3BR3A

Crystal structure of the complex of ethidium bound to qacr(e90q), a mutant of a multidrug binding transcriptional repressor
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
185
structure length
185
Chain Sequence
LKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKSEQIKAKTNREKFYLYNELSLTTQYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords HTH-type transcriptional regulator qacR
publication title Formal electrostatic interactions do not govern QacR-cation affinity
rcsb
source organism Staphylococcus aureus
total genus 76
structure length 185
sequence length 185
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3br3A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3br3A02
3EGQA 1Y1WJ 3IH4A 4FISA 2O7TA 2MSYA 3S1QJ 2R5YB 3E7QA 2ZOYA 3EUPA 2HQ5A 2HKUA 1MNMC 3NAUA 2R0QC 1TWGJ 4M3GA 1IC8A 2XGCA 2JMWA 5FGLA 3BG5A 2GM4A 3S16J 3ON4A 2R5YA 2JK3A 2M34A 3S2DJ 2R93J 5EEAA 4V2FA 1H8AC 1B72A 2X48A 2E2JJ 2DA6A 2CJJA 2LKXA 1XS9A 1W0UA 2EZKA 1RKTA 3IH2A 2LY9A 3G1LA 1AKHA 1APLC 3WHBA 3L1PA 5E3OA 1LE8B 4M3EA 2YVHA 1ZK8A 3C2BA 3ANPA 3Q0UA 4GFBA 2GENA 2Y9ZA 2K9NA 5C4XJ 3DCFA 2JA5J 2JA7J 4MXMA 2KT0A 1TWHJ 2JA8J 2PBXA 1Y1VJ 1JGGA 2LTPA 2HI3A 2JA6J 5FKMA 2VKEA 1ETXA 4A3KJ 2E2IJ 3GTOJ 3HTJA 2VI6A 2X9DA 3LWJA 3LNQA 4B4CA 3VP5A 1RPWA 3F0CA 4GCTA 1MSEC 4W1UA 4UDSA 2HXOA 1HF0A 1D5YA 2QWTA 3B81A 4MFEA 2DG8A 1IJWC 2L7MP 1VF9A 4DW6A 5IYCJ 2QKOA 4CYCB 3OSGA 4A3BJ 1FEXA 5EG0A 4FCYA 2X6OA 1K61A 1JKQC 5EGOA 3GTGJ 3NNRA 2AO9A 3GTQJ 3I4MJ 1Z77A 2TCTA 3JRDA 4X6AJ 1GDTA 2Q24A 1MBEA 1U78A 5IPAA 2CUFA 5EF6A 1T33A 1QVTA 3HIMA 3F1BA 3NPIA 2Y9YA 3BTLA 2UXOA 3A01A 5IP9J 4MO7A 2G7GA 3MVPA 2NVXJ 1OFCX 2COBA 1YRNA 3K2AA 2ECCA 3BR2A 4I76A 1ZR2A 3KKDA 1MBHA 1ZKGA 1VFCA 4JNNA 5C44J 2CU7A 2M2EA 4M6VA 5EZGA 2IBDA 3RKQA 5C4YA 1JUPA 5K58A 1PUFB 2XB5A 1RKWA 5IYBJ 4EEFG 4BY7J 2LVSA 3G1MA 1B8IB 2EH3A 2HYJA 4JX5A 1H88C 3BG9A 4CGRA 5M5YJ 3NRGA 2XPVA 3H0GJ 3Q0WA 5K7FA 1MBJA 1OCTC 1PUFA 2DJNA 1EF4A 2QTQA 1FIPA 3VOXA 2EZIA 5C4JJ 1ETVA 3PO3J 4A3GJ 1UHSA 4D7NA 2EZHA 5DS9A 1NTCA 2NVQJ 4DYQA 1BW6A 2I10A 1Q1VA 1VI0A 3S15J 1TWFJ 3FISA 3CRJA 2WGBA 4A3IJ 3JRBA 3JRHA 3JSJA 2VPRA 2H8RA 3CJDA 5DTDA 2MGQA 1DU6A 1A5JA 3S17J 3ZQFA 3K7AJ 4BXXJ 4A3JJ 4JL3A 3ZQIA 3VW2A 2L9RA 5IOZA 3S1RJ 1AU7A 3S1NJ 3LHQA 1GT0C 5CXIA 3HEFA 2ECBA 3GTMJ 1NK2P 4IHWA 4A93J 3TP3A 1GVDA 4C3IJ 2GUHA 1B72B 1XC5A 4M3DA 5JLXA 4XRSG 1JTYA 3CCYA 1JT6A 5F0CA 2N8GA 1AKHB 1SGMA 3HOYJ 4BY1J 1HLVA 3BRUA 3HGYA 5GP9A 2L7ZA 1MH3A 4MIMA 5F0FA 5FKKA 5H9TA 1K83J 3JRGA 5HBUA 5JLWA 2HOAA 2NVTJ 3S14J 2ELKA 4XIDA 2Y2ZA 5F1JA 3IV5A 3JRCA 1U8BA 3VIBA 4A3EJ 4NDLA 1HDDC 1ORKA 3Q3SA 1ZQ3P 1MBKA 2DA2A 1IGNA 2FX0A 3BQYA 5EYRA 3ANGA 3G56A 5D18A 5AQCA 2QOPA 3AQSA 5M3FJ 3MN2A 2K9QA 2ME6A 3VOKA 2ID6A 2WAQN 5BNGA 2H1KA 5F0HA 3HTIA 2QF7A 5F27A 5K7ZA 2M0CA 2YU9J 2ZCMA 4RDUA 2IAIA 2EZLA 1ETKA 3SFIA 3COLA 2CQQA 3ZQHA 2UXIA 1GUUA 5FKOA 1RESA 3CQZJ 5FKNA 3DEWA 3OIOA 1QRYA 5EG0B 3GTLJ 2DN0A 5EGOB 1TC3C 2MG4A 1I50J 1VNDA 3JRFA 3FK7A 2QCOA 5F04A 4UUSB 2OPTA 2DMTA 3HKZN 5M5XJ 1UI5A 3WHCA 1JT0A 1MH4A 2PMZN 2L7FP 3HTAA 2XGEA 1X2MA 5FJ8J 4A3DJ 2DMNA 3JRAA 4XICA 1WI3A 2AHQA 3A01B 2L0KA 3ZOBA 2LD5A 4G12A 4UUSA 2ID3A 3RZOJ 4D7MA 1FTZA 5GPAA 1P7JA 3RQIA 1HCRA 2ZOZA 4IHVA 1YRNB 2YVEA 5HODA 5J3LA 2ZCXA 1RR7A 3G7RA 2XRLA 4XRSA 2CUEA 1IG7A 2F07A 3GTKJ 3HOWJ 3RH2A 2FJ1A 3I4NJ 3GZIA 4MFDA 2EQRA 2GBYA 2LK2A 2K9SA 2D6YA 2R7ZJ 4D5CA 3LSJA 2NOGA 2IU5A 4AUXA 2FD5A 1ZTRA 1H89C 3HBLA 2W53A 4GFLA 5F08A 3O60A 3NARA 3H3VK 1F36A 2YUSA 3HGGA 3QQAA 2WUIA 4A69C 3TW7A 4B1RA 3JR9A 1A6IA 3C07A 3E7LA 2XGDA 3TW6A 3VW0A 1O4XA 1CQTA 2D5VA 1IDYA 3LSPA 3JREA 3QKXA 3BQZA 3BTCA 3OSFA 3CDLA 2E1OA 3VVYA 3ON2A 1MBFA 4Y52J 4C3JJ 1AHDP 1HDPA 4A3CJ 4I6ZA 2G7LA 3LSGA 4DZPA 4C2MJ 5D1RA 3BHQA 2RASA 2Y0SN 2ZB9A 5M5WJ 4LOCA 1GV2A 1OCPA 4J19A 5M3MJ 5FLVA 2V57A 3IH3A 2JN6A 1LFUP 4HNVA 1BJZA 1HOMA 2QIBA 2OI8A 1ZR4A 3BR1A 1P7IA 3QPLA 5E3LA 3GTJJ 3W6VA 5E3MA 2O9LA 5D19A 2XSDC 4ACIA 5FLMJ 2DTZA 2P81A 3RZDJ 5J1UA 4ABZA 3BR3A 1ITYA 1U9OA 4AF5A 3PASA 1TWAJ 2GLOA 2TRTA 1I3QJ 2NS8A 4PXIA 1POGA 4L5EA 2NP5A 1RETA 1ETYA 3IUVA 2DA7A 2UXUA 2XPUA 4AC6A 4GFKA 4JKZA 2OF7A 2ME0A 2XPWA 3B6CA 5FKLA 1QPIA 1E3OC 1UMQA 4MK6A 3PPBA 2M8GX 3BR5A 1JUSA 3KKCA 3LSRA 1UI6A 1Z0XA 2NS7A 2G0EA 2RAEA 4MLOA 3Q0VA 1IDZA 5IP7J 1OJLA 2LFBA 3MKLA 3PM1A 4NELA 3GBGA 3FIWA 3G1OA 5K7HA 4DZJA 2OERA 2HOSA 3VVXA 4FE4A 5GPCA 4M3BA 1JKRC 2JJ7A 1ETWA 3LOCA 3OOUA 4JP0A 3S1MJ 3ZQCA 4JX4A 1JJ6C 3BT9A 3TEDA 4W97A 4BKXA 3HOUJ 2MW8A 3M3YJ 2RHAA 4XK4A 3BCGA 5E3NA 2WB1N 2XB0X 4DYCA 3VW1A 2DA4A 3VUQA 2YS9A 2WV1A 1MSFC 3O8GA 3JRIA 2VUMJ 3CWRA 1W0TA 2E2HJ 3BTIA 1WGXA 4D5FA 4GCLA 1JKPC 2IEKA 1I6HJ 2O8KA 2G3BA 2UXHA 2DG7A 4X1EA 2ZCNA 3GEUA 1LE8A 5C3EJ 3PO2J 3FRQA 1GV5A 1MBGA 4AYBN 2DA3A 3SDGA 2HOTA 1NK3P 1T56A 3VPRA 2DA5A 4B3AA 1FJLA 2KDZA 2Y31A 2O7OA 1G2HA 2Y30A 4HKUA 4M3FA 3BG3A 3V78A 1X58A 2R5ZB 4FE7A 3CMYA 5J1YA 2CQXA 1S7EA 3HDDA 5IOYA 2PZ9A 5EDNA 4XRMA 2NVYJ 3D1NI 3HE0A 2R5ZA 1QVUA 1JJ8C 2REKA 3FK6A 3HOXJ 4C3HJ 2W48A 5HSZA 3DPJA 2LLKA 4ME9A 2E19A 3SJMA 1WH7A 5J1RA 1XG1A 4CYCA 4A3FJ 2B63J 1ETOA 1WCMJ 2FQ4A 4V2GA 2HYTA 1ETQA 3S2HJ 1WPKA 1F43A 1WH5A 1IRZA 2DMPA 1ENHA 4UUTA 3A03A 4IEJA 4BBRJ 1FIAA 5EZHA 1UG2A 2K40A 4FTHA 3GTPJ 2FBQA 4GCKA 1R9TJ 4JX6A 4DYRA 3HTHA 3KZ9A 4QTRA 3V6GA 4A3MJ 2CRGA 9ANTA 4JYKA 4ICHA 3VVZA 3M4OJ 3NI7A 3FKIJ 3KNWA 5FHPA 5EFYA 2JWTA 2LP0A 4QSHA 3AQTA 3MNLA 1BL0A 4KWAA 5CW8A 2DMUA 1DU0A 4NN1A 5DAJA 3NXCA 3B6AA 1IV6A 3RD3A 1ZGWA 3TP0A 4QIWN 2EBIA 2VKVA 1FTTA 3S5RA 1BA5A 1SANA 1TWCJ 3BNIA 3ZQGA 2HXIA 1JKOC 4IHYA 2R92J 5IYDJ 1BW5A 2NP3A 3BJBA 1LFBA 1B8IA 2NX4A 3O8HA 3HOZJ 4RBOA 1X2NA 1SFOJ 3HB9A 1U9NA 5HAWA 3A02A 4IHXA 2DA1A 4Y7NJ 3UKGA 4YZEA 3BR0A 2LR8A 3BTJA 3HM5A 4A3LJ 4L62A 5FMPA 1IUFA 3BR6A 2UXPA 3T6NA 2GFNA 3LJLA 3P9TA 2M9HA 2DMQA 3HOVJ 4BBSJ 5IP6A 1JUMA 2XDNA 1JTXA 3ZQLA 2G7SA 3QPSA 4S0HB 2HDDA 3QBMA 4AC0A 5CXGA
chains in the Genus database with same CATH superfamily
3L7WA 4LK0F 1Y1WJ 1FOKA 3CCJI 3L09A 2HPIA 3IC7A 3KFWX 5LGNA 3S1QJ 2OTJI 5L3BA 2QA4I 3EDPA 2HQ5A 1SVLA 2WY7Q 1S8NA 4L0YB 2V1DA 3FXKA 4R8HA 1TWGJ 3TDZC 3NS4A 4BAYA 5FGLA 2PFVA 3I59B 2VLAA 3A0HC 3ON4A 2OD5A 3S2DJ 5EEAA 1HKSA 4V2FA 2X48A 1I1GA 2CJJA 3Q9VA 2LKXA 1W0UA 2EZKA 3IHUA 4EATA 2LY9A 4M74A 5E79C 3L1PA 1JXSA 2EV5A 4M3EA 5J47A 3W6JB 2DYSH 5FGMA 1VTNC 2K9NA 3DCFA 4HOBA 4KFCA 1XMKA 1T0FC 2GA2A 2JA8J 2PBXA 2EJRA 4Y33A 4GXOA 1Y1VJ 4E7HA 2JA6J 3AG2H 2XSJC 3S32A 3OL3A 3L2UA 3LAJA 2HNHA 5DV5A 3MKWB 3LFKA 1HSJA 3LWJA 1BBYA 4M9SA 3RYRA 3KYCB 3HPGA 5BOXA 2DODA 1J59A 4B8XA 4GCTA 3GF2A 3SEZA 2A05A 4UDSA 1D5YA 4FASD 3WU1B 2RQQA 3KYLA 1R4MB 3OSGA 1OCZH 4CZZA 3K1MA 3B73A 3GTGJ 2YPRA 3ASOH 2AO9A 3GTQJ 2CFOA 3DF8A 2NS0A 5D5WB 4RLFA 4P1WA 1FOWA 2G7UA 1MBEA 3IKVA 2NNNA 2XV4S 3ECOA 1D0ZA 2QZ8A 3F6VA 5L3DA 1UAAA 2Y9YA 2DBBA 2KP6A 2G7GA 2CMPA 2X6WA 1OFCX 5FRMA 3ABLH 3R4KA 2ECCA 1QGPA 2RC4A 3LFUA 2FMYA 1KYWA 1ZR2A 1IN8A 4BQQA 1MBHA 4CCMA 5FRNA 1ZKGA 3T8RA 1PP8F 2CU7A 1Z21A 2QKLB 5C4YA 4ZDPA 3F8MA 2PBIA 1LJ9A 2MD5A 4BY7J 3V7CA 4HRIA 2LVSA 3O6BB 4PJJA 2EH3A 3ABKH 1LFPA 3Q9SA 2HYJA 3OYJA 1B8IB 1WZ2A 2GA1A 3NRGA 2XPVA 1D5VA 4EGZA 1OCTC 4IL6C 1DGWY 3NRVA 4PJLA 1PUFA 1FP2A 2EA4A 1TBXA 1EF4A 1FIPA 4X0GA 1H0MA 5BMZA 3ECHA 4KIFA 5LBQA 2EZHA 3K69A 5DS9A 1CF7A 1TT0A 3WTUC 2NVQJ 1RI7A 1EKEA 1XN7A 1ZGJA 5L3EA 3CRJA 2ZXJA 2XIGA 4LLGF 3DEUA 1O57A 1TTYA 2L4MA 3SFZA 4LGWA 1T98A 2ELJA 2YSRA 2MGQA 1A5JA 2E7XA 3ZQFA 3ABTA 4E7KA 2LC2A 2W00A 1K6OA 1VQ7I 2HEOA 3LHQA 1RRJA 2IGOA 2VODA 3OYNA 4IHWA 3KX2A 4A93J 2HFHA 3MZYA 4PJMA 2MLGA 1GVDA 4PFOA 1D1CA 5CLSA 1XC5A 3CF5F 4DOZA 1JTYA 1H9TA 2XAUA 1JT6A 5JR3A 3HRUA 3P5JA 1FYMA 4BY1J 1HLVA 3BRUA 2D45A 5GP9A 2GOXB 3JRGA 1TNSA 5HBUA 2F4IA 5D5VB 1BC8C 4IVNA 4KNYA 1JI8A 3OY9A 1R58A 2DO7A 2XF6A 3RDIA 1OLTA 2DU9A 4J00A 1LVKA 4A3EJ 1F1ZA 3M8EA 1P4AA 3RKXA 3CUOA 3HSRA 4ZDLA 3G56A 3FXMA 1Y6IA 2BZTA 1IF1A 5D18A 4R79A 5E18F 2DQRA 1FMVA 5M3FJ 5ERIA 2WAQN 2H1KA 3VFZA 3CJNA 4BHPA 2E1CA 3W6KB 1ZH5A 2KRFA 4WXHA 2BY0A 5FFXA 4RDUA 2IAIA 3SFIA 4AIJA 2CQQA 3CC2I 2HWVA 4G6DA 4OMZA 2F5VA 3CQZJ 3FZVA 3A1YA 1RIOH 3CO7C 2QUFA 4V19K 5D8KB 2JRTA 1HQCA 2LMDA 1TLHB 5F04A 4UUSB 3R61A 2IPQX 4ZYAA 3BLYA 5JHUA 4O3MA 4BL0B 5E1XA 2DW4A 3KIOA 4RB1A 4GDFA 1D0XA 2XGEA 2KISA 1X2MA 1UELB 5FJ8J 2DMNA 3JRAA 1YG2A 5FLXZ 4IOCF 4L9JA 3SDBA 3DBHB 1FTZA 5GPAA 3VYSB 2AQFA 1P7JA 3LQRA 2C6YA 2ELHA 1FPQA 1R00A 4IHVA 4M73A 2YVEA 3ABUA 4NC7A 5HODA 2W1OA 4EM2A 2XF7A 3G7RA 4XRSA 2Q2EA 4RGXA 4LK1F 2GAUA 1IG7A 3E5UA 2IW5A 5EFYA 4HLXA 2F07A 3Q5FA 3HOWJ 1VZ0A 3TMOA 3GZIA 2D6YA 2Y69H 2O3FA 2L5QA 3LSJA 2IU5A 3G6EI 1G8XA 4M71A 2KRHA 5TJJA 2OAZA 4MNUA 3ZMTA 3RI4A 1F36A 1BN5A 4A69C 3OIPA 1YIOA 4RAYA 3E7LA 2XGDA 2P8TA 4NBQA 1CGPA 1O4XA 3UNGC 2FQ3A 1CQTA 4IRIA 2CQNA 4ENJA 2E1OA 1KU9A 4BS9A 2VQHA 5HNHA 5D5UB 1MBFA 4C3JJ 3BWGA 4XORA 4A3CJ 2VOPA 2CG4A 4I6ZA 4R1HA 4C2MJ 3MQ0A 4CDGA 1OYYA 1D0YA 1SAUA 2Y0SN 4C2MA 3GMEA 1TT5B 2ZSHB 5D4RA 3EYIA 2H6BA 3IH3A 1MZBA 2JN6A 4ESBA 1BJZA 3F9KA 1QHHD 3BZKA 2EFNA 5DD8A 1HOMA 4MGRA 1ZR4A 2QIBA 2LF8A 2Z33A 4XKVA 3QPLA 3GTJJ 4H0EA 4PGGA 3KZYA 4E7JA 3EPZA 2ZMEA 5E3MA 3CCRI 2O9LA 3V8KA 3GFLA 3V8LA 3ROUA 4ACIA 2DTZA 1FLIA 1S7AA 2MABA 4AF5A 3PASA 4HQMA 2B0LA 2TRTA 4PXIA 1Z05A 4PJNA 4MTDA 2CV1A 4A6EA 3EUHA 1QZEA 1RETA 4YIFA 2NP5A 2LRDA 2UXUA 4A5NA 4JQFA 3TQNA 2OZ6A 4JKZA 2OF7A 1UJ8A 2A5YB 4RB3C 3B6CA 5FKLA 4G94A 3C1DA 2LG4A 2O6GE 1UI6A 1Z0XA 4BGDA 2G0EA 1BIAA 3Q0VA 3OR2C 2K27A 4HV5A 3VEPA 3KP5A 4RB2C 5K7HA 3G1OA 3NWSA 3RPUD 3DKYA 4A2UA 2OERA 3E97A 4IPAA 5D4SA 4IQ4A 4OOIA 2HOSA 1YX3A 3QOPA 4J01A 2JJ7A 2QQ8A 2CH0A 2X85A 2CW0F 3ZQCA 2NNYA 2ZJ2A 4C30A 1JJ6C 1QZYA 3BT9A 3QAHA 2OC6A 1I39A 2XVCA 