3B81A

Crystal structure of predicted dna-binding transcriptional regulator of tetr/acrr family (np_350189.1) from clostridium acetobutylicum at 2.10 a resolution
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
194
structure length
183
Chain Sequence
INFNNKRTELANKIWDIFIANGYENTTLAFIINKLGISKGALYHYFSSKEECADAAIENRVAFFSNEVLKESEEGLNSIERLKKILLAGIINSPSNKIFHQKLMVAIIKYFAPIYADIISQGNEEGVFKVKYPLETAEIILTLSHFYLDEDLFKWKKEDMSLKLTAFKETLIKILDADEDTFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Transcriptional regulator, AcrR family
publication title Crystal structure of predicted DNA-binding transcriptional regulator of TetR/AcrR family (NP_350189.1) from Clostridium acetobutylicum at 2.10 A resolution
rcsb
source organism Clostridium acetobutylicum atcc 824
total genus 68
structure length 183
sequence length 194
ec nomenclature
pdb deposition date 2007-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3b81A00
2UXHA 5GPCA 2HYTA 3BNIA 3BT9A 3BCGA 3QQAA 2G7GA 3CCYA 3ANGA 5EZHA 3EUPA 3MNLA 2ZOYA 2XPWA 2F07A 5HAWA 2GENA 3HGGA 5J3LA 2ID3A 2WGBA 4YZEA 2Y30A 5FMPA 3KNWA 3HIMA 2Q24A 3BTJA 5CXIA 2QKOA 3BR0A 3F0CA 1RKTA 5IPAA 5IOYA 3MVPA 2Y31A 2TRTA 3HGYA 5GPAA 5FKLA 2RASA 4ICHA 4M3BA 3ZQHA 3BR3A 2WUIA 3BTCA 2EH3A 3B6CA 3IH3A 3BR5A 3ZQFA 3C2BA 3IH4A 2VKVA 3BTIA 3V6GA 2NS8A 2YVEA 4AUXA 2GFNA 3HE0A 5H9TA 2HQ5A 3NNRA 3ZQLA 3Q3SA 3C07A 4PXIA 3VVYA 2V57A 3BJBA 5HSZA 3DPJA 2QCOA 4I6ZA 4GCLA 3LJLA 2JK3A 5CW8A 3LSJA 5FHPA 4CGRA 3FIWA 2NP3A 1BJZA 4GCTA 2REKA 2XGDA 3BHQA 5F0FA 3PPBA 3LHQA 1JUPA 4W97A 3WHCA 2XB5A 5C4YA 4UDSA 4JNNA 2OI8A 3ZQIA 2DG8A 4D7NA 3QKXA 1JTYA 2X6OA 2WV1A 3B81A 4GFKA 4M3FA 2DTZA 5GP9A 4NELA 1QVTA 1RPWA 2OERA 1QVUA 3NXCA 3RD3A 2QOPA 3VOKA 2RAEA 3BR1A 3FK7A 3CRJA 3DEWA 2NP5A 3BQZA 5EZGA 4L62A 3RH2A 4V2GA 1RKWA 3VP5A 4M3GA 2HXIA 4MK6A 5HBUA 4AF5A 3G56A 4MXMA 1Z77A 2QIBA 3NRGA 3HTHA 5F08A 3T6NA 5K7ZA 2XGCA 1U9NA 3E7QA 3FK6A 1UI5A 4AC6A 3EGQA 2XGEA 4M3EA 1JT0A 3ON4A 1T56A 5J1RA 2OPTA 1JTXA 2OF7A 4M3DA 5K7HA 1U9OA 3AQTA 3SDGA 3VW0A 4NN1A 3VOXA 5IP6A 4I76A 1ORKA 3DCFA 3LOCA 2ID6A 2XPVA 3QBMA 4X1EA 3KKCA 1A6IA 2JJ7A 3QPLA 5FKMA 2XPUA 5K58A 2ZCMA 3F1BA 3PM1A 2DG7A 3CWRA 5FKKA 2YVHA 2QWTA 2G0EA 4ME9A 3CJDA 2NX4A 3ON2A 3TP0A 3LWJA 2UXUA 3WHBA 2IBDA 4ACIA 3LSRA 5J1YA 