4M3GA

Rapid and efficient design of new inhibitors of mycobacterium tuberculosis transcriptional repressor ethr using fragment growing, merging and linking approaches
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
193
structure length
191
Chain Sequence
GDDRELAILATAENLLEDRPLADISVDDLAKGAGISRPTFYFYFPSKEAVLLTLLDRVVNQADMALQTLAENPTDRENMWRTGINVFFETFGSHKAVTRAGQAARATSVEVAELWSTFMQKWIAYTAAVIDAERDRGAAPRTLPAHELATALNLMNERTLFASFAGEQPSVPEARVLDTLVHIWVTSIYGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator EthR
publication title Ligand Efficiency Driven Design of New Inhibitors of Mycobacterium tuberculosis Transcriptional Repressor EthR Using Fragment Growing, Merging, and Linking Approaches.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription repressor/inhibitor
total genus 80
structure length 191
sequence length 193
ec nomenclature
pdb deposition date 2013-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4m3gA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 4m3gA02
1BL0A 5FGLA 3OOUA 3DCFA 3HTIA 2FD5A 2UXUA 4FISA 1QVTA 3BR1A 5C44J 3JRCA 3O8HA 2HYJA 4B1RA 3JRAA 4JL3A 2UXOA 3BQZA 1D5YA 1U9NA 4JP0A 5F0HA 4AC6A 3VP5A 2XB5A 3FISA 4MLOA 2MG4A 1FTTA 1X2NA 4EEFG 5EZHA 3D1NI 2XDNA 5EYRA 4B4CA 2ZOZA 3LSPA 3CWRA 3ZQHA 2DA1A 1SANA 2LY9A 2XB0X 4MO7A 3ZQFA 4J19A 3VVXA 5EG0A 1R9TJ 1TWHJ 2G7SA 3GTGJ 4UDSA 2HOAA 1MSEC 2UXIA 1PUFB 1AHDP 2EZIA 4ICHA 2YVHA 5GPCA 1BW6A 1IDYA 5C3EJ 3S1QJ 3NAUA 3HKZN 4A3GJ 3KKCA 3BG5A 2O7TA 2K9SA 2GUHA 3HB9A 2L9RA 3PO3J 2CUFA 4XIDA 2GENA 2ID3A 3HEFA 4XRSA 1NTCA 1ZR4A 4JX6A 1FIAA 4JX4A 1W0TA 2HOSA 2ZCMA 3JRHA 2ELKA 4HNVA 1AKHB 4IHYA 3NNRA 4GFLA 5J1YA 3A01B 4I6ZA 3F1BA 2NS8A 3V6GA 3HOVJ 1K83J 4YZEA 3VIBA 2XPVA 2DA3A 3Q0UA 4HKUA 3S17J 1IJWC 2HDDA 2R93J 5HAWA 1RKTA 1XC5A 1U9OA 1MSFC 3HIMA 3RQIA 1BA5A 1ZR2A 3I4MJ 2EZLA 2O8KA 3FIWA 1F43A 2YU9J 3S16J 1JKPC 2ZCXA 5IYCJ 2TCTA 1Z0XA 3CQZJ 2DG8A 4AC0A 4BKXA 2HKUA 1E3OC 4JKZA 3OSFA 3DEWA 5FHPA 4QIWN 2P81A 2K40A 2K9QA 2UXHA 2XPUA 4QSHA 3WHBA 1ITYA 2LKXA 1JUSA 3KZ9A 1IV6A 2R5ZA 4M3FA 3RKQA 5IOZA 1GDTA 1JJ8C 2W53A 5HBUA 1FTZA 1SFOJ 1EF4A 2NX4A 4NN1A 1H88C 3VW1A 1QRYA 5FLMJ 4JX5A 2OF7A 3QPLA 3JREA 3G56A 3QKXA 2LP0A 1I50J 3HOXJ 3FK6A 2QKOA 1FIPA 2NVTJ 3HTHA 2JN6A 2LLKA 2DMNA 2NOGA 4BY7J 3ZQCA 3NI7A 1ETWA 2Y30A 2NVYJ 3COLA 3BNIA 2HI3A 3GTLJ 2O7OA 3BT9A 5D18A 5EDNA 3GTOJ 2ME0A 2X48A 1H89C 5EG0B 2JJ7A 3Q3SA 2ECCA 2H8RA 2DMQA 2CQQA 2HXOA 2LFBA 3MNLA 3V78A 3ZQIA 1JKRC 2IEKA 3JRIA 2PBXA 4IHVA 3SJMA 2M2EA 3ZOBA 5HODA 4A3EJ 1IC8A 2L7FP 2XGCA 2YS9A 1Y1WJ 2NP5A 1OCTC 4UUTA 3RZOJ 3ANPA 5GPAA 1JKOC 2N8GA 3BR3A 1XS9A 1JTYA 2FQ4A 3JSJA 3BTIA 4UUSA 2F07A 4MFDA 1UI5A 3BTLA 1I6HJ 2KT0A 1GV5A 3S15J 1WI3A 1S7EA 4QTRA 5K7FA 1MH4A 3LOCA 3OIOA 4A3IJ 3EUPA 3CCYA 3OSGA 1WGXA 5FKKA 2GLOA 4DYRA 2EZKA 5F1JA 3CMYA 2X6OA 4NDLA 4XRMA 3UKGA 1WCMJ 2DA5A 1I3QJ 5GP9A 3NXCA 5F0FA 4ABZA 3SDGA 1IRZA 1SGMA 1WPKA 3S2DJ 4BBSJ 4C3JJ 3HGYA 2NVQJ 1IGNA 1JUMA 5J1UA 1ZKGA 1IDZA 1UI6A 1ETXA 2HOTA 1NK3P 2E2JJ 3BRUA 2LVSA 3VUQA 3VPRA 3HOWJ 1OJLA 2KDZA 2L7ZA 2JK3A 3O60A 3VW0A 1IG7A 3VOXA 2IU5A 3BJBA 5E3MA 4NELA 3RH2A 4AYBN 2QWTA 2WUIA 2G0EA 3GZIA 1T33A 3A03A 9ANTA 1UG2A 1O4XA 2R5ZB 1TWAJ 5K7ZA 2O9LA 3H3VK 5JLXA 3TP3A 2Q24A 5EGOA 3AQTA 5J1RA 1ETQA 5FJ8J 3CRJA 2YUSA 3WHCA 5IP7J 3HTJA 2DA2A 3IH2A 1TC3C 1OFCX 3HOUJ 5FLVA 2GM4A 2M8GX 1WH7A 1P7JA 4JYKA 5EFYA 1ORKA 3HTAA 3NARA 3JR9A 1MBFA 1T56A 4IEJA 1RESA 1P7IA 3LSRA 4A3MJ 3VW2A 2XRLA 2EBIA 5EZGA 5K7HA 3I4NJ 3FKIJ 5FKLA 3G1MA 1BW5A 2ZCNA 4D7NA 5M5WJ 3JRGA 3HOZJ 4D5CA 5F0CA 1ZGWA 2V57A 1RKWA 2FBQA 1B72A 1ENHA 2XSDC 1GVDA 2M34A 2DA6A 3BHQA 2GFNA 2NS7A 1ETYA 2ECBA 5EF6A 2FX0A 3LHQA 5D1RA 4ME9A 1LFBA 2GBYA 2DJNA 3PO2J 3NRGA 4C3IJ 3ON4A 3BCGA 4FTHA 2HYTA 5JLWA 3GTJJ 3TW6A 3BTJA 5M3MJ 1HOMA 1OCPA 4XICA 1GV2A 4UUSB 2QF7A 1MBHA 1IUFA 3EGQA 4IHWA 2XGEA 3IH3A 5K58A 2L7MP 2Y31A 1G2HA 4M3BA 4CYCA 1ETKA 3BR2A 1LE8A 4A69C 5M3FJ 2K9NA 1AU7A 5CXGA 3GTMJ 3ANGA 2B63J 4GCLA 4FCYA 5DS9A 3BR5A 1JJ6C 1F36A 5H9TA 3JRBA 1ETVA 3P9TA 1FJLA 1WH5A 2VUMJ 2UXPA 4GFKA 2CU7A 2Y2ZA 2E2IJ 3Q0WA 4GCKA 5F08A 3A02A 3O8GA 3PASA 3HE0A 2LK2A 4MIMA 1FEXA 1Q1VA 5IP9J 2RAEA 4M3EA 1DU6A 4W97A 2EQRA 5M5XJ 2EZHA 1ZQ3P 3K7AJ 2H1KA 1VFCA 1B8IA 3S5RA 5EGOB 2I10A 4G12A 3RZDJ 4M3GA 2D5VA 4S0HB 5BNGA 2WV1A 5FKOA 3S1NJ 3TP0A 1MBKA 4BY1J 1YRNA 4BXXJ 4LOCA 3L1PA 2FJ1A 2L0KA 3LWJA 2DA7A 2HXIA 2XGDA 4AF5A 4A93J 4W1UA 3LSGA 1XG1A 5E3LA 1U78A 4A3LJ 3LSJA 5DTDA 1CQTA 3M4OJ 5IOYA 2R5YA 3TEDA 1MBJA 4X6AJ 3K2AA 3SFIA 3C2BA 5C4YA 2LD5A 1QPIA 2WB1N 2DMPA 2LR8A 2NP3A 1B72B 2RHAA 3GEUA 3HM5A 4C3HJ 5FKMA 5E3NA 4B3AA 2VKEA 1HDDC 2WAQN 5IYDJ 1ZK8A 2E19A 4GFBA 2JMWA 5E3OA 4BBRJ 3GBGA 3S14J 3E7QA 5HSZA 1JGGA 3B81A 4C2MJ 2ME6A 4A3DJ 5F04A 2VKVA 1RR7A 4DW6A 4GCTA 3PPBA 2PZ9A 2AO9A 3VOKA 1MBEA 3VVYA 3PM1A 3IH4A 2DMUA 1K61A 2Y9YA 3KKDA 3QBMA 3HBLA 1JTXA 2E1OA 2JA8J 3VVZA 3FRQA 4CYCB 1W0UA 1LE8B 2OI8A 2OERA 3MN2A 4DYCA 3F0CA 3BG9A 4M6VA 2HQ5A 5EEAA 5CXIA 3Q0VA 1A6IA 5IYBJ 2MW8A 3HOYJ 3GTPJ 5CW8A 1VF9A 5FKNA 2OPTA 1BJZA 2CQXA 1DU0A 3BG3A 5AQCA 1JKQC 1HLVA 2R0QC 4A3KJ 2LTPA 4D7MA 2CUEA 1LFUP 2WGBA 3H0GJ 2TRTA 4Y7NJ 1TWFJ 4M3DA 2G7LA 3KNWA 2DMTA 2G3BA 2G7GA 3IV5A 1JUPA 5IP6A 2M9HA 2QIBA 3IUVA 2PMZN 4XRSG 4MFEA 1X2MA 3JRFA 4DZPA 2VI6A 2MGQA 4I76A 3RD3A 1TWCJ 1Z77A 2EH3A 1U8BA 2COBA 3M3YJ 3DPJA 4A3JJ 1QVUA 4A3BJ 4MXMA 1PUFA 2XPWA 3MKLA 3TW7A 4PXIA 3ZQLA 5DAJA 1RPWA 1B8IB 4V2GA 5IPAA 3GTKJ 2DN0A 1JT0A 2ZB9A 2Y0SN 1VNDA 3G1OA 4DYQA 2JA6J 3MVPA 2DA4A 1GT0C 2DTZA 3ZQGA 3BQYA 3G7RA 3NPIA 4A3FJ 4MK6A 3G1LA 5F27A 1UHSA 2CRGA 1RETA 3JRDA 4RDUA 1YRNB 1NK2P 1GUUA 1TWGJ 1AKHA 3A01A 2R7ZJ 3S1MJ 2JWTA 2REKA 4XK4A 3CJDA 4CGRA 4V2FA 3C07A 4X1EA 2RASA 3BR6A 4DZJA 1APLC 4Y52J 2DG7A 1MBGA 2R92J 4JNNA 4A3CJ 3B6AA 3HGGA 2JA7J 2D6YA 2QOPA 2R5YB 1HDPA 2QTQA 4KWAA 2IAIA 5C4XJ 3B6CA 3AQSA 4IHXA 4ACIA 4L62A 5J3LA 3LNQA 3QPSA 4FE7A 1MNMC 1JT6A 4FE4A 2QCOA 4L5EA 4AUXA 1VI0A 2JA5J 3HDDA 5C4JJ 1A5JA 2ID6A 3LJLA 2VPRA 3S1RJ 3BTCA 1POGA 1ETOA 3CDLA 5D19A 2AHQA 3T6NA 2M0CA 3FK7A 5FMPA 3W6VA 3E7LA 4D5FA 1X58A 1H8AC 3ON2A 2W48A 1HF0A 3QQAA 2IBDA 3S2HJ 2CJJA 2MSYA 3BR0A 2Y9ZA 2YVEA 1Y1VJ 2X9DA 1MH3A 2ZOYA 1ZTRA 2E2HJ 1HCRA 5M5YJ 1UMQA 4RBOA 2NVXJ 3GTQJ
chains in the Genus database with same CATH superfamily
3WG7H 1IF1A 2E5NA 4RM3A 5GTIC 1G3YA 2MLGA 1SC7A 1E17A 2IA1A 4N4NB 3K0LA 2OQRA 4V19K 3BR1A 3OWTA 2BVLA 5CPRB 3FBNB 1D5YA 3C2GA 3WTTC 4JP0A 2IA0A 2XB5A 3FISA 1WJBA 4MLOA 4OWRB 2MG4A 4CYDA 1T08B 4DBRA 3M8FA 1ON1A 3RKWA 3CCLI 5H20A 5LGNA 2ZOZA 5DM7F 4LK1F 3ZQHA 2DA1A 2EJRA 3FM5A 3PUBA 4KDPA 1VTNC 4J19A 2VLAA 3KP3A 1HC8A 1SVLA 2K02A 1TWHJ 5TJJA 2KRCA 2PMUA 3WU2C 2A2FX 3L2UA 2V7FA 3BJ6A 3L9FA 2Y48A 3CLOA 3CCRI 2YVHA 5GPCA 2UXXA 3S1QJ 1IW7F 2O7TA 2LY1A 5E20A 2GUHA 1QZZA 2IGMA 3WE2A 4XORA 1YX5A 4IXAA 2GENA 3HXLA 3G2BA 1E2XA 1NTCA 4EJWA 2ZCMA 2XRNA 4RAGA 1YJNI 1S72I 4I0BA 3OYNA 1LVAA 3DV8A 3JRHA 5FGMA 5J1YA 2BW3A 2ELHA 2OCCH 2QQAA 3CC7I 3A4CA 1K83J 1D8KA 2KQRA 5JR3A 2CV0A 4HA8A 4HKUA 4RLFA 2CUZA 2WC2A 2KISA 1RKTA 3LFUA 4ZDPA 3CDHA 4F3QA 1ZR2A 2JPCA 1ZG1A 3I4MJ 2EZLA 2GQQA 4PJJA 1EH8A 1F43A 1LFPA 1JKPC 4A6EA 3K10A 2HWVA 3ZMSA 1FP1D 2QENA 1I6XA 1BIBA 2HKUA 5LBQA 1Y6IA 3MD2A 3D5SC 4P9UA 2DDBA 2K40A 3H9QA 2J5OA 2BY1A 3ELKA 5E1XA 3HSRA 2R3SA 2R5ZA 4L9NA 1ZRCA 1TLHB 1UHWA 3RKQA 2W53A 3CF5F 2P8TA 1N25A 5L3BA 2NAZA 4YFKF 2E1MB 3JREA 3HOXJ 5DUKA 2NVTJ 2JN6A 2OZ6A 3PUFA 4BY7J 3WU0A 3ZQCA 1B59A 1V5FA 4KNYA 3RKXA 1K4TA 2VT2A 3DU5A 3L00A 3A0HC 3GX4X 4IQJA 1W7PD 3BT9A 2PJPA 2IT0A 4HDVA 3IKVA 3ECOA 1T38A 1K79A 2M0MA 2KZVA 3G71I 2X48A 4KJZA 2HXOA 4MQVA 3MNLA 3WTXC 2IEKA 3DQVC 3M9AA 3KETA 3HJEA 4C2MA 2A61A 3RYRA 3G6EI 2EIMH 1VQ5I 4MHGA 5HODA 5BOXA 1G4DA 2L7FP 3U9GA 4M9SA 3TBIA 1YO5C 3RZOJ 3ANPA 5GPAA 3ZQ7A 1TT0A 3JSJA 3BTIA 3DEUA 3QAHA 4UUSA 4WX9A 2KRHA 4HNTA 1YE9A 2FA5A 2ZFUA 3BTLA 4DBQA 4CICA 1GV5A 2IVMA 3S15J 3K4KA 2Q0OA 3KE2A 1W36D 1S7EA 2BW3B 1LJ9A 5E17F 2NXNB 3OIOA 2EIKH 1O3TA 3OSGA 3LQQA 5FKKA 2GLOA 3J7AO 3L09A 3T8RA 2XUBA 3GCMA 3HTSB 1VQNI 2X6OA 3GFIA 3EETA 5HNHA 3HSFA 4GCVA 4BQQA 4ABZA 3SDGA 2XKPA 3V8KA 2EFQA 5K5OA 2IXSA 4FETA 4HQEA 5J1UA 2CUJA 3F6OA 1NK3P 2H6BA 1TZLA 3VUQA 1XX5A 3F6VA 1IXRC 4IKFA 1BOBA 3GZ5A 2K4BA 1FOKA 1WJ5A 3RIRA 3OS0A 4LLNA 3KYDB 3ZMUA 1O7LA 2P5KA 4XNFA 4DGWB 1T33A 2DOEA 2F6CA 2IPQX 2VN2A 4I02A 2ZJQF 2IRFG 5F6FA 1AOYA 3V7RA 3WGHA 4IL6C 1B6AA 2ZO4A 2R5ZB 4S05A 3TP3A 1SD4A 1EA3A 1XCBA 3K4BA 5AONA 5FJ8J 1BOAA 1STZA 2R7DA 3E5XA 3T5XA 2DA2A 4XSZF 3HOUJ 2DFFA 5HS7A 2Q1ZB 3AG4H 1DGWY 4BJ5C 4CDGA 1OLTA 5D6EA 3ZR8X 4HZFA 4O6JA 4XLHA 2M8GX 4JYKA 3SZPA 2K86A 2VT3A 3CD6I 4ZYDA 3PIOF 1J59A 1P7IA 3KP4A 3F8FA 3I59A 4XLEA 1Y56A 5EZGA 3QODA 1XB4A 5FKLA 2LY2A 4AD9A 2KDOA 2PEXA 3OYKA 3VWBA 1LVKA 4UVBA 2KMUA 1ZGWA 2DT5A 1EV7A 2DYSH 2Y69H 3BLYA 4BUPA 1ENHA 2XSDC 3DF8A 2M34A 3VB2A 1N77A 3BHQA 2NS7A 1FT9A 1ETYA 2CFXA 2Z16A 4FQGA 2BXYA 5LD2C 2FX0A 3LHQA 3ABTA 1LFBA 2FRHA 3E3VA 3AKZA 3ON4A 4C3IJ 4FTHA 1OPCA 2HYTA 2KZGA 2A05A 2V6CA 4XLAA 2VASA 3DTEA 2ZKZA 4CSWA 1G3SA 4XICA 4UUSB 2DPUA 2HTSA 1MBHA 2DFHA 4IOAF 5JFRA 1FLIA 2HNHA 4LD5A 4Z6YA 4YIRX 1D5VA 3L2RA 4CYCA 3TOBA 4E7KA 2EA2A 4GYIA 5M3FJ 1MMAA 1YG2A 1UELB 1KQ8A 4GCLA 3M07A 4MQ9F 4RLQA 5DS9A 3F21A 1D8JA 1K6YA 4O3MA 1I1SA 2JSCA 4CZZA 2M7AA 2HVQA 2X6YA 1FJLA 2QLZA 3FM3A 2VUMJ 1S8NA 1HKQA 4OAZA 5F64A 2E5ZA 2IP2A 4AYBA 3NRVA 2WTEA 1ULYA 2V6EA 2CV2A 3E6DA 2MBFA 4AIKA 3I53A 2LK2A 4OD4A 3DTIA 4HPQA 4DNCA 2WADA 4PFOA 1ZQ3P 2MLKA 1G8XA 1VFCA 2EV6A 1SVMA 5LEKA 3BZKA 4EMSA 2W85A 1R36A 3CJNA 1MNDA 1UCRA 1QU3A 3S1NJ 4B3XA 4G6TB 3TP0A 1YRNA 2ZNZA 4BXXJ 2L0KA 5CYVA 2XGDA 4AF5A 4CGZA 2DBBA 4GYGA 4W1UA 1ZRFA 4HSRA 3I59B 3LSJA 4OMYA 1CQTA 4Q4ZF 1UFMA 4X6AJ 3EPZA 4LK0F 1KU9A 3KEYA 5EJCA 