4ME9A

Crystal structure of a transcriptional regulator, tetr family (bce_2991) from bacillus cereus atcc 10987 at 2.50 a resolution
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
188
structure length
188
Chain Sequence
MAKNKQEDIFDAAMQLFAERGYDGTTIPMIAEKAKVGAGTIYRYFENKEALVNSLFSKSMLQLSEMIKTDFPVEANIREQFSHTYNRLFEFARNNVDAFLFTNSHCDSYFLDEQSKKIFDDFIGFFMNIIEDGIVKGLLRPLPPVALIIIVYQPLEKLIKVIATGQLEYSKELVKELEESSWNAIRII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, TetR family
publication title Crystal structure of a transcriptional regulator, TetR family (BCE_2991) from Bacillus cereus ATCC 10987 at 2.50 A resolution
rcsb
source organism Bacillus cereus
molecule tags Transcription regulator
total genus 66
structure length 188
sequence length 188
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF16295 TetR_C_10 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 4me9A00
2WV1A 2DG8A 2HYTA 3RH2A 3LHQA 2F07A 2GFNA 4V2GA 1ORKA 2FBQA 3SFIA 2HKUA 3COLA 2IEKA 2QKOA 4YZEA 3NPIA 3BTCA 4D5CA 3RD3A 1U9NA 1RKWA 5FMPA 5C4YA 4D5FA 4M3GA 2YVHA 2DTZA 2Y30A 5F04A 3KNWA 3VVXA 5F1JA 3ZQGA 4D7NA 2G7LA 3PPBA 3P9TA 2FQ4A 3BCGA 5K58A 3BTJA 2UXHA 4GFLA 2QTQA 5EZHA 3WHBA 2Y31A 3HTIA 4DW6A 4GCTA 3ZQLA 4G12A 2G3BA 3BR5A 3QBMA 2HQ5A 2QOPA 3MVPA 5FKMA 4AC6A 4B1RA 1RPWA 4MXMA 3ZQHA 5F08A 2ID3A 2V57A 3B6AA 5EYRA 2TRTA 3BJBA 4AUXA 4KWAA 3Q0UA 3BQZA 3IUVA 3NRGA 2O7TA 3LSPA 2Q24A 3ZQIA 2HXOA 5H9TA 2WGBA 3SDGA 2XDNA 1QVTA 3ZQFA 2IBDA 4W1UA 3HGGA 4GCKA 3LSRA 3C2BA 2XB5A 3BR6A 3CRJA 3EUPA 2ZB9A 3E7QA 1BJZA 3FK7A 3VIBA 3JSJA 1Z0XA 3QPSA 3BR2A 2D6YA 3B6CA 5D1RA 5FKLA 3HTJA 3ANGA 5F0CA 3BQYA 2OERA 3MNLA 3O60A 4XK4A 3DCFA 5CW8A 3GEUA 2G7GA 5K7ZA 4ACIA 5CXIA 2NX4A 3LSJA 3EGQA 1VI0A 5F0HA 4X1EA 3HGYA 4I6ZA 2ID6A 2QWTA 3HTAA 3AQTA 5F0FA 2ZOZA 5IP6A 1UI6A 5D18A 4V2FA 1T56A 2UXOA 5J3LA 2XPWA 3FIWA 2YVEA 3F1BA 2VKEA 3CCYA 3NXCA 2G0EA 1JUMA 1A6IA 3WHCA 1T33A 3LOCA 3KKCA 3BR3A 3Q0VA 3Q3SA 3CDLA 1QVUA 3BTLA 3LWJA 2RASA 3TP3A 4ICHA 4JYKA 4AC0A 2VKVA 1ZK8A 2ZOYA 2RHAA 3VP5A 3BTIA 4MO7A 3DEWA 2XGEA 3Q0WA 2JK3A 3KKDA 3VW2A 1JUPA 4UDSA 5FKKA 5CXGA 2G7SA 3G56A 5D19A 3F0CA 2UXPA 1ZKGA 3VOXA 2XRLA 3BR0A 3O8HA 4M3FA 1JT0A 4JKZA 5HAWA 3G1LA 2ZCXA 3VPRA 3IH4A 1RKTA 2PZ9A 3VW0A 5K7HA 4M3DA 3VVZA 2NP5A 