3BR3A

Crystal structure of the complex of ethidium bound to qacr(e90q), a mutant of a multidrug binding transcriptional repressor
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
185
structure length
185
Chain Sequence
LKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKSEQIKAKTNREKFYLYNELSLTTQYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Formal electrostatic interactions do not govern QacR-cation affinity
rcsb
source organism Staphylococcus aureus
molecule tags Transcription
molecule keywords HTH-type transcriptional regulator qacR
total genus 76
structure length 185
sequence length 185
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3br3A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3br3A02
3JSJA 1MH4A 2UXHA 2VI6A 3T6NA 1HLVA 4XK4A 4M3BA 5H9TA 2L7MP 4EEFG 1LFBA 2R5ZB 2RHAA 1JKOC 1OCTC 1GT0C 3HKZN 3JRCA 2FQ4A 3IH3A 3TEDA 3G1OA 3QPSA 2PZ9A 2JK3A 3HDDA 1ZTRA 3HM5A 5DTDA 2MGQA 3JR9A 5EGOB 3I4NJ 1U9NA 3DCFA 2OERA 5EG0B 5CXIA 1NTCA 3MVPA 3QQAA 1IV6A 3NRGA 3BTLA 2XB0X 2R7ZJ 3VVZA 3P9TA 4HNVA 3CMYA 4KWAA 3HGYA 1ORKA 2G0EA 1MNMC 2HOTA 1Z0XA 2DA4A 5J1YA 3PM1A 3KKCA 2LLKA 4D5FA 3HOZJ 1HCRA 3MN2A 3F1BA 2ID6A 5JLWA 3VVXA 2CUEA 3QBMA 2RASA 2E2HJ 3G7RA 2E1OA 3GBGA 1FTTA 2E2IJ 2MW8A 3ON2A 1RKWA 4DW6A 2JA8J 5K7ZA 5EDNA 3JRGA 5IP7J 4J19A 2HXIA 4A93J 2QTQA 3NXCA 1ITYA 1AHDP 3S16J 4UUTA 1MBEA 2DMTA 3NNRA 1QVUA 2HQ5A 1X58A 3RKQA 2K9NA 2X9DA 3BG9A 3S5RA 3FK7A 1W0UA 3S2DJ 3QKXA 1Y1WJ 4BY7J 1GV2A 2KDZA 4GCKA 1JKRC 2ELKA 4BY1J 5CXGA 3JRIA 4W1UA 4CYCA 1MSEC 2ZCMA 1WI3A 2M2EA 5GPAA 4A3FJ 4DYQA 2DA7A 4DYCA 2RAEA 2NS7A 2VKVA 5IYCJ 2E19A 3S1RJ 1NK2P 4A3DJ 4FE7A 1IRZA 2NP5A 2HOSA 4M3EA 1ETOA 5D18A 1ZR2A 5F27A 4ICHA 4UDSA 3EGQA 3ZQHA 1HDDC 1U8BA 3IV5A 3ON4A 4UUSB 2K9QA 1FIPA 1PUFA 5EFYA 4GFBA 4Y7NJ 1IDZA 1WCMJ 5IOYA 4RDUA 1JKPC 1P7JA 1JT6A 5D1RA 2HYJA 3A02A 4NN1A 4XIDA 1K83J 1T56A 5IOZA 5GPCA 4GCLA 1F43A 3VIBA 5F0FA 2HXOA 5K7FA 3Q0VA 3TP3A 4IHVA 4GFLA 1O4XA 1JJ6C 1MBKA 2Y9ZA 2L7ZA 4A3KJ 3GEUA 2UXOA 5FKLA 1GV5A 2YVEA 2HDDA 4V2GA 3CRJA 4DZJA 5HAWA 5F04A 4QSHA 3WHCA 2H8RA 3VW1A 1X2MA 3GTLJ 2M8GX 2R5ZA 1OFCX 3CDLA 2YU9J 2DTZA 1MBHA 4LOCA 4PXIA 5AQCA 5F1JA 1VF9A 1ETWA 2G7LA 3VOXA 1BW5A 3VVYA 1IJWC 4AF5A 2O7OA 4YZEA 4FTHA 1EF4A 4DZPA 3KKDA 3EUPA 2B63J 1ZGWA 4JYKA 3H3VK 2DMQA 3ZQFA 4D7NA 1RESA 2UXUA 2NVTJ 2EH3A 2P81A 5FJ8J 2E2JJ 2L9RA 1TWGJ 1S7EA 3TW7A 2EZLA 1LE8B 3BQYA 3NARA 5J1RA 3FKIJ 1TWFJ 1H88C 3HOYJ 4CYCB 2R92J 1JKQC 2UXPA 3O8HA 4JP0A 2R5YA 1B8IB 3ANGA 1E3OC 3LSPA 3S1QJ 3VP5A 1A6IA 4B4CA 1FTZA 3A01B 4A3JJ 4AC0A 1JUSA 2VPRA 3NAUA 3GTKJ 1MBFA 3HEFA 2ECBA 3MNLA 1GDTA 1IG7A 5K7HA 1QRYA 5HSZA 4JKZA 2ME0A 5F0HA 4XRSA 2FX0A 3M3YJ 2GBYA 1IUFA 3RQIA 3NPIA 2ZB9A 5FLVA 2QKOA 3BHQA 3JREA 4ME9A 5DAJA 2MG4A 1QVTA 3GTGJ 3HOXJ 2XRLA 3BCGA 3VW2A 1HDPA 1Q1VA 5FKKA 3BR0A 2TRTA 5M3MJ 4IHYA 2Y31A 1WPKA 4W97A 1XS9A 3BJBA 2EBIA 5GP9A 3L1PA 1RPWA 3ANPA 5IP9J 1ETYA 2G3BA 3KNWA 3JRHA 5CW8A 5IYBJ 4BXXJ 4MXMA 1CQTA 4IHXA 3ZQGA 1FEXA 1MBGA 2IBDA 3GTOJ 5C4JJ 1D5YA 2LD5A 2R93J 1ETXA 1XC5A 5M3FJ 4I6ZA 3A03A 1OCPA 3F0CA 3VPRA 4BBSJ 5HODA 2L0KA 2LTPA 2K40A 2DA2A 5M5XJ 4A3LJ 3IUVA 4BKXA 3IH2A 1TWCJ 2I10A 1IGNA 3CQZJ 5FMPA 2ZCNA 2Q24A 3LWJA 4NELA 2JA6J 5EGOA 3OOUA 2LFBA 2OPTA 3HBLA 3VOKA 2W53A 2HKUA 3E7LA 4JX5A 3GTJJ 3SDGA 2NVXJ 3AQSA 3NI7A 2DMUA 3GTQJ 2UXIA 3PPBA 2QWTA 2Y0SN 1IDYA 1ZQ3P 4A3GJ 3V6GA 2NVYJ 3RZOJ 1VFCA 2WV1A 1I3QJ 2NP3A 4A3CJ 1JUMA 4MFDA 4B3AA 1RKTA 1I6HJ 1SANA 1MH3A 1NK3P 1AU7A 3BR5A 3TP0A 2N8GA 3LHQA 2M0CA 1YRNA 2WB1N 5F08A 3LOCA 4FE4A 3FISA 2EQRA 5FLMJ 2QF7A 4MK6A 1TWHJ 1JT0A 5EEAA 3CWRA 1WH7A 2GUHA 3BR1A 3BQZA 3JRDA 4MIMA 2LR8A 2F07A 3A01A 3HTIA 1ETQA 2DN0A 2G7SA 2XGCA 1UMQA 3S17J 2Y9YA 3BR6A 1B8IA 5FHPA 4L62A 1VNDA 2V57A 2D6YA 3RZDJ 2XDNA 4C2MJ 4M3GA 3S2HJ 2LKXA 2YVHA 3VUQA 4XRSG 3ZQCA 2X48A 3ZOBA 2EZIA 2DG8A 5HBUA 2REKA 1H89C 3H0GJ 2M9HA 1JTYA 4BBRJ 4JX4A 5EZHA 5K58A 2EZHA 4JL3A 1B72B 4IHWA 3OSGA 4A3MJ 3HOUJ 3QPLA 1A5JA 5BNGA 3CJDA 2QIBA 2GLOA 4A3IJ 1HF0A 5E3OA 1X2NA 4QTRA 3G56A 2O9LA 3PO3J 4FCYA 3M4OJ 2AHQA 1OJLA 3S1MJ 1GUUA 5FGLA 2LP0A 3LJLA 5J1UA 3LSRA 3B6CA 3LSGA 3HTHA 4I76A 3SJMA 1UG2A 5J3LA 3JRAA 3E7QA 2LY9A 4M3FA 5M5WJ 3COLA 2IEKA 2JMWA 4M3DA 1ENHA 1LFUP 5JLXA 1AKHA 1MBJA 3CCYA 3GTPJ 1BW6A 3FRQA 3I4MJ 4Y52J 3LSJA 2CQXA 1UHSA 1VI0A 3GTMJ 2DA3A 3K7AJ 5M5YJ 3ZQLA 5EYRA 3SFIA 1DU6A 5IP6A 3OIOA 1Y1VJ 1BJZA 3DEWA 2DA6A 5FKMA 2G7GA 5E3NA 2DJNA 5EZGA 1UI5A 2ZOYA 1XG1A 1U9OA 1MSFC 3O8GA 4XRMA 2LVSA 2HI3A 3BTIA 2O8KA 4FISA 2WAQN 1SGMA 4ACIA 4X1EA 4IEJA 3HE0A 2ME6A 4GFKA 1TWAJ 1U78A 1ETVA 2K9SA 4XICA 3BR2A 5EG0A 3VW0A 3BTCA 2NX4A 3JRBA 3S1NJ 1QPIA 3HOVJ 3S15J 5IPAA 3BNIA 2Y2ZA 2DA5A 1H8AC 2FJ1A 1BA5A 5C44J 3FK6A 2Y30A 4G12A 1FJLA 5E3LA 4MFEA 1BL0A 2D5VA 4GCTA 2NS8A 3WHBA 1B72A 2QCOA 3LNQA 3TW6A 1SFOJ 2GFNA 5EF6A 4QIWN 1WH5A 3HOWJ 4A69C 3KZ9A 3B81A 2XB5A 3GZIA 5D19A 2CRGA 2DMPA 3MKLA 2IAIA 3RD3A 1Z77A 2HOAA 4L5EA 1APLC 2CUFA 3FIWA 2XGDA 2HYTA 3W6VA 2CQQA 2PBXA 2LK2A 4AUXA 4A3BJ 1ZKGA 4JX6A 2GENA 2JWTA 2OF7A 1ZK8A 3BG5A 2GM4A 1WGXA 2L7FP 1JGGA 2DMNA 2MSYA 1ETKA 2WGBA 2JJ7A 2M34A 3ZQIA 5E3MA 3BR3A 5C4XJ 2XGEA 2O7TA 2R5YB 3O60A 5FKOA 5IYDJ 5FKNA 3PASA 1YRNB 4RBOA 3S14J 2JN6A 2FBQA 4CGRA 3Q0UA 5C4YA 3Q3SA 1K61A 2KT0A 2WUIA 3BG3A 2NVQJ 2EZKA 3HIMA 3UKGA 1HOMA 2ECCA 5C3EJ 3HB9A 4AC6A 2CJJA 1ZR4A 3DPJA 2ZOZA 4C3IJ 2OI8A 3D1NI 4MLOA 1T33A 1I50J 2ZCXA 1JJ8C 3JRFA 2R0QC 1W0TA 2XPVA 2FD5A 3G1LA 3V78A 2W48A 1RR7A 2DG7A 1LE8A 2NOGA 2YUSA 4NDLA 3BT9A 2DA1A 4AYBN 2XPWA 2X6OA 4C3HJ 4X6AJ 4ABZA 3AQTA 2XPUA 1POGA 2XSDC 2CU7A 1GVDA 3Q0WA 3C2BA 4C3JJ 1AKHB 1G2HA 9ANTA 3HGGA 4HKUA 1JUPA 3C07A 2ID3A 1P7IA 2VKEA 4M6VA 1RETA 2AO9A 3HTAA 1JTXA 2JA7J 1R9TJ 3PO2J 4B1RA 2H1KA 3IH4A 4DYRA 4V2FA 2IU5A 2PMZN 4JNNA 5DS9A 2JA5J 1FIAA 4MO7A 3G1MA 1F36A 3BRUA 1PUFB 4UUSA 3HTJA 1UI6A 3K2AA 4S0HB 4D7MA 1IC8A 2TCTA 2YS9A 4A3EJ 1DU0A 5F0CA 3OSFA 3B6AA 3RH2A 2VUMJ 2COBA 2QOPA 4D5CA 1TC3C 3BTJA
chains in the Genus database with same CATH superfamily
5K1YA 4EVIA 3LSHA 4XONA 2VI6A 2R7SA 1J7KA 1TL8A 5H9TA 2L7MP 3PFYA 5D5XB 1JKOC 1W7PA 3T8TA 1XSDA 3CJQB 3TEDA 2RQQA 1J2XA 3CDHA 1DP3A 2KZGA 2O61A 2PMZA 4RGRA 3S8PA 2VT2A 1X3ZB 5EGOB 1FP1D 2IGKA 3I56I 2V6EA 3I4NJ 1U9NA 3DCFA 1TZLA 3OMYA 4UB8C 3RQ4A 3IRQA 5CXIA 3G6EI 3KX2A 4BQOA 3MVPA 3E1SA 2OCEA 3QQAA 1Y8RB 1IV6A 1G3SA 2XB0X 3BTLA 2R7ZJ 4IKFA 4YEJA 4F91B 3WTYC 3HGYA 4UVAA 3DXJF 1BC8C 3DU6A 3MQ0A 1MNMC 4KFCA 1VQ6I 4PJLA 2DA4A 4EJTA 3PM1A 3FXQA 4LG3A 1ZRDA 3HHHA 4E7LA 2QQ8A 2VBZA 1KU2A 4XKCA 2ID6A 4DNCA 4BQQA 4KICA 2VXDA 2VOPA 3PNVA 2E1OA 2KFDA 3ABKH 2VLAA 1BIAA 3ON2A 5H2FC 3J7ZI 5CKTA 4ITVA 1LPQA 2O5RA 2W84A 3L2UA 3M8JA 1Z05A 2RNJA 1FZPB 4R1HA 4I7HA 2JQ7A 4A93J 2X0LA 2L4AA 5D6FA 4A6EA 2L4MA 2MC4A 4CCLA 2NRAC 4UUTA 1IN6A 3AL0B 3NNRA 1R22A 2X9DA 3S3NA 4LLGF 1Y1WJ 4BY7J 1S72I 1JKRC 2QSHX 4BY1J 2CMPA 3IWZA 2ZJPF 3ERMA 2Y0SA 4Y33A 4JQFA 3AKZA 4A3FJ 1Y39A 2DA7A 5IYCJ 3S1RJ 3HUGA 5JHUA 3H9GA 4FE7A 3PQKA 2HOSA 1ETOA 5CVIA 5DM6F 1QPMA 4HOBA 5F27A 4UDSA 2VL8A 3EGQA 3ZQHA 1EH6A 3BJOA 2MD5A 3QAHA 4UUSB 2K3FA 3RPUD 2CUZA 4RM2A 1FYLA 1K7AA 4RB2C 1WCMJ 1JKPC 1P7JA 2R7FA 3RDIA 4ZYEA 3SZPA 3D0SA 2WC2A 5LGNA 2HYJA 3A02A 4IQJA 2DQRA 4XIDA 2KIMA 3OYDA 4GCLA 4I98B 2ZNYA 3B02A 4EQQA 2ESHA 4YRVA 1N77A 4ETSA 2K4BA 1OR7C 2HFHA 4CHUA 1SVOA 2ZKZA 1GHCA 3Q0VA 5LRSA 3U2RA 4GFLA 2RV8A 1O4XA 3KZIC 1IXSB 2Y9ZA 5FKLA 2OJED 4KMFA 2RN7A 5HAWA 1TW3A 1X3WB 4QSHA 3WHCA 3GTLJ 2BVLA 2VBYA 4P9FA 1M1EB 3ML6A 2R5ZA 3FX3A 1YYVA 1ETWA 1K79A 3ECHA 3SZTA 3F23A 1BR2A 1BW5A 3VOXA 3VVYA 4OIPF 1FSHA 1EF4A 2JZYA 3F6VA 2P5LC 1H9GA 1XB4A 3EUPA 3E5UA 2CW7A 3ZQFA 4D7NA 2UXUA 3OYGA 2EH3A 2XAQA 4BYYA 5FJ8J 3CCUI 3HPGA 2CFXA 2KISA 3IUOA 2E2JJ 2NS0A 1Z7UA 5CVJA 2ZJRF 1YHQI 1SFKA 1LE8B 1OKRA 2NNNA 1H88C 2P7VB 4O6JA 1SMTA 4CYCB 4BDYA 2LY1A 2VQGA 2R92J 1G8XA 4JP0A 2R5YA 4J01A 3RKWA 3LSPA 2PJRB 1UG0A 4B4CA 3MKWB 1FTZA 4A3JJ 1TP4A 3UR3C 4AC0A 1BL0A 3HEFA 2OBPA 2DOEA 5E1WA 4PZJA 4F52A 1IG7A 1VQ7I 2GXBA 3ZXSA 4RA2A 2KIQA 3ULQB 4JKZA 2DLLA 2ME0A 5F0HA 4GGGA 4XRSA 1YW8A 4IRIA 3M3YJ 3NPIA 5BMZA 2COMA 3LSKA 5KAFC 3GFIA 5ICCA 4EGZA 4L9VA 4PK4A 4GO1A 3CC7I 5FLVA 2Y0MA 3M8EA 4LK1F 1V5GA 5DAJA 1FMVA 1QVTA 1S5LC 3HOXJ 2XRLA 2Z1DA 1R5GA 3BCGA 1HDPA 1YLFA 3TO6A 4RMNA 2HS5A 3CTAA 4W97A 4RGSA 1XS9A 3BJBA 3BG6A 1XX5A 2PEXA 5GP9A 2MLGA 3LA2A 1RPWA 3ANPA 5CW8A 3JRHA 5J4VA 3HJEA 1IRGA 2LRDA 2K9MA 5D4RA 1PDNC 4MXMA 3KEOA 1WJEA 1X1AA 2IBDA 1SEUA 1D5YA 1O3TA 2LD5A 4Q48A 1WHUA 2KJCA 1ZYRF 3R0AA 4Y4RA 1OCPA 3VPRA 4EV0A 5JVTA 2L0KA 4ZJZA 4G7HF 2DU9A 2K40A 2FEZA 2G7UA 4A3LJ 2TDXA 3IH2A 3S3OA 2IGNA 1ZLKA 2PJRA 3PL8A 1U5TC 3WE3A 5FRNA 2Q24A 1SAUA 3OOUA 4IJAA 1JHHA 2QWWA 4I0BA 3S3MA 2MH9A 2IRFG 4IRGA 2Q0OA 3PPBA 3VYSB 2QYOA 4UVBA 4FHTA 4A3GJ 1SFEA 3V6GA 2A5WA 2NVYJ 3OOPA 2R7DA 1WJBA 2WV1A 1I3QJ 3HRUA 3TDUC 1IN8A 1D1BA 5LLQA 2WWYA 4GDFA 4A3CJ 1JUMA 4N9IA 4RLQA 1SANA 2FUG2 1NK3P 2VPLA 3TP0A 3G3ZA 3LHQA 2RVCA 2M0CA 4AVZA 1RNLA 2IVMA 4XN3A 5FLMJ 2QF7A 1KYZA 5EEAA 2PN6A 4IRHA 2VE9A 1G59A 2ZBKA 3F21A 5L3FA 4EM1A 1LDKB 2HZTA 1WJAA 5HVQC 5BOXA 3CP2A 2IS6A 2LF8A 2G7SA 2XGCA 3S17J 4L62A 2Y9YA 5FHPA 3IWFA 1XSXA 1VNDA 2XDNA 4KNYA 1MNEA 2D6YA 3ECOA 3S2HJ 3FXLA 4ENJA 2E35A 3VUQA 2X48A 2DG8A 1MJBA 1P2FA 3FMQA 4S05A 1T6SA 2QZ8A 2ESNA 3J7YJ 3CMAI 1H89C 1Z3YA 1JTYA 3FM5A 4CZCA 2BHYA 1V54H 4FASD 5KAIC 4MGRA 2IA2A 1BI3A 3V7SA 3RYPA 1FWZA 5DCFA 2IJLA 4QTRA 2DAOA 3BROA 3G56A 2XF6A 1X1PA 2G9WA 3M4OJ 1O57A 4FCYA 2RNGA 2AHQA 1U8RA 2Q2EA 5FGLA 1MZBA 2LP0A 3LJLA 2HKXA 1OYWA 4UXNA 3LSMA 3LSRA 2YPRA 1FSEA 4A12A 1R1UA 1R4NB 4IO9F 3C3WA 1UG2A 3JRAA 1IAWA 3R6SA 2IEKA 1KU9A 4L18B 1LFUP 2HKOA 2XKPA 5JLXA 2I8DA 1ULYA 2M4GA 1BW6A 4ESFA 3H3ZA 3K7AJ 1DU6A 3ZQLA 