4ME9A

Crystal structure of a transcriptional regulator, tetr family (bce_2991) from bacillus cereus atcc 10987 at 2.50 a resolution
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
188
structure length
188
Chain Sequence
MAKNKQEDIFDAAMQLFAERGYDGTTIPMIAEKAKVGAGTIYRYFENKEALVNSLFSKSMLQLSEMIKTDFPVEANIREQFSHTYNRLFEFARNNVDAFLFTNSHCDSYFLDEQSKKIFDDFIGFFMNIIEDGIVKGLLRPLPPVALIIIVYQPLEKLIKVIATGQLEYSKELVKELEESSWNAIRII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a transcriptional regulator, TetR family (BCE_2991) from Bacillus cereus ATCC 10987 at 2.50 A resolution
rcsb
source organism Bacillus cereus
molecule tags Transcription regulator
molecule keywords Transcriptional regulator, TetR family
total genus 66
structure length 188
sequence length 188
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF16295 TetR_C_10 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 4me9A00
4XK4A 2Y2ZA 2XPVA 5HBUA 3KKDA 5J3LA 1VI0A 2UXPA 5EFYA 2RASA 3IH3A 3V6GA 1JUMA 2WUIA 3NXCA 5EYRA 2O7TA 2XGEA 3CDLA 2TCTA 3S5RA 4X1EA 2WV1A 3IH4A 4MK6A 2HQ5A 3ZQFA 1UI6A 2UXUA 3Q3SA 4D5CA 2DG8A 2IU5A 2FBQA 4UDSA 4B3AA 5D18A 3WHCA 3ZQGA 4JL3A 3ZQLA 3QBMA 2V57A 3C2BA 5FGLA 5DAJA 2GBYA 3HTAA 2X6OA 5FKKA 3BRUA 3VVZA 5F0CA 2EH3A 5IPAA 4NN1A 3T6NA 5GP9A 5J1YA 3PPBA 2OERA 4ACIA 4YZEA 1JUSA 3RH2A 5FHPA 2DTZA 2ZCXA 2G7LA 5K7HA 5K7FA 1U9NA 3VW1A 3HIMA 2UXIA 3NNRA 2RHAA 2XGDA 3MVPA 4AC6A 5J1UA 1T33A 5GPCA 4ICHA 4GFKA 5IOYA 3VP5A 2VKVA 5H9TA 3LWJA 4AF5A 2UXHA 3G56A 5CXGA 4KWAA 2ZOYA 1ZK8A 3IH2A 4PXIA 5FKLA 3CCYA 4NELA 2ZCMA 4JYKA 3LHQA 5FMPA 5J1RA 5EZGA 2GUHA 3AQSA 2FD5A 4GFLA 5K7ZA 3PASA 4M3GA 4W1UA 2FX0A 2HKUA 3VVXA 5F0HA 5IP6A 2QCOA 1U9OA 2RAEA 2YVEA 5EZHA 2TRTA 3BR0A 2XPUA 4D7MA 5GPAA 4CGRA 3BR2A 1JUPA 3VVYA 3VOKA 2HXOA 3O60A 3VPRA 5D1RA 3QPSA 2IBDA 3ON2A 2F07A 3ANGA 3BCGA 4AC0A 4GCTA 3BR3A 5HSZA 3COLA 2W53A 3BNIA 2QOPA 2GFNA 5D19A 3JSJA 1RKWA 2QKOA 3CWRA 2ZCNA 5IOZA 3P9TA 3EUPA 2REKA 5FKNA 3BTCA 2IEKA 4MXMA 3BJBA 2HYTA 3HGYA 3BT9A 4W97A 3QQAA 3SFIA 3TP3A 3FIWA 4L62A 3PM1A 3SDGA 2OPTA 3EGQA 1Z0XA 5F0FA 5K58A 2OI8A 2G7SA 4HKUA 3B6CA 3RD3A 2X9DA 2NX4A 3F1BA 5F04A 2JJ7A 3FRQA 2Y30A 3QPLA 4M3EA 3LOCA 2Y31A 3ANPA 1ZKGA 3BQZA 4ME9A 4MO7A 1JT6A 3LJLA 2NS7A 3NPIA 3B6AA 5AQCA 2I10A 3HE0A 5CW8A 