3VOXA

X-ray crystal structure of wild type hrtr in the apo form
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
187
structure length
181
Chain Sequence
PKSTYFSLSDEKRNRVYDACLNEFQTHSFHEAKIMHIVKALDIPRGSFYQYFEDLKDAYFYVLSQETLEIHDLFFNLLKDNSIEESLDKYKYLLLENLIDSPQYKLYKYRFLDWTYELERDWKPQSSATDNPISQVLKSVVHNLVYRLFSENWTEKTFIENYDKEIKLVTEGLLNYITDRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Transcriptional regulator
publication title Structural Basis for the Transcriptional Regulation of Heme Homeostasis in Lactococcus lactis.
pubmed doi rcsb
source organism Lactococcus lactis
total genus 62
structure length 181
sequence length 187
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3voxA00
4I76A 1QVUA 2HYTA 4CGRA 3G1MA 1SGMA 2JK3A 3VUQA 3HGYA 2OF7A 3CWRA 3IH2A 5J1YA 5J1UA 3EUPA 1RPWA 4JKZA 3MVPA 3BR2A 3QPLA 3IH4A 5F04A 3KKCA 2FQ4A 3FK6A 2UXPA 2XDNA 4AF5A 3LSPA 2I10A 2IBDA 5EYRA 3HTIA 3DCFA 3SFIA 2V57A 2QKOA 3TP0A 1A6IA 4XK4A 5F1JA 3G1LA 2GUHA 1UI6A 2VKEA 2O7OA 2DG7A 2DG8A 3QKXA 3LSRA 3RD3A 5FKNA 1JTXA 3QPSA 5FKMA 4W97A 1T56A 5J3LA 3BRUA 2XB5A 1JT6A 3VIBA 4D5FA 4PXIA 4M3EA 4V2FA 2NP5A 2ZB9A 5EFYA 5IP6A 5H9TA 2HXIA 3C2BA 3ZQFA 5F0CA 4AUXA 3Q0WA 5D18A 3ON2A 5DAJA 3IUVA 3V78A 4L62A 3V6GA 2NX4A 3ZQLA 3WHCA 2RASA 2REKA 5K7ZA 3LHQA 5F0HA 3BR0A 3B6CA 3QBMA 2Y2ZA 2IEKA 3CRJA 3G1OA 3BCGA 3BT9A 2X9DA 3BQYA 2VPRA 4ACIA 3S5RA 2GENA 1BJZA 2PBXA 5FHPA 5HAWA 3RH2A 5IPAA 2NP3A 2EH3A 3F1BA 1JUSA 4NN1A 2FD5A 3HTHA 4X1EA 3LSJA 1QVTA 3CDLA 2ZOYA 2FJ1A 3AQSA 1U9OA 3ANGA 5IOZA 4MO7A 5F08A 2HQ5A 3DEWA 2HYJA 3T6NA 4AC6A 2YVHA 3Q0UA 3ZQHA 3QQAA 2D6YA 3HTJA 2XRLA 5F0FA 2TCTA 4G12A 3NRGA 2XPVA 3BNIA 3FK7A 3WHBA 3O8GA 3IH3A 3EGQA 3KZ9A 5FKLA 3VOXA 3VVXA 2ZCMA 4JYKA 5K58A 2ID6A 2VKVA 2XGEA 2QWTA 5F27A 3NNRA 1JTYA 5EZGA 2GFNA 1QPIA 3BTIA 4UDSA 4DW6A 3BQZA 5FMPA 3BR6A 4GFLA 2UXUA 5CXGA 2ZCXA 2QOPA 1ZK8A 3MNLA 1U9NA 5GP9A 3B81A 3VOKA 4W1UA 2QCOA 2ZOZA 2IAIA 5CXIA 5K7FA 5HBUA 3JSJA 3CCYA 5FKOA 2F07A 1Z0XA 3SDGA 1UI5A 2FBQA 2YVEA 3DPJA 3FIWA 3G56A 3LWJA 4B1RA 4NELA 2Y30A 2OI8A 3Q3SA 2OPTA 2UXHA 3LJLA 4M3GA 2NS8A 3PASA 3E7QA 2XGCA 2WUIA 3AQTA 2TRTA 4YZEA 3KNWA 3BR5A 2UXOA 2QTQA 3PM1A 3BTLA 3KKDA 3ZQGA 2WV1A 5GPCA 2FX0A 5EZHA 3G7RA 3VVYA 4GCTA 4D7NA 2RHAA 5CW8A 