4M3GA

Rapid and efficient design of new inhibitors of mycobacterium tuberculosis transcriptional repressor ethr using fragment growing, merging and linking approaches
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
193
structure length
191
Chain Sequence
GDDRELAILATAENLLEDRPLADISVDDLAKGAGISRPTFYFYFPSKEAVLLTLLDRVVNQADMALQTLAENPTDRENMWRTGINVFFETFGSHKAVTRAGQAARATSVEVAELWSTFMQKWIAYTAAVIDAERDRGAAPRTLPAHELATALNLMNERTLFASFAGEQPSVPEARVLDTLVHIWVTSIYGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ligand Efficiency Driven Design of New Inhibitors of Mycobacterium tuberculosis Transcriptional Repressor EthR Using Fragment Growing, Merging, and Linking Approaches.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription repressor/inhibitor
molecule keywords HTH-type transcriptional regulator EthR
total genus 80
structure length 191
sequence length 193
ec nomenclature
pdb deposition date 2013-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4m3gA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 4m3gA02
4D7MA 1SFOJ 1U78A 3S2DJ 2HQ5A 2XGEA 5EZHA 2OF7A 5HODA 2TRTA 5EZGA 2R93J 3IH4A 1GDTA 5IP6A 1I3QJ 2CU7A 2R0QC 2UXHA 2LTPA 1SANA 3VP5A 3MKLA 2JA5J 5FLMJ 3BG5A 2NVXJ 4V2FA 2CRGA 2JN6A 5IP7J 3LSGA 2R7ZJ 2ZOYA 3HOVJ 3BR1A 3BJBA 2E2HJ 4JX5A 1PUFB 3O8GA 4A3EJ 3JREA 5K58A 3NRGA 3MNLA 2R5ZB 3NNRA 2M8GX 1B72B 3QPLA 4YZEA 1IDYA 2ME6A 3JR9A 1FEXA 2HXOA 2QOPA 3HB9A 2L0KA 3HOYJ 4GCKA 1Y1VJ 2GM4A 2ID3A 1FTTA 3F1BA 3LSRA 5F08A 4IHWA 4AC6A 2YS9A 5IYCJ 1K83J 3S17J 1RKWA 2CQXA 1OCPA 2PZ9A 2G0EA 2NP5A 5FKNA 1LE8B 4HKUA 4B3AA 5FKMA 2NS7A 1BJZA 1MBJA 2R5ZA 1I6HJ 1VFCA 2JJ7A 2FX0A 3B6CA 3TP3A 3B81A 3RH2A 4RBOA 3S1QJ 3BG9A 4GCTA 2UXUA 5AQCA 3E7QA 3BHQA 2M9HA 1X2NA 2GUHA 2ZOZA 1IGNA 3A02A 2JWTA 4Y7NJ 4GFLA 1TWFJ 3CJDA 4S0HB 3VW2A 2NS8A 4FTHA 4ACIA 4V2GA 3FK7A 4M6VA 3P9TA 5M5YJ 4FISA 2GFNA 1H89C 2JA7J 2E2IJ 2G3BA 1TWGJ 1X2MA 2K9SA 3A03A 3MN2A 4I76A 3OSFA 3HDDA 1IC8A 1ITYA 4NN1A 3HTHA 1NK3P 3ANGA 1HDPA 3GBGA 3V6GA 1Z77A 1B8IB 1UI5A 1QVTA 2XSDC 1HF0A 2ME0A 4L62A 2MG4A 4X1EA 3HM5A 1VI0A 4XICA 2O7TA 2ZCMA 1SGMA 3S15J 1YRNA 1IV6A 2DA2A 1P7IA 3DPJA 3BR0A 1VF9A 5K7HA 4QTRA 1JKOC 4XK4A 2WUIA 3FRQA 1JTXA 5EG0B 5M3FJ 5D1RA 2EZKA 1GV2A 1WPKA 4MXMA 5J3LA 2GENA 1IUFA 1POGA 2RHAA 5E3NA 2JMWA 5E3OA 2EZLA 2CQQA 5EDNA 3NARA 2D6YA 4A3LJ 3QBMA 1R9TJ 4DW6A 3JRFA 2HI3A 3B6AA 3G1LA 4GFBA 3VOKA 2LP0A 2ZB9A 5EF6A 2UXOA 5F0CA 3BTLA 2X9DA 5JLXA 5C3EJ 4W97A 1H8AC 3S2HJ 3GTGJ 3ON2A 3BT9A 2FD5A 3LSJA 2QF7A 3H3VK 2CUEA 1MBFA 3I4MJ 5FMPA 3Q0VA 1BW6A 3BR5A 3JRCA 1JTYA 1BL0A 3PO3J 1S7EA 1OFCX 2L7MP 5DTDA 2EQRA 2XGDA 4B4CA 2H8RA 5IYDJ 1F43A 4DYRA 2O9LA 1XS9A 2X48A 5C4XJ 5IP9J 1H88C 4MFDA 1MBEA 2NX4A 2LD5A 4W1UA 2DG8A 3LSPA 2ECCA 2Y31A 4BXXJ 3GTOJ 2M34A 4QSHA 5IOYA 1AKHA 1AKHB 2IAIA 2OERA 1Z0XA 3HTJA 5F27A 1JUMA 2YVHA 2VUMJ 5C4JJ 2KT0A 4A3IJ 5GPCA 3BR3A 4A3DJ 1JT6A 2EZIA 1JKQC 3C2BA 1DU6A 1GUUA 3ZQHA 3HOZJ 1Q1VA 3VIBA 2UXPA 2PMZN 3IH3A 4DYQA 2PBXA 3OOUA 3ANPA 5D19A 2EBIA 2DMPA 2K40A 1T56A 1A6IA 2MGQA 2XDNA 5J1YA 3K2AA 2DN0A 5M3MJ 1MH3A 3S1MJ 3BRUA 3T6NA 4A3JJ 2VPRA 3ZQGA 5FJ8J 2N8GA 2M2EA 4BKXA 1WH5A 2HDDA 1IDZA 3JRBA 4C2MJ 2B63J 3A01A 3BR6A 1RR7A 2GLOA 2E1OA 3BTCA 2QWTA 2OPTA 1ZR4A 4AC0A 2QCOA 5EYRA 2IU5A 2DJNA 2LVSA 2XGCA 1QRYA 2AHQA 4FE4A 3SJMA 5DS9A 2WAQN 3A01B 1IJWC 3CRJA 3BQZA 2ECBA 1U9OA 4GCLA 4BBSJ 2JA8J 3I4NJ 1HOMA 3RZOJ 4RDUA 4ABZA 3O60A 4MFEA 3RKQA 2DG7A 3K7AJ 5F1JA 2FJ1A 5HAWA 1UMQA 4KWAA 5E3MA 5C44J 1BA5A 2HKUA 3BTJA 4JX6A 3HOWJ 1HCRA 2QIBA 1WGXA 2DA4A 3S1NJ 1QVUA 4MLOA 1JUSA 3O8HA 3CMYA 2HOAA 3ZQLA 1HDDC 2FQ4A 2HOSA 4XRMA 5M5XJ 4JP0A 4J19A 5JLWA 4Y52J 3KKDA 5E3LA 3QPSA 3M3YJ 4M3GA 4C3IJ 3G7RA 2E19A 2WGBA 1ETYA 4C3HJ 5EEAA 5F04A 1AU7A 1FTZA 1P7JA 4IHYA 3HEFA 1FIAA 4L5EA 3HIMA 3GTLJ 1K61A 1APLC 3LWJA 3ON4A 2LR8A 2XPWA 1LFUP 2MSYA 1B72A 4B1RA 1ZK8A 5EGOB 3LOCA 2NVTJ 2GBYA 3FISA 2QKOA 2QTQA 1F36A 3C07A 1FJLA 1LE8A 3NI7A 2R5YA 2HOTA 3HTIA 3NXCA 2DMUA 3D1NI 2MW8A 3RD3A 3BR2A 3Q3SA 4UUTA 3L1PA 2HXIA 1QPIA 4ICHA 4XRSG 2JK3A 3H0GJ 1XC5A 5J1UA 1NK2P 2ZCNA 5HBUA 5HSZA 5J1RA 4XIDA 1GV5A 2RAEA 3SDGA 2Q24A 4XRSA 3EGQA 5FLVA 3F0CA 2EZHA 5GPAA 2DA5A 1ZKGA 4M3DA 3FK6A 4A3CJ 4IHVA 9ANTA 4ME9A 1MSEC 4A93J 2K9NA 2X6OA 3PASA 3PPBA 1MBGA 4D5CA 1RKTA 2I10A 2WB1N 2OI8A 3VPRA 2XB0X 3GTKJ 2L7FP 4FE7A 4LOCA 5FGLA 5IPAA 3UKGA 3RQIA 3JRIA 1JUPA 4FCYA 4MO7A 3GTJJ 1MBHA 3RZDJ 3BQYA 4CGRA 1JKRC 2DMTA 3HGYA 1OJLA 1CQTA 1MSFC 2Y9ZA 4A3GJ 2LFBA 5GP9A 5FKOA 5FHPA 3CWRA 3LJLA 3TEDA 1U8BA 1MNMC 2CUFA 1WCMJ 1GT0C 2W53A 5EGOA 3HOUJ 4AUXA 1HLVA 2XPVA 3QKXA 3VUQA 3FIWA 3NPIA 2YUSA 3WHBA 3GTMJ 5EFYA 3PO2J 1W0UA 4JL3A 2LK2A 2H1KA 2W48A 5EG0A 3OSGA 4M3EA 4IHXA 3S16J 3EUPA 4DZPA 3CDLA 2VKEA 2Y30A 3TP0A 1RETA 1ETVA 2K9QA 1ETOA 2HYJA 3TW6A 2L7ZA 2E2JJ 4X6AJ 1WI3A 3FKIJ 5IOZA 3IV5A 3LHQA 1MBKA 3HTAA 3BG3A 3ZQIA 5D18A 3CQZJ 1B8IA 2ZCXA 3Q0WA 1U9NA 1IG7A 1UHSA 4C3JJ 1T33A 1GVDA 3JSJA 4PXIA 1ZQ3P 2Y9YA 4QIWN 2D5VA 2FBQA 4D5FA 1EF4A 3VVYA 3JRGA 3S5RA 2LKXA 2VKVA 2VI6A 4CYCB 1W0TA 3AQSA 3GEUA 3KNWA 2DMQA 2KDZA 3BTIA 3S14J 3IUVA 3HKZN 1YRNB 4M3FA 2ELKA 2O7OA 5C4YA 3WHCA 3VVZA 3ZQCA 5CXGA 3GTQJ 4G12A 3SFIA 1OCTC 3W6VA 4JKZA 3ZOBA 1JT0A 1WH7A 3HOXJ 2REKA 3BNIA 1NTCA 4BY1J 3NAUA 4A3KJ 3S1RJ 1ETQA 1DU0A 3VVXA 2EH3A 2G7SA 3ZQFA 2ID6A 3GZIA 4UUSA 1XG1A 2COBA 2XPUA 3M4OJ 4JYKA 2DA3A 4GFKA 3IH2A 2IEKA 2YU9J 3DCFA 1I50J 5M5WJ 3BCGA 3HBLA 3HGGA 2O8KA 2G7GA 3LNQA 4NDLA 2LLKA 4JX4A 4A3MJ 3VW1A 1BW5A 4UUSB 1UI6A 4BBRJ 3GTPJ 2RASA 1X58A 1ZTRA 3CCYA 2R92J 4HNVA 2F07A 1ORKA 2DA1A 2XRLA 2Y2ZA 2AO9A 5F0HA 2NOGA 2HYTA 4AF5A 3MVPA 1RPWA 3Q0UA 1ZGWA 4NELA 5FKKA 3HE0A 4UDSA 4CYCA 1JJ6C 3DEWA 1TWAJ 2DA6A 1JGGA 1TWHJ 1UG2A 2XB5A 1Y1WJ 4EEFG 3VW0A 3TW7A 4DYCA 1JJ8C 2DMNA 1ETKA 1TC3C 2DA7A 1FIPA 3JRDA 4BY7J 2NVQJ 3QQAA 2TCTA 4D7NA 3COLA 2LY9A 2JA6J 4MIMA 4MK6A 2DTZA 2YVEA 3G1OA 1ENHA 5CXIA 3VOXA 3OIOA 1PUFA 3KZ9A 4JNNA 1TWCJ 1RESA 2NVYJ 1E3OC 1D5YA 3KKCA 1MH4A 4A69C 1AHDP 4A3FJ 2WV1A 3E7LA 1ETXA 2R5YB 1ZR2A 5DAJA 4AYBN 1LFBA 5K7ZA 1O4XA 4IEJA 3AQTA 5FKLA 1G2HA 1IRZA 2IBDA 1VNDA 2V57A 4DZJA 1A5JA 2CJJA 5H9TA 2NP3A 3V78A 2UXIA 5IYBJ 2M0CA 3G1MA 3G56A 3JRHA 3JRAA 3PM1A 2Y0SN 1ETWA 1JKPC 4I6ZA 2P81A 5F0FA 5BNGA 4A3BJ 2L9RA 5K7FA 4M3BA 5CW8A 2G7LA
chains in the Genus database with same CATH superfamily
5GTIC 4D7MA 4CCMA 4CA0A 3RI4A 2PMHA 2CW8A 5HODA 1GDTA 1FWZA 3P9CA 4UVCA 4B48A 2CU7A 3A1YA 5JR3A 5K5RA 2R0QC 3LMMA 3QPHA 1F9NA 4WWCA 4IHTA 1BI0A 3FXKA 1FBSA 1SMTA 3GFMA 2JA5J 2OTJI 5FLMJ 3BG5A 2JTVA 4V2FA 2R7ZJ 3I53A 2O8XA 5L3EA 3J81Z 1PUFB 1IV8A 3E0JB 3JREA 2ICWG 5K58A 3QP5A 3MNLA 2EV0A 3M9AA 2XASA 1Z67A 3V7CA 3KIOA 3WE2A 4YZEA 5KVRA 1IDYA 2ME6A 1FEXA 1TQPA 3GYHX 1I39A 3OYHA 1X1CA 2F48A 3QP6A 5E1XA 3WE3A 3ERED 4IRHA 2RDPA 3BWGA 2QSFX 4BYYA 3LSRA 2MC3A 3ZMTA 2P0WA 3S17J 2Z5UA 3D5RC 2DBBA 2CFOA 4O5VA 1B1BA 3RYPA 2PZ9A 2D1VA 2NP5A 1LE8B 2R7XA 1UCRA 2CFXA 5FKMA 1BJZA 1S72I 1I6HJ 1VFCA 3B6CA 3TP3A 4X0GA 2KRHA 4LLNA 2ZJ2A 5F6FA 2P5VA 4RBOA 3S1QJ 1LNWA 4MNUA 3CMAI 2Z9OA 4XSXF 3VYUB 2UXUA 3E7QA 5AQCA 4GCTA 4N4NB 4KMFA 2JWTA 3EPZA 3NWSA 4GFLA 4MEXF 2ZJPF 5HLGA 1LDKB 4PFPA 3VW2A 1IXCA 2NS8A 4HAMA 2OC6A 4V2GA 3FXUA 5M5YJ 1WFXA 4F55A 2HTJA 5FGMA 1TWGJ 4R8HA 3PIPF 1ITYA 3HTHA 3U2RA 5HS8A 3GBGA 1YJWI 4OIQF 1RR8C 5A2QZ 4CO8A 2ME0A 4HX4A 4ASNA 4UV8A 4EVIA 1R4NB 2M7AA 3RPUD 1T8IA 1IV6A 2DA2A 5K7HA 2MLGA 3ABMH 2VC1A 5DCMA 1HW2A 3FRQA 1JTXA 3I56I 4OD5A 2WY8Q 4XKCA 2TDXA 3FX3A 5M3FJ 5D1RA 1J09A 2EZKA 1WPKA 4MTEA 3OYDA 2R7TA 5J3LA 1QZEA 1EH8A 3C3WA 4L9JA 2JMWA 5E3NA 1O3RA 4CH7A 2CQQA 3NARA 4FETA 3JRFA 3QYBA 4ZH4F 3G1LA 3L2RA 1UHWA 1TT0A 3VOKA 1VQ9I 2LKSA 3DF8A 3SZTA 3GTGJ 2OUMA 3H9QA 4Q5SF 3F8MA 3KZZA 2CUEA 2IS1A 1P6RA 4LK0F 2CG4A 2EFNA 2PQ8A 1HA8A 1WJCA 3PO3J 1XN7A 3J80K 2W85A 2L7MP 1P9QC 1YYVA 5IYDJ 3ZGKA 4HZFA 5AIPA 2A5WA 3CJNA 1U5TB 2EV6A 1CGPA 2DG8A 1K4SA 4UUVA 2Y31A 3TO7A 2E5NA 3OYNA 1IN7A 3I71A 2IAIA 2KIQA 3ONQA 1K6YA 2W82A 2XF7A 1YFHA 1HXDA 2LH9A 4BQQA 4HNTA 2ELHA 3BR3A 2QBYB 2EZIA 5HVQC 1DU6A 1HBXG 5D19A 2EBIA 2DMPA 2F6CA 5E17F 3G3ZA 1WI9A 5HNFA 1SD6A 2DN0A 4YFXF 5M3MJ 3P9IA 3ZQGA 1IUYA 2LRDA 3RYRA 1Y8QB 3M1EA 2HDDA 4UXNA 4B43A 5IT3A 3BR6A 3A01A 4ESBA 2STTA 3BTCA 3GZ6A 4IF4A 4R1HA 1LEAA 4XQFA 1PVEA 4AC0A 4G8XA 4FT8A 5EYRA 3OYAA 4I09A 3LQQA 4GRIA 5J47A 5LRSA 2VBYA 3S2WA 4F52A 2K27A 4P96A 2PJRA 4BBSJ 4OAZA 3I4NJ 3GLLA 1R7JA 1HOMA 1N77A 5DEQA 1D5VA 1WHUA 2BY0A 3RPQA 5LGNA 2DG7A 3VB2A 2VXDA 1UMQA 2COMA 4J00A 5DD8A 1BA5A 2HKUA 3FXRA 4HOBA 1Z3XA 2EA2A 3RKWA 1WGXA 2VIXA 2DA4A 3G71I 2FSWA 1QVUA 2WBMA 4S05A 3R61A 1S7AA 5CQGA 3G4SI 4ESJA 1SD5A 2HOAA 3CMYA 4HX7A 4IJAA 2HOSA 2WAFA 3KKDA 1LQ1A 2X0LA 4ZYAA 3M3YJ 4M3GA 1LVKA 3CESA 4G6DA 3E1SA 2ZSHB 4C3HJ 3K4BA 3ZXSA 2DLLA 5GAHJ 5EEAA 1AU7A 1XGMA 1SFUA 4ZYEA 3FXOA 2RNGA 5LFAA 1Y0UA 3TO6A 2V1UA 2XPWA 1JHFA 1ZK8A 4XOTA 3TQNA 3DTKA 1S5LC 3RKYA 3NEUA 4PSXA 3C07A 2IPQX 3BROA 1LE8A 3NI7A 2R5YA 3C18A 3ZCOA 5HOOA 2MW8A 3FM3A 4LG3A 3D1NI 3TKYA 2IS2A 3GUDA 2HFHA 2GA1A 5D5XB 3D5SC 3W3CA 4XRSG 3H0GJ 2WTEA 5J1UA 2V79A 4AU7A 1GV5A 1T0FA 2Q24A 3EDPA 3GZ5A 4ME9A 3HC7A 1MSEC 2K9NA 2X6OA 4GDFA 4HF2A 2I10A 2WB1N 1NH3A 1MJAA 2BZTA 1LPQA 2L7FP 4FE7A 4KT5C 3IAS2 5GTHC 1PUEE 1ERDA 3SHFA 5JVTA 4MO7A 3GTJJ 4K2EA 1TP4A 1XDUA 4CICA 3PJRA 2XIGA 3TDZC 1CQTA 2Y9ZA 3B02A 2L01A 1Z6RA 2ESHA 5GP9A 1U3EM 4A5NA 4CGZA 3QODA 5FKOA 1X3UA 5K1YA 5FHPA 4M72A 2VJ4A 4QPQA 3HPHA 4RLQA 4MQVA 2EB7A 3CO6C 5FO5A 3HOUJ 5DV5A 4AUXA 1HLVA 3AG1H 3F3XA 4UNOA 2A5YB 4ZZDA 3WHBA 1I1GA 4UVBA 5LEKA 3PO2J 3SEQA 4XBFA 4JL3A 2V9KA 1SFXA 5EG0A 3VSLA 4DVYP 4M3EA 2MLKA 3S16J 3KCCA 3ABKH 1R00A 1WQ2A 2VKEA 2Y30A 1LDJA 2K9QA 2E1MB 1ETOA 3K4JA 2ZY9A 2L7ZA 2KP6A 3BOQA 3NQOA 4XM3A 3VODA 1XX5A 1MBKA 3HTAA 2VT3A 4L9NA 