3BR3A

Crystal structure of the complex of ethidium bound to qacr(e90q), a mutant of a multidrug binding transcriptional repressor
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
185
structure length
185
Chain Sequence
b'LKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKSEQIKAKTNREKFYLYNELSLTTQYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator qacR
publication title Formal electrostatic interactions do not govern QacR-cation affinity
rcsb
source organism Staphylococcus aureus
molecule tags Transcription
total genus 76
structure length 185
sequence length 185
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3br3A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3br3A02
3CCYA 4IHYA 2MGQA 2UXUA 1LE8A 4UUSA 3S14J 2OERA 1RR7A 3GTPJ 3S16J 2VI6A 1BW5A 5IP9J 2HYJA 1UHSA 2Y9YA 4B4CA 1IC8A 1AU7A 3BTJA 3OSFA 2E2IJ 2EZKA 1NTCA 1U8BA 5DS9A 1ETOA 5F08A 5BNGA 1B8IA 2Y31A 1HDDC 2E2JJ 3LJLA 5GPAA 5FLVA 2QCOA 1JGGA 4M3GA 1OFCX 3M4OJ 3BNIA 4M6VA 2YU9J 4MXMA 1UG2A 2JJ7A 1FIPA 2GUHA 1LFUP 2XPUA 4AC6A 2M8GX 1PUFA 3BG3A 5K7HA 5EF6A 3BHQA 3FK6A 1ETXA 1RPWA 2ID6A 3HOWJ 1A5JA 2Q24A 4CGRA 1GDTA 4XIDA 1JUPA 4A3BJ 5AQCA 1JTXA 3JRBA 3VW2A 4L62A 2LD5A 4ICHA 3H3VK 1I6HJ 3IH2A 1QRYA 3KKDA 4QSHA 1W0TA 5EGOA 3KZ9A 1VNDA 3HOVJ 4A3KJ 5EG0A 1I50J 4FISA 4GFBA 1YRNB 1WCMJ 3BTLA 2O9LA 1X58A 2Y0SN 4C3IJ 4ACIA 2UXHA 5J1UA 5EDNA 5C3EJ 3S1NJ 1WGXA 3BTCA 5E3NA 4MIMA 4I6ZA 4BXXJ 5FGLA 3JRDA 1B8IB 1SANA 3HBLA 1TWHJ 5IP7J 3JRCA 2DA2A 2ZCXA 1X2MA 9ANTA 2WV1A 5EFYA 2XPWA 3MVPA 4RBOA 2M2EA 1ORKA 4FE4A 3BR0A 2V57A 4C3HJ 4V2GA 3IV5A 3SJMA 4C3JJ 3WHCA 5IYBJ 5CW8A 3BR5A 3CQZJ 2HXOA 2MSYA 5F0FA 5IP6A 1B72A 4FTHA 2TCTA 5F0CA 2HDDA 4JX6A 1NK3P 2DMQA 1ZK8A 2M0CA 1JT0A 1MBKA 2QIBA 4D7NA 2ZOZA 3LSJA 3SDGA 2WAQN 3GTOJ 2GENA 1MBFA 4GCLA 3ON4A 2YS9A 2NX4A 1P7IA 3QPSA 2E2HJ 4A3DJ 4JX5A 3S1RJ 3QPLA 2R5YB 3HE0A 2OF7A 3F1BA 1FEXA 2H1KA 4XRSA 5IYDJ 2W53A 2EZIA 1ZTRA 2O7OA 2WB1N 3EGQA 2M9HA 2KT0A 3HOZJ 2K9NA 1JKQC 3M3YJ 2LLKA 3P9TA 3BR2A 4BY7J 4BY1J 4G12A 5E3MA 2ELKA 2MG4A 3B81A 3WHBA 2H8RA 2NVTJ 3BQYA 3JRFA 5M3FJ 5JLXA 2RHAA 4HKUA 3PO3J 3BT9A 3A01B 5FKOA 2M34A 1E3OC 3RKQA 4IEJA 2B63J 2XGEA 3ON2A 4DZPA 3S2DJ 4DW6A 1IUFA 2Y2ZA 1QVUA 5M3MJ 5M5WJ 5EYRA 2LFBA 2RASA 1JKPC 1XS9A 3Q3SA 3LHQA 1TC3C 1F43A 2NVYJ 1YRNA 1JKOC 4KWAA 2Y30A 2IEKA 1D5YA 4A3CJ 1MSEC 2COBA 4A69C 3TW7A 1IV6A 2LKXA 3ZQCA 2ZB9A 2ECCA 3NPIA 1HLVA 2DA5A 5CXGA 4MFDA 3S1MJ 4M3BA 1IJWC 2L0KA 3MN2A 5EZHA 1MBGA 2PMZN 3ZQLA 4FCYA 3VOKA 1K61A 2KDZA 3AQTA 1BL0A 5IPAA 3HTAA 1BJZA 2VKEA 1VI0A 3JSJA 2R0QC 3JRAA 1SGMA 3VUQA 4XRSG 1XG1A 2CQQA 2JWTA 3V6GA 2YUSA 4YZEA 1JJ6C 1T33A 2GFNA 5HODA 5GPCA 4JX4A 1ZR2A 3QBMA 2LY9A 1G2HA 1WPKA 2D5VA 4JL3A 4BBSJ 1TWFJ 3VW0A 4GCTA 4AUXA 1Y1WJ 2JA7J 3C07A 3HB9A 4M3DA 2Y9ZA 3BR3A 3ANGA 2I10A 2REKA 2R5YA 4GCKA 1QVTA 4AYBN 3S1QJ 3OSGA 2P81A 3S17J 3NI7A 2OPTA 4B3AA 2E1OA 3BR6A 3OOUA 5FJ8J 5C4XJ 2EZHA 2DG7A 3CMYA 5FHPA 3VVZA 3LSGA 1Z0XA 4C2MJ 4IHVA 2N8GA 2XSDC 2HI3A 5IOZA 3HOYJ 3NAUA 5K7FA 3GTKJ 1W0UA 3MNLA 3PASA 4A3LJ 2X6OA 4FE7A 2O8KA 3A01A 3I4NJ 3TEDA 4Y7NJ 5D18A 4M3FA 2QF7A 1EF4A 3ZQIA 5H9TA 3H0GJ 2IBDA 4JKZA 5IYCJ 3O60A 3LWJA 4QIWN 4HNVA 1FTTA 3NXCA 1I3QJ 5FKNA 3BTIA 2CQXA 2HKUA 1IDYA 3S15J 3IUVA 4ME9A 3GEUA 2LK2A 5F1JA 2L7MP 2TRTA 3G7RA 1DU6A 3LSPA 4X1EA 2OI8A 1R9TJ 4MLOA 2XB5A 5D19A 2JK3A 4JYKA 2EH3A 5F27A 2GLOA 5F04A 3PPBA 1X2NA 3SFIA 3G56A 2ME0A 1BA5A 4D5FA 2UXOA 5CXIA 2EZLA 1FIAA 4EEFG 1TWCJ 2O7TA 2CJJA 2DA1A 2ECBA 1LFBA 3HIMA 2FD5A 3RQIA 3LNQA 4GFLA 3V78A 4M3EA 1A6IA 1U9NA 1ETKA 1JKRC 4NELA 2FQ4A 5J3LA 1MBJA 3A03A 1GVDA 4A3EJ 3ZOBA 2PBXA 3Q0VA 2CU7A 1Q1VA 5FKLA 3UKGA 3VVYA 4RDUA 4BKXA 1UI6A 3VIBA 1VF9A 3W6VA 2R7ZJ 1QPIA 4DYCA 2WGBA 2QWTA 1S7EA 1U78A 3G1MA 2ID3A 2R93J 1IG7A 3RH2A 5EEAA 2MW8A 2GM4A 2VPRA 3GTMJ 4I76A 2JMWA 2IU5A 3G1LA 4X6AJ 3CRJA 1JUSA 1F36A 2L7ZA 2YVHA 1OCPA 3QQAA 1RKTA 5C4JJ 3PM1A 2ME6A 2DMNA 3Q0WA 3VVXA 2R5ZB 2X48A 1O4XA 3S2HJ 2AHQA 3A02A 1ZQ3P 3HEFA 2XDNA 3B6AA 3ZQFA 3ZQHA 4Y52J 1MH4A 4B1RA 1VFCA 3FK7A 5M5XJ 4IHWA 4CYCA 1IDZA 1TWAJ 3E7LA 5C4YA 3FKIJ 5IOYA 2QKOA 2DMUA 2LP0A 2HOAA 3COLA 3DCFA 1MH3A 5C44J 3K2AA 3NNRA 5FMPA 1HF0A 4A3IJ 1HCRA 3HGGA 3RZDJ 2AO9A 2FJ1A 4A3MJ 1FJLA 1Y1VJ 2ZOYA 4W1UA 2UXIA 2G7SA 2K9SA 4V2FA 4BBRJ 4UDSA 2DA4A 4W97A 3BG5A 2G7GA 1K83J 4MFEA 3O8GA 3LSRA 1U9OA 3I4MJ 4QTRA 1GT0C 3FISA 4AF5A 4DYQA 2L7FP 4LOCA 3HKZN 5E3OA 5FLMJ 3RD3A 2XGDA 1Z77A 1ZKGA 3DEWA 3BR1A 2F07A 3HTIA 5D1RA 4UUTA 2DN0A 1AKHB 3VP5A 1BW6A 2JN6A 3O8HA 2XGCA 2DA7A 3HTJA 5HBUA 2NOGA 2CRGA 1MNMC 4A93J 5K58A 1ETVA 3TP3A 3OIOA 4D7MA 2HQ5A 1AHDP 3GTLJ 4MK6A 2JA8J 3LOCA 2NS7A 4CYCB 3GTQJ 4DYRA 3TP0A 2DA6A 1ETWA 2XB0X 5F0HA 4ABZA 2EBIA 2NVXJ 3B6CA 3KKCA 2HXIA 5J1YA 3HOUJ 3BCGA 3NARA 1ENHA 3HGYA 1FTZA 3EUPA 2NP5A 4GFKA 4XRMA 1CQTA 1ZGWA 1WI3A 5DTDA 1LE8B 1POGA 4UUSB 1MBHA 3JREA 5EZGA 3VPRA 4DZJA 4S0HB 3L1PA 1NK2P 3AQSA 2G0EA 1JJ8C 1RKWA 4L5EA 2X9DA 3FRQA 3GZIA 3JRHA 2R5ZA 3MKLA 4XICA 2YVEA 4D5CA 3KNWA 1JUMA 3HTHA 5K7ZA 1DU0A 2NVQJ 2JA6J 3GTJJ 1H88C 1ETQA 5M5YJ 3CJDA 5FKMA 1UI5A 2LTPA 2JA5J 2QTQA 1WH5A 2HOTA 5DAJA 1H8AC 2UXPA 4NDLA 4J19A 2VKVA 1PUFB 5FKKA 2PZ9A 1TWGJ 2EQRA 2DJNA 4IHXA 1HOMA 3BG9A 3ANPA 4NN1A 2NP3A 3G1OA 3ZQGA 3HOXJ 1IRZA 2ZCMA 4MO7A 5JLWA 2D6YA 2DA3A 3F0CA 3K7AJ 3GBGA 1APLC 1OJLA 2ZCNA 1UMQA 3D1NI 3GTGJ 3DPJA 4PXIA 1JTYA 2HYTA 3PO2J 2DG8A 5J1RA 2XPVA 3BRUA 5HSZA 5E3LA 1WH7A 3FIWA 3TW6A 2CUEA 1ZR4A 3E7QA 2L9RA 3IH3A 2FBQA 2GBYA 3HDDA 2IAIA 3HM5A 3C2BA 1SFOJ 1RETA 1GV2A 5EGOB 3CWRA 4JP0A 2HOSA 1JT6A 1GV5A 3JRIA 5EG0B 4A3GJ 3BJBA 1MSFC 2DMPA 2K9QA 2LVSA 2E19A 2LR8A 3Q0UA 1AKHA 1IGNA 2VUMJ 3BQZA 1ITYA 2CUFA 2K40A 5GP9A 2DMTA 2DTZA 2QOPA 5HAWA 1XC5A 3VOXA 1MBEA 1P7JA 2FX0A 2XRLA 1GUUA 3CDLA 3S5RA 3JR9A 2NS8A 1H89C 4AC0A 2R92J 2RAEA 3NRGA 4XK4A 3T6NA 1OCTC 1RESA 2G7LA 1HDPA 2W48A 3QKXA 2G3BA 3JRGA 3VW1A 3RZOJ 4JNNA 1B72B 4A3JJ 1T56A 2WUIA 3IH4A 1ETYA 4A3FJ
chains in the Genus database with same CATH superfamily
3CCYA 4IHYA 2UXUA 1LE8A 5AONA 3S14J 4I7HA 3S16J 2WA0A 3NWSA 2HYJA 1IRXA 3BZ6A 4XMYA 4KUMA 2Y9YA 4G6TB 3BTJA 4LLGF 5DD4A 5EEGA 3OSFA 3CCVI 1H9TA 3J81Z 2NNNA 3TBIA 2PG4A 3OL3A 4S04A 2QWWA 3KX2A 2QUFA 3GEZA 5J8FA 4FETA 2LG4A 2M30A 3SEQA 1UG2A 1FYLA 3VYRB 3MEXA 2GUHA 1LFUP 1X4OA 1ZN2A 2BXYA 2QQ9A 3BG3A 2QEXI 1ACIA 1ETXA 1K6OA 3GLLA 2Q24A 3H5RA 5TISC 1GDTA 2DFFA 2A5WA 2RKHA 2YPRA 1BIAA 2F48A 2M3AA 3E1SA 3QPTA 4BUPA 2OQRA 2RV8A 1OPCA 4RA2A 5TJJA 1XD7A 2GQQA 2VQGA 3KKDA 1U5TA 3SEZA 3WTXC 3KZZA 4PFOA 4UB6C 4XKWA 4LG0B 1Z3XA 2E7XA 5HLIA 2DOEA 3KZ9A 3FHZA 5HLTA 2WWYA 1BC8C 4XONA 2ADUA 2ZCWA 2DOAA 3FXMA 2PLYA 3HKZA 2O9LA 4Q5SF 1RUOA 4YFXF 2VE8A 3FXOA 5E1ZB 5EDNA 1G4DA 1QBJA 1R5HA 3BTCA 1FX7A 2CQNA 1HW1A 4I6ZA 4BXXJ 1D0YA 3D5SC 4WXDA 2IS6A 3HBLA 1FYMA 1YW7A 2DAOA 2AXTC 5IP7J 3OIQA 3JRCA 4IQJA 1ULYA 2VBYA 3MZYA 2WV1A 2GIVA 4RBOA 2P8TA 4HLXA 4FE4A 3IP4B 2VE9A 3HIFA 3AKZA 3WHCA 4B8XA 3CCRI 1PUEE 2BW3B 2A2FX 2E5ZA 2X1DA 2RDPA 2HXOA 3Q5FA 4UUVA 1QO0D 2TCTA 4JX6A 2DMQA 1W1WE 3VSKA 4XL9A 3BROA 4P9UA 1MBKA 4D7NA 5BQTA 4IX7A 4LIVA 4QPQA 4ZYEA 2GENA 2L02A 4GCLA 2YS9A 3WTWC 2NX4A 4MGRA 2P6TA 4J00A 4LB5A 2Y0SA 2E35A 2BY0A 2E2HJ 3FXQA 1X4PA 3U1DA 2JUCA 3DTEA 3GVAA 5F6FA 3S3NA 1XPXA 1IZ1A 4RS8A 5FO5A 4XRSA 4U9LA 3KETA 1ZTRA 3H36A 1BR4A 3HRMA 1TW2A 4YIRX 3HOZJ 2K9NA 2O6GE 5E18F 3BR2A 2HZTA 3I59A 5HS8A 1LKXA 1IUYA 4FX0A 4YIIA 5M3FJ 2EIMH 3FZVA 3W2AA 2JRMA 4HKUA 1T8IA 1QHHD 1N77A 4L9JA 3ZMUA 2LY2A 4CA0A 3G2BA 5J6XA 2ZC2A 3LA2A 1ZRCA 2DT5A 4BE0A 3S2DJ 5AIPA 1IUFA 2Y2ZA 4NQWB 5M5WJ 1A36A 2K27A 2LFBA 4LG0A 2W85A 5LGNA 1RZ4A 2BBYA 2LH9A 2EFQA 3LHQA 3DPLC 2NVYJ 3DV8A 3MWMA 2JUGA 1JKOC 4KWAA 1HSTA 4Q4ZF 1B59A 2UV1A 2WB1A 3HOTA 2COBA 4A69C 3BG6A 1BBYA 3RPQA 4XOTA 5BS6A 5HDKA 3M8EA 1JHFA 4HQEA 3ZQCA 5DCMB 2HQAA 5CXGA 5ICGA 1UFMA 3H5NA 5A2QK 5IT3A 1MBGA 3I0TA 4DBQA 2Q1ZB 1B1BA 4FCYA 4R79A 1K61A 3F6VA 3RJPA 1X1AA 4G7OF 4I99C 4YEJA 1P92A 2BW3A 3QYEA 4XRSG 1XG1A 4CCMA 3H3ZA 3DXJF 3KYCB 4BEHB 3LQQA 1ZR2A 3LQRA 1VQNI 4HSRA 1KONA 1YW9A 3VW0A 4AUXA 1Y1WJ 3HB9A 4M3DA 1ODDA 3BR3A 1WZ2A 3KFWX 2MC3A 3K10A 3PUFA 4BACA 2ISYA 3JSPA 3MD2A 4GCKA 3S1QJ 4ZTFA 3S17J 1P6RA 3OOUA 4A6EA 4BHBA 3J80K 2HKXA 2EZHA 3JTGA 3CMYA 3LSGA 2PMZA 4HDVA 3NAUA 3PASA 1W0UA 4QPOA 3MNLA 6PAXA 1IN4A 3ZPLA 3BJ6A 2VJIA 3BPXA 3C3WA 2O8KA 2W84A 2X0LA 1OMIA 2NOJB 1R36A 2LKPA 1EF4A 1LVKA 3H0GJ 3OV8A 5IYCJ 4QIWN 3F8NA 3F21A 1I3QJ 1Z7LA 4NQWA 1HW5A 3SDBA 3MKWB 2HKUA 1YJWI 4FX4A 2WAEA 2IS1A 4ME9A 3KEOA 5F1JA 1K4SA 4F52A 4HZFA 2M7AA 1E17A 1Z3YA 4BHPA 2E71A 1ZYRF 2M7BA 4XOPA 2HS5A 3GFIA 4MLOA 2XB5A 2EK5A 5F27A 1AOYA 1X2NA 4XSXF 5DCMA 2ME0A 3SFIA 4D5FA 5L3GA 1KU2A 2P5KA 2X6XA 3WTZA 2VBZA 4IOAF 3TDZC 2DA1A 4IJAA 2Y69H 3FMSA 2FD5A 4GFLA 1XCVA 3I64A 3HRUA 4B47A 3HOSA 1MBJA 1R22A 4NBQA 4MQVA 4IQ4A 3RYRA 2PBXA 5KCMA 3HRTA 1Q1VA 5FKLA 3VVYA 2O61A 1UI6A 3VIBA 2DOFA 3W6VA 2F4IA 4BEHA 2YX7A 4A2UA 3QRFF 2ID3A 4D0PA 4NC8A 2GM4A 2JQ7A 1OCCH 3OL4A 3G1LA 3J7AO 2K5CA 4X6AJ 3CRJA 2DPDA 3VTIA 2YVHA 3KP6A 2A5YB 4ETSA 1WJFA 2I5UA 3HTSB 1MJAA 3JAMZ 4A3CJ 5L3CA 3IUOA 1RUNA 3S2HJ 2JVHA 3A02A 5CLSA 2F5VA 1WHUA 3GO5A 3IKVA 3ZQHA 4RM3A 4ZDPA 2DTRA 4IHWA 3L7WA 2HVQA 1FMWA 4CYCA 1Q1HA 1XTAA 1TWAJ 2BHYA 5LGTA 1MMSA 2Y75A 5IOYA 1Z7UA 2DMUA 2MD5A 4PJJA 2HOAA 5C44J 1P2FA 2Z99A 3K2AA 4PK4A 4BJ6C 4WCGA 1GLNA 2DJIA 1HF0A 3AG1H 3WU2C 1R5ID 4C2MA 1I1SA 3BY6A 1ZH5A 2FJ1A 2UUZA 3G6EI 4A3MJ 1Y1VJ 1F1ZA 1HA8A 2CFOA 2UXIA 2K9SA 5LD2C 3OIPA 3DU6A 2DA4A 4Y4RA 3LSMA 3O8GA 3LSRA 3PFIA 3FISA 3QP5A 3GFLA 2BY1A 3MZ8A 5E3OA 5FLMJ 2XGXA 3RD3A 1YW8A 1OCOH 3PIOF 2F07A 3GZ6A 2BEOA 4L18B 2Z16A 2ZBKA 1MJBA 2MFZA 2VQLA 3O8HA 4N4OB 2K3PA 2KJCA 1HKSA 1K78B 2K02A 2ZFWA 1ETVA 3GTLJ 1IXSB 4ESJA 2HQ5A 