1JT0A 3BR6A 4D7NA 2QIBA 3G1LA 3GZIA 3KZ9A 3HTJA 2NS8A 2QWTA 4M3FA 3Q0WA 3Q0VA 2ID6A 1ORKA 3BTLA 2UXOA 2PBXA 1Z77A 3LSPA 1QPIA 4ABZA 1BJZA 2DG7A 3VOXA 4I6ZA 4DW6A 2FJ1A 3DCFA 4D5FA 1SGMA 3WHBA 2G0EA 2NP3A 5CXIA 2VPRA 4AUXA 3VW2A 3F0CA 1RKTA 4JKZA 3C07A 5C4YA 3E7QA 2XPWA 5F08A 2PZ9A 2OF7A 3LSJA 4GCKA 3G1OA 3V78A 1T56A 4JNNA 2G7GA 4V2GA 3BQYA 5F1JA 2XGCA 3BR5A 4I76A 3KNWA 2HXIA 1A6IA 3VUQA 3BTJA 5FKOA 3VIBA 2ID3A 3HGGA 2NP5A 3O8HA 4M3BA 2HYJA 3FK6A 2XB5A 2D6YA 3CJDA 3MNLA 2O7OA 2Q24A 3CRJA 3NI7A 3O8GA 3HTHA 3KKCA 3LSRA 3DPJA 2ZOZA 4GCLA 3ON4A 1JTXA 1JTYA 2G3BA 3NRGA 2JK3A 2IAIA 4M3DA 3GEUA 3B81A 4G12A 1QVUA 2VKEA 3VW0A 3HTIA 3ZQIA 2FQ4A 5HAWA 3G1MA 3G7RA 3DEWA 3BHQA 5FKMA 3BR1A 2XDNA 3FK7A 3AQTA 4B1RA 2GENA 3BTIA 1QVTA 5F27A 1RPWA 2QTQA 3IUVA 4V2FA 2YVHA 2WGBA 1UI5A 3Q0UA 2ZB9A 3ZQHA 3QKXA 2XRLA 3TP0A
chains in the Genus database with same CATH superfamily
4XK4A 3DU5A 2Y2ZA 2XPVA 5HBUA 3KKDA 2FJI1 5J3LA 1VI0A 2UXPA 5EFYA 2RASA 3IH3A 3V6GA 1JUMA 2WUIA 3NXCA 5EYRA 2O7TA 2XGEA 3CDLA 2TCTA 3S5RA 4X1EA 2WV1A 3IH4A 4MK6A 2HQ5A 3ZQFA 1UI6A 2UXUA 3Q3SA 4D5CA 2DG8A 2IU5A 2FBQA 4UDSA 4B3AA 5D18A 3WHCA 3ZQGA 4JL3A 3ZQLA 3QBMA 2V57A 3C2BA 5FGLA 5DAJA 2GBYA 3HTAA 2X6OA 5FKKA 3BRUA 3VVZA 5F0CA 2EH3A 5IPAA 4NN1A 3T6NA 5GP9A 5J1YA 3PPBA 2OERA 4ACIA 4YZEA 1JUSA 3NS4A 3RH2A 3K8PC 5FHPA 2DTZA 2ZCXA 2G7LA 5K7HA 5K7FA 1U9NA 3VW1A 3HIMA 2UXIA 3NNRA 2ZY9A 2RHAA 2XGDA 3MVPA 4AC6A 5J1UA 1T33A 5GPCA 4ICHA 4GFKA 5IOYA 3VP5A 2VKVA 5H9TA 3LWJA 4AF5A 2UXHA 3G56A 5CXGA 4KWAA 2ZOYA 1ZK8A 3IH2A 4PXIA 5FKLA 3CCYA 4NELA 2ZCMA 4JYKA 3LHQA 5FMPA 5J1RA 5EZGA 2GUHA 3AQSA 2FD5A 4GFLA 5K7ZA 3PASA 4M3GA 4W1UA 2FX0A 2HKUA 3VVXA 5F0HA 5IP6A 2QCOA 1U9OA 2RAEA 4DVYP 2YVEA 5CQGA 5EZHA 2TRTA 3BR0A 2XPUA 4D7MA 5GPAA 4CGRA 3BR2A 1JUPA 3VVYA 3VOKA 2HXOA 3O60A 3VPRA 5D1RA 3QPSA 2IBDA 2R7SA 3ON2A 2F07A 3ANGA 3BCGA 4AC0A 4GCTA 3BR3A 5HSZA 3COLA 2W53A 3BNIA 2QOPA 2GFNA 5D19A 3JSJA 1RKWA 2QKOA 3CWRA 2ZCNA 5IOZA 3P9TA 3EUPA 2REKA 5FKNA 3BTCA 2IEKA 4MXMA 3BJBA 2HYTA 3HGYA 3BT9A 2PFVA 4W97A 3QQAA 3SFIA 3TP3A 3FIWA 4L62A 3PM1A 3SDGA 2OPTA 3EGQA 2R7QA 1Z0XA 5F0FA 5K58A 2OI8A 2G7SA 4HKUA 3B6CA 3RD3A 2X9DA 2NX4A 3F1BA 5F04A 2JJ7A 3FRQA 2Y30A 3QPLA 4M3EA 3LOCA 2Y31A 4U9NA 2R7UA 3ANPA 1ZKGA 3BQZA 4ME9A 4MO7A 1JT6A 