3B81A

Crystal structure of predicted dna-binding transcriptional regulator of tetr/acrr family (np_350189.1) from clostridium acetobutylicum at 2.10 a resolution
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
194
structure length
183
Chain Sequence
INFNNKRTELANKIWDIFIANGYENTTLAFIINKLGISKGALYHYFSSKEECADAAIENRVAFFSNEVLKESEEGLNSIERLKKILLAGIINSPSNKIFHQKLMVAIIKYFAPIYADIISQGNEEGVFKVKYPLETAEIILTLSHFYLDEDLFKWKKEDMSLKLTAFKETLIKILDADEDTFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, AcrR family
publication title Crystal structure of predicted DNA-binding transcriptional regulator of TetR/AcrR family (NP_350189.1) from Clostridium acetobutylicum at 2.10 A resolution
rcsb
source organism Clostridium acetobutylicum atcc 824
molecule tags Transcription regulator
total genus 68
structure length 183
sequence length 194
ec nomenclature
pdb deposition date 2007-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3b81A00
1U9OA 3NI7A 2ID6A 3NNRA 4M3BA 2WGBA 3B81A 3C07A 3NRGA 3KKCA 3V78A 3V6GA 2ZCNA 1A6IA 3KNWA 4M3FA 4M3EA 2HKUA 3VP5A 5D18A 2OERA 3VPRA 3ZQHA 3BJBA 1JTXA 3MNLA 2HXOA 1JTYA 3Q0VA 2Q24A 4JL3A 3BR1A 4I6ZA 4JKZA 4D5CA 2NX4A 4M3DA 2GENA 4B3AA 4GCKA 2QOPA 5GP9A 3IUVA 3BQZA 4ABZA 2PBXA 3RH2A 3VVZA 3BNIA 5IOZA 3BT9A 3HTAA 3PM1A 5F0FA 3GZIA 4KWAA 2NS8A 1JUSA 5AQCA 3E7QA 5F27A 4AC6A 2O7TA 3G56A 5FKNA 1Z77A 2EH3A 5FMPA 2XDNA 2IBDA 3BR2A 3FIWA 3F1BA 1JUPA 2ZB9A 4UDSA 1ZKGA 3FRQA 3IH3A 2HQ5A 2O7OA 2VKEA 2REKA 5EYRA 3KZ9A 5IP6A 5D19A 2DG7A 4X1EA 3WHCA 3QQAA 1RKTA 3HTJA 2NP3A 3BR6A 3BTIA 3QBMA 2FQ4A 2HYJA 2RASA 2XRLA 1JT6A 5EFYA 3O8GA 1JT0A 2ZOYA 4V2GA 3ANGA 3ZQGA 4B1RA 3F0CA 2OPTA 3LJLA 5K7FA 4JNNA 3AQSA 4GFLA 3NXCA 3BTCA 2OF7A 3VOXA 3BQYA 2WUIA 3PASA 2QWTA 3B6CA 2XPVA 3COLA 3BRUA 1T56A 3VIBA 4D7MA 3DEWA 2X9DA 2FX0A 5F1JA 4NELA 3CCYA 2V57A 2I10A 4PXIA 3VOKA 2QCOA 3KKDA 2QTQA 3C2BA 1QVUA 3LWJA 3DPJA 2YVHA 3HIMA 3ON2A 2FD5A 5F0CA 1T33A 3G1LA 5FHPA 1VI0A 2TCTA 2XB5A 2NP5A 2G7SA 4D5FA 5IOYA 4GCTA 4AUXA 3LHQA 4D7NA 5K7ZA 5HSZA 2ID3A 5EZGA 3VW0A 2GBYA 2WV1A 3MVPA 1SGMA 2VKVA 3VUQA 3VVXA 3TP3A 5J1UA 3SFIA 1RPWA 2UXOA 3GEUA 4HKUA 3CJDA 4M3GA 4YZEA 4MO7A 1ZK8A 3LSRA 2FJ1A 3BCGA 5F08A 5FKMA 2XPWA 3SDGA 2UXIA 4JYKA 2QKOA 5F04A 3HTHA 2UXUA 2IU5A 4AC0A 5FGLA 3EGQA 3QPSA 