3VOXA

X-ray crystal structure of wild type hrtr in the apo form
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
187
structure length
181
Chain Sequence
PKSTYFSLSDEKRNRVYDACLNEFQTHSFHEAKIMHIVKALDIPRGSFYQYFEDLKDAYFYVLSQETLEIHDLFFNLLKDNSIEESLDKYKYLLLENLIDSPQYKLYKYRFLDWTYELERDWKPQSSATDNPISQVLKSVVHNLVYRLFSENWTEKTFIENYDKEIKLVTEGLLNYITDRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for the Transcriptional Regulation of Heme Homeostasis in Lactococcus lactis.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Transcription
molecule keywords Transcriptional regulator
total genus 62
structure length 181
sequence length 187
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3voxA00
3VW1A 2RAEA 3CCYA 2D6YA 3BR6A 4JNNA 3WHBA 2HQ5A 4UDSA 5F0HA 5GP9A 5FKLA 5EZGA 3V78A 3HGYA 2G7LA 2UXHA 3F1BA 3VVZA 2QWTA 3CDLA 4B3AA 2GUHA 5FKKA 2REKA 2IU5A 3SDGA 1VI0A 3BTIA 3EGQA 5CW8A 2PZ9A 3VOKA 2Q24A 3TP3A 2QKOA 3G1LA 3QPLA 3HGGA 2XDNA 3GZIA 3P9TA 2ID6A 2RHAA 3HTHA 1ZKGA 3SFIA 5F1JA 3CRJA 5GPCA 2JK3A 3QPSA 2VKEA 3HTJA 5IOZA 2FBQA 2XGDA 4NN1A 3LJLA 5D19A 1Z77A 3KKCA 3VUQA 4V2FA 4ACIA 1U9NA 3O60A 2G7GA 3G1OA 2OPTA 1ORKA 5H9TA 4V2GA 3BNIA 3VVXA 5D1RA 2G0EA 2NX4A 4DW6A 3FIWA 2XPUA 4AUXA 2ZOZA 4M3EA 4D7NA 1QPIA 1A6IA 1JUSA 2TCTA 4I76A 3COLA 3KKDA 2ID3A 5EYRA 3PPBA 5F04A 4JL3A 3F0CA 2NP5A 4MO7A 1JT6A 3RD3A 5IOYA 4W1UA 1RPWA 4D7MA 2ZCNA 3B81A 5J1RA 5GPAA 4D5CA 2ZB9A 4JKZA 2O7OA 2UXIA 3QBMA 2UXOA 3VOXA 5HBUA 3VPRA 3BQYA 2GFNA 2GBYA 3IUVA 3DCFA 3NXCA 3HTAA 3LSPA 4M3DA 2DTZA 5IP6A 2RASA 5DAJA 1RKWA 3HIMA 2HYTA 1UI5A 3ANPA 3NI7A 3ZQFA 3VIBA 3NNRA 4X1EA 3ZQHA 3B6CA 3HE0A 3C07A 1JTXA 1BJZA 3GEUA 4ICHA 2UXPA 2IBDA 3PM1A 2Y30A 5F0FA 5K7FA 2NS7A 2HXIA 2FJ1A 3QKXA 3O8HA 2V57A 3IH3A 2DG7A 1U9OA 3QQAA 5J3LA 2IAIA 3BR3A 2XPVA 5J1UA 1QVUA 2G7SA 3DPJA 3IH4A 4ME9A 5FKOA 2WGBA 4KWAA 3VP5A 2PBXA 2EH3A 5FGLA 5K58A 3HTIA 3KNWA 1UI6A 4AC0A 2YVHA 3Q3SA 2IEKA 2XPWA 4ABZA 4L62A 1JUMA 5HAWA 3ZQIA 2QIBA 4MK6A 2YVEA 2WV1A 2QTQA 2G3BA 5F0CA 3FK6A 2HKUA 3BCGA 3ON2A 3BTLA 3E7QA 4GCLA 3KZ9A 5EFYA 5F08A 3BJBA 3LOCA 4YZEA 1T33A 3FRQA 2ZOYA 5FKNA 1SGMA 2XGEA 3V6GA 3G56A 4W97A 2XB5A 2HXOA 2I10A 3BHQA 3AQSA 3CWRA 4G12A 2HYJA 3BT9A 3NRGA 2TRTA 3PASA 2QOPA 5FKMA 3VW0A 4D5FA 1JUPA 