3SWHA

Munc13-1, mun domain, c-terminal module
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
316
structure length
295
Chain Sequence
b'AWFEPFVIQWLDENEEVSRDFLHGALERDKKDGFQQTSEHALFSCSVVDVFSQLNQSFEIIKKLECPDPQIVGHYMRRFAKTISNVLLQYADIVSKDFASYCSKEKEKVPCILMNNTQQLRVQLEKMFEAMGGKELDAEASGTLKELQVKLNNVLDELSHVFATSFQPHIEECVRQMGDILSQVKSVAQDADNVLQPIMDLLDSNLTLFAKICEKTVLKRVLKELWKLVMNTMERTIVLPPEFSKLKDHPKQCAVVELALDTIKQYFHAGGVGLKKTFLEKSPDLQSLRYALSLY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein unc-13 homolog A
publication title The Crystal Structure of a Munc13 C-terminal Module Exhibits a Remarkable Similarity to Vesicle Tethering Factors.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Exocytosis
total genus 130
structure length 295
sequence length 316
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10540 Membr_traf_MHD Munc13 (mammalian uncoordinated) homology domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.50 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor; domain 2 3swhA01
1.20.58.1100 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3swhA02
3SWHA 2FJI1
chains in the Genus database with same CATH superfamily
4O4IE 2NP9A 2R7RA 3HIMA 2Z6EA 3LSJA 4TUYE 2X9XA 2ZM2A 3AE9A 5HEHA 2W4XA 3SDGA 5JRCB 3KFWX 1KFYA 4WYVA 3ANGA 3OYXA 4YTMA 4Z8XA 4U2ZA 2LSGA 1J5WA 2L8KA 2PG8A 2XDNA 2TCTA 4NN1A 2JK3A 3OTOT 4AISA 4PXIA 3P4RA 1XMOT 3RH3A 4U3CA 2IC9A 2W2UA 1KF6A 2KLQA 3MZKB 2H7VC 3Q0UA 4OHFA 1Y01A 4CN1A 5GPCA 2LSYA 2DWGA 4KMCA 2XPUA 5FVLA 4WNKA 2UXCT 4AXPA 2LRKA 1LKXA 4LF6T 1D0XA 4UF0B 3NWIA 3ZQLA 2XAJB 3PV0F 2VPRA 3UQ4A 4U31A 1SHZC 1MIVA 2NR4A 3PU3A 5LA6E 2WV1A 3UU8A 5KX5E 5HEJA 2R7TA 2W62A 2CLYC 5HEUA 5CGMA 2NW7A 3CRJA 4GCTA 4NELA 5GP9A 3TLUA 2WSSV 5LHGB 2O7TA 