5GADJ 2XSJC 5FFZA 1T0FC 4KDPA 3RPQA 4G94A 1B9MA 3I5UA 2LSOA 2DA6A 3V7RA 5FKMA 2IS2A 1JI8A 2DJNA 5EZGA 2PFVA 2VODA 2FMYA 1UI5A 2ZOYA 2KP6A 4AIHA 1R1VA 4JBAA 4XRMA 2LVSA 1HA8A 3HSFA 1SD5A 2HI3A 2B3WA 1KA8A 1SGMA 3I59B 3R60A 2VE8A 1Y56A 1ETVA 1J59A 2RGVA 3BR2A 4WWCA 3BWGA 3VW0A 2K7LA 5J6XA 3HOVJ 3BNIA 5IPAA 2Y2ZA 2DA5A 4ZDOA 3FK6A 2Y30A 4G12A 3WHBA 1B72A 2DTRA 2GFNA 4QIWN 3KYCB 4G9YA 3HOWJ 1MMGA 5E8GA 2EK5A 4UY8I 2O3FA 2CRGA 2DMPA 3SYTA 2I5UA 1YTYA 1R6RA 4YFXF 2L7KA 1W1WE 1Z77A 2CUFA 1ZH5A 4UV9A 2Q1ZB 1NG7A 2QKMB 4IOCF 3W6VA 4ZH4F 3KEYA 3BOQA 4AUXA 4HF0A 3J81Z 4B3XA 5DEQA 2OF7A 2GWRA 4CO8A 2GM4A 3H9JA 2VQHA 1MMNA 5L3DA 2MD0A 1I1GA 1WGXA 1JGGA 3W2VA 3WTSC 3BLYA 3P5JA 2W85A 4PJJA 2CQ7A 1UELB 1TQIA 3GMEA 3VDXA 4HQEA 1E0EA 3EUAA 3GF2A 3L2RA 1YRNB 1UHWA 4RBOA 3S14J 4WX9A 4PDKA 2XASA 3Q3SA 1K61A 1FP2A 2KT0A 3I64A 1R1TA 4MTEA 2NVQJ 2VOOA 3K6GA 1W4MA 3UKGA 1HOMA 4AC6A 4C9YA 2B0LA 2ISYA 1G6NA 1ZR4A 3DPJA 2UZKA 3K70C 2BY0A 4V19K 4PJNA 2IS1A 2XPVA 2DDBA 3KP6A 4L0YB 4U9LA 5AIPA 1RR7A 2CFOA 3V8JA 3DLLF 2VT3A 2YUSA 3CJTB 2L01A 3ABUA 4NDLA 4PCQA 3JCUC 4HDVA 1HXDA 1DGWY 2CU7A 2G7HA 4NC6A 1AKHB 2BOLA 2WAFA 2BE5F 2LKSA 5ICFA 5H6QA 5CJ9A 4B1RA 2W7NA 3IH4A 4J00A 5B5EC 3GLXA 5ILVA 2RREA 3F8MA 1FYKA 3H9QA 3V4GA 3PFIA 4OMZA 4EM0B 1BOAA 4XSZF 1BI1A 1XDSA 2M87A 3DPLC 4X0GA 4UVCA 3BRUA 4Z2YA 1GXPA 5L3BA 1G4DA 3K2AA 4D7MA 1QO0D 2AXTC 2WAEA 4A3EJ 1W7PD 2E7XA 3CCVI 1WRJA 3K0LA 4OIOF 3B6AA 3RI4A 2A6HF 2BVMA 2COBA 4OD4A 1HW5A 2EPFA 3VSLA 2HWVA 3E3VA 3GW2A 1OCZH 3BTJA 1TQPA 1SC7A 1Z91A 2GXAA 3E97A 2ZXIA 2BY3A 2UXHA 3T6NA 1QZEA 1T08B 4M3BA 2R5ZB 3D5SC 1MMSA 4K2EA 1Z21A 4N4NB 3JRCA 3KP7A 1WJ5A 1S9HA 4HNTA 2XVCA 4E7KA 2PZ9A 4GRIA 3HM5A 2A69F 4HLXA 4Y13A 4ANJA 5KCMA 2F5DA 1BI2A 4JK1X 3LQQA 2OERA 3FXKA 1D8KA 1NTCA 4U0VA 4XLPF 1WWXA 2GA1A 5EEGA 3WGIA 3P9TA 4BJ6C 4KWAA 1ORKA 1T39A 5J1YA 3PIPF 5DD4A 1QZYA 2JUCA 2ZSHB 1IV8A 4XBFA 3AL0C 3ISPA 1Y0UA 2EFOA 2LF7A 1HCRA 1MMAA 2JRMA 5K5RA 2GOXB 2QBYA 3VVXA 2GIZA 2RASA 2E2HJ 1B4AA 1XMAA 4UHTA 3VOEA 1FTTA 3KP2A 2MW8A 3BG7A 4YIFA 1RKWA 4B43A 5K7ZA 5EDNA 3ABLH 1EH8A 1I27A 3NXCA 1UB9A 3H5AA 2DFEA 2OA4A 1QVUA 1X58A 3S5RA 3BG9A 3DPUA 3KCCA 3ABTA 1TNSA 4WXCA 2KDZA 4F93B 2ELKA 2WV0A 4AIDA 2V9PA 2XAFA 3JRIA 4CYCA 5B3SH 2M2EA 4UV8A 4XR6A 5B66C 1ZREA 1W5CC 2WTEA 5J47A 4A3DJ 3FXMA 1ERDA 4ENKA 2PBIA 1AWCA 2AXLA 5ERIA 3PJRA 3CUQC 4L5JA 1U8BA 3IV5A 3ON4A 1P4XA 3EUKL 2K9QA 2BY2A 5DCMB 4Y7NJ 4ZDPA 1IDZA 4M74A 5CPRB 5D1RA 4ZTJA 4NN1A 4PFOA 3HZJA 1K83J 4HW0A 1T56A 1FBQA 1KQ8A 5IOZA 5GPCA 4KIGA 4FX4A 3HOSA 4B09A 2MYSA 3ZCOA 3T0YA 5K7FA 3TP3A 1LJ9A 3K4KA 1WQ2A 1MBKA 2HQRA 4GCVA 3GEUA 1Y8QB 1LNWA 4KT6A 1GV5A 3ZQQA 5ICEA 2YVEA 3EUHA 1MJAA 2XRNA 3ZMZA 4IX7A 2KZVA 2HDDA 2FA5A 3K4BA 2M8GX 1YS6A 3OS1A 2YU9J 4BS9A 5AQCA 3WGHA 1IF1A 6PAXA 3A1YA 2L54A 1WSUA 1IJWC 1F4KA 5DYMA 4YZEA 1Z3XA 4LD5A 4DZPA 3FM3A 5ILSA 1GVJA 1C0WA 4JYKA 2B63J 2DJIA 4CH7A 2JT1A 2BW3B 2P5VA 2NVTJ 4C2TA 4OAYA 3ZMDA 4E6KG 2VQCA 3TMOA 1YG2A 3OYAA 2OTLI 4LG0B 1EKEA 1OYYA 4CXFA 1IXCA 2EZLA 4XKWA 5E18F 3W2WA 4AIKA 1JKQC 1S8NA 3ANGA 1V55H 2H6BA 4BXFA 4LMYA 3S1QJ 1X4PA 5LGUA 5D5VB 2CQKA 2OU2A 4KN4X 3A01B 3JAMK 2EFWA 3TQNA 2VPRA 1Z6RA 1YW9A 4LLLA 4RB1A 3MNLA 2F4MB 5LEKA 5K7HA 3CUQA 2VJJA 3VEPA 1HQCA 1QRYA 3KPHA 5HSZA 1QHHD 1YFHA 5BPDA 1OMIA 2EWNA 2FX0A 3F3XA 1BI0A 1IUFA 5D19A 5FLXZ 3EYIA 1YJ9I 4DQ2A 1IN5A 4KITB 3FZVA 3HRTA 1FMWA 4KN7X 2X1CA 2PJPA 2K85A 3V7CA 4GYIA 5D8KB 2TRTA 4B48A 3CF2A 2Y31A 2FBKA 5F1RA 3R61A 3G4SI 3OYCA 1FBUA 2EBIA 2KKOA 5CVVA 3F9KA 5LRRA 3L1PA 1ETYA 3GX4X 2BW3A 2G3BA 5L3EA 1LEAA 4LGWA 3CCMI 4IHXA 1LEBA 4RGXA 3GTOJ 4MQ9F 4BEHB 4HYEA 2K02A 2CV2A 2FF4A 2R93J 2EA4A 1UZCA 3AG3H 3ZMTA 4F55A 2BXYA 2V79A 5M3FJ 4I6ZA 3F0CA 1SFUA 5HODA 2ZXJA 1WVRA 3M8FA 3OR1C 2LTPA 2DA2A 2LMDA 2L9NA 3N97A 3F8FA 4I02A 4BKXA 5J4YA 2I10A 1HKTA 1ZARA 3DP7A 1OISA 3FKJA 4U87A 2ZMEB 2CGPA 2H1LA 3BZKA 1FX7A 3CDIA 1I39A 3IRRA 5KNLA 3MAJA 2OPTA 5TISC 1OPCA 3KFWX 1QQIA 2W53A 2EA2A 3E5XA 4JX5A 1VZ0A 1Y0NA 4M6XA 4DBRA 4HV6A 3GTJJ 2NVXJ 3IC7A 3AQSA 1Z9CA 2JVGA 3GLLA 1IDYA 1ZN2A 1ZQ3P 1ODDA 1WKMA 4OINF 4XM3A 1R49A 1GXQA 2WY8Q 3ESWB 1MH3A 2XIGA 1AU7A 2JPBA 2N8GA 3ZRGA 3HC7A 2A5YB 1ONVA 2WB1N 2DFHA 4FE4A 3FISA 2EQRA 2A3SA 2X6XA 1JT0A 1X1DA 3PQJA 4GYGA 5JR3A 5DM7F 1WH7A 2GUHA 4BAYA 3BR1A 3T1BA 1D1CA 2XGXA 2E7WA 2PFBA 2LR8A 1IXRC 2W82A 3SZGA 1ETQA 2X85A 2DN0A 2WY7Q 3MKYB 1B8IA 1J5YA 3R4KA 1PUEE 4C2MJ 1J0RA 3WG9A 4ESBA 2LKXA 2BY1A 2H09A 2BXZA 4XRSG 1DDNA 3ZQCA 3ZOBA 3FBNB 4QWQA 1WJCA 5HNFA 5HLGA 1FPQA 2REKA 1MW7A 3H0GJ 4N4OB 1ZHFA 2EZHA 3CP8A 4JL3A 2OC6A 4IHWA 3OSGA 1V4RA 4A3MJ 3QPLA 3CJDA 4B8XA 4A3IJ 3DKWA 3VYUB 5E3OA 1W36C 1X2NA 1VQ4I 1GLNA 4IHSA 2Z9OA 5L3CA 5HLHA 1SAXA 4YFNF 1O7LA 3O2PE 2ZXWH 3HTHA 2MABA 3GCMA 2X6WA 4I76A 4P96A 3JAMZ 4BACA 5J3LA 3E7QA 3DWLE 4M3FA 2XC7A 1S7AA 1DPUA 4BEHA 4LITA 3ZMUA 4ZTFA 3BCAA 2HDCA 5FD5A 3FRQA 2PQ8A 1EV7A 5J8CA 4LFUA 1U3EM 2K86A 3LSJA 1WI9A 2CQXA 1G3WA 4EJVA 5FLXK 2HQAA 2J5PA 5M5YJ 5EYRA 3SFIA 5IP6A 2HPMA 3OIOA 3DEWA 1BJZA 5LBQA 2QEXI 2RC4A 3T5XA 2M45A 3NWSA 3CF5F 2X51A 3SHFA 2FE3A 3NI7A 3C7JA 3OS0A 1T95A 3E5QA 3O8GA 1E3HA 2ZXHA 5FD6A 1YIOA 4ZZLA 2WAQN 2PI0A 4UUVA 4GFKA 2CQNA 1Y6IA 2L5QA 1ZRCA 3HG9A 5EG0A 1XD7A 2DYRH 3K70D 2IP2A 3BTCA 2NX4A 2XAUA 3L2WA 4M9SA 3S1NJ 4OIQF 3VODA 3QOPA 3S15J 2OZ6A 4NQWB 5KK1A 2FJ1A 1BA5A 4A5NA 4LK0F 1FJLA 2X1DA 2JRTA 2D5VA 5E3LA 4GCTA 4D9JA 2F5VA 1YE9A 2QCOA 1YI2I 4UNOA 4MEYF 2FBHA 3TW6A 3G71I 3LWFA 5EF6A 1B6AA 1OCRH 4HQMA 4CDGA 2LNBA 4PSXA 1QU3A 2YVXA 1BN5A 1FOKA 2XB5A 3B81A 4RB0A 2LDUA 4AD9A 2D1VA 2VASA 3K2ZA 2RDPA 3TDZC 1APLC 1XN7A 4XLFA 2HYTA 2M5WA 2FSWA 3HRSA 3DBHB 3KIOA 1NHAA 2E60A 4JX6A 5HLIA 2GENA 2FJI1 4CA0A 1ZK8A 3A4CA 1FOYA 4I01A 2VJ5A 5E20A 4CGZA 2L7FP 4OIRF 4HSRA 4CCNA 4MQVA 4HSTA 3C1DA 2Z16A 1ETKA 2BZTA 2WGBA 2QSFX 1K6YA 2LBFA 3PASA 4MHGA 3HUGB 3OR2C 3CCSI 2FBQA 2MH2A 3KP5A 5IT3A 3Q0UA 2EB7A 4AIJA 4C2UA 1USSA 4CZZA 2WUIA 3RIRA 1DQUA 2ECCA 3FMRA 3HB9A 1BJAA 1SFXA 3LA7A 4EGYA 5HS9A 2OI8A 3OYMA 3K1MA 2ZCXA 3JRFA 5DCMA 3GYHX 2YX4A 2WBMA 2DOAA 4D1QA 2HQNA 4AWXB 4G6QA 2CUJA 2ZC2A 3BT9A 3T8RA 1E17A 4AYBN 3K4NA 4G6TB 3DEEA 4C3HJ 4X6AJ 3F22A 3FWEA 5CYVA 1POGA 2OQGA 2XSDC 5CVRA 4DIQA 2VXZA 3Q0WA 4BE1A 1XGNA 1P92A 3GZ5A 2LH9A 5TRDA 2D45A 1G2HA 2Z33A 4R8HA 2ID3A 3I9V2 5D5WB 2AO9A 3HTAA 1PP8F 1QBJA 1S3JA 5H20A 2V4JC 3ROUA 3F8BA 1IN7A 2VN2A 2PMZN 2QVOA 3AG4H 1XSVA 4JNNA 2JA5J 1FIAA 1SVMA 3LL7A 2DQLA 1R4MB 1PUFB 3M1EA 2HPIA 4II2A 1UI6A 1I1SA 3L09A 4KA4A 2YS9A 2DDAA 4RM3A 2HTSA 2V1UA 4Q5SF 1DU0A 2KPMA 4BDZA 3LQRA 4FETA 2QQ9A 1K4SA 1I5ZA 3OYKA 2F2EA 4GXOA 1BOBA 3OYEA 1T38A 2DO7A 2LOOA 4D5CA 5HS7A 2X4HA 4UB6C 4L0ZB 2CWEA 2QGUA 1V5FA 3IP4B 1BR4A 3VSKA 1LFBA 2RHAA 4XKBA 1OCTC 3Q5FA 3EUHC 5ICGA 3HKZN 3IH3A 4ON0A 3FXJA 3HSRA 1R5ID 3HDDA 5DTDA 1X19A 3IKVA 4BH9A 3JR9A 2GOMA 4NC8A 5LGTA 2UV1A 3OY9A 4IL6C 3SEZA 1H9TA 5K5QA 1RR8C 3VVZA 1AA7A 2IXSA 4QLCU 2G0EA 3D5LA 1Z0XA 2CV0A 2O8XA 2Z2SB 3OIQA 3BZCA 3VYRB 1WJDA 5HDGA 1JGSA 3BJ6A 3OYBA 2LLKA 4D5FA 4G7OF 2ZCWA 3MN2A 3F1BA 5JLWA 4LLNA 3EQLF 2HVSA 1BR1A 3G7RA 5J40A 3GBGA 4M9XA 1USTA 2DCEA 4ASNA 2E2IJ 5IT9K 1HKSA 1YX3A 3PUFA 2JA8J 1QHGA 3BPVA 4E70A 3WTVC 5KHDA 4FT8A 1ZELA 4J19A 1O3QA 4MNUA 1ITYA 2HEOA 1AHDP 4BQNA 4HDUA 3S16J 3DBRB 1MBEA 1J9IA 2YU3A 1ZRFA 2LREA 4A0ZA 2K9NA 1MKMA 3FK7A 3CMEI 1W0UA 3QKXA 2FRHA 1GV2A 4ENMA 1XCVA 4RAZA 1A36A 4N0BA 5CXGA 2ZY9A 3BCBA 3EYYA 4H4KC 4RAYA 5E79C 1G3TA 3Q9VA 4PJ0C 1MSEC 2ZCMA 2EINH 4DYQA 4DYCA 2RAEA 4Y17A 1T8IA 4OMYA 2ACJA 2HVQA 3TOAA 2DT5A 4M3EA 4XRFA 3RTRA 2LKPA 2R7XA 5D18A 3DFGA 4PGHA 1I3AA 2DFFA 4ICHA 3P7NA 1LDDA 3IHUA 2NXNB 3CCQI 2BHZA 4EMSA 1FIPA 2VJ4A 1PUFA 5EFYA 4RLFA 2D2WA 5FGMA 3GFMA 5IOYA 3R0JA 4Q47A 4RDUA 4BE2A 1JT6A 1REPC 1O3RA 5HNHA 2FU4A 1F43A 1SD6A 2QENA 3I0TA 3VIBA 5F0FA 1PJRA 2HXOA 1J09A 4XLAA 2AQEA 4YELA 3CCEI 2L7ZA 4I09A 2ZMEA 2UXOA 1ZLJA 3L2CA 2GAUA 2YR2A 3CMMA 2M8EA 3KZYA 4V2GA 4DZJA 3CRJA 3VW1A 2R7QA 2H8RA 5LHHA 2ZJ2A 3U9GA 2DTZA 3MZ8A 4CCMA 4ZYGA 1F5TA 5F1JA 1VF9A 3IL2A 2KRHA 1XGOA 1G3YA 1WJFA 3DPTA 4FTHA 2V9KA 2XAJA 3KKDA 4HRIA 2X1EA 1ZGWA 3CCRI 4M71A 2DMQA 2VQLA 5E8IA 3H3VK 1RZ4A 1PVEA 1ON1A 4CICA 1MDMB 1KQ0A 2JA2A 2WADA 2GA2A 2L9RA 1Z6TA 1TWGJ 3I3LA 4G6DA 4U88A 2HYFA 3BQYA 3NARA 3W6KB 3FKIJ 5J1RA 2DK5A 4HF1A 4BJTA 3WU0A 4KIFA 2A68F 2UXPA 2LBFB 1B8IB 3WE2A 3HRMA 1E3OC 3VP5A 1A6IA 2EJRA 1ZGAA 2K4JA 1ZGJA 2P8TA 5HS8A 3U1KA 2FMLA 3CLQA 3NAUA 2F5FA 4IQ4A 4RB3C 3GTKJ 1GDTA 4HF2A 2HVRA 1K6OA 3H0DA 3U21A 2E1NA 3DTIA 1W7PB 3GZ6A 3V8KA 3ZPLA 3A2KA 4L5IA 3RQIA 1TC3C 1FNNA 1T0FA 2E34A 2XUBA 1KU7A 1BC7C 1P9QC 3BHQA 3JREA 3CCLI 4XLEA 4AYBA 3GXOA 1E3PA 2KJBA 3KE2A 1Q1VA 2EV6A 3WTUC 2DOFA 3M07A 5M3MJ 4NNJA 1WPKA 1LVAA 2W24A 5JVGF 4XLHA 2ZMEC 3H5RA 5IP9J 3P9IA 1YQAA 1CQTA 2MC3A 1FEXA 2M3AA 5C4JJ 1D8JA 2O6GE 2BV6A 1ETXA 2KDOA 1HW2A 2H27A 4L9JA 2B1EA 4LB5A 3A03A 1QZZA 4BBSJ 2F48A 2OAZA 4I99C 3GWZA 4WK8F 5CVUA 3IUVA 4U7BA 1TWCJ 2DYSH 1IRXA 1L3LA 3K69A 2XDVA 3K8PC 1PP7U 3ZQ7A 3LWJA 2E1MB 5EGOA 2LFBA 3VOKA 2HKUA 2DMUA 1U5TA 5GTIC 2M30A 1L0OC 2XAHA 2QWTA 1RI7A 2VBWA 1VQPI 2FOWA 3IAM2 5E17F 2KIFA 1BBYA 2R3SA 4DJAA 1VFCA 2K27A 2NP3A 4CCOA 4MFDA 3HTSB 1RKTA 4M9ZA 1I6HJ 3FXUA 1IO2A 3QU3A 4HX8A 3CZ6A 1YRNA 4BUPA 1YJNI 3J7AO 1SD7A 5F08A 3LOCA 3RCOA 2XF5A 2XHKA 3P9CA 3NEUA 2R7OA 2HYGD 2DW4A 1DGRM 2BYVE 1X4OA 2IGMA 3CUQB 4NC7A 4QPQA 3IAS2 3F6OA 3M7GA 4C30A 4MIMA 1B59A 3EETA 2VC0A 3A01A 3HTIA 1S6LA 3DU5A 1YO5C 2NNYA 1TQMA 2NYXA 1VQLI 3CO7C 2V57A 1VQNI 4M3GA 1JHFA 5DD8A 2YVHA 1QGPA 3FXRA 3K9TA 2DT6A 4A0YA 1LB2A 3KEQA 2EILH 5JHFA 2H8WA 3EPZA 4M73A 4BU2A 3BY6A 2M9HA 4ENNA 4BBRJ 4JX4A 3LAJA 4E7JA 5D6EA 3J80Z 3NRVA 4U7DA 1A5JA 5BNGA 5LHGA 2QIBA 2GLOA 4U0WA 4WF2A 3MKZA 4LB6B 