4M3GA

Rapid and efficient design of new inhibitors of mycobacterium tuberculosis transcriptional repressor ethr using fragment growing, merging and linking approaches
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
193
structure length
191
Chain Sequence
GDDRELAILATAENLLEDRPLADISVDDLAKGAGISRPTFYFYFPSKEAVLLTLLDRVVNQADMALQTLAENPTDRENMWRTGINVFFETFGSHKAVTRAGQAARATSVEVAELWSTFMQKWIAYTAAVIDAERDRGAAPRTLPAHELATALNLMNERTLFASFAGEQPSVPEARVLDTLVHIWVTSIYGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ligand Efficiency Driven Design of New Inhibitors of Mycobacterium tuberculosis Transcriptional Repressor EthR Using Fragment Growing, Merging, and Linking Approaches.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription repressor/inhibitor
molecule keywords HTH-type transcriptional regulator EthR
total genus 80
structure length 191
sequence length 193
ec nomenclature
pdb deposition date 2013-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4m3gA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 4m3gA02
2TCTA 2EZIA 1NK3P 2DG8A 3WHCA 2JA5J 3HE0A 4A3MJ 3EUPA 2DMQA 3JR9A 1Y1VJ 3HOYJ 3OOUA 3RKQA 2E2JJ 1W0UA 3JRBA 2MW8A 3JREA 1DU6A 2XB5A 1BW5A 2HQ5A 3BR2A 2ECBA 3C07A 3LSPA 2ZCXA 3TEDA 2M0CA 4PXIA 3A02A 3CQZJ 3T6NA 3BTLA 3CCYA 4FE4A 2WV1A 3MKLA 4M3DA 1B8IA 1X2NA 2WB1N 1TWCJ 1QRYA 2LLKA 5J1UA 4A3BJ 4JP0A 1BW6A 4X1EA 2N8GA 5IPAA 3RH2A 4JKZA 1JUSA 1IGNA 5FLMJ 1GVDA 1F36A 5JLXA 4FCYA 2R5ZA 1HF0A 3I4NJ 1X58A 3MVPA 4RDUA 2GUHA 3KKCA 2DMNA 3PASA 2UXHA 2E1OA 2JWTA 1ZQ3P 1I50J 3JRGA 5EEAA 4AC0A 2G7LA 3W6VA 2HKUA 4A3GJ 4M3EA 4JNNA 5GPAA 3NRGA 5GPCA 4AC6A 2G0EA 3F0CA 4QIWN 1JKRC 3ANGA 2Y9YA 3HKZN 3I4MJ 3G56A 3HGYA 1WH5A 2HI3A 3HTHA 1IV6A 5E3LA 1EF4A 2QIBA 1JJ8C 2K9SA 1GV2A 3JRFA 1Z0XA 5J1YA 4FISA 2HYJA 3GTOJ 1ETWA 4XRMA 3LSJA 2OERA 2FJ1A 2QF7A 2R7ZJ 2Y2ZA 3GTPJ 2PBXA 4I76A 3IH3A 1ENHA 3MN2A 2LD5A 4D5CA 1WI3A 3BNIA 1MBHA 1WPKA 2IAIA 5IP7J 3ZQHA 2I10A 3HEFA 4JX5A 5K7FA 1ETOA 2KDZA 3RD3A 3O8GA 3A03A 2DA5A 2DA1A 5FHPA 2QTQA 4YZEA 3BCGA 2DMTA 3GZIA 5C4JJ 2R92J 2CUFA 2COBA 4ACIA 3GTKJ 1IC8A 2LR8A 5JLWA 5HAWA 2M8GX 4M3GA 5K7ZA 3G7RA 1MH4A 2ZCMA 3ZQCA 4A69C 1IRZA 3CMYA 3LJLA 4MK6A 5D1RA 1ETVA 3LWJA 4MIMA 2L7FP 1AKHA 4UDSA 4A3DJ 3ZQLA 1JTYA 1JGGA 5M5YJ 4Y52J 2CQQA 5FKLA 2WUIA 4GFKA 4BKXA 3KNWA 5K58A 1ZR4A 3TW6A 2O9LA 3FISA 3S2DJ 3JRHA 1NTCA 3S5RA 5M5XJ 1JJ6C 4DYQA 2NOGA 4UUSB 3IH2A 2E2HJ 2MSYA 4BY7J 3FK7A 2NVQJ 1YRNA 2X6OA 3GEUA 1LE8A 4XRSG 2DG7A 2D6YA 9ANTA 1XG1A 3QBMA 5F0FA 1AHDP 4XRSA 4X6AJ 3RZOJ 5D19A 1Z77A 2M2EA 2UXPA 4C2MJ 3OIOA 1APLC 1HDPA 5C4XJ 2GBYA 3H0GJ 5FKKA 3BQZA 2DA2A 2ECCA 3FIWA 4MFEA 1MSEC 5FKOA 2Q24A 4M3FA 5HBUA 1OFCX 1B72A 2G7SA 3VUQA 1F43A 1VNDA 1PUFB 4D7NA 5E3NA 4BXXJ 4HNVA 2TRTA 5F08A 2MG4A 1RESA 3H3VK 2OI8A 2B63J 3NXCA 3QKXA 2YVHA 2DMPA 3V6GA 4BY1J 1CQTA 3HOUJ 2M34A 1OJLA 3D1NI 2YVEA 1B72B 2NP3A 5FKNA 1R9TJ 1ITYA 2LVSA 5IYDJ 5DS9A 2NVXJ 2NX4A 3BR6A 1JUMA 3VVXA 4C3JJ 2JA8J 3QPSA 2ELKA 2OPTA 2E2IJ 4NDLA 1HCRA 1JUPA 1AU7A 2UXIA 3ON2A 3ZQFA 1P7IA 4CYCA 1ORKA 2JA7J 2ZB9A 2AHQA 4A93J 2RAEA 2XB0X 2XGDA 1XS9A 2HDDA 3BQYA 1MH3A 4I6ZA 4GFBA 3M4OJ 1XC5A 1HLVA 1QVUA 2EZKA 3VW2A 5CXGA 1VFCA 4J19A 3COLA 2QCOA 3KKDA 3Q0UA 3AQTA 2DA3A 4A3JJ 5F1JA 2HXIA 3LHQA 2ID6A 2VKVA 1E3OC 1MBJA 1AKHB 3E7QA 1W0TA 1JTXA 2XGEA 2MGQA 3TP3A 4D7MA 5CXIA 2CJJA 1FIPA 4IHYA 2HOAA 1DU0A 4AUXA 4MO7A 2CU7A 4L62A 2VKEA 1JT6A 4B4CA 1WGXA 3VW0A 3S16J 2QKOA 4UUSA 1ZKGA 2PMZN 1G2HA 1SFOJ 4HKUA 1ETQA 3JRDA 3K2AA 2XPWA 1RR7A 1MBEA 3NARA 1UI6A 3A01B 2L7ZA 5EGOB 1Q1VA 2EZHA 1ZR2A 1I6HJ 2IU5A 4GFLA 3LOCA 2GM4A 3HGGA 3G1OA 1GUUA 4DW6A 4JX6A 2K40A 3OSGA 2ZCNA 1IJWC 5GP9A 2XPUA 4C3HJ 5IOZA 2K9QA 3JSJA 3HM5A 2R5YB 2R5ZB 2DMUA 2DA6A 5F04A 4A3FJ 1WH7A 3LSGA 3ZQGA 4QTRA 2FD5A 2R0QC 4DZJA 5M5WJ 2F07A 4AF5A 2YS9A 1SANA 3HDDA 3DPJA 2DA4A 2EQRA 4IHVA 5E3MA 5HSZA 1UMQA 1QPIA 3ON4A 4B1RA 1BA5A 3CJDA 5EG0B 4MLOA 4D5FA 3IV5A 4LOCA 1OCPA 2LFBA 5E3OA 4BBRJ 3PM1A 3BTJA 2D5VA 1ZTRA 2E19A 1A5JA 3HIMA 2NS8A 3S1QJ 3BG9A 1WCMJ 1D5YA 3GTQJ 2REKA 2VI6A 2ME6A 3LNQA 5M3FJ 2LKXA 2W53A 3BR3A 1OCTC 2R5YA 2JA6J 3QQAA 4M3BA 1TC3C 3BG5A 3O8HA 1ETKA 4MXMA 5F0CA 1JKPC 1MBFA 1RETA 5EDNA 1JT0A 3G1LA 2FQ4A 5EGOA 2OF7A 3A01A 5J3LA 2K9NA 2O7TA 4W1UA 3FKIJ 2DA7A 3B6CA 3VOXA 2KT0A 4EEFG 4MFDA 4DYCA 3S14J 3Q3SA 4A3KJ 5CW8A 2NVYJ 5DAJA 1O4XA 2AO9A 5EYRA 4B3AA 3TP0A 4DZPA 5HODA 3BRUA 5C4YA 5FLVA 2WGBA 2L7MP 3HTAA 3VIBA 3ZQIA 1P7JA 3HOXJ 1LFUP 4XICA 3HTJA 2YU9J 5F27A 1QVTA 4DYRA 4A3IJ 2WAQN 1JKQC 3BR5A 3S1RJ 2JMWA 2G3BA 3OSFA 2NP5A 5DTDA 5FGLA 3S2HJ 2X9DA 2XSDC 1MNMC 2RASA 1MBGA 3B6AA 4GCTA 4A3LJ 1FTTA 3CRJA 2GLOA 3ZOBA 2CQXA 4G12A 3O60A 2CUEA 2JN6A 1U9OA 3VVYA 3DEWA 1B8IB 3S15J 1HOMA 2HOSA 2XRLA 3GTJJ 3HTIA 1PUFA 2O8KA 3VOKA 4V2GA 3G1MA 2VPRA 3WHBA 4FTHA 1IDZA 3IH4A 4C3IJ 3BHQA 2L9RA 4JX4A 5IYCJ 2Y30A 3BJBA 2LY9A 1FIAA 1LFBA 2P81A 3NI7A 3BG3A 1IDYA 2JK3A 2RHAA 2XDNA 5J1RA 2ZOZA 1BJZA 4KWAA 2YUSA 1GV5A 1ZK8A 4JYKA 4BBSJ 2IBDA 3FRQA 2V57A 3KZ9A 1RKWA 1I3QJ 3VVZA 1VI0A 5IOYA 1JKOC 3UKGA 4M6VA 3MNLA 1RPWA 2HYTA 1GDTA 1H89C 1K83J 4CGRA 3HOVJ 3NAUA 1SGMA 3P9TA 3L1PA 5H9TA 3E7LA 3GTLJ 3NNRA 3BTIA 5BNGA 2LK2A 4IEJA 4GCKA 2ID3A 3DCFA 3TW7A 4QSHA 4XIDA 2FX0A 2QWTA 2EH3A 5C44J 3GBGA 1FTZA 2UXUA 5IP9J 2NS7A 5IYBJ 3HBLA 1U9NA 3SFIA 3JRIA 5C3EJ 4UUTA 1ETYA 2R93J 3C2BA 2H8RA 1BL0A 3K7AJ 3FK6A 4V2FA 4CYCB 3V78A 4W97A 1A6IA 3RQIA 1LE8B 2H1KA 2CRGA 4Y7NJ 4GCLA 1HDDC 3VW1A 3SJMA 2FBQA 2W48A 3PO3J 2GFNA 5EZHA 4AYBN 1TWAJ 5K7HA 2Y0SN 2EZLA 1FJLA 3HOWJ 3ANPA 3GTGJ 5EF6A 5FMPA 2VUMJ 1IG7A 2L0KA 5EFYA 2UXOA 3QPLA 3HOZJ 5M3MJ 1ETXA 2NVTJ 2O7OA 3LSRA 2LTPA 2M9HA 4NN1A 4ICHA 5D18A 3Q0WA 2JJ7A 5EZGA 3B81A 1U78A 2HOTA 2HXOA 2EBIA 1MSFC 1ZGWA 1K61A 4S0HB 5FKMA 3JRAA 2ME0A 3PO2J 3Q0VA 1H8AC 3VP5A 1NK2P 1FEXA 2DJNA 1RKTA 3PPBA 4IHXA 3S1MJ 3NPIA 3CDLA 4ME9A 4NELA 1X2MA 2IEKA 4A3EJ 3BTCA 2QOPA 1H88C 2XPVA 5AQCA 2GENA 2G7GA 2ZOYA 1UI5A 1U8BA 4JL3A 3F1BA 2Y31A 3HB9A 1TWGJ 4L5EA 2PZ9A 3RZDJ 3S1NJ 3EGQA 3BT9A 1YRNB 4RBOA 1IUFA 2DN0A 3BR0A 1UHSA 3JRCA 4IHWA 2LP0A 1TWFJ 1TWHJ 2X48A 3M3YJ 3AQSA 4XK4A 3VPRA 1T56A 5IP6A 1POGA 1UG2A 3S17J 3CWRA 1VF9A 3IUVA 1MBKA 1T33A 1Y1WJ 2Y9ZA 4A3CJ 4FE7A 3SDGA 1GT0C 4ABZA 3BR1A 5F0HA 2XGCA 5EG0A 1S7EA 3GTMJ 5FJ8J 2DTZA
chains in the Genus database with same CATH superfamily
3IWFA 2DG8A 4CCOA 3HE0A 3ZN0A 2M7BA 3HOYJ 2X1EA 1D1AA 1A6QA 3GLLA 3G73A 1BW5A 1R5ID 3BR2A 3GWZA 3C07A 2ZCXA 4Q47A 4GO1A 2CQNA 3BLYA 4WF2A 4F93B 3CQZJ 3DPLC 1XMXA 1B8IA 1C0WA 2QM3A 5FD6A 1DPRA 2WB1N 4NQWA 2LLKA 2QZ8A 4PJJA 5J1UA 4A3BJ 1BR1A 1KU3A 4PZJA 4X1EA 3KCCA 2CFXA 1LFPA 2E34A 3J81K 3WG7H 5B66C 1GVDA 2HVSA 1XGMA 1UJ8A 1XX5A 2CMPA 2R7OA 1SD7A 4A6EA 1YIOA 3FM3A 3EYYA 3MVPA 3GW2A 2GUHA 2E1OA 2JWTA 4ZZLA 1ZQ3P 5ICFA 4E7JA 5EEAA 2O8XA 1FOWA 3OYKA 4EV0A 2QEXI 4CH7A 4A3GJ 2PFVA 3NRGA 3L2RA 3T5XA 4GGGA 1VQPI 1T0FC 1JKRC 3TO7A 3ZP5A 2LDUA 1BI0A 1SMYF 2QKLB 3HOTA 3HTHA 3L7WA 1IV6A 2KP6A 1Z7UA 1X4OA 3J80K 3RPUA 2Y0MA 1BR4A 5KHDA 3JRFA 3M07A 3GTOJ 4FISA 1ETWA 2ZKZA 3G71I 2OERA 5LGNA 5E18F 2DQLA 4I76A 1ENHA 2ZY9A 2QYOA 1UHMA 1LNWA 4BEHB 1WI3A 4CICA 4HDVA 3BNIA 3ABMH 2IAIA 3ZQHA 1BIBA 5KCMA 3HEFA 5LHGA 1ETOA 1LVKA 1T39A 2G9WA 1LQ1A 1L3LA 2DT5A 2QENA 4YFNF 3L2CA 5FO5A 1TL8A 4L5JA 3HHGA 2DMTA 5FRNA 5C4JJ 2F5FA 3OV8A 3GTKJ 5HAWA 3G7RA 2H27A 2VJJA 3LJLA 5F64A 3TL4X 1ETVA 1PP8F 1RI7A 2L01A 3HPGA 3KP7A 2DXIA 4GFKA 3ZQLA 3K1PA 2E7WA 5BQTA 5M5YJ 2UWMA 2WUIA 1W7PA 1WJFA 4Y17A 1OKRA 2HTJA 3S5RA 5HLGA 4DYQA 2NOGA 5GTHC 3OYMA 3HRUA 2IGOA 3T1BA 4CHUA 2V1XA 3GEUA 2X6OA 1J2XA 4XRSG 2K02A 1LE8A 2DG7A 2D6YA 2Q8KA 5F0FA 3VSLA 3EQLF 3DKWA 4WXHA 4II2A 4A2UA 4XRSA 4XLAA 1VQOI 1Z77A 2DCEA 2M2EA 3FKJA 3OIOA 1HDPA 4PDKA 3WG9A 4KN7X 4OOIA 3KP6A 2GBYA 3BQZA 1G3TA 5KK1A 4CGZA 3O2PE 2ECCA 5HS7A 5DM6F 2Q24A 3PQJA 5HBUA 5DCMB 1B72A 2G7SA 4LK0F 3VUQA 1SD5A 4OD5A 1EH8A 1VNDA 4F92B 1FYLA 3FX3A 3MZ8A 4HNVA 2ZBKA 1WKMA 3H1CA 4F7ZA 3MAJA 4QPOA 3R4KA 2YVHA 5LGUA 3HOUJ 3K1NA 1EJ9A 4AD9A 1OPCA 2KZGA 2ISYA 2KJBA 1DDNA 1K78A 1KQ8A 4U9NA 4I02A 2NP3A 2QLZA 3OWTA 4IJAA 1SAXA 2NX4A 2W1OA 3KP4A 3RSNA 2ELKA 1I1GA 2E2IJ 3K8PC 1R36A 1WJEA 3OS1A 3ON2A 5CJ9A 1K79A 2LC2A 3NQOA 1TW3A 2YVXA 5J4YA 2XROA 2JA7J 3D5RC 1K7AA 2AHQA 2RAEA 2CW8A 2XB0X 1XS9A 1A36A 5CKTA 4I6ZA 2M30A 3OYLA 1HLVA 3AG2H 4KYWA 4ZYHA 4U7DA 5CXGA 3COLA 3ZPLA 1IV8A 2FBHA 1BIAA 4HV6A 3E6BA 3V8JA 2KZVA 4ZYAA 5B5EC 4G6TB 2HXIA 4DBRA 2QBYA 1REPC 2VKVA 1E3OC 5HLTA 4IQ4A 3FXLA 1W0TA 1JTXA 3K10A 1H9TA 1Y6IA 4IHYA 3OYGA 1DU0A 2AQFA 3RKXA 4MO7A 3DKXA 2VKEA 4L62A 5KAFC 5L3FA 1TNSA 1P4AA 1WGXA 3VW0A 1QZYA 1RUOA 3K70D 1G8XA 1SD6A 4UUSA 4JQFA 1HW2A 1G2HA 2XF7A 3WE3A 2IA2A 4MQ9F 4HKUA 2Z2SB 1B9MA 1VQ6I 1S5LC 4YELA 1O3TA 2DO7A 3NARA 2C6YA 2EB7A 1F4KA 3SDBA 4Q48A 2FXAA 2GM4A 3F9KA 1GUUA 1ZRFA 1VQ5I 2A5WA 5FLXZ 1EV7A 1ON1A 4G7OF 2LF8A 4DW6A 1LJ9A 5HS8A 2OA4A 4EMSA 2K40A 3OSGA 3RIRA 3J81Z 5IOZA 2K9QA 1VZ0A 2Y48A 2DMUA 5F04A 1WH7A 5FRMA 3ZQGA 4KJZA 2FBIA 4UVBA 1R4MB 4HX8A 2NVUB 1SANA 3HDDA 3DPJA 3E6CC 1TNTA 2DA4A 2W24A 4BHBA 3H9GA 5JHUA 4EGYA 2X6WA 4ENKA 4IHVA 4U9LA 1QPIA 2JVHA 4AM3A 4MGRA 4OU0A 3KX2A 3HIFA 5FFZA 3R0JA 4D5FA 3IV5A 2R7QA 3ECOA 4C30A 3RTRA 4BBRJ 1E0EA 1YS7A 2E19A 5BOXA 2NS8A 2ICWG 1WCMJ 1R23A 3LNQA 2D2WA 1LDKB 5M3FJ 2W53A 4S04A 1WSUA 5CVIA 1O3SA 1AA7A 1DP7P 1RC9A 2VODA 3RQ4A 1VQ8I 2JA6J 4TV7A 3QQAA 1TC3C 4L9VA 3KE2A 4CCMA 1GXPA 4HSRA 5HLHA 1KONA 4HA8A 2WY7Q 5F0CA 5EDNA 3J7ZI 1JT0A 5F1RA 1V54H 2HOEA 2FQ4A 4B44A 3GF2A 4FHTA 4G6QA 4M9XA 2DFEA 3R6SA 4BGDA 3DXJF 3CMMA 1E3HA 2K9NA 4L9TA 2GQQA 3W3CA 3WGIA 2GXAA 3BCAA 3SXYA 2K3PA 4M71A 3A4CA 3B6CA 4AIHA 2F4OB 4II3A 2EFPA 2O3FA 4ZC3A 3OYHA 4PSXA 3Q3SA 2HDWA 4XLHA 1J7KA 3P9KA 4HYEA 2QSFX 4B3AA 2E5ZA 5HODA 2J5PA 2GZWA 2WGBA 3HTAA 