3SWHA

Munc13-1, mun domain, c-terminal module
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
316
structure length
295
Chain Sequence
AWFEPFVIQWLDENEEVSRDFLHGALERDKKDGFQQTSEHALFSCSVVDVFSQLNQSFEIIKKLECPDPQIVGHYMRRFAKTISNVLLQYADIVSKDFASYCSKEKEKVPCILMNNTQQLRVQLEKMFEAMGGKELDAEASGTLKELQVKLNNVLDELSHVFATSFQPHIEECVRQMGDILSQVKSVAQDADNVLQPIMDLLDSNLTLFAKICEKTVLKRVLKELWKLVMNTMERTIVLPPEFSKLKDHPKQCAVVELALDTIKQYFHAGGVGLKKTFLEKSPDLQSLRYALSLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Exocytosis
molecule keywords Protein unc-13 homolog A
publication title The Crystal Structure of a Munc13 C-terminal Module Exhibits a Remarkable Similarity to Vesicle Tethering Factors.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 130
structure length 295
sequence length 316
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10540 Membr_traf_MHD Munc13 (mammalian uncoordinated) homology domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.50 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor; domain 2 3swhA01
1.20.58.1100 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3swhA02
2FJI1 3SWHA
chains in the Genus database with same CATH superfamily
2JRKA 3BR3A 1M7KA 3HGGA 3AEDA 1W0AA 3RGLA 5JDQA 4WBNE 4YSXA 3I0QA 4AQFC 1JNRA 2XQAA 4C90A 1UI6A 1MIWA 2JQ9A 2ACZA 3EVYA 1J5WA 3BR6A 2CBJA 1NENA 1MMAA 2XGEA 3I9WA 3NZQA 2LKGA 2HPJA 3AE1A 3AXJB 5IOYA 5GPAA 3VVXA 2ZM6T 1NEKA 3LSJA 2WCAA 2QA7A 4ZI2C 3JADA 2JMHA 3K3OA 2NP9A 3PM1A 4ISSA 1YKEB 5J1UA 3ZSSA 5HXEA 3BTIA 4LF5T 1BJZA 1T98A 3PTRB 4Z91A 3JC6C 3ZN0B 3KKCA 5J0ZA 4IE6A 1AJ3A 1G73A 5FL1A 5IYZE 4YTPA 2A3DA 4G63A 5LJNA 3OKQA 4JI7T 4G12A 3MXZA 3AQTA 2NS7A 2D6YA 3DEWA 3Q9DA 4MHCA 5EZHA 3ZQHA 2XQ3A 5J2UE 5LMNT 2X9WA 3AE3A 4YY3T 4AQFA 3G1LA 3Q5XA 4P09A 2R6GF 2Y31A 2Q9QD 4MLKA 5CGMA 3Q0UA 5HBUA 2N2NA 3PUWF 5ABFB 5KDMC 2BG9B 2ZM8A 4ME9A 4QHOA 4DVYP 2DHRA 4DNDA 3VW2A 3FZMB 3O8HA 4NUUA 3VP5A 2WV1A 2YVEA 4X20E 2QRXA 5HEOA 2XPUA 4JEUB 4O4IE 4QX8B 5JDLA 4D7NA 2VL0A 3KDSE 2XSBA 3VRBA 2DLRA 5J1RA 1DU2A 2CMRA 2XPVA 4X66T 2IU5A 2XAQB 4JYAT 5HCJA 4JI2T 2XY8B 4UXNB 3BCGA 5KMGP 3ON4A 4LF7T 2W00A 2WMNA 4IDNA 4V2GA 2OA5A 1JTYA 3AQSA 3QOFA 2VKOA 4GFLA 4EYUA 4JKZA 4WIBA 3M3ZB 5FXVA 2YDRA 4WZXA 1JT0A 2H88A 5JR9C 2Y30A 1E7PA 5CXIA 4M3DA 3ZKRA 2MYSA 3V6GA 2YVHA 4O2BE 4Z90A 3EI0A 3ETUA 1UX5A 3AE5A 3RRCA 4IDOA 5FKOA 5HXRA 3ESLA 2TRTA 3O4XE 5LBQB 2ZCXA 5HAWA 5LNKA 4AKIA 4IE5A 3EUPA 3VVZA 2JQKA 1OXZA 2KWIB 2WM9A 3B57A 2LRLA 2H7OA 3VIBA 3KVBA 2MBGA 3HTAA 4FI5A 3EDVA 2E9XB 3VR8A 3QNUA 4HWIB 1J1JA 2QCOA 3TP0A 1WR0A 2VASA 4JI3T 3VHLA 5IPAA 2IIUA 5AQIB 4OHFA 2AXDS 3ZLIA 4ZI2D 3T1HT 3ETVA 4ZI3C 2LOPA 4MALA 3QB5A 5JR9A 3WHBA 2XUEA 2LM9A 5ABEA 3N9LA 4JYKA 2IHR1 3A8YC 2CHOA 1US7B 3G1MA 4HFVA 1R8IA 3AXJA 2HN2A 2GENA 2X9XA 2XJ7A 2WZHA 4LFBT 3HR0A 2PG8A 4GYRA 4GIWA 4I55E 4ZZBA 5HEGA 1IJ6A 4CZZB 4TV8E 3SWHA 2UUAT 3UFEA 2NX4A 3PJAJ 5JQGE 4ILCA 3H37A 5ADXL 1UGOA 5IWAT 1S35A 4YLHA 2IEKA 5DJQC 4YHJA 3MZKB 2UUCT 4D7MA 2ZB9A 3RYCE 2VURA 5EK4A 5HEJA 3P7IA 5F27A 5EK2A 4I43B 4UVAB 3F31A 3CX8B 2MOZA 4H9PC 2ID6A 3BQZA 5CA1E 3C4WA 5CW8A 4JI1T 4K0KT 2HH7A 3K1SA 3VKGA 5ABFA 2BG9A 3T6NA 2CWOA 4AKRB 4B3MT 2CBIA 2ZM2A 4GK0E 4CN4A 1I6ZA 3LK3B 4LF8T 1L0VA 1KK7A 3P9TA 3QK6A 1QPIA 2CE7A 3HTIA 4PFPA 1RPWA 2D9DA 4KHPT 5K7FA 3FZHB 3LG7A 4AUXA 3RIAA 4JNNA 2YDSA 4I50E 4GCTA 5C3JA 3DTOA 4MFRA 4CI2B 4ZS3A 1ZHCA 4IIJE 2UXPA 3ZEFB 1OWAA 4EIWA 5KXJA 2QYWA 3RYHE 4DBRA 2VKDA 2V26A 5JDMA 4UIGA 5LB7B 4CI3B 4P1NA 4B3RT 1XMOT 3UU3A 2JPFA 4HFDA 4EGWA 3QPSA 4X1YE 5AQHB 3ANPA 5F0CA 5LJMA 3RRWA 3AA0B 4H9RC 3JAEA 3FRQA 4L5GA 3WAJA 2NTXA 3BQLA 4MK6A 3GZIA 3PUGA 3EUHA 3OVUA 3O60A 5A1LA 2ODVA 4DV1T 2X6OA 4GYSA 1VCSA 1N33T 3CWRA 2XQYA 2FUPA 2BKNA 3VW1A 3AE2A 2WWUA 3KV4A 3CVRA 2UXDT 3ZYKA 2W62A 3P4QA 5LGNB 4ZI3D 2O7TA 5JREA 3MJXA 3B6AA 3CDLA 1YW0A 2I6HA 4YSZA 2G0UA 3B13A 3M65A 4AQGA 4HWCA 2E9XA 4YXDA 2V1DB 4GCLA 4AKLA 2ZMAA 2M6IA 1U4QA 4IREA 2HHHT 1UI5A 1D0YA 2H7VC 1WRDA 2H89A 2CXDA 1UCUA 4V2FA 1X79A 4HWDA 2ID3A 2LSGA 3MA9A 3ZMUB 5LG3A 5LMUT 2KXPB 2V7JA 1T7SA 3K8PC 3EDUA 2Q9QC 3O1IA 2WWVA 3RX6A 4L9IA 1HR0T 1BR4A 3W15B 4GKJT 3UUMA 2XQ5A 4A98A 2CA5A 2CPTA 2YU1A 4ZS2A 2VVNA 5HAXA 3VKHA 4JV5T 3BQIA 2KSRA 4OYKA 4X62T 4HFIA 3AE7A 5FXXA 3ONJA 4EV6A 2VVSA 2ACXA 2XQ6A 2PZ9A 2CXLA 5ABGA 1VCTA 1JUMA 4LMJA 3L3PA 4U7IA 1Y64B 4C2MA 2RA1A 3PUVF 1EZ3A 3P4WA 5AQQB 2FX0A 3L8RA 3HE0A 2VL8A 2WGBA 1HX1B 3BR1A 3AEAA 2HYTA 1T33A 1IBKT 1W0BA 2QOPA 2WP9A 3G06A 1T56A 1WLXA 1G8XA 2NP5A 4BA9A 4YJ3E 2LHRA 2Q9QA 4QXHB 2AE9A 5FGLA 3RIFA 3RI5A 3EAMA 4I0UA 3BTCA 4H9OC 4ADZA 2D0UA 4ZOLE 3KFWX 3PUSA 3J9X1 4I6ZA 4IDPA 1ZK8A 5GP9A 2LSJA 4JBWF 4AC6A 4M3BA 3CX6B 4ISTA 3EHZA 2YK0A 3HIMA 4DR1T 3ANGA 4W97A 2E9XD 2FJDA 3RPUA 4AXPA 4A56A 1JT6A 1X9BA 3UU4A 3HKBE 1OEDE 3L39A 2RASA 3FHNA 3UT5E 3Q2MA 2Y8DA 1LRZA 5HXSA 4DV2T 2FD5A 1RKTA 3UUNA 4GFKA 3KVAA 4L62A 1YXRA 3CK6A 2XAJB 3QQAA 3KV6A 3ONLC 4UF0A 2QVAA 3DJBA 5L3GB 5CQGA 3CIRA 2PTFA 3AVRA 2C0SA 5L3BB 4M3FA 3ZCJA 2ZM0A 4PK5A 2W2UA 4E7ZA 3N5LA 3HKCE 3P8CD 2Q24A 4ILBA 3UTKA 1HNWT 3ZMVB 2P9BA 1XDOA 2X0HA 5LP6E 2UXUA 2A2FX 