4ME9A 3BR3A 4W97A 2NS7A 2X6OA 4V2FA 1Z0XA 4XK4A 3DCFA 3BTJA 4W1UA 1UI6A 4ACIA 3NPIA 2UXPA 5EZHA 2JK3A 3BR0A 3CWRA 4I76A 2XGEA 3Q0WA 5HAWA 3G1OA 2DG8A 2VPRA 2RAEA 5CW8A 3JSJA 3G1MA 3G7RA 3IH2A 3ZQLA 2Y30A 2JJ7A 3S5RA 5C4YA 1QPIA 3O8HA 5F0HA 2ZCXA 3BTLA 4ICHA 5DAJA 1BJZA 3FK6A 1RKWA 2GFNA 5CXIA 2OI8A 5FKKA 2XPUA 3ANPA 1ORKA 3HE0A 3QKXA 3Q3SA 4MXMA 3HGYA 2G7GA 2HXIA 5J3LA 4GFKA 3VW1A 5HBUA 4GCLA 2PZ9A 2QIBA 5J1RA 3CRJA 2TRTA 3HTIA 3RD3A 2G7LA 5IPAA 4NN1A 3FK7A 3LSPA 2D6YA 1QVTA 2W53A 3O60A 3QPLA 5FKLA 2YVEA 5K58A 3AQTA 3Q0UA 3ZQIA 3WHBA 5K7HA 2RHAA 3T6NA 1U9NA 3VW2A 3ZQFA 5D1RA 3PPBA 4L62A 2XGCA 2IEKA 2XGDA 2UXHA 3B6AA 2Y2ZA 2F07A 3P9TA 2IAIA 3IH4A 3CDLA 2Y31A 3ON4A 4AF5A 2ZOZA 2GUHA 4G12A 2FBQA 3EUPA 5GPAA 4CGRA 5H9TA 5J1YA 2ZCMA 3BHQA 3VVYA 2G3BA 3BR5A 3LOCA 5FKOA 2G0EA 2DTZA 5GPCA 1UI5A 2HYTA 4DW6A 1JUMA 3HGGA 3TP0A 3LSJA 4MK6A 5CXGA
chains in the Genus database with same CATH superfamily
1U9OA 3NI7A 2ID6A 3NNRA 4M3BA 2WGBA 3B81A 3C07A 3NRGA 3KKCA 3V78A 2YVXA 3V6GA 2ZCNA 1A6IA 3KNWA 4M3FA 4M3EA 2HKUA 3VP5A 5D18A 2OERA 3VPRA 3ZQHA 3BJBA 2R7TA 5CQGA 1JTXA 3MNLA 2HXOA 2A2FX 1JTYA 3Q0VA 2Q24A 4JL3A 3BR1A 4I6ZA 4JKZA 4D5CA 2NX4A 2R7VA 4M3DA 2GENA 4B3AA 4GCKA 2QOPA 5GP9A 3IUVA 3BQZA 4ABZA 2PBXA 3RH2A 3VVZA 3BNIA 5IOZA 3BT9A 3HTAA 3PM1A 5F0FA 3GZIA 4KWAA 2NS8A 4U9LA 1JUSA 5AQCA 3E7QA 5F27A 4AC6A 2O7TA 3G56A 5FKNA 1Z77A 2EH3A 5FMPA 2XDNA 2IBDA 3BR2A 3FIWA 3F1BA 1JUPA 2ZB9A 4UDSA 1ZKGA 3FRQA 3IH3A 2HQ5A 2O7OA 2VKEA 2REKA 5EYRA 3KZ9A 5IP6A 5D19A 2DG7A 4X1EA 3WHCA 3QQAA 1RKTA 3HTJA 2NP3A 3BR6A 3BTIA 3QBMA 2FQ4A 2HYJA 2RASA 2XRLA 4C2MA 1JT6A 5EFYA 3O8GA 1JT0A 2ZOYA 4V2GA 3ANGA 3ZQGA 4B1RA 3F0CA 2OPTA 3LJLA 5K7FA 4JNNA 2R7XA 3AQSA 2R7OA 4GFLA 3NXCA 3BTCA 2OF7A 3VOXA 3BQYA 2WUIA 3PASA 2QWTA 3B6CA 2XPVA 3COLA 3BRUA 1T56A 3VIBA 4D7MA 2R7RA 3DEWA 2X9DA 3SWHA 2FX0A 5F1JA 4NELA 3CCYA 2V57A 2I10A 4PXIA 3VOKA 2QCOA 3KKDA 2QTQA 3C2BA 1QVUA 3LWJA 3DPJA 4DVYP 2YVHA 3HIMA 3ON2A 2FD5A 5F0CA 2PFVA 1T33A 3G1LA 5FHPA 1VI0A 2TCTA 2XB5A 2NP5A 4IRVA 3FHNA 2G7SA 4D5FA 5IOYA 4GCTA 4AUXA 3LHQA 3K8PC 4D7NA 5K7ZA 5HSZA 2ID3A 5EZGA 3VW0A 2GBYA 2WV1A 3MVPA 4OD4A 1SGMA 2VKVA 3VUQA 3VVXA 3TP3A 5J1UA 3SFIA 1RPWA 2UXOA 3GEUA 4HKUA 3CJDA 4M3GA 4YZEA 4MO7A 1ZK8A 3LSRA 2FJ1A 3BCGA 5F08A 5FKMA 2XPWA 