3K8PC

Structural basis for vesicle tethering by the dsl1 complex
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
352
structure length
295
Chain Sequence
NIYTTLKFESMMQQRVIQIRSIPEEEYHELVSVQPIQVSVFVQSAAKVFTEFEQGCDTIGRSKVESIYLYKFNLLQTAFFAMVSEKVNDWTQLYKDVRYLYTENPKLLQLMELNSRRLDLNLNLIKKTIYKLVNDQLQELKDNERTPDWDITISSLLPYLKKTALPTLYKLEDNTILVALIRYIVHDLVIDNILHWRVISEKSSENLSEFIMLLLSGLEIPRLNLIETYRHSREKLGILSKILTAHLKDILEMFYEGEFFLFETDEIVQWIILLFADTPTRRDCIDEIRRVREEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A structure-based mechanism for vesicle capture by the multisubunit tethering complex Dsl1.
pubmed doi rcsb
source organism Kluyveromyces lactis
molecule tags Transport protein/transport protein
molecule keywords Dsl1
total genus 112
structure length 295
sequence length 352
ec nomenclature
pdb deposition date 2009-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF11989 Dsl1_C Retrograde transport protein Dsl1 C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.150 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor; domain 2 3k8pC02
1.20.58.1440 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3k8pC01
3K8PC
chains in the Genus database with same CATH superfamily
2GENA 2H89A 2D0UA 4G2AA 1D1CA 5KDMC 4JV5T 1U5PA 4QKNA 3C50A 1H7CA 3K3OA 3UUXB 3RYCE 3CX8B 2WU5A 3PUAA 1OEDC 3ZQHA 2XY8B 4ABZA 3C4WA 3HR0A 1T56A 4HFVA 4OYJA 2H88A 2ZM6T 3ZT7A 3KV6A 4KBMB 4QH1A 5FHPA 2V7IA 4U2YA 2VKDA 1Z0PA 4YSYA 2X9WA 2XUEA 1FMWA 4U72A 1XNRT 2CBIA 5JDFA 2Y48B 4ILUA 3V5SA 5F1JA 3BTJA 2X9DA 3P4PA 4W97A 5HCJA 2D6YA 2YVXA 1IZNB 4UVAB 4DV5T 2KMFA 5HSZA 4B3TT 1WFDA 2RAEA 3I9YA 4DR6T 1KFYA 2RPAA 1YW0A 3CWRA 4JI4T 2O7OA 4GCTA 2LOSA 2YEVC 5L3DB 4KHPT 3P7IA 3NBXX 4XBFB 1UK5A 4Q25A 3IBPA 5HBUA 3C64A 4AF5A 2M6BA 3PASA 4U33A 5E0OA 2MTQA 2O7TA 3M3ZB 2IC6A 2N9DA 3VTIA 5HAWA 2CEAA 3RKGA 3EVYA 5JREA 4HEAA 3TLTA 2Y30A 4DO0A 2CA5A 4ZOLE 3N2OA 4AQGA 3MNLA 4HFEA 2JQQA 3G56A 3EHZA 2LRKA 3L8RA 2LE8A 4ACIA 5AQPB 4C2MA 4I76A 3Q9DA 5AQRB 1WYCA 4TN7B 2FD5A 3PUSA 4B3ST 5HAXA 4HWCA 2R7RA 4UIGA 2YVEA 4H63H 1NENA 1YQ3A 4MHCA 4F6RC 2ZCNA 2CLYC 3OYXA 4ISSA 3ZSSA 2XM1A 1HG2A 3B5MA 2JQHA 2W62A 2JQ9A 1W0AA 1OEDA 4EEDA 3ON4A 2ZM0A 1J1JA 2TCTA 2OPTA 1N33T 5LMNT 2LKHA 1B7TA 4PJLA 3Q0WA 3ONLC 3AE4A 4I55E 2XDNA 5BR8T 4KX6A 5IOYA 2PFVA 2Y31A 4TV8E 2VKHA 2WV1A 3N9LA 3MVPA 3KV4A 4DNDA 1SGMA 5LJNA 1S35A 4LMKA 5EZYE 2N1GA 1XZYA 5L3FB 2YDQA 3JADA 3HKCE 4HWIB 2XQ7A 3T6NA 3RF1A 4CI3B 3K1SA 2YU2A 1QPIA 3SDGA 4M3GA 2LOPA 5L3EB 2UXUA 4M3BA 1R8IA 4EEBA 2XSBA 3B6AA 5F08A 4YT0A 5FVLA 3ZQIA 4ZEYA 3QQAA 2YDSA 3PUVF 5GONE 4Z91A 2ZM2A 2PG8A 3N9QA 5D19A 4ZS3A 3PU3A 4JI0T 2JMKA 1US7B 4GCLA 4UXNB 1RKTA 4GFLA 2FUPA 1RPWA 4U3CA 5GPCA 1FMVA 2QRXA 4PFPA 3ZYMA 4LFCT 3O8HA 2FJAA 3P8CD 4BAYB 2LHRA 4A97A 3F2EA 2WUIA 4IGUA 4EIWA 5CB4E 3RC3A 2XRLA 2IC9A 3ZQLA 2L3LA 3HI2A 2Q24A 3NRXA 1ZKEA 3G1LA 3ONJA 4LF8T 3KV9A 2R7XA 4O4JE 2IW5B 4HWFA 4WYVA 4LFAT 4ILBA 3ONXA 5EFYA 3BR5A 5HXSA 4V2FA 4NELA 3J9X1 3HTHA 2H3RA 4Z90A 2J62A 1BR0A 2WDRA 2M6IA 2XPWA 1QSDA 3TLVA 4HKAA 2DWGA 1Z77A 4UR9A 2QWTA 2KLQA 1N32T 2PBXA 2YVHA 4MLKA 1QVTA 2BS3A 1MMNA 3HE0A 3AE6A 1CUNA 1XNQT 3MA9A 5FY0A 4B1RA 3ZYLA 4U74A 3AE3A 3RRCA 2VVNA 2WDVA 5JR9A 4K0UA 5DABA 4GFKA 4YSZA 5AQCA 4O4IE 4PK6A 3EABA 4X5TA 2PZ9A 1U9OA 2BKNA 4UF0B 4HFBA 2V6YA 3C4ZA 3I0QA 2ID6A 5JDNA 3VRBA 4XZCA 1MMAA 4AQYT 1ORKA 4CXWA 4ZHQE 3ESLA 5HEUA 2G0UA 3PU8A 3BQYA 1HNZT 3JC6C 5AQHB 2V5CA 4V1Av 2W2UA 3RX6A 5AQFB 3DU6A 2VVSA 1XDOA 3TLSA 4B6XA 1UGOA 5JH7E 3VKHA 2VB6A 3B13A 3HTAA 5H6QB 3WHCA 1U4QA 4WZXA 2EHOD 2JQKA 2BS4A 3BCGA 4U7YA 2HYJA 2IMLA 3O9XA 3IUVA 4AKGA 2XJ7A 1IJ5A 2L9QA 3IH4A 3MXZA 3MK7C 3AE5A 2PJQA 2W66A 1IJ6A 3RGLA 4O2BE 4MALA 2YU1A 4IT4A 3AXJB 4AXPA 3O1HA 5IOZA 2LJLA 3VIBA 4IDPA 2W53A 4GYRA 1ZHCA 2X0HA 4YTNA 3VVXA 1DU2A 2KINB 3KVAA 1T72A 4HTEA 3KDSE 4IE5A 2LHNA 4B3RT 2RHAA 4JI3T 3GWHA 2ZMAA 4HFIA 3AEEA 2LM9A 4EZHA 2XHEB 2NTXA 5FYMA 4V2GA 4I6ZA 2CRBA 3AA7B 4LMJA 3WI3A 3ZKRA 4AKIA 4COFA 3ZMUB 5JDLA 5FY1A 3S4UA 4ZZBA 3E08A 3D0TA 3ZJ2A 4JUYA 3TKLB 3SFIA 3C51A 2HKUA 3N2GE 1D0XA 3MZKB 4DV7T 1IBKT 1T8BA 2SPCA 2ZLYA 3Q5DA 2KXPB 2IEKA 3FBZA 3DEWA 3GMIA 5J1YA 5AQVB 4TUYE 3VW2A 3I0OA 3LK42 2ZB9A 4TZ4C 3KINB 4OYKA 3J7Yq 1SA0E 3AXJA 2VQFT 3ZPOA 2QIBA 5J1GA 3ANGA 4DUYT 1LVKA 3LSPA 5A1LA 4ZI7E 2I6HA 3FK7A 5FMNA 1NAFA 2V6YB 1SHZC 1JNRA 3UULA 2LKGA 2X67A 2XPVA 4ZI3C 3FBLA 3KBUA 2ACXA 4HFHA 2Q9QD 2GFNA 5L2LA 2HXIA 4W1UA 5CXIA 4U2ZA 3HIMA 4QH5A 2C5IT 3UTKA 3ANPA 2UUAT 5JDMA 3PE0A 2NW8A 5HEOA 1HFAA 3PM1A 3OJAA 3PURA 5FKOA 4KI0F 3RHWA 4NXMT 4YY3T 3AAEB 3Q5XA 4AKHA 4WW0A 4NIQA 4DR2T 5KXJA 3K3NA 2XAGB 3P4SA 3IHRA 3ZMTB 3ZMZB 1OWAA 4ZI3D 4IE4A 5ABFB 3BJBA 4L9IA 5ABEA 2X68A 3ANWB 5AQMB 3G1OA 4ILAA 2C5KT 4Z8XA 4LF7T 1M62A 2LSJA 1HNXT 3F31A 4ILCA 4JI1T 3RIUA 4AI6A 2BG9B 4PJNA 5LJMA 2LSGA 3RD3A 3C98B 3RYIE 1Y01A 2XB5A 2RASA 2H7VC 3TP0A 4X65T 2HN2A 4OFZA 5K58A 2FJEA 3U78A 2TRTA 2UXBT 3ZCIA 3ZEFB 4I50E 2Y6XA 2WCAA 1J5ET 1W0BA 3RC8A 4ERRA 2G7LA 2K9AA 3H37A 3LOCA 3PJAJ 4H9NC 2C5JA 3BK9A 3AAIA 1WCRA 2QVAA 4CZZB 3PUZF 4G63A 1T7SA 4NN1A 4TNWA 1X79A 4QX8B 3Q3SA 