2WB1N 1MMDA 5GTHC 3CDIA 5F1RA 3HM5A 4PJNA 1R5ID 5E3NA 2EFNA 3VOEA 3IAM2 2VKEA 5K1YA 5IYDJ 4IPAA 4GFBA 4PUSA 4KN7X 4BBRJ 4EGYA 2JZYA 2MA3A 4MEYF 5DCFA 1MMNA 3CCUI 2M4KA 2O5RA 4C2MJ 2ME6A 4U0YA 1SAXA 5F04A 2VKVA 1RR7A 3ECHA 2VODA 3OYCA 2F2EA 1GVJA 3LSHA 2PZ9A 5ILVA 3CJTB 5B1BH 3PM1A 3IH4A 1WJFA 2DK5A 2Y9YA 1Z21A 2HQAA 2E1OA 3VVZA 4U87A 3FRQA 5HOOA 4ZZDA 2GIVA 4CYCB 1QHGA 2OI8A 4DYCA 4KUMA 3BG9A 4HDUA 4M6VA 5ED4A 3LFKA 3Q0VA 4PJMA 5IYBJ 1T39A 1FBUA 4BE2A 3ASOH 5FKNA 4XMYA 2NNYA 1BJZA 4BXFA 2BE5F 5AQCA 5E8IA 1KONA 1LFUP 3LAPA 4ZYAA 4ZDLA 2LG4A 2BVMA 2OTLI 4MGRA 2Q8KA 3BDDA 3PQJA 2VKHA 3RJPA 5IP6A 2PMZN 3JRFA 3CUQA 2VI6A 2MGQA 3FXUA 4XLFA 1TWCJ 4WCGA 3KZIC 4MXMA 1PUFA 3QPTA 3MKLA 5HS9A 3SWHA 4YIIA 1FSEA 4C2UA 1RPWA 4YFXF 3O2PE 4UV9A 2KRFA 4BHCA 2ZB9A 3JSPA 2DA4A 1GT0C 2DTZA 2OA4A 3ZQGA 2P5LC 3GF2A 4KMFA 3G7RA 3NPIA 3G1LA 2LH9A 2CRGA 5F27A 3MMYB 3JRDA 3CJQB 5CQGA 2JUCA 3BZCA 3ERED 4G7ZF 1AKHA 1YRNB 2FE3A 4II2A 5CKTA 5B1AH 1T2KA 3S1MJ 1L0OC 2REKA 3QWLA 2K3PA 3K9TA 4EJTA 1APLC 3SXYA 2WY8Q 5L3CA 4S04A 1R5GA 1F4KA 2D6YA 4G94A 1HDPA 4CZCA 4KWAA 2IAIA 1E3HA 2DW4A 3AQSA 3HRSA 3HPHA 5IT3A 1ZAOA 2O3FA 2VE9A 1B9NA 1WJAA 2HZDA 1JT6A 4FE4A 2QCOA 3SDBA 3PFIA 2QYOA 2OZUA 2P7VB 4GXOA 4KISA 3FWEA 3QOPA 2XF6A 2M0CA 3KZZA 4GRIA 3T6NA 1WRJA 4P5OA 4D5FA 2ZJRF 3S3OA 2GWRA 1HF0A 5H2FC 2CYYA 2CJJA 2MD0A 5DDGA 4H0EA 2Y9ZA 1YIJI 1MIJA 3I54A 3TO6A 2YVEA 5LHHA 1IAWA 2NRAC 4RBOA 2VQHA 2KPMA 1BR2A 4HNUA 3OYBA 3BY6A 1W5SA 4ZZLA 2XAGA 2P0WA 3E6MA 5C44J 3O8HA 2HYJA 4JL3A 4HLYA 3BQZA 1ACIA 2CQNA 3KEOA 3DWLE 1U9NA 2OAZA 3RKYA 1V55H 1Y0UA 2MC4A 1J2XA 5EZHA 3TDUC 3QU6A 3VFZA 2I8DA 1FX7A 4AIJA 2XDNA 4IQ4A 1WWXA 2P7CB 3LSPA 5LGUA 1ZELA 4MO7A 3WTYC 5D8LB 3VVXA 2CW7A 1SFKA 1J09A 3CUQB 4B09A 1R9TJ 2EWNA 4H4KC 1ZLJA 3SYTA 2IS2A 3IWZA 5J6XA 1AWCA 3GTGJ 2HOAA 2XV4S 1MSEC 2O03A 5DV5A 1PUFB 1XMKA 3DBRB 4CCMA 2Y0SA 4L0ZB 3NAUA 3HKZN 1G3TA 3ML6A 2K9SA 1V5EA 3HB9A 2L9RA 3PO3J 2K85A 1EKEA 3IHUA 3OV8A 4JX4A 2XROA 3ZMZA 1MMSA 2WAEA 3ZXSA 4YRVA 1AKHB 3F72A 1XGNA 4GFLA 3C18A 3BJAA 2F5VA 3FXLA 4Y4RA 2A6TA 3V8LA 4LMYA 3F3XA 3M8EA 2VQLA 4Y33A 2XPVA 1TBXA 3EQLF 3V7SA 4G9YA 1D1AA 1U9OA 1MSFC 3HIMA 3H1CA 1LUJB 3M1EA 4YFNF 3FKJA 1QZEA 2OCEA 2O8KA 3RQ4A 3P9KA 3TQNA 3S16J 4HG2A 5KAIC 4RB0A 4AC0A 2CW8A 5L3GA 2HOEA 3J7ZI 4CUGA 4E7IA 3QYFA 4QPQA 2JT1A 4QIWN 1BR1A 2ZSHB 4N9HA 2DK8A 3TDZC 3T0YA 2K9QA 1DDNA 2KFDA 3WHBA 4I09A 2UXHA 3CTAA 2LKXA 1IN4A 1S7OA 4OIQF 1DQUA 4RGSA 2DFIA 4XR6A 4M3FA 4KICA 1GDTA 4NNJA 1YITI 1JJ8C 2VOPA 5HBUA 2IJLA 4C9YA 2DT6A 2DODA 1R00A 2X1CA 1EF4A 2NX4A 2VXZA 2IGNA 1H88C 2OTJI 2V1UA 1YFHA 3VW1A 1B4AA 3CJRB 4JX5A 4ETSA 2DXIA 3GTQJ 1IN5A 3QPLA 4K2EA 3QKXA 3I0TA 3BJOA 3E6BA 3FK6A 1BC8C 1FIPA 3HTHA 2LLKA 1X4OA 3V7CA 1K7AA 1MJ9A 1OQYA 4CHUA 2FQ3A 3NI7A 3QP6A 2E34A 2EFPA 4LG3A 1DP7P 2Y30A 5E1WA 1Z05A 2DOAA 1D1BA 3KYLA 3VEPA 3BNIA 4KYWA 2BYVE 2CQ7A 4UXNA 3MWMA 2NNNA 3K4NA 1YW8A 3EUHC 3K70C 3MZHA 5EDNA 3GTOJ 3KP6A 2X1EA 3G3ZA 4PGHA 4NBQA 5LRRA 1R71A 1H89C 1UB9A 2H8RA 2CQQA 2F4IA 4FX4A 3V78A 3ZQIA 2F5CA 5L3FA 5K5RA 5ILUA 4AWXB 4NC8A 5FLXK 3FMQA 2M2EA 4F92B 4PJLA 3ZOBA 2NP5A 5FLXZ 5CVRA 1JKOC 3BR3A 1H0MA 2CS3A 1OR7A 3IWFA 3T8TA 1TQIA 3K69A 2PN6A 3E6CC 4KT6A 3G4SI 3FXMA 3R6SA 3MFKA 1MH4A 3DBLB 3SFZA 4I0AA 4BQOA 3EUPA 1WGXA 1HW2A 1TQPA 4HF0A 2LBFA 1Z6TA 4FASD 4M6XA 2EK5A 3F8BA 3QYBA 4A0YA 1CGPA 2FUG2 1SD7A 1WCMJ 3NXCA 3HC7A 3DTKA 2CSOA 1SGMA 3S2DJ 4BBSJ 3HGYA 1JUMA 2W25A 2HOTA 1IZ1A 1P2FA 3T1BA 2E2JJ 3D5RC 3W6KB 4PZJA 3SZGA 5LEJA 2L7ZA 2OJED 4G8XA 1M1EB 3O60A 3JTHA 2OUMA 1H9TA 4NELA 4LB5A 3RH2A 4EJOA 2IGKA 2WUIA 1KA8A 2FBKA 4Q48A 1FY7A 2M7BA 2VJIA 3L2VA 1TWAJ 3S93A 5K7ZA 4GGGA 2Q24A 4IZZA 3AQTA 3CRJA 1IXCA 3BWGA 5IP7J 3HTJA 1TNSA 1ZN2A 1SMYF 2CQKA 4ZTJA 1SFUA 1OFCX 2JVGA 2KHMA 1J0RA 4M9XA 1T95A 5J4YA 1FYMA 1ORKA 3NARA 1LKXA 1MBFA 1ODDA 1RESA 3A2KA 2L9NA 3VYSB 2W82A 1USSA 3D5LA 3HHHA 3OYIA 3I4NJ 1BW5A 3G1MA 4ON0A 2VXDA 3F9KA 3KX2A 3JRGA 3BROA 4D5CA 2V57A 3QPHA 1RKWA 2NVUB 2FBQA 1R4NB 1GVDA 1YS7A 2Z9OA 2W4SA 3F22A 1D1CA 1PUEE 2VOOA 3CCQI 2EV5A 4NUBA 2F4OB 4E4HA 4U0VA 3PO2J 3ZMVA 1RC9A 4NQWA 3CCMI 3HG9A 4IJAA 5JLWA 4ZYHA 2XF7A 4OAYA 1PJRA 4E7SA 1HOMA 3K6GA 1GV2A 5BPDA 1HSJA 3R60A 4OIRF 3EGQA 1FBSA 3IH3A 2Y31A 1G2HA 4M3BA 2BHYA 2LRDA 3DXJF 3BR2A 4HEA2 1LE8A 1HQCA 2HPIA 4RAFA 2X4HA 4OU0A 3HSEA 4BYYA 4GDFA 1AU7A 3GTMJ 2DU9A 2LBFB 2B63J 4XKWA 1J9IA 4C2TA 2FEZA 3BR5A 3LSKA 1JJ6C 5FRMA 2DOFA 3H36A 5H6QA 4ZYGA 2F5DA 3PSIA 3A1YA 5LRSA 4BDYA 4ZDOA 2UXPA 4GFKA 2XVCA 1OCRH 1XSXA 2G7HA 3JTGA 3MAJA 5HDGA 2QGUA 3IRRA 3Q0WA 1OYIA 2QQBA 4XRFA 2BOLA 1U5TC 4PSWA 4DOZA 5D5XB 3GZNB 3HE0A 1FEXA 2HFHA 1CF7A 2VBWA 2RAEA 2GAUA 1IRFA 4M74A 4W97A 5M5XJ 2H1KA 1FPQA 2EZHA 1MW7A 2ZXJA 1B8IA 2R7WA 1EH6A 4G12A 3ABUA 1F5TA 4M73A 2EFWA 4M3GA 4ITVA 5FKOA 2V1DA 2HQRA 3EDPA 4CO8A 1S7AA 2FJ1A 1R1UA 4L9VA 5IT9K 4L5JA 3LSGA 5IT9Z 1W36C 4QPOA 4L18B 2ESNA 5E3LA 4IX7A 3E5UA 2OQGA 4NB5A 5DTDA 1FSHA 2E7XA 1BM9A 3ZRGA 3TEDA 5CVUA 1R23A 3OL4A 3G73A 3H5NA 1MNEA 1XTAA 2DMPA 2W00A 4LG0A 5GADJ 4XLCA 3CC4I 1UJ8A 2D1VA 3H5AA 4M71A 2CWEA 5L3EA 2WAQN 2VBYA 1ZK8A 4DVYP 1V4RA 4NQWB 4BDZA 1E3PA 1REPC 2I5UA 3GBGA 2BY0A 2RQQA 1VQKI 4E70A 2ISZA 4KITB 5HSZA 1JGGA 1WFXA 4DW6A 2EIJH 2VL8A 2YR2A 4BH9A 5DD4A 2ICWG 1MBEA 2QUFA 3R0AA 3OYHA 1OCZH 1K61A 1HKTA 1S29A 3HYIA 1A6QA 3QOEA 3QU3A 2H27A 1AA7A 4ANJA 1LE8B 2QQ8A 2W1OA 3MN2A 5ICFA 3U1KA 5KAFC 5KCMA 3JSOA 3CP2A 4XN3A 5B3SH 1R1VA 4E7ZA 5HS8A 4BXUA 2JA7J 1OISA 1Z7UA 1P4WA 1JKQC 3OS2A 4LGWA 2STTA 1HLVA 2R0QC 1RRJA 1Z3YA 2WAFA 2LTPA 2DO7A 2CUEA 1ZGAA 4Y7NJ 5JHUA 1WSUA 3HPGA 2L7KA 3A0BC 3KZYA 1LEAA 4KFCA 1SFXA 2M9HA 3H5RA 5B5EC 2BBYA 1X2MA 3ESWB 4DZPA 1N75A 3H35A 4BL0B 4A3JJ 2IW5A 2XPWA 1CF7B 2JQ7A 3ZQLA 2NYXA 3V42A 4ZH4F 1RUNA 1B8IB 2DN0A 1JT0A 2UXNA 1R1TA 5J47A 3G1OA 2VONA 4IHTA 3AL0C 3KFWX 4MK6A 4BE1A 3OMYA 2HYGD 1YI2I 1MD0A 1GUUA 3IL2A 3A01A 5ICEA 1LDKB 3CJDA 3C07A 2RASA 3FXOA 1VQ8I 4EM0B 4EM2A 4Y52J 2DG7A 1NG6A 2OBPA 3I56I 4A3CJ 2WB1A 3B6AA 3HGGA 4KIFA 5B66C 3OYGA 3D0SA 4NHJA 1WJCA 3HRMA 4DIQA 3WTVC 2JTVA 1PP8F 1XMAA 4LFUA 2X6WA 4LG0B 1X1PA 1KU7A 1QPMA 5J3LA 1BC7C 2VQCA 4FE7A 5GAGJ 3IRQA 5C4JJ 2DYRH 1X19A 3LJLA 4AVPA 3S1RJ 2FNPA 2XAJA 1POGA 4RB1A 1H8AC 3CF2A 4LLLA 2W48A 1F1ZA 2IBDA 1XDUA 4F52A 2EFOA 2MSYA 4U7BA 2YU3A 2DDAA 1MH3A 1O7FA 2L2OA 1RZ4A 5KVRA 2E2HJ 1LNWA 4MEXF 1HCRA 2GA1A 2DAOA 2HGCA 4HLXA 5BQTA 1NG7A 1UG0A 2PX9A 2FBHA 1WHUA 2KIUA 3OOUA 5FGLA 3DCFA 3HTIA 1B9MA 2FD5A 2UXUA 2M1BA 1QVTA 3I9V2 4B1RA 2JRTA 5J4VA 3CESA 4AC6A 5F0HA 3D1NI 2LOOA 2Q2EA 3TO7A 1YJ9I 2XF5A 5EYRA 4B4CA 5GAHJ 2KLOA 1O3SA 3CWRA 1SANA 2L9SA 2PMZA 2LY9A 2XB0X 4XM3A 3ZQFA 3U1DA 2DTRA 1K78A 4JK1X 1BJAA 2UV1A 4B8XA 2RC4A 2UXIA 3JAMK 2FNAA 5D5VB 1BW6A 3JAMZ 2QSHX 2XASA 5FROA 3FXRA 1MJAA 3BG5A 4J01A 1MKMA 1YQAA 4U9LA 2ETHA 2ID3A 3FMRA 3E5QA 3DBHB 4JX6A 1NH3A 1Z91A 3ONQA 2ELKA 4HNVA 1FNNA 4IHYA 1Z9CA 4UNOA 3NNRA 3A01B 1R58A 2P4WA 2KP6A 2NS8A 3V6GA 2LF8A 1USTA 1DUXC 4YZEA 3LSIA 2XIGA 3DLAA 4ENJA 2OD5A 4Q5SF 1X1CA 3VIBA 2F48A 3S17J 1IJWC 3ZPLA 2R93J 5HAWA 3GO5A 6PAXA 2A6EF 4I98B 3RCOA 2GZWA 2QZ8A 1TP4A 3KP5A 1VQMI 5IYCJ 3AG2H 1Z0XA 1BI2A 1GXQA 1FMVA 2HS5A 2HPMA 3HHGA 2DPDA 3OSFA 5D5UB 3WTWC 2BZTA 3GUDA 4C30A 1FYKA 1IUYA 2ZC2A 4WF2A 5BMZA 2TDXA 2NS0A 2XPUA 1ITYA 1RI7A 2ZXWH 5CVIA 2O6GE 3K1MA 3OYLA 2FF4A 3K8PC 2UUZA 4U88A 4CH7A 2PG4A 3S3NA 4L9JA 2VBXA 4BNCA 2GIZA 1QRYA 5D4SA 2M30A 5FLMJ 4II3A 1ZGJA 2K4JA 3G56A 2FOKA 4RMNA 2QKOA 2WY7Q 2DMNA 5HNFA 1KYZA 2PFVA 1ETWA 1QO0D 2Q2EB 4G6DA 2NVYJ 1X1DA 2WV0A 1XGSA 2C6YA 2B0LA 3GTLJ 4AIHA 2E36A 5D18A 2YPRA 4PCQA 4Y3OA 4UVCA 4A5NA 2ME0A 2O8XA 1T8IA 4XKVA 1SEUA 2Y75A 4HX7A 2LFBA 1TQMA 1K78B 1JKRC 1QA6A 1VQLI 3JRIA 4XOTA 2PBXA 3HKZA 1OCCH 5FFZA 3ZP5A 3SJMA 2PBIA 1VQ9I 2VC0A 2RN7A 4A3EJ 1IC8A 3ZN0A 4LLGF 2A6HF 1OCTC 2F5EA 2IS6A 3N05A 2IGOA 1XS9A 1JTYA 2FQ4A 3FXJA 4OMZA 2F07A 2COMA 4MFDA 4HRIA 4E7JA 1UI5A 1OCOH 1Q1HA 1BN5A 1R6RA 3COAC 1FP2A 4QTRA 5K7FA 2RREA 4OD5A 1O3QA 2QSFX 3LOCA 1E0EA 3CCYA 3BC8A 2CV1A 1P92A 2JUGA 2BY2A 5F1JA 3RTRA 3REOA 4NDLA 4XRMA 1FC3A 3UKGA 2DA5A 3PNTA 5HLHA 2W57A 3RDIA 4C3JJ 3U21A 5DEQA 3AFHA 4A12A 2NVQJ 4P1WA 4WXDA 1IGNA 3J7YJ 1ZKGA 2L02A 1ETXA 3DFGA 3AL0B 2LVSA 2H1LA 1DGRM 4BACA 3HOWJ 1OJLA 4HF1A 2HZTA 3LQRA 3M8JA 4AIDA 2Z2SB 3W2AA 2JK3A 5E18F 5J40A 1GHCA 3VOXA 2IU5A 3R4KA 2JVHA 3EYIA 1Y8QB 2QWTA 2E1MC 3GZIA 4NC6A 3A03A 3C1DA 1R7JA 3LMMA 3NWTA 3H3VK 3LA7A 2XGXA 3HRUA 1P4AA 2L9VA 3CP8A 2CGPA 1MDMA 2HQNA 3PSFA 4G7HF 1S5LC 3KP7A 4BS9A 2R7RA 4B48A 1T6SA 2GM4A 3J7AY 1WH7A 3F8CA 1IO2A 1HSTA 2H6CA 3HIFA 4YIFA 4I7HA 3HTAA 3LSMA 3B73A 3JR9A 3LSRA 1YYVA 3L7WA 4IRVA 5FFXA 3VW2A 2XRLA 2EBIA 5K7HA 3RPQA 3P9CA 3FKIJ 2ZCNA 3QRFF 4D7NA 2Z5UA 1U3EM 2X6XA 3F8MA 2K5CA 5F0CA 4HV6A 2CO5A 4EVIA 3F8NA 3TO9A 3R61A 4WXHA 1B72A 3GYHX 1JE8A 4KA4A 2DA6A 2HEOA 2YX7A 4HF2A 2Z3YA 2ECBA 4M72A 5EF6A 2W84A 5D1RA 4ME9A 2GXAA 1X3WB 2GBYA 2DJNA 2RQPA 1QNTA 1Z3XA 3RSNA 4RB2C 3NRGA 3BCGA 3OL3A 4BQAA 3GTJJ 3SEZA 2CH0A 2KIMA 2FBIA 1ZG3A 2Z99A 1TNTA 1LPQA 4EGZA 1Z67A 1DPRA 1RUOA 3FBIB 2E1NA 4L0YB 1JHHA 3S32A 3VYUB 4UHTA 5IY5H 3OYMA 2AS5F 4D0PA 3HZJA 1HA8A 1KYWA 5TISC 4L5IA 4A69C 5HLGA 2B9SA 1QZYA 2VKDA 4PGGA 3X2QH 2A3SA 3VYTB 2DT7B 3FDYA 1SAUA 2V9PA 1VQ6I 1O57A 5H9TA 4WXCA 2HR3A 3JRBA 3EYYA 1MZBA 1XPXA 5JVGF 1ETVA 3P9TA 4ESFA 4XSXF 1P9QC 3K70D 3MCZA 2PMHA 2D1HA 1FMWA 1BI1A 4XL9A 2R7SA 1YW9A 2KL4A 3UNGC 3PL8A 3GFLA 3W2VA 5F08A 3MKZA 3A02A 4EM1A 2A5WA 3O8GA 3PASA 3ZCOA 4MIMA 2WA0A 4PDKA 2PQ8A 3GLXA 2KKOA 4M3EA 3WTUC 1SD5A 1KU2A 4OINF 2EQRA 3K7AJ 4E7HA 4HQMA 5J8FA 2JSPA 1LB2A 1FBQA 4FHTA 4AU7A 3RZDJ 2D5VA 1MDMB 5BNGA 2WV1A 3FHNA 2R7TA 1P4XA 1LDJA 1Z6RA 2EV0A 4JOMA 4LOCA 3L1PA 3ABMH 2L4MA 4A93J 1A04A 1U78A 2MABA 4A3LJ 3EUKL 1BBYA 3M4OJ 