4M3GA

Rapid and efficient design of new inhibitors of mycobacterium tuberculosis transcriptional repressor ethr using fragment growing, merging and linking approaches
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
193
structure length
191
Chain Sequence
GDDRELAILATAENLLEDRPLADISVDDLAKGAGISRPTFYFYFPSKEAVLLTLLDRVVNQADMALQTLAENPTDRENMWRTGINVFFETFGSHKAVTRAGQAARATSVEVAELWSTFMQKWIAYTAAVIDAERDRGAAPRTLPAHELATALNLMNERTLFASFAGEQPSVPEARVLDTLVHIWVTSIYGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ligand Efficiency Driven Design of New Inhibitors of Mycobacterium tuberculosis Transcriptional Repressor EthR Using Fragment Growing, Merging, and Linking Approaches.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription repressor/inhibitor
molecule keywords HTH-type transcriptional regulator EthR
total genus 80
structure length 191
sequence length 193
ec nomenclature
pdb deposition date 2013-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4m3gA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 4m3gA02
5HSZA 5E3OA 2OF7A 2E2JJ 3E7QA 3IUVA 3L1PA 3UKGA 2VKVA 3ANGA 4A3LJ 3S17J 2ZCMA 4S0HB 3S2HJ 3VOXA 1NK3P 2EZHA 3BQZA 1POGA 5J3LA 4MFEA 4EEFG 2YVEA 5C4YA 1TC3C 1BJZA 1FJLA 1WH7A 2XPWA 5AQCA 1YRNB 3BR2A 2HYTA 3NAUA 3NI7A 1ENHA 2PMZN 1UMQA 3CCYA 1A6IA 1P7IA 2ME0A 3A01A 3S2DJ 3Q0VA 2ECCA 5EG0A 5FKMA 2HQ5A 2NP5A 1MBFA 3HIMA 2QKOA 3SJMA 2L9RA 4V2FA 5F1JA 4AC0A 1QVUA 2DA7A 1S7EA 4DYRA 2NVXJ 4C2MJ 3BG5A 3GTQJ 3S5RA 3S1RJ 1HDPA 4UDSA 3Q3SA 2E2HJ 1Z77A 1IC8A 4JKZA 1SGMA 2X48A 5JLWA 5M5XJ 3HTHA 3QKXA 4KWAA 2M8GX 4BXXJ 2GBYA 3NPIA 2W53A 1JKOC 1SANA 3HOVJ 1W0UA 1JKRC 1I50J 3PM1A 4NN1A 3TEDA 3A02A 2CQQA 5GP9A 2RHAA 5D19A 5EG0B 1X2NA 3H0GJ 3HDDA 1T33A 2ECBA 4A3JJ 3G7RA 1K83J 4DYQA 1JUPA 1SFOJ 3TP0A 5H9TA 2M9HA 1MBGA 3DPJA 1RESA 2UXIA 3VVXA 3HOYJ 3VP5A 1BW5A 2L7ZA 3BTLA 4M3BA 2LR8A 3OSGA 1B72A 2JA8J 3A03A 3DEWA 2VI6A 2D6YA 2EQRA 1XC5A 4M6VA 2CJJA 5F0CA 1U9OA 5IOZA 2R93J 4LOCA 5EYRA 4D7NA 3HE0A 1MBHA 2L7FP 2K40A 1ETOA 5IYBJ 3C07A 1IUFA 2WV1A 2O8KA 3GEUA 2O7OA 4XICA 5EDNA 2M0CA 2Y0SN 1ETYA 2HYJA 3HKZN 3JRIA 4JP0A 3W6VA 4ME9A 1G2HA 3LJLA 3TW6A 2IEKA 2R0QC 3H3VK 2DMPA 2IBDA 3BCGA 5K58A 2QF7A 4I76A 3I4NJ 4D7MA 3IH4A 3M3YJ 3SFIA 3K2AA 4M3GA 2HOSA 3PO3J 4A3IJ 1FIPA 2WAQN 2FBQA 3BT9A 3OOUA 1X58A 2CRGA 1Q1VA 2G7LA 4NDLA 2R7ZJ 3VW2A 1HOMA 2EZLA 2LFBA 4JX4A 4M3DA 3EGQA 3M4OJ 2DTZA 1FIAA 5M3FJ 3PO2J 4W1UA 3G1MA 2MG4A 1CQTA 2O9LA 1IDYA 2ZB9A 1QVTA 4RBOA 4MXMA 4FE4A 1H89C 2ZCXA 2GLOA 1TWFJ 2CUEA 3LSGA 1ETXA 1WPKA 1O4XA 3BRUA 1JTYA 2DA5A 1MNMC 3VPRA 3LSRA 2PZ9A 2REKA 2DA6A 2TCTA 4DZJA 4JNNA 2NS8A 2JN6A 3ZQLA 4GCLA 3JSJA 2ME6A 1RPWA 2MW8A 2G0EA 3ZQGA 2HXOA 2E2IJ 4MFDA 1JJ8C 4I6ZA 4A3GJ 1TWHJ 4JYKA 4BY1J 3GZIA 1ETKA 2HOAA 5EF6A 2QOPA 2NVQJ 1B8IB 1AKHB 3CWRA 1WCMJ 3K7AJ 3KZ9A 1ZQ3P 3D1NI 2GENA 2LD5A 2MGQA 4V2GA 4B3AA 2DA1A 2DMNA 3JRGA 4ABZA 2UXUA 3BG3A 5E3NA 1QPIA 1MBKA 5C4JJ 4A3DJ 1ETWA 2XRLA 5HBUA 2ELKA 5EEAA 1IV6A 1QRYA 4GCKA 1K61A 2GFNA 3NNRA 2Q24A 3QPLA 1FTTA 3ANPA 2HOTA 3BHQA 3VUQA 3IH2A 1TWAJ 1MH4A 3CRJA 3S1NJ 5HODA 1DU6A 1WH5A 3JRBA 5JLXA 2HXIA 5FHPA 3WHCA 1OCTC 3JRCA 5FMPA 1B72B 3O8HA 1ZK8A 1RETA 2M34A 3B6CA 1JT6A 2DA4A 4XIDA 3HOXJ 3GTMJ 1Y1VJ 3RKQA 3JR9A 3KNWA 4HNVA 5IP7J 1WGXA 2LK2A 4AF5A 2IU5A 1JT0A 3JRDA 4QIWN 5IYCJ 4CGRA 2DMTA 2JA5J 1F43A 4HKUA 5FGLA 4IHWA 5FLVA 2KDZA 2K9NA 5C44J 2O7TA 3HTAA 1IJWC 4IEJA 1I6HJ 2MSYA 5FJ8J 1LE8A 4NELA 4FE7A 2H1KA 4YZEA 3RZOJ 9ANTA 3V78A 2DN0A 1UI6A 1W0TA 3BR0A 4G12A 5FKLA 2LP0A 2G3BA 3JRAA 3ZQHA 3PASA 4W97A 1OJLA 4RDUA 2FQ4A 1Y1WJ 4UUTA 2DA2A 2XPVA 3RH2A 4A3CJ 5BNGA 2GUHA 3FKIJ 3OIOA 1DU0A 2EH3A 5F04A 3VOKA 4FTHA 5CXIA 3Q0WA 2FD5A 3EUPA 1ETVA 5EGOA 3C2BA 2QTQA 3LHQA 2JJ7A 1PUFB 1LE8B 2D5VA 2XGDA 2W48A 2WB1N 3MN2A 3HM5A 1MBEA 3HTJA 3ZQIA 4ACIA 4BBRJ 3BR3A 5IP6A 1RR7A 5J1RA 3F1BA 1ZTRA 4AUXA 4UUSB 2CQXA 4MLOA 4FCYA 5DS9A 5F0HA 3B81A 3MNLA 1BL0A 4AYBN 1JKPC 4DZPA 2M2EA 4J19A 2XPUA 3S1MJ 2R5ZB 1GT0C 2Y31A 3O60A 5D1RA 3GBGA 2AO9A 2DA3A 2X6OA 2F07A 3VIBA 1OFCX 3PPBA 4XRSG 1ZKGA 4PXIA 4QTRA 1LFBA 5D18A 4FISA 3S16J 5GPCA 1TWGJ 3LWJA 1LFUP 3BNIA 1H88C 1BW6A 3NRGA 4GCTA 3E7LA 3S15J 1HLVA 4IHYA 2Y2ZA 3BJBA 1PUFA 1XG1A 5FKNA 3ON4A 4UUSA 1RKTA 2JK3A 3MVPA 2DJNA 2R5ZA 2L7MP 1IGNA 5IPAA 3AQSA 1AU7A 1HCRA 5K7HA 2LY9A 2R5YB 2LTPA 4C3JJ 4A93J 5IP9J 5EFYA 1APLC 2NVTJ 1U78A 1E3OC 4L5EA 1GVDA 1ORKA 3VW1A 1H8AC 2ID3A 5E3LA 1GDTA 5FKKA 3COLA 4XK4A 4M3FA 3S1QJ 2NS7A 3TP3A 2VPRA 4XRMA 5K7FA 5EZGA 1NTCA 2WUIA 2R5YA 5K7ZA 1F36A 3JRFA 1ZR4A 2NVYJ 2OPTA 1JTXA 5CXGA 2UXOA 2YUSA 3BTIA 5M5WJ 3HBLA 1UG2A 2V57A 1U8BA 2I10A 5E3MA 3GTKJ 3S14J 5J1YA 3V6GA 3LNQA 1B8IA 4M3EA 1AKHA 1ETQA 1MSFC 2ZOZA 3MKLA 2YVHA 1MSEC 5C3EJ 5M3MJ 4B4CA 4MIMA 3CQZJ 5F08A 1JKQC 2YS9A 1VF9A 3GTJJ 2Y30A 3BTCA 4A3KJ 1HF0A 3RD3A 5EGOB 5CW8A 1I3QJ 4BKXA 4D5CA 4AC6A 2LKXA 1UI5A 2E1OA 2EZIA 2JA7J 5GPAA 2PBXA 4L62A 3JREA 2AHQA 4MO7A 3ZQFA 2WGBA 5EZHA 5FKOA 3TW7A 4C3HJ 2XSDC 5C4XJ 3GTGJ 1IDZA 2EBIA 3G56A 1NK2P 5DTDA 4D5FA 3JRHA 3GTPJ 3KKDA 1ZGWA 1FEXA 1U9NA 1A5JA 2X9DA 2XB0X 2TRTA 4Y7NJ 3P9TA 3NARA 2KT0A 3F0CA 4GFLA 2XGEA 1VFCA 2GM4A 2HI3A 4C3IJ 3OSFA 2JMWA 1T56A 3GTOJ 4JX5A 4A3EJ 5DAJA 4QSHA 4X6AJ 4BY7J 4JL3A 3BR5A 2VUMJ 2E19A 2JWTA 4B1RA 2DMQA 1XS9A 2G7GA 3I4MJ 2K9SA 2XGCA 3Q0UA 4CYCB 3T6NA 1BA5A 2NOGA 2DG8A 3QQAA 3HTIA 2FX0A 1GUUA 1IRZA 3HB9A 2NX4A 1UHSA 1TWCJ 3BR1A 3NXCA 3G1LA 1OCPA 2P81A 2VKEA 4BBSJ 4ICHA 5FLMJ 5F27A 3IV5A 1D5YA 1ZR2A 2EZKA 2DMUA 3HEFA 2H8RA 2QWTA 1MBJA 1EF4A 2YU9J 2LVSA 2OI8A 1JUMA 1GV5A 2Y9YA 5F0FA 1IG7A 1JJ6C 4DYCA 5IOYA 3HOWJ 1FTZA 3BQYA 1AHDP 3RZDJ 3FK7A 2XDNA 4Y52J 3ZQCA 3BG9A 3SDGA 4DW6A 5HAWA 3CDLA 4GFBA 1GV2A 3HGYA 3HGGA 3CJDA 1JGGA 1HDDC 1VNDA 3LOCA 1ITYA 2RASA 3QBMA 3FRQA 1X2MA 3HOUJ 4X1EA 4XRSA 3CMYA 1YRNA 3WHBA 2CU7A 2L0KA 2UXHA 2R92J 2B63J 3GTLJ 2HKUA 5M5YJ 2HDDA 2K9QA 3O8GA 1RKWA 2OERA 2QCOA 1JUSA 3FK6A 5IYDJ 2JA6J 2RAEA 3VVYA 2QIBA 3A01B 2UXPA 4CYCA 3G1OA 3IH3A 1R9TJ 3FISA 3LSPA 4JX6A 2ZOYA 2ZCNA 3HOZJ 4A3BJ 2IAIA 2COBA 3DCFA 3VW0A 2Y9ZA 4IHXA 1VI0A 2CUFA 3B6AA 4A3FJ 4A3MJ 1MH3A 1Z0XA 3QPSA 3FIWA 2DG7A 3BTJA 2N8GA 4GFKA 2ID6A 2LLKA 3RQIA 1WI3A 5J1UA 3ZOBA 4A69C 3AQTA 3VVZA 1P7JA 2G7SA 3KKCA 4IHVA 2XB5A 2NP3A 3BR6A 3LSJA 2FJ1A 4MK6A 3ON2A
chains in the Genus database with same CATH superfamily
5HSZA 3E6BA 2X4HA 3E7QA 3IUVA 3UKGA 3C3WA 2ZFWA 3F9KA 4RA2A 4YG2F 3CCVI 5L3EA 3CF5F 2J5OA 1C0WA 2MH2A 5H2FC 1V5GA 4R8HA 1NK3P 2VONA 2FMYA 3LSIA 4IQ4A 2XPWA 3J7AO 1USSA 1YRNB 1ENHA 4KNYA 1UMQA 3CCYA 2ME0A 2Y0MA 3A01A 2K3FA 2DK5A 3OMYA 2HU9A 2VJIA 3FKJA 2QYOA 3R4KA 4HLYA 4M9XA 3CESA 3PNVA 3HIMA 1IRXA 2A05A 2L9RA 3WU2C 4ZDOA 4DYRA 3BG5A 1HW1A 3S1RJ 4Q48A 3WGHA 2E2HJ 4FHTA 4E70A 1IC8A 3QODA 3OYMA 2FJI1 3MMYB 5JLWA 2FRHA 5M5XJ 1X1AA 5FD6A 3DEUA 2M87A 2A5YB 4J01A 2Q1ZB 4FASD 3ZP5A 3WG9A 2Z16A 4XLNF 3BC8A 1JKOC 1SANA 3TEDA 2FE3A 2ESNA 4P9FA 3H0GJ 1E17A 1XGSA 3QPTA 2CV1A 2XIGA 5FROA 5HLHA 3OYLA 1P4AA 2HPIA 3WGIA 1K83J 3BDDA 4NBQA 3H9JA 5FFXA 1SFOJ 1T0FC 1SEUA 2FOWA 1MBGA 4HX4A 3DPJA 1RESA 3N97A 2UXIA 3HOYJ 2MFZA 4F93B 2L7ZA 2QKMB 5D5VB 2FF4A 3CCLI 2A69F 3LA2A 4LLNA 2LR8A 5LHGA 3OSGA 5E18F 3DEWA 1FBSA 2D6YA 5IT9Z 3K10A 2LY1A 2K7LA 2F5VA 3SQNA 1KONA 2K40A 1ETOA 1FNNA 1HXDA 2WV1A 2O8KA 4WXDA 2O7OA 2L4AA 5B1AH 5EDNA 2M0CA 3OYEA 3BJAA 2Z5UA 4RAYA 3DBLB 4F7ZA 2PQ8A 2QGUA 2VQGA 5CVUA 4ZJZA 4ME9A 1G2HA 1DQUA 1W4MA 1IO2A 2OCCH 3L00A 3RI4A 3GWZA 1G3SA 3DEEA 2IEKA 4IJAA 2CW0F 2DMPA 2IBDA 5ICCA 2L9SA 3OYKA 3AAFA 3I4NJ 4M3GA 1QBJA 2F2EA 4A3IJ 5JHUA 3DKXA 2FBQA 2CRGA 1ZREA 2E5ZA 1MJ9A 1DPRA 2EZLA 2LOOA 2E7WA 4RGUA 5M3FJ 4U0WA 3E6CC 1CQTA 4U9NA 2VOPA 2O9LA 1IDYA 3OYAA 1QVTA 5EEGA 2R7OA 4XLPF 3CO6C 2CQ7A 3I59B 4FE4A 2A6TA 1K4TA 1FY7A 4NQWB 2ZCXA 2PJPA 2KISA 3BCBA 5CVIA 1MNMC 2DA5A 3LSRA 2PZ9A 2DA6A 2EJRA 2QM3A 2EPFA 1IXSB 1R22A 2V26A 5D6FA 3ZQLA 2VBYA 3JSJA 2PEXA 4CYDA 2MW8A 1ZAOA 3MEXA 3FF5A 2XROA 3G3ZA 2HXOA 3ZQ7A 2E2IJ 4MFDA 1QZZA 1YFHA 4P5OA 1TQIA 1VQ8I 2UUZA 4Q47A 2QOPA 3TBIA 2HVSA 3K7AJ 2NXNB 2H1LA 3ZMUA 4H0EA 2GENA 4AIHA 4B3AA 5IT9K 2UXUA 3BLYA 4ABZA 1Y0NA 5E3NA 1QPIA 4G6TB 1MBKA 1OQYA 4BH9A 1D0ZA 4CDGA 1U8RA 1R6RA 1TW2A 4XNFA 1R7JA 3S3OA 1FTTA 3ANPA 2QBYA 3BHQA 5J8CA 3H0DA 2GZWA 5HODA 1BI2A 4F3QA 2HDWA 2KKOA 1FSEA 3P9IA 3K4LA 2VT2A 4XSXF 3WHCA 5CYVA 4AIKA 2GA1A 2M34A 4BACA 1JT6A 2DA4A 2YPRA 3KPHA 2DCEA 3QYFA 1Y1VJ 2PMZA 1XX5A 2YR2A 4KITB 4LG0B 1OR7A 4Y15A 5IP7J 4PSXA 2E1MC 3HPHA 3LFKA 4AIDA 3J7YJ 4LIUA 3JRDA 3OL4A 2OQGA 4CGRA 1K7AA 3P9KA 2JA5J 2LF8A 3A0HC 3P5JA 3KYDB 4JBAA 2KDZA 2RN7A 4L0YB 2VJ5A 5CVRA 5HS9A 5HNHA 1IJWC 1GLNA 2MSYA 2X51A 1TT5B 2DAOA 4HOBA 1ZRFA 4RAFA 1HW2A 4YFKF 3OYDA 9ANTA 2HYFA 3MQ0A 3BR0A 3F8FA 5E79C 2IW5A 1BOAA 1Z7LA 3FHNA 3OR2C 3WTZA 4B47A 3NWTA 2FQ4A 3QOPA 3HOTA 1MDMB 1L0OC 1IV8A 2X0LA 3J81Z 3HUGA 4UUTA 4EJUA 2A68F 2QWWA 1YIOA 3DV8A 4IF4A 3EYIA 3M1EA 3GX4X 4P1WA 1LQ1A 2JUGA 1ETVA 1W1WE 2RQPA 3E97A 2IGNA 2QENA 2UXNA 2FNAA 3RYRA 1DPUA 1SAUA 1YI2I 1OPCA 3E5UA 3MZ8A 2K85A 2D5VA 3GEZA 2PJRA 2XDVA 3HTUA 3HTJA 1D0YA 1QO0D 1TZLA 3PIPF 3KIOA 3IP4B 4BBRJ 4ZTFA 2UV1A 2HZTA 2EWNA 4Y3OA 4IZZA 5DS9A 5GAHJ 3ECOA 3GFLA 3B81A 2DFIA 3MNLA 1O3QA 1BL0A 1JKPC 2ISZA 4IRVA 4UVBA 3S1MJ 4Z6YA 3M8FA 1D8KA 1LVAA 1PYVA 2KL4A 3O60A 3GBGA 2AO9A 1XSVA 3H5AA 1Z7UA 3VIBA 2LBFA 2E1MB 2V9PA 4XRSG 1ZKGA 1X19A 4PZJA 1EH6A 3I4PA 1E0EA 5D18A 5FGMA 2VBZA 2FOKA 5GPCA 3LWJA 4UV8A 1V55H 1AOYA 4A5NA 4AVZA 2MC3A 3V4GA 1U5TC 2IJLA 4HF0A 4BEHB 1LB2A 4GCTA 2O0YA 3I54A 4BDZA 1YJNI 2Z9OA 2Y2ZA 5DCMA 4XKCA 5HOOA 1XGNA 5FKNA 1PUFA 1I6XA 2OTJI 2XF6A 3L09A 1HKTA 3BWGA 1JE8A 1IGNA 3AQSA 3GMEA 1HCRA 4OMZA 4L5JA 4XKWA 4C3JJ 1BI3A 2A6HF 5IP9J 5DDGA 1APLC 2NVTJ 3KZ9A 2Y69H 3TO6A 3IKVA 1ORKA 1HSTA 1VQ7I 4XK4A 4HV6A 3F6OA 