4 T;  3NRG A;  2E8I A;  3N9L A;  2X0Y A;  2IBD A;  1CHU A;  1WYC A;  3Q5X A;  1XMO T;  4WNK A;  2QTQ A;  3ZYL A;  3C4Z A;  4M3B A;  2HPJ A;  5L3G B;  4ZZB A;  3EI0 A;  3EGQ A;  5H6R B;  4DO0 A;  3PUZ F;  2YKS A;  1O3X A;  2RAE A;  4CN4 A;  2VL8 A;  4IE7 A;  4FI5 A;  4IE5 A;  2IEK A;  3ZT7 A;  4DV0 T;  2WAU A;  3AA1 B;  1HS7 A;  1MND A;  3ZST A;  3ZMT B;  3OBV E;  3KZ9 A;  5HXR A;  1G8X A;  2UXO A;  2BS2 A;  2E9X A;  3HKC E;  3B81 A;  2PG8 A;  2VUR A;  4NXM T;  3PUG A;  3BQL A;  1UK5 A;  4LF4 T;  1Y64 B;  2BKO A;  2BBH A;  4AIU A;  5JDH A;  2Y8D A;  2EHO A;  2VQE T;  5EK3 A;  5J2T E;  5KDM C;  2FJE A;  2HN1 A;  4ZI3 D;  3UU6 A;  1JT6 A;  3BQI A;  3DJB A;  3S5R A;  4DBQ A;  2FJA A;  2J47 A;  2NOX A;  2V8S V;  1D0Z A;  2UXD T;  3VP5 A;  2ZOZ A;  5FXW A;  5JDN A;  1J1J A;  5AQQ B;  3RPU A;  4IDZ A;  3PM1 A;  4MXM A;  3AEC A;  2VL0 A;  2QA7 A;  4V2G A;  1ZOY A;  4CQI A;  1MIY A;  2A2F X;  2XPU A;  2K3W A;  1EZ3 A;  2KWH A;  4OK0 A;  5AFU L;  4PNI A;  3VKH A;  3S4U A;  5C4Y A;  1HR0 T;  1R8I A;  5K7H A;  1QUU A;  2O7T A;  5AQH B;  3RIU C;  1JNR A;  4A97 A;  3N9P A;  1E7P A;  4ICH A;  3ANW A;  2WMN A;  3I0O A;  2JMK A;  2LM2 A;  5L2L A;  5HCJ A;  3O8H A;  4MHC A;  2LSG A;  2XM2 A;  4HE8 A;  3L3P A;  2WDV A;  4HTE A;  5DQV A;  4AI6 A;  3BTI A;  1FMW A;  2V57 A;  2D6Y A;  3AE1 A;  2UXH A;  5E0O A;  2WUI A;  3QOF A;  3F2E A;  2JK3 A;  1M7K A;  2E9X B;  2CHO A;  4GCK A;  2OV9 A;  3MKD A;  4I43 B;  4AKR B; 
#chains in the Genus database with same CATH homology
 2IC6 A;  1BR0 A;  4DVY P;  1MMG A;  3KV5 A;  5JDF A;  2NW9 A;  1ZEE A;  3DTO A;  5KMG P;  3N9M A;  2B3W A;  2K9A A;  5JRC B;  2EHO B;  3H3A A;  1UX5 A;  3NRY A;  1ZKE A;  2JPF A;  4C90 A;  3W15 B;  4N78 D;  5L3C B;  3VHL A;  3O1J A;  5LG4 A;  3NRX A;  5LCY A;  3RC3 A;  2BVM A;  3V5S A;  2D0T A;  4QX8 B;  4DBR A;  3ZCJ A;  5HWX A;  1YKH B;  4QWN B;  2W62 A;  2W63 A;  4HGA A;  4QHO A;  1CUN A;  4IE0 A;  3P8C D;  2X9W A;  4IST A;  2VAS A;  1MIW A;  2LE8 A;  3RKO A;  3TKL B;  1KK7 A;  4K0U A;  2V7M A;  4M1P A;  4TV9 E;  2VKO A;  2N2N A;  5EK4 A;  2L3L A;  1QSD A;  4OYJ A;  1IZN B;  2LOP A;  5DJQ C;  1HFA A;  4B6X A;  3ZEF B;  2V1D B;  2XQY A;  5HXC A;  3ZN1 B;  3PU3 A;  2DNX A;  5DQW A;  3PTR B;  2J1D G;  4O8S A;  3CX8 B;  3OKQ A;  