3VOXA

X-ray crystal structure of wild type hrtr in the apo form
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
187
structure length
181
Chain Sequence
b'PKSTYFSLSDEKRNRVYDACLNEFQTHSFHEAKIMHIVKALDIPRGSFYQYFEDLKDAYFYVLSQETLEIHDLFFNLLKDNSIEESLDKYKYLLLENLIDSPQYKLYKYRFLDWTYELERDWKPQSSATDNPISQVLKSVVHNLVYRLFSENWTEKTFIENYDKEIKLVTEGLLNYITDRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator
publication title Structural Basis for the Transcriptional Regulation of Heme Homeostasis in Lactococcus lactis.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Transcription
total genus 62
structure length 181
sequence length 187
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3voxA00
1VI0A 2DG8A 4M3BA 3PPBA 2OPTA 2I10A 3FRQA 4I76A 3HGYA 3LWJA 2G7LA 3BT9A 5EYRA 5H9TA 1A6IA 2G3BA 4GFLA 3ZQHA 2RAEA 2XRLA 4GFKA 5IP6A 3T6NA 5HSZA 2HYTA 3BTJA 3KKCA 3VW2A 3LOCA 2GUHA 3G1LA 2O7TA 2VKEA 4GCTA 3ON2A 5IOZA 2QTQA 2X9DA 3BQZA 3CWRA 4JNNA 5FKMA 3BR1A 3FK7A 3CCYA 5FMPA 3LSJA 4AC6A 3JSJA 5J1YA 2NP3A 2XPWA 5FKNA 3Q0VA 3BTCA 3GEUA 3KNWA 5F0FA 2X6OA 2OF7A 3FIWA 5K7HA 2EH3A 5HBUA 2YVEA 5EZHA 2XGEA 2F07A 4ICHA 3QQAA 2G7GA 2FJ1A 2FX0A 2ZCNA 3TP3A 3VPRA 3BTLA 4G12A 4GCKA 1JUSA 4D7MA 5FGLA 4B1RA 4HKUA 2UXIA 2VKVA 5DAJA 5AQCA 3HTIA 2REKA 2OI8A 3VW1A 3RD3A 3VVYA 3ZQLA 3IH3A 2XGCA 3G56A 5EFYA 2HXIA 2RHAA 3VUQA 1QVTA 4MO7A 3ZQFA 2JK3A 5K7ZA 2DTZA 4AF5A 5D18A 2Y2ZA 3HIMA 4YZEA 2NP5A 5GPAA 4CGRA 3COLA 2UXOA 3DCFA 3O8GA 3Q0WA 3BR0A 4M3DA 2VPRA 3BTIA 3CDLA 5F0CA 3BR6A 1ORKA 2XPUA 2G0EA 3BCGA 2HYJA 2JJ7A 2IAIA 3IUVA 3B6CA 3CJDA 5FKOA 2OERA 2W53A 3ZQIA 2FBQA 5K7FA 3HE0A 2FD5A 4X1EA 3NNRA 2QIBA 5D19A 3AQTA 2GFNA 3P9TA 3BR2A 5K58A 3BRUA 2QOPA 5CW8A 3VW0A 3Q0UA 2D6YA 5J1UA 3BR3A 4GCLA 2YVHA 2UXUA 3BQYA 2TRTA 4XK4A 3HGGA 2NX4A 2QWTA 2ZCXA 3NPIA 4JL3A 2UXPA 2XDNA 2XGDA 3MVPA 2WGBA 3VIBA 4JKZA 5GP9A 3AQSA 5FKLA 1JTXA 4AC0A 1QPIA 4M3FA 4MXMA 1U9OA 3MNLA 3TP0A 2PBXA 3HTHA 4V2GA 3V6GA 4NN1A 3KKDA 5J3LA 2ZOYA 3G1OA 3BHQA 2HKUA 4V2FA 3SDGA 3LSPA 3C07A 3NRGA 3VOXA 5FKKA 3QPSA 4D5FA 3QPLA 3ANPA 3QKXA 1U9NA 2XB5A 3LHQA 3G1MA 3BR5A 2O7OA 3V78A 3F0CA 5EZGA 2ID6A 3BNIA 2NS7A 2ZCMA 3IH2A 2IU5A 2TCTA 1JTYA 2HQ5A 3S5RA 3C2BA 1RKTA 3E7QA 3DEWA 4KWAA 2HXOA 4B3AA 4AUXA 2QKOA 5J1RA 