4M3BA 3S5RA 3V78A 3DPJA 2NS8A 4AF5A 4M3EA 2HYJA 2IU5A 3HTHA 2FX0A 3QKXA 2UXUA 2O7OA 2Y2ZA 5GPAA 3QPLA 3VUQA 2DG7A 2PBXA 3G1OA 2RAEA 4L62A 4ME9A 3CJDA 3KZ9A 1UI5A 3BRUA 2EH3A 3T6NA 2HXIA 3BHQA 5GPCA 3HIMA 1QPIA 3IH2A 3QQAA 5HBUA 1Z77A 3NI7A 2NP3A 4NELA 5HSZA 5FHPA 2ZCNA 4ABZA 4MK6A 5EZGA 4NN1A 3GZIA 5FGLA 2XPUA 1JTXA 4CGRA 5J1RA 3G7RA 3B81A 2GBYA 3ON4A 1SGMA 5J1UA 5J1YA 3ON2A 3BNIA 4B3AA 1U9OA 2IAIA 2NS7A 2OPTA 3TP0A 2WUIA 2VPRA 2X6OA 3HE0A 3VW1A 5IOZA 3C07A 5GP9A 2JJ7A 5FKOA 2FJ1A 2XGDA 2UXIA 4JL3A 5F27A 2GUHA 2FD5A 2X9DA 2I10A 5IPAA 2GENA 5K7FA 5IOYA 1JTYA 2QCOA 3V6GA 3BR1A 3FRQA 4I76A 3PM1A 3IH3A 3VOKA 2QIBA 3FK6A 4W97A 4PXIA 3CWRA 2REKA 4GCLA 4HKUA 3AQSA 2XGCA 3LJLA 4D7MA 1JT6A 3PASA 5DAJA 3NNRA 2OF7A 2OI8A 2ZCMA 4GFKA 5EFYA 2W53A 2XPVA 5AQCA 3BT9A 2TCTA 3O8GA 5FKNA 3ANPA 4JNNA 1JUSA 3G1MA 3VVYA
chains in the Genus database with same CATH superfamily
2WV1A 2DG8A 2HYTA 3RH2A 3LHQA 2F07A 2GFNA 4V2GA 1ORKA 2FBQA 3SFIA 2HKUA 3COLA 2IEKA 2QKOA 4YZEA 3NPIA 3BTCA 4D5CA 3RD3A 1U9NA 4U9NA 1RKWA 5FMPA 5C4YA 4D5FA 4U9LA 4M3GA 2R7TA 4IRVA 2YVHA 2DTZA 2Y30A 5F04A 3KNWA 3KYLA 3K8PC 3VVXA 5F1JA 3ZQGA 3FHNA 4D7NA 2G7LA 3PPBA 3P9TA 2FQ4A 3BCGA 5K58A 3BTJA 2UXHA 4GFLA 3NS4A 2QTQA 5EZHA 3WHBA 2Y31A 3HTIA 2R7VA 4DW6A 4GCTA 3ZQLA 4G12A 2G3BA 3BR5A 3QBMA 2HQ5A 2QOPA 3MVPA 5FKMA 4AC6A 4B1RA 4WIBA 1RPWA 4MXMA 3ZQHA 5F08A 2B1EA 2ID3A 2V57A 3B6AA 5EYRA 2TRTA 3BJBA 4AUXA 4KWAA 3Q0UA 3BQZA 3IUVA 3NRGA 2O7TA 3LSPA 2Q24A 3ZQIA 2HXOA 5H9TA 2WGBA 3SDGA 2XDNA 1QVTA 3ZQFA 2IBDA 4W1UA 3HGGA 4GCKA 3LSRA 2ZY9A 3C2BA 2XB5A 3BR6A 3CRJA 3EUPA 2ZB9A 3E7QA 1BJZA 3FK7A 3VIBA 3JSJA 1Z0XA 3QPSA 3BR2A 2D6YA 3B6CA 5D1RA 5FKLA 3HTJA 3ANGA 5F0CA 3BQYA 2OERA 3MNLA 3O60A 5CQGA 4XK4A 3DCFA 5CW8A 3GEUA 2G7GA 5K7ZA 4ACIA 5CXIA 2NX4A 3LSJA 3EGQA 1VI0A 5F0HA 2R7SA 4OD5A 4X1EA 3VTIA 3HGYA 4I6ZA 2ID6A 2QWTA 3HTAA 3AQTA 5F0FA 2ZOZA 5IP6A 1UI6A 5D18A 4V2FA 1T56A 2UXOA 2YVXA 5J3LA 2XPWA 3FIWA 2YVEA 3F1BA 2VKEA 3CCYA 3NXCA 2G0EA 1JUMA 1A6IA 3WHCA 1T33A 3LOCA 3KKCA 2FJI1 3BR3A 3Q0VA 3Q3SA 2R7UA 4C2MA 3CDLA 1QVUA 3BTLA 3LWJA 2RASA 4OD4A 4ICHA 3TP3A 4JYKA 4AC0A 2VKVA 1ZK8A 2ZOYA 2RHAA 3VP5A 3BTIA 4MO7A 3DEWA 2XGEA 3Q0WA 2JK3A 3KKDA 3VW2A 1JUPA 4UDSA 5FKKA 5CXGA 2G7SA 3G56A 5D19A 3F0CA 2UXPA 1ZKGA 3VOXA 2XRLA 3BR0A 