1U9NA 1T33A 1XDSA 3T5XA 4ZYDA 3PFYA 5LHHA 2Y9YA 4QIWN 2FBQA 1T2KA 3ZQQA 2BW3B 2M1BA 4XKWA 3OY9A 3L9FA 2VKVA 2VI6A 3KNWA 3GEUA 3AQSA 3PL8A 4BL0B 1VQPI 3JSPA 4M3FA 5C4YA 3DPLC 2HGCA 4BNCA 1ZG3A 3ZQCA 1W5SA 4G12A 1BR1A 2HQAA 2RVCA 4P9UA 1H9TA 3RKXA 1JT0A 5CJ9A 2BVLA 3J81K 1WH7A 1MDMA 1WZ2A 3HOXJ 2BHZA 5LRRA 2R7SA 4M73A 4XONA 4AD9A 3NAUA 3KZYA 4GYIA 2NNYA 1S6LA 3S1RJ 1HKSA 3VVXA 1B9NA 2F4MB 3M8JA 5ED4A 2ID6A 3RQ4A 3E97A 3ML6A 4NB5A 3HHHA 1IF1A 3D5LA 2ZMEC 5TRDA 5KNLA 1TL8A 5M5WJ 3HGGA 1G3YA 1YS7A 2G7GA 3LNQA 4NDLA 1QZYA 3OL3A 2HDWA 2KIUA 4IQJA 1MMSA 2DFIA 5AONA 3FM5A 4Q48A 1U5TA 3GTPJ 2YSRA 2GAUA 1ZTRA 5L3DA 2F07A 4M74A 1UG0A 4Y17A 2R7FA 4G7OF 1V4RA 5F0HA 3CCSI 1IW7F 2Z3YA 4C2UA 2H8WA 1RPWA 2QQ8A 3OYEA 2W84A 3QPTA 1P4WA 3I59A 1TWAJ 3TOBA 4DIQA 2DFFA 1HC8A 3DTEA 4XLCA 2DAOA 3CF2A 4NHJA 4DYCA 1JJ8C 1W7PD 4KJZA 4D1QA 1D0XA 2WA0A 1FIPA 4WXCA 1WJEA 3JRDA 4BY7J 3U1KA 2QKMB 3H9GA 4D7NA 1UHMA 4BHPA 2VN2A 3HIFA 3WGHA 1J7KA 2GIZA 1X3ZB 4MK6A 1NHAA 3CDIA 2KFDA 3W6JB 2OU2A 2HWVA 2VC0A 4C30A 1RESA 1YHQI 2JRTA 2ZMEB 3DKYA 3F23A 5L3GA 2EPFA 3DBHB 2RREA 2KIFA 3KLNA 3K4CA 3KKCA 2FOWA 3F8NA 4A3FJ 3E7LA 3KEYA 3TL4X 3CD6I 1ETXA 3ELKA 3KP7A 2QWWA 4E7SA 2XF5A 4B3XA 4AYBN 1QBJA 1LFBA 2A68F 3AQTA 2IBDA 4IXAA 1USSA 1A5JA 4RA2A 4BAYA 3MAJA 4MHGA 4ZYHA 5J4VA 3FBNB 2IJLA 4CCJA 3ECHA 3JAMZ 5A2QK 3E3VA 2P81A 4I98B 2LNBA 4HQMA 2W57A 4F93B 3TOAA 5CW8A 2G7LA 1K7AA 1REPC 3I64A 1Z3YA 1VTNC 2BGCA 3LQRA 2ZXWH 1U78A 2EFQA 3PSIA 3S2DJ 3DPTA 3J7YJ 5EZHA 2R93J 2TRTA 5EZGA 2CUJA 2R3SA 4BEHA 3X2QH 5ERIA 2Z1DA 1S3JA 1SANA 3EYIA 2VONA 1WJAA 3FMRA 3MKLA 2JSCA 2NVXJ 4IPAA 2MC4A 3VSKA 1MZBA 1BOAA 3BR1A 1BM9A 2DYRH 1LDDA 2HZTA 2E2HJ 4JX5A 5HS7A 3VYRB 1LB2A 4A3EJ 2DT5A 2CUZA 1O57A 2M8GX 1B72B 3H0DA 2E7XA 2OZUA 1O7LA 3VWBA 3SWHA 1WSUA 3L2CA 2UWMA 3JR9A 2E71A 1WKMA 1V3FA 3ANPA 2ZNYA 2L0KA 3KYCB 4LITA 4GCKA 2ID3A 1SD4A 1OYIA 2O6GE 5F08A 4AC6A 2YS9A 5IYCJ 2EV5A 2K9LA 4ITVA 5F64A 4L5IA 4MQ9F 1RKWA 2CQXA 4PGHA 1IXSB 4G6QA 4OMYA 1MMGA 5FKNA 4HKUA 1ZLKA 3CMEI 2NS7A 4ZYGA 1A36A 2MA3A 2ZJQF 2JJ7A 2FX0A 5BMZA 2M5WA 4GXOA 1J9IA 3RH2A 3HRSA 2WB1A 3O6BB 3OL4A 3OYFA 4G6TB 3BHQA 5D4RA 3IL2A 2HZDA 2GUHA 3EUHA 1G3TA 3WTYC 3SXYA 4NUBA 5HDNA 1J5YA 3JTHA 4IZZA 4FTHA 3D0SA 2IS4A 3WU2C 1V55H 2PJRB 4KA4A 1Z21A 2DFHA 1Y0NA 1FSHA 3OMYA 1N25A 2K9SA 3MN2A 3HDDA 4NN1A 1X1AA 1YE9A 2AQEA 3M1CA 4JK1X 4B09A 2DT7B 3EQLF 3ANGA 2UXXA 1Z77A 2HVRA 1UI5A 1QVTA 2KL4A 2RN7A 3VOEA 1HF0A 1PP7U 1RRJA 3R0JA 1YIOA 1VI0A 2O7TA 2IGOA 4F91B 2GIVA 2E60A 3V8LA 1YRNA 4BXFA 4HF1A 3BR0A 4M9SA 2WUIA 3CLOA 3BCBA 4J01A 1LJ9A 5EG0B 2K3FA 1DQUA 4E7HA 1GV2A 3OS0A 2DDBA 4LLGF 4MXMA 2BXZA 5HLIA 2QLZA 1R4MB 4BJ5C 1POGA 3J7ZI 3WTVC 2VBWA 2P8TA 2VL8A 5EDNA 5CYVA 2D6YA 4A3LJ 4QPOA 3ZMZA 1R9TJ 2PX9A 4UHTA 3PQKA 3ISPA 1QNTA 2CYYA 4A0YA 3OR1C 5E18F 1R71A 1J75A 4XSZF 2OQGA 2DYSH 5F0CA 3T0YA 2OCEA 2X9DA 3BTLA 3S2HJ 5J8FA 3K1PA 1XCVA 3LSJA 1KQ9A 3KP6A 4R79A 2K3PA 5FD6A 3WTWC 2LOOA 1B6AA 5KAIC 2OCCH 1VQLI 5H6QA 1BW6A 4C2MA 1FBUA 1SEUA 3O2PE 3JRCA 1JTYA 1OMIA 3OYGA 4N4OB 3FF5A 1OFCX 2XGDA 1F1ZA 2H8RA 3F8FA 1F43A 4DYRA 5BPDA 1T6SA 1XS9A 2A2FX 4RAGA 5HNHA 2NX4A 1F4KA 2D2WA 2VJJA 4BXXJ 5IOYA 4QSHA 4ESFA 4E7LA 2R7OA 2OERA 1IRGA 4WXHA 5F27A 1BIBA 2BY3A 1JUMA 2YVHA 1FMVA 3IHUA 5GPCA 3RPUA 1R5HA 1R1TA 5D5VB 1JKQC 3CUQB 3VIBA 2UXPA 1WJ5A 3IH3A 3CZ6A 1FNNA 2MGQA 3GWZA 5J1YA 3I58A 4KIGA 3GO5A 2R7QA 3K6GA 3K2ZA 1MH3A 1XMKA 3S1MJ 3T6NA 4CZCA 2XV4S 3H1CA 1QHHD 5FJ8J 2N8GA 2M2EA 2VJIA 2BXYA 1WH5A 2HKXA 3TDUC 1IDZA 3CP8A 4IX7A 2CV0A 4C2MJ 1TW2A 2KMUA 2QWTA 2J5PA 1R36A 2OPTA 5CVJA 3P7NA 2XGCA 2FNAA 4WIBA 4ENMA 4ANJA 1LKXA 4PSWA 3SJMA 2QSGX 2K85A 2ECBA 1U9OA 4GCLA 1BI2A 2Z33A 1FLIA 3CC7I 3MKWB 1KA8A 2P5KA 4RDUA 3HOTA 2VQLA 1O3TA 1C0WA 1GXQA 4MFEA 4Y15A 5LGUA 3AG4H 2XRNA 2V1XA 4KWAA 2W25A 1WVRA 3BTJA 2A6HF 2QIBA 1HCRA 3UNGC 4E7KA 1JUSA 3HG9A 3ZQLA 2GOXB 4TV7A 1HDDC 4XKVA 2FQ4A 3OYMA 1TBXA 4JP0A 4AYBA 2A6TA 3KP2A 3L00A 2LY1A 5E3LA 4I0BA 2YPRA 4U9NA 4PCQA 2WGBA 1ETYA 4PJLA 1IN5A 4N9HA 3CCMI 2OD5A 4EJWA 1OQYA 1P7JA 2XAHA 3HEFA 3IWZA 2DQRA 3GFIA 1K61A 5BS6A 1APLC 2GA2A 2HVQA 3EETA 2NVTJ 4PZJA 2QKOA 1XPXA 3NWTA 1USTA 1FJLA 5DUIA 1OCOH 3IKTA 3HTIA 4OIPF 2EK5A 2Q8KA 1HQCA 5CQEA 4A12A 1BC7C 1VQKI 4UUTA 3AFHA 3Q9SA 1QPIA 5L3FA 2JK3A 3T8RA 2ZCNA 1FC3A 5HBUA 2MH2A 2R7WA 3UR3C 3CF5F 3K10A 5JHUA 5GPAA 2DA5A 3FK6A 9ANTA 3HYIA 1MNEA 3PPBA 1V5EA 1P4XA 1UAAA 1RKTA 1TLHB 1FYKA 2KISA 1JI8A 3C1DA 4XMYA 1ZH5A 2QQBA 5FGLA 2V7FA 3JRIA 4FCYA 1VQ4I 2XF6A 3QOEA 3RZDJ 4FX0A 4M9XA 3QOPA 3K8PC 4CGRA 2Z99A 1JKRC 2DMTA 3HGYA 4RMNA 4A3GJ 2IGNA 3HL2A 4C2TA 2M7BA 4LJZF 2VOPA 3H5RA 4ON0A 5HLHA 1OLTA 2VE9A 2VE8A 2K4BA 3PNTA 1X3WB 1U8BA 3WGGA 2W53A 1Z6TA 5EGOA 1X4PA 2X4HA 3M7GA 2Y69H 3MKZA 2UZKA 3QKXA 3VUQA 2LSOA 1D8KA 4GGGA 3KLOA 3HSRA 3GTMJ 2IS6A 2FXAA 3FXLA 3DV8A 1W0UA 1D0YA 2H1KA 2W48A 2VBZA 4KT6A 4YEJA 4DZPA 5L3CA 3CDLA 2Z2SB 3MZHA 3TP0A 3DPUA 3TW6A 5D8KB 2VQCA 4WXDA 3F6VA 2HTSA 4RB1A 2JRMA 2QSHX 3HPGA 2ZKZA 2DFEA 3Q0WA 4FX4A 4C3JJ 2P7CB 2WC2A 4BQNA 2VPLA 4PXIA 1ZYRF 3GFJA 3I4PA 3KFWX 2LG4A 3JRGA 3S5RA 2VBXA 2LKXA 1BN5A 2K9MA 2DMQA 4DOZA 4EQQA 1S8NA 1YRNB 5KK1A 2O7OA 3WHCA 3VVZA 2LBFA 2DJIA 4XL9A 2BV6A 1E3HA 1D1CA 4PUSA 1K78B 5EEGA 3RSNA 3BNIA 1N75A 1IAWA 2STWA 3CP2A 1DU0A 1AOYA 1MKMA 5K5OA 4IHSA 2COBA 2E1MC 3M4OJ 3GEZA 4JYKA 4GFKA 4ZDOA 5L3BA 2IEKA 2O03A 2EWNA 4ZTJA 2CWEA 4IVNA 2E7WA 1FYLA 4XRFA 5IT9Z 4JQFA 2DQLA 2LLKA 3FZVA 1L0OC 3VW1A 4ENKA 2PFBA 3Q5FA 2DI3A 4UUSB 1UI6A 2B1EA 1K78A 2RASA 3CCYA 5ICGA 4U87A 4HNVA 4YRVA 5CKTA 1XGNA 2AO9A 2F5DA 2NOGA 1DPUA 4XLNF 2HYTA 4HLXA 4PK4A 3FWEA 3MVPA 3BG6A 4NELA 5FKKA 2Q0OA 3HE0A 1I27A 2MFZA 2X51A 4QLCU 3CMMA 1JJ6C 4OIOF 2MH9A 1TWHJ 2XB5A 1B9MA 1MD0A 1OR7A 2RKHA 3E6BA 3TW7A 4BDYA 1YJNI 1BR4A 1LUJB 1ETKA 2M4KA 3I55I 4HW0A 1STZA 3AL0B 2WAQA 2XDVA 2IA1A 2EILH 5EEHA 3A0HC 3HRMA 4A6DA 2CV1A 4LGWA 3QQAA 1X4OA 2V9VA 2NRAC 2LY9A 2JA6J 2LF8A 3ULQB 2DTZA 2YVEA 1ENHA 1OISA 3AKZA 1TWCJ 3H5NA 1YG2A 2BY2A 2ZMEA 3V8JA 1D5YA 2PMUA 4MTDA 2OZ6A 4I01A 2WV1A 3R6SA 3DEEA 2CH0A 2L3DA 2R5YB 5LLQA 5DAJA 4YIIA 3MEXA 4OINF 1O4XA 4BH9A 2R7DA 5FKLA 3W2WA 2DCEA 2FJI1 2V57A 1FOWA 2L4MA 4XLFA 2E5ZA 3V78A 1IXRC 3G56A 3HUGA 3JRHA 3E5QA 3GX4X 2Y0SN 1KU9A 4A0ZA 4YG2F 3DU5A 3DKWA 5CPRB 4HYEA 2Y75A 2VKDA 4LK1F 1G59A 5KAFC 5H6RA 2HQ5A 4OMZA 2XGEA 2ADUA 2OF7A 2DOEA 3E6DA 1Y56A 4PJJA 4XN3A 1DDNA 1HW5A 1I3QJ 2UXHA 2NNNA 2LTPA 4M71A 3ZMSA 2HR3A 2X1DA 2CRGA 3W2VA 5IP7J 3LSGA 2ZOYA 3HOVJ 1FSEA 3BJBA 1WWXA 2HVSA 3O8GA 4BXUA 3NRGA 4HV5A 3K9TA 2R5ZB 4LB5A 2BVMA 2EA4A 1JGSA 5ILSA 5D8LB 3WTSC 2A07F 3CJQB 1J0RA 4HNUA 4EJTA 2HXOA 2QOPA 4AIKA 3HSFA 3FKJA 2W7NA 1P4AA 2BY1A 1S7OA 2OV7A 1FOKA 3L2UA 4BE0A 3HOYJ 5ICFA 3I3LA 1TNTA 3H9JA 1FTTA 3TBIA 4IHWA 1SAXA 3RTRA 5FRMA 2HYGD 4YIRX 3OR2C 3U1DA 3Q9VA 1KQ8A 1ZRCA 2KIMA 1OCPA 2G0EA 3ABTA 4B3AA 1XSXA 2ZBKA 1P92A 4C9YA 2GXAA 4G7HF 1S9HA 2R5ZA 4LG0A 3B81A 2H6BA 3S3MA 2YVXA 1IN6A 2IP2A 3BPVA 2V6EA 2B7EA 3DFGA 2ZOZA 1R1VA 4AVZA 4BU2A 1WRJA 2M4GA 1NG6A 3A02A 4DQ2A 4Y7NJ 2D45A 1K6OA 1TWFJ 2JSPA 3CJDA 4S0HB 5DD4A 1IRFA 3F21A 3IP4B 4M6VA 1G4DA 3P9TA 1IO2A 4FISA 2KDOA 2GFNA 2LYCA 1CF7A 5H2FC 4E70A 1H89C 2JA7J 2XAGA 1ON1A 1X2MA 2Q2EB 3A03A 4KIFA 4I76A 4BJ6C 5DM7F 3OSFA 1IC8A 3MFKA 1NK3P 1MDMB 2X6WA 2X1CA 5E1ZB 1UZCA 4Y33A 4U0WA 4XICA 4X1EA 3HM5A 2ZCMA 1SGMA 3WG7H 4U88A 2NAZA 3RIRA 4RS8A 3S8PA 4CUGA 3DEUA 5HS9A 4QTRA 1JKOC 4XK4A 1PDNC 1ULYA 1XMXA 5E1WA 2XAUA 3ZMDA 5D6EA 1ZAOA 3C2HA 1H0MA 3FDYA 2L9NA 3CCJI 4IRVA 2GENA 1IUFA 3I5UA 2WADA 4YFNF 3OOPA 2RHAA 2EZLA 1W36C 3SZGA 1Z9CA 2HEOA 1I5ZA 4HQEA 2H1LA 3B6AA 3JW4A 5B66C 2LP0A 1PYVA 5EF6A 2VQHA 3K4NA 4I02A 5JLXA 4Y4RA 3ON2A 1VQMI 1UELB 1W1WE 4KISA 3HXLA 4FQGA 2GOMA 5FMPA 1E2XA 4EM2A 2ISYA 1W5TA 2CGPA 4II2A 1YIJI 4E7ZA 2P6TA 5DTDA 2FRHA 2EIJH 2EQRA 2FOKA 3TGNA 4WF2A 4L0ZB 3CCLI 2O9LA 2X48A 4UV9A 4NQWA 5IP9J 1H88C 4EGZA 4W1UA 1BI1A 3KPHA 3FMSA 4U7DA 2A3SA 3CCEI 1QU3A 3I0TA 1FPQA 1BJAA 2EJRA 2M34A 2Y48A 3F72A 3DQVC 3OYCA 1RNLA 4UB8C 4AIJA 1BBYA 1AKHA 1AKHB 1I1SA 4E7JA 3WODF 2LDUA 3CUOA 4EM0B 5C4JJ 4EM1A 4IQ4A 2M3AA 2DW4A 1TZLA 1AA7A 3QRFF 2OBPA 3QYFA 4DNCA 3OYIA 3C2BA 2G7UA 2M30A 3ZQHA 3HOZJ 1SVOA 4CDGA 5ILVA 3LSHA 1GXPA 3OOUA 2PBXA 4RGSA 2K40A 4KYWA 4E7IA 3HZJA 1XSVA 1U0JA 3IRQA 1AWCA 4EATA 4OAYA 3JAMK 1SD7A 4M9ZA 2EFPA 4AVPA 4DBQA 1D1BA 2VPRA 2X6XA 4ZDLA 2EINH 4KIBA 4ETSA 2E1CA 1E0EA 3HJEA 1K4TA 1BOBA 3JRBA 5CVIA 2B63J 1RR7A 2R4GA 2E1OA 4L18B 4NBQA 1G3WA 5F1RA 4CSWA 2IRFG 2PMZA 2V1NA 2IA2A 1FT9A 3FBIB 1D8JA 2DJNA 1KU7A 2AHQA 4FE4A 4ZDPA 3J80Z 2DT6A 5DS9A 2WAQN 1U8RA 4GCVA 3A01B 4I2OA 1IJWC 1W7PA 1RI7A 3VTIA 3G2BA 4PGGA 4XKBA 2JUCA 3ASOH 4NC7A 3RZOJ 2GXGA 3DKXA 3K1MA 4YFKF 4DBRA 3HTSB 3RKQA 1U6GA 5F1JA 1DGRM 5HAWA 1TQMA 3AAFA 5E3MA 5C44J 4JX6A 2M45A 3HOWJ 2IXSA 3CUQC 2FEZA 2H09A 3CCRI 3CJTB 4GYGA 2W4SA 2PJPA 3O8HA 3RJPA 3GZNB 2WV0A 3LFKA 5M5XJ 4XRMA 2EFWA 4J19A 1VQ6I 3LL7A 5JLWA 2KRCA 3DXJF 4RAZA 4C3IJ 4IKFA 3G7RA 4ZJZA 2HYFA 2KRFA 1MMDA 3ROUA 2PLYA 5BQTA 1Q1HA 2HKOA 4YELA 1FTZA 4IHYA 3MZYA 3A0BC 4L5EA 3GTLJ 3H3UA 3R0AA 3R4KA 2FUG2 4EGYA 3HRTA 3LA7A 1DPRA 4XN0A 4U0YA 2V6CA 2MSYA 2Y0SA 5EGOB 1B72A 3BY6A 3FISA 3S3NA 4BDZA 2XHKA 3IC7A 2V26A 4F7ZA 1ZREA 4XOPA 1OCRH 3VDXA 3NXCA 1KGSA 2DMUA 2QUFA 3LSMA 3BR2A 2OA4A 2O5RA 2HXIA 3L1PA 4IRGA 2B9SA 3M8FA 4DJAA 1A31A 5HSZA 4XIDA 3CCUI 3SDGA 1HKTA 4XRSA 2PI0A 4BEHB 3EGQA 3F0CA 4M3DA 1ZKGA 3WGIA 2MBFA 2QZ8A 2ZFWA 3K1NA 2I8DA 1YOVB 2LREA 1W5CC 3PASA 5D18A 1MMAA 4D5CA 2OI8A 3BG7A 3KX2A 1QA6A 3LAPA 5IT9K 4EMSA 3F9KA 3QAHA 1NG7A 4LOCA 1Z91A 3UKGA 3HOSA 3RQIA 5DDGA 4H0EA 3DLAA 2QQ9A 3BQYA 2AS5F 3ESWB 4WCGA 2Z16A 1DUXC 3AL0C 3BLYA 3KEOA 5D4SA 4V19K 4LIVA 2PN6A 1KQ0A 3H92A 5CVRA 2ESNA 2XROA 1A04A 1R23A 2CSOA 3BZKA 3IUOA 3BZ6A 3CO7C 