3SFIA 4PXIA 3PASA 2ID3A 3Q3SA 1RPWA 5F1JA 5F27A 2ZB9A 3WHCA 3CRJA 1UI5A 2IEKA 3QBMA 4ME9A 3LJLA 3F1BA 4ABZA 3G7RA 5F04A 3EUPA 3NXCA 5F08A 4I6ZA 1T56A 2ZOZA 4NELA 4UDSA 4L62A 2XPVA 2WUIA 2FQ4A 3NI7A 1ZKGA 4M3GA 5IPAA 4D7NA 4MK6A 2QCOA 5HAWA 4W1UA 5C4YA 3VP5A 2NS8A 5GPCA 5CXIA 3ANGA 1RKWA 2UXHA 3O8HA 1Z0XA 1UI6A 1Z77A 3DPJA 1SGMA 3RH2A 3VVXA 1QVUA 3WHBA 3ZQGA 2DG7A 4W97A 3HTAA 1BJZA 3B81A 3VVZA 1T33A 3KZ9A 5FHPA 1JT6A 3EGQA 2IBDA 3B6AA 3PM1A 5D1RA 3ON4A 5CXGA 3GZIA 4DW6A 2V57A 2Y31A 2RASA 1JT0A 2G7SA 3VOKA 2GENA 1ZK8A 2GBYA 3BJBA 3LSRA 1JUMA 5IOYA 2WV1A 3IH4A 3HTJA 1JUPA 4M3EA 5F0HA 2PZ9A 2Y30A 4ACIA 4JYKA 4D5CA 3O60A 3FK6A 2Q24A
chains in the Genus database with same CATH superfamily
1VI0A 2DG8A 4M3BA 3PPBA 2OPTA 2I10A 3FRQA 4I76A 3HGYA 3LWJA 2G7LA 3BT9A 5EYRA 5H9TA 1A6IA 2G3BA 4GFLA 2A2FX 2B1EA 3ZQHA 2RAEA 2XRLA 4GFKA 5IP6A 3T6NA 5HSZA 2HYTA 3BTJA 3KKCA 3VW2A 3LOCA 2GUHA 3G1LA 2O7TA 2VKEA 4GCTA 3ON2A 2FJI1 5IOZA 2QTQA 2X9DA 3BQZA 3CWRA 4JNNA 5FKMA 3BR1A 4OD4A 4WIBA 3FK7A 3CCYA 5FMPA 2R7UA 3LSJA 4AC6A 3JSJA 5J1YA 2NP3A 2XPWA 5FKNA 3Q0VA 3BTCA 3GEUA 3KNWA 5F0FA 2X6OA 2OF7A 3FIWA 5K7HA 2EH3A 5HBUA 2YVEA 4OD5A 5EZHA 2XGEA 2F07A 4ICHA 3QQAA 2G7GA 2FJ1A 2FX0A 2ZCNA 3TP3A 3VPRA 3BTLA 4G12A 4GCKA 1JUSA 4D7MA 5FGLA 4B1RA 4HKUA 2UXIA 2VKVA 5DAJA 5AQCA 3HTIA 2REKA 2OI8A 3VW1A 3RD3A 3VVYA 3ZQLA 3IH3A 2XGCA 3G56A 5EFYA 2HXIA 2RHAA 4IRVA 2R7XA 3VUQA 1QVTA 4MO7A 3SWHA 3ZQFA 2JK3A 5K7ZA 2R7QA 2DTZA 4AF5A 5D18A 2Y2ZA 3HIMA 2R7OA 4YZEA 2NP5A 5GPAA 4CGRA 3COLA 2UXOA 3DCFA 3O8GA 3Q0WA 3BR0A 4M3DA 2VPRA 3BTIA 3CDLA 5F0CA 3BR6A 1ORKA 2XPUA 2G0EA 3BCGA 2HYJA 2JJ7A 2IAIA 3FHNA 3IUVA 3DU6A 3B6CA 3CJDA 5FKOA 2OERA 2W53A 3VTIA 3ZQIA 2FBQA 5K7FA 3HE0A 2FD5A 4X1EA 3NNRA 2QIBA 5D19A 3AQTA 2GFNA 3P9TA 3BR2A 3DU5A 5K58A 3BRUA 2QOPA 5CW8A 3VW0A 3Q0UA 2D6YA 5J1UA 3BR3A 4GCLA 2YVHA 2UXUA 3BQYA 5CQGA 2TRTA 4XK4A 3HGGA 2NX4A 2QWTA 2R7VA 2ZCXA 3NPIA 4JL3A 2UXPA 2XDNA 2XGDA 3MVPA 2WGBA 3VIBA 4JKZA 5GP9A 3AQSA 5FKLA 1JTXA 2YVXA 4AC0A 1QPIA 4M3FA 4MXMA 1U9OA 3MNLA 3TP0A 2PBXA 3HTHA 4V2GA 3V6GA 2R7RA 4NN1A 3KKDA 5J3LA 2ZOYA 2R7WA 3G1OA 3BHQA 2HKUA 4V2FA 3SDGA 3LSPA 3C07A 3NRGA 3VOXA 5FKKA 3QPSA 4D5FA 3NS4A 3QPLA 3ANPA 3QKXA 1U9NA 2XB5A 3LHQA 3G1MA 2R7SA 3BR5A 4U9NA 