3TP3A 2IGKA 2M45A 1LDDA 3FXRA 5K7FA 1TL8A 2ZJ2A 5EZGA 5K7ZA 1F36A 1FT9A 1RRJA 1XDSA 2NVYJ 3S32A 1JTXA 4Y13A 2RGVA 1UG2A 3I71A 5ED4A 2LSOA 5HVQC 1IAWA 5LHIA 4XBFA 3LL7A 2I5UA 5J1YA 1ETQA 5CLSA 2ZOZA 2JVGA 4ENNA 4I02A 5C3EJ 1KQ9A 4D1QA 4MIMA 2LY2A 2JSCA 4G94A 3K4MA 5LFAA 3NEUA 4M6XA 2VOOA 1QU3A 2OBPA 3LSKA 1ZLKA 1F9NA 2Y30A 1F4KA 2OTLI 1HF0A 1V4RA 5EGOB 4UY8I 4NQWA 1YX3A 1S7OA 2AXTC 2E1OA 4S05A 4L62A 2V1XA 3FXJA 2ESHA 3JREA 3ZQFA 1STZA 4L18B 3VDXA 1KYWA 3OYJA 2LF7A 2EBIA 2CV0A 4LITA 3KKDA 2AXLA 2RKHA 1Q1HA 1FEXA 1MZBA 3DP7A 3WE2A 3LSTA 3K70D 2XB0X 4UVCA 1WWXA 3NARA 2KT0A 3HG9A 1FP2A 5DD8A 4C3IJ 3BOQA 1LFPA 2JMWA 2KZGA 4IRIA 4B43A 3GTOJ 3Q9VA 4A3EJ 3K1MA 2AS5F 2F5EA 4LG3A 3H5RA 2CV2A 3HSEA 3FXMA 2L9NA 2E19A 3V8KA 3M7GA 1UAAA 3DBRB 1D1BA 3ISPA 2R7XA 3Q0UA 2W00A 5J40A 3G2BA 3G6EI 2NOGA 5FRNA 2QQBA 1TNTA 3HTIA 1GUUA 4C2TA 1BIBA 3VYTB 3NXCA 1DP7P 1IRFA 3HRMA 3LWFA 1UFMA 1SFUA 4HZFA 4KIGA 2WA0A 5F27A 5FLMJ 3IV5A 2EFNA 5LBQA 3IUOA 3HEFA 2QWTA 1MBJA 2Z1DA 2R7TA 1MMGA 2IT0A 3D5RC 4BNCA 1JUMA 2Y9YA 1IG7A 5AIPA 2P6SA 2DFEA 4DYCA 4OD4A 1DP3A 1R5HA 3I53A 3GZ6A 2Q2EA 3N05A 3MZYA 3KYLA 1AHDP 1PVEA 2G9WA 5L3FA 2XDNA 3GO5A 5BOXA 3ZQCA 2NOJB 4DW6A 3FX3A 2HWVA 3HGYA 3T8RA 3DTEA 1B4AA 3LOCA 1WVRA 4KIFA 1P4XA 4XRSA 2CU7A 1KZHA 2VQCA 4L9JA 2DPDA 3D0SA 4IXAA 4RM2A 1YHQI 2UXHA 3GTLJ 2HDDA 3I59A 1RKWA 3O8GA 2OERA 2VC0A 4HF2A 4G6QA 1T38A 2RAEA 2JA6J 2X1DA 4EVIA 3M9AA 3A01B 3ZXSA 1YTYA 2UXPA 4K2EA 3T0YA 3OYNA 1QQIA 4KT6A 3LSPA 3J81K 4JX6A 2ZOYA 3RYPA 3HOZJ 4I09A 2IAIA 1SFXA 1S3JA 3OL3A 1RR8C 4OIOF 2KJBA 3DCFA 1J09A 3VW0A 1VI0A 3T8TA 3B6AA 4A3FJ 2IP2A 3KETA 3QPSA 1IN4A 3GFMA 3DPLC 1TT0A 3BTJA 2W85A 5DEQA 4M74A 1OYYA 4AD9A 2ID6A 5J1UA 4LJZF 4A69C 2F4OB 5LRRA 2JT1A 1JXSA 2NP3A 1WJ5A 2BY0A 4IHTA 2DOEA 1QPMA 5B5EC 2R7WA 5E3OA 2GXBA 5JVGF 3G71I 2VKVA 3F22A 3ANGA 3BG7A 2XAUA 3S2HJ 3L2RA 2COMA 4UHTA 2Y0SA 2QEXI 1YOVB 1SD6A 2EFPA 2EZHA 3ERMA 3K6GA 5KAFC 3PL8A 2Z3YA 1TC3C 4M6YA 1LNWA 1FJLA 2VQLA 4MQVA 3ERED 3RKYA 2L02A 3BR2A 1AWCA 3VSKA 2PMZN 2HGCA 1MNDA 1A6IA 1P7IA 3PFYA 4D9JA 1EJ9A 3CC4I 2V1DA 3K4JA 4ASNA 2H94A 3VWBA 5FKMA 3IL2A 2HQ5A 2NP5A 1MBFA 3DXJF 5F1JA 2QSGX 2VL8A 5KHDA 1LKXA 3KE2A 1HDPA 4UDSA 1ONVA 3TOAA 1W5TA 1Z77A 2HTSA 3H36A 4KFCA 1SGMA 3D5LA 4RLQA 2LREA 3HTHA 1T08B 4N0BA 3VYRB 4HX7A 4KWAA 1P92A 3ZMZA 1MJBA 4BXXJ 1X3WB 5D8KB 2MC4A 3TMOA 1U0JA 1JKRC 1I50J 3PM1A 1XB4A 3KZZA 3Q5FA 3EYYA 5D19A 2K86A 2KMUA 4AYBA 2ECBA 1GXPA 1X1PA 1KU7A 3OYIA 4EQQA 1ON1A 4YIFA 1R5GA 2RV8A 2PBIA 2WAEA 1EH7A 3DBHB 4XN3A 4DYQA 3LFUA 1WZ2A 1B59A 2M9HA 2OV7A 4HBLA 5DCFA 5DV5A 4EGZA 5BMZA 1FSHA 2STWA 3V42A 3HRSA 4OINF 1XMKA 2KDOA 5JHFA 1TLHB 3BTLA 4FETA 3EETA 4LFUA 4JK1X 5CVJA 5CKTA 2W24A 4O5VA 2O5RA 3U9GA 3A03A 2QQAA 3AG4H 5F0CA 5IOZA 1SAXA 4I7HA 1W7PB 1G8XA 5IYBJ 3C07A 2Y0SN 2AQFA 3OYHA 4PUSA 4EGYA 3JRIA 3W6VA 1FYKA 4BXFA 1Z6RA 3BCGA 3K8PC 2H6BA 1J75A 2HEOA 4NB5A 2QF7A 3JAMK 4D7MA 3IH4A 2CUZA 4UNOA 1X4OA 3OOUA 2P6TA 2G7LA 2R7ZJ 3FBIB 2QUFA 2HPMA 2PFVA 5HS7A 3KYCB 4G7ZF 1FYLA 3M4OJ 2DTZA 3ZN0A 3WE3A 2PLYA 1P4WA 3KEQA 1R23A 4I99C 1H89C 3ABTA 2GLOA 3LSGA 1K78B 1J5YA 2OA4A 1MGTA 1X3UA 4IPAA 1JTYA 3VPRA 3Q9SA 3VODA 4JNNA 2JN6A 3AG1H 4IL6C 1VQOI 1RPWA 2FMLA 3FZVA 1ZGJA 1OCRH 2ELJA 5E20A 1T39A 4XR6A 3ZQGA 2BEOA 4I6ZA 4A3GJ 1TWHJ 4A12A 2IA2A 4ENJA 5KAIC 4BY1J 1MD0A 3GZIA 3C1DA 5EF6A 4DOZA 4RB2C 1B8IB 2W57A 1IN5A 4BS9A 1AKHB 4GXOA 4P9UA 2DDBA 1WCMJ 2ZSIB 5F1RA 1ZQ3P 4BJTA 4CCNA 2O8XA 1USTA 3DQVC 2V9VA 3BG3A 2H6CA 3NWSA 2D1VA 1BR1A 2XASA 2IA0A 2GWRA 3QOEA 3SZTA 1QRYA 3M8JA 3IHUA 1IV6A 4B8XA 1DUXC 1K61A 1NH3A 3BG6A 1FMWA 1XN7A 2ZO4A 3K1NA 4PFPA 3QPLA 1ZRCA 5J4YA 3VUQA 2BW3B 3IH2A 1GXQA 1UHMA 3RKXA 3CRJA 1XCBA 1DU6A 1WH5A 2DJIA 2UZKA 3JRBA 3K69A 2FBIA 2HXIA 5FHPA 3A4CA 2A3SA 4I0AA 2DT5A 1OCOH 1QHGA 4HQEA 5FMPA 1B72B 4WK8F 3K1PA 1ZK8A 1RETA 4A2UA 4XIDA 1RZ4A 3HOXJ 3GTMJ 2XVCA 3RKQA 3BY6A 3JR9A 4HNVA 3RKWA 3N4MA 2E34A 2LK2A 4AF5A 2IU5A 1G6NA 1JT0A 2MABA 4QIWN 3K4BA 3J7AY 5ICFA 5FLVA 1S5LC 5D6EA 4AM3A 2PX9A 1QNTA 3HTAA 4KIBA 3ZPLA 4IEJA 1T6SA 2K4BA 4FE7A 2H1KA 4HPQA 3RZOJ 2BV6A 2W1OA 4C2MA 4IRHA 3K4KA 3CUOA 5K5OA 4ZZLA 3JRAA 2KP6A 2UXXA 5TRDA 3ZQHA 3PSIA 2LMDA 2B1EA 3F8BA 1FBQA 3OS2A 4RDUA 1IXRC 1IZ1A 2DDAA 2ZKZA 2MLGA 3DLLF 3LSHA 2DA2A 4HSTA 4A3CJ 5BNGA 2GUHA 3F72A 5F6FA 3RSNA 2P7VB 4XORA 3ZN1A 1YE9A 2JRTA 3ZGKA 1MDMA 3VOKA 3VSLA 4N9IA 1BI0A 3F8MA 3Q0WA 2DOAA 1R58A 2BOLA 4PDKA 5BQTA 3GLLA 3P9CA 1U6GA 2KIFA 3KEYA 5EGOA 4ANJA 4EJWA 3LHQA 4ZTJA 4ON0A 1MIJA 3V8LA 3K0LA 1PUFB 1LE8B 2KIQA 3CF2A 1YIJI 1Z9CA 1MMSA 2XGDA 3FDYA 2W48A 3EUAA 4CCMA 4RAGA 2MD5A 5IP6A 3E5XA 2HZDA 2CQXA 4UUSB 4MLOA 3IWFA 5DUKA 1EH8A 4A6EA 1OYIA 3CCQI 3JAMZ 4DGWB 3L9FA 1YW8A 4HNUA 2XGXA 2OZUA 2M2EA 4J19A 3S3MA 2R5ZB 3ZCOA 1X3ZB 5D1RA 4H4KC 4OIPF 2BXYA 5E8IA 3PPBA 2EB7A 2K9LA 2E36A 2F4IA 4MHGA 3AG2H 4IKFA 4E7KA 4RGXA 3ULQB 4ZDPA 2L5QA 2P5KA 3KLOA 4CZCA 5DM6F 4WXHA 2VODA 3CCRI 2DQLA 4HDVA 1G3TA 5L3BA 1XG1A 2L4MA 2ZJPF 2L54A 4E7ZA 1RKTA 3VB2A 4UUSA 1W7PD 2IRFG 2R5ZA 2L7MP 4GYGA 3SYTA 1TW3A 5D4SA 5LLQA 2YU3A 3CCEI 5K7HA 3WTWC 4E7IA 2LTPA 4RAZA 4A93J 4NC8A 2FEZA 3QAHA 3EPZA 5A2QK 3QRFF 3K4NA 2V6CA 2ID3A 3I5UA 3COLA 5FKKA 2NS7A 1YW7A 2VPRA 3S8PA 4U7BA 2DODA 2VBXA 3FXQA 5BS6A 3OR1C 2R5YA 2ISYA 2UXOA 2FBHA 4D0PA 2RDPA 4ZYHA 2QLZA 1BR4A 3LNQA 3L2WA 4IO9F 1MSFC 3RQ4A 2ZCWA 2YVHA 2LRDA 5FD5A 1B1BA 1MMAA 1P2FA 1Z05A 3OIQA 4XKVA 2I8DA 4UV9A 4JQFA 2A6EF 3RD3A 4L9NA 1A31A 5CW8A 1I3QJ 2NNNA 4D5CA 3E6MA 3U1KA 2OQRA 2WAFA 3RPUD 2Q0OA 4S04A 3KX2A 1XSDA 1UI5A 3KEOA 2X6XA 4EM0B 5CVVA 1IF1A 2KPMA 5FKOA 3TW7A 4M73A 4C3HJ 3GTGJ 4GYIA 4ETSA 4XONA 2XV4S 4ESFA 4UVAA 5DTDA 3JRHA 3TOBA 1WJAA 3ONQA 5KK1A 2X9DA 2TRTA 2W84A 4GFLA 1OKRA 1SMTA 2XGEA 1SVOA 5CQEA 1XDUA 4L9TA 3CC2I 4DIQA 3GYHX 2KFDA 4OIQF 1U3EM 2DW4A 2ELHA 1WRJA 3CDIA 3IKTA 2DMQA 3RJPA 5HDKA 3FXOA 4BHBA 2G7GA 2K9SA 2PFBA 2XGCA 1MMDA 2PI0A 2XAHA 3LMMA 1Y8QB 2G7UA 1E3PA 1RUNA 3QU3A 5KNLA 5K5RA 2FX0A 3C2HA 5CQGA 2K9MA 2KIUA 2NX4A 3BR1A 1TWCJ 1OCCH 4EV0A 1S8NA 2VKEA 3CP8A 2BW3A 4ICHA 2KQRA 1LPQA 1D5YA 1ZR2A 2CW8A 2EZKA 2FA5A 2DMUA 2F4MB 4PCQA 2H8RA 1O3SA 1EF4A 3CO7C 2YU9J 1WHUA 1N78A 2LH9A 3HYIA 2XF5A 2A07F 3W2VA 4YFNF 5IOYA 3HOWJ 5ILVA 3ASOH 5FLXK 3BQYA 4YIRX 3RZDJ 1HQCA 3SZGA 3SDGA 3HGGA 4NUBA 4PSWA 3ZMTA 1HDDC 4KT5C 2CS3A 3H5NA 2P5VA 1TNSA 1YX5A 4L5IA 4UXNA 4X1EA 4AU7A 3WHBA 1JHFA 4F91B 4B09A 2L0KA 2XAJA 2R92J 2B63J 3TL4X 2HKUA 4KICA 2VN2A 1U5TB 1FOYA 1G59A 2V9KA 1EV7A 5IYDJ 1J0RA 3FWEA 1J7KA 4BJ5C 3RIRA 3O6BB 2CQNA 3CMAI 5J47A 2Y48A 1R9TJ 3G1OA 3IH3A 3RCOA 2R7VA 3BJOA 4A3BJ 3K2ZA 2YX7A 4II3A 1YO5C 4IHXA 1FOKA 3J80Z 1Z0XA 5HS8A 2Z2SB 1FBUA 1W5SA 2F5DA 4FQGA 1XSXA 3HPGA 4GFKA 2VXZA 2LLKA 2JZYA 2BZTA 2MBFA 1WI3A 3T5XA 5HNFA 1D8JA 1P7JA 2G7SA 4IHVA 1MMNA 1X1DA 2XB5A 3CUQA 4RB0A 1QZEA 2K3PA 1X4PA 4BQAA 1LJ9A 2K5CA 2OF7A 3L1PA 5D5WB 3DF8A 2W7NA 1R71A 3S17J 1FMVA 3UR3C 2IS2A 3VYUB 2P7CB 1OR7C 1YG2A 2OU2A 1HBXG 4MFEA 4IOAF 1RNLA 1BJZA 4PJJA 1EKEA 5IY5H 1K78A 1WH7A 5AQCA 2HYTA 3NI7A 3DU5A 3NAUA 2O3FA 2O61A 2E1CA 2Z33A 2M8EA 3S2DJ 2ECCA 1LDJA 5EG0A 1PP8F 1VQ9I 4BGDA 2IGOA 3IAS2 2DYSH 2E1NA 2QKOA 2KJCA 4BE2A 2IS4A 1S7EA 2NVXJ 4C2MJ 3GTQJ 4LB5A 3W6KB 3H3UA 3Q3SA 2R7RA 2JPBA 2EV5A 4XLAA 2X48A 3BCAA 3GF2A 5FRMA 1V5EA 3QKXA 2DTRA 3SEZA 2ZBKA 4OOIA 5H6QA 4M71A 3IRRA 1IN7A 2W53A 3HOVJ 2VJ4A 1SVLA 5GP9A 1BOBA 3HDDA 1X2NA 2LKSA 3C18A 4CSWA 3NRVA 3G7RA 1JUPA 3TP0A 5H9TA 3RPUA 2KRCA 3WGGA 3VVXA 1BJAA 1VQLI 2Q8KA 1BW5A 2GXGA 1R1TA 2JSPA 2D45A 3F6VA 1MNEA 1SFEA 2CH0A 2BY3A 4A0ZA 1BI1A 4B44A 2EINH 5L3DA 3FXKA 3ABKH 3HZJA 2EQRA 1U9OA 5EJCA 3LAJA 2M5WA 5EYRA 3QYBA 4D7NA 3HE0A 1MBHA 2L7FP 1IUFA 5E8GA 4ESJA 2BVLA 1KU2A 3GEUA 4XICA 1FYMA 3H1CA 4IVNA 4CCKA 3DTKA 1FLIA 1ETYA 2WY8Q 2HYJA 5EEHA 1MJAA 4LK1F 3HTSB 4CICA 1KU3A 1LVKA 1WFXA 3LJLA 3TW6A 3H3VK 5B66C 2IXSA 3HL2A 2JRMA 2VKDA 3M3YJ 2XKPA 3SFIA 3K2AA 2HOSA 1FIPA 2WAQN 4TV7A 3WODF 2HQAA 1WI9A 2DT7B 4V19K 2PMUA 1WJDA 2V1UA 1G3YA 2O03A 3VW2A 1HOMA 2OJED 4XQFA 4E7HA 2LFBA 3CJQB 4JX4A 3R6SA 3PO2J 4W1UA 3SWHA 4RBOA 4MXMA 1O7FA 2CQKA 2M30A 3SXYA 2CUEA 1FOWA 2V79A 3X2QH 1O4XA 3DPUA 1EA3A 2REKA 2QSFX 1S29A 4PJ0C 4DZJA 1REPC 2ZC2A 4XLHA 5D8LB 4FX0A 3KZYA 5CPRB 3ABMH 2ZMEA 4XN0A 3ZMDA 3VYSB 2G0EA 2DBBA 2ZJQF 3FMSA 1YQAA 3P7NA 3MCZA 3DU6A 1JJ8C 4RGSA 2NVUB 5D4RA 4JYKA 5D5XB 2LYCA 4AWXB 1ZELA 2XKOA 2R3SA 4BQOA 2NVQJ 1G3WA 4OWRB 5DD4A 2ZXHA 2F48A 1T98A 3D1NI 1S72I 2PG4A 1IN6A 2ETHA 1ON2A 2MGQA 2VT3A 4V2GA 3H35A 3F21A 2OAZA 2DMNA 3JRGA 1P6RA 5C4JJ 2A2FX 2XRLA 5HBUA 5EEAA 2QQ9A 2JPCA 1D0XA 3CCSI 5AIQA 3NNRA 3ASNH 4Q4ZF 1SD5A 1ZYRF 3I3LA 4BE0A 2FNPA 3SHFA 4N9HA 2QSHX 2R7DA 5JLXA 1SD7A 1V3FA 3EUHC 2OCEA 2EIJH 1I39A 4OAYA 4RMNA 3JRCA 3LA3A 1WKMA 3TDZC 2CW7A 3O8HA 4F92B 3B6CA 3IAM2 3O2PE 5E1XA 2WWYA 4E6KG 2Z99A 4KISA 5D5UB 4LK0F 3KNWA 2M7AA 1WGXA 3JTGA 4PK4A 1VQ5I 3I55I 3MFKA 2DMTA 5LGTA 3GLXA 5FGLA 2YVXA 2DU9A 5TGTA 3MKZA 2KIMA 3J80K 3ABLH 3HHGA 4BAYA 3W2AA 1FC3A 3GFJA 1TTYA 4HW0A 3WG7H 5FJ8J 1ZLJA 5GTIC 1LE8A 1U2WA 1O57A 1PDNC 3WU0A 3R61A 3V78A 4M72A 2RQQA 4CCLA 1UI6A 4ESBA 1D1AA 4CH7A 2VLAA 2LP0A 4G7HF 1SD4A 3ZQQA 2BY1A 4O3MA 2BHZA 4GGGA 1R00A 2ZXIA 4NNJA 4W97A 1OJLA 1ZHFA 1UJ8A 1RC9A 3BZ6A 1I1GA 1TQMA 4RM3A 4DNCA 3PJRA 1Y1WJ 2QKLB 3RH2A 3CP2A 3S2WA 4L0ZB 4A0YA 2HVQA 3FKIJ 5J8FA 1FZPB 3OIOA 1DU0A 2CFXA 5F04A 4KUMA 1K6OA 5GAEJ 5CXIA 1KU9A 1XMAA 4M9SA 1K6YA 3DFGA 1SC7A 1A36A 4LMYA 4R1HA 4BHCA 4LB6B 3EUPA 1A35A 3OV8A 3V7SA 3I58A 1T0FA 1SVMA 2FQ3A 3OS0A 5FLXZ 1DDNA 4P55A 4QLCU 2KHMA 3K4CA 3MN2A 4YELA 2EV0A 3ZQIA 1BC7C 2DPUA 1RR7A 1Z6TA 1Y8RB 2ZY9A 3HIFA 4AUXA 4BXUA 3NS4A 1PUEE 3NQOA 2LC2A 3GZNB 1Z1DA 2L3DA 5KVRA 1CGPA 1O7LA 2FBKA 3OY9A 1KQ8A 4DZPA 4HDUA 4YEJA 1GT0C 3HJEA 2Y31A 4ENMA 4U9LA 2RNGA 4XMYA 2X6OA 1Z21A 4C9YA 