3LJLA 2NS7A 3NPIA 3B6AA 5AQCA 2I10A 3HE0A 5CW8A 3SWHA 1JT0A 3BR6A 4D7NA 2R7TA 2QIBA 3G1LA 3GZIA 3KZ9A 3HTJA 2NS8A 2QWTA 4M3FA 3Q0WA 3Q0VA 2ID6A 1ORKA 3BTLA 2UXOA 2PBXA 4IRVA 1Z77A 3LSPA 2R7OA 1QPIA 4ABZA 1BJZA 2DG7A 3VOXA 4I6ZA 4DW6A 2FJ1A 3DCFA 4D5FA 2YVXA 1SGMA 3WHBA 2G0EA 2NP3A 5CXIA 2VPRA 4AUXA 4C2MA 3VW2A 3F0CA 3DU6A 1RKTA 4JKZA 3C07A 5C4YA 3E7QA 2XPWA 3FHNA 5F08A 4OD5A 2PZ9A 2OF7A 3LSJA 4GCKA 3G1OA 3V78A 1T56A 4JNNA 2G7GA 2R7VA 4V2GA 3BQYA 2XGCA 5F1JA 3BR5A 4I76A 3KYLA 3KNWA 2HXIA 1A6IA 3VUQA 3BTJA 5FKOA 3VIBA 2ID3A 3HGGA 2NP5A 3O8HA 4M3BA 2HYJA 4WIBA 3FK6A 2XB5A 2D6YA 3CJDA 3MNLA 2O7OA 2Q24A 3CRJA 3NI7A 3O8GA 3HTHA 3KKCA 3LSRA 3DPJA 2ZOZA 4GCLA 2R7XA 3ON4A 1JTXA 1JTYA 2G3BA 3NRGA 2A2FX 2JK3A 2R7WA 2IAIA 4M3DA 3GEUA 3B81A 4G12A 1QVUA 2VKEA 3VW0A 3HTIA 2B3WA 3ZQIA 2FQ4A 5HAWA 3G1MA 2B1EA 3G7RA 3DEWA 3BHQA 5FKMA 3BR1A 2XDNA 3FK7A 3AQTA 4U9LA 4B1RA 2GENA 3BTIA 1QVTA 5F27A 1RPWA 2QTQA 3IUVA 4V2FA 3VTIA 2YVHA 2R7RA 2WGBA 1UI5A 3Q0UA 2ZB9A 3ZQHA 3QKXA 4OD4A 2XRLA 3TP0A
chains in the Genus database with same CATH topology
4XK4A 2Y2ZA 2XPVA 5HBUA 3KKDA 5J3LA 1VI0A 2UXPA 5EFYA 2RASA 3IH3A 3V6GA 1JUMA 2WUIA 3NXCA 5EYRA 2O7TA 2XGEA 3CDLA 2TCTA 3S5RA 4X1EA 2WV1A 3IH4A 4MK6A 2HQ5A 3ZQFA 1UI6A 2UXUA 3Q3SA 4D5CA 2DG8A 2IU5A 2FBQA 4UDSA 4B3AA 5D18A 3WHCA 3ZQGA 4JL3A 3ZQLA 3QBMA 2V57A 3C2BA 5FGLA 5DAJA 2GBYA 3HTAA 2X6OA 5FKKA 3BRUA 3VVZA 5F0CA 2EH3A 5IPAA 4NN1A 3T6NA 5GP9A 5J1YA 3PPBA 2OERA 4ACIA 4YZEA 1JUSA 3RH2A 5FHPA 2DTZA 2ZCXA 2G7LA 5K7HA 5K7FA 1U9NA 3VW1A 3HIMA 2UXIA 3NNRA 2RHAA 2XGDA 3MVPA 4AC6A 5J1UA 1T33A 5GPCA 4ICHA 4GFKA 5IOYA 3VP5A 2VKVA 5H9TA 3LWJA 4AF5A 2UXHA 3G56A 5CXGA 4KWAA 2ZOYA 1ZK8A 3IH2A 4PXIA 5FKLA 3CCYA 4NELA 2ZCMA 4JYKA 3LHQA 5FMPA 5J1RA 5EZGA 2GUHA 3AQSA 2FD5A 4GFLA 5K7ZA 3PASA 4M3GA 4W1UA 2FX0A 2HKUA 3VVXA 5F0HA 5IP6A 2QCOA 1U9OA 2RAEA 2YVEA 5EZHA 2TRTA 3BR0A 2XPUA 4D7MA 5GPAA 4CGRA 3BR2A 1JUPA 3VVYA 3VOKA 2HXOA 3O60A 3VPRA 5D1RA 3QPSA 2IBDA 3ON2A 2F07A 3ANGA 3BCGA 4AC0A 4GCTA 3BR3A 5HSZA 3COLA 2W53A 3BNIA 2QOPA 2GFNA 5D19A 3JSJA 1RKWA 2QKOA 3CWRA 2ZCNA 5IOZA 3P9TA 3EUPA 2REKA 5FKNA 3BTCA 2IEKA 4MXMA 3BJBA 2HYTA 3HGYA 3BT9A 4W97A 3QQAA 3SFIA 3TP3A 3FIWA 4L62A 3PM1A 3SDGA 2OPTA 3EGQA 1Z0XA 5F0FA 5K58A 2OI8A 2G7SA 4HKUA 3B6CA 3RD3A 2X9DA 