3SWHA

Munc13-1, mun domain, c-terminal module
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
316
structure length
295
Chain Sequence
AWFEPFVIQWLDENEEVSRDFLHGALERDKKDGFQQTSEHALFSCSVVDVFSQLNQSFEIIKKLECPDPQIVGHYMRRFAKTISNVLLQYADIVSKDFASYCSKEKEKVPCILMNNTQQLRVQLEKMFEAMGGKELDAEASGTLKELQVKLNNVLDELSHVFATSFQPHIEECVRQMGDILSQVKSVAQDADNVLQPIMDLLDSNLTLFAKICEKTVLKRVLKELWKLVMNTMERTIVLPPEFSKLKDHPKQCAVVELALDTIKQYFHAGGVGLKKTFLEKSPDLQSLRYALSLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Crystal Structure of a Munc13 C-terminal Module Exhibits a Remarkable Similarity to Vesicle Tethering Factors.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Exocytosis
molecule keywords Protein unc-13 homolog A
total genus 130
structure length 295
sequence length 316
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10540 Membr_traf_MHD Munc13 (mammalian uncoordinated) homology domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.50 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor; domain 2 3swhA01
1.20.58.1100 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3swhA02
2FJI1 3SWHA
chains in the Genus database with same CATH superfamily
2PTFA 3O1JA 2X0HA 1UURA 1LRZA 2YK0A 2VB6A 5C4YA 4TNWA 1S35A 4EGWA 2BG9B 2X9YA 4I6ZA 1UI6A 3JADA 3CX6B 3NKZA 5L2LA 4ZOLE 2VVSA 2WGBA 2UUCT 2XSBA 5FY0A 1IJ6A 5LHIB 1KF6A 1X9BA 4DO0A 1XZYA 4H9SE 4DW6A 3C4ZA 4WZXA 3C07A 3S5RA 4ICHA 2XZEA 2E9XC 3Q5XA 3VKGA 5GP9A 5EYRA 5FKNA 2CLYB 4MFRA 2X9WA 2GBYA 3SFIA 1IZNB 3LBXA 1U4QA 1N33T 4NN1A 3BQKA 5EK4A 2V5DA 4P0AA 2ZOZA 3RIFA 3TLVA 2HYTA 3OTOT 1ZP0A 2WZIA 2RASA 2QWTA 3IH2A 4DR5T 3TP0A 3DCFA 3PM1A 2FUPA 4JKZA 3IHRA 4BJMA 2TRTA 3CKDA 3ZEFB 1JT6A 5LXTE 2W63A 4YJ2E 3K3QC 3RYIE 1JNRA 3I0OA 2BS2A 3E08A 4KWAA 4COFA 3UU4A 2FBWA 3LK2B 5JDGA 3RLFF 1D0XA 4PJJA 4F8HA 1XNQT 4IE4A 3WHCA 2C5IT 3GN5A 4K0UA 2XPKA 2IIUA 3UU8A 4IRVA 3HKBE 3L39A 4L62A 4AQGA 1IBLT 1QUUA 3VU7H 3S4UA 1G73A 3FZKB 3E22E 4EXTA 4OFZA 1QVUA 2FJAA 2Q9QD 3ETUA 3AA0B 1NEKA 4HWDA 3NXCA 2FJI1 4CI3B 4JI6T 2I10A 2H7VC 4TWDA 5CGMA 3HKDE 2W00A 3RQUA 3LDQB 4ACIA 3HE0A 4M1PA 3SDGA 5IHYA 3JC6D 3AE9A 2UXIA 4YZEA 2Y8DA 2IUBA 2B76A 1VCTA 1N34T 2DHRA 2IU5A 3V5SA 3GN5B 2WWVA 3PURA 3LWJA 3ANGA 2YDQA 5F8PA 3SWHA 5AQTB 2L3LA 2FQ4A 3BR1A 4HWHA 4KX6A 4WW0A 4PW8A 2VURA 2IBDA 4AF5A 3N9MA 3R84B 2XRLA 2CWYA 3HR0A 2MAWA 1BR2A 5AFUL 3P4SA 4CGRA 3N9QA 2XB5A 1QPIA 2ZY9A 1HX8A 1KFYA 2IEKA 4P1NA 3PE0A 3BTCA 3UQ7A 4D5FA 1JUMA 4U33A 4IDOA 4LF9T 3BR5A 2V7KA 2YU1A 4FJOA 2Q9QC 5LB7B 4BA9A 5F0HA 3ZMZB 4KHPT 1VRBA 3AEAA 2NS8A 3RYFE 3MACA 4O4HE 2WMNA 2XJ7A 2KWIB 5LGNB 5LMUT 5AQJB 4WIBA 3ONXA 1UI5A 3I9YA 2XUEA 5FMPA 3VRBA 1J5ET 3JC6C 3ZT5A 2R7RA 1JUPA 1ZK8A 5EZYE 3ZYKA 2P9BA 2ODVA 3RIUA 2XQ4A 1VCSA 4AUXA 5JDHA 3VVXA 5C3JA 5F0CA 1HFAA 4X1YE 5JDLA 2NX4A 5AQMB 5EK2A 3OYZA 3RPUA 2CHNA 3BTIA 4DUYT 2FX0A 4D7NA 5D1RA 5KX5E 5GPCA 1G8XA 2ZCXA 1SE7A 2CMRA 3AECA 4QXHB 3PUZF 2VQFT 3AVRA 3I9WA 4DVDA 2BVMA 4KMCA 2K9AA 4PAGA 1QLBA 3RF1A 5LHHB 3ABVA 3Q5DA 1S94A 2WDQA 5FY1A 2LSKA 5HEOA 4A97A 3G1LA 1KNPA 3CX8B 5FMNA 1KEYA 2R7XA 4MLKA 2LOSA 4HGAA 3L09A 5ADXL 2I6HA 4OD5A 1BR0A 3P8CD 3FXDB 3F1BA 1MMDA 3PUYF 5H6QB 3B6AA 5JDQA 3AEEA 3PJAJ 1RPWA 2R7WA 3UUMA 4I76A 2QOPA 5AQUB 5LBQB 2NW9A 3AQTA 4ZI3C 3IEEA 3Q0VA 3KYLA 4AISA 5CXIA 1U9NA 5LCYA 5HXSA 5F04A 3ONLC 2XPUA 3KKCA 2YVHA 5FXVA 3FZMB 2V7LA 1MNEA 2UXDT 1HCIA 4H63H 3CX7B 3F0CA 4DVYP 3B6CA 4IDNA 2LJLA 5L4HA 4HWIB 2VL0A 4EB6E 1N32T 4DV5T 5HWYA 2XY8B 4B3TT 3ZYLA 4DR3T 4A56A 3GA8A 2HN2A 4NUVA 4KHZF 4TWHA 3CWZB 2Q24A 2DG7A 3AE8A 3NZQA 3LK42 2CE7A 1YW0A 3QNUA 3UUNA 2QCOA 2LHRA 2LKGA 3J9X1 4DV3T 4YSXA 2UXNB 1D1BA 4W97A 2XPWA 4PXIA 3NZPA 4Z90A 3ZQHA 3UT5E 1T98A 2ZCNA 4HN9A 3T8OA 4FI5A 4P0BA 3HTIA 5AQFB 3SFDA 4C90A 2W53A 1UGOA 5CXGA 4GOUA 2WBLA 2M67A 3EI0A 4YT0A 2GENA 1NENA 5FL1A 5F27A 2LRLA 5HXEA 3CDLA 2K24A 4JYAT 1HNWT 2D0UA 2V7IA 2WAUA 4ZXLA 3FXEB 4PJNA 5DQWA 5FHPA 4UXNB 2NW7A 5FNVE 3G1OA 4E7ZA 1UK5A 5LP6E 2FJBA 4JI0T 3AA6B 3ON4A 2IW5B 4L9IA 1J5WA 1KNZA 4OK0A 2V5CA 3AEGA 2JK3A 3UFEA 3OVUA 1L0VA 5K7HA 3RYCE 2M6IA 5F0FA 3KV4A 4U2YA 3AA1B 2L8KA 1MIYA 2HN1A 4H63V 2GK9A 2YVEA 4EAHA 3UTKA 4C91A 4U7IA 4N78D 3PASA 1WRDA 4GKJT 2BS3A 2QRXA 2W62A 2HQ5A 2VWAA 4PNIA 2I59A 4ILAA 3VVZA 2VKHA 2WDVA 3C98B 2H3RA 3OYXA 2WB5A 1Z77A 1W0AA 2CCQA 3ZSTA 4ADZA 2XQ6A 4U7YA 4CQIA 3KKDA 1JUSA 3JAFA 1MMNA 1W0BA 3ZMTB 4NIQA 3UUBA 5C2TA 5M4YA 2N2NA 4YHJA 2CXFA 4ZS3A 3HL6A 4NPPA 2CHOA 3AE6A 5HWXA 2V7MA 2YU2A 3H3AA 1UCUA 2D0TA 4HFIA 4X20E 4V2GA 3RIAA 4DV7T 5LA6E 2WWUA 3K3NA 2BKNA 3EHZA 4EZHA 5JDMA 3BK9A 3ANWA 3HKCE 2VVNA 3F57A 2LT3A 2WSSV 3UUXB 2CBIA 5J1GA 5LOVE 2B1EA 2MOZA 3V6GA 1LVKA 2W66A 2KWHA 5LJMA 4JYKA 2R6GF 4X66T 4U74A 1QSDA 4U9NA 5EZHA 2R7SA 3K1SA 2ZLYA 3K8PC 3ZC0A 3TKLB 2ACZA 3N2GE 4YJ3E 3SFEA 1T56A 1FEWA 2RHAA 4TZ4C 3MJXA 2IC9A 4TN7B 3RC3A 2BG9E 4DMVA 5D19A 1W09A 4OD4A 4JI3T 3DU6A 3PJAA 2ZM2A 5J3LA 4QXCB 4DUZT 2OLTA 2JQKA 4UELA 2WP9A 4AKHA 4HKUA 1YQ3A 2PJQA 3FZLB 4IDPA 2LSJA 2AE9A 2GFNA 4XAXB 4B6XA 4YTNA 3MVPA 1UX4A 2E9XA 3AE5A 3N9NA 1T72A 2UU9T 3P4PA 1XNRT 5ABHA 4DV2T 1U5PA 5IUXA 5JQGE 3AAAB 