3MAJA 1OFCX 4BEHA 2LG4A 4WIBA 3CCMI 3IWZA 4QTRA 3PSFA 1Y56A 4XLEA 1ZRDA 1J59A 1LUJB 1YW9A 3BPVA 3S16J 1RUOA 3LSMA 1TWGJ 1LFUP 3BNIA 4PJNA 1F1ZA 2IGMA 5J6XA 1TBXA 4WX9A 3NRGA 4EM1A 3E7LA 1BM9A 1UZCA 2WTEA 3LAPA 4XSZF 2VASA 2GIVA 1BN5A 3MVPA 3HRTA 2XSJC 2XRNA 4MNUA 4U0YA 3HKZA 1SFKA 3S93A 3CJNA 3WTYC 3HXLA 2LY9A 4BQQA 2R5YB 1HSJA 1S9HA 5EFYA 2J5PA 1T2KA 3JTHA 3E5QA 3LA7A 1GVDA 3VW1A 2R4GA 1H8AC 5KCMA 5E3LA 1SMYF 1GDTA 3AFHA 1D5VA 3J7ZI 2XC7A 5IT3A 3I56I 1XTAA 2DT6A 5GAGJ 2WUIA 2DFHA 1ZR4A 2OZ6A 4G9YA 2OPTA 5CXGA 2G7HA 2YUSA 4QWQA 1H9GA 5M5WJ 1OCZH 1R1UA 4KMUX 4DQ2A 2V57A 1U8BA 2I10A 5E3MA 3GTKJ 3S14J 3ESWB 1UELB 3JCUC 1HKQA 3KCCA 1MSEC 2CUJA 5M3MJ 4B4CA 5F08A 3CQZJ 3A1YA 4BL0B 4BU2A 1JKQC 2YS9A 1VF9A 2HYGD 2GAUA 2HKXA 5ILSA 3VFZA 3GTJJ 4BE1A 3BTCA 4A3KJ 4FT8A 3CCJI 2KRHA 1ZG5A 1QA6A 1UCRA 3KZIC 4CO8A 3RTRA 3COAC 2EZIA 2JA7J 5GPAA 2PBXA 2AHQA 2CG4A 2L9VA 4HA8A 4MO7A 2QVOA 2YSRA 5JI6A 2QBYB 3L2UA 4RLFA 1IUYA 4ITVA 2EA4A 1NK2P 1UG0A 2H09A 1WJEA 4XL9A 4D5FA 3QU6A 2M0MA 3V8JA 1ZGWA 1A5JA 5B1BH 3C2GA 3OSFA 1T56A 4JX5A 2XAQA 1FOXA 1WSUA 2ACJA 1W7PA 2ZNYA 4X6AJ 4JL3A 3LQQA 2VUMJ 2LDUA 1MW7A 4WF2A 1DGWY 1YJ9I 2E5NA 1XS9A 4LIVA 3T6NA 4LGWA 1BA5A 1YS7A 2GOXB 3FBNB 3BROA 2DG8A 4DBRA 3QQAA 2HKOA 4C30A 1VQNI 4HF1A 1YJWI 6PAXA 1OCPA 1NG6A 2P81A 1IXCA 4BBSJ 1B9MA 5ERIA 3T1BA 4GCVA 1HA8A 2GXAA 3CC7I 2RREA 4EMSA 4R79A 3U21A 2NRAC 3DKWA 1N25A 4NHJA 2F5CA 2JVHA 4FX4A 4ZYAA 1BIAA 4L9VA 1VQ6I 2HNHA 2IPQX 2B9SA 2PMHA 1D1CA 1FTZA 3U1DA 2M1BA 4EJVA 3FK7A 2EK5A 2HTJA 4I2OA 3AL0B 3BG9A 3SZPA 5HAWA 3CDLA 2DO7A 3GVAA 1GV2A 2VE8A 2WY7Q 3UNGC 4A5MA 4GFBA 3CJDA 1JGGA 4XOTA 1ITYA 2RASA 3FRQA 1X2MA 3BP8A 4EM2A 1YYVA 3CMYA 5L3GA 2NS0A 2EILH 4ZDLA 5M5YJ 4QPQA 3OYGA 2K9QA 3VOEA 5FO5A 3RPQA 1J2XA 2QCOA 1GVJA 1JUSA 2X6YA 3FMRA 2C6YA 3VVYA 4GDFA 3PIOF 1Z3XA 1DGRM 1VQPI 4KJZA 1VZ0A 1FWZA 5H20A 1Y39A 4X0GA 3A0BC 3KP7A 1WJBA 4RB1A 1GHCA 5E1ZB 2ZCNA 2DLLA 2JTVA 2COBA 4EJOA 2TDXA 3MKWB 1N75A 2BBYA 3H92A 4KYWA 1YLFA 2HDCA 4CCOA 2DG7A 3VEPA 2P0WA 4LG0A 2R7QA 2KZVA 2N8GA 5ILUA 2L2OA 1E3HA 3OYFA 5K1YA 3RQIA 3H9QA 1LDKB 3ZOBA 5J4VA 1FPQA 3AQTA 3M07A 1U5TA 3LSJA 3GXOA 3AKZA 4CZZA 5DUIA 2E2JJ 2ZMEB 3WTSC 4RB3C 4A3LJ 2ZCMA 4S0HB 3VOXA 3QPHA 4J00A 3BQZA 1POGA 5J3LA 3HSRA 1CF7A 1VTNC 4EEFG 2YVEA 5C4YA 4NC7A 1JHHA 4BUPA 3KP3A 4XRFA 3B02A 2DQRA 4HV5A 2B7EA 3CD6I 1JGSA 3Q0VA 1BBYA 4M9ZA 1S6LA 4PGHA 2WB1A 3W3CA 3JSPA 5B3SH 2XF7A 2E60A 3SJMA 4V2FA 3REOA 4AC0A 1QVUA 4OU0A 5LHHA 2DA7A 2JQ7A 4U0VA 2MLKA 4MEXF 3S5RA 2X1EA 5CJ9A 1PP7U 1IN8A 4XLFA 4JKZA 4HYEA 1OLTA 3V7RA 5HLIA 3L2CA 4ENKA 2K27A 2ZFUA 3GCMA 3CLOA 3DPTA 2P5LC 2K4JA 2M8GX 2GBYA 4HX8A 3NPIA 5LGNA 1W0UA 1ERDA 4NN1A 1XCVA 3KFWX 3A02A 2CQQA 2RHAA 5EG0B 4B3XA 1T33A 4A3JJ 4ZC3A 2A61A 2HS5A 4AVPA 5LRSA 4UB6C 2V6EA 5JR3A 2UWMA 4F52A 5DCMB 2LNBA 3VP5A 4B48A 2BGCA 1W36C 4DJAA 5GTHC 1RIOH 1TP4A 2VPLA 1OMIA 1VQKI 3W6JB 1HW5A 4M3BA 2M7BA 3OS1A 1B72A 2JA8J 2VBWA 2M4KA 2VI6A 2ZXWH 2CWEA 2ZJRF 1XC5A 4M6VA 2CJJA 4CHUA 2R93J 4LOCA 3FM3A 2Y75A 4XKBA 2E35A 3M8EA 2MD0A 4CXFA 3L2VA 1VQ4I 4NC6A 1K4SA 3OWTA 2VIXA 4ZYGA 3I64A 3HKZN 4JP0A 2AQEA 5K58A 1Y6IA 2R0QC 4N4OB 4I76A 3E6DA 4ZZDA 3PO3J 3EDPA 2R7UA 1X1BA 3BT9A 3BPXA 4CUGA 2FUG2 1X58A 1Q1VA 4OMYA 1W5CC 4NDLA 2EFWA 1E2XA 4HLXA 2QQ8A 4LD5A 2EFQA 2ZXJA 4M3DA 1LEAA 3EGQA 5K5QA 3ON2A 1FIAA 2CO5A 1N77A 3G1MA 2MG4A 2BE5F 3O3KA 2ZB9A 1QGPA 2B3WA 1TWFJ 4KMFA 1ETXA 1V54H 1WPKA 2CFOA 3BRUA 3VTIA 2XAFA 1OYWA 3PQKA 5GADJ 4MQ9F 1HKSA 1AA7A 2TCTA 1KA8A 1B9NA 2F5FA 2O6GE 2NS8A 4IQJA 4GCLA 4UB8C 2ME6A 1I27A 4LLGF 4PJMA 2GIZA 1R36A 2JA2A 2X1CA 4I01A 1ETKA 2HOAA 3F8CA 3E1SA 1Z67A 3E3VA 3KP6A 4BQNA 5JVTA 3CWRA 2VQHA 3CDHA 4U87A 4U7DA 1MKMA 1NHAA 2LD5A 1QZYA 3H9GA 3FXLA 2DA1A 5HDGA 3K70C 1I3AA 1I5ZA 5E1WA 2QA4I 3PQJA 4XM3A 2RC4A 4DBQA 4A3DJ 1ETWA 4HRIA 4CGZA 2ELKA 3TQNA 2EIKH 4GCKA 3PNTA 4HQMA 2GFNA 4F55A 3I9V2 1ZG1A 2Q24A 3ML6A 3MD2A 3A2KA 2HOTA 1TWAJ 1MH4A 5HLTA 3TO9A 3S1NJ 3G4SI 3DTIA 3TDUC 4WCGA 5DYMA 2BHYA 4E7JA 3ELKA 3CZ6A 1OCTC 2DOFA 5HDNA 2IS6A 2P4WA 4N4NB 4KN7X 3TKYA 4WXCA 2KRFA 5IYCJ 4BHPA 1IW7F 1F43A 4HKUA 3CJRB 4Y33A 2WV0A 4CA0A 4IHWA 1A04A 2K9NA 3R0AA 5BPDA 1R1VA 5C44J 2O7TA 1HC8A 3GZ5A 2V1NA 1ACIA 1I6HJ 1V5FA 1UB9A 2B0LA 3GUDA 4NELA 4YZEA 3BZKA 2NYXA 4ZH4F 4U88A 2WBMA 4BDYA 2DN0A 1W0TA 1ZGAA 1XD7A 4G12A 3ZRGA 5FKLA 2G3BA 3FHZA 4E7LA 2IS1A 4ZYEA 1VQMI 2HQNA 3PASA 2Q2EB 4DVYP 2GA2A 3OYBA 2WC2A 1ULYA 1ZARA 3BZCA 4BYYA 2XPVA 3IC7A 5JFRA 3E0JB 3WTUC 3OYCA 4IOCF 1LEBA 2EH3A 1O3RA 2FXAA 4RS8A 4FTHA 4GO1A 1I1SA 2FD5A 2HR3A 3QP6A 4RGRA 4E7SA 2NAZA 2VJJA 5ICGA 4JOMA 2PN6A 2V7FA 1P9QC 3HHHA 3KLNA 3RDIA 2GQQA 3C2BA 2QTQA 3D5SC 5DM7F 2JJ7A 2X85A 3ZMSA 3EQLF 4II2A 2NNYA 4P96A 3FMQA 4OIRF 4KN4X 5TJJA 5LEJA 2WB1N 3HM5A 4QPOA 1R4NB 1MBEA 2MA3A 3ROUA 4ACIA 3BR3A 2OC6A 5J1RA 3F1BA 1ZTRA 2H8WA 4EJTA 4GRIA 4BJ6C 4FCYA 3V7CA 5F0HA 2KLOA 3CJTB 4YIIA 4CCJA 1IRGA 4HAMA 2YX4A 5E17F 4AYBN 3C7JA 2XPUA 4HSRA 1Z3YA 3GFIA 1K79A 3CUQB 2DA3A 1PJRA 3R0JA 3CMEI 2F07A 1XMXA 4PXIA 1JI8A 3H3ZA 1LFBA 1R4MB 4FISA 1YITI 2FU4A 2OUMA 3ECHA 2PJRB 2XHKA 4MTEA 1H88C 1OISA 2WAQA 1BW6A 1QHHD 4HG2A 4PJLA 3CUQC 3S15J 1HLVA 2EFOA 4IHYA 1TQPA 4PGGA 5HLGA 3BJBA 3ON4A 3TGNA 3F3XA 2JK3A 2DJNA 4OAZA 3WTTC 1KQ0A 3DLAA 5IPAA 3F8NA 1ZG3A 1AU7A 2VXDA 4MEYF 1WJCA 4YFXF 1ODDA 1U78A 3JW4A 1E3OC 5TISC 3CLQA 5ICEA 4L5EA 3KP2A 4M3FA 4I98B 3S1QJ 4XRMA 5FB2A 2FSWA 1NTCA 3QP5A 1UHWA 4WWCA 3JRFA 4ZYDA 3FXUA 3GW2A 1NG7A 2EV6A 1D3YA 3BTIA 3HBLA 3IRQA 1F5TA 3HUGB 3V6GA 2CSOA 2W82A 4KDPA 1B8IA 3U2RA 4M3EA 2D1HA 1AKHA 1CF7B 2VE9A 2M4GA 2R7SA 3ZR8X 3MZHA 3MKLA 2A5WA 2D2WA 3F23A 4C2UA 4OD5A 3SFZA 2BXZA 4A6DA 4IX7A 1R49A 2CYYA 2BY2A 3R60A 4LLLA 3K9TA 2RVCA 4IRGA 3L2QA 3AL0C 4AC6A 4BKXA 2LKXA 4Z2YA 3PFIA 3CMMA 2K02A 2WGBA 5EZHA 1Y0UA 2IVMA 2XSDC 5C4XJ 2CGPA 3TO7A 1FP1D 1IDZA 4G6DA 3G56A 2DK8A 2LBFB 3DKYA 3WU1B 3GTPJ 2JUCA 4HNTA 1U9NA 4YRVA 5LD2C 2HOEA 3FM5A 1T8IA 2CMPA 3HC7A 4Y7NJ 2P8TA 3P9TA 2OD5A 3WTXC 4XOPA 3F0CA 1VFCA 2GM4A 2HI3A 5DAJA 4QSHA 1RI7A 4IHSA 4BY7J 1T95A 2L7KA 2XAGA 3BR5A 2JWTA 4B1RA 3L7WA 1XGMA 2DXIA 1L3LA 2ICWG 3I4MJ 2WADA 4CYCB 1J9IA 2ADUA 2VC1A 2QZ8A 4O6JA 3B73A 1Z91A 2BVMA 5FFZA 2W25A 1IRZA 3HB9A 1FX7A 2V4JC 2M3AA 4KA4A 1UHSA 5LEKA 3KP4A 3G1LA 2MH9A 3CCUI 2HVRA 2VB6A 4Y4RA 3ZMVA 5H6RA 1KYZA 3SDBA 1X1CA 3KP5A 2F6CA 3PUFA 2ZNZA 2LVSA 2ZSHB 1BC8C 2STTA 1GV5A 3CTAA 5F0FA 2OI8A 3QYEA 1JJ6C 2MYSA 4Q5SF 3DWLE 4MGRA 2E71A 3BJ6A 2HQRA 1XPXA 2R7FA 2X6WA 4G8XA 4Y52J 4AIJA 1ZN2A 4XLCA 3EUKL 2XUBA 1B6AA 4HEA2 1XGOA 3LQRA 2VKHA 4A0XA 4MTDA 1KGSA 1WJFA 1VNDA 3QWLA 4EATA 2LKPA 2RNJA 4E4HA 3W2WA 4G7OF 3QBMA 1S7AA 3HRUA 5F64A 1BR2A 2GOMA 3AG3H 2ZMEC 5AONA 1W36D 1YRNA 3HOUJ 2HFHA 2IA1A 2DI3A 3JSOA 2EIMH 2W4SA 1A6QA 3HOSA 3ABUA 3FK6A 2EA2A 2DYRH 3MWMA 3SEQA 2QIBA 2H27A 2BYVE 3MKYB 5BPIA 4CYCA 1ZH5A 5L3CA 3FISA 1WQ2A 3I0TA 5A2QZ 1R5ID 2Y9ZA 2CUFA 4A3MJ 1M1EB 3PUBA 1MH3A 1H9TA 2E7XA 3OIPA 3FIWA 1O3TA 3WTVC 3PNYA 1G4DA 5LGUA 3HSFA 3M1CA 4I0BA 3OOPA 1H0MA 3G73A 4UUVA 4Y17A 2DFFA 3VVZA 2L01A 3KKCA 1YS6A 3BR6A 2FJ1A 4MK6A 3EUHA 3S3NA 4PFOA
chains in the Genus database with same CATH topology
5HSZA 5E3OA 2OF7A 2E2JJ 3E7QA 3IUVA 3L1PA 3UKGA 2VKVA 3ANGA 4A3LJ 3S17J 2ZCMA 4S0HB 3S2HJ 3VOXA 1NK3P 2EZHA 3BQZA 1POGA 5J3LA 4MFEA 4EEFG 2YVEA 5C4YA 1TC3C 1BJZA 1FJLA 1WH7A 2XPWA 5AQCA 1YRNB 3BR2A 2HYTA 3NAUA 3NI7A 1ENHA 2PMZN 1UMQA 3CCYA 1A6IA 1P7IA 2ME0A 3A01A 3S2DJ 3Q0VA 2ECCA 5EG0A 5FKMA 2HQ5A 2NP5A 1MBFA 3HIMA 2QKOA 3SJMA 2L9RA 4V2FA 5F1JA 4AC0A 1QVUA 2DA7A 1S7EA 4DYRA 2NVXJ 4C2MJ 3BG5A 3GTQJ 3S5RA 3S1RJ 1HDPA 4UDSA 3Q3SA 2E2HJ 1Z77A 1IC8A 4JKZA 1SGMA 2X48A 5JLWA 5M5XJ 3HTHA 3QKXA 4KWAA 2M8GX 4BXXJ 2GBYA 3NPIA 2W53A 1JKOC 1SANA 3HOVJ 1W0UA 1JKRC 1I50J 3PM1A 4NN1A 3TEDA 3A02A 2CQQA 5GP9A 2RHAA 5D19A 5EG0B 1X2NA 3H0GJ 3HDDA 1T33A 2ECBA 4A3JJ 3G7RA 1K83J 4DYQA 1JUPA 1SFOJ 3TP0A 5H9TA 2M9HA 1MBGA 3DPJA 1RESA 2UXIA 3VVXA 3HOYJ 3VP5A 1BW5A 2L7ZA 3BTLA 4M3BA 2LR8A 3OSGA 1B72A 2JA8J 3A03A 3DEWA 2VI6A 2D6YA 2EQRA 1XC5A 4M6VA 2CJJA 5F0CA 1U9OA 5IOZA 2R93J 4LOCA 5EYRA 4D7NA 3HE0A 1MBHA 2L7FP 2K40A 1ETOA 5IYBJ 3C07A 1IUFA 2WV1A 2O8KA 3GEUA 2O7OA 4XICA 5EDNA 2M0CA 2Y0SN 1ETYA 2HYJA 3HKZN 3JRIA 4JP0A 3W6VA 4ME9A 1G2HA 3LJLA 3TW6A 2IEKA 2R0QC 3H3VK 2DMPA 2IBDA 3BCGA 5K58A 2QF7A 4I76A 3I4NJ 4D7MA 3IH4A 3M3YJ 3SFIA 3K2AA 4M3GA 2HOSA 3PO3J 4A3IJ 1FIPA 2WAQN 2FBQA 3BT9A 3OOUA 1X58A 2CRGA 1Q1VA 2G7LA 4NDLA 2R7ZJ 3VW2A 1HOMA 2EZLA 2LFBA 4JX4A 4M3DA 3EGQA 3M4OJ 2DTZA 1FIAA 5M3FJ 3PO2J 4W1UA 3G1MA 2MG4A 1CQTA 2O9LA 1IDYA 2ZB9A 1QVTA 4RBOA 4MXMA 4FE4A 1H89C 2ZCXA 2GLOA 1TWFJ 2CUEA 3LSGA 1ETXA 1WPKA 1O4XA 3BRUA 1JTYA 2DA5A 1MNMC 3VPRA 3LSRA 2PZ9A 2REKA 2DA6A 2TCTA 4DZJA 4JNNA 2NS8A 2JN6A 3ZQLA 4GCLA 3JSJA 2ME6A 1RPWA 2MW8A 2G0EA 3ZQGA 2HXOA 2E2IJ 4MFDA 1JJ8C 4I6ZA 4A3GJ 1TWHJ 4JYKA 4BY1J 3GZIA 1ETKA 2HOAA 5EF6A 2QOPA 2NVQJ 1B8IB 1AKHB 3CWRA 1WCMJ 3K7AJ 3KZ9A 1ZQ3P 3D1NI 2GENA 2LD5A 2MGQA 4V2GA 4B3AA 2DA1A 2DMNA 3JRGA 4ABZA 2UXUA 3BG3A 5E3NA 1QPIA 1MBKA 5C4JJ 4A3DJ 1ETWA 2XRLA 5HBUA 2ELKA 5EEAA 1IV6A 1QRYA 4GCKA 1K61A 2GFNA 3NNRA 2Q24A 3QPLA 1FTTA 3ANPA 2HOTA 3BHQA 3VUQA 3IH2A 1TWAJ 1MH4A 3CRJA 3S1NJ 5HODA 1DU6A 1WH5A 3JRBA 5JLXA 2HXIA 5FHPA 3WHCA 1OCTC 3JRCA 5FMPA 1B72B 3O8HA 1ZK8A 1RETA 2M34A 3B6CA 1JT6A 2DA4A 4XIDA 3HOXJ 3GTMJ 1Y1VJ 3RKQA 3JR9A 3KNWA 4HNVA 5IP7J 1WGXA 2LK2A 4AF5A 2IU5A 1JT0A 3JRDA 4QIWN 5IYCJ 4CGRA 2DMTA 2JA5J 1F43A 4HKUA 5FGLA 4IHWA 5FLVA 2KDZA 2K9NA 5C44J 2O7TA 3HTAA 1IJWC 4IEJA 1I6HJ 2MSYA 5FJ8J 1LE8A 4NELA 4FE7A 2H1KA 4YZEA 3RZOJ 9ANTA 3V78A 2DN0A 1UI6A 1W0TA 3BR0A 4G12A 5FKLA 2LP0A 2G3BA 3JRAA 3ZQHA 3PASA 4W97A 1OJLA 4RDUA 2FQ4A 1Y1WJ 4UUTA 2DA2A 2XPVA 3RH2A 4A3CJ 5BNGA 2GUHA 3FKIJ 3OIOA 1DU0A 2EH3A 5F04A 3VOKA 4FTHA 