4NXMT 3Q3SA 5AQVB 4JI0T 3ZQGA 2D0TA 2D5UA 3N9NA 3IH4A 3CPZA 1Z0XA 2KWHA 3LOCA 3QB5K 3LDQB 3Q0WA 1QLBA 2WU5A 2CXFA 4YZEA 2JK3A 4HFCA 3VUQA 3ZT7A 4X64T 4COFA 1ZP0A 4I4TE 3Q0VA 3DCFA 4GKKT 4LMKA 2K5BB 2HXIA 3PUQA 4TX5A 2KMFA 2JJ7A 4IL9A 2PBXA 3DU5A 4NIQA 5L2LA 2XGCA 2R7VA 5L4HA 5LHIB 4KHZF 1MMGA 2WUIA 4AISA 2Y48B 4H9QC 1IAPA 3TLWA 4TN7B 2FJAA 5EFYA 2OI8A 4YSYA 1HS7A 2YKSA 2PFVA 2FJEA 5BR8T 4HN9A 3I1AA 4PJNA 2DWGA 5AQGB 2C5JA 1IJ5A 2VKEA 2V8SV 4EAHA 4DMWA 3ZPOA 5LYJE 4HE8A 1HTJF 3MNLA 3KV9A 4PJMA 2KZ7B 4CXWA 3AAEB 2JMKA 2G3BA 4U33A 3ZCIA 3HGYA 2DG8A 1Z77A 5JDFA 3HKEE 3V5SA 1ORKA 2QGSA 3GWHA 4YTMA 5HWYA 2XQ8A 4M3EA 4YT0A 1SHZC 5AQUB 2RPAA 3AEFA 2J47A 5LGUB 1SA0E 2YDQA 1QSDA 3UUBA 3WAKA 1QUUA 3AA7B 2M6BA 2FBQA 5JDGA 4KUMB 3ZJ1A 4QKNA 3ZT6A 1LKXA 4DV0T 2NS8A 3N9OA 5FXWA 4ZZCA 2VKJA 4EB6E 4A5XA 4IRVA 4IHJE 4IE0A 1JUPA 5AQLB 2WDRA 4TWFA 5JTGA 4UVBB 1HF8A 3ZJ2A 3CJDA 2Z6EA 2X0LB 4DV6T 2X67A 3G7RA 3VW0A 5F0FA 3TP3A 3PU8A 3D0TA 3NXCA 3AB3B 5J3LA 4PXIA 3R6NA 3C51A 4O4HE 2E5VA 3BR5A 4LF6T 5CJ5A 2V6XA 2B1EA 3MKDA 1HX8A 2XTLA 2N9DA 2K3WA 4V1Av 4NPPA 1M62A 2CRBA 2REKA 4EEBA 3NPIA 5EZGA 4QX7B 2GUHA 4F6RC 3MK7C 3O8GA 1D0ZA 1HNZT 4BAYB 1OEDB 1ZEEA 1U5PA 1MMNA 2WY2A 2IMLA 4HKUA 5LHGB 5FNVE 2UXBT 4DR6T 1Y01A 2DNXA 2BG9C 2R7UA 3IH2A 4H63H 4Q25A 2PBIA 2X9DA 3B5MA 4JI8T 1WYBA 3B6CA 2CLYB 3KKDA 5HXCA 4YJ2E 2BKPA 2JQHA 2LT3A 4H9NC 5DQWA 2R7WA 3GA8A 3DU6A 2HN1A 3PUAA 2R7OA 3GN5B 2WDQA 2LRKA 3HKDE 2XM1A 2BKOA 4X1IE 2HXOA 3BR0A 5FKYA 4IL4A 1MNDA 1WYCA 3LBXB 4H9SE 4M1PA 4OFZA 2WDVA 3RC8A 3RIUA 2XB5A 5L47A 2B3WA 5HEUA 1D1AA 5IUXA 1QVTA 3Q5DA 3NRGA 3VPRA 2VB6A 3FZLB 3BRUA 3SOLA 3SRZA 2GBYA 5D19A 2C5KT 5CA0E 5FL0A 2LLYA 4TNWA 4AF5A 4JI5T 4DR4T 2UXHA 4OD4A 2E5LT 3CRJA 1MIYA 2IDOB 2L3LA 3PUXF 2YOEA 1H7CA 4K0UA 2XASB 2FQ4A 3UU8A 2N1GA 3RH2A 3FB2A 2J4GA 1WCRA 2C5IT 2F07A 2W66A 5F5WA 3ZYMA 3ZC0A 3K3NA 2K9AA 3C4ZA 2XQ9A 2OERA 2XPWA 1HFAA 2ZCMA 1KF6A 4IT4A 4YFSA 3I9YA 3AEBA 4GOUA 3C4XA 4O4JE 3UULA 3OYZA 3V5UA 2E9XC 4LF9T 3KZ9A 3NNRA 3CQCB 3ONXA 2MAWA 2R7QA 1B7TA 1D0XA 2J1DG 2VKVA 3MACA 2LEHA 2VQET 3ZQLA 3K3QC 4X65T 3VR9A 1MNEA 3KINB 5JDHA 3AA1B 3NS4A 4H63V 4CXYA 1VI0A 1SUMB 3SFDA 4DV5T 4JUYA 1OEDC 4EZ4A 1W09A 2IC6A 4DUZT 5IHYA 2A72A 3BTLA 5HWXA 3TLSA 4ILAA 2DL1A 5FKKA 4LMLA 3RC3A 4EOZB 2FBWA 2V5DA 1ZOYA 2UXOA 5LCYA 5FP3A 1NWMX 3VU7H 3RKOA 3JAFA 5KX5E 4XZCA 5BMVE 2XAGB 1JUSA 4DW6A 5L3CB 3BK9A 4QXBB 3ZMTB 2TCTA 4DV4T 3ZSTA 2K48A 2OF7A 3F2EA 5F8PA 1Z8UA 4U72A 4WBOA 1N34T 3VRAA 3BT9A 2BBJA 3UQ7A 5CB4E 1A6IA 2X9HA 2Y2ZA 2GK9A 1OEDA 2VWAA 4TV9E 4EXTA 4HWHA 4X1EA 2R7RA 3E08A 4J2CA 2LE8A 1ZKGA 3LSRA 4IE4A 1YD8G 2WB5A 2R7SA 4ACIA 5LGTB 1FEWA 5D1RA 2JJ9A 4LF4T 5AQNB 1Z0PA 1HG5A 2BVLA 2LKHA 2DCFA 2UXXB 5HYAA 4ASKA 3GEUA 4B3ST 2XGDA 5K7HA 5D18A 3N9MA 5DAJA 1KFYA 3VVYA 1V9DA 4DV7T 2XAHB 1HG2A 5H6QB 2F4VT 3P4PA 4QH1A 3QKXA 3UU5A 4UR9A 4P0AA 3LBXA 3CCYA 3TKLB 2QKOA 4CQIA 4OK0A 4UV8B 2J62A 1O3XA 1T72A 2Y6XA 1IBLT 1KNZA 5F08A 4ZHQE 4XBFB 4DUYT 3HL6A 1XZYA 4ERRA 3RD3A 4UV9B 2V7KA 3CWZB 2GFNA 5AFUL 5F3JA 2VKHA 1ZKEA 1BR2A 5CXGA 3NVOA 4PK4A 3A5XA 4MO7A 3P50A 2WS3A 3ANWB 1UK5A 3LJCA 3QC9A 5LA6E 3SS1A 5ABHA 3BHQA 3WHCA 3UFGA 4C91A 3C07A 5ETWA 3N9QA 4JL3A 5DABA 5AQFB 3JSJA 3PASA 4WNKA 2V7MA 2WMOA 2QIBA 4GCKA 3BNIA 3SDGA 3NWIA 2MTQA 2NWBA 3GMIA 2SPCA 4JEHB 4JLEA 3IA3A 1UUSA 2W4XA 3VOXA 2LOSA 4CN1A 3FK7A 3EABA 1XNQT 1KNRA 2YN6A 5JR9B 2XRLA 3OJAA 3O1JA 3AEEA 2G0EA 5FXZA 2JIWA 5J1YA 1FIOA 4HFHA 4CXXA 2BS2A 3F57A 5LHHB 4U7YA 4AI6A 5EYRA 3AECA 4ICHA 5DQVA 3LSPA 2YU2A 4TNVA 2X66A 5L3DB 3J7Yq 2DI4A 2NW9A 2HPLA 2LSYA 3B81A 1XDPA 2UU9T 4KMCA 4OD5A 3UUXB 2D2SA 1SE7A 2NOXA 3AE6A 3CX7B 2NW8A 2HQ5A 3FZFB 4D5CA 5JH7E 2W67A 2CHNA 4U74A 1UURA 4WYVA 2XM2A 4OX9T 4U9LA 1RKWA 3BJBA 2O7OA 2HKUA 3E22E 4CGRA 2UXIA 5FVKA 3UU6A 4N78D 2W0GA 3BR2A 1KNPA 2WSSV 2LSIA 2WU2A 2G7LA 5HXHA 5AQOB 2M67A 1LVFA 3TLUA 4U9NA 1KEYA 3QBMA 1SGMA 3N2KE 3T1YT 3AEGA 3P4RA 2K24A 1BR0A 2X68A 2XAFB 3SFEA 4AQYT 1I94T 3NI7A 5LG4A 2XPKA 2B76A 1FMVA 2KNDA 3LK42 4Z8XA 4F8HA 3PUZF 4HFBA 2OV9A 4EZHA 3OPCA 2XSAA 2VPRA 5LOVE 3CMLA 4P0BA 5F04A 3U78A 3KBTA 5FKMA 4OYJA 1W9RA 5LXTE 4PK6A 3RKGA 2IW5B 3ZQIA 4AIUA 2BVMA 2KLQA 4HKAA 2L8KA 4UVCB 2YINA 4I76A 4NN1A 2BDEA 3H3AA 3RF1A 2XHEB 5FVLA 4X1KE 3NKZA 4KBMB 3A7MA 3KYLA 3Q5WA 3KNWA 3WI3A 2LM2A 3AVSA 1D1CA 2WZIA 4LFCT 2FJI1 5E0OA 3C64A 2G7GA 5L3FB 2XDNA 5J2TE 4HTEA 5C8YE 5CFBA 4G2AA 1HCIA 3S5RA 4U2ZA 2EHOB 3ANWA 3P4SA 4W1UA 3JCFA 3RIUC 2PJQA 2DG7A 2KINB 5H9TA 5J1GA 3HA4A 5AQPB 3LHQA 2VQFT 4DR2T 5AQSB 3AE8A 1N36T 5IOZA 1T8BA 3FZKB 2KT9A 4UEMA 5AQJB 2V5CA 3DP7A 4AKHA 2DTZA 3F0CA 1U9NA 4FJOA 2BS3A 3O9XA 2IUBA 3PDYA 3IF8B 4TUYE 5IP6A 4YTNA 3LK2B 3HTHA 2XZEA 2IAIA 3IHRA 3IH3A 4B3AA 2I10A 2NTYA 5FMPA 3QPLA 3CQGB 1YKHB 5FKLA 4GK5E 5JVDE 1JNZA 2I59A 4B1RA 3RLFF 4DBQA 3JC6D 5JRCB 1XNRT 3BQKA 3I0OA 2WQYA 1S94A 2WAUA 5FY1A 3RYFE 4ABZA 2BS4A 1XWMA 5K7ZA 2ZY9A 5TAOA 2R7TA 2NR4A 4AKGA 3G1OA 2EH3A 4XAXB 3IBPA 3RQWA 2VK9A 4IDZA 3ZN1B 4MBQA 4X5TA 4WW0A 2IAKA 3Q5EA 2NW7A 3FBLA 4PFOA 5FKNA 4PNIA 3R84B 3N2OA 3FXDB 4PJLA 2I0MA 1J5ET 3IEEA 3NRYA 5H6RB 1IZNB 4DMVA 4M3GA 4PW8A 