3F0CA

Crystal structure of transcriptional regulator from cytophaga hutchinsonii atcc 33406
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
196
structure length
193
Chain Sequence
DGKLELIINAAQKRFAHYGLCKTTMNEIASDVGMGKASLYYYFPDKETLFEAVIKKEQNVFFDEMDKILNSGIDATALLKKYVKLRSLHFRHLLNLSKLRSDFTKPVFAKAFESFKQKEVEIVAGIIQYGITTKEFKRGNKHENAEFLVHLLLGVRMVKLKYKEINDFDESDYEDLDKNMCKVAGMFLKEIQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Transcriptional regulator
publication title Crystal structure of transcriptional regulator from Cytophaga hutchinsonii ATCC 33406
rcsb
source organism Cytophaga hutchinsonii
total genus 72
structure length 193
sequence length 196
ec nomenclature
pdb deposition date 2008-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3f0cA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3f0cA02
3SDGA 4C2MJ 3COLA 3BR6A 3CJDA 1IV6A 2DG8A 2PZ9A 4DW6A 1X2NA 2E2JJ 3JRCA 2GBYA 3JRDA 3W6VA 3FK7A 5GP9A 4AC6A 3B6AA 3IV5A 4RBOA 2RAEA 3DEWA 1B72B 3EUPA 1APLC 3GTPJ 5HSZA 4MIMA 2N8GA 3HOUJ 5F08A 2HKUA 1JTXA 5EDNA 2JWTA 3LSPA 3V78A 4D7NA 2UXOA 4B3AA 2WV1A 3QBMA 3LJLA 1NTCA 2Y0SN 5IYDJ 4M6VA 2X48A 4ACIA 2LR8A 5J3LA 3HB9A 5J1YA 3HOYJ 1ITYA 2K9NA 2LLKA 3QPLA 2GENA 4FE4A 3ZQLA 2YUSA 2QOPA 1TWGJ 2P81A 2W48A 4C3IJ 2NX4A 3AQSA 3NRGA 2XPVA 5C3EJ 4I76A 1D5YA 2NS8A 2OERA 2DA1A 2DMQA 5EZHA 3JR9A 4GFKA 3VVZA 3Q3SA 2KDZA 4A3JJ 2CUFA 1P7IA 1PUFB 1CQTA 2L7ZA 2CRGA 3NI7A 3FKIJ 1HLVA 5D1RA 3HOWJ 3VOXA 5H9TA 3GTQJ 3TP3A 3S14J 4GCTA 3IH3A 3OOUA 2IU5A 3KNWA 2HOAA 2LK2A 3SFIA 3HKZN 5FJ8J 4AYBN 2DMNA 4M3EA 3F1BA 1RR7A 2FBQA 4LOCA 5IPAA 2L7FP 3BG5A 2DA3A 2GLOA 5E3MA 3QKXA 1MBJA 5M3MJ 3S2HJ 3BG9A 3BTCA 1UI5A 3VVXA 1U78A 2G7LA 3HBLA 1T56A 3BCGA 2KT0A 5C44J 2D5VA 2YS9A 5EEAA 1NK3P 4X6AJ 2TCTA 1U8BA 2HDDA 3A01A 5C4XJ 5EZGA 4D5FA 1Y1VJ 5FKNA 1H8AC 4A3GJ 2I10A 4FE7A 2PBXA 4JX5A 1BW6A 3GTJJ 2LKXA 1MSFC 2F07A 1UG2A 5FMPA 4UUSB 3V6GA 5D18A 2R93J 1RETA 4JX4A 4ICHA 5EYRA 5FHPA 5C4YA 3DCFA 3ANGA 2R5YA 5F1JA 5C4JJ 3S17J 1ETKA 3A02A 2QKOA 4DYRA 1P7JA 5EFYA 4GCKA 3LSJA 3GZIA 3E7QA 4XICA 2LTPA 2NP5A 2ZB9A 1QVTA 2XRLA 1AHDP 3CMYA 2O8KA 4CYCA 4BY1J 2GM4A 4JX6A 3TP0A 3HTAA 3OSFA 5HODA 5AQCA 1ETQA 2VPRA 5FLVA 3ANPA 3VW1A 4MFDA 3RQIA 2Y9ZA 3A03A 1JKQC 1FJLA 4JL3A 5M5XJ 3KKDA 4IHWA 1FTTA 2HYJA 3MVPA 4DZJA 5JLWA 5EG0B 3T6NA 3ON4A 1POGA 1ETVA 3HTIA 3MNLA 3JRIA 2Y30A 3HGGA 5FGLA 2DA4A 2O7OA 2OF7A 4MK6A 1LE8B 1E3OC 3B6CA 2XDNA 3ON2A 2CQQA 1MNMC 3NPIA 1IGNA 5EF6A 1R9TJ 1JUSA 1ZKGA 1H88C 4IHXA 3C2BA 3ZQIA 5CW8A 3GTOJ 4M3FA 4GFBA 1BW5A 3GEUA 2IBDA 4XK4A 3TW7A 2CUEA 3S1NJ 1TWCJ 2DMTA 3IH2A 4G12A 2M34A 2HXOA 4S0HB 3TEDA 3ZQFA 1JGGA 4Y52J 5GPCA 4RDUA 5HBUA 5FKMA 3BQYA 2GUHA 1WI3A 2DA7A 3JRGA 5IYBJ 2M0CA 3HM5A 5EGOA 1AKHA 1BL0A 2MGQA 5F0CA 1HDDC 2Y2ZA 2XB0X 2G7GA 2DTZA 4UDSA 1NK2P 1IRZA 3D1NI 1RESA 3RZDJ 5IP7J 3VP5A 5DTDA 5IOZA 2TRTA 3WHBA 2R92J 1ETOA 1F43A 2JJ7A 1O4XA 2JA8J 3C07A 2Y9YA 4D7MA 1H89C 1WPKA 3HEFA 4B1RA 5FKKA 4A93J 2QF7A 1XG1A 2ZOZA 1JJ8C 2COBA 2LD5A 1MH4A 3G1LA 1WH7A 4CGRA 3O8HA 1VF9A 3HIMA 4GFLA 1MBFA 2M8GX 1B72A 3VOKA 3FK6A 2XGEA 2VI6A 3VW0A 3MKLA 1RKTA 3BR5A 2ZCXA 3CRJA 5IP9J 5E3OA 1ZGWA 2IAIA 3AQTA 4NDLA 1U9NA 3GTLJ 5IYCJ 3VIBA 5K7ZA 2JA6J 1FEXA 1I50J 1IC8A 2CJJA 3CWRA 2O7TA 2DG7A 2YVEA 2XSDC 2LFBA 4M3GA 3LHQA 5F0FA 4A3MJ 3PPBA 3BTIA 1OJLA 3I4NJ 2EQRA 4D5CA 3EGQA 3LWJA 2E2HJ 4YZEA 1RPWA 1WCMJ 4A69C 1ZR4A 2E19A 2R5ZB 1HOMA 3E7LA 1UHSA 3FISA 3HOXJ 4A3EJ 1QRYA 1PUFA 2VKVA 4B4CA 1TWHJ 2QIBA 2FJ1A 3QPSA 2ZCMA 4JKZA 3BJBA 1B8IB 4AC0A 1BJZA 1HDPA 3G1MA 3BG3A 1VNDA 2K9SA 2W53A 1XC5A 4IHYA 2VUMJ 2RHAA 3NNRA 2L0KA 2ID3A 5E3NA 3H0GJ 3S1MJ 3VUQA 1JT6A 2FX0A 2H1KA 1JKOC 4QTRA 1I6HJ 2NVTJ 2XPUA 4L5EA 5J1RA 3G1OA 3IUVA 1WH5A 3ZOBA 2ZOYA 2EZKA 1IUFA 2NVQJ 4XIDA 4UUTA 2ME0A 2FQ4A 3GBGA 1MH3A 9ANTA 1TWAJ 1ETYA 3OIOA 1K61A 3PO3J 1FTZA 2HQ5A 3ZQGA 3RKQA 1YRNB 5F04A 3K2AA 3JREA 1FIPA 1OFCX 1TC3C 2JA7J 1JUPA 5K58A 4UUSA 4A3FJ 1IDYA 4I6ZA 3ZQHA 2Y31A 4NN1A 3NAUA 1EF4A 2CU7A 5IOYA 2CQXA 3HTJA 3MN2A 2VKEA 2ID6A 2ELKA 1ENHA 1MBHA 1Y1WJ 3QQAA 1I3QJ 2DA6A 4A3BJ 1VI0A 3DPJA 4A3KJ 3S1QJ 4EEFG 3ZQCA 2XGDA 2JK3A 2ZCNA 5CXIA 2OPTA 5GPAA 2X6OA 4C3JJ 2HOSA 4DYCA 1QVUA 3Q0VA 4HNVA 1Q1VA 3UKGA 2E2IJ 2G3BA 2UXIA 1GDTA 1GVDA 1SGMA 1OCPA 3FRQA 4AUXA 3RH2A 3PM1A 2JA5J 5EG0A 3H3VK 1GUUA 1GV5A 2K9QA 2V57A 1X2MA 1ETXA 2NS7A 1LE8A 3JSJA 2YU9J 4FISA 3PASA 1K83J 4DZPA 3PO2J 2WUIA 2MG4A 3BR1A 4AF5A 2EBIA 3TW6A 2XPWA 2WB1N 5M5YJ 3B81A 3O8GA 4MFEA 2M2EA 2R7ZJ 2IEKA 4ME9A 4JP0A 2AO9A 4FTHA 3HE0A 3S1RJ 3HDDA 1WGXA 1RKWA 2L9RA 4MO7A 1A6IA 1GV2A 2EH3A 2HXIA 1W0TA 2LY9A 2M9HA 1QPIA 3HOZJ 1ETWA 3L1PA 4IHVA 1X58A 1Z0XA 1UI6A 2HI3A 2LVSA 4MLOA 4J19A 1W0UA 3OSGA 3KZ9A 4KWAA 3BQZA 1AU7A 4A3DJ 2HYTA 3A01B 3NXCA 2K40A 3CCYA 3CQZJ 2DMPA 2UXPA 5IP6A 3RZOJ 1XS9A 4QIWN 4BBSJ 3RD3A 5M5WJ 1IG7A 2YVHA 2JN6A 2ECBA 1T33A 1ZTRA 1Z77A 2R5YB 4HKUA 3VVYA 2DJNA 4Y7NJ 1A5JA 2WAQN 3FIWA 5JLXA 3GTKJ 3P9TA 4ABZA 2GFNA 1VFCA 3KKCA 3M4OJ 2QCOA 2Q24A 3BHQA 5J1UA 3LNQA 2MSYA 3G7RA 1MBKA 5BNGA 1JT0A 3BR3A 5HAWA 3JRAA 1JTYA 1UMQA 2EZHA 2XB5A 4DYQA 2EZLA 3JRHA 3BTLA 3BT9A 4CYCB 2L7MP 3LSGA 4W97A 4PXIA 2QWTA 2G7SA 1JUMA 2JMWA 3BRUA 3M3YJ 1FIAA 3BNIA 2PMZN 4V2GA 3S5RA 1OCTC 1DU0A 1LFUP 2R0QC 1HF0A 2B63J 2WGBA 2NVYJ 4XRSG 3NARA 1S7EA 2ME6A 4QSHA 1DU6A 5FLMJ 4MXMA 3LOCA 2FD5A 2ECCA 4M3DA 1BA5A 3SJMA 2QTQA 4A3LJ 2D6YA 3BTJA 1ZQ3P 4BBRJ 1HCRA 2NVXJ 2OI8A 1ZK8A 3S16J 2H8RA 1MSEC 3VPRA 1U9OA 3IH4A 3JRFA 3G56A 5FKLA 3VW2A 4V2FA 5DS9A 1JKPC 2REKA 2DN0A 4NELA 3HOVJ 3S2DJ 2HOTA 1ZR2A 2LP0A 2X9DA 5E3LA 3LSRA 2DA2A 1JKRC 5DAJA 2AHQA 2R5ZA 5F0HA 4C3HJ 2UXUA 1F36A 3JRBA 3BR0A 5FKOA 4A3IJ 1SFOJ 1B8IA 1MBGA 1SANA 4JYKA 4W1UA 1G2HA 5EGOB 1TWFJ 1JJ6C 1AKHB 4L62A 2NOGA 4XRMA 1GT0C 3HTHA 4JNNA 5F27A 3K7AJ 4IEJA 4X1EA 1ORKA 3GTGJ 4A3CJ 1IDZA 4FCYA 1IJWC 5CXGA 5D19A 4XRSA 5K7FA 4GCLA 2DMUA 2XGCA 2G0EA 3HGYA 3Q0UA 4BKXA 3WHCA 4BY7J 3GTMJ 4BXXJ 3S15J 2MW8A 5K7HA 2UXHA 3Q0WA 1LFBA 3CDLA 5M3FJ 3BR2A 3F0CA 1MBEA 2O9LA 2E1OA 2RASA 2DA5A 3I4MJ 3O60A 4M3BA 2EZIA 1YRNA 2NP3A
chains in the Genus database with same CATH superfamily
5CVUA 5LFAA 1D0XA 4DW6A 3H36A 1X2NA 2NOJB 3JRDA 4OIPF 4WXHA 5GP9A 2TDXA 3B6AA 3DEWA 1B72B 3EUPA 2QQ9A 2P7CB 3VODA 4S04A 1Y8QB 3HOUJ 4IF4A 5F08A 1BBYA 2P6SA 1QBJA 1S3JA 3U9GA 2HZTA 2Y0SN 3MZ8A 5HLIA 2LNBA 4ACIA 1W5SA 3EUAA 3LAJA 2GENA 1BOAA 4FE4A 1Z21A 4BHCA 4AYBA 4KICA 2P81A 4WX9A 2DT5A 2IA0A 3Q9SA 2CQNA 5L3FA 4RM3A 4LLLA 3TBIA 1S9HA 3OMYA 2M0MA 5L3EA 4ZZDA 1QHGA 4HQMA 2QSFX 3OYKA 3COAC 3J81Z 1VQKI 1SVMA 4UB8C 5D1RA 3HOWJ 5H9TA 3TP3A 4HA8A 2V1NA 2IU5A 2DK8A 1DQUA 4BEHA 2IVMA 2DU9A 2HOAA 3X2QH 2Z33A 3DTIA 4LITA 4AYBN 2DMNA 3GFIA 4PFOA 3F1BA 4LOCA 5IPAA 2DA3A 3OYEA 1T98A 4XLAA 1IN4A 1VQ7I 2XF5A 3S2HJ 3BG9A 1ZG3A 3BTCA 3L2QA 5HLHA 2AS5F 3HRTA 5EEHA 1U78A 2LC2A 4XKVA 4WXDA 2HDCA 3N97A 1GXQA 2FUG2 2JA2A 3KZZA 3HXLA 3I58A 3OYCA 1XPXA 5C4XJ 3A01A 1J9IA 3OIPA 2FOKA 4WXCA 2CFXA 4FE7A 3CCSI 1RI7A 4A3GJ 3WGGA 2F07A 2DAOA 3HL2A 5FMPA 4UUSB 3GUDA 3V6GA 1H0MA 3FXKA 3DKXA 5EYRA 3H5NA 5FHPA 3OYBA 3V4GA 3WTSC 3ANGA 4KNYA 4FX4A 1VQ9I 2R5YA 5F1JA 5D5XB 3I9V2 3H9QA 2BY2A 4Q48A 2R7DA 3TMOA 3LSJA 2F5DA 1JHHA 1X3UA 2KRCA 3BWGA 2CV1A 4IKFA 2ZB9A 5DYMA 2YVXA 2BOLA 4N9HA 2J5OA 2CUZA 1W4MA 1NHAA 3CMYA 4E7IA 3K8PC 4BE1A 2OCEA 3SEZA 5HNHA 1FY7A 3ANPA 2XDVA 3VW1A 2Y9ZA 3A03A 1A31A 2HPMA 2XRNA 5M5XJ 1FJLA 2XAHA 5HDKA 2QUFA 5JLWA 3RQ4A 5EG0B 3OS1A 3ON4A 3HTIA 2LKSA 3IWZA 2Y30A 2O7OA 2OF7A 4GGGA 1D8KA 4NNJA 4MK6A 1HXDA 4OD5A 3B6CA 3OL4A 1I39A 1KYZA 1YX3A 1IGNA 1BOBA 3BCBA 1X3ZB 1G6NA 4HG2A 2ZJRF 3ZQIA 3GTOJ 4HF1A 2OA4A 5HDNA 1BW5A 2IGOA 2F48A 2E7WA 2G7HA 4XK4A 4Y13A 1ON2A 3P9CA 2NNYA 2F5CA 4NB5A 1TQMA 2HQRA 1MJAA 2M34A 2HXOA 3REOA 3OYFA 3ECHA 1PJRA 1JGGA 2BVLA 3GZNB 4DJAA 4PJ0C 3E6MA 5E8IA 5FKMA 1T6SA 1SFEA 1KA8A 2Q2EB 2XHKA 3JRGA 3QU3A 4ZYHA 3P5JA 3PUFA 4MQ9F 1O3RA 3L09A 3LQRA 1AKHA 3AG4H 3LA2A 3UR3C 4C2UA 2W24A 3CCQI 2HVRA 3OYLA 3HG9A 3QOEA 2DTZA 4XLCA 4UDSA 2ACJA 2BY0A 4L0YB 3U1KA 1ZG1A 3DWLE 2R7QA 3VP5A 5DTDA 4FT8A 5IOZA 3QP6A 3JTHA 1F43A 2JA8J 3G4SI 2MBFA 3C07A 2KZVA 2VC1A 4D7MA 3VSLA 2Z9OA 3WG7H 2IS1A 3EUHC 2EIKH 3OYDA 4LMYA 2QF7A 3FM3A 3OYIA 2OTJI 2ZOZA 1AA7A 1FP2A 2LD5A 1MH4A 1MMGA 3G1LA 2VKDA 3KEYA 3I59B 1YJ9I 2XKOA 2QBYB 1TBXA 4UB6C 4OMYA 2WBMA 3ASOH 2PI0A 2ELHA 2XGEA 3FXJA 1GLNA 1RKTA 3HTSB 1W1WE 3H9GA 5KAIC 3G73A 1GHCA 5E3OA 3I3LA 2DFIA 2IAIA 3AQTA 2A68F 2I8DA 5IYCJ 5K7ZA 4G7ZF 2DT6A 3KFWX 2OD5A 2EFPA 4NQWA 2LFBA 3OIQA 2P5KA 4A12A 2B0LA 1W7PA 5F0FA 3Q5FA 2VQCA 4ENKA 2WADA 1FNNA 3EGQA 4RGXA 2FNAA 4HBLA 4FETA 1B9MA 1IN8A 4ZTJA 3CUOA 4N4OB 4A69C 2FRHA 2R5ZB 3FISA 1BI1A 3ASNH 3KP4A 3HOXJ 3FXRA 4B4CA 2VOOA 2E1NA 1LDDA 3I0TA 4XKWA 2X0LA 2UV1A 2X51A 4XN3A 4AC0A 3L2RA 2Z16A 4KISA 2K9SA 3BOQA 2ZFWA 1VQLI 1R5HA 1BR4A 1QQIA 1J5YA 3HC7A 3VEPA 4IRHA 1ZAOA 1MJBA 2XF7A 3S1MJ 1ZRFA 1LUJB 1SD5A 3CO7C 3ZCOA 5KVRA 4LGWA 1I6HJ 1QU3A 3W2VA 5J1RA 3IUVA 4NHJA 3ZOBA 4CHUA 3IP4B 1JHFA 1ZGJA 3I5UA 4XIDA 3HYIA 4UUTA 1H9TA 4QPQA 3OS2A 2FQ4A 3GBGA 3F6VA 4HV5A 3BZCA 3ZQGA 1XDSA 2KPMA 5F04A 3K2AA 3FMSA 4C9YA 3JW4A 2VB6A 3SZGA 3E97A 4IHSA 2QQ8A 1R71A 2AQEA 4G9YA 4WK8F 1OMIA 2PBIA 2ZKZA 1T0FA 3FHZA 3BDDA 2OZUA 2IJLA 1R1VA 4E7LA 1MBHA 1Y1WJ 3QQAA 4IVNA 4L9VA 2MLGA 3C18A 3ZQCA 2YX4A 2H27A 2JK3A 1D5VA 2WB1A 5CXIA 2X6OA 1L0OC 3KP7A 4B48A 4DYCA 1MMNA 3ABLH 2MLKA 1KQ8A 3LSHA 2VT2A 1R58A 1SMYF 2L3DA 1RUOA 2GXGA 1TLHB 4MHGA 2G3BA 2UXIA 1XMXA 3MMYB 1PUEE 3L7WA 3B02A 1SGMA 4QWQA 4ZC3A 1X1BA 1HSJA 1ZREA 2W1OA 1Z3XA 2K3FA 2K9QA 4E7KA 1X2MA 1BI3A 2PLYA 2L02A 1BIBA 3AG1H 3BR1A 2QYOA 1R4MB 2IGKA 2WB1N 3OR2C 4Y17A 1VQ5I 2M2EA 2R7ZJ 3LSTA 1OYIA 1BN5A 2IGMA 2WAQA 3VSKA 3S1RJ 1XGMA 1RKWA 1QZYA 4U9NA 3MAJA 2DCEA 1EV7A 1GV2A 