5F08A 3W15B 1KNRA 2EH3A 3O1JA 3JCFA 3R6NA 2LSKA 4NUUA 4ABZA 3ZCJA 2ODUA 4U74A 3SOLA 4ADZA 4ZI7E 4P0AA 5L2LA 3C98B 3VVZA 1U9NA 4UELA 4MFRA 4E7ZA 5CFBA 5HXEA 2J62A 1I6ZA 4KX6A 2WDVA 3ZYLA 3PUGA 3V5SA 2CHOA 5GPAA 3PE0A 1Z0PA 2E5VA 2WGBA 3UU5A 1QSDA 4OX9T 5FKNA 5ABFA 4FI5A 2F4VT 4HKUA 5L4EA 2XQAA 2XPKA 3ZEFB 5F5WA 2LEHA 5IUXA 5DABA 4JLEA 4LMJA 3UUMA 2IIUA 3VKHA 4LFCT 4OYKA 1XWMA 2ES0A 3NZQA 2AE9A 5HWYA 4CXXA 2ZM6T 3I0QA 4HFBA 3EDUA 4Q25A 4YJ3E 2QVAA 3Q5WA 3NXCA 3PUYF 2A9UA 2LLYA 3HTAA 1A6IA 3TP0A 4ISSA 4UVAB 2OV9A 2YU2A 3N2KE 5AQOB 2CRBA 2LKGA 2DI4A 4V2GA 5DJQC 4AQGA 2R7SA 2DNXA 1ORKA 4D5FA 1T8BA 3KKDA 1ZV4X 1W9RA 2CEAA 2B3WA 5FMPA 4LF4T 1B7TA 2M6IA 3IUVA 3SRZA 2X0HA 3U3IA 3GMIA 4QWNB 3AE7A 4L0RA 2FUPA 2AXDS 2BDEA 5BMVE 4ME9A 2V7JA 4LF8T 1R8IA 2E9XC 3Q5DA 4TX5A 4ZOLE 3BR1A 4IDPA 4X1EA 2DCFA 5F0CA 3GWHA 5HXCA 4X5TA 3RC3A 3F31A 4QH4A 3QOFA 3BK9A 1T98A 3L8RA 4AKRB 4DR7T 3FB2A 2D5UA 1Z77A 4DR3T 4NIQA 2VL0A 2B76A 2X66A 2UUAT 3DJBA 5C8YE 4DIDB 3ZT5A 2MOZA 4ZZCA 1JUMA 3RIAA 4JI3T 4B3AA 3KV5A 3AB3B 3ANWB 3ESLA 3O60A 2VWAA 4H9NC 3RLFF 3JAEA 3E7QA 1O3XA 1UI5A 2WU2A 3VVYA 1HFAA 2LOSA 5JDFA 2YK0A 1N36T 4IL4A 1I94T 4EYUA 4XAXB 2Y2ZA 3MVPA 3ZSTA 2LOPA 4LFAT 2KNDA 2D6YA 2IAKA 3F2EA 4CGRA 3AEGA 3WAJA 2V8SV 3I9YA 1VRBA 3J9X1 4HWDA 1KEYA 5AQCA 3FK7A 3QKXA 2V7LA 1FIOA 4K0KT 4DV2T 5JR9C 3ZC0A 5CXIA 4YZEA 3C4WA 1UK5A 4XZCA 4NUVA 2IDOB 4YY3T 2FJI1 4QXHB 2J4GA 2XSBA 2UUCT 3AEAA 4IE6A 5JDLA 2JQHA 3EGQA 5JVDE 3ZYKA 2WUIA 4OD5A 2ODVA 1T7SA 3DU5A 4U33A 1D1CA 2V26A 2XJ7A 4AKLA 1MNDA 1QVUA 1SUMB 4QXBB 5JTGA 2BG9C 2ZCNA 3KBTA 1HS7A 3N9QA 2QKOA 4MO7A 2CXDA 4Z91A 1OWAA 2IU5A 3RX6A 2MTQA 4KI0F 5LHIB 1D1BA 4H63H 4L62A 2G7GA 3KZ9A 3FZLB 2V7KA 3AVSA 5LXTE 3L3PA 1U4QA 3F57A 2M67A 4AIUA 2CXLA 2W53A 3G7RA 3A5XA 2RASA 