4BHCA 2MW8A 2R7XA 1ZLJA 4RS8A 1BI1A 1R1TA 1VQLI 2B7EA 2CSOA 2QENA 4FT8A 5E3NA 4AD9A 3AKZA 3BCBA 4OU0A 2XAJA 1MSFC 3O8GA 1KA8A 3CWRA 2W57A 4D5FA 4GCLA 1G3SA 2VJIA 4HW0A 1JKPC 2IEKA 5LRSA 3GEUA 2PQ8A 4XONA 2VQGA 1R7JA 1X1BA 4AYBN 1O3SA 3H9QA 2Q2EB 3E0JB 4B3AA 3HHGA 4HF0A 5J6XA 1V5EA 1G6NA 3MD2A 2OU2A 4M3FA 5GAHJ 1T2KA 4HX8A 3CO6C 2OA4A 1PP7U 3GW2A 5B1BH 4EM0B 1FT9A 4RLQA 2FBHA 4II2A 2M45A 4HSTA 2VASA 1S7EA 3MWMA 3GWZA 3EUHC 1FBQA 1YS7A 1USSA 1O3TA 4OD5A 4JK1X 5K5QA 3HOXJ 1X3UA 2W48A 2H8WA 1WHUA 4XNFA 3ERMA 1T95A 2R7QA 4CYCA 3REOA 2M3AA 2DT6A 4V2GA 1ETQA 1MJBA 3GX4X 3S3MA 4IKFA 1WH5A 1F43A 4UUTA 2LY2A 1B4AA 4IEJA 1S9HA 1FIAA 3I3LA 5EJCA 3CCLI 2BE5F 1R9TJ 4JX6A 4U0YA 1I5ZA 1UB9A 3L2CA 5E1WA 5D8LB 4B44A 2STWA 2L02A 1R1VA 3DTIA 1BL0A 2P4WA 5ICGA 2DMUA 2JPBA 4TV7A 5HDGA 1DU0A 1FBUA 3NXCA 3OYHA 1BOAA 1IV6A 4LLNA 4I99C 1IN4A 4QIWN 1HSTA 3I54A 1BR4A 3S5RA 1JHHA 3V7RA 1BA5A 1VQMI 3BNIA 3ZQGA 2XKPA 1JGSA 3ELKA 2EFWA 1SC7A 2F48A 2NP3A 5IYDJ 1RR8C 2NYXA 4E6KG 3WG7H 3HJEA 2VJ4A 2FNAA 4GRIA 2NX4A 1W1WE 2DLLA 3A4CA 1X1PA 4UV9A 4RBOA 4MQ9F 3OV8A 1X2NA 3GVAA 1IXRC 1BI0A 3WGHA 1U9NA 2JA2A 4FX4A 3A02A 1LKXA 2I8DA 1TW2A 3VYUB 4U0WA 4CUGA 1XGMA 1IXSB 3BTJA 1DDNA 4KJZA 5HNFA 2A69F 3MKZA 1UHWA 3LJLA 4XM3A 2DMQA 2ZFUA 1JUMA 3CMAI 4CCJA 1J7KA 2J5OA 4EJVA 3CCVI 3ZQLA 1DP7P 3QPSA 1FOYA 1P4XA 2LREA 1XTAA 4FISA 2UZKA 1FC3A 1WRJA 1WKMA 4WIBA 2LDUA 4NNJA 3E7QA 2LH9A 2HKUA 3WU0A 2M8EA 1G4DA 2O0YA 4HZFA 4LMYA 3D5RC 2ZSIB 3CUQC 4M3GA 1ZG5A 2ZY9A 2VT3A 1LPQA 2Q1ZB 1P6RA 2GM4A 2IP2A 2R93J 3BOQA 1B72A 2E2JJ 5LHGA 2DA6A 3SYTA 5DYMA 1GXQA 4AVZA 5LGTA 1AKHA 5HDKA 1APLC 3WHBA 1OCCH 3BY6A 4HNUA 1FSHA 3ANPA 3Q0UA 4GFBA 2WADA 2Y9ZA 2JA5J 5F6FA 2L2OA 2JA7J 2KT0A 4NHJA 5IY5H 5LEKA 3FF5A 2BHZA 3M1CA 1JGGA 2LTPA 2HI3A 3IKTA 2F5FA 5FKMA 3ZMZA 2H6CA 3MZHA 5BQTA 4I0AA 2RNJA 1ETXA 4A3KJ 3HTJA 4QLCU 2VI6A 3VP5A 4B4CA 5L3CA 5EEGA 3DTEA 2R7UA 2X1DA 4I02A 3L00A 3SEQA 2QSHX 3OYBA 3FXJA 4LB6B 4W1UA 1Z9CA 2AS5F 2UUZA 4CGZA 1HF0A 3WTTC 1O3QA 5DM7F 3IRRA 4IX7A 5LLQA 3QRFF 2W4SA 1VF9A 4DW6A 5JFRA 5IYCJ 5FO5A 4CYCB 1YJ9I 2QKOA 1L0OC 1Z67A 5EG0A 2PEXA 3BC8A 3L9FA 2MC3A 2VBZA 3DBLB 3AG4H 5EGOA 3F23A 3I4MJ 3CUQB 4Y4RA 3A2KA 3CMMA 2WWYA 2Q24A 2A6HF 2E5NA 1PYVA 5IPAA 1XPXA 2CUFA 3QYBA 4Q47A 2X51A 2UXOA 2GIVA 5HS9A 5IP9J 3K4LA 4CH7A 2V6EA 4BDZA 3RKYA 2CWEA 2HQNA 3K2AA 3VODA 5ILVA 1ZYRF 3DLAA 4C9YA 4ZTJA 3EYYA 4JNNA 3LSMA 2IBDA 3S8PA 1RKWA 4CCLA 3HRMA 2WV0A 4HF2A 4ZH4F 1H88C 2VKDA 1XCVA 3BG9A 3HHHA 5M5YJ 1OISA 2DDAA 1I6XA 4CGRA 1UHMA 3H0GJ 4K2EA 3Q0WA 2YVXA 4AIHA 4A6DA 2COMA 2DJNA 3DV8A 1GXPA 2P0WA 2QTQA 1P4WA 1T39A 5C4JJ 3V8JA 2HU9A 4HA8A 4YG2F 2FU4A 4Q5SF 2QQAA 1YI2I 1WVRA 4WCGA 3P7NA 2OQGA 2GXGA 4U9LA 3EUKL 2I10A 3PJRA 3H9JA 1TWFJ 3FISA 4DBRA 1HC8A 4LG3A 1X3WB 4DIQA 3JRBA 2HKXA 3JRHA 2BW3A 3K0LA 3CJDA 4L18B 1KZHA 2PMUA 4BXXJ 3K1NA 4A3JJ 3ZQIA 2L9RA 5IOZA 2KZVA 1QU3A 3BP8A 3H5AA 1IRGA 4A0YA 5CXIA 3BG7A 1R5GA 3C3WA 5HLTA 3HXLA 4A12A 1UCRA 1HW2A 2IT0A 4E7SA 1XSVA 4C3IJ 2GUHA 4L9TA 1B72B 4N0BA 3KYDB 2P5LC 4M3DA 3L2QA 2KIFA 4BU2A 3CCYA 1ZRCA 1MMSA 1VQ8I 1AKHB 2N8GA 1SGMA 2MLKA 1XD7A 3M8FA 2DDBA 3F6OA 1XDUA 4MIMA 2JPCA 1W36D 3TOAA 2HOAA 3BPVA 5JLWA 2NVTJ 1J5YA 1RC9A 2M4GA 2JSCA 3S14J 2PG4A 4YIIA 2ELKA 2DXIA 1AWCA 1PJRA 1VQOI 3DQVC 1STZA 4WF2A 3F8NA 2DI3A 1ORKA 3Q3SA 1BI3A 1YW8A 1G3WA 2FX0A 5EYRA 1HA8A 2XC7A 3DTKA 3HOTA 1TW3A 1SEUA 2QOPA 4NB5A 2A5WA 4ENMA 5AIQA 3AQSA 2K9QA 3VOKA 2CW7A 3FHNA 5BNGA 4BACA 3HTIA 4WXDA 4N4NB 4FETA 1WWXA 3COLA 4OAZA 5FKOA 4KA4A 4G7HF 5HS7A 5EG0B 3OIOA 1QRYA 3GTLJ 5EGOB 2AXLA 2NXNB 2OPTA 2DMTA 2BXZA 5M5XJ 1UI5A 3K2ZA 1JT0A 1B59A 3T8TA 1EH6A 1EV7A 2DYRH 3HTAA 2JVHA 3FX3A 4XICA 2AHQA 1VQNI 1MMAA 2LD5A 4XBFA 4UUSA 4L5IA 4D7MA 4PGHA 1J75A 1MNDA 3RQIA 4RAFA 2ZOZA 1SFEA 5BPDA 4KMUX 5J3LA 2FMLA 2P7VB 1R36A 4E7IA 4HG2A 4PDKA 3L2VA 2RKHA 3RH2A 2DCEA 3I4NJ 4MFDA 3TDUC 1HW1A 2K9SA 2HGCA 2DTRA 3HRTA 3KP3A 4UXNA 4D5CA 2CFXA 3N97A 2NOGA 1FX7A 2ADUA 2VBXA 4QPQA 2FD5A 1ZTRA 2JZYA 3OYIA 1H89C 4U88A 4Z2YA 1QO0D 3CJRB 2KDOA 1PDNC 4GFLA 2L3DA 5F08A 3O60A 5B5EC 2BHYA 3HC7A 3H3VK 2BEOA 2YUSA 2KIUA 1U8RA 1KONA 3OR1C 2OBPA 2R7WA 1KQ9A 4DQ2A 3C07A 4KUMA 3TW6A 4XR6A 3N05A 4BE2A 2CO5A 1DUXC 2D5VA 3GLLA 3LSPA 3JREA 4L5JA 3KLNA 1GLNA 3OSFA 4M6XA 3ZXSA 3VVYA 2HR3A 4Y52J 5GADJ 1TNTA 5LFAA 4HEA2 2KIMA 4NUBA 1HDPA 1VQ6I 2IJLA 1XB4A 2BW3B 4ENKA 4OD4A 2QQBA 2Z5UA 3H92A 3BHQA 4RM3A 3NNRA 5M5WJ 1OCPA 5M3MJ 4WK8F 4I01A 4BHBA 3F8CA 4MTEA 2OI8A 3GLXA 4BE0A 5CVVA 3I4PA 1A36A 3CTAA 3BR1A 3SZTA 2B1EA 1W4MA 2V9PA 5DEQA 1P7IA 3LAPA 5E3LA 1SAXA 1F9NA 1WJDA 3W6VA 5D19A 1TZLA 3AL0C 3HUGA 2X1EA 1Z91A 2Z1DA 4RMNA 4I2OA 4ABZA 3GFJA 4OMYA 4GO1A 3JSPA 2GLOA 2NS8A 4NQWB 1YOVB 2BY3A 3I58A 4L5EA 1ETYA 5B66C 4AC6A 4GFKA 1RUOA 3ISPA 3M8JA 2QKMB 2XPWA 3BJ6A 1IXCA 4QPOA 4MK6A 3PPBA 1L3LA 2M8GX 3I55I 4HBLA 3KKCA 3LSRA 2VL8A 3WE2A 5ED4A 2NS7A 1ACIA 1N75A 5FB2A 2LKPA 2YX7A 2LFBA 1E2XA 3E6DA 2W82A 3PM1A 5IP7J 5J8FA 2P7CB 3CF2A 4DZJA 3WTXC 1S29A 4FE4A 5GPCA 4M9ZA 3E6CC 1QPMA 2XASA 3LOCA 4YELA 3HKZA 4EV0A 3CD6I 1Z3XA 4C2UA 4W97A 2XAQA 4E70A 1Q1HA 3HOUJ 2V79A 4KITB 2EA2A 1OPCA 2Z2SB 4EJTA 1YLFA 2HVQA 4KN4X 3MFKA 3QU6A 2XB0X 3VW1A 5D6FA 2CUZA 5K5OA 2M1BA 3AL0B 3AG3H 3NQOA 1BIBA 3JRIA 2IA0A 1W0TA 1WGXA 3H36A 1SFUA 3QODA 3GEZA 1LUJB 3N4MA 2R7VA 1I6HJ 1K79A 3J7AO 2KLOA 2G3BA 2HPMA 4X1EA 4BJ6C 1LE8A 5C3EJ 2QGUA 1QBJA 1MNEA 4RB0A 3WE3A 3RTRA 1QZZA 3FRQA 1GV5A 1MBGA 3EUAA 2DA3A 3T1BA 1AOYA 1T56A 2X6XA 5CKTA 1ODDA 1D1BA 3K4BA 2Y31A 5J40A 2KDZA 4LIUA 1X58A 1V4RA 2OZUA 2R5ZB 1ONVA 2MA3A 1S5LC 5JVTA 4FE7A 4CHUA 4M6YA 5D5XB 2PX9A 4CCKA 2F5DA 2PZ9A 2IRFG 4YIRX 2ICWG 3ZQ7A 4FHTA 3D1NI 4O6JA 2MYSA 1OYIA 2XHKA 3QU3A 1JJ8C 3FK6A 2OTLI 1X3ZB 4C3HJ 1YJNI 4AIDA 5HSZA 4ME9A 2RGVA 1BOBA 2Q0OA 3SJMA 1WH7A 5TRDA 2PLYA 2PN6A 1V3FA 3DPLC 3EQLF 2B63J 1ETOA 3FHZA 3I56I 3S2HJ 1WPKA 3WTWC 2BY2A 1IRZA 3CCQI 3FBNB 1K78B 4BBRJ 5EZHA 1NG6A 1VQ5I 2Z3YA 4KIBA 2FOKA 2V6CA 4KN7X 4DYRA 2DFEA 3V6GA 4QTRA 1S6LA 3AAFA 9ANTA 2X1CA 3ULQB 3PIPF 3CJTB 2ZJRF 2Z16A 3W2AA 3M7GA 1XGOA 3CCUI 3KP2A 5FROA 2LP0A 1KGSA 4QSHA 1FYKA 3P9KA 5E1ZB 3U1DA 2RVCA 4I98B 4KWAA 5CW8A 4BE1A 1B1BA 1XX5A 2KKOA 2ZXHA 4NN1A 2WTEA 2F4MB 3DP7A 3RD3A 1ZGWA 2L01A 1YHQI 3CMEI 3HUGB 2EILH 1DPRA 2OCCH 2RDPA 2R92J 1JKOC 1BW5A 2BOLA 2O5RA 2X6YA 2HDCA 2ZNYA 1XGNA 4KICA 2PJRA 4P96A 4G7OF 2JT1A 3HOZJ 2DFHA 4LLLA 1HXDA 3OYGA 2K5CA 3HG9A 3HB9A 4BQNA 2DFFA 2LF7A 2GIZA 2ACJA 3HTUA 2UXXA 1K4TA 1TQMA 2UXPA 3M9AA 1XMAA 1ZN2A 4F52A 2GWRA 2VPLA 1ON2A 3VB2A 3P9TA 1X4PA 4ZC3A 4BBSJ 2AQEA 2XDNA 3WTSC 2LSOA 2WB1A 1U3EM 4AC0A 3K4KA 2JVGA 3EGQA 2EK5A 4U7DA 3S2WA 2R5YB 1IAWA 2ZOYA 3EUPA 2HS5A 1XSDA 1MNMC 1OCRH 3NAUA 2R0QC 4HDVA 2QM3A 5L3GA 4C2TA 1KU3A 4ASNA 2V4JC 1W5CC 3VDXA 2XGCA 3ZMSA 3S16J 4RGUA 4YFXF 2JK3A 2DT5A 4P5OA 1H8AC 4KMFA 1RKTA 2KHMA 3IH2A 4G9YA 2CS3A 2YVHA 5E3OA 1LE8B 4BNCA 2DFIA 2FBIA 2NAZA 2VBWA 4A0XA 2GENA 1TQPA 4XSXF 5C4XJ 3FXRA 3R6SA 2IGKA 4LG0A 4MXMA 3X2QH 2UWMA 3FMQA 2A68F 2EFQA 3HYIA 1REPC 3PSFA 2E2IJ 3VWBA 5TISC 2A3SA 4G7ZF 1WJ5A 3FDYA 1NG7A 3LNQA 3QWLA 2K3FA 5FD6A 1KU7A 2VJ5A 3ZRGA 4WX9A 2EINH 4XRFA 4YFKF 2KZGA 2GZWA 3C2GA 5LHHA 2R7TA 2HXOA 5DM6F 1MDMB 2OQRA 4OIOF 2KRCA 4MFEA 2DG8A 1IJWC 4M72A 3DKWA 4LFUA 1ERDA 3CCEI 2BVMA 4FCYA 1K61A 5JHFA 1J2XA 2M87A 5E8GA 1AA7A 3QPTA 3RSNA 3ZMDA 3BPXA 3CP8A 2RQPA 1Z77A 5E8IA 1PUEE 1SFXA 4Q48A 4EJOA 4F93B 1GDTA 4X6AJ 1FSEA 2E1MC 4KIGA 2GOMA 1U78A 4RAZA 2W25A 1T33A 1QVTA 1GHCA 3CUQA 2ZXIA 1OR7C 2L4AA 1BC7C 4P55A 4MO7A 3MVPA 2NVXJ 5KHDA 2COBA 3LA3A 2FXAA 3H3ZA 2B3WA 2R3SA 3BR2A 3KETA 4I76A 3HRSA 4E7ZA 4F3QA 5E20A 1B9MA 4M6VA 4IJAA 4KISA 4U0VA 3RYPA 4N4OB 4EEFG 3H1CA 2PJRB 1GVJA 1LDJA 3D0SA 1ZRFA 4WWCA 2V1XA 4Y15A 5K7FA 1MBJA 2K02A 3FBIB 3SZGA 3LMMA 3GUDA 3E1SA 1OKRA 3O3KA 4L9VA 5BS6A 3VOXA 5H2FC 4XLEA 2EZIA 1ETVA 3PO3J 3F22A 2V26A 3ZQQA 2DK5A 5KCMA 5F1RA 4A3GJ 1EH7A 1BJAA 2WAEA 4D7NA 4I0BA 4DYQA 1BW6A 4FX0A 1Q1VA 2JTVA 2F2EA 2WGBA 2E1MB 3CZ6A 3T5XA 4A3IJ 2IS6A 3IAS2 2VN2A 1Z7LA 3JSJA 2H8RA 1DU6A 1USTA 2HDWA 1YTYA 1S7OA 3K7AJ 2VQCA 2L54A 3OYLA 3DLLF 3VW2A 2HKOA 4IOAF 2ETHA 4II3A 3GTMJ 2ECBA 1KYZA 3J7AY 2ZO4A 4XLFA 1NK2P 2PFBA 3CC7I 2JSPA 3A0BC 1ULYA 3AG1H 2MC4A 3RPUA 1ZELA 2BVLA 2DOFA 4CYDA 2LOOA 1SD5A 3IL2A 4XRSG 3G3ZA 3SHFA 5F0CA 3G73A 4IHSA 1FP1D 4U7BA 3C18A 3HGYA 4HNTA 2NOJB 5H9TA 2L7ZA 2WAQA 5F0FA 2A61A 2V9VA 1K83J 1WSUA 1O3RA 3DXJF 1I27A 4PZJA 1W5SA 4LG0B 2Y2ZA 2ZKZA 1FMWA 3W2VA 5F64A 1DP3A 2DPUA 3JRCA 1IN7A 5HOOA 1U8BA 4L0ZB 4EMSA 3J7ZI 3ZCOA 4NDLA 1HDDC 2UV1A 1MBKA 3MMYB 2DA2A 2Y48A 4UB6C 3W2WA 1YW9A 4LD5A 5AQCA 2OJED 4O5VA 3K4MA 3MN2A 2CV2A 3DU5A 3PUFA 2ID6A 1H9GA 5F0HA 3ZN0A 2ZCMA 2L9VA 2YU9J 3VSLA 1ETKA 2HVRA 3ZQHA 2UXIA 1GUUA 3OYFA 3BG6A 1J09A 1Z6RA 1R5ID 1RESA 1NH3A 2BXYA 1B6AA 1V55H 2DN0A 1D8JA 1TC3C 3TO6A 2MG4A 1T8IA 2A6EF 1I50J 2M0MA 4CXFA 3FK7A 2QCOA 3JRFA 4KDPA 2UXNA 3HKZN 4IRHA 3BDDA 4N9HA 3WHCA 3WODF 1MH4A 1K7AA 4P9UA 1N25A 4A3DJ 2VC0A 2H09A 1WI3A 2TDXA 4Z6YA 4HYEA 2ID3A 3RZOJ 5ILSA 1B9NA 4BJTA 5DDGA 4IXAA 4B47A 1Y0NA 2R7DA 1YYVA 3K1PA 1RR7A 3K4JA 5H6RA 4XN3A 1QQIA 3ZMVA 5J8CA 4XL9A 3GTKJ 2FJ1A 1OQYA 2EQRA 3E6MA 2LK2A 2X0LA 3CCMI 3ASNH 1A6QA 1P92A 2XRNA 3E6BA 1X4OA 2Z9OA 1F5TA 5ICEA 1R4NB 1Y39A 3KE2A 2FOWA 4DJAA 1Y56A 3QQAA 3HGGA 4DGWB 2WUIA 2V1UA 3JR9A 2K4BA 2JQ7A 3JCUC 1A6IA 2L7KA 4KT6A 5B3SH 1R22A 1J9IA 1YFHA 5A2QK 3VW0A 3ML6A 5D6EA 2QYOA 1IDYA 3QKXA 3BQZA 1WJAA 4UB8C 3V42A 1R6RA 3OIQA 3ON2A 3DPUA 3PSIA 1AHDP 2WBMA 4CO8A 3R0JA 3CP2A 3OS2A 3G71I 1EJ9A 4BQAA 4IRVA 3O2PE 1WJFA 2FF4A 4XLCA 2R7FA 5JVGF 4LOCA 4Y3OA 1KQ0A 4ANJA 5FLVA 5KAFC 3I0TA 4PUSA 4CCNA 4ETSA 2IS2A 2BY1A 2IA2A 4HX7A 3LWFA 3K9TA 2ZCWA 4XLHA 3JAMK 1OMIA 2P5KA 4XQFA 4AWXB 3ERED 