3B81A

Crystal structure of predicted dna-binding transcriptional regulator of tetr/acrr family (np_350189.1) from clostridium acetobutylicum at 2.10 a resolution
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
194
structure length
183
Chain Sequence
b'INFNNKRTELANKIWDIFIANGYENTTLAFIINKLGISKGALYHYFSSKEECADAAIENRVAFFSNEVLKESEEGLNSIERLKKILLAGIINSPSNKIFHQKLMVAIIKYFAPIYADIISQGNEEGVFKVKYPLETAEIILTLSHFYLDEDLFKWKKEDMSLKLTAFKETLIKILDADEDTFD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, AcrR family
publication title Crystal structure of predicted DNA-binding transcriptional regulator of TetR/AcrR family (NP_350189.1) from Clostridium acetobutylicum at 2.10 A resolution
rcsb
source organism Clostridium acetobutylicum atcc 824
molecule tags Transcription regulator
total genus 68
structure length 183
sequence length 194
ec nomenclature
pdb deposition date 2007-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3b81A00
3RD3A 3BR5A 3CJDA 3TP3A 3BHQA 4MXMA 2F07A 3O8GA 1JUSA 2ID3A 3FRQA 2OF7A 2XDNA 3VPRA 2FJ1A 5DAJA 3PM1A 3RH2A 2JK3A 5FKLA 3ON4A 3G7RA 3WHCA 2VKVA 4GCKA 4GFKA 3BCGA 3G56A 3GZIA 2UXUA 3QQAA 3FIWA 1JT6A 2G7LA 3VVXA 5IP6A 5D1RA 2QCOA 1QVTA 2WUIA 4JKZA 3C07A 4HKUA 4I76A 1VI0A 4W1UA 3B81A 1RKWA 2UXPA 2Y30A 3WHBA 3B6CA 3BJBA 4JL3A 5F0HA 3BTIA 5J1RA 3DCFA 3IUVA 2G7GA 3QPLA 1Z77A 2Y31A 3BTLA 4XK4A 2RASA 4G12A 3Q3SA 2NP3A 3ANPA 2HYJA 1SGMA 2IU5A 4AC6A 2NX4A 3EUPA 5F27A 2GBYA 4W97A 2XGCA 1UI6A 5F04A 3T6NA 2X9DA 3VVZA 1JUMA 2OI8A 2FD5A 2NS8A 2ZB9A 5EZGA 2XGEA 4DW6A 2HKUA 4JNNA 4D5CA 3NNRA 2NS7A 2QKOA 2RHAA 4B3AA 3IH2A 5IOYA 2WGBA 5K7HA 3KZ9A 1ORKA 2IAIA 4ME9A 3E7QA 3NI7A 2YVEA 2XPVA 2GFNA 2IBDA 3VW2A 1QPIA 4ICHA 3EGQA 3VOXA 4D7MA 3HTHA 4M3GA 4M3FA 4YZEA 3CWRA 4I6ZA 4M3DA 3NPIA 1JUPA 5HSZA 3Q0WA 4M3EA 2YVHA 3HGGA 2PBXA 4GCLA 5AQCA 3FK7A 3IH4A 2V57A 3JSJA 3MNLA 5IOZA 3LJLA 3KKCA 3HTAA 2UXIA 3Q0VA 2RAEA 5K7FA 2G7SA 1UI5A 3PPBA 3HTJA 5D18A 4JYKA 2I10A 3CCYA 4MK6A 1BJZA 3ON2A 3BR6A 4AUXA 3BR0A 5K7ZA 2QWTA 5HAWA 2HXIA 3V78A 5GPAA 2FBQA 1T56A 5GPCA 2HQ5A 3B6AA 3MVPA 1T33A 4X1EA 3BTJA 4GFLA 2D6YA 2O7OA 3O60A 3VOKA 3TP0A 5FMPA 3G1MA 2Q24A 2Y2ZA 2OERA 2FX0A 2JJ7A 4PXIA 3G1OA 2VKEA 3KNWA 3NXCA 3BR2A 4ABZA 2UXHA 2XGDA 2TCTA 2PZ9A 3LSRA 2IEKA 1JTYA 4ACIA 1JTXA 1RKTA 