4MO7A 3F8MA 2KJCA 4NBQA 3LFUA 2L9SA 2LY9A 3HOZJ 3ZP5A 3L1PA 1X19A 1X58A 4LD5A 4MNUA 3ZQ7A 3ZMZA 4IHVA 5D5WB 3H9JA 4J19A 4M9XA 2KIUA 2ZC2A 4A3DJ 2RGVA 4Q5SF 1FSHA 5IP6A 1ACIA 1VQOI 2VOPA 4L9TA 2ADUA 4BBSJ 2A3SA 3RD3A 4CGZA 2ZXJA 3ZRGA 4LG0A 4MEXF 1TNTA 2L01A 4A2UA 2OQRA 4RAFA 2WAQN 4IQ4A 4JQFA 5JLXA 5JVTA 1SVLA 3KKCA 1WJAA 3BZ6A 2ZJ2A 4YIIA 2IA2A 2P0WA 3G7RA 4G8XA 2HS5A 1JT0A 1YIJI 3HSFA 4JK1X 1JTYA 2EZHA 5D8LB 4DYQA 2EZLA 2BYVE 2VQHA 3LSGA 3T0YA 2A5YB 1K6OA 4AU7A 2B1EA 2QWTA 1Z6TA 2DFFA 2JMWA 1A36A 1R1TA 1FYKA 4LB5A 1O7FA 1ONVA 1N78A 4M9SA 3MCZA 5GTIC 3LOCA 2FD5A 3JSOA 5GTHC 2ZMEB 4I02A 4A3LJ 3OWTA 3KYLA 3S8PA 4BBRJ 3RPUD 4GYIA 2OI8A 1ZK8A 3JSPA 2CS3A 1MSEC 5CVIA 3SYTA 3JRFA 3G56A 4XLHA 4A0XA 2LOOA 4I7HA 5FLXK 1FPQA 3GEZA 2DN0A 3V8JA 2NVUB 4Q4ZF 1ZR2A 1BR2A 2DA2A 3AG3H 4I99C 3KP6A 2QQAA 5F0HA 4G7OF 2FBHA 4LIVA 2FNPA 1G4DA 3NS4A 2BXYA 1LVAA 5IT9K 4A3IJ 1B8IA 2R3SA 1SANA 4W1UA 5EGOB 2KISA 1OCCH 3I53A 4XRMA 1GT0C 3HTHA 4WWCA 3H0DA 1Y56A 4XLPF 2HPIA 1IDZA 3U21A 4BJTA 4HW0A 4XL9A 5K7FA 4GCLA 3K4KA 3WHCA 4OAYA 2UXHA 1R23A 1FMWA 2PFBA 3B73A 3BR2A 4P9FA 3LSMA 2O9LA 5D8KB 5L3DA 2Q8KA 1QZZA 3I4MJ 2F4OB 4K2EA 1X1AA 1XGNA 5FGLA 5KK1A 4YIFA 5FRMA 3DPTA 3HSEA 3F21A 1VQNI 4EM2A 1FWZA 2GBYA 3W6VA 5KHDA 2V9PA 3K4CA 4LJZF 3OYHA 4R8HA 2RAEA 5IT3A 2Q1ZB 1SAUA 4J00A 2B9SA 3DPLC 3DEUA 3VDXA 5ICFA 2OJED 1P9QC 2WC2A 3HOSA 1S8NA 5IYDJ 4M6VA 2LYCA 4BE0A 3FHNA 1BC7C 4JOMA 3HB9A 4RAZA 4CCOA 5J1YA 3HOYJ 3F22A 2LLKA 3OYMA 3MWMA 2W00A 2ZFUA 2QOPA 3WTYC 2F2EA 1TW3A 2NX4A 2VL8A 2R4GA 1SD6A 3BLYA 3EUKL 3M9AA 4DNCA 1D5YA 2DA1A 1LEBA 3Q3SA 1UCRA 5LRSA 2RQQA 3CUQC 4B3XA 1G3SA 3S2WA 1PUFB 2L7ZA 1YE9A 3NQOA 1MNEA 2A5WA 3FKIJ 1RUNA 3EETA 3LSIA 5DCFA 3DLLF 3J81K 3S14J 2AXLA 1Z3YA 2GOXB 4OIOF 2DTRA 2M7BA 4J01A 4PCQA 4QLCU 4YELA 3R61A 1V5EA 1RR7A 4EVIA 1N25A 2L7FP 2GAUA 2IP2A 4HRIA 3QKXA 3T8TA 2JQ7A 1DGRM 3H3ZA 1I1GA 3SWHA 1WVRA 2GXAA 1T56A 1I5ZA 1T38A 2D5VA 4O6JA 4PK4A 1SEUA 3FXQA 4X6AJ 1UFMA 4BDZA 5GAGJ 1H8AC 2I10A 2LG4A 2YX7A 3M8JA 5CJ9A 4EJTA 5JFRA 1WRJA 1G8XA 4D9JA 2R93J 4Z6YA 4ZYDA 4H4KC 4JX4A 1MMDA 4XN0A 2XAGA 3MFKA 3DCFA 1KYWA 5LRRA 5FLXZ 4BXFA 3VYRB 3S17J 2OU2A 3E0JB 3OOPA 1P7JA 4DYRA 3L9FA 2KMUA 3MZYA 2KDOA 3E5XA 5FB2A 4BXUA 1S29A 1VQMI 4XKBA 4Y4RA 4ZH4F 3HJEA 3CLQA 3RKWA 2LTPA 1V3FA 4YFKF 1QVTA 5TISC 1STZA 4I98B 3ZN0A 2K7LA 1K4SA 4ITVA 2A6EF 2JSPA 1OYYA 3KYCB 3TP0A 3OSFA 4ETSA 5AQCA 2DJIA 2QKMB 1ETQA 4KIBA 1BI2A 5FLVA 4FASD 3DKYA 3KX2A 1FBUA 2VQGA 2FA5A 3CCEI 2QEXI 4IHWA 2HYJA 3RPUA 2CO5A 1IUYA 1P92A 1POGA 4KYWA 5JR3A 3JRIA 5J40A 1G3TA 1FP1D 1YFHA 1QHHD 1Y0UA 1T95A 2DI3A 4NC8A 4BACA 1XN7A 2CQQA 4G6QA 5BPDA 3L00A 4RS8A 2Z99A 5EF6A 5AONA 5H20A 4CZZA 2DW4A 3TL4X 2XVCA 4XR6A 5CLSA 5CW8A 4GFBA 3TW7A 3K1MA 4DOZA 4B8XA 2DMTA 5DCMB 4BHPA 2D1HA 1KU9A 4UVBA 2IA1A 3I71A 3TEDA 3ZQFA 3ABTA 1OCZH 5HBUA 2DLLA 1ZYRF 2M45A 4A5MA 3BQYA 4GO1A 2DA7A 3FKJA 5D6EA 2XF6A 3HM5A 2K9LA 2CWEA 1HDDC 3CCRI 2G7GA 3J7YJ 2CSOA 1EA3A 1XMKA 3TDZC 1NK2P 2Y75A 1RC9A 3HTUA 2JTVA 4L5IA 3RZDJ 4OWRB 4XSXF 5KAFC 3WHBA 2VBXA 3TOBA 2IRFG 4AM3A 1ETOA 1O4XA 3HHHA 1E3PA 1D0ZA 3AL0C 2Y9YA 3NEUA 4XLFA 3E6DA 4IRGA 2V4JC 1W7PD 5KCMA 2RREA 2J5PA 1ZRCA 1JJ8C 2COBA 3T1BA 3EDPA 1YIOA 3K4BA 2M30A 2O3FA 4N9IA 4BS9A 2EV6A 1LJ9A 3FM5A 4PFPA 2FSWA 4YFXF 2VBWA 4CGRA 5IY5H 4CCJA 2KHMA 3HIMA 1MBFA 3A0BC 1LB2A 3E5QA 1W36C 4HNTA 3FK6A 2L54A 4EJVA 2A6HF 2A07F 3CRJA 2BVMA 3IAM2 1YG2A 1T39A 9ANTA 2BY3A 3IRRA 1IRXA 1U9NA 1X1PA 2ZNZA 4KFCA 3JAMK 2CJJA 2OZ6A 2O7TA 2YVEA 4U0WA 2XSDC 1J09A 2GA1A 4M3GA 3LHQA 3FF5A 4ZZLA 2D1VA 3RYPA 1OJLA 4I0BA 1TP4A 2L9NA 2E2HJ 4UVAA 4M73A 1ZR4A 2E19A 4L9JA 1Y6IA 2LBFB 3E7LA 3H5RA 4A3EJ 2H8WA 2QIBA 1FYLA 2FJ1A 4IX7A 1DPRA 4DVYP 2ZCMA 2DBBA 3H35A 1R00A 2V6EA 2VODA 1TQIA 3G1MA 2IPQX 2W53A 4IHYA 4HNUA 2VUMJ 4A6EA 2L0KA 4U0YA 3PQJA 1D8JA 2KRHA 5E3NA 4OIQF 4RM2A 1N77A 2PQ8A 5JVGF 3NRVA 4L5JA 4ENNA 1LKXA 1WJBA 2QSGX 1JT6A 3N4MA 2ZXIA 3WODF 1TNSA 3M07A 3QRFF 2XPUA 3HHGA 3WTVC 3G1OA 2L4AA 2ZOYA 1O57A 3HOTA 1YJNI 2XV4S 1USTA 2GZWA 2L7KA 3RIRA 1MH3A 2QVOA 1TWAJ 1ETYA 1SMTA 3JCUC 1YITI 1K61A 2HQ5A 3BP8A 3PO3J 3RKQA 1YRNB 1FTZA 2Z1DA 3OR1C 2RVCA 1XMAA 5TGTA 4H0EA 4BJ5C 4ANJA 3JREA 2DPDA 1X1DA 1ZG5A 4WCGA 3EUHA 3C1DA 1UAAA 4C2TA 1IDYA 3WGHA 2Y31A 3QPHA 5LGUA 1EF4A 4XLNF 4D0PA 3HTJA 3MN2A 2VC0A 3C3WA 2V6CA 2DQRA 2ID6A 4ZDLA 4F93B 3I55I 1D1BA 1ENHA 4KN7X 3BROA 2V9VA 1TTYA 6PAXA 1ZLKA 1I3QJ 2HKXA 3S1QJ 4EEFG 2M4GA 4HLYA 2OPTA 4EQQA 3W3CA 4PZJA 2BV6A 1BI0A 1BM9A 3Q0VA 2IT0A 3WTTC 3OS0A 3IWFA 4LK1F 1Q1VA 1J7KA 2VASA 3QWLA 3UNGC 1GVDA 1MMSA 3ZMVA 1OCPA 1XCVA 5TJJA 3RH2A 1Y8RB 3PM1A 2JA5J 4QPOA 4DQ2A 3I4PA 2FQ3A 2X1CA 4BJ6C 3FBNB 3H3VK 3PSFA 1NH3A 3CF2A 4RMNA 2E1CA 2JUGA 3QYBA 1XSVA 4CCMA 2NS7A 1LE8A 2VBYA 3K9TA 2YU9J 3FXMA 1BIAA 2NXNB 3EYYA 4BEHB 4P1WA 2EBIA 3TW6A 5D5VB 4RGRA 1WKMA 2XPWA 4G7HF 1XCBA 3HRMA 4IXAA 4ME9A 3I64A 3E6BA 1TT5B 4JP0A 4RB3C 2AO9A 1PP7U 1XDUA 2L9VA 1YQAA 2UXNA 1WGXA 2L9RA 2ZCWA 4UV9A 4CZCA 2WA0A 4M72A 3HSRA 4ZDPA 3ERED 2K85A 1V5GA 2HXIA 3J80K 3FZVA 5FRNA 3PL8A 1UI6A 1Z0XA 5DUKA 3M7GA 4PJLA 3KZ9A 4KWAA 1K4TA 2HYTA 3A01B 3DQVC 3NXCA 3CCYA 3CCVI 3CQZJ 3PNTA 1HA8A 1WFXA 3JAMZ 1S7AA 4E7ZA 1D3YA 1S5LC 3BJOA 3EQLF 4HLXA 3JTGA 4L18B 2YR2A 4RA2A 1IG7A 1USSA 2C6YA 2ISYA 2HGCA 4B43A 1T33A 1ZTRA 1Z77A 2R5YB 3VVYA 2F6CA 2DJNA 1W5CC 4HF0A 4HDUA 3GTKJ 3P9TA 5LHGA 3VOEA 2GFNA 3M4OJ 2JVGA 5J1UA 5JHFA 3HPHA 1MBKA 5BNGA 3WTUC 2BE5F 1E0EA 3JRAA 1OKRA 4U87A 3CCJI 2ESNA 2L7MP 2WAFA 3KP5A 1JUMA 1ZGAA 3M3YJ 1KU3A 2R0QC 1MDMA 1YTYA 1LQ1A 3KEQA 3EYIA 2W85A 5FLMJ 4MXMA 1BA5A 2ECCA 3CJQB 4M3DA 1WJEA 5GAHJ 2D6YA 5J8FA 3HRSA 5BQTA 5LHHA 4PJJA 2CQKA 2H8RA 2V1DA 1U9OA 1IN5A 3VW2A 5DS9A 2W57A 1R1UA 4BQNA 3ZN1A 3CTAA 2REKA 3ROUA 4AIHA 3DFGA 3HOVJ 3GYHX 2DOFA 4XLEA 2HOTA 3LSRA 1X4OA 1WJFA 1VZ0A 3CP2A 3GFLA 4IJAA 1P4AA 3MD2A 2UXUA 1KQ9A 2YSRA 5LEJA 2M4KA 3JRBA 1F4KA 2HU9A 4EM0B 2H6BA 5F6FA 2WWYA 2A2FX 3BR0A 5FKOA 1MKMA 3K2ZA 4PJMA 3CCLI 1SFOJ 1MBGA 4JYKA 1G2HA 1AKHB 2EINH 4JNNA 3G2BA 5ILUA 2Y0MA 3K7AJ 3KLNA 1HC8A 3V8LA 3GTGJ 3L2CA 4A3CJ 4FCYA 4HX4A 5D19A 1UG0A 4XRSA 1WJCA 3HGYA 2RKHA 1FLIA 5K7HA 3CDLA 5DM6F 1LFPA 3WTXC 3K10A 1LPQA 2VLAA 2Z3YA 4RGSA 3CC2I 2RASA 3P9IA 5DEQA 2DA5A 2G7UA 3O60A 1IXCA 2K86A 2DK5A 2HWVA 3SDGA 4C2MJ 3W2AA 3BR6A 3CJDA 2VJ5A 1IV6A 2PFVA 2PZ9A 4UXNA 2B3WA 1CF7A 1E3HA 2LMDA 4AC6A 3IV5A 4RBOA 4YFNF 1APLC 5FGMA 4MIMA 1O3QA 4MTDA 2N8GA 1REPC 2HKUA 2QQBA 1X1CA 2ZNYA 5EDNA 3LA3A 4BU2A 1UHWA 4D7NA 2UXOA 1S72I 1B6AA 3QBMA 4L9NA 1NTCA 4IO9F 4N4NB 4KN4X 3J80Z 1GVJA 2RNJA 5J3LA 3L2UA 5KNLA 1YX5A 4BDYA 3SFZA 2K9NA 4BGDA 4NQWB 4FHTA 2EWNA 3CC4I 1TWGJ 2W48A 1W7PB 4C3IJ 2ZO4A 2ICWG 2JPBA 4AVZA 1K7AA 3PJRA 3NRGA 2XAQA 1WI9A 3T5XA 3ERMA 1CGPA 2EFWA 4A5NA 2NS8A 2X6XA 3A2KA 2QENA 2OERA 2DMQA 2XAJA 2RQPA 3LL7A 5EZHA 3VVZA 2KDZA 4B09A 4ESFA 2DYRH 2CUFA 1K78A 1XB4A 4LLGF 2AXTC 2HQNA 3DBLB 2X6WA 3O6BB 1IN6A 4KITB 4KUMA 1HLVA 3GTQJ 5CPRB 2XAUA 3W6KB 4GCTA 1QO0D 3KP2A 1MW7A 3KNWA 4RAYA 1HKSA 3CLOA 5ILSA 2LK2A 4NC7A 4OMZA 3SFIA 4ASNA 2BHZA 3AFHA 4M3EA 2FBQA 3WU1B 2DQLA 3G3ZA 3T8RA 5LEKA 1IO2A 5M3MJ 1FYMA 3QP5A 3VVXA 2V9KA 3OV8A 2G7LA 5DV5A 1ON1A 3HBLA 2Q0OA 5L3CA 3ZMDA 3BCGA 5CKTA 1OISA 2YS9A 5GADJ 2TCTA 1U8BA 4AWXB 2HDDA 1U5TC 5EZGA 3V8KA 4D5FA 2A69F 5ED4A 3QYEA 5FD5A 5E1ZB 2PBXA 1BW6A 3E3VA 2LKXA 1MSFC 4EJWA 4G6TB 1Z6RA 1RETA 3S32A 3LQQA 2QA4I 1R7JA 5C4YA 5CYVA 2DFHA 2NYXA 2IS4A 3CF5F 1IW7F 3DLAA 1R5GA 4M9ZA 2RN7A 3HUGA 4PUSA 4I2OA 3R60A 2E71A 2HZDA 1V55H 1JGSA 1TQPA 3RJPA 5EFYA 2JUCA 1DDNA 3GZIA 4GCKA 1YO5C 2DT7B 5D4SA 2E35A 1PP8F 2M8EA 4GCVA 2NP5A 2BBYA 3O3KA 1W36D 2XRLA 3CMMA 3FX3A 4EJOA 4E7JA 1R22A 1AHDP 1UELB 2CG4A 1ZARA 4CYCA 4BY1J 2VXZA 4JX6A 5HS9A 3K6GA 3J7ZI 5H6RA 3FDYA 2E36A 2K5CA 5K5OA 2X4HA 3RQIA 5FROA 4JL3A 4IHTA 3KKDA 2VE8A 3HPGA 4E70A 2W7NA 3MVPA 3QU6A 5CVJA 2O03A 1ETVA 4GYGA 2WAEA 4KT5C 1E3OC 1U0JA 3CUQA 4AIKA 4UUVA 3OYNA 2EILH 3ON2A 4XMYA 1MNMC 2R7TA 3DP7A 4XSZF 1ZLJA 1DGWY 1JUSA 3K4MA 1H88C 3RYRA 3C2BA 1WQ2A 4M3FA 3KZIC 3GEUA 3TDUC 2CUEA 2CW0F 2PN6A 3S1NJ 1TWCJ 2FBKA 2VQLA 3TQNA 3BPVA 2DOAA 3FMQA 1OLTA 1FOXA 2PG4A 4RDUA 3BG6A 2R7FA 2L4MA 4BQAA 2GUHA 1WJDA 1WI3A 1TT0A 2FU4A 5IYBJ 2HR3A 2M0CA 2KIFA 1BL0A 2R7OA 5F0CA 4O5VA 4XM3A 2XB0X 1FSEA 1IRZA 5BMZA 2UZKA 3O2PE 4LG0B 2JRMA 2ZJPF 2ETHA 5AIPA 3TOAA 2HVQA 5F1RA 2CH0A 2VJJA 2R92J 2HDWA 4EATA 2JJ7A 2BZTA 4LFUA 4NC6A 2EFNA 3VYTB 1IRFA 5E79C 1H89C 4ESJA 1WPKA 5J6XA 1DP3A 3HEFA 4B1RA 1RR8C 2PJRA 1JI8A 4A93J 4KT6A 2P5VA 3AKZA 1OPCA 2NAZA 5CVVA 3DU6A 2K4BA 2DPUA 3O8HA 4GFLA 1T2KA 1B72A 3VOKA 2DDAA 3A0HC 3RDIA 4E7HA 2VI6A 4II2A 3KYDB 2LRDA 3DTKA 1WHUA 1G3WA 3M8FA 4RLQA 3GTLJ 1JXSA 2IS6A 1YLFA 2JA6J 3K0LA 3CCMI 1FEXA 2MABA 2YU3A 5B66C 2Z5UA 1IC8A 1FBSA 3CWRA 1MMAA 2DG7A 5LLQA 3QOPA 1IV8A 5J8CA 3QPTA 2DODA 1SD7A 2BW3A 4A3MJ 3BTIA 2EQRA 3ZR8X 3CC7I 4YZEA 1HQCA 3WTWC 1RPWA 2H09A 2V26A 3KEOA 1WCMJ 5L3BA 2ESHA 2KZGA 3BC8A 2XUBA 3P7NA 3PIPF 2PEXA 1UHSA 4IOAF 1QRYA 3FXLA 3KZYA 2VKVA 2XIGA 3ESWB 1U3EM 4E7SA 4XONA 3W6JB 3MZHA 4JKZA 3BJBA 1S7OA 3EPZA 1B8IB 1HDPA 3ZPLA 3BG3A 4LG3A 4DIQA 2RHAA 3NNRA 3RKXA 3A4CA 1SVOA 5HS7A 2A05A 5E18F 2KRFA 4AD9A 2H1KA 1OR7A 3BY6A 3CP8A 4L5EA 1YYVA 3D0SA 2EZKA 1FOWA 3HIFA 5FFZA 2ME0A 5B3SH 4YEJA 4PSWA 3SDBA 1WWXA 2EJRA 4HEA2 1FIPA 1OFCX 1TC3C 2JA7J 5K58A 4R1HA 4UUSA 1O7LA 4A3FJ 3WU0A 3R0JA 3U2RA 3NWSA 2CW8A 2M87A 3CJRB 2OUMA 3W2WA 2CU7A 2X1DA 5IOYA 2CQXA 1MZBA 2BGCA 2COMA 4BH9A 3FXUA 2NS0A 4X0GA 3AAFA 1ZH5A 3FWEA 5ERIA 4AIJA 2ELKA 1MJ9A 1BR1A 1ERDA 1QA6A 3U1DA 4HSRA 4A3BJ 2HQAA 4A3KJ 2E1MB 4XOPA 2ISZA 2JZYA 2A61A 2CUJA 3SHFA 2B7EA 3QODA 1F9NA 4YRVA 1TW2A 4FQGA 2W4SA 1VQPI 2OV7A 1HBXG 3V7RA 2UUZA 4BQOA 1LDJA 2E34A 2HTJA 2E2IJ 5FFXA 5CQEA 2CGPA 