2E5LT 5H6RB 3RIUC 5A1LA 4TNWA 1Y64B 2VQFT 1WR0A 2VVSA 4BAYB 4JI2T 1SA0E 1V9DA 3I9WA 2WBLA 5HYAA 5HXRA 3EUPA 4PJMA 1IAPA 2BZBA 2YEVC 5F04A 1OEDC 2XHEB 3AEEA 3PUWF 3FZMB 4JI4T 3T6NA 1H7CA 3V5UA 2DWKA 2KXPB 4K0UA 5CXGA 3G1MA 4QH1A 3RD3A 3CVRA 2YU1A 5L3EB 3MXZA 4AC0A 2R6GF 2XGEA 4M3EA 4A56A 5F8PA 5J0ZA 3TLWA 4V1Av 3SFDA 3BCGA 4I76A 5J2UE 3ZQFA 5HSZA 3HR0A 3VU7H 4HGAA 3RPUA 2MYSA 5LMNT 5DQVA 3N9MA 1KK7A 3BHQA 3FZKB 2X0LB 3T1YT 2WM9A 5FKYA 2RAEA 3BTJA 5JDMA 2FJBA 3PUZF 2YVEA 4COFA 2CWYA 2GFNA 4WZXA 3RGLA 3PUQA 4IDZA 4EEDA 3BNIA 5KXJA 1X9BA 2CE7A 4TV8E 4KWAA 2Q9QB 4EYYR 2V57A 2XUEA 5HWXA 1NEKA 2LM9A 3IH3A 1XDOA 1XZYA 2XQ8A 2HPJA 2IMLA 3CDLA 2FD5A 4U7YA 2XAHB 2XY8B 4ILBA 5DQWA 1MNEA 4A98A 4N78D 3Q3SA 3Q5EA 3VW0A 2MBGA 1XMQT 2Q9QA 3P50A 3CMLA 4NXMT 5LHHB 4CN4A 2WDQA 3PASA 5AQKB 4D5CA 3ZQHA 3RQUA 1G8XA 1T56A 3ZQGA 1ZP0A 2JMKA 3C64A 4HFIA 4DMVA 3NNRA 3NI7A 2X68A 5HEGA 5HAWA 3LDQB 1WLXA 4W97A 4I4TE 4HE8A 3B6AA 3HGYA 4EGWA 1SE7A 2JQKA 2I10A 2O7OA 3PUAA 4DV5T 4UV9B 1JUSA 1MIYA 2VASA 3HKEE 3RF1A 3JAFA 5FKKA 1UURA 3NVOA 3IEEA 2BBJA 4AQFA 5L3BB 4DR5T 4TZ4C 3O8HA 2R7VA 2DHRA 2MPKA 3DEWA 4H9QC 3UQ7A 5JDGA 2PJQA 3EAMA 4Z90A 4HN9A 3ZMZB 5TAOA 3G1OA 5IWAT 2V6XA 2WY2A 3HTIA 4EIWA 2LKHA 4PAGA 2JQQA 4A97A 4DV6T 4DO0A 4DR1T 2XAGB 3KV6A 1T33A 3QB5A 4OK0A 4JUYA 1W09A 2V7IA 4AKGA 3N9OA 3NRGA 4HWFA 1ZKEA 4YT0A 2CCQA 5K58A 1MIWA 3ZN1B 5DAJA 1US7B 2VB6A 1HNWT 3TKLB 5LG4A 5FKMA 3BQIA 3EABA 3RH2A 3PUSA 2WU5A 5CB4E 2YDSA 2LJLA 2XQ6A 5F27A 3ETUA 5HCMA 2K9AA 3AA6B 2IW5B 2ZLYA 4M1PA 3P4SA 3ZLIA 2Q24A 4JL3A 4KHPT 2EHOB 2HKUA 5K7ZA 4P09A 4PW8A 5AQMB 3JC6D 3LK2B 2FBWA 2CA5A 5EZYE 4DV7T 4GFKA 3LOCA 2R7OA 3C51A 2P9BA 4X1IE 1JTXA 2XAQB 5LYJE 2HXIA 2NOXA 5LCYA 2EHOA 4JEHB 1UUSA 3WHBA 3ONJA 4U7IA 3C4XA 3B5MA 3EI0A 1U9OA 