3RZDJ 4OWRB 3BR3A 1ITYA 1U9OA 4ITVA 2J5PA 2V7FA 1I3QJ 5K1YA 3GFMA 1LDDA 1POGA 4KT5C 4OIRF 5CVJA 3IUVA 1U2WA 1WJBA 2DA7A 4GYIA 5LGUA 2VBYA 1IO2A 5B1AH 2GQQA 1E3OC 3LA7A 3BJOA 3RJPA 4BJ5C 4NQWA 3BR5A 1SD7A 3IWFA 3CLOA 3VYRB 2QQ9A 1WQ2A 4MLOA 1IDZA 1OJLA 3GBGA 3FIWA 6PAXA 5HLHA 4PK4A 1OYWA 3ZP5A 5L3FA 5KVRA 3FMSA 4ZYDA 2F5CA 2F6CA 4HLYA 4JP0A 4AM3A 3I64A 4MEYF 3G2BA 4JX4A 5EEHA 4YFNF 2PMZA 3CDIA 2QBYB 3TEDA 3F8BA 3FXLA 3TO7A 3DBRB 4AYBA 1T38A 1YX5A 3TOBA 1S72I 4IRGA 1HKTA 1U5TA 2CUJA 1SMTA 3JTGA 2WB1N 2R7RA 4CA0A 3VUQA 4LB5A 4ZZDA 2YS9A 2WV1A 3WG9A 2ISZA 2E2HJ 3LL7A 2CYYA 1W5TA 2LBFA 2M4KA 2A2FX 2KJBA 2RN7A 4CICA 5IT9K 2FEZA 2O8KA 3ZR8X 2KIQA 4CCOA 5HDNA 1A35A 2DQLA 2HYFA 3GFIA 3PO2J 3QP6A 1MMGA 1YE9A 2XKOA 2CGPA 1Y8QB 3D5LA 2HOTA 1NK3P 1FJLA 4GCVA 4PSXA 3J7YJ 3WTVC 1ZREA 1E3HA 2Y30A 4HKUA 3V78A 3BG3A 5AONA 3D5SC 2IVMA 2MH9A 2HYGD 2Y0MA 3K6GA 5J1YA 5LD2C 4PSWA 3HDDA 5IOYA 3DWLE 4XRMA 4XSZF 2NVYJ 2FNPA 3HE0A 2R5ZA 2IGMA 4FQGA 1QVUA 2REKA 2WA0A 2A6TA 2E34A 4RM2A 3KP7A 1G3YA 2RNGA 3LSTA 2DT7B 3DPJA 2LLKA 2QSFX 2E19A 3RIRA 3RKWA 4HX4A 3WGIA 5J1RA 1XG1A 2KQRA 4A3FJ 3FMRA 1WCMJ 2HYTA 1T6SA 2E7WA 2JUCA 3CDHA 1ON1A 3OYKA 2LYCA 1UG2A 2K40A 4D1QA 4FTHA 3GTPJ 2FBQA 2VIXA 3VTIA 1BR1A 4GCKA 3KZ9A 3VSKA 4A3MJ 1MMNA 1QA6A 3HIFA 2CRGA 1DQUA 5K5RA 2JRMA 5DUIA 1P9QC 1RUNA 4D0PA 1C0WA 2M5WA 3NI7A 2F5EA 3FKIJ 1K78A 5FHPA 1D8KA 2JWTA 2K4JA 2HZDA 4UUVA 3AQTA 3IRQA 1ZGAA 1MD0A 1R71A 1U5TC 2IS1A 1IN5A 2GXAA 5DAJA 1S3JA 4CZCA 2B9SA 4P9FA 3TP0A 2P6SA 4RAGA 4XMYA 1FTTA 3QP5A 4HF1A 1TWCJ 5DUKA 4UVAA 1KQ8A 2HXIA 4IHYA 1SVOA 2W85A 2CW8A 4BEHA 1RNLA 2EV6A 2XAFA 3LSHA 4GGGA 2FJI1 3OS1A 3E5QA 3RQ4A 1WI9A 2P6TA 5AIPA 3GZ5A 5GAEJ 1FYLA 3J81K 4HSRA 3I5UA 3FWEA 3GXOA 3KP4A 2R4GA 5HAWA 3FXOA 3JW4A 2A07F 4Y7NJ 3UKGA 2K9LA 3KPHA 4YZEA 4OIQF 1EA3A 3BR0A 1FWZA 2LR8A 3FKJA 3HM5A 4OAYA 5FMPA 1G3TA 2XUBA 4ESFA 2NRAC 1U6GA 3QYFA 1YIJI 1YJWI 4Y17A 3BROA 2K85A 1K6YA 5IP6A 4HQEA 2G7SA 2FRHA 1MIJA 1IW7F 5CXGA 3IH4A 4RA2A 2O7TA 4LJZF 2MSYA 4F7ZA 1MW7A 1YO5C 3HTSB 4MEXF 1U5TB 1YS6A 3B02A 2E60A 3LQQA 4PFPA 5JI6A 1IC8A 1MGTA 1YITI 2JMWA 2WC2A 3BG5A 4HV6A 2I5UA 2R5YA 2M34A 1IN6A 3H35A 1LVAA 1XS9A 2LBFB 1ZRDA 1X1CA 3G1LA 4XOPA 3UR3C 1ZK8A 3C2BA 2ESNA 5CQEA 1R1UA 2ZJPF 1TWHJ 1ZLKA 4ZDOA 3U21A 2VKEA 4S04A 2V1NA 3DFGA 3TBIA 4BQOA 3VOEA 3GTOJ 4DNCA 2W24A 2X9DA 1MJ9A 3K70D 2VE8A 4DBQA 1RPWA 3F0CA 2XF5A 3I9V2 1ZG1A 1MSEC 3H0DA 1MJAA 3KZIC 3FXQA 1TL8A 2E36A 3VYTB 2QWTA 3KEQA 2EB7A 3B81A 3U9GA 2STTA 2HQRA 2FUG2 2L7MP 1Y0UA 4EGYA 4A3BJ 1FEXA 1JKQC 2X6OA 4H4KC 1A31A 1A04A 2MBFA 4B09A 1XCBA 5J4VA 1X1AA 2E1NA 1U0JA 2QWWA 1R49A 1MDMA 3H9GA 2TCTA 1N78A 3JRDA 1NHAA 3K4NA 3J80K 4MHGA 1MKMA 3ZMUA 2VONA 3PNYA 3DEEA 1MMDA 1FNNA 4UHTA 1W36C 4AVPA 5EF6A 3NEUA 3HIMA 3F1BA 3NPIA 2EIMH 1LEAA 3BTLA 3A01A 1VQ4I 1K4SA 2DJIA 3CC4I 3GYHX 1YRNA 3QPHA 5CVIA 3PL8A 2QLZA 2KFDA 2XAHA 3SXYA 3KKDA 4G6TB 1VFCA 5C44J 2M2EA 5EZGA 3ZN1A 3RKQA 5K58A 1JUPA 2R7OA 4ZYGA 2XDVA 3HPHA 1PUFB 2L9NA 2XB5A 5IYBJ 4BEHB 4F55A 3G1MA 2ZXWH 4JX5A 3MKYB 2IXSA 3LA2A 3PUBA 4UY8I 5CVUA 3TGNA 3W3CA 3HSFA 3GZNB 5ICFA 3PNTA 4IZZA 3GCMA 1CF7B 4OIPF 2YR2A 4E4HA 5ICCA 1XSXA 3T0YA 4MQVA 3OL4A 1T08B 1DGRM 1UHSA 1VQPI 2PMHA 3PQKA 1Z1DA 1NTCA 3F21A 3S15J 2EPFA 1VI0A 4IF4A 2M30A 4L9NA 4IHTA 2NVUB 2DAOA 1PVEA 1FBSA 2BBYA 2ESHA 1I1SA 3C7JA 2VPRA 2VT2A 3KP6A 5DTDA 5GAGJ 4EVIA 4KYWA 3S17J 4JL3A 1RZ4A 3S1RJ 1AU7A 3S1NJ 2QVOA 1GT0C 1SD6A 3HEFA 2ZBKA 3ZPLA 3LSKA 1HW5A 2RV8A 4A5MA 3CESA 3G4SI 1OR7A 4HDUA 2F4OB 3TP3A 2EV0A 2DOEA 1F4KA 1ZARA 3OMYA 4I09A 4LIVA 3SQNA 5JLXA 2D1HA 3TKYA 2CV0A 3P9IA 4XOTA 5HLIA 2E35A 3OOPA 3HOYJ 1E3PA 5FD5A 1MH3A 5FKKA 3HSEA 4UNOA 4XLNF 4G6QA 1N77A 5J4YA 3CJQB 4RGSA 4XIDA 5A2QZ 3S3OA 5F1JA 4ZJZA 2O03A 3IV5A 3JSOA 1W7PD 4ZTFA 3VIBA 2CQ7A 3PFYA 4BXUA 4EJUA 3RCOA 3MAJA 5KNLA 1BR2A 2OUMA 3K10A 1ZQ3P 2E71A 1IGNA 2KMUA 3E3VA 4HAMA 3BQYA 2FE3A 3KEOA 5HLGA 4GYGA 3R0AA 5H6QA 3ZGKA 3CCSI 3ANGA 2KL4A 3ABMH 1LB2A 1HBXG 2VOOA 3R60A 2H1LA 4ZYEA 1FOXA 2ME6A 1JE8A 1SD4A 1BM9A 1QNTA 4PCQA 2QF7A 5F27A 5K7ZA 2M0CA 3WGGA 2EZLA 2RREA 3K8PC 2JUGA 3S3NA 2EIKH 3M1EA 2R7SA 1Y8RB 3DEWA 5FKNA 5E17F 1X19A 1R23A 2DK8A 4XN0A 1VNDA 3JAMZ 2GXBA 2XGXA 4IO9F 2IA1A 2BYVE 4A0ZA 1P2FA 2PMZN 3IUOA 2L7FP 3OYCA 2CQKA 3H5NA 5KK1A 3ONQA 2K3PA 3A01B 1IUYA 2L0KA 2FSWA 3ZOBA 3IAM2 1ZAOA 4G12A 2K86A 2ZMEC 3KLOA 3F8FA 1HCRA 1YRNB 1R5HA 2EWNA 2ZCXA 2YX4A 1UZCA 1XMXA 2XRLA 2D2WA 2CUEA 4EJWA 5HS8A 2Y75A 3OWTA 2AXTC 2GBYA 4HPQA 2R7ZJ 3H3UA 2KJCA 2FBKA 1WJEA 3OYDA 1JHFA 5DCMA 5TGTA 4AUXA 2QEXI 3PNVA 3HBLA 2P5VA 4XKCA 4AU7A 2W53A 2G9WA 2ZNZA 3JTHA 3NARA 3U2RA 3MCZA 1EH8A 3SZPA 2OCEA 3TW7A 4B1RA 3WTZA 2H94A 3K4CA 3F72A 2D1VA 2LY1A 2VC1A 2Q8KA 4UVBA 1OCOH 3BTCA 4F91B 2G7HA 3CDLA 5GTHC 3WTYC 4U9NA 3LSIA 4DVYP 3HZJA 3HOSA 2G7LA 5IT9Z 3LSGA 4DZPA 5CQGA 3TL4X 3U1KA 2VB6A 5D1RA 4ON0A 2HTSA 1M1EB 2RASA 1IRFA 1O7FA 2ZB9A 1FY7A 3QYEA 1GV2A 2ZMEB 2LKSA 4J19A 2VJJA 3PQJA 3K70C 2V57A 1LFUP 1VQKI 4HNVA 1WJCA 1IRXA 1TQIA 2VQLA 4EM1A 3TO9A 1BI2A 2V9KA 1Z7UA 2HOEA 2HTJA 2WY8Q 4OINF 2XSDC 5FLMJ 1QHGA 2P81A 3DKXA 3FM3A 4B3XA 1SVMA 1Z6TA 5J1UA 4D9JA 3E5XA 3GZ6A 1YQAA 1TWAJ 5FFZA 3OYAA 2L9SA 4XKBA 5FLXK 2PI0A 4RGRA 1D3YA 2XPUA 3H5RA 3COAC 5LEJA 5HVQC 3QOEA 2ME0A 1QPIA 3AFHA 1LEBA 1UMQA 3PIOF 1I3AA 1LDKB 4UVCA 3I53A 4ESJA 1JUSA 2O8XA 5CPRB 3PFIA 4WXCA 2RAEA 2ZJQF 1ZG3A 2VKHA 3MKLA 4NELA 2QSGX 4ENNA 3VVXA 3I71A 1W7PA 4M3BA 1JKRC 1O7LA 3FXUA 4XLPF 4BDYA 1ETWA 4BYYA 4LITA 3FM5A 1XGSA 3MZ8A 1G59A 3OOUA 2LNBA 4PJ0C 3S1MJ 1HKQA 1D1AA 3IP4B 2E5ZA 4BH9A 2PJPA 2MD0A 1V54H 4BKXA 2VE9A 3M3YJ 4JOMA 3SWHA 2RHAA 4XK4A 3BCGA 2Z99A 4M9XA 1UFMA 1LNWA 4DYCA 2HQAA 3V7SA 2QBYA 2DA4A 4N9IA 3OYEA 1SFKA 4E7LA 3I59A 4F92B 2VUMJ 3BTIA 3P9CA 3OS0A 4UV8A 2ISYA 2BGCA 3J81Z 3F3XA 3L2WA 1UG0A 2K7LA 2VXZA 2UXHA 1YW7A 3HL2A 2DG7A 2ZCNA 2W7NA 3RPQA 5KAIC 2X4HA 3SDGA 2ZFWA 4EQQA 1XDSA 2WAFA 2YU3A 3VPRA 2DA5A 1G2HA 2O7OA 4XLAA 1J0RA 4ZZLA 4IQJA 4I7HA 4B43A 1DPUA 5DCMB 2ZC2A 3CMYA 3MEXA 2CQXA 3CLQA 3V4GA 5CJ9A 4BUPA 5EDNA 3ESWB 1FZPB 1WFXA 5LRRA 4YEJA 1LQ1A 2VXDA 5IT3A 2M7AA 4YRVA 3NWTA 3KZZA 3KCCA 1Z3YA 4BXFA 2FQ4A 3S93A 4CSWA 1IZ1A 2Y0SA 1E17A 2DMPA 1ENHA 1VQ9I 2FA5A 3A03A 4ZYHA 3BCAA 3HTHA 4NC6A 4JYKA 3WU2C 3C2HA 2DPDA 4ICHA 3M4OJ 3VVZA 3DPTA 4B48A 5CYVA 3KNWA 1X1DA 4Y13A 2EIJH 3MNLA 5DCFA 4NC8A 1SMYF 3DU6A 5H20A 1T0FA 1V5GA 3B6AA 4Q4ZF 2EFPA 2EBIA 2VKVA 5CVRA 1SANA 2MH2A 3EETA 3BJBA 2OV7A 2XROA 5DD4A 1E0EA 2M7BA 1LFBA 1IV8A 2IGNA 1B8IA 4XKWA 5GTIC 2W84A 4JBAA 1TP4A 3O8HA 2KPMA 3L2RA 2HZTA 3KEYA 4G8XA 1SFOJ 2MFZA 2XAGA 4AIKA 4IHXA 2DA1A 5BPIA 4QWQA 4S05A 3OYMA 2H27A 2K9MA 4A3LJ 4L62A 2O61A 1IUFA 2IS4A 3BR6A 2BV6A 5LHIA 1V5FA 3T6NA 4U87A 2DOAA 2GFNA 3J80Z 3BZCA 2M9HA 3HOVJ 1ZHFA 3IWZA 3M07A 1W7PB 3BJAA 2EFOA 1JTXA 2HVSA 3BZ6A 4S0HB 2HDDA 3GO5A 3QBMA 1KU2A 5ILUA
chains in the Genus database with same CATH topology
3EGQA 1Y1WJ 3IH4A 4FISA 2O7TA 2MSYA 3S1QJ 2R5YB 3E7QA 2ZOYA 3EUPA 2HQ5A 2HKUA 1MNMC 3NAUA 2R0QC 1TWGJ 4M3GA 1IC8A 2XGCA 2JMWA 5FGLA 3BG5A 2GM4A 3S16J 3ON4A 2R5YA 2JK3A 2M34A 3S2DJ 2R93J 5EEAA 4V2FA 1H8AC 1B72A 2X48A 2E2JJ 2DA6A 2CJJA 2LKXA 1XS9A 1W0UA 2EZKA 1RKTA 3IH2A 2LY9A 3G1LA 1AKHA 1APLC 3WHBA 3L1PA 5E3OA 1LE8B 4M3EA 2YVHA 1ZK8A 3C2BA 3ANPA 3Q0UA 4GFBA 2GENA 2Y9ZA 2K9NA 5C4XJ 3DCFA 2JA5J 2JA7J 4MXMA 2KT0A 1TWHJ 2JA8J 2PBXA 1Y1VJ 1JGGA 2LTPA 2HI3A 2JA6J 5FKMA 2VKEA 1ETXA 4A3KJ 2E2IJ 3GTOJ 3HTJA 2VI6A 2X9DA 3LWJA 3LNQA 4B4CA 3VP5A 1RPWA 3F0CA 4GCTA 1MSEC 4W1UA 4UDSA 2HXOA 1HF0A 1D5YA 2QWTA 3B81A 4MFEA 2DG8A 1IJWC 2L7MP 1VF9A 4DW6A 5IYCJ 2QKOA 4CYCB 3OSGA 4A3BJ 1FEXA 5EG0A 4FCYA 2X6OA 1K61A 1JKQC 5EGOA 3GTGJ 3NNRA 2AO9A 3GTQJ 3I4MJ 1Z77A 2TCTA 3JRDA 4X6AJ 1GDTA 2Q24A 1MBEA 1U78A 5IPAA 2CUFA 5EF6A 1T33A 1QVTA 3HIMA 3F1BA 3NPIA 2Y9YA 3BTLA 2UXOA 3A01A 5IP9J 4MO7A 2G7GA 3MVPA 2NVXJ 1OFCX 2COBA 1YRNA 3K2AA 2ECCA 3BR2A 4I76A 1ZR2A 3KKDA 1MBHA 1ZKGA 1VFCA 4JNNA 5C44J 2CU7A 2M2EA 4M6VA 5EZGA 2IBDA 3RKQA 5C4YA 1JUPA 5K58A 1PUFB 2XB5A 1RKWA 5IYBJ 4EEFG 4BY7J 2LVSA 3G1MA 1B8IB 2EH3A 2HYJA 4JX5A 1H88C 3BG9A 4CGRA 5M5YJ 3NRGA 2XPVA 3H0GJ 3Q0WA 5K7FA 1MBJA 1OCTC 1PUFA 2DJNA 1EF4A 2QTQA 1FIPA 3VOXA 2EZIA 5C4JJ 1ETVA 3PO3J 4A3GJ 1UHSA 4D7NA 2EZHA 5DS9A 1NTCA 2NVQJ 4DYQA 1BW6A 2I10A 1Q1VA 1VI0A 3S15J 1TWFJ 3FISA 3CRJA 2WGBA 4A3IJ 3JRBA 3JRHA 3JSJA 2VPRA 2H8RA 3CJDA 5DTDA 2MGQA 1DU6A 1A5JA 3S17J 3ZQFA 3K7AJ 4BXXJ 4A3JJ 4JL3A 3ZQIA 3VW2A 2L9RA 5IOZA 3S1RJ 1AU7A 3S1NJ 3LHQA 1GT0C 5CXIA 3HEFA 2ECBA 3GTMJ 1NK2P 4IHWA 4A93J 3TP3A 1GVDA 4C3IJ 2GUHA 1B72B 1XC5A 4M3DA 5JLXA 4XRSG 1JTYA 3CCYA 1JT6A 5F0CA 2N8GA 1AKHB 1SGMA 3HOYJ 4BY1J 1HLVA 3BRUA 3HGYA 5GP9A 2L7ZA 1MH3A 4MIMA 5F0FA 5FKKA 5H9TA 1K83J 3JRGA 5HBUA 5JLWA 2HOAA 2NVTJ 3S14J 2ELKA 4XIDA 2Y2ZA 5F1JA 3IV5A 3JRCA 1U8BA 3VIBA 4A3EJ 4NDLA 1HDDC 1ORKA 3Q3SA 1ZQ3P 1MBKA 2DA2A 1IGNA 2FX0A 3BQYA 5EYRA 3ANGA 3G56A 5D18A 5AQCA 2QOPA 3AQSA 5M3FJ 3MN2A 2K9QA 2ME6A 3VOKA 2ID6A 2WAQN 5BNGA 2H1KA 5F0HA 3HTIA 2QF7A 5F27A 5K7ZA 2M0CA 2YU9J 2ZCMA 4RDUA 2IAIA 2EZLA 1ETKA 3SFIA 3COLA 2CQQA 3ZQHA 2UXIA 1GUUA 5FKOA 1RESA 3CQZJ 5FKNA 3DEWA 3OIOA 1QRYA 5EG0B 3GTLJ 2DN0A 5EGOB 1TC3C 2MG4A 1I50J 1VNDA 3JRFA 3FK7A 2QCOA 5F04A 4UUSB 2OPTA 2DMTA 3HKZN 5M5XJ 1UI5A 3WHCA 1JT0A 1MH4A 2PMZN 2L7FP 3HTAA 2XGEA 1X2MA 5FJ8J 4A3DJ 2DMNA 3JRAA 4XICA 1WI3A 2AHQA 3A01B 2L0KA 3ZOBA 2LD5A 4G12A 4UUSA 2ID3A 3RZOJ 4D7MA 1FTZA 5GPAA 1P7JA 3RQIA 1HCRA 2ZOZA 4IHVA 1YRNB 2YVEA 5HODA 5J3LA 2ZCXA 1RR7A 3G7RA 2XRLA 4XRSA 2CUEA 1IG7A 2F07A 3GTKJ 3HOWJ 3RH2A 2FJ1A 3I4NJ 3GZIA 4MFDA 2EQRA 2GBYA 2LK2A 2K9SA 2D6YA 2R7ZJ 4D5CA 3LSJA 2NOGA 2IU5A 4AUXA 2FD5A 1ZTRA 1H89C 3HBLA 2W53A 4GFLA 5F08A 3O60A 3NARA 3H3VK 1F36A 2YUSA 3HGGA 3QQAA 2WUIA 