2L8KA 2XTLA 4L5GA 4UV8B 1MIYA 2AXDS 5LNKA 4I0UA 4DV6T 4IDNA 3VPRA 3M65A 3RQUA 1QUUA 2V7JA 1ZEEA 3KBTA 4YTPA 5AQUB 3AEBA 5ABFA 5JDQA 1YKHB 2UUBT 5AQGB 3BHQA 1NWMX 3ON2A 3O1JA 3UT5E 4LFBT 3UUMA 2NW7A 2ID3A 1UX5A 4IL4A 2LSKA 2CWYA 2BDEA 2LM2A 4O4LE 1YD8G 4EXTA 3AA0B 3KFWX 2D2SA 4M1PA 4PJJA 2A3DA 3DPJA 3UUBA 4ZXLA 1E1HB 2WP9A 2ODUA 2WY2A 2WGBA 3L09A 2CXFA 1FEWA 1JUSA 5HWYA 5GP9A 3HGGA 2DI4A 2LT3A 3AAAB 3E22E 5F27A 1KNRA 4UF0A 5AQLB 5FXZA 3R84B 4AC0A 4DIDB 5IP6A 5FKNA 3N2KE 4YLHA 3FB2A 3KV5A 2XQ6A 4ADZA 4DR5T 1Z0XA 3CPZA 3BQLA 2NWBA 2A72A 2JRKA 5FMPA 2E9XC 2WU2A 5CJ5A 3LBXB 3F57A 2PBIA 2DTZA 2XPKA 5H6RB 3RIFA 4JI6T 5LYJE 4GKJT 3JCFA 3Q0UA 5JDHA 5KMGP 3L3PA 1HNWT 4DW6A 5IYZE 4A5XA 2LLYA 2WWUA 4ME9A 2UU9T 2OF7A 3COLA 3CQCB 3P4WA 2IHR1 2M67A 3EAMA 1I6ZA 4TWFA 2KNDA 1OEDB 5HXRA 1KEYA 4HKUA 3RPUA 5L4HA 3BRUA 4YZEA 5FY7A 4MBQA 1BJZA 5TAOA 1D0YA 5CW8A 3G1MA 2K5BB 2I59A 3I9WA 3BR3A 5JDGA 4M3DA 5LBMA 3V6GA 4JI8T 2VWAA 1QVUA 3NKZA 3HKEE 1MMDA 2QGSA 2BG9E 2VURA 2R7VA 4U9NA 1MNDA 5CGMA 3BQKA 2VPRA 4X66T 2ZCMA 4LF6T 3VW0A 1HX1B 1KNPA 4NXNT 1JUPA 3BR6A 2ODVA 3ETVA 1WRDA 2KWIB 4YJ2E 2XSAA 3QKXA 2R7TA 4PAGA 3LSRA 4CI2B 1GQEA 4M3EA 2XQYA 4UDSA 3RIUC 5AQTB 3UU4A 5FL1A 3HA4A 2XQ4A 1QLBA 3BR0A 5LHGB 3Q5EA 3BQZA 4KP3C 3AA6B 3A7MA 3AE2A 3QPSA 5CQGA 5LHHB 1XDPA 2XQAA 3CDLA 5LB7B 4QXCB 3L39A 2V7KA 4DMWA 2CM0A 4DV4T 4F8HA 3UFGA 2XAJB 4ZI2D 1HX8A 4IE7A 4IE6A 3EDVA 2DL1A 5HXHA 4B3MT 2EHOC 4FJOA 5IUXA 1KF6A 3RH2A 1I94T 3CRJA 2D9DA 5J1RA 3PUQA 1UURA 2OLTA 1SE7A 2KT9A 4LF5T 4DVDA 1KNZA 5K7FA 4U31A 4YXDA 2CBJA 3JC6D 4TNVA 2YOEA 3ZMSB 3QK6A 2UXDT 3EUPA 2E9XA 4PK5A 1IBLT 2CLYB 4EZ4A 5HEJA 1W09A 3VU7H 3WAJA 2GUHA 2LSIA 2Z6EA 3AEFA 5J2UE 2E2AA 2EHOB 2WBLA 4WIBA 3GN5B 4YHHT 2A2FX 3AQSA 4CN6A 2CHNA 2F4VT 2OI8A 2Y8DA 3FHNA 3BR1A 5AFUL 3CJDA 3IH2A 4HWDA 4MK6A 2MPKA 2X0LB 3RYHE 2HXOA 4CXYA 1D1AA 4G12A 3W15B 2IDOB 1WLXA 2JJ9A 1W9RA 4YHJA 4ZI2C 2ACZA 2V57A 4AKLA 5CA1E 2BZBA 2DWKA 3HGYA 4GK5E 4JI7T 3NZQA 4KMCA 5DAJA 5JR9B 3JAEA 4GIWA 3T8OA 3NZPA 4QHOA 1XWMA 2UXIA 4CN4A 5FXVA 2JIWA 3PV0F 1ZV4X 2BKPA 1LVFA 4OD4A 4HGAA 5JRCA 2G3BA 4QH4A 4GKKT 4XK4A 3A8YC 4A98A 2HPJA 2LRLA 2XAQB 3TLUA 3T1YT 5LBQB 4X1EA 4TV9E 4ZZCA 3ANWA 5AQKB 3QBMA 4UV9B 2JMHA 3ZC1A 2XQ8A 1UI5A 3RLFF 5FVKA 1BR4A 3QPLA 4K0KT 1CHUA 3H3AA 4DUZT 2R7SA 4P1NA 3HTIA 2E5VA 3ZLIA 3VVYA 3KNWA 1UI6A 2NP9A 2W0GA 3ABVA 4IREA 3DP7A 2HQ5A 2W67A 2FX0A 5F0HA 1WR6A 3FZKB 3T1HT 4E7SA 4O4HE 2FJ1A 5J2TE 2G7SA 5ABGA 3C2BA 3VW1A 5LA6E 4JYKA 4GOUA 2FJI1 5BMVE 3E0ZA 3PDYA 4KWAA 4QXBB 3ZJ1A 3DCFA 5AQNB 5EK4A 2RA1A 4JYAT 2NR4A 5EZHA 2H7OA 3NPIA 4IRVA 3GZIA 1YXRA 2CMRA 3WAKA 4EYUA 4JNNA 1S94A 3A5XA 2WDQA 3EDUA 2AE9A 2NS7A 4U7IA 2R7WA 3AE8A 2QCOA 4IDOA 5JR9C 4DR1T 3NXCA 1JTYA 5LXTE 3AE9A 3VRAA 4X1KE 4DBRA 2VKVA 2R7QA 3CVRA 3IH3A 2OV9A 5J0ZA 2XM2A 3AEDA 3LJLA 3AVRA 1HTJF 3FZMB 4LF9T 4AQFA 4DBQA 2X9XA 4FI5A 3VP5A 3TLWA 3LFMA 3CX7B 2X6OA 5FKMA 4IL9A 5LMUT 4DVYP 2UXOA 4EYYR 4NUVA 3C07A 3N9OA 1VRBA 1YQ4A 5JRCB 5HEGA 1FJGT 3VOKA 5EZGA 1ZOYA 2DG8A 3BNIA 2D0TA 3OVUA 2I10A 4JI2T 1VOMA 3GEUA 4O2AE 3B6CA 4YSXA 3P4RA 1EZ3A 3ZQFA 2X9HA 2C0SA 3AA1B 4BA9A 2V7LA 5HWXA 3QC9A 3FXDB 3UU5A 2HPLA 5D1RA 3I1AA 3FZHB 2KSRA 2NW9A 2GK9A 3N5LA 3PUXF 2ZCXA 2WAUA 3B57A 1U9NA 4DR4T 3N9PA 4DV2T 4LMLA 4EGWA 3FZFB 1KK7A 1LRZA 4NPPA 4LF4T 3ZSTA 4JL3A 2XGEA 2G0EA 3B81A 3P9TA 2JK3A 4GK0E 3O8GA 3OTOT 3GN5A 2UXXB 4D5FA 4YTMA 3FRQA 3RRWA 3EGQA 3AQTA 4PK4A 2I0MA 3PJAA 1VI0A 2CHOA 2YINA 1WYBA 4H9SE 3FIWA 2BG9A 4UVBB 2VQET 2Y2ZA 2YN6A 4I4TE 3BTCA 2NTYA 3CX6B 3F1BA 3VKGA 5HXEA 2UUCT 2A9UA 3V5UA 2N2NA 3BR2A 4HE8A 1OEDE 1X9BA 5LGUB 2DHRA 1Z8UA 1HS7A 2F07A 3Q5WA 5AQOB 1MIVA 4QWNB 5LP6E 3AB3B 2EH3A 3ZQGA 1AJ3A 3RH3A 2VASA 1SUMB 2NP5A 4N78D 2CXLA 4PW8A 4WNKA 2WMNA 5J1UA 5FP3A 2R7OA 2V5DA 2CE7A 3MACA 5LOVE 4UVCB 1NEKA 2VL0A 3ZCJA 3O60A 2OERA 3PPBA 3Q2MA 4TWHA 2W63A 2J4GA 3AECA 4L0RA 1YKEB 2R7UA 2J47A 5FXXA 3N9NA 3R6NA 4HFDA 1MNEA 3LJCA 3ZYKA 3KKCA 4IE0A 5L3GB 4CQIA 4A56A 2ZM8A 5AQQB 3OYZA 4EAHA 3ZN0B 3KYLA 3PUWF 4P0BA 2V6XA 5FNVE 3HKDE 3HL6A 3PTRB 1L0VA 2W00A 4AC6A 5ADXL 3H3MA 5FGLA 4O8SA 4JLEA 4X1IE 2BBJA 1V9DA 5HCMA 2WSSV 4IHJE 3RQWA 1FIOA 2HN1A 4D7MA 2XQ3A 3MJXA 2XQ9A 2MBGA 4H9QC 2P9BA 2Q9QA 1VCSA 2DLRA 3WHBA 5LCYA 3E7QA 2V26A 5IPAA 2WQYA 5LHIB 2KZ7B 3LDQB 4D7NA 3C4XA 3IA3A 4J2CA 2MAWA 4KUMB 4XAXB 4DR7T 4YJ3E 1G73A 3VOXA 4JEUB 5FKYA 2BKOA 3QB5K 4YFSA 4H63V 2VL8A 1MMGA 4NUUA 4AUXA 2UXCT 3QB5A 4EV6A 5F0FA 3EI0A 2FQ4A 4X64T 1JNZA 2UXHA 4DMVA 5L47A 4HN9A 2YKSA 2QTQA 5LG3A 3CCYA 3VUQA 4QXHB 4I43B 2XZEA 3JSJA 5L3CB 3SRZA 2G7GA 2YK0A 3LK3B 5M4YA 4UEMA 3RI5A 2PTFA 3UFEA 1O3XA 3LSVA 5LG4A 2YDRA 4IDZA 2HYTA 2X0YA 4D5CA 4E7ZA 2XGDA 5JVDE 3CQXC 2B3WA 3N9MA 3P4QA 2WZIA 2JPFA 5F0CA 2FJBA 1OXZA 1T98A 1BR2A 4JBWF 4PJMA 5CXGA 3NNRA 4P0AA 3KKDA 2WB5A 3UU6A 4ASKA 4AKRB 3GA8A 3U3IA 2K3WA 3AVSA 3Q0VA 1VCTA 2WS3A 2FJDA 5JTGA 3SFDA 1N36T 2NP3A 4C90A 3LWJA 4ZS2A 3LG7A 3QOFA 3KZ9A 2K48A 4JI5T 1E7PA 2E8IA 2NOXA 3DU5A 1JTXA 5IHYA 2CCQA 1JT0A 4TX5A 3IF8B 2DCFA 4HWHA 2IAIA 2QA7A 3FXEB 2WM9A 4DR3T 3VR9A 2VK9A 4P09A 1IAPA 3VVZA 4EB6E 5KX5E 2UXPA 3RKOA 2KWHA 3NRYA 