3BTCA 3AQTA 3F1BA 3BQYA 3LOCA 1JT0A 4GCTA 5C4YA 5FGLA 2REKA 5CXGA 4D5FA 3GEUA 3VW0A 5CW8A 2W53A 3BRUA 2ZCMA 2G0EA 4MO7A 3QKXA 3S5RA 1RPWA 5FKMA 2ZOZA 3BR3A 5EFYA 5F0FA 5FKKA 1A6IA 3CRJA 5EYRA 2GUHA 2X6OA 4NELA 3VVYA 2ZOYA 1Z0XA 3LWJA 2HXOA 3PASA 3HGYA 2DG7A 2UXOA 3BT9A 3VUQA 3BR1A 3CDLA 2O7TA 2XPWA 5EZHA 3KKDA 3LSJA 3VIBA 5CXIA 1U9NA 5F1JA 4CGRA 5FKNA 2QOPA 4L62A 5H9TA 2WV1A 3P9TA 3SDGA 3QPSA 2TRTA 5FKOA 3ZQLA 2DTZA 5HBUA 3VW1A 3VP5A 2G3BA 3G1LA 2QTQA 5J1UA 3SFIA 3HTIA 3DEWA 4AC0A 3F0CA 2ID6A 3NRGA 2XRLA 4V2GA 5J3LA 4KWAA 3HIMA 5IPAA 2XPUA 2HYTA 3ZQFA 3DPJA 4D7NA 2NP5A 2QIBA 2DG8A 3FK6A 4V2FA 1U9OA 5D19A 3ZQIA 1ZK8A 5F08A 3ANGA 5F0CA 4NN1A 3C2BA 3IH3A 2OPTA 2GENA 2VPRA 3LSPA 2XB5A 3BNIA 3LHQA 4B1RA 3AQSA 5K58A 2EH3A 2FQ4A 3O8HA 4UDSA 5FHPA 3HE0A 3V6GA 3QBMA 5GP9A 2ZCXA 3BQZA 3Q0UA 1QVUA 4M3BA 3ZQGA 4AF5A 3COLA 3ZQHA 2ZCNA 5J1YA 1ZKGA
chains in the Genus database with same CATH superfamily
3RD3A 3DU6A 2PFVA 3BR5A 3CJDA 3TP3A 3BHQA 4MXMA 2F07A 3O8GA 1JUSA 2ID3A 3FRQA 2OF7A 2XDNA 3VPRA 4C2MA 2ZY9A 2B3WA 2FJ1A 5DAJA 3PM1A 3RH2A 2JK3A 2R7SA 5FKLA 3ON4A 2R7RA 3G7RA 3WHCA 2VKVA 4WIBA 4GCKA 4GFKA 3BCGA 3G56A 3GZIA 2UXUA 3QQAA 3FIWA 1JT6A 2G7LA 3VVXA 5IP6A 5D1RA 2QCOA 1QVTA 2WUIA 4JKZA 3C07A 4HKUA 4I76A 1VI0A 4W1UA 3B81A 1RKWA 2UXPA 2Y30A 3WHBA 2YVXA 3B6CA 3BJBA 4JL3A 5F0HA 3BTIA 5J1RA 3DCFA 3IUVA 2G7GA 3QPLA 1Z77A 2Y31A 3BTLA 4XK4A 2RASA 4G12A 3Q3SA 2NP3A 3ANPA 2HYJA 1SGMA 3SWHA 4OD5A 2IU5A 4AC6A 2NX4A 3EUPA 5F27A 3DU5A 2R7OA 2GBYA 4W97A 2XGCA 1UI6A 5F04A 3T6NA 2X9DA 3VVZA 1JUMA 2OI8A 2FD5A 2NS8A 4U9NA 2ZB9A 4OD4A 5EZGA 2XGEA 4DVYP 4DW6A 2HKUA 4JNNA 4D5CA 3NNRA 2NS7A 2QKOA 2RHAA 4B3AA 3IH2A 5IOYA 2WGBA 5K7HA 2R7TA 3KZ9A 1ORKA 2IAIA 4ME9A 3E7QA 3NI7A 2YVEA 2XPVA 2GFNA 2IBDA 3VW2A 1QPIA 4ICHA 3EGQA 3VOXA 4D7MA 3KYLA 3HTHA 3FHNA 4M3GA 4M3FA 4YZEA 3CWRA 4I6ZA 4M3DA 3NPIA 1JUPA 5HSZA 3Q0WA 4M3EA 2YVHA 3HGGA 2PBXA 4GCLA 5AQCA 3FK7A 3IH4A 2V57A 3JSJA 3MNLA 5IOZA 3LJLA 3KKCA 3HTAA 2UXIA 3Q0VA 2RAEA 5K7FA 2R7UA 2G7SA 1UI5A 3PPBA 3HTJA 5D18A 4JYKA 2I10A 3CCYA 4MK6A 1BJZA 3ON2A 3BR6A 4AUXA 3BR0A 5K7ZA 2QWTA 5HAWA 2HXIA 3V78A 5GPAA 2FBQA 1T56A 5GPCA 2HQ5A 3B6AA 3MVPA 1T33A 4X1EA 3BTJA 4GFLA 2D6YA 2O7OA 3O60A 5CQGA 3VOKA 3TP0A 5FMPA 3G1MA 2Q24A 2Y2ZA 2OERA 2FX0A 2JJ7A 4PXIA 