4M3GA

Rapid and efficient design of new inhibitors of mycobacterium tuberculosis transcriptional repressor ethr using fragment growing, merging and linking approaches
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
193
structure length
191
Chain Sequence
GDDRELAILATAENLLEDRPLADISVDDLAKGAGISRPTFYFYFPSKEAVLLTLLDRVVNQADMALQTLAENPTDRENMWRTGINVFFETFGSHKAVTRAGQAARATSVEVAELWSTFMQKWIAYTAAVIDAERDRGAAPRTLPAHELATALNLMNERTLFASFAGEQPSVPEARVLDTLVHIWVTSIYGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription repressor/inhibitor
molecule keywords HTH-type transcriptional regulator EthR
publication title Ligand Efficiency Driven Design of New Inhibitors of Mycobacterium tuberculosis Transcriptional Repressor EthR Using Fragment Growing, Merging, and Linking Approaches.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 80
structure length 191
sequence length 193
ec nomenclature
pdb deposition date 2013-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4m3gA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 4m3gA02
2O8KA 3C2BA 2XDNA 1XG1A 3Q0UA 4A3LJ 5D19A 3S1NJ 4CGRA 2OF7A 1R9TJ 1BW5A 1TWGJ 2DMQA 2Y30A 2JJ7A 2OERA 3P9TA 3RZOJ 2EH3A 2F07A 1MSFC 3HOXJ 4XIDA 2LLKA 1LE8A 4FTHA 2E1OA 5D18A 3VOKA 1SGMA 2WUIA 1MBHA 5EFYA 1Z0XA 1F43A 2L9RA 5FKKA 5JLXA 1JKPC 5FMPA 4CYCA 4M6VA 4BY1J 2XGDA 3NPIA 4NN1A 1ETVA 3GTKJ 5M3FJ 1JT6A 3GTLJ 1IDYA 4Y52J 3SJMA 4M3GA 5M3MJ 2JA6J 2QKOA 3E7LA 3HOYJ 3HOVJ 3JRHA 1EF4A 1ZR2A 1AHDP 1I50J 1RKTA 9ANTA 1FIPA 4QSHA 5JLWA 3HB9A 4GFLA 2WGBA 2PMZN 4I6ZA 3QPSA 2E2HJ 2X6OA 1OFCX 2O7OA 3GEUA 2L7ZA 2WAQN 1WI3A 2NVYJ 3EUPA 4JX6A 1U8BA 2RAEA 2QTQA 1B8IB 3I4MJ 2IAIA 2ECBA 4GCTA 2LK2A 3S15J 3HOUJ 4LOCA 2QWTA 2DJNA 5E3OA 3OSGA 1OJLA 3D1NI 2EBIA 3E7QA 2DA3A 3WHCA 2R5YB 1WCMJ 2XRLA 2M34A 1GT0C 1IG7A 3QQAA 1GDTA 3HGGA 2FJ1A 2NP3A 1GV5A 3BR3A 4D5FA 2ZOYA 4B1RA 2R5ZB 4JKZA 4FE7A 4BXXJ 4IHWA 1MBGA 5K7HA 4AC0A 1B8IA 2ZOZA 3PASA 5FGLA 3HTIA 3DCFA 1WPKA 2JA8J 1XS9A 3F1BA 3JRIA 2LD5A 1BW6A 4MFDA 3H3VK 4HNVA 2X48A 3LSRA 1I6HJ 5CXIA 4FE4A 2R5YA 2UXUA 1MH4A 1W0TA 5D1RA 2R5ZA 4YZEA 3BQZA 2H8RA 2JA5J 1JT0A 4GFKA 1BJZA 3Q3SA 2LY9A 1GVDA 5F08A 3A01B 1AU7A 1UHSA 2D5VA 2PZ9A 3C07A 3QPLA 3S1RJ 1W0UA 3RKQA 3BJBA 2HYTA 5IYDJ 1ETWA 2HYJA 2G7GA 1B72B 1UI6A 4BY7J 3BR2A 2CU7A 2L0KA 4GCKA 1ZGWA 3DPJA 1JKOC 1FJLA 3CJDA 2QCOA 1H89C 4M3BA 3PPBA 2G7LA 1X2MA 3TW6A 3K7AJ 2GLOA 2HXOA 5BNGA 5IP9J 4NELA 1P7JA 3A01A 2FX0A 3CCYA 2GBYA 1FTTA 3JRCA 5C44J 3BQYA 1QVTA 1YRNB 1H8AC 2IU5A 3HM5A 4V2FA 2X9DA 3S14J 3O8GA 2B63J 1K83J 5F04A 1HOMA 1B72A 3S1QJ 1TWCJ 4JP0A 3NAUA 3OSFA 5K58A 2ECCA 3VPRA 3KKCA 2DA1A 3G1MA 4MXMA 2DA4A 2LP0A 4ACIA 3HBLA 3FIWA 1UI5A 2CQQA 5DAJA 4D7NA 2KT0A 5E3MA 3AQTA 4M3FA 1WH7A 3K2AA 3PM1A 4I76A 5EDNA 4PXIA 1WH5A 3V6GA 3KKDA 4A93J 1ENHA 3O60A 1YRNA 2VKEA 3PO2J 3JSJA 5IYCJ 4JNNA 5C4XJ 1FIAA 4ME9A 3VW2A 1ETQA 2EZKA 2VKVA 4A3EJ 3HIMA 2LKXA 3KZ9A 4KWAA 2ID3A 4IEJA 2JMWA 5F0FA 4XK4A 3VIBA 3CWRA 2JWTA 1VI0A 2E2JJ 2YVHA 1S7EA 3BR6A 3HTHA 2Y9YA 4B3AA 2NX4A 2OI8A 1D5YA 5F27A 3IH4A 5GPCA 2HOAA 3LWJA 4AC6A 2AO9A 3ZQFA 2E2IJ 3IH3A 3LHQA 2GUHA 3LJLA 3H0GJ 3S16J 3UKGA 1TWAJ 2EQRA 1P7IA 1MBFA 3JRGA 1GV2A 4AUXA 5IP7J 1ZKGA 4NDLA 3GTQJ 3BTCA 1Q1VA 5C4JJ 3LSGA 3FRQA 2HQ5A 2Q24A 3G7RA 2FD5A 1ETKA 4M3EA 3S2DJ 4XRMA 1ETXA 3RQIA 3HE0A 2K9SA 4W1UA 4ICHA 4C3JJ 3JRAA 3NARA 1RR7A 4AF5A 3WHBA 2RHAA 1NK3P 3Q0WA 3LSPA 4FCYA 1U78A 2JN6A 4D5CA 2HOTA 3AQSA 2DMNA 3MVPA 1IC8A 3ZQCA 1OCPA 4A3DJ 3PO3J 5F0CA 1DU6A 2R0QC 5EZGA 2ELKA 3BTIA 3HEFA 3ON4A 4IHVA 1IDZA 2KDZA 2XPVA 1ITYA 1WGXA 5FKMA 1MBEA 2CRGA 3W6VA 2JK3A 3S5RA 1JTYA 3TP3A 1DU0A 3ZQIA 3HGYA 2AHQA 4DYRA 4XICA 5C4YA 4DYQA 3GTJJ 3A03A 2UXHA 1LFBA 4W97A 4UUSB 2QF7A 1HCRA 2UXIA 3COLA 4HKUA 1Y1VJ 2EZIA 5FJ8J 2XSDC 5HSZA 2P81A 3VOXA 2K9NA 5FHPA 1U9OA 3CDLA 3BG5A 2LR8A 1Y1WJ 1O4XA 3I4NJ 4X1EA 3LNQA 2QOPA 3BR1A 2G3BA 3IH2A 5EGOB 1U9NA 2DA2A 3TP0A 5E3NA 2LTPA 4JX4A 2FQ4A 1XC5A 3T6NA 3JRBA 2YS9A 1RKWA 2CQXA 4AYBN 3ZOBA 2XB0X 1SANA 2EZHA 3ZQHA 4UUSA 1G2HA 1JUPA 2VUMJ 2G7SA 2HOSA 3G1OA 2WB1N 2HKUA 2NVTJ 5FLMJ 2NVQJ 3GTPJ 2V57A 1CQTA 3HOZJ 1MBKA 2VPRA 3VW1A 3HOWJ 5EGOA 5J1RA 3NXCA 3KNWA 4MIMA 2XPWA 1JKRC 4BBSJ 1MH3A 2JA7J 1TWFJ 4A3GJ 4RDUA 3FISA 4A3IJ 1IGNA 1ZQ3P 3HKZN 5IOYA 3VVXA 1HF0A 1X58A 1NK2P 1GUUA 2Y0SN 1HDDC 3NNRA 4DZPA 2XGEA 3BT9A 1VNDA 2ZCNA 5FLVA 4L5EA 3MNLA 2DA6A 3RH2A 4MO7A 1FTZA 3SFIA 2M8GX 2PBXA 2K40A 2M9HA 3MN2A 3B6CA 2WV1A 1MSEC 1MNMC 3NRGA 4RBOA 2Y9ZA 4DW6A 1F36A 5C3EJ 2DMTA 3QKXA 2RASA 1E3OC 1ETYA 4C3IJ 3IV5A 1X2NA 3Q0VA 4A3JJ 1APLC 1ETOA 3BCGA 2EZLA 3DEWA 3V78A 4MLOA 2OPTA 2ME6A 2GFNA 3CRJA 2N8GA 3OIOA 4C3HJ 1T33A 4A3CJ 2GM4A 1VFCA 2DG7A 3BRUA 2QIBA 2YVEA 3O8HA 5IYBJ 3GTOJ 2ME0A 1QVUA 2DMPA 2NS7A 3B81A 3NI7A 1ZK8A 3FK6A 2DG8A 2DA5A 1K61A 1JGGA 4V2GA 1MBJA 1IV6A 2NS8A 2R93J 4G12A 4XRSA 2I10A 2E19A 5EYRA 3M3YJ 5CXGA 2NOGA 3JRFA 1UMQA 4ABZA 5K7FA 4L62A 3BNIA 2TRTA 4UUTA 4XRSG 5IOZA 5J1UA 2XB5A 1POGA 5EF6A 1SFOJ 3S2HJ 1JUMA 4JX5A 3S1MJ 2HXIA 2DTZA 2IBDA 2TCTA 4BBRJ 1HLVA 4M3DA 1ZR4A 2DA7A 5IP6A 3VW0A 1BA5A 5GP9A 2XGCA 3LOCA 4QIWN 4QTRA 1UG2A 3BTJA 3FK7A 1JKQC 2GENA 1Z77A 1A6IA 2Y31A 3HTAA 1TWHJ 4A69C 2HDDA 3G56A 2R92J 2DMUA 3B6AA 2O7TA 2Y2ZA 2ZB9A 1T56A 3GZIA 4IHXA 5FKOA 1OCTC 5J3LA 3RD3A 4S0HB 2XPUA 4MK6A 2REKA 2M0CA 4C2MJ 3OOUA 2ZCXA 5F0HA 2G0EA 3MKLA 3VP5A 3ANGA 1NTCA 3ANPA 3BG3A 3BR5A 4D7MA 4A3BJ 3EGQA 2HI3A 4IHYA 1ZTRA 2K9QA 4A3MJ 2D6YA 5FKLA 3JRDA 3GTGJ 3BTLA 3CQZJ 3ZQGA 2LFBA 2H1KA 3SDGA 2UXPA 4J19A 1BL0A 1ORKA 4B4CA 1TC3C 2UXOA 5EZHA 2L7FP 3JREA 3TEDA 1A5JA 1QRYA 1FEXA 5F1JA 2R7ZJ 3FKIJ 4GFBA 4A3FJ 5GPAA 3CMYA 3TW7A 2IEKA 3HDDA 3BG9A 5CW8A 5E3LA 3A02A 1HDPA 1I3QJ 5IPAA 3ZQLA 1IRZA 2NP5A 3HTJA 3BR0A 2LVSA 5M5XJ 4A3KJ 2W53A 1QPIA 5HODA 1JJ6C 3F0CA 5EG0B 3L1PA 5DS9A 2ID6A 2MW8A 1JJ8C 4DZJA 2COBA 2NVXJ 4X6AJ 5J1YA 2VI6A 3G1LA 4JYKA 3M4OJ 1PUFB 1JTXA 5HAWA 2CUFA 5DTDA 2M2EA 3QBMA 4GCLA 1JUSA 1AKHB 2YUSA 2O9LA 3VVYA 1RETA 4UDSA 2MG4A 4MFEA 3S17J 2MGQA 5EEAA 3IUVA 5K7ZA 2ZCMA 2W48A 2L7MP 5EG0A 4BKXA 5HBUA 5M5YJ 5FKNA 5M5WJ 2CUEA 3GTMJ 3RZDJ 1IUFA 3GBGA 1LE8B 1LFUP 2DN0A 2MSYA 1H88C 1IJWC 2YU9J 5H9TA 4JL3A 3BHQA 1PUFA 4DYCA 2FBQA 3JR9A 4CYCB 3ON2A 5AQCA 1VF9A 4FISA 3LSJA 2CJJA 1RESA 3VVZA 4Y7NJ 1AKHA 3VUQA 1RPWA 4EEFG
chains in the Genus database with same CATH superfamily
4ZDPA 2O8KA 3Q0UA 1U8RA 4AVPA 4N0BA 2KJBA 4A3LJ 5D19A 4CGRA 4IX7A 2QLZA 5FD6A 2CW0F 2F5CA 2Y30A 3P9TA 4FT8A 4N9IA 5B3SH 2LLKA 4L5IA 2GOXB 1LE8A 1LKXA 4FTHA 2E1OA 1BI2A 4KNYA 2VOOA 1R5ID 1Z05A 1Y6IA 1MBHA 1KQ9A 2ELJA 3H92A 4R1HA 2O03A 5JLXA 2LY1A 3BZ6A 1F43A 4XL9A 2QQ8A 2M45A 4M6VA 2K5CA 4FX4A 4BY1J 5LRRA 1IXCA 3LL7A 1D8JA 2FSWA 4MQVA 1T6SA 1IDYA 3H3UA 1BM9A 1TBXA 1YW7A 3HOYJ 3HOVJ 5DEQA 4XN3A 1EF4A 1IO2A 2FBIA 3RPUA 3NWSA 2E60A 3HB9A 4XKWA 1ZRCA 1I39A 2WGBA 5KCMA 4GFLA 1PYVA 2L7ZA 3IRQA 4PSWA 1WI3A 2NVYJ 4Q48A 5E1ZB 3HSFA 1Z6RA 4LITA 1XGSA 4LIUA 1B8IB 2OD5A 4Y33A 1N75A 5L3GA 2VXDA 3AL0C 1QZZA 5FB2A 4RGXA 3OSGA 1V4RA 4PDKA 3E7QA 1IAWA 3R0AA 3WHCA 4H0EA 2R5YB 1WCMJ 1GT0C 2CG4A 2HQRA 3VYRB 4I2OA 4Y13A 1XTAA 5HNHA 3HPHA 3CCSI 1LNWA 2B7EA 3DLAA 1WHUA 4CCNA 2MABA 4HDVA 4IHWA 2JPBA 2KRHA 2DFHA 4G94A 1MBGA 3R6SA 2ZOZA 2P6SA 2W85A 3DCFA 1WPKA 3AAFA 1QPMA 1XS9A 3LSIA 2LD5A 4FETA 4II3A 5J4YA 1VQPI 2BHYA 2DOFA 4N9HA 4HZFA 2MLKA 2JTVA 2R4GA 4OIPF 2GQQA 2UXUA 1MH4A 3ECOA 3DU6A 3BPVA 4G7ZF 5B1AH 4MTDA 3E3VA 5KAIC 4GFKA 2R7DA 2O5RA 4XLPF 3Q3SA 5DCMB 2VN2A 5HLHA 1N78A 1G3TA 1UHSA 2NAZA 1U6GA 1QZYA 2DK8A 2F5FA 3DLLF 2Q0OA 3J7AY 3C07A 2TDXA 2X6XA 3LFKA 3RKQA 3LQQA 5DD4A 4HLXA 5L3CA 2FJI1 1V5EA 2QYOA 3HPGA 2CYYA 4BY7J 1ZGWA 1WJBA 1IRGA 4PUSA 3H9JA 2PFVA 2EINH 3PFIA 3QYBA 3TW6A 4ZC3A 1Q1HA 3SEQA 3V8LA 2GLOA 1R36A 4RS8A 3W6JB 3PNTA 1W4MA 1D0ZA 3DBRB 3JRCA 1GVJA 2O3FA 4YRVA 5C44J 1P4XA 1S7AA 2L01A 3U21A 1H8AC 2IU5A 2GZWA 3OS2A 4V2FA 4A0ZA 1D1BA 3O8GA 1TZLA 1XCVA 2D45A 2HVRA 2B63J 2VQHA 2VC0A 2M7AA 3OSFA 1O57A 4C2TA 1E2XA 2ECCA 3KKCA 4ACIA 3G1MA 2DA4A 1LFPA 3HBLA 3ONQA 2XKPA 1UI5A 3FHZA 4PJLA 2XC7A 5KK1A 1XGMA 2A61A 4M72A 3ZR8X 4IRHA 1STZA 5CVIA 1OPCA 2KRFA 2Q2EA 3KKDA 2NS0A 4GO1A 2IPQX 4I7HA 1LUJB 3LMMA 4RAYA 3DTKA 1ETQA 5CPRB 4N4OB 3OYNA 4A3EJ 1FMWA 1LPQA 4KT5C 3P9CA 1E17A 3L2VA 1MMSA 1YIJI 5F0FA 2O0YA 3CWRA 1VI0A 1X3WB 2EK5A 3H3ZA 3FM5A 2ZXWH 2VOPA 4BGDA 3COAC 4IPAA 1E0EA 4M6YA 1H9TA 2HKOA 2Y9YA 3B73A 4XLFA 2H6CA 3F9KA 4OIRF 4G6QA 2NX4A 2OQRA 2HOAA 3K4CA 5HLTA 2AO9A 3DQVC 1LJ9A 3LWJA 4AC6A 3IH3A 4DGWB 4DIQA 4V19K 1X3ZB 3E6DA 4KIFA 2QKMB 1P7IA 4HNUA 2FA5A 1DQUA 1GV2A 4NDLA 3CMEI 1ULYA 3DTIA 4LB6B 4YG2F 5C4JJ 5LGNA 3F23A 3G7RA 1W7PA 2QQAA 3SDBA 3S2DJ 3OYBA 4XRMA 3MWMA 1SD4A 3KFWX 3RQIA 1MNEA 4WF2A 3JRAA 3WTWC 1BBYA 1FBQA 1FBUA 4ESBA 1NK3P 4WCGA 4CXFA 3LSPA 3D5SC 4WX9A 4LG0B 2A07F 3EPZA 3I54A 3WTUC 1R4NB 2A3SA 4ENMA 4LD5A 3ZQCA 3BY6A 1J59A 1RIOH 4A3DJ 1JGSA 2VQLA 2PMUA 3RPUD 1DU6A 1SMTA 1TQMA 3DV8A 5EZGA 3GX4X 3L2RA 3TGNA 2KP6A 3FF5A 3HUGA 5HNFA 3ON4A 4IHVA 1IDZA 1ITYA 3DEUA 1DU0A 3ZQIA 3HGYA 4DYRA 3LA3A 4KN4X 2LNBA 2XKOA 3A03A 4RAZA 1S6LA 4BE0A 1FMVA 4KMFA 2XF7A 1XD7A 2DODA 5FHPA 4LGWA 2VLAA 3HSRA 4E7JA 2VODA 2LR8A 1UJ8A 3CJRB 2EILH 2GXGA 2XGXA 4EJVA 2ESNA 2HKXA 2QOPA 5EGOB 3TO6A 1CF7B 1V5GA 2KIMA 3EETA 2DTRA 3TP0A 2JRMA 4BJ5C 4BACA 5L3DA 1LDJA 3I56I 1XC5A 3PUFA 3CCQI 4BE2A 1NG7A 3T6NA 2FOWA 2IJLA 1ZRFA 5LD2C 3ZOBA 3KX2A 2FBKA 3K70D 4BH9A 1G2HA 3CC7I 4IO9F 1AOYA 2G7SA 3G1OA 3WODF 4ETSA 3L09A 2NVQJ 2V57A 5DCFA 1CQTA 1MBKA 2VPRA 3SZGA 3NXCA 3H35A 2K4JA 1USSA 3HRSA 4BBSJ 3U1DA 2NVUB 5GTIC 3RQ4A 4A3GJ 3CF5F 1SFXA 3FISA 2EA2A 3OR1C 3VVXA 4CICA 1HF0A 1X58A 4KJZA 4K2EA 2WBMA 1O7FA 4KITB 1VNDA 1DGWY 3FHNA 1BR2A 1SVLA 4L5EA 4MO7A 4AM3A 3SFIA 2H09A 2V1NA 2VJ5A 3E0JB 3IC7A 3W6KB 4EM1A 3NRGA 1F36A 4EGZA 