3VOXA

X-ray crystal structure of wild type hrtr in the apo form
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
187
structure length
181
Chain Sequence
PKSTYFSLSDEKRNRVYDACLNEFQTHSFHEAKIMHIVKALDIPRGSFYQYFEDLKDAYFYVLSQETLEIHDLFFNLLKDNSIEESLDKYKYLLLENLIDSPQYKLYKYRFLDWTYELERDWKPQSSATDNPISQVLKSVVHNLVYRLFSENWTEKTFIENYDKEIKLVTEGLLNYITDRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator
publication title Structural Basis for the Transcriptional Regulation of Heme Homeostasis in Lactococcus lactis.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Transcription
total genus 62
structure length 181
sequence length 187
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3voxA00
3HGGA 4HKUA 4NELA 5EYRA 1BJZA 3LJLA 3WHBA 5FKNA 3HIMA 1JT6A 2QTQA 5EZGA 2O7TA 2IU5A 3ANPA 1UI6A 1JUPA 5CXIA 1JUMA 5F27A 2PBXA 4YZEA 3GEUA 5AQCA 2UXUA 2G7SA 3ON2A 3VW0A 3GZIA 4MXMA 3KNWA 2Q24A 3QQAA 3SFIA 3S5RA 4XK4A 3BR6A 3B6CA 2X9DA 4ICHA 2FD5A 5F04A 1ZKGA 5IPAA 4GFKA 4L62A 2UXHA 4PXIA 2I10A 2PZ9A 3B6AA 3EGQA 2JJ7A 2HYJA 2D6YA 3NRGA 2FJ1A 4I6ZA 3CWRA 3NPIA 5CW8A 1A6IA 2XGCA 2Y31A 3E7QA 5FKLA 3EUPA 4MK6A 4M3FA 3G7RA 3Q0UA 2XGEA 2W53A 4M3DA 5HSZA 1T56A 3VIBA 2UXIA 5J1RA 3BTCA 2TRTA 2UXOA 3ON4A 4AC0A 3G1LA 3Q0VA 4AUXA 3HTIA 2OF7A 2ID6A 3QBMA 2DTZA 3HTAA 2G3BA 2NS8A 2RASA 3Q0WA 5F0HA 4D5FA 4GCKA 5FKOA 5K7FA 3ZQFA 2ZCXA 2TCTA 3BTJA 2OPTA 3QPSA 3C2BA 2RAEA 2DG8A 2DG7A 4M3BA 3VOKA 3AQTA 1RPWA 3NNRA 2REKA 3BTLA 3FIWA 3F1BA 5K7HA 3SDGA 4GFLA 2RHAA 1Z77A 5D1RA 5GPAA 4V2GA 2XDNA 3IH4A 3IH3A 1ORKA 3BR5A 2ZOZA 3PM1A 1SGMA 2X6OA 3T6NA 3VUQA 4ME9A 2XPVA 4G12A 4JKZA 2OI8A 3HE0A 5J3LA 2ZB9A 2YVHA 3NXCA 2IEKA 4JYKA 3ZQIA 3BRUA 4MO7A 5F0CA 4JL3A 2QKOA 2NS7A 4D7NA 3PPBA 3PASA 1JUSA 3BR0A 1JTXA 2XPWA 5DAJA 2QIBA 3KZ9A 3LSPA 2XB5A 2Y2ZA 3O8HA 2NX4A 2V57A 4CGRA 5IOZA 2HKUA 1RKWA 1ZK8A 5EZHA 5D18A 4I76A 4ACIA 2HXOA 1QVTA 3COLA 3BQZA 3MVPA 2YVEA 5IP6A 5C4YA 5J1UA 4B1RA 5H9TA 4D7MA 3LSJA 3BR3A 4M3GA 3CRJA 2G7LA 5FMPA 2GUHA 2WV1A 2JK3A 3O60A 5F1JA 3TP3A 1JT0A 2QOPA 5K7ZA 3DPJA 3CDLA 3G1MA 1JTYA 5F0FA 4AF5A 3VP5A 4UDSA 1U9OA 3NI7A 3QPLA 3FRQA 3ANGA 4V2FA 3IUVA 3KKDA 2QWTA 4W97A 4ABZA 2G0EA 3VOXA 2VKVA 3HTHA 1UI5A 3O8GA 3BQYA 4B3AA 5J1YA 3HTJA 3IH2A 3Q3SA 1RKTA 3LOCA 3RH2A 