4D7MA 3HTAA 3VVXA 3BRUA 3G1OA 3SFIA 3O60A 2D6YA 3ANPA 4MO7A 2O7TA 5AQCA 5D18A 2PBXA 5D19A 2HKUA 3Q0VA 3QPSA 4AC0A 1ZK8A 3AQSA 2GUHA 2HYJA 2X9DA 3KKDA 2ZCXA 1Z0XA 3VIBA 4B1RA 2O7OA 5F0HA 1T33A 3Q0UA 5DAJA 5FKOA 5IOZA 3ZQGA 3G1LA 2RHAA 5F04A 4GFLA 4W1UA 3VVZA 5FGLA 2FX0A 2XRLA 5CXGA 1QPIA 2GBYA 2G7SA 3BQYA 2PZ9A 2UXOA 2FBQA 2ZCNA 2IEKA 2G3BA 5F1JA 4XK4A 4D5CA 3V78A 2XDNA 3G7RA 5F0CA 3VW2A 4B3AA 2UXPA 3VUQA 1JUMA 1JT6A 2FQ4A 2IU5A 1JUSA 4D5FA 3CDLA 3TP3A 3HTIA 3NPIA 3O8GA 1VI0A 2UXIA 3BTLA 3P9TA 5FKNA 2VPRA 5EFYA 4JL3A 3VPRA 3B6AA 4GCKA 5K7FA 3GEUA 2I10A 2TCTA 3G1MA 3IUVA 3KZ9A 1UI6A 4ABZA 5J1UA 2W53A 4G12A 3Q0WA 2NS7A 5F27A 4DW6A 2IAIA 3NI7A 2ZOZA 3LSPA 3BR2A 2QTQA 2FJ1A 2G7LA 4HKUA 2ZB9A 1ZKGA 4V2FA 3GZIA 3O8HA 2FD5A 2VKEA 2HXOA 3S5RA 3COLA 5D1RA 3JSJA 4JYKA 2Y2ZA 1SGMA 3HTJA 5EYRA 4KWAA 3FRQA 3VW1A 3BR6A 3IH2A 4JKZA 3PASA
chains in the Genus database with same CATH superfamily
2UXHA 5GPCA 2HYTA 3BNIA 3BT9A 3BCGA 3QQAA 2G7GA 3CCYA 3ANGA 5EZHA 3EUPA 3MNLA 2ZOYA 2XPWA 3KYLA 2F07A 5HAWA 2GENA 3HGGA 5J3LA 2ID3A 2WGBA 4YZEA 2Y30A 5FMPA 3KNWA 3HIMA 2Q24A 3BTJA 5CXIA 2QKOA 3BR0A 4WIBA 3F0CA 1RKTA 5IPAA 5IOYA 3MVPA 2Y31A 2TRTA 3HGYA 5GPAA 5FKLA 2RASA 4ICHA 4C2MA 4M3BA 3ZQHA 3BR3A 2WUIA 3BTCA 2EH3A 3B6CA 3IH3A 3BR5A 3ZQFA 3C2BA 3IH4A 2VKVA 3BTIA 2R7UA 3V6GA 2NS8A 2YVEA 4AUXA 2GFNA 3HE0A 5H9TA 2HQ5A 3NNRA 3ZQLA 3Q3SA 3C07A 4PXIA 3VVYA 2V57A 3BJBA 5HSZA 3DPJA 2QCOA 4I6ZA 4GCLA 3LJLA 3NS4A 2JK3A 5CW8A 3LSJA 5FHPA 4CGRA 3FIWA 2NP3A 1BJZA 4GCTA 2REKA 2XGDA 3BHQA 5F0FA 3FHNA 2FJI1 3PPBA 3LHQA 1JUPA 4W97A 3WHCA 2XB5A 5C4YA 4UDSA 4JNNA 2OI8A 3ZQIA 2DG8A 4D7NA 3QKXA 1JTYA 2X6OA 2WV1A 3B81A 4GFKA 4U9NA 4M3FA 2DTZA 5GP9A 4NELA 1QVTA 1RPWA 2OERA 1QVUA 3NXCA 3RD3A 2R7XA 2QOPA 3VOKA 2RAEA 3BR1A 3FK7A 3CRJA 3DEWA 2NP5A 3BQZA 5EZGA 4L62A 3RH2A 4V2GA 1RKWA 3VP5A 4M3GA 2HXIA 4MK6A 5HBUA 4AF5A 3G56A 4MXMA 1Z77A 2QIBA 3NRGA 2R7RA 3HTHA 5F08A 3T6NA 5K7ZA 2XGCA 1U9NA 3E7QA 3FK6A 1UI5A 4AC6A 3EGQA 2XGEA 4M3EA 1JT0A 3ON4A 1T56A 5J1RA 2OPTA 1JTXA 3K8PC 2OF7A 4M3DA 5K7HA 1U9OA 3AQTA 3SDGA 3VW0A 2R7OA 4NN1A 3VOXA 5IP6A 4I76A 1ORKA 3DCFA 3LOCA 2ID6A 2XPVA 4OD4A 3QBMA 4X1EA 3KKCA 3DU5A 1A6IA 2JJ7A 3QPLA 5FKMA 2XPUA 5K58A 2ZCMA 2ZY9A 3F1BA 3PM1A 2DG7A 3CWRA 5FKKA 2YVHA 2QWTA 2G0EA 4ME9A 3CJDA 