2KKOA 3QOPA 1FY7A 4C3IJ 3L2UA 4X0GA 4BJTA 5BPIA 4A3JJ 2HEOA 2DU9A 2OA4A 3I3LA 3BCGA 4RB1A 1QU3A 2COMA 3V78A 3CRJA 4A5NA 2KPMA 1T33A 4U0YA 5HS7A 2XUBA 4B8XA 2E1CA 1RUOA 4XOPA 4I01A 5LBQA 4GCVA 5IYBJ 3WTVC 3JAMZ 4I0AA 3ABMH 2MBFA 1LDDA 1OYWA 3A0HC 4CCJA 2NS8A 2RNGA 2PJRB 4CYDA 1N77A 2ZJPF 3M3YJ 3FDYA 2Y0MA 3K4JA 3V7SA 3FWEA 4L62A 4M74A 4A6DA 4QPQA 1RNLA 2TRTA 1HSJA 1WJAA 3E6BA 3HG9A 1LEBA 2IBDA 2WY7Q 2DPDA 1KQ0A 2A05A 2XGCA 5GP9A 5HDGA 2ZJQF 2ZXIA 2Y31A 1R1TA 5ERIA 1WJEA 2HDDA 1HA8A 3G56A 3GFMA 3RTRA 4QLCU 3J81K 2O7TA 4XKCA 3V7CA 2Y2ZA 2ZB9A 1T56A 2FXAA 1MDMB 3GLLA 2QBYA 5H20A 5J3LA 2VT2A 4S0HB 2Y75A 4ANJA 4MK6A 1QNTA 1R5HA 2M0CA 3ABUA 4IHSA 2ZCXA 3EDPA 3QPTA 3KIOA 3J80K 3WG9A 2LF8A 2CO5A 4EJOA 3RKYA 3N4MA 1KU3A 2LBFA 2MD5A 3QU3A 4XR6A 1W7PD 2RQPA 1KYWA 2BZTA 4I98B 2LFBA 1MIJA 3KP2A 2UXPA 3GMEA 1BL0A 1D0XA 4XLEA 1TC3C 3FXLA 2R7TA 4FASD 2D1HA 2EPFA 2E7WA 2YU3A 3KP5A 3F8BA 3AFHA 5B5EC 1O3SA 3U2RA 5GPAA 1XSDA 1EH8A 2IEKA 1WVRA 3LSKA 5E3LA 4CUGA 1HDPA 3OYKA 3ZPLA 1ODDA 5IPAA 3D5LA 1P4AA 5M5XJ 3HOTA 3WE2A 2VBYA 2F4MB 2K86A 1JJ6C 3HTSB 1CGPA 2NVXJ 4X6AJ 1YO5C 3K1MA 3WG7H 1RR8C 2JVGA 2A2FX 2XROA 3BJ6A 5DTDA 2M2EA 4GCLA 4IZZA 1MW7A 3ZN0A 1KQ8A 2AXTC 2H6BA 2P8TA 3K6GA 2KLOA 4UDSA 2NNYA 4MFEA 4LLGF 5H6QA 4UVAA 2BW3A 5HBUA 2M0MA 3FXKA 5FKNA 2A5WA 3HSEA 1LE8B 1DDNA 3SZTA 1H88C 2JUCA 2K9LA 3IP4B 4PGGA 2JUGA 5ILVA 5H9TA 2ZCWA 2P7VB 4RGUA 1WFXA 1PUFA 2BBYA 4DYCA 3HHHA 2HDWA 5J8CA 2FBQA 3ON2A 3MZHA 3O2PE 1YI2I 1G59A 1RESA 1AKHA 3VUQA 5CVJA 4ENKA 2XDVA 2P7CB 1X4OA 2XDNA 3CC2I 2QWWA 2OF7A 5HS8A 3S1NJ 4KYWA 3E6CC 1BW5A 1TWGJ 2JJ7A 3SHFA 2XSJC 2EH3A 3L2CA 2BHZA 3RJPA 1MSFC 2NRAC 3HOXJ 2OCCH 4XIDA 4BDYA 2QSHX 4DOZA 2STWA 1VQLI 1SGMA 4U9LA 1NG6A 2IS1A 2G7HA 3WU2C 4XOTA 2LMDA 2EFQA 3G3ZA 4M71A 3S3OA 4PSXA 3NPIA 2W25A 1ONVA 5M3FJ 1JT6A 5D6EA 1J5YA 5M3MJ 3CCLI 3KYDB 2CV1A 1W5SA 2WTEA 4G7HF 3E7LA 3HRMA 1R6RA 3JRHA 4KDPA 4GXOA 3GYHX 1I50J 2A69F 2W7NA 2IS2A 1FIPA 3BZKA 3JCUC 4QSHA 5JLWA 2GA2A 2A6HF 1Y39A 1T0FA 3QPSA 2X6OA 2X6WA 1OFCX 3GEUA 5F6FA 2B0LA 3K69A 4HX8A 1TW2A 1U8BA 2RAEA 3FMRA 3QODA 4II2A 1WQ2A 2IA1A 3I4MJ 3QP5A 2IAIA 2ECBA 2KMUA 5LRSA 2LK2A 2V7FA 2DT6A 4F52A 2CH0A 4IQ4A 2R7XA 2K3FA 2QWTA 2V6CA 5E3OA 3G71I 2EBIA 4U0WA 1OCRH 5HDKA 3OYHA 3OS1A 2CW7A 2XRLA 1GDTA 1P4WA 5LLQA 3K4LA 1IW7F 3MAJA 2ZOYA 2PG4A 3U9GA 4FE7A 3ZMDA 2EIMH 1LVKA 3G4SI 1T0FC 3VOEA 4UV9A 3HRTA 1WJCA 1H9GA 5K7HA 4AC0A 3PASA 2RVCA 4H4KC 4P9UA 1XMAA 2X85A 3OIPA 1B1BA 4HLYA 3F1BA 3HHGA 2LRDA 2UWMA 4HNVA 1K79A 3M9AA 1YJ9I 2E71A 2YSRA 2FNAA 4FE4A 3TO9A 4F7ZA 3IAS2 2R5ZA 2M4GA 3K0LA 4YZEA 1WI9A 3BQZA 2JA5J 1OCCH 3I5UA 1BOBA 4J01A 2GOMA 2HPMA 2EB7A 1GVDA 3S93A 2JZYA 3BG6A 5F08A 1AU7A 4BE1A 2ISYA 3VYTB 2PZ9A 4Y17A 5J40A 3IWFA 4BL0B 4C9YA 3SFZA 3BJBA 1ETWA 2BXYA 1UELB 4E7HA 3BR2A 4IJAA 4XLNF 3HXLA 1P9QC 1ZRDA 3DPJA 4GCKA 2QCOA 5CQEA 1M1EB 2KL4A 3PPBA 3QPHA 1G8XA 1OLTA 3DPLC 2ZO4A 2RNJA 3NRVA 3GVAA 3K7AJ 5CYVA 4F55A 5BNGA 5IP9J 3K4MA 3A01A 1Y0UA 2GBYA 2Q2EB 1RC9A 3SWHA 3BQYA 4M73A 2E1MB 1ERDA 3HM5A 3CLQA 3ZP5A 3E5UA 1HOMA 3ASOH 2EFPA 4LG0A 1IN7A 1O3TA 5IT9Z 1XDSA 4UUVA 4R79A 1MGTA 2EJRA 2BVLA 4OD5A 5DAJA 2ETHA 1R5GA 3KZIC 2L9VA 1VQ8I 3P7NA 1T08B 3AQTA 4XRFA 1IF1A 1I6XA 2DAOA 4M3FA 3K2AA 1BN5A 1ACIA 4PXIA 3V6GA 3KPHA 1Z3XA 2O6GE 3OYFA 1OR7C 4BHPA 1YRNA 3PO2J 4ME9A 3I71A 1FIAA 3W2WA 1YX3A 3ELKA 2ZFUA 1D1AA 2EZKA 2MC3A 4RB0A 2LKPA 3HIMA 2L9NA 3GZ5A 4KWAA 2ZMEA 4XMYA 2XV4S 1W7PB 2E2JJ 5GAEJ 3M1CA 4O5VA 5HS9A 1BI1A 1XGNA 2F5DA 5CVRA 4MEXF 3KP3A 1E3PA 5D5UB 2OI8A 4PCQA 1D5YA 4DVYP 4KICA 2K7LA 2QSGX 3TDUC 3LHQA 3Q5FA 2FMYA 1FYLA 2IGOA 1MBFA 4P9FA 1HSTA 3HUGB 3FRQA 3KLNA 2FD5A 1ETKA 3V7RA 1D8KA 1FT9A 3C2GA 5ILUA 1ETXA 3ML6A 3HE0A 4ICHA 4LFUA 1RR7A 2Z33A 2BY3A 3DKXA 4HV5A 1EH7A 4PGHA 4FCYA 2M8EA 1OYYA 2JN6A 3ASNH 4XSZF 3V42A 1U78A 2YVXA 4D5CA 1F1ZA 4A0YA 2HOTA 3L00A 3PNVA 1IC8A 3I64A 5FD5A 3CMAI 3N97A 3VW1A 2H94A 1MNDA 3I4PA 2OV7A 3ZXSA 4ZYDA 2DW4A 3A2KA 4BDZA 2XPVA 2Z9OA 2R7QA 3L7WA 4FHTA 4HW0A 5FKMA 1MBEA 1Z3YA 2CRGA 2JK3A 3K4KA 4BXFA 3W6VA 4HF2A 2HTSA 3TP3A 2O8XA 2AHQA 3H5AA 5C4YA 4DYQA 1Z9CA 2OAZA 5D8LB 1LFBA 1ZYRF 2JPCA 1HCRA 4HKUA 2EZIA 2XSDC 4GYGA 2A6EF 1R49A 2P81A 3OL4A 2K9NA 4BQAA 2E35A 1Y1WJ 3BROA 3BG5A 3S3MA 3I4NJ 3WU0A 2G3BA 2F48A 3IH2A 3MKWB 3HL2A 2PMHA 5E3NA 1ZG5A 3KZYA 3K70C 4D1QA 2I5UA 3GW2A 1Z21A 2YS9A 2DDAA 4CCOA 2CQXA 1EJ9A 2CMPA 1X1AA 2PBIA 4Z2YA 2Y48A 2F4OB 2XB0X 5FO5A 4UUSA 3PUBA 3O3KA 1X1CA 1YS7A 2M3AA 5ED4A 2VUMJ 5AONA 2P5VA 1JE8A 4L0YB 2WB1N 2RQQA 2HKUA 3GF2A 2YX7A 4UHTA 1YTYA 4RA2A 1SD5A 5CQGA 5J1RA 4KA4A 3KNWA 2I8DA 2XPWA 2HTJA 4XONA 1DP3A 1TWFJ 4E7IA 4IQJA 5FGMA 2LY2A 4A3IJ 3R4KA 2Z5UA 5IOYA 2FMLA 1A36A 2DYSH 3IAM2 5LFAA 2B3WA 2W1OA 2Y0SN 2HVQA 4NQWA 1F5TA 1REPC 2BOLA 3NNRA 4O3MA 4NUBA 2QENA 3H9QA 1G3YA 1X1PA 5FLVA 2ZCNA 2DA6A 2E5NA 4LG3A 3FXUA 2EWNA 4BQNA 5IY5H 1K78A 3TO7A 2PBXA 2K40A 2QZ8A 3T1BA 2F2EA 3MN2A 3CO7C 2FQ3A 2E36A 4WWCA 4RBOA 2M4KA 2QQ9A 2DMTA 3GWZA 4OINF 4BUPA 1ETYA 5KNLA 3ERED 2R7OA 3ECHA 3RDIA 1LQ1A 3F6VA 1ETOA 2ADUA 2EZLA 4MQ9F 4IRIA 4MLOA 2ME6A 1PP7U 2GFNA 3OIOA 2IT0A 1HKSA 1SFKA 4A3CJ 4L5JA 2JSPA 2DG7A 2L5QA 5E8GA 2CV0A 2YVEA 3GCMA 4GDFA 2PJPA 1Z7LA 2ESHA 3KLOA 3EYIA 1ZH5A 1JGGA 4UVCA 3H1CA 2HS5A 2L4MA 2A68F 3UNGC 4LK1F 5J6XA 1SMYF 5EYRA 2GIVA 5CXGA 2E1MC 3JRFA 5F1RA 5LEKA 3OYDA 5K7FA 2EFWA 1K4SA 1O7LA 3AG3H 2QBYB 3BNIA 2CSOA 5IOZA 2IP2A 5J1UA 5D5XB 1YW9A 2XB5A 5EF6A 1SFOJ 3LQRA 3S2HJ 4JX5A 2EFOA 2H27A 3S1MJ 2HXIA 2DOEA 2DTZA 4BBRJ 3AG4H 4CH7A 1HLVA 3DPTA 3KZZA 3MD2A 1ZR4A 2DA7A 5IP6A 2L4AA 4HF0A 1HKQA 1A04A 4QIWN 4ZYEA 2LBFB 1V3FA 1JKQC 1UZCA 1Z77A 1A6IA 1L3LA 3HTAA 2OC6A 3G73A 1U5TA 1UAAA 5D6FA 3M1EA 2QSFX 1OISA 3GXOA 4I0BA 4MEYF 5B1BH 5FROA 4ZTJA 5FFZA 1S5LC 1R00A 2A5YB 4D9JA 1DPRA 3F3XA 5E1WA 5E8IA 4PFOA 3DEEA 4C2MJ 3MKYB 4LLNA 5F0HA 3PIPF 2G0EA 3W2AA 3VP5A 3HJEA 1HKTA 3DU5A 5ICCA 2K02A 3W3CA 4D7MA 2GAUA 1BR4A 3KCCA 4ZTFA 1SD7A 1W36C 3ROUA 2V79A 2MH9A 5FLXK 3F6OA 3JRDA 4RM3A 3BTLA 3CQZJ 1QBJA 2KHMA 2ZNZA 3K2ZA 3OMYA 4XKVA 3SDGA 4BHBA 1UG0A 2K27A 1ORKA 3ZQQA 4ESJA 5EZHA 2R7VA 2CFOA 3DTEA 3H5NA 2CS3A 3H0DA 5HDNA 1QRYA 4EM0B 2ISZA 1D5VA 1HQCA 1FEXA 1TQIA 3FKIJ 1QZEA 3HZJA 4BU2A 3CMYA 3QYEA 3F8NA 4B43A 1IRXA 1XSVA 1I3QJ 2KQRA 3L9FA 2NP5A 1XN7A 3WGHA 5TRDA 4A3KJ 3OIQA 1BI0A 5HODA 3SZPA 2BW3B 2LDUA 3PFYA 5DS9A 3L1PA 4OAZA 2WAEA 3QAHA 4HSRA 2W57A 2K9MA 1I1GA 2H1LA 5J1YA 1J7KA 2VI6A 2LREA 4JYKA 5D5VB 1Y8QB 1PUFB 3M4OJ 4M9SA 3AKZA 1JTXA 5HAWA 2CUFA 2A6TA 2E7XA 5LGUA 3C3WA 3BC8A 1BIAA 1MZBA 1U3EM 1JUSA 1MMNA 1AKHB 2YUSA 3DFGA 4KIBA 3WTTC 2O9LA 1LDKB 4PZJA 1R7JA 5K7ZA 2W48A 3MZ8A 5EG0A 4KISA 3QOEA 5M5YJ 5M5WJ 2CUEA 3GTMJ 3SYTA 3S8PA 1LFUP 2DN0A 2MSYA 4E4HA 2VE9A 4AIHA 3HRUA 4JL3A 1NHAA 2VJ4A 3BHQA 3E5QA 1T8IA 1FPQA 1YQAA 4C2MA 4PJMA 3DPUA 3M8EA 2CQKA 4FISA 5L3FA 3LSJA 3CUQA 3CDHA 3W2VA 3VB2A 4A2UA 4EV0A 2RDPA 4Y7NJ 1UCRA 1XG1A 1R9TJ 1KU9A 2DMQA 2OERA 2GIZA 2XAFA 2MFZA 3M8FA 4G8XA 5HLGA 2F07A 1FOYA 3LSHA 5FRMA 3GFIA 5D18A 1XGOA 2WUIA 2R7SA 5K1YA 5EFYA 1IV8A 5ICFA 1KU2A 1Z0XA 2CFXA 2L9RA 1JKPC 5FMPA 4YELA 4CYCA 3MFKA 2EA4A 2XGDA 2Z99A 2ACJA 4NN1A 1ETVA 4J00A 3E1SA 3GTKJ 1J09A 3CUQC 5DUIA 2VKHA 3OYAA 1S29A 2QKOA 2HYFA 1ZR2A 9ANTA 1RKTA 3WTZA 2HVSA 2IXSA 3LAJA 2QEXI 2YPRA 1FYMA 1MJ9A 2PMZN 2PFBA 4I6ZA 4F91B 3CD6I 5BQTA 2WAQN 1R1UA 2FF4A 3WU1B 4JX6A 5DD8A 1YLFA 4YEJA 3F21A 3FBIB 4LMYA 2LC2A 3BPXA 2EFNA 3GO5A 3S15J 3JW4A 4G6TB 4B09A 4LOCA 2RREA 2DJNA 2HQNA 4S05A 1OJLA 1B9NA 4L9NA 3T5XA 1IG7A 1XSXA 3QQAA 4Q47A 2ZFWA 2NP3A 3BR3A 2DFFA 2R5ZB 4JKZA 4YFKF 1SD6A 2MD0A 3K10A 3PNYA 2BYVE 1R23A 5CVVA 4L9TA 4P55A 1R22A 1GXQA 1W36D 2KISA 1BOAA 4IRGA 1XMXA 3UR3C 2JSCA 2CW8A 2Z16A 3DWLE 2X48A 4UNOA 4F92B 1BI3A 1I6HJ 5CXIA 4LIVA 4DJAA 3Q9VA 4XN0A 1W0TA 2DT7B 5D1RA 4BEHA 2H8WA 2H8RA 1ZG3A 1XX5A 2BGCA 2W00A 1JT0A 2STTA 1FSEA 2GWRA 2XIGA 2QQBA 3A01B 3LSMA 2D5VA 1EA3A 2HZDA 3OYGA 5A2QK 4I99C 4A0XA 2F5EA 1S8NA 1SFUA 3IHUA 3C1DA 1SEUA 3TKYA 2CQ7A 1YW8A 3PQKA 4CO8A 1YOVB 1MD0A 2L0KA 3KEQA 3TQNA 4EJUA 3WTXC 2W84A 3CJDA 1FJLA 2OZ6A 3I53A 1H89C 2LG4A 2WAFA 2IRFG 4BNCA 1WJ5A 3ZRGA 4NBQA 4MTEA 2HXOA 1A6QA 1TT0A 2AXLA 2DO7A 3FZVA 4NELA 2UUZA 3MKZA 1P7JA 2FX0A 3P9IA 1QVTA 1YRNB 2VJIA 5L3EA 2K85A 3S14J 3TOAA 3CUOA 1K83J 4RB3C 1J75A 5F04A 4HBLA 2LYCA 1B72A 1I3AA 3S1QJ 1IN5A 3NAUA 3OS0A 3LAPA 2L9SA 4BAYA 1Z67A 4MXMA 1Z1DA 2LP0A 2Q1ZB 2J5PA 2ZMEB 3FIWA 1QO0D 3G2BA 5JFRA 2CQQA 2FUG2 4CCKA 4D7NA 3J7ZI 3FXRA 3GEZA 2ZY9A 3PM1A 3M07A 4I76A 5EDNA 2O61A 3A4CA 3O60A 3PL8A 2ZXHA 2VKEA 3JSJA 1T95A 2E5ZA 2HYGD 5IYCJ 4JNNA 4P96A 1TP4A 2L54A 2WWYA 4BQOA 1YS6A 3G6EI 1X4PA 3J7YJ 2LKXA 4KFCA 1ON1A 1YE9A 3CP2A 4IEJA 3KZ9A 2JMWA 4XK4A 1B6AA 3GFJA 2JWTA 2CGPA 4IOAF 3K9TA 1SFEA 3MEXA 3NS4A 5TISC 1T39A 2IW5A 1S7EA 4G6DA 4HX7A 1E3HA 3RSNA 3HTHA 4B3AA 5F27A 2DDBA 3JAMK 3RKWA 1VZ0A 3CMMA 3BCBA 3ZQFA 2E2IJ 2CQNA 2VJJA 2G7UA 2GUHA 3CCMI 3H0GJ 3EUAA 3UKGA 1TNTA 4U9NA 3MMYB 3JRGA 4AUXA 5IP7J 1X1DA 1ZKGA 3OY9A 3GTQJ 1Q1VA 1UB9A 4JOMA 2HQ5A 5LHGA 1FYKA 5DV5A 4M3EA 4EGYA 3ZMUA 1WWXA 3OYLA 4B48A 2VT3A 3V8KA 1W5TA 3PJRA 2K9SA 2JA2A 4C3JJ 3NARA 1F9NA 5DYMA 3JTGA 3WHBA 3J7AO 3Q0WA 2RN7A 4CZCA 4KN7X 4U88A 4BS9A 3BDDA 1UHWA 3GZNB 3ESWB 2X6YA 1YG2A 3AQSA 1G3WA 3MVPA 3BZCA 1HW1A 1OCPA 2HU9A 2QGUA 5F0CA 3KYLA 2DXIA 4HSTA 1LB2A 2X1CA 3BTIA 3HEFA 3CCRI 2QKLB 5J8FA 1QHGA 4M6XA 4XLHA 2UZKA 5EJCA 3S5RA 1WKMA 3OOPA 3VSKA 1YJNI 1FZPB 1JTYA 2VL8A 3KEOA 3SEZA 3V8JA 1SAXA 3GTJJ 2UXHA 3I58A 3JSPA 1MKMA 4UUSB 3COLA 2UXIA 2PI0A 1Y1VJ 4YIIA 5FJ8J 1SC7A 3C2HA 2AQFA 3OYJA 3VOXA 2R7RA 1U9OA 3IL2A 2HFHA 4PJ0C 4ZZLA 5D8KB 3LNQA 3GZ6A 1O4XA 3BR1A 1S9HA 1U9NA 1QGPA 2DA2A 2LH9A 1I27A 4PFPA 1V55H 2LTPA 3HTUA 5HVQC 2B1EA 3EUKL 1RKWA 4AYBN 4U7BA 3ZMVA 4CSWA 3CF2A 1SANA 2EZHA 4NQWB 