3SWHA

Munc13-1, mun domain, c-terminal module
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
316
structure length
295
Chain Sequence
AWFEPFVIQWLDENEEVSRDFLHGALERDKKDGFQQTSEHALFSCSVVDVFSQLNQSFEIIKKLECPDPQIVGHYMRRFAKTISNVLLQYADIVSKDFASYCSKEKEKVPCILMNNTQQLRVQLEKMFEAMGGKELDAEASGTLKELQVKLNNVLDELSHVFATSFQPHIEECVRQMGDILSQVKSVAQDADNVLQPIMDLLDSNLTLFAKICEKTVLKRVLKELWKLVMNTMERTIVLPPEFSKLKDHPKQCAVVELALDTIKQYFHAGGVGLKKTFLEKSPDLQSLRYALSLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein unc-13 homolog A
publication title The Crystal Structure of a Munc13 C-terminal Module Exhibits a Remarkable Similarity to Vesicle Tethering Factors.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Exocytosis
total genus 130
structure length 295
sequence length 316
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10540 Membr_traf_MHD Munc13 (mammalian uncoordinated) homology domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.50 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor; domain 2 3swhA01
1.20.58.1100 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3swhA02
2FJI1 3SWHA
chains in the Genus database with same CATH superfamily
4L0RA 3AEAA 4LFBT 3IEEA 3RH3A 2XQAA 2RASA 2V7MA 1SGMA 3CX6B 4DR6T 3V5SA 2AE9A 3MKDA 2V8SV 2NW8A 5DJQC 4DV6T 3KKCA 3E7QA 4WZXA 4GFKA 4NUVA 1WFDA 2LOPA 3ZMZB 5EYRA 3LJCA 3TLUA 3NPIA 5CA1E 4X1EA 4HE8A 5E0OA 1XDPA 3UULA 4AKRB 4AKIA 2R7XA 1CHUA 3N9NA 4YTPA 3HL6A 4HKAA 2JIWA 3A5XA 3ZMVB 5KXJA 4H9QC 1O3XA 2FJDA 3FBLA 4PXIA 5C8YE 4UIGA 5FP3A 2VVNA 2LJLA 4QXCB 2XAQB 2CRBA 3IF8B 3RF1A 3IHRA 2NWBA 4IE0A 2XQ6A 4JLEA 2LKGA 1IZNB 2WMNA 2VK9A 4Z91A 2I0MA 2HN1A 3RQUA 4EB6E 4I4TE 1I94T 2QA7A 3AE4A 3P4QA 4JI4T 4B3MT 2LSKA 4U7IA 2ZB9A 2W0GA 3PM1A 5EK3A 5F08A 5L3EB 5F3JA 4EV6A 3HGYA 3DP7A 3MK7C 2WGBA 2NS8A 3SS1A 4ME9A 1D0YA 3HI2A 5FKOA 5J1YA 4YLHA 4NXMT 4PNIA 4OYKA 2HPLA 4O4IE 4JI3T 2B76A 5HEHA 4XZCA 2WWVA 2XB5A 4U3CA 5AQHB 3LWJA 3ZQFA 3ZC1A 2IIUA 3LSPA 3PU8A 4M1PA 4HWIB 4D7MA 4KWAA 2JQ9A 3AXJB 3WHCA 5HXSA 3ONLC 1N33T 1QVUA 3ZJ2A 2JPFA 5HXEA 5CA0E 4IIJE 5HYAA 3NRGA 1MMGA 4I43B 1WLXA 3NXCA 1XWMA 5JQGE 3LDQB 3E08A 1V9DA 1YKHB 3VHLA 5EZYE 1T98A 2FJ1A 2WUIA 4OK0A 3AA7B 4KMCA 2G7SA 3RHWA 2CHOA 2MAWA 3HKDE 4PK4A 4JEUB 2PBXA 1JUPA 3QK6A 3AAAB 3VR9A 4DR2T 2IAIA 3G1OA 1S35A 4QH5A 3RYFE 1D0ZA 4ABZA 4IE7A 4N78D 2REKA 3N9MA 4K0KT 1NENA 3FZLB 2E9XC 3OJAA 3K1SA 2JQQA 4AKHA 2RP4A 3BQIA 4KHZF 3BR2A 5J2TE 4IRVA 3PASA 4WBOA 4LF7T 5AQTB 2O7OA 2X9WA 3SFEA 4ZZCA 4AIUA 2IDOB 2QWTA 2DTZA 2X9HA 5HWXA 4W97A 2ACZA 4HN9A 2R7UA 4JNNA 4DV3T 1HX1B 4CN1A 3FZFB 2N2NA 2E9XA 2K3WA 5CQGA 3CPZA 4E7ZA 3UQ4A 3ZCIA 4COFA 3AQTA 2N9DA 5HEUA 5LYJE 2I10A 3HE0A 2Y8DA 1AJ3A 4YZEA 3JC6D 2VQET 2VKOA 1W0AA 3N9QA 5AQOB 4HFCA 2X0YA 2Q9QC 4AISA 2XQ7A 3L09A 5L3CB 1BR1A 2QOPA 4ZXLA 5LA6E 1H7CA 5LOVE 1IAPA 5A1LA 4ZS2A 2ID6A 2ZM8A 4CN6A 3RGLA 4JV5T 4ICHA 2BVLA 2XPUA 5LGNB 1E2AA 4ILAA 4ZI7E 5LG4A 2Q9QA 2GUHA 3Q0WA 3VVZA 3P4SA 4QH1A 2JRKA 4JI2T 3VU7H 5LG3A 2KINB 2VURA 1JT0A 2ID3A 1UCUA 5ABFB 4ACIA 4UVBB 2LSGA 2LRLA 2NR4A 3ONJA 3ZSTA 4Z90A 4UR9A 4O4JE 2WU2A 5FY1A 5F04A 5FVKA 2JMKA 5EZHA 5FMPA 4CXYA 2VL8A 3PUAA 5HXHA 2XDNA 4H63H 2YDQA 4PJMA 3L39A 1I6ZA 2V7IA 5GP9A 2XM2A 5JRCA 2CM0A 5BMVE 2XSBA 1UGOA 1UX5A 2X66A 3CIRA 2Y2ZA 2CPTA 3KFWX 1J5ET 2LM9A 4L62A 4AQGA 5EK2A 2R7OA 1WR0A 4MLKA 3CKDA 1HNWT 3F31A 3PE0A 3ZQIA 1IJ5A 5JR9A 4XBFB 4E7SA 4WBNE 3VP5A 3PUVF 5LHGB 3KV9A 3QBMA 2ZM6T 4CXXA 2CA5A 4DR3T 5FKMA 2X9YA 2KT9A 3UU5A 2X68A 4DR4T 1U9NA 3TKLB 5K7ZA 5L3DB 2R7SA 2V26A 3FZKB 3VTIA 5AQIB 2OF7A 2YN6A 3VVXA 2VKJA 3PJAJ 5JREA 1KEYA 2Y31A 1KNRA 2XM1A 4MK6A 5EFYA 4KBMB 4P0BA 3Q5XA 1WCRA 2D6YA 2VKVA 4QXBB 4HFEA 4NPPA 1Y64B 4NUUA 2NP3A 2XQ8A 5IPAA 1D0XA 2WMOA 4EAHA 5D18A 4ZI3C 4CGRA 1JTXA 3ON2A 1ZHCA 3VVYA 2UUAT 3BNIA 4M3EA 2HXOA 2WB5A 3NZPA 4X5TA 3UFEA 3Q0VA 2MPKA 3HGGA 5GPAA 4M3DA 2X0HA 4DVDA 2VVSA 4JEHB 1SE7A 1OXZA 4UEMA 5L3FB 4EOZB 4TX5A 4P09A 3WHBA 4DR1T 4LFCT 2GENA 1L0VA 1FMWA 2PBIA 4YTMA 2K24A 4CI1B 2YOEA 3ZN1B 3C50A 3BR1A 4HWFA 4JKZA 5HCJA 1B7TA 3PDYA 2BS4A 1KNZA 3LHQA 1LVKA 3BT9A 2X67A 3PUGA 4MXMA 3AE3A 3AECA 4AI6A 3EGQA 2YEVC 3VOKA 3UTKA 1MMDA 5LNKA 4PJLA 3BQZA 1NEKA 2E2AA 4NIQA 4IDNA 4H9OC 4U7YA 3MA9A 2IMLA 2XUEA 5AQGB 3AXJA 2J1DG 3I0QA 5F0HA 4GOUA 4JI5T 2QYWA 4H9SE 2BZBA 5LBQB 2KWIB 1S94A 1KK7A 2LLYA 4FJOA 5LXTE 3QKXA 2V7JA 4IE5A 3LOCA 4MHCA 2CWOA 2DG7A 4IDOA 3NI7A 3HTHA 3MZKB 2VKHA 3MACA 5FL1A 2C5KT 2GFNA 1ZV4X 3LK2B 4D5FA 3UU8A 2DWGA 4A98A 3KV5A 4KP3C 3RKGA 4B6XA 4OD4A 4AF5A 1XMQT 4ISSA 3P7IA 4PK5A 2VQFT 1ZK8A 3BQYA 3HIMA 5HBUA 4UVAB 2E5LT 4EZHA 1IBLT 1HF8A 1GQEA 2V7LA 5GPCA 2B3WA 1XZYA 4M3FA 3VUQA 3AA1B 2BBJA 4GKJT 3AE5A 3F0CA 4P1NA 3KV4A 4LMLA 3RLFF 3HTAA 2LE8A 2CE7A 2ZOZA 4AKGA 3I1AA 2WWUA 3BTLA 4Q25A 5L4HA 3X1DA 3LK42 5AQKB 3TLTA 3VRAA 5FKNA 4U9NA 3PUSA 2W00A 2UXIA 2XGCA 2LM2A 3ZT7A 1HG2A 5AQQB 2IAKA 2D0TA 2KNDA 4F6RC 2K48A 2LHRA 3SDGA 2L3LA 4KUMB 2UXBT 4PJNA 2WCAA 2FBQA 4ZI2D 2BDEA 3AE9A 4LMKA 3AQSA 3ZJ1A 2CLYB 2LRKA 2RHAA 1JNRA 4IREA 3ZMTB 3ZQGA 3RRWA 2YU2A 2L8KA 5AQSB 4ZOLE 1JTYA 4DW6A 2V6XA 5ABFA 3CCYA 1UI6A 2BKOA 