4M3GA

Rapid and efficient design of new inhibitors of mycobacterium tuberculosis transcriptional repressor ethr using fragment growing, merging and linking approaches
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
193
structure length
191
Chain Sequence
b'GDDRELAILATAENLLEDRPLADISVDDLAKGAGISRPTFYFYFPSKEAVLLTLLDRVVNQADMALQTLAENPTDRENMWRTGINVFFETFGSHKAVTRAGQAARATSVEVAELWSTFMQKWIAYTAAVIDAERDRGAAPRTLPAHELATALNLMNERTLFASFAGEQPSVPEARVLDTLVHIWVTSIYGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator EthR
publication title Ligand Efficiency Driven Design of New Inhibitors of Mycobacterium tuberculosis Transcriptional Repressor EthR Using Fragment Growing, Merging, and Linking Approaches.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription repressor/inhibitor
total genus 80
structure length 191
sequence length 193
ec nomenclature
pdb deposition date 2013-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4m3gA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 4m3gA02
4IHVA 3QQAA 2K9QA 1H89C 3V6GA 4DZPA 2R93J 2CQXA 3JRGA 3B6AA 2O8KA 5GP9A 5J1RA 2VPRA 5IYBJ 2DA5A 2EZHA 3VPRA 3FK7A 2AO9A 4JNNA 5F0CA 1LE8A 3WHBA 4D7NA 4GCKA 4J19A 2DMPA 4MFDA 4BY7J 2G0EA 2GUHA 4A3MJ 3DCFA 3B81A 1I3QJ 2JK3A 2Q24A 1MNMC 5IP6A 2B63J 2DA4A 2XDNA 2CUFA 1ETVA 2L7ZA 2JJ7A 1JKPC 1AKHA 2LFBA 1NTCA 4W1UA 5IP7J 3Q3SA 3IV5A 2W48A 3OSFA 1U8BA 2E2JJ 1WPKA 2L7MP 3RH2A 4AUXA 2MSYA 3FK6A 1T56A 5EDNA 1ZR2A 3VVZA 3Q0WA 3BR3A 1IRZA 1CQTA 1ETOA 3JRFA 4HKUA 3LSGA 1BL0A 4JX5A 1DU6A 3S15J 3KNWA 1GVDA 3F0CA 3Q0VA 3ZQCA 1FIAA 3BG9A 1WGXA 4BBRJ 2ME0A 2M34A 4G12A 2DG7A 1TWGJ 1A5JA 1XC5A 3S1RJ 3LNQA 1MBKA 2YU9J 3ZQGA 3HOWJ 1MBFA 3UKGA 2UXIA 4LOCA 1ZK8A 2DMQA 4UUSA 2ID6A 1D5YA 3NXCA 2EH3A 2LK2A 4FTHA 1RPWA 3A01A 1GDTA 3RD3A 2R5YB 1BW5A 3CRJA 2VKVA 3P9TA 1JJ6C 5IP9J 2IU5A 1IUFA 3PO3J 5EZGA 1HDDC 3K7AJ 3S1QJ 4BXXJ 2WV1A 2XPUA 1UMQA 5J1UA 2GENA 3BNIA 1I50J 4JYKA 1APLC 3BR0A 4DYQA 3HOVJ 1UG2A 3E7LA 1ORKA 2HOSA 3I4MJ 3BCGA 1BJZA 2ME6A 3HOZJ 2UXHA 4IHYA 3ANPA 5IOYA 4DYCA 4CYCB 4RDUA 2DA2A 3LOCA 4GFLA 2WGBA 5CW8A 1WH7A 2FJ1A 4BKXA 1HF0A 2ECBA 4A3JJ 3S14J 2WB1N 3GTMJ 3BQYA 4HNVA 5DAJA 3KZ9A 3H0GJ 2ZB9A 3A03A 4MO7A 1GV2A 2QF7A 4D5FA 3E7QA 2XB5A 5EF6A 2DJNA 2QOPA 1MBHA 2DMNA 4QIWN 5IOZA 2HQ5A 4C3JJ 1LE8B 3BR6A 1AU7A 1I6HJ 4YZEA 1MH4A 1XG1A 1U78A 2K9NA 1HCRA 3FRQA 2EZIA 5F27A 2K40A 1RKTA 4JX6A 2RASA 4Y52J 2RAEA 1W0UA 1MSEC 2Y0SN 2FX0A 3VW1A 5FKNA 1FJLA 1P7IA 2ELKA 5HBUA 1AKHB 1F36A 5E3NA 4A3GJ 5FJ8J 5BNGA 2R0QC 1O4XA 1ETXA 4PXIA 1H8AC 2VUMJ 1BA5A 3BTCA 3JRBA 2OERA 3IH4A 3C07A 3HOUJ 3BJBA 2O7TA 3T6NA 2W53A 4MLOA 2OI8A 5JLXA 4W97A 1WI3A 1IC8A 4CGRA 3IH2A 1K61A 4Y7NJ 4A3EJ 1PUFB 3VW2A 2LKXA 2FBQA 5CXIA 1MBEA 2REKA 5M5YJ 5F08A 2DMUA 4UUSB 1IDZA 3JREA 1TWCJ 3H3VK 2LD5A 4IEJA 3A01B 2XGEA 3OIOA 2MG4A 2GM4A 4ABZA 2IEKA 5E3LA 2ZCXA 1K83J 1HDPA 3PPBA 4MXMA 1JT6A 5HSZA 4GFBA 3ZQFA 2MW8A 4MK6A 2V57A 2R5ZA 1U9OA 5CXGA 4DW6A 4D5CA 3M4OJ 1T33A 3S5RA 5M3MJ 4A3KJ 2EZLA 3S2DJ 3KKDA 5D1RA 4JX4A 2CJJA 3LSRA 3RKQA 1SANA 4ACIA 1JKOC 3GTQJ 3BRUA 3LHQA 3VP5A 1YRNA 5FKOA 3HDDA 1ZQ3P 2UXPA 1UI5A 3V78A 4A3LJ 3BR2A 5K7HA 1P7JA 2QIBA 3HEFA 1TWFJ 2DA1A 2YVHA 2QKOA 1PUFA 3HTAA 5EYRA 2M0CA 3G56A 5JLWA 1ZR4A 1DU0A 4XRSA 3HOXJ 1UI6A 3ZQHA 2TRTA 5HAWA 3EGQA 5GPCA 3NARA 3HTHA 1B72B 3FIWA 4KWAA 5E3OA 5DTDA 2YVEA 2FD5A 4QSHA 4JL3A 1VFCA 5FKMA 2Y9YA 2QTQA 3BT9A 4I76A 4GFKA 3O8HA 3HOYJ 1LFUP 3GBGA 5C3EJ 3CJDA 1WH5A 5M3FJ 2PMZN 1RETA 3BR5A 3GTOJ 1JUMA 5C4JJ 2E2IJ 1A6IA 3S1MJ 2IBDA 1MH3A 3D1NI 5EZHA 3CQZJ 3JRCA 2LY9A 2G3BA 1JGGA 1RKWA 1SGMA 2X6OA 3NNRA 3CCYA 2NS8A 5F1JA 2EQRA 2HOTA 3KKCA 3BTLA 1F43A 4GCTA 5M5XJ 2ZOZA 1GV5A 2XB0X 1FEXA 4A93J 3ON4A 3ZQIA 2XRLA 3SJMA 3ZQLA 2GFNA 3IH3A 2XSDC 1ETWA 1WCMJ 3PM1A 2JMWA 2H1KA 2R92J 2DN0A 3I4NJ 5FKLA 5FGLA 2ZOYA 4FISA 1B72A 5C44J 3C2BA 3CMYA 1HLVA 2FQ4A 2LTPA 1ETYA 3VUQA 2KDZA 4X1EA 3LJLA 2E1OA 1HOMA 2YUSA 4FCYA 1TWAJ 1IGNA 4S0HB 3F1BA 3AQTA 9ANTA 3BG5A 4XICA 4AYBN 2OF7A 3RQIA 4UUTA 2NX4A 2YS9A 3BR1A 3TW6A 2WAQN 4JKZA 1RESA 1X58A 2DTZA 2EZKA 3HKZN 2JA5J 3VOKA 2JA6J 2R7ZJ 4B3AA 1MBJA 5IYCJ 2R5ZB 2CRGA 3DEWA 3O8GA 4V2GA 1Z0XA 2IAIA 3G7RA 3QKXA 1FIPA 1X2MA 4A3DJ 2EBIA 3BTIA 3PO2J 1YRNB 3O60A 3SFIA 2G7LA 4DYRA 4M3BA 3W6VA 2GLOA 3HTJA 4A3BJ 3LWJA 4ICHA 3HB9A 1GT0C 3CDLA 1VI0A 2O7OA 3B6CA 2G7SA 1NK3P 3VOXA 3S16J 5D18A 3JRDA 2F07A 5AQCA 4XRSG 3G1MA 4A3FJ 5J3LA 4B1RA 2ZCNA 5E3MA 5EG0A 1OFCX 4B4CA 1VF9A 3CWRA 5K58A 2XGCA 1ZGWA 4FE7A 3A02A 3DPJA 2ID3A 2XGDA 2CU7A 1B8IA 2NP5A 1X2NA 2AHQA 2QCOA 4A3IJ 3NI7A 2Y30A 1EF4A 1BW6A 2E19A 2X48A 3SDGA 5F0FA 3JRHA 3ANGA 1QRYA 1MSFC 3GEUA 3L1PA 4M3DA 5FHPA 5F0HA 1NK2P 2HI3A 5FKKA 4RBOA 2JWTA 2E2HJ 1E3OC 2MGQA 3QPLA 1ZTRA 1Y1WJ 5DS9A 1JKRC 3HM5A 1R9TJ 4C3IJ 4GCLA 5D19A 3VVYA 1GUUA 5IPAA 3MN2A 1XS9A 4I6ZA 1IJWC 5FMPA 2NVYJ 3NAUA 1SFOJ 2XPWA 3VVXA 3S17J 2Y9ZA 3HGYA 1OCPA 2PBXA 2H8RA 2CQQA 1U9NA 3JRIA 2JA8J 2L7FP 3MNLA 3NRGA 2G7GA 2M8GX 2OPTA 2D5VA 3G1LA 4IHWA 3HIMA 4A3CJ 2TCTA 1ETKA 2D6YA 2M9HA 1JUPA 1S7EA 2GBYA 2VKEA 3GTLJ 1JJ8C 2HOAA 1ITYA 2P81A 1POGA 1QVTA 2HYTA 4IHXA 4XK4A 1OJLA 3BTJA 1JT0A 3HBLA 3S1NJ 2HDDA 1JTYA 3WHCA 1Z77A 4AC0A 3TW7A 4AC6A 2KT0A 4L62A 1OCTC 4X6AJ 1TC3C 2VI6A 2WUIA 4A69C 2RHAA 5K7FA 4QTRA 2NVTJ 1Q1VA 4JP0A 3OOUA 5EGOB 1QVUA 3K2AA 1H88C 4BBSJ 4XIDA 3VW0A 4V2FA 3GZIA 5FLMJ 4M3EA 2HXOA 5GPAA 2I10A 3GTKJ 3GTPJ 4UDSA 4EEFG 4M3GA 1ZKGA 3HGGA 2DA7A 3TP3A 2Y2ZA 1FTTA 4ME9A 2Y31A 3FISA 3FKIJ 3QPSA 2LP0A 3GTGJ 2LR8A 5EEAA 3Q0UA 1G2HA 1JKQC 2QWTA 4L5EA 3BHQA 2UXOA 3NPIA 2JA7J 2HKUA 2HXIA 4MFEA 2LVSA 1FTZA 3JSJA 2COBA 4XRMA 5EG0B 2K9SA 3LSPA 4MIMA 3HTIA 4DZJA 2UXUA 2N8GA 2LLKA 3IUVA 4C3HJ 5H9TA 1IDYA 4AF5A 1JTXA 4NELA 3JR9A 2L9RA 1B8IB 2CUEA 1JUSA 4M3FA 4D7MA 3RZOJ 5C4YA 4BY1J 1UHSA 2NOGA 3AQSA 5C4XJ 3EUPA 2NS7A 3QBMA 3TP0A 3PASA 2L0KA 5EGOA 3JRAA 2DA6A 1LFBA 3BG3A 2R5YA 5IYDJ 2NVXJ 2PZ9A 2NP3A 3BQZA 3ON2A 2NVQJ 3ZOBA 1AHDP 5K7ZA 5J1YA 3OSGA 5HODA 2XPVA 4NN1A 2M2EA 3COLA 3MKLA 3M3YJ 2JN6A 2DA3A 2X9DA 1ENHA 2HYJA 1VNDA 2DMTA 4M6VA 1QPIA 2ZCMA 2ECCA 4C2MJ 3VIBA 4CYCA 1RR7A 3TEDA 5M5WJ 1TWHJ 3MVPA 1W0TA 1ETQA 2DG8A 4FE4A 2O9LA 3GTJJ 1Y1VJ 4NDLA 5F04A 5EFYA 3HE0A 1IV6A 3LSJA 3S2HJ 1IG7A 3G1OA 3RZDJ 1MBGA 5FLVA
chains in the Genus database with same CATH superfamily
4XR6A 3L2WA 1HKQA 3JRGA 2VKDA 3BJAA 2GIZA 3FX3A 2XAQA 4IQ4A 1IV8A 2LY2A 3KLOA 3FXUA 5F0CA 4EJVA 1R7JA 2PMHA 2A61A 4MFDA 2UV1A 3PUFA 2B0LA 2CW0F 4DIQA 4IL6C 1X3WB 1YW8A 3G71I 1D3YA 3G3ZA 3B81A 2JK3A 5F1RA 4G8XA 2B63J 3OR1C 2XDNA 1QHHD 2JRMA 1ETVA 3WTVC 2GXBA 4UVCA 3DTKA 3FMSA 3E5XA 2KIUA 4AUXA 1WQ2A 4RLQA 1T56A 1ZR2A 3H36A 5CVIA 3Q0WA 3KEYA 4BQNA 1FP2A 1IRZA 2F5DA 1V54H 2ZKZA 4I2OA 4PGHA 3JRFA 5ILUA 1BL0A 1OYIA 3D5RC 4HG2A 3RJPA 2CV1A 3SXYA 3KNWA 3E6MA 3ZQCA 1FIAA 1WGXA 5IY5H 5GADJ 2UZKA 1MBKA 2CFOA 1DGWY 1F9NA 2DMQA 1O7FA 2FQ3A 3DTIA 4CCLA 4XLPF 4FTHA 4FX4A 3RD3A 1WRJA 1E3HA 2QBYA 1Y56A 3CCJI 2D1HA 1ZAOA 4CH7A 4NBQA 2JSCA 3OYNA 5HLGA 1JJ6C 4CCMA 4ENNA 3L2CA 3E6BA 3F6OA 2EV0A 3PO3J 5BQTA 3S1QJ 5GTIC 2WV1A 3PNTA 1OR7A 2XPUA 2GENA 2BE5F 1GXQA 1WVRA 3BG7A 3OYEA 1MW7A 1UG2A 4HLYA 2HOSA 3BCGA 2ME6A 4ZC3A 4N9HA 2UXHA 3KCCA 1LNWA 4IRHA 4OMZA 3F8CA 1YI2I 3WGHA 5FLXK 3ANPA 1WKMA 1CF7B 2KJCA 4XLCA 1SMTA 3R6SA 3DKXA 4A3JJ 5CVRA 2DT7B 1IW7F 1XMAA 4BJ5C 2IGMA 3I5UA 3M1CA 3A03A 2A68F 4EQQA 2F5VA 4D5FA 4RB1A 2XB5A 4OIQF 1MBHA 5ICEA 3K4NA 1OLTA 3KYLA 3RKWA 2DMNA 5HDGA 1SEUA 3R0AA 4II2A 1AU7A 1I6HJ 5FFXA 1U78A 2Q2EB 3FRQA 2EZIA 1FLIA 2K40A 2M1BA 1T0FC 3AG3H 4AIJA 1PP8F 1MSEC 4F55A 3OY9A 3K4JA 5FKNA 1FJLA 1P6RA 2DU9A 5LD2C 4U88A 1WJCA 1LEBA 4HEA2 4L5IA 2HQRA 2KZVA 3TOAA 1BI0A 1H8AC 2VUMJ 1BA5A 5KAFC 2XF7A 4PXIA 2CQ7A 4DVYP 3JRBA 2DYSH 3IAS2 3QPHA 3WGGA 1HC8A 3C07A 3DF8A 3BJBA 2E1NA 3A4CA 4MLOA 3HC7A 3MD2A 2LG4A 3BCBA 2AXLA 4L9NA 1LVAA 2BEOA 2H6CA 2P4WA 2HZDA 2XAFA 4CGRA 4U7BA 4Y7NJ 3LQRA 2ZJPF 4M6YA 1R00A 5CXIA 2GZWA 3KE2A 5BS6A 2VODA 4MNUA 2X6WA 3GZ6A 4Z2YA 1IDZA 3PQKA 2EFNA 3TBIA 2MABA 1FT9A 4IEJA 2DXIA 3FZVA 3ZMSA 4ABZA 2H94A 1ULYA 2ZFUA 1HDPA 3P9CA 2WADA 1JT6A 2X1DA 3EYIA 3EUHC 2VQCA 2MW8A 3FDYA 3K0LA 2NOJB 2UWMA 2D2WA 5DD4A 1Y8RB 5CXGA 1V55H 3S5RA 2A3SA 4BE2A 3LSRA 3RKQA 1SANA 3ZPLA 1Z3XA 2Y69H 3M07A 1YRNA 3HDDA 4BUPA 4ZDLA 5KVRA 1G59A 5ICFA 4MQVA 5K7HA 4PSXA 2QIBA 3V4GA 1MZBA 3RSNA 2HS5A 1YIJI 4HSRA 2ADUA 5EYRA 1ZR4A 2E60A 3G2BA 4UVAA 2D1VA 2FD5A 3SYTA 5FKMA 5GTHC 4KICA 5FB2A 1FOKA 1I5ZA 1G3SA 3CC2I 1FY7A 1XSDA 1WH5A 4PCQA 3E5UA 4S04A 2FSWA 5E8IA 3FXQA 5HLHA 2IRFG 1JUMA 1ZN2A 4BHPA 1MMDA 3K9TA 3S1MJ 4C2MA 1S29A 3D1NI 2R7WA 3OYDA 5EZHA 4CA0A 4H0EA 1IUYA 1RKWA 2DT5A 1SFKA 1J75A 1AOYA 3DTEA 1TW3A 5H2FC 2BBYA 4MQ9F 4IXAA 3F8FA 5D6EA 1T39A 3BTLA 4PJNA 4XKBA 4RB2C 1FEXA 4M73A 2QQAA 3GMEA 5J47A 2XRLA 3SJMA 4QWQA 3IH3A 3ABUA 1XPXA 3OL3A 2R7DA 2R92J 3I4NJ 2RV8A 3KIOA 4FISA 5C44J 2CYYA 2LTPA 1ETYA 3VUQA 3LJLA 3HHHA 2KRHA 3D5LA 4ESBA 4GYIA 4BEHB 1IGNA 1MNDA 3F1BA 9ANTA 1BI2A 2OF7A 1SC7A 3K8PC 1A31A 1GHCA 3F8MA 2YS9A 3TW6A 1ZELA 2EZKA 2R7ZJ 1YOVB 4B3AA 1LDKB 2EIJH 1T95A 5E1ZB 4EVIA 1FIPA 2Y0MA 4LGWA 2EBIA 1NH3A 5L3CA 4U7DA 3SFIA 2CV0A 1MJ9A 4DYRA 4BXUA 3W6VA 2O6GE 2STTA 3HTJA 1T98A 2EIMH 3HB9A 1YJNI 2ELHA 1VI0A 4G94A 2G7SA 1X1DA 3VOXA 2UXXA 3ZGKA 5D18A 3FBNB 4A3FJ 1XX5A 5J3LA 1RUOA 3ASOH 2ZCNA 2HDWA 4MEYF 2DPDA 2Z33A 1EV7A 4XN0A 4P5OA 4J01A 1ZRDA 3S2WA 2GXAA 1W36C 2XGCA 2JRTA 2KISA 3PSFA 3DPJA 1AWCA 3T1BA 2EA2A 2MBFA 1B8IA 2BY0A 2QEXI 3TKYA 4PSWA 2Y30A 2IS2A 1BW6A 1ZGAA 2X48A 3QYBA 3CESA 2FNAA 3ANGA 3KEOA 4XM3A 5E1XA 2ZJ2A 3GEUA 4M3DA 5FHPA 2VXZA 4FASD 5FKKA 1UHMA 4BGDA 1STZA 3QPLA 3FXRA 5DS9A 2O0YA 2YX4A 4GCLA 2YSRA 1GUUA 1E2XA 5IPAA 3ZMUA 4ENKA 3W2WA 2QLZA 3F8BA 1IJWC 4I7HA 1MNEA 2VQHA 1SFOJ 2ZJRF 3RPUD 3K4KA 1H0MA 3HKZA 