1P7JA 2STTA 2QA4I 4XICA 3HTJA 3LA2A 1QVTA 2XSJC 3OYAA 2WAQN 3QPHA 3KETA 1JKQC 2JMWA 2NP5A 3CJTB 5DTDA 3B73A 1D8JA 5FGLA 2V9VA 4RA2A 3ZXSA 2X9DA 2XSDC 1LB2A 1HKTA 5H6QA 3B6AA 3IWZA 3O3KA 2GLOA 3ZOBA 4I2OA 3CDHA 2ADUA 1HQCA 1LVAA 3AL0C 3O60A 2CUEA 2WBMA 1U9OA 1FX7A 3DEWA 2HOSA 4HX7A 3GTJJ 3HTIA 2CQ7A 2PX9A 1PUFA 1CF7A 4V2GA 3G1MA 4L5IA 2QKMB 4C3IJ 1SVOA 1BOAA 2EA2A 1K78B 2FMLA 2Y30A 2YR2A 3KEYA 3QU6A 2P81A 1X19A 1J09A 3K4KA 2OTLI 1FY7A 3AFHA 1XTAA 1S6LA 2ETHA 2P8TA 4XLFA 3VWBA 2BOLA 4JYKA 3VVZA 5JR3A 2X0LA 5GAHJ 4M6VA 1T08B 1W36C 5H20A 1ZH5A 2OZ6A 4CGRA 3KLOA 4CZZA 2Y75A 4UV9A 3CC2I 2WAQA 4P5OA 1BI1A 3L1PA 1FMVA 3NNRA 2EINH 1OR7A 3BTIA 4RAGA 3CCQI 3TW7A 2HQRA 4UY8I 2D1HA 4OMYA 4EJOA 4RB1A 5DD8A 2IRFG 5F6FA 1GVJA 3K4LA 4E6KG 5C44J 1UAAA 2UXUA 4XOPA 4CCKA 2Z9OA 1I6XA 5C3EJ 4GXOA 1ETYA 4U87A 4LD5A 2XRNA 2GOMA 4S05A 3VB2A 4L9NA 1YFHA 3M8FA 1ODDA 4D9JA 1DPUA 3OMYA 1YYVA 3OYFA 2ZMEC 3VW1A 2W48A 4HSTA 3PO3J 3CJRB 1ZLJA 5EZHA 4AYBN 1IUYA 1Z21A 1Z7LA 2JUGA 3DF8A 2FRHA 5ILSA 5EF6A 3GTGJ 4BU2A 2L0KA 3BY6A 3F6VA 3IL2A 1D5VA 1I1SA 1TBXA 2CUZA 3QPTA 3B81A 3ZQQA 1OYYA 3WTUC 4DBQA 2M8EA 1B4AA 2GOXB 1SVMA 2DJNA 1TLHB 1N77A 1R1UA 2BVLA 4G7ZF 4ME9A 2E71A 1X2MA 1NG7A 1WWXA 3SZGA 1QHGA 1T2KA 4YIRX 5AQCA 3LSTA 1CF7B 4KIBA 3S8PA 5TISC 5E79C 2G7GA 2ZOYA 3TGNA 4JL3A 1FMWA 1Z3YA 2BBYA 3F1BA 4E7KA 2IGMA 1ZELA 4IO9F 4XLCA 3RJPA 3BT9A 2O0YA 3LSIA 4KDPA 1ULYA 1ZN2A 4KMUX 1IUFA 2BYVE 2RGVA 2EV6A 5LHIA 4RBOA 3G4SI 1T98A 3H5AA 4F91B 1A31A 2DFHA 1D3YA 2MLKA 3DLAA 3F8NA 2FU4A 2NAZA 4IF4A 2V6EA 2VQHA 1TWFJ 1TWHJ 3ZMZA 5IP6A 4G94A 2R7XA 2BY0A 4XMYA 3O6BB 3IUVA 1MBKA 1Y1WJ 4PCQA 3LSKA 4BYYA 4WK8F 1GT0C 1XGOA 1FSEA 1PDNC 1Z67A 2GIZA 1HW5A 3N4MA 1S7EA 5L3EA 1FYMA 1XSVA 3DBHB 2M4KA 5FJ8J 4KT5C 2A69F 5DEQA 4A5MA 3OYIA 2JA5J 1VQKI 3JR9A 2L9NA 5B3SH 3OOUA 5K5OA 2E2JJ 1UCRA 3GMEA 4UV8A 3GXOA 6PAXA 4PJMA 1YS6A 2HQ5A 2ECBA 3C3WA 1SFEA 5ILVA 2W25A 4PXIA 4XM3A 1WJBA 3Q9VA 5DM7F 3MKLA 1X2NA 3IHUA 1TQMA 4JP0A 1BW6A 2N8GA 3VTIA 1KYZA 3L09A 3ZMUA 1XMKA 3GFJA 4JKZA 2YPRA 1JUSA 3W2AA 4FX0A 3E0JB 1ZG5A 2R5ZA 2EFQA 3CLQA 1HF0A 3I4NJ 1LUJB 3DQVC 2XKOA 1BR2A 2MYSA 2H09A 1I50J 3K6GA 2VKHA 4U88A 3PNTA 4L9JA 4AC0A 4XBFA 5GPAA 2ZSIB 2DOAA 4IOCF 2P6TA 2M0MA 3F0CA 4PGHA 4RMNA 4QIWN 1HSJA 4F3QA 3I4MJ 3HKZN 2Z99A 2EIKH 1USSA 3OS0A 1WH5A 2HI3A 4DGWB 5ERIA 3HUGA 3HSEA 5E3LA 1EF4A 2EV5A 2ZMEA 5IY5H 1UG0A 3L2UA 2HYJA 3SFZA 1WJ5A 3H9QA 4XRMA 3LSJA 1FBUA 2FJ1A 1HXDA 2PBXA 3IH3A 4XONA 5GAEJ 3ASOH 2V9PA 1MBHA 2HYGD 2ZXJA 4XOTA 3S93A 4PUSA 3WGHA 4BS9A 1ZGAA 1WJDA 2I10A 4JX5A 5K7FA 1RRJA 3RD3A 2L4AA 4AWXB 4BUPA 3O8GA 3H35A 2NXNB 2IW5A 4ZTFA 5FHPA 1G3YA 3AKZA 3K69A 2ZXWH 2QTQA 1YJNI 2LKSA 5IT9Z 1VQNI 2M8GX 4UXNA 1XGNA 5K7ZA 2V7FA 3I59B 3J80Z 4HF0A 2EWNA 4MK6A 2RVCA 4HDUA 3SQNA 2XIGA 1AKHA 4OIQF 4WIBA 3M1EA 1MNDA 3AG3H 4A5NA 5FKLA 4BKXA 3KNWA 3MMYB 1ZR4A 2VQGA 3BCBA 3TW6A 3HTSB 3T0YA 2VASA 3V7RA 1NTCA 2OD5A 2DT7B 5M5XJ 1JI8A 4IX7A 3I53A 3IH2A 2LSOA 4BY7J 1PYVA 1YRNA 1LEAA 2P7CB 1MDMB 2A05A 1YG2A 1IN7A 2P5KA 3RZOJ 2KIQA 3LFUA 4MEXF 1JHFA 1XCVA 2HQNA 2UXPA 5KNLA 2IGNA 3GEZA 1APLC 1XDSA 2XF5A 4ESJA 1XDUA 4KN4X 5K1YA 5BMZA 1V4RA 3ZQ7A 2R7TA 2DA2A 3KZIC 1BBYA 3FIWA 1MSEC 1WJAA 4M3FA 2L02A 4PSWA 1OFCX 4XLPF 5J8FA 5B1AH 1YTYA 1MMNA 2TRTA 2MG4A 2JRMA 4U0YA 3E1SA 2B63J 2OV7A 3DWLE 1GXQA 5DDGA 3CCRI 4KNYA 1P92A 3QKXA 2DMPA 3EUAA 3S32A 1E2XA 2HKXA 1FP2A 3GO5A 3KP2A 3CO7C 3D1NI 1MNEA 4BDYA 2YVEA 2QBYB 3CJNA 1FP1D 5FKNA 1QZEA 4BQNA 1ITYA 5IYDJ 4LITA 2KJCA 2L5QA 2BY1A 5E8GA 2JSCA 3BPXA 1JUMA 4C3JJ 3QPSA 2IS6A 2OPTA 2Z5UA 1YW7A 2ZXHA 4NDLA 4QWQA 3M1CA 2PLYA 2UXIA 5AONA 2BHYA 3DKYA 3U1KA 1KU7A 1HC8A 4C2MA 2QWWA 2X4HA 3IC7A 4A93J 3KLNA 4GFBA 2OQGA 4CA0A 1QVUA 3VW2A 1VFCA 4J19A 3E5QA 1DGWY 2QCOA 2IVMA 3JSPA 3Q0UA 3WTWC 2DA3A 5DYMA 2A5YB 2VB6A 3SYTA 3WE2A 2RREA 1WQ2A 3AG1H 4RGSA 3KP5A 2ZJ2A 2MLGA 3HRSA 3CCJI 4D7MA 1BOBA 2HU9A 3JW4A 2CJJA 2HOAA 1XMAA 3I59A 3E5XA 4AUXA 2FNAA 3SHFA 1O7LA 3RCOA 1JT6A 2KMUA 1R1VA 5J4VA 2QQBA 2PMZN 3JRDA 3K2AA 2XPWA 4HF2A 2VOOA 1MBEA 1BC7C 2FEZA 3J7YJ 2HZTA 1P4WA 5EGOB 3KP3A 3FDYA 2EZHA 1ZR2A 2IU5A 4RGXA 1U8RA 4LG0A 3G1OA 3K0LA 2E1MC 3C2GA 4Y15A 3K2ZA 1MZBA 3M7GA 1IJWC 1DQUA 1W1WE 1RZ4A 3HM5A 2CV2A 4JOMA 2DLLA 1KGSA 3LSGA 5DD4A 1IN4A 3IAM2 4XKVA 2F07A 5GTIC 2R7DA 5BPDA 4L0ZB 3CZ6A 2IP2A 1ONVA 1UB9A 3ECHA 4O3MA 4E7SA 1IXCA 1AWCA 5LHHA 1UMQA 3BC8A 4QPQA 5KAIC 4BQOA 4KISA 3SZPA 2XAGA 5EG0B 2JUCA 3OIPA 4R1HA 4MLOA 2FF4A 2LFBA 5E3OA 1Y0UA 4I01A 2LOOA 3OIQA 3LA7A 3BTJA 3PM1A 4AYBA 4WX9A 1A5JA 1YE9A 3HIMA 2WB1A 3GZ5A 3WTZA 1D5YA 1IRGA 2DODA 1RNLA 2PQ8A 3TOAA 3V8LA 2LKXA 2E1MB 2H1LA 4IXAA 3ZN1A 4GDFA 1OCTC 4I99C 2ZSHB 1B9NA 2G7UA 1W5TA 2M7AA 5KVRA 3K70C 3R61A 5HS9A 1FT9A 3BG5A 2QUFA 2KFDA 4MXMA 3RKWA 3MKWB 4LJZF 1RETA 2BXZA 4DQ2A 2JA2A 2QQ8A 1Z91A 2KRCA 4IOAF 3DFGA 3FWEA 4Y3OA 5ILUA 2Z3YA 2F6CA 4PK4A 5HDNA 1W4MA 2O7TA 2XVCA 4W1UA 1MW7A 1ZAOA 1YW9A 2PMUA 1H9GA 2FJI1 2VIXA 4EJUA 3BZKA 2VXZA 1MD0A 4IHSA 2KT0A 3BDDA 3GYHX 1B59A 4MFDA 3MD2A 1X1BA 3S14J 3JTHA 5CW8A 2NVYJ 3VODA 3OYCA 4IRIA 1YX5A 4PFPA 3K4NA 3NS4A 4IL6C 1EKEA 4IKFA 3VIBA 1ZG1A 1FC3A 4H4KC 5F27A 4IRGA 3RDIA 4ENJA 4LG0B 2Z1DA 1EH7A 3BR5A 2OU2A 3A2KA 4NC6A 3CCMI 2VBYA 2VQCA 1LPQA 2R7RA 4MEYF 1UHWA 1NH3A 1MBGA 4GCTA 2HTSA 2CYYA 5CQEA 3PNYA 3QYEA 4I0BA 2JPBA 2OCEA 3ABKH 1MMDA 4FX4A 1O3RA 3I3LA 2JN6A 4RGRA 4YIIA 5FLXK 2XDVA 2DI3A 1B8IB 3NRVA 2YX7A 2XRLA 4IPAA 2CWEA 2O8KA 3J7AO 3BHQA 1XB4A 3CCSI 2KIUA 1FIAA 1LFBA 3NI7A 3BG3A 4OIRF 2JK3A 2L3DA 2CSOA 2RHAA 1U0JA 1BJZA 2YUSA 2E7XA 3M9AA 3LAPA 5HLIA 1O3QA 4NQWB 2CQKA 3FRQA 3FMSA 1RKWA 1I3QJ 3CUOA 1VI0A 5IOYA 1JKOC 3FM5A 1RIOH 4WCGA 2HYTA 1GDTA 4UNOA 2H6CA 1AOYA 3NAUA 4XLEA 3P9TA 2KDOA 3ONQA 3CDIA 3E7LA 3GTLJ 5BNGA 2ESHA 1XSDA 1OCCH 2P0WA 1R6RA 1WRJA 4U0VA 2BY3A 2QWTA 2CV1A 2FSWA 2KQRA 2E36A 4LK1F 4FASD 2A6EF 3H0DA 2CG4A 1TT0A 3HBLA 4UUTA 2CS3A 1BL0A 3K7AJ 2QQ9A 1Z05A 2F5EA 2JPCA 3PFYA 4BE1A 1A6IA 2DU9A 4D1QA 2CRGA 4GCLA 3DTIA 5L3BA 3JAMZ 2RN7A 3NEUA 1WJCA 3CTAA 2K5CA 2B3WA 3F6OA 1MIJA 2EZLA 1FJLA 4O6JA 3HOWJ 3OL4A 4OIOF 3ANPA 2VUMJ 3CJQB 3MKYB 1IG7A 2IS4A 3FXKA 2LY1A 5D6EA 2UXOA 1BI3A 1LEBA 1GHCA 3TBIA 5M3MJ 3OYNA 1ETXA 2XF6A 1Y0NA 2HVQA 4BEHA 4I09A 3U21A 3QOPA 2JRTA 4MNUA 2UZKA 5D18A 4M74A 3UR3C 2XAFA 1Z6RA 3LAJA 1MJ9A 2EBIA 5L3GA 1ZGWA 1QA6A 3W6KB 4S0HB 4LLLA 2ME0A 2XKPA 3C2HA 2Y0SA 1H8AC 1NK2P 3ABTA 2RNGA 1BI2A 2MH9A 2HFHA 1LDDA 4Q4ZF 3HC7A 4IHXA 1G6NA 3CCUI 3S1MJ 3OYJA 3CC7I 3EUHC 2X6YA 2PJRA 3CESA 4XRFA 4ETSA 3E5UA 2DPDA 4MTEA 2PI0A 2O61A 4ANJA 2R7FA 1VQ4I 5LEKA 4QLCU 3LMMA 5CVRA 1WHUA 4YFKF 2VQLA 3ML6A 1UI5A 5CVUA 1GLNA 2VKDA 4M9ZA 3DBLB 3HB9A 5A2QK 1TWGJ 3Q5FA 3N05A 3RZDJ 2EV0A 3S1NJ 3HUGB 1FZPB 4BHCA 3DPUA 3HZJA 4M72A 1S7AA 3FBNB 4ZZDA 3WU1B 3COAC 1YJ9I 2HVRA 3JRCA 2MC4A 4B47A 1KU9A 1N75A 2YX4A 2ZFWA 2UV1A 2WADA 5DCMA 5LRSA 3AQSA 1Z1DA 2AXLA 2WY8Q 4XK4A 3REOA 2KPMA 1POGA 1UG2A 3BG7A 4A0XA 4ENNA 1BC8C 3SDGA 3HHHA 3VYRB 5F0HA 3BR1A 2DW4A 2Q0OA 4NBQA 5EG0A 2JVGA 2BW3B 3GTMJ 4E7HA 2CFOA 2TCTA 4F52A 4Z6YA 3WHCA 2Q2EB 4OAZA 3EUPA 2DMQA 1Y1VJ 3RKQA 4YFXF 3KYDB 2AS5F 3JRBA 3JREA 3WODF 2XB5A 4MQVA 2WTEA 3I71A 3LSPA 2L54A 3CMAI 4RB3C 2K4BA 1EH6A 3TEDA 3C18A 3A02A 2FOKA 1ZRDA 3S3NA 3CCYA 3NWTA 2WV1A 4FE4A 4M3DA 1QNTA 4CO8A 1R71A 1QRYA 3ESWB 2PJPA 3TDZC 3RH2A 3W2VA 3H3UA 1OISA 2BHZA 4P96A 5L3DA 1IGNA 2EIMH 1S9HA 2K9LA 4AVZA 1R22A 4NHJA 2FNPA 5ICCA 1UFMA 4RDUA 2ZJRF 3KKCA 2DMNA 3MFKA 2NYXA 2QVOA 2VC1A 4IVNA 2ZJQF 2G7LA 2K3FA 3W6VA 4M3EA 5CVJA 3DU6A 2OTJI 3BG6A 2DBBA 2BEOA 5E1XA 4L0YB 1XGSA 2Y9YA 3G56A 1R58A 4Y4RA 4RB0A 1JJ8C 2K9SA 4RLFA 3I54A 1Z3XA 4R79A 1Z0XA 1NG6A 5DCFA 3LL7A 3EPZA 4HAMA 1VTNC 4GCVA 2R7ZJ 4EM0B 3QP6A 3LFKA 3JAMK 5D6FA 3KIOA 2LD5A 3A0HC 3LWFA 5IP7J 4HF1A 3LQQA 2BE5F 4LG3A 2KDZA 3CCLI 3FZVA 3ABUA 3OR2C 2JZYA 2DA5A 2EJRA 2HEOA 3FXQA 2E5NA 2VE8A 4YZEA 3BCGA 1XD7A 2G7HA 3FBIB 3GZIA 5K5QA 2CUFA 4EJTA 2LR8A 4M3GA 2FBKA 2AQEA 3QU3A 1MH4A 2DPUA 2ZCMA 1WVRA 4H0EA 4A69C 1IRZA 3CMYA 2CH0A 3GFMA 1D8KA 3LWJA 4MIMA 2L7FP 4ENMA 2X6XA 2WV0A 4A3DJ 1JGGA 5K58A 5GADJ 3OR1C 1TP4A 4BACA 2RQPA 3FISA 3IUOA 3VFZA 1HW1A 3HTUA 4B48A 1JJ6C 3E6MA 1XN7A 2E2HJ 2ESNA 3IRRA 2NVQJ 1ZG3A 1O7FA 5HOOA 4HQEA 3DTEA 9ANTA 3QBMA 2KISA 2HDCA 4HNUA 4X6AJ 4XR6A 1MJAA 1P4XA 5D19A 1P6RA 3U1DA 5BS6A 4LMYA 5D5WB 2X85A 3D5SC 4DJAA 3JCUC 2P4WA 4NUBA 2M1BA 3MZHA 3ZCOA 2PG4A 1E17A 3CUQA 3P5JA 3ZMSA 3U9GA 2R7SA 5FKOA 2BZTA 4OWRB 4RAZA 5JI6A 3FXUA 1F43A 1IXSB 1UZCA 4ZYEA 1WI9A 2F2EA 1RESA 3H3VK 2OI8A 4CYDA 3NXCA 3PSFA 2P6SA 2TDXA 2W7NA 4LB5A 3BZCA 3IRQA 3DEUA 1OLTA 1A04A 4ZYGA 1CQTA 1B6AA 4KUMA 2M34A 1OJLA 2VXDA 4KIFA 1TQIA 4NC8A 5J8CA 1ZHFA 4GYIA 1B72B 4HLYA 4OINF 1R9TJ 3AG4H 2LVSA 1P2FA 4LIVA 2RDPA 5DS9A 4BXUA 1YITI 4G7HF 2L2OA 3BR6A 2D1VA 3V4GA 2XAQA 2JA8J 4E7LA 1FBSA 2L4MA 2B7EA 4BJTA 5JFRA 2JSPA 1AU7A 2EILH 2XUBA 4XORA 1CGPA 1P7IA 2KRFA 5K5RA 1ORKA 2PN6A 1YX3A 3A0BC 3OY9A 3QWLA 4XKCA 3GZNB 3BQYA 4NC7A 3M4OJ 1XC5A 1N25A 3ERMA 3CCVI 2EZKA 2PMZA 5HNHA 1D0ZA 3KKDA 4PFOA 4BJ5C 3RI4A 1IZ1A 2VJ4A 2FA5A 2V1DA 4L18B 5FGMA 3E7QA 2DQRA 5CXIA 2XGEA 3TP3A 2A07F 1FIPA 2K85A 3I58A 3IKVA 2HNHA 3C7JA 2HQAA 3WTVC 2XHKA 1U6GA 3S16J 1ZKGA 3TMOA 1ETQA 4BHPA 2IT0A 1MGTA 1RR7A 2BV6A 2O5RA 3P9CA 2D45A 2HR3A 3X2QH 5E1WA 3PJRA 3A01B 2L7ZA 1VQMI 1KQ9A 4GFLA 3LOCA 3PNVA 2RQQA 4ZDPA 1I39A 2DK8A 1T38A 2EK5A 2JT1A 1HKSA 4JX6A 4E7ZA 2F4MB 3ELKA 4EJVA 2FMYA 5J47A 2JTVA 1X3WB 1J0RA 4BL0B 2HPMA 2E1NA 2PMHA 5GP9A 3JSJA 2R5YB 2R5ZB 1K4TA 3HKZA 4XSZF 2DA6A 1PJRA 1SFXA 2FD5A 2R0QC 5M5WJ 2DDAA 2HKOA 4I7HA 1U5TC 5EJCA 2A68F 3WTTC 3QYFA 2K27A 2EQRA 5HSZA 4I98B 1IO2A 3ON4A 1S3JA 4B3XA 2DOFA 3PFIA 4CXFA 4LOCA 1OCPA 2L9SA 2VBZA 4U0WA 2DFIA 4Y33A 1IAWA 1ZTRA 4ON0A 2KKOA 3S1QJ 3M8JA 1YW8A 3BG9A 5JHFA 4UB8C 2REKA 