3K8PC 2IU5A 4ICHA 3BQIA 2B76A 3ETUA 2XAFB 5D18A 2XAHB 4JKZA 2Q9QB 5GPAA 5FL0A 2UXNB 5H9TA 2HH7A 5DQVA 1D0ZA 4AISA 5DQWA 3BTLA 1IBMT 2BG9C 3KVBA 2XQ5A 2IIUA 3K3QC 5J3LA 1HCIA 3FZLB 2CWOA 3NS4A 5HYAA 4H9PC 3AEGA 4AQFC 1T33A 2BVLA 3CQGB 3LHQA 3TP3A 4OD5A 1LKXA 4OK0A 3NI7A 2MOZA 3S5RA 3PUGA 3EUHA 3P50A 5K7ZA 2GBYA 1G8XA 3F0CA 4GCKA 2NX4A 5FXWA 5AQJB 2IAKA 3ZT6A 1HR0T 1WR0A 2NS8A 4MO7A 1ZKGA 2VKOA 2QOPA 4EOZB 5L3BB 3NVOA 4WBNE 5C8YE 3LK2B 2XGCA 1XMOT 3QUJA 4H9OC 1HG5A 3O1IA 3X1DA 4KHZF 2ES0A 5LGTB 2K24A 5C2TA 3UQ4A 2LEHA 2E9XB 3RIAA 2WMOA 4QX7B 1E2AA 3CWZB 3CMLA 3PUYF 1UUSA 2J1DG 5CA0E 3HKBE 3NRGA 3ZN1B 5F5WA 1HF8A 5HEHA 3OBVE 4BJNA 3BTIA 4PXIA 2QYWA 4M3FA 4IIJE 5C4YA 5K7HA 2OA5A 4ANJA 3AE1A 3CIRA 5L4EA 4MXMA 5EK2A 2E5LT 4X1YE 1JUMA 2B1EA 2Q9QC 1UX4A 5ABHA 1J5WA 3ZC0A 4L62A 2REKA 2ZOZA 4H9RC 4PFOA 5FKLA 3MKDA 2IUBA 2JJ7A 2BVMA 3OKQA 4X20E 3QNUA 3LSJA 3SS1A 3SOLA 3AE7A 2W61A 3UUNA 1ZP0A 2X66A 4JEHB 1JT6A 2V8SV 5EYRA 2DG7A 4CI1B 3ZMVB 4HFCA 2ZOYA 2IBDA 3VHLA 5IWAT 1M7KA 1Y64B 2WZHA 2LSYA 4DV3T 2HHHT 5JQGE 2DNXA 3DTOA 3IEEA 1A6IA 3VR8A 4C91A 2D5UA 4DV1T 4PNIA 2CXDA 3UU8A 3OPCA 2WWVA 3FK6A 5EK3A 5ETWA 4BJMA 5C3JA 2QKOA 4OHFA 3AEAA 4X62T 3O4XE 3SFEA 2FBWA 4WBOA 3RYFE 2FBQA 3CK6A 2E9XD 1RKWA 1ZK8A 3G06A 4TWDA 4UELA 5LGNB 1MIWA 1D1BA 4MFRA 5FKKA 2VKEA 2X9YA 3NWIA 5AQIB 5F8PA 3UU3A 5F3JA 2BS2A 4DV0T 5CFBA 4IDQA 3DJBA 2W4XA 4AIUA 3ZT5A 4CXXA 2V1DB 2X51A 1XMQT 1N34T 2VKJA 2XPUA 3JAFA 3V78A 4U9LA 5F04A 5DJQC 3BT9A 2EHOA 4ISTA 2R6GF 2V7MA 4GYSA 2RP4A 1BR1A 2ZY9A 4B3AA 5AQSB 3G7RA 4CN1A 2CPTA 2MYSA 3UQ7A 3LBXA 2BBHA 4OX9T 2XASB 1UCUA 3HTJA 3SWHA 4CGRA 5HXCA 3CKDA
chains in the Genus database with same CATH topology
2KINB 3KVAA 2WSSV 4HTEA 4IHJE 3KDSE 4IE5A 2D0UA 2LHNA 4G2AA 1FIOA 1D1CA 5KDMC 3GWHA 3MJXA 1U5PA 3PUQA 2ZMAA 4QKNA 3C50A 2KT9A 1H7CA 3K3OA 3UUXB 2MBGA 4H9QC 4DVDA 2LM9A 1KNZA 2P9BA 2Q9QA 4EZHA 2DLRA 2XHEB 2NTXA 3RYCE 5FYMA 3JC6D 3AA7B 3CX8B 5LCYA 2V26A 3WI3A 5LHIB 2KZ7B 3C4XA 4J2CA 3PUAA 3ZMSB 4AKIA 3QK6A 2E9XA 3ZMUB 5JDLA 4PK5A 5FY1A 3S4UA 2CLYB 4EZ4A 4KUMB 4XAXB 3E08A 3D0TA 3C4WA 3HR0A 4HFVA 4YJ3E 3VU7H 1G73A 4OYJA 3WAJA 4JEUB 3ZJ2A 2LSIA 2Z6EA 5J2UE 3KV6A 2EHOB 4KBMB 4JUYA 2WBLA 4YFSA 4H63V 3TKLB 2VL8A 1MMGA 3C51A 3GN5B 3N2GE 4NUUA 1D0XA 2V7IA 3MZKB 2VKDA 1Z0PA 2A2FX 2SPCA 2X9WA 2ZLYA 2XUEA 1FMWA 4U72A 2Y8DA 5JDFA 3FHNA 5AFUL 2Y48B 4ILUA 2KXPB 3V5SA 2X0LB 3FBZA 3RYHE 3GMIA 4CXYA 4DMVA 1D1AA 4HN9A 1IZNB 4UVAB 3W15B 2KMFA 1WLXA 2JJ9A 4TUYE 4QXHB 4YHJA 3I0OA 3LK42 4I43B 4ZI2C 4TZ4C 3KINB 4OYKA 5L3CB 3I9YA 3SRZA 3J7Yq 1SA0E 4AKLA 2YK0A 2EHOC 3LK3B 2BZBA 5CA1E 5M4YA 1YW0A 4UEMA 3ZPOA 2DWKA 3UFEA 2LOSA 1O3XA 5LG4A 2YEVC 5J1GA 5L3DB 3P7IA 4IDZA 3NBXX 4XBFB 1LVKA 4GK5E 5A1LA 3IBPA 4E7ZA 4ZI7E 5JVDE 3NZQA 3C64A 4KMCA 3CQXC 2B3WA 3N9MA 5JR9B 5E0OA 2MTQA 1NAFA 5FMNA 1SHZC 4GIWA 2JPFA 3UULA 3T8OA 2X67A 2IC6A 2N9DA 3FBLA 1OXZA 3VTIA 3NZPA 1T98A 4QHOA 4ZI3C 2CEAA 3KBUA 1BR2A 3EVYA 5JREA 2ACXA 2Q9QD 4PJMA 4HEAA 5FXVA 5L2LA 1ZV4X 4P0AA 4ASKA 4AKRB 4DO0A 3GA8A 3U3IA 1LVFA 2C5IT 2CA5A 4ZOLE 3N2OA 4OD4A 4HGAA 3UTKA 3AVSA 5JRCA 4AQGA 5JDMA 2JQQA 3PE0A 2NW8A 1HFAA 3OJAA 3PURA 2HPJA 2LE8A 2XAQB 4C90A 4ZS2A 3LG7A 5LBQB 4TV9E 3AAEB 3Q5XA 2K48A 4AKHA 3ANWA 4WW0A 4C2MA 2E8IA 2NOXA 3Q9DA 4UV9B 3DU5A 5IHYA 3K3NA 2CCQA 1WYCA 2XAGB 4TN7B 2JMHA 3IHRA 3ZC1A 3PUSA 3ZMTB 5HAXA 3ZMZB 1OWAA 4ZI3D 4IE4A 1BR4A 2R7RA 4TX5A 4UIGA 3IF8B 3H3AA 2DCFA 2R7SA 2QA7A 4L9IA 3ZLIA 4H63H 4F6RC 2X68A 3FXEB 4MHCA 3OYXA 2CLYC 3ANWB 2WM9A 2C5KT 4ISSA 2NP9A 2W0GA 4Z8XA 1HG2A 2VK9A 2W62A 3DP7A 4P09A 2LSJA 1IAPA 3F31A 4EB6E 5KX5E 1WR6A 4AI6A 3RKOA 4PJNA 2KWHA 2ZM0A 5LJMA 3NRYA 2LSGA 3K8PC 3C98B 3RYIE 4E7SA 2H7VC 4O4HE 5J2TE 1B7TA 3BQIA 4PJLA 4OFZA 3ETUA 5LA6E 2XAFB 3U78A 4I55E 2XAHB 3ZCIA 4GOUA 3ZEFB 2FJI1 4I50E 5BMVE 2Q9QB 2Y6XA 3E0ZA 2UXNB 3PDYA 2HH7A 2PFVA 4QXBB 4TV8E 2VKHA 5DQVA 3ZJ1A 1D0ZA 5EK4A 3N9LA 3RC8A 5DQWA 2RA1A 3KV4A 4DNDA 4ERRA 5LJNA 2H7OA 4IRVA 2K9AA 2CMRA 3H37A 1S35A 3WAKA 4H9NC 2C5JA 4EYUA 1S94A 3BK9A 3AAIA 5EZYE 2N1GA 3A5XA 3EDUA 5L3FB 4CZZB 2R7WA 3KVBA 4G63A 3HKCE 3K3QC 1HCIA 1X79A 4CI3B 4QX8B 2CWOA 3NS4A 2L8KA 2XTLA 5JR9C 2YU2A 5HYAA 4L5GA 4H9PC 4AQFC 4UV8B 1MIYA 2BVLA 3CQGB 5LNKA 5LXTE 2LOPA 4OD5A 1LKXA 5L3EB 4OK0A 2MOZA 4X1KE 4DBRA 3M65A 3PUGA 2R7QA 1QUUA 2V7JA 3EUHA 3CVRA 1ZEEA 1G8XA 3KBTA 5FXWA 3AVRA 5GONE 1HTJF 2IAKA 2ZM2A 1YKHB 5JDQA 2PG8A 3N9QA 4ZS3A 3PU3A 4AQFA 2JMKA 1NWMX 1US7B 2X9XA 4DBQA 4FI5A 2VKOA 3O1JA 4EOZB 3LFMA 4UXNB 3UT5E 5L3BB 3CX7B 4WBNE 3UUMA 5C8YE 2NW7A 3LK2B 1UX5A 3QUJA 4H9OC 1HG5A 2CWYA 2LSKA 4DVYP 2BDEA 3O1IA 2ES0A 1FMVA 2K24A 5LGTB 4O4LE 2LEHA 4PFPA 3ZYMA 4EYYR 4NUVA 1YD8G 2E9XB 4EXTA 3AA0B 3KFWX 2D2SA 4M1PA 4PJJA 3P8CD 2WMOA 3N9OA 2LHRA 2A3DA 4BAYB 3F2EA 4QX7B 1VRBA 3CWZB 4IGUA 1E1HB 5JRCB 4EIWA 3CMLA 2ODUA 5CB4E 3RC3A 2D0TA 2IC9A 2L3LA 3HI2A 2J1DG 3NRXA 1ZKEA 1VOMA 5CA0E 3L09A 3HKBE 2CXFA 3KV9A 4O2AE 1FEWA 3ZN1B 2R7XA 4O4JE 2IW5B 1HF8A 5HWYA 3OBVE 1EZ3A 2DI4A 2LT3A 3AAAB 2X9HA 2C0SA 4BJNA 3AA1B 3E22E 4BA9A 3ONXA 4UF0A 5FXZA 3R84B 2V7LA 5HWXA 3N2KE 4YLHA 3FB2A 3KV5A 5HXSA 4IIJE 3QC9A 3FXDB 4ADZA 