1BC8C 2EPFA 3K4CA 3JRIA 3SZTA 4BDZA 3MNLA 3KP2A 4XQFA 4KN7X 1D5VA 2M8GX 2BV6A 2OPTA 3ZQ7A 2D5VA 4IHWA 3HIMA 3VDXA 4A3CJ 1VZ0A 2F48A 3OYHA 4DOZA 1JJ8C 1N25A 2R7RA 4XLEA 1J59A 2OD5A 1QVTA 4OWRB 1TL8A 1UHWA 2DJIA 4XBFA 4HDVA 5BPIA 5EEHA 3DLLF 4JBAA 4G6QA 4AC6A 2KT0A 3L9FA 4X6AJ 1TC3C 2KLOA 1UFMA 2E7WA 4A69C 5K7FA 4C9YA 3LSTA 2DFFA 4QTRA 1D1CA 3OOUA 3K2AA 4CSWA 1Z6RA 4RGSA 3PIPF 3IWFA 4M3EA 4M9ZA 2HXOA 5B66C 3C7JA 5H6QA 3CCVI 3SDBA 3AG1H 2Y31A 3OOPA 3UR3C 4ESFA 3RPQA 1IRGA 3FKIJ 1XTAA 1LEAA 1ODDA 3QPSA 4XLHA 2GAUA 4F91B 1FYKA 5EEAA 3K70C 2EIKH 4XSXF 3NPIA 2PX9A 3V7SA 2COBA 1J2XA 3AL0C 2QKLB 3VEPA 2K9SA 3C18A 3GVAA 1RIOH 1QZZA 4DQ2A 2EV6A 4DZJA 1WZ2A 4A0XA 2LLKA 3BG6A 3FHZA 5FRNA 4KN4X 1KZHA 2M30A 2R7OA 2Z1DA 2E1MB 5HVQC 2L9RA 4A6DA 1T0FA 1JGSA 2CUEA 3KX2A 1FZPB 1VQ9I 4ZDOA 2XDVA 2M7BA 1JUSA 3PFYA 5FD5A 4Q5SF 2ZXHA 4D7MA 1UHSA 1KA8A 1GLNA 2IXSA 3K69A 1ZLJA 4M72A 2OQGA 1HXDA 3TP0A 5LEJA 2L0KA 2AXTC 3RTRA 4UXNA 2DA6A 1D8KA 1LFBA 1WJEA 2Z5UA 3TDZC 1YTYA 4WIBA 2FA5A 5IYDJ 2NVXJ 1R49A 1XD7A 3ON2A 3P7NA 1TBXA 1B59A 1AHDP 2WTEA 2OZUA 3ERED 2P5VA 2BZTA 4M6XA 2OV7A 5J1YA 5HODA 2ETHA 1OISA 4NN1A 3FF5A 3MKLA 3M3YJ 5TGTA 2LSOA 3H3ZA 2DO7A 2CV2A 2X9DA 1ENHA 3F23A 2ZNZA 3OYKA 1W36D 4DGWB 3C3WA 1G8XA 2ZCMA 4XOTA 2IP2A 2BXYA 1OPCA 1CF7A 3QPTA 5TISC 2DG8A 3B73A 4FE4A 5CVJA 4B09A 2DLLA 2DTRA 5F04A 3BZ6A 3JAMK 2A6TA 1VQPI 4CO8A 3HE0A 1IV6A 2V6CA 1IG7A 2PN6A 4PGGA 3RZDJ 4LG0B 5HLTA 4Y13A 4EJOA 3EUHA 2HQAA 4IHVA 2K9LA 3QQAA 3V6GA 4NB5A 4DZPA 2CQXA 1YG2A 3B6AA 3J7AY 2JZYA 4J00A 1VQ4I 2FMYA 2XGXA 4IZZA 3FK7A 4NC6A 5K5OA 1OCOH 2WC2A 3GLXA 5AONA 2DMPA 4FX0A 2IW5A 5TRDA 5JR3A 2R7QA 4XKCA 3F8NA 2Q2EA 3I9V2 4XONA 4A3MJ 2GA1A 2IGOA 1X1AA 2Q24A 1MNMC 4WCGA 1X3ZB 4XNFA 2DA4A 5FRMA 1K79A 4RGRA 2V1UA 1O7LA 2FMLA 2X0LA 2L7ZA 3RPUA 4HSTA 3L7WA 1SVMA 3PQJA 4U0YA 4BQAA 1NTCA 1XCBA 5FLXZ 5IP7J 3H9QA 4N4NB 3OSFA 3EUKL 1WPKA 3RH2A 1V5FA 2L3DA 4B8XA 2CGPA 5EDNA 2EILH 1F4KA 2K86A 2ZBKA 4JX5A 3KETA 3S15J 1BI3A 1FBQA 2KRFA 3JSPA 2XHKA 1YQAA 2ME0A 1IF1A 1T2KA 2M34A 4RMNA 2XAHA 2Z2SB 2LF8A 1GXPA 2WY8Q 1XC5A 2HVQA 3CO7C 1D8JA 3GF2A 3TDUC 5LGUA 2LDUA 2V9PA 4RAGA 3ECOA 2UXIA 2ID6A 3K1MA 3NRVA 1D5YA 1RPWA 2RGVA 1GDTA 4U9LA 2R5YB 2E1CA 3CRJA 2F2EA 1FSHA 4XKWA 3VODA 2M0MA 3CDHA 3TO9A 3K70D 1PDNC 3I3LA 5IP9J 3MZ8A 1KGSA 4HAMA 1IUFA 2VQGA 3ZMZA 1SD6A 4L9JA 1UMQA 5J1UA 3EETA 2LREA 5LFAA 1APLC 3BR0A 4MEXF 1ORKA 5JHFA 1EJ9A 5KCMA 1C0WA 3WG7H 3U1DA 3DPTA 3J80K 1FP1D 1FSEA 2TDXA 5IOYA 4DYCA 2DA2A 2BW3B 1WH7A 1YW9A 2BHYA 3DU5A 5ED4A 3DU6A 2ZO4A 2FOKA 5IT9K 5FROA 1HF0A 1BR1A 3GTMJ 2W85A 1S72I 3H35A 2VJ5A 4ETSA 3V42A 3A0BC 1R1VA 2QOPA 4HX4A 3WTWC 1R22A 3TQNA 2LY1A 2HQ5A 4Y4RA 3ELKA 4NHJA 3QOEA 5H20A 1SMYF 4YZEA 1DGRM 4EJUA 2K9NA 3FXLA 3ZMTA 5F27A 1SFUA 1QPMA 1XGSA 3I58A 2EJRA 3I59A 3RKYA 1W0UA 2EWNA 1FOWA 3CMAI 3HTSB 3BPXA 1S7AA 3DKWA 2PQ8A 1KU9A 2DOFA 2KQRA 3CF5F 4L18B 2VT3A 4UV9A 3RCOA 1E3PA 5FJ8J 4FQGA 2DOEA 2IJLA 2DQRA 5BNGA 1KYZA 5FD6A 4OAZA 1O4XA 3MKYB 3FM5A 3OL4A 2DFEA 1B1BA 2FBHA 1DQUA 3I64A 4LK1F 3NS4A 3DFGA 2QSHX 4FHTA 2FE3A 1O3RA 1SAXA 5A2QK 2VOPA 1WI3A 4A3EJ 2I5UA 4DNCA 2RQPA 2VT2A 2LKXA 2REKA 2VN2A 5F08A 2NAZA 4UUSB 4BEHA 3JREA 1DP7P 3DP7A 2LD5A 3H3VK 2XGEA 2QQ8A 3OIOA 2MG4A 2GM4A 1A6QA 1K83J 3BJOA 4BJ6C 4N9IA 3DWLE 4UB8C 5HSZA 3RQ4A 1ZG5A 3M7GA 1U9OA 2Y48A 2DI3A 2VBYA 3QWLA 1T33A 5M3MJ 3KKDA 1MD0A 4JX4A 2CJJA 4CXFA 1OYWA 1JKOC 3H9JA 3LA7A 3GTQJ 1Z91A 3LHQA 2BY2A 2V26A 2FJI1 2KFDA 4JK1X 5BMZA 1PP7U 1ZQ3P 1UAAA 1UI5A 1J09A 4KITB 4ZJZA 3BR2A 3P9KA 1P7JA 1LUJB 3BDDA 4RAYA 1TWFJ 2DFHA 3GXOA 2R7XA 2Z99A 2YVHA 1V3FA 1PUFA 2FRHA 1R71A 1Z6TA 2M0CA 4I01A 3OYGA 1DU0A 3G56A 4XRSA 4KWAA 3MKWB 3ZQHA 1EH8A 3M8FA 3EGQA 3NARA 2F5FA 3FIWA 3I71A 5LRRA 4JL3A 4EM2A 1BI1A 4ESJA 1VFCA 1PVEA 3GZ5A 2V9VA 2QTQA 3LA2A 4D9JA 5CQEA 4GFKA 2R3SA 3O8HA 1OMIA 2BXZA 3HOYJ 1R1UA 5C3EJ 1YX5A 4ZYDA 3HYIA 2QENA 3GTOJ 1IZ1A 2LKPA 3V8JA 4CCJA 1MH3A 4PK4A 2LBFA 3DLAA 1LKXA 1OCRH 4PJ0C 3EPZA 5DYMA 2DODA 3G4SI 4A12A 3OS2A 2X6OA 3CCYA 2NS8A 2HOTA 1YJ9I 3KKCA 4IHSA 1Y6IA 4OU0A 3WE3A 1ERDA 1GV5A 2F5CA 3PUBA 2KJBA 2K9MA 2AQFA 4I09A 2CQKA 3H5AA 3ZMDA 3PM1A 1W1WE 4IOAF 3PNYA 2OBPA 4NC8A 3Q5FA 3R60A 2ZOYA 1B72A 1HKSA 2FQ4A 4OMYA 3BWGA 3NQOA 3KP7A 4IPAA 2KDZA 2E1OA 4UNOA 3CDIA 1TWAJ 3CCMI 2G7HA 2OCCH 2RREA 1U5TB 3AQTA 3BG5A 4BL0B 4OOIA 4AYBN 1OYYA 3HUGB 4OIRF 4AVPA 3KZZA 4BH9A 1ZREA 2NX4A 4E4HA 4ENJA 1HW1A 2LOOA 1W7PB 4PDKA 1DUXC 4DBQA 2V4JC 4L0ZB 3HKZN 3VOKA 1G3TA 2R5ZB 3WTYC 2LKSA 3DEWA 5F6FA 5DUIA 1YW7A 1W5TA 2V6EA 3G7RA 1X2MA 1WSUA 1FYLA 3I53A 2F4IA 3BTIA 4JQFA 3PO2J 2IS1A 3O60A 2HVSA 1W5CC 3IKVA 3OS1A 1U0JA 4KISA 2GLOA 3LWJA 5J40A 1I3AA 3CDLA 4I99C 1GT0C 3U2RA 3MZHA 4WXHA 1CGPA 1A04A 4PJLA 1IN6A 3JRDA 2F07A 4YG2F 5AQCA 3G1MA 2IA2A 4YIIA 4RAZA 2G9WA 3VSLA 4PZJA 4B4CA 1KQ0A 3M8JA 3CWRA 3F72A 2FF4A 1ZGWA 4FE7A 5D4SA 5J4YA 3G73A 3J7AO 2ID3A 4G6DA 1HBXG 1I39A 2CU7A 1T6SA 2P5KA 2AHQA 4AIDA 4H4KC 4KDPA 2L4MA 4OIPF 4KMUX 5F0FA 3QYEA 2F4OB 1QRYA 3TL4X 1D1AA 2HI3A 1NK2P 2JWTA 3DKYA 1E3OC 4KT6A 5E17F 1ZTRA 3HM5A 2XASA 4R8HA 4C3IJ 3PJRA 2VXDA 3SEQA 1TNSA 2EFQA 3VVYA 2EA4A 2KP6A 3MN2A 2IVMA 4GCVA 4Y33A 4A0ZA 4B3XA 4U0WA 3T0YA 5FMPA 3NAUA 4OINF 3QAHA 3BCAA 3KP3A 1F1ZA 2BY3A 4KYWA 5E18F 4LIVA 1ZG3A 4B43A 4EGYA 4I02A 1RNLA 1R5HA 2BGCA 2WWYA 2ICWG 3CJNA 5DCMB 3JW4A 2TCTA 2D6YA 4EATA 2W25A 3GFMA 2HOAA 2LRDA 1K78B 1ITYA 1POGA 3MFKA 3P5JA 2FEZA 3L2QA 2HYTA 2K3FA 5DUKA 4F7ZA 4QLCU 4ZTJA 3RKXA 2HDDA 2HGCA 2HPMA 1JTYA 3WHCA 3DBHB 2E36A 1IO2A 4AC0A 1WHUA 2ZXWH 5LEKA 1ON2A 3HRMA 3I4PA 2JVGA 1U8RA 2MYSA 3ASNH 3LSIA 5HDNA 2COMA 2V1DA 1Q1VA 1MJAA 3N4MA 1H88C 3QU3A 4XIDA 3VW0A 3BY6A 4HX8A 4IRVA 4XLAA 2LH9A 3CTAA 2I10A 1XB4A 3DPUA 4UDSA 1ZKGA 1UZCA 4E7LA 2WAFA 2DT6A 2OAZA 3GLLA 4P9FA 4ZYHA 2GA2A 2MFZA 2D45A 2GOMA 3QRFF 3E97A 3Q0UA 3CMEI 1JKQC 2QWTA 4L5EA 4XL9A 5BOXA 2UXOA 4MTDA 2BVMA 4MFEA 1VQOI 2PLYA 5E8GA 2O03A 5CVUA 3JSJA 1R23A 3HRSA 4XRMA 3LSPA 1B9MA 4MIMA 2VBZA 3VB2A 2RN7A 5L3EA 2FBIA 4XRFA 1VQ5I 3TOBA 3S8PA 3JAMZ 3OYFA 4AWXB 2CO5A 1IDYA 1JTXA 4HOBA 5CJ9A 2MC4A 1MDMB 2FU4A 5LHHA 3DXJF 3O2PE 4WK8F 3WU0A 1IXSB 2NNYA 4KNYA 2NOGA 5FFZA 2L9NA 1G4DA 4EV0A 2JPBA 3FWEA 2VONA 5EGOA 3JRAA 3CD6I 2W1OA 1MGTA 4O6JA 3CCSI 2MC3A 2R5YA 2PZ9A 1RC9A 2NP3A 2RQQA 3ZOBA 5EEGA 1TP4A 2R4GA 3OSGA 2L4AA 1EA3A 2QGUA 5ICCA 1TQIA 2M2EA 5B1BH 3K1NA 2NRAC 3HTUA 5J8FA 2HYJA 1VNDA 1VQLI 4M6VA 3J7ZI 3OWTA 1QPIA 4ZH4F 5LGNA 2ZXIA 1SFEA 1XSVA 1RR7A 2YR2A 1TWHJ 1W0TA 2Z9OA 2E71A 2PBIA 5BPDA 3I55I 1Y1VJ 3BZKA 3OYJA 5EFYA 2CWEA 3G1OA 1G6NA 1P92A 1MBGA 3HHGA 4G6TB 5L3FA 1TLHB 3H9GA 1AA7A 1KQ9A 2O8XA 5GAGJ 1H89C 1EH6A 2O8KA 5GP9A 3KEQA 5IYBJ 1USSA 2DA5A 3UNGC 1WFXA 3WTXC 2AO9A 4EJTA 4ZTFA 3M1EA 4AYBA 4J19A 1BBYA 2QM3A 1IXRC 3WU1B 1T38A 4BY7J 2G0EA 1W7PD 4M9SA 2K5CA 3GX4X 2E5NA 2P6SA 2WV0A 4BDYA 1I3QJ 4ZZLA 3CLOA 1J7KA 1XGMA 4A6EA 2QA4I 3T5XA 2VC0A 2E35A 2JJ7A 1JKPC 3IRRA 2LFBA 4XLFA 3J80Z 2L2OA 2P6TA 3Q3SA 2C6YA 2MLKA 1E0EA 2L7MP 2MSYA 3FK6A 1TT5B 3IKTA 3VVZA 3CP2A 4XN3A 3BR3A 1PUEE 1CQTA 1ETOA 4IQJA 1YS6A 5L3BA 3CC7I 1GVDA 1N75A 1ZRCA 3BG9A 4BBRJ 4L5JA 1I1SA 1P4XA 3ECHA 3ZN1A 1TWGJ 1A5JA 3MCZA 3S1RJ 3LNQA 2YU9J 2AQEA 4CCKA 3HOWJ 2X85A 2L5QA 3UKGA 4LOCA 1ZK8A 4UUSA 2EH3A 3FXKA 1X3UA 2VKVA 4I0AA 2HWVA 1LB2A 3BJ6A 3T8TA 2O61A 1KU3A 3BPVA 2IU5A 2V1NA 3H5RA 5EZGA 1HDDC 1YFHA 4X0GA 2XSJC 3BNIA 1XMXA 2X6XA 4RA2A 2GIVA 3GEZA 4DYQA 4AM3A 4Q4ZF 4G9YA 3NEUA 3ML6A 3E7LA 3X2QH 3I4MJ 5KHDA 1BJZA 2IT0A 2F6CA 5D5VB 2ZY9A 1QZYA 4I0BA 4CYCB 1B9NA 1V5GA 3LAJA 4RDUA 3LOCA 2PJRB 2WGBA 2EFOA 5CW8A 3CCQI 1WJDA 4LD5A 2VB6A 4M71A 2J5PA 1OCCH 3HRTA 5E79C 5A2QZ 4BKXA 2HEOA 2JQ7A 3CC4I 1V5EA 2WB1N 1SD4A 1R1TA 1FNNA 3EUAA 4HNVA 5JHUA 5DAJA 1REPC 3KZ9A 2KIMA 2OZ6A 2W4SA 1GV2A 2QF7A 3C1DA 4HF2A 3I54A 2DDBA 1VQMI 2FBKA 3KFWX 3AG4H 3JTGA 3DV8A 1YYVA 2L54A 3ZN0A 3LMMA 4C3JJ 1LE8B 2WA0A 3BR6A 1TT0A 4XORA 1BIAA 2VBXA 4XSZF 1S5LC 1DPUA 2PJPA 4IJAA 1RKTA 4GO1A 2EFWA 4LJZF 2VOOA 2RAEA 2JPCA 4ZYGA 1P7IA 2ELKA 1AKHB 4IHTA 1ZRFA 1F36A 2LC2A 3E3VA 5E3NA 4A3GJ 1N78A 1S6LA 3TGNA 2Y75A 4CCOA 2P7VB 3QODA 4E6KG 2A6HF 2KIQA 3WTTC 2M4GA 3IH4A 1Y0NA 2B1EA 4BQOA 1VQ6I 1XDSA 4D0PA 2ELJA 2E5ZA 1KONA 1JHHA 5CKTA 2OI8A 5JLXA 4W97A 5DV5A 4ANJA 3R4KA 1IC8A 1K61A 3U9GA 2FBQA 2ZSHB 4AU7A 2HYGD 2BOLA 1MBEA 3OS0A 2DMUA 3VSKA 1HQCA 3MZYA 1U5TA 3V8KA 3J81K 1RRJA 3L2VA 3A01B 2E1MC 2XROA 2NVUB 2IEKA 5E3LA 2PMUA 2ZCXA 5JVGF 2VASA 2VJ4A 3PPBA 4E7JA 4LLLA 1Q1HA 3PSIA 4GFBA 2P8TA 3VOEA 3ZQFA 2V57A 2R5ZA 3AG2H 1H9GA 4KIBA 4D5CA 3GFJA 4A3KJ 2QSGX 3S2DJ 5D1RA 3OIPA 4ACIA 1NG7A 1H9TA 5HNFA 3VP5A 5KAIC 2MH9A 3CF2A 1NHAA 4WF2A 5FKOA 2NXNB 3REOA 3S32A 2UXPA 4A3LJ 1ZG1A 2Y0SA 3LWFA 3HEFA 4CCNA 2DPUA 2DA1A 3O6BB 5D8KB 1YHQI 1UI6A 3WTZA 4JOMA 5FO5A 1QHGA 2G7UA 3CCEI 2ESHA 5DEQA 3DEEA 5HAWA 5ILVA 1Z7UA 1UJ8A 4A0YA 5GPCA 3K4BA 4KA4A 5E3OA 5DTDA 2YVEA 4UY8I 4UV8A 2CH0A 1XDUA 2RC4A 2XKPA 3OMYA 3CCLI 1Y0UA 3MEXA 3GBGA 3COAC 2XAGA 1LFUP 5M3FJ 2PMZN 2HVRA 3VTIA 1RETA 3RI4A 2GWRA 2DYRH 2W57A 2Q8KA 1B4AA 2E2IJ 3F9KA 3A1YA 2L02A 4L0YB 5D5WB 1TZLA 3CQZJ 3JRCA 3GWZA 3W2VA 1UB9A 1FOXA 1JGGA 1WJBA 5D6FA 4A5MA 2PFBA 1SGMA 1S8NA 3LL7A 4FETA 3N97A 2K4BA 3H92A 5DDGA 4GCTA 5M5XJ 3F22A 2ZOZA 2K27A 1W4MA 3CUQB 4A93J 3ON4A 5IT3A 3FMQA 2XSDC 1ETWA 2UUZA 1WCMJ 1WI9A 5DCMA 2CUZA 2H1KA 1SFXA 2DN0A 5FGLA 2JUCA 5FKLA 2X51A 3CMYA 3BLYA 1K78A 2YPRA 2XF6A 4X1EA 4HF0A 3ABKH 2YUSA 4S0HB 2YU3A 4B47A 4E7HA 2R7SA 4BU2A 4HQMA 2Q1ZB 1R6RA 1HW5A 2EV5A 5DCFA 3RQIA 4UUTA 4F93B 2QQBA 2WAQN 4JKZA 1RESA 2ZNYA 3BP8A 1X58A 2X1CA 4LFUA 3BC8A 2JA6J 1BM9A 2B9SA 3G6EI 3QU6A 1MBJA 1HSJA 3DQVC 3VFZA 2CRGA 5DM6F 3O8GA 4V2GA 1Z0XA 3HOTA 2IAIA 3V7CA 3QKXA 4HPQA 4YIRX 1P2FA 4A3DJ 3LSKA 3KYDB 4ASNA 1Z67A 2JTVA 1A36A 2G7LA 1Z21A 4ICHA 