5ABFB 2X6OA 4GCLA 3DU6A 5LJMA 3PJAA 2QOPA 3B6CA 2KINB 5FGLA 1RPWA 5F0HA 2ACXA 4G2AA 4GIWA 2RHAA 3CK6A 2H88A 1L0VA 3J7Yq 1QUUA 2VURA 3VIBA 2XQ7A 5L3GB 3UUNA 4HEAA 3LSRA 3IF8B 4ANJA 3LSVA 2NTXA 4H9PC 2GBYA 5JDNA 4V2FA 3G56A 2WB5A 2YVXA 2F07A 4JV5T 5AQPB 3UTKA 3FHNA 4NXNT 3BR3A 4ZI2C 4CI2B 2YDRA 3CQXC 2R7UA 4ACIA 1X79A 3AAEB 3V6GA 2V5DA 3EUHA 2I6HA 3FK6A 5AQTB 2FJDA 5L47A 4CXYA 2XSAA 3QUJA 1E7PA 3OYZA 4EXTA 3HTJA 4MBQA 3PU8A 2L9QA 4KUMB 4O8SA 5KDMC 5IPAA 3O4XE 1E2AA 4U9NA 2KWHA 1Z8UA 2UXHA 3UU6A 3ZT7A 3LK42 5L3CB 3FXEB 3UFGA 2GK9A 4X1YE 5C3JA 3NRXA 1HCIA 5L3DB 2QGSA 4TWDA 4IDOA 4AKIA 5F0FA 1M7KA 5J1GA 3EVYA 3N9LA 3PTRB 1WR6A 3TLVA 2I0MA 2PBIA 2W67A 4P1NA 2H7OA 2XZEA 2K5BB 4ZXLA 2VL8A 3Q0VA 3UUXB 3LHQA 1S35A 4QX8B 3L39A 3RC8A 1JTYA 4UR9A 4BJNA 3AAIA 5HAXA 4PJLA 5AQFB 2XQ5A 2GENA 2D0UA 3RQWA 1W0BA 2OERA 3KV4A 4BJMA 2V7MA 3E08A 3ZN0B 3C50A 5AQJB 4B3RT 3SFEA 4GKJT 4D7MA 5LJNA 3KKCA 2K24A 2OLTA 2MAWA 5AQRB 2QTQA 4X66T 2REKA 3OKQA 3KBUA 4X65T 5LP6E 1YXRA 4IDQA 2JRKA 1RKWA 1UI6A 2Q9QD 3K3OA 1XNRT 2HH7A 1HNZT 3BTIA 2VKDA 3BR0A 3WHCA 4C2MA 3B13A 4LMLA 3RKGA 5AQGB 5FXWA 3UFEA 1YQ4A 2HYJA 4JYKA 3P4QA 3N2OA 3C2BA 2R7XA 3ON4A 2YKSA 4I55E 3RIUA 1BR2A 2D0TA 4AI6A 1MMDA 4A5XA 3IBPA 2XTLA 2YVHA 2NTYA 4PFPA 4X64T 4XK4A 2ZCXA 3QK6A 4DUYT 1N33T 4ZZBA 2I59A 2E2AA 3UT5E 4CN6A 4B6XA 1ZK8A 2ZCMA 4GYSA 4UV8B 2XQYA 4UEMA 2LE8A 4H63V 3LJLA 3K3NA 1XDPA 2FBQA 5AQSB 3K3QC 3JADA 3VR8A 2ZY9A 3NZPA 4IREA 3A7MA 3BJBA 4ZS2A 4DR6T 3BQYA 1SGMA 3E22E 4EZHA 4DR4T 3CPZA 4EOZB 5D19A 2DL1A 2LSIA 3Q2MA 2NS8A 3AE1A 3FBZA 1IZNB 2XQ9A 4LFBT 3PUVF 2Y48B 2CBIA 2VKEA 3ZYMA 1FMVA 4DW6A 5C4YA 5FHPA 4ISTA 4M3DA 4H9SE 1D0YA 3AA1B 3B57A 4TWHA 3OVUA 3VW2A 1W0AA 5JREA 2WZIA 5ABGA 4L9IA 2Y6XA 5ABEA 5AQLB 1EZ3A 2JIWA 3N9NA 2X67A 4PJNA 4HFHA 