5D18A 2XGCA 3ANGA 3JSJA 3LWJA 2Y2ZA 2F07A 3TP0A 4PXIA 3MVPA 2VPRA 2OF7A 2ZCMA 1JT0A 3Q0VA 3S5RA 3ON4A 4I6ZA 5FHPA 5K7HA 2FQ4A 1Z0XA 3Q0WA 4HKUA 4M3BA 3ZQLA 2WUIA 3EUPA 2JJ7A 3IH2A 1RKTA 3BR1A 2Y31A 3T6NA 4M3GA 4GFLA 3BR0A 3LSJA 4GFKA 3LSRA 3WHCA 5CXGA 2FX0A 2NS8A 3VVYA 2X9DA 3AQTA 2DG8A 2X6OA 3BR5A 2W53A 3C2BA 5CXIA 3VW2A 2GENA 4AF5A 2XRLA 3DEWA 4XK4A 2NP3A 5C4YA 3G7RA 4GCKA 1T56A 3G1MA 2FD5A 3O8GA 2O7TA 3MNLA 2QCOA 1QVTA 3LHQA 2OI8A 4CGRA 3BTJA 5F27A 4AC6A 3B6AA 2ZCXA 3BQZA 2OERA 4NELA 3RH2A 3CJDA 5IPAA 5AQCA 3ZQGA 3BTCA 4B1RA 1ZK8A 5FMPA 3NPIA 3BR2A 3BRUA 3Q0UA 4M3FA 5J1YA 4JYKA 5K7ZA 4GCTA 2VKVA 2UXUA 3FK7A 1JTYA 5EZHA 4MXMA 5HSZA
chains in the Genus database with same CATH superfamily
3VW1A 2RAEA 2R7RA 3CCYA 2D6YA 3BR6A 4JNNA 3WHBA 2HQ5A 4UDSA 5F0HA 5GP9A 5FKLA 5EZGA 3V78A 3HGYA 2G7LA 2UXHA 3F1BA 3VVZA 2QWTA 3CDLA 4B3AA 2GUHA 5FKKA 2REKA 4U9LA 4IRVA 2IU5A 3SDGA 2B3WA 1VI0A 2R7OA 3BTIA 3EGQA 5CW8A 2PZ9A 3VOKA 2Q24A 4C2MA 3TP3A 2QKOA 3G1LA 3QPLA 3HGGA 2XDNA 3GZIA 3P9TA 2ID6A 2RHAA 3HTHA 1ZKGA 3VTIA 3SFIA 5F1JA 3CRJA 5GPCA 2JK3A 3QPSA 2VKEA 3HTJA 5IOZA 2FBQA 2XGDA 4NN1A 3LJLA 5D19A 1Z77A 3KKCA 3VUQA 4V2FA 4ACIA 1U9NA 3O60A 2G7GA 3G1OA 2OPTA 2FJI1 1ORKA 5H9TA 4V2GA 3BNIA 3VVXA 2B1EA 5D1RA 4DVYP 2G0EA 2NX4A 2R7SA 4DW6A 3FIWA 2XPUA 4AUXA 2ZOZA 4M3EA 2R7WA 4D7NA 1QPIA 1A6IA 1JUSA 2TCTA 4I76A 3COLA 3KKDA 2ID3A 5EYRA 3PPBA 5F04A 4JL3A 3F0CA 2NP5A 4MO7A 1JT6A 2R7TA 3RD3A 5IOYA 4W1UA 1RPWA 4D7MA 2ZCNA 3B81A 5J1RA 5GPAA 4D5CA 2ZB9A 4JKZA 2O7OA 2UXIA 3QBMA 2UXOA 3VOXA 5HBUA 3VPRA 3BQYA 2GFNA 2GBYA 3IUVA 3DCFA 3NXCA 3HTAA 3LSPA 4M3DA 2DTZA 5IP6A 2RASA 5DAJA 1RKWA 3HIMA 2HYTA 1UI5A 3ANPA 3ZQFA 3DU6A 3NI7A 3VIBA 3NNRA 4X1EA 3ZQHA 3B6CA 3HE0A 3C07A 1JTXA 2R7XA 1BJZA 3GEUA 4ICHA 2UXPA 2IBDA 3FHNA 3PM1A 2Y30A 5F0FA 5K7FA 2NS7A 2HXIA 2FJ1A 3QKXA 3O8HA 2V57A 3DU5A 3IH3A 2DG7A 1U9OA 3QQAA 5J3LA 2IAIA 3BR3A 2XPVA 5J1UA 3KYLA 1QVUA 2G7SA 3DPJA 3IH4A 4ME9A 5FKOA 2WGBA 4KWAA 3VP5A 2PBXA 2EH3A 5FGLA 5K58A 3HTIA 3KNWA 1UI6A 4AC0A 2YVHA 3Q3SA 2IEKA 2XPWA 4ABZA 4L62A 1JUMA 5HAWA 3ZQIA 2QIBA 4MK6A 2YVEA 2WV1A 2QTQA 2G3BA 2ZY9A 5F0CA 3FK6A 2HKUA 3BCGA 3ON2A 3BTLA 3E7QA 4GCLA 3KZ9A 5EFYA 5F08A 3BJBA 3LOCA 4YZEA 4U9NA 1T33A 3FRQA 2R7VA 2ZOYA 5FKNA 1SGMA 3NS4A 