1KYWA 2ME6A 1HKQA 5CPRB 1SMTA 5LBQA 2KRHA 3G6EI 3BR3A 3CP8A 1E3PA 2ZCWA 4HEA2 3QRFF 5LFAA 2R5YA 2MFZA 4M3BA 3NWSA 2OC6A 4C2UA 3ZR8X 3O8HA 5LRRA 2CW7A 4NNJA 1QGPA 3SWHA 3PL8A 2WAFA 1U5TB 4CDGA 3K4BA 1T95A 3G1LA 4BJ6C 2OF7A 3A01A 3ZMDA 2JQ7A 3DP7A 3M8EA 4GYGA 5J3LA 2XASA 2RC4A 3BJOA 4KA4A 3OL3A 4HZFA 3FKIJ 1HA8A 3VOXA 4EEFG 1PUEE 2GWRA 1YOVB 2EPFA 2HGCA 1V5EA 2P5VA 1V55H 5AIQA 1O4XA 5EYRA 5C4YA 5FLVA 4M73A 2L7MP 1ACIA 4HRIA 2IPQX 4U7BA 1MMSA 2F5VA 3TDUC 3KZYA 1JHHA 3V42A 5GAGJ 3S1RJ 1T6SA 4IHTA 2ZMEB 4WWCA 1EA3A 1QBJA 4A3LJ 2W57A 1J75A 4IRHA 4G9YA 3HPHA 2CQXA 2BW3A 4KT6A 2XAUA 2MA3A 3DLLF 4EVIA 3E3VA 2B9SA 2FE3A 4IQJA 3S15J 1HOMA 2FQ3A 4ESFA 5D5XB 2VONA 4FTHA 4KFCA 1IDZA 2KLOA 3WHBA 1JE8A 2MH2A 2A3SA 5D4RA 1V3FA 3H92A 2L9RA 3MCZA 1X1PA 1UELB 5DUIA 1G3SA 1FSHA 3BJBA 2LY9A 4MTDA 1YO5C 1YHQI 2ZOZA 3T8RA 1Z6TA 4KITB 3HOSA 1DP3A 1GV5A 1R5GA 3F8FA 1ZK8A 3OYEA 2VC0A 4HV5A 1W5SA 3WTYC 3ROUA 3S2WA 1IRXA 1RPWA 2VBWA 4XLNF 1H89C 4HG2A 4WXCA 3WTSC 1SGMA 2ACJA 2M5WA 5BPIA 2O6GE 2E60A 2M45A 3E97A 4BE2A 2LK2A 5J40A 1TW2A 4GCKA 2ID3A 3DCFA 2A6TA 1FLIA 4QSHA 1NHAA 2UXNA 2FX0A 3VEPA 2E35A 3Q9SA 1J5YA 1SD4A 3R0AA 1FTZA 1SVLA 1DUXC 3AL0B 2NS7A 5IYBJ 1U9NA 3JRIA 1JXSA 3PUFA 2H8RA 2XGXA 3L2QA 3H36A 4V2FA 3V7CA 1KU2A 1LDJA 1QHHD 1LE8B 2H1KA 4Y7NJ 1HDDC 3HJEA 2IJLA 1L0OC 2MD0A 2FBQA 2GFNA 1PVEA 5HDKA 2Z33A 2L7KA 1TWAJ 3HG9A 2Y0SN 3F22A 2OQRA 4K2EA 5FMPA 1X1DA 3ULQB 1MMAA 4BH9A 3HSFA 2PFBA 3ERED 1SFUA 2GA2A 2O7OA 2HWVA 3LSRA 4BAYA 3UNGC 5E17F 4E7IA 3BPVA 2STWA 3CMEI 1OCRH 4ICHA 3Q0WA 2JJ7A 5EZGA 1Y39A 1U78A 2HXOA 4PJLA 2O03A 5DV5A 1K61A 3FMQA 2HS5A 1XSXA 2IA0A 2R7WA 3VP5A 1TQPA 1D0YA 1ON2A 2X51A 1RKTA 2R7VA 3F23A 4RAYA 3PPBA 2K7LA 2WWYA 3IP4B 3G2BA 4HBLA 4A3EJ 4XQFA 2ZJPF 2QOPA 1D0XA 4ESBA 4GRIA 2XPVA 3I4PA 3KZZA 3CCEI 1Q1HA 3HL2A 2LH9A 4NB5A 1OYWA 2E1CA 5EEHA 4LIUA 3VOEA 2ZO4A 3ABLH 3VYUB 5LGTA 1XCBA 1Y8RB 1YLFA 3E6DA 5AIPA 2PZ9A 2Z16A 1F9NA 2V9KA 4RM3A 5FD5A 3EGQA 2X1DA 3GX4X 3S3OA 2EIJH 4KMFA 4ZH4F 3BR0A 4YRVA 3LQRA 4A0YA 3M3YJ 3AAFA 5ICGA 3EDPA 2V6CA 1X3UA 1OMIA 2L9VA 2CUJA 1ZRCA 1QU3A 2KIFA 5TJJA 2NNNA 1T33A 2Y9ZA 2BXYA 5CYVA 2ZXIA 3F8BA 4JK1X 3MZYA 2OAZA 2ELJA 4P9FA 4P55A 2EZIA 1NK3P 5JVGF 2YU3A 4HW0A 2LG4A 4A3MJ 5A2QZ 2QSHX 1J9IA 2V1UA 1W0UA 5J6XA 2PEXA 2MW8A 3EUKL 4EGZA 4OIPF 2CGPA 1DU6A 3K4CA 1YQAA 2M0CA 3T6NA 5E8IA 3BTLA 3ZMVA 2F5CA 3B02A 2MBFA 1TWCJ 5IPAA 3J7AY 1IN5A 4N9IA 1X1AA 5FLMJ 2XV4S 1F36A 5JLXA 4FCYA 2Y69H 5ED4A 2VT2A 3BJ6A 1Y8QB 4WXDA 1X58A 2LNBA 3PIOF 3PASA 5FROA 3HRTA 2UXHA 2IXSA 3JRGA 1OCZH 2BGCA 2IS1A 2HZDA 4JNNA 2HKUA 4AC6A 5GPCA 3SZTA 5TRDA 4YG2F 2G0EA 4XSXF 2OCCH 3D0SA 4CUGA 2KIMA 3ANGA 1QPMA 2I5UA 2V26A 2FOWA 3HGYA 1IW7F 3RKYA 2K9MA 2QIBA 1GV2A 2HPIA 3I5UA 4LGWA 4ASNA 2XAJA 4AVPA 5J1YA 4UVAA 3LSMA 1RR8C 2QF7A 3L9FA 2Y2ZA 2LY2A 1RUNA 3GTPJ 1O57A 3MN2A 1MKMA 2LBFB 4D5CA 1H0MA 3CF2A 1VQLI 4LLGF 4HNTA 3V7SA 1WPKA 3JTGA 1XPXA 2COMA 3KFWX 2EA4A 4MHGA 1IF1A 1OYIA 3P7NA 3WTXC 1ZARA 1K4SA 3A03A 5HDGA 4EM2A 2DA1A 4B09A 3FHZA 5ICEA 4RLQA 2R92J 1YJWI 2COBA 4ACIA 1IC8A 5JLWA 3I0TA 2YSRA 1MMGA 1M1EB 1X4PA 3QYBA 4UHTA 3ZQCA 4UVCA 5D1RA 3VYSB 3CF5F 2VPLA 3C1DA 4UDSA 4HOBA 4Y52J 1JTYA 2CQQA 1OQYA 3ASNH 4RM2A 3I9V2 1TTYA 4Z2YA 2O9LA 2HYFA 3MWMA 4EQQA 1W5CC 3JSOA 2DAOA 3QAHA 1U2WA 1FNNA 2A61A 3U2RA 3JRHA 3S2DJ 3KPHA 1B1BA 5D5UB 4UUSB 4AU7A 3LA3A 2MSYA 2EFNA 5LEJA 3FK7A 1KQ0A 2BVMA 1W7PD 2VOPA 3MKZA 2DYSH 3GLXA 4J01A 1XG1A 4XKBA 3TO6A 3QOEA 4F55A 1AHDP 4XKWA 5CQGA 3L2VA 3KEOA 4OMZA 2GIVA 1OCOH 3L00A 4V19K 4C2MJ 4B8XA 2NS0A 5C4XJ 3PQKA 3H0GJ 2XC7A 5FKKA 2ELHA 3KYCB 3CC4I 4MFEA 1IN6A 1K6YA 4M6XA 2F5DA 2B1EA 2VLAA 3SEQA 1KZHA 1PUFB 3ZGKA 4D7NA 4OD4A 5E3NA 4BXXJ 4HPQA 5F08A 1G4DA 2W00A 2VJIA 2X1CA 2OBPA 2QSGX 1T0FA 3V6GA 4BY1J 5D8LB 3P9IA 4C2TA 4BE0A 3V8KA 4DVYP 3FHNA 1TZLA 4EJWA 2LMDA 5JVTA 4LB6B 3VDXA 1SAUA 5D5VB 2NVXJ 1LKXA 3TO9A 4DIQA 2KHMA 3VVXA 1JGSA 4E70A 1R7JA 1HCRA 3HYIA 1JUPA 2DFFA 2K4JA 4ZJZA 3ZQFA 2WC2A 3PSIA 4CYCA 1FYKA 3RYRA 2LF7A 2ZB9A 2MD5A 2XGDA 2HDDA 3I64A 5FFXA 1MH3A 2XAHA 3QP5A 1STZA 4D0PA 2A2FX 2V4JC 3AQTA 1MJBA 2I8DA 3H5RA 4C9YA 1YI2I 4A3JJ 5F1JA 3LHQA 3TOBA 2ID6A 5CVVA 1Y56A 4ITVA 1MBJA 1AKHB 1U5TA 1V5GA 5E20A 2MGQA 3DBRB 2CU7A 4PGGA 1SEUA 3TQNA 4B4CA 5HVQC 2DYRH 2DT6A 4M6YA 4AIDA 5LD2C 1YIJI 1FPQA 3MEXA 2CV0A 2QKOA 3ZMTA 3PIPF 1SFOJ 4I0AA 4LLNA 2A6HF 3DV8A 4BXFA 1Z9CA 2CW0F 1S8NA 2RKHA 2ZNYA 2EFWA 1UI6A 2AXTC 1Q1VA 2ZFUA 3WU0A 1I6HJ 4M9SA 2NNYA 2F48A 1VQ9I 3HGGA 3KYLA 1P9QC 2R3SA 1QQIA 3CO6C 2GA1A 2ZC2A 2LBFA 3F8CA 3GFLA 3F72A 3RPQA 2BY2A 2DOEA 3RPUD 2MC3A 1R4NB 3F8MA 2ZCNA 1QZZA 4Q5SF 2XPUA 2VL8A 4C3HJ 1USTA 1IRFA 4A3FJ 2W84A 1ERDA 3CUQC 4QTRA 2RV8A 3BP8A 4DZJA 4AF5A 2YS9A 3G3ZA 2CO5A 3H5NA 2RNJA 4N9HA 1ZREA 5E3MA 4G8XA 2W82A 2LKPA 3L2WA 1R00A 4B1RA 1S7OA 1BA5A 3CJDA 1WZ2A 1I5ZA 1R5HA 4J00A 2FUG2 3FXJA 2D5VA 4BQQA 3A1YA 1WFXA 2VJ5A 3GTQJ 4FQGA 2VI6A 1T8IA 4RGUA 4B43A 2GXGA 1OR7C 5CLSA 4ZYDA 1F5TA 4HQMA 4N4NB 4XN3A 5HNFA 2M87A 2MABA 4YEJA 3GFIA 1N78A 2ZNZA 1W7PB 3DU5A 1ETKA 2VE9A 1JKPC 3MQ0A 1MBFA 3I56I 2P7VB 1D1CA 4HLXA 5EGOA 2J5OA 4IZZA 1IN8A 4CCJA 3EUHA 4YIFA 2F4IA 1FOKA 1U3EM 2PJRB 3DPTA 4EM1A 2IS2A 4A0ZA 3WGGA 1R49A 3W6JB 1KA8A 4P1WA 5E1ZB 3R60A 2DA7A 1DGRM 4HX4A 4BNCA 4DYCA 4A3KJ 3BZ6A 1BN5A 3BWGA 5DAJA 4A12A 2AO9A 4DZPA 1X3ZB 3FXMA 4KICA 3TP0A 3BRUA 4IRVA 3RYPA 3ZQIA 3HOXJ 2WAEA 1LFUP 3BOQA 2YU9J 4A3IJ 4DYRA 5D8KB 4DOZA 2OZUA 3DTKA 5DUKA 1S29A 3OYDA 2G3BA 3OSFA 3BROA 5H6RA 3WU2C 2OJED 3S2HJ 3K1MA 2VBXA 1MNMC 1FOXA 3N97A 2RASA 2NRAC 1QO0D 2W4SA 4CZCA 1FTTA 4XN0A 3CRJA 4BQAA 2W85A 1G59A 4O5VA 2V1NA 4G12A 3K4MA 3T8TA 5FB2A 1SFKA 1BJAA 3ZRGA 1FBQA 1PP7U 4PJNA 3VVYA 4JBAA 1W36D 3EETA 4N4OB 2M4GA 3VOKA 5B1BH 2DDBA 2VPRA 5LLQA 3IH4A 3HRMA 4JX4A 5IYCJ 2IA1A 3CUQB 3GZ6A 1IDYA 1G3WA 1FOYA 1HSTA 3FMRA 3QODA 2GAUA 4XNFA 5J1RA 2XDNA 4KWAA 5D4SA 2EFOA 1ZYRF 3IAS2 4BBSJ 2IBDA 2V57A 3KZ9A 3OYBA 3UKGA 3H9JA 3MNLA 4CCNA 1K83J 3HOVJ 1ZLKA 3CP2A 2QGUA 1VQ7I 2KL4A 3BJAA 5H9TA 3GCMA 4AIJA 2DJIA 4IEJA 2IGKA 4UB6C 4CCLA 4FT8A 3LSHA 4XIDA 4P9UA 1V5FA 2Q2EA 3VYTB 2EH3A 2H6BA 3GBGA 3HXLA 3OOPA 2B0LA 5TGTA 5IP9J 3I55I 2QQAA 3SFIA 3CLOA 2R93J 3C2BA 3VSKA 3FK6A 1ZGJA 2GXBA 2WA0A 2PBIA 4CYCB 4RB2C 4W97A 4ZDOA 3RQIA 3V78A 1R1TA 1MDMA 3CD6I 4FETA 1F1ZA 1X1CA 3SJMA 1A35A 2DK5A 2LYCA 4BDZA 5K7HA 3F3XA 3GUDA 2DTRA 5H2FC 3DEEA 4RS8A 4ZDLA 5EEGA 5EFYA 3QPLA 1S72I 3HOZJ 3FF5A 4AIKA 4EATA 2NVTJ 3PUBA 2OUMA 2LTPA 2M9HA 4NN1A 3K4JA 4N0BA 3D5LA 1I3AA 2HOTA 2H94A 2UXXA 1MSFC 1D1BA 2H8WA 2VN2A 4E4HA 4ZTJA 3JRAA 5FKMA 4Y13A 3ISPA 3F21A 3PO2J 3Q0VA 3KEQA 5IT3A 3FXRA 1FEXA 2UUZA 4KIGA 2V79A 4UUVA 1FWZA 1BM9A 4LFUA 2ISZA 3NPIA 4CSWA 3CDLA 4NELA 2Q1ZB 2IEKA 4R8HA 3H3ZA 3BTCA 2LREA 1SC7A 1H88C 4XL9A 1J59A 2GENA 1TT5B 3EYIA 2LRDA 1U8BA 2Y31A 4G6DA 3K9TA 3FXOA 4L5EA 1IXRC 4DNCA 2K86A 2NOJB 1YRNB 4PJ0C 2DN0A 1HBXG 1UHSA 2M3AA 3SEZA 4IHWA 2R7UA 2LP0A 5IT9K 4RAFA 2X48A 3GVAA 3VPRA 1T56A 2R4GA 2P5LC 1K6OA 3S17J 4A6DA 1VF9A 3W2WA 5L3CA 3IKTA 4X0GA 3S3MA 3CWRA 3TKYA 4A3CJ 4FE7A 1I27A 3OS2A 4ABZA 2XGCA 3HSRA 4OAYA 2DTZA 2VT3A
chains in the Genus database with same CATH topology
2TCTA 2EZIA 1NK3P 2DG8A 3WHCA 2JA5J 3HE0A 4A3MJ 3EUPA 2DMQA 3JR9A 1Y1VJ 3HOYJ 3OOUA 3RKQA 2E2JJ 1W0UA 3JRBA 2MW8A 3JREA 1DU6A 2XB5A 1BW5A 2HQ5A 3BR2A 2ECBA 3C07A 3LSPA 2ZCXA 3TEDA 2M0CA 4PXIA 3A02A 3CQZJ 3T6NA 3BTLA 3CCYA 4FE4A 2WV1A 3MKLA 4M3DA 1B8IA 1X2NA 2WB1N 1TWCJ 1QRYA 2LLKA 5J1UA 4A3BJ 4JP0A 1BW6A 4X1EA 2N8GA 5IPAA 3RH2A 4JKZA 1JUSA 1IGNA 5FLMJ 1GVDA 1F36A 5JLXA 4FCYA 2R5ZA 1HF0A 3I4NJ 1X58A 3MVPA 4RDUA 2GUHA 3KKCA 2DMNA 3PASA 2UXHA 2E1OA 2JWTA 1ZQ3P 1I50J 3JRGA 5EEAA 4AC0A 2G7LA 3W6VA 2HKUA 4A3GJ 4M3EA 4JNNA 5GPAA 3NRGA 5GPCA 4AC6A 2G0EA 3F0CA 4QIWN 1JKRC 3ANGA 2Y9YA 3HKZN 3I4MJ 3G56A 3HGYA 1WH5A 2HI3A 3HTHA 1IV6A 5E3LA 1EF4A 2QIBA 1JJ8C 2K9SA 1GV2A 3JRFA 1Z0XA 5J1YA 4FISA 2HYJA 3GTOJ 1ETWA 4XRMA 3LSJA 2OERA 2FJ1A 2QF7A 2R7ZJ 2Y2ZA 3GTPJ 2PBXA 4I76A 3IH3A 1ENHA 3MN2A 2LD5A 4D5CA 1WI3A 3BNIA 1MBHA 1WPKA 2IAIA 5IP7J 3ZQHA 2I10A 3HEFA 4JX5A 5K7FA 1ETOA 2KDZA 3RD3A 3O8GA 3A03A 2DA5A 2DA1A 5FHPA 2QTQA 4YZEA 3BCGA 2DMTA 3GZIA 5C4JJ 2R92J 2CUFA 2COBA 4ACIA 3GTKJ 1IC8A 2LR8A 5JLWA 5HAWA 2M8GX 4M3GA 5K7ZA 3G7RA 1MH4A 2ZCMA 3ZQCA 4A69C 1IRZA 3CMYA 3LJLA 4MK6A 5D1RA 1ETVA 3LWJA 4MIMA 2L7FP 1AKHA 4UDSA 4A3DJ 3ZQLA 1JTYA 1JGGA 5M5YJ 4Y52J 2CQQA 5FKLA 2WUIA 4GFKA 4BKXA 3KNWA 5K58A 1ZR4A 3TW6A 2O9LA 3FISA 3S2DJ 3JRHA 1NTCA 3S5RA 5M5XJ 1JJ6C 4DYQA 2NOGA 4UUSB 3IH2A 2E2HJ 2MSYA 4BY7J 3FK7A 2NVQJ 1YRNA 2X6OA 3GEUA 1LE8A 4XRSG 2DG7A 2D6YA 9ANTA 1XG1A 3QBMA 5F0FA 1AHDP 4XRSA 4X6AJ 3RZOJ 5D19A 1Z77A 2M2EA 2UXPA 4C2MJ 3OIOA 1APLC 1HDPA 5C4XJ 2GBYA 3H0GJ 5FKKA 3BQZA 2DA2A 2ECCA 3FIWA 4MFEA 1MSEC 5FKOA 2Q24A 4M3FA 5HBUA 1OFCX 1B72A 2G7SA 3VUQA 1F43A 1VNDA 1PUFB 4D7NA 5E3NA 4BXXJ 4HNVA 2TRTA 5F08A 2MG4A 1RESA 3H3VK 2OI8A 2B63J 3NXCA 3QKXA 2YVHA 2DMPA 3V6GA 4BY1J 1CQTA 3HOUJ 2M34A 1OJLA 3D1NI 2YVEA 1B72B 2NP3A 5FKNA 1R9TJ 1ITYA 2LVSA 5IYDJ 5DS9A 2NVXJ 2NX4A 3BR6A 1JUMA 3VVXA 4C3JJ 2JA8J 3QPSA 2ELKA 2OPTA 2E2IJ 4NDLA 1HCRA 1JUPA 1AU7A 2UXIA 3ON2A 3ZQFA 1P7IA 4CYCA 1ORKA 2JA7J 2ZB9A 2AHQA 4A93J 2RAEA 2XB0X 2XGDA 1XS9A 2HDDA 3BQYA 1MH3A 4I6ZA 4GFBA 3M4OJ 1XC5A 1HLVA 1QVUA 2EZKA 3VW2A 5CXGA 1VFCA 4J19A 3COLA 2QCOA 3KKDA 3Q0UA 3AQTA 2DA3A 4A3JJ 5F1JA 2HXIA 3LHQA 2ID6A 2VKVA 1E3OC 1MBJA 1AKHB 3E7QA 1W0TA 1JTXA 2XGEA 2MGQA 3TP3A 4D7MA 5CXIA 2CJJA 1FIPA 4IHYA 2HOAA 1DU0A 4AUXA 4MO7A 2CU7A 4L62A 2VKEA 1JT6A 4B4CA 1WGXA 3VW0A 3S16J 2QKOA 4UUSA 1ZKGA 2PMZN 1G2HA 1SFOJ 4HKUA 1ETQA 3JRDA 3K2AA 2XPWA 1RR7A 1MBEA 3NARA 1UI6A 3A01B 2L7ZA 5EGOB 1Q1VA 2EZHA 1ZR2A 1I6HJ 2IU5A 4GFLA 3LOCA 2GM4A 3HGGA 3G1OA 1GUUA 4DW6A 4JX6A 2K40A 3OSGA 2ZCNA 1IJWC 5GP9A 2XPUA 