3G1OA 2VKEA 3KNWA 3NXCA 3BR2A 4ABZA 2UXHA 2XGDA 2TCTA 2PZ9A 3LSRA 2IEKA 1JTYA 4ACIA 4IRVA 1JTXA 1RKTA 3BTCA 3AQTA 3F1BA 3VTIA 3BQYA 3LOCA 1JT0A 4GCTA 5C4YA 5FGLA 2REKA 3NS4A 5CXGA 4D5FA 3GEUA 3VW0A 5CW8A 2W53A 3BRUA 2ZCMA 2G0EA 4MO7A 3QKXA 3S5RA 1RPWA 5FKMA 2ZOZA 3BR3A 5EFYA 5F0FA 5FKKA 1A6IA 3CRJA 5EYRA 2GUHA 2X6OA 4NELA 3VVYA 2ZOYA 1Z0XA 3LWJA 2HXOA 3PASA 2A2FX 3HGYA 2DG7A 2UXOA 3BT9A 2B1EA 3VUQA 3BR1A 3CDLA 2O7TA 2XPWA 5EZHA 3KKDA 3LSJA 3VIBA 5CXIA 1U9NA 5F1JA 4CGRA 5FKNA 2QOPA 4L62A 5H9TA 2R7WA 2R7QA 2WV1A 3P9TA 3SDGA 3QPSA 2TRTA 5FKOA 3ZQLA 2DTZA 5HBUA 3VW1A 3VP5A 2G3BA 3G1LA 2QTQA 5J1UA 3SFIA 3HTIA 3DEWA 4AC0A 3F0CA 2ID6A 3NRGA 2XRLA 4V2GA 5J3LA 4KWAA 3HIMA 5IPAA 2XPUA 2HYTA 3ZQFA 3DPJA 4D7NA 2NP5A 2QIBA 2DG8A 3K8PC 3FK6A 4V2FA 1U9OA 5D19A 3ZQIA 1ZK8A 5F08A 3ANGA 5F0CA 4NN1A 3C2BA 3IH3A 2OPTA 2GENA 2VPRA 3LSPA 2R7VA 2XB5A 2R7XA 3BNIA 3LHQA 4B1RA 3AQSA 4U9LA 5K58A 2EH3A 2FQ4A 3O8HA 4UDSA 5FHPA 3HE0A 2FJI1 3V6GA 3QBMA 5GP9A 2ZCXA 3BQZA 3Q0UA 1QVUA 4M3BA 3ZQGA 4AF5A 3COLA 3ZQHA 2ZCNA 5J1YA 1ZKGA
chains in the Genus database with same CATH topology
3RD3A 3BR5A 3CJDA 3TP3A 3BHQA 4MXMA 2F07A 3O8GA 1JUSA 2ID3A 3FRQA 2OF7A 2XDNA 3VPRA 2FJ1A 5DAJA 3PM1A 3RH2A 2JK3A 5FKLA 3ON4A 3G7RA 3WHCA 2VKVA 4GCKA 4GFKA 3BCGA 3G56A 3GZIA 2UXUA 3QQAA 3FIWA 1JT6A 2G7LA 3VVXA 5IP6A 5D1RA 2QCOA 1QVTA 2WUIA 4JKZA 3C07A 4HKUA 4I76A 1VI0A 4W1UA 3B81A 1RKWA 2UXPA 2Y30A 3WHBA 3B6CA 3BJBA 4JL3A 5F0HA 3BTIA 5J1RA 3DCFA 3IUVA 2G7GA 3QPLA 1Z77A 2Y31A 3BTLA 4XK4A 2RASA 4G12A 3Q3SA 2NP3A 3ANPA 2HYJA 1SGMA 2IU5A 4AC6A 2NX4A 3EUPA 5F27A 2GBYA 4W97A 2XGCA 1UI6A 5F04A 3T6NA 2X9DA 3VVZA 1JUMA 2OI8A 2FD5A 2NS8A 2ZB9A 5EZGA 2XGEA 4DW6A 2HKUA 4JNNA 4D5CA 3NNRA 2NS7A 2QKOA 2RHAA 4B3AA 3IH2A 5IOYA 2WGBA 5K7HA 3KZ9A 1ORKA 2IAIA 4ME9A 3E7QA 3NI7A 2YVEA 2XPVA 2GFNA 2IBDA 3VW2A 1QPIA 4ICHA 3EGQA 3VOXA 4D7MA 3HTHA 4M3GA 4M3FA 4YZEA 3CWRA 4I6ZA 4M3DA 3NPIA 1JUPA 5HSZA 3Q0WA 4M3EA 2YVHA 3HGGA 2PBXA 4GCLA 5AQCA 3FK7A 3IH4A 2V57A 3JSJA 3MNLA 5IOZA 3LJLA 3KKCA 3HTAA 2UXIA 3Q0VA 2RAEA 5K7FA 2G7SA 1UI5A 3PPBA 3HTJA 5D18A 4JYKA 2I10A 3CCYA 4MK6A 1BJZA 3ON2A 3BR6A 4AUXA 3BR0A 5K7ZA 2QWTA 5HAWA 2HXIA 3V78A 5GPAA 2FBQA 1T56A 5GPCA 2HQ5A 3B6AA 3MVPA 1T33A 4X1EA 3BTJA 4GFLA 2D6YA 2O7OA 3O60A 3VOKA 3TP0A 5FMPA 