3O8HA 4M3FA 1JT0A 4JKZA 5HAWA 3G1LA 2R7XA 2ZCXA 3VPRA 3IH4A 1RKTA 2PZ9A 3VW0A 5K7HA 4M3DA 3VVZA 2NP5A 2B3WA 4M3BA 3S5RA 3V78A 3DPJA 2NS8A 4AF5A 4M3EA 2HYJA 2IU5A 3HTHA 2FX0A 3QKXA 2UXUA 2O7OA 2Y2ZA 5GPAA 3QPLA 3VUQA 2DG7A 2PBXA 3G1OA 3SWHA 2RAEA 4L62A 4ME9A 3CJDA 2PFVA 3KZ9A 1UI5A 3BRUA 2EH3A 3T6NA 2HXIA 3BHQA 5GPCA 3HIMA 1QPIA 3IH2A 3QQAA 5HBUA 1Z77A 3NI7A 2NP3A 4NELA 5HSZA 5FHPA 2ZCNA 4ABZA 4MK6A 5EZGA 4NN1A 3GZIA 5FGLA 2XPUA 1JTXA 4CGRA 5J1RA 3G7RA 3B81A 4DVYP 2GBYA 3ON4A 1SGMA 5J1UA 5J1YA 3ON2A 3BNIA 4B3AA 1U9OA 3DU5A 2IAIA 2NS7A 2OPTA 3TP0A 2WUIA 2VPRA 2X6OA 3HE0A 3VW1A 5IOZA 2R7WA 3C07A 5GP9A 2JJ7A 5FKOA 2FJ1A 2XGDA 2UXIA 4JL3A 5F27A 2GUHA 2FD5A 2X9DA 2I10A 5IPAA 2R7QA 2GENA 5K7FA 5IOYA 1JTYA 2QCOA 3DU6A 3V6GA 3BR1A 3FRQA 4I76A 3PM1A 3IH3A 3VOKA 2R7RA 2QIBA 3FK6A 2A2FX 4W97A 4PXIA 3CWRA 2REKA 4GCLA 4HKUA 3AQSA 2XGCA 3LJLA 4D7MA 1JT6A 3PASA 5DAJA 3NNRA 2OF7A 2OI8A 2ZCMA 4GFKA 5EFYA 2W53A 2XPVA 5AQCA 3BT9A 2TCTA 3O8GA 5FKNA 3ANPA 4JNNA 1JUSA 2R7OA 3G1MA 3VVYA
chains in the Genus database with same CATH topology
2WV1A 2DG8A 2HYTA 3RH2A 3LHQA 2F07A 2GFNA 4V2GA 1ORKA 2FBQA 3SFIA 2HKUA 3COLA 2IEKA 2QKOA 4YZEA 3NPIA 3BTCA 4D5CA 3RD3A 1U9NA 1RKWA 5FMPA 5C4YA 4D5FA 4M3GA 2YVHA 2DTZA 2Y30A 5F04A 3KNWA 3VVXA 5F1JA 3ZQGA 4D7NA 2G7LA 3PPBA 3P9TA 2FQ4A 3BCGA 5K58A 3BTJA 2UXHA 4GFLA 2QTQA 5EZHA 3WHBA 2Y31A 3HTIA 4DW6A 4GCTA 3ZQLA 4G12A 2G3BA 3BR5A 3QBMA 2HQ5A 2QOPA 3MVPA 5FKMA 4AC6A 4B1RA 1RPWA 4MXMA 3ZQHA 5F08A 2ID3A 2V57A 3B6AA 5EYRA 2TRTA 3BJBA 4AUXA 4KWAA 3Q0UA 3BQZA 3IUVA 3NRGA 2O7TA 3LSPA 2Q24A 3ZQIA 2HXOA 5H9TA 2WGBA 3SDGA 2XDNA 1QVTA 3ZQFA 2IBDA 4W1UA 3HGGA 4GCKA 3LSRA 3C2BA 2XB5A 3BR6A 3CRJA 3EUPA 2ZB9A 3E7QA 1BJZA 3FK7A 3VIBA 3JSJA 1Z0XA 3QPSA 3BR2A 2D6YA 3B6CA 5D1RA 5FKLA 3HTJA 3ANGA 5F0CA 3BQYA 2OERA 3MNLA 3O60A 4XK4A 3DCFA 5CW8A 3GEUA 2G7GA 5K7ZA 4ACIA 5CXIA 2NX4A 3LSJA 3EGQA 1VI0A 5F0HA 4X1EA 3HGYA 4I6ZA 2ID6A 2QWTA 3HTAA 3AQTA 5F0FA 2ZOZA 5IP6A 1UI6A 5D18A 4V2FA 1T56A 2UXOA 5J3LA 2XPWA 3FIWA 2YVEA 3F1BA 2VKEA 3CCYA 3NXCA 2G0EA 1JUMA 1A6IA 3WHCA 1T33A 3LOCA 3KKCA 3BR3A 3Q0VA 3Q3SA 3CDLA 1QVUA 3BTLA 3LWJA 2RASA 3TP3A 4ICHA 4JYKA 4AC0A 2VKVA 1ZK8A 2ZOYA 2RHAA 3VP5A 3BTIA 4MO7A 3DEWA 2XGEA 3Q0WA 2JK3A 3KKDA 3VW2A 1JUPA 4UDSA 5FKKA 5CXGA 2G7SA 