5BMZA 1YYVA 1JUPA 2R7WA 2GXAA 2OTLI 2HOSA 4ZDLA 1K78B 3I55I 3VEPA 2NVTJ 3GTPJ 5E1XA 2IGNA 4HOBA 1IN4A 1NH3A 3OYEA 4XORA 2VQCA 3HOWJ 4OU0A 4MIMA 2RC4A 1O3RA 1VQ4I 3S32A 4RDUA 3E5XA 2KIFA 3I9V2 4A5MA 3HKZN 1UHMA 1GUUA 2P4WA 2G9WA 1HDDC 4HA8A 2VQGA 3VDXA 3ZQ7A 4DZPA 2XGEA 3BT9A 4LLLA 4E7ZA 2P5KA 1P2FA 1VQ9I 3MNLA 4HRIA 4LK0F 3RH2A 1FTZA 5JHUA 4RM2A 2Z2SB 4DNCA 2M8GX 2M9HA 4BQQA 2V4JC 5BOXA 3B6CA 4D0PA 1VQNI 3BWGA 1MNMC 4DW6A 3CCJI 3K4NA 2CWEA 3QKXA 2RASA 2X4HA 1J2XA 3C18A 4RMNA 3Q0VA 2QVOA 3RYRA 2M5WA 2DQLA 1APLC 5GAHJ 1P6RA 1PVEA 1QHHD 3DEWA 3S2WA 4HNTA 2OPTA 2X1EA 5IT3A 1Z7UA 4C3HJ 5JVTA 1XMKA 2EV5A 4AIJA 3K1NA 5CVUA 4WK8F 3NWTA 3RKXA 2FU4A 3GTOJ 5LHHA 4OWRB 1QVUA 2DMPA 3HC7A 1ZK8A 3FK6A 2DQRA 2DA5A 1PDNC 4MGRA 1K61A 3A0BC 4V2GA 3R60A 2B9SA 2OJED 1OCOH 4RAGA 1YFHA 4NNJA 1YJWI 2L02A 3OV8A 1U5TB 1TNSA 3LSTA 1DP7P 1MJAA 4G12A 2UV1A 2I10A 1U2WA 2IS6A 1UMQA 3I59A 5ICEA 1MJBA 1X3UA 4P5OA 4UUTA 4XRSG 2QM3A 4BYYA 4ZJZA 2ZBKA 2IS4A 2MLGA 1JUMA 5ILSA 2BVMA 1ZG1A 2ZMEC 3FMSA 2Q8KA 4M3DA 4HPQA 3BOQA 2DPUA 1BA5A 4ASNA 3LOCA 2XF6A 5KAFC 1UG2A 2GENA 3FK7A 5CKTA 3B02A 4AVZA 3FX3A 1TWHJ 1Y8RB 3F8CA 4A69C 1KONA 3LA2A 2DMUA 2WA0A 1KYZA 1G4DA 2V1XA 1B4AA 3E97A 1HW2A 1I1SA 2FOKA 4IHXA 5FKOA 5FFXA 4ENJA 1OCTC 1V5FA 1FOKA 3RD3A 4B3XA 1ZGAA 2XPUA 2REKA 4CCMA 4OMYA 3GFLA 3MKLA 3R0JA 1B59A 3ANGA 2R7FA 3REOA 3ANPA 4FQGA 2WB1A 5FLXZ 2D2WA 2Y69H 3BR5A 2L3DA 2HI3A 4IHYA 4CHUA 1ZTRA 2K9QA 4A3MJ 2D6YA 3HOSA 4U7DA 3AG1H 2JVHA 5FKLA 5JI6A 3AG2H 3BCAA 2FEZA 1RUNA 4OD4A 3K1PA 3GTGJ 1GHCA 2IVMA 1OKRA 4J19A 2R7UA 1PP8F 2FE3A 4HAMA 4YFNF 1XCBA 4F3QA 2CUJA 2UXOA 2AS5F 1LEAA 2Y0SA 1RZ4A 1A5JA 1L0OC 1Z91A 2R3SA 3DXJF 2R7ZJ 3ZN1A 3CCUI 2XAGA 4ESFA 4KT6A 1FP2A 4RAFA 1IRZA 3SQNA 2LVSA 4WXHA 1QPIA 4UVBA 4IL6C 3KEYA 5EG0B 2XASA 2ID6A 1JJ8C 4DZJA 2VBXA 3FKJA 3MCZA 4CCLA 5J47A 5KHDA 2COBA 1GXPA 4N4NB 1SVMA 3G1LA 1JI8A 2PX9A 5J4VA 1KA8A 1W1WE 1VQOI 5CLSA 2MYSA 3QBMA 3CUQB 3H9GA 3VVYA 3BJOA 2MG4A 3S17J 5EEAA 3N05A 3IUVA 3WGIA 3ABTA 1T38A 1OCZH 1TW3A 3O6BB 3VTIA 1UI6A 1IUFA 1DGRM 2BEOA 1HW5A 4EVIA 1IJWC 2KIQA 3CLOA 4XSXF 3P5JA 4U87A 3VWBA 3WGGA 3BP8A 3ULQB 2C6YA 2J5OA 3JR9A 4CYCB 1WJDA 2CJJA 3LWFA 3CESA 1RPWA 3RYPA 4EEFG 3BLYA 3C2BA 2HR3A 4WIBA 2M87A 2EIJH 1N25A 3CP8A 4WXDA 5IT9K 3RZOJ 2Z1DA 3FXQA 4LJZF 4PJJA 3ZMTA 2FNPA 2DK5A 3VOKA 5JHFA 3ZMSA 2HWVA 4LB5A 5K5RA 1GLNA 2WC2A 5FRNA 2MC4A 3RCOA 5FKKA 3DKYA 4RB2C 3CJTB 4FX0A 4CA0A 3GTLJ 2DBBA 4Y52J 3SJMA 4M3GA 4HDUA 1R71A 2KZGA 4G7OF 3IWZA 2JA6J 3JTHA 2W4SA 1X1BA 2LSOA 2OQGA 2QA4I 1AHDP 2UXNA 3I0TA 1EKEA 2P5LC 2E2HJ 3J81Z 3TMOA 2O7OA 3OWTA 4A12A 2GXBA 2XHKA 3EUPA 3PIOF 3ZCOA 2W82A 4S04A 3HYIA 2YX4A 2QTQA 4ZZDA 1ZLKA 1XPXA 2ICWG 3Q9SA 4GCTA 3FXJA 1P92A 3CZ6A 3J80Z 2EIKH 2DI3A 1VQ7I 3HOUJ 2X0LA 1WRJA 1XDUA 3E6MA 3D1NI 2DA3A 4DQ2A 2M34A 3HGGA 2FJ1A 1GV5A 4JQFA 4D5FA 4I09A 4L9JA 4B1RA 2IA0A 4BEHB 2FBHA 5H2FC 3ZGKA 4OOIA 5D4SA 5HOOA 4BXXJ 1BC8C 4BXUA 1U5TC 4UV8A 2E1NA 3TOBA 1F4KA 1B8IA 1QA6A 5FGLA 3HTIA 4ITVA 5D5WB 2JA8J 3FXMA 3L2QA 5E18F 3JRIA 2MA3A 1A35A 1BW6A 1S7OA 4MFDA 3H3VK 1FWZA 3S3NA 5H6RA 1ZAOA 5HLIA 2AQEA 3ERMA 3LSRA 5DUKA 1MMAA 2R5YA 2VB6A 2KFDA 4G9YA 1HXDA 4RGSA 3CJQB 1SVOA 2XAHA 3CJNA 3LA7A 1G3SA 3OR2C 1WSUA 1G6NA 1R4MB 1BJZA 5JR3A 5E17F 2LY9A 4E7LA 5A2QZ 3CO6C 4YIRX 1VQKI 4R8HA 4ZH4F 1RI7A 3QPLA 3S1RJ 1BC7C 5LHIA 1W0UA 5BPDA 5LGTA 2HYTA 5IYDJ 2HYJA 3RPQA 1B72B 2G7GA 2CU7A 1JKOC 2YR2A 1KZHA 1D1CA 4M3BA 1TL8A 2G7LA 1X2MA 3D5RC 1JHHA 2V9KA 1IUYA 5DCMA 2ZSIB 4AIKA 1PUEE 5DM6F 5TGTA 3CCYA 4WXCA 1FTTA 4UXNA 1FNNA 5GADJ 2VBZA 2V9VA 2EV0A 2XAUA 3FBNB 1VQMI 2X9DA 1K6YA 2BY2A 2OUMA 2ZKZA 4C30A 4F93B 1KGSA 1LVAA 1XB4A 1TWCJ 4JP0A 3WTSC 3WTYC 5K58A 1YHQI 3VPRA 4OIOF 2DA1A 2GA1A 2X51A 3KE2A 3OYCA 2JQ7A 4Q5SF 2DJIA 2PMZA 4IF4A 4XM3A 2HZTA 3D0SA 3F22A 2KT0A 3A1YA 5E3MA 1R1VA 2WAQA 4XLAA 2KJCA 1WH7A 1D3YA 2XAJA 1WH5A 4A93J 1ENHA 2Z3YA 5AIQA 3MZYA 5C4XJ 3VW2A 3KYCB 3ABLH 3V4GA 2UXXA 2VKVA 4E70A 4GGGA 5K5QA 4UB6C 1YITI 1AWCA 2ID3A 3KP4A 5D4RA 1Y56A 2L2OA 5GAGJ 3KETA 4ZDOA 3VIBA 2WADA 4HQMA 1FX7A 2M7BA 2YVHA 4E7SA 3BR6A 2BY0A 3DBHB 4U0VA 4OAYA 4XKBA 4IOCF 1FP1D 1PJRA 3M7GA 2NYXA 1FBSA 2HPIA 4XLCA 5AIPA 4HEA2 3IH4A 5GPCA 4E7KA 4NC8A 2L7KA 4ZYHA 3M8JA 2QUFA 3LJLA 4EMSA 3S16J 1S3JA 2BE5F 2DFEA 2MH2A 1TWAJ 1FC3A 2DLLA 2EQRA 2FRHA 5B66C 3TDZC 1FOXA 4HV6A 3BTCA 3IUOA 3T8RA 1EH6A 3LSGA 3KP6A 2Q24A 1WZ2A 5EEGA 1ZHFA 3FMQA 4CDGA 4W1UA 3HIFA 2HGCA 4AF5A 2RHAA 4A6EA 4QPOA 1BJAA 2D1VA 3PSIA 3U1KA 4PJNA 5CJ9A 2DMNA 3QWLA 1AA7A 2VASA 3PSFA 3PO3J 2F4IA 1U0JA 2W24A 2R0QC 2ELKA 3F8FA 1UFMA 4RLFA 1VQ5I 2HDCA 5K5OA 3T8TA 2KDZA 4AWXB 5E20A 2WV0A 2K3PA 4EJTA 4XICA 3EYYA 5KVRA 4W97A 2QF7A 4JK1X 1HC8A 4DBRA 1O3QA 2NNNA 5HSZA 2M1BA 3IRRA 2F5VA 1VQ6I 4E6KG 4Q4ZF 1OYIA 3CDLA 4L0ZB 4X1EA 1JXSA 2RV8A 3CDIA 2JT1A 2XF5A 3CTAA 4UY8I 4JX4A 1K4TA 2NOJB 1T98A 1A31A 1T2KA 2FQ4A 4UB8C 3JRBA 4B44A 1K6OA 4BHCA 4Y15A 1OQYA 1TT5B 3ZQHA 4C2UA 3RIRA 3TL4X 1ZGJA 2PQ8A 2VONA 4AD9A 2V1UA 2F6CA 4HG2A 5FLMJ 5JVGF 3HOZJ 3GUDA 1JHFA 3IKVA 4EM2A 3DBLB 2ZJRF 2ZJ2A 3F8MA 1MMDA 5DDGA 5EGOA 1CF7A 3CC4I 3F72A 4YFXF 1JKRC 1MH3A 4EJWA 2JA7J 2VE8A 4ZYAA 3T0YA 4EATA 4BJ6C 1IGNA 1ZQ3P 1FOWA 1KU7A 1NK2P 2PLYA 2DT5A 3QRFF 2RGVA 3H5RA 1TQPA 6PAXA 1TLHB 4OMZA 1SAUA 1DPUA 2LKSA 2WV1A 1IN8A 2OBPA 1MSEC 2PEXA 1RRJA 2Y9ZA 1QQIA 5C3EJ 5EEHA 2JRTA 4ENNA 1E3OC 1HBXG 1J9IA 4MNUA 2DOAA 2V26A 4P1WA 1ZN2A 4O6JA 3IV5A 4XQFA 5F64A 1X2NA 4B47A 2CV2A 4I02A 4ZYGA 1OMIA 3AL0B 3C7JA 3I59B 2VXZA 3MQ0A 2IA2A 2N8GA 1VTNC 2GM4A 1VFCA 5LEJA 3BRUA 3TBIA 1EV7A 2QIBA 3K8PC 3O8HA 5DM7F 1Y0NA 2ME0A 4NB5A 3B81A 2NS7A 1J0RA 2BV6A 3NI7A 2DG8A 3QU6A 3ABKH 4HX4A 2XAQA 2OZUA 3DP7A 3OYMA 1MBJA 1IV6A 4Y4RA 2K4BA 4HF1A 2X1DA 2R93J 4XRSA 2E19A 2HQAA 2NOGA 4ABZA 2XVCA 2ZXJA 2KIUA 3BG7A 5L3BA 2ZSHB 3QP6A 4JBAA 3CCVI 1POGA 2PN6A 4IVNA 1USTA 2LOOA 3WE3A 2DCEA 3P9KA 2EV6A 1WJFA 2ZNYA 2TCTA 2OU2A 1IZ1A 3VYSB 3QYFA 3VW0A 1TTYA 1BIBA 4QTRA 3L2WA 2P6TA 3BTJA 5TJJA 4ON0A 2PJRA 2R92J 3LFUA 3GLXA 3B6AA 2VPLA 3PQJA 3OL3A 3R61A 3GZIA 1Z6TA 3ISPA 4M9XA 1R58A 4YIFA 2NXNB 4AIDA 3X2QH 4AYBA 4HQEA 4L18B 3OOUA 3BJAA 1ON2A 4DBQA 1NTCA 3FM3A 3VSLA 4CGZA 1YX5A 5BS6A 3CCEI 2LF7A 3BG3A 4A3BJ 1DUXC 3EGQA 2P0WA 4M9ZA 4RLQA 2OCEA 4KIGA 1IN6A 2M30A 1X19A 4PK4A 1FLIA 4RGRA 3ZQGA 3RI4A 4QWQA 2H1KA 4KMUX 3JSOA 1S72I 1H0MA 2OTJI 1IXRC 2KDOA 4IRVA 4AU7A 1MDMA 1IXSB 3HKZA 3EQLF 3K4BA 2HOEA 4B4CA 5ICGA 2L7FP 1D0YA 4OIQF 3JREA 1YIOA 4NC7A 3TEDA 1I5ZA 1IRFA 4CZZA 1ZELA 5F1JA 2IGKA 4NC6A 4GFBA 4A3FJ 2ELHA 2BXZA 4HYEA 3NQOA 3TW7A 4EQQA 4Z6YA 3HDDA 4TV7A 3VODA 3BG9A 5CW8A 2VBWA 4L9VA 3A02A 3ZQLA 3HTJA 3BR0A 2W53A 4Y3OA 4GYIA 1BR1A 3F0CA 2DYRH 2IGMA 4GRIA 3OYIA 3EUHA 4NHJA 2E34A 2MW8A 2V9PA 1ZREA 2VIXA 3VYUB 3ZMZA 4MHGA 1ZLJA 2KZVA 1C0WA 4IXAA 5E79C 2DFIA 2KRCA 2WY8Q 2VC1A 2VKDA 2V6EA 2CUZA 3VFZA 1FSHA 1V54H 3DKWA 1RETA 4IHTA 2MGQA 1ZARA 2HNHA 2ZCMA 2L7MP 4BKXA 1MMGA 4IKFA 3SXYA 4XNFA 1OR7A 3RZDJ 3GBGA 3IKTA 1K7AA 3FXOA 3EUHC 3NEUA 2YU9J 2BY1A 3KP7A 2RKHA 3H36A 5GTHC 5AQCA 1W5CC 1VF9A 2V1DA 2ZC2A 2XRNA 3DF8A 4KUMA 3VVZA 4XBFA 1B9MA 1WGXA
chains in the Genus database with same CATH topology
2O8KA 3C2BA 2XDNA 1XG1A 3Q0UA 4A3LJ 5D19A 3S1NJ 4CGRA 2OF7A 1R9TJ 1BW5A 1TWGJ 2DMQA 2Y30A 2JJ7A 2OERA 3P9TA 3RZOJ 2EH3A 2F07A 1MSFC 3HOXJ 4XIDA 2LLKA 1LE8A 4FTHA 2E1OA 5D18A 3VOKA 1SGMA 2WUIA 1MBHA 5EFYA 1Z0XA 1F43A 2L9RA 5FKKA 5JLXA 1JKPC 5FMPA 4CYCA 4M6VA 4BY1J 2XGDA 3NPIA 4NN1A 1ETVA 3GTKJ 5M3FJ 1JT6A 3GTLJ 1IDYA 4Y52J 3SJMA 4M3GA 5M3MJ 2JA6J 2QKOA 3E7LA 3HOYJ 3HOVJ 3JRHA 1EF4A 1ZR2A 1AHDP 1I50J 1RKTA 9ANTA 1FIPA 4QSHA 5JLWA 3HB9A 4GFLA 2WGBA 2PMZN 4I6ZA 3QPSA 2E2HJ 2X6OA 1OFCX 2O7OA 3GEUA 2L7ZA 2WAQN 1WI3A 2NVYJ 3EUPA 4JX6A 1U8BA 2RAEA 2QTQA 1B8IB 3I4MJ 2IAIA 2ECBA 4GCTA 2LK2A 3S15J 3HOUJ 4LOCA 2QWTA 2DJNA 5E3OA 3OSGA 1OJLA 3D1NI 2EBIA 3E7QA 2DA3A 3WHCA 2R5YB 1WCMJ 2XRLA 2M34A 1GT0C 1IG7A 3QQAA 1GDTA 3HGGA 2FJ1A 2NP3A 1GV5A 3BR3A 4D5FA 2ZOYA 4B1RA 2R5ZB 4JKZA 4FE7A 4BXXJ 4IHWA 1MBGA 5K7HA 4AC0A 1B8IA 2ZOZA 3PASA 5FGLA 3HTIA 3DCFA 1WPKA 2JA8J 1XS9A 3F1BA 3JRIA 2LD5A 1BW6A 4MFDA 3H3VK 4HNVA 2X48A 3LSRA 1I6HJ 5CXIA 4FE4A 2R5YA 2UXUA 1MH4A 1W0TA 5D1RA 2R5ZA 4YZEA 3BQZA 2H8RA 2JA5J 1JT0A 4GFKA 1BJZA 3Q3SA 2LY9A 1GVDA 5F08A 3A01B 1AU7A 1UHSA 2D5VA 2PZ9A 3C07A 3QPLA 3S1RJ 1W0UA 3RKQA 3BJBA 2HYTA 5IYDJ 1ETWA 2HYJA 2G7GA 1B72B 1UI6A 4BY7J 3BR2A 2CU7A 2L0KA 4GCKA 1ZGWA 3DPJA 1JKOC 1FJLA 3CJDA 2QCOA 1H89C 4M3BA 3PPBA 2G7LA 1X2MA 3TW6A 3K7AJ 2GLOA 2HXOA 5BNGA 5IP9J 4NELA 1P7JA 3A01A 2FX0A 3CCYA 2GBYA 1FTTA 3JRCA 5C44J 3BQYA 1QVTA 1YRNB 1H8AC 2IU5A 3HM5A 4V2FA 2X9DA 3S14J 3O8GA 2B63J 1K83J 5F04A 1HOMA 1B72A 3S1QJ 1TWCJ 4JP0A 3NAUA 3OSFA 5K58A 2ECCA 3VPRA 3KKCA 2DA1A 3G1MA 4MXMA 2DA4A 2LP0A 4ACIA 3HBLA 3FIWA 1UI5A 2CQQA 5DAJA 4D7NA 2KT0A 5E3MA 3AQTA 4M3FA 1WH7A 3K2AA 3PM1A 4I76A 5EDNA 4PXIA 1WH5A 3V6GA 3KKDA 4A93J 1ENHA 3O60A 1YRNA 2VKEA 3PO2J 3JSJA 5IYCJ 4JNNA 5C4XJ 1FIAA 4ME9A 3VW2A 1ETQA 2EZKA 2VKVA 4A3EJ 3HIMA 2LKXA 3KZ9A 4KWAA 2ID3A 4IEJA 2JMWA 5F0FA 4XK4A 3VIBA 3CWRA 2JWTA 1VI0A 2E2JJ 2YVHA 1S7EA 3BR6A 3HTHA 2Y9YA 4B3AA 2NX4A 2OI8A 1D5YA 5F27A 3IH4A 5GPCA 2HOAA 3LWJA 4AC6A 2AO9A 3ZQFA 2E2IJ 3IH3A 3LHQA 2GUHA 3LJLA 3H0GJ 3S16J 3UKGA 1TWAJ 2EQRA 1P7IA 1MBFA 3JRGA 1GV2A 4AUXA 5IP7J 1ZKGA 4NDLA 3GTQJ 3BTCA 1Q1VA 5C4JJ 3LSGA 3FRQA 2HQ5A 2Q24A 3G7RA 2FD5A 1ETKA 4M3EA 3S2DJ 4XRMA 1ETXA 3RQIA 3HE0A 2K9SA 4W1UA 4ICHA 4C3JJ 3JRAA 3NARA 1RR7A 4AF5A 3WHBA 2RHAA 1NK3P 3Q0WA 3LSPA 4FCYA 1U78A 2JN6A 4D5CA 2HOTA 3AQSA 2DMNA 3MVPA 1IC8A 3ZQCA 1OCPA 4A3DJ 3PO3J 5F0CA 1DU6A 2R0QC 5EZGA 2ELKA 3BTIA 3HEFA 3ON4A 4IHVA 1IDZA 2KDZA 2XPVA 1ITYA 1WGXA 5FKMA 1MBEA 2CRGA 3W6VA 2JK3A 3S5RA 1JTYA 3TP3A 1DU0A 3ZQIA 3HGYA 2AHQA 4DYRA 4XICA 5C4YA 4DYQA 