3MA9A 2KWIB 5CJ5A 2H3RA 3VOXA 2K48A 5L3FB 2W00A 3HL6A 4O4LE 2YDQA 3CX6B 4KP3C 4EEBA 3PDYA 3VPRA 2W63A 3IH2A 3GEUA 4IE4A 2UXIA 3ANPA 4J2CA 3HE0A 3AAAB 4IL9A 4UXNB 3X1DA 3RYCE 2HQ5A 4UVBB 5CA0E 3VHLA 2OF7A 2R7QA 2LSJA 4M3BA 3VOKA 2NX4A 4MXMA 2EHOD 3BQZA 5JDHA 1YW0A 2IC6A 2N9DA 2X51A 1HG5A 4PK5A 3KV9A 1BR0A 2LRLA 3N9PA 2JPFA 2XPWA 5EZGA 2QWTA 2J47A 1J1JA 3N2GE 2DLRA 1ZHCA 3H3AA 4I50E 3PM1A 3RKOA 4HWCA 2ZM8A 3NKZA 5J1YA 4DV1T 1FMWA 2VKVA 3UU3A 4ILCA 3MKDA 3AQSA 3Q5XA 4ILAA 5D1RA 4CI1B 5LNKA 2NW8A 3LFMA 4UIGA 3AEFA 4YJ2E 1DU2A 2HN1A 4JI1T 4IRVA 4MHCA 3LG7A 4ILUA 4DUZT 4IIJE 2CXFA 5LMUT 3BR6A 4AQYT 5J1RA 4PNIA 2BG9E 4IE7A 4DR2T 3E0ZA 2A2FX 2BKNA 5FL0A 2FX0A 1J5ET 3EHZA 2X9WA 1Z0XA 2HYTA 3FRQA 3UUBA 4GFLA 2B1EA 2C5IT 2LT3A 5AQUB 1UX4A 2ZM0A 5J3LA 4HTEA 1OXZA 3FIWA 3ETVA 3SWHA 4JKZA 3G06A 1D1AA 4UVCB 4HWHA 2N2NA 2FJAA 2CLYB 2UXBT 4W1UA 5IYZE 3HI2A 4HKAA 1WYCA 3GN5A 5AQIB 4JYAT 5FKLA 4QH5A 1MMNA 1OEDE 1KNZA 2D2SA 3AE3A 4IDNA 3PPBA 1HF8A 2DTZA 3SS1A 2SPCA 2CM0A 3MACA 2OI8A 3H3MA 4QKNA 4C91A 4CQIA 3RHWA 5F3JA 1JUPA 2G0UA 3F1BA 3O8GA 1S94A 3BTLA 2L3LA 2VQET 1WFDA 2IBDA 4PJJA 5EFYA 2WS3A 5FY1A 3ZMSB 3ONXA 3S5RA 4ZS3A 2Q9QC 2WZHA 2NS7A 2RPAA 4GK5E 2G7LA 3HA4A 4WW0A 5J2TE 4M3GA 2V6YA 4TN7B 3VTIA 4CXWA 3AA0B 4IE0A 4GOUA 3AEBA 2XB5A 3VUQA 3VKGA 4BA9A 2KT9A 3CWZB 3I0OA 4YSXA 4GKKT 2HN2A 1YD8G 1LVKA 2NP5A 1HNXT 5HXSA 3ZC1A 5JRCA 2QCOA 2XGDA 1MMGA 4O4HE 2FQ4A 2ID3A 2UXNB 2XRLA 4OFZA 1YKHB 5FL1A 3AXJB 2Y8DA 3AE4A 4AQFC 2JQ9A 5JQGE 2UXDT 4HWIB 3K8PC 2RP4A 1XNQT 1YQ3A 1LVFA 5KMGP 3RYIE 3QQAA 3ONLC 4UF0A 3AXJA 3VRAA 4ERRA 1YKEB 3CJDA 5E0OA 3LJCA 1UGOA 4TNVA 2IEKA 4ZI3D 2QYWA 2E9XB 3OJAA 2KMFA 2PBXA 3HTHA 1NENA 2WMOA 3DCFA 4DBRA 5H9TA 2NWBA 4IGUA 3AEDA 2WQYA 4PK6A 5LGUB 3RI5A 2PFVA 2E8IA 2CHNA 3CX8B 