2HPLA 2OA5A 3I1AA 3J9X1 3CPZA 2NW9A 2GK9A 3BQLA 2WAUA 2NWBA 2A72A 3N5LA 2JRKA 4ANJA 3B57A 2E9XC 2H3RA 3LBXB 5EK2A 1BR0A 4X1YE 3F57A 3N9PA 2PBIA 2B1EA 2Q9QC 1UX4A 1QSDA 3ZC0A 5H6RB 1KK7A 1LRZA 4HKAA 5LYJE 2DWGA 5JDHA 4H9RC 5KMGP 3L3PA 2KLQA 4GK0E 4PFOA 3GN5A 3MKDA 4MLKA 5IYZE 2BVMA 2UXXB 3OKQA 4X20E 2WWUA 3SS1A 3RRWA 1MMNA 3SOLA 2W61A 1CUNA 3UUNA 2X66A 4PK4A 3MA9A 3CQCB 4JEHB 5FY0A 3ZYLA 4U74A 2YINA 2M67A 1WYBA 3RRCA 4H9SE 4CI1B 3ZMVB 2KNDA 4UVBB 5HXRA 3RPUA 5JR9A 4K0UA 5DABA 3VHLA 4I4TE 2NTYA 4O4IE 3CX6B 4PK6A 3VKGA 1Y64B 2LSYA 5HXEA 5FY7A 4MBQA 3V5UA 5JQGE 4UF0B 5TAOA 2DNXA 3DTOA 3IEEA 1D0YA 2N2NA 3C4ZA 2D5UA 3I0QA 4C91A 2K5BB 4HE8A 2I59A 3I9WA 2CXDA 4PNIA 5JDGA 5LBMA 5LGUB 2DHRA 2VWAA 5JDNA 5EK3A 5ETWA 1HS7A 3Q5WA 4XZCA 1MMAA 4BJMA 3HKEE 1MMDA 4OHFA 1MIVA 2QGSA 4QWNB 4CXWA 4ZHQE 3ESLA 3O4XE 2R7VA 5LP6E 1MNDA 3AB3B 3BQKA 1AJ3A 3RH3A 2G0UA 2VASA 4WBOA 3RYFE 3PU8A 4N78D 2E9XD 2CXLA 3JC6C 4PW8A 4WNKA 2WMNA 2ODVA 4V1Av 3RX6A 3ETVA 5FP3A 2R7OA 3DU6A 2CE7A 1WRDA 3MACA 4UELA 2KWIB 5LOVE 5LGNB 1MIWA 4UVCB 1D1BA 4MFRA 4B6XA 4YJ2E 3ZCJA 2X9YA 2R7TA 5F8PA 4PAGA 5F3JA 5JH7E 3VKHA 2VB6A 3B13A 5H6QB 3Q2MA 4CI2B 1U4QA 2XQYA 2W63A 4L0RA 3DJBA 1YKEB 2EHOD 2R7UA 3HA4A 4CXXA 2V1DB 2X51A 5LHGB 2VKJA 5FXXA 3O9XA 4AKGA 3N9NA 1IJ5A 4KP3C 3R6NA 2L9QA 1MNEA 3AA6B 3LJCA 3MXZA 3MK7C 3ZYKA 5DJQC 2EHOA 4ISTA 2PJQA 5CQGA 2V7MA 4GYSA 5LHHB 4IE0A 5L3GB 2RP4A 1BR1A 4CQIA 4A56A 1IJ6A 2ZM8A 4QXCB 3OYZA 4EAHA 4O2BE 2V7KA 4DMWA 2CM0A 3ZN0B 3KYLA 4MALA 4P0BA 5FNVE 2MYSA 2YU1A 3LBXA 3HKDE 3HL6A 3PTRB 2XASB 2W00A 4AXPA 1UCUA 2XAJB 3O1HA 4ZI2D 5ADXL 1HX8A 2LJLA 4IE7A 3SWHA 4O8SA 4JLEA 5HXCA 4X1IE 4IE6A 1V9DA 3EDVA 5HXHA 4GYRA 1ZHCA 3CKDA 4FJOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K8P C; 
#chains in the Genus database with same CATH topology
 2GEN A;  2H89 A;  2D0U A;  4G2A A;  1D1C A;  5KDM C;  4JV5 T;  1U5P A;  4QKN A;  3C50 A;  1H7C A;  3K3O A;  3UUX B;  3RYC E;  3CX8 B;  2WU5 A;  3PUA A;  1OED C;  3ZQH A;  2XY8 B;  4ABZ A;  3C4W A;  3HR0 A;  1T56 A;  4HFV A;  4OYJ A;  2H88 A;  2ZM6 T;  3ZT7 A;  3KV6 A;  4KBM B;  4QH1 A;  5FHP A;  2V7I A;  4U2Y A;  2VKD A;  1Z0P A;  4YSY A;  2X9W A;  2XUE A;  1FMW A;  4U72 A;  1XNR T;  2CBI A;  5JDF A;  2Y48 B;  4ILU A;  3V5S A;  5F1J A;  3BTJ A;  2X9D A;  3P4P A;  4W97 A;  5HCJ A;  2D6Y A;  2YVX A;  1IZN B;  4UVA B;  4DV5 T;  2KMF A;  5HSZ A;  4B3T T;  1WFD A;  2RAE A;  3I9Y A;  4DR6 T;  1KFY A;  2RPA A;  1YW0 A;  3CWR A;  4JI4 T;  2O7O A;  4GCT A;  2LOS A;  2YEV C;  5L3D B;  4KHP T;  3P7I A;  3NBX X;  4XBF B;  1UK5 A;  4Q25 A;  3IBP A;  5HBU A;  3C64 A;  4AF5 A;  2M6B A;  3PAS A;  4U33 A;  5E0O A;  2MTQ A;  2O7T A;  3M3Z B;  2IC6 A;  2N9D A;  3VTI A;  5HAW A;  2CEA A;  3RKG A;  3EVY A;  5JRE A;  4HEA A;  3TLT A;  2Y30 A;  4DO0 A;  2CA5 A;  4ZOL E;  3N2O A;  4AQG A;  3MNL A;  4HFE A;  2JQQ A;  3G56 A;  3EHZ A;  2LRK A;  3L8R A;  2LE8 A;  4ACI A;  5AQP B;  4C2M A;  4I76 A;  3Q9D A;  5AQR B;  1WYC A;  4TN7 B;  2FD5 A;  3PUS A;  4B3S T;  5HAX A;  4HWC A;  2R7R A;  4UIG A;  2YVE A;  4H63 H;  1NEN A;  1YQ3 A;  4MHC A;  4F6R C;  2ZCN A;  2CLY C;  3OYX A;  4ISS A;  3ZSS A;  2XM1 A;  1HG2 A;  3B5M A;  2JQH A;  2W62 A;  2JQ9 A;  1W0A A;  1OED A;  4EED A;  3ON4 A;  2ZM0 A;  1J1J A;  2TCT A;  2OPT A;  1N33 T;  5LMN T;  2LKH A;  1B7T A;  4PJL A;  3Q0W A;  3ONL C;  3AE4 A;  4I55 E;  2XDN A;  5BR8 T;  4KX6 A;  5IOY A;  2PFV A;  2Y31 A;  4TV8 E;  2VKH A;  2WV1 A;  3N9L A;  3MVP A;  3KV4 A;  4DND A;  1SGM A;  5LJN A;  1S35 A;  4LMK A;  5EZY E;  2N1G A;  1XZY A;  5L3F B;  2YDQ A;  3JAD A;  3HKC E;  4HWI B;  2XQ7 A;  3T6N A;  3RF1 A;  4CI3 B;  3K1S A;  2YU2 A;  1QPI A;  3SDG A;  4M3G A;  2LOP A;  5L3E B;  2UXU A;  4M3B A;  1R8I A;  4EEB A;  2XSB A;  3B6A A;  5F08 A;  4YT0 A;  5FVL A;  3ZQI A;  4ZEY A;  3QQA A;  2YDS A;  3PUV F;  5GON E;  4Z91 A;  2ZM2 A;  2PG8 A;  3N9Q A;  5D19 A;  4ZS3 A;  3PU3 A;  4JI0 T;  2JMK A;  1US7 B;  4GCL A;  4UXN B;  1RKT A;  4GFL A;  2FUP A;  1RPW A;  4U3C A;  5GPC A;  1FMV A;  2QRX A;  4PFP A;  3ZYM A;  4LFC T;  3O8H A;  2FJA A;  3P8C D;  4BAY B;  2LHR A;  4A97 A;  3F2E A;  2WUI A;  4IGU A;  4EIW A;  5CB4 E;  3RC3 A;  2XRL A;  2IC9 A;  3ZQL A;  2L3L A;  3HI2 A;  2Q24 A;  3NRX A;  1ZKE A;  3G1L A;  3ONJ A;  4LF8 T;  3KV9 A;  2R7X A;  4O4J E;  2IW5 B;  4HWF A;  4WYV A;  4LFA T;  4ILB A;  3ONX A;  5EFY A;  3BR5 A;  5HXS A;  4V2F A;  4NEL A;  3J9X 1;  3HTH A;  2H3R A;  4Z90 A;  2J62 A;  1BR0 A;  2WDR A;  2M6I A;  2XPW A;  1QSD A;  3TLV A;  4HKA A;  2DWG A;  1Z77 A;  4UR9 A;  2QWT A;  2KLQ A;  1N32 T;  2PBX A;  2YVH A;  4MLK A;  1QVT A;  2BS3 A;  1MMN A;  3HE0 A;  3AE6 A;  1CUN A;  1XNQ T;  3MA9 A;  5FY0 A;  4B1R A;  3ZYL A;  4U74 A;  3AE3 A;  3RRC A;  2VVN A;  2WDV A;  5JR9 A;  4K0U A;  5DAB A;  4GFK A;  4YSZ A;  5AQC A;  4O4I E;  4PK6 A;  3EAB A;  4X5T A;  2PZ9 A;  1U9O A;  2BKN A;  4UF0 B;  4HFB A;  2V6Y A;  3C4Z A;  3I0Q A;  2ID6 A;  5JDN A;  3VRB A;  4XZC A;  1MMA A;  4AQY T;  1ORK A;  4CXW A;  4ZHQ E;  3ESL A;  5HEU A;  2G0U A;  3PU8 A;  3BQY A;  1HNZ T;  