2NX4A 3ON2A 3TP0A 3LWJA 2UXUA 3WHBA 2IBDA 4ACIA 3LSRA 5J1YA 4D7MA 3HTAA 3VVXA 4U9LA 3BRUA 3G1OA 2R7VA 3SFIA 3O60A 2D6YA 3ANPA 4MO7A 2O7TA 5AQCA 5D18A 2PBXA 5CQGA 5D19A 2HKUA 3Q0VA 3QPSA 2PFVA 3VTIA 4AC0A 1ZK8A 3AQSA 2R7WA 2GUHA 2HYJA 2X9DA 3KKDA 2ZCXA 1Z0XA 3VIBA 4B1RA 2O7OA 2B1EA 5F0HA 1T33A 3Q0UA 5DAJA 5FKOA 5IOZA 3ZQGA 3G1LA 2RHAA 5F04A 4GFLA 4W1UA 3VVZA 5FGLA 2FX0A 2XRLA 5CXGA 1QPIA 2GBYA 2G7SA 3BQYA 2PZ9A 2UXOA 2FBQA 2ZCNA 4IRVA 2IEKA 2G3BA 5F1JA 4XK4A 4D5CA 2YVXA 3V78A 2XDNA 3G7RA 5F0CA 3VW2A 4B3AA 2UXPA 2R7QA 3VUQA 1JUMA 1JT6A 2FQ4A 2IU5A 1JUSA 2B3WA 4D5FA 3CDLA 3TP3A 4DVYP 3HTIA 3NPIA 3O8GA 1VI0A 2UXIA 3BTLA 3P9TA 5FKNA 3DU6A 2VPRA 5EFYA 4JL3A 3VPRA 3B6AA 3SWHA 4GCKA 5K7FA 3GEUA 2I10A 2TCTA 3G1MA 3IUVA 3KZ9A 1UI6A 4ABZA 5J1UA 2W53A 4G12A 3Q0WA 2NS7A 5F27A 4DW6A 2IAIA 3NI7A 2ZOZA 3LSPA 3BR2A 4OD5A 2QTQA 2FJ1A 2G7LA 2R7SA 4HKUA 2ZB9A 1ZKGA 4V2FA 2R7TA 2A2FX 3GZIA 3O8HA 2FD5A 2VKEA 2HXOA 3S5RA 3COLA 5D1RA 3JSJA 4JYKA 2Y2ZA 1SGMA 3HTJA 5EYRA 4KWAA 3FRQA 3VW1A 3BR6A 3IH2A 4JKZA 3PASA
chains in the Genus database with same CATH topology
2UXHA 5GPCA 2HYTA 3BNIA 3BT9A 3BCGA 3QQAA 2G7GA 3CCYA 3ANGA 5EZHA 3EUPA 3MNLA 2ZOYA 2XPWA 2F07A 5HAWA 2GENA 3HGGA 5J3LA 2ID3A 2WGBA 4YZEA 2Y30A 5FMPA 3KNWA 3HIMA 2Q24A 3BTJA 5CXIA 2QKOA 3BR0A 3F0CA 1RKTA 5IPAA 5IOYA 3MVPA 2Y31A 2TRTA 3HGYA 5GPAA 5FKLA 2RASA 4ICHA 4M3BA 3ZQHA 3BR3A 2WUIA 3BTCA 2EH3A 3B6CA 3IH3A 3BR5A 3ZQFA 3C2BA 3IH4A 2VKVA 3BTIA 3V6GA 2NS8A 2YVEA 4AUXA 2GFNA 3HE0A 5H9TA 2HQ5A 3NNRA 3ZQLA 3Q3SA 3C07A 4PXIA 3VVYA 2V57A 3BJBA 5HSZA 3DPJA 2QCOA 4I6ZA 4GCLA 3LJLA 2JK3A 5CW8A 3LSJA 5FHPA 4CGRA 3FIWA 2NP3A 1BJZA 4GCTA 2REKA 2XGDA 3BHQA 5F0FA 3PPBA 3LHQA 1JUPA 4W97A 3WHCA 2XB5A 5C4YA 4UDSA 4JNNA 2OI8A 3ZQIA 2DG8A 4D7NA 3QKXA 1JTYA 2X6OA 2WV1A 3B81A 4GFKA 4M3FA 2DTZA 5GP9A 4NELA 1QVTA 1RPWA 2OERA 1QVUA 3NXCA 3RD3A 2QOPA 3VOKA 2RAEA 3BR1A 3FK7A 3CRJA 3DEWA 2NP5A 3BQZA 5EZGA 4L62A 3RH2A 4V2GA 1RKWA 3VP5A 4M3GA 2HXIA 4MK6A 5HBUA 4AF5A 3G56A 4MXMA 1Z77A 2QIBA 3NRGA 3HTHA 5F08A 3T6NA 5K7ZA 2XGCA 1U9NA 3E7QA 3FK6A 1UI5A 4AC6A 3EGQA 2XGEA 4M3EA 1JT0A 3ON4A 1T56A 5J1RA 2OPTA 1JTXA 2OF7A 4M3DA 5K7HA 1U9OA 3AQTA 3SDGA 3VW0A 4NN1A 3VOXA 5IP6A 4I76A 1ORKA 3DCFA 3LOCA 2ID6A 2XPVA 3QBMA 4X1EA 3KKCA 1A6IA 2JJ7A 3QPLA 5FKMA 