4A69C 3TW7A 4B1RA 3JR9A 1A6IA 3C07A 3E7LA 2XGDA 3TW6A 3VW0A 1O4XA 1CQTA 2D5VA 1IDYA 3LSPA 3JREA 3QKXA 3BQZA 3BTCA 3OSFA 3CDLA 2E1OA 3VVYA 3ON2A 1MBFA 4Y52J 4C3JJ 1AHDP 1HDPA 4A3CJ 4I6ZA 2G7LA 3LSGA 4DZPA 4C2MJ 5D1RA 3BHQA 2RASA 2Y0SN 2ZB9A 5M5WJ 4LOCA 1GV2A 1OCPA 4J19A 5M3MJ 5FLVA 2V57A 3IH3A 2JN6A 1LFUP 4HNVA 1BJZA 1HOMA 2QIBA 2OI8A 1ZR4A 3BR1A 1P7IA 3QPLA 5E3LA 3GTJJ 3W6VA 5E3MA 2O9LA 5D19A 2XSDC 4ACIA 5FLMJ 2DTZA 2P81A 3RZDJ 5J1UA 4ABZA 3BR3A 1ITYA 1U9OA 4AF5A 3PASA 1TWAJ 2GLOA 2TRTA 1I3QJ 2NS8A 4PXIA 1POGA 4L5EA 2NP5A 1RETA 1ETYA 3IUVA 2DA7A 2UXUA 2XPUA 4AC6A 4GFKA 4JKZA 2OF7A 2ME0A 2XPWA 3B6CA 5FKLA 1QPIA 1E3OC 1UMQA 4MK6A 3PPBA 2M8GX 3BR5A 1JUSA 3KKCA 3LSRA 1UI6A 1Z0XA 2NS7A 2G0EA 2RAEA 4MLOA 3Q0VA 1IDZA 5IP7J 1OJLA 2LFBA 3MKLA 3PM1A 4NELA 3GBGA 3FIWA 3G1OA 5K7HA 4DZJA 2OERA 2HOSA 3VVXA 4FE4A 5GPCA 4M3BA 1JKRC 2JJ7A 1ETWA 3LOCA 3OOUA 4JP0A 3S1MJ 3ZQCA 4JX4A 1JJ6C 3BT9A 3TEDA 4W97A 4BKXA 3HOUJ 2MW8A 3M3YJ 2RHAA 4XK4A 3BCGA 5E3NA 2WB1N 2XB0X 4DYCA 3VW1A 2DA4A 3VUQA 2YS9A 2WV1A 1MSFC 3O8GA 3JRIA 2VUMJ 3CWRA 1W0TA 2E2HJ 3BTIA 1WGXA 4D5FA 4GCLA 1JKPC 2IEKA 1I6HJ 2O8KA 2G3BA 2UXHA 2DG7A 4X1EA 2ZCNA 3GEUA 1LE8A 5C3EJ 3PO2J 3FRQA 1GV5A 1MBGA 4AYBN 2DA3A 3SDGA 2HOTA 1NK3P 1T56A 3VPRA 2DA5A 4B3AA 1FJLA 2KDZA 2Y31A 2O7OA 1G2HA 2Y30A 4HKUA 4M3FA 3BG3A 3V78A 1X58A 2R5ZB 4FE7A 3CMYA 5J1YA 2CQXA 1S7EA 3HDDA 5IOYA 2PZ9A 5EDNA 4XRMA 2NVYJ 3D1NI 3HE0A 2R5ZA 1QVUA 1JJ8C 2REKA 3FK6A 3HOXJ 4C3HJ 2W48A 5HSZA 3DPJA 2LLKA 4ME9A 2E19A 3SJMA 1WH7A 5J1RA 1XG1A 4CYCA 4A3FJ 2B63J 1ETOA 1WCMJ 2FQ4A 4V2GA 2HYTA 1ETQA 3S2HJ 1WPKA 1F43A 1WH5A 1IRZA 2DMPA 1ENHA 4UUTA 3A03A 4IEJA 4BBRJ 1FIAA 5EZHA 1UG2A 2K40A 4FTHA 3GTPJ 2FBQA 4GCKA 1R9TJ 4JX6A 4DYRA 3HTHA 3KZ9A 4QTRA 3V6GA 4A3MJ 2CRGA 9ANTA 4JYKA 4ICHA 3VVZA 3M4OJ 3NI7A 3FKIJ 3KNWA 5FHPA 5EFYA 2JWTA 2LP0A 4QSHA 3AQTA 3MNLA 1BL0A 4KWAA 5CW8A 2DMUA 1DU0A 4NN1A 5DAJA 3NXCA 3B6AA 1IV6A 3RD3A 1ZGWA 3TP0A 4QIWN 2EBIA 2VKVA 1FTTA 3S5RA 1BA5A 1SANA 1TWCJ 3BNIA 3ZQGA 2HXIA 1JKOC 4IHYA 2R92J 5IYDJ 1BW5A 2NP3A 3BJBA 1LFBA 1B8IA 2NX4A 3O8HA 3HOZJ 4RBOA 1X2NA 1SFOJ 3HB9A 1U9NA 5HAWA 3A02A 4IHXA 2DA1A 4Y7NJ 3UKGA 4YZEA 3BR0A 2LR8A 3BTJA 3HM5A 4A3LJ 4L62A 5FMPA 1IUFA 3BR6A 2UXPA 3T6NA 2GFNA 3LJLA 3P9TA 2M9HA 2DMQA 3HOVJ 4BBSJ 5IP6A 1JUMA 2XDNA 1JTXA 3ZQLA 2G7SA 3QPSA 4S0HB 2HDDA 3QBMA 4AC0A 5CXGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EGQ A;  1Y1W J;  3IH4 A;  4FIS A;  2O7T A;  2MSY A;  3S1Q J;  2R5Y B;  3E7Q A;  2ZOY A;  3EUP A;  2HQ5 A;  2HKU A;  1MNM C;  3NAU A;  2R0Q C;  1TWG J;  4M3G A;  1IC8 A;  2XGC A;  2JMW A;  5FGL A;  3BG5 A;  2GM4 A;  3S16 J;  3ON4 A;  2R5Y A;  2JK3 A;  2M34 A;  3S2D J;  2R93 J;  5EEA A;  4V2F A;  1H8A C;  1B72 A;  2X48 A;  2E2J J;  2DA6 A;  2CJJ A;  2LKX A;  1XS9 A;  1W0U A;  2EZK A;  1RKT A;  3IH2 A;  2LY9 A;  3G1L A;  1AKH A;  1APL C;  3WHB A;  3L1P A;  5E3O A;  1LE8 B;  4M3E A;  2YVH A;  1ZK8 A;  3C2B A;  3ANP A;  3Q0U A;  4GFB A;  2GEN A;  2Y9Z A;  2K9N A;  5C4X J;  3DCF A;  2JA5 J;  2JA7 J;  4MXM A;  2KT0 A;  1TWH J;  2JA8 J;  2PBX A;  1Y1V J;  1JGG A;  2LTP A;  2HI3 A;  2JA6 J;  5FKM A;  2VKE A;  1ETX A;  4A3K J;  2E2I J;  3GTO J;  3HTJ A;  2VI6 A;  2X9D A;  3LWJ A;  3LNQ A;  4B4C A;  3VP5 A;  1RPW A;  3F0C A;  4GCT A;  1MSE C;  4W1U A;  4UDS A;  2HXO A;  1HF0 A;  1D5Y A;  2QWT A;  3B81 A;  4MFE A;  2DG8 A;  1IJW C;  2L7M P;  1VF9 A;  4DW6 A;  5IYC J;  2QKO A;  4CYC B;  3OSG A;  4A3B J;  1FEX A;  5EG0 A;  4FCY A;  2X6O A;  1K61 A;  1JKQ C;  5EGO A;  3GTG J;  3NNR A;  2AO9 A;  3GTQ J;  3I4M J;  1Z77 A;  2TCT A;  3JRD A;  4X6A J;  1GDT A;  2Q24 A;  1MBE A;  1U78 A;  5IPA A;  2CUF A;  5EF6 A;  1T33 A;  1QVT A;  3HIM A;  3F1B A;  3NPI A;  2Y9Y A;  3BTL A;  2UXO A;  3A01 A;  5IP9 J;  4MO7 A;  2G7G A;  3MVP A;  2NVX J;  1OFC X;  2COB A;  1YRN A;  3K2A A;  2ECC A;  3BR2 A;  4I76 A;  1ZR2 A;  3KKD A;  1MBH A;  1ZKG A;  1VFC A;  4JNN A;  5C44 J;  2CU7 A;  2M2E A;  4M6V A;  5EZG A;  2IBD A;  3RKQ A;  5C4Y A;  1JUP A;  5K58 A;  1PUF B;  2XB5 A;  1RKW A;  5IYB J;  4EEF G;  4BY7 J;  2LVS A;  3G1M A;  1B8I B;  2EH3 A;  2HYJ A;  4JX5 A;  1H88 C;  3BG9 A;  4CGR A;  5M5Y J;  3NRG A;  2XPV A;  3H0G J;  3Q0W A;  5K7F A;  1MBJ A;  1OCT C;  1PUF A;  2DJN A;  1EF4 A;  2QTQ A;  1FIP A;  3VOX A;  2EZI A;  5C4J J;  1ETV A;  3PO3 J;  4A3G J;  1UHS A;  4D7N A;  2EZH A;  5DS9 A;  1NTC A;  2NVQ J;  4DYQ A;  1BW6 A;  2I10 A;  1Q1V A;  1VI0 A;  3S15 J;  1TWF J;  3FIS A;  3CRJ A;  2WGB A;  4A3I J;  3JRB A;  3JRH A;  3JSJ A;  2VPR A;  2H8R A;  3CJD A;  5DTD A;  2MGQ A;  1DU6 A;  1A5J A;  3S17 J;  3ZQF A;  3K7A J;  4BXX J;  4A3J J;  4JL3 A;  3ZQI A;  3VW2 A;  2L9R A;  5IOZ A;  3S1R J;  1AU7 A;  3S1N J;  3LHQ A;  1GT0 C;  5CXI A;  3HEF A;  2ECB A;  3GTM J;  1NK2 P;  4IHW A;  4A93 J;  3TP3 A;  1GVD A;  4C3I J;  2GUH A;  1B72 B;  1XC5 A;  4M3D A;  5JLX A;  4XRS G;  1JTY A;  3CCY A;  1JT6 A;  5F0C A;  2N8G A;  1AKH B;  1SGM A;  3HOY J;  4BY1 J;  1HLV A;  3BRU A;  3HGY A;  5GP9 A;  2L7Z A;  1MH3 A;  4MIM A;  5F0F A;  5FKK A;  5H9T A;  1K83 J;  3JRG A;  5HBU A;  5JLW A;  2HOA A;  2NVT J;  3S14 J;  2ELK A;  4XID A;  2Y2Z A;  5F1J A;  3IV5 A;  3JRC A;  1U8B A;  3VIB A;  4A3E J;  4NDL A;  1HDD C;  1ORK A;  3Q3S A;  1ZQ3 P;  1MBK A;  2DA2 A;  1IGN A;  2FX0 A;  3BQY A;  5EYR A;  3ANG A;  3G56 A;  5D18 A;  5AQC A;  2QOP A;  3AQS A;  5M3F J;  3MN2 A;  2K9Q A;  2ME6 A;  3VOK A;  2ID6 A;  2WAQ N;  5BNG A;  2H1K A;  5F0H A;  3HTI A;  2QF7 A;  5F27 A;  5K7Z A;  2M0C A;  2YU9 J;  2ZCM A;  4RDU A;  2IAI A;  2EZL A;  1ETK A;  3SFI A;  3COL A;  2CQQ A;  3ZQH A;  2UXI A;  1GUU A;  5FKO A;  1RES A;  3CQZ J;  5FKN A;  3DEW A;  3OIO A;  1QRY A;  5EG0 B;  3GTL J;  2DN0 A;  5EGO B;  1TC3 C;  2MG4 A;  1I50 J;  1VND A;  3JRF A;  3FK7 A;  2QCO A;  5F04 A;  4UUS B;  2OPT A;  2DMT A;  3HKZ N;  5M5X J;  1UI5 A;  3WHC A;  1JT0 A;  1MH4 A;  2PMZ N;  2L7F P;  3HTA A;  2XGE A;  1X2M A;  5FJ8 J;  4A3D J;  2DMN A;  3JRA A;  4XIC A;  1WI3 A;  2AHQ A;  3A01 B;  2L0K A;  3ZOB A;  2LD5 A;  4G12 A;  4UUS A;  2ID3 A;  3RZO J;  4D7M A;  1FTZ A;  5GPA A;  1P7J A;  3RQI A;  1HCR A;  2ZOZ A;  4IHV A;  1YRN B;  2YVE A;  5HOD A;  5J3L A;  2ZCX A;  1RR7 A;  3G7R A;  2XRL A;  4XRS A;  2CUE A;  1IG7 A;  2F07 A;  3GTK J;  3HOW J;  3RH2 A;  2FJ1 A;  3I4N J;  3GZI A;  4MFD A;  2EQR A;  2GBY A;  2LK2 A;  2K9S A;  2D6Y A;  2R7Z J;  4D5C A;  3LSJ A;  2NOG A;  2IU5 A;  4AUX A;  2FD5 A;  1ZTR A;  1H89 C;  3HBL A;  2W53 A;  4GFL A;  5F08 A;  3O60 A;  3NAR A;  3H3V K;  1F36 A;  2YUS A;  3HGG A;  3QQA A;  2WUI A;  4A69 C;  3TW7 A;  4B1R A;  3JR9 A;  1A6I A;  3C07 A;  3E7L A;  2XGD A;  3TW6 A;  3VW0 A;  1O4X A;  1CQT A;  2D5V A;  1IDY A;  3LSP A;  3JRE A;  3QKX A;  3BQZ A;  3BTC A;  3OSF A;  3CDL A;  2E1O A;  3VVY A;  3ON2 A;  1MBF A;  4Y52 J;  4C3J J;  1AHD P;  1HDP A;  4A3C J;  4I6Z A;  2G7L A;  3LSG A;  4DZP A;  4C2M J;  5D1R A;  3BHQ A;  2RAS A;  2Y0S N;  2ZB9 A;  5M5W J;  4LOC A;  1GV2 A;  1OCP A;  4J19 A;  5M3M J;  5FLV A;  2V57 A;  3IH3 A;  2JN6 A;  1LFU P;  4HNV A;  1BJZ A;  1HOM A;  2QIB A;  2OI8 A;  1ZR4 A;  3BR1 A;  1P7I A;  3QPL A;  5E3L A;  3GTJ J;  3W6V A;  5E3M A;  2O9L A;  5D19 A;  2XSD C;  4ACI A;  5FLM J;  2DTZ A;  2P81 A;  3RZD J;  5J1U A;  4ABZ A;  3BR3 A;  1ITY A;  1U9O A;  4AF5 A;  3PAS A;  1TWA J;  2GLO A;  2TRT A;  1I3Q J;  2NS8 A;  4PXI A;  1POG A;  4L5E A;  2NP5 A;  1RET A;  1ETY A;  3IUV A;  2DA7 A;  2UXU A;  2XPU A;  4AC6 A;  4GFK A;  4JKZ A;  2OF7 A;  2ME0 A;  2XPW A;  3B6C A;  5FKL A;  1QPI A;  1E3O C;  1UMQ A;  4MK6 A;  3PPB A;  2M8G X;  3BR5 A;  1JUS A;  3KKC A;  3LSR A;  1UI6 A;  1Z0X A;  2NS7 A;  2G0E A;  2RAE A;  4MLO A;  3Q0V A;  1IDZ A;  5IP7 J;  1OJL A;  2LFB A;  3MKL A;  3PM1 A;  4NEL A;  3GBG A;  3FIW A;  3G1O A;  5K7H A;  4DZJ A;  2OER A;  2HOS A;  3VVX A;  4FE4 A;  5GPC A;  4M3B A;  1JKR C;  2JJ7 A;  1ETW A;  3LOC A;  3OOU A;  4JP0 A;  3S1M J;  3ZQC A;  4JX4 A;  1JJ6 C;  3BT9 A;  3TED A;  4W97 A;  4BKX A;  3HOU J;  2MW8 A;  3M3Y J;  2RHA A;  4XK4 A;  3BCG A;  5E3N A;  2WB1 N;  2XB0 X;  4DYC A;  3VW1 A;  2DA4 A;  3VUQ A;  2YS9 A;  2WV1 A;  1MSF C;  3O8G A;  3JRI A;  2VUM J;  3CWR A;  1W0T A;  2E2H J;  3BTI A;  1WGX A;  4D5F A;  4GCL A;  1JKP C;  2IEK A;  1I6H J;  2O8K A;  2G3B A;  2UXH A;  2DG7 A;  4X1E A;  2ZCN A;  3GEU A;  1LE8 A;  5C3E J;  3PO2 J;  3FRQ A;  1GV5 A;  1MBG A;  4AYB N;  2DA3 A;  3SDG A;  2HOT A;  1NK3 P;  1T56 A;  3VPR A;  2DA5 A;  4B3A A;  1FJL A;  2KDZ A;  2Y31 A;  2O7O A;  1G2H A;  2Y30 A;  4HKU A;  4M3F A;  3BG3 A;  3V78 A;  1X58 A;  2R5Z B;  4FE7 A;  3CMY A;  5J1Y A;  2CQX A;  1S7E A;  3HDD A;  5IOY A;  2PZ9 A;  5EDN A;  4XRM A;  2NVY J;  3D1N I;  3HE0 A;  2R5Z A;  1QVU A;  1JJ8 C;  2REK A;  3FK6 A;  3HOX J;  4C3H J;  2W48 A;  5HSZ A;  3DPJ A;  2LLK A;  4ME9 A;  2E19 A;  3SJM A;  1WH7 A;  5J1R A;  1XG1 A;  4CYC A;  4A3F J;  2B63 J;  1ETO A;  1WCM J;  2FQ4 A;  4V2G A;  2HYT A;  1ETQ A;  3S2H J;  1WPK A;  1F43 A;  1WH5 A;  1IRZ A;  2DMP A;  1ENH A;  4UUT A;  3A03 A;  4IEJ A;  4BBR J;  1FIA A;  5EZH A;  1UG2 A;  2K40 A;  4FTH A;  3GTP J;  2FBQ A;  4GCK A;  1R9T J;  4JX6 A;  4DYR A;  3HTH A;  3KZ9 A;  4QTR A;  3V6G A;  4A3M J;  2CRG A;  9ANT A;  4JYK A;  4ICH A;  3VVZ A;  3M4O J;  3NI7 A;  3FKI J;  3KNW A;  5FHP A;  5EFY A;  2JWT A;  2LP0 A;  4QSH A;  3AQT A;  3MNL A;  1BL0 A;  4KWA A;  5CW8 A;  2DMU A;  1DU0 A;  4NN1 A;  5DAJ A;  3NXC A;  3B6A A;  1IV6 A;  3RD3 A;  1ZGW A;  3TP0 A;  4QIW N;  2EBI A;  2VKV A;  1FTT A;  3S5R A;  1BA5 A;  1SAN A;  1TWC J;  3BNI A;  3ZQG A;  2HXI A;  1JKO C;  4IHY A;  2R92 J;  5IYD J;  1BW5 A;  2NP3 A;  3BJB A;  1LFB A;  1B8I A;  2NX4 A;  3O8H A;  3HOZ J;  4RBO A;  1X2N A;  1SFO J;  3HB9 A;  1U9N A;  5HAW A;  3A02 A;  4IHX A;  2DA1 A;  4Y7N J;  3UKG A;  4YZE A;  3BR0 A;  2LR8 A;  3BTJ A;  3HM5 A;  4A3L J;  4L62 A;  5FMP A;  1IUF A;  3BR6 A;  2UXP A;  3T6N A;  2GFN A;  3LJL A;  3P9T A;  2M9H A;  2DMQ A;  3HOV J;  4BBS J;  5IP6 A;  1JUM A;  2XDN A;  1JTX A;  3ZQL A;  2G7S A;  3QPS A;  4S0H B;  2HDD A;  3QBM A;  4AC0 A;  5CXG A; 
