3G56A

Structure of the macrolide biosensor protein, mphr(a)
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
183
structure length
180
Chain Sequence
SDDEVLEAATVVLKRCGPIEFTLSGVAKEVGLSRAALIQRFTNRDTLLVRMMERGVEQVRHYLNAIPIGAGPQGLWEFLQVLVRSMNDFSVNYLISWYELQVPELRTLAIQRNRAVVEGIRKRLPPGAPAAAELLLHSVIAGATMQWAVDPDGELADHVLAQIAAILCLMFPEHDDFQLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and function of the macrolide biosensor protein, MphR(A), with and without erythromycin
pubmed doi rcsb
source organism Escherichia coli
molecule tags Dna binding protein
molecule keywords Regulator of macrolide 2'-phosphotransferase I
total genus 65
structure length 180
sequence length 183
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3g56A00
1JUMA 2WUIA 2REKA 3HTIA 1QVTA 1QPIA 2PBXA 2YVHA 3MNLA 4W1UA 3B6AA 2UXPA 2O7TA 3CRJA 3GZIA 2GUHA 2XGDA 2Y2ZA 2UXUA 3MVPA 2ID3A 2HQ5A 5J3LA 3NNRA 2QIBA 3F1BA 5K7FA 2QTQA 3CJDA 3BTJA 3QKXA 3EUPA 4GCTA 3QQAA 2NX4A 3BQZA 2JJ7A 4B1RA 1JT0A 5F27A 4NELA 2GBYA 2NP5A 5F1JA 2HYTA 1JUSA 3VW0A 3G56A 1U9NA 3VVYA 3O60A 3SFIA 5CW8A 5J1YA 1SGMA 3VVXA 5IPAA 2RASA 2NP3A 2HXIA 3VW1A 3Q0VA 3COLA 3AQSA 3G1MA 3KKCA 5F08A 5FKLA 3ANGA 3BR1A 3ANPA 3AQTA 5F0CA 4KWAA 3VOXA 5J1RA 2HXOA 2QKOA 4UDSA 3P9TA 4YZEA 3NRGA 3TP3A 3VIBA 2X9DA 5C4YA 5D18A 2Y31A 2RAEA 4I6ZA 2FJ1A 2Y30A 3BTLA 5IOYA 4NN1A 2XPWA 4W97A 2G3BA 1UI6A 2UXIA 2ZCMA 4B3AA 3KZ9A 5CXIA 2OPTA 3DEWA 3LSRA 3B81A 3QBMA 5EYRA 3DPJA 3QPSA 3GEUA 5CXGA 3SDGA 2XPUA 3QPLA 2DTZA 3ZQGA 3C2BA 5IOZA 4V2FA 2GFNA 2I10A 3NI7A 3ON4A 4JL3A 3FIWA 3KKDA 5EZHA 3BRUA 3IH3A 3FRQA 5F0FA 3TP0A 1RPWA 2YVEA 2ZOZA 2IBDA 3BNIA 3Q0WA 2WGBA 1ZKGA 2OERA 3LSJA 3ZQHA 1JT6A 3BQYA 2X6OA 5DAJA 2UXHA 4X1EA 3KNWA 3G7RA 3ZQFA 1JTYA 1T33A 3BR0A 3DCFA 1JUPA 3VP5A 4JYKA 4HKUA 4I76A 1RKWA 5HSZA 4D5CA 2QWTA 3IH2A 5F0HA 3ZQLA 3VW2A 5K7ZA 4D7NA 4GCKA 2QCOA 5HBUA 4XK4A 3NPIA 4MO7A 2G7LA 4D5FA 2FX0A 2ZCXA 3IUVA 5IP6A 3BHQA 3BR2A 3BJBA 2ZOYA 3JSJA 5GP9A 4M3FA 3WHBA 4D7MA 1T56A 1BJZA 3Q0UA 2DG7A 2IEKA 2XDNA 1U9OA 1VI0A 3O8GA 2WV1A 2UXOA 3PPBA 4CGRA 3HTAA 3LJLA 3BTIA 2Q24A 2QOPA 5H9TA 3HIMA 2ZCNA 1A6IA 3HTHA 3V78A 5FHPA 2NS8A 2G0EA 4M3EA 3CCYA 2DG8A 3BR3A 3LWJA 3HGGA 5HAWA 3O8HA 2TRTA 3LHQA 4ABZA 3NXCA 2VPRA 3BR6A 2HKUA 2EH3A 