2XPUA 5K58A 2ZCMA 3F1BA 3PM1A 2DG7A 3CWRA 5FKKA 2YVHA 2QWTA 2G0EA 4ME9A 3CJDA 2NX4A 3ON2A 3TP0A 3LWJA 2UXUA 3WHBA 2IBDA 4ACIA 3LSRA 5J1YA 4D7MA 3HTAA 3VVXA 3BRUA 3G1OA 3SFIA 3O60A 2D6YA 3ANPA 4MO7A 2O7TA 5AQCA 5D18A 2PBXA 5D19A 2HKUA 3Q0VA 3QPSA 4AC0A 1ZK8A 3AQSA 2GUHA 2HYJA 2X9DA 3KKDA 2ZCXA 1Z0XA 3VIBA 4B1RA 2O7OA 5F0HA 1T33A 3Q0UA 5DAJA 5FKOA 5IOZA 3ZQGA 3G1LA 2RHAA 5F04A 4GFLA 4W1UA 3VVZA 5FGLA 2FX0A 2XRLA 5CXGA 1QPIA 2GBYA 2G7SA 3BQYA 2PZ9A 2UXOA 2FBQA 2ZCNA 2IEKA 2G3BA 5F1JA 4XK4A 4D5CA 3V78A 2XDNA 3G7RA 5F0CA 3VW2A 4B3AA 2UXPA 3VUQA 1JUMA 1JT6A 2FQ4A 2IU5A 1JUSA 4D5FA 3CDLA 3TP3A 3HTIA 3NPIA 3O8GA 1VI0A 2UXIA 3BTLA 3P9TA 5FKNA 2VPRA 5EFYA 4JL3A 3VPRA 3B6AA 4GCKA 5K7FA 3GEUA 2I10A 2TCTA 3G1MA 3IUVA 3KZ9A 1UI6A 4ABZA 5J1UA 2W53A 4G12A 3Q0WA 2NS7A 5F27A 4DW6A 2IAIA 3NI7A 2ZOZA 3LSPA 3BR2A 2QTQA 2FJ1A 2G7LA 4HKUA 2ZB9A 1ZKGA 4V2FA 3GZIA 3O8HA 2FD5A 2VKEA 2HXOA 3S5RA 3COLA 5D1RA 3JSJA 4JYKA 2Y2ZA 1SGMA 3HTJA 5EYRA 4KWAA 3FRQA 3VW1A 3BR6A 3IH2A 4JKZA 3PASA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UXH A;  5GPC A;  2HYT A;  3BNI A;  3BT9 A;  3BCG A;  3QQA A;  2G7G A;  3CCY A;  3ANG A;  5EZH A;  3EUP A;  3MNL A;  2ZOY A;  2XPW A;  2F07 A;  5HAW A;  2GEN A;  3HGG A;  5J3L A;  2ID3 A;  2WGB A;  4YZE A;  2Y30 A;  5FMP A;  3KNW A;  3HIM A;  2Q24 A;  3BTJ A;  5CXI A;  2QKO A;  3BR0 A;  3F0C A;  1RKT A;  5IPA A;  5IOY A;  3MVP A;  2Y31 A;  2TRT A;  3HGY A;  5GPA A;  5FKL A;  2RAS A;  4ICH A;  4M3B A;  3ZQH A;  3BR3 A;  2WUI A;  3BTC A;  2EH3 A;  3B6C A;  3IH3 A;  3BR5 A;  3ZQF A;  3C2B A;  3IH4 A;  2VKV A;  3BTI A;  3V6G A;  2NS8 A;  2YVE A;  4AUX A;  2GFN A;  3HE0 A;  5H9T A;  2HQ5 A;  3NNR A;  3ZQL A;  3Q3S A;  3C07 A;  4PXI A;  3VVY A;  2V57 A;  3BJB A;  5HSZ A;  3DPJ A;  2QCO A;  4I6Z A;  4GCL A;  3LJL A;  2JK3 A;  5CW8 A;  3LSJ A;  5FHP A;  4CGR A;  3FIW A;  2NP3 A;  1BJZ A;  4GCT A;  2REK A;  2XGD A;  3BHQ A;  5F0F A;  3PPB A;  3LHQ A;  1JUP A;  4W97 A;  3WHC A;  2XB5 A;  5C4Y A;  4UDS A;  4JNN A;  2OI8 A;  3ZQI A;  2DG8 A;  4D7N A;  3QKX A;  1JTY A;  2X6O A;  2WV1 A;  3B81 A;  4GFK A;  4M3F A;  2DTZ A;  5GP9 A;  4NEL A;  1QVT A;  1RPW A;  2OER A;  1QVU A;  3NXC A;  3RD3 A;  2QOP A;  3VOK A;  2RAE A;  3BR1 A;  3FK7 A;  3CRJ A;  3DEW A;  2NP5 A;  