3G56A

Structure of the macrolide biosensor protein, mphr(a)
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
183
structure length
180
Chain Sequence
SDDEVLEAATVVLKRCGPIEFTLSGVAKEVGLSRAALIQRFTNRDTLLVRMMERGVEQVRHYLNAIPIGAGPQGLWEFLQVLVRSMNDFSVNYLISWYELQVPELRTLAIQRNRAVVEGIRKRLPPGAPAAAELLLHSVIAGATMQWAVDPDGELADHVLAQIAAILCLMFPEHDDFQLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Regulator of macrolide 2'-phosphotransferase I
publication title Structure and function of the macrolide biosensor protein, MphR(A), with and without erythromycin
pubmed doi rcsb
source organism Escherichia coli
total genus 65
structure length 180
sequence length 183
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3g56A00
2X9DA 3NRGA 2OPTA 3HTJA 3KKCA 4AUXA 2ZCXA 2DG8A 4JL3A 3RD3A 3VVZA 1ZK8A 2NP3A 3G1LA 2IU5A 3BRUA 2EH3A 2IEKA 2G7LA 3HTHA 3V78A 5F0HA 3NXCA 4M3GA 4GCTA 3ZQHA 1JTXA 3PPBA 3FK7A 4D7MA 5J1RA 5FGLA 3VUQA 3F0CA 4ICHA 3G7RA 2G7GA 3MNLA 3IH3A 3FIWA 3BR2A 2ZOZA 4CGRA 2ID6A 2XGCA 1JT0A 2Y30A 3LSJA 4GFKA 3BTIA 3DEWA 5IPAA 2VPRA 5FKNA 1RKTA 2OERA 5J3LA 3TP0A 4I76A 3NPIA 5IOZA 3BTLA 4JNNA 3LOCA 5FKMA 3QKXA 3E7QA 5DAJA 1ZKGA 4GCKA 3LWJA 3EGQA 3KKDA 2X6OA 3HTIA 3SDGA 3P9TA 2JK3A 3T6NA 2NP5A 3BR1A 3G1OA 3GEUA 1QPIA 4GFLA 3BT9A 2YVEA 3KNWA 5EYRA 4V2GA 4GCLA 3BTCA 5GP9A 3RH2A 1QVTA 2UXHA 2UXUA 4X1EA 5HBUA 2VKVA 2XDNA 3CRJA 2QWTA 4W1UA 5FHPA 5F0FA 2XGDA 3WHCA 3VVXA 3CCYA 3ZQGA 4XK4A 3LHQA 2XPWA 4AC6A 2IAIA 2F07A 2PBXA 3ZQIA 2QCOA 3VW1A 3VW0A 3F1BA 3LJLA 2NX4A 3BJBA 4M3EA 3ON2A 3LSRA 2DG7A 2YVHA 3G56A 2OF7A 2HYJA 2JJ7A 3Q0VA 4MK6A 5K7HA 3QPSA 1T33A 1RKWA 2Y2ZA 3DCFA 2HKUA 2W53A 2Y31A 2G7SA 4L62A 3Q0UA 3VIBA 3BQZA 5F27A 5EZGA 3WHBA 4D7NA 2IBDA 5H9TA 5D18A 3AQTA 3AQSA 2HXIA 2UXPA 2PZ9A 4D5FA 4HKUA 2GFNA 3ANPA 2QTQA 5EZHA 5J1UA 4UDSA 2OI8A 3O8HA 3VVYA 5F04A 5FKKA 1QVUA 3TP3A 2Q24A 5EFYA 2XRLA 2ID3A 4B1RA 3O60A 3QBMA 4M3BA 3DPJA 3BCGA 3BR0A 1RPWA 2DTZA 4ABZA 3BR3A 3B6CA 3BR5A 2ZOYA 3VP5A 2O7TA 5K58A 4M3DA 5F1JA 2XPUA 3JSJA 2QOPA 2REKA 3G1MA 3IUVA 3S5RA 1BJZA 3Q0WA 1ORKA 3B6AA 2V57A 3NI7A 3ON4A 5HSZA 2FX0A 3FK6A 4MO7A 3COLA 1JT6A 2QIBA 2G0EA 5IP6A 2TCTA 2XB5A 4I6ZA 4DW6A 3QPLA 2GENA 2ZCNA 5FKLA 5F08A 2ZB9A 5CXIA 4NELA 2HQ5A 5FKOA 2WV1A 5J1YA 1Z0XA 1A6IA 