1JT0A 1RKWA 2XGDA 3BR1A 4GCLA 3O60A 3BHQA 5K7HA 3NI7A 4MXMA 2X6OA 3HIMA 4AC0A 5D19A 3BTJA 3COLA 3F0CA 5AQCA 5J1RA 1JUMA 2W53A 2G0EA 3NPIA 3LOCA 4B3AA 3GEUA 5FKKA 3VVZA 4I6ZA 4MK6A 3BJBA 3FRQA 5FGLA 4JNNA 5IOYA 2XPUA 3HTAA 3B6AA 3BR3A 2Q24A 3VW2A 2QIBA 3PPBA 2PZ9A 2G7SA 2WGBA 2OERA 3BTCA 2G7GA 1ORKA 4D5CA 1Z77A 3VW0A 2HKUA 2Y31A 2G3BA 3HGGA 3C07A 3VP5A 4M3BA 4V2GA 2GBYA 4ABZA 4ME9A 4M3FA 2O7TA 2XPWA 2DTZA 3ON4A 3Q0VA 3P9TA 1ZKGA 2ZCNA 3ANPA 3CJDA 5C4YA 2JJ7A 5HSZA 4GFKA 4JL3A 1T33A 2UXIA 4M3DA 2G7LA 5GPAA 3TP3A 3HE0A 2HXOA 2RAEA 2NS7A 2ID3A 3O8HA 1VI0A 4GCKA 4ICHA 3VPRA 1JUPA 2IU5A 3NXCA 3ZQIA 1RKTA 5D1RA 3VW1A 4HKUA 4KWAA 3GZIA 4D7MA
chains in the Genus database with same CATH superfamily
4I76A 1QVUA 2A2FX 2HYTA 4CGRA 3G1MA 1SGMA 2JK3A 3VUQA 3HGYA 2OF7A 3CWRA 4U9NA 3IH2A 5J1YA 5J1UA 3EUPA 1RPWA 4JKZA 3MVPA 3BR2A 3QPLA 3IH4A 5F04A 3KKCA 2FQ4A 3FK6A 2UXPA 2XDNA 4AF5A 3LSPA 2I10A 2IBDA 5EYRA 3HTIA 2R7QA 3DCFA 3SFIA 2ZY9A 2V57A 2QKOA 3TP0A 1A6IA 4XK4A 5F1JA 3FHNA 3G1LA 2GUHA 1UI6A 2VKEA 2O7OA 2DG7A 2DG8A 3QKXA 3LSRA 3RD3A 4IRVA 5FKNA 1JTXA 3QPSA 5FKMA 4W97A 1T56A 5J3LA 3BRUA 2XB5A 1JT6A 4WIBA 3VIBA 4D5FA 4PXIA 4M3EA 4V2FA 2NP5A 2ZB9A 5EFYA 5IP6A 5H9TA 2HXIA 3C2BA 3ZQFA 2R7WA 5F0CA 4AUXA 3Q0WA 5D18A 2PFVA 3ON2A 5DAJA 3IUVA 3V78A 4L62A 2R7XA 3V6GA 2NX4A 3ZQLA 3WHCA 2RASA 2REKA 5K7ZA 4U9LA 3LHQA 5F0HA 3BR0A 3B6CA 3NS4A 3QBMA 2Y2ZA 2IEKA 3CRJA 3G1OA 3BCGA 3BT9A 2X9DA 3BQYA 2VPRA 4ACIA 3S5RA 2GENA 1BJZA 2PBXA 5FHPA 5HAWA 3RH2A 4DVYP 5IPAA 2NP3A 2EH3A 3F1BA 1JUSA 2B1EA 4NN1A 4OD5A 2FD5A 3HTHA 4X1EA 3LSJA 1QVTA 3CDLA 2ZOYA 2FJ1A 3AQSA 1U9OA 3ANGA 5IOZA 4MO7A 5F08A 2HQ5A 3DEWA 2HYJA 3K8PC 3T6NA 4AC6A 2YVHA 3Q0UA 3ZQHA 3QQAA 2D6YA 3HTJA 5F0FA 2XRLA 2TCTA 4G12A 3NRGA 2XPVA 3BNIA 3FK7A 3WHBA 3O8GA 3IH3A 3EGQA 3KZ9A 5FKLA 3VOXA 3VVXA 2ZCMA 4JYKA 5K58A 2ID6A 2VKVA 2XGEA 2QWTA 3DU5A 5F27A 3NNRA 1JTYA 5EZGA 2GFNA 1QPIA 3BTIA 4UDSA 4DW6A 3BQZA 5FMPA 3BR6A 4GFLA 2UXUA 5CXGA 2ZCXA 2QOPA 1ZK8A 5CQGA 3MNLA 1U9NA 5GP9A 2R7TA 3B81A 3VOKA 4W1UA 2QCOA 2ZOZA 2IAIA 5CXIA 5K7FA 5HBUA 3JSJA 3CCYA 5FKOA 2F07A 1Z0XA 3SDGA 1UI5A 2FBQA 2YVEA 3DPJA 3FIWA 3G56A 3LWJA 3VTIA 4B1RA 4NELA 2Y30A 2R7RA 2OI8A 3Q3SA 2OPTA 2UXHA 3LJLA 4M3GA 2R7OA 2NS8A 3PASA 3E7QA 2XGCA 