2NX4A 3F1BA 5F04A 2JJ7A 3FRQA 2Y30A 3QPLA 4M3EA 3LOCA 2Y31A 3ANPA 1ZKGA 3BQZA 4ME9A 4MO7A 1JT6A 3LJLA 2NS7A 3NPIA 3B6AA 5AQCA 2I10A 3HE0A 5CW8A 1JT0A 3BR6A 4D7NA 2QIBA 3G1LA 3GZIA 3KZ9A 3HTJA 2NS8A 2QWTA 4M3FA 3Q0WA 3Q0VA 2ID6A 1ORKA 3BTLA 2UXOA 2PBXA 1Z77A 3LSPA 1QPIA 4ABZA 1BJZA 2DG7A 3VOXA 4I6ZA 4DW6A 2FJ1A 3DCFA 4D5FA 1SGMA 3WHBA 2G0EA 2NP3A 5CXIA 2VPRA 4AUXA 3VW2A 3F0CA 1RKTA 4JKZA 3C07A 5C4YA 3E7QA 2XPWA 5F08A 2PZ9A 2OF7A 3LSJA 4GCKA 3G1OA 3V78A 1T56A 4JNNA 2G7GA 4V2GA 3BQYA 5F1JA 2XGCA 3BR5A 4I76A 3KNWA 2HXIA 1A6IA 3VUQA 3BTJA 5FKOA 3VIBA 2ID3A 3HGGA 2NP5A 3O8HA 4M3BA 2HYJA 3FK6A 2XB5A 2D6YA 3CJDA 3MNLA 2O7OA 2Q24A 3CRJA 3NI7A 3O8GA 3HTHA 3KKCA 3LSRA 3DPJA 2ZOZA 4GCLA 3ON4A 1JTXA 1JTYA 2G3BA 3NRGA 2JK3A 2IAIA 4M3DA 3GEUA 3B81A 4G12A 1QVUA 2VKEA 3VW0A 3HTIA 3ZQIA 2FQ4A 5HAWA 3G1MA 3G7RA 3DEWA 3BHQA 5FKMA 3BR1A 2XDNA 3FK7A 3AQTA 4B1RA 2GENA 3BTIA 1QVTA 5F27A 1RPWA 2QTQA 3IUVA 4V2FA 2YVHA 2WGBA 1UI5A 3Q0UA 2ZB9A 3ZQHA 3QKXA 2XRLA 3TP0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XK4 A;  2Y2Z A;  2XPV A;  5HBU A;  3KKD A;  5J3L A;  1VI0 A;  2UXP A;  5EFY A;  2RAS A;  3IH3 A;  3V6G A;  1JUM A;  2WUI A;  3NXC A;  5EYR A;  2O7T A;  2XGE A;  3CDL A;  2TCT A;  3S5R A;  4X1E A;  2WV1 A;  3IH4 A;  4MK6 A;  2HQ5 A;  3ZQF A;  1UI6 A;  2UXU A;  3Q3S A;  4D5C A;  2DG8 A;  2IU5 A;  2FBQ A;  4UDS A;  4B3A A;  5D18 A;  3WHC A;  3ZQG A;  4JL3 A;  3ZQL A;  3QBM A;  2V57 A;  3C2B A;  5FGL A;  5DAJ A;  2GBY A;  3HTA A;  2X6O A;  5FKK A;  3BRU A;  3VVZ A;  5F0C A;  2EH3 A;  5IPA A;  4NN1 A;  3T6N A;  5GP9 A;  5J1Y A;  3PPB A;  2OER A;  4ACI A;  4YZE A;  1JUS A;  3RH2 A;  5FHP A;  2DTZ A;  2ZCX A;  2G7L A;  5K7H A;  5K7F A;  1U9N A;  3VW1 A;  3HIM A;  2UXI A;  3NNR A;  2RHA A;  2XGD A;  3MVP A;  4AC6 A;  5J1U A;  1T33 A;  5GPC A;  4ICH A;  4GFK A;  5IOY A;  3VP5 A;  2VKV A;  5H9T A;  3LWJ A;  4AF5 A;  2UXH A;  3G56 A;  5CXG A;  4KWA A;  2ZOY A;  1ZK8 A;  3IH2 A;  4PXI A;  5FKL A;  3CCY A;  4NEL A;  2ZCM A;  4JYK A;  3LHQ A;  5FMP A;  5J1R A;  5EZG A;  2GUH A;  3AQS A;  2FD5 A;  4GFL A;  5K7Z A;  3PAS A;  4M3G A;  4W1U A;  2FX0 A;  2HKU A;  3VVX A;  5F0H A;  5IP6 A;  2QCO A;  1U9O A;  2RAE A;  2YVE A;  5EZH A;  2TRT A;  3BR0 A;  2XPU A;  4D7M A;  5GPA A;  4CGR