4C3HJ 5IOZA 2K9QA 3JSJA 3HM5A 2R5YB 2R5ZB 2DMUA 2DA6A 5F04A 4A3FJ 1WH7A 3LSGA 3ZQGA 4QTRA 2FD5A 2R0QC 4DZJA 5M5WJ 2F07A 4AF5A 2YS9A 1SANA 3HDDA 3DPJA 2DA4A 2EQRA 4IHVA 5E3MA 5HSZA 1UMQA 1QPIA 3ON4A 4B1RA 1BA5A 3CJDA 5EG0B 4MLOA 4D5FA 3IV5A 4LOCA 1OCPA 2LFBA 5E3OA 4BBRJ 3PM1A 3BTJA 2D5VA 1ZTRA 2E19A 1A5JA 3HIMA 2NS8A 3S1QJ 3BG9A 1WCMJ 1D5YA 3GTQJ 2REKA 2VI6A 2ME6A 3LNQA 5M3FJ 2LKXA 2W53A 3BR3A 1OCTC 2R5YA 2JA6J 3QQAA 4M3BA 1TC3C 3BG5A 3O8HA 1ETKA 4MXMA 5F0CA 1JKPC 1MBFA 1RETA 5EDNA 1JT0A 3G1LA 2FQ4A 5EGOA 2OF7A 3A01A 5J3LA 2K9NA 2O7TA 4W1UA 3FKIJ 2DA7A 3B6CA 3VOXA 2KT0A 4EEFG 4MFDA 4DYCA 3S14J 3Q3SA 4A3KJ 5CW8A 2NVYJ 5DAJA 1O4XA 2AO9A 5EYRA 4B3AA 3TP0A 4DZPA 5HODA 3BRUA 5C4YA 5FLVA 2WGBA 2L7MP 3HTAA 3VIBA 3ZQIA 1P7JA 3HOXJ 1LFUP 4XICA 3HTJA 2YU9J 5F27A 1QVTA 4DYRA 4A3IJ 2WAQN 1JKQC 3BR5A 3S1RJ 2JMWA 2G3BA 3OSFA 2NP5A 5DTDA 5FGLA 3S2HJ 2X9DA 2XSDC 1MNMC 2RASA 1MBGA 3B6AA 4GCTA 4A3LJ 1FTTA 3CRJA 2GLOA 3ZOBA 2CQXA 4G12A 3O60A 2CUEA 2JN6A 1U9OA 3VVYA 3DEWA 1B8IB 3S15J 1HOMA 2HOSA 2XRLA 3GTJJ 3HTIA 1PUFA 2O8KA 3VOKA 4V2GA 3G1MA 2VPRA 3WHBA 4FTHA 1IDZA 3IH4A 4C3IJ 3BHQA 2L9RA 4JX4A 5IYCJ 2Y30A 3BJBA 2LY9A 1FIAA 1LFBA 2P81A 3NI7A 3BG3A 1IDYA 2JK3A 2RHAA 2XDNA 5J1RA 2ZOZA 1BJZA 4KWAA 2YUSA 1GV5A 1ZK8A 4JYKA 4BBSJ 2IBDA 3FRQA 2V57A 3KZ9A 1RKWA 1I3QJ 3VVZA 1VI0A 5IOYA 1JKOC 3UKGA 4M6VA 3MNLA 1RPWA 2HYTA 1GDTA 1H89C 1K83J 4CGRA 3HOVJ 3NAUA 1SGMA 3P9TA 3L1PA 5H9TA 3E7LA 3GTLJ 3NNRA 3BTIA 5BNGA 2LK2A 4IEJA 4GCKA 2ID3A 3DCFA 3TW7A 4QSHA 4XIDA 2FX0A 2QWTA 2EH3A 5C44J 3GBGA 1FTZA 2UXUA 5IP9J 2NS7A 5IYBJ 3HBLA 1U9NA 3SFIA 3JRIA 5C3EJ 4UUTA 1ETYA 2R93J 3C2BA 2H8RA 1BL0A 3K7AJ 3FK6A 4V2FA 4CYCB 3V78A 4W97A 1A6IA 3RQIA 1LE8B 2H1KA 2CRGA 4Y7NJ 4GCLA 1HDDC 3VW1A 3SJMA 2FBQA 2W48A 3PO3J 2GFNA 5EZHA 4AYBN 1TWAJ 5K7HA 2Y0SN 2EZLA 1FJLA 3HOWJ 3ANPA 3GTGJ 5EF6A 5FMPA 2VUMJ 1IG7A 2L0KA 5EFYA 2UXOA 3QPLA 3HOZJ 5M3MJ 1ETXA 2NVTJ 2O7OA 3LSRA 2LTPA 2M9HA 4NN1A 4ICHA 5D18A 3Q0WA 2JJ7A 5EZGA 3B81A 1U78A 2HOTA 2HXOA 2EBIA 1MSFC 1ZGWA 1K61A 4S0HB 5FKMA 3JRAA 2ME0A 3PO2J 3Q0VA 1H8AC 3VP5A 1NK2P 1FEXA 2DJNA 1RKTA 3PPBA 4IHXA 3S1MJ 3NPIA 3CDLA 4ME9A 4NELA 1X2MA 2IEKA 4A3EJ 3BTCA 2QOPA 1H88C 2XPVA 5AQCA 2GENA 2G7GA 2ZOYA 1UI5A 1U8BA 4JL3A 3F1BA 2Y31A 3HB9A 1TWGJ 4L5EA 2PZ9A 3RZDJ 3S1NJ 3EGQA 3BT9A 1YRNB 4RBOA 1IUFA 2DN0A 3BR0A 1UHSA 3JRCA 4IHWA 2LP0A 1TWFJ 1TWHJ 2X48A 3M3YJ 3AQSA 4XK4A 3VPRA 1T56A 5IP6A 1POGA 1UG2A 3S17J 3CWRA 1VF9A 3IUVA 1MBKA 1T33A 1Y1WJ 2Y9ZA 4A3CJ 4FE7A 3SDGA 1GT0C 4ABZA 3BR1A 5F0HA 2XGCA 5EG0A 1S7EA 3GTMJ 5FJ8J 2DTZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2TCT A;  2EZI A;  1NK3 P;  2DG8 A;  3WHC A;  2JA5 J;  3HE0 A;  4A3M J;  3EUP A;  2DMQ A;  3JR9 A;  1Y1V J;  3HOY J;  3OOU A;  3RKQ A;  2E2J J;  1W0U A;  3JRB A;  2MW8 A;  3JRE A;  1DU6 A;  2XB5 A;  1BW5 A;  2HQ5 A;  3BR2 A;  2ECB A;  3C07 A;  3LSP A;  2ZCX A;  3TED A;  2M0C A;  4PXI A;  3A02 A;  3CQZ J;  3T6N A;  3BTL A;  3CCY A;  4FE4 A;  2WV1 A;  3MKL A;  4M3D A;  1B8I A;  1X2N A;  2WB1 N;  1TWC J;  1QRY A;  2LLK A;  5J1U A;  4A3B J;  4JP0 A;  1BW6 A;  4X1E A;  2N8G A;  5IPA A;  3RH2 A;  4JKZ A;  1JUS A;  1IGN A;  5FLM J;  1GVD A;  1F36 A;  5JLX A;  4FCY A;  2R5Z A;  1HF0 A;  3I4N J;  1X58 A;  3MVP A;  4RDU A;  2GUH A;  3KKC A;  2DMN A;  3PAS A;  2UXH A;  2E1O A;  2JWT A;  1ZQ3 P;  1I50 J;  3JRG A;  5EEA A;  4AC0 A;  2G7L A;  3W6V A;  2HKU A;  4A3G J;  4M3E A;  4JNN A;  5GPA A;  3NRG A;  5GPC A;  4AC6 A;  2G0E A;  3F0C A;  4QIW N;  1JKR C;  3ANG A;  2Y9Y A;  3HKZ N;  3I4M J;  3G56 A;  3HGY A;  1WH5 A;  2HI3 A;  3HTH A;  1IV6 A;  5E3L A;  1EF4 A;  2QIB A;  1JJ8 C;  2K9S A;  1GV2 A;  3JRF A;  1Z0X A;  5J1Y A;  4FIS A;  2HYJ A;  3GTO J;  1ETW A;  4XRM A;  3LSJ A;  2OER A;  2FJ1 A;  2QF7 A;  2R7Z J;  2Y2Z A;  3GTP J;  2PBX A;  4I76 A;  3IH3 A;  1ENH A;  3MN2 A;  2LD5 A;  4D5C A;  1WI3 A;  3BNI A;  1MBH A;  1WPK A;  2IAI A;  5IP7 J;  3ZQH A;  2I10 A;  3HEF A;  4JX5 A;  5K7F A;  1ETO A;  2KDZ A;  3RD3 A;  3O8G A;  3A03 A;  2DA5 A;  2DA1 A;  5FHP A;  2QTQ A;  4YZE A;  3BCG A;  2DMT A;  3GZI A;  5C4J J;  2R92 J;  2CUF A;  2COB A;  4ACI A;  3GTK J;  1IC8 A;  2LR8 A;  5JLW A;  5HAW A;  2M8G X;  4M3G A;  5K7Z A;  3G7R A;  1MH4 A;  2ZCM A;  3ZQC A;  4A69 C;  1IRZ A;  3CMY A;  3LJL A;  4MK6 A;  5D1R A;  1ETV A;  3LWJ A;  4MIM A;  2L7F P;  1AKH A;  4UDS A;  4A3D J;  3ZQL A;  1JTY A;  1JGG A;  5M5Y J;  4Y52 J;  2CQQ A;  5FKL A;  2WUI A;  4GFK A;  4BKX A;  3KNW A;  5K58 A;  1ZR4 A;  3TW6 A;  2O9L A;  3FIS A;  3S2D J;  3JRH A;  1NTC A;  3S5R A;  5M5X J;  1JJ6 C;  4DYQ A;  2NOG A;  4UUS B;  3IH2 A;  2E2H J;  2MSY A;  4BY7 J;  3FK7 A;  2NVQ J;  1YRN A;  2X6O A;  3GEU A;  1LE8 A;  4XRS G;  2DG7 A;  2D6Y A;  9ANT A;  1XG1 A;  3QBM A;  5F0F A;  1AHD P;  4XRS A;  4X6A J;  3RZO J;  5D19 A;  1Z77 A;  2M2E A;  2UXP A;  4C2M J;  3OIO A;  1APL C;  1HDP A;  5C4X J;  2GBY A;  3H0G J;  5FKK A;  3BQZ A;  2DA2 A;  2ECC A;  3FIW A;  4MFE A;  1MSE C;  5FKO A;  2Q24 A;  4M3F A;  5HBU A;  1OFC X;  1B72 A;  2G7S A;  3VUQ A;  1F43 A;  1VND A;  1PUF B;  4D7N A;  5E3N A;  4BXX J;  4HNV A;  2TRT A;  5F08 A;  2MG4 A;  1RES A;  3H3V K;  2OI8 A;  2B63 J;  3NXC A;  3QKX A;  2YVH A;  2DMP A;  3V6G A;  4BY1 J;  1CQT A;  3HOU J;  2M34 A;  1OJL A;  3D1N I;  2YVE A;  1B72 B;  2NP3 A;  5FKN A;  1R9T J;  1ITY A;  2LVS A;  5IYD J;  5DS9 A;  2NVX J;  2NX4 A;  3BR6 A;  1JUM A;  3VVX A;  4C3J J;  2JA8 J;  3QPS A;  2ELK A;  2OPT A;  2E2I J;  4NDL A;  1HCR A;  1JUP A;  1AU7 A;  2UXI A;  3ON2 A;  3ZQF A;  1P7I A;  4CYC A;  1ORK A;  2JA7 J;  2ZB9 A;  2AHQ A;  4A93 J;  2RAE A;  2XB0 X;  2XGD A;  1XS9 A;  2HDD A;  3BQY A;  1MH3 A;  4I6Z A;  4GFB A;  3M4O J;  1XC5 A;  1HLV A;  1QVU A;  2EZK A;  3VW2 A;  5CXG A;  1VFC A;  4J19 A;  3COL A;  2QCO A;  3KKD A;  3Q0U A;  3AQT A;  2DA3 A;  4A3J J;  5F1J A;  2HXI A;  3LHQ A;  2ID6 A;  2VKV A;  1E3O C;  1MBJ A;  1AKH B;  3E7Q A;  1W0T A;  1JTX A;  2XGE A;  2MGQ A;  3TP3 A;  4D7M A;  5CXI A;  2CJJ A;  1FIP A;  4IHY A;  2HOA A;  1DU0 A;  4AUX A;  4MO7 A;  2CU7 A;  4L62 A;  2VKE A;  1JT6 A;  4B4C A;  1WGX A;  3VW0 A;  3S16 J;  2QKO A;  4UUS A;  1ZKG A;  2PMZ N;  1G2H A;  1SFO J;  4HKU A;  1ETQ A;  3JRD A;  3K2A A;  2XPW A;  1RR7 A;  1MBE A;  3NAR A;  1UI6 A;  3A01 B;  2L7Z A;  5EGO B;  1Q1V A;  2EZH A;  1ZR2 A;  1I6H J;  2IU5 A;  4GFL A;  3LOC A;  2GM4 A;  3HGG A;  3G1O A;  1GUU A;  4DW6 A;  4JX6 A;  2K40 A;  3OSG A;  2ZCN A;  1IJW C;  5GP9 A;  2XPU A;  4C3H J;  5IOZ A;  2K9Q A;  3JSJ A;  3HM5 A;  2R5Y B;  2R5Z B;  2DMU A;  2DA6 A;  5F04 A;  4A3F J;  1WH7 A;  3LSG A;  3ZQG A;  4QTR A;  2FD5 A;  2R0Q C;  4DZJ A;  5M5W J;  2F07 A;  4AF5 A;  2YS9 A;  1SAN A;  3HDD A;  3DPJ A;  2DA4 A;  2EQR A;  4IHV A;  5E3M A;  5HSZ A;  1UMQ A;  1QPI A;  3ON4 A;  4B1R A;  1BA5 A;  3CJD A;  5EG0 B;  4MLO A;  4D5F A;  3IV5 A;  4LOC A;  1OCP A;  2LFB A;  5E3O A;  4BBR J;  3PM1 A;  3BTJ A;  2D5V A;  1ZTR A;  2E19 A;  1A5J A;  3HIM A;  2NS8 A;  3S1Q J;  3BG9 A;  1WCM J;  1D5Y A;  3GTQ J;  2REK A;  2VI6 A;  2ME6 A;  3LNQ A;  5M3F J;  2LKX A;  2W53 A;  3BR3 A;  1OCT C;  2R5Y A;  2JA6 J;  3QQA A;  4M3B A;  1TC3 C;  3BG5 A;  3O8H A;  1ETK A;  4MXM A;  5F0C A;  1JKP C;  1MBF A;  1RET A;  5EDN A;  1JT0 A;  3G1L A;  2FQ4 A;  5EGO A;  2OF7 A;  3A01 A;  5J3L A;  2K9N A;  2O7T A;  4W1U A;  3FKI J;  2DA7 A;  3B6C A;  3VOX A;  2KT0 A;  4EEF G;  4MFD A;  4DYC A;  3S14 J;  3Q3S A;  4A3K J;  5CW8 A;  2NVY J;  5DAJ A;  1O4X A;  2AO9 A;  5EYR A;  4B3A A;  3TP0 A;  4DZP A;  5HOD A;  3BRU A;  5C4Y A;  5FLV A;  2WGB A;  2L7M P;  3HTA A;  3VIB A;  3ZQI A;  1P7J A;  3HOX J;  1LFU P;  4XIC A;  3HTJ A;  2YU9 J;  5F27 A;  1QVT A;  4DYR A;  4A3I J;  2WAQ N;  1JKQ C;  3BR5 A;  3S1R J;  2JMW A;  2G3B A;  3OSF A;  2NP5 A;  5DTD A;  5FGL A;  3S2H J;  2X9D A;  2XSD C;  1MNM C;  2RAS A;  1MBG A;  3B6A A;  4GCT A;  4A3L J;  1FTT A;  3CRJ A;  2GLO A;  3ZOB A;  2CQX A;  4G12 A;  3O60 A;  2CUE A;  2JN6 A;  1U9O A;  3VVY A;  3DEW A;  1B8I B;  3S15 J;  1HOM A;  2HOS A;  2XRL A;  3GTJ J;  3HTI A;  1PUF A;  2O8K A;  3VOK A;  4V2G A;  3G1M A;  2VPR A;  3WHB A;  4FTH A;  1IDZ A;  3IH4 A;  4C3I J;  3BHQ A;  2L9R A;  4JX4 A;  5IYC J;  2Y30 A;  3BJB A;  2LY9 A;  1FIA A;  1LFB A;  2P81 A;  3NI7 A;  3BG3 A;  1IDY A;  2JK3 A;  2RHA A;  2XDN A;  5J1R A;  2ZOZ A;  1BJZ A;  4KWA A;  2YUS A;  1GV5 A;  1ZK8 A;  4JYK A;  4BBS J;  2IBD A;  3FRQ A;  2V57 A;  3KZ9 A;  1RKW A;  1I3Q J;  3VVZ A;  1VI0 A;  5IOY A;  1JKO C;  3UKG A;  4M6V A;  3MNL A;  1RPW A;  2HYT A;  1GDT A;  1H89 C;  1K83 J;  4CGR A;  3HOV J;  3NAU A;  1SGM A;  3P9T A;  3L1P A;  5H9T A;  3E7L A;  3GTL J;  3NNR A;  3BTI A;  5BNG A;  2LK2 A;  4IEJ A;  4GCK A;  2ID3 A;  3DCF A;  3TW7 A;  4QSH A;  4XID A;  2FX0 A;  2QWT A;  2EH3 A;  5C44 J;  3GBG A;  1FTZ A;  2UXU A;  5IP9 J;  2NS7 A;  5IYB J;  3HBL A;  1U9N A;  3SFI A;  3JRI A;  5C3E J;  4UUT A;  1ETY A;  2R93 J;  3C2B A;  2H8R A;  1BL0 A;  3K7A J;  3FK6 A;  4V2F A;  4CYC B;  3V78 A;  4W97 A;  1A6I A;  3RQI A;  1LE8 B;  2H1K A;  2CRG A;  4Y7N J;  4GCL A;  1HDD C;  3VW1 A;  3SJM A;  2FBQ A;  2W48 A;  3PO3 J;  2GFN A;  5EZH A;  4AYB N;  1TWA J;  5K7H A;  2Y0S N;  2EZL A;  1FJL A;  3HOW J;  3ANP A;  3GTG J;  5EF6 A;  5FMP A;  2VUM J;  1IG7 A;  2L0K A;  5EFY A;  2UXO A;  3QPL A;  3HOZ J;  5M3M J;  1ETX A;  2NVT J;  2O7O A;  3LSR A;  2LTP A;  2M9H A;  4NN1 A;  4ICH A;  5D18 A;  3Q0W A;  2JJ7 A;  5EZG A;  3B81 A;  1U78 A;  2HOT A;  2HXO A;  2EBI A;  1MSF C;  1ZGW A;  1K61 A;  4S0H B;  5FKM A;  3JRA A;  2ME0 A;  3PO2 J;  3Q0V A;  1H8A C;  3VP5 A;  1NK2 P;  1FEX A;  2DJN A;  1RKT A;  3PPB A;  4IHX A;  3S1M J;  3NPI A;  3CDL A;  4ME9 A;  4NEL A;  1X2M A;  2IEK A;  4A3E J;  3BTC A;  2QOP A;  1H88 C;  2XPV A;  5AQC A;  2GEN A;  2G7G A;  2ZOY A;  1UI5 A;  1U8B A;  4JL3 A;  3F1B A;  2Y31 A;  3HB9 A;  1TWG J;  4L5E A;  2PZ9 A;  3RZD J;  3S1N J;  3EGQ A;  3BT9 A;  1YRN B;  4RBO A;  1IUF A;  2DN0 A;  3BR0 A;  1UHS A;  3JRC A;  4IHW A;  2LP0 A;  1TWF J;  1TWH J;  2X48 A;  3M3Y J;  3AQS A;  4XK4 A;  3VPR A;  1T56 A;  5IP6 A;  1POG A;  1UG2 A;  3S17 J;  3CWR A;  1VF9 A;  3IUV A;  1MBK A;  1T33 A;  1Y1W J;  2Y9Z A;  4A3C J;  4FE7 A;  3SDG A;  1GT0 C;  4ABZ A;  3BR1 A;  5F0H A;  2XGC A;  5EG0 A;  1S7E A;  3GTM J;  5FJ8 J;  2DTZ A; 