3BT9A 2ZOYA 3BJBA 3CJDA 4GCLA 5FGLA 5IOYA 2Y30A 1VI0A 5HBUA 2XGDA 1QVUA 1T33A 3V6GA 2ZCMA 1U9NA 5K58A 3BR1A 2QCOA 2ID3A 3ZQGA 4JNNA 4GCTA 3C07A 3B81A 5FKMA 3VW1A 3VVZA 3HGYA 5D19A 3BTIA 2EH3A 5GP9A 5EFYA 4X1EA 3LSRA 2HYTA 2IBDA 3G1OA 2XPUA 3DEWA 3WHCA 2FBQA 2ZCNA 3KKCA 2NP3A 2WGBA 2VPRA 3V78A 4D5CA 3AQSA 3MNLA 2FQ4A 3LWJA 3BHQA 2VKEA 4KWAA 3LHQA 3JSJA 1QPIA 2WUIA 3BCGA 2GBYA 2F07A 2OERA 3BR2A 4M3EA 2G7GA 5GPCA 2HXIA 2IAIA 3VVXA 3TP0A 3FK6A 2GFNA 3VPRA 5F08A 2FX0A 3P9TA 3VVYA 3F0CA 4AC6A 3DCFA 3FK7A 4DW6A 2UXPA 3G56A 3ZQHA 2NP5A 3QKXA 3BNIA 2XRLA 5CXGA 2O7OA 3CCYA 5FHPA 3RD3A 3VW2A 4NN1A 4W1UA 2GENA 3ZQLA 1Z0XA 5FKKA 2HQ5A 5HAWA
chains in the Genus database with same CATH superfamily
3HGGA 4HKUA 4NELA 5EYRA 1BJZA 3LJLA 3WHBA 5FKNA 3HIMA 1JT6A 2QTQA 3K8PC 5EZGA 2O7TA 2IU5A 2R7RA 3ANPA 1UI6A 1JUPA 5CXIA 1JUMA 5F27A 2PBXA 4YZEA 3GEUA 5AQCA 2UXUA 2G7SA 3ON2A 3VW0A 3GZIA 4MXMA 3KNWA 2Q24A 3QQAA 3SFIA 3S5RA 4XK4A 3BR6A 3B6CA 2X9DA 4ICHA 3SWHA 2FD5A 5F04A 1ZKGA 5IPAA 4GFKA 4L62A 2UXHA 4PXIA 2I10A 2PZ9A 3B6AA 3EGQA 2JJ7A 2HYJA 2D6YA 3NRGA 2FJ1A 4I6ZA 3CWRA 3NPIA 5CW8A 1A6IA 2XGCA 2B3WA 2Y31A 3E7QA 5FKLA 3EUPA 4MK6A 3VTIA 4M3FA 3G7RA 3Q0UA 2PFVA 2R7VA 2XGEA 2R7OA 2W53A 4M3DA 5HSZA 1T56A 3VIBA 2UXIA 5J1RA 3BTCA 2TRTA 2UXOA 3ON4A 4AC0A 3G1LA 3Q0VA 4AUXA 4U9NA 3HTIA 2OF7A 2ID6A 3QBMA 2DTZA 3HTAA 2G3BA 2NS8A 2RASA 3Q0WA 2FJI1 2B1EA 5F0HA 4D5FA 4GCKA 5FKOA 5K7FA 3ZQFA 2ZCXA 2TCTA 4IRVA 3BTJA 2OPTA 3QPSA 3C2BA 2RAEA 2DG8A 2DG7A 4M3BA 3VOKA 3AQTA 1RPWA 3NNRA 2REKA 3BTLA 3FIWA 3F1BA 5K7HA 2R7QA 3SDGA 4GFLA 2RHAA 1Z77A 5D1RA 5GPAA 4V2GA 2XDNA 3IH4A 3IH3A 1ORKA 2R7XA 3BR5A 2ZOZA 3PM1A 1SGMA 3KYLA 2X6OA 3T6NA 3VUQA 4ME9A 2XPVA 4G12A 4JKZA 2OI8A 3HE0A 5J3LA 3DU5A 2ZB9A 2R7TA 2YVHA 3NXCA 2IEKA 4JYKA 3BRUA 4MO7A 5F0CA 3ZQIA 4JL3A 2QKOA 2NS7A 4D7NA 3PPBA 3PASA 1JUSA 3BR0A 1JTXA 2XPWA 5DAJA 2QIBA 3KZ9A 2ZY9A 3LSPA 2XB5A 2Y2ZA 3O8HA 2NX4A 2V57A 4CGRA 5IOZA 2HKUA 1RKWA 1ZK8A 5EZHA 5D18A 2R7SA 4I76A 4ACIA 2HXOA 1QVTA 3COLA 3BQZA 4C2MA 3MVPA 2YVEA 5IP6A 5C4YA 4WIBA 5J1UA 4B1RA 5H9TA 4D7MA 3LSJA 3BR3A 4M3GA 3CRJA 2G7LA 5FMPA 4U9LA 2GUHA 4OD5A 2WV1A 2JK3A 3O60A 2A2FX 5F1JA 3TP3A 1JT0A 2QOPA 5K7ZA 3DPJA 3CDLA 3G1MA 1JTYA 5F0FA 4AF5A 3VP5A 4UDSA 1U9OA 3NI7A 