5L4EA 2Q9QB 2MPKA 4O2AE 5C2TA 3OTOT 2UXNB 2W63A 2WBLA 1BR1A 5FYMA 2CEAA 2UXCT 1YQ4A 4DVDA 3N9PA 3EGQA 1FMWA 2A9UA 3U3IA 2L9QA 2CWYA 4HEAA 2IC9A 2BZBA 1CHUA 2H3RA 3FBZA 2V6YB 2V7IA 1NAFA 2CCQA 4DR3T 1WR6A 2IBDA 1N32T 4EEDA 2ZOYA 4UELA 2G7SA 2JQQA 2E8IA 5FY7A 4NELA 2ZLYA 2XQ7A 4JI6T 5HCMA 4B6XA 4CN6A 5AQCA 2R7XA 3PURA 4QH5A 1IBMT 2EHOC 4U31A 2XQ4A 3FIWA 2ES0A 1GQEA 4DO0A 3TLTA 5EK3A 4ANJA 2NP3A 1YQ3A 4NXNT 4UF0B 4O8SA 1WFDA 4KX6A 4QWNB 1QVUA 5M4YA 1E1HB 4TZ4C 3C98B 5EZYE 5FMNA 2OLTA 3RYIE 4O4LE 2X0YA 4U2YA 3ZC1A 4DIDB 4XK4A 3F1BA 4A97A 4E7SA 4BJNA 3PPBA 2E2AA 2BBHA 2FJBA 1HNXT 3NZPA 4PJJA 3IUVA 3PV0F 1D1BA 3AAAB 3C50A 4YHHT 5AQRB 1XMQT 5JDNA 2CLYC 2QWTA 2YVXA 3SFIA 3S4UA 2X9YA 5LBMA 3KBUA 2ODUA 4ZXLA 3DPJA 4QH4A 2BG9E 2EHOA 3AE9A 5HSZA 1U9OA 2DWKA 4IDQA 5GONE 2V7LA 4ZEYA 1E2AA 3LSVA 3AE4A 3X1DA 4BJMA 3CQXC 3PUYF 2FJ1A 2ZOZA 5K58A 3COLA 4CI1B 3FK6A 5AQKB 2W61A 3RQUA 2UUBT 5C4YA 5F1JA 4UDSA 2LHNA 4HWFA 3L09A 3VOKA 3C2BA 3OBVE 2LSKA 2HYJA 3HI2A 3LJLA 3E7QA 4IGUA 4KP3C 2RAEA 3CKDA 3RHWA 3ZMZB 5AQTB 1VOMA 4DR5T 3E0ZA 5L3EB 5JRCA 3RH3A 3MVPA 5GPCA 3KV5A 4NUVA 3OYXA 5FHPA 1LVKA 5F0HA 3VTIA 3GN5A 4HGAA 4JI4T 3N2GE 1CUNA 4DR7T 3O1HA 4IE7A 4ILUA 4L0RA 3NRXA 1FJGT 3ZT5A 4MXMA 3QUJA 3G56A 4ZI7E 2V57A 3ZYLA 3NBXX 2OPTA 4KI0F 2ZCNA 3LFMA 3V78A 4TWHA 1MIVA 3T8OA 4D5FA 3ZMSB 5AQMB 3UQ4A 4DV3T 4EYYR 4QXCB 2QTQA 2X51A 3AAIA 3H3MA 4U3CA 4KWAA 3FXEB 1MMDA 3BQYA 1ZV4X 4TWDA 3BTJA 4HFEA 4PAGA 2LJLA 2W53A 3ABVA 3PE0A 3HTJA 1JTXA 3LWJA 4AC0A 2CM0A 1UX4A 3ZQFA 5HEHA 5FY0A 4B3TT 2RP4A 3PU3A 2EHOD 3TLVA 4LFAT 3AA6B 3ON2A 2V6YA 3PJAA 2RHAA 2YEVC 1VRBA
chains in the Genus database with same CATH topology
1YW0A 2JRKA 4Z8XA 2B3WA 2G0UA 1D1AA 3B13A 3M65A 4AQGA 2E9XA 2V1DB 4EZHA 4AKLA 2ZMAA 2VB6A 5LOVE 3SOLA 5JDQA 3CMLA 3SRZA 1U4QA 4WBNE 4P0BA 2C5KT 5CA0E 3I0QA 3U78A 4AQFC 1D0YA 2H7VC 1WRDA 3KBTA 4OYJA 5LXTE 4PK6A 2IW5B 2CXDA 4C90A 1UCUA 1X79A 1MIWA 4OD4A 2BVMA 2KLQA 2LSGA 2L8KA 3EVYA 4HKAA 4UVCB 3MA9A 3ZMUB 2YINA 2KXPB 1MMAA 3I9WA 2BDEA 1MIYA 2V7JA 3H3AA 3NZQA 2L3LA 2HPJA 3K8PC 2XHEB 1H7CA 3EDUA 2Q9QC 4K0UA 2XASB 3O1IA 2N1GA 3RX6A 4L9IA 3FB2A 1BR4A 2QA7A 4X1KE 4ZI2C 2C5IT 2JMHA 3W15B 4KBMB 3UUMA 2CA5A 3KYLA 3Q5WA 3WI3A 3K3OA 2YU1A 4ZS2A 2NP9A 4ISSA 1YKEB 3AVSA 5HAXA 3ZYMA 3ZC0A 3VKHA 3K3NA 2K9AA 1D1CA 3C4ZA 2FJI1 5E0OA 3BQIA 3C64A 5HXEA 4OYKA 5L3FB 1HFAA 1T98A 3PTRB 5J2TE 4YFSA 4HTEA 5C8YE 3JC6C 3ZN0B 4G2AA 1HCIA 5FXXA 2EHOB 2ACXA 4IE6A 1AJ3A 1G73A 2CXLA 3ANWA 3I9YA 5IYZE 2A3DA 4G63A 5LJNA 3L3PA 4GOUA 3OKQA 1Y64B 3C4XA 4C2MA 2PJQA 4O4JE 2KINB 2RA1A 3MXZA 3UULA 5J1GA 3OYZA 3V5UA 3HA4A 1EZ3A 2E9XC 3Q9DA 3CQCB 4MHCA 3ONXA 2KT9A 4UEMA 5J2UE 2VL8A 3DP7A 2R7QA 2X9WA 1B7TA 4AKHA 1D0XA 4FJOA 4AQFA 2J1DG 3MACA 2LEHA 3O9XA 3Q5XA 4P09A 3K3QC 2Q9QD 4MLKA 3PDYA 1MNEA 2N2NA 3KINB 5JDHA 3AA1B 3IF8B 4TUYE 5KDMC 1WLXA 2ZM8A 3NS4A 1G8XA 3LK2B 4H63V 4CXYA 4BA9A 4YJ3E 2LHRA 3IHRA 2Q9QA 4QHOA 4QXHB 4DVYP 2DHRA 4DNDA 4JUYA 2NTYA 4H9OC 4ADZA 2D0UA 4NUUA 4ZOLE 4EZ4A 3CQGB 1YKHB 2IC6A 3KFWX 3PUSA 3J9X1 4GK5E 5IHYA 5JVDE 2I59A 2A72A 4X20E 4DBQA 3JC6D 5HWXA 2LSJA 5JRCB 3BQKA 3I0OA 3CX6B 4EOZB 3RC3A 1S94A 2WAUA 4ISTA 5FY1A 3RYFE 4JEUB 4O4IE 2YK0A 4QX8B 5LCYA 5JDLA 5FP3A 2E9XD 1NWMX 3VU7H 5TAOA 3RKOA 3KDSE 3RPUA 5KX5E 2R7TA 4AXPA 2DLRA 4A56A 4XZCA 4AKGA 2CMRA 5BMVE 2XAGB 4XAXB 3IBPA 3HKBE 3FHNA 2VK9A 2XAQB 3UT5E 3Q2MA 2Y8DA 1LRZA 4IDZA 5L3CB 3ZN1B 4MBQA 4UXNB 5HXSA 4WW0A 3BK9A 2IAKA 4QXBB 3ZMTB 2NW7A 5KMGP 3FBLA 4PFOA 3UUNA 3R84B 4PNIA 3KVAA 3N2OA 3FXDB 2W00A 4PJLA 2K48A 3F2EA 5F8PA 2WMNA 3IEEA 3NRYA 5H6RB 1IZNB 4U72A 2OA5A 2XAJB 3KV6A 2VKOA 4DMVA 4PW8A 4WBOA 4EYUA 2Q9QB 4UF0A 3DJBA 5FXVA 5L3GB 5CQGA 5CB4E 4O2AE 2X9HA 3AVRA 5JR9C 2C0SA 5L3BB 2GK9A 2VWAA 4TV9E 2UXNB 2W63A 4EXTA 2WBLA 1BR1A 2R7RA 2CEAA 2ZM0A 3E08A 4PK5A 5FYMA 4J2CA 3ZCJA 2LE8A 4DVDA 2MYSA 3HKCE 3N5LA 3N9PA 3P8CD 1FMWA 3UTKA 4E7ZA 3U3IA 4IE4A 1YD8G 3ZMVB 4O2BE 2R7SA 2L9QA 1UX5A 2P9BA 3ETUA 3RRCA 5LGTB 2CWYA 1FEWA 2JJ9A 4HEAA 5HXRA 1Z0PA 3ESLA 2IC9A 2BZBA 3O4XE 5LBQB 5LP6E 2H3RA 3FBZA 5LNKA 4AKIA 2A2FX 1HG5A 2BVLA 4IE5A 2V7IA 1NAFA 1OXZA 2CCQA 1WR6A 2KWIB 2DCFA 2UXXB 2WM9A 3B57A 5HYAA 2H7OA 4ASKA 3KVBA 2D0TA 2MBGA 4FI5A 3EDVA 2D5UA 3N9NA 4UELA 3CPZA 3N9MA 2JQQA 2E8IA 5FY7A 2E9XB 2KWHA 2ZLYA 1V9DA 2CXFA 2XAHB 2VASA 4B6XA 1HG2A 3VHLA 5H6QB 2R7XA 3PURA 2EHOC 5JREA 4P0AA 4I4TE 3LBXA 2ES0A 2K5BB 3TKLB 4DO0A 4CQIA 3PUQA 5EK3A 4OHFA 4OK0A 4TX5A 3ZLIA 4ZI2D 4UV8B 4ANJA 2KMFA 1O3XA 3DU5A 4UF0B 3ETVA 4O8SA 4ZI3C 2LOPA 4QWNB 5L2LA 5LHIB 2R7VA 5M4YA 1E1HB 4MALA 4TZ4C 5JR9A 3C98B 1MMGA 2XUEA 2Y6XA 5EZYE 5FMNA 2Y48B 1KNZA 2LM9A 3RYIE 4O4LE 3ZC1A 4H9QC 4ZHQE 3N9LA 1IAPA 4XBFB 4TN7B 3HL6A 4E7SA 4BJNA 4ERRA 1US7B 4UV9B 2V7KA 3CWZB 4HFVA 5AFUL 5F3JA 2VKHA 1HS7A 1ZKEA 3NZPA 4PJJA 2PFVA 1BR2A 2X9XA 4HN9A 4PK4A 3HR0A 3I1AA 3A5XA 2PG8A 4PJNA 1D1BA 2DWGA 3AAAB 2C5JA 3C50A 4GYRA 3ANWB 4GIWA 4I55E 5JDNA 3LJCA 1IJ5A 2CLYC 3QC9A 1IJ6A 5LA6E 3SS1A 4CZZB 4EAHA 4DMWA 4TV8E 3SWHA 3S4UA 3ZPOA 5LYJE 4HE8A 3UFEA 5ETWA 1HTJF 2X9YA 3KV9A 4PJMA 4C91A 2KZ7B 4CXWA 3N9QA 3AAEB 5LBMA 3KBUA 2JMKA 5DABA 5JQGE 2ODUA 