3G1MA 2Q24A 2Y2ZA 2OERA 2FX0A 2JJ7A 4PXIA 3G1OA 2VKEA 3KNWA 3NXCA 3BR2A 4ABZA 2UXHA 2XGDA 2TCTA 2PZ9A 3LSRA 2IEKA 1JTYA 4ACIA 1JTXA 1RKTA 3BTCA 3AQTA 3F1BA 3BQYA 3LOCA 1JT0A 4GCTA 5C4YA 5FGLA 2REKA 5CXGA 4D5FA 3GEUA 3VW0A 5CW8A 2W53A 3BRUA 2ZCMA 2G0EA 4MO7A 3QKXA 3S5RA 1RPWA 5FKMA 2ZOZA 3BR3A 5EFYA 5F0FA 5FKKA 1A6IA 3CRJA 5EYRA 2GUHA 2X6OA 4NELA 3VVYA 2ZOYA 1Z0XA 3LWJA 2HXOA 3PASA 3HGYA 2DG7A 2UXOA 3BT9A 3VUQA 3BR1A 3CDLA 2O7TA 2XPWA 5EZHA 3KKDA 3LSJA 3VIBA 5CXIA 1U9NA 5F1JA 4CGRA 5FKNA 2QOPA 4L62A 5H9TA 2WV1A 3P9TA 3SDGA 3QPSA 2TRTA 5FKOA 3ZQLA 2DTZA 5HBUA 3VW1A 3VP5A 2G3BA 3G1LA 2QTQA 5J1UA 3SFIA 3HTIA 3DEWA 4AC0A 3F0CA 2ID6A 3NRGA 2XRLA 4V2GA 5J3LA 4KWAA 3HIMA 5IPAA 2XPUA 2HYTA 3ZQFA 3DPJA 4D7NA 2NP5A 2QIBA 2DG8A 3FK6A 4V2FA 1U9OA 5D19A 3ZQIA 1ZK8A 5F08A 3ANGA 5F0CA 4NN1A 3C2BA 3IH3A 2OPTA 2GENA 2VPRA 3LSPA 2XB5A 3BNIA 3LHQA 4B1RA 3AQSA 5K58A 2EH3A 2FQ4A 3O8HA 4UDSA 5FHPA 3HE0A 3V6GA 3QBMA 5GP9A 2ZCXA 3BQZA 3Q0UA 1QVUA 4M3BA 3ZQGA 4AF5A 3COLA 3ZQHA 2ZCNA 5J1YA 1ZKGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RD3 A;  3BR5 A;  3CJD A;  3TP3 A;  3BHQ A;  4MXM A;  2F07 A;  3O8G A;  1JUS A;  2ID3 A;  3FRQ A;  2OF7 A;  2XDN A;  3VPR A;  2FJ1 A;  5DAJ A;  3PM1 A;  3RH2 A;  2JK3 A;  5FKL A;  3ON4 A;  3G7R A;  3WHC A;  2VKV A;  4GCK A;  4GFK A;  3BCG A;  3G56 A;  3GZI A;  2UXU A;  3QQA A;  3FIW A;  1JT6 A;  2G7L A;  3VVX A;  5IP6 A;  5D1R A;  2QCO A;  1QVT A;  2WUI A;  4JKZ A;  3C07 A;  4HKU A;  4I76 A;  1VI0 A;  4W1U A;  3B81 A;  1RKW A;  2UXP A;  2Y30 A;  3WHB A;  3B6C A;  3BJB A;  4JL3 A;  5F0H A;  3BTI A;  5J1R A;  3DCF A;  3IUV A;  2G7G A;  3QPL A;  1Z77 A;  2Y31 A;  3BTL A;  4XK4 A;  2RAS A;  4G12 A;  3Q3S A;  2NP3 A;  3ANP A;  2HYJ A;  1SGM A;  2IU5 A;  4AC6 A;  2NX4 A;  3EUP A;  5F27 A;  2GBY A;  4W97 A;  2XGC A;  1UI6 A;  5F04 A;  3T6N A;  2X9D A;  3VVZ A;  1JUM A;  2OI8 A;  2FD5 A;  2NS8 A;  2ZB9 A;  5EZG A;  2XGE A;  4DW6 A;  2HKU A;  4JNN A;  4D5C A;  3NNR A;  2NS7 A;  2QKO A;  2RHA A;  4B3A A;  3IH2 A;  5IOY A;  2WGB A;  5K7H A;  3KZ9 A;  1ORK A;  2IAI A;  4ME9 A;  3E7Q A;  3NI7 A;  2YVE A;  2XPV A;  2GFN A;  2IBD A;  3VW2 A;  1QPI A;  4ICH A;  3EGQ A;  3VOX A;  4D7M A;  3HTH A;  4M3G A;  4M3F A;  4YZE A;  3CWR A;  4I6Z A;  4M3D A;  3NPI A;  