A;  3BR2 A;  1JUP A;  3VVY A;  3VOK A;  2HXO A;  3O60 A;  3VPR A;  5D1R A;  3QPS A;  2IBD A;  3ON2 A;  2F07 A;  3ANG A;  3BCG A;  4AC0 A;  4GCT A;  3BR3 A;  5HSZ A;  3COL A;  2W53 A;  3BNI A;  2QOP A;  2GFN A;  5D19 A;  3JSJ A;  1RKW A;  2QKO A;  3CWR A;  2ZCN A;  5IOZ A;  3P9T A;  3EUP A;  2REK A;  5FKN A;  3BTC A;  2IEK A;  4MXM A;  3BJB A;  2HYT A;  3HGY A;  3BT9 A;  4W97 A;  3QQA A;  3SFI A;  3TP3 A;  3FIW A;  4L62 A;  3PM1 A;  3SDG A;  2OPT A;  3EGQ A;  1Z0X A;  5F0F A;  5K58 A;  2OI8 A;  2G7S A;  4HKU A;  3B6C A;  3RD3 A;  2X9D A;  2NX4 A;  3F1B A;  5F04 A;  2JJ7 A;  3FRQ A;  2Y30 A;  3QPL A;  4M3E A;  3LOC A;  2Y31 A;  3ANP A;  1ZKG A;  3BQZ A;  4ME9 A;  4MO7 A;  1JT6 A;  3LJL A;  2NS7 A;  3NPI A;  3B6A A;  5AQC A;  2I10 A;  3HE0 A;  5CW8 A;  1JT0 A;  3BR6 A;  4D7N A;  2QIB A;  3G1L A;  3GZI A;  3KZ9 A;  3HTJ A;  2NS8 A;  2QWT A;  4M3F A;  3Q0W A;  3Q0V A;  2ID6 A;  1ORK A;  3BTL A;  2UXO A;  2PBX A;  1Z77 A;  3LSP A;  1QPI A;  4ABZ A;  1BJZ A;  2DG7 A;  3VOX A;  4I6Z A;  4DW6 A;  2FJ1 A;  3DCF A;  4D5F A;  1SGM A;  3WHB A;  2G0E A;  2NP3 A;  5CXI A;  2VPR A;  4AUX A;  3VW2 A;  3F0C A;  1RKT A;  4JKZ A;  3C07 A;  5C4Y A;  3E7Q A;  2XPW A;  5F08 A;  2PZ9 A;  2OF7 A;  3LSJ A;  4GCK A;  3G1O A;  3V78 A;  1T56 A;  4JNN A;  2G7G A;  4V2G A;  3BQY A;  5F1J A;  2XGC A;  3BR5 A;  4I76 A;  3KNW A;  2HXI A;  1A6I A;  3VUQ A;  3BTJ A;  5FKO A;  3VIB A;  2ID3 A;  3HGG A;  2NP5 A;  3O8H A;  4M3B A;  2HYJ A;  3FK6 A;  2XB5 A;  2D6Y A;  3CJD A;  3MNL A;  2O7O A;  2Q24 A;  3CRJ A;  3NI7 A;  3O8G A;  3HTH A;  3KKC A;  3LSR A;  3DPJ A;  2ZOZ A;  4GCL A;  3ON4 A;  1JTX A;  1JTY A;  2G3B A;  3NRG A;  2JK3 A;  2IAI A;  4M3D A;  3GEU A;  3B81 A;  4G12 A;  1QVU A;  2VKE A;  3VW0 A;  3HTI A;  3ZQI A;  2FQ4 A;  5HAW A;  3G1M A;  3G7R A;  3DEW A;  3BHQ A;  5FKM A;  3BR1 A;  2XDN A;  3FK7 A;  3AQT A;  4B1R A;  2GEN A;  3BTI A;  1QVT A;  5F27 A;  1RPW A;  2QTQ A;  3IUV A;  4V2F A;  2YVH A;  2WGB A;  1UI5 A;  3Q0U A;  2ZB9 A;  3ZQH A;  3QKX A;  2XRL A;  3TP0 A; 
#chains in the Genus database with same CATH topology