3RH2A 2V57A 3G1OA 2TCTA 4V2GA 3Q3SA 4ME9A 3ON2A 2XB5A 4M3BA 3IH4A 3BR5A 4AC6A 5J1UA 2NS7A 1ORKA 3PASA 3EGQA 5FKKA 4JNNA 3VOKA 5D1RA 3HGYA 4ACIA 3RD3A 2D6YA 3FK7A 4ICHA 4GFLA 5GPAA 3F0CA 2ZB9A 2XGEA 3ZQIA 5D19A 2IU5A 3B6CA 4MXMA 2FBQA 2XGCA 4JKZA 2PZ9A 2RHAA 5FKOA 3VUQA 4M3DA 3T6NA 3BCGA 1UI5A 1QVUA 1ZK8A 3G1LA 2G7GA 4AF5A 4GFKA 3LOCA 3PM1A 1Z77A 4M3GA 5EZGA 2IAIA 4AC0A 5K7HA 2W53A 2VKEA 1RKTA 2OI8A 2FQ4A 2O7OA 4AUXA 3CWRA 5AQCA 3S5RA 2GENA 5GPCA 3CDLA 2VKVA 5FKMA 2XRLA 5FMPA 4DW6A 4GCLA 4PXIA 3VVZA 2ID6A 1JTXA 3VPRA 3BTCA 3BT9A 4MK6A 3V6GA 1Z0XA 2OF7A 5FGLA 5EFYA 2JK3A 4L62A 2G7SA 5K58A 4G12A 2XPVA 3HTJA 5F04A 3FK6A 2FD5A 3E7QA 3LSPA 2HYJA 3HE0A 3WHCA 2F07A 3C07A 5FKNA
chains in the Genus database with same CATH superfamily
1JUMA 2WUIA 2REKA 2B1EA 3HTIA 2YVXA 1QVTA 1QPIA 2PBXA 2YVHA 3MNLA 4W1UA 3B6AA 2UXPA 2O7TA 3CRJA 3GZIA 3FHNA 2GUHA 2XGDA 2Y2ZA 2UXUA 3MVPA 2ID3A 2HQ5A 5J3LA 3NNRA 2QIBA 3F1BA 5K7FA 2QTQA 3CJDA 3BTJA 3QKXA 3EUPA 4GCTA 3QQAA 2NX4A 3BQZA 2JJ7A 4B1RA 1JT0A 5F27A 4NELA 2GBYA 2NP5A 5F1JA 2HYTA 1JUSA 3VW0A 3G56A 1U9NA 3VVYA 3O60A 3SFIA 5CW8A 3DU5A 5J1YA 1SGMA 3VVXA 5IPAA 2RASA 2NP3A 2HXIA 3VW1A 3Q0VA 3COLA 3AQSA 3G1MA 3KKCA 5F08A 5FKLA 3ANGA 3BR1A 3ANPA 3AQTA 5F0CA 4KWAA 2R7SA 3VOXA 5J1RA 2HXOA 2QKOA 4UDSA 3P9TA 4YZEA 2R7UA 3NRGA 3TP3A 3VIBA 2X9DA 5C4YA 5D18A 3SWHA 2Y31A 2RAEA 4I6ZA 2FJ1A 2Y30A 3BTLA 5IOYA 4NN1A 2XPWA 4W97A 2G3BA 1UI6A 2UXIA 2ZCMA 4B3AA 3KZ9A 5CXIA 2OPTA 3DEWA 3LSRA 3B81A 3QBMA 5EYRA 3DPJA 3QPSA 3GEUA 4OD4A 5CXGA 3SDGA 2XPUA 3QPLA 2DTZA 3ZQGA 2R7RA 3C2BA 5IOZA 4V2FA 2GFNA 2R7WA 2I10A 3NI7A 3ON4A 4JL3A 3FIWA 3KKDA 5EZHA 3BRUA 3IH3A 3FRQA 5F0FA 3TP0A 1RPWA 2YVEA 2ZOZA 2IBDA 3BNIA 3Q0WA 2WGBA 1ZKGA 2OERA 3LSJA 3ZQHA 1JT6A 3BQYA 2X6OA 5DAJA 2UXHA 4X1EA 3KNWA 2PFVA 3G7RA 5CQGA 3ZQFA 1JTYA 1T33A 3BR0A 3DCFA 1JUPA 3VP5A 4JYKA 4HKUA 4I76A 1RKWA 5HSZA 4D5CA 2QWTA 3IH2A 5F0HA 3ZQLA 3VW2A 5K7ZA 4D7NA 4GCKA 2QCOA 5HBUA 4XK4A 3NPIA 4MO7A 4C2MA 2G7LA 4D5FA 2FX0A 2ZCXA 3IUVA 5IP6A 3BHQA 3BR2A 3BJBA 2ZOYA 3JSJA 5GP9A 4M3FA 3WHBA 2R7XA 3DU6A 4D7MA 1T56A 1BJZA 3Q0UA 2DG7A 2IEKA 2XDNA 1U9OA 1VI0A 3O8GA 2WV1A 2UXOA 3PPBA 4CGRA 3HTAA 3LJLA 3BTIA 2Q24A 2QOPA 5H9TA 2A2FX 3HIMA 2ZCNA 1A6IA 3HTHA 3V78A 5FHPA 2NS8A 2G0EA 4OD5A 