4DV1T 3N5LA 3ZSSA 2C5KT 5HEJA 5AQRB 2H89A 3BCGA 1D0YA 4X65T 3GZIA 2XQ3A 4AKRB 2HXIA 3UFGA 2JRKA 4IE0A 1ZHCA 5FY7A 4HFCA 3HIMA 4IL4A 2SPCA 3CIRA 3ZMUB 4G12A 3Q0UA 4QH1A 1MMGA 4JEHB 3TLTA 2PFVA 2ZOYA 4UVAB 2DLRA 4EYUA 5HYAA 4LF4T 2XQAA 3P4QA 3AB3B 5AQGB 1GQEA 5AQOB 3Q3SA 2UXOA 1Y01A 3KV5A 5FVKA 5J2TE 4HTEA 5FXWA 3RIUC 4B3MT 4U31A 1M7KA 3N2KE 2YKSA 2Z6EA 4GCKA 4I50E 3ZQIA 2X51A 4PFPA 2IC6A 3UU5A 2NWBA 1OEDE 3ESLA 1HS7A 3VIBA 4MXMA 3G7RA 4IDZA 3O8HA 3GEUA 3QB5K 3EDUA 3VOXA 4NUUA 3ZKRA 3AE2A 5FL0A 3CMLA 4QHOA 2VK9A 4CN6A 5J0ZA 3AAEB 5EZGA 3BR6A 4AKGA 3NS4A 2OPTA 4DMWA 1ZV4X 4KUMB 2Y31A 4OX9T 4IIJE 1M62A 5HAXA 4V2FA 4UF0B 5K58A 2REKA 4LF5T 2LOPA 4AIUA 4CI1B 4JUYA 1X79A 4TNVA 4ILCA 5A1LA 5EFYA 4EV6A 5FKOA 1MMAA 2LSGA 2XM1A 3DU5A 5FXZA 4ZI2D 2Y6XA 2FJ1A 4AQFC 3UU6A 4MHCA 2D6YA 3QB5A 3J7Yq 1UUSA 2D2SA 5DABA 4EIWA 4PK6A 5AQCA 3ON2A 1WCRA 3ZT6A 2NW8A 4C2MA 2DNXA 2XHEB 2IHR1 3O8GA 4B3ST 2XQYA 4ISSA 2AXDS 2XDNA 3Q0WA 2JIWA 4LF8T 4IE6A 3QPLA 5LNKA 4CXYA 2WU2A 2E8IA 3P9TA 2ACXA 4AC6A 2V6YB 4UVBB 2NS7A 2TCTA 2Y2ZA 1WR0A 2Y48B 3AXJA 4X1IE 3AEBA 2R7TA 3W15B 5AQHB 3ZC1A 2LM9A 4W1UA 2KT9A 1FIOA 2UXHA 3T1YT 4O2AE 2ZB9A 2KZ7B 1O3XA 5HAWA 3BQYA 2IMLA 1T33A 5GONE 3CK6A 4WBNE 5J1YA 3ZN1B 3RHWA 3WHBA 2Y30A 2BS4A 2CBJA 2M6BA 3L3PA 4M3DA 5KDMC 5CJ5A 3DPJA 5HXCA 2X66A 3ZJ2A 2R7QA 2ZMAA 4ZI2C 4M3EA 3P4WA 1ZKGA 2XTLA 3ZCIA 4O2BE 2CLYC 2NTXA 4GK5E 3CRJA 3VW2A 4WYVA 2UXXB 2WU5A 2F07A 2OA5A 5HBUA 2VASA 5BR8T 1JT0A 3RH3A 2KXPB 3NI7A 5HEUA 3SS1A 4DBRA 3MK7C 4TX5A 5C8YE 1HG2A 4AQFA 5L3BB 3C64A 3ZN0B 2LSYA 5AQIB 2Q9QA 2ZM0A 3KZ9A 3LFMA 1HX1B 3BQZA 3LJLA 3HTHA 5AQQB 4AI6A 4ZZBA 2G7GA 1UX5A 4WBOA 5F1JA 2XGDA 3RQWA 3IA3A 3VTIA 4D5CA 3PV0F 1WFDA 4JI4T 4UDSA 2L9QA 3A7MA 1D1CA 4KBMB 3K3OA 1Y64B 4TUYE 2W2UA 4PK4A 4JI8T 5F08A 2G3BA 2BBHA 5K7FA 3FB2A 1LVFA 4JI2T 2K5BB 3EDVA 2W4XA 4G2AA 2V57A 3N9LA 1WLXA 4ASKA 3KVBA 4JV5T 3C4XA 4HKAA 4JLEA 3PUSA 5L4EA 3HKEE 2FBQA 2D5UA 2JPFA 3PU3A 4DR6T 4LFCT 5F3JA 1IBMT 4QX8B 3UULA 5GPAA 2QTQA 2HPJA 1RKTA 5IWAT 1FMVA 1OXZA 2YDSA 4GYSA 2J1DG 2VPRA 3RYHE 3Q5WA 4ZZCA 3MNLA 3NRGA 2ZCMA 2BG9C 1WR6A 4YHHT 2RP4A 3KINB 3RKGA 2WY2A 3PUXF 4ZI3D 3KBUA 4GCLA 4HWFA 2O7OA 1FMWA 4PJMA 4HEAA 4EZ4A 3VPRA 1A6IA 3VRAA 2DL1A 1MIVA 2NR4A 4DV4T 3KV9A 4IHJE 3ETVA 2WM9A 3I1AA 2G0EA 4IL9A 3RRCA 2XGCA 3OKQA 2A2FX 3AE4A 3NNRA 4LMLA 5FGLA 4I43B 4D7MA 2PBXA 1D1AA 4QH4A 4ME9A 5ETWA 3MA9A 5JH7E 2XGEA 3A5XA 4I0UA 2G7SA 1XDPA 3LOCA 1SHZC 3JSJA 4UV9B 4DNDA 1W9RA 1US7B 1BR4A 4QX7B 4MALA 3VR8A 3DP7A 4P09A 2NTYA 3AE1A 4BAYB 1HF8A 3PPBA 1VOMA 4IREA 1IBKT 3TLWA 3O9XA 4H9RC 4DIDB 2CEAA 3B13A 2LSIA 5JVDE 3SOLA 4E7SA 2RPAA 3BHQA 3CQGB 1ORKA 2ID6A 2DCFA 1HG5A 4NXNT 2OV9A 5H9TA 2FJEA 4LF7T 4OYKA 4ABZA 3RI5A 2PG8A 4LF6T 5DJQC 4DR4T 4IGUA 3VHLA 2V6YA 5FYMA 2LHNA 1Z0XA 1OEDB 2RAEA 2CXDA 1V9DA 2OF7A 3X1DA 1H7CA 3EAMA 3QC9A 5HCJA 2PBIA 1N36T 2PZ9A 2J62A 5F5WA 3M3ZB 2ZM6T 4IE5A 4M3FA 4HE8A 5AQPB 3LJCA 2KMFA 2EHOB 4H9QC 3ZQLA 5HCMA 4U2ZA 3ANPA 3IUVA 1I94T 3BRUA 3BJBA 4KI0F 1I6ZA 2VL8A 5HSZA 2UXBT 2JJ9A 5LYJE 4AKIA 4CI2B 4HFDA 4GCTA 3C4WA 3FZFB 5JR9C 3PUQA 2JMKA 4LMKA 1OEDC 4O4LE 2WDRA 3U78A 3H3MA 3CWRA 3TP3A 3ZQGA 3PDYA 2A3DA 3C2BA 4AC0A 2IDOB 1SUMB 2Q9QB 3KBTA 5ABFB 4EYYR 3FK7A 3NRXA 2BDEA 3ZQFA 5EK3A 2LLYA 5IPAA 3VOKA 3FRQA 2BG9A 2VKOA 3UQ4A 5HXHA 1JTXA 5AQLB 3TLUA 4GFLA 5J2UE 4DBQA 4JI1T 3BQIA 2QIBA 4ILBA 4UEMA 3FK6A 2A9UA 4V1Av 3AAIA 4XK4A 2UUAT 3LBXB 4JBWF 1XDOA 1KK7A 3KV6A 5L3DB 3NPIA 2BKPA 2LE8A 3VW0A 2G0UA 2BVLA 5TAOA 3TLSA 3VVYA 3AEFA 5DQVA 2XQ7A 3EVYA 1HNXT 4XZCA 3QBMA 4GIWA 4HFHA 5JR9A 4UF0A 5CA1E 5CFBA 4YSZA 1XMOT 1RKWA 3NRYA 1OEDA 3ANWB 2XAGB 4A5XA 3ZMVB 4EEBA 1IJ5A 2DTZA 3B57A 2V8SV 2HH7A 4OYJA 1OWAA 3RH2A 5IOZA 3OPCA 5E0OA 5FKKA 3WAKA 3LHQA 4YTMA 1B7TA 2EHOA 2X68A 4KP3C 5ABGA 3HA4A 3E7QA 5AQKB 4O8SA 3D0TA 3FBLA 3BNIA 5J1RA 3NWIA 5HEGA 2WUIA 4Q25A 3AEDA 1YXRA 5ABEA 1XWMA 2BBJA 5JTGA 4CN1A 4UR9A 5L3FB 3Q5EA 5K7ZA 2OERA 2CM0A 3MXZA 3BQLA 3NVOA 3LG7A 3LSVA 3E0ZA 4CXXA 3QKXA 4CZZB 3VP5A 4YLHA 5H6RB 3EUHA 3RKOA 2UXCT 2ZM8A 4I4TE 1HR0T 4X5TA 4UVCB 2I0MA 4PJLA 5IOYA 2KLQA 1D0ZA 2CRBA 2FD5A 5L3CB 3G56A 3V78A 4YTPA 2HKUA 4OHFA 2V7JA 4L5GA 3PUAA 2X6OA 2NP5A 2LEHA 4YSYA 5FKMA 4JEUB 2W67A 2E9XB 3VKHA 5L3GB 2X9HA 2ID3A 2DWGA 2XAFB 4H9PC 4LFBT 4TWFA 3H37A 3VR9A 2YEVC 2E2AA 5JDNA 3R6NA 1WYCA 3KVAA 2ES0A 3DEWA 4J2CA 2HHHT 4BJNA 1R8IA 2UXUA 3ZCJA 2XQ8A 4JI7T 3HTJA 3N2OA 3JCFA 2NP3A 2FJDA 3RRWA 2E5LT 2VKDA 2WMOA 3CPZA 4YFSA 3P50A 4CXWA 2MTQA 2VQET 4GKKT 2NOXA 1JTYA 3KNWA 4MBQA 1U9OA 2C5JA 3M65A 3KDSE 1E2AA 2QYWA 2X9XA 5FXXA 4JNNA 4ZI7E 4L0RA 5HXRA 1E1HB 5BMVE 3ZPOA 1ZOYA 5LG3A 4YY3T 2RA1A 1VI0A 2R7VA 2CXLA 1T7SA 2YINA 5JRCA 3COLA 3PU8A 4JL3A 1QVTA 4IE7A 3LK3B 2BZBA 3VUQA 2W61A 3FZHB 2WV1A 2J4GA 5AQSB 3PUVF 3U3IA 3NBXX 3IH4A 2XQ5A 4JI5T 4QXBB 3ZT7A 3Q9DA 1XMQT 4HFBA 2V1DB 4UV8B 5CB4E 1SGMA 3MZKB 3BTJA 2O7TA 3EABA 3KFWX 2YN6A 2KINB 5ABFA 3B81A 4AXPA 4H9OC 4X1KE 3BR2A 3BR0A 2A72A 2XPVA 5D18A 4QWNB 4U3CA 3UU3A 2CWOA 4DR1T 4U72A 4ERRA 2KNDA 2X67A 3P4RA 3I0QA 2MPKA 3IF8B 2VKEA 5DAJA 3O4XE 4TV8E 4UIGA 3DJBA 3CJDA 1YKHB 4HFEA 2V6XA 3HGYA 2VKJA 