1YLFA 2HVSA 2YX4A 2DFEA 3MZ8A 5IOYA 4EV0A 5LHGA 2R5YA 4Q47A 1QQIA 2LKSA 3K2AA 5CQEA 1VZ0A 3HOSA 1PDNC 5C4YA 5CJ9A 2LD5A 3SHFA 3I64A 1B72B 4UUVA 3RPUA 2RHAA 4ZYEA 3GEUA 1SD6A 4B3AA 1KQ9A 1FZPB 1HDDC 2E19A 2BY3A 2JMWA 3L2WA 2B1EA 2HU9A 2PFBA 1K4SA 3BOQA 2B3WA 4CCJA 2GOMA 2KJCA 4A3DJ 2VE8A 5DUIA 2AO9A 3CCJI 3FHZA 3GZ6A 3VTIA 1HXDA 1YIOA 2DMUA 5AIPA 1A31A 3KKDA 3J81K 4ICHA 3HL2A 5ICCA 3J81Z 4F91B 1W0UA 2VBZA 1G6NA 1J75A 2DI3A 4ZTFA 3F0CA 4OOIA 3WODF 5BPIA 2XKOA 4HV5A 1A6IA 2ZJPF 2MW8A 1R4MB 1XSVA 2QWWA 3K4MA 2HKXA 2K27A 2M4GA 3M7GA 1VF9A 3GTPJ 2R7XA 2OPTA 5CW8A 3NQOA 2HKOA 1EJ9A 4A0XA 1C0WA 1K6OA 2WGBA 3IAS2 3V4GA 2G7LA 3OYDA 1JI8A 3DKWA 3K4LA 1IXSB 3WG9A 3HTUA 2ZSIB 2G3BA 2CW0F 2G7GA 3EUAA 3IV5A 1JUPA 3IUVA 4XRSG 4WIBA 1Z7LA 4I76A 3DKYA 4I01A 3RD3A 2J5PA 3WGIA 2EH3A 2COBA 4ENNA 3M3YJ 3DPJA 4A3BJ 1QVUA 1JGSA 4LIVA 1Y39A 2HVRA 4E7LA 3N4MA 5HVQC 4PSXA 3EUHA 3TW7A 4PXIA 2R7FA 3K4CA 5DAJA 5E8GA 3KLOA 4XOPA 5K5QA 4V2GA 5IPAA 4O5VA 1I3AA 2WWYA 3GTKJ 2BEOA 2V9VA 1VNDA 1R49A 2JA6J 3MVPA 4P96A 5JVTA 2IS1A 2BXZA 5LLQA 5LHIA 4ENMA 4RDUA 3DEEA 1NK2P 1G3WA 1TWGJ 3NWSA 2JPBA 3P7NA 4I2OA 4CGRA 4XK4A 2HDCA 4P9FA 4X1EA 3BR6A 3VDXA 3V8JA 1FOXA 4CCNA 2R92J 4JNNA 5D6FA 3VSKA 2QOPA 1PP7U 4RAZA 2R5YB 1V3FA 5DCMA 1Y0NA 4IRHA 2EA4A 4ACIA 2XSJC 2WAQA 5AIQA 3HDDA 3PNVA 1MNMC 2JA5J 1I1GA 2FMYA 3K1PA 3HUGA 3KLNA 3BTCA 1Y8RB 2AHQA 3CMAI 3FK7A 5FMPA 2AXTC 4OIOF 4EJVA 3C7JA 3FZVA 3P5JA 3ZGKA 5GAEJ 5ICGA 3CC2I 3S2HJ 3BR0A 3L2QA 4ZJZA 1ZTRA 5M5YJ 1UMQA 3NEUA 2GOXB 4XLPF 1OKRA 5E79C 5TGTA 3CCSI 1BL0A 1X3UA 3S8PA 1FOYA 3S3MA 4KT5C 2BGCA 2XDVA 3Q9VA 4FISA 3JRCA 1EH7A 3CLQA 3K4JA 4RGUA 3O3KA 3JRAA 2UXOA 4YG2F 2VIXA 2EINH 3I71A 1ON2A 3DLLF 3VP5A 5D5WB 1IN8A 4ZC3A 1FTTA 1X2NA 4EEFG 1TL8A 4A5MA 5BS6A 4WWCA 2L3DA 2V4JC 4IO9F 4EATA 2K3FA 4D9JA 1ZRDA 1YHQI 1U2WA 3QP5A 1D3YA 5DM6F 3GVAA 2BV6A 4IHSA 5EG0A 4G6QA 2G7SA 2QQ9A 1XMXA 2P5VA 2G7UA 1IRXA 4UDSA 1U8RA 4ESBA 4QLCU 1AHDP 1TW2A 3H9JA 1PYVA 2EZIA 2X0LA 4XKBA 3E0JB 1VQOI 4BGDA 1IDYA 5H6RA 2QKMB 5C3EJ 2DQLA 4A3GJ 3KKCA 4F55A 1FYLA 1RR8C 2M87A 2E35A 1WJEA 3IUOA 3AG3H 4IRGA 2CUFA 2PLYA 4I99C 4PK4A 4XIDA 4LJZF 3HEFA 1W1WE 3K1NA 4XRSA 1ZR4A 1W0TA 1FIAA 2HOSA 1IV8A 4GO1A 1I39A 3WE3A 5ILSA 4OIPF 3S2WA 4I6ZA 3F1BA 2STWA 1BR4A 3TGNA 3JCUC 4XKCA 4BQNA 3HOVJ 4JQFA 4B44A 2YVXA 3AG1H 1RNLA 2A5YB 2QVOA 1HKSA 2DA3A 2AXLA 3KP2A 3Q0UA 2HDDA 2ISYA 1XC5A 1F9NA 2HTJA 3CMMA 5DCMB 3RQIA 4CXFA 1BA5A 2R7QA 3C3WA 2ESHA 3FIWA 2O0YA 2YU9J 2FXAA 2ZCXA 2TCTA 2ZNYA 1JXSA 2V1NA 3CQZJ 2DG8A 1L3LA 2AQEA 4DQ2A 4RGXA 5FO5A 4BKXA 1WQ2A 1E3OC 3HUGB 4JKZA 3BZ6A 3KYCB 1R22A 3DEWA 4A2UA 5FHPA 3H92A 1JHFA 3E1SA 5KNLA 2P81A 2LMDA 4QSHA 2HYFA 1JUSA 2H09A 5KK1A 2IS4A 1W5TA 3KZ9A 1BI0A 1IV6A 1WKMA 5IOZA 4N0BA 4EJUA 1S3JA 1W7PA 2D2WA 4F7ZA 3MQ0A 3GWZA 3ZN1A 3I55I 1FTZA 1SFOJ 4NN1A 1U5TA 3PQKA 3GFMA 1UZCA 4A6DA 2ZMEC 2OF7A 3E97A 1OYWA 4LB6B 2LP0A 1I50J 3DP7A 2VB6A 1YOVB 2EB7A 2OC6A 1XSDA 2LKPA 2NOGA 3CUQC 2G9WA 3GXOA 1ZREA 2XAHA 2L4AA 3PFYA 3COLA 4R8HA 3WTSC 2HI3A 2Y0MA 2M45A 3H3UA 2JRMA 2O7OA 2EILH 2KIFA 2V79A 1X3ZB 3NS4A 2L5QA 4HX8A 4M9ZA 2JJ7A 3Q3SA 2ECCA 5EG0B 3BPVA 2DMQA 2FOWA 3MEXA 2ZXIA 5ERIA 4R79A 2F4MB 4KIGA 3CO7C 3W3CA 4UB8C 4Y15A 4IHVA 2A07F 1KQ0A 2W7NA 3WTZA 2XGCA 2YS9A 1Y1WJ 2ACJA 4UUTA 2MFZA 3HOTA 2N8GA 4BEHA 3LAJA 2E7WA 3BP8A 5HDKA 4BU2A 2AQFA 5FB2A 1I6HJ 2KT0A 3KPHA 1IRGA 1WI3A 4Y13A 4MNUA 1ZH5A 2DJIA 4A3IJ 4XN0A 4Z2YA 3WGGA 3I3LA 2XAQA 2EZKA 3KEQA 2LF7A 4DYRA 3CCEI 1G59A 3CMYA 2X1DA 1VQ4I 3ULQB 2PI0A 4XLNF 5FRNA 2V9KA 2H94A 2M3AA 3W2WA 1I3QJ 1WI9A 5GP9A 5F0FA 3TMOA 2VPLA 1IRZA 1BI3A 1QGPA 1WPKA 3UR3C 2CMPA 1WVRA 1UI6A 4PJ0C 2Z1DA 1IDZA 3BRUA 3SZTA 3VPRA 3ERMA 3OYAA 3MKWB 2KDZA 4CCOA 3GW2A 2P6TA 2K7LA 2RDPA 3PNYA 3VW0A 3GLLA 1IG7A 3BJBA 1N78A 3OR1C 5E3MA 2DCEA 4AYBN 4U0WA 3MZYA 2G0EA 1V5GA 9ANTA 1UG2A 1O4XA 3B02A 1TW3A 3FMSA 2O9LA 1OMIA 5JLXA 3DKXA 5EGOA 1W7PB 4IRIA 5J1RA 1ETQA 2LNBA 5CVJA 4B43A 1QBJA 3DPLC 2YUSA 3WHCA 4LITA 1U5TB 3IH2A 1TTYA 4N4OB 1TC3C 2ELJA 5FLVA 2NOJB 3KIOA 4E6KG 1P7JA 5EFYA 1O3RA 3ISPA 5HLIA 2L01A 1YX3A 5LGTA 2MYSA 1LDDA 1T56A 4IEJA 4RM2A 4A3MJ 3H9GA 3DPUA 1DP3A 2VJ4A 3DPTA 1SMTA 2K9LA 2X85A 4F93B 5M5WJ 3MKYB 2A69F 3HOZJ 3SEQA 1LQ1A 4JBAA 1SFEA 4BJ6C 2ZBKA 1XDSA 2LC2A 3ABKH 3ZQQA 2GFNA 1PVEA 1GLNA 3BCBA 1BIAA 2XHKA 2ZMEA 3PIPF 1XN7A 2XAFA 4NC7A 3I58A 2D45A 2ZCWA 1DPUA 3LA3A 3H0DA 4BAYA 3C2HA 5HLTA 2LREA 3ROUA 2A68F 5KHDA 3TW6A 3ZMDA 3BTJA 5M3MJ 4BJTA 1HBXG 4BEHB 1OCPA 2KJBA 2K9MA 2QF7A 2E60A 3LWFA 4M6YA 1WZ2A 1XCVA 4U9NA 1IUFA 4L9TA 4IHWA 2XGEA 4QWQA 5K58A 1VQ7I 2YSRA 3OR2C 2R7VA 2L7MP 4HSTA 1ETKA 4HAMA 2F5FA 2W24A 2RV8A 2K9NA 4G7OF 3SQNA 2P6SA 3O6BB 1T0FC 1YJWI 4AVZA 5CXGA 1ZARA 3ANGA 1IN6A 2XC7A 4FCYA 3BG6A 3FF5A 4D1QA 2RNGA 5E1ZB 4XBFA 1XGMA 1F36A 4BHBA 4UVAA 2ZY9A 2QA4I 1TT5B 2R7OA 4ASNA 2VC1A 1FWZA 1WH5A 5J8CA 4P55A 4WK8F 2RVCA 2OU2A 1YW7A 2CU7A 3PJRA 2BHZA 2RKHA 1W4MA 2Y2ZA 1LEBA 2FSWA 4KIBA 2E2IJ 4GCKA 2E71A 3CO6C 1XD7A 3JW4A 1P6RA 3K2ZA 1Q1VA 5IP9J 2LYCA 1HW5A 2X51A 5FD5A 4UY8I 1DU6A 4BE0A 2R4GA 3S5RA 3ABLH 5EGOB 3BCAA 3AAFA 4BHPA 2I10A 3RI4A 4MTEA 4S0HB 4AM3A 2QBYA 4IOCF 2PJRA 1MBKA 4HOBA 4BY1J 3ASNH 2QM3A 4Y17A 2DA7A 4IF4A 3VODA 3LWJA 2HXIA 5TRDA 4FX0A 1MGTA 1X1BA 1NHAA 1XG1A 2ADUA 4TV7A 1A35A 1KGSA 2FMLA 3KCCA 4X0GA 1ZG5A 4RS8A 4CCLA 1MBJA 4YELA 2O61A 3SFIA 3C2BA 1QPIA 1S9HA 1MJBA 2LR8A 2NP3A 2MC3A 3P9IA 3IKTA 5D8KB 1ZHFA 3CMEI 3TL4X 3ZMTA 3FX3A 4RGRA 3RYPA 4C3HJ 5FKMA 1MMGA 1OR7C 2VJ5A 5FD6A 2ZMEB 3I4PA 3OIQA 3TKYA 5E3OA 1VQPI 3R0JA 4PFPA 2ZXHA 3IP4B 4UB6C 3N97A 3S14J 2WBMA 4HX4A 3E7QA 1X1AA 1KU3A 2EPFA 2KIQA 3B81A 2VQGA 2QSGX 4ENKA 4GCTA 3DU6A 3Q5FA 3PPBA 3OYFA 3VOKA 1U6GA 5DYMA 3VVYA 3QBMA 3HBLA 3LSTA 1JTXA 4LIUA 4XONA 2M8EA 2JA8J 1H9GA 1V54H 2LSOA 3RPUD 2MH2A 4KN4X 3GEZA 3OYEA 2MD5A 3W6JB 2OERA 3OS1A 4ESJA 2GXBA 1GXPA 2HQ5A 1FOWA 5EEAA 5CXIA 1WJDA 3BG7A 3HOYJ 2ZJ2A 2QKLB 1Z1DA 1I5ZA 5LFAA 2UWMA 1D0ZA 1I27A 3OIPA 4HW0A 2CQXA 3OYJA 3BG3A 1DU0A 1R5HA 2IA2A 3H3ZA 3QYEA 4A3KJ 2H8WA 4HBLA 4D7MA 2CFOA 3BPXA 2V1XA 4R1HA 2RGVA 3H0GJ 4MTDA 2TRTA 1A36A 1TWFJ 4M3DA 3KNWA 2DMTA 3M1CA 1XGOA 2R7UA 2QEXI 1S6LA 2ZFWA 2M5WA 3U2RA 3F23A 2UZKA 2QIBA 1ZYRF 3VYRB 4MFEA 2VJJA 2DLLA 3IC7A 1T0FA 1Z77A 2DQRA 1IN7A 2HDWA 3LA2A 1U8BA 1RIOH 4XQFA 3FXQA 2B7EA 5EEHA 1B1BA 4CA0A 4RAYA 1X4PA 2L54A 4CCKA 4RB3C 2GXGA 3HRTA 5A2QK 2Y0SN 4DYQA 4A0ZA 5A2QZ 5L3DA 1YS6A 3BQYA 3OY9A 1UAAA 2QBYB 5JI6A 4A3FJ 2PJRB 3GMEA 4HYEA 3WU1B 1UHSA 3CZ6A 1RETA 2FJI1 1J7KA 2FU4A 4UV8A 2R7ZJ 5JHFA 2JWTA 1OYYA 1UHMA 4V2FA 5D4RA 2GA2A 4B47A 4DZJA 4IVNA 1ERDA 1MBGA 3FXKA 5EEGA 5DD8A 1U0JA 1ONVA 4FT8A 1ZLKA 2E1CA 2QTQA 5CVVA 5C4XJ 3B6CA 2OV7A 4IHXA 2V26A 3OOPA 3VSLA 4KMUX 4L62A 3LNQA 4J00A 2RNJA 3TOAA 3QPSA 2JA2A 2Z33A 4L5EA 4AUXA 1VI0A 3Q9SA 5CLSA 1A5JA 3L2CA 2ID6A 1T98A 4DJAA 2VPRA 3LL7A 1YTYA 2LDUA 1ETOA 1HW1A 3CDLA 5D19A 4N9IA 3I5UA 3E7LA 4U7DA 1X58A 5HDNA 1W5CC 3W6VA 1QHHD 3ON2A 4EQQA 3CUOA 3GFJA 1D0XA 3QQAA 3CCVI 4YEJA 1Y1VJ 2X9DA 2XAUA 3J80K 2ZOYA 1J5YA 1KZHA 3J80Z 2MH9A 2CG4A 2NVXJ 1SVOA 1D0YA 4RA2A
chains in the Genus database with same CATH topology
1BL0A 5FGLA 3OOUA 3DCFA 3HTIA 2FD5A 2UXUA 4FISA 1QVTA 3BR1A 5C44J 3JRCA 3O8HA 2HYJA 4B1RA 3JRAA 4JL3A 2UXOA 3BQZA 1D5YA 1U9NA 4JP0A 5F0HA 4AC6A 3VP5A 2XB5A 3FISA 4MLOA 2MG4A 1FTTA 1X2NA 4EEFG 5EZHA 3D1NI 2XDNA 5EYRA 4B4CA 2ZOZA 3LSPA 3CWRA 3ZQHA 2DA1A 1SANA 2LY9A 2XB0X 4MO7A 3ZQFA 4J19A 3VVXA 5EG0A 1R9TJ 1TWHJ 2G7SA 3GTGJ 4UDSA 2HOAA 1MSEC 2UXIA 1PUFB 1AHDP 2EZIA 4ICHA 2YVHA 5GPCA 1BW6A 1IDYA 5C3EJ 3S1QJ 3NAUA 3HKZN 4A3GJ 3KKCA 3BG5A 2O7TA 2K9SA 2GUHA 3HB9A 2L9RA 3PO3J 2CUFA 4XIDA 2GENA 2ID3A 3HEFA 4XRSA 1NTCA 1ZR4A 4JX6A 1FIAA 4JX4A 1W0TA 2HOSA 2ZCMA 3JRHA 2ELKA 4HNVA 1AKHB 4IHYA 3NNRA 4GFLA 5J1YA 3A01B 4I6ZA 3F1BA 2NS8A 3V6GA 3HOVJ 1K83J 4YZEA 3VIBA 2XPVA 2DA3A 3Q0UA 4HKUA 3S17J 1IJWC 2HDDA 2R93J 5HAWA 1RKTA 1XC5A 1U9OA 1MSFC 3HIMA 3RQIA 1BA5A 1ZR2A 3I4MJ 2EZLA 2O8KA 3FIWA 1F43A 2YU9J 3S16J 1JKPC 2ZCXA 5IYCJ 2TCTA 1Z0XA 3CQZJ 2DG8A 4AC0A 4BKXA 2HKUA 1E3OC 4JKZA 3OSFA 3DEWA 5FHPA 4QIWN 2P81A 2K40A 2K9QA 2UXHA 2XPUA 4QSHA 3WHBA 1ITYA 2LKXA 1JUSA 3KZ9A 1IV6A 2R5ZA 4M3FA 3RKQA 5IOZA 1GDTA 1JJ8C 2W53A 5HBUA 1FTZA 1SFOJ 1EF4A 2NX4A 4NN1A 1H88C 3VW1A 1QRYA 5FLMJ 4JX5A 2OF7A 3QPLA 3JREA 3G56A 3QKXA 2LP0A 1I50J 3HOXJ 3FK6A 2QKOA 1FIPA 2NVTJ 3HTHA 2JN6A 2LLKA 2DMNA 2NOGA 4BY7J 3ZQCA 3NI7A 1ETWA 2Y30A 2NVYJ 3COLA 3BNIA 2HI3A 3GTLJ 2O7OA 3BT9A 5D18A 5EDNA 3GTOJ 2ME0A 2X48A 1H89C 5EG0B 2JJ7A 3Q3SA 2ECCA 2H8RA 2DMQA 2CQQA 2HXOA 2LFBA 3MNLA 3V78A 3ZQIA 1JKRC 2IEKA 3JRIA 2PBXA 4IHVA 3SJMA 2M2EA 3ZOBA 5HODA 4A3EJ 1IC8A 2L7FP 2XGCA 2YS9A 1Y1WJ 2NP5A 1OCTC 4UUTA 3RZOJ 3ANPA 5GPAA 1JKOC 2N8GA 3BR3A 1XS9A 1JTYA 2FQ4A 3JSJA 3BTIA 4UUSA 2F07A 4MFDA 1UI5A 3BTLA 1I6HJ 2KT0A 1GV5A 3S15J 1WI3A 1S7EA 4QTRA 5K7FA 1MH4A 3LOCA 3OIOA 4A3IJ 3EUPA 3CCYA 3OSGA 1WGXA 5FKKA 2GLOA 4DYRA 2EZKA 5F1JA 3CMYA 2X6OA 4NDLA 4XRMA 3UKGA 1WCMJ 2DA5A 1I3QJ 5GP9A 3NXCA 5F0FA 4ABZA 3SDGA 1IRZA 1SGMA 1WPKA 3S2DJ 4BBSJ 4C3JJ 3HGYA 2NVQJ 1IGNA 1JUMA 5J1UA 1ZKGA 1IDZA 1UI6A 1ETXA 2HOTA 1NK3P 2E2JJ 3BRUA 2LVSA 3VUQA 3VPRA 3HOWJ 1OJLA 2KDZA 2L7ZA 2JK3A 3O60A 3VW0A 1IG7A 3VOXA 2IU5A 3BJBA 5E3MA 4NELA 3RH2A 4AYBN 2QWTA 2WUIA 2G0EA 3GZIA 1T33A 3A03A 9ANTA 1UG2A 1O4XA 2R5ZB 1TWAJ 5K7ZA 2O9LA 3H3VK 5JLXA 3TP3A 2Q24A 5EGOA 3AQTA 5J1RA 1ETQA 5FJ8J 3CRJA 2YUSA 3WHCA 5IP7J 3HTJA 2DA2A 3IH2A 1TC3C 1OFCX 3HOUJ 5FLVA 2GM4A 2M8GX 1WH7A 1P7JA 4JYKA 5EFYA 1ORKA 3HTAA 3NARA 3JR9A 1MBFA 1T56A 4IEJA 1RESA 1P7IA 3LSRA 4A3MJ 3VW2A 2XRLA 2EBIA 5EZGA 5K7HA 3I4NJ 3FKIJ 5FKLA 3G1MA 1BW5A 2ZCNA 4D7NA 5M5WJ 3JRGA 3HOZJ 4D5CA 5F0CA 1ZGWA 2V57A 1RKWA 2FBQA 1B72A 1ENHA 2XSDC 1GVDA 2M34A 2DA6A 3BHQA 2GFNA 2NS7A 1ETYA 2ECBA 