4M3EA 3CCYA 2DG8A 2R7QA 3BR3A 3LWJA 3HGGA 5HAWA 3O8HA 2TRTA 3LHQA 4ABZA 4U9NA 3NXCA 2VPRA 3BR6A 2HKUA 2EH3A 3RH2A 2V57A 3G1OA 2TCTA 4V2GA 3Q3SA 4ME9A 3ON2A 2XB5A 4M3BA 3KYLA 3IH4A 3BR5A 4WIBA 4AC6A 5J1UA 2NS7A 1ORKA 3PASA 3EGQA 5FKKA 4JNNA 3VOKA 2R7TA 2B3WA 5D1RA 3HGYA 4ACIA 3RD3A 2D6YA 3FK7A 2R7VA 4ICHA 4GFLA 5GPAA 3F0CA 2ZB9A 2XGEA 3ZQIA 5D19A 2IU5A 3B6CA 4MXMA 2FBQA 2XGCA 4JKZA 2PZ9A 2RHAA 5FKOA 2R7OA 3VUQA 4M3DA 3T6NA 3BCGA 1UI5A 1QVUA 1ZK8A 3G1LA 2G7GA 4AF5A 4GFKA 3K8PC 3LOCA 3PM1A 1Z77A 3NS4A 4M3GA 5EZGA 2IAIA 4AC0A 5K7HA 2W53A 2VKEA 1RKTA 2OI8A 2FQ4A 2O7OA 4AUXA 2ZY9A 3CWRA 5AQCA 3S5RA 2GENA 5GPCA 3CDLA 2VKVA 5FKMA 2XRLA 5FMPA 4DW6A 4GCLA 4PXIA 4U9LA 3VVZA 2ID6A 1JTXA 3VPRA 3BTCA 3BT9A 4MK6A 3V6GA 1Z0XA 2OF7A 5FGLA 5EFYA 4DVYP 2JK3A 4L62A 2G7SA 5K58A 4G12A 2XPVA 3HTJA 5F04A 3FK6A 2FD5A 3E7QA 3LSPA 4IRVA 2HYJA 3HE0A 3WHCA 2F07A 3VTIA 2FJI1 3C07A 5FKNA
chains in the Genus database with same CATH topology
1JUMA 2WUIA 2REKA 3HTIA 1QVTA 1QPIA 2PBXA 2YVHA 3MNLA 4W1UA 3B6AA 2UXPA 2O7TA 3CRJA 3GZIA 2GUHA 2XGDA 2Y2ZA 2UXUA 3MVPA 2ID3A 2HQ5A 5J3LA 3NNRA 2QIBA 3F1BA 5K7FA 2QTQA 3CJDA 3BTJA 3QKXA 3EUPA 4GCTA 3QQAA 2NX4A 3BQZA 2JJ7A 4B1RA 1JT0A 5F27A 4NELA 2GBYA 2NP5A 5F1JA 2HYTA 1JUSA 3VW0A 3G56A 1U9NA 3VVYA 3O60A 3SFIA 5CW8A 5J1YA 1SGMA 3VVXA 5IPAA 2RASA 2NP3A 2HXIA 3VW1A 3Q0VA 3COLA 3AQSA 3G1MA 3KKCA 5F08A 5FKLA 3ANGA 3BR1A 3ANPA 3AQTA 5F0CA 4KWAA 3VOXA 5J1RA 2HXOA 2QKOA 4UDSA 3P9TA 4YZEA 3NRGA 3TP3A 3VIBA 2X9DA 5C4YA 5D18A 2Y31A 2RAEA 4I6ZA 2FJ1A 2Y30A 3BTLA 5IOYA 4NN1A 2XPWA 4W97A 2G3BA 1UI6A 2UXIA 2ZCMA 4B3AA 3KZ9A 5CXIA 2OPTA 3DEWA 3LSRA 3B81A 3QBMA 5EYRA 3DPJA 3QPSA 3GEUA 5CXGA 3SDGA 2XPUA 3QPLA 2DTZA 3ZQGA 3C2BA 5IOZA 4V2FA 2GFNA 2I10A 3NI7A 3ON4A 4JL3A 3FIWA 3KKDA 5EZHA 3BRUA 3IH3A 3FRQA 5F0FA 3TP0A 1RPWA 2YVEA 2ZOZA 2IBDA 3BNIA 3Q0WA 2WGBA 1ZKGA 2OERA 3LSJA 3ZQHA 1JT6A 3BQYA 2X6OA 5DAJA 2UXHA 4X1EA 3KNWA 3G7RA 3ZQFA 1JTYA 1T33A 3BR0A 3DCFA 1JUPA 3VP5A 4JYKA 4HKUA 4I76A 1RKWA 5HSZA 4D5CA 2QWTA 3IH2A 5F0HA 3ZQLA 3VW2A 5K7ZA 4D7NA 4GCKA 2QCOA 5HBUA 4XK4A 3NPIA 4MO7A 2G7LA 4D5FA 2FX0A 2ZCXA 3IUVA 5IP6A 3BHQA 3BR2A 3BJBA 2ZOYA 3JSJA 5GP9A 4M3FA 3WHBA 4D7MA 1T56A 1BJZA 3Q0UA 2DG7A 2IEKA 2XDNA 1U9OA 1VI0A 3O8GA 2WV1A 2UXOA 3PPBA 4CGRA 