2XGEA 3V6GA 3G56A 4W97A 2XB5A 2HXOA 2I10A 3BHQA 3AQSA 3CWRA 4G12A 2HYJA 3BT9A 3NRGA 4OD4A 2TRTA 3PASA 2QOPA 5FKMA 3VW0A 4D5FA 1JUPA 5D18A 2XGCA 3ANGA 3JSJA 3LWJA 2Y2ZA 2F07A 3TP0A 4PXIA 3MVPA 2VPRA 2OF7A 2ZCMA 1JT0A 3Q0VA 3S5RA 3ON4A 4I6ZA 5FHPA 5K7HA 2FQ4A 1Z0XA 3Q0WA 4HKUA 4M3BA 3ZQLA 2WUIA 3EUPA 2JJ7A 3IH2A 2PFVA 1RKTA 3BR1A 2Y31A 3T6NA 4M3GA 4GFLA 3BR0A 3LSJA 4GFKA 3LSRA 3WHCA 2A2FX 3SWHA 5CXGA 2FX0A 2NS8A 3VVYA 2X9DA 3AQTA 2DG8A 2X6OA 3BR5A 2W53A 3C2BA 5CXIA 3VW2A 3K8PC 2GENA 4AF5A 2XRLA 3DEWA 4XK4A 2NP3A 2YVXA 5C4YA 3G7RA 4GCKA 1T56A 3G1MA 2FD5A 3O8GA 2O7TA 3MNLA 4OD5A 2QCOA 1QVTA 3LHQA 2OI8A 4CGRA 3BTJA 2R7UA 5F27A 4AC6A 3B6AA 2R7QA 5CQGA 2ZCXA 3BQZA 2OERA 4WIBA 4NELA 3RH2A 3CJDA 5IPAA 5AQCA 3ZQGA 3BTCA 4B1RA 1ZK8A 5FMPA 3NPIA 3BR2A 3BRUA 3Q0UA 4M3FA 5J1YA 4JYKA 5K7ZA 4GCTA 2VKVA 2UXUA 3FK7A 1JTYA 5EZHA 4MXMA 5HSZA
chains in the Genus database with same CATH topology
3VW1A 2RAEA 3CCYA 2D6YA 3BR6A 4JNNA 3WHBA 2HQ5A 4UDSA 5F0HA 5GP9A 5FKLA 5EZGA 3V78A 3HGYA 2G7LA 2UXHA 3F1BA 3VVZA 2QWTA 3CDLA 4B3AA 2GUHA 5FKKA 2REKA 2IU5A 3SDGA 1VI0A 3BTIA 3EGQA 5CW8A 2PZ9A 3VOKA 2Q24A 3TP3A 2QKOA 3G1LA 3QPLA 3HGGA 2XDNA 3GZIA 3P9TA 2ID6A 2RHAA 3HTHA 1ZKGA 3SFIA 5F1JA 3CRJA 5GPCA 2JK3A 3QPSA 2VKEA 3HTJA 5IOZA 2FBQA 2XGDA 4NN1A 3LJLA 5D19A 1Z77A 3KKCA 3VUQA 4V2FA 4ACIA 1U9NA 3O60A 2G7GA 3G1OA 2OPTA 1ORKA 5H9TA 4V2GA 3BNIA 3VVXA 5D1RA 2G0EA 2NX4A 4DW6A 3FIWA 2XPUA 4AUXA 2ZOZA 4M3EA 4D7NA 1QPIA 1A6IA 1JUSA 2TCTA 4I76A 3COLA 3KKDA 2ID3A 5EYRA 3PPBA 5F04A 4JL3A 3F0CA 2NP5A 4MO7A 1JT6A 3RD3A 5IOYA 4W1UA 1RPWA 4D7MA 2ZCNA 3B81A 5J1RA 5GPAA 4D5CA 2ZB9A 4JKZA 2O7OA 2UXIA 3QBMA 2UXOA 3VOXA 5HBUA 3VPRA 3BQYA 2GFNA 2GBYA 3IUVA 3DCFA 3NXCA 3HTAA 3LSPA 4M3DA 2DTZA 5IP6A 2RASA 5DAJA 1RKWA 3HIMA 2HYTA 1UI5A 3ANPA 3NI7A 3ZQFA 3VIBA 3NNRA 4X1EA 3ZQHA 3B6CA 3HE0A 3C07A 1JTXA 1BJZA 3GEUA 4ICHA 2UXPA 2IBDA 3PM1A 2Y30A 5F0FA 5K7FA 2NS7A 2HXIA 2FJ1A 3QKXA 3O8HA 2V57A 3IH3A 2DG7A 1U9OA 3QQAA 5J3LA 2IAIA 3BR3A 2XPVA 5J1UA 1QVUA 2G7SA 3DPJA 3IH4A 4ME9A 5FKOA 2WGBA 4KWAA 3VP5A 2PBXA 2EH3A 5FGLA 5K58A 3HTIA 3KNWA 1UI6A 4AC0A 2YVHA 3Q3SA 2IEKA 2XPWA 4ABZA 4L62A 1JUMA 5HAWA 3ZQIA 2QIBA 4MK6A 2YVEA 2WV1A 2QTQA 2G3BA 5F0CA 3FK6A 2HKUA 3BCGA 3ON2A 3BTLA 3E7QA 4GCLA 