2UU9T 2M6IA 1ZKEA 2CXLA 1HFAA 2H7VC 3EDVA 4F8HA 2WU5A 3PUYF 3S4UA 3RYIE 2R7VA 2QIBA 2UXPA 2NW9A 2YU1A 3FHNA 1YQ4A 3QOFA 1VCSA 5JDNA 2P9BA 3NRXA 2Y30A 4B3AA 5FHPA 4JYAT 3VW1A 2PZ9A 3B6CA 3H37A 5HXRA 3TP3A 2IU5A 5K58A 1N36T 2V5CA 5J1GA 4P0AA 1ZP0A 3ZYLA 2FJBA 4TUYE 4ZEYA 3CQXC 4YSYA 4YTNA 2XAHB 2XJ7A 3ZEFB 2KXPB 4DNDA 3FK7A 2I6HA 2FQ4A 3ABVA 4UV9B 2DWKA 3ETVA 2LEHA 5F27A 4DV7T 5ABEA 2PG8A 4HFIA 5DQVA 1KFYA 2ZLYA 2EHOD 4MFRA 4ISTA 3GWHA 4LMJA 3GEUA 5ETWA 5CXIA 3OYXA 1G73A 3U78A 2WM9A 5H6RB 3P9TA 2J62A 2Q24A 2YVHA 3HKEE 3KV6A 5L3BB 3C2BA 3NWIA 3C98B 4HKUA 1BR4A 2VB6A 2NOXA 5HAWA 5FXXA 3K3NA 3A8YC 1KF6A 3V5UA 3ZT6A 3KZ9A 5FKLA 4PK6A 2UXDT 5AQMB 4EGWA 3Q3SA 1ORKA 3DU5A 1W09A 4B1RA 4PFPA 3U3IA 5LMNT 3AVRA 2WZHA 3SRZA 3CVRA 1LVFA 1UURA 4DR7T 4O2BE 2W61A 5L47A 3CWRA 2B1EA 1JT6A 3HTJA 2HXIA 3OPCA 2CBIA 2XPVA 2XSAA 3N5LA 4DIDB 4X66T 2IC6A 4DV5T 4AXPA 4HEAA 3FIWA 5LHIB 2LSIA 3OVUA 2YVEA 3Q5DA 2WBLA 4MO7A 3Q9DA 3QB5K 1MMNA 3M65A 2BKNA 2JMHA 1N32T 2BVMA 4IL4A 3DCFA 4ZZBA 2WZIA 2XQ4A 3MJXA 2WDQA 1VOMA 5AQUB 2Z6EA 2Y6XA 2X9XA 3O1IA 1T33A 2QTQA 5FVLA 4YJ2E 4PJJA 3N9OA 2V5DA 3EHZA 1UUSA 3KBUA 2BKPA 3BR6A 4B3RT 4TWHA 4I76A 5IUXA 2W2UA 3JAEA 2X51A 4JL3A 4CZZB 3QNUA 3UU3A 3RIUA 2LKHA 2ZOYA 4LF9T 3LSVA 3OYZA 4KI0F 1XMOT 2BG9B 4HWHA 3UT5E 2W53A 4MALA 1US7B 2V1DB 2XGDA 3CWZB 3FXDB 3KKDA 3IH3A 3F2EA 2ZM2A 2HKUA 2UXCT 2HN2A 3Q0UA 5JR9C 4I50E 4DUYT 3T6NA 2EHOB 2OV9A 2BBHA 3VR8A 4TV9E 3ON4A 1M7KA 3O60A 3AE6A 5FXWA 3K3OA 5D1RA 4WNKA 3GN5B 2E9XD 1T56A 3B81A 5D19A 5JTGA 3ZYMA 5LBMA 2F07A 1J1JA 2ZM0A 3CQGB 4QHOA 3NS4A 2NP9A 3CX7B 1Z0XA 2JK3A 5HEOA 3TLWA 2MYSA 3PJAA 4CI2B 1T7SA 4I55E 3IUVA 5H6QB 3K8PC 3KBTA 4TNWA 4CQIA 5LMUT 1W9RA 4YHJA 5FXVA 3HKCE 5J1UA 2LHNA 2FUPA 3C51A 3R84B 2JQHA 2KSRA 4HFVA 4EZ4A 3C07A 1MNEA 2Q9QD 4ASKA 3KINB 3PTRB 5F5WA 3ZPOA 3H3AA 4L5GA 3J9X1 3QPSA 1UX4A 2H7OA 5K7HA 4G12A 2OLTA 5CFBA 2SPCA 2ACXA 1BR2A 2D9DA 4AKLA 2CBJA 1VCTA 2XQ5A 3BHQA 2IEKA 3AEDA 3NRYA 4DV2T 4QX7B 5TAOA 1YD8G 3N2OA 3QC9A 2QKOA 1VRBA 3EUPA 4D5CA 4HTEA 2UXHA 2DLRA 3VRBA 4IL9A 4A5XA 5CB4E 4IGUA 3VKGA 2WP9A 5FKKA 3SFIA 1KNPA 2V6YB 3M3ZB 5LGTB 4G63A 4AC0A 3C4ZA 2YDRA 1HS7A 4GIWA 4UDSA 3O8GA 5LJNA 3ESLA 2OI8A 2KZ7B 3JADA 2HQ5A 3B13A 4U9LA 3KVAA 3ETUA 4LF4T 3BTCA 5L4EA 2G3BA 1J5WA 5CGMA 3MXZA 2LOSA 1T8BA 3LBXB 3TLSA 5F8PA 5FKYA 4X1KE 4B3ST 5AQVB 3UUBA 4YFSA 4ZS3A 2OERA 2QGSA 3QB5A 3QUJA 2WV1A 1X9BA 2RAEA 3L3PA 4Z8XA 3A7MA 3B6AA 3W15B 3C64A 5JDFA 2HYJA 2RA1A 3AB3B 3WAKA 3NVOA 1HG5A 2X0LB 3ANGA 4XAXB 2RPAA 2LSJA 2DHRA 4O8SA 3NNRA 1OEDB 4ANJA 1D1AA 3LJLA 4QKNA 4C2MA 5FY7A 5ABHA 4YY3T 5AQCA 2WS3A 2XASB 5J2UE 4A56A 2FD5A 2XAFB 3DU6A 2VKEA 3V78A 3LK3B 3AEBA 2NS7A 3BTJA 2FJI1 2R7QA 4U2ZA 2YK0A 2R7TA 3RH2A 3K3QC 3UU6A 1X79A 4AUXA 5M4YA 3WI3A 1MIYA 2G7LA 1FEWA 4YSXA 2WY2A 4ILCA 3G1MA 3RIAA 3I9YA 2QCOA 4WYVA 2NP5A 4YJ3E 1MMAA 1RKWA 2J47A 2ZY9A 2VKDA 1IBMT 5AQFB 3ZQLA 2ZMAA 3F1BA 1HCIA 4HWCA 5ABGA 5DQWA 5LGUB 4TWDA 3PUQA 5AQNB 5JDMA 5H9TA 3RYHE 2F4VT 5HSZA 2XY8B 2OA5A 4H9PC 3P4RA 4HFDA 4TZ4C 2K5BB 2ZCXA 3PV0F 3EDUA 4PW8A 4GYRA 2IBDA 4D7NA 3AEEA 2K9AA 5JVDE 1JNZA 3CMLA 4KX6A 1WRDA 3UUMA 2NTYA 4AQFA 2G0EA 4DR5T 3WAJA 4GYSA 1YQ3A 3PPBA 4A97A 1MNDA 3TLVA 5LCYA 3AA0B 1Z77A 2TRTA 5JDLA 5HCMA 3AVSA 2ODVA 5KX5E 2HYTA 3PUWF 2VPRA 4K0UA 2CXFA 3RI5A 1U5PA 3RC8A 2G7GA 1YXRA 4ZHQE 4B3TT 3ZSSA 1QVTA 3RX6A 3H3MA 4TN7B 2EHOC 3L8RA 4DVYP 4M3BA 4QX8B 3DJBA 3QQAA 2VWAA 1UI5A 2BG9A 4JYKA 5FY0A 3BR0A 4UF0B 2M67A 3B57A 2NTXA 3FK6A 1SA0E 2C0SA 3MVPA 5L3GB 5AQRB 3FZHB 3UUNA 1BR0A 3FB2A 3CJDA 3RYCE 4AQYT 3HKBE 4WIBA 3ZCJA 4GCKA 2R6GF 5LP6E 2BG9E 4WW0A 2EHOA 5IOYA 1EZ3A 4ILUA 3OBVE 3ANWB 2H3RA 2EH3A 5IOZA 4YHHT 5HAXA 4GKKT 5J1RA 2XAJB 3GN5A 4OYJA 5JDQA 2WDVA 3BRUA 3EUHA 3G7RA 3VOXA 3AAIA 2ZCNA 4EYYR 3T1YT 3SFDA 3VPRA 3IBPA 2QRXA 3BQKA 2E8IA 4JUYA 2XPWA 4PAGA 2X6OA 3N2GE 5HXCA 4C91A 1NWMX 2W66A 1IJ6A 2X9DA 4IDZA 2OPTA 3JC6C 2XRLA 4UXNB 1WYCA 5GONE 4JI6T 1HNXT 3CRJA 2G0UA 3IH2A 1N34T 3HR0A 4DV4T 2JJ7A 1HTJF 1ZKGA 2R7RA 3N2KE 3DEWA 2DL1A 2W62A 5KMGP 2C5JA 3OKQA 1XNRT 4NELA 2A9UA 3AEFA 3Q5WA 3AEGA 1FJGT 4HWDA 5JH7E 5C3JA 2CHNA 1UK5A 2ODUA 4U72A 2XTLA 2UUBT 2WQYA 2XQ3A 3RKOA 4YSZA 5K7FA 2CMRA 3BTIA 3CDLA 4QH4A 4DV0T 2W4XA 2XGEA 3MNLA 1U9OA 2HH7A 2FX0A 1D1CA 3PURA 4TWFA 2YINA 1SUMB 2GK9A 2N1GA 1R8IA 3LFMA 5EK4A 2VL0A 4JI8T 1LKXA 3P4PA 1E1HB 1CUNA 3V6GA 3BJBA 3UFGA 2V6YA 4HFHA 4DBQA 4O4LE 2ZCMA 3AA6B 5F0FA 4ERRA 4LF5T 2XQYA 3NBXX 5AQJB 5CJ5A 5IP6A 3RQWA 5DAJA 2FJAA 3DPJA 1SHZC 4PFOA 4YXDA 3LBXA 1YKEB 4UV8B 3RPUA 3E0ZA 3SWHA 4ADZA 3C4XA 4V1Av 5JDHA 1OEDC 2BS2A 3EAMA 2PJQA 4X20E 3RIUC 2NW7A 5HWYA 4W1UA 3RRCA 4U2YA 3AE7A 3JAFA 4DBRA 3UU4A 3AE8A 2A3DA 3GMIA 3LSRA 4C90A 2FBWA 2V57A 2XHEB 4KHPT 2JJ9A 1BJZA 5EZGA 2PTFA 4ILBA 1DU2A 2D0UA 2R7WA 2D2SA 4I0UA 5FMNA 3PUZF 1OEDA 2UXXB 3BQLA 3N9LA 4UVCB 4IE6A 1FIOA 2LT3A 3ZQHA 4X64T 4JI0T 4IT4A 2PFVA 5FNVE 3KVBA 1D1BA 2FJEA 4OHFA 2KWHA 3NZQA 4H9RC 4DV1T 3P8CD 2KMFA 4TV8E 3UUXB 4EEBA 3J7Yq 3BK9A 3DTOA 3P4WA 4QWNB 3B5MA 2O7TA 1OEDE 5DABA 3I0OA 2MOZA 4JI1T 1RPWA 3BCGA 3NKZA 4NXNT 2HPJA 2TCTA 3O4XE 2XAGB 5C2TA 3CQCB 3KNWA 5LJMA 