3EUPA 4JKZA 1U9NA 1Z77A 3Q3SA 4NN1A 2ZCMA 4KWAA 2FJ1A 2D6YA 4G12A 3HE0A 1U9OA 2RHAA 4JYKA 3IH2A 3NNRA 2RASA 1JUPA 5HAWA 1UI6A 3BQYA 3SFIA 3VW2A 4PXIA 3VOXA 5K7ZA 3B81A 3LSPA 3ZQFA 2UXIA 4AF5A 2GUHA 3C2BA 1JUMA 1T56A 2I10A 4V2FA 5GPCA 3IH4A 2HXOA 2FQ4A 1JTYA 3CDLA 3BTJA 5IOYA 2XPVA 3FRQA 2O7OA 2TRTA 5AQCA 4YZEA 2WGBA 3PM1A 3BHQA 5C4YA 3HTAA 5K7FA 5GPAA 5D1RA 3VPRA 1UI5A 3BNIA 5CXGA 4ME9A 2NS8A 5FMPA 2NS7A 3HIMA 2XGEA 2UXOA 2RAEA 3PASA 4B3AA 3MVPA 3VOKA 3ZQLA 2GBYA 3GZIA 3C07A 1VI0A 1JUSA 4D5CA 2FBQA 4AC0A 4MXMA 4W97A 3CWRA 3V6GA 3O8GA 2HYTA 2VKEA 3CJDA 3HGGA 2FD5A 3KZ9A 3BR6A 5D19A 2QKOA 5F0CA 3QQAA 4M3FA 2G3BA 5CW8A 1SGMA 4ACIA 3HGYA 3ANGA 2WUIA
chains in the Genus database with same CATH superfamily
2X9DA 3NRGA 2OPTA 3HTJA 3KKCA 4AUXA 2ZCXA 2DG8A 4JL3A 3RD3A 3VVZA 1ZK8A 2NP3A 3G1LA 2IU5A 3BRUA 2EH3A 2IEKA 2G7LA 3HTHA 3V78A 5F0HA 3NXCA 4M3GA 4GCTA 3ZQHA 1JTXA 3PPBA 3FK7A 4D7MA 5J1RA 5FGLA 3VUQA 3F0CA 4ICHA 3G7RA 2G7GA 3MNLA 4C2MA 3IH3A 3FIWA 3BR2A 2ZOZA 3K8PC 4CGRA 2ID6A 2XGCA 1JT0A 2Y30A 3LSJA 4GFKA 3BTIA 3DEWA 5IPAA 2VPRA 5FKNA 1RKTA 2OERA 5J3LA 3TP0A 4I76A 3NPIA 5IOZA 3BTLA 4JNNA 3LOCA 5FKMA 3QKXA 3E7QA 5DAJA 1ZKGA 2A2FX 4GCKA 3FHNA 3LWJA 3EGQA 3KKDA 2X6OA 3HTIA 3SDGA 3P9TA 2JK3A 3T6NA 2NP5A 3BR1A 3G1OA 3GEUA 1QPIA 4GFLA 3BT9A 2YVEA 3KNWA 5EYRA 4V2GA 4GCLA 3BTCA 2R7VA 5GP9A 3RH2A 1QVTA 2UXHA 2UXUA 4X1EA 5HBUA 2VKVA 2XDNA 3CRJA 2QWTA 3VTIA 4W1UA 5FHPA 5F0FA 2XGDA 3WHCA 3VVXA 3CCYA 3ZQGA 4XK4A 3LHQA 2XPWA 4AC6A 2IAIA 3DU5A 2F07A 2PBXA 3ZQIA 2QCOA 3VW1A 2R7TA 3VW0A 3F1BA 3LJLA 2NX4A 3BJBA 4M3EA 3ON2A 3LSRA 2DG7A 2YVHA 3G56A 4IRVA 2OF7A 2HYJA 2JJ7A 3Q0VA 4MK6A 5K7HA 3QPSA 1T33A 1RKWA 2Y2ZA 3DCFA 2HKUA 2W53A 2Y31A 2G7SA 4L62A 3KYLA 3Q0UA 3VIBA 3BQZA 4OD5A 2YVXA 5EZGA 5F27A 3WHBA 4D7NA 2IBDA 5H9TA 5D18A 3AQTA 3AQSA 2HXIA 2UXPA 2PZ9A 4D5FA 4HKUA 2GFNA 3ANPA 2QTQA 5EZHA 5J1UA 4UDSA 2R7UA 2OI8A 3O8HA 3VVYA 5F04A 5FKKA 1QVUA 3TP3A 2Q24A 5EFYA 2XRLA 2ID3A 4B1RA 3O60A 3QBMA 4M3BA 3DPJA 3BCGA 3BR0A 1RPWA 2DTZA 4ABZA 3BR3A 3B6CA 3BR5A 2ZOYA 3VP5A 2O7TA 5K58A 4M3DA 5F1JA 2XPUA 3JSJA 2QOPA 2REKA 3G1MA 3IUVA 2R7RA 3S5RA 1BJZA 3Q0WA 1ORKA 3SWHA 3B6AA 2V57A 3NI7A 3ON4A 5HSZA 2FX0A 3FK6A 4MO7A 3COLA 2B1EA 1JT6A 2QIBA 2G0EA 5IP6A 2TCTA 2XB5A 