3F0CA

Crystal structure of transcriptional regulator from cytophaga hutchinsonii atcc 33406
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
196
structure length
193
Chain Sequence
b'DGKLELIINAAQKRFAHYGLCKTTMNEIASDVGMGKASLYYYFPDKETLFEAVIKKEQNVFFDEMDKILNSGIDATALLKKYVKLRSLHFRHLLNLSKLRSDFTKPVFAKAFESFKQKEVEIVAGIIQYGITTKEFKRGNKHENAEFLVHLLLGVRMVKLKYKEINDFDESDYEDLDKNMCKVAGMFLKEIQT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator
publication title Crystal structure of transcriptional regulator from Cytophaga hutchinsonii ATCC 33406
rcsb
source organism Cytophaga hutchinsonii
molecule tags Transcription regulator
total genus 72
structure length 193
sequence length 196
ec nomenclature
pdb deposition date 2008-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3f0cA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3f0cA02
3ZQHA 3ON4A 4LOCA 2JA8J 5D19A 3JRDA 4X6AJ 4B1RA 5D1RA 3CRJA 5C3EJ 9ANTA 3DEWA 2DA5A 2EQRA 1ETWA 1OJLA 3S1NJ 1UG2A 3HOYJ 4C3JJ 3S14J 1BL0A 1TWFJ 3S17J 4CYCB 5HSZA 4DZPA 2LP0A 1BW5A 1MBEA 4DYCA 1JKRC 2XGCA 1ETVA 2XPVA 4PXIA 5EFYA 2L7MP 3GTLJ 3Q3SA 3JSJA 2XRLA 1VI0A 2R5ZA 1GVDA 3RKQA 5E3NA 4J19A 1U78A 2LK2A 3CCYA 1A6IA 3LNQA 2R0QC 3B6AA 2G7LA 1HLVA 2M8GX 4Y52J 3BQYA 2HOSA 5GP9A 2VKVA 1XS9A 1SFOJ 1I6HJ 3BR5A 2LD5A 3LWJA 3DCFA 1IDYA 2NVQJ 4C2MJ 3G1MA 1FIAA 1G2HA 5FMPA 1ZQ3P 1UI6A 1IUFA 5FKKA 3HTJA 3C07A 3ZQLA 1AKHB 2HQ5A 5IYDJ 3BG5A 2LR8A 5BNGA 3BR3A 4XRSG 3JRCA 3G56A 4IHYA 1QRYA 4A3LJ 4A3BJ 3C2BA 3W6VA 5K7FA 3FISA 3GTMJ 1JT6A 3L1PA 2LFBA 4MFEA 4NELA 1W0UA 3HE0A 2HKUA 3HEFA 3HB9A 3OSGA 2XDNA 3LJLA 1VF9A 1U8BA 2G3BA 3Q0WA 4QSHA 3PO2J 2R5YA 4IHXA 2EZLA 2DN0A 1S7EA 2X9DA 4JNNA 5M5YJ 3T6NA 3BTIA 2L9RA 2LVSA 3GTGJ 2WV1A 1T33A 4XIDA 3O8GA 2XPWA 5C4YA 2NVXJ 2GBYA 3ANGA 2HOAA 2GM4A 1WI3A 1WH5A 2GUHA 5F08A 4BY1J 3VW1A 1Y1VJ 4D5FA 2ECCA 2JN6A 3A02A 3QPSA 2CUFA 3ZQFA 3E7LA 1ZR2A 3EUPA 3A01A 3HOWJ 5FGLA 1IJWC 3BTCA 2KT0A 2RASA 2WB1N 3RZOJ 2DA2A 2O7OA 3K2AA 2XGEA 3PPBA 1WH7A 2R5ZB 2Y0SN 5DS9A 3AQSA 1DU6A 1GUUA 1QVTA 2COBA 2IU5A 4UUSA 2QTQA 4GFKA 3HOVJ 5HODA 2L7ZA 5K7ZA 2JWTA 1FEXA 5C4XJ 4MLOA 3JREA 5M3MJ 2FBQA 1RR7A 2E2IJ 2HXIA 1JGGA 2H8RA 1TWAJ 4AF5A 2DA1A 3WHBA 3ON2A 5HAWA 2R7ZJ 4D5CA 4M3GA 3HOUJ 1AHDP 4XK4A 2H1KA 1Z0XA 3JRBA 3ZQCA 2O8KA 3HTHA 1ZR4A 4HKUA 2JK3A 2DA4A 1NTCA 2I10A 2R92J 3GTOJ 3I4MJ 3VOKA 5M5XJ 3HDDA 2K9SA 5C44J 2LKXA 2DG7A 3EGQA 3JR9A 2DMPA 1JJ6C 5J1YA 1D5YA 3VOXA 4BXXJ 2XPUA 1GT0C 4A3CJ 2LTPA 1ORKA 5EYRA 1BA5A 3CMYA 2EZHA 4MO7A 4MXMA 2R5YB 4Y7NJ 3HKZN 2PMZN 4A3KJ 4JX5A 1MNMC 4QIWN 3IH4A 1EF4A 2QOPA 5FHPA 3VW2A 3V78A 2ME6A 2FD5A 3BCGA 3KKDA 2ZOYA 1ETKA 2DG8A 3FRQA 1POGA 1WCMJ 2D6YA 2ID3A 1F43A 4BBRJ 1RPWA 2CJJA 1LE8A 1IDZA 4AC6A 2K9QA 3ZOBA 4AYBN 1P7JA 3A01B 3KKCA 1JTXA 1BJZA 1GV5A 3D1NI 2YVHA 3MNLA 5EGOA 4I6ZA 2Y9YA 2WAQN 3PM1A 1HDPA 4FISA 2GLOA 2W53A 2P81A 1TWGJ 3QQAA 3HBLA 1VFCA 3I4NJ 2OPTA 2HYTA 5E3LA 4UUSB 2RHAA 4GCTA 1ZK8A 3GTJJ 2JMWA 1X2MA 1ZTRA 2L7FP 1E3OC 1JJ8C 1FTZA 5JLXA 4GCLA 1JKPC 3SJMA 4IHWA 3K7AJ 2G7SA 4M6VA 3JRFA 1HCRA 2UXOA 3VVYA 4A3JJ 1JKOC 5FLVA 2ZCMA 3BR1A 5IP9J 1MBKA 1MH3A 2O9LA 3CDLA 2L0KA 5DAJA 1AU7A 4A3DJ 3BR2A 3LSGA 1ZGWA 5F0FA 2MSYA 2REKA 3VW0A 1BW6A 3BJBA 2DMTA 1MSFC 2NVTJ 1K61A 1QVUA 2ELKA 3E7QA 3NPIA 1K83J 5IP7J 1HOMA 4DYRA 1CQTA 2E19A 5E3OA 2NS8A 5FKNA 1H8AC 3A03A 3UKGA 1SGMA 3QBMA 3TP0A 1B8IA 4MK6A 4L62A 3HOZJ 4JX4A 3M4OJ 4IHVA 1UI5A 3GZIA 3S15J 3KNWA 3G1LA 3TW7A 4M3EA 1FTTA 4L5EA 4M3DA 5IPAA 5F27A 5J1RA 4A3IJ 2DTZA 3BQZA 2KDZA 4BKXA 3H3VK 5DTDA 4MIMA 3SDGA 2ZB9A 3BNIA 1LE8B 3FIWA 1IV6A 4FE4A 2MW8A 2W48A 3HM5A 1ZKGA 2JA7J 1ITYA 2X6OA 5JLWA 2AHQA 2K9NA 3FKIJ 5EGOB 3BR6A 1P7IA 2IEKA 1R9TJ 1WPKA 3O60A 1MBFA 4W97A 5AQCA 2HXOA 1LFUP 3QPLA 2QKOA 1UMQA 2M9HA 3S1QJ 5FJ8J 5J1UA 2JJ7A 5CW8A 3NAUA 5CXIA 2IAIA 3NARA 4G12A 2XB0X 3M3YJ 2OERA 2UXPA 4A69C 1X2NA 1HDDC 3RD3A 3GEUA 3JRIA 2DMQA 3FK6A 4MFDA 3Q0UA 3VUQA 5FKOA 1XC5A 3JRAA 4IEJA 2CUEA 4ACIA 3BR0A 1U9NA 2DJNA 5IP6A 2VUMJ 1U9OA 2UXUA 1IC8A 4ME9A 3HIMA 3IV5A 4DW6A 2XSDC 3GTPJ 2Y9ZA 3S2DJ 2QCOA 3S1MJ 1ETYA 2NVYJ 1VNDA 1RKTA 2OF7A 1OCPA 3VP5A 4GCKA 4GFBA 1HF0A 5F04A 4D7MA 2UXIA 2LLKA 5HBUA 4KWAA 2K40A 3IUVA 5GPAA 1B8IB 4I76A 3QKXA 4NN1A 1NK3P 4YZEA 2QIBA 1ETOA 3PASA 2GENA 2EZKA 4C3HJ 2YS9A 1TC3C 4W1UA 3RQIA 1TWCJ 4RDUA 1FIPA 3OIOA 1A5JA 4X1EA 2VPRA 1B72A 4FCYA 2E2HJ 3B81A 5EDNA 2NP5A 2N8GA 1YRNA 2CU7A 3IH3A 2YU9J 3VVZA 2FX0A 2NOGA 3JRGA 5FKMA 1PUFA 1APLC 5F0CA 5IOZA 2ME0A 5FLMJ 4ABZA 3LSPA 4M3FA 2Y31A 3SFIA 3NRGA 2NX4A 4AC0A 3NNRA 1X58A 1RKWA 3F0CA 2DA7A 2HYJA 2WUIA 5E3MA 3LOCA 4JX6A 3O8HA 3BRUA 4DZJA 3RH2A 3P9TA 3BG9A 5IYCJ 5M3FJ 4JL3A 1T56A 1JT0A 2Y30A 2AO9A 2NP3A 5GPCA 4B4CA 5EG0A 2M34A 1IGNA 3G7RA 2R93J 4EEFG 1FJLA 2G7GA 3VVXA 1RETA 3LHQA 2CRGA 2DA6A 2VI6A 3GTKJ 3RZDJ 1ETQA 2XB5A 1QPIA 1Y1WJ 2UXHA 4A3EJ 2VKEA 3HOXJ 4HNVA 1GDTA 3AQTA 4FE7A 1NK2P 3TP3A 4XICA 2E2JJ 4D7NA 4V2FA 2WGBA 2EZIA 4M3BA 1I50J 3GBGA 3VPRA 3LSJA 5M5WJ 3BTLA 2NS7A 2TCTA 3TW6A 3HTAA 4RBOA 2Y2ZA 2MGQA 1JTYA 4DYQA 4A93J 4UDSA 1B72B 2V57A 1I3QJ 3Q0VA 3IH2A 1UHSA 4AUXA 2DMUA 3VIBA 4QTRA 1YRNB 4FTHA 1MBJA 3NXCA 5J3LA 5IYBJ 2IBDA 4V2GA 1PUFB 1O4XA 2PZ9A 5EZHA 1MH4A 4ICHA 2ZCNA 5D18A 2CQXA 3MKLA 1XG1A 3PO3J 3TEDA 1H89C 3S5RA 2MG4A 3BG3A 3G1OA 3BT9A 2GFNA 1IRZA 4CGRA 3S16J 2YVEA 2YUSA 5K7HA 2HDDA 3ZQGA 3B6CA 5EF6A 5H9TA 1ETXA 1F36A 1LFBA 1MBHA 2PBXA 1W0TA 3FK7A 5FKLA 3OSFA 2OI8A 3COLA 2B63J 2ZOZA 4A3FJ 3H0GJ 2E1OA 1GV2A 2HI3A 2XGDA 3HGYA 3MN2A 4JYKA 5EG0B 4CYCA 1Q1VA 4S0HB 2ZCXA 2JA5J 2Q24A 3F1BA 3OOUA 2M0CA 4B3AA 5F1JA 3MVPA 4XRMA 5F0HA 5C4JJ 4BBSJ 3ANPA 2ECBA 1ENHA 1Z77A 3LSRA 4A3MJ 2DA3A 3V6GA 3HTIA 1MBGA 2QF7A 1H88C 2JA6J 3KZ9A 3S2HJ 1TWHJ 2TRTA 3CQZJ 5EEAA 3JRHA 2O7TA 1JKQC 1DU0A 2QWTA 2RAEA 3WHCA 1RESA 2DMNA 2F07A 4A3GJ 2FJ1A 5IOYA 2D5VA 2EBIA 3S1RJ 3BHQA 2M2EA 3CJDA 4JKZA 2EH3A 4XRSA 1AKHA 4GFLA 1IG7A 5CXGA 3CWRA 3GTQJ 4NDLA 1SANA 3NI7A 1MSEC 2FQ4A 3ZQIA 2G0EA 5EZGA 3DPJA 2LY9A 1OFCX 2ID6A 1JUPA 4UUTA 4BY7J 1JUMA 4C3IJ 1OCTC 3HGGA 3BTJA 1JUSA 2CQQA 2HOTA 4JP0A 5K58A 1WGXA 2X48A
chains in the Genus database with same CATH superfamily
2NOJB 3ZQHA 3KEYA 2DQLA 1F5TA 5IT3A 4YIFA 3D0SA 4X6AJ 1R58A 4UB6C 5C3EJ 9ANTA 2M1BA 2VBYA 1U5TC 2GXAA 1ETWA 1FY7A 1LKXA 3BJAA 4G7OF 3U9GA 2E1MC 2OCEA 3OR2C 2IS6A 1BL0A 1IZ1A 4CCKA 5HS7A 4XBFA 2VJIA 2WV0A 1OCZH 2LP0A 3KEQA 1A35A 1PJRA 1MBEA 3DPLC 4N9IA 2R7VA 3KX2A 2L7MP 1T2KA 2A07F 2MH2A 3QOEA 3CUQC 3DBRB 2VIXA 2MLKA 3GTLJ 5CQGA 3FBNB 1HKTA 3Q3SA 3RPUD 5E79C 1VI0A 4L18B 1GVDA 4RMNA 4UVAA 3HOTA 1U78A 2RNGA 2FOWA 3BZKA 1MKMA 3T1BA 5HDKA 4NQWB 4CICA 4ZC3A 1EH6A 2VKHA 1BOBA 4KIFA 5BMZA 4U9LA 5GP9A 2LMDA 3CCVI 2PI0A 2Y48A 3BR5A 2LD5A 2R7UA 2WAEA 2E71A 3G1MA 2QSFX 1G2HA 5FMPA 1BIBA 5E8IA 3HTJA 4QWQA 1FMWA 2M0MA 3ASOH 2WA0A 2LR8A 4ZZDA 5H6QA 4XRSG 4A6DA 3JRCA 2X4HA 3W6VA 3IHUA 5BS6A 1UCRA 2Y69H 2Y0SA 2LFBA 3HE0A 3VODA 2GOMA 1BBYA 3HB9A 3OYNA 1LJ9A 4D1QA 5ILVA 3LJLA 1U8BA 3TGNA 1F4KA 3BY6A 2G3BA 4QSHA 5DM7F 3PO2J 2R5YA 2IT0A 4C30A 5LRSA 1S7EA 5D5VB 1RIOH 1MZBA 2DJIA 4P55A 3T6NA 3TO6A 3I4PA 2ACJA 1MMGA 1X1DA 5C4YA 1XGMA 3FXMA 3SYTA 1SMTA 2BEOA 3G71I 1WH5A 4BY1J 1X1CA 2ECCA 4XSXF 3WGIA 3CF5F 3IL2A 3DTEA 1ZR2A 2EIKH 2H6CA 2MBFA 3MCZA 2R7WA 2KT0A 2K4BA 2HPIA 3K2AA 3KEOA 2W7NA 1WH7A 2R5ZB 2RKHA 4FASD 3V7SA 1YIOA 3KYDB 2FQ3A 1GUUA 2K3PA 2MABA 4AVPA 3MZ8A 5L3FA 5HODA 2L7ZA 2JWTA 5DYMA 4MLOA 2DFEA 2X6WA 2HXIA 1JGGA 1TWAJ 2JZYA 4E7SA 4EV0A 2M87A 1G4DA 1TT0A 2F48A 4PJMA 3ZCOA 3IRRA 5LGNA 2VOOA 2PEXA 1BIAA 4M3GA 1OISA 3HOUJ 3L2CA 1HC8A 2H1KA 3GXOA 4WIBA 3OY9A 2CYYA 2GZWA 1RC9A 1C0WA 4HKUA 1D0XA 1FPQA 1TQPA 1NTCA 4CA0A 2W85A 2ZMEA 2EV6A 5L3GA 5C44J 2LKXA 4OIPF 3EGQA 1SFKA 2VASA 3DBHB 1QO0D 4L9VA 4M9SA 4RAYA 1D5YA 3F9KA 4E70A 4DBRA 4BHPA 2MFZA 3EDPA 3CMYA 2EZHA 4MO7A 3H9GA 2PMZN 4J01A 2BXYA 3TOAA 2MD0A 4QIWN 3PL8A 4U88A 1W4MA 1S9HA 2V4JC 3GF2A 4P9UA 3CCJI 4BE2A 4DBQA 1XX5A 1HW2A 2ME6A 4FX0A 2H27A 4BUPA 2HKXA 3F8BA 3WU0A 2ZOYA 2D6YA 3DV8A 4HAMA 4AC6A 3ZP5A 4AYBN 5J4VA 1P7JA 2P5KA 3RTRA 3MD2A 2CV2A 4CCOA 1BJZA 1GV5A 4XONA 1X19A 3RYRA 3OYDA 3D1NI 1VQOI 4MEXF 1VQ7I 4I99C 4GDFA 1USSA 2MA3A 2EFWA 4GYIA 2WAQN 2A69F 2W53A 1R1TA 1VFCA 2BHZA 1UZCA 3HIFA 3BPVA 4XM3A 1FT9A 5FRNA 1ZTRA 1IRFA 2CMPA 2M30A 1UHMA 2HZDA 5JLXA 5B66C 4NBQA 2LBFA 1JXSA 4IHWA 5JI6A 1K4TA 4L5JA 2H8WA 3CCLI 2KPMA 1B6AA 4L9TA 2UXOA 2BV6A 3LL7A 3K69A 4A3JJ 5FLVA 4M9XA 2OTJI 2ZCMA 2DK8A 1O3TA 5IP9J 1MBKA 1MH3A 2UXXA 3SZGA 3CDLA 1Y39A 3ABTA 1KQ0A 2NS0A 3PSIA 5L3EA 5D5XB 3E5QA 4ENJA 2WTEA 1MSFC 1QA6A 1D1BA 3WU1B 2O6GE 3E7QA 1MIJA 5IP7J 3OMYA 4NHJA 1HOMA 2G7HA 1RUOA 2E19A 3TDZC 1MJ9A 2KLOA 1D8KA 2NS8A 4IRIA 3IKVA 4Y33A 5HLHA 1H8AC 1OCCH 3NWTA 3QBMA 2DPDA 4L62A 1D1CA 2DFHA 1YLFA 3E5XA 2KJBA 4CUGA 1YJ9I 4WCGA 1FTTA 5HLGA 4A3IJ 2DTZA 3WTXC 4MIMA 2JPBA 1SD4A 3KP6A 3SDGA 4LG3A 1B9NA 2ZB9A 2VT3A 1XCVA 3FIWA 2HTSA 3HM5A 4RB2C 2A2FX 1T39A 5K1YA 2K9NA 1FSHA 3BR6A 2DQRA 5AIPA 4EQQA 5DCMA 6PAXA 4YELA 4DGWB 4X0GA 2L2OA 3QPLA 5ERIA 2M9HA 4MTEA 2XV4S 3IWZA 1ZN2A 2JJ7A 4NB5A 1KONA 2OQRA 2OERA 2W57A 1ULYA 1X2NA 4XN0A 3S93A 1K4SA 4XNFA 1KQ9A 4WF2A 3CESA 3DPTA 3Q0UA 4YIRX 1J59A 3E6CC 1ONVA 2ETHA 3R60A 4OMZA 1G3TA 2DJNA 3BROA 2VUMJ 3KP4A 3S32A 4UY8I 2E35A 2GIVA 1IC8A 3FXLA 3IV5A 2CFXA 4HPQA 4DW6A 2Y9ZA 1PP8F 1ETYA 1SVMA 2VONA 2IGOA 4O6JA 4HNTA 5ICGA 3OYGA 2R7OA 1JE8A 1VNDA 1OCPA 5LHHA 1HF0A 3I58A 4ETSA 2LRDA 1YO5C 1U5TB 2K40A 5EJCA 4P1WA 1DPRA 4GCVA 4OWRB 5GPAA 3MQ0A 2VT2A 4I76A 3QKXA 4CZCA 2DBBA 1NK3P 4FETA 1ETOA 3TKYA 1Y0NA 3CCSI 1MMSA 2CV1A 3HPGA 4PGHA 5CVUA 3V8LA 2PFBA 2B7EA 2X85A 5A2QZ 2VLAA 3RQIA 1Z7LA 2EFNA 3HYIA 2P4WA 2XF7A 5CJ9A 3ZMSA 2A6HF 3CUQB 2GOXB 4XR6A 3OYAA 3OIOA 4HV5A 3VSLA 1YJWI 2FEZA 3CJNA 2E2HJ 3B81A 