4MK6A 4N0BA 3GTQJ 3TP0A 3H92A 2EIKH 2BZTA 2EBIA 4IXAA 1R00A 2HQNA 4HX7A 3NARA 1BOBA 4EVIA 2AS5F 2PJPA 3CUOA 4P5OA 2EINH 1CQTA 3N4MA 1LEAA 5B1BH 1EH7A 2BV6A 2H94A 3JREA 2RVCA 5EZGA 2ZNZA 4S0HB 5B66C 3AQSA 2G0EA 1JJ8C 1RKWA 4L5EA 2X9DA 4F93B 1D3YA 3OWTA 2M87A 5ILSA 4D5CA 4RAYA 1JUMA 2ELJA 2OBPA 3HTHA 2NVQJ 3J7YJ 2XAHA 1H88C 5FKMA 1J0RA 1F5TA 2QTQA 5L3DA 1T08B 3EETA 1FBQA 4RLFA 3Q9SA 5DV5A 2R7FA 2VPLA 4NDLA 1VZ0A 5FKKA 1IV8A 3HXLA 1TWGJ 1HOMA 4WWCA 4IHXA 3KEQA 4NN1A 1OISA 3ZQGA 3HOXJ 4BJTA 2A68F 5JLWA 2IVMA 2D6YA 2BHZA 2P6SA 4OMYA 1OJLA 2VQCA 2KLOA 1TL8A 3DPJA 1XMAA 1YFHA 3RKWA 1R6RA 3QOEA 2ETHA 4EJOA 2HR3A 1TW3A 2KQRA 2DG8A 2ZFUA 4NC7A 2R7OA 1D0ZA 3RDIA 2L9RA 1USSA 3IH3A 3C2BA 1UG0A 2DT6A 1JT6A 2CW7A 5F1RA 2MABA 3HZJA 3JRIA 3BWGA 5EG0B 1N78A 3GW2A 1EKEA 4ITVA 3PFYA 3UR3C 3K1PA 1FOXA 2LR8A 2EILH 3PUBA 1BIBA 2R7TA 3ESWB 4BXFA 3MAJA 5HLGA 2DMTA 2DU9A 2XDVA 4YFNF 3R0AA 2ZMEC 1K78A 3VOXA 4M74A 1P7JA 1U8RA 2XRLA 1U6GA 2Y48A 5J4VA 2VOPA 1S5LC 3CJQB 3H9QA 1H89C 2R92J 2RAEA 4DVYP 2YSRA 5JFRA 4XK4A 2CSOA 3VYTB 5FB2A 1Z91A 2F6CA 2L3DA 4A93J 2X1CA 2FSWA 4A3FJ 3CCQI 2FJI1 4BE1A 3VYSB 5HNHA 1RR7A 3EQLF 1BW5A 1UHSA 1FBSA 2J5OA 1IC8A 4M6XA 5L3EA 5D5UB 1AU7A 3RKXA 3G73A 5ILUA 4XNFA 4HPQA 2MC4A 2VL8A 1BI3A 1MNEA 3QYFA 4IL6C 4XM3A 1QGPA 5BNGA 1B8IA 1HDDC 1YS7A 2E2JJ 4PJNA 3BNIA 1YO5C 1RNLA 2ZXHA 3OYEA 1TBXA 2PBIA 2XPUA 3ZMDA 2M8GX 3OS0A 3H3UA 3HPHA 1PDNC 2A69F 1JI8A 1XB4A 2AQEA 2P7VB 3F72A 4UY8I 2WY7Q 5H6QA 2LY1A 4XIDA 4A3BJ 2LC2A 3H5AA 1YS6A 4F3QA 1J2XA 2EA4A 4Y13A 3ZMTA 5GAGJ 2W1OA 3AG4H 4ENNA 3QOPA 3OYAA 4RMNA 3A0HC 5J8CA 3CCUI 1I6HJ 3DEEA 3I54A 5D8LB 1VQPI 2B3WA 2OTLI 2HYGD 4QSHA 3SZPA 1TQMA 1VNDA 1Z9CA 3HOVJ 2DBBA 1YLFA 4XLFA 5EG0A 3S8PA 4AIJA 4XORA 3TO9A 4B3XA 4GFBA 1WCMJ 3BTLA 3DP7A 1S3JA 2QQBA 3C2HA 4C3IJ 2Y0SN 1YYVA 5ERIA 2B1EA 3VODA 1M1EB 2JZYA 3S1NJ 4NB5A 4RGSA 3FXJA 5E3NA 4MIMA 1USTA 3VB2A 1Y8QB 1NG6A 3TGNA 2DA2A 2ZCXA 1X2MA 1YITI 2WV0A 1ZRFA 4U7DA 2FUG2 2VKDA 3SHFA 1FC3A 3MZHA 2ZMEA 3P7NA 1ORKA 4LB6B 1SVLA 4C3HJ 3SJMA 1TZLA 1A6QA 1LUJB 3ERED 1BOAA 2K4BA 1AA7A 5GADJ 1NG7A 3HJEA 4FTHA 3ELKA 3ZGKA 4RGRA 2GA1A 5DDGA 3B02A 2FBIA 2M0CA 5D5XB 1X3UA 1O3TA 4EV0A 2DT7B 2OCEA 3U21A 2P0WA 1MBFA 4BS9A 4CCLA 1VQMI 3ONQA 1P7IA 3QPSA 3W2VA 4AWXB 2H8WA 4A3DJ 3F8CA 3S1RJ 1J09A 1HQCA 3QPLA 1DP7P 3OMYA 3F1BA 4CICA 2EV6A 1FYKA 2H1KA 5H9TA 1FP1D 2WB1N 2O7OA 3D5LA 3K2ZA 1JKQC 3BJOA 4RGXA 4G12A 5E3MA 2ELKA 3VFZA 3J81K 3B81A 2K86A 4XN3A 1CF7B 3I9V2 3L2CA 3M8JA 1K79A 3JRFA 2QQAA 2CO5A 3IHUA 5JLXA 2XROA 2RHAA 2W7NA 1L3LA 1UZCA 1LEBA 4M9ZA 5CQGA 2HEOA 3M9AA 4C30A 3P9CA 3JSOA 2NYXA 3A01B 3K70D 2IA0A 1JXSA 3ABLH 2H09A 2FQ3A 2M34A 4YRVA 2OTJI 3RKQA 2XAQA 4HAMA 3D0SA 2XGEA 4N9IA 4DZPA 3E6DA 2VXDA 1QVUA 2QKMB 4IOCF 2L4MA 2WAQA 4BQNA 5M3MJ 1NH3A 4PJ0C 5EYRA 1WWXA 2PI0A 2UWMA 1ZG3A 2DODA 2M5WA 3E97A 3ABTA 2DDAA 3R0JA 3T0YA 1F43A 4B09A 4EGYA 4XLNF 1XGMA 2IEKA 4RAFA 4LK1F 3GFJA 2IXSA 3CMMA 4BYYA 1IV6A 2A3SA 3QYBA 2OC6A 2DA5A 4XKVA 1E0EA 2FBKA 4PDKA 3WU1B 1S8NA 3OR1C 1VQ5I 2PMZN 4PSWA 1Y6IA 2ZSIB 2GZWA 2JT1A 3PNVA 3RIRA 3CESA 5D8KB 3KZIC 1VQKI 1BL0A 5IPAA 4UXNA 3I59B 1VI0A 2R0QC 2K9MA 5HDNA 3VUQA 1MNDA 3FM5A 3U9GA 2JWTA 4NUBA 3SZTA 3WG7H 3MKZA 2K7LA 4YZEA 2CV0A 1JJ6C 2Z5UA 5E8GA 2X4HA 5HODA 1D0XA 3LL7A 3G4SI 2LY9A 1WPKA 1OKRA 4BBSJ 1TWFJ 4RLQA 3C07A 2Y9ZA 5BPDA 3N97A 2I10A 1DDNA 3L00A 4HSTA 4LLNA 1QVTA 1TLHB 2WC2A 3NEUA 5K1YA 3H9JA 3OSGA 2P81A 5IT9Z 4M6YA 3NI7A 5HS9A 5FJ8J 5C4XJ 2B0LA 3VVZA 3F8MA 1Z0XA 3WU0A 5FD6A 3TO6A 4E7KA 1CF7A 5IOZA 3V7SA 4CCJA 1WJBA 4A3LJ 2FEZA 3J7ZI 3A01A 4E4HA 3CDHA 2VASA 2QA4I 1KQ8A 3ZQIA 2OU2A 3ECHA 5LRSA 3LWJA 5JR3A 1FTTA 2ZY9A 3NXCA 5FKNA 4G9YA 2QLZA 3DPTA 1XX5A 3LA3A 3C18A 5FRMA 1P4AA 3DF8A 3JCUC 3L2UA 2L7MP 2Q0OA 1BN5A 1IN6A 2OQGA 1NHAA 2TRTA 3M7GA 1MMNA 3OYHA 3G7RA 1DU6A 3LSPA 3CJNA 4X1EA 2OI8A 1MZBA 2KISA 3DBHB 2OAZA 4ANJA 4CSWA 2R7VA 5F04A 3PPBA 1BA5A 1GXPA 1FIAA 4EEFG 4A5NA 2O7TA 2ECBA 3V78A 4B43A 2W00A 1K6YA 3H1CA 2XASA 3HIMA 3LWFA 1U3EM 1U9NA 2I8DA 2XF6A 5GAHJ 2D2WA 2Q2EB 3ROUA 4CCKA 3K4LA 1S9HA 2RN7A 4HF0A 4I01A 3Q0VA 5CYVA 1SVOA 5KNLA 2VKHA 3L2WA 3UKGA 4RDUA 1VF9A 4CCOA 4DYCA 2JSPA 3H35A 1S7EA 3HPGA 1U78A 2L7KA 2HVSA 3GTMJ 4I2OA 2VPRA 1YX5A 2VN2A 4ASNA 5CVVA 3VDXA 1W7PD 2L01A 1WKMA 3K0LA 1YOVB 1JUSA 5B1AH 2R7UA 3QQAA 1RKTA 5C4JJ 3PM1A 4U0WA 3Q0WA 5TRDA 4X0GA 4EJTA 1O4XA 1MMGA 4S05A 3HEFA 2HTSA 3B6AA 1IRFA 4B1RA 2GXAA 3K6GA 1VFCA 3FK7A 1EJ9A 1X19A 3W6KB 3E7LA 4G94A 3FKIJ 3FBNB 3T8RA 2JTVA 3OYNA 5B5EC 3OYGA 3B73A 1XDUA 3I56I 3HL2A 3COLA 4G7HF 2JRTA 1UCRA 4M73A 3TO7A 3NNRA 5FMPA 4XLHA 3OYKA 2MD0A 3HGGA 4GO1A 4WF2A 2QGUA 1V54H 2HDCA 3R61A 3HTUA 1SAUA 3NQOA 4W1UA 3CC7I 4M72A 2DK5A 4XBFA 1XDSA 2K4JA 1G3WA 4MFEA 1OLTA 2XIGA 1LFPA 2LMDA 3WODF 4E7SA 2ZO4A 2FU4A 3ABUA 4DYQA 5LHGA 4LOCA 1T38A 3BZCA 3IC7A 4EQQA 1PVEA 2XGDA 1TQPA 2ESHA 1V5GA 3FM3A 2ZJQF 2Q8KA 5D1RA 3CP8A 2DN0A 1AKHB 3IWZA 3FXUA 4MEYF 4XKCA 3W2WA 2DDBA 3KLOA 2EA2A 5HBUA 5HVQC 2Q2EA 4N9HA 2CRGA 1SVMA 1YIJI 1BC7C 2IRFG 5K58A 1KU9A 2KPMA 3OIOA 4E7HA 1AHDP 4MHGA 1SAXA 2JA8J 1ONVA 3LSIA 4F55A 3HHGA 4E70A 4CYCB 2XC7A 4AM3A 2IT0A 3F6OA 3I58A 2DA6A 1ETWA 3SYTA 4DGWB 2DQLA 4AIKA 1MMAA 2MLKA 2ISZA 2YU3A 1SFXA 4DQ2A 2KKOA 1O3QA 3KKCA 2HXIA 2ZKZA 5J1YA 3CO6C 4HW0A 3M1CA 2HDWA 2XAUA 3DBRB 3OYCA 1ZGWA 3Q9VA 3WE3A 4V19K 1ZG5A 2CW8A 1MBHA 2PQ8A 1VQLI 3L1PA 2XKPA 2OJED 1NK2P 3F22A 1JGSA 2O8XA 3JRHA 2V7FA 3OR2C 1RC9A 2M45A 1T95A 2RGVA 1DU0A 2STTA 1R58A 2W25A 3CJDA 2OCCH 2EPFA 2H1LA 2HOTA 1E2XA 1YQAA 4YIFA 3I55I 2Z2SB 3JAMK 1PUFB 3RSNA 4Q47A 5LFAA 2QENA 1O7FA 3DQVC 3OYJA 1DGWY 1U2WA 2HYFA 1A31A 2MYSA 2DA3A 3F0CA 3K7AJ 3TOBA 4EJWA 2MBFA 3GTGJ 3D1NI 5HNFA 2F2EA 2KRFA 4I98B 2F5CA 2V1UA 1XN7A 3OY9A 2YR2A 3PO2J 4EJUA 3ULQB 2W57A 2XPVA 3EUKL 5E3LA 2L9SA 3GUDA 3FIWA 5KAIC 3RQ4A 1Y39A 2CUEA 2ZXWH 3QWLA 4ZH4F 2CWEA 2GBYA 2R7RA 2V79A 2CGPA 3IL2A 1YJNI 1RETA 2CS3A 4JP0A 5K5RA 4XLAA 1GV5A 4A3GJ 1N75A 3FMQA 3BJBA 1FOYA 1QPMA 4M9SA 3SZGA 1SFUA 3R60A 2OZUA 3Q0UA 1AKHA 5E17F 5ED4A 1R1VA 4JBAA 4YELA 3GXOA 4NNJA 2A07F 1ZHFA 5GP9A 1SD6A 5CVUA 1AWCA 2VOOA 4XRFA 1EA3A 4PJLA 4JK1X 3CLOA 1B9NA 3GLXA 4CHUA 3CCEI 2FX0A 3PL8A 3CDLA 3I5UA 4OD4A 1PJRA 3I4PA 3NRGA 3T6NA 4D9JA 2WADA 3ASOH 2W48A 3QKXA 2G3BA 5J4YA 1WRJA 1KQ0A 3R6SA 3RZOJ 1BR1A 4CZCA 3KP3A 1B72B 3V7RA 2F5EA 3QPHA 4DIQA 1MDMA 4O3MA 3K4BA 3GTPJ 3FKJA 2E36A 2BOLA 4UV9A 3FXKA 1H9GA 1LDKB 4AVZA 5F08A 1X3WB 2FXAA 2Y31A 4ZC3A 4IPAA 3REOA 2VC1A 1BI2A 4MTEA 4N4NB 3I53A 3WGIA 2E60A 3E6BA 4M3GA 4MXMA 5DM6F 2XAJA 2YU9J 2RREA 4GDFA 2JJ7A 2GAUA 1FIPA 4AC6A 3BG7A 1PUFA 1R5GA 2GOMA 5E1WA 3ZQ7A 2XF7A 4OINF 5EF6A 1XGOA 3BHQA 1KYZA 1RPWA 2HU9A 3HOWJ 1A5JA 3DPUA 4CGRA 3AG3H 2NNYA 2XHKA 4WXCA 5AQCA 3JRBA 2KP6A 2PFBA 3VW2A 2V4JC 1ZAOA 3VSLA 2LD5A 2CH0A 3C7JA 4ICHA 1Y0NA 3ZN0A 3NS4A 2FMYA 1ZG1A 1QRYA 4P55A 4KT5C 3MFKA 1QA6A 2RNGA 5H6RA 3E0JB 1IN5A 1FLIA 2WY8Q 1ON1A 3CLQA 3PQJA 1I50J 1D5VA 1T6SA 1YRNB 3F8FA 4KMUX 1X58A 2KIMA 4CDGA 2D1HA 2QBYB 4ACIA 5J1UA 5C3EJ 3VEPA 2XKOA 1H0MA 4HEA2 1WGXA 1FOKA 2PMHA 5FGLA 3JRDA 1B8IB 3A1YA 1WI9A 3S32A 1ZGAA 2A6HF 4F91B 2KDOA 1EH6A 2C6YA 5EFYA 3K69A 2XPWA 3MVPA 4ON0A 2M2EA 4IO9F 1J59A 1DUXC 3CDIA 2ESNA 5CW8A 2H6CA 3BR5A 3CQZJ 3JW4A 3RCOA 2VT3A 1MJ9A 3KLNA 1S6LA 1B72A 3KP2A 4MEXF 3WG9A 4L9TA 1TNTA 1X1DA 1BR2A 2ZOZA 2OD5A 2WAQN 3GTOJ 2NVUB 3K70C 2X1EA 2E7WA 4F7ZA 2M1BA 3E3VA 2RQPA 3T5XA 2R5YB 4KN4X 1FEXA 2LRDA 2LYCA 2XF5A 4PSXA 2GXBA 5IYDJ 2CG4A 3EGQA 1FOWA 1OYIA 2KT0A 4M9XA 4RAGA 1UAAA 3M3YJ 2LLKA 3T1BA 3GZNB 3BOQA 2BE5F 2HTJA 3ZCOA 3KCCA 4IRHA 4LK0F 2VC0A 2H8RA 2NVTJ 4EMSA 3PO3J 3K1MA 4QWQA 4C9YA 4L5IA 3BT9A 2A6TA 5FKOA 3OYMA 4OD5A 2E1CA 1E3OC 2PN6A 1YJ9I 4HYEA 2ZMEB 3ON2A 4DW6A 1FSEA 2V6EA 4HDUA 5K5OA 2RASA 1XS9A 1MW7A 5FFXA 1FPQA 1XMXA 3Q3SA 1KQ9A 2JA2A 1YRNA 4KDPA 2Y30A 2QBYA 1D5YA 1WJEA 1MIJA 4DNCA 1Z21A 2LKXA 2ZSHB 1ZLJA 2ZB9A 1VQ6I 2ECCA 3G71I 1XGSA 3FBIB 3NPIA 2FBHA 3S1MJ 1IJWC 4HLYA 4ZDOA 3MN2A 4U0VA 5IY5H 4TV7A 3ZQLA 4ZTJA 2XAGA 3AQTA 3JSJA 4KIBA 2VKEA 3JRAA 1WFXA 1ON2A 1SGMA 2O5RA 1BM9A 5LRRA 2BYVE 2YUSA 3V6GA 1W36D 2HKOA 1HC8A 2GFNA 1XGNA 5GPCA 2EIJH 4JX4A 2HFHA 4A5MA 3QBMA 3SXYA 1G2HA 4M71A 4GCTA 2JA7J 3FMRA 4RM2A 4C2TA 1E3HA 2MH2A 1W5TA 3ANGA 5KK1A 2REKA 4Z6YA 2R5YA 1R1TA 3KP5A 3BRUA 4PFPA 4WX9A 3IAS2 4HOBA 2IS2A 4HF2A 3F8BA 2OPTA 4B3AA 1RIOH 3H9GA 1HKQA 4MTDA 1VTNC 4NHJA 2DG7A 1LDJA 4LG3A 5FHPA 2IP2A 2R4GA 3BPVA 4HQMA 4C2MJ 4CUGA 5CVRA 2LDUA 3GTKJ 1N25A 5DUKA 5ICFA 1QHGA 3AG2H 4LFUA 2X6OA 2QSFX 1GHCA 3FXLA 4XR6A 1O7LA 2IGMA 2QF7A 3E5QA 2HZDA 4KN7X 4RGUA 4E6KG 2IW5A 4B44A 4U9NA 2IBDA 3KZYA 4JKZA 4HX8A 3O60A 2F4OB 4HNVA 1KYWA 1RI7A 3KEYA 4AIHA 2VIXA 5D18A 1IDYA 1DPUA 3S15J 4H4KC 3GEUA 2LK2A 4LJZF 2D45A 2KFDA 4AYBA 2VQHA 5JHUA 4CO8A 3DTIA 1G3TA 2A6EF 4F92B 1R9TJ 2D1VA 2EH3A 4AD9A 1OCZH 2L2OA 3G56A 1SC7A 1IAWA 2UXOA 2ICWG 2EZLA 1TWCJ 5H20A 2CJJA 2L54A 3VYUB 5TGTA 2M4KA 1R23A 4M3EA 4KIFA 1ETKA 1A6IA 1SMYF 4NELA 2FQ4A 1W7PB 2DLLA 5J3LA 1DQUA 5JVGF 4A3EJ 1O57A 3WTTC 3AL0C 4HRIA 5CKTA 2G7UA 2YX4A 4RAZA 2GIZA 5EEHA 3FHNA 3BDDA 3CC2I 1O3RA 2R7ZJ 1F9NA 1QPIA 3G1MA 3OYIA 2R93J 1IG7A 1OYYA 1UHMA 1UHWA 1X1CA 2MW8A 3CP2A 4HX4A 3GMEA 3AL0B 4I76A 2IU5A 1REPC 1Z67A 2E34A 4P1WA 1TT0A 1F36A 3AAFA 3ZQQA 3M07A 1B6AA 1O3SA 5D6EA 4BGDA 3BJAA 1R49A 2YVXA 1GXQA 2R7QA 2KRHA 2XAFA 3VVXA 3S93A 4ESBA 2X48A 3L9FA 4XSZF 1ZQ3P 2EFWA 2JPBA 2VJ5A 4GGGA 5ICEA 3ZQFA 4Y52J 2E5NA 2L9NA 1B4AA 3MMYB 2VODA 1IDZA 3K8PC 2RQQA 5C4YA 3ZN1A 3CJRB 1WVRA 4FQGA 1RRJA 2QKOA 2LP0A 5IT9K 2CUZA 3V42A 1MH3A 1OR7C 2CQ7A 4U87A 4LITA 3LSTA 4PZJA 3JTHA 1VQ4I 1TNSA 4GRIA 2IGKA 3V8JA 4ZYDA 3RZDJ 2AO9A 4L5JA 1FJLA 2ZOYA 5FLXZ 4OIOF 4BU2A 5GAEJ 2Y0MA 3BP8A 3BG5A 1IN7A 1WSUA 1LB2A 