4A3BJ 1GVJA 5HLIA 3B6CA 2PEXA 3R0JA 2VBWA 3S16J 3WE2A 4ITVA 4A5NA 4XRSG 1OQYA 3MKZA 3SHFA 2L9SA 5L3GA 3HXLA 4F92B 3PFIA 2QYOA 4ENMA 2EFPA 1BN5A 1A35A 4Q48A 4UHTA 5B3SH 1T8IA 1JXSA 4PJJA 2XRNA 3HPHA 4OD4A 4CZZA 4O5VA 4DBRA 2XGDA 2WB1A 1X19A 4HNUA 2ISZA 2QCOA 3SZPA 4BHCA 2M45A 2JSPA 3CUQC 2P0WA 1VQKI 4GGGA 3ABTA 3ONQA 3JRHA 3F3XA 4LLGF 1MSFC 1FYMA 2XF5A 4PFPA 4RBOA 4E7SA 2E2HJ 2H1LA 4HLXA 1QO0D 1R9TJ 3IC7A 2HR3A 3LFKA 5D19A 2LYCA 3HOSA 1IXCA 4BE1A 2W24A 5GAEJ 3RIRA 2XPWA 1LPQA 1HKTA 3HSFA 2FNPA 4EM0B 1FX7A 1KU7A 3CO6C 1U9NA 2JA8J 2L7FP 1YX3A 1FBUA 3NRGA 2M7AA 3U1KA 4RM3A 2WAEA 3BOQA 2DW4A 4R79A 4S05A 5CQGA 5D8LB 3ZRGA 2W00A 2E34A 4IX7A 4IHXA 4NNJA 3BTJA 1K4SA 1JT0A 4KIFA 2VE8A 2DFIA 2DOAA 1O57A 1Z1DA 4RB3C 4MGRA 4E7IA 1OCTC 2VI6A 2BY1A 4LB6B 1UELB 2WUIA 2HDCA 2HPIA 3HL2A 3PL8A 4CUGA 1KYWA 3A0HC 4DJAA 4PFOA 3C2GA 4AVZA 2HKOA 4U0VA 4BBSJ 4JP0A 4YFXF 1QVUA 3CCRI 4BNCA 1XGOA 2V79A 1U3EM 5GPAA 3OYLA 1P4AA 3GTPJ 5CPRB 4E7ZA 3IAM2 3TP3A 2Y2ZA 2DDAA 1FTTA 3W3CA 4FT8A 2VJJA 4KUMA 1NG6A 4GDFA 4CYDA 2KIFA 2OTLI 3GTGJ 2LR8A 2OCEA 1J5YA 1G2HA 3BHQA 1TQMA 3Q9SA 5K5QA 1FC3A 2KRCA 2CS3A 2KHMA 2LVSA 2OU2A 2NNNA 1FTZA 3SWHA 2DK8A 2LNBA 3KP6A 4TV7A 3H0DA 4G7OF 5EG0B 3JSOA 1JI8A 2UXUA 1X1PA 1S3JA 2M8EA 3FXJA 1S7OA 3ABMH 1LDJA 2CUJA 4C3HJ 4AF5A 1FOYA 2K7LA 1W5SA 5H9TA 3AFHA 2F5EA 4KJZA 1F5TA 3DBRB 5TJJA 1I1GA 3OIQA 2STWA 2R7TA 4M3FA 2PFVA 4BY1J 1HA8A 3AQSA 2JA2A 5C4XJ 2WBMA 4NQWB 3ZMVA 3PASA 4BACA 3QBMA 2WY7Q 5HDKA 3BG3A 3OR2C 5LRSA 3WGIA 1N77A 2KDOA 4P9UA 3OYCA 1IAWA 4YELA 2KZGA 2XKOA 2JUGA 2PMZA 2IA0A 2K4JA 2P5LC 3E0JB 3EDPA 1VQ8I 3GZNB 1X1BA 3VWBA 4A2UA 4AD9A 2JT1A 3COLA 3ESWB 1IN7A 2EK5A 4O3MA 3CJRB 2DA3A 5E20A 4E7KA 2M3AA 3DEUA 4WXDA 3M8EA 4C2MJ 2XVCA 1K4TA 4CYCA 2PJRA 3P9IA 3MVPA 3U21A 3WTUC 2IPQX 1ETQA 3DBLB 4P55A 3GTJJ 4NDLA 1X4OA 3W2AA 3FM3A 2XUBA 5LGTA 5FLVA 3S3OA 2VIXA 2K9QA 2R93J 4OD5A 2A69F 3IP4B 2RNJA 3BZCA 1R5GA 1S9HA 5J1RA 2VPRA 2EZHA 2K02A 3VPRA 3KP5A 3TO6A 4JNNA 1LE8A 3WHBA 4D7NA 4GCKA 1ZGJA 1U5TC 4V19K 2HOEA 2NYXA 3K10A 2GUHA 3DCFA 2WAQA 3SZGA 5IP6A 3HG9A 3QOPA 5DD8A 2CUFA 4HNTA 1AKHA 1Z7LA 4NC7A 2VLAA 3QYFA 4YFNF 3QP6A 3GUDA 4W1UA 3JTHA 4YEJA 5LHGA 3IV5A 2CW7A 3L00A 5ILSA 2W48A 2CG4A 1G3YA 2BVLA 3J7YJ 1U8BA 2E2JJ 3K4LA 5HS8A 3TO7A 1ACIA 1OCZH 1YITI 2R7FA 4F3QA 1PJRA 4HKUA 3L2UA 1Z05A 3LSGA 4N0BA 4K2EA 4P1WA 4LG0A 3GW2A 3CJQB 1DU6A 3WU2C 3Q0VA 3F0CA 3HIFA 3OYIA 4E70A 3GFLA 4G12A 2EINH 1XN7A 2ISYA 3IHUA 1QQIA 2DG7A 2H6BA 2RDPA 1FMWA 3ZQGA 1MBFA 1ZYRF 1K6YA 2CQNA 2OA4A 2ZMEB 3FMRA 3NXCA 2LK2A 2GOXB 2X6YA 4N4OB 3A01A 1EH7A 1BW5A 3V8LA 4ZYAA 2MD0A 3KZIC 1U6GA 4HDUA 2O5RA 5LHIA 3P9TA 3R61A 4RM2A 1MMSA 3VYUB 1XCVA 3K7AJ 4BXXJ 3I59B 1IRFA 1QBJA 2VC1A 4AIHA 1SD7A 1I50J 4JYKA 3KYCB 3HOVJ 2MLGA 1R4MB 1SVOA 2CFXA 4C2UA 1J0RA 4YIFA 2MA3A 3HOZJ 2KPMA 4ZDPA 5HS9A 4IHYA 3SQNA 4BHBA 4KT5C 1B6AA 4QPOA 2YVXA 4GFLA 2HNHA 3E6DA 3FKJA 3MWMA 4R1HA 2FJ1A 2ECBA 4WWCA 3S93A 3S14J 1WJ5A 3BQYA 4XLNF 4UVBA 3H5NA 3H0GJ 2R7UA 2ZB9A 2W84A 1UCRA 4MO7A 2H27A 4U87A 2O3FA 1Y8QB 3E7QA 4HV5A 3ISPA 1BOAA 1SD5A 2DJNA 2HQNA 5EF6A 3J81Z 4XOPA 1L3LA 2NS0A 3WODF 4QIWN 5IOZA 1YLFA 2H09A 4PUSA 1K7AA 1D0ZA 1HSTA 4RLFA 4EJWA 1MH4A 3OV8A 1XG1A 1BC7C 1HCRA 4RGUA 2IGNA 4JX6A 2RASA 4Y52J 2R7VA 2OJED 2Y0SN 1USTA 2FX0A 3VW1A 3MAJA 3I0TA 1UG0A 5HBUA 1ZLKA 1SAUA 6PAXA 2A2FX 2V7FA 4OIOF 1MMAA 3CJTB 1IRXA 2ZMEC 3FXOA 2V1XA 2R0QC 3CUOA 1ETXA 2XAUA 3BTCA 2BW3A 1Z9CA 1LDDA 2OERA 3K2ZA 2RVCA 3HOUJ 1ZH5A 2O7TA 2Z3YA 3T6NA 2W53A 2ZSIB 3CUQA 4IKFA 5LBQA 2AS5F 1FBSA 1DDNA 4ZYEA 2KKOA 3SFZA 3IH2A 1PUFB 3H3UA 3VW2A 4LLNA 1ONVA 2MD5A 5M5YJ 1VQNI 4G7HF 1TWCJ 4C2TA 3GFIA 1ZARA 1JHFA 2Q0OA 2QBYB 3E5QA 3SEZA 2I8DA 1WWXA 5J4VA 2B7EA 3EQLF 4MXMA 4HA8A 4BE0A 2QZ8A 3VYTB 1MKMA 1RZ4A 3I56I 3ZQQA 3S3NA 1D0XA 2A6EF 4RAFA 4G7ZF 5HNHA 4MK6A 2L9VA 4F52A 2W82A 4DW6A 1QNTA 3CLQA 2F4MB 3M4OJ 2EZLA 2A5YB 3ERMA 4L9VA 3AL0B 2LBFB 3BRUA 3GYHX 4AIKA 1IN4A 5IT9Z 2A05A 3V78A 2DK5A 5K1YA 1YO5C 1T08B 1BJAA 3K1PA 5D5XB 3ULQB 3IL2A 1O3QA 2QKOA 1FWZA 1O3SA 3HTAA 1Z3YA 1U2WA 3ROUA 1R5ID 5JLWA 4II3A 4QPQA 3HOXJ 1E17A 2XC7A 2TRTA 4WX9A 3HTHA 5D5UB 1B72B 2OTJI 1TNTA 2JVHA 3C2HA 5EJCA 4UUVA 4QSHA 4BS9A 1EKEA 2FXAA 4B48A 5CYVA 3HPGA 2Y9YA 3BT9A 4I76A 3B02A 2QQ9A 2CMPA 2QUFA 2LF7A 3CJDA 2ESNA 4RB0A 4LMYA 2L7KA 3W6KB 3BR5A 4Y3OA 5KK1A 3S3MA 3L09A 5C4JJ 2OC6A 1BOBA 3LA3A 4I98B 1A6IA 2IBDA 3K4MA 2FOWA 4Y15A 1ON1A 2ZCWA 4GXOA 2LY9A 2G3BA 1TQPA 1FMVA 2IA1A 3IWZA 4HW0A 5E1WA 3QP5A 4M9XA 2HZTA 3RYRA 3NNRA 2GXGA 2ZFWA 1WJFA 2EQRA 2FUG2 5F1JA 2X4HA 3L2RA 4IOCF 2DBBA 1F43A 3HZJA 1D0YA 4HQEA 2M5WA 3FHNA 1M1EB 5H6RA 2XB0X 1XSXA 2HYFA 1IN8A 3ZQIA 3ABLH 3ZR8X 5JI6A 3ZQLA 2GFNA 1V4RA 4EMSA 1OR7C 3TMOA 4IRIA 1MJBA 2JMWA 5D4RA 1RUNA 2MH2A 4RS8A 1FPQA 3C2BA 2IS4A 1HLVA 4L9TA 3HJEA 4MTEA 2OQRA 1HOMA 4FCYA 1QU3A 4NUBA 4XICA 2QWWA 4LK0F 1R36A 3AAFA 4CDGA 3HRUA 4KIGA 3KZYA 3O3KA 3BR1A 2DTZA 2JA5J 5J6XA 5CVVA 5IYCJ 4KMFA 4HF1A 3LQQA 4ON0A 5JVTA 2HTSA 1YRNB 1HW2A 4M3BA 2IGKA 2XAJA 1KU2A 5AIPA 2P7CB 2O7OA 5F64A 1NK3P 3LAPA 1RI7A 2ZJQF 3Q9VA 2B3WA 2Z16A 4XKVA 4B1RA 2ACJA 5KNLA 3EYYA 4ZZDA 5E3MA 5EG0A 1OFCX 4IO9F 3WTSC 1MMNA 1XGNA 1VF9A 3FXMA 3IRQA 2M87A 3CP8A 2VL8A 5K58A 4CHUA 1OKRA 2J5OA 3A02A 3KPHA 4LITA 2ZC2A 4CZCA 3LSHA 1MMGA 3HUGA 3ZP5A 2PG4A 2NP5A 3BROA 1X2NA 3K6GA 2CSOA 3V7RA 2K85A 3W6JB 3NWTA 1MIJA 4BAYA 2W7NA 4A3IJ 1W7PA 3NI7A 1EF4A 2E19A 3SDGA 4HYEA 1P9QC 4NQWA 3L1PA 1LFPA 2H8WA 5F0HA 5HOOA 4YRVA 3JCUC 5FGMA 2MGQA 3HSEA 3ZXSA 1Y1WJ 1JKRC 2IS6A 1XMKA 2BHZA 2KL4A 1J9IA 4M74A 3WG9A 1G3WA 4IVNA 2HFHA 1XS9A 4I6ZA 2M4KA 2NVYJ 1BR2A 4OAYA 4BXFA 3VVXA 5GAHJ 3S17J 2Y9ZA 3HGYA 1OCPA 1K6OA 2PBXA 2H8RA 2CQQA 2GQQA 4XMYA 2QSFX 2VKHA 3ZCOA 5K5RA 1RR8C 4B44A 2G7GA 4EM1A 4Z6YA 4GYGA 2QVOA 3G1LA 4IF4A 4BQQA 5ICGA 1QA6A 1ETKA 1TTYA 1JUPA 1S7EA 2GBYA 2M9HA 2K3PA 2VKEA 1JE8A 2A07F 3GTLJ 1QZEA 2P81A 1D1BA 1KQ8A 4XK4A 4IRGA 1OJLA 4LIUA 3HBLA 3D0SA 3S1NJ 4PJMA 1L0OC 1Z77A 3TW7A 4L62A 2VE9A 5CLSA 4RGXA 4KFCA 2KMUA 2DAOA 2ZXJA 2RHAA 3F6VA 1YIOA 2RKHA 3LSMA 2NVTJ 2OUMA 2X1EA 1Y39A 5EGOB 2XIGA 3LFUA 4MHGA 4V2FA 3GZIA 5L3DA 5FLMJ 4GRIA 2DQLA 2UXNA 3GTKJ 1X4PA 4EEFG 4M3GA 4C30A 3HGGA 2DA7A 4EGZA 3DPLC 3KLNA 4ME9A 2BYVE 1YE9A 3T8RA 3FISA 5B5EC 1YS7A 2LP0A 5JFRA 3AKZA 4CICA 4P96A 2HTJA 5LLQA 4HX7A 2VQLA 2JA7J 2HKUA 2HXIA 3RDIA 1I6XA 2PI0A 5DM7F 3HSRA 2DCEA 3IUOA 3HTIA 3OYMA 3N05A 3MMYB 2N8GA 2CW8A 1TW2A 3H1CA 3IUVA 2HU9A 3KP4A 1BR4A 4NELA 1DPRA 3OYBA 1LVKA 3JR9A 1B8IB 5ERIA 2L01A 2VJIA 4HZFA 4HBLA 3VYRB 4Q47A 3E1SA 3RZOJ 5C4YA 3E6CC 1I27A 3D5SC 4WXCA 3EUPA 1P4WA 2NS7A 3RYPA 2ZMEA 1WJAA 3F21A 2XV4S 3FBIB 3PNVA 1DP3A 3MQ0A 4CGZA 3BQZA 1LJ9A 2NVQJ 3VYSB 1QGPA 2V9KA 5K7ZA 5AIQA 1SVLA 4Y17A 2XPVA 4U9NA 1LQ1A 3M9AA 2E7XA 2YX7A 3GCMA 5HS7A 2JN6A 3CMMA 1IN5A 2EB7A 2RNGA 2A5WA 1PYVA 1ZHFA 1BIBA 1VTNC 4LB5A 2DMTA 3OYAA 2HKXA 4BYYA 1X1CA 4D1QA 1O3TA 2ECCA 3VIBA 3TEDA 5M5WJ 3A2KA 3CCUI 1YJWI 2VPLA 2QKMB 2O9LA 1MDMA 4BJTA 2LMDA 3PIOF 3GO5A 1R4NB 4YFKF 1VQ7I 4HV6A 3LSJA 4HRIA 3S2HJ 4LG3A 3CZ6A 5B1AH 5J8CA 3NWSA 1R58A 4UB6C
chains in the Genus database with same CATH topology
4IHVA 3QQAA 2K9QA 1H89C 3V6GA 4DZPA 2R93J 2CQXA 3JRGA 3B6AA 2O8KA 5GP9A 5J1RA 2VPRA 5IYBJ 2DA5A 2EZHA 3VPRA 3FK7A 2AO9A 4JNNA 5F0CA 1LE8A 3WHBA 4D7NA 4GCKA 4J19A 2DMPA 4MFDA 4BY7J 2G0EA 2GUHA 4A3MJ 3DCFA 3B81A 1I3QJ 2JK3A 2Q24A 1MNMC 5IP6A 2B63J 2DA4A 2XDNA 2CUFA 1ETVA 2L7ZA 2JJ7A 1JKPC 1AKHA 2LFBA 1NTCA 4W1UA 5IP7J 3Q3SA 3IV5A 2W48A 3OSFA 1U8BA 2E2JJ 1WPKA 2L7MP 3RH2A 4AUXA 2MSYA 3FK6A 1T56A 5EDNA 1ZR2A 3VVZA 3Q0WA 3BR3A 1IRZA 1CQTA 1ETOA 3JRFA 4HKUA 3LSGA 1BL0A 4JX5A 1DU6A 3S15J 3KNWA 1GVDA 3F0CA 3Q0VA 3ZQCA 1FIAA 3BG9A 1WGXA 4BBRJ 2ME0A 2M34A 4G12A 2DG7A 1TWGJ 1A5JA 1XC5A 3S1RJ 3LNQA 1MBKA 2YU9J 3ZQGA 3HOWJ 1MBFA 3UKGA 2UXIA 4LOCA 1ZK8A 2DMQA 4UUSA 2ID6A 1D5YA 3NXCA 2EH3A 2LK2A 4FTHA 1RPWA 3A01A 1GDTA 3RD3A 2R5YB 1BW5A 3CRJA 2VKVA 3P9TA 1JJ6C 5IP9J 2IU5A 1IUFA 3PO3J 5EZGA 1HDDC 3K7AJ 3S1QJ 4BXXJ 2WV1A 2XPUA 1UMQA 5J1UA 2GENA 3BNIA 1I50J 4JYKA 1APLC 3BR0A 4DYQA 3HOVJ 1UG2A 3E7LA 1ORKA 2HOSA 3I4MJ 3BCGA 1BJZA 2ME6A 3HOZJ 2UXHA 4IHYA 3ANPA 5IOYA 4DYCA 4CYCB 4RDUA 2DA2A 3LOCA 4GFLA 2WGBA 5CW8A 1WH7A 2FJ1A 4BKXA 1HF0A 2ECBA 4A3JJ 3S14J 2WB1N 3GTMJ 3BQYA 4HNVA 5DAJA 3KZ9A 3H0GJ 2ZB9A 3A03A 4MO7A 1GV2A 2QF7A 4D5FA 3E7QA 2XB5A 5EF6A 2DJNA 2QOPA 1MBHA 2DMNA 4QIWN 5IOZA 2HQ5A 4C3JJ 1LE8B 3BR6A 1AU7A 1I6HJ 4YZEA 1MH4A 1XG1A 1U78A 2K9NA 1HCRA 3FRQA 2EZIA 5F27A 2K40A 1RKTA 4JX6A 2RASA 4Y52J 2RAEA 1W0UA 1MSEC 2Y0SN 2FX0A 3VW1A 5FKNA 1FJLA 1P7IA 2ELKA 5HBUA 1AKHB 1F36A 5E3NA 4A3GJ 5FJ8J 5BNGA 2R0QC 1O4XA 1ETXA 4PXIA 1H8AC 2VUMJ 1BA5A 3BTCA 3JRBA 2OERA 3IH4A 3C07A 3HOUJ 3BJBA 2O7TA 3T6NA 2W53A 4MLOA 2OI8A 5JLXA 4W97A 1WI3A 1IC8A 4CGRA 3IH2A 1K61A 4Y7NJ 4A3EJ 1PUFB 3VW2A 2LKXA 2FBQA 5CXIA 1MBEA 2REKA 5M5YJ 5F08A 2DMUA 4UUSB 1IDZA 3JREA 1TWCJ 3H3VK 2LD5A 4IEJA 3A01B 2XGEA 3OIOA 2MG4A 2GM4A 4ABZA 2IEKA 5E3LA 2ZCXA 1K83J 1HDPA 3PPBA 4MXMA 1JT6A 5HSZA 4GFBA 3ZQFA 2MW8A 4MK6A 2V57A 2R5ZA 1U9OA 5CXGA 4DW6A 4D5CA 3M4OJ 1T33A 3S5RA 5M3MJ 4A3KJ 2EZLA 3S2DJ 3KKDA 5D1RA 4JX4A 2CJJA 3LSRA 3RKQA 1SANA 4ACIA 1JKOC 3GTQJ 3BRUA 3LHQA 3VP5A 1YRNA 5FKOA 3HDDA 1ZQ3P 2UXPA 1UI5A 3V78A 4A3LJ 3BR2A 5K7HA 1P7JA 2QIBA 3HEFA 1TWFJ 2DA1A 2YVHA 2QKOA 1PUFA 3HTAA 5EYRA 2M0CA 3G56A 5JLWA 1ZR4A 1DU0A 4XRSA 3HOXJ 1UI6A 3ZQHA 2TRTA 5HAWA 3EGQA 5GPCA 3NARA 3HTHA 1B72B 3FIWA 4KWAA 5E3OA 5DTDA 2YVEA 2FD5A 4QSHA 4JL3A 1VFCA 5FKMA 2Y9YA 2QTQA 3BT9A 4I76A 4GFKA 3O8HA 3HOYJ 1LFUP 3GBGA 5C3EJ 3CJDA 1WH5A 5M3FJ 2PMZN 1RETA 3BR5A 3GTOJ 1JUMA 5C4JJ 2E2IJ 1A6IA 3S1MJ 2IBDA 1MH3A 3D1NI 5EZHA 3CQZJ 3JRCA 2LY9A 2G3BA 1JGGA 1RKWA 1SGMA 2X6OA 3NNRA 3CCYA 2NS8A 5F1JA 2EQRA 2HOTA 3KKCA 3BTLA 1F43A 4GCTA 