2WUIA 3AQTA 2TRTA 4YZEA 3KNWA 3BR5A 2UXOA 3SWHA 2QTQA 3PM1A 3BTLA 3KKDA 3ZQGA 2WV1A 2B3WA 5GPCA 2FX0A 5EZHA 3G7RA 3VVYA 4GCTA 4D7NA 2RHAA 5CW8A 1JT0A 1RKWA 2XGDA 3BR1A 4GCLA 3O60A 3BHQA 5K7HA 3NI7A 4MXMA 2X6OA 3HIMA 4AC0A 5D19A 3BTJA 3COLA 3F0CA 5AQCA 5J1RA 1JUMA 2W53A 2G0EA 4OD4A 3NPIA 2R7SA 3LOCA 4B3AA 3GEUA 5FKKA 3VVZA 4I6ZA 4MK6A 3BJBA 3FRQA 5FGLA 4JNNA 5IOYA 2XPUA 3HTAA 3B6AA 3BR3A 2Q24A 3VW2A 2QIBA 4C2MA 3PPBA 2PZ9A 2G7SA 2WGBA 2OERA 3BTCA 2G7GA 2YVXA 1ORKA 4D5CA 1Z77A 3VW0A 2HKUA 2Y31A 2G3BA 3HGGA 3C07A 3VP5A 4M3BA 4V2GA 2GBYA 4ABZA 4ME9A 4M3FA 2O7TA 2XPWA 2DTZA 3ON4A 3Q0VA 3P9TA 1ZKGA 3DU6A 2ZCNA 3ANPA 3CJDA 5C4YA 2JJ7A 5HSZA 3KYLA 4GFKA 4JL3A 2FJI1 2R7VA 1T33A 2UXIA 4M3DA 2G7LA 5GPAA 3TP3A 3HE0A 2HXOA 2RAEA 2NS7A 2ID3A 3O8HA 1VI0A 4GCKA 4ICHA 3VPRA 1JUPA 2IU5A 3NXCA 1RKTA 5D1RA 3VW1A 3ZQIA 4HKUA 4KWAA 3GZIA 4D7MA 2R7UA
chains in the Genus database with same CATH topology
4I76A 1QVUA 2HYTA 4CGRA 3G1MA 1SGMA 2JK3A 3VUQA 3HGYA 2OF7A 3CWRA 3IH2A 5J1YA 5J1UA 3EUPA 1RPWA 4JKZA 3MVPA 3BR2A 3QPLA 3IH4A 5F04A 3KKCA 2FQ4A 3FK6A 2UXPA 2XDNA 4AF5A 3LSPA 2I10A 2IBDA 5EYRA 3HTIA 3DCFA 3SFIA 2V57A 2QKOA 3TP0A 1A6IA 4XK4A 5F1JA 3G1LA 2GUHA 1UI6A 2VKEA 2O7OA 2DG7A 2DG8A 3QKXA 3LSRA 3RD3A 5FKNA 1JTXA 3QPSA 5FKMA 4W97A 1T56A 5J3LA 3BRUA 2XB5A 1JT6A 3VIBA 4D5FA 4PXIA 4M3EA 4V2FA 2NP5A 2ZB9A 5EFYA 5IP6A 5H9TA 2HXIA 3C2BA 3ZQFA 5F0CA 4AUXA 3Q0WA 5D18A 3ON2A 5DAJA 3IUVA 3V78A 4L62A 3V6GA 2NX4A 3ZQLA 3WHCA 2RASA 2REKA 5K7ZA 3LHQA 5F0HA 3BR0A 3B6CA 3QBMA 2Y2ZA 2IEKA 3CRJA 3G1OA 3BCGA 3BT9A 2X9DA 3BQYA 2VPRA 4ACIA 3S5RA 2GENA 1BJZA 2PBXA 5FHPA 5HAWA 3RH2A 5IPAA 2NP3A 2EH3A 3F1BA 1JUSA 4NN1A 2FD5A 3HTHA 4X1EA 3LSJA 1QVTA 3CDLA 2ZOYA 2FJ1A 3AQSA 1U9OA 3ANGA 5IOZA 4MO7A 5F08A 2HQ5A 3DEWA 2HYJA 3T6NA 4AC6A 2YVHA 3Q0UA 3ZQHA 3QQAA 2D6YA 3HTJA 2XRLA 5F0FA 2TCTA 4G12A 3NRGA 2XPVA 3BNIA 3FK7A 3WHBA 3O8GA 3IH3A 3EGQA 3KZ9A 5FKLA 3VOXA 3VVXA 2ZCMA 4JYKA 5K58A 2ID6A 2VKVA 2XGEA 2QWTA 5F27A 3NNRA 1JTYA 5EZGA 2GFNA 1QPIA 3BTIA 4UDSA 4DW6A 3BQZA 5FMPA 3BR6A 4GFLA 2UXUA 5CXGA 2ZCXA 2QOPA 1ZK8A 3MNLA 1U9NA 5GP9A 3B81A 3VOKA 4W1UA 2QCOA 2ZOZA 2IAIA 5CXIA 5K7FA 5HBUA 3JSJA 3CCYA 5FKOA 2F07A 1Z0XA 3SDGA 1UI5A 2FBQA 2YVEA 3DPJA 3FIWA 3G56A 3LWJA 4B1RA 4NELA 2Y30A 