3H37A 5ADXL 4WNKA 3ZCIA 2V7MA 2WMOA 1S35A 4YLHA 5DJQC 5JDFA 3HKEE 3V5SA 2EHOA 4YHJA 3GWHA 2QGSA 3MZKB 2MTQA 5HWYA 2DWKA 1SHZC 5GONE 3RYCE 2NWBA 2V7LA 3GMIA 2SPCA 5EK4A 5LGUB 4JEHB 4JLEA 4BJMA 3P7IA 1SA0E 1QSDA 2LOSA 3CQXC 3WAKA 5EK2A 4I43B 1QUUA 4UVAB 3AA7B 3F31A 4CI1B 5JR9B 3CX8B 3OJAA 2W61A 3O1JA 2MOZA 4H9PC 5JDGA 5FXZA 4KUMB 5CA1E 3C4WA 3ZJ1A 1FIOA 4QKNA 2HH7A 2LHNA 1LKXA 3L09A 3VKGA 3N9OA 4CXXA 5FXWA 3OBVE 2LSKA 2CWOA 2VKJA 3F57A 4AKRB 4EB6E 5LHHB 4AI6A 2ZM2A 4GK0E 4IRVA 4IHJE 3LK3B 4IE0A 3HI2A 5DQVA 2YU2A 1KK7A 4IGUA 4KP3C 3QK6A 2CE7A 2X66A 3CKDA 5L3DB 3ZMZB 3J7Yq 4UVBB 1VOMA 1HF8A 2DI4A 3ZJ2A 4PFPA 2NW9A 2HPLA 2LSYA 2Z6EA 2X0LB 3E0ZA 5L3EB 5JRCA 3RH3A 3KV5A 2X67A 4NUVA 3OYXA 4KMCA 3LG7A 4OD5A 3PU8A 3UUXB 2D2SA 1LVKA 3D0TA 2NOXA 3AB3B 4I50E 3VTIA 3GN5A 3R6NA 3C51A 3CX7B 3DTOA 4HGAA 2NW8A 4MFRA 4O4HE 5JH7E 4CI2B 3N2GE 1CUNA 1ZHCA 4ZS3A 4IIJE 2B1EA 3O1HA 3MKDA 1HX8A 1OWAA 2XTLA 4U74A 3ZEFB 2N9DA 4IE7A 4V1Av 4EIWA 4ILUA 4L0RA 3NRXA 3QUJA 3RYHE 4DBRA 2VKDA 2V26A 4QX7B 5JDMA 4UIGA 4ZI7E 3ZYLA 4F6RC 3NBXX 3MK7C 1D0ZA 4CI3B 4BAYB 3E22E 3LFMA 1ZEEA 1U5PA 2JPFA 1MMNA 4N78D 5LHGB 1MIVA 5FNVE 3T8OA 4X1YE 3ZMSB 2DNXA 2W0GA 2R7UA 4QXCB 2WSSV 3AAIA 2LSIA 2X51A 4H63H 4EYYR 3FXEB 5LJMA 1MMDA 3RRWA 2PBIA 3AA0B 4H9RC 5HXHA 1ZV4X 4L5GA 3WAJA 2M67A 2NTXA 3BQLA 1LVFA 2LJLA 4PAGA 1WYBA 3PUGA 3EUHA 2CLYB 5HXCA 3PE0A 5A1LA 4YJ2E 2ODVA 2CM0A 1UX4A 3N2KE 5FY0A 4GYSA 2K24A 2RP4A 2LT3A 1BR0A 3PU3A 2X68A 2XAFB 2EHOD 4H9NC 5DQWA 2R7WA 3GA8A 3DU6A 3PUAA 5LG4A 3AA6B 2XQYA 2R7OA 3GN5B 3HKDE 4X1IE 2WWUA 3KV4A 3CVRA 3ZYKA 2W62A 5LGNB 1MNDA 1WYCA 3LBXB 4H9SE 4M1PA 4OFZA 4ZI3D 2YEVC 1FMVA 2KNDA 1VRBA 3RC8A 3MJXA 3LK42
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FJI 1;  3SWH A; 
#chains in the Genus database with same CATH topology
 2JRK A;  3BR3 A;  1M7K A;  3HGG A;  3AED A;  1W0A A;  3RGL A;  5JDQ A;  4WBN E;  4YSX A;  3I0Q A;  4AQF C;  1JNR A;  2XQA A;  4C90 A;  1UI6 A;  1MIW A;  2JQ9 A;  2ACZ A;  3EVY A;  1J5W A;  3BR6 A;  2CBJ A;  1NEN A;  1MMA A;  2XGE A;  3I9W A;  3NZQ A;  2LKG A;  2HPJ A;  3AE1 A;  3AXJ B;  5IOY A;  5GPA A;  3VVX A;  2ZM6 T;  1NEK A;  3LSJ A;  2WCA A;  2QA7 A;  4ZI2 C;  3JAD A;  2JMH A;  3K3O A;  2NP9 A;  3PM1 A;  4ISS A;  1YKE B;  5J1U A;  3ZSS A;  5HXE A;  3BTI A;  4LF5 T;  1BJZ A;  1T98 A;  3PTR B;  4Z91 A;  3JC6 C;  3ZN0 B;  3KKC A;  5J0Z A;  4IE6 A;  1AJ3 A;  1G73 A;  5FL1 A;  5IYZ E;  4YTP A;  2A3D A;  4G63 A;  5LJN A;  3OKQ A;  4JI7 T;  4G12 A;  3MXZ A;  3AQT A;  2NS7 A;  2D6Y A;  3DEW A;  3Q9D A;  4MHC A;  5EZH A;  3ZQH A;  2XQ3 A;  5J2U E;  5LMN T;  2X9W A;  3AE3 A;  4YY3 T;  4AQF A;  3G1L A;  3Q5X A;  4P09 A;  2R6G F;  2Y31 A;  2Q9Q D;  4MLK A;  5CGM A;  3Q0U A;  5HBU A;  2N2N A;  3PUW F;  5ABF B;  5KDM C;  2BG9 B;  2ZM8 A;  4ME9 A;  4QHO A;  4DVY P;  2DHR A;  4DND A;  3VW2 A;  3FZM B;  3O8H A;  4NUU A;  3VP5 A;  2WV1 A;  2YVE A;  4X20 E;  2QRX A;  5HEO A;  2XPU A;  4JEU B;  4O4I E;  4QX8 B;  5JDL A;  4D7N A;  2VL0 A;  3KDS E;  2XSB A;  3VRB A;  2DLR A;  5J1R A;  1DU2 A;  2CMR A;  2XPV A;  4X66 T;  2IU5 A;  2XAQ B;  4JYA T;  5HCJ A;  4JI2 T;  2XY8 B;  4UXN B;  3BCG A;  5KMG P;  3ON4 A;  4LF7 T;  2W00 A;  2WMN A;  4IDN A;  4V2G A;  2OA5 A;  1JTY A;  3AQS A;  3QOF A;  2VKO A;  4GFL A;  4EYU A;  4JKZ A;  4WIB A;  3M3Z B;  5FXV A;  2YDR A;  4WZX A;  1JT0 A;  2H88 A;  5JR9 C;  2Y30 A;  1E7P A;  5CXI A;  4M3D A;  3ZKR A;  2MYS A;  3V6G A;  2YVH A;  4O2B E;  4Z90 A;  3EI0 A;  3ETU A;  1UX5 A;  3AE5 A;  3RRC A;  4IDO A;  5FKO A;  5HXR A;  3ESL A;  2TRT A;  3O4X E;  5LBQ B;  2ZCX A;  5HAW A;  5LNK A;  4AKI A;  4IE5 A;  3EUP A;  3VVZ A;  2JQK A;  1OXZ A;  2KWI B;  2WM9 A;  3B57 A;  2LRL A;  2H7O A;  3VIB A;  3KVB A;  2MBG A;  3HTA A;  4FI5 A;  3EDV A;  2E9X B;  3VR8 A;  3QNU A;  4HWI B;  1J1J A;  2QCO A;  3TP0 A;  1WR0 A;  2VAS A;  4JI3 T;  3VHL A;  5IPA A;  2IIU A;  5AQI B;  4OHF A;  2AXD S;  3ZLI A;  4ZI2 D;  3T1H T;  3ETV A;  4ZI3 C;  2LOP A;  4MAL A;  3QB5 A;  5JR9 A;  3WHB A;  2XUE A;  2LM9 A;  5ABE A;  3N9L A;  4JYK A;  2IHR 1;  3A8Y C;  2CHO A;  1US7 B;  3G1M A;  4HFV A;  1R8I A;  3AXJ A;  2HN2 A;  2GEN A;  2X9X A;  2XJ7 A;  2WZH A;  4LFB T;  3HR0 A;  2PG8 A;  4GYR A;  4GIW A;  4I55 E;  4ZZB A;  5HEG A;  1IJ6 A;  4CZZ B;  4TV8 E;  3SWH A;  2UUA T;  3UFE A;  2NX4 A;  3PJA J;  5JQG E;  4ILC A;  3H37 A;  5ADX L;  1UGO A;  5IWA T;  1S35 A;  4YLH A;  2IEK A;  5DJQ C;  4YHJ A;  3MZK B;  2UUC T;  4D7M A;  2ZB9 A;  3RYC E;  2VUR A;  5EK4 A;  5HEJ A;  3P7I A;  5F27 A;  5EK2 A;  4I43 B;  4UVA B;  3F31 A;  3CX8 B;  2MOZ A;  4H9P C;  2ID6 A;  3BQZ A;  5CA1 E;  3C4W A;  5CW8 A;  4JI1 T;  4K0K T;  2HH7 A;  3K1S A;  3VKG A;  5ABF A;  2BG9 A;  3T6N A;  2CWO A;  4AKR B;  4B3M T;  2CBI A;  2ZM2 A;  4GK0 E;  4CN4 A;  1I6Z A;  3LK3 B;  4LF8 T;  1L0V A;  1KK7 A;  3P9T A;  3QK6 A;  1QPI A;  2CE7 A;  3HTI A;  4PFP A;  1RPW A;  2D9D A;  4KHP T;  5K7F A;  3FZH B;  3LG7 A;  4AUX A;  3RIA A;  4JNN A;  2YDS A;  4I50 E;  4GCT A;  5C3J A;  3DTO A;  4MFR A;  4CI2 B;  4ZS3 A;  1ZHC A;  4IIJ E;  2UXP A;  