3KYLA 1U9OA 2UZKA 3I4MJ 2DFIA 4P96A 3LSHA 1FY7A 1QZYA 3HRSA 2XUBA 5FROA 3W3CA 2HPMA 3ERMA 3DEWA 3BR1A 4KT6A 3RKYA 1J7KA 4A6DA 4XQFA 1KU7A 1HSJA 3BLYA 1BJAA 3VP5A 2P5LC 2XGCA 2NOGA 1W7PA 1MNMC 1P9QC 3NWTA 3TP3A 2R7XA 3EPZA 1SFKA 2NS7A 3IAM2 5F0HA 4ABZA 5D4RA 3WTVC 1WJCA 2M8EA 4GYGA 2NVXJ 3ABMH 3B6CA 3ZMZA 5FFZA 5KHDA 2L5QA 3HOUJ 3E6CC 1SD7A 3EDPA 2NRAC 4I0AA 5DTDA 4ZYAA 4GXOA 3IKTA 1POGA 4UUSB 5AIQA 4Z2YA 5DUIA 4DZJA 2BY2A 2EB7A 3HSRA 2E1MC 1HXDA 1G3YA 4FASD 4Y17A 4XICA 1FZPB 3DEUA 3KNWA 4IZZA 1PP8F 1MKMA 5K7ZA 2ZJ2A 4Y15A 1Y0UA 4YG2F 5M5YJ 3GTJJ 2LTPA 2E1MB 4R8HA 1GVJA 1T0FC 2MA3A 4OIQF 3X2QH 5LHHA 2UXPA 2W4SA 3IRQA 4J19A 1ZARA 3ASNH 2DJNA 3EYYA 4CGZA 5DD8A 3GF2A 2ZCMA 1UJ8A 2LSOA 4IHSA 5DM7F 1YX3A 1ZGJA 3LMMA 4JQFA 5J47A 3K4CA 1UMQA 4KMFA 4BE2A 1OR7A 5JVTA 1KGSA 3K4NA 4A0XA 5HSZA 1WQ2A 1WH7A 2CQKA 1I5ZA 3T8TA 2LREA 2FBQA 3SWHA 3CTAA 1SFOJ 5EGOB 3CWRA 2K9LA 1MMDA 2M0MA 2QKLB 4UVAA 2V1XA 5KVRA 2HOSA 2ELHA 2F5FA 4G6QA 3HYIA 2KIQA 2LF8A 1QQIA 2V9VA 2LVSA 4PGHA 2FRHA 4OWRB 2VUMJ 2EFPA 3BQZA 1ITYA 4HV5A 2FMLA 2L9VA 2DTZA 1S29A 1FSHA 5HAWA 3PSIA 1MBEA 2OUMA 2DYRH 2V26A 1LNWA 4ZZDA 5L3FA 2BY3A 1GUUA 3OYFA 1YIOA 2X6WA 5KAFC 1R4MB 3GX4X 4AC0A 1IXRC 2WAFA 2Z9OA 1G8XA 3DBLB 2G7LA 4UVBA 2LOOA 2DW4A 1UB9A 3VW1A 4JNNA 3S2WA 1J9IA 2PJRB 2HWVA 4A3JJ 1T56A 2WUIA 2QYOA 1ETYA 3IH4A 1QZZA 2UXNA 2MGQA 4II2A 3V8LA 4FT8A 2E1NA 3F23A 1C0WA 5F64A 4UUSA 3WTSC 2LNBA 4O5VA 2OERA 2VI6A 2L4AA 4IRGA 4LGWA 5IP9J 1PP7U 4B4CA 4OMZA 2XVCA 1YTYA 2DQRA 4EM0B 2E2IJ 2EZKA 1NTCA 2Z3YA 3QAHA 1U8BA 5DS9A 1ETOA 1CGPA 4DOZA 2KZVA 2IA1A 3OS1A 2PFVA 3LJLA 5GPAA 1SMTA 1ZRDA 5FLVA 2QCOA 1R4NB 1JGGA 1OFCX 3M4OJ 4M6VA 3QU3A 3FX3A 4XN0A 3ZXSA 3LA7A 3GFMA 1SD4A 5K7HA 1S7OA 3U1KA 3ECOA 3EUHC 3FK6A 5J40A 4ESFA 4ZDLA 2ID6A 2QZ8A 3WE2A 1T0FA 2OZ6A 1W4MA 1L0OC 1JUPA 3DLAA 2VLAA 1JTXA 3QP6A 3HG9A 2GOXB 2IGOA 1OCRH 1IF1A 5B3SH 4L62A 1LQ1A 3CD6I 1XSXA 2DFEA 3TOAA 1W5SA 3H3VK 1STZA 3DLLF 1QU3A 3TDUC 4ZYGA 1HW2A 2P5VA 4G8XA 2TDXA 3IH2A 3HHHA 4UNOA 1W0TA 4G7ZF 5EGOA 1G3SA 4HNUA 2R3SA 4A3KJ 1LVAA 1Y56A 2EV0A 3KIOA 4FISA 3V4GA 2F4MB 3LAPA 3V8KA 5A2QZ 3QU6A 1MDMB 4BXUA 4CZZA 3DKXA 2P7CB 2UXHA 4EM2A 2G9WA 4CCNA 2FNPA 4NC6A 2EV5A 3HSFA 1SANA 1FNNA 1TWHJ 1QZEA 3O2PE 4P9FA 3L2VA 9ANTA 1E3PA 1IRGA 3D5RC 4AVPA 3K9TA 3BR0A 4XLCA 2V57A 2V6CA 4V2GA 3IV5A 4C3JJ 2NXNB 5IYBJ 1KU3A 2IS4A 2MSYA 3FF5A 2CFXA 5F0FA 5IP6A 1FBUA 5F0CA 1K7AA 2HDDA 2PJRA 4PUSA 1P4WA 1NK3P 5DEQA 2WTEA 1T98A 3ZRGA 1ZK8A 2BGCA 1JT0A 2QIBA 1I27A 4BHCA 1SEUA 2FF4A 2ZXJA 3LSJA 3J80Z 2IGNA 4IHTA 3SDGA 1V5FA 4HF1A 2DYSH 4I09A 3SQNA 5GTHC 2HVRA 4UHTA 3ON4A 2HQRA 3KP7A 1G59A 4C2UA 4JX5A 3HE0A 4R1HA 2OF7A 3I71A 1P4XA 3J7AY 2FA5A 5HLHA 1TTYA 2W53A 2EZIA 4PGGA 1FMVA 2M9HA 2M4GA 1IXCA 4MQ9F 2FOWA 2DFHA 2B7EA 2XV4S 4KIGA 1XSVA 2O03A 5DYMA 3P9TA 2JSCA 4BY7J 4BY1J 3OOPA 2MG4A 2V9KA 4ZYHA 3WHBA 5BPIA 1X1BA 3BQYA 2VB6A 4WXHA 1T39A 2MH9A 2QQ8A 3R4KA 1DP3A 3EUHA 3GYHX 4A0ZA 1PYVA 4E7IA 5FRNA 2OA4A 3GCMA 2F5DA 2W82A 1SD5A 2AQFA 2KHMA 2H27A 4IEJA 1X1PA 2CMPA 2EWNA 4I02A 2B63J 2VJJA 5E8IA 3HC7A 5D5VB 2LKSA 2UXXA 5LHIA 3CC4I 3CUQC 3DWLE 1JKPC 1KA8A 4KA4A 5LEJA 1TC3C 2CW0F 1DGRM 1W36C 2VBXA 3WGHA 1D8KA 3CUQB 2DI3A 2JPCA 5JHFA 1MSEC 2CV1A 2NS0A 3TW7A 4KITB 3BCAA 3CMAI 4IF4A 5CVJA 3BC8A 1R71A 1QNTA 1HLVA 1ZLKA 4OOIA 5D6FA 4MFDA 4M3BA 1HKTA 4RB0A 2L0KA 1V3FA 4OU0A 5EZHA 5LEKA 2A61A 3VOEA 3CMEI 3CCJI 3VOKA 4PCQA 4IVNA 3DKWA 4OAYA 2KDZA 3S3OA 4BDYA 3HTAA 1BJZA 2VBWA 3P5JA 4HNTA 3F3XA 1IW7F 4K2EA 1XSDA 2CQQA 4KICA 3CCMI 2G7HA 2QVOA 5GTIC 3TQNA 1V5EA 1T33A 2KJBA 2KL4A 1FP2A 4A12A 3HSEA 3DKYA 2KMUA 4G6DA 4MNUA 2D5VA 4JL3A 1Z1DA 2PEXA 3L2QA 3WTYC 4LD5A 4A0YA 4KISA 3A2KA 5EJCA 3TL4X 5D4SA 4AYBN 4AIDA 1TQIA 3COAC 2STWA 5L3BA 4B48A 1I6XA 2RC4A 1OQYA 4BL0B 2CYYA 2E1OA 3BR6A 4L0ZB 1LPQA 1WJAA 3A4CA 1YG2A 3MKYB 3EYIA 2X6YA 3CF2A 3HUGB 1Z05A 4IHVA 2IJLA 2N8GA 2XSDC 2HI3A 3HOYJ 3OYDA 5K7FA 2OV7A 2O0YA 2Z1DA 4BAYA 4XKBA 3PNYA 4FE7A 2V1NA 3NRVA 2XRNA 3I4NJ 4DBRA 3TEDA 4BH9A 1WJDA 4M3FA 4Y7NJ 4ZZLA 4WK8F 2KIUA 5JI6A 3QODA 2CV2A 3C2GA 1D8JA 2BXZA 4LLLA 1DPRA 2X51A 4GYIA 3F9KA 3BTIA 3K4MA 2CQXA 2R7DA 1ERDA 1BI1A 3IUVA 1XCBA 3OS2A 2QSHX 2EFOA 3LFUA 2B9SA 1R7JA 1MGTA 3KPHA 1ZELA 2ZJPF 2AXLA 3E6MA 3IRRA 4KYWA 3CUQA 2DPUA 2DCEA 3N05A 5E20A 5D19A 2JK3A 4UB8C 4JYKA 5CVIA 2GLOA 4XLPF 3DFGA 5CXIA 4BDZA 3IWFA 3K1NA 4O6JA 5K5QA 3K4JA 2BVLA 5CPRB 1LFBA 2HPIA 3PIPF 3RQIA 1V55H 4U88A 3LNQA 5HDGA 3ML6A 1JKRC 2H6BA 3OYLA 3WTUC 4L9NA 5LBQA 2R7SA 1JHHA 2COMA 3A03A 1GVDA 3C1DA 3CZ6A 3ZOBA 2DK8A 1Y8RB 2CU7A 2FE3A 1FT9A 4I0BA 4H0EA 4BKXA 3KP4A 4HBLA 1SFEA 3H0DA 3I3LA 2WGBA 2QWTA 4OIRF 4ENKA 3RH2A 2LF7A 5EEAA 5ILVA 1W5CC 4IKFA 4Y3OA 1D1BA 2JMWA 4FHTA 4BJ5C 5D5WB 1T2KA 1HBXG 4EATA 2L7ZA 1OCPA 4JOMA 2KRCA 2QM3A 5FD5A 2ME6A 2DMNA 2IA2A 3O6BB 3LSKA 3PQKA 1F4KA 5ICCA 3DTKA 2R5ZB 3ZMVA 2GWRA 3OYBA 1R1UA 2AHQA 1Z6RA 1EV7A 3TKYA 2XDNA 1MH4A 2P4WA 3BZKA 3HUGA 5M5XJ 1EH8A 1G6NA 5CJ9A 5HOOA 5E79C 3CCSI 3V7CA 1JE8A 2LBFB 5BMZA 4EM1A 2PMUA 3LAJA 3A0BC 4YFKF 3EUAA 3DCFA 3FXRA 3M1EA 1FWZA 3RI4A 4GCVA 5CQEA 1VQ8I 4A3IJ 4ENMA 3CO7C 1YE9A 1HCRA 1U0JA 4BQOA 3U2RA 2X85A 1K4TA 1IN8A 4II3A 1LJ9A 4PJMA 4U7BA 4LMYA 2G7SA 5HS7A 4BBRJ 4V2FA 2O3FA 1J75A 4UDSA 2CUJA 4W97A 4LIUA 1IO2A 1YI2I 2G7GA 1K83J 2WBMA 4ENJA 1RR8C 4WIBA 4QTRA 1GT0C 4AF5A 2A05A 2L7FP 3K4KA 4EGZA 4UV8A 3SFZA 1YHQI 3HKZN 2KIFA 3M8FA 2K85A 3L2RA 1TP4A 4UVCA 1Z77A 1ZKGA 2RNJA 4CXFA 3HTIA 4UUTA 4DJAA 1BW6A 2JN6A 1KZHA 3ZR8X 2DA7A 3HTJA 2GA2A 4D1QA 4BQQA 1WJ5A 4HG2A 4ZJZA 3VWBA 4RB3C 4D7MA 3MCZA 2EFNA 2HGCA 2FOKA 1MD0A 3CJTB 3GZ5A 2EJRA 3LOCA 4E7JA 4DYRA 3RPUA 4RB2C 3E5XA 2XB0X 3P9KA 1LDDA 2V1DA 2ZNYA 3AFHA 2JVGA 1S72I 4IRVA 2Z33A 2BVMA 1Z6TA 3BCGA 1ENHA 2J5PA 3HGYA 1FTZA 1D1CA 2NP5A 3EUPA 1B9MA 4XRMA 3S3MA 4GFKA 3FDYA 1J5YA 3RTRA 5DCFA 1WI3A 1LE8B 4KFCA 2QSGX 3VPRA 3FWEA 1UELB 2PX9A 4OAZA 4J01A 3FRQA 3E5UA 3RYPA 3GZIA 2R5ZA 3G3ZA 3MKLA 1ZREA 4U0YA 1BI0A 2YVEA 3BCBA 5LLQA 1VQ9I 3TMOA 2JA6J 1ETQA 1UI5A 2ACJA 2VXZA 3LFKA 1D1AA 4XLEA 2JA5J 1WH5A 2DXIA 5DAJA 4L9VA 1H8AC 4KNYA 3PJRA 2LBFA 1A35A 2MLGA 2VKVA 5FGMA 2PZ9A 2EQRA 2ZXIA 2GXGA 3BG9A 4OIPF 3ANPA 4BQAA 1I1GA 2W24A 4BNCA 2NP3A 3G1OA 1IRZA 3KE2A 2VT2A 4CH7A 4MO7A 4EJVA 3CF5F 3PNTA 5E1XA 3GBGA 1APLC 1U5TC 3CCLI 2ZCNA 1XMKA 4PXIA 1I39A 4KJZA 1JTYA 1OYWA 2HYTA 2DO7A 5J1RA 3TW6A 3WGGA 2V9PA 3MQ0A 4Y33A 1A04A 1U5TB 3L09A 5BOXA 1ZR4A 3E7QA 2XSJC 3HDDA 2IAIA 3HM5A 3PSFA 1GV2A 2VJ4A 2HOEA 2FNAA 4QLCU 2KZGA 3GWZA 4HV6A 1X3ZB 2IPQX 5FLXK 1MSFC 2DMPA 2K9QA 3ZMSA 4L0YB 2E19A 3RPUD 1IGNA 3UNGC 4CYDA 3W6JB 4RB1A 2CUFA 2K40A 2QOPA 1XC5A 2HNHA 5H2FC 4E7ZA 4E7LA 5LGUA 3KYDB 2NAZA 1S7AA 3ZP5A 3S5RA 3JR9A 2ZJRF 2NS8A 1I3AA 4IRIA 1VQ7I 2R7WA 1OCTC 1RESA 3ABKH 3ISPA 4AU7A 4Q48A 2K3FA 1HDPA 3P9IA 3O3KA 1VQOI 2VONA 1TT5B 3JRGA 3DU5A 1V4RA 4HA8A
chains in the Genus database with same CATH topology
3CCYA 4IHYA 2MGQA 2UXUA 1LE8A 4UUSA 3S14J 2OERA 1RR7A 3GTPJ 3S16J 2VI6A 1BW5A 5IP9J 2HYJA 1UHSA 2Y9YA 4B4CA 1IC8A 1AU7A 3BTJA 3OSFA 2E2IJ 2EZKA 1NTCA 1U8BA 5DS9A 1ETOA 5F08A 5BNGA 1B8IA 2Y31A 1HDDC 2E2JJ 3LJLA 5GPAA 5FLVA 2QCOA 1JGGA 4M3GA 1OFCX 3M4OJ 3BNIA 4M6VA 2YU9J 4MXMA 1UG2A 2JJ7A 1FIPA 2GUHA 1LFUP 2XPUA 4AC6A 2M8GX 1PUFA 3BG3A 5K7HA 5EF6A 3BHQA 3FK6A 1ETXA 1RPWA 2ID6A 3HOWJ 1A5JA 2Q24A 4CGRA 1GDTA 4XIDA 1JUPA 4A3BJ 5AQCA 1JTXA 3JRBA 3VW2A 4L62A 2LD5A 4ICHA 3H3VK 1I6HJ 3IH2A 1QRYA 3KKDA 4QSHA 1W0TA 5EGOA 3KZ9A 1VNDA 3HOVJ 4A3KJ 5EG0A 1I50J 4FISA 4GFBA 1YRNB 1WCMJ 3BTLA 2O9LA 1X58A 2Y0SN 4C3IJ 4ACIA 2UXHA 5J1UA 5EDNA 5C3EJ 3S1NJ 1WGXA 3BTCA 5E3NA 4MIMA 4I6ZA 4BXXJ 5FGLA 3JRDA 1B8IB 1SANA 3HBLA 1TWHJ 5IP7J 3JRCA 2DA2A 2ZCXA 1X2MA 9ANTA 2WV1A 5EFYA 2XPWA 3MVPA 4RBOA 2M2EA 1ORKA 4FE4A 3BR0A 2V57A 4C3HJ 4V2GA 3IV5A 3SJMA 4C3JJ 3WHCA 5IYBJ 5CW8A 3BR5A 3CQZJ 2HXOA 2MSYA 5F0FA 5IP6A 1B72A 4FTHA 2TCTA 5F0CA 2HDDA 4JX6A 1NK3P 2DMQA 1ZK8A 2M0CA 1JT0A 1MBKA 2QIBA 4D7NA 2ZOZA 3LSJA 3SDGA 2WAQN 3GTOJ 2GENA 1MBFA 4GCLA 3ON4A 2YS9A 2NX4A 1P7IA 3QPSA 2E2HJ 4A3DJ 4JX5A 3S1RJ 3QPLA 2R5YB 3HE0A 2OF7A 3F1BA 1FEXA 2H1KA 4XRSA 5IYDJ 2W53A 2EZIA 1ZTRA 2O7OA 2WB1N 3EGQA 2M9HA 2KT0A 3HOZJ 2K9NA 1JKQC 3M3YJ 2LLKA 3P9TA 3BR2A 4BY7J 4BY1J 4G12A 5E3MA 2ELKA 2MG4A 3B81A 3WHBA 2H8RA 2NVTJ 3BQYA 3JRFA 5M3FJ 5JLXA 2RHAA 4HKUA 3PO3J 3BT9A 3A01B 5FKOA 2M34A 1E3OC 3RKQA 4IEJA 2B63J 2XGEA 3ON2A 4DZPA 3S2DJ 4DW6A 1IUFA 2Y2ZA 1QVUA 5M3MJ 5M5WJ 5EYRA 2LFBA 2RASA 1JKPC 1XS9A 3Q3SA 3LHQA 1TC3C 1F43A 2NVYJ 1YRNA 1JKOC 4KWAA 2Y30A 2IEKA 1D5YA 4A3CJ 1MSEC 2COBA 4A69C 3TW7A 1IV6A 2LKXA 3ZQCA 2ZB9A 2ECCA 3NPIA 1HLVA 2DA5A 5CXGA 4MFDA 3S1MJ 4M3BA 1IJWC 2L0KA 3MN2A 5EZHA 1MBGA 2PMZN 3ZQLA 4FCYA 3VOKA 1K61A 2KDZA 3AQTA 1BL0A 5IPAA 3HTAA 1BJZA 2VKEA 1VI0A 3JSJA 2R0QC 3JRAA 1SGMA 3VUQA 4XRSG 1XG1A 2CQQA 2JWTA 3V6GA 2YUSA 4YZEA 1JJ6C 1T33A 2GFNA 5HODA 5GPCA 4JX4A 1ZR2A 3QBMA 2LY9A 1G2HA 1WPKA 2D5VA 4JL3A 4BBSJ 1TWFJ 3VW0A 4GCTA 4AUXA 1Y1WJ 2JA7J 3C07A 3HB9A 4M3DA 2Y9ZA 3BR3A 3ANGA 2I10A 2REKA 2R5YA 4GCKA 1QVTA 4AYBN 3S1QJ 3OSGA 2P81A 3S17J 3NI7A 2OPTA 4B3AA 2E1OA 3BR6A 3OOUA 5FJ8J 5C4XJ 2EZHA 2DG7A 3CMYA 5FHPA 3VVZA 3LSGA 1Z0XA 4C2MJ 4IHVA 2N8GA 2XSDC 2HI3A 5IOZA 3HOYJ 3NAUA 5K7FA 3GTKJ 1W0UA 3MNLA 3PASA 4A3LJ 2X6OA 4FE7A 2O8KA 3A01A 3I4NJ 3TEDA 4Y7NJ 5D18A 4M3FA 2QF7A 1EF4A 3ZQIA 5H9TA 3H0GJ 2IBDA 4JKZA 5IYCJ 3O60A 3LWJA 4QIWN 4HNVA 1FTTA 3NXCA 1I3QJ 5FKNA 3BTIA 2CQXA 2HKUA 1IDYA 3S15J 3IUVA 4ME9A 3GEUA 2LK2A 5F1JA 2L7MP 2TRTA 3G7RA 1DU6A 3LSPA 4X1EA 2OI8A 1R9TJ 4MLOA 2XB5A 5D19A 2JK3A 4JYKA 2EH3A 5F27A 2GLOA 5F04A 3PPBA 1X2NA 3SFIA 3G56A 2ME0A 1BA5A 4D5FA 2UXOA 5CXIA 2EZLA 1FIAA 4EEFG 1TWCJ 2O7TA 2CJJA 2DA1A 2ECBA 1LFBA 3HIMA 2FD5A 3RQIA 3LNQA 4GFLA 3V78A 4M3EA 1A6IA 