3BQZ A;  5EZG A;  4L62 A;  3RH2 A;  4V2G A;  1RKW A;  3VP5 A;  4M3G A;  2HXI A;  4MK6 A;  5HBU A;  4AF5 A;  3G56 A;  4MXM A;  1Z77 A;  2QIB A;  3NRG A;  3HTH A;  5F08 A;  3T6N A;  5K7Z A;  2XGC A;  1U9N A;  3E7Q A;  3FK6 A;  1UI5 A;  4AC6 A;  3EGQ A;  2XGE A;  4M3E A;  1JT0 A;  3ON4 A;  1T56 A;  5J1R A;  2OPT A;  1JTX A;  2OF7 A;  4M3D A;  5K7H A;  1U9O A;  3AQT A;  3SDG A;  3VW0 A;  4NN1 A;  3VOX A;  5IP6 A;  4I76 A;  1ORK A;  3DCF A;  3LOC A;  2ID6 A;  2XPV A;  3QBM A;  4X1E A;  3KKC A;  1A6I A;  2JJ7 A;  3QPL A;  5FKM A;  2XPU A;  5K58 A;  2ZCM A;  3F1B A;  3PM1 A;  2DG7 A;  3CWR A;  5FKK A;  2YVH A;  2QWT A;  2G0E A;  4ME9 A;  3CJD A;  2NX4 A;  3ON2 A;  3TP0 A;  3LWJ A;  2UXU A;  3WHB A;  2IBD A;  4ACI A;  3LSR A;  5J1Y A;  4D7M A;  3HTA A;  3VVX A;  3BRU A;  3G1O A;  3SFI A;  3O60 A;  2D6Y A;  3ANP A;  4MO7 A;  2O7T A;  5AQC A;  5D18 A;  2PBX A;  5D19 A;  2HKU A;  3Q0V A;  3QPS A;  4AC0 A;  1ZK8 A;  3AQS A;  2GUH A;  2HYJ A;  2X9D A;  3KKD A;  2ZCX A;  1Z0X A;  3VIB A;  4B1R A;  2O7O A;  5F0H A;  1T33 A;  3Q0U A;  5DAJ A;  5FKO A;  5IOZ A;  3ZQG A;  3G1L A;  2RHA A;  5F04 A;  4GFL A;  4W1U A;  3VVZ A;  5FGL A;  2FX0 A;  2XRL A;  5CXG A;  1QPI A;  2GBY A;  2G7S A;  3BQY A;  2PZ9 A;  2UXO A;  2FBQ A;  2ZCN A;  2IEK A;  2G3B A;  5F1J A;  4XK4 A;  4D5C A;  3V78 A;  2XDN A;  3G7R A;  5F0C A;  3VW2 A;  4B3A A;  2UXP A;  3VUQ A;  1JUM A;  1JT6 A;  2FQ4 A;  2IU5 A;  1JUS A;  4D5F A;  3CDL A;  3TP3 A;  3HTI A;  3NPI A;  3O8G A;  1VI0 A;  2UXI A;  3BTL A;  3P9T A;  5FKN A;  2VPR A;  5EFY A;  4JL3 A;  3VPR A;  3B6A A;  4GCK A;  5K7F A;  3GEU A;  2I10 A;  2TCT A;  3G1M A;  3IUV A;  3KZ9 A;  1UI6 A;  4ABZ A;  5J1U A;  2W53 A;  4G12 A;  3Q0W A;  2NS7 A;  5F27 A;  4DW6 A;  2IAI A;  3NI7 A;  2ZOZ A;  3LSP A;  3BR2 A;  2QTQ A;  2FJ1 A;  2G7L A;  4HKU A;  2ZB9 A;  1ZKG A;  4V2F A;  3GZI A;  3O8H A;  2FD5 A;  2VKE A;  2HXO A;  3S5R A;  3COL A;  5D1R A;  3JSJ A;  4JYK A;  2Y2Z A;  1SGM A;  3HTJ A;  5EYR A;  4KWA A;  3FRQ A;  3VW1 A;  3BR6 A;  3IH2 A;  4JKZ A;  3PAS A; 
#chains in the Genus database with same CATH topology