4I6ZA 4DW6A 3QPLA 2GENA 2ZCNA 5FKLA 5F08A 2R7OA 2ZB9A 5CXIA 3NS4A 4NELA 2HQ5A 5FKOA 2WV1A 5J1YA 1Z0XA 1A6IA 3EUPA 4JKZA 1U9NA 1Z77A 3Q3SA 4NN1A 2ZCMA 4KWAA 2R7QA 2FJ1A 2D6YA 4G12A 3HE0A 1U9OA 2RHAA 4JYKA 3IH2A 2R7WA 3NNRA 2RASA 4U9NA 1JUPA 5HAWA 2R7XA 1UI6A 4U9LA 3BQYA 3SFIA 3VW2A 4PXIA 3VOXA 5K7ZA 3B81A 3LSPA 3ZQFA 2UXIA 4AF5A 2GUHA 3C2BA 1JUMA 1T56A 3DU6A 2I10A 2ZY9A 4WIBA 4V2FA 5GPCA 3IH4A 2HXOA 2R7SA 2B3WA 2FQ4A 1JTYA 3CDLA 3BTJA 5IOYA 2XPVA 3FRQA 2O7OA 2TRTA 4OD4A 5AQCA 4YZEA 2WGBA 3PM1A 3BHQA 5C4YA 3HTAA 5K7FA 5GPAA 5D1RA 3VPRA 1UI5A 3BNIA 5CXGA 4ME9A 2NS8A 5FMPA 2NS7A 3HIMA 2XGEA 2UXOA 2RAEA 3PASA 4B3AA 3MVPA 3VOKA 3ZQLA 2GBYA 2PFVA 3GZIA 3C07A 1VI0A 1JUSA 4D5CA 4DVYP 2FBQA 4AC0A 4MXMA 4W97A 3CWRA 3V6GA 3O8GA 2HYTA 2VKEA 3CJDA 3HGGA 2FD5A 3KZ9A 3BR6A 5D19A 2FJI1 2QKOA 5F0CA 5CQGA 3QQAA 4M3FA 2G3BA 5CW8A 1SGMA 4ACIA 3HGYA 3ANGA 2WUIA
chains in the Genus database with same CATH topology
2X9DA 3NRGA 2OPTA 3HTJA 3KKCA 4AUXA 2ZCXA 2DG8A 4JL3A 3RD3A 3VVZA 1ZK8A 2NP3A 3G1LA 2IU5A 3BRUA 2EH3A 2IEKA 2G7LA 3HTHA 3V78A 5F0HA 3NXCA 4M3GA 4GCTA 3ZQHA 1JTXA 3PPBA 3FK7A 4D7MA 5J1RA 5FGLA 3VUQA 3F0CA 4ICHA 3G7RA 2G7GA 3MNLA 3IH3A 3FIWA 3BR2A 2ZOZA 4CGRA 2ID6A 2XGCA 1JT0A 2Y30A 3LSJA 4GFKA 3BTIA 3DEWA 5IPAA 2VPRA 5FKNA 1RKTA 2OERA 5J3LA 3TP0A 4I76A 3NPIA 5IOZA 3BTLA 4JNNA 3LOCA 5FKMA 3QKXA 3E7QA 5DAJA 1ZKGA 4GCKA 3LWJA 3EGQA 3KKDA 2X6OA 3HTIA 3SDGA 3P9TA 2JK3A 3T6NA 2NP5A 3BR1A 3G1OA 3GEUA 1QPIA 4GFLA 3BT9A 2YVEA 3KNWA 5EYRA 4V2GA 4GCLA 3BTCA 5GP9A 3RH2A 1QVTA 2UXHA 2UXUA 4X1EA 5HBUA 2VKVA 2XDNA 3CRJA 2QWTA 4W1UA 5FHPA 5F0FA 2XGDA 3WHCA 3VVXA 3CCYA 3ZQGA 4XK4A 3LHQA 2XPWA 4AC6A 2IAIA 2F07A 2PBXA 3ZQIA 2QCOA 3VW1A 3VW0A 3F1BA 3LJLA 2NX4A 3BJBA 4M3EA 3ON2A 3LSRA 2DG7A 2YVHA 3G56A 2OF7A 2HYJA 2JJ7A 3Q0VA 4MK6A 5K7HA 3QPSA 1T33A 1RKWA 2Y2ZA 3DCFA 2HKUA 2W53A 2Y31A 2G7SA 4L62A 3Q0UA 3VIBA 3BQZA 5F27A 5EZGA 3WHBA 4D7NA 2IBDA 5H9TA 5D18A 3AQTA 3AQSA 2HXIA 2UXPA 2PZ9A 4D5FA 4HKUA 2GFNA 3ANPA 2QTQA 5EZHA 5J1UA 4UDSA 2OI8A 3O8HA 3VVYA 5F04A 5FKKA 1QVUA 3TP3A 2Q24A 5EFYA 2XRLA 2ID3A 4B1RA 3O60A 3QBMA 4M3BA 3DPJA 3BCGA 3BR0A 1RPWA 2DTZA 4ABZA 3BR3A 3B6CA 3BR5A 2ZOYA 3VP5A 2O7TA 5K58A 4M3DA 5F1JA 2XPUA 3JSJA 2QOPA 2REKA 3G1MA 3IUVA 3S5RA 1BJZA 3Q0WA 