3SDGA 3KYLA 2UXIA 4JYKA 2QKOA 5F04A 3HTHA 2UXUA 2IU5A 4AC0A 5FGLA 3EGQA 3NS4A 3QPSA 4ME9A 2FJI1 3BR3A 4W97A 2NS7A 2X6OA 4V2FA 3DU5A 1Z0XA 4XK4A 3DCFA 3BTJA 4OD5A 4W1UA 2R7WA 1UI6A 4ACIA 3NPIA 2UXPA 5EZHA 2JK3A 3BR0A 3CWRA 4I76A 2XGEA 3Q0WA 5HAWA 3G1OA 2DG8A 2VPRA 2RAEA 5CW8A 3JSJA 3G1MA 3G7RA 3IH2A 3ZQLA 2Y30A 2JJ7A 3S5RA 5C4YA 1QPIA 3O8HA 4WIBA 5F0HA 2ZCXA 3BTLA 4ICHA 5DAJA 1BJZA 3FK6A 1RKWA 2GFNA 5CXIA 2OI8A 5FKKA 2XPUA 3ANPA 1ORKA 3HE0A 3QKXA 3Q3SA 4MXMA 3HGYA 2G7GA 2HXIA 5J3LA 4GFKA 3VW1A 5HBUA 4GCLA 2PZ9A 2QIBA 5J1RA 3CRJA 2TRTA 3HTIA 3RD3A 2G7LA 5IPAA 4NN1A 3FK7A 3DU6A 3LSPA 2B3WA 2D6YA 1QVTA 2W53A 3O60A 3QPLA 5FKLA 2B1EA 3VTIA 2ZY9A 2YVEA 5K58A 3AQTA 3Q0UA 3ZQIA 3WHBA 5K7HA 2RHAA 3T6NA 2R7QA 1U9NA 3VW2A 3ZQFA 5D1RA 3PPBA 4L62A 2XGCA 2IEKA 2XGDA 2UXHA 3B6AA 2Y2ZA 2F07A 3P9TA 2IAIA 3IH4A 3CDLA 2Y31A 3ON4A 4AF5A 2ZOZA 2GUHA 4G12A 2FBQA 3EUPA 4U9NA 2R7UA 5GPAA 4CGRA 5H9TA 5J1YA 2ZCMA 3BHQA 3VVYA 2G3BA 3BR5A 3LOCA 5FKOA 2G0EA 2DTZA 5GPCA 1UI5A 2HYTA 4DW6A 1JUMA 3HGGA 3TP0A 3LSJA 4MK6A 2R7SA 5CXGA
chains in the Genus database with same CATH topology
1U9OA 3NI7A 2ID6A 3NNRA 4M3BA 2WGBA 3B81A 3C07A 3NRGA 3KKCA 3V78A 3V6GA 2ZCNA 1A6IA 3KNWA 4M3FA 4M3EA 2HKUA 3VP5A 5D18A 2OERA 3VPRA 3ZQHA 3BJBA 1JTXA 3MNLA 2HXOA 1JTYA 3Q0VA 2Q24A 4JL3A 3BR1A 4I6ZA 4JKZA 4D5CA 2NX4A 4M3DA 2GENA 4B3AA 4GCKA 2QOPA 5GP9A 3IUVA 3BQZA 4ABZA 2PBXA 3RH2A 3VVZA 3BNIA 5IOZA 3BT9A 3HTAA 3PM1A 5F0FA 3GZIA 4KWAA 2NS8A 1JUSA 5AQCA 3E7QA 5F27A 4AC6A 2O7TA 3G56A 5FKNA 1Z77A 2EH3A 5FMPA 2XDNA 2IBDA 3BR2A 3FIWA 3F1BA 1JUPA 2ZB9A 4UDSA 1ZKGA 3FRQA 3IH3A 2HQ5A 2O7OA 2VKEA 2REKA 5EYRA 3KZ9A 5IP6A 5D19A 2DG7A 4X1EA 3WHCA 3QQAA 1RKTA 3HTJA 2NP3A 3BR6A 3BTIA 3QBMA 2FQ4A 2HYJA 2RASA 2XRLA 1JT6A 5EFYA 3O8GA 1JT0A 2ZOYA 4V2GA 3ANGA 3ZQGA 4B1RA 3F0CA 2OPTA 3LJLA 5K7FA 4JNNA 3AQSA 4GFLA 3NXCA 3BTCA 2OF7A 3VOXA 3BQYA 2WUIA 3PASA 2QWTA 3B6CA 2XPVA 3COLA 3BRUA 1T56A 3VIBA 4D7MA 3DEWA 2X9DA 2FX0A 5F1JA 4NELA 3CCYA 2V57A 2I10A 4PXIA 3VOKA 2QCOA 3KKDA 2QTQA 3C2BA 1QVUA 3LWJA 3DPJA 2YVHA 3HIMA 3ON2A 2FD5A 5F0CA 1T33A 3G1LA 5FHPA 1VI0A 2TCTA 2XB5A 2NP5A 2G7SA 4D5FA 5IOYA 4GCTA 4AUXA 3LHQA 4D7NA 5K7ZA 5HSZA 2ID3A 5EZGA 3VW0A 2GBYA 2WV1A 3MVPA 1SGMA 2VKVA 3VUQA 3VVXA 3TP3A 5J1UA 3SFIA 1RPWA 2UXOA 3GEUA 4HKUA 3CJDA 