5M5XJ 2ZOZA 1GV5A 2XB0X 1FEXA 4A93J 3ON4A 3ZQIA 2XRLA 3SJMA 3ZQLA 2GFNA 3IH3A 2XSDC 1ETWA 1WCMJ 3PM1A 2JMWA 2H1KA 2R92J 2DN0A 3I4NJ 5FKLA 5FGLA 2ZOYA 4FISA 1B72A 5C44J 3C2BA 3CMYA 1HLVA 2FQ4A 2LTPA 1ETYA 3VUQA 2KDZA 4X1EA 3LJLA 2E1OA 1HOMA 2YUSA 4FCYA 1TWAJ 1IGNA 4S0HB 3F1BA 3AQTA 9ANTA 3BG5A 4XICA 4AYBN 2OF7A 3RQIA 4UUTA 2NX4A 2YS9A 3BR1A 3TW6A 2WAQN 4JKZA 1RESA 1X58A 2DTZA 2EZKA 3HKZN 2JA5J 3VOKA 2JA6J 2R7ZJ 4B3AA 1MBJA 5IYCJ 2R5ZB 2CRGA 3DEWA 3O8GA 4V2GA 1Z0XA 2IAIA 3G7RA 3QKXA 1FIPA 1X2MA 4A3DJ 2EBIA 3BTIA 3PO2J 1YRNB 3O60A 3SFIA 2G7LA 4DYRA 4M3BA 3W6VA 2GLOA 3HTJA 4A3BJ 3LWJA 4ICHA 3HB9A 1GT0C 3CDLA 1VI0A 2O7OA 3B6CA 2G7SA 1NK3P 3VOXA 3S16J 5D18A 3JRDA 2F07A 5AQCA 4XRSG 3G1MA 4A3FJ 5J3LA 4B1RA 2ZCNA 5E3MA 5EG0A 1OFCX 4B4CA 1VF9A 3CWRA 5K58A 2XGCA 1ZGWA 4FE7A 3A02A 3DPJA 2ID3A 2XGDA 2CU7A 1B8IA 2NP5A 1X2NA 2AHQA 2QCOA 4A3IJ 3NI7A 2Y30A 1EF4A 1BW6A 2E19A 2X48A 3SDGA 5F0FA 3JRHA 3ANGA 1QRYA 1MSFC 3GEUA 3L1PA 4M3DA 5FHPA 5F0HA 1NK2P 2HI3A 5FKKA 4RBOA 2JWTA 2E2HJ 1E3OC 2MGQA 3QPLA 1ZTRA 1Y1WJ 5DS9A 1JKRC 3HM5A 1R9TJ 4C3IJ 4GCLA 5D19A 3VVYA 1GUUA 5IPAA 3MN2A 1XS9A 4I6ZA 1IJWC 5FMPA 2NVYJ 3NAUA 1SFOJ 2XPWA 3VVXA 3S17J 2Y9ZA 3HGYA 1OCPA 2PBXA 2H8RA 2CQQA 1U9NA 3JRIA 2JA8J 2L7FP 3MNLA 3NRGA 2G7GA 2M8GX 2OPTA 2D5VA 3G1LA 4IHWA 3HIMA 4A3CJ 2TCTA 1ETKA 2D6YA 2M9HA 1JUPA 1S7EA 2GBYA 2VKEA 3GTLJ 1JJ8C 2HOAA 1ITYA 2P81A 1POGA 1QVTA 2HYTA 4IHXA 4XK4A 1OJLA 3BTJA 1JT0A 3HBLA 3S1NJ 2HDDA 1JTYA 3WHCA 1Z77A 4AC0A 3TW7A 4AC6A 2KT0A 4L62A 1OCTC 4X6AJ 1TC3C 2VI6A 2WUIA 4A69C 2RHAA 5K7FA 4QTRA 2NVTJ 1Q1VA 4JP0A 3OOUA 5EGOB 1QVUA 3K2AA 1H88C 4BBSJ 4XIDA 3VW0A 4V2FA 3GZIA 5FLMJ 4M3EA 2HXOA 5GPAA 2I10A 3GTKJ 3GTPJ 4UDSA 4EEFG 4M3GA 1ZKGA 3HGGA 2DA7A 3TP3A 2Y2ZA 1FTTA 4ME9A 2Y31A 3FISA 3FKIJ 3QPSA 2LP0A 3GTGJ 2LR8A 5EEAA 3Q0UA 1G2HA 1JKQC 2QWTA 4L5EA 3BHQA 2UXOA 3NPIA 2JA7J 2HKUA 2HXIA 4MFEA 2LVSA 1FTZA 3JSJA 2COBA 4XRMA 5EG0B 2K9SA 3LSPA 4MIMA 3HTIA 4DZJA 2UXUA 2N8GA 2LLKA 3IUVA 4C3HJ 5H9TA 1IDYA 4AF5A 1JTXA 4NELA 3JR9A 2L9RA 1B8IB 2CUEA 1JUSA 4M3FA 4D7MA 3RZOJ 5C4YA 4BY1J 1UHSA 2NOGA 3AQSA 5C4XJ 3EUPA 2NS7A 3QBMA 3TP0A 3PASA 2L0KA 5EGOA 3JRAA 2DA6A 1LFBA 3BG3A 2R5YA 5IYDJ 2NVXJ 2PZ9A 2NP3A 3BQZA 3ON2A 2NVQJ 3ZOBA 1AHDP 5K7ZA 5J1YA 3OSGA 5HODA 2XPVA 4NN1A 2M2EA 3COLA 3MKLA 3M3YJ 2JN6A 2DA3A 2X9DA 1ENHA 2HYJA 1VNDA 2DMTA 4M6VA 1QPIA 2ZCMA 2ECCA 4C2MJ 3VIBA 4CYCA 1RR7A 3TEDA 5M5WJ 1TWHJ 3MVPA 1W0TA 1ETQA 2DG8A 4FE4A 2O9LA 3GTJJ 1Y1VJ 4NDLA 5F04A 5EFYA 3HE0A 1IV6A 3LSJA 3S2HJ 1IG7A 3G1OA 3RZDJ 1MBGA 5FLVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IHV A;  3QQA A;  2K9Q A;  1H89 C;  3V6G A;  4DZP A;  2R93 J;  2CQX A;  3JRG A;  3B6A A;  2O8K A;  5GP9 A;  5J1R A;  2VPR A;  5IYB J;  2DA5 A;  2EZH A;  3VPR A;  3FK7 A;  2AO9 A;  4JNN A;  5F0C A;  1LE8 A;  3WHB A;  4D7N A;  4GCK A;  4J19 A;  2DMP A;  4MFD A;  4BY7 J;  2G0E A;  2GUH A;  4A3M J;  3DCF A;  3B81 A;  1I3Q J;  2JK3 A;  2Q24 A;  1MNM C;  5IP6 A;  2B63 J;  2DA4 A;  2XDN A;  2CUF A;  1ETV A;  2L7Z A;  2JJ7 A;  1JKP C;  1AKH A;  2LFB A;  1NTC A;  4W1U A;  5IP7 J;  3Q3S A;  3IV5 A;  2W48 A;  3OSF A;  1U8B A;  2E2J J;  1WPK A;  2L7M P;  3RH2 A;  4AUX A;  2MSY A;  3FK6 A;  1T56 A;  5EDN A;  1ZR2 A;  3VVZ A;  3Q0W A;  3BR3 A;  1IRZ A;  1CQT A;  1ETO A;  3JRF A;  4HKU A;  3LSG A;  1BL0 A;  4JX5 A;  1DU6 A;  3S15 J;  3KNW A;  1GVD A;  3F0C A;  3Q0V A;  3ZQC A;  1FIA A;  3BG9 A;  1WGX A;  4BBR J;  2ME0 A;  2M34 A;  4G12 A;  2DG7 A;  1TWG J;  1A5J A;  1XC5 A;  3S1R J;  3LNQ A;  1MBK A;  2YU9 J;  3ZQG A;  3HOW J;  1MBF A;  3UKG A;  2UXI A;  4LOC A;  1ZK8 A;  2DMQ A;  4UUS A;  2ID6 A;  1D5Y A;  3NXC A;  2EH3 A;  2LK2 A;  4FTH A;  1RPW A;  3A01 A;  1GDT A;  3RD3 A;  2R5Y B;  1BW5 A;  3CRJ A;  2VKV A;  3P9T A;  1JJ6 C;  5IP9 J;  2IU5 A;  1IUF A;  3PO3 J;  5EZG A;  1HDD C;  3K7A J;  3S1Q J;  4BXX J;  2WV1 A;  2XPU A;  1UMQ A;  5J1U A;  2GEN A;  3BNI A;  1I50 J;  4JYK A;  1APL C;  3BR0 A;  4DYQ A;  3HOV J;  1UG2 A;  3E7L A;  1ORK A;  2HOS A;  3I4M J;  3BCG A;  1BJZ A;  2ME6 A;  3HOZ J;  2UXH A;  4IHY A;  3ANP A;  5IOY A;  4DYC A;  4CYC B;  4RDU A;  2DA2 A;  3LOC A;  4GFL A;  2WGB A;  5CW8 A;  1WH7 A;  2FJ1 A;  4BKX A;  1HF0 A;  2ECB A;  4A3J J;  3S14 J;  2WB1 N;  3GTM J;  3BQY A;  4HNV A;  5DAJ A;  3KZ9 A;  3H0G J;  2ZB9 A;  3A03 A;  4MO7 A;  1GV2 A;  2QF7 A;  4D5F A;  3E7Q A;  2XB5 A;  5EF6 A;  2DJN A;  2QOP A;  1MBH A;  2DMN A;  4QIW N;  5IOZ A;  2HQ5 A;  4C3J J;  1LE8 B;  3BR6 A;  1AU7 A;  1I6H J;  4YZE A;  1MH4 A;  1XG1 A;  1U78 A;  2K9N A;  1HCR A;  3FRQ A;  2EZI A;  5F27 A;  2K40 A;  1RKT A;  4JX6 A;  2RAS A;  4Y52 J;  2RAE A;  1W0U A;  1MSE C;  2Y0S N;  2FX0 A;  3VW1 A;  5FKN A;  1FJL A;  1P7I A;  2ELK A;  5HBU A;  1AKH B;  1F36 A;  5E3N A;  4A3G J;  5FJ8 J;  5BNG A;  2R0Q C;  1O4X A;  1ETX A;  4PXI A;  1H8A C;  2VUM J;  1BA5 A;  3BTC A;  3JRB A;  2OER A;  3IH4 A;  3C07 A;  3HOU J;  3BJB A;  2O7T A;  3T6N A;  2W53 A;  4MLO A;  2OI8 A;  5JLX A;  4W97 A;  1WI3 A;  1IC8 A;  4CGR A;  3IH2 A;  1K61 A;  4Y7N J;  4A3E J;  1PUF B;  3VW2 A;  2LKX A;  2FBQ A;  5CXI A;  1MBE A;  2REK A;  5M5Y J;  5F08 A;  2DMU A;  4UUS B;  1IDZ A;  3JRE A;  1TWC J;  3H3V K;  2LD5 A;  4IEJ A;  3A01 B;  2XGE A;  3OIO A;  2MG4 A;  2GM4 A;  4ABZ A;  2IEK A;  5E3L A;  2ZCX A;  1K83 J;  1HDP A;  3PPB A;  4MXM A;  1JT6 A;  5HSZ A;  4GFB A;  3ZQF A;  2MW8 A;  4MK6 A;  2V57 A;  2R5Z A;  1U9O A;  5CXG A;  4DW6 A;  4D5C A;  3M4O J;  1T33 A;  3S5R A;  5M3M J;  4A3K J;  2EZL A;  3S2D J;  3KKD A;  5D1R A;  4JX4 A;  2CJJ A;  3LSR A;  3RKQ A;  1SAN A;  4ACI A;  1JKO C;  3GTQ J;  3BRU A;  3LHQ A;  3VP5 A;  1YRN A;  5FKO A;  3HDD A;  1ZQ3 P;  2UXP A;  1UI5 A;  3V78 A;  4A3L J;  3BR2 A;  5K7H A;  1P7J A;  2QIB A;  3HEF A;  1TWF J;  2DA1 A;  2YVH A;  2QKO A;  1PUF A;  3HTA A;  5EYR A;  2M0C A;  3G56 A;  5JLW A;  1ZR4 A;  1DU0 A;  4XRS A;  3HOX J;  1UI6 A;  3ZQH A;  2TRT A;  5HAW A;  3EGQ A;  5GPC A;  3NAR A;  3HTH A;  1B72 B;  3FIW A;  4KWA A;  5E3O A;  5DTD A;  2YVE A;  2FD5 A;  4QSH A;  4JL3 A;  1VFC A;  5FKM A;  2Y9Y A;  2QTQ A;  3BT9 A;  4I76 A;  4GFK A;  3O8H A;  3HOY J;  1LFU P;  3GBG A;  5C3E J;  3CJD A;  1WH5 A;  5M3F J;  2PMZ N;  1RET A;  3BR5 A;  3GTO J;  1JUM A;  5C4J J;  2E2I J;  1A6I A;  3S1M J;  2IBD A;  1MH3 A;  3D1N I;  5EZH A;  3CQZ J;  3JRC A;  2LY9 A;  2G3B A;  1JGG A;  1RKW A;  1SGM A;  2X6O A;  3NNR A;  3CCY A;  2NS8 A;  5F1J A;  2EQR A;  2HOT A;  3KKC A;  3BTL A;  1F43 A;  4GCT A;  5M5X J;  2ZOZ A;  1GV5 A;  2XB0 X;  1FEX A;  4A93 J;  3ON4 A;  3ZQI A;  2XRL A;  3SJM A;  3ZQL A;  2GFN A;  3IH3 A;  2XSD C;  1ETW A;  1WCM J;  3PM1 A;  2JMW A;  2H1K A;  2R92 J;  2DN0 A;  3I4N J;  5FKL A;  5FGL A;  2ZOY A;  4FIS A;  1B72 A;  5C44 J;  3C2B A;  3CMY A;  1HLV A;  2FQ4 A;  2LTP A;  1ETY A;  3VUQ A;  2KDZ A;  4X1E A;  3LJL A;  2E1O A;  1HOM A;  2YUS A;  4FCY A;  1TWA J;  1IGN A;  4S0H B;  3F1B A;  3AQT A;  9ANT A;  3BG5 A;  4XIC A;  4AYB N;  2OF7 A;  3RQI A;  4UUT A;  2NX4 A;  2YS9 A;  3BR1 A;  3TW6 A;  2WAQ N;  4JKZ A;  1RES A;  1X58 A;  2DTZ A;  2EZK A;  3HKZ N;  2JA5 J;  3VOK A;  2JA6 J;  2R7Z J;  4B3A A;  1MBJ A;  5IYC J;  2R5Z B;  2CRG A;  3DEW A;  3O8G A;  4V2G A;  1Z0X A;  2IAI A;  3G7R A;  3QKX A;  1FIP A;  1X2M A;  4A3D J;  2EBI A;  3BTI A;  3PO2 J;  1YRN B;  3O60 A;  3SFI A;  2G7L A;  4DYR A;  4M3B A;  3W6V A;  2GLO A;  3HTJ A;  4A3B J;  3LWJ A;  4ICH A;  3HB9 A;  1GT0 C;  3CDL A;  1VI0 A;  2O7O A;  3B6C A;  2G7S A;  1NK3 P;  3VOX A;  3S16 J;  5D18 A;  3JRD A;  2F07 A;  5AQC A;  4XRS G;  3G1M A;  4A3F J;  5J3L A;  4B1R A;  2ZCN A;  5E3M A;  5EG0 A;  1OFC X;  4B4C A;  1VF9 A;  3CWR A;  5K58 A;  2XGC A;  1ZGW A;  4FE7 A;  3A02 A;  3DPJ A;  2ID3 A;  2XGD A;  2CU7 A;  1B8I A;  2NP5 A;  1X2N A;  2AHQ A;  2QCO A;  4A3I J;  3NI7 A;  2Y30 A;  1EF4 A;  1BW6 A;  2E19 A;  2X48 A;  3SDG A;  5F0F A;  3JRH A;  3ANG A;  1QRY A;  1MSF C;  3GEU A;  3L1P A;  4M3D A;  5FHP A;  5F0H A;  1NK2 P;  2HI3 A;  5FKK A;  4RBO A;  2JWT A;  2E2H J;  1E3O C;  2MGQ A;  3QPL A;  1ZTR A;  1Y1W J;  5DS9 A;  1JKR C;  3HM5 A;  1R9T J;  4C3I J;  4GCL A;  5D19 A;  3VVY A;  1GUU A;  5IPA A;  3MN2 A;  1XS9 A;  4I6Z A;  1IJW C;  5FMP A;  2NVY J;  3NAU A;  1SFO J;  2XPW A;  3VVX A;  3S17 J;  2Y9Z A;  3HGY A;  1OCP A;  2PBX A;  2H8R A;  2CQQ A;  1U9N A;  3JRI A;  2JA8 J;  2L7F P;  3MNL A;  3NRG A;  2G7G A;  2M8G X;  2OPT A;  2D5V A;  3G1L A;  4IHW A;  3HIM A;  4A3C J;  2TCT A;  1ETK A;  2D6Y A;  2M9H A;  1JUP A;  1S7E A;  2GBY A;  2VKE A;  3GTL J;  1JJ8 C;  2HOA A;  1ITY A;  2P81 A;  1POG A;  1QVT A;  2HYT A;  4IHX A;  4XK4 A;  1OJL A;  3BTJ A;  1JT0 A;  3HBL A;  3S1N J;  2HDD A;  1JTY A;  3WHC A;  1Z77 A;  4AC0 A;  3TW7 A;  4AC6 A;  2KT0 A;  4L62 A;  1OCT C;  4X6A J;  1TC3 C;  2VI6 A;  2WUI A;  4A69 C;  2RHA A;  5K7F A;  4QTR A;  2NVT J;  1Q1V A;  4JP0 A;  3OOU A;  5EGO B;  1QVU A;  3K2A A;  1H88 C;  4BBS J;  4XID A;  3VW0 A;  4V2F A;  3GZI A;  5FLM J;  4M3E A;  2HXO A;  5GPA A;  2I10 A;  3GTK J;  3GTP J;  4UDS A;  4EEF G;  4M3G A;  1ZKG A;  3HGG A;  2DA7 A;  3TP3 A;  2Y2Z A;  1FTT A;  4ME9 A;  2Y31 A;  3FIS A;  3FKI J;  3QPS A;  2LP0 A;  3GTG J;  2LR8 A;  5EEA A;  3Q0U A;  1G2H A;  1JKQ C;  2QWT A;  4L5E A;  3BHQ A;  2UXO A;  3NPI A;  2JA7 J;  2HKU A;  2HXI A;  4MFE A;  2LVS A;  1FTZ A;  3JSJ A;  2COB A;  4XRM A;  5EG0 B;  2K9S A;  3LSP A;  4MIM A;  3HTI A;  4DZJ A;  2UXU A;  2N8G A;  2LLK A;  3IUV A;  4C3H J;  5H9T A;  1IDY A;  4AF5 A;  1JTX A;  4NEL A;  3JR9 A;  2L9R A;  1B8I B;  2CUE A;  1JUS A;  4M3F A;  4D7M A;  3RZO J;  5C4Y A;  4BY1 J;  1UHS A;  2NOG A;  3AQS A;  5C4X J;  3EUP A;  2NS7 A;  3QBM A;  3TP0 A;  3PAS A;  2L0K A;  5EGO A;  3JRA A;  2DA6 A;  1LFB A;  3BG3 A;  2R5Y A;  5IYD J;  2NVX J;  2PZ9 A;  2NP3 A;  3BQZ A;  3ON2 A;  2NVQ J;  3ZOB A;  1AHD P;  5K7Z A;  5J1Y A;  3OSG A;  5HOD A;  2XPV A;  4NN1 A;  2M2E A;  3COL A;  3MKL A;  3M3Y J;  2JN6 A;  2DA3 A;  2X9D A;  1ENH A;  2HYJ A;  1VND A;  2DMT A;  4M6V A;  1QPI A;  2ZCM A;  2ECC A;  4C2M J;  3VIB A;  4CYC A;  1RR7 A;  3TED A;  5M5W J;  1TWH J;  3MVP A;  1W0T A;  1ETQ A;  2DG8 A;  4FE4 A;  2O9L A;  3GTJ J;  1Y1V J;  4NDL A;  5F04 A;  5EFY A;  3HE0 A;  1IV6 A;  3LSJ A;  3S2H J;  1IG7 A;  3G1O A;  3RZD J;  1MBG A;  5FLV A; 