3ZN0B 3O8HA 1Z8UA 4V2GA 3JSJA 3FBZA 4X1IE 3GZIA 3P50A 4I6ZA 4LFAT 2UXUA 3RC3A 3PU3A 4YT0A 1QPIA 1G8XA 5ADXL 3SOLA 4M3GA 5IHYA 1U4QA 3VKHA 3RD3A 5AQPB 2XPKA 4HGAA 5FGLA 4EEDA 1MIVA 5HEJA 1W0BA 4JBWF 2NX4A 2H88A 2QVAA 1RKTA 4H9NC 4XK4A 1WYBA 5LB7B 3FRQA 5J0ZA 3RIFA 5F1JA 3CX8B 4JI7T 5L2LA 1HNZT 1QSDA 2W63A 4BJNA 2CLYC 5KDMC 1LRZA 3O9XA 2D5UA 3G1LA 3AE2A 4EXTA 1XNQT 1T72A 4DMVA 4LF8T 4LF6T 4GFLA 3I9WA 2BS3A 2CXDA 3Q5EA 3HA4A 3ZLIA 3T1HT 4J2CA 5CXGA 2XZEA 2CEAA 4BJMA 4IDPA 3KDSE 3ZYKA 5AQLB 4U33A 1VI0A 3VW0A 4IE4A 4QXHB 1WR6A 4UF0A 4DMWA 4IDQA 3COLA 1QLBA 3T8OA 2W67A 2JQKA 5JDGA 3N9PA 2V7KA 2YDSA 3O1JA 4CI3B 2DI4A 1HR0T 3ANWA 1M62A 1IBKT 2UXOA 2CCQA 3GA8A 4FI5A 3E22E 4UELA 5IWAT 1A6IA 5CW8A 1E7PA 1MIWA 2IUBA 3AAEB 3F57A 3ZMUB 3VIBA 2H89A 4BA9A 1HX8A 1FMVA 5FXZA 3BR5A 4DO0A 2E9XB 3OTOT 4CN4A 3UQ7A 5BR8T 3IA3A 2XQ9A 1XDOA 5C4YA 5FL0A 2M6BA 4BAYB 3ZT5A 3TP0A 1NAFA 2IC9A 3ANPA 2KLQA 2L9QA 1Z0PA 2LSYA 3EVYA 5LHHB 4GCLA 4U74A 2DG8A 4O4HE 3Q2MA 4H63V 3FXEB 3FZMB 1ZEEA 4DUZT 1YW0A 2CWYA 4NN1A 4IHJE 5HEGA 3QPLA 3LSJA 2I59A 4OFZA 2A72A 2VASA 3LG7A 2MTQA 4CXWA 3ONXA 2YVXA 3AE1A 2IW5B 3EABA 5FYMA 3KYLA 1OWAA 4X65T 4GK5E 2UXNB 4ZI2C 4O2AE 2Q9QB 4X1YE 2DNXA 3CK6A 4ZI3D 2HHHT 1JUMA 4OD5A 2IHR1 2C5IT 4GK0E 1ZOYA 2ES0A 4AC6A 4OX9T 4TNVA 3G56A 4V2FA 4EIWA 5F0CA 2UUCT 2DCFA 4AQFC 3C4WA 4MBQA 2WSSV 4U31A 2YKSA 3G06A 2E5VA 3EI0A 2A2FX 5JRCB 3R6NA 2GBYA 1Y01A 2WAUA 3ZC0A 2AXDS 2WDRA 3PUXF 5J3LA 4G2AA 3JCFA 3ZMSB 3ZKRA 1JUSA 2Y48B 3HTIA 3IH4A 5JR9B 4HFBA 3O1HA 3BR3A 5IYZE 3S5RA 4GCTA 1QUUA 4X62T 2MBGA 3D0TA 4L9IA 4EYUA 5AFUL 2J4GA 3VW2A 2BG9C
chains in the Genus database with same CATH topology
4L0RA 3ZN1B 5JR9C 3C50A 3IEEA 5JH7E 4I50E 3RH3A 2EHOB 1B7TA 2ODUA 2V7MA 4TV9E 4U72A 2XTLA 3CX6B 3PDYA 1KNZA 3V5SA 5FXWA 3RKOA 2CMRA 1LVKA 2X67A 3K3OA 3MKDA 3PUGA 2NW8A 5DJQC 4AI6A 4WNKA 3GN5B 2E9XD 2YEVC 2HH7A 1D1CA 3PURA 2YINA 4NUVA 3UTKA 2GK9A 2LOPA 2N1GA 1MMDA 3ZMZB 3ZYMA 5LNKA 3LFMA 5EK4A 5LBMA 4PJLA 1LKXA 2ZM0A 1E1HB 1CUNA 3CQGB 4QHOA 3NS4A 2NP9A 3LJCA 5CA1E 4HE8A 5E0OA 3CX7B 3UULA 4AKRB 4H9OC 4DBQA 3MA9A 2XUEA 4O4LE 4AKIA 2R7XA 3AA6B 2MYSA 3N9NA 4CI2B 4ERRA 3HL6A 2XQYA 4HKAA 4I55E 3A5XA 3ZMVB 2J1DG 4H9QC 1O3XA 3FBLA 3I0QA 3NBXX 5H6QB 4GOUA 5C8YE 3K8PC 4UIGA 5FP3A 3KBTA 2LJLA 4QXCB 4CQIA 2XAQB 3IF8B 4H9SE 4YHJA 1SHZC 3IHRA 2BZBA 4PFOA 5LBQB 2NWBA 2KWIB 4IE0A 3LBXA 1S94A 1YKEB 4UV8B 1KK7A 5FXVA 3RPUA 4JLEA 3HKCE 4FJOA 1IZNB 3E0ZA 2WMNA 5LXTE 2VK9A 2V7JA 2LHNA 3C51A 4IE5A 3R84B 3SWHA 4ADZA 3C4XA 4V1Av 4MHCA 2CWOA 4HFVA 4EZ4A 4EB6E 1MNEA 5JDHA 3MZKB 2Q9QD 2PJQA 2VKHA 4ASKA 3KINB 3MACA 4X20E 2C5KT 2NW7A 4I4TE 3PTRB 3ZPOA 2QA7A 1ZV4X 3H3AA 4L5GA 5HWYA 3J9X1 1UX4A 3RRCA 2H7OA 4DBRA 3LK2B 2LSKA 2A3DA 3GMIA 2SPCA 4C90A 2ACXA 1BR2A 2DWGA 4AKLA 2XHEB 2W0GA 5EK3A 5L3EB 2JJ9A 5F3JA 3KV5A 4KP3C 3DP7A 3MK7C 3NRYA 4B6XA 4OD4A 4QX7B 3SS1A 1D0YA 5TAOA 1YD8G 3N2OA 3HI2A 3QC9A 4ISSA 2D0UA 2R7WA 4YLHA 2D2SA 5FMNA 3P7IA 1VRBA 4PK5A 4PNIA 4OYKA 2HPLA 2UXXB 3BQLA 3N9LA 4HTEA 4O4IE 4UVCB 2DLRA 4IE6A 4UVAB 4XZCA 1FIOA 2LT3A 5CB4E 4IGUA 4EZHA 3VKGA 2PFVA 1HF8A 3KVBA 1D1BA 5FNVE 3ZC1A 3NZQA 2KWHA 2V7LA 4H9RC 4G63A 4OHFA 5LGTB 3P8CD 3C4ZA 2B3WA 2KMFA 3PU8A 4TV8E 3UUXB 1HS7A 3AA1B 4M1PA 3J7Yq 3BK9A 3DTOA 4GIWA 4QWNB 3KV4A 5LJNA 3ESLA 2KZ7B 5DABA 3I0OA 5HXSA 2MOZA 3B13A 2LE8A 2CE7A 3KVAA 3ETUA 2HPJA 4AKGA 3I1AA 3O4XE 2XAGB 2WWUA 3ZJ2A 2JPFA 3CQCB 5HXEA 5CA0E 3MXZA 2LOSA 3LK42 3LBXB 5LJMA 3ZN0B 5F8PA 3PUSA 4IIJE 5HYAA 4X1KE 1MMGA 3FBZA 1WLXA 4X1IE 4YFSA 4I43B 4ZS3A 2W00A 2QGSA 3QUJA 5JQGE 3L3PA 4Z8XA 3E08A 1V9DA 1YKHB 3VHLA 5EZYE 1T98A 3W15B 3C64A 5JDFA 2RA1A 3RC3A 4OK0A 1HG2A 3AA7B 3PU3A 2IAKA 2D0TA 2KNDA 3AB3B 4KMCA 4F6RC 1G8XA 2K48A 3HKDE 5ADXL 4PK4A 3SOLA 2LHRA 4JEUB 3WAKA 5IHYA 1U4QA 3VKHA 3QK6A 3AAAB 2L3LA 4KUMB 1HG5A 4HGAA 2X0LB 1S35A 4PJNA 3RYFE 1D0ZA 1MIVA 4IE7A 4N78D 4XAXB 3N9MA 2LSJA 2DHRA 2E9XC 4ZI2D 3OJAA 2BDEA 4H9NC 4O8SA 2JQQA 3ZJ1A 2CLYB 4AKHA 2RP4A 3BQIA 3ZMTB 1WYBA 4ANJA 3RRWA 2YU2A 5J2TE 4IRVA 2L8KA 1D1AA 4WBOA 4ZOLE 4QKNA 4C2MA 2X9WA 5FY7A 3CX8B 5L2LA 2XASB 1QSDA 2W63A 2X9HA 4A56A 4BJNA 5HWXA 5J2UE 2XAFB 3DU6A 1ZKEA 4HN9A 2R7UA 2CLYC 5KDMC 1LRZA 3O9XA 2CXLA 1HFAA 2H7VC 2D5UA 3EDVA 3LK3B 4EXTA 2FJI1 4DMVA 3S4UA 2N2NA 2R7QA 2E9XA 3RYIE 2YK0A 2R7TA 2R7VA 5CQGA 3CPZA 3I9WA 4E7ZA 3K3QC 1X79A 2NW9A 2YU1A 2CXDA 3ZCIA 2N9DA 3FHNA 3HA4A 3ZLIA 5LYJE 5M4YA 4J2CA 2Y8DA 1AJ3A 3WI3A 2CEAA 3JC6D 4BJMA 5JDNA 2P9BA 3NRXA 3KDSE 3ZYKA 1MIYA 1FEWA 2VKOA 3N9QA 3I9YA 4IE4A 2Q9QC 3H37A 5HXRA 4QXHB 1WR6A 3L09A 4YJ3E 4UF0A 1MMAA 5L3CB 1BR1A 5J1GA 2VKDA 4DMWA 4P0AA 2ZMAA 1HCIA 3ZYLA 5LA6E 1H7CA 4TUYE 3CQXC 5LOVE 1IAPA 5DQWA 2XAHB 5LGUB 5A1LA 3ZEFB 2KXPB 4ZS2A 3T8OA 3PUQA 5JDMA 2ZM8A 5JDGA 4DNDA 3RYHE 3N9PA 2V7KA 2OA5A 4H9PC 4TZ4C 2K5BB 4UV9B 3EDUA 4PW8A 4GYRA 3O1JA 4CI3B 2DI4A 2BVLA 2DWKA 5LGNB 3ETVA 3ANWA 2LEHA 2K9AA 4ZI7E 5JVDE 5LG4A 2Q9QA 2PG8A 2CCQA 2JRKA 3CMLA 3GA8A 4FI5A 3VU7H 5DQVA 1WRDA 3UUMA 2NTYA 2KINB 4AQFA 3E22E 1UCUA 4UELA 4UVBB 2ZLYA 2LSGA 2EHOD 4MFRA 4ISTA 3WAJA 3GWHA 4GYSA 1MIWA 3AAEB 4O4JE 1MNDA 3F57A 3ZMUB 5LCYA 4BA9A 1HX8A 