3CWRA 3LJLA 1HKQA 1MNMC 2KHMA 2CUFA 3F8CA 1WCMJ 1GT0C 3QU3A 4JOMA 4HA8A 2XPVA 4EJUA 3NPIA 2QQAA 1A6QA 3LFUA 5J40A 2QEXI 1Z05A 4YIFA 3AG3H 4LLLA 2KJBA 1DGWY 4XLEA 2F5VA 4AWXB 3MWMA 4N9IA 5DM6F 3EYYA 4ENJA 3OSGA 4IHXA 3EUPA 2R7UA 2JPCA 1PP8F 4L0YB 2V1DA 3O3KA 5FFZA 2VT2A 1RETA 1XGSA 3PNVA 2HYJA 2E2JJ 4X6AJ 5IOZA 3IV5A 2BHYA 2E36A 3BG3A 1OYWA 3ZQIA 2LKPA 3CQZJ 3ZN0A 3FXMA 1B59A 2JZYA 1B8IA 2ZCXA 2ZCWA 3FXJA 3T8TA 3WU1B 1IG7A 1UHSA 4G94A 3V8KA 1GVDA 3S3OA 3JSJA 1ZQ3P 4A2UA 2CQ7A 4Q4ZF 1D3YA 4D5FA 5GAGJ 2OTLI 4NNJA 3F22A 1EF4A 1YQAA 3KE2A 3WG9A 4B47A 3VVYA 2PBIA 4F3QA 1XTAA 1W0TA 5DCMB 1O7FA 3BTIA 3SQNA 5GAEJ 3S14J 2XKPA 2D1HA 3HKZN 4CHUA 2ELKA 1XD7A 3GMEA 4G7ZF 5CXGA 2OJED 1Y39A 2CQNA 3H5AA 3GXOA 1OCTC 3RDIA 4U9LA 4PJ0C 1ZG1A 4JKZA 3ZOBA 1O3SA 4MEYF 3DP7A 1Z7UA 2REKA 1NTCA 4BY1J 2FNPA 2UV1A 3ZMUA 5J6XA 2NYXA 4XNFA 4A3KJ 1RC9A 4BQAA 2BYVE 1R58A 2L9VA 1ETQA 4LMYA 3MCZA 4XORA 1YJ9I 3W2AA 4KN7X 1ZHFA 3GZIA 2ZNZA 5HDGA 4RGXA 1RUOA 2HQNA 2DO7A 2RGVA 2ZXHA 3DCFA 3HHGA 3NS4A 4GO1A 1ZELA 3CC4I 3BJOA 4A3MJ 3CCQI 1TT5B 5CVVA 4U7BA 4XR6A 2F4IA 1TW3A 3FHNA 1X58A 5FD5A 2QENA 2M0MA 3COAC 1ORKA 2A6EF 1FMWA 5HDKA 1IN8A 2Y2ZA 3MQ0A 2K86A 1KONA 2H94A 2M8EA 3I59B 5LHGA 5BOXA 1WJBA 2DDAA 1FOYA 2ISZA 4QWQA 3IKVA 1IN4A 1X19A 2L7KA 1JGGA 2ZFUA 3I9V2 1MIJA 3VW0A 1V5GA 2FQ3A 1JE8A 1GLNA 2DMNA 3GFLA 3B73A 3OV8A 2KLOA 2DA7A 2FBIA 1QO0D 4ZC3A 5LEJA 2L2OA 4I0AA 2NVQJ 2GXBA 3COLA 3OYLA 1OYYA 3CLQA 4MIMA 1OCCH 4B8XA 3G1OA 2VKHA 2HDCA 5CXIA 3VFZA 1PUFA 1ZGJA 1FP2A 4HV6A 1KZHA 3KZ9A 2CMPA 3PIOF 3E5XA 1LVAA 3DTIA 3KYLA 4KFCA 1T08B 3E5UA 2NVYJ 1MH4A 5TJJA 2JPBA 3LSKA 4A69C 4WX9A 2WAEA 1AHDP 2E1NA 2F2EA 4HLYA 3IWFA 1MNDA 4KDPA 5CLSA 2V9PA 5CVUA 3K4MA 2YX4A 2F4OB 2ZO4A 5FROA 3L09A 3S32A 1KYZA 1T98A 2EIMH 2E34A 1VNDA 2HQRA 2KZVA 4OIRF 4DZJA 3QU6A 1N78A 3CJRB 2DXIA 3BZCA 1VQNI 2RQPA 2NP3A 2UXIA 1R6RA 5IYBJ 5E79C 2M0CA 3G1MA 5HLTA 3JRAA 5D5UB 3REOA 2ZXJA 1OCZH 3SFZA 2KKOA 2DPDA 2PEXA 2RQQA 2BW3A 5F0FA 5BNGA 4A3BJ 3K0LA 5K7FA 3LA2A 1U2WA 1SFOJ 3U21A 4O6JA 2DOFA 1P2FA 1YTYA 2K7LA 2MD0A 1V5FA 4HPQA 3SEZA 3IH4A 3QWLA 3R60A 5IP6A 5LBQA 2JVGA 3JCUC 3GF2A 2XAFA 3T1BA 3VP5A 4HBLA 2UXNA 2Y0MA 2F5FA 1IRXA 1MJ9A 2BE5F 4IOAF 1YW7A 2VJ5A 2X85A 2JN6A 3C7JA 4P1WA 1X1DA 2ELJA 1T95A 5EJCA 1OPCA 3MKYB 2F5CA 1I3AA 4RB3C 3OS2A 1ZG5A 3NNRA 4AIDA 4CXFA 2VASA 2FA5A 2FBHA 3QPLA 4KMUX 1SAUA 5LD2C 4OWRB 2QBYA 2J5OA 2HOEA 1JHHA 5ILUA 5DUKA 3HB9A 2Q1ZB 1Y1VJ 3SZPA 2GM4A 5B5EC 3F1BA 1FOXA 1K83J 4ZTFA 1EH6A 3GLXA 3OWTA 2ZSIB 4O3MA 4Z2YA 4AM3A 4UY8I 3PUBA 4U0VA 4Z6YA 1MBJA 1LEBA 5D6FA 3JTGA 5FLXZ 1R49A 4BGDA 3DU6A 3HSEA 1BR2A 3BG9A 2KZGA 2W24A 4L9VA 5DYMA 1YW8A 3OIQA 3L2VA 4KITB 2M9HA 1X2NA 3F8BA 2LC2A 1IGNA 3LAJA 2GWRA 4N0BA 2OAZA 3L7WA 1Z1DA 4I7HA 4ACIA 2L02A 4G9YA 3FK7A 2L9SA 3G73A 2B3WA 2BBYA 2PG4A 5DCFA 3NRVA 4FHTA 4E4HA 2E2IJ 1ACIA 2G3BA 2A05A 2NOJB 1QHGA 3CTAA 1HDPA 3V6GA 1B8IB 2CQKA 3BP8A 2XSDC 4L62A 2MG4A 4HRIA 2FMLA 3N97A 3ZR8X 3S15J 1U5TC 1P7IA 3DPJA 1VF9A 1BIAA 1VQOI 5B1AH 1CF7B 3OS1A 3EUKL 2GQQA 2ZJRF 1EV7A 2RNJA 5ICCA 2RC4A 1ODDA 1JXSA 4KN4X 5E3OA 4ENNA 3V7SA 1QGPA 1T39A 3QBMA 4DW6A 2HI3A 3MZ8A 4CCOA 3WU0A 3GCMA 4E6KG 4GFBA 1FX7A 4BHBA 2ZB9A 2UXOA 3EUHC 4RB0A 5C3EJ 1I6XA 1YW9A 2A61A 4OOIA 4W97A 1H8AC 3CC2I 1MMNA 2BEOA 2L5QA 3BT9A 2FD5A 4II3A 2RV8A 5LGTA 1FBQA 2PFVA 2QF7A 3H3VK 2XVCA 1MBFA 1Y6IA 3I4MJ 3HKZA 3Q0VA 2O3FA 3BC8A 4BACA 1W7PB 5IY5H 3L2WA 3BR5A 4BE2A 1BL0A 1VQ7I 4CZZA 2X1EA 3ZQ7A 2JA2A 3CUQA 1S7EA 1XCBA 1YI2I 3N4MA 1J59A 4B4CA 2E35A 3E6MA 3PSFA 4Y13A 5H20A 5C4XJ 1XSDA 4MFDA 1MBEA 2WWYA 2LD5A 4OD4A 3VYSB 4BJTA 1TQIA 4M6YA 2ECCA 3VEPA 3LSPA 3K70D 3GTOJ 5JHFA 1WJFA 3N05A 3LSTA 2HPIA 1YITI 2CS3A 2FF4A 1LFPA 1Z0XA 3HTJA 2VUMJ 1ZLJA 2KT0A 2L4AA 2YU3A 4A3IJ 1R5ID 2QYOA 4A3DJ 1JT6A 1GUUA 1Q1VA 3KP4A 2PMZN 4A5MA 4DYQA 3H35A 4BHCA 5GADJ 1G3SA 5TGTA 3JSOA 3ECOA 3P9KA 1T56A 1W4MA 1A6IA 4PDKA 2DOAA 1K79A 3G6EI 2XDNA 2VQGA 3K2AA 4RGRA 4CCKA 3BRUA 2H6CA 3DBLB 3F6OA 4A3JJ 2QM3A 2IGMA 2DODA 4RAYA 4BKXA 3ZRGA 1VQ8I 5JVGF 5D5WB 2K02A 2GLOA 4KNYA 3DBRB 4NQWB 2CO5A 1ZR4A 2P5LC 2QCOA 3P5JA 2IU5A 3HRUA 2LVSA 1QRYA 5FFXA 2O0YA 4S04A 1ZGAA 2FU4A 3J7AY 2CW7A 3CRJA 1KU2A 3BQZA 1O3QA 1QZZA 1YX3A 3KZIC 4M6XA 1H9GA 2JA8J 5TISC 3I54A 2H27A 1ONVA 1MGTA 4L5JA 4RM2A 1ZRDA 1FY7A 4ABZA 3PUFA 1GVJA 3O60A 3K7AJ 2XGXA 2FJ1A 5JI6A 2HS5A 1T0FC 5E8IA 3S93A 1VZ0A 3S1NJ 3IRRA 4MLOA 5E8GA 1GHCA 3MD2A 4IOCF 2JT1A 3ERMA 4P9FA 4Y52J 2NS0A 3QPSA 4HDVA 4HSRA 1UFMA 2V4JC 2E19A 3ZPLA 1D1AA 5F04A 1RIOH 1ZARA 2IVMA 4KUMA 1RUNA 4Q47A 2QGUA 1FIAA 3HIMA 4L9TA 3LWJA 3BCAA 3ON4A 2LR8A 3PQJA 1LFUP 2AQFA 2F5EA 2NVUB 3SYTA 3ABLH 4B1RA 1E17A 3LOCA 1OR7C 2GBYA 2VB6A 1VQ5I 3ABUA 1TNSA 2QTQA 1F36A 1XGOA 1T38A 1MJBA 3ZMVA 2QVOA 3FMQA 2HOTA 2Q2EA 3GVAA 1SC7A 2C6YA 5AIQA 3FHZA 3RD3A 3Q3SA 1YLFA 2ACJA 1W36D 4ICHA 5JFRA 1M1EB 1QPMA 1XC5A 1SVLA 1YO5C 1NK2P 2BOLA 5J1RA 3U9GA 4CYDA 2RAEA 4WK8F 1KU3A 5FLVA 2EZHA 4A3CJ 2WY7Q 4IHVA 4RLFA 3A2KA 4PJNA 4A93J 3RCOA 1MBGA 2MABA 5ICEA 3C2GA 5LHIA 4FASD 3VPRA 4RB2C 4BQOA 2XB0X 4D9JA 1R22A 3GTKJ 2G7HA 2K5CA 5IPAA 4RM3A 1JUPA 1MBHA 2IA0A 4LD5A 4P5OA 1EKEA 3K69A 4NC8A 4LG0B 1OJLA 4XLAA 1MSFC 2XAJA 2LFBA 1PJRA 2P4WA 1KYWA 1YS6A 2DTRA 4PFOA 1A35A 3TEDA 3BPXA 1R5GA 3K70C 3PFIA 3OYKA 2GZWA 3ASNH 4A0XA 2CV2A 2I5UA 3V7RA 2FBKA 2MD5A 3L2QA 3FIWA 3CCVI 2LBFB 1EJ9A 4RGUA 2YUSA 5FRNA 5EFYA 3BJ6A 1G6NA 2KJCA 3PNYA 2LK2A 4HG2A 2W00A 1HSTA 2P7VB 4I99C 3H36A 2VLAA 2R7RA 2X6YA 2ETHA 4LFUA 4LB6B 1BC8C 2XUBA 3OYJA 1ETVA 2FMYA 1WI3A 3FKIJ 4NC6A 3LHQA 4EJOA 1SMYF 4CCNA 2LY2A 2IGKA 5BPIA 4EJVA 3TMOA 2W1OA 1IZ1A 2D5VA 3OIPA 1R1UA 2DK5A 3KYDB 1HSJA 1OKRA 3E6CC 1UB9A 4AIHA 2KPMA 4EV0A 2L54A 2LMDA 4HF0A 4CYCB 5KHDA 2EIKH 2KDZA 1SFEA 3IUVA 1QQIA 5J4YA 1EH7A 2EFOA 2XC7A 5FLXK 3GTQJ 5J8CA 3SFIA 2JUGA 3V42A 2KQRA 3HUGB 3W6VA 3V4GA 2IW5A 3HTUA 3FXQA 2OQRA 3WTZA 3GW2A 3KEQA 1UJ8A 3VYTB 2EH3A 2G7SA 4H4KC 3ZQFA 4Y3OA 4LIUA 3ZN1A 2QKLB 4UUSA 1XG1A 2DU9A 1SFKA 2P6SA 2XPUA 1F5TA 2DA3A 1B4AA 2UUZA 3IH2A 3KP3A 2AXLA 2YU9J 2VODA 3J7AO 1I50J 3M07A 4A6EA 4PJMA 3BCGA 3HBLA 2O8KA 3TO9A 2JQ7A 1FYMA 4JX4A 3SDBA 1J2XA 4IO9F 1BW5A 3H3ZA 1D0ZA 4BBRJ 1WJDA 3M8EA 4HSTA 3KP5A 2R92J 1DP7P 6PAXA 5B3SH 2QA4I 1TTYA 2M87A 4P55A 1EA3A 1XMAA 2DA1A 2XRLA 2DPUA 3BDDA 2K4JA 3IAM2 3KETA 5E20A 3K4LA 4BS9A 4AF5A 1ZGWA 5FB2A 3Q0UA 4BUPA 4UDSA 1MW7A 4CYCA 3DEWA 2DA6A 3OYBA 2R7VA 1UG2A 1Y1WJ 2YX7A 4EEFG 2IT0A 3QYEA 1BI3A 3WTUC 3WTXC 1YX5A 1E3PA 3K4KA 4HDUA 1TC3C 1HW1A 3A4CA 1ZRFA 2VXZA 2FE3A 2DK8A 2TCTA 4F92B 2XKOA 3LA3A 5KCMA 3LSIA 1FZPB 1FP1D 1S29A 4HX8A 3W6KB 2XSJC 3DWLE 4UVAA 3VOXA 3OIOA 1RZ4A 1Z7LA 1ZN2A 4JNNA 1SVMA 4MGRA 4RAFA 1E3OC 3CDHA 4UB6C 2AXTC 3WTTC 4CCLA 3MMYB 2A69F 3BJAA 1ZR2A 2VOOA 2XAQA 3DLLF 5K5QA 2O61A 5K7ZA 4IEJA 3LWFA 2NXNB 1G2HA 5B1BH 3ZP5A 4IRIA 1IRZA 1V54H 4ZZLA 4HEA2 2LF7A 1DP3A 4DGWB 1ON2A 1G8XA 4BE1A 4KICA 2CJJA 1Y8RB 2YR2A 2ZC2A 2CW0F 5H9TA 1L3LA 4JBAA 2G9WA 4XLHA 4D0PA 4OU0A 3AG2H 3EUAA 2HNHA 2HU9A 2HPMA 2B0LA 1X1BA 3PM1A 4XLPF 1ETWA 2JVHA 4I6ZA 1JKPC 2MYSA 1XB4A 2L9RA 4IL6C 2ZXIA 1X1PA 4M3BA 4B44A
chains in the Genus database with same CATH topology
4D7MA 1SFOJ 1U78A 3S2DJ 2HQ5A 2XGEA 5EZHA 2OF7A 5HODA 2TRTA 5EZGA 2R93J 3IH4A 1GDTA 5IP6A 1I3QJ 2CU7A 2R0QC 2UXHA 2LTPA 1SANA 3VP5A 3MKLA 2JA5J 5FLMJ 3BG5A 2NVXJ 4V2FA 2CRGA 2JN6A 5IP7J 3LSGA 2R7ZJ 2ZOYA 3HOVJ 3BR1A 3BJBA 2E2HJ 4JX5A 1PUFB 3O8GA 4A3EJ 3JREA 5K58A 3NRGA 3MNLA 2R5ZB 3NNRA 2M8GX 1B72B 3QPLA 4YZEA 1IDYA 2ME6A 3JR9A 1FEXA 2HXOA 2QOPA 3HB9A 2L0KA 3HOYJ 4GCKA 1Y1VJ 2GM4A 2ID3A 1FTTA 3F1BA 3LSRA 5F08A 4IHWA 4AC6A 2YS9A 5IYCJ 1K83J 3S17J 1RKWA 2CQXA 1OCPA 2PZ9A 2G0EA 2NP5A 5FKNA 1LE8B 4HKUA 4B3AA 5FKMA 2NS7A 1BJZA 1MBJA 2R5ZA 1I6HJ 1VFCA 2JJ7A 2FX0A 3B6CA 3TP3A 3B81A 3RH2A 4RBOA 3S1QJ 3BG9A 4GCTA 2UXUA 5AQCA 3E7QA 3BHQA 2M9HA 1X2NA 2GUHA 2ZOZA 1IGNA 3A02A 2JWTA 4Y7NJ 4GFLA 1TWFJ 3CJDA 4S0HB 3VW2A 2NS8A 4FTHA 4ACIA 4V2GA 3FK7A 4M6VA 3P9TA 5M5YJ 4FISA 2GFNA 1H89C 2JA7J 2E2IJ 2G3BA 1TWGJ 1X2MA 2K9SA 3A03A 3MN2A 4I76A 3OSFA 3HDDA 1IC8A 1ITYA 4NN1A 3HTHA 1NK3P 3ANGA 1HDPA 3GBGA 3V6GA 1Z77A 1B8IB 1UI5A 1QVTA 2XSDC 1HF0A 2ME0A 4L62A 2MG4A 4X1EA 3HM5A 1VI0A 4XICA 2O7TA 2ZCMA 1SGMA 3S15J 1YRNA 1IV6A 2DA2A 1P7IA 3DPJA 3BR0A 1VF9A 5K7HA 4QTRA 1JKOC 4XK4A 2WUIA 3FRQA 1JTXA 5EG0B 5M3FJ 5D1RA 2EZKA 1GV2A 1WPKA 4MXMA 5J3LA 2GENA 1IUFA 1POGA 2RHAA 5E3NA 2JMWA 5E3OA 2EZLA 2CQQA 5EDNA 3NARA 2D6YA 4A3LJ 3QBMA 1R9TJ 4DW6A 3JRFA 2HI3A 3B6AA 3G1LA 4GFBA 3VOKA 2LP0A 2ZB9A 5EF6A 2UXOA 5F0CA 3BTLA 2X9DA 5JLXA 5C3EJ 4W97A 1H8AC 3S2HJ 3GTGJ 3ON2A 3BT9A 2FD5A 3LSJA 2QF7A 3H3VK 2CUEA 1MBFA 3I4MJ 5FMPA 3Q0VA 1BW6A 3BR5A 3JRCA 1JTYA 1BL0A 3PO3J 1S7EA 1OFCX 2L7MP 5DTDA 2EQRA 2XGDA 4B4CA 2H8RA 5IYDJ 1F43A 4DYRA 2O9LA 1XS9A 2X48A 5C4XJ 5IP9J 1H88C 4MFDA 1MBEA 2NX4A 2LD5A 4W1UA 2DG8A 3LSPA 2ECCA 2Y31A 4BXXJ 3GTOJ 2M34A 4QSHA 5IOYA 1AKHA 1AKHB 2IAIA 2OERA 1Z0XA 3HTJA 5F27A 1JUMA 2YVHA 2VUMJ 5C4JJ 2KT0A 4A3IJ 5GPCA 3BR3A 4A3DJ 1JT6A 2EZIA 1JKQC 3C2BA 1DU6A 1GUUA 3ZQHA 3HOZJ 1Q1VA 3VIBA 2UXPA 2PMZN 3IH3A 4DYQA 2PBXA 3OOUA 3ANPA 5D19A 2EBIA 2DMPA 2K40A 1T56A 1A6IA 2MGQA 2XDNA 5J1YA 3K2AA 2DN0A 5M3MJ 1MH3A 3S1MJ 3BRUA 3T6NA 4A3JJ 2VPRA 3ZQGA 5FJ8J 2N8GA 2M2EA 4BKXA 1WH5A 2HDDA 1IDZA 3JRBA 4C2MJ 2B63J 3A01A 3BR6A 1RR7A 2GLOA 2E1OA 3BTCA 2QWTA 2OPTA 1ZR4A 4AC0A 2QCOA 5EYRA 2IU5A 2DJNA 2LVSA 2XGCA 1QRYA 2AHQA 4FE4A 3SJMA 5DS9A 2WAQN 3A01B 1IJWC 3CRJA 3BQZA 2ECBA 1U9OA 4GCLA 4BBSJ 2JA8J 3I4NJ 1HOMA 3RZOJ 4RDUA 4ABZA 3O60A 4MFEA 3RKQA 2DG7A 3K7AJ 5F1JA 2FJ1A 5HAWA 1UMQA 4KWAA 5E3MA 5C44J 1BA5A 2HKUA 3BTJA 4JX6A 3HOWJ 1HCRA 2QIBA 1WGXA 2DA4A 3S1NJ 1QVUA 4MLOA 1JUSA 3O8HA 3CMYA 2HOAA 3ZQLA 1HDDC 2FQ4A 2HOSA 4XRMA 5M5XJ 4JP0A 4J19A 5JLWA 4Y52J 3KKDA 5E3LA 3QPSA 