1U9NA 1ETKA 1JKRC 4NELA 2FQ4A 5J3LA 1MBJA 3A03A 1GVDA 4A3EJ 3ZOBA 2PBXA 3Q0VA 2CU7A 1Q1VA 5FKLA 3UKGA 3VVYA 4RDUA 4BKXA 1UI6A 3VIBA 1VF9A 3W6VA 2R7ZJ 1QPIA 4DYCA 2WGBA 2QWTA 1S7EA 1U78A 3G1MA 2ID3A 2R93J 1IG7A 3RH2A 5EEAA 2MW8A 2GM4A 2VPRA 3GTMJ 4I76A 2JMWA 2IU5A 3G1LA 4X6AJ 3CRJA 1JUSA 1F36A 2L7ZA 2YVHA 1OCPA 3QQAA 1RKTA 5C4JJ 3PM1A 2ME6A 2DMNA 3Q0WA 3VVXA 2R5ZB 2X48A 1O4XA 3S2HJ 2AHQA 3A02A 1ZQ3P 3HEFA 2XDNA 3B6AA 3ZQFA 3ZQHA 4Y52J 1MH4A 4B1RA 1VFCA 3FK7A 5M5XJ 4IHWA 4CYCA 1IDZA 1TWAJ 3E7LA 5C4YA 3FKIJ 5IOYA 2QKOA 2DMUA 2LP0A 2HOAA 3COLA 3DCFA 1MH3A 5C44J 3K2AA 3NNRA 5FMPA 1HF0A 4A3IJ 1HCRA 3HGGA 3RZDJ 2AO9A 2FJ1A 4A3MJ 1FJLA 1Y1VJ 2ZOYA 4W1UA 2UXIA 2G7SA 2K9SA 4V2FA 4BBRJ 4UDSA 2DA4A 4W97A 3BG5A 2G7GA 1K83J 4MFEA 3O8GA 3LSRA 1U9OA 3I4MJ 4QTRA 1GT0C 3FISA 4AF5A 4DYQA 2L7FP 4LOCA 3HKZN 5E3OA 5FLMJ 3RD3A 2XGDA 1Z77A 1ZKGA 3DEWA 3BR1A 2F07A 3HTIA 5D1RA 4UUTA 2DN0A 1AKHB 3VP5A 1BW6A 2JN6A 3O8HA 2XGCA 2DA7A 3HTJA 5HBUA 2NOGA 2CRGA 1MNMC 4A93J 5K58A 1ETVA 3TP3A 3OIOA 4D7MA 2HQ5A 1AHDP 3GTLJ 4MK6A 2JA8J 3LOCA 2NS7A 4CYCB 3GTQJ 4DYRA 3TP0A 2DA6A 1ETWA 2XB0X 5F0HA 4ABZA 2EBIA 2NVXJ 3B6CA 3KKCA 2HXIA 5J1YA 3HOUJ 3BCGA 3NARA 1ENHA 3HGYA 1FTZA 3EUPA 2NP5A 4GFKA 4XRMA 1CQTA 1ZGWA 1WI3A 5DTDA 1LE8B 1POGA 4UUSB 1MBHA 3JREA 5EZGA 3VPRA 4DZJA 4S0HB 3L1PA 1NK2P 3AQSA 2G0EA 1JJ8C 1RKWA 4L5EA 2X9DA 3FRQA 3GZIA 3JRHA 2R5ZA 3MKLA 4XICA 2YVEA 4D5CA 3KNWA 1JUMA 3HTHA 5K7ZA 1DU0A 2NVQJ 2JA6J 3GTJJ 1H88C 1ETQA 5M5YJ 3CJDA 5FKMA 1UI5A 2LTPA 2JA5J 2QTQA 1WH5A 2HOTA 5DAJA 1H8AC 2UXPA 4NDLA 4J19A 2VKVA 1PUFB 5FKKA 2PZ9A 1TWGJ 2EQRA 2DJNA 4IHXA 1HOMA 3BG9A 3ANPA 4NN1A 2NP3A 3G1OA 3ZQGA 3HOXJ 1IRZA 2ZCMA 4MO7A 5JLWA 2D6YA 2DA3A 3F0CA 3K7AJ 3GBGA 1APLC 1OJLA 2ZCNA 1UMQA 3D1NI 3GTGJ 3DPJA 4PXIA 1JTYA 2HYTA 3PO2J 2DG8A 5J1RA 2XPVA 3BRUA 5HSZA 5E3LA 1WH7A 3FIWA 3TW6A 2CUEA 1ZR4A 3E7QA 2L9RA 3IH3A 2FBQA 2GBYA 3HDDA 2IAIA 3HM5A 3C2BA 1SFOJ 1RETA 1GV2A 5EGOB 3CWRA 4JP0A 2HOSA 1JT6A 1GV5A 3JRIA 5EG0B 4A3GJ 3BJBA 1MSFC 2DMPA 2K9QA 2LVSA 2E19A 2LR8A 3Q0UA 1AKHA 1IGNA 2VUMJ 3BQZA 1ITYA 2CUFA 2K40A 5GP9A 2DMTA 2DTZA 2QOPA 5HAWA 1XC5A 3VOXA 1MBEA 1P7JA 2FX0A 2XRLA 1GUUA 3CDLA 3S5RA 3JR9A 2NS8A 1H89C 4AC0A 2R92J 2RAEA 3NRGA 4XK4A 3T6NA 1OCTC 1RESA 2G7LA 1HDPA 2W48A 3QKXA 2G3BA 3JRGA 3VW1A 3RZOJ 4JNNA 1B72B 4A3JJ 1T56A 2WUIA 3IH4A 1ETYA 4A3FJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCY A;  4IHY A;  2MGQ A;  2UXU A;  1LE8 A;  4UUS A;  3S14 J;  2OER A;  1RR7 A;  3GTP J;  3S16 J;  2VI6 A;  1BW5 A;  5IP9 J;  2HYJ A;  1UHS A;  2Y9Y A;  4B4C A;  1IC8 A;  1AU7 A;  3BTJ A;  3OSF A;  2E2I J;  2EZK A;  1NTC A;  1U8B A;  5DS9 A;  1ETO A;  5F08 A;  5BNG A;  1B8I A;  2Y31 A;  1HDD C;  2E2J J;  3LJL A;  5GPA A;  5FLV A;  2QCO A;  1JGG A;  4M3G A;  1OFC X;  3M4O J;  3BNI A;  4M6V A;  2YU9 J;  4MXM A;  1UG2 A;  2JJ7 A;  1FIP A;  2GUH A;  1LFU P;  2XPU A;  4AC6 A;  2M8G X;  1PUF A;  3BG3 A;  5K7H A;  5EF6 A;  3BHQ A;  3FK6 A;  1ETX A;  1RPW A;  2ID6 A;  3HOW J;  1A5J A;  2Q24 A;  4CGR A;  1GDT A;  4XID A;  1JUP A;  4A3B J;  5AQC A;  1JTX A;  3JRB A;  3VW2 A;  4L62 A;  2LD5 A;  4ICH A;  3H3V K;  1I6H J;  3IH2 A;  1QRY A;  3KKD A;  4QSH A;  1W0T A;  5EGO A;  3KZ9 A;  1VND A;  3HOV J;  4A3K J;  5EG0 A;  1I50 J;  4FIS A;  4GFB A;  1YRN B;  1WCM J;  3BTL A;  2O9L A;  1X58 A;  2Y0S N;  4C3I J;  4ACI A;  2UXH A;  5J1U A;  5EDN A;  5C3E J;  3S1N J;  1WGX A;  3BTC A;  5E3N A;  4MIM A;  4I6Z A;  4BXX J;  5FGL A;  3JRD A;  1B8I B;  1SAN A;  3HBL A;  1TWH J;  5IP7 J;  3JRC A;  2DA2 A;  2ZCX A;  1X2M A;  9ANT A;  2WV1 A;  5EFY A;  2XPW A;  3MVP A;  4RBO A;  2M2E A;  1ORK A;  4FE4 A;  3BR0 A;  2V57 A;  4C3H J;  4V2G A;  3IV5 A;  3SJM A;  4C3J J;  3WHC A;  5IYB J;  5CW8 A;  3BR5 A;  3CQZ J;  2HXO A;  2MSY A;  5F0F A;  5IP6 A;  1B72 A;  4FTH A;  2TCT A;  5F0C A;  2HDD A;  4JX6 A;  1NK3 P;  2DMQ A;  1ZK8 A;  2M0C A;  1JT0 A;  1MBK A;  2QIB A;  4D7N A;  2ZOZ A;  3LSJ A;  3SDG A;  2WAQ N;  3GTO J;  2GEN A;  1MBF A;  4GCL A;  3ON4 A;  2YS9 A;  2NX4 A;  1P7I A;  3QPS A;  2E2H J;  4A3D J;  4JX5 A;  3S1R J;  3QPL A;  2R5Y B;  3HE0 A;  2OF7 A;  3F1B A;  1FEX A;  2H1K A;  4XRS A;  5IYD J;  2W53 A;  2EZI A;  1ZTR A;  2O7O A;  2WB1 N;  3EGQ A;  2M9H A;  2KT0 A;  3HOZ J;  2K9N A;  1JKQ C;  3M3Y J;  2LLK A;  3P9T A;  3BR2 A;  4BY7 J;  4BY1 J;  4G12 A;  5E3M A;  2ELK A;  2MG4 A;  3B81 A;  3WHB A;  2H8R A;  2NVT J;  3BQY A;  3JRF A;  5M3F J;  5JLX A;  2RHA A;  4HKU A;  3PO3 J;  3BT9 A;  3A01 B;  5FKO A;  2M34 A;  1E3O C;  3RKQ A;  4IEJ A;  2B63 J;  2XGE A;  3ON2 A;  4DZP A;  3S2D J;  4DW6 A;  1IUF A;  2Y2Z A;  1QVU A;  5M3M J;  5M5W J;  5EYR A;  2LFB A;  2RAS A;  1JKP C;  1XS9 A;  3Q3S A;  3LHQ A;  1TC3 C;  1F43 A;  2NVY J;  1YRN A;  1JKO C;  4KWA A;  2Y30 A;  2IEK A;  1D5Y A;  4A3C J;  1MSE C;  2COB A;  4A69 C;  3TW7 A;  1IV6 A;  2LKX A;  3ZQC A;  2ZB9 A;  2ECC A;  3NPI A;  1HLV A;  2DA5 A;  5CXG A;  4MFD A;  3S1M J;  4M3B A;  1IJW C;  2L0K A;  3MN2 A;  5EZH A;  1MBG A;  2PMZ N;  3ZQL A;  4FCY A;  3VOK A;  1K61 A;  2KDZ A;  3AQT A;  1BL0 A;  5IPA A;  3HTA A;  1BJZ A;  2VKE A;  1VI0 A;  3JSJ A;  2R0Q C;  3JRA A;  1SGM A;  3VUQ A;  4XRS G;  1XG1 A;  2CQQ A;  2JWT A;  3V6G A;  2YUS A;  4YZE A;  1JJ6 C;  1T33 A;  2GFN A;  5HOD A;  5GPC A;  4JX4 A;  1ZR2 A;  3QBM A;  2LY9 A;  1G2H A;  1WPK A;  2D5V A;  4JL3 A;  4BBS J;  1TWF J;  3VW0 A;  4GCT A;  4AUX A;  1Y1W J;  2JA7 J;  3C07 A;  3HB9 A;  4M3D A;  2Y9Z A;  3BR3 A;  3ANG A;  2I10 A;  2REK A;  2R5Y A;  4GCK A;  1QVT A;  4AYB N;  3S1Q J;  3OSG A;  2P81 A;  3S17 J;  3NI7 A;  2OPT A;  4B3A A;  2E1O A;  3BR6 A;  3OOU A;  5FJ8 J;  5C4X J;  2EZH A;  2DG7 A;  3CMY A;  5FHP A;  3VVZ A;  3LSG A;  1Z0X A;  4C2M J;  4IHV A;  2N8G A;  2XSD C;  2HI3 A;  5IOZ A;  3HOY J;  3NAU A;  5K7F A;  3GTK J;  1W0U A;  3MNL A;  3PAS A;  4A3L J;  2X6O A;  4FE7 A;  2O8K A;  3A01 A;  3I4N J;  3TED A;  4Y7N J;  5D18 A;  4M3F A;  2QF7 A;  1EF4 A;  3ZQI A;  5H9T A;  3H0G J;  2IBD A;  4JKZ A;  5IYC J;  3O60 A;  3LWJ A;  4QIW N;  4HNV A;  1FTT A;  3NXC A;  1I3Q J;  5FKN A;  3BTI A;  2CQX A;  2HKU A;  1IDY A;  3S15 J;  3IUV A;  4ME9 A;  3GEU A;  2LK2 A;  5F1J A;  2L7M P;  2TRT A;  3G7R A;  1DU6 A;  3LSP A;  4X1E A;  2OI8 A;  1R9T J;  4MLO A;  2XB5 A;  5D19 A;  2JK3 A;  4JYK A;  2EH3 A;  5F27 A;  2GLO A;  5F04 A;  3PPB A;  1X2N A;  3SFI A;  3G56 A;  2ME0 A;  1BA5 A;  4D5F A;  2UXO A;  5CXI A;  2EZL A;  1FIA A;  4EEF G;  1TWC J;  2O7T A;  2CJJ A;  2DA1 A;  2ECB A;  1LFB A;  3HIM A;  2FD5 A;  3RQI A;  3LNQ A;  4GFL A;  3V78 A;  4M3E A;  1A6I A;  1U9N A;  1ETK A;  1JKR C;  4NEL A;  2FQ4 A;  5J3L A;  1MBJ A;  3A03 A;  1GVD A;  4A3E J;  3ZOB A;  2PBX A;  3Q0V A;  2CU7 A;  1Q1V A;  5FKL A;  3UKG A;  3VVY A;  4RDU A;  4BKX A;  1UI6 A;  3VIB A;  1VF9 A;  3W6V A;  2R7Z J;  1QPI A;  4DYC A;  2WGB A;  2QWT A;  1S7E A;  1U78 A;  3G1M A;  2ID3 A;  2R93 J;  1IG7 A;  3RH2 A;  5EEA A;  2MW8 A;  2GM4 A;  2VPR A;  3GTM J;  4I76 A;  2JMW A;  2IU5 A;  3G1L A;  4X6A J;  3CRJ A;  1JUS A;  1F36 A;  2L7Z A;  2YVH A;  1OCP A;  3QQA A;  1RKT A;  5C4J J;  3PM1 A;  2ME6 A;  2DMN A;  3Q0W A;  3VVX A;  2R5Z B;  2X48 A;  1O4X A;  3S2H J;  2AHQ A;  3A02 A;  1ZQ3 P;  3HEF A;  2XDN A;  3B6A A;  3ZQF A;  3ZQH A;  4Y52 J;  1MH4 A;  4B1R A;  1VFC A;  3FK7 A;  5M5X J;  4IHW A;  4CYC A;  1IDZ A;  1TWA J;  3E7L A;  5C4Y A;  3FKI J;  5IOY A;  2QKO A;  2DMU A;  2LP0 A;  2HOA A;  3COL A;  3DCF A;  1MH3 A;  5C44 J;  3K2A A;  3NNR A;  5FMP A;  1HF0 A;  4A3I J;  1HCR A;  3HGG A;  3RZD J;  2AO9 A;  2FJ1 A;  4A3M J;  1FJL A;  1Y1V J;  2ZOY A;  4W1U A;  2UXI A;  2G7S A;  2K9S A;  4V2F A;  4BBR J;  4UDS A;  2DA4 A;  4W97 A;  3BG5 A;  2G7G A;  1K83 J;  4MFE A;  3O8G A;  3LSR A;  1U9O A;  3I4M J;  4QTR A;  1GT0 C;  3FIS A;  4AF5 A;  4DYQ A;  2L7F P;  4LOC A;  3HKZ N;  5E3O A;  5FLM J;  3RD3 A;  2XGD A;  1Z77 A;  1ZKG A;  3DEW A;  3BR1 A;  2F07 A;  3HTI A;  5D1R A;  4UUT A;  2DN0 A;  1AKH B;  3VP5 A;  1BW6 A;  2JN6 A;  3O8H A;  2XGC A;  2DA7 A;  3HTJ A;  5HBU A;  2NOG A;  2CRG A;  1MNM C;  4A93 J;  5K58 A;  1ETV A;  3TP3 A;  3OIO A;  4D7M A;  2HQ5 A;  1AHD P;  3GTL J;  4MK6 A;  2JA8 J;  3LOC A;  2NS7 A;  4CYC B;  3GTQ J;  4DYR A;  3TP0 A;  2DA6 A;  1ETW A;  2XB0 X;  5F0H A;  4ABZ A;  2EBI A;  2NVX J;  3B6C A;  3KKC A;  2HXI A;  5J1Y A;  3HOU J;  3BCG A;  3NAR A;  1ENH A;  3HGY A;  1FTZ A;  3EUP A;  2NP5 A;  4GFK A;  4XRM A;  1CQT A;  1ZGW A;  1WI3 A;  5DTD A;  1LE8 B;  1POG A;  4UUS B;  1MBH A;  3JRE A;  5EZG A;  3VPR A;  4DZJ A;  4S0H B;  3L1P A;  1NK2 P;  3AQS A;  2G0E A;  1JJ8 C;  1RKW A;  4L5E A;  2X9D A;  3FRQ A;  3GZI A;  3JRH A;  2R5Z A;  3MKL A;  4XIC A;  2YVE A;  4D5C A;  3KNW A;  1JUM A;  3HTH A;  5K7Z A;  1DU0 A;  2NVQ J;  2JA6 J;  3GTJ J;  1H88 C;  1ETQ A;  5M5Y J;  3CJD A;  5FKM A;  1UI5 A;  2LTP A;  2JA5 J;  2QTQ A;  1WH5 A;  2HOT A;  5DAJ A;  1H8A C;  2UXP A;  4NDL A;  4J19 A;  2VKV A;  1PUF B;  5FKK A;  2PZ9 A;  1TWG J;  2EQR A;  2DJN A;  4IHX A;  1HOM A;  3BG9 A;  3ANP A;  4NN1 A;  2NP3 A;  3G1O A;  3ZQG A;  3HOX J;  1IRZ A;  2ZCM A;  4MO7 A;  5JLW A;  2D6Y A;  2DA3 A;  3F0C A;  3K7A J;  3GBG A;  1APL C;  1OJL A;  2ZCN A;  1UMQ A;  3D1N I;  3GTG J;  3DPJ A;  4PXI A;  1JTY A;  2HYT A;  3PO2 J;  2DG8 A;  5J1R A;  2XPV A;  3BRU A;  5HSZ A;  5E3L A;  1WH7 A;  3FIW A;  3TW6 A;  2CUE A;  1ZR4 A;  3E7Q A;  2L9R A;  3IH3 A;  2FBQ A;  2GBY A;  3HDD A;  2IAI A;  3HM5 A;  3C2B A;  1SFO J;  1RET A;  1GV2 A;  5EGO B;  3CWR A;  4JP0 A;  2HOS A;  1JT6 A;  1GV5 A;  3JRI A;  5EG0 B;  4A3G J;  3BJB A;  1MSF C;  2DMP A;  2K9Q A;  2LVS A;  2E19 A;  2LR8 A;  3Q0U A;  1AKH A;  1IGN A;  2VUM J;  3BQZ A;  1ITY A;  2CUF A;  2K40 A;  5GP9 A;  2DMT A;  2DTZ A;  2QOP A;  5HAW A;  1XC5 A;  3VOX A;  1MBE A;  1P7J A;  2FX0 A;  2XRL A;  1GUU A;  3CDL A;  3S5R A;  3JR9 A;  2NS8 A;  1H89 C;  4AC0 A;  2R92 J;  2RAE A;  3NRG A;  4XK4 A;  3T6N A;  1OCT C;  1RES A;  2G7L A;  1HDP A;  2W48 A;  3QKX A;  2G3B A;  3JRG A;  3VW1 A;  3RZO J;  4JNN A;  1B72 B;  4A3J J;  1T56 A;  2WUI A;  3IH4 A;  1ETY A;  4A3F J; 