3M8EA 2HOEA 3K70C 4XRFA 1HW2A 3H1CA 4AUXA 4OD4A 1OR7C 3G71I 3KE2A 4RB0A 5EG0A 2YPRA 1U2WA 1GUUA 1XX5A 2M7AA 2KFDA 1GV5A 2V57A 1KU2A 2K9MA 2X85A 3JSJA 1UJ8A 2O8XA 1Y0NA 1KZHA 3PASA 1K83J 4DZPA 3PO2J 2WUIA 3CD6I 2KQRA 2MG4A 4IOCF 2W82A 2FF4A 2DO7A 2K27A 4Y3OA 1UZCA 2KIMA 2O5RA 2KKOA 1YW8A 1VQ8I 1Z1DA 3ISPA 2CMPA 4HX8A 4FTHA 5BPIA 1NG7A 3GVAA 3VFZA 3HDDA 3OYJA 1XGOA 3RPQA 3J7AO 1A6IA 3RI4A 3TO6A 1I3AA 1FT9A 1W0TA 1QPIA 4OIRF 3ABUA 3DF8A 1D1CA 2LVSA 2WV0A 2V7FA 4MLOA 2O0YA 2BEOA 2BW3B 1OCOH 3BQZA 1AU7A 2Q2EA 2K40A 3P9KA 2OBPA 2DMPA 1ZRDA 2HNHA 2UXPA 5TRDA 3RZOJ 1XS9A 3ZGKA 4QIWN 2EPFA 2HKOA 3PIOF 2PMZA 3PFIA 1IXRC 2H6CA 2YVHA 2JN6A 2ECBA 4IQJA 4HKUA 2M1BA 1FOKA 4Y7NJ 3SEQA 4EM1A 3FXOA 1PVEA 4ABZA 1YHQI 1VFCA 2Y69H 3BHQA 2Q24A 2GIVA 2F5FA 4G94A 4CO8A 3BR3A 2D45A 1IXSB 4HF2A 1HW1A 2BY1A 1UMQA 4RB2C 3DKWA 3BT9A 3K4NA 4HX7A 4GXOA 1QZEA 4KIGA 3I59A 4W97A 2CYYA 4HDVA 4BYYA 4MTEA 2G7SA 2QBYA 3BRUA 4II3A 2PMZN 1DU0A 2WGBA 2NVYJ 2XKPA 4XRSG 4L0ZB 1S7EA 2CQ7A 4QSHA 2ME6A 1OYWA 3AL0B 3V7CA 3KLOA 3IL2A 4M6YA 1E17A 3SZTA 2CV2A 3GZ5A 3ZXSA 3BTJA 2HTSA 5GAEJ 2QSHX 2MA3A 2VONA 3F8NA 1XSDA 4OOIA 3HRUA 4HOBA 1HCRA 2NVXJ 2VBZA 3S16J 5D6FA 3M1EA 3IAS2 4KMUX 5BOXA 1B9NA 2G9WA 4CCKA 1JKPC 1BC8C 3E5UA 4CSWA 4U7DA 5DD4A 1TL8A 1G3YA 4BL0B 4NELA 3S2DJ 2LP0A 5E3LA 2GQQA 2F4IA 4I01A 2R5ZA 2DYSH 3CO6C 1F36A 3IKTA 2FEZA 3GLLA 2PMUA 1B4AA 1D1AA 1I6XA 3R0AA 1JJ6C 1OQYA 4GDFA 4WIBA 2CFOA 2EIMH 4R79A 2VT3A 2GIZA 5D5UB 3FMRA 4PGHA 4F3QA 4IEJA 2AQFA 3KCCA 4X1EA 2MC4A 4UHTA 3GFJA 3MKZA 1ORKA 3BZKA 2E5ZA 1SFXA 3F9KA 2XGCA 4BKXA 2STWA 4LB6B 2XSJC 1PYVA 4CXFA 3S15J 3RTRA 3Q0WA 1FX7A 1QNTA 2RV8A 2RDPA 3GFMA 2XROA 1MBEA 1RZ4A 2ELJA 4Y15A 3KIOA 4HZFA 4LIUA 4E6KG 2LH9A 4M3BA 2EZIA 4ZYAA 2NP3A 5CXGA 1XTAA 3COLA 2DG8A 1D0YA 4DBQA 2LF7A 3JRCA 2E2JJ 1FZPB 3FK7A 4U88A 2VKHA 2GOMA 2RNGA 1A35A 3CMEI 3GTPJ 2XC7A 5HSZA 2A6TA 2FE3A 5HDGA 1JTXA 3FBIB 2JWTA 3LSPA 4CH7A 3V78A 4B3AA 2WV1A 3NWTA 3LJLA 1ULYA 5ILVA 2VPLA 1XSXA 2X48A 2VIXA 3QYFA 3WGIA 2LR8A 3VYUB 4N0BA 5E20A 1ITYA 2HVSA 3QPLA 1B1BA 1P2FA 3ZQLA 5ICEA 2YUSA 4B47A 3HKZA 4WF2A 3V42A 1OCRH 4F55A 1ODDA 3AQSA 3F8BA 2XPVA 5C3EJ 2VJ4A 2V1UA 1SD4A 4UNOA 1MD0A 3ZMTA 4I76A 2PJPA 2OQGA 4KIFA 3LA7A 3JR9A 1EH6A 2FJI1 4GFKA 4A3JJ 3IUOA 2IXSA 1P7IA 2HYGD 5JI6A 1YOVB 3PSIA 4UY8I 4I09A 2E7XA 1CQTA 4P5OA 4F7ZA 1IN7A 2CRGA 3NI7A 1X4PA 3SXYA 5J47A 1F1ZA 3VOXA 1DP7P 4HSTA 3CESA 3IH3A 3OOUA 2CW7A 1J2XA 4LK0F 5E17F 3RSNA 3BCAA 3HKZN 5FJ8J 5H2FC 1O3TA 3BG5A 1MNDA 3GF2A 4HV6A 3H5AA 4A0ZA 5E3MA 1MBJA 5K5QA 2GLOA 1WJ5A 1UI5A 3MQ0A 1NG6A 2KP6A 2UXXA 3V7SA 4IL6C 4ENMA 2K3PA 2OC6A 4FX0A 5B1AH 2KT0A 5C44J 1JE8A 5EEAA 1NK3P 2WY8Q 1A6QA 3E1SA 4KDPA 1Y1VJ 5FKNA 4XBFA 1LNWA 4JX5A 2EB7A 3GTJJ 4RB1A 1UG2A 4P9UA 5HOOA 5A2QK 1Z9CA 1J59A 5D18A 2LY1A 2EV5A 5DD8A 2EFOA 4ICHA 4RAGA 2IW5A 4XKCA 3L2VA 3S3NA 2ZXWH 5C4JJ 1ETKA 3A02A 2O61A 1Z91A 2QKOA 3CMAI 3D5RC 4XORA 3PNVA 4OU0A 1XGSA 1WSUA 3E7QA 4XICA 1IAWA 3C2GA 1W5TA 4C30A 5B1BH 2JVHA 5CQGA 4OINF 2O8KA 4UV8A 2GM4A 3HTAA 4CICA 5HODA 1I27A 4DBRA 4NUBA 2VPRA 3GZ6A 4IZZA 5B5EC 3D5LA 1FOYA 1KGSA 3F8CA 4MFDA 2XASA 1JKQC 1FTTA 4CA0A 4DZJA 4I0AA 5H6QA 3H92A 3QAHA 3S3OA 4LLNA 3T6NA 1R5ID 2LREA 4PDKA 3MNLA 3F6OA 3HGGA 2D2WA 1HW5A 2DA4A 2ZMEA 5LGNA 4ZYGA 4U7BA 2Y48A 1LE8B 2BHYA 3D5SC 1B59A 1QPMA 2XDNA 5D4RA 1DUXC 2EV0A 3NPIA 3S93A 4PSXA 3GMEA 2PMHA 4EGYA 1MGTA 1R9TJ 1DPUA 3KP3A 1ZKGA 4KMFA 1YS7A 2F5VA 4IHXA 4AIDA 4F92B 4AVPA 2LY2A 3DXJF 4ZDOA 1EJ9A 1YJWI 2IBDA 1FC3A 2L5QA 1EKEA 1KQ0A 3IH2A 2FXAA 4G12A 1KU7A 4KJZA 1IZ1A 4S0HB 1F5TA 2R7SA 1HKTA 3IC7A 4GRIA 1VTNC 4Y52J 3ABKH 5GPCA 3CJNA 4CCNA 4YIRX 4IRIA 5DUIA 1I1SA 2KIQA 1BJAA 3IHUA 3OYAA 5EGOA 2M3AA 2IGNA 2MGQA 4ESBA 1M1EB 2Y2ZA 4E4HA 3DBHB 2ZBKA 2R7RA 3PQKA 5EEGA 4BUPA 1EH8A 1U5TA 1SC7A 3LAPA 3CJTB 2P6TA 3D1NI 1RESA 3ULQB 5IP7J 3K4JA 4MEYF 2X1EA 2TRTA 3RKYA 1T8IA 4HPQA 5J4YA 1XD7A 2FOWA 2QM3A 5AIQA 2QKLB 3VYSB 5DM7F 3F3XA 3DEEA 3PNYA 4ON0A 2ZMEC 2DOEA 4EJUA 5FKKA 1XG1A 3WE3A 5ICGA 4OAZA 2JT1A 4S05A 3LFKA 1PDNC 1WH7A 1VF9A 2M8GX 3E6CC 1V54H 1T0FC 2W84A 1SAXA 1MDMB 4P96A 1RNLA 2F4MB 3VW0A 3MKLA 2ZCXA 3BR5A 1N75A 1R6RA 5IP9J 4HQEA 3OYGA 2GXBA 1HSTA 2VXDA 1ZGWA 4NDLA 3WTZA 3VIBA 4HYEA 1L3LA 4A0YA 1RIOH 1I50J 1GXPA 1R36A 3K70D 2QGUA 1IF1A 5HNFA 1P4WA 2VN2A 3PPBA 3Q9VA 3SQNA 2QZ8A 3F23A 5LBQA 2EFQA 2OAZA 3I4NJ 4D5CA 3LWJA 5A2QZ 5E1WA 2GWRA 2HFHA 4CDGA 2QWWA 3TO9A 3ZMUA 1G59A 1LEAA 3CDIA 2VJIA 2LKPA 1HOMA 2OCCH 3TGNA 4BAYA 2MH2A 1PUFA 2KL4A 2WY7Q 1TWHJ 4B44A 2JRTA 3QPSA 2P8TA 3GX4X 1KONA 4CYDA 1BJZA 1VNDA 1XC5A 4D1QA 2F5EA 1V4RA 3ECOA 2ID3A 1O3SA 1RRJA 1LVKA 3H0GJ 2ZXHA 3H3UA 4U0VA 1LDKB 2K4JA 4F52A 3G6EI 3VUQA 1MIJA 2FX0A 2L2OA 1JKOC 3ONQA 4QTRA 2HEOA 2GA2A 1YW7A 3GXOA 3OL3A 2NVTJ 4IRVA 4M71A 4XNFA 1WH5A 1IUFA 4KA4A 2O6GE 2NVQJ 1A04A 1AOYA 2PX9A 4Y33A 2Z2SB 3C7JA 3GWZA 3OIOA 2R7WA 1U8RA 4ZTFA 1VQ6I 4P55A 5EJCA 4MQVA 3R4KA 1Z67A 1JUPA 1CF7B 1P6RA 4BNCA 1Y39A 1HKQA 2FBIA 3DPUA 4I6ZA 3ZQHA 2LF8A 5J4VA 2P7VB 4NN1A 3NAUA 3BJ6A 1Z7LA 4EV0A 3KETA 3KPHA 5K1YA 1IRGA 1Q1HA 2VKEA 2MFZA 3WE2A 3AG2H 3DBRB 2R7UA 4O3MA 3OY9A 2QLZA 4BHBA 1U5TB 1V5FA 2DA6A 3DPJA 1VI0A 3N05A 3DV8A 2XGDA 3ZMSA 2ZCNA 5GPAA 4YG2F 2DXIA 4C3JJ 2HOSA 3PUBA 1QVUA 4HNVA 1K79A 1ZELA 3UKGA 2NRAC 4PGGA 3K69A 1GDTA 5CVRA 1C0WA 3FRQA 1S6LA 1K78B 2MD0A 2RC4A 5JHUA 2W25A 4RLFA 3K4LA 3IRQA 4CUGA 2EA2A 1AWCA 2JSCA 1ETXA 3GCMA 3IKVA 4EMSA 4FISA 1TZLA 1H9GA 4ZJZA 3BJAA 2EIJH 1E2XA 2M5WA 3RCOA 1R49A 1P4XA 1SFKA 4AF5A 4ZYEA 5M5YJ 4HAMA 3B81A 3O8GA 2EK5A 4MFEA 3LSKA 2IEKA 2MD5A 5FD6A 4TV7A 3HE0A 1R4NB 2MYSA 3WU2C 3S3MA 5DCMA 2IS2A 3ZQQA 3ML6A 2EH3A 5HLTA 3TKYA 2EA4A 5E1XA 2M9HA 1ETWA 1J0RA 4CCLA 3PFYA 4RGUA 3DTEA 2HI3A 3GLXA 1QGPA 2I5UA 2BXZA 3CZ6A 4Z2YA 3OSGA 4JBAA 2VE9A 1W0UA 1J75A 4M6XA 3VTIA 3F72A 1WZ2A 1K6YA 4DGWB 5M5WJ 2P4WA 5E8GA 2JPCA 4MGRA 2ZSIB 4A6DA 2V1XA 4F91B 3HUGB 3FIWA 1A5JA 1Z05A 1UHMA 1ZHFA 5F64A 2H1LA 2QCOA 5L3GA 5ICCA 3LNQA 2MSYA 2LSOA 4Q47A 3LWFA 2R7VA 5HAWA 3HZJA 3MKWB 4BQQA 5FO5A 2XB5A 3JRHA 3BTLA 1YI2I 1U6GA 2E5NA 4CYCB 4IPAA 4PXIA 4M74A 4ENJA 2FMYA 2ZJQF 3GO5A 1FIAA 3ELKA 3BNIA 4V2GA 3S5RA 1OCTC 1LFUP 1FMVA 1HF0A 2B63J 2P5LC 2UWMA 5K5RA 3NARA 1EH7A 1T08B 1DU6A 3BG7A 2E1MC 3CCUI 3SJMA 3CDHA 2QTQA 3R6SA 4BE2A 3DU5A 4U9LA 3CUQB 1ZQ3P 3C2HA 1FBQA 5LGTA 5LD2C 3VPRA 5HLGA 2HYFA 2KLOA 3IH4A 4C2MA 5FKLA 4G6DA 3A1YA 4V2FA 2CV0A 1YS6A 5HVQC 5HS8A 2DDBA 3VB2A 2X9DA 1YW9A 3M1CA 2DFEA 2NNNA 2X6YA 1JKRC 5DAJA 2AHQA 2LBFA 4C3HJ 2FMLA 1VQ4I 5IT9Z 1SFUA 2XAFA 3BPXA 3GW2A 2ZSHB 3L2WA 3I56I 3K1PA 2OTLI 2H94A 4UVCA 3F8FA 5LHIA 1ZN2A 1X3WB 3K1NA 1TWFJ 2MC3A 4L62A 2STTA 4V19K 2NOGA 3MKYB 5F27A 1Z7UA 4XOTA 2V79A 4XQFA 5BS6A 4EGZA 3VWBA 2R7XA 3I54A 1IJWC 2MH9A 2LDUA 2DMUA 2Y0SA 2G0EA 3Q0UA 2WTEA 3TO7A 4BXXJ 3MEXA 4BY7J 3GTMJ 4PJNA 1UB9A 2KJBA 2MW8A 1LFBA 2K02A 5M3FJ 3F0CA 3WG9A 2XGXA 2E1OA 3SZPA 2PJRB 3LMMA 5DDGA 2ZY9A 2E60A 3J7AY 3ABMH 1YRNA
chains in the Genus database with same CATH topology
3SDGA 4C2MJ 3COLA 3BR6A 3CJDA 1IV6A 2DG8A 2PZ9A 4DW6A 1X2NA 2E2JJ 3JRCA 2GBYA 3JRDA 3W6VA 3FK7A 5GP9A 4AC6A 3B6AA 3IV5A 4RBOA 2RAEA 3DEWA 1B72B 3EUPA 1APLC 3GTPJ 5HSZA 4MIMA 2N8GA 3HOUJ 5F08A 2HKUA 1JTXA 5EDNA 2JWTA 3LSPA 3V78A 4D7NA 2UXOA 4B3AA 2WV1A 3QBMA 3LJLA 1NTCA 2Y0SN 5IYDJ 4M6VA 2X48A 4ACIA 2LR8A 5J3LA 3HB9A 5J1YA 3HOYJ 1ITYA 2K9NA 2LLKA 3QPLA 2GENA 4FE4A 3ZQLA 2YUSA 2QOPA 1TWGJ 2P81A 2W48A 4C3IJ 2NX4A 3AQSA 3NRGA 2XPVA 5C3EJ 4I76A 1D5YA 2NS8A 2OERA 2DA1A 2DMQA 5EZHA 3JR9A 4GFKA 3VVZA 3Q3SA 2KDZA 4A3JJ 2CUFA 1P7IA 1PUFB 1CQTA 2L7ZA 2CRGA 3NI7A 3FKIJ 1HLVA 5D1RA 3HOWJ 3VOXA 5H9TA 3GTQJ 3TP3A 3S14J 4GCTA 3IH3A 3OOUA 2IU5A 3KNWA 2HOAA 2LK2A 3SFIA 3HKZN 5FJ8J 4AYBN 2DMNA 4M3EA 3F1BA 1RR7A 2FBQA 4LOCA 5IPAA 2L7FP 3BG5A 2DA3A 2GLOA 5E3MA 3QKXA 1MBJA 5M3MJ 3S2HJ 3BG9A 3BTCA 1UI5A 3VVXA 1U78A 2G7LA 3HBLA 1T56A 3BCGA 2KT0A 5C44J 2D5VA 2YS9A 5EEAA 1NK3P 4X6AJ 2TCTA 1U8BA 2HDDA 3A01A 5C4XJ 5EZGA 4D5FA 1Y1VJ 5FKNA 1H8AC 4A3GJ 2I10A 4FE7A 2PBXA 4JX5A 1BW6A 3GTJJ 2LKXA 1MSFC 2F07A 1UG2A 5FMPA 4UUSB 3V6GA 5D18A 2R93J 1RETA 4JX4A 4ICHA 5EYRA 5FHPA 5C4YA 3DCFA 3ANGA 2R5YA 5F1JA 5C4JJ 3S17J 1ETKA 3A02A 2QKOA 4DYRA 1P7JA 5EFYA 4GCKA 3LSJA 3GZIA 3E7QA 4XICA 2LTPA 2NP5A 2ZB9A 1QVTA 2XRLA 1AHDP 3CMYA 2O8KA 4CYCA 4BY1J 2GM4A 4JX6A 3TP0A 3HTAA 3OSFA 5HODA 5AQCA 1ETQA 2VPRA 5FLVA 3ANPA 3VW1A 4MFDA 3RQIA 2Y9ZA 3A03A 1JKQC 1FJLA 4JL3A 5M5XJ 3KKDA 4IHWA 1FTTA 2HYJA 3MVPA 4DZJA 5JLWA 5EG0B 3T6NA 3ON4A 1POGA 1ETVA 3HTIA 3MNLA 3JRIA 2Y30A 3HGGA 5FGLA 2DA4A 2O7OA 2OF7A 4MK6A 1LE8B 1E3OC 3B6CA 2XDNA 3ON2A 2CQQA 1MNMC 3NPIA 1IGNA 5EF6A 1R9TJ 1JUSA 1ZKGA 1H88C 4IHXA 3C2BA 3ZQIA 5CW8A 3GTOJ 4M3FA 4GFBA 1BW5A 3GEUA 2IBDA 4XK4A 3TW7A 2CUEA 3S1NJ 1TWCJ 2DMTA 3IH2A 4G12A 2M34A 2HXOA 4S0HB 3TEDA 3ZQFA 1JGGA 4Y52J 5GPCA 4RDUA 5HBUA 5FKMA 3BQYA 2GUHA 1WI3A 2DA7A 3JRGA 5IYBJ 2M0CA 3HM5A 5EGOA 1AKHA 1BL0A 2MGQA 5F0CA 1HDDC 2Y2ZA 2XB0X 2G7GA 2DTZA 4UDSA 1NK2P 1IRZA 3D1NI 1RESA 3RZDJ 5IP7J 3VP5A 5DTDA 5IOZA 2TRTA 3WHBA 2R92J 1ETOA 1F43A 2JJ7A 1O4XA 2JA8J 3C07A 2Y9YA 4D7MA 1H89C 1WPKA 3HEFA 4B1RA 5FKKA 4A93J 2QF7A 1XG1A 2ZOZA 1JJ8C 2COBA 2LD5A 1MH4A 3G1LA 1WH7A 4CGRA 3O8HA 1VF9A 3HIMA 4GFLA 1MBFA 2M8GX 1B72A 3VOKA 3FK6A 2XGEA 2VI6A 3VW0A 3MKLA 1RKTA 3BR5A 2ZCXA 3CRJA 5IP9J 5E3OA 1ZGWA 2IAIA 3AQTA 4NDLA 1U9NA 3GTLJ 5IYCJ 3VIBA 5K7ZA 2JA6J 1FEXA 1I50J 1IC8A 2CJJA 3CWRA 2O7TA 2DG7A 2YVEA 2XSDC 2LFBA 4M3GA 3LHQA 5F0FA 4A3MJ 3PPBA 3BTIA 1OJLA 3I4NJ 2EQRA 4D5CA 3EGQA 3LWJA 2E2HJ 4YZEA 1RPWA 1WCMJ 4A69C 1ZR4A 2E19A 2R5ZB 1HOMA 3E7LA 1UHSA 3FISA 3HOXJ 4A3EJ 1QRYA 1PUFA 2VKVA 4B4CA 1TWHJ 2QIBA 2FJ1A 3QPSA 2ZCMA 4JKZA 3BJBA 1B8IB 4AC0A 1BJZA 1HDPA 3G1MA 3BG3A 1VNDA 2K9SA 2W53A 1XC5A 4IHYA 2VUMJ 