3GTJJ 3A03A 2UXHA 1LFBA 4W97A 4UUSB 2QF7A 1HCRA 2UXIA 3COLA 4HKUA 1Y1VJ 2EZIA 5FJ8J 2XSDC 5HSZA 2P81A 3VOXA 2K9NA 5FHPA 1U9OA 3CDLA 3BG5A 2LR8A 1Y1WJ 1O4XA 3I4NJ 4X1EA 3LNQA 2QOPA 3BR1A 2G3BA 3IH2A 5EGOB 1U9NA 2DA2A 3TP0A 5E3NA 2LTPA 4JX4A 2FQ4A 1XC5A 3T6NA 3JRBA 2YS9A 1RKWA 2CQXA 4AYBN 3ZOBA 2XB0X 1SANA 2EZHA 3ZQHA 4UUSA 1G2HA 1JUPA 2VUMJ 2G7SA 2HOSA 3G1OA 2WB1N 2HKUA 2NVTJ 5FLMJ 2NVQJ 3GTPJ 2V57A 1CQTA 3HOZJ 1MBKA 2VPRA 3VW1A 3HOWJ 5EGOA 5J1RA 3NXCA 3KNWA 4MIMA 2XPWA 1JKRC 4BBSJ 1MH3A 2JA7J 1TWFJ 4A3GJ 4RDUA 3FISA 4A3IJ 1IGNA 1ZQ3P 3HKZN 5IOYA 3VVXA 1HF0A 1X58A 1NK2P 1GUUA 2Y0SN 1HDDC 3NNRA 4DZPA 2XGEA 3BT9A 1VNDA 2ZCNA 5FLVA 4L5EA 3MNLA 2DA6A 3RH2A 4MO7A 1FTZA 3SFIA 2M8GX 2PBXA 2K40A 2M9HA 3MN2A 3B6CA 2WV1A 1MSEC 1MNMC 3NRGA 4RBOA 2Y9ZA 4DW6A 1F36A 5C3EJ 2DMTA 3QKXA 2RASA 1E3OC 1ETYA 4C3IJ 3IV5A 1X2NA 3Q0VA 4A3JJ 1APLC 1ETOA 3BCGA 2EZLA 3DEWA 3V78A 4MLOA 2OPTA 2ME6A 2GFNA 3CRJA 2N8GA 3OIOA 4C3HJ 1T33A 4A3CJ 2GM4A 1VFCA 2DG7A 3BRUA 2QIBA 2YVEA 3O8HA 5IYBJ 3GTOJ 2ME0A 1QVUA 2DMPA 2NS7A 3B81A 3NI7A 1ZK8A 3FK6A 2DG8A 2DA5A 1K61A 1JGGA 4V2GA 1MBJA 1IV6A 2NS8A 2R93J 4G12A 4XRSA 2I10A 2E19A 5EYRA 3M3YJ 5CXGA 2NOGA 3JRFA 1UMQA 4ABZA 5K7FA 4L62A 3BNIA 2TRTA 4UUTA 4XRSG 5IOZA 5J1UA 2XB5A 1POGA 5EF6A 1SFOJ 3S2HJ 1JUMA 4JX5A 3S1MJ 2HXIA 2DTZA 2IBDA 2TCTA 4BBRJ 1HLVA 4M3DA 1ZR4A 2DA7A 5IP6A 3VW0A 1BA5A 5GP9A 2XGCA 3LOCA 4QIWN 4QTRA 1UG2A 3BTJA 3FK7A 1JKQC 2GENA 1Z77A 1A6IA 2Y31A 3HTAA 1TWHJ 4A69C 2HDDA 3G56A 2R92J 2DMUA 3B6AA 2O7TA 2Y2ZA 2ZB9A 1T56A 3GZIA 4IHXA 5FKOA 1OCTC 5J3LA 3RD3A 4S0HB 2XPUA 4MK6A 2REKA 2M0CA 4C2MJ 3OOUA 2ZCXA 5F0HA 2G0EA 3MKLA 3VP5A 3ANGA 1NTCA 3ANPA 3BG3A 3BR5A 4D7MA 4A3BJ 3EGQA 2HI3A 4IHYA 1ZTRA 2K9QA 4A3MJ 2D6YA 5FKLA 3JRDA 3GTGJ 3BTLA 3CQZJ 3ZQGA 2LFBA 2H1KA 3SDGA 2UXPA 4J19A 1BL0A 1ORKA 4B4CA 1TC3C 2UXOA 5EZHA 2L7FP 3JREA 3TEDA 1A5JA 1QRYA 1FEXA 5F1JA 2R7ZJ 3FKIJ 4GFBA 4A3FJ 5GPAA 3CMYA 3TW7A 2IEKA 3HDDA 3BG9A 5CW8A 5E3LA 3A02A 1HDPA 1I3QJ 5IPAA 3ZQLA 1IRZA 2NP5A 3HTJA 3BR0A 2LVSA 5M5XJ 4A3KJ 2W53A 1QPIA 5HODA 1JJ6C 3F0CA 5EG0B 3L1PA 5DS9A 2ID6A 2MW8A 1JJ8C 4DZJA 2COBA 2NVXJ 4X6AJ 5J1YA 2VI6A 3G1LA 4JYKA 3M4OJ 1PUFB 1JTXA 5HAWA 2CUFA 5DTDA 2M2EA 3QBMA 4GCLA 1JUSA 1AKHB 2YUSA 2O9LA 3VVYA 1RETA 4UDSA 2MG4A 4MFEA 3S17J 2MGQA 5EEAA 3IUVA 5K7ZA 2ZCMA 2W48A 2L7MP 5EG0A 4BKXA 5HBUA 5M5YJ 5FKNA 5M5WJ 2CUEA 3GTMJ 3RZDJ 1IUFA 3GBGA 1LE8B 1LFUP 2DN0A 2MSYA 1H88C 1IJWC 2YU9J 5H9TA 4JL3A 3BHQA 1PUFA 4DYCA 2FBQA 3JR9A 4CYCB 3ON2A 5AQCA 1VF9A 4FISA 3LSJA 2CJJA 1RESA 3VVZA 4Y7NJ 1AKHA 3VUQA 1RPWA 4EEFG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O8K A;  3C2B A;  2XDN A;  1XG1 A;  3Q0U A;  4A3L J;  5D19 A;  3S1N J;  4CGR A;  2OF7 A;  1R9T J;  1BW5 A;  1TWG J;  2DMQ A;  2Y30 A;  2JJ7 A;  2OER A;  3P9T A;  3RZO J;  2EH3 A;  2F07 A;  1MSF C;  3HOX J;  4XID A;  2LLK A;  1LE8 A;  4FTH A;  2E1O A;  5D18 A;  3VOK A;  1SGM A;  2WUI A;  1MBH A;  5EFY A;  1Z0X A;  1F43 A;  2L9R A;  5FKK A;  5JLX A;  1JKP C;  5FMP A;  4CYC A;  4M6V A;  4BY1 J;  2XGD A;  3NPI A;  4NN1 A;  1ETV A;  3GTK J;  5M3F J;  1JT6 A;  3GTL J;  1IDY A;  4Y52 J;  3SJM A;  4M3G A;  5M3M J;  2JA6 J;  2QKO A;  3E7L A;  3HOY J;  3HOV J;  3JRH A;  1EF4 A;  1ZR2 A;  1AHD P;  1I50 J;  1RKT A;  9ANT A;  1FIP A;  4QSH A;  5JLW A;  3HB9 A;  4GFL A;  2WGB A;  2PMZ N;  4I6Z A;  3QPS A;  2E2H J;  2X6O A;  1OFC X;  2O7O A;  3GEU A;  2L7Z A;  2WAQ N;  1WI3 A;  2NVY J;  3EUP A;  4JX6 A;  1U8B A;  2RAE A;  2QTQ A;  1B8I B;  3I4M J;  2IAI A;  2ECB A;  4GCT A;  2LK2 A;  3S15 J;  3HOU J;  4LOC A;  2QWT A;  2DJN A;  5E3O A;  3OSG A;  1OJL A;  3D1N I;  2EBI A;  3E7Q A;  2DA3 A;  3WHC A;  2R5Y B;  1WCM J;  2XRL A;  2M34 A;  1GT0 C;  1IG7 A;  3QQA A;  1GDT A;  3HGG A;  2FJ1 A;  2NP3 A;  1GV5 A;  3BR3 A;  4D5F A;  2ZOY A;  4B1R A;  2R5Z B;  4JKZ A;  4FE7 A;  4BXX J;  4IHW A;  1MBG A;  5K7H A;  4AC0 A;  1B8I A;  2ZOZ A;  3PAS A;  5FGL A;  3HTI A;  3DCF A;  1WPK A;  2JA8 J;  1XS9 A;  3F1B A;  3JRI A;  2LD5 A;  1BW6 A;  4MFD A;  3H3V K;  4HNV A;  2X48 A;  3LSR A;  1I6H J;  5CXI A;  4FE4 A;  2R5Y A;  2UXU A;  1MH4 A;  1W0T A;  5D1R A;  2R5Z A;  4YZE A;  3BQZ A;  2H8R A;  2JA5 J;  1JT0 A;  4GFK A;  1BJZ A;  3Q3S A;  2LY9 A;  1GVD A;  5F08 A;  3A01 B;  1AU7 A;  1UHS A;  2D5V A;  2PZ9 A;  3C07 A;  3QPL A;  3S1R J;  1W0U A;  3RKQ A;  3BJB A;  2HYT A;  5IYD J;  1ETW A;  2HYJ A;  2G7G A;  1B72 B;  1UI6 A;  4BY7 J;  3BR2 A;  2CU7 A;  2L0K A;  4GCK A;  1ZGW A;  3DPJ A;  1JKO C;  1FJL A;  3CJD A;  2QCO A;  1H89 C;  4M3B A;  3PPB A;  2G7L A;  1X2M A;  3TW6 A;  3K7A J;  2GLO A;  2HXO A;  5BNG A;  5IP9 J;  4NEL A;  1P7J A;  3A01 A;  2FX0 A;  3CCY A;  2GBY A;  1FTT A;  3JRC A;  5C44 J;  3BQY A;  1QVT A;  1YRN B;  1H8A C;  2IU5 A;  3HM5 A;  4V2F A;  2X9D A;  3S14 J;  3O8G A;  2B63 J;  1K83 J;  5F04 A;  1HOM A;  1B72 A;  3S1Q J;  1TWC J;  4JP0 A;  3NAU A;  3OSF A;  5K58 A;  2ECC A;  3VPR A;  3KKC A;  2DA1 A;  3G1M A;  4MXM A;  2DA4 A;  2LP0 A;  4ACI A;  3HBL A;  3FIW A;  1UI5 A;  2CQQ A;  5DAJ A;  4D7N A;  2KT0 A;  5E3M A;  3AQT A;  4M3F A;  1WH7 A;  3K2A A;  3PM1 A;  4I76 A;  5EDN A;  4PXI A;  1WH5 A;  3V6G A;  3KKD A;  4A93 J;  1ENH A;  3O60 A;  1YRN A;  2VKE A;  3PO2 J;  3JSJ A;  5IYC J;  4JNN A;  5C4X J;  1FIA A;  4ME9 A;  3VW2 A;  1ETQ A;  2EZK A;  2VKV A;  4A3E J;  3HIM A;  2LKX A;  3KZ9 A;  4KWA A;  2ID3 A;  4IEJ A;  2JMW A;  5F0F A;  4XK4 A;  3VIB A;  3CWR A;  2JWT A;  1VI0 A;  2E2J J;  2YVH A;  1S7E A;  3BR6 A;  3HTH A;  2Y9Y A;  4B3A A;  2NX4 A;  2OI8 A;  1D5Y A;  5F27 A;  3IH4 A;  5GPC A;  2HOA A;  3LWJ A;  4AC6 A;  2AO9 A;  3ZQF A;  2E2I J;  3IH3 A;  3LHQ A;  2GUH A;  3LJL A;  3H0G J;  3S16 J;  3UKG A;  1TWA J;  2EQR A;  1P7I A;  1MBF A;  3JRG A;  1GV2 A;  4AUX A;  5IP7 J;  1ZKG A;  4NDL A;  3GTQ J;  3BTC A;  1Q1V A;  5C4J J;  3LSG A;  3FRQ A;  2HQ5 A;  2Q24 A;  3G7R A;  2FD5 A;  1ETK A;  4M3E A;  3S2D J;  4XRM A;  1ETX A;  3RQI A;  3HE0 A;  2K9S A;  4W1U A;  4ICH A;  4C3J J;  3JRA A;  3NAR A;  1RR7 A;  4AF5 A;  3WHB A;  2RHA A;  1NK3 P;  3Q0W A;  3LSP A;  4FCY A;  1U78 A;  2JN6 A;  4D5C A;  2HOT A;  3AQS A;  2DMN A;  3MVP A;  1IC8 A;  3ZQC A;  1OCP A;  4A3D J;  3PO3 J;  5F0C A;  1DU6 A;  2R0Q C;  5EZG A;  2ELK A;  3BTI A;  3HEF A;  3ON4 A;  4IHV A;  1IDZ A;  2KDZ A;  2XPV A;  1ITY A;  1WGX A;  5FKM A;  1MBE A;  2CRG A;  3W6V A;  2JK3 A;  3S5R A;  1JTY A;  3TP3 A;  1DU0 A;  3ZQI A;  3HGY A;  2AHQ A;  4DYR A;  4XIC A;  5C4Y A;  4DYQ A;  3GTJ J;  3A03 A;  2UXH A;  1LFB A;  4W97 A;  4UUS B;  2QF7 A;  1HCR A;  2UXI A;  3COL A;  4HKU A;  1Y1V J;  2EZI A;  5FJ8 J;  2XSD C;  5HSZ A;  2P81 A;  3VOX A;  2K9N A;  5FHP A;  1U9O A;  3CDL A;  3BG5 A;  2LR8 A;  1Y1W J;  1O4X A;  3I4N J;  4X1E A;  3LNQ A;  2QOP A;  3BR1 A;  2G3B A;  3IH2 A;  5EGO B;  1U9N A;  2DA2 A;  3TP0 A;  5E3N A;  2LTP A;  4JX4 A;  2FQ4 A;  1XC5 A;  3T6N A;  3JRB A;  2YS9 A;  1RKW A;  2CQX A;  4AYB N;  3ZOB A;  2XB0 X;  1SAN A;  2EZH A;  3ZQH A;  4UUS A;  1G2H A;  1JUP A;  2VUM J;  2G7S A;  2HOS A;  3G1O A;  2WB1 N;  2HKU A;  2NVT J;  5FLM J;  2NVQ J;  3GTP J;  2V57 A;  1CQT A;  3HOZ J;  1MBK A;  2VPR A;  3VW1 A;  3HOW J;  5EGO A;  5J1R A;  3NXC A;  3KNW A;  4MIM A;  2XPW A;  1JKR C;  4BBS J;  1MH3 A;  2JA7 J;  1TWF J;  4A3G J;  4RDU A;  3FIS A;  4A3I J;  1IGN A;  1ZQ3 P;  3HKZ N;  5IOY A;  3VVX A;  1HF0 A;  1X58 A;  1NK2 P;  1GUU A;  2Y0S N;  1HDD C;  3NNR A;  4DZP A;  2XGE A;  3BT9 A;  1VND A;  2ZCN A;  5FLV A;  4L5E A;  3MNL A;  2DA6 A;  3RH2 A;  4MO7 A;  1FTZ A;  3SFI A;  2M8G X;  2PBX A;  2K40 A;  2M9H A;  3MN2 A;  3B6C A;  2WV1 A;  1MSE C;  1MNM C;  3NRG A;  4RBO A;  2Y9Z A;  4DW6 A;  1F36 A;  5C3E J;  2DMT A;  3QKX A;  2RAS A;  1E3O C;  1ETY A;  4C3I J;  3IV5 A;  1X2N A;  3Q0V A;  4A3J J;  1APL C;  1ETO A;  3BCG A;  2EZL A;  3DEW A;  3V78 A;  4MLO A;  2OPT A;  2ME6 A;  2GFN A;  3CRJ A;  2N8G A;  3OIO A;  4C3H J;  1T33 A;  4A3C J;  2GM4 A;  1VFC A;  2DG7 A;  3BRU A;  2QIB A;  2YVE A;  3O8H A;  5IYB J;  3GTO J;  2ME0 A;  1QVU A;  2DMP A;  2NS7 A;  3B81 A;  3NI7 A;  1ZK8 A;  3FK6 A;  2DG8 A;  2DA5 A;  1K61 A;  1JGG A;  4V2G A;  1MBJ A;  1IV6 A;  2NS8 A;  2R93 J;  4G12 A;  4XRS A;  2I10 A;  2E19 A;  5EYR A;  3M3Y J;  5CXG A;  2NOG A;  3JRF A;  1UMQ A;  4ABZ A;  5K7F A;  4L62 A;  3BNI A;  2TRT A;  4UUT A;  4XRS G;  5IOZ A;  5J1U A;  2XB5 A;  1POG A;  5EF6 A;  1SFO J;  3S2H J;  1JUM A;  4JX5 A;  3S1M J;  2HXI A;  2DTZ A;  2IBD A;  2TCT A;  4BBR J;  1HLV A;  4M3D A;  1ZR4 A;  2DA7 A;  5IP6 A;  3VW0 A;  1BA5 A;  5GP9 A;  2XGC A;  3LOC A;  4QIW N;  4QTR A;  1UG2 A;  3BTJ A;  3FK7 A;  1JKQ C;  2GEN A;  1Z77 A;  1A6I A;  2Y31 A;  3HTA A;  1TWH J;  4A69 C;  2HDD A;  3G56 A;  2R92 J;  2DMU A;  3B6A A;  2O7T A;  2Y2Z A;  2ZB9 A;  1T56 A;  3GZI A;  4IHX A;  5FKO A;  1OCT C;  5J3L A;  3RD3 A;  4S0H B;  2XPU A;  4MK6 A;  2REK A;  2M0C A;  4C2M J;  3OOU A;  2ZCX A;  5F0H A;  2G0E A;  3MKL A;  3VP5 A;  3ANG A;  1NTC A;  3ANP A;  3BG3 A;  3BR5 A;  4D7M A;  4A3B J;  3EGQ A;  2HI3 A;  4IHY A;  1ZTR A;  2K9Q A;  4A3M J;  2D6Y A;  5FKL A;  3JRD A;  3GTG J;  3BTL A;  3CQZ J;  3ZQG A;  2LFB A;  2H1K A;  3SDG A;  2UXP A;  4J19 A;  1BL0 A;  1ORK A;  4B4C A;  1TC3 C;  2UXO A;  5EZH A;  2L7F P;  3JRE A;  3TED A;  1A5J A;  1QRY A;  1FEX A;  5F1J A;  2R7Z J;  3FKI J;  4GFB A;  4A3F J;  5GPA A;  3CMY A;  3TW7 A;  2IEK A;  3HDD A;  3BG9 A;  5CW8 A;  5E3L A;  3A02 A;  1HDP A;  1I3Q J;  5IPA A;  3ZQL A;  1IRZ A;  2NP5 A;  3HTJ A;  3BR0 A;  2LVS A;  5M5X J;  4A3K J;  2W53 A;  1QPI A;  5HOD A;  1JJ6 C;  3F0C A;  5EG0 B;  3L1P A;  5DS9 A;  2ID6 A;  2MW8 A;  1JJ8 C;  4DZJ A;  2COB A;  2NVX J;  4X6A J;  5J1Y A;  2VI6 A;  3G1L A;  4JYK A;  3M4O J;  1PUF B;  1JTX A;  5HAW A;  2CUF A;  5DTD A;  2M2E A;  3QBM A;  4GCL A;  1JUS A;  1AKH B;  2YUS A;  2O9L A;  3VVY A;  1RET A;  4UDS A;  2MG4 A;  4MFE A;  3S17 J;  2MGQ A;  5EEA A;  3IUV A;  5K7Z A;  2ZCM A;  2W48 A;  2L7M P;  5EG0 A;  4BKX A;  5HBU A;  5M5Y J;  5FKN A;  5M5W J;  2CUE A;  3GTM J;  3RZD J;  1IUF A;  3GBG A;  1LE8 B;  1LFU P;  2DN0 A;  2MSY A;  1H88 C;  1IJW C;  2YU9 J;  5H9T A;  4JL3 A;  3BHQ A;  1PUF A;  4DYC A;  2FBQ A;  3JR9 A;  4CYC B;  3ON2 A;  5AQC A;  1VF9 A;  4FIS A;  3LSJ A;  2CJJ A;  1RES A;  3VVZ A;  4Y7N J;  1AKH A;  3VUQ A;  1RPW A;  4EEF G; 