3ZEF B;  1OWA A;  4EIW A;  5KXJ A;  2QYW A;  3RYH E;  4DBR A;  2VKD A;  2V26 A;  5JDM A;  4UIG A;  5LB7 B;  4CI3 B;  4P1N A;  4B3R T;  1XMO T;  3UU3 A;  2JPF A;  4HFD A;  4EGW A;  3QPS A;  4X1Y E;  5AQH B;  3ANP A;  5F0C A;  5LJM A;  3RRW A;  3AA0 B;  4H9R C;  3JAE A;  3FRQ A;  4L5G A;  3WAJ A;  2NTX A;  3BQL A;  4MK6 A;  3GZI A;  3PUG A;  3EUH A;  3OVU A;  3O60 A;  5A1L A;  2ODV A;  4DV1 T;  2X6O A;  4GYS A;  1VCS A;  1N33 T;  3CWR A;  2XQY A;  2FUP A;  2BKN A;  3VW1 A;  3AE2 A;  2WWU A;  3KV4 A;  3CVR A;  2UXD T;  3ZYK A;  2W62 A;  3P4Q A;  5LGN B;  4ZI3 D;  2O7T A;  5JRE A;  3MJX A;  3B6A A;  3CDL A;  1YW0 A;  2I6H A;  4YSZ A;  2G0U A;  3B13 A;  3M65 A;  4AQG A;  4HWC A;  2E9X A;  4YXD A;  2V1D B;  4GCL A;  4AKL A;  2ZMA A;  2M6I A;  1U4Q A;  4IRE A;  2HHH T;  1UI5 A;  1D0Y A;  2H7V C;  1WRD A;  2H89 A;  2CXD A;  1UCU A;  4V2F A;  1X79 A;  4HWD A;  2ID3 A;  2LSG A;  3MA9 A;  3ZMU B;  5LG3 A;  5LMU T;  2KXP B;  2V7J A;  1T7S A;  3K8P C;  3EDU A;  2Q9Q C;  3O1I A;  2WWV A;  3RX6 A;  4L9I A;  1HR0 T;  1BR4 A;  3W15 B;  4GKJ T;  3UUM A;  2XQ5 A;  4A98 A;  2CA5 A;  2CPT A;  2YU1 A;  4ZS2 A;  2VVN A;  5HAX A;  3VKH A;  4JV5 T;  3BQI A;  2KSR A;  4OYK A;  4X62 T;  4HFI A;  3AE7 A;  5FXX A;  3ONJ A;  4EV6 A;  2VVS A;  2ACX A;  2XQ6 A;  2PZ9 A;  2CXL A;  5ABG A;  1VCT A;  1JUM A;  4LMJ A;  3L3P A;  4U7I A;  1Y64 B;  4C2M A;  2RA1 A;  3PUV F;  1EZ3 A;  3P4W A;  5AQQ B;  2FX0 A;  3L8R A;  3HE0 A;  2VL8 A;  2WGB A;  1HX1 B;  3BR1 A;  3AEA A;  2HYT A;  1T33 A;  1IBK T;  1W0B A;  2QOP A;  2WP9 A;  3G06 A;  1T56 A;  1WLX A;  1G8X A;  2NP5 A;  4BA9 A;  4YJ3 E;  2LHR A;  2Q9Q A;  4QXH B;  2AE9 A;  5FGL A;  3RIF A;  3RI5 A;  3EAM A;  4I0U A;  3BTC A;  4H9O C;  4ADZ A;  2D0U A;  4ZOL E;  3KFW X;  3PUS A;  3J9X 1;  4I6Z A;  4IDP A;  1ZK8 A;  5GP9 A;  2LSJ A;  4JBW F;  4AC6 A;  4M3B A;  3CX6 B;  4IST A;  3EHZ A;  2YK0 A;  3HIM A;  4DR1 T;  3ANG A;  4W97 A;  2E9X D;  2FJD A;  3RPU A;  4AXP A;  4A56 A;  1JT6 A;  1X9B A;  3UU4 A;  3HKB E;  1OED E;  3L39 A;  2RAS A;  3FHN A;  3UT5 E;  3Q2M A;  2Y8D A;  1LRZ A;  5HXS A;  4DV2 T;  2FD5 A;  1RKT A;  3UUN A;  4GFK A;  3KVA A;  4L62 A;  1YXR A;  3CK6 A;  2XAJ B;  3QQA A;  3KV6 A;  3ONL C;  4UF0 A;  2QVA A;  3DJB A;  5L3G B;  5CQG A;  3CIR A;  2PTF A;  3AVR A;  2C0S A;  5L3B B;  4M3F A;  3ZCJ A;  2ZM0 A;  4PK5 A;  2W2U A;  4E7Z A;  3N5L A;  3HKC E;  3P8C D;  2Q24 A;  4ILB A;  3UTK A;  1HNW T;  3ZMV B;  2P9B A;  1XDO A;  2X0H A;  5LP6 E;  2UXU A;  2A2F X;  4NXM T;  3Q3S A;  5AQV B;  4JI0 T;  3ZQG A;  2D0T A;  2D5U A;  3N9N A;  3IH4 A;  3CPZ A;  1Z0X A;  2KWH A;  3LOC A;  3QB5 K;  3LDQ B;  3Q0W A;  1QLB A;  2WU5 A;  2CXF A;  4YZE A;  2JK3 A;  4HFC A;  3VUQ A;  3ZT7 A;  4X64 T;  4COF A;  1ZP0 A;  4I4T E;  3Q0V A;  3DCF A;  4GKK T;  4LMK A;  2K5B B;  2HXI A;  3PUQ A;  4TX5 A;  2KMF A;  2JJ7 A;  4IL9 A;  2PBX A;  3DU5 A;  4NIQ A;  5L2L A;  2XGC A;  2R7V A;  5L4H A;  5LHI B;  4KHZ F;  1MMG A;  2WUI A;  4AIS A;  2Y48 B;  4H9Q C;  1IAP A;  3TLW A;  4TN7 B;  2FJA A;  5EFY A;  2OI8 A;  4YSY A;  1HS7 A;  2YKS A;  2PFV A;  2FJE A;  5BR8 T;  4HN9 A;  3I1A A;  4PJN A;  2DWG A;  5AQG B;  2C5J A;  1IJ5 A;  2VKE A;  2V8S V;  4EAH A;  4DMW A;  3ZPO A;  5LYJ E;  4HE8 A;  1HTJ F;  3MNL A;  3KV9 A;  4PJM A;  2KZ7 B;  4CXW A;  3AAE B;  2JMK A;  2G3B A;  4U33 A;  3ZCI A;  3HGY A;  2DG8 A;  1Z77 A;  5JDF A;  3HKE E;  3V5S A;  1ORK A;  2QGS A;  3GWH A;  4YTM A;  5HWY A;  2XQ8 A;  4M3E A;  4YT0 A;  1SHZ C;  5AQU B;  2RPA A;  3AEF A;  2J47 A;  5LGU B;  1SA0 E;  2YDQ A;  1QSD A;  3UUB A;  3WAK A;  1QUU A;  3AA7 B;  2M6B A;  2FBQ A;  5JDG A;  4KUM B;  3ZJ1 A;  4QKN A;  3ZT6 A;  1LKX A;  4DV0 T;  2NS8 A;  3N9O A;  5FXW A;  4ZZC A;  2VKJ A;  4EB6 E;  4A5X A;  4IRV A;  4IHJ E;  4IE0 A;  1JUP A;  5AQL B;  2WDR A;  4TWF A;  5JTG A;  4UVB B;  1HF8 A;  3ZJ2 A;  3CJD A;  2Z6E A;  2X0L B;  4DV6 T;  2X67 A;  3G7R A;  3VW0 A;  5F0F A;  3TP3 A;  3PU8 A;  3D0T A;  3NXC A;  3AB3 B;  5J3L A;  4PXI A;  3R6N A;  3C51 A;  4O4H E;  2E5V A;  3BR5 A;  4LF6 T;  5CJ5 A;  2V6X A;  2B1E A;  3MKD A;  1HX8 A;  2XTL A;  2N9D A;  2K3W A;  4V1A v;  4NPP A;  1M62 A;  2CRB A;  2REK A;  4EEB A;  3NPI A;  5EZG A;  4QX7 B;  2GUH A;  4F6R C;  3MK7 C;  3O8G A;  1D0Z A;  1HNZ T;  4BAY B;  1OED B;  1ZEE A;  1U5P A;  1MMN A;  2WY2 A;  2IML A;  4HKU A;  5LHG B;  5FNV E;  2UXB T;  4DR6 T;  1Y01 A;  2DNX A;  2BG9 C;  2R7U A;  3IH2 A;  4H63 H;  4Q25 A;  2PBI A;  2X9D A;  3B5M A;  4JI8 T;  1WYB A;  3B6C A;  2CLY B;  3KKD A;  5HXC A;  4YJ2 E;  2BKP A;  2JQH A;  2LT3 A;  4H9N C;  5DQW A;  2R7W A;  3GA8 A;  3DU6 A;  2HN1 A;  3PUA A;  2R7O A;  3GN5 B;  2WDQ A;  2LRK A;  3HKD E;  2XM1 A;  2BKO A;  4X1I E;  2HXO A;  3BR0 A;  5FKY A;  4IL4 A;  1MND A;  1WYC A;  3LBX B;  4H9S E;  4M1P A;  4OFZ A;  2WDV A;  3RC8 A;  3RIU A;  2XB5 A;  5L47 A;  2B3W A;  5HEU A;  1D1A A;  5IUX A;  1QVT A;  3Q5D A;  3NRG A;  3VPR A;  2VB6 A;  3FZL B;  3BRU A;  3SOL A;  3SRZ A;  2GBY A;  5D19 A;  2C5K T;  5CA0 E;  5FL0 A;  2LLY A;  4TNW A;  4AF5 A;  4JI5 