4M3GA 4YZEA 4MO7A 1ZK8A 3LSRA 2FJ1A 3BCGA 5F08A 5FKMA 2XPWA 3SDGA 2UXIA 4JYKA 2QKOA 5F04A 3HTHA 2UXUA 2IU5A 4AC0A 5FGLA 3EGQA 3QPSA 4ME9A 3BR3A 4W97A 2NS7A 2X6OA 4V2FA 1Z0XA 4XK4A 3DCFA 3BTJA 4W1UA 1UI6A 4ACIA 3NPIA 2UXPA 5EZHA 2JK3A 3BR0A 3CWRA 4I76A 2XGEA 3Q0WA 5HAWA 3G1OA 2DG8A 2VPRA 2RAEA 5CW8A 3JSJA 3G1MA 3G7RA 3IH2A 3ZQLA 2Y30A 2JJ7A 3S5RA 5C4YA 1QPIA 3O8HA 5F0HA 2ZCXA 3BTLA 4ICHA 5DAJA 1BJZA 3FK6A 1RKWA 2GFNA 5CXIA 2OI8A 5FKKA 2XPUA 3ANPA 1ORKA 3HE0A 3QKXA 3Q3SA 4MXMA 3HGYA 2G7GA 2HXIA 5J3LA 4GFKA 3VW1A 5HBUA 4GCLA 2PZ9A 2QIBA 5J1RA 3CRJA 2TRTA 3HTIA 3RD3A 2G7LA 5IPAA 4NN1A 3FK7A 3LSPA 2D6YA 1QVTA 2W53A 3O60A 3QPLA 5FKLA 2YVEA 5K58A 3AQTA 3Q0UA 3ZQIA 3WHBA 5K7HA 2RHAA 3T6NA 1U9NA 3VW2A 3ZQFA 5D1RA 3PPBA 4L62A 2XGCA 2IEKA 2XGDA 2UXHA 3B6AA 2Y2ZA 2F07A 3P9TA 2IAIA 3IH4A 3CDLA 2Y31A 3ON4A 4AF5A 2ZOZA 2GUHA 4G12A 2FBQA 3EUPA 5GPAA 4CGRA 5H9TA 5J1YA 2ZCMA 3BHQA 3VVYA 2G3BA 3BR5A 3LOCA 5FKOA 2G0EA 2DTZA 5GPCA 1UI5A 2HYTA 4DW6A 1JUMA 3HGGA 3TP0A 3LSJA 4MK6A 5CXGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U9O A;  3NI7 A;  2ID6 A;  3NNR A;  4M3B A;  2WGB A;  3B81 A;  3C07 A;  3NRG A;  3KKC A;  3V78 A;  3V6G A;  2ZCN A;  1A6I A;  3KNW A;  4M3F A;  4M3E A;  2HKU A;  3VP5 A;  5D18 A;  2OER A;  3VPR A;  3ZQH A;  3BJB A;  1JTX A;  3MNL A;  2HXO A;  1JTY A;  3Q0V A;  2Q24 A;  4JL3 A;  3BR1 A;  4I6Z A;  4JKZ A;  4D5C A;  2NX4 A;  4M3D A;  2GEN A;  4B3A A;  4GCK A;  2QOP A;  5GP9 A;  3IUV A;  3BQZ A;  4ABZ A;  2PBX A;  3RH2 A;  3VVZ A;  3BNI A;  5IOZ A;  3BT9 A;  3HTA A;  3PM1 A;  5F0F A;  3GZI A;  4KWA A;  2NS8 A;  1JUS A;  5AQC A;  3E7Q A;  5F27 A;  4AC6 A;  2O7T A;  3G56 A;  5FKN A;  1Z77 A;  2EH3 A;  5FMP A;  2XDN A;  2IBD A;  3BR2 A;  3FIW A;  3F1B A;  1JUP A;  2ZB9 A;  4UDS A;  1ZKG A;  3FRQ A;  3IH3 A;  2HQ5 A;  2O7O A;  2VKE A;  2REK A;  5EYR A;  3KZ9 A;  5IP6 A;  5D19 A;  2DG7 A;  4X1E A;  3WHC A;  3QQA A;  1RKT A;  3HTJ A;  2NP3 A;  3BR6 A;  3BTI A;  3QBM A;  2FQ4 A;  2HYJ A;  2RAS A;  2XRL A;  1JT6 A;  5EFY A;  3O8G A;  1JT0 A;  2ZOY A;  4V2G A;  3ANG A;  3ZQG A;  4B1R A;  3F0C A;  2OPT A;  3LJL A;  5K7F A;  4JNN A;  3AQS A;  4GFL A;  3NXC A;  3BTC A;  2OF7 A;  3VOX A;  3BQY A;  2WUI A;  3PAS A;  2QWT A;  3B6C A;  2XPV A;  3COL A;  3BRU A;  