4ME9A

Crystal structure of a transcriptional regulator, tetr family (bce_2991) from bacillus cereus atcc 10987 at 2.50 a resolution
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
188
structure length
188
Chain Sequence
b'MAKNKQEDIFDAAMQLFAERGYDGTTIPMIAEKAKVGAGTIYRYFENKEALVNSLFSKSMLQLSEMIKTDFPVEANIREQFSHTYNRLFEFARNNVDAFLFTNSHCDSYFLDEQSKKIFDDFIGFFMNIIEDGIVKGLLRPLPPVALIIIVYQPLEKLIKVIATGQLEYSKELVKELEESSWNAIRII'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, TetR family
publication title Crystal structure of a transcriptional regulator, TetR family (BCE_2991) from Bacillus cereus ATCC 10987 at 2.50 A resolution
rcsb
source organism Bacillus cereus
molecule tags Transcription regulator
total genus 66
structure length 188
sequence length 188
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF16295 TetR_C_10 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 4me9A00
2ZCNA 3G1LA 3EGQA 2FX0A 3BR5A 2W53A 3RD3A 2F07A 5FKMA 1JUSA 3JSJA 2VKEA 2PZ9A 5HSZA 3BTCA 2O7TA 3SFIA 2QWTA 2V57A 1JTXA 2TRTA 2JJ7A 3FRQA 4GCKA 5F0HA 2IBDA 3BR2A 1BJZA 4W1UA 3NPIA 5K7FA 1Z0XA 3G56A 3G7RA 4PXIA 5HBUA 4MXMA 4AC0A 4GCLA 5FKKA 1T56A 2WV1A 3C2BA 1A6IA 4CGRA 3CWRA 3BTJA 2OI8A 3LJLA 2ZCXA 5J1UA 2ID6A 2QIBA 4D7NA 4JL3A 5GP9A 3NRGA 3BNIA 3BRUA 3MNLA 2OF7A 4MK6A 3G1MA 5GPCA 3ON4A 3DCFA 3ZQFA 2WUIA 2NP3A 2XRLA 3KNWA 1Z77A 5F27A 4ME9A 3VOKA 3VOXA 2GFNA 5IOZA 3HTIA 4GFKA 4GCTA 3CRJA 5FKNA 1QPIA 5GPAA 2UXIA 3IH2A 5D19A 2FQ4A 3HE0A 3F0CA 2YVEA 3HGGA 2DTZA 1QVTA 2EH3A 3AQSA 1ZK8A 3V78A 3PM1A 2G7LA 5H9TA 3B81A 2REKA 4M3EA 3BTLA 3HGYA 3QQAA 3VVZA 5CXIA 3ZQGA 5FKOA 2XPWA 5C4YA 2HKUA 5F0FA 3VPRA 3ANGA 3KZ9A 3NNRA 4XK4A 3COLA 4D5FA 5FMPA 1SGMA 3BR1A 2G3BA 3BQZA 2HXOA 3GZIA 2UXPA 3CJDA 3B6AA 3BQYA 3LHQA 2O7OA 3E7QA 1ZKGA 1RKWA 3BR6A 2GUHA 3DEWA 2RHAA 2WGBA 2IU5A 3HTAA 4HKUA 2XPUA 2XDNA 3C07A 3AQTA 2DG7A 4ACIA 4ICHA 2VKVA 3GEUA 3LWJA 2QKOA 5F04A 3WHCA 2NS7A 2ZOZA 3ZQIA 4M3GA 3BCGA 3HTJA 2HXIA 3S5RA 4MO7A 3FK7A 1UI6A 1RPWA 2Q24A 3IUVA 2HYTA 5J1YA 4M3BA 2NP5A 1RKTA 2HQ5A 5F0CA 3CCYA 3ANPA 2GBYA 3V6GA 5K7ZA 3O60A 3NXCA 2RASA 3TP0A 5FKLA 4V2GA 1U9NA 5F08A 5FGLA 2FBQA 3VIBA 2X6OA 4L62A 2D6YA 3Q0UA 2ID3A 2QTQA 4JYKA 3P9TA 2YVHA 3ON2A 2HYJA 3QPLA 3EUPA 2IEKA 3MVPA 3VVXA 2DG8A 2XGEA 3Q0WA 