3KZ9A 5EFYA 5F08A 3BJBA 3LOCA 4YZEA 1T33A 3FRQA 2ZOYA 5FKNA 1SGMA 2XGEA 3V6GA 3G56A 4W97A 2XB5A 2HXOA 2I10A 3BHQA 3AQSA 3CWRA 4G12A 2HYJA 3BT9A 3NRGA 2TRTA 3PASA 2QOPA 5FKMA 3VW0A 4D5FA 1JUPA 5D18A 2XGCA 3ANGA 3JSJA 3LWJA 2Y2ZA 2F07A 3TP0A 4PXIA 3MVPA 2VPRA 2OF7A 2ZCMA 1JT0A 3Q0VA 3S5RA 3ON4A 4I6ZA 5FHPA 5K7HA 2FQ4A 1Z0XA 3Q0WA 4HKUA 4M3BA 3ZQLA 2WUIA 3EUPA 2JJ7A 3IH2A 1RKTA 3BR1A 2Y31A 3T6NA 4M3GA 4GFLA 3BR0A 3LSJA 4GFKA 3LSRA 3WHCA 5CXGA 2FX0A 2NS8A 3VVYA 2X9DA 3AQTA 2DG8A 2X6OA 3BR5A 2W53A 3C2BA 5CXIA 3VW2A 2GENA 4AF5A 2XRLA 3DEWA 4XK4A 2NP3A 5C4YA 3G7RA 4GCKA 1T56A 3G1MA 2FD5A 3O8GA 2O7TA 3MNLA 2QCOA 1QVTA 3LHQA 2OI8A 4CGRA 3BTJA 5F27A 4AC6A 3B6AA 2ZCXA 3BQZA 2OERA 4NELA 3RH2A 3CJDA 5IPAA 5AQCA 3ZQGA 3BTCA 4B1RA 1ZK8A 5FMPA 3NPIA 3BR2A 3BRUA 3Q0UA 4M3FA 5J1YA 4JYKA 5K7ZA 4GCTA 2VKVA 2UXUA 3FK7A 1JTYA 5EZHA 4MXMA 5HSZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VW1 A;  2RAE A;  3CCY A;  2D6Y A;  3BR6 A;  4JNN A;  3WHB A;  2HQ5 A;  4UDS A;  5F0H A;  5GP9 A;  5FKL A;  5EZG A;  3V78 A;  3HGY A;  2G7L A;  2UXH A;  3F1B A;  3VVZ A;  2QWT A;  3CDL A;  4B3A A;  2GUH A;  5FKK A;  2REK A;  2IU5 A;  3SDG A;  1VI0 A;  3BTI A;  3EGQ A;  5CW8 A;  2PZ9 A;  3VOK A;  2Q24 A;  3TP3 A;  2QKO A;  3G1L A;  3QPL A;  3HGG A;  2XDN A;  3GZI A;  3P9T A;  2ID6 A;  2RHA A;  3HTH A;  1ZKG A;  3SFI A;  5F1J A;  3CRJ A;  5GPC A;  2JK3 A;  3QPS A;  2VKE A;  3HTJ A;  5IOZ A;  2FBQ A;  2XGD A;  4NN1 A;  3LJL A;  5D19 A;  1Z77 A;  3KKC A;  3VUQ A;  4V2F A;  4ACI A;  1U9N A;  3O60 A;  2G7G A;  3G1O A;  2OPT A;  1ORK A;  5H9T A;  4V2G A;  3BNI A;  3VVX A;  5D1R A;  2G0E A;  2NX4 A;  4DW6 A;  3FIW A;  2XPU A;  4AUX A;  2ZOZ A;  4M3E A;  4D7N A;  1QPI A;  1A6I A;  1JUS A;  2TCT A;  4I76 A;  3COL A;  3KKD A;  2ID3 A;  5EYR A;  3PPB A;  5F04 A;  4JL3 A;  3F0C A;  2NP5 A;  4MO7 A;  1JT6 A;  3RD3 A;  5IOY A;  4W1U A;  1RPW A;  4D7M A;  2ZCN A;  3B81 A;  5J1R A;  5GPA A;  4D5C A;  2ZB9 A;  4JKZ A;  2O7O A;  2UXI A;  3QBM A;  2UXO A;  3VOX A;  5HBU A;  3VPR A;  3BQY A;  2GFN A;  2GBY A;  3IUV A;  3DCF A;  3NXC A;  3HTA A;  3LSP A;  4M3D A;  2DTZ A;  5IP6 A;  2RAS A;  5DAJ A;  1RKW A;  3HIM A;  2HYT A;  1UI5 A;  3ANP A;  3NI7 A;  3ZQF A;  3VIB A;  3NNR A;  4X1E