2O7OA 3V78A 3F0CA 5EZGA 2ID6A 3BNIA 2NS7A 2PFVA 2ZCMA 3IH2A 2IU5A 2TCTA 1JTYA 2HQ5A 3S5RA 3C2BA 1RKTA 3E7QA 3DEWA 4KWAA 2HXOA 4B3AA 4AUXA 2QKOA 5J1RA 3SFIA 4PXIA 3PASA 4DVYP 2ID3A 2R7TA 3Q3SA 1RPWA 5F1JA 5F27A 2ZB9A 3WHCA 3CRJA 1UI5A 2IEKA 3QBMA 4ME9A 3LJLA 3F1BA 4ABZA 3G7RA 5F04A 3EUPA 3NXCA 5F08A 4I6ZA 1T56A 2ZOZA 4NELA 4UDSA 4L62A 2XPVA 2WUIA 2FQ4A 3NI7A 1ZKGA 3KYLA 4M3GA 5IPAA 4D7NA 2ZY9A 4U9LA 4MK6A 2QCOA 5HAWA 4W1UA 5C4YA 3K8PC 3VP5A 2NS8A 5GPCA 5CXIA 3ANGA 1RKWA 2UXHA 3O8HA 1Z0XA 1UI6A 1Z77A 3DPJA 1SGMA 3RH2A 3VVXA 1QVUA 3WHBA 3ZQGA 2DG7A 4W97A 3HTAA 1BJZA 3B81A 3VVZA 1T33A 3KZ9A 5FHPA 1JT6A 3EGQA 2IBDA 3B6AA 3PM1A 5D1RA 3ON4A 5CXGA 3GZIA 4DW6A 2V57A 2Y31A 2RASA 1JT0A 2G7SA 3VOKA 2GENA 1ZK8A 2GBYA 3BJBA 3LSRA 1JUMA 5IOYA 2B3WA 2WV1A 3IH4A 3HTJA 1JUPA 4M3EA 5F0HA 2PZ9A 2Y30A 4ACIA 4JYKA 4D5CA 3O60A 3FK6A 4C2MA 2Q24A
chains in the Genus database with same CATH topology
1VI0A 2DG8A 4M3BA 3PPBA 2OPTA 2I10A 3FRQA 4I76A 3HGYA 3LWJA 2G7LA 3BT9A 5EYRA 5H9TA 1A6IA 2G3BA 4GFLA 3ZQHA 2RAEA 2XRLA 4GFKA 5IP6A 3T6NA 5HSZA 2HYTA 3BTJA 3KKCA 3VW2A 3LOCA 2GUHA 3G1LA 2O7TA 2VKEA 4GCTA 3ON2A 5IOZA 2QTQA 2X9DA 3BQZA 3CWRA 4JNNA 5FKMA 3BR1A 3FK7A 3CCYA 5FMPA 3LSJA 4AC6A 3JSJA 5J1YA 2NP3A 2XPWA 5FKNA 3Q0VA 3BTCA 3GEUA 3KNWA 5F0FA 2X6OA 2OF7A 3FIWA 5K7HA 2EH3A 5HBUA 2YVEA 5EZHA 2XGEA 2F07A 4ICHA 3QQAA 2G7GA 2FJ1A 2FX0A 2ZCNA 3TP3A 3VPRA 3BTLA 4G12A 4GCKA 1JUSA 4D7MA 5FGLA 4B1RA 4HKUA 2UXIA 2VKVA 5DAJA 5AQCA 3HTIA 2REKA 2OI8A 3VW1A 3RD3A 3VVYA 3ZQLA 3IH3A 2XGCA 3G56A 5EFYA 2HXIA 2RHAA 3VUQA 1QVTA 4MO7A 3ZQFA 2JK3A 5K7ZA 2DTZA 4AF5A 5D18A 2Y2ZA 3HIMA 4YZEA 2NP5A 5GPAA 4CGRA 3COLA 2UXOA 3DCFA 3O8GA 3Q0WA 3BR0A 4M3DA 2VPRA 3BTIA 3CDLA 5F0CA 3BR6A 1ORKA 2XPUA 2G0EA 3BCGA 2HYJA 2JJ7A 2IAIA 3IUVA 3B6CA 3CJDA 5FKOA 2OERA 2W53A 3ZQIA 2FBQA 5K7FA 3HE0A 2FD5A 4X1EA 3NNRA 2QIBA 5D19A 3AQTA 2GFNA 3P9TA 3BR2A 5K58A 3BRUA 2QOPA 5CW8A 3VW0A 3Q0UA 2D6YA 5J1UA 3BR3A 4GCLA 2YVHA 2UXUA 3BQYA 2TRTA 4XK4A 3HGGA 2NX4A 2QWTA 2ZCXA 3NPIA 4JL3A 2UXPA 2XDNA 2XGDA 3MVPA 2WGBA 3VIBA 4JKZA 5GP9A 3AQSA 5FKLA 1JTXA 4AC0A 1QPIA 4M3FA 4MXMA 1U9OA 3MNLA 3TP0A 2PBXA 3HTHA 4V2GA 3V6GA 4NN1A 3KKDA 5J3LA 2ZOYA 3G1OA 3BHQA 2HKUA 4V2FA 3SDGA 3LSPA 3C07A 3NRGA 3VOXA 5FKKA 3QPSA 4D5FA 