3G56A 5D19A 3F0CA 2UXPA 1ZKGA 3VOXA 2XRLA 3BR0A 3O8HA 4M3FA 1JT0A 4JKZA 5HAWA 3G1LA 2ZCXA 3VPRA 3IH4A 1RKTA 2PZ9A 3VW0A 5K7HA 4M3DA 3VVZA 2NP5A 4M3BA 3S5RA 3V78A 3DPJA 2NS8A 4AF5A 4M3EA 2HYJA 2IU5A 3HTHA 2FX0A 3QKXA 2UXUA 2O7OA 2Y2ZA 5GPAA 3QPLA 3VUQA 2DG7A 2PBXA 3G1OA 2RAEA 4L62A 4ME9A 3CJDA 3KZ9A 1UI5A 3BRUA 2EH3A 3T6NA 2HXIA 3BHQA 5GPCA 3HIMA 1QPIA 3IH2A 3QQAA 5HBUA 1Z77A 3NI7A 2NP3A 4NELA 5HSZA 5FHPA 2ZCNA 4ABZA 4MK6A 5EZGA 4NN1A 3GZIA 5FGLA 2XPUA 1JTXA 4CGRA 5J1RA 3G7RA 3B81A 2GBYA 3ON4A 1SGMA 5J1UA 5J1YA 3ON2A 3BNIA 4B3AA 1U9OA 2IAIA 2NS7A 2OPTA 3TP0A 2WUIA 2VPRA 2X6OA 3HE0A 3VW1A 5IOZA 3C07A 5GP9A 2JJ7A 5FKOA 2FJ1A 2XGDA 2UXIA 4JL3A 5F27A 2GUHA 2FD5A 2X9DA 2I10A 5IPAA 2GENA 5K7FA 5IOYA 1JTYA 2QCOA 3V6GA 3BR1A 3FRQA 4I76A 3PM1A 3IH3A 3VOKA 2QIBA 3FK6A 4W97A 4PXIA 3CWRA 2REKA 4GCLA 4HKUA 3AQSA 2XGCA 3LJLA 4D7MA 1JT6A 3PASA 5DAJA 3NNRA 2OF7A 2OI8A 2ZCMA 4GFKA 5EFYA 2W53A 2XPVA 5AQCA 3BT9A 2TCTA 3O8GA 5FKNA 3ANPA 4JNNA 1JUSA 3G1MA 3VVYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WV1 A;  2DG8 A;  2HYT A;  3RH2 A;  3LHQ A;  2F07 A;  2GFN A;  4V2G A;  1ORK A;  2FBQ A;  3SFI A;  2HKU A;  3COL A;  2IEK A;  2QKO A;  4YZE A;  3NPI A;  3BTC A;  4D5C A;  3RD3 A;  1U9N A;  1RKW A;  5FMP A;  5C4Y A;  4D5F A;  4M3G A;  2YVH A;  2DTZ A;  2Y30 A;  5F04 A;  3KNW A;  3VVX A;  5F1J A;  3ZQG A;  4D7N A;  2G7L A;  3PPB A;  3P9T A;  2FQ4 A;  3BCG A;  5K58 A;  3BTJ A;  2UXH A;  4GFL A;  2QTQ A;  5EZH A;  3WHB A;  2Y31 A;  3HTI A;  4DW6 A;  4GCT A;  3ZQL A;  4G12 A;  2G3B A;  3BR5 A;  3QBM A;  2HQ5 A;  2QOP A;  3MVP A;  5FKM A;  4AC6 A;  4B1R A;  1RPW A;  4MXM A;  3ZQH A;  5F08 A;  2ID3 A;  2V57 A;  3B6A A;  5EYR A;  2TRT A;  3BJB A;  4AUX A;  4KWA A;  3Q0U A;  3BQZ A;  3IUV A;  3NRG A;  2O7T A;  3LSP A;  2Q24 A;  3ZQI A;  2HXO A;  5H9T A;  2WGB A;  3SDG A;  2XDN A;  1QVT A;  3ZQF A;  2IBD A;  4W1U A;  3HGG A;  4GCK A;  3LSR A;  3C2B A;  2XB5 A;  3BR6 A;  3CRJ A;  3EUP A;  2ZB9 A;  3E7Q A;  1BJZ A;  3FK7 A;  3VIB A;  3JSJ A;  1Z0X A;  3QPS A;  3BR2 A;  2D6Y A;  3B6C A;  5D1R A;  5FKL A;  3HTJ A;  3ANG A;  5F0C A;  3BQY A;  2OER A;  3MNL A;  3O60 A;  4XK4 A;  3DCF A;  5CW8 A;  3GEU A;  2G7G A;  5K7Z A;  4ACI A;  5CXI A;  2NX4 A;  3LSJ A;  3EGQ A;  1VI0 A;  5F0H