5ILUA 4ITVA 2NP5A 4LIVA 3VVZA 1J09A 2FX0A 3O6BB 4RB1A 1PUFA 3K2ZA 2XROA 2NNYA 1S3JA 4PGGA 4MGRA 2Y31A 3SFIA 3W2WA 3N4MA 4XKVA 2QSHX 2OJED 1X58A 2DA7A 2Q8KA 2AXLA 3EYYA 2P5VA 3PUFA 4JX6A 3CLQA 4XKCA 1KQ8A 1FLIA 4O3MA 4WXCA 4ANJA 4DZJA 1GHCA 4XKWA 3P9TA 4NC6A 3RH2A 4RGSA 1JT0A 3U2RA 3L2VA 2FBHA 3A1YA 1EA3A 2OQGA 4HF0A 3JSOA 4LD5A 1TTYA 3GUDA 2LKSA 4HRIA 2G7GA 2W82A 4F93B 3BPXA 2ZBKA 3HRUA 2QYOA 2NVUB 5H6RA 4BEHA 1O57A 4WXHA 5E20A 5KK1A 3PFYA 3VFZA 3GTKJ 3RZDJ 2XB5A 1QPIA 1FOXA 4KISA 2F5FA 5CYVA 4FE7A 1DUXC 4ENNA 4D7NA 4V2FA 3CC4I 1FYLA 2EZIA 4M3BA 2PJRB 1AOYA 3WTZA 3LSJA 2IJLA 4WXDA 4G6TB 3KLOA 1LFPA 3A4CA 1ZHFA 2K27A 5DUIA 1RZ4A 4IO9F 5JVTA 3G73A 1R71A 2CSOA 1JTYA 5FO5A 4B48A 1B59A 1IAWA 3CZ6A 1YYVA 1I3QJ 1UHSA 3PUBA 2DMUA 1QZEA 1VQKI 3CUOA 2H09A 3F8FA 3NXCA 5FD5A 3NQOA 2IBDA 2PZ9A 2M7BA 1X4OA 4XL9A 4ICHA 5D18A 3ZMUA 5IY5H 1Z3YA 2XAJA 3PO3J 4RS8A 3BT9A 1FMVA 1F9NA 3I56I 1B4AA 1ETXA 4G8XA 1LFBA 5D6EA 4G6DA 3GLLA 3HXLA 1WI9A 5EEHA 4LJZF 1W0TA 1SC7A 3OSFA 2PBXA 1LNWA 1V4RA 4JBAA 5CVIA 1JHHA 3L2UA 1GV2A 3GZNB 3HPHA 4UV9A 2XGDA 1LQ1A 3EPZA 4DVYP 2HDCA 3GX4X 2DYRH 2KISA 4S0HB 2ZCXA 3ZGKA 2Q24A 3CMMA 3PNYA 2LC2A 4XRMA 1H9GA 3LFUA 3ANPA 3D5SC 4G9YA 3NS4A 3R4KA 3ML6A 2B1EA 1IN4A 2I5UA 4A3MJ 3S3OA 2FXAA 1D0ZA 2M4KA 3CCUI 1MBGA 2OD5A 2QF7A 5E8GA 1MNDA 4FX4A 3KZ9A 2BZTA 2QVOA 4FT8A 1T6SA 3T0YA 3JSPA 4OD5A 1TWHJ 2TRTA 4NQWA 3FM5A 3CO6C 1Y6IA 4CHUA 3OYLA 4L0YB 4ESJA 2DMNA 2RNJA 2F2EA 3HJEA 3KYLA 2K3FA 2L3DA 2K9LA 3H1CA 2FSWA 2JUGA 3NRVA 3BHQA 3HSEA 1ZRFA 4JKZA 2EH3A 2LY1A 1I1GA 1UELB 1IG7A 3K4KA 3H0DA 2L9VA 5HLIA 3NI7A 3ZMVA 3ZQIA 1KZHA 4EJVA 2IS1A 3DF8A 2ID6A 2E1CA 1JUPA 2DAOA 1R49A 2VE9A 2XSJC 4BQAA 3BTJA 1DQUA 1JUSA 2CQQA 2EA2A 3P7NA 5DCMB 3CC7I 1WGXA 3GCMA 5K58A 2X48A 1LEAA 3EUHC 2DFIA 2R7DA 3UR3C 3ON4A 3ZMDA 4UHTA 3SDBA 2XAGA 2MD5A 3O3KA 4XLEA 3ELKA 1M1EB 2E7WA 3CRJA 3WTVC 2DA5A 1R5ID 2JRTA 4KICA 5LFAA 2LDUA 3HOYJ 4C3JJ 3S14J 4BXFA 1N77A 4CYCB 3OR1C 5F64A 3ZXSA 4IRHA 4DYCA 1SAUA 1JKRC 4PXIA 1ETVA 2H1LA 4N9HA 5HDGA 4I0AA 4PJNA 5EFYA 3H3UA 2QKLB 3KCCA 2TDXA 1YHQI 2IW5A 2R5ZA 1RRJA 2X1DA 2LK2A 1GXPA 3LNQA 3B6AA 1HLVA 1D8JA 2M8GX 4PK4A 2E5ZA 5GAGJ 2KZGA 4MNUA 3H5NA 3FMSA 3BG7A 2V1DA 1SFOJ 1BC8C 1PUEE 4M72A 1IDYA 3QU3A 2NVQJ 3DQVC 1FNNA 1ZQ3P 2K85A 1IUFA 4I0BA 5FKKA 1AKHB 2WC2A 2XF5A 2X1CA 5FLXK 5J6XA 4AIHA 1YW8A 4IHYA 1QRYA 3EQLF 2LREA 3FXRA 4IJAA 3MAJA 2V1XA 3FISA 1EKEA 1JT6A 4U0VA 4MFEA 3GWZA 3HEFA 2PBIA 3HRMA 5DD8A 1MNEA 4F92B 4BNCA 2QBYB 4R8HA 4E7LA 3R0JA 3ECOA 3FF5A 4IHXA 5FD6A 3AL0C 1OR7C 2DODA 1P4WA 2DN0A 2X9DA 4JNNA 4PZJA 3I64A 4EVIA 4IQJA 3J7AY 4XIDA 3O8GA 4ZTFA 2B0LA 3P9IA 5FGMA 4BDZA 1S5LC 3SHFA 3AFHA 4LFUA 1Q1HA 2ZSHB 4PFOA 4BHBA 3EUAA 1HA8A 2JN6A 2ZFUA 1CGPA 1J75A 3EUKL 3E7LA 4CXFA 4ZDOA 3EUPA 2DPUA 3HOWJ 1IJWC 3BTCA 2RASA 3RZOJ 1MJBA 1YW7A 2VJJA 4HYEA 5DS9A 4BH9A 1DU6A 1BI0A 1QVTA 4F91B 2PMZA 5K7ZA 5DV5A 3HOVJ 3J81Z 2K7LA 3ULQB 5M3MJ 1RR7A 2H8RA 4AF5A 3BJ6A 5FFXA 3WTTC 4RLFA 1BC7C 3S3MA 3MKZA 3WHBA 3BJOA 2KIQA 1Z91A 4D5CA 2DT5A 2L54A 1P9QC 2DDBA 1WJBA 4XK4A 2LY2A 1Z0XA 3QAHA 4E7KA 1R7JA 4UXNA 2O8KA 5EEGA 2ESHA 4AYBA 1ZR4A 2JK3A 3ERMA 2DA4A 2FU4A 3VOKA 1S72I 3D5LA 2QSGX 2K9SA 2UWMA 2WAQA 3G3ZA 1OR7A 4B47A 1T08B 3JR9A 2A6TA 1OQYA 4S04A 4Y17A 5D5UB 4BXXJ 1D1AA 1IN7A 4I98B 2JQ7A 1WJEA 5D4SA 5CQEA 3RI4A 4ESBA 3HKZN 3BG6A 1MD0A 3QYBA 4A3KJ 4OMYA 2VC1A 1EF4A 1SFXA 2OAZA 2F4OB 4K2EA 3IRQA 3GFLA 1D0YA 4BQQA 4Y4RA 3V7RA 4LG0B 3BCBA 4GGGA 2OCCH 2O0YA 4HBLA 1WJAA 3GFMA 2GXGA 4I09A 1XD7A 4BBRJ 2CJJA 2WY8Q 1T95A 2W4SA 5LLQA 3A01B 3KKCA 4H4KC 1BI3A 1KU3A 1SD7A 2YVHA 4I6ZA 3B73A 4RAGA 3E0JB 1TQIA 2IA0A 3O2PE 3J81K 2JT1A 1HDPA 2GLOA 3L09A 3QQAA 1TWGJ 3W3CA 4JQFA 2VBZA 2PQ8A 5E3LA 4UUSB 4GCTA 1ZK8A 3CP2A 2L7FP 4IKFA 1E0EA 2QGUA 1R00A 2JPCA 1JKPC 5LHIA 3DEUA 1WKMA 1N78A 2G7SA 2DU9A 3E97A 2WADA 3JRFA 1HCRA 3OYCA 2BW3B 2HZTA 5DCFA 4RGXA 3BR1A 2L0KA 4LIUA 1AU7A 4N4NB 1FYMA 4IRVA 2AS5F 4A3DJ 3BR2A 5F0FA 2K02A 2REKA 3DXJF 2FNAA 2OZUA 2DMTA 2ELHA 2HR3A 2NVTJ 3WTSC 3TL4X 1K61A 5HVQC 1I27A 4E7JA 2ELKA 2VB6A 4EM0B 2V1UA 5E3OA 3K4MA 2OU2A 1ZLKA 5FFZA 1U5TA 4B09A 1SGMA 1SMYF 2F5VA 5LGTA 3MEXA 2PN6A 1IXRC 4IHVA 3GZIA 2QEXI 3S15J 2BXZA 1BJAA 3HHHA 3OS1A 2FJI1 3L2RA 4P96A 3QPTA 4OIOF 1SFUA 3KYCB 4DNCA 3CUQA 3GW2A 1LE8B 4G94A 1IV6A 2HQRA 2MW8A 4BE0A 1ZKGA 2NNNA 1ITYA 1H9TA 2AHQA 2ZFWA 1QZYA 2MC4A 2XVCA 2L5QA 4KIGA 4HF1A 3O60A 1E3PA 4W97A 5HNFA 2XAQA 4HX7A 2KL4A 5BPDA 3ZQQA 3S1QJ 4IRGA 2DOEA 3T8RA 4YFKF 5FJ8J 3LAJA 2EFOA 2RV8A 2UXPA 3RD3A 3FBIB 4OAZA 4A69C 4F3QA 1HDDC 2DT6A 4U87A 4FQGA 5H2FC 3SEQA 3FM3A 1WVRA 2CW7A 3VUQA 2YPRA 2BY3A 3M7GA 1IO2A 5F1RA 2HQNA 2A05A 3SEZA 3SFZA 2UXUA 1U9OA 2YU3A 4AIJA 5HDNA 4ME9A 3HIMA 2XDVA 3GTPJ 5DDGA 1EH8A 2MH9A 2QCOA 3RKXA 5LRRA 3VSKA 4A0XA 2LYCA 1R5HA 2WAFA 4KITB 1Z3XA 5IT9Z 4LGWA 1RKTA 4GFBA 2KHMA 1U6GA 5D4RA 2E34A 4PSWA 2LLKA 1VQ8I 5HBUA 5GTIC 1B8IB 3ZR8X 2BYVE 2PJRA 3EETA 3TO9A 4P9FA 3PASA 2RVCA 3H3ZA 4F55A 1CF7B 1TBXA 3HRTA 4A0ZA 1ON2A 1TZLA 2W84A 4X1EA 5KAFC 2CFOA 4FCYA 2IPQX 2OBPA 1IN8A 1MJAA 1FOWA 4U0YA 3IH3A 3AG2H 3CCMI 2O5RA 2ZJPF 4EGYA 4HX8A 3MWMA 2COMA 3IAM2 5FLMJ 3LSPA 1O3QA 2X1EA 4XLHA 3NRGA 1WHUA 3K6GA 1G3SA 1MMDA 3LQRA 4HW0A 2WUIA 1Z6TA 5CVRA 4G6QA 1XMXA 1IF1A 5JVGF 5L3BA 3BG9A 5IYCJ 3KETA 3R61A 2IGKA 1Z21A 2Y30A 2K86A 2K4JA 4BJTA 4I02A 2NP3A 3WU2C 2DDAA 5GPCA 4AWXB 4RGUA 2XF6A 1IGNA 3H5AA 2HTJA 2R93J 4XSZF 2ZY9A 1OMIA 4PJ0C 1YIJI 1W1WE 3AL0B 2ZXHA 2DA6A 2VI6A 2ZXJA 1A04A 1FP2A 4HF2A 2Z1DA 2ZJRF 2UXHA 4MTDA 2IA1A 1V54H 1NK2P 3TP3A 5JHFA 1ACIA 4U7DA 1S7OA 4M9ZA 2CGPA 1I50J 5M5WJ 4CCLA 2TCTA 3TW6A 2DTRA 2KIUA 4JOMA 4WWCA 2Y2ZA 2H6BA 3ZPLA 2ZJ2A 5TISC 1BR1A 1B72B 2BY1A 2L01A 1OCRH 3Q0VA 2VC0A 2VOPA 3A0BC 2CUJA 3OIQA 4CZZA 4V2GA 2ZCNA 1R23A 2CQXA 3ISPA 1XG1A 1H89C 2MG4A 3G1OA 3S16J 4AM3A 2RREA 5J4YA 4M6XA 4ZJZA 3DU6A 5EF6A 5H9TA 1F36A 1TW3A 3NWSA 4PSXA 1MBHA 3VWBA 3ROUA 4I01A 2CWEA 2LKPA 3RDIA 3MKYB 5FKLA 2B63J 4A3FJ 4G7HF 1YS6A 2P7CB 2Q0OA 1YG2A 4KN7X 2XAFA 4ZYHA 4JYKA 1FWZA 2V6CA 4NNJA 2R7FA 4ZZLA 4CYCA 2JA5J 2M0CA 2EFPA 5F1JA 3FXKA 5F0HA 5C4JJ 4BBSJ 5LGUA 2ECBA 2FRHA 4UB8C 2KFDA 3Q9SA 1YX3A 1WJCA 1PVEA 3MFKA 3I55I 1XSDA 3HTIA 2FA5A 3AG4H 4UNOA 4AIDA 3JRHA 1P4XA 2JTVA 5DUKA 2V7FA 3WHCA 3KP7A 4A3GJ 3CDIA 4KYWA 5LD2C 2FBKA 1DGWY 3C2HA 3CJDA 2M2EA 2XKPA 1AKHA 1WQ2A 5CXGA 3GTQJ 1W5SA 4NDLA 3LSTA 3TQNA 2OZ6A 3OYHA 3WTYC 4ZYAA 3GZ5A 3LSMA 2DCEA 1ERDA 5D6FA 4UUTA 1XGNA 1A36A 4HA8A 3OS2A 2OUMA 1ZELA 2QBYA 1X3UA 3JRDA 3OYBA 2A5YB 3OIPA 3DP7A 4B44A 3DEWA 5TRDA 2FUG2 2EQRA 3CDHA 3PNVA 1VQ6I 1TWFJ 3H5RA 2CQ7A 5HSZA 4DZPA 4HOBA 1K6OA 4DOZA 3KPHA 5D8KB 5JR3A 5D5WB 2XPVA 1NG7A 4ZYGA 3MMYB 3F8MA 3DLAA 3OYJA 4NUBA 4MQVA 4B43A 1PYVA 1ZGAA 3JSJA 1WJDA 3FMRA 4EATA 5E3NA 5F6FA 4J19A 1J0RA 1A6IA 4P5OA 4A0YA 3S2WA 2R0QC 3UNGC 5ED4A 1P4AA 3H9JA 4Y52J 1LEBA 2HYFA 4RM3A 4H0EA 5A2QK 1XS9A 1I6HJ 3LWJA 2ZXWH 4BHCA 3DCFA 2X6YA 4C2MJ 3K1NA 1FIAA 5GTHC 3BCAA 2D1VA 3H36A 1YI2I 3HRSA 2HKOA 3QOPA 3E6MA 1V3FA 1O7LA 1YW9A 4A2UA 5IYDJ 1XN7A 1B9MA 2MC3A 1ZRDA 4A3BJ 1HW5A 3C2BA 5K7FA 3GTMJ 3FXJA 4NELA 1W0UA 2IA2A 3M1CA 3P9CA 3MZHA 4C2TA 1R22A 3OSGA 2BOLA 2XDNA 4L0ZB 1WWXA 2KKOA 3TDUC 1T8IA 2EZLA 1W7PB 2XRNA 2JVHA 1U8RA 3BTIA 5KHDA 2WV1A 4C2UA 3LSHA 3E3VA 3AG1H 1ON1A 4LG0A 3OS0A 3BLYA 2NVXJ 3LA3A 2GM4A 2LG4A 1MDMB 4ESFA 2DYSH 1Y1VJ 1IUYA 3A02A 3CF2A 2CUFA 3ZQFA 4IHTA 4UV8A 4OIRF 3A01A 5H20A 2J5OA 5BOXA 1X3ZB 5FGLA 3WODF 1REPC 2WB1N 2DA2A 1R1VA 4A5NA 4J00A 3PPBA 1VQ9I 4N0BA 4OINF 3K4BA 2HVQA 3J80Z 3VEPA 1Z67A 2HFHA 4UUSA 3HKZA 1IN6A 1YS7A 3SZTA 2D45A 3VTIA 2FBQA 3BZ6A 3HUGB 4XLAA 2R7ZJ 1E3HA 3H92A 3U1DA 1AHDP 5JFRA 3F8CA 2M7AA 2BW3A 4MQ9F 3HC7A 4XN3A 3VYTB 4LB6B 5JHUA 3ZQCA 3J7AO 3HTHA 2M45A 1HKSA 3QU6A 2I10A 3CC2I 2A61A 5B1AH 3HDDA 3A2KA 2V9VA 4ZDLA 5K5RA 2R3SA 2G9WA 1ZLJA 2DMPA 1JJ6C 3WG9A 4I7HA 2DW4A 2ISZA 1GT0C 4A3CJ 2LTPA 1ORKA 2M8EA 2L4MA 5EYRA 1BA5A 2VKDA 1WJ5A 4DQ2A 1FZPB 4MXMA 3GO5A 4Y7NJ 2R7RA 3OYIA 4JX5A 4KMFA 4XOTA 3IH4A 5FHPA 2QOPA 3Q9VA 3F8NA 3I54A 4HZFA 3WTWC 2B3WA 2GAUA 2V1NA 2O3FA 1MGTA 3E6DA 3I59B 3KKDA 1VQLI 1ETKA 3CJQB 2DG8A 3K8PC 1POGA 1WCMJ 2ID3A 4HG2A 1F43A 1RPWA 3REOA 2P6SA 1LDDA 2V9PA 1LE8A 2ESNA 2K9QA 3BDDA 3RJPA 3ZN0A 3DU5A 2VPLA 2Z99A 5DEQA 1KYZA 3MNLA 2FMYA 1YJNI 3TMOA 2X0LA 4FISA 2HYTA 3HBLA 3JTHA 3HTUA 3U21A 2QENA 3ERED 4ZYDA 2JMWA 1U3EM 1E3OC 4RAZA 1DPUA 3LA2A 1JJ8C 2NRAC 4HLXA 3LQQA 1WRJA 4IVNA 4M73A 4M6VA 5GADJ 4HDUA 1BI2A 1JKOC 1SD6A 2NYXA 4Q4ZF 3KP3A 5DAJA 1UJ8A 5TGTA 4E4HA 1ZGWA 2MSYA 2ZNZA 1BW6A 2HNHA 4KT5C 3VW0A 3EUHA 4IOAF 2P5LC 4ENKA 3NPIA 5CKTA 3WTUC 4LITA 1IXCA 1VQMI 1MW7A 3TOBA 2UV1A 3ONQA 2EINH 5FKNA 4XMYA 2UXNA 2L4AA 3TP0A 1B8IA 2PFVA 3HOZJ 1UI5A 5AIQA 3SWHA 2Z33A 3G1LA 3OL4A 4M3EA 1L0OC 4FHTA 4L5EA 5IPAA 5E1WA 3K4CA 5F27A 5J1RA 3BQZA 1CF7A 4BKXA 5TJJA 3VDXA 5DTDA 5LEJA 3C7JA 3H3VK 3LFKA 3FDYA 3RKYA 3HOSA 1JHFA 1OLTA 4MHGA 5CLSA 4KDPA 2JA7J 2W48A 2X6OA 5JLWA 3RIRA 3ABMH 3B02A 5EGOB 1P7IA 4U0WA 1XMKA 1R9TJ 2HVSA 5AQCA 2HXOA 2IXSA 1X1BA 3KFWX 4L9JA 2HEOA 3NARA 1STZA 2XB0X 1WZ2A 1V5FA 4RA2A 1KA8A 5CPRB 2LF7A 1VQNI 5FKOA 1XC5A 2KMUA 5J40A 2CUEA 2HYGD 4RB0A 1IN5A 1TQMA 5IP6A 1I39A 3FX3A 3DWLE 2QKMB 4HSTA 4HLYA 4EJUA 3S2DJ 2KJCA 1KGSA 3G6EI 3NEUA 2QUFA 2NVYJ 4HQMA 1U0JA 2QQAA 3WE2A 2FNPA 3K9TA 4CDGA 3VP5A 4II2A 4M6YA 4WX9A 1QBJA 2UXIA 5F04A 3I9V2 1ZG3A 2DK5A 4A12A 1ZH5A 1NG6A 1VZ0A 2X51A 3VOEA 4YRVA 2PX9A 3CMEI 4XORA 2QIBA 3I53A 2DT7B 4IXAA 1X4PA 2EZKA 2O8XA 1TC3C 1ZG5A 4W1UA 4BQOA 1X1AA 1B1BA 1FBSA 3RQ4A 4GRIA 1TWCJ 1NHAA 3FHNA 4C9YA 4RDUA 5AONA 4KFCA 3M8JA 3JCUC 3PQKA 4TV7A 2VPRA 1B72A 4RM2A 2EWNA 5EDNA 4BS9A 2Y0MA 3C1DA 3VYUB 5ICFA 4BQNA 3FZVA 3A0HC 1WSUA 2CU7A 2YU9J 2VXZA 2NOGA 3JRGA 5FKMA 4AVZA 2HQAA 1APLC 