#chains in the Genus database with same CATH topology
 4ZDP A;  2O8K A;  3Q0U A;  1U8R A;  4AVP A;  4N0B A;  2KJB A;  4A3L J;  5D19 A;  4CGR A;  4IX7 A;  2QLZ A;  5FD6 A;  2CW0 F;  2F5C A;  2Y30 A;  3P9T A;  4FT8 A;  4N9I A;  5B3S H;  2LLK A;  4L5I A;  2GOX B;  1LE8 A;  1LKX A;  4FTH A;  2E1O A;  1BI2 A;  4KNY A;  2VOO A;  1R5I D;  1Z05 A;  1Y6I A;  1MBH A;  1KQ9 A;  2ELJ A;  3H92 A;  4R1H A;  2O03 A;  5JLX A;  2LY1 A;  3BZ6 A;  1F43 A;  4XL9 A;  2QQ8 A;  2M45 A;  4M6V A;  2K5C A;  4FX4 A;  4BY1 J;  5LRR A;  1IXC A;  3LL7 A;  1D8J A;  2FSW A;  4MQV A;  1T6S A;  1IDY A;  3H3U A;  1BM9 A;  1TBX A;  1YW7 A;  3HOY J;  3HOV J;  5DEQ A;  4XN3 A;  1EF4 A;  1IO2 A;  2FBI A;  3RPU A;  3NWS A;  2E60 A;  3HB9 A;  4XKW A;  1ZRC A;  1I39 A;  2WGB A;  5KCM A;  4GFL A;  1PYV A;  2L7Z A;  3IRQ A;  4PSW A;  1WI3 A;  2NVY J;  4Q48 A;  5E1Z B;  3HSF A;  1Z6R A;  4LIT A;  1XGS A;  4LIU A;  1B8I B;  2OD5 A;  4Y33 A;  1N75 A;  5L3G A;  2VXD A;  3AL0 C;  1QZZ A;  5FB2 A;  4RGX A;  3OSG A;  1V4R A;  4PDK A;  3E7Q A;  1IAW A;  3R0A A;  3WHC A;  4H0E A;  2R5Y B;  1WCM J;  1GT0 C;  2CG4 A;  2HQR A;  3VYR B;  4I2O A;  4Y13 A;  1XTA A;  5HNH A;  3HPH A;  3CCS I;  1LNW A;  2B7E A;  3DLA A;  1WHU A;  4CCN A;  2MAB A;  4HDV A;  4IHW A;  2JPB A;  2KRH A;  2DFH A;  4G94 A;  1MBG A;  3R6S A;  2ZOZ A;  2P6S A;  2W85 A;  3DCF A;  1WPK A;  3AAF A;  1QPM A;  1XS9 A;  3LSI A;  2LD5 A;  4FET A;  4II3 A;  5J4Y A;  1VQP I;  2BHY A;  2DOF A;  4N9H A;  4HZF A;  2MLK A;  2JTV A;  2R4G A;  4OIP F;  2GQQ A;  2UXU A;  1MH4 A;  3ECO A;  3DU6 A;  3BPV A;  4G7Z F;  5B1A H;  4MTD A;  3E3V A;  5KAI C;  4GFK A;  2R7D A;  2O5R A;  4XLP F;  3Q3S A;  5DCM B;  2VN2 A;  5HLH A;  1N78 A;  1G3T A;  1UHS A;  2NAZ A;  1U6G A;  1QZY A;  2DK8 A;  2F5F A;  3DLL F;  2Q0O A;  3J7A Y;  3C07 A;  2TDX A;  2X6X A;  3LFK A;  3RKQ A;  3LQQ A;  5DD4 A;  4HLX A;  5L3C A;  2FJI 1;  1V5E A;  2QYO A;  3HPG A;  2CYY A;  4BY7 J;  1ZGW A;  1WJB A;  1IRG A;  4PUS A;  3H9J A;  2PFV A;  2EIN H;  3PFI A;  3QYB A;  3TW6 A;  4ZC3 A;  1Q1H A;  3SEQ A;  3V8L A;  2GLO A;  1R36 A;  4RS8 A;  3W6J B;  3PNT A;  1W4M A;  1D0Z A;  3DBR B;  3JRC A;  1GVJ A;  2O3F A;  4YRV A;  5C44 J;  1P4X A;  1S7A A;  2L01 A;  3U21 A;  1H8A C;  2IU5 A;  2GZW A;  3OS2 A;  4V2F A;  4A0Z A;  1D1B A;  3O8G A;  1TZL A;  1XCV A;  2D45 A;  2HVR A;  2B63 J;  2VQH A;  2VC0 A;  2M7A A;  3OSF A;  1O57 A;  4C2T A;  1E2X A;  2ECC A;  3KKC A;  4ACI A;  3G1M A;  2DA4 A;  1LFP A;  3HBL A;  3ONQ A;  2XKP A;  1UI5 A;  3FHZ A;  4PJL A;  2XC7 A;  5KK1 A;  1XGM A;  2A61 A;  4M72 A;  3ZR8 X;  4IRH A;  1STZ A;  5CVI A;  1OPC A;  2KRF A;  2Q2E A;  3KKD A;  2NS0 A;  4GO1 A;  2IPQ X;  4I7H A;  1LUJ B;  3LMM A;  4RAY A;  3DTK A;  1ETQ A;  5CPR B;  4N4O B;  3OYN A;  4A3E J;  1FMW A;  1LPQ A;  4KT5 C;  3P9C A;  1E17 A;  3L2V A;  1MMS A;  1YIJ I;  5F0F A;  2O0Y A;  3CWR A;  1VI0 A;  1X3W B;  2EK5 A;  3H3Z A;  3FM5 A;  2ZXW H;  2VOP A;  4BGD A;  3COA C;  4IPA A;  1E0E A;  4M6Y A;  1H9T A;  2HKO A;  2Y9Y A;  3B73 A;  4XLF A;  2H6C A;  3F9K A;  4OIR F;  4G6Q A;  2NX4 A;  2OQR A;  2HOA A;  3K4C A;  5HLT A;  2AO9 A;  3DQV C;  1LJ9 A;  3LWJ A;  4AC6 A;  3IH3 A;  4DGW B;  4DIQ A;  4V19 K;  1X3Z B;  3E6D A;  4KIF A;  2QKM B;  1P7I A;  4HNU A;  2FA5 A;  1DQU A;  1GV2 A;  4NDL A;  3CME I;  1ULY A;  3DTI A;  4LB6 B;  4YG2 F;  5C4J J;  5LGN A;  3F23 A;  3G7R A;  1W7P A;  2QQA A;  3SDB A;  3S2D J;  3OYB A;  4XRM A;  3MWM A;  1SD4 A;  3KFW X;  3RQI A;  1MNE A;  4WF2 A;  3JRA A;  3WTW C;  1BBY A;  1FBQ A;  1FBU A;  4ESB A;  1NK3 P;  4WCG A;  4CXF A;  3LSP A;  3D5S C;  4WX9 A;  4LG0 B;  2A07 F;  3EPZ A;  3I54 A;  3WTU C;  1R4N B;  2A3S A;  4ENM A;  4LD5 A;  3ZQC A;  3BY6 A;  1J59 A;  1RIO H;  4A3D J;  1JGS A;  2VQL A;  2PMU A;  3RPU D;  1DU6 A;  1SMT A;  1TQM A;  3DV8 A;  5EZG A;  3GX4 X;  3L2R A;  3TGN A;  2KP6 A;  3FF5 A;  3HUG A;  5HNF A;  3ON4 A;  4IHV A;  1IDZ A;  1ITY A;  3DEU A;  1DU0 A;  3ZQI A;  3HGY A;  4DYR A;  3LA3 A;  4KN4 X;  2LNB A;  2XKO A;  3A03 A;  4RAZ A;  1S6L A;  4BE0 A;  1FMV A;  4KMF A;  2XF7 A;  1XD7 A;  2DOD A;  5FHP A;  4LGW A;  2VLA A;  3HSR A;  4E7J A;  2VOD A;  2LR8 A;  1UJ8 A;  3CJR B;  2EIL H;  2GXG A;  2XGX A;  4EJV A;  2ESN A;  2HKX A;  2QOP A;  5EGO B;  3TO6 A;  1CF7 B;  1V5G A;  2KIM A;  3EET A;  2DTR A;  3TP0 A;  2JRM A;  4BJ5 C;  4BAC A;  5L3D A;  1LDJ A;  3I56 I;  1XC5 A;  3PUF A;  3CCQ I;  4BE2 A;  1NG7 A;  3T6N A;  2FOW A;  2IJL A;  1ZRF A;  5LD2 C;  3ZOB A;  3KX2 A;  2FBK A;  3K70 D;  4BH9 A;  1G2H A;  3CC7 I;  4IO9 F;  1AOY A;  2G7S A;  3G1O A;  3WOD F;  4ETS A;  3L09 A;  2NVQ J;  2V57 A;  5DCF A;  1CQT A;  1MBK A;  2VPR A;  3SZG A;  3NXC A;  3H35 A;  2K4J A;  1USS A;  3HRS A;  4BBS J;  3U1D A;  2NVU B;  5GTI C;  3RQ4 A;  4A3G J;  3CF5 F;  1SFX A;  3FIS A;  2EA2 A;  3OR1 C;  3VVX A;  4CIC A;  1HF0 A;  1X58 A;  4KJZ A;  4K2E A;  2WBM A;  1O7F A;  4KIT B;  1VND A;  1DGW Y;  3FHN A;  1BR2 A;  1SVL A;  4L5E A;  4MO7 A;  4AM3 A;  3SFI A;  2H09 A;  2V1N A;  2VJ5 A;  3E0J B;  3IC7 A;  3W6K B;  4EM1 A;  3NRG A;  1F36 A;  4EGZ A;  2KKO A;  3QOP A;  1FY7 A;  4C3I J;  3L2U A;  4X0G A;  4BJT A;  5BPI A;  4A3J J;  2HEO A;  2DU9 A;  2OA4 A;  3I3L A;  3BCG A;  4RB1 A;  1QU3 A;  2COM A;  3V78 A;  3CRJ A;  4A5N A;  2KPM A;  1T33 A;  4U0Y A;  5HS7 A;  2XUB A;  4B8X A;  2E1C A;  1RUO A;  4XOP A;  4I01 A;  5LBQ A;  4GCV A;  5IYB J;  3WTV C;  3JAM Z;  4I0A A;  3ABM H;  2MBF A;  1LDD A;  1OYW A;  3A0H C;  4CCJ A;  2NS8 A;  2RNG A;  2PJR B;  4CYD A;  1N77 A;  2ZJP F;  3M3Y J;  3FDY A;  2Y0M A;  3K4J A;  3V7S A;  3FWE A;  4L62 A;  4M74 A;  4A6D A;  4QPQ A;  1RNL A;  2TRT A;  1HSJ A;  1WJA A;  3E6B A;  3HG9 A;  1LEB A;  2IBD A;  2WY7 Q;  2DPD A;  1KQ0 A;  2A05 A;  2XGC A;  5GP9 A;  5HDG A;  2ZJQ F;  2ZXI A;  2Y31 A;  1R1T A;  5ERI A;  1WJE A;  2HDD A;  1HA8 A;  3G56 A;  3GFM A;  3RTR A;  4QLC U;  3J81 K;  2O7T A;  4XKC A;  3V7C A;  2Y2Z A;  2ZB9 A;  1T56 A;  2FXA A;  1MDM B;  3GLL A;  2QBY A;  5H20 A;  5J3L A;  2VT2 A;  4S0H B;  2Y75 A;  4ANJ A;  4MK6 A;  1QNT A;  1R5H A;  2M0C A;  3ABU A;  4IHS A;  2ZCX A;  3EDP A;  3QPT A;  3KIO A;  3J80 K;  3WG9 A;  2LF8 A;  2CO5 A;  4EJO A;  3RKY A;  3N4M A;  1KU3 A;  2LBF A;  2MD5 A;  3QU3 A;  4XR6 A;  1W7P D;  2RQP A;  1KYW A;  2BZT A;  4I98 B;  2LFB A;  1MIJ A;  3KP2 A;  2UXP A;  3GME A;  1BL0 A;  1D0X A;  4XLE A;  1TC3 C;  3FXL A;  2R7T A;  4FAS D;  2D1H A;  2EPF A;  2E7W A;  2YU3 A;  3KP5 A;  3F8B A;  3AFH A;  5B5E C;  1O3S A;  3U2R A;  5GPA A;  1XSD A;  1EH8 A;  2IEK A;  1WVR A;  3LSK A;  5E3L A;  4CUG A;  1HDP A;  3OYK A;  3ZPL A;  1ODD A;  5IPA A;  3D5L A;  1P4A A;  5M5X J;  3HOT A;  3WE2 A;  2VBY A;  2F4M B;  2K86 A;  1JJ6 C;  3HTS B;  1CGP A;  2NVX J;  4X6A J;  1YO5 C;  3K1M A;  3WG7 H;  1RR8 C;  2JVG A;  2A2F X;  2XRO A;  3BJ6 A;  5DTD A;  2M2E A;  4GCL A;  4IZZ A;  1MW7 A;  3ZN0 A;  1KQ8 A;  2AXT C;  2H6B A;  2P8T A;  3K6G A;  2KLO A;  4UDS A;  2NNY A;  4MFE A;  4LLG F;  5H6Q A;  4UVA A;  2BW3 A;  5HBU A;  2M0M A;  3FXK A;  5FKN A;  2A5W A;  3HSE A;  1LE8 B;  1DDN A;  3SZT A;  1H88 C;  2JUC A;  2K9L A;  3IP4 B;  4PGG A;  2JUG A;  5ILV A;  5H9T A;  2ZCW A;  2P7V B;  4RGU A;  1WFX A;  1PUF A;  2BBY A;  4DYC A;  3HHH A;  2HDW A;  5J8C A;  2FBQ A;  3ON2 A;  3MZH A;  3O2P E;  1YI2 I;  1G59 A;  1RES A;  1AKH A;  3VUQ A;  5CVJ A;  4ENK A;  2XDV A;  2P7C B;  1X4O A;  2XDN A;  3CC2 I;  2QWW A;  2OF7 A;  5HS8 A;  3S1N J;  4KYW A;  3E6C C;  1BW5 A;  1TWG J;  2JJ7 A;  3SHF A;  2XSJ C;  2EH3 A;  3L2C A;  2BHZ A;  3RJP A;  1MSF C;  2NRA C;  3HOX J;  2OCC H;  4XID A;  4BDY A;  2QSH X;  4DOZ A;  2STW A;  1VQL I;  1SGM A;  4U9L A;  1NG6 A;  2IS1 A;  2G7H A;  3WU2 C;  4XOT A;  2LMD A;  2EFQ A;  3G3Z A;  4M71 A;  3S3O A;  4PSX A;  3NPI A;  2W25 A;  1ONV A;  5M3F J;  1JT6 A;  5D6E A;  1J5Y A;  5M3M J;  3CCL I;  3KYD B;  2CV1 A;  1W5S A;  2WTE A;  4G7H F;  3E7L A;  3HRM A;  1R6R A;  3JRH A;  4KDP A;  4GXO A;  3GYH X;  1I50 J;  2A69 F;  2W7N A;  2IS2 A;  1FIP A;  3BZK A;  3JCU C;  4QSH A;  5JLW A;  2GA2 A;  2A6H F;  1Y39 A;  1T0F A;  3QPS A;  2X6O A;  2X6W A;  1OFC X;  3GEU A;  5F6F A;  2B0L A;  3K69 A;  4HX8 A;  1TW2 A;  1U8B A;  2RAE A;  3FMR A;  3QOD A;  4II2 A;  1WQ2 A;  2IA1 A;  3I4M J;  3QP5 A;  2IAI A;  2ECB A;  2KMU A;  5LRS A;  2LK2 A;  2V7F A;  2DT6 A;  4F52 A;  2CH0 A;  4IQ4 A;  2R7X A;  2K3F A;  2QWT A;  2V6C A;  5E3O A;  3G71 I;  2EBI A;  4U0W A;  1OCR H;  5HDK A;  3OYH A;  3OS1 A;  2CW7 A;  2XRL A;  1GDT A;  1P4W A;  5LLQ A;  3K4L A;  1IW7 F;  3MAJ A;  2ZOY A;  2PG4 A;  3U9G A;  4FE7 A;  3ZMD A;  2EIM H;  1LVK A;  3G4S I;  1T0F C;  3VOE A;  4UV9 A;  3HRT A;  1WJC A;  1H9G A;  5K7H A;  4AC0 A;  3PAS A;  2RVC A;  4H4K C;  4P9U A;  1XMA A;  2X85 A;  3OIP A;  1B1B A;  4HLY A;  3F1B A;  3HHG A;  2LRD A;  2UWM A;  4HNV A;  1K79 A;  3M9A A;  1YJ9 I;  2E71 A;  2YSR A;  2FNA A;  4FE4 A;  3TO9 A;  4F7Z A;  3IAS 2;  2R5Z A;  2M4G A;  3K0L