1JUP A;  5HSZ A;  3Q0W A;  4M3E A;  2YVH A;  3HGG A;  2PBX A;  4GCL A;  5AQC A;  3FK7 A;  3IH4 A;  2V57 A;  3JSJ A;  3MNL A;  5IOZ A;  3LJL A;  3KKC A;  3HTA A;  2UXI A;  3Q0V A;  2RAE A;  5K7F A;  2G7S A;  1UI5 A;  3PPB A;  3HTJ A;  5D18 A;  4JYK A;  2I10 A;  3CCY A;  4MK6 A;  1BJZ A;  3ON2 A;  3BR6 A;  4AUX A;  3BR0 A;  5K7Z A;  2QWT A;  5HAW A;  2HXI A;  3V78 A;  5GPA A;  2FBQ A;  1T56 A;  5GPC A;  2HQ5 A;  3B6A A;  3MVP A;  1T33 A;  4X1E A;  3BTJ A;  4GFL A;  2D6Y A;  2O7O A;  3O60 A;  3VOK A;  3TP0 A;  5FMP A;  3G1M A;  2Q24 A;  2Y2Z A;  2OER A;  2FX0 A;  2JJ7 A;  4PXI A;  3G1O A;  2VKE A;  3KNW A;  3NXC A;  3BR2 A;  4ABZ A;  2UXH A;  2XGD A;  2TCT A;  2PZ9 A;  3LSR A;  2IEK A;  1JTY A;  4ACI A;  1JTX A;  1RKT A;  3BTC A;  3AQT A;  3F1B A;  3BQY A;  3LOC A;  1JT0 A;  4GCT A;  5C4Y A;  5FGL A;  2REK A;  5CXG A;  4D5F A;  3GEU A;  3VW0 A;  5CW8 A;  2W53 A;  3BRU A;  2ZCM A;  2G0E A;  4MO7 A;  3QKX A;  3S5R A;  1RPW A;  5FKM A;  2ZOZ A;  3BR3 A;  5EFY A;  5F0F A;  5FKK A;  1A6I A;  3CRJ A;  5EYR A;  2GUH A;  2X6O A;  4NEL A;  3VVY A;  2ZOY A;  1Z0X A;  3LWJ A;  2HXO A;  3PAS A;  3HGY A;  2DG7 A;  2UXO A;  3BT9 A;  3VUQ A;  3BR1 A;  3CDL A;  2O7T A;  2XPW A;  5EZH A;  3KKD A;  3LSJ A;  3VIB A;  5CXI A;  1U9N A;  5F1J A;  4CGR A;  5FKN A;  2QOP A;  4L62 A;  5H9T A;  2WV1 A;  3P9T A;  3SDG A;  3QPS A;  2TRT A;  5FKO A;  3ZQL A;  2DTZ A;  5HBU A;  3VW1 A;  3VP5 A;  2G3B A;  3G1L A;  2QTQ A;  5J1U A;  3SFI A;  3HTI A;  3DEW A;  4AC0 A;  3F0C A;  2ID6 A;  3NRG A;  2XRL A;  4V2G A;  5J3L A;  4KWA A;  3HIM A;  5IPA A;  2XPU A;  2HYT A;  3ZQF A;  3DPJ A;  4D7N A;  2NP5 A;  2QIB A;  2DG8 A;  3FK6 A;  4V2F A;  1U9O A;  5D19 A;  3ZQI A;  1ZK8 A;  5F08 A;  3ANG A;  5F0C A;  4NN1 A;  3C2B A;  3IH3 A;  2OPT A;  2GEN A;  2VPR A;  3LSP A;  2XB5 A;  3BNI A;  3LHQ A;  4B1R A;  3AQS A;  5K58 A;  2EH3 A;  2FQ4 A;  3O8H A;  4UDS A;  5FHP A;  3HE0 A;  3V6G A;  3QBM A;  5GP9 A;  2ZCX A;  3BQZ A;  3Q0U A;  1QVU A;  4M3B A;  3ZQG A;  4AF5 A;  3COL A;  3ZQH A;  2ZCN A;  5J1Y A;  1ZKG A; 
#chains in the Genus database with same CATH topology