3LOCA 4AC6A 2FJ1A 3BHQA 5J1RA 2QCOA 2GENA 2FD5A 2UXUA 5K7HA 2OERA 2Y2ZA 2PBXA 5EFYA 3BTIA 1U9OA 2X9DA 1JUPA 1UI5A 2G0EA 2TCTA 3VUQA 5HAWA 3DPJA 2XGCA 3T6NA 4KWAA 3IH3A 5IOYA 2Y30A 1QVUA 5CW8A 3Q3SA 3NI7A 4GFLA 2IAIA 5EYRA 2NS8A 3FK6A 4NELA 1JT0A 3Q0VA 5D1RA 4DW6A 2G7SA 4M3DA 3QPSA 3HTHA 1ORKA 2I10A 3O8GA 3B6CA 3BT9A 3IH4A 5D18A 2RAEA 3BR3A 3LSPA 1T33A 5J3LA 4YZEA 3F1BA 2XPVA 2QOPA 3VW1A 3VW0A 2ZOYA 3LSJA 4B3AA 3BJBA 4JKZA 3VP5A 4D7MA 1JTYA 4I76A 5F1JA 3O8HA 3VVYA 5EZHA 5DAJA 3KKDA 3ZQLA 1JT6A 2VPRA 3SDGA 1JUMA 4I6ZA 3BR0A 3WHBA 3ZQHA 5FHPA 3LSRA 2XB5A 3CDLA 5AQCA 2G7GA 2ZB9A 2UXHA 3VW2A 4M3FA 5IPAA 3TP3A 4G12A 3RH2A 4X1EA 4AF5A 4JNNA 2XGDA 4AUXA 4V2FA 4B1RA 2NX4A 3G1OA 2UXOA 5CXGA 3QBMA 2JK3A 2ZCMA 2Y31A 3PPBA 3FIWA 3PASA 2OPTA 4W97A 3KKCA 1VI0A 4UDSA 4NN1A 5IP6A 3HIMA 4D5CA 5K58A 3QKXA 4ABZA 5EZGA
chains in the Genus database with same CATH superfamily
2ZCNA 3G1LA 3EGQA 2FX0A 3BR5A 2W53A 3RD3A 3FHNA 2F07A 4OD4A 5FKMA 1JUSA 3JSJA 2VKEA 2PZ9A 5HSZA 3BTCA 2O7TA 3SFIA 2QWTA 2V57A 1JTXA 2TRTA 2JJ7A 3FRQA 4GCKA 5F0HA 2IBDA 3BR2A 1BJZA 4W1UA 3NPIA 5K7FA 1Z0XA 3G56A 3G7RA 4PXIA 5HBUA 4MXMA 4AC0A 4GCLA 5FKKA 1T56A 2WV1A 3C2BA 1A6IA 3KYLA 4CGRA 3CWRA 3BTJA 2OI8A 3LJLA 2ZCXA 5J1UA 2ID6A 3K8PC 2R7RA 2QIBA 4D7NA 4JL3A 5GP9A 3NRGA 3BNIA 3BRUA 3MNLA 2OF7A 4MK6A 3G1MA 5GPCA 3ON4A 3DCFA 3ZQFA 2WUIA 2NP3A 2XRLA 3KNWA 1Z77A 5F27A 4ME9A 3VOKA 3VOXA 2GFNA 4WIBA 5IOZA 3HTIA 4GFKA 4GCTA 3CRJA 5FKNA 1QPIA 5GPAA 2UXIA 2R7UA 3IH2A 5D19A 2R7TA 2FQ4A 3HE0A 3F0CA 2ZY9A 3NS4A 2YVEA 3HGGA 2DTZA 1QVTA 2EH3A 3AQSA 1ZK8A 3V78A 3PM1A 2G7LA 5H9TA 3B81A 2REKA 4M3EA 3BTLA 3HGYA 3QQAA 3VVZA 5CXIA 3ZQGA 5FKOA 2XPWA 5C4YA 4U9LA 2HKUA 5F0FA 3VPRA 3ANGA 3KZ9A 3NNRA 4XK4A 3COLA 4D5FA 5FMPA 1SGMA 3BR1A 2G3BA 3BQZA 2HXOA 3GZIA 2A2FX 2UXPA 3CJDA 3B6AA 3BQYA 3LHQA 2O7OA 3E7QA 1ZKGA 1RKWA 3BR6A 2GUHA 3DEWA 2RHAA 2WGBA 2IU5A 3HTAA 4HKUA 2XPUA 2XDNA 3C07A 3AQTA 2DG7A 4ACIA 4ICHA 2VKVA 4U9NA 3GEUA 3LWJA 2QKOA 5F04A 3WHCA 2NS7A 2ZOZA 3ZQIA 4M3GA 3BCGA 3HTJA 2HXIA 3S5RA 4MO7A 3FK7A 1UI6A 1RPWA 2Q24A 3IUVA 2HYTA 5J1YA 4M3BA 2NP5A 1RKTA 2HQ5A 5F0CA 3CCYA 3ANPA 2GBYA 3V6GA 5K7ZA 3O60A 3NXCA 2R7WA 2RASA 3TP0A 5FKLA 3DU5A 4V2GA 1U9NA 5F08A 2PFVA 2FBQA 5FGLA 2X6OA 3VIBA 4L62A 2D6YA 3Q0UA 2ID3A 2QTQA 4JYKA 