#chains in the Genus database with same CATH topology
 3CCY A;  4IHY A;  2UXU A;  1LE8 A;  5AON A;  3S14 J;  4I7H A;  3S16 J;  2WA0 A;  3NWS A;  2HYJ A;  1IRX A;  3BZ6 A;  4XMY A;  4KUM A;  2Y9Y A;  4G6T B;  3BTJ A;  4LLG F;  5DD4 A;  5EEG A;  3OSF A;  3CCV I;  1H9T A;  3J81 Z;  2NNN A;  3TBI A;  2PG4 A;  3OL3 A;  4S04 A;  2QWW A;  3KX2 A;  2QUF A;  3GEZ A;  5J8F A;  4FET A;  2LG4 A;  2M30 A;  3SEQ A;  1UG2 A;  1FYL A;  3VYR B;  3MEX A;  2GUH A;  1LFU P;  1X4O A;  1ZN2 A;  2BXY A;  2QQ9 A;  3BG3 A;  2QEX I;  1ACI A;  1ETX A;  1K6O A;  3GLL A;  2Q24 A;  3H5R A;  5TIS C;  1GDT A;  2DFF A;  2A5W A;  2RKH A;  2YPR A;  1BIA A;  2F48 A;  2M3A A;  3E1S A;  3QPT A;  4BUP A;  2OQR A;  2RV8 A;  1OPC A;  4RA2 A;  5TJJ A;  1XD7 A;  2GQQ A;  2VQG A;  3KKD A;  1U5T A;  3SEZ A;  3WTX C;  3KZZ A;  4PFO A;  4UB6 C;  4XKW A;  4LG0 B;  1Z3X A;  2E7X A;  5HLI A;  2DOE A;  3KZ9 A;  3FHZ A;  5HLT A;  2WWY A;  1BC8 C;  4XON A;  2ADU A;  2ZCW A;  2DOA A;  3FXM A;  2PLY A;  3HKZ A;  2O9L A;  4Q5S F;  1RUO A;  4YFX F;  2VE8 A;  3FXO A;  5E1Z B;  5EDN A;  1G4D A;  1QBJ A;  1R5H A;  3BTC A;  1FX7 A;  2CQN A;  1HW1 A;  4I6Z A;  4BXX J;  1D0Y A;  3D5S C;  4WXD A;  2IS6 A;  3HBL A;  1FYM A;  1YW7 A;  2DAO A;  2AXT C;  5IP7 J;  3OIQ A;  3JRC A;  4IQJ A;  1ULY A;  2VBY A;  3MZY A;  2WV1 A;  2GIV A;  4RBO A;  2P8T A;  4HLX A;  4FE4 A;  3IP4 B;  2VE9 A;  3HIF A;  3AKZ A;  3WHC A;  4B8X A;  3CCR I;  1PUE E;  2BW3 B;  2A2F X;  2E5Z A;  2X1D A;  2RDP A;  2HXO A;  3Q5F A;  4UUV A;  1QO0 D;  2TCT A;  4JX6 A;  2DMQ A;  1W1W E;  3VSK A;  4XL9 A;  3BRO A;  4P9U A;  1MBK A;  4D7N A;  5BQT A;  4IX7 A;  4LIV A;  4QPQ A;  4ZYE A;  2GEN A;  2L02 A;  4GCL A;  2YS9 A;  3WTW C;  2NX4 A;  4MGR A;  2P6T A;  4J00 A;  4LB5 A;  2Y0S A;  2E35 A;  2BY0 A;  2E2H J;  3FXQ A;  1X4P A;  3U1D A;  2JUC A;  3DTE A;  3GVA A;  5F6F A;  3S3N A;  1XPX A;  1IZ1 A;  4RS8 A;  5FO5 A;  4XRS A;  4U9L A;  3KET A;  1ZTR A;  3H36 A;  1BR4 A;  3HRM A;  1TW2 A;  4YIR X;  3HOZ J;  2K9N A;  2O6G E;  5E18 F;  3BR2 A;  2HZT A;  3I59 A;  5HS8 A;  1LKX A;  1IUY A;  4FX0 A;  4YII A;  5M3F J;  2EIM H;  3FZV A;  3W2A A;  2JRM A;  4HKU A;  1T8I A;  1QHH D;  1N77 A;  4L9J A;  3ZMU A;  2LY2 A;  4CA0 A;  3G2B A;  5J6X A;  2ZC2 A;  3LA2 A;  1ZRC A;  2DT5 A;  4BE0 A;  3S2D J;  5AIP A;  1IUF A;  2Y2Z A;  4NQW B;  5M5W J;  1A36 A;  2K27 A;  2LFB A;  4LG0 A;  2W85 A;  5LGN A;  1RZ4 A;  2BBY A;  2LH9 A;  2EFQ A;  3LHQ A;  3DPL C;  2NVY J;  3DV8 A;  3MWM A;  2JUG A;  1JKO C;  4KWA A;  1HST A;  4Q4Z F;  1B59 A;  2UV1 A;  2WB1 A;  3HOT A;  2COB A;  4A69 C;  3BG6 A;  1BBY A;  3RPQ A;  4XOT A;  5BS6 A;  5HDK A;  3M8E A;  1JHF A;  4HQE A;  3ZQC A;  5DCM B;  2HQA A;  5CXG A;  5ICG A;  1UFM A;  3H5N A;  5A2Q K;  5IT3 A;  1MBG A;  3I0T A;  4DBQ A;  2Q1Z B;  1B1B A;  4FCY A;  4R79 A;  1K61 A;  3F6V A;  3RJP A;  1X1A A;  4G7O F;  4I99 C;  4YEJ A;  1P92 A;  2BW3 A;  3QYE A;  4XRS G;  1XG1 A;  4CCM A;  3H3Z A;  3DXJ F;  3KYC B;  4BEH B;  3LQQ A;  1ZR2 A;  3LQR A;  1VQN I;  4HSR A;  1KON A;  1YW9 A;  3VW0 A;  4AUX A;  1Y1W J;  3HB9 A;  4M3D A;  1ODD A;  3BR3 A;  1WZ2 A;  3KFW X;  2MC3 A;  3K10 A;  3PUF A;  4BAC A;  2ISY A;  3JSP A;  3MD2 A;  4GCK A;  3S1Q J;  4ZTF A;  3S17 J;  1P6R A;  3OOU A;  4A6E A;  4BHB A;  3J80 K;  2HKX A;  2EZH A;  3JTG A;  3CMY A;  3LSG A;  2PMZ A;  4HDV A;  3NAU A;  3PAS A;  1W0U A;  4QPO A;  3MNL A;  6PAX A;  1IN4 A;  3ZPL A;  3BJ6 A;  2VJI A;  3BPX A;  3C3W A;  2O8K A;  2W84 A;  2X0L A;  1OMI A;  2NOJ B;  1R36 A;  2LKP A;  1EF4 A;  1LVK A;  3H0G J;  3OV8 A;  5IYC J;  4QIW N;  3F8N A;  3F21 A;  1I3Q J;  1Z7L A;  4NQW A;  1HW5 A;  3SDB A;  3MKW B;  2HKU A;  1YJW I;  4FX4 A;  2WAE A;  2IS1 A;  4ME9 A;  3KEO A;  5F1J A;  1K4S A;  4F52 A;  4HZF A;  2M7A A;  1E17 A;  1Z3Y A;  4BHP A;  2E71 A;  1ZYR F;  2M7B A;  4XOP A;  2HS5 A;  3GFI A;  4MLO A;  2XB5 A;  2EK5 A;  5F27 A;  1AOY A;  1X2N A;  4XSX F;  5DCM A;  2ME0 A;  3SFI A;  4D5F A;  5L3G A;  1KU2 A;  2P5K A;  2X6X A;  3WTZ A;  2VBZ A;  4IOA F;  3TDZ C;  2DA1 A;  4IJA A;  2Y69 H;  3FMS A;  2FD5 A;  4GFL A;  1XCV A;  3I64 A;  3HRU A;  4B47 A;  3HOS A;  1MBJ A;  1R22 A;  4NBQ A;  4MQV A;  4IQ4 A;  3RYR A;  2PBX A;  5KCM A;  3HRT A;  1Q1V A;  5FKL A;  3VVY A;  2O61 A;  1UI6 A;  3VIB A;  2DOF A;  3W6V A;  2F4I A;  4BEH A;  2YX7 A;  4A2U A;  3QRF F;  2ID3 A;  4D0P A;  4NC8 A;  2GM4 A;  2JQ7 A;  1OCC H;  3OL4 A;  3G1L A;  3J7A O;  2K5C A;  4X6A J;  3CRJ A;  2DPD A;  3VTI A;  2YVH A;  3KP6 A;  2A5Y B;  4ETS A;  1WJF A;  2I5U A;  3HTS B;  1MJA A;  3JAM Z;  4A3C J;  5L3C A;  3IUO A;  1RUN A;  3S2H J;  2JVH A;  3A02 A;  5CLS A;  2F5V A;  1WHU A;  3GO5 A;  3IKV A;  3ZQH A;  4RM3 A;  4ZDP A;  2DTR A;  4IHW A;  3L7W A;  2HVQ A;  1FMW A;  4CYC A;  1Q1H A;  1XTA A;  1TWA J;  2BHY A;  5LGT A;  1MMS A;  2Y75 A;  5IOY A;  1Z7U A;  2DMU A;  2MD5 A;  4PJJ A;  2HOA A;  5C44 J;  1P2F A;  2Z99 A;  3K2A A;  4PK4 A;  4BJ6 C;  4WCG A;  1GLN A;  2DJI A;  1HF0 A;  3AG1 H;  3WU2 C;  1R5I D;  4C2M A;  1I1S A;  3BY6 A;  1ZH5 A;  2FJ1 A;  2UUZ A;  3G6E I;  4A3M J;  1Y1V J;  1F1Z A;  1HA8 A;  2CFO A;  2UXI A;  2K9S A;  5LD2 C;  3OIP A;  3DU6 A;  2DA4 A;  4Y4R A;  3LSM A;  3O8G A;  3LSR A;  3PFI A;  3FIS A;  3QP5 A;  3GFL A;  2BY1 A;  3MZ8 A;  5E3O A;  5FLM J;  2XGX A;  3RD3 A;  1YW8 A;  1OCO H;  3PIO F;  2F07 A;  3GZ6 A;  2BEO A;  4L18 B;  2Z16 A;  2ZBK A;  1MJB A;  2MFZ A;  2VQL A;  3O8H A;  4N4O B;  2K3P A;  2KJC A;  1HKS A;  1K78 B;  2K02 A;  2ZFW A;  1ETV A;  3GTL J;  1IXS B;  4ESJ A;  2HQ5 A;  4MK6 A;  4N0B A;  3GTQ J;  3TP0 A;  3H92 A;  2EIK H;  2BZT A;  2EBI A;  4IXA A;  1R00 A;  2HQN A;  4HX7 A;  3NAR A;  1BOB A;  4EVI A;  2AS5 F;  2PJP A;  3CUO A;  4P5O A;  2EIN H;  1CQT A;  3N4M A;  1LEA A;  5B1B H;  1EH7 A;  2BV6 A;  2H94 A;  3JRE A;  2RVC A;  5EZG A;  2ZNZ A;  4S0H B;  5B66 C;  3AQS A;  2G0E A;  1JJ8 C;  1RKW A;  4L5E A;  2X9D A;  4F93 B;  1D3Y A;  3OWT A;  2M87 A;  5ILS A;  4D5C A;  4RAY A;  1JUM A;  2ELJ A;  2OBP A;  3HTH A;  2NVQ J;  3J7Y J;  2XAH A;  1H88 C;  5FKM A;  1J0R A;  1F5T A;  2QTQ A;  5L3D A;  1T08 B;  3EET A;  1FBQ A;  4RLF A;  3Q9S A;  5DV5 A;  2R7F A;  2VPL A;  4NDL A;  1VZ0 A;  5FKK A;  1IV8 A;  3HXL A;  1TWG J;  1HOM A;  4WWC A;  4IHX A;  3KEQ A;  4NN1 A;  1OIS A;  3ZQG A;  3HOX J;  4BJT A;  2A68 F;  5JLW A;  2IVM A;  2D6Y A;  2BHZ A;  2P6S A;  4OMY A;  1OJL A;  2VQC A;  2KLO A;  1TL8 A;  3DPJ A;  1XMA A;  1YFH A;  3RKW A;  1R6R A;  3QOE A;  2ETH A;  4EJO A;  2HR3 A;  1TW3 A;  2KQR A;  2DG8 A;  2ZFU A;  4NC7 A;  2R7O A;  1D0Z A;  3RDI A;  2L9R A;  1USS A;  3IH3 A;  3C2B A;  1UG0 A;  2DT6 A;  1JT6 A;  2CW7 A;  5F1R A;  2MAB A;  3HZJ A;  3JRI A;  3BWG A;  5EG0 B;  1N78 A;  3GW2 A;  1EKE A;  4ITV A;  3PFY A;  3UR3 C;  3K1P A;  1FOX A;  2LR8 A;  2EIL H;  3PUB A;  1BIB A;  2R7T A;  3ESW B;  4BXF A;  3MAJ A;  5HLG A;  2DMT A;  2DU9 A;  2XDV A;  4YFN F;  3R0A A;  2ZME C;  1K78 A;  3VOX A;  4M74 A;  1P7J A;  1U8R A;  2XRL A;  1U6G A;  2Y48 A;  5J4V A;  2VOP A;  1S5L C;  3CJQ B;  3H9Q A;  1H89 C;  2R92 J;  2RAE A;  4DVY P;  2YSR A;  5JFR A;  4XK4 A;  2CSO A;  3VYT B;  5FB2 A;  1Z91 A;  2F6C A;  2L3D A;  4A93 J;  2X1C A;  2FSW A;  4A3F J;  3CCQ I;  2FJI 1;  4BE1 A;  3VYS B;  5HNH A;  1RR7 A;  3EQL F;  1BW5 A;  1UHS A;  1FBS A;  2J5O A;  1IC8 A;  4M6X A;  5L3E A;  5D5U B;  1AU7 A;  3RKX A;  3G73 A;  5ILU A;  4XNF A;  4HPQ A;  2MC4 A;  2VL8 A;  1BI3 A;  1MNE A;  3QYF A;  4IL6 C;  4XM3 A;  1QGP A;  5BNG A;  1B8I A;  1HDD C;  1YS7 A;  2E2J J;  4PJN A;  3BNI A;  1YO5 C;  1RNL A;  2ZXH A;  3OYE A;  1TBX A;  2PBI A;  2XPU A;  3ZMD A;  2M8G X;  3OS0 A;  3H3U A;  3HPH A;  1PDN C;  2A69 F;  1JI8 A;  1XB4 A;  2AQE A;  2P7V B;  3F72 A;  4UY8 I;  2WY7 Q;  5H6Q A;  2LY1 A;  4XID A;  4A3B J;  2LC2 A;  3H5A A;  1YS6 A;  4F3Q A;  1J2X A;  2EA4 A;  4Y13 A;  3ZMT A;  5GAG J;  2W1O A;  3AG4 H;  4ENN A;  3QOP A;  3OYA A;  4RMN A;  3A0H C;  5J8C A;  3CCU I;  1I6H J;  3DEE A;  3I54 A;  5D8L B;  1VQP I;  2B3W A;  2OTL I;  2HYG D;  4QSH A;  3SZP A;  1TQM A;  1VND A;  1Z9C A;  3HOV J;  2DBB A;  1YLF A;  4XLF A;  5EG0 A;  3S8P A;  4AIJ A;  4XOR A;  3TO9 A;  4B3X A;  4GFB A;  1WCM J;  3BTL A;  3DP7 A;  1S3J A;  2QQB A;  3C2H A;  4C3I J;  2Y0S N;  1YYV A;  5ERI A;  2B1E A;  3VOD A;  1M1E B;  2JZY A;  3S1N J;  4NB5 A;  4RGS A;  3FXJ A;  5E3N A;  4MIM A;  1UST A;  3VB2 A;  1Y8Q B;  1NG6 A;  3TGN A;  2DA2 A;  2ZCX A;  1X2M A;  1YIT I;  2WV0 A;  1ZRF A;  4U7D A;  2FUG 2;  2VKD A;  3SHF A;  1FC3 A;  3MZH A;  2ZME A;  3P7N A;  1ORK A;  4LB6 B;  1SVL A;  4C3H J;  3SJM A;  1TZL A;  1A6Q A;  1LUJ B;  3ERE D;  1BOA A;  2K4B A;  1AA7 A;  5GAD J;  1NG7 A;  3HJE A;  4FTH A;  3ELK A;  3ZGK A;  4RGR A;  2GA1 A;  5DDG A;  3B02 A;  2FBI A;  2M0C A;  5D5X B;  1X3U A;  1O3T A;  4EV0 A;  2DT7 B;  2OCE A;  3U21 A;  2P0W A;  1MBF A;  4BS9 A;  4CCL A;  1VQM I;  3ONQ A;  1P7I A;  3QPS A;  3W2V A;  4AWX B;  2H8W A;  4A3D J;  3F8C A;  3S1R J;  1J09 A;  1HQC A;  3QPL A;  1DP7 P;  3OMY A;  3F1B A;  4CIC A;  2EV6 A;  1FYK A;  2H1K A;  5H9T A;  1FP1 D;  