2RHAA 3NNRA 2L0KA 2ID3A 5E3NA 3H0GJ 3S1MJ 3VUQA 1JT6A 2FX0A 2H1KA 1JKOC 4QTRA 1I6HJ 2NVTJ 2XPUA 4L5EA 5J1RA 3G1OA 3IUVA 1WH5A 3ZOBA 2ZOYA 2EZKA 1IUFA 2NVQJ 4XIDA 4UUTA 2ME0A 2FQ4A 3GBGA 1MH3A 9ANTA 1TWAJ 1ETYA 3OIOA 1K61A 3PO3J 1FTZA 2HQ5A 3ZQGA 3RKQA 1YRNB 5F04A 3K2AA 3JREA 1FIPA 1OFCX 1TC3C 2JA7J 1JUPA 5K58A 4UUSA 4A3FJ 1IDYA 4I6ZA 3ZQHA 2Y31A 4NN1A 3NAUA 1EF4A 2CU7A 5IOYA 2CQXA 3HTJA 3MN2A 2VKEA 2ID6A 2ELKA 1ENHA 1MBHA 1Y1WJ 3QQAA 1I3QJ 2DA6A 4A3BJ 1VI0A 3DPJA 4A3KJ 3S1QJ 4EEFG 3ZQCA 2XGDA 2JK3A 2ZCNA 5CXIA 2OPTA 5GPAA 2X6OA 4C3JJ 2HOSA 4DYCA 1QVUA 3Q0VA 4HNVA 1Q1VA 3UKGA 2E2IJ 2G3BA 2UXIA 1GDTA 1GVDA 1SGMA 1OCPA 3FRQA 4AUXA 3RH2A 3PM1A 2JA5J 5EG0A 3H3VK 1GUUA 1GV5A 2K9QA 2V57A 1X2MA 1ETXA 2NS7A 1LE8A 3JSJA 2YU9J 4FISA 3PASA 1K83J 4DZPA 3PO2J 2WUIA 2MG4A 3BR1A 4AF5A 2EBIA 3TW6A 2XPWA 2WB1N 5M5YJ 3B81A 3O8GA 4MFEA 2M2EA 2R7ZJ 2IEKA 4ME9A 4JP0A 2AO9A 4FTHA 3HE0A 3S1RJ 3HDDA 1WGXA 1RKWA 2L9RA 4MO7A 1A6IA 1GV2A 2EH3A 2HXIA 1W0TA 2LY9A 2M9HA 1QPIA 3HOZJ 1ETWA 3L1PA 4IHVA 1X58A 1Z0XA 1UI6A 2HI3A 2LVSA 4MLOA 4J19A 1W0UA 3OSGA 3KZ9A 4KWAA 3BQZA 1AU7A 4A3DJ 2HYTA 3A01B 3NXCA 2K40A 3CCYA 3CQZJ 2DMPA 2UXPA 5IP6A 3RZOJ 1XS9A 4QIWN 4BBSJ 3RD3A 5M5WJ 1IG7A 2YVHA 2JN6A 2ECBA 1T33A 1ZTRA 1Z77A 2R5YB 4HKUA 3VVYA 2DJNA 4Y7NJ 1A5JA 2WAQN 3FIWA 5JLXA 3GTKJ 3P9TA 4ABZA 2GFNA 1VFCA 3KKCA 3M4OJ 2QCOA 2Q24A 3BHQA 5J1UA 3LNQA 2MSYA 3G7RA 1MBKA 5BNGA 1JT0A 3BR3A 5HAWA 3JRAA 1JTYA 1UMQA 2EZHA 2XB5A 4DYQA 2EZLA 3JRHA 3BTLA 3BT9A 4CYCB 2L7MP 3LSGA 4W97A 4PXIA 2QWTA 2G7SA 1JUMA 2JMWA 3BRUA 3M3YJ 1FIAA 3BNIA 2PMZN 4V2GA 3S5RA 1OCTC 1DU0A 1LFUP 2R0QC 1HF0A 2B63J 2WGBA 2NVYJ 4XRSG 3NARA 1S7EA 2ME6A 4QSHA 1DU6A 5FLMJ 4MXMA 3LOCA 2FD5A 2ECCA 4M3DA 1BA5A 3SJMA 2QTQA 4A3LJ 2D6YA 3BTJA 1ZQ3P 4BBRJ 1HCRA 2NVXJ 2OI8A 1ZK8A 3S16J 2H8RA 1MSEC 3VPRA 1U9OA 3IH4A 3JRFA 3G56A 5FKLA 3VW2A 4V2FA 5DS9A 1JKPC 2REKA 2DN0A 4NELA 3HOVJ 3S2DJ 2HOTA 1ZR2A 2LP0A 2X9DA 5E3LA 3LSRA 2DA2A 1JKRC 5DAJA 2AHQA 2R5ZA 5F0HA 4C3HJ 2UXUA 1F36A 3JRBA 3BR0A 5FKOA 4A3IJ 1SFOJ 1B8IA 1MBGA 1SANA 4JYKA 4W1UA 1G2HA 5EGOB 1TWFJ 1JJ6C 1AKHB 4L62A 2NOGA 4XRMA 1GT0C 3HTHA 4JNNA 5F27A 3K7AJ 4IEJA 4X1EA 1ORKA 3GTGJ 4A3CJ 1IDZA 4FCYA 1IJWC 5CXGA 5D19A 4XRSA 5K7FA 4GCLA 2DMUA 2XGCA 2G0EA 3HGYA 3Q0UA 4BKXA 3WHCA 4BY7J 3GTMJ 4BXXJ 3S15J 2MW8A 5K7HA 2UXHA 3Q0WA 1LFBA 3CDLA 5M3FJ 3BR2A 3F0CA 1MBEA 2O9LA 2E1OA 2RASA 2DA5A 3I4MJ 3O60A 4M3BA 2EZIA 1YRNA 2NP3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SDG A;  4C2M J;  3COL A;  3BR6 A;  3CJD A;  1IV6 A;  2DG8 A;  2PZ9 A;  4DW6 A;  1X2N A;  2E2J J;  3JRC A;  2GBY A;  3JRD A;  3W6V A;  3FK7 A;  5GP9 A;  4AC6 A;  3B6A A;  3IV5 A;  4RBO A;  2RAE A;  3DEW A;  1B72 B;  3EUP A;  1APL C;  3GTP J;  5HSZ A;  4MIM A;  2N8G A;  3HOU J;  5F08 A;  2HKU A;  1JTX A;  5EDN A;  2JWT A;  3LSP A;  3V78 A;  4D7N A;  2UXO A;  4B3A A;  2WV1 A;  3QBM A;  3LJL A;  1NTC A;  2Y0S N;  5IYD J;  4M6V A;  2X48 A;  4ACI A;  2LR8 A;  5J3L A;  3HB9 A;  5J1Y A;  3HOY J;  1ITY A;  2K9N A;  2LLK A;  3QPL A;  2GEN A;  4FE4 A;  3ZQL A;  2YUS A;  2QOP A;  1TWG J;  2P81 A;  2W48 A;  4C3I J;  2NX4 A;  3AQS A;  3NRG A;  2XPV A;  5C3E J;  4I76 A;  1D5Y A;  2NS8 A;  2OER A;  2DA1 A;  2DMQ A;  5EZH A;  3JR9 A;  4GFK A;  3VVZ A;  3Q3S A;  2KDZ A;  4A3J J;  2CUF A;  1P7I A;  1PUF B;  1CQT A;  2L7Z A;  2CRG A;  3NI7 A;  3FKI J;  1HLV A;  5D1R A;  3HOW J;  3VOX A;  5H9T A;  3GTQ J;  3TP3 A;  3S14 J;  4GCT A;  3IH3 A;  3OOU A;  2IU5 A;  3KNW A;  2HOA A;  2LK2 A;  3SFI A;  3HKZ N;  5FJ8 J;  4AYB N;  2DMN A;  4M3E A;  3F1B A;  1RR7 A;  2FBQ A;  4LOC A;  5IPA A;  2L7F P;  3BG5 A;  2DA3 A;  2GLO A;  5E3M A;  3QKX A;  1MBJ A;  5M3M J;  3S2H J;  3BG9 A;  3BTC A;  1UI5 A;  3VVX A;  1U78 A;  2G7L A;  3HBL A;  1T56 A;  3BCG A;  2KT0 A;  5C44 J;  2D5V A;  2YS9 A;  5EEA A;  1NK3 P;  4X6A J;  2TCT A;  1U8B A;  2HDD A;  3A01 A;  5C4X J;  5EZG A;  4D5F A;  1Y1V J;  5FKN A;  1H8A C;  4A3G J;  2I10 A;  4FE7 A;  2PBX A;  4JX5 A;  1BW6 A;  3GTJ J;  2LKX A;  1MSF C;  2F07 A;  1UG2 A;  5FMP A;  4UUS B;  3V6G A;  5D18 A;  2R93 J;  1RET A;  4JX4 A;  4ICH A;  5EYR A;  5FHP A;  5C4Y A;  3DCF A;  3ANG A;  2R5Y A;  5F1J A;  5C4J J;  3S17 J;  1ETK A;  3A02 A;  2QKO A;  4DYR A;  1P7J A;  5EFY A;  4GCK A;  3LSJ A;  3GZI A;  3E7Q A;  4XIC A;  2LTP A;  2NP5 A;  2ZB9 A;  1QVT A;  2XRL A;  1AHD P;  3CMY A;  2O8K A;  4CYC A;  4BY1 J;  2GM4 A;  4JX6 A;  3TP0 A;  3HTA A;  3OSF A;  5HOD A;  5AQC A;  1ETQ A;  2VPR A;  5FLV A;  3ANP A;  3VW1 A;  4MFD A;  3RQI A;  2Y9Z A;  3A03 A;  1JKQ C;  1FJL A;  4JL3 A;  5M5X J;  3KKD A;  4IHW A;  1FTT A;  2HYJ A;  3MVP A;  4DZJ A;  5JLW A;  5EG0 B;  3T6N A;  3ON4 A;  1POG A;  1ETV A;  3HTI A;  3MNL A;  3JRI A;  2Y30 A;  3HGG A;  5FGL A;  2DA4 A;  2O7O A;  2OF7 A;  4MK6 A;  1LE8 B;  1E3O C;  3B6C A;  2XDN A;  3ON2 A;  2CQQ A;  1MNM C;  3NPI A;  1IGN A;  5EF6 A;  1R9T J;  1JUS A;  1ZKG A;  1H88 C;  4IHX A;  3C2B A;  3ZQI A;  5CW8 A;  3GTO J;  4M3F A;  4GFB A;  1BW5 A;  3GEU A;  2IBD A;  4XK4 A;  3TW7 A;  2CUE A;  3S1N J;  1TWC J;  2DMT A;  3IH2 A;  4G12 A;  2M34 A;  2HXO A;  4S0H B;  3TED A;  3ZQF A;  1JGG A;  4Y52 J;  5GPC A;  4RDU A;  5HBU A;  5FKM A;  3BQY A;  2GUH A;  1WI3 A;  2DA7 A;  3JRG A;  5IYB J;  2M0C A;  3HM5 A;  5EGO A;  1AKH A;  1BL0 A;  2MGQ A;  5F0C A;  1HDD C;  2Y2Z A;  2XB0 X;  2G7G A;  2DTZ A;  4UDS A;  1NK2 P;  1IRZ A;  3D1N I;  1RES A;  3RZD J;  5IP7 J;  3VP5 A;  5DTD A;  5IOZ A;  2TRT A;  3WHB A;  2R92 J;  1ETO A;  1F43 A;  2JJ7 A;  1O4X A;  2JA8 J;  3C07 A;  2Y9Y A;  4D7M A;  1H89 C;  1WPK A;  3HEF A;  4B1R A;  5FKK A;  4A93 J;  2QF7 A;  1XG1 A;  2ZOZ A;  1JJ8 C;  2COB A;  2LD5 A;  1MH4 A;  3G1L A;  1WH7 A;  4CGR A;  3O8H A;  1VF9 A;  3HIM A;  4GFL A;  1MBF A;  2M8G X;  1B72 A;  3VOK A;  3FK6 A;  2XGE A;  2VI6 A;  3VW0 A;  3MKL A;  1RKT A;  3BR5 A;  2ZCX A;  3CRJ A;  5IP9 J;  5E3O A;  1ZGW A;  2IAI A;  3AQT A;  4NDL A;  1U9N A;  3GTL J;  5IYC J;  3VIB A;  5K7Z A;  2JA6 J;  1FEX A;  1I50 J;  1IC8 A;  2CJJ A;  3CWR A;  2O7T A;  2DG7 A;  2YVE A;  2XSD C;  2LFB A;  4M3G A;  3LHQ A;  5F0F A;  4A3M J;  3PPB A;  3BTI A;  1OJL A;  3I4N J;  2EQR A;  4D5C A;  3EGQ A;  3LWJ A;  2E2H J;  4YZE A;  1RPW A;  1WCM J;  4A69 C;  1ZR4 A;  2E19 A;  2R5Z B;  1HOM A;  3E7L A;  1UHS A;  3FIS A;  3HOX J;  4A3E J;  1QRY A;  1PUF A;  2VKV A;  4B4C A;  1TWH J;  2QIB A;  2FJ1 A;  3QPS A;  2ZCM A;  4JKZ A;  3BJB A;  1B8I B;  4AC0 A;  1BJZ A;  1HDP A;  3G1M A;  3BG3 A;  1VND A;  2K9S A;  2W53 A;  1XC5 A;  4IHY A;  2VUM J;  2RHA A;  3NNR A;  2L0K A;  2ID3 A;  5E3N A;  3H0G J;  3S1M J;  3VUQ A;  1JT6 A;  2FX0 A;  2H1K A;  1JKO C;  4QTR A;  1I6H J;  2NVT J;  2XPU A;  4L5E A;  5J1R A;  3G1O A;  3IUV A;  1WH5 A;  3ZOB A;  2ZOY A;  2EZK A;  1IUF A;  2NVQ J;  4XID A;  4UUT A;  2ME0 A;  2FQ4 A;  3GBG A;  1MH3 A;  9ANT A;  1TWA J;  1ETY A;  3OIO A;  1K61 A;  3PO3 J;  1FTZ A;  2HQ5 A;  3ZQG A;  3RKQ A;  1YRN B;  5F04 A;  3K2A A;  3JRE A;  1FIP A;  1OFC X;  1TC3 C;  2JA7 J;  1JUP A;  5K58 A;  4UUS A;  4A3F J;  1IDY A;  4I6Z A;  3ZQH A;  2Y31 A;  4NN1 A;  3NAU A;  1EF4 A;  2CU7 A;  5IOY A;  2CQX A;  3HTJ A;  3MN2 A;  2VKE A;  2ID6 A;  2ELK A;  1ENH A;  1MBH A;  1Y1W J;  3QQA A;  1I3Q J;  2DA6 A;  4A3B J;  1VI0 A;  3DPJ A;  4A3K J;  3S1Q J;  4EEF G;  3ZQC A;  2XGD A;  2JK3 A;  2ZCN A;  5CXI A;  2OPT A;  5GPA A;  2X6O A;  4C3J J;  2HOS A;  4DYC A;  1QVU A;  3Q0V A;  4HNV A;  1Q1V A;  3UKG A;  2E2I J;  2G3B A;  2UXI A;  1GDT A;  1GVD A;  1SGM A;  1OCP A;  3FRQ A;  4AUX A;  3RH2 A;  3PM1 A;  2JA5 J;  5EG0 A;  3H3V K;  1GUU A;  1GV5 A;  2K9Q A;  2V57 A;  1X2M A;  1ETX A;  2NS7 A;  1LE8 A;  3JSJ A;  2YU9 J;  4FIS A;  3PAS A;  1K83 J;  4DZP A;  3PO2 J;  2WUI A;  2MG4 A;  3BR1 A;  4AF5 A;  2EBI A;  3TW6 A;  2XPW A;  2WB1 N;  5M5Y J;  3B81 A;  3O8G A;  4MFE A;  2M2E A;  2R7Z J;  2IEK A;  4ME9 A;  4JP0 A;  2AO9 A;  4FTH A;  3HE0 A;  3S1R J;  3HDD A;  1WGX A;  1RKW A;  2L9R A;  4MO7 A;  1A6I A;  1GV2 A;  2EH3 A;  2HXI A;  1W0T A;  2LY9 A;  2M9H A;  1QPI A;  3HOZ J;  1ETW A;  3L1P A;  4IHV A;  1X58 A;  1Z0X A;  1UI6 A;  2HI3 A;  2LVS A;  4MLO A;  4J19 A;  1W0U A;  3OSG A;  3KZ9 A;  4KWA A;  3BQZ A;  1AU7 A;  4A3D J;  2HYT A;  3A01 B;  3NXC A;  2K40 A;  3CCY A;  3CQZ J;  2DMP A;  2UXP A;  5IP6 A;  3RZO J;  1XS9 A;  4QIW N;  4BBS J;  3RD3 A;  5M5W J;  1IG7 A;  2YVH A;  2JN6 A;  2ECB A;  1T33 A;  1ZTR A;  1Z77 A;  2R5Y B;  4HKU A;  3VVY A;  2DJN A;  4Y7N J;  1A5J A;  2WAQ N;  3FIW A;  5JLX A;  3GTK J;  3P9T A;  4ABZ A;  2GFN A;  1VFC A;  3KKC A;  3M4O J;  2QCO A;  2Q24 A;  3BHQ A;  5J1U A;  3LNQ A;  2MSY A;  3G7R A;  1MBK A;  5BNG A;  1JT0 A;  3BR3 A;  5HAW A;  3JRA A;  1JTY A;  1UMQ A;  2EZH A;  2XB5 A;  4DYQ A;  2EZL A;  3JRH A;  3BTL A;  3BT9 A;  4CYC B;  2L7M P;  3LSG A;  4W97 A;  4PXI A;  2QWT A;  2G7S A;  1JUM A;  2JMW A;  3BRU A;  3M3Y J;  1FIA A;  3BNI A;  2PMZ N;  4V2G A;  3S5R A;  1OCT C;  1DU0 A;  1LFU P;  2R0Q C;  1HF0 A;  2B63 J;  2WGB A;  2NVY J;  4XRS G;  3NAR A;  1S7E A;  2ME6 A;  4QSH A;  1DU6 A;  5FLM J;  4MXM A;  3LOC A;  2FD5 A;  2ECC A;  4M3D A;  1BA5 A;  3SJM A;  2QTQ A;  4A3L J;  2D6Y A;  3BTJ A;  1ZQ3 P;  4BBR J;  1HCR A;  2NVX J;  2OI8 A;  1ZK8 A;  3S16 J;  2H8R A;  1MSE C;  3VPR A;  1U9O A;  3IH4 A;  3JRF A;  3G56 A;  5FKL A;  3VW2 A;  4V2F A;  5DS9 A;  1JKP C;  2REK A;  2DN0 A;  4NEL A;  3HOV J;  3S2D J;  2HOT A;  1ZR2 A;  2LP0 A;  2X9D A;  5E3L A;  3LSR A;  2DA2 A;  1JKR C;  5DAJ A;  2AHQ A;  2R5Z A;  5F0H A;  4C3H J;  2UXU A;  1F36 A;  3JRB A;  3BR0 A;  5FKO A;  4A3I J;  1SFO J;  1B8I A;  1MBG A;  1SAN A;  4JYK A;  4W1U A;  1G2H A;  5EGO B;  1TWF J;  1JJ6 C;  1AKH B;  4L62 A;  2NOG A;  4XRM A;  1GT0 C;  3HTH A;  4JNN A;  5F27 A;  3K7A J;  4IEJ A;  4X1E A;  1ORK A;  3GTG J;  4A3C J;  1IDZ A;  4FCY A;  1IJW C;  5CXG A;  5D19 A;  4XRS A;  5K7F A;  4GCL A;  2DMU A;  2XGC A;  2G0E A;  3HGY A;  3Q0U A;  4BKX A;  3WHC A;  4BY7 J;  3GTM J;  4BXX J;  3S15 J;  2MW8 A;  5K7H A;  2UXH A;  3Q0W A;  1LFB A;  3CDL A;  5M3F J;  3BR2 A;  3F0C A;  1MBE A;  2O9L A;  2E1O A;  2RAS A;  2DA5 A;  3I4M J;  3O60 A;  4M3B A;  2EZI A;  1YRN A;  2NP3 A; 