3HTAA 3LJLA 3BTIA 2Q24A 2QOPA 5H9TA 3HIMA 2ZCNA 1A6IA 3HTHA 3V78A 5FHPA 2NS8A 2G0EA 4M3EA 3CCYA 2DG8A 3BR3A 3LWJA 3HGGA 5HAWA 3O8HA 2TRTA 3LHQA 4ABZA 3NXCA 2VPRA 3BR6A 2HKUA 2EH3A 3RH2A 2V57A 3G1OA 2TCTA 4V2GA 3Q3SA 4ME9A 3ON2A 2XB5A 4M3BA 3IH4A 3BR5A 4AC6A 5J1UA 2NS7A 1ORKA 3PASA 3EGQA 5FKKA 4JNNA 3VOKA 5D1RA 3HGYA 4ACIA 3RD3A 2D6YA 3FK7A 4ICHA 4GFLA 5GPAA 3F0CA 2ZB9A 2XGEA 3ZQIA 5D19A 2IU5A 3B6CA 4MXMA 2FBQA 2XGCA 4JKZA 2PZ9A 2RHAA 5FKOA 3VUQA 4M3DA 3T6NA 3BCGA 1UI5A 1QVUA 1ZK8A 3G1LA 2G7GA 4AF5A 4GFKA 3LOCA 3PM1A 1Z77A 4M3GA 5EZGA 2IAIA 4AC0A 5K7HA 2W53A 2VKEA 1RKTA 2OI8A 2FQ4A 2O7OA 4AUXA 3CWRA 5AQCA 3S5RA 2GENA 5GPCA 3CDLA 2VKVA 5FKMA 2XRLA 5FMPA 4DW6A 4GCLA 4PXIA 3VVZA 2ID6A 1JTXA 3VPRA 3BTCA 3BT9A 4MK6A 3V6GA 1Z0XA 2OF7A 5FGLA 5EFYA 2JK3A 4L62A 2G7SA 5K58A 4G12A 2XPVA 3HTJA 5F04A 3FK6A 2FD5A 3E7QA 3LSPA 2HYJA 3HE0A 3WHCA 2F07A 3C07A 5FKNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JUM A;  2WUI A;  2REK A;  3HTI A;  1QVT A;  1QPI A;  2PBX A;  2YVH A;  3MNL A;  4W1U A;  3B6A A;  2UXP A;  2O7T A;  3CRJ A;  3GZI A;  2GUH A;  2XGD A;  2Y2Z A;  2UXU A;  3MVP A;  2ID3 A;  2HQ5 A;  5J3L A;  3NNR A;  2QIB A;  3F1B A;  5K7F A;  2QTQ A;  3CJD A;  3BTJ A;  3QKX A;  3EUP A;  4GCT A;  3QQA A;  2NX4 A;  3BQZ A;  2JJ7 A;  4B1R A;  1JT0 A;  5F27 A;  4NEL A;  2GBY A;  2NP5 A;  5F1J A;  2HYT A;  1JUS A;  3VW0 A;  3G56 A;  1U9N A;  3VVY A;  3O60 A;  3SFI A;  5CW8 A;  5J1Y A;  1SGM A;  3VVX A;  5IPA A;  2RAS A;  2NP3 A;  2HXI A;  3VW1 A;  3Q0V A;  3COL A;  3AQS A;  3G1M A;  3KKC A;  5F08 A;  5FKL A;  3ANG A;  3BR1 A;  3ANP A;  3AQT A;  5F0C A;  4KWA A;  3VOX A;  5J1R A;  2HXO A;  2QKO A;  4UDS A;  3P9T A;  4YZE A;  3NRG A;  3TP3 A;  3VIB A;  2X9D A;  5C4Y A;  5D18 A;  2Y31 A;  2RAE A;  4I6Z A;  2FJ1 A;  2Y30 A;  3BTL A;  5IOY A;  4NN1 A;  2XPW A;  4W97 A;  2G3B A;  1UI6 A;  2UXI A;  2ZCM A;  4B3A A;  3KZ9 A;  5CXI A;  2OPT A;  3DEW A;  3LSR A;  3B81 A;  3QBM A;  5EYR A;  3DPJ A;  3QPS A;  3GEU A;  5CXG A;  3SDG A;  2XPU A;  3QPL A;  2DTZ A;  3ZQG A;  3C2B A;  5IOZ A;  4V2F A;  2GFN A;  2I10 A;  3NI7 A;  3ON4 A;  4JL3 A;  3FIW A;  3KKD A;  5EZH A;  3BRU A;  3IH3 A;  3FRQ A;  5F0F A;  3TP0 A;  1RPW A;  2YVE A;  2ZOZ A;  2IBD A;  3BNI A;  