3RGLA 2V26A 2X0LB 3QUJA 2LRKA 1NAFA 5JDFA 2EHOD 2N9DA 4HWCA 4ANJA 4Z91A 2B3WA 4ZHQE 3C50A 3RX6A 4XBFB 5FP3A 4TV9E 4DR7T 2IAIA 4F6RC 4U9LA 3N9OA 5L3EB 3O60A 4AKLA 4A98A 2EH3A 1YKEB 2QA7A 5L47A 2GUHA 4MO7A 2CA5A 1IAPA 3DTOA 4ZS2A 2X9DA 2JQQA 3EUPA 2E5VA 3AXJB 3IH3A 2XAQB 4DV0T 3FBZA 2YDRA 3GMIA 1E7PA 1ZKEA 3HTAA 2CPTA 2HYJA 3ONJA 4LFAT 4B3AA 4MK6A 3Q2MA 4AQYT 1MNDA 1AJ3A 4HFVA 1YQ4A 5IP6A 2KSRA 3FHNA 4ZEYA 1T8BA 5JRCB 2JMHA 3O1HA 2HPLA 2J47A 2WCAA 3QQAA 5FKLA 2DI4A 2YVXA 4GK0E 2DWKA 5JREA 3EGQA 1CHUA 2QVAA 3AE7A 4NXMT 4H9NC 2EHOC 2LM2A 1Z8UA 3F2EA 3QOFA 2H7OA 2XAHB 4Z8XA 2QGSA 4M3BA 2D9DA 3PUWF 4WNKA 1BJZA 5LBMA 3BTLA 3RD3A 3AQSA 5HEHA 1J1JA 3WAJA 2MYSA 4IT4A 2BKOA 2H88A 5JR9B 4K0KT 1HNZT 3FIWA 2R7UA 2W0GA 3F31A 2UXPA 2VKVA 3JAEA 5FVLA 3L8RA 2XAJB 1ZEEA 2XASB 5CQGA 2XM2A 3CQCB 4G63A 2G7LA 4IDQA 5KMGP 3VW1A 5LHGB 3SRZA 3LSPA 3WI3A 2ODUA 3QPSA 3LSRA 4GFKA 3GWHA 5LG4A 4B3RT 4ILUA 3IBPA 4B1RA 4PK5A 5IYZE 1FJGT 2WS3A 3C51A 4QKNA 4X62T 4X1EA 3G1MA 4CN4A 3T1HT 2NP9A 5KXJA 3AE3A 5AQVB 4EOZB 2WQYA 4QH5A 5CA0E 4YXDA 1HTJF 5LMNT 2K3WA 1Z0PA 3T6NA 3BR3A 3OBVE 3AA7B 3ZMSB 3PTRB 2UUBT 3RC8A 3G06A 3HGGA 3ZLIA 4NELA 4DV6T 3MKDA 3N9PA 3V5UA 1BR1A 4ISTA 2QKOA 4O4IE 3OJAA 1YD8G 2WZHA 2MBGA 4I55E 1KNRA 2R7OA 4O4JE 3A8YC 5J1UA 2XSAA 1WYBA 1NWMX 1CUNA 2E9XD 1MIWA 2F4VT 3ZJ1A 3P7IA 2JJ7A 2YOEA 4GYRA 4EEDA 2DG8A 3O1IA 5AQNB 3PUGA 3CVRA 5LGTB 2LKHA 3LSJA 2C0SA 2OI8A 5FKYA 1JNZA 3HI2A 2JQHA 5LGUB 4M3GA 2JQ9A 3AVSA 4DR2T 1EZ3A 2IAKA 3BT9A 3CQXC 2XQ9A 2K48A 2N1GA 3CCYA 3B5MA 1DU2A 4X64T 1LKXA 5LJNA 5CW8A 4PFOA 3QK6A 4LMJA 2HXOA 3ZYMA 1SA0E 2X0YA
chains in the Genus database with same CATH topology
4EAHA 2X9HA 3UTKA 2DWGA 2XAFB 3O1JA 4AI6A 4H9PC 4C91A 1LRZA 2YK0A 4N78D 1UX5A 2VB6A 4WBOA 1S35A 1WRDA 3H37A 2W62A 2X9YA 2VWAA 2YEVC 4PNIA 2I59A 5JDNA 3R6NA 2VKHA 3C98B 3VTIA 3CX6B 1WYCA 3KVAA 5L2LA 2H3RA 2ES0A 3OYXA 2L9QA 4ZOLE 4J2CA 1D1CA 4KBMB 3K3OA 1Y64B 4TUYE 4PK4A 5FY0A 1IJ6A 5LHIB 4BJNA 2CCQA 3ZCJA 4DO0A 4ADZA 3FB2A 1LVFA 3N2OA 2K5BB 4H9SE 3EDVA 4CQIA 3C4ZA 4G2AA 3N9LA 1WLXA 1MMNA 3Q5XA 2E9XC 3RRWA 3VKGA 2VKDA 2WMOA 4ASKA 3ZMTB 3CPZA 4MFRA 2CLYB 4YFSA 2X9WA 3LBXA 5M4YA 1IZNB 2N2NA 2MTQA 3KVBA 4CXWA 4YHJA 2CXFA 4ZS3A 1U4QA 3HL6A 2NOXA 5EK4A 3BQKA 5HWXA 2V7MA 4MBQA 2YU2A 4P0AA 3H3AA 2C5JA 1UCUA 3C4XA 2D0TA 3M65A 3KDSE 4HKAA 4JLEA 3PUSA 4X20E 3HKEE 2D5UA 2JPFA 3PU3A 2X9XA 5FXXA 5LA6E 4ZI7E 4L0RA 5HXRA 1E1HB 2WWUA 5F3JA 3IHRA 5BMVE 4BJMA 3ZPOA 4QX8B 3UULA 2RA1A 3K3NA 2HPJA 2R7VA 3CKDA 3ZEFB 5LXTE 2W63A 4YJ2E 3K3QC 2CXLA 3RYIE 2YINA 5JRCA 1FMVA 1OXZA 4GYSA 4EZHA 3BK9A 3ANWA 5JDMA 2J1DG 3I0OA 3HKCE 3PU8A 3F57A 3RYHE 2LT3A 2WSSV 4IE7A 3UUXB 3Q5WA 3E08A 3LK3B 2BZBA 5J1GA 5LOVE 2B1EA 1WR6A 2W61A 3LK2B 2MOZA 2RP4A 5JDGA 1LVKA 3VKHA 3KINB 5L3GB 1D0XA 4ZI3D 4PJJA 2KWHA 3KBUA 3U3IA 5LJMA 4IE4A 3NBXX 1FMWA 2C5IT 3GN5A 4K0UA 4U74A 4PJMA 1QSDA 4HEAA 4EZ4A 4QXBB 3Q9DA 2R7SA 2ZLYA 4IRVA 1MIVA 3K8PC 2V1DB 3HKBE 4UV8B 5CB4E 4AQGA 3ZC0A 3KV9A 1QUUA 3MZKB 3TKLB 3VU7H 3S4UA 1G73A 4IHJE 3ETVA 3E22E 4EXTA 3KFWX 3N2GE 4OFZA 4YJ3E 2Q9QD 2WM9A 3ETUA 3I1AA 3AA0B 1FEWA 3RRCA 2KINB 2FJI1 3OKQA 4TZ4C 3MJXA 2A2FX 2IC9A 4H9OC 4X1KE 4I43B 2A72A 4AXPA 1D1AA 4CI3B 4TN7B 5ETWA 2H7VC 3MA9A 4QWNB 3RC3A 5JH7E 3A5XA 2CWOA 4DMVA 4OD4A 1SHZC 3DU6A 3HKDE 2W00A 4U72A 2ZM2A 4UV9B 4ERRA 4DNDA 2KNDA 1US7B 4M1PA 1BR4A 4QXCB 5IHYA 2X67A 3JC6D 4QX7B 4MALA 4UELA 3I0QA 3DP7A 2Y8DA 4P09A 4AKHA 2NTYA 4BAYB 1HF8A 3IF8B 1VOMA 2PJQA 2DHRA 3O4XE 4TV8E 3O9XA 2LSJA 4UIGA 3DJBA 1YKHB 3GN5B 4XAXB 3V5SA 4B6XA 4H9RC 1UX4A 2E9XA 3PURA 2CEAA 3B13A 3N9NA 2LSIA 5F8PA 5JVDE 2VKJA 3SOLA 3SWHA 2V26A 2X0LB 2L3LA 3QUJA 1NAFA 5JDFA 2EHOD 2N9DA 4E7SA 1U5PA 4ANJA 3CQGB 5JQGE 4WW0A 3AAAB 4PW8A 2DCFA 2B3WA 3N5LA 1HG5A 3C50A 3N9MA 3R84B 2C5KT 4ZHQE 3RX6A 2CWYA 4XBFB 3HR0A 5FP3A 1BR2A 1D0YA 5AFUL 4TV9E 3N9QA 4F6RC 3N9OA 5L3EB 4OYKA 4AKLA 4AKRB 2JRKA 4IE0A 1ZHCA 2PG8A 5FY7A 5DJQC 1YKEB 2QA7A 1HX8A 4IGUA 3VHLA 2CA5A 5FYMA 1IAPA 2SPCA 3DTOA 3PE0A 4ZS2A 3ZMUB 2LHNA 2JQQA 2CXDA 1V9DA 1MMGA 4JEHB 1H7CA 2XAQB 3FBZA 3QC9A 2V7KA 2YU1A 2PFVA 2Q9QC 4FJOA 2PBIA 3GMIA 4UVAB 4BA9A 2DLRA 3ZMZB 4EYUA 5HYAA 1ZKEA 1VRBA 3RYFE 3MACA 3AB3B 4O4HE 2WMNA 4IE5A 4HE8A 3LJCA 3Q2MA 2KMFA 2KWIB 2EHOB 1MNDA 3KV5A 5LGNB 1AJ3A 4H9QC 4HFVA 5J2TE 4HTEA 3ONXA 3FHNA 5FXWA 3I9YA 2XUEA 5JRCB 2JMHA 3N2KE 3O1HA 2Z6EA 3JC6C 4I50E 2X51A 2R7RA 2VL8A 2HPLA 4PFPA 2IC6A 5EZYE 2NWBA 3ZYKA 2P9BA 2ODVA 3ESLA 2DI4A 2JJ9A 5LYJE 1HS7A 4AKIA 4CI2B 4GK0E 5JDHA 2DWKA 5JREA 4IDZA 3C4WA 5JR9C 3EDUA 1HFAA 3PUQA 4X1YE 5JDLA 5EK2A 2JMKA 3OYZA 4H9NC 2EHOC 4NUUA 4O4LE 3RPUA 3U78A 3F2EA 2H7OA 2XAHB 4Z8XA 2QGSA 3CMLA 4QHOA 2VK9A 3PDYA 5KX5E 2A3DA 3AAEB 4AKGA 3NS4A 1G8XA 4WNKA 2CMRA 4DMWA 5LBMA 4QXHB 2Q9QB 3KBTA 3AVRA 1ZV4X 3I9WA 4KUMB 4DVDA 2BVMA 4EYYR 4KMCA 2K9AA 4PAGA 3NRXA 3WAJA 2MYSA 2BDEA 4IIJE 5LHHB 5HAXA 1S94A 5EK3A 5FY1A 2LSKA 5JR9B 4UF0B 2R7UA 2LOPA 2W0GA 2VKOA 3F31A 3CX8B 5FMNA 4CI1B 4JUYA 1X79A 5HXHA 5A1LA 2R7XA 2XAJB 4MLKA 1ZEEA 2XASB 5CQGA 2LOSA 4HGAA 3CQCB 5J2UE 3L09A 4DBQA 5ADXL 1MMAA 4OD5A 2LSGA 4G63A 1BR0A 3BQIA 3DU5A 3P8CD 3FXDB 