3QPLA 3FRQA 2R7WA 3ANGA 4V2FA 3IUVA 3KKDA 2QWTA 4W97A 4ABZA 2G0EA 3VOXA 2VKVA 3HTHA 1UI5A 3O8GA 3BQYA 4B3AA 5J1YA 3HTJA 3IH2A 3Q3SA 1RKTA 3LOCA 3RH2A 3BT9A 2ZOYA 3BJBA 3CJDA 4GCLA 5FGLA 3DU6A 5IOYA 2Y30A 1VI0A 5HBUA 2XGDA 1QVUA 2YVXA 1T33A 3V6GA 2ZCMA 1U9NA 5K58A 3BR1A 2QCOA 2ID3A 3ZQGA 4JNNA 4GCTA 3C07A 3B81A 5FKMA 3VW1A 3VVZA 3HGYA 5D19A 3BTIA 2EH3A 5GP9A 5EFYA 4X1EA 3LSRA 2HYTA 2IBDA 3G1OA 2R7UA 2XPUA 3DEWA 2FBQA 2ZCNA 3KKCA 3WHCA 2NP3A 2WGBA 2VPRA 3FHNA 5CQGA 3V78A 4D5CA 3AQSA 3MNLA 3NS4A 2FQ4A 3LWJA 3BHQA 2VKEA 4KWAA 3LHQA 3JSJA 1QPIA 4DVYP 2WUIA 3BCGA 2GBYA 2F07A 2OERA 3BR2A 4M3EA 2G7GA 5GPCA 2HXIA 2IAIA 3VVXA 3TP0A 3FK6A 2GFNA 5F08A 3VPRA 2FX0A 3P9TA 3VVYA 3F0CA 4AC6A 3DCFA 3FK7A 4DW6A 2UXPA 3G56A 3ZQHA 2NP5A 3QKXA 3BNIA 2XRLA 5CXGA 2O7OA 3CCYA 4OD4A 5FHPA 3RD3A 3VW2A 4NN1A 4W1UA 2GENA 3ZQLA 1Z0XA 5FKKA 2HQ5A 5HAWA
chains in the Genus database with same CATH topology
3HGGA 4HKUA 4NELA 5EYRA 1BJZA 3LJLA 3WHBA 5FKNA 3HIMA 1JT6A 2QTQA 5EZGA 2O7TA 2IU5A 3ANPA 1UI6A 1JUPA 5CXIA 1JUMA 5F27A 2PBXA 4YZEA 3GEUA 5AQCA 2UXUA 2G7SA 3ON2A 3VW0A 3GZIA 4MXMA 3KNWA 2Q24A 3QQAA 3SFIA 3S5RA 4XK4A 3BR6A 3B6CA 2X9DA 4ICHA 2FD5A 5F04A 1ZKGA 5IPAA 4GFKA 4L62A 2UXHA 4PXIA 2I10A 2PZ9A 3B6AA 3EGQA 2JJ7A 2HYJA 2D6YA 3NRGA 2FJ1A 4I6ZA 3CWRA 3NPIA 5CW8A 1A6IA 2XGCA 2Y31A 3E7QA 5FKLA 3EUPA 4MK6A 4M3FA 3G7RA 3Q0UA 2XGEA 2W53A 4M3DA 5HSZA 1T56A 3VIBA 2UXIA 5J1RA 3BTCA 2TRTA 2UXOA 3ON4A 4AC0A 3G1LA 3Q0VA 4AUXA 3HTIA 2OF7A 2ID6A 3QBMA 2DTZA 3HTAA 2G3BA 2NS8A 2RASA 3Q0WA 5F0HA 4D5FA 4GCKA 5FKOA 5K7FA 3ZQFA 2ZCXA 2TCTA 3BTJA 2OPTA 3QPSA 3C2BA 2RAEA 2DG8A 2DG7A 4M3BA 3VOKA 3AQTA 1RPWA 3NNRA 2REKA 3BTLA 3FIWA 3F1BA 5K7HA 3SDGA 4GFLA 2RHAA 1Z77A 5D1RA 5GPAA 4V2GA 2XDNA 3IH4A 3IH3A 1ORKA 3BR5A 2ZOZA 3PM1A 1SGMA 2X6OA 3T6NA 3VUQA 4ME9A 2XPVA 4G12A 4JKZA 2OI8A 3HE0A 5J3LA 2ZB9A 2YVHA 3NXCA 2IEKA 4JYKA 3ZQIA 3BRUA 4MO7A 5F0CA 4JL3A 2QKOA 2NS7A 4D7NA 3PPBA 3PASA 1JUSA 3BR0A 1JTXA 2XPWA 5DAJA 2QIBA 3KZ9A 3LSPA 2XB5A 2Y2ZA 3O8HA 2NX4A 2V57A 4CGRA 5IOZA 2HKUA 1RKWA 1ZK8A 5EZHA 5D18A 4I76A 4ACIA 2HXOA 1QVTA 3COLA 3BQZA 3MVPA 2YVEA 5IP6A 5C4YA 5J1UA 4B1RA 5H9TA 4D7MA 3LSJA 3BR3A 4M3GA 3CRJA 2G7LA 5FMPA 2GUHA 2WV1A 2JK3A 3O60A 5F1JA 3TP3A 1JT0A 2QOPA 5K7ZA 3DPJA 3CDLA 