4PK6 A;  4QKN A;  2KND A;  1UX4 A;  2Q9Q D;  4BJM A;  2V7I A;  2YU1 A;  1FMV A;  4ASK A;  2B1E A;  3PE0 A;  3ANW B;  2DWG A;  3ZMZ B;  4Z8X A;  5A1L A;  2GK9 A;  3KVB A;  4HFV A;  4UIG A;  5LHH B;  4TUY E;  2RP4 A;  3E08 A;  4WBO A;  4ANJ A;  4E7S A;  1AJ3 A;  4GOU A;  4OHF A;  3I1A A;  4UVA B;  3MK7 C;  2ACX A;  2D0U A;  4AKH A;  4UEL A;  3LG7 A;  2R7S A;  2R7T A;  4BAY B;  4ILU A;  3ZJ1 A;  5J2U E;  2D2S A;  2PJQ A;  2OA5 A;  1D0X A;  2CWY A;  2CLY C;  3ZLI A;  4IIJ E;  4YHJ A;  3CWZ B;  5HWY A;  3KBT A;  2C5K T;  2N9D A;  4MLK A;  4NUV A;  2LSJ A;  4GK0 E;  4ZS3 A;  3MA9 A;  3C4W A;  5M4Y A;  4UXN B;  2VKH A;  3PUQ A;  3U78 A;  2R7O A;  2R7R A;  3AB3 B;  4IRV A;  2R7X A;  3PUS A;  1LVK A;  5JVD E;  3DP7 A;  3T8O A;  1OXZ A;  3ETU A;  3C51 A;  3K3N A;  3RYF E;  3Q5W A;  5HXH A;  5LNK A;  2LM9 A;  4G63 A;  4ADZ A;  4JEU B;  3C4X A;  3OJA A;  3RRC A;  3GN5 A;  2I59 A;  4H9N C;  2MTQ A;  3E22 E;  2CA5 A;  3ZYK A;  2Q9Q C;  4CXX A;  2R7Q A;  2LSY A;  3I0Q A;  3RH3 A;  4EB6 E;  4PK5 A;  1LRZ A;  3NZP A;  4H9P C;  1MMA A;  3R84 B;  3Q2M A;  1MIV A;  2XAH B;  1HX8 A;  1MMD A;  2HPL A;  5LA6 E;  2VWA A;  3AA7 B;  3IHR A;  1SA0 E;  3NBX X;  3J9X 1;  2P9B A;  2K48 A;  2WSS V;  2KMF A;  2NTX A;  3NS4 A;  1Z0P A;  4XZC A;  1OWA A;  3SRZ A;  4X20 E;  3RYH E;  4YLH A;  2YU2 A;  4G2A A;  3VTI A;  2Y6X A;  4BJN A;  3KV6 A;  4TN7 B;  5LGU B;  3ZC0 A;  2VKJ A;  2WBL A;  3I9W A;  4XBF B;  2M67 A;  5LJN A;  2X9X A;  3MZK B;  5L3D B;  1WLX A;  2XUE A;  1B7T A;  3GMI A;  3ONX A;  2R7V A;  3J7Y q;  4AKG A;  5C8Y E;  5FP3 A;  3E0Z A;  2JQQ A;  2DI4 A;  2A3D A;  1ZHC A;  2ODU A;  3BQK A;  3P7I A;  3EDU A;  4UF0 B;  1VRB A;  2E9X D;  3AA0 B;  3HKB E;  4WW0 A;  3RRW A;  4IHJ E;  3LJC A;  2HH7 A;  5JQG E;  5JDG A;  3AVS A;  5CA0 E;  1WRD A;  3FBZ A;  5H6Q B;  2H7O A;  3N2G E;  1S94 A;  5HYA A;  3DU6 A;  2WM9 A;  3L09 A;  4EZ4 A;  3KDS E;  5JDM A;  4JUY A;  4AQG A;  5FMN A;  3O1I A;  4P0A A;  2L8K A;  2CCQ A;  4OD5 A;  4JLE A;  3WI3 A;  4EAH A;  3BK9 A;  5ADX L;  4H9R C;  5HXE A;  1US7 B;  2EHO D;  5LBM A;  3N2O A;  5EK2 A;  3RC8 A;  3FHN A;  1IJ5 A;  5FY1 A;  2JJ9 A;  5LBQ B;  3JC6 D;  5FXX A;  4O2B E;  2ZMA A;  4L0R A;  4JEH B;  1HTJ F;  3F57 A;  4PJN A;  2CEA A;  3KYL A;  1MMN A;  3QK6 A;  3RYC