2OI8A 3Q3SA 2OPTA 2UXHA 3LJLA 4M3GA 2NS8A 3PASA 3E7QA 2XGCA 2WUIA 3AQTA 2TRTA 4YZEA 3KNWA 3BR5A 2UXOA 2QTQA 3PM1A 3BTLA 3KKDA 3ZQGA 2WV1A 5GPCA 2FX0A 5EZHA 3G7RA 3VVYA 4GCTA 4D7NA 2RHAA 5CW8A 1JT0A 1RKWA 2XGDA 3BR1A 4GCLA 3O60A 3BHQA 5K7HA 3NI7A 4MXMA 2X6OA 3HIMA 4AC0A 5D19A 3BTJA 3COLA 3F0CA 5AQCA 5J1RA 1JUMA 2W53A 2G0EA 3NPIA 3LOCA 4B3AA 3GEUA 5FKKA 3VVZA 4I6ZA 4MK6A 3BJBA 3FRQA 5FGLA 4JNNA 5IOYA 2XPUA 3HTAA 3B6AA 3BR3A 2Q24A 3VW2A 2QIBA 3PPBA 2PZ9A 2G7SA 2WGBA 2OERA 3BTCA 2G7GA 1ORKA 4D5CA 1Z77A 3VW0A 2HKUA 2Y31A 2G3BA 3HGGA 3C07A 3VP5A 4M3BA 4V2GA 2GBYA 4ABZA 4ME9A 4M3FA 2O7TA 2XPWA 2DTZA 3ON4A 3Q0VA 3P9TA 1ZKGA 2ZCNA 3ANPA 3CJDA 5C4YA 2JJ7A 5HSZA 4GFKA 4JL3A 1T33A 2UXIA 4M3DA 2G7LA 5GPAA 3TP3A 3HE0A 2HXOA 2RAEA 2NS7A 2ID3A 3O8HA 1VI0A 4GCKA 4ICHA 3VPRA 1JUPA 2IU5A 3NXCA 3ZQIA 1RKTA 5D1RA 3VW1A 4HKUA 4KWAA 3GZIA 4D7MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I76 A;  1QVU A;  2HYT A;  4CGR A;  3G1M A;  1SGM A;  2JK3 A;  3VUQ A;  3HGY A;  2OF7 A;  3CWR A;  3IH2 A;  5J1Y A;  5J1U A;  3EUP A;  1RPW A;  4JKZ A;  3MVP A;  3BR2 A;  3QPL A;  3IH4 A;  5F04 A;  3KKC A;  2FQ4 A;  3FK6 A;  2UXP A;  2XDN A;  4AF5 A;  3LSP A;  2I10 A;  2IBD A;  5EYR A;  3HTI A;  3DCF A;  3SFI A;  2V57 A;  2QKO A;  3TP0 A;  1A6I A;  4XK4 A;  5F1J A;  3G1L A;  2GUH A;  1UI6 A;  2VKE A;  2O7O A;  2DG7 A;  2DG8 A;  3QKX A;  3LSR A;  3RD3 A;  5FKN A;  1JTX A;  3QPS A;  5FKM A;  4W97 A;  1T56 A;  5J3L A;  3BRU A;  2XB5 A;  1JT6 A;  3VIB A;  4D5F A;  4PXI A;  4M3E A;  4V2F A;  2NP5 A;  2ZB9 A;  5EFY A;  5IP6 A;  5H9T A;  2HXI A;  3C2B A;  3ZQF A;  5F0C A;  4AUX A;  3Q0W A;  5D18 A;  3ON2 A;  5DAJ A;  3IUV A;  3V78 A;  4L62 A;  3V6G A;  2NX4 A;  3ZQL A;  3WHC A;  2RAS A;  2REK A;  5K7Z A;  3LHQ A;  5F0H A;  3BR0 A;  3B6C A;  3QBM A;  2Y2Z A;  2IEK A;  3CRJ A;  3G1O A;  3BCG A;  3BT9 A;  2X9D A;  3BQY A;  2VPR A;  4ACI A;  3S5R A;  2GEN A;  1BJZ A;  2PBX A;  5FHP A;  5HAW A;  3RH2 A;  5IPA A;  2NP3 A;  2EH3 A;  3F1B A;  1JUS A;  4NN1 A;  2FD5 A;  3HTH A;  4X1E A;  3LSJ A;  1QVT A;  3CDL A;  2ZOY A;  2FJ1 A;  3AQS A;  1U9O A;  3ANG A;  5IOZ A;  4MO7 A;  5F08 A;  2HQ5 A;  3DEW A;  2HYJ A;  3T6N A;  4AC6 A;  2YVH A;  3Q0U A;  3ZQH A;  3QQA A;  2D6Y A;  