3QPLA 3ANPA 3QKXA 1U9NA 2XB5A 3LHQA 3G1MA 3BR5A 2O7OA 3V78A 3F0CA 5EZGA 2ID6A 3BNIA 2NS7A 2ZCMA 3IH2A 2IU5A 2TCTA 1JTYA 2HQ5A 3S5RA 3C2BA 1RKTA 3E7QA 3DEWA 4KWAA 2HXOA 4B3AA 4AUXA 2QKOA 5J1RA 3SFIA 4PXIA 3PASA 2ID3A 3Q3SA 1RPWA 5F1JA 5F27A 2ZB9A 3WHCA 3CRJA 1UI5A 2IEKA 3QBMA 4ME9A 3LJLA 3F1BA 4ABZA 3G7RA 5F04A 3EUPA 3NXCA 5F08A 4I6ZA 1T56A 2ZOZA 4NELA 4UDSA 4L62A 2XPVA 2WUIA 2FQ4A 3NI7A 1ZKGA 4M3GA 5IPAA 4D7NA 4MK6A 2QCOA 5HAWA 4W1UA 5C4YA 3VP5A 2NS8A 5GPCA 5CXIA 3ANGA 1RKWA 2UXHA 3O8HA 1Z0XA 1UI6A 1Z77A 3DPJA 1SGMA 3RH2A 3VVXA 1QVUA 3WHBA 3ZQGA 2DG7A 4W97A 3HTAA 1BJZA 3B81A 3VVZA 1T33A 3KZ9A 5FHPA 1JT6A 3EGQA 2IBDA 3B6AA 3PM1A 5D1RA 3ON4A 5CXGA 3GZIA 4DW6A 2V57A 2Y31A 2RASA 1JT0A 2G7SA 3VOKA 2GENA 1ZK8A 2GBYA 3BJBA 3LSRA 1JUMA 5IOYA 2WV1A 3IH4A 3HTJA 1JUPA 4M3EA 5F0HA 2PZ9A 2Y30A 4ACIA 4JYKA 4D5CA 3O60A 3FK6A 2Q24A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VI0 A;  2DG8 A;  4M3B A;  3PPB A;  2OPT A;  2I10 A;  3FRQ A;  4I76 A;  3HGY A;  3LWJ A;  2G7L A;  3BT9 A;  5EYR A;  5H9T A;  1A6I A;  2G3B A;  4GFL A;  3ZQH A;  2RAE A;  2XRL A;  4GFK A;  5IP6 A;  3T6N A;  5HSZ A;  2HYT A;  3BTJ A;  3KKC A;  3VW2 A;  3LOC A;  2GUH A;  3G1L A;  2O7T A;  2VKE A;  4GCT A;  3ON2 A;  5IOZ A;  2QTQ A;  2X9D A;  3BQZ A;  3CWR A;  4JNN A;  5FKM A;  3BR1 A;  3FK7 A;  3CCY A;  5FMP A;  3LSJ A;  4AC6 A;  3JSJ A;  5J1Y A;  2NP3 A;  2XPW A;  5FKN A;  3Q0V A;  3BTC A;  3GEU A;  3KNW A;  5F0F A;  2X6O A;  2OF7 A;  3FIW A;  5K7H A;  2EH3 A;  5HBU A;  2YVE A;  5EZH A;  2XGE A;  2F07 A;  4ICH A;  3QQA A;  2G7G A;  2FJ1 A;  2FX0 A;  2ZCN A;  3TP3 A;  3VPR A;  3BTL A;  4G12 A;  4GCK A;  1JUS A;  4D7M A;  5FGL A;  4B1R A;  4HKU A;  2UXI A;  2VKV A;  5DAJ A;  5AQC A;  3HTI A;  2REK A;  2OI8 A;  3VW1 A;  3RD3 A;  3VVY A;  3ZQL A;  3IH3 A;  2XGC A;  3G56 A;  5EFY A;  2HXI A;  2RHA A;  3VUQ A;  1QVT A;  4MO7 A;  3ZQF A;  2JK3 A;  5K7Z A;  2DTZ A;  4AF5 A;  5D18 A;  2Y2Z A;  3HIM A;  4YZE A;  2NP5 A;  5GPA A;  4CGR A;  3COL A;  2UXO A;  3DCF A;  3O8G A;  3Q0W A;  3BR0 A;  4M3D A;  2VPR A;  3BTI A;  3CDL A;  5F0C A;  3BR6 A;  1ORK A;  2XPU A;  2G0E A;  3BCG A;  2HYJ A;  2JJ7 A;  2IAI A;  3IUV A;  3B6C A;  3CJD A;  5FKO A;  2OER A;  2W53 A;  3ZQI A;  2FBQ A;  5K7F A;  3HE0 A;  2FD5 A;  4X1E A;  3NNR A;  2QIB A;  5D19 A;  3AQT A;  2GFN A;  3P9T A;  3BR2 A;  5K58 A;  3BRU A;  2QOP A;  5CW8 A;  3VW0 A;  3Q0U A;  2D6Y A;  5J1U A;  3BR3 A;  4GCL A;  2YVH A;  2UXU A;  3BQY A;  2TRT A;  4XK4 A;  3HGG A;  2NX4 A;  2QWT A;  2ZCX A;  3NPI A;  4JL3 A;  2UXP A;  2XDN A;  2XGD A;  3MVP A;  2WGB A;  3VIB A;  4JKZ A;  5GP9 A;  3AQS A;  5FKL A;  1JTX A;  4AC0 A;  1QPI A;  4M3F A;  4MXM A;  1U9O A;  3MNL A;  3TP0 A;  2PBX A;  3HTH A;  4V2G A;  3V6G A;  4NN1 A;  3KKD A;  5J3L A;  2ZOY A;  3G1O A;  3BHQ A;  2HKU A;  4V2F A;  3SDG A;  3LSP A;  3C07 A;  3NRG A;  3VOX A;  5FKK A;  3QPS A;  4D5F A;  3QPL A;  3ANP A;  3QKX A;  1U9N A;  2XB5 A;  3LHQ A;  3G1M A;  3BR5 A;  2O7O A;  3V78 A;  3F0C A;  5EZG A;  2ID6 A;  3BNI A;  2NS7 A;  2ZCM A;  3IH2 A;  2IU5 A;  2TCT A;  1JTY A;  2HQ5 A;  3S5R A;  3C2B A;  1RKT A;  3E7Q A;  3DEW A;  4KWA A;  2HXO A;  4B3A A;  4AUX A;  2QKO A;  5J1R A;  3SFI A;  4PXI A;  3PAS A;  2ID3 A;  3Q3S A;  1RPW A;  5F1J A;  5F27 A;  2ZB9 A;  3WHC A;  3CRJ A;  1UI5 A;  2IEK A;  3QBM A;  4ME9 A;  3LJL A;  3F1B A;  4ABZ A;  3G7R A;  5F04 A;  3EUP A;  3NXC A;  5F08 A;  4I6Z A;  1T56 A;  2ZOZ A;  4NEL A;  4UDS A;  4L62 A;  2XPV A;  2WUI A;  2FQ4 A;  3NI7 A;  1ZKG A;  4M3G A;  5IPA A;  4D7N A;  4MK6 A;  2QCO A;  5HAW A;  4W1U A;  5C4Y A;  3VP5 A;  2NS8 A;  5GPC A;  5CXI A;  3ANG A;  1RKW A;  2UXH A;  3O8H A;  1Z0X A;  1UI6 A;  1Z77 A;  3DPJ A;  1SGM A;  3RH2 A;  3VVX A;  1QVU A;  3WHB A;  3ZQG A;  2DG7 A;  4W97 A;  3HTA A;  1BJZ A;  3B81 A;  3VVZ A;  1T33 A;  3KZ9 A;  5FHP A;  1JT6 A;  3EGQ A;  2IBD A;  3B6A A;  3PM1 A;  5D1R A;  3ON4 A;  5CXG A;  3GZI A;  4DW6 A;  2V57 A;  2Y31 A;  2RAS A;  1JT0 A;  2G7S A;  3VOK A;  2GEN A;  1ZK8 A;  2GBY A;  3BJB A;  3LSR A;  1JUM A;  5IOY A;  2WV1 A;  3IH4 A;  3HTJ A;  1JUP A;  4M3E A;  5F0H A;  2PZ9 A;  2Y30 A;  4ACI A;  4JYK A;  4D5C A;  3O60 A;  3FK6 A;  2Q24 A; 
#chains in the Genus database with same CATH topology