4PGGA 3K10A 3PO3J 3TL4X 2QSGX 1OJLA 3GVAA 1GUUA 3K4CA 3S1MJ 4ESJA 1YW7A 4PFPA 5J1UA 1PYVA 1XMXA 3B6CA 3G73A 2R7WA 3L7WA 3LFKA 4XNFA 1P6RA 5M5WJ 2JMWA 3ERED 4M3DA 3M9AA 3LA3A 4ZYAA 2BBYA 3K4JA 3DEUA 3HOTA 3I4MJ 4OU0A 3GZNB 4Y52J 2HNHA 1VI0A 3GTMJ 2DA3A 2UXXA 2HTJA 3SDBA 3OYFA 2E1CA 1Y1VJ 3OS2A 2A05A 3UNGC 4P55A 3KP3A 2G7GA 4ZDLA 1J75A 1T2KA 4OAZA 1XG1A 2P5KA 1U9OA 1MSFC 1VTNC 3E6CC 1R36A 5AIQA 4FISA 4RAGA 4ACIA 5FRMA 4X1EA 4IEJA 1D1AA 1TWAJ 4BHBA 2K9SA 4HV5A 4L9TA 2XROA 5FROA 3OYNA 1NH3A 3JRBA 4XMYA 3OYJA 2R7VA 3BJAA 1ZAOA 2L9VA 2P6SA 5C44J 1X1CA 3Q9SA 4HEA2 3AFHA 1MGTA 3HTUA 3J81K 1X1BA 3LNQA 1UFMA 2PMUA 5FO5A 4ZYDA 1SFOJ 1WH5A 2DT7B 2O03A 3KZ9A 3KLNA 4IHTA 1ACIA 3WTTC 2P4WA 2LG4A 2ICWG 2KMUA 3RD3A 4L5EA 2J5OA 4R79A 3FIWA 1F9NA 1FT9A 1B9NA 2LY2A 3FF5A 2XGDA 2FOKA 4LIVA 3WG7H 4B44A 4NHJA 2CW8A 2Y48A 1IUYA 2CQQA 4A5MA 1TT5B 1LVKA 3RYRA 2PBXA 4A3BJ 1ZKGA 3ZP5A 2A61A 2DPUA 2JWTA 2R4GA 3AG2H 4DGWB 4II3A 1FLIA 1XCBA 3BG5A 5D4SA 3E0JB 3K1NA 5GAEJ 2F6CA 2A07F 5BS6A 1HSTA 2DMNA 4IZZA 3VTIA 1OR7A 3QYBA 2HOEA 2W00A 2JJ7A 3ZQIA 3DV8A 5E3MA 3BR3A 2O7TA 2P7CB 3I53A 1LKXA 2HDWA 1K4TA 4BL0B 2MFZA 2JN6A 4C2MA 1Z67A 4CGRA 2M0MA 3PNTA 1N75A 3ASOH 2VIXA 3BG3A 2YSRA 3WTZA 3F8CA 3DKYA 5C3EJ 1EJ9A 4QPOA 5DV5A 3W6JB 1A04A 2ZOZA 3DF8A 4MLOA 4B47A 2CV1A 1LDJA 2QBYB 1JJ8C 2KL4A 2R0QC 3V42A 4A0XA 3W2AA 2FD5A 5GTHC 2QLZA 3G1LA 3V78A 1FY7A 1IN4A 2W48A 3E6MA 4YFKF 1VQKI 3H1CA 3HKZA 3CESA 4RAFA 3HYIA 3WU1B 2Z99A 2DA1A 5FFXA 2VB6A 1KZHA 2X6OA 1KYWA 3H35A 4IVNA 1S29A 2XPUA 1QA6A 1GVDA 1H0MA 3V8LA 1VQ5I 5E1XA 3HSEA 1UCRA 4C3JJ 1A31A 2VJIA 1UAAA 3VWBA 9ANTA 3HGGA 1LQ1A 4HKUA 2WB1A 3J7AY 3FMSA 1P7IA 2NAZA 4M6VA 2M4KA 1JTXA 2JA7J 3PO2J 1YJWI 3DLAA 3ZMVA 2Q8KA 3FBIB 2IU5A 1V5EA 3BZ6A 1Z1DA 3REOA 2HZDA 1A6QA 2MBFA 2L2OA 4MO7A 3G1MA 4N9HA 2IGOA 2RKHA 4OOIA 1VQ8I 2E71A 3ZN1A 5EJCA 3HTJA 1F1ZA 2NOJB 4S0HB 4HAMA 3QYEA 2V26A 2EIMH 5F0CA 3N05A 3RH2A 1OQYA 5HDKA 1FOXA 2QOPA 2VC1A 4L9NA 2DI3A 2F4OB 4BGDA 3GUDA 2V1NA 1YOVB 4RGUA 1W5SA 2QKLB 3ZN0A 3JSJA 1MH4A 5JFRA 1Z7LA 4O5VA 1IZ1A 1HLVA 4XK4A 4EEFG 2ZO4A 2BEOA 1CF7B 1TTYA 1GT0C 4IRVA 2FQ4A 2P0WA 3PUBA 3G1OA 3QPSA 2JK3A 1ZTRA 2MGQA 4IF4A 2V1XA 5DUKA 3BPXA 4CCJA 5LEJA 5EG0B 3MEXA 4WXHA 1WZ2A 3OYIA 3D5RC 2JPCA 3KYLA 2ZNZA 3CC4I 3NRGA 4HNVA 3MZHA 2EIKH 3CMYA 5E1ZB 2IA1A 3ELKA 2EV0A 3TO9A 1HBXG 2HOTA 5TGTA 3A0BC 1R71A 3RKYA 1MD0A 2EFPA 3KKCA 4H0EA 3OYHA 3HOZJ 4M6YA 1JE8A 1U5TB 2CUEA 3QBMA 5CQGA 4F3QA 4DW6A 3JRGA 5IP7J 5CQEA 5D8LB 4CCKA 2HXIA 2QTQA 1YIJI 3O6BB 4ZC3A 2E5ZA 2DMTA 1B1BA 3QODA 3RKQA 2HQ5A 3S2DJ 5EEHA 1TNTA 4GCKA 3OL4A 4HA8A 5IY5H 2XV4S 2W57A 1ZG3A 4W1UA 2OTJI 1WI3A 5GPAA 2IT0A 4BQAA 1R7JA 2JSCA 2NS7A 2VKVA 2E19A 3ONQA 1NK2P 1HC8A 4ZYHA 1IRZA 2NP5A 1ZR2A 3WODF 1EH7A 3QYFA 2OD5A 2QA4I 1HDDC 3NS4A 4YIIA 4HZFA 3C2GA 1YITI 2VKDA 4GFBA 3OV8A 2WAQA 4Z6YA 3W3CA 4S04A 3LAPA 2OZUA 5F6FA 2ELJA 3COAC 1BM9A 1HKQA 4XKVA 1RRJA 1D5VA 4I0AA 4IHVA 4TV7A 2E5NA 1JJ6C 2Y69H 5D5UB 4A3KJ 2XKOA 3WTWC 3MZYA 5F04A 1X2MA 2AS5F 1OFCX 3CDLA 4PXIA 4LOCA 1MBHA 3JW4A 1DP7P 2G7LA 4EJOA 2IS4A 2YX7A 4AF5A 2O7OA 2GQQA 4E7IA 1U6GA 1HW1A 1DPRA 2PX9A 3SQNA 2OCCH 3LSTA 3DTKA 1RESA 5F64A 2KLOA 1I6XA 5J8FA 2P81A 2ZJQF 1EA3A 1MIJA 1QNTA 2GXGA 1VQMI 1S7EA 3TW7A 3P9KA 2E36A 2B9SA 1TWFJ 3HOYJ 2STWA 3H3UA 1OYIA 2OUMA 5IT9Z 3O8HA 4IXAA 3NQOA 4XLCA 5LFAA 1LFPA 3J80K 3L2QA 1JUSA 2R7RA 3BP8A 1MBFA 2ECBA 1NG6A 4JOMA 1O3SA 5LD2C 1MJ9A 3DTEA 3QPHA 4F7ZA 3CO6C 1CF7A 2Y75A 4NBQA 4DBQA 1O7FA 2GBYA 4BE0A 4E7ZA 2F5CA 2KHMA 5TJJA 1YX5A 1MDMA 4Y3OA 2CS3A 3K4MA 1AOYA 2ZB9A 3L9FA 2A6TA 2QKOA 4IPAA 2VKHA 2IW5A 4CYDA 4ME9A 2MG4A 1XTAA 1KQ9A 2W4SA 3GTGJ 3VW2A 3TO7A 5FB2A 1XGSA 1OCCH 5FKKA 3BR0A 3TOBA 2B7EA 2ETHA 2WA0A 3ABMH 4FQGA 4ZZDA 3MFKA 5H6RA 3L2VA 4IHYA 4OD5A 2VBXA 1R58A 2XF7A 3SFZA 5A2QK 4D0PA 2UWMA 3KNWA 1LUJB 2E1MC 2R7UA 5IYBJ 4BXXJ 5GAHJ 3VB2A 1U0JA 3ZQGA 2DXIA 1MBGA 5ILUA 3FDYA 3N4MA 3SXYA 1XC5A 1XDUA 4G8XA 4A2UA 3F8NA 2L9SA 2EFQA 1Q1HA 3MD2A 5M5XJ 3ZR8X 2HGCA 1WFXA 5ED4A 3RJPA 1IGNA 1DUXC 3CQZJ 2F5EA 4EJUA 1FYMA 5FMPA 3HHGA 2ZCNA 4NELA 2IA0A 3BDDA 3H5NA 2JA6J 3JTHA 2LC2A 3GEZA 4NB5A 2P6TA 4E7SA 3HBLA 1XMKA 2DK8A 2JSPA 1SMYF 3E7LA 3SDGA 5HDNA 5K5OA 4PJMA 3GTQJ 1V3FA 2HU9A 2UXIA 2C6YA 3L00A 2Y0SN 5DUIA 3I59A 1UJ8A 4XSXF 2A2FX 2CO5A 2CH0A 3RZOJ 2ZFUA 3S93A 1P4AA 3MMYB 4M72A 4B3AA 3RPUA 2NVUB 4DVYP 3TKYA 3FXOA 2QUFA 3BR5A 1IRFA 2V6CA 1T98A 4EM2A 4RS8A 1OLTA 3CUOA 1TW2A 2OQRA 4MK6A 1TWHJ 2FNPA 1IW7F 4BJ5C 3CWRA 3DBLB 1X3UA 2F4IA 1W36D 2PG4A 1W5TA 2FNAA 3CD6I 3BQZA 1ZG1A 3JRDA 2K9LA 3QPTA 5DDGA 3I71A 2F07A 2IPQX 2FBIA 2DPDA 1D0ZA 5GAGJ 3WTXC 2X6YA 1UMQA 3BR6A 3E6BA 3RZDJ 2A6EF 2CYYA 2XAGA 5HLTA 1D0YA 3ZMSA 4A6DA 2ZFWA 3S2WA 2QQBA 3ASNH 2KIUA 2EZIA 5HBUA 2K3PA 4EATA 4EJWA 3I55I 4DOZA 3QOEA 5EZHA 3K4LA 5K58A 1HSJA 1E2XA 1B72B 4P1WA 3A0HC 3PIOF 3HOUJ 4AVPA 1R00A 4KUMA 5LHIA 1HF0A 3DKXA 1JXSA 3I4PA 3OL3A 3SWHA 2FXAA 2O9LA 2ADUA 1FC3A 3E6DA 2KRFA 4WCGA 3M1CA 1VQOI 4XOTA 3LSGA 4PUSA 5A2QZ 3SEQA 1TBXA 4OWRB 3C2HA 3LSIA 4WXDA 3SJMA 3U1DA 3PNYA 3JSPA 2LY9A 3COLA 5KVRA 1ENHA 2MA3A 1AKHA 2D1HA 1MBJA 4KIBA 3CCYA 4KISA 3GTPJ 3HXLA 1TLHB 1D0XA 3KZZA 3QRFF 3WGGA 1S7OA 1UHSA 3I54A 5JI6A 4KYWA 3OIPA 2W25A 2DFIA 3EDPA 3JSOA 3B73A 2EFNA 3O3KA 4KJZA 4HBLA 2DODA 5E3NA 3FHZA 3C18A 1RIOH 3CJRB 3RKXA 3HIFA 2Z3YA 3BTIA 2O8KA 3VFZA 1YS7A 4HLYA 3HE0A 2ME6A 4WIBA 1U78A 4HPQA 4LJZF 5BQTA 3KYDB 4XICA 2CW0F 2PLYA 1ON2A 1P4WA 1QPIA 2Z5UA 3I58A 3IKTA 1KU3A 1KGSA 2QM3A 3VYTB 4XOPA 1H8AC 1SD4A 1STZA 1TT0A 2LYCA 4MFEA 5B1BH 2M1BA 4CUGA 4PSWA 2NS8A 3H36A 2GZWA 2JTVA 3LFUA 3PSIA 1MMDA 3RSNA 4I2OA 2W1OA 1KONA 4HNUA 4XORA 4A69C 3GZIA 2O0YA 2UUZA 2KRCA 3MKLA 1SVLA 2IAIA 1N78A 2HOAA 3AAFA 2V1DA 3KETA 5AONA 4NUBA 4F92B 5L3GA 3HL2A 1FOWA 2V9VA 2LK2A 2H94A 4AU7A 1ZG5A 2GIVA 3GO5A 2RQPA 2EIJH 1MNDA 3QP5A 4Y15A 3LMMA 5BPIA 2EV5A 4HG2A 2JVHA 2MSYA 1K78B 1XGMA 3NWTA 4HX7A 1CGPA 4XL9A 4XLNF 5HOOA 2M34A 5C4XJ 4CSWA 2XGEA 3DQVC 2R5YB 1UHMA 3O60A 1N25A 5FKOA 5FKNA 5IYDJ 4O3MA 2R7TA 4YG2F 5C4YA 2JUGA 4MTDA 4BXUA 2EZKA 1D3YA 3HIMA 3AG1H 2CJJA 4P9UA 4C3IJ 2STTA 3D1NI 3QP6A 1T33A 2FQ3A 1I50J 2PMHA 1A35A 4E4HA 1W0TA 1K78A 3S32A 3QWLA 3PSFA 4BHCA 5B1AH 2M7BA 4G7ZF 2DG7A 4XN0A 3BC8A 3CLOA 1LE8A 2NOGA 3H92A 1U2WA 3FHNA 2QQAA 2XPWA 3F72A 4MEXF 3HPHA 4ABZA 3AQTA 4E7HA 1OCOH 4LIUA 2H6CA 5CLSA 3GFJA 3WU2C 1RUNA 4NQWA 2MLKA 1BIBA 3MCZA 2ELHA 3C2BA 3MWMA 2M7AA 3G2BA 2CG4A 1JUPA 3CC2I 4IOAF 3C07A 2VKEA 1RETA 3JTGA 4BHPA 3X2QH 1R9TJ 2H1KA 1FBSA 1RUOA 4FX0A 2OV7A 4DYRA 3TGNA 4V2FA 4BNCA 2BGCA 2UXNA 2K5CA 4Q4ZF 5DS9A 2Q2EB 4AM3A 1RC9A 1F36A 3GFLA 2L3DA 2ISZA 4P5OA 4U9NA 4UUSA 4XQFA 3TBIA 2VONA 3CCJI 1IC8A 4KMUX 1R5HA 2TCTA 4KT5C 3CJNA 3ZGKA 1XPXA 3KLOA 4LG0A 1R23A 3QU6A 2ZSIB 2DBBA 4HX4A 3OWTA 3OSFA 2CSOA 4YIRX 2VUMJ 4U0YA 2AQFA 1VQ9I 2HR3A 2V7FA 3K1PA 3KP4A 2L02A 3OYLA 2KQRA
chains in the Genus database with same CATH topology
3JSJA 1MH4A 2UXHA 2VI6A 3T6NA 1HLVA 4XK4A 4M3BA 5H9TA 2L7MP 4EEFG 1LFBA 2R5ZB 2RHAA 1JKOC 1OCTC 1GT0C 3HKZN 3JRCA 2FQ4A 3IH3A 3TEDA 3G1OA 3QPSA 2PZ9A 2JK3A 3HDDA 1ZTRA 3HM5A 5DTDA 2MGQA 3JR9A 5EGOB 3I4NJ 1U9NA 3DCFA 2OERA 5EG0B 5CXIA 1NTCA 3MVPA 3QQAA 1IV6A 3NRGA 3BTLA 2XB0X 2R7ZJ 3VVZA 3P9TA 4HNVA 3CMYA 4KWAA 3HGYA 1ORKA 2G0EA 1MNMC 2HOTA 1Z0XA 2DA4A 5J1YA 3PM1A 3KKCA 2LLKA 4D5FA 3HOZJ 1HCRA 3MN2A 3F1BA 2ID6A 5JLWA 3VVXA 2CUEA 3QBMA 2RASA 2E2HJ 3G7RA 2E1OA 3GBGA 1FTTA 2E2IJ 2MW8A 3ON2A 1RKWA 4DW6A 2JA8J 5K7ZA 5EDNA 3JRGA 5IP7J 4J19A 2HXIA 4A93J 2QTQA 3NXCA 1ITYA 1AHDP 3S16J 4UUTA 1MBEA 2DMTA 3NNRA 1QVUA 2HQ5A 1X58A 3RKQA 2K9NA 2X9DA 3BG9A 3S5RA 3FK7A 1W0UA 3S2DJ 3QKXA 1Y1WJ 4BY7J 1GV2A 2KDZA 4GCKA 1JKRC 2ELKA 4BY1J 5CXGA 3JRIA 4W1UA 4CYCA 1MSEC 2ZCMA 1WI3A 2M2EA 5GPAA 4A3FJ 4DYQA 2DA7A 4DYCA 2RAEA 2NS7A 2VKVA 5IYCJ 2E19A 3S1RJ 1NK2P 4A3DJ 4FE7A 1IRZA 2NP5A 2HOSA 4M3EA 1ETOA 5D18A 1ZR2A 5F27A 4ICHA 4UDSA 3EGQA 3ZQHA 1HDDC 1U8BA 3IV5A 3ON4A 4UUSB 2K9QA 1FIPA 1PUFA 5EFYA 4GFBA 4Y7NJ 1IDZA 1WCMJ 5IOYA 4RDUA 1JKPC 1P7JA 1JT6A 5D1RA 2HYJA 3A02A 4NN1A 4XIDA 1K83J 1T56A 5IOZA 5GPCA 4GCLA 1F43A 3VIBA 5F0FA 2HXOA 5K7FA 3Q0VA 3TP3A 4IHVA 4GFLA 1O4XA 1JJ6C 1MBKA 2Y9ZA 2L7ZA 4A3KJ 3GEUA 2UXOA 5FKLA 1GV5A 2YVEA 2HDDA 4V2GA 3CRJA 4DZJA 5HAWA 5F04A 4QSHA 3WHCA 2H8RA 3VW1A 1X2MA 3GTLJ 2M8GX 2R5ZA 1OFCX 3CDLA 2YU9J 2DTZA 1MBHA 4LOCA 4PXIA 5AQCA 5F1JA 1VF9A 1ETWA 2G7LA 3VOXA 1BW5A 3VVYA 1IJWC 4AF5A 2O7OA 4YZEA 4FTHA 1EF4A 4DZPA 3KKDA 3EUPA 2B63J 1ZGWA 4JYKA 3H3VK 2DMQA 3ZQFA 4D7NA 1RESA 2UXUA 2NVTJ 2EH3A 2P81A 5FJ8J 2E2JJ 2L9RA 1TWGJ 1S7EA 3TW7A 2EZLA 1LE8B 3BQYA 3NARA 5J1RA 3FKIJ 1TWFJ 1H88C 3HOYJ 4CYCB 2R92J 1JKQC 2UXPA 3O8HA 4JP0A 2R5YA 1B8IB 3ANGA 1E3OC 3LSPA 3S1QJ 3VP5A 1A6IA 4B4CA 1FTZA 3A01B 4A3JJ 4AC0A 1JUSA 2VPRA 3NAUA 3GTKJ 1MBFA 3HEFA 2ECBA 3MNLA 1GDTA 1IG7A 5K7HA 1QRYA 5HSZA 4JKZA 2ME0A 5F0HA 4XRSA 2FX0A 3M3YJ 2GBYA 1IUFA 3RQIA 3NPIA 2ZB9A 5FLVA 2QKOA 3BHQA 3JREA 4ME9A 5DAJA 2MG4A 1QVTA 3GTGJ 3HOXJ 2XRLA 3BCGA 3VW2A 1HDPA 1Q1VA 5FKKA 3BR0A 2TRTA 5M3MJ 4IHYA 2Y31A 1WPKA 4W97A 1XS9A 3BJBA 2EBIA 5GP9A 3L1PA 1RPWA 3ANPA 5IP9J 1ETYA 2G3BA 3KNWA 3JRHA 5CW8A 5IYBJ 4BXXJ 4MXMA 1CQTA 4IHXA 3ZQGA 1FEXA 1MBGA 2IBDA 3GTOJ 5C4JJ 1D5YA 2LD5A 2R93J 1ETXA 1XC5A 5M3FJ 4I6ZA 3A03A 1OCPA 3F0CA 3VPRA 4BBSJ 5HODA 2L0KA 2LTPA 2K40A 2DA2A 5M5XJ 4A3LJ 3IUVA 4BKXA 3IH2A 1TWCJ 2I10A 1IGNA 3CQZJ 5FMPA 2ZCNA 2Q24A 3LWJA 4NELA 2JA6J 5EGOA 3OOUA 2LFBA 2OPTA 3HBLA 3VOKA 2W53A 2HKUA 3E7LA 4JX5A 3GTJJ 3SDGA 2NVXJ 3AQSA 3NI7A 2DMUA 3GTQJ 2UXIA 3PPBA 2QWTA 2Y0SN 1IDYA 1ZQ3P 4A3GJ 3V6GA 2NVYJ 3RZOJ 1VFCA 2WV1A 1I3QJ 2NP3A 4A3CJ 1JUMA 4MFDA 4B3AA 1RKTA 1I6HJ 1SANA 1MH3A 1NK3P 1AU7A 3BR5A 3TP0A 2N8GA 3LHQA 2M0CA 1YRNA 2WB1N 5F08A 3LOCA 4FE4A 3FISA 