5FXZA 4ZI2D 1MMDA 4UEMA 2Y6XA 4AQFC 4MHCA 5KMGP 5LHGB 5H6QB 4V1Av 3SRZA 5JDQA 2R7WA 3UUMA 3WI3A 3J7Yq 2ODUA 3AAIA 5LBQB 2NW9A 2D2SA 4ZI3C 3IEEA 3KYLA 3GWHA 5DABA 3LBXB 4EIWA 5LG4A 4PK6A 1KK7A 4ILUA 5LCYA 3IBPA 4PK5A 3KV6A 5HXSA 5IYZE 5L3DB 2NW8A 4C2MA 2DNXA 3C51A 4QKNA 2XHEB 5FXVA 2NP9A 2V7LA 1MNEA 2LE8A 1HCIA 4H63H 2XQYA 3CX7B 4EOZB 4ISSA 4DVYP 2G0UA 2BVLA 5TAOA 5CA0E 2LJLA 4IE6A 4EB6E 5DQVA 5LNKA 3EVYA 1HTJF 5HWYA 4XZCA 4CXYA 4GIWA 1Z0PA 2E8IA 2ACXA 3OBVE 5JR9A 3AA7B 3ZYLA 4UF0A 3PTRB 4UVBB 3ZMSB 5CA1E 4A56A 3GA8A 4NUVA 3NRYA 3ANWB 3RC8A 2Y48B 2XAGB 3CWZB 3ZMVB 4X1IE 3ZLIA 2R7TA 3W15B 3NZQA 3LK42 3MKDA 3N9PA 3ZC1A 3V5UA 1BR1A 1YW0A 2CE7A 2LM9A 3UUNA 1IJ5A 2LHRA 4ISTA 3B57A 3J9X1 2KT9A 2HH7A 4O4IE 1FIOA 3OJAA 1YD8G 4O2AE 2UXNB 1D1BA 4OYJA 1OWAA 2KZ7B 3NZPA 4I55E 2MBGA 1O3XA 5E0OA 5GONE 3UT5E 3WAKA 2R7OA 1T98A 4WBNE 4O4JE 4HN9A 3T8OA 1B7TA 4FI5A 2EHOA 2X68A 4P0BA 3ZN1B 4KP3C 1WYBA 1NWMX 1CUNA 2E9XD 1MIWA 3HA4A 3ZJ1A 3P7IA 4GYRA 4O8SA 3L3PA 4C90A 3D0TA 3FBLA 4GOUA 5KDMC 3O1IA 3PUGA 3CVRA 2WBLA 2M67A 5HXCA 2X66A 3ZJ2A 2R7QA 5LGTB 2ZMAA 4ZI2C 2C0SA 5HXEA 5L3FB 2K24A 2XTLA 2D0UA 2WAUA 2V7IA 3HI2A 2CM0A 4O2BE 3ZCIA 2CLYC 2NTXA 3MXZA 3FXEB 5LGUB 3BQLA 3AVSA 4PJNA 4GK5E 1EZ3A 2IAKA 3LG7A 2UXXB 5DQWA 3E0ZA 4CXXA 2OA5A 4CZZB 4YLHA 5H6RB 3EUHA 3CQXC 2NW7A 2VASA 4UXNB 5FNVE 2K48A 3RKOA 2N1GA 2ZM8A 3RH3A 4I4TE 2KXPB 4UVCB 4E7ZA 5LP6E 4PJLA 2KLQA 1D0ZA 3AA6B 2IW5B 5L3CB 4L9IA 3SS1A 1KNZA 1LKXA 4OK0A 4DBRA 3MK7C 4TX5A 4OHFA 3UFEA 5C8YE 2V7JA 5LJNA 4L5GA 1HG2A 4AQFA 5L3BB 3RYCE 4PFOA 3C64A 3PUAA 3ZN0B 3QK6A 3KV4A 2LSYA 3ZYMA 3AA1B 2LEHA 2Q9QA 2L8KA 2ZM0A 4JEUB 1MIYA 1SA0E 2E9XB 3LFMA 4H63V 2GK9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FJI 1;  3SWH A; 
#chains in the Genus database with same CATH topology
 2PTF A;  3O1J A;  2X0H A;  1UUR A;  1LRZ A;  2YK0 A;  2VB6 A;  5C4Y A;  4TNW A;  1S35 A;  4EGW A;  2BG9 B;  2X9Y A;  4I6Z A;  1UI6 A;  3JAD A;  3CX6 B;  3NKZ A;  5L2L A;  4ZOL E;  2VVS A;  2WGB A;  2UUC T;  2XSB A;  5FY0 A;  1IJ6 A;  5LHI B;  1KF6 A;  1X9B A;  4DO0 A;  1XZY A;  4H9S E;  4DW6 A;  3C4Z A;  4WZX A;  3C07 A;  3S5R A;  4ICH A;  2XZE A;  2E9X C;  3Q5X A;  3VKG A;  5GP9 A;  5EYR A;  5FKN A;  2CLY B;  4MFR A;  2X9W A;  2GBY A;  3SFI A;  1IZN B;  3LBX A;  1U4Q A;  1N33 T;  4NN1 A;  3BQK A;  5EK4 A;  2V5D A;  4P0A A;  2ZOZ A;  3RIF A;  3TLV A;  2HYT A;  3OTO T;  1ZP0 A;  2WZI A;  2RAS A;  2QWT A;  3IH2 A;  4DR5 T;  3TP0 A;  3DCF A;  3PM1 A;  2FUP A;  4JKZ A;  3IHR A;  4BJM A;  2TRT A;  3CKD A;  3ZEF B;  1JT6 A;  5LXT E;  2W63 A;  4YJ2 E;  3K3Q C;  3RYI E;  1JNR A;  3I0O A;  2BS2 A;  3E08 A;  4KWA A;  4COF A;  3UU4 A;  2FBW A;  3LK2 B;  5JDG A;  3RLF F;  1D0X A;  4PJJ A;  4F8H A;  1XNQ T;  4IE4 A;  3WHC A;  2C5I T;  3GN5 A;  4K0U A;  2XPK A;  2IIU A;  3UU8 A;  4IRV A;  3HKB E;  3L39 A;  4L62 A;  4AQG A;  1IBL T;  1QUU A;  3VU7 H;  3S4U A;  1G73 A;  3FZK B;  3E22 E;  4EXT A;  4OFZ A;  1QVU A;  2FJA A;  2Q9Q D;  3ETU A;  3AA0 B;  1NEK A;  4HWD A;  3NXC A;  2FJI 1;  4CI3 B;  4JI6 T;  2I10 A;  2H7V C;  4TWD A;  5CGM A;  3HKD E;  2W00 A;  3RQU A;  3LDQ B;  4ACI A;  3HE0 A;  4M1P A;  3SDG A;  5IHY A;  3JC6 D;  3AE9 A;  2UXI A;  4YZE A;  2Y8D A;  2IUB A;  2B76 A;  1VCT A;  1N34 T;  2DHR A;  2IU5 A;  3V5S A;  3GN5 B;  2WWV A;  3PUR A;  3LWJ A;  3ANG A;  2YDQ A;  5F8P A;  3SWH A;  5AQT B;  2L3L A;  2FQ4 A;  3BR1 A;  4HWH A;  4KX6 A;  4WW0 A;  4PW8 A;  2VUR A;  2IBD A;  4AF5 A;  3N9M A;  3R84 B;  2XRL A;  2CWY A;  3HR0 A;  2MAW A;  1BR2 A;  5AFU L;  3P4S A;  4CGR A;  3N9Q A;  2XB5 A;  1QPI A;  2ZY9 A;  1HX8 A;  1KFY A;  2IEK A;  4P1N A;  3PE0 A;  3BTC A;  3UQ7 A;  4D5F A;  1JUM A;  4U33 A;  4IDO A;  4LF9 T;  3BR5 A;  2V7K A;  2YU1 A;  4FJO A;  2Q9Q C;  5LB7 B;  4BA9 A;  5F0H A;  3ZMZ B;  4KHP T;  1VRB A;  3AEA A;  2NS8 A;  3RYF E;  3MAC A;  4O4H E;  2WMN A;  2XJ7 A;  2KWI B;  5LGN B;  5LMU T;  5AQJ B;  4WIB A;  3ONX A;  1UI5 A;  3I9Y A;  2XUE A;  5FMP A;  3VRB A;  1J5E T;  3JC6 C;  3ZT5 A;  2R7R A;  1JUP A;  1ZK8 A;  5EZY E;  3ZYK A;  2P9B A;  2ODV A;  3RIU A;  2XQ4 A;  1VCS A;  4AUX A;  5JDH A;  3VVX A;  5C3J A;  5F0C A;  1HFA A;  4X1Y E;  5JDL A;  2NX4 A;  5AQM B;  5EK2 A;  3OYZ A;  3RPU A;  2CHN A;  3BTI A;  4DUY T;  2FX0 A;  4D7N A;  5D1R A;  5KX5 E;  5GPC A;  1G8X A;  2ZCX A;  1SE7 A;  2CMR A;  3AEC A;  4QXH B;  3PUZ F;  2VQF T;  3AVR A;  3I9W A;  4DVD A;  2BVM A;  4KMC A;  2K9A A;  4PAG A;  1QLB A;  3RF1 A;  5LHH B;  3ABV A;  3Q5D A;  1S94 A;  2WDQ A;  5FY1 A;  2LSK A;  5HEO A;  4A97 A;  3G1L A;  1KNP A;  3CX8 B;  5FMN A;  1KEY A;  2R7X A;  4MLK A;  2LOS A;  4HGA A;  3L09 A;  5ADX L;  2I6H A;  4OD5 A;  1BR0 A;  3P8C D;  3FXD B;  3F1B A;  1MMD A;  3PUY F;  5H6Q B;  3B6A A;  5JDQ A;  3AEE A;  3PJA J;  1RPW A;  2R7W A;  3UUM A;  4I76 A;  2QOP A;  5AQU B;  5LBQ B;  2NW9 A;  3AQT A;  4ZI3 C;  3IEE A;  3Q0V A;  3KYL A;  4AIS A;  5CXI A;  1U9N A;  5LCY A;  5HXS A;  5F04 A;  3ONL C;  2XPU A;  3KKC A;  2YVH A;  5FXV A;  3FZM B;  2V7L A;  1MNE A;  2UXD T;  1HCI A;  4H63 H;  3CX7 B;  3F0C