3Q0W A;  2WGB A;  1ZKG A;  2OER A;  3LSJ A;  3ZQH A;  1JT6 A;  3BQY A;  2X6O A;  5DAJ A;  2UXH A;  4X1E A;  3KNW A;  3G7R A;  3ZQF A;  1JTY A;  1T33 A;  3BR0 A;  3DCF A;  1JUP A;  3VP5 A;  4JYK A;  4HKU A;  4I76 A;  1RKW A;  5HSZ A;  4D5C A;  2QWT A;  3IH2 A;  5F0H A;  3ZQL A;  3VW2 A;  5K7Z A;  4D7N A;  4GCK A;  2QCO A;  5HBU A;  4XK4 A;  3NPI A;  4MO7 A;  2G7L A;  4D5F A;  2FX0 A;  2ZCX A;  3IUV A;  5IP6 A;  3BHQ A;  3BR2 A;  3BJB A;  2ZOY A;  3JSJ A;  5GP9 A;  4M3F A;  3WHB A;  4D7M A;  1T56 A;  1BJZ A;  3Q0U A;  2DG7 A;  2IEK A;  2XDN A;  1U9O A;  1VI0 A;  3O8G A;  2WV1 A;  2UXO A;  3PPB A;  4CGR A;  3HTA A;  3LJL A;  3BTI A;  2Q24 A;  2QOP A;  5H9T A;  3HIM A;  2ZCN A;  1A6I A;  3HTH A;  3V78 A;  5FHP A;  2NS8 A;  2G0E A;  4M3E A;  3CCY A;  2DG8 A;  3BR3 A;  3LWJ A;  3HGG A;  5HAW A;  3O8H A;  2TRT A;  3LHQ A;  4ABZ A;  3NXC A;  2VPR A;  3BR6 A;  2HKU A;  2EH3 A;  3RH2 A;  2V57 A;  3G1O A;  2TCT A;  4V2G A;  3Q3S A;  4ME9 A;  3ON2 A;  2XB5 A;  4M3B A;  3IH4 A;  3BR5 A;  4AC6 A;  5J1U A;  2NS7 A;  1ORK A;  3PAS A;  3EGQ A;  5FKK A;  4JNN A;  3VOK A;  5D1R A;  3HGY A;  4ACI A;  3RD3 A;  2D6Y A;  3FK7 A;  4ICH A;  4GFL A;  5GPA A;  3F0C A;  2ZB9 A;  2XGE A;  3ZQI A;  5D19 A;  2IU5 A;  3B6C A;  4MXM A;  2FBQ A;  2XGC A;  4JKZ A;  2PZ9 A;  2RHA A;  5FKO A;  3VUQ A;  4M3D A;  3T6N A;  3BCG A;  1UI5 A;  1QVU A;  1ZK8 A;  3G1L A;  2G7G A;  4AF5 A;  4GFK A;  3LOC A;  3PM1 A;  1Z77 A;  4M3G A;  5EZG A;  2IAI A;  4AC0 A;  5K7H A;  2W53 A;  2VKE A;  1RKT A;  2OI8 A;  2FQ4 A;  2O7O A;  4AUX A;  3CWR A;  5AQC A;  3S5R A;  2GEN A;  5GPC A;  3CDL A;  2VKV A;  5FKM A;  2XRL A;  5FMP A;  4DW6 A;  4GCL A;  4PXI A;  3VVZ A;  2ID6 A;  1JTX A;  3VPR A;  3BTC A;  3BT9 A;  4MK6 A;  3V6G A;  1Z0X A;  2OF7 A;  5FGL A;  5EFY A;  2JK3 A;  4L62 A;  2G7S A;  5K58 A;  4G12 A;  2XPV A;  3HTJ A;  5F04 A;  3FK6 A;  2FD5 A;  3E7Q A;  3LSP A;  2HYJ A;  3HE0 A;  3WHC A;  2F07 A;  3C07 A;  5FKN A; 
#chains in the Genus database with same CATH topology