2EQRA 5FLMJ 2QF7A 4MK6A 1TWHJ 1JT0A 5EEAA 3CWRA 1WH7A 2GUHA 3BR1A 3BQZA 3JRDA 4MIMA 2LR8A 2F07A 3A01A 3HTIA 1ETQA 2DN0A 2G7SA 2XGCA 1UMQA 3S17J 2Y9YA 3BR6A 1B8IA 5FHPA 4L62A 1VNDA 2V57A 2D6YA 3RZDJ 2XDNA 4C2MJ 4M3GA 3S2HJ 2LKXA 2YVHA 3VUQA 4XRSG 3ZQCA 2X48A 3ZOBA 2EZIA 2DG8A 5HBUA 2REKA 1H89C 3H0GJ 2M9HA 1JTYA 4BBRJ 4JX4A 5EZHA 5K58A 2EZHA 4JL3A 1B72B 4IHWA 3OSGA 4A3MJ 3HOUJ 3QPLA 1A5JA 5BNGA 3CJDA 2QIBA 2GLOA 4A3IJ 1HF0A 5E3OA 1X2NA 4QTRA 3G56A 2O9LA 3PO3J 4FCYA 3M4OJ 2AHQA 1OJLA 3S1MJ 1GUUA 5FGLA 2LP0A 3LJLA 5J1UA 3LSRA 3B6CA 3LSGA 3HTHA 4I76A 3SJMA 1UG2A 5J3LA 3JRAA 3E7QA 2LY9A 4M3FA 5M5WJ 3COLA 2IEKA 2JMWA 4M3DA 1ENHA 1LFUP 5JLXA 1AKHA 1MBJA 3CCYA 3GTPJ 1BW6A 3FRQA 3I4MJ 4Y52J 3LSJA 2CQXA 1UHSA 1VI0A 3GTMJ 2DA3A 3K7AJ 5M5YJ 3ZQLA 5EYRA 3SFIA 1DU6A 5IP6A 3OIOA 1Y1VJ 1BJZA 3DEWA 2DA6A 5FKMA 2G7GA 5E3NA 2DJNA 5EZGA 1UI5A 2ZOYA 1XG1A 1U9OA 1MSFC 3O8GA 4XRMA 2LVSA 2HI3A 3BTIA 2O8KA 4FISA 2WAQN 1SGMA 4ACIA 4X1EA 4IEJA 3HE0A 2ME6A 4GFKA 1TWAJ 1U78A 1ETVA 2K9SA 4XICA 3BR2A 5EG0A 3VW0A 3BTCA 2NX4A 3JRBA 3S1NJ 1QPIA 3HOVJ 3S15J 5IPAA 3BNIA 2Y2ZA 2DA5A 1H8AC 2FJ1A 1BA5A 5C44J 3FK6A 2Y30A 4G12A 1FJLA 5E3LA 4MFEA 1BL0A 2D5VA 4GCTA 2NS8A 3WHBA 1B72A 2QCOA 3LNQA 3TW6A 1SFOJ 2GFNA 5EF6A 4QIWN 1WH5A 3HOWJ 4A69C 3KZ9A 3B81A 2XB5A 3GZIA 5D19A 2CRGA 2DMPA 3MKLA 2IAIA 3RD3A 1Z77A 2HOAA 4L5EA 1APLC 2CUFA 3FIWA 2XGDA 2HYTA 3W6VA 2CQQA 2PBXA 2LK2A 4AUXA 4A3BJ 1ZKGA 4JX6A 2GENA 2JWTA 2OF7A 1ZK8A 3BG5A 2GM4A 1WGXA 2L7FP 1JGGA 2DMNA 2MSYA 1ETKA 2WGBA 2JJ7A 2M34A 3ZQIA 5E3MA 3BR3A 5C4XJ 2XGEA 2O7TA 2R5YB 3O60A 5FKOA 5IYDJ 5FKNA 3PASA 1YRNB 4RBOA 3S14J 2JN6A 2FBQA 4CGRA 3Q0UA 5C4YA 3Q3SA 1K61A 2KT0A 2WUIA 3BG3A 2NVQJ 2EZKA 3HIMA 3UKGA 1HOMA 2ECCA 5C3EJ 3HB9A 4AC6A 2CJJA 1ZR4A 3DPJA 2ZOZA 4C3IJ 2OI8A 3D1NI 4MLOA 1T33A 1I50J 2ZCXA 1JJ8C 3JRFA 2R0QC 1W0TA 2XPVA 2FD5A 3G1LA 3V78A 2W48A 1RR7A 2DG7A 1LE8A 2NOGA 2YUSA 4NDLA 3BT9A 2DA1A 4AYBN 2XPWA 2X6OA 4C3HJ 4X6AJ 4ABZA 3AQTA 2XPUA 1POGA 2XSDC 2CU7A 1GVDA 3Q0WA 3C2BA 4C3JJ 1AKHB 1G2HA 9ANTA 3HGGA 4HKUA 1JUPA 3C07A 2ID3A 1P7IA 2VKEA 4M6VA 1RETA 2AO9A 3HTAA 1JTXA 2JA7J 1R9TJ 3PO2J 4B1RA 2H1KA 3IH4A 4DYRA 4V2FA 2IU5A 2PMZN 4JNNA 5DS9A 2JA5J 1FIAA 4MO7A 3G1MA 1F36A 3BRUA 1PUFB 4UUSA 3HTJA 1UI6A 3K2AA 4S0HB 4D7MA 1IC8A 2TCTA 2YS9A 4A3EJ 1DU0A 5F0CA 3OSFA 3B6AA 3RH2A 2VUMJ 2COBA 2QOPA 4D5CA 1TC3C 3BTJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JSJ A;  1MH4 A;  2UXH A;  2VI6 A;  3T6N A;  1HLV A;  4XK4 A;  4M3B A;  5H9T A;  2L7M P;  4EEF G;  1LFB A;  2R5Z B;  2RHA A;  1JKO C;  1OCT C;  1GT0 C;  3HKZ N;  3JRC A;  2FQ4 A;  3IH3 A;  3TED A;  3G1O A;  3QPS A;  2PZ9 A;  2JK3 A;  3HDD A;  1ZTR A;  3HM5 A;  5DTD A;  2MGQ A;  3JR9 A;  5EGO B;  3I4N J;  1U9N A;  3DCF A;  2OER A;  5EG0 B;  5CXI A;  1NTC A;  3MVP A;  3QQA A;  1IV6 A;  3NRG A;  3BTL A;  2XB0 X;  2R7Z J;  3VVZ A;  3P9T A;  4HNV A;  3CMY A;  4KWA A;  3HGY A;  1ORK A;  2G0E A;  1MNM C;  2HOT A;  1Z0X A;  2DA4 A;  5J1Y A;  3PM1 A;  3KKC A;  2LLK A;  4D5F A;  3HOZ J;  1HCR A;  3MN2 A;  3F1B A;  2ID6 A;  5JLW A;  3VVX A;  2CUE A;  3QBM A;  2RAS A;  2E2H J;  3G7R A;  2E1O A;  3GBG A;  1FTT A;  2E2I J;  2MW8 A;  3ON2 A;  1RKW A;  4DW6 A;  2JA8 J;  5K7Z A;  5EDN A;  3JRG A;  5IP7 J;  4J19 A;  2HXI A;  4A93 J;  2QTQ A;  3NXC A;  1ITY A;  1AHD P;  3S16 J;  4UUT A;  1MBE A;  2DMT A;  3NNR A;  1QVU A;  2HQ5 A;  1X58 A;  3RKQ A;  2K9N A;  2X9D A;  3BG9 A;  3S5R A;  3FK7 A;  1W0U A;  3S2D J;  3QKX A;  1Y1W J;  4BY7 J;  1GV2 A;  2KDZ A;  4GCK A;  1JKR C;  2ELK A;  4BY1 J;  5CXG A;  3JRI A;  4W1U A;  4CYC A;  1MSE C;  2ZCM A;  1WI3 A;  2M2E A;  5GPA A;  4A3F J;  4DYQ A;  2DA7 A;  4DYC A;  2RAE A;  2NS7 A;  2VKV A;  5IYC J;  2E19 A;  3S1R J;  1NK2 P;  4A3D J;  4FE7 A;  1IRZ A;  2NP5 A;  2HOS A;  4M3E A;  1ETO A;  5D18 A;  1ZR2 A;  5F27 A;  4ICH A;  4UDS A;  3EGQ A;  3ZQH A;  1HDD C;  1U8B A;  3IV5 A;  3ON4 A;  4UUS B;  2K9Q A;  1FIP A;  1PUF A;  5EFY A;  4GFB A;  4Y7N J;  1IDZ A;  1WCM J;  5IOY A;  4RDU A;  1JKP C;  1P7J A;  1JT6 A;  5D1R A;  2HYJ A;  3A02 A;  4NN1 A;  4XID A;  1K83 J;  1T56 A;  5IOZ A;  5GPC A;  4GCL A;  1F43 A;  3VIB A;  5F0F A;  2HXO A;  5K7F A;  3Q0V A;  3TP3 A;  4IHV A;  4GFL A;  1O4X A;  1JJ6 C;  1MBK A;  2Y9Z A;  2L7Z A;  4A3K J;  3GEU A;  2UXO A;  5FKL A;  1GV5 A;  2YVE A;  2HDD A;  4V2G A;  3CRJ A;  4DZJ A;  5HAW A;  5F04 A;  4QSH A;  3WHC A;  2H8R A;  3VW1 A;  1X2M A;  3GTL J;  2M8G X;  2R5Z A;  1OFC X;  3CDL A;  2YU9 J;  2DTZ A;  1MBH A;  4LOC A;  4PXI A;  5AQC A;  5F1J A;  1VF9 A;  1ETW A;  2G7L A;  3VOX A;  1BW5 A;  3VVY A;  1IJW C;  4AF5 A;  2O7O A;  4YZE A;  4FTH A;  1EF4 A;  4DZP A;  3KKD A;  3EUP A;  2B63 J;  1ZGW A;  4JYK A;  3H3V K;  2DMQ A;  3ZQF A;  4D7N A;  1RES A;  2UXU A;  2NVT J;  2EH3 A;  2P81 A;  5FJ8 J;  2E2J J;  2L9R A;  1TWG J;  1S7E A;  3TW7 A;  2EZL A;  1LE8 B;  3BQY A;  3NAR A;  5J1R A;  3FKI J;  1TWF J;  1H88 C;  3HOY J;  4CYC B;  2R92 J;  1JKQ C;  2UXP A;  3O8H A;  4JP0 A;  2R5Y A;  1B8I B;  3ANG A;  1E3O C;  3LSP A;  3S1Q J;  3VP5 A;  1A6I A;  4B4C A;  1FTZ A;  3A01 B;  4A3J J;  4AC0 A;  1JUS A;  2VPR A;  3NAU A;  3GTK J;  1MBF A;  3HEF A;  2ECB A;  3MNL A;  1GDT A;  1IG7 A;  5K7H A;  1QRY A;  5HSZ A;  4JKZ A;  2ME0 A;  5F0H A;  4XRS A;  2FX0 A;  3M3Y J;  2GBY A;  1IUF A;  3RQI A;  3NPI A;  2ZB9 A;  5FLV A;  2QKO A;  3BHQ A;  3JRE A;  4ME9 A;  5DAJ A;  2MG4 A;  1QVT A;  3GTG J;  3HOX J;  2XRL A;  3BCG A;  3VW2 A;  1HDP A;  1Q1V A;  5FKK A;  3BR0 A;  2TRT A;  5M3M J;  4IHY A;  2Y31 A;  1WPK A;  4W97 A;  1XS9 A;  3BJB A;  2EBI A;  5GP9 A;  3L1P A;  1RPW A;  3ANP A;  5IP9 J;  1ETY A;  2G3B A;  3KNW A;  3JRH A;  5CW8 A;  5IYB J;  4BXX J;  4MXM A;  1CQT A;  4IHX A;  3ZQG A;  1FEX A;  1MBG A;  2IBD A;  3GTO J;  5C4J J;  1D5Y A;  2LD5 A;  2R93 J;  1ETX A;  1XC5 A;  5M3F J;  4I6Z A;  3A03 A;  1OCP A;  3F0C A;  3VPR A;  4BBS J;  5HOD A;  2L0K A;  2LTP A;  2K40 A;  2DA2 A;  5M5X J;  4A3L J;  3IUV A;  4BKX A;  3IH2 A;  1TWC J;  2I10 A;  1IGN A;  3CQZ J;  5FMP A;  2ZCN A;  2Q24 A;  3LWJ A;  4NEL A;  2JA6 J;  5EGO A;  3OOU A;  2LFB A;  2OPT A;  3HBL A;  3VOK A;  2W53 A;  2HKU A;  3E7L A;  4JX5 A;  3GTJ J;  3SDG A;  2NVX J;  3AQS A;  3NI7 A;  2DMU A;  3GTQ J;  2UXI A;  3PPB A;  2QWT A;  2Y0S N;  1IDY A;  1ZQ3 P;  4A3G J;  3V6G A;  2NVY J;  3RZO J;  1VFC A;  2WV1 A;  1I3Q J;  2NP3 A;  4A3C J;  1JUM A;  4MFD A;  4B3A A;  1RKT A;  1I6H J;  1SAN A;  1MH3 A;  1NK3 P;  1AU7 A;  3BR5 A;  3TP0 A;  2N8G A;  3LHQ A;  2M0C A;  1YRN A;  2WB1 N;  5F08 A;  3LOC A;  4FE4 A;  3FIS A;  2EQR A;  5FLM J;  2QF7 A;  4MK6 A;  1TWH J;  1JT0 A;  5EEA A;  3CWR A;  1WH7 A;  2GUH A;  3BR1 A;  3BQZ A;  3JRD A;  4MIM A;  2LR8 A;  2F07 A;  3A01 A;  3HTI A;  1ETQ A;  2DN0 A;  2G7S A;  2XGC A;  1UMQ A;  3S17 J;  2Y9Y A;  3BR6 A;  1B8I A;  5FHP A;  4L62 A;  1VND A;  2V57 A;  2D6Y A;  3RZD J;  2XDN A;  4C2M J;  4M3G A;  3S2H J;  2LKX A;  2YVH A;  3VUQ A;  4XRS G;  3ZQC A;  2X48 A;  3ZOB A;  2EZI A;  2DG8 A;  5HBU A;  2REK A;  1H89 C;  3H0G J;  2M9H A;  1JTY A;  4BBR J;  4JX4 A;  5EZH A;  5K58 A;  2EZH A;  4JL3 A;  1B72 B;  4IHW A;  3OSG A;  4A3M J;  3HOU J;  3QPL A;  1A5J A;  5BNG A;  3CJD A;  2QIB A;  2GLO A;  4A3I J;  1HF0 A;  5E3O A;  1X2N A;  4QTR A;  3G56 A;  2O9L A;  3PO3 J;  4FCY A;  3M4O J;  2AHQ A;  1OJL A;  3S1M J;  1GUU A;  5FGL A;  2LP0 A;  3LJL A;  5J1U A;  3LSR A;  3B6C A;  3LSG A;  3HTH A;  4I76 A;  3SJM A;  1UG2 A;  5J3L A;  3JRA A;  3E7Q A;  2LY9 A;  4M3F A;  5M5W J;  3COL A;  2IEK A;  2JMW A;  4M3D A;  1ENH A;  1LFU P;  5JLX A;  1AKH A;  1MBJ A;  3CCY A;  3GTP J;  1BW6 A;  3FRQ A;  3I4M J;  4Y52 J;  3LSJ A;  2CQX A;  1UHS A;  1VI0 A;  3GTM J;  2DA3 A;  3K7A J;  5M5Y J;  3ZQL A;  5EYR A;  3SFI A;  1DU6 A;  5IP6 A;  3OIO A;  1Y1V J;  1BJZ A;  3DEW A;  2DA6 A;  5FKM A;  2G7G A;  5E3N A;  2DJN A;  5EZG A;  1UI5 A;  2ZOY A;  1XG1 A;  1U9O A;  1MSF C;  3O8G A;  4XRM A;  2LVS A;  2HI3 A;  3BTI A;  2O8K A;  4FIS A;  2WAQ N;  1SGM A;  4ACI A;  4X1E A;  4IEJ A;  3HE0 A;  2ME6 A;  4GFK A;  1TWA J;  1U78 A;  1ETV A;  2K9S A;  4XIC A;  3BR2 A;  5EG0 A;  3VW0 A;  3BTC A;  2NX4 A;  3JRB A;  3S1N J;  1QPI A;  3HOV J;  3S15 J;  5IPA A;  3BNI A;  2Y2Z A;  2DA5 A;  1H8A C;  2FJ1 A;  1BA5 A;  5C44 J;  3FK6 A;  2Y30 A;  4G12 A;  1FJL A;  5E3L A;  4MFE A;  1BL0 A;  2D5V A;  4GCT A;  2NS8 A;  3WHB A;  1B72 A;  2QCO A;  3LNQ A;  3TW6 A;  1SFO J;  2GFN A;  5EF6 A;  4QIW N;  1WH5 A;  3HOW J;  4A69 C;  3KZ9 A;  3B81 A;  2XB5 A;  3GZI A;  5D19 A;  2CRG A;  2DMP A;  3MKL A;  2IAI A;  3RD3 A;  1Z77 A;  2HOA A;  4L5E A;  1APL C;  2CUF A;  3FIW A;  2XGD A;  2HYT A;  3W6V A;  2CQQ A;  2PBX A;  2LK2 A;  4AUX A;  4A3B J;  1ZKG A;  4JX6 A;  2GEN A;  2JWT A;  2OF7 A;  1ZK8 A;  3BG5 A;  2GM4 A;  1WGX A;  2L7F P;  1JGG A;  2DMN A;  2MSY A;  1ETK A;  2WGB A;  2JJ7 A;  2M34 A;  3ZQI A;  5E3M A;  3BR3 A;  5C4X J;  2XGE A;  2O7T A;  2R5Y B;  3O60 A;  5FKO A;  5IYD J;  5FKN A;  3PAS A;  1YRN B;  4RBO A;  3S14 J;  2JN6 A;  2FBQ A;  4CGR A;  3Q0U A;  5C4Y A;  3Q3S A;  1K61 A;  2KT0 A;  2WUI A;  3BG3 A;  2NVQ J;  2EZK A;  3HIM A;  3UKG A;  1HOM A;  2ECC A;  5C3E J;  3HB9 A;  4AC6 A;  2CJJ A;  1ZR4 A;  3DPJ A;  2ZOZ A;  4C3I J;  2OI8 A;  3D1N I;  4MLO A;  1T33 A;  1I50 J;  2ZCX A;  1JJ8 C;  3JRF A;  2R0Q C;  1W0T A;  2XPV A;  2FD5 A;  3G1L A;  3V78 A;  2W48 A;  1RR7 A;  2DG7 A;  1LE8 A;  2NOG A;  2YUS A;  4NDL A;  3BT9 A;  2DA1 A;  4AYB N;  2XPW A;  2X6O A;  4C3H J;  4X6A J;  4ABZ A;  3AQT A;  2XPU A;  1POG A;  2XSD C;  2CU7 A;  1GVD A;  3Q0W A;  3C2B A;  4C3J J;  1AKH B;  1G2H A;  9ANT A;  3HGG A;  4HKU A;  1JUP A;  3C07 A;  2ID3 A;  1P7I A;  2VKE A;  4M6V A;  1RET A;  2AO9 A;  3HTA A;  1JTX A;  2JA7 J;  1R9T J;  3PO2 J;  4B1R A;  2H1K A;  3IH4 A;  4DYR A;  4V2F A;  2IU5 A;  2PMZ N;  4JNN A;  5DS9 A;  2JA5 J;  1FIA A;  4MO7 A;  3G1M A;  1F36 A;  3BRU A;  1PUF B;  4UUS A;  3HTJ A;  1UI6 A;  3K2A A;  4S0H B;  4D7M A;  1IC8 A;  2TCT A;  2YS9 A;  4A3E J;  1DU0 A;  5F0C A;  3OSF A;  3B6A A;  3RH2 A;  2VUM J;  2COB A;  2QOP A;  4D5C A;  1TC3 C;  3BTJ A; 