#chains in the Genus database with same CATH topology
 3IWF A;  2DG8 A;  4CCO A;  3HE0 A;  3ZN0 A;  2M7B A;  3HOY J;  2X1E A;  1D1A A;  1A6Q A;  3GLL A;  3G73 A;  1BW5 A;  1R5I D;  3BR2 A;  3GWZ A;  3C07 A;  2ZCX A;  4Q47 A;  4GO1 A;  2CQN A;  3BLY A;  4WF2 A;  4F93 B;  3CQZ J;  3DPL C;  1XMX A;  1B8I A;  1C0W A;  2QM3 A;  5FD6 A;  1DPR A;  2WB1 N;  4NQW A;  2LLK A;  2QZ8 A;  4PJJ A;  5J1U A;  4A3B J;  1BR1 A;  1KU3 A;  4PZJ A;  4X1E A;  3KCC A;  2CFX A;  1LFP A;  2E34 A;  3J81 K;  3WG7 H;  5B66 C;  1GVD A;  2HVS A;  1XGM A;  1UJ8 A;  1XX5 A;  2CMP A;  2R7O A;  1SD7 A;  4A6E A;  1YIO A;  3FM3 A;  3EYY A;  3MVP A;  3GW2 A;  2GUH A;  2E1O A;  2JWT A;  4ZZL A;  1ZQ3 P;  5ICF A;  4E7J A;  5EEA A;  2O8X A;  1FOW A;  3OYK A;  4EV0 A;  2QEX I;  4CH7 A;  4A3G J;  2PFV A;  3NRG A;  3L2R A;  3T5X A;  4GGG A;  1VQP I;  1T0F C;  1JKR C;  3TO7 A;  3ZP5 A;  2LDU A;  1BI0 A;  1SMY F;  2QKL B;  3HOT A;  3HTH A;  3L7W A;  1IV6 A;  2KP6 A;  1Z7U A;  1X4O A;  3J80 K;  3RPU A;  2Y0M A;  1BR4 A;  5KHD A;  3JRF A;  3M07 A;  3GTO J;  4FIS A;  1ETW A;  2ZKZ A;  3G71 I;  2OER A;  5LGN A;  5E18 F;  2DQL A;  4I76 A;  1ENH A;  2ZY9 A;  2QYO A;  1UHM A;  1LNW A;  4BEH B;  1WI3 A;  4CIC A;  4HDV A;  3BNI A;  3ABM H;  2IAI A;  3ZQH A;  1BIB A;  5KCM A;  3HEF A;  5LHG A;  1ETO A;  1LVK A;  1T39 A;  2G9W A;  1LQ1 A;  1L3L A;  2DT5 A;  2QEN A;  4YFN F;  3L2C A;  5FO5 A;  1TL8 A;  4L5J A;  3HHG A;  2DMT A;  5FRN A;  5C4J J;  2F5F A;  3OV8 A;  3GTK J;  5HAW A;  3G7R A;  2H27 A;  2VJJ A;  3LJL A;  5F64 A;  3TL4 X;  1ETV A;  1PP8 F;  1RI7 A;  2L01 A;  3HPG A;  3KP7 A;  2DXI A;  4GFK A;  3ZQL A;  3K1P A;  2E7W A;  5BQT A;  5M5Y J;  2UWM A;  2WUI A;  1W7P A;  1WJF A;  4Y17 A;  1OKR A;  2HTJ A;  3S5R A;  5HLG A;  4DYQ A;  2NOG A;  5GTH C;  3OYM A;  3HRU A;  2IGO A;  3T1B A;  4CHU A;  2V1X A;  3GEU A;  2X6O A;  1J2X A;  4XRS G;  2K02 A;  1LE8 A;  2DG7 A;  2D6Y A;  2Q8K A;  5F0F A;  3VSL A;  3EQL F;  3DKW A;  4WXH A;  4II2 A;  4A2U A;  4XRS A;  4XLA A;  1VQO I;  1Z77 A;  2DCE A;  2M2E A;  3FKJ A;  3OIO A;  1HDP A;  4PDK A;  3WG9 A;  4KN7 X;  4OOI A;  3KP6 A;  2GBY A;  3BQZ A;  1G3T A;  5KK1 A;  4CGZ A;  3O2P E;  2ECC A;  5HS7 A;  5DM6 F;  2Q24 A;  3PQJ A;  5HBU A;  5DCM B;  1B72 A;  2G7S A;  4LK0 F;  3VUQ A;  1SD5 A;  4OD5 A;  1EH8 A;  1VND A;  4F92 B;  1FYL A;  3FX3 A;  3MZ8 A;  4HNV A;  2ZBK A;  1WKM A;  3H1C A;  4F7Z A;  3MAJ A;  4QPO A;  3R4K A;  2YVH A;  5LGU A;  3HOU J;  3K1N A;  1EJ9 A;  4AD9 A;  1OPC A;  2KZG A;  2ISY A;  2KJB A;  1DDN A;  1K78 A;  1KQ8 A;  4U9N A;  4I02 A;  2NP3 A;  2QLZ A;  3OWT A;  4IJA A;  1SAX A;  2NX4 A;  2W1O A;  3KP4 A;  3RSN A;  2ELK A;  1I1G A;  2E2I J;  3K8P C;  1R36 A;  1WJE A;  3OS1 A;  3ON2 A;  5CJ9 A;  1K79 A;  2LC2 A;  3NQO A;  1TW3 A;  2YVX A;  5J4Y A;  2XRO A;  2JA7 J;  3D5R C;  1K7A A;  2AHQ A;  2RAE A;  2CW8 A;  2XB0 X;  1XS9 A;  1A36 A;  5CKT A;  4I6Z A;  2M30 A;  3OYL A;  1HLV A;  3AG2 H;  4KYW A;  4ZYH A;  4U7D A;  5CXG A;  3COL A;  3ZPL A;  1IV8 A;  2FBH A;  1BIA A;  4HV6 A;  3E6B A;  3V8J A;  2KZV A;  4ZYA A;  5B5E C;  4G6T B;  2HXI A;  4DBR A;  2QBY A;  1REP C;  2VKV A;  1E3O C;  5HLT A;  4IQ4 A;  3FXL A;  1W0T A;  1JTX A;  3K10 A;  1H9T A;  1Y6I A;  4IHY A;  3OYG A;  1DU0 A;  2AQF A;  3RKX A;  4MO7 A;  3DKX A;  2VKE A;  4L62 A;  5KAF C;  5L3F A;  1TNS A;  1P4A A;  1WGX A;  3VW0 A;  1QZY A;  1RUO A;  3K70 D;  1G8X A;  1SD6 A;  4UUS A;  4JQF A;  1HW2 A;  1G2H A;  2XF7 A;  3WE3 A;  2IA2 A;  4MQ9 F;  4HKU A;  2Z2S B;  1B9M A;  1VQ6 I;  1S5L C;  4YEL A;  1O3T A;  2DO7 A;  3NAR A;  2C6Y A;  2EB7 A;  1F4K A;  3SDB A;  4Q48 A;  2FXA A;  2GM4 A;  3F9K A;  1GUU A;  1ZRF A;  1VQ5 I;  2A5W A;  5FLX Z;  1EV7 A;  1ON1 A;  4G7O F;  2LF8 A;  4DW6 A;  1LJ9 A;  5HS8 A;  2OA4 A;  4EMS A;  2K40 A;  3OSG A;  3RIR A;  3J81 Z;  5IOZ A;  2K9Q A;  1VZ0 A;  2Y48 A;  2DMU A;  5F04 A;  1WH7 A;  5FRM A;  3ZQG A;  4KJZ A;  2FBI A;  4UVB A;  1R4M B;  4HX8 A;  2NVU B;  1SAN A;  3HDD A;  3DPJ A;  3E6C C;  1TNT A;  2DA4 A;  2W24 A;  4BHB A;  3H9G A;  5JHU A;  4EGY A;  2X6W A;  4ENK A;  4IHV A;  4U9L A;  1QPI A;  2JVH A;  4AM3 A;  4MGR A;  4OU0 A;  3KX2 A;  3HIF A;  5FFZ A;  3R0J A;  4D5F A;  3IV5 A;  2R7Q A;  3ECO A;  4C30 A;  3RTR A;  4BBR J;  1E0E A;  1YS7 A;  2E19 A;  5BOX A;  2NS8 A;  2ICW G;  1WCM J;  1R23 A;  3LNQ A;  2D2W A;  1LDK B;  5M3F J;  2W53 A;  4S04 A;  1WSU A;  5CVI A;  1O3S A;  1AA7 A;  1DP7 P;  1RC9 A;  2VOD A;  3RQ4 A;  1VQ8 I;  2JA6 J;  4TV7 A;  3QQA A;  1TC3 C;  4L9V A;  3KE2 A;  4CCM A;  1GXP A;  4HSR A;  5HLH A;  1KON A;  4HA8 A;  2WY7 Q;  5F0C A;  5EDN A;  3J7Z I;  1JT0 A;  5F1R A;  1V54 H;  2HOE A;  2FQ4 A;  4B44 A;  3GF2 A;  4FHT A;  4G6Q A;  4M9X A;  2DFE A;  3R6S A;  4BGD A;  3DXJ F;  3CMM A;  1E3H A;  2K9N A;  4L9T A;  2GQQ A;  3W3C A;  3WGI A;  2GXA A;  3BCA A;  3SXY A;  2K3P A;  4M71 A;  3A4C A;  3B6C A;  4AIH A;  2F4O B;  4II3 A;  2EFP A;  2O3F A;  4ZC3 A;  3OYH A;  4PSX A;  3Q3S A;  2HDW A;  4XLH A;  1J7K A;  3P9K A;  4HYE A;  2QSF X;  4B3A A;  2E5Z A;  5HOD A;  2J5P A;  2GZW A;  2WGB A;  3HTA A;  1P7J A;  2STT A;  2QA4 I;  4XIC A;  3HTJ A;  3LA2 A;  1QVT A;  2XSJ C;  3OYA A;  2WAQ N;  3QPH A;  3KET A;  1JKQ C;  2JMW A;  2NP5 A;  3CJT B;  5DTD A;  3B73 A;  1D8J A;  5FGL A;  2V9V A;  4RA2 A;  3ZXS A;  2X9D A;  2XSD C;  1LB2 A;  1HKT A;  5H6Q A;  3B6A A;  3IWZ A;  3O3K A;  2GLO A;  3ZOB A;  4I2O A;  3CDH A;  2ADU A;  1HQC A;  1LVA A;  3AL0 C;  3O60 A;  2CUE A;  2WBM A;  1U9O A;  1FX7 A;  3DEW A;  2HOS A;  4HX7 A;  3GTJ J;  3HTI A;  2CQ7 A;  2PX9 A;  1PUF A;  1CF7 A;  4V2G A;  3G1M A;  4L5I A;  2QKM B;  4C3I J;  1SVO A;  1BOA A;  2EA2 A;  1K78 B;  2FML A;  2Y30 A;  2YR2 A;  3KEY A;  3QU6 A;  2P81 A;  1X19 A;  1J09 A;  3K4K A;  2OTL I;  1FY7 A;  3AFH A;  1XTA A;  1S6L A;  2ETH A;  2P8T A;  4XLF A;  3VWB A;  2BOL A;  4JYK A;  3VVZ A;  5JR3 A;  2X0L A;  5GAH J;  4M6V A;  1T08 B;  1W36 C;  5H20 A;  1ZH5 A;  2OZ6 A;  4CGR A;  3KLO A;  4CZZ A;  2Y75 A;  4UV9 A;  3CC2 I;  2WAQ A;  4P5O A;  1BI1 A;  3L1P A;  1FMV A;  3NNR A;  2EIN H;  1OR7 A;  3BTI A;  4RAG A;  3CCQ I;  3TW7 A;  2HQR A;  4UY8 I;  2D1H A;  4OMY A;  4EJO A;  4RB1 A;  5DD8 A;  2IRF G;  5F6F A;  1GVJ A;  3K4L A;  4E6K G;  5C44 J;  1UAA A;  2UXU A;  4XOP A;  4CCK A;  2Z9O A;  1I6X A;  5C3E J;  4GXO A;  1ETY A;  4U87 A;  4LD5 A;  2XRN A;  2GOM A;  4S05 A;  3VB2 A;  4L9N A;  1YFH A;  3M8F A;  1ODD A;  4D9J A;  1DPU A;  3OMY A;  1YYV A;  3OYF A;  2ZME C;  3VW1 A;  2W48 A;  4HST A;  3PO3 J;  3CJR B;  1ZLJ A;  5EZH A;  4AYB N;  1IUY A;  1Z21 A;  1Z7L A;  2JUG A;  3DF8 A;  2FRH A;  5ILS A;  5EF6 A;  3GTG J;  4BU2 A;  2L0K A;  3BY6 A;  3F6V A;  3IL2 A;  1D5V A;  1I1S A;  1TBX A;  2CUZ A;  3QPT A;  3B81 A;  3ZQQ A;  1OYY A;  3WTU C;  4DBQ A;  2M8E A;  1B4A A;  2GOX B;  1SVM A;  2DJN A;  1TLH B;  1N77 A;  1R1U A;  2BVL A;  4G7Z F;  4ME9 A;  2E71 A;  1X2M A;  1NG7 A;  1WWX A;  3SZG A;  1QHG A;  1T2K A;  4YIR X;  5AQC A;  3LST A;  1CF7 B;  4KIB A;  3S8P A;  5TIS C;  5E79 C;  2G7G A;  2ZOY A;  3TGN A;  4JL3 A;  1FMW A;  1Z3Y A;  2BBY A;  3F1B A;  4E7K A;  2IGM A;  1ZEL A;  4IO9 F;  4XLC A;  3RJP A;  3BT9 A;  2O0Y A;  3LSI A;  4KDP A;  1ULY A;  1ZN2 A;  4KMU X;  1IUF A;  2BYV E;  2RGV A;  2EV6 A;  5LHI A;  4RBO A;  3G4S I;  1T98 A;  3H5A A;  4F91 B;  1A31 A;  2DFH A;  1D3Y A;  2MLK A;  3DLA A;  3F8N A;  2FU4 A;  2NAZ A;  4IF4 A;  2V6E A;  2VQH A;  1TWF J;  1TWH J;  3ZMZ A;  5IP6 A;  4G94 A;  2R7X A;  2BY0 A;  4XMY A;  3O6B B;  3IUV A;  1MBK A;  1Y1W J;  4PCQ A;  3LSK A;  4BYY A;  4WK8 F;  1GT0 C;  1XGO A;  1FSE A;  1PDN C;  1Z67 A;  2GIZ A;  1HW5 A;  3N4M A;  1S7E A;  5L3E A;  1FYM A;  1XSV A;  3DBH B;  2M4K A;  5FJ8 J;  4KT5 C;  2A69 F;  5DEQ A;  4A5M A;  3OYI A;  2JA5 J;  1VQK I;  3JR9 A;  2L9N A;  5B3S H;  3OOU A;  5K5O A;  2E2J J;  1UCR A;  3GME A;  4UV8 A;  3GXO A;  6PAX A;  4PJM A;  1YS6 A;  2HQ5 A;  2ECB A;  3C3W A;  1SFE A;  5ILV A;  2W25 A;  4PXI A;  4XM3 A;  1WJB A;  3Q9V A;  5DM7 F;  3MKL A;  1X2N A;  3IHU A;  1TQM A;  4JP0 A;  1BW6 A;  2N8G A;  3VTI A;  1KYZ A;  3L09 A;  3ZMU A;  1XMK A;  3GFJ A;  4JKZ A;  2YPR A;  1JUS A;  3W2A A;  4FX0 A;  3E0J B;  1ZG5 A;  2R5Z A;  2EFQ A;  3CLQ A;  1HF0 A;  3I4N J;  1LUJ B;  3DQV C;  2XKO A;  1BR2 A;  2MYS A;  2H09 A;  1I50 J;  3K6G A;  2VKH A;  4U88 A;  3PNT A;  4L9J A;  4AC0 A;  4XBF A;  5GPA A;  2ZSI B;  2DOA A;  4IOC F;  2P6T A;  2M0M A;  3F0C A;  4PGH A;  4RMN A;  4QIW N;  1HSJ A;  4F3Q A;  3I4M J;  3HKZ N;  2Z99 A;  2EIK H;  1USS A;  3OS0 A;  1WH5 A;  2HI3 A;  4DGW B;  5ERI A;  3HUG A;  3HSE A;  5E3L A;  1EF4 A;  2EV5 A;  2ZME A;  5IY5 H;  1UG0 A;  3L2U A;  2HYJ A;  3SFZ A;  1WJ5 A;  3H9Q A;  4XRM A;  3LSJ A;  1FBU A;  2FJ1 A;  1HXD A;  2PBX A;  3IH3 A;  4XON A;  5GAE J;  3ASO H;  2V9P A;  1MBH A;  2HYG D;  2ZXJ A;  4XOT A;  3S93 A;  4PUS A;  3WGH A;  4BS9 A;  1ZGA A;  1WJD A;  2I10 A;  4JX5 A;  5K7F A;  1RRJ A;  3RD3 A;  2L4A