5EF6A 2FX0A 3LHQA 5D1RA 4ME9A 1LFBA 2GBYA 2DJNA 3PO2J 3NRGA 4C3IJ 3ON4A 3BCGA 4FTHA 2HYTA 5JLWA 3GTJJ 3TW6A 3BTJA 5M3MJ 1HOMA 1OCPA 4XICA 1GV2A 4UUSB 2QF7A 1MBHA 1IUFA 3EGQA 4IHWA 2XGEA 3IH3A 5K58A 2L7MP 2Y31A 1G2HA 4M3BA 4CYCA 1ETKA 3BR2A 1LE8A 4A69C 5M3FJ 2K9NA 1AU7A 5CXGA 3GTMJ 3ANGA 2B63J 4GCLA 4FCYA 5DS9A 3BR5A 1JJ6C 1F36A 5H9TA 3JRBA 1ETVA 3P9TA 1FJLA 1WH5A 2VUMJ 2UXPA 4GFKA 2CU7A 2Y2ZA 2E2IJ 3Q0WA 4GCKA 5F08A 3A02A 3O8GA 3PASA 3HE0A 2LK2A 4MIMA 1FEXA 1Q1VA 5IP9J 2RAEA 4M3EA 1DU6A 4W97A 2EQRA 5M5XJ 2EZHA 1ZQ3P 3K7AJ 2H1KA 1VFCA 1B8IA 3S5RA 5EGOB 2I10A 4G12A 3RZDJ 4M3GA 2D5VA 4S0HB 5BNGA 2WV1A 5FKOA 3S1NJ 3TP0A 1MBKA 4BY1J 1YRNA 4BXXJ 4LOCA 3L1PA 2FJ1A 2L0KA 3LWJA 2DA7A 2HXIA 2XGDA 4AF5A 4A93J 4W1UA 3LSGA 1XG1A 5E3LA 1U78A 4A3LJ 3LSJA 5DTDA 1CQTA 3M4OJ 5IOYA 2R5YA 3TEDA 1MBJA 4X6AJ 3K2AA 3SFIA 3C2BA 5C4YA 2LD5A 1QPIA 2WB1N 2DMPA 2LR8A 2NP3A 1B72B 2RHAA 3GEUA 3HM5A 4C3HJ 5FKMA 5E3NA 4B3AA 2VKEA 1HDDC 2WAQN 5IYDJ 1ZK8A 2E19A 4GFBA 2JMWA 5E3OA 4BBRJ 3GBGA 3S14J 3E7QA 5HSZA 1JGGA 3B81A 4C2MJ 2ME6A 4A3DJ 5F04A 2VKVA 1RR7A 4DW6A 4GCTA 3PPBA 2PZ9A 2AO9A 3VOKA 1MBEA 3VVYA 3PM1A 3IH4A 2DMUA 1K61A 2Y9YA 3KKDA 3QBMA 3HBLA 1JTXA 2E1OA 2JA8J 3VVZA 3FRQA 4CYCB 1W0UA 1LE8B 2OI8A 2OERA 3MN2A 4DYCA 3F0CA 3BG9A 4M6VA 2HQ5A 5EEAA 5CXIA 3Q0VA 1A6IA 5IYBJ 2MW8A 3HOYJ 3GTPJ 5CW8A 1VF9A 5FKNA 2OPTA 1BJZA 2CQXA 1DU0A 3BG3A 5AQCA 1JKQC 1HLVA 2R0QC 4A3KJ 2LTPA 4D7MA 2CUEA 1LFUP 2WGBA 3H0GJ 2TRTA 4Y7NJ 1TWFJ 4M3DA 2G7LA 3KNWA 2DMTA 2G3BA 2G7GA 3IV5A 1JUPA 5IP6A 2M9HA 2QIBA 3IUVA 2PMZN 4XRSG 4MFEA 1X2MA 3JRFA 4DZPA 2VI6A 2MGQA 4I76A 3RD3A 1TWCJ 1Z77A 2EH3A 1U8BA 2COBA 3M3YJ 3DPJA 4A3JJ 1QVUA 4A3BJ 4MXMA 1PUFA 2XPWA 3MKLA 3TW7A 4PXIA 3ZQLA 5DAJA 1RPWA 1B8IB 4V2GA 5IPAA 3GTKJ 2DN0A 1JT0A 2ZB9A 2Y0SN 1VNDA 3G1OA 4DYQA 2JA6J 3MVPA 2DA4A 1GT0C 2DTZA 3ZQGA 3BQYA 3G7RA 3NPIA 4A3FJ 4MK6A 3G1LA 5F27A 1UHSA 2CRGA 1RETA 3JRDA 4RDUA 1YRNB 1NK2P 1GUUA 1TWGJ 1AKHA 3A01A 2R7ZJ 3S1MJ 2JWTA 2REKA 4XK4A 3CJDA 4CGRA 4V2FA 3C07A 4X1EA 2RASA 3BR6A 4DZJA 1APLC 4Y52J 2DG7A 1MBGA 2R92J 4JNNA 4A3CJ 3B6AA 3HGGA 2JA7J 2D6YA 2QOPA 2R5YB 1HDPA 2QTQA 4KWAA 2IAIA 5C4XJ 3B6CA 3AQSA 4IHXA 4ACIA 4L62A 5J3LA 3LNQA 3QPSA 4FE7A 1MNMC 1JT6A 4FE4A 2QCOA 4L5EA 4AUXA 1VI0A 2JA5J 3HDDA 5C4JJ 1A5JA 2ID6A 3LJLA 2VPRA 3S1RJ 3BTCA 1POGA 1ETOA 3CDLA 5D19A 2AHQA 3T6NA 2M0CA 3FK7A 5FMPA 3W6VA 3E7LA 4D5FA 1X58A 1H8AC 3ON2A 2W48A 1HF0A 3QQAA 2IBDA 3S2HJ 2CJJA 2MSYA 3BR0A 2Y9ZA 2YVEA 1Y1VJ 2X9DA 1MH3A 2ZOYA 1ZTRA 2E2HJ 1HCRA 5M5YJ 1UMQA 4RBOA 2NVXJ 3GTQJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BL0 A;  5FGL A;  3OOU A;  3DCF A;  3HTI A;  2FD5 A;  2UXU A;  4FIS A;  1QVT A;  3BR1 A;  5C44 J;  3JRC A;  3O8H A;  2HYJ A;  4B1R A;  3JRA A;  4JL3 A;  2UXO A;  3BQZ A;  1D5Y A;  1U9N A;  4JP0 A;  5F0H A;  4AC6 A;  3VP5 A;  2XB5 A;  3FIS A;  4MLO A;  2MG4 A;  1FTT A;  1X2N A;  4EEF G;  5EZH A;  3D1N I;  2XDN A;  5EYR A;  4B4C A;  2ZOZ A;  3LSP A;  3CWR A;  3ZQH A;  2DA1 A;  1SAN A;  2LY9 A;  2XB0 X;  4MO7 A;  3ZQF A;  4J19 A;  3VVX A;  5EG0 A;  1R9T J;  1TWH J;  2G7S A;  3GTG J;  4UDS A;  2HOA A;  1MSE C;  2UXI A;  1PUF B;  1AHD P;  2EZI A;  4ICH A;  2YVH A;  5GPC A;  1BW6 A;  1IDY A;  5C3E J;  3S1Q J;  3NAU A;  3HKZ N;  4A3G J;  3KKC A;  3BG5 A;  2O7T A;  2K9S A;  2GUH A;  3HB9 A;  2L9R A;  3PO3 J;  2CUF A;  4XID A;  2GEN A;  2ID3 A;  3HEF A;  4XRS A;  1NTC A;  1ZR4 A;  4JX6 A;  1FIA A;  4JX4 A;  1W0T A;  2HOS A;  2ZCM A;  3JRH A;  2ELK A;  4HNV A;  1AKH B;  4IHY A;  3NNR A;  4GFL A;  5J1Y A;  3A01 B;  4I6Z A;  3F1B A;  2NS8 A;  3V6G A;  3HOV J;  1K83 J;  4YZE A;  3VIB A;  2XPV A;  2DA3 A;  3Q0U A;  4HKU A;  3S17 J;  1IJW C;  2HDD A;  2R93 J;  5HAW A;  1RKT A;  1XC5 A;  1U9O A;  1MSF C;  3HIM A;  3RQI A;  1BA5 A;  1ZR2 A;  3I4M J;  2EZL A;  2O8K A;  3FIW A;  1F43 A;  2YU9 J;  3S16 J;  1JKP C;  2ZCX A;  5IYC J;  2TCT A;  1Z0X A;  3CQZ J;  2DG8 A;  4AC0 A;  4BKX A;  2HKU A;  1E3O C;  4JKZ A;  3OSF A;  3DEW A;  5FHP A;  4QIW N;  2P81 A;  2K40 A;  2K9Q A;  2UXH A;  2XPU A;  4QSH A;  3WHB A;  1ITY A;  2LKX A;  1JUS A;  3KZ9 A;  1IV6 A;  2R5Z A;  4M3F A;  3RKQ A;  5IOZ A;  1GDT A;  1JJ8 C;  2W53 A;  5HBU A;  1FTZ A;  1SFO J;  1EF4 A;  2NX4 A;  4NN1 A;  1H88 C;  3VW1 A;  1QRY A;  5FLM J;  4JX5 A;  2OF7 A;  3QPL A;  3JRE A;  3G56 A;  3QKX A;  2LP0 A;  1I50 J;  3HOX J;  3FK6 A;  2QKO A;  1FIP A;  2NVT J;  3HTH A;  2JN6 A;  2LLK A;  2DMN A;  2NOG A;  4BY7 J;  3ZQC A;  3NI7 A;  1ETW A;  2Y30 A;  2NVY J;  3COL A;  3BNI A;  2HI3 A;  3GTL J;  2O7O A;  3BT9 A;  5D18 A;  5EDN A;  3GTO J;  2ME0 A;  2X48 A;  1H89 C;  5EG0 B;  2JJ7 A;  3Q3S A;  2ECC A;  2H8R A;  2DMQ A;  2CQQ A;  2HXO A;  2LFB A;  3MNL A;  3V78 A;  3ZQI A;  1JKR C;  2IEK A;  3JRI A;  2PBX A;  4IHV A;  3SJM A;  2M2E A;  3ZOB A;  5HOD A;  4A3E J;  1IC8 A;  2L7F P;  2XGC A;  2YS9 A;  1Y1W J;  2NP5 A;  1OCT C;  4UUT A;  3RZO J;  3ANP A;  5GPA A;  1JKO C;  2N8G A;  3BR3 A;  1XS9 A;  1JTY A;  2FQ4 A;  3JSJ A;  3BTI A;  4UUS A;  2F07 A;  4MFD A;  1UI5 A;  3BTL A;  1I6H J;  2KT0 A;  1GV5 A;  3S15 J;  1WI3 A;  1S7E A;  4QTR A;  5K7F A;  1MH4 A;  3LOC A;  3OIO A;  4A3I J;  3EUP A;  3CCY A;  3OSG A;  1WGX A;  5FKK A;  2GLO A;  4DYR A;  2EZK A;  5F1J A;  3CMY A;  2X6O A;  4NDL A;  4XRM A;  3UKG A;  1WCM J;  2DA5 A;  1I3Q J;  5GP9 A;  3NXC A;  5F0F A;  4ABZ A;  3SDG A;  1IRZ A;  1SGM A;  1WPK A;  3S2D J;  4BBS J;  4C3J J;  3HGY A;  2NVQ J;  1IGN A;  1JUM A;  5J1U A;  1ZKG A;  1IDZ A;  1UI6 A;  1ETX A;  2HOT A;  1NK3 P;  2E2J J;  3BRU A;  2LVS A;  3VUQ A;  3VPR A;  3HOW J;  1OJL A;  2KDZ A;  2L7Z A;  2JK3 A;  3O60 A;  3VW0 A;  1IG7 A;  3VOX A;  2IU5 A;  3BJB A;  5E3M A;  4NEL A;  3RH2 A;  4AYB N;  2QWT A;  2WUI A;  2G0E A;  3GZI A;  1T33 A;  3A03 A;  9ANT A;  1UG2 A;  1O4X A;  2R5Z B;  1TWA J;  5K7Z A;  2O9L A;  3H3V K;  5JLX A;  3TP3 A;  2Q24 A;  5EGO A;  3AQT A;  5J1R A;  1ETQ A;  5FJ8 J;  3CRJ A;  2YUS A;  3WHC A;  5IP7 J;  3HTJ A;  2DA2 A;  3IH2 A;  1TC3 C;  1OFC X;  3HOU J;  5FLV A;  2GM4 A;  2M8G X;  1WH7 A;  1P7J A;  4JYK A;  5EFY A;  1ORK A;  3HTA A;  3NAR A;  3JR9 A;  1MBF A;  1T56 A;  4IEJ A;  1RES A;  1P7I A;  3LSR A;  4A3M J;  3VW2 A;  2XRL A;  2EBI A;  5EZG A;  5K7H A;  3I4N J;  3FKI J;  5FKL A;  3G1M A;  1BW5 A;  2ZCN A;  4D7N A;  5M5W J;  3JRG A;  3HOZ J;  4D5C A;  5F0C A;  1ZGW A;  2V57 A;  1RKW A;  2FBQ A;  1B72 A;  1ENH A;  2XSD C;  1GVD A;  2M34 A;  2DA6 A;  3BHQ A;  2GFN A;  2NS7 A;  1ETY A;  2ECB A;  5EF6 A;  2FX0 A;  3LHQ A;  5D1R A;  4ME9 A;  1LFB A;  2GBY A;  2DJN A;  3PO2 J;  3NRG A;  4C3I J;  3ON4 A;  3BCG A;  4FTH A;  2HYT A;  5JLW A;  3GTJ J;  3TW6 A;  3BTJ A;  5M3M J;  1HOM A;  1OCP A;  4XIC A;  1GV2 A;  4UUS B;  2QF7 A;  1MBH A;  1IUF A;  3EGQ A;  4IHW A;  2XGE A;  3IH3 A;  5K58 A;  2L7M P;  2Y31 A;  1G2H A;  4M3B A;  4CYC A;  1ETK A;  3BR2 A;  1LE8 A;  4A69 C;  5M3F J;  2K9N A;  1AU7 A;  5CXG A;  3GTM J;  3ANG A;  2B63 J;  4GCL A;  4FCY A;  5DS9 A;  3BR5 A;  1JJ6 C;  1F36 A;  5H9T A;  3JRB A;  1ETV A;  3P9T A;  1FJL A;  1WH5 A;  2VUM J;  2UXP A;  4GFK A;  2CU7 A;  2Y2Z A;  2E2I J;  3Q0W A;  4GCK A;  5F08 A;  3A02 A;  3O8G A;  3PAS A;  3HE0 A;  2LK2 A;  4MIM A;  1FEX A;  1Q1V A;  5IP9 J;  2RAE A;  4M3E A;  1DU6 A;  4W97 A;  2EQR A;  5M5X J;  2EZH A;  1ZQ3 P;  3K7A J;  2H1K A;  1VFC A;  1B8I A;  3S5R A;  5EGO B;  2I10 A;  4G12 A;  3RZD J;  4M3G A;  2D5V A;  4S0H B;  5BNG A;  2WV1 A;  5FKO A;  3S1N J;  3TP0 A;  1MBK A;  4BY1 J;  1YRN A;  4BXX J;  4LOC A;  3L1P A;  2FJ1 A;  2L0K A;  3LWJ A;  2DA7 A;  2HXI A;  2XGD A;  4AF5 A;  4A93 J;  4W1U A;  3LSG A;  1XG1 A;  5E3L A;  1U78 A;  4A3L J;  3LSJ A;  5DTD A;  1CQT A;  3M4O J;  5IOY A;  2R5Y A;  3TED A;  1MBJ A;  4X6A J;  3K2A A;  3SFI A;  3C2B A;  5C4Y A;  2LD5 A;  1QPI A;  2WB1 N;  2DMP A;  2LR8 A;  2NP3 A;  1B72 B;  2RHA A;  3GEU A;  3HM5 A;  4C3H J;  5FKM A;  5E3N A;  4B3A A;  2VKE A;  1HDD C;  2WAQ N;  5IYD J;  1ZK8 A;  2E19 A;  4GFB A;  2JMW A;  5E3O A;  4BBR J;  3GBG A;  3S14 J;  3E7Q A;  5HSZ A;  1JGG A;  3B81 A;  4C2M J;  2ME6 A;  4A3D J;  5F04 A;  2VKV A;  1RR7 A;  4DW6 A;  4GCT A;  3PPB A;  2PZ9 A;  2AO9 A;  3VOK A;  1MBE A;  3VVY A;  3PM1 A;  3IH4 A;  2DMU A;  1K61 A;  2Y9Y A;  3KKD A;  3QBM A;  3HBL A;  1JTX A;  2E1O A;  2JA8 J;  3VVZ A;  3FRQ A;  4CYC B;  1W0U A;  1LE8 B;  2OI8 A;  2OER A;  3MN2 A;  4DYC A;  3F0C A;  3BG9 A;  4M6V A;  2HQ5 A;  5EEA A;  5CXI A;  3Q0V A;  1A6I A;  5IYB J;  2MW8 A;  3HOY J;  3GTP J;  5CW8 A;  1VF9 A;  5FKN A;  2OPT A;  1BJZ A;  2CQX A;  1DU0 A;  3BG3 A;  5AQC A;  1JKQ C;  1HLV A;  2R0Q C;  4A3K J;  2LTP A;  4D7M A;  2CUE A;  1LFU P;  2WGB A;  3H0G J;  2TRT A;  4Y7N J;  1TWF J;  4M3D A;  2G7L A;  3KNW A;  2DMT A;  2G3B A;  2G7G A;  3IV5 A;  1JUP A;  5IP6 A;  2M9H A;  2QIB A;  3IUV A;  2PMZ N;  4XRS G;  4MFE A;  1X2M A;  3JRF A;  4DZP A;  2VI6 A;  2MGQ A;  4I76 A;  3RD3 A;  1TWC J;  1Z77 A;  2EH3 A;  1U8B A;  2COB A;  3M3Y J;  3DPJ A;  4A3J J;  1QVU A;  4A3B J;  4MXM A;  1PUF A;  2XPW A;  3MKL A;  3TW7 A;  4PXI A;  3ZQL A;  5DAJ A;  1RPW A;  1B8I B;  4V2G A;  5IPA A;  3GTK J;  2DN0 A;  1JT0 A;  2ZB9 A;  2Y0S N;  1VND A;  3G1O A;  4DYQ A;  2JA6 J;  3MVP A;  2DA4 A;  1GT0 C;  2DTZ A;  3ZQG A;  3BQY A;  3G7R A;  3NPI A;  4A3F J;  4MK6 A;  3G1L A;  5F27 A;  1UHS A;  2CRG A;  1RET A;  3JRD A;  4RDU A;  1YRN B;  1NK2 P;  1GUU A;  1TWG J;  1AKH A;  3A01 A;  2R7Z J;  3S1M J;  2JWT A;  2REK A;  4XK4 A;  3CJD A;  4CGR A;  4V2F A;  3C07 A;  4X1E A;  2RAS A;  3BR6 A;  4DZJ A;  1APL C;  4Y52 J;  2DG7 A;  1MBG A;  2R92 J;  4JNN A;  4A3C J;  3B6A A;  3HGG A;  2JA7 J;  2D6Y A;  2QOP A;  2R5Y B;  1HDP A;  2QTQ A;  4KWA A;  2IAI A;  5C4X J;  3B6C A;  3AQS A;  4IHX A;  4ACI A;  4L62 A;  5J3L A;  3LNQ A;  3QPS A;  4FE7 A;  1MNM C;  1JT6 A;  4FE4 A;  2QCO A;  4L5E A;  4AUX A;  1VI0 A;  2JA5 J;  3HDD A;  5C4J J;  1A5J A;  2ID6 A;  3LJL A;  2VPR A;  3S1R J;  3BTC A;  1POG A;  1ETO A;  3CDL A;  5D19 A;  2AHQ A;  3T6N A;  2M0C A;  3FK7 A;  5FMP A;  3W6V A;  3E7L A;  4D5F A;  1X58 A;  1H8A C;  3ON2 A;  2W48 A;  1HF0 A;  3QQA A;  2IBD A;  3S2H J;  2CJJ A;  2MSY A;  3BR0 A;  2Y9Z A;  2YVE A;  1Y1V J;  2X9D A;  1MH3 A;  2ZOY A;  1ZTR A;  2E2H J;  1HCR A;  5M5Y J;  1UMQ A;  4RBO A;  2NVX J;  3GTQ J; 