5F0CA 5IOZA 4ABZA 4KIBA 4AC0A 2PMHA 1V5EA 2HYJA 1HW1A 1P92A 1TLHB 4O5VA 1DGRM 3J7YJ 3DKWA 3ZN1A 3BWGA 4A5MA 2MYSA 3D5RC 4B4CA 3IAS2 5D8LB 1ZREA 1OYIA 3G7RA 4EEFG 1FJLA 3KLNA 3VVXA 1RETA 5K5OA 3V7CA 1R4NB 4BAYA 3LHQA 1D3YA 2CRGA 1VQPI 4B8XA 3MKWB 3K0LA 4KJZA 3C2GA 4BACA 1XMAA 1LPQA 1ETQA 2ISYA 5HLTA 3CD6I 1LDKB 2VKEA 3HOXJ 2GA2A 4KUMA 5LBQA 4HNVA 1GDTA 3AQTA 4C2MA 1Y8RB 1UFMA 4XICA 2PMUA 2E2JJ 1VTNC 5ILSA 2I8DA 2A6EF 1TNTA 2MLGA 2NS7A 3BZCA 1N75A 2YX4A 2HS5A 5B1BH 4DIQA 3QWLA 3Q5FA 2BBYA 4II3A 2WY7Q 1Z6RA 2MGQA 1UB9A 4DYQA 1G6NA 3RCOA 4A93J 4BXUA 4U9NA 3M9AA 4JK1X 2V57A 2F4MB 2IGMA 2ZNYA 3C18A 4LLGF 1S6LA 3ZRGA 4QTRA 2Z5UA 4FTHA 1YRNB 1A31A 3AAFA 5HS8A 2LH9A 4Q47A 1O4XA 2V6EA 5EZHA 1MH4A 1GVJA 1LB2A 2HGCA 3MKLA 4LLLA 2XC7A 2ZMEC 2R4GA 2EV5A 1QHGA 1IXSB 1IRZA 4CGRA 2YVEA 2YUSA 1ZAOA 3AG3H 3QRFF 1BR4A 3ZQGA 2P0WA 1I3AA 1K6YA 2L9SA 4WK8F 3M8FA 1TW2A 4G7ZF 3CO7C 1WJFA 3FK7A 1FBQA 3DLLF 3COLA 1Y0UA 1XSVA 4D0PA 5BQTA 2ZOZA 2IP2A 2E1NA 4BJ6C 4CYDA 2WWYA 3HGYA 2QLZA 1DDNA 4F7ZA 5EG0B 1OCOH 1Q1VA 2QWWA 1T38A 3OOUA 3F22A 3C3WA 2DOAA 3MVPA 2QQ8A 1PP7U 1I5ZA 1FSEA 5DM6F 2Z16A 3LSRA 2YSRA 2V79A 1BN5A 1V55H 2P6TA 4OD4A 3I5UA 2KIFA 3ABUA 3ABKH 4M71A 4YIIA 1H88C 5KNLA 2JA6J 3S2HJ 3P9KA 2BE5F 3F3XA 2EIMH 4E6KG 2RGVA 5EEAA 3M07A 1E2XA 3FWEA 3PSFA 2RN7A 1LVKA 2BVLA 1ZYRF 4HX4A 4LMYA 4LB5A 1OKRA 1Z1DA 2F07A 2FJ1A 1G3WA 3I71A 3V8JA 5IOYA 1V5GA 5DD4A 3PIPF 1FYKA 1EH7A 3S1RJ 3L2QA 1K78B 3CCQI 2R7QA 2CO5A 4XRSA 4GFLA 4HV6A 3CWRA 3RKWA 4EJOA 1SANA 2UUZA 1MSEC 2VODA 2P7VB 2FQ4A 3FMQA 4BE1A 1I1SA 5EZGA 3DPJA 2CW8A 4BY7J 1OCTC 3HHGA 2F5EA 2Q2EB 4JP0A 4PFPA 4AU7A 5CVVA 1S29A 2C6YA 5FROA 2M5WA 2W1OA 1YITI 1LDJA 2VQHA 4LOCA 3QP5A 2ZJQF 4NC8A 4AD9A 2JA8J 5D19A 4CO8A 2RQQA 2OTLI 5GAHJ 1W7PA 4B1RA 2UZKA 5D1RA 3QYFA 4XLCA 2VBXA 2A68F 3X2QH 3F6OA 1OJLA 3S1NJ 2Z2SB 1G8XA 1UG2A 4HDVA 1FX7A 3S17J 2PLYA 3LSIA 1R5GA 2ZC2A 4ZDPA 4R79A 1MDMA 1BW5A 4XRFA 2XGCA 3M8EA 4LK1F 2YR2A 1HKQA 5IT9K 3KIOA 1E17A 3CJTB 1SD5A 2XRLA 3GEZA 3LSKA 3SZPA 3RKQA 2R7XA 3CCYA 2EIJH 2G7LA 4LLNA 4HNUA 3BQYA 2HOSA 2QQ9A 4KNYA 4A6EA 1J2XA 2VKVA 3HUGA 4ON0A 1EV7A 2IVMA 4L5IA 5CVJA 1W36C 4KA4A 2QQBA 3OWTA 3KP2A 1L3LA 1RUNA 1UI6A 2RQPA 1GLNA 3C07A 3ZQLA 3E5UA 2HQ5A 3F72A 5B3SH 1R6RA 2DFFA 1GXQA 3BG5A 5BNGA 2WB1A 2JRMA 3BR3A 3G56A 2CW0F 4A3LJ 2CS3A 1J9IA 2AQEA 4BU2A 3H35A 3L1PA 1OYWA 2A5WA 2HKUA 3HSFA 2KDOA 1VF9A 1LUJB 3DPUA 3Q0WA 4UVCA 1OYYA 1XSXA 3AKZA 3R6SA 2CG4A 5M5YJ 3T8TA 2CH0A 4EMSA 2L9RA 2LVSA 1IRGA 1TT5B 3GTGJ 1T33A 2D1HA 3QODA 2XPWA 2Z3YA 2XASA 2H94A 2GBYA 3ANGA 2G7UA 3I59A 1XB4A 2HOAA 1WI3A 2GUHA 3VW1A 5F08A 4PJJA 3F21A 3WE3A 4D5FA 3HZJA 3QPSA 4PDKA 1W7PD 2IRFG 3KZZA 4CCMA 3N05A 4RB3C 2VL8A 2O7OA 4EM2A 1RI7A 2XGEA 2XKOA 3BP8A 2RC4A 2P8TA 1VQ5I 2Y0SN 4YFNF 3AQSA 3K4NA 4IHSA 1XDSA 2COBA 2IU5A 4GFKA 2HDWA 2QTQA 1FEXA 5C4XJ 3JREA 2EPFA 2E2IJ 1K7AA 2OA4A 3JAMZ 3L00A 2CQNA 4IX7A 2KIMA 2DA1A 3F23A 3KZIC 1UAAA 2CQKA 5KAIC 3RSNA 4D9JA 2KQRA 3ON2A 5HAWA 3QYEA 4XKBA 2L7KA 4M74A 1Z7UA 4XOPA 1MMAA 3ABLH 3ZMZA 3L2WA 4IL6C 1QQIA 3JRBA 5HS9A 2FBIA 4R1HA 2Q1ZB 1MMNA 2ZO4A 4UUVA 3BC8A 3I4MJ 2R92J 3GTOJ 4KT6A 5M5XJ 2VN2A 4RAFA 4BL0B 2DG7A 2AXTC 5J1YA 3VOXA 4AIKA 2XPUA 1YFHA 4MEYF 3T5XA 2HOEA 2E1MB 2R5YB 2EV0A 2JVGA 3GFJA 2RDPA 4RGRA 2QM3A 1MNMC 1R1UA 3U1KA 3VW2A 5K5QA 4E7IA 2YX7A 4KMUX 3V78A 3JTGA 4EJWA 2FD5A 3VYRB 3F6VA 3BCGA 2FMLA 2VE8A 3FRQA 2XAUA 3HL2A 4Q5SF 4EGZA 2X6XA 2QA4I 1IDZA 3ZOBA 2NAZA 2Y75A 2O03A 3FXOA 3K10A 1JTXA 2W24A 4S05A 3DFGA 5EGOA 1YQAA 3GMEA 1ZARA 2Y9YA 1ODDA 3W6JB 3PM1A 2OV7A 1KU2A 3RPQA 4BGDA 1XGSA 2P81A 3JAMK 1G59A 3SXYA 2OPTA 1EJ9A 3I4NJ 3BOQA 2RHAA 3GTJJ 2WBMA 5E1XA 1X2MA 2VQLA 4V19K 2GQQA 2KRHA 3K1PA 1FTZA 1A6QA 1KYWA 1RR8C 5E1ZB 3SJMA 2VXDA 2STWA 4GCLA 5J8FA 3OYFA 1DP7P 3K7AJ 2EB7A 3L7WA 3LAPA 2B9SA 3E1SA 4YG2F 2EA4A 2XUBA 3W2VA 3OYEA 4IOCF 1KU7A 2DI3A 2L9NA 3VVYA 2ADUA 2PG4A 1W36D 3FKJA 2EJRA 2ZSIB 4ZH4F 2O9LA 2E5NA 3IKTA 3LSGA 2ZMEB 4XLFA 3N97A 3BJBA 1FOKA 1QVUA 1XPXA 1K83J 3TBIA 1WFXA 4EJTA 3DKXA 4DYRA 1CQTA 4BDYA 3IUOA 1SVLA 2F5DA 3KZYA 3L9FA 3A03A 3IWFA 4UVBA 3W6KB 3FHZA 3UKGA 2F4IA 2XGXA 4ASNA 1X1PA 4MK6A 4JX4A 5KVRA 2M3AA 4HQEA 3M4OJ 2V9KA 3FXUA 1NH3A 3KNWA 3TW7A 4M3DA 1N25A 2ELJA 4OIQF 2KDZA 2IS4A 3PQJA 1S8NA 2GWRA 2DLLA 3BNIA 2LF8A 5B5EC 4FE4A 2BGCA 3WGGA 3S3NA 1J5YA 2JA2A 2GXBA 3FKIJ 1YX5A 1HSJA 2IEKA 1WPKA 1MBFA 1RNLA 1J7KA 5L3CA 1LFUP 4YFXF 2BY0A 2K9MA 1UMQA 2F6CA 3CCRI 2QKOA 5LHGA 2ZXIA 3IC7A 2HWVA 4Q48A 5J1UA 5CW8A 3NAUA 5CXIA 2IAIA 1R36A 2EILH 2KRFA 4G12A 3M3YJ 2W25A 2FF4A 2LBFB 3CCEI 1BM9A 3GEUA 3JRIA 1R4MB 3K70C 2DMQA 3FK6A 4MFDA 1F1ZA 2VQGA 1YE9A 2CUZA 4BYYA 1Z05A 2KZVA 4E7ZA 5ICEA 3HTSB 3PNTA 1W5TA 2W00A 1SEUA 3JRAA 3ESWB 4IEJA 4ACIA 3BR0A 1U9NA 4F52A 3GLXA 2CV0A 1BI1A 3K4LA 2XSDC 2VQCA 3ZMTA 3S1MJ 1BOAA 3FXQA 1JI8A 5FB2A 4CH7A 4U7BA 3IP4B 2OF7A 3VB2A 1HQCA 4GCKA 2L02A 2E60A 4D7MA 2F5CA 3E6BA 4KWAA 3IUVA 1AWCA 1XTAA 1Z9CA 2LOOA 4NN1A 4YZEA 1FOYA 1QNTA 1UHWA 2VJ4A 3MZYA 2JSCA 2QZ8A 4XLNF 1TP4A 1X3WB 2J5PA 3VYSB 3V4GA 2KP6A 4Z6YA 2GENA 2GIZA 2E36A 2YS9A 4C3HJ 1XDUA 3QPHA 2Z9OA 4Y3OA 2EFQA 2R7SA 3CLOA 5GAEJ 1JGSA 1FIPA 2O61A 1A5JA 1G3YA 2STTA 1QPMA 3K1MA 4Y13A 3GYHX 1S7AA 2BHYA 1HXDA 1XGOA 3OV8A 5FLXZ 2N8GA 4IF4A 1YRNA 1LVAA 1K79A 1TNSA 2IGNA 4CGZA 2DO7A 3J80K 3RYPA 2ME0A 5BPIA 4OOIA 2DXIA 3PIOF 4M3FA 2DOFA 2NX4A 4PCQA 3SQNA 3NNRA 2LSOA 3W2AA 4PJLA 4E7HA 5E17F 1RKWA 3V42A 3F0CA 1Y56A 3CJRB 4L9NA 4CCNA 1O3RA 5E3MA 3LOCA 3G4SI 3O8HA 4ZTJA 3BRUA 2HPMA 5M3FJ 4JL3A 2BVMA 5LEKA 1FC3A 3DTIA 1T56A 1UG0A 2XAHA 3I0TA 3LA7A 4IZZA 5J47A 1XCBA 2AO9A 5EG0A 1ZG1A 2M34A 2E7XA 3OL3A 4XQFA 3J7ZI 2GA1A 1IW7F 3I3LA 4Y15A 4OU0A 4EM1A 1HBXG 1VQ4I 2ZKZA 2AQFA 3ECHA 2EK5A 3LMMA 3ZQ7A 5ICCA 1Y1WJ 1BR2A 5E18F 4A3EJ 2OC6A 1TL8A 3EYIA 2XIGA 1ZRCA 3PJRA 1I6XA 2K5CA 2WGBA 3GFIA 3GBGA 3K4JA 1QHHD 3VPRA 4N4OB 3ASNH 3HSRA 1YTYA 3BTLA 3WGHA 3H9QA 3HTAA 4RBOA 5KCMA 1YOVB 1USTA 2HVRA 4PUSA 1SFEA 3LWFA 3COAC 4UDSA 3GVAA 1K78A 3IH2A 4AUXA 4KN4X 1T0FC 3VIBA 3OYKA 1AA7A 1MBJA 2KRCA 2HU9A 4HEA2 5J3LA 5IYBJ 3JW4A 1KU9A 1PUFB 1PDNC 1QU3A 2JSPA 4Z2YA 3S8PA 2XHKA 5HOOA 1QZZA 2PJPA 2Q2EA 3S5RA 3TEDA 4GO1A 3BG3A 2GFNA 3QP6A 2IS2A 2NXNB 5K7HA 2HDDA 1ZGJA 3DKYA 4B3XA 3B6CA 1IRXA 2ICWG 5FRMA 1H0MA 3R0AA 3P5JA 3OOPA 2OI8A 2A3SA 2LNBA 4IQ4A 3V8KA 1P2FA 3H0GJ 2E1OA 1P6RA 2HI3A 3K70D 2FOKA 3CP8A 3RPUA 3GZ6A 2R7TA 1FP1D 4CSWA 3MN2A 2BY2A 2JUCA 5L3DA 1DP3A 1T98A 3F1BA 4CCJA 1HSTA 4GXOA 4B3AA 3CMAI 3DBLB 1ENHA 4BJ5C 1D5VA 1Z77A 4BEHB 4I2OA 2VJ5A 4RLQA 2M4GA 1FBUA 2DA3A 1SAXA 4NC7A 3V6GA 2ZCWA 3PFIA 4QPQA 2FE3A 1Y8QB 4ZYEA 4OAYA 2VBWA 4ENMA 5HNHA 3CQZJ 2D2WA 2O7TA 3KP5A 1JKQC 1DU0A 3KE2A 2QWTA 2RAEA 3M1EA 1T0FA 1W5CC 1OPCA 5J8CA 1RESA 1O7FA 4XLPF 3WG7H 2D5VA 1IV8A 4IPAA 2EBIA 4DJAA 3OYMA 3TO7A 2V26A 1O3SA 1QGPA 1SVOA 4QLCU 1U2WA 3HG9A 2G0EA 3CTAA 4GYGA 2LY9A 1OFCX 3G2BA 4YEJA 1JUMA 4HSRA 4C3IJ 3HGGA 4LK0F 4QPOA 2HOTA 3DEEA 3DTKA 2YVXA
chains in the Genus database with same CATH topology
3ZQHA 3ON4A 4LOCA 2JA8J 5D19A 3JRDA 4X6AJ 4B1RA 5D1RA 3CRJA 5C3EJ 9ANTA 3DEWA 2DA5A 2EQRA 1ETWA 1OJLA 3S1NJ 1UG2A 3HOYJ 4C3JJ 3S14J 1BL0A 1TWFJ 3S17J 4CYCB 5HSZA 4DZPA 2LP0A 1BW5A 1MBEA 4DYCA 1JKRC 2XGCA 1ETVA 2XPVA 4PXIA 5EFYA 2L7MP 3GTLJ 3Q3SA 3JSJA 2XRLA 1VI0A 2R5ZA 1GVDA 3RKQA 5E3NA 4J19A 1U78A 2LK2A 3CCYA 1A6IA 3LNQA 2R0QC 3B6AA 2G7LA 1HLVA 2M8GX 4Y52J 3BQYA 2HOSA 5GP9A 2VKVA 1XS9A 1SFOJ 1I6HJ 3BR5A 2LD5A 3LWJA 3DCFA 1IDYA 2NVQJ 4C2MJ 3G1MA 1FIAA 1G2HA 5FMPA 1ZQ3P 1UI6A 1IUFA 5FKKA 3HTJA 3C07A 3ZQLA 1AKHB 2HQ5A 5IYDJ 3BG5A 2LR8A 5BNGA 3BR3A 4XRSG 3JRCA 3G56A 4IHYA 1QRYA 4A3LJ 4A3BJ 3C2BA 3W6VA 5K7FA 3FISA 3GTMJ 1JT6A 3L1PA 2LFBA 4MFEA 4NELA 1W0UA 3HE0A 2HKUA 3HEFA 3HB9A 3OSGA 2XDNA 3LJLA 1VF9A 1U8BA 2G3BA 3Q0WA 4QSHA 3PO2J 2R5YA 4IHXA 2EZLA 2DN0A 1S7EA 2X9DA 4JNNA 5M5YJ 3T6NA 3BTIA 2L9RA 2LVSA 3GTGJ 2WV1A 1T33A 4XIDA 3O8GA 2XPWA 5C4YA 2NVXJ 2GBYA 3ANGA 2HOAA 2GM4A 1WI3A 1WH5A 2GUHA 5F08A 4BY1J 3VW1A 1Y1VJ 4D5FA 2ECCA 2JN6A 3A02A 3QPSA 2CUFA 3ZQFA 3E7LA 1ZR2A 3EUPA 3A01A 3HOWJ 5FGLA 1IJWC 3BTCA 2KT0A 2RASA 2WB1N 3RZOJ 2DA2A 2O7OA 3K2AA 2XGEA 3PPBA 1WH7A 2R5ZB 2Y0SN 5DS9A 3AQSA 1DU6A 1GUUA 1QVTA 2COBA 2IU5A 4UUSA 2QTQA 4GFKA 3HOVJ 5HODA 2L7ZA 5K7ZA 2JWTA 1FEXA 5C4XJ 4MLOA 3JREA 5M3MJ 2FBQA 1RR7A 2E2IJ 2HXIA 1JGGA 2H8RA 1TWAJ 4AF5A 2DA1A 3WHBA 3ON2A 5HAWA 2R7ZJ 4D5CA 4M3GA 3HOUJ 1AHDP 4XK4A 2H1KA 1Z0XA 3JRBA 3ZQCA 2O8KA 3HTHA 1ZR4A 4HKUA 2JK3A 2DA4A 1NTCA 2I10A 2R92J 3GTOJ 3I4MJ 3VOKA 5M5XJ 3HDDA 2K9SA 5C44J 2LKXA 2DG7A 3EGQA 3JR9A 2DMPA 1JJ6C 5J1YA 1D5YA 3VOXA 4BXXJ 2XPUA 1GT0C 4A3CJ 2LTPA 1ORKA 5EYRA 1BA5A 3CMYA 2EZHA 4MO7A 4MXMA 2R5YB 4Y7NJ 3HKZN 2PMZN 4A3KJ 4JX5A 1MNMC 4QIWN 3IH4A 1EF4A 2QOPA 5FHPA 3VW2A 3V78A 2ME6A 2FD5A 3BCGA 3KKDA 2ZOYA 1ETKA 2DG8A 3FRQA 1POGA 1WCMJ 2D6YA 2ID3A 1F43A 4BBRJ 1RPWA 2CJJA 1LE8A 1IDZA 4AC6A 2K9QA 3ZOBA 4AYBN 1P7JA 3A01B 3KKCA 1JTXA 1BJZA 1GV5A 3D1NI 2YVHA 3MNLA 5EGOA 4I6ZA 2Y9YA 2WAQN 3PM1A 1HDPA 4FISA 2GLOA 2W53A 2P81A 1TWGJ 3QQAA 3HBLA 1VFCA 3I4NJ 2OPTA 2HYTA 5E3LA 4UUSB 2RHAA 4GCTA 1ZK8A 3GTJJ 2JMWA 1X2MA 1ZTRA 2L7FP 1E3OC 1JJ8C 1FTZA 5JLXA 4GCLA 1JKPC 3SJMA 4IHWA 3K7AJ 2G7SA 4M6VA 3JRFA 1HCRA 2UXOA 3VVYA 4A3JJ 1JKOC 5FLVA 2ZCMA 3BR1A 5IP9J 1MBKA 1MH3A 2O9LA 3CDLA 2L0KA 5DAJA 1AU7A 4A3DJ 3BR2A 3LSGA 1ZGWA 5F0FA 2MSYA 2REKA 3VW0A 1BW6A 3BJBA 2DMTA 1MSFC 2NVTJ 1K61A 1QVUA 2ELKA 3E7QA 3NPIA 1K83J 5IP7J 1HOMA 4DYRA 1CQTA 2E19A 5E3OA 2NS8A 5FKNA 1H8AC 3A03A 3UKGA 1SGMA 3QBMA 3TP0A 1B8IA 4MK6A 4L62A 3HOZJ 4JX4A 3M4OJ 4IHVA 1UI5A 3GZIA 3S15J 3KNWA 3G1LA 3TW7A 4M3EA 1FTTA 4L5EA 4M3DA 5IPAA 5F27A 5J1RA 4A3IJ 2DTZA 3BQZA 2KDZA 4BKXA 3H3VK 5DTDA 4MIMA 3SDGA 2ZB9A 3BNIA 1LE8B 3FIWA 1IV6A 4FE4A 2MW8A 2W48A 