#chains in the Genus database with same CATH topology
 3L7W A;  4LK0 F;  1Y1W J;  1FOK A;  3CCJ I;  3L09 A;  2HPI A;  3IC7 A;  3KFW X;  5LGN A;  3S1Q J;  2OTJ I;  5L3B A;  2QA4 I;  3EDP A;  2HQ5 A;  1SVL A;  2WY7 Q;  1S8N A;  4L0Y B;  2V1D A;  3FXK A;  4R8H A;  1TWG J;  3TDZ C;  3NS4 A;  4BAY A;  5FGL A;  2PFV A;  3I59 B;  2VLA A;  3A0H C;  3ON4 A;  2OD5 A;  3S2D J;  5EEA A;  1HKS A;  4V2F A;  2X48 A;  1I1G A;  2CJJ A;  3Q9V A;  2LKX A;  1W0U A;  2EZK A;  3IHU A;  4EAT A;  2LY9 A;  4M74 A;  5E79 C;  3L1P A;  1JXS A;  2EV5 A;  4M3E A;  5J47 A;  3W6J B;  2DYS H;  5FGM A;  1VTN C;  2K9N A;  3DCF A;  4HOB A;  4KFC A;  1XMK A;  1T0F C;  2GA2 A;  2JA8 J;  2PBX A;  2EJR A;  4Y33 A;  4GXO A;  1Y1V J;  4E7H A;  2JA6 J;  3AG2 H;  2XSJ C;  3S32 A;  3OL3 A;  3L2U A;  3LAJ A;  2HNH A;  5DV5 A;  3MKW B;  3LFK A;  1HSJ A;  3LWJ A;  1BBY A;  4M9S A;  3RYR A;  3KYC B;  3HPG A;  5BOX A;  2DOD A;  1J59 A;  4B8X A;  4GCT A;  3GF2 A;  3SEZ A;  2A05 A;  4UDS A;  1D5Y A;  4FAS D;  3WU1 B;  2RQQ A;  3KYL A;  1R4M B;  3OSG A;  1OCZ H;  4CZZ A;  3K1M A;  3B73 A;  3GTG J;  2YPR A;  3ASO H;  2AO9 A;  3GTQ J;  2CFO A;  3DF8 A;  2NS0 A;  5D5W B;  4RLF A;  4P1W A;  1FOW A;  2G7U A;  1MBE A;  3IKV A;  2NNN A;  2XV4 S;  3ECO A;  1D0Z A;  2QZ8 A;  3F6V A;  5L3D A;  1UAA A;  2Y9Y A;  2DBB A;  2KP6 A;  2G7G A;  2CMP A;  2X6W A;  1OFC X;  5FRM A;  3ABL H;  3R4K A;  2ECC A;  1QGP A;  2RC4 A;  3LFU A;  2FMY A;  1KYW A;  1ZR2 A;  1IN8 A;  4BQQ A;  1MBH A;  4CCM A;  5FRN A;  1ZKG A;  3T8R A;  1PP8 F;  2CU7 A;  1Z21 A;  2QKL B;  5C4Y A;  4ZDP A;  3F8M A;  2PBI A;  1LJ9 A;  2MD5 A;  4BY7 J;  3V7C A;  4HRI A;  2LVS A;  3O6B B;  4PJJ A;  2EH3 A;  3ABK H;  1LFP A;  3Q9S A;  2HYJ A;  3OYJ A;  1B8I B;  1WZ2 A;  2GA1 A;  3NRG A;  2XPV A;  1D5V A;  4EGZ A;  1OCT C;  4IL6 C;  1DGW Y;  3NRV A;  4PJL A;  1PUF A;  1FP2 A;  2EA4 A;  1TBX A;  1EF4 A;  1FIP A;  4X0G A;  1H0M A;  5BMZ A;  3ECH A;  4KIF A;  5LBQ A;  2EZH A;  3K69 A;  5DS9 A;  1CF7 A;  1TT0 A;  3WTU C;  2NVQ J;  1RI7 A;  1EKE A;  1XN7 A;  1ZGJ A;  5L3E A;  3CRJ A;  2ZXJ A;  2XIG A;  4LLG F;  3DEU A;  1O57 A;  1TTY A;  2L4M A;  3SFZ A;  4LGW A;  1T98 A;  2ELJ A;  2YSR A;  2MGQ A;  1A5J A;  2E7X A;  3ZQF A;  3ABT A;  4E7K A;  2LC2 A;  2W00 A;  1K6O A;  1VQ7 I;  2HEO A;  3LHQ A;  1RRJ A;  2IGO A;  2VOD A;  3OYN A;  4IHW A;  3KX2 A;  4A93 J;  2HFH A;  3MZY A;  4PJM A;  2MLG A;  1GVD A;  4PFO A;  1D1C A;  5CLS A;  1XC5 A;  3CF5 F;  4DOZ A;  1JTY A;  1H9T A;  2XAU A;  1JT6 A;  5JR3 A;  3HRU A;  3P5J A;  1FYM A;  4BY1 J;  1HLV A;  3BRU A;  2D45 A;  5GP9 A;  2GOX B;  3JRG A;  1TNS A;  5HBU A;  2F4I A;  5D5V B;  1BC8 C;  4IVN A;  4KNY A;  1JI8 A;  3OY9 A;  1R58 A;  2DO7 A;  2XF6 A;  3RDI A;  1OLT A;  2DU9 A;  4J00 A;  1LVK A;  4A3E J;  1F1Z A;  3M8E A;  1P4A A;  3RKX A;  3CUO A;  3HSR A;  4ZDL A;  3G56 A;  3FXM A;  1Y6I A;  2BZT A;  1IF1 A;  5D18 A;  4R79 A;  5E18 F;  2DQR A;  1FMV A;  5M3F J;  5ERI A;  2WAQ N;  2H1K A;  3VFZ A;  3CJN A;  4BHP A;  2E1C A;  3W6K B;  1ZH5 A;  2KRF A;  4WXH A;  2BY0 A;  5FFX A;  4RDU A;  2IAI A;  3SFI A;  4AIJ A;  2CQQ A;  3CC2 I;  2HWV A;  4G6D A;  4OMZ A;  2F5V A;  3CQZ J;  3FZV A;  3A1Y A;  1RIO H;  3CO7 C;  2QUF A;  4V19 K;  5D8K B;  2JRT A;  1HQC A;  2LMD A;  1TLH B;  5F04 A;  4UUS B;  3R61 A;  2IPQ X;  4ZYA A;  3BLY A;  5JHU A;  4O3M A;  4BL0 B;  5E1X A;  2DW4 A;  3KIO A;  4RB1 A;  4GDF A;  1D0X A;  2XGE A;  2KIS A;  1X2M A;  1UEL B;  5FJ8 J;  2DMN A;  3JRA A;  1YG2 A;  5FLX Z;  4IOC F;  4L9J A;  3SDB A;  3DBH B;  1FTZ A;  5GPA A;  3VYS B;  2AQF A;  1P7J A;  3LQR A;  2C6Y A;  2ELH A;  1FPQ A;  1R00 A;  4IHV A;  4M73 A;  2YVE A;  3ABU A;  4NC7 A;  5HOD A;  2W1O A;  4EM2 A;  2XF7 A;  3G7R A;  4XRS A;  2Q2E A;  4RGX A;  4LK1 F;  2GAU A;  1IG7 A;  3E5U A;  2IW5 A;  5EFY A;  4HLX A;  2F07 A;  3Q5F A;  3HOW J;  1VZ0 A;  3TMO A;  3GZI A;  2D6Y A;  2Y69 H;  2O3F A;  2L5Q A;  3LSJ A;  2IU5 A;  3G6E I;  1G8X A;  4M71 A;  2KRH A;  5TJJ A;  2OAZ A;  4MNU A;  3ZMT A;  3RI4 A;  1F36 A;  1BN5 A;  4A69 C;  3OIP A;  1YIO A;  4RAY A;  3E7L A;  2XGD A;  2P8T A;  4NBQ A;  1CGP A;  1O4X A;  3UNG C;  2FQ3 A;  1CQT A;  4IRI A;  2CQN A;  4ENJ A;  2E1O A;  1KU9 A;  4BS9 A;  2VQH A;  5HNH A;  5D5U B;  1MBF A;  4C3J J;  3BWG A;  4XOR A;  4A3C J;  2VOP A;  2CG4 A;  4I6Z A;  4R1H A;  4C2M J;  3MQ0 A;  4CDG A;  1OYY A;  1D0Y A;  1SAU A;  2Y0S N;  4C2M A;  3GME A;  1TT5 B;  2ZSH B;  5D4R A;  3EYI A;  2H6B A;  3IH3 A;  1MZB A;  2JN6 A;  4ESB A;  1BJZ A;  3F9K A;  1QHH D;  3BZK A;  2EFN A;  5DD8 A;  1HOM A;  4MGR A;  1ZR4 A;  2QIB A;  2LF8 A;  2Z33 A;  4XKV A;  3QPL A;  3GTJ J;  4H0E A;  4PGG A;  3KZY A;  4E7J A;  3EPZ A;  2ZME A;  5E3M A;  3CCR I;  2O9L A;  3V8K A;  3GFL A;  3V8L A;  3ROU A;  4ACI A;  2DTZ A;  1FLI A;  1S7A A;  2MAB A;  4AF5 A;  3PAS A;  4HQM A;  2B0L A;  2TRT A;  4PXI A;  1Z05 A;  4PJN A;  4MTD A;  2CV1 A;  4A6E A;  3EUH A;  1QZE A;  1RET A;  4YIF A;  2NP5 A;  2LRD A;  2UXU A;  4A5N A;  4JQF A;  3TQN A;  2OZ6 A;  4JKZ A;  2OF7 A;  1UJ8 A;  2A5Y B;  4RB3 C;  3B6C A;  5FKL A;  4G94 A;  3C1D A;  2LG4 A;  2O6G E;  1UI6 A;  1Z0X A;  4BGD A;  2G0E A;  1BIA A;  3Q0V A;  3OR2 C;  2K27 A;  4HV5 A;  3VEP A;  3KP5 A;  4RB2 C;  5K7H A;  3G1O A;  3NWS A;  3RPU D;  3DKY A;  4A2U A;  2OER A;  3E97 A;  4IPA A;  5D4S A;  4IQ4 A;  4OOI A;  2HOS A;  1YX3 A;  3QOP A;  4J01 A;  2JJ7 A;  2QQ8 A;  2CH0 A;  2X85 A;  2CW0 F;  3ZQC A;  2NNY A;  2ZJ2 A;  4C30 A;  1JJ6 C;  1QZY A;  3BT9 A;  3QAH A;  2OC6 A;  1I39 A;  2XVC A;  4BHC A;  2MW8 A;  2R7X A;  1ZLJ A;  4RS8 A;  1BI1 A;  1R1T A;  1VQL I;  2B7E A;  2CSO A;  2QEN A;  4FT8 A;  5E3N A;  4AD9 A;  3AKZ A;  3BCB A;  4OU0 A;  2XAJ A;  1MSF C;  3O8G A;  1KA8 A;  3CWR A;  2W57 A;  4D5F A;  4GCL A;  1G3S A;  2VJI A;  4HW0 A;  1JKP C;  2IEK A;  5LRS A;  3GEU A;  2PQ8 A;  4XON A;  2VQG A;  1R7J A;  1X1B A;  4AYB N;  1O3S A;  3H9Q A;  2Q2E B;  3E0J B;  4B3A A;  3HHG A;  4HF0 A;  5J6X A;  1V5E A;  1G6N A;  3MD2 A;  2OU2 A;  4M3F A;  5GAH J;  1T2K A;  4HX8 A;  3CO6 C;  2OA4 A;  1PP7 U;  3GW2 A;  5B1B H;  4EM0 B;  1FT9 A;  4RLQ A;  2FBH A;  4II2 A;  2M45 A;  4HST A;  2VAS A;  1S7E A;  3MWM A;  3GWZ A;  3EUH C;  1FBQ A;  1YS7 A;  1USS A;  1O3T A;  4OD5 A;  4JK1 X;  5K5Q A;  3HOX J;  1X3U A;  2W48 A;  2H8W A;  1WHU A;  4XNF A;  3ERM A;  1T95 A;  2R7Q A;  4CYC A;  3REO A;  2M3A A;  2DT6 A;  4V2G A;  1ETQ A;  1MJB A;  3GX4 X;  3S3M A;  4IKF A;  1WH5 A;  1F43 A;  4UUT A;  2LY2 A;  1B4A A;  4IEJ A;  1S9H A;  1FIA A;  3I3L A;  5EJC A;  3CCL I;  2BE5 F;  1R9T J;  4JX6 A;  4U0Y A;  1I5Z A;  1UB9 A;  3L2C A;  5E1W A;  5D8L B;  4B44 A;  2STW A;  2L02 A;  1R1V A;  3DTI A;  1BL0 A;  2P4W A;  5ICG A;  2DMU A;  2JPB A;  4TV7 A;  5HDG A;  1DU0 A;  1FBU A;  3NXC A;  3OYH A;  1BOA A;  1IV6 A;  4LLN A;  4I99 C;  1IN4 A;  4QIW N;  1HST A;  3I54 A;  1BR4 A;  3S5R A;  1JHH A;  3V7R A;  1BA5 A;  1VQM I;  3BNI A;  3ZQG A;  2XKP A;  1JGS A;  3ELK A;  2EFW A;  1SC7 A;  2F48 A;  2NP3 A;  5IYD J;  1RR8 C;  2NYX A;  4E6K G;  3WG7 H;  3HJE A;  2VJ4 A;  2FNA A;  4GRI A;  2NX4 A;  1W1W E;  2DLL A;  3A4C A;  1X1P A;  4UV9 A;  4RBO A;  4MQ9 F;  3OV8 A;  1X2N A;  3GVA A;  1IXR C;  1BI0 A;  3WGH A;  1U9N A;  2JA2 A;  4FX4 A;  3A02 A;  1LKX A;  2I8D A;  1TW2 A;  3VYU B;  4U0W A;  4CUG A;  1XGM A;  1IXS B;  3BTJ A;  1DDN A;  4KJZ A;  5HNF A;  2A69 F;  3MKZ A;  1UHW A;  3LJL A;  4XM3 A;  2DMQ A;  2ZFU A;  1JUM A;  3CMA I;  4CCJ A;  1J7K A;  2J5O A;  4EJV A;  3CCV I;  3ZQL A;  1DP7 P;  3QPS A;  1FOY A;  1P4X A;  2LRE A;  1XTA A;  4FIS A;  2UZK A;  1FC3 A;  1WRJ A;  1WKM A;  4WIB A;  2LDU A;  4NNJ A;  3E7Q A;  2LH9 A;  2HKU A;  3WU0 A;  2M8E A;  1G4D A;  2O0Y A;  4HZF A;  4LMY A;  3D5R C;  2ZSI B;  3CUQ C;  4M3G A;  1ZG5 A;  2ZY9 A;  2VT3 A;  1LPQ A;  2Q1Z B;  1P6R A;  2GM4 A;  2IP2 A;  2R93 J;  3BOQ A;  1B72 A;  2E2J J;  5LHG A;  2DA6 A;  3SYT A;  5DYM A;  1GXQ A;  4AVZ A;  5LGT A;  1AKH A;  5HDK A;  1APL C;  3WHB A;  1OCC H;  3BY6 A;  4HNU A;  1FSH A;  3ANP A;  3Q0U A;  4GFB A;  2WAD A;  2Y9Z A;  2JA5 J;  5F6F A;  2L2O A;  2JA7 J;  2KT0 A;  4NHJ A;  5IY5 H;  5LEK A;  3FF5 A;  2BHZ A;  3M1C A;  1JGG A;  2LTP A;  2HI3 A;  3IKT A;  2F5F A;  5FKM A;  3ZMZ A;  2H6C A;  3MZH A;  5BQT A;  4I0A A;  2RNJ A;  1ETX A;  4A3K J;  3HTJ A;  4QLC U;  2VI6 A;  3VP5 A;  4B4C A;  5L3C A;  5EEG A;  3DTE A;  2R7U A;  2X1D A;  4I02 A;  3L00 A;  3SEQ A;  2QSH X;  3OYB A;  3FXJ A;  4LB6 B;  4W1U A;  1Z9C A;  2AS5 F;  2UUZ A;  4CGZ A;  1HF0 A;  3WTT C;  1O3Q A;  5DM7 F;  3IRR A;  4IX7 A;  5LLQ A;  3QRF F;  2W4S A;  1VF9 A;  4DW6 A;  5JFR A;  5IYC J;  5FO5 A;  4CYC B;  1YJ9 I;  2QKO A;  1L0O C;  1Z67 A;  5EG0 A;  2PEX A;  3BC8 A;  3L9F A;  2MC3 A;  2VBZ A;  3DBL B;  3AG4 H;  5EGO A;  3F23 A;  3I4M J;  3CUQ B;  4Y4R A;  3A2K A;  3CMM A;  2WWY A;  2Q24 A;  2A6H F;  2E5N A;  1PYV A;  5IPA A;  1XPX A;  2CUF A;  3QYB A;  4Q47 A;  2X51 A;  2UXO A;  2GIV A;  5HS9 A;  5IP9 J;  3K4L A;  4CH7 A;  2V6E A;  4BDZ A;  3RKY A;  2CWE A;  2HQN A;  3K2A A;  3VOD A;  5ILV A;  1ZYR F;  3DLA