2WB1 N;  2O7O A;  3D5L A;  3K2Z A;  1JKQ C;  3BJO A;  4RGX A;  4G12 A;  5E3M A;  2ELK A;  3VFZ A;  3J81 K;  3B81 A;  2K86 A;  4XN3 A;  1CF7 B;  3I9V 2;  3L2C A;  3M8J A;  1K79 A;  3JRF A;  2QQA A;  2CO5 A;  3IHU A;  5JLX A;  2XRO A;  2RHA A;  2W7N A;  1L3L A;  1UZC A;  1LEB A;  4M9Z A;  5CQG A;  2HEO A;  3M9A A;  4C30 A;  3P9C A;  3JSO A;  2NYX A;  3A01 B;  3K70 D;  2IA0 A;  1JXS A;  3ABL H;  2H09 A;  2FQ3 A;  2M34 A;  4YRV A;  2OTJ I;  3RKQ A;  2XAQ A;  4HAM A;  3D0S A;  2XGE A;  4N9I A;  4DZP A;  3E6D A;  2VXD A;  1QVU A;  2QKM B;  4IOC F;  2L4M A;  2WAQ A;  4BQN A;  5M3M J;  1NH3 A;  4PJ0 C;  5EYR A;  1WWX A;  2PI0 A;  2UWM A;  1ZG3 A;  2DOD A;  2M5W A;  3E97 A;  3ABT A;  2DDA A;  3R0J A;  3T0Y A;  1F43 A;  4B09 A;  4EGY A;  4XLN F;  1XGM A;  2IEK A;  4RAF A;  4LK1 F;  3GFJ A;  2IXS A;  3CMM A;  4BYY A;  1IV6 A;  2A3S A;  3QYB A;  2OC6 A;  2DA5 A;  4XKV A;  1E0E A;  2FBK A;  4PDK A;  3WU1 B;  1S8N A;  3OR1 C;  1VQ5 I;  2PMZ N;  4PSW A;  1Y6I A;  2ZSI B;  2GZW A;  2JT1 A;  3PNV A;  3RIR A;  3CES A;  5D8K B;  3KZI C;  1VQK I;  1BL0 A;  5IPA A;  4UXN A;  3I59 B;  1VI0 A;  2R0Q C;  2K9M A;  5HDN A;  3VUQ A;  1MND A;  3FM5 A;  3U9G A;  2JWT A;  4NUB A;  3SZT A;  3WG7 H;  3MKZ A;  2K7L A;  4YZE A;  2CV0 A;  1JJ6 C;  2Z5U A;  5E8G A;  2X4H A;  5HOD A;  1D0X A;  3LL7 A;  3G4S I;  2LY9 A;  1WPK A;  1OKR A;  4BBS J;  1TWF J;  4RLQ A;  3C07 A;  2Y9Z A;  5BPD A;  3N97 A;  2I10 A;  1DDN A;  3L00 A;  4HST A;  4LLN A;  1QVT A;  1TLH B;  2WC2 A;  3NEU A;  5K1Y A;  3H9J A;  3OSG A;  2P81 A;  5IT9 Z;  4M6Y A;  3NI7 A;  5HS9 A;  5FJ8 J;  5C4X J;  2B0L A;  3VVZ A;  3F8M A;  1Z0X A;  3WU0 A;  5FD6 A;  3TO6 A;  4E7K A;  1CF7 A;  5IOZ A;  3V7S A;  4CCJ A;  1WJB A;  4A3L J;  2FEZ A;  3J7Z I;  3A01 A;  4E4H A;  3CDH A;  2VAS A;  2QA4 I;  1KQ8 A;  3ZQI A;  2OU2 A;  3ECH A;  5LRS A;  3LWJ A;  5JR3 A;  1FTT A;  2ZY9 A;  3NXC A;  5FKN A;  4G9Y A;  2QLZ A;  3DPT A;  1XX5 A;  3LA3 A;  3C18 A;  5FRM A;  1P4A A;  3DF8 A;  3JCU C;  3L2U A;  2L7M P;  2Q0O A;  1BN5 A;  1IN6 A;  2OQG A;  1NHA A;  2TRT A;  3M7G A;  1MMN A;  3OYH A;  3G7R A;  1DU6 A;  3LSP A;  3CJN A;  4X1E A;  2OI8 A;  1MZB A;  2KIS A;  3DBH B;  2OAZ A;  4ANJ A;  4CSW A;  2R7V A;  5F04 A;  3PPB A;  1BA5 A;  1GXP A;  1FIA A;  4EEF G;  4A5N A;  2O7T A;  2ECB A;  3V78 A;  4B43 A;  2W00 A;  1K6Y A;  3H1C A;  2XAS A;  3HIM A;  3LWF A;  1U3E M;  1U9N A;  2I8D A;  2XF6 A;  5GAH J;  2D2W A;  2Q2E B;  3ROU A;  4CCK A;  3K4L A;  1S9H A;  2RN7 A;  4HF0 A;  4I01 A;  3Q0V A;  5CYV A;  1SVO A;  5KNL A;  2VKH A;  3L2W A;  3UKG A;  4RDU A;  1VF9 A;  4CCO A;  4DYC A;  2JSP A;  3H35 A;  1S7E A;  3HPG A;  1U78 A;  2L7K A;  2HVS A;  3GTM J;  4I2O A;  2VPR A;  1YX5 A;  2VN2 A;  4ASN A;  5CVV A;  3VDX A;  1W7P D;  2L01 A;  1WKM A;  3K0L A;  1YOV B;  1JUS A;  5B1A H;  2R7U A;  3QQA A;  1RKT A;  5C4J J;  3PM1 A;  4U0W A;  3Q0W A;  5TRD A;  4X0G A;  4EJT A;  1O4X A;  1MMG A;  4S05 A;  3HEF A;  2HTS A;  3B6A A;  1IRF A;  4B1R A;  2GXA A;  3K6G A;  1VFC A;  3FK7 A;  1EJ9 A;  1X19 A;  3W6K B;  3E7L A;  4G94 A;  3FKI J;  3FBN B;  3T8R A;  2JTV A;  3OYN A;  5B5E C;  3OYG A;  3B73 A;  1XDU A;  3I56 I;  3HL2 A;  3COL A;  4G7H F;  2JRT A;  1UCR A;  4M73 A;  3TO7 A;  3NNR A;  5FMP A;  4XLH A;  3OYK A;  2MD0 A;  3HGG A;  4GO1 A;  4WF2 A;  2QGU A;  1V54 H;  2HDC A;  3R61 A;  3HTU A;  1SAU A;  3NQO A;  4W1U A;  3CC7 I;  4M72 A;  2DK5 A;  4XBF A;  1XDS A;  2K4J A;  1G3W A;  4MFE A;  1OLT A;  2XIG A;  1LFP A;  2LMD A;  3WOD F;  4E7S A;  2ZO4 A;  2FU4 A;  3ABU A;  4DYQ A;  5LHG A;  4LOC A;  1T38 A;  3BZC A;  3IC7 A;  4EQQ A;  1PVE A;  2XGD A;  1TQP A;  2ESH A;  1V5G A;  3FM3 A;  2ZJQ F;  2Q8K A;  5D1R A;  3CP8 A;  2DN0 A;  1AKH B;  3IWZ A;  3FXU A;  4MEY F;  4XKC A;  3W2W A;  2DDB A;  3KLO A;  2EA2 A;  5HBU A;  5HVQ C;  2Q2E A;  4N9H A;  2CRG A;  1SVM A;  1YIJ I;  1BC7 C;  2IRF G;  5K58 A;  1KU9 A;  2KPM A;  3OIO A;  4E7H A;  1AHD P;  4MHG A;  1SAX A;  2JA8 J;  1ONV A;  3LSI A;  4F55 A;  3HHG A;  4E70 A;  4CYC B;  2XC7 A;  4AM3 A;  2IT0 A;  3F6O A;  3I58 A;  2DA6 A;  1ETW A;  3SYT A;  4DGW B;  2DQL A;  4AIK A;  1MMA A;  2MLK A;  2ISZ A;  2YU3 A;  1SFX A;  4DQ2 A;  2KKO A;  1O3Q A;  3KKC A;  2HXI A;  2ZKZ A;  5J1Y A;  3CO6 C;  4HW0 A;  3M1C A;  2HDW A;  2XAU A;  3DBR B;  3OYC A;  1ZGW A;  3Q9V A;  3WE3 A;  4V19 K;  1ZG5 A;  2CW8 A;  1MBH A;  2PQ8 A;  1VQL I;  3L1P A;  2XKP A;  2OJE D;  1NK2 P;  3F22 A;  1JGS A;  2O8X A;  3JRH A;  2V7F A;  3OR2 C;  1RC9 A;  2M45 A;  1T95 A;  2RGV A;  1DU0 A;  2STT A;  1R58 A;  2W25 A;  3CJD A;  2OCC H;  2EPF A;  2H1L A;  2HOT A;  1E2X A;  1YQA A;  4YIF A;  3I55 I;  2Z2S B;  3JAM K;  1PUF B;  3RSN A;  4Q47 A;  5LFA A;  2QEN A;  1O7F A;  3DQV C;  3OYJ A;  1DGW Y;  1U2W A;  2HYF A;  1A31 A;  2MYS A;  2DA3 A;  3F0C A;  3K7A J;  3TOB A;  4EJW A;  2MBF A;  3GTG J;  3D1N I;  5HNF A;  2F2E A;  2KRF A;  4I98 B;  2F5C A;  2V1U A;  1XN7 A;  3OY9 A;  2YR2 A;  3PO2 J;  4EJU A;  3ULQ B;  2W57 A;  2XPV A;  3EUK L;  5E3L A;  2L9S A;  3GUD A;  3FIW A;  5KAI C;  3RQ4 A;  1Y39 A;  2CUE A;  2ZXW H;  3QWL A;  4ZH4 F;  2CWE A;  2GBY A;  2R7R A;  2V79 A;  2CGP A;  3IL2 A;  1YJN I;  1RET A;  2CS3 A;  4JP0 A;  5K5R A;  4XLA A;  1GV5 A;  4A3G J;  1N75 A;  3FMQ A;  3BJB A;  1FOY A;  1QPM A;  4M9S A;  3SZG A;  1SFU A;  3R60 A;  2OZU A;  3Q0U A;  1AKH A;  5E17 F;  5ED4 A;  1R1V A;  4JBA A;  4YEL A;  3GXO A;  4NNJ A;  2A07 F;  1ZHF A;  5GP9 A;  1SD6 A;  5CVU A;  1AWC A;  2VOO A;  4XRF A;  1EA3 A;  4PJL A;  4JK1 X;  3CLO A;  1B9N A;  3GLX A;  4CHU A;  3CCE I;  2FX0 A;  3PL8 A;  3CDL A;  3I5U A;  4OD4 A;  1PJR A;  3I4P A;  3NRG A;  3T6N A;  4D9J A;  2WAD A;  3ASO H;  2W48 A;  3QKX A;  2G3B A;  5J4Y A;  1WRJ A;  1KQ0 A;  3R6S A;  3RZO J;  1BR1 A;  4CZC A;  3KP3 A;  1B72 B;  3V7R A;  2F5E A;  3QPH A;  4DIQ A;  1MDM A;  4O3M A;  3K4B A;  3GTP J;  3FKJ A;  2E36 A;  2BOL A;  4UV9 A;  3FXK A;  1H9G A;  1LDK B;  4AVZ A;  5F08 A;  1X3W B;  2FXA A;  2Y31 A;  4ZC3 A;  4IPA A;  3REO A;  2VC1 A;  1BI2 A;  4MTE A;  4N4N B;  3I53 A;  3WGI A;  2E60 A;  3E6B A;  4M3G A;  4MXM A;  5DM6 F;  2XAJ A;  2YU9 J;  2RRE A;  4GDF A;  2JJ7 A;  2GAU A;  1FIP A;  4AC6 A;  3BG7 A;  1PUF A;  1R5G A;  2GOM A;  5E1W A;  3ZQ7 A;  2XF7 A;  4OIN F;  5EF6 A;  1XGO A;  3BHQ A;  1KYZ A;  1RPW A;  2HU9 A;  3HOW J;  1A5J A;  3DPU A;  4CGR A;  3AG3 H;  2NNY A;  2XHK A;  4WXC A;  5AQC A;  3JRB A;  2KP6 A;  2PFB A;  3VW2 A;  2V4J C;  1ZAO A;  3VSL A;  2LD5 A;  2CH0 A;  3C7J A;  4ICH A;  1Y0N A;  3ZN0 A;  3NS4 A;  2FMY A;  1ZG1 A;  1QRY A;  4P55 A;  4KT5 C;  3MFK A;  1QA6 A;  2RNG A;  5H6R A;  3E0J B;  1IN5 A;  1FLI A;  2WY8 Q;  1ON1 A;  3CLQ A;  3PQJ A;  1I50 J;  1D5V A;  1T6S A;  1YRN B;  3F8F A;  4KMU X;  1X58 A;  2KIM A;  4CDG A;  2D1H A;  2QBY B;  4ACI A;  5J1U A;  5C3E J;  3VEP A;  2XKO A;  1H0M A;  4HEA 2;  1WGX A;  1FOK A;  2PMH A;  5FGL A;  3JRD A;  1B8I B;  3A1Y A;  1WI9 A;  3S32 A;  1ZGA A;  2A6H F;  4F91 B;  2KDO A;  1EH6 A;  2C6Y A;  5EFY A;  3K69 A;  2XPW A;  3MVP A;  4ON0 A;  2M2E A;  4IO9 F;  1J59 A;  1DUX C;  3CDI A;  2ESN A;  5CW8 A;  2H6C A;  3BR5 A;  3CQZ J;  3JW4 A;  3RCO A;  2VT3 A;  1MJ9 A;  3KLN A;  1S6L A;  1B72 A;  3KP2 A;  4MEX F;  3WG9 A;  4L9T A;  1TNT A;  1X1D A;  1BR2 A;  2ZOZ A;  2OD5 A;  2WAQ N;  3GTO J;  2NVU B;  3K70 C;  2X1E A;  2E7W A;  4F7Z A;  2M1B A;  3E3V A;  2RQP A;  3T5X A;  2R5Y B;  4KN4 X;  1FEX A;  2LRD A;  2LYC A;  2XF5 A;  4PSX A;  2GXB A;  5IYD J;  2CG4 A;  3EGQ A;  1FOW A;  1OYI A;  2KT0 A;  4M9X A;  4RAG A;  1UAA A;  3M3Y J;  2LLK A;  3T1B A;  3GZN B;  3BOQ A;  2BE5 F;  2HTJ A;  3ZCO A;  3KCC A;  4IRH A;  4LK0 F;  2VC0 A;  2H8R A;  2NVT J;  4EMS A;  3PO3 J;  3K1M A;  4QWQ A;  4C9Y A;  4L5I A;  3BT9 A;  2A6T A;  5FKO A;  3OYM A;  4OD5 A;  2E1C A;  1E3O C;  2PN6 A;  1YJ9 I;  4HYE A;  2ZME B;  3ON2 A;  4DW6 A;  1FSE A;  2V6E A;  4HDU A;  5K5O A;  2RAS A;  1XS9 A;  1MW7 A;  5FFX A;  1FPQ A;  1XMX A;  3Q3S A;  1KQ9 A;  2JA2 A;  1YRN A;  4KDP A;  2Y30 A;  2QBY A;  1D5Y A;  1WJE A;  1MIJ A;  4DNC A;  1Z21 A;  2LKX A;  2ZSH B;  1ZLJ A;  2ZB9 A;  1VQ6 I;  2ECC A;  3G71 I;  1XGS A;  3FBI B;  3NPI A;  2FBH A;  3S1M J;  1IJW C;  4HLY A;  4ZDO A;  3MN2 A;  4U0V A;  5IY5 H;  4TV7 A;  3ZQL A;  4ZTJ A;  2XAG A;  3AQT A;  3JSJ A;  4KIB A;  2VKE A;  3JRA A;  1WFX A;  1ON2 A;  1SGM A;  2O5R A;  1BM9 A;  5LRR A;  2BYV E;  2YUS A;  3V6G A;  1W36 D;  2HKO A;  1HC8 A;  2GFN A;  1XGN A;  5GPC A;  2EIJ H;  4JX4 A;  2HFH A;  4A5M A;  3QBM A;  3SXY A;  1G2H A;  4M71 A;  4GCT A;  2JA7 J;  3FMR A;  4RM2 A;  4C2T A;  1E3H A;  2MH2 A;  1W5T A;  3ANG A;  5KK1 A;  2REK A;  4Z6Y A;  2R5Y A;  1R1T A;  3KP5 A;  3BRU A;  4PFP A;  4WX9 A;  3IAS 2;  4HOB A;  2IS2 A;  4HF2 A;  3F8B A;  2OPT A;  4B3A A;  1RIO H;  3H9G A;  1HKQ A;  4MTD A;  1VTN C;  4NHJ A;  2DG7 A;  1LDJ A;  4LG3 A;  5FHP A;  2IP2 A;  2R4G A;  3BPV A;  4HQM A;  4C2M J;  4CUG A;  5CVR A;  2LDU A;  3GTK J;  1N25 A;  5DUK A;  5ICF A;  1QHG A;  3AG2 H;  4LFU A;  2X6O A;  2QSF X;  1GHC A;  3FXL A;  4XR6 A;  1O7L A;  2IGM A;  2QF7 A;  3E5Q A;  2HZD A;  4KN7 X;  4RGU A;  4E6K G;  2IW5 A;  4B44 A;  4U9N A;  2IBD A;  3KZY A;  4JKZ A;  4HX8 A;  3O60 A;  2F4O B;  4HNV A;  1KYW A;  1RI7 A;  3KEY A;  4AIH A;  2VIX A;  5D18 A;  1IDY A;  1DPU A;  3S15 J;  4H4K C;  3GEU A;  2LK2 A;  4LJZ F;  2D45 A;  2KFD A;  4AYB A;  2VQH A;  5JHU A;  4CO8 A;  3DTI A;  1G3T A;  2A6E F;  4F92 B;  1R9T J;  2D1V A;  2EH3 A;  4AD9 A;  1OCZ H;  2L2O A;  3G56 A;  1SC7 A;  1IAW A;  2UXO A;  2ICW G;  2EZL A;  1TWC J;  5H20 