 3RD3 A;  3DU6 A;  2PFV A;  3BR5 A;  3CJD A;  3TP3 A;  3BHQ A;  4MXM A;  2F07 A;  3O8G A;  1JUS A;  2ID3 A;  3FRQ A;  2OF7 A;  2XDN A;  3VPR A;  4C2M A;  2ZY9 A;  2B3W A;  2FJ1 A;  5DAJ A;  3PM1 A;  3RH2 A;  2JK3 A;  2R7S A;  5FKL A;  3ON4 A;  2R7R A;  3G7R A;  3WHC A;  2VKV A;  4WIB A;  4GCK A;  4GFK A;  3BCG A;  3G56 A;  3GZI A;  2UXU A;  3QQA A;  3FIW A;  1JT6 A;  2G7L A;  3VVX A;  5IP6 A;  5D1R A;  2QCO A;  1QVT A;  2WUI A;  4JKZ A;  3C07 A;  4HKU A;  4I76 A;  1VI0 A;  4W1U A;  3B81 A;  1RKW A;  2UXP A;  2Y30 A;  3WHB A;  2YVX A;  3B6C A;  3BJB A;  4JL3 A;  5F0H A;  3BTI A;  5J1R A;  3DCF A;  3IUV A;  2G7G A;  3QPL A;  1Z77 A;  2Y31 A;  3BTL A;  4XK4 A;  2RAS A;  4G12 A;  3Q3S A;  2NP3 A;  3ANP A;  2HYJ A;  1SGM A;  3SWH A;  4OD5 A;  2IU5 A;  4AC6 A;  2NX4 A;  3EUP A;  5F27 A;  3DU5 A;  2R7O A;  2GBY A;  4W97 A;  2XGC A;  1UI6 A;  5F04 A;  3T6N A;  2X9D A;  3VVZ A;  1JUM A;  2OI8 A;  2FD5 A;  2NS8 A;  4U9N A;  2ZB9 A;  4OD4 A;  5EZG A;  2XGE A;  4DVY P;  4DW6 A;  2HKU A;  4JNN A;  4D5C A;  3NNR A;  2NS7 A;  2QKO A;  2RHA A;  4B3A A;  3IH2 A;  5IOY A;  2WGB A;  5K7H A;  2R7T A;  3KZ9 A;  1ORK A;  2IAI A;  4ME9 A;  3E7Q A;  3NI7 A;  2YVE A;  2XPV A;  2GFN A;  2IBD A;  3VW2 A;  1QPI A;  4ICH A;  3EGQ A;  3VOX A;  4D7M A;  3KYL A;  3HTH A;  3FHN A;  4M3G A;  4M3F A;  4YZE A;  3CWR A;  4I6Z A;  4M3D A;  3NPI A;  1JUP A;  5HSZ A;  3Q0W A;  4M3E A;  2YVH A;  3HGG A;  2PBX A;  4GCL A;  5AQC A;  3FK7 A;  3IH4 A;  2V57 A;  3JSJ A;  3MNL A;  5IOZ A;  3LJL A;  3KKC A;  3HTA A;  2UXI A;  3Q0V A;  2RAE A;  5K7F A;  2R7U A;  2G7S A;  1UI5 A;  3PPB A;  3HTJ A;  5D18 A;  4JYK A;  2I10 A;  3CCY A;  4MK6 A;  1BJZ A;  3ON2 A;  3BR6 A;  4AUX A;  3BR0 A;  5K7Z A;  2QWT A;  5HAW A;  2HXI A;  3V78 A;  5GPA A;  2FBQ A;  1T56 A;  5GPC A;  2HQ5 A;  3B6A A;  3MVP A;  1T33 A;  4X1E A;  3BTJ A;  4GFL A;  2D6Y A;  2O7O A;  3O60 A;  5CQG A;  3VOK A;  3TP0 A;  5FMP A;  3G1M A;  2Q24 A;  2Y2Z A;  2OER A;  2FX0 A;  2JJ7 A;  4PXI A;  3G1O A;  2VKE A;  3KNW A;  3NXC A;  3BR2 A;  4ABZ A;  2UXH A;  2XGD A;  2TCT A;  2PZ9 A;  3LSR A;  2IEK A;  1JTY A;  4ACI A;  4IRV A;  1JTX A;  1RKT A;  3BTC A;  3AQT A;  3F1B A;  3VTI A;  3BQY A;  3LOC A;  1JT0 A;  4GCT A;  5C4Y A;  5FGL A;  2REK A;  3NS4 A;  5CXG A;  4D5F A;  3GEU A;  3VW0 A;  5CW8 A;  2W53 A;  3BRU A;  2ZCM A;  2G0E A;  4MO7 A;  3QKX A;  3S5R A;  1RPW A;  5FKM A;  2ZOZ A;  3BR3 A;  5EFY A;  5F0F A;  5FKK A;  1A6I A;  3CRJ A;  5EYR A;  2GUH A;  2X6O A;  4NEL A;  3VVY A;  2ZOY A;  1Z0X A;  3LWJ A;  2HXO A;  3PAS A;  2A2F X;  3HGY A;  2DG7 A;  2UXO A;  3BT9 A;  2B1E A;  3VUQ A;  3BR1 A;  3CDL A;  2O7T A;  2XPW A;  5EZH A;  3KKD A;  3LSJ A;  3VIB A;  5CXI A;  1U9N A;  5F1J A;  4CGR A;  5FKN A;  2QOP A;  4L62 A;  5H9T A;  2R7W A;  2R7Q A;  2WV1 A;  3P9T A;  3SDG A;  3QPS A;  2TRT A;  5FKO A;  3ZQL A;  2DTZ A;  5HBU A;  3VW1 A;  3VP5 A;  2G3B A;  3G1L A;  2QTQ A;  5J1U A;  3SFI A;  3HTI A;  3DEW A;  4AC0 A;  3F0C A;  2ID6 A;  3NRG A;  2XRL A;  4V2G A;  5J3L A;  4KWA A;  3HIM A;  5IPA A;  2XPU A;  2HYT A;  3ZQF A;  3DPJ A;  4D7N A;  2NP5 A;  2QIB A;  2DG8 A;  3K8P C;  3FK6 A;  4V2F A;  1U9O A;  5D19 A;  3ZQI A;  1ZK8 A;  5F08 A;  3ANG A;  5F0C A;  4NN1 A;  3C2B A;  3IH3 A;  2OPT A;  2GEN A;  2VPR A;  3LSP A;  2R7V A;  2XB5 A;  2R7X A;  3BNI A;  3LHQ A;  4B1R A;  3AQS A;  4U9L A;  5K58 A;  2EH3 A;  2FQ4 A;  3O8H A;  4UDS A;  5FHP A;  3HE0 A;  2FJI 1;  3V6G A;  3QBM A;  5GP9 A;  2ZCX A;  3BQZ A;  3Q0U A;  1QVU A;  4M3B A;  3ZQG A;  4AF5 A;  3COL A;  3ZQH A;  2ZCN A;  5J1Y A;  1ZKG A; 
#chains in the Genus database with same CATH homology
 3RD3 A;  3BR5 A;  3CJD A;  3TP3 A;  3BHQ A;  4MXM A;  2F07 A;  3O8G A;  1JUS A;  2ID3 A;  3FRQ A;  2OF7 A;  2XDN A;  3VPR A;  2FJ1 A;  5DAJ A;  3PM1 A;  3RH2 A;  2JK3 A;  5FKL A;  3ON4 A;  3G7R A;  3WHC A;  2VKV A;  4GCK A;  4GFK A;  3BCG A;  3G56 A;  3GZI A;  2UXU A;  3QQA A;  3FIW A;  1JT6 A;  2G7L A;  3VVX A;  5IP6 A;  5D1R A;  2QCO A;  1QVT A;  2WUI A;  4JKZ A;  3C07 A;  4HKU A;  4I76 A;  1VI0 A;  4W1U A;  3B81 A;  1RKW A;  2UXP A;  2Y30 A;  3WHB A;  3B6C A;  3BJB A;  4JL3 A;  5F0H A;  3BTI A;  5J1R A;  3DCF A;  3IUV A;  2G7G A;  3QPL A;  1Z77 A;  2Y31 A;  3BTL A;  4XK4 A;  2RAS A;  4G12 A;  3Q3S A;  2NP3 A;  3ANP A;  2HYJ A;  1SGM A;  2IU5 A;  4AC6 A;  2NX4 A;  3EUP A;  5F27 A;  2GBY A;  4W97 A;  2XGC A;  1UI6 A;  5F04 A;  3T6N A;  2X9D A;  3VVZ A;  1JUM A;  2OI8 A;  2FD5 A;  2NS8 A;  2ZB9 A;  5EZG A;  2XGE A;  4DW6 A;  2HKU A;  4JNN A;  4D5C A;  3NNR A;  2NS7 A;  2QKO A;  2RHA A;  4B3A A;  3IH2 A;  5IOY A;  2WGB A;  5K7H A;  3KZ9 A;  1ORK A;  2IAI A;  4ME9 A;  3E7Q A;  3NI7 A;  2YVE A;  2XPV A;  