A;  4X1E A;  3HGY A;  4I6Z A;  2ID6 A;  2QWT A;  3HTA A;  3AQT A;  5F0F A;  2ZOZ A;  5IP6 A;  1UI6 A;  5D18 A;  4V2F A;  1T56 A;  2UXO A;  5J3L A;  2XPW A;  3FIW A;  2YVE A;  3F1B A;  2VKE A;  3CCY A;  3NXC A;  2G0E A;  1JUM A;  1A6I A;  3WHC A;  1T33 A;  3LOC A;  3KKC A;  3BR3 A;  3Q0V A;  3Q3S A;  3CDL A;  1QVU A;  3BTL A;  3LWJ A;  2RAS A;  3TP3 A;  4ICH A;  4JYK A;  4AC0 A;  2VKV A;  1ZK8 A;  2ZOY A;  2RHA A;  3VP5 A;  3BTI A;  4MO7 A;  3DEW A;  2XGE A;  3Q0W A;  2JK3 A;  3KKD A;  3VW2 A;  1JUP A;  4UDS A;  5FKK A;  5CXG A;  2G7S A;  3G56 A;  5D19 A;  3F0C A;  2UXP A;  1ZKG A;  3VOX A;  2XRL A;  3BR0 A;  3O8H A;  4M3F A;  1JT0 A;  4JKZ A;  5HAW A;  3G1L A;  2ZCX A;  3VPR A;  3IH4 A;  1RKT A;  2PZ9 A;  3VW0 A;  5K7H A;  4M3D A;  3VVZ A;  2NP5 A;  4M3B A;  3S5R A;  3V78 A;  3DPJ A;  2NS8 A;  4AF5 A;  4M3E A;  2HYJ A;  2IU5 A;  3HTH A;  2FX0 A;  3QKX A;  2UXU A;  2O7O A;  2Y2Z A;  5GPA A;  3QPL A;  3VUQ A;  2DG7 A;  2PBX A;  3G1O A;  2RAE A;  4L62 A;  4ME9 A;  3CJD A;  3KZ9 A;  1UI5 A;  3BRU A;  2EH3 A;  3T6N A;  2HXI A;  3BHQ A;  5GPC A;  3HIM A;  1QPI A;  3IH2 A;  3QQA A;  5HBU A;  1Z77 A;  3NI7 A;  2NP3 A;  4NEL A;  5HSZ A;  5FHP A;  2ZCN A;  4ABZ A;  4MK6 A;  5EZG A;  4NN1 A;  3GZI A;  5FGL A;  2XPU A;  1JTX A;  4CGR A;  5J1R A;  3G7R A;  3B81 A;  2GBY A;  3ON4 A;  1SGM A;  5J1U A;  5J1Y A;  3ON2 A;  3BNI A;  4B3A A;  1U9O A;  2IAI A;  2NS7 A;  2OPT A;  3TP0 A;  2WUI A;  2VPR A;  2X6O A;  3HE0 A;  3VW1 A;  5IOZ A;  3C07 A;  5GP9 A;  2JJ7 A;  5FKO A;  2FJ1 A;  2XGD A;  2UXI A;  4JL3 A;  5F27 A;  2GUH A;  2FD5 A;  2X9D A;  2I10 A;  5IPA A;  2GEN A;  5K7F A;  5IOY A;  1JTY A;  2QCO A;  3V6G A;  3BR1 A;  3FRQ A;  4I76 A;  3PM1 A;  3IH3 A;  3VOK A;  2QIB A;  3FK6 A;  4W97 A;  4PXI A;  3CWR A;  2REK A;  4GCL A;  4HKU A;  3AQS A;  2XGC A;  3LJL A;  4D7M A;  1JT6 A;  3PAS A;  5DAJ A;  3NNR A;  2OF7 A;  2OI8 A;  2ZCM A;  4GFK A;  5EFY A;  2W53 A;  2XPV A;  5AQC A;  3BT9 A;  2TCT A;  3O8G A;  5FKN A;  3ANP A;  4JNN A;  1JUS A;  3G1M A;  3VVY A; 
#chains in the Genus database with same CATH topology