3HTJ A;  2XRL A;  5F0F A;  2TCT A;  4G12 A;  3NRG A;  2XPV A;  3BNI A;  3FK7 A;  3WHB A;  3O8G A;  3IH3 A;  3EGQ A;  3KZ9 A;  5FKL A;  3VOX A;  3VVX A;  2ZCM A;  4JYK A;  5K58 A;  2ID6 A;  2VKV A;  2XGE A;  2QWT A;  5F27 A;  3NNR A;  1JTY A;  5EZG A;  2GFN A;  1QPI A;  3BTI A;  4UDS A;  4DW6 A;  3BQZ A;  5FMP A;  3BR6 A;  4GFL A;  2UXU A;  5CXG A;  2ZCX A;  2QOP A;  1ZK8 A;  3MNL A;  1U9N A;  5GP9 A;  3B81 A;  3VOK A;  4W1U A;  2QCO A;  2ZOZ A;  2IAI A;  5CXI A;  5K7F A;  5HBU A;  3JSJ A;  3CCY A;  5FKO A;  2F07 A;  1Z0X A;  3SDG A;  1UI5 A;  2FBQ A;  2YVE A;  3DPJ A;  3FIW A;  3G56 A;  3LWJ A;  4B1R A;  4NEL A;  2Y30 A;  2OI8 A;  3Q3S A;  2OPT A;  2UXH A;  3LJL A;  4M3G A;  2NS8 A;  3PAS A;  3E7Q A;  2XGC A;  2WUI A;  3AQT A;  2TRT A;  4YZE A;  3KNW A;  3BR5 A;  2UXO A;  2QTQ A;  3PM1 A;  3BTL A;  3KKD A;  3ZQG A;  2WV1 A;  5GPC A;  2FX0 A;  5EZH A;  3G7R A;  3VVY A;  4GCT A;  4D7N A;  2RHA A;  5CW8 A;  1JT0 A;  1RKW A;  2XGD A;  3BR1 A;  4GCL A;  3O60 A;  3BHQ A;  5K7H A;  3NI7 A;  4MXM A;  2X6O A;  3HIM A;  4AC0 A;  5D19 A;  3BTJ A;  3COL A;  3F0C A;  5AQC A;  5J1R A;  1JUM A;  2W53 A;  2G0E A;  3NPI A;  3LOC A;  4B3A A;  3GEU A;  5FKK A;  3VVZ A;  4I6Z A;  4MK6 A;  3BJB A;  3FRQ A;  5FGL A;  4JNN A;  5IOY A;  2XPU A;  3HTA A;  3B6A A;  3BR3 A;  2Q24 A;  3VW2 A;  2QIB A;  3PPB A;  2PZ9 A;  2G7S A;  2WGB A;  2OER A;  3BTC A;  2G7G A;  1ORK A;  4D5C A;  1Z77 A;  3VW0 A;  2HKU A;  2Y31 A;  2G3B A;  3HGG A;  3C07 A;  3VP5 A;  4M3B A;  4V2G A;  2GBY A;  4ABZ A;  4ME9 A;  4M3F A;  2O7T A;  2XPW A;  2DTZ A;  3ON4 A;  3Q0V A;  3P9T A;  1ZKG A;  2ZCN A;  3ANP A;  3CJD A;  5C4Y A;  2JJ7 A;  5HSZ A;  4GFK A;  4JL3 A;  1T33 A;  2UXI A;  4M3D A;  2G7L A;  5GPA A;  3TP3 A;  3HE0 A;  2HXO A;  2RAE A;  2NS7 A;  2ID3 A;  3O8H A;  1VI0 A;  4GCK A;  4ICH A;  3VPR A;  1JUP A;  2IU5 A;  3NXC A;  3ZQI A;  1RKT A;  5D1R A;  3VW1 A;  4HKU A;  4KWA A;  3GZI A;  4D7M A; 
#chains in the Genus database with same CATH topology