#chains in the Genus database with same CATH topology
 5CVU A;  5LFA A;  1D0X A;  4DW6 A;  3H36 A;  1X2N A;  2NOJ B;  3JRD A;  4OIP F;  4WXH A;  5GP9 A;  2TDX A;  3B6A A;  3DEW A;  1B72 B;  3EUP A;  2QQ9 A;  2P7C B;  3VOD A;  4S04 A;  1Y8Q B;  3HOU J;  4IF4 A;  5F08 A;  1BBY A;  2P6S A;  1QBJ A;  1S3J A;  3U9G A;  2HZT A;  2Y0S N;  3MZ8 A;  5HLI A;  2LNB A;  4ACI A;  1W5S A;  3EUA A;  3LAJ A;  2GEN A;  1BOA A;  4FE4 A;  1Z21 A;  4BHC A;  4AYB A;  4KIC A;  2P81 A;  4WX9 A;  2DT5 A;  2IA0 A;  3Q9S A;  2CQN A;  5L3F A;  4RM3 A;  4LLL A;  3TBI A;  1S9H A;  3OMY A;  2M0M A;  5L3E A;  4ZZD A;  1QHG A;  4HQM A;  2QSF X;  3OYK A;  3COA C;  3J81 Z;  1VQK I;  1SVM A;  4UB8 C;  5D1R A;  3HOW J;  5H9T A;  3TP3 A;  4HA8 A;  2V1N A;  2IU5 A;  2DK8 A;  1DQU A;  4BEH A;  2IVM A;  2DU9 A;  2HOA A;  3X2Q H;  2Z33 A;  3DTI A;  4LIT A;  4AYB N;  2DMN A;  3GFI A;  4PFO A;  3F1B A;  4LOC A;  5IPA A;  2DA3 A;  3OYE A;  1T98 A;  4XLA A;  1IN4 A;  1VQ7 I;  2XF5 A;  3S2H J;  3BG9 A;  1ZG3 A;  3BTC A;  3L2Q A;  5HLH A;  2AS5 F;  3HRT A;  5EEH A;  1U78 A;  2LC2 A;  4XKV A;  4WXD A;  2HDC A;  3N97 A;  1GXQ A;  2FUG 2;  2JA2 A;  3KZZ A;  3HXL A;  3I58 A;  3OYC A;  1XPX A;  5C4X J;  3A01 A;  1J9I A;  3OIP A;  2FOK A;  4WXC A;  2CFX A;  4FE7 A;  3CCS I;  1RI7 A;  4A3G J;  3WGG A;  2F07 A;  2DAO A;  3HL2 A;  5FMP A;  4UUS B;  3GUD A;  3V6G A;  1H0M A;  3FXK A;  3DKX A;  5EYR A;  3H5N A;  5FHP A;  3OYB A;  3V4G A;  3WTS C;  3ANG A;  4KNY A;  4FX4 A;  1VQ9 I;  2R5Y A;  5F1J A;  5D5X B;  3I9V 2;  3H9Q A;  2BY2 A;  4Q48 A;  2R7D A;  3TMO A;  3LSJ A;  2F5D A;  1JHH A;  1X3U A;  2KRC A;  3BWG A;  2CV1 A;  4IKF A;  2ZB9 A;  5DYM A;  2YVX A;  2BOL A;  4N9H A;  2J5O A;  2CUZ A;  1W4M A;  1NHA A;  3CMY A;  4E7I A;  3K8P C;  4BE1 A;  2OCE A;  3SEZ A;  5HNH A;  1FY7 A;  3ANP A;  2XDV A;  3VW1 A;  2Y9Z A;  3A03 A;  1A31 A;  2HPM A;  2XRN A;  5M5X J;  1FJL A;  2XAH A;  5HDK A;  2QUF A;  5JLW A;  3RQ4 A;  5EG0 B;  3OS1 A;  3ON4 A;  3HTI A;  2LKS A;  3IWZ A;  2Y30 A;  2O7O A;  2OF7 A;  4GGG A;  1D8K A;  4NNJ A;  4MK6 A;  1HXD A;  4OD5 A;  3B6C A;  3OL4 A;  1I39 A;  1KYZ A;  1YX3 A;  1IGN A;  1BOB A;  3BCB A;  1X3Z B;  1G6N A;  4HG2 A;  2ZJR F;  3ZQI A;  3GTO J;  4HF1 A;  2OA4 A;  5HDN A;  1BW5 A;  2IGO A;  2F48 A;  2E7W A;  2G7H A;  4XK4 A;  4Y13 A;  1ON2 A;  3P9C A;  2NNY A;  2F5C A;  4NB5 A;  1TQM A;  2HQR A;  1MJA A;  2M34 A;  2HXO A;  3REO A;  3OYF A;  3ECH A;  1PJR A;  1JGG A;  2BVL A;  3GZN B;  4DJA A;  4PJ0 C;  3E6M A;  5E8I A;  5FKM A;  1T6S A;  1SFE A;  1KA8 A;  2Q2E B;  2XHK A;  3JRG A;  3QU3 A;  4ZYH A;  3P5J A;  3PUF A;  4MQ9 F;  1O3R A;  3L09 A;  3LQR A;  1AKH A;  3AG4 H;  3LA2 A;  3UR3 C;  4C2U A;  2W24 A;  3CCQ I;  2HVR A;  3OYL A;  3HG9 A;  3QOE A;  2DTZ A;  4XLC A;  4UDS A;  2ACJ A;  2BY0 A;  4L0Y B;  3U1K A;  1ZG1 A;  3DWL E;  2R7Q A;  3VP5 A;  5DTD A;  4FT8 A;  5IOZ A;  3QP6 A;  3JTH A;  1F43 A;  2JA8 J;  3G4S I;  2MBF A;  3C07 A;  2KZV A;  2VC1 A;  4D7M A;  3VSL A;  2Z9O A;  3WG7 H;  2IS1 A;  3EUH C;  2EIK H;  3OYD A;  4LMY A;  2QF7 A;  3FM3 A;  3OYI A;  2OTJ I;  2ZOZ A;  1AA7 A;  1FP2 A;  2LD5 A;  1MH4 A;  1MMG A;  3G1L A;  2VKD A;  3KEY A;  3I59 B;  1YJ9 I;  2XKO A;  2QBY B;  1TBX A;  4UB6 C;  4OMY A;  2WBM A;  3ASO H;  2PI0 A;  2ELH A;  2XGE A;  3FXJ A;  1GLN A;  1RKT A;  3HTS B;  1W1W E;  3H9G A;  5KAI C;  3G73 A;  1GHC A;  5E3O A;  3I3L A;  2DFI A;  2IAI A;  3AQT A;  2A68 F;  2I8D A;  5IYC J;  5K7Z A;  4G7Z F;  2DT6 A;  3KFW X;  2OD5 A;  2EFP A;  4NQW A;  2LFB A;  3OIQ A;  2P5K A;  4A12 A;  2B0L A;  1W7P A;  5F0F A;  3Q5F A;  2VQC A;  4ENK A;  2WAD A;  1FNN A;  3EGQ A;  4RGX A;  2FNA A;  4HBL A;  4FET A;  1B9M A;  1IN8 A;  4ZTJ A;  3CUO A;  4N4O B;  4A69 C;  2FRH A;  2R5Z B;  3FIS A;  1BI1 A;  3ASN H;  3KP4 A;  3HOX J;  3FXR A;  4B4C A;  2VOO A;  2E1N A;  1LDD A;  3I0T A;  4XKW A;  2X0L A;  2UV1 A;  2X51 A;  4XN3 A;  4AC0 A;  3L2R A;  2Z16 A;  4KIS A;  2K9S A;  3BOQ A;  2ZFW A;  1VQL I;  1R5H A;  1BR4 A;  1QQI A;  1J5Y A;  3HC7 A;  3VEP A;  4IRH A;  1ZAO A;  1MJB A;  2XF7 A;  3S1M J;  1ZRF A;  1LUJ B;  1SD5 A;  3CO7 C;  3ZCO A;  5KVR A;  4LGW A;  1I6H J;  1QU3 A;  3W2V A;  5J1R A;  3IUV A;  4NHJ A;  3ZOB A;  4CHU A;  3IP4 B;  1JHF A;  1ZGJ A;  3I5U A;  4XID A;  3HYI A;  4UUT A;  1H9T A;  4QPQ A;  3OS2 A;  2FQ4 A;  3GBG A;  3F6V A;  4HV5 A;  3BZC A;  3ZQG A;  1XDS A;  2KPM A;  5F04 A;  3K2A A;  3FMS A;  4C9Y A;  3JW4 A;  2VB6 A;  3SZG A;  3E97 A;  4IHS A;  2QQ8 A;  1R71 A;  2AQE A;  4G9Y A;  4WK8 F;  1OMI A;  2PBI A;  2ZKZ A;  1T0F A;  3FHZ A;  3BDD A;  2OZU A;  2IJL A;  1R1V A;  4E7L A;  1MBH A;  1Y1W J;  3QQA A;  4IVN A;  4L9V A;  2MLG A;  3C18 A;  3ZQC A;  2YX4 A;  2H27 A;  2JK3 A;  1D5V A;  2WB1 A;  5CXI A;  2X6O A;  1L0O C;  3KP7 A;  4B48 A;  4DYC A;  1MMN A;  3ABL H;  2MLK A;  1KQ8 A;  3LSH A;  2VT2 A;  1R58 A;  1SMY F;  2L3D A;  1RUO A;  2GXG A;  1TLH B;  4MHG A;  2G3B A;  2UXI A;  1XMX A;  3MMY B;  1PUE E;  3L7W A;  3B02 A;  1SGM A;  4QWQ A;  4ZC3 A;  1X1B A;  1HSJ A;  1ZRE A;  2W1O A;  1Z3X A;  2K3F A;  2K9Q A;  4E7K A;  1X2M A;  1BI3 A;  2PLY A;  2L02 A;  1BIB A;  3AG1 H;  3BR1 A;  2QYO A;  1R4M B;  2IGK A;  2WB1 N;  3OR2 C;  4Y17 A;  1VQ5 I;  2M2E A;  2R7Z J;  3LST A;  1OYI A;  1BN5 A;  2IGM A;  2WAQ A;  3VSK A;  3S1R J;  1XGM A;  1RKW A;  1QZY A;  4U9N A;  3MAJ A;  2DCE A;  1EV7 A;  1GV2 A;  4MO7 A;  3F8M A;  2KJC A;  4NBQ A;  3LFU A;  2L9S A;  2LY9 A;  3HOZ J;  3ZP5 A;  3L1P A;  1X19 A;  1X58 A;  4LD5 A;  4MNU A;  3ZQ7 A;  3ZMZ A;  4IHV A;  5D5W B;  3H9J A;  4J19 A;  4M9X A;  2KIU A;  2ZC2 A;  4A3D J;  2RGV A;  4Q5S F;  1FSH A;  5IP6 A;  1ACI A;  1VQO I;  2VOP A;  4L9T A;  2ADU A;  4BBS J;  2A3S A;  3RD3 A;  4CGZ A;  2ZXJ A;  3ZRG A;  4LG0 A;  4MEX F;  1TNT A;  2L01 A;  4A2U A;  2OQR A;  4RAF A;  2WAQ N;  4IQ4 A;  4JQF A;  5JLX A;  5JVT A;  1SVL A;  3KKC A;  1WJA A;  3BZ6 A;  2ZJ2 A;  4YII A;  2IA2 A;  2P0W A;  3G7R A;  4G8X A;  2HS5 A;  1JT0 A;  1YIJ I;  3HSF A;  4JK1 X;  1JTY A;  2EZH A;  5D8L B;  4DYQ A;  2EZL A;  2BYV E;  2VQH A;  3LSG A;  3T0Y A;  2A5Y B;  1K6O A;  4AU7 A;  2B1E A;  2QWT A;  1Z6T A;  2DFF A;  2JMW A;  1A36 A;  1R1T A;  1FYK A;  4LB5 A;  1O7F A;  1ONV A;  1N78 A;  4M9S A;  3MCZ A;  5GTI C;  3LOC A;  2FD5 A;  3JSO A;  5GTH C;  2ZME B;  4I02 A;  4A3L J;  3OWT A;  3KYL A;  3S8P A;  4BBR J;  3RPU D;  4GYI A;  2OI8 A;  1ZK8 A;  3JSP A;  2CS3 A;  1MSE C;  5CVI A;  3SYT A;  3JRF A;  3G56 A;  4XLH A;  4A0X A;  2LOO A;  4I7H A;  5FLX K;  1FPQ A;  3GEZ A;  2DN0 A;  3V8J A;  2NVU B;  4Q4Z F;  1ZR2 A;  1BR2 A;  2DA2 A;  3AG3 H;  4I99 C;  3KP6 A;  2QQA A;  5F0H A;  4G7O F;  2FBH A;  4LIV A;  2FNP A;  1G4D A;  3NS4 A;  2BXY A;  1LVA A;  5IT9 K;  4A3I J;  1B8I A;  2R3S A;  1SAN A;  4W1U A;  5EGO B;  2KIS A;  1OCC H;  3I53 A;  4XRM A;  1GT0 C;  3HTH A;  4WWC A;  3H0D A;  1Y56 A;  4XLP F;  2HPI A;  1IDZ A;  3U21 A;  4BJT A;  4HW0 A;  4XL9 A;  5K7F A;  4GCL A;  3K4K A;  3WHC A;  4OAY A;  2UXH A;  1R23 A;  1FMW A;  2PFB A;  3B73 A;  3BR2 A;  4P9F A;  3LSM A;  2O9L A;  5D8K B;  5L3D A;  2Q8K A;  1QZZ A;  3I4M J;  2F4O B;  4K2E A;  1X1A A;  1XGN A;  5FGL A;  5KK1 A;  4YIF A;  5FRM A;  3DPT A;  3HSE A;  3F21 A;  1VQN I;  4EM2 A;  1FWZ A;  2GBY A;  3W6V A;  5KHD A;  2V9P A;  3K4C A;  4LJZ F;  3OYH A;  4R8H A;  2RAE A;  5IT3 A;  2Q1Z B;  1SAU A;  4J00 A;  2B9S A;  3DPL C;  3DEU A;  3VDX A;  5ICF A;  2OJE D;  1P9Q C;  2WC2 A;  3HOS A;  1S8N A;  5IYD J;  4M6V A;  2LYC A;  4BE0 A;  3FHN A;  1BC7 C;  4JOM A;  3HB9 A;  4RAZ A;  4CCO A;  5J1Y A;  3HOY J;  3F22 A;  2LLK A;  3OYM A;  3MWM A;  2W00 A;  2ZFU A;  2QOP A;  3WTY C;  2F2E A;  1TW3 A;  2NX4 A;  2VL8 A;  2R4G A;  1SD6 A;  3BLY A;  3EUK L;  3M9A A;  4DNC A;  1D5Y A;  2DA1 A;  1LEB A;  3Q3S A;  1UCR A;  5LRS A;  2RQQ A;  3CUQ C;  4B3X A;  1G3S A;  3S2W A;  1PUF B;  2L7Z A;  1YE9 A;  3NQO A;  1MNE A;  2A5W A;  3FKI J;  1RUN A;  3EET A;  3LSI A;  5DCF A;  3DLL F;  3J81 K;  3S14 J;  2AXL A;  1Z3Y A;  2GOX B;  4OIO F;  2DTR A;  2M7B A;  4J01 A;  4PCQ A;  4QLC U;  4YEL A;  3R61 A;  1V5E A;  1RR7 A;  4EVI A;  1N25 A;  2L7F P;  2GAU A;  2IP2 A;  4HRI A;  3QKX A;  3T8T A;  2JQ7 A;  1DGR M;  3H3Z A;  1I1G A;  3SWH A;  1WVR A;  2GXA A;  1T56 A;  1I5Z A;  1T38 A;  2D5V A;  4O6J A;  4PK4 A;  1SEU A;  3FXQ A;  4X6A J;  1UFM A;  4BDZ A;  5GAG J;  1H8A C;  2I10 A;  2LG4 A;  2YX7 A;  3M8J A;  5CJ9 A;  4EJT A;  5JFR A;  1WRJ A;  1G8X A;  4D9J A;  2R93 J;  4Z6Y A;  4ZYD A;  4H4K C;  4JX4 A;  1MMD A;  4XN0 A;  2XAG A;  3MFK A;  3DCF A;  1KYW A;  5LRR A;  5FLX Z;  4BXF A;  3VYR B;  3S17 J;  2OU2 A;  3E0J B;  3OOP A;  1P7J A;  4DYR A;  3L9F A;  2KMU A;  3MZY A;  2KDO A;  3E5X A;  5FB2 A;  4BXU A;  1S29 A;  1VQM I;  4XKB A;  4Y4R A;  4ZH4 F;  3HJE A;  3CLQ A;  3RKW A;  2LTP A;  1V3F A;  4YFK F;  1QVT A;  5TIS C;  1STZ A;  4I98 B;  3ZN0 A;  2K7L A;  1K4S A;  4ITV A;  2A6E F;  2JSP A;  1OYY A;  3KYC B;  3TP0 A;  3OSF A;  4ETS A;  5AQC A;  2DJI A;  2QKM B;  1ETQ A;  4KIB A;  1BI2 A;  5FLV A;  