3P9TA 2YVHA 3ON2A 2HYJA 3QPLA 3EUPA 2IEKA 3MVPA 3VVXA 2DG8A 2XGEA 2R7SA 3Q0WA 3DU6A 3LOCA 3SWHA 4AC6A 2FJ1A 5CQGA 3BHQA 5J1RA 2QCOA 2GENA 2FD5A 2UXUA 5K7HA 2OERA 2Y2ZA 2PBXA 5EFYA 3BTIA 1U9OA 2X9DA 1JUPA 1UI5A 2G0EA 2TCTA 3VUQA 5HAWA 3DPJA 4C2MA 2XGCA 4DVYP 3T6NA 2B1EA 4KWAA 3IH3A 5IOYA 2Y30A 1QVUA 5CW8A 3Q3SA 3NI7A 4GFLA 2IAIA 5EYRA 2NS8A 3FK6A 4NELA 1JT0A 3Q0VA 5D1RA 4DW6A 2G7SA 4M3DA 3QPSA 3HTHA 1ORKA 2I10A 3O8GA 3B6CA 3BT9A 3IH4A 4IRVA 5D18A 2RAEA 4OD5A 3BR3A 3LSPA 2B3WA 1T33A 5J3LA 4YZEA 3F1BA 2XPVA 2QOPA 3VW1A 3VW0A 2ZOYA 3LSJA 4B3AA 3BJBA 4JKZA 3VP5A 4D7MA 1JTYA 4I76A 5F1JA 3O8HA 3VVYA 5EZHA 2R7XA 2FJI1 5DAJA 3KKDA 3ZQLA 1JT6A 2VPRA 2R7QA 3SDGA 1JUMA 4I6ZA 3BR0A 3WHBA 3ZQHA 5FHPA 3LSRA 2R7VA 2XB5A 3CDLA 5AQCA 2G7GA 2ZB9A 2UXHA 3VW2A 4M3FA 5IPAA 3TP3A 4G12A 3RH2A 4X1EA 4AF5A 4JNNA 2XGDA 4AUXA 4V2FA 4B1RA 2NX4A 2R7OA 3G1OA 2UXOA 5CXGA 3VTIA 3QBMA 2JK3A 2ZCMA 2Y31A 3PPBA 3FIWA 3PASA 2OPTA 4W97A 3KKCA 1VI0A 4UDSA 4NN1A 5IP6A 3HIMA 4D5CA 5K58A 2YVXA 3QKXA 4ABZA 5EZGA
chains in the Genus database with same CATH topology
2ZCNA 3G1LA 3EGQA 2FX0A 3BR5A 2W53A 3RD3A 2F07A 5FKMA 1JUSA 3JSJA 2VKEA 2PZ9A 5HSZA 3BTCA 2O7TA 3SFIA 2QWTA 2V57A 1JTXA 2TRTA 2JJ7A 3FRQA 4GCKA 5F0HA 2IBDA 3BR2A 1BJZA 4W1UA 3NPIA 5K7FA 1Z0XA 3G56A 3G7RA 4PXIA 5HBUA 4MXMA 4AC0A 4GCLA 5FKKA 1T56A 2WV1A 3C2BA 1A6IA 4CGRA 3CWRA 3BTJA 2OI8A 3LJLA 2ZCXA 5J1UA 2ID6A 2QIBA 4D7NA 4JL3A 5GP9A 3NRGA 3BNIA 3BRUA 3MNLA 2OF7A 4MK6A 3G1MA 5GPCA 3ON4A 3DCFA 3ZQFA 2WUIA 2NP3A 2XRLA 3KNWA 1Z77A 5F27A 4ME9A 3VOKA 3VOXA 2GFNA 5IOZA 3HTIA 4GFKA 4GCTA 3CRJA 5FKNA 1QPIA 5GPAA 2UXIA 3IH2A 5D19A 2FQ4A 3HE0A 3F0CA 2YVEA 3HGGA 2DTZA 1QVTA 2EH3A 3AQSA 1ZK8A 3V78A 3PM1A 2G7LA 5H9TA 3B81A 2REKA 4M3EA 3BTLA 3HGYA 3QQAA 3VVZA 5CXIA 3ZQGA 5FKOA 2XPWA 5C4YA 2HKUA 5F0FA 3VPRA 3ANGA 3KZ9A 3NNRA 4XK4A 3COLA 4D5FA 5FMPA 1SGMA 3BR1A 2G3BA 3BQZA 2HXOA 3GZIA 2UXPA 3CJDA 3B6AA 3BQYA 3LHQA 2O7OA 3E7QA 1ZKGA 1RKWA 3BR6A 2GUHA 3DEWA 2RHAA 2WGBA 2IU5A 3HTAA 4HKUA 2XPUA 2XDNA 3C07A 3AQTA 2DG7A 4ACIA 4ICHA 2VKVA 3GEUA 3LWJA 2QKOA 5F04A 3WHCA 2NS7A 2ZOZA 3ZQIA 4M3GA 3BCGA 3HTJA 2HXIA 3S5RA 4MO7A 3FK7A 1UI6A 1RPWA 2Q24A 3IUVA 2HYTA 5J1YA 4M3BA 2NP5A 1RKTA 2HQ5A 5F0CA 3CCYA 3ANPA 2GBYA 3V6GA 5K7ZA 3O60A 3NXCA 2RASA 3TP0A 5FKLA 4V2GA 