5FKOA 1WRDA 4B3ST 3NRYA 1M62A 5AQVB 5HCJA 2XM2A 2QA7A 4YLHA 2E9XA 4WBNE 4AC6A 5FMNA 3C07A 4UDSA 1JNRA 3ZCIA 1IBKT 4MALA 2QRXA 3P4PA 3P4WA 2CWOA 1IJ5A 4L5GA 2Y31A 5D18A 5EZHA 1LRZA 3GZIA 3QPLA 5IP6A 4JEUB 4AKHA 1HX1B 3KNWA 2JJ9A 4JBWF 4E7SA 1KNPA 4X62T 2CPTA 4HFDA 4KHZF 3ZMUB 4DV4T 5CQGA 2WCAA 4DMWA 3QB5K 5LGTB 3ZMTB 1FJGT 3BR5A 2X0YA 5IOZA 3UU4A 3LSPA 3MJXA 2VVNA 5LG3A 4YSZA 1CUNA 2JMHA 3QC9A 1HR0T 1ZEEA 5L4HA 3AE5A 2JJ7A 4MK6A 3K1SA 3ON2A 1D0ZA 2EHOC 4HFVA 3M65A 1N34T 2BKPA 2C0SA 3BT9A 3KVBA 1VCSA 5JDQA 3AECA 3WAKA 4EZ4A 4PFOA 3COLA 4JI6T 2NP3A 4QHOA 3HGGA 5EK3A 5JR9B 4P0BA 5ETWA 3TLSA 5LB7B 4JI0T 3V78A 4IHJE 4YHJA 5C2TA 3AE2A 2VKOA 1AJ3A 2N1GA 2M6BA 5ADXL 2XGCA 4GCKA 2G3BA 5F1JA 2OA5A 2KZ7B 2NW9A 4O2BE 3CKDA 2ZB9A 3ZSSA 5JR9A 1MMAA 3MK7C 4U9LA 1BR4A 2G0EA 2W66A 3S4UA 1VCTA 4G63A 2BG9B 3TLTA 3G1LA 2W0GA 3A8YC 2DG8A 3BTCA 4PK4A 1VI0A 5FXXA 3O1IA 3F0CA 3RRCA 5H6QB 3PUXF 4KBMB 2TRTA 4JI5T 4ASKA 1JT6A 2GUHA 2PZ9A 3QPSA 4YFSA 1BR1A 1QPIA 5M4YA 1QVTA 2BG9A 5FXZA 1HG2A 2J1DG 4XBFB 3ZJ2A 4YSYA 3QNUA 3GA8A 5ABHA 4ICHA 1BJZA 3HKDE 4B1RA 3NPIA 2BS4A 2ID6A 4JI8T 2YOEA 4DV0T 3UULA 1UX5A 3HKBE 3FBLA 3ZMVB 2FJEA 4I43B 1OEDB 2YN6A 2QIBA 4I0UA 4WBOA 3AE8A 5FYMA 3ANWA 3Q0WA 3VVXA 2ZMAA 1RKTA 4ZEYA 5FVKA 3P8CD 5AQNB 4CI3B 2UUBT 4G12A 3M3ZB 3AQTA 4YTPA 3NS4A 3ZPOA 1N32T 3OBVE 1IJ6A 1OEDA 3FXDB 2VK9A 5AFUL 3TP3A 2LM2A 3I1AA 2HHHT 2ZOYA 2XASB 4HFEA 3BQKA 4AF5A 4LMKA 1CHUA 4TV9E 5FY7A 2XAFB 4B3TT 2FJ1A 2WWUA 2ACZA 3RRWA 5FNVE 2BVMA 4WIBA 1WCRA 2UXPA 3BR2A 2WMNA 1ZOYA 4MLKA 3AA7B 3BRUA 5AQQB 2CBJA 1ZKGA 3CWRA 4DVDA 5BR8T 3AE6A 3R84B 3VRBA 5K7FA 2WWVA 2XQ4A 2A72A 3C4ZA 2LHNA 3DTOA 4IT4A 3VP5A 1JNZA 4ZHQE 2C5JA 5GONE 3H37A 4H9RC 2R7WA 3T8OA 2Y30A 4C90A 5LBMA 1IBLT 2YINA 3N5LA 5EK4A 4U72A 2HXOA 3QBMA 