5ETWA 1FMVA 5FY1A 5FXZA 3AA0B 2JMKA 3OYXA 5JDLA 1G73A 3U78A 2WM9A 4CXYA 3AVSA 4DO0A 5H6RB 2E9XB 2VL8A 2ODVA 3PUAA 5HXHA 5KX5E 4H63H 4PJMA 4K0UA 2CXFA 3HKEE 2V7IA 3KV6A 5L3BB 1U5PA 5JRCA 3RC8A 2CM0A 5BMVE 4BAYB 4ZHQE 1UX5A 3C98B 3RX6A 2X66A 4TN7B 1NAFA 2IC9A 2EHOC 1BR4A 2VB6A 2KLQA 4DVYP 2NOXA 2L9QA 3KFWX 3K3NA 5FXXA 1Z0PA 4QX8B 2LM9A 2LSYA 3EVYA 3DJBA 5LHHB 3V5UA 2VWAA 2R7OA 4AQGA 5EK2A 4MLKA 3CKDA 4U74A 5FY0A 3F31A 3PE0A 4PK6A 4O4HE 3Q2MA 1IJ5A 4H63V 5JR9A 4UF0B 3FXEB 2M67A 3B57A 2NTXA 3DU5A 1ZEEA 4XBFB 1SA0E 2C0SA 4PFPA 3U3IA 5L3GB 4E7SA 1YW0A 3AVRA 4WBNE 2CWYA 4IHJE 3SRZA 3CVRA 3UUNA 1BR0A 5LHGB 3FB2A 3KV9A 1LVFA 3RYCE 4OFZA 2CA5A 2I59A 2A72A 2VASA 3LG7A 2MTQA 4O2BE 2W61A 4CXWA 2X9YA 2KT9A 3HKBE 2B1EA 3ONXA 3ZCJA 2X68A 2IW5B 3TKLB 5L3DB 5LP6E 2R7SA 4WW0A 3KYLA 1OWAA 3N5LA 5FYMA 4GK5E 2EHOA 2UXNB 1EZ3A 2V26A 4ILUA 4ZI2C 3OBVE 2IC6A 3ANWB 4AXPA 4O2AE 4HEAA 5LHIB 3VTIA 2LSIA 2Q9QB 2H3RA 2DNXA 4X1YE 2WBLA 4ZI3D 3Q9DA 5HAXA 2VKJA 5JREA 2XAJB 3GN5A 4OD5A 4OYJA 5JDQA 1MMNA 3M65A 2C5IT 2JMHA 4GK0E 2BVMA 3EUHA 2ES0A 3AAIA 4CXXA 4EYYR 4KBMB 4P0BA 3Q5XA 3IBPA 4QXBB 3MJXA 1VOMA 3BQKA 4EIWA 1Y64B 2E8IA 4NUUA 2Z6EA 2DCFA 2Y6XA 4JUYA 4PAGA 2X9XA 3O1IA 3N2GE 1D0XA 4YJ2E 4AQFC 5HXCA 3C4WA 4PJJA 2WMOA 2WSSV 3N9OA 4MBQA 4EAHA 4C91A 1NWMX 3KBUA 1IJ6A 4ZI3C 2A2FX 5JRCB 1ZHCA 3R6NA 4IDZA 2WAUA 3ZC0A 3JC6C 2X51A 4CZZB 4UXNB 3NZPA 1WYCA 5GONE 3UFEA 4G2AA 2G0UA 3OYZA 3ZMSB 3HR0A 2Y48B 3UT5E 4DVDA 1HTJF 5JR9B 4MALA 1US7B 2V1DB 3O1HA 2R7RA 5IYZE 3N2KE 4JEHB 1OXZA 3CWZB 4UEMA 1QUUA 5L3FB 4EOZB 2W62A 5KMGP 3FXDB 2MBGA 3D0TA 4L9IA 3F2EA 2C5JA 2ZM2A 3OKQA 4P09A 4TX5A 4EYUA 5AFUL 1FMWA 2PBIA 2K24A 4CI1B 3Q5WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FJI 1;  3SWH A; 
#chains in the Genus database with same CATH topology
 4L0R A;  3AEA A;  4LFB T;  3IEE A;  3RH3 A;  2XQA A;  2RAS A;  2V7M A;  1SGM A;  3CX6 B;  4DR6 T;  3V5S A;  2AE9 A;  3MKD A;  2V8S V;  2NW8 A;  5DJQ C;  4DV6 T;  3KKC A;  3E7Q A;  4WZX A;  4GFK A;  4NUV A;  1WFD A;  2LOP A;  3ZMZ B;  5EYR A;  3LJC A;  3TLU A;  3NPI A;  5CA1 E;  4X1E A;  4HE8 A;  5E0O A;  1XDP A;  3UUL A;  4AKR B;  4AKI A;  2R7X A;  1CHU A;  3N9N A;  4YTP A;  3HL6 A;  4HKA A;  2JIW A;  3A5X A;  3ZMV B;  5KXJ A;  4H9Q C;  1O3X A;  2FJD A;  3FBL A;  4PXI A;  5C8Y E;  4UIG A;  5FP3 A;  2VVN A;  2LJL A;  4QXC B;  2XAQ B;  2CRB A;  3IF8 B;  3RF1 A;  3IHR A;  2NWB A;  4IE0 A;  2XQ6 A;  4JLE A;  2LKG A;  1IZN B;  2WMN A;  2VK9 A;  4Z91 A;  2I0M A;  2HN1 A;  3RQU A;  4EB6 E;  4I4T E;  1I94 T;  2QA7 A;  3AE4 A;  3P4Q A;  4JI4 T;  4B3M T;  2LSK A;  4U7I A;  2ZB9 A;  2W0G A;  3PM1 A;  5EK3 A;  5F08 A;  5L3E B;  5F3J A;  4EV6 A;  3HGY A;  3DP7 A;  3MK7 C;  2WGB A;  2NS8 A;  3SS1 A;  4ME9 A;  1D0Y A;  3HI2 A;  5FKO A;  5J1Y A;  4YLH A;  4NXM T;  4PNI A;  4OYK A;  2HPL A;  4O4I E;  4JI3 T;  2B76 A;  5HEH A;  4XZC A;  2WWV A;  2XB5 A;  4U3C A;  5AQH B;  3LWJ A;  3ZQF A;  3ZC1 A;  2IIU A;  3LSP A;  3PU8 A;  4M1P A;  4HWI B;  4D7M A;  4KWA A;  2JQ9 A;  3AXJ B;  3WHC A;  5HXS A;  3ONL C;  1N33 T;  1QVU A;  3ZJ2 A;  2JPF A;  5HXE A;  5CA0 E;  4IIJ E;  5HYA A;  3NRG A;  1MMG A;  4I43 B;  1WLX A;  3NXC A;  1XWM A;  5JQG E;  3LDQ B;  3E08 A;  1V9D A;  1YKH B;  3VHL A;  5EZY E;  1T98 A;  2FJ1 A;  2WUI A;  4OK0 A;  3AA7 B;  4KMC A;  2G7S A;  3RHW A;  2CHO A;  2MAW A;  3HKD E;  4PK4 A;  4JEU B;  2PBX A;  1JUP A;  3QK6 A;  3AAA B;  3VR9 A;  4DR2 T;  2IAI A;  3G1O A;  1S35 A;  4QH5 A;  3RYF E;  1D0Z A;  4ABZ A;  4IE7 A;  4N78 D;  2REK A;  3N9M A;  4K0K T;  1NEN A;  3FZL B;  2E9X C;  3OJA A;  3K1S A;  2JQQ A;  4AKH A;  2RP4 A;  3BQI A;  4KHZ F;  3BR2 A;  5J2T E;  4IRV A;  3PAS A;  4WBO A;  4LF7 T;  5AQT B;  2O7O A;  2X9W A;  3SFE A;  4ZZC A;  4AIU A;  2IDO B;  2QWT A;  2DTZ A;  2X9H A;  5HWX A;  4W97 A;  2ACZ A;  4HN9 A;  2R7U A;  4JNN A;  4DV3 T;  1HX1 B;  4CN1 A;  3FZF B;  2N2N A;  2E9X A;  2K3W A;  5CQG A;  3CPZ A;  4E7Z A;  3UQ4 A;  3ZCI A;  4COF A;  3AQT A;  2N9D A;  5HEU A;  5LYJ E;  2I10 A;  3HE0 A;  2Y8D A;  1AJ3 A;  4YZE A;  3JC6 D;  2VQE T;  2VKO A;  1W0A A;  3N9Q A;  5AQO B;  4HFC A;  2X0Y A;  2Q9Q C;  4AIS A;  2XQ7 A;  3L09 A;  5L3C B;  1BR1 A;  2QOP A;  4ZXL A;  5LA6 E;  1H7C A;  5LOV E;  1IAP A;  5A1L A;  4ZS2 A;  2ID6 A;  2ZM8 A;  4CN6 A;  3RGL A;  4JV5 T;  4ICH A;  2BVL A;  2XPU A;  5LGN B;  1E2A A;  4ILA A;  4ZI7 E;  5LG4 A;  2Q9Q A;  2GUH A;  3Q0W A;  3VVZ A;  3P4S A;  4QH1 A;  2JRK A;  4JI2 T;  3VU7 H;  5LG3 A;  2KIN B;  2VUR A;  1JT0 A;  2ID3 A;  1UCU A;  5ABF B;  4ACI A;  4UVB B;  2LSG A;  2LRL A;  2NR4 A;  3ONJ A;  3ZST A;  4Z90 A;  4UR9 A;  4O4J E;  2WU2 A;  5FY1 A;  5F04 A;  5FVK A;  2JMK A;  5EZH A;  5FMP A;  4CXY A;  2VL8 A;  3PUA A;  5HXH A;  2XDN A;  4H63 H;  2YDQ A;  4PJM A;  3L39 A;  1I6Z A;  2V7I A;  5GP9 A;  2XM2 A;  5JRC A;  2CM0 A;  5BMV E;  2XSB A;  1UGO A;  1UX5 A;  2X66 A;  3CIR A;  2Y2Z A;  2CPT A;  3KFW X;  1J5E T;  2LM9 A;  4L62 A;  4AQG A;  5EK2 A;  2R7O A;  1WR0 A;  4MLK A;  3CKD A;  1HNW T;  3F31 A;  3PE0 A;  3ZQI A;  1IJ5 A;  5JR9 A;  4XBF B;  4E7S