#chains in the Genus database with same CATH topology
 4XR6 A;  3L2W A;  1HKQ A;  3JRG A;  2VKD A;  3BJA A;  2GIZ A;  3FX3 A;  2XAQ A;  4IQ4 A;  1IV8 A;  2LY2 A;  3KLO A;  3FXU A;  5F0C A;  4EJV A;  1R7J A;  2PMH A;  2A61 A;  4MFD A;  2UV1 A;  3PUF A;  2B0L A;  2CW0 F;  4DIQ A;  4IL6 C;  1X3W B;  1YW8 A;  3G71 I;  1D3Y A;  3G3Z A;  3B81 A;  2JK3 A;  5F1R A;  4G8X A;  2B63 J;  3OR1 C;  2XDN A;  1QHH D;  2JRM A;  1ETV A;  3WTV C;  2GXB A;  4UVC A;  3DTK A;  3FMS A;  3E5X A;  2KIU A;  4AUX A;  1WQ2 A;  4RLQ A;  1T56 A;  1ZR2 A;  3H36 A;  5CVI A;  3Q0W A;  3KEY A;  4BQN A;  1FP2 A;  1IRZ A;  2F5D A;  1V54 H;  2ZKZ A;  4I2O A;  4PGH A;  3JRF A;  5ILU A;  1BL0 A;  1OYI A;  3D5R C;  4HG2 A;  3RJP A;  2CV1 A;  3SXY A;  3KNW A;  3E6M A;  3ZQC A;  1FIA A;  1WGX A;  5IY5 H;  5GAD J;  2UZK A;  1MBK A;  2CFO A;  1DGW Y;  1F9N A;  2DMQ A;  1O7F A;  2FQ3 A;  3DTI A;  4CCL A;  4XLP F;  4FTH A;  4FX4 A;  3RD3 A;  1WRJ A;  1E3H A;  2QBY A;  1Y56 A;  3CCJ I;  2D1H A;  1ZAO A;  4CH7 A;  4NBQ A;  2JSC A;  3OYN A;  5HLG A;  1JJ6 C;  4CCM A;  4ENN A;  3L2C A;  3E6B A;  3F6O A;  2EV0 A;  3PO3 J;  5BQT A;  3S1Q J;  5GTI C;  2WV1 A;  3PNT A;  1OR7 A;  2XPU A;  2GEN A;  2BE5 F;  1GXQ A;  1WVR A;  3BG7 A;  3OYE A;  1MW7 A;  1UG2 A;  4HLY A;  2HOS A;  3BCG A;  2ME6 A;  4ZC3 A;  4N9H A;  2UXH A;  3KCC A;  1LNW A;  4IRH A;  4OMZ A;  3F8C A;  1YI2 I;  3WGH A;  5FLX K;  3ANP A;  1WKM A;  1CF7 B;  2KJC A;  4XLC A;  1SMT A;  3R6S A;  3DKX A;  4A3J J;  5CVR A;  2DT7 B;  1IW7 F;  1XMA A;  4BJ5 C;  2IGM A;  3I5U A;  3M1C A;  3A03 A;  2A68 F;  4EQQ A;  2F5V A;  4D5F A;  4RB1 A;  2XB5 A;  4OIQ F;  1MBH A;  5ICE A;  3K4N A;  1OLT A;  3KYL A;  3RKW A;  2DMN A;  5HDG A;  1SEU A;  3R0A A;  4II2 A;  1AU7 A;  1I6H J;  5FFX A;  1U78 A;  2Q2E B;  3FRQ A;  2EZI A;  1FLI A;  2K40 A;  2M1B A;  1T0F C;  3AG3 H;  4AIJ A;  1PP8 F;  1MSE C;  4F55 A;  3OY9 A;  3K4J A;  5FKN A;  1FJL A;  1P6R A;  2DU9 A;  5LD2 C;  4U88 A;  1WJC A;  1LEB A;  4HEA 2;  4L5I A;  2HQR A;  2KZV A;  3TOA A;  1BI0 A;  1H8A C;  2VUM J;  1BA5 A;  5KAF C;  2XF7 A;  4PXI A;  2CQ7 A;  4DVY P;  3JRB A;  2DYS H;  3IAS 2;  3QPH A;  3WGG A;  1HC8 A;  3C07 A;  3DF8 A;  3BJB A;  2E1N A;  3A4C A;  4MLO A;  3HC7 A;  3MD2 A;  2LG4 A;  3BCB A;  2AXL A;  4L9N A;  1LVA A;  2BEO A;  2H6C A;  2P4W A;  2HZD A;  2XAF A;  4CGR A;  4U7B A;  4Y7N J;  3LQR A;  2ZJP F;  4M6Y A;  1R00 A;  5CXI A;  2GZW A;  3KE2 A;  5BS6 A;  2VOD A;  4MNU A;  2X6W A;  3GZ6 A;  4Z2Y A;  1IDZ A;  3PQK A;  2EFN A;  3TBI A;  2MAB A;  1FT9 A;  4IEJ A;  2DXI A;  3FZV A;  3ZMS A;  4ABZ A;  2H94 A;  1ULY A;  2ZFU A;  1HDP A;  3P9C A;  2WAD A;  1JT6 A;  2X1D A;  3EYI A;  3EUH C;  2VQC A;  2MW8 A;  3FDY A;  3K0L A;  2NOJ B;  2UWM A;  2D2W A;  5DD4 A;  1Y8R B;  5CXG A;  1V55 H;  3S5R A;  2A3S A;  4BE2 A;  3LSR A;  3RKQ A;  1SAN A;  3ZPL A;  1Z3X A;  2Y69 H;  3M07 A;  1YRN A;  3HDD A;  4BUP A;  4ZDL A;  5KVR A;  1G59 A;  5ICF A;  4MQV A;  5K7H A;  4PSX A;  2QIB A;  3V4G A;  1MZB A;  3RSN A;  2HS5 A;  1YIJ I;  4HSR A;  2ADU A;  5EYR A;  1ZR4 A;  2E60 A;  3G2B A;  4UVA A;  2D1V A;  2FD5 A;  3SYT A;  5FKM A;  5GTH C;  4KIC A;  5FB2 A;  1FOK A;  1I5Z A;  1G3S A;  3CC2 I;  1FY7 A;  1XSD A;  1WH5 A;  4PCQ A;  3E5U A;  4S04 A;  2FSW A;  5E8I A;  3FXQ A;  5HLH A;  2IRF G;  1JUM A;  1ZN2 A;  4BHP A;  1MMD A;  3K9T A;  3S1M J;  4C2M A;  1S29 A;  3D1N I;  2R7W A;  3OYD A;  5EZH A;  4CA0 A;  4H0E A;  1IUY A;  1RKW A;  2DT5 A;  1SFK A;  1J75 A;  1AOY A;  3DTE A;  1TW3 A;  5H2F C;  2BBY A;  4MQ9 F;  4IXA A;  3F8F A;  5D6E A;  1T39 A;  3BTL A;  4PJN A;  4XKB A;  4RB2 C;  1FEX A;  4M73 A;  2QQA A;  3GME A;  5J47 A;  2XRL A;  3SJM A;  4QWQ A;  3IH3 A;  3ABU A;  1XPX A;  3OL3 A;  2R7D A;  2R92 J;  3I4N J;  2RV8 A;  3KIO A;  4FIS A;  5C44 J;  2CYY A;  2LTP A;  1ETY A;  3VUQ A;  3LJL A;  3HHH A;  2KRH A;  3D5L A;  4ESB A;  4GYI A;  4BEH B;  1IGN A;  1MND A;  3F1B A;  9ANT A;  1BI2 A;  2OF7 A;  1SC7 A;  3K8P C;  1A31 A;  1GHC A;  3F8M A;  2YS9 A;  3TW6 A;  1ZEL A;  2EZK A;  2R7Z J;  1YOV B;  4B3A A;  1LDK B;  2EIJ H;  1T95 A;  5E1Z B;  4EVI A;  1FIP A;  2Y0M A;  4LGW A;  2EBI A;  1NH3 A;  5L3C A;  4U7D A;  3SFI A;  2CV0 A;  1MJ9 A;  4DYR A;  4BXU A;  3W6V A;  2O6G E;  2STT A;  3HTJ A;  1T98 A;  2EIM H;  3HB9 A;  1YJN I;  2ELH A;  1VI0 A;  4G94 A;  2G7S A;  1X1D A;  3VOX A;  2UXX A;  3ZGK A;  5D18 A;  3FBN B;  4A3F J;  1XX5 A;  5J3L A;  1RUO A;  3ASO H;  2ZCN A;  2HDW A;  4MEY F;  2DPD A;  2Z33 A;  1EV7 A;  4XN0 A;  4P5O A;  4J01 A;  1ZRD A;  3S2W A;  2GXA A;  1W36 C;  2XGC A;  2JRT A;  2KIS A;  3PSF A;  3DPJ A;  1AWC A;  3T1B A;  2EA2 A;  2MBF A;  1B8I A;  2BY0 A;  2QEX I;  3TKY A;  4PSW A;  2Y30 A;  2IS2 A;  1BW6 A;  1ZGA A;  2X48 A;  3QYB A;  3CES A;  2FNA A;  3ANG A;  3KEO A;  4XM3 A;  5E1X A;  2ZJ2 A;  3GEU A;  4M3D A;  5FHP A;  2VXZ A;  4FAS D;  5FKK A;  1UHM A;  4BGD A;  1STZ A;  3QPL A;  3FXR A;  5DS9 A;  2O0Y A;  2YX4 A;  4GCL A;  2YSR A;  1GUU A;  1E2X A;  5IPA A;  3ZMU A;  4ENK A;  3W2W A;  2QLZ A;  3F8B A;  1IJW C;  4I7H A;  1MNE A;  2VQH A;  1SFO J;  2ZJR F;  3RPU D;  3K4K A;  1H0M A;  3HKZ A;  1BC8 C;  2EPF A;  3K4C A;  3JRI A;  3SZT A;  4BDZ A;  3MNL A;  3KP2 A;  4XQF A;  4KN7 X;  1D5V A;  2M8G X;  2BV6 A;  2OPT A;  3ZQ7 A;  2D5V A;  4IHW A;  3HIM A;  3VDX A;  4A3C J;  1VZ0 A;  2F48 A;  3OYH A;  4DOZ A;  1JJ8 C;  1N25 A;  2R7R A;  4XLE A;  1J59 A;  2OD5 A;  1QVT A;  4OWR B;  1TL8 A;  1UHW A;  2DJI A;  4XBF A;  4HDV A;  5BPI A;  5EEH A;  3DLL F;  4JBA A;  4G6Q A;  4AC6 A;  2KT0 A;  3L9F A;  4X6A J;  1TC3 C;  2KLO A;  1UFM A;  2E7W A;  4A69 C;  5K7F A;  4C9Y A;  3LST A;  2DFF A;  4QTR A;  1D1C A;  3OOU A;  3K2A A;  4CSW A;  1Z6R A;  4RGS A;  3PIP F;  3IWF A;  4M3E A;  4M9Z A;  2HXO A;  5B66 C;  3C7J A;  5H6Q A;  3CCV I;  3SDB A;  3AG1 H;  2Y31 A;  3OOP A;  3UR3 C;  4ESF A;  3RPQ A;  1IRG A;  3FKI J;  1XTA A;  1LEA A;  1ODD A;  3QPS A;  4XLH A;  2GAU A;  4F91 B;  1FYK A;  5EEA A;  3K70 C;  2EIK H;  4XSX F;  3NPI A;  2PX9 A;  3V7S A;  2COB A;  1J2X A;  3AL0 C;  2QKL B;  3VEP A;  2K9S A;  3C18 A;  3GVA A;  1RIO H;  1QZZ A;  4DQ2 A;  2EV6 A;  4DZJ A;  1WZ2 A;  4A0X A;  2LLK A;  3BG6 A;  3FHZ A;  5FRN A;  4KN4 X;  1KZH A;  2M30 A;  2R7O A;  2Z1D A;  2E1M B;  5HVQ C;  2L9R A;  4A6D A;  1T0F A;  1JGS A;  2CUE A;  3KX2 A;  1FZP B;  1VQ9 I;  4ZDO A;  2XDV A;  2M7B A;  1JUS A;  3PFY A;  5FD5 A;  4Q5S F;  2ZXH A;  4D7M A;  1UHS A;  1KA8 A;  1GLN A;  2IXS A;  3K69 A;  1ZLJ A;  4M72 A;  2OQG A;  1HXD A;  3TP0 A;  5LEJ A;  2L0K A;  2AXT C;  3RTR A;  4UXN A;  2DA6 A;  1D8K A;  1LFB A;  1WJE A;  2Z5U A;  3TDZ C;  1YTY A;  4WIB A;  2FA5 A;  5IYD J;  2NVX J;  1R49 A;  1XD7 A;  3ON2 A;  3P7N A;  1TBX A;  1B59 A;  1AHD P;  2WTE A;  2OZU A;  3ERE D;  2P5V A;  2BZT A;  4M6X A;  2OV7 A;  5J1Y A;  5HOD A;  2ETH A;  1OIS A;  4NN1 A;  3FF5 A;  3MKL A;  3M3Y J;  5TGT A;  2LSO A;  3H3Z A;  2DO7 A;  2CV2 A;  2X9D A;  1ENH A;  3F23 A;  2ZNZ A;  3OYK A;  1W36 D;  4DGW B;  3C3W A;  1G8X A;  2ZCM A;  4XOT A;  2IP2 A;  2BXY A;  1OPC A;  1CF7 A;  3QPT A;  5TIS C;  2DG8 A;  3B73 A;  4FE4 A;  5CVJ A;  4B09 A;  2DLL A;  2DTR A;  5F04 A;  3BZ6 A;  3JAM K;  2A6T A;  1VQP I;  4CO8 A;  3HE0 A;  1IV6 A;  2V6C A;  1IG7 A;  2PN6 A;  4PGG A;  3RZD J;  4LG0 B;  5HLT A;  4Y13 A;  4EJO A;  3EUH A;  2HQA A;  4IHV A;  2K9L A;  3QQA A;  3V6G A;  4NB5 A;  4DZP A;  2CQX A;  1YG2 A;  3B6A A;  3J7A Y;  2JZY A;  4J00 A;  1VQ4 I;  2FMY A;  2XGX A;  4IZZ A;  3FK7 A;  4NC6 A;  5K5O A;  1OCO H;  2WC2 A;  3GLX A;  5AON A;  2DMP A;  4FX0 A;  2IW5 A;  5TRD A;  5JR3 A;  2R7Q A;  4XKC A;  3F8N A;  2Q2E A;  3I9V 2;  4XON A;  4A3M J;  2GA1 A;  2IGO A;  1X1A A;  2Q24 A;  1MNM C;  4WCG A;  1X3Z B;  4XNF A;  2DA4 A;  5FRM A;  1K79 A;  4RGR A;  2V1U A;  1O7L A;  2FML A;  2X0L A;  2L7Z A;  3RPU A;  4HST A;  3L7W A;  1SVM A;  3PQJ A;  4U0Y A;  4BQA A;  1NTC A;  1XCB A;  5FLX Z;  5IP7 J;  3H9Q A;  4N4N B;  3OSF A;  3EUK L;  1WPK A;  3RH2 A;  1V5F A;  2L3D A;  4B8X A;  2CGP A;  5EDN A;  2EIL H;  1F4K A;  2K86 A;  2ZBK A;  4JX5 A;  3KET A;  3S15 J;  1BI3 A;  1FBQ A;  2KRF A;  3JSP A;  2XHK A;  1YQA A;  2ME0 A;  1IF1 A;  1T2K A;  2M34 A;  4RMN A;  2XAH A;  2Z2S B;  2LF8 A;  1GXP A;  2WY8 Q;  1XC5 A;  2HVQ A;  3CO7 C;  1D8J A;  3GF2 A;  3TDU C;  5LGU A;  2LDU A;  2V9P A;  4RAG A;  3ECO A;  2UXI A;  2ID6 A;  3K1M A;  3NRV A;  1D5Y A;  1RPW A;  2RGV A;  1GDT A;  4U9L A;  2R5Y B;  2E1C A;  3CRJ A;  2F2E A;  1FSH A;  4XKW A;  3VOD A;  2M0M A;  3CDH A;  3TO9 A;  3K70 D;  1PDN C;  3I3L A;  5IP9 J;  3MZ8 A;  1KGS A;  4HAM A;  1IUF A;  2VQG A;  3ZMZ A;  1SD6 A;  4L9J A;  1UMQ A;  5J1U A;  3EET A;  2LRE A;  5LFA A;  1APL C;  3BR0 A;  4MEX F;  1ORK A;  5JHF A;  1EJ9 A;  5KCM A;  1C0W A;  3WG7 H;  3U1D A;  3DPT A;  3J80 K;  1FP1 D;  1FSE A;  2TDX A;  5IOY A;  4DYC A;  2DA2 A;  2BW3 B;  1WH7 A;  1YW9 A;  2BHY A;  3DU5 A;  5ED4 A;  3DU6 A;  2ZO4 A;  2FOK A;  5IT9 K;  5FRO