 4I76 A;  1QVU A;  2A2F X;  2HYT A;  4CGR A;  3G1M A;  1SGM A;  2JK3 A;  3VUQ A;  3HGY A;  2OF7 A;  3CWR A;  4U9N A;  3IH2 A;  5J1Y A;  5J1U A;  3EUP A;  1RPW A;  4JKZ A;  3MVP A;  3BR2 A;  3QPL A;  3IH4 A;  5F04 A;  3KKC A;  2FQ4 A;  3FK6 A;  2UXP A;  2XDN A;  4AF5 A;  3LSP A;  2I10 A;  2IBD A;  5EYR A;  3HTI A;  2R7Q A;  3DCF A;  3SFI A;  2ZY9 A;  2V57 A;  2QKO A;  3TP0 A;  1A6I A;  4XK4 A;  5F1J A;  3FHN A;  3G1L A;  2GUH A;  1UI6 A;  2VKE A;  2O7O A;  2DG7 A;  2DG8 A;  3QKX A;  3LSR A;  3RD3 A;  4IRV A;  5FKN A;  1JTX A;  3QPS A;  5FKM A;  4W97 A;  1T56 A;  5J3L A;  3BRU A;  2XB5 A;  1JT6 A;  4WIB A;  3VIB A;  4D5F A;  4PXI A;  4M3E A;  4V2F A;  2NP5 A;  2ZB9 A;  5EFY A;  5IP6 A;  5H9T A;  2HXI A;  3C2B A;  3ZQF A;  2R7W A;  5F0C A;  4AUX A;  3Q0W A;  5D18 A;  2PFV A;  3ON2 A;  5DAJ A;  3IUV A;  3V78 A;  4L62 A;  2R7X A;  3V6G A;  2NX4 A;  3ZQL A;  3WHC A;  2RAS A;  2REK A;  5K7Z A;  4U9L A;  3LHQ A;  5F0H A;  3BR0 A;  3B6C A;  3NS4 A;  3QBM A;  2Y2Z A;  2IEK A;  3CRJ A;  3G1O A;  3BCG A;  3BT9 A;  2X9D A;  3BQY A;  2VPR A;  4ACI A;  3S5R A;  2GEN A;  1BJZ A;  2PBX A;  5FHP A;  5HAW A;  3RH2 A;  4DVY P;  5IPA A;  2NP3 A;  2EH3 A;  3F1B A;  1JUS A;  2B1E A;  4NN1 A;  4OD5 A;  2FD5 A;  3HTH A;  4X1E A;  3LSJ A;  1QVT A;  3CDL A;  2ZOY A;  2FJ1 A;  3AQS A;  1U9O A;  3ANG A;  5IOZ A;  4MO7 A;  5F08 A;  2HQ5 A;  3DEW A;  2HYJ A;  3K8P C;  3T6N A;  4AC6 A;  2YVH A;  3Q0U A;  3ZQH A;  3QQA A;  2D6Y A;  3HTJ A;  5F0F A;  2XRL A;  2TCT A;  4G12 A;  3NRG A;  2XPV A;  3BNI A;  3FK7 A;  3WHB A;  3O8G A;  3IH3 A;  3EGQ A;  3KZ9 A;  5FKL A;  3VOX A;  3VVX A;  2ZCM A;  4JYK A;  5K58 A;  2ID6 A;  2VKV A;  2XGE A;  2QWT A;  3DU5 A;  5F27 A;  3NNR A;  1JTY A;  5EZG A;  2GFN A;  1QPI A;  3BTI A;  4UDS A;  4DW6 A;  3BQZ A;  5FMP A;  3BR6 A;  4GFL A;  2UXU A;  5CXG A;  2ZCX A;  2QOP A;  1ZK8 A;  5CQG A;  3MNL A;  1U9N A;  5GP9 A;  2R7T A;  3B81 A;  3VOK A;  4W1U A;  2QCO A;  2ZOZ A;  2IAI A;  5CXI A;  5K7F A;  5HBU A;  3JSJ A;  3CCY A;  5FKO A;  2F07 A;  1Z0X A;  3SDG A;  1UI5 A;  2FBQ A;  2YVE A;  3DPJ A;  3FIW A;  3G56 A;  3LWJ A;  3VTI A;  4B1R A;  4NEL A;  2Y30 A;  2R7R A;  2OI8 A;  3Q3S A;  2OPT A;  2UXH A;  3LJL A;  4M3G A;  2R7O A;  2NS8 A;  3PAS A;  3E7Q A;  2XGC A;  2WUI A;  3AQT A;  2TRT A;  4YZE A;  3KNW A;  3BR5 A;  2UXO A;  3SWH A;  2QTQ A;  3PM1 A;  3BTL A;  3KKD A;  3ZQG A;  2WV1 A;  2B3W A;  5GPC A;  2FX0 A;  5EZH A;  3G7R A;  3VVY A;  4GCT A;  4D7N A;  