3JC6 C;  5AQH B;  2V5C A;  4V1A v;  2W2U A;  3RX6 A;  5AQF B;  3DU6 A;  2VVS A;  1XDO A;  3TLS A;  4B6X A;  1UGO A;  5JH7 E;  3VKH A;  2VB6 A;  3B13 A;  3HTA A;  5H6Q B;  3WHC A;  1U4Q A;  4WZX A;  2EHO D;  2JQK A;  2BS4 A;  3BCG A;  4U7Y A;  2HYJ A;  2IML A;  3O9X A;  3IUV A;  4AKG A;  2XJ7 A;  1IJ5 A;  2L9Q A;  3IH4 A;  3MXZ A;  3MK7 C;  3AE5 A;  2PJQ A;  2W66 A;  1IJ6 A;  3RGL A;  4O2B E;  4MAL A;  2YU1 A;  4IT4 A;  3AXJ B;  4AXP A;  3O1H A;  5IOZ A;  2LJL A;  3VIB A;  4IDP A;  2W53 A;  4GYR A;  1ZHC A;  2X0H A;  4YTN A;  3VVX A;  1DU2 A;  2KIN B;  3KVA A;  1T72 A;  4HTE A;  3KDS E;  4IE5 A;  2LHN A;  4B3R T;  2RHA A;  4JI3 T;  3GWH A;  2ZMA A;  4HFI A;  3AEE A;  2LM9 A;  4EZH A;  2XHE B;  2NTX A;  5FYM A;  4V2G A;  4I6Z A;  2CRB A;  3AA7 B;  4LMJ A;  3WI3 A;  3ZKR A;  4AKI A;  4COF A;  3ZMU B;  5JDL A;  5FY1 A;  3S4U A;  4ZZB A;  3E08 A;  3D0T A;  3ZJ2 A;  4JUY A;  3TKL B;  3SFI A;  3C51 A;  2HKU A;  3N2G E;  1D0X A;  3MZK B;  4DV7 T;  1IBK T;  1T8B A;  2SPC A;  2ZLY A;  3Q5D A;  2KXP B;  2IEK A;  3FBZ A;  3DEW A;  3GMI A;  5J1Y A;  5AQV B;  4TUY E;  3VW2 A;  3I0O A;  3LK4 2;  2ZB9 A;  4TZ4 C;  3KIN B;  4OYK A;  3J7Y q;  1SA0 E;  3AXJ A;  2VQF T;  3ZPO A;  2QIB A;  5J1G A;  3ANG A;  4DUY T;  1LVK A;  3LSP A;  5A1L A;  4ZI7 E;  2I6H A;  3FK7 A;  5FMN A;  1NAF A;  2V6Y B;  1SHZ C;  1JNR A;  3UUL A;  2LKG A;  2X67 A;  2XPV A;  4ZI3 C;  3FBL A;  3KBU A;  2ACX A;  4HFH A;  2Q9Q D;  2GFN A;  5L2L A;  2HXI A;  4W1U A;  5CXI A;  4U2Z A;  3HIM A;  4QH5 A;  2C5I T;  3UTK A;  3ANP A;  2UUA T;  5JDM A;  3PE0 A;  2NW8 A;  5HEO A;  1HFA A;  3PM1 A;  3OJA A;  3PUR A;  5FKO A;  4KI0 F;  3RHW A;  4NXM T;  4YY3 T;  3AAE B;  3Q5X A;  4AKH A;  4WW0 A;  4NIQ A;  4DR2 T;  5KXJ A;  3K3N A;  2XAG B;  3P4S A;  3IHR A;  3ZMT B;  3ZMZ B;  1OWA A;  4ZI3 D;  4IE4 A;  5ABF B;  3BJB A;  4L9I A;  5ABE A;  2X68 A;  3ANW B;  5AQM B;  3G1O A;  4ILA A;  2C5K T;  4Z8X A;  4LF7 T;  1M62 A;  2LSJ A;  1HNX T;  3F31 A;  4ILC A;  4JI1 T;  3RIU A;  4AI6 A;  2BG9 B;  4PJN A;  5LJM A;  2LSG A;  3RD3 A;  3C98 B;  3RYI E;  1Y01 A;  2XB5 A;  2RAS A;  2H7V C;  3TP0 A;  4X65 T;  2HN2 A;  4OFZ A;  5K58 A;  2FJE A;  3U78 A;  2TRT A;  2UXB T;  3ZCI A;  3ZEF B;  4I50 E;  2Y6X A;  2WCA A;  1J5E T;  1W0B A;  3RC8 A;  4ERR A;  2G7L A;  2K9A A;  3H37 A;  3LOC A;  3PJA J;  4H9N C;  2C5J A;  3BK9 A;  3AAI A;  1WCR A;  2QVA A;  4CZZ B;  3PUZ F;  4G63 A;  1T7S A;  4NN1 A;  4TNW A;  1X79 A;  4QX8 B;  3Q3S A;  2L8K A;  2XTL A;  4L5G A;  4UV8 B;  1MIY A;  2AXD S;  5LNK A;  4I0U A;  4DV6 T;  4IDN A;  3VPR A;  3M65 A;  3RQU A;  1QUU A;  2V7J A;  1ZEE A;  3KBT A;  4YTP A;  5AQU B;  3AEB A;  5ABF A;  5JDQ A;  1YKH B;  2UUB T;  5AQG B;  3BHQ A;  1NWM X;  3ON2 A;  3O1J A;  3UT5 E;  4LFB T;  3UUM A;  2NW7 A;  2ID3 A;  1UX5 A;  4IL4 A;  2LSK A;  2CWY A;  2BDE A;  2LM2 A;  4O4L E;  1YD8 G;  4EXT A;  3AA0 B;  3KFW X;  2D2S A;  4M1P A;  4PJJ A;  2A3D A;  3DPJ A;  3UUB A;  4ZXL A;  1E1H B;  2WP9 A;  2ODU A;  2WY2 A;  2WGB A;  3L09 A;  2CXF A;  1FEW A;  1JUS A;  5HWY A;  5GP9 A;  3HGG A;  2DI4 A;  2LT3 A;  3AAA B;  3E22 E;  5F27 A;  1KNR A;  4UF0 A;  5AQL B;  5FXZ A;  3R84 B;  4AC0 A;  4DID B;  5IP6 A;  5FKN A;  3N2K E;  4YLH A;  3FB2 A;  3KV5 A;  2XQ6 A;  4ADZ A;  4DR5 T;  1Z0X A;  3CPZ A;  3BQL A;  2NWB A;  2A72 A;  2JRK A;  5FMP A;  2E9X C;  2WU2 A;  5CJ5 A;  3LBX B;  3F57 A;  2PBI A;  2DTZ A;  2XPK A;  5H6R B;  3RIF A;  4JI6 T;  5LYJ E;  4GKJ T;  3JCF A;  3Q0U A;  5JDH A;  5KMG P;  3L3P A;  1HNW T;  4DW6 A;  5IYZ E;  4A5X A;  2LLY A;  2WWU A;  4ME9 A;  2UU9 T;  2OF7 A;  3COL A;  3CQC B;  3P4W A;  2IHR 1;  2M67 A;  3EAM A;  1I6Z A;  4TWF A;  2KND A;  1OED B;  5HXR A;  1KEY A;  4HKU A;  3RPU A;  5L4H A;  3BRU A;  4YZE A;  5FY7 A;  4MBQ A;  1BJZ A;  5TAO A;  1D0Y A;  5CW8 A;  3G1M A;  2K5B B;  2I59 A;  3I9W A;  3BR3 A;  5JDG A;  4M3D A;  5LBM A;  3V6G A;  4JI8 T;  2VWA A;  1QVU A;  3NKZ A;  3HKE E;  1MMD A;  2QGS A;  2BG9 E;  2VUR A;  2R7V A;  4U9N A;  1MND A;  5CGM A;  3BQK A;  2VPR A;  4X66 T;  2ZCM A;  4LF6 T;  3VW0 A;  1HX1 B;  1KNP A;  4NXN T;  1JUP A;  3BR6 A;  2ODV A;  3ETV A;  1WRD A;  2KWI B;  4YJ2 E;  2XSA A;  3QKX A;  2R7T A;  4PAG A;  3LSR A;  4CI2 B;  1GQE A;  4M3E A;  2XQY A;  4UDS A;  3RIU C;  5AQT B;  3UU4 A;  5FL1 A;  3HA4 A;  2XQ4 A;  1QLB A;  3BR0 A;  5LHG B;  3Q5E A;  3BQZ A;  4KP3 C;  3AA6 B;  3A7M A;  3AE2 A;  3QPS A;  5CQG A;  5LHH B;  1XDP A;  2XQA A;  3CDL A;  5LB7 B;  4QXC B;  3L39 A;  2V7K A;  4DMW A;  2CM0 A;  4DV4 T;  4F8H A;  3UFG A;  2XAJ B;  4ZI2 D;  1HX8 A;  4IE7 A;  4IE6 A;  3EDV A;  2DL1 A;  5HXH A;  4B3M T;  2EHO C;  4FJO A;  5IUX A;  1KF6 A;  3RH2 A;  1I94 T;  3CRJ A;  2D9D A;  5J1R A;  3PUQ A;  1UUR A;  2OLT A;  1SE7 A;  2KT9 A;  4LF5 T;  4DVD A;  1KNZ A;  5K7F A;  4U31 A;  4YXD A;  2CBJ A;  3JC6 D;  4TNV A;  2YOE A;  3ZMS B;  3QK6 A;  2UXD T;  3EUP A;  2E9X A;  4PK5 A;  1IBL T;  2CLY B;  4EZ4 A;  5HEJ A;  1W09 A;  3VU7 H;  3WAJ A;  2GUH A;  2LSI A;  2Z6E A;  3AEF A;  5J2U E;  2E2A A;  2EHO B;  2WBL A;  4WIB A;  