 2WV1 A;  2DG8 A;  2HYT A;  3RH2 A;  3LHQ A;  2F07 A;  2GFN A;  4V2G A;  1ORK A;  2FBQ A;  3SFI A;  2HKU A;  3COL A;  2IEK A;  2QKO A;  4YZE A;  3NPI A;  3BTC A;  4D5C A;  3RD3 A;  1U9N A;  4U9N A;  1RKW A;  5FMP A;  5C4Y A;  4D5F A;  4U9L A;  4M3G A;  2R7T A;  4IRV A;  2YVH A;  2DTZ A;  2Y30 A;  5F04 A;  3KNW A;  3KYL A;  3K8P C;  3VVX A;  5F1J A;  3ZQG A;  3FHN A;  4D7N A;  2G7L A;  3PPB A;  3P9T A;  2FQ4 A;  3BCG A;  5K58 A;  3BTJ A;  2UXH A;  4GFL A;  3NS4 A;  2QTQ A;  5EZH A;  3WHB A;  2Y31 A;  3HTI A;  2R7V A;  4DW6 A;  4GCT A;  3ZQL A;  4G12 A;  2G3B A;  3BR5 A;  3QBM A;  2HQ5 A;  2QOP A;  3MVP A;  5FKM A;  4AC6 A;  4B1R A;  4WIB A;  1RPW A;  4MXM A;  3ZQH A;  5F08 A;  2B1E A;  2ID3 A;  2V57 A;  3B6A A;  5EYR A;  2TRT A;  3BJB A;  4AUX A;  4KWA A;  3Q0U A;  3BQZ A;  3IUV A;  3NRG A;  2O7T A;  3LSP A;  2Q24 A;  3ZQI A;  2HXO A;  5H9T A;  2WGB A;  3SDG A;  2XDN A;  1QVT A;  3ZQF A;  2IBD A;  4W1U A;  3HGG A;  4GCK A;  3LSR A;  2ZY9 A;  3C2B A;  2XB5 A;  3BR6 A;  3CRJ A;  3EUP A;  2ZB9 A;  3E7Q A;  1BJZ A;  3FK7 A;  3VIB A;  3JSJ A;  1Z0X A;  3QPS A;  3BR2 A;  2D6Y A;  3B6C A;  5D1R A;  5FKL A;  3HTJ A;  3ANG A;  5F0C A;  3BQY A;  2OER A;  3MNL A;  3O60 A;  5CQG A;  4XK4 A;  3DCF A;  5CW8 A;  3GEU A;  2G7G A;  5K7Z A;  4ACI A;  5CXI A;  2NX4 A;  3LSJ A;  3EGQ A;  1VI0 A;  5F0H A;  2R7S A;  4OD5 A;  4X1E A;  3VTI A;  3HGY A;  4I6Z A;  2ID6 A;  2QWT A;  3HTA A;  3AQT A;  5F0F A;  2ZOZ A;  5IP6 A;  1UI6 A;  5D18 A;  4V2F A;  1T56 A;  2UXO A;  2YVX A;  5J3L A;  2XPW A;  3FIW A;  2YVE A;  3F1B A;  2VKE A;  3CCY A;  3NXC A;  2G0E A;  1JUM A;  1A6I A;  3WHC A;  1T33 A;  3LOC A;  3KKC A;  2FJI 1;  3BR3 A;  3Q0V A;  3Q3S A;  2R7U A;  4C2M A;  3CDL A;  1QVU A;  3BTL A;  3LWJ A;  2RAS A;  4OD4 A;  4ICH A;  3TP3 A;  4JYK A;  4AC0 A;  2VKV A;  1ZK8 A;  2ZOY A;  2RHA A;  3VP5 A;  3BTI A;  4MO7 A;  3DEW A;  2XGE A;  3Q0W A;  2JK3 A;  3KKD A;  3VW2 A;  1JUP A;  4UDS A;  5FKK A;  5CXG A;  2G7S A;  3G56 A;  5D19 A;  3F0C A;  2UXP A;  1ZKG A;  3VOX A;  2XRL A;  3BR0 A;  3O8H A;  4M3F A;  1JT0 A;  4JKZ A;  5HAW A;  3G1L A;  2R7X A;  2ZCX A;  3VPR A;  3IH4 A;  1RKT A;  2PZ9 A;  3VW0 A;  5K7H A;  4M3D A;  3VVZ A;  2NP5 A;  2B3W A;  4M3B A;  3S5R A;  3V78 A;  3DPJ A;  2NS8 A;  4AF5 A;  4M3E A;  2HYJ A;  2IU5 A;  3HTH A;  2FX0 A;  3QKX A;  2UXU A;  2O7O A;  2Y2Z A;  5GPA A;  3QPL A;  3VUQ A;  2DG7 A;  2PBX A;  3G1O A;  3SWH