3G1MA 1JTYA 5F0FA 4AF5A 3VP5A 4UDSA 1U9OA 3NI7A 3QPLA 3FRQA 3ANGA 4V2FA 3IUVA 3KKDA 2QWTA 4W97A 4ABZA 2G0EA 3VOXA 2VKVA 3HTHA 1UI5A 3O8GA 3BQYA 4B3AA 5J1YA 3HTJA 3IH2A 3Q3SA 1RKTA 3LOCA 3RH2A 3BT9A 2ZOYA 3BJBA 3CJDA 4GCLA 5FGLA 5IOYA 2Y30A 1VI0A 5HBUA 2XGDA 1QVUA 1T33A 3V6GA 2ZCMA 1U9NA 5K58A 3BR1A 2QCOA 2ID3A 3ZQGA 4JNNA 4GCTA 3C07A 3B81A 5FKMA 3VW1A 3VVZA 3HGYA 5D19A 3BTIA 2EH3A 5GP9A 5EFYA 4X1EA 3LSRA 2HYTA 2IBDA 3G1OA 2XPUA 3DEWA 3WHCA 2FBQA 2ZCNA 3KKCA 2NP3A 2WGBA 2VPRA 3V78A 4D5CA 3AQSA 3MNLA 2FQ4A 3LWJA 3BHQA 2VKEA 4KWAA 3LHQA 3JSJA 1QPIA 2WUIA 3BCGA 2GBYA 2F07A 2OERA 3BR2A 4M3EA 2G7GA 5GPCA 2HXIA 2IAIA 3VVXA 3TP0A 3FK6A 2GFNA 3VPRA 5F08A 2FX0A 3P9TA 3VVYA 3F0CA 4AC6A 3DCFA 3FK7A 4DW6A 2UXPA 3G56A 3ZQHA 2NP5A 3QKXA 3BNIA 2XRLA 5CXGA 2O7OA 3CCYA 5FHPA 3RD3A 3VW2A 4NN1A 4W1UA 2GENA 3ZQLA 1Z0XA 5FKKA 2HQ5A 5HAWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HGG A;  4HKU A;  4NEL A;  5EYR A;  1BJZ A;  3LJL A;  3WHB A;  5FKN A;  3HIM A;  1JT6 A;  2QTQ A;  5EZG A;  2O7T A;  2IU5 A;  3ANP A;  1UI6 A;  1JUP A;  5CXI A;  1JUM A;  5F27 A;  2PBX A;  4YZE A;  3GEU A;  5AQC A;  2UXU A;  2G7S A;  3ON2 A;  3VW0 A;  3GZI A;  4MXM A;  3KNW A;  2Q24 A;  3QQA A;  3SFI A;  3S5R A;  4XK4 A;  3BR6 A;  3B6C A;  2X9D A;  4ICH A;  2FD5 A;  5F04 A;  1ZKG A;  5IPA A;  4GFK A;  4L62 A;  2UXH A;  4PXI A;  2I10 A;  2PZ9 A;  3B6A A;  3EGQ A;  2JJ7 A;  2HYJ A;  2D6Y A;  3NRG A;  2FJ1 A;  4I6Z A;  3CWR A;  3NPI A;  5CW8 A;  1A6I A;  2XGC A;  2Y31 A;  3E7Q A;  5FKL A;  3EUP A;  4MK6 A;  4M3F A;  3G7R A;  3Q0U A;  2XGE A;  2W53 A;  4M3D A;  5HSZ A;  1T56 A;  3VIB A;  2UXI A;  5J1R A;  3BTC A;  2TRT A;  2UXO A;  3ON4 A;  4AC0 A;  3G1L A;  3Q0V A;  4AUX A;  3HTI A;  2OF7 A;  2ID6 A;  3QBM A;  2DTZ A;  3HTA A;  2G3B A;  2NS8 A;  2RAS A;  3Q0W A;  5F0H A;  4D5F A;  4GCK A;  5FKO A;  5K7F A;  3ZQF A;  2ZCX A;  2TCT A;  3BTJ A;  2OPT A;  3QPS A;  3C2B A;  2RAE A;  2DG8 A;  2DG7 A;  4M3B A;  3VOK A;  3AQT A;  1RPW A;  3NNR A;  2REK A;  3BTL A;  3FIW A;  3F1B A;  5K7H A;  3SDG A;  4GFL A;  2RHA A;  1Z77 A;  5D1R A;  5GPA A;  4V2G A;  2XDN A;  3IH4 A;  3IH3 A;  1ORK A;  3BR5 A;  2ZOZ A;  3PM1 A;  1SGM A;  2X6O A;  3T6N A;  3VUQ A;  4ME9 A;  2XPV A;  4G12 A;  4JKZ A;  2OI8 A;  3HE0 A;  5J3L A;  2ZB9 A;  2YVH A;  3NXC A;  2IEK A;  4JYK A;  3ZQI A;  3BRU A;  4MO7 A;  5F0C A;  4JL3 A;  2QKO A;  2NS7 A;  4D7N A;  3PPB A;  3PAS A;  1JUS A;  3BR0 A;  1JTX A;  2XPW A;  5DAJ A;  2QIB A;  3KZ9 A;  3LSP A;  2XB5 A;  2Y2Z A;  3O8H A;  2NX4 A;  2V57 A;  4CGR A;  5IOZ A;  2HKU A;  1RKW A;  1ZK8 A;  5EZH A;  5D18 A;  4I76 A;  4ACI A;  2HXO A;  1QVT A;  3COL A;  3BQZ A;  3MVP A;  2YVE A;  5IP6 A;  5C4Y A;  5J1U A;  4B1R A;  5H9T A;  4D7M A;  3LSJ A;  3BR3 A;  4M3G A;  3CRJ A;  2G7L A;  5FMP A;  2GUH A;  2WV1 A;  2JK3 A;  3O60 A;  5F1J A;  3TP3 A;  1JT0 A;  2QOP A;  5K7Z A;  3DPJ A;  3CDL A;  3G1M A;  1JTY A;  5F0F A;  4AF5 A;  3VP5 A;  4UDS A;  1U9O A;  3NI7 A;  3QPL A;  3FRQ A;  3ANG A;  4V2F A;  3IUV A;  3KKD A;  2QWT A;  4W97 A;  4ABZ A;  2G0E A;  3VOX A;  2VKV A;  3HTH A;  1UI5 A;  3O8G A;  3BQY A;  4B3A A;  5J1Y A;  3HTJ A;  3IH2 A;  3Q3S A;  1RKT A;  3LOC A;  3RH2 A;  3BT9 A;  2ZOY A;  3BJB A;  3CJD A;  4GCL A;  5FGL A;  5IOY A;  2Y30 A;  1VI0 A;  5HBU A;  2XGD A;  1QVU A;  1T33 A;  3V6G A;  2ZCM A;  1U9N A;  5K58 A;  3BR1 A;  2QCO A;  2ID3 A;  3ZQG A;  4JNN A;  4GCT A;  3C07 A;  3B81 A;  5FKM A;  3VW1 A;  3VVZ A;  3HGY A;  5D19 A;  3BTI A;  2EH3 A;  5GP9 A;  5EFY A;  4X1E A;  3LSR A;  2HYT A;  2IBD A;  3G1O A;  2XPU A;  3DEW A;  3WHC A;  2FBQ A;  2ZCN A;  3KKC A;  2NP3 A;  2WGB A;  2VPR A;  3V78 A;  4D5C A;  3AQS A;  3MNL A;  2FQ4 A;  3LWJ A;  3BHQ A;  2VKE A;  4KWA A;  3LHQ A;  3JSJ A;  1QPI A;  2WUI A;  3BCG A;  2GBY A;  2F07 A;  2OER A;  3BR2 A;  4M3E A;  2G7G A;  5GPC A;  2HXI A;  2IAI A;  3VVX A;  3TP0 A;  3FK6 A;  2GFN A;  3VPR A;  5F08 A;  2FX0 A;  3P9T A;  3VVY A;  3F0C A;  4AC6 A;  3DCF A;  3FK7 A;  4DW6 A;  2UXP A;  3G56 A;  3ZQH A;  2NP5 A;  3QKX A;  3BNI A;  2XRL A;  5CXG A;  2O7O A;  3CCY A;  5FHP A;  3RD3 A;  3VW2 A;  4NN1 A;  4W1U A;  2GEN A;  3ZQL A;  1Z0X A;  5FKK A;  2HQ5 A;  5HAW A; 
#chains in the Genus database with same CATH topology