A;  2CJJ A;  2L54 A;  3VYU B;  5TGT A;  2M4K A;  1R23 A;  4M3E A;  4KIF A;  1ETK A;  1A6I A;  1SMY F;  4NEL A;  2FQ4 A;  1W7P B;  2DLL A;  5J3L A;  1DQU A;  5JVG F;  4A3E J;  1O57 A;  3WTT C;  3AL0 C;  4HRI A;  5CKT A;  2G7U A;  2YX4 A;  4RAZ A;  2GIZ A;  5EEH A;  3FHN A;  3BDD A;  3CC2 I;  1O3R A;  2R7Z J;  1F9N A;  1QPI A;  3G1M A;  3OYI A;  2R93 J;  1IG7 A;  1OYY A;  1UHM A;  1UHW A;  1X1C A;  2MW8 A;  3CP2 A;  4HX4 A;  3GME A;  3AL0 B;  4I76 A;  2IU5 A;  1REP C;  1Z67 A;  2E34 A;  4P1W A;  1TT0 A;  1F36 A;  3AAF A;  3ZQQ A;  3M07 A;  1B6A A;  1O3S A;  5D6E A;  4BGD A;  3BJA A;  1R49 A;  2YVX A;  1GXQ A;  2R7Q A;  2KRH A;  2XAF A;  3VVX A;  3S93 A;  4ESB A;  2X48 A;  3L9F A;  4XSZ F;  1ZQ3 P;  2EFW A;  2JPB A;  2VJ5 A;  4GGG A;  5ICE A;  3ZQF A;  4Y52 J;  2E5N A;  2L9N A;  1B4A A;  3MMY B;  2VOD A;  1IDZ A;  3K8P C;  2RQQ A;  5C4Y A;  3ZN1 A;  3CJR B;  1WVR A;  4FQG A;  1RRJ A;  2QKO A;  2LP0 A;  5IT9 K;  2CUZ A;  3V42 A;  1MH3 A;  1OR7 C;  2CQ7 A;  4U87 A;  4LIT A;  3LST A;  4PZJ A;  3JTH A;  1VQ4 I;  1TNS A;  4GRI A;  2IGK A;  3V8J A;  4ZYD A;  3RZD J;  2AO9 A;  4L5J A;  1FJL A;  2ZOY A;  5FLX Z;  4OIO F;  4BU2 A;  5GAE J;  2Y0M A;  3BP8 A;  3BG5 A;  1IN7 A;  1WSU A;  1LB2 A;  3KYL A;  1U9O A;  2UZK A;  3I4M J;  2DFI A;  4P96 A;  3LSH A;  1FY7 A;  1QZY A;  3HRS A;  2XUB A;  5FRO A;  3W3C A;  2HPM A;  3ERM A;  3DEW A;  3BR1 A;  4KT6 A;  3RKY A;  1J7K A;  4A6D A;  4XQF A;  1KU7 A;  1HSJ A;  3BLY A;  1BJA A;  3VP5 A;  2P5L C;  2XGC A;  2NOG A;  1W7P A;  1MNM C;  1P9Q C;  3NWT A;  3TP3 A;  2R7X A;  3EPZ A;  1SFK A;  2NS7 A;  3IAM 2;  5F0H A;  4ABZ A;  5D4R A;  3WTV C;  1WJC A;  2M8E A;  4GYG A;  2NVX J;  3ABM H;  3B6C A;  3ZMZ A;  5FFZ A;  5KHD A;  2L5Q A;  3HOU J;  3E6C C;  1SD7 A;  3EDP A;  2NRA C;  4I0A A;  5DTD A;  4ZYA A;  4GXO A;  3IKT A;  1POG A;  4UUS B;  5AIQ A;  4Z2Y A;  5DUI A;  4DZJ A;  2BY2 A;  2EB7 A;  3HSR A;  2E1M C;  1HXD A;  1G3Y A;  4FAS D;  4Y17 A;  4XIC A;  1FZP B;  3DEU A;  3KNW A;  4IZZ A;  1PP8 F;  1MKM A;  5K7Z A;  2ZJ2 A;  4Y15 A;  1Y0U A;  4YG2 F;  5M5Y J;  3GTJ J;  2LTP A;  2E1M B;  4R8H A;  1GVJ A;  1T0F C;  2MA3 A;  4OIQ F;  3X2Q H;  5LHH A;  2UXP A;  2W4S A;  3IRQ A;  4J19 A;  1ZAR A;  3ASN H;  2DJN A;  3EYY A;  4CGZ A;  5DD8 A;  3GF2 A;  2ZCM A;  1UJ8 A;  2LSO A;  4IHS A;  5DM7 F;  1YX3 A;  1ZGJ A;  3LMM A;  4JQF A;  5J47 A;  3K4C A;  1UMQ A;  4KMF A;  4BE2 A;  1OR7 A;  5JVT A;  1KGS A;  3K4N A;  4A0X A;  5HSZ A;  1WQ2 A;  1WH7 A;  2CQK A;  1I5Z A;  3T8T A;  2LRE A;  2FBQ A;  3SWH A;  3CTA A;  1SFO J;  5EGO B;  3CWR A;  2K9L A;  1MMD A;  2M0M A;  2QKL B;  4UVA A;  2V1X A;  5KVR A;  2HOS A;  2ELH A;  2F5F A;  4G6Q A;  3HYI A;  2KIQ A;  2LF8 A;  1QQI A;  2V9V A;  2LVS A;  4PGH A;  2FRH A;  4OWR B;  2VUM J;  2EFP A;  3BQZ A;  1ITY A;  4HV5 A;  2FML A;  2L9V A;  2DTZ A;  1S29 A;  1FSH A;  5HAW A;  3PSI A;  1MBE A;  2OUM A;  2DYR H;  2V26 A;  1LNW A;  4ZZD A;  5L3F A;  2BY3 A;  1GUU A;  3OYF A;  1YIO A;  2X6W A;  5KAF C;  1R4M B;  3GX4 X;  4AC0 A;  1IXR C;  2WAF A;  2Z9O A;  1G8X A;  3DBL B;  2G7L A;  4UVB A;  2LOO A;  2DW4 A;  1UB9 A;  3VW1 A;  4JNN A;  3S2W A;  1J9I A;  2PJR B;  2HWV A;  4A3J J;  1T56 A;  2WUI A;  2QYO A;  1ETY A;  3IH4 A;  1QZZ A;  2UXN A;  2MGQ A;  4II2 A;  3V8L A;  4FT8 A;  2E1N A;  3F23 A;  1C0W A;  5F64 A;  4UUS A;  3WTS C;  2LNB A;  4O5V A;  2OER A;  2VI6 A;  2L4A A;  4IRG A;  4LGW A;  5IP9 J;  1PP7 U;  4B4C A;  4OMZ A;  2XVC A;  1YTY A;  2DQR A;  4EM0 B;  2E2I J;  2EZK A;  1NTC A;  2Z3Y A;  3QAH A;  1U8B A;  5DS9 A;  1ETO A;  1CGP A;  4DOZ A;  2KZV A;  2IA1 A;  3OS1 A;  2PFV A;  3LJL A;  5GPA A;  1SMT A;  1ZRD A;  5FLV A;  2QCO A;  1R4N B;  1JGG A;  1OFC X;  3M4O J;  4M6V A;  3QU3 A;  3FX3 A;  4XN0 A;  3ZXS A;  3LA7 A;  3GFM A;  1SD4 A;  5K7H A;  1S7O A;  3U1K A;  3ECO A;  3EUH C;  3FK6 A;  5J40 A;  4ESF A;  4ZDL A;  2ID6 A;  2QZ8 A;  3WE2 A;  1T0F A;  2OZ6 A;  1W4M A;  1L0O C;  1JUP A;  3DLA A;  2VLA A;  1JTX A;  3QP6 A;  3HG9 A;  2GOX B;  2IGO A;  1OCR H;  1IF1 A;  5B3S H;  4L62 A;  1LQ1 A;  3CD6 I;  1XSX A;  2DFE A;  3TOA A;  1W5S A;  3H3V K;  1STZ A;  3DLL F;  1QU3 A;  3TDU C;  4ZYG A;  1HW2 A;  2P5V A;  4G8X A;  2TDX A;  3IH2 A;  3HHH A;  4UNO A;  1W0T A;  4G7Z F;  5EGO A;  1G3S A;  4HNU A;  2R3S A;  4A3K J;  1LVA A;  1Y56 A;  2EV0 A;  3KIO A;  4FIS A;  3V4G A;  2F4M B;  3LAP A;  3V8K A;  5A2Q Z;  3QU6 A;  1MDM B;  4BXU A;  4CZZ A;  3DKX A;  2P7C B;  2UXH A;  4EM2 A;  2G9W A;  4CCN A;  2FNP A;  4NC6 A;  2EV5 A;  3HSF A;  1SAN A;  1FNN A;  1TWH J;  1QZE A;  3O2P E;  4P9F A;  3L2V A;  9ANT A;  1E3P A;  1IRG A;  3D5R C;  4AVP A;  3K9T A;  3BR0 A;  4XLC A;  2V57 A;  2V6C A;  4V2G A;  3IV5 A;  4C3J J;  2NXN B;  5IYB J;  1KU3 A;  2IS4 A;  2MSY A;  3FF5 A;  2CFX A;  5F0F A;  5IP6 A;  1FBU A;  5F0C A;  1K7A A;  2HDD A;  2PJR A;  4PUS A;  1P4W A;  1NK3 P;  5DEQ A;  2WTE A;  1T98 A;  3ZRG A;  1ZK8 A;  2BGC A;  1JT0 A;  2QIB A;  1I27 A;  4BHC A;  1SEU A;  2FF4 A;  2ZXJ A;  3LSJ A;  3J80 Z;  2IGN A;  4IHT A;  3SDG A;  1V5F A;  4HF1 A;  2DYS H;  4I09 A;  3SQN A;  5GTH C;  2HVR A;  4UHT A;  3ON4 A;  2HQR A;  3KP7 A;  1G59 A;  4C2U A;  4JX5 A;  3HE0 A;  4R1H A;  2OF7 A;  3I71 A;  1P4X A;  3J7A Y;  2FA5 A;  5HLH A;  1TTY A;  2W53 A;  2EZI A;  4PGG A;  1FMV A;  2M9H A;  2M4G A;  1IXC A;  4MQ9 F;  2FOW A;  2DFH A;  2B7E A;  2XV4 S;  4KIG A;  1XSV A;  2O03 A;  5DYM A;  3P9T A;  2JSC A;  4BY7 J;  4BY1 J;  3OOP A;  2MG4 A;  2V9K A;  4ZYH A;  3WHB A;  5BPI A;  1X1B A;  3BQY A;  2VB6 A;  4WXH A;  1T39 A;  2MH9 A;  2QQ8 A;  3R4K A;  1DP3 A;  3EUH A;  3GYH X;  4A0Z A;  1PYV A;  4E7I A;  5FRN A;  2OA4 A;  3GCM A;  2F5D A;  2W82 A;  1SD5 A;  2AQF A;  2KHM A;  2H27 A;  4IEJ A;  1X1P A;  2CMP A;  2EWN A;  4I02 A;  2B63 J;  2VJJ A;  5E8I A;  3HC7 A;  5D5V B;  2LKS A;  2UXX A;  5LHI A;  3CC4 I;  3CUQ C;  3DWL E;  1JKP C;  1KA8 A;  4KA4 A;  5LEJ A;  1TC3 C;  2CW0 F;  1DGR M;  1W36 C;  2VBX A;  3WGH A;  1D8K A;  3CUQ B;  2DI3 A;  2JPC A;  5JHF A;  1MSE C;  2CV1 A;  2NS0 A;  3TW7 A;  4KIT B;  3BCA A;  3CMA I;  4IF4 A;  5CVJ A;  3BC8 A;  1R71 A;  1QNT A;  1HLV A;  1ZLK A;  4OOI A;  5D6F A;  4MFD A;  4M3B A;  1HKT A;  4RB0 A;  2L0K A;  1V3F A;  4OU0 A;  5EZH A;  5LEK A;  2A61 A;  3VOE A;  3CME I;  3CCJ I;  3VOK A;  4PCQ A;  4IVN A;  3DKW A;  4OAY A;  2KDZ A;  3S3O A;  4BDY A;  3HTA A;  1BJZ A;  2VBW A;  3P5J A;  4HNT A;  3F3X A;  1IW7 F;  4K2E A;  1XSD A;  2CQQ A;  4KIC A;  3CCM I;  2G7H A;  2QVO A;  5GTI C;  3TQN A;  1V5E A;  1T33 A;  2KJB A;  2KL4 A;  1FP2 A;  4A12 A;  3HSE A;  3DKY A;  2KMU A;  4G6D A;  4MNU A;  2D5V A;  4JL3 A;  1Z1D A;  2PEX A;  3L2Q A;  3WTY C;  4LD5 A;  4A0Y A;  4KIS A;  3A2K A;  5EJC A;  3TL4 X;  5D4S A;  4AYB N;  4AID A;  1TQI A;  3COA C;  2STW A;  5L3B A;  4B48 A;  1I6X A;  2RC4 A;  1OQY A;  4BL0 B;  2CYY A;  2E1O A;  3BR6 A;  4L0Z B;  1LPQ A;  1WJA A;  3A4C A;  1YG2 A;  3MKY B;  3EYI A;  2X6Y A;  3CF2 A;  3HUG B;  1Z05 A;  4IHV A;  2IJL A;  2N8G A;  2XSD C;  2HI3 A;  3HOY J;  3OYD A;  5K7F A;  2OV7 A;  2O0Y A;  2Z1D A;  4BAY A;  4XKB A;  3PNY A;  4FE7 A;  2V1N A;  3NRV A;  2XRN A;  3I4N J;  4DBR A;  3TED A;  4BH9 A;  1WJD A;  4M3F A;  4Y7N J;  4ZZL A;  4WK8 F;  2KIU A;  5JI6 A;  3QOD A;  2CV2 A;  3C2G A;  1D8J A;  2BXZ A;  4LLL A;  1DPR A;  2X51 A;  4GYI A;  3F9K A;  3BTI A;  3K4M A;  2CQX A;  2R7D A;  1ERD A;  1BI1 A;  3IUV A;  1XCB A;  3OS2 A;  2QSH X;  2EFO A;  3LFU A;  2B9S A;  1R7J A;  1MGT A;  3KPH A;  1ZEL A;  2ZJP F;  2AXL A;  3E6M A;  3IRR A;  4KYW A;  3CUQ A;  2DPU A;  2DCE A;  3N05 A;  5E20 A;  5D19 A;  2JK3 A;  4UB8 C;  4JYK A;  5CVI A;  2GLO A;  4XLP F;  3DFG A;  5CXI A;  4BDZ A;  3IWF A;  3K1N A;  4O6J A;  5K5Q A;  3K4J A;  2BVL A;  5CPR B;  1LFB A;  2HPI A;  3PIP F;  3RQI A;  1V55 H;  4U88 A;  3LNQ A;  5HDG A;  3ML6 A;  1JKR C;  2H6B A;  3OYL A;  3WTU C;  4L9N A;  5LBQ A;  2R7S A;  1JHH A;  2COM A;  3A03 A;  1GVD A;  3C1D A;  3CZ6 A;  3ZOB A;  2DK8 A;  1Y8R B;  2CU7 A;  2FE3 A;  1FT9 A;  4I0B A;  4H0E A;  4BKX A;  3KP4 A;  4HBL A;  1SFE A;  3H0D A;  3I3L A;  2WGB A;  2QWT A;  4OIR F;  4ENK A;  3RH2 A;  2LF7 A;  5EEA A;  5ILV A;  1W5C C;  4IKF A;  4Y3O A;  1D1B A;  2JMW A;  4FHT A;  4BJ5 C;  5D5W B;  1T2K A;  1HBX G;  4EAT A;  2L7Z A;  1OCP A;  4JOM A;  2KRC A;  2QM3 A;  5FD5 A;  2ME6 A;  2DMN A;  2IA2 A;  3O6B B;  3LSK A;  3PQK A;  1F4K A;  5ICC A;  3DTK A;  2R5Z B;  3ZMV A;  2GWR A;  3OYB A;  1R1U A;  2AHQ A;  1Z6R A;  1EV7 A;  3TKY A;  2XDN A;  1MH4 A;  2P4W A;  3BZK A;  3HUG A;  5M5X J;  1EH8 A;  1G6N A;  5CJ9 A;  5HOO A;  5E79 C;  3CCS I;  3V7C A;  1JE8 A;  2LBF B;  5BMZ A;  4EM1 A;  2PMU A;  3LAJ A;  3A0B C;  4YFK F;  3EUA A;  3DCF A;  3FXR A;  3M1E A;  1FWZ A;  3RI4 A;  4GCV A;  5CQE A;  1VQ8 I;  4A3I J;  4ENM A;  3CO7 C;  1YE9 A;  1HCR A;  1U0J A;  4BQO A;  3U2R A;  2X85 A;  1K4T A;  1IN8 A;  4II3 A;  1LJ9 A;  4PJM A;  4U7B A;  4LMY A;  2G7S A;  5HS7 A;  4BBR J;  4V2F A;  2O3F A;  1J75 A;  4UDS A;  2CUJ A;  4W97 A;  4LIU A;  1IO2 A;  1YI2 I;  2G7G A;  1K83 J;  2WBM A;  4ENJ A;  1RR8 C;  4WIB A;  4QTR A;  1GT0 C;  4AF5 A;  2A05 A;  2L7F P;  3K4K A;  4EGZ A;  4UV8 A;  3SFZ A;  1YHQ I;  3HKZ N;  2KIF A;  3M8F A;  2K85 A;  3L2R A;  1TP4 A;  4UVC A;  1Z77 A;  1ZKG A;  2RNJ A;  4CXF A;  3HTI A;  4UUT A;  4DJA A;  1BW6 A;  2JN6 A;  1KZH A;  3ZR8 X;  2DA7 A;  3HTJ A;  2GA2 A;  4D1Q A;  4BQQ A;  1WJ5 A;  4HG2 A;  4ZJZ A;  3VWB A;  4RB3 C;  4D7M A;  3MCZ A;  2EFN A;  2HGC A;  2FOK A;  1MD0 A;  3CJT B;  3GZ5 A;  2EJR A;  3LOC A;  4E7J A;  4DYR