A;  4DVY P;  3B6C A;  4IDN A;  2LJL A;  5L4H A;  4HWI B;  2VL0 A;  4EB6 E;  1N32 T;  4DV5 T;  5HWY A;  2XY8 B;  4B3T T;  3ZYL A;  4DR3 T;  4A56 A;  3GA8 A;  2HN2 A;  4NUV A;  4KHZ F;  4TWH A;  3CWZ B;  2Q24 A;  2DG7 A;  3AE8 A;  3NZQ A;  3LK4 2;  2CE7 A;  1YW0 A;  3QNU A;  3UUN A;  2QCO A;  2LHR A;  2LKG A;  3J9X 1;  4DV3 T;  4YSX A;  2UXN B;  1D1B A;  4W97 A;  2XPW A;  4PXI A;  3NZP A;  4Z90 A;  3ZQH A;  3UT5 E;  1T98 A;  2ZCN A;  4HN9 A;  3T8O A;  4FI5 A;  4P0B A;  3HTI A;  5AQF B;  3SFD A;  4C90 A;  2W53 A;  1UGO A;  5CXG A;  4GOU A;  2WBL A;  2M67 A;  3EI0 A;  4YT0 A;  2GEN A;  1NEN A;  5FL1 A;  5F27 A;  2LRL A;  5HXE A;  3CDL A;  2K24 A;  4JYA T;  1HNW T;  2D0U A;  2V7I A;  2WAU A;  4ZXL A;  3FXE B;  4PJN A;  5DQW A;  5FHP A;  4UXN B;  2NW7 A;  5FNV E;  3G1O A;  4E7Z A;  1UK5 A;  5LP6 E;  2FJB A;  4JI0 T;  3AA6 B;  3ON4 A;  2IW5 B;  4L9I A;  1J5W A;  1KNZ A;  4OK0 A;  2V5C A;  3AEG A;  2JK3 A;  3UFE A;  3OVU A;  1L0V A;  5K7H A;  3RYC E;  2M6I A;  5F0F A;  3KV4 A;  4U2Y A;  3AA1 B;  2L8K A;  1MIY A;  2HN1 A;  4H63 V;  2GK9 A;  2YVE A;  4EAH A;  3UTK A;  4C91 A;  4U7I A;  4N78 D;  3PAS A;  1WRD A;  4GKJ T;  2BS3 A;  2QRX A;  2W62 A;  2HQ5 A;  2VWA A;  4PNI A;  2I59 A;  4ILA A;  3VVZ A;  2VKH A;  2WDV A;  3C98 B;  2H3R A;  3OYX A;  2WB5 A;  1Z77 A;  1W0A A;  2CCQ A;  3ZST A;  4ADZ A;  2XQ6 A;  4U7Y A;  4CQI A;  3KKD A;  1JUS A;  3JAF A;  1MMN A;  1W0B A;  3ZMT B;  4NIQ A;  3UUB A;  5C2T A;  5M4Y A;  2N2N A;  4YHJ A;  2CXF A;  4ZS3 A;  3HL6 A;  4NPP A;  2CHO A;  3AE6 A;  5HWX A;  2V7M A;  2YU2 A;  3H3A A;  1UCU A;  2D0T A;  4HFI A;  4X20 E;  4V2G A;  3RIA A;  4DV7 T;  5LA6 E;  2WWU A;  3K3N A;  2BKN A;  3EHZ A;  4EZH A;  5JDM A;  3BK9 A;  3ANW A;  3HKC E;  2VVN A;  3F57 A;  2LT3 A;  2WSS V;  3UUX B;  2CBI A;  5J1G A;  5LOV E;  2B1E A;  2MOZ A;  3V6G A;  1LVK A;  2W66 A;  2KWH A;  5LJM A;  4JYK A;  2R6G F;  4X66 T;  4U74 A;  1QSD A;  4U9N A;  5EZH A;  2R7S A;  3K1S A;  2ZLY A;  3K8P C;  3ZC0 A;  3TKL B;  2ACZ A;  3N2G E;  4YJ3 E;  3SFE A;  1T56 A;  1FEW A;  2RHA A;  4TZ4 C;  3MJX A;  2IC9 A;  4TN7 B;  3RC3 A;  2BG9 E;  4DMV A;  5D19 A;  1W09 A;  4OD4 A;  4JI3 T;  3DU6 A;  3PJA A;  2ZM2 A;  5J3L A;  4QXC B;  4DUZ T;  2OLT A;  2JQK A;  4UEL A;  2WP9 A;  4AKH A;  4HKU A;  1YQ3 A;  2PJQ A;  3FZL B;  4IDP A;  2LSJ A;  2AE9 A;  2GFN A;  4XAX B;  4B6X A;  4YTN A;  3MVP A;  1UX4 A;  2E9X A;  3AE5 A;  3N9N A;  1T72 A;  2UU9 T;  3P4P A;  1XNR T;  5ABH A;  4DV2 T;  1U5P A;  5IUX A;  5JQG E;  3AAA B;  4DV1 T;  3N5L A;  3ZSS A;  2C5K T;  5HEJ A;  5AQR B;  2H89 A;  3BCG A;  1D0Y A;  4X65 T;  3GZI A;  2XQ3 A;  4AKR B;  2HXI A;  3UFG A;  2JRK A;  4IE0 A;  1ZHC A;  5FY7 A;  4HFC A;  3HIM A;  4IL4 A;  2SPC A;  3CIR A;  3ZMU B;  4G12 A;  3Q0U A;  4QH1 A;  1MMG A;  4JEH B;  3TLT A;  2PFV A;  2ZOY A;  4UVA B;  2DLR A;  4EYU A;  5HYA A;  4LF4 T;  2XQA A;  3P4Q A;  3AB3 B;  5AQG B;  1GQE A;  5AQO B;  3Q3S A;  2UXO A;  1Y01 A;  3KV5 A;  5FVK A;  5J2T E;  4HTE A;  5FXW A;  3RIU C;  4B3M T;  4U31 A;  1M7K A;  3N2K E;  2YKS A;  2Z6E A;  4GCK A;  4I50 E;  3ZQI A;  2X51 A;  4PFP A;  2IC6 A;  3UU5 A;  2NWB A;  1OED E;  3ESL A;  1HS7 A;  3VIB A;  4MXM A;  3G7R A;  4IDZ A;  3O8H A;  3GEU A;  3QB5 K;  3EDU A;  3VOX A;  4NUU A;  3ZKR A;  3AE2 A;  5FL0 A;  3CML A;  4QHO A;  2VK9 A;  4CN6 A;  5J0Z A;  3AAE B;  5EZG A;  3BR6 A;  4AKG A;  3NS4 A;  2OPT A;  4DMW A;  1ZV4 X;  4KUM B;  2Y31 A;  4OX9 T;  4IIJ E;  1M62 A;  5HAX A;  4V2F A;  4UF0 B;  5K58 A;  2REK A;  4LF5 T;  2LOP A;  4AIU A;  4CI1 B;  4JUY A;  1X79 A;  4TNV A;  4ILC A;  5A1L A;  5EFY A;  4EV6 A;  5FKO A;  1MMA A;  2LSG A;  2XM1 A;  3DU5 A;  5FXZ A;  4ZI2 D;  2Y6X A;  2FJ1 A;  4AQF C;  3UU6 A;  4MHC A;  2D6Y A;  3QB5 A;  3J7Y q;  1UUS A;  2D2S A;  5DAB A;  4EIW A;  4PK6 A;  5AQC A;  3ON2 A;  1WCR A;  3ZT6 A;  2NW8 A;  4C2M A;  2DNX A;  2XHE B;  2IHR 1;  3O8G A;  4B3S T;  2XQY A;  4ISS A;  2AXD S;  2XDN A;  3Q0W A;  2JIW A;  4LF8 T;  4IE6 A;  3QPL A;  5LNK A;  4CXY A;  2WU2 A;  2E8I A;  3P9T A;  2ACX A;  4AC6 A;  2V6Y B;  4UVB B;  2NS7 A;  2TCT A;  2Y2Z A;  1WR0 A;  2Y48 B;  3AXJ A;  4X1I E;  3AEB A;  2R7T A;  3W15 B;  5AQH B;  3ZC1 A;  2LM9 A;  4W1U A;  2KT9 A;  1FIO A;  2UXH A;  3T1Y T;  4O2A E;  2ZB9 A;  2KZ7 B;  1O3X A;  5HAW A;  3BQY A;  2IML A;  1T33 A;  5GON E;  3CK6 A;  4WBN E;  5J1Y A;  3ZN1 B;  3RHW A;  3WHB A;  2Y30 A;  2BS4 A;  2CBJ A;  2M6B A;  3L3P A;  4M3D A;  5KDM C;  5CJ5 A;  3DPJ A;  5HXC A;  2X66 A;  3ZJ2 A;  2R7Q A;  2ZMA A;  4ZI2 C;  4M3E A;  3P4W A;  1ZKG A;  2XTL A;  3ZCI A;  4O2B E;  2CLY C;  2NTX A;  4GK5 E;  3CRJ A;  3VW2 A;  4WYV A;  2UXX B;  2WU5 A;  2F07 A;  2OA5 A;  5HBU A;  2VAS A;  5BR8 T;  1JT0 A;  3RH3 A;  2KXP B;  3NI7 A;  5HEU A;  3SS1 A;  4DBR A;  3MK7 C;  4TX5 A;  5C8Y E;  1HG2 A;  4AQF A;  5L3B B;  3C64 A;  3ZN0 B;  2LSY A;  5AQI B;  2Q9Q A;  2ZM0 A;  3KZ9 A;  3LFM A;  1HX1 B;  3BQZ A;  3LJL A;  3HTH A;  5AQQ B;  4AI6 A;  4ZZB A;  2G7G A;  1UX5 A;  4WBO A;  5F1J A;  2XGD A;  3RQW A;  3IA3 A;  3VTI A;  4D5C A;  