A;  4C9Y A;  4ZTJ A;  3EYY A;  4JNN A;  3LSM A;  2IBD A;  3S8P A;  1RKW A;  4CCL A;  3HRM A;  2WV0 A;  4HF2 A;  4ZH4 F;  1H88 C;  2VKD A;  1XCV A;  3BG9 A;  3HHH A;  5M5Y J;  1OIS A;  2DDA A;  1I6X A;  4CGR A;  1UHM A;  3H0G J;  4K2E A;  3Q0W A;  2YVX A;  4AIH A;  4A6D A;  2COM A;  2DJN A;  3DV8 A;  1GXP A;  2P0W A;  2QTQ A;  1P4W A;  1T39 A;  5C4J J;  3V8J A;  2HU9 A;  4HA8 A;  4YG2 F;  2FU4 A;  4Q5S F;  2QQA A;  1YI2 I;  1WVR A;  4WCG A;  3P7N A;  2OQG A;  2GXG A;  4U9L A;  3EUK L;  2I10 A;  3PJR A;  3H9J A;  1TWF J;  3FIS A;  4DBR A;  1HC8 A;  4LG3 A;  1X3W B;  4DIQ A;  3JRB A;  2HKX A;  3JRH A;  2BW3 A;  3K0L A;  3CJD A;  4L18 B;  1KZH A;  2PMU A;  4BXX J;  3K1N A;  4A3J J;  3ZQI A;  2L9R A;  5IOZ A;  2KZV A;  1QU3 A;  3BP8 A;  3H5A A;  1IRG A;  4A0Y A;  5CXI A;  3BG7 A;  1R5G A;  3C3W A;  5HLT A;  3HXL A;  4A12 A;  1UCR A;  1HW2 A;  2IT0 A;  4E7S A;  1XSV A;  4C3I J;  2GUH A;  4L9T A;  1B72 B;  4N0B A;  3KYD B;  2P5L C;  4M3D A;  3L2Q A;  2KIF A;  4BU2 A;  3CCY A;  1ZRC A;  1MMS A;  1VQ8 I;  1AKH B;  2N8G A;  1SGM A;  2MLK A;  1XD7 A;  3M8F A;  2DDB A;  3F6O A;  1XDU A;  4MIM A;  2JPC A;  1W36 D;  3TOA A;  2HOA A;  3BPV A;  5JLW A;  2NVT J;  1J5Y A;  1RC9 A;  2M4G A;  2JSC A;  3S14 J;  2PG4 A;  4YII A;  2ELK A;  2DXI A;  1AWC A;  1PJR A;  1VQO I;  3DQV C;  1STZ A;  4WF2 A;  3F8N A;  2DI3 A;  1ORK A;  3Q3S A;  1BI3 A;  1YW8 A;  1G3W A;  2FX0 A;  5EYR A;  1HA8 A;  2XC7 A;  3DTK A;  3HOT A;  1TW3 A;  1SEU A;  2QOP A;  4NB5 A;  2A5W A;  4ENM A;  5AIQ A;  3AQS A;  2K9Q A;  3VOK A;  2CW7 A;  3FHN A;  5BNG A;  4BAC A;  3HTI A;  4WXD A;  4N4N B;  4FET A;  1WWX A;  3COL A;  4OAZ A;  5FKO A;  4KA4 A;  4G7H F;  5HS7 A;  5EG0 B;  3OIO A;  1QRY A;  3GTL J;  5EGO B;  2AXL A;  2NXN B;  2OPT A;  2DMT A;  2BXZ A;  5M5X J;  1UI5 A;  3K2Z A;  1JT0 A;  1B59 A;  3T8T A;  1EH6 A;  1EV7 A;  2DYR H;  3HTA A;  2JVH A;  3FX3 A;  4XIC A;  2AHQ A;  1VQN I;  1MMA A;  2LD5 A;  4XBF A;  4UUS A;  4L5I A;  4D7M A;  4PGH A;  1J75 A;  1MND A;  3RQI A;  4RAF A;  2ZOZ A;  1SFE A;  5BPD A;  4KMU X;  5J3L A;  2FML A;  2P7V B;  1R36 A;  4E7I A;  4HG2 A;  4PDK A;  3L2V A;  2RKH A;  3RH2 A;  2DCE A;  3I4N J;  4MFD A;  3TDU C;  1HW1 A;  2K9S A;  2HGC A;  2DTR A;  3HRT A;  3KP3 A;  4UXN A;  4D5C A;  2CFX A;  3N97 A;  2NOG A;  1FX7 A;  2ADU A;  2VBX A;  4QPQ A;  2FD5 A;  1ZTR A;  2JZY A;  3OYI A;  1H89 C;  4U88 A;  4Z2Y A;  1QO0 D;  3CJR B;  2KDO A;  1PDN C;  4GFL A;  2L3D A;  5F08 A;  3O60 A;  5B5E C;  2BHY A;  3HC7 A;  3H3V K;  2BEO A;  2YUS A;  2KIU A;  1U8R A;  1KON A;  3OR1 C;  2OBP A;  2R7W A;  1KQ9 A;  4DQ2 A;  3C07 A;  4KUM A;  3TW6 A;  4XR6 A;  3N05 A;  4BE2 A;  2CO5 A;  1DUX C;  2D5V A;  3GLL A;  3LSP A;  3JRE A;  4L5J A;  3KLN A;  1GLN A;  3OSF A;  4M6X A;  3ZXS A;  3VVY A;  2HR3 A;  4Y52 J;  5GAD J;  1TNT A;  5LFA A;  4HEA 2;  2KIM A;  4NUB A;  1HDP A;  1VQ6 I;  2IJL A;  1XB4 A;  2BW3 B;  4ENK A;  4OD4 A;  2QQB A;  2Z5U A;  3H92 A;  3BHQ A;  4RM3 A;  3NNR A;  5M5W J;  1OCP A;  5M3M J;  4WK8 F;  4I01 A;  4BHB A;  3F8C A;  4MTE A;  2OI8 A;  3GLX A;  4BE0 A;  5CVV A;  3I4P A;  1A36 A;  3CTA A;  3BR1 A;  3SZT A;  2B1E A;  1W4M A;  2V9P A;  5DEQ A;  1P7I A;  3LAP A;  5E3L A;  1SAX A;  1F9N A;  1WJD A;  3W6V A;  5D19 A;  1TZL A;  3AL0 C;  3HUG A;  2X1E A;  1Z91 A;  2Z1D A;  4RMN A;  4I2O A;  4ABZ A;  3GFJ A;  4OMY A;  4GO1 A;  3JSP A;  2GLO A;  2NS8 A;  4NQW B;  1YOV B;  2BY3 A;  3I58 A;  4L5E A;  1ETY A;  5B66 C;  4AC6 A;  4GFK A;  1RUO A;  3ISP A;  3M8J A;  2QKM B;  2XPW A;  3BJ6 A;  1IXC A;  4QPO A;  4MK6 A;  3PPB A;  1L3L A;  2M8G X;  3I55 I;  4HBL A;  3KKC A;  3LSR A;  2VL8 A;  3WE2 A;  5ED4 A;  2NS7 A;  1ACI A;  1N75 A;  5FB2 A;  2LKP A;  2YX7 A;  2LFB A;  1E2X A;  3E6D A;  2W82 A;  3PM1 A;  5IP7 J;  5J8F A;  2P7C B;  3CF2 A;  4DZJ A;  3WTX C;  1S29 A;  4FE4 A;  5GPC A;  4M9Z A;  3E6C C;  1QPM A;  2XAS A;  3LOC A;  4YEL A;  3HKZ A;  4EV0 A;  3CD6 I;  1Z3X A;  4C2U A;  4W97 A;  2XAQ A;  4E70 A;  1Q1H A;  3HOU J;  2V79 A;  4KIT B;  2EA2 A;  1OPC A;  2Z2S B;  4EJT A;  1YLF A;  2HVQ A;  4KN4 X;  3MFK A;  3QU6 A;  2XB0 X;  3VW1 A;  5D6F A;  2CUZ A;  5K5O A;  2M1B A;  3AL0 B;  3AG3 H;  3NQO A;  1BIB A;  3JRI A;  2IA0 A;  1W0T A;  1WGX A;  3H36 A;  1SFU A;  3QOD A;  3GEZ A;  1LUJ B;  3N4M A;  2R7V A;  1I6H J;  1K79 A;  3J7A O;  2KLO A;  2G3B A;  2HPM A;  4X1E A;  4BJ6 C;  1LE8 A;  5C3E J;  2QGU A;  1QBJ A;  1MNE A;  4RB0 A;  3WE3 A;  3RTR A;  1QZZ A;  3FRQ A;  1GV5 A;  1MBG A;  3EUA A;  2DA3 A;  3T1B A;  1AOY A;  1T56 A;  2X6X A;  5CKT A;  1ODD A;  1D1B A;  3K4B A;  2Y31 A;  5J40 A;  2KDZ A;  4LIU A;  1X58 A;  1V4R A;  2OZU A;  2R5Z B;  1ONV A;  2MA3 A;  1S5L C;  5JVT A;  4FE7 A;  4CHU A;  4M6Y A;  5D5X B;  2PX9 A;  4CCK A;  2F5D A;  2PZ9 A;  2IRF G;  4YIR X;  2ICW G;  3ZQ7 A;  4FHT A;  3D1N I;  4O6J A;  2MYS A;  1OYI A;  2XHK A;  3QU3 A;  1JJ8 C;  3FK6 A;  2OTL I;  1X3Z B;  4C3H J;  1YJN I;  4AID A;  5HSZ A;  4ME9 A;  2RGV A;  1BOB A;  2Q0O A;  3SJM A;  1WH7 A;  5TRD A;  2PLY A;  2PN6 A;  1V3F A;  3DPL C;  3EQL F;  2B63 J;  1ETO A;  3FHZ A;  3I56 I;  3S2H J;  1WPK A;  3WTW C;  2BY2 A;  1IRZ A;  3CCQ I;  3FBN B;  1K78 B;  4BBR J;  5EZH A;  1NG6 A;  1VQ5 I;  2Z3Y A;  4KIB A;  2FOK A;  2V6C A;  4KN7 X;  4DYR A;  2DFE A;  3V6G A;  4QTR A;  1S6L A;  3AAF A;  9ANT A;  2X1C A;  3ULQ B;  3PIP F;  3CJT B;  2ZJR F;  2Z16 A;  3W2A A;  3M7G A;  1XGO A;  3CCU I;  3KP2 A;  5FRO A;  2LP0 A;  1KGS A;  4QSH A;  1FYK A;  3P9K A;  5E1Z B;  3U1D A;  2RVC A;  4I98 B;  4KWA A;  5CW8 A;  4BE1 A;  1B1B A;  1XX5 A;  2KKO A;  2ZXH A;  4NN1 A;  2WTE A;  2F4M B;  3DP7 A;  3RD3 A;  1ZGW A;  2L01 A;  1YHQ I;  3CME I;  3HUG B;  2EIL H;  1DPR A;  2OCC H;  2RDP A;  2R92 J;  1JKO C;  1BW5 A;  2BOL A;  2O5R A;  2X6Y A;  2HDC A;  2ZNY A;  1XGN A;  4KIC A;  2PJR A;  4P96 A;  4G7O F;  2JT1 A;  3HOZ J;  2DFH A;  4LLL A;  1HXD A;  3OYG A;  2K5C A;  3HG9 A;  3HB9 A;  4BQN A;  2DFF A;  2LF7 A;  2GIZ A;  2ACJ A;  3HTU A;  2UXX A;  1K4T A;  1TQM A;  2UXP A;  3M9A A;  1XMA A;  1ZN2 A;  4F52 A;  2GWR A;  2VPL A;  1ON2 A;  3VB2 A;  3P9T A;  1X4P A;  4ZC3 A;  4BBS J;  2AQE A;  2XDN A;  3WTS C;  2LSO A;  2WB1 A;  1U3E M;  4AC0 A;  3K4K A;  2JVG A;  3EGQ A;  2EK5 A;  4U7D A;  3S2W A;  2R5Y B;  1IAW A;  2ZOY A;  3EUP A;  2HS5 A;  1XSD A;  1MNM C;  1OCR H;  3NAU A;  2R0Q C;  4HDV A;  2QM3 A;  5L3G A;  4C2T A;  1KU3 A;  4ASN A;  2V4J C;  1W5C C;  3VDX A;  2XGC A;  3ZMS A;  3S16 J;  4RGU A;  4YFX F;  2JK3 A;  2DT5 A;  4P5O A;  1H8A C;  4KMF A;  1RKT A;  2KHM A;  3IH2 A;  4G9Y A;  2CS3 A;  2YVH A;  5E3O A;  1LE8 B;  4BNC A;  2DFI A;  2FBI A;  2NAZ A;  2VBW A;  4A0X A;  2GEN A;  1TQP A;  4XSX F;  5C4X J;  3FXR A;  3R6S A;  2IGK A;  4LG0 A;  4MXM A;  3X2Q H;  2UWM A;  3FMQ A;  2A68 F;  2EFQ A;  3HYI A;  1REP C;  3PSF A;  2E2I J;  3VWB A;  5TIS C;  2A3S A;  4G7Z F;  1WJ5 A;  3FDY A;  1NG7 A;  3LNQ A;  3QWL A;  2K3F A;  5FD6 A;  1KU7 A;  2VJ5 A;  3ZRG A;  4WX9 A;  2EIN H;  4XRF A;  4YFK F;  2KZG A;  2GZW A;  3C2G A;  5LHH A;  2R7T A;  2HXO A;  5DM6 F;  1MDM B;  2OQR A;  4OIO F;  2KRC A;  4MFE A;  2DG8 A;  1IJW C;  4M72 A;  3DKW A;  4LFU A;  1ERD A;  3CCE I;  2BVM A;  4FCY A;  1K61 A;  5JHF A;  1J2X A;  2M87 A;  5E8G A;  1AA7 A;  3QPT A;  3RSN A;  3ZMD A;  3BPX A;  3CP8 A;  2RQP A;  1Z77 A;  5E8I A;  1PUE E;  1SFX A;  4Q48 A;  4EJO A;  4F93 B;  1GDT A;  4X6A J;  1FSE A;  2E1M C;  4KIG A;  2GOM A;  1U78 A;  4RAZ A;  2W25 A;  1T33 A;  1QVT A;  1GHC A;  3CUQ A;  2ZXI A;  1OR7 C;  2L4A A;  1BC7 C;  4P55 A;  4MO7 A;  3MVP A;  2NVX J;  5KHD A;  2COB A;  3LA3 A;  2FXA A;  3H3Z A;  2B3W A;  2R3S A;  3BR2 A;  3KET A;  4I76 A;  3HRS A;  4E7Z A;  4F3Q A;  5E20 A;  1B9M A;  4M6V A;  4IJA A;  4KIS A;  4U0V A;  3RYP A;  4N4O B;  4EEF G;  3H1C A;  2PJR B;  1GVJ A;  1LDJ A;  3D0S A;  1ZRF A;  4WWC A;  2V1X A;  4Y15 A;  5K7F A;  1MBJ A;  2K02 A;  3FBI B;  3SZG A;  3LMM A;  3GUD A;  3E1S A;  1OKR A;  3O3K A;  4L9V A;  5BS6 A;  3VOX A;  5H2F C;  4XLE A;  2EZI A;  1ETV A;  3PO3 J;  3F22 A;  2V26 A;  3ZQQ A;  2DK5 A;  5KCM A;  5F1R A;  4A3G J;  1EH7 A;  1BJA A;  2WAE A;  4D7N A;  4I0B A;  4DYQ A;  1BW6 A;  4FX0 A;  1Q1V A;  2JTV A;  2F2E A;  2WGB A;  2E1M B;  3CZ6 A;  3T5X A;  4A3I J;  2IS6 A;  3IAS 2;  2VN2 A;  1Z7L A;  3JSJ A;  2H8R A;  1DU6 A;  1UST A;  2HDW A;  1YTY A;  1S7O A;  3K7A J;  2VQC A;  2L54 A;  3OYL A;  3DLL F;  3VW2 A;  2HKO A;  4IOA F;  2ETH A;  4II3 A;  3GTM J;  2ECB A;  1KYZ A;  3J7A Y;  2ZO4 A;  4XLF A;  1NK2 P;  2PFB A;  3CC7 I;  2JSP A;  3A0B C;  1ULY A;  3AG1 H;  2MC4 A;  3RPU A;  1ZEL A;  2BVL A;  2DOF A;  4CYD A;  2LOO A;  1SD5 A;  3IL2 A;  4XRS G;  3G3Z A;  3SHF A;  5F0C A;  3G73 A;  4IHS A;  1FP1 D;  4U7B A;  3C18 A;  3HGY A;  4HNT A;  2NOJ B;  5H9T A;  2L7Z A;  2WAQ A;  5F0F A;  2A61 A;  2V9V A;  1K83 J;  1WSU A;  1O3R A;  3DXJ F;  1I27 A;  4PZJ A;  1W5S A;  4LG0 B;  2Y2Z A;  2ZKZ A;  1FMW A;  3W2V A;  5F64 A;  1DP3 A;  2DPU A;  3JRC A;  1IN7 A;  5HOO A;  1U8B A;  4L0Z B;  4EMS A;  3J7Z I;  3ZCO A;  4NDL A;  1HDD C;  2UV1 A;  1MBK A;  3MMY B;  2DA2 A;  2Y48 A;  4UB6 C;  3W2W A;  1YW9 A;  4LD5 A;  5AQC A;  2OJE D;  4O5V A;  3K4M A;  3MN2 A;  2CV2 A;  3DU5 A;  3PUF A;  2ID6 A;  1H9G A;  5F0H A;  3ZN0 A;  2ZCM A;  2L9V A;  2YU9 J;  3VSL A;  1ETK A;  2HVR A;  3ZQH A;  2UXI A;  1GUU A;  3OYF A;  3BG6 A;  1J09 A;  1Z6R A;  1R5I D;  1RES A;  1NH3 A;  2BXY A;  1B6A A;  1V55 H;  2DN0 A;  1D8J A;  1TC3 C;  3TO6 A;  2MG4 A;  1T8I A;  2A6E F;  1I50 J;  2M0M A;  4CXF A;  3FK7 A;  2QCO A;  3JRF A;  4KDP A;  