A;  4AWX B;  4BUP A;  3O8G A;  3H35 A;  2NXN B;  2IW5 A;  4ZTF A;  5FHP A;  1G3Y A;  3AKZ A;  3K69 A;  2ZXW H;  2QTQ A;  1YJN I;  2LKS A;  5IT9 Z;  1VQN I;  2M8G X;  4UXN A;  1XGN A;  5K7Z A;  2V7F A;  3I59 B;  3J80 Z;  4HF0 A;  2EWN A;  4MK6 A;  2RVC A;  4HDU A;  3SQN A;  2XIG A;  1AKH A;  4OIQ F;  4WIB A;  3M1E A;  1MND A;  3AG3 H;  4A5N A;  5FKL A;  4BKX A;  3KNW A;  3MMY B;  1ZR4 A;  2VQG A;  3BCB A;  3TW6 A;  3HTS B;  3T0Y A;  2VAS A;  3V7R A;  1NTC A;  2OD5 A;  2DT7 B;  5M5X J;  1JI8 A;  4IX7 A;  3I53 A;  3IH2 A;  2LSO A;  4BY7 J;  1PYV A;  1YRN A;  1LEA A;  2P7C B;  1MDM B;  2A05 A;  1YG2 A;  1IN7 A;  2P5K A;  3RZO J;  2KIQ A;  3LFU A;  4MEX F;  1JHF A;  1XCV A;  2HQN A;  2UXP A;  5KNL A;  2IGN A;  3GEZ A;  1APL C;  1XDS A;  2XF5 A;  4ESJ A;  1XDU A;  4KN4 X;  5K1Y A;  5BMZ A;  1V4R A;  3ZQ7 A;  2R7T A;  2DA2 A;  3KZI C;  1BBY A;  3FIW A;  1MSE C;  1WJA A;  4M3F A;  2L02 A;  4PSW A;  1OFC X;  4XLP F;  5J8F A;  5B1A H;  1YTY A;  1MMN A;  2TRT A;  2MG4 A;  2JRM A;  4U0Y A;  3E1S A;  2B63 J;  2OV7 A;  3DWL E;  1GXQ A;  5DDG A;  3CCR I;  4KNY A;  1P92 A;  3QKX A;  2DMP A;  3EUA A;  3S32 A;  1E2X A;  2HKX A;  1FP2 A;  3GO5 A;  3KP2 A;  3CO7 C;  3D1N I;  1MNE A;  4BDY A;  2YVE A;  2QBY B;  3CJN A;  1FP1 D;  5FKN A;  1QZE A;  4BQN A;  1ITY A;  5IYD J;  4LIT A;  2KJC A;  2L5Q A;  2BY1 A;  5E8G A;  2JSC A;  3BPX A;  1JUM A;  4C3J J;  3QPS A;  2IS6 A;  2OPT A;  2Z5U A;  1YW7 A;  2ZXH A;  4NDL A;  4QWQ A;  3M1C A;  2PLY A;  2UXI A;  5AON A;  2BHY A;  3DKY A;  3U1K A;  1KU7 A;  1HC8 A;  4C2M A;  2QWW A;  2X4H A;  3IC7 A;  4A93 J;  3KLN A;  4GFB A;  2OQG A;  4CA0 A;  1QVU A;  3VW2 A;  1VFC A;  4J19 A;  3E5Q A;  1DGW Y;  2QCO A;  2IVM A;  3JSP A;  3Q0U A;  3WTW C;  2DA3 A;  5DYM A;  2A5Y B;  2VB6 A;  3SYT A;  3WE2 A;  2RRE A;  1WQ2 A;  3AG1 H;  4RGS A;  3KP5 A;  2ZJ2 A;  2MLG A;  3HRS A;  3CCJ I;  4D7M A;  1BOB A;  2HU9 A;  3JW4 A;  2CJJ A;  2HOA A;  1XMA A;  3I59 A;  3E5X A;  4AUX A;  2FNA A;  3SHF A;  1O7L A;  3RCO A;  1JT6 A;  2KMU A;  1R1V A;  5J4V A;  2QQB A;  2PMZ N;  3JRD A;  3K2A A;  2XPW A;  4HF2 A;  2VOO A;  1MBE A;  1BC7 C;  2FEZ A;  3J7Y J;  2HZT A;  1P4W A;  5EGO B;  3KP3 A;  3FDY A;  2EZH A;  1ZR2 A;  2IU5 A;  4RGX A;  1U8R A;  4LG0 A;  3G1O A;  3K0L A;  2E1M C;  3C2G A;  4Y15 A;  3K2Z A;  1MZB A;  3M7G A;  1IJW C;  1DQU A;  1W1W E;  1RZ4 A;  3HM5 A;  2CV2 A;  4JOM A;  2DLL A;  1KGS A;  3LSG A;  5DD4 A;  1IN4 A;  3IAM 2;  4XKV A;  2F07 A;  5GTI C;  2R7D A;  5BPD A;  4L0Z B;  3CZ6 A;  2IP2 A;  1ONV A;  1UB9 A;  3ECH A;  4O3M A;  4E7S A;  1IXC A;  1AWC A;  5LHH A;  1UMQ A;  3BC8 A;  4QPQ A;  5KAI C;  4BQO A;  4KIS A;  3SZP A;  2XAG A;  5EG0 B;  2JUC A;  3OIP A;  4R1H A;  4MLO A;  2FF4 A;  2LFB A;  5E3O A;  1Y0U A;  4I01 A;  2LOO A;  3OIQ A;  3LA7 A;  3BTJ A;  3PM1 A;  4AYB A;  4WX9 A;  1A5J A;  1YE9 A;  3HIM A;  2WB1 A;  3GZ5 A;  3WTZ A;  1D5Y A;  1IRG A;  2DOD A;  1RNL A;  2PQ8 A;  3TOA A;  3V8L A;  2LKX A;  2E1M B;  2H1L A;  4IXA A;  3ZN1 A;  4GDF A;  1OCT C;  4I99 C;  2ZSH B;  1B9N A;  2G7U A;  1W5T A;  2M7A A;  5KVR A;  3K70 C;  3R61 A;  5HS9 A;  1FT9 A;  3BG5 A;  2QUF A;  2KFD A;  4MXM A;  3RKW A;  3MKW B;  4LJZ F;  1RET A;  2BXZ A;  4DQ2 A;  2JA2 A;  2QQ8 A;  1Z91 A;  2KRC A;  4IOA F;  3DFG A;  3FWE A;  4Y3O A;  5ILU A;  2Z3Y A;  2F6C A;  4PK4 A;  5HDN A;  1W4M A;  2O7T A;  2XVC A;  4W1U A;  1MW7 A;  1ZAO A;  1YW9 A;  2PMU A;  1H9G A;  2FJI 1;  2VIX A;  4EJU A;  3BZK A;  2VXZ A;  1MD0 A;  4IHS A;  2KT0 A;  3BDD A;  3GYH X;  1B59 A;  4MFD A;  3MD2 A;  1X1B A;  3S14 J;  3JTH A;  5CW8 A;  2NVY J;  3VOD A;  3OYC A;  4IRI A;  1YX5 A;  4PFP A;  3K4N A;  3NS4 A;  4IL6 C;  1EKE A;  4IKF A;  3VIB A;  1ZG1 A;  1FC3 A;  4H4K C;  5F27 A;  4IRG A;  3RDI A;  4ENJ A;  4LG0 B;  2Z1D A;  1EH7 A;  3BR5 A;  2OU2 A;  3A2K A;  4NC6 A;  3CCM I;  2VBY A;  2VQC A;  1LPQ A;  2R7R A;  4MEY F;  1UHW A;  1NH3 A;  1MBG A;  4GCT A;  2HTS A;  2CYY A;  5CQE A;  3PNY A;  3QYE A;  4I0B A;  2JPB A;  2OCE A;  3ABK H;  1MMD A;  4FX4 A;  1O3R A;  3I3L A;  2JN6 A;  4RGR A;  4YII A;  5FLX K;  2XDV A;  2DI3 A;  1B8I B;  3NRV A;  2YX7 A;  2XRL A;  4IPA A;  2CWE A;  2O8K A;  3J7A O;  3BHQ A;  1XB4 A;  3CCS I;  2KIU A;  1FIA A;  1LFB A;  3NI7 A;  3BG3 A;  4OIR F;  2JK3 A;  2L3D A;  2CSO A;  2RHA A;  1U0J A;  1BJZ A;  2YUS A;  2E7X A;  3M9A A;  3LAP A;  5HLI A;  1O3Q A;  4NQW B;  2CQK A;  3FRQ A;  3FMS A;  1RKW A;  1I3Q J;  3CUO A;  1VI0 A;  5IOY A;  1JKO C;  3FM5 A;  1RIO H;  4WCG A;  2HYT A;  1GDT A;  4UNO A;  2H6C A;  1AOY A;  3NAU A;  4XLE A;  3P9T A;  2KDO A;  3ONQ A;  3CDI A;  3E7L A;  3GTL J;  5BNG A;  2ESH A;  1XSD A;  1OCC H;  2P0W A;  1R6R A;  1WRJ A;  4U0V A;  2BY3 A;  2QWT A;  2CV1 A;  2FSW A;  2KQR A;  2E36 A;  4LK1 F;  4FAS D;  2A6E F;  3H0D A;  2CG4 A;  1TT0 A;  3HBL A;  4UUT A;  2CS3 A;  1BL0 A;  3K7A J;  2QQ9 A;  1Z05 A;  2F5E A;  2JPC A;  3PFY A;  4BE1 A;  1A6I A;  2DU9 A;  4D1Q A;  2CRG A;  4GCL A;  3DTI A;  5L3B A;  3JAM Z;  2RN7 A;  3NEU A;  1WJC A;  3CTA A;  2K5C A;  2B3W A;  3F6O A;  1MIJ A;  2EZL A;  1FJL A;  4O6J A;  3HOW J;  3OL4 A;  4OIO F;  3ANP A;  2VUM J;  3CJQ B;  3MKY B;  1IG7 A;  2IS4 A;  3FXK A;  2LY1 A;  5D6E A;  2UXO A;  1BI3 A;  1LEB A;  1GHC A;  3TBI A;  5M3M J;  3OYN A;  1ETX A;  2XF6 A;  1Y0N A;  2HVQ A;  4BEH A;  4I09 A;  3U21 A;  3QOP A;  2JRT A;  4MNU A;  2UZK A;  5D18 A;  4M74 A;  3UR3 C;  2XAF A;  1Z6R A;  3LAJ A;  1MJ9 A;  2EBI A;  5L3G A;  1ZGW A;  1QA6 A;  3W6K B;  4S0H B;  4LLL A;  2ME0 A;  2XKP A;  3C2H A;  2Y0S A;  1H8A C;  1NK2 P;  3ABT A;  2RNG A;  1BI2 A;  2MH9 A;  2HFH A;  1LDD A;  4Q4Z F;  3HC7 A;  4IHX A;  1G6N A;  3CCU I;  3S1M J;  3OYJ A;  3CC7 I;  3EUH C;  2X6Y A;  2PJR A;  3CES A;  4XRF A;  4ETS A;  3E5U A;  2DPD A;  4MTE A;  2PI0 A;  2O61 A;  4ANJ A;  2R7F A;  1VQ4 I;  5LEK A;  4QLC U;  3LMM A;  5CVR A;  1WHU A;  4YFK F;  2VQL A;  3ML6 A;  1UI5 A;  5CVU A;  1GLN A;  2VKD A;  4M9Z A;  3DBL B;  3HB9 A;  5A2Q K;  1TWG J;  3Q5F A;  3N05 A;  3RZD J;  2EV0 A;  3S1N J;  3HUG B;  1FZP B;  4BHC A;  3DPU A;  3HZJ A;  4M72 A;  1S7A A;  3FBN B;  4ZZD A;  3WU1 B;  3COA C;  1YJ9 I;  2HVR A;  3JRC A;  2MC4 A;  4B47 A;  1KU9 A;  1N75 A;  2YX4 A;  2ZFW A;  2UV1 A;  2WAD A;  5DCM A;  5LRS A;  3AQS A;  1Z1D A;  2AXL A;  2WY8 Q;  4XK4 A;  3REO A;  2KPM A;  1POG A;  1UG2 A;  3BG7 A;  4A0X A;  4ENN A;  1BC8 C;  3SDG A;  3HHH A;  3VYR B;  5F0H A;  3BR1 A;  2DW4 A;  2Q0O A;  4NBQ A;  5EG0 A;  2JVG A;  2BW3 B;  3GTM J;  4E7H A;  2CFO A;  2TCT A;  4F52 A;  4Z6Y A;  3WHC A;  2Q2E B;  4OAZ A;  3EUP A;  2DMQ A;  1Y1V J;  3RKQ A;  4YFX F;  3KYD B;  2AS5 F;  3JRB A;  3JRE A;  3WOD F;  2XB5 A;  4MQV A;  2WTE A;  3I71 A;  3LSP A;  2L54 A;  3CMA I;  4RB3 C;  2K4B A;  1EH6 A;  3TED A;  3C18 A;  3A02 A;  2FOK A;  1ZRD A;  3S3N A;  3CCY A;  3NWT A;  2WV1 A;  4FE4 A;  4M3D A;  1QNT A;  4CO8 A;  1R71 A;  1QRY A;  3ESW B;  2PJP A;  3TDZ C;  3RH2 A;  3W2V A;  3H3U A;  1OIS A;  2BHZ A;  4P96 A;  5L3D A;  1IGN A;  2EIM H;  1S9H A;  2K9L A;  4AVZ A;  1R22 A;  4NHJ A;  2FNP A;  5ICC A;  1UFM A;  4RDU A;  2ZJR F;  3KKC A;  2DMN A;  3MFK A;  2NYX A;  2QVO A;  2VC1 A;  4IVN A;  2ZJQ F;  2G7L A;  2K3F A;  3W6V A;  4M3E A;  5CVJ A;  3DU6 A;  2OTJ I;  3BG6 A;  2DBB A;  2BEO A;  5E1X A;  4L0Y B;  1XGS A;  2Y9Y A;  3G56 A;  1R58 A;  4Y4R A;  4RB0 A;  1JJ8 C;  2K9S A;  4RLF A;  3I54 A;  1Z3X A;  4R79 A;  1Z0X A;  1NG6 A;  5DCF A;  3LL7 A;  3EPZ A;  4HAM A;  1VTN C;  4GCV A;  2R7Z J;  4EM0 B;  3QP6 A;  3LFK A;  3JAM K;  5D6F A;  3KIO A;  2LD5 A;  3A0H C;  3LWF A;  5IP7 J;  4HF1 A;  3LQQ A;  2BE5 F;  4LG3 A;  2KDZ A;  3CCL I;  3FZV A;  3ABU A;  3OR2 C;  2JZY A;  2DA5 A;  2EJR A;  2HEO A;  3FXQ A;  2E5N A;  2VE8 A;  4YZE A;  3BCG A;  1XD7 A;  2G7H A;  3FBI B;  3GZI A;  5K5Q A;  2CUF A;  4EJT A;  2LR8 A;  4M3G A;  2FBK A;  2AQE A;  3QU3 A;  1MH4 A;  2DPU A;  2ZCM A;  1WVR A;  4H0E A;  4A69 C;  1IRZ A;  3CMY A;  2CH0 A;  3GFM A;  1D8K A;  3LWJ A;  4MIM A;  2L7F P;  4ENM A;  2X6X A;  2WV0 A;  4A3D J;  1JGG A;  5K58 A;  5GAD J;  3OR1 C;  1TP4 A;  4BAC A;  2RQP A;  3FIS A;  3IUO A;  3VFZ A;  1HW1 A;  3HTU A;  4B48 A;  1JJ6 C;  3E6M A;  1XN7 A;  2E2H J;  2ESN A;  3IRR A;  2NVQ J;  1ZG3 A;  1O7F A;  5HOO A;  4HQE A;  3DTE A;  9ANT A;  3QBM A;  2KIS A;  2HDC A;  4HNU A;  4X6A J;  4XR6 A;  1MJA A;  1P4X A;  5D19 A;  1P6R A;  3U1D A;  5BS6 A;  4LMY A;  5D5W B;  2X85 A;  3D5S C;  4DJA A;  3JCU C;  2P4W A;  4NUB A;  2M1B A;  3MZH A;  3ZCO A;  2PG4 A;  1E17 A;  3CUQ A;  3P5J A;  3ZMS A;  3U9G A;  2R7S A;  5FKO A;  2BZT A;  4OWR B;  4RAZ A;  5JI6 A;  3FXU A;  1F43 A;  1IXS B;  1UZC A;  4ZYE A;  1WI9 A;  2F2E A;  1RES A;  3H3V K;  2OI8 A;  4CYD A;  3NXC A;  3PSF A;  2P6S A;  2TDX A;  2W7N A;  4LB5 A;  3BZC A;  3IRQ A;  3DEU A;  1OLT A;  1A04 A;  4ZYG A;  1CQT A;  1B6A A;  4KUM A;  2M34 A;  1OJL A;  2VXD A;  4KIF A;  1TQI A;  4NC8 A;  5J8C A;  1ZHF A;  4GYI A;  1B72 B;  4HLY A;  4OIN F;  1R9T J;  3AG4 H;  2LVS A;  1P2F A;  4LIV A;  2RDP A;  5DS9 A;  4BXU A;  1YIT I;  4G7H F;  2L2O A;  3BR6 A;  2D1V A;  3V4G A;  2XAQ A;  2JA8 J;  4E7L A;  1FBS A;  2L4M A;  2B7E A;  4BJT A;  5JFR A;  2JSP A;  1AU7 A;  2EIL H;  2XUB A;  4XOR A;  1CGP A;  1P7I A;  2KRF A;  5K5R A;  1ORK A;  2PN6 A;  1YX3 A;  3A0B C;  3OY9 A;  3QWL A;  4XKC A;  3GZN B;  3BQY A;  4NC7 A;  3M4O J;  1XC5 A;  1N25 A;  3ERM A;  3CCV I;  2EZK A;  2PMZ A;  5HNH A;  1D0Z A;  3KKD A;  4PFO A;  4BJ5 C;  3RI4 A;  1IZ1 A;  2VJ4 A;  2FA5 A;  2V1D A;  4L18 B;  5FGM A;  3E7Q A;  2DQR A;  5CXI A;  2XGE A;  3TP3 A;  2A07 F;  1FIP A;  2K85 A;  