A;  3ZQH A;  3B6C A;  3HE0 A;  3C07 A;  1JTX A;  1BJZ A;  3GEU A;  4ICH A;  2UXP A;  2IBD A;  3PM1 A;  2Y30 A;  5F0F A;  5K7F A;  2NS7 A;  2HXI A;  2FJ1 A;  3QKX A;  3O8H A;  2V57 A;  3IH3 A;  2DG7 A;  1U9O A;  3QQA A;  5J3L A;  2IAI A;  3BR3 A;  2XPV A;  5J1U A;  1QVU A;  2G7S A;  3DPJ A;  3IH4 A;  4ME9 A;  5FKO A;  2WGB A;  4KWA A;  3VP5 A;  2PBX A;  2EH3 A;  5FGL A;  5K58 A;  3HTI A;  3KNW A;  1UI6 A;  4AC0 A;  2YVH A;  3Q3S A;  2IEK A;  2XPW A;  4ABZ A;  4L62 A;  1JUM A;  5HAW A;  3ZQI A;  2QIB A;  4MK6 A;  2YVE A;  2WV1 A;  2QTQ A;  2G3B A;  5F0C A;  3FK6 A;  2HKU A;  3BCG A;  3ON2 A;  3BTL A;  3E7Q A;  4GCL A;  3KZ9 A;  5EFY A;  5F08 A;  3BJB A;  3LOC A;  4YZE A;  1T33 A;  3FRQ A;  2ZOY A;  5FKN A;  1SGM A;  2XGE A;  3V6G A;  3G56 A;  4W97 A;  2XB5 A;  2HXO A;  2I10 A;  3BHQ A;  3AQS A;  3CWR A;  4G12 A;  2HYJ A;  3BT9 A;  3NRG A;  2TRT A;  3PAS A;  2QOP A;  5FKM A;  3VW0 A;  4D5F A;  1JUP A;  5D18 A;  2XGC A;  3ANG A;  3JSJ A;  3LWJ A;  2Y2Z A;  2F07 A;  3TP0 A;  4PXI A;  3MVP A;  2VPR A;  2OF7 A;  2ZCM A;  1JT0 A;  3Q0V A;  3S5R A;  3ON4 A;  4I6Z A;  5FHP A;  5K7H A;  2FQ4 A;  1Z0X A;  3Q0W A;  4HKU A;  4M3B A;  3ZQL A;  2WUI A;  3EUP A;  2JJ7 A;  3IH2 A;  1RKT A;  3BR1 A;  2Y31 A;  3T6N A;  4M3G A;  4GFL A;  3BR0 A;  3LSJ A;  4GFK A;  3LSR A;  3WHC A;  5CXG A;  2FX0 A;  2NS8 A;  3VVY A;  2X9D A;  3AQT A;  2DG8 A;  2X6O A;  3BR5 A;  2W53 A;  3C2B A;  5CXI A;  3VW2 A;  2GEN A;  4AF5 A;  2XRL A;  3DEW A;  4XK4 A;  2NP3 A;  5C4Y A;  3G7R A;  4GCK A;  1T56 A;  3G1M A;  2FD5 A;  3O8G A;  2O7T A;  3MNL A;  2QCO A;  1QVT A;  3LHQ A;  2OI8 A;  4CGR A;  3BTJ A;  5F27 A;  4AC6 A;  3B6A A;  2ZCX A;  3BQZ A;  2OER A;  4NEL A;  3RH2 A;  3CJD A;  5IPA A;  5AQC A;  3ZQG A;  3BTC A;  4B1R A;  1ZK8 A;  5FMP A;  3NPI A;  3BR2 A;  3BRU A;  3Q0U A;  4M3F A;  5J1Y A;  4JYK A;  5K7Z A;  4GCT A;  2VKV A;  2UXU A;  3FK7 A;  1JTY A;  5EZH A;  4MXM A;  5HSZ A; 
#chains in the Genus database with same CATH topology