A;  1HF0 A;  1BR1 A;  3GTM J;  2W85 A;  1S72 I;  3H35 A;  2VJ5 A;  4ETS A;  3V42 A;  3A0B C;  1R1V A;  2QOP A;  4HX4 A;  3WTW C;  1R22 A;  3TQN A;  2LY1 A;  2HQ5 A;  4Y4R A;  3ELK A;  4NHJ A;  3QOE A;  5H20 A;  1SMY F;  4YZE A;  1DGR M;  4EJU A;  2K9N A;  3FXL A;  3ZMT A;  5F27 A;  1SFU A;  1QPM A;  1XGS A;  3I58 A;  2EJR A;  3I59 A;  3RKY A;  1W0U A;  2EWN A;  1FOW A;  3CMA I;  3HTS B;  3BPX A;  1S7A A;  3DKW A;  2PQ8 A;  1KU9 A;  2DOF A;  2KQR A;  3CF5 F;  4L18 B;  2VT3 A;  4UV9 A;  3RCO A;  1E3P A;  5FJ8 J;  4FQG A;  2DOE A;  2IJL A;  2DQR A;  5BNG A;  1KYZ A;  5FD6 A;  4OAZ A;  1O4X A;  3MKY B;  3FM5 A;  3OL4 A;  2DFE A;  1B1B A;  2FBH A;  1DQU A;  3I64 A;  4LK1 F;  3NS4 A;  3DFG A;  2QSH X;  4FHT A;  2FE3 A;  1O3R A;  1SAX A;  5A2Q K;  2VOP A;  1WI3 A;  4A3E J;  2I5U A;  4DNC A;  2RQP A;  2VT2 A;  2LKX A;  2REK A;  2VN2 A;  5F08 A;  2NAZ A;  4UUS B;  4BEH A;  3JRE A;  1DP7 P;  3DP7 A;  2LD5 A;  3H3V K;  2XGE A;  2QQ8 A;  3OIO A;  2MG4 A;  2GM4 A;  1A6Q A;  1K83 J;  3BJO A;  4BJ6 C;  4N9I A;  3DWL E;  4UB8 C;  5HSZ A;  3RQ4 A;  1ZG5 A;  3M7G A;  1U9O A;  2Y48 A;  2DI3 A;  2VBY A;  3QWL A;  1T33 A;  5M3M J;  3KKD A;  1MD0 A;  4JX4 A;  2CJJ A;  4CXF A;  1OYW A;  1JKO C;  3H9J A;  3LA7 A;  3GTQ J;  1Z91 A;  3LHQ A;  2BY2 A;  2V26 A;  2FJI 1;  2KFD A;  4JK1 X;  5BMZ A;  1PP7 U;  1ZQ3 P;  1UAA A;  1UI5 A;  1J09 A;  4KIT B;  4ZJZ A;  3BR2 A;  3P9K A;  1P7J A;  1LUJ B;  3BDD A;  4RAY A;  1TWF J;  2DFH A;  3GXO A;  2R7X A;  2Z99 A;  2YVH A;  1V3F A;  1PUF A;  2FRH A;  1R71 A;  1Z6T A;  2M0C A;  4I01 A;  3OYG A;  1DU0 A;  3G56 A;  4XRS A;  4KWA A;  3MKW B;  3ZQH A;  1EH8 A;  3M8F A;  3EGQ A;  3NAR A;  2F5F A;  3FIW A;  3I71 A;  5LRR A;  4JL3 A;  4EM2 A;  1BI1 A;  4ESJ A;  1VFC A;  1PVE A;  3GZ5 A;  2V9V A;  2QTQ A;  3LA2 A;  4D9J A;  5CQE A;  4GFK A;  2R3S A;  3O8H A;  1OMI A;  2BXZ A;  3HOY J;  1R1U A;  5C3E J;  1YX5 A;  4ZYD A;  3HYI A;  2QEN A;  3GTO J;  1IZ1 A;  2LKP A;  3V8J A;  4CCJ A;  1MH3 A;  4PK4 A;  2LBF A;  3DLA A;  1LKX A;  1OCR H;  4PJ0 C;  3EPZ A;  5DYM A;  2DOD A;  3G4S I;  4A12 A;  3OS2 A;  2X6O A;  3CCY A;  2NS8 A;  2HOT A;  1YJ9 I;  3KKC A;  4IHS A;  1Y6I A;  4OU0 A;  3WE3 A;  1ERD A;  1GV5 A;  2F5C A;  3PUB A;  2KJB A;  2K9M A;  2AQF A;  4I09 A;  2CQK A;  3H5A A;  3ZMD A;  3PM1 A;  1W1W E;  4IOA F;  3PNY A;  2OBP A;  4NC8 A;  3Q5F A;  3R60 A;  2ZOY A;  1B72 A;  1HKS A;  2FQ4 A;  4OMY A;  3BWG A;  3NQO A;  3KP7 A;  4IPA A;  2KDZ A;  2E1O A;  4UNO A;  3CDI A;  1TWA J;  3CCM I;  2G7H A;  2OCC H;  2RRE A;  1U5T B;  3AQT A;  3BG5 A;  4BL0 B;  4OOI A;  4AYB N;  1OYY A;  3HUG B;  4OIR F;  4AVP A;  3KZZ A;  4BH9 A;  1ZRE A;  2NX4 A;  4E4H A;  4ENJ A;  1HW1 A;  2LOO A;  1W7P B;  4PDK A;  1DUX C;  4DBQ A;  2V4J C;  4L0Z B;  3HKZ N;  3VOK A;  1G3T A;  2R5Z B;  3WTY C;  2LKS A;  3DEW A;  5F6F A;  5DUI A;  1YW7 A;  1W5T A;  2V6E A;  3G7R A;  1X2M A;  1WSU A;  1FYL A;  3I53 A;  2F4I A;  3BTI A;  4JQF A;  3PO2 J;  2IS1 A;  3O60 A;  2HVS A;  1W5C C;  3IKV A;  3OS1 A;  1U0J A;  4KIS A;  2GLO A;  3LWJ A;  5J40 A;  1I3A A;  3CDL A;  4I99 C;  1GT0 C;  3U2R A;  3MZH A;  4WXH A;  1CGP A;  1A04 A;  4PJL A;  1IN6 A;  3JRD A;  2F07 A;  4YG2 F;  5AQC A;  3G1M A;  2IA2 A;  4YII A;  4RAZ A;  2G9W A;  3VSL A;  4PZJ A;  4B4C A;  1KQ0 A;  3M8J A;  3CWR A;  3F72 A;  2FF4 A;  1ZGW A;  4FE7 A;  5D4S A;  5J4Y A;  3G73 A;  3J7A O;  2ID3 A;  4G6D A;  1HBX G;  1I39 A;  2CU7 A;  1T6S A;  2P5K A;  2AHQ A;  4AID A;  4H4K C;  4KDP A;  2L4M A;  4OIP F;  4KMU X;  5F0F A;  3QYE A;  2F4O B;  1QRY A;  3TL4 X;  1D1A A;  2HI3 A;  1NK2 P;  2JWT A;  3DKY A;  1E3O C;  4KT6 A;  5E17 F;  1ZTR A;  3HM5 A;  2XAS A;  4R8H A;  4C3I J;  3PJR A;  2VXD A;  3SEQ A;  1TNS A;  2EFQ A;  3VVY A;  2EA4 A;  2KP6 A;  3MN2 A;  2IVM A;  4GCV A;  4Y33 A;  4A0Z A;  4B3X A;  4U0W A;  3T0Y A;  5FMP A;  3NAU A;  4OIN F;  3QAH A;  3BCA A;  3KP3 A;  1F1Z A;  2BY3 A;  4KYW A;  5E18 F;  4LIV A;  1ZG3 A;  4B43 A;  4EGY A;  4I02 A;  1RNL A;  1R5H A;  2BGC A;  2WWY A;  2ICW G;  3CJN A;  5DCM B;  3JW4 A;  2TCT A;  2D6Y A;  4EAT A;  2W25 A;  3GFM A;  2HOA A;  2LRD A;  1K78 B;  1ITY A;  1POG A;  3MFK A;  3P5J A;  2FEZ A;  3L2Q A;  2HYT A;  2K3F A;  5DUK A;  4F7Z A;  4QLC U;  4ZTJ A;  3RKX A;  2HDD A;  2HGC A;  2HPM A;  1JTY A;  3WHC A;  3DBH B;  2E36 A;  1IO2 A;  4AC0 A;  1WHU A;  2ZXW H;  5LEK A;  1ON2 A;  3HRM A;  3I4P A;  2JVG A;  1U8R A;  2MYS A;  3ASN H;  3LSI A;  5HDN A;  2COM A;  2V1D A;  1Q1V A;  1MJA A;  3N4M A;  1H88 C;  3QU3 A;  4XID A;  3VW0 A;  3BY6 A;  4HX8 A;  4IRV A;  4XLA A;  2LH9 A;  3CTA A;  2I10 A;  1XB4 A;  3DPU A;  4UDS A;  1ZKG A;  1UZC A;  4E7L A;  2WAF A;  2DT6 A;  2OAZ A;  3GLL A;  4P9F A;  4ZYH A;  2GA2 A;  2MFZ A;  2D45 A;  2GOM A;  3QRF F;  3E97 A;  3Q0U A;  3CME I;  1JKQ C;  2QWT A;  4L5E A;  4XL9 A;  5BOX A;  2UXO A;  4MTD A;  2BVM A;  4MFE A;  1VQO I;  2PLY A;  5E8G A;  2O03 A;  5CVU A;  3JSJ A;  1R23 A;  3HRS A;  4XRM A;  3LSP A;  1B9M A;  4MIM A;  2VBZ A;  3VB2 A;  2RN7 A;  5L3E A;  2FBI A;  4XRF A;  1VQ5 I;  3TOB A;  3S8P A;  3JAM Z;  3OYF A;  4AWX B;  2CO5 A;  1IDY A;  1JTX A;  4HOB A;  5CJ9 A;  2MC4 A;  1MDM B;  2FU4 A;  5LHH A;  3DXJ F;  3O2P E;  4WK8 F;  3WU0 A;  1IXS B;  2NNY A;  4KNY A;  2NOG A;  5FFZ A;  2L9N A;  1G4D A;  4EV0 A;  2JPB A;  3FWE A;  2VON A;  5EGO A;  3JRA A;  3CD6 I;  2W1O A;  1MGT A;  4O6J A;  3CCS I;  2MC3 A;  2R5Y A;  2PZ9 A;  1RC9 A;  2NP3 A;  2RQQ A;  3ZOB A;  5EEG A;  1TP4 A;  2R4G A;  3OSG A;  2L4A A;  1EA3 A;  2QGU A;  5ICC A;  1TQI A;  2M2E A;  5B1B H;  3K1N A;  2NRA C;  3HTU A;  5J8F A;  2HYJ A;  1VND A;  1VQL I;  4M6V A;  3J7Z I;  3OWT A;  1QPI A;  4ZH4 F;  5LGN A;  2ZXI A;  1SFE A;  1XSV A;  1RR7 A;  2YR2 A;  1TWH J;  1W0T A;  2Z9O A;  2E71 A;  2PBI A;  5BPD A;  3I55 I;  1Y1V J;  3BZK A;  3OYJ A;  5EFY A;  2CWE A;  3G1O A;  1G6N A;  1P92 A;  1MBG A;  3HHG A;  4G6T B;  5L3F A;  1TLH B;  3H9G A;  1AA7 A;  1KQ9 A;  2O8X A;  5GAG J;  1H89 C;  1EH6 A;  2O8K A;  5GP9 A;  3KEQ A;  5IYB J;  1USS A;  2DA5 A;  3UNG C;  1WFX A;  3WTX C;  2AO9 A;  4EJT A;  4ZTF A;  3M1E A;  4AYB A;  4J19 A;  1BBY A;  2QM3 A;  1IXR C;  3WU1 B;  1T38 A;  4BY7 J;  2G0E A;  1W7P D;  4M9S A;  2K5C A;  3GX4 X;  2E5N A;  2P6S A;  2WV0 A;  4BDY A;  1I3Q J;  4ZZL A;  3CLO A;  1J7K A;  1XGM A;  4A6E A;  2QA4 I;  3T5X A;  2VC0 A;  2E35 A;  2JJ7 A;  1JKP C;  3IRR A;  2LFB A;  4XLF A;  3J80 Z;  2L2O A;  2P6T A;  3Q3S A;  2C6Y A;  2MLK A;  1E0E A;  2L7M P;  2MSY A;  3FK6 A;  1TT5 B;  3IKT A;  3VVZ A;  3CP2 A;  4XN3 A;  3BR3 A;  1PUE E;  1CQT A;  1ETO A;  4IQJ A;  1YS6 A;  5L3B A;  3CC7 I;  1GVD A;  1N75 A;  1ZRC A;  3BG9 A;  4BBR J;  4L5J A;  1I1S A;  1P4X A;  3ECH A;  3ZN1 A;  1TWG J;  1A5J A;  3MCZ A;  3S1R J;  3LNQ A;  2YU9 J;  2AQE A;  4CCK A;  3HOW J;  2X85 A;  2L5Q A;  3UKG A;  4LOC A;  1ZK8 A;  4UUS A;  2EH3 A;  3FXK A;  1X3U A;  2VKV A;  4I0A A;  2HWV A;  1LB2 A;  3BJ6 A;  3T8T A;  2O61 A;  1KU3 A;  3BPV A;  2IU5 A;  2V1N A;  3H5R A;  5EZG A;  1HDD C;  1YFH A;  4X0G A;  2XSJ C;  3BNI A;  1XMX A;  2X6X A;  4RA2 A;  2GIV A;  3GEZ A;  4DYQ A;  4AM3 A;  4Q4Z F;  4G9Y A;  3NEU A;  3ML6 A;  3E7L A;  3X2Q H;  3I4M J;  5KHD A;  1BJZ A;  2IT0 A;  2F6C A;  5D5V B;  2ZY9 A;  1QZY A;  4I0B A;  4CYC B;  1B9N A;  1V5G A;  3LAJ A;  4RDU A;  3LOC A;  2PJR B;  2WGB A;  2EFO A;  5CW8 A;  3CCQ I;  1WJD A;  4LD5 A;  2VB6 A;  4M71 A;  2J5P A;  1OCC H;  3HRT A;  5E79 C;  5A2Q Z;  4BKX A;  2HEO A;  2JQ7 A;  3CC4 I;  1V5E A;  2WB1 N;  1SD4 A;  1R1T A;  1FNN A;  3EUA A;  4HNV A;  5JHU A;  5DAJ A;  1REP C;  3KZ9 A;  2KIM A;  2OZ6 A;  2W4S A;  1GV2 A;  2QF7 A;  3C1D A;  4HF2 A;  3I54 A;  2DDB A;  1VQM I;  2FBK A;  3KFW X;  3AG4 H;  3JTG A;  3DV8 A;  1YYV A;  2L54 A;  3ZN0 A;  3LMM A;  4C3J J;  1LE8 B;  2WA0 A;  3BR6 A;  1TT0 A;  4XOR A;  1BIA A;  2VBX A;  4XSZ F;  1S5L C;  1DPU A;  2PJP A;  4IJA A;  1RKT A;  4GO1 A;  2EFW A;  4LJZ F;  2VOO A;  2RAE A;  2JPC A;  4ZYG A;  1P7I A;  2ELK A;  1AKH B;  4IHT A;  1ZRF A;  1F36 A;  2LC2 A;  3E3V A;  5E3N A;  4A3G J;  1N78 A;  1S6L A;  3TGN A;  2Y75 A;  4CCO A;  2P7V B;  3QOD A;  4E6K G;  2A6H F;  2KIQ A;  3WTT C;  2M4G A;  3IH4 A;  1Y0N A;  2B1E A;  4BQO A;  1VQ6 I;  1XDS A;  4D0P A;  2ELJ A;  2E5Z A;  1KON A;  1JHH A;  5CKT A;  2OI8 A;  5JLX A;  4W97 A;  5DV5 A;  4ANJ A;  3R4K A;  1IC8 A;  1K61 A;  3U9G A;  2FBQ A;  2ZSH B;  4AU7 A;  2HYG D;  2BOL A;  1MBE A;  3OS0 A;  2DMU A;  3VSK A;  1HQC A;  3MZY A;  1U5T A;  3V8K A;  3J81 K;  1RRJ A;  3L2V A;  3A01 B;  2E1M C;  2XRO A;  2NVU B;  2IEK A;  5E3L A;  2PMU A;  2ZCX A;  5JVG F;  2VAS A;  2VJ4 A;  3PPB A;  4E7J A;  4LLL A;  1Q1H A;  3PSI A;  4GFB A;  2P8T A;  3VOE A;  3ZQF A;  2V57 A;  2R5Z A;  3AG2 H;  1H9G A;  4KIB A;  4D5C A;  3GFJ A;  4A3K J;  2QSG X;  3S2D J;  5D1R A;  3OIP A;  4ACI A;  1NG7 A;  1H9T A;  5HNF A;  3VP5 A;  5KAI C;  2MH9 A;  3CF2 A;  1NHA A;  4WF2 A;  5FKO A;  2NXN B;  3REO A;  3S32 A;  2UXP A;  4A3L J;  1ZG1 A;  2Y0S A;  3LWF A;  3HEF A;  4CCN A;  2DPU A;  2DA1 A;  3O6B B;  5D8K B;  1YHQ I;  1UI6 A;  3WTZ A;  4JOM A;  5FO5 A;  1QHG A;  2G7U A;  3CCE I;  2ESH A;  5DEQ A;  3DEE A;  5HAW A;  5ILV A;  1Z7U A;  1UJ8 A;  4A0Y A;  5GPC A;  3K4B A;  4KA4 A;  5E3O A;  5DTD A;  2YVE A;  4UY8 I;  4UV8 A;  2CH0 A;  1XDU A;  2RC4 A;  2XKP A;  3OMY A;  3CCL I;  1Y0U A;  3MEX A;  3GBG A;  3COA C;  2XAG A;  1LFU P;  5M3F J;  2PMZ N;  2HVR A;  3VTI A;  1RET A;  3RI4 A;  2GWR A;  2DYR H;  2W57 A;  2Q8K A;  1B4A A;  2E2I J;  3F9K A;  3A1Y A;  2L02 A;  4L0Y B;  5D5W B;  1TZL A;  3CQZ J;  3JRC A;  3GWZ A;  3W2V A;  