3GN5 B;  4YHH T;  2A2F X;  3AQS A;  4CN6 A;  2CHN A;  2F4V T;  2OI8 A;  2Y8D A;  3FHN A;  3BR1 A;  5AFU L;  3CJD A;  3IH2 A;  4HWD A;  4MK6 A;  2MPK A;  2X0L B;  3RYH E;  2HXO A;  4CXY A;  1D1A A;  4G12 A;  3W15 B;  2IDO B;  1WLX A;  2JJ9 A;  1W9R A;  4YHJ A;  4ZI2 C;  2ACZ A;  2V57 A;  4AKL A;  5CA1 E;  2BZB A;  2DWK A;  3HGY A;  4GK5 E;  4JI7 T;  3NZQ A;  4KMC A;  5DAJ A;  5JR9 B;  3JAE A;  4GIW A;  3T8O A;  3NZP A;  4QHO A;  1XWM A;  2UXI A;  4CN4 A;  5FXV A;  2JIW A;  3PV0 F;  1ZV4 X;  2BKP A;  1LVF A;  4OD4 A;  4HGA A;  5JRC A;  2G3B A;  4QH4 A;  4GKK T;  4XK4 A;  3A8Y C;  4A98 A;  2HPJ A;  2LRL A;  2XAQ B;  3TLU A;  3T1Y T;  5LBQ B;  4X1E A;  4TV9 E;  4ZZC A;  3ANW A;  5AQK B;  3QBM A;  4UV9 B;  2JMH A;  3ZC1 A;  2XQ8 A;  1UI5 A;  3RLF F;  5FVK A;  1BR4 A;  3QPL A;  4K0K T;  1CHU A;  3H3A A;  4DUZ T;  2R7S A;  4P1N A;  3HTI A;  2E5V A;  3ZLI A;  3VVY A;  3KNW A;  1UI6 A;  2NP9 A;  2W0G A;  3ABV A;  4IRE A;  3DP7 A;  2HQ5 A;  2W67 A;  2FX0 A;  5F0H A;  1WR6 A;  3FZK B;  3T1H T;  4E7S A;  4O4H E;  2FJ1 A;  5J2T E;  2G7S A;  5ABG A;  3C2B A;  3VW1 A;  5LA6 E;  4JYK A;  4GOU A;  2FJI 1;  5BMV E;  3E0Z A;  3PDY A;  4KWA A;  4QXB B;  3ZJ1 A;  3DCF A;  5AQN B;  5EK4 A;  2RA1 A;  4JYA T;  2NR4 A;  5EZH A;  2H7O A;  3NPI A;  4IRV A;  3GZI A;  1YXR A;  2CMR A;  3WAK A;  4EYU A;  4JNN A;  1S94 A;  3A5X A;  2WDQ A;  3EDU A;  2AE9 A;  2NS7 A;  4U7I A;  2R7W A;  3AE8 A;  2QCO A;  4IDO A;  5JR9 C;  4DR1 T;  3NXC A;  1JTY A;  5LXT E;  3AE9 A;  3VRA A;  4X1K E;  4DBR A;  2VKV A;  2R7Q A;  3CVR A;  3IH3 A;  2OV9 A;  5J0Z A;  2XM2 A;  3AED A;  3LJL A;  3AVR A;  1HTJ F;  3FZM B;  4LF9 T;  4AQF A;  4DBQ A;  2X9X A;  4FI5 A;  3VP5 A;  3TLW A;  3LFM A;  3CX7 B;  2X6O A;  5FKM A;  4IL9 A;  5LMU T;  4DVY P;  2UXO A;  4EYY R;  4NUV A;  3C07 A;  3N9O A;  1VRB A;  1YQ4 A;  5JRC B;  5HEG A;  1FJG T;  3VOK A;  5EZG A;  1ZOY A;  2DG8 A;  3BNI A;  2D0T A;  3OVU A;  2I10 A;  4JI2 T;  1VOM A;  3GEU A;  4O2A E;  3B6C A;  4YSX A;  3P4R A;  1EZ3 A;  3ZQF A;  2X9H A;  2C0S A;  3AA1 B;  4BA9 A;  2V7L A;  5HWX A;  3QC9 A;  3FXD B;  3UU5 A;  2HPL A;  5D1R A;  3I1A A;  3FZH B;  2KSR A;  2NW9 A;  2GK9 A;  3N5L A;  3PUX F;  2ZCX A;  2WAU A;  3B57 A;  1U9N A;  4DR4 T;  3N9P A;  4DV2 T;  4LML A;  4EGW A;  3FZF B;  1KK7 A;  1LRZ A;  4NPP A;  4LF4 T;  3ZST A;  4JL3 A;  2XGE A;  2G0E A;  3B81 A;  3P9T A;  2JK3 A;  4GK0 E;  3O8G A;  3OTO T;  3GN5 A;  2UXX B;  4D5F A;  4YTM A;  3FRQ A;  3RRW A;  3EGQ A;  3AQT A;  4PK4 A;  2I0M A;  3PJA A;  1VI0 A;  2CHO A;  2YIN A;  1WYB A;  4H9S E;  3FIW A;  2BG9 A;  4UVB B;  2VQE T;  2Y2Z A;  2YN6 A;  4I4T E;  3BTC A;  2NTY A;  3CX6 B;  3F1B A;  3VKG A;  5HXE A;  2UUC T;  2A9U A;  3V5U A;  2N2N A;  3BR2 A;  4HE8 A;  1OED E;  1X9B A;  5LGU B;  2DHR A;  1Z8U A;  1HS7 A;  2F07 A;  3Q5W A;  5AQO B;  1MIV A;  4QWN B;  5LP6 E;  3AB3 B;  2EH3 A;  3ZQG A;  1AJ3 A;  3RH3 A;  2VAS A;  1SUM B;  2NP5 A;  4N78 D;  2CXL A;  4PW8 A;  4WNK A;  2WMN A;  5J1U A;  5FP3 A;  2R7O A;  2V5D A;  2CE7 A;  3MAC A;  5LOV E;  4UVC B;  1NEK A;  2VL0 A;  3ZCJ A;  3O60 A;  2OER A;  3PPB A;  3Q2M A;  4TWH A;  2W63 A;  2J4G A;  3AEC A;  4L0R A;  1YKE B;  2R7U A;  2J47 A;  5FXX A;  3N9N A;  3R6N A;  4HFD A;  1MNE A;  3LJC A;  3ZYK A;  3KKC A;  4IE0 A;  5L3G B;  4CQI A;  4A56 A;  2ZM8 A;  5AQQ B;  3OYZ A;  4EAH A;  3ZN0 B;  3KYL A;  3PUW F;  4P0B A;  2V6X A;  5FNV E;  3HKD E;  3HL6 A;  3PTR B;  1L0V A;  2W00 A;  4AC6 A;  5ADX L;  3H3M A;  5FGL A;  4O8S A;  4JLE A;  4X1I E;  2BBJ A;  1V9D A;  5HCM A;  2WSS V;  4IHJ E;  3RQW A;  1FIO A;  2HN1 A;  4D7M A;  2XQ3 A;  3MJX A;  2XQ9 A;  2MBG A;  4H9Q C;  2P9B A;  2Q9Q A;  1VCS A;  2DLR A;  3WHB A;  5LCY A;  3E7Q A;  2V26 A;  5IPA A;  2WQY A;  5LHI B;  2KZ7 B;  3LDQ B;  4D7N A;  3C4X A;  3IA3 A;  4J2C A;  2MAW A;  4KUM B;  4XAX B;  4DR7 T;  4YJ3 E;  1G73 A;  3VOX A;  4JEU B;  5FKY A;  2BKO A;  3QB5 K;  4YFS A;  4H63 V;  2VL8 A;  1MMG A;  4NUU A;  4AUX A;  2UXC T;  3QB5 A;  4EV6 A;  5F0F A;  3EI0 A;  2FQ4 A;  4X64 T;  1JNZ A;  2UXH A;  4DMV A;  5L47 A;  4HN9 A;  2YKS A;  2QTQ A;  5LG3 A;  3CCY A;  3VUQ A;  4QXH B;  4I43 B;  2XZE A;  3JSJ A;  5L3C B;  3SRZ A;  2G7G A;  2YK0 A;  3LK3 B;  5M4Y A;  4UEM A;  3RI5 A;  2PTF A;  3UFE A;  1O3X A;  3LSV A;  5LG4 A;  2YDR A;  4IDZ A;  2HYT A;  2X0Y A;  4D5C A;  4E7Z A;  2XGD A;  5JVD E;  3CQX C;  2B3W A;  3N9M A;  3P4Q A;  2WZI A;  2JPF A;  5F0C A;  2FJB A;  1OXZ A;  1T98 A;  1BR2 A;  4JBW F;  4PJM A;  5CXG A;  3NNR A;  4P0A A;  3KKD A;  2WB5 A;  3UU6 A;  4ASK A;  4AKR B;  3GA8 A;  3U3I A;  2K3W A;  3AVS A;  3Q0V A;  1VCT A;  2WS3 A;  2FJD A;  5JTG A;  3SFD A;  1N36 T;  2NP3 A;  4C90 A;  3LWJ A;  4ZS2 A;  3LG7 A;  3QOF A;  3KZ9 A;  2K48 A;  4JI5 T;  1E7P A;  2E8I A;  2NOX A;  3DU5 A;  1JTX A;  5IHY A;  2CCQ A;  1JT0 A;  4TX5 A;  3IF8 B;  2DCF A;  4HWH A;  2IAI A;  2QA7 A;  3FXE B;  2WM9 A;  4DR3 T;  3VR9 A;  2VK9 A;  4P09 A;  1IAP A;  3VVZ A;  4EB6 E;  5KX5 E;  2UXP A;  3RKO A;  2KWH A;  3NRY A;  3K8P C;  2IU5 A;  4ICH A;  3BQI A;  2B76 A;  