3M3YJ 4M3GA 4C3IJ 3G7RA 2E19A 2WGBA 1ETYA 4C3HJ 5EEAA 5F04A 1AU7A 1FTZA 1P7JA 4IHYA 3HEFA 1FIAA 4L5EA 3HIMA 3GTLJ 1K61A 1APLC 3LWJA 3ON4A 2LR8A 2XPWA 1LFUP 2MSYA 1B72A 4B1RA 1ZK8A 5EGOB 3LOCA 2NVTJ 2GBYA 3FISA 2QKOA 2QTQA 1F36A 3C07A 1FJLA 1LE8A 3NI7A 2R5YA 2HOTA 3HTIA 3NXCA 2DMUA 3D1NI 2MW8A 3RD3A 3BR2A 3Q3SA 4UUTA 3L1PA 2HXIA 1QPIA 4ICHA 4XRSG 2JK3A 3H0GJ 1XC5A 5J1UA 1NK2P 2ZCNA 5HBUA 5HSZA 5J1RA 4XIDA 1GV5A 2RAEA 3SDGA 2Q24A 4XRSA 3EGQA 5FLVA 3F0CA 2EZHA 5GPAA 2DA5A 1ZKGA 4M3DA 3FK6A 4A3CJ 4IHVA 9ANTA 4ME9A 1MSEC 4A93J 2K9NA 2X6OA 3PASA 3PPBA 1MBGA 4D5CA 1RKTA 2I10A 2WB1N 2OI8A 3VPRA 2XB0X 3GTKJ 2L7FP 4FE7A 4LOCA 5FGLA 5IPAA 3UKGA 3RQIA 3JRIA 1JUPA 4FCYA 4MO7A 3GTJJ 1MBHA 3RZDJ 3BQYA 4CGRA 1JKRC 2DMTA 3HGYA 1OJLA 1CQTA 1MSFC 2Y9ZA 4A3GJ 2LFBA 5GP9A 5FKOA 5FHPA 3CWRA 3LJLA 3TEDA 1U8BA 1MNMC 2CUFA 1WCMJ 1GT0C 2W53A 5EGOA 3HOUJ 4AUXA 1HLVA 2XPVA 3QKXA 3VUQA 3FIWA 3NPIA 2YUSA 3WHBA 3GTMJ 5EFYA 3PO2J 1W0UA 4JL3A 2LK2A 2H1KA 2W48A 5EG0A 3OSGA 4M3EA 4IHXA 3S16J 3EUPA 4DZPA 3CDLA 2VKEA 2Y30A 3TP0A 1RETA 1ETVA 2K9QA 1ETOA 2HYJA 3TW6A 2L7ZA 2E2JJ 4X6AJ 1WI3A 3FKIJ 5IOZA 3IV5A 3LHQA 1MBKA 3HTAA 3BG3A 3ZQIA 5D18A 3CQZJ 1B8IA 2ZCXA 3Q0WA 1U9NA 1IG7A 1UHSA 4C3JJ 1T33A 1GVDA 3JSJA 4PXIA 1ZQ3P 2Y9YA 4QIWN 2D5VA 2FBQA 4D5FA 1EF4A 3VVYA 3JRGA 3S5RA 2LKXA 2VKVA 2VI6A 4CYCB 1W0TA 3AQSA 3GEUA 3KNWA 2DMQA 2KDZA 3BTIA 3S14J 3IUVA 3HKZN 1YRNB 4M3FA 2ELKA 2O7OA 5C4YA 3WHCA 3VVZA 3ZQCA 5CXGA 3GTQJ 4G12A 3SFIA 1OCTC 3W6VA 4JKZA 3ZOBA 1JT0A 1WH7A 3HOXJ 2REKA 3BNIA 1NTCA 4BY1J 3NAUA 4A3KJ 3S1RJ 1ETQA 1DU0A 3VVXA 2EH3A 2G7SA 3ZQFA 2ID6A 3GZIA 4UUSA 1XG1A 2COBA 2XPUA 3M4OJ 4JYKA 2DA3A 4GFKA 3IH2A 2IEKA 2YU9J 3DCFA 1I50J 5M5WJ 3BCGA 3HBLA 3HGGA 2O8KA 2G7GA 3LNQA 4NDLA 2LLKA 4JX4A 4A3MJ 3VW1A 1BW5A 4UUSB 1UI6A 4BBRJ 3GTPJ 2RASA 1X58A 1ZTRA 3CCYA 2R92J 4HNVA 2F07A 1ORKA 2DA1A 2XRLA 2Y2ZA 2AO9A 5F0HA 2NOGA 2HYTA 4AF5A 3MVPA 1RPWA 3Q0UA 1ZGWA 4NELA 5FKKA 3HE0A 4UDSA 4CYCA 1JJ6C 3DEWA 1TWAJ 2DA6A 1JGGA 1TWHJ 1UG2A 2XB5A 1Y1WJ 4EEFG 3VW0A 3TW7A 4DYCA 1JJ8C 2DMNA 1ETKA 1TC3C 2DA7A 1FIPA 3JRDA 4BY7J 2NVQJ 3QQAA 2TCTA 4D7NA 3COLA 2LY9A 2JA6J 4MIMA 4MK6A 2DTZA 2YVEA 3G1OA 1ENHA 5CXIA 3VOXA 3OIOA 1PUFA 3KZ9A 4JNNA 1TWCJ 1RESA 2NVYJ 1E3OC 1D5YA 3KKCA 1MH4A 4A69C 1AHDP 4A3FJ 2WV1A 3E7LA 1ETXA 2R5YB 1ZR2A 5DAJA 4AYBN 1LFBA 5K7ZA 1O4XA 4IEJA 3AQTA 5FKLA 1G2HA 1IRZA 2IBDA 1VNDA 2V57A 4DZJA 1A5JA 2CJJA 5H9TA 2NP3A 3V78A 2UXIA 5IYBJ 2M0CA 3G1MA 3G56A 3JRHA 3JRAA 3PM1A 2Y0SN 1ETWA 1JKPC 4I6ZA 2P81A 5F0FA 5BNGA 4A3BJ 2L9RA 5K7FA 4M3BA 5CW8A 2G7LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D7M A;  1SFO J;  1U78 A;  3S2D J;  2HQ5 A;  2XGE A;  5EZH A;  2OF7 A;  5HOD A;  2TRT A;  5EZG A;  2R93 J;  3IH4 A;  1GDT A;  5IP6 A;  1I3Q J;  2CU7 A;  2R0Q C;  2UXH A;  2LTP A;  1SAN A;  3VP5 A;  3MKL A;  2JA5 J;  5FLM J;  3BG5 A;  2NVX J;  4V2F A;  2CRG A;  2JN6 A;  5IP7 J;  3LSG A;  2R7Z J;  2ZOY A;  3HOV J;  3BR1 A;  3BJB A;  2E2H J;  4JX5 A;  1PUF B;  3O8G A;  4A3E J;  3JRE A;  5K58 A;  3NRG A;  3MNL A;  2R5Z B;  3NNR A;  2M8G X;  1B72 B;  3QPL A;  4YZE A;  1IDY A;  2ME6 A;  3JR9 A;  1FEX A;  2HXO A;  2QOP A;  3HB9 A;  2L0K A;  3HOY J;  4GCK A;  1Y1V J;  2GM4 A;  2ID3 A;  1FTT A;  3F1B A;  3LSR A;  5F08 A;  4IHW A;  4AC6 A;  2YS9 A;  5IYC J;  1K83 J;  3S17 J;  1RKW A;  2CQX A;  1OCP A;  2PZ9 A;  2G0E A;  2NP5 A;  5FKN A;  1LE8 B;  4HKU A;  4B3A A;  5FKM A;  2NS7 A;  1BJZ A;  1MBJ A;  2R5Z A;  1I6H J;  1VFC A;  2JJ7 A;  2FX0 A;  3B6C A;  3TP3 A;  3B81 A;  3RH2 A;  4RBO A;  3S1Q J;  3BG9 A;  4GCT A;  2UXU A;  5AQC A;  3E7Q A;  3BHQ A;  2M9H A;  1X2N A;  2GUH A;  2ZOZ A;  1IGN A;  3A02 A;  2JWT A;  4Y7N J;  4GFL A;  1TWF J;  3CJD A;  4S0H B;  3VW2 A;  2NS8 A;  4FTH A;  4ACI A;  4V2G A;  3FK7 A;  4M6V A;  3P9T A;  5M5Y J;  4FIS A;  2GFN A;  1H89 C;  2JA7 J;  2E2I J;  2G3B A;  1TWG J;  1X2M A;  2K9S A;  3A03 A;  3MN2 A;  4I76 A;  3OSF A;  3HDD A;  1IC8 A;  1ITY A;  4NN1 A;  3HTH A;  1NK3 P;  3ANG A;  1HDP A;  3GBG A;  3V6G A;  1Z77 A;  1B8I B;  1UI5 A;  1QVT A;  2XSD C;  1HF0 A;  2ME0 A;  4L62 A;  2MG4 A;  4X1E A;  3HM5 A;  1VI0 A;  4XIC A;  2O7T A;  2ZCM A;  1SGM A;  3S15 J;  1YRN A;  1IV6 A;  2DA2 A;  1P7I A;  3DPJ A;  3BR0 A;  1VF9 A;  5K7H A;  4QTR A;  1JKO C;  4XK4 A;  2WUI A;  3FRQ A;  1JTX A;  5EG0 B;  5M3F J;  5D1R A;  2EZK A;  1GV2 A;  1WPK A;  4MXM A;  5J3L A;  2GEN A;  1IUF A;  1POG A;  2RHA A;  5E3N A;  2JMW A;  5E3O A;  2EZL A;  2CQQ A;  5EDN A;  3NAR A;  2D6Y A;  4A3L J;  3QBM A;  1R9T J;  4DW6 A;  3JRF A;  2HI3 A;  3B6A A;  3G1L A;  4GFB A;  3VOK A;  2LP0 A;  2ZB9 A;  5EF6 A;  2UXO A;  5F0C A;  3BTL A;  2X9D A;  5JLX A;  5C3E J;  4W97 A;  1H8A C;  3S2H J;  3GTG J;  3ON2 A;  3BT9 A;  2FD5 A;  3LSJ A;  2QF7 A;  3H3V K;  2CUE A;  1MBF A;  3I4M J;  5FMP A;  3Q0V A;  1BW6 A;  3BR5 A;  3JRC A;  1JTY A;  1BL0 A;  3PO3 J;  1S7E A;  1OFC X;  2L7M P;  5DTD A;  2EQR A;  2XGD A;  4B4C A;  2H8R A;  5IYD J;  1F43 A;  4DYR A;  2O9L A;  1XS9 A;  2X48 A;  5C4X J;  5IP9 J;  1H88 C;  4MFD A;  1MBE A;  2NX4 A;  2LD5 A;  4W1U A;  2DG8 A;  3LSP A;  2ECC A;  2Y31 A;  4BXX J;  3GTO J;  2M34 A;  4QSH A;  5IOY A;  1AKH A;  1AKH B;  2IAI A;  2OER A;  1Z0X A;  3HTJ A;  5F27 A;  1JUM A;  2YVH A;  2VUM J;  5C4J J;  2KT0 A;  4A3I J;  5GPC A;  3BR3 A;  4A3D J;  1JT6 A;  2EZI A;  1JKQ C;  3C2B A;  1DU6 A;  1GUU A;  3ZQH A;  3HOZ J;  1Q1V A;  3VIB A;  2UXP A;  2PMZ N;  3IH3 A;  4DYQ A;  2PBX A;  3OOU A;  3ANP A;  5D19 A;  2EBI A;  2DMP A;  2K40 A;  1T56 A;  1A6I A;  2MGQ A;  2XDN A;  5J1Y A;  3K2A A;  2DN0 A;  5M3M J;  1MH3 A;  3S1M J;  3BRU A;  3T6N A;  4A3J J;  2VPR A;  3ZQG A;  5FJ8 J;  2N8G A;  2M2E A;  4BKX A;  1WH5 A;  2HDD A;  1IDZ A;  3JRB A;  4C2M J;  2B63 J;  3A01 A;  3BR6 A;  1RR7 A;  2GLO A;  2E1O A;  3BTC A;  2QWT A;  2OPT A;  1ZR4 A;  4AC0 A;  2QCO A;  5EYR A;  2IU5 A;  2DJN A;  2LVS A;  2XGC A;  1QRY A;  2AHQ A;  4FE4 A;  3SJM A;  5DS9 A;  2WAQ N;  3A01 B;  1IJW C;  3CRJ A;  3BQZ A;  2ECB A;  1U9O A;  4GCL A;  4BBS J;  2JA8 J;  3I4N J;  1HOM A;  3RZO J;  4RDU A;  4ABZ A;  3O60 A;  4MFE A;  3RKQ A;  2DG7 A;  3K7A J;  5F1J A;  2FJ1 A;  5HAW A;  1UMQ A;  4KWA A;  5E3M A;  5C44 J;  1BA5 A;  2HKU A;  3BTJ A;  4JX6 A;  3HOW J;  1HCR A;  2QIB A;  1WGX A;  2DA4 A;  3S1N J;  1QVU A;  4MLO A;  1JUS A;  3O8H A;  3CMY A;  2HOA A;  3ZQL A;  1HDD C;  2FQ4 A;  2HOS A;  4XRM A;  5M5X J;  4JP0 A;  4J19 A;  5JLW A;  4Y52 J;  3KKD A;  5E3L A;  3QPS A;  3M3Y J;  4M3G A;  4C3I J;  3G7R A;  2E19 A;  2WGB A;  1ETY A;  4C3H J;  5EEA A;  5F04 A;  1AU7 A;  1FTZ A;  1P7J A;  4IHY A;  3HEF A;  1FIA A;  4L5E A;  3HIM A;  3GTL J;  1K61 A;  1APL C;  3LWJ A;  3ON4 A;  2LR8 A;  2XPW A;  1LFU P;  2MSY A;  1B72 A;  4B1R A;  1ZK8 A;  5EGO B;  3LOC A;  2NVT J;  2GBY A;  3FIS A;  2QKO A;  2QTQ A;  1F36 A;  3C07 A;  1FJL A;  1LE8 A;  3NI7 A;  2R5Y A;  2HOT A;  3HTI A;  3NXC A;  2DMU A;  3D1N I;  2MW8 A;  3RD3 A;  3BR2 A;  3Q3S A;  4UUT A;  3L1P A;  2HXI A;  1QPI A;  4ICH A;  4XRS G;  2JK3 A;  3H0G J;  1XC5 A;  5J1U A;  1NK2 P;  2ZCN A;  5HBU A;  5HSZ A;  5J1R A;  4XID A;  1GV5 A;  2RAE A;  3SDG A;  2Q24 A;  4XRS A;  3EGQ A;  5FLV A;  3F0C A;  2EZH A;  5GPA A;  2DA5 A;  1ZKG A;  4M3D A;  3FK6 A;  4A3C J;  4IHV A;  9ANT A;  4ME9 A;  1MSE C;  4A93 J;  2K9N A;  2X6O A;  3PAS A;  3PPB A;  1MBG A;  4D5C A;  1RKT A;  2I10 A;  2WB1 N;  2OI8 A;  3VPR A;  2XB0 X;  3GTK J;  2L7F P;  4FE7 A;  4LOC A;  5FGL A;  5IPA A;  3UKG A;  3RQI A;  3JRI A;  1JUP A;  4FCY A;  4MO7 A;  3GTJ J;  1MBH A;  3RZD J;  3BQY A;  4CGR A;  1JKR C;  2DMT A;  3HGY A;  1OJL A;  1CQT A;  1MSF C;  2Y9Z A;  4A3G J;  2LFB A;  5GP9 A;  5FKO A;  5FHP A;  3CWR A;  3LJL A;  3TED A;  1U8B A;  1MNM C;  2CUF A;  1WCM J;  1GT0 C;  2W53 A;  5EGO A;  3HOU J;  4AUX A;  1HLV A;  2XPV A;  3QKX A;  3VUQ A;  3FIW A;  3NPI A;  2YUS A;  3WHB A;  3GTM J;  5EFY A;  3PO2 J;  1W0U A;  4JL3 A;  2LK2 A;  2H1K A;  2W48 A;  5EG0 A;  3OSG A;  4M3E A;  4IHX A;  3S16 J;  3EUP A;  4DZP A;  3CDL A;  2VKE A;  2Y30 A;  3TP0 A;  1RET A;  1ETV A;  2K9Q A;  1ETO A;  2HYJ A;  3TW6 A;  2L7Z A;  2E2J J;  4X6A J;  1WI3 A;  3FKI J;  5IOZ A;  3IV5 A;  3LHQ A;  1MBK A;  3HTA A;  3BG3 A;  3ZQI A;  5D18 A;  3CQZ J;  1B8I A;  2ZCX A;  3Q0W A;  1U9N A;  1IG7 A;  1UHS A;  4C3J J;  1T33 A;  1GVD A;  3JSJ A;  4PXI A;  1ZQ3 P;  2Y9Y A;  4QIW N;  2D5V A;  2FBQ A;  4D5F A;  1EF4 A;  3VVY A;  3JRG A;  3S5R A;  2LKX A;  2VKV A;  2VI6 A;  4CYC B;  1W0T A;  3AQS A;  3GEU A;  3KNW A;  2DMQ A;  2KDZ A;  3BTI A;  3S14 J;  3IUV A;  3HKZ N;  1YRN B;  4M3F A;  2ELK A;  2O7O A;  5C4Y A;  3WHC A;  3VVZ A;  3ZQC A;  5CXG A;  3GTQ J;  4G12 A;  3SFI A;  1OCT C;  3W6V A;  4JKZ A;  3ZOB A;  1JT0 A;  1WH7 A;  3HOX J;  2REK A;  3BNI A;  1NTC A;  4BY1 J;  3NAU A;  4A3K J;  3S1R J;  1ETQ A;  1DU0 A;  3VVX A;  2EH3 A;  2G7S A;  3ZQF A;  2ID6 A;  3GZI A;  4UUS A;  1XG1 A;  2COB A;  2XPU A;  3M4O J;  4JYK A;  2DA3 A;  4GFK A;  3IH2 A;  2IEK A;  2YU9 J;  3DCF A;  1I50 J;  5M5W J;  3BCG A;  3HBL A;  3HGG A;  2O8K A;  2G7G A;  3LNQ A;  4NDL A;  2LLK A;  4JX4 A;  4A3M J;  3VW1 A;  1BW5 A;  4UUS B;  1UI6 A;  4BBR J;  3GTP J;  2RAS A;  1X58 A;  1ZTR A;  3CCY A;  2R92 J;  4HNV A;  2F07 A;  1ORK A;  2DA1 A;  2XRL A;  2Y2Z A;  2AO9 A;  5F0H A;  2NOG A;  2HYT A;  4AF5 A;  3MVP A;  1RPW A;  3Q0U A;  1ZGW A;  4NEL A;  5FKK A;  3HE0 A;  4UDS A;  4CYC A;  1JJ6 C;  3DEW A;  1TWA J;  2DA6 A;  1JGG A;  1TWH J;  1UG2 A;  2XB5 A;  1Y1W J;  4EEF G;  3VW0 A;  3TW7 A;  4DYC A;  1JJ8 C;  2DMN A;  1ETK A;  1TC3 C;  2DA7 A;  1FIP A;  3JRD A;  4BY7 J;  2NVQ J;  3QQA A;  2TCT A;  4D7N A;  3COL A;  2LY9 A;  2JA6 J;  4MIM A;  4MK6 A;  2DTZ A;  2YVE A;  3G1O A;  1ENH A;  5CXI A;  3VOX A;  3OIO A;  1PUF A;  3KZ9 A;  4JNN A;  1TWC J;  1RES A;  2NVY J;  1E3O C;  1D5Y A;  3KKC A;  1MH4 A;  4A69 C;  1AHD P;  4A3F J;  2WV1 A;  3E7L A;  1ETX A;  2R5Y B;  1ZR2 A;  5DAJ A;  4AYB N;  1LFB A;  5K7Z A;  1O4X A;  4IEJ A;  3AQT A;  5FKL A;  1G2H A;  1IRZ A;  2IBD A;  1VND A;  2V57 A;  4DZJ A;  1A5J A;  2CJJ A;  5H9T A;  2NP3 A;  3V78 A;  2UXI A;  5IYB J;  2M0C A;  3G1M A;  3G56 A;  3JRH A;  3JRA A;  3PM1 A;  2Y0S N;  1ETW A;  1JKP C;  4I6Z A;  2P81 A;  5F0F A;  5BNG A;  4A3B J;  2L9R A;  5K7F A;  4M3B A;  5CW8 A;  2G7L A; 