#chains in the Genus database with same CATH topology
 3WG7 H;  1IF1 A;  2E5N A;  4RM3 A;  5GTI C;  1G3Y A;  2MLG A;  1SC7 A;  1E17 A;  2IA1 A;  4N4N B;  3K0L A;  2OQR A;  4V19 K;  3BR1 A;  3OWT A;  2BVL A;  5CPR B;  3FBN B;  1D5Y A;  3C2G A;  3WTT C;  4JP0 A;  2IA0 A;  2XB5 A;  3FIS A;  1WJB A;  4MLO A;  4OWR B;  2MG4 A;  4CYD A;  1T08 B;  4DBR A;  3M8F A;  1ON1 A;  3RKW A;  3CCL I;  5H20 A;  5LGN A;  2ZOZ A;  5DM7 F;  4LK1 F;  3ZQH A;  2DA1 A;  2EJR A;  3FM5 A;  3PUB A;  4KDP A;  1VTN C;  4J19 A;  2VLA A;  3KP3 A;  1HC8 A;  1SVL A;  2K02 A;  1TWH J;  5TJJ A;  2KRC A;  2PMU A;  3WU2 C;  2A2F X;  3L2U A;  2V7F A;  3BJ6 A;  3L9F A;  2Y48 A;  3CLO A;  3CCR I;  2YVH A;  5GPC A;  2UXX A;  3S1Q J;  1IW7 F;  2O7T A;  2LY1 A;  5E20 A;  2GUH A;  1QZZ A;  2IGM A;  3WE2 A;  4XOR A;  1YX5 A;  4IXA A;  2GEN A;  3HXL A;  3G2B A;  1E2X A;  1NTC A;  4EJW A;  2ZCM A;  2XRN A;  4RAG A;  1YJN I;  1S72 I;  4I0B A;  3OYN A;  1LVA A;  3DV8 A;  3JRH A;  5FGM A;  5J1Y A;  2BW3 A;  2ELH A;  2OCC H;  2QQA A;  3CC7 I;  3A4C A;  1K83 J;  1D8K A;  2KQR A;  5JR3 A;  2CV0 A;  4HA8 A;  4HKU A;  4RLF A;  2CUZ A;  2WC2 A;  2KIS A;  1RKT A;  3LFU A;  4ZDP A;  3CDH A;  4F3Q A;  1ZR2 A;  2JPC A;  1ZG1 A;  3I4M J;  2EZL A;  2GQQ A;  4PJJ A;  1EH8 A;  1F43 A;  1LFP A;  1JKP C;  4A6E A;  3K10 A;  2HWV A;  3ZMS A;  1FP1 D;  2QEN A;  1I6X A;  1BIB A;  2HKU A;  5LBQ A;  1Y6I A;  3MD2 A;  3D5S C;  4P9U A;  2DDB A;  2K40 A;  3H9Q A;  2J5O A;  2BY1 A;  3ELK A;  5E1X A;  3HSR A;  2R3S A;  2R5Z A;  4L9N A;  1ZRC A;  1TLH B;  1UHW A;  3RKQ A;  2W53 A;  3CF5 F;  2P8T A;  1N25 A;  5L3B A;  2NAZ A;  4YFK F;  2E1M B;  3JRE A;  3HOX J;  5DUK A;  2NVT J;  2JN6 A;  2OZ6 A;  3PUF A;  4BY7 J;  3WU0 A;  3ZQC A;  1B59 A;  1V5F A;  4KNY A;  3RKX A;  1K4T A;  2VT2 A;  3DU5 A;  3L00 A;  3A0H C;  3GX4 X;  4IQJ A;  1W7P D;  3BT9 A;  2PJP A;  2IT0 A;  4HDV A;  3IKV A;  3ECO A;  1T38 A;  1K79 A;  2M0M A;  2KZV A;  3G71 I;  2X48 A;  4KJZ A;  2HXO A;  4MQV A;  3MNL A;  3WTX C;  2IEK A;  3DQV C;  3M9A A;  3KET A;  3HJE A;  4C2M A;  2A61 A;  3RYR A;  3G6E I;  2EIM H;  1VQ5 I;  4MHG A;  5HOD A;  5BOX A;  1G4D A;  2L7F P;  3U9G A;  4M9S A;  3TBI A;  1YO5 C;  3RZO J;  3ANP A;  5GPA A;  3ZQ7 A;  1TT0 A;  3JSJ A;  3BTI A;  3DEU A;  3QAH A;  4UUS A;  4WX9 A;  2KRH A;  4HNT A;  1YE9 A;  2FA5 A;  2ZFU A;  3BTL A;  4DBQ A;  4CIC A;  1GV5 A;  2IVM A;  3S15 J;  3K4K A;  2Q0O A;  3KE2 A;  1W36 D;  1S7E A;  2BW3 B;  1LJ9 A;  5E17 F;  2NXN B;  3OIO A;  2EIK H;  1O3T A;  3OSG A;  3LQQ A;  5FKK A;  2GLO A;  3J7A O;  3L09 A;  3T8R A;  2XUB A;  3GCM A;  3HTS B;  1VQN I;  2X6O A;  3GFI A;  3EET A;  5HNH A;  3HSF A;  4GCV A;  4BQQ A;  4ABZ A;  3SDG A;  2XKP A;  3V8K A;  2EFQ A;  5K5O A;  2IXS A;  4FET A;  4HQE A;  5J1U A;  2CUJ A;  3F6O A;  1NK3 P;  2H6B A;  1TZL A;  3VUQ A;  1XX5 A;  3F6V A;  1IXR C;  4IKF A;  1BOB A;  3GZ5 A;  2K4B A;  1FOK A;  1WJ5 A;  3RIR A;  3OS0 A;  4LLN A;  3KYD B;  3ZMU A;  1O7L A;  2P5K A;  4XNF A;  4DGW B;  1T33 A;  2DOE A;  2F6C A;  2IPQ X;  2VN2 A;  4I02 A;  2ZJQ F;  2IRF G;  5F6F A;  1AOY A;  3V7R A;  3WGH A;  4IL6 C;  1B6A A;  2ZO4 A;  2R5Z B;  4S05 A;  3TP3 A;  1SD4 A;  1EA3 A;  1XCB A;  3K4B A;  5AON A;  5FJ8 J;  1BOA A;  1STZ A;  2R7D A;  3E5X A;  3T5X A;  2DA2 A;  4XSZ F;  3HOU J;  2DFF A;  5HS7 A;  2Q1Z B;  3AG4 H;  1DGW Y;  4BJ5 C;  4CDG A;  1OLT A;  5D6E A;  3ZR8 X;  4HZF A;  4O6J A;  4XLH A;  2M8G X;  4JYK A;  3SZP A;  2K86 A;  2VT3 A;  3CD6 I;  4ZYD A;  3PIO F;  1J59 A;  1P7I A;  3KP4 A;  3F8F A;  3I59 A;  4XLE A;  1Y56 A;  5EZG A;  3QOD A;  1XB4 A;  5FKL A;  2LY2 A;  4AD9 A;  2KDO A;  2PEX A;  3OYK A;  3VWB A;  1LVK A;  4UVB A;  2KMU A;  1ZGW A;  2DT5 A;  1EV7 A;  2DYS H;  2Y69 H;  3BLY A;  4BUP A;  1ENH A;  2XSD C;  3DF8 A;  2M34 A;  3VB2 A;  1N77 A;  3BHQ A;  2NS7 A;  1FT9 A;  1ETY A;  2CFX A;  2Z16 A;  4FQG A;  2BXY A;  5LD2 C;  2FX0 A;  3LHQ A;  3ABT A;  1LFB A;  2FRH A;  3E3V A;  3AKZ A;  3ON4 A;  4C3I J;  4FTH A;  1OPC A;  2HYT A;  2KZG A;  2A05 A;  2V6C A;  4XLA A;  2VAS A;  3DTE A;  2ZKZ A;  4CSW A;  1G3S A;  4XIC A;  4UUS B;  2DPU A;  2HTS A;  1MBH A;  2DFH A;  4IOA F;  5JFR A;  1FLI A;  2HNH A;  4LD5 A;  4Z6Y A;  4YIR X;  1D5V A;  3L2R A;  4CYC A;  3TOB A;  4E7K A;  2EA2 A;  4GYI A;  5M3F J;  1MMA A;  1YG2 A;  1UEL B;  1KQ8 A;  4GCL A;  3M07 A;  4MQ9 F;  4RLQ A;  5DS9 A;  3F21 A;  1D8J A;  1K6Y A;  4O3M A;  1I1S A;  2JSC A;  4CZZ A;  2M7A A;  2HVQ A;  2X6Y A;  1FJL A;  2QLZ A;  3FM3 A;  2VUM J;  1S8N A;  1HKQ A;  4OAZ A;  5F64 A;  2E5Z A;  2IP2 A;  4AYB A;  3NRV A;  2WTE A;  1ULY A;  2V6E A;  2CV2 A;  3E6D A;  2MBF A;  4AIK A;  3I53 A;  2LK2 A;  4OD4 A;  3DTI A;  4HPQ A;  4DNC A;  2WAD A;  4PFO A;  1ZQ3 P;  2MLK A;  1G8X A;  1VFC A;  2EV6 A;  1SVM A;  5LEK A;  3BZK A;  4EMS A;  2W85 A;  1R36 A;  3CJN A;  1MND A;  1UCR A;  1QU3 A;  3S1N J;  4B3X A;  4G6T B;  3TP0 A;  1YRN A;  2ZNZ A;  4BXX J;  2L0K A;  5CYV A;  2XGD A;  4AF5 A;  4CGZ A;  2DBB A;  4GYG A;  4W1U A;  1ZRF A;  4HSR A;  3I59 B;  3LSJ A;  4OMY A;  1CQT A;  4Q4Z F;  1UFM A;  4X6A J;  3EPZ A;  4LK0 F;  1KU9 A;  3KEY A;  5EJC A;  2WB1 N;  1MMD A;  5GTH C;  3CDI A;  5F1R A;  3HM5 A;  4PJN A;  1R5I D;  5E3N A;  2EFN A;  3VOE A;  3IAM 2;  2VKE A;  5K1Y A;  5IYD J;  4IPA A;  4GFB A;  4PUS A;  4KN7 X;  4BBR J;  4EGY A;  2JZY A;  2MA3 A;  4MEY F;  5DCF A;  1MMN A;  3CCU I;  2M4K A;  2O5R A;  4C2M J;  2ME6 A;  4U0Y A;  1SAX A;  5F04 A;  2VKV A;  1RR7 A;  3ECH A;  2VOD A;  3OYC A;  2F2E A;  1GVJ A;  3LSH A;  2PZ9 A;  5ILV A;  3CJT B;  5B1B H;  3PM1 A;  3IH4 A;  1WJF A;  2DK5 A;  2Y9Y A;  1Z21 A;  2HQA A;  2E1O A;  3VVZ A;  4U87 A;  3FRQ A;  5HOO A;  4ZZD A;  2GIV A;  4CYC B;  1QHG A;  2OI8 A;  4DYC A;  4KUM A;  3BG9 A;  4HDU A;  4M6V A;  5ED4 A;  3LFK A;  3Q0V A;  4PJM A;  5IYB J;  1T39 A;  1FBU A;  4BE2 A;  3ASO H;  5FKN A;  4XMY A;  2NNY A;  1BJZ A;  4BXF A;  2BE5 F;  5AQC A;  5E8I A;  1KON A;  1LFU P;  3LAP A;  4ZYA A;  4ZDL A;  2LG4 A;  2BVM A;  2OTL I;  4MGR A;  2Q8K A;  3BDD A;  3PQJ A;  2VKH A;  3RJP A;  5IP6 A;  2PMZ N;  3JRF A;  3CUQ A;  2VI6 A;  2MGQ A;  3FXU A;  4XLF A;  1TWC J;  4WCG A;  3KZI C;  4MXM A;  1PUF A;  3QPT A;  3MKL A;  5HS9 A;  3SWH A;  4YII A;  1FSE A;  4C2U A;  1RPW A;  4YFX F;  3O2P E;  4UV9 A;  2KRF A;  4BHC A;  2ZB9 A;  3JSP A;  2DA4 A;  1GT0 C;  2DTZ A;  2OA4 A;  3ZQG A;  2P5L C;  3GF2 A;  4KMF A;  3G7R A;  3NPI A;  3G1L A;  2LH9 A;  2CRG A;  5F27 A;  3MMY B;  3JRD A;  3CJQ B;  5CQG A;  2JUC A;  3BZC A;  3ERE D;  4G7Z F;  1AKH A;  1YRN B;  2FE3 A;  4II2 A;  5CKT A;  5B1A H;  1T2K A;  3S1M J;  1L0O C;  2REK A;  3QWL A;  2K3P A;  3K9T A;  4EJT A;  1APL C;  3SXY A;  2WY8 Q;  5L3C A;  4S04 A;  1R5G A;  1F4K A;  2D6Y A;  4G94 A;  1HDP A;  4CZC A;  4KWA A;  2IAI A;  1E3H A;  2DW4 A;  3AQS A;  3HRS A;  3HPH A;  5IT3 A;  1ZAO A;  2O3F A;  2VE9 A;  1B9N A;  1WJA A;  2HZD A;  1JT6 A;  4FE4 A;  2QCO A;  3SDB A;  3PFI A;  2QYO A;  2OZU A;  2P7V B;  4GXO A;  4KIS A;  3FWE A;  3QOP A;  2XF6 A;  2M0C A;  3KZZ A;  4GRI A;  3T6N A;  1WRJ A;  4P5O A;  4D5F A;  2ZJR F;  3S3O A;  2GWR A;  1HF0 A;  5H2F C;  2CYY A;  2CJJ A;  2MD0 A;  5DDG A;  4H0E A;  2Y9Z A;  1YIJ I;  1MIJ A;  3I54 A;  3TO6 A;  2YVE A;  5LHH A;  1IAW A;  2NRA C;  4RBO A;  2VQH A;  2KPM A;  1BR2 A;  4HNU A;  3OYB A;  3BY6 A;  1W5S A;  4ZZL A;  2XAG A;  2P0W A;  3E6M A;  5C44 J;  3O8H A;  2HYJ A;  4JL3 A;  4HLY A;  3BQZ A;  1ACI A;  2CQN A;  3KEO A;  3DWL E;  1U9N A;  2OAZ A;  3RKY A;  1V55 H;  1Y0U A;  2MC4 A;  1J2X A;  5EZH A;  3TDU C;  3QU6 A;  3VFZ A;  2I8D A;  1FX7 A;  4AIJ A;  2XDN A;  4IQ4 A;  1WWX A;  2P7C B;  3LSP A;  5LGU A;  1ZEL A;  4MO7 A;  3WTY C;  5D8L B;  3VVX A;  2CW7 A;  1SFK A;  1J09 A;  3CUQ B;  4B09 A;  1R9T J;  2EWN A;  4H4K C;  1ZLJ A;  3SYT A;  2IS2 A;  3IWZ A;  5J6X A;  1AWC A;  3GTG J;  2HOA A;  2XV4 S;  1MSE C;  2O03 A;  5DV5 A;  1PUF B;  1XMK A;  3DBR B;  4CCM A;  2Y0S A;  4L0Z B;  3NAU A;  3HKZ N;  1G3T A;  3ML6 A;  2K9S A;  1V5E A;  3HB9 A;  2L9R A;  3PO3 J;  2K85 A;  1EKE A;  3IHU A;  3OV8 A;  4JX4 A;  2XRO A;  3ZMZ A;  1MMS A;  2WAE A;  3ZXS A;  4YRV A;  1AKH B;  3F72 A;  1XGN A;  4GFL A;  3C18 A;  3BJA A;  2F5V A;  3FXL A;  4Y4R A;  2A6T A;  3V8L A;  4LMY A;  3F3X A;  3M8E A;  2VQL A;  4Y33 A;  2XPV A;  1TBX A;  3EQL F;  3V7S A;  4G9Y A;  1D1A A;  1U9O A;  1MSF C;  3HIM A;  3H1C A;  1LUJ B;  3M1E A;  4YFN F;  3FKJ A;  1QZE A;  2OCE A;  2O8K A;  3RQ4 A;  3P9K A;  3TQN A;  3S16 J;  4HG2 A;  5KAI C;  4RB0 A;  4AC0 A;  2CW8 A;  5L3G A;  2HOE A;  3J7Z I;  4CUG A;  4E7I A;  3QYF A;  4QPQ A;  2JT1 A;  4QIW N;  1BR1 A;  2ZSH B;  4N9H A;  2DK8 A;  3TDZ C;  3T0Y A;  2K9Q A;  1DDN A;  2KFD A;  3WHB A;  4I09 A;  2UXH A;  3CTA A;  2LKX A;  1IN4 A;  1S7O A;  4OIQ F;  1DQU A;  4RGS A;  2DFI A;  4XR6 A;  4M3F A;  4KIC A;  1GDT A;  4NNJ A;  1YIT I;  1JJ8 C;  2VOP A;  5HBU A;  2IJL A;  4C9Y A;  2DT6 A;  2DOD A;  1R00 A;  2X1C A;  1EF4 A;  