 3VW1 A;  2RAE A;  2R7R A;  3CCY A;  2D6Y A;  3BR6 A;  4JNN A;  3WHB A;  2HQ5 A;  4UDS A;  5F0H A;  5GP9 A;  5FKL A;  5EZG A;  3V78 A;  3HGY A;  2G7L A;  2UXH A;  3F1B A;  3VVZ A;  2QWT A;  3CDL A;  4B3A A;  2GUH A;  5FKK A;  2REK A;  4U9L A;  4IRV A;  2IU5 A;  3SDG A;  2B3W A;  1VI0 A;  2R7O A;  3BTI A;  3EGQ A;  5CW8 A;  2PZ9 A;  3VOK A;  2Q24 A;  4C2M A;  3TP3 A;  2QKO A;  3G1L A;  3QPL A;  3HGG A;  2XDN A;  3GZI A;  3P9T A;  2ID6 A;  2RHA A;  3HTH A;  1ZKG A;  3VTI A;  3SFI A;  5F1J A;  3CRJ A;  5GPC A;  2JK3 A;  3QPS A;  2VKE A;  3HTJ A;  5IOZ A;  2FBQ A;  2XGD A;  4NN1 A;  3LJL A;  5D19 A;  1Z77 A;  3KKC A;  3VUQ A;  4V2F A;  4ACI A;  1U9N A;  3O60 A;  2G7G A;  3G1O A;  2OPT A;  2FJI 1;  1ORK A;  5H9T A;  4V2G A;  3BNI A;  3VVX A;  2B1E A;  5D1R A;  4DVY P;  2G0E A;  2NX4 A;  2R7S A;  4DW6 A;  3FIW A;  2XPU A;  4AUX A;  2ZOZ A;  4M3E A;  2R7W A;  4D7N A;  1QPI A;  1A6I A;  1JUS A;  2TCT A;  4I76 A;  3COL A;  3KKD A;  2ID3 A;  5EYR A;  3PPB A;  5F04 A;  4JL3 A;  3F0C A;  2NP5 A;  4MO7 A;  1JT6 A;  2R7T A;  3RD3 A;  5IOY A;  4W1U A;  1RPW A;  4D7M A;  2ZCN A;  3B81 A;  5J1R A;  5GPA A;  4D5C A;  2ZB9 A;  4JKZ A;  2O7O A;  2UXI A;  3QBM A;  2UXO A;  3VOX A;  5HBU A;  3VPR A;  3BQY A;  2GFN A;  2GBY A;  3IUV A;  3DCF A;  3NXC A;  3HTA A;  3LSP A;  4M3D A;  2DTZ A;  5IP6 A;  2RAS A;  5DAJ A;  1RKW A;  3HIM A;  2HYT A;  1UI5 A;  3ANP A;  3ZQF A;  3DU6 A;  3NI7 A;  3VIB A;  3NNR A;  4X1E A;  3ZQH A;  3B6C A;  3HE0 A;  3C07 A;  1JTX A;  2R7X A;  1BJZ A;  3GEU A;  4ICH A;  2UXP A;  2IBD A;  3FHN A;  3PM1 A;  2Y30 A;  5F0F A;  5K7F A;  2NS7 A;  2HXI A;  2FJ1 A;  3QKX A;  3O8H A;  2V57 A;  3DU5 A;  3IH3 A;  2DG7 A;  1U9O A;  3QQA A;  5J3L A;  2IAI A;  3BR3 A;  2XPV A;  5J1U A;  3KYL A;  1QVU A;  2G7S A;  3DPJ A;  3IH4 A;  4ME9 A;  5FKO A;  2WGB A;  4KWA A;  3VP5 A;  2PBX A;  2EH3 A;  5FGL A;  5K58 A;  3HTI A;  3KNW A;  1UI6 A;  4AC0 A;  2YVH A;  3Q3S A;  2IEK A;  2XPW A;  4ABZ A;  4L62 A;  1JUM A;  5HAW A;  3ZQI A;  2QIB A;  4MK6 A;  2YVE A;  2WV1 A;  2QTQ A;  2G3B A;  2ZY9 A;  5F0C A;  3FK6 A;  2HKU A;  3BCG A;  3ON2 A;  3BTL A;  3E7Q A;  4GCL A;  3KZ9 A;  5EFY A;  5F08 A;  3BJB A;  3LOC A;  4YZE A;  4U9N A;  1T33 A;  3FRQ A;  2R7V A;  2ZOY A;  5FKN A;  1SGM A;  3NS4 A;  2XGE A;  3V6G A;  3G56 A;  4W97 A;  2XB5 A;  2HXO A;  2I10 A;  3BHQ A;  3AQS A;  3CWR A;  4G12 A;  2HYJ A;  3BT9 A;  3NRG A;  4OD4 A;  2TRT A;  3PAS A;  2QOP A;  5FKM A;  3VW0 A;  4D5F A;  