#chains in the Genus database with same CATH topology
 5GTI C;  4D7M A;  4CCM A;  4CA0 A;  3RI4 A;  2PMH A;  2CW8 A;  5HOD A;  1GDT A;  1FWZ A;  3P9C A;  4UVC A;  4B48 A;  2CU7 A;  3A1Y A;  5JR3 A;  5K5R A;  2R0Q C;  3LMM A;  3QPH A;  1F9N A;  4WWC A;  4IHT A;  1BI0 A;  3FXK A;  1FBS A;  1SMT A;  3GFM A;  2JA5 J;  2OTJ I;  5FLM J;  3BG5 A;  2JTV A;  4V2F A;  2R7Z J;  3I53 A;  2O8X A;  5L3E A;  3J81 Z;  1PUF B;  1IV8 A;  3E0J B;  3JRE A;  2ICW G;  5K58 A;  3QP5 A;  3MNL A;  2EV0 A;  3M9A A;  2XAS A;  1Z67 A;  3V7C A;  3KIO A;  3WE2 A;  4YZE A;  5KVR A;  1IDY A;  2ME6 A;  1FEX A;  1TQP A;  3GYH X;  1I39 A;  3OYH A;  1X1C A;  2F48 A;  3QP6 A;  5E1X A;  3WE3 A;  3ERE D;  4IRH A;  2RDP A;  3BWG A;  2QSF X;  4BYY A;  3LSR A;  2MC3 A;  3ZMT A;  2P0W A;  3S17 J;  2Z5U A;  3D5R C;  2DBB A;  2CFO A;  4O5V A;  1B1B A;  3RYP A;  2PZ9 A;  2D1V A;  2NP5 A;  1LE8 B;  2R7X A;  1UCR A;  2CFX A;  5FKM A;  1BJZ A;  1S72 I;  1I6H J;  1VFC A;  3B6C A;  3TP3 A;  4X0G A;  2KRH A;  4LLN A;  2ZJ2 A;  5F6F A;  2P5V A;  4RBO A;  3S1Q J;  1LNW A;  4MNU A;  3CMA I;  2Z9O A;  4XSX F;  3VYU B;  2UXU A;  3E7Q A;  5AQC A;  4GCT A;  4N4N B;  4KMF A;  2JWT A;  3EPZ A;  3NWS A;  4GFL A;  4MEX F;  2ZJP F;  5HLG A;  1LDK B;  4PFP A;  3VW2 A;  1IXC A;  2NS8 A;  4HAM A;  2OC6 A;  4V2G A;  3FXU A;  5M5Y J;  1WFX A;  4F55 A;  2HTJ A;  5FGM A;  1TWG J;  4R8H A;  3PIP F;  1ITY A;  3HTH A;  3U2R A;  5HS8 A;  3GBG A;  1YJW I;  4OIQ F;  1RR8 C;  5A2Q Z;  4CO8 A;  2ME0 A;  4HX4 A;  4ASN A;  4UV8 A;  4EVI A;  1R4N B;  2M7A A;  3RPU D;  1T8I A;  1IV6 A;  2DA2 A;  5K7H A;  2MLG A;  3ABM H;  2VC1 A;  5DCM A;  1HW2 A;  3FRQ A;  1JTX A;  3I56 I;  4OD5 A;  2WY8 Q;  4XKC A;  2TDX A;  3FX3 A;  5M3F J;  5D1R A;  1J09 A;  2EZK A;  1WPK A;  4MTE A;  3OYD A;  2R7T A;  5J3L A;  1QZE A;  1EH8 A;  3C3W A;  4L9J A;  2JMW A;  5E3N A;  1O3R A;  4CH7 A;  2CQQ A;  3NAR A;  4FET A;  3JRF A;  3QYB A;  4ZH4 F;  3G1L A;  3L2R A;  1UHW A;  1TT0 A;  3VOK A;  1VQ9 I;  2LKS A;  3DF8 A;  3SZT A;  3GTG J;  2OUM A;  3H9Q A;  4Q5S F;  3F8M A;  3KZZ A;  2CUE A;  2IS1 A;  1P6R A;  4LK0 F;  2CG4 A;  2EFN A;  2PQ8 A;  1HA8 A;  1WJC A;  3PO3 J;  1XN7 A;  3J80 K;  2W85 A;  2L7M P;  1P9Q C;  1YYV A;  5IYD J;  3ZGK A;  4HZF A;  5AIP A;  2A5W A;  3CJN A;  1U5T B;  2EV6 A;  1CGP A;  2DG8 A;  1K4S A;  4UUV A;  2Y31 A;  3TO7 A;  2E5N A;  3OYN A;  1IN7 A;  3I71 A;  2IAI A;  2KIQ A;  3ONQ A;  1K6Y A;  2W82 A;  2XF7 A;  1YFH A;  1HXD A;  2LH9 A;  4BQQ A;  4HNT A;  2ELH A;  3BR3 A;  2QBY B;  2EZI A;  5HVQ C;  1DU6 A;  1HBX G;  5D19 A;  2EBI A;  2DMP A;  2F6C A;  5E17 F;  3G3Z A;  1WI9 A;  5HNF A;  1SD6 A;  2DN0 A;  4YFX F;  5M3M J;  3P9I A;  3ZQG A;  1IUY A;  2LRD A;  3RYR A;  1Y8Q B;  3M1E A;  2HDD A;  4UXN A;  4B43 A;  5IT3 A;  3BR6 A;  3A01 A;  4ESB A;  2STT A;  3BTC A;  3GZ6 A;  4IF4 A;  4R1H A;  1LEA A;  4XQF A;  1PVE A;  4AC0 A;  4G8X A;  4FT8 A;  5EYR A;  3OYA A;  4I09 A;  3LQQ A;  4GRI A;  5J47 A;  5LRS A;  2VBY A;  3S2W A;  4F52 A;  2K27 A;  4P96 A;  2PJR A;  4BBS J;  4OAZ A;  3I4N J;  3GLL A;  1R7J A;  1HOM A;  1N77 A;  5DEQ A;  1D5V A;  1WHU A;  2BY0 A;  3RPQ A;  5LGN A;  2DG7 A;  3VB2 A;  2VXD A;  1UMQ A;  2COM A;  4J00 A;  5DD8 A;  1BA5 A;  2HKU A;  3FXR A;  4HOB A;  1Z3X A;  2EA2 A;  3RKW A;  1WGX A;  2VIX A;  2DA4 A;  3G71 I;  2FSW A;  1QVU A;  2WBM A;  4S05 A;  3R61 A;  1S7A A;  5CQG A;  3G4S I;  4ESJ A;  1SD5 A;  2HOA A;  3CMY A;  4HX7 A;  4IJA A;  2HOS A;  2WAF A;  3KKD A;  1LQ1 A;  2X0L A;  4ZYA A;  3M3Y J;  4M3G A;  1LVK A;  3CES A;  4G6D A;  3E1S A;  2ZSH B;  4C3H J;  3K4B A;  3ZXS A;  2DLL A;  5GAH J;  5EEA A;  1AU7 A;  1XGM A;  1SFU A;  4ZYE A;  3FXO A;  2RNG A;  5LFA A;  1Y0U A;  3TO6 A;  2V1U A;  2XPW A;  1JHF A;  1ZK8 A;  4XOT A;  3TQN A;  3DTK A;  1S5L C;  3RKY A;  3NEU A;  4PSX A;  3C07 A;  2IPQ X;  3BRO A;  1LE8 A;  3NI7 A;  2R5Y A;  3C18 A;  3ZCO A;  5HOO A;  2MW8 A;  3FM3 A;  4LG3 A;  3D1N I;  3TKY A;  2IS2 A;  3GUD A;  2HFH A;  2GA1 A;  5D5X B;  3D5S C;  3W3C A;  4XRS G;  3H0G J;  2WTE A;  5J1U A;  2V79 A;  4AU7 A;  1GV5 A;  1T0F A;  2Q24 A;  3EDP A;  3GZ5 A;  4ME9 A;  3HC7 A;  1MSE C;  2K9N A;  2X6O A;  4GDF A;  4HF2 A;  2I10 A;  2WB1 N;  1NH3 A;  1MJA A;  2BZT A;  1LPQ A;  2L7F P;  4FE7 A;  4KT5 C;  3IAS 2;  5GTH C;  1PUE E;  1ERD A;  3SHF A;  5JVT A;  4MO7 A;  3GTJ J;  4K2E A;  1TP4 A;  1XDU A;  4CIC A;  3PJR A;  2XIG A;  3TDZ C;  1CQT A;  2Y9Z A;  3B02 A;  2L01 A;  1Z6R A;  2ESH A;  5GP9 A;  1U3E M;  4A5N A;  4CGZ A;  3QOD A;  5FKO A;  1X3U A;  5K1Y A;  5FHP A;  4M72 A;  2VJ4 A;  4QPQ A;  3HPH A;  4RLQ A;  4MQV A;  2EB7 A;  3CO6 C;  5FO5 A;  3HOU J;  5DV5 A;  4AUX A;  1HLV A;  3AG1 H;  3F3X A;  4UNO A;  2A5Y B;  4ZZD A;  3WHB A;  1I1G A;  4UVB A;  5LEK A;  3PO2 J;  3SEQ A;  4XBF A;  4JL3 A;  2V9K A;  1SFX A;  5EG0 A;  3VSL A;  4DVY P;  4M3E A;  2MLK A;  3S16 J;  3KCC A;  3ABK H;  1R00 A;  1WQ2 A;  2VKE A;  2Y30 A;  1LDJ A;  2K9Q A;  2E1M B;  1ETO A;  3K4J A;  2ZY9 A;  2L7Z A;  2KP6 A;  3BOQ A;  3NQO A;  4XM3 A;  3VOD A;  1XX5 A;  1MBK A;  3HTA A;  2VT3 A;  4L9N A;  1U9N A;  1T33 A;  1XDS A;  3T5X A;  4ZYD A;  3PFY A;  5LHH A;  2Y9Y A;  4QIW N;  2FBQ A;  1T2K A;  3ZQQ A;  2BW3 B;  2M1B A;  4XKW A;  3OY9 A;  3L9F A;  2VKV A;  2VI6 A;  3KNW A;  3GEU A;  3AQS A;  3PL8 A;  4BL0 B;  1VQP I;  3JSP A;  4M3F A;  5C4Y A;  3DPL C;  2HGC A;  4BNC A;  1ZG3 A;  3ZQC A;  1W5S A;  4G12 A;  1BR1 A;  2HQA A;  2RVC A;  4P9U A;  1H9T A;  3RKX A;  1JT0 A;  5CJ9 A;  2BVL A;  3J81 K;  1WH7 A;  1MDM A;  1WZ2 A;  3HOX J;  2BHZ A;  5LRR A;  2R7S A;  4M73 A;  4XON A;  4AD9 A;  3NAU A;  3KZY A;  4GYI A;  2NNY A;  1S6L A;  3S1R J;  1HKS A;  3VVX A;  1B9N A;  2F4M B;  3M8J A;  5ED4 A;  2ID6 A;  3RQ4 A;  3E97 A;  3ML6 A;  4NB5 A;  3HHH A;  1IF1 A;  3D5L A;  2ZME C;  5TRD A;  5KNL A;  1TL8 A;  5M5W J;  3HGG A;  1G3Y A;  1YS7 A;  2G7G A;  3LNQ A;  4NDL A;  1QZY A;  3OL3 A;  2HDW A;  2KIU A;  4IQJ A;  1MMS A;  2DFI A;  5AON A;  3FM5 A;  4Q48 A;  1U5T A;  3GTP J;  2YSR A;  2GAU A;  1ZTR A;  5L3D A;  2F07 A;  4M74 A;  1UG0 A;  4Y17 A;  2R7F A;  4G7O F;  1V4R A;  5F0H A;  3CCS I;  1IW7 F;  2Z3Y A;  4C2U A;  2H8W A;  1RPW A;  2QQ8 A;  3OYE A;  2W84 A;  3QPT A;  1P4W A;  3I59 A;  1TWA J;  3TOB A;  4DIQ A;  2DFF A;  1HC8 A;  3DTE A;  4XLC A;  2DAO A;  3CF2 A;  4NHJ A;  4DYC A;  1JJ8 C;  1W7P D;  4KJZ A;  4D1Q A;  1D0X A;  2WA0 A;  1FIP A;  4WXC A;  1WJE A;  3JRD A;  4BY7 J;  3U1K A;  2QKM B;  3H9G A;  4D7N A;  1UHM A;  4BHP A;  2VN2 A;  3HIF A;  3WGH A;  1J7K A;  2GIZ A;  1X3Z B;  4MK6 A;  1NHA A;  3CDI A;  2KFD A;  3W6J B;  2OU2 A;  2HWV A;  2VC0 A;  4C30 A;  1RES A;  1YHQ I;  2JRT A;  2ZME B;  3DKY A;  3F23 A;  5L3G A;  2EPF A;  3DBH B;  2RRE A;  2KIF A;  3KLN A;  3K4C A;  3KKC A;  2FOW A;  3F8N A;  4A3F J;  3E7L A;  3KEY A;  3TL4 X;  3CD6 I;  1ETX A;  3ELK A;  3KP7 A;  2QWW A;  4E7S A;  2XF5 A;  4B3X A;  4AYB N;  1QBJ A;  1LFB A;  2A68 F;  3AQT A;  2IBD A;  4IXA A;  1USS A;  1A5J A;  4RA2 A;  4BAY A;  3MAJ A;  4MHG A;  4ZYH A;  5J4V A;  3FBN B;  2IJL A;  4CCJ A;  3ECH A;  3JAM Z;  5A2Q K;  3E3V A;  2P81 A;  4I98 B;  2LNB A;  4HQM A;  2W57 A;  4F93 B;  3TOA A;  5CW8 A;  2G7L A;  1K7A A;  1REP C;  3I64 A;  1Z3Y A;  1VTN C;  2BGC A;  3LQR A;  2ZXW H;  1U78 A;  2EFQ A;  3PSI A;  3S2D J;  3DPT A;  3J7Y J;  5EZH A;  2R93 J;  2TRT A;  5EZG A;  2CUJ A;  2R3S A;  4BEH A;  3X2Q H;  5ERI A;  2Z1D A;  1S3J A;  1SAN A;  3EYI A;  2VON A;  1WJA A;  3FMR A;  3MKL A;  2JSC A;  2NVX J;  4IPA A;  2MC4 A;  3VSK A;  1MZB A;  1BOA A;  3BR1 A;  1BM9 A;  2DYR H;  1LDD A;  2HZT A;  2E2H J;  4JX5 A;  5HS7 A;  3VYR B;  1LB2 A;  4A3E J;  2DT5 A;  2CUZ A;  1O57 A;  2M8G X;  1B72 B;  3H0D A;  2E7X A;  2OZU A;  1O7L A;  3VWB A;  3SWH A;  1WSU A;  3L2C A;  2UWM A;  3JR9 A;  2E71 A;  1WKM A;  1V3F A;  3ANP A;  2ZNY A;  2L0K A;  3KYC B;  4LIT A;  4GCK A;  2ID3 A;  1SD4 A;  1OYI A;  2O6G E;  5F08 A;  4AC6 A;  2YS9 A;  5IYC J;  2EV5 A;  2K9L A;  4ITV A;  5F64 A;  4L5I A;  4MQ9 F;  1RKW A;  2CQX A;  4PGH A;  1IXS B;  4G6Q A;  4OMY A;  1MMG A;  5FKN A;  4HKU A;  1ZLK A;  3CME I;  2NS7 A;  4ZYG A;  1A36 A;  2MA3 A;  2ZJQ F;  2JJ7 A;  2FX0 A;  5BMZ A;  2M5W A;  4GXO A;  1J9I A;  3RH2 A;  3HRS A;  2WB1 A;  3O6B B;  3OL4 A;  3OYF A;  4G6T B;  3BHQ A;  5D4R A;  3IL2 A;  2HZD A;  2GUH A;  3EUH A;  1G3T A;  3WTY C;  3SXY A;  4NUB A;  5HDN A;  1J5Y A;  3JTH A;  4IZZ A;  4FTH A;  3D0S A;  2IS4 A;  3WU2 C;  1V55 H;  2PJR B;  4KA4 A;  1Z21 A;  2DFH A;  1Y0N A;  1FSH A;  3OMY A;  1N25 A;  2K9S A;  3MN2 A;  3HDD A;  4NN1 A;  1X1A A;  1YE9 A;  2AQE A;  3M1C A;  4JK1 X;  4B09 A;  2DT7 B;  3EQL F;  3ANG A;  2UXX A;  1Z77 A;  2HVR A;  1UI5 A;  1QVT A;  2KL4 A;  2RN7 A;  3VOE A;  1HF0 A;  1PP7 U;  1RRJ A;  3R0J A;  1YIO A;  1VI0 A;  2O7T A;  2IGO A;  4F91 B;  2GIV A;  2E60 A;  3V8L A;  1YRN A;  4BXF A;  4HF1 A;  3BR0 A;  4M9S A;  2WUI A;  3CLO A;  3BCB A;  4J01 A;  1LJ9 A;  5EG0 