5CXIA 3Q0WA 2FD5A 3EUPA 1ETVA 5EGOA 3C2BA 2QTQA 3LHQA 2JJ7A 1PUFB 1LE8B 2D5VA 2XGDA 2W48A 2WB1N 3MN2A 3HM5A 1MBEA 3HTJA 3ZQIA 4ACIA 4BBRJ 3BR3A 5IP6A 1RR7A 5J1RA 3F1BA 1ZTRA 4AUXA 4UUSB 2CQXA 4MLOA 4FCYA 5DS9A 5F0HA 3B81A 3MNLA 1BL0A 4AYBN 1JKPC 4DZPA 2M2EA 4J19A 2XPUA 3S1MJ 2R5ZB 1GT0C 2Y31A 3O60A 5D1RA 3GBGA 2AO9A 2DA3A 2X6OA 2F07A 3VIBA 1OFCX 3PPBA 4XRSG 1ZKGA 4PXIA 4QTRA 1LFBA 5D18A 4FISA 3S16J 5GPCA 1TWGJ 3LWJA 1LFUP 3BNIA 1H88C 1BW6A 3NRGA 4GCTA 3E7LA 3S15J 1HLVA 4IHYA 2Y2ZA 3BJBA 1PUFA 1XG1A 5FKNA 3ON4A 4UUSA 1RKTA 2JK3A 3MVPA 2DJNA 2R5ZA 2L7MP 1IGNA 5IPAA 3AQSA 1AU7A 1HCRA 5K7HA 2LY9A 2R5YB 2LTPA 4C3JJ 4A93J 5IP9J 5EFYA 1APLC 2NVTJ 1U78A 1E3OC 4L5EA 1GVDA 1ORKA 3VW1A 1H8AC 2ID3A 5E3LA 1GDTA 5FKKA 3COLA 4XK4A 4M3FA 3S1QJ 2NS7A 3TP3A 2VPRA 4XRMA 5K7FA 5EZGA 1NTCA 2WUIA 2R5YA 5K7ZA 1F36A 3JRFA 1ZR4A 2NVYJ 2OPTA 1JTXA 5CXGA 2UXOA 2YUSA 3BTIA 5M5WJ 3HBLA 1UG2A 2V57A 1U8BA 2I10A 5E3MA 3GTKJ 3S14J 5J1YA 3V6GA 3LNQA 1B8IA 4M3EA 1AKHA 1ETQA 1MSFC 2ZOZA 3MKLA 2YVHA 1MSEC 5C3EJ 5M3MJ 4B4CA 4MIMA 3CQZJ 5F08A 1JKQC 2YS9A 1VF9A 3GTJJ 2Y30A 3BTCA 4A3KJ 1HF0A 3RD3A 5EGOB 5CW8A 1I3QJ 4BKXA 4D5CA 4AC6A 2LKXA 1UI5A 2E1OA 2EZIA 2JA7J 5GPAA 2PBXA 4L62A 3JREA 2AHQA 4MO7A 3ZQFA 2WGBA 5EZHA 5FKOA 3TW7A 4C3HJ 2XSDC 5C4XJ 3GTGJ 1IDZA 2EBIA 3G56A 1NK2P 5DTDA 4D5FA 3JRHA 3GTPJ 3KKDA 1ZGWA 1FEXA 1U9NA 1A5JA 2X9DA 2XB0X 2TRTA 4Y7NJ 3P9TA 3NARA 2KT0A 3F0CA 4GFLA 2XGEA 1VFCA 2GM4A 2HI3A 4C3IJ 3OSFA 2JMWA 1T56A 3GTOJ 4JX5A 4A3EJ 5DAJA 4QSHA 4X6AJ 4BY7J 4JL3A 3BR5A 2VUMJ 2E19A 2JWTA 4B1RA 2DMQA 1XS9A 2G7GA 3I4MJ 2K9SA 2XGCA 3Q0UA 4CYCB 3T6NA 1BA5A 2NOGA 2DG8A 3QQAA 3HTIA 2FX0A 1GUUA 1IRZA 3HB9A 2NX4A 1UHSA 1TWCJ 3BR1A 3NXCA 3G1LA 1OCPA 2P81A 2VKEA 4BBSJ 4ICHA 5FLMJ 5F27A 3IV5A 1D5YA 1ZR2A 2EZKA 2DMUA 3HEFA 2H8RA 2QWTA 1MBJA 1EF4A 2YU9J 2LVSA 2OI8A 1JUMA 1GV5A 2Y9YA 5F0FA 1IG7A 1JJ6C 4DYCA 5IOYA 3HOWJ 1FTZA 3BQYA 1AHDP 3RZDJ 3FK7A 2XDNA 4Y52J 3ZQCA 3BG9A 3SDGA 4DW6A 5HAWA 3CDLA 4GFBA 1GV2A 3HGYA 3HGGA 3CJDA 1JGGA 1HDDC 1VNDA 3LOCA 1ITYA 2RASA 3QBMA 3FRQA 1X2MA 3HOUJ 4X1EA 4XRSA 3CMYA 1YRNA 3WHBA 2CU7A 2L0KA 2UXHA 2R92J 2B63J 3GTLJ 2HKUA 5M5YJ 2HDDA 2K9QA 3O8GA 1RKWA 2OERA 2QCOA 1JUSA 3FK6A 5IYDJ 2JA6J 2RAEA 3VVYA 2QIBA 3A01B 2UXPA 4CYCA 3G1OA 3IH3A 1R9TJ 3FISA 3LSPA 4JX6A 2ZOYA 2ZCNA 3HOZJ 4A3BJ 2IAIA 2COBA 3DCFA 3VW0A 2Y9ZA 4IHXA 1VI0A 2CUFA 3B6AA 4A3FJ 4A3MJ 1MH3A 1Z0XA 3QPSA 3FIWA 2DG7A 3BTJA 2N8GA 4GFKA 2ID6A 2LLKA 3RQIA 1WI3A 5J1UA 3ZOBA 4A69C 3AQTA 3VVZA 1P7JA 2G7SA 3KKCA 4IHVA 2XB5A 2NP3A 3BR6A 3LSJA 2FJ1A 4MK6A 3ON2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HSZ A;  5E3O A;  2OF7 A;  2E2J J;  3E7Q A;  3IUV A;  3L1P A;  3UKG A;  2VKV A;  3ANG A;  4A3L J;  3S17 J;  2ZCM A;  4S0H B;  3S2H J;  3VOX A;  1NK3 P;  2EZH A;  3BQZ A;  1POG A;  5J3L A;  4MFE A;  4EEF G;  2YVE A;  5C4Y A;  1TC3 C;  1BJZ A;  1FJL A;  1WH7 A;  2XPW A;  5AQC A;  1YRN B;  3BR2 A;  2HYT A;  3NAU A;  3NI7 A;  1ENH A;  2PMZ N;  1UMQ A;  3CCY A;  1A6I A;  1P7I A;  2ME0 A;  3A01 A;  3S2D J;  3Q0V A;  2ECC A;  5EG0 A;  5FKM A;  2HQ5 A;  2NP5 A;  1MBF A;  3HIM A;  2QKO A;  3SJM A;  2L9R A;  4V2F A;  5F1J A;  4AC0 A;  1QVU A;  2DA7 A;  1S7E A;  4DYR A;  2NVX J;  4C2M J;  3BG5 A;  3GTQ J;  3S5R A;  3S1R J;  1HDP A;  4UDS A;  3Q3S A;  2E2H J;  1Z77 A;  1IC8 A;  4JKZ A;  1SGM A;  2X48 A;  5JLW A;  5M5X J;  3HTH A;  3QKX A;  4KWA A;  2M8G X;  4BXX J;  2GBY A;  3NPI A;  2W53 A;  1JKO C;  1SAN A;  3HOV J;  1W0U A;  1JKR C;  1I50 J;  3PM1 A;  4NN1 A;  3TED A;  3A02 A;  2CQQ A;  5GP9 A;  2RHA A;  5D19 A;  5EG0 B;  1X2N A;  3H0G J;  3HDD A;  1T33 A;  2ECB A;  4A3J J;  3G7R A;  1K83 J;  4DYQ A;  1JUP A;  1SFO J;  3TP0 A;  5H9T A;  2M9H A;  1MBG A;  3DPJ A;  1RES A;  2UXI A;  3VVX A;  3HOY J;  3VP5 A;  1BW5 A;  2L7Z A;  3BTL A;  4M3B A;  2LR8 A;  3OSG A;  1B72 A;  2JA8 J;  3A03 A;  3DEW A;  2VI6 A;  2D6Y A;  2EQR A;  1XC5 A;  4M6V A;  2CJJ A;  5F0C A;  1U9O A;  5IOZ A;  2R93 J;  4LOC A;  5EYR A;  4D7N A;  3HE0 A;  1MBH A;  2L7F P;  2K40 A;  1ETO A;  5IYB J;  3C07 A;  1IUF A;  2WV1 A;  2O8K A;  3GEU A;  2O7O A;  4XIC A;  5EDN A;  2M0C A;  2Y0S N;  1ETY A;  2HYJ A;  3HKZ N;  3JRI A;  4JP0 A;  3W6V A;  4ME9 A;  1G2H A;  3LJL A;  3TW6 A;  2IEK A;  2R0Q C;  3H3V K;  2DMP A;  2IBD A;  3BCG A;  5K58 A;  2QF7 A;  4I76 A;  3I4N J;  4D7M A;  3IH4 A;  3M3Y J;  3SFI A;  3K2A A;  4M3G A;  2HOS A;  3PO3 J;  4A3I J;  1FIP A;  2WAQ N;  2FBQ A;  3BT9 A;  3OOU A;  1X58 A;  2CRG A;  1Q1V A;  2G7L A;  4NDL A;  2R7Z J;  3VW2 A;  1HOM A;  2EZL A;  2LFB A;  4JX4 A;  4M3D A;  3EGQ A;  3M4O J;  2DTZ A;  1FIA A;  5M3F J;  3PO2 J;  4W1U A;  3G1M A;  2MG4 A;  1CQT A;  2O9L A;  1IDY A;  2ZB9 A;  1QVT A;  4RBO A;  4MXM A;  4FE4 A;  1H89 C;  2ZCX A;  2GLO A;  1TWF J;  2CUE A;  3LSG A;  1ETX A;  1WPK A;  1O4X A;  3BRU A;  1JTY A;  2DA5 A;  1MNM C;  3VPR A;  3LSR A;  2PZ9 A;  2REK A;  2DA6 A;  2TCT A;  4DZJ A;  4JNN A;  2NS8 A;  2JN6 A;  3ZQL A;  4GCL A;  3JSJ A;  2ME6 A;  1RPW A;  2MW8 A;  2G0E A;  3ZQG A;  2HXO A;  2E2I J;  4MFD A;  1JJ8 C;  4I6Z A;  4A3G J;  1TWH J;  4JYK A;  4BY1 J;  3GZI A;  1ETK A;  2HOA A;  5EF6 A;  2QOP A;  2NVQ J;  1B8I B;  1AKH B;  3CWR A;  1WCM J;  3K7A J;  3KZ9 A;  1ZQ3 P;  3D1N I;  2GEN A;  2LD5 A;  2MGQ A;  4V2G A;  4B3A A;  2DA1 A;  2DMN A;  3JRG A;  4ABZ A;  2UXU A;  3BG3 A;  5E3N A;  1QPI A;  1MBK A;  5C4J J;  4A3D J;  1ETW A;  2XRL A;  5HBU A;  2ELK A;  5EEA A;  1IV6 A;  1QRY A;  4GCK A;  1K61 A;  2GFN A;  3NNR A;  2Q24 A;  3QPL A;  1FTT A;  3ANP A;  2HOT A;  3BHQ A;  3VUQ A;  3IH2 A;  1TWA J;  1MH4 A;  3CRJ A;  3S1N J;  5HOD A;  1DU6 A;  1WH5 A;  3JRB A;  5JLX A;  2HXI A;  5FHP A;  3WHC A;  1OCT C;  3JRC A;  5FMP A;  1B72 B;  3O8H A;  1ZK8 A;  1RET A;  2M34 A;  3B6C A;  1JT6 A;  2DA4 A;  4XID A;  3HOX J;  3GTM J;  1Y1V J;  3RKQ A;  3JR9 A;  3KNW A;  4HNV A;  5IP7 J;  1WGX A;  2LK2 A;  4AF5 A;  2IU5 A;  1JT0 A;  3JRD A;  4QIW N;  5IYC J;  4CGR A;  2DMT A;  2JA5 J;  1F43 A;  4HKU A;  5FGL A;  4IHW A;  5FLV A;  2KDZ A;  2K9N A;  5C44 J;  2O7T A;  3HTA A;  1IJW C;  4IEJ A;  1I6H J;  2MSY A;  5FJ8 J;  1LE8 A;  4NEL A;  4FE7 A;  2H1K A;  4YZE A;  3RZO J;  9ANT A;  3V78 A;  2DN0 A;  1UI6 A;  1W0T A;  3BR0 A;  4G12 A;  5FKL A;  2LP0 A;  2G3B A;  3JRA A;  3ZQH A;  3PAS A;  4W97 A;  1OJL A;  4RDU A;  2FQ4 A;  1Y1W J;  4UUT A;  2DA2 A;  2XPV A;  3RH2 A;  4A3C J;  5BNG A;  2GUH A;  3FKI J;  3OIO A;  1DU0 A;  2EH3 A;  5F04 A;  3VOK A;  4FTH A;  5CXI A;  3Q0W A;  2FD5 A;  3EUP A;  1ETV A;  5EGO A;  3C2B A;  2QTQ A;  3LHQ A;  2JJ7 A;  1PUF B;  1LE8 B;  2D5V A;  2XGD A;  2W48 A;  2WB1 N;  3MN2 A;  3HM5 A;  1MBE A;  3HTJ A;  3ZQI A;  4ACI A;  4BBR J;  3BR3 A;  5IP6 A;  1RR7 A;  5J1R A;  3F1B A;  1ZTR A;  4AUX A;  4UUS B;  2CQX A;  4MLO A;  4FCY A;  5DS9 A;  5F0H A;  3B81 A;  3MNL A;  1BL0 A;  4AYB N;  1JKP C;  4DZP A;  2M2E A;  4J19 A;  2XPU A;  3S1M J;  2R5Z B;  1GT0 C;  2Y31 A;  3O60 A;  5D1R A;  3GBG A;  2AO9 A;  2DA3 A;  2X6O A;  2F07 A;  3VIB A;  1OFC X;  3PPB A;  4XRS G;  1ZKG A;  4PXI A;  4QTR A;  1LFB A;  5D18 A;  4FIS A;  3S16 J;  5GPC A;  1TWG J;  3LWJ A;  1LFU P;  3BNI A;  1H88 C;  1BW6 A;  3NRG A;  4GCT A;  3E7L A;  3S15 J;  1HLV A;  4IHY A;  2Y2Z A;  3BJB A;  1PUF A;  1XG1 A;  5FKN A;  3ON4 A;  4UUS A;  1RKT A;  2JK3 A;  3MVP A;  2DJN A;  2R5Z A;  2L7M P;  1IGN A;  5IPA A;  3AQS A;  1AU7 A;  1HCR A;  5K7H A;  2LY9 A;  2R5Y B;  2LTP A;  4C3J J;  4A93 J;  5IP9 J;  5EFY A;  1APL C;  2NVT J;  1U78 A;  1E3O C;  4L5E A;  1GVD A;  1ORK A;  3VW1 A;  1H8A C;  2ID3 A;  5E3L A;  1GDT A;  5FKK A;  3COL A;  4XK4 A;  4M3F A;  3S1Q J;  2NS7 A;  3TP3 A;  2VPR A;  4XRM A;  5K7F A;  5EZG A;  1NTC A;  2WUI A;  2R5Y A;  5K7Z A;  1F36 A;  3JRF A;  1ZR4 A;  2NVY J;  2OPT A;  1JTX A;  5CXG A;  2UXO A;  2YUS A;  3BTI A;  5M5W J;  3HBL A;  1UG2 A;  2V57 A;  1U8B A;  2I10 A;  5E3M A;  3GTK J;  3S14 J;  5J1Y A;  3V6G A;  3LNQ A;  1B8I A;  4M3E A;  1AKH A;  1ETQ A;  1MSF C;  2ZOZ A;  3MKL A;  2YVH A;  1MSE C;  5C3E J;  5M3M J;  4B4C A;  4MIM A;  3CQZ J;  5F08 A;  1JKQ C;  2YS9 A;  1VF9 A;  3GTJ J;  2Y30 A;  3BTC A;  4A3K J;  1HF0 A;  3RD3 A;  5EGO B;  5CW8 A;  1I3Q J;  4BKX A;  4D5C A;  4AC6 A;  2LKX A;  1UI5 A;  2E1O A;  2EZI A;  2JA7 J;  5GPA A;  2PBX A;  4L62 A;  3JRE A;  2AHQ A;  4MO7 A;  3ZQF A;  2WGB A;  5EZH A;  5FKO A;  3TW7 A;  4C3H J;  2XSD C;  5C4X J;  3GTG J;  1IDZ A;  2EBI A;  3G56 A;  1NK2 P;  5DTD A;  4D5F A;  3JRH A;  3GTP J;  3KKD A;  1ZGW A;  1FEX A;  1U9N A;  1A5J A;  2X9D A;  2XB0 X;  2TRT A;  4Y7N J;  3P9T A;  3NAR A;  2KT0 A;  3F0C A;  4GFL A;  2XGE A;  1VFC A;  2GM4 A;  2HI3 A;  4C3I J;  3OSF A;  2JMW A;  1T56 A;  3GTO J;  4JX5 A;  4A3E J;  5DAJ A;  4QSH A;  4X6A J;  4BY7 J;  4JL3 A;  3BR5 A;  2VUM J;  2E19 A;  2JWT A;  4B1R A;  2DMQ A;  1XS9 A;  2G7G A;  3I4M J;  2K9S A;  2XGC A;  3Q0U A;  4CYC B;  3T6N A;  1BA5 A;  2NOG A;  2DG8 A;  3QQA A;  3HTI A;  2FX0 A;  1GUU A;  1IRZ A;  3HB9 A;  2NX4 A;  1UHS A;  1TWC J;  3BR1 A;  3NXC A;  3G1L A;  1OCP A;  2P81 A;  2VKE A;  4BBS J;  4ICH A;  5FLM J;  5F27 A;  3IV5 A;  1D5Y A;  1ZR2 A;  2EZK A;  2DMU A;  3HEF A;  2H8R A;  2QWT A;  1MBJ A;  1EF4 A;  2YU9 J;  2LVS A;  2OI8 A;  1JUM A;  1GV5 A;  2Y9Y A;  5F0F A;  1IG7 A;  1JJ6 C;  4DYC A;  5IOY A;  3HOW J;  1FTZ A;  3BQY A;  1AHD P;  3RZD J;  3FK7 A;  2XDN A;  4Y52 J;  3ZQC A;  3BG9 A;  3SDG A;  4DW6 A;  5HAW A;  3CDL A;  4GFB A;  1GV2 A;  3HGY A;  3HGG A;  3CJD A;  1JGG A;  1HDD C;  1VND A;  3LOC A;  1ITY A;  2RAS A;  3QBM A;  3FRQ A;  1X2M A;  3HOU J;  4X1E A;  4XRS A;  3CMY A;  1YRN A;  3WHB A;  2CU7 A;  2L0K A;  2UXH A;  2R92 J;  2B63 J;  3GTL J;  2HKU A;  5M5Y J;  2HDD A;  2K9Q A;  3O8G A;  1RKW A;  2OER A;  2QCO A;  1JUS A;  3FK6 A;  5IYD J;  2JA6 J;  2RAE A;  3VVY A;  2QIB A;  3A01 B;  2UXP A;  4CYC A;  3G1O A;  3IH3 A;  1R9T J;  3FIS A;  3LSP A;  4JX6 A;  2ZOY A;  2ZCN A;  3HOZ J;  4A3B J;  2IAI A;  2COB A;  3DCF A;  3VW0 A;  2Y9Z A;  4IHX A;  1VI0 A;  2CUF A;  3B6A A;  4A3F J;  4A3M J;  1MH3 A;  1Z0X A;  3QPS A;  3FIW A;  2DG7 A;  3BTJ A;  2N8G A;  4GFK A;  2ID6 A;  2LLK A;  3RQI A;  1WI3 A;  5J1U A;  3ZOB A;  4A69 C;  3AQT A;  3VVZ A;  1P7J A;  2G7S A;  3KKC A;  4IHV A;  2XB5 A;  2NP3 A;  3BR6 A;  3LSJ A;  2FJ1 A;  4MK6 A;  3ON2 A; 