T;  4DR4 T;  2UXH A;  4OD4 A;  2E5L T;  3CRJ A;  1MIY A;  2IDO B;  2L3L A;  3PUX F;  2YOE A;  1H7C A;  4K0U A;  2XAS B;  2FQ4 A;  3UU8 A;  2N1G A;  3RH2 A;  3FB2 A;  2J4G A;  1WCR A;  2C5I T;  2F07 A;  2W66 A;  5F5W A;  3ZYM A;  3ZC0 A;  3K3N A;  2K9A A;  3C4Z A;  2XQ9 A;  2OER A;  2XPW A;  1HFA A;  2ZCM A;  1KF6 A;  4IT4 A;  4YFS A;  3I9Y A;  3AEB A;  4GOU A;  3C4X A;  4O4J E;  3UUL A;  3OYZ A;  3V5U A;  2E9X C;  4LF9 T;  3KZ9 A;  3NNR A;  3CQC B;  3ONX A;  2MAW A;  2R7Q A;  1B7T A;  1D0X A;  2J1D G;  2VKV A;  3MAC A;  2LEH A;  2VQE T;  3ZQL A;  3K3Q C;  4X65 T;  3VR9 A;  1MNE A;  3KIN B;  5JDH A;  3AA1 B;  3NS4 A;  4H63 V;  4CXY A;  1VI0 A;  1SUM B;  3SFD A;  4DV5 T;  4JUY A;  1OED C;  4EZ4 A;  1W09 A;  2IC6 A;  4DUZ T;  5IHY A;  2A72 A;  3BTL A;  5HWX A;  3TLS A;  4ILA A;  2DL1 A;  5FKK A;  4LML A;  3RC3 A;  4EOZ B;  2FBW A;  2V5D A;  1ZOY A;  2UXO A;  5LCY A;  5FP3 A;  1NWM X;  3VU7 H;  3RKO A;  3JAF A;  5KX5 E;  4XZC A;  5BMV E;  2XAG B;  1JUS A;  4DW6 A;  5L3C B;  3BK9 A;  4QXB B;  3ZMT B;  2TCT A;  4DV4 T;  3ZST A;  2K48 A;  2OF7 A;  3F2E A;  5F8P A;  1Z8U A;  4U72 A;  4WBO A;  1N34 T;  3VRA A;  3BT9 A;  2BBJ A;  3UQ7 A;  5CB4 E;  1A6I A;  2X9H A;  2Y2Z A;  2GK9 A;  1OED A;  2VWA A;  4TV9 E;  4EXT A;  4HWH A;  4X1E A;  2R7R A;  3E08 A;  4J2C A;  2LE8 A;  1ZKG A;  3LSR A;  4IE4 A;  1YD8 G;  2WB5 A;  2R7S A;  4ACI A;  5LGT B;  1FEW A;  5D1R A;  2JJ9 A;  4LF4 T;  5AQN B;  1Z0P A;  1HG5 A;  2BVL A;  2LKH A;  2DCF A;  2UXX B;  5HYA A;  4ASK A;  3GEU A;  4B3S T;  2XGD A;  5K7H A;  5D18 A;  3N9M A;  5DAJ A;  1KFY A;  3VVY A;  1V9D A;  4DV7 T;  2XAH B;  1HG2 A;  5H6Q B;  2F4V T;  3P4P A;  4QH1 A;  3QKX A;  3UU5 A;  4UR9 A;  4P0A A;  3LBX A;  3CCY A;  3TKL B;  2QKO A;  4CQI A;  4OK0 A;  4UV8 B;  2J62 A;  1O3X A;  1T72 A;  2Y6X A;  1IBL T;  1KNZ A;  5F08 A;  4ZHQ E;  4XBF B;  4DUY T;  3HL6 A;  1XZY A;  4ERR A;  3RD3 A;  4UV9 B;  2V7K A;  3CWZ B;  2GFN A;  5AFU L;  5F3J A;  2VKH A;  1ZKE A;  1BR2 A;  5CXG A;  3NVO A;  4PK4 A;  3A5X A;  4MO7 A;  3P50 A;  2WS3 A;  3ANW B;  1UK5 A;  3LJC A;  3QC9 A;  5LA6 E;  3SS1 A;  5ABH A;  3BHQ A;  3WHC A;  3UFG A;  4C91 A;  3C07 A;  5ETW A;  3N9Q A;  4JL3 A;  5DAB A;  5AQF B;  3JSJ A;  3PAS A;  4WNK A;  2V7M A;  2WMO A;  2QIB A;  4GCK A;  3BNI A;  3SDG A;  3NWI A;  2MTQ A;  2NWB A;  3GMI A;  2SPC A;  4JEH B;  4JLE A;  3IA3 A;  1UUS A;  2W4X A;  3VOX A;  2LOS A;  4CN1 A;  3FK7 A;  3EAB A;  1XNQ T;  1KNR A;  2YN6 A;  5JR9 B;  2XRL A;  3OJA A;  3O1J A;  3AEE A;  2G0E A;  5FXZ A;  2JIW A;  5J1Y A;  1FIO A;  4HFH A;  4CXX A;  2BS2 A;  3F57 A;  5LHH B;  4U7Y A;  4AI6 A;  5EYR A;  3AEC A;  4ICH A;  5DQV A;  3LSP A;  2YU2 A;  4TNV A;  2X66 A;  5L3D B;  3J7Y q;  2DI4 A;  2NW9 A;  2HPL A;  2LSY A;  3B81 A;  1XDP A;  2UU9 T;  4KMC A;  4OD5 A;  3UUX B;  2D2S A;  1SE7 A;  2NOX A;  3AE6 A;  3CX7 B;  2NW8 A;  2HQ5 A;  3FZF B;  4D5C A;  5JH7 E;  2W67 A;  2CHN A;  4U74 A;  1UUR A;  4WYV A;  2XM2 A;  4OX9 T;  4U9L A;  1RKW A;  3BJB A;  2O7O A;  2HKU A;  3E22 E;  4CGR A;  2UXI A;  5FVK A;  3UU6 A;  4N78 D;  2W0G A;  3BR2 A;  1KNP A;  2WSS V;  2LSI A;  2WU2 A;  2G7L A;  5HXH A;  5AQO B;  2M67 A;  1LVF A;  3TLU A;  4U9N A;  1KEY A;  3QBM A;  1SGM A;  3N2K E;  3T1Y T;  3AEG A;  3P4R A;  2K24 A;  1BR0 A;  2X68 A;  2XAF B;  3SFE A;  4AQY T;  1I94 T;  3NI7 A;  5LG4 A;  2XPK A;  2B76 A;  1FMV A;  2KND A;  3LK4 2;  4Z8X A;  4F8H A;  3PUZ F;  4HFB A;  2OV9 A;  4EZH A;  3OPC A;  2XSA A;  2VPR A;  5LOV E;  3CML A;  4P0B A;  5F04 A;  3U78 A;  3KBT A;  5FKM A;  4OYJ A;  1W9R A;  5LXT E;  4PK6 A;  3RKG A;  2IW5 B;  3ZQI A;  4AIU A;  2BVM A;  2KLQ A;  4HKA A;  2L8K A;  4UVC B;  2YIN A;  4I76 A;  4NN1 A;  2BDE A;  3H3A A;  3RF1 A;  2XHE B;  5FVL A;  4X1K E;  3NKZ A;  4KBM B;  3A7M A;  3KYL A;  3Q5W A;  3KNW A;  3WI3 A;  2LM2 A;  3AVS A;  1D1C A;  2WZI A;  4LFC T;  2FJI 1;  5E0O A;  3C64 A;  2G7G A;  5L3F B;  2XDN A;  5J2T E;  4HTE A;  5C8Y E;  5CFB A;  4G2A A;  1HCI A;  3S5R A;  4U2Z A;  2EHO B;  3ANW A;  3P4S A;  4W1U A;  3JCF A;  3RIU C;  2PJQ A;  2DG7 A;  2KIN B;  5H9T A;  5J1G A;  3HA4 A;  5AQP B;  3LHQ A;  2VQF T;  4DR2 T;  5AQS B;  3AE8 A;  1N36 T;  5IOZ A;  1T8B A;  3FZK B;  2KT9 A;  4UEM A;  5AQJ B;  2V5C A;  3DP7 A;  4AKH A;  2DTZ A;  3F0C A;  1U9N A;  4FJO A;  2BS3 A;  3O9X A;  2IUB A;  3PDY A;  3IF8 B;  4TUY E;  5IP6 A;  4YTN A;  3LK2 B;  3HTH A;  2XZE A;  2IAI A;  3IHR A;  3IH3 A;  4B3A A;  2I10 A;  2NTY A;  5FMP A;  3QPL A;  3CQG B;  1YKH B;  5FKL A;  4GK5 E;  5JVD E;  1JNZ A;  2I59 A;  4B1R A;  3RLF F;  4DBQ A;  3JC6 D;  5JRC B;  1XNR T;  3BQK A;  3I0O A;  2WQY A;  1S94 A;  2WAU A;  5FY1 A;  3RYF E;  4ABZ A;  2BS4 A;  1XWM A;  5K7Z A;  2ZY9 A;  5TAO A;  2R7T A;  2NR4 A;  4AKG A;  3G1O A;  2EH3 A;  4XAX B;  3IBP A;  3RQW A;  2VK9 A;  4IDZ A;  3ZN1 B;  4MBQ A;  4X5T A;  4WW0 A;  2IAK A;  3Q5E A;  2NW7 A;  3FBL A;  4PFO A;  5FKN A;  4PNI A;  3R84 B;  3N2O A;  3FXD B;  4PJL A;  2I0M A;  1J5E T;  3IEE A;  3NRY A;  5H6R B;  1IZN B;  4DMV A;  4M3G A;  4PW8 A;  5L4E A;  2Q9Q