A;  4WBN E;  3VP5 A;  3PUV F;  5LHG B;  3KV9 A;  3QBM A;  2ZM6 T;  4CXX A;  2CA5 A;  4DR3 T;  5FKM A;  2X9Y A;  2KT9 A;  3UU5 A;  2X68 A;  4DR4 T;  1U9N A;  3TKL B;  5K7Z A;  5L3D B;  2R7S A;  2V26 A;  3FZK B;  3VTI A;  5AQI B;  2OF7 A;  2YN6 A;  3VVX A;  2VKJ A;  3PJA J;  5JRE A;  1KEY A;  2Y31 A;  1KNR A;  2XM1 A;  4MK6 A;  5EFY A;  4KBM B;  4P0B A;  3Q5X A;  1WCR A;  2D6Y A;  2VKV A;  4QXB B;  4HFE A;  4NPP A;  1Y64 B;  4NUU A;  2NP3 A;  2XQ8 A;  5IPA A;  1D0X A;  2WMO A;  4EAH A;  5D18 A;  4ZI3 C;  4CGR A;  1JTX A;  3ON2 A;  1ZHC A;  3VVY A;  2UUA T;  3BNI A;  4M3E A;  2HXO A;  2WB5 A;  3NZP A;  4X5T A;  3UFE A;  3Q0V A;  2MPK A;  3HGG A;  5GPA A;  4M3D A;  2X0H A;  4DVD A;  2VVS A;  4JEH B;  1SE7 A;  1OXZ A;  4UEM A;  5L3F B;  4EOZ B;  4TX5 A;  4P09 A;  3WHB A;  4DR1 T;  4LFC T;  2GEN A;  1L0V A;  1FMW A;  2PBI A;  4YTM A;  2K24 A;  4CI1 B;  2YOE A;  3ZN1 B;  3C50 A;  3BR1 A;  4HWF A;  4JKZ A;  5HCJ A;  1B7T A;  3PDY A;  2BS4 A;  1KNZ A;  3LHQ A;  1LVK A;  3BT9 A;  2X67 A;  3PUG A;  4MXM A;  3AE3 A;  3AEC A;  4AI6 A;  3EGQ A;  2YEV C;  3VOK A;  3UTK A;  1MMD A;  5LNK A;  4PJL A;  3BQZ A;  1NEK A;  2E2A A;  4NIQ A;  4IDN A;  4H9O C;  4U7Y A;  3MA9 A;  2IML A;  2XUE A;  5AQG B;  3AXJ A;  2J1D G;  3I0Q A;  5F0H A;  4GOU A;  4JI5 T;  2QYW A;  4H9S E;  2BZB A;  5LBQ B;  2KWI B;  1S94 A;  1KK7 A;  2LLY A;  4FJO A;  5LXT E;  3QKX A;  2V7J A;  4IE5 A;  3LOC A;  4MHC A;  2CWO A;  2DG7 A;  4IDO A;  3NI7 A;  3HTH A;  3MZK B;  2VKH A;  3MAC A;  5FL1 A;  2C5K T;  2GFN A;  1ZV4 X;  3LK2 B;  4D5F A;  3UU8 A;  2DWG A;  4A98 A;  3KV5 A;  4KP3 C;  3RKG A;  4B6X A;  4OD4 A;  4AF5 A;  1XMQ T;  4ISS A;  3P7I A;  4PK5 A;  2VQF T;  1ZK8 A;  3BQY A;  3HIM A;  5HBU A;  4UVA B;  2E5L T;  4EZH A;  1IBL T;  1HF8 A;  1GQE A;  2V7L A;  5GPC A;  2B3W A;  1XZY A;  4M3F A;  3VUQ A;  3AA1 B;  2BBJ A;  4GKJ T;  3AE5 A;  3F0C A;  4P1N A;  3KV4 A;  4LML A;  3RLF F;  3HTA A;  2LE8 A;  2CE7 A;  2ZOZ A;  4AKG A;  3I1A A;  2WWU A;  3BTL A;  4Q25 A;  5L4H A;  3X1D A;  3LK4 2;  5AQK B;  3TLT A;  3VRA A;  5FKN A;  4U9N A;  3PUS A;  2W00 A;  2UXI A;  2XGC A;  2LM2 A;  3ZT7 A;  1HG2 A;  5AQQ B;  2IAK A;  2D0T A;  2KND A;  4F6R C;  2K48 A;  2LHR A;  3SDG A;  2L3L A;  4KUM B;  2UXB T;  4PJN A;  2WCA A;  2FBQ A;  4ZI2 D;  2BDE A;  3AE9 A;  4LMK A;  3AQS A;  3ZJ1 A;  2CLY B;  2LRK A;  2RHA A;  1JNR A;  4IRE A;  3ZMT B;  3ZQG A;  3RRW A;  2YU2 A;  2L8K A;  5AQS B;  4ZOL E;  1JTY A;  4DW6 A;  2V6X A;  5ABF A;  3CCY A;  1UI6 A;  2BKO A;  2UU9 T;  2M6I A;  1ZKE A;  2CXL A;  1HFA A;  2H7V C;  3EDV A;  4F8H A;  2WU5 A;  3PUY F;  3S4U A;  3RYI E;  2R7V A;  2QIB A;  2UXP A;  2NW9 A;  2YU1 A;  3FHN A;  1YQ4 A;  3QOF A;  1VCS A;  5JDN A;  2P9B A;  3NRX A;  2Y30 A;  4B3A A;  5FHP A;  4JYA T;  3VW1 A;  2PZ9 A;  3B6C A;  3H37 A;  5HXR A;  3TP3 A;  2IU5 A;  5K58 A;  1N36 T;  2V5C A;  5J1G A;  4P0A A;  1ZP0 A;  3ZYL A;  2FJB A;  4TUY E;  4ZEY A;  3CQX C;  4YSY A;  4YTN A;  2XAH B;  2XJ7 A;  3ZEF B;  2KXP B;  4DND A;  3FK7 A;  2I6H A;  2FQ4 A;  3ABV A;  4UV9 B;  2DWK A;  3ETV A;  2LEH A;  5F27 A;  4DV7 T;  5ABE A;  2PG8 A;  4HFI A;  5DQV A;  1KFY A;  2ZLY A;  2EHO D;  4MFR A;  4IST A;  3GWH A;  4LMJ A;  3GEU A;  5ETW A;  5CXI A;  3OYX A;  1G73 A;  3U78 A;  2WM9 A;  5H6R B;  3P9T A;  2J62 A;  2Q24 A;  2YVH A;  3HKE E;  3KV6 A;  5L3B B;  3C2B A;  3NWI A;  3C98 B;  4HKU A;  1BR4 A;  2VB6 A;  2NOX A;  5HAW A;  5FXX A;  3K3N A;  3A8Y C;  1KF6 A;  3V5U A;  3ZT6 A;  3KZ9 A;  5FKL A;  4PK6 A;  2UXD T;  5AQM B;  4EGW A;  3Q3S A;  1ORK A;  3DU5 A;  1W09 A;  4B1R A;  4PFP A;  3U3I A;  5LMN T;  3AVR A;  2WZH A;  3SRZ A;  3CVR A;  1LVF A;  1UUR A;  4DR7 T;  4O2B E;  2W61 A;  5L47 A;  3CWR A;  2B1E A;  1JT6 A;  3HTJ A;  2HXI A;  3OPC A;  2CBI A;  2XPV A;  2XSA A;  3N5L A;  4DID B;  4X66 T;  2IC6 A;  4DV5 T;  4AXP A;  4HEA A;  3FIW A;  5LHI B;  2LSI A;  3OVU A;  2YVE A;  3Q5D A;  2WBL A;  4MO7 A;  3Q9D A;  3QB5 K;  1MMN A;  3M65 A;  2BKN A;  2JMH A;  1N32 T;  2BVM A;  4IL4 A;  3DCF A;  4ZZB A;  2WZI A;  2XQ4 A;  3MJX A;  2WDQ A;  1VOM A;  5AQU B;  2Z6E A;  2Y6X A;  2X9X A;  3O1I A;  1T33 A;  2QTQ A;  5FVL A;  4YJ2 E;  4PJJ A;  3N9O A;  2V5D A;  3EHZ A;  1UUS A;  3KBU A;  2BKP A;  3BR6 A;  4B3R T;  4TWH A;  4I76 A;  5IUX A;  2W2U A;  3JAE A;  2X51 A;  4JL3 A;  4CZZ B;  3QNU A;  3UU3 A;  3RIU A;  2LKH A;  2ZOY A;  4LF9 T;  3LSV A;  3OYZ A;  4KI0 F;  1XMO T;  2BG9 B;  4HWH A;  3UT5 E;  2W53 A;  4MAL A;  1US7 B;  2V1D B;  2XGD A;  3CWZ B;  3FXD B;  3KKD A;  3IH3 A;  3F2E A;  2ZM2 A;  2HKU A;  2UXC T;  2HN2 A;  3Q0U A;  5JR9 C;  4I50 E;  4DUY T;  3T6N A;  2EHO B;  2OV9 A;  2BBH A;  3VR8 A;  4TV9 E;  3ON4 A;  1M7K A;  3O60 A;  3AE6 A;  5FXW A;  3K3O A;  5D1R A;  4WNK A;  3GN5 B;  2E9X D;  1T56 A;  3B81 A;  5D19 A;  5JTG A;  3ZYM A;  5LBM A;  2F07 A;  1J1J A;  2ZM0 A;  3CQG B;  4QHO A;  3NS4 A;  2NP9 A;  3CX7 B;  1Z0X A;  2JK3 A;  5HEO A;  3TLW A;  2MYS A;  3PJA A;  4CI2 B;  1T7S A;  4I55 E;  3IUV A;  5H6Q B;  3K8P C;  3KBT A;  4TNW A;  4CQI A;  5LMU T;  