#chains in the Genus database with same CATH topology
 5HSZ A;  3E6B A;  2X4H A;  3E7Q A;  3IUV A;  3UKG A;  3C3W A;  2ZFW A;  3F9K A;  4RA2 A;  4YG2 F;  3CCV I;  5L3E A;  3CF5 F;  2J5O A;  1C0W A;  2MH2 A;  5H2F C;  1V5G A;  4R8H A;  1NK3 P;  2VON A;  2FMY A;  3LSI A;  4IQ4 A;  2XPW A;  3J7A O;  1USS A;  1YRN B;  1ENH A;  4KNY A;  1UMQ A;  3CCY A;  2ME0 A;  2Y0M A;  3A01 A;  2K3F A;  2DK5 A;  3OMY A;  2HU9 A;  2VJI A;  3FKJ A;  2QYO A;  3R4K A;  4HLY A;  4M9X A;  3CES A;  3PNV A;  3HIM A;  1IRX A;  2A05 A;  2L9R A;  3WU2 C;  4ZDO A;  4DYR A;  3BG5 A;  1HW1 A;  3S1R J;  4Q48 A;  3WGH A;  2E2H J;  4FHT A;  4E70 A;  1IC8 A;  3QOD A;  3OYM A;  2FJI 1;  3MMY B;  5JLW A;  2FRH A;  5M5X J;  1X1A A;  5FD6 A;  3DEU A;  2M87 A;  2A5Y B;  4J01 A;  2Q1Z B;  4FAS D;  3ZP5 A;  3WG9 A;  2Z16 A;  4XLN F;  3BC8 A;  1JKO C;  1SAN A;  3TED A;  2FE3 A;  2ESN A;  4P9F A;  3H0G J;  1E17 A;  1XGS A;  3QPT A;  2CV1 A;  2XIG A;  5FRO A;  5HLH A;  3OYL A;  1P4A A;  2HPI A;  3WGI A;  1K83 J;  3BDD A;  4NBQ A;  3H9J A;  5FFX A;  1SFO J;  1T0F C;  1SEU A;  2FOW A;  1MBG A;  4HX4 A;  3DPJ A;  1RES A;  3N97 A;  2UXI A;  3HOY J;  2MFZ A;  4F93 B;  2L7Z A;  2QKM B;  5D5V B;  2FF4 A;  3CCL I;  2A69 F;  3LA2 A;  4LLN A;  2LR8 A;  5LHG A;  3OSG A;  5E18 F;  3DEW A;  1FBS A;  2D6Y A;  5IT9 Z;  3K10 A;  2LY1 A;  2K7L A;  2F5V A;  3SQN A;  1KON A;  2K40 A;  1ETO A;  1FNN A;  1HXD A;  2WV1 A;  2O8K A;  4WXD A;  2O7O A;  2L4A A;  5B1A H;  5EDN A;  2M0C A;  3OYE A;  3BJA A;  2Z5U A;  4RAY A;  3DBL B;  4F7Z A;  2PQ8 A;  2QGU A;  2VQG A;  5CVU A;  4ZJZ A;  4ME9 A;  1G2H A;  1DQU A;  1W4M A;  1IO2 A;  2OCC H;  3L00 A;  3RI4 A;  3GWZ A;  1G3S A;  3DEE A;  2IEK A;  4IJA A;  2CW0 F;  2DMP A;  2IBD A;  5ICC A;  2L9S A;  3OYK A;  3AAF A;  3I4N J;  4M3G A;  1QBJ A;  2F2E A;  4A3I J;  5JHU A;  3DKX A;  2FBQ A;  2CRG A;  1ZRE A;  2E5Z A;  1MJ9 A;  1DPR A;  2EZL A;  2LOO A;  2E7W A;  4RGU A;  5M3F J;  4U0W A;  3E6C C;  1CQT A;  4U9N A;  2VOP A;  2O9L A;  1IDY A;  3OYA A;  1QVT A;  5EEG A;  2R7O A;  4XLP F;  3CO6 C;  2CQ7 A;  3I59 B;  4FE4 A;  2A6T A;  1K4T A;  1FY7 A;  4NQW B;  2ZCX A;  2PJP A;  2KIS A;  3BCB A;  5CVI A;  1MNM C;  2DA5 A;  3LSR A;  2PZ9 A;  2DA6 A;  2EJR A;  2QM3 A;  2EPF A;  1IXS B;  1R22 A;  2V26 A;  5D6F A;  3ZQL A;  2VBY A;  3JSJ A;  2PEX A;  4CYD A;  2MW8 A;  1ZAO A;  3MEX A;  3FF5 A;  2XRO A;  3G3Z A;  2HXO A;  3ZQ7 A;  2E2I J;  4MFD A;  1QZZ A;  1YFH A;  4P5O A;  1TQI A;  1VQ8 I;  2UUZ A;  4Q47 A;  2QOP A;  3TBI A;  2HVS A;  3K7A J;  2NXN B;  2H1L A;  3ZMU A;  4H0E A;  2GEN A;  4AIH A;  4B3A A;  5IT9 K;  2UXU A;  3BLY A;  4ABZ A;  1Y0N A;  5E3N A;  1QPI A;  4G6T B;  1MBK A;  1OQY A;  4BH9 A;  1D0Z A;  4CDG A;  1U8R A;  1R6R A;  1TW2 A;  4XNF A;  1R7J A;  3S3O A;  1FTT A;  3ANP A;  2QBY A;  3BHQ A;  5J8C A;  3H0D A;  2GZW A;  5HOD A;  1BI2 A;  4F3Q A;  2HDW A;  2KKO A;  1FSE A;  3P9I A;  3K4L A;  2VT2 A;  4XSX F;  3WHC A;  5CYV A;  4AIK A;  2GA1 A;  2M34 A;  4BAC A;  1JT6 A;  2DA4 A;  2YPR A;  3KPH A;  2DCE A;  3QYF A;  1Y1V J;  2PMZ A;  1XX5 A;  2YR2 A;  4KIT B;  4LG0 B;  1OR7 A;  4Y15 A;  5IP7 J;  4PSX A;  2E1M C;  3HPH A;  3LFK A;  4AID A;  3J7Y J;  4LIU A;  3JRD A;  3OL4 A;  2OQG A;  4CGR A;  1K7A A;  3P9K A;  2JA5 J;  2LF8 A;  3A0H C;  3P5J A;  3KYD B;  4JBA A;  2KDZ A;  2RN7 A;  4L0Y B;  2VJ5 A;  5CVR A;  5HS9 A;  5HNH A;  1IJW C;  1GLN A;  2MSY A;  2X51 A;  1TT5 B;  2DAO A;  4HOB A;  1ZRF A;  4RAF A;  1HW2 A;  4YFK F;  3OYD A;  9ANT A;  2HYF A;  3MQ0 A;  3BR0 A;  3F8F A;  5E79 C;  2IW5 A;  1BOA A;  1Z7L A;  3FHN A;  3OR2 C;  3WTZ A;  4B47 A;  3NWT A;  2FQ4 A;  3QOP A;  3HOT A;  1MDM B;  1L0O C;  1IV8 A;  2X0L A;  3J81 Z;  3HUG A;  4UUT A;  4EJU A;  2A68 F;  2QWW A;  1YIO A;  3DV8 A;  4IF4 A;  3EYI A;  3M1E A;  3GX4 X;  4P1W A;  1LQ1 A;  2JUG A;  1ETV A;  1W1W E;  2RQP A;  3E97 A;  2IGN A;  2QEN A;  2UXN A;  2FNA A;  3RYR A;  1DPU A;  1SAU A;  1YI2 I;  1OPC A;  3E5U A;  3MZ8 A;  2K85 A;  2D5V A;  3GEZ A;  2PJR A;  2XDV A;  3HTU A;  3HTJ A;  1D0Y A;  1QO0 D;  1TZL A;  3PIP F;  3KIO A;  3IP4 B;  4BBR J;  4ZTF A;  2UV1 A;  2HZT A;  2EWN A;  4Y3O A;  4IZZ A;  5DS9 A;  5GAH J;  3ECO A;  3GFL A;  3B81 A;  2DFI A;  3MNL A;  1O3Q A;  1BL0 A;  1JKP C;  2ISZ A;  4IRV A;  4UVB A;  3S1M J;  4Z6Y A;  3M8F A;  1D8K A;  1LVA A;  1PYV A;  2KL4 A;  3O60 A;  3GBG A;  2AO9 A;  1XSV A;  3H5A A;  1Z7U A;  3VIB A;  2LBF A;  2E1M B;  2V9P A;  4XRS G;  1ZKG A;  1X19 A;  4PZJ A;  1EH6 A;  3I4P A;  1E0E A;  5D18 A;  5FGM A;  2VBZ A;  2FOK A;  5GPC A;  3LWJ A;  4UV8 A;  1V55 H;  1AOY A;  4A5N A;  4AVZ A;  2MC3 A;  3V4G A;  1U5T C;  2IJL A;  4HF0 A;  4BEH B;  1LB2 A;  4GCT A;  2O0Y A;  3I54 A;  4BDZ A;  1YJN I;  2Z9O A;  2Y2Z A;  5DCM A;  4XKC A;  5HOO A;  1XGN A;  5FKN A;  1PUF A;  1I6X A;  2OTJ I;  2XF6 A;  3L09 A;  1HKT A;  3BWG A;  1JE8 A;  1IGN A;  3AQS A;  3GME A;  1HCR A;  4OMZ A;  4L5J A;  4XKW A;  4C3J J;  1BI3 A;  2A6H F;  5IP9 J;  5DDG A;  1APL C;  2NVT J;  3KZ9 A;  2Y69 H;  3TO6 A;  3IKV A;  1ORK A;  1HST A;  1VQ7 I;  4XK4 A;  4HV6 A;  3F6O A;  3TP3 A;  2IGK A;  2M45 A;  1LDD A;  3FXR A;  5K7F A;  1TL8 A;  2ZJ2 A;  5EZG A;  5K7Z A;  1F36 A;  1FT9 A;  1RRJ A;  1XDS A;  2NVY J;  3S32 A;  1JTX A;  4Y13 A;  2RGV A;  1UG2 A;  3I71 A;  5ED4 A;  2LSO A;  5HVQ C;  1IAW A;  5LHI A;  4XBF A;  3LL7 A;  2I5U A;  5J1Y A;  1ETQ A;  5CLS A;  2ZOZ A;  2JVG A;  4ENN A;  4I02 A;  5C3E J;  1KQ9 A;  4D1Q A;  4MIM A;  2LY2 A;  2JSC A;  4G94 A;  3K4M A;  5LFA A;  3NEU A;  4M6X A;  2VOO A;  1QU3 A;  2OBP A;  3LSK A;  1ZLK A;  1F9N A;  2Y30 A;  1F4K A;  2OTL I;  1HF0 A;  1V4R A;  5EGO B;  4UY8 I;  4NQW A;  1YX3 A;  1S7O A;  2AXT C;  2E1O A;  4S05 A;  4L62 A;  2V1X A;  3FXJ A;  2ESH A;  3JRE A;  3ZQF A;  1STZ A;  4L18 B;  3VDX A;  1KYW A;  3OYJ A;  2LF7 A;  2EBI A;  2CV0 A;  4LIT A;  3KKD A;  2AXL A;  2RKH A;  1Q1H A;  1FEX A;  1MZB A;  3DP7 A;  3WE2 A;  3LST A;  3K70 D;  2XB0 X;  4UVC A;  1WWX A;  3NAR A;  2KT0 A;  3HG9 A;  1FP2 A;  5DD8 A;  4C3I J;  3BOQ A;  1LFP A;  2JMW A;  2KZG A;  4IRI A;  4B43 A;  3GTO J;  3Q9V A;  4A3E J;  3K1M A;  2AS5 F;  2F5E A;  4LG3 A;  3H5R A;  2CV2 A;  3HSE A;  3FXM A;  2L9N A;  2E19 A;  3V8K A;  3M7G A;  1UAA A;  3DBR B;  1D1B A;  3ISP A;  2R7X A;  3Q0U A;  2W00 A;  5J40 A;  3G2B A;  3G6E I;  2NOG A;  5FRN A;  2QQB A;  1TNT A;  3HTI A;  1GUU A;  4C2T A;  1BIB A;  3VYT B;  3NXC A;  1DP7 P;  1IRF A;  3HRM A;  3LWF A;  1UFM A;  1SFU A;  4HZF A;  4KIG A;  2WA0 A;  5F27 A;  5FLM J;  3IV5 A;  2EFN A;  5LBQ A;  3IUO A;  3HEF A;  2QWT A;  1MBJ A;  2Z1D A;  2R7T A;  1MMG A;  2IT0 A;  3D5R C;  4BNC A;  1JUM A;  2Y9Y A;  1IG7 A;  5AIP A;  2P6S A;  2DFE A;  4DYC A;  4OD4 A;  1DP3 A;  1R5H A;  3I53 A;  3GZ6 A;  2Q2E A;  3N05 A;  3MZY A;  3KYL A;  1AHD P;  1PVE A;  2G9W A;  5L3F A;  2XDN A;  3GO5 A;  5BOX A;  3ZQC A;  2NOJ B;  4DW6 A;  3FX3 A;  2HWV A;  3HGY A;  3T8R A;  3DTE A;  1B4A A;  3LOC A;  1WVR A;  4KIF A;  1P4X A;  4XRS A;  2CU7 A;  1KZH A;  2VQC A;  4L9J A;  2DPD A;  3D0S A;  4IXA A;  4RM2 A;  1YHQ I;  2UXH A;  3GTL J;  2HDD A;  3I59 A;  1RKW A;  3O8G A;  2OER A;  2VC0 A;  4HF2 A;  4G6Q A;  1T38 A;  2RAE A;  2JA6 J;  2X1D A;  4EVI A;  3M9A A;  3A01 B;  3ZXS A;  1YTY A;  2UXP A;  4K2E A;  3T0Y A;  3OYN A;  1QQI A;  4KT6 A;  3LSP A;  3J81 K;  4JX6 A;  2ZOY A;  3RYP A;  3HOZ J;  4I09 A;  2IAI A;  1SFX A;  1S3J A;  3OL3 A;  1RR8 C;  4OIO F;  2KJB A;  3DCF A;  1J09 A;  3VW0 A;  1VI0 A;  3T8T A;  3B6A A;  4A3F J;  2IP2 A;  3KET A;  3QPS A;  1IN4 A;  3GFM A;  3DPL C;  1TT0 A;  3BTJ A;  2W85 A;  5DEQ A;  4M74 A;  1OYY A;  4AD9 A;  2ID6 A;  5J1U A;  4LJZ F;  4A69 C;  2F4O B;  5LRR A;  2JT1 A;  1JXS A;  2NP3 A;  1WJ5 A;  2BY0 A;  4IHT A;  2DOE A;  1QPM A;  5B5E C;  2R7W A;  5E3O A;  2GXB A;  5JVG F;  3G71 I;  2VKV A;  3F22 A;  3ANG A;  3BG7 A;  2XAU A;  3S2H J;  3L2R A;  2COM A;  4UHT A;  2Y0S A;  2QEX I;  1YOV B;  1SD6 A;  2EFP A;  2EZH A;  3ERM A;  3K6G A;  5KAF C;  3PL8 A;  2Z3Y A;  1TC3 C;  4M6Y A;  1LNW A;  1FJL A;  2VQL A;  4MQV A;  3ERE D;  3RKY A;  2L02 A;  3BR2 A;  1AWC A;  3VSK A;  2PMZ N;  2HGC A;  1MND A;  1A6I A;  1P7I A;  3PFY A;  4D9J A;  1EJ9 A;  3CC4 I;  2V1D A;  3K4J A;  4ASN A;  2H94 A;  3VWB A;  5FKM A;  3IL2 A;  2HQ5 A;  2NP5 A;  1MBF A;  3DXJ F;  5F1J A;  2QSG X;  2VL8 A;  5KHD A;  1LKX A;  3KE2 A;  1HDP A;  4UDS A;  1ONV A;  3TOA A;  1W5T A;  1Z77 A;  2HTS A;  3H36 A;  4KFC A;  1SGM A;  3D5L A;  4RLQ A;  2LRE A;  3HTH A;  1T08 B;  4N0B A;  3VYR B;  4HX7 A;  4KWA A;  1P92 A;  3ZMZ A;  1MJB A;  4BXX J;  1X3W B;  5D8K B;  2MC4 A;  3TMO A;  1U0J A;  1JKR C;  1I50 J;  3PM1 A;  1XB4 A;  3KZZ A;  3Q5F A;  3EYY A;  5D19 A;  2K86 A;  2KMU A;  4AYB A;  2ECB A;  1GXP A;  1X1P A;  1KU7 A;  3OYI A;  4EQQ A;  1ON1 A;  4YIF A;  1R5G A;  2RV8 A;  2PBI A;  2WAE A;  1EH7 A;  3DBH B;  4XN3 A;  4DYQ A;  3LFU A;  1WZ2 A;  1B59 A;  2M9H A;  2OV7 A;  4HBL A;  5DCF A;  5DV5 