#chains in the Genus database with same CATH topology
 5K1Y A;  4EVI A;  3LSH A;  4XON A;  2VI6 A;  2R7S A;  1J7K A;  1TL8 A;  5H9T A;  2L7M P;  3PFY A;  5D5X B;  1JKO C;  1W7P A;  3T8T A;  1XSD A;  3CJQ B;  3TED A;  2RQQ A;  1J2X A;  3CDH A;  1DP3 A;  2KZG A;  2O61 A;  2PMZ A;  4RGR A;  3S8P A;  2VT2 A;  1X3Z B;  5EGO B;  1FP1 D;  2IGK A;  3I56 I;  2V6E A;  3I4N J;  1U9N A;  3DCF A;  1TZL A;  3OMY A;  4UB8 C;  3RQ4 A;  3IRQ A;  5CXI A;  3G6E I;  3KX2 A;  4BQO A;  3MVP A;  3E1S A;  2OCE A;  3QQA A;  1Y8R B;  1IV6 A;  1G3S A;  2XB0 X;  3BTL A;  2R7Z J;  4IKF A;  4YEJ A;  4F91 B;  3WTY C;  3HGY A;  4UVA A;  3DXJ F;  1BC8 C;  3DU6 A;  3MQ0 A;  1MNM C;  4KFC A;  1VQ6 I;  4PJL A;  2DA4 A;  4EJT A;  3PM1 A;  3FXQ A;  4LG3 A;  1ZRD A;  3HHH A;  4E7L A;  2QQ8 A;  2VBZ A;  1KU2 A;  4XKC A;  2ID6 A;  4DNC A;  4BQQ A;  4KIC A;  2VXD A;  2VOP A;  3PNV A;  2E1O A;  2KFD A;  3ABK H;  2VLA A;  1BIA A;  3ON2 A;  5H2F C;  3J7Z I;  5CKT A;  4ITV A;  1LPQ A;  2O5R A;  2W84 A;  3L2U A;  3M8J A;  1Z05 A;  2RNJ A;  1FZP B;  4R1H A;  4I7H A;  2JQ7 A;  4A93 J;  2X0L A;  2L4A A;  5D6F A;  4A6E A;  2L4M A;  2MC4 A;  4CCL A;  2NRA C;  4UUT A;  1IN6 A;  3AL0 B;  3NNR A;  1R22 A;  2X9D A;  3S3N A;  4LLG F;  1Y1W J;  4BY7 J;  1S72 I;  1JKR C;  2QSH X;  4BY1 J;  2CMP A;  3IWZ A;  2ZJP F;  3ERM A;  2Y0S A;  4Y33 A;  4JQF A;  3AKZ A;  4A3F J;  1Y39 A;  2DA7 A;  5IYC J;  3S1R J;  3HUG A;  5JHU A;  3H9G A;  4FE7 A;  3PQK A;  2HOS A;  1ETO A;  5CVI A;  5DM6 F;  1QPM A;  4HOB A;  5F27 A;  4UDS A;  2VL8 A;  3EGQ A;  3ZQH A;  1EH6 A;  3BJO A;  2MD5 A;  3QAH A;  4UUS B;  2K3F A;  3RPU D;  2CUZ A;  4RM2 A;  1FYL A;  1K7A A;  4RB2 C;  1WCM J;  1JKP C;  1P7J A;  2R7F A;  3RDI A;  4ZYE A;  3SZP A;  3D0S A;  2WC2 A;  5LGN A;  2HYJ A;  3A02 A;  4IQJ A;  2DQR A;  4XID A;  2KIM A;  3OYD A;  4GCL A;  4I98 B;  2ZNY A;  3B02 A;  4EQQ A;  2ESH A;  4YRV A;  1N77 A;  4ETS A;  2K4B A;  1OR7 C;  2HFH A;  4CHU A;  1SVO A;  2ZKZ A;  1GHC A;  3Q0V A;  5LRS A;  3U2R A;  4GFL A;  2RV8 A;  1O4X A;  3KZI C;  1IXS B;  2Y9Z A;  5FKL A;  2OJE D;  4KMF A;  2RN7 A;  5HAW A;  1TW3 A;  1X3W B;  4QSH A;  3WHC A;  3GTL J;  2BVL A;  2VBY A;  4P9F A;  1M1E B;  3ML6 A;  2R5Z A;  3FX3 A;  1YYV A;  1ETW A;  1K79 A;  3ECH A;  3SZT A;  3F23 A;  1BR2 A;  1BW5 A;  3VOX A;  3VVY A;  4OIP F;  1FSH A;  1EF4 A;  2JZY A;  3F6V A;  2P5L C;  1H9G A;  1XB4 A;  3EUP A;  3E5U A;  2CW7 A;  3ZQF A;  4D7N A;  2UXU A;  3OYG A;  2EH3 A;  2XAQ A;  4BYY A;  5FJ8 J;  3CCU I;  3HPG A;  2CFX A;  2KIS A;  3IUO A;  2E2J J;  2NS0 A;  1Z7U A;  5CVJ A;  2ZJR F;  1YHQ I;  1SFK A;  1LE8 B;  1OKR A;  2NNN A;  1H88 C;  2P7V B;  4O6J A;  1SMT A;  4CYC B;  4BDY A;  2LY1 A;  2VQG A;  2R92 J;  1G8X A;  4JP0 A;  2R5Y A;  4J01 A;  3RKW A;  3LSP A;  2PJR B;  1UG0 A;  4B4C A;  3MKW B;  1FTZ A;  4A3J J;  1TP4 A;  3UR3 C;  4AC0 A;  1BL0 A;  3HEF A;  2OBP A;  2DOE A;  5E1W A;  4PZJ A;  4F52 A;  1IG7 A;  1VQ7 I;  2GXB A;  3ZXS A;  4RA2 A;  2KIQ A;  3ULQ B;  4JKZ A;  2DLL A;  2ME0 A;  5F0H A;  4GGG A;  4XRS A;  1YW8 A;  4IRI A;  3M3Y J;  3NPI A;  5BMZ A;  2COM A;  3LSK A;  5KAF C;  3GFI A;  5ICC A;  4EGZ A;  4L9V A;  4PK4 A;  4GO1 A;  3CC7 I;  5FLV A;  2Y0M A;  3M8E A;  4LK1 F;  1V5G A;  5DAJ A;  1FMV A;  1QVT A;  1S5L C;  3HOX J;  2XRL A;  2Z1D A;  1R5G A;  3BCG A;  1HDP A;  1YLF A;  3TO6 A;  4RMN A;  2HS5 A;  3CTA A;  4W97 A;  4RGS A;  1XS9 A;  3BJB A;  3BG6 A;  1XX5 A;  2PEX A;  5GP9 A;  2MLG A;  3LA2 A;  1RPW A;  3ANP A;  5CW8 A;  3JRH A;  5J4V A;  3HJE A;  1IRG A;  2LRD A;  2K9M A;  5D4R A;  1PDN C;  4MXM A;  3KEO A;  1WJE A;  1X1A A;  2IBD A;  1SEU A;  1D5Y A;  1O3T A;  2LD5 A;  4Q48 A;  1WHU A;  2KJC A;  1ZYR F;  3R0A A;  4Y4R A;  1OCP A;  3VPR A;  4EV0 A;  5JVT A;  2L0K A;  4ZJZ A;  4G7H F;  2DU9 A;  2K40 A;  2FEZ A;  2G7U A;  4A3L J;  2TDX A;  3IH2 A;  3S3O A;  2IGN A;  1ZLK A;  2PJR A;  3PL8 A;  1U5T C;  3WE3 A;  5FRN A;  2Q24 A;  1SAU A;  3OOU A;  4IJA A;  1JHH A;  2QWW A;  4I0B A;  3S3M A;  2MH9 A;  2IRF G;  4IRG A;  2Q0O A;  3PPB A;  3VYS B;  2QYO A;  4UVB A;  4FHT A;  4A3G J;  1SFE A;  3V6G A;  2A5W A;  2NVY J;  3OOP A;  2R7D A;  1WJB A;  2WV1 A;  1I3Q J;  3HRU A;  3TDU C;  1IN8 A;  1D1B A;  5LLQ A;  2WWY A;  4GDF A;  4A3C J;  1JUM A;  4N9I A;  4RLQ A;  1SAN A;  2FUG 2;  1NK3 P;  2VPL A;  3TP0 A;  3G3Z A;  3LHQ A;  2RVC A;  2M0C A;  4AVZ A;  1RNL A;  2IVM A;  4XN3 A;  5FLM J;  2QF7 A;  1KYZ A;  5EEA A;  2PN6 A;  4IRH A;  2VE9 A;  1G59 A;  2ZBK A;  3F21 A;  5L3F A;  4EM1 A;  1LDK B;  2HZT A;  1WJA A;  5HVQ C;  5BOX A;  3CP2 A;  2IS6 A;  2LF8 A;  2G7S A;  2XGC A;  3S17 J;  4L62 A;  2Y9Y A;  5FHP A;  3IWF A;  1XSX A;  1VND A;  2XDN A;  4KNY A;  1MNE A;  2D6Y A;  3ECO A;  3S2H J;  3FXL A;  4ENJ A;  2E35 A;  3VUQ A;  2X48 A;  2DG8 A;  1MJB A;  1P2F A;  3FMQ A;  4S05 A;  1T6S A;  2QZ8 A;  2ESN A;  3J7Y J;  3CMA I;  1H89 C;  1Z3Y A;  1JTY A;  3FM5 A;  4CZC A;  2BHY A;  1V54 H;  4FAS D;  5KAI C;  4MGR A;  2IA2 A;  1BI3 A;  3V7S A;  3RYP A;  1FWZ A;  5DCF A;  2IJL A;  4QTR A;  2DAO A;  3BRO A;  3G56 A;  2XF6 A;  1X1P A;  2G9W A;  3M4O J;  1O57 A;  4FCY A;  2RNG A;  2AHQ A;  1U8R A;  2Q2E A;  5FGL A;  1MZB A;  2LP0 A;  3LJL A;  2HKX A;  1OYW A;  4UXN A;  3LSM A;  3LSR A;  2YPR A;  1FSE A;  4A12 A;  1R1U A;  1R4N B;  4IO9 F;  3C3W A;  1UG2 A;  3JRA A;  1IAW A;  3R6S A;  2IEK A;  1KU9 A;  4L18 B;  1LFU P;  2HKO A;  2XKP A;  5JLX A;  2I8D A;  1ULY A;  2M4G A;  1BW6 A;  4ESF A;  3H3Z A;  3K7A J;  1DU6 A;  3ZQL A;  5GAD J;  2XSJ C;  5FFZ A;  1T0F C;  4KDP A;  3RPQ A;  4G94 A;  1B9M A;  3I5U A;  2LSO A;  2DA6 A;  3V7R A;  5FKM A;  2IS2 A;  1JI8 A;  2DJN A;  5EZG A;  2PFV A;  2VOD A;  2FMY A;  1UI5 A;  2ZOY A;  2KP6 A;  4AIH A;  1R1V A;  4JBA A;  4XRM A;  2LVS A;  1HA8 A;  3HSF A;  1SD5 A;  2HI3 A;  2B3W A;  1KA8 A;  1SGM A;  3I59 B;  3R60 A;  2VE8 A;  1Y56 A;  1ETV A;  1J59 A;  2RGV A;  3BR2 A;  4WWC A;  3BWG A;  3VW0 A;  2K7L A;  5J6X A;  3HOV J;  3BNI A;  5IPA A;  2Y2Z A;  2DA5 A;  4ZDO A;  3FK6 A;  2Y30 A;  4G12 A;  3WHB A;  1B72 A;  2DTR A;  2GFN A;  4QIW N;  3KYC B;  4G9Y A;  3HOW J;  1MMG A;  5E8G A;  2EK5 A;  4UY8 I;  2O3F A;  2CRG A;  2DMP A;  3SYT A;  2I5U A;  1YTY A;  1R6R A;  4YFX F;  2L7K A;  1W1W E;  1Z77 A;  2CUF A;  1ZH5 A;  4UV9 A;  2Q1Z B;  1NG7 A;  2QKM B;  4IOC F;  3W6V A;  4ZH4 F;  3KEY A;  3BOQ A;  4AUX A;  4HF0 A;  3J81 Z;  4B3X A;  5DEQ A;  2OF7 A;  2GWR A;  4CO8 A;  2GM4 A;  3H9J A;  2VQH A;  1MMN A;  5L3D A;  2MD0 A;  1I1G A;  1WGX A;  1JGG A;  3W2V A;  3WTS C;  3BLY A;  3P5J A;  2W85 A;  4PJJ A;  2CQ7 A;  1UEL B;  1TQI A;  3GME A;  3VDX A;  4HQE A;  1E0E A;  3EUA A;  3GF2 A;  3L2R A;  1YRN B;  1UHW A;  4RBO A;  3S14 J;  4WX9 A;  4PDK A;  2XAS A;  3Q3S A;  1K61 A;  1FP2 A;  2KT0 A;  3I64 A;  1R1T A;  4MTE A;  2NVQ J;  2VOO A;  3K6G A;  1W4M A;  3UKG A;  1HOM A;  4AC6 A;  4C9Y A;  2B0L A;  2ISY A;  1G6N A;  1ZR4 A;  3DPJ A;  2UZK A;  3K70 C;  2BY0 A;  4V19 K;  4PJN A;  2IS1 A;  2XPV A;  2DDB A;  3KP6 A;  4L0Y B;  4U9L A;  5AIP A;  1RR7 A;  2CFO A;  3V8J A;  3DLL F;  2VT3 A;  2YUS A;  3CJT B;  2L01 A;  3ABU A;  4NDL A;  4PCQ A;  3JCU C;  4HDV A;  1HXD A;  1DGW Y;  2CU7 A;  2G7H A;  4NC6 A;  1AKH B;  2BOL A;  2WAF A;  2BE5 F;  2LKS A;  5ICF A;  5H6Q A;  5CJ9 A;  4B1R A;  2W7N A;  3IH4 A;  4J00 A;  5B5E C;  3GLX A;  5ILV A;  2RRE A;  3F8M A;  1FYK A;  3H9Q A;  3V4G A;  3PFI A;  4OMZ A;  4EM0 B;  1BOA A;  4XSZ F;  1BI1 A;  1XDS A;  2M87 A;  3DPL C;  4X0G A;  4UVC A;  3BRU A;  4Z2Y A;  1GXP A;  5L3B A;  1G4D A;  3K2A A;  4D7M A;  1QO0 D;  2AXT C;  2WAE A;  4A3E J;  1W7P D;  2E7X A;  3CCV I;  1WRJ A;  3K0L A;  4OIO F;  3B6A A;  3RI4 A;  2A6H F;  2BVM A;  2COB A;  4OD4 A;  1HW5 A;  2EPF A;  3VSL A;  2HWV A;  3E3V A;  3GW2 A;  1OCZ H;  3BTJ A;  1TQP A;  1SC7 A;  1Z91 A;  2GXA A;  3E97 A;  2ZXI A;  2BY3 A;  2UXH A;  3T6N A;  1QZE A;  1T08 B;  4M3B A;  2R5Z B;  3D5S C;  1MMS A;  4K2E A;  1Z21 A;  4N4N B;  3JRC A;  3KP7 A;  1WJ5 A;  1S9H A;  4HNT A;  2XVC A;  4E7K A;  2PZ9 A;  4GRI A;  3HM5 A;  2A69 F;  4HLX A;  4Y13 A;  4ANJ A;  5KCM A;  2F5D A;  1BI2 A;  4JK1 X;  3LQQ A;  2OER A;  3FXK A;  1D8K A;  1NTC A;  4U0V A;  4XLP F;  1WWX A;  2GA1 A;  5EEG A;  3WGI A;  3P9T A;  4BJ6 C;  4KWA A;  1ORK A;  1T39 A;  5J1Y A;  3PIP F;  5DD4 A;  1QZY A;  2JUC A;  2ZSH B;  1IV8 A;  4XBF A;  3AL0 C;  3ISP A;  1Y0U A;  2EFO A;  2LF7 A;  1HCR A;  1MMA A;  2JRM A;  5K5R A;  2GOX B;  2QBY A;  3VVX A;  2GIZ A;  2RAS A;  2E2H J;  1B4A A;  1XMA A;  4UHT A;  3VOE A;  1FTT A;  3KP2 A;  2MW8 A;  3BG7 A;  4YIF A;  1RKW A;  4B43 A;  5K7Z A;  5EDN A;  3ABL H;  1EH8 A;  1I27 A;  3NXC A;  1UB9 A;  3H5A A;  2DFE A;  2OA4 A;  1QVU A;  1X58 A;  3S5R A;  3BG9 A;  3DPU A;  3KCC A;  3ABT A;  1TNS A;  4WXC A;  2KDZ A;  4F93 B;  2ELK A;  2WV0 A;  4AID A;  2V9P A;  2XAF A;  3JRI A;  4CYC A;  5B3S H;  2M2E A;  4UV8 A;  4XR6 A;  5B66 C;  1ZRE A;  1W5C C;  2WTE A;  5J47 A;  4A3D J;  3FXM A;  1ERD A;  4ENK A;  2PBI A;  1AWC A;  2AXL A;  5ERI A;  3PJR A;  3CUQ C;  4L5J A;  1U8B A;  3IV5 A;  