1W9R A;  4YHJ A;  5FXV A;  3HKC E;  5J1U A;  2LHN A;  2FUP A;  3C51 A;  3R84 B;  2JQH A;  2KSR A;  4HFV A;  4EZ4 A;  3C07 A;  1MNE A;  2Q9Q D;  4ASK A;  3KIN B;  3PTR B;  5F5W A;  3ZPO A;  3H3A A;  4L5G A;  3J9X 1;  3QPS A;  1UX4 A;  2H7O A;  5K7H A;  4G12 A;  2OLT A;  5CFB A;  2SPC A;  2ACX A;  1BR2 A;  2D9D A;  4AKL A;  2CBJ A;  1VCT A;  2XQ5 A;  3BHQ A;  2IEK A;  3AED A;  3NRY A;  4DV2 T;  4QX7 B;  5TAO A;  1YD8 G;  3N2O A;  3QC9 A;  2QKO A;  1VRB A;  3EUP A;  4D5C A;  4HTE A;  2UXH A;  2DLR A;  3VRB A;  4IL9 A;  4A5X A;  5CB4 E;  4IGU A;  3VKG A;  2WP9 A;  5FKK A;  3SFI A;  1KNP A;  2V6Y B;  3M3Z B;  5LGT B;  4G63 A;  4AC0 A;  3C4Z A;  2YDR A;  1HS7 A;  4GIW A;  4UDS A;  3O8G A;  5LJN A;  3ESL A;  2OI8 A;  2KZ7 B;  3JAD A;  2HQ5 A;  3B13 A;  4U9L A;  3KVA A;  3ETU A;  4LF4 T;  3BTC A;  5L4E A;  2G3B A;  1J5W A;  5CGM A;  3MXZ A;  2LOS A;  1T8B A;  3LBX B;  3TLS A;  5F8P A;  5FKY A;  4X1K E;  4B3S T;  5AQV B;  3UUB A;  4YFS A;  4ZS3 A;  2OER A;  2QGS A;  3QB5 A;  3QUJ A;  2WV1 A;  1X9B A;  2RAE A;  3L3P A;  4Z8X A;  3A7M A;  3B6A A;  3W15 B;  3C64 A;  5JDF A;  2HYJ A;  2RA1 A;  3AB3 B;  3WAK A;  3NVO A;  1HG5 A;  2X0L B;  3ANG A;  4XAX B;  2RPA A;  2LSJ A;  2DHR A;  4O8S A;  3NNR A;  1OED B;  4ANJ A;  1D1A A;  3LJL A;  4QKN A;  4C2M A;  5FY7 A;  5ABH A;  4YY3 T;  5AQC A;  2WS3 A;  2XAS B;  5J2U E;  4A56 A;  2FD5 A;  2XAF B;  3DU6 A;  2VKE A;  3V78 A;  3LK3 B;  3AEB A;  2NS7 A;  3BTJ A;  2FJI 1;  2R7Q A;  4U2Z A;  2YK0 A;  2R7T A;  3RH2 A;  3K3Q C;  3UU6 A;  1X79 A;  4AUX A;  5M4Y A;  3WI3 A;  1MIY A;  2G7L A;  1FEW A;  4YSX A;  2WY2 A;  4ILC A;  3G1M A;  3RIA A;  3I9Y A;  2QCO A;  4WYV A;  2NP5 A;  4YJ3 E;  1MMA A;  1RKW A;  2J47 A;  2ZY9 A;  2VKD A;  1IBM T;  5AQF B;  3ZQL A;  2ZMA A;  3F1B A;  1HCI A;  4HWC A;  5ABG A;  5DQW A;  5LGU B;  4TWD A;  3PUQ A;  5AQN B;  5JDM A;  5H9T A;  3RYH E;  2F4V T;  5HSZ A;  2XY8 B;  2OA5 A;  4H9P C;  3P4R A;  4HFD A;  4TZ4 C;  2K5B B;  2ZCX A;  3PV0 F;  3EDU A;  4PW8 A;  4GYR A;  2IBD A;  4D7N A;  3AEE A;  2K9A A;  5JVD E;  1JNZ A;  3CML A;  4KX6 A;  1WRD A;  3UUM A;  2NTY A;  4AQF A;  2G0E A;  4DR5 T;  3WAJ A;  4GYS A;  1YQ3 A;  3PPB A;  4A97 A;  1MND A;  3TLV A;  5LCY A;  3AA0 B;  1Z77 A;  2TRT A;  5JDL A;  5HCM A;  3AVS A;  2ODV A;  5KX5 E;  2HYT A;  3PUW F;  2VPR A;  4K0U A;  2CXF A;  3RI5 A;  1U5P A;  3RC8 A;  2G7G A;  1YXR A;  4ZHQ E;  4B3T T;  3ZSS A;  1QVT A;  3RX6 A;  3H3M A;  4TN7 B;  2EHO C;  3L8R A;  4DVY P;  4M3B A;  4QX8 B;  3DJB A;  3QQA A;  2VWA A;  1UI5 A;  2BG9 A;  4JYK A;  5FY0 A;  3BR0 A;  4UF0 B;  2M67 A;  3B57 A;  2NTX A;  3FK6 A;  1SA0 E;  2C0S A;  3MVP A;  5L3G B;  5AQR B;  3FZH B;  3UUN A;  1BR0 A;  3FB2 A;  3CJD A;  3RYC E;  4AQY T;  3HKB E;  4WIB A;  3ZCJ A;  4GCK A;  2R6G F;  5LP6 E;  2BG9 E;  4WW0 A;  2EHO A;  5IOY A;  1EZ3 A;  4ILU A;  3OBV E;  3ANW B;  2H3R A;  2EH3 A;  5IOZ A;  4YHH T;  5HAX A;  4GKK T;  5J1R A;  2XAJ B;  3GN5 A;  4OYJ A;  5JDQ A;  2WDV A;  3BRU A;  3EUH A;  3G7R A;  3VOX A;  3AAI A;  2ZCN A;  4EYY R;  3T1Y T;  3SFD A;  3VPR A;  3IBP A;  2QRX A;  3BQK A;  2E8I A;  4JUY A;  2XPW A;  4PAG A;  2X6O A;  3N2G E;  5HXC A;  4C91 A;  1NWM X;  2W66 A;  1IJ6 A;  2X9D A;  4IDZ A;  2OPT A;  3JC6 C;  2XRL A;  4UXN B;  1WYC A;  5GON E;  4JI6 T;  1HNX T;  3CRJ A;  2G0U A;  3IH2 A;  1N34 T;  3HR0 A;  4DV4 T;  2JJ7 A;  1HTJ F;  1ZKG A;  2R7R A;  3N2K E;  3DEW A;  2DL1 A;  2W62 A;  5KMG P;  2C5J A;  3OKQ A;  1XNR T;  4NEL A;  2A9U A;  3AEF A;  3Q5W A;  3AEG A;  1FJG T;  4HWD A;  5JH7 E;  5C3J A;  2CHN A;  1UK5 A;  2ODU A;  4U72 A;  2XTL A;  2UUB T;  2WQY A;  2XQ3 A;  3RKO A;  4YSZ A;  5K7F A;  2CMR A;  3BTI A;  3CDL A;  4QH4 A;  4DV0 T;  2W4X A;  2XGE A;  3MNL A;  1U9O A;  2HH7 A;  2FX0 A;  1D1C A;  3PUR A;  4TWF A;  2YIN A;  1SUM B;  2GK9 A;  2N1G A;  1R8I A;  3LFM A;  5EK4 A;  2VL0 A;  4JI8 T;  1LKX A;  3P4P A;  1E1H B;  1CUN A;  3V6G A;  3BJB A;  3UFG A;  2V6Y A;  4HFH A;  4DBQ A;  4O4L E;  2ZCM A;  3AA6 B;  5F0F A;  4ERR A;  4LF5 T;  2XQY A;  3NBX X;  5AQJ B;  5CJ5 A;  5IP6 A;  3RQW A;  5DAJ A;  2FJA A;  3DPJ A;  1SHZ C;  4PFO A;  4YXD A;  3LBX A;  1YKE B;  4UV8 B;  3RPU A;  3E0Z A;  3SWH A;  4ADZ A;  3C4X A;  4V1A v;  5JDH A;  1OED C;  2BS2 A;  3EAM A;  2PJQ A;  4X20 E;  3RIU C;  2NW7 A;  5HWY A;  4W1U A;  3RRC A;  4U2Y A;  3AE7 A;  3JAF A;  4DBR A;  3UU4 A;  3AE8 A;  2A3D A;  3GMI A;  3LSR A;  4C90 A;  2FBW A;  2V57 A;  2XHE B;  4KHP T;  2JJ9 A;  1BJZ A;  5EZG A;  2PTF A;  4ILB A;  1DU2 A;  2D0U A;  2R7W A;  2D2S A;  4I0U A;  5FMN A;  3PUZ F;  1OED A;  2UXX B;  3BQL A;  3N9L A;  4UVC B;  4IE6 A;  1FIO A;  2LT3 A;  3ZQH A;  4X64 T;  4JI0 T;  4IT4 A;  2PFV A;  5FNV E;  3KVB A;  1D1B A;  2FJE A;  4OHF A;  2KWH A;  3NZQ A;  4H9R C;  4DV1 T;  3P8C D;  2KMF A;  4TV8 E;  3UUX B;  4EEB A;  3J7Y q;  3BK9 A;  3DTO A;  3P4W A;  4QWN B;  3B5M A;  2O7T A;  1OED E;  5DAB A;  3I0O A;  2MOZ A;  4JI1 T;  1RPW A;  3BCG A;  3NKZ A;  4NXN T;  2HPJ A;  2TCT A;  3O4X E;  2XAG B;  5C2T A;  3CQC B;  3KNW A;  5LJM A;  3ZN0 