1ORKA 3B6AA 2V57A 3NI7A 3ON4A 5HSZA 2FX0A 3FK6A 4MO7A 3COLA 1JT6A 2QIBA 2G0EA 5IP6A 2TCTA 2XB5A 4I6ZA 4DW6A 3QPLA 2GENA 2ZCNA 5FKLA 5F08A 2ZB9A 5CXIA 4NELA 2HQ5A 5FKOA 2WV1A 5J1YA 1Z0XA 1A6IA 3EUPA 4JKZA 1U9NA 1Z77A 3Q3SA 4NN1A 2ZCMA 4KWAA 2FJ1A 2D6YA 4G12A 3HE0A 1U9OA 2RHAA 4JYKA 3IH2A 3NNRA 2RASA 1JUPA 5HAWA 1UI6A 3BQYA 3SFIA 3VW2A 4PXIA 3VOXA 5K7ZA 3B81A 3LSPA 3ZQFA 2UXIA 4AF5A 2GUHA 3C2BA 1JUMA 1T56A 2I10A 4V2FA 5GPCA 3IH4A 2HXOA 2FQ4A 1JTYA 3CDLA 3BTJA 5IOYA 2XPVA 3FRQA 2O7OA 2TRTA 5AQCA 4YZEA 2WGBA 3PM1A 3BHQA 5C4YA 3HTAA 5K7FA 5GPAA 5D1RA 3VPRA 1UI5A 3BNIA 5CXGA 4ME9A 2NS8A 5FMPA 2NS7A 3HIMA 2XGEA 2UXOA 2RAEA 3PASA 4B3AA 3MVPA 3VOKA 3ZQLA 2GBYA 3GZIA 3C07A 1VI0A 1JUSA 4D5CA 2FBQA 4AC0A 4MXMA 4W97A 3CWRA 3V6GA 3O8GA 2HYTA 2VKEA 3CJDA 3HGGA 2FD5A 3KZ9A 3BR6A 5D19A 2QKOA 5F0CA 3QQAA 4M3FA 2G3BA 5CW8A 1SGMA 4ACIA 3HGYA 3ANGA 2WUIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X9D A;  3NRG A;  2OPT A;  3HTJ A;  3KKC A;  4AUX A;  2ZCX A;  2DG8 A;  4JL3 A;  3RD3 A;  3VVZ A;  1ZK8 A;  2NP3 A;  3G1L A;  2IU5 A;  3BRU A;  2EH3 A;  2IEK A;  2G7L A;  3HTH A;  3V78 A;  5F0H A;  3NXC A;  4M3G A;  4GCT A;  3ZQH A;  1JTX A;  3PPB A;  3FK7 A;  4D7M A;  5J1R A;  5FGL A;  3VUQ A;  3F0C A;  4ICH A;  3G7R A;  2G7G A;  3MNL A;  3IH3 A;  3FIW A;  3BR2 A;  2ZOZ A;  4CGR A;  2ID6 A;  2XGC A;  1JT0 A;  2Y30 A;  3LSJ A;  4GFK A;  3BTI A;  3DEW A;  5IPA A;  2VPR A;  5FKN A;  1RKT A;  2OER A;  5J3L A;  3TP0 A;  4I76 A;  3NPI A;  5IOZ A;  3BTL A;  4JNN A;  3LOC A;  5FKM A;  3QKX A;  3E7Q A;  5DAJ A;  1ZKG A;  4GCK A;  3LWJ A;  3EGQ A;  3KKD A;  2X6O A;  3HTI A;  3SDG A;  3P9T A;  2JK3 A;  3T6N A;  2NP5 A;  3BR1 A;  3G1O A;  3GEU A;  1QPI A;  4GFL A;  3BT9 A;  2YVE A;  3KNW A;  5EYR A;  4V2G A;  4GCL A;  3BTC A;  5GP9 A;  3RH2 A;  1QVT A;  2UXH A;  2UXU A;  4X1E A;  5HBU A;  2VKV A;  2XDN A;  3CRJ A;  2QWT A;  4W1U A;  5FHP A;  5F0F A;  2XGD A;  3WHC A;  3VVX A;  3CCY A;  3ZQG A;  4XK4 A;  3LHQ A;  2XPW A;  4AC6 A;  2IAI A;  2F07 A;  2PBX A;  3ZQI A;  2QCO A;  3VW1 A;  3VW0 A;  3F1B A;  3LJL A;  2NX4 A;  3BJB A;  4M3E A;  3ON2 A;  3LSR A;  2DG7 A;  2YVH A;  3G56 A;  2OF7 A;  2HYJ A;  2JJ7 A;  3Q0V A;  4MK6 A;  5K7H A;  3QPS A;  1T33 A;  1RKW A;  2Y2Z