1T56 A;  3VIB A;  4D7M A;  3DEW A;  2X9D A;  2FX0 A;  5F1J A;  4NEL A;  3CCY A;  2V57 A;  2I10 A;  4PXI A;  3VOK A;  2QCO A;  3KKD A;  2QTQ A;  3C2B A;  1QVU A;  3LWJ A;  3DPJ A;  2YVH A;  3HIM A;  3ON2 A;  2FD5 A;  5F0C A;  1T33 A;  3G1L A;  5FHP A;  1VI0 A;  2TCT A;  2XB5 A;  2NP5 A;  2G7S A;  4D5F A;  5IOY A;  4GCT A;  4AUX A;  3LHQ A;  4D7N A;  5K7Z A;  5HSZ A;  2ID3 A;  5EZG A;  3VW0 A;  2GBY A;  2WV1 A;  3MVP A;  1SGM A;  2VKV A;  3VUQ A;  3VVX A;  3TP3 A;  5J1U A;  3SFI A;  1RPW A;  2UXO A;  3GEU A;  4HKU A;  3CJD A;  4M3G A;  4YZE A;  4MO7 A;  1ZK8 A;  3LSR A;  2FJ1 A;  3BCG A;  5F08 A;  5FKM A;  2XPW A;  3SDG A;  2UXI A;  4JYK A;  2QKO A;  5F04 A;  3HTH A;  2UXU A;  2IU5 A;  4AC0 A;  5FGL A;  3EGQ A;  3QPS A;  4ME9 A;  3BR3 A;  4W97 A;  2NS7 A;  2X6O A;  4V2F A;  1Z0X A;  4XK4 A;  3DCF A;  3BTJ A;  4W1U A;  1UI6 A;  4ACI A;  3NPI A;  2UXP A;  5EZH A;  2JK3 A;  3BR0 A;  3CWR A;  4I76 A;  2XGE A;  3Q0W A;  5HAW A;  3G1O A;  2DG8 A;  2VPR A;  2RAE A;  5CW8 A;  3JSJ A;  3G1M A;  3G7R A;  3IH2 A;  3ZQL A;  2Y30 A;  2JJ7 A;  3S5R A;  5C4Y A;  1QPI A;  3O8H A;  5F0H A;  2ZCX A;  3BTL A;  4ICH A;  5DAJ A;  1BJZ A;  3FK6 A;  1RKW A;  2GFN A;  5CXI A;  2OI8 A;  5FKK A;  2XPU A;  3ANP A;  1ORK A;  3HE0 A;  3QKX A;  3Q3S A;  4MXM A;  3HGY A;  2G7G A;  2HXI A;  5J3L A;  4GFK A;  3VW1 A;  5HBU A;  4GCL A;  2PZ9 A;  2QIB A;  5J1R A;  3CRJ A;  2TRT A;  3HTI A;  3RD3 A;  2G7L A;  5IPA A;  4NN1 A;  3FK7 A;  3LSP A;  2D6Y A;  1QVT A;  2W53 A;  3O60 A;  3QPL A;  5FKL A;  2YVE A;  5K58 A;  3AQT A;  3Q0U A;  3ZQI A;  3WHB A;  5K7H A;  2RHA A;  3T6N A;  1U9N A;  3VW2 A;  3ZQF A;  5D1R A;  3PPB A;  4L62 A;  2XGC A;  2IEK A;  2XGD A;  2UXH A;  3B6A A;  2Y2Z A;  2F07 A;  3P9T A;  2IAI A;  3IH4 A;  3CDL A;  2Y31 A;  3ON4 A;  4AF5 A;  2ZOZ A;  2GUH A;  4G12 A;  2FBQ A;  3EUP A;  5GPA A;  4CGR A;  5H9T A;  5J1Y A;  2ZCM A;  3BHQ A;  3VVY A;  2G3B A;  3BR5 A;  3LOC A;  5FKO A;  2G0E A;  2DTZ A;  5GPC A;  1UI5 A;  2HYT A;  4DW6 A;  1JUM A;  3HGG A;  3TP0 A;  3LSJ A;  4MK6 A;  5CXG A; 
#chains in the Genus database with same CATH topology