E;  4EIW A;  3N9O A;  2X67 A;  2LOS A;  3ZMU B;  2Z6E A;  3AAI A;  2L9Q A;  4ZHQ E;  3FB2 A;  3N2K E;  2RA1 A;  3UUN A;  3CQX C;  3ZCI A;  4X1I E;  4ZI7 E;  5LP6 E;  3KBU A;  4IGU A;  4TX5 A;  3K3O A;  2ZM2 A;  5FYM A;  2C5I T;  1FIO A;  3IF8 B;  3OYZ A;  2D5U A;  3B57 A;  5JR9 C;  4AKI A;  2Y48 B;  4H9Q C;  4QXH B;  3CQC B;  4GK5 E;  3IEE A;  4UF0 A;  2CWO A;  2KZ7 B;  3GN5 B;  3CX7 B;  4J2C A;  4QXC B;  4CI2 B;  3PUA A;  5L3E B;  1D1C A;  2X0L B;  2LEH A;  2CXF A;  4GYR A;  5EZY E;  1BR2 A;  2E9X C;  4O4I E;  3R6N A;  1G73 A;  4KBM B;  3QUJ A;  4OYK A;  5F8P A;  2KIN B;  2VKD A;  3LK3 B;  3Q9D A;  3VU7 H;  4O2A E;  4UV8 B;  3GWH A;  4KUM B;  2CXL A;  1WYB A;  3MJX A;  3HL6 A;  3CKD A;  4L9I A;  2VK9 A;  3CVR A;  2JMH A;  4O4J E;  3UUM A;  2MBG A;  4X1K E;  4DVD A;  4I4T E;  4P0B A;  2EHO C;  3ZMV B;  2G0U A;  2XAJ B;  4CZZ B;  4YJ2 E;  2WMO A;  5L3F B;  4ZOL E;  2ZM0 A;  1MNE A;  1ZV4 X;  3JC6 C;  2BDE A;  2KT9 A;  5FXZ A;  3AAA B;  1U4Q A;  4EOZ B;  2NW7 A;  3ZYM A;  4YJ3 E;  2YIN A;  3VKG A;  3AA6 B;  5L3B B;  5FY0 A;  4EZH A;  5BMV E;  3FXE B;  3UUX B;  4UVB B;  4OD4 A;  3PU8 A;  1D1B A;  2LHR A;  1LVF A;  2KWI B;  2C0S A;  2LHN A;  1UCU A;  4PJL A;  2H3R A;  4AQF C;  4H9S E;  2LSK A;  3N9N A;  5JDQ A;  3MAC A;  4I55 E;  5IYZ E;  5FY7 A;  2Q9Q A;  4QXB B;  1NWM X;  2XAF B;  3GA8 A;  4ZI2 D;  3EVY A;  3QC9 A;  4PAG A;  2W61 A;  4PJJ A;  3WAJ A;  2NW8 A;  2MYS A;  2V7L A;  3ESL A;  5FXV A;  3RYI E;  1D0Y A;  2BVL A;  2V7J A;  2X9H A;  2X66 A;  3D0T A;  4A56 A;  3CQG B;  3F31 A;  2A72 A;  3N5L A;  2BZB A;  3LK2 B;  3IBP A;  5GON E;  5LOV E;  3EDV A;  4H9O C;  2V26 A;  3UT5 E;  3ZJ2 A;  4GYS A;  3KFW X;  3ETV A;  5HXS A;  1KNZ A;  4HKA A;  4DMV A;  5JDL A;  3AVR A;  2IAK A;  1LKX A;  5KX5 E;  2NWB A;  3ZMS B;  3EUH A;  4WBN E;  3HR0 A;  3O1H A;  3PUR A;  4CXY A;  4ZS2 A;  4XAX B;  2E8I A;  3HA4 A;  3N9L A;  4QX7 B;  1YW0 A;  2ES0 A;  5DAB A;  4U72 A;  1H7C A;  5J1G A;  1WYC A;  4EXT A;  4C2M A;  3C64 A;  3Q5X A;  4P09 A;  4ERR A;  4F6R C;  4YFS A;  4WNK A;  2XAQ B;  5LHI B;  4PW8 A;  5HAX A;  1HCI A;  3ZYL A;  3C4Z A;  2MOZ A;  3LBX A;  2HPJ A;  1IAP A;  2CMR A;  5L3G B;  3C50 A;  2CXD A;  1V9D A;  2JRK A;  2N1G A;  3M65 A;  2IC9 A;  5CQG A;  5H6R B;  4DMW A;  4DO0 A;  