A;  4EGZ A;  5BMZ A;  1FSH A;  2STW A;  3V42 A;  3HRS A;  4OIN F;  1XMK A;  2KDO A;  5JHF A;  1TLH B;  3BTL A;  4FET A;  3EET A;  4LFU A;  4JK1 X;  5CVJ A;  5CKT A;  2W24 A;  4O5V A;  2O5R A;  3U9G A;  3A03 A;  2QQA A;  3AG4 H;  5F0C A;  5IOZ A;  1SAX A;  4I7H A;  1W7P B;  1G8X A;  5IYB J;  3C07 A;  2Y0S N;  2AQF A;  3OYH A;  4PUS A;  4EGY A;  3JRI A;  3W6V A;  1FYK A;  4BXF A;  1Z6R A;  3BCG A;  3K8P C;  2H6B A;  1J75 A;  2HEO A;  4NB5 A;  2QF7 A;  3JAM K;  4D7M A;  3IH4 A;  2CUZ A;  4UNO A;  1X4O A;  3OOU A;  2P6T A;  2G7L A;  2R7Z J;  3FBI B;  2QUF A;  2HPM A;  2PFV A;  5HS7 A;  3KYC B;  4G7Z F;  1FYL A;  3M4O J;  2DTZ A;  3ZN0 A;  3WE3 A;  2PLY A;  1P4W A;  3KEQ A;  1R23 A;  4I99 C;  1H89 C;  3ABT A;  2GLO A;  3LSG A;  1K78 B;  1J5Y A;  2OA4 A;  1MGT A;  1X3U A;  4IPA A;  1JTY A;  3VPR A;  3Q9S A;  3VOD A;  4JNN A;  2JN6 A;  3AG1 H;  4IL6 C;  1VQO I;  1RPW A;  2FML A;  3FZV A;  1ZGJ A;  1OCR H;  2ELJ A;  5E20 A;  1T39 A;  4XR6 A;  3ZQG A;  2BEO A;  4I6Z A;  4A3G J;  1TWH J;  4A12 A;  2IA2 A;  4ENJ A;  5KAI C;  4BY1 J;  1MD0 A;  3GZI A;  3C1D A;  5EF6 A;  4DOZ A;  4RB2 C;  1B8I B;  2W57 A;  1IN5 A;  4BS9 A;  1AKH B;  4GXO A;  4P9U A;  2DDB A;  1WCM J;  2ZSI B;  5F1R A;  1ZQ3 P;  4BJT A;  4CCN A;  2O8X A;  1UST A;  3DQV C;  2V9V A;  3BG3 A;  2H6C A;  3NWS A;  2D1V A;  1BR1 A;  2XAS A;  2IA0 A;  2GWR A;  3QOE A;  3SZT A;  1QRY A;  3M8J A;  3IHU A;  1IV6 A;  4B8X A;  1DUX C;  1K61 A;  1NH3 A;  3BG6 A;  1FMW A;  1XN7 A;  2ZO4 A;  3K1N A;  4PFP A;  3QPL A;  1ZRC A;  5J4Y A;  3VUQ A;  2BW3 B;  3IH2 A;  1GXQ A;  1UHM A;  3RKX A;  3CRJ A;  1XCB A;  1DU6 A;  1WH5 A;  2DJI A;  2UZK A;  3JRB A;  3K69 A;  2FBI A;  2HXI A;  5FHP A;  3A4C A;  2A3S A;  4I0A A;  2DT5 A;  1OCO H;  1QHG A;  4HQE A;  5FMP A;  1B72 B;  4WK8 F;  3K1P A;  1ZK8 A;  1RET A;  4A2U A;  4XID A;  1RZ4 A;  3HOX J;  3GTM J;  2XVC A;  3RKQ A;  3BY6 A;  3JR9 A;  4HNV A;  3RKW A;  3N4M A;  2E34 A;  2LK2 A;  4AF5 A;  2IU5 A;  1G6N A;  1JT0 A;  2MAB A;  4QIW N;  3K4B A;  3J7A Y;  5ICF A;  5FLV A;  1S5L C;  5D6E A;  4AM3 A;  2PX9 A;  1QNT A;  3HTA A;  4KIB A;  3ZPL A;  4IEJ A;  1T6S A;  2K4B A;  4FE7 A;  2H1K A;  4HPQ A;  3RZO J;  2BV6 A;  2W1O A;  4C2M A;  4IRH A;  3K4K A;  3CUO A;  5K5O A;  4ZZL A;  3JRA A;  2KP6 A;  2UXX A;  5TRD A;  3ZQH A;  3PSI A;  2LMD A;  2B1E A;  3F8B A;  1FBQ A;  3OS2 A;  4RDU A;  1IXR C;  1IZ1 A;  2DDA A;  2ZKZ A;  2MLG A;  3DLL F;  3LSH A;  2DA2 A;  4HST A;  4A3C J;  5BNG A;  2GUH A;  3F72 A;  5F6F A;  3RSN A;  2P7V B;  4XOR A;  3ZN1 A;  1YE9 A;  2JRT A;  3ZGK A;  1MDM A;  3VOK A;  3VSL A;  4N9I A;  1BI0 A;  3F8M A;  3Q0W A;  2DOA A;  1R58 A;  2BOL A;  4PDK A;  5BQT A;  3GLL A;  3P9C A;  1U6G A;  2KIF A;  3KEY A;  5EGO A;  4ANJ A;  4EJW A;  3LHQ A;  4ZTJ A;  4ON0 A;  1MIJ A;  3V8L A;  3K0L A;  1PUF B;  1LE8 B;  2KIQ A;  3CF2 A;  1YIJ I;  1Z9C A;  1MMS A;  2XGD A;  3FDY A;  2W48 A;  3EUA A;  4CCM A;  4RAG A;  2MD5 A;  5IP6 A;  3E5X A;  2HZD A;  2CQX A;  4UUS B;  4MLO A;  3IWF A;  5DUK A;  1EH8 A;  4A6E A;  1OYI A;  3CCQ I;  3JAM Z;  4DGW B;  3L9F A;  1YW8 A;  4HNU A;  2XGX A;  2OZU A;  2M2E A;  4J19 A;  3S3M A;  2R5Z B;  3ZCO A;  1X3Z B;  5D1R A;  4H4K C;  4OIP F;  2BXY A;  5E8I A;  3PPB A;  2EB7 A;  2K9L A;  2E36 A;  2F4I A;  4MHG A;  3AG2 H;  4IKF A;  4E7K A;  4RGX A;  3ULQ B;  4ZDP A;  2L5Q A;  2P5K A;  3KLO A;  4CZC A;  5DM6 F;  4WXH A;  2VOD A;  3CCR I;  2DQL A;  4HDV A;  1G3T A;  5L3B A;  1XG1 A;  2L4M A;  2ZJP F;  2L54 A;  4E7Z A;  1RKT A;  3VB2 A;  4UUS A;  1W7P D;  2IRF G;  2R5Z A;  2L7M P;  4GYG A;  3SYT A;  1TW3 A;  5D4S A;  5LLQ A;  2YU3 A;  3CCE I;  5K7H A;  3WTW C;  4E7I A;  2LTP A;  4RAZ A;  4A93 J;  4NC8 A;  2FEZ A;  3QAH A;  3EPZ A;  5A2Q K;  3QRF F;  3K4N A;  2V6C A;  2ID3 A;  3I5U A;  3COL A;  5FKK A;  2NS7 A;  1YW7 A;  2VPR A;  3S8P A;  4U7B A;  2DOD A;  2VBX A;  3FXQ A;  5BS6 A;  3OR1 C;  2R5Y A;  2ISY A;  2UXO A;  2FBH A;  4D0P A;  2RDP A;  4ZYH A;  2QLZ A;  1BR4 A;  3LNQ A;  3L2W A;  4IO9 F;  1MSF C;  3RQ4 A;  2ZCW A;  2YVH A;  2LRD A;  5FD5 A;  1B1B A;  1MMA A;  1P2F A;  1Z05 A;  3OIQ A;  4XKV A;  2I8D A;  4UV9 A;  4JQF A;  2A6E F;  3RD3 A;  4L9N A;  1A31 A;  5CW8 A;  1I3Q J;  2NNN A;  4D5C A;  3E6M A;  3U1K A;  2OQR A;  2WAF A;  3RPU D;  2Q0O A;  4S04 A;  3KX2 A;  1XSD A;  1UI5 A;  3KEO A;  2X6X A;  4EM0 B;  5CVV A;  1IF1 A;  2KPM A;  5FKO A;  3TW7 A;  4M73 A;  4C3H J;  3GTG J;  4GYI A;  4ETS A;  4XON A;  2XV4 S;  4ESF A;  4UVA A;  5DTD A;  3JRH A;  3TOB A;  1WJA A;  3ONQ A;  5KK1 A;  2X9D A;  2TRT A;  2W84 A;  4GFL A;  1OKR A;  1SMT A;  2XGE A;  1SVO A;  5CQE A;  1XDU A;  4L9T A;  3CC2 I;  4DIQ A;  3GYH X;  2KFD A;  4OIQ F;  1U3E M;  2DW4 A;  2ELH A;  1WRJ A;  3CDI A;  3IKT A;  2DMQ A;  3RJP A;  5HDK A;  3FXO A;  4BHB A;  2G7G A;  2K9S A;  2PFB A;  2XGC A;  1MMD A;  2PI0 A;  2XAH A;  3LMM A;  1Y8Q B;  2G7U A;  1E3P A;  1RUN A;  3QU3 A;  5KNL A;  5K5R A;  2FX0 A;  3C2H A;  5CQG A;  2K9M A;  2KIU A;  2NX4 A;  3BR1 A;  1TWC J;  1OCC H;  4EV0 A;  1S8N A;  2VKE A;  3CP8 A;  2BW3 A;  4ICH A;  2KQR A;  1LPQ A;  1D5Y A;  1ZR2 A;  2CW8 A;  2EZK A;  2FA5 A;  2DMU A;  2F4M B;  4PCQ A;  2H8R A;  1O3S A;  1EF4 A;  3CO7 C;  2YU9 J;  1WHU A;  1N78 A;  2LH9 A;  3HYI A;  2XF5 A;  2A07 F;  3W2V A;  4YFN F;  5IOY A;  3HOW J;  5ILV A;  3ASO H;  5FLX K;  3BQY A;  4YIR X;  3RZD J;  1HQC A;  3SZG A;  3SDG A;  3HGG A;  4NUB A;  4PSW A;  3ZMT A;  1HDD C;  4KT5 C;  2CS3 A;  3H5N A;  2P5V A;  1TNS A;  1YX5 A;  4L5I A;  4UXN A;  4X1E A;  4AU7 A;  3WHB A;  1JHF A;  4F91 B;  4B09 A;  2L0K A;  2XAJ A;  2R92 J;  2B63 J;  3TL4 X;  2HKU A;  4KIC A;  2VN2 A;  1U5T B;  1FOY A;  1G59 A;  2V9K A;  1EV7 A;  5IYD J;  1J0R A;  3FWE A;  1J7K A;  4BJ5 C;  3RIR A;  3O6B B;  2CQN A;  3CMA I;  5J47 A;  2Y48 A;  1R9T J;  3G1O A;  3IH3 A;  3RCO A;  2R7V A;  3BJO A;  4A3B J;  3K2Z A;  2YX7 A;  4II3 A;  1YO5 C;  4IHX A;  1FOK A;  3J80 Z;  1Z0X A;  5HS8 A;  2Z2S B;  1FBU A;  1W5S A;  2F5D A;  4FQG A;  1XSX A;  3HPG A;  4GFK A;  2VXZ A;  2LLK A;  2JZY A;  2BZT A;  2MBF A;  1WI3 A;  3T5X A;  5HNF A;  1D8J A;  1P7J A;  2G7S A;  4IHV A;  1MMN A;  1X1D A;  2XB5 A;  3CUQ A;  4RB0 A;  1QZE A;  2K3P A;  1X4P A;  4BQA A;  1LJ9 A;  2K5C A;  2OF7 A;  3L1P A;  5D5W B;  3DF8 A;  2W7N A;  1R71 A;  3S17 J;  1FMV A;  3UR3 C;  2IS2 A;  3VYU B;  2P7C B;  1OR7 C;  1YG2 A;  2OU2 A;  1HBX G;  4MFE A;  4IOA F;  1RNL A;  1BJZ A;  4PJJ A;  1EKE A;  5IY5 H;  1K78 A;  1WH7 A;  5AQC A;  2HYT A;  3NI7 A;  3DU5 A;  3NAU A;  2O3F A;  2O61 A;  2E1C A;  2Z33 A;  2M8E A;  3S2D J;  2ECC A;  1LDJ A;  5EG0 A;  1PP8 F;  1VQ9 I;  4BGD A;  2IGO A;  3IAS 2;  2DYS H;  2E1N A;  2QKO A;  2KJC A;  4BE2 A;  2IS4 A;  1S7E A;  2NVX J;  4C2M J;  3GTQ J;  4LB5 A;  3W6K B;  3H3U A;  3Q3S A;  2R7R A;  2JPB A;  2EV5 A;  4XLA A;  2X48 A;  3BCA A;  3GF2 A;  5FRM A;  1V5E A;  3QKX A;  2DTR A;  3SEZ A;  2ZBK A;  4OOI A;  5H6Q A;  4M71 A;  3IRR A;  1IN7 A;  2W53 A;  3HOV J;  2VJ4 A;  1SVL A;  5GP9 A;  1BOB A;  3HDD A;  1X2N A;  2LKS A;  3C18 A;  4CSW A;  3NRV A;  3G7R A;  1JUP A;  3TP0 A;  5H9T A;  3RPU A;  2KRC A;  3WGG A;  3VVX A;  1BJA A;  1VQL I;  2Q8K A;  1BW5 A;  2GXG A;  1R1T A;  2JSP A;  2D45 A;  3F6V A;  1MNE A;  1SFE A;  2CH0 A;  2BY3 A;  4A0Z A;  1BI1 A;  4B44 A;  2EIN H;  5L3D A;  3FXK A;  3ABK H;  3HZJ A;  2EQR A;  1U9O A;  5EJC A;  3LAJ A;  2M5W A;  5EYR A;  3QYB A;  4D7N A;  3HE0 A;  1MBH A;  2L7F P;  1IUF A;  5E8G A;  4ESJ A;  2BVL A;  1KU2 A;  3GEU A;  4XIC A;  1FYM A;  3H1C A;  4IVN A;  4CCK A;  3DTK A;  1FLI A;  1ETY A;  2WY8 Q;  2HYJ A;  5EEH A;  1MJA A;  4LK1 F;  3HTS B;  4CIC A;  1KU3 A;  1LVK A;  1WFX A;  3LJL A;  3TW6 A;  3H3V K;  5B66 C;  2IXS A;  3HL2 A;  2JRM A;  2VKD A;  3M3Y J;  2XKP A;  3SFI A;  3K2A A;  2HOS A;  1FIP A;  2WAQ N;  4TV7 A;  3WOD F;  2HQA A;  1WI9 A;  2DT7 B;  4V19 K;  2PMU A;  1WJD A;  2V1U A;  1G3Y A;  2O03 A;  3VW2 A;  1HOM A;  2OJE D;  4XQF A;  4E7H A;  2LFB A;  3CJQ B;  4JX4 A;  3R6S A;  3PO2 J;  4W1U A;  3SWH A;  4RBO A;  4MXM A;  1O7F A;  2CQK A;  2M30 A;  3SXY A;  2CUE A;  1FOW A;  2V79 A;  3X2Q H;  1O4X A;  3DPU A;  1EA3 A;  2REK A;  2QSF X;  1S29 A;  4PJ0 C;  4DZJ A;  1REP C;  2ZC2 A;  4XLH A;  5D8L B;  4FX0 A;  3KZY A;  5CPR B;  3ABM H;  2ZME A;  4XN0 A;  3ZMD A;  3VYS B;  2G0E A;  2DBB A;  2ZJQ F;  3FMS A;  1YQA A;  3P7N A;  3MCZ A;  3DU6 A;  1JJ8 C;  4RGS A;  2NVU B;  5D4R A;  4JYK A;  5D5X B;  2LYC A;  4AWX B;  1ZEL A;  2XKO A;  2R3S A;  4BQO A;  2NVQ J;  1G3W A;  4OWR B;  5DD4 A;  2ZXH A;  2F48 A;  1T98 A;  3D1N I;  1S72 I;  2PG4 A;  1IN6 A;  2ETH A;  1ON2 A;  2MGQ A;  2VT3 A;  4V2G A;  3H35 A;  3F21 A;  2OAZ A;  2DMN A;  3JRG A;  1P6R A;  5C4J J;  2A2F X;  2XRL A;  5HBU A;  5EEA A;  2QQ9 A;  2JPC A;  1D0X A;  3CCS I;  5AIQ A;  3NNR A;  3ASN H;  4Q4Z F;  1SD5 A;  1ZYR F;  3I3L A;  4BE0 A;  2FNP A;  3SHF A;  4N9H A;  2QSH X;  2R7D A;  5JLX A;  1SD7 A;  1V3F A;  3EUH C;  2OCE A;  2EIJ H;  1I39 A;  4OAY A;  4RMN A;  3JRC A;  3LA3 A;  1WKM A;  3TDZ C;  2CW7 A;  3O8H A;  4F92 B;  3B6C A;  3IAM 2;  3O2P E;  5E1X A;  2WWY A;  4E6K G;  2Z99 A;  4KIS A;  5D5U B;  4LK0 F;  3KNW A;  2M7A A;  1WGX A;  3JTG A;  4PK4 A;  1VQ5 I;  3I55 I;  3MFK A;  2DMT A;  5LGT A;  3GLX A;  5FGL A;  2YVX A;  2DU9 A;  5TGT A;  3MKZ A;  2KIM A;  3J80 K;  3ABL H;  3HHG A;  4BAY A;  3W2A A;  1FC3 A;  3GFJ A;  1TTY A;  4HW0 A;  3WG7 H;  5FJ8 J;  1ZLJ A;  5GTI C;  1LE8 A;  1U2W A;  1O57 A;  1PDN C;  3WU0 A;  3R61 A;  3V78 A;  4M72 A;  2RQQ A;  4CCL A;  1UI6 A;  4ESB A;  1D1A A;  4CH7 A;  2VLA A;  2LP0 A;  4G7H F;  1SD4 A;  