1U9NA 5F08A 5FGLA 2FBQA 3VIBA 2X6OA 4L62A 2D6YA 3Q0UA 2ID3A 2QTQA 4JYKA 3P9TA 2YVHA 3ON2A 2HYJA 3QPLA 3EUPA 2IEKA 3MVPA 3VVXA 2DG8A 2XGEA 3Q0WA 3LOCA 4AC6A 2FJ1A 3BHQA 5J1RA 2QCOA 2GENA 2FD5A 2UXUA 5K7HA 2OERA 2Y2ZA 2PBXA 5EFYA 3BTIA 1U9OA 2X9DA 1JUPA 1UI5A 2G0EA 2TCTA 3VUQA 5HAWA 3DPJA 2XGCA 3T6NA 4KWAA 3IH3A 5IOYA 2Y30A 1QVUA 5CW8A 3Q3SA 3NI7A 4GFLA 2IAIA 5EYRA 2NS8A 3FK6A 4NELA 1JT0A 3Q0VA 5D1RA 4DW6A 2G7SA 4M3DA 3QPSA 3HTHA 1ORKA 2I10A 3O8GA 3B6CA 3BT9A 3IH4A 5D18A 2RAEA 3BR3A 3LSPA 1T33A 5J3LA 4YZEA 3F1BA 2XPVA 2QOPA 3VW1A 3VW0A 2ZOYA 3LSJA 4B3AA 3BJBA 4JKZA 3VP5A 4D7MA 1JTYA 4I76A 5F1JA 3O8HA 3VVYA 5EZHA 5DAJA 3KKDA 3ZQLA 1JT6A 2VPRA 3SDGA 1JUMA 4I6ZA 3BR0A 3WHBA 3ZQHA 5FHPA 3LSRA 2XB5A 3CDLA 5AQCA 2G7GA 2ZB9A 2UXHA 3VW2A 4M3FA 5IPAA 3TP3A 4G12A 3RH2A 4X1EA 4AF5A 4JNNA 2XGDA 4AUXA 4V2FA 4B1RA 2NX4A 3G1OA 2UXOA 5CXGA 3QBMA 2JK3A 2ZCMA 2Y31A 3PPBA 3FIWA 3PASA 2OPTA 4W97A 3KKCA 1VI0A 4UDSA 4NN1A 5IP6A 3HIMA 4D5CA 5K58A 3QKXA 4ABZA 5EZGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZCN A;  3G1L A;  3EGQ A;  2FX0 A;  3BR5 A;  2W53 A;  3RD3 A;  2F07 A;  5FKM A;  1JUS A;  3JSJ A;  2VKE A;  2PZ9 A;  5HSZ A;  3BTC A;  2O7T A;  3SFI A;  2QWT A;  2V57 A;  1JTX A;  2TRT A;  2JJ7 A;  3FRQ A;  4GCK A;  5F0H A;  2IBD A;  3BR2 A;  1BJZ A;  4W1U A;  3NPI A;  5K7F A;  1Z0X A;  3G56 A;  3G7R A;  4PXI A;  5HBU A;  4MXM A;  4AC0 A;  4GCL A;  5FKK A;  1T56 A;  2WV1 A;  3C2B A;  1A6I A;  4CGR A;  3CWR A;  3BTJ A;  2OI8 A;  3LJL A;  2ZCX A;  5J1U A;  2ID6 A;  2QIB A;  4D7N A;  4JL3 A;  5GP9 A;  3NRG A;  3BNI A;  3BRU A;  3MNL A;  2OF7 A;  4MK6 A;  3G1M A;  5GPC A;  3ON4 A;  3DCF A;  3ZQF A;  2WUI A;  2NP3 A;  2XRL A;  3KNW A;  1Z77 A;  5F27 A;  4ME9 A;  3VOK A;  3VOX A;  2GFN A;  5IOZ A;  3HTI A;  4GFK A;  4GCT A;  3CRJ A;  5FKN A;  1QPI A;  5GPA A;  2UXI A;  3IH2 A;  5D19 A;  2FQ4 A;  3HE0 A;  3F0C A;  2YVE A;  3HGG A;  2DTZ A;  1QVT A;  2EH3 A;  3AQS A;  1ZK8 A;  3V78 A;  3PM1 A;  2G7L A;  5H9T A;  3B81 A;  2REK A;  4M3E A;  3BTL A;  3HGY A;  3QQA A;  3VVZ A;  5CXI A;  3ZQG A;  5FKO A;  2XPW A;  5C4Y A;  2HKU A;  5F0F A;  3VPR A;  3ANG A;  3KZ9 A;  3NNR A;  4XK4 A;  3COL A;  4D5F A;  5FMP A;  1SGM A;  3BR1 A;  2G3B A;  3BQZ A;  2HXO A;  3GZI A;  2UXP A;  3CJD