3PV0 F;  1WFD A;  4JI4 T;  4UDS A;  2L9Q A;  3A7M A;  1D1C A;  4KBM B;  3K3O A;  1Y64 B;  4TUY E;  2W2U A;  4PK4 A;  4JI8 T;  5F08 A;  2G3B A;  2BBH A;  5K7F A;  3FB2 A;  1LVF A;  4JI2 T;  2K5B B;  3EDV A;  2W4X A;  4G2A A;  2V57 A;  3N9L A;  1WLX A;  4ASK A;  3KVB A;  4JV5 T;  3C4X A;  4HKA A;  4JLE A;  3PUS A;  5L4E A;  3HKE E;  2FBQ A;  2D5U A;  2JPF A;  3PU3 A;  4DR6 T;  4LFC T;  5F3J A;  1IBM T;  4QX8 B;  3UUL A;  5GPA A;  2QTQ A;  2HPJ A;  1RKT A;  5IWA T;  1FMV A;  1OXZ A;  2YDS A;  4GYS A;  2J1D G;  2VPR A;  3RYH E;  3Q5W A;  4ZZC A;  3MNL A;  3NRG A;  2ZCM A;  2BG9 C;  1WR6 A;  4YHH T;  2RP4 A;  3KIN B;  3RKG A;  2WY2 A;  3PUX F;  4ZI3 D;  3KBU A;  4GCL A;  4HWF A;  2O7O A;  1FMW A;  4PJM A;  4HEA A;  4EZ4 A;  3VPR A;  1A6I A;  3VRA A;  2DL1 A;  1MIV A;  2NR4 A;  4DV4 T;  3KV9 A;  4IHJ E;  3ETV A;  2WM9 A;  3I1A A;  2G0E A;  4IL9 A;  3RRC A;  2XGC A;  3OKQ A;  2A2F X;  3AE4 A;  3NNR A;  4LML A;  5FGL A;  4I43 B;  4D7M A;  2PBX A;  1D1A A;  4QH4 A;  4ME9 A;  5ETW A;  3MA9 A;  5JH7 E;  2XGE A;  3A5X A;  4I0U A;  2G7S A;  1XDP A;  3LOC A;  1SHZ C;  3JSJ A;  4UV9 B;  4DND A;  1W9R A;  1US7 B;  1BR4 A;  4QX7 B;  4MAL A;  3VR8 A;  3DP7 A;  4P09 A;  2NTY A;  3AE1 A;  4BAY B;  1HF8 A;  3PPB A;  1VOM A;  4IRE A;  1IBK T;  3TLW A;  3O9X A;  4H9R C;  4DID B;  2CEA A;  3B13 A;  2LSI A;  5JVD E;  3SOL A;  4E7S A;  2RPA A;  3BHQ A;  3CQG B;  1ORK A;  2ID6 A;  2DCF A;  1HG5 A;  4NXN T;  2OV9 A;  5H9T A;  2FJE A;  4LF7 T;  4OYK A;  4ABZ A;  3RI5 A;  2PG8 A;  4LF6 T;  5DJQ C;  4DR4 T;  4IGU A;  3VHL A;  2V6Y A;  5FYM A;  2LHN A;  1Z0X A;  1OED B;  2RAE A;  2CXD A;  1V9D A;  2OF7 A;  3X1D A;  1H7C A;  3EAM A;  3QC9 A;  5HCJ A;  2PBI A;  1N36 T;  2PZ9 A;  2J62 A;  5F5W A;  3M3Z B;  2ZM6 T;  4IE5 A;  4M3F A;  4HE8 A;  5AQP B;  3LJC A;  2KMF A;  2EHO B;  4H9Q C;  3ZQL A;  5HCM A;  4U2Z A;  3ANP A;  3IUV A;  1I94 T;  3BRU A;  3BJB A;  4KI0 F;  1I6Z A;  2VL8 A;  5HSZ A;  2UXB T;  2JJ9 A;  5LYJ E;  4AKI A;  4CI2 B;  4HFD A;  4GCT A;  3C4W A;  3FZF B;  5JR9 C;  3PUQ A;  2JMK A;  4LMK A;  1OED C;  4O4L E;  2WDR A;  3U78 A;  3H3M A;  3CWR A;  3TP3 A;  3ZQG A;  3PDY A;  2A3D A;  3C2B A;  4AC0 A;  2IDO B;  1SUM B;  2Q9Q B;  3KBT A;  5ABF B;  4EYY R;  3FK7 A;  3NRX A;  2BDE A;  3ZQF A;  5EK3 A;  2LLY A;  5IPA A;  3VOK A;  3FRQ A;  2BG9 A;  2VKO A;  3UQ4 A;  5HXH A;  1JTX A;  5AQL B;  3TLU A;  4GFL A;  5J2U E;  4DBQ A;  4JI1 T;  3BQI A;  2QIB A;  4ILB A;  4UEM A;  3FK6 A;  2A9U A;  4V1A v;  3AAI A;  4XK4 A;  2UUA T;  3LBX B;  4JBW F;  1XDO A;  1KK7 A;  3KV6 A;  5L3D B;  3NPI A;  2BKP A;  2LE8 A;  3VW0 A;  2G0U A;  2BVL A;  5TAO A;  3TLS A;  3VVY A;  3AEF A;  5DQV A;  2XQ7 A;  3EVY A;  1HNX T;  4XZC A;  3QBM A;  4GIW A;  4HFH A;  5JR9 A;  4UF0 A;  5CA1 E;  5CFB A;  4YSZ A;  1XMO T;  1RKW A;  3NRY A;  1OED A;  3ANW B;  2XAG B;  4A5X A;  3ZMV B;  4EEB A;  1IJ5 A;  2DTZ A;  3B57 A;  2V8S V;  2HH7 A;  4OYJ A;  1OWA A;  3RH2 A;  5IOZ A;  3OPC A;  5E0O A;  5FKK A;  3WAK A;  3LHQ A;  4YTM A;  1B7T A;  2EHO A;  2X68 A;  4KP3 C;  5ABG A;  3HA4 A;  3E7Q A;  5AQK B;  4O8S A;  3D0T A;  3FBL A;  3BNI A;  5J1R A;  3NWI A;  5HEG A;  2WUI A;  4Q25 A;  3AED A;  1YXR A;  5ABE A;  1XWM A;  2BBJ A;  5JTG A;  4CN1 A;  4UR9 A;  5L3F B;  3Q5E A;  5K7Z A;  2OER A;  2CM0 A;  3MXZ A;  3BQL A;  3NVO A;  3LG7 A;  3LSV A;  3E0Z A;  4CXX A;  3QKX A;  4CZZ B;  3VP5 A;  4YLH A;  5H6R B;  3EUH A;  3RKO A;  2UXC T;  2ZM8 A;  4I4T E;  1HR0 T;  4X5T A;  4UVC B;  2I0M A;  4PJL A;  5IOY A;  2KLQ A;  1D0Z A;  2CRB A;  2FD5 A;  5L3C B;  3G56 A;  3V78 A;  4YTP A;  2HKU A;  4OHF A;  2V7J A;  4L5G A;  3PUA A;  2X6O A;  2NP5 A;  2LEH A;  4YSY A;  5FKM A;  4JEU B;  2W67 A;  2E9X B;  3VKH A;  5L3G B;  2X9H A;  2ID3 A;  2DWG A;  2XAF B;  4H9P C;  4LFB T;  4TWF A;  3H37 A;  3VR9 A;  2YEV C;  2E2A A;  5JDN A;  3R6N A;  1WYC A;  3KVA A;  2ES0 A;  3DEW A;  4J2C A;  2HHH T;  4BJN A;  1R8I A;  2UXU A;  3ZCJ A;  2XQ8 A;  4JI7 T;  3HTJ A;  3N2O A;  3JCF A;  2NP3 A;  2FJD A;  3RRW A;  2E5L T;  2VKD A;  2WMO A;  3CPZ A;  4YFS A;  3P50 A;  4CXW A;  2MTQ A;  2VQE T;  4GKK T;  2NOX A;  1JTY A;  3KNW A;  4MBQ A;  1U9O A;  2C5J A;  3M65 A;  3KDS E;  1E2A A;  2QYW A;  2X9X A;  5FXX A;  4JNN A;  4ZI7 E;  4L0R A;  5HXR A;  1E1H B;  5BMV E;  3ZPO A;  1ZOY A;  5LG3 A;  4YY3 T;  2RA1 A;  1VI0 A;  2R7V A;  2CXL A;  1T7S A;  2YIN A;  5JRC A;  3COL A;  3PU8 A;  4JL3 A;  1QVT A;  4IE7 A;  3LK3 B;  2BZB A;  3VUQ A;  2W61 A;  3FZH B;  2WV1 A;  2J4G A;  5AQS B;  3PUV F;  3U3I A;  3NBX X;  3IH4 A;  2XQ5 A;  4JI5 T;  4QXB B;  3ZT7 A;  3Q9D A;  1XMQ T;  4HFB A;  2V1D B;  4UV8 B;  5CB4 E;  1SGM A;  3MZK B;  3BTJ A;  2O7T A;  3EAB A;  3KFW X;  2YN6 A;  2KIN B;  5ABF A;  3B81 A;  4AXP A;  4H9O C;  4X1K E;  3BR2 A;  3BR0 A;  2A72 A;  2XPV A;  5D18 A;  4QWN B;  4U3C A;  3UU3 A;  2CWO A;  4DR1 T;  4U72 A;  4ERR A;  2KND A;  2X67 A;  3P4R A;  3I0Q A;  2MPK A;  3IF8 B;  2VKE A;  5DAJ A;  3O4X E;  4TV8 E;  4UIG A;  3DJB A;  3CJD A;  1YKH B;  4HFE A;  2V6X A;  3HGY A;  2VKJ A;  3RGL