2GFN A;  2IBD A;  3VW2 A;  1QPI A;  4ICH A;  3EGQ A;  3VOX A;  4D7M A;  3HTH A;  4M3G A;  4M3F A;  4YZE A;  3CWR A;  4I6Z A;  4M3D A;  3NPI A;  1JUP A;  5HSZ A;  3Q0W A;  4M3E A;  2YVH A;  3HGG A;  2PBX A;  4GCL A;  5AQC A;  3FK7 A;  3IH4 A;  2V57 A;  3JSJ A;  3MNL A;  5IOZ A;  3LJL A;  3KKC A;  3HTA A;  2UXI A;  3Q0V A;  2RAE A;  5K7F A;  2G7S A;  1UI5 A;  3PPB A;  3HTJ A;  5D18 A;  4JYK A;  2I10 A;  3CCY A;  4MK6 A;  1BJZ A;  3ON2 A;  3BR6 A;  4AUX A;  3BR0 A;  5K7Z A;  2QWT A;  5HAW A;  2HXI A;  3V78 A;  5GPA A;  2FBQ A;  1T56 A;  5GPC A;  2HQ5 A;  3B6A A;  3MVP A;  1T33 A;  4X1E A;  3BTJ A;  4GFL A;  2D6Y A;  2O7O A;  3O60 A;  3VOK A;  3TP0 A;  5FMP A;  3G1M A;  2Q24 A;  2Y2Z A;  2OER A;  2FX0 A;  2JJ7 A;  4PXI A;  3G1O A;  2VKE A;  3KNW A;  3NXC A;  3BR2 A;  4ABZ A;  2UXH A;  2XGD A;  2TCT A;  2PZ9 A;  3LSR A;  2IEK A;  1JTY A;  4ACI A;  1JTX A;  1RKT A;  3BTC A;  3AQT A;  3F1B A;  3BQY A;  3LOC A;  1JT0 A;  4GCT A;  5C4Y A;  5FGL A;  2REK A;  5CXG A;  4D5F A;  3GEU A;  3VW0 A;  5CW8 A;  2W53 A;  3BRU A;  2ZCM A;  2G0E A;  4MO7 A;  3QKX A;  3S5R A;  1RPW A;  5FKM A;  2ZOZ A;  3BR3 A;  5EFY A;  5F0F A;  5FKK A;  1A6I A;  3CRJ A;  5EYR A;  2GUH A;  2X6O A;  4NEL A;  3VVY A;  2ZOY A;  1Z0X A;  3LWJ A;  2HXO A;  3PAS A;  3HGY A;  2DG7 A;  2UXO A;  3BT9 A;  3VUQ A;  3BR1 A;  3CDL A;  2O7T A;  2XPW A;  5EZH A;  3KKD A;  3LSJ A;  3VIB A;  5CXI A;  1U9N A;  5F1J A;  4CGR A;  5FKN A;  2QOP A;  4L62 A;  5H9T A;  2WV1 A;  3P9T A;  3SDG A;  3QPS A;  2TRT A;  5FKO A;  3ZQL A;  2DTZ A;  5HBU A;  3VW1 A;  3VP5 A;  2G3B A;  3G1L A;  2QTQ A;  5J1U A;  3SFI A;  3HTI A;  3DEW A;  4AC0 A;  3F0C A;  2ID6 A;  3NRG A;  2XRL A;  4V2G A;  5J3L A;  4KWA A;  3HIM A;  5IPA A;  2XPU A;  2HYT A;  3ZQF A;  3DPJ A;  4D7N A;  2NP5 A;  2QIB A;  2DG8 A;  3FK6 A;  4V2F A;  1U9O A;  5D19 A;  3ZQI A;  1ZK8 A;  5F08 A;  3ANG A;  5F0C A;  4NN1 A;  3C2B A;  3IH3 A;  2OPT A;  2GEN A;  2VPR A;  3LSP A;  2XB5 A;  3BNI A;  3LHQ A;  4B1R A;  3AQS A;  5K58 A;  2EH3 A;  2FQ4 A;  3O8H A;  4UDS A;  5FHP A;  3HE0 A;  3V6G A;  3QBM A;  5GP9 A;  2ZCX A;  3BQZ A;  3Q0U A;  1QVU A;  4M3B A;  3ZQG A;  4AF5 A;  3COL A;  3ZQH A;  2ZCN A;  5J1Y A;  1ZKG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...