4FAS D;  3DKY A;  3KX2 A;  1FBU A;  2VQG A;  2FA5 A;  3CCE I;  2QEX I;  4IHW A;  2HYJ A;  3RPU A;  2CO5 A;  1IUY A;  1P92 A;  1POG A;  4KYW A;  5JR3 A;  3JRI A;  5J40 A;  1G3T A;  1FP1 D;  1YFH A;  1QHH D;  1Y0U A;  1T95 A;  2DI3 A;  4NC8 A;  4BAC A;  1XN7 A;  2CQQ A;  4G6Q A;  5BPD A;  3L00 A;  4RS8 A;  2Z99 A;  5EF6 A;  5AON A;  5H20 A;  4CZZ A;  2DW4 A;  3TL4 X;  2XVC A;  4XR6 A;  5CLS A;  5CW8 A;  4GFB A;  3TW7 A;  3K1M A;  4DOZ A;  4B8X A;  2DMT A;  5DCM B;  4BHP A;  2D1H A;  1KU9 A;  4UVB A;  2IA1 A;  3I71 A;  3TED A;  3ZQF A;  3ABT A;  1OCZ H;  5HBU A;  2DLL A;  1ZYR F;  2M45 A;  4A5M A;  3BQY A;  4GO1 A;  2DA7 A;  3FKJ A;  5D6E A;  2XF6 A;  3HM5 A;  2K9L A;  2CWE A;  1HDD C;  3CCR I;  2G7G A;  3J7Y J;  2CSO A;  1EA3 A;  1XMK A;  3TDZ C;  1NK2 P;  2Y75 A;  1RC9 A;  3HTU A;  2JTV A;  4L5I A;  3RZD J;  4OWR B;  4XSX F;  5KAF C;  3WHB A;  2VBX A;  3TOB A;  2IRF G;  4AM3 A;  1ETO A;  1O4X A;  3HHH A;  1E3P A;  1D0Z A;  3AL0 C;  2Y9Y A;  3NEU A;  4XLF A;  3E6D A;  4IRG A;  2V4J C;  1W7P D;  5KCM A;  2RRE A;  2J5P A;  1ZRC A;  1JJ8 C;  2COB A;  3T1B A;  3EDP A;  1YIO A;  3K4B A;  2M30 A;  2O3F A;  4N9I A;  4BS9 A;  2EV6 A;  1LJ9 A;  3FM5 A;  4PFP A;  2FSW A;  4YFX F;  2VBW A;  4CGR A;  5IY5 H;  4CCJ A;  2KHM A;  3HIM A;  1MBF A;  3A0B C;  1LB2 A;  3E5Q A;  1W36 C;  4HNT A;  3FK6 A;  2L54 A;  4EJV A;  2A6H F;  2A07 F;  3CRJ A;  2BVM A;  3IAM 2;  1YG2 A;  1T39 A;  9ANT A;  2BY3 A;  3IRR A;  1IRX A;  1U9N A;  1X1P A;  2ZNZ A;  4KFC A;  3JAM K;  2CJJ A;  2OZ6 A;  2O7T A;  2YVE A;  4U0W A;  2XSD C;  1J09 A;  2GA1 A;  4M3G A;  3LHQ A;  3FF5 A;  4ZZL A;  2D1V A;  3RYP A;  1OJL A;  4I0B A;  1TP4 A;  2L9N A;  2E2H J;  4UVA A;  4M73 A;  1ZR4 A;  2E19 A;  4L9J A;  1Y6I A;  2LBF B;  3E7L A;  3H5R A;  4A3E J;  2H8W A;  2QIB A;  1FYL A;  2FJ1 A;  4IX7 A;  1DPR A;  4DVY P;  2ZCM A;  2DBB A;  3H35 A;  1R00 A;  2V6E A;  2VOD A;  1TQI A;  3G1M A;  2IPQ X;  2W53 A;  4IHY A;  4HNU A;  2VUM J;  4A6E A;  2L0K A;  4U0Y A;  3PQJ A;  1D8J A;  2KRH A;  5E3N A;  4OIQ F;  4RM2 A;  1N77 A;  2PQ8 A;  5JVG F;  3NRV A;  4L5J A;  4ENN A;  1LKX A;  1WJB A;  2QSG X;  1JT6 A;  3N4M A;  2ZXI A;  3WOD F;  1TNS A;  3M07 A;  3QRF F;  2XPU A;  3HHG A;  3WTV C;  3G1O A;  2L4A A;  2ZOY A;  1O57 A;  3HOT A;  1YJN I;  2XV4 S;  1UST A;  2GZW A;  2L7K A;  3RIR A;  1MH3 A;  2QVO A;  1TWA J;  1ETY A;  1SMT A;  3JCU C;  1YIT I;  1K61 A;  2HQ5 A;  3BP8 A;  3PO3 J;  3RKQ A;  1YRN B;  1FTZ A;  2Z1D A;  3OR1 C;  2RVC A;  1XMA A;  5TGT A;  4H0E A;  4BJ5 C;  4ANJ A;  3JRE A;  2DPD A;  1X1D A;  1ZG5 A;  4WCG A;  3EUH A;  3C1D A;  1UAA A;  4C2T A;  1IDY A;  3WGH A;  2Y31 A;  3QPH A;  5LGU A;  1EF4 A;  4XLN F;  4D0P A;  3HTJ A;  3MN2 A;  2VC0 A;  3C3W A;  2V6C A;  2DQR A;  2ID6 A;  4ZDL A;  4F93 B;  3I55 I;  1D1B A;  1ENH A;  4KN7 X;  3BRO A;  2V9V A;  1TTY A;  6PAX A;  1ZLK A;  1I3Q J;  2HKX A;  3S1Q J;  4EEF G;  2M4G A;  4HLY A;  2OPT A;  4EQQ A;  3W3C A;  4PZJ A;  2BV6 A;  1BI0 A;  1BM9 A;  3Q0V A;  2IT0 A;  3WTT C;  3OS0 A;  3IWF A;  4LK1 F;  1Q1V A;  1J7K A;  2VAS A;  3QWL A;  3UNG C;  1GVD A;  1MMS A;  3ZMV A;  1OCP A;  1XCV A;  5TJJ A;  3RH2 A;  1Y8R B;  3PM1 A;  2JA5 J;  4QPO A;  4DQ2 A;  3I4P A;  2FQ3 A;  2X1C A;  4BJ6 C;  3FBN B;  3H3V K;  3PSF A;  1NH3 A;  3CF2 A;  4RMN A;  2E1C A;  2JUG A;  3QYB A;  1XSV A;  4CCM A;  2NS7 A;  1LE8 A;  2VBY A;  3K9T A;  2YU9 J;  3FXM A;  1BIA A;  2NXN B;  3EYY A;  4BEH B;  4P1W A;  2EBI A;  3TW6 A;  5D5V B;  4RGR A;  1WKM A;  2XPW A;  4G7H F;  1XCB A;  3HRM A;  4IXA A;  4ME9 A;  3I64 A;  3E6B A;  1TT5 B;  4JP0 A;  4RB3 C;  2AO9 A;  1PP7 U;  1XDU A;  2L9V A;  1YQA A;  2UXN A;  1WGX A;  2L9R A;  2ZCW A;  4UV9 A;  4CZC A;  2WA0 A;  4M72 A;  3HSR A;  4ZDP A;  3ERE D;  2K85 A;  1V5G A;  2HXI A;  3J80 K;  3FZV A;  5FRN A;  3PL8 A;  1UI6 A;  1Z0X A;  5DUK A;  3M7G A;  4PJL A;  3KZ9 A;  4KWA A;  1K4T A;  2HYT A;  3A01 B;  3DQV C;  3NXC A;  3CCY A;  3CCV I;  3CQZ J;  3PNT A;  1HA8 A;  1WFX A;  3JAM Z;  1S7A A;  4E7Z A;  1D3Y A;  1S5L C;  3BJO A;  3EQL F;  4HLX A;  3JTG A;  4L18 B;  2YR2 A;  4RA2 A;  1IG7 A;  1USS A;  2C6Y A;  2ISY A;  2HGC A;  4B43 A;  1T33 A;  1ZTR A;  1Z77 A;  2R5Y B;  3VVY A;  2F6C A;  2DJN A;  1W5C C;  4HF0 A;  4HDU A;  3GTK J;  3P9T A;  5LHG A;  3VOE A;  2GFN A;  3M4O J;  2JVG A;  5J1U A;  5JHF A;  3HPH A;  1MBK A;  5BNG A;  3WTU C;  2BE5 F;  1E0E A;  3JRA A;  1OKR A;  4U87 A;  3CCJ I;  2ESN A;  2L7M P;  2WAF A;  3KP5 A;  1JUM A;  1ZGA A;  3M3Y J;  1KU3 A;  2R0Q C;  1MDM A;  1YTY A;  1LQ1 A;  3KEQ A;  3EYI A;  2W85 A;  5FLM J;  4MXM A;  1BA5 A;  2ECC A;  3CJQ B;  4M3D A;  1WJE A;  5GAH J;  2D6Y A;  5J8F A;  3HRS A;  5BQT A;  5LHH A;  4PJJ A;  2CQK A;  2H8R A;  2V1D A;  1U9O A;  1IN5 A;  3VW2 A;  5DS9 A;  2W57 A;  1R1U A;  4BQN A;  3ZN1 A;  3CTA A;  2REK A;  3ROU A;  4AIH A;  3DFG A;  3HOV J;  3GYH X;  2DOF A;  4XLE A;  2HOT A;  3LSR A;  1X4O A;  1WJF A;  1VZ0 A;  3CP2 A;  3GFL A;  4IJA A;  1P4A A;  3MD2 A;  2UXU A;  1KQ9 A;  2YSR A;  5LEJ A;  2M4K A;  3JRB A;  1F4K A;  2HU9 A;  4EM0 B;  2H6B A;  5F6F A;  2WWY A;  2A2F X;  3BR0 A;  5FKO A;  1MKM A;  3K2Z A;  4PJM A;  3CCL I;  1SFO J;  1MBG A;  4JYK A;  1G2H A;  1AKH B;  2EIN H;  4JNN A;  3G2B A;  5ILU A;  2Y0M A;  3K7A J;  3KLN A;  1HC8 A;  3V8L A;  3GTG J;  3L2C A;  4A3C J;  4FCY A;  4HX4 A;  5D19 A;  1UG0 A;  4XRS A;  1WJC A;  3HGY A;  2RKH A;  1FLI A;  5K7H A;  3CDL A;  5DM6 F;  1LFP A;  3WTX C;  3K10 A;  1LPQ A;  2VLA A;  2Z3Y A;  4RGS A;  3CC2 I;  2RAS A;  3P9I A;  5DEQ A;  2DA5 A;  2G7U A;  3O60 A;  1IXC A;  2K86 A;  2DK5 A;  2HWV A;  3SDG A;  4C2M J;  3W2A A;  3BR6 A;  3CJD A;  2VJ5 A;  1IV6 A;  2PFV A;  2PZ9 A;  4UXN A;  2B3W A;  1CF7 A;  1E3H A;  2LMD A;  4AC6 A;  3IV5 A;  4RBO A;  4YFN F;  1APL C;  5FGM A;  4MIM A;  1O3Q A;  4MTD A;  2N8G A;  1REP C;  2HKU A;  2QQB A;  1X1C A;  2ZNY A;  5EDN A;  3LA3 A;  4BU2 A;  1UHW A;  4D7N A;  2UXO A;  1S72 I;  1B6A A;  3QBM A;  4L9N A;  1NTC A;  4IO9 F;  4N4N B;  4KN4 X;  3J80 Z;  1GVJ A;  2RNJ A;  5J3L A;  3L2U A;  5KNL A;  1YX5 A;  4BDY A;  3SFZ A;  2K9N A;  4BGD A;  4NQW B;  4FHT A;  2EWN A;  3CC4 I;  1TWG J;  2W48 A;  1W7P B;  4C3I J;  2ZO4 A;  2ICW G;  2JPB A;  4AVZ A;  1K7A A;  3PJR A;  3NRG A;  2XAQ A;  1WI9 A;  3T5X A;  3ERM A;  1CGP A;  2EFW A;  4A5N A;  2NS8 A;  2X6X A;  3A2K A;  2QEN A;  2OER A;  2DMQ A;  2XAJ A;  2RQP A;  3LL7 A;  5EZH A;  3VVZ A;  2KDZ A;  4B09 A;  4ESF A;  2DYR H;  2CUF A;  1K78 A;  1XB4 A;  4LLG F;  2AXT C;  2HQN A;  3DBL B;  2X6W A;  3O6B B;  1IN6 A;  4KIT B;  4KUM A;  1HLV A;  3GTQ J;  5CPR B;  2XAU A;  3W6K B;  4GCT A;  1QO0 D;  3KP2 A;  1MW7 A;  3KNW A;  4RAY A;  1HKS A;  3CLO A;  5ILS A;  2LK2 A;  4NC7 A;  4OMZ A;  3SFI A;  4ASN A;  2BHZ A;  3AFH A;  4M3E A;  2FBQ A;  3WU1 B;  2DQL A;  3G3Z A;  3T8R A;  5LEK A;  1IO2 A;  5M3M J;  1FYM A;  3QP5 A;  3VVX A;  2V9K A;  3OV8 A;  2G7L A;  5DV5 A;  1ON1 A;  3HBL A;  2Q0O A;  5L3C A;  3ZMD A;  3BCG A;  5CKT A;  1OIS A;  2YS9 A;  5GAD J;  2TCT A;  1U8B A;  4AWX B;  2HDD A;  1U5T C;  5EZG A;  3V8K A;  4D5F A;  2A69 F;  5ED4 A;  3QYE A;  5FD5 A;  5E1Z B;  2PBX A;  1BW6 A;  3E3V A;  2LKX A;  1MSF C;  4EJW A;  4G6T B;  1Z6R A;  1RET A;  3S32 A;  3LQQ A;  2QA4 I;  1R7J A;  5C4Y A;  5CYV A;  2DFH A;  2NYX A;  2IS4 A;  3CF5 F;  1IW7 F;  3DLA A;  1R5G A;  4M9Z A;  2RN7 A;  3HUG A;  4PUS A;  4I2O A;  3R60 A;  2E71 A;  2HZD A;  1V55 H;  1JGS A;  1TQP A;  3RJP A;  5EFY A;  2JUC A;  1DDN A;  3GZI A;  4GCK A;  1YO5 C;  2DT7 B;  5D4S A;  2E35 A;  1PP8 F;  2M8E A;  4GCV A;  2NP5 A;  2BBY A;  3O3K A;  1W36 D;  2XRL A;  3CMM A;  3FX3 A;  4EJO A;  4E7J A;  1R22 A;  1AHD P;  1UEL B;  2CG4 A;  1ZAR A;  4CYC A;  4BY1 J;  2VXZ A;  4JX6 A;  5HS9 A;  3K6G A;  3J7Z I;  5H6R A;  3FDY A;  2E36 A;  2K5C A;  5K5O A;  2X4H A;  3RQI A;  5FRO A;  4JL3 A;  4IHT A;  3KKD A;  2VE8 A;  3HPG A;  4E70 A;  2W7N A;  3MVP A;  3QU6 A;  5CVJ A;  2O03 A;  1ETV A;  4GYG A;  2WAE A;  4KT5 C;  1E3O C;  1U0J A;  3CUQ A;  4AIK A;  4UUV A;  3OYN A;  2EIL H;  3ON2 A;  4XMY A;  1MNM C;  2R7T A;  3DP7 A;  4XSZ F;  1ZLJ A;  1DGW Y;  1JUS A;  3K4M A;  1H88 C;  3RYR A;  3C2B A;  1WQ2 A;  4M3F A;  3KZI C;  3GEU A;  3TDU C;  2CUE A;  2CW0 F;  2PN6 A;  3S1N J;  1TWC J;  2FBK A;  2VQL A;  3TQN A;  3BPV A;  2DOA A;  3FMQ A;  1OLT A;  1FOX A;  2PG4 A;  4RDU A;  3BG6 A;  2R7F A;  2L4M A;  4BQA A;  2GUH A;  1WJD A;  1WI3 A;  1TT0 A;  2FU4 A;  5IYB J;  2HR3 A;  2M0C A;  2KIF A;  1BL0 A;  2R7O A;  5F0C A;  4O5V A;  4XM3 A;  2XB0 X;  1FSE A;  1IRZ A;  5BMZ A;  2UZK A;  3O2P E;  4LG0 B;  2JRM A;  2ZJP F;  2ETH A;  5AIP A;  3TOA A;  2HVQ A;  5F1R A;  2CH0 A;  2VJJ A;  2R92 J;  2HDW A;  4EAT A;  2JJ7 A;  2BZT A;  4LFU A;  4NC6 A;  2EFN A;  3VYT B;  1IRF A;  5E79 C;  1H89 C;  4ESJ A;  1WPK A;  5J6X A;  1DP3 A;  3HEF A;  4B1R A;  1RR8 C;  2PJR A;  1JI8 A;  4A93 J;  4KT6 A;  2P5V A;  3AKZ A;  1OPC A;  2NAZ A;  5CVV A;  3DU6 A;  2K4B A;  2DPU A;  3O8H A;  4GFL A;  1T2K A;  1B72 A;  3VOK A;  2DDA A;  3A0H C;  3RDI A;  4E7H A;  2VI6 A;  4II2 A;  3KYD B;  2LRD A;  3DTK A;  1WHU A;  1G3W A;  3M8F A;  4RLQ A;  3GTL J;  1JXS A;  2IS6 A;  1YLF A;  2JA6 J;  3K0L A;  3CCM I;  1FEX A;  2MAB A;  2YU3 A;  5B66 C;  2Z5U A;  1IC8 A;  1FBS A;  3CWR A;  1MMA A;  2DG7 A;  5LLQ A;  3QOP A;  1IV8 A;  5J8C A;  3QPT A;  2DOD A;  1SD7 A;  2BW3 A;  4A3M J;  3BTI A;  2EQR A;  3ZR8 X;  3CC7 I;  4YZE A;  1HQC A;  3WTW C;  1RPW A;  2H09 A;  2V26 A;  3KEO A;  1WCM J;  5L3B A;  2ESH A;  2KZG A;  3BC8 A;  2XUB A;  3P7N A;  3PIP F;  2PEX A;  1UHS A;  