 2UXH A;  5GPC A;  2HYT A;  3BNI A;  3BT9 A;  3BCG A;  3QQA A;  2G7G A;  3CCY A;  3ANG A;  5EZH A;  3EUP A;  3MNL A;  2ZOY A;  2XPW A;  3KYL A;  2F07 A;  5HAW A;  2GEN A;  3HGG A;  5J3L A;  2ID3 A;  2WGB A;  4YZE A;  2Y30 A;  5FMP A;  3KNW A;  3HIM A;  2Q24 A;  3BTJ A;  5CXI A;  2QKO A;  3BR0 A;  4WIB A;  3F0C A;  1RKT A;  5IPA A;  5IOY A;  3MVP A;  2Y31 A;  2TRT A;  3HGY A;  5GPA A;  5FKL A;  2RAS A;  4ICH A;  4C2M A;  4M3B A;  3ZQH A;  3BR3 A;  2WUI A;  3BTC A;  2EH3 A;  3B6C A;  3IH3 A;  3BR5 A;  3ZQF A;  3C2B A;  3IH4 A;  2VKV A;  3BTI A;  2R7U A;  3V6G A;  2NS8 A;  2YVE A;  4AUX A;  2GFN A;  3HE0 A;  5H9T A;  2HQ5 A;  3NNR A;  3ZQL A;  3Q3S A;  3C07 A;  4PXI A;  3VVY A;  2V57 A;  3BJB A;  5HSZ A;  3DPJ A;  2QCO A;  4I6Z A;  4GCL A;  3LJL A;  3NS4 A;  2JK3 A;  5CW8 A;  3LSJ A;  5FHP A;  4CGR A;  3FIW A;  2NP3 A;  1BJZ A;  4GCT A;  2REK A;  2XGD A;  3BHQ A;  5F0F A;  3FHN A;  2FJI 1;  3PPB A;  3LHQ A;  1JUP A;  4W97 A;  3WHC A;  2XB5 A;  5C4Y A;  4UDS A;  4JNN A;  2OI8 A;  3ZQI A;  2DG8 A;  4D7N A;  3QKX A;  1JTY A;  2X6O A;  2WV1 A;  3B81 A;  4GFK A;  4U9N A;  4M3F A;  2DTZ A;  5GP9 A;  4NEL A;  1QVT A;  1RPW A;  2OER A;  1QVU A;  3NXC A;  3RD3 A;  2R7X A;  2QOP A;  3VOK A;  2RAE A;  3BR1 A;  3FK7 A;  3CRJ A;  3DEW A;  2NP5 A;  3BQZ A;  5EZG A;  4L62 A;  3RH2 A;  4V2G A;  1RKW A;  3VP5 A;  4M3G A;  2HXI A;  4MK6 A;  5HBU A;  4AF5 A;  3G56 A;  4MXM A;  1Z77 A;  2QIB A;  3NRG A;  2R7R A;  3HTH A;  5F08 A;  3T6N A;  5K7Z A;  2XGC A;  1U9N A;  3E7Q A;  3FK6 A;  1UI5 A;  4AC6 A;  3EGQ A;  2XGE A;  4M3E A;  1JT0 A;  3ON4 A;  1T56 A;  5J1R A;  2OPT A;  1JTX A;  3K8P C;  2OF7 A;  4M3D A;  5K7H A;  1U9O A;  3AQT A;  3SDG A;  3VW0 A;  2R7O A;  4NN1 A;  3VOX A;  5IP6 A;  4I76 A;  1ORK A;  3DCF A;  3LOC A;  2ID6 A;  2XPV A;  4OD4 A;  3QBM A;  4X1E A;  3KKC A;  3DU5 A;  1A6I A;  2JJ7 A;  3QPL A;  5FKM A;  2XPU A;  5K58 A;  2ZCM A;  2ZY9 A;  3F1B A;  3PM1 A;  2DG7 A;  3CWR A;  5FKK A;  2YVH A;  2QWT A;  2G0E A;  4ME9 A;  3CJD A;  2NX4 A;  3ON2 A;  3TP0 A;  3LWJ A;  2UXU A;  3WHB A;  2IBD A;  4ACI A;  3LSR A;  5J1Y A;  4D7M A;  3HTA A;  3VVX A;  4U9L A;  3BRU A;  3G1O A;  2R7V A;  3SFI A;  3O60 A;  2D6Y A;  3ANP A;  4MO7 A;  2O7T A;  5AQC A;  5D18 A;  2PBX A;  5CQG A;  5D19 A;  2HKU A;  3Q0V A;  3QPS A;  2PFV A;  3VTI A;  4AC0 A;  1ZK8 A;  3AQS A;  2R7W A;  2GUH A;  2HYJ A;  2X9D A;  3KKD A;  2ZCX A;  1Z0X A;  