A;  2RAE A;  4L62 A;  4ME9 A;  3CJD A;  2PFV A;  3KZ9 A;  1UI5 A;  3BRU A;  2EH3 A;  3T6N A;  2HXI A;  3BHQ A;  5GPC A;  3HIM A;  1QPI A;  3IH2 A;  3QQA A;  5HBU A;  1Z77 A;  3NI7 A;  2NP3 A;  4NEL A;  5HSZ A;  5FHP A;  2ZCN A;  4ABZ A;  4MK6 A;  5EZG A;  4NN1 A;  3GZI A;  5FGL A;  2XPU A;  1JTX A;  4CGR A;  5J1R A;  3G7R A;  3B81 A;  4DVY P;  2GBY A;  3ON4 A;  1SGM A;  5J1U A;  5J1Y A;  3ON2 A;  3BNI A;  4B3A A;  1U9O A;  3DU5 A;  2IAI A;  2NS7 A;  2OPT A;  3TP0 A;  2WUI A;  2VPR A;  2X6O A;  3HE0 A;  3VW1 A;  5IOZ A;  2R7W A;  3C07 A;  5GP9 A;  2JJ7 A;  5FKO A;  2FJ1 A;  2XGD A;  2UXI A;  4JL3 A;  5F27 A;  2GUH A;  2FD5 A;  2X9D A;  2I10 A;  5IPA A;  2R7Q A;  2GEN A;  5K7F A;  5IOY A;  1JTY A;  2QCO A;  3DU6 A;  3V6G A;  3BR1 A;  3FRQ A;  4I76 A;  3PM1 A;  3IH3 A;  3VOK A;  2R7R A;  2QIB A;  3FK6 A;  2A2F X;  4W97 A;  4PXI A;  3CWR A;  2REK A;  4GCL A;  4HKU A;  3AQS A;  2XGC A;  3LJL A;  4D7M A;  1JT6 A;  3PAS A;  5DAJ A;  3NNR A;  2OF7 A;  2OI8 A;  2ZCM A;  4GFK A;  5EFY A;  2W53 A;  2XPV A;  5AQC A;  3BT9 A;  2TCT A;  3O8G A;  5FKN A;  3ANP A;  4JNN A;  1JUS A;  2R7O A;  3G1M A;  3VVY A; 
#chains in the Genus database with same CATH homology
 2WV1 A;  2DG8 A;  2HYT A;  3RH2 A;  3LHQ A;  2F07 A;  2GFN A;  4V2G A;  1ORK A;  2FBQ A;  3SFI A;  2HKU A;  3COL A;  2IEK A;  2QKO A;  4YZE A;  3NPI A;  3BTC A;  4D5C A;  3RD3 A;  1U9N A;  1RKW A;  5FMP A;  5C4Y A;  4D5F A;  4M3G A;  2YVH A;  2DTZ A;  2Y30 A;  5F04 A;  3KNW A;  3VVX A;  5F1J A;  3ZQG A;  4D7N A;  2G7L A;  3PPB A;  3P9T A;  2FQ4 A;  3BCG A;  5K58 A;  3BTJ A;  2UXH A;  4GFL A;  2QTQ A;  5EZH A;  3WHB A;  2Y31 A;  3HTI A;  4DW6 A;  4GCT A;  3ZQL A;  4G12 A;  2G3B A;  3BR5 A;  3QBM A;  2HQ5 A;  2QOP A;  3MVP A;  5FKM A;  4AC6 A;  4B1R A;  1RPW A;  4MXM A;  3ZQH A;  5F08 A;  2ID3 A;  2V57 A;  3B6A A;  5EYR A;  2TRT A;  3BJB A;  4AUX A;  4KWA A;  3Q0U A;  3BQZ A;  3IUV A;  3NRG A;  2O7T A;  3LSP A;  2Q24 A;  3ZQI A;  2HXO A;  5H9T A;  2WGB A;  3SDG A;  2XDN A;  1QVT A;  3ZQF A;  2IBD A;  4W1U A;  3HGG A;  4GCK A;  3LSR A;  3C2B A;  2XB5 A;  3BR6 A;  3CRJ A;  3EUP A;  2ZB9 A;  3E7Q A;  1BJZ A;  3FK7 A;  3VIB A;  3JSJ A;  1Z0X A;  3QPS A;  3BR2 A;  2D6Y A;  3B6C A;  5D1R A;  5FKL A;  3HTJ A;  3ANG