4IOA F;  1QRY A;  3FXL A;  3KZY A;  2VKV A;  2XIG A;  3ESW B;  1U3E M;  4E7S A;  4XON A;  3W6J B;  3MZH A;  4JKZ A;  3BJB A;  1S7O A;  3EPZ A;  1B8I B;  1HDP A;  3ZPL A;  3BG3 A;  4LG3 A;  4DIQ A;  2RHA A;  3NNR A;  3RKX A;  3A4C A;  1SVO A;  5HS7 A;  2A05 A;  5E18 F;  2KRF A;  4AD9 A;  2H1K A;  1OR7 A;  3BY6 A;  3CP8 A;  4L5E A;  1YYV A;  3D0S A;  2EZK A;  1FOW A;  3HIF A;  5FFZ A;  2ME0 A;  5B3S H;  4YEJ A;  4PSW A;  3SDB A;  1WWX A;  2EJR A;  4HEA 2;  1FIP A;  1OFC X;  1TC3 C;  2JA7 J;  5K58 A;  4R1H A;  4UUS A;  1O7L A;  4A3F J;  3WU0 A;  3R0J A;  3U2R A;  3NWS A;  2CW8 A;  2M87 A;  3CJR B;  2OUM A;  3W2W A;  2CU7 A;  2X1D A;  5IOY A;  2CQX A;  1MZB A;  2BGC A;  2COM A;  4BH9 A;  3FXU A;  2NS0 A;  4X0G A;  3AAF A;  1ZH5 A;  3FWE A;  5ERI A;  4AIJ A;  2ELK A;  1MJ9 A;  1BR1 A;  1ERD A;  1QA6 A;  3U1D A;  4HSR A;  4A3B J;  2HQA A;  4A3K J;  2E1M B;  4XOP A;  2ISZ A;  2JZY A;  2A61 A;  2CUJ A;  3SHF A;  2B7E A;  3QOD A;  1F9N A;  4YRV A;  1TW2 A;  4FQG A;  2W4S A;  1VQP I;  2OV7 A;  1HBX G;  3V7R A;  2UUZ A;  4BQO A;  1LDJ A;  2E34 A;  2HTJ A;  2E2I J;  5FFX A;  5CQE A;  2CGP A;  3M8E A;  2HOE A;  3K70 C;  4XRF A;  1HW2 A;  3H1C A;  4AUX A;  4OD4 A;  1OR7 C;  3G71 I;  3KE2 A;  4RB0 A;  5EG0 A;  2YPR A;  1U2W A;  1GUU A;  1XX5 A;  2M7A A;  2KFD A;  1GV5 A;  2V57 A;  1KU2 A;  2K9M A;  2X85 A;  3JSJ A;  1UJ8 A;  2O8X A;  1Y0N A;  1KZH A;  3PAS A;  1K83 J;  4DZP A;  3PO2 J;  2WUI A;  3CD6 I;  2KQR A;  2MG4 A;  4IOC F;  2W82 A;  2FF4 A;  2DO7 A;  2K27 A;  4Y3O A;  1UZC A;  2KIM A;  2O5R A;  2KKO A;  1YW8 A;  1VQ8 I;  1Z1D A;  3ISP A;  2CMP A;  4HX8 A;  4FTH A;  5BPI A;  1NG7 A;  3GVA A;  3VFZ A;  3HDD A;  3OYJ A;  1XGO A;  3RPQ A;  3J7A O;  1A6I A;  3RI4 A;  3TO6 A;  1I3A A;  1FT9 A;  1W0T A;  1QPI A;  4OIR F;  3ABU A;  3DF8 A;  1D1C A;  2LVS A;  2WV0 A;  2V7F A;  4MLO A;  2O0Y A;  2BEO A;  2BW3 B;  1OCO H;  3BQZ A;  1AU7 A;  2Q2E A;  2K40 A;  3P9K A;  2OBP A;  2DMP A;  1ZRD A;  2HNH A;  2UXP A;  5TRD A;  3RZO J;  1XS9 A;  3ZGK A;  4QIW N;  2EPF A;  2HKO A;  3PIO F;  2PMZ A;  3PFI A;  1IXR C;  2H6C A;  2YVH A;  2JN6 A;  2ECB A;  4IQJ A;  4HKU A;  2M1B A;  1FOK A;  4Y7N J;  3SEQ A;  4EM1 A;  3FXO A;  1PVE A;  4ABZ A;  1YHQ I;  1VFC A;  2Y69 H;  3BHQ A;  2Q24 A;  2GIV A;  2F5F A;  4G94 A;  4CO8 A;  3BR3 A;  2D45 A;  1IXS B;  4HF2 A;  1HW1 A;  2BY1 A;  1UMQ A;  4RB2 C;  3DKW A;  3BT9 A;  3K4N A;  4HX7 A;  4GXO A;  1QZE A;  4KIG A;  3I59 A;  4W97 A;  2CYY A;  4HDV A;  4BYY A;  4MTE A;  2G7S A;  2QBY A;  3BRU A;  4II3 A;  2PMZ N;  1DU0 A;  2WGB A;  2NVY J;  2XKP A;  4XRS G;  4L0Z B;  1S7E A;  2CQ7 A;  4QSH A;  2ME6 A;  1OYW A;  3AL0 B;  3V7C A;  3KLO A;  3IL2 A;  4M6Y A;  1E17 A;  3SZT A;  2CV2 A;  3GZ5 A;  3ZXS A;  3BTJ A;  2HTS A;  5GAE J;  2QSH X;  2MA3 A;  2VON A;  3F8N A;  1XSD A;  4OOI A;  3HRU A;  4HOB A;  1HCR A;  2NVX J;  2VBZ A;  3S16 J;  5D6F A;  3M1E A;  3IAS 2;  4KMU X;  5BOX A;  1B9N A;  2G9W A;  4CCK A;  1JKP C;  1BC8 C;  3E5U A;  4CSW A;  4U7D A;  5DD4 A;  1TL8 A;  1G3Y A;  4BL0 B;  4NEL A;  3S2D J;  2LP0 A;  5E3L A;  2GQQ A;  2F4I A;  4I01 A;  2R5Z A;  2DYS H;  3CO6 C;  1F36 A;  3IKT A;  2FEZ A;  3GLL A;  2PMU A;  1B4A A;  1D1A A;  1I6X A;  3R0A A;  1JJ6 C;  1OQY A;  4GDF A;  4WIB A;  2CFO A;  2EIM H;  4R79 A;  2VT3 A;  2GIZ A;  5D5U B;  3FMR A;  4PGH A;  4F3Q A;  4IEJ A;  2AQF A;  3KCC A;  4X1E A;  2MC4 A;  4UHT A;  3GFJ A;  3MKZ A;  1ORK A;  3BZK A;  2E5Z A;  1SFX A;  3F9K A;  2XGC A;  4BKX A;  2STW A;  4LB6 B;  2XSJ C;  1PYV A;  4CXF A;  3S15 J;  3RTR A;  3Q0W A;  1FX7 A;  1QNT A;  2RV8 A;  2RDP A;  3GFM A;  2XRO A;  1MBE A;  1RZ4 A;  2ELJ A;  4Y15 A;  3KIO A;  4HZF A;  4LIU A;  4E6K G;  2LH9 A;  4M3B A;  2EZI A;  4ZYA A;  2NP3 A;  5CXG A;  1XTA A;  3COL A;  2DG8 A;  1D0Y A;  4DBQ A;  2LF7 A;  3JRC A;  2E2J J;  1FZP B;  3FK7 A;  4U88 A;  2VKH A;  2GOM A;  2RNG A;  1A35 A;  3CME I;  3GTP J;  2XC7 A;  5HSZ A;  2A6T A;  2FE3 A;  5HDG A;  1JTX A;  3FBI B;  2JWT A;  3LSP A;  4CH7 A;  3V78 A;  4B3A A;  2WV1 A;  3NWT A;  3LJL A;  1ULY A;  5ILV A;  2VPL A;  1XSX A;  2X48 A;  2VIX A;  3QYF A;  3WGI A;  2LR8 A;  3VYU B;  4N0B A;  5E20 A;  1ITY A;  2HVS A;  3QPL A;  1B1B A;  1P2F A;  3ZQL A;  5ICE A;  2YUS A;  4B47 A;  3HKZ A;  4WF2 A;  3V42 A;  1OCR H;  4F55 A;  1ODD A;  3AQS A;  3F8B A;  2XPV A;  5C3E J;  2VJ4 A;  2V1U A;  1SD4 A;  4UNO A;  1MD0 A;  3ZMT A;  4I76 A;  2PJP A;  2OQG A;  4KIF A;  3LA7 A;  3JR9 A;  1EH6 A;  2FJI 1;  4GFK A;  4A3J J;  3IUO A;  2IXS A;  1P7I A;  2HYG D;  5JI6 A;  1YOV B;  3PSI A;  4UY8 I;  4I09 A;  2E7X A;  1CQT A;  4P5O A;  4F7Z A;  1IN7 A;  2CRG A;  3NI7 A;  1X4P A;  3SXY A;  5J47 A;  1F1Z A;  3VOX A;  1DP7 P;  4HST A;  3CES A;  3IH3 A;  3OOU A;  2CW7 A;  1J2X A;  4LK0 F;  5E17 F;  3RSN A;  3BCA A;  3HKZ N;  5FJ8 J;  5H2F C;  1O3T A;  3BG5 A;  1MND A;  3GF2 A;  4HV6 A;  3H5A A;  4A0Z A;  5E3M A;  1MBJ A;  5K5Q A;  2GLO A;  1WJ5 A;  1UI5 A;  3MQ0 A;  1NG6 A;  2KP6 A;  2UXX A;  3V7S A;  4IL6 C;  4ENM A;  2K3P A;  2OC6 A;  4FX0 A;  5B1A H;  2KT0 A;  5C44 J;  1JE8 A;  5EEA A;  1NK3 P;  2WY8 Q;  1A6Q A;  3E1S A;  4KDP A;  1Y1V J;  5FKN A;  4XBF A;  1LNW A;  4JX5 A;  2EB7 A;  3GTJ J;  4RB1 A;  1UG2 A;  4P9U A;  5HOO A;  5A2Q K;  1Z9C A;  1J59 A;  5D18 A;  2LY1 A;  2EV5 A;  5DD8 A;  2EFO A;  4ICH A;  4RAG A;  2IW5 A;  4XKC A;  3L2V A;  3S3N A;  2ZXW H;  5C4J J;  1ETK A;  3A02 A;  2O61 A;  1Z91 A;  2QKO A;  3CMA I;  3D5R C;  4XOR A;  3PNV A;  4OU0 A;  1XGS A;  1WSU A;  3E7Q A;  4XIC A;  1IAW A;  3C2G A;  1W5T A;  4C30 A;  5B1B H;  2JVH A;  5CQG A;  4OIN F;  2O8K A;  4UV8 A;  2GM4 A;  3HTA A;  4CIC A;  5HOD A;  1I27 A;  4DBR A;  4NUB A;  2VPR A;  3GZ6 A;  4IZZ A;  5B5E C;  3D5L A;  1FOY A;  1KGS A;  3F8C A;  4MFD A;  2XAS A;  1JKQ C;  1FTT A;  4CA0 A;  4DZJ A;  4I0A A;  5H6Q A;  3H92 A;  3QAH A;  3S3O A;  4LLN A;  3T6N A;  1R5I D;  2LRE A;  4PDK A;  3MNL A;  3F6O A;  3HGG A;  2D2W A;  1HW5 A;  2DA4 A;  2ZME A;  5LGN A;  4ZYG A;  4U7B A;  2Y48 A;  1LE8 B;  2BHY A;  3D5S C;  1B59 A;  1QPM A;  2XDN A;  5D4R A;  1DUX C;  2EV0 A;  3NPI A;  3S93 A;  4PSX A;  3GME A;  2PMH A;  4EGY A;  1MGT A;  1R9T J;  1DPU A;  3KP3 A;  1ZKG A;  4KMF A;  1YS7 A;  2F5V A;  4IHX A;  4AID A;  4F92 B;  4AVP A;  2LY2 A;  3DXJ F;  4ZDO A;  1EJ9 A;  1YJW I;  2IBD A;  1FC3 A;  2L5Q A;  1EKE A;  1KQ0 A;  3IH2 A;  2FXA A;  4G12 A;  1KU7 A;  4KJZ A;  1IZ1 A;  4S0H B;  1F5T A;  2R7S A;  1HKT A;  3IC7 A;  4GRI A;  1VTN C;  4Y52 J;  3ABK H;  5GPC A;  3CJN A;  4CCN A;  4YIR X;  4IRI A;  5DUI A;  1I1S A;  2KIQ A;  1BJA A;  3IHU A;  3OYA A;  5EGO A;  2M3A A;  2IGN A;  2MGQ A;  4ESB A;  1M1E B;  2Y2Z A;  4E4H A;  3DBH B;  2ZBK A;  2R7R A;  3PQK A;  5EEG A;  4BUP A;  1EH8 A;  1U5T A;  1SC7 A;  3LAP A;  3CJT B;  2P6T A;  3D1N I;  1RES A;  3ULQ B;  5IP7 J;  3K4J A;  4MEY F;  2X1E A;  2TRT A;  3RKY A;  1T8I A;  4HPQ A;  5J4Y A;  1XD7 A;  2FOW A;  2QM3 A;  5AIQ A;  2QKL B;  3VYS B;  5DM7 F;  3F3X A;  3DEE A;  3PNY A;  4ON0 A;  2ZME C;  2DOE A;  4EJU A;  5FKK A;  1XG1 A;  3WE3 A;  5ICG A;  4OAZ A;  2JT1 A;  4S05 A;  3LFK A;  1PDN C;  1WH7 A;  1VF9 A;  2M8G X;  3E6C C;  1V54 H;  1T0F C;  2W84 A;  1SAX A;  1MDM B;  4P96 A;  1RNL A;  2F4M B;  3VW0 A;  3MKL A;  2ZCX A;  3BR5 A;  1N75 A;  1R6R A;  5IP9 J;  4HQE A;  3OYG A;  2GXB A;  1HST A;  2VXD A;  1ZGW A;  4NDL A;  3WTZ A;  3VIB A;  4HYE A;  1L3L A;  4A0Y A;  1RIO H;  1I50 J;  1GXP A;  1R36 A;  3K70 D;  2QGU A;  1IF1 A;  5HNF A;  1P4W A;  2VN2 A;  3PPB A;  3Q9V A;  3SQN A;  2QZ8 A;  3F23 A;  5LBQ A;  2EFQ A;  2OAZ A;  3I4N J;  4D5C A;  3LWJ A;  5A2Q Z;  5E1W A;  2GWR A;  2HFH A;  4CDG A;  2QWW A;  3TO9 A;  3ZMU A;  1G59 A;  1LEA A;  3CDI A;  2VJI A;  2LKP A;  1HOM A;  2OCC H;  3TGN A;  4BAY A;  2MH2 A;  1PUF A;  2KL4 A;  2WY7 Q;  1TWH J;  4B44 A;  2JRT A;  3QPS A;  2P8T A;  3GX4 X;  1KON A;  4CYD A;  1BJZ A;  1VND A;  1XC5 A;  4D1Q A;  2F5E A;  1V4R A;  3ECO A;  2ID3 A;  1O3S A;  1RRJ A;  1LVK A;  3H0G J;  2ZXH A;  3H3U A;  4U0V A;  1LDK B;  2K4J A;  4F52 A;  3G6E I;  3VUQ A;  1MIJ A;  2FX0 A;  2L2O A;  1JKO C;  3ONQ A;  4QTR A;  2HEO A;  2GA2 A;  1YW7 A;  3GXO A;  3OL3 A;  2NVT J;  4IRV A;  4M71 A;  4XNF A;  1WH5 A;  1IUF A;  4KA4 A;  2O6G E;  2NVQ J;  1A04 A;  1AOY A;  2PX9 A;  4Y33 A;  2Z2S B;  3C7J A;  3GWZ A;  3OIO A;  2R7W A;  1U8R A;  4ZTF A;  1VQ6 I;  4P55 A;  5EJC A;  4MQV A;  3R4K A;  1Z67 A;  1JUP A;  1CF7 B;  1P6R A;  4BNC A;  1Y39 A;  1HKQ A;  2FBI A;  3DPU A;  4I6Z A;  3ZQH A;  2LF8 A;  5J4V A;  2P7V B;  4NN1 A;  3NAU A;  3BJ6 A;  1Z7L A;  4EV0 A;  3KET A;  3KPH A;  5K1Y A;  1IRG A;  1Q1H A;  2VKE A;  2MFZ A;  3WE2 A;  3AG2 H;  3DBR B;  2R7U A;  4O3M A;  3OY9 A;  2QLZ A;  4BHB A;  1U5T B;  1V5F A;  2DA6 A;  3DPJ A;  1VI0 A;  3N05 A;  3DV8 A;  2XGD A;  3ZMS A;  2ZCN A;  5GPA A;  4YG2 F;  2DXI A;  4C3J J;  2HOS A;  3PUB A;  1QVU A;  4HNV A;  1K79 A;  1ZEL A;  3UKG A;  2NRA C;  4PGG A;  3K69 A;  1GDT A;  5CVR A;  1C0W A;  3FRQ A;  1S6L A;  1K78 B;  2MD0 A;  2RC4 A;  5JHU A;  2W25 A;  4RLF A;  3K4L A;  3IRQ A;  4CUG A;  2EA2 A;  1AWC A;  2JSC A;  1ETX A;  3GCM A;  3IKV A;  4EMS A;  4FIS A;  1TZL A;  1H9G A;  4ZJZ A;  3BJA A;  2EIJ H;  1E2X A;  2M5W A;  3RCO A;  1R49 A;  1P4X A;  1SFK A;  4AF5 A;  4ZYE A;  5M5Y J;  4HAM A;  3B81 A;  3O8G A;  2EK5 A;  4MFE A;  3LSK A;  2IEK A;  2MD5 A;  5FD6 A;  4TV7 A;  3HE0 A;  1R4N B;  2MYS A;  3WU2 C;  3S3M A;  5DCM A;  2IS2 A;  3ZQQ A;  3ML6 A;  2EH3 A;  5HLT A;  3TKY A;  2EA4 A;  5E1X A;  2M9H A;  1ETW A;  1J0R A;  4CCL A;  3PFY A;  4RGU A;  3DTE A;  