B;  2K3F A;  1DQU A;  4E7H A;  1GV2 A;  3OS0 A;  2DDB A;  4LLG F;  4MXM A;  2BXZ A;  5HLI A;  2QLZ A;  1R4M B;  4BJ5 C;  1POG A;  3J7Z I;  3WTV C;  2VBW A;  2P8T A;  2VL8 A;  5EDN A;  5CYV A;  2D6Y A;  4A3L J;  4QPO A;  3ZMZ A;  1R9T J;  2PX9 A;  4UHT A;  3PQK A;  3ISP A;  1QNT A;  2CYY A;  4A0Y A;  3OR1 C;  5E18 F;  1R71 A;  1J75 A;  4XSZ F;  2OQG A;  2DYS H;  5F0C A;  3T0Y A;  2OCE A;  2X9D A;  3BTL A;  3S2H J;  5J8F A;  3K1P A;  1XCV A;  3LSJ A;  1KQ9 A;  3KP6 A;  4R79 A;  2K3P A;  5FD6 A;  3WTW C;  2LOO A;  1B6A A;  5KAI C;  2OCC H;  1VQL I;  5H6Q A;  1BW6 A;  4C2M A;  1FBU A;  1SEU A;  3O2P E;  3JRC A;  1JTY A;  1OMI A;  3OYG A;  4N4O B;  3FF5 A;  1OFC X;  2XGD A;  1F1Z A;  2H8R A;  3F8F A;  1F43 A;  4DYR A;  5BPD A;  1T6S A;  1XS9 A;  2A2F X;  4RAG A;  5HNH A;  2NX4 A;  1F4K A;  2D2W A;  2VJJ A;  4BXX J;  5IOY A;  4QSH A;  4ESF A;  4E7L A;  2R7O A;  2OER A;  1IRG A;  4WXH A;  5F27 A;  1BIB A;  2BY3 A;  1JUM A;  2YVH A;  1FMV A;  3IHU A;  5GPC A;  3RPU A;  1R5H A;  1R1T A;  5D5V B;  1JKQ C;  3CUQ B;  3VIB A;  2UXP A;  1WJ5 A;  3IH3 A;  3CZ6 A;  1FNN A;  2MGQ A;  3GWZ A;  5J1Y A;  3I58 A;  4KIG A;  3GO5 A;  2R7Q A;  3K6G A;  3K2Z A;  1MH3 A;  1XMK A;  3S1M J;  3T6N A;  4CZC A;  2XV4 S;  3H1C A;  1QHH D;  5FJ8 J;  2N8G A;  2M2E A;  2VJI A;  2BXY A;  1WH5 A;  2HKX A;  3TDU C;  1IDZ A;  3CP8 A;  4IX7 A;  2CV0 A;  4C2M J;  1TW2 A;  2KMU A;  2QWT A;  2J5P A;  1R36 A;  2OPT A;  5CVJ A;  3P7N A;  2XGC A;  2FNA A;  4WIB A;  4ENM A;  4ANJ A;  1LKX A;  4PSW A;  3SJM A;  2QSG X;  2K85 A;  2ECB A;  1U9O A;  4GCL A;  1BI2 A;  2Z33 A;  1FLI A;  3CC7 I;  3MKW B;  1KA8 A;  2P5K A;  4RDU A;  3HOT A;  2VQL A;  1O3T A;  1C0W A;  1GXQ A;  4MFE A;  4Y15 A;  5LGU A;  3AG4 H;  2XRN A;  2V1X A;  4KWA A;  2W25 A;  1WVR A;  3BTJ A;  2A6H F;  2QIB A;  1HCR A;  3UNG C;  4E7K A;  1JUS A;  3HG9 A;  3ZQL A;  2GOX B;  4TV7 A;  1HDD C;  4XKV A;  2FQ4 A;  3OYM A;  1TBX A;  4JP0 A;  4AYB A;  2A6T A;  3KP2 A;  3L00 A;  2LY1 A;  5E3L A;  4I0B A;  2YPR A;  4U9N A;  4PCQ A;  2WGB A;  1ETY A;  4PJL A;  1IN5 A;  4N9H A;  3CCM I;  2OD5 A;  4EJW A;  1OQY A;  1P7J A;  2XAH A;  3HEF A;  3IWZ A;  2DQR A;  3GFI A;  1K61 A;  5BS6 A;  1APL C;  2GA2 A;  2HVQ A;  3EET A;  2NVT J;  4PZJ A;  2QKO A;  1XPX A;  3NWT A;  1UST A;  1FJL A;  5DUI A;  1OCO H;  3IKT A;  3HTI A;  4OIP F;  2EK5 A;  2Q8K A;  1HQC A;  5CQE A;  4A12 A;  1BC7 C;  1VQK I;  4UUT A;  3AFH A;  3Q9S A;  1QPI A;  5L3F A;  2JK3 A;  3T8R A;  2ZCN A;  1FC3 A;  5HBU A;  2MH2 A;  2R7W A;  3UR3 C;  3CF5 F;  3K10 A;  5JHU A;  5GPA A;  2DA5 A;  3FK6 A;  9ANT A;  3HYI A;  1MNE A;  3PPB A;  1V5E A;  1P4X A;  1UAA A;  1RKT A;  1TLH B;  1FYK A;  2KIS A;  1JI8 A;  3C1D A;  4XMY A;  1ZH5 A;  2QQB A;  5FGL A;  2V7F A;  3JRI A;  4FCY A;  1VQ4 I;  2XF6 A;  3QOE A;  3RZD J;  4FX0 A;  4M9X A;  3QOP A;  3K8P C;  4CGR A;  2Z99 A;  1JKR C;  2DMT A;  3HGY A;  4RMN A;  4A3G J;  2IGN A;  3HL2 A;  4C2T A;  2M7B A;  4LJZ F;  2VOP A;  3H5R A;  4ON0 A;  5HLH A;  1OLT A;  2VE9 A;  2VE8 A;  2K4B A;  3PNT A;  1X3W B;  1U8B A;  3WGG A;  2W53 A;  1Z6T A;  5EGO A;  1X4P A;  2X4H A;  3M7G A;  2Y69 H;  3MKZ A;  2UZK A;  3QKX A;  3VUQ A;  2LSO A;  1D8K A;  4GGG A;  3KLO A;  3HSR A;  3GTM J;  2IS6 A;  2FXA A;  3FXL A;  3DV8 A;  1W0U A;  1D0Y A;  2H1K A;  2W48 A;  2VBZ A;  4KT6 A;  4YEJ A;  4DZP A;  5L3C A;  3CDL A;  2Z2S B;  3MZH A;  3TP0 A;  3DPU A;  3TW6 A;  5D8K B;  2VQC A;  4WXD A;  3F6V A;  2HTS A;  4RB1 A;  2JRM A;  2QSH X;  3HPG A;  2ZKZ A;  2DFE A;  3Q0W A;  4FX4 A;  4C3J J;  2P7C B;  2WC2 A;  4BQN A;  2VPL A;  4PXI A;  1ZYR F;  3GFJ A;  3I4P A;  3KFW X;  2LG4 A;  3JRG A;  3S5R A;  2VBX A;  2LKX A;  1BN5 A;  2K9M A;  2DMQ A;  4DOZ A;  4EQQ A;  1S8N A;  1YRN B;  5KK1 A;  2O7O A;  3WHC A;  3VVZ A;  2LBF A;  2DJI A;  4XL9 A;  2BV6 A;  1E3H A;  1D1C A;  4PUS A;  1K78 B;  5EEG A;  3RSN A;  3BNI A;  1N75 A;  1IAW A;  2STW A;  3CP2 A;  1DU0 A;  1AOY A;  1MKM A;  5K5O A;  4IHS A;  2COB A;  2E1M C;  3M4O J;  3GEZ A;  4JYK A;  4GFK A;  4ZDO A;  5L3B A;  2IEK A;  2O03 A;  2EWN A;  4ZTJ A;  2CWE A;  4IVN A;  2E7W A;  1FYL A;  4XRF A;  5IT9 Z;  4JQF A;  2DQL A;  2LLK A;  3FZV A;  1L0O C;  3VW1 A;  4ENK A;  2PFB A;  3Q5F A;  2DI3 A;  4UUS B;  1UI6 A;  2B1E A;  1K78 A;  2RAS A;  3CCY A;  5ICG A;  4U87 A;  4HNV A;  4YRV A;  5CKT A;  1XGN A;  2AO9 A;  2F5D A;  2NOG A;  1DPU A;  4XLN F;  2HYT A;  4HLX A;  4PK4 A;  3FWE A;  3MVP A;  3BG6 A;  4NEL A;  5FKK A;  2Q0O A;  3HE0 A;  1I27 A;  2MFZ A;  2X51 A;  4QLC U;  3CMM A;  1JJ6 C;  4OIO F;  2MH9 A;  1TWH J;  2XB5 A;  1B9M A;  1MD0 A;  1OR7 A;  2RKH A;  3E6B A;  3TW7 A;  4BDY A;  1YJN I;  1BR4 A;  1LUJ B;  1ETK A;  2M4K A;  3I55 I;  4HW0 A;  1STZ A;  3AL0 B;  2WAQ A;  2XDV A;  2IA1 A;  2EIL H;  5EEH A;  3A0H C;  3HRM A;  4A6D A;  2CV1 A;  4LGW A;  3QQA A;  1X4O A;  2V9V A;  2NRA C;  2LY9 A;  2JA6 J;  2LF8 A;  3ULQ B;  2DTZ A;  2YVE A;  1ENH A;  1OIS A;  3AKZ A;  1TWC J;  3H5N A;  1YG2 A;  2BY2 A;  2ZME A;  3V8J A;  1D5Y A;  2PMU A;  4MTD A;  2OZ6 A;  4I01 A;  2WV1 A;  3R6S A;  3DEE A;  2CH0 A;  2L3D A;  2R5Y B;  5LLQ A;  5DAJ A;  4YII A;  3MEX A;  4OIN F;  1O4X A;  4BH9 A;  2R7D A;  5FKL A;  3W2W A;  2DCE A;  2FJI 1;  2V57 A;  1FOW A;  2L4M A;  4XLF A;  2E5Z A;  3V78 A;  1IXR C;  3G56 A;  3HUG A;  3JRH A;  3E5Q A;  3GX4 X;  2Y0S N;  1KU9 A;  4A0Z A;  4YG2 F;  3DU5 A;  3DKW A;  5CPR B;  4HYE A;  2Y75 A;  2VKD A;  4LK1 F;  1G59 A;  5KAF C;  5H6R A;  2HQ5 A;  4OMZ A;  2XGE A;  2ADU A;  2OF7 A;  2DOE A;  3E6D A;  1Y56 A;  4PJJ A;  4XN3 A;  1DDN A;  1HW5 A;  1I3Q J;  2UXH A;  2NNN A;  2LTP A;  4M71 A;  3ZMS A;  2HR3 A;  2X1D A;  2CRG A;  3W2V A;  5IP7 J;  3LSG A;  2ZOY A;  3HOV J;  1FSE A;  3BJB A;  1WWX A;  2HVS A;  3O8G A;  4BXU A;  3NRG A;  4HV5 A;  3K9T A;  2R5Z B;  4LB5 A;  2BVM A;  2EA4 A;  1JGS A;  5ILS A;  5D8L B;  3WTS C;  2A07 F;  3CJQ B;  1J0R A;  4HNU A;  4EJT A;  2HXO A;  2QOP A;  4AIK A;  3HSF A;  3FKJ A;  2W7N A;  1P4A A;  2BY1 A;  1S7O A;  2OV7 A;  1FOK A;  3L2U A;  4BE0 A;  3HOY J;  5ICF A;  3I3L A;  1TNT A;  3H9J A;  1FTT A;  3TBI A;  4IHW A;  1SAX A;  3RTR A;  5FRM A;  2HYG D;  4YIR X;  3OR2 C;  3U1D A;  3Q9V A;  1KQ8 A;  1ZRC A;  2KIM A;  1OCP A;  2G0E A;  3ABT A;  4B3A A;  1XSX A;  2ZBK A;  1P92 A;  4C9Y A;  2GXA A;  4G7H F;  1S9H A;  2R5Z A;  4LG0 A;  3B81 A;  2H6B A;  3S3M A;  2YVX A;  1IN6 A;  2IP2 A;  3BPV A;  2V6E A;  2B7E A;  3DFG A;  2ZOZ A;  1R1V A;  4AVZ A;  4BU2 A;  1WRJ A;  2M4G A;  1NG6 A;  3A02 A;  4DQ2 A;  4Y7N J;  2D45 A;  1K6O A;  1TWF J;  2JSP A;  3CJD A;  4S0H B;  5DD4 A;  1IRF A;  3F21 A;  3IP4 B;  4M6V A;  1G4D A;  3P9T A;  1IO2 A;  4FIS A;  2KDO A;  2GFN A;  2LYC A;  1CF7 A;  5H2F C;  4E70 A;  1H89 C;  2JA7 J;  2XAG A;  1ON1 A;  1X2M A;  2Q2E B;  3A03 A;  4KIF A;  4I76 A;  4BJ6 C;  5DM7 F;  3OSF A;  1IC8 A;  3MFK A;  1NK3 P;  1MDM B;  2X6W A;  2X1C A;  5E1Z B;  1UZC A;  4Y33 A;  4U0W A;  4XIC A;  4X1E A;  3HM5 A;  2ZCM A;  1SGM A;  3WG7 H;  4U88 A;  2NAZ A;  3RIR A;  4RS8 A;  3S8P A;  4CUG A;  3DEU A;  5HS9 A;  4QTR A;  1JKO C;  4XK4 A;  1PDN C;  1ULY A;  1XMX A;  5E1W A;  2XAU A;  3ZMD A;  5D6E A;  1ZAO A;  3C2H A;  1H0M A;  3FDY A;  2L9N A;  3CCJ I;  4IRV A;  2GEN A;  1IUF A;  3I5U A;  2WAD A;  4YFN F;  3OOP A;  2RHA A;  2EZL A;  1W36 C;  3SZG A;  1Z9C A;  2HEO A;  1I5Z A;  4HQE A;  2H1L A;  3B6A A;  3JW4 A;  5B66 C;  2LP0 A;  1PYV A;  5EF6 A;  2VQH A;  3K4N A;  4I02 A;  5JLX A;  4Y4R A;  3ON2 A;  1VQM I;  1UEL B;  1W1W E;  4KIS A;  3HXL A;  4FQG A;  2GOM A;  5FMP A;  1E2X A;  4EM2 A;  2ISY A;  1W5T A;  2CGP A;  4II2 A;  1YIJ I;  4E7Z A;  2P6T A;  5DTD A;  2FRH A;  2EIJ H;  2EQR A;  2FOK A;  3TGN A;  4WF2 A;  4L0Z B;  3CCL I;  2O9L A;  2X48 A;  4UV9 A;  4NQW A;  5IP9 J;  1H88 C;  4EGZ A;  4W1U A;  1BI1 A;  3KPH A;  3FMS A;  4U7D A;  2A3S A;  3CCE I;  1QU3 A;  3I0T A;  1FPQ A;  1BJA A;  2EJR A;  2M34 A;  2Y48 A;  3F72 A;  3DQV C;  3OYC A;  1RNL A;  4UB8 C;  4AIJ A;  1BBY A;  1AKH A;  1AKH B;  1I1S A;  4E7J A;  3WOD F;  2LDU A;  3CUO A;  4EM0 B;  5C4J J;  4EM1 A;  4IQ4 A;  2M3A A;  2DW4 A;  1TZL A;  1AA7 A;  3QRF F;  2OBP A;  3QYF A;  4DNC A;  3OYI A;  3C2B A;  2G7U A;  2M30 A;  3ZQH A;  3HOZ J;  1SVO A;  4CDG A;  5ILV A;  3LSH A;  1GXP A;  3OOU A;  2PBX A;  4RGS A;  2K40 A;  4KYW A;  4E7I A;  3HZJ A;  1XSV A;  1U0J A;  3IRQ A;  1AWC A;  4EAT A;  4OAY A;  3JAM K;  1SD7 A;  4M9Z A;  2EFP A;  4AVP A;  4DBQ A;  1D1B A;  2VPR A;  2X6X A;  4ZDL A;  2EIN H;  4KIB A;  4ETS A;  2E1C A;  1E0E A;  3HJE A;  1K4T A;  1BOB A;  3JRB A;  5CVI A;  2B63 J;  1RR7 A;  2R4G A;  2E1O A;  4L18 B;  4NBQ A;  1G3W A;  5F1R A;  4CSW A;  2IRF G;  2PMZ A;  2V1N A;  2IA2 A;  1FT9 A;  3FBI B;  1D8J A;  2DJN A;  1KU7 A;  2AHQ A;  4FE4 A;  4ZDP A;  3J80 Z;  2DT6 A;  5DS9 A;  2WAQ N;  1U8R A;  4GCV A;  3A01 B;  4I2O A;  1IJW C;  1W7P A;  1RI7 A;  3VTI A;  3G2B A;  4PGG A;  4XKB A;  2JUC A;  3ASO H;  4NC7 A;  3RZO J;  2GXG A;  3DKX A;  3K1M A;  4YFK F;  4DBR A;  3HTS B;  3RKQ A;  1U6G A;  5F1J A;  1DGR M;  5HAW A;  1TQM A;  3AAF A;  5E3M A;  5C44 J;  4JX6 A;  2M45 A;  3HOW J;  2IXS A;  3CUQ C;  2FEZ A;  2H09 A;  3CCR I;  3CJT B;  4GYG A;  2W4S A;  2PJP A;  3O8H A;  3RJP A;  3GZN B;  2WV0 A;  3LFK A;  5M5X J;  4XRM A;  2EFW A;  4J19 A;  1VQ6 I;  3LL7 A;  5JLW A;  2KRC A;  3DXJ F;  4RAZ A;  4C3I J;  4IKF A;  3G7R A;  4ZJZ A;  2HYF A;  2KRF A;  1MMD A;  3ROU A;  2PLY A;  5BQT A;  1Q1H A;  2HKO A;  4YEL A;  1FTZ A;  4IHY A;  3MZY A;  3A0B C;  4L5E A;  3GTL J;  3H3U A;  3R0A A;  3R4K A;  2FUG 2;  4EGY A;  3HRT A;  3LA7 A;  1DPR A;  