A;  3B6A A;  3BQY A;  3LHQ A;  2O7O A;  3E7Q A;  1ZKG A;  1RKW A;  3BR6 A;  2GUH A;  3DEW A;  2RHA A;  2WGB A;  2IU5 A;  3HTA A;  4HKU A;  2XPU A;  2XDN A;  3C07 A;  3AQT A;  2DG7 A;  4ACI A;  4ICH A;  2VKV A;  3GEU A;  3LWJ A;  2QKO A;  5F04 A;  3WHC A;  2NS7 A;  2ZOZ A;  3ZQI A;  4M3G A;  3BCG A;  3HTJ A;  2HXI A;  3S5R A;  4MO7 A;  3FK7 A;  1UI6 A;  1RPW A;  2Q24 A;  3IUV A;  2HYT A;  5J1Y A;  4M3B A;  2NP5 A;  1RKT A;  2HQ5 A;  5F0C A;  3CCY A;  3ANP A;  2GBY A;  3V6G A;  5K7Z A;  3O60 A;  3NXC A;  2RAS A;  3TP0 A;  5FKL A;  4V2G A;  1U9N A;  5F08 A;  5FGL A;  2FBQ A;  3VIB A;  2X6O A;  4L62 A;  2D6Y A;  3Q0U A;  2ID3 A;  2QTQ A;  4JYK A;  3P9T A;  2YVH A;  3ON2 A;  2HYJ A;  3QPL A;  3EUP A;  2IEK A;  3MVP A;  3VVX A;  2DG8 A;  2XGE A;  3Q0W A;  3LOC A;  4AC6 A;  2FJ1 A;  3BHQ A;  5J1R A;  2QCO A;  2GEN A;  2FD5 A;  2UXU A;  5K7H A;  2OER A;  2Y2Z A;  2PBX A;  5EFY A;  3BTI A;  1U9O A;  2X9D A;  1JUP A;  1UI5 A;  2G0E A;  2TCT A;  3VUQ A;  5HAW A;  3DPJ A;  2XGC A;  3T6N A;  4KWA A;  3IH3 A;  5IOY A;  2Y30 A;  1QVU A;  5CW8 A;  3Q3S A;  3NI7 A;  4GFL A;  2IAI A;  5EYR A;  2NS8 A;  3FK6 A;  4NEL A;  1JT0 A;  3Q0V A;  5D1R A;  4DW6 A;  2G7S A;  4M3D A;  3QPS A;  3HTH A;  1ORK A;  2I10 A;  3O8G A;  3B6C A;  3BT9 A;  3IH4 A;  5D18 A;  2RAE A;  3BR3 A;  3LSP A;  1T33 A;  5J3L A;  4YZE A;  3F1B A;  2XPV A;  2QOP A;  3VW1 A;  3VW0 A;  2ZOY A;  3LSJ A;  4B3A A;  3BJB A;  4JKZ A;  3VP5 A;  4D7M A;  1JTY A;  4I76 A;  5F1J A;  3O8H A;  3VVY A;  5EZH A;  5DAJ A;  3KKD A;  3ZQL A;  1JT6 A;  2VPR A;  3SDG A;  1JUM A;  4I6Z A;  3BR0 A;  3WHB A;  3ZQH A;  5FHP A;  3LSR A;  2XB5 A;  3CDL A;  5AQC A;  2G7G A;  2ZB9 A;  2UXH A;  3VW2 A;  4M3F A;  5IPA A;  3TP3 A;  4G12 A;  3RH2 A;  4X1E A;  4AF5 A;  4JNN A;  2XGD A;  4AUX A;  4V2F A;  4B1R A;  2NX4 A;  3G1O A;  2UXO A;  5CXG A;  3QBM A;  2JK3 A;  2ZCM A;  2Y31 A;  3PPB A;  3FIW A;  3PAS A;  2OPT A;  4W97 A;  3KKC A;  1VI0 A;  4UDS A;  4NN1 A;  5IP6 A;  3HIM A;  4D5C A;  5K58 A;  3QKX A;  4ABZ A;  5EZG A; 
#chains in the Genus database with same CATH topology