 3HGG A;  4HKU A;  4NEL A;  5EYR A;  1BJZ A;  3LJL A;  3WHB A;  5FKN A;  3HIM A;  1JT6 A;  2QTQ A;  3K8P C;  5EZG A;  2O7T A;  2IU5 A;  2R7R A;  3ANP A;  1UI6 A;  1JUP A;  5CXI A;  1JUM A;  5F27 A;  2PBX A;  4YZE A;  3GEU A;  5AQC A;  2UXU A;  2G7S A;  3ON2 A;  3VW0 A;  3GZI A;  4MXM A;  3KNW A;  2Q24 A;  3QQA A;  3SFI A;  3S5R A;  4XK4 A;  3BR6 A;  3B6C A;  2X9D A;  4ICH A;  3SWH A;  2FD5 A;  5F04 A;  1ZKG A;  5IPA A;  4GFK A;  4L62 A;  2UXH A;  4PXI A;  2I10 A;  2PZ9 A;  3B6A A;  3EGQ A;  2JJ7 A;  2HYJ A;  2D6Y A;  3NRG A;  2FJ1 A;  4I6Z A;  3CWR A;  3NPI A;  5CW8 A;  1A6I A;  2XGC A;  2B3W A;  2Y31 A;  3E7Q A;  5FKL A;  3EUP A;  4MK6 A;  3VTI A;  4M3F A;  3G7R A;  3Q0U A;  2PFV A;  2R7V A;  2XGE A;  2R7O A;  2W53 A;  4M3D A;  5HSZ A;  1T56 A;  3VIB A;  2UXI A;  5J1R A;  3BTC A;  2TRT A;  2UXO A;  3ON4 A;  4AC0 A;  3G1L A;  3Q0V A;  4AUX A;  4U9N A;  3HTI A;  2OF7 A;  2ID6 A;  3QBM A;  2DTZ A;  3HTA A;  2G3B A;  2NS8 A;  2RAS A;  3Q0W A;  2FJI 1;  2B1E A;  5F0H A;  4D5F A;  4GCK A;  5FKO A;  5K7F A;  3ZQF A;  2ZCX A;  2TCT A;  4IRV A;  3BTJ A;  2OPT A;  3QPS A;  3C2B A;  2RAE A;  2DG8 A;  2DG7 A;  4M3B A;  3VOK A;  3AQT A;  1RPW A;  3NNR A;  2REK A;  3BTL A;  3FIW A;  3F1B A;  5K7H A;  2R7Q A;  3SDG A;  4GFL A;  2RHA A;  1Z77 A;  5D1R A;  5GPA A;  4V2G A;  2XDN A;  3IH4 A;  3IH3 A;  1ORK A;  2R7X A;  3BR5 A;  2ZOZ A;  3PM1 A;  1SGM A;  3KYL A;  2X6O A;  3T6N A;  3VUQ A;  4ME9 A;  2XPV A;  4G12 A;  4JKZ A;  2OI8 A;  3HE0 A;  5J3L A;  3DU5 A;  2ZB9 A;  2R7T A;  2YVH A;  3NXC A;  2IEK A;  4JYK A;  3BRU A;  4MO7 A;  5F0C A;  3ZQI A;  4JL3 A;  2QKO A;  2NS7 A;  4D7N A;  3PPB A;  3PAS A;  1JUS A;  3BR0 A;  1JTX A;  2XPW A;  5DAJ A;  2QIB A;  3KZ9 A;  2ZY9 A;  3LSP A;  2XB5 A;  2Y2Z A;  3O8H A;  2NX4 A;  2V57 A;  4CGR A;  5IOZ A;  2HKU A;  1RKW A;  1ZK8 A;  5EZH A;  5D18 A;  2R7S A;  4I76 A;  4ACI A;  2HXO A;  1QVT A;  3COL A;  3BQZ A;  4C2M A;  3MVP A;  2YVE A;  5IP6 A;  5C4Y A;  4WIB A;  5J1U A;  4B1R A;  5H9T A;  4D7M A;  3LSJ A;  3BR3 A;  4M3G A;  3CRJ A;  2G7L A;  5FMP A;  4U9L A;  2GUH A;  4OD5 A;  2WV1 A;  2JK3 A;  3O60 A;  2A2F X;  5F1J A;  3TP3 A;  1JT0 A;  2QOP A;  5K7Z A;  3DPJ A;  3CDL A;  3G1M A;  1JTY A;  5F0F A;  4AF5 A;  3VP5 A;  4UDS A;  1U9O A;  3NI7 A;  3QPL A;  3FRQ A;  2R7W A;  3ANG A;  4V2F A;  3IUV A;  3KKD A;  2QWT A;  4W97 A;  4ABZ A;  2G0E A;  3VOX A;  2VKV A;  3HTH A;  1UI5 A;  3O8G A;  3BQY A;  4B3A A;  5J1Y A;  3HTJ A;  3IH2 A;  