1UB9 A;  1FOX A;  1JGG A;  1WJB A;  5D6F A;  4A5M A;  2PFB A;  1SGM A;  1S8N A;  3LL7 A;  4FET A;  3N97 A;  2K4B A;  3H92 A;  5DDG A;  4GCT A;  5M5X J;  3F22 A;  2ZOZ A;  2K27 A;  1W4M A;  3CUQ B;  4A93 J;  3ON4 A;  5IT3 A;  3FMQ A;  2XSD C;  1ETW A;  2UUZ A;  1WCM J;  1WI9 A;  5DCM A;  2CUZ A;  2H1K A;  1SFX A;  2DN0 A;  5FGL A;  2JUC A;  5FKL A;  2X51 A;  3CMY A;  3BLY A;  1K78 A;  2YPR A;  2XF6 A;  4X1E A;  4HF0 A;  3ABK H;  2YUS A;  4S0H B;  2YU3 A;  4B47 A;  4E7H A;  2R7S A;  4BU2 A;  4HQM A;  2Q1Z B;  1R6R A;  1HW5 A;  2EV5 A;  5DCF A;  3RQI A;  4UUT A;  4F93 B;  2QQB A;  2WAQ N;  4JKZ A;  1RES A;  2ZNY A;  3BP8 A;  1X58 A;  2X1C A;  4LFU A;  3BC8 A;  2JA6 J;  1BM9 A;  2B9S A;  3G6E I;  3QU6 A;  1MBJ A;  1HSJ A;  3DQV C;  3VFZ A;  2CRG A;  5DM6 F;  3O8G A;  4V2G A;  1Z0X A;  3HOT A;  2IAI A;  3V7C A;  3QKX A;  4HPQ A;  4YIR X;  1P2F A;  4A3D J;  3LSK A;  3KYD B;  4ASN A;  1Z67 A;  2JTV A;  1A36 A;  2G7L A;  1Z21 A;  4ICH A;  4A3B J;  1GVJ A;  5HLI A;  3B6C A;  2PEX A;  3R0J A;  2VBW A;  3S16 J;  3WE2 A;  4ITV A;  4A5N A;  4XRS G;  1OQY A;  3MKZ A;  3SHF A;  2L9S A;  5L3G A;  3HXL A;  4F92 B;  3PFI A;  2QYO A;  4ENM A;  2EFP A;  1BN5 A;  1A35 A;  4Q48 A;  4UHT A;  5B3S H;  1T8I A;  1JXS A;  4PJJ A;  2XRN A;  3HPH A;  4OD4 A;  4CZZ A;  4O5V A;  4DBR A;  2XGD A;  2WB1 A;  1X19 A;  4HNU A;  2ISZ A;  2QCO A;  3SZP A;  4BHC A;  2M45 A;  2JSP A;  3CUQ C;  2P0W A;  1VQK I;  4GGG A;  3ABT A;  3ONQ A;  3JRH A;  3F3X A;  4LLG F;  1MSF C;  1FYM A;  2XF5 A;  4PFP A;  4RBO A;  4E7S A;  2E2H J;  2H1L A;  4HLX A;  1QO0 D;  1R9T J;  3IC7 A;  2HR3 A;  3LFK A;  5D19 A;  2LYC A;  3HOS A;  1IXC A;  4BE1 A;  2W24 A;  5GAE J;  3RIR A;  2XPW A;  1LPQ A;  1HKT A;  3HSF A;  2FNP A;  4EM0 B;  1FX7 A;  1KU7 A;  3CO6 C;  1U9N A;  2JA8 J;  2L7F P;  1YX3 A;  1FBU A;  3NRG A;  2M7A A;  3U1K A;  4RM3 A;  2WAE A;  3BOQ A;  2DW4 A;  4R79 A;  4S05 A;  5CQG A;  5D8L B;  3ZRG A;  2W00 A;  2E34 A;  4IX7 A;  4IHX A;  4NNJ A;  3BTJ A;  1K4S A;  1JT0 A;  4KIF A;  2VE8 A;  2DFI A;  2DOA A;  1O57 A;  1Z1D A;  4RB3 C;  4MGR A;  4E7I A;  1OCT C;  2VI6 A;  2BY1 A;  4LB6 B;  1UEL B;  2WUI A;  2HDC A;  2HPI A;  3HL2 A;  3PL8 A;  4CUG A;  1KYW A;  3A0H C;  4DJA A;  4PFO A;  3C2G A;  4AVZ A;  2HKO A;  4U0V A;  4BBS J;  4JP0 A;  4YFX F;  1QVU A;  3CCR I;  4BNC A;  1XGO A;  2V79 A;  1U3E M;  5GPA A;  3OYL A;  1P4A A;  3GTP J;  5CPR B;  4E7Z A;  3IAM 2;  3TP3 A;  2Y2Z A;  2DDA A;  1FTT A;  3W3C A;  4FT8 A;  2VJJ A;  4KUM A;  1NG6 A;  4GDF A;  4CYD A;  2KIF A;  2OTL I;  3GTG J;  2LR8 A;  2OCE A;  1J5Y A;  1G2H A;  3BHQ A;  1TQM A;  3Q9S A;  5K5Q A;  1FC3 A;  2KRC A;  2CS3 A;  2KHM A;  2LVS A;  2OU2 A;  2NNN A;  1FTZ A;  3SWH A;  2DK8 A;  2LNB A;  3KP6 A;  4TV7 A;  3H0D A;  4G7O F;  5EG0 B;  3JSO A;  1JI8 A;  2UXU A;  1X1P A;  1S3J A;  2M8E A;  3FXJ A;  1S7O A;  3ABM H;  1LDJ A;  2CUJ A;  4C3H J;  4AF5 A;  1FOY A;  2K7L A;  1W5S A;  5H9T A;  3AFH A;  2F5E A;  4KJZ A;  1F5T A;  3DBR B;  5TJJ A;  1I1G A;  3OIQ A;  2STW A;  2R7T A;  4M3F A;  2PFV A;  4BY1 J;  1HA8 A;  3AQS A;  2JA2 A;  5C4X J;  2WBM A;  4NQW B;  3ZMV A;  3PAS A;  4BAC A;  3QBM A;  2WY7 Q;  5HDK A;  3BG3 A;  3OR2 C;  5LRS A;  3WGI A;  1N77 A;  2KDO A;  4P9U A;  3OYC A;  1IAW A;  4YEL A;  2KZG A;  2XKO A;  2JUG A;  2PMZ A;  2IA0 A;  2K4J A;  2P5L C;  3E0J B;  3EDP A;  1VQ8 I;  3GZN B;  1X1B A;  3VWB A;  4A2U A;  4AD9 A;  2JT1 A;  3COL A;  3ESW B;  1IN7 A;  2EK5 A;  4O3M A;  3CJR B;  2DA3 A;  5E20 A;  4E7K A;  2M3A A;  3DEU A;  4WXD A;  3M8E A;  4C2M J;  2XVC A;  1K4T A;  4CYC A;  2PJR A;  3P9I A;  3MVP A;  3U21 A;  3WTU C;  2IPQ X;  1ETQ A;  3DBL B;  4P55 A;  3GTJ J;  4NDL A;  1X4O A;  3W2A A;  3FM3 A;  2XUB A;  5LGT A;  5FLV A;  3S3O A;  2VIX A;  2K9Q A;  2R93 J;  4OD5 A;  2A69 F;  3IP4 B;  2RNJ A;  3BZC A;  1R5G A;  1S9H A;  5J1R A;  2VPR A;  2EZH A;  2K02 A;  3VPR A;  3KP5 A;  3TO6 A;  4JNN A;  1LE8 A;  3WHB A;  4D7N A;  4GCK A;  1ZGJ A;  1U5T C;  4V19 K;  2HOE A;  2NYX A;  3K10 A;  2GUH A;  3DCF A;  2WAQ A;  3SZG A;  5IP6 A;  3HG9 A;  3QOP A;  5DD8 A;  2CUF A;  4HNT A;  1AKH A;  1Z7L A;  4NC7 A;  2VLA A;  3QYF A;  4YFN F;  3QP6 A;  3GUD A;  4W1U A;  3JTH A;  4YEJ A;  5LHG A;  3IV5 A;  2CW7 A;  3L00 A;  5ILS A;  2W48 A;  2CG4 A;  1G3Y A;  2BVL A;  3J7Y J;  1U8B A;  2E2J J;  3K4L A;  5HS8 A;  3TO7 A;  1ACI A;  1OCZ H;  1YIT I;  2R7F A;  4F3Q A;  1PJR A;  4HKU A;  3L2U A;  1Z05 A;  3LSG A;  4N0B A;  4K2E A;  4P1W A;  4LG0 A;  3GW2 A;  3CJQ B;  1DU6 A;  3WU2 C;  3Q0V A;  3F0C A;  3HIF A;  3OYI A;  4E70 A;  3GFL A;  4G12 A;  2EIN H;  1XN7 A;  2ISY A;  3IHU A;  1QQI A;  2DG7 A;  2H6B A;  2RDP A;  1FMW A;  3ZQG A;  1MBF A;  1ZYR F;  1K6Y A;  2CQN A;  2OA4 A;  2ZME B;  3FMR A;  3NXC A;  2LK2 A;  2GOX B;  2X6Y A;  4N4O B;  3A01 A;  1EH7 A;  1BW5 A;  3V8L A;  4ZYA A;  2MD0 A;  3KZI C;  1U6G A;  4HDU A;  2O5R A;  5LHI A;  3P9T A;  3R61 A;  4RM2 A;  1MMS A;  3VYU B;  1XCV A;  3K7A J;  4BXX J;  3I59 B;  1IRF A;  1QBJ A;  2VC1 A;  4AIH A;  1SD7 A;  1I50 J;  4JYK A;  3KYC B;  3HOV J;  2MLG A;  1R4M B;  1SVO A;  2CFX A;  4C2U A;  1J0R A;  4YIF A;  2MA3 A;  3HOZ J;  2KPM A;  4ZDP A;  5HS9 A;  4IHY A;  3SQN A;  4BHB A;  4KT5 C;  1B6A A;  4QPO A;  2YVX A;  4GFL A;  2HNH A;  3E6D A;  3FKJ A;  3MWM A;  4R1H A;  2FJ1 A;  2ECB A;  4WWC A;  3S93 A;  3S14 J;  1WJ5 A;  3BQY A;  4XLN F;  4UVB A;  3H5N A;  3H0G J;  2R7U A;  2ZB9 A;  2W84 A;  1UCR A;  4MO7 A;  2H27 A;  4U87 A;  2O3F A;  1Y8Q B;  3E7Q A;  4HV5 A;  3ISP A;  1BOA A;  1SD5 A;  2DJN A;  2HQN A;  5EF6 A;  3J81 Z;  4XOP A;  1L3L A;  2NS0 A;  3WOD F;  4QIW N;  5IOZ A;  1YLF A;  2H09 A;  4PUS A;  1K7A A;  1D0Z A;  1HST A;  4RLF A;  4EJW A;  1MH4 A;  3OV8 A;  1XG1 A;  1BC7 C;  1HCR A;  4RGU A;  2IGN A;  4JX6 A;  2RAS A;  4Y52 J;  2R7V A;  2OJE D;  2Y0S N;  1UST A;  2FX0 A;  3VW1 A;  3MAJ A;  3I0T A;  1UG0 A;  5HBU A;  1ZLK A;  1SAU A;  6PAX A;  2A2F X;  2V7F A;  4OIO F;  1MMA A;  3CJT B;  1IRX A;  2ZME C;  3FXO A;  2V1X A;  2R0Q C;  3CUO A;  1ETX A;  2XAU A;  3BTC A;  2BW3 A;  1Z9C A;  1LDD A;  2OER A;  3K2Z A;  2RVC A;  3HOU J;  1ZH5 A;  2O7T A;  2Z3Y A;  3T6N A;  2W53 A;  2ZSI B;  3CUQ A;  4IKF A;  5LBQ A;  2AS5 F;  1FBS A;  1DDN A;  4ZYE A;  2KKO A;  3SFZ A;  3IH2 A;  1PUF B;  3H3U A;  3VW2 A;  4LLN A;  1ONV A;  2MD5 A;  5M5Y J;  1VQN I;  4G7H F;  1TWC J;  4C2T A;  3GFI A;  1ZAR A;  1JHF A;  2Q0O A;  2QBY B;  3E5Q A;  3SEZ A;  2I8D A;  1WWX A;  5J4V A;  2B7E A;  3EQL F;  4MXM A;  4HA8 A;  4BE0 A;  2QZ8 A;  3VYT B;  1MKM A;  1RZ4 A;  3I56 I;  3ZQQ A;  3S3N A;  1D0X A;  2A6E F;  4RAF A;  4G7Z F;  5HNH A;  4MK6 A;  2L9V A;  4F52 A;  2W82 A;  4DW6 A;  1QNT A;  3CLQ A;  2F4M B;  3M4O J;  2EZL A;  2A5Y B;  3ERM A;  4L9V A;  3AL0 B;  2LBF B;  3BRU A;  3GYH X;  4AIK A;  1IN4 A;  5IT9 Z;  2A05 A;  3V78 A;  2DK5 A;  5K1Y A;  1YO5 C;  1T08 B;  1BJA A;  3K1P A;  5D5X B;  3ULQ B;  3IL2 A;  1O3Q A;  2QKO A;  1FWZ A;  1O3S A;  3HTA A;  1Z3Y A;  1U2W A;  3ROU A;  1R5I D;  5JLW A;  4II3 A;  4QPQ A;  3HOX J;  1E17 A;  2XC7 A;  2TRT A;  4WX9 A;  3HTH A;  5D5U B;  1B72 B;  2OTJ I;  1TNT A;  2JVH A;  3C2H A;  5EJC A;  4UUV A;  4QSH A;  4BS9 A;  1EKE A;  2FXA A;  4B48 A;  5CYV A;  3HPG A;  2Y9Y A;  3BT9 A;  4I76 A;  3B02 A;  2QQ9 A;  2CMP A;  2QUF A;  2LF7 A;  3CJD A;  2ESN A;  4RB0 A;  4LMY A;  2L7K A;  3W6K B;  3BR5 A;  4Y3O A;  5KK1 A;  3S3M A;  3L09 A;  5C4J J;  2OC6 A;  1BOB A;  3LA3 A;  4I98 B;  1A6I A;  2IBD A;  3K4M A;  2FOW A;  4Y15 A;  1ON1 A;  2ZCW A;  4GXO A;  2LY9 A;  2G3B A;  1TQP A;  1FMV A;  2IA1 A;  3IWZ A;  4HW0 A;  5E1W A;  3QP5 A;  4M9X A;  2HZT A;  3RYR A;  3NNR A;  2GXG A;  2ZFW A;  1WJF A;  2EQR A;  2FUG 2;  5F1J A;  2X4H A;  3L2R A;  4IOC F;  2DBB A;  1F43 A;  3HZJ A;  1D0Y A;  4HQE A;  2M5W A;  3FHN A;  1M1E B;  5H6R A;  2XB0 X;  1XSX A;  2HYF A;  1IN8 A;  3ZQI A;  3ABL H;  3ZR8 X;  5JI6 A;  3ZQL A;  2GFN A;  1V4R A;  4EMS A;  1OR7 C;  3TMO A;  4IRI A;  1MJB A;  2JMW A;  5D4R A;  1RUN A;  2MH2 A;  4RS8 A;  1FPQ A;  3C2B A;  2IS4 A;  1HLV A;  4L9T A;  3HJE A;  4MTE A;  2OQR A;  1HOM A;  4FCY A;  1QU3 A;  4NUB A;  4XIC A;  2QWW A;  4LK0 F;  1R36 A;  3AAF A;  4CDG A;  3HRU A;  4KIG A;  3KZY A;  3O3K A;  3BR1 A;  2DTZ A;  2JA5 J;  5J6X A;  5CVV A;  5IYC J;  4KMF A;  4HF1 A;  3LQQ A;  4ON0 A;  5JVT A;  2HTS A;  1YRN B;  1HW2 A;  4M3B A;  2IGK A;  2XAJ A;  1KU2 A;  5AIP A;  2P7C B;  2O7O A;  5F64 A;  1NK3 P;  3LAP A;  1RI7 A;  2ZJQ F;  3Q9V A;  2B3W A;  2Z16 A;  4XKV A;  4B1R A;  2ACJ A;  5KNL A;  3EYY A;  4ZZD A;  5E3M A;  5EG0 A;  1OFC X;  4IO9 F;  3WTS C;  1MMN A;  1XGN A;  1VF9 A;  3FXM A;  3IRQ A;  2M87 A;  3CP8 A;  2VL8 A;  5K58 A;  4CHU A;  1OKR A;  2J5O A;  3A02 A;  3KPH A;  4LIT A;  2ZC2 A;  4CZC A;  3LSH A;  1MMG A;  3HUG A;  3ZP5 A;  2PG4 A;  2NP5 A;  3BRO A;  1X2N A;  3K6G A;  2CSO A;  3V7R A;  2K85 A;  3W6J B;  3NWT A;  1MIJ A;  4BAY A;  2W7N A;  4A3I J;  1W7P A;  3NI7 A;  1EF4 A;  2E19 A;  3SDG A;  4HYE A;  1P9Q C;  4NQW A;  3L1P A;  1LFP A;  2H8W A;  5F0H A;  5HOO A;  4YRV A;  3JCU C;  5FGM A;  2MGQ A;  3HSE A;  3ZXS A;  1Y1W J;  1JKR C;  2IS6 A;  1XMK A;  2BHZ A;  2KL4 A;  1J9I A;  4M74 A;  3WG9 A;  1G3W A;  4IVN A;  2HFH A;  1XS9 A;  4I6Z A;  2M4K A;  2NVY J;  1BR2 A;  4OAY A;  4BXF A;  3VVX A;  5GAH J;  3S17 J;  2Y9Z A;  3HGY A;  1OCP A;  1K6O A;  2PBX A;  2H8R A;  2CQQ A;  2GQQ A;  4XMY A;  2QSF X;  2VKH A;  3ZCO A;  5K5R A;  1RR8 C;  4B44 A;  2G7G A;  4EM1 A;  4Z6Y A;  4GYG A;  2QVO A;  3G1L A;  4IF4 A;  4BQQ A;  5ICG A;  1QA6 A;  1ETK A;  1TTY A;  1JUP A;  1S7E A;  2GBY A;  2M9H