3ON4 A;  1P4X A;  3EUK L;  2K9Q A;  2BY2 A;  5DCM B;  4Y7N J;  4ZDP A;  1IDZ A;  4M74 A;  5CPR B;  5D1R A;  4ZTJ A;  4NN1 A;  4PFO A;  3HZJ A;  1K83 J;  4HW0 A;  1T56 A;  1FBQ A;  1KQ8 A;  5IOZ A;  5GPC A;  4KIG A;  4FX4 A;  3HOS A;  4B09 A;  2MYS A;  3ZCO A;  3T0Y A;  5K7F A;  3TP3 A;  1LJ9 A;  3K4K A;  1WQ2 A;  1MBK A;  2HQR A;  4GCV A;  3GEU A;  1Y8Q B;  1LNW A;  4KT6 A;  1GV5 A;  3ZQQ A;  5ICE A;  2YVE A;  3EUH A;  1MJA A;  2XRN A;  3ZMZ A;  4IX7 A;  2KZV A;  2HDD A;  2FA5 A;  3K4B A;  2M8G X;  1YS6 A;  3OS1 A;  2YU9 J;  4BS9 A;  5AQC A;  3WGH A;  1IF1 A;  6PAX A;  3A1Y A;  2L54 A;  1WSU A;  1IJW C;  1F4K A;  5DYM A;  4YZE A;  1Z3X A;  4LD5 A;  4DZP A;  3FM3 A;  5ILS A;  1GVJ A;  1C0W A;  4JYK A;  2B63 J;  2DJI A;  4CH7 A;  2JT1 A;  2BW3 B;  2P5V A;  2NVT J;  4C2T A;  4OAY A;  3ZMD A;  4E6K G;  2VQC A;  3TMO A;  1YG2 A;  3OYA A;  2OTL I;  4LG0 B;  1EKE A;  1OYY A;  4CXF A;  1IXC A;  2EZL A;  4XKW A;  5E18 F;  3W2W A;  4AIK A;  1JKQ C;  1S8N A;  3ANG A;  1V55 H;  2H6B A;  4BXF A;  4LMY A;  3S1Q J;  1X4P A;  5LGU A;  5D5V B;  2CQK A;  2OU2 A;  4KN4 X;  3A01 B;  3JAM K;  2EFW A;  3TQN A;  2VPR A;  1Z6R A;  1YW9 A;  4LLL A;  4RB1 A;  3MNL A;  2F4M B;  5LEK A;  5K7H A;  3CUQ A;  2VJJ A;  3VEP A;  1HQC A;  1QRY A;  3KPH A;  5HSZ A;  1QHH D;  1YFH A;  5BPD A;  1OMI A;  2EWN A;  2FX0 A;  3F3X A;  1BI0 A;  1IUF A;  5D19 A;  5FLX Z;  3EYI A;  1YJ9 I;  4DQ2 A;  1IN5 A;  4KIT B;  3FZV A;  3HRT A;  1FMW A;  4KN7 X;  2X1C A;  2PJP A;  2K85 A;  3V7C A;  4GYI A;  5D8K B;  2TRT A;  4B48 A;  3CF2 A;  2Y31 A;  2FBK A;  5F1R A;  3R61 A;  3G4S I;  3OYC A;  1FBU A;  2EBI A;  2KKO A;  5CVV A;  3F9K A;  5LRR A;  3L1P A;  1ETY A;  3GX4 X;  2BW3 A;  2G3B A;  5L3E A;  1LEA A;  4LGW A;  3CCM I;  4IHX A;  1LEB A;  4RGX A;  3GTO J;  4MQ9 F;  4BEH B;  4HYE A;  2K02 A;  2CV2 A;  2FF4 A;  2R93 J;  2EA4 A;  1UZC A;  3AG3 H;  3ZMT A;  4F55 A;  2BXY A;  2V79 A;  5M3F J;  4I6Z A;  3F0C A;  1SFU A;  5HOD A;  2ZXJ A;  1WVR A;  3M8F A;  3OR1 C;  2LTP A;  2DA2 A;  2LMD A;  2L9N A;  3N97 A;  3F8F A;  4I02 A;  4BKX A;  5J4Y A;  2I10 A;  1HKT A;  1ZAR A;  3DP7 A;  1OIS A;  3FKJ A;  4U87 A;  2ZME B;  2CGP A;  2H1L A;  3BZK A;  1FX7 A;  3CDI A;  1I39 A;  3IRR A;  5KNL A;  3MAJ A;  2OPT A;  5TIS C;  1OPC A;  3KFW X;  1QQI A;  2W53 A;  2EA2 A;  3E5X A;  4JX5 A;  1VZ0 A;  1Y0N A;  4M6X A;  4DBR A;  4HV6 A;  3GTJ J;  2NVX J;  3IC7 A;  3AQS A;  1Z9C A;  2JVG A;  3GLL A;  1IDY A;  1ZN2 A;  1ZQ3 P;  1ODD A;  1WKM A;  4OIN F;  4XM3 A;  1R49 A;  1GXQ A;  2WY8 Q;  3ESW B;  1MH3 A;  2XIG A;  1AU7 A;  2JPB A;  2N8G A;  3ZRG A;  3HC7 A;  2A5Y B;  1ONV A;  2WB1 N;  2DFH A;  4FE4 A;  3FIS A;  2EQR A;  2A3S A;  2X6X A;  1JT0 A;  1X1D A;  3PQJ A;  4GYG A;  5JR3 A;  5DM7 F;  1WH7 A;  2GUH A;  4BAY A;  3BR1 A;  3T1B A;  1D1C A;  2XGX A;  2E7W A;  2PFB A;  2LR8 A;  1IXR C;  2W82 A;  3SZG A;  1ETQ A;  2X85 A;  2DN0 A;  2WY7 Q;  3MKY B;  1B8I A;  1J5Y A;  3R4K A;  1PUE E;  4C2M J;  1J0R A;  3WG9 A;  4ESB A;  2LKX A;  2BY1 A;  2H09 A;  2BXZ A;  4XRS G;  1DDN A;  3ZQC A;  3ZOB A;  3FBN B;  4QWQ A;  1WJC A;  5HNF A;  5HLG A;  1FPQ A;  2REK A;  1MW7 A;  3H0G J;  4N4O B;  1ZHF A;  2EZH A;  3CP8 A;  4JL3 A;  2OC6 A;  4IHW A;  3OSG A;  1V4R A;  4A3M J;  3QPL A;  3CJD A;  4B8X A;  4A3I J;  3DKW A;  3VYU B;  5E3O A;  1W36 C;  1X2N A;  1VQ4 I;  1GLN A;  4IHS A;  2Z9O A;  5L3C A;  5HLH A;  1SAX A;  4YFN F;  1O7L A;  3O2P E;  2ZXW H;  3HTH A;  2MAB A;  3GCM A;  2X6W A;  4I76 A;  4P96 A;  3JAM Z;  4BAC A;  5J3L A;  3E7Q A;  3DWL E;  4M3F A;  2XC7 A;  1S7A A;  1DPU A;  4BEH A;  4LIT A;  3ZMU A;  4ZTF A;  3BCA A;  2HDC A;  5FD5 A;  3FRQ A;  2PQ8 A;  1EV7 A;  5J8C A;  4LFU A;  1U3E M;  2K86 A;  3LSJ A;  1WI9 A;  2CQX A;  1G3W A;  4EJV A;  5FLX K;  2HQA A;  2J5P A;  5M5Y J;  5EYR A;  3SFI A;  5IP6 A;  2HPM A;  3OIO A;  3DEW A;  1BJZ A;  5LBQ A;  2QEX I;  2RC4 A;  3T5X A;  2M45 A;  3NWS A;  3CF5 F;  2X51 A;  3SHF A;  2FE3 A;  3NI7 A;  3C7J A;  3OS0 A;  1T95 A;  3E5Q A;  3O8G A;  1E3H A;  2ZXH A;  5FD6 A;  1YIO A;  4ZZL A;  2WAQ N;  2PI0 A;  4UUV A;  4GFK A;  2CQN A;  1Y6I A;  2L5Q A;  1ZRC A;  3HG9 A;  5EG0 A;  1XD7 A;  2DYR H;  3K70 D;  2IP2 A;  3BTC A;  2NX4 A;  2XAU A;  3L2W A;  4M9S A;  3S1N J;  4OIQ F;  3VOD A;  3QOP A;  3S15 J;  2OZ6 A;  4NQW B;  5KK1 A;  2FJ1 A;  1BA5 A;  4A5N A;  4LK0 F;  1FJL A;  2X1D A;  2JRT A;  2D5V A;  5E3L A;  4GCT A;  4D9J A;  2F5V A;  1YE9 A;  2QCO A;  1YI2 I;  4UNO A;  4MEY F;  2FBH A;  3TW6 A;  3G71 I;  3LWF A;  5EF6 A;  1B6A A;  1OCR H;  4HQM A;  4CDG A;  2LNB A;  4PSX A;  1QU3 A;  2YVX A;  1BN5 A;  1FOK A;  2XB5 A;  3B81 A;  4RB0 A;  2LDU A;  4AD9 A;  2D1V A;  2VAS A;  3K2Z A;  2RDP A;  3TDZ C;  1APL C;  1XN7 A;  4XLF A;  2HYT A;  2M5W A;  2FSW A;  3HRS A;  3DBH B;  3KIO A;  1NHA A;  2E60 A;  4JX6 A;  5HLI A;  2GEN A;  2FJI 1;  4CA0 A;  1ZK8 A;  3A4C A;  1FOY A;  4I01 A;  2VJ5 A;  5E20 A;  4CGZ A;  2L7F P;  4OIR F;  4HSR A;  4CCN A;  4MQV A;  4HST A;  3C1D A;  2Z16 A;  1ETK A;  2BZT A;  2WGB A;  2QSF X;  1K6Y A;  2LBF A;  3PAS A;  4MHG A;  3HUG B;  3OR2 C;  3CCS I;  2FBQ A;  2MH2 A;  3KP5 A;  5IT3 A;  3Q0U A;  2EB7 A;  4AIJ A;  4C2U A;  1USS A;  4CZZ A;  2WUI A;  3RIR A;  1DQU A;  2ECC A;  3FMR A;  3HB9 A;  1BJA A;  1SFX A;  3LA7 A;  4EGY A;  5HS9 A;  2OI8 A;  3OYM A;  3K1M A;  2ZCX A;  3JRF A;  5DCM A;  3GYH X;  2YX4 A;  2WBM A;  2DOA A;  4D1Q A;  2HQN A;  4AWX B;  4G6Q A;  2CUJ A;  2ZC2 A;  3BT9 A;  3T8R A;  1E17 A;  4AYB N;  3K4N A;  4G6T B;  3DEE A;  4C3H J;  4X6A J;  3F22 A;  3FWE A;  5CYV A;  1POG A;  2OQG A;  2XSD C;  5CVR A;  4DIQ A;  2VXZ A;  3Q0W A;  4BE1 A;  1XGN A;  1P92 A;  3GZ5 A;  2LH9 A;  5TRD A;  2D45 A;  1G2H A;  2Z33 A;  4R8H A;  2ID3 A;  3I9V 2;  5D5W B;  2AO9 A;  3HTA A;  1PP8 F;  1QBJ A;  1S3J A;  5H20 A;  2V4J C;  3ROU A;  3F8B A;  1IN7 A;  2VN2 A;  2PMZ N;  2QVO A;  3AG4 H;  1XSV A;  4JNN A;  2JA5 J;  1FIA A;  1SVM A;  3LL7 A;  2DQL A;  1R4M B;  1PUF B;  3M1E A;  2HPI A;  4II2 A;  1UI6 A;  1I1S A;  3L09 A;  4KA4 A;  2YS9 A;  2DDA A;  4RM3 A;  2HTS A;  2V1U A;  4Q5S F;  1DU0 A;  2KPM A;  4BDZ A;  3LQR A;  4FET A;  2QQ9 A;  1K4S A;  1I5Z A;  3OYK A;  2F2E A;  4GXO A;  1BOB A;  3OYE A;  1T38 A;  2DO7 A;  2LOO A;  4D5C A;  5HS7 A;  2X4H A;  4UB6 C;  4L0Z B;  2CWE A;  2QGU A;  1V5F A;  3IP4 B;  1BR4 A;  3VSK A;  1LFB A;  2RHA A;  4XKB A;  1OCT C;  3Q5F A;  3EUH C;  5ICG A;  3HKZ N;  3IH3 A;  4ON0 A;  3FXJ A;  3HSR A;  1R5I D;  3HDD A;  5DTD A;  1X19 A;  3IKV A;  4BH9 A;  3JR9 A;  2GOM A;  4NC8 A;  5LGT A;  2UV1 A;  3OY9 A;  4IL6 C;  3SEZ A;  1H9T A;  5K5Q A;  1RR8 C;  3VVZ A;  1AA7 A;  2IXS A;  4QLC U;  2G0E A;  3D5L A;  1Z0X A;  2CV0 A;  2O8X A;  2Z2S B;  3OIQ A;  3BZC A;  3VYR B;  1WJD A;  5HDG A;  1JGS A;  3BJ6 A;  3OYB A;  2LLK A;  4D5F A;  4G7O F;  2ZCW A;  3MN2 A;  3F1B A;  5JLW A;  4LLN A;  3EQL F;  2HVS A;  1BR1 A;  3G7R A;  5J40 A;  3GBG A;  4M9X A;  1UST A;  2DCE A;  4ASN A;  2E2I J;  5IT9 K;  1HKS A;  1YX3 A;  3PUF A;  2JA8 J;  1QHG A;  3BPV A;  4E70 A;  3WTV C;  5KHD A;  4FT8 A;  1ZEL A;  4J19 A;  1O3Q A;  4MNU A;  1ITY A;  2HEO A;  1AHD P;  4BQN A;  4HDU A;  3S16 J;  3DBR B;  1MBE A;  1J9I A;  2YU3 A;  1ZRF A;  2LRE A;  4A0Z A;  2K9N A;  1MKM A;  3FK7 A;  3CME I;  1W0U A;  3QKX A;  2FRH A;  1GV2 A;  4ENM A;  1XCV A;  4RAZ A;  1A36 A;  4N0B A;  5CXG A;  2ZY9 A;  3BCB A;  3EYY A;  4H4K C;  4RAY A;  5E79 C;  1G3T A;  3Q9V A;  4PJ0 C;  1MSE C;  2ZCM A;  2EIN H;  4DYQ A;  4DYC A;  2RAE A;  4Y17 A;  1T8I A;  4OMY A;  2ACJ A;  2HVQ A;  3TOA A;  2DT5 A;  4M3E A;  4XRF A;  3RTR A;  2LKP A;  2R7X A;  5D18 A;  3DFG A;  4PGH A;  1I3A A;  2DFF A;  4ICH A;  3P7N A;  1LDD A;  3IHU A;  2NXN B;  3CCQ I;  2BHZ A;  4EMS A;  1FIP A;  2VJ4 A;  1PUF A;  5EFY A;  4RLF A;  2D2W A;  5FGM A;  3GFM A;  5IOY A;  3R0J A;  4Q47 A;  4RDU A;  4BE2 A;  1JT6 A;  1REP C;  1O3R A;  5HNH A;  2FU4 A;  1F43 A;  1SD6 A;  2QEN A;  3I0T A;  3VIB A;  5F0F A;  1PJR A;  2HXO A;  1J09 A;  4XLA A;  2AQE A;  4YEL A;  3CCE I;  2L7Z A;  4I09 A;  2ZME A;  2UXO A;  1ZLJ A;  3L2C A;  2GAU A;  2YR2 A;  3CMM A;  2M8E A;  3KZY A;  4V2G A;  4DZJ A;  3CRJ A;  3VW1 A;  2R7Q A;  2H8R A;  5LHH A;  2ZJ2 A;  3U9G A;  2DTZ A;  3MZ8 A;  4CCM A;  4ZYG A;  1F5T A;  5F1J A;  1VF9 A;  3IL2 A;  2KRH A;  1XGO A;  1G3Y A;  1WJF A;  3DPT A;  4FTH A;  2V9K A;  2XAJ A;  3KKD A;  4HRI A;  2X1E A;  1ZGW A;  3CCR I;  4M71 A;  2DMQ A;  2VQL A;  5E8I A;  3H3V K;  1RZ4 A;  1PVE A;  1ON1 A;  4CIC A;  1MDM B;  1KQ0 A;  2JA2 A;  2WAD A;  2GA2 A;  2L9R A;  1Z6T A;  1TWG J;  3I3L A;  4G6D A;  4U88 A;  2HYF A;  3BQY A;  3NAR A;  3W6K B;  3FKI J;  5J1R A;  2DK5 A;  4HF1 A;  4BJT A;  3WU0 A;  4KIF A;  2A68 F;  2UXP A;  2LBF B;  1B8I B;  3WE2 A;  3HRM A;  1E3O C;  3VP5 A;  1A6I A;  2EJR A;  1ZGA A;  2K4J A;  1ZGJ A;  2P8T A;  5HS8 A;  3U1K A;  2FML A;  3CLQ A;  3NAU A;  2F5F A;  4IQ4 A;  4RB3 C;  3GTK J;  1GDT A;  4HF2 A;  2HVR A;  1K6O A;  3H0D A;  3U21 A;  2E1N A;  3DTI A;  1W7P B;  3GZ6 A;  3V8K A;  3ZPL A;  3A2K A;  4L5I A;  3RQI A;  1TC3 C;  1FNN A;  1T0F A;  2E34 A;  2XUB A;  1KU7 A;  1BC7 C;  1P9Q C;  3BHQ A;  3JRE A;  3CCL I;  4XLE A;  4AYB A;  3GXO A;  1E3P A;  2KJB A;  3KE2 A;  1Q1V A;  2EV6 A;  3WTU C;  2DOF A;  3M07 A;  5M3M J;  4NNJ A;  1WPK A;  1LVA A;  2W24 A;  5JVG F;  4XLH A;  2ZME C;  3H5R A;  5IP9 J;  3P9I A;  1YQA A;  1CQT A;  2MC3 A;  1FEX A;  2M3A A;  5C4J J;  1D8J A;  2O6G E;  2BV6 A;  1ETX A;  2KDO A;  1HW2 A;  2H27 A;  4L9J A;  2B1E A;  4LB5 A;  3A03 A;  1QZZ A;  4BBS J;  2F48 A;  2OAZ A;  4I99 C;  3GWZ A;  4WK8 F;  5CVU A;  3IUV A;  4U7B A;  1TWC J;  2DYS H;  1IRX A;  1L3L A;  3K69 A;  2XDV A;  3K8P C;  1PP7 U;  3ZQ7 A;  3LWJ A;  2E1M B;  5EGO A;  2LFB A;  3VOK A;  2HKU A;  2DMU A;  1U5T A;  5GTI C;  2M30 A;  1L0O C;  2XAH A;  2QWT A;  1RI7 A;  2VBW A;  1VQP I;  2FOW A;  3IAM 2;  5E17 F;  2KIF A;  1BBY A;  2R3S A;  4DJA A;  1VFC A;  2K27 A;  2NP3 A;  4CCO A;  4MFD A;  3HTS B;  1RKT A;  4M9Z A;  1I6H J;  3FXU A;  1IO2 A;  3QU3 A;  4HX8 A;  3CZ6 A;  1YRN A;  4BUP A;  1YJN I;  3J7A O;  1SD7 A;  5F08 A;  3LOC A;  3RCO A;  2XF5 A;  2XHK A;  3P9C A;  3NEU A;  2R7O A;  2HYG D;  2DW4 A;  1DGR M;  2BYV E;  1X4O A;  2IGM A;  3CUQ B;  4NC7 A;  4QPQ A;  3IAS 2;  3F6O A;  3M7G A;  4C30 A;  4MIM A;  1B59 A;  3EET A;  2VC0 A;  3A01 A;  3HTI A;  1S6L A;  3DU5 A;  1YO5 C;  2NNY A;  1TQM A;  2NYX A;  1VQL I;  3CO7 C;  2V57 A;  1VQN I;  4M3G A;  1JHF A;  5DD8 A;  2YVH A;  1QGP A;  3FXR A;  3K9T A;  2DT6 A;  4A0Y A;  1LB2 A;  3KEQ A;  2EIL H;  5JHF A;  2H8W A;  3EPZ A;  4M73 A;  4BU2 A;  3BY6 A;  2M9H A;  4ENN A;  4BBR J;  4JX4 A;  3LAJ A;  4E7J A;  5D6E A;  3J80 Z;  3NRV A;  4U7D A;  1A5J A;  5BNG A;  5LHG A;  2QIB A;  2GLO A;  4U0W A;  4WF2 A;  3MKZ A;  4LB6 B;  4PGG A;  3K10 A;  3PO3 J;  3TL4 X;  2QSG X;  1OJL A;  3GVA A;  1GUU A;  3K4C A;  3S1M J;  4ESJ A;  1YW7 A;  4PFP A;  5J1U A;  1PYV A;  1XMX A;  3B6C A;  3G73 A;  2R7W A;  3L7W A;  3LFK A;  4XNF A;  1P6R A;  5M5W J;  2JMW A;  3ERE D;  4M3D A;  3M9A A;  3LA3 A;  4ZYA A;  2BBY A;  3K4J A;  3DEU A;  3HOT A;  3I4M J;  4OU0 A;  3GZN B;  4Y52 J;  2HNH A;  1VI0 A;  3GTM J;  2DA3 A;  2UXX A;  2HTJ A;  3SDB A;  3OYF A;  2E1C A;  1Y1V J;  3OS2 A;  2A05 A;  3UNG C;  4P55 A;  3KP3 A;  2G7G A;  4ZDL A;  1J75 A;  1T2K A;  4OAZ A;  1XG1 A;  2P5K A;  1U9O A;  1MSF C;  1VTN C;  3E6C C;  1R36 A;  5AIQ A;  4FIS A;  4RAG A;  4ACI A;  5FRM A;  4X1E A;  4IEJ A;  1D1A A;  1TWA J;  4BHB A;  2K9S A;  4HV5 A;  4L9T A;  2XRO A;  5FRO A;  3OYN A;  1NH3 A;  3JRB A;  4XMY A;  3OYJ A;  2R7V A;  3BJA A;  1ZAO A;  2L9V A;  2P6S A;  5C44 J;  1X1C A;  3Q9S A;  4HEA 2;  3AFH A;  1MGT A;  3HTU A;  3J81 K;  1X1B A;  3LNQ A;  1UFM A;  2PMU A;  5FO5 A;  4ZYD A;  1SFO J;  1WH5 A;  2DT7 B;  2O03 A;  3KZ9 A;  3KLN A;  4IHT A;  1ACI A;  3WTT C;  2P4W A;  2LG4 A;  2ICW G;  2KMU A;  3RD3 A;  4L5E A;  2J5O A;  4R79 A;  3FIW A;  1F9N A;  1FT9 A;  1B9N A;  2LY2 A;  3FF5 A;  2XGD A;  2FOK A;  4LIV A;  3WG7 H;  4B44 A;  4NHJ A;  2CW8 A;  2Y48 A;  1IUY A;  2CQQ A;  4A5M A;  1TT5 B;  1LVK A;  3RYR A;  2PBX A;  4A3B J;  1ZKG A;  3ZP5 A;  2A61 A;  2DPU A;  2JWT A;  2R4G A;  3AG2 H;  4DGW B;  4II3 A;  1FLI A;  1XCB A;  3BG5 A;  5D4S A;  3E0J B;  3K1N A;  5GAE J;  2F6C A;  2A07 F;  5BS6 A;  1HST A;  2DMN A;  4IZZ A;  3VTI A;  1OR7 A;  3QYB A;  2HOE A;  2W00 A;  2JJ7 A;  3ZQI A;  3DV8 A;  5E3M A;  3BR3 A;  2O7T A;  2P7C B;  3I53 A;  1LKX A;  2HDW A;  1K4T A;  4BL0 B;  2MFZ A;  2JN6 A;  4C2M A;  1Z67 A;  4CGR A;  2M0M A;  3PNT A;  1N75 A;  3ASO H;  2VIX A;  3BG3 A;  2YSR A;  3WTZ A;  3F8C A;  3DKY A;  5C3E J;  1EJ9 A;  4QPO A;  5DV5 A;  3W6J B;  1A04 A;  2ZOZ A;  3DF8 A;  4MLO A;  4B47 A;  2CV1 A;  1LDJ A;  2QBY B;  1JJ8 C;  2KL4 A;  2R0Q C;  3V42 A;  4A0X A;  3W2A A;  2FD5 A;  5GTH C;  2QLZ A;  3G1L A;  3V78 A;  1FY7 A;  1IN4 A;  2W48 A;  3E6M A;  4YFK F;  1VQK I;  3H1C A;  3HKZ A;  3CES A;  4RAF A;  3HYI A;  3WU1 B;  2Z99 A;  2DA1 A;  5FFX A;  2VB6 A;  1KZH A;  2X6O A;  1KYW A;  3H35 A;  4IVN A;  1S29 A;  2XPU A;  1QA6 A;  1GVD A;  1H0M A;  3V8L A;  1VQ5 I;  5E1X A;  3HSE A;  1UCR A;  4C3J J;  1A31 A;  2VJI A;  1UAA A;  3VWB A;  9ANT A;  3HGG A;  1LQ1 A;  4HKU A;  2WB1 A;  3J7A Y;  3FMS A;  1P7I A;  2NAZ A;  4M6V A;  2M4K A;  1JTX A;  2JA7 J;  3PO2 J;  1YJW I;  3DLA A;  3ZMV A;  2Q8K A;  3FBI B;  2IU5 A;  1V5E A;  3BZ6 A;  1Z1D A;  3REO A;  2HZD A;  1A6Q A;  2MBF A;  2L2O A;  4MO7 A;  3G1M A;  4N9H A;  2IGO A;  2RKH A;  4OOI A;  1VQ8 I;  2E71 A;  3ZN1 A;  5EJC A;  3HTJ A;  1F1Z A;  2NOJ B;  4S0H B;  4HAM A;  3QYE A;  2V26 A;  2EIM H;  5F0C A;  3N05 A;  3RH2 A;  1OQY A;  5HDK A;  1FOX A;  2QOP A;  2VC1 A;  4L9N A;  2DI3 A;  2F4O B;  4BGD A;  3GUD A;  2V1N A;  1YOV B;  4RGU A;  1W5S A;  2QKL B;  3ZN0 A;  3JSJ A;  1MH4 A;  5JFR A;  1Z7L A;  4O5V A;  1IZ1 A;  1HLV A;  4XK4 A;  4EEF G;  2ZO4 A;  2BEO A;  1CF7 B;  1TTY A;  1GT0 C;  4IRV A;  2FQ4 A;  2P0W A;  3PUB A;  3G1O A;  3QPS A;  2JK3 A;  1ZTR A;  2MGQ A;  4IF4 A;  2V1X A;  5DUK A;  3BPX A;  4CCJ A;  5LEJ A;  5EG0 B;  3MEX A;  4WXH A;  1WZ2 A;  3OYI A;  3D5R C;  2JPC A;  3KYL A;  2ZNZ A;  3CC4 I;  3NRG A;  4HNV A;  3MZH A;  2EIK H;  3CMY A;  5E1Z B;  2IA1 A;  3ELK A;  2EV0 A;  3TO9 A;  1HBX G;  2HOT A;  5TGT A;  3A0B C;  1R71 A;  3RKY A;  1MD0 A;  2EFP A;  3KKC A;  4H0E A;  3OYH A;  3HOZ J;  4M6Y A;  1JE8 A;  1U5T B;  2CUE A;  3QBM A;  5CQG A;  4F3Q A;  4DW6 A;  3JRG A;  5IP7 J;  5CQE A;  5D8L B;  4CCK A;  2HXI A;  2QTQ A;  1YIJ I;  3O6B B;  4ZC3 A;  2E5Z A;  2DMT A;  1B1B A;  3QOD A;  3RKQ A;  2HQ5 A;  3S2D J;  5EEH A;  1TNT A;  4GCK A;  3OL4 A;  4HA8 A;  5IY5 H;  2XV4 S;  2W57 A;  1ZG3 A;  4W1U A;  2OTJ I;  1WI3 A;  5GPA A;  2IT0 A;  4BQA A;  1R7J A;  2JSC A;  2NS7 A;  2VKV A;  2E19 A;  3ONQ A;  1NK2 P;  1HC8 A;  4ZYH A;  1IRZ A;  2NP5 A;  1ZR2 A;  3WOD F;  1EH7 A;  3QYF A;  2OD5 A;  2QA4 I;  1HDD C;  3NS4 A;  4YII A;  4HZF A;  3C2G A;  1YIT I;  2VKD A;  4GFB A;  3OV8 A;  2WAQ A;  4Z6Y A;  3W3C A;  4S04 A;  3LAP A;  2OZU A;  5F6F A;  2ELJ A;  3COA C;  1BM9 A;  1HKQ A;  4XKV A;  1RRJ A;  1D5V A;  4I0A A;  4IHV A;  4TV7 A;  2E5N A;  1JJ6 C;  2Y69 H;  5D5U B;  4A3K J;  2XKO A;  3WTW C;  3MZY A;  5F04 A;  1X2M A;  2AS5 F;  1OFC X;  3CDL A;  4PXI A;  4LOC A;  1MBH A;  3JW4 A;  1DP7 P;  2G7L A;  4EJO A;  2IS4 A;  2YX7 A;  4AF5 A;  2O7O A;  2GQQ A;  4E7I A;  1U6G A;  1HW1 A;  1DPR A;  2PX9 A;  3SQN A;  2OCC H;  3LST A;  3DTK A;  1RES A;  5F64 A;  2KLO A;  1I6X A;  5J8F A;  2P81 A;  2ZJQ F;  1EA3 A;  1MIJ A;  1QNT A;  2GXG A;  1VQM I;  1S7E A;  3TW7 A;  3P9K A;  2E36 A;  2B9S A;  1TWF J;  3HOY J;  2STW A;  3H3U A;  1OYI A;  2OUM A;  5IT9 Z;  3O8H A;  4IXA A;  3NQO A;  4XLC A;  5LFA A;  1LFP A;  3J80 K;  3L2Q A;  1JUS A;  2R7R A;  3BP8 A;  1MBF A;  2ECB A;  1NG6 A;  4JOM A;  1O3S A;  5LD2 C;  1MJ9 A;  3DTE A;  3QPH A;  4F7Z A;  3CO6 C;  1CF7 A;  2Y75 A;  4NBQ A;  4DBQ A;  1O7F A;  2GBY A;  4BE0 A;  4E7Z A;  2F5C A;  2KHM A;  5TJJ A;  1YX5 A;  1MDM A;  4Y3O A;  2CS3 A;  3K4M A;  1AOY A;  2ZB9 A;  3L9F A;  2A6T A;  2QKO A;  4IPA A;  2VKH A;  2IW5 A;  4CYD A;  4ME9 A;  2MG4 A;  1XTA A;  1KQ9 A;  2W4S A;  3GTG J;  3VW2 A;  3TO7 A;  5FB2 A;  1XGS A;  1OCC H;  5FKK A;  3BR0 A;  3TOB A;  2B7E A;  2ETH A;  2WA0 A;  3ABM H;  4FQG A;  4ZZD A;  3MFK A;  5H6R A;  3L2V A;  4IHY A;  4OD5 A;  2VBX A;  1R58 A;  2XF7 A;  3SFZ A;  5A2Q K;  4D0P A;  2UWM A;  3KNW A;  1LUJ B;  2E1M C;  2R7U A;  5IYB J;  4BXX J;  5GAH J;  3VB2 A;  1U0J A;  3ZQG A;  2DXI A;  1MBG A;  5ILU A;  3FDY A;  3N4M A;  3SXY A;  1XC5 A;  1XDU A;  4G8X A;  4A2U A;  3F8N A;  2L9S A;  2EFQ A;  1Q1H A;  3MD2 A;  5M5X J;  3ZR8 X;  2HGC A;  1WFX A;  5ED4 A;  3RJP A;  1IGN A;  1DUX C;  3CQZ J;  2F5E A;  4EJU A;  1FYM A;  5FMP A;  3HHG A;  2ZCN A;  4NEL A;  2IA0 A;  3BDD A;  3H5N A;  2JA6 J;  3JTH A;  2LC2 A;  3GEZ A;  4NB5 A;  2P6T A;  4E7S A;  3HBL A;  1XMK A;  2DK8 A;  2JSP A;  1SMY F;  3E7L A;  3SDG A;  5HDN A;  5K5O A;  4PJM A;  3GTQ J;  1V3F A;  2HU9 A;  2UXI A;  2C6Y A;  3L00 A;  2Y0S N;  5DUI A;  3I59 A;  1UJ8 A;  4XSX F;  2A2F X;  2CO5 A;  2CH0 A;  3RZO J;  2ZFU A;  3S93 A;  1P4A A;  3MMY B;  4M72 A;  4B3A A;  3RPU A;  2NVU B;  4DVY P;  3TKY A;  3FXO A;  2QUF A;  3BR5 A;  1IRF A;  2V6C A;  1T98 A;  4EM2 A;  4RS8 A;  1OLT A;  3CUO A;  1TW2 A;  2OQR A;  4MK6 A;  1TWH J;  2FNP A;  1IW7 F;  4BJ5 C;  3CWR A;  3DBL B;  1X3U A;  2F4I A;  1W36 D;  2PG4 A;  1W5T A;  2FNA A;  3CD6 I;  3BQZ A;  1ZG1 A;  3JRD A;  2K9L A;  3QPT A;  5DDG A;  3I71 A;  2F07 A;  2IPQ X;  2FBI A;  2DPD A;  1D0Z A;  5GAG J;  3WTX C;  2X6Y A;  1UMQ A;  3BR6 A;  3E6B A;  3RZD J;  2A6E F;  2CYY A;  2XAG A;  5HLT A;  1D0Y A;  3ZMS A;  4A6D A;  2ZFW A;  3S2W A;  2QQB A;  3ASN H;  2KIU A;  2EZI A;  5HBU A;  2K3P A;  4EAT A;  4EJW A;  3I55 I;  4DOZ A;  3QOE A;  5EZH A;  3K4L A;  5K58 A;  1HSJ A;  1E2X A;  1B72 B;  4P1W A;  3A0H C;  3PIO F;  3HOU J;  4AVP A;  1R00 A;  4KUM A;  5LHI A;  1HF0 A;  3DKX A;  1JXS A;  3I4P A;  3OL3 A;  3SWH A;  2FXA A;  2O9L A;  2ADU A;  1FC3 A;  3E6D A;  2KRF A;  4WCG A;  3M1C A;  1VQO I;  4XOT A;  3LSG A;  4PUS A;  5A2Q Z;  3SEQ A;  1TBX A;  4OWR B;  3C2H A;  3LSI A;  4WXD A;  3SJM A;  3U1D A;  3PNY A;  3JSP A;  2LY9 A;  3COL A;  5KVR A;  1ENH A;  2MA3 A;  1AKH A;  2D1H A;  1MBJ A;  4KIB A;  3CCY A;  4KIS A;  3GTP J;  3HXL A;  1TLH B;  1D0X A;  3KZZ A;  3QRF F;  3WGG A;  1S7O A;  1UHS A;  3I54 A;  5JI6 A;  4KYW A;  3OIP A;  2W25 A;  2DFI A;  3EDP A;  3JSO A;  3B73 A;  2EFN A;  3O3K A;  4KJZ A;  4HBL A;  2DOD A;  5E3N A;  3FHZ A;  3C18 A;  1RIO H;  3CJR B;  3RKX A;  3HIF A;  2Z3Y A;  3BTI A;  2O8K A;  3VFZ A;  1YS7 A;  4HLY A;  3HE0 A;  2ME6 A;  4WIB A;  1U78 A;  4HPQ A;  4LJZ F;  5BQT A;  3KYD B;  4XIC A;  2CW0 F;  2PLY A;  1ON2 A;  1P4W A;  1QPI A;  2Z5U A;  3I58 A;  3IKT A;  1KU3 A;  1KGS A;  2QM3 A;  3VYT B;  4XOP A;  1H8A C;  1SD4 A;  1STZ A;  1TT0 A;  2LYC A;  4MFE A;  5B1B H;  2M1B A;  4CUG A;  4PSW A;  2NS8 A;  3H36 A;  2GZW A;  2JTV A;  3LFU A;  3PSI A;  1MMD A;  3RSN A;  4I2O A;  2W1O A;  1KON A;  4HNU A;  4XOR A;  