3HM5A 1ZKGA 2JA7J 1ITYA 2X6OA 5JLWA 2AHQA 2K9NA 3FKIJ 5EGOB 3BR6A 1P7IA 2IEKA 1R9TJ 1WPKA 3O60A 1MBFA 4W97A 5AQCA 2HXOA 1LFUP 3QPLA 2QKOA 1UMQA 2M9HA 3S1QJ 5FJ8J 5J1UA 2JJ7A 5CW8A 3NAUA 5CXIA 2IAIA 3NARA 4G12A 2XB0X 3M3YJ 2OERA 2UXPA 4A69C 1X2NA 1HDDC 3RD3A 3GEUA 3JRIA 2DMQA 3FK6A 4MFDA 3Q0UA 3VUQA 5FKOA 1XC5A 3JRAA 4IEJA 2CUEA 4ACIA 3BR0A 1U9NA 2DJNA 5IP6A 2VUMJ 1U9OA 2UXUA 1IC8A 4ME9A 3HIMA 3IV5A 4DW6A 2XSDC 3GTPJ 2Y9ZA 3S2DJ 2QCOA 3S1MJ 1ETYA 2NVYJ 1VNDA 1RKTA 2OF7A 1OCPA 3VP5A 4GCKA 4GFBA 1HF0A 5F04A 4D7MA 2UXIA 2LLKA 5HBUA 4KWAA 2K40A 3IUVA 5GPAA 1B8IB 4I76A 3QKXA 4NN1A 1NK3P 4YZEA 2QIBA 1ETOA 3PASA 2GENA 2EZKA 4C3HJ 2YS9A 1TC3C 4W1UA 3RQIA 1TWCJ 4RDUA 1FIPA 3OIOA 1A5JA 4X1EA 2VPRA 1B72A 4FCYA 2E2HJ 3B81A 5EDNA 2NP5A 2N8GA 1YRNA 2CU7A 3IH3A 2YU9J 3VVZA 2FX0A 2NOGA 3JRGA 5FKMA 1PUFA 1APLC 5F0CA 5IOZA 2ME0A 5FLMJ 4ABZA 3LSPA 4M3FA 2Y31A 3SFIA 3NRGA 2NX4A 4AC0A 3NNRA 1X58A 1RKWA 3F0CA 2DA7A 2HYJA 2WUIA 5E3MA 3LOCA 4JX6A 3O8HA 3BRUA 4DZJA 3RH2A 3P9TA 3BG9A 5IYCJ 5M3FJ 4JL3A 1T56A 1JT0A 2Y30A 2AO9A 2NP3A 5GPCA 4B4CA 5EG0A 2M34A 1IGNA 3G7RA 2R93J 4EEFG 1FJLA 2G7GA 3VVXA 1RETA 3LHQA 2CRGA 2DA6A 2VI6A 3GTKJ 3RZDJ 1ETQA 2XB5A 1QPIA 1Y1WJ 2UXHA 4A3EJ 2VKEA 3HOXJ 4HNVA 1GDTA 3AQTA 4FE7A 1NK2P 3TP3A 4XICA 2E2JJ 4D7NA 4V2FA 2WGBA 2EZIA 4M3BA 1I50J 3GBGA 3VPRA 3LSJA 5M5WJ 3BTLA 2NS7A 2TCTA 3TW6A 3HTAA 4RBOA 2Y2ZA 2MGQA 1JTYA 4DYQA 4A93J 4UDSA 1B72B 2V57A 1I3QJ 3Q0VA 3IH2A 1UHSA 4AUXA 2DMUA 3VIBA 4QTRA 1YRNB 4FTHA 1MBJA 3NXCA 5J3LA 5IYBJ 2IBDA 4V2GA 1PUFB 1O4XA 2PZ9A 5EZHA 1MH4A 4ICHA 2ZCNA 5D18A 2CQXA 3MKLA 1XG1A 3PO3J 3TEDA 1H89C 3S5RA 2MG4A 3BG3A 3G1OA 3BT9A 2GFNA 1IRZA 4CGRA 3S16J 2YVEA 2YUSA 5K7HA 2HDDA 3ZQGA 3B6CA 5EF6A 5H9TA 1ETXA 1F36A 1LFBA 1MBHA 2PBXA 1W0TA 3FK7A 5FKLA 3OSFA 2OI8A 3COLA 2B63J 2ZOZA 4A3FJ 3H0GJ 2E1OA 1GV2A 2HI3A 2XGDA 3HGYA 3MN2A 4JYKA 5EG0B 4CYCA 1Q1VA 4S0HB 2ZCXA 2JA5J 2Q24A 3F1BA 3OOUA 2M0CA 4B3AA 5F1JA 3MVPA 4XRMA 5F0HA 5C4JJ 4BBSJ 3ANPA 2ECBA 1ENHA 1Z77A 3LSRA 4A3MJ 2DA3A 3V6GA 3HTIA 1MBGA 2QF7A 1H88C 2JA6J 3KZ9A 3S2HJ 1TWHJ 2TRTA 3CQZJ 5EEAA 3JRHA 2O7TA 1JKQC 1DU0A 2QWTA 2RAEA 3WHCA 1RESA 2DMNA 2F07A 4A3GJ 2FJ1A 5IOYA 2D5VA 2EBIA 3S1RJ 3BHQA 2M2EA 3CJDA 4JKZA 2EH3A 4XRSA 1AKHA 4GFLA 1IG7A 5CXGA 3CWRA 3GTQJ 4NDLA 1SANA 3NI7A 1MSEC 2FQ4A 3ZQIA 2G0EA 5EZGA 3DPJA 2LY9A 1OFCX 2ID6A 1JUPA 4UUTA 4BY7J 1JUMA 4C3IJ 1OCTC 3HGGA 3BTJA 1JUSA 2CQQA 2HOTA 4JP0A 5K58A 1WGXA 2X48A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZQH A;  3ON4 A;  4LOC A;  2JA8 J;  5D19 A;  3JRD A;  4X6A J;  4B1R A;  5D1R A;  3CRJ A;  5C3E J;  9ANT A;  3DEW A;  2DA5 A;  2EQR A;  1ETW A;  1OJL A;  3S1N J;  1UG2 A;  3HOY J;  4C3J J;  3S14 J;  1BL0 A;  1TWF J;  3S17 J;  4CYC B;  5HSZ A;  4DZP A;  2LP0 A;  1BW5 A;  1MBE A;  4DYC A;  1JKR C;  2XGC A;  1ETV A;  2XPV A;  4PXI A;  5EFY A;  2L7M P;  3GTL J;  3Q3S A;  3JSJ A;  2XRL A;  1VI0 A;  2R5Z A;  1GVD A;  3RKQ A;  5E3N A;  4J19 A;  1U78 A;  2LK2 A;  3CCY A;  1A6I A;  3LNQ A;  2R0Q C;  3B6A A;  2G7L A;  1HLV A;  2M8G X;  4Y52 J;  3BQY A;  2HOS A;  5GP9 A;  2VKV A;  1XS9 A;  1SFO J;  1I6H J;  3BR5 A;  2LD5 A;  3LWJ A;  3DCF A;  1IDY A;  2NVQ J;  4C2M J;  3G1M A;  1FIA A;  1G2H A;  5FMP A;  1ZQ3 P;  1UI6 A;  1IUF A;  5FKK A;  3HTJ A;  3C07 A;  3ZQL A;  1AKH B;  2HQ5 A;  5IYD J;  3BG5 A;  2LR8 A;  5BNG A;  3BR3 A;  4XRS G;  3JRC A;  3G56 A;  4IHY A;  1QRY A;  4A3L J;  4A3B J;  3C2B A;  3W6V A;  5K7F A;  3FIS A;  3GTM J;  1JT6 A;  3L1P A;  2LFB A;  4MFE A;  4NEL A;  1W0U A;  3HE0 A;  2HKU A;  3HEF A;  3HB9 A;  3OSG A;  2XDN A;  3LJL A;  1VF9 A;  1U8B A;  2G3B A;  3Q0W A;  4QSH A;  3PO2 J;  2R5Y A;  4IHX A;  2EZL A;  2DN0 A;  1S7E A;  2X9D A;  4JNN A;  5M5Y J;  3T6N A;  3BTI A;  2L9R A;  2LVS A;  3GTG J;  2WV1 A;  1T33 A;  4XID A;  3O8G A;  2XPW A;  5C4Y A;  2NVX J;  2GBY A;  3ANG A;  2HOA A;  2GM4 A;  1WI3 A;  1WH5 A;  2GUH A;  5F08 A;  4BY1 J;  3VW1 A;  1Y1V J;  4D5F A;  2ECC A;  2JN6 A;  3A02 A;  3QPS A;  2CUF A;  3ZQF A;  3E7L A;  1ZR2 A;  3EUP A;  3A01 A;  3HOW J;  5FGL A;  1IJW C;  3BTC A;  2KT0 A;  2RAS A;  2WB1 N;  3RZO J;  2DA2 A;  2O7O A;  3K2A A;  2XGE A;  3PPB A;  1WH7 A;  2R5Z B;  2Y0S N;  5DS9 A;  3AQS A;  1DU6 A;  1GUU A;  1QVT A;  2COB A;  2IU5 A;  4UUS A;  2QTQ A;  4GFK A;  3HOV J;  5HOD A;  2L7Z A;  5K7Z A;  2JWT A;  1FEX A;  5C4X J;  4MLO A;  3JRE A;  5M3M J;  2FBQ A;  1RR7 A;  2E2I J;  2HXI A;  1JGG A;  2H8R A;  1TWA J;  4AF5 A;  2DA1 A;  3WHB A;  3ON2 A;  5HAW A;  2R7Z J;  4D5C A;  4M3G A;  3HOU J;  1AHD P;  4XK4 A;  2H1K A;  1Z0X A;  3JRB A;  3ZQC A;  2O8K A;  3HTH A;  1ZR4 A;  4HKU A;  2JK3 A;  2DA4 A;  1NTC A;  2I10 A;  2R92 J;  3GTO J;  3I4M J;  3VOK A;  5M5X J;  3HDD A;  2K9S A;  5C44 J;  2LKX A;  2DG7 A;  3EGQ A;  3JR9 A;  2DMP A;  1JJ6 C;  5J1Y A;  1D5Y A;  3VOX A;  4BXX J;  2XPU A;  1GT0 C;  4A3C J;  2LTP A;  1ORK A;  5EYR A;  1BA5 A;  3CMY A;  2EZH A;  4MO7 A;  4MXM A;  2R5Y B;  4Y7N J;  3HKZ N;  2PMZ N;  4A3K J;  4JX5 A;  1MNM C;  4QIW N;  3IH4 A;  1EF4 A;  2QOP A;  5FHP A;  3VW2 A;  3V78 A;  2ME6 A;  2FD5 A;  3BCG A;  3KKD A;  2ZOY A;  1ETK A;  2DG8 A;  3FRQ A;  1POG A;  1WCM J;  2D6Y A;  2ID3 A;  1F43 A;  4BBR J;  1RPW A;  2CJJ A;  1LE8 A;  1IDZ A;  4AC6 A;  2K9Q A;  3ZOB A;  4AYB N;  1P7J A;  3A01 B;  3KKC A;  1JTX A;  1BJZ A;  1GV5 A;  3D1N I;  2YVH A;  3MNL A;  5EGO A;  4I6Z A;  2Y9Y A;  2WAQ N;  3PM1 A;  1HDP A;  4FIS A;  2GLO A;  2W53 A;  2P81 A;  1TWG J;  3QQA A;  3HBL A;  1VFC A;  3I4N J;  2OPT A;  2HYT A;  5E3L A;  4UUS B;  2RHA A;  4GCT A;  1ZK8 A;  3GTJ J;  2JMW A;  1X2M A;  1ZTR A;  2L7F P;  1E3O C;  1JJ8 C;  1FTZ A;  5JLX A;  4GCL A;  1JKP C;  3SJM A;  4IHW A;  3K7A J;  2G7S A;  4M6V A;  3JRF A;  1HCR A;  2UXO A;  3VVY A;  4A3J J;  1JKO C;  5FLV A;  2ZCM A;  3BR1 A;  5IP9 J;  1MBK A;  1MH3 A;  2O9L A;  3CDL A;  2L0K A;  5DAJ A;  1AU7 A;  4A3D J;  3BR2 A;  3LSG A;  1ZGW A;  5F0F A;  2MSY A;  2REK A;  3VW0 A;  1BW6 A;  3BJB A;  2DMT A;  1MSF C;  2NVT J;  1K61 A;  1QVU A;  2ELK A;  3E7Q A;  3NPI A;  1K83 J;  5IP7 J;  1HOM A;  4DYR A;  1CQT A;  2E19 A;  5E3O A;  2NS8 A;  5FKN A;  1H8A C;  3A03 A;  3UKG A;  1SGM A;  3QBM A;  3TP0 A;  1B8I A;  4MK6 A;  4L62 A;  3HOZ J;  4JX4 A;  3M4O J;  4IHV A;  1UI5 A;  3GZI A;  3S15 J;  3KNW A;  3G1L A;  3TW7 A;  4M3E A;  1FTT A;  4L5E A;  4M3D A;  5IPA A;  5F27 A;  5J1R A;  4A3I J;  2DTZ A;  3BQZ A;  2KDZ A;  4BKX A;  3H3V K;  5DTD A;  4MIM A;  3SDG A;  2ZB9 A;  3BNI A;  1LE8 B;  3FIW A;  1IV6 A;  4FE4 A;  2MW8 A;  2W48 A;  3HM5 A;  1ZKG A;  2JA7 J;  1ITY A;  2X6O A;  5JLW A;  2AHQ A;  2K9N A;  3FKI J;  5EGO B;  3BR6 A;  1P7I A;  2IEK A;  1R9T J;  1WPK A;  3O60 A;  1MBF A;  4W97 A;  5AQC A;  2HXO A;  1LFU P;  3QPL A;  2QKO A;  1UMQ A;  2M9H A;  3S1Q J;  5FJ8 J;  5J1U A;  2JJ7 A;  5CW8 A;  3NAU A;  5CXI A;  2IAI A;  3NAR A;  4G12 A;  2XB0 X;  3M3Y J;  2OER A;  2UXP A;  4A69 C;  1X2N A;  1HDD C;  3RD3 A;  3GEU A;  3JRI A;  2DMQ A;  3FK6 A;  4MFD A;  3Q0U A;  3VUQ A;  5FKO A;  1XC5 A;  3JRA A;  4IEJ A;  2CUE A;  4ACI A;  3BR0 A;  1U9N A;  2DJN A;  5IP6 A;  2VUM J;  1U9O A;  2UXU A;  1IC8 A;  4ME9 A;  3HIM A;  3IV5 A;  4DW6 A;  2XSD C;  3GTP J;  2Y9Z A;  3S2D J;  2QCO A;  3S1M J;  1ETY A;  2NVY J;  1VND A;  1RKT A;  2OF7 A;  1OCP A;  3VP5 A;  4GCK A;  4GFB A;  1HF0 A;  5F04 A;  4D7M A;  2UXI A;  2LLK A;  5HBU A;  4KWA A;  2K40 A;  3IUV A;  5GPA A;  1B8I B;  4I76 A;  3QKX A;  4NN1 A;  1NK3 P;  4YZE A;  2QIB A;  1ETO A;  3PAS A;  2GEN A;  2EZK A;  4C3H J;  2YS9 A;  1TC3 C;  4W1U A;  3RQI A;  1TWC J;  4RDU A;  1FIP A;  3OIO A;  1A5J A;  4X1E A;  2VPR A;  1B72 A;  4FCY A;  2E2H J;  3B81 A;  5EDN A;  2NP5 A;  2N8G A;  1YRN A;  2CU7 A;  3IH3 A;  2YU9 J;  3VVZ A;  2FX0 A;  2NOG A;  3JRG A;  5FKM A;  1PUF A;  1APL C;  5F0C A;  5IOZ A;  2ME0 A;  5FLM J;  4ABZ A;  3LSP A;  4M3F A;  2Y31 A;  3SFI A;  3NRG A;  2NX4 A;  4AC0 A;  3NNR A;  1X58 A;  1RKW A;  3F0C A;  2DA7 A;  2HYJ A;  2WUI A;  5E3M A;  3LOC A;  4JX6 A;  3O8H A;  3BRU A;  4DZJ A;  3RH2 A;  3P9T A;  3BG9 A;  5IYC J;  5M3F J;  4JL3 A;  1T56 A;  1JT0 A;  2Y30 A;  2AO9 A;  2NP3 A;  5GPC A;  4B4C A;  5EG0 A;  2M34 A;  1IGN A;  3G7R A;  2R93 J;  4EEF G;  1FJL A;  2G7G A;  3VVX A;  1RET A;  3LHQ A;  2CRG A;  2DA6 A;  2VI6 A;  3GTK J;  3RZD J;  1ETQ A;  2XB5 A;  1QPI A;  1Y1W J;  2UXH A;  4A3E J;  2VKE A;  3HOX J;  4HNV A;  1GDT A;  3AQT A;  4FE7 A;  1NK2 P;  3TP3 A;  4XIC A;  2E2J J;  4D7N A;  4V2F A;  2WGB A;  2EZI A;  4M3B A;  1I50 J;  3GBG A;  3VPR A;  3LSJ A;  5M5W J;  3BTL A;  2NS7 A;  2TCT A;  3TW6 A;  3HTA A;  4RBO A;  2Y2Z A;  2MGQ A;  1JTY A;  4DYQ A;  4A93 J;  4UDS A;  1B72 B;  2V57 A;  1I3Q J;  3Q0V A;  3IH2 A;  1UHS A;  4AUX A;  2DMU A;  3VIB A;  4QTR A;  1YRN B;  4FTH A;  1MBJ A;  3NXC A;  5J3L A;  5IYB J;  2IBD A;  4V2G A;  1PUF B;  1O4X A;  2PZ9 A;  5EZH A;  1MH4 A;  4ICH A;  2ZCN A;  5D18 A;  2CQX A;  3MKL A;  1XG1 A;  3PO3 J;  3TED A;  1H89 C;  3S5R A;  2MG4 A;  3BG3 A;  3G1O A;  3BT9 A;  2GFN A;  1IRZ A;  4CGR A;  3S16 J;  2YVE A;  2YUS A;  5K7H A;  2HDD A;  3ZQG A;  3B6C A;  5EF6 A;  5H9T A;  1ETX A;  1F36 A;  1LFB A;  1MBH A;  2PBX A;  1W0T A;  3FK7 A;  5FKL A;  3OSF A;  2OI8 A;  3COL A;  2B63 J;  2ZOZ A;  4A3F J;  3H0G J;  2E1O A;  1GV2 A;  2HI3 A;  2XGD A;  3HGY A;  3MN2 A;  4JYK A;  5EG0 B;  4CYC A;  1Q1V A;  4S0H B;  2ZCX A;  2JA5 J;  2Q24 A;  3F1B A;  3OOU A;  2M0C A;  4B3A A;  5F1J A;  3MVP A;  4XRM A;  5F0H A;  5C4J J;  4BBS J;  3ANP A;  2ECB A;  1ENH A;  1Z77 A;  3LSR A;  4A3M J;  2DA3 A;  3V6G A;  3HTI A;  1MBG A;  2QF7 A;  1H88 C;  2JA6 J;  3KZ9 A;  3S2H J;  1TWH J;  2TRT A;  3CQZ J;  5EEA A;  3JRH A;  2O7T A;  1JKQ C;  1DU0 A;  2QWT A;  2RAE A;  3WHC A;  1RES A;  2DMN A;  2F07 A;  4A3G J;  2FJ1 A;  5IOY A;  2D5V A;  2EBI A;  3S1R J;  3BHQ A;  2M2E A;  3CJD A;  4JKZ A;  2EH3 A;  4XRS A;  1AKH A;  4GFL A;  1IG7 A;  5CXG A;  3CWR A;  3GTQ J;  4NDL A;  1SAN A;  3NI7 A;  1MSE C;  2FQ4 A;  3ZQI A;  2G0E A;  5EZG A;  3DPJ A;  2LY9 A;  1OFC X;  2ID6 A;  1JUP A;  4UUT A;  4BY7 J;  1JUM A;  4C3I J;  1OCT C;  3HGG A;  3BTJ A;  1JUS A;  2CQQ A;  2HOT A;  4JP0 A;  5K58 A;  1WGX A;  2X48 A; 