 1VI0 A;  2DG8 A;  4M3B A;  3PPB A;  2OPT A;  2I10 A;  3FRQ A;  4I76 A;  3HGY A;  3LWJ A;  2G7L A;  3BT9 A;  5EYR A;  5H9T A;  1A6I A;  2G3B A;  4GFL A;  2A2F X;  2B1E A;  3ZQH A;  2RAE A;  2XRL A;  4GFK A;  5IP6 A;  3T6N A;  5HSZ A;  2HYT A;  3BTJ A;  3KKC A;  3VW2 A;  3LOC A;  2GUH A;  3G1L A;  2O7T A;  2VKE A;  4GCT A;  3ON2 A;  2FJI 1;  5IOZ A;  2QTQ A;  2X9D A;  3BQZ A;  3CWR A;  4JNN A;  5FKM A;  3BR1 A;  4OD4 A;  4WIB A;  3FK7 A;  3CCY A;  5FMP A;  2R7U A;  3LSJ A;  4AC6 A;  3JSJ A;  5J1Y A;  2NP3 A;  2XPW A;  5FKN A;  3Q0V A;  3BTC A;  3GEU A;  3KNW A;  5F0F A;  2X6O A;  2OF7 A;  3FIW A;  5K7H A;  2EH3 A;  5HBU A;  2YVE A;  4OD5 A;  5EZH A;  2XGE A;  2F07 A;  4ICH A;  3QQA A;  2G7G A;  2FJ1 A;  2FX0 A;  2ZCN A;  3TP3 A;  3VPR A;  3BTL A;  4G12 A;  4GCK A;  1JUS A;  4D7M A;  5FGL A;  4B1R A;  4HKU A;  2UXI A;  2VKV A;  5DAJ A;  5AQC A;  3HTI A;  2REK A;  2OI8 A;  3VW1 A;  3RD3 A;  3VVY A;  3ZQL A;  3IH3 A;  2XGC A;  3G56 A;  5EFY A;  2HXI A;  2RHA A;  4IRV A;  2R7X A;  3VUQ A;  1QVT A;  4MO7 A;  3SWH A;  3ZQF A;  2JK3 A;  5K7Z A;  2R7Q A;  2DTZ A;  4AF5 A;  5D18 A;  2Y2Z A;  3HIM A;  2R7O A;  4YZE A;  2NP5 A;  5GPA A;  4CGR A;  3COL A;  2UXO A;  3DCF A;  3O8G A;  3Q0W A;  3BR0 A;  4M3D A;  2VPR A;  3BTI A;  3CDL A;  5F0C A;  3BR6 A;  1ORK A;  2XPU A;  2G0E A;  3BCG A;  2HYJ A;  2JJ7 A;  2IAI A;  3FHN A;  3IUV A;  3DU6 A;  3B6C A;  3CJD A;  5FKO A;  2OER A;  2W53 A;  3VTI A;  3ZQI A;  2FBQ A;  5K7F A;  3HE0 A;  2FD5 A;  4X1E A;  3NNR A;  2QIB A;  5D19 A;  3AQT A;  2GFN A;  3P9T A;  3BR2 A;  3DU5 A;  5K58 A;  3BRU A;  2QOP A;  5CW8 A;  3VW0 A;  3Q0U A;  2D6Y A;  5J1U A;  3BR3 A;  4GCL A;  2YVH A;  2UXU A;  3BQY A;  5CQG A;  2TRT A;  4XK4 A;  3HGG A;  2NX4 A;  2QWT A;  2R7V A;  2ZCX A;  3NPI A;  4JL3 A;  2UXP A;  2XDN A;  2XGD A;  3MVP A;  2WGB A;  3VIB A;  4JKZ A;  5GP9 A;  3AQS A;  5FKL A;  1JTX A;  2YVX A;  4AC0 A;  1QPI A;  4M3F A;  4MXM A;  1U9O A;  3MNL A;  3TP0 A;  2PBX A;  3HTH A;  4V2G A;  3V6G A;  2R7R A;  4NN1 A;  3KKD A;  5J3L A;  2ZOY A;  2R7W A;  3G1O A;  3BHQ A;  2HKU A;  4V2F A;  3SDG A;  3LSP A;  3C07 A;  3NRG A;  3VOX A;  5FKK A;  3QPS A;  4D5F A;  3NS4 A;  3QPL A;  3ANP A;  3QKX A;  1U9N A;  2XB5 A;  3LHQ A;  3G1M A;  2R7S A;  3BR5 A;  4U9N A;  2O7O A;  3V78 A;  3F0C A;  5EZG A;  2ID6 A;  3BNI A;  2NS7 A;  2PFV A;  2ZCM A;  3IH2 A;  2IU5 A;  2TCT A;  1JTY A;  2HQ5 A;  3S5R A;  3C2B A;  1RKT A;  3E7Q A;  3DEW A;  4KWA A;  2HXO A;  