A;  3RPU A;  4RB2 C;  3E5X A;  2XB0 X;  3P9K A;  1LDD A;  2V1D A;  2ZNY A;  3AFH A;  2JVG A;  1S72 I;  4IRV A;  2Z33 A;  2BVM A;  1Z6T A;  3BCG A;  1ENH A;  2J5P A;  3HGY A;  1FTZ A;  1D1C A;  2NP5 A;  3EUP A;  1B9M A;  4XRM A;  3S3M A;  4GFK A;  3FDY A;  1J5Y A;  3RTR A;  5DCF A;  1WI3 A;  1LE8 B;  4KFC A;  2QSG X;  3VPR A;  3FWE A;  1UEL B;  2PX9 A;  4OAZ A;  4J01 A;  3FRQ A;  3E5U A;  3RYP A;  3GZI A;  2R5Z A;  3G3Z A;  3MKL A;  1ZRE A;  4U0Y A;  1BI0 A;  2YVE A;  3BCB A;  5LLQ A;  1VQ9 I;  3TMO A;  2JA6 J;  1ETQ A;  1UI5 A;  2ACJ A;  2VXZ A;  3LFK A;  1D1A A;  4XLE A;  2JA5 J;  1WH5 A;  2DXI A;  5DAJ A;  4L9V A;  1H8A C;  4KNY A;  3PJR A;  2LBF A;  1A35 A;  2MLG A;  2VKV A;  5FGM A;  2PZ9 A;  2EQR A;  2ZXI A;  2GXG A;  3BG9 A;  4OIP F;  3ANP A;  4BQA A;  1I1G A;  2W24 A;  4BNC A;  2NP3 A;  3G1O A;  1IRZ A;  3KE2 A;  2VT2 A;  4CH7 A;  4MO7 A;  4EJV A;  3CF5 F;  3PNT A;  5E1X A;  3GBG A;  1APL C;  1U5T C;  3CCL I;  2ZCN A;  1XMK A;  4PXI A;  1I39 A;  4KJZ A;  1JTY A;  1OYW A;  2HYT A;  2DO7 A;  5J1R A;  3TW6 A;  3WGG A;  2V9P A;  3MQ0 A;  4Y33 A;  1A04 A;  1U5T B;  3L09 A;  5BOX A;  1ZR4 A;  3E7Q A;  2XSJ C;  3HDD A;  2IAI A;  3HM5 A;  3PSF A;  1GV2 A;  2VJ4 A;  2HOE A;  2FNA A;  4QLC U;  2KZG A;  3GWZ A;  4HV6 A;  1X3Z B;  2IPQ X;  5FLX K;  1MSF C;  2DMP A;  2K9Q A;  3ZMS A;  4L0Y B;  2E19 A;  3RPU D;  1IGN A;  3UNG C;  4CYD A;  3W6J B;  4RB1 A;  2CUF A;  2K40 A;  2QOP A;  1XC5 A;  2HNH A;  5H2F C;  4E7Z A;  4E7L A;  5LGU A;  3KYD B;  2NAZ A;  1S7A A;  3ZP5 A;  3S5R A;  3JR9 A;  2ZJR F;  2NS8 A;  1I3A A;  4IRI A;  1VQ7 I;  2R7W A;  1OCT C;  1RES A;  3ABK H;  3ISP A;  4AU7 A;  4Q48 A;  2K3F A;  1HDP A;  3P9I A;  3O3K A;  1VQO I;  2VON A;  1TT5 B;  3JRG A;  3DU5 A;  1V4R A;  4HA8 A; 
#chains in the Genus database with same CATH homology
 3CCY A;  4IHY A;  2MGQ A;  2UXU A;  1LE8 A;  4UUS A;  3S14 J;  2OER A;  1RR7 A;  3GTP J;  3S16 J;  2VI6 A;  1BW5 A;  5IP9 J;  2HYJ A;  1UHS A;  2Y9Y A;  4B4C A;  1IC8 A;  1AU7 A;  3BTJ A;  3OSF A;  2E2I J;  2EZK A;  1NTC A;  1U8B A;  5DS9 A;  1ETO A;  5F08 A;  5BNG A;  1B8I A;  2Y31 A;  1HDD C;  2E2J J;  3LJL A;  5GPA A;  5FLV A;  2QCO A;  1JGG A;  4M3G A;  1OFC X;  3M4O J;  3BNI A;  4M6V A;  2YU9 J;  4MXM A;  1UG2 A;  2JJ7 A;  1FIP A;  2GUH A;  1LFU P;  2XPU A;  4AC6 A;  2M8G X;  1PUF A;  3BG3 A;  5K7H A;  5EF6 A;  3BHQ A;  3FK6 A;  1ETX A;  1RPW A;  2ID6 A;  3HOW J;  1A5J A;  2Q24 A;  4CGR A;  1GDT A;  4XID A;  1JUP A;  4A3B J;  5AQC A;  1JTX A;  3JRB A;  3VW2 A;  4L62 A;  2LD5 A;  4ICH A;  3H3V K;  1I6H J;  3IH2 A;  1QRY A;  3KKD A;  4QSH A;  1W0T A;  5EGO A;  3KZ9 A;  1VND A;  3HOV J;  4A3K J;  5EG0 A;  1I50 J;  4FIS A;  4GFB A;  1YRN B;  1WCM J;  3BTL A;  2O9L A;  1X58 A;  2Y0S N;  4C3I J;  4ACI A;  2UXH A;  5J1U A;  5EDN A;  5C3E J;  3S1N J;  1WGX A;  3BTC A;  5E3N A;  4MIM A;  4I6Z A;  4BXX J;  5FGL A;  3JRD A;  1B8I B;  1SAN A;  3HBL A;  1TWH J;  5IP7 J;  3JRC A;  2DA2 A;  2ZCX A;  1X2M A;  9ANT A;  2WV1 A;  5EFY A;  2XPW A;  3MVP A;  4RBO A;  2M2E A;  1ORK A;  4FE4 A;  3BR0 A;  2V57 A;  4C3H J;  4V2G A;  3IV5 A;  3SJM A;  4C3J J;  3WHC A;  5IYB J;  5CW8 A;  3BR5 A;  3CQZ J;  2HXO A;  2MSY A;  5F0F A;  5IP6 A;  1B72 A;  4FTH A;  2TCT A;  5F0C A;  2HDD A;  4JX6 A;  1NK3 P;  2DMQ A;  1ZK8 A;  2M0C A;  1JT0 A;  1MBK A;  2QIB A;  4D7N A;  2ZOZ A;  3LSJ A;  3SDG A;  2WAQ N;  3GTO J;  2GEN A;  1MBF A;  4GCL A;  3ON4 A;  2YS9 A;  2NX4 A;  1P7I A;  3QPS A;  2E2H J;  4A3D J;  4JX5 A;  3S1R J;  3QPL A;  2R5Y B;  3HE0 A;  2OF7 A;  3F1B A;  1FEX A;  2H1K A;  4XRS A;  5IYD J;  2W53 A;  2EZI A;  1ZTR A;  2O7O A;  2WB1 N;  3EGQ A;  2M9H A;  2KT0 A;  3HOZ J;  2K9N A;  1JKQ C;  3M3Y J;  2LLK A;  3P9T A;  3BR2 A;  4BY7 J;  4BY1 J;  4G12 A;  5E3M A;  2ELK A;  2MG4 A;  3B81 A;  3WHB A;  2H8R A;  2NVT J;  3BQY A;  3JRF A;  5M3F J;  5JLX A;  2RHA A;  4HKU A;  3PO3 J;  3BT9 A;  3A01 B;  5FKO A;  2M34 A;  1E3O C;  3RKQ A;  4IEJ A;  2B63 J;  2XGE A;  3ON2 A;  4DZP A;  3S2D J;  4DW6 A;  1IUF A;  2Y2Z A;  1QVU A;  5M3M J;  5M5W J;  5EYR A;  2LFB A;  2RAS A;  1JKP C;  1XS9 A;  3Q3S A;  3LHQ A;  1TC3 C;  1F43 A;  2NVY J;  1YRN A;  1JKO C;  4KWA A;  2Y30 A;  2IEK A;  1D5Y A;  4A3C J;  1MSE C;  2COB A;  4A69 C;  3TW7 A;  1IV6 A;  2LKX A;  3ZQC A;  2ZB9 A;  2ECC A;  3NPI A;  1HLV A;  2DA5 A;  5CXG A;  4MFD A;  3S1M J;  4M3B A;  1IJW C;  2L0K A;  3MN2 A;  5EZH A;  1MBG A;  2PMZ N;  3ZQL A;  4FCY A;  3VOK A;  1K61 A;  2KDZ A;  3AQT A;  1BL0 A;  5IPA A;  3HTA A;  1BJZ A;  2VKE A;  1VI0 A;  3JSJ A;  2R0Q C;  3JRA A;  1SGM A;  3VUQ A;  4XRS G;  1XG1 A;  2CQQ A;  2JWT A;  3V6G A;  2YUS A;  4YZE A;  1JJ6 C;  1T33 A;  2GFN A;  5HOD A;  5GPC A;  4JX4 A;  1ZR2 A;  3QBM A;  2LY9 A;  1G2H A;  1WPK A;  2D5V A;  4JL3 A;  4BBS J;  1TWF J;  3VW0 A;  4GCT A;  4AUX A;  1Y1W J;  2JA7 J;  3C07 A;  3HB9 A;  4M3D A;  2Y9Z A;  3BR3 A;  3ANG A;  2I10 A;  2REK A;  2R5Y A;  4GCK A;  1QVT A;  4AYB N;  3S1Q J;  3OSG A;  2P81 A;  3S17 J;  3NI7 A;  2OPT A;  4B3A A;  2E1O A;  3BR6 A;  3OOU A;  5FJ8 J;  5C4X J;  2EZH A;  2DG7 A;  3CMY A;  5FHP A;  3VVZ A;  3LSG A;  1Z0X A;  4C2M J;  4IHV A;  2N8G A;  2XSD C;  2HI3 A;  5IOZ A;  3HOY J;  3NAU A;  5K7F A;  3GTK J;  1W0U A;  3MNL A;  3PAS A;  4A3L J;  2X6O A;  4FE7 A;  2O8K A;  3A01 A;  3I4N J;  3TED A;  4Y7N J;  5D18 A;  4M3F A;  2QF7 A;  1EF4 A;  3ZQI A;  5H9T A;  3H0G J;  2IBD A;  4JKZ A;  5IYC J;  3O60 A;  3LWJ A;  4QIW N;  4HNV A;  1FTT A;  3NXC A;  1I3Q J;  5FKN A;  3BTI A;  2CQX A;  2HKU A;  1IDY A;  3S15 J;  3IUV A;  4ME9 A;  3GEU A;  2LK2 A;  5F1J A;  2L7M P;  2TRT A;  3G7R A;  1DU6 A;  3LSP A;  4X1E A;  2OI8 A;  1R9T J;  4MLO A;  2XB5 A;  5D19 A;  2JK3 A;  4JYK A;  2EH3 A;  5F27 A;  2GLO A;  5F04 A;  3PPB A;  1X2N A;  3SFI A;  3G56 A;  2ME0 A;  1BA5 A;  4D5F A;  2UXO A;  5CXI A;  2EZL A;  1FIA A;  4EEF G;  1TWC J;  2O7T A;  2CJJ A;  2DA1 A;  2ECB A;  1LFB A;  3HIM A;  2FD5 A;  3RQI A;  3LNQ A;  4GFL A;  3V78 A;  4M3E A;  1A6I A;  1U9N A;  1ETK A;  1JKR C;  4NEL A;  2FQ4 A;  5J3L A;  1MBJ A;  3A03 A;  1GVD A;  4A3E J;  3ZOB A;  2PBX A;  3Q0V A;  2CU7 A;  1Q1V A;  5FKL A;  3UKG A;  3VVY A;  4RDU A;  4BKX A;  1UI6 A;  3VIB A;  1VF9 A;  3W6V A;  2R7Z J;  1QPI A;  4DYC A;  2WGB A;  2QWT A;  1S7E A;  1U78 A;  3G1M A;  2ID3 A;  2R93 J;  1IG7 A;  3RH2 A;  5EEA A;  2MW8 A;  2GM4 A;  2VPR A;  3GTM J;  4I76 A;  2JMW A;  2IU5 A;  3G1L A;  4X6A J;  3CRJ A;  1JUS A;  1F36 A;  2L7Z A;  2YVH A;  1OCP A;  3QQA A;  1RKT A;  5C4J J;  3PM1 A;  2ME6 A;  2DMN A;  3Q0W A;  3VVX A;  2R5Z B;  2X48 A;  1O4X A;  3S2H J;  2AHQ A;  3A02 A;  1ZQ3 P;  3HEF A;  2XDN A;  3B6A A;  3ZQF A;  3ZQH A;  4Y52 J;  1MH4 A;  4B1R A;  1VFC A;  3FK7 A;  5M5X J;  4IHW A;  4CYC A;  1IDZ A;  1TWA J;  3E7L A;  5C4Y A;  3FKI J;  5IOY A;  2QKO A;  2DMU A;  2LP0 A;  2HOA A;  3COL A;  3DCF A;  1MH3 A;  5C44 J;  3K2A A;  3NNR A;  5FMP A;  1HF0 A;  4A3I J;  1HCR A;  3HGG A;  3RZD J;  2AO9 A;  2FJ1 A;  4A3M J;  1FJL A;  1Y1V J;  2ZOY A;  4W1U A;  2UXI A;  2G7S A;  2K9S A;  4V2F A;  4BBR J;  4UDS A;  2DA4 A;  4W97 A;  3BG5 A;  2G7G A;  1K83 J;  4MFE A;  3O8G A;  3LSR A;  1U9O A;  3I4M J;  4QTR A;  1GT0 C;  3FIS A;  4AF5 A;  4DYQ A;  2L7F P;  4LOC A;  3HKZ N;  5E3O A;  5FLM J;  3RD3 A;  2XGD A;  1Z77 A;  1ZKG A;  3DEW A;  3BR1 A;  2F07 A;  3HTI A;  5D1R A;  4UUT A;  2DN0 A;  1AKH B;  3VP5 A;  1BW6 A;  2JN6 A;  3O8H A;  2XGC A;  2DA7 A;  3HTJ A;  5HBU A;  2NOG A;  2CRG A;  1MNM C;  4A93 J;  5K58 A;  1ETV A;  3TP3 A;  3OIO A;  4D7M A;  2HQ5 A;  1AHD P;  3GTL J;  4MK6 A;  2JA8 J;  3LOC A;  2NS7 A;  4CYC B;  3GTQ J;  4DYR A;  3TP0 A;  2DA6 A;  1ETW A;  2XB0 X;  5F0H A;  4ABZ A;  2EBI A;  2NVX J;  3B6C A;  3KKC A;  2HXI A;  5J1Y A;  3HOU J;  3BCG A;  3NAR A;  1ENH A;  3HGY A;  1FTZ A;  3EUP A;  2NP5 A;  4GFK A;  4XRM A;  1CQT A;  1ZGW A;  1WI3 A;  5DTD A;  1LE8 B;  1POG A;  4UUS B;  1MBH A;  3JRE A;  5EZG A;  3VPR A;  4DZJ A;  4S0H B;  3L1P A;  1NK2 P;  3AQS A;  2G0E A;  1JJ8 C;  1RKW A;  4L5E A;  2X9D A;  3FRQ A;  3GZI A;  3JRH A;  2R5Z A;  3MKL A;  4XIC A;  2YVE A;  4D5C A;  3KNW A;  1JUM A;  3HTH A;  5K7Z A;  1DU0 A;  2NVQ J;  2JA6 J;  3GTJ J;  1H88 C;  1ETQ A;  5M5Y J;  3CJD A;  5FKM A;  1UI5 A;  2LTP A;  2JA5 J;  2QTQ A;  1WH5 A;  2HOT A;  5DAJ A;  1H8A C;  2UXP A;  4NDL A;  4J19 A;  2VKV A;  1PUF B;  5FKK A;  2PZ9 A;  1TWG J;  2EQR A;  2DJN A;  4IHX A;  1HOM A;  3BG9 A;  3ANP A;  4NN1 A;  2NP3 A;  3G1O A;  3ZQG A;  3HOX J;  1IRZ A;  2ZCM A;  4MO7 A;  5JLW A;  2D6Y A;  2DA3 A;  3F0C A;  3K7A J;  3GBG A;  1APL C;  1OJL A;  2ZCN A;  1UMQ A;  3D1N I;  3GTG J;  3DPJ A;  4PXI A;  1JTY A;  2HYT A;  3PO2 J;  2DG8 A;  5J1R A;  2XPV A;  3BRU A;  5HSZ A;  5E3L A;  1WH7 A;  3FIW A;  3TW6 A;  2CUE A;  1ZR4 A;  3E7Q A;  2L9R A;  3IH3 A;  2FBQ A;  2GBY A;  3HDD A;  2IAI A;  3HM5 A;  3C2B A;  1SFO J;  1RET A;  1GV2 A;  5EGO B;  3CWR A;  4JP0 A;  2HOS A;  1JT6 A;  1GV5 A;  3JRI A;  5EG0 B;  4A3G J;  3BJB A;  1MSF C;  2DMP A;  2K9Q A;  2LVS A;  2E19 A;  2LR8 A;  3Q0U A;  1AKH A;  1IGN A;  2VUM J;  3BQZ A;  1ITY A;  2CUF A;  2K40 A;  5GP9 A;  2DMT A;  2DTZ A;  2QOP A;  5HAW A;  1XC5 A;  3VOX A;  1MBE A;  1P7J A;  2FX0 A;  2XRL A;  1GUU A;  3CDL A;  3S5R A;  3JR9 A;  2NS8 A;  1H89 C;  4AC0 A;  2R92 J;  2RAE A;  3NRG A;  4XK4 A;  3T6N A;  1OCT C;  1RES A;  2G7L A;  1HDP A;  2W48 A;  3QKX A;  2G3B A;  3JRG A;  3VW1 A;  3RZO J;  4JNN A;  1B72 B;  4A3J J;  1T56 A;  2WUI A;  3IH4 A;  1ETY A;  4A3F J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...