#chains in the Genus database with same CATH topology
 2NOJ B;  3ZQH A;  3KEY A;  2DQL A;  1F5T A;  5IT3 A;  4YIF A;  3D0S A;  4X6A J;  1R58 A;  4UB6 C;  5C3E J;  9ANT A;  2M1B A;  2VBY A;  1U5T C;  2GXA A;  1ETW A;  1FY7 A;  1LKX A;  3BJA A;  4G7O F;  3U9G A;  2E1M C;  2OCE A;  3OR2 C;  2IS6 A;  1BL0 A;  1IZ1 A;  4CCK A;  5HS7 A;  4XBF A;  2VJI A;  2WV0 A;  1OCZ H;  2LP0 A;  3KEQ A;  1A35 A;  1PJR A;  1MBE A;  3DPL C;  4N9I A;  2R7V A;  3KX2 A;  2L7M P;  1T2K A;  2A07 F;  2MH2 A;  3QOE A;  3CUQ C;  3DBR B;  2VIX A;  2MLK A;  3GTL J;  5CQG A;  3FBN B;  1HKT A;  3Q3S A;  3RPU D;  5E79 C;  1VI0 A;  4L18 B;  1GVD A;  4RMN A;  4UVA A;  3HOT A;  1U78 A;  2RNG A;  2FOW A;  3BZK A;  1MKM A;  3T1B A;  5HDK A;  4NQW B;  4CIC A;  4ZC3 A;  1EH6 A;  2VKH A;  1BOB A;  4KIF A;  5BMZ A;  4U9L A;  5GP9 A;  2LMD A;  3CCV I;  2PI0 A;  2Y48 A;  3BR5 A;  2LD5 A;  2R7U A;  2WAE A;  2E71 A;  3G1M A;  2QSF X;  1G2H A;  5FMP A;  1BIB A;  5E8I A;  3HTJ A;  4QWQ A;  1FMW A;  2M0M A;  3ASO H;  2WA0 A;  2LR8 A;  4ZZD A;  5H6Q A;  4XRS G;  4A6D A;  3JRC A;  2X4H A;  3W6V A;  3IHU A;  5BS6 A;  1UCR A;  2Y69 H;  2Y0S A;  2LFB A;  3HE0 A;  3VOD A;  2GOM A;  1BBY A;  3HB9 A;  3OYN A;  1LJ9 A;  4D1Q A;  5ILV A;  3LJL A;  1U8B A;  3TGN A;  1F4K A;  3BY6 A;  2G3B A;  4QSH A;  5DM7 F;  3PO2 J;  2R5Y A;  2IT0 A;  4C30 A;  5LRS A;  1S7E A;  5D5V B;  1RIO H;  1MZB A;  2DJI A;  4P55 A;  3T6N A;  3TO6 A;  3I4P A;  2ACJ A;  1MMG A;  1X1D A;  5C4Y A;  1XGM A;  3FXM A;  3SYT A;  1SMT A;  2BEO A;  3G71 I;  1WH5 A;  4BY1 J;  1X1C A;  2ECC A;  4XSX F;  3WGI A;  3CF5 F;  3IL2 A;  3DTE A;  1ZR2 A;  2EIK H;  2H6C A;  2MBF A;  3MCZ A;  2R7W A;  2KT0 A;  2K4B A;  2HPI A;  3K2A A;  3KEO A;  2W7N A;  1WH7 A;  2R5Z B;  2RKH A;  4FAS D;  3V7S A;  1YIO A;  3KYD B;  2FQ3 A;  1GUU A;  2K3P A;  2MAB A;  4AVP A;  3MZ8 A;  5L3F A;  5HOD A;  2L7Z A;  2JWT A;  5DYM A;  4MLO A;  2DFE A;  2X6W A;  2HXI A;  1JGG A;  1TWA J;  2JZY A;  4E7S A;  4EV0 A;  2M87 A;  1G4D A;  1TT0 A;  2F48 A;  4PJM A;  3ZCO A;  3IRR A;  5LGN A;  2VOO A;  2PEX A;  1BIA A;  4M3G A;  1OIS A;  3HOU J;  3L2C A;  1HC8 A;  2H1K A;  3GXO A;  4WIB A;  3OY9 A;  2CYY A;  2GZW A;  1RC9 A;  1C0W A;  4HKU A;  1D0X A;  1FPQ A;  1TQP A;  1NTC A;  4CA0 A;  2W85 A;  2ZME A;  2EV6 A;  5L3G A;  5C44 J;  2LKX A;  4OIP F;  3EGQ A;  1SFK A;  2VAS A;  3DBH B;  1QO0 D;  4L9V A;  4M9S A;  4RAY A;  1D5Y A;  3F9K A;  4E70 A;  4DBR A;  4BHP A;  2MFZ A;  3EDP A;  3CMY A;  2EZH A;  4MO7 A;  3H9G A;  2PMZ N;  4J01 A;  2BXY A;  3TOA A;  2MD0 A;  4QIW N;  3PL8 A;  4U88 A;  1W4M A;  1S9H A;  2V4J C;  3GF2 A;  4P9U A;  3CCJ I;  4BE2 A;  4DBQ A;  1XX5 A;  1HW2 A;  2ME6 A;  4FX0 A;  2H27 A;  4BUP A;  2HKX A;  3F8B A;  3WU0 A;  2ZOY A;  2D6Y A;  3DV8 A;  4HAM A;  4AC6 A;  3ZP5 A;  4AYB N;  5J4V A;  1P7J A;  2P5K A;  3RTR A;  3MD2 A;  2CV2 A;  4CCO A;  1BJZ A;  1GV5 A;  4XON A;  1X19 A;  3RYR A;  3OYD A;  3D1N I;  1VQO I;  4MEX F;  1VQ7 I;  4I99 C;  4GDF A;  1USS A;  2MA3 A;  2EFW A;  4GYI A;  2WAQ N;  2A69 F;  2W53 A;  1R1T A;  1VFC A;  2BHZ A;  1UZC A;  3HIF A;  3BPV A;  4XM3 A;  1FT9 A;  5FRN A;  1ZTR A;  1IRF A;  2CMP A;  2M30 A;  1UHM A;  2HZD A;  5JLX A;  5B66 C;  4NBQ A;  2LBF A;  1JXS A;  4IHW A;  5JI6 A;  1K4T A;  4L5J A;  2H8W A;  3CCL I;  2KPM A;  1B6A A;  4L9T A;  2UXO A;  2BV6 A;  3LL7 A;  3K69 A;  4A3J J;  5FLV A;  4M9X A;  2OTJ I;  2ZCM A;  2DK8 A;  1O3T A;  5IP9 J;  1MBK A;  1MH3 A;  2UXX A;  3SZG A;  3CDL A;  1Y39 A;  3ABT A;  1KQ0 A;  2NS0 A;  3PSI A;  5L3E A;  5D5X B;  3E5Q A;  4ENJ A;  2WTE A;  1MSF C;  1QA6 A;  1D1B A;  3WU1 B;  2O6G E;  3E7Q A;  1MIJ A;  5IP7 J;  3OMY A;  4NHJ A;  1HOM A;  2G7H A;  1RUO A;  2E19 A;  3TDZ C;  1MJ9 A;  2KLO A;  1D8K A;  2NS8 A;  4IRI A;  3IKV A;  4Y33 A;  5HLH A;  1H8A C;  1OCC H;  3NWT A;  3QBM A;  2DPD A;  4L62 A;  1D1C A;  2DFH A;  1YLF A;  3E5X A;  2KJB A;  4CUG A;  1YJ9 I;  4WCG A;  1FTT A;  5HLG A;  4A3I J;  2DTZ A;  3WTX C;  4MIM A;  2JPB A;  1SD4 A;  3KP6 A;  3SDG A;  4LG3 A;  1B9N A;  2ZB9 A;  2VT3 A;  1XCV A;  3FIW A;  2HTS A;  3HM5 A;  4RB2 C;  2A2F X;  1T39 A;  5K1Y A;  2K9N A;  1FSH A;  3BR6 A;  2DQR A;  5AIP A;  4EQQ A;  5DCM A;  6PAX A;  4YEL A;  4DGW B;  4X0G A;  2L2O A;  3QPL A;  5ERI A;  2M9H A;  4MTE A;  2XV4 S;  3IWZ A;  1ZN2 A;  2JJ7 A;  4NB5 A;  1KON A;  2OQR A;  2OER A;  2W57 A;  1ULY A;  1X2N A;  4XN0 A;  3S93 A;  1K4S A;  4XNF A;  1KQ9 A;  4WF2 A;  3CES A;  3DPT A;  3Q0U A;  4YIR X;  1J59 A;  3E6C C;  1ONV A;  2ETH A;  3R60 A;  4OMZ A;  1G3T A;  2DJN A;  3BRO A;  2VUM J;  3KP4 A;  3S32 A;  4UY8 I;  2E35 A;  2GIV A;  1IC8 A;  3FXL A;  3IV5 A;  2CFX A;  4HPQ A;  4DW6 A;  2Y9Z A;  1PP8 F;  1ETY A;  1SVM A;  2VON A;  2IGO A;  4O6J A;  4HNT A;  5ICG A;  3OYG A;  2R7O A;  1JE8 A;  1VND A;  1OCP A;  5LHH A;  1HF0 A;  3I58 A;  4ETS A;  2LRD A;  1YO5 C;  1U5T B;  2K40 A;  5EJC A;  4P1W A;  1DPR A;  4GCV A;  4OWR B;  5GPA A;  3MQ0 A;  2VT2 A;  4I76 A;  3QKX A;  4CZC A;  2DBB A;  1NK3 P;  4FET A;  1ETO A;  3TKY A;  1Y0N A;  3CCS I;  1MMS A;  2CV1 A;  3HPG A;  4PGH A;  5CVU A;  3V8L A;  2PFB A;  2B7E A;  2X85 A;  5A2Q Z;  2VLA A;  3RQI A;  1Z7L A;  2EFN A;  3HYI A;  2P4W A;  2XF7 A;  5CJ9 A;  3ZMS A;  2A6H F;  3CUQ B;  2GOX B;  4XR6 A;  3OYA A;  3OIO A;  4HV5 A;  3VSL A;  1YJW I;  2FEZ A;  3CJN A;  2E2H J;  3B81 A;  5ILU A;  4ITV A;  2NP5 A;  4LIV A;  3VVZ A;  1J09 A;  2FX0 A;  3O6B B;  4RB1 A;  1PUF A;  3K2Z A;  2XRO A;  2NNY A;  1S3J A;  4PGG A;  4MGR A;  2Y31 A;  3SFI A;  3W2W A;  3N4M A;  4XKV A;  2QSH X;  2OJE D;  1X58 A;  2DA7 A;  2Q8K A;  2AXL A;  3EYY A;  2P5V A;  3PUF A;  4JX6 A;  3CLQ A;  4XKC A;  1KQ8 A;  1FLI A;  4O3M A;  4WXC A;  4ANJ A;  4DZJ A;  1GHC A;  4XKW A;  3P9T A;  4NC6 A;  3RH2 A;  4RGS A;  1JT0 A;  3U2R A;  3L2V A;  2FBH A;  3A1Y A;  1EA3 A;  2OQG A;  4HF0 A;  3JSO A;  4LD5 A;  1TTY A;  3GUD A;  2LKS A;  4HRI A;  2G7G A;  2W82 A;  4F93 B;  3BPX A;  2ZBK A;  3HRU A;  2QYO A;  2NVU B;  5H6R A;  4BEH A;  1O57 A;  4WXH A;  5E20 A;  5KK1 A;  3PFY A;  3VFZ A;  3GTK J;  3RZD J;  2XB5 A;  1QPI A;  1FOX A;  4KIS A;  2F5F A;  5CYV A;  4FE7 A;  1DUX C;  4ENN A;  4D7N A;  4V2F A;  3CC4 I;  1FYL A;  2EZI A;  4M3B A;  2PJR B;  1AOY A;  3WTZ A;  3LSJ A;  2IJL A;  4WXD A;  4G6T B;  3KLO A;  1LFP A;  3A4C A;  1ZHF A;  2K27 A;  5DUI A;  1RZ4 A;  4IO9 F;  5JVT A;  3G73 A;  1R71 A;  2CSO A;  1JTY A;  5FO5 A;  4B48 A;  1B59 A;  1IAW A;  3CZ6 A;  1YYV A;  1I3Q J;  1UHS A;  3PUB A;  2DMU A;  1QZE A;  1VQK I;  3CUO A;  2H09 A;  3F8F A;  3NXC A;  5FD5 A;  3NQO A;  2IBD A;  2PZ9 A;  2M7B A;  1X4O A;  4XL9 A;  4ICH A;  5D18 A;  3ZMU A;  5IY5 H;  1Z3Y A;  2XAJ A;  3PO3 J;  4RS8 A;  3BT9 A;  1FMV A;  1F9N A;  3I56 I;  1B4A A;  1ETX A;  4G8X A;  1LFB A;  5D6E A;  4G6D A;  3GLL A;  3HXL A;  1WI9 A;  5EEH A;  4LJZ F;  1W0T A;  1SC7 A;  3OSF A;  2PBX A;  1LNW A;  1V4R A;  4JBA A;  5CVI A;  1JHH A;  3L2U A;  1GV2 A;  3GZN B;  3HPH A;  4UV9 A;  2XGD A;  1LQ1 A;  3EPZ A;  4DVY P;  2HDC A;  3GX4 X;  2DYR H;  2KIS A;  4S0H B;  2ZCX A;  3ZGK A;  2Q24 A;  3CMM A;  3PNY A;  2LC2 A;  4XRM A;  1H9G A;  3LFU A;  3ANP A;  3D5S C;  4G9Y A;  3NS4 A;  3R4K A;  3ML6 A;  2B1E A;  1IN4 A;  2I5U A;  4A3M J;  3S3O A;  2FXA A;  1D0Z A;  2M4K A;  3CCU I;  1MBG A;  2OD5 A;  2QF7 A;  5E8G A;  1MND A;  4FX4 A;  3KZ9 A;  2BZT A;  2QVO A;  4FT8 A;  1T6S A;  3T0Y A;  3JSP A;  4OD5 A;  1TWH J;  2TRT A;  4NQW A;  3FM5 A;  3CO6 C;  1Y6I A;  4CHU A;  3OYL A;  4L0Y B;  4ESJ A;  2DMN A;  2RNJ A;  2F2E A;  3HJE A;  3KYL A;  2K3F A;  2L3D A;  2K9L A;  3H1C A;  2FSW A;  2JUG A;  3NRV A;  3BHQ A;  3HSE A;  1ZRF A;  4JKZ A;  2EH3 A;  2LY1 A;  1I1G A;  1UEL B;  1IG7 A;  3K4K A;  3H0D A;  2L9V A;  5HLI A;  3NI7 A;  3ZMV A;  3ZQI A;  1KZH A;  4EJV A;  2IS1 A;  3DF8 A;  2ID6 A;  2E1C A;  1JUP A;  2DAO A;  1R49 A;  2VE9 A;  2XSJ C;  4BQA A;  3BTJ A;  1DQU A;  1JUS A;  2CQQ A;  2EA2 A;  3P7N A;  5DCM B;  3CC7 I;  1WGX A;  3GCM A;  5K58 A;  2X48 A;  1LEA A;  3EUH C;  2DFI A;  2R7D A;  3UR3 C;  3ON4 A;  3ZMD A;  4UHT A;  3SDB A;  2XAG A;  2MD5 A;  3O3K A;  4XLE A;  3ELK A;  1M1E B;  2E7W A;  3CRJ A;  3WTV C;  2DA5 A;  1R5I D;  2JRT A;  4KIC A;  5LFA A;  2LDU A;  3HOY J;  4C3J J;  3S14 J;  4BXF A;  1N77 A;  4CYC B;  3OR1 C;  5F64 A;  3ZXS A;  4IRH A;  4DYC A;  1SAU A;  1JKR C;  4PXI A;  1ETV A;  2H1L A;  4N9H A;  5HDG A;  4I0A A;  4PJN A;  5EFY A;  3H3U A;  2QKL B;  3KCC A;  2TDX A;  1YHQ I;  2IW5 A;  2R5Z A;  1RRJ A;  2X1D A;  2LK2 A;  1GXP A;  3LNQ A;  3B6A A;  1HLV A;  1D8J A;  2M8G X;  4PK4 A;  2E5Z A;  5GAG J;  2KZG A;  4MNU A;  3H5N A;  3FMS A;  3BG7 A;  2V1D A;  1SFO J;  1BC8 C;  1PUE E;  4M72 A;  1IDY A;  3QU3 A;  2NVQ J;  3DQV C;  1FNN A;  1ZQ3 P;  2K85 A;  1IUF A;  4I0B A;  5FKK A;  1AKH B;  2WC2 A;  2XF5 A;  2X1C A;  5FLX K;  5J6X A;  4AIH A;  1YW8 A;  4IHY A;  1QRY A;  3EQL F;  2LRE A;  3FXR A;  4IJA A;  3MAJ A;  2V1X A;  3FIS A;  1EKE A;  1JT6 A;  4U0V A;  4MFE A;  3GWZ A;  3HEF A;  2PBI A;  3HRM A;  