4XN0 A;  4U0Y A;  2V6C A;  2MSY A;  2Y0S A;  5EGO B;  1B72 A;  3BY6 A;  3FIS A;  3S3N A;  4BDZ A;  2XHK A;  3IC7 A;  2V26 A;  4F7Z A;  1ZRE A;  4XOP A;  1OCR H;  3VDX A;  3NXC A;  1KGS A;  2DMU A;  2QUF A;  3LSM A;  3BR2 A;  2OA4 A;  2O5R A;  2HXI A;  3L1P A;  4IRG A;  2B9S A;  3M8F A;  4DJA A;  1A31 A;  5HSZ A;  4XID A;  3CCU I;  3SDG A;  1HKT A;  4XRS A;  2PI0 A;  4BEH B;  3EGQ A;  3F0C A;  4M3D A;  1ZKG A;  3WGI A;  2MBF A;  2QZ8 A;  2ZFW A;  3K1N A;  2I8D A;  1YOV B;  2LRE A;  1W5C C;  3PAS A;  5D18 A;  1MMA A;  4D5C A;  2OI8 A;  3BG7 A;  3KX2 A;  1QA6 A;  3LAP A;  5IT9 K;  4EMS A;  3F9K A;  3QAH A;  1NG7 A;  4LOC A;  1Z91 A;  3UKG A;  3HOS A;  3RQI A;  5DDG A;  4H0E A;  3DLA A;  2QQ9 A;  3BQY A;  2AS5 F;  3ESW B;  4WCG A;  2Z16 A;  1DUX C;  3AL0 C;  3BLY A;  3KEO A;  5D4S A;  4V19 K;  4LIV A;  2PN6 A;  1KQ0 A;  3H92 A;  5CVR A;  2ESN A;  2XRO A;  1A04 A;  1R23 A;  2CSO A;  3BZK A;  3IUO A;  3BZ6 A;  3CO7 C;  3CWR A;  3LJL A;  1HKQ A;  1MNM C;  2KHM A;  2CUF A;  3F8C A;  1WCM J;  1GT0 C;  3QU3 A;  4JOM A;  4HA8 A;  2XPV A;  4EJU A;  3NPI A;  2QQA A;  1A6Q A;  3LFU A;  5J40 A;  2QEX I;  1Z05 A;  4YIF A;  3AG3 H;  4LLL A;  2KJB A;  1DGW Y;  4XLE A;  2F5V A;  4AWX B;  3MWM A;  4N9I A;  5DM6 F;  3EYY A;  4ENJ A;  3OSG A;  4IHX A;  3EUP A;  2R7U A;  2JPC A;  1PP8 F;  4L0Y B;  2V1D A;  3O3K A;  5FFZ A;  2VT2 A;  1RET A;  1XGS A;  3PNV A;  2HYJ A;  2E2J J;  4X6A J;  5IOZ A;  3IV5 A;  2BHY A;  2E36 A;  3BG3 A;  1OYW A;  3ZQI A;  2LKP A;  3CQZ J;  3ZN0 A;  3FXM A;  1B59 A;  2JZY A;  1B8I A;  2ZCX A;  2ZCW A;  3FXJ A;  3T8T A;  3WU1 B;  1IG7 A;  1UHS A;  4G94 A;  3V8K A;  1GVD A;  3S3O A;  3JSJ A;  1ZQ3 P;  4A2U A;  2CQ7 A;  4Q4Z F;  1D3Y A;  4D5F A;  5GAG J;  2OTL I;  4NNJ A;  3F22 A;  1EF4 A;  1YQA A;  3KE2 A;  3WG9 A;  4B47 A;  3VVY A;  2PBI A;  4F3Q A;  1XTA A;  1W0T A;  5DCM B;  1O7F A;  3BTI A;  3SQN A;  5GAE J;  3S14 J;  2XKP A;  2D1H A;  3HKZ N;  4CHU A;  2ELK A;  1XD7 A;  3GME A;  4G7Z F;  5CXG A;  2OJE D;  1Y39 A;  2CQN A;  3H5A A;  3GXO A;  1OCT C;  3RDI A;  4U9L A;  4PJ0 C;  1ZG1 A;  4JKZ A;  3ZOB A;  1O3S A;  4MEY F;  3DP7 A;  1Z7U A;  2REK A;  1NTC A;  4BY1 J;  2FNP A;  2UV1 A;  3ZMU A;  5J6X A;  2NYX A;  4XNF A;  4A3K J;  1RC9 A;  4BQA A;  2BYV E;  1R58 A;  2L9V A;  1ETQ A;  4LMY A;  3MCZ A;  4XOR A;  1YJ9 I;  3W2A A;  4KN7 X;  1ZHF A;  3GZI A;  2ZNZ A;  5HDG A;  4RGX A;  1RUO A;  2HQN A;  2DO7 A;  2RGV A;  2ZXH A;  3DCF A;  3HHG A;  3NS4 A;  4GO1 A;  1ZEL A;  3CC4 I;  3BJO A;  4A3M J;  3CCQ I;  1TT5 B;  5CVV A;  4U7B A;  4XR6 A;  2F4I A;  1TW3 A;  3FHN A;  1X58 A;  5FD5 A;  2QEN A;  2M0M A;  3COA C;  1ORK A;  2A6E F;  1FMW A;  5HDK A;  1IN8 A;  2Y2Z A;  3MQ0 A;  2K86 A;  1KON A;  2H94 A;  2M8E A;  3I59 B;  5LHG A;  5BOX A;  1WJB A;  2DDA A;  1FOY A;  2ISZ A;  4QWQ A;  3IKV A;  1IN4 A;  1X19 A;  2L7K A;  1JGG A;  2ZFU A;  3I9V 2;  1MIJ A;  3VW0 A;  1V5G A;  2FQ3 A;  1JE8 A;  1GLN A;  2DMN A;  3GFL A;  3B73 A;  3OV8 A;  2KLO A;  2DA7 A;  2FBI A;  1QO0 D;  4ZC3 A;  5LEJ A;  2L2O A;  4I0A A;  2NVQ J;  2GXB A;  3COL A;  3OYL A;  1OYY A;  3CLQ A;  4MIM A;  1OCC H;  4B8X A;  3G1O A;  2VKH A;  2HDC A;  5CXI A;  3VFZ A;  1PUF A;  1ZGJ A;  1FP2 A;  4HV6 A;  1KZH A;  3KZ9 A;  2CMP A;  3PIO F;  3E5X A;  1LVA A;  3DTI A;  3KYL A;  4KFC A;  1T08 B;  3E5U A;  2NVY J;  1MH4 A;  5TJJ A;  2JPB A;  3LSK A;  4A69 C;  4WX9 A;  2WAE A;  1AHD P;  2E1N A;  2F2E A;  4HLY A;  3IWF A;  1MND A;  4KDP A;  5CLS A;  2V9P A;  5CVU A;  3K4M A;  2YX4 A;  2F4O B;  2ZO4 A;  5FRO A;  3L09 A;  3S32 A;  1KYZ A;  1T98 A;  2EIM H;  2E34 A;  1VND A;  2HQR A;  2KZV A;  4OIR F;  4DZJ A;  3QU6 A;  1N78 A;  3CJR B;  2DXI A;  3BZC A;  1VQN I;  2RQP A;  2NP3 A;  2UXI A;  1R6R A;  5IYB J;  5E79 C;  2M0C A;  3G1M A;  5HLT A;  3JRA A;  5D5U B;  3REO A;  2ZXJ A;  1OCZ H;  3SFZ A;  2KKO A;  2DPD A;  2PEX A;  2RQQ A;  2BW3 A;  5F0F A;  5BNG A;  4A3B J;  3K0L A;  5K7F A;  3LA2 A;  1U2W A;  1SFO J;  3U21 A;  4O6J A;  2DOF A;  1P2F A;  1YTY A;  2K7L A;  2MD0 A;  1V5F A;  4HPQ A;  3SEZ A;  3IH4 A;  3QWL A;  3R60 A;  5IP6 A;  5LBQ A;  2JVG A;  3JCU C;  3GF2 A;  2XAF A;  3T1B A;  3VP5 A;  4HBL A;  2UXN A;  2Y0M A;  2F5F A;  1IRX A;  1MJ9 A;  2BE5 F;  4IOA F;  1YW7 A;  2VJ5 A;  2X85 A;  2JN6 A;  3C7J A;  4P1W A;  1X1D A;  2ELJ A;  1T95 A;  5EJC A;  1OPC A;  3MKY B;  2F5C A;  1I3A A;  4RB3 C;  3OS2 A;  1ZG5 A;  3NNR A;  4AID A;  4CXF A;  2VAS A;  2FA5 A;  2FBH A;  3QPL A;  4KMU X;  1SAU A;  5LD2 C;  4OWR B;  2QBY A;  2J5O A;  2HOE A;  1JHH A;  5ILU A;  5DUK A;  3HB9 A;  2Q1Z B;  1Y1V J;  3SZP A;  2GM4 A;  5B5E C;  3F1B A;  1FOX A;  1K83 J;  4ZTF A;  1EH6 A;  3GLX A;  3OWT A;  2ZSI B;  4O3M A;  4Z2Y A;  4AM3 A;  4UY8 I;  3PUB A;  4U0V A;  4Z6Y A;  1MBJ A;  1LEB A;  5D6F A;  3JTG A;  5FLX Z;  1R49 A;  4BGD A;  3DU6 A;  3HSE A;  1BR2 A;  3BG9 A;  2KZG A;  2W24 A;  4L9V A;  5DYM A;  1YW8 A;  3OIQ A;  3L2V A;  4KIT B;  2M9H A;  1X2N A;  3F8B A;  2LC2 A;  1IGN A;  3LAJ A;  2GWR A;  4N0B A;  2OAZ A;  3L7W A;  1Z1D A;  4I7H A;  4ACI A;  2L02 A;  4G9Y A;  3FK7 A;  2L9S A;  3G73 A;  2B3W A;  2BBY A;  2PG4 A;  5DCF A;  3NRV A;  4FHT A;  4E4H A;  2E2I J;  1ACI A;  2G3B A;  2A05 A;  2NOJ B;  1QHG A;  3CTA A;  1HDP A;  3V6G A;  1B8I B;  2CQK A;  3BP8 A;  2XSD C;  4L62 A;  2MG4 A;  4HRI A;  2FML A;  3N97 A;  3ZR8 X;  3S15 J;  1U5T C;  1P7I A;  3DPJ A;  1VF9 A;  1BIA A;  1VQO I;  5B1A H;  1CF7 B;  3OS1 A;  3EUK L;  2GQQ A;  2ZJR F;  1EV7 A;  2RNJ A;  5ICC A;  2RC4 A;  1ODD A;  1JXS A;  4KN4 X;  5E3O A;  4ENN A;  3V7S A;  1QGP A;  1T39 A;  3QBM A;  4DW6 A;  2HI3 A;  3MZ8 A;  4CCO A;  3WU0 A;  3GCM A;  4E6K G;  4GFB A;  1FX7 A;  4BHB A;  2ZB9 A;  2UXO A;  3EUH C;  4RB0 A;  5C3E J;  1I6X A;  1YW9 A;  2A61 A;  4OOI A;  4W97 A;  1H8A C;  3CC2 I;  1MMN A;  2BEO A;  2L5Q A;  3BT9 A;  2FD5 A;  4II3 A;  2RV8 A;  5LGT A;  1FBQ A;  2PFV A;  2QF7 A;  3H3V K;  2XVC A;  1MBF A;  1Y6I A;  3I4M J;  3HKZ A;  3Q0V A;  2O3F A;  3BC8 A;  4BAC A;  1W7P B;  5IY5 H;  3L2W A;  3BR5 A;  4BE2 A;  1BL0 A;  1VQ7 I;  4CZZ A;  2X1E A;  3ZQ7 A;  2JA2 A;  3CUQ A;  1S7E A;  1XCB A;  1YI2 I;  3N4M A;  1J59 A;  4B4C A;  2E35 A;  3E6M A;  3PSF A;  4Y13 A;  5H20 A;  5C4X J;  1XSD A;  4MFD A;  1MBE A;  2WWY A;  2LD5 A;  4OD4 A;  3VYS B;  4BJT A;  1TQI A;  4M6Y A;  2ECC A;  3VEP A;  3LSP A;  3K70 D;  3GTO J;  5JHF A;  1WJF A;  3N05 A;  3LST A;  2HPI A;  1YIT I;  2CS3 A;  2FF4 A;  1LFP A;  1Z0X A;  3HTJ A;  2VUM J;  1ZLJ A;  2KT0 A;  2L4A A;  2YU3 A;  4A3I J;  1R5I D;  2QYO A;  4A3D J;  1JT6 A;  1GUU A;  1Q1V A;  3KP4 A;  2PMZ N;  4A5M A;  4DYQ A;  3H35 A;  4BHC A;  5GAD J;  1G3S A;  5TGT A;  3JSO A;  3ECO A;  3P9K A;  1T56 A;  1W4M A;  1A6I A;  4PDK A;  2DOA A;  1K79 A;  3G6E I;  2XDN A;  2VQG A;  3K2A A;  4RGR A;  4CCK A;  3BRU A;  2H6C A;  3DBL B;  3F6O A;  4A3J J;  2QM3 A;  2IGM A;  2DOD A;  4RAY A;  4BKX A;  3ZRG A;  1VQ8 I;  5JVG F;  5D5W B;  2K02 A;  2GLO A;  4KNY A;  3DBR B;  4NQW B;  2CO5 A;  1ZR4 A;  2P5L C;  2QCO A;  3P5J A;  2IU5 A;  3HRU A;  2LVS A;  1QRY A;  5FFX A;  2O0Y A;  4S04 A;  1ZGA A;  2FU4 A;  3J7A Y;  2CW7 A;  3CRJ A;  1KU2 A;  3BQZ A;  1O3Q A;  1QZZ A;  1YX3 A;  3KZI C;  4M6X A;  1H9G A;  2JA8 J;  5TIS C;  3I54 A;  2H27 A;  1ONV A;  1MGT A;  4L5J A;  4RM2 A;  1ZRD A;  1FY7 A;  4ABZ A;  3PUF A;  1GVJ A;  3O60 A;  3K7A J;  2XGX A;  2FJ1 A;  5JI6 A;  2HS5 A;  1T0F C;  5E8I A;  3S93 A;  1VZ0 A;  3S1N J;  3IRR A;  4MLO A;  5E8G A;  1GHC A;  3MD2 A;  4IOC F;  2JT1 A;  3ERM A;  4P9F A;  4Y52 J;  2NS0 A;  3QPS A;  4HDV A;  4HSR A;  1UFM A;  2V4J C;  2E19 A;  3ZPL A;  1D1A A;  5F04 A;  1RIO H;  1ZAR A;  2IVM A;  4KUM A;  1RUN A;  4Q47 A;  2QGU A;  1FIA A;  3HIM A;  4L9T A;  3LWJ A;  3BCA A;  3ON4 A;  2LR8 A;  3PQJ A;  1LFU P;  2AQF A;  2F5E A;  2NVU B;  3SYT A;  3ABL H;  4B1R A;  1E17 A;  3LOC A;  1OR7 C;  2GBY A;  2VB6 A;  1VQ5 I;  3ABU A;  1TNS A;  2QTQ A;  1F36 A;  1XGO A;  1T38 A;  1MJB A;  3ZMV A;  2QVO A;  3FMQ A;  2HOT A;  2Q2E A;  3GVA A;  1SC7 A;  2C6Y A;  5AIQ A;  3FHZ A;  3RD3 A;  3Q3S A;  1YLF A;  2ACJ A;  1W36 D;  4ICH A;  5JFR A;  1M1E B;  1QPM A;  1XC5 A;  1SVL A;  1YO5 C;  1NK2 P;  2BOL A;  5J1R A;  3U9G A;  4CYD A;  2RAE A;  4WK8 F;  1KU3 A;  5FLV A;  2EZH A;  4A3C J;  2WY7 Q;  4IHV A;  4RLF A;  3A2K A;  4PJN A;  4A93 J;  3RCO A;  1MBG A;  2MAB A;  5ICE A;  3C2G A;  5LHI A;  4FAS D;  3VPR A;  4RB2 C;  4BQO A;  2XB0 X;  4D9J A;  1R22 A;  3GTK J;  2G7H A;  2K5C A;  5IPA A;  4RM3 A;  1JUP A;  1MBH A;  2IA0 A;  4LD5 A;  4P5O A;  1EKE A;  3K69 A;  4NC8 A;  4LG0 B;  1OJL A;  4XLA A;  1MSF C;  2XAJ A;  2LFB A;  1PJR A;  2P4W A;  1KYW A;  1YS6 A;  2DTR A;  4PFO A;  1A35 A;  3TED A;  3BPX A;  1R5G A;  3K70 C;  3PFI A;  3OYK A;  2GZW A;  3ASN H;  4A0X A;  2CV2 A;  2I5U A;  3V7R A;  2FBK A;  2MD5 A;  3L2Q A;  3FIW A;  3CCV I;  2LBF B;  1EJ9 A;  4RGU A;  2YUS A;  5FRN A;  5EFY A;  3BJ6 A;  1G6N A;  2KJC A;  3PNY A;  2LK2 A;  4HG2 A;  2W00 A;  1HST A;  2P7V B;  4I99 C;  3H36 A;  2VLA A;  2R7R A;  2X6Y A;  2ETH A;  4LFU A;  4LB6 B;  1BC8 C;  2XUB A;  3OYJ A;  1ETV A;  2FMY A;  1WI3 A;  3FKI J;  4NC6 A;  3LHQ A;  4EJO A;  1SMY F;  4CCN A;  2LY2 A;  2IGK A;  5BPI A;  4EJV A;  3TMO A;  2W1O A;  1IZ1 A;  2D5V A;  3OIP A;  1R1U A;  2DK5 A;  3KYD B;  1HSJ A;  1OKR A;  3E6C C;  1UB9 A;  4AIH A;  2KPM A;  4EV0 A;  2L54 A;  2LMD A;  4HF0 A;  4CYC B;  5KHD A;  2EIK H;  2KDZ A;  1SFE A;  3IUV A;  1QQI A;  5J4Y A;  1EH7 A;  2EFO A;  2XC7 A;  5FLX K;  3GTQ J;  5J8C A;  3SFI A;  2JUG A;  3V42 A;  2KQR A;  3HUG B;  3W6V A;  3V4G A;  2IW5 A;  3HTU A;  