B;  3O8H A;  1Z8U A;  4V2G A;  3JSJ A;  3FBZ A;  4X1I E;  3GZI A;  3P50 A;  4I6Z A;  4LFA T;  2UXU A;  3RC3 A;  3PU3 A;  4YT0 A;  1QPI A;  1G8X A;  5ADX L;  3SOL A;  4M3G A;  5IHY A;  1U4Q A;  3VKH A;  3RD3 A;  5AQP B;  2XPK A;  4HGA A;  5FGL A;  4EED A;  1MIV A;  5HEJ A;  1W0B A;  4JBW F;  2NX4 A;  2H88 A;  2QVA A;  1RKT A;  4H9N C;  4XK4 A;  1WYB A;  5LB7 B;  3FRQ A;  5J0Z A;  3RIF A;  5F1J A;  3CX8 B;  4JI7 T;  5L2L A;  1HNZ T;  1QSD A;  2W63 A;  4BJN A;  2CLY C;  5KDM C;  1LRZ A;  3O9X A;  2D5U A;  3G1L A;  3AE2 A;  4EXT A;  1XNQ T;  1T72 A;  4DMV A;  4LF8 T;  4LF6 T;  4GFL A;  3I9W A;  2BS3 A;  2CXD A;  3Q5E A;  3HA4 A;  3ZLI A;  3T1H T;  4J2C A;  5CXG A;  2XZE A;  2CEA A;  4BJM A;  4IDP A;  3KDS E;  3ZYK A;  5AQL B;  4U33 A;  1VI0 A;  3VW0 A;  4IE4 A;  4QXH B;  1WR6 A;  4UF0 A;  4DMW A;  4IDQ A;  3COL A;  1QLB A;  3T8O A;  2W67 A;  2JQK A;  5JDG A;  3N9P A;  2V7K A;  2YDS A;  3O1J A;  4CI3 B;  2DI4 A;  1HR0 T;  3ANW A;  1M62 A;  1IBK T;  2UXO A;  2CCQ A;  3GA8 A;  4FI5 A;  3E22 E;  4UEL A;  5IWA T;  1A6I A;  5CW8 A;  1E7P A;  1MIW A;  2IUB A;  3AAE B;  3F57 A;  3ZMU B;  3VIB A;  2H89 A;  4BA9 A;  1HX8 A;  1FMV A;  5FXZ A;  3BR5 A;  4DO0 A;  2E9X B;  3OTO T;  4CN4 A;  3UQ7 A;  5BR8 T;  3IA3 A;  2XQ9 A;  1XDO A;  5C4Y A;  5FL0 A;  2M6B A;  4BAY B;  3ZT5 A;  3TP0 A;  1NAF A;  2IC9 A;  3ANP A;  2KLQ A;  2L9Q A;  1Z0P A;  2LSY A;  3EVY A;  5LHH B;  4GCL A;  4U74 A;  2DG8 A;  4O4H E;  3Q2M A;  4H63 V;  3FXE B;  3FZM B;  1ZEE A;  4DUZ T;  1YW0 A;  2CWY A;  4NN1 A;  4IHJ E;  5HEG A;  3QPL A;  3LSJ A;  2I59 A;  4OFZ A;  2A72 A;  2VAS A;  3LG7 A;  2MTQ A;  4CXW A;  3ONX A;  2YVX A;  3AE1 A;  2IW5 B;  3EAB A;  5FYM A;  3KYL A;  1OWA A;  4X65 T;  4GK5 E;  2UXN B;  4ZI2 C;  4O2A E;  2Q9Q B;  4X1Y E;  2DNX A;  3CK6 A;  4ZI3 D;  2HHH T;  1JUM A;  4OD5 A;  2IHR 1;  2C5I T;  4GK0 E;  1ZOY A;  2ES0 A;  4AC6 A;  4OX9 T;  4TNV A;  3G56 A;  4V2F A;  4EIW A;  5F0C A;  2UUC T;  2DCF A;  4AQF C;  3C4W A;  4MBQ A;  2WSS V;  4U31 A;  2YKS A;  3G06 A;  2E5V A;  3EI0 A;  2A2F X;  5JRC B;  3R6N A;  2GBY A;  1Y01 A;  2WAU A;  3ZC0 A;  2AXD S;  2WDR A;  3PUX F;  5J3L A;  4G2A A;  3JCF A;  3ZMS B;  3ZKR A;  1JUS A;  2Y48 B;  3HTI A;  3IH4 A;  5JR9 B;  4HFB A;  3O1H A;  3BR3 A;  5IYZ E;  3S5R A;  4GCT A;  1QUU A;  4X62 T;  2MBG A;  3D0T A;  4L9I A;  4EYU A;  5AFU L;  2J4G A;  3VW2 A;  2BG9 C; 
#chains in the Genus database with same CATH homology
 4L0R A;  3ZN1 B;  5JR9 C;  3C50 A;  3IEE A;  5JH7 E;  4I50 E;  3RH3 A;  2EHO B;  1B7T A;  2ODU A;  2V7M A;  4TV9 E;  4U72 A;  2XTL A;  3CX6 B;  3PDY A;  1KNZ A;  3V5S A;  5FXW A;  3RKO A;  2CMR A;  1LVK A;  2X67 A;  3K3O A;  3MKD A;  3PUG A;  2NW8 A;  5DJQ C;  4AI6 A;  4WNK A;  3GN5 B;  2E9X D;  2YEV C;  2HH7 A;  1D1C A;  3PUR A;  2YIN A;  4NUV A;  3UTK A;  2GK9 A;  2LOP A;  2N1G A;  1MMD A;  3ZMZ B;  3ZYM A;  5LNK A;  3LFM A;  5EK4 A;  5LBM A;  4PJL A;  1LKX A;  2ZM0 A;  1E1H B;  1CUN A;  3CQG B;  4QHO A;  3NS4 A;  2NP9 A;  3LJC A;  5CA1 E;  4HE8 A;  5E0O A;  3CX7 B;  3UUL A;  4AKR B;  4H9O C;  4DBQ A;  3MA9 A;  2XUE A;  4O4L E;  4AKI A;  2R7X A;  3AA6 B;  2MYS A;  3N9N A;  4CI2 B;  4ERR A;  3HL6 A;  2XQY A;  4HKA A;  4I55 E;  3A5X A;  3ZMV B;  2J1D G;  4H9Q C;  1O3X A;  3FBL A;  3I0Q A;  3NBX X;  5H6Q B;  4GOU A;  5C8Y E;  3K8P C;  4UIG A;  5FP3 A;  3KBT A;  2LJL A;  4QXC B;  4CQI A;  2XAQ B;  3IF8 B;  4H9S E;  4YHJ A;  1SHZ C;  3IHR A;  2BZB A;  4PFO A;  5LBQ B;  2NWB A;  2KWI B;  4IE0 A;  3LBX A;  1S94 A;  1YKE B;  4UV8 B;  1KK7 A;  5FXV A;  3RPU A;  4JLE A;  3HKC E;  4FJO A;  1IZN B;  3E0Z A;  2WMN A;  5LXT E;  2VK9 A;  2V7J A;  2LHN A;  3C51 A;  4IE5 A;  3R84 B;  3SWH A;  4ADZ A;  3C4X A;  4V1A v;  4MHC A;  2CWO A;  4HFV A;  4EZ4 A;  4EB6 E;  1MNE A;  5JDH A;  3MZK B;  2Q9Q D;  2PJQ A;  2VKH A;  4ASK A;  3KIN B;  3MAC A;  4X20 E;  2C5K T;  2NW7 A;  4I4T E;  3PTR B;  3ZPO A;  2QA7 A;  1ZV4 X;  3H3A A;  4L5G A;  5HWY A;  3J9X 1;  1UX4 A;  3RRC A;  2H7O A;  4DBR A;  3LK2 B;  2LSK A;  2A3D A;  3GMI A;  2SPC A;  4C90 A;  2ACX A;  1BR2 A;  2DWG A;  4AKL A;  2XHE B;  2W0G A;  5EK3 A;  5L3E B;  2JJ9 A;  5F3J A;  3KV5 A;  4KP3 C;  3DP7 A;  3MK7 C;  3NRY A;  4B6X A;  4OD4 A;  4QX7 B;  3SS1 A;  1D0Y A;  5TAO A;  1YD8 G;  3N2O A;  3HI2 A;  3QC9 A;  4ISS A;  2D0U A;  2R7W A;  4YLH A;  2D2S A;  5FMN A;  3P7I A;  1VRB A;  4PK5 A;  4PNI A;  4OYK A;  2HPL A;  2UXX B;  3BQL A;  3N9L A;  4HTE A;  4O4I E;  4UVC B;  2DLR A;  4IE6 A;  4UVA B;  4XZC A;  1FIO A;  2LT3 A;  5CB4 E;  4IGU A;  4EZH A;  3VKG A;  2PFV A;  1HF8 A;  3KVB A;  1D1B A;  5FNV E;  3ZC1 A;  3NZQ A;  2KWH A;  2V7L A;  4H9R C;  4G63 A;  4OHF A;  5LGT B;  3P8C D;  3C4Z A;  2B3W A;  2KMF A;  3PU8 A;  4TV8 E;  3UUX B;  1HS7 A;  3AA1 B;  4M1P A;  3J7Y q;  3BK9 A;  3DTO A;  4GIW A;  4QWN B;  3KV4 A;  5LJN A;  3ESL A;  2KZ7 B;  5DAB A;  3I0O A;  5HXS A;  2MOZ A;  3B13 A;  2LE8 A;  2CE7 A;  3KVA A;  3ETU A;  2HPJ A;  4AKG A;  3I1A A;  3O4X E;  2XAG B;  2WWU A;  3ZJ2 A;  2JPF A;  3CQC B;  5HXE A;  5CA0 E;  3MXZ A;  