3ZQQ A;  2BY1 A;  4O3M A;  2BHZ A;  4GGG A;  1R00 A;  2ZXI A;  4NNJ A;  4W97 A;  1OJL A;  1ZHF A;  1UJ8 A;  1RC9 A;  3BZ6 A;  1I1G A;  1TQM A;  4RM3 A;  4DNC A;  3PJR A;  1Y1W J;  2QKL B;  3RH2 A;  3CP2 A;  3S2W A;  4L0Z B;  4A0Y A;  2HVQ A;  3FKI J;  5J8F A;  1FZP B;  3OIO A;  1DU0 A;  2CFX A;  5F04 A;  4KUM A;  1K6O A;  5GAE J;  5CXI A;  1KU9 A;  1XMA A;  4M9S A;  1K6Y A;  3DFG A;  1SC7 A;  1A36 A;  4LMY A;  4R1H A;  4BHC A;  4LB6 B;  3EUP A;  1A35 A;  3OV8 A;  3V7S A;  3I58 A;  1T0F A;  1SVM A;  2FQ3 A;  3OS0 A;  5FLX Z;  1DDN A;  4P55 A;  4QLC U;  2KHM A;  3K4C A;  3MN2 A;  4YEL A;  2EV0 A;  3ZQI A;  1BC7 C;  2DPU A;  1RR7 A;  1Z6T A;  1Y8R B;  2ZY9 A;  3HIF A;  4AUX A;  4BXU A;  3NS4 A;  1PUE E;  3NQO A;  2LC2 A;  3GZN B;  1Z1D A;  2L3D A;  5KVR A;  1CGP A;  1O7L A;  2FBK A;  3OY9 A;  1KQ8 A;  4DZP A;  4HDU A;  4YEJ A;  1GT0 C;  3HJE A;  2Y31 A;  4ENM A;  4U9L A;  2RNG A;  4XMY A;  2X6O A;  1Z21 A;  4C9Y A;  3MAJ A;  1OFC X;  4BEH A;  2LG4 A;  4WIB A;  3CCM I;  3IWZ A;  4QTR A;  3PSF A;  1Y56 A;  4XLE A;  1ZRD A;  1J59 A;  1LUJ B;  1YW9 A;  3BPV A;  3S16 J;  1RUO A;  3LSM A;  1TWG J;  1LFU P;  3BNI A;  4PJN A;  1F1Z A;  2IGM A;  5J6X A;  1TBX A;  4WX9 A;  3NRG A;  4EM1 A;  3E7L A;  1BM9 A;  1UZC A;  2WTE A;  3LAP A;  4XSZ F;  2VAS A;  2GIV A;  1BN5 A;  3MVP A;  3HRT A;  2XSJ C;  2XRN A;  4MNU A;  4U0Y A;  3HKZ A;  1SFK A;  3S93 A;  3CJN A;  3WTY C;  3HXL A;  2LY9 A;  4BQQ A;  2R5Y B;  1HSJ A;  1S9H A;  5EFY A;  2J5P A;  1T2K A;  3JTH A;  3E5Q A;  3LA7 A;  1GVD A;  3VW1 A;  2R4G A;  1H8A C;  5KCM A;  5E3L A;  1SMY F;  1GDT A;  3AFH A;  1D5V A;  3J7Z I;  2XC7 A;  5IT3 A;  3I56 I;  1XTA A;  2DT6 A;  5GAG J;  2WUI A;  2DFH A;  1ZR4 A;  2OZ6 A;  4G9Y A;  2OPT A;  5CXG A;  2G7H A;  2YUS A;  4QWQ A;  1H9G A;  5M5W J;  1OCZ H;  1R1U A;  4KMU X;  4DQ2 A;  2V57 A;  1U8B A;  2I10 A;  5E3M A;  3GTK J;  3S14 J;  3ESW B;  1UEL B;  3JCU C;  1HKQ A;  3KCC A;  1MSE C;  2CUJ A;  5M3M J;  4B4C A;  5F08 A;  3CQZ J;  3A1Y A;  4BL0 B;  4BU2 A;  1JKQ C;  2YS9 A;  1VF9 A;  2HYG D;  2GAU A;  2HKX A;  5ILS A;  3VFZ A;  3GTJ J;  4BE1 A;  3BTC A;  4A3K J;  4FT8 A;  3CCJ I;  2KRH A;  1ZG5 A;  1QA6 A;  1UCR A;  3KZI C;  4CO8 A;  3RTR A;  3COA C;  2EZI A;  2JA7 J;  5GPA A;  2PBX A;  2AHQ A;  2CG4 A;  2L9V A;  4HA8 A;  4MO7 A;  2QVO A;  2YSR A;  5JI6 A;  2QBY B;  3L2U A;  4RLF A;  1IUY A;  4ITV A;  2EA4 A;  1NK2 P;  1UG0 A;  2H09 A;  1WJE A;  4XL9 A;  4D5F A;  3QU6 A;  2M0M A;  3V8J A;  1ZGW A;  1A5J A;  5B1B H;  3C2G A;  3OSF A;  1T56 A;  4JX5 A;  2XAQ A;  1FOX A;  1WSU A;  2ACJ A;  1W7P A;  2ZNY A;  4X6A J;  4JL3 A;  3LQQ A;  2VUM J;  2LDU A;  1MW7 A;  4WF2 A;  1DGW Y;  1YJ9 I;  2E5N A;  1XS9 A;  4LIV A;  3T6N A;  4LGW A;  1BA5 A;  1YS7 A;  2GOX B;  3FBN B;  3BRO A;  2DG8 A;  4DBR A;  3QQA A;  2HKO A;  4C30 A;  1VQN I;  4HF1 A;  1YJW I;  6PAX A;  1OCP A;  1NG6 A;  2P81 A;  1IXC A;  4BBS J;  1B9M A;  5ERI A;  3T1B A;  4GCV A;  1HA8 A;  2GXA A;  3CC7 I;  2RRE A;  4EMS A;  4R79 A;  3U21 A;  2NRA C;  3DKW A;  1N25 A;  4NHJ A;  2F5C A;  2JVH A;  4FX4 A;  4ZYA A;  1BIA A;  4L9V A;  1VQ6 I;  2HNH A;  2IPQ X;  2B9S A;  2PMH A;  1D1C A;  1FTZ A;  3U1D A;  2M1B A;  4EJV A;  3FK7 A;  2EK5 A;  2HTJ A;  4I2O A;  3AL0 B;  3BG9 A;  3SZP A;  5HAW A;  3CDL A;  2DO7 A;  3GVA A;  1GV2 A;  2VE8 A;  2WY7 Q;  3UNG C;  4A5M A;  4GFB A;  3CJD A;  1JGG A;  4XOT A;  1ITY A;  2RAS A;  3FRQ A;  1X2M A;  3BP8 A;  4EM2 A;  1YYV A;  3CMY A;  5L3G A;  2NS0 A;  2EIL H;  4ZDL A;  5M5Y J;  4QPQ A;  3OYG A;  2K9Q A;  3VOE A;  5FO5 A;  3RPQ A;  1J2X A;  2QCO A;  1GVJ A;  1JUS A;  2X6Y A;  3FMR A;  2C6Y A;  3VVY A;  4GDF A;  3PIO F;  1Z3X A;  1DGR M;  1VQP I;  4KJZ A;  1VZ0 A;  1FWZ A;  5H20 A;  1Y39 A;  4X0G A;  3A0B C;  3KP7 A;  1WJB A;  4RB1 A;  1GHC A;  5E1Z B;  2ZCN A;  2DLL A;  2JTV A;  2COB A;  4EJO A;  2TDX A;  3MKW B;  1N75 A;  2BBY A;  3H92 A;  4KYW A;  1YLF A;  2HDC A;  4CCO A;  2DG7 A;  3VEP A;  2P0W A;  4LG0 A;  2R7Q A;  2KZV A;  2N8G A;  5ILU A;  2L2O A;  1E3H A;  3OYF A;  5K1Y A;  3RQI A;  3H9Q A;  1LDK B;  3ZOB A;  5J4V A;  1FPQ A;  3AQT A;  3M07 A;  1U5T A;  3LSJ A;  3GXO A;  3AKZ A;  4CZZ A;  5DUI A;  2E2J J;  2ZME B;  3WTS C;  4RB3 C;  4A3L J;  2ZCM A;  4S0H B;  3VOX A;  3QPH A;  4J00 A;  3BQZ A;  1POG A;  5J3L A;  3HSR A;  1CF7 A;  1VTN C;  4EEF G;  2YVE A;  5C4Y A;  4NC7 A;  1JHH A;  4BUP A;  3KP3 A;  4XRF A;  3B02 A;  2DQR A;  4HV5 A;  2B7E A;  3CD6 I;  1JGS A;  3Q0V A;  1BBY A;  4M9Z A;  1S6L A;  4PGH A;  2WB1 A;  3W3C A;  3JSP A;  5B3S H;  2XF7 A;  2E60 A;  3SJM A;  4V2F A;  3REO A;  4AC0 A;  1QVU A;  4OU0 A;  5LHH A;  2DA7 A;  2JQ7 A;  4U0V A;  2MLK A;  4MEX F;  3S5R A;  2X1E A;  5CJ9 A;  1PP7 U;  1IN8 A;  4XLF A;  4JKZ A;  4HYE A;  1OLT A;  3V7R A;  5HLI A;  3L2C A;  4ENK A;  2K27 A;  2ZFU A;  3GCM A;  3CLO A;  3DPT A;  2P5L C;  2K4J A;  2M8G X;  2GBY A;  4HX8 A;  3NPI A;  5LGN A;  1W0U A;  1ERD A;  4NN1 A;  1XCV A;  3KFW X;  3A02 A;  2CQQ A;  2RHA A;  5EG0 B;  4B3X A;  1T33 A;  4A3J J;  4ZC3 A;  2A61 A;  2HS5 A;  4AVP A;  5LRS A;  4UB6 C;  2V6E A;  5JR3 A;  2UWM A;  4F52 A;  5DCM B;  2LNB A;  3VP5 A;  4B48 A;  2BGC A;  1W36 C;  4DJA A;  5GTH C;  1RIO H;  1TP4 A;  2VPL A;  1OMI A;  1VQK I;  3W6J B;  1HW5 A;  4M3B A;  2M7B A;  3OS1 A;  1B72 A;  2JA8 J;  2VBW A;  2M4K A;  2VI6 A;  2ZXW H;  2CWE A;  2ZJR F;  1XC5 A;  4M6V A;  2CJJ A;  4CHU A;  2R93 J;  4LOC A;  3FM3 A;  2Y75 A;  4XKB A;  2E35 A;  3M8E A;  2MD0 A;  4CXF A;  3L2V A;  1VQ4 I;  4NC6 A;  1K4S A;  3OWT A;  2VIX A;  4ZYG A;  3I64 A;  3HKZ N;  4JP0 A;  2AQE A;  5K58 A;  1Y6I A;  2R0Q C;  4N4O B;  4I76 A;  3E6D A;  4ZZD A;  3PO3 J;  3EDP A;  2R7U A;  1X1B A;  3BT9 A;  3BPX A;  4CUG A;  2FUG 2;  1X58 A;  1Q1V A;  4OMY A;  1W5C C;  4NDL A;  2EFW A;  1E2X A;  4HLX A;  2QQ8 A;  4LD5 A;  2EFQ A;  2ZXJ A;  4M3D A;  1LEA A;  3EGQ A;  5K5Q A;  3ON2 A;  1FIA A;  2CO5 A;  1N77 A;  3G1M A;  2MG4 A;  2BE5 F;  3O3K A;  2ZB9 A;  1QGP A;  2B3W A;  1TWF J;  4KMF A;  1ETX A;  1V54 H;  1WPK A;  2CFO A;  3BRU A;  3VTI A;  2XAF A;  1OYW A;  3PQK A;  5GAD J;  4MQ9 F;  1HKS A;  1AA7 A;  2TCT A;  1KA8 A;  1B9N A;  2F5F A;  2O6G E;  2NS8 A;  4IQJ A;  4GCL A;  4UB8 C;  2ME6 A;  1I27 A;  4LLG F;  4PJM A;  2GIZ A;  1R36 A;  2JA2 A;  2X1C A;  4I01 A;  1ETK A;  2HOA A;  3F8C A;  3E1S A;  1Z67 A;  3E3V A;  3KP6 A;  4BQN A;  5JVT A;  3CWR A;  2VQH A;  3CDH A;  4U87 A;  4U7D A;  1MKM A;  1NHA A;  2LD5 A;  1QZY A;  3H9G A;  3FXL A;  2DA1 A;  5HDG A;  3K70 C;  1I3A A;  1I5Z A;  5E1W A;  2QA4 I;  3PQJ A;  4XM3 A;  2RC4 A;  4DBQ A;  4A3D J;  1ETW A;  4HRI A;  4CGZ A;  2ELK A;  3TQN A;  2EIK H;  4GCK A;  3PNT A;  4HQM A;  2GFN A;  4F55 A;  3I9V 2;  1ZG1 A;  2Q24 A;  3ML6 A;  3MD2 A;  3A2K A;  2HOT A;  1TWA J;  1MH4 A;  5HLT A;  3TO9 A;  3S1N J;  3G4S I;  3DTI A;  3TDU C;  4WCG A;  5DYM A;  2BHY A;  4E7J A;  3ELK A;  3CZ6 A;  1OCT C;  2DOF A;  5HDN A;  2IS6 A;  2P4W A;  4N4N B;  4KN7 X;  3TKY A;  4WXC A;  2KRF A;  5IYC J;  4BHP A;  1IW7 F;  1F43 A;  4HKU A;  3CJR B;  4Y33 A;  2WV0 A;  4CA0 A;  4IHW A;  1A04 A;  2K9N A;  3R0A A;  5BPD A;  1R1V A;  5C44 J;  2O7T A;  1HC8 A;  3GZ5 A;  2V1N A;  1ACI A;  1I6H J;  1V5F A;  1UB9 A;  2B0L A;  3GUD A;  4NEL A;  4YZE A;  3BZK A;  2NYX A;  4ZH4 F;  4U88 A;  2WBM A;  4BDY A;  2DN0 A;  1W0T A;  1ZGA A;  1XD7 A;  4G12 A;  3ZRG A;  5FKL A;  2G3B A;  3FHZ A;  4E7L A;  2IS1 A;  4ZYE A;  1VQM I;  2HQN A;  3PAS A;  2Q2E B;  4DVY P;  2GA2 A;  3OYB A;  2WC2 A;  1ULY A;  1ZAR A;  3BZC A;  4BYY A;  2XPV A;  3IC7 A;  5JFR A;  3E0J B;  3WTU C;  3OYC A;  4IOC F;  1LEB A;  2EH3 A;  1O3R A;  2FXA A;  4RS8 A;  4FTH A;  4GO1 A;  1I1S A;  2FD5 A;  2HR3 A;  3QP6 A;  4RGR A;  4E7S A;  2NAZ A;  2VJJ A;  5ICG A;  4JOM A;  2PN6 A;  2V7F A;  1P9Q C;  3HHH A;  3KLN A;  3RDI A;  2GQQ A;  3C2B A;  2QTQ A;  3D5S C;  5DM7 F;  2JJ7 A;  2X85 A;  3ZMS A;  3EQL F;  4II2 A;  2NNY A;  4P96 A;  3FMQ A;  4OIR F;  4KN4 X;  5TJJ A;  5LEJ A;  2WB1 N;  3HM5 A;  4QPO A;  1R4N B;  1MBE A;  2MA3 A;  3ROU A;  4ACI A;  3BR3 A;  2OC6 A;  5J1R A;  3F1B A;  1ZTR A;  2H8W A;  4EJT A;  4GRI A;  4BJ6 C;  4FCY A;  3V7C A;  5F0H A;  2KLO A;  3CJT B;  4YII A;  4CCJ A;  1IRG A;  4HAM A;  2YX4 A;  5E17 F;  4AYB N;  3C7J A;  2XPU A;  4HSR A;  1Z3Y A;  3GFI A;  1K79 A;  3CUQ B;  2DA3 A;  1PJR A;  3R0J A;  3CME I;  2F07 A;  1XMX A;  4PXI A;  1JI8 A;  3H3Z A;  1LFB A;  1R4M B;  4FIS A;  1YIT I;  2FU4 A;  2OUM A;  3ECH A;  2PJR B;  2XHK A;  4MTE A;  1H88 C;  1OIS A;  2WAQ A;  1BW6 A;  1QHH D;  4HG2 A;  4PJL A;  3CUQ C;  3S15 J;  1HLV A;  2EFO A;  4IHY A;  1TQP A;  4PGG A;  5HLG A;  3BJB A;  3ON4 A;  3TGN A;  3F3X A;  2JK3 A;  2DJN A;  4OAZ A;  3WTT C;  1KQ0 A;  3DLA A;  5IPA A;  3F8N A;  1ZG3 A;  1AU7 A;  2VXD A;  4MEY F;  1WJC A;  4YFX F;  1ODD A;  1U78 A;  3JW4 A;  1E3O C;  5TIS C;  3CLQ A;  5ICE A;  4L5E A;  3KP2 A;  4M3F A;  4I98 B;  3S1Q J;  4XRM A;  5FB2 A;  2FSW A;  1NTC A;  3QP5 A;  1UHW A;  4WWC A;  3JRF A;  4ZYD A;  3FXU A;  3GW2 A;  1NG7 A;  2EV6 A;  1D3Y A;  3BTI A;  3HBL A;  3IRQ A;  1F5T A;  3HUG B;  3V6G A;  2CSO A;  2W82 A;  4KDP A;  1B8I A;  3U2R A;  4M3E A;  2D1H A;  1AKH A;  1CF7 B;  2VE9 A;  2M4G A;  2R7S A;  3ZR8 X;  3MZH A;  3MKL A;  2A5W A;  2D2W A;  3F23 A;  4C2U A;  4OD5 A;  3SFZ A;  2BXZ A;  4A6D A;  4IX7 A;  1R49 A;  2CYY A;  2BY2 A;  3R60 A;  4LLL A;  3K9T A;  2RVC A;  4IRG A;  3L2Q A;  3AL0 C;  4AC6 A;  4BKX A;  2LKX A;  4Z2Y A;  3PFI A;  3CMM A;  2K02 A;  2WGB A;  5EZH A;  1Y0U A;  2IVM A;  2XSD C;  5C4X J;  2CGP A;  3TO7 A;  1FP1 D;  1IDZ A;  4G6D A;  3G56 A;  