3ETU A;  2XAF B;  5D18 A;  2XAH B;  4JKZ A;  2Q9Q B;  5GPA A;  5FL0 A;  2UXN B;  5H9T A;  2HH7 A;  5DQV A;  1D0Z A;  4AIS A;  5DQW A;  3BTL A;  1IBM T;  2BG9 C;  3KVB A;  2XQ5 A;  2IIU A;  3K3Q C;  5J3L A;  1HCI A;  3FZL B;  2CWO A;  3NS4 A;  5HYA A;  4H9P C;  3AEG A;  4AQF C;  1T33 A;  2BVL A;  3CQG B;  3LHQ A;  3TP3 A;  4OD5 A;  1LKX A;  4OK0 A;  3NI7 A;  2MOZ A;  3S5R A;  3PUG A;  3EUH A;  3P50 A;  5K7Z A;  2GBY A;  1G8X A;  3F0C A;  4GCK A;  2NX4 A;  5FXW A;  5AQJ B;  2IAK A;  3ZT6 A;  1HR0 T;  1WR0 A;  2NS8 A;  4MO7 A;  1ZKG A;  2VKO A;  2QOP A;  4EOZ B;  5L3B B;  3NVO A;  4WBN E;  5C8Y E;  3LK2 B;  2XGC A;  1XMO T;  3QUJ A;  4H9O C;  1HG5 A;  3O1I A;  3X1D A;  4KHZ F;  2ES0 A;  5LGT B;  2K24 A;  5C2T A;  3UQ4 A;  2LEH A;  2E9X B;  3RIA A;  2WMO A;  4QX7 B;  1E2A A;  3CWZ B;  3CML A;  3PUY F;  1UUS A;  2J1D G;  5CA0 E;  3HKB E;  3NRG A;  3ZN1 B;  5F5W A;  1HF8 A;  5HEH A;  3OBV E;  4BJN A;  3BTI A;  4PXI A;  2QYW A;  4M3F A;  4IIJ E;  5C4Y A;  5K7H A;  2OA5 A;  4ANJ A;  3AE1 A;  3CIR A;  5L4E A;  4MXM A;  5EK2 A;  2E5L T;  4X1Y E;  1JUM A;  2B1E A;  2Q9Q C;  1UX4 A;  5ABH A;  1J5W A;  3ZC0 A;  4L62 A;  2REK A;  2ZOZ A;  4H9R C;  4PFO A;  5FKL A;  3MKD A;  2IUB A;  2JJ7 A;  2BVM A;  3OKQ A;  4X20 E;  3QNU A;  3LSJ A;  3SS1 A;  3SOL A;  3AE7 A;  2W61 A;  3UUN A;  1ZP0 A;  2X66 A;  4JEH B;  1JT6 A;  2V8S V;  5EYR A;  2DG7 A;  4CI1 B;  3ZMV B;  4HFC A;  2ZOY A;  2IBD A;  3VHL A;  5IWA T;  1M7K A;  1Y64 B;  2WZH A;  2LSY A;  4DV3 T;  2HHH T;  5JQG E;  2DNX A;  3DTO A;  3IEE A;  1A6I A;  3VR8 A;  4C91 A;  2D5U A;  4DV1 T;  4PNI A;  2CXD A;  3UU8 A;  3OPC A;  2WWV A;  3FK6 A;  5EK3 A;  5ETW A;  4BJM A;  5C3J A;  2QKO A;  4OHF A;  3AEA A;  4X62 T;  3O4X E;  3SFE A;  2FBW A;  4WBO A;  3RYF E;  2FBQ A;  3CK6 A;  2E9X D;  1RKW A;  1ZK8 A;  3G06 A;  4TWD A;  4UEL A;  5LGN B;  1MIW A;  1D1B A;  4MFR A;  5FKK A;  2VKE A;  2X9Y A;  3NWI A;  5AQI B;  5F8P A;  3UU3 A;  5F3J A;  2BS2 A;  4DV0 T;  5CFB A;  4IDQ A;  3DJB A;  2W4X A;  4AIU A;  3ZT5 A;  4CXX A;  2V1D B;  2X51 A;  1XMQ T;  1N34 T;  2VKJ A;  2XPU A;  3JAF A;  3V78 A;  4U9L A;  5F04 A;  5DJQ C;  3BT9 A;  2EHO A;  4IST A;  2R6G F;  2V7M A;  4GYS A;  2RP4 A;  1BR1 A;  2ZY9 A;  4B3A A;  5AQS B;  3G7R A;  4CN1 A;  2CPT A;  2MYS A;  3UQ7 A;  3LBX A;  2BBH A;  4OX9 T;  2XAS B;  1UCU A;  3HTJ A;  3SWH A;  4CGR A;  5HXC A;  3CKD A; 
#chains in the Genus database with same CATH homology
 2KIN B;  3KVA A;  2WSS V;  4HTE A;  4IHJ E;  3KDS E;  4IE5 A;  2D0U A;  2LHN A;  4G2A A;  1FIO A;  1D1C A;  5KDM C;  3GWH A;  3MJX A;  1U5P A;  3PUQ A;  2ZMA A;  4QKN A;  3C50 A;  2KT9 A;  1H7C A;  3K3O A;  3UUX B;  2MBG A;  4H9Q C;  4DVD A;  2LM9 A;  1KNZ A;  2P9B A;  2Q9Q A;  4EZH A;  2DLR A;  2XHE B;  2NTX A;  3RYC E;  5FYM A;  3JC6 D;  3AA7 B;  3CX8 B;  5LCY A;  2V26 A;  3WI3 A;  5LHI B;  2KZ7 B;  3C4X A;  4J2C A;  3PUA A;  3ZMS B;  4AKI A;  3QK6 A;  2E9X A;  3ZMU B;  5JDL A;  4PK5 A;  5FY1 A;  3S4U A;  2CLY B;  4EZ4 A;  4KUM B;  4XAX B;  3E08 A;  3D0T A;  3C4W A;  3HR0 A;  4HFV A;  4YJ3 E;  3VU7 H;  1G73 A;  4OYJ A;  3WAJ A;  4JEU B;  3ZJ2 A;  2LSI A;  2Z6E A;  5J2U E;  3KV6 A;  2EHO B;  4KBM B;  4JUY A;  2WBL A;  4YFS A;  4H63 V;  3TKL B;  2VL8 A;  1MMG A;  3C51 A;  3GN5 B;  3N2G E;  4NUU A;  1D0X A;  2V7I A;  3MZK B;  2VKD A;  1Z0P A;  2A2F X;  2SPC A;  2X9W A;  2ZLY A;  2XUE A;  1FMW A;  4U72 A;  2Y8D A;  5JDF A;  3FHN A;  5AFU L;  2Y48 B;  4ILU A;  2KXP B;  3V5S A;  2X0L B;  3FBZ A;  3RYH E;  3GMI A;  4CXY A;  4DMV A;  1D1A A;  4HN9 A;  1IZN B;  4UVA B;  3W15 B;  2KMF A;  1WLX A;  2JJ9 A;  4TUY E;  4QXH B;  4YHJ A;  3I0O A;  3LK4 2;  4I43 B;  4ZI2 C;  4TZ4 C;  3KIN B;  4OYK A;  5L3C B;  3I9Y A;  3SRZ A;  3J7Y q;  1SA0 E;  4AKL A;  2YK0 A;  2EHO C;  3LK3 B;  2BZB A;  5CA1 E;  5M4Y A;  1YW0 A;  4UEM A;  3ZPO A;  2DWK A;  3UFE A;  2LOS A;  1O3X A;  5LG4 A;  2YEV C;  5J1G A;  5L3D B;  3P7I A;  4IDZ A;  3NBX X;  4XBF B;  1LVK A;  4GK5 E;  5A1L A;  3IBP A;  4E7Z A;  4ZI7 E;  5JVD E;  3NZQ A;  3C64 A;  4KMC A;  3CQX C;  2B3W A;  3N9M A;  5JR9 B;  5E0O A;  2MTQ A;  1NAF A;  5FMN A;  1SHZ C;  4GIW A;  2JPF A;  3UUL A;  3T8O A;  2X67 A;  2IC6 A;  2N9D A;  3FBL A;  1OXZ A;  3VTI A;  3NZP A;  1T98 A;  4QHO A;  4ZI3 C;  2CEA A;  3KBU A;  1BR2 A;  3EVY A;  5JRE A;  2ACX A;  2Q9Q D;  4PJM A;  4HEA A;  5FXV A;  5L2L A;  1ZV4 X;  4P0A A;  4ASK A;  4AKR B;  4DO0 A;  3GA8 A;  3U3I A;  1LVF A;  2C5I T;  2CA5 A;  4ZOL E;  3N2O A;  4OD4 A;  4HGA A;  3UTK A;  3AVS A;  5JRC A;  4AQG A;  5JDM A;  2JQQ A;  3PE0 A;  2NW8 A;  1HFA A;  3OJA A;  3PUR A;  2HPJ A;  2LE8 A;  2XAQ B;  4C90 A;  4ZS2 A;  3LG7 A;  5LBQ B;  4TV9 E;  3AAE B;  3Q5X A;  2K48 A;  4AKH A;  3ANW A;  4WW0 A;  4C2M A;  2E8I A;  2NOX A;  3Q9D A;  4UV9 B;  3DU5 A;  5IHY A;  3K3N A;  2CCQ A;  1WYC A;  2XAG B;  4TN7 B;  2JMH A;  3IHR A;  3ZC1 A;  3PUS A;  3ZMT B;  5HAX A;  3ZMZ B;  1OWA A;  4ZI3 D;  4IE4 A;  1BR4 A;  2R7R A;  4TX5 A;  4UIG A;  3IF8 B;  3H3A A;  2DCF A;  2R7S A;  2QA7 A;  4L9I A;  3ZLI A;  4H63 