 4XK4 A;  3DU5 A;  2Y2Z A;  2XPV A;  5HBU A;  3KKD A;  2FJI 1;  5J3L A;  1VI0 A;  2UXP A;  5EFY A;  2RAS A;  3IH3 A;  3V6G A;  1JUM A;  2WUI A;  3NXC A;  5EYR A;  2O7T A;  2XGE A;  3CDL A;  2TCT A;  3S5R A;  4X1E A;  2WV1 A;  3IH4 A;  4MK6 A;  2HQ5 A;  3ZQF A;  1UI6 A;  2UXU A;  3Q3S A;  4D5C A;  2DG8 A;  2IU5 A;  2FBQ A;  4UDS A;  4B3A A;  5D18 A;  3WHC A;  3ZQG A;  4JL3 A;  3ZQL A;  3QBM A;  2V57 A;  3C2B A;  5FGL A;  5DAJ A;  2GBY A;  3HTA A;  2X6O A;  5FKK A;  3BRU A;  3VVZ A;  5F0C A;  2EH3 A;  5IPA A;  4NN1 A;  3T6N A;  5GP9 A;  5J1Y A;  3PPB A;  2OER A;  4ACI A;  4YZE A;  1JUS A;  3NS4 A;  3RH2 A;  3K8P C;  5FHP A;  2DTZ A;  2ZCX A;  2G7L A;  5K7H A;  5K7F A;  1U9N A;  3VW1 A;  3HIM A;  2UXI A;  3NNR A;  2ZY9 A;  2RHA A;  2XGD A;  3MVP A;  4AC6 A;  5J1U A;  1T33 A;  5GPC A;  4ICH A;  4GFK A;  5IOY A;  3VP5 A;  2VKV A;  5H9T A;  3LWJ A;  4AF5 A;  2UXH A;  3G56 A;  5CXG A;  4KWA A;  2ZOY A;  1ZK8 A;  3IH2 A;  4PXI A;  5FKL A;  3CCY A;  4NEL A;  2ZCM A;  4JYK A;  3LHQ A;  5FMP A;  5J1R A;  5EZG A;  2GUH A;  3AQS A;  2FD5 A;  4GFL A;  5K7Z A;  3PAS A;  4M3G A;  4W1U A;  2FX0 A;  2HKU A;  3VVX A;  5F0H A;  5IP6 A;  2QCO A;  1U9O A;  2RAE A;  4DVY P;  2YVE A;  5CQG A;  5EZH A;  2TRT A;  3BR0 A;  2XPU A;  4D7M A;  5GPA A;  4CGR A;  3BR2 A;  1JUP A;  3VVY A;  3VOK A;  2HXO A;  3O60 A;  3VPR A;  5D1R A;  3QPS A;  2IBD A;  2R7S A;  3ON2 A;  2F07 A;  3ANG A;  3BCG A;  4AC0 A;  4GCT A;  3BR3 A;  5HSZ A;  3COL A;  2W53 A;  3BNI A;  2QOP A;  2GFN A;  5D19 A;  3JSJ A;  1RKW A;  2QKO A;  3CWR A;  2ZCN A;  5IOZ A;  3P9T A;  3EUP A;  2REK A;  5FKN A;  3BTC A;  2IEK A;  4MXM A;  3BJB A;  2HYT A;  3HGY A;  3BT9 A;  2PFV A;  4W97 A;  3QQA A;  3SFI A;  3TP3 A;  3FIW A;  4L62 A;  3PM1 A;  3SDG A;  2OPT A;  3EGQ A;  2R7Q A;  1Z0X A;  5F0F A;  5K58 A;  2OI8 A;  2G7S A;  4HKU A;  3B6C A;  3RD3 A;  2X9D A;  2NX4 A;  3F1B A;  5F04 A;  2JJ7 A;  3FRQ A;  2Y30 A;  3QPL A;  4M3E A;  3LOC A;  2Y31 A;  4U9N A;  2R7U A;  3ANP A;  1ZKG A;  3BQZ A;  4ME9 A;  4MO7 A;  1JT6 A;  3LJL A;  2NS7 A;  3NPI A;  3B6A A;  5AQC A;  2I10 A;  3HE0 A;  5CW8 A;  3SWH A;  1JT0 A;  3BR6 A;  4D7N A;  2R7T A;  2QIB A;  3G1L A;  3GZI A;  3KZ9 A;  3HTJ A;  2NS8 A;  2QWT A;  4M3F A;  3Q0W A;  3Q0V A;  2ID6 A;  1ORK A;  3BTL A;  2UXO A;  2PBX A;  4IRV A;  1Z77 A;  3LSP A;  2R7O A;  1QPI A;  4ABZ A;  1BJZ A;  2DG7 A;  3VOX A;  4I6Z A;  4DW6 A;  2FJ1 A;  3DCF