5DD8 A;  1MNE A;  4F92 B;  4BNC A;  2QBY B;  4R8H A;  4E7L A;  3R0J A;  3ECO A;  3FF5 A;  4IHX A;  5FD6 A;  3AL0 C;  1OR7 C;  2DOD A;  1P4W A;  2DN0 A;  2X9D A;  4JNN A;  4PZJ A;  3I64 A;  4EVI A;  4IQJ A;  3J7A Y;  4XID A;  3O8G A;  4ZTF A;  2B0L A;  3P9I A;  5FGM A;  4BDZ A;  1S5L C;  3SHF A;  3AFH A;  4LFU A;  1Q1H A;  2ZSH B;  4PFO A;  4BHB A;  3EUA A;  1HA8 A;  2JN6 A;  2ZFU A;  1CGP A;  1J75 A;  3EUK L;  3E7L A;  4CXF A;  4ZDO A;  3EUP A;  2DPU A;  3HOW J;  1IJW C;  3BTC A;  2RAS A;  3RZO J;  1MJB A;  1YW7 A;  2VJJ A;  4HYE A;  5DS9 A;  4BH9 A;  1DU6 A;  1BI0 A;  1QVT A;  4F91 B;  2PMZ A;  5K7Z A;  5DV5 A;  3HOV J;  3J81 Z;  2K7L A;  3ULQ B;  5M3M J;  1RR7 A;  2H8R A;  4AF5 A;  3BJ6 A;  5FFX A;  3WTT C;  4RLF A;  1BC7 C;  3S3M A;  3MKZ A;  3WHB A;  3BJO A;  2KIQ A;  1Z91 A;  4D5C A;  2DT5 A;  2L54 A;  1P9Q C;  2DDB A;  1WJB A;  4XK4 A;  2LY2 A;  1Z0X A;  3QAH A;  4E7K A;  1R7J A;  4UXN A;  2O8K A;  5EEG A;  2ESH A;  4AYB A;  1ZR4 A;  2JK3 A;  3ERM A;  2DA4 A;  2FU4 A;  3VOK A;  1S72 I;  3D5L A;  2QSG X;  2K9S A;  2UWM A;  2WAQ A;  3G3Z A;  1OR7 A;  4B47 A;  1T08 B;  3JR9 A;  2A6T A;  1OQY A;  4S04 A;  4Y17 A;  5D5U B;  4BXX J;  1D1A A;  1IN7 A;  4I98 B;  2JQ7 A;  1WJE A;  5D4S A;  5CQE A;  3RI4 A;  4ESB A;  3HKZ N;  3BG6 A;  1MD0 A;  3QYB A;  4A3K J;  4OMY A;  2VC1 A;  1EF4 A;  1SFX A;  2OAZ A;  2F4O B;  4K2E A;  3IRQ A;  3GFL A;  1D0Y A;  4BQQ A;  4Y4R A;  3V7R A;  4LG0 B;  3BCB A;  4GGG A;  2OCC H;  2O0Y A;  4HBL A;  1WJA A;  3GFM A;  2GXG A;  4I09 A;  1XD7 A;  4BBR J;  2CJJ A;  2WY8 Q;  1T95 A;  2W4S A;  5LLQ A;  3A01 B;  3KKC A;  4H4K C;  1BI3 A;  1KU3 A;  1SD7 A;  2YVH A;  4I6Z A;  3B73 A;  4RAG A;  3E0J B;  1TQI A;  2IA0 A;  3O2P E;  3J81 K;  2JT1 A;  1HDP A;  2GLO A;  3L09 A;  3QQA A;  1TWG J;  3W3C A;  4JQF A;  2VBZ A;  2PQ8 A;  5E3L A;  4UUS B;  4GCT A;  1ZK8 A;  3CP2 A;  2L7F P;  4IKF A;  1E0E A;  2QGU A;  1R00 A;  2JPC A;  1JKP C;  5LHI A;  3DEU A;  1WKM A;  1N78 A;  2G7S A;  2DU9 A;  3E97 A;  2WAD A;  3JRF A;  1HCR A;  3OYC A;  2BW3 B;  2HZT A;  5DCF A;  4RGX A;  3BR1 A;  2L0K A;  4LIU A;  1AU7 A;  4N4N B;  1FYM A;  4IRV A;  2AS5 F;  4A3D J;  3BR2 A;  5F0F A;  2K02 A;  2REK A;  3DXJ F;  2FNA A;  2OZU A;  2DMT A;  2ELH A;  2HR3 A;  2NVT J;  3WTS C;  3TL4 X;  1K61 A;  5HVQ C;  1I27 A;  4E7J A;  2ELK A;  2VB6 A;  4EM0 B;  2V1U A;  5E3O A;  3K4M A;  2OU2 A;  1ZLK A;  5FFZ A;  1U5T A;  4B09 A;  1SGM A;  1SMY F;  2F5V A;  5LGT A;  3MEX A;  2PN6 A;  1IXR C;  4IHV A;  3GZI A;  2QEX I;  3S15 J;  2BXZ A;  1BJA A;  3HHH A;  3OS1 A;  2FJI 1;  3L2R A;  4P96 A;  3QPT A;  4OIO F;  1SFU A;  3KYC B;  4DNC A;  3CUQ A;  3GW2 A;  1LE8 B;  4G94 A;  1IV6 A;  2HQR A;  2MW8 A;  4BE0 A;  1ZKG A;  2NNN A;  1ITY A;  1H9T A;  2AHQ A;  2ZFW A;  1QZY A;  2MC4 A;  2XVC A;  2L5Q A;  4KIG A;  4HF1 A;  3O60 A;  1E3P A;  4W97 A;  5HNF A;  2XAQ A;  4HX7 A;  2KL4 A;  5BPD A;  3ZQQ A;  3S1Q J;  4IRG A;  2DOE A;  3T8R A;  4YFK F;  5FJ8 J;  3LAJ A;  2EFO A;  2RV8 A;  2UXP A;  3RD3 A;  3FBI B;  4OAZ A;  4A69 C;  4F3Q A;  1HDD C;  2DT6 A;  4U87 A;  4FQG A;  5H2F C;  3SEQ A;  3FM3 A;  1WVR A;  2CW7 A;  3VUQ A;  2YPR A;  2BY3 A;  3M7G A;  1IO2 A;  5F1R A;  2HQN A;  2A05 A;  3SEZ A;  3SFZ A;  2UXU A;  1U9O A;  2YU3 A;  4AIJ A;  5HDN A;  4ME9 A;  3HIM A;  2XDV A;  3GTP J;  5DDG A;  1EH8 A;  2MH9 A;  2QCO A;  3RKX A;  5LRR A;  3VSK A;  4A0X A;  2LYC A;  1R5H A;  2WAF A;  4KIT B;  1Z3X A;  5IT9 Z;  4LGW A;  1RKT A;  4GFB A;  2KHM A;  1U6G A;  5D4R A;  2E34 A;  4PSW A;  2LLK A;  1VQ8 I;  5HBU A;  5GTI C;  1B8I B;  3ZR8 X;  2BYV E;  2PJR A;  3EET A;  3TO9 A;  4P9F A;  3PAS A;  2RVC A;  3H3Z A;  4F55 A;  1CF7 B;  1TBX A;  3HRT A;  4A0Z A;  1ON2 A;  1TZL A;  2W84 A;  4X1E A;  5KAF C;  2CFO A;  4FCY A;  2IPQ X;  2OBP A;  1IN8 A;  1MJA A;  1FOW A;  4U0Y A;  3IH3 A;  3AG2 H;  3CCM I;  2O5R A;  2ZJP F;  4EGY A;  4HX8 A;  3MWM A;  2COM A;  3IAM 2;  5FLM J;  3LSP A;  1O3Q A;  2X1E A;  4XLH A;  3NRG A;  1WHU A;  3K6G A;  1G3S A;  1MMD A;  3LQR A;  4HW0 A;  2WUI A;  1Z6T A;  5CVR A;  4G6Q A;  1XMX A;  1IF1 A;  5JVG F;  5L3B A;  3BG9 A;  5IYC J;  3KET A;  3R61 A;  2IGK A;  1Z21 A;  2Y30 A;  2K86 A;  2K4J A;  4BJT A;  4I02 A;  2NP3 A;  3WU2 C;  2DDA A;  5GPC A;  4AWX B;  4RGU A;  2XF6 A;  1IGN A;  3H5A A;  2HTJ A;  2R93 J;  4XSZ F;  2ZY9 A;  1OMI A;  4PJ0 C;  1YIJ I;  1W1W E;  3AL0 B;  2ZXH A;  2DA6 A;  2VI6 A;  2ZXJ A;  1A04 A;  1FP2 A;  4HF2 A;  2Z1D A;  2ZJR F;  2UXH A;  4MTD A;  2IA1 A;  1V54 H;  1NK2 P;  3TP3 A;  5JHF A;  1ACI A;  4U7D A;  1S7O A;  4M9Z A;  2CGP A;  1I50 J;  5M5W J;  4CCL A;  2TCT A;  3TW6 A;  2DTR A;  2KIU A;  4JOM A;  4WWC A;  2Y2Z A;  2H6B A;  3ZPL A;  2ZJ2 A;  5TIS C;  1BR1 A;  1B72 B;  2BY1 A;  2L01 A;  1OCR H;  3Q0V A;  2VC0 A;  2VOP A;  3A0B C;  2CUJ A;  3OIQ A;  4CZZ A;  4V2G A;  2ZCN A;  1R23 A;  2CQX A;  3ISP A;  1XG1 A;  1H89 C;  2MG4 A;  3G1O A;  3S16 J;  4AM3 A;  2RRE A;  5J4Y A;  4M6X A;  4ZJZ A;  3DU6 A;  5EF6 A;  5H9T A;  1F36 A;  1TW3 A;  3NWS A;  4PSX A;  1MBH A;  3VWB A;  3ROU A;  4I01 A;  2CWE A;  2LKP A;  3RDI A;  3MKY B;  5FKL A;  2B63 J;  4A3F J;  4G7H F;  1YS6 A;  2P7C B;  2Q0O A;  1YG2 A;  4KN7 X;  2XAF A;  4ZYH A;  4JYK A;  1FWZ A;  2V6C A;  4NNJ A;  2R7F A;  4ZZL A;  4CYC A;  2JA5 J;  2M0C A;  2EFP A;  5F1J A;  3FXK A;  5F0H A;  5C4J J;  4BBS J;  5LGU A;  2ECB A;  2FRH A;  4UB8 C;  2KFD A;  3Q9S A;  1YX3 A;  1WJC A;  1PVE A;  3MFK A;  3I55 I;  1XSD A;  3HTI A;  2FA5 A;  3AG4 H;  4UNO A;  4AID A;  3JRH A;  1P4X A;  2JTV A;  5DUK A;  2V7F A;  3WHC A;  3KP7 A;  4A3G J;  3CDI A;  4KYW A;  5LD2 C;  2FBK A;  1DGW Y;  3C2H A;  3CJD A;  2M2E A;  2XKP A;  1AKH A;  1WQ2 A;  5CXG A;  3GTQ J;  1W5S A;  4NDL A;  3LST A;  3TQN A;  2OZ6 A;  3OYH A;  3WTY C;  4ZYA A;  3GZ5 A;  3LSM A;  2DCE A;  1ERD A;  5D6F A;  4UUT A;  1XGN A;  1A36 A;  4HA8 A;  3OS2 A;  2OUM A;  1ZEL A;  2QBY A;  1X3U A;  3JRD A;  3OYB A;  2A5Y B;  3OIP A;  3DP7 A;  4B44 A;  3DEW A;  5TRD A;  2FUG 2;  2EQR A;  3CDH A;  3PNV A;  1VQ6 I;  1TWF J;  3H5R A;  2CQ7 A;  5HSZ A;  4DZP A;  4HOB A;  1K6O A;  4DOZ A;  3KPH A;  5D8K B;  5JR3 A;  5D5W B;  2XPV A;  1NG7 A;  4ZYG A;  3MMY B;  3F8M A;  3DLA A;  3OYJ A;  4NUB A;  4MQV A;  4B43 A;  1PYV A;  1ZGA A;  3JSJ A;  1WJD A;  3FMR A;  4EAT A;  5E3N A;  5F6F A;  4J19 A;  1J0R A;  1A6I A;  4P5O A;  4A0Y A;  3S2W A;  2R0Q C;  3UNG C;  5ED4 A;  1P4A A;  3H9J A;  4Y52 J;  1LEB A;  2HYF A;  4RM3 A;  4H0E A;  5A2Q K;  1XS9 A;  1I6H J;  3LWJ A;  2ZXW H;  4BHC A;  3DCF A;  2X6Y A;  4C2M J;  3K1N A;  1FIA A;  5GTH C;  3BCA A;  2D1V A;  3H36 A;  1YI2 I;  3HRS A;  2HKO A;  3QOP A;  3E6M A;  1V3F A;  1O7L A;  1YW9 A;  4A2U A;  5IYD J;  1XN7 A;  1B9M A;  2MC3 A;  1ZRD A;  4A3B J;  1HW5 A;  3C2B A;  5K7F A;  3GTM J;  3FXJ A;  4NEL A;  1W0U A;  2IA2 A;  3M1C A;  3P9C A;  3MZH A;  4C2T A;  1R22 A;  3OSG A;  2BOL A;  2XDN A;  4L0Z B;  1WWX A;  2KKO A;  3TDU C;  1T8I A;  2EZL A;  1W7P B;  2XRN A;  2JVH A;  1U8R A;  3BTI A;  5KHD A;  2WV1 A;  4C2U A;  3LSH A;  3E3V A;  3AG1 H;  1ON1 A;  4LG0 A;  3OS0 A;  3BLY A;  2NVX J;  3LA3 A;  2GM4 A;  2LG4 A;  1MDM B;  4ESF A;  2DYS H;  1Y1V J;  1IUY A;  3A02 A;  3CF2 A;  2CUF A;  3ZQF A;  4IHT A;  4UV8 A;  4OIR F;  3A01 A;  5H20 A;  2J5O A;  5BOX A;  1X3Z B;  5FGL A;  3WOD F;  1REP C;  2WB1 N;  2DA2 A;  1R1V A;  4A5N A;  4J00 A;  3PPB A;  1VQ9 I;  4N0B A;  4OIN F;  3K4B A;  2HVQ A;  3J80 Z;  3VEP A;  1Z67 A;  2HFH A;  4UUS A;  3HKZ A;  1IN6 A;  1YS7 A;  3SZT A;  2D45 A;  3VTI A;  2FBQ A;  3BZ6 A;  3HUG B;  4XLA A;  2R7Z J;  1E3H A;  3H92 A;  3U1D A;  1AHD P;  5JFR A;  3F8C A;  2M7A A;  2BW3 A;  4MQ9 F;  3HC7 A;  4XN3 A;  3VYT B;  4LB6 B;  5JHU A;  3ZQC A;  3J7A O;  3HTH A;  2M45 A;  1HKS A;  3QU6 A;  2I10 A;  3CC2 I;  2A61 A;  5B1A H;  3HDD A;  3A2K A;  2V9V A;  4ZDL A;  5K5R A;  2R3S A;  2G9W A;  1ZLJ A;  2DMP A;  1JJ6 C;  3WG9 A;  4I7H A;  2DW4 A;  2ISZ A;  1GT0 C;  4A3C J;  2LTP A;  1ORK A;  2M8E A;  2L4M A;  5EYR A;  1BA5 A;  2VKD A;  1WJ5 A;  4DQ2 A;  1FZP B;  4MXM A;  3GO5 A;  4Y7N J;  2R7R A;  3OYI A;  4JX5 A;  4KMF A;  4XOT A;  3IH4 A;  5FHP A;  2QOP A;  3Q9V A;  3F8N A;  3I54 A;  4HZF A;  3WTW C;  2B3W A;  2GAU A;  2V1N A;  2O3F A;  1MGT A;  3E6D A;  3I59 B;  3KKD A;  1VQL I;  1ETK A;  3CJQ B;  2DG8 A;  3K8P C;  1POG A;  1WCM J;  2ID3 A;  4HG2 A;  1F43 A;  1RPW A;  3REO A;  2P6S A;  1LDD A;  2V9P A;  1LE8 A;  2ESN A;  2K9Q A;  3BDD A;  3RJP A;  3ZN0 A;  3DU5 A;  2VPL A;  2Z99 A;  5DEQ A;  1KYZ A;  3MNL A;  2FMY A;  1YJN I;  3TMO A;  2X0L A;  4FIS A;  2HYT A;  3HBL A;  3JTH A;  3HTU A;  3U21 A;  2QEN A;  3ERE D;  4ZYD A;  2JMW A;  1U3E M;  1E3O C;  4RAZ A;  1DPU A;  3LA2 A;  1JJ8 C;  2NRA C;  4HLX A;  3LQQ A;  1WRJ A;  4IVN A;  4M73 A;  4M6V A;  5GAD J;  4HDU A;  1BI2 A;  1JKO C;  1SD6 A;  2NYX A;  4Q4Z F;  3KP3 A;  5DAJ A;  1UJ8 A;  5TGT A;  4E4H A;  1ZGW A;  2MSY A;  2ZNZ A;  1BW6 A;  2HNH A;  4KT5 C;  3VW0 A;  3EUH A;  4IOA F;  2P5L C;  4ENK A;  3NPI A;  5CKT A;  3WTU C;  4LIT A;  1IXC A;  1VQM I;  1MW7 A;  3TOB A;  2UV1 A;  3ONQ A;  2EIN H;  5FKN A;  4XMY A;  2UXN A;  2L4A A;  3TP0 A;  1B8I A;  2PFV A;  3HOZ J;  1UI5 A;  5AIQ A;  3SWH A;  2Z33 A;  3G1L A;  3OL4 A;  4M3E A;  1L0O C;  4FHT A;  4L5E A;  5IPA A;  5E1W A;  3K4C A;  5F27 A;  5J1R A;  3BQZ A;  1CF7 A;  4BKX A;  5TJJ A;  3VDX A;  5DTD A;  5LEJ A;  3C7J A;  3H3V K;  3LFK A;  3FDY A;  3RKY A;  3HOS A;  1JHF A;  1OLT A;  4MHG A;  5CLS A;  4KDP A;  2JA7 J;  2W48 A;  2X6O A;  5JLW A;  3RIR A;  3ABM H;  3B02 A;  5EGO B;  1P7I A;  4U0W A;  1XMK