2RHA A;  5CW8 A;  1JT0 A;  1RKW A;  2XGD A;  3BR1 A;  4GCL A;  3O60 A;  3BHQ A;  5K7H A;  3NI7 A;  4MXM A;  2X6O A;  3HIM A;  4AC0 A;  5D19 A;  3BTJ A;  3COL A;  3F0C A;  5AQC A;  5J1R A;  1JUM A;  2W53 A;  2G0E A;  4OD4 A;  3NPI A;  2R7S A;  3LOC A;  4B3A A;  3GEU A;  5FKK A;  3VVZ A;  4I6Z A;  4MK6 A;  3BJB A;  3FRQ A;  5FGL A;  4JNN A;  5IOY A;  2XPU A;  3HTA A;  3B6A A;  3BR3 A;  2Q24 A;  3VW2 A;  2QIB A;  4C2M A;  3PPB A;  2PZ9 A;  2G7S A;  2WGB A;  2OER A;  3BTC A;  2G7G A;  2YVX A;  1ORK A;  4D5C A;  1Z77 A;  3VW0 A;  2HKU A;  2Y31 A;  2G3B A;  3HGG A;  3C07 A;  3VP5 A;  4M3B A;  4V2G A;  2GBY A;  4ABZ A;  4ME9 A;  4M3F A;  2O7T A;  2XPW A;  2DTZ A;  3ON4 A;  3Q0V A;  3P9T A;  1ZKG A;  3DU6 A;  2ZCN A;  3ANP A;  3CJD A;  5C4Y A;  2JJ7 A;  5HSZ A;  3KYL A;  4GFK A;  4JL3 A;  2FJI 1;  2R7V A;  1T33 A;  2UXI A;  4M3D A;  2G7L A;  5GPA A;  3TP3 A;  3HE0 A;  2HXO A;  2RAE A;  2NS7 A;  2ID3 A;  3O8H A;  1VI0 A;  4GCK A;  4ICH A;  3VPR A;  1JUP A;  2IU5 A;  3NXC A;  1RKT A;  5D1R A;  3VW1 A;  3ZQI A;  4HKU A;  4KWA A;  3GZI A;  4D7M A;  2R7U A; 
#chains in the Genus database with same CATH homology
 4I76 A;  1QVU A;  2HYT A;  4CGR A;  3G1M A;  1SGM A;  2JK3 A;  3VUQ A;  3HGY A;  2OF7 A;  3CWR A;  3IH2 A;  5J1Y A;  5J1U A;  3EUP A;  1RPW A;  4JKZ A;  3MVP A;  3BR2 A;  3QPL A;  3IH4 A;  5F04 A;  3KKC A;  2FQ4 A;  3FK6 A;  2UXP A;  2XDN A;  4AF5 A;  3LSP A;  2I10 A;  2IBD A;  5EYR A;  3HTI A;  3DCF A;  3SFI A;  2V57 A;  2QKO A;  3TP0 A;  1A6I A;  4XK4 A;  5F1J A;  3G1L A;  2GUH A;  1UI6 A;  2VKE A;  2O7O A;  2DG7 A;  2DG8 A;  3QKX A;  3LSR A;  3RD3 A;  5FKN A;  1JTX A;  3QPS A;  5FKM A;  4W97 A;  1T56 A;  5J3L A;  3BRU A;  2XB5 A;  1JT6 A;  3VIB A;  4D5F A;  4PXI A;  4M3E A;  4V2F A;  2NP5 A;  2ZB9 A;  5EFY A;  5IP6 A;  5H9T A;  2HXI A;  3C2B A;  3ZQF A;  5F0C A;  4AUX A;  3Q0W A;  5D18 A;  3ON2 A;  5DAJ A;  3IUV A;  3V78 A;  4L62 A;  3V6G A;  2NX4 A;  3ZQL A;  3WHC A;  2RAS A;  2REK A;  5K7Z A;  3LHQ A;  5F0H A;  3BR0 A;  3B6C A;  3QBM A;  2Y2Z A;  2IEK A;  3CRJ A;  3G1O A;  3BCG A;  3BT9 A;  2X9D A;  3BQY A;  2VPR A;  4ACI A;  3S5R A;  2GEN A;  1BJZ A;  2PBX A;  5FHP A;  5HAW A;  3RH2 A;  5IPA A;  2NP3 A;  2EH3 A;  3F1B A;  