 1U9O A;  3NI7 A;  2ID6 A;  3NNR A;  4M3B A;  2WGB A;  3B81 A;  3C07 A;  3NRG A;  3KKC A;  3V78 A;  2YVX A;  3V6G A;  2ZCN A;  1A6I A;  3KNW A;  4M3F A;  4M3E A;  2HKU A;  3VP5 A;  5D18 A;  2OER A;  3VPR A;  3ZQH A;  3BJB A;  2R7T A;  5CQG A;  1JTX A;  3MNL A;  2HXO A;  2A2F X;  1JTY A;  3Q0V A;  2Q24 A;  4JL3 A;  3BR1 A;  4I6Z A;  4JKZ A;  4D5C A;  2NX4 A;  2R7V A;  4M3D A;  2GEN A;  4B3A A;  4GCK A;  2QOP A;  5GP9 A;  3IUV A;  3BQZ A;  4ABZ A;  2PBX A;  3RH2 A;  3VVZ A;  3BNI A;  5IOZ A;  3BT9 A;  3HTA A;  3PM1 A;  5F0F A;  3GZI A;  4KWA A;  2NS8 A;  4U9L A;  1JUS A;  5AQC A;  3E7Q A;  5F27 A;  4AC6 A;  2O7T A;  3G56 A;  5FKN A;  1Z77 A;  2EH3 A;  5FMP A;  2XDN A;  2IBD A;  3BR2 A;  3FIW A;  3F1B A;  1JUP A;  2ZB9 A;  4UDS A;  1ZKG A;  3FRQ A;  3IH3 A;  2HQ5 A;  2O7O A;  2VKE A;  2REK A;  5EYR A;  3KZ9 A;  5IP6 A;  5D19 A;  2DG7 A;  4X1E A;  3WHC A;  3QQA A;  1RKT A;  3HTJ A;  2NP3 A;  3BR6 A;  3BTI A;  3QBM A;  2FQ4 A;  2HYJ A;  2RAS A;  2XRL A;  4C2M A;  1JT6 A;  5EFY A;  3O8G A;  1JT0 A;  2ZOY A;  4V2G A;  3ANG A;  3ZQG A;  4B1R A;  3F0C A;  2OPT A;  3LJL A;  5K7F A;  4JNN A;  2R7X A;  3AQS A;  2R7O A;  4GFL A;  3NXC A;  3BTC A;  2OF7 A;  3VOX A;  3BQY A;  2WUI A;  3PAS A;  2QWT A;  3B6C A;  2XPV A;  3COL A;  3BRU A;  1T56 A;  3VIB A;  4D7M A;  2R7R A;  3DEW A;  2X9D A;  3SWH A;  2FX0 A;  5F1J A;  4NEL A;  3CCY A;  2V57 A;  2I10 A;  4PXI A;  3VOK A;  2QCO A;  3KKD A;  2QTQ A;  3C2B A;  1QVU A;  3LWJ A;  3DPJ A;  4DVY P;  2YVH A;  3HIM A;  3ON2 A;  2FD5 A;  5F0C A;  2PFV A;  1T33 A;  3G1L A;  5FHP A;  1VI0 A;  2TCT A;  2XB5 A;  2NP5 A;  4IRV A;  3FHN A;  2G7S A;  4D5F A;  5IOY A;  4GCT A;  4AUX A;  3LHQ A;  3K8P C;  4D7N A;  5K7Z A;  5HSZ A;  2ID3 A;  5EZG A;  3VW0 A;  2GBY A;  2WV1 A;  3MVP A;  4OD4 A;  1SGM A;  2VKV A;  3VUQ A;  3VVX A;  3TP3 A;  5J1U A;  3SFI A;  1RPW A;  2UXO A;  3GEU A;  4HKU A;  3CJD A;  4M3G A;  4YZE A;  4MO7 A;  1ZK8 A;  3LSR A;  2FJ1 A;  3BCG A;  5F08 A;  5FKM A;  2XPW A;  3SDG A;  3KYL A;  2UXI A;  4JYK A;  2QKO A;  5F04 A;  3HTH A;  2UXU A;  2IU5 A;  4AC0 A;  5FGL A;  3EGQ A;  3NS4 A;  3QPS A;  4ME9 A;  2FJI 1;  3BR3 A;  4W97 A;  2NS7 A;  2X6O A;  4V2F A;  3DU5 A;  1Z0X A;  4XK4 A;  3DCF A;  3BTJ A;  4OD5 A;  4W1U A;  2R7W A;  1UI6 A;  4ACI A;  3NPI A;  2UXP A;  5EZH A;  2JK3 A;  3BR0 A;  3CWR A;  4I76 A;  2XGE A;  3Q0W A;  5HAW A;  3G1O A;  2DG8 A;  2VPR A;  2RAE