A;  4D5F A;  2YVX A;  1SGM A;  3WHB A;  2G0E A;  2NP3 A;  5CXI A;  2VPR A;  4AUX A;  4C2M A;  3VW2 A;  3F0C A;  3DU6 A;  1RKT A;  4JKZ A;  3C07 A;  5C4Y A;  3E7Q A;  2XPW A;  3FHN A;  5F08 A;  4OD5 A;  2PZ9 A;  2OF7 A;  3LSJ A;  4GCK A;  3G1O A;  3V78 A;  1T56 A;  4JNN A;  2G7G A;  2R7V A;  4V2G A;  3BQY A;  2XGC A;  5F1J A;  3BR5 A;  4I76 A;  3KYL A;  3KNW A;  2HXI A;  1A6I A;  3VUQ A;  3BTJ A;  5FKO A;  3VIB A;  2ID3 A;  3HGG A;  2NP5 A;  3O8H A;  4M3B A;  2HYJ A;  4WIB A;  3FK6 A;  2XB5 A;  2D6Y A;  3CJD A;  3MNL A;  2O7O A;  2Q24 A;  3CRJ A;  3NI7 A;  3O8G A;  3HTH A;  3KKC A;  3LSR A;  3DPJ A;  2ZOZ A;  4GCL A;  2R7X A;  3ON4 A;  1JTX A;  1JTY A;  2G3B A;  3NRG A;  2A2F X;  2JK3 A;  2R7W A;  2IAI A;  4M3D A;  3GEU A;  3B81 A;  4G12 A;  1QVU A;  2VKE A;  3VW0 A;  3HTI A;  2B3W A;  3ZQI A;  2FQ4 A;  5HAW A;  3G1M A;  2B1E A;  3G7R A;  3DEW A;  3BHQ A;  5FKM A;  3BR1 A;  2XDN A;  3FK7 A;  3AQT A;  4U9L A;  4B1R A;  2GEN A;  3BTI A;  1QVT A;  5F27 A;  1RPW A;  2QTQ A;  3IUV A;  4V2F A;  3VTI A;  2YVH A;  2R7R A;  2WGB A;  1UI5 A;  3Q0U A;  2ZB9 A;  3ZQH A;  3QKX A;  4OD4 A;  2XRL A;  3TP0 A; 
#chains in the Genus database with same CATH homology
 4XK4 A;  2Y2Z A;  2XPV A;  5HBU A;  3KKD A;  5J3L A;  1VI0 A;  2UXP A;  5EFY A;  2RAS A;  3IH3 A;  3V6G A;  1JUM A;  2WUI A;  3NXC A;  5EYR A;  2O7T A;  2XGE A;  3CDL A;  2TCT A;  3S5R A;  4X1E A;  2WV1 A;  3IH4 A;  4MK6 A;  2HQ5 A;  3ZQF A;  1UI6 A;  2UXU A;  3Q3S A;  4D5C A;  2DG8 A;  2IU5 A;  2FBQ A;  4UDS A;  4B3A A;  5D18 A;  3WHC A;  3ZQG A;  4JL3 A;  3ZQL A;  3QBM A;  2V57 A;  3C2B A;  5FGL A;  5DAJ A;  2GBY A;  3HTA A;  2X6O A;  5FKK A;  3BRU A;  3VVZ A;  5F0C A;  2EH3 A;  5IPA A;  4NN1 A;  3T6N A;  5GP9 A;  5J1Y A;  3PPB A;  2OER A;  4ACI A;  4YZE A;  1JUS A;  3RH2 A;  5FHP A;  2DTZ A;  2ZCX A;  2G7L A;  5K7H A;  5K7F A;  1U9N A;  3VW1 A;  3HIM A;  2UXI A;  3NNR A;  2RHA A;  2XGD A;  3MVP A;  4AC6 A;  5J1U A;  1T33 A;  5GPC A;  4ICH A;  4GFK A;  5IOY A;  3VP5 A;  2VKV A;  5H9T A;  3LWJ A;  4AF5 A;  2UXH A;  3G56 A;  5CXG A;  4KWA A;  2ZOY A;  1ZK8 A;  3IH2 A;  4PXI A;  5FKL A;  3CCY A;  4NEL A;  2ZCM A;  4JYK A;  3LHQ A;  5FMP A;  5J1R A;  5EZG A;  2GUH A;  3AQS A;  2FD5 A;  4GFL A;  5K7Z A;  3PAS