B;  2MPK A;  4O2A E;  5C2T A;  3OTO T;  2UXN B;  2W63 A;  2WBL A;  1BR1 A;  5FYM A;  2CEA A;  2UXC T;  1YQ4 A;  4DVD A;  3N9P A;  3EGQ A;  1FMW A;  2A9U A;  3U3I A;  2L9Q A;  2CWY A;  4HEA A;  2IC9 A;  2BZB A;  1CHU A;  2H3R A;  3FBZ A;  2V6Y B;  2V7I A;  1NAF A;  2CCQ A;  4DR3 T;  1WR6 A;  2IBD A;  1N32 T;  4EED A;  2ZOY A;  4UEL A;  2G7S A;  2JQQ A;  2E8I A;  5FY7 A;  4NEL A;  2ZLY A;  2XQ7 A;  4JI6 T;  5HCM A;  4B6X A;  4CN6 A;  5AQC A;  2R7X A;  3PUR A;  4QH5 A;  1IBM T;  2EHO C;  4U31 A;  2XQ4 A;  3FIW A;  2ES0 A;  1GQE A;  4DO0 A;  3TLT A;  5EK3 A;  4ANJ A;  2NP3 A;  1YQ3 A;  4NXN T;  4UF0 B;  4O8S A;  1WFD A;  4KX6 A;  4QWN B;  1QVU A;  5M4Y A;  1E1H B;  4TZ4 C;  3C98 B;  5EZY E;  5FMN A;  2OLT A;  3RYI E;  4O4L E;  2X0Y A;  4U2Y A;  3ZC1 A;  4DID B;  4XK4 A;  3F1B A;  4A97 A;  4E7S A;  4BJN A;  3PPB A;  2E2A A;  2BBH A;  2FJB A;  1HNX T;  3NZP A;  4PJJ A;  3IUV A;  3PV0 F;  1D1B A;  3AAA B;  3C50 A;  4YHH T;  5AQR B;  1XMQ T;  5JDN A;  2CLY C;  2QWT A;  2YVX A;  3SFI A;  3S4U A;  2X9Y A;  5LBM A;  3KBU A;  2ODU A;  4ZXL A;  3DPJ A;  4QH4 A;  2BG9 E;  2EHO A;  3AE9 A;  5HSZ A;  1U9O A;  2DWK A;  4IDQ A;  5GON E;  2V7L A;  4ZEY A;  1E2A A;  3LSV A;  3AE4 A;  3X1D A;  4BJM A;  3CQX C;  3PUY F;  2FJ1 A;  2ZOZ A;  5K58 A;  3COL A;  4CI1 B;  3FK6 A;  5AQK B;  2W61 A;  3RQU A;  2UUB T;  5C4Y A;  5F1J A;  4UDS A;  2LHN A;  4HWF A;  3L09 A;  3VOK A;  3C2B A;  3OBV E;  2LSK A;  2HYJ A;  3HI2 A;  3LJL A;  3E7Q A;  4IGU A;  4KP3 C;  2RAE A;  3CKD A;  3RHW A;  3ZMZ B;  5AQT B;  1VOM A;  4DR5 T;  3E0Z A;  5L3E B;  5JRC A;  3RH3 A;  3MVP A;  5GPC A;  3KV5 A;  4NUV A;  3OYX A;  5FHP A;  1LVK A;  5F0H A;  3VTI A;  3GN5 A;  4HGA A;  4JI4 T;  3N2G E;  1CUN A;  4DR7 T;  3O1H A;  4IE7 A;  4ILU A;  4L0R A;  3NRX A;  1FJG T;  3ZT5 A;  4MXM A;  3QUJ A;  3G56 A;  4ZI7 E;  2V57 A;  3ZYL A;  3NBX X;  2OPT A;  4KI0 F;  2ZCN A;  3LFM A;  3V78 A;  4TWH A;  1MIV A;  3T8O A;  4D5F A;  3ZMS B;  5AQM B;  3UQ4 A;  4DV3 T;  4EYY R;  4QXC B;  2QTQ A;  2X51 A;  3AAI A;  3H3M A;  4U3C A;  4KWA A;  3FXE B;  1MMD A;  3BQY A;  1ZV4 X;  4TWD A;  3BTJ A;  4HFE A;  4PAG A;  2LJL A;  2W53 A;  3ABV A;  3PE0 A;  3HTJ A;  1JTX A;  3LWJ A;  4AC0 A;  2CM0 A;  1UX4 A;  3ZQF A;  5HEH A;  5FY0 A;  4B3T T;  2RP4 A;  3PU3 A;  2EHO D;  3TLV A;  4LFA T;  3AA6 B;  3ON2 A;  2V6Y A;  3PJA A;  2RHA A;  2YEV C;  1VRB A; 
#chains in the Genus database with same CATH homology
 1YW0 A;  2JRK A;  4Z8X A;  2B3W A;  2G0U A;  1D1A A;  3B13 A;  3M65 A;  4AQG A;  2E9X A;  2V1D B;  4EZH A;  4AKL A;  2ZMA A;  2VB6 A;  5LOV E;  3SOL A;  5JDQ A;  3CML A;  3SRZ A;  1U4Q A;  4WBN E;  4P0B A;  2C5K T;  5CA0 E;  3I0Q A;  3U78 A;  4AQF C;  1D0Y A;  2H7V C;  1WRD A;  3KBT A;  4OYJ A;  5LXT E;  4PK6 A;  2IW5 B;  2CXD A;  4C90 A;  1UCU A;  1X79 A;  1MIW A;  4OD4 A;  2BVM A;  2KLQ A;  2LSG A;  2L8K A;  3EVY A;  4HKA A;  4UVC B;  3MA9 A;  3ZMU B;  2YIN A;  2KXP B;  1MMA A;  3I9W A;  2BDE A;  1MIY A;  2V7J A;  3H3A A;  3NZQ A;  2L3L A;  2HPJ A;  3K8P C;  2XHE B;  1H7C A;  3EDU A;  2Q9Q C;  4K0U A;  2XAS B;  3O1I A;  2N1G A;  3RX6 A;  4L9I A;  3FB2 A;  1BR4 A;  2QA7 A;  4X1K E;  4ZI2 C;  2C5I T;  2JMH A;  3W15 B;  4KBM B;  3UUM A;  2CA5 A;  3KYL A;  3Q5W A;  3WI3 A;  3K3O A;  2YU1 A;  4ZS2 A;  2NP9 A;  4ISS A;  1YKE B;  3AVS A;  5HAX A;  3ZYM A;  3ZC0 A;  3VKH A;  3K3N A;  2K9A A;  1D1C A;  3C4Z A;  2FJI 1;  5E0O A;  3BQI A;  3C64 A;  5HXE A;  4OYK A;  5L3F B;  1HFA A;  1T98 A;  3PTR B;  5J2T E;  4YFS A;  4HTE A;  5C8Y E;  3JC6 C;  3ZN0 B;  4G2A A;  1HCI A;  5FXX A;  2EHO B;  2ACX A;  4IE6 A;  1AJ3 A;  1G73 A;  2CXL A;  3ANW A;  3I9Y A;  5IYZ E;  2A3D A;  4G63 A;  5LJN A;  3L3P A;  4GOU A;  3OKQ A;  1Y64 B;  3C4X A;  4C2M A;  2PJQ A;  4O4J E;  2KIN B;  2RA1 A;  3MXZ A;  3UUL A;  5J1G A;  3OYZ A;  3V5U A;  3HA4 A;  1EZ3 A;  2E9X C;  3Q9D A;  3CQC B;  4MHC A;  3ONX A;  2KT9 A;  4UEM A;  5J2U E;  2VL8 A;  3DP7 A;  2R7Q A;  2X9W A;  1B7T A;  4AKH A;  1D0X A;  4FJO A;  4AQF A;  2J1D G;  3MAC A;  2LEH A;  3O9X A;  3Q5X A;  4P09 A;  3K3Q C;  2Q9Q D;  4MLK A;  3PDY A;  1MNE A;  2N2N A;  3KIN B;  5JDH A;  3AA1 B;  3IF8 B;  4TUY E;  5KDM C;  1WLX A;  2ZM8 A;  3NS4 A;  1G8X A;  3LK2 B;  4H63 V;  4CXY A;  4BA9 A;  4YJ3 E;  2LHR A;  3IHR A;  2Q9Q A;  4QHO A;  4QXH B;  4DVY P;  2DHR A;  4DND A;  4JUY A;  2NTY A;  4H9O C;  4ADZ A;  2D0U A;  4NUU A;  4ZOL E;  4EZ4 A;  3CQG B;  1YKH B;  2IC6 A;  3KFW X;  3PUS A;  3J9X 1;  4GK5 E;  5IHY A;  5JVD E;  2I59 A;  2A72 A;  4X20 E;  4DBQ A;  3JC6 D;  5HWX A;  2LSJ A;  5JRC B;  3BQK A;  3I0O A;  3CX6 B;  4EOZ B;  3RC3 A;  1S94 A;  2WAU A;  4IST A;  5FY1 A;  3RYF E;  4JEU B;  4O4I E;  2YK0 A;  4QX8 B;  5LCY A;  5JDL A;  5FP3 A;  2E9X D;  1NWM X;  3VU7 H;  5TAO A;  3RKO A;  3KDS E;  3RPU A;  5KX5 E;  2R7T A;  4AXP A;  2DLR A;  4A56 A;  4XZC A;  4AKG A;  2CMR A;  5BMV E;  2XAG B;  4XAX B;  3IBP A;  3HKB E;  3FHN A;  2VK9 A;  2XAQ B;  3UT5 E;  3Q2M A;  2Y8D A;  1LRZ A;  4IDZ A;  5L3C B;  3ZN1 B;  4MBQ A;  4UXN B;  5HXS A;  4WW0 A;  