A;  4YZE A;  1WI9 A;  3BQZ A;  2JA5 J;  1OCC H;  3I5U A;  1BOB A;  4J01 A;  2GOM A;  2HPM A;  2EB7 A;  1GVD A;  3S93 A;  2JZY A;  3BG6 A;  5F08 A;  1AU7 A;  4BE1 A;  2ISY A;  3VYT B;  2PZ9 A;  4Y17 A;  5J40 A;  3IWF A;  4BL0 B;  4C9Y A;  3SFZ A;  3BJB A;  1ETW A;  2BXY A;  1UEL B;  4E7H A;  3BR2 A;  4IJA A;  4XLN F;  3HXL A;  1P9Q C;  1ZRD A;  3DPJ A;  4GCK A;  2QCO A;  5CQE A;  1M1E B;  2KL4 A;  3PPB A;  3QPH A;  1G8X A;  1OLT A;  3DPL C;  2ZO4 A;  2RNJ A;  3NRV A;  3GVA A;  3K7A J;  5CYV A;  4F55 A;  5BNG A;  5IP9 J;  3K4M A;  3A01 A;  1Y0U A;  2GBY A;  2Q2E B;  1RC9 A;  3SWH A;  3BQY A;  4M73 A;  2E1M B;  1ERD A;  3HM5 A;  3CLQ A;  3ZP5 A;  3E5U A;  1HOM A;  3ASO H;  2EFP A;  4LG0 A;  1IN7 A;  1O3T A;  5IT9 Z;  1XDS A;  4UUV A;  4R79 A;  1MGT A;  2EJR A;  2BVL A;  4OD5 A;  5DAJ A;  2ETH A;  1R5G A;  3KZI C;  2L9V A;  1VQ8 I;  3P7N A;  1T08 B;  3AQT A;  4XRF A;  1IF1 A;  1I6X A;  2DAO A;  4M3F A;  3K2A A;  1BN5 A;  1ACI A;  4PXI A;  3V6G A;  3KPH A;  1Z3X A;  2O6G E;  3OYF A;  1OR7 C;  4BHP A;  1YRN A;  3PO2 J;  4ME9 A;  3I71 A;  1FIA A;  3W2W A;  1YX3 A;  3ELK A;  2ZFU A;  1D1A A;  2EZK A;  2MC3 A;  4RB0 A;  2LKP A;  3HIM A;  2L9N A;  3GZ5 A;  4KWA A;  2ZME A;  4XMY A;  2XV4 S;  1W7P B;  2E2J J;  5GAE J;  3M1C A;  4O5V A;  5HS9 A;  1BI1 A;  1XGN A;  2F5D A;  5CVR A;  4MEX F;  3KP3 A;  1E3P A;  5D5U B;  2OI8 A;  4PCQ A;  1D5Y A;  4DVY P;  4KIC A;  2K7L A;  2QSG X;  3TDU C;  3LHQ A;  3Q5F A;  2FMY A;  1FYL A;  2IGO A;  1MBF A;  4P9F A;  1HST A;  3HUG B;  3FRQ A;  3KLN A;  2FD5 A;  1ETK A;  3V7R A;  1D8K A;  1FT9 A;  3C2G A;  5ILU A;  1ETX A;  3ML6 A;  3HE0 A;  4ICH A;  4LFU A;  1RR7 A;  2Z33 A;  2BY3 A;  3DKX A;  4HV5 A;  1EH7 A;  4PGH A;  4FCY A;  2M8E A;  1OYY A;  2JN6 A;  3ASN H;  4XSZ F;  3V42 A;  1U78 A;  2YVX A;  4D5C A;  1F1Z A;  4A0Y A;  2HOT A;  3L00 A;  3PNV A;  1IC8 A;  3I64 A;  5FD5 A;  3CMA I;  3N97 A;  3VW1 A;  2H94 A;  1MND A;  3I4P A;  2OV7 A;  3ZXS A;  4ZYD A;  2DW4 A;  3A2K A;  4BDZ A;  2XPV A;  2Z9O A;  2R7Q A;  3L7W A;  4FHT A;  4HW0 A;  5FKM A;  1MBE A;  1Z3Y A;  2CRG A;  2JK3 A;  3K4K A;  4BXF A;  3W6V A;  4HF2 A;  2HTS A;  3TP3 A;  2O8X A;  2AHQ A;  3H5A A;  5C4Y A;  4DYQ A;  1Z9C A;  2OAZ A;  5D8L B;  1LFB A;  1ZYR F;  2JPC A;  1HCR A;  4HKU A;  2EZI A;  2XSD C;  4GYG A;  2A6E F;  1R49 A;  2P81 A;  3OL4 A;  2K9N A;  4BQA A;  2E35 A;  1Y1W J;  3BRO A;  3BG5 A;  3S3M A;  3I4N J;  3WU0 A;  2G3B A;  2F48 A;  3IH2 A;  3MKW B;  3HL2 A;  2PMH A;  5E3N A;  1ZG5 A;  3KZY A;  3K70 C;  4D1Q A;  2I5U A;  3GW2 A;  1Z21 A;  2YS9 A;  2DDA A;  4CCO A;  2CQX A;  1EJ9 A;  2CMP A;  1X1A A;  2PBI A;  4Z2Y A;  2Y48 A;  2F4O B;  2XB0 X;  5FO5 A;  4UUS A;  3PUB A;  3O3K A;  1X1C A;  1YS7 A;  2M3A A;  5ED4 A;  2VUM J;  5AON A;  2P5V A;  1JE8 A;  4L0Y B;  2WB1 N;  2RQQ A;  2HKU A;  3GF2 A;  2YX7 A;  4UHT A;  1YTY A;  4RA2 A;  1SD5 A;  5CQG A;  5J1R A;  4KA4 A;  3KNW A;  2I8D A;  2XPW A;  2HTJ A;  4XON A;  1DP3 A;  1TWF J;  4E7I A;  4IQJ A;  5FGM A;  2LY2 A;  4A3I J;  3R4K A;  2Z5U A;  5IOY A;  2FML A;  1A36 A;  2DYS H;  3IAM 2;  5LFA A;  2B3W A;  2W1O A;  2Y0S N;  2HVQ A;  4NQW A;  1F5T A;  1REP C;  2BOL A;  3NNR A;  4O3M A;  4NUB A;  2QEN A;  3H9Q A;  1G3Y A;  1X1P A;  5FLV A;  2ZCN A;  2DA6 A;  2E5N A;  4LG3 A;  3FXU A;  2EWN A;  4BQN A;  5IY5 H;  1K78 A;  3TO7 A;  2PBX A;  2K40 A;  2QZ8 A;  3T1B A;  2F2E A;  3MN2 A;  3CO7 C;  2FQ3 A;  2E36 A;  4WWC A;  4RBO A;  2M4K A;  2QQ9 A;  2DMT A;  3GWZ A;  4OIN F;  4BUP A;  1ETY A;  5KNL A;  3ERE D;  2R7O A;  3ECH A;  3RDI A;  1LQ1 A;  3F6V A;  1ETO A;  2ADU A;  2EZL A;  4MQ9 F;  4IRI A;  4MLO A;  2ME6 A;  1PP7 U;  2GFN A;  3OIO A;  2IT0 A;  1HKS A;  1SFK A;  4A3C J;  4L5J A;  2JSP A;  2DG7 A;  2L5Q A;  5E8G A;  2CV0 A;  2YVE A;  3GCM A;  4GDF A;  2PJP A;  1Z7L A;  2ESH A;  3KLO A;  3EYI A;  1ZH5 A;  1JGG A;  4UVC A;  3H1C A;  2HS5 A;  2L4M A;  2A68 F;  3UNG C;  4LK1 F;  5J6X A;  1SMY F;  5EYR A;  2GIV A;  5CXG A;  2E1M C;  3JRF A;  5F1R A;  5LEK A;  3OYD A;  5K7F A;  2EFW A;  1K4S A;  1O7L A;  3AG3 H;  2QBY B;  3BNI A;  2CSO A;  5IOZ A;  2IP2 A;  5J1U A;  5D5X B;  1YW9 A;  2XB5 A;  5EF6 A;  1SFO J;  3LQR A;  3S2H J;  4JX5 A;  2EFO A;  2H27 A;  3S1M J;  2HXI A;  2DOE A;  2DTZ A;  4BBR J;  3AG4 H;  4CH7 A;  1HLV A;  3DPT A;  3KZZ A;  3MD2 A;  1ZR4 A;  2DA7 A;  5IP6 A;  2L4A A;  4HF0 A;  1HKQ A;  1A04 A;  4QIW N;  4ZYE A;  2LBF B;  1V3F A;  1JKQ C;  1UZC A;  1Z77 A;  1A6I A;  1L3L A;  3HTA A;  2OC6 A;  3G73 A;  1U5T A;  1UAA A;  5D6F A;  3M1E A;  2QSF X;  1OIS A;  3GXO A;  4I0B A;  4MEY F;  5B1B H;  5FRO A;  4ZTJ A;  5FFZ A;  1S5L C;  1R00 A;  2A5Y B;  4D9J A;  1DPR A;  3F3X A;  5E1W A;  5E8I A;  4PFO A;  3DEE A;  4C2M J;  3MKY B;  4LLN A;  5F0H A;  3PIP F;  2G0E A;  3W2A A;  3VP5 A;  3HJE A;  1HKT A;  3DU5 A;  5ICC A;  2K02 A;  3W3C A;  4D7M A;  2GAU A;  1BR4 A;  3KCC A;  4ZTF A;  1SD7 A;  1W36 C;  3ROU A;  2V79 A;  2MH9 A;  5FLX K;  3F6O A;  3JRD A;  4RM3 A;  3BTL A;  3CQZ J;  1QBJ A;  2KHM A;  2ZNZ A;  3K2Z A;  3OMY A;  4XKV A;  3SDG A;  4BHB A;  1UG0 A;  2K27 A;  1ORK A;  3ZQQ A;  4ESJ A;  5EZH A;  2R7V A;  2CFO A;  3DTE A;  3H5N A;  2CS3 A;  3H0D A;  5HDN A;  1QRY A;  4EM0 B;  2ISZ A;  1D5V A;  1HQC A;  1FEX A;  1TQI A;  3FKI J;  1QZE A;  3HZJ A;  4BU2 A;  3CMY A;  3QYE A;  3F8N A;  4B43 A;  1IRX A;  1XSV A;  1I3Q J;  2KQR A;  3L9F A;  2NP5 A;  1XN7 A;  3WGH A;  5TRD A;  4A3K J;  3OIQ A;  1BI0 A;  5HOD A;  3SZP A;  2BW3 B;  2LDU A;  3PFY A;  5DS9 A;  3L1P A;  4OAZ A;  2WAE A;  3QAH A;  4HSR A;  2W57 A;  2K9M A;  1I1G A;  2H1L A;  5J1Y A;  1J7K A;  2VI6 A;  2LRE A;  4JYK A;  5D5V B;  1Y8Q B;  1PUF B;  3M4O J;  4M9S A;  3AKZ A;  1JTX A;  5HAW A;  2CUF A;  2A6T A;  2E7X A;  5LGU A;  3C3W A;  3BC8 A;  1BIA A;  1MZB A;  1U3E M;  1JUS A;  1MMN A;  1AKH B;  2YUS A;  3DFG A;  4KIB A;  3WTT C;  2O9L A;  1LDK B;  4PZJ A;  1R7J A;  5K7Z A;  2W48 A;  3MZ8 A;  5EG0 A;  4KIS A;  3QOE A;  5M5Y J;  5M5W J;  2CUE A;  3GTM J;  3SYT A;  3S8P A;  1LFU P;  2DN0 A;  2MSY A;  4E4H A;  2VE9 A;  4AIH A;  3HRU A;  4JL3 A;  1NHA A;  2VJ4 A;  3BHQ A;  3E5Q A;  1T8I A;  1FPQ A;  1YQA A;  4C2M A;  4PJM A;  3DPU A;  3M8E A;  2CQK A;  4FIS A;  5L3F A;  3LSJ A;  3CUQ A;  3CDH A;  3W2V A;  3VB2 A;  4A2U A;  4EV0 A;  2RDP A;  4Y7N J;  1UCR A;  1XG1 A;  1R9T J;  1KU9 A;  2DMQ A;  2OER A;  2GIZ A;  2XAF A;  2MFZ A;  3M8F A;  4G8X A;  5HLG A;  2F07 A;  1FOY A;  3LSH A;  5FRM A;  3GFI A;  5D18 A;  1XGO A;  2WUI A;  2R7S A;  5K1Y A;  5EFY A;  1IV8 A;  5ICF A;  1KU2 A;  1Z0X A;  2CFX A;  2L9R A;  1JKP C;  5FMP A;  4YEL A;  4CYC A;  3MFK A;  2EA4 A;  2XGD A;  2Z99 A;  2ACJ A;  4NN1 A;  1ETV A;  4J00 A;  3E1S A;  3GTK J;  1J09 A;  3CUQ C;  5DUI A;  2VKH A;  3OYA A;  1S29 A;  2QKO A;  2HYF A;  1ZR2 A;  9ANT A;  1RKT A;  3WTZ A;  2HVS A;  2IXS A;  3LAJ A;  2QEX I;  2YPR A;  1FYM A;  1MJ9 A;  2PMZ N;  2PFB A;  4I6Z A;  4F91 B;  3CD6 I;  5BQT A;  2WAQ N;  1R1U A;  2FF4 A;  3WU1 B;  4JX6 A;  5DD8 A;  1YLF A;  4YEJ A;  3F21 A;  3FBI B;  4LMY A;  2LC2 A;  3BPX A;  2EFN A;  3GO5 A;  3S15 J;  3JW4 A;  4G6T B;  4B09 A;  4LOC A;  2RRE A;  2DJN A;  2HQN A;  4S05 A;  1OJL A;  1B9N A;  4L9N A;  3T5X A;  1IG7 A;  1XSX A;  3QQA A;  4Q47 A;  2ZFW A;  2NP3 A;  3BR3 A;  2DFF A;  2R5Z B;  4JKZ A;  4YFK F;  1SD6 A;  2MD0 A;  3K10 A;  3PNY A;  2BYV E;  1R23 A;  5CVV A;  4L9T A;  4P55 A;  1R22 A;  1GXQ A;  1W36 D;  2KIS A;  1BOA A;  4IRG A;  1XMX A;  3UR3 C;  2JSC A;  2CW8 A;  2Z16 A;  3DWL E;  2X48 A;  4UNO A;  4F92 B;  1BI3 A;  1I6H J;  5CXI A;  4LIV A;  4DJA A;  3Q9V A;  4XN0 A;  1W0T A;  2DT7 B;  5D1R A;  4BEH A;  2H8W A;  2H8R A;  1ZG3 A;  1XX5 A;  2BGC A;  2W00 A;  1JT0 A;  2STT A;  1FSE A;  2GWR A;  2XIG A;  2QQB A;  3A01 B;  3LSM A;  2D5V A;  1EA3 A;  2HZD A;  3OYG A;  5A2Q K;  4I99 C;  4A0X A;  2F5E A;  1S8N A;  1SFU A;  3IHU A;  3C1D A;  1SEU A;  3TKY A;  2CQ7 A;  1YW8 A;  3PQK A;  4CO8 A;  1YOV B;  1MD0 A;  2L0K A;  3KEQ A;  3TQN A;  4EJU A;  3WTX C;  2W84 A;  3CJD A;  1FJL A;  2OZ6 A;  3I53 A;  1H89 C;  2LG4 A;  2WAF A;  2IRF G;  4BNC A;  1WJ5 A;  3ZRG A;  4NBQ A;  4MTE A;  2HXO A;  1A6Q A;  1TT0 A;  2AXL A;  2DO7 A;  3FZV A;  4NEL A;  2UUZ A;  3MKZ A;  1P7J A;  2FX0 A;  3P9I A;  1QVT A;  1YRN B;  2VJI A;  5L3E A;  2K85 A;  3S14 J;  3TOA A;  3CUO A;  1K83 J;  4RB3 C;  1J75 A;  5F04 A;  4HBL A;  2LYC A;  1B72 A;  1I3A A;  3S1Q J;  1IN5 A;  3NAU A;  3OS0 A;  3LAP A;  2L9S A;  4BAY A;  1Z67 A;  4MXM A;  1Z1D A;  2LP0 A;  2Q1Z B;  2J5P A;  2ZME B;  3FIW A;  1QO0 D;  3G2B A;  5JFR A;  2CQQ A;  2FUG 2;  4CCK A;  4D7N A;  3J7Z I;  3FXR A;  3GEZ A;  2ZY9 A;  3PM1 A;  3M07 A;  4I76 A;  5EDN A;  2O61 A;  3A4C A;  3O60 A;  3PL8 A;  2ZXH A;  2VKE A;  3JSJ A;  1T95 A;  2E5Z A;  2HYG D;  5IYC J;  4JNN A;  4P96 A;  1TP4 A;  2L54 A;  2WWY A;  4BQO A;  1YS6 A;  3G6E I;  1X4P A;  3J7Y J;  2LKX A;  4KFC A;  1ON1 A;  1YE9 A;  3CP2 A;  4IEJ A;  3KZ9 A;  2JMW A;  4XK4 A;  1B6A A;  3GFJ A;  2JWT A;  2CGP A;  4IOA F;  3K9T A;  1SFE A;  3MEX A;  3NS4 A;  5TIS C;  1T39 A;  2IW5 A;  1S7E A;  4G6D A;  4HX7 A;  1E3H A;  3RSN A;  3HTH A;  4B3A A;  5F27 A;  2DDB A;  3JAM K;  3RKW A;  1VZ0 A;  3CMM A;  3BCB A;  3ZQF A;  2E2I J;  2CQN A;  2VJJ A;  2G7U A;  2GUH A;  3CCM I;  3H0G J;  3EUA A;  3UKG A;  1TNT A;  4U9N A;  3MMY B;  3JRG A;  4AUX A;  5IP7 J;  1X1D A;  1ZKG A;  3OY9 A;  3GTQ J;  1Q1V A;  1UB9 A;  4JOM A;  2HQ5 A;  5LHG A;  1FYK A;  5DV5 A;  4M3E A;  4EGY A;  3ZMU A;  1WWX A;  3OYL A;  4B48 A;  2VT3 A;  3V8K A;  1W5T A;  3PJR A;  2K9S A;  2JA2 A;  4C3J J;  3NAR A;  1F9N A;  