A;  4M3G A;  4W1U A;  2FX0 A;  2HKU A;  3VVX A;  5F0H A;  5IP6 A;  2QCO A;  1U9O A;  2RAE A;  2YVE A;  5EZH A;  2TRT A;  3BR0 A;  2XPU A;  4D7M A;  5GPA A;  4CGR A;  3BR2 A;  1JUP A;  3VVY A;  3VOK A;  2HXO A;  3O60 A;  3VPR A;  5D1R A;  3QPS A;  2IBD A;  3ON2 A;  2F07 A;  3ANG A;  3BCG A;  4AC0 A;  4GCT A;  3BR3 A;  5HSZ A;  3COL A;  2W53 A;  3BNI A;  2QOP A;  2GFN A;  5D19 A;  3JSJ A;  1RKW A;  2QKO A;  3CWR A;  2ZCN A;  5IOZ A;  3P9T A;  3EUP A;  2REK A;  5FKN A;  3BTC A;  2IEK A;  4MXM A;  3BJB A;  2HYT A;  3HGY A;  3BT9 A;  4W97 A;  3QQA A;  3SFI A;  3TP3 A;  3FIW A;  4L62 A;  3PM1 A;  3SDG A;  2OPT A;  3EGQ A;  1Z0X A;  5F0F A;  5K58 A;  2OI8 A;  2G7S A;  4HKU A;  3B6C A;  3RD3 A;  2X9D A;  2NX4 A;  3F1B A;  5F04 A;  2JJ7 A;  3FRQ A;  2Y30 A;  3QPL A;  4M3E A;  3LOC A;  2Y31 A;  3ANP A;  1ZKG A;  3BQZ A;  4ME9 A;  4MO7 A;  1JT6 A;  3LJL A;  2NS7 A;  3NPI A;  3B6A A;  5AQC A;  2I10 A;  3HE0 A;  5CW8 A;  1JT0 A;  3BR6 A;  4D7N A;  2QIB A;  3G1L A;  3GZI A;  3KZ9 A;  3HTJ A;  2NS8 A;  2QWT A;  4M3F A;  3Q0W A;  3Q0V A;  2ID6 A;  1ORK A;  3BTL A;  2UXO A;  2PBX A;  1Z77 A;  3LSP A;  1QPI A;  4ABZ A;  1BJZ A;  2DG7 A;  3VOX A;  4I6Z A;  4DW6 A;  2FJ1 A;  3DCF A;  4D5F A;  1SGM A;  3WHB A;  2G0E A;  2NP3 A;  5CXI A;  2VPR A;  4AUX A;  3VW2 A;  3F0C A;  1RKT A;  4JKZ A;  3C07 A;  5C4Y A;  3E7Q A;  2XPW A;  5F08 A;  2PZ9 A;  2OF7 A;  3LSJ A;  4GCK A;  3G1O A;  3V78 A;  1T56 A;  4JNN A;  2G7G A;  4V2G A;  3BQY A;  5F1J A;  2XGC A;  3BR5 A;  4I76 A;  3KNW A;  2HXI A;  1A6I A;  3VUQ A;  3BTJ A;  5FKO A;  3VIB A;  2ID3 A;  3HGG A;  2NP5 A;  3O8H A;  4M3B A;  2HYJ A;  3FK6 A;  2XB5 A;  2D6Y A;  3CJD A;  3MNL A;  2O7O A;  2Q24 A;  3CRJ A;  3NI7 A;  3O8G A;  3HTH A;  3KKC A;  3LSR A;  3DPJ A;  2ZOZ A;  4GCL A;  3ON4 A;  1JTX A;  1JTY A;  2G3B A;  3NRG A;  2JK3 A;  2IAI A;  4M3D A;  3GEU A;  3B81 A;  4G12 A;  1QVU A;  2VKE A;  3VW0 A;  3HTI A;  3ZQI A;  2FQ4 A;  5HAW A;  3G1M A;  3G7R A;  3DEW A;  3BHQ A;  5FKM A;  3BR1 A;  2XDN A;  3FK7 A;  3AQT A;  4B1R A;  2GEN A;  3BTI A;  1QVT A;  5F27 A;  1RPW A;  2QTQ A;  3IUV A;  4V2F A;  2YVH A;  2WGB A;  1UI5 A;  3Q0U A;  2ZB9 A;  3ZQH A;  3QKX A;  2XRL A;  3TP0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...