3FXQ A;  2OQR A;  3WTZ A;  3GW2 A;  3KEQ A;  1UJ8 A;  3VYT B;  2EH3 A;  2G7S A;  4H4K C;  3ZQF A;  4Y3O A;  4LIU A;  3ZN1 A;  2QKL B;  4UUS A;  1XG1 A;  2DU9 A;  1SFK A;  2P6S A;  2XPU A;  1F5T A;  2DA3 A;  1B4A A;  2UUZ A;  3IH2 A;  3KP3 A;  2AXL A;  2YU9 J;  2VOD A;  3J7A O;  1I50 J;  3M07 A;  4A6E A;  4PJM A;  3BCG A;  3HBL A;  2O8K A;  3TO9 A;  2JQ7 A;  1FYM A;  4JX4 A;  3SDB A;  1J2X A;  4IO9 F;  1BW5 A;  3H3Z A;  1D0Z A;  4BBR J;  1WJD A;  3M8E A;  4HST A;  3KP5 A;  2R92 J;  1DP7 P;  6PAX A;  5B3S H;  2QA4 I;  1TTY A;  2M87 A;  4P55 A;  1EA3 A;  1XMA A;  2DA1 A;  2XRL A;  2DPU A;  3BDD A;  2K4J A;  3IAM 2;  3KET A;  5E20 A;  3K4L A;  4BS9 A;  4AF5 A;  1ZGW A;  5FB2 A;  3Q0U A;  4BUP A;  4UDS A;  1MW7 A;  4CYC A;  3DEW A;  2DA6 A;  3OYB A;  2R7V A;  1UG2 A;  1Y1W J;  2YX7 A;  4EEF G;  2IT0 A;  3QYE A;  1BI3 A;  3WTU C;  3WTX C;  1YX5 A;  1E3P A;  3K4K A;  4HDU A;  1TC3 C;  1HW1 A;  3A4C A;  1ZRF A;  2VXZ A;  2FE3 A;  2DK8 A;  2TCT A;  4F92 B;  2XKO A;  3LA3 A;  5KCM A;  3LSI A;  1FZP B;  1FP1 D;  1S29 A;  4HX8 A;  3W6K B;  2XSJ C;  3DWL E;  4UVA A;  3VOX A;  3OIO A;  1RZ4 A;  1Z7L A;  1ZN2 A;  4JNN A;  1SVM A;  4MGR A;  4RAF A;  1E3O C;  3CDH A;  4UB6 C;  2AXT C;  3WTT C;  4CCL A;  3MMY B;  2A69 F;  3BJA A;  1ZR2 A;  2VOO A;  2XAQ A;  3DLL F;  5K5Q A;  2O61 A;  5K7Z A;  4IEJ A;  3LWF A;  2NXN B;  1G2H A;  5B1B H;  3ZP5 A;  4IRI A;  1IRZ A;  1V54 H;  4ZZL A;  4HEA 2;  2LF7 A;  1DP3 A;  4DGW B;  1ON2 A;  1G8X A;  4BE1 A;  4KIC A;  2CJJ A;  1Y8R B;  2YR2 A;  2ZC2 A;  2CW0 F;  5H9T A;  1L3L A;  4JBA A;  2G9W A;  4XLH A;  4D0P A;  4OU0 A;  3AG2 H;  3EUA A;  2HNH A;  2HU9 A;  2HPM A;  2B0L A;  1X1B A;  3PM1 A;  4XLP F;  1ETW A;  2JVH A;  4I6Z A;  1JKP C;  2MYS A;  1XB4 A;  2L9R A;  4IL6 C;  2ZXI A;  1X1P A;  4M3B A;  4B44 A; 
#chains in the Genus database with same CATH homology
 4D7M A;  1SFO J;  1U78 A;  3S2D J;  2HQ5 A;  2XGE A;  5EZH A;  2OF7 A;  5HOD A;  2TRT A;  5EZG A;  2R93 J;  3IH4 A;  1GDT A;  5IP6 A;  1I3Q J;  2CU7 A;  2R0Q C;  2UXH A;  2LTP A;  1SAN A;  3VP5 A;  3MKL A;  2JA5 J;  5FLM J;  3BG5 A;  2NVX J;  4V2F A;  2CRG A;  2JN6 A;  5IP7 J;  3LSG A;  2R7Z J;  2ZOY A;  3HOV J;  3BR1 A;  3BJB A;  2E2H J;  4JX5 A;  1PUF B;  3O8G A;  4A3E J;  3JRE A;  5K58 A;  3NRG A;  3MNL A;  2R5Z B;  3NNR A;  2M8G X;  1B72 B;  3QPL A;  4YZE A;  1IDY A;  2ME6 A;  3JR9 A;  1FEX A;  2HXO A;  2QOP A;  3HB9 A;  2L0K A;  3HOY J;  4GCK A;  1Y1V J;  2GM4 A;  2ID3 A;  1FTT A;  3F1B A;  3LSR A;  5F08 A;  4IHW A;  4AC6 A;  2YS9 A;  5IYC J;  1K83 J;  3S17 J;  1RKW A;  2CQX A;  1OCP A;  2PZ9 A;  2G0E A;  2NP5 A;  5FKN A;  1LE8 B;  4HKU A;  4B3A A;  5FKM A;  2NS7 A;  1BJZ A;  1MBJ A;  2R5Z A;  1I6H J;  1VFC A;  2JJ7 A;  2FX0 A;  3B6C A;  3TP3 A;  3B81 A;  3RH2 A;  4RBO A;  3S1Q J;  3BG9 A;  4GCT A;  2UXU A;  5AQC A;  3E7Q A;  3BHQ A;  2M9H A;  1X2N A;  2GUH A;  2ZOZ A;  1IGN A;  3A02 A;  2JWT A;  4Y7N J;  4GFL A;  1TWF J;  3CJD A;  4S0H B;  3VW2 A;  2NS8 A;  4FTH A;  4ACI A;  4V2G A;  3FK7 A;  4M6V A;  3P9T A;  5M5Y J;  4FIS A;  2GFN A;  1H89 C;  2JA7 J;  2E2I J;  2G3B A;  1TWG J;  1X2M A;  2K9S A;  3A03 A;  3MN2 A;  4I76 A;  3OSF A;  3HDD A;  1IC8 A;  1ITY A;  4NN1 A;  3HTH A;  1NK3 P;  3ANG A;  1HDP A;  3GBG A;  3V6G A;  1Z77 A;  1B8I B;  1UI5 A;  1QVT A;  2XSD C;  1HF0 A;  2ME0 A;  4L62 A;  2MG4 A;  4X1E A;  3HM5 A;  1VI0 A;  4XIC A;  2O7T A;  2ZCM A;  1SGM A;  3S15 J;  1YRN A;  1IV6 A;  2DA2 A;  1P7I A;  3DPJ A;  3BR0 A;  1VF9 A;  5K7H A;  4QTR A;  1JKO C;  4XK4 A;  2WUI A;  3FRQ A;  1JTX A;  5EG0 B;  5M3F J;  5D1R A;  2EZK A;  1GV2 A;  1WPK A;  4MXM A;  5J3L A;  2GEN A;  1IUF A;  1POG A;  2RHA A;  5E3N A;  2JMW A;  5E3O A;  2EZL A;  2CQQ A;  5EDN A;  3NAR A;  2D6Y A;  4A3L J;  3QBM A;  1R9T J;  4DW6 A;  3JRF A;  2HI3 A;  3B6A A;  3G1L A;  4GFB A;  3VOK A;  2LP0 A;  2ZB9 A;  5EF6 A;  2UXO A;  5F0C A;  3BTL A;  2X9D A;  5JLX A;  5C3E J;  4W97 A;  1H8A C;  3S2H J;  3GTG J;  3ON2 A;  3BT9 A;  2FD5 A;  3LSJ A;  2QF7 A;  3H3V K;  2CUE A;  1MBF A;  3I4M J;  5FMP A;  3Q0V A;  1BW6 A;  3BR5 A;  3JRC A;  1JTY A;  1BL0 A;  3PO3 J;  1S7E A;  1OFC X;  2L7M P;  5DTD A;  2EQR A;  2XGD A;  4B4C A;  2H8R A;  5IYD J;  1F43 A;  4DYR A;  2O9L A;  1XS9 A;  2X48 A;  5C4X J;  5IP9 J;  1H88 C;  4MFD A;  1MBE A;  2NX4 A;  2LD5 A;  4W1U A;  2DG8 A;  3LSP A;  2ECC A;  2Y31 A;  4BXX J;  3GTO J;  2M34 A;  4QSH A;  5IOY A;  1AKH A;  1AKH B;  2IAI A;  2OER A;  1Z0X A;  3HTJ A;  5F27 A;  1JUM A;  2YVH A;  2VUM J;  5C4J J;  2KT0 A;  4A3I J;  5GPC A;  3BR3 A;  4A3D J;  1JT6 A;  2EZI A;  1JKQ C;  3C2B A;  1DU6 A;  1GUU A;  3ZQH A;  3HOZ J;  1Q1V A;  3VIB A;  2UXP A;  2PMZ N;  3IH3 A;  4DYQ A;  2PBX A;  3OOU A;  3ANP A;  5D19 A;  2EBI A;  2DMP A;  2K40 A;  1T56 A;  1A6I A;  2MGQ A;  2XDN A;  5J1Y A;  3K2A A;  2DN0 A;  5M3M J;  1MH3 A;  3S1M J;  3BRU A;  3T6N A;  4A3J J;  2VPR A;  3ZQG A;  5FJ8 J;  2N8G A;  2M2E A;  4BKX A;  1WH5 A;  2HDD A;  1IDZ A;  3JRB A;  4C2M J;  2B63 J;  3A01 A;  3BR6 A;  1RR7 A;  2GLO A;  2E1O A;  3BTC A;  2QWT A;  2OPT A;  1ZR4 A;  4AC0 A;  2QCO A;  5EYR A;  2IU5 A;  2DJN A;  2LVS A;  2XGC A;  1QRY A;  2AHQ A;  4FE4 A;  3SJM A;  5DS9 A;  2WAQ N;  3A01 B;  1IJW C;  3CRJ A;  3BQZ A;  2ECB A;  1U9O A;  4GCL A;  4BBS J;  2JA8 J;  3I4N J;  1HOM A;  3RZO J;  4RDU A;  4ABZ A;  3O60 A;  4MFE A;  3RKQ A;  2DG7 A;  3K7A J;  5F1J A;  2FJ1 A;  5HAW A;  1UMQ A;  4KWA A;  5E3M A;  5C44 J;  1BA5 A;  2HKU A;  3BTJ A;  4JX6 A;  3HOW J;  1HCR A;  2QIB A;  1WGX A;  2DA4 A;  3S1N J;  1QVU A;  4MLO A;  1JUS A;  3O8H A;  3CMY A;  2HOA A;  3ZQL A;  1HDD C;  2FQ4 A;  2HOS A;  4XRM A;  5M5X J;  4JP0 A;  4J19 A;  5JLW A;  4Y52 J;  3KKD A;  5E3L A;  3QPS A;  3M3Y J;  4M3G A;  4C3I J;  3G7R A;  2E19 A;  2WGB A;  1ETY A;  4C3H J;  5EEA A;  5F04 A;  1AU7 A;  1FTZ A;  1P7J A;  4IHY A;  3HEF A;  1FIA A;  4L5E A;  3HIM A;  3GTL J;  1K61 A;  1APL C;  3LWJ A;  3ON4 A;  2LR8 A;  2XPW A;  1LFU P;  2MSY A;  1B72 A;  4B1R A;  1ZK8 A;  5EGO B;  3LOC A;  2NVT J;  2GBY A;  3FIS A;  2QKO A;  2QTQ A;  1F36 A;  3C07 A;  1FJL A;  1LE8 A;  3NI7 A;  2R5Y A;  2HOT A;  3HTI A;  3NXC A;  2DMU A;  3D1N I;  2MW8 A;  3RD3 A;  3BR2 A;  3Q3S A;  4UUT A;  3L1P A;  2HXI A;  1QPI A;  4ICH A;  4XRS G;  2JK3 A;  3H0G J;  1XC5 A;  5J1U A;  1NK2 P;  2ZCN A;  5HBU A;  5HSZ A;  5J1R A;  4XID A;  1GV5 A;  2RAE A;  3SDG A;  2Q24 A;  4XRS A;  3EGQ A;  5FLV A;  3F0C A;  2EZH A;  5GPA A;  2DA5 A;  1ZKG A;  4M3D A;  3FK6 A;  4A3C J;  4IHV A;  9ANT A;  4ME9 A;  1MSE C;  4A93 J;  2K9N A;  2X6O A;  3PAS A;  3PPB A;  1MBG A;  4D5C A;  1RKT A;  2I10 A;  2WB1 N;  2OI8 A;  3VPR A;  2XB0 X;  3GTK J;  2L7F P;  4FE7 A;  4LOC A;  5FGL A;  5IPA A;  3UKG A;  3RQI A;  3JRI A;  1JUP A;  4FCY A;  4MO7 A;  3GTJ J;  1MBH A;  3RZD J;  3BQY A;  4CGR A;  1JKR C;  2DMT A;  3HGY A;  1OJL A;  1CQT A;  1MSF C;  2Y9Z A;  4A3G J;  2LFB A;  5GP9 A;  5FKO A;  5FHP A;  3CWR A;  3LJL A;  3TED A;  1U8B A;  1MNM C;  2CUF A;  1WCM J;  1GT0 C;  2W53 A;  5EGO A;  3HOU J;  4AUX A;  1HLV A;  2XPV A;  3QKX A;  3VUQ A;  3FIW A;  3NPI A;  2YUS A;  3WHB A;  3GTM J;  5EFY A;  3PO2 J;  1W0U A;  4JL3 A;  2LK2 A;  2H1K A;  2W48 A;  5EG0 A;  3OSG A;  4M3E A;  4IHX A;  3S16 J;  3EUP A;  4DZP A;  3CDL A;  2VKE A;  2Y30 A;  3TP0 A;  1RET A;  1ETV A;  2K9Q A;  1ETO A;  2HYJ A;  3TW6 A;  2L7Z A;  2E2J J;  4X6A J;  1WI3 A;  3FKI J;  5IOZ A;  3IV5 A;  3LHQ A;  1MBK A;  3HTA A;  3BG3 A;  3ZQI A;  5D18 A;  3CQZ J;  1B8I A;  2ZCX A;  3Q0W A;  1U9N A;  1IG7 A;  1UHS A;  4C3J J;  1T33 A;  1GVD A;  3JSJ A;  4PXI A;  1ZQ3 P;  2Y9Y A;  4QIW N;  2D5V A;  2FBQ A;  4D5F A;  1EF4 A;  3VVY A;  3JRG A;  3S5R A;  2LKX A;  2VKV A;  2VI6 A;  4CYC B;  1W0T A;  3AQS A;  3GEU A;  3KNW A;  2DMQ A;  2KDZ A;  3BTI A;  3S14 J;  3IUV A;  3HKZ N;  1YRN B;  4M3F A;  2ELK A;  2O7O A;  5C4Y A;  3WHC A;  3VVZ A;  3ZQC A;  5CXG A;  3GTQ J;  4G12 A;  3SFI A;  1OCT C;  3W6V A;  4JKZ A;  3ZOB A;  1JT0 A;  1WH7 A;  3HOX J;  2REK A;  3BNI A;  1NTC A;  4BY1 J;  3NAU A;  4A3K J;  3S1R J;  1ETQ A;  1DU0 A;  3VVX A;  2EH3 A;  2G7S A;  3ZQF A;  2ID6 A;  3GZI A;  4UUS A;  1XG1 A;  2COB A;  2XPU A;  3M4O J;  4JYK A;  2DA3 A;  4GFK A;  3IH2 A;  2IEK A;  2YU9 J;  3DCF A;  1I50 J;  5M5W J;  3BCG A;  3HBL A;  3HGG A;  2O8K A;  2G7G A;  3LNQ A;  4NDL A;  2LLK A;  4JX4 A;  4A3M J;  3VW1 A;  1BW5 A;  4UUS B;  1UI6 A;  4BBR J;  3GTP J;  2RAS A;  1X58 A;  1ZTR A;  3CCY A;  2R92 J;  4HNV A;  2F07 A;  1ORK A;  2DA1 A;  2XRL A;  2Y2Z A;  2AO9 A;  5F0H A;  2NOG A;  2HYT A;  4AF5 A;  3MVP A;  1RPW A;  3Q0U A;  1ZGW A;  4NEL A;  5FKK A;  3HE0 A;  4UDS A;  4CYC A;  1JJ6 C;  3DEW A;  1TWA J;  2DA6 A;  1JGG A;  1TWH J;  1UG2 A;  2XB5 A;  1Y1W J;  4EEF G;  3VW0 A;  3TW7 A;  4DYC A;  1JJ8 C;  2DMN A;  1ETK A;  1TC3 C;  2DA7 A;  1FIP A;  3JRD A;  4BY7 J;  2NVQ J;  3QQA A;  2TCT A;  4D7N A;  3COL A;  2LY9 A;  2JA6 J;  4MIM A;  4MK6 A;  2DTZ A;  2YVE A;  3G1O A;  1ENH A;  5CXI A;  3VOX A;  3OIO A;  1PUF A;  3KZ9 A;  4JNN A;  1TWC J;  1RES A;  2NVY J;  1E3O C;  1D5Y A;  3KKC A;  1MH4 A;  4A69 C;  1AHD P;  4A3F J;  2WV1 A;  3E7L A;  1ETX A;  2R5Y B;  1ZR2 A;  5DAJ A;  4AYB N;  1LFB A;  5K7Z A;  1O4X A;  4IEJ A;  3AQT A;  5FKL A;  1G2H A;  1IRZ A;  2IBD A;  1VND A;  2V57 A;  4DZJ A;  1A5J A;  2CJJ A;  5H9T A;  2NP3 A;  3V78 A;  2UXI A;  5IYB J;  2M0C A;  3G1M A;  3G56 A;  3JRH A;  3JRA A;  3PM1 A;  2Y0S N;  1ETW A;  1JKP C;  4I6Z A;  2P81 A;  5F0F A;  5BNG A;  4A3B J;  2L9R A;  5K7F A;  4M3B A;  5CW8 A;  2G7L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...