3VIB A;  4B1R A;  2O7O A;  2B1E A;  5F0H A;  1T33 A;  3Q0U A;  5DAJ A;  5FKO A;  5IOZ A;  3ZQG A;  3G1L A;  2RHA A;  5F04 A;  4GFL A;  4W1U A;  3VVZ A;  5FGL A;  2FX0 A;  2XRL A;  5CXG A;  1QPI A;  2GBY A;  2G7S A;  3BQY A;  2PZ9 A;  2UXO A;  2FBQ A;  2ZCN A;  4IRV A;  2IEK A;  2G3B A;  5F1J A;  4XK4 A;  4D5C A;  2YVX A;  3V78 A;  2XDN A;  3G7R A;  5F0C A;  3VW2 A;  4B3A A;  2UXP A;  2R7Q A;  3VUQ A;  1JUM A;  1JT6 A;  2FQ4 A;  2IU5 A;  1JUS A;  2B3W A;  4D5F A;  3CDL A;  3TP3 A;  4DVY P;  3HTI A;  3NPI A;  3O8G A;  1VI0 A;  2UXI A;  3BTL A;  3P9T A;  5FKN A;  3DU6 A;  2VPR A;  5EFY A;  4JL3 A;  3VPR A;  3B6A A;  3SWH A;  4GCK A;  5K7F A;  3GEU A;  2I10 A;  2TCT A;  3G1M A;  3IUV A;  3KZ9 A;  1UI6 A;  4ABZ A;  5J1U A;  2W53 A;  4G12 A;  3Q0W A;  2NS7 A;  5F27 A;  4DW6 A;  2IAI A;  3NI7 A;  2ZOZ A;  3LSP A;  3BR2 A;  4OD5 A;  2QTQ A;  2FJ1 A;  2G7L A;  2R7S A;  4HKU A;  2ZB9 A;  1ZKG A;  4V2F A;  2R7T A;  2A2F X;  3GZI A;  3O8H A;  2FD5 A;  2VKE A;  2HXO A;  3S5R A;  3COL A;  5D1R A;  3JSJ A;  4JYK A;  2Y2Z A;  1SGM A;  3HTJ A;  5EYR A;  4KWA A;  3FRQ A;  3VW1 A;  3BR6 A;  3IH2 A;  4JKZ A;  3PAS A; 
#chains in the Genus database with same CATH homology
 2UXH A;  5GPC A;  2HYT A;  3BNI A;  3BT9 A;  3BCG A;  3QQA A;  2G7G A;  3CCY A;  3ANG A;  5EZH A;  3EUP A;  3MNL A;  2ZOY A;  2XPW A;  2F07 A;  5HAW A;  2GEN A;  3HGG A;  5J3L A;  2ID3 A;  2WGB A;  4YZE A;  2Y30 A;  5FMP A;  3KNW A;  3HIM A;  2Q24 A;  3BTJ A;  5CXI A;  2QKO A;  3BR0 A;  3F0C A;  1RKT A;  5IPA A;  5IOY A;  3MVP A;  2Y31 A;  2TRT A;  3HGY A;  5GPA A;  5FKL A;  2RAS A;  4ICH A;  4M3B A;  3ZQH A;  3BR3 A;  2WUI A;  3BTC A;  2EH3 A;  3B6C A;  3IH3 A;  3BR5 A;  3ZQF A;  3C2B A;  3IH4 A;  2VKV A;  3BTI A;  3V6G A;  2NS8 A;  2YVE A;  4AUX A;  2GFN A;  3HE0 A;  5H9T A;  2HQ5 A;  3NNR A;  3ZQL A;  3Q3S A;  3C07 A;  4PXI A;  3VVY A;  2V57 A;  3BJB A;  5HSZ A;  3DPJ A;  2QCO A;  4I6Z A;  4GCL A;  3LJL A;  2JK3 A;  5CW8 A;  3LSJ A;  5FHP A;  4CGR A;  3FIW A;  2NP3 A;  1BJZ A;  4GCT A;  2REK A;  2XGD A;  3BHQ A;  5F0F A;  3PPB A;  3LHQ A;  1JUP A;  4W97 A;  3WHC A;  2XB5 A;  5C4Y A;  4UDS A;  4JNN A;  2OI8 A;  3ZQI A;  2DG8 A;  4D7N A;  3QKX A;  1JTY A;  2X6O A;  2WV1 A;  3B81 A;  4GFK A;  4M3F A;  