A;  1R9T J;  2HVS A;  5AQC A;  2HXO A;  2IXS A;  1X1B A;  3KFW X;  4L9J A;  2HEO A;  3NAR A;  1STZ A;  2XB0 X;  1WZ2 A;  1V5F A;  4RA2 A;  1KA8 A;  5CPR B;  2LF7 A;  1VQN I;  5FKO A;  1XC5 A;  2KMU A;  5J40 A;  2CUE A;  2HYG D;  4RB0 A;  1IN5 A;  1TQM A;  5IP6 A;  1I39 A;  3FX3 A;  3DWL E;  2QKM B;  4HST A;  4HLY A;  4EJU A;  3S2D J;  2KJC A;  1KGS A;  3G6E I;  3NEU A;  2QUF A;  2NVY J;  4HQM A;  1U0J A;  2QQA A;  3WE2 A;  2FNP A;  3K9T A;  4CDG A;  3VP5 A;  4II2 A;  4M6Y A;  4WX9 A;  1QBJ A;  2UXI A;  5F04 A;  3I9V 2;  1ZG3 A;  2DK5 A;  4A12 A;  1ZH5 A;  1NG6 A;  1VZ0 A;  2X51 A;  3VOE A;  4YRV A;  2PX9 A;  3CME I;  4XOR A;  2QIB A;  3I53 A;  2DT7 B;  4IXA A;  1X4P A;  2EZK A;  2O8X A;  1TC3 C;  1ZG5 A;  4W1U A;  4BQO A;  1X1A A;  1B1B A;  1FBS A;  3RQ4 A;  4GRI A;  1TWC J;  1NHA A;  3FHN A;  4C9Y A;  4RDU A;  5AON A;  4KFC A;  3M8J A;  3JCU C;  3PQK A;  4TV7 A;  2VPR A;  1B72 A;  4RM2 A;  2EWN A;  5EDN A;  4BS9 A;  2Y0M A;  3C1D A;  3VYU B;  5ICF A;  4BQN A;  3FZV A;  3A0H C;  1WSU A;  2CU7 A;  2YU9 J;  2VXZ A;  2NOG A;  3JRG A;  5FKM A;  4AVZ A;  2HQA A;  1APL C;  5F0C A;  5IOZ A;  4ABZ A;  4KIB A;  4AC0 A;  2PMH A;  1V5E A;  2HYJ A;  1HW1 A;  1P92 A;  1TLH B;  4O5V A;  1DGR M;  3J7Y J;  3DKW A;  3ZN1 A;  3BWG A;  4A5M A;  2MYS A;  3D5R C;  4B4C A;  3IAS 2;  5D8L B;  1ZRE A;  1OYI A;  3G7R A;  4EEF G;  1FJL A;  3KLN A;  3VVX A;  1RET A;  5K5O A;  3V7C A;  1R4N B;  4BAY A;  3LHQ A;  1D3Y A;  2CRG A;  1VQP I;  4B8X A;  3MKW B;  3K0L A;  4KJZ A;  3C2G A;  4BAC A;  1XMA A;  1LPQ A;  1ETQ A;  2ISY A;  5HLT A;  3CD6 I;  1LDK B;  2VKE A;  3HOX J;  2GA2 A;  4KUM A;  5LBQ A;  4HNV A;  1GDT A;  3AQT A;  4C2M A;  1Y8R B;  1UFM A;  4XIC A;  2PMU A;  2E2J J;  1VTN C;  5ILS A;  2I8D A;  2A6E F;  1TNT A;  2MLG A;  2NS7 A;  3BZC A;  1N75 A;  2YX4 A;  2HS5 A;  5B1B H;  4DIQ A;  3QWL A;  3Q5F A;  2BBY A;  4II3 A;  2WY7 Q;  1Z6R A;  2MGQ A;  1UB9 A;  4DYQ A;  1G6N A;  3RCO A;  4A93 J;  4BXU A;  4U9N A;  3M9A A;  4JK1 X;  2V57 A;  2F4M B;  2IGM A;  2ZNY A;  3C18 A;  4LLG F;  1S6L A;  3ZRG A;  4QTR A;  2Z5U A;  4FTH A;  1YRN B;  1A31 A;  3AAF A;  5HS8 A;  2LH9 A;  4Q47 A;  1O4X A;  2V6E A;  5EZH A;  1MH4 A;  1GVJ A;  1LB2 A;  2HGC A;  3MKL A;  4LLL A;  2XC7 A;  2ZME C;  2R4G A;  2EV5 A;  1QHG A;  1IXS B;  1IRZ A;  4CGR A;  2YVE A;  2YUS A;  1ZAO A;  3AG3 H;  3QRF F;  1BR4 A;  3ZQG A;  2P0W A;  1I3A A;  1K6Y A;  2L9S A;  4WK8 F;  3M8F A;  1TW2 A;  4G7Z F;  3CO7 C;  1WJF A;  3FK7 A;  1FBQ A;  3DLL F;  3COL A;  1Y0U A;  1XSV A;  4D0P A;  5BQT A;  2ZOZ A;  2IP2 A;  2E1N A;  4BJ6 C;  4CYD A;  2WWY A;  3HGY A;  2QLZ A;  1DDN A;  4F7Z A;  5EG0 B;  1OCO H;  1Q1V A;  2QWW A;  1T38 A;  3OOU A;  3F22 A;  3C3W A;  2DOA A;  3MVP A;  2QQ8 A;  1PP7 U;  1I5Z A;  1FSE A;  5DM6 F;  2Z16 A;  3LSR A;  2YSR A;  2V79 A;  1BN5 A;  1V55 H;  2P6T A;  4OD4 A;  3I5U A;  2KIF A;  3ABU A;  3ABK H;  4M71 A;  4YII A;  1H88 C;  5KNL A;  2JA6 J;  3S2H J;  3P9K A;  2BE5 F;  3F3X A;  2EIM H;  4E6K G;  2RGV A;  5EEA A;  3M07 A;  1E2X A;  3FWE A;  3PSF A;  2RN7 A;  1LVK A;  2BVL A;  1ZYR F;  4HX4 A;  4LMY A;  4LB5 A;  1OKR A;  1Z1D A;  2F07 A;  2FJ1 A;  1G3W A;  3I71 A;  3V8J A;  5IOY A;  1V5G A;  5DD4 A;  3PIP F;  1FYK A;  1EH7 A;  3S1R J;  3L2Q A;  1K78 B;  3CCQ I;  2R7Q A;  2CO5 A;  4XRS A;  4GFL A;  4HV6 A;  3CWR A;  3RKW A;  4EJO A;  1SAN A;  2UUZ A;  1MSE C;  2VOD A;  2P7V B;  2FQ4 A;  3FMQ A;  4BE1 A;  1I1S A;  5EZG A;  3DPJ A;  2CW8 A;  4BY7 J;  1OCT C;  3HHG A;  2F5E A;  2Q2E B;  4JP0 A;  4PFP A;  4AU7 A;  5CVV A;  1S29 A;  2C6Y A;  5FRO A;  2M5W A;  2W1O A;  1YIT I;  1LDJ A;  2VQH A;  4LOC A;  3QP5 A;  2ZJQ F;  4NC8 A;  4AD9 A;  2JA8 J;  5D19 A;  4CO8 A;  2RQQ A;  2OTL I;  5GAH J;  1W7P A;  4B1R A;  2UZK A;  5D1R A;  3QYF A;  4XLC A;  2VBX A;  2A68 F;  3X2Q H;  3F6O A;  1OJL A;  3S1N J;  2Z2S B;  1G8X A;  1UG2 A;  4HDV A;  1FX7 A;  3S17 J;  2PLY A;  3LSI A;  1R5G A;  2ZC2 A;  4ZDP A;  4R79 A;  1MDM A;  1BW5 A;  4XRF A;  2XGC A;  3M8E A;  4LK1 F;  2YR2 A;  1HKQ A;  5IT9 K;  3KIO A;  1E17 A;  3CJT B;  1SD5 A;  2XRL A;  3GEZ A;  3LSK A;  3SZP A;  3RKQ A;  2R7X A;  3CCY A;  2EIJ H;  2G7L A;  4LLN A;  4HNU A;  3BQY A;  2HOS A;  2QQ9 A;  4KNY A;  4A6E A;  1J2X A;  2VKV A;  3HUG A;  4ON0 A;  1EV7 A;  2IVM A;  4L5I A;  5CVJ A;  1W36 C;  4KA4 A;  2QQB A;  3OWT A;  3KP2 A;  1L3L A;  1RUN A;  1UI6 A;  2RQP A;  1GLN A;  3C07 A;  3ZQL A;  3E5U A;  2HQ5 A;  3F72 A;  5B3S H;  1R6R A;  2DFF A;  1GXQ A;  3BG5 A;  5BNG A;  2WB1 A;  2JRM A;  3BR3 A;  3G56 A;  2CW0 F;  4A3L J;  2CS3 A;  1J9I A;  2AQE A;  4BU2 A;  3H35 A;  3L1P A;  1OYW A;  2A5W A;  2HKU A;  3HSF A;  2KDO A;  1VF9 A;  1LUJ B;  3DPU A;  3Q0W A;  4UVC A;  1OYY A;  1XSX A;  3AKZ A;  3R6S A;  2CG4 A;  5M5Y J;  3T8T A;  2CH0 A;  4EMS A;  2L9R A;  2LVS A;  1IRG A;  1TT5 B;  3GTG J;  1T33 A;  2D1H A;  3QOD A;  2XPW A;  2Z3Y A;  2XAS A;  2H94 A;  2GBY A;  3ANG A;  2G7U A;  3I59 A;  1XB4 A;  2HOA A;  1WI3 A;  2GUH A;  3VW1 A;  5F08 A;  4PJJ A;  3F21 A;  3WE3 A;  4D5F A;  3HZJ A;  3QPS A;  4PDK A;  1W7P D;  2IRF G;  3KZZ A;  4CCM A;  3N05 A;  4RB3 C;  2VL8 A;  2O7O A;  4EM2 A;  1RI7 A;  2XGE A;  2XKO A;  3BP8 A;  2RC4 A;  2P8T A;  1VQ5 I;  2Y0S N;  4YFN F;  3AQS A;  3K4N A;  4IHS A;  1XDS A;  2COB A;  2IU5 A;  4GFK A;  2HDW A;  2QTQ A;  1FEX A;  5C4X J;  3JRE A;  2EPF A;  2E2I J;  1K7A A;  2OA4 A;  3JAM Z;  3L00 A;  2CQN A;  4IX7 A;  2KIM A;  2DA1 A;  3F23 A;  3KZI C;  1UAA A;  2CQK A;  5KAI C;  3RSN A;  4D9J A;  2KQR A;  3ON2 A;  5HAW A;  3QYE A;  4XKB A;  2L7K A;  4M74 A;  1Z7U A;  4XOP A;  1MMA A;  3ABL H;  3ZMZ A;  3L2W A;  4IL6 C;  1QQI A;  3JRB A;  5HS9 A;  2FBI A;  4R1H A;  2Q1Z B;  1MMN A;  2ZO4 A;  4UUV A;  3BC8 A;  3I4M J;  2R92 J;  3GTO J;  4KT6 A;  5M5X J;  2VN2 A;  4RAF A;  4BL0 B;  2DG7 A;  2AXT C;  5J1Y A;  3VOX A;  4AIK A;  2XPU A;  1YFH A;  4MEY F;  3T5X A;  2HOE A;  2E1M B;  2R5Y B;  2EV0 A;  2JVG A;  3GFJ A;  2RDP A;  4RGR A;  2QM3 A;  1MNM C;  1R1U A;  3U1K A;  3VW2 A;  5K5Q A;  4E7I A;  2YX7 A;  4KMU X;  3V78 A;  3JTG A;  4EJW A;  2FD5 A;  3VYR B;  3F6V A;  3BCG A;  2FML A;  2VE8 A;  3FRQ A;  2XAU A;  3HL2 A;  4Q5S F;  4EGZ A;  2X6X A;  2QA4 I;  1IDZ A;  3ZOB A;  2NAZ A;  2Y75 A;  2O03 A;  3FXO A;  3K10 A;  1JTX A;  2W24 A;  4S05 A;  3DFG A;  5EGO A;  1YQA A;  3GME A;  1ZAR A;  2Y9Y A;  1ODD A;  3W6J B;  3PM1 A;  2OV7 A;  1KU2 A;  3RPQ A;  4BGD A;  1XGS A;  2P81 A;  3JAM K;  1G59 A;  3SXY A;  2OPT A;  1EJ9 A;  3I4N J;  3BOQ A;  2RHA A;  3GTJ J;  2WBM A;  5E1X A;  1X2M A;  2VQL A;  4V19 K;  2GQQ A;  2KRH A;  3K1P A;  1FTZ A;  1A6Q A;  1KYW A;  1RR8 C;  5E1Z B;  3SJM A;  2VXD A;  2STW A;  4GCL A;  5J8F A;  3OYF A;  1DP7 P;  3K7A J;  2EB7 A;  3L7W A;  3LAP A;  2B9S A;  3E1S A;  4YG2 F;  2EA4 A;  2XUB A;  3W2V A;  3OYE A;  4IOC F;  1KU7 A;  2DI3 A;  2L9N A;  3VVY A;  2ADU A;  2PG4 A;  1W36 D;  3FKJ A;  2EJR A;  2ZSI B;  4ZH4 F;  2O9L A;  2E5N A;  3IKT A;  3LSG A;  2ZME B;  4XLF A;  3N97 A;  3BJB A;  1FOK A;  1QVU A;  1XPX A;  1K83 J;  3TBI A;  1WFX A;  4EJT A;  3DKX A;  4DYR A;  1CQT A;  4BDY A;  3IUO A;  1SVL A;  2F5D A;  3KZY A;  3L9F A;  3A03 A;  3IWF A;  4UVB A;  3W6K B;  3FHZ A;  3UKG A;  2F4I A;  2XGX A;  4ASN A;  1X1P A;  4MK6 A;  4JX4 A;  5KVR A;  2M3A A;  4HQE A;  3M4O J;  2V9K A;  3FXU A;  1NH3 A;  3KNW A;  3TW7 A;  4M3D A;  1N25 A;  2ELJ A;  4OIQ F;  2KDZ A;  2IS4 A;  3PQJ A;  1S8N A;  2GWR A;  2DLL A;  3BNI A;  2LF8 A;  5B5E C;  4FE4 A;  2BGC A;  3WGG A;  3S3N A;  1J5Y A;  2JA2 A;  2GXB A;  3FKI J;  1YX5 A;  1HSJ A;  2IEK A;  1WPK A;  1MBF A;  1RNL A;  1J7K A;  5L3C A;  1LFU P;  4YFX F;  2BY0 A;  2K9M A;  1UMQ A;  2F6C A;  3CCR I;  2QKO A;  5LHG A;  2ZXI A;  3IC7 A;  2HWV A;  4Q48 A;  5J1U A;  5CW8 A;  3NAU A;  5CXI A;  2IAI A;  1R36 A;  2EIL H;  2KRF A;  4G12 A;  3M3Y J;  2W25 A;  2FF4 A;  2LBF B;  3CCE I;  1BM9 A;  3GEU A;  3JRI A;  1R4M B;  3K70 C;  2DMQ A;  3FK6 A;  4MFD A;  1F1Z A;  2VQG A;  1YE9 A;  2CUZ A;  4BYY A;  1Z05 A;  2KZV A;  4E7Z A;  5ICE A;  3HTS B;  3PNT A;  1W5T A;  2W00 A;  1SEU A;  3JRA A;  3ESW B;  4IEJ A;  4ACI A;  3BR0 A;  1U9N A;  4F52 A;  3GLX A;  2CV0 A;  1BI1 A;  3K4L A;  2XSD C;  2VQC A;  3ZMT A;  3S1M J;  1BOA A;  3FXQ A;  1JI8 A;  5FB2 A;  4CH7 A;  4U7B A;  3IP4 B;  2OF7 A;  3VB2 A;  1HQC A;  4GCK A;  2L02 A;  2E60 A;  4D7M A;  2F5C A;  3E6B A;  4KWA A;  3IUV A;  1AWC A;  1XTA A;  1Z9C A;  2LOO A;  4NN1 A;  4YZE A;  1FOY A;  1QNT A;  1UHW A;  2VJ4 A;  3MZY A;  2JSC A;  2QZ8 A;  4XLN F;  1TP4 A;  1X3W B;  2J5P A;  3VYS B;  3V4G A;  2KP6 A;  4Z6Y A;  2GEN A;  2GIZ A;  2E36 A;  2YS9 A;  4C3H J;  1XDU A;  3QPH A;  2Z9O A;  4Y3O A;  2EFQ A;  2R7S A;  3CLO A;  5GAE J;  1JGS A;  1FIP A;  2O61 A;  1A5J A;  1G3Y A;  2STT A;  1QPM A;  3K1M A;  4Y13 A;  3GYH X;  1S7A A;  2BHY A;  1HXD A;  1XGO A;  3OV8 A;  5FLX Z;  2N8G A;  4IF4 A;  1YRN A;  1LVA A;  1K79 A;  1TNS A;  2IGN A;  4CGZ A;  2DO7 A;  3J80 K;  3RYP A;  2ME0 A;  5BPI A;  4OOI A;  2DXI A;  3PIO F;  4M3F A;  2DOF A;  2NX4 A;  4PCQ A;  3SQN A;  3NNR A;  2LSO A;  3W2A A;  4PJL A;  4E7H A;  5E17 F;  1RKW A;  3V42 A;  3F0C A;  1Y56 A;  3CJR B;  4L9N A;  4CCN A;  1O3R A;  5E3M A;  3LOC A;  3G4S I;  3O8H A;  4ZTJ A;  3BRU A;  2HPM A;  5M3F J;  4JL3 A;  2BVM A;  5LEK A;  1FC3 A;  3DTI A;  1T56 A;  1UG0 A;  2XAH A;  3I0T A;  3LA7 A;  4IZZ A;  5J47 A;  1XCB A;  2AO9 A;  5EG0 A;  1ZG1 A;  2M34 A;  2E7X A;  3OL3 A;  4XQF A;  3J7Z I;  2GA1 A;  1IW7 F;  3I3L A;  4Y15 A;  4OU0 A;  4EM1 A;  1HBX G;  1VQ4 I;  2ZKZ A;  2AQF A;  3ECH A;  2EK5 