A;  5CW8 A;  3JSJ A;  3G1M A;  3G7R A;  3IH2 A;  3ZQL A;  2Y30 A;  2JJ7 A;  3S5R A;  5C4Y A;  1QPI A;  3O8H A;  4WIB A;  5F0H A;  2ZCX A;  3BTL A;  4ICH A;  5DAJ A;  1BJZ A;  3FK6 A;  1RKW A;  2GFN A;  5CXI A;  2OI8 A;  5FKK A;  2XPU A;  3ANP A;  1ORK A;  3HE0 A;  3QKX A;  3Q3S A;  4MXM A;  3HGY A;  2G7G A;  2HXI A;  5J3L A;  4GFK A;  3VW1 A;  5HBU A;  4GCL A;  2PZ9 A;  2QIB A;  5J1R A;  3CRJ A;  2TRT A;  3HTI A;  3RD3 A;  2G7L A;  5IPA A;  4NN1 A;  3FK7 A;  3DU6 A;  3LSP A;  2B3W A;  2D6Y A;  1QVT A;  2W53 A;  3O60 A;  3QPL A;  5FKL A;  2B1E A;  3VTI A;  2ZY9 A;  2YVE A;  5K58 A;  3AQT A;  3Q0U A;  3ZQI A;  3WHB A;  5K7H A;  2RHA A;  3T6N A;  2R7Q A;  1U9N A;  3VW2 A;  3ZQF A;  5D1R A;  3PPB A;  4L62 A;  2XGC A;  2IEK A;  2XGD A;  2UXH A;  3B6A A;  2Y2Z A;  2F07 A;  3P9T A;  2IAI A;  3IH4 A;  3CDL A;  2Y31 A;  3ON4 A;  4AF5 A;  2ZOZ A;  2GUH A;  4G12 A;  2FBQ A;  3EUP A;  4U9N A;  2R7U A;  5GPA A;  4CGR A;  5H9T A;  5J1Y A;  2ZCM A;  3BHQ A;  3VVY A;  2G3B A;  3BR5 A;  3LOC A;  5FKO A;  2G0E A;  2DTZ A;  5GPC A;  1UI5 A;  2HYT A;  4DW6 A;  1JUM A;  3HGG A;  3TP0 A;  3LSJ A;  4MK6 A;  2R7S A;  5CXG A; 
#chains in the Genus database with same CATH homology
 1U9O A;  3NI7 A;  2ID6 A;  3NNR A;  4M3B A;  2WGB A;  3B81 A;  3C07 A;  3NRG A;  3KKC A;  3V78 A;  3V6G A;  2ZCN A;  1A6I A;  3KNW A;  4M3F A;  4M3E A;  2HKU A;  3VP5 A;  5D18 A;  2OER A;  3VPR A;  3ZQH A;  3BJB A;  1JTX A;  3MNL A;  2HXO A;  1JTY A;  3Q0V A;  2Q24 A;  4JL3 A;  3BR1 A;  4I6Z A;  4JKZ A;  4D5C A;  2NX4 A;  4M3D A;  2GEN A;  4B3A A;  4GCK A;  2QOP A;  5GP9 A;  3IUV A;  3BQZ A;  4ABZ A;  2PBX A;  3RH2 A;  3VVZ A;  3BNI A;  5IOZ A;  3BT9 A;  3HTA A;  3PM1 A;  5F0F A;  3GZI A;  4KWA A;  2NS8 A;  1JUS A;  5AQC A;  3E7Q A;  5F27 A;  4AC6 A;  2O7T A;  3G56 A;  5FKN A;  1Z77 A;  2EH3 A;  5FMP A;  2XDN A;  2IBD A;  3BR2 A;  3FIW A;  3F1B A;  1JUP A;  2ZB9 A;  4UDS A;  1ZKG A;  3FRQ A;  3IH3 A;  2HQ5 A;  2O7O A;  2VKE A;  2REK A;  5EYR A;  3KZ9 A;  5IP6 A;  5D19 A;  2DG7 A;  4X1E A;  3WHC A;  3QQA A;  1RKT A;  3HTJ A;  2NP3 A;  3BR6 A;  3BTI A;  3QBM A;  2FQ4 A;  2HYJ A;  2RAS A;  2XRL A;  1JT6 A;  5EFY A;  3O8G A;  1JT0 A;  2ZOY A;  4V2G A;  3ANG A;  3ZQG A;  4B1R A;  3F0C A;  2OPT A;  3LJL A;  