 1JUM A;  2WUI A;  2REK A;  2B1E A;  3HTI A;  2YVX A;  1QVT A;  1QPI A;  2PBX A;  2YVH A;  3MNL A;  4W1U A;  3B6A A;  2UXP A;  2O7T A;  3CRJ A;  3GZI A;  3FHN A;  2GUH A;  2XGD A;  2Y2Z A;  2UXU A;  3MVP A;  2ID3 A;  2HQ5 A;  5J3L A;  3NNR A;  2QIB A;  3F1B A;  5K7F A;  2QTQ A;  3CJD A;  3BTJ A;  3QKX A;  3EUP A;  4GCT A;  3QQA A;  2NX4 A;  3BQZ A;  2JJ7 A;  4B1R A;  1JT0 A;  5F27 A;  4NEL A;  2GBY A;  2NP5 A;  5F1J A;  2HYT A;  1JUS A;  3VW0 A;  3G56 A;  1U9N A;  3VVY A;  3O60 A;  3SFI A;  5CW8 A;  3DU5 A;  5J1Y A;  1SGM A;  3VVX A;  5IPA A;  2RAS A;  2NP3 A;  2HXI A;  3VW1 A;  3Q0V A;  3COL A;  3AQS A;  3G1M A;  3KKC A;  5F08 A;  5FKL A;  3ANG A;  3BR1 A;  3ANP A;  3AQT A;  5F0C A;  4KWA A;  2R7S A;  3VOX A;  5J1R A;  2HXO A;  2QKO A;  4UDS A;  3P9T A;  4YZE A;  2R7U A;  3NRG A;  3TP3 A;  3VIB A;  2X9D A;  5C4Y A;  5D18 A;  3SWH A;  2Y31 A;  2RAE A;  4I6Z A;  2FJ1 A;  2Y30 A;  3BTL A;  5IOY A;  4NN1 A;  2XPW A;  4W97 A;  2G3B A;  1UI6 A;  2UXI A;  2ZCM A;  4B3A A;  3KZ9 A;  5CXI A;  2OPT A;  3DEW A;  3LSR A;  3B81 A;  3QBM A;  5EYR A;  3DPJ A;  3QPS A;  3GEU A;  4OD4 A;  5CXG A;  3SDG A;  2XPU A;  3QPL A;  2DTZ A;  3ZQG A;  2R7R A;  3C2B A;  5IOZ A;  4V2F A;  2GFN A;  2R7W A;  2I10 A;  3NI7 A;  3ON4 A;  4JL3 A;  3FIW A;  3KKD A;  5EZH A;  3BRU A;  3IH3 A;  3FRQ A;  5F0F A;  3TP0 A;  1RPW A;  2YVE A;  2ZOZ A;  2IBD A;  3BNI A;  3Q0W A;  2WGB A;  1ZKG A;  2OER A;  3LSJ A;  3ZQH A;  1JT6 A;  3BQY A;  2X6O A;  5DAJ A;  2UXH A;  4X1E A;  3KNW A;  2PFV A;  3G7R A;  5CQG A;  3ZQF A;  1JTY A;  1T33 A;  3BR0 A;  3DCF A;  1JUP A;  3VP5 A;  4JYK A;  4HKU A;  4I76 A;  1RKW A;  5HSZ A;  4D5C A;  2QWT A;  3IH2 A;  5F0H A;  3ZQL A;  3VW2 A;  5K7Z A;  4D7N A;  4GCK A;  2QCO A;  5HBU A;  4XK4 A;  3NPI A;  4MO7 A;  4C2M A;  2G7L A;  4D5F A;  2FX0 A;  2ZCX A;  3IUV A;  5IP6 A;  3BHQ A;  3BR2 A;  3BJB A;  2ZOY A;  3JSJ A;  5GP9 A;  4M3F A;  3WHB A;  2R7X A;  3DU6 A;  4D7M A;  1T56 A;  1BJZ A;  3Q0U A;  2DG7 A;  2IEK A;  2XDN A;  1U9O A;  1VI0 A;  3O8G A;  2WV1 A;  2UXO A;  3PPB A;  4CGR A;  3HTA A;  3LJL A;  3BTI A;  2Q24 A;  2QOP A;  5H9T A;  2A2F X;  3HIM A;  2ZCN A;  1A6I A;  3HTH A;  3V78 A;  5FHP A;  2NS8 A;  2G0E A;  4OD5 A;  4M3E A;  3CCY A;  2DG8 A;  2R7Q A;  3BR3 A;  3LWJ A;  3HGG A;  5HAW A;  3O8H A;  2TRT A;  3LHQ A;  4ABZ A;  4U9N A;  3NXC A;  2VPR A;  3BR6 A;  2HKU A;  2EH3 A;  3RH2 A;  2V57 A;  3G1O A;  2TCT A;  4V2G A;  3Q3S A;  4ME9 A;  3ON2 A;  