 2ZCN A;  3G1L A;  3EGQ A;  2FX0 A;  3BR5 A;  2W53 A;  3RD3 A;  3FHN A;  2F07 A;  4OD4 A;  5FKM A;  1JUS A;  3JSJ A;  2VKE A;  2PZ9 A;  5HSZ A;  3BTC A;  2O7T A;  3SFI A;  2QWT A;  2V57 A;  1JTX A;  2TRT A;  2JJ7 A;  3FRQ A;  4GCK A;  5F0H A;  2IBD A;  3BR2 A;  1BJZ A;  4W1U A;  3NPI A;  5K7F A;  1Z0X A;  3G56 A;  3G7R A;  4PXI A;  5HBU A;  4MXM A;  4AC0 A;  4GCL A;  5FKK A;  1T56 A;  2WV1 A;  3C2B A;  1A6I A;  3KYL A;  4CGR A;  3CWR A;  3BTJ A;  2OI8 A;  3LJL A;  2ZCX A;  5J1U A;  2ID6 A;  3K8P C;  2R7R A;  2QIB A;  4D7N A;  4JL3 A;  5GP9 A;  3NRG A;  3BNI A;  3BRU A;  3MNL A;  2OF7 A;  4MK6 A;  3G1M A;  5GPC A;  3ON4 A;  3DCF A;  3ZQF A;  2WUI A;  2NP3 A;  2XRL A;  3KNW A;  1Z77 A;  5F27 A;  4ME9 A;  3VOK A;  3VOX A;  2GFN A;  4WIB A;  5IOZ A;  3HTI A;  4GFK A;  4GCT A;  3CRJ A;  5FKN A;  1QPI A;  5GPA A;  2UXI A;  2R7U A;  3IH2 A;  5D19 A;  2R7T A;  2FQ4 A;  3HE0 A;  3F0C A;  2ZY9 A;  3NS4 A;  2YVE A;  3HGG A;  2DTZ A;  1QVT A;  2EH3 A;  3AQS A;  1ZK8 A;  3V78 A;  3PM1 A;  2G7L A;  5H9T A;  3B81 A;  2REK A;  4M3E A;  3BTL A;  3HGY A;  3QQA A;  3VVZ A;  5CXI A;  3ZQG A;  5FKO A;  2XPW A;  5C4Y A;  4U9L A;  2HKU A;  5F0F A;  3VPR A;  3ANG A;  3KZ9 A;  3NNR A;  4XK4 A;  3COL A;  4D5F A;  5FMP A;  1SGM A;  3BR1 A;  2G3B A;  3BQZ A;  2HXO A;  3GZI A;  2A2F X;  2UXP A;  3CJD A;  3B6A A;  3BQY A;  3LHQ A;  2O7O A;  3E7Q A;  1ZKG A;  1RKW A;  3BR6 A;  2GUH A;  3DEW A;  2RHA A;  2WGB A;  2IU5 A;  3HTA A;  4HKU A;  2XPU A;  2XDN A;  3C07 A;  3AQT A;  2DG7 A;  4ACI A;  4ICH A;  2VKV A;  4U9N A;  3GEU A;  3LWJ A;  2QKO A;  5F04 A;  3WHC A;  2NS7 A;  2ZOZ A;  3ZQI A;  4M3G A;  3BCG A;  3HTJ A;  2HXI A;  3S5R A;  4MO7 A;  3FK7 A;  1UI6 A;  1RPW A;  2Q24 A;  3IUV A;  2HYT A;  5J1Y A;  4M3B A;  2NP5 A;  1RKT A;  2HQ5 A;  5F0C A;  3CCY A;  3ANP A;  2GBY A;  3V6G A;  5K7Z A;  3O60 A;  3NXC A;  2R7W A;  2RAS A;  3TP0 A;  5FKL A;  3DU5 A;  4V2G A;  1U9N A;  5F08 A;  2PFV A;  2FBQ A;  5FGL A;  2X6O A;  3VIB A;  4L62 A;  2D6Y A;  3Q0U A;  2ID3 A;  2QTQ A;  4JYK A;  3P9T A;  2YVH A;  3ON2 A;  2HYJ A;  3QPL A;  3EUP A;  2IEK A;  3MVP A;  3VVX A;  2DG8 A;  2XGE A;  2R7S A;  3Q0W A;  3DU6 A;  3LOC A;  3SWH A;  4AC6 A;  2FJ1 A;  5CQG A;  3BHQ A;  5J1R A;  2QCO A;  2GEN A;  2FD5 A;  2UXU A;  5K7H A;  2OER A;  2Y2Z A;  2PBX A;  5EFY A;  3BTI A;  1U9O A;  2X9D A;  1JUP A;  1UI5 A;  2G0E A;  2TCT A;  3VUQ A;  5HAW A;  3DPJ A;  4C2M