2UXN A;  3HKZ N;  4IRH A;  3BDD A;  4N9H A;  3WHC A;  3WOD F;  1MH4 A;  1K7A A;  4P9U A;  1N25 A;  4A3D J;  2VC0 A;  2H09 A;  1WI3 A;  2TDX A;  4Z6Y A;  4HYE A;  2ID3 A;  3RZO J;  5ILS A;  1B9N A;  4BJT A;  5DDG A;  4IXA A;  4B47 A;  1Y0N A;  2R7D A;  1YYV A;  3K1P A;  1RR7 A;  3K4J A;  5H6R A;  4XN3 A;  1QQI A;  3ZMV A;  5J8C A;  4XL9 A;  3GTK J;  2FJ1 A;  1OQY A;  2EQR A;  3E6M A;  2LK2 A;  2X0L A;  3CCM I;  3ASN H;  1A6Q A;  1P92 A;  2XRN A;  3E6B A;  1X4O A;  2Z9O A;  1F5T A;  5ICE A;  1R4N B;  1Y39 A;  3KE2 A;  2FOW A;  4DJA A;  1Y56 A;  3QQA A;  3HGG A;  4DGW B;  2WUI A;  2V1U A;  3JR9 A;  2K4B A;  2JQ7 A;  3JCU C;  1A6I A;  2L7K A;  4KT6 A;  5B3S H;  1R22 A;  1J9I A;  1YFH A;  5A2Q K;  3VW0 A;  3ML6 A;  5D6E A;  2QYO A;  1IDY A;  3QKX A;  3BQZ A;  1WJA A;  4UB8 C;  3V42 A;  1R6R A;  3OIQ A;  3ON2 A;  3DPU A;  3PSI A;  1AHD P;  2WBM A;  4CO8 A;  3R0J A;  3CP2 A;  3OS2 A;  3G71 I;  1EJ9 A;  4BQA A;  4IRV A;  3O2P E;  1WJF A;  2FF4 A;  4XLC A;  2R7F A;  5JVG F;  4LOC A;  4Y3O A;  1KQ0 A;  4ANJ A;  5FLV A;  5KAF C;  3I0T A;  4PUS A;  4CCN A;  4ETS A;  2IS2 A;  2BY1 A;  2IA2 A;  4HX7 A;  3LWF A;  3K9T A;  2ZCW A;  4XLH A;  3JAM K;  1OMI A;  2P5K A;  4XQF A;  4AWX B;  3ERE D;  3RZD J;  4OWR B;  3BR3 A;  1ITY A;  1U9O A;  4ITV A;  2J5P A;  2V7F A;  1I3Q J;  5K1Y A;  3GFM A;  1LDD A;  1POG A;  4KT5 C;  4OIR F;  5CVJ A;  3IUV A;  1U2W A;  1WJB A;  2DA7 A;  4GYI A;  5LGU A;  2VBY A;  1IO2 A;  5B1A H;  2GQQ A;  1E3O C;  3LA7 A;  3BJO A;  3RJP A;  4BJ5 C;  4NQW A;  3BR5 A;  1SD7 A;  3IWF A;  3CLO A;  3VYR B;  2QQ9 A;  1WQ2 A;  4MLO A;  1IDZ A;  1OJL A;  3GBG A;  3FIW A;  6PAX A;  5HLH A;  4PK4 A;  1OYW A;  3ZP5 A;  5L3F A;  5KVR A;  3FMS A;  4ZYD A;  2F5C A;  2F6C A;  4HLY A;  4JP0 A;  4AM3 A;  3I64 A;  4MEY F;  3G2B A;  4JX4 A;  5EEH A;  4YFN F;  2PMZ A;  3CDI A;  2QBY B;  3TED A;  3F8B A;  3FXL A;  3TO7 A;  3DBR B;  4AYB A;  1T38 A;  1YX5 A;  3TOB A;  1S72 I;  4IRG A;  1HKT A;  1U5T A;  2CUJ A;  1SMT A;  3JTG A;  2WB1 N;  2R7R A;  4CA0 A;  3VUQ A;  4LB5 A;  4ZZD A;  2YS9 A;  2WV1 A;  3WG9 A;  2ISZ A;  2E2H J;  3LL7 A;  2CYY A;  1W5T A;  2LBF A;  2M4K A;  2A2F X;  2KJB A;  2RN7 A;  4CIC A;  5IT9 K;  2FEZ A;  2O8K A;  3ZR8 X;  2KIQ A;  4CCO A;  5HDN A;  1A35 A;  2DQL A;  2HYF A;  3GFI A;  3PO2 J;  3QP6 A;  1MMG A;  1YE9 A;  2XKO A;  2CGP A;  1Y8Q B;  3D5L A;  2HOT A;  1NK3 P;  1FJL A;  4GCV A;  4PSX A;  3J7Y J;  3WTV C;  1ZRE A;  1E3H A;  2Y30 A;  4HKU A;  3V78 A;  3BG3 A;  5AON A;  3D5S C;  2IVM A;  2MH9 A;  2HYG D;  2Y0M A;  3K6G A;  5J1Y A;  5LD2 C;  4PSW A;  3HDD A;  5IOY A;  3DWL E;  4XRM A;  4XSZ F;  2NVY J;  2FNP A;  3HE0 A;  2R5Z A;  2IGM A;  4FQG A;  1QVU A;  2REK A;  2WA0 A;  2A6T A;  2E34 A;  4RM2 A;  3KP7 A;  1G3Y A;  2RNG A;  3LST A;  2DT7 B;  3DPJ A;  2LLK A;  2QSF X;  2E19 A;  3RIR A;  3RKW A;  4HX4 A;  3WGI A;  5J1R A;  1XG1 A;  2KQR A;  4A3F J;  3FMR A;  1WCM J;  2HYT A;  1T6S A;  2E7W A;  2JUC A;  3CDH A;  1ON1 A;  3OYK A;  2LYC A;  1UG2 A;  2K40 A;  4D1Q A;  4FTH A;  3GTP J;  2FBQ A;  2VIX A;  3VTI A;  1BR1 A;  4GCK A;  3KZ9 A;  3VSK A;  4A3M J;  1MMN A;  1QA6 A;  3HIF A;  2CRG A;  1DQU A;  5K5R A;  2JRM A;  5DUI A;  1P9Q C;  1RUN A;  4D0P A;  1C0W A;  2M5W A;  3NI7 A;  2F5E A;  3FKI J;  1K78 A;  5FHP A;  1D8K A;  2JWT A;  2K4J A;  2HZD A;  4UUV A;  3AQT A;  3IRQ A;  1ZGA A;  1MD0 A;  1R71 A;  1U5T C;  2IS1 A;  1IN5 A;  2GXA A;  5DAJ A;  1S3J A;  4CZC A;  2B9S A;  4P9F A;  3TP0 A;  2P6S A;  4RAG A;  4XMY A;  1FTT A;  3QP5 A;  4HF1 A;  1TWC J;  5DUK A;  4UVA A;  1KQ8 A;  2HXI A;  4IHY A;  1SVO A;  2W85 A;  2CW8 A;  4BEH A;  1RNL A;  2EV6 A;  2XAF A;  3LSH A;  4GGG A;  2FJI 1;  3OS1 A;  3E5Q A;  3RQ4 A;  1WI9 A;  2P6T A;  5AIP A;  3GZ5 A;  5GAE J;  1FYL A;  3J81 K;  4HSR A;  3I5U A;  3FWE A;  3GXO A;  3KP4 A;  2R4G A;  5HAW A;  3FXO A;  3JW4 A;  2A07 F;  4Y7N J;  3UKG A;  2K9L A;  3KPH A;  4YZE A;  4OIQ F;  1EA3 A;  3BR0 A;  1FWZ A;  2LR8 A;  3FKJ A;  3HM5 A;  4OAY A;  5FMP A;  1G3T A;  2XUB A;  4ESF A;  2NRA C;  1U6G A;  3QYF A;  1YIJ I;  1YJW I;  4Y17 A;  3BRO A;  2K85 A;  1K6Y A;  5IP6 A;  4HQE A;  2G7S A;  2FRH A;  1MIJ A;  1IW7 F;  5CXG A;  3IH4 A;  4RA2 A;  2O7T A;  4LJZ F;  2MSY A;  4F7Z A;  1MW7 A;  1YO5 C;  3HTS B;  4MEX F;  1U5T B;  1YS6 A;  3B02 A;  2E60 A;  3LQQ A;  4PFP A;  5JI6 A;  1IC8 A;  1MGT A;  1YIT I;  2JMW A;  2WC2 A;  3BG5 A;  4HV6 A;  2I5U A;  2R5Y A;  2M34 A;  1IN6 A;  3H35 A;  1LVA A;  1XS9 A;  2LBF B;  1ZRD A;  1X1C A;  3G1L A;  4XOP A;  3UR3 C;  1ZK8 A;  3C2B A;  2ESN A;  5CQE A;  1R1U A;  2ZJP F;  1TWH J;  1ZLK A;  4ZDO A;  3U21 A;  2VKE A;  4S04 A;  2V1N A;  3DFG A;  3TBI A;  4BQO A;  3VOE A;  3GTO J;  4DNC A;  2W24 A;  2X9D A;  1MJ9 A;  3K70 D;  2VE8 A;  4DBQ A;  1RPW A;  3F0C A;  2XF5 A;  3I9V 2;  1ZG1 A;  1MSE C;  3H0D A;  1MJA A;  3KZI C;  3FXQ A;  1TL8 A;  2E36 A;  3VYT B;  2QWT A;  3KEQ A;  2EB7 A;  3B81 A;  3U9G A;  2STT A;  2HQR A;  2FUG 2;  2L7M P;  1Y0U A;  4EGY A;  4A3B J;  1FEX A;  1JKQ C;  2X6O A;  4H4K C;  1A31 A;  1A04 A;  2MBF A;  4B09 A;  1XCB A;  5J4V A;  1X1A A;  2E1N A;  1U0J A;  2QWW A;  1R49 A;  1MDM A;  3H9G A;  2TCT A;  1N78 A;  3JRD A;  1NHA A;  3K4N A;  3J80 K;  4MHG A;  1MKM A;  3ZMU A;  2VON A;  3PNY A;  3DEE A;  1MMD A;  1FNN A;  4UHT A;  1W36 C;  4AVP A;  5EF6 A;  3NEU A;  3HIM A;  3F1B A;  3NPI A;  2EIM H;  1LEA A;  3BTL A;  3A01 A;  1VQ4 I;  1K4S A;  2DJI A;  3CC4 I;  3GYH X;  1YRN A;  3QPH A;  5CVI A;  3PL8 A;  2QLZ A;  2KFD A;  2XAH A;  3SXY A;  3KKD A;  4G6T B;  1VFC A;  5C44 J;  2M2E A;  5EZG A;  3ZN1 A;  3RKQ A;  5K58 A;  1JUP A;  2R7O A;  4ZYG A;  2XDV A;  3HPH A;  1PUF B;  2L9N A;  2XB5 A;  5IYB J;  4BEH B;  4F55 A;  3G1M A;  2ZXW H;  4JX5 A;  3MKY B;  2IXS A;  3LA2 A;  3PUB A;  4UY8 I;  5CVU A;  3TGN A;  3W3C A;  3HSF A;  3GZN B;  5ICF A;  3PNT A;  4IZZ A;  3GCM A;  1CF7 B;  4OIP F;  2YR2 A;  4E4H A;  5ICC A;  1XSX A;  3T0Y A;  4MQV A;  3OL4 A;  1T08 B;  1DGR M;  1UHS A;  1VQP I;  2PMH A;  3PQK A;  1Z1D A;  1NTC A;  3F21 A;  3S15 J;  2EPF A;  1VI0 A;  4IF4 A;  2M30 A;  4L9N A;  4IHT A;  2NVU B;  2DAO A;  1PVE A;  1FBS A;  2BBY A;  2ESH A;  1I1S A;  3C7J A;  2VPR A;  2VT2 A;  3KP6 A;  5DTD A;  5GAG J;  4EVI A;  4KYW A;  3S17 J;  4JL3 A;  1RZ4 A;  3S1R J;  1AU7 A;  3S1N J;  2QVO A;  1GT0 C;  1SD6 A;  3HEF A;  2ZBK A;  3ZPL A;  3LSK A;  1HW5 A;  2RV8 A;  4A5M A;  3CES A;  3G4S I;  1OR7 A;  4HDU A;  2F4O B;  3TP3 A;  2EV0 A;  2DOE A;  1F4K A;  1ZAR A;  3OMY A;  4I09 A;  4LIV A;  3SQN A;  5JLX A;  2D1H A;  3TKY A;  2CV0 A;  3P9I A;  4XOT A;  5HLI A;  2E35 A;  3OOP A;  3HOY J;  1E3P A;  5FD5 A;  1MH3 A;  5FKK A;  3HSE A;  4UNO A;  4XLN F;  4G6Q A;  1N77 A;  5J4Y A;  3CJQ B;  4RGS A;  4XID A;  5A2Q Z;  3S3O A;  5F1J A;  4ZJZ A;  2O03 A;  3IV5 A;  3JSO A;  1W7P D;  4ZTF A;  3VIB A;  2CQ7 A;  3PFY A;  4BXU A;  4EJU A;  3RCO A;  3MAJ A;  5KNL A;  1BR2 A;  2OUM A;  3K10 A;  1ZQ3 P;  2E71 A;  1IGN A;  2KMU A;  3E3V A;  4HAM A;  3BQY A;  2FE3 A;  3KEO A;  5HLG A;  4GYG A;  3R0A A;  5H6Q A;  3ZGK A;  3CCS I;  3ANG A;  2KL4 A;  3ABM H;  1LB2 A;  1HBX G;  2VOO A;  3R60 A;  2H1L A;  4ZYE A;  1FOX A;  2ME6 A;  1JE8 A;  1SD4 A;  1BM9 A;  1QNT A;  4PCQ A;  2QF7 A;  5F27 A;  5K7Z A;  2M0C A;  3WGG A;  2EZL A;  2RRE A;  3K8P C;  2JUG A;  3S3N A;  2EIK H;  3M1E A;  2R7S A;  1Y8R B;  3DEW A;  5FKN A;  5E17 F;  1X19 A;  1R23 A;  2DK8 A;  4XN0 A;  1VND A;  3JAM Z;  2GXB A;  2XGX A;  4IO9 F;  2IA1 A;  2BYV E;  4A0Z A;  1P2F A;  2PMZ N;  3IUO A;  2L7F P;  3OYC A;  2CQK A;  3H5N A;  5KK1 A;  3ONQ A;  2K3P A;  3A01 B;  1IUY A;  2L0K A;  2FSW A;  3ZOB A;  3IAM 2;  1ZAO A;  4G12 A;  2K86 A;  2ZME C;  3KLO A;  3F8F A;  1HCR A;  1YRN B;  1R5H A;  2EWN A;  2ZCX A;  2YX4 A;  1UZC A;  1XMX A;  2XRL A;  2D2W A;  2CUE A;  4EJW A;  5HS8 A;  2Y75 A;  3OWT A;  2AXT C;  2GBY A;  4HPQ A;  2R7Z J;  3H3U A;  2KJC A;  2FBK A;  1WJE A;  3OYD A;  1JHF A;  5DCM A;  5TGT A;  4AUX A;  2QEX I;  3PNV A;  3HBL A;  2P5V A;  4XKC A;  4AU7 A;  2W53 A;  2G9W A;  2ZNZ A;  3JTH A;  3NAR A;  3U2R A;  3MCZ A;  1EH8 A;  3SZP A;  2OCE A;  3TW7 A;  4B1R A;  3WTZ A;  2H94 A;  3K4C A;  3F72 A;  2D1V A;  2LY1 A;  2VC1 A;  2Q8K A;  4UVB A;  1OCO H;  3BTC A;  4F91 B;  2G7H A;  3CDL A;  5GTH C;  3WTY C;  4U9N A;  3LSI A;  4DVY P;  3HZJ A;  3HOS A;  2G7L A;  5IT9 Z;  3LSG A;  4DZP A;  5CQG A;  3TL4 X;  3U1K A;  2VB6 A;  5D1R A;  4ON0 A;  2HTS A;  1M1E B;  2RAS A;  1IRF A;  1O7F A;  2ZB9 A;  1FY7 A;  3QYE A;  1GV2 A;  2ZME B;  2LKS A;  4J19 A;  2VJJ A;  3PQJ A;  3K70 C;  2V57 A;  1LFU P;  1VQK I;  4HNV A;  1WJC A;  1IRX A;  1TQI A;  2VQL A;  4EM1 A;  3TO9 A;  1BI2 A;  2V9K A;  1Z7U A;  2HOE A;  2HTJ A;  2WY8 Q;  4OIN F;  2XSD C;  5FLM J;  1QHG A;  2P81 A;  3DKX A;  3FM3 A;  4B3X A;  1SVM A;  1Z6T A;  5J1U A;  4D9J A;  3E5X A;  3GZ6 A;  1YQA A;  1TWA J;  5FFZ A;  3OYA A;  2L9S A;  4XKB A;  5FLX K;  2PI0 A;  4RGR A;  1D3Y A;  2XPU A;  3H5R A;  3COA C;  5LEJ A;  5HVQ C;  3QOE A;  2ME0 A;  1QPI A;  3AFH A;  1LEB A;  1UMQ A;  3PIO F;  1I3A A;  1LDK B;  4UVC A;  3I53 A;  4ESJ A;  1JUS A;  2O8X A;  5CPR B;  3PFI A;  4WXC A;  2RAE A;  2ZJQ F;  1ZG3 A;  2VKH A;  3MKL A;  4NEL A;  2QSG X;  4ENN A;  3VVX A;  3I71 A;  1W7P A;  4M3B A;  1JKR C;  1O7L A;  3FXU A;  4XLP F;  4BDY A;  1ETW A;  4BYY A;  4LIT A;  3FM5 A;  1XGS A;  3MZ8 A;  1G59 A;  3OOU A;  2LNB A;  4PJ0 C;  3S1M J;  1HKQ A;  1D1A A;  3IP4 B;  2E5Z A;  4BH9 A;  2PJP A;  2MD0 A;  1V54 H;  4BKX A;  2VE9 A;  3M3Y J;  4JOM A;  3SWH A;  2RHA A;  4XK4 A;  3BCG