5DYM A;  3JTG A;  3WHB A;  3J7A O;  3Q0W A;  2RN7 A;  4CZC A;  4KN7 X;  4U88 A;  4BS9 A;  3BDD A;  1UHW A;  3GZN B;  3ESW B;  2X6Y A;  1YG2 A;  3AQS A;  1G3W A;  3MVP A;  3BZC A;  1HW1 A;  1OCP A;  2HU9 A;  2QGU A;  5F0C A;  3KYL A;  2DXI A;  4HST A;  1LB2 A;  2X1C A;  3BTI A;  3HEF A;  3CCR I;  2QKL B;  5J8F A;  1QHG A;  4M6X A;  4XLH A;  2UZK A;  5EJC A;  3S5R A;  1WKM A;  3OOP A;  3VSK A;  1YJN I;  1FZP B;  1JTY A;  2VL8 A;  3KEO A;  3SEZ A;  3V8J A;  1SAX A;  3GTJ J;  2UXH A;  3I58 A;  3JSP A;  1MKM A;  4UUS B;  3COL A;  2UXI A;  2PI0 A;  1Y1V J;  4YII A;  5FJ8 J;  1SC7 A;  3C2H A;  2AQF A;  3OYJ A;  3VOX A;  2R7R A;  1U9O A;  3IL2 A;  2HFH A;  4PJ0 C;  4ZZL A;  5D8K B;  3LNQ A;  3GZ6 A;  1O4X A;  3BR1 A;  1S9H A;  1U9N A;  1QGP A;  2DA2 A;  2LH9 A;  1I27 A;  4PFP A;  1V55 H;  2LTP A;  3HTU A;  5HVQ C;  2B1E A;  3EUK L;  1RKW A;  4AYB N;  4U7B A;  3ZMV A;  4CSW A;  3CF2 A;  1SAN A;  2EZH A;  4NQW B;  5BMZ A;  1YYV A;  1JUP A;  2R7W A;  2GXA A;  2OTL I;  2HOS A;  4ZDL A;  1K78 B;  3I55 I;  3VEP A;  2NVT J;  3GTP J;  5E1X A;  2IGN A;  4HOB A;  1IN4 A;  1NH3 A;  3OYE A;  4XOR A;  2VQC A;  3HOW J;  4OU0 A;  4MIM A;  2RC4 A;  1O3R A;  1VQ4 I;  3S32 A;  4RDU A;  3E5X A;  2KIF A;  3I9V 2;  4A5M A;  3HKZ N;  1UHM A;  1GUU A;  2P4W A;  2G9W A;  1HDD C;  4HA8 A;  2VQG A;  3VDX A;  3ZQ7 A;  4DZP A;  2XGE A;  3BT9 A;  4LLL A;  4E7Z A;  2P5K A;  1P2F A;  1VQ9 I;  3MNL A;  4HRI A;  4LK0 F;  3RH2 A;  1FTZ A;  5JHU A;  4RM2 A;  2Z2S B;  4DNC A;  2M8G X;  2M9H A;  4BQQ A;  2V4J C;  5BOX A;  3B6C A;  4D0P A;  1VQN I;  3BWG A;  1MNM C;  4DW6 A;  3CCJ I;  3K4N A;  2CWE A;  3QKX A;  2RAS A;  2X4H A;  1J2X A;  3C18 A;  4RMN A;  3Q0V A;  2QVO A;  3RYR A;  2M5W A;  2DQL A;  1APL C;  5GAH J;  1P6R A;  1PVE A;  1QHH D;  3DEW A;  3S2W A;  4HNT A;  2OPT A;  2X1E A;  5IT3 A;  1Z7U A;  4C3H J;  5JVT A;  1XMK A;  2EV5 A;  4AIJ A;  3K1N A;  5CVU A;  4WK8 F;  3NWT A;  3RKX A;  2FU4 A;  3GTO J;  5LHH A;  4OWR B;  1QVU A;  2DMP A;  3HC7 A;  1ZK8 A;  3FK6 A;  2DQR A;  2DA5 A;  1PDN C;  4MGR A;  1K61 A;  3A0B C;  4V2G A;  3R60 A;  2B9S A;  2OJE D;  1OCO H;  4RAG A;  1YFH A;  4NNJ A;  1YJW I;  2L02 A;  3OV8 A;  1U5T B;  1TNS A;  3LST A;  1DP7 P;  1MJA A;  4G12 A;  2UV1 A;  2I10 A;  1U2W A;  2IS6 A;  1UMQ A;  3I59 A;  5ICE A;  1MJB A;  1X3U A;  4P5O A;  4UUT A;  4XRS G;  2QM3 A;  4BYY A;  4ZJZ A;  2ZBK A;  2IS4 A;  2MLG A;  1JUM A;  5ILS A;  2BVM A;  1ZG1 A;  2ZME C;  3FMS A;  2Q8K A;  4M3D A;  4HPQ A;  3BOQ A;  2DPU A;  1BA5 A;  4ASN A;  3LOC A;  2XF6 A;  5KAF C;  1UG2 A;  2GEN A;  3FK7 A;  5CKT A;  3B02 A;  4AVZ A;  3FX3 A;  1TWH J;  1Y8R B;  3F8C A;  4A69 C;  1KON A;  3LA2 A;  2DMU A;  2WA0 A;  1KYZ A;  1G4D A;  2V1X A;  1B4A A;  3E97 A;  1HW2 A;  1I1S A;  2FOK A;  4IHX A;  5FKO A;  5FFX A;  4ENJ A;  1OCT C;  1V5F A;  1FOK A;  3RD3 A;  4B3X A;  1ZGA A;  2XPU A;  2REK A;  4CCM A;  4OMY A;  3GFL A;  3MKL A;  3R0J A;  1B59 A;  3ANG A;  2R7F A;  3REO A;  3ANP A;  4FQG A;  2WB1 A;  5FLX Z;  2D2W A;  2Y69 H;  3BR5 A;  2L3D A;  2HI3 A;  4IHY A;  4CHU A;  1ZTR A;  2K9Q A;  4A3M J;  2D6Y A;  3HOS A;  4U7D A;  3AG1 H;  2JVH A;  5FKL A;  5JI6 A;  3AG2 H;  3BCA A;  2FEZ A;  1RUN A;  4OD4 A;  3K1P A;  3GTG J;  1GHC A;  2IVM A;  1OKR A;  4J19 A;  2R7U A;  1PP8 F;  2FE3 A;  4HAM A;  4YFN F;  1XCB A;  4F3Q A;  2CUJ A;  2UXO A;  2AS5 F;  1LEA A;  2Y0S A;  1RZ4 A;  1A5J A;  1L0O C;  1Z91 A;  2R3S A;  3DXJ F;  2R7Z J;  3ZN1 A;  3CCU I;  2XAG A;  4ESF A;  4KT6 A;  1FP2 A;  4RAF A;  1IRZ A;  3SQN A;  2LVS A;  4WXH A;  1QPI A;  4UVB A;  4IL6 C;  3KEY A;  5EG0 B;  2XAS A;  2ID6 A;  1JJ8 C;  4DZJ A;  2VBX A;  3FKJ A;  3MCZ A;  4CCL A;  5J47 A;  5KHD A;  2COB A;  1GXP A;  4N4N B;  1SVM A;  3G1L A;  1JI8 A;  2PX9 A;  5J4V A;  1KA8 A;  1W1W E;  1VQO I;  5CLS A;  2MYS A;  3QBM A;  3CUQ B;  3H9G A;  3VVY A;  3BJO A;  2MG4 A;  3S17 J;  5EEA A;  3N05 A;  3IUV A;  3WGI A;  3ABT A;  1T38 A;  1OCZ H;  1TW3 A;  3O6B B;  3VTI A;  1UI6 A;  1IUF A;  1DGR M;  2BEO A;  1HW5 A;  4EVI A;  1IJW C;  2KIQ A;  3CLO A;  4XSX F;  3P5J A;  4U87 A;  3VWB A;  3WGG A;  3BP8 A;  3ULQ B;  2C6Y A;  2J5O A;  3JR9 A;  4CYC B;  1WJD A;  2CJJ A;  3LWF A;  3CES A;  1RPW A;  3RYP A;  4EEF G;  3BLY A;  3C2B A;  2HR3 A;  4WIB A;  2M87 A;  2EIJ H;  1N25 A;  3CP8 A;  4WXD A;  5IT9 K;  3RZO J;  2Z1D A;  3FXQ A;  4LJZ F;  4PJJ A;  3ZMT A;  2FNP A;  2DK5 A;  3VOK A;  5JHF A;  3ZMS A;  2HWV A;  4LB5 A;  5K5R A;  1GLN A;  2WC2 A;  5FRN A;  2MC4 A;  3RCO A;  5FKK A;  3DKY A;  4RB2 C;  3CJT B;  4FX0 A;  4CA0 A;  3GTL J;  2DBB A;  4Y52 J;  3SJM A;  4M3G A;  4HDU A;  1R71 A;  2KZG A;  4G7O F;  3IWZ A;  2JA6 J;  3JTH A;  2W4S A;  1X1B A;  2LSO A;  2OQG A;  2QA4 I;  1AHD P;  2UXN A;  3I0T A;  1EKE A;  2P5L C;  2E2H J;  3J81 Z;  3TMO A;  2O7O A;  3OWT A;  4A12 A;  2GXB A;  2XHK A;  3EUP A;  3PIO F;  3ZCO A;  2W82 A;  4S04 A;  3HYI A;  2YX4 A;  2QTQ A;  4ZZD A;  1ZLK A;  1XPX A;  2ICW G;  3Q9S A;  4GCT A;  3FXJ A;  1P92 A;  3CZ6 A;  3J80 Z;  2EIK H;  2DI3 A;  1VQ7 I;  3HOU J;  2X0L A;  1WRJ A;  1XDU A;  3E6M A;  3D1N I;  2DA3 A;  4DQ2 A;  2M34 A;  3HGG A;  2FJ1 A;  1GV5 A;  4JQF A;  4D5F A;  4I09 A;  4L9J A;  4B1R A;  2IA0 A;  4BEH B;  2FBH A;  5H2F C;  3ZGK A;  4OOI A;  5D4S A;  5HOO A;  4BXX J;  1BC8 C;  4BXU A;  1U5T C;  4UV8 A;  2E1N A;  3TOB A;  1F4K A;  1B8I A;  1QA6 A;  5FGL A;  3HTI A;  4ITV A;  5D5W B;  2JA8 J;  3FXM A;  3L2Q A;  5E18 F;  3JRI A;  2MA3 A;  1A35 A;  1BW6 A;  1S7O A;  4MFD A;  3H3V K;  1FWZ A;  3S3N A;  5H6R A;  1ZAO A;  5HLI A;  2AQE A;  3ERM A;  3LSR A;  5DUK A;  1MMA A;  2R5Y A;  2VB6 A;  2KFD A;  4G9Y A;  1HXD A;  4RGS A;  3CJQ B;  1SVO A;  2XAH A;  3CJN A;  3LA7 A;  1G3S A;  3OR2 C;  1WSU A;  1G6N A;  1R4M B;  1BJZ A;  5JR3 A;  5E17 F;  2LY9 A;  4E7L A;  5A2Q Z;  3CO6 C;  4YIR X;  1VQK I;  4R8H A;  4ZH4 F;  1RI7 A;  3QPL A;  3S1R J;  1BC7 C;  5LHI A;  1W0U A;  5BPD A;  5LGT A;  2HYT A;  5IYD J;  2HYJ A;  3RPQ A;  1B72 B;  2G7G A;  2CU7 A;  1JKO C;  2YR2 A;  1KZH A;  1D1C A;  4M3B A;  1TL8 A;  2G7L A;  1X2M A;  3D5R C;  1JHH A;  2V9K A;  1IUY A;  5DCM A;  2ZSI B;  4AIK A;  1PUE E;  5DM6 F;  5TGT A;  3CCY A;  4WXC A;  1FTT A;  4UXN A;  1FNN A;  5GAD J;  2VBZ A;  2V9V A;  2EV0 A;  2XAU A;  3FBN B;  1VQM I;  2X9D A;  1K6Y A;  2BY2 A;  2OUM A;  2ZKZ A;  4C30 A;  4F93 B;  1KGS A;  1LVA A;  1XB4 A;  1TWC J;  4JP0 A;  3WTS C;  3WTY C;  5K58 A;  1YHQ I;  3VPR A;  4OIO F;  2DA1 A;  2GA1 A;  2X51 A;  3KE2 A;  3OYC A;  2JQ7 A;  4Q5S F;  2DJI A;  2PMZ A;  4IF4 A;  4XM3 A;  2HZT A;  3D0S A;  3F22 A;  2KT0 A;  3A1Y A;  5E3M A;  1R1V A;  2WAQ A;  4XLA A;  2KJC A;  1WH7 A;  1D3Y A;  2XAJ A;  1WH5 A;  4A93 J;  1ENH A;  2Z3Y A;  5AIQ A;  3MZY A;  5C4X J;  3VW2 A;  3KYC B;  3ABL H;  3V4G A;  2UXX A;  2VKV A;  4E70 A;  4GGG A;  5K5Q A;  4UB6 C;  1YIT I;  1AWC A;  2ID3 A;  3KP4 A;  5D4R A;  1Y56 A;  2L2O A;  5GAG J;  3KET A;  4ZDO A;  3VIB A;  2WAD A;  4HQM A;  1FX7 A;  2M7B A;  2YVH A;  4E7S A;  3BR6 A;  2BY0 A;  3DBH B;  4U0V A;  4OAY A;  4XKB A;  4IOC F;  1FP1 D;  1PJR A;  3M7G A;  2NYX A;  1FBS A;  2HPI A;  4XLC A;  5AIP A;  4HEA 2;  3IH4 A;  5GPC A;  4E7K A;  4NC8 A;  2L7K A;  4ZYH A;  3M8J A;  2QUF A;  3LJL A;  4EMS A;  3S16 J;  1S3J A;  2BE5 F;  2DFE A;  2MH2 A;  1TWA J;  1FC3 A;  2DLL A;  2EQR A;  2FRH A;  5B66 C;  3TDZ C;  1FOX A;  4HV6 A;  3BTC A;  3IUO A;  3T8R A;  1EH6 A;  3LSG A;  3KP6 A;  2Q24 A;  1WZ2 A;  5EEG A;  1ZHF A;  3FMQ A;  4CDG A;  4W1U A;  3HIF A;  2HGC A;  4AF5 A;  2RHA A;  4A6E A;  4QPO A;  1BJA A;  2D1V A;  3PSI A;  3U1K A;  4PJN A;  5CJ9 A;  2DMN A;  3QWL A;  1AA7 A;  2VAS A;  3PSF A;  3PO3 J;  2F4I A;  1U0J A;  2W24 A;  2R0Q C;  2ELK A;  3F8F A;  1UFM A;  4RLF A;  1VQ5 I;  2HDC A;  5K5O A;  3T8T A;  2KDZ A;  4AWX B;  5E20 A;  2WV0 A;  2K3P A;  4EJT A;  4XIC A;  3EYY A;  5KVR A;  4W97 A;  2QF7 A;  4JK1 X;  1HC8 A;  4DBR A;  1O3Q A;  2NNN A;  5HSZ A;  2M1B A;  3IRR A;  2F5V A;  1VQ6 I;  4E6K G;  4Q4Z F;  1OYI A;  3CDL A;  4L0Z B;  4X1E A;  1JXS A;  2RV8 A;  3CDI A;  2JT1 A;  2XF5 A;  3CTA A;  4UY8 I;  4JX4 A;  1K4T A;  2NOJ B;  1T98 A;  1A31 A;  1T2K A;  2FQ4 A;  4UB8 C;  3JRB A;  4B44 A;  1K6O A;  4BHC A;  4Y15 A;  1OQY A;  1TT5 B;  3ZQH A;  4C2U A;  3RIR A;  3TL4 X;  1ZGJ A;  2PQ8 A;  2VON A;  4AD9 A;  2V1U A;  2F6C A;  4HG2 A;  5FLM J;  5JVG F;  3HOZ J;  3GUD A;  1JHF A;  3IKV A;  4EM2 A;  3DBL B;  2ZJR F;  2ZJ2 A;  3F8M A;  1MMD A;  5DDG A;  5EGO A;  1CF7 A;  3CC4 I;  3F72 A;  4YFX F;  1JKR C;  1MH3 A;  4EJW A;  2JA7 J;  2VE8 A;  4ZYA A;  3T0Y A;  4EAT A;  4BJ6 C;  1IGN A;  1ZQ3 P;  1FOW A;  1KU7 A;  1NK2 P;  2PLY A;  2DT5 A;  3QRF F;  2RGV A;  3H5R A;  1TQP A;  6PAX A;  1TLH B;  4OMZ A;  1SAU A;  1DPU A;  2LKS A;  2WV1 A;  1IN8 A;  2OBP A;  1MSE C;  2PEX A;  1RRJ A;  2Y9Z A;  1QQI A;  5C3E J;  5EEH A;  2JRT A;  4ENN A;  1E3O C;  1HBX G;  1J9I A;  4MNU A;  2DOA A;  2V26 A;  4P1W A;  1ZN2 A;  4O6J A;  3IV5 A;  4XQF A;  5F64 A;  1X2N A;  4B47 A;  2CV2 A;  4I02 A;  4ZYG A;  1OMI A;  3AL0 B;  3C7J A;  3I59 B;  2VXZ A;  3MQ0 A;  2IA2 A;  2N8G A;  1VTN C;  2GM4 A;  1VFC A;  5LEJ A;  3BRU A;  3TBI A;  1EV7 A;  2QIB A;  3K8P C;  3O8H A;  5DM7 F;  1Y0N A;  2ME0 A;  4NB5 A;  3B81 A;  2NS7 A;  1J0R A;  2BV6 A;  3NI7 A;  2DG8 A;  3QU6 A;  3ABK H;  4HX4 A;  2XAQ A;  2OZU A;  3DP7 A;  3OYM A;  1MBJ A;  1IV6 A;  4Y4R A;  2K4B A;  4HF1 A;  2X1D A;  2R93 J;  4XRS A;  2E19 A;  2HQA A;  2NOG A;  4ABZ A;  2XVC A;  2ZXJ A;  2KIU A;  3BG7 A;  5L3B A;  2ZSH B;  3QP6 A;  4JBA A;  3CCV I;  1POG A;  2PN6 A;  4IVN A;  1UST A;  2LOO A;  3WE3 A;  