3Q3S A;  1RKT A;  3LOC A;  3RH2 A;  3BT9 A;  2ZOY A;  3BJB A;  3CJD A;  4GCL A;  5FGL A;  3DU6 A;  5IOY A;  2Y30 A;  1VI0 A;  5HBU A;  2XGD A;  1QVU A;  2YVX A;  1T33 A;  3V6G A;  2ZCM A;  1U9N A;  5K58 A;  3BR1 A;  2QCO A;  2ID3 A;  3ZQG A;  4JNN A;  4GCT A;  3C07 A;  3B81 A;  5FKM A;  3VW1 A;  3VVZ A;  3HGY A;  5D19 A;  3BTI A;  2EH3 A;  5GP9 A;  5EFY A;  4X1E A;  3LSR A;  2HYT A;  2IBD A;  3G1O A;  2R7U A;  2XPU A;  3DEW A;  2FBQ A;  2ZCN A;  3KKC A;  3WHC A;  2NP3 A;  2WGB A;  2VPR A;  3FHN A;  5CQG A;  3V78 A;  4D5C A;  3AQS A;  3MNL A;  3NS4 A;  2FQ4 A;  3LWJ A;  3BHQ A;  2VKE A;  4KWA A;  3LHQ A;  3JSJ A;  1QPI A;  4DVY P;  2WUI A;  3BCG A;  2GBY A;  2F07 A;  2OER A;  3BR2 A;  4M3E A;  2G7G A;  5GPC A;  2HXI A;  2IAI A;  3VVX A;  3TP0 A;  3FK6 A;  2GFN A;  5F08 A;  3VPR A;  2FX0 A;  3P9T A;  3VVY A;  3F0C A;  4AC6 A;  3DCF A;  3FK7 A;  4DW6 A;  2UXP A;  3G56 A;  3ZQH A;  2NP5 A;  3QKX A;  3BNI A;  2XRL A;  5CXG A;  2O7O A;  3CCY A;  4OD4 A;  5FHP A;  3RD3 A;  3VW2 A;  4NN1 A;  4W1U A;  2GEN A;  3ZQL A;  1Z0X A;  5FKK A;  2HQ5 A;  5HAW A; 
#chains in the Genus database with same CATH homology
 3HGG A;  4HKU A;  4NEL A;  5EYR A;  1BJZ A;  3LJL A;  3WHB A;  5FKN A;  3HIM A;  1JT6 A;  2QTQ A;  5EZG A;  2O7T A;  2IU5 A;  3ANP A;  1UI6 A;  1JUP A;  5CXI A;  1JUM A;  5F27 A;  2PBX A;  4YZE A;  3GEU A;  5AQC A;  2UXU A;  2G7S A;  3ON2 A;  3VW0 A;  3GZI A;  4MXM A;  3KNW A;  2Q24 A;  3QQA A;  3SFI A;  3S5R A;  4XK4 A;  3BR6 A;  3B6C A;  2X9D A;  4ICH A;  2FD5 A;  5F04 A;  1ZKG A;  5IPA A;  4GFK A;  4L62 A;  2UXH A;  4PXI A;  2I10 A;  2PZ9 A;  3B6A A;  3EGQ A;  2JJ7 A;  2HYJ A;  2D6Y A;  3NRG A;  2FJ1 A;  4I6Z A;  3CWR A;  3NPI A;  5CW8 A;  1A6I A;  2XGC A;  2Y31 A;  3E7Q A;  5FKL A;  3EUP A;  4MK6 A;  4M3F A;  3G7R A;  3Q0U A;  2XGE A;  2W53 A;  4M3D A;  5HSZ A;  1T56 A;  3VIB A;  2UXI A;  5J1R A;  3BTC A;  2TRT A;  2UXO A;  3ON4 A;  4AC0 A;  3G1L A;  3Q0V A;  4AUX A;  3HTI A;  2OF7 A;  2ID6 A;  3QBM A;  2DTZ A;  3HTA A;  2G3B A;  2NS8 A;  2RAS A;  3Q0W A;  5F0H A;  4D5F A;  4GCK A;  5FKO A;  5K7F A;  3ZQF A;  2ZCX A;  2TCT A;  3BTJ A;  2OPT A;  3QPS A;  3C2B A;  2RAE A;  2DG8 A;  2DG7 A;  4M3B A;  3VOK A;  3AQT A;  1RPW A;  3NNR