A;  5F0C A;  3BQY A;  2OER A;  3MNL A;  3O60 A;  4XK4 A;  3DCF A;  5CW8 A;  3GEU A;  2G7G A;  5K7Z A;  4ACI A;  5CXI A;  2NX4 A;  3LSJ A;  3EGQ A;  1VI0 A;  5F0H A;  4X1E A;  3HGY A;  4I6Z A;  2ID6 A;  2QWT A;  3HTA A;  3AQT A;  5F0F A;  2ZOZ A;  5IP6 A;  1UI6 A;  5D18 A;  4V2F A;  1T56 A;  2UXO A;  5J3L A;  2XPW A;  3FIW A;  2YVE A;  3F1B A;  2VKE A;  3CCY A;  3NXC A;  2G0E A;  1JUM A;  1A6I A;  3WHC A;  1T33 A;  3LOC A;  3KKC A;  3BR3 A;  3Q0V A;  3Q3S A;  3CDL A;  1QVU A;  3BTL A;  3LWJ A;  2RAS A;  3TP3 A;  4ICH A;  4JYK A;  4AC0 A;  2VKV A;  1ZK8 A;  2ZOY A;  2RHA A;  3VP5 A;  3BTI A;  4MO7 A;  3DEW A;  2XGE A;  3Q0W A;  2JK3 A;  3KKD A;  3VW2 A;  1JUP A;  4UDS A;  5FKK A;  5CXG A;  2G7S A;  3G56 A;  5D19 A;  3F0C A;  2UXP A;  1ZKG A;  3VOX A;  2XRL A;  3BR0 A;  3O8H A;  4M3F A;  1JT0 A;  4JKZ A;  5HAW A;  3G1L A;  2ZCX A;  3VPR A;  3IH4 A;  1RKT A;  2PZ9 A;  3VW0 A;  5K7H A;  4M3D A;  3VVZ A;  2NP5 A;  4M3B A;  3S5R A;  3V78 A;  3DPJ A;  2NS8 A;  4AF5 A;  4M3E A;  2HYJ A;  2IU5 A;  3HTH A;  2FX0 A;  3QKX A;  2UXU A;  2O7O A;  2Y2Z A;  5GPA A;  3QPL A;  3VUQ A;  2DG7 A;  2PBX A;  3G1O A;  2RAE A;  4L62 A;  4ME9 A;  3CJD A;  3KZ9 A;  1UI5 A;  3BRU A;  2EH3 A;  3T6N A;  2HXI A;  3BHQ A;  5GPC A;  3HIM A;  1QPI A;  3IH2 A;  3QQA A;  5HBU A;  1Z77 A;  3NI7 A;  2NP3 A;  4NEL A;  5HSZ A;  5FHP A;  2ZCN A;  4ABZ A;  4MK6 A;  5EZG A;  4NN1 A;  3GZI A;  5FGL A;  2XPU A;  1JTX A;  4CGR A;  5J1R A;  3G7R A;  3B81 A;  2GBY A;  3ON4 A;  1SGM A;  5J1U A;  5J1Y A;  3ON2 A;  3BNI A;  4B3A A;  1U9O A;  2IAI A;  2NS7 A;  2OPT A;  3TP0 A;  2WUI A;  2VPR A;  2X6O A;  3HE0 A;  3VW1 A;  5IOZ A;  3C07 A;  5GP9 A;  2JJ7 A;  5FKO A;  2FJ1 A;  2XGD A;  2UXI A;  4JL3 A;  5F27 A;  2GUH A;  2FD5 A;  2X9D A;  2I10 A;  5IPA A;  2GEN A;  5K7F A;  5IOY A;  1JTY A;  2QCO A;  3V6G A;  3BR1 A;  3FRQ A;  4I76 A;  3PM1 A;  3IH3 A;  3VOK A;  2QIB A;  3FK6 A;  4W97 A;  4PXI A;  3CWR A;  2REK A;  4GCL A;  4HKU A;  3AQS A;  2XGC A;  3LJL A;  4D7M A;  1JT6 A;  3PAS A;  5DAJ A;  3NNR A;  2OF7 A;  2OI8 A;  2ZCM A;  4GFK A;  5EFY A;  2W53 A;  2XPV A;  5AQC A;  3BT9 A;  2TCT A;  3O8G A;  5FKN A;  3ANP A;  4JNN A;  1JUS A;  3G1M A;  3VVY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...