5K7F A;  4JNN A;  3AQS A;  4GFL A;  3NXC A;  3BTC A;  2OF7 A;  3VOX A;  3BQY A;  2WUI A;  3PAS A;  2QWT A;  3B6C A;  2XPV A;  3COL A;  3BRU A;  1T56 A;  3VIB A;  4D7M A;  3DEW A;  2X9D A;  2FX0 A;  5F1J A;  4NEL A;  3CCY A;  2V57 A;  2I10 A;  4PXI A;  3VOK A;  2QCO A;  3KKD A;  2QTQ A;  3C2B A;  1QVU A;  3LWJ A;  3DPJ A;  2YVH A;  3HIM A;  3ON2 A;  2FD5 A;  5F0C A;  1T33 A;  3G1L A;  5FHP A;  1VI0 A;  2TCT A;  2XB5 A;  2NP5 A;  2G7S A;  4D5F A;  5IOY A;  4GCT A;  4AUX A;  3LHQ A;  4D7N A;  5K7Z A;  5HSZ A;  2ID3 A;  5EZG A;  3VW0 A;  2GBY A;  2WV1 A;  3MVP A;  1SGM A;  2VKV A;  3VUQ A;  3VVX A;  3TP3 A;  5J1U A;  3SFI A;  1RPW A;  2UXO A;  3GEU A;  4HKU A;  3CJD A;  4M3G A;  4YZE A;  4MO7 A;  1ZK8 A;  3LSR A;  2FJ1 A;  3BCG A;  5F08 A;  5FKM A;  2XPW A;  3SDG A;  2UXI A;  4JYK A;  2QKO A;  5F04 A;  3HTH A;  2UXU A;  2IU5 A;  4AC0 A;  5FGL A;  3EGQ A;  3QPS A;  4ME9 A;  3BR3 A;  4W97 A;  2NS7 A;  2X6O A;  4V2F A;  1Z0X A;  4XK4 A;  3DCF A;  3BTJ A;  4W1U A;  1UI6 A;  4ACI A;  3NPI A;  2UXP A;  5EZH A;  2JK3 A;  3BR0 A;  3CWR A;  4I76 A;  2XGE A;  3Q0W A;  5HAW A;  3G1O A;  2DG8 A;  2VPR A;  2RAE A;  5CW8 A;  3JSJ A;  3G1M A;  3G7R A;  3IH2 A;  3ZQL A;  2Y30 A;  2JJ7 A;  3S5R A;  5C4Y A;  1QPI A;  3O8H A;  5F0H A;  2ZCX A;  3BTL A;  4ICH A;  5DAJ A;  1BJZ A;  3FK6 A;  1RKW A;  2GFN A;  5CXI A;  2OI8 A;  5FKK A;  2XPU A;  3ANP A;  1ORK A;  3HE0 A;  3QKX A;  3Q3S A;  4MXM A;  3HGY A;  2G7G A;  2HXI A;  5J3L A;  4GFK A;  3VW1 A;  5HBU A;  4GCL A;  2PZ9 A;  2QIB A;  5J1R A;  3CRJ A;  2TRT A;  3HTI A;  3RD3 A;  2G7L A;  5IPA A;  4NN1 A;  3FK7 A;  3LSP A;  2D6Y A;  1QVT A;  2W53 A;  3O60 A;  3QPL A;  5FKL A;  2YVE A;  5K58 A;  3AQT A;  3Q0U A;  3ZQI A;  3WHB A;  5K7H A;  2RHA A;  3T6N A;  1U9N A;  3VW2 A;  3ZQF A;  5D1R A;  3PPB A;  4L62 A;  2XGC A;  2IEK A;  2XGD A;  2UXH A;  3B6A A;  2Y2Z A;  2F07 A;  3P9T A;  2IAI A;  3IH4 A;  3CDL A;  2Y31 A;  3ON4 A;  4AF5 A;  2ZOZ A;  2GUH A;  4G12 A;  2FBQ A;  3EUP A;  5GPA A;  4CGR A;  5H9T A;  5J1Y A;  2ZCM A;  3BHQ A;  3VVY A;  2G3B A;  3BR5 A;  3LOC A;  5FKO A;  2G0E A;  2DTZ A;  5GPC A;  1UI5 A;  2HYT A;  4DW6 A;  1JUM A;  3HGG A;  3TP0 A;  3LSJ A;  4MK6 A;  5CXG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...