A;  2K3P A;  2VKE A;  1JE8 A;  2A07 F;  3GTL J;  1QZE A;  2P81 A;  1D1B A;  1KQ8 A;  4XK4 A;  4IRG A;  1OJL A;  4LIU A;  3HBL A;  3D0S A;  3S1N J;  4PJM A;  1L0O C;  1Z77 A;  3TW7 A;  4L62 A;  2VE9 A;  5CLS A;  4RGX A;  4KFC A;  2KMU A;  2DAO A;  2ZXJ A;  2RHA A;  3F6V A;  1YIO A;  2RKH A;  3LSM A;  2NVT J;  2OUM A;  2X1E A;  1Y39 A;  5EGO B;  2XIG A;  3LFU A;  4MHG A;  4V2F A;  3GZI A;  5L3D A;  5FLM J;  4GRI A;  2DQL A;  2UXN A;  3GTK J;  1X4P A;  4EEF G;  4M3G A;  4C30 A;  3HGG A;  2DA7 A;  4EGZ A;  3DPL C;  3KLN A;  4ME9 A;  2BYV E;  1YE9 A;  3T8R A;  3FIS A;  5B5E C;  1YS7 A;  2LP0 A;  5JFR A;  3AKZ A;  4CIC A;  4P96 A;  2HTJ A;  5LLQ A;  4HX7 A;  2VQL A;  2JA7 J;  2HKU A;  2HXI A;  3RDI A;  1I6X A;  2PI0 A;  5DM7 F;  3HSR A;  2DCE A;  3IUO A;  3HTI A;  3OYM A;  3N05 A;  3MMY B;  2N8G A;  2CW8 A;  1TW2 A;  3H1C A;  3IUV A;  2HU9 A;  3KP4 A;  1BR4 A;  4NEL A;  1DPR A;  3OYB A;  1LVK A;  3JR9 A;  1B8I B;  5ERI A;  2L01 A;  2VJI A;  4HZF A;  4HBL A;  3VYR B;  4Q47 A;  3E1S A;  3RZO J;  5C4Y A;  3E6C C;  1I27 A;  3D5S C;  4WXC A;  3EUP A;  1P4W A;  2NS7 A;  3RYP A;  2ZME A;  1WJA A;  3F21 A;  2XV4 S;  3FBI B;  3PNV A;  1DP3 A;  3MQ0 A;  4CGZ A;  3BQZ A;  1LJ9 A;  2NVQ J;  3VYS B;  1QGP A;  2V9K A;  5K7Z A;  5AIQ A;  1SVL A;  4Y17 A;  2XPV A;  4U9N A;  1LQ1 A;  3M9A A;  2E7X A;  2YX7 A;  3GCM A;  5HS7 A;  2JN6 A;  3CMM A;  1IN5 A;  2EB7 A;  2RNG A;  2A5W A;  1PYV A;  1ZHF A;  1BIB A;  1VTN C;  4LB5 A;  2DMT A;  3OYA A;  2HKX A;  4BYY A;  1X1C A;  4D1Q A;  1O3T A;  2ECC A;  3VIB A;  3TED A;  5M5W J;  3A2K A;  3CCU I;  1YJW I;  2VPL A;  2QKM B;  2O9L A;  1MDM A;  4BJT A;  2LMD A;  3PIO F;  3GO5 A;  1R4N B;  4YFK F;  1VQ7 I;  4HV6 A;  3LSJ A;  4HRI A;  3S2H J;  4LG3 A;  3CZ6 A;  5B1A H;  5J8C A;  3NWS A;  1R58 A;  4UB6 C; 
#chains in the Genus database with same CATH homology
 4IHV A;  3QQA A;  2K9Q A;  1H89 C;  3V6G A;  4DZP A;  2R93 J;  2CQX A;  3JRG A;  3B6A A;  2O8K A;  5GP9 A;  5J1R A;  2VPR A;  5IYB J;  2DA5 A;  2EZH A;  3VPR A;  3FK7 A;  2AO9 A;  4JNN A;  5F0C A;  1LE8 A;  3WHB A;  4D7N A;  4GCK A;  4J19 A;  2DMP A;  4MFD A;  4BY7 J;  2G0E A;  2GUH A;  4A3M J;  3DCF A;  3B81 A;  1I3Q J;  2JK3 A;  2Q24 A;  1MNM C;  5IP6 A;  2B63 J;  2DA4 A;  2XDN A;  2CUF A;  1ETV A;  2L7Z A;  2JJ7 A;  1JKP C;  1AKH A;  2LFB A;  1NTC A;  4W1U A;  5IP7 J;  3Q3S A;  3IV5 A;  2W48 A;  3OSF A;  1U8B A;  2E2J J;  1WPK A;  2L7M P;  3RH2 A;  4AUX A;  2MSY A;  3FK6 A;  1T56 A;  5EDN A;  1ZR2 A;  3VVZ A;  3Q0W A;  3BR3 A;  1IRZ A;  1CQT A;  1ETO A;  3JRF A;  4HKU A;  3LSG A;  1BL0 A;  4JX5 A;  1DU6 A;  3S15 J;  3KNW A;  1GVD A;  3F0C A;  3Q0V A;  3ZQC A;  1FIA A;  3BG9 A;  1WGX A;  4BBR J;  2ME0 A;  2M34 A;  4G12 A;  2DG7 A;  1TWG J;  1A5J A;  1XC5 A;  3S1R J;  3LNQ A;  1MBK A;  2YU9 J;  3ZQG A;  3HOW J;  1MBF A;  3UKG A;  2UXI A;  4LOC A;  1ZK8 A;  2DMQ A;  4UUS A;  2ID6 A;  1D5Y A;  3NXC A;  2EH3 A;  2LK2 A;  4FTH A;  1RPW A;  3A01 A;  1GDT A;  3RD3 A;  2R5Y B;  1BW5 A;  3CRJ A;  2VKV A;  3P9T A;  1JJ6 C;  5IP9 J;  2IU5 A;  1IUF A;  3PO3 J;  5EZG A;  1HDD C;  3K7A J;  3S1Q J;  4BXX J;  2WV1 A;  2XPU A;  1UMQ A;  5J1U A;  2GEN A;  3BNI A;  1I50 J;  4JYK A;  1APL C;  3BR0 A;  4DYQ A;  3HOV J;  1UG2 A;  3E7L A;  1ORK A;  2HOS A;  3I4M J;  3BCG A;  1BJZ A;  2ME6 A;  3HOZ J;  2UXH A;  4IHY A;  3ANP A;  5IOY A;  4DYC A;  4CYC B;  4RDU A;  2DA2 A;  3LOC A;  4GFL A;  2WGB A;  5CW8 A;  1WH7 A;  2FJ1 A;  4BKX A;  1HF0 A;  2ECB A;  4A3J J;  3S14 J;  2WB1 N;  3GTM J;  3BQY A;  4HNV A;  5DAJ A;  3KZ9 A;  3H0G J;  2ZB9 A;  3A03 A;  4MO7 A;  1GV2 A;  2QF7 A;  4D5F A;  3E7Q A;  2XB5 A;  5EF6 A;  2DJN A;  2QOP A;  1MBH A;  2DMN A;  4QIW N;  5IOZ A;  2HQ5 A;  4C3J J;  1LE8 B;  3BR6 A;  1AU7 A;  1I6H J;  4YZE A;  1MH4 A;  1XG1 A;  1U78 A;  2K9N A;  1HCR A;  3FRQ A;  2EZI A;  5F27 A;  2K40 A;  1RKT A;  4JX6 A;  2RAS A;  4Y52 J;  2RAE A;  1W0U A;  1MSE C;  2Y0S N;  2FX0 A;  3VW1 A;  5FKN A;  1FJL A;  1P7I A;  2ELK A;  5HBU A;  1AKH B;  1F36 A;  5E3N A;  4A3G J;  5FJ8 J;  5BNG A;  2R0Q C;  1O4X A;  1ETX A;  4PXI A;  1H8A C;  2VUM J;  1BA5 A;  3BTC A;  3JRB A;  2OER A;  3IH4 A;  3C07 A;  3HOU J;  3BJB A;  2O7T A;  3T6N A;  2W53 A;  4MLO A;  2OI8 A;  5JLX A;  4W97 A;  1WI3 A;  1IC8 A;  4CGR A;  3IH2 A;  1K61 A;  4Y7N J;  4A3E J;  1PUF B;  3VW2 A;  2LKX A;  2FBQ A;  5CXI A;  1MBE A;  2REK A;  5M5Y J;  5F08 A;  2DMU A;  4UUS B;  1IDZ A;  3JRE A;  1TWC J;  3H3V K;  2LD5 A;  4IEJ A;  3A01 B;  2XGE A;  3OIO A;  2MG4 A;  2GM4 A;  4ABZ A;  2IEK A;  5E3L A;  2ZCX A;  1K83 J;  1HDP A;  3PPB A;  4MXM A;  1JT6 A;  5HSZ A;  4GFB A;  3ZQF A;  2MW8 A;  4MK6 A;  2V57 A;  2R5Z A;  1U9O A;  5CXG A;  4DW6 A;  4D5C A;  3M4O J;  1T33 A;  3S5R A;  5M3M J;  4A3K J;  2EZL A;  3S2D J;  3KKD A;  5D1R A;  4JX4 A;  2CJJ A;  3LSR A;  3RKQ A;  1SAN A;  4ACI A;  1JKO C;  3GTQ J;  3BRU A;  3LHQ A;  3VP5 A;  1YRN A;  5FKO A;  3HDD A;  1ZQ3 P;  2UXP A;  1UI5 A;  3V78 A;  4A3L J;  3BR2 A;  5K7H A;  1P7J A;  2QIB A;  3HEF A;  1TWF J;  2DA1 A;  2YVH A;  2QKO A;  1PUF A;  3HTA A;  5EYR A;  2M0C A;  3G56 A;  5JLW A;  1ZR4 A;  1DU0 A;  4XRS A;  3HOX J;  1UI6 A;  3ZQH A;  2TRT A;  5HAW A;  3EGQ A;  5GPC A;  3NAR A;  3HTH A;  1B72 B;  3FIW A;  4KWA A;  5E3O A;  5DTD A;  2YVE A;  2FD5 A;  4QSH A;  4JL3 A;  1VFC A;  5FKM A;  2Y9Y A;  2QTQ A;  3BT9 A;  4I76 A;  4GFK A;  3O8H A;  3HOY J;  1LFU P;  3GBG A;  5C3E J;  3CJD A;  1WH5 A;  5M3F J;  2PMZ N;  1RET A;  3BR5 A;  3GTO J;  1JUM A;  5C4J J;  2E2I J;  1A6I A;  3S1M J;  2IBD A;  1MH3 A;  3D1N I;  5EZH A;  3CQZ J;  3JRC A;  2LY9 A;  2G3B A;  1JGG A;  1RKW A;  1SGM A;  2X6O A;  3NNR A;  3CCY A;  2NS8 A;  5F1J A;  2EQR A;  2HOT A;  3KKC A;  3BTL A;  1F43 A;  4GCT A;  5M5X J;  2ZOZ A;  1GV5 A;  2XB0 X;  1FEX A;  4A93 J;  3ON4 A;  3ZQI A;  2XRL A;  3SJM A;  3ZQL A;  2GFN A;  3IH3 A;  2XSD C;  1ETW A;  1WCM J;  3PM1 A;  2JMW A;  2H1K A;  2R92 J;  2DN0 A;  3I4N J;  5FKL A;  5FGL A;  2ZOY A;  4FIS A;  1B72 A;  5C44 J;  3C2B A;  3CMY A;  1HLV A;  2FQ4 A;  2LTP A;  1ETY A;  3VUQ A;  2KDZ A;  4X1E A;  3LJL A;  2E1O A;  1HOM A;  2YUS A;  4FCY A;  1TWA J;  1IGN A;  4S0H B;  3F1B A;  3AQT A;  9ANT A;  3BG5 A;  4XIC A;  4AYB N;  2OF7 A;  3RQI A;  4UUT A;  2NX4 A;  2YS9 A;  3BR1 A;  3TW6 A;  2WAQ N;  4JKZ A;  1RES A;  1X58 A;  2DTZ A;  2EZK A;  3HKZ N;  2JA5 J;  3VOK A;  2JA6 J;  2R7Z J;  4B3A A;  1MBJ A;  5IYC J;  2R5Z B;  2CRG A;  3DEW A;  3O8G A;  4V2G A;  1Z0X A;  2IAI A;  3G7R A;  3QKX A;  1FIP A;  1X2M A;  4A3D J;  2EBI A;  3BTI A;  3PO2 J;  1YRN B;  3O60 A;  3SFI A;  2G7L A;  4DYR A;  4M3B A;  3W6V A;  2GLO A;  3HTJ A;  4A3B J;  3LWJ A;  4ICH A;  3HB9 A;  1GT0 C;  3CDL A;  1VI0 A;  2O7O A;  3B6C A;  2G7S A;  1NK3 P;  3VOX A;  3S16 J;  5D18 A;  3JRD A;  2F07 A;  5AQC A;  4XRS G;  3G1M A;  4A3F J;  5J3L A;  4B1R A;  2ZCN A;  5E3M A;  5EG0 A;  1OFC X;  4B4C A;  1VF9 A;  3CWR A;  5K58 A;  2XGC A;  1ZGW A;  4FE7 A;  3A02 A;  3DPJ A;  2ID3 A;  2XGD A;  2CU7 A;  1B8I A;  2NP5 A;  1X2N A;  2AHQ A;  2QCO A;  4A3I J;  3NI7 A;  2Y30 A;  1EF4 A;  1BW6 A;  2E19 A;  2X48 A;  3SDG A;  5F0F A;  3JRH A;  3ANG A;  1QRY A;  1MSF C;  3GEU A;  3L1P A;  4M3D A;  5FHP A;  5F0H A;  1NK2 P;  2HI3 A;  5FKK A;  4RBO A;  2JWT A;  2E2H J;  1E3O C;  2MGQ A;  3QPL A;  1ZTR A;  1Y1W J;  5DS9 A;  1JKR C;  3HM5 A;  1R9T J;  4C3I J;  4GCL A;  5D19 A;  3VVY A;  1GUU A;  5IPA A;  3MN2 A;  1XS9 A;  4I6Z A;  1IJW C;  5FMP A;  2NVY J;  3NAU A;  1SFO J;  2XPW A;  3VVX A;  3S17 J;  2Y9Z A;  3HGY A;  1OCP A;  2PBX A;  2H8R A;  2CQQ A;  1U9N A;  3JRI A;  2JA8 J;  2L7F P;  3MNL A;  3NRG A;  2G7G A;  2M8G X;  2OPT A;  2D5V A;  3G1L A;  4IHW A;  3HIM A;  4A3C J;  2TCT A;  1ETK A;  2D6Y A;  2M9H A;  1JUP A;  1S7E A;  2GBY A;  2VKE A;  3GTL J;  1JJ8 C;  2HOA A;  1ITY A;  2P81 A;  1POG A;  1QVT A;  2HYT A;  4IHX A;  4XK4 A;  1OJL A;  3BTJ A;  1JT0 A;  3HBL A;  3S1N J;  2HDD A;  1JTY A;  3WHC A;  1Z77 A;  4AC0 A;  3TW7 A;  4AC6 A;  2KT0 A;  4L62 A;  1OCT C;  4X6A J;  1TC3 C;  2VI6 A;  2WUI A;  4A69 C;  2RHA A;  5K7F A;  4QTR A;  2NVT J;  1Q1V A;  4JP0 A;  3OOU A;  5EGO B;  1QVU A;  3K2A A;  1H88 C;  4BBS J;  4XID A;  3VW0 A;  4V2F A;  3GZI A;  5FLM J;  4M3E A;  2HXO A;  5GPA A;  2I10 A;  3GTK J;  3GTP J;  4UDS A;  4EEF G;  4M3G A;  1ZKG A;  3HGG A;  2DA7 A;  3TP3 A;  2Y2Z A;  1FTT A;  4ME9 A;  2Y31 A;  3FIS A;  3FKI J;  3QPS A;  2LP0 A;  3GTG J;  2LR8 A;  5EEA A;  3Q0U A;  1G2H A;  1JKQ C;  2QWT A;  4L5E A;  3BHQ A;  2UXO A;  3NPI A;  2JA7 J;  2HKU A;  2HXI A;  4MFE A;  2LVS A;  1FTZ A;  3JSJ A;  2COB A;  4XRM A;  5EG0 B;  2K9S A;  3LSP A;  4MIM A;  3HTI A;  4DZJ A;  2UXU A;  2N8G A;  2LLK A;  3IUV A;  4C3H J;  5H9T A;  1IDY A;  4AF5 A;  1JTX A;  4NEL A;  3JR9 A;  2L9R A;  1B8I B;  2CUE A;  1JUS A;  4M3F A;  4D7M A;  3RZO J;  5C4Y A;  4BY1 J;  1UHS A;  2NOG A;  3AQS A;  5C4X J;  3EUP A;  2NS7 A;  3QBM A;  3TP0 A;  3PAS A;  2L0K A;  5EGO A;  3JRA A;  2DA6 A;  1LFB A;  3BG3 A;  2R5Y A;  5IYD J;  2NVX J;  2PZ9 A;  2NP3 A;  3BQZ A;  3ON2 A;  2NVQ J;  3ZOB A;  1AHD P;  5K7Z A;  5J1Y A;  3OSG A;  5HOD A;  2XPV A;  4NN1 A;  2M2E A;  3COL A;  3MKL A;  3M3Y J;  2JN6 A;  2DA3 A;  2X9D A;  1ENH A;  2HYJ A;  1VND A;  2DMT A;  4M6V A;  1QPI A;  2ZCM A;  2ECC A;  4C2M J;  3VIB A;  4CYC A;  1RR7 A;  3TED A;  5M5W J;  1TWH J;  3MVP A;  1W0T A;  1ETQ A;  2DG8 A;  4FE4 A;  2O9L A;  3GTJ J;  1Y1V J;  4NDL A;  5F04 A;  5EFY A;  3HE0 A;  1IV6 A;  3LSJ A;  3S2H J;  1IG7 A;  3G1O A;  3RZD J;  1MBG A;  5FLV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...