2DK8 A;  2LBF B;  3DKY A;  3WU1 B;  3GTP J;  2JUC A;  4HNT A;  1U9N A;  4YRV A;  5LD2 C;  2HOE A;  3FM5 A;  1T8I A;  2CMP A;  3HC7 A;  4Y7N J;  2P8T A;  3P9T A;  2OD5 A;  3WTX C;  4XOP A;  3F0C A;  1VFC A;  2GM4 A;  2HI3 A;  5DAJ A;  4QSH A;  1RI7 A;  4IHS A;  4BY7 J;  1T95 A;  2L7K A;  2XAG A;  3BR5 A;  2JWT A;  4B1R A;  3L7W A;  1XGM A;  2DXI A;  1L3L A;  2ICW G;  3I4M J;  2WAD A;  4CYC B;  1J9I A;  2ADU A;  2VC1 A;  2QZ8 A;  4O6J A;  3B73 A;  1Z91 A;  2BVM A;  5FFZ A;  2W25 A;  1IRZ A;  3HB9 A;  1FX7 A;  2V4J C;  2M3A A;  4KA4 A;  1UHS A;  5LEK A;  3KP4 A;  3G1L A;  2MH9 A;  3CCU I;  2HVR A;  2VB6 A;  4Y4R A;  3ZMV A;  5H6R A;  1KYZ A;  3SDB A;  1X1C A;  3KP5 A;  2F6C A;  3PUF A;  2ZNZ A;  2LVS A;  2ZSH B;  1BC8 C;  2STT A;  1GV5 A;  3CTA A;  5F0F A;  2OI8 A;  3QYE A;  1JJ6 C;  2MYS A;  4Q5S F;  3DWL E;  4MGR A;  2E71 A;  3BJ6 A;  2HQR A;  1XPX A;  2R7F A;  2X6W A;  4G8X A;  4Y52 J;  4AIJ A;  1ZN2 A;  4XLC A;  3EUK L;  2XUB A;  1B6A A;  4HEA 2;  1XGO A;  3LQR A;  2VKH A;  4A0X A;  4MTD A;  1KGS A;  1WJF A;  1VND A;  3QWL A;  4EAT A;  2LKP A;  2RNJ A;  4E4H A;  3W2W A;  4G7O F;  3QBM A;  1S7A A;  3HRU A;  5F64 A;  1BR2 A;  2GOM A;  3AG3 H;  2ZME C;  5AON A;  1W36 D;  1YRN A;  3HOU J;  2HFH A;  2IA1 A;  2DI3 A;  3JSO A;  2EIM H;  2W4S A;  1A6Q A;  3HOS A;  3ABU A;  3FK6 A;  2EA2 A;  2DYR H;  3MWM A;  3SEQ A;  2QIB A;  2H27 A;  2BYV E;  3MKY B;  5BPI A;  4CYC A;  1ZH5 A;  5L3C A;  3FIS A;  1WQ2 A;  3I0T A;  5A2Q Z;  1R5I D;  2Y9Z A;  2CUF A;  4A3M J;  1M1E B;  3PUB A;  1MH3 A;  1H9T A;  2E7X A;  3OIP A;  3FIW A;  1O3T A;  3WTV C;  3PNY A;  1G4D A;  5LGU A;  3HSF A;  3M1C A;  4I0B A;  3OOP A;  1H0M A;  3G73 A;  4UUV A;  4Y17 A;  2DFF A;  3VVZ A;  2L01 A;  3KKC A;  1YS6 A;  3BR6 A;  2FJ1 A;  4MK6 A;  3EUH A;  3S3N A;  4PFO A; 
#chains in the Genus database with same CATH homology
 5HSZ A;  5E3O A;  2OF7 A;  2E2J J;  3E7Q A;  3IUV A;  3L1P A;  3UKG A;  2VKV A;  3ANG A;  4A3L J;  3S17 J;  2ZCM A;  4S0H B;  3S2H J;  3VOX A;  1NK3 P;  2EZH A;  3BQZ A;  1POG A;  5J3L A;  4MFE A;  4EEF G;  2YVE A;  5C4Y A;  1TC3 C;  1BJZ A;  1FJL A;  1WH7 A;  2XPW A;  5AQC A;  1YRN B;  3BR2 A;  2HYT A;  3NAU A;  3NI7 A;  1ENH A;  2PMZ N;  1UMQ A;  3CCY A;  1A6I A;  1P7I A;  2ME0 A;  3A01 A;  3S2D J;  3Q0V A;  2ECC A;  5EG0 A;  5FKM A;  2HQ5 A;  2NP5 A;  1MBF A;  3HIM A;  2QKO A;  3SJM A;  2L9R A;  4V2F A;  5F1J A;  4AC0 A;  1QVU A;  2DA7 A;  1S7E A;  4DYR A;  2NVX J;  4C2M J;  3BG5 A;  3GTQ J;  3S5R A;  3S1R J;  1HDP A;  4UDS A;  3Q3S A;  2E2H J;  1Z77 A;  1IC8 A;  4JKZ A;  1SGM A;  2X48 A;  5JLW A;  5M5X J;  3HTH A;  3QKX A;  4KWA A;  2M8G X;  4BXX J;  2GBY A;  3NPI A;  2W53 A;  1JKO C;  1SAN A;  3HOV J;  1W0U A;  1JKR C;  1I50 J;  3PM1 A;  4NN1 A;  3TED A;  3A02 A;  2CQQ A;  5GP9 A;  2RHA A;  5D19 A;  5EG0 B;  1X2N A;  3H0G J;  3HDD A;  1T33 A;  2ECB A;  4A3J J;  3G7R A;  1K83 J;  4DYQ A;  1JUP A;  1SFO J;  3TP0 A;  5H9T A;  2M9H A;  1MBG A;  3DPJ A;  1RES A;  2UXI A;  3VVX A;  3HOY J;  3VP5 A;  1BW5 A;  2L7Z A;  3BTL A;  4M3B A;  2LR8 A;  3OSG A;  1B72 A;  2JA8 J;  3A03 A;  3DEW A;  2VI6 A;  2D6Y A;  2EQR A;  1XC5 A;  4M6V A;  2CJJ A;  5F0C A;  1U9O A;  5IOZ A;  2R93 J;  4LOC A;  5EYR A;  4D7N A;  3HE0 A;  1MBH A;  2L7F P;  2K40 A;  1ETO A;  5IYB J;  3C07 A;  1IUF A;  2WV1 A;  2O8K A;  3GEU A;  2O7O A;  4XIC A;  5EDN A;  2M0C A;  2Y0S N;  1ETY A;  2HYJ A;  3HKZ N;  3JRI A;  4JP0 A;  3W6V A;  4ME9 A;  1G2H A;  3LJL A;  3TW6 A;  2IEK A;  2R0Q C;  3H3V K;  2DMP A;  2IBD A;  3BCG A;  5K58 A;  2QF7 A;  4I76 A;  3I4N J;  4D7M A;  3IH4 A;  3M3Y J;  3SFI A;  3K2A A;  4M3G A;  2HOS A;  3PO3 J;  4A3I J;  1FIP A;  2WAQ N;  2FBQ A;  3BT9 A;  3OOU A;  1X58 A;  2CRG A;  1Q1V A;  2G7L A;  4NDL A;  2R7Z J;  3VW2 A;  1HOM A;  2EZL A;  2LFB A;  4JX4 A;  4M3D A;  3EGQ A;  3M4O J;  2DTZ A;  1FIA A;  5M3F J;  3PO2 J;  4W1U A;  3G1M A;  2MG4 A;  1CQT A;  2O9L A;  1IDY A;  2ZB9 A;  1QVT A;  4RBO A;  4MXM A;  4FE4 A;  1H89 C;  2ZCX A;  2GLO A;  1TWF J;  2CUE A;  3LSG A;  1ETX A;  1WPK A;  1O4X A;  3BRU A;  1JTY A;  2DA5 A;  1MNM C;  3VPR A;  3LSR A;  2PZ9 A;  2REK A;  2DA6 A;  2TCT A;  4DZJ A;  4JNN A;  2NS8 A;  2JN6 A;  3ZQL A;  4GCL A;  3JSJ A;  2ME6 A;  1RPW A;  2MW8 A;  2G0E A;  3ZQG A;  2HXO A;  2E2I J;  4MFD A;  1JJ8 C;  4I6Z A;  4A3G J;  1TWH J;  4JYK A;  4BY1 J;  3GZI A;  1ETK A;  2HOA A;  5EF6 A;  2QOP A;  2NVQ J;  1B8I B;  1AKH B;  3CWR A;  1WCM J;  3K7A J;  3KZ9 A;  1ZQ3 P;  3D1N I;  2GEN A;  2LD5 A;  2MGQ A;  4V2G A;  4B3A A;  2DA1 A;  2DMN A;  3JRG A;  4ABZ A;  2UXU A;  3BG3 A;  5E3N A;  1QPI A;  1MBK A;  5C4J J;  4A3D J;  1ETW A;  2XRL A;  5HBU A;  2ELK A;  5EEA A;  1IV6 A;  1QRY A;  4GCK A;  1K61 A;  2GFN A;  3NNR A;  2Q24 A;  3QPL A;  1FTT A;  3ANP A;  2HOT A;  3BHQ A;  3VUQ A;  3IH2 A;  1TWA J;  1MH4 A;  3CRJ A;  3S1N J;  5HOD A;  1DU6 A;  1WH5 A;  3JRB A;  5JLX A;  2HXI A;  5FHP A;  3WHC A;  1OCT C;  3JRC A;  5FMP A;  1B72 B;  3O8H A;  1ZK8 A;  1RET A;  2M34 A;  3B6C A;  1JT6 A;  2DA4 A;  4XID A;  3HOX J;  3GTM J;  1Y1V J;  3RKQ A;  3JR9 A;  3KNW A;  4HNV A;  5IP7 J;  1WGX A;  2LK2 A;  4AF5 A;  2IU5 A;  1JT0 A;  3JRD A;  4QIW N;  5IYC J;  4CGR A;  2DMT A;  2JA5 J;  1F43 A;  4HKU A;  5FGL A;  4IHW A;  5FLV A;  2KDZ A;  2K9N A;  5C44 J;  2O7T A;  3HTA A;  1IJW C;  4IEJ A;  1I6H J;  2MSY A;  5FJ8 J;  1LE8 A;  4NEL A;  4FE7 A;  2H1K A;  4YZE A;  3RZO J;  9ANT A;  3V78 A;  2DN0 A;  1UI6 A;  1W0T A;  3BR0 A;  4G12 A;  5FKL A;  2LP0 A;  2G3B A;  3JRA A;  3ZQH A;  3PAS A;  4W97 A;  1OJL A;  4RDU A;  2FQ4 A;  1Y1W J;  4UUT A;  2DA2 A;  2XPV A;  3RH2 A;  4A3C J;  5BNG A;  2GUH A;  3FKI J;  3OIO A;  1DU0 A;  2EH3 A;  5F04 A;  3VOK A;  4FTH A;  5CXI A;  3Q0W A;  2FD5 A;  3EUP A;  1ETV A;  5EGO A;  3C2B A;  2QTQ A;  3LHQ A;  2JJ7 A;  1PUF B;  1LE8 B;  2D5V A;  2XGD A;  2W48 A;  2WB1 N;  3MN2 A;  3HM5 A;  1MBE A;  3HTJ A;  3ZQI A;  4ACI A;  4BBR J;  3BR3 A;  5IP6 A;  1RR7 A;  5J1R A;  3F1B A;  1ZTR A;  4AUX A;  4UUS B;  2CQX A;  4MLO A;  4FCY A;  5DS9 A;  5F0H A;  3B81 A;  3MNL A;  1BL0 A;  4AYB N;  1JKP C;  4DZP A;  2M2E A;  4J19 A;  2XPU A;  3S1M J;  2R5Z B;  1GT0 C;  2Y31 A;  3O60 A;  5D1R A;  3GBG A;  2AO9 A;  2DA3 A;  2X6O A;  2F07 A;  3VIB A;  1OFC X;  3PPB A;  4XRS G;  1ZKG A;  4PXI A;  4QTR A;  1LFB A;  5D18 A;  4FIS A;  3S16 J;  5GPC A;  1TWG J;  3LWJ A;  1LFU P;  3BNI A;  1H88 C;  1BW6 A;  3NRG A;  4GCT A;  3E7L A;  3S15 J;  1HLV A;  4IHY A;  2Y2Z A;  3BJB A;  1PUF A;  1XG1 A;  5FKN A;  3ON4 A;  4UUS A;  1RKT A;  2JK3 A;  3MVP A;  2DJN A;  2R5Z A;  2L7M P;  1IGN A;  5IPA A;  3AQS A;  1AU7 A;  1HCR A;  5K7H A;  2LY9 A;  2R5Y B;  2LTP A;  4C3J J;  4A93 J;  5IP9 J;  5EFY A;  1APL C;  2NVT J;  1U78 A;  1E3O C;  4L5E A;  1GVD A;  1ORK A;  3VW1 A;  1H8A C;  2ID3 A;  5E3L A;  1GDT A;  5FKK A;  3COL A;  4XK4 A;  4M3F A;  3S1Q J;  2NS7 A;  3TP3 A;  2VPR A;  4XRM A;  5K7F A;  5EZG A;  1NTC A;  2WUI A;  2R5Y A;  5K7Z A;  1F36 A;  3JRF A;  1ZR4 A;  2NVY J;  2OPT A;  1JTX A;  5CXG A;  2UXO A;  2YUS A;  3BTI A;  5M5W J;  3HBL A;  1UG2 A;  2V57 A;  1U8B A;  2I10 A;  5E3M A;  3GTK J;  3S14 J;  5J1Y A;  3V6G A;  3LNQ A;  1B8I A;  4M3E A;  1AKH A;  1ETQ A;  1MSF C;  2ZOZ A;  3MKL A;  2YVH A;  1MSE C;  5C3E J;  5M3M J;  4B4C A;  4MIM A;  3CQZ J;  5F08 A;  1JKQ C;  2YS9 A;  1VF9 A;  3GTJ J;  2Y30 A;  3BTC A;  4A3K J;  1HF0 A;  3RD3 A;  5EGO B;  5CW8 A;  1I3Q J;  4BKX A;  4D5C A;  4AC6 A;  2LKX A;  1UI5 A;  2E1O A;  2EZI A;  2JA7 J;  5GPA A;  2PBX A;  4L62 A;  3JRE A;  2AHQ A;  4MO7 A;  3ZQF A;  2WGB A;  5EZH A;  5FKO A;  3TW7 A;  4C3H J;  2XSD C;  5C4X J;  3GTG J;  1IDZ A;  2EBI A;  3G56 A;  1NK2 P;  5DTD A;  4D5F A;  3JRH A;  3GTP J;  3KKD A;  1ZGW A;  1FEX A;  1U9N A;  1A5J A;  2X9D A;  2XB0 X;  2TRT A;  4Y7N J;  3P9T A;  3NAR A;  2KT0 A;  3F0C A;  4GFL A;  2XGE A;  1VFC A;  2GM4 A;  2HI3 A;  4C3I J;  3OSF A;  2JMW A;  1T56 A;  3GTO J;  4JX5 A;  4A3E J;  5DAJ A;  4QSH A;  4X6A J;  4BY7 J;  4JL3 A;  3BR5 A;  2VUM J;  2E19 A;  2JWT A;  4B1R A;  2DMQ A;  1XS9 A;  2G7G A;  3I4M J;  2K9S A;  2XGC A;  3Q0U A;  4CYC B;  3T6N A;  1BA5 A;  2NOG A;  2DG8 A;  3QQA A;  3HTI A;  2FX0 A;  1GUU A;  1IRZ A;  3HB9 A;  2NX4 A;  1UHS A;  1TWC J;  3BR1 A;  3NXC A;  3G1L A;  1OCP A;  2P81 A;  2VKE A;  4BBS J;  4ICH A;  5FLM J;  5F27 A;  3IV5 A;  1D5Y A;  1ZR2 A;  2EZK A;  2DMU A;  3HEF A;  2H8R A;  2QWT A;  1MBJ A;  1EF4 A;  2YU9 J;  2LVS A;  2OI8 A;  1JUM A;  1GV5 A;  2Y9Y A;  5F0F A;  1IG7 A;  1JJ6 C;  4DYC A;  5IOY A;  3HOW J;  1FTZ A;  3BQY A;  1AHD P;  3RZD J;  3FK7 A;  2XDN A;  4Y52 J;  3ZQC A;  3BG9 A;  3SDG A;  4DW6 A;  5HAW A;  3CDL A;  4GFB A;  1GV2 A;  3HGY A;  3HGG A;  3CJD A;  1JGG A;  1HDD C;  1VND A;  3LOC A;  1ITY A;  2RAS A;  3QBM A;  3FRQ A;  1X2M A;  3HOU J;  4X1E A;  4XRS A;  3CMY A;  1YRN A;  3WHB A;  2CU7 A;  2L0K A;  2UXH A;  2R92 J;  2B63 J;  3GTL J;  2HKU A;  5M5Y J;  2HDD A;  2K9Q A;  3O8G A;  1RKW A;  2OER A;  2QCO A;  1JUS A;  3FK6 A;  5IYD J;  2JA6 J;  2RAE A;  3VVY A;  2QIB A;  3A01 B;  2UXP A;  4CYC A;  3G1O A;  3IH3 A;  1R9T J;  3FIS A;  3LSP A;  4JX6 A;  2ZOY A;  2ZCN A;  3HOZ J;  4A3B J;  2IAI A;  2COB A;  3DCF A;  3VW0 A;  2Y9Z A;  4IHX A;  1VI0 A;  2CUF A;  3B6A A;  4A3F J;  4A3M J;  1MH3 A;  1Z0X A;  3QPS A;  3FIW A;  2DG7 A;  3BTJ A;  2N8G A;  4GFK A;  2ID6 A;  2LLK A;  3RQI A;  1WI3 A;  5J1U A;  3ZOB A;  4A69 C;  3AQT A;  3VVZ A;  1P7J A;  2G7S A;  3KKC A;  4IHV A;  2XB5 A;  2NP3 A;  3BR6 A;  3LSJ A;  2FJ1 A;  4MK6 A;  3ON2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...