A;  3DCF A;  2HKU A;  2W53 A;  2Y31 A;  2G7S A;  4L62 A;  3Q0U A;  3VIB A;  3BQZ A;  5F27 A;  5EZG A;  3WHB A;  4D7N A;  2IBD A;  5H9T A;  5D18 A;  3AQT A;  3AQS A;  2HXI A;  2UXP A;  2PZ9 A;  4D5F A;  4HKU A;  2GFN A;  3ANP A;  2QTQ A;  5EZH A;  5J1U A;  4UDS A;  2OI8 A;  3O8H A;  3VVY A;  5F04 A;  5FKK A;  1QVU A;  3TP3 A;  2Q24 A;  5EFY A;  2XRL A;  2ID3 A;  4B1R A;  3O60 A;  3QBM A;  4M3B A;  3DPJ A;  3BCG A;  3BR0 A;  1RPW A;  2DTZ A;  4ABZ A;  3BR3 A;  3B6C A;  3BR5 A;  2ZOY A;  3VP5 A;  2O7T A;  5K58 A;  4M3D A;  5F1J A;  2XPU A;  3JSJ A;  2QOP A;  2REK A;  3G1M A;  3IUV A;  3S5R A;  1BJZ A;  3Q0W A;  1ORK A;  3B6A A;  2V57 A;  3NI7 A;  3ON4 A;  5HSZ A;  2FX0 A;  3FK6 A;  4MO7 A;  3COL A;  1JT6 A;  2QIB A;  2G0E A;  5IP6 A;  2TCT A;  2XB5 A;  4I6Z A;  4DW6 A;  3QPL A;  2GEN A;  2ZCN A;  5FKL A;  5F08 A;  2ZB9 A;  5CXI A;  4NEL A;  2HQ5 A;  5FKO A;  2WV1 A;  5J1Y A;  1Z0X A;  1A6I A;  3EUP A;  4JKZ A;  1U9N A;  1Z77 A;  3Q3S A;  4NN1 A;  2ZCM A;  4KWA A;  2FJ1 A;  2D6Y A;  4G12 A;  3HE0 A;  1U9O A;  2RHA A;  4JYK A;  3IH2 A;  3NNR A;  2RAS A;  1JUP A;  5HAW A;  1UI6 A;  3BQY A;  3SFI A;  3VW2 A;  4PXI A;  3VOX A;  5K7Z A;  3B81 A;  3LSP A;  3ZQF A;  2UXI A;  4AF5 A;  2GUH A;  3C2B A;  1JUM A;  1T56 A;  2I10 A;  4V2F A;  5GPC A;  3IH4 A;  2HXO A;  2FQ4 A;  1JTY A;  3CDL A;  3BTJ A;  5IOY A;  2XPV A;  3FRQ A;  2O7O A;  2TRT A;  5AQC A;  4YZE A;  2WGB A;  3PM1 A;  3BHQ A;  5C4Y A;  3HTA A;  5K7F A;  5GPA A;  5D1R A;  3VPR A;  1UI5 A;  3BNI A;  5CXG A;  4ME9 A;  2NS8 A;  5FMP A;  2NS7 A;  3HIM A;  2XGE A;  2UXO A;  2RAE A;  3PAS A;  4B3A A;  3MVP A;  3VOK A;  3ZQL A;  2GBY A;  3GZI A;  3C07 A;  1VI0 A;  1JUS A;  4D5C A;  2FBQ A;  4AC0 A;  4MXM A;  4W97 A;  3CWR A;  3V6G A;  3O8G A;  2HYT A;  2VKE A;  3CJD A;  3HGG A;  2FD5 A;  3KZ9 A;  3BR6 A;  5D19 A;  2QKO A;  5F0C A;  3QQA A;  4M3F A;  2G3B A;  5CW8 A;  1SGM A;  4ACI A;  3HGY A;  3ANG A;  2WUI A; 
#chains in the Genus database with same CATH topology