1JUP A;  5D18 A;  2XGC A;  3ANG A;  3JSJ A;  3LWJ A;  2Y2Z A;  2F07 A;  3TP0 A;  4PXI A;  3MVP A;  2VPR A;  2OF7 A;  2ZCM A;  1JT0 A;  3Q0V A;  3S5R A;  3ON4 A;  4I6Z A;  5FHP A;  5K7H A;  2FQ4 A;  1Z0X A;  3Q0W A;  4HKU A;  4M3B A;  3ZQL A;  2WUI A;  3EUP A;  2JJ7 A;  3IH2 A;  2PFV A;  1RKT A;  3BR1 A;  2Y31 A;  3T6N A;  4M3G A;  4GFL A;  3BR0 A;  3LSJ A;  4GFK A;  3LSR A;  3WHC A;  2A2F X;  3SWH A;  5CXG A;  2FX0 A;  2NS8 A;  3VVY A;  2X9D A;  3AQT A;  2DG8 A;  2X6O A;  3BR5 A;  2W53 A;  3C2B A;  5CXI A;  3VW2 A;  3K8P C;  2GEN A;  4AF5 A;  2XRL A;  3DEW A;  4XK4 A;  2NP3 A;  2YVX A;  5C4Y A;  3G7R A;  4GCK A;  1T56 A;  3G1M A;  2FD5 A;  3O8G A;  2O7T A;  3MNL A;  4OD5 A;  2QCO A;  1QVT A;  3LHQ A;  2OI8 A;  4CGR A;  3BTJ A;  2R7U A;  5F27 A;  4AC6 A;  3B6A A;  2R7Q A;  5CQG A;  2ZCX A;  3BQZ A;  2OER A;  4WIB A;  4NEL A;  3RH2 A;  3CJD A;  5IPA A;  5AQC A;  3ZQG A;  3BTC A;  4B1R A;  1ZK8 A;  5FMP A;  3NPI A;  3BR2 A;  3BRU A;  3Q0U A;  4M3F A;  5J1Y A;  4JYK A;  5K7Z A;  4GCT A;  2VKV A;  2UXU A;  3FK7 A;  1JTY A;  5EZH A;  4MXM A;  5HSZ A; 
#chains in the Genus database with same CATH homology
 3VW1 A;  2RAE A;  3CCY A;  2D6Y A;  3BR6 A;  4JNN A;  3WHB A;  2HQ5 A;  4UDS A;  5F0H A;  5GP9 A;  5FKL A;  5EZG A;  3V78 A;  3HGY A;  2G7L A;  2UXH A;  3F1B A;  3VVZ A;  2QWT A;  3CDL A;  4B3A A;  2GUH A;  5FKK A;  2REK A;  2IU5 A;  3SDG A;  1VI0 A;  3BTI A;  3EGQ A;  5CW8 A;  2PZ9 A;  3VOK A;  2Q24 A;  3TP3 A;  2QKO A;  3G1L A;  3QPL A;  3HGG A;  2XDN A;  3GZI A;  3P9T A;  2ID6 A;  2RHA A;  3HTH A;  1ZKG A;  3SFI A;  5F1J A;  3CRJ A;  5GPC A;  2JK3 A;  3QPS A;  2VKE A;  3HTJ A;  5IOZ A;  2FBQ A;  2XGD A;  4NN1 A;  3LJL A;  5D19 A;  1Z77 A;  3KKC A;  3VUQ A;  4V2F A;  4ACI A;  1U9N A;  3O60 A;  2G7G A;  3G1O A;  2OPT A;  1ORK A;  5H9T A;  4V2G A;  3BNI A;  3VVX A;  5D1R A;  2G0E A;  2NX4 A;  4DW6 A;  3FIW A;  2XPU A;  4AUX A;  2ZOZ A;  4M3E A;  4D7N A;  1QPI A;  1A6I A;  1JUS A;  2TCT A;  4I76 A;  3COL A;  3KKD A;  2ID3 A;  5EYR A;  3PPB A;  5F04 A;  4JL3 A;  3F0C A;  2NP5 A;  4MO7 A;  1JT6 A;  3RD3 A;  5IOY A;  4W1U A;  1RPW A;  4D7M A;  2ZCN A;  3B81 A;  5J1R A;  5GPA A;  4D5C A;  2ZB9 A;  4JKZ A;  2O7O A;  2UXI A;  3QBM A;  2UXO