2DCE A;  3P9K A;  2EV6 A;  1WJF A;  2ZNY A;  2TCT A;  2OU2 A;  1IZ1 A;  3VYS B;  3QYF A;  3VW0 A;  1TTY A;  1BIB A;  4QTR A;  3L2W A;  2P6T A;  3BTJ A;  5TJJ A;  4ON0 A;  2PJR A;  2R92 J;  3LFU A;  3GLX A;  3B6A A;  2VPL A;  3PQJ A;  3OL3 A;  3R61 A;  3GZI A;  1Z6T A;  3ISP A;  4M9X A;  1R58 A;  4YIF A;  2NXN B;  4AID A;  3X2Q H;  4AYB A;  4HQE A;  4L18 B;  3OOU A;  3BJA A;  1ON2 A;  4DBQ A;  1NTC A;  3FM3 A;  3VSL A;  4CGZ A;  1YX5 A;  5BS6 A;  3CCE I;  2LF7 A;  3BG3 A;  4A3B J;  1DUX C;  3EGQ A;  2P0W A;  4M9Z A;  4RLQ A;  2OCE A;  4KIG A;  1IN6 A;  2M30 A;  1X19 A;  4PK4 A;  1FLI A;  4RGR A;  3ZQG A;  3RI4 A;  4QWQ A;  2H1K A;  4KMU X;  3JSO A;  1S72 I;  1H0M A;  2OTJ I;  1IXR C;  2KDO A;  4IRV A;  4AU7 A;  1MDM A;  1IXS B;  3HKZ A;  3EQL F;  3K4B A;  2HOE A;  4B4C A;  5ICG A;  2L7F P;  1D0Y A;  4OIQ F;  3JRE A;  1YIO A;  4NC7 A;  3TED A;  1I5Z A;  1IRF A;  4CZZ A;  1ZEL A;  5F1J A;  2IGK A;  4NC6 A;  4GFB A;  4A3F J;  2ELH A;  2BXZ A;  4HYE A;  3NQO A;  3TW7 A;  4EQQ A;  4Z6Y A;  3HDD A;  4TV7 A;  3VOD A;  3BG9 A;  5CW8 A;  2VBW A;  4L9V A;  3A02 A;  3ZQL A;  3HTJ A;  3BR0 A;  2W53 A;  4Y3O A;  4GYI A;  1BR1 A;  3F0C A;  2DYR H;  2IGM A;  4GRI A;  3OYI A;  3EUH A;  4NHJ A;  2E34 A;  2MW8 A;  2V9P A;  1ZRE A;  2VIX A;  3VYU B;  3ZMZ A;  4MHG A;  1ZLJ A;  2KZV A;  1C0W A;  4IXA A;  5E79 C;  2DFI A;  2KRC A;  2WY8 Q;  2VC1 A;  2VKD A;  2V6E A;  2CUZ A;  3VFZ A;  1FSH A;  1V54 H;  3DKW A;  1RET A;  4IHT A;  2MGQ A;  1ZAR A;  2HNH A;  2ZCM A;  2L7M P;  4BKX A;  1MMG A;  4IKF A;  3SXY A;  4XNF A;  1OR7 A;  3RZD J;  3GBG A;  3IKT A;  1K7A A;  3FXO A;  3EUH C;  3NEU A;  2YU9 J;  2BY1 A;  3KP7 A;  2RKH A;  3H36 A;  5GTH C;  5AQC A;  1W5C C;  1VF9 A;  2V1D A;  2ZC2 A;  2XRN A;  3DF8 A;  4KUM A;  3VVZ A;  4XBF A;  1B9M A;  1WGX A; 
#chains in the Genus database with same CATH homology
 2O8K A;  3C2B A;  2XDN A;  1XG1 A;  3Q0U A;  4A3L J;  5D19 A;  3S1N J;  4CGR A;  2OF7 A;  1R9T J;  1BW5 A;  1TWG J;  2DMQ A;  2Y30 A;  2JJ7 A;  2OER A;  3P9T A;  3RZO J;  2EH3 A;  2F07 A;  1MSF C;  3HOX J;  4XID A;  2LLK A;  1LE8 A;  4FTH A;  2E1O A;  5D18 A;  3VOK A;  1SGM A;  2WUI A;  1MBH A;  5EFY A;  1Z0X A;  1F43 A;  2L9R A;  5FKK A;  5JLX A;  1JKP C;  5FMP A;  4CYC A;  4M6V A;  4BY1 J;  2XGD A;  3NPI A;  4NN1 A;  1ETV A;  3GTK J;  5M3F J;  1JT6 A;  3GTL J;  1IDY A;  4Y52 J;  3SJM A;  4M3G A;  5M3M J;  2JA6 J;  2QKO A;  3E7L A;  3HOY J;  3HOV J;  3JRH A;  1EF4 A;  1ZR2 A;  1AHD P;  1I50 J;  1RKT A;  9ANT A;  1FIP A;  4QSH A;  5JLW A;  3HB9 A;  4GFL A;  2WGB A;  2PMZ N;  4I6Z A;  3QPS A;  2E2H J;  2X6O A;  1OFC X;  2O7O A;  3GEU A;  2L7Z A;  2WAQ N;  1WI3 A;  2NVY J;  3EUP A;  4JX6 A;  1U8B A;  2RAE A;  2QTQ A;  1B8I B;  3I4M J;  2IAI A;  2ECB A;  4GCT A;  2LK2 A;  3S15 J;  3HOU J;  4LOC A;  2QWT A;  2DJN A;  5E3O A;  3OSG A;  1OJL A;  3D1N I;  2EBI A;  3E7Q A;  2DA3 A;  3WHC A;  2R5Y B;  1WCM J;  2XRL A;  2M34 A;  1GT0 C;  1IG7 A;  3QQA A;  1GDT A;  3HGG A;  2FJ1 A;  2NP3 A;  1GV5 A;  3BR3 A;  4D5F A;  2ZOY A;  4B1R A;  2R5Z B;  4JKZ A;  4FE7 A;  4BXX J;  4IHW A;  1MBG A;  5K7H A;  4AC0 A;  1B8I A;  2ZOZ A;  3PAS A;  5FGL A;  3HTI A;  3DCF A;  1WPK A;  2JA8 J;  1XS9 A;  3F1B A;  3JRI A;  2LD5 A;  1BW6 A;  4MFD A;  3H3V K;  4HNV A;  2X48 A;  3LSR A;  1I6H J;  5CXI A;  4FE4 A;  2R5Y A;  2UXU A;  1MH4 A;  1W0T A;  5D1R A;  2R5Z A;  4YZE A;  3BQZ A;  2H8R A;  2JA5 J;  1JT0 A;  4GFK A;  1BJZ A;  3Q3S A;  2LY9 A;  1GVD A;  5F08 A;  3A01 B;  1AU7 A;  1UHS A;  2D5V A;  2PZ9 A;  3C07 A;  3QPL A;  3S1R J;  1W0U A;  3RKQ A;  3BJB A;  2HYT A;  5IYD J;  1ETW A;  2HYJ A;  2G7G A;  1B72 B;  1UI6 A;  4BY7 J;  3BR2 A;  2CU7 A;  2L0K A;  4GCK A;  1ZGW A;  3DPJ A;  1JKO C;  1FJL A;  3CJD A;  2QCO A;  1H89 C;  4M3B A;  3PPB A;  2G7L A;  1X2M A;  3TW6 A;  3K7A J;  2GLO A;  2HXO A;  5BNG A;  5IP9 J;  4NEL A;  1P7J A;  3A01 A;  2FX0 A;  3CCY A;  2GBY A;  1FTT A;  3JRC A;  5C44 J;  3BQY A;  1QVT A;  1YRN B;  1H8A C;  2IU5 A;  3HM5 A;  4V2F A;  2X9D A;  3S14 J;  3O8G A;  2B63 J;  1K83 J;  5F04 A;  1HOM A;  1B72 A;  3S1Q J;  1TWC J;  4JP0 A;  3NAU A;  3OSF A;  5K58 A;  2ECC A;  3VPR A;  3KKC A;  2DA1 A;  3G1M A;  4MXM A;  2DA4 A;  2LP0 A;  4ACI A;  3HBL A;  3FIW A;  1UI5 A;  2CQQ A;  5DAJ A;  4D7N A;  2KT0 A;  5E3M A;  3AQT A;  4M3F A;  1WH7 A;  3K2A A;  3PM1 A;  4I76 A;  5EDN A;  4PXI A;  1WH5 A;  3V6G A;  3KKD A;  4A93 J;  1ENH A;  3O60 A;  1YRN A;  2VKE A;  3PO2 J;  3JSJ A;  5IYC J;  4JNN A;  5C4X J;  1FIA A;  4ME9 A;  3VW2 A;  1ETQ A;  2EZK A;  2VKV A;  4A3E J;  3HIM A;  2LKX A;  3KZ9 A;  4KWA A;  2ID3 A;  4IEJ A;  2JMW A;  5F0F A;  4XK4 A;  3VIB A;  3CWR A;  2JWT A;  1VI0 A;  2E2J J;  2YVH A;  1S7E A;  3BR6 A;  3HTH A;  2Y9Y A;  4B3A A;  2NX4 A;  2OI8 A;  1D5Y A;  5F27 A;  3IH4 A;  5GPC A;  2HOA A;  3LWJ A;  4AC6 A;  2AO9 A;  3ZQF A;  2E2I J;  3IH3 A;  3LHQ A;  2GUH A;  3LJL A;  3H0G J;  3S16 J;  3UKG A;  1TWA J;  2EQR A;  1P7I A;  1MBF A;  3JRG A;  1GV2 A;  4AUX A;  5IP7 J;  1ZKG A;  4NDL A;  3GTQ J;  3BTC A;  1Q1V A;  5C4J J;  3LSG A;  3FRQ A;  2HQ5 A;  2Q24 A;  3G7R A;  2FD5 A;  1ETK A;  4M3E A;  3S2D J;  4XRM A;  1ETX A;  3RQI A;  3HE0 A;  2K9S A;  4W1U A;  4ICH A;  4C3J J;  3JRA A;  3NAR A;  1RR7 A;  4AF5 A;  3WHB A;  2RHA A;  1NK3 P;  3Q0W A;  3LSP A;  4FCY A;  1U78 A;  2JN6 A;  4D5C A;  2HOT A;  3AQS A;  2DMN A;  3MVP A;  1IC8 A;  3ZQC A;  1OCP A;  4A3D J;  3PO3 J;  5F0C A;  1DU6 A;  2R0Q C;  5EZG A;  2ELK A;  3BTI A;  3HEF A;  3ON4 A;  4IHV A;  1IDZ A;  2KDZ A;  2XPV A;  1ITY A;  1WGX A;  5FKM A;  1MBE A;  2CRG A;  3W6V A;  2JK3 A;  3S5R A;  1JTY A;  3TP3 A;  1DU0 A;  3ZQI A;  3HGY A;  2AHQ A;  4DYR A;  4XIC A;  5C4Y A;  4DYQ A;  3GTJ J;  3A03 A;  2UXH A;  1LFB A;  4W97 A;  4UUS B;  2QF7 A;  1HCR A;  2UXI A;  3COL A;  4HKU A;  1Y1V J;  2EZI A;  5FJ8 J;  2XSD C;  5HSZ A;  2P81 A;  3VOX A;  2K9N A;  5FHP A;  1U9O A;  3CDL A;  3BG5 A;  2LR8 A;  1Y1W J;  1O4X A;  3I4N J;  4X1E A;  3LNQ A;  2QOP A;  3BR1 A;  2G3B A;  3IH2 A;  5EGO B;  1U9N A;  2DA2 A;  3TP0 A;  5E3N A;  2LTP A;  4JX4 A;  2FQ4 A;  1XC5 A;  3T6N A;  3JRB A;  2YS9 A;  1RKW A;  2CQX A;  4AYB N;  3ZOB A;  2XB0 X;  1SAN A;  2EZH A;  3ZQH A;  4UUS A;  1G2H A;  1JUP A;  2VUM J;  2G7S A;  2HOS A;  3G1O A;  2WB1 N;  2HKU A;  2NVT J;  5FLM J;  2NVQ J;  3GTP J;  2V57 A;  1CQT A;  3HOZ J;  1MBK A;  2VPR A;  3VW1 A;  3HOW J;  5EGO A;  5J1R A;  3NXC A;  3KNW A;  4MIM A;  2XPW A;  1JKR C;  4BBS J;  1MH3 A;  2JA7 J;  1TWF J;  4A3G J;  4RDU A;  3FIS A;  4A3I J;  1IGN A;  1ZQ3 P;  3HKZ N;  5IOY A;  3VVX A;  1HF0 A;  1X58 A;  1NK2 P;  1GUU A;  2Y0S N;  1HDD C;  3NNR A;  4DZP A;  2XGE A;  3BT9 A;  1VND A;  2ZCN A;  5FLV A;  4L5E A;  3MNL A;  2DA6 A;  3RH2 A;  4MO7 A;  1FTZ A;  3SFI A;  2M8G X;  2PBX A;  2K40 A;  2M9H A;  3MN2 A;  3B6C A;  2WV1 A;  1MSE C;  1MNM C;  3NRG A;  4RBO A;  2Y9Z A;  4DW6 A;  1F36 A;  5C3E J;  2DMT A;  3QKX A;  2RAS A;  1E3O C;  1ETY A;  4C3I J;  3IV5 A;  1X2N A;  3Q0V A;  4A3J J;  1APL C;  1ETO A;  3BCG A;  2EZL A;  3DEW A;  3V78 A;  4MLO A;  2OPT A;  2ME6 A;  2GFN A;  3CRJ A;  2N8G A;  3OIO A;  4C3H J;  1T33 A;  4A3C J;  2GM4 A;  1VFC A;  2DG7 A;  3BRU A;  2QIB A;  2YVE A;  3O8H A;  5IYB J;  3GTO J;  2ME0 A;  1QVU A;  2DMP A;  2NS7 A;  3B81 A;  3NI7 A;  1ZK8 A;  3FK6 A;  2DG8 A;  2DA5 A;  1K61 A;  1JGG A;  4V2G A;  1MBJ A;  1IV6 A;  2NS8 A;  2R93 J;  4G12 A;  4XRS A;  2I10 A;  2E19 A;  5EYR A;  3M3Y J;  5CXG A;  2NOG A;  3JRF A;  1UMQ A;  4ABZ A;  5K7F A;  4L62 A;  3BNI A;  2TRT A;  4UUT A;  4XRS G;  5IOZ A;  5J1U A;  2XB5 A;  1POG A;  5EF6 A;  1SFO J;  3S2H J;  1JUM A;  4JX5 A;  3S1M J;  2HXI A;  2DTZ A;  2IBD A;  2TCT A;  4BBR J;  1HLV A;  4M3D A;  1ZR4 A;  2DA7 A;  5IP6 A;  3VW0 A;  1BA5 A;  5GP9 A;  2XGC A;  3LOC A;  4QIW N;  4QTR A;  1UG2 A;  3BTJ A;  3FK7 A;  1JKQ C;  2GEN A;  1Z77 A;  1A6I A;  2Y31 A;  3HTA A;  1TWH J;  4A69 C;  2HDD A;  3G56 A;  2R92 J;  2DMU A;  3B6A A;  2O7T A;  2Y2Z A;  2ZB9 A;  1T56 A;  3GZI A;  4IHX A;  5FKO A;  1OCT C;  5J3L A;  3RD3 A;  4S0H B;  2XPU A;  4MK6 A;  2REK A;  2M0C A;  4C2M J;  3OOU A;  2ZCX A;  5F0H A;  2G0E A;  3MKL A;  3VP5 A;  3ANG A;  1NTC A;  3ANP A;  3BG3 A;  3BR5 A;  4D7M A;  4A3B J;  3EGQ A;  2HI3 A;  4IHY A;  1ZTR A;  2K9Q A;  4A3M J;  2D6Y A;  5FKL A;  3JRD A;  3GTG J;  3BTL A;  3CQZ J;  3ZQG A;  2LFB A;  2H1K A;  3SDG A;  2UXP A;  4J19 A;  1BL0 A;  1ORK A;  4B4C A;  1TC3 C;  2UXO A;  5EZH A;  2L7F P;  3JRE A;  3TED A;  1A5J A;  1QRY A;  1FEX A;  5F1J A;  2R7Z J;  3FKI J;  4GFB A;  4A3F J;  5GPA A;  3CMY A;  3TW7 A;  2IEK A;  3HDD A;  3BG9 A;  5CW8 A;  5E3L A;  3A02 A;  1HDP A;  1I3Q J;  5IPA A;  3ZQL A;  1IRZ A;  2NP5 A;  3HTJ A;  3BR0 A;  2LVS A;  5M5X J;  4A3K J;  2W53 A;  1QPI A;  5HOD A;  1JJ6 C;  3F0C A;  5EG0 B;  3L1P A;  5DS9 A;  2ID6 A;  2MW8 A;  1JJ8 C;  4DZJ A;  2COB A;  2NVX J;  4X6A J;  5J1Y A;  2VI6 A;  3G1L A;  4JYK A;  3M4O J;  1PUF B;  1JTX A;  5HAW A;  2CUF A;  5DTD A;  2M2E A;  3QBM A;  4GCL A;  1JUS A;  1AKH B;  2YUS A;  2O9L A;  3VVY A;  1RET A;  4UDS A;  2MG4 A;  4MFE A;  3S17 J;  2MGQ A;  5EEA A;  3IUV A;  5K7Z A;  2ZCM A;  2W48 A;  2L7M P;  5EG0 A;  4BKX A;  5HBU A;  5M5Y J;  5FKN A;  5M5W J;  2CUE A;  3GTM J;  3RZD J;  1IUF A;  3GBG A;  1LE8 B;  1LFU P;  2DN0 A;  2MSY A;  1H88 C;  1IJW C;  2YU9 J;  5H9T A;  4JL3 A;  3BHQ A;  1PUF A;  4DYC A;  2FBQ A;  3JR9 A;  4CYC B;  3ON2 A;  5AQC A;  1VF9 A;  4FIS A;  3LSJ A;  2CJJ A;  1RES A;  3VVZ A;  4Y7N J;  1AKH A;  3VUQ A;  1RPW A;  4EEF G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...