2DTZ A;  5GP9 A;  4NEL A;  1QVT A;  1RPW A;  2OER A;  1QVU A;  3NXC A;  3RD3 A;  2QOP A;  3VOK A;  2RAE A;  3BR1 A;  3FK7 A;  3CRJ A;  3DEW A;  2NP5 A;  3BQZ A;  5EZG A;  4L62 A;  3RH2 A;  4V2G A;  1RKW A;  3VP5 A;  4M3G A;  2HXI A;  4MK6 A;  5HBU A;  4AF5 A;  3G56 A;  4MXM A;  1Z77 A;  2QIB A;  3NRG A;  3HTH A;  5F08 A;  3T6N A;  5K7Z A;  2XGC A;  1U9N A;  3E7Q A;  3FK6 A;  1UI5 A;  4AC6 A;  3EGQ A;  2XGE A;  4M3E A;  1JT0 A;  3ON4 A;  1T56 A;  5J1R A;  2OPT A;  1JTX A;  2OF7 A;  4M3D A;  5K7H A;  1U9O A;  3AQT A;  3SDG A;  3VW0 A;  4NN1 A;  3VOX A;  5IP6 A;  4I76 A;  1ORK A;  3DCF A;  3LOC A;  2ID6 A;  2XPV A;  3QBM A;  4X1E A;  3KKC A;  1A6I A;  2JJ7 A;  3QPL A;  5FKM A;  2XPU A;  5K58 A;  2ZCM A;  3F1B A;  3PM1 A;  2DG7 A;  3CWR A;  5FKK A;  2YVH A;  2QWT A;  2G0E A;  4ME9 A;  3CJD A;  2NX4 A;  3ON2 A;  3TP0 A;  3LWJ A;  2UXU A;  3WHB A;  2IBD A;  4ACI A;  3LSR A;  5J1Y A;  4D7M A;  3HTA A;  3VVX A;  3BRU A;  3G1O A;  3SFI A;  3O60 A;  2D6Y A;  3ANP A;  4MO7 A;  2O7T A;  5AQC A;  5D18 A;  2PBX A;  5D19 A;  2HKU A;  3Q0V A;  3QPS A;  4AC0 A;  1ZK8 A;  3AQS A;  2GUH A;  2HYJ A;  2X9D A;  3KKD A;  2ZCX A;  1Z0X A;  3VIB A;  4B1R A;  2O7O A;  5F0H A;  1T33 A;  3Q0U A;  5DAJ A;  5FKO A;  5IOZ A;  3ZQG A;  3G1L A;  2RHA A;  5F04 A;  4GFL A;  4W1U A;  3VVZ A;  5FGL A;  2FX0 A;  2XRL A;  5CXG A;  1QPI A;  2GBY A;  2G7S A;  3BQY A;  2PZ9 A;  2UXO A;  2FBQ A;  2ZCN A;  2IEK A;  2G3B A;  5F1J A;  4XK4 A;  4D5C A;  3V78 A;  2XDN A;  3G7R A;  5F0C A;  3VW2 A;  4B3A A;  2UXP A;  3VUQ A;  1JUM A;  1JT6 A;  2FQ4 A;  2IU5 A;  1JUS A;  4D5F A;  3CDL A;  3TP3 A;  3HTI A;  3NPI A;  3O8G A;  1VI0 A;  2UXI A;  3BTL A;  3P9T A;  5FKN A;  2VPR A;  5EFY A;  4JL3 A;  3VPR A;  3B6A A;  4GCK A;  5K7F A;  3GEU A;  2I10 A;  2TCT A;  3G1M A;  3IUV A;  3KZ9 A;  1UI6 A;  4ABZ A;  5J1U A;  2W53 A;  4G12 A;  3Q0W A;  2NS7 A;  5F27 A;  4DW6 A;  2IAI A;  3NI7 A;  2ZOZ A;  3LSP A;  3BR2 A;  2QTQ A;  2FJ1 A;  2G7L A;  4HKU A;  2ZB9 A;  1ZKG A;  4V2F A;  3GZI A;  3O8H A;  2FD5 A;  2VKE A;  2HXO A;  3S5R A;  3COL A;  5D1R A;  3JSJ A;  4JYK A;  2Y2Z A;  1SGM A;  3HTJ A;  5EYR A;  4KWA A;  3FRQ A;  3VW1 A;  3BR6 A;  3IH2 A;  4JKZ A;  3PAS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...