4A69 C;  3GZI A;  2O0Y A;  2UUZ A;  2KRC A;  3MKL A;  1SVL A;  2IAI A;  1N78 A;  2HOA A;  3AAF A;  2V1D A;  3KET A;  5AON A;  4NUB A;  4F92 B;  5L3G A;  3HL2 A;  1FOW A;  2V9V A;  2LK2 A;  2H94 A;  4AU7 A;  1ZG5 A;  2GIV A;  3GO5 A;  2RQP A;  2EIJ H;  1MND A;  3QP5 A;  4Y15 A;  3LMM A;  5BPI A;  2EV5 A;  4HG2 A;  2JVH A;  2MSY A;  1K78 B;  1XGM A;  3NWT A;  4HX7 A;  1CGP A;  4XL9 A;  4XLN F;  5HOO A;  2M34 A;  5C4X J;  4CSW A;  2XGE A;  3DQV C;  2R5Y B;  1UHM A;  3O60 A;  1N25 A;  5FKO A;  5FKN A;  5IYD J;  4O3M A;  2R7T A;  4YG2 F;  5C4Y A;  2JUG A;  4MTD A;  4BXU A;  2EZK A;  1D3Y A;  3HIM A;  3AG1 H;  2CJJ A;  4P9U A;  4C3I J;  2STT A;  3D1N I;  3QP6 A;  1T33 A;  2FQ3 A;  1I50 J;  2PMH A;  1A35 A;  4E4H A;  1W0T A;  1K78 A;  3S32 A;  3QWL A;  3PSF A;  4BHC A;  5B1A H;  2M7B A;  4G7Z F;  2DG7 A;  4XN0 A;  3BC8 A;  3CLO A;  1LE8 A;  2NOG A;  3H92 A;  1U2W A;  3FHN A;  2QQA A;  2XPW A;  3F72 A;  4MEX F;  3HPH A;  4ABZ A;  3AQT A;  4E7H A;  1OCO H;  4LIU A;  2H6C A;  5CLS A;  3GFJ A;  3WU2 C;  1RUN A;  4NQW A;  2MLK A;  1BIB A;  3MCZ A;  2ELH A;  3C2B A;  3MWM A;  2M7A A;  3G2B A;  2CG4 A;  1JUP A;  3CC2 I;  4IOA F;  3C07 A;  2VKE A;  1RET A;  3JTG A;  4BHP A;  3X2Q H;  1R9T J;  2H1K A;  1FBS A;  1RUO A;  4FX0 A;  2OV7 A;  4DYR A;  3TGN A;  4V2F A;  4BNC A;  2BGC A;  2UXN A;  2K5C A;  4Q4Z F;  5DS9 A;  2Q2E B;  4AM3 A;  1RC9 A;  1F36 A;  3GFL A;  2L3D A;  2ISZ A;  4P5O A;  4U9N A;  4UUS A;  4XQF A;  3TBI A;  2VON A;  3CCJ I;  1IC8 A;  4KMU X;  1R5H A;  2TCT A;  4KT5 C;  3CJN A;  3ZGK A;  1XPX A;  3KLO A;  4LG0 A;  1R23 A;  3QU6 A;  2ZSI B;  2DBB A;  4HX4 A;  3OWT A;  3OSF A;  2CSO A;  4YIR X;  2VUM J;  4U0Y A;  2AQF A;  1VQ9 I;  2HR3 A;  2V7F A;  3K1P A;  3KP4 A;  2L02 A;  3OYL A;  2KQR A; 
#chains in the Genus database with same CATH homology
 3JSJ A;  1MH4 A;  2UXH A;  2VI6 A;  3T6N A;  1HLV A;  4XK4 A;  4M3B A;  5H9T A;  2L7M P;  4EEF G;  1LFB A;  2R5Z B;  2RHA A;  1JKO C;  1OCT C;  1GT0 C;  3HKZ N;  3JRC A;  2FQ4 A;  3IH3 A;  3TED A;  3G1O A;  3QPS A;  2PZ9 A;  2JK3 A;  3HDD A;  1ZTR A;  3HM5 A;  5DTD A;  2MGQ A;  3JR9 A;  5EGO B;  3I4N J;  1U9N A;  3DCF A;  2OER A;  5EG0 B;  5CXI A;  1NTC A;  3MVP A;  3QQA A;  1IV6 A;  3NRG A;  3BTL A;  2XB0 X;  2R7Z J;  3VVZ A;  3P9T A;  4HNV A;  3CMY A;  4KWA A;  3HGY A;  1ORK A;  2G0E A;  1MNM C;  2HOT A;  1Z0X A;  2DA4 A;  5J1Y A;  3PM1 A;  3KKC A;  2LLK A;  4D5F A;  3HOZ J;  1HCR A;  3MN2 A;  3F1B A;  2ID6 A;  5JLW A;  3VVX A;  2CUE A;  3QBM A;  2RAS A;  2E2H J;  3G7R A;  2E1O A;  3GBG A;  1FTT A;  2E2I J;  2MW8 A;  3ON2 A;  1RKW A;  4DW6 A;  2JA8 J;  5K7Z A;  5EDN A;  3JRG A;  5IP7 J;  4J19 A;  2HXI A;  4A93 J;  2QTQ A;  3NXC A;  1ITY A;  1AHD P;  3S16 J;  4UUT A;  1MBE A;  2DMT A;  3NNR A;  1QVU A;  2HQ5 A;  1X58 A;  3RKQ A;  2K9N A;  2X9D A;  3BG9 A;  3S5R A;  3FK7 A;  1W0U A;  3S2D J;  3QKX A;  1Y1W J;  4BY7 J;  1GV2 A;  2KDZ A;  4GCK A;  1JKR C;  2ELK A;  4BY1 J;  5CXG A;  3JRI A;  4W1U A;  4CYC A;  1MSE C;  2ZCM A;  1WI3 A;  2M2E A;  5GPA A;  4A3F J;  4DYQ A;  2DA7 A;  4DYC A;  2RAE A;  2NS7 A;  2VKV A;  5IYC J;  2E19 A;  3S1R J;  1NK2 P;  4A3D J;  4FE7 A;  1IRZ A;  2NP5 A;  2HOS A;  4M3E A;  1ETO A;  5D18 A;  1ZR2 A;  5F27 A;  4ICH A;  4UDS A;  3EGQ A;  3ZQH A;  1HDD C;  1U8B A;  3IV5 A;  3ON4 A;  4UUS B;  2K9Q A;  1FIP A;  1PUF A;  5EFY A;  4GFB A;  4Y7N J;  1IDZ A;  1WCM J;  5IOY A;  4RDU A;  1JKP C;  1P7J A;  1JT6 A;  5D1R A;  2HYJ A;  3A02 A;  4NN1 A;  4XID A;  1K83 J;  1T56 A;  5IOZ A;  5GPC A;  4GCL A;  1F43 A;  3VIB A;  5F0F A;  2HXO A;  5K7F A;  3Q0V A;  3TP3 A;  4IHV A;  4GFL A;  1O4X A;  1JJ6 C;  1MBK A;  2Y9Z A;  2L7Z A;  4A3K J;  3GEU A;  2UXO A;  5FKL A;  1GV5 A;  2YVE A;  2HDD A;  4V2G A;  3CRJ A;  4DZJ A;  5HAW A;  5F04 A;  4QSH A;  3WHC A;  2H8R A;  3VW1 A;  1X2M A;  3GTL J;  2M8G X;  2R5Z A;  1OFC X;  3CDL A;  2YU9 J;  2DTZ A;  1MBH A;  4LOC A;  4PXI A;  5AQC A;  5F1J A;  1VF9 A;  1ETW A;  2G7L A;  3VOX A;  1BW5 A;  3VVY A;  1IJW C;  4AF5 A;  2O7O A;  4YZE A;  4FTH A;  1EF4 A;  4DZP A;  3KKD A;  3EUP A;  2B63 J;  1ZGW A;  4JYK A;  3H3V K;  2DMQ A;  3ZQF A;  4D7N A;  1RES A;  2UXU A;  2NVT J;  2EH3 A;  2P81 A;  5FJ8 J;  2E2J J;  2L9R A;  1TWG J;  1S7E A;  3TW7 A;  2EZL A;  1LE8 B;  3BQY A;  3NAR A;  5J1R A;  3FKI J;  1TWF J;  1H88 C;  3HOY J;  4CYC B;  2R92 J;  1JKQ C;  2UXP A;  3O8H A;  4JP0 A;  2R5Y A;  1B8I B;  3ANG A;  1E3O C;  3LSP A;  3S1Q J;  3VP5 A;  1A6I A;  4B4C A;  1FTZ A;  3A01 B;  4A3J J;  4AC0 A;  1JUS A;  2VPR A;  3NAU A;  3GTK J;  1MBF A;  3HEF A;  2ECB A;  3MNL A;  1GDT A;  1IG7 A;  5K7H A;  1QRY A;  5HSZ A;  4JKZ A;  2ME0 A;  5F0H A;  4XRS A;  2FX0 A;  3M3Y J;  2GBY A;  1IUF A;  3RQI A;  3NPI A;  2ZB9 A;  5FLV A;  2QKO A;  3BHQ A;  3JRE A;  4ME9 A;  5DAJ A;  2MG4 A;  1QVT A;  3GTG J;  3HOX J;  2XRL A;  3BCG A;  3VW2 A;  1HDP A;  1Q1V A;  5FKK A;  3BR0 A;  2TRT A;  5M3M J;  4IHY A;  2Y31 A;  1WPK A;  4W97 A;  1XS9 A;  3BJB A;  2EBI A;  5GP9 A;  3L1P A;  1RPW A;  3ANP A;  5IP9 J;  1ETY A;  2G3B A;  3KNW A;  3JRH A;  5CW8 A;  5IYB J;  4BXX J;  4MXM A;  1CQT A;  4IHX A;  3ZQG A;  1FEX A;  1MBG A;  2IBD A;  3GTO J;  5C4J J;  1D5Y A;  2LD5 A;  2R93 J;  1ETX A;  1XC5 A;  5M3F J;  4I6Z A;  3A03 A;  1OCP A;  3F0C A;  3VPR A;  4BBS J;  5HOD A;  2L0K A;  2LTP A;  2K40 A;  2DA2 A;  5M5X J;  4A3L J;  3IUV A;  4BKX A;  3IH2 A;  1TWC J;  2I10 A;  1IGN A;  3CQZ J;  5FMP A;  2ZCN A;  2Q24 A;  3LWJ A;  4NEL A;  2JA6 J;  5EGO A;  3OOU A;  2LFB A;  2OPT A;  3HBL A;  3VOK A;  2W53 A;  2HKU A;  3E7L A;  4JX5 A;  3GTJ J;  3SDG A;  2NVX J;  3AQS A;  3NI7 A;  2DMU A;  3GTQ J;  2UXI A;  3PPB A;  2QWT A;  2Y0S N;  1IDY A;  1ZQ3 P;  4A3G J;  3V6G A;  2NVY J;  3RZO J;  1VFC A;  2WV1 A;  1I3Q J;  2NP3 A;  4A3C J;  1JUM A;  4MFD A;  4B3A A;  1RKT A;  1I6H J;  1SAN A;  1MH3 A;  1NK3 P;  1AU7 A;  3BR5 A;  3TP0 A;  2N8G A;  3LHQ A;  2M0C A;  1YRN A;  2WB1 N;  5F08 A;  3LOC A;  4FE4 A;  3FIS A;  2EQR A;  5FLM J;  2QF7 A;  4MK6 A;  1TWH J;  1JT0 A;  5EEA A;  3CWR A;  1WH7 A;  2GUH A;  3BR1 A;  3BQZ A;  3JRD A;  4MIM A;  2LR8 A;  2F07 A;  3A01 A;  3HTI A;  1ETQ A;  2DN0 A;  2G7S A;  2XGC A;  1UMQ A;  3S17 J;  2Y9Y A;  3BR6 A;  1B8I A;  5FHP A;  4L62 A;  1VND A;  2V57 A;  2D6Y A;  3RZD J;  2XDN A;  4C2M J;  4M3G A;  3S2H J;  2LKX A;  2YVH A;  3VUQ A;  4XRS G;  3ZQC A;  2X48 A;  3ZOB A;  2EZI A;  2DG8 A;  5HBU A;  2REK A;  1H89 C;  3H0G J;  2M9H A;  1JTY A;  4BBR J;  4JX4 A;  5EZH A;  5K58 A;  2EZH A;  4JL3 A;  1B72 B;  4IHW A;  3OSG A;  4A3M J;  3HOU J;  3QPL A;  1A5J A;  5BNG A;  3CJD A;  2QIB A;  2GLO A;  4A3I J;  1HF0 A;  5E3O A;  1X2N A;  4QTR A;  3G56 A;  2O9L A;  3PO3 J;  4FCY A;  3M4O J;  2AHQ A;  1OJL A;  3S1M J;  1GUU A;  5FGL A;  2LP0 A;  3LJL A;  5J1U A;  3LSR A;  3B6C A;  3LSG A;  3HTH A;  4I76 A;  3SJM A;  1UG2 A;  5J3L A;  3JRA A;  3E7Q A;  2LY9 A;  4M3F A;  5M5W J;  3COL A;  2IEK A;  2JMW A;  4M3D A;  1ENH A;  1LFU P;  5JLX A;  1AKH A;  1MBJ A;  3CCY A;  3GTP J;  1BW6 A;  3FRQ A;  3I4M J;  4Y52 J;  3LSJ A;  2CQX A;  1UHS A;  1VI0 A;  3GTM J;  2DA3 A;  3K7A J;  5M5Y J;  3ZQL A;  5EYR A;  3SFI A;  1DU6 A;  5IP6 A;  3OIO A;  1Y1V J;  1BJZ A;  3DEW A;  2DA6 A;  5FKM A;  2G7G A;  5E3N A;  2DJN A;  5EZG A;  1UI5 A;  2ZOY A;  1XG1 A;  1U9O A;  1MSF C;  3O8G A;  4XRM A;  2LVS A;  2HI3 A;  3BTI A;  2O8K A;  4FIS A;  2WAQ N;  1SGM A;  4ACI A;  4X1E A;  4IEJ A;  3HE0 A;  2ME6 A;  4GFK A;  1TWA J;  1U78 A;  1ETV A;  2K9S A;  4XIC A;  3BR2 A;  5EG0 A;  3VW0 A;  3BTC A;  2NX4 A;  3JRB A;  3S1N J;  1QPI A;  3HOV J;  3S15 J;  5IPA A;  3BNI A;  2Y2Z A;  2DA5 A;  1H8A C;  2FJ1 A;  1BA5 A;  5C44 J;  3FK6 A;  2Y30 A;  4G12 A;  1FJL A;  5E3L A;  4MFE A;  1BL0 A;  2D5V A;  4GCT A;  2NS8 A;  3WHB A;  1B72 A;  2QCO A;  3LNQ A;  3TW6 A;  1SFO J;  2GFN A;  5EF6 A;  4QIW N;  1WH5 A;  3HOW J;  4A69 C;  3KZ9 A;  3B81 A;  2XB5 A;  3GZI A;  5D19 A;  2CRG A;  2DMP A;  3MKL A;  2IAI A;  3RD3 A;  1Z77 A;  2HOA A;  4L5E A;  1APL C;  2CUF A;  3FIW A;  2XGD A;  2HYT A;  3W6V A;  2CQQ A;  2PBX A;  2LK2 A;  4AUX A;  4A3B J;  1ZKG A;  4JX6 A;  2GEN A;  2JWT A;  2OF7 A;  1ZK8 A;  3BG5 A;  2GM4 A;  1WGX A;  2L7F P;  1JGG A;  2DMN A;  2MSY A;  1ETK A;  2WGB A;  2JJ7 A;  2M34 A;  3ZQI A;  5E3M A;  3BR3 A;  5C4X J;  2XGE A;  2O7T A;  2R5Y B;  3O60 A;  5FKO A;  5IYD J;  5FKN A;  3PAS A;  1YRN B;  4RBO A;  3S14 J;  2JN6 A;  2FBQ A;  4CGR A;  3Q0U A;  5C4Y A;  3Q3S A;  1K61 A;  2KT0 A;  2WUI A;  3BG3 A;  2NVQ J;  2EZK A;  3HIM A;  3UKG A;  1HOM A;  2ECC A;  5C3E J;  3HB9 A;  4AC6 A;  2CJJ A;  1ZR4 A;  3DPJ A;  2ZOZ A;  4C3I J;  2OI8 A;  3D1N I;  4MLO A;  1T33 A;  1I50 J;  2ZCX A;  1JJ8 C;  3JRF A;  2R0Q C;  1W0T A;  2XPV A;  2FD5 A;  3G1L A;  3V78 A;  2W48 A;  1RR7 A;  2DG7 A;  1LE8 A;  2NOG A;  2YUS A;  4NDL A;  3BT9 A;  2DA1 A;  4AYB N;  2XPW A;  2X6O A;  4C3H J;  4X6A J;  4ABZ A;  3AQT A;  2XPU A;  1POG A;  2XSD C;  2CU7 A;  1GVD A;  3Q0W A;  3C2B A;  4C3J J;  1AKH B;  1G2H A;  9ANT A;  3HGG A;  4HKU A;  1JUP A;  3C07 A;  2ID3 A;  1P7I A;  2VKE A;  4M6V A;  1RET A;  2AO9 A;  3HTA A;  1JTX A;  2JA7 J;  1R9T J;  3PO2 J;  4B1R A;  2H1K A;  3IH4 A;  4DYR A;  4V2F A;  2IU5 A;  2PMZ N;  4JNN A;  5DS9 A;  2JA5 J;  1FIA A;  4MO7 A;  3G1M A;  1F36 A;  3BRU A;  1PUF B;  4UUS A;  3HTJ A;  1UI6 A;  3K2A A;  4S0H B;  4D7M A;  1IC8 A;  2TCT A;  2YS9 A;  4A3E J;  1DU0 A;  5F0C A;  3OSF A;  3B6A A;  3RH2 A;  2VUM J;  2COB A;  2QOP A;  4D5C A;  1TC3 C;  3BTJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...