A;  2Z99 A;  4M9X A;  1UFM A;  1LNW A;  4DYC A;  2HQA A;  3V7S A;  2QBY A;  2DA4 A;  4N9I A;  3OYE A;  1SFK A;  4E7L A;  3I59 A;  4F92 B;  2VUM J;  3BTI A;  3P9C A;  3OS0 A;  4UV8 A;  2ISY A;  2BGC A;  3J81 Z;  3F3X A;  3L2W A;  1UG0 A;  2K7L A;  2VXZ A;  2UXH A;  1YW7 A;  3HL2 A;  2DG7 A;  2ZCN A;  2W7N A;  3RPQ A;  5KAI C;  2X4H A;  3SDG A;  2ZFW A;  4EQQ A;  1XDS A;  2WAF A;  2YU3 A;  3VPR A;  2DA5 A;  1G2H A;  2O7O A;  4XLA A;  1J0R A;  4ZZL A;  4IQJ A;  4I7H A;  4B43 A;  1DPU A;  5DCM B;  2ZC2 A;  3CMY A;  3MEX A;  2CQX A;  3CLQ A;  3V4G A;  5CJ9 A;  4BUP A;  5EDN A;  3ESW B;  1FZP B;  1WFX A;  5LRR A;  4YEJ A;  1LQ1 A;  2VXD A;  5IT3 A;  2M7A A;  4YRV A;  3NWT A;  3KZZ A;  3KCC A;  1Z3Y A;  4BXF A;  2FQ4 A;  3S93 A;  4CSW A;  1IZ1 A;  2Y0S A;  1E17 A;  2DMP A;  1ENH A;  1VQ9 I;  2FA5 A;  3A03 A;  4ZYH A;  3BCA A;  3HTH A;  4NC6 A;  4JYK A;  3WU2 C;  3C2H A;  2DPD A;  4ICH A;  3M4O J;  3VVZ A;  3DPT A;  4B48 A;  5CYV A;  3KNW A;  1X1D A;  4Y13 A;  2EIJ H;  3MNL A;  5DCF A;  4NC8 A;  1SMY F;  3DU6 A;  5H20 A;  1T0F A;  1V5G A;  3B6A A;  4Q4Z F;  2EFP A;  2EBI A;  2VKV A;  5CVR A;  1SAN A;  2MH2 A;  3EET A;  3BJB A;  2OV7 A;  2XRO A;  5DD4 A;  1E0E A;  2M7B A;  1LFB A;  1IV8 A;  2IGN A;  1B8I A;  4XKW A;  5GTI C;  2W84 A;  4JBA A;  1TP4 A;  3O8H A;  2KPM A;  3L2R A;  2HZT A;  3KEY A;  4G8X A;  1SFO J;  2MFZ A;  2XAG A;  4AIK A;  4IHX A;  2DA1 A;  5BPI A;  4QWQ A;  4S05 A;  3OYM A;  2H27 A;  2K9M A;  4A3L J;  4L62 A;  2O61 A;  1IUF A;  2IS4 A;  3BR6 A;  2BV6 A;  5LHI A;  1V5F A;  3T6N A;  4U87 A;  2DOA A;  2GFN A;  3J80 Z;  3BZC A;  2M9H A;  3HOV J;  1ZHF A;  3IWZ A;  3M07 A;  1W7P B;  3BJA A;  2EFO A;  1JTX A;  2HVS A;  3BZ6 A;  4S0H B;  2HDD A;  3GO5 A;  3QBM A;  1KU2 A;  5ILU A; 
#chains in the Genus database with same CATH homology
 3EGQ A;  1Y1W J;  3IH4 A;  4FIS A;  2O7T A;  2MSY A;  3S1Q J;  2R5Y B;  3E7Q A;  2ZOY A;  3EUP A;  2HQ5 A;  2HKU A;  1MNM C;  3NAU A;  2R0Q C;  1TWG J;  4M3G A;  1IC8 A;  2XGC A;  2JMW A;  5FGL A;  3BG5 A;  2GM4 A;  3S16 J;  3ON4 A;  2R5Y A;  2JK3 A;  2M34 A;  3S2D J;  2R93 J;  5EEA A;  4V2F A;  1H8A C;  1B72 A;  2X48 A;  2E2J J;  2DA6 A;  2CJJ A;  2LKX A;  1XS9 A;  1W0U A;  2EZK A;  1RKT A;  3IH2 A;  2LY9 A;  3G1L A;  1AKH A;  1APL C;  3WHB A;  3L1P A;  5E3O A;  1LE8 B;  4M3E A;  2YVH A;  1ZK8 A;  3C2B A;  3ANP A;  3Q0U A;  4GFB A;  2GEN A;  2Y9Z A;  2K9N A;  5C4X J;  3DCF A;  2JA5 J;  2JA7 J;  4MXM A;  2KT0 A;  1TWH J;  2JA8 J;  2PBX A;  1Y1V J;  1JGG A;  2LTP A;  2HI3 A;  2JA6 J;  5FKM A;  2VKE A;  1ETX A;  4A3K J;  2E2I J;  3GTO J;  3HTJ A;  2VI6 A;  2X9D A;  3LWJ A;  3LNQ A;  4B4C A;  3VP5 A;  1RPW A;  3F0C A;  4GCT A;  1MSE C;  4W1U A;  4UDS A;  2HXO A;  1HF0 A;  1D5Y A;  2QWT A;  3B81 A;  4MFE A;  2DG8 A;  1IJW C;  2L7M P;  1VF9 A;  4DW6 A;  5IYC J;  2QKO A;  4CYC B;  3OSG A;  4A3B J;  1FEX A;  5EG0 A;  4FCY A;  2X6O A;  1K61 A;  1JKQ C;  5EGO A;  3GTG J;  3NNR A;  2AO9 A;  3GTQ J;  3I4M J;  1Z77 A;  2TCT A;  3JRD A;  4X6A J;  1GDT A;  2Q24 A;  1MBE A;  1U78 A;  5IPA A;  2CUF A;  5EF6 A;  1T33 A;  1QVT A;  3HIM A;  3F1B A;  3NPI A;  2Y9Y A;  3BTL A;  2UXO A;  3A01 A;  5IP9 J;  4MO7 A;  2G7G A;  3MVP A;  2NVX J;  1OFC X;  2COB A;  1YRN A;  3K2A A;  2ECC A;  3BR2 A;  4I76 A;  1ZR2 A;  3KKD A;  1MBH A;  1ZKG A;  1VFC A;  4JNN A;  5C44 J;  2CU7 A;  2M2E A;  4M6V A;  5EZG A;  2IBD A;  3RKQ A;  5C4Y A;  1JUP A;  5K58 A;  1PUF B;  2XB5 A;  1RKW A;  5IYB J;  4EEF G;  4BY7 J;  2LVS A;  3G1M A;  1B8I B;  2EH3 A;  2HYJ A;  4JX5 A;  1H88 C;  3BG9 A;  4CGR A;  5M5Y J;  3NRG A;  2XPV A;  3H0G J;  3Q0W A;  5K7F A;  1MBJ A;  1OCT C;  1PUF A;  2DJN A;  1EF4 A;  2QTQ A;  1FIP A;  3VOX A;  2EZI A;  5C4J J;  1ETV A;  3PO3 J;  4A3G J;  1UHS A;  4D7N A;  2EZH A;  5DS9 A;  1NTC A;  2NVQ J;  4DYQ A;  1BW6 A;  2I10 A;  1Q1V A;  1VI0 A;  3S15 J;  1TWF J;  3FIS A;  3CRJ A;  2WGB A;  4A3I J;  3JRB A;  3JRH A;  3JSJ A;  2VPR A;  2H8R A;  3CJD A;  5DTD A;  2MGQ A;  1DU6 A;  1A5J A;  3S17 J;  3ZQF A;  3K7A J;  4BXX J;  4A3J J;  4JL3 A;  3ZQI A;  3VW2 A;  2L9R A;  5IOZ A;  3S1R J;  1AU7 A;  3S1N J;  3LHQ A;  1GT0 C;  5CXI A;  3HEF A;  2ECB A;  3GTM J;  1NK2 P;  4IHW A;  4A93 J;  3TP3 A;  1GVD A;  4C3I J;  2GUH A;  1B72 B;  1XC5 A;  4M3D A;  5JLX A;  4XRS G;  1JTY A;  3CCY A;  1JT6 A;  5F0C A;  2N8G A;  1AKH B;  1SGM A;  3HOY J;  4BY1 J;  1HLV A;  3BRU A;  3HGY A;  5GP9 A;  2L7Z A;  1MH3 A;  4MIM A;  5F0F A;  5FKK A;  5H9T A;  1K83 J;  3JRG A;  5HBU A;  5JLW A;  2HOA A;  2NVT J;  3S14 J;  2ELK A;  4XID A;  2Y2Z A;  5F1J A;  3IV5 A;  3JRC A;  1U8B A;  3VIB A;  4A3E J;  4NDL A;  1HDD C;  1ORK A;  3Q3S A;  1ZQ3 P;  1MBK A;  2DA2 A;  1IGN A;  2FX0 A;  3BQY A;  5EYR A;  3ANG A;  3G56 A;  5D18 A;  5AQC A;  2QOP A;  3AQS A;  5M3F J;  3MN2 A;  2K9Q A;  2ME6 A;  3VOK A;  2ID6 A;  2WAQ N;  5BNG A;  2H1K A;  5F0H A;  3HTI A;  2QF7 A;  5F27 A;  5K7Z A;  2M0C A;  2YU9 J;  2ZCM A;  4RDU A;  2IAI A;  2EZL A;  1ETK A;  3SFI A;  3COL A;  2CQQ A;  3ZQH A;  2UXI A;  1GUU A;  5FKO A;  1RES A;  3CQZ J;  5FKN A;  3DEW A;  3OIO A;  1QRY A;  5EG0 B;  3GTL J;  2DN0 A;  5EGO B;  1TC3 C;  2MG4 A;  1I50 J;  1VND A;  3JRF A;  3FK7 A;  2QCO A;  5F04 A;  4UUS B;  2OPT A;  2DMT A;  3HKZ N;  5M5X J;  1UI5 A;  3WHC A;  1JT0 A;  1MH4 A;  2PMZ N;  2L7F P;  3HTA A;  2XGE A;  1X2M A;  5FJ8 J;  4A3D J;  2DMN A;  3JRA A;  4XIC A;  1WI3 A;  2AHQ A;  3A01 B;  2L0K A;  3ZOB A;  2LD5 A;  4G12 A;  4UUS A;  2ID3 A;  3RZO J;  4D7M A;  1FTZ A;  5GPA A;  1P7J A;  3RQI A;  1HCR A;  2ZOZ A;  4IHV A;  1YRN B;  2YVE A;  5HOD A;  5J3L A;  2ZCX A;  1RR7 A;  3G7R A;  2XRL A;  4XRS A;  2CUE A;  1IG7 A;  2F07 A;  3GTK J;  3HOW J;  3RH2 A;  2FJ1 A;  3I4N J;  3GZI A;  4MFD A;  2EQR A;  2GBY A;  2LK2 A;  2K9S A;  2D6Y A;  2R7Z J;  4D5C A;  3LSJ A;  2NOG A;  2IU5 A;  4AUX A;  2FD5 A;  1ZTR A;  1H89 C;  3HBL A;  2W53 A;  4GFL A;  5F08 A;  3O60 A;  3NAR A;  3H3V K;  1F36 A;  2YUS A;  3HGG A;  3QQA A;  2WUI A;  4A69 C;  3TW7 A;  4B1R A;  3JR9 A;  1A6I A;  3C07 A;  3E7L A;  2XGD A;  3TW6 A;  3VW0 A;  1O4X A;  1CQT A;  2D5V A;  1IDY A;  3LSP A;  3JRE A;  3QKX A;  3BQZ A;  3BTC A;  3OSF A;  3CDL A;  2E1O A;  3VVY A;  3ON2 A;  1MBF A;  4Y52 J;  4C3J J;  1AHD P;  1HDP A;  4A3C J;  4I6Z A;  2G7L A;  3LSG A;  4DZP A;  4C2M J;  5D1R A;  3BHQ A;  2RAS A;  2Y0S N;  2ZB9 A;  5M5W J;  4LOC A;  1GV2 A;  1OCP A;  4J19 A;  5M3M J;  5FLV A;  2V57 A;  3IH3 A;  2JN6 A;  1LFU P;  4HNV A;  1BJZ A;  1HOM A;  2QIB A;  2OI8 A;  1ZR4 A;  3BR1 A;  1P7I A;  3QPL A;  5E3L A;  3GTJ J;  3W6V A;  5E3M A;  2O9L A;  5D19 A;  2XSD C;  4ACI A;  5FLM J;  2DTZ A;  2P81 A;  3RZD J;  5J1U A;  4ABZ A;  3BR3 A;  1ITY A;  1U9O A;  4AF5 A;  3PAS A;  1TWA J;  2GLO A;  2TRT A;  1I3Q J;  2NS8 A;  4PXI A;  1POG A;  4L5E A;  2NP5 A;  1RET A;  1ETY A;  3IUV A;  2DA7 A;  2UXU A;  2XPU A;  4AC6 A;  4GFK A;  4JKZ A;  2OF7 A;  2ME0 A;  2XPW A;  3B6C A;  5FKL A;  1QPI A;  1E3O C;  1UMQ A;  4MK6 A;  3PPB A;  2M8G X;  3BR5 A;  1JUS A;  3KKC A;  3LSR A;  1UI6 A;  1Z0X A;  2NS7 A;  2G0E A;  2RAE A;  4MLO A;  3Q0V A;  1IDZ A;  5IP7 J;  1OJL A;  2LFB A;  3MKL A;  3PM1 A;  4NEL A;  3GBG A;  3FIW A;  3G1O A;  5K7H A;  4DZJ A;  2OER A;  2HOS A;  3VVX A;  4FE4 A;  5GPC A;  4M3B A;  1JKR C;  2JJ7 A;  1ETW A;  3LOC A;  3OOU A;  4JP0 A;  3S1M J;  3ZQC A;  4JX4 A;  1JJ6 C;  3BT9 A;  3TED A;  4W97 A;  4BKX A;  3HOU J;  2MW8 A;  3M3Y J;  2RHA A;  4XK4 A;  3BCG A;  5E3N A;  2WB1 N;  2XB0 X;  4DYC A;  3VW1 A;  2DA4 A;  3VUQ A;  2YS9 A;  2WV1 A;  1MSF C;  3O8G A;  3JRI A;  2VUM J;  3CWR A;  1W0T A;  2E2H J;  3BTI A;  1WGX A;  4D5F A;  4GCL A;  1JKP C;  2IEK A;  1I6H J;  2O8K A;  2G3B A;  2UXH A;  2DG7 A;  4X1E A;  2ZCN A;  3GEU A;  1LE8 A;  5C3E J;  3PO2 J;  3FRQ A;  1GV5 A;  1MBG A;  4AYB N;  2DA3 A;  3SDG A;  2HOT A;  1NK3 P;  1T56 A;  3VPR A;  2DA5 A;  4B3A A;  1FJL A;  2KDZ A;  2Y31 A;  2O7O A;  1G2H A;  2Y30 A;  4HKU A;  4M3F A;  3BG3 A;  3V78 A;  1X58 A;  2R5Z B;  4FE7 A;  3CMY A;  5J1Y A;  2CQX A;  1S7E A;  3HDD A;  5IOY A;  2PZ9 A;  5EDN A;  4XRM A;  2NVY J;  3D1N I;  3HE0 A;  2R5Z A;  1QVU A;  1JJ8 C;  2REK A;  3FK6 A;  3HOX J;  4C3H J;  2W48 A;  5HSZ A;  3DPJ A;  2LLK A;  4ME9 A;  2E19 A;  3SJM A;  1WH7 A;  5J1R A;  1XG1 A;  4CYC A;  4A3F J;  2B63 J;  1ETO A;  1WCM J;  2FQ4 A;  4V2G A;  2HYT A;  1ETQ A;  3S2H J;  1WPK A;  1F43 A;  1WH5 A;  1IRZ A;  2DMP A;  1ENH A;  4UUT A;  3A03 A;  4IEJ A;  4BBR J;  1FIA A;  5EZH A;  1UG2 A;  2K40 A;  4FTH A;  3GTP J;  2FBQ A;  4GCK A;  1R9T J;  4JX6 A;  4DYR A;  3HTH A;  3KZ9 A;  4QTR A;  3V6G A;  4A3M J;  2CRG A;  9ANT A;  4JYK A;  4ICH A;  3VVZ A;  3M4O J;  3NI7 A;  3FKI J;  3KNW A;  5FHP A;  5EFY A;  2JWT A;  2LP0 A;  4QSH A;  3AQT A;  3MNL A;  1BL0 A;  4KWA A;  5CW8 A;  2DMU A;  1DU0 A;  4NN1 A;  5DAJ A;  3NXC A;  3B6A A;  1IV6 A;  3RD3 A;  1ZGW A;  3TP0 A;  4QIW N;  2EBI A;  2VKV A;  1FTT A;  3S5R A;  1BA5 A;  1SAN A;  1TWC J;  3BNI A;  3ZQG A;  2HXI A;  1JKO C;  4IHY A;  2R92 J;  5IYD J;  1BW5 A;  2NP3 A;  3BJB A;  1LFB A;  1B8I A;  2NX4 A;  3O8H A;  3HOZ J;  4RBO A;  1X2N A;  1SFO J;  3HB9 A;  1U9N A;  5HAW A;  3A02 A;  4IHX A;  2DA1 A;  4Y7N J;  3UKG A;  4YZE A;  3BR0 A;  2LR8 A;  3BTJ A;  3HM5 A;  4A3L J;  4L62 A;  5FMP A;  1IUF A;  3BR6 A;  2UXP A;  3T6N A;  2GFN A;  3LJL A;  3P9T A;  2M9H A;  2DMQ A;  3HOV J;  4BBS J;  5IP6 A;  1JUM A;  2XDN A;  1JTX A;  3ZQL A;  2G7S A;  3QPS A;  4S0H B;  2HDD A;  3QBM A;  4AC0 A;  5CXG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...