3I58 A;  3IKV A;  2HNH A;  3C7J A;  2HQA A;  3WTV C;  2XHK A;  1U6G A;  3S16 J;  1ZKG A;  3TMO A;  1ETQ A;  4BHP A;  2IT0 A;  1MGT A;  1RR7 A;  2BV6 A;  2O5R A;  3P9C A;  2D45 A;  2HR3 A;  3X2Q H;  5E1W A;  3PJR A;  3A01 B;  2L7Z A;  1VQM I;  1KQ9 A;  4GFL A;  3LOC A;  3PNV A;  2RQQ A;  4ZDP A;  1I39 A;  2DK8 A;  1T38 A;  2EK5 A;  2JT1 A;  1HKS A;  4JX6 A;  4E7Z A;  2F4M B;  3ELK A;  4EJV A;  2FMY A;  5J47 A;  2JTV A;  1X3W B;  1J0R A;  4BL0 B;  2HPM A;  2E1N A;  2PMH A;  5GP9 A;  3JSJ A;  2R5Y B;  2R5Z B;  1K4T A;  3HKZ A;  4XSZ F;  2DA6 A;  1PJR A;  1SFX A;  2FD5 A;  2R0Q C;  5M5W J;  2DDA A;  2HKO A;  4I7H A;  1U5T C;  5EJC A;  2A68 F;  3WTT C;  3QYF A;  2K27 A;  2EQR A;  5HSZ A;  4I98 B;  1IO2 A;  3ON4 A;  1S3J A;  4B3X A;  2DOF A;  3PFI A;  4CXF A;  4LOC A;  1OCP A;  2L9S A;  2VBZ A;  4U0W A;  2DFI A;  4Y33 A;  1IAW A;  1ZTR A;  4ON0 A;  2KKO A;  3S1Q J;  3M8J A;  1YW8 A;  3BG9 A;  5JHF A;  4UB8 C;  2REK A;  1KYW A;  2ME6 A;  1HKQ A;  5CPR B;  1SMT A;  5LBQ A;  2KRH A;  3G6E I;  3BR3 A;  3CP8 A;  1E3P A;  2ZCW A;  4HEA 2;  3QRF F;  5LFA A;  2R5Y A;  2MFZ A;  4M3B A;  3NWS A;  2OC6 A;  4C2U A;  3ZR8 X;  3O8H A;  5LRR A;  2CW7 A;  4NNJ A;  1QGP A;  3SWH A;  3PL8 A;  2WAF A;  1U5T B;  4CDG A;  3K4B A;  1T95 A;  3G1L A;  4BJ6 C;  2OF7 A;  3A01 A;  3ZMD A;  2JQ7 A;  3DP7 A;  3M8E A;  4GYG A;  5J3L A;  2XAS A;  2RC4 A;  3BJO A;  4KA4 A;  3OL3 A;  4HZF A;  3FKI J;  1HA8 A;  3VOX A;  4EEF G;  1PUE E;  2GWR A;  1YOV B;  2EPF A;  2HGC A;  1V5E A;  2P5V A;  1V55 H;  5AIQ A;  1O4X A;  5EYR A;  5C4Y A;  5FLV A;  4M73 A;  2L7M P;  1ACI A;  4HRI A;  2IPQ X;  4U7B A;  1MMS A;  2F5V A;  3TDU C;  3KZY A;  1JHH A;  3V42 A;  5GAG J;  3S1R J;  1T6S A;  4IHT A;  2ZME B;  4WWC A;  1EA3 A;  1QBJ A;  4A3L J;  2W57 A;  1J75 A;  4IRH A;  4G9Y A;  3HPH A;  2CQX A;  2BW3 A;  4KT6 A;  2XAU A;  2MA3 A;  3DLL F;  4EVI A;  3E3V A;  2B9S A;  2FE3 A;  4IQJ A;  3S15 J;  1HOM A;  2FQ3 A;  4ESF A;  5D5X B;  2VON A;  4FTH A;  4KFC A;  1IDZ A;  2KLO A;  3WHB A;  1JE8 A;  2MH2 A;  2A3S A;  5D4R A;  1V3F A;  3H92 A;  2L9R A;  3MCZ A;  1X1P A;  1UEL B;  5DUI A;  1G3S A;  1FSH A;  3BJB A;  2LY9 A;  4MTD A;  1YO5 C;  1YHQ I;  2ZOZ A;  3T8R A;  1Z6T A;  4KIT B;  3HOS A;  1DP3 A;  1GV5 A;  1R5G A;  3F8F A;  1ZK8 A;  3OYE A;  2VC0 A;  4HV5 A;  1W5S A;  3WTY C;  3ROU A;  3S2W A;  1IRX A;  1RPW A;  2VBW A;  4XLN F;  1H89 C;  4HG2 A;  4WXC A;  3WTS C;  1SGM A;  2ACJ A;  2M5W A;  5BPI A;  2O6G E;  2E60 A;  2M45 A;  3E97 A;  4BE2 A;  2LK2 A;  5J40 A;  1TW2 A;  4GCK A;  2ID3 A;  3DCF A;  2A6T A;  1FLI A;  4QSH A;  1NHA A;  2UXN A;  2FX0 A;  3VEP A;  2E35 A;  3Q9S A;  1J5Y A;  1SD4 A;  3R0A A;  1FTZ A;  1SVL A;  1DUX C;  3AL0 B;  2NS7 A;  5IYB J;  1U9N A;  3JRI A;  1JXS A;  3PUF A;  2H8R A;  2XGX A;  3L2Q A;  3H36 A;  4V2F A;  3V7C A;  1KU2 A;  1LDJ A;  1QHH D;  1LE8 B;  2H1K A;  4Y7N J;  1HDD C;  3HJE A;  2IJL A;  1L0O C;  2MD0 A;  2FBQ A;  2GFN A;  1PVE A;  5HDK A;  2Z33 A;  2L7K A;  1TWA J;  3HG9 A;  2Y0S N;  3F22 A;  2OQR A;  4K2E A;  5FMP A;  1X1D A;  3ULQ B;  1MMA A;  4BH9 A;  3HSF A;  2PFB A;  3ERE D;  1SFU A;  2GA2 A;  2O7O A;  2HWV A;  3LSR A;  4BAY A;  3UNG C;  5E17 F;  4E7I A;  3BPV A;  2STW A;  3CME I;  1OCR H;  4ICH A;  3Q0W A;  2JJ7 A;  5EZG A;  1Y39 A;  1U78 A;  2HXO A;  4PJL A;  2O03 A;  5DV5 A;  1K61 A;  3FMQ A;  2HS5 A;  1XSX A;  2IA0 A;  2R7W A;  3VP5 A;  1TQP A;  1D0Y A;  1ON2 A;  2X51 A;  1RKT A;  2R7V A;  3F23 A;  4RAY A;  3PPB A;  2K7L A;  2WWY A;  3IP4 B;  3G2B A;  4HBL A;  4A3E J;  4XQF A;  2ZJP F;  2QOP A;  1D0X A;  4ESB A;  4GRI A;  2XPV A;  3I4P A;  3KZZ A;  3CCE I;  1Q1H A;  3HL2 A;  2LH9 A;  4NB5 A;  1OYW A;  2E1C A;  5EEH A;  4LIU A;  3VOE A;  2ZO4 A;  3ABL H;  3VYU B;  5LGT A;  1XCB A;  1Y8R B;  1YLF A;  3E6D A;  5AIP A;  2PZ9 A;  2Z16 A;  1F9N A;  2V9K A;  4RM3 A;  5FD5 A;  3EGQ A;  2X1D A;  3GX4 X;  3S3O A;  2EIJ H;  4KMF A;  4ZH4 F;  3BR0 A;  4YRV A;  3LQR A;  4A0Y A;  3M3Y J;  3AAF A;  5ICG A;  3EDP A;  2V6C A;  1X3U A;  1OMI A;  2L9V A;  2CUJ A;  1ZRC A;  1QU3 A;  2KIF A;  5TJJ A;  2NNN A;  1T33 A;  2Y9Z A;  2BXY A;  5CYV A;  2ZXI A;  3F8B A;  4JK1 X;  3MZY A;  2OAZ A;  2ELJ A;  4P9F A;  4P55 A;  2EZI A;  1NK3 P;  5JVG F;  2YU3 A;  4HW0 A;  2LG4 A;  4A3M J;  5A2Q Z;  2QSH X;  1J9I A;  2V1U A;  1W0U A;  5J6X A;  2PEX A;  2MW8 A;  3EUK L;  4EGZ A;  4OIP F;  2CGP A;  1DU6 A;  3K4C A;  1YQA A;  2M0C A;  3T6N A;  5E8I A;  3BTL A;  3ZMV A;  2F5C A;  3B02 A;  2MBF A;  1TWC J;  5IPA A;  3J7A Y;  1IN5 A;  4N9I A;  1X1A A;  5FLM J;  2XV4 S;  1F36 A;  5JLX A;  4FCY A;  2Y69 H;  5ED4 A;  2VT2 A;  3BJ6 A;  1Y8Q B;  4WXD A;  1X58 A;  2LNB A;  3PIO F;  3PAS A;  5FRO A;  3HRT A;  2UXH A;  2IXS A;  3JRG A;  1OCZ H;  2BGC A;  2IS1 A;  2HZD A;  4JNN A;  2HKU A;  4AC6 A;  5GPC A;  3SZT A;  5TRD A;  4YG2 F;  2G0E A;  4XSX F;  2OCC H;  3D0S A;  4CUG A;  2KIM A;  3ANG A;  1QPM A;  2I5U A;  2V26 A;  2FOW A;  3HGY A;  1IW7 F;  3RKY A;  2K9M A;  2QIB A;  1GV2 A;  2HPI A;  3I5U A;  4LGW A;  4ASN A;  2XAJ A;  4AVP A;  5J1Y A;  4UVA A;  3LSM A;  1RR8 C;  2QF7 A;  3L9F A;  2Y2Z A;  2LY2 A;  1RUN A;  3GTP J;  1O57 A;  3MN2 A;  1MKM A;  2LBF B;  4D5C A;  1H0M A;  3CF2 A;  1VQL I;  4LLG F;  4HNT A;  3V7S A;  1WPK A;  3JTG A;  1XPX A;  2COM A;  3KFW X;  2EA4 A;  4MHG A;  1IF1 A;  1OYI A;  3P7N A;  3WTX C;  1ZAR A;  1K4S A;  3A03 A;  5HDG A;  4EM2 A;  2DA1 A;  4B09 A;  3FHZ A;  5ICE A;  4RLQ A;  2R92 J;  1YJW I;  2COB A;  4ACI A;  1IC8 A;  5JLW A;  3I0T A;  2YSR A;  1MMG A;  1M1E B;  1X4P A;  3QYB A;  4UHT A;  3ZQC A;  4UVC A;  5D1R A;  3VYS B;  3CF5 F;  2VPL A;  3C1D A;  4UDS A;  4HOB A;  4Y52 J;  1JTY A;  2CQQ A;  1OQY A;  3ASN H;  4RM2 A;  3I9V 2;  1TTY A;  4Z2Y A;  2O9L A;  2HYF A;  3MWM A;  4EQQ A;  1W5C C;  3JSO A;  2DAO A;  3QAH A;  1U2W A;  1FNN A;  2A61 A;  3U2R A;  3JRH A;  3S2D J;  3KPH A;  1B1B A;  5D5U B;  4UUS B;  4AU7 A;  3LA3 A;  2MSY A;  2EFN A;  5LEJ A;  3FK7 A;  1KQ0 A;  2BVM A;  1W7P D;  2VOP A;  3MKZ A;  2DYS H;  3GLX A;  4J01 A;  1XG1 A;  4XKB A;  3TO6 A;  3QOE A;  4F55 A;  1AHD P;  4XKW A;  5CQG A;  3L2V A;  3KEO A;  4OMZ A;  2GIV A;  1OCO H;  3L00 A;  4V19 K;  4C2M J;  4B8X A;  2NS0 A;  5C4X J;  3PQK A;  3H0G J;  2XC7 A;  5FKK A;  2ELH A;  3KYC B;  3CC4 I;  4MFE A;  1IN6 A;  1K6Y A;  4M6X A;  2F5D A;  2B1E A;  2VLA A;  3SEQ A;  1KZH A;  1PUF B;  3ZGK A;  4D7N A;  4OD4 A;  5E3N A;  4BXX J;  4HPQ A;  5F08 A;  1G4D A;  2W00 A;  2VJI A;  2X1C A;  2OBP A;  2QSG X;  1T0F A;  3V6G A;  4BY1 J;  5D8L B;  3P9I A;  4C2T A;  4BE0 A;  3V8K A;  4DVY P;  3FHN A;  1TZL A;  4EJW A;  2LMD A;  5JVT A;  4LB6 B;  3VDX A;  1SAU A;  5D5V B;  2NVX J;  1LKX A;  3TO9 A;  4DIQ A;  2KHM A;  3VVX A;  1JGS A;  4E70 A;  1R7J A;  1HCR A;  3HYI A;  1JUP A;  2DFF A;  2K4J A;  4ZJZ A;  3ZQF A;  2WC2 A;  3PSI A;  4CYC A;  1FYK A;  3RYR A;  2LF7 A;  2ZB9 A;  2MD5 A;  2XGD A;  2HDD A;  3I64 A;  5FFX A;  1MH3 A;  2XAH A;  3QP5 A;  1STZ A;  4D0P A;  2A2F X;  2V4J C;  3AQT A;  1MJB A;  2I8D A;  3H5R A;  4C9Y A;  1YI2 I;  4A3J J;  5F1J A;  3LHQ A;  3TOB A;  2ID6 A;  5CVV A;  1Y56 A;  4ITV A;  1MBJ A;  1AKH B;  1U5T A;  1V5G A;  5E20 A;  2MGQ A;  3DBR B;  2CU7 A;  4PGG A;  1SEU A;  3TQN A;  4B4C A;  5HVQ C;  2DYR H;  2DT6 A;  4M6Y A;  4AID A;  5LD2 C;  1YIJ I;  1FPQ A;  3MEX A;  2CV0 A;  2QKO A;  3ZMT A;  3PIP F;  1SFO J;  4I0A A;  4LLN A;  2A6H F;  3DV8 A;  4BXF A;  1Z9C A;  2CW0 F;  1S8N A;  2RKH A;  2ZNY A;  2EFW A;  1UI6 A;  2AXT C;  1Q1V A;  2ZFU A;  3WU0 A;  1I6H J;  4M9S A;  2NNY A;  2F48 A;  1VQ9 I;  3HGG A;  3KYL A;  1P9Q C;  2R3S A;  1QQI A;  3CO6 C;  2GA1 A;  2ZC2 A;  2LBF A;  3F8C A;  3GFL A;  3F72 A;  3RPQ A;  2BY2 A;  2DOE A;  3RPU D;  2MC3 A;  1R4N B;  3F8M A;  2ZCN A;  1QZZ A;  4Q5S F;  2XPU A;  2VL8 A;  4C3H J;  1UST A;  1IRF A;  4A3F J;  2W84 A;  1ERD A;  3CUQ C;  4QTR A;  2RV8 A;  3BP8 A;  4DZJ A;  4AF5 A;  2YS9 A;  3G3Z A;  2CO5 A;  3H5N A;  2RNJ A;  4N9H A;  1ZRE A;  5E3M A;  4G8X A;  2W82 A;  2LKP A;  3L2W A;  1R00 A;  4B1R A;  1S7O A;  1BA5 A;  3CJD A;  1WZ2 A;  1I5Z A;  1R5H A;  4J00 A;  2FUG 2;  3FXJ A;  2D5V A;  4BQQ A;  3A1Y A;  1WFX A;  2VJ5 A;  3GTQ J;  4FQG A;  2VI6 A;  1T8I A;  4RGU A;  4B43 A;  2GXG A;  1OR7 C;  5CLS A;  4ZYD A;  1F5T A;  4HQM A;  4N4N B;  4XN3 A;  5HNF A;  2M87 A;  2MAB A;  4YEJ A;  3GFI A;  1N78 A;  2ZNZ A;  1W7P B;  3DU5 A;  1ETK A;  2VE9 A;  1JKP C;  3MQ0 A;  1MBF A;  3I56 I;  2P7V B;  1D1C A;  4HLX A;  5EGO A;  2J5O A;  4IZZ A;  1IN8 A;  4CCJ A;  3EUH A;  4YIF A;  2F4I A;  1FOK A;  1U3E M;  2PJR B;  3DPT A;  4EM1 A;  2IS2 A;  4A0Z A;  3WGG A;  1R49 A;  3W6J B;  1KA8 A;  4P1W A;  5E1Z B;  3R60 A;  2DA7 A;  1DGR M;  4HX4 A;  4BNC A;  4DYC A;  4A3K J;  3BZ6 A;  1BN5 A;  3BWG A;  5DAJ A;  4A12 A;  2AO9 A;  4DZP A;  1X3Z B;  3FXM A;  4KIC A;  3TP0 A;  3BRU A;  4IRV A;  3RYP A;  3ZQI A;  3HOX J;  2WAE A;  1LFU P;  3BOQ A;  2YU9 J;  4A3I J;  4DYR A;  5D8K B;  4DOZ A;  2OZU A;  3DTK A;  5DUK A;  1S29 A;  3OYD A;  2G3B A;  3OSF A;  3BRO A;  5H6R A;  3WU2 C;  2OJE D;  3S2H J;  3K1M A;  2VBX A;  1MNM C;  1FOX A;  3N97 A;  2RAS A;  2NRA C;  1QO0 D;  2W4S A;  4CZC A;  1FTT A;  4XN0 A;  3CRJ A;  4BQA A;  2W85 A;  1G59 A;  4O5V A;  2V1N A;  4G12 A;  3K4M A;  3T8T A;  5FB2 A;  1SFK A;  1BJA A;  3ZRG A;  1FBQ A;  1PP7 U;  4PJN A;  3VVY A;  4JBA A;  1W36 D;  3EET A;  4N4O B;  2M4G A;  3VOK A;  5B1B H;  2DDB A;  2VPR A;  5LLQ A;  3IH4 A;  3HRM A;  4JX4 A;  5IYC J;  2IA1 A;  3CUQ B;  3GZ6 A;  1IDY A;  1G3W A;  1FOY A;  1HST A;  3FMR A;  3QOD A;  2GAU A;  4XNF A;  5J1R A;  2XDN A;  