2NX4 A;  2VXZ A;  2IGN A;  1H88 C;  2OTJ I;  2V1U A;  1YFH A;  3VW1 A;  1B4A A;  3CJR B;  4JX5 A;  4ETS A;  2DXI A;  3GTQ J;  1IN5 A;  3QPL A;  4K2E A;  3QKX A;  3I0T A;  3BJO A;  3E6B A;  3FK6 A;  1BC8 C;  1FIP A;  3HTH A;  2LLK A;  1X4O A;  3V7C A;  1K7A A;  1MJ9 A;  1OQY A;  4CHU A;  2FQ3 A;  3NI7 A;  3QP6 A;  2E34 A;  2EFP A;  4LG3 A;  1DP7 P;  2Y30 A;  5E1W A;  1Z05 A;  2DOA A;  1D1B A;  3KYL A;  3VEP A;  3BNI A;  4KYW A;  2BYV E;  2CQ7 A;  4UXN A;  3MWM A;  2NNN A;  3K4N A;  1YW8 A;  3EUH C;  3K70 C;  3MZH A;  5EDN A;  3GTO J;  3KP6 A;  2X1E A;  3G3Z A;  4PGH A;  4NBQ A;  5LRR A;  1R71 A;  1H89 C;  1UB9 A;  2H8R A;  2CQQ A;  2F4I A;  4FX4 A;  3V78 A;  3ZQI A;  2F5C A;  5L3F A;  5K5R A;  5ILU A;  4AWX B;  4NC8 A;  5FLX K;  3FMQ A;  2M2E A;  4F92 B;  4PJL A;  3ZOB A;  2NP5 A;  5FLX Z;  5CVR A;  1JKO C;  3BR3 A;  1H0M A;  2CS3 A;  1OR7 A;  3IWF A;  3T8T A;  1TQI A;  3K69 A;  2PN6 A;  3E6C C;  4KT6 A;  3G4S I;  3FXM A;  3R6S A;  3MFK A;  1MH4 A;  3DBL B;  3SFZ A;  4I0A A;  4BQO A;  3EUP A;  1WGX A;  1HW2 A;  1TQP A;  4HF0 A;  2LBF A;  1Z6T A;  4FAS D;  4M6X A;  2EK5 A;  3F8B A;  3QYB A;  4A0Y A;  1CGP A;  2FUG 2;  1SD7 A;  1WCM J;  3NXC A;  3HC7 A;  3DTK A;  2CSO A;  1SGM A;  3S2D J;  4BBS J;  3HGY A;  1JUM A;  2W25 A;  2HOT A;  1IZ1 A;  1P2F A;  3T1B A;  2E2J J;  3D5R C;  3W6K B;  4PZJ A;  3SZG A;  5LEJ A;  2L7Z A;  2OJE D;  4G8X A;  1M1E B;  3O60 A;  3JTH A;  2OUM A;  1H9T A;  4NEL A;  4LB5 A;  3RH2 A;  4EJO A;  2IGK A;  2WUI A;  1KA8 A;  2FBK A;  4Q48 A;  1FY7 A;  2M7B A;  2VJI A;  3L2V A;  1TWA J;  3S93 A;  5K7Z A;  4GGG A;  2Q24 A;  4IZZ A;  3AQT A;  3CRJ A;  1IXC A;  3BWG A;  5IP7 J;  3HTJ A;  1TNS A;  1ZN2 A;  1SMY F;  2CQK A;  4ZTJ A;  1SFU A;  1OFC X;  2JVG A;  2KHM A;  1J0R A;  4M9X A;  1T95 A;  5J4Y A;  1FYM A;  1ORK A;  3NAR A;  1LKX A;  1MBF A;  1ODD A;  1RES A;  3A2K A;  2L9N A;  3VYS B;  2W82 A;  1USS A;  3D5L A;  3HHH A;  3OYI A;  3I4N J;  1BW5 A;  3G1M A;  4ON0 A;  2VXD A;  3F9K A;  3KX2 A;  3JRG A;  3BRO A;  4D5C A;  2V57 A;  3QPH A;  1RKW A;  2NVU B;  2FBQ A;  1R4N B;  1GVD A;  1YS7 A;  2Z9O A;  2W4S A;  3F22 A;  1D1C A;  1PUE E;  2VOO A;  3CCQ I;  2EV5 A;  4NUB A;  2F4O B;  4E4H A;  4U0V A;  3PO2 J;  3ZMV A;  1RC9 A;  4NQW A;  3CCM I;  3HG9 A;  4IJA A;  5JLW A;  4ZYH A;  2XF7 A;  4OAY A;  1PJR A;  4E7S A;  1HOM A;  3K6G A;  1GV2 A;  5BPD A;  1HSJ A;  3R60 A;  4OIR F;  3EGQ A;  1FBS A;  3IH3 A;  2Y31 A;  1G2H A;  4M3B A;  2BHY A;  2LRD A;  3DXJ F;  3BR2 A;  4HEA 2;  1LE8 A;  1HQC A;  2HPI A;  4RAF A;  2X4H A;  4OU0 A;  3HSE A;  4BYY A;  4GDF A;  1AU7 A;  3GTM J;  2DU9 A;  2LBF B;  2B63 J;  4XKW A;  1J9I A;  4C2T A;  2FEZ A;  3BR5 A;  3LSK A;  1JJ6 C;  5FRM A;  2DOF A;  3H36 A;  5H6Q A;  4ZYG A;  2F5D A;  3PSI A;  3A1Y A;  5LRS A;  4BDY A;  4ZDO A;  2UXP A;  4GFK A;  2XVC A;  1OCR H;  1XSX A;  2G7H A;  3JTG A;  3MAJ A;  5HDG A;  2QGU A;  3IRR A;  3Q0W A;  1OYI A;  2QQB A;  4XRF A;  2BOL A;  1U5T C;  4PSW A;  4DOZ A;  5D5X B;  3GZN B;  3HE0 A;  1FEX A;  2HFH A;  1CF7 A;  2VBW A;  2RAE A;  2GAU A;  1IRF A;  4M74 A;  4W97 A;  5M5X J;  2H1K A;  1FPQ A;  2EZH A;  1MW7 A;  2ZXJ A;  1B8I A;  2R7W A;  1EH6 A;  4G12 A;  3ABU A;  1F5T A;  4M73 A;  2EFW A;  4M3G A;  4ITV A;  5FKO A;  2V1D A;  2HQR A;  3EDP A;  4CO8 A;  1S7A A;  2FJ1 A;  1R1U A;  4L9V A;  5IT9 K;  4L5J A;  3LSG A;  5IT9 Z;  1W36 C;  4QPO A;  4L18 B;  2ESN A;  5E3L A;  4IX7 A;  3E5U A;  2OQG A;  4NB5 A;  5DTD A;  1FSH A;  2E7X A;  1BM9 A;  3ZRG A;  3TED A;  5CVU A;  1R23 A;  3OL4 A;  3G73 A;  3H5N A;  1MNE A;  1XTA A;  2DMP A;  2W00 A;  4LG0 A;  5GAD J;  4XLC A;  3CC4 I;  1UJ8 A;  2D1V A;  3H5A A;  4M71 A;  2CWE A;  5L3E A;  2WAQ N;  2VBY A;  1ZK8 A;  4DVY P;  1V4R A;  4NQW B;  4BDZ A;  1E3P A;  1REP C;  2I5U A;  3GBG A;  2BY0 A;  2RQQ A;  1VQK I;  4E70 A;  2ISZ A;  4KIT B;  5HSZ A;  1JGG A;  1WFX A;  4DW6 A;  2EIJ H;  2VL8 A;  2YR2 A;  4BH9 A;  5DD4 A;  2ICW G;  1MBE A;  2QUF A;  3R0A A;  3OYH A;  1OCZ H;  1K61 A;  1HKT A;  1S29 A;  3HYI A;  1A6Q A;  3QOE A;  3QU3 A;  2H27 A;  1AA7 A;  4ANJ A;  1LE8 B;  2QQ8 A;  2W1O A;  3MN2 A;  5ICF A;  3U1K A;  5KAF C;  5KCM A;  3JSO A;  3CP2 A;  4XN3 A;  5B3S H;  1R1V A;  4E7Z A;  5HS8 A;  4BXU A;  2JA7 J;  1OIS A;  1Z7U A;  1P4W A;  1JKQ C;  3OS2 A;  4LGW A;  2STT A;  1HLV A;  2R0Q C;  1RRJ A;  1Z3Y A;  2WAF A;  2LTP A;  2DO7 A;  2CUE A;  1ZGA A;  4Y7N J;  5JHU A;  1WSU A;  3HPG A;  2L7K A;  3A0B C;  3KZY A;  1LEA A;  4KFC A;  1SFX A;  2M9H A;  3H5R A;  5B5E C;  2BBY A;  1X2M A;  3ESW B;  4DZP A;  1N75 A;  3H35 A;  4BL0 B;  4A3J J;  2IW5 A;  2XPW A;  1CF7 B;  2JQ7 A;  3ZQL A;  2NYX A;  3V42 A;  4ZH4 F;  1RUN A;  1B8I B;  2DN0 A;  1JT0 A;  2UXN A;  1R1T A;  5J47 A;  3G1O A;  2VON A;  4IHT A;  3AL0 C;  3KFW X;  4MK6 A;  4BE1 A;  3OMY A;  2HYG D;  1YI2 I;  1MD0 A;  1GUU A;  3IL2 A;  3A01 A;  5ICE A;  1LDK B;  3CJD A;  3C07 A;  2RAS A;  3FXO A;  1VQ8 I;  4EM0 B;  4EM2 A;  4Y52 J;  2DG7 A;  1NG6 A;  2OBP A;  3I56 I;  4A3C J;  2WB1 A;  3B6A A;  3HGG A;  4KIF A;  5B66 C;  3OYG A;  3D0S A;  4NHJ A;  1WJC A;  3HRM A;  4DIQ A;  3WTV C;  2JTV A;  1PP8 F;  1XMA A;  4LFU A;  2X6W A;  4LG0 B;  1X1P A;  1KU7 A;  1QPM A;  5J3L A;  1BC7 C;  2VQC A;  4FE7 A;  5GAG J;  3IRQ A;  5C4J J;  2DYR H;  1X19 A;  3LJL A;  4AVP A;  3S1R J;  2FNP A;  2XAJ A;  1POG A;  4RB1 A;  1H8A C;  3CF2 A;  4LLL A;  2W48 A;  1F1Z A;  2IBD A;  1XDU A;  4F52 A;  2EFO A;  2MSY A;  4U7B A;  2YU3 A;  2DDA A;  1MH3 A;  1O7F A;  2L2O A;  1RZ4 A;  5KVR A;  2E2H J;  1LNW A;  4MEX F;  1HCR A;  2GA1 A;  2DAO A;  2HGC A;  4HLX A;  5BQT A;  1NG7 A;  1UG0 A;  2PX9 A;  2FBH A;  1WHU A;  2KIU A;  3OOU A;  5FGL A;  3DCF A;  3HTI A;  1B9M A;  2FD5 A;  2UXU A;  2M1B A;  1QVT A;  3I9V 2;  4B1R A;  2JRT A;  5J4V A;  3CES A;  4AC6 A;  5F0H A;  3D1N I;  2LOO A;  2Q2E A;  3TO7 A;  1YJ9 I;  2XF5 A;  5EYR A;  4B4C A;  5GAH J;  2KLO A;  1O3S A;  3CWR A;  1SAN A;  2L9S A;  2PMZ A;  2LY9 A;  2XB0 X;  4XM3 A;  3ZQF A;  3U1D A;  2DTR A;  1K78 A;  4JK1 X;  1BJA A;  2UV1 A;  4B8X A;  2RC4 A;  2UXI A;  3JAM K;  2FNA A;  5D5V B;  1BW6 A;  3JAM Z;  2QSH X;  2XAS A;  5FRO A;  3FXR A;  1MJA A;  3BG5 A;  4J01 A;  1MKM A;  1YQA A;  4U9L A;  2ETH A;  2ID3 A;  3FMR A;  3E5Q A;  3DBH B;  4JX6 A;  1NH3 A;  1Z91 A;  3ONQ A;  2ELK A;  4HNV A;  1FNN A;  4IHY A;  1Z9C A;  4UNO A;  3NNR A;  3A01 B;  1R58 A;  2P4W A;  2KP6 A;  2NS8 A;  3V6G A;  2LF8 A;  1UST A;  1DUX C;  4YZE A;  3LSI A;  2XIG A;  3DLA A;  4ENJ A;  2OD5 A;  4Q5S F;  1X1C A;  3VIB A;  2F48 A;  3S17 J;  1IJW C;  3ZPL A;  2R93 J;  5HAW A;  3GO5 A;  6PAX A;  2A6E F;  4I98 B;  3RCO A;  2GZW A;  2QZ8 A;  1TP4 A;  3KP5 A;  1VQM I;  5IYC J;  3AG2 H;  1Z0X A;  1BI2 A;  1GXQ A;  1FMV A;  2HS5 A;  2HPM A;  3HHG A;  2DPD A;  3OSF A;  5D5U B;  3WTW C;  2BZT A;  3GUD A;  4C30 A;  1FYK A;  1IUY A;  2ZC2 A;  4WF2 A;  5BMZ A;  2TDX A;  2NS0 A;  2XPU A;  1ITY A;  1RI7 A;  2ZXW H;  5CVI A;  2O6G E;  3K1M A;  3OYL A;  2FF4 A;  3K8P C;  2UUZ A;  4U88 A;  4CH7 A;  2PG4 A;  3S3N A;  4L9J A;  2VBX A;  4BNC A;  2GIZ A;  1QRY A;  5D4S A;  2M30 A;  5FLM J;  4II3 A;  1ZGJ A;  2K4J A;  3G56 A;  2FOK A;  4RMN A;  2QKO A;  2WY7 Q;  2DMN A;  5HNF A;  1KYZ A;  2PFV A;  1ETW A;  1QO0 D;  2Q2E B;  4G6D A;  2NVY J;  1X1D A;  2WV0 A;  1XGS A;  2C6Y A;  2B0L A;  3GTL J;  4AIH A;  2E36 A;  5D18 A;  2YPR A;  4PCQ A;  4Y3O A;  4UVC A;  4A5N A;  2ME0 A;  2O8X A;  1T8I A;  4XKV A;  1SEU A;  2Y75 A;  4HX7 A;  2LFB A;  1TQM A;  1K78 B;  1JKR C;  1QA6 A;  1VQL I;  3JRI A;  4XOT A;  2PBX A;  3HKZ A;  1OCC H;  5FFZ A;  3ZP5 A;  3SJM A;  2PBI A;  1VQ9 I;  2VC0 A;  2RN7 A;  4A3E J;  1IC8 A;  3ZN0 A;  4LLG F;  2A6H F;  1OCT C;  2F5E A;  2IS6 A;  3N05 A;  2IGO A;  1XS9 A;  1JTY A;  2FQ4 A;  3FXJ A;  4OMZ A;  2F07 A;  2COM A;  4MFD A;  4HRI A;  4E7J A;  1UI5 A;  1OCO H;  1Q1H A;  1BN5 A;  1R6R A;  3COA C;  1FP2 A;  4QTR A;  5K7F A;  2RRE A;  4OD5 A;  1O3Q A;  2QSF X;  3LOC A;  1E0E A;  3CCY A;  3BC8 A;  2CV1 A;  1P92 A;  2JUG A;  2BY2 A;  5F1J A;  3RTR A;  3REO A;  4NDL A;  4XRM A;  1FC3 A;  3UKG A;  2DA5 A;  3PNT A;  5HLH A;  2W57 A;  3RDI A;  4C3J J;  3U21 A;  5DEQ A;  3AFH A;  4A12 A;  2NVQ J;  4P1W A;  4WXD A;  1IGN A;  3J7Y J;  1ZKG A;  2L02 A;  1ETX A;  3DFG A;  3AL0 B;  2LVS A;  2H1L A;  1DGR M;  4BAC A;  3HOW J;  1OJL A;  4HF1 A;  2HZT A;  3LQR A;  3M8J A;  4AID A;  2Z2S B;  3W2A A;  2JK3 A;  5E18 F;  5J40 A;  1GHC A;  3VOX A;  2IU5 A;  3R4K A;  2JVH A;  3EYI A;  1Y8Q B;  2QWT A;  2E1M C;  3GZI A;  4NC6 A;  3A03 A;  3C1D A;  1R7J A;  3LMM A;  3NWT A;  3H3V K;  3LA7 A;  2XGX A;  3HRU A;  1P4A A;  2L9V A;  3CP8 A;  2CGP A;  1MDM A;  2HQN A;  3PSF A;  4G7H F;  1S5L C;  3KP7 A;  4BS9 A;  2R7R A;  4B48 A;  1T6S A;  2GM4 A;  3J7A Y;  1WH7 A;  3F8C A;  1IO2 A;  1HST A;  2H6C A;  3HIF A;  4YIF A;  4I7H A;  3HTA A;  3LSM A;  3B73 A;  3JR9 A;  3LSR A;  1YYV A;  3L7W A;  4IRV A;  5FFX A;  3VW2 A;  2XRL A;  2EBI A;  5K7H A;  3RPQ A;  3P9C A;  3FKI J;  2ZCN A;  3QRF F;  4D7N A;  2Z5U A;  1U3E M;  2X6X A;  3F8M A;  2K5C A;  5F0C A;  4HV6 A;  2CO5 A;  4EVI A;  3F8N A;  3TO9 A;  3R61 A;  4WXH A;  1B72 A;  3GYH X;  1JE8 A;  4KA4 A;  2DA6 A;  2HEO A;  2YX7 A;  4HF2 A;  2Z3Y A;  2ECB A;  4M72 A;  5EF6 A;  2W84 A;  5D1R A;  4ME9 A;  2GXA A;  1X3W B;  2GBY A;  2DJN A;  2RQP A;  1QNT A;  1Z3X A;  3RSN A;  4RB2 C;  3NRG A;  3BCG A;  3OL3 A;  4BQA A;  3GTJ J;  3SEZ A;  2CH0 A;  2KIM A;  2FBI A;  1ZG3 A;  2Z99 A;  1TNT A;  1LPQ A;  4EGZ A;  1Z67 A;  1DPR A;  1RUO A;  3FBI B;  2E1N A;  4L0Y B;  1JHH A;  3S32 A;  3VYU B;  