 2X9D A;  3NRG A;  2OPT A;  3HTJ A;  3KKC A;  4AUX A;  2ZCX A;  2DG8 A;  4JL3 A;  3RD3 A;  3VVZ A;  1ZK8 A;  2NP3 A;  3G1L A;  2IU5 A;  3BRU A;  2EH3 A;  2IEK A;  2G7L A;  3HTH A;  3V78 A;  5F0H A;  3NXC A;  4M3G A;  4GCT A;  3ZQH A;  1JTX A;  3PPB A;  3FK7 A;  4D7M A;  5J1R A;  5FGL A;  3VUQ A;  3F0C A;  4ICH A;  3G7R A;  2G7G A;  3MNL A;  4C2M A;  3IH3 A;  3FIW A;  3BR2 A;  2ZOZ A;  3K8P C;  4CGR A;  2ID6 A;  2XGC A;  1JT0 A;  2Y30 A;  3LSJ A;  4GFK A;  3BTI A;  3DEW A;  5IPA A;  2VPR A;  5FKN A;  1RKT A;  2OER A;  5J3L A;  3TP0 A;  4I76 A;  3NPI A;  5IOZ A;  3BTL A;  4JNN A;  3LOC A;  5FKM A;  3QKX A;  3E7Q A;  5DAJ A;  1ZKG A;  2A2F X;  4GCK A;  3FHN A;  3LWJ A;  3EGQ A;  3KKD A;  2X6O A;  3HTI A;  3SDG A;  3P9T A;  2JK3 A;  3T6N A;  2NP5 A;  3BR1 A;  3G1O A;  3GEU A;  1QPI A;  4GFL A;  3BT9 A;  2YVE A;  3KNW A;  5EYR A;  4V2G A;  4GCL A;  3BTC A;  2R7V A;  5GP9 A;  3RH2 A;  1QVT A;  2UXH A;  2UXU A;  4X1E A;  5HBU A;  2VKV A;  2XDN A;  3CRJ A;  2QWT A;  3VTI A;  4W1U A;  5FHP A;  5F0F A;  2XGD A;  3WHC A;  3VVX A;  3CCY A;  3ZQG A;  4XK4 A;  3LHQ A;  2XPW A;  4AC6 A;  2IAI A;  3DU5 A;  2F07 A;  2PBX A;  3ZQI A;  2QCO A;  3VW1 A;  2R7T A;  3VW0 A;  3F1B A;  3LJL A;  2NX4 A;  3BJB A;  4M3E A;  3ON2 A;  3LSR A;  2DG7 A;  2YVH A;  3G56 A;  4IRV A;  2OF7 A;  2HYJ A;  2JJ7 A;  3Q0V A;  4MK6 A;  5K7H A;  3QPS A;  1T33 A;  1RKW A;  2Y2Z A;  3DCF A;  2HKU A;  2W53 A;  2Y31 A;  2G7S A;  4L62 A;  3KYL A;  3Q0U A;  3VIB A;  3BQZ A;  4OD5 A;  2YVX A;  5EZG A;  5F27 A;  3WHB A;  4D7N A;  2IBD A;  5H9T A;  5D18 A;  3AQT A;  3AQS A;  2HXI A;  2UXP A;  2PZ9 A;  4D5F A;  4HKU A;  2GFN A;  3ANP A;  2QTQ A;  5EZH A;  5J1U A;  4UDS A;  2R7U A;  2OI8 A;  3O8H A;  3VVY A;  5F04 A;  5FKK A;  1QVU A;  3TP3 A;  2Q24 A;  5EFY A;  2XRL A;  2ID3 A;  4B1R A;  3O60 A;  3QBM A;  4M3B A;  3DPJ A;  3BCG A;  3BR0 A;  1RPW A;  2DTZ A;  4ABZ A;  3BR3 A;  3B6C A;  3BR5 A;  2ZOY A;  3VP5 A;  2O7T A;  5K58 A;  4M3D A;  5F1J A;  2XPU A;  3JSJ A;  2QOP A;  2REK A;  3G1M A;  3IUV A;  2R7R A;  3S5R A;  1BJZ A;  3Q0W A;  1ORK A;  3SWH A;  3B6A A;  2V57 A;  3NI7 A;  3ON4 A;  5HSZ A;  2FX0 A;  3FK6 A;  4MO7 A;  3COL A;  2B1E A;  1JT6 A;  2QIB A;  2G0E A;  5IP6 A;  2TCT A;  2XB5 A;  4I6Z A;  4DW6 A;  3QPL A;  2GEN A;  2ZCN A;  5FKL A;  5F08 A;  2R7O A;  2ZB9 A;  5CXI A;  3NS4 A;  4NEL A;  2HQ5 A;  5FKO A;  2WV1 A;  5J1Y A;  1Z0X A;  1A6I A;  3EUP A;  4JKZ A;  1U9N A;  1Z77 A;  3Q3S A;  4NN1 