A;  3LMM A;  3ZQ7 A;  5ICC A;  1Y1W J;  1BR2 A;  5E18 F;  4A3E J;  2OC6 A;  1TL8 A;  3EYI A;  2XIG A;  1ZRC A;  3PJR A;  1I6X A;  2K5C A;  2WGB A;  3GFI A;  3GBG A;  3K4J A;  1QHH D;  3VPR A;  4N4O B;  3ASN H;  3HSR A;  1YTY A;  3BTL A;  3WGH A;  3H9Q A;  3HTA A;  4RBO A;  5KCM A;  1YOV B;  1UST A;  2HVR A;  4PUS A;  1SFE A;  3LWF A;  3COA C;  4UDS A;  3GVA A;  1K78 A;  3IH2 A;  4AUX A;  4KN4 X;  1T0F C;  3VIB A;  3OYK A;  1AA7 A;  1MBJ A;  2KRC A;  2HU9 A;  4HEA 2;  5J3L A;  5IYB J;  3JW4 A;  1KU9 A;  1PUF B;  1PDN C;  1QU3 A;  2JSP A;  4Z2Y A;  3S8P A;  2XHK A;  5HOO A;  1QZZ A;  2PJP A;  2Q2E A;  3S5R A;  3TED A;  4GO1 A;  3BG3 A;  2GFN A;  3QP6 A;  2IS2 A;  2NXN B;  5K7H A;  2HDD A;  1ZGJ A;  3DKY A;  4B3X A;  3B6C A;  1IRX A;  2ICW G;  5FRM A;  1H0M A;  3R0A A;  3P5J A;  3OOP A;  2OI8 A;  2A3S A;  2LNB A;  4IQ4 A;  3V8K A;  1P2F A;  3H0G J;  2E1O A;  1P6R A;  2HI3 A;  3K70 D;  2FOK A;  3CP8 A;  3RPU A;  3GZ6 A;  2R7T A;  1FP1 D;  4CSW A;  3MN2 A;  2BY2 A;  2JUC A;  5L3D A;  1DP3 A;  1T98 A;  3F1B A;  4CCJ A;  1HST A;  4GXO A;  4B3A A;  3CMA I;  3DBL B;  1ENH A;  4BJ5 C;  1D5V A;  1Z77 A;  4BEH B;  4I2O A;  2VJ5 A;  4RLQ A;  2M4G A;  1FBU A;  2DA3 A;  1SAX A;  4NC7 A;  3V6G A;  2ZCW A;  3PFI A;  4QPQ A;  2FE3 A;  1Y8Q B;  4ZYE A;  4OAY A;  2VBW A;  4ENM A;  5HNH A;  3CQZ J;  2D2W A;  2O7T A;  3KP5 A;  1JKQ C;  1DU0 A;  3KE2 A;  2QWT A;  2RAE A;  3M1E A;  1T0F A;  1W5C C;  1OPC A;  5J8C A;  1RES A;  1O7F A;  4XLP F;  3WG7 H;  2D5V A;  1IV8 A;  4IPA A;  2EBI A;  4DJA A;  3OYM A;  3TO7 A;  2V26 A;  1O3S A;  1QGP A;  1SVO A;  4QLC U;  1U2W A;  3HG9 A;  2G0E A;  3CTA A;  4GYG A;  2LY9 A;  1OFC X;  3G2B A;  4YEJ A;  1JUM A;  4HSR A;  4C3I J;  3HGG A;  4LK0 F;  4QPO A;  2HOT A;  3DEE A;  3DTK A;  2YVX A; 
#chains in the Genus database with same CATH homology
 3ZQH A;  3ON4 A;  4LOC A;  2JA8 J;  5D19 A;  3JRD A;  4X6A J;  4B1R A;  5D1R A;  3CRJ A;  5C3E J;  9ANT A;  3DEW A;  2DA5 A;  2EQR A;  1ETW A;  1OJL A;  3S1N J;  1UG2 A;  3HOY J;  4C3J J;  3S14 J;  1BL0 A;  1TWF J;  3S17 J;  4CYC B;  5HSZ A;  4DZP A;  2LP0 A;  1BW5 A;  1MBE A;  4DYC A;  1JKR C;  2XGC A;  1ETV A;  2XPV A;  4PXI A;  5EFY A;  2L7M P;  3GTL J;  3Q3S A;  3JSJ A;  2XRL A;  1VI0 A;  2R5Z A;  1GVD A;  3RKQ A;  5E3N A;  4J19 A;  1U78 A;  2LK2 A;  3CCY A;  1A6I A;  3LNQ A;  2R0Q C;  3B6A A;  2G7L A;  1HLV A;  2M8G X;  4Y52 J;  3BQY A;  2HOS A;  5GP9 A;  2VKV A;  1XS9 A;  1SFO J;  1I6H J;  3BR5 A;  2LD5 A;  3LWJ A;  3DCF A;  1IDY A;  2NVQ J;  4C2M J;  3G1M A;  1FIA A;  1G2H A;  5FMP A;  1ZQ3 P;  1UI6 A;  1IUF A;  5FKK A;  3HTJ A;  3C07 A;  3ZQL A;  1AKH B;  2HQ5 A;  5IYD J;  3BG5 A;  2LR8 A;  5BNG A;  3BR3 A;  4XRS G;  3JRC A;  3G56 A;  4IHY A;  1QRY A;  4A3L J;  4A3B J;  3C2B A;  3W6V A;  5K7F A;  3FIS A;  3GTM J;  1JT6 A;  3L1P A;  2LFB A;  4MFE A;  4NEL A;  1W0U A;  3HE0 A;  2HKU A;  3HEF A;  3HB9 A;  3OSG A;  2XDN A;  3LJL A;  1VF9 A;  1U8B A;  2G3B A;  3Q0W A;  4QSH A;  3PO2 J;  2R5Y A;  4IHX A;  2EZL A;  2DN0 A;  1S7E A;  2X9D A;  4JNN A;  5M5Y J;  3T6N A;  3BTI A;  2L9R A;  2LVS A;  3GTG J;  2WV1 A;  1T33 A;  4XID A;  3O8G A;  2XPW A;  5C4Y A;  2NVX J;  2GBY A;  3ANG A;  2HOA A;  2GM4 A;  1WI3 A;  1WH5 A;  2GUH A;  5F08 A;  4BY1 J;  3VW1 A;  1Y1V J;  4D5F A;  2ECC A;  2JN6 A;  3A02 A;  3QPS A;  2CUF A;  3ZQF A;  3E7L A;  1ZR2 A;  3EUP A;  3A01 A;  3HOW J;  5FGL A;  1IJW C;  3BTC A;  2KT0 A;  2RAS A;  2WB1 N;  3RZO J;  2DA2 A;  2O7O A;  3K2A A;  2XGE A;  3PPB A;  1WH7 A;  2R5Z B;  2Y0S N;  5DS9 A;  3AQS A;  1DU6 A;  1GUU A;  1QVT A;  2COB A;  2IU5 A;  4UUS A;  2QTQ A;  4GFK A;  3HOV J;  5HOD A;  2L7Z A;  5K7Z A;  2JWT A;  1FEX A;  5C4X J;  4MLO A;  3JRE A;  5M3M J;  2FBQ A;  1RR7 A;  2E2I J;  2HXI A;  1JGG A;  2H8R A;  1TWA J;  4AF5 A;  2DA1 A;  3WHB A;  3ON2 A;  5HAW A;  2R7Z J;  4D5C A;  4M3G A;  3HOU J;  1AHD P;  4XK4 A;  2H1K A;  1Z0X A;  3JRB A;  3ZQC A;  2O8K A;  3HTH A;  1ZR4 A;  4HKU A;  2JK3 A;  2DA4 A;  1NTC A;  2I10 A;  2R92 J;  3GTO J;  3I4M J;  3VOK A;  5M5X J;  3HDD A;  2K9S A;  5C44 J;  2LKX A;  2DG7 A;  3EGQ A;  3JR9 A;  2DMP A;  1JJ6 C;  5J1Y A;  1D5Y A;  3VOX A;  4BXX J;  2XPU A;  1GT0 C;  4A3C J;  2LTP A;  1ORK A;  5EYR A;  1BA5 A;  3CMY A;  2EZH A;  4MO7 A;  4MXM A;  2R5Y B;  4Y7N J;  3HKZ N;  2PMZ N;  4A3K J;  4JX5 A;  1MNM C;  4QIW N;  3IH4 A;  1EF4 A;  2QOP A;  5FHP A;  3VW2 A;  3V78 A;  2ME6 A;  2FD5 A;  3BCG A;  3KKD A;  2ZOY A;  1ETK A;  2DG8 A;  3FRQ A;  1POG A;  1WCM J;  2D6Y A;  2ID3 A;  1F43 A;  4BBR J;  1RPW A;  2CJJ A;  1LE8 A;  1IDZ A;  4AC6 A;  2K9Q A;  3ZOB A;  4AYB N;  1P7J A;  3A01 B;  3KKC A;  1JTX A;  1BJZ A;  1GV5 A;  3D1N I;  2YVH A;  3MNL A;  5EGO A;  4I6Z A;  2Y9Y A;  2WAQ N;  3PM1 A;  1HDP A;  4FIS A;  2GLO A;  2W53 A;  2P81 A;  1TWG J;  3QQA A;  3HBL A;  1VFC A;  3I4N J;  2OPT A;  2HYT A;  5E3L A;  4UUS B;  2RHA A;  4GCT A;  1ZK8 A;  3GTJ J;  2JMW A;  1X2M A;  1ZTR A;  2L7F P;  1E3O C;  1JJ8 C;  1FTZ A;  5JLX A;  4GCL A;  1JKP C;  3SJM A;  4IHW A;  3K7A J;  2G7S A;  4M6V A;  3JRF A;  1HCR A;  2UXO A;  3VVY A;  4A3J J;  1JKO C;  5FLV A;  2ZCM A;  3BR1 A;  5IP9 J;  1MBK A;  1MH3 A;  2O9L A;  3CDL A;  2L0K A;  5DAJ A;  1AU7 A;  4A3D J;  3BR2 A;  3LSG A;  1ZGW A;  5F0F A;  2MSY A;  2REK A;  3VW0 A;  1BW6 A;  3BJB A;  2DMT A;  1MSF C;  2NVT J;  1K61 A;  1QVU A;  2ELK A;  3E7Q A;  3NPI A;  1K83 J;  5IP7 J;  1HOM A;  4DYR A;  1CQT A;  2E19 A;  5E3O A;  2NS8 A;  5FKN A;  1H8A C;  3A03 A;  3UKG A;  1SGM A;  3QBM A;  3TP0 A;  1B8I A;  4MK6 A;  4L62 A;  3HOZ J;  4JX4 A;  3M4O J;  4IHV A;  1UI5 A;  3GZI A;  3S15 J;  3KNW A;  3G1L A;  3TW7 A;  4M3E A;  1FTT A;  4L5E A;  4M3D A;  5IPA A;  5F27 A;  5J1R A;  4A3I J;  2DTZ A;  3BQZ A;  2KDZ A;  4BKX A;  3H3V K;  5DTD A;  4MIM A;  3SDG A;  2ZB9 A;  3BNI A;  1LE8 B;  3FIW A;  1IV6 A;  4FE4 A;  2MW8 A;  2W48 A;  3HM5 A;  1ZKG A;  2JA7 J;  1ITY A;  2X6O A;  5JLW A;  2AHQ A;  2K9N A;  3FKI J;  5EGO B;  3BR6 A;  1P7I A;  2IEK A;  1R9T J;  1WPK A;  3O60 A;  1MBF A;  4W97 A;  5AQC A;  2HXO A;  1LFU P;  3QPL A;  2QKO A;  1UMQ A;  2M9H A;  3S1Q J;  5FJ8 J;  5J1U A;  2JJ7 A;  5CW8 A;  3NAU A;  5CXI A;  2IAI A;  3NAR A;  4G12 A;  2XB0 X;  3M3Y J;  2OER A;  2UXP A;  4A69 C;  1X2N A;  1HDD C;  3RD3 A;  3GEU A;  3JRI A;  2DMQ A;  3FK6 A;  4MFD A;  3Q0U A;  3VUQ A;  5FKO A;  1XC5 A;  3JRA A;  4IEJ A;  2CUE A;  4ACI A;  3BR0 A;  1U9N A;  2DJN A;  5IP6 A;  2VUM J;  1U9O A;  2UXU A;  1IC8 A;  4ME9 A;  3HIM A;  3IV5 A;  4DW6 A;  2XSD C;  3GTP J;  2Y9Z A;  3S2D J;  2QCO A;  3S1M J;  1ETY A;  2NVY J;  1VND A;  1RKT A;  2OF7 A;  1OCP A;  3VP5 A;  4GCK A;  4GFB A;  1HF0 A;  5F04 A;  4D7M A;  2UXI A;  2LLK A;  5HBU A;  4KWA A;  2K40 A;  3IUV A;  5GPA A;  1B8I B;  4I76 A;  3QKX A;  4NN1 A;  1NK3 P;  4YZE A;  2QIB A;  1ETO A;  3PAS A;  2GEN A;  2EZK A;  4C3H J;  2YS9 A;  1TC3 C;  4W1U A;  3RQI A;  1TWC J;  4RDU A;  1FIP A;  3OIO A;  1A5J A;  4X1E A;  2VPR A;  1B72 A;  4FCY A;  2E2H J;  3B81 A;  5EDN A;  2NP5 A;  2N8G A;  1YRN A;  2CU7 A;  3IH3 A;  2YU9 J;  3VVZ A;  2FX0 A;  2NOG A;  3JRG A;  5FKM A;  1PUF A;  1APL C;  5F0C A;  5IOZ A;  2ME0 A;  5FLM J;  4ABZ A;  3LSP A;  4M3F A;  2Y31 A;  3SFI A;  3NRG A;  2NX4 A;  4AC0 A;  3NNR A;  1X58 A;  1RKW A;  3F0C A;  2DA7 A;  2HYJ A;  2WUI A;  5E3M A;  3LOC A;  4JX6 A;  3O8H A;  3BRU A;  4DZJ A;  3RH2 A;  3P9T A;  3BG9 A;  5IYC J;  5M3F J;  4JL3 A;  1T56 A;  1JT0 A;  2Y30 A;  2AO9 A;  2NP3 A;  5GPC A;  4B4C A;  5EG0 A;  2M34 A;  1IGN A;  3G7R A;  2R93 J;  4EEF G;  1FJL A;  2G7G A;  3VVX A;  1RET A;  3LHQ A;  2CRG A;  2DA6 A;  2VI6 A;  3GTK J;  3RZD J;  1ETQ A;  2XB5 A;  1QPI A;  1Y1W J;  2UXH A;  4A3E J;  2VKE A;  3HOX J;  4HNV A;  1GDT A;  3AQT A;  4FE7 A;  1NK2 P;  3TP3 A;  4XIC A;  2E2J J;  4D7N A;  4V2F A;  2WGB A;  2EZI A;  4M3B A;  1I50 J;  3GBG A;  3VPR A;  3LSJ A;  5M5W J;  3BTL A;  2NS7 A;  2TCT A;  3TW6 A;  3HTA A;  4RBO A;  2Y2Z A;  2MGQ A;  1JTY A;  4DYQ A;  4A93 J;  4UDS A;  1B72 B;  2V57 A;  1I3Q J;  3Q0V A;  3IH2 A;  1UHS A;  4AUX A;  2DMU A;  3VIB A;  4QTR A;  1YRN B;  4FTH A;  1MBJ A;  3NXC A;  5J3L A;  5IYB J;  2IBD A;  4V2G A;  1PUF B;  1O4X A;  2PZ9 A;  5EZH A;  1MH4 A;  4ICH A;  2ZCN A;  5D18 A;  2CQX A;  3MKL A;  1XG1 A;  3PO3 J;  3TED A;  1H89 C;  3S5R A;  2MG4 A;  3BG3 A;  3G1O A;  3BT9 A;  2GFN A;  1IRZ A;  4CGR A;  3S16 J;  2YVE A;  2YUS A;  5K7H A;  2HDD A;  3ZQG A;  3B6C A;  5EF6 A;  5H9T A;  1ETX A;  1F36 A;  1LFB A;  1MBH A;  2PBX A;  1W0T A;  3FK7 A;  5FKL A;  3OSF A;  2OI8 A;  3COL A;  2B63 J;  2ZOZ A;  4A3F J;  3H0G J;  2E1O A;  1GV2 A;  2HI3 A;  2XGD A;  3HGY A;  3MN2 A;  4JYK A;  5EG0 B;  4CYC A;  1Q1V A;  4S0H B;  2ZCX A;  2JA5 J;  2Q24 A;  3F1B A;  3OOU A;  2M0C A;  4B3A A;  5F1J A;  3MVP A;  4XRM A;  5F0H A;  5C4J J;  4BBS J;  3ANP A;  2ECB A;  1ENH A;  1Z77 A;  3LSR A;  4A3M J;  2DA3 A;  3V6G A;  3HTI A;  1MBG A;  2QF7 A;  1H88 C;  2JA6 J;  3KZ9 A;  3S2H J;  1TWH J;  2TRT A;  3CQZ J;  5EEA A;  3JRH A;  2O7T A;  1JKQ C;  1DU0 A;  2QWT A;  2RAE A;  3WHC A;  1RES A;  2DMN A;  2F07 A;  4A3G J;  2FJ1 A;  5IOY A;  2D5V A;  2EBI A;  3S1R J;  3BHQ A;  2M2E A;  3CJD A;  4JKZ A;  2EH3 A;  4XRS A;  1AKH A;  4GFL A;  1IG7 A;  5CXG A;  3CWR A;  3GTQ J;  4NDL A;  1SAN A;  3NI7 A;  1MSE C;  2FQ4 A;  3ZQI A;  2G0E A;  5EZG A;  3DPJ A;  2LY9 A;  1OFC X;  2ID6 A;  1JUP A;  4UUT A;  4BY7 J;  1JUM A;  4C3I J;  1OCT C;  3HGG A;  3BTJ A;  1JUS A;  2CQQ A;  2HOT A;  4JP0 A;  5K58 A;  1WGX A;  2X48 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...