4KWA A;  5D4S A;  2EFO A;  1ZYR F;  3IAS 2;  4BBS J;  2IBD A;  2V57 A;  3KZ9 A;  3OYB A;  3UKG A;  3H9J A;  3MNL A;  4CCN A;  1K83 J;  3HOV J;  1ZLK A;  3CP2 A;  2QGU A;  1VQ7 I;  2KL4 A;  3BJA A;  5H9T A;  3GCM A;  4AIJ A;  2DJI A;  4IEJ A;  2IGK A;  4UB6 C;  4CCL A;  4FT8 A;  3LSH A;  4XID A;  4P9U A;  1V5F A;  2Q2E A;  3VYT B;  2EH3 A;  2H6B A;  3GBG A;  3HXL A;  3OOP A;  2B0L A;  5TGT A;  5IP9 J;  3I55 I;  2QQA A;  3SFI A;  3CLO A;  2R93 J;  3C2B A;  3VSK A;  3FK6 A;  1ZGJ A;  2GXB A;  2WA0 A;  2PBI A;  4CYC B;  4RB2 C;  4W97 A;  4ZDO A;  3RQI A;  3V78 A;  1R1T A;  1MDM A;  3CD6 I;  4FET A;  1F1Z A;  1X1C A;  3SJM A;  1A35 A;  2DK5 A;  2LYC A;  4BDZ A;  5K7H A;  3F3X A;  3GUD A;  2DTR A;  5H2F C;  3DEE A;  4RS8 A;  4ZDL A;  5EEG A;  5EFY A;  3QPL A;  1S72 I;  3HOZ J;  3FF5 A;  4AIK A;  4EAT A;  2NVT J;  3PUB A;  2OUM A;  2LTP A;  2M9H A;  4NN1 A;  3K4J A;  4N0B A;  3D5L A;  1I3A A;  2HOT A;  2H94 A;  2UXX A;  1MSF C;  1D1B A;  2H8W A;  2VN2 A;  4E4H A;  4ZTJ A;  3JRA A;  5FKM A;  4Y13 A;  3ISP A;  3F21 A;  3PO2 J;  3Q0V A;  3KEQ A;  5IT3 A;  3FXR A;  1FEX A;  2UUZ A;  4KIG A;  2V79 A;  4UUV A;  1FWZ A;  1BM9 A;  4LFU A;  2ISZ A;  3NPI A;  4CSW A;  3CDL A;  4NEL A;  2Q1Z B;  2IEK A;  4R8H A;  3H3Z A;  3BTC A;  2LRE A;  1SC7 A;  1H88 C;  4XL9 A;  1J59 A;  2GEN A;  1TT5 B;  3EYI A;  2LRD A;  1U8B A;  2Y31 A;  4G6D A;  3K9T A;  3FXO A;  4L5E A;  1IXR C;  4DNC A;  2K86 A;  2NOJ B;  1YRN B;  4PJ0 C;  2DN0 A;  1HBX G;  1UHS A;  2M3A A;  3SEZ A;  4IHW A;  2R7U A;  2LP0 A;  5IT9 K;  4RAF A;  2X48 A;  3GVA A;  3VPR A;  1T56 A;  2R4G A;  2P5L C;  1K6O A;  3S17 J;  4A6D A;  1VF9 A;  3W2W A;  5L3C A;  3IKT A;  4X0G A;  3S3M A;  3CWR A;  3TKY A;  4A3C J;  4FE7 A;  1I27 A;  3OS2 A;  4ABZ A;  2XGC A;  3HSR A;  4OAY A;  2DTZ A;  2VT3 A; 
#chains in the Genus database with same CATH homology
 2TCT A;  2EZI A;  1NK3 P;  2DG8 A;  3WHC A;  2JA5 J;  3HE0 A;  4A3M J;  3EUP A;  2DMQ A;  3JR9 A;  1Y1V J;  3HOY J;  3OOU A;  3RKQ A;  2E2J J;  1W0U A;  3JRB A;  2MW8 A;  3JRE A;  1DU6 A;  2XB5 A;  1BW5 A;  2HQ5 A;  3BR2 A;  2ECB A;  3C07 A;  3LSP A;  2ZCX A;  3TED A;  2M0C A;  4PXI A;  3A02 A;  3CQZ J;  3T6N A;  3BTL A;  3CCY A;  4FE4 A;  2WV1 A;  3MKL A;  4M3D A;  1B8I A;  1X2N A;  2WB1 N;  1TWC J;  1QRY A;  2LLK A;  5J1U A;  4A3B J;  4JP0 A;  1BW6 A;  4X1E A;  2N8G A;  5IPA A;  3RH2 A;  4JKZ A;  1JUS A;  1IGN A;  5FLM J;  1GVD A;  1F36 A;  5JLX A;  4FCY A;  2R5Z A;  1HF0 A;  3I4N J;  1X58 A;  3MVP A;  4RDU A;  2GUH A;  3KKC A;  2DMN A;  3PAS A;  2UXH A;  2E1O A;  2JWT A;  1ZQ3 P;  1I50 J;  3JRG A;  5EEA A;  4AC0 A;  2G7L A;  3W6V A;  2HKU A;  4A3G J;  4M3E A;  4JNN A;  5GPA A;  3NRG A;  5GPC A;  4AC6 A;  2G0E A;  3F0C A;  4QIW N;  1JKR C;  3ANG A;  2Y9Y A;  3HKZ N;  3I4M J;  3G56 A;  3HGY A;  1WH5 A;  2HI3 A;  3HTH A;  1IV6 A;  5E3L A;  1EF4 A;  2QIB A;  1JJ8 C;  2K9S A;  1GV2 A;  3JRF A;  1Z0X A;  5J1Y A;  4FIS A;  2HYJ A;  3GTO J;  1ETW A;  4XRM A;  3LSJ A;  2OER A;  2FJ1 A;  2QF7 A;  2R7Z J;  2Y2Z A;  3GTP J;  2PBX A;  4I76 A;  3IH3 A;  1ENH A;  3MN2 A;  2LD5 A;  4D5C A;  1WI3 A;  3BNI A;  1MBH A;  1WPK A;  2IAI A;  5IP7 J;  3ZQH A;  2I10 A;  3HEF A;  4JX5 A;  5K7F A;  1ETO A;  2KDZ A;  3RD3 A;  3O8G A;  3A03 A;  2DA5 A;  2DA1 A;  5FHP A;  2QTQ A;  4YZE A;  3BCG A;  2DMT A;  3GZI A;  5C4J J;  2R92 J;  2CUF A;  2COB A;  4ACI A;  3GTK J;  1IC8 A;  2LR8 A;  5JLW A;  5HAW A;  2M8G X;  4M3G A;  5K7Z A;  3G7R A;  1MH4 A;  2ZCM A;  3ZQC A;  4A69 C;  1IRZ A;  3CMY A;  3LJL A;  4MK6 A;  5D1R A;  1ETV A;  3LWJ A;  4MIM A;  2L7F P;  1AKH A;  4UDS A;  4A3D J;  3ZQL A;  1JTY A;  1JGG A;  5M5Y J;  4Y52 J;  2CQQ A;  5FKL A;  2WUI A;  4GFK A;  4BKX A;  3KNW A;  5K58 A;  1ZR4 A;  3TW6 A;  2O9L A;  3FIS A;  3S2D J;  3JRH A;  1NTC A;  3S5R A;  5M5X J;  1JJ6 C;  4DYQ A;  2NOG A;  4UUS B;  3IH2 A;  2E2H J;  2MSY A;  4BY7 J;  3FK7 A;  2NVQ J;  1YRN A;  2X6O A;  3GEU A;  1LE8 A;  4XRS G;  2DG7 A;  2D6Y A;  9ANT A;  1XG1 A;  3QBM A;  5F0F A;  1AHD P;  4XRS A;  4X6A J;  3RZO J;  5D19 A;  1Z77 A;  2M2E A;  2UXP A;  4C2M J;  3OIO A;  1APL C;  1HDP A;  5C4X J;  2GBY A;  3H0G J;  5FKK A;  3BQZ A;  2DA2 A;  2ECC A;  3FIW A;  4MFE A;  1MSE C;  5FKO A;  2Q24 A;  4M3F A;  5HBU A;  1OFC X;  1B72 A;  2G7S A;  3VUQ A;  1F43 A;  1VND A;  1PUF B;  4D7N A;  5E3N A;  4BXX J;  4HNV A;  2TRT A;  5F08 A;  2MG4 A;  1RES A;  3H3V K;  2OI8 A;  2B63 J;  3NXC A;  3QKX A;  2YVH A;  2DMP A;  3V6G A;  4BY1 J;  1CQT A;  3HOU J;  2M34 A;  1OJL A;  3D1N I;  2YVE A;  1B72 B;  2NP3 A;  5FKN A;  1R9T J;  1ITY A;  2LVS A;  5IYD J;  5DS9 A;  2NVX J;  2NX4 A;  3BR6 A;  1JUM A;  3VVX A;  4C3J J;  2JA8 J;  3QPS A;  2ELK A;  2OPT A;  2E2I J;  4NDL A;  1HCR A;  1JUP A;  1AU7 A;  2UXI A;  3ON2 A;  3ZQF A;  1P7I A;  4CYC A;  1ORK A;  2JA7 J;  2ZB9 A;  2AHQ A;  4A93 J;  2RAE A;  2XB0 X;  2XGD A;  1XS9 A;  2HDD A;  3BQY A;  1MH3 A;  4I6Z A;  4GFB A;  3M4O J;  1XC5 A;  1HLV A;  1QVU A;  2EZK A;  3VW2 A;  5CXG A;  1VFC A;  4J19 A;  3COL A;  2QCO A;  3KKD A;  3Q0U A;  3AQT A;  2DA3 A;  4A3J J;  5F1J A;  2HXI A;  3LHQ A;  2ID6 A;  2VKV A;  1E3O C;  1MBJ A;  1AKH B;  3E7Q A;  1W0T A;  1JTX A;  2XGE A;  2MGQ A;  3TP3 A;  4D7M A;  5CXI A;  2CJJ A;  1FIP A;  4IHY A;  2HOA A;  1DU0 A;  4AUX A;  4MO7 A;  2CU7 A;  4L62 A;  2VKE A;  1JT6 A;  4B4C A;  1WGX A;  3VW0 A;  3S16 J;  2QKO A;  4UUS A;  1ZKG A;  2PMZ N;  1G2H A;  1SFO J;  4HKU A;  1ETQ A;  3JRD A;  3K2A A;  2XPW A;  1RR7 A;  1MBE A;  3NAR A;  1UI6 A;  3A01 B;  2L7Z A;  5EGO B;  1Q1V A;  2EZH A;  1ZR2 A;  1I6H J;  2IU5 A;  4GFL A;  3LOC A;  2GM4 A;  3HGG A;  3G1O A;  1GUU A;  4DW6 A;  4JX6 A;  2K40 A;  3OSG A;  2ZCN A;  1IJW C;  5GP9 A;  2XPU A;  4C3H J;  5IOZ A;  2K9Q A;  3JSJ A;  3HM5 A;  2R5Y B;  2R5Z B;  2DMU A;  2DA6 A;  5F04 A;  4A3F J;  1WH7 A;  3LSG A;  3ZQG A;  4QTR A;  2FD5 A;  2R0Q C;  4DZJ A;  5M5W J;  2F07 A;  4AF5 A;  2YS9 A;  1SAN A;  3HDD A;  3DPJ A;  2DA4 A;  2EQR A;  4IHV A;  5E3M A;  5HSZ A;  1UMQ A;  1QPI A;  3ON4 A;  4B1R A;  1BA5 A;  3CJD A;  5EG0 B;  4MLO A;  4D5F A;  3IV5 A;  4LOC A;  1OCP A;  2LFB A;  5E3O A;  4BBR J;  3PM1 A;  3BTJ A;  2D5V A;  1ZTR A;  2E19 A;  1A5J A;  3HIM A;  2NS8 A;  3S1Q J;  3BG9 A;  1WCM J;  1D5Y A;  3GTQ J;  2REK A;  2VI6 A;  2ME6 A;  3LNQ A;  5M3F J;  2LKX A;  2W53 A;  3BR3 A;  1OCT C;  2R5Y A;  2JA6 J;  3QQA A;  4M3B A;  1TC3 C;  3BG5 A;  3O8H A;  1ETK A;  4MXM A;  5F0C A;  1JKP C;  1MBF A;  1RET A;  5EDN A;  1JT0 A;  3G1L A;  2FQ4 A;  5EGO A;  2OF7 A;  3A01 A;  5J3L A;  2K9N A;  2O7T A;  4W1U A;  3FKI J;  2DA7 A;  3B6C A;  3VOX A;  2KT0 A;  4EEF G;  4MFD A;  4DYC A;  3S14 J;  3Q3S A;  4A3K J;  5CW8 A;  2NVY J;  5DAJ A;  1O4X A;  2AO9 A;  5EYR A;  4B3A A;  3TP0 A;  4DZP A;  5HOD A;  3BRU A;  5C4Y A;  5FLV A;  2WGB A;  2L7M P;  3HTA A;  3VIB A;  3ZQI A;  1P7J A;  3HOX J;  1LFU P;  4XIC A;  3HTJ A;  2YU9 J;  5F27 A;  1QVT A;  4DYR A;  4A3I J;  2WAQ N;  1JKQ C;  3BR5 A;  3S1R J;  2JMW A;  2G3B A;  3OSF A;  2NP5 A;  5DTD A;  5FGL A;  3S2H J;  2X9D A;  2XSD C;  1MNM C;  2RAS A;  1MBG A;  3B6A A;  4GCT A;  4A3L J;  1FTT A;  3CRJ A;  2GLO A;  3ZOB A;  2CQX A;  4G12 A;  3O60 A;  2CUE A;  2JN6 A;  1U9O A;  3VVY A;  3DEW A;  1B8I B;  3S15 J;  1HOM A;  2HOS A;  2XRL A;  3GTJ J;  3HTI A;  1PUF A;  2O8K A;  3VOK A;  4V2G A;  3G1M A;  2VPR A;  3WHB A;  4FTH A;  1IDZ A;  3IH4 A;  4C3I J;  3BHQ A;  2L9R A;  4JX4 A;  5IYC J;  2Y30 A;  3BJB A;  2LY9 A;  1FIA A;  1LFB A;  2P81 A;  3NI7 A;  3BG3 A;  1IDY A;  2JK3 A;  2RHA A;  2XDN A;  5J1R A;  2ZOZ A;  1BJZ A;  4KWA A;  2YUS A;  1GV5 A;  1ZK8 A;  4JYK A;  4BBS J;  2IBD A;  3FRQ A;  2V57 A;  3KZ9 A;  1RKW A;  1I3Q J;  3VVZ A;  1VI0 A;  5IOY A;  1JKO C;  3UKG A;  4M6V A;  3MNL A;  1RPW A;  2HYT A;  1GDT A;  1H89 C;  1K83 J;  4CGR A;  3HOV J;  3NAU A;  1SGM A;  3P9T A;  3L1P A;  5H9T A;  3E7L A;  3GTL J;  3NNR A;  3BTI A;  5BNG A;  2LK2 A;  4IEJ A;  4GCK A;  2ID3 A;  3DCF A;  3TW7 A;  4QSH A;  4XID A;  2FX0 A;  2QWT A;  2EH3 A;  5C44 J;  3GBG A;  1FTZ A;  2UXU A;  5IP9 J;  2NS7 A;  5IYB J;  3HBL A;  1U9N A;  3SFI A;  3JRI A;  5C3E J;  4UUT A;  1ETY A;  2R93 J;  3C2B A;  2H8R A;  1BL0 A;  3K7A J;  3FK6 A;  4V2F A;  4CYC B;  3V78 A;  4W97 A;  1A6I A;  3RQI A;  1LE8 B;  2H1K A;  2CRG A;  4Y7N J;  4GCL A;  1HDD C;  3VW1 A;  3SJM A;  2FBQ A;  2W48 A;  3PO3 J;  2GFN A;  5EZH A;  4AYB N;  1TWA J;  5K7H A;  2Y0S N;  2EZL A;  1FJL A;  3HOW J;  3ANP A;  3GTG J;  5EF6 A;  5FMP A;  2VUM J;  1IG7 A;  2L0K A;  5EFY A;  2UXO A;  3QPL A;  3HOZ J;  5M3M J;  1ETX A;  2NVT J;  2O7O A;  3LSR A;  2LTP A;  2M9H A;  4NN1 A;  4ICH A;  5D18 A;  3Q0W A;  2JJ7 A;  5EZG A;  3B81 A;  1U78 A;  2HOT A;  2HXO A;  2EBI A;  1MSF C;  1ZGW A;  1K61 A;  4S0H B;  5FKM A;  3JRA A;  2ME0 A;  3PO2 J;  3Q0V A;  1H8A C;  3VP5 A;  1NK2 P;  1FEX A;  2DJN A;  1RKT A;  3PPB A;  4IHX A;  3S1M J;  3NPI A;  3CDL A;  4ME9 A;  4NEL A;  1X2M A;  2IEK A;  4A3E J;  3BTC A;  2QOP A;  1H88 C;  2XPV A;  5AQC A;  2GEN A;  2G7G A;  2ZOY A;  1UI5 A;  1U8B A;  4JL3 A;  3F1B A;  2Y31 A;  3HB9 A;  1TWG J;  4L5E A;  2PZ9 A;  3RZD J;  3S1N J;  3EGQ A;  3BT9 A;  1YRN B;  4RBO A;  1IUF A;  2DN0 A;  3BR0 A;  1UHS A;  3JRC A;  4IHW A;  2LP0 A;  1TWF J;  1TWH J;  2X48 A;  3M3Y J;  3AQS A;  4XK4 A;  3VPR A;  1T56 A;  5IP6 A;  1POG A;  1UG2 A;  3S17 J;  3CWR A;  1VF9 A;  3IUV A;  1MBK A;  1T33 A;  1Y1W J;  2Y9Z A;  4A3C J;  4FE7 A;  3SDG A;  1GT0 C;  4ABZ A;  3BR1 A;  5F0H A;  2XGC A;  5EG0 A;  1S7E A;  3GTM J;  5FJ8 J;  2DTZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...