A;  2V26 A;  2X0L B;  3QUJ A;  2LRK A;  1NAF A;  5JDF A;  2EHO D;  2N9D A;  4HWC A;  4ANJ A;  4Z91 A;  2B3W A;  4ZHQ E;  3C50 A;  3RX6 A;  4XBF B;  5FP3 A;  4TV9 E;  4DR7 T;  2IAI A;  4F6R C;  4U9L A;  3N9O A;  5L3E B;  3O60 A;  4AKL A;  4A98 A;  2EH3 A;  1YKE B;  2QA7 A;  5L47 A;  2GUH A;  4MO7 A;  2CA5 A;  1IAP A;  3DTO A;  4ZS2 A;  2X9D A;  2JQQ A;  3EUP A;  2E5V A;  3AXJ B;  3IH3 A;  2XAQ B;  4DV0 T;  3FBZ A;  2YDR A;  3GMI A;  1E7P A;  1ZKE A;  3HTA A;  2CPT A;  2HYJ A;  3ONJ A;  4LFA T;  4B3A A;  4MK6 A;  3Q2M A;  4AQY T;  1MND A;  1AJ3 A;  4HFV A;  1YQ4 A;  5IP6 A;  2KSR A;  3FHN A;  4ZEY A;  1T8B A;  5JRC B;  2JMH A;  3O1H A;  2HPL A;  2J47 A;  2WCA A;  3QQA A;  5FKL A;  2DI4 A;  2YVX A;  4GK0 E;  2DWK A;  5JRE A;  3EGQ A;  1CHU A;  2QVA A;  3AE7 A;  4NXM T;  4H9N C;  2EHO C;  2LM2 A;  1Z8U A;  3F2E A;  3QOF A;  2H7O A;  2XAH B;  4Z8X A;  2QGS A;  4M3B A;  2D9D A;  3PUW F;  4WNK A;  1BJZ A;  5LBM A;  3BTL A;  3RD3 A;  3AQS A;  5HEH A;  1J1J A;  3WAJ A;  2MYS A;  4IT4 A;  2BKO A;  2H88 A;  5JR9 B;  4K0K T;  1HNZ T;  3FIW A;  2R7U A;  2W0G A;  3F31 A;  2UXP A;  2VKV A;  3JAE A;  5FVL A;  3L8R A;  2XAJ B;  1ZEE A;  2XAS B;  5CQG A;  2XM2 A;  3CQC B;  4G63 A;  2G7L A;  4IDQ A;  5KMG P;  3VW1 A;  5LHG B;  3SRZ A;  3LSP A;  3WI3 A;  2ODU A;  3QPS A;  3LSR A;  4GFK A;  3GWH A;  5LG4 A;  4B3R T;  4ILU A;  3IBP A;  4B1R A;  4PK5 A;  5IYZ E;  1FJG T;  2WS3 A;  3C51 A;  4QKN A;  4X62 T;  4X1E A;  3G1M A;  4CN4 A;  3T1H T;  2NP9 A;  5KXJ A;  3AE3 A;  5AQV B;  4EOZ B;  2WQY A;  4QH5 A;  5CA0 E;  4YXD A;  1HTJ F;  5LMN T;  2K3W A;  1Z0P A;  3T6N A;  3BR3 A;  3OBV E;  3AA7 B;  3ZMS B;  3PTR B;  2UUB T;  3RC8 A;  3G06 A;  3HGG A;  3ZLI A;  4NEL A;  4DV6 T;  3MKD A;  3N9P A;  3V5U A;  1BR1 A;  4IST A;  2QKO A;  4O4I E;  3OJA A;  1YD8 G;  2WZH A;  2MBG A;  4I55 E;  1KNR A;  2R7O A;  4O4J E;  3A8Y C;  5J1U A;  2XSA A;  1WYB A;  1NWM X;  1CUN A;  2E9X D;  1MIW A;  2F4V T;  3ZJ1 A;  3P7I A;  2JJ7 A;  2YOE A;  4GYR A;  4EED A;  2DG8 A;  3O1I A;  5AQN B;  3PUG A;  3CVR A;  5LGT B;  2LKH A;  3LSJ A;  2C0S A;  2OI8 A;  5FKY A;  1JNZ A;  3HI2 A;  2JQH A;  5LGU B;  4M3G A;  2JQ9 A;  3AVS A;  4DR2 T;  1EZ3 A;  2IAK A;  3BT9 A;  3CQX C;  2XQ9 A;  2K48 A;  2N1G A;  3CCY A;  3B5M A;  1DU2 A;  4X64 T;  1LKX A;  5LJN A;  5CW8 A;  4PFO A;  3QK6 A;  4LMJ A;  2HXO A;  3ZYM A;  1SA0 E;  2X0Y A; 
#chains in the Genus database with same CATH homology
 4EAH A;  2X9H A;  3UTK A;  2DWG A;  2XAF B;  3O1J A;  4AI6 A;  4H9P C;  4C91 A;  1LRZ A;  2YK0 A;  4N78 D;  1UX5 A;  2VB6 A;  4WBO A;  1S35 A;  1WRD A;  3H37 A;  2W62 A;  2X9Y A;  2VWA A;  2YEV C;  4PNI A;  2I59 A;  5JDN A;  3R6N A;  2VKH A;  3C98 B;  3VTI A;  3CX6 B;  1WYC A;  3KVA A;  5L2L A;  2H3R A;  2ES0 A;  3OYX A;  2L9Q A;  4ZOL E;  4J2C A;  1D1C A;  4KBM B;  3K3O A;  1Y64 B;  4TUY E;  4PK4 A;  5FY0 A;  1IJ6 A;  5LHI B;  4BJN A;  2CCQ A;  3ZCJ A;  4DO0 A;  4ADZ A;  3FB2 A;  1LVF A;  3N2O A;  2K5B B;  4H9S E;  3EDV A;  4CQI A;  3C4Z A;  4G2A A;  3N9L A;  1WLX A;  1MMN A;  3Q5X A;  2E9X C;  3RRW A;  3VKG A;  2VKD A;  2WMO A;  4ASK A;  3ZMT B;  3CPZ A;  4MFR A;  2CLY B;  4YFS A;  2X9W A;  3LBX A;  5M4Y A;  1IZN B;  2N2N A;  2MTQ A;  3KVB A;  4CXW A;  4YHJ A;  2CXF A;  4ZS3 A;  1U4Q A;  3HL6 A;  2NOX A;  5EK4 A;  3BQK A;  5HWX A;  2V7M A;  4MBQ A;  2YU2 A;  4P0A A;  3H3A A;  2C5J A;  1UCU A;  3C4X A;  2D0T A;  3M65 A;  3KDS E;  4HKA A;  4JLE A;  3PUS A;  4X20 E;  3HKE E;  2D5U A;  2JPF A;  3PU3 A;  2X9X A;  5FXX A;  5LA6 E;  4ZI7 E;  4L0R A;  5HXR A;  1E1H B;  2WWU A;  5F3J A;  3IHR A;  5BMV E;  4BJM A;  3ZPO A;  4QX8 B;  3UUL A;  2RA1 A;  3K3N A;  2HPJ A;  2R7V A;  3CKD A;  3ZEF B;  5LXT E;  2W63 A;  4YJ2 E;  3K3Q C;  2CXL A;  3RYI E;  2YIN A;  5JRC A;  1FMV A;  1OXZ A;  4GYS A;  4EZH A;  3BK9 A;  3ANW A;  5JDM A;  2J1D G;  3I0O A;  3HKC E;  3PU8 A;  3F57 A;  3RYH E;  2LT3 A;  2WSS V;  4IE7 A;  3UUX B;  3Q5W A;  3E08 A;  3LK3 B;  2BZB A;  5J1G A;  5LOV E;  2B1E A;  1WR6 A;  2W61 A;  3LK2 B;  2MOZ A;  2RP4 A;  5JDG A;  1LVK A;  3VKH A;  3KIN B;  5L3G B;  1D0X A;  4ZI3 D;  4PJJ A;  2KWH A;  3KBU A;  3U3I A;  5LJM A;  4IE4 A;  3NBX X;  1FMW A;  2C5I T;  3GN5 A;  4K0U A;  4U74 A;  4PJM A;  1QSD A;  4HEA A;  4EZ4 A;  4QXB B;  3Q9D A;  2R7S A;  2ZLY A;  4IRV A;  1MIV A;  3K8P C;  2V1D B;  3HKB E;  4UV8 B;  5CB4 E;  4AQG A;  3ZC0 A;  3KV9 A;  1QUU A;  3MZK B;  3TKL B;  3VU7 H;  3S4U A;  1G73 A;  4IHJ E;  3ETV A;  3E22 E;  4EXT A;  3KFW X;  3N2G E;  4OFZ A;  4YJ3 E;  2Q9Q D;  2WM9 A;  3ETU A;  3I1A A;  3AA0 B;  1FEW A;  3RRC A;  2KIN B;  2FJI 1;  3OKQ A;  4TZ4 C;  3MJX A;  2A2F X;  2IC9 A;  4H9O C;  4X1K E;  4I43 B;  2A72 A;  4AXP A;  1D1A A;  4CI3 B;  4TN7 B;  5ETW A;  2H7V C;  3MA9 A;  4QWN B;  3RC3 A;  5JH7 E;  3A5X A;  2CWO A;  4DMV A;  4OD4 A;  1SHZ C;  3DU6 A;  3HKD E;  2W00 A;  4U72 A;  2ZM2 A;  4UV9 B;  4ERR A;  4DND A;  2KND A;  1US7 B;  4M1P A;  1BR4 A;  4QXC B;  5IHY A;  2X67 A;  3JC6 D;  4QX7 B;  4MAL A;  4UEL A;  3I0Q A;  3DP7 A;  2Y8D A;  4P09 A;  