H;  4F6R C;  2X68 A;  3FXE B;  4MHC A;  3OYX A;  2CLY C;  3ANW B;  2WM9 A;  2C5K T;  4ISS A;  2NP9 A;  2W0G A;  4Z8X A;  1HG2 A;  2VK9 A;  2W62 A;  3DP7 A;  4P09 A;  2LSJ A;  1IAP A;  3F31 A;  4EB6 E;  5KX5 E;  1WR6 A;  4AI6 A;  3RKO A;  4PJN A;  2KWH A;  2ZM0 A;  5LJM A;  3NRY A;  2LSG A;  3K8P C;  3C98 B;  3RYI E;  4E7S A;  2H7V C;  4O4H E;  5J2T E;  1B7T A;  3BQI A;  4PJL A;  4OFZ A;  3ETU A;  5LA6 E;  2XAF B;  3U78 A;  4I55 E;  2XAH B;  3ZCI A;  4GOU A;  3ZEF B;  2FJI 1;  4I50 E;  5BMV E;  2Q9Q B;  2Y6X A;  3E0Z A;  2UXN B;  3PDY A;  2HH7 A;  2PFV A;  4QXB B;  4TV8 E;  2VKH A;  5DQV A;  3ZJ1 A;  1D0Z A;  5EK4 A;  3N9L A;  3RC8 A;  5DQW A;  2RA1 A;  3KV4 A;  4DND A;  4ERR A;  5LJN A;  2H7O A;  4IRV A;  2K9A A;  2CMR A;  3H37 A;  1S35 A;  3WAK A;  4H9N C;  2C5J A;  4EYU A;  1S94 A;  3BK9 A;  3AAI A;  5EZY E;  2N1G A;  3A5X A;  3EDU A;  5L3F B;  4CZZ B;  2R7W A;  3KVB A;  4G63 A;  3HKC E;  3K3Q C;  1HCI A;  1X79 A;  4CI3 B;  4QX8 B;  2CWO A;  3NS4 A;  2L8K A;  2XTL A;  5JR9 C;  2YU2 A;  5HYA A;  4L5G A;  4H9P C;  4AQF C;  4UV8 B;  1MIY A;  2BVL A;  3CQG B;  5LNK A;  5LXT E;  2LOP A;  4OD5 A;  1LKX A;  5L3E B;  4OK0 A;  2MOZ A;  4X1K E;  4DBR A;  3M65 A;  3PUG A;  2R7Q A;  1QUU A;  2V7J A;  3EUH A;  3CVR A;  1ZEE A;  1G8X A;  3KBT A;  5FXW A;  3AVR A;  5GON E;  1HTJ F;  2IAK A;  2ZM2 A;  1YKH B;  5JDQ A;  2PG8 A;  3N9Q A;  4ZS3 A;  3PU3 A;  4AQF A;  2JMK A;  1NWM X;  1US7 B;  2X9X A;  4DBQ A;  4FI5 A;  2VKO A;  3O1J A;  4EOZ B;  3LFM A;  4UXN B;  3UT5 E;  5L3B B;  3CX7 B;  4WBN E;  3UUM A;  5C8Y E;  2NW7 A;  3LK2 B;  1UX5 A;  3QUJ A;  4H9O C;  1HG5 A;  2CWY A;  2LSK A;  4DVY P;  2BDE A;  3O1I A;  2ES0 A;  1FMV A;  2K24 A;  5LGT B;  4O4L E;  2LEH A;  4PFP A;  3ZYM A;  4EYY R;  4NUV A;  1YD8 G;  2E9X B;  4EXT A;  3AA0 B;  3KFW X;  2D2S A;  4M1P A;  4PJJ A;  3P8C D;  2WMO A;  3N9O A;  2LHR A;  2A3D A;  4BAY B;  3F2E A;  4QX7 B;  1VRB A;  3CWZ B;  4IGU A;  1E1H B;  5JRC B;  4EIW A;  3CML A;  2ODU A;  5CB4 E;  3RC3 A;  2D0T A;  2IC9 A;  2L3L A;  3HI2 A;  2J1D G;  3NRX A;  1ZKE A;  1VOM A;  5CA0 E;  3L09 A;  3HKB E;  2CXF A;  3KV9 A;  4O2A E;  1FEW A;  3ZN1 B;  2R7X A;  4O4J E;  2IW5 B;  1HF8 A;  5HWY A;  3OBV E;  1EZ3 A;  2DI4 A;  2LT3 A;  3AAA B;  2X9H A;  2C0S A;  4BJN A;  3AA1 B;  3E22 E;  4BA9 A;  3ONX A;  4UF0 A;  5FXZ A;  3R84 B;  2V7L A;  5HWX A;  3N2K E;  4YLH A;  3FB2 A;  3KV5 A;  5HXS A;  4IIJ E;  3QC9 A;  3FXD B;  4ADZ A;  2HPL A;  2OA5 A;  3I1A A;  3J9X 1;  3CPZ A;  2NW9 A;  2GK9 A;  3BQL A;  2WAU A;  2NWB A;  2A72 A;  3N5L A;  2JRK A;  4ANJ A;  3B57 A;  2E9X C;  2H3R A;  3LBX B;  5EK2 A;  1BR0 A;  4X1Y E;  3F57 A;  3N9P A;  2PBI A;  2B1E A;  2Q9Q C;  1UX4 A;  1QSD A;  3ZC0 A;  5H6R B;  1KK7 A;  1LRZ A;  4HKA A;  5LYJ E;  2DWG A;  5JDH A;  4H9R C;  5KMG P;  3L3P A;  2KLQ A;  4GK0 E;  4PFO A;  3GN5 A;  3MKD A;  4MLK A;  5IYZ E;  2BVM A;  2UXX B;  3OKQ A;  4X20 E;  2WWU A;  3SS1 A;  3RRW A;  1MMN A;  3SOL A;  2W61 A;  1CUN A;  3UUN A;  2X66 A;  4PK4 A;  3MA9 A;  3CQC B;  4JEH B;  5FY0 A;  3ZYL A;  4U74 A;  2YIN A;  2M67 A;  1WYB A;  3RRC A;  4H9S E;  4CI1 B;  3ZMV B;  2KND A;  4UVB B;  5HXR A;  3RPU A;  5JR9 A;  4K0U A;  5DAB A;  3VHL A;  4I4T E;  2NTY A;  4O4I E;  3CX6 B;  4PK6 A;  3VKG A;  1Y64 B;  2LSY A;  5HXE A;  5FY7 A;  4MBQ A;  3V5U A;  5JQG E;  4UF0 B;  5TAO A;  2DNX A;  3DTO A;  3IEE A;  1D0Y A;  2N2N A;  3C4Z A;  2D5U A;  3I0Q A;  4C91 A;  2K5B B;  4HE8 A;  2I59 A;  3I9W A;  2CXD A;  4PNI A;  5JDG A;  5LBM A;  5LGU B;  2DHR A;  2VWA A;  5JDN A;  5EK3 A;  5ETW A;  1HS7 A;  3Q5W A;  4XZC A;  1MMA A;  4BJM A;  3HKE E;  1MMD A;  4OHF A;  1MIV A;  2QGS A;  4QWN B;  4CXW A;  4ZHQ E;  3ESL A;  3O4X E;  2R7V A;  5LP6 E;  1MND A;  3AB3 B;  3BQK A;  1AJ3 A;  3RH3 A;  2G0U A;  2VAS A;  4WBO A;  3RYF E;  3PU8 A;  4N78 D;  2E9X D;  2CXL A;  3JC6 C;  4PW8 A;  4WNK A;  2WMN A;  2ODV A;  4V1A v;  3RX6 A;  3ETV A;  5FP3 A;  2R7O A;  3DU6 A;  2CE7 A;  1WRD A;  3MAC A;  4UEL A;  2KWI B;  5LOV E;  5LGN B;  1MIW A;  4UVC B;  1D1B A;  4MFR A;  4B6X A;  4YJ2 E;  3ZCJ A;  2X9Y A;  2R7T A;  5F8P A;  4PAG A;  5F3J A;  5JH7 E;  3VKH A;  2VB6 A;  3B13 A;  5H6Q B;  3Q2M A;  4CI2 B;  1U4Q A;  2XQY A;  2W63 A;  4L0R A;  3DJB A;  1YKE B;  2EHO D;  2R7U A;  3HA4 A;  4CXX A;  2V1D B;  2X51 A;  5LHG B;  2VKJ A;  5FXX A;  3O9X A;  4AKG A;  3N9N A;  1IJ5 A;  4KP3 C;  3R6N A;  2L9Q A;  1MNE A;  3AA6 B;  3LJC A;  3MXZ A;  3MK7 C;  3ZYK A;  5DJQ C;  2EHO A;  4IST A;  2PJQ A;  5CQG A;  2V7M A;  4GYS A;  5LHH B;  4IE0 A;  5L3G B;  2RP4 A;  1BR1 A;  4CQI A;  4A56 A;  1IJ6 A;  2ZM8 A;  4QXC B;  3OYZ A;  4EAH A;  4O2B E;  2V7K A;  4DMW A;  2CM0 A;  3ZN0 B;  3KYL A;  4MAL A;  4P0B A;  5FNV E;  2MYS A;  2YU1 A;  3LBX A;  3HKD E;  3HL6 A;  3PTR B;  2XAS B;  2W00 A;  4AXP A;  1UCU A;  2XAJ B;  3O1H A;  4ZI2 D;  5ADX L;  1HX8 A;  2LJL A;  4IE7 A;  3SWH A;  4O8S A;  4JLE A;  5HXC A;  4X1I E;  4IE6 A;  1V9D A;  3EDV A;  5HXH A;  4GYR A;  1ZHC A;  3CKD A;  4FJO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...