A;  2XGC A;  4DVY P;  3T6N A;  2B1E A;  4KWA A;  3IH3 A;  5IOY A;  2Y30 A;  1QVU A;  5CW8 A;  3Q3S A;  3NI7 A;  4GFL A;  2IAI A;  5EYR A;  2NS8 A;  3FK6 A;  4NEL A;  1JT0 A;  3Q0V A;  5D1R A;  4DW6 A;  2G7S A;  4M3D A;  3QPS A;  3HTH A;  1ORK A;  2I10 A;  3O8G A;  3B6C A;  3BT9 A;  3IH4 A;  4IRV A;  5D18 A;  2RAE A;  4OD5 A;  3BR3 A;  3LSP A;  2B3W A;  1T33 A;  5J3L A;  4YZE A;  3F1B A;  2XPV A;  2QOP A;  3VW1 A;  3VW0 A;  2ZOY A;  3LSJ A;  4B3A A;  3BJB A;  4JKZ A;  3VP5 A;  4D7M A;  1JTY A;  4I76 A;  5F1J A;  3O8H A;  3VVY A;  5EZH A;  2R7X A;  2FJI 1;  5DAJ A;  3KKD A;  3ZQL A;  1JT6 A;  2VPR A;  2R7Q A;  3SDG A;  1JUM A;  4I6Z A;  3BR0 A;  3WHB A;  3ZQH A;  5FHP A;  3LSR A;  2R7V A;  2XB5 A;  3CDL A;  5AQC A;  2G7G A;  2ZB9 A;  2UXH A;  3VW2 A;  4M3F A;  5IPA A;  3TP3 A;  4G12 A;  3RH2 A;  4X1E A;  4AF5 A;  4JNN A;  2XGD A;  4AUX A;  4V2F A;  4B1R A;  2NX4 A;  2R7O A;  3G1O A;  2UXO A;  5CXG A;  3VTI A;  3QBM A;  2JK3 A;  2ZCM A;  2Y31 A;  3PPB A;  3FIW A;  3PAS A;  2OPT A;  4W97 A;  3KKC A;  1VI0 A;  4UDS A;  4NN1 A;  5IP6 A;  3HIM A;  4D5C A;  5K58 A;  2YVX A;  3QKX A;  4ABZ A;  5EZG A; 
#chains in the Genus database with same CATH homology
 2ZCN A;  3G1L A;  3EGQ A;  2FX0 A;  3BR5 A;  2W53 A;  3RD3 A;  2F07 A;  5FKM A;  1JUS A;  3JSJ A;  2VKE A;  2PZ9 A;  5HSZ A;  3BTC A;  2O7T A;  3SFI A;  2QWT A;  2V57 A;  1JTX A;  2TRT A;  2JJ7 A;  3FRQ A;  4GCK A;  5F0H A;  2IBD A;  3BR2 A;  1BJZ A;  4W1U A;  3NPI A;  5K7F A;  1Z0X A;  3G56 A;  3G7R A;  4PXI A;  5HBU A;  4MXM A;  4AC0 A;  4GCL A;  5FKK A;  1T56 A;  2WV1 A;  3C2B A;  1A6I A;  4CGR A;  3CWR A;  3BTJ A;  2OI8 A;  3LJL A;  2ZCX A;  5J1U A;  2ID6 A;  2QIB A;  4D7N A;  4JL3 A;  5GP9 A;  3NRG A;  3BNI A;  3BRU A;  3MNL A;  2OF7 A;  4MK6 A;  3G1M A;  5GPC A;  3ON4 A;  3DCF A;  3ZQF A;  2WUI A;  2NP3 A;  2XRL A;  3KNW A;  1Z77 A;  5F27 A;  4ME9 A;  3VOK A;  3VOX A;  2GFN A;  5IOZ A;  3HTI A;  4GFK A;  4GCT A;  3CRJ A;  5FKN A;  1QPI A;  5GPA A;  2UXI A;  3IH2 A;  5D19 A;  2FQ4 A;  3HE0 A;  3F0C A;  2YVE A;  3HGG A;  2DTZ A;  1QVT A;  2EH3 A;  3AQS A;  1ZK8 A;  3V78 A;  3PM1 A;  2G7L A;  5H9T A;  3B81 A;  2REK A;  4M3E A;  3BTL A;  3HGY A;  3QQA A;  3VVZ A;  5CXI A;  3ZQG A;  5FKO A;  2XPW A;  5C4Y