4UHT A;  5IY5 H;  3OYM A;  2AS5 F;  4D0P A;  3HZJ A;  1HA8 A;  1KYW A;  5TIS C;  4L5I A;  4A69 C;  5HLG A;  2B9S A;  1QZY A;  2VKD A;  4PGG A;  3X2Q H;  2A3S A;  3VYT B;  2DT7 B;  3FDY A;  1SAU A;  2V9P A;  1VQ6 I;  1O57 A;  5H9T A;  4WXC A;  2HR3 A;  3JRB A;  3EYY A;  1MZB A;  1XPX A;  5JVG F;  1ETV A;  3P9T A;  4ESF A;  4XSX F;  1P9Q C;  3K70 D;  3MCZ A;  2PMH A;  2D1H A;  1FMW A;  1BI1 A;  4XL9 A;  2R7S A;  1YW9 A;  2KL4 A;  3UNG C;  3PL8 A;  3GFL A;  3W2V A;  5F08 A;  3MKZ A;  3A02 A;  4EM1 A;  2A5W A;  3O8G A;  3PAS A;  3ZCO A;  4MIM A;  2WA0 A;  4PDK A;  2PQ8 A;  3GLX A;  2KKO A;  4M3E A;  3WTU C;  1SD5 A;  1KU2 A;  4OIN F;  2EQR A;  3K7A J;  4E7H A;  4HQM A;  5J8F A;  2JSP A;  1LB2 A;  1FBQ A;  4FHT A;  4AU7 A;  3RZD J;  2D5V A;  1MDM B;  5BNG A;  2WV1 A;  3FHN A;  2R7T A;  1P4X A;  1LDJ A;  1Z6R A;  2EV0 A;  4JOM A;  4LOC A;  3L1P A;  3ABM H;  2L4M A;  4A93 J;  1A04 A;  1U78 A;  2MAB A;  4A3L J;  3EUK L;  1BBY A;  3M4O J;  1YLF A;  2HVS A;  2YX4 A;  2DFE A;  3MZ8 A;  5IOY A;  4EV0 A;  5LHG A;  2R5Y A;  4Q47 A;  1QQI A;  2LKS A;  3K2A A;  5CQE A;  1VZ0 A;  3HOS A;  1PDN C;  5C4Y A;  5CJ9 A;  2LD5 A;  3SHF A;  3I64 A;  1B72 B;  4UUV A;  3RPU A;  2RHA A;  4ZYE A;  3GEU A;  1SD6 A;  4B3A A;  1KQ9 A;  1FZP B;  1HDD C;  2E19 A;  2BY3 A;  2JMW A;  3L2W A;  2B1E A;  2HU9 A;  2PFB A;  1K4S A;  3BOQ A;  2B3W A;  4CCJ A;  2GOM A;  2KJC A;  4A3D J;  2VE8 A;  5DUI A;  2AO9 A;  3CCJ I;  3FHZ A;  3GZ6 A;  3VTI A;  1HXD A;  1YIO A;  2DMU A;  5AIP A;  1A31 A;  3KKD A;  3J81 K;  4ICH A;  3HL2 A;  5ICC A;  3J81 Z;  4F91 B;  1W0U A;  2VBZ A;  1G6N A;  1J75 A;  2DI3 A;  4ZTF A;  3F0C A;  4OOI A;  3WOD F;  5BPI A;  2XKO A;  4HV5 A;  1A6I A;  2ZJP F;  2MW8 A;  1R4M B;  1XSV A;  2QWW A;  3K4M A;  2HKX A;  2K27 A;  2M4G A;  3M7G A;  1VF9 A;  3GTP J;  2R7X A;  2OPT A;  5CW8 A;  3NQO A;  2HKO A;  1EJ9 A;  4A0X A;  1C0W A;  1K6O A;  2WGB A;  3IAS 2;  3V4G A;  2G7L A;  3OYD A;  1JI8 A;  3DKW A;  3K4L A;  1IXS B;  3WG9 A;  3HTU A;  2ZSI B;  2G3B A;  2CW0 F;  2G7G A;  3EUA A;  3IV5 A;  1JUP A;  3IUV A;  4XRS G;  4WIB A;  1Z7L A;  4I76 A;  3DKY A;  4I01 A;  3RD3 A;  2J5P A;  3WGI A;  2EH3 A;  2COB A;  4ENN A;  3M3Y J;  3DPJ A;  4A3B J;  1QVU A;  1JGS A;  4LIV A;  1Y39 A;  2HVR A;  4E7L A;  3N4M A;  5HVQ C;  4PSX A;  3EUH A;  3TW7 A;  4PXI A;  2R7F A;  3K4C A;  5DAJ A;  5E8G A;  3KLO A;  4XOP A;  5K5Q A;  4V2G A;  5IPA A;  4O5V A;  1I3A A;  2WWY A;  3GTK J;  2BEO A;  2V9V A;  1VND A;  1R49 A;  2JA6 J;  3MVP A;  4P96 A;  5JVT A;  2IS1 A;  2BXZ A;  5LLQ A;  5LHI A;  4ENM A;  4RDU A;  3DEE A;  1NK2 P;  1G3W A;  1TWG J;  3NWS A;  2JPB A;  3P7N A;  4I2O A;  4CGR A;  4XK4 A;  2HDC A;  4P9F A;  4X1E A;  3BR6 A;  3VDX A;  3V8J A;  1FOX A;  4CCN A;  2R92 J;  4JNN A;  5D6F A;  3VSK A;  2QOP A;  1PP7 U;  4RAZ A;  2R5Y B;  1V3F A;  5DCM A;  1Y0N A;  4IRH A;  2EA4 A;  4ACI A;  2XSJ C;  2WAQ A;  5AIQ A;  3HDD A;  3PNV A;  1MNM C;  2JA5 J;  1I1G A;  2FMY A;  3K1P A;  3HUG A;  3KLN A;  3BTC A;  1Y8R B;  2AHQ A;  3CMA I;  3FK7 A;  5FMP A;  2AXT C;  4OIO F;  4EJV A;  3C7J A;  3FZV A;  3P5J A;  3ZGK A;  5GAE J;  5ICG A;  3CC2 I;  3S2H J;  3BR0 A;  3L2Q A;  4ZJZ A;  1ZTR A;  5M5Y J;  1UMQ A;  3NEU A;  2GOX B;  4XLP F;  1OKR A;  5E79 C;  5TGT A;  3CCS I;  1BL0 A;  1X3U A;  3S8P A;  1FOY A;  3S3M A;  4KT5 C;  2BGC A;  2XDV A;  3Q9V A;  4FIS A;  3JRC A;  1EH7 A;  3CLQ A;  3K4J A;  4RGU A;  3O3K A;  3JRA A;  2UXO A;  4YG2 F;  2VIX A;  2EIN H;  3I71 A;  1ON2 A;  3DLL F;  3VP5 A;  5D5W B;  1IN8 A;  4ZC3 A;  1FTT A;  1X2N A;  4EEF G;  1TL8 A;  4A5M A;  5BS6 A;  4WWC A;  2L3D A;  2V4J C;  4IO9 F;  4EAT A;  2K3F A;  4D9J A;  1ZRD A;  1YHQ I;  1U2W A;  3QP5 A;  1D3Y A;  5DM6 F;  3GVA A;  2BV6 A;  4IHS A;  5EG0 A;  4G6Q A;  2G7S A;  2QQ9 A;  1XMX A;  2P5V A;  2G7U A;  1IRX A;  4UDS A;  1U8R A;  4ESB A;  4QLC U;  1AHD P;  1TW2 A;  3H9J A;  1PYV A;  2EZI A;  2X0L A;  4XKB A;  3E0J B;  1VQO I;  4BGD A;  1IDY A;  5H6R A;  2QKM B;  5C3E J;  2DQL A;  4A3G J;  3KKC A;  4F55 A;  1FYL A;  1RR8 C;  2M87 A;  2E35 A;  1WJE A;  3IUO A;  3AG3 H;  4IRG A;  2CUF A;  2PLY A;  4I99 C;  4PK4 A;  4XID A;  4LJZ F;  3HEF A;  1W1W E;  3K1N A;  4XRS A;  1ZR4 A;  1W0T A;  1FIA A;  2HOS A;  1IV8 A;  4GO1 A;  1I39 A;  3WE3 A;  5ILS A;  4OIP F;  3S2W A;  4I6Z A;  3F1B A;  2STW A;  1BR4 A;  3TGN A;  3JCU C;  4XKC A;  4BQN A;  3HOV J;  4JQF A;  4B44 A;  2YVX A;  3AG1 H;  1RNL A;  2A5Y B;  2QVO A;  1HKS A;  2DA3 A;  2AXL A;  3KP2 A;  3Q0U A;  2HDD A;  2ISY A;  1XC5 A;  1F9N A;  2HTJ A;  3CMM A;  5DCM B;  3RQI A;  4CXF A;  1BA5 A;  2R7Q A;  3C3W A;  2ESH A;  3FIW A;  2O0Y A;  2YU9 J;  2FXA A;  2ZCX A;  2TCT A;  2ZNY A;  1JXS A;  2V1N A;  3CQZ J;  2DG8 A;  1L3L A;  2AQE A;  4DQ2 A;  4RGX A;  5FO5 A;  4BKX A;  1WQ2 A;  1E3O C;  3HUG B;  4JKZ A;  3BZ6 A;  3KYC B;  1R22 A;  3DEW A;  4A2U A;  5FHP A;  3H92 A;  1JHF A;  3E1S A;  5KNL A;  2P81 A;  2LMD A;  4QSH A;  2HYF A;  1JUS A;  2H09 A;  5KK1 A;  2IS4 A;  1W5T A;  3KZ9 A;  1BI0 A;  1IV6 A;  1WKM A;  5IOZ A;  4N0B A;  4EJU A;  1S3J A;  1W7P A;  2D2W A;  4F7Z A;  3MQ0 A;  3GWZ A;  3ZN1 A;  3I55 I;  1FTZ A;  1SFO J;  4NN1 A;  1U5T A;  3PQK A;  3GFM A;  1UZC A;  4A6D A;  2ZME C;  2OF7 A;  3E97 A;  1OYW A;  4LB6 B;  2LP0 A;  1I50 J;  3DP7 A;  2VB6 A;  1YOV B;  2EB7 A;  2OC6 A;  1XSD A;  2LKP A;  2NOG A;  3CUQ C;  2G9W A;  3GXO A;  1ZRE A;  2XAH A;  2L4A A;  3PFY A;  3COL A;  4R8H A;  3WTS C;  2HI3 A;  2Y0M A;  2M45 A;  3H3U A;  2JRM A;  2O7O A;  2EIL H;  2KIF A;  2V79 A;  1X3Z B;  3NS4 A;  2L5Q A;  4HX8 A;  4M9Z A;  2JJ7 A;  3Q3S A;  2ECC A;  5EG0 B;  3BPV A;  2DMQ A;  2FOW A;  3MEX A;  2ZXI A;  5ERI A;  4R79 A;  2F4M B;  4KIG A;  3CO7 C;  3W3C A;  4UB8 C;  4Y15 A;  4IHV A;  2A07 F;  1KQ0 A;  2W7N A;  3WTZ A;  2XGC A;  2YS9 A;  1Y1W J;  2ACJ A;  4UUT A;  2MFZ A;  3HOT A;  2N8G A;  4BEH A;  3LAJ A;  2E7W A;  3BP8 A;  5HDK A;  4BU2 A;  2AQF A;  5FB2 A;  1I6H J;  2KT0 A;  3KPH A;  1IRG A;  1WI3 A;  4Y13 A;  4MNU A;  1ZH5 A;  2DJI A;  4A3I J;  4XN0 A;  4Z2Y A;  3WGG A;  3I3L A;  2XAQ A;  2EZK A;  3KEQ A;  2LF7 A;  4DYR A;  3CCE I;  1G59 A;  3CMY A;  2X1D A;  1VQ4 I;  3ULQ B;  2PI0 A;  4XLN F;  5FRN A;  2V9K A;  2H94 A;  2M3A A;  3W2W A;  1I3Q J;  1WI9 A;  5GP9 A;  5F0F A;  3TMO A;  2VPL A;  1IRZ A;  1BI3 A;  1QGP A;  1WPK A;  3UR3 C;  2CMP A;  1WVR A;  1UI6 A;  4PJ0 C;  2Z1D A;  1IDZ A;  3BRU A;  3SZT A;  3VPR A;  3ERM A;  3OYA A;  3MKW B;  2KDZ A;  4CCO A;  3GW2 A;  2P6T A;  2K7L A;  2RDP A;  3PNY A;  3VW0 A;  3GLL A;  1IG7 A;  3BJB A;  1N78 A;  3OR1 C;  5E3M A;  2DCE A;  4AYB N;  4U0W A;  3MZY A;  2G0E A;  1V5G A;  9ANT A;  1UG2 A;  1O4X A;  3B02 A;  1TW3 A;  3FMS A;  2O9L A;  1OMI A;  5JLX A;  3DKX A;  5EGO A;  1W7P B;  4IRI A;  5J1R A;  1ETQ A;  2LNB A;  5CVJ A;  4B43 A;  1QBJ A;  3DPL C;  2YUS A;  3WHC A;  4LIT A;  1U5T B;  3IH2 A;  1TTY A;  4N4O B;  1TC3 C;  2ELJ A;  5FLV A;  2NOJ B;  3KIO A;  4E6K G;  1P7J A;  5EFY A;  1O3R A;  3ISP A;  5HLI A;  2L01 A;  1YX3 A;  5LGT A;  2MYS A;  1LDD A;  1T56 A;  4IEJ A;  4RM2 A;  4A3M J;  3H9G A;  3DPU A;  1DP3 A;  2VJ4 A;  3DPT A;  1SMT A;  2K9L A;  2X85 A;  4F93 B;  5M5W J;  3MKY B;  2A69 F;  3HOZ J;  3SEQ A;  1LQ1 A;  4JBA A;  1SFE A;  4BJ6 C;  2ZBK A;  1XDS A;  2LC2 A;  3ABK H;  3ZQQ A;  2GFN A;  1PVE A;  1GLN A;  3BCB A;  1BIA A;  2XHK A;  2ZME A;  3PIP F;  1XN7 A;  2XAF A;  4NC7 A;  3I58 A;  2D45 A;  2ZCW A;  1DPU A;  3LA3 A;  3H0D A;  4BAY A;  3C2H A;  5HLT A;  2LRE A;  3ROU A;  2A68 F;  5KHD A;  3TW6 A;  3ZMD A;  3BTJ A;  5M3M J;  4BJT A;  1HBX G;  4BEH B;  1OCP A;  2KJB A;  2K9M A;  2QF7 A;  2E60 A;  3LWF A;  4M6Y A;  1WZ2 A;  1XCV A;  4U9N A;  1IUF A;  4L9T A;  4IHW A;  2XGE A;  4QWQ A;  5K58 A;  1VQ7 I;  2YSR A;  3OR2 C;  2R7V A;  2L7M P;  4HST A;  1ETK A;  4HAM A;  2F5F A;  2W24 A;  2RV8 A;  2K9N A;  4G7O F;  3SQN A;  2P6S A;  3O6B B;  1T0F C;  1YJW I;  4AVZ A;  5CXG A;  1ZAR A;  3ANG A;  1IN6 A;  2XC7 A;  4FCY A;  3BG6 A;  3FF5 A;  4D1Q A;  2RNG A;  5E1Z B;  4XBF A;  1XGM A;  1F36 A;  4BHB A;  4UVA A;  2ZY9 A;  2QA4 I;  1TT5 B;  2R7O A;  4ASN A;  2VC1 A;  1FWZ A;  1WH5 A;  5J8C A;  4P55 A;  4WK8 F;  2RVC A;  2OU2 A;  1YW7 A;  2CU7 A;  3PJR A;  2BHZ A;  2RKH A;  1W4M A;  2Y2Z A;  1LEB A;  2FSW A;  4KIB A;  2E2I J;  4GCK A;  2E71 A;  3CO6 C;  1XD7 A;  3JW4 A;  1P6R A;  3K2Z A;  1Q1V A;  5IP9 J;  2LYC A;  1HW5 A;  2X51 A;  5FD5 A;  4UY8 I;  1DU6 A;  4BE0 A;  2R4G A;  3S5R A;  3ABL H;  5EGO B;  3BCA A;  3AAF A;  4BHP A;  2I10 A;  3RI4 A;  4MTE A;  4S0H B;  4AM3 A;  2QBY A;  4IOC F;  2PJR A;  1MBK A;  4HOB A;  4BY1 J;  3ASN H;  2QM3 A;  4Y17 A;  2DA7 A;  4IF4 A;  3VOD A;  3LWJ A;  2HXI A;  5TRD A;  4FX0 A;  1MGT A;  1X1B A;  1NHA A;  1XG1 A;  2ADU A;  4TV7 A;  1A35 A;  1KGS A;  2FML A;  3KCC A;  4X0G A;  1ZG5 A;  4RS8 A;  4CCL A;  1MBJ A;  4YEL A;  2O61 A;  3SFI A;  3C2B A;  1QPI A;  1S9H A;  1MJB A;  2LR8 A;  2NP3 A;  2MC3 A;  3P9I A;  3IKT A;  5D8K B;  1ZHF A;  3CME I;  3TL4 X;  3ZMT A;  3FX3 A;  4RGR A;  3RYP A;  4C3H J;  5FKM A;  1MMG A;  1OR7 C;  2VJ5 A;  5FD6 A;  2ZME B;  3I4P A;  3OIQ A;  3TKY A;  5E3O A;  1VQP I;  3R0J A;  4PFP A;  2ZXH A;  3IP4 B;  4UB6 C;  3N97 A;  3S14 J;  2WBM A;  4HX4 A;  3E7Q A;  1X1A A;  1KU3 A;  2EPF A;  2KIQ A;  3B81 A;  2VQG A;  2QSG X;  4ENK A;  4GCT A;  3DU6 A;  3Q5F A;  3PPB A;  3OYF A;  3VOK A;  1U6G A;  5DYM A;  3VVY A;  3QBM A;  3HBL A;  3LST A;  1JTX A;  4LIU A;  4XON A;  2M8E A;  2JA8 J;  1H9G A;  1V54 H;  2LSO A;  3RPU D;  2MH2 A;  4KN4 X;  3GEZ A;  3OYE A;  2MD5 A;  3W6J B;  2OER A;  3OS1 A;  4ESJ A;  2GXB A;  1GXP A;  2HQ5 A;  1FOW A;  5EEA A;  5CXI A;  1WJD A;  3BG7 A;  3HOY J;  2ZJ2 A;  2QKL B;  1Z1D A;  1I5Z A;  5LFA A;  2UWM A;  1D0Z A;  1I27 A;  3OIP A;  4HW0 A;  2CQX A;  3OYJ A;  3BG3 A;  1DU0 A;  1R5H A;  2IA2 A;  3H3Z A;  3QYE A;  4A3K J;  2H8W A;  4HBL A;  4D7M A;  2CFO A;  3BPX A;  2V1X A;  4R1H A;  2RGV A;  3H0G J;  4MTD A;  2TRT A;  1A36 A;  1TWF J;  4M3D A;  3KNW A;  2DMT A;  3M1C A;  1XGO A;  2R7U A;  2QEX I;  1S6L A;  2ZFW A;  2M5W A;  3U2R A;  3F23 A;  2UZK A;  2QIB A;  1ZYR F;  3VYR B;  4MFE A;  2VJJ A;  2DLL A;  3IC7 A;  1T0F A;  1Z77 A;  2DQR A;  1IN7 A;  2HDW A;  3LA2 A;  1U8B A;  1RIO H;  4XQF A;  3FXQ A;  2B7E A;  5EEH A;  1B1B A;  4CA0 A;  4RAY A;  1X4P A;  2L54 A;  4CCK A;  4RB3 C;  2GXG A;  3HRT A;  5A2Q K;  2Y0S N;  4DYQ A;  4A0Z A;  5A2Q Z;  5L3D A;  1YS6 A;  3BQY A;  3OY9 A;  1UAA A;  2QBY B;  5JI6 A;  4A3F J;  2PJR B;  3GME A;  4HYE A;  3WU1 B;  1UHS A;  3CZ6 A;  1RET A;  2FJI 1;  1J7K A;  2FU4 A;  4UV8 A;  2R7Z J;  5JHF A;  2JWT A;  1OYY A;  1UHM A;  4V2F A;  5D4R A;  2GA2 A;  4B47 A;  4DZJ A;  4IVN A;  1ERD A;  1MBG A;  3FXK A;  5EEG A;  5DD8 A;  1U0J A;  1ONV A;  4FT8 A;  1ZLK A;  2E1C A;  2QTQ A;  5CVV A;  5C4X J;  3B6C A;  2OV7 A;  4IHX A;  2V26 A;  3OOP A;  3VSL A;  4KMU X;  4L62 A;  3LNQ A;  4J00 A;  2RNJ A;  3TOA A;  3QPS A;  2JA2 A;  2Z33 A;  4L5E A;  4AUX A;  1VI0 A;  3Q9S A;  5CLS A;  1A5J A;  3L2C A;  2ID6 A;  1T98 A;  4DJA A;  2VPR A;  3LL7 A;  1YTY A;  2LDU A;  1ETO A;  1HW1 A;  3CDL A;  5D19 A;  4N9I A;  3I5U A;  3E7L A;  4U7D A;  1X58 A;  5HDN A;  1W5C C;  3W6V A;  1QHH D;  3ON2 A;  4EQQ A;  3CUO A;  3GFJ A;  1D0X A;  3QQA A;  3CCV I;  4YEJ A;  1Y1V J;  2X9D A;  2XAU A;  3J80 K;  2ZOY A;  1J5Y A;  1KZH A;  3J80 Z;  2MH9 A;  2CG4 A;  2NVX J;  1SVO A;  1D0Y A;  4RA2 A; 
#chains in the Genus database with same CATH homology
 1BL0 A;  5FGL A;  3OOU A;  3DCF A;  3HTI A;  2FD5 A;  2UXU A;  4FIS A;  1QVT A;  3BR1 A;  5C44 J;  3JRC A;  3O8H A;  2HYJ A;  4B1R A;  3JRA A;  4JL3 A;  2UXO A;  3BQZ A;  1D5Y A;  1U9N A;  4JP0 A;  5F0H A;  4AC6 A;  3VP5 A;  2XB5 A;  3FIS A;  4MLO A;  2MG4 A;  1FTT A;  1X2N A;  4EEF G;  5EZH A;  3D1N I;  2XDN A;  5EYR A;  4B4C A;  2ZOZ A;  3LSP A;  3CWR A;  3ZQH A;  2DA1 A;  1SAN A;  2LY9 A;  2XB0 X;  4MO7 A;  3ZQF A;  4J19 A;  3VVX A;  5EG0 A;  1R9T J;  1TWH J;  2G7S A;  3GTG J;  4UDS A;  2HOA A;  1MSE C;  2UXI A;  1PUF B;  1AHD P;  2EZI A;  4ICH A;  2YVH A;  5GPC A;  1BW6 A;  1IDY A;  5C3E J;  3S1Q J;  3NAU A;  3HKZ N;  4A3G J;  3KKC A;  3BG5 A;  2O7T A;  2K9S A;  2GUH A;  3HB9 A;  2L9R A;  3PO3 J;  2CUF A;  4XID A;  2GEN A;  2ID3 A;  3HEF A;  4XRS A;  1NTC A;  1ZR4 A;  4JX6 A;  1FIA A;  4JX4 A;  1W0T A;  2HOS A;  2ZCM A;  3JRH A;  2ELK A;  4HNV A;  1AKH B;  4IHY A;  3NNR A;  4GFL A;  5J1Y A;  3A01 B;  4I6Z A;  3F1B A;  2NS8 A;  3V6G A;  3HOV J;  1K83 J;  4YZE A;  3VIB A;  2XPV A;  2DA3 A;  3Q0U A;  4HKU A;  3S17 J;  1IJW C;  2HDD A;  2R93 J;  5HAW A;  1RKT A;  1XC5 A;  1U9O A;  1MSF C;  3HIM A;  3RQI A;  1BA5 A;  1ZR2 A;  3I4M J;  2EZL A;  2O8K A;  3FIW A;  1F43 A;  2YU9 J;  3S16 J;  1JKP C;  2ZCX A;  5IYC J;  2TCT A;  1Z0X A;  3CQZ J;  2DG8 A;  4AC0 A;  4BKX A;  2HKU A;  1E3O C;  4JKZ A;  3OSF A;  3DEW A;  5FHP A;  4QIW N;  2P81 A;  2K40 A;  2K9Q A;  2UXH A;  2XPU A;  4QSH A;  3WHB A;  1ITY A;  2LKX A;  1JUS A;  3KZ9 A;  1IV6 A;  2R5Z A;  4M3F A;  3RKQ A;  5IOZ A;  1GDT A;  1JJ8 C;  2W53 A;  5HBU A;  1FTZ A;  1SFO J;  1EF4 A;  2NX4 A;  4NN1 A;  1H88 C;  3VW1 A;  1QRY A;  5FLM J;  4JX5 A;  2OF7 A;  3QPL A;  3JRE A;  3G56 A;  3QKX A;  2LP0 A;  1I50 J;  3HOX J;  3FK6 A;  2QKO A;  1FIP A;  2NVT J;  3HTH A;  2JN6 A;  2LLK A;  2DMN A;  2NOG A;  4BY7 J;  3ZQC A;  3NI7 A;  1ETW A;  2Y30 A;  2NVY J;  3COL A;  3BNI A;  2HI3 A;  3GTL J;  2O7O A;  3BT9 A;  5D18 A;  5EDN A;  3GTO J;  2ME0 A;  2X48 A;  1H89 C;  5EG0 B;  2JJ7 A;  3Q3S A;  2ECC A;  2H8R A;  2DMQ A;  2CQQ A;  2HXO A;  2LFB A;  3MNL A;  3V78 A;  3ZQI A;  1JKR C;  2IEK A;  3JRI A;  2PBX A;  4IHV A;  3SJM A;  2M2E A;  3ZOB A;  5HOD A;  4A3E J;  1IC8 A;  2L7F P;  2XGC A;  2YS9 A;  1Y1W J;  2NP5 A;  1OCT C;  4UUT A;  3RZO J;  3ANP A;  5GPA A;  1JKO C;  2N8G A;  3BR3 A;  1XS9 A;  1JTY A;  2FQ4 A;  3JSJ A;  3BTI A;  4UUS A;  2F07 A;  4MFD A;  1UI5 A;  3BTL A;  1I6H J;  2KT0 A;  1GV5 A;  3S15 J;  1WI3 A;  1S7E A;  4QTR A;  5K7F A;  1MH4 A;  3LOC A;  3OIO A;  4A3I J;  3EUP A;  3CCY A;  3OSG A;  1WGX A;  5FKK A;  2GLO A;  4DYR A;  2EZK A;  5F1J A;  3CMY A;  2X6O A;  4NDL A;  4XRM A;  3UKG A;  1WCM J;  2DA5 A;  1I3Q J;  5GP9 A;  3NXC A;  5F0F A;  4ABZ A;  3SDG A;  1IRZ A;  1SGM A;  1WPK A;  3S2D J;  4BBS J;  4C3J J;  3HGY A;  2NVQ J;  1IGN A;  1JUM A;  5J1U A;  1ZKG A;  1IDZ A;  1UI6 A;  1ETX A;  2HOT A;  1NK3 P;  2E2J J;  3BRU A;  2LVS A;  3VUQ A;  3VPR A;  3HOW J;  1OJL A;  2KDZ A;  2L7Z A;  2JK3 A;  3O60 A;  3VW0 A;  1IG7 A;  3VOX A;  2IU5 A;  3BJB A;  5E3M A;  4NEL A;  3RH2 A;  4AYB N;  2QWT A;  2WUI A;  2G0E A;  3GZI A;  1T33 A;  3A03 A;  9ANT A;  1UG2 A;  1O4X A;  2R5Z B;  1TWA J;  5K7Z A;  2O9L A;  3H3V K;  5JLX A;  3TP3 A;  2Q24 A;  5EGO A;  3AQT A;  5J1R A;  1ETQ A;  5FJ8 J;  3CRJ A;  2YUS A;  3WHC A;  5IP7 J;  3HTJ A;  2DA2 A;  3IH2 A;  1TC3 C;  1OFC X;  3HOU J;  5FLV A;  2GM4 A;  2M8G X;  1WH7 A;  1P7J A;  4JYK A;  5EFY A;  1ORK A;  3HTA A;  3NAR A;  3JR9 A;  1MBF A;  1T56 A;  4IEJ A;  1RES A;  1P7I A;  3LSR A;  4A3M J;  3VW2 A;  2XRL A;  2EBI A;  5EZG A;  5K7H A;  3I4N J;  3FKI J;  5FKL A;  3G1M A;  1BW5 A;  2ZCN A;  4D7N A;  5M5W J;  3JRG A;  3HOZ J;  4D5C A;  5F0C A;  1ZGW A;  2V57 A;  1RKW A;  2FBQ A;  1B72 A;  1ENH A;  2XSD C;  1GVD A;  2M34 A;  2DA6 A;  3BHQ A;  2GFN A;  2NS7 A;  1ETY A;  2ECB A;  5EF6 A;  2FX0 A;  3LHQ A;  5D1R A;  4ME9 A;  1LFB A;  2GBY A;  2DJN A;  3PO2 J;  3NRG A;  4C3I J;  3ON4 A;  3BCG A;  4FTH A;  2HYT A;  5JLW A;  3GTJ J;  3TW6 A;  3BTJ A;  5M3M J;  1HOM A;  1OCP A;  4XIC A;  1GV2 A;  4UUS B;  2QF7 A;  1MBH A;  1IUF A;  3EGQ A;  4IHW A;  2XGE A;  3IH3 A;  5K58 A;  2L7M P;  2Y31 A;  1G2H A;  4M3B A;  4CYC A;  1ETK A;  3BR2 A;  1LE8 A;  4A69 C;  5M3F J;  2K9N A;  1AU7 A;  5CXG A;  3GTM J;  3ANG A;  2B63 J;  4GCL A;  4FCY A;  5DS9 A;  3BR5 A;  1JJ6 C;  1F36 A;  5H9T A;  3JRB A;  1ETV A;  3P9T A;  1FJL A;  1WH5 A;  2VUM J;  2UXP A;  4GFK A;  2CU7 A;  2Y2Z A;  2E2I J;  3Q0W A;  4GCK A;  5F08 A;  3A02 A;  3O8G A;  3PAS A;  3HE0 A;  2LK2 A;  4MIM A;  1FEX A;  1Q1V A;  5IP9 J;  2RAE A;  4M3E A;  1DU6 A;  4W97 A;  2EQR A;  5M5X J;  2EZH A;  1ZQ3 P;  3K7A J;  2H1K A;  1VFC A;  1B8I A;  3S5R A;  5EGO B;  2I10 A;  4G12 A;  3RZD J;  4M3G A;  2D5V A;  4S0H B;  5BNG A;  2WV1 A;  5FKO A;  3S1N J;  3TP0 A;  1MBK A;  4BY1 J;  1YRN A;  4BXX J;  4LOC A;  3L1P A;  2FJ1 A;  2L0K A;  3LWJ A;  2DA7 A;  2HXI A;  2XGD A;  4AF5 A;  4A93 J;  4W1U A;  3LSG A;  1XG1 A;  5E3L A;  1U78 A;  4A3L J;  3LSJ A;  5DTD A;  1CQT A;  3M4O J;  5IOY A;  2R5Y A;  3TED A;  1MBJ A;  4X6A J;  3K2A A;  3SFI A;  3C2B A;  5C4Y A;  2LD5 A;  1QPI A;  2WB1 N;  2DMP A;  2LR8 A;  2NP3 A;  1B72 B;  2RHA A;  3GEU A;  3HM5 A;  4C3H J;  5FKM A;  5E3N A;  4B3A A;  2VKE A;  1HDD C;  2WAQ N;  5IYD J;  1ZK8 A;  2E19 A;  4GFB A;  2JMW A;  5E3O A;  4BBR J;  3GBG A;  3S14 J;  3E7Q A;  5HSZ A;  1JGG A;  3B81 A;  4C2M J;  2ME6 A;  4A3D J;  5F04 A;  2VKV A;  1RR7 A;  4DW6 A;  4GCT A;  3PPB A;  2PZ9 A;  2AO9 A;  3VOK A;  1MBE A;  3VVY A;  3PM1 A;  3IH4 A;  2DMU A;  1K61 A;  2Y9Y A;  3KKD A;  3QBM A;  3HBL A;  1JTX A;  2E1O A;  2JA8 J;  3VVZ A;  3FRQ A;  4CYC B;  1W0U A;  1LE8 B;  2OI8 A;  2OER A;  3MN2 A;  4DYC A;  3F0C A;  3BG9 A;  4M6V A;  2HQ5 A;  5EEA A;  5CXI A;  3Q0V A;  1A6I A;  5IYB J;  2MW8 A;  3HOY J;  3GTP J;  5CW8 A;  1VF9 A;  5FKN A;  2OPT A;  1BJZ A;  2CQX A;  1DU0 A;  3BG3 A;  5AQC A;  1JKQ C;  1HLV A;  2R0Q C;  4A3K J;  2LTP A;  4D7M A;  2CUE A;  1LFU P;  2WGB A;  3H0G J;  2TRT A;  4Y7N J;  1TWF J;  4M3D A;  2G7L A;  3KNW A;  2DMT A;  2G3B A;  2G7G A;  3IV5 A;  1JUP A;  5IP6 A;  2M9H A;  2QIB A;  3IUV A;  2PMZ N;  4XRS G;  4MFE A;  1X2M A;  3JRF A;  4DZP A;  2VI6 A;  2MGQ A;  4I76 A;  3RD3 A;  1TWC J;  1Z77 A;  2EH3 A;  1U8B A;  2COB A;  3M3Y J;  3DPJ A;  4A3J J;  1QVU A;  4A3B J;  4MXM A;  1PUF A;  2XPW A;  3MKL A;  3TW7 A;  4PXI A;  3ZQL A;  5DAJ A;  1RPW A;  1B8I B;  4V2G A;  5IPA A;  3GTK J;  2DN0 A;  1JT0 A;  2ZB9 A;  2Y0S N;  1VND A;  3G1O A;  4DYQ A;  2JA6 J;  3MVP A;  2DA4 A;  1GT0 C;  2DTZ A;  3ZQG A;  3BQY A;  3G7R A;  3NPI A;  4A3F J;  4MK6 A;  3G1L A;  5F27 A;  1UHS A;  2CRG A;  1RET A;  3JRD A;  4RDU A;  1YRN B;  1NK2 P;  1GUU A;  1TWG J;  1AKH A;  3A01 A;  2R7Z J;  3S1M J;  2JWT A;  2REK A;  4XK4 A;  3CJD A;  4CGR A;  4V2F A;  3C07 A;  4X1E A;  2RAS A;  3BR6 A;  4DZJ A;  1APL C;  4Y52 J;  2DG7 A;  1MBG A;  2R92 J;  4JNN A;  4A3C J;  3B6A A;  3HGG A;  2JA7 J;  2D6Y A;  2QOP A;  2R5Y B;  1HDP A;  2QTQ A;  4KWA A;  2IAI A;  5C4X J;  3B6C A;  3AQS A;  4IHX A;  4ACI A;  4L62 A;  5J3L A;  3LNQ A;  3QPS A;  4FE7 A;  1MNM C;  1JT6 A;  4FE4 A;  2QCO A;  4L5E A;  4AUX A;  1VI0 A;  2JA5 J;  3HDD A;  5C4J J;  1A5J A;  2ID6 A;  3LJL A;  2VPR A;  3S1R J;  3BTC A;  1POG A;  1ETO A;  3CDL A;  5D19 A;  2AHQ A;  3T6N A;  2M0C A;  3FK7 A;  5FMP A;  3W6V A;  3E7L A;  4D5F A;  1X58 A;  1H8A C;  3ON2 A;  2W48 A;  1HF0 A;  3QQA A;  2IBD A;  3S2H J;  2CJJ A;  2MSY A;  3BR0 A;  2Y9Z A;  2YVE A;  1Y1V J;  2X9D A;  1MH3 A;  2ZOY A;  1ZTR A;  2E2H J;  1HCR A;  5M5Y J;  1UMQ A;  4RBO A;  2NVX J;  3GTQ J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...