A;  2REK A;  3BTL A;  3FIW A;  3F1B A;  5K7H A;  3SDG A;  4GFL A;  2RHA A;  1Z77 A;  5D1R A;  5GPA A;  4V2G A;  2XDN A;  3IH4 A;  3IH3 A;  1ORK A;  3BR5 A;  2ZOZ A;  3PM1 A;  1SGM A;  2X6O A;  3T6N A;  3VUQ A;  4ME9 A;  2XPV A;  4G12 A;  4JKZ A;  2OI8 A;  3HE0 A;  5J3L A;  2ZB9 A;  2YVH A;  3NXC A;  2IEK A;  4JYK A;  3ZQI A;  3BRU A;  4MO7 A;  5F0C A;  4JL3 A;  2QKO A;  2NS7 A;  4D7N A;  3PPB A;  3PAS A;  1JUS A;  3BR0 A;  1JTX A;  2XPW A;  5DAJ A;  2QIB A;  3KZ9 A;  3LSP A;  2XB5 A;  2Y2Z A;  3O8H A;  2NX4 A;  2V57 A;  4CGR A;  5IOZ A;  2HKU A;  1RKW A;  1ZK8 A;  5EZH A;  5D18 A;  4I76 A;  4ACI A;  2HXO A;  1QVT A;  3COL A;  3BQZ A;  3MVP A;  2YVE A;  5IP6 A;  5C4Y A;  5J1U A;  4B1R A;  5H9T A;  4D7M A;  3LSJ A;  3BR3 A;  4M3G A;  3CRJ A;  2G7L A;  5FMP A;  2GUH A;  2WV1 A;  2JK3 A;  3O60 A;  5F1J A;  3TP3 A;  1JT0 A;  2QOP A;  5K7Z A;  3DPJ A;  3CDL A;  3G1M A;  1JTY A;  5F0F A;  4AF5 A;  3VP5 A;  4UDS A;  1U9O A;  3NI7 A;  3QPL A;  3FRQ A;  3ANG A;  4V2F A;  3IUV A;  3KKD A;  2QWT A;  4W97 A;  4ABZ A;  2G0E A;  3VOX A;  2VKV A;  3HTH A;  1UI5 A;  3O8G A;  3BQY A;  4B3A A;  5J1Y A;  3HTJ A;  3IH2 A;  3Q3S A;  1RKT A;  3LOC A;  3RH2 A;  3BT9 A;  2ZOY A;  3BJB A;  3CJD A;  4GCL A;  5FGL A;  5IOY A;  2Y30 A;  1VI0 A;  5HBU A;  2XGD A;  1QVU A;  1T33 A;  3V6G A;  2ZCM A;  1U9N A;  5K58 A;  3BR1 A;  2QCO A;  2ID3 A;  3ZQG A;  4JNN A;  4GCT A;  3C07 A;  3B81 A;  5FKM A;  3VW1 A;  3VVZ A;  3HGY A;  5D19 A;  3BTI A;  2EH3 A;  5GP9 A;  5EFY A;  4X1E A;  3LSR A;  2HYT A;  2IBD A;  3G1O A;  2XPU A;  3DEW A;  3WHC A;  2FBQ A;  2ZCN A;  3KKC A;  2NP3 A;  2WGB A;  2VPR A;  3V78 A;  4D5C A;  3AQS A;  3MNL A;  2FQ4 A;  3LWJ A;  3BHQ A;  2VKE A;  4KWA A;  3LHQ A;  3JSJ A;  1QPI A;  2WUI A;  3BCG A;  2GBY A;  2F07 A;  2OER A;  3BR2 A;  4M3E A;  2G7G A;  5GPC A;  2HXI A;  2IAI A;  3VVX A;  3TP0 A;  3FK6 A;  2GFN A;  3VPR A;  5F08 A;  2FX0 A;  3P9T A;  3VVY A;  3F0C A;  4AC6 A;  3DCF A;  3FK7 A;  4DW6 A;  2UXP A;  3G56 A;  3ZQH A;  2NP5 A;  3QKX A;  3BNI A;  2XRL A;  5CXG A;  2O7O A;  3CCY A;  5FHP A;  3RD3 A;  3VW2 A;  4NN1 A;  4W1U A;  2GEN A;  3ZQL A;  1Z0X A;  5FKK A;  2HQ5 A;  5HAW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...