A;  2ZCM A;  4KWA A;  2R7Q A;  2FJ1 A;  2D6Y A;  4G12 A;  3HE0 A;  1U9O A;  2RHA A;  4JYK A;  3IH2 A;  2R7W A;  3NNR A;  2RAS A;  4U9N A;  1JUP A;  5HAW A;  2R7X A;  1UI6 A;  4U9L A;  3BQY A;  3SFI A;  3VW2 A;  4PXI A;  3VOX A;  5K7Z A;  3B81 A;  3LSP A;  3ZQF A;  2UXI A;  4AF5 A;  2GUH A;  3C2B A;  1JUM A;  1T56 A;  3DU6 A;  2I10 A;  2ZY9 A;  4WIB A;  4V2F A;  5GPC A;  3IH4 A;  2HXO A;  2R7S A;  2B3W A;  2FQ4 A;  1JTY A;  3CDL A;  3BTJ A;  5IOY A;  2XPV A;  3FRQ A;  2O7O A;  2TRT A;  4OD4 A;  5AQC A;  4YZE A;  2WGB A;  3PM1 A;  3BHQ A;  5C4Y A;  3HTA A;  5K7F A;  5GPA A;  5D1R A;  3VPR A;  1UI5 A;  3BNI A;  5CXG A;  4ME9 A;  2NS8 A;  5FMP A;  2NS7 A;  3HIM A;  2XGE A;  2UXO A;  2RAE A;  3PAS A;  4B3A A;  3MVP A;  3VOK A;  3ZQL A;  2GBY A;  2PFV A;  3GZI A;  3C07 A;  1VI0 A;  1JUS A;  4D5C A;  4DVY P;  2FBQ A;  4AC0 A;  4MXM A;  4W97 A;  3CWR A;  3V6G A;  3O8G A;  2HYT A;  2VKE A;  3CJD A;  3HGG A;  2FD5 A;  3KZ9 A;  3BR6 A;  5D19 A;  2FJI 1;  2QKO A;  5F0C A;  5CQG A;  3QQA A;  4M3F A;  2G3B A;  5CW8 A;  1SGM A;  4ACI A;  3HGY A;  3ANG A;  2WUI A; 
#chains in the Genus database with same CATH homology
 2X9D A;  3NRG A;  2OPT A;  3HTJ A;  3KKC A;  4AUX A;  2ZCX A;  2DG8 A;  4JL3 A;  3RD3 A;  3VVZ A;  1ZK8 A;  2NP3 A;  3G1L A;  2IU5 A;  3BRU A;  2EH3 A;  2IEK A;  2G7L A;  3HTH A;  3V78 A;  5F0H A;  3NXC A;  4M3G A;  4GCT A;  3ZQH A;  1JTX A;  3PPB A;  3FK7 A;  4D7M A;  5J1R A;  5FGL A;  3VUQ A;  3F0C A;  4ICH A;  3G7R A;  2G7G A;  3MNL A;  3IH3 A;  3FIW A;  3BR2 A;  2ZOZ A;  4CGR A;  2ID6 A;  2XGC A;  1JT0 A;  2Y30 A;  3LSJ A;  4GFK A;  3BTI A;  3DEW A;  5IPA A;  2VPR A;  5FKN A;  1RKT A;  2OER A;  5J3L A;  3TP0 A;  4I76 A;  3NPI A;  5IOZ A;  3BTL A;  4JNN A;  3LOC A;  5FKM A;  3QKX A;  3E7Q A;  5DAJ A;  1ZKG A;  4GCK A;  3LWJ A;  3EGQ A;  3KKD A;  2X6O A;  3HTI A;  3SDG A;  3P9T A;  2JK3 A;  3T6N A;  2NP5 A;  3BR1 A;  3G1O A;  3GEU A;  1QPI A;  4GFL A;  3BT9 A;  2YVE A;  3KNW A;  5EYR A;  4V2G A;  4GCL A;  3BTC A;  5GP9 A;  3RH2 A;  1QVT A;  2UXH A;  2UXU A;  4X1E A;  5HBU A;  2VKV A;  2XDN A;  3CRJ A;  2QWT A;  4W1U A;  5FHP A;  5F0F A;  2XGD A;  3WHC A;  3VVX A;  3CCY A;  3ZQG A;  4XK4 A;  3LHQ A;  2XPW A;  4AC6 A;  2IAI A;  