2XB5 A;  4M3B A;  3KYL A;  3IH4 A;  3BR5 A;  4WIB A;  4AC6 A;  5J1U A;  2NS7 A;  1ORK A;  3PAS A;  3EGQ A;  5FKK A;  4JNN A;  3VOK A;  2R7T A;  2B3W A;  5D1R A;  3HGY A;  4ACI A;  3RD3 A;  2D6Y A;  3FK7 A;  2R7V A;  4ICH A;  4GFL A;  5GPA A;  3F0C A;  2ZB9 A;  2XGE A;  3ZQI A;  5D19 A;  2IU5 A;  3B6C A;  4MXM A;  2FBQ A;  2XGC A;  4JKZ A;  2PZ9 A;  2RHA A;  5FKO A;  2R7O A;  3VUQ A;  4M3D A;  3T6N A;  3BCG A;  1UI5 A;  1QVU A;  1ZK8 A;  3G1L A;  2G7G A;  4AF5 A;  4GFK A;  3K8P C;  3LOC A;  3PM1 A;  1Z77 A;  3NS4 A;  4M3G A;  5EZG A;  2IAI A;  4AC0 A;  5K7H A;  2W53 A;  2VKE A;  1RKT A;  2OI8 A;  2FQ4 A;  2O7O A;  4AUX A;  2ZY9 A;  3CWR A;  5AQC A;  3S5R A;  2GEN A;  5GPC A;  3CDL A;  2VKV A;  5FKM A;  2XRL A;  5FMP A;  4DW6 A;  4GCL A;  4PXI A;  4U9L A;  3VVZ A;  2ID6 A;  1JTX A;  3VPR A;  3BTC A;  3BT9 A;  4MK6 A;  3V6G A;  1Z0X A;  2OF7 A;  5FGL A;  5EFY A;  4DVY P;  2JK3 A;  4L62 A;  2G7S A;  5K58 A;  4G12 A;  2XPV A;  3HTJ A;  5F04 A;  3FK6 A;  2FD5 A;  3E7Q A;  3LSP A;  4IRV A;  2HYJ A;  3HE0 A;  3WHC A;  2F07 A;  3VTI A;  2FJI 1;  3C07 A;  5FKN A; 
#chains in the Genus database with same CATH homology
 1JUM A;  2WUI A;  2REK A;  3HTI A;  1QVT A;  1QPI A;  2PBX A;  2YVH A;  3MNL A;  4W1U A;  3B6A A;  2UXP A;  2O7T A;  3CRJ A;  3GZI A;  2GUH A;  2XGD A;  2Y2Z A;  2UXU A;  3MVP A;  2ID3 A;  2HQ5 A;  5J3L A;  3NNR A;  2QIB A;  3F1B A;  5K7F A;  2QTQ A;  3CJD A;  3BTJ A;  3QKX A;  3EUP A;  4GCT A;  3QQA A;  2NX4 A;  3BQZ A;  2JJ7 A;  4B1R A;  1JT0 A;  5F27 A;  4NEL A;  2GBY A;  2NP5 A;  5F1J A;  2HYT A;  1JUS A;  3VW0 A;  3G56 A;  1U9N A;  3VVY A;  3O60 A;  3SFI A;  5CW8 A;  5J1Y A;  1SGM A;  3VVX A;  5IPA A;  2RAS A;  2NP3 A;  2HXI A;  3VW1 A;  3Q0V A;  3COL A;  3AQS A;  3G1M A;  3KKC A;  5F08 A;  5FKL A;  3ANG A;  3BR1 A;  3ANP A;  3AQT A;  5F0C A;  4KWA A;  3VOX A;  5J1R A;  2HXO A;  2QKO A;  4UDS A;  3P9T A;  4YZE A;  3NRG A;  3TP3 A;  3VIB A;  2X9D A;  5C4Y A;  5D18 A;  2Y31 A;  2RAE A;  4I6Z A;  2FJ1 A;  2Y30 A;  3BTL A;  5IOY A;  4NN1 A;  2XPW A;  4W97 A;  2G3B A;  1UI6 A;  2UXI A;  2ZCM A;  4B3A A;  3KZ9 A;  5CXI A;  2OPT A;  3DEW A;  3LSR A;  3B81 A;  3QBM A;  5EYR A;  3DPJ A;  3QPS A;  3GEU A;  5CXG A;  3SDG A;  2XPU A;  3QPL A;  2DTZ A;  3ZQG A;  3C2B A;  5IOZ A;  4V2F A;  2GFN A;  2I10 A;  3NI7 A;  3ON4 A;  4JL3 A;  3FIW A;  3KKD A;  5EZH A;  3BRU A;  3IH3 A;  3FRQ A;  5F0F A;  3TP0 A;  1RPW A;  2YVE A;  2ZOZ A;  2IBD A;  3BNI A;  3Q0W A;  2WGB A;  1ZKG A;  2OER A;  3LSJ A;  3ZQH A;  1JT6 A;  3BQY A;  2X6O A;  5DAJ A;  2UXH A;  4X1E A;  3KNW A;  3G7R A;  3ZQF A;  1JTY A;  1T33 A;  3BR0 A;  3DCF A;  1JUP A;  3VP5 A;  4JYK A;  4HKU A;  4I76 A;  1RKW A;  5HSZ A;  4D5C A;  2QWT A;  3IH2 A;  5F0H A;  3ZQL A;  3VW2 A;  5K7Z A;  4D7N A;  4GCK A;  2QCO A;  5HBU A;  4XK4 A;  3NPI A;  4MO7 A;  2G7L A;  4D5F A;  2FX0 A;  2ZCX A;  3IUV A;  5IP6 A;  3BHQ A;  3BR2 A;  3BJB A;  2ZOY A;  3JSJ A;  5GP9 A;  4M3F A;  3WHB A;  4D7M A;  1T56 A;  1BJZ A;  3Q0U A;  2DG7 A;  2IEK A;  2XDN A;  1U9O A;  1VI0 A;  3O8G A;  2WV1 A;  2UXO A;  3PPB A;  4CGR A;  3HTA A;  3LJL A;  3BTI A;  2Q24 A;  2QOP A;  5H9T A;  3HIM A;  2ZCN A;  1A6I A;  3HTH A;  3V78 A;  5FHP A;  2NS8 A;  2G0E A;  4M3E A;  3CCY A;  2DG8 A;  3BR3 A;  3LWJ A;  3HGG A;  5HAW A;  3O8H A;  2TRT A;  3LHQ A;  4ABZ A;  3NXC A;  2VPR A;  3BR6 A;  2HKU A;  2EH3 A;  3RH2 A;  2V57 A;  3G1O A;  2TCT A;  4V2G A;  3Q3S A;  4ME9 A;  3ON2 A;  2XB5 A;  4M3B A;  3IH4 A;  3BR5 A;  4AC6 A;  5J1U A;  2NS7 A;  1ORK A;  3PAS A;  3EGQ A;  5FKK A;  4JNN A;  3VOK A;  5D1R A;  3HGY A;  4ACI A;  3RD3 A;  2D6Y A;  3FK7 A;  4ICH A;  4GFL A;  5GPA A;  3F0C A;  2ZB9 A;  2XGE A;  3ZQI A;  5D19 A;  2IU5 A;  3B6C A;  4MXM A;  2FBQ A;  2XGC A;  4JKZ A;  2PZ9 A;  2RHA A;  5FKO A;  3VUQ A;  4M3D A;  3T6N A;  3BCG A;  1UI5 A;  1QVU A;  1ZK8 A;  3G1L A;  2G7G A;  4AF5 A;  4GFK A;  3LOC A;  3PM1 A;  1Z77 A;  4M3G A;  5EZG A;  2IAI A;  4AC0 A;  5K7H A;  2W53 A;  2VKE A;  1RKT A;  2OI8 A;  2FQ4 A;  2O7O A;  4AUX A;  3CWR A;  5AQC A;  3S5R A;  2GEN A;  5GPC A;  3CDL A;  2VKV A;  5FKM A;  2XRL A;  5FMP A;  4DW6 A;  4GCL A;  4PXI A;  3VVZ A;  2ID6 A;  1JTX A;  3VPR A;  3BTC A;  3BT9 A;  4MK6 A;  3V6G A;  1Z0X A;  2OF7 A;  5FGL A;  5EFY A;  2JK3 A;  4L62 A;  2G7S A;  5K58 A;  4G12 A;  2XPV A;  3HTJ A;  5F04 A;  3FK6 A;  2FD5 A;  3E7Q A;  3LSP A;  2HYJ A;  3HE0 A;  3WHC A;  2F07 A;  3C07 A;  5FKN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...