4B3A A;  4AUX A;  2QKO A;  5J1R A;  3SFI A;  4PXI A;  3PAS A;  4DVY P;  2ID3 A;  2R7T A;  3Q3S A;  1RPW A;  5F1J A;  5F27 A;  2ZB9 A;  3WHC A;  3CRJ A;  1UI5 A;  2IEK A;  3QBM A;  4ME9 A;  3LJL A;  3F1B A;  4ABZ A;  3G7R A;  5F04 A;  3EUP A;  3NXC A;  5F08 A;  4I6Z A;  1T56 A;  2ZOZ A;  4NEL A;  4UDS A;  4L62 A;  2XPV A;  2WUI A;  2FQ4 A;  3NI7 A;  1ZKG A;  3KYL A;  4M3G A;  5IPA A;  4D7N A;  2ZY9 A;  4U9L A;  4MK6 A;  2QCO A;  5HAW A;  4W1U A;  5C4Y A;  3K8P C;  3VP5 A;  2NS8 A;  5GPC A;  5CXI A;  3ANG A;  1RKW A;  2UXH A;  3O8H A;  1Z0X A;  1UI6 A;  1Z77 A;  3DPJ A;  1SGM A;  3RH2 A;  3VVX A;  1QVU A;  3WHB A;  3ZQG A;  2DG7 A;  4W97 A;  3HTA A;  1BJZ A;  3B81 A;  3VVZ A;  1T33 A;  3KZ9 A;  5FHP A;  1JT6 A;  3EGQ A;  2IBD A;  3B6A A;  3PM1 A;  5D1R A;  3ON4 A;  5CXG A;  3GZI A;  4DW6 A;  2V57 A;  2Y31 A;  2RAS A;  1JT0 A;  2G7S A;  3VOK A;  2GEN A;  1ZK8 A;  2GBY A;  3BJB A;  3LSR A;  1JUM A;  5IOY A;  2B3W A;  2WV1 A;  3IH4 A;  3HTJ A;  1JUP A;  4M3E A;  5F0H A;  2PZ9 A;  2Y30 A;  4ACI A;  4JYK A;  4D5C A;  3O60 A;  3FK6 A;  4C2M A;  2Q24 A; 
#chains in the Genus database with same CATH homology
 1VI0 A;  2DG8 A;  4M3B A;  3PPB A;  2OPT A;  2I10 A;  3FRQ A;  4I76 A;  3HGY A;  3LWJ A;  2G7L A;  3BT9 A;  5EYR A;  5H9T A;  1A6I A;  2G3B A;  4GFL A;  3ZQH A;  2RAE A;  2XRL A;  4GFK A;  5IP6 A;  3T6N A;  5HSZ A;  2HYT A;  3BTJ A;  3KKC A;  3VW2 A;  3LOC A;  2GUH A;  3G1L A;  2O7T A;  2VKE A;  4GCT A;  3ON2 A;  5IOZ A;  2QTQ A;  2X9D A;  3BQZ A;  3CWR A;  4JNN A;  5FKM A;  3BR1 A;  3FK7 A;  3CCY A;  5FMP A;  3LSJ A;  4AC6 A;  3JSJ A;  5J1Y A;  2NP3 A;  2XPW A;  5FKN A;  3Q0V A;  3BTC A;  3GEU A;  3KNW A;  5F0F A;  2X6O A;  2OF7 A;  3FIW A;  5K7H A;  2EH3 A;  5HBU A;  2YVE A;  5EZH A;  2XGE A;  2F07 A;  4ICH A;  3QQA A;  2G7G A;  2FJ1 A;  2FX0 A;  2ZCN A;  3TP3 A;  3VPR A;  3BTL A;  4G12 A;  4GCK A;  1JUS A;  4D7M A;  5FGL A;  4B1R A;  4HKU A;  2UXI A;  2VKV A;  5DAJ A;  5AQC A;  3HTI A;  2REK A;  2OI8 A;  3VW1 A;  3RD3 A;  3VVY A;  3ZQL A;  3IH3 A;  2XGC A;  3G56 A;  5EFY A;  2HXI A;  2RHA A;  3VUQ A;  1QVT A;  4MO7 A;  3ZQF A;  2JK3 A;  5K7Z A;  2DTZ A;  4AF5 A;  5D18 A;  2Y2Z A;  3HIM A;  4YZE A;  2NP5 A;  5GPA A;  4CGR A;  3COL