3C98 B;  4AXP A;  4DND A;  4ZI2 C;  2CLY B;  1O3X A;  4GIW A;  3SWH A;  4OFZ A;  2SPC A;  2VL8 A;  1IJ6 A;  2KXP B;  3KVA A;  4I50 E;  4FI5 A;  4IE7 A;  4TV8 E;  3KV4 A;  3I9Y A;  4U74 A;  3SS1 A;  2DWK A;  1NAF A;  4IE5 A;  3AAE B;  4HN9 A;  2LJL A;  3V5U A;  5JR9 A;  2R7U A;  4MAL A;  2W0G A;  2WAU A;  4CXW A;  5LGN B;  3K3Q C;  3AA1 B;  2K5B B;  3LFM A;  4PJM A;  2XTL A;  1HS7 A;  1YKE B;  1MND A;  4CI1 B;  3ZMT B;  2Q9Q B;  3OBV E;  1D1A A;  3KIN B;  2X68 A;  4TZ4 C;  5HXR A;  1G8X A;  3H37 A;  3ZC1 A;  2ODV A;  2E9X A;  3HKC E;  2W00 A;  2PG8 A;  4X1Y E;  3WAK A;  3UFE A;  1FEW A;  2XAG B;  3PUG A;  3UUL A;  3BQL A;  3O9X A;  3B13 A;  1VOM A;  4V1A v;  3OYX A;  4EYU A;  1Y64 B;  4EYY R;  1HF8 A;  3PDY A;  3U3I A;  1S35 A;  5JRC A;  4NUU A;  2ZM8 A;  2Y8D A;  2EHO A;  4O4H E;  5JDH A;  3FBL A;  2FJI 1;  4FJO A;  5ETW A;  5EK3 A;  5J2T E;  3ZN0 B;  3A5X A;  2NP9 A;  5KDM C;  5LYJ E;  4ZI3 D;  4PFP A;  5LHG B;  3BQI A;  2KLQ A;  3DJB A;  4DBQ A;  4E7Z A;  3MXZ A;  3KV9 A;  2NOX A;  1D0Z A;  4C91 A;  2CE7 A;  4UV9 B;  4KMC A;  5FXW A;  2WWU A;  4ISS A;  5JDN A;  4PK4 A;  3RPU A;  1X79 A;  5JRE A;  2K24 A;  4IDZ A;  4IE6 A;  2DHR A;  3NZQ A;  5FNV E;  2QA7 A;  5LJM A;  4CQI A;  2IW5 B;  4AQF A;  1MIY A;  3HKE E;  1BR4 A;  3LBX B;  2XHE B;  2A2F X;  4H63 H;  5JH7 E;  3CML A;  4CI3 B;  1EZ3 A;  2H7V C;  2YEV C;  3CX6 B;  1E1H B;  3CPZ A;  2KWH A;  3RX6 A;  4MBQ A;  2PFV A;  2UXN B;  4KP3 C;  4OK0 A;  1T98 A;  5AFU L;  4PNI A;  3VKH A;  3S4U A;  4O4L E;  1QUU A;  3HKD E;  2DLR A;  3UTK A;  3FXD B;  4BA9 A;  5LGT B;  2UXX B;  4MFR A;  4AKL A;  3LK4 2;  3N9Q A;  1SHZ C;  4UEM A;  2DCF A;  3N9P A;  5CB4 E;  4L5G A;  3SOL A;  5TAO A;  3ANW A;  2WMN A;  1U5P A;  3I0O A;  2C5J A;  2JMK A;  5F3J A;  5L2L A;  3ZPO A;  2LSG A;  2V7K A;  4HEA A;  4MHC A;  4H63 V;  4UVC B;  4HE8 A;  3L3P A;  5JR9 B;  1BR1 A;  2X9Y A;  3K8P C;  4HTE A;  2R7W A;  5DQV A;  2LT3 A;  2YK0 A;  3O4X E;  4AI6 A;  2PBI A;  1FMW A;  4ZI3 C;  5LXT E;  2ZLY A;  2QGS A;  5CA1 E;  2NTY A;  5E0O A;  2CM0 A;  3F2E A;  3HI2 A;  2E9X B;  2LSI A;  1HG5 A;  2XAS B;  3MKD A;  5IHY A;  2VB6 A;  2X51 A;  4IE4 A;  4I43 B;  1HG2 A;  1YD8 G;  4AKR B;  4PFO A;  1WR6 A;  3DU5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...