4AKH A;  2NTY A;  4BAY B;  1HF8 A;  3IF8 B;  1VOM A;  2PJQ A;  2DHR A;  3O4X E;  4TV8 E;  3O9X A;  2LSJ A;  4UIG A;  3DJB A;  1YKH B;  3GN5 B;  4XAX B;  3V5S A;  4B6X A;  4H9R C;  1UX4 A;  2E9X A;  3PUR A;  2CEA A;  3B13 A;  3N9N A;  2LSI A;  5F8P A;  5JVD E;  2VKJ A;  3SOL A;  3SWH A;  2V26 A;  2X0L B;  2L3L A;  3QUJ A;  1NAF A;  5JDF A;  2EHO D;  2N9D A;  4E7S A;  1U5P A;  4ANJ A;  3CQG B;  5JQG E;  4WW0 A;  3AAA B;  4PW8 A;  2DCF A;  2B3W A;  3N5L A;  1HG5 A;  3C50 A;  3N9M A;  3R84 B;  2C5K T;  4ZHQ E;  3RX6 A;  2CWY A;  4XBF B;  3HR0 A;  5FP3 A;  1BR2 A;  1D0Y A;  5AFU L;  4TV9 E;  3N9Q A;  4F6R C;  3N9O A;  5L3E B;  4OYK A;  4AKL A;  4AKR B;  2JRK A;  4IE0 A;  1ZHC A;  2PG8 A;  5FY7 A;  5DJQ C;  1YKE B;  2QA7 A;  1HX8 A;  4IGU A;  3VHL A;  2CA5 A;  5FYM A;  1IAP A;  2SPC A;  3DTO A;  3PE0 A;  4ZS2 A;  3ZMU B;  2LHN A;  2JQQ A;  2CXD A;  1V9D A;  1MMG A;  4JEH B;  1H7C A;  2XAQ B;  3FBZ A;  3QC9 A;  2V7K A;  2YU1 A;  2PFV A;  2Q9Q C;  4FJO A;  2PBI A;  3GMI A;  4UVA B;  4BA9 A;  2DLR A;  3ZMZ B;  4EYU A;  5HYA A;  1ZKE A;  1VRB A;  3RYF E;  3MAC A;  3AB3 B;  4O4H E;  2WMN A;  4IE5 A;  4HE8 A;  3LJC A;  3Q2M A;  2KMF A;  2KWI B;  2EHO B;  1MND A;  3KV5 A;  5LGN B;  1AJ3 A;  4H9Q C;  4HFV A;  5J2T E;  4HTE A;  3ONX A;  3FHN A;  5FXW A;  3I9Y A;  2XUE A;  5JRC B;  2JMH A;  3N2K E;  3O1H A;  2Z6E A;  3JC6 C;  4I50 E;  2X51 A;  2R7R A;  2VL8 A;  2HPL A;  4PFP A;  2IC6 A;  5EZY E;  2NWB A;  3ZYK A;  2P9B A;  2ODV A;  3ESL A;  2DI4 A;  2JJ9 A;  5LYJ E;  1HS7 A;  4AKI A;  4CI2 B;  4GK0 E;  5JDH A;  2DWK A;  5JRE A;  4IDZ A;  3C4W A;  5JR9 C;  3EDU A;  1HFA A;  3PUQ A;  4X1Y E;  5JDL A;  5EK2 A;  2JMK A;  3OYZ A;  4H9N C;  2EHO C;  4NUU A;  4O4L E;  3RPU A;  3U78 A;  3F2E A;  2H7O A;  2XAH B;  4Z8X A;  2QGS A;  3CML A;  4QHO A;  2VK9 A;  3PDY A;  5KX5 E;  2A3D A;  3AAE B;  4AKG A;  3NS4 A;  1G8X A;  4WNK A;  2CMR A;  4DMW A;  5LBM A;  4QXH B;  2Q9Q B;  3KBT A;  3AVR A;  1ZV4 X;  3I9W A;  4KUM B;  4DVD A;  2BVM A;  4EYY R;  4KMC A;  2K9A A;  4PAG A;  3NRX A;  3WAJ A;  2MYS A;  2BDE A;  4IIJ E;  5LHH B;  5HAX A;  1S94 A;  5EK3 A;  5FY1 A;  2LSK A;  5JR9 B;  4UF0 B;  2R7U A;  2LOP A;  2W0G A;  2VKO A;  3F31 A;  3CX8 B;  5FMN A;  4CI1 B;  4JUY A;  1X79 A;  5HXH A;  5A1L A;  2R7X A;  2XAJ B;  4MLK A;  1ZEE A;  2XAS B;  5CQG A;  2LOS A;  4HGA A;  3CQC B;  5J2U E;  3L09 A;  4DBQ A;  5ADX L;  1MMA A;  4OD5 A;  2LSG A;  4G63 A;  1BR0 A;  3BQI A;  3DU5 A;  3P8C D;  3FXD B;  5FXZ A;  4ZI2 D;  1MMD A;  4UEM A;  2Y6X A;  4AQF C;  4MHC A;  5KMG P;  5LHG B;  5H6Q B;  4V1A v;  3SRZ A;  5JDQ A;  2R7W A;  3UUM A;  3WI3 A;  3J7Y q;  2ODU A;  3AAI A;  5LBQ B;  2NW9 A;  2D2S A;  4ZI3 C;  3IEE A;  3KYL A;  3GWH A;  5DAB A;  3LBX B;  4EIW A;  5LG4 A;  4PK6 A;  1KK7 A;  4ILU A;  5LCY A;  3IBP A;  4PK5 A;  3KV6 A;  5HXS A;  5IYZ E;  5L3D B;  2NW8 A;  4C2M A;  2DNX A;  3C51 A;  4QKN A;  2XHE B;  5FXV A;  2NP9 A;  2V7L A;  1MNE A;  2LE8 A;  1HCI A;  4H63 H;  2XQY A;  3CX7 B;  4EOZ B;  4ISS A;  4DVY P;  2G0U A;  2BVL A;  5TAO A;  5CA0 E;  2LJL A;  4IE6 A;  4EB6 E;  5DQV A;  5LNK A;  3EVY A;  1HTJ F;  5HWY A;  4XZC A;  4CXY A;  4GIW A;  1Z0P A;  2E8I A;  2ACX A;  3OBV E;  5JR9 A;  3AA7 B;  3ZYL A;  4UF0 A;  3PTR B;  4UVB B;  3ZMS B;  5CA1 E;  4A56 A;  3GA8 A;  4NUV A;  3NRY A;  3ANW B;  3RC8 A;  2Y48 B;  2XAG B;  3CWZ B;  3ZMV B;  4X1I E;  3ZLI A;  2R7T A;  3W15 B;  3NZQ A;  3LK4 2;  3MKD A;  3N9P A;  3ZC1 A;  3V5U A;  1BR1 A;  1YW0 A;  2CE7 A;  2LM9 A;  3UUN A;  1IJ5 A;  2LHR A;  4IST A;  3B57 A;  3J9X 1;  2KT9 A;  2HH7 A;  4O4I E;  1FIO A;  3OJA A;  1YD8 G;  4O2A E;  2UXN B;  1D1B A;  4OYJ A;  1OWA A;  2KZ7 B;  3NZP A;  4I55 E;  2MBG A;  1O3X A;  5E0O A;  5GON E;  3UT5 E;  3WAK A;  2R7O A;  1T98 A;  4WBN E;  4O4J E;  4HN9 A;  3T8O A;  1B7T A;  4FI5 A;  2EHO A;  2X68 A;  4P0B A;  3ZN1 B;  4KP3 C;  1WYB A;  1NWM X;  1CUN A;  2E9X D;  1MIW A;  3HA4 A;  3ZJ1 A;  3P7I A;  4GYR A;  4O8S A;  3L3P A;  4C90 A;  3D0T A;  3FBL A;  4GOU A;  5KDM C;  3O1I A;  3PUG A;  3CVR A;  2WBL A;  2M67 A;  5HXC A;  2X66 A;  3ZJ2 A;  2R7Q A;  5LGT B;  2ZMA A;  4ZI2 C;  2C0S A;  5HXE A;  5L3F B;  2K24 A;  2XTL A;  2D0U A;  2WAU A;  2V7I A;  3HI2 A;  2CM0 A;  4O2B E;  3ZCI A;  2CLY C;  2NTX A;  3MXZ A;  3FXE B;  5LGU B;  3BQL A;  3AVS A;  4PJN A;  4GK5 E;  1EZ3 A;  2IAK A;  3LG7 A;  2UXX B;  5DQW A;  3E0Z A;  4CXX A;  2OA5 A;  4CZZ B;  4YLH A;  5H6R B;  3EUH A;  3CQX C;  2NW7 A;  2VAS A;  4UXN B;  5FNV E;  2K48 A;  3RKO A;  2N1G A;  2ZM8 A;  3RH3 A;  4I4T E;  2KXP B;  4UVC B;  4E7Z A;  5LP6 E;  4PJL A;  2KLQ A;  1D0Z A;  3AA6 B;  2IW5 B;  5L3C B;  4L9I A;  3SS1 A;  1KNZ A;  1LKX A;  4OK0 A;  4DBR A;  3MK7 C;  4TX5 A;  4OHF A;  3UFE A;  5C8Y E;  2V7J A;  5LJN A;  4L5G A;  1HG2 A;  4AQF A;  5L3B B;  3RYC E;  4PFO A;  3C64 A;  3PUA A;  3ZN0 B;  3QK6 A;  3KV4 A;  2LSY A;  3ZYM A;  3AA1 B;  2LEH A;  2Q9Q A;  2L8K A;  2ZM0 A;  4JEU B;  1MIY A;  1SA0 E;  2E9X B;  3LFM A;  4H63 V;  2GK9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...