A;  2UXO A;  3DCF A;  3O8G A;  3Q0W A;  3BR0 A;  4M3D A;  2VPR A;  3BTI A;  3CDL A;  5F0C A;  3BR6 A;  1ORK A;  2XPU A;  2G0E A;  3BCG A;  2HYJ A;  2JJ7 A;  2IAI A;  3IUV A;  3B6C A;  3CJD A;  5FKO A;  2OER A;  2W53 A;  3ZQI A;  2FBQ A;  5K7F A;  3HE0 A;  2FD5 A;  4X1E A;  3NNR A;  2QIB A;  5D19 A;  3AQT A;  2GFN A;  3P9T A;  3BR2 A;  5K58 A;  3BRU A;  2QOP A;  5CW8 A;  3VW0 A;  3Q0U A;  2D6Y A;  5J1U A;  3BR3 A;  4GCL A;  2YVH A;  2UXU A;  3BQY A;  2TRT A;  4XK4 A;  3HGG A;  2NX4 A;  2QWT A;  2ZCX A;  3NPI A;  4JL3 A;  2UXP A;  2XDN A;  2XGD A;  3MVP A;  2WGB A;  3VIB A;  4JKZ A;  5GP9 A;  3AQS A;  5FKL A;  1JTX A;  4AC0 A;  1QPI A;  4M3F A;  4MXM A;  1U9O A;  3MNL A;  3TP0 A;  2PBX A;  3HTH A;  4V2G A;  3V6G A;  4NN1 A;  3KKD A;  5J3L A;  2ZOY A;  3G1O A;  3BHQ A;  2HKU A;  4V2F A;  3SDG A;  3LSP A;  3C07 A;  3NRG A;  3VOX A;  5FKK A;  3QPS A;  4D5F A;  3QPL A;  3ANP A;  3QKX A;  1U9N A;  2XB5 A;  3LHQ A;  3G1M A;  3BR5 A;  2O7O A;  3V78 A;  3F0C A;  5EZG A;  2ID6 A;  3BNI A;  2NS7 A;  2ZCM A;  3IH2 A;  2IU5 A;  2TCT A;  1JTY A;  2HQ5 A;  3S5R A;  3C2B A;  1RKT A;  3E7Q A;  3DEW A;  4KWA A;  2HXO A;  4B3A A;  4AUX A;  2QKO A;  5J1R A;  3SFI A;  4PXI A;  3PAS A;  2ID3 A;  3Q3S A;  1RPW A;  5F1J A;  5F27 A;  2ZB9 A;  3WHC A;  3CRJ A;  1UI5 A;  2IEK A;  3QBM A;  4ME9 A;  3LJL A;  3F1B A;  4ABZ A;  3G7R A;  5F04 A;  3EUP A;  3NXC A;  5F08 A;  4I6Z A;  1T56 A;  2ZOZ A;  4NEL A;  4UDS A;  4L62 A;  2XPV A;  2WUI A;  2FQ4 A;  3NI7 A;  1ZKG A;  4M3G A;  5IPA A;  4D7N A;  4MK6 A;  2QCO A;  5HAW A;  4W1U A;  5C4Y A;  3VP5 A;  2NS8 A;  5GPC A;  5CXI A;  3ANG A;  1RKW A;  2UXH A;  3O8H A;  1Z0X A;  1UI6 A;  1Z77 A;  3DPJ A;  1SGM A;  3RH2 A;  3VVX A;  1QVU A;  3WHB A;  3ZQG A;  2DG7 A;  4W97 A;  3HTA A;  1BJZ A;  3B81 A;  3VVZ A;  1T33 A;  3KZ9 A;  5FHP A;  1JT6 A;  3EGQ A;  2IBD A;  3B6A A;  3PM1 A;  5D1R A;  3ON4 A;  5CXG A;  3GZI A;  4DW6 A;  2V57 A;  2Y31 A;  2RAS A;  1JT0 A;  2G7S A;  3VOK A;  2GEN A;  1ZK8 A;  2GBY A;  3BJB A;  3LSR A;  1JUM A;  5IOY A;  2WV1 A;  3IH4 A;  3HTJ A;  1JUP A;  4M3E A;  5F0H A;  2PZ9 A;  2Y30 A;  4ACI A;  4JYK A;  4D5C A;  3O60 A;  3FK6 A;  2Q24 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...