2HI3 A;  3GLX A;  1QGP A;  2I5U A;  2BXZ A;  3CZ6 A;  4Z2Y A;  3OSG A;  4JBA A;  2VE9 A;  1W0U A;  1J75 A;  4M6X A;  3VTI A;  3F72 A;  1WZ2 A;  1K6Y A;  4DGW B;  5M5W J;  2P4W A;  5E8G A;  2JPC A;  4MGR A;  2ZSI B;  4A6D A;  2V1X A;  4F91 B;  3HUG B;  3FIW A;  1A5J A;  1Z05 A;  1UHM A;  1ZHF A;  5F64 A;  2H1L A;  2QCO A;  5L3G A;  5ICC A;  3LNQ A;  2MSY A;  2LSO A;  4Q47 A;  3LWF A;  2R7V A;  5HAW A;  3HZJ A;  3MKW B;  4BQQ A;  5FO5 A;  2XB5 A;  3JRH A;  3BTL A;  1YI2 I;  1U6G A;  2E5N A;  4CYC B;  4IPA A;  4PXI A;  4M74 A;  4ENJ A;  2FMY A;  2ZJQ F;  3GO5 A;  1FIA A;  3ELK A;  3BNI A;  4V2G A;  3S5R A;  1OCT C;  1LFU P;  1FMV A;  1HF0 A;  2B63 J;  2P5L C;  2UWM A;  5K5R A;  3NAR A;  1EH7 A;  1T08 B;  1DU6 A;  3BG7 A;  2E1M C;  3CCU I;  3SJM A;  3CDH A;  2QTQ A;  3R6S A;  4BE2 A;  3DU5 A;  4U9L A;  3CUQ B;  1ZQ3 P;  3C2H A;  1FBQ A;  5LGT A;  5LD2 C;  3VPR A;  5HLG A;  2HYF A;  2KLO A;  3IH4 A;  4C2M A;  5FKL A;  4G6D A;  3A1Y A;  4V2F A;  2CV0 A;  1YS6 A;  5HVQ C;  5HS8 A;  2DDB A;  3VB2 A;  2X9D A;  1YW9 A;  3M1C A;  2DFE A;  2NNN A;  2X6Y A;  1JKR C;  5DAJ A;  2AHQ A;  2LBF A;  4C3H J;  2FML A;  1VQ4 I;  5IT9 Z;  1SFU A;  2XAF A;  3BPX A;  3GW2 A;  2ZSH B;  3L2W A;  3I56 I;  3K1P A;  2OTL I;  2H94 A;  4UVC A;  3F8F A;  5LHI A;  1ZN2 A;  1X3W B;  3K1N A;  1TWF J;  2MC3 A;  4L62 A;  2STT A;  4V19 K;  2NOG A;  3MKY B;  5F27 A;  1Z7U A;  4XOT A;  2V79 A;  4XQF A;  5BS6 A;  4EGZ A;  3VWB A;  2R7X A;  3I54 A;  1IJW C;  2MH9 A;  2LDU A;  2DMU A;  2Y0S A;  2G0E A;  3Q0U A;  2WTE A;  3TO7 A;  4BXX J;  3MEX A;  4BY7 J;  3GTM J;  4PJN A;  1UB9 A;  2KJB A;  2MW8 A;  1LFB A;  2K02 A;  5M3F J;  3F0C A;  3WG9 A;  2XGX A;  2E1O A;  3SZP A;  2PJR B;  3LMM A;  5DDG A;  2ZY9 A;  2E60 A;  3J7A Y;  3ABM H;  1YRN A; 
#chains in the Genus database with same CATH homology
 3SDG A;  4C2M J;  3COL A;  3BR6 A;  3CJD A;  1IV6 A;  2DG8 A;  2PZ9 A;  4DW6 A;  1X2N A;  2E2J J;  3JRC A;  2GBY A;  3JRD A;  3W6V A;  3FK7 A;  5GP9 A;  4AC6 A;  3B6A A;  3IV5 A;  4RBO A;  2RAE A;  3DEW A;  1B72 B;  3EUP A;  1APL C;  3GTP J;  5HSZ A;  4MIM A;  2N8G A;  3HOU J;  5F08 A;  2HKU A;  1JTX A;  5EDN A;  2JWT A;  3LSP A;  3V78 A;  4D7N A;  2UXO A;  4B3A A;  2WV1 A;  3QBM A;  3LJL A;  1NTC A;  2Y0S N;  5IYD J;  4M6V A;  2X48 A;  4ACI A;  2LR8 A;  5J3L A;  3HB9 A;  5J1Y A;  3HOY J;  1ITY A;  2K9N A;  2LLK A;  3QPL A;  2GEN A;  4FE4 A;  3ZQL A;  2YUS A;  2QOP A;  1TWG J;  2P81 A;  2W48 A;  4C3I J;  2NX4 A;  3AQS A;  3NRG A;  2XPV A;  5C3E J;  4I76 A;  1D5Y A;  2NS8 A;  2OER A;  2DA1 A;  2DMQ A;  5EZH A;  3JR9 A;  4GFK A;  3VVZ A;  3Q3S A;  2KDZ A;  4A3J J;  2CUF A;  1P7I A;  1PUF B;  1CQT A;  2L7Z A;  2CRG A;  3NI7 A;  3FKI J;  1HLV A;  5D1R A;  3HOW J;  3VOX A;  5H9T A;  3GTQ J;  3TP3 A;  3S14 J;  4GCT A;  3IH3 A;  3OOU A;  2IU5 A;  3KNW A;  2HOA A;  2LK2 A;  3SFI A;  3HKZ N;  5FJ8 J;  4AYB N;  2DMN A;  4M3E A;  3F1B A;  1RR7 A;  2FBQ A;  4LOC A;  5IPA A;  2L7F P;  3BG5 A;  2DA3 A;  2GLO A;  5E3M A;  3QKX A;  1MBJ A;  5M3M J;  3S2H J;  3BG9 A;  3BTC A;  1UI5 A;  3VVX A;  1U78 A;  2G7L A;  3HBL A;  1T56 A;  3BCG A;  2KT0 A;  5C44 J;  2D5V A;  2YS9 A;  5EEA A;  1NK3 P;  4X6A J;  2TCT A;  1U8B A;  2HDD A;  3A01 A;  5C4X J;  5EZG A;  4D5F A;  1Y1V J;  5FKN A;  1H8A C;  4A3G J;  2I10 A;  4FE7 A;  2PBX A;  4JX5 A;  1BW6 A;  3GTJ J;  2LKX A;  1MSF C;  2F07 A;  1UG2 A;  5FMP A;  4UUS B;  3V6G A;  5D18 A;  2R93 J;  1RET A;  4JX4 A;  4ICH A;  5EYR A;  5FHP A;  5C4Y A;  3DCF A;  3ANG A;  2R5Y A;  5F1J A;  5C4J J;  3S17 J;  1ETK A;  3A02 A;  2QKO A;  4DYR A;  1P7J A;  5EFY A;  4GCK A;  3LSJ A;  3GZI A;  3E7Q A;  4XIC A;  2LTP A;  2NP5 A;  2ZB9 A;  1QVT A;  2XRL A;  1AHD P;  3CMY A;  2O8K A;  4CYC A;  4BY1 J;  2GM4 A;  4JX6 A;  3TP0 A;  3HTA A;  3OSF A;  5HOD A;  5AQC A;  1ETQ A;  2VPR A;  5FLV A;  3ANP A;  3VW1 A;  4MFD A;  3RQI A;  2Y9Z A;  3A03 A;  1JKQ C;  1FJL A;  4JL3 A;  5M5X J;  3KKD A;  4IHW A;  1FTT A;  2HYJ A;  3MVP A;  4DZJ A;  5JLW A;  5EG0 B;  3T6N A;  3ON4 A;  1POG A;  1ETV A;  3HTI A;  3MNL A;  3JRI A;  2Y30 A;  3HGG A;  5FGL A;  2DA4 A;  2O7O A;  2OF7 A;  4MK6 A;  1LE8 B;  1E3O C;  3B6C A;  2XDN A;  3ON2 A;  2CQQ A;  1MNM C;  3NPI A;  1IGN A;  5EF6 A;  1R9T J;  1JUS A;  1ZKG A;  1H88 C;  4IHX A;  3C2B A;  3ZQI A;  5CW8 A;  3GTO J;  4M3F A;  4GFB A;  1BW5 A;  3GEU A;  2IBD A;  4XK4 A;  3TW7 A;  2CUE A;  3S1N J;  1TWC J;  2DMT A;  3IH2 A;  4G12 A;  2M34 A;  2HXO A;  4S0H B;  3TED A;  3ZQF A;  1JGG A;  4Y52 J;  5GPC A;  4RDU A;  5HBU A;  5FKM A;  3BQY A;  2GUH A;  1WI3 A;  2DA7 A;  3JRG A;  5IYB J;  2M0C A;  3HM5 A;  5EGO A;  1AKH A;  1BL0 A;  2MGQ A;  5F0C A;  1HDD C;  2Y2Z A;  2XB0 X;  2G7G A;  2DTZ A;  4UDS A;  1NK2 P;  1IRZ A;  3D1N I;  1RES A;  3RZD J;  5IP7 J;  3VP5 A;  5DTD A;  5IOZ A;  2TRT A;  3WHB A;  2R92 J;  1ETO A;  1F43 A;  2JJ7 A;  1O4X A;  2JA8 J;  3C07 A;  2Y9Y A;  4D7M A;  1H89 C;  1WPK A;  3HEF A;  4B1R A;  5FKK A;  4A93 J;  2QF7 A;  1XG1 A;  2ZOZ A;  1JJ8 C;  2COB A;  2LD5 A;  1MH4 A;  3G1L A;  1WH7 A;  4CGR A;  3O8H A;  1VF9 A;  3HIM A;  4GFL A;  1MBF A;  2M8G X;  1B72 A;  3VOK A;  3FK6 A;  2XGE A;  2VI6 A;  3VW0 A;  3MKL A;  1RKT A;  3BR5 A;  2ZCX A;  3CRJ A;  5IP9 J;  5E3O A;  1ZGW A;  2IAI A;  3AQT A;  4NDL A;  1U9N A;  3GTL J;  5IYC J;  3VIB A;  5K7Z A;  2JA6 J;  1FEX A;  1I50 J;  1IC8 A;  2CJJ A;  3CWR A;  2O7T A;  2DG7 A;  2YVE A;  2XSD C;  2LFB A;  4M3G A;  3LHQ A;  5F0F A;  4A3M J;  3PPB A;  3BTI A;  1OJL A;  3I4N J;  2EQR A;  4D5C A;  3EGQ A;  3LWJ A;  2E2H J;  4YZE A;  1RPW A;  1WCM J;  4A69 C;  1ZR4 A;  2E19 A;  2R5Z B;  1HOM A;  3E7L A;  1UHS A;  3FIS A;  3HOX J;  4A3E J;  1QRY A;  1PUF A;  2VKV A;  4B4C A;  1TWH J;  2QIB A;  2FJ1 A;  3QPS A;  2ZCM A;  4JKZ A;  3BJB A;  1B8I B;  4AC0 A;  1BJZ A;  1HDP A;  3G1M A;  3BG3 A;  1VND A;  2K9S A;  2W53 A;  1XC5 A;  4IHY A;  2VUM J;  2RHA A;  3NNR A;  2L0K A;  2ID3 A;  5E3N A;  3H0G J;  3S1M J;  3VUQ A;  1JT6 A;  2FX0 A;  2H1K A;  1JKO C;  4QTR A;  1I6H J;  2NVT J;  2XPU A;  4L5E A;  5J1R A;  3G1O A;  3IUV A;  1WH5 A;  3ZOB A;  2ZOY A;  2EZK A;  1IUF A;  2NVQ J;  4XID A;  4UUT A;  2ME0 A;  2FQ4 A;  3GBG A;  1MH3 A;  9ANT A;  1TWA J;  1ETY A;  3OIO A;  1K61 A;  3PO3 J;  1FTZ A;  2HQ5 A;  3ZQG A;  3RKQ A;  1YRN B;  5F04 A;  3K2A A;  3JRE A;  1FIP A;  1OFC X;  1TC3 C;  2JA7 J;  1JUP A;  5K58 A;  4UUS A;  4A3F J;  1IDY A;  4I6Z A;  3ZQH A;  2Y31 A;  4NN1 A;  3NAU A;  1EF4 A;  2CU7 A;  5IOY A;  2CQX A;  3HTJ A;  3MN2 A;  2VKE A;  2ID6 A;  2ELK A;  1ENH A;  1MBH A;  1Y1W J;  3QQA A;  1I3Q J;  2DA6 A;  4A3B J;  1VI0 A;  3DPJ A;  4A3K J;  3S1Q J;  4EEF G;  3ZQC A;  2XGD A;  2JK3 A;  2ZCN A;  5CXI A;  2OPT A;  5GPA A;  2X6O A;  4C3J J;  2HOS A;  4DYC A;  1QVU A;  3Q0V A;  4HNV A;  1Q1V A;  3UKG A;  2E2I J;  2G3B A;  2UXI A;  1GDT A;  1GVD A;  1SGM A;  1OCP A;  3FRQ A;  4AUX A;  3RH2 A;  3PM1 A;  2JA5 J;  5EG0 A;  3H3V K;  1GUU A;  1GV5 A;  2K9Q A;  2V57 A;  1X2M A;  1ETX A;  2NS7 A;  1LE8 A;  3JSJ A;  2YU9 J;  4FIS A;  3PAS A;  1K83 J;  4DZP A;  3PO2 J;  2WUI A;  2MG4 A;  3BR1 A;  4AF5 A;  2EBI A;  3TW6 A;  2XPW A;  2WB1 N;  5M5Y J;  3B81 A;  3O8G A;  4MFE A;  2M2E A;  2R7Z J;  2IEK A;  4ME9 A;  4JP0 A;  2AO9 A;  4FTH A;  3HE0 A;  3S1R J;  3HDD A;  1WGX A;  1RKW A;  2L9R A;  4MO7 A;  1A6I A;  1GV2 A;  2EH3 A;  2HXI A;  1W0T A;  2LY9 A;  2M9H A;  1QPI A;  3HOZ J;  1ETW A;  3L1P A;  4IHV A;  1X58 A;  1Z0X A;  1UI6 A;  2HI3 A;  2LVS A;  4MLO A;  4J19 A;  1W0U A;  3OSG A;  3KZ9 A;  4KWA A;  3BQZ A;  1AU7 A;  4A3D J;  2HYT A;  3A01 B;  3NXC A;  2K40 A;  3CCY A;  3CQZ J;  2DMP A;  2UXP A;  5IP6 A;  3RZO J;  1XS9 A;  4QIW N;  4BBS J;  3RD3 A;  5M5W J;  1IG7 A;  2YVH A;  2JN6 A;  2ECB A;  1T33 A;  1ZTR A;  1Z77 A;  2R5Y B;  4HKU A;  3VVY A;  2DJN A;  4Y7N J;  1A5J A;  2WAQ N;  3FIW A;  5JLX A;  3GTK J;  3P9T A;  4ABZ A;  2GFN A;  1VFC A;  3KKC A;  3M4O J;  2QCO A;  2Q24 A;  3BHQ A;  5J1U A;  3LNQ A;  2MSY A;  3G7R A;  1MBK A;  5BNG A;  1JT0 A;  3BR3 A;  5HAW A;  3JRA A;  1JTY A;  1UMQ A;  2EZH A;  2XB5 A;  4DYQ A;  2EZL A;  3JRH A;  3BTL A;  3BT9 A;  4CYC B;  2L7M P;  3LSG A;  4W97 A;  4PXI A;  2QWT A;  2G7S A;  1JUM A;  2JMW A;  3BRU A;  3M3Y J;  1FIA A;  3BNI A;  2PMZ N;  4V2G A;  3S5R A;  1OCT C;  1DU0 A;  1LFU P;  2R0Q C;  1HF0 A;  2B63 J;  2WGB A;  2NVY J;  4XRS G;  3NAR A;  1S7E A;  2ME6 A;  4QSH A;  1DU6 A;  5FLM J;  4MXM A;  3LOC A;  2FD5 A;  2ECC A;  4M3D A;  1BA5 A;  3SJM A;  2QTQ A;  4A3L J;  2D6Y A;  3BTJ A;  1ZQ3 P;  4BBR J;  1HCR A;  2NVX J;  2OI8 A;  1ZK8 A;  3S16 J;  2H8R A;  1MSE C;  3VPR A;  1U9O A;  3IH4 A;  3JRF A;  3G56 A;  5FKL A;  3VW2 A;  4V2F A;  5DS9 A;  1JKP C;  2REK A;  2DN0 A;  4NEL A;  3HOV J;  3S2D J;  2HOT A;  1ZR2 A;  2LP0 A;  2X9D A;  5E3L A;  3LSR A;  2DA2 A;  1JKR C;  5DAJ A;  2AHQ A;  2R5Z A;  5F0H A;  4C3H J;  2UXU A;  1F36 A;  3JRB A;  3BR0 A;  5FKO A;  4A3I J;  1SFO J;  1B8I A;  1MBG A;  1SAN A;  4JYK A;  4W1U A;  1G2H A;  5EGO B;  1TWF J;  1JJ6 C;  1AKH B;  4L62 A;  2NOG A;  4XRM A;  1GT0 C;  3HTH A;  4JNN A;  5F27 A;  3K7A J;  4IEJ A;  4X1E A;  1ORK A;  3GTG J;  4A3C J;  1IDZ A;  4FCY A;  1IJW C;  5CXG A;  5D19 A;  4XRS A;  5K7F A;  4GCL A;  2DMU A;  2XGC A;  2G0E A;  3HGY A;  3Q0U A;  4BKX A;  3WHC A;  4BY7 J;  3GTM J;  4BXX J;  3S15 J;  2MW8 A;  5K7H A;  2UXH A;  3Q0W A;  1LFB A;  3CDL A;  5M3F J;  3BR2 A;  3F0C A;  1MBE A;  2O9L A;  2E1O A;  2RAS A;  2DA5 A;  3I4M J;  3O60 A;  4M3B A;  2EZI A;  1YRN A;  2NP3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...