3BK9 A;  2IAK A;  4QXB B;  3ZMT B;  2NW7 A;  5KMG P;  3FBL A;  4PFO A;  3UUN A;  3R84 B;  4PNI A;  3KVA A;  3N2O A;  3FXD B;  2W00 A;  4PJL A;  2K48 A;  3F2E A;  5F8P A;  2WMN A;  3IEE A;  3NRY A;  5H6R B;  1IZN B;  4U72 A;  2OA5 A;  2XAJ B;  3KV6 A;  2VKO A;  4DMV A;  4PW8 A;  4WBO A;  4EYU A;  2Q9Q B;  4UF0 A;  3DJB A;  5FXV A;  5L3G B;  5CQG A;  5CB4 E;  4O2A E;  2X9H A;  3AVR A;  5JR9 C;  2C0S A;  5L3B B;  2GK9 A;  2VWA A;  4TV9 E;  2UXN B;  2W63 A;  4EXT A;  2WBL A;  1BR1 A;  2R7R A;  2CEA A;  2ZM0 A;  3E08 A;  4PK5 A;  5FYM A;  4J2C A;  3ZCJ A;  2LE8 A;  4DVD A;  2MYS A;  3HKC E;  3N5L A;  3N9P A;  3P8C D;  1FMW A;  3UTK A;  4E7Z A;  3U3I A;  4IE4 A;  1YD8 G;  3ZMV B;  4O2B E;  2R7S A;  2L9Q A;  1UX5 A;  2P9B A;  3ETU A;  3RRC A;  5LGT B;  2CWY A;  1FEW A;  2JJ9 A;  4HEA A;  5HXR A;  1Z0P A;  3ESL A;  2IC9 A;  2BZB A;  3O4X E;  5LBQ B;  5LP6 E;  2H3R A;  3FBZ A;  5LNK A;  4AKI A;  2A2F X;  1HG5 A;  2BVL A;  4IE5 A;  2V7I A;  1NAF A;  1OXZ A;  2CCQ A;  1WR6 A;  2KWI B;  2DCF A;  2UXX B;  2WM9 A;  3B57 A;  5HYA A;  2H7O A;  4ASK A;  3KVB A;  2D0T A;  2MBG A;  4FI5 A;  3EDV A;  2D5U A;  3N9N A;  4UEL A;  3CPZ A;  3N9M A;  2JQQ A;  2E8I A;  5FY7 A;  2E9X B;  2KWH A;  2ZLY A;  1V9D A;  2CXF A;  2XAH B;  2VAS A;  4B6X A;  1HG2 A;  3VHL A;  5H6Q B;  2R7X A;  3PUR A;  2EHO C;  5JRE A;  4P0A A;  4I4T E;  3LBX A;  2ES0 A;  2K5B B;  3TKL B;  4DO0 A;  4CQI A;  3PUQ A;  5EK3 A;  4OHF A;  4OK0 A;  4TX5 A;  3ZLI A;  4ZI2 D;  4UV8 B;  4ANJ A;  2KMF A;  1O3X A;  3DU5 A;  4UF0 B;  3ETV A;  4O8S A;  4ZI3 C;  2LOP A;  4QWN B;  5L2L A;  5LHI B;  2R7V A;  5M4Y A;  1E1H B;  4MAL A;  4TZ4 C;  5JR9 A;  3C98 B;  1MMG A;  2XUE A;  2Y6X A;  5EZY E;  5FMN A;  2Y48 B;  1KNZ A;  2LM9 A;  3RYI E;  4O4L E;  3ZC1 A;  4H9Q C;  4ZHQ E;  3N9L A;  1IAP A;  4XBF B;  4TN7 B;  3HL6 A;  4E7S A;  4BJN A;  4ERR A;  1US7 B;  4UV9 B;  2V7K A;  3CWZ B;  4HFV A;  5AFU L;  5F3J A;  2VKH A;  1HS7 A;  1ZKE A;  3NZP A;  4PJJ A;  2PFV A;  1BR2 A;  2X9X A;  4HN9 A;  4PK4 A;  3HR0 A;  3I1A A;  3A5X A;  2PG8 A;  4PJN A;  1D1B A;  2DWG A;  3AAA B;  2C5J A;  3C50 A;  4GYR A;  3ANW B;  4GIW A;  4I55 E;  5JDN A;  3LJC A;  1IJ5 A;  2CLY C;  3QC9 A;  1IJ6 A;  5LA6 E;  3SS1 A;  4CZZ B;  4EAH A;  4DMW A;  4TV8 E;  3SWH A;  3S4U A;  3ZPO A;  5LYJ E;  4HE8 A;  3UFE A;  5ETW A;  1HTJ F;  2X9Y A;  3KV9 A;  4PJM A;  4C91 A;  2KZ7 B;  4CXW A;  3N9Q A;  3AAE B;  5LBM A;  3KBU A;  2JMK A;  5DAB A;  5JQG E;  2ODU A;  3H37 A;  5ADX L;  4WNK A;  3ZCI A;  2V7M A;  2WMO A;  1S35 A;  4YLH A;  5DJQ C;  5JDF A;  3HKE E;  3V5S A;  2EHO A;  4YHJ A;  3GWH A;  2QGS A;  3MZK B;  2MTQ A;  5HWY A;  2DWK A;  1SHZ C;  5GON E;  3RYC E;  2NWB A;  2V7L A;  3GMI A;  2SPC A;  5EK4 A;  5LGU B;  4JEH B;  4JLE A;  4BJM A;  3P7I A;  1SA0 E;  1QSD A;  2LOS A;  3CQX C;  3WAK A;  5EK2 A;  4I43 B;  1QUU A;  4UVA B;  3AA7 B;  3F31 A;  4CI1 B;  5JR9 B;  3CX8 B;  3OJA A;  2W61 A;  3O1J A;  2MOZ A;  4H9P C;  5JDG A;  5FXZ A;  4KUM B;  5CA1 E;  3C4W A;  3ZJ1 A;  1FIO A;  4QKN A;  2HH7 A;  2LHN A;  1LKX A;  3L09 A;  3VKG A;  3N9O A;  4CXX A;  5FXW A;  3OBV E;  2LSK A;  2CWO A;  2VKJ A;  3F57 A;  4AKR B;  4EB6 E;  5LHH B;  4AI6 A;  2ZM2 A;  4GK0 E;  4IRV A;  4IHJ E;  3LK3 B;  4IE0 A;  3HI2 A;  5DQV A;  2YU2 A;  1KK7 A;  4IGU A;  4KP3 C;  3QK6 A;  2CE7 A;  2X66 A;  3CKD A;  5L3D B;  3ZMZ B;  3J7Y q;  4UVB B;  1VOM A;  1HF8 A;  2DI4 A;  3ZJ2 A;  4PFP A;  2NW9 A;  2HPL A;  2LSY A;  2Z6E A;  2X0L B;  3E0Z A;  5L3E B;  5JRC A;  3RH3 A;  3KV5 A;  2X67 A;  4NUV A;  3OYX A;  4KMC A;  3LG7 A;  4OD5 A;  3PU8 A;  3UUX B;  2D2S A;  1LVK A;  3D0T A;  2NOX A;  3AB3 B;  4I50 E;  3VTI A;  3GN5 A;  3R6N A;  3C51 A;  3CX7 B;  3DTO A;  4HGA A;  2NW8 A;  4MFR A;  4O4H E;  5JH7 E;  4CI2 B;  3N2G E;  1CUN A;  1ZHC A;  4ZS3 A;  4IIJ E;  2B1E A;  3O1H A;  3MKD A;  1HX8 A;  1OWA A;  2XTL A;  4U74 A;  3ZEF B;  2N9D A;  4IE7 A;  4V1A v;  4EIW A;  4ILU A;  4L0R A;  3NRX A;  3QUJ A;  3RYH E;  4DBR A;  2VKD A;  2V26 A;  4QX7 B;  5JDM A;  4UIG A;  4ZI7 E;  3ZYL A;  4F6R C;  3NBX X;  3MK7 C;  1D0Z A;  4CI3 B;  4BAY B;  3E22 E;  3LFM A;  1ZEE A;  1U5P A;  2JPF A;  1MMN A;  4N78 D;  5LHG B;  1MIV A;  5FNV E;  3T8O A;  4X1Y E;  3ZMS B;  2DNX A;  2W0G A;  2R7U A;  4QXC B;  2WSS V;  3AAI A;  2LSI A;  2X51 A;  4H63 H;  4EYY R;  3FXE B;  5LJM A;  1MMD A;  3RRW A;  2PBI A;  3AA0 B;  4H9R C;  5HXH A;  1ZV4 X;  4L5G A;  3WAJ A;  2M67 A;  2NTX A;  3BQL A;  1LVF A;  2LJL A;  4PAG A;  1WYB A;  3PUG A;  3EUH A;  2CLY B;  5HXC A;  3PE0 A;  5A1L A;  4YJ2 E;  2ODV A;  2CM0 A;  1UX4 A;  3N2K E;  5FY0 A;  4GYS A;  2K24 A;  2RP4 A;  2LT3 A;  1BR0 A;  3PU3 A;  2X68 A;  2XAF B;  2EHO D;  4H9N C;  5DQW A;  2R7W A;  3GA8 A;  3DU6 A;  3PUA A;  5LG4 A;  3AA6 B;  2XQY A;  2R7O A;  3GN5 B;  3HKD E;  4X1I E;  2WWU A;  3KV4 A;  3CVR A;  3ZYK A;  2W62 A;  5LGN B;  1MND A;  1WYC A;  3LBX B;  4H9S E;  4M1P A;  4OFZ A;  4ZI3 D;  2YEV C;  1FMV A;  2KND A;  1VRB A;  3RC8 A;  3MJX A;  3LK4 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...