A;  2HKU A;  5F0F A;  3VPR A;  3ANG A;  3KZ9 A;  3NNR A;  4XK4 A;  3COL A;  4D5F A;  5FMP A;  1SGM A;  3BR1 A;  2G3B A;  3BQZ A;  2HXO A;  3GZI A;  2UXP A;  3CJD A;  3B6A A;  3BQY A;  3LHQ A;  2O7O A;  3E7Q A;  1ZKG A;  1RKW A;  3BR6 A;  2GUH A;  3DEW A;  2RHA A;  2WGB A;  2IU5 A;  3HTA A;  4HKU A;  2XPU A;  2XDN A;  3C07 A;  3AQT A;  2DG7 A;  4ACI A;  4ICH A;  2VKV A;  3GEU A;  3LWJ A;  2QKO A;  5F04 A;  3WHC A;  2NS7 A;  2ZOZ A;  3ZQI A;  4M3G A;  3BCG A;  3HTJ A;  2HXI A;  3S5R A;  4MO7 A;  3FK7 A;  1UI6 A;  1RPW A;  2Q24 A;  3IUV A;  2HYT A;  5J1Y A;  4M3B A;  2NP5 A;  1RKT A;  2HQ5 A;  5F0C A;  3CCY A;  3ANP A;  2GBY A;  3V6G A;  5K7Z A;  3O60 A;  3NXC A;  2RAS A;  3TP0 A;  5FKL A;  4V2G A;  1U9N A;  5F08 A;  5FGL A;  2FBQ A;  3VIB A;  2X6O A;  4L62 A;  2D6Y A;  3Q0U A;  2ID3 A;  2QTQ A;  4JYK A;  3P9T A;  2YVH A;  3ON2 A;  2HYJ A;  3QPL A;  3EUP A;  2IEK A;  3MVP A;  3VVX A;  2DG8 A;  2XGE A;  3Q0W A;  3LOC A;  4AC6 A;  2FJ1 A;  3BHQ A;  5J1R A;  2QCO A;  2GEN A;  2FD5 A;  2UXU A;  5K7H A;  2OER A;  2Y2Z A;  2PBX A;  5EFY A;  3BTI A;  1U9O A;  2X9D A;  1JUP A;  1UI5 A;  2G0E A;  2TCT A;  3VUQ A;  5HAW A;  3DPJ A;  2XGC A;  3T6N A;  4KWA A;  3IH3 A;  5IOY A;  2Y30 A;  1QVU A;  5CW8 A;  3Q3S A;  3NI7 A;  4GFL A;  2IAI A;  5EYR A;  2NS8 A;  3FK6 A;  4NEL A;  1JT0 A;  3Q0V A;  5D1R A;  4DW6 A;  2G7S A;  4M3D A;  3QPS A;  3HTH A;  1ORK A;  2I10 A;  3O8G A;  3B6C A;  3BT9 A;  3IH4 A;  5D18 A;  2RAE A;  3BR3 A;  3LSP A;  1T33 A;  5J3L A;  4YZE A;  3F1B A;  2XPV A;  2QOP A;  3VW1 A;  3VW0 A;  2ZOY A;  3LSJ A;  4B3A A;  3BJB A;  4JKZ A;  3VP5 A;  4D7M A;  1JTY A;  4I76 A;  5F1J A;  3O8H A;  3VVY A;  5EZH A;  5DAJ A;  3KKD A;  3ZQL A;  1JT6 A;  2VPR A;  3SDG A;  1JUM A;  4I6Z A;  3BR0 A;  3WHB A;  3ZQH A;  5FHP A;  3LSR A;  2XB5 A;  3CDL A;  5AQC A;  2G7G A;  2ZB9 A;  2UXH A;  3VW2 A;  4M3F A;  5IPA A;  3TP3 A;  4G12 A;  3RH2 A;  4X1E A;  4AF5 A;  4JNN A;  2XGD A;  4AUX A;  4V2F A;  4B1R A;  2NX4 A;  3G1O A;  2UXO A;  5CXG A;  3QBM A;  2JK3 A;  2ZCM A;  2Y31 A;  3PPB A;  3FIW A;  3PAS A;  2OPT A;  4W97 A;  3KKC A;  1VI0 A;  4UDS A;  4NN1 A;  5IP6 A;  3HIM A;  4D5C A;  5K58 A;  3QKX A;  4ABZ A;  5EZG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...