A;  3VOX A;  5HBU A;  3VPR A;  3BQY A;  2GFN A;  2GBY A;  3IUV A;  3DCF A;  3NXC A;  3HTA A;  3LSP A;  4M3D A;  2DTZ A;  5IP6 A;  2RAS A;  5DAJ A;  1RKW A;  3HIM A;  2HYT A;  1UI5 A;  3ANP A;  3NI7 A;  3ZQF A;  3VIB A;  3NNR A;  4X1E A;  3ZQH A;  3B6C A;  3HE0 A;  3C07 A;  1JTX A;  1BJZ A;  3GEU A;  4ICH A;  2UXP A;  2IBD A;  3PM1 A;  2Y30 A;  5F0F A;  5K7F A;  2NS7 A;  2HXI A;  2FJ1 A;  3QKX A;  3O8H A;  2V57 A;  3IH3 A;  2DG7 A;  1U9O A;  3QQA A;  5J3L A;  2IAI A;  3BR3 A;  2XPV A;  5J1U A;  1QVU A;  2G7S A;  3DPJ A;  3IH4 A;  4ME9 A;  5FKO A;  2WGB A;  4KWA A;  3VP5 A;  2PBX A;  2EH3 A;  5FGL A;  5K58 A;  3HTI A;  3KNW A;  1UI6 A;  4AC0 A;  2YVH A;  3Q3S A;  2IEK A;  2XPW A;  4ABZ A;  4L62 A;  1JUM A;  5HAW A;  3ZQI A;  2QIB A;  4MK6 A;  2YVE A;  2WV1 A;  2QTQ A;  2G3B A;  5F0C A;  3FK6 A;  2HKU A;  3BCG A;  3ON2 A;  3BTL A;  3E7Q A;  4GCL A;  3KZ9 A;  5EFY A;  5F08 A;  3BJB A;  3LOC A;  4YZE A;  1T33 A;  3FRQ A;  2ZOY A;  5FKN A;  1SGM A;  2XGE A;  3V6G A;  3G56 A;  4W97 A;  2XB5 A;  2HXO A;  2I10 A;  3BHQ A;  3AQS A;  3CWR A;  4G12 A;  2HYJ A;  3BT9 A;  3NRG A;  2TRT A;  3PAS A;  2QOP A;  5FKM A;  3VW0 A;  4D5F A;  1JUP A;  5D18 A;  2XGC A;  3ANG A;  3JSJ A;  3LWJ A;  2Y2Z A;  2F07 A;  3TP0 A;  4PXI A;  3MVP A;  2VPR A;  2OF7 A;  2ZCM A;  1JT0 A;  3Q0V A;  3S5R A;  3ON4 A;  4I6Z A;  5FHP A;  5K7H A;  2FQ4 A;  1Z0X A;  3Q0W A;  4HKU A;  4M3B A;  3ZQL A;  2WUI A;  3EUP A;  2JJ7 A;  3IH2 A;  1RKT A;  3BR1 A;  2Y31 A;  3T6N A;  4M3G A;  4GFL A;  3BR0 A;  3LSJ A;  4GFK A;  3LSR A;  3WHC A;  5CXG A;  2FX0 A;  2NS8 A;  3VVY A;  2X9D A;  3AQT A;  2DG8 A;  2X6O A;  3BR5 A;  2W53 A;  3C2B A;  5CXI A;  3VW2 A;  2GEN A;  4AF5 A;  2XRL A;  3DEW A;  4XK4 A;  2NP3 A;  5C4Y A;  3G7R A;  4GCK A;  1T56 A;  3G1M A;  2FD5 A;  3O8G A;  2O7T A;  3MNL A;  2QCO A;  1QVT A;  3LHQ A;  2OI8 A;  4CGR A;  3BTJ A;  5F27 A;  4AC6 A;  3B6A A;  2ZCX A;  3BQZ A;  2OER A;  4NEL A;  3RH2 A;  3CJD A;  5IPA A;  5AQC A;  3ZQG A;  3BTC A;  4B1R A;  1ZK8 A;  5FMP A;  3NPI A;  3BR2 A;  3BRU A;  3Q0U A;  4M3F A;  5J1Y A;  4JYK A;  5K7Z A;  4GCT A;  2VKV A;  2UXU A;  3FK7 A;  1JTY A;  5EZH A;  4MXM A;  5HSZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...