1JUS A;  4NN1 A;  2FD5 A;  3HTH A;  4X1E A;  3LSJ A;  1QVT A;  3CDL A;  2ZOY A;  2FJ1 A;  3AQS A;  1U9O A;  3ANG A;  5IOZ A;  4MO7 A;  5F08 A;  2HQ5 A;  3DEW A;  2HYJ A;  3T6N A;  4AC6 A;  2YVH A;  3Q0U A;  3ZQH A;  3QQA A;  2D6Y A;  3HTJ A;  2XRL A;  5F0F A;  2TCT A;  4G12 A;  3NRG A;  2XPV A;  3BNI A;  3FK7 A;  3WHB A;  3O8G A;  3IH3 A;  3EGQ A;  3KZ9 A;  5FKL A;  3VOX A;  3VVX A;  2ZCM A;  4JYK A;  5K58 A;  2ID6 A;  2VKV A;  2XGE A;  2QWT A;  5F27 A;  3NNR A;  1JTY A;  5EZG A;  2GFN A;  1QPI A;  3BTI A;  4UDS A;  4DW6 A;  3BQZ A;  5FMP A;  3BR6 A;  4GFL A;  2UXU A;  5CXG A;  2ZCX A;  2QOP A;  1ZK8 A;  3MNL A;  1U9N A;  5GP9 A;  3B81 A;  3VOK A;  4W1U A;  2QCO A;  2ZOZ A;  2IAI A;  5CXI A;  5K7F A;  5HBU A;  3JSJ A;  3CCY A;  5FKO A;  2F07 A;  1Z0X A;  3SDG A;  1UI5 A;  2FBQ A;  2YVE A;  3DPJ A;  3FIW A;  3G56 A;  3LWJ A;  4B1R A;  4NEL A;  2Y30 A;  2OI8 A;  3Q3S A;  2OPT A;  2UXH A;  3LJL A;  4M3G A;  2NS8 A;  3PAS A;  3E7Q A;  2XGC A;  2WUI A;  3AQT A;  2TRT A;  4YZE A;  3KNW A;  3BR5 A;  2UXO A;  2QTQ A;  3PM1 A;  3BTL A;  3KKD A;  3ZQG A;  2WV1 A;  5GPC A;  2FX0 A;  5EZH A;  3G7R A;  3VVY A;  4GCT A;  4D7N A;  2RHA A;  5CW8 A;  1JT0 A;  1RKW A;  2XGD A;  3BR1 A;  4GCL A;  3O60 A;  3BHQ A;  5K7H A;  3NI7 A;  4MXM A;  2X6O A;  3HIM A;  4AC0 A;  5D19 A;  3BTJ A;  3COL A;  3F0C A;  5AQC A;  5J1R A;  1JUM A;  2W53 A;  2G0E A;  3NPI A;  3LOC A;  4B3A A;  3GEU A;  5FKK A;  3VVZ A;  4I6Z A;  4MK6 A;  3BJB A;  3FRQ A;  5FGL A;  4JNN A;  5IOY A;  2XPU A;  3HTA A;  3B6A A;  3BR3 A;  2Q24 A;  3VW2 A;  2QIB A;  3PPB A;  2PZ9 A;  2G7S A;  2WGB A;  2OER A;  3BTC A;  2G7G A;  1ORK A;  4D5C A;  1Z77 A;  3VW0 A;  2HKU A;  2Y31 A;  2G3B A;  3HGG A;  3C07 A;  3VP5 A;  4M3B A;  4V2G A;  2GBY A;  4ABZ A;  4ME9 A;  4M3F A;  2O7T A;  2XPW A;  2DTZ A;  3ON4 A;  3Q0V A;  3P9T A;  1ZKG A;  2ZCN A;  3ANP A;  3CJD A;  5C4Y A;  2JJ7 A;  5HSZ A;  4GFK A;  4JL3 A;  1T33 A;  2UXI A;  4M3D A;  2G7L A;  5GPA A;  3TP3 A;  3HE0 A;  2HXO A;  2RAE A;  2NS7 A;  2ID3 A;  3O8H A;  1VI0 A;  4GCK A;  4ICH A;  3VPR A;  1JUP A;  2IU5 A;  3NXC A;  3ZQI A;  1RKT A;  5D1R A;  3VW1 A;  4HKU A;  4KWA A;  3GZI A;  4D7M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...