2F07 A;  2PBX A;  3ZQI A;  2QCO A;  3VW1 A;  3VW0 A;  3F1B A;  3LJL A;  2NX4 A;  3BJB A;  4M3E A;  3ON2 A;  3LSR A;  2DG7 A;  2YVH A;  3G56 A;  2OF7 A;  2HYJ A;  2JJ7 A;  3Q0V A;  4MK6 A;  5K7H A;  3QPS A;  1T33 A;  1RKW A;  2Y2Z A;  3DCF A;  2HKU A;  2W53 A;  2Y31 A;  2G7S A;  4L62 A;  3Q0U A;  3VIB A;  3BQZ A;  5F27 A;  5EZG A;  3WHB A;  4D7N A;  2IBD A;  5H9T A;  5D18 A;  3AQT A;  3AQS A;  2HXI A;  2UXP A;  2PZ9 A;  4D5F A;  4HKU A;  2GFN A;  3ANP A;  2QTQ A;  5EZH A;  5J1U A;  4UDS A;  2OI8 A;  3O8H A;  3VVY A;  5F04 A;  5FKK A;  1QVU A;  3TP3 A;  2Q24 A;  5EFY A;  2XRL A;  2ID3 A;  4B1R A;  3O60 A;  3QBM A;  4M3B A;  3DPJ A;  3BCG A;  3BR0 A;  1RPW A;  2DTZ A;  4ABZ A;  3BR3 A;  3B6C A;  3BR5 A;  2ZOY A;  3VP5 A;  2O7T A;  5K58 A;  4M3D A;  5F1J A;  2XPU A;  3JSJ A;  2QOP A;  2REK A;  3G1M A;  3IUV A;  3S5R A;  1BJZ A;  3Q0W A;  1ORK A;  3B6A A;  2V57 A;  3NI7 A;  3ON4 A;  5HSZ A;  2FX0 A;  3FK6 A;  4MO7 A;  3COL A;  1JT6 A;  2QIB A;  2G0E A;  5IP6 A;  2TCT A;  2XB5 A;  4I6Z A;  4DW6 A;  3QPL A;  2GEN A;  2ZCN A;  5FKL A;  5F08 A;  2ZB9 A;  5CXI A;  4NEL A;  2HQ5 A;  5FKO A;  2WV1 A;  5J1Y A;  1Z0X A;  1A6I A;  3EUP A;  4JKZ A;  1U9N A;  1Z77 A;  3Q3S A;  4NN1 A;  2ZCM A;  4KWA A;  2FJ1 A;  2D6Y A;  4G12 A;  3HE0 A;  1U9O A;  2RHA A;  4JYK A;  3IH2 A;  3NNR A;  2RAS A;  1JUP A;  5HAW A;  1UI6 A;  3BQY A;  3SFI A;  3VW2 A;  4PXI A;  3VOX A;  5K7Z A;  3B81 A;  3LSP A;  3ZQF A;  2UXI A;  4AF5 A;  2GUH A;  3C2B A;  1JUM A;  1T56 A;  2I10 A;  4V2F A;  5GPC A;  3IH4 A;  2HXO A;  2FQ4 A;  1JTY A;  3CDL A;  3BTJ A;  5IOY A;  2XPV A;  3FRQ A;  2O7O A;  2TRT A;  5AQC A;  4YZE A;  2WGB A;  3PM1 A;  3BHQ A;  5C4Y A;  3HTA A;  5K7F A;  5GPA A;  5D1R A;  3VPR A;  1UI5 A;  3BNI A;  5CXG A;  4ME9 A;  2NS8 A;  5FMP A;  2NS7 A;  3HIM A;  2XGE A;  2UXO A;  2RAE A;  3PAS A;  4B3A A;  3MVP A;  3VOK A;  3ZQL A;  2GBY A;  3GZI A;  3C07 A;  1VI0 A;  1JUS A;  4D5C A;  2FBQ A;  4AC0 A;  4MXM A;  4W97 A;  3CWR A;  3V6G A;  3O8G A;  2HYT A;  2VKE A;  3CJD A;  3HGG A;  2FD5 A;  3KZ9 A;  3BR6 A;  5D19 A;  2QKO A;  5F0C A;  3QQA A;  4M3F A;  2G3B A;  5CW8 A;  1SGM A;  4ACI A;  3HGY A;  3ANG A;  2WUI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...