2LOS A;  3LK4 2;  3LBX B;  5LJM A;  3ZN0 B;  5F8P A;  3PUS A;  4IIJ E;  5HYA A;  4X1K E;  1MMG A;  3FBZ A;  1WLX A;  4X1I E;  4YFS A;  4I43 B;  4ZS3 A;  2W00 A;  2QGS A;  3QUJ A;  5JQG E;  3L3P A;  4Z8X A;  3E08 A;  1V9D A;  1YKH B;  3VHL A;  5EZY E;  1T98 A;  3W15 B;  3C64 A;  5JDF A;  2RA1 A;  3RC3 A;  4OK0 A;  1HG2 A;  3AA7 B;  3PU3 A;  2IAK A;  2D0T A;  2KND A;  3AB3 B;  4KMC A;  4F6R C;  1G8X A;  2K48 A;  3HKD E;  5ADX L;  4PK4 A;  3SOL A;  2LHR A;  4JEU B;  3WAK A;  5IHY A;  1U4Q A;  3VKH A;  3QK6 A;  3AAA B;  2L3L A;  4KUM B;  1HG5 A;  4HGA A;  2X0L B;  1S35 A;  4PJN A;  3RYF E;  1D0Z A;  1MIV A;  4IE7 A;  4N78 D;  4XAX B;  3N9M A;  2LSJ A;  2DHR A;  2E9X C;  4ZI2 D;  3OJA A;  2BDE A;  4H9N C;  4O8S A;  2JQQ A;  3ZJ1 A;  2CLY B;  4AKH A;  2RP4 A;  3BQI A;  3ZMT B;  1WYB A;  4ANJ A;  3RRW A;  2YU2 A;  5J2T E;  4IRV A;  2L8K A;  1D1A A;  4WBO A;  4ZOL E;  4QKN A;  4C2M A;  2X9W A;  5FY7 A;  3CX8 B;  5L2L A;  2XAS B;  1QSD A;  2W63 A;  2X9H A;  4A56 A;  4BJN A;  5HWX A;  5J2U E;  2XAF B;  3DU6 A;  1ZKE A;  4HN9 A;  2R7U A;  2CLY C;  5KDM C;  1LRZ A;  3O9X A;  2CXL A;  1HFA A;  2H7V C;  2D5U A;  3EDV A;  3LK3 B;  4EXT A;  2FJI 1;  4DMV A;  3S4U A;  2N2N A;  2R7Q A;  2E9X A;  3RYI E;  2YK0 A;  2R7T A;  2R7V A;  5CQG A;  3CPZ A;  3I9W A;  4E7Z A;  3K3Q C;  1X79 A;  2NW9 A;  2YU1 A;  2CXD A;  3ZCI A;  2N9D A;  3FHN A;  3HA4 A;  3ZLI A;  5LYJ E;  5M4Y A;  4J2C A;  2Y8D A;  1AJ3 A;  3WI3 A;  2CEA A;  3JC6 D;  4BJM A;  5JDN A;  2P9B A;  3NRX A;  3KDS E;  3ZYK A;  1MIY A;  1FEW A;  2VKO A;  3N9Q A;  3I9Y A;  4IE4 A;  2Q9Q C;  3H37 A;  5HXR A;  4QXH B;  1WR6 A;  3L09 A;  4YJ3 E;  4UF0 A;  1MMA A;  5L3C B;  1BR1 A;  5J1G A;  2VKD A;  4DMW A;  4P0A A;  2ZMA A;  1HCI A;  3ZYL A;  5LA6 E;  1H7C A;  4TUY E;  3CQX C;  5LOV E;  1IAP A;  5DQW A;  2XAH B;  5LGU B;  5A1L A;  3ZEF B;  2KXP B;  4ZS2 A;  3T8O A;  3PUQ A;  5JDM A;  2ZM8 A;  5JDG A;  4DND A;  3RYH E;  3N9P A;  2V7K A;  2OA5 A;  4H9P C;  4TZ4 C;  2K5B B;  4UV9 B;  3EDU A;  4PW8 A;  4GYR A;  3O1J A;  4CI3 B;  2DI4 A;  2BVL A;  2DWK A;  5LGN B;  3ETV A;  3ANW A;  2LEH A;  2K9A A;  4ZI7 E;  5JVD E;  5LG4 A;  2Q9Q A;  2PG8 A;  2CCQ A;  2JRK A;  3CML A;  3GA8 A;  4FI5 A;  3VU7 H;  5DQV A;  1WRD A;  3UUM A;  2NTY A;  2KIN B;  4AQF A;  3E22 E;  1UCU A;  4UEL A;  4UVB B;  2ZLY A;  2LSG A;  2EHO D;  4MFR A;  4IST A;  3WAJ A;  3GWH A;  4GYS A;  1MIW A;  3AAE B;  4O4J E;  1MND A;  3F57 A;  3ZMU B;  5LCY A;  4BA9 A;  1HX8 A;  5ETW A;  1FMV A;  5FY1 A;  5FXZ A;  3AA0 B;  2JMK A;  3OYX A;  5JDL A;  1G73 A;  3U78 A;  2WM9 A;  4CXY A;  3AVS A;  4DO0 A;  5H6R B;  2E9X B;  2VL8 A;  2ODV A;  3PUA A;  5HXH A;  5KX5 E;  4H63 H;  4PJM A;  4K0U A;  2CXF A;  3HKE E;  2V7I A;  3KV6 A;  5L3B B;  1U5P A;  5JRC A;  3RC8 A;  2CM0 A;  5BMV E;  4BAY B;  4ZHQ E;  1UX5 A;  3C98 B;  3RX6 A;  2X66 A;  4TN7 B;  1NAF A;  2IC9 A;  2EHO C;  1BR4 A;  2VB6 A;  2KLQ A;  4DVY P;  2NOX A;  2L9Q A;  3KFW X;  3K3N A;  5FXX A;  1Z0P A;  4QX8 B;  2LM9 A;  2LSY A;  3EVY A;  3DJB A;  5LHH B;  3V5U A;  2VWA A;  2R7O A;  4AQG A;  5EK2 A;  4MLK A;  3CKD A;  4U74 A;  5FY0 A;  3F31 A;  3PE0 A;  4PK6 A;  4O4H E;  3Q2M A;  1IJ5 A;  4H63 V;  5JR9 A;  4UF0 B;  3FXE B;  2M67 A;  3B57 A;  2NTX A;  3DU5 A;  1ZEE A;  4XBF B;  1SA0 E;  2C0S A;  4PFP A;  3U3I A;  5L3G B;  4E7S A;  1YW0 A;  3AVR A;  4WBN E;  2CWY A;  4IHJ E;  3SRZ A;  3CVR A;  3UUN A;  1BR0 A;  5LHG B;  3FB2 A;  3KV9 A;  1LVF A;  3RYC E;  4OFZ A;  2CA5 A;  2I59 A;  2A72 A;  2VAS A;  3LG7 A;  2MTQ A;  4O2B E;  2W61 A;  4CXW A;  2X9Y A;  2KT9 A;  3HKB E;  2B1E A;  3ONX A;  3ZCJ A;  2X68 A;  2IW5 B;  3TKL B;  5L3D B;  5LP6 E;  2R7S A;  4WW0 A;  3KYL A;  1OWA A;  3N5L A;  5FYM A;  4GK5 E;  2EHO A;  2UXN B;  1EZ3 A;  2V26 A;  4ILU A;  4ZI2 C;  3OBV E;  2IC6 A;  3ANW B;  4AXP A;  4O2A E;  4HEA A;  5LHI B;  3VTI A;  2LSI A;  2Q9Q B;  2H3R A;  2DNX A;  4X1Y E;  2WBL A;  4ZI3 D;  3Q9D A;  5HAX A;  2VKJ A;  5JRE A;  2XAJ B;  3GN5 A;  4OD5 A;  4OYJ A;  5JDQ A;  1MMN A;  3M65 A;  2C5I T;  2JMH A;  4GK0 E;  2BVM A;  3EUH A;  2ES0 A;  3AAI A;  4CXX A;  4EYY R;  4KBM B;  4P0B A;  3Q5X A;  3IBP A;  4QXB B;  3MJX A;  1VOM A;  3BQK A;  4EIW A;  1Y64 B;  2E8I A;  4NUU A;  2Z6E A;  2DCF A;  2Y6X A;  4JUY A;  4PAG A;  2X9X A;  3O1I A;  3N2G E;  1D0X A;  4YJ2 E;  4AQF C;  5HXC A;  3C4W A;  4PJJ A;  2WMO A;  2WSS V;  3N9O A;  4MBQ A;  4EAH A;  4C91 A;  1NWM X;  3KBU A;  1IJ6 A;  4ZI3 C;  2A2F X;  5JRC B;  1ZHC A;  3R6N A;  4IDZ A;  2WAU A;  3ZC0 A;  3JC6 C;  2X51 A;  4CZZ B;  4UXN B;  3NZP A;  1WYC A;  5GON E;  3UFE A;  4G2A A;  2G0U A;  3OYZ A;  3ZMS B;  3HR0 A;  2Y48 B;  3UT5 E;  4DVD A;  1HTJ F;  5JR9 B;  4MAL A;  1US7 B;  2V1D B;  3O1H A;  2R7R A;  5IYZ E;  3N2K E;  4JEH B;  1OXZ A;  3CWZ B;  4UEM A;  1QUU A;  5L3F B;  4EOZ B;  2W62 A;  5KMG P;  3FXD B;  2MBG A;  3D0T A;  4L9I A;  3F2E A;  2C5J A;  2ZM2 A;  3OKQ A;  4P09 A;  4TX5 A;  4EYU A;  5AFU L;  1FMW A;  2PBI A;  2K24 A;  4CI1 B;  3Q5W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...