1JT0A 3JC6C 3O1HA 3JSJA 2CMRA 5EK2A 4JI7T 3DPJA 3ZT6A 4F6RC 4YXDA 4GK0E 5K7HA 1FEWA 4CZZB 4OD4A 5CA1E 4DVYP 4X20E 2H89A 3RYFE 2KSRA 3FZHB 1UCUA 4OYJA 4ZI2D 2XM1A 3HKCE 4LF7T 2ZOZA 4ZI3C 1NWMX 4H9OC 4U2YA 2UXUA 4EAHA 5LOVE 2BS3A 4X1KE 5IHYA 2WP9A 3P7IA 2G7SA 3PJAJ 5LGNB 4I6ZA 2VKJA 2X9HA 4QX7B 4HFCA 3VW1A 1HX8A 3LK3B 2W61A 3CX7B 4YHHT 2WAUA 3U78A 2X9YA 4LF9T 5HBUA 4DBQA 4IE5A 1G73A 2WDRA 4LF5T 3SFIA 3KDSE 2BBHA 2DG7A 3LBXB 3BQLA 3RYHE 1GQEA 2K3WA 3LWJA 4D7NA 4O2AE 3P9TA 4EV6A 3IHRA 4M3FA 4GYRA 4JNNA 1NAFA 2V1DB 3ZKRA 3CQCB 3MNLA 3FZFB 2UXOA 2D9DA 3OPCA 2E9XD 2HPLA 3Q9DA 4B3MT 3KINB 2X9DA 3EDVA 3LBXA 4F8HA 4FJOA 2VKHA 5IOYA 1QLBA 5EYRA 2BKOA 3CIRA 2A3DA 4DNDA 2IUBA 4YTNA 3IH4A 3B81A 5FP3A 2XQ3A 1E1HB 2C5KT 3ZQIA 5AQHB 2OPTA 3RIFA 1T72A 3CCYA 2BVLA 2V5CA 5HEOA 4O4JE 4QXCB 3GN5B 1VOMA 5JH7E 4NPPA 3NBXX 2XPVA 5HXHA 2IAIA 3ZJ1A 3KVAA 3T1HT 3DP7A 3AVRA 3CQGB 1U5PA 2RA1A 3IA3A 1IBMT 2PTFA 3L09A 4TWFA 2IHR1 2BS2A 5FXVA 4AUXA 4EB6E 3VR9A 4DV3T 3O9XA 3D0TA 2UU9T 5J1UA 5LBQB 5CW8A 2UXXB 5FY0A 3WI3A 1WYBA 2V6YB 3PURA 3KYLA 2LHRA 3ABVA 1HTJF
chains in the Genus database with same CATH topology
4L5GA 4O4IE 2NP9A 4V1Av 2R7RA 3B13A 1LRZA 5J2UE 4A56A 2Z6EA 4JEUB 5FXWA 4AKHA 3HR0A 3UFEA 4HGAA 3RPUA 3VU7H 2MYSA 4TUYE 2X9XA 5DQVA 2ZM2A 2JJ9A 3N2OA 3N9MA 1KK7A 4E7SA 2X0LB 2R7XA 5JRCB 2WM9A 4I55E 1BR2A 3KFWX 3ZMUB 5CQGA 2D0TA 4DMWA 5LGTB 4AI6A 1MMDA 3ZMTB 3IBPA 2XTLA 3OYXA 4Z8XA 5JDMA 2NTYA 4PFPA 3MJXA 2CWYA 2LSGA 1CUNA 2JMHA 3QC9A 3PUQA 3QK6A 1ZEEA 2L8KA 2PG8A 4IDZA 2I59A 3UT5E 4B6XA 4GYSA 3RH3A 1D0ZA 2EHOC 4HFVA 2CE7A 3M65A 4TV8E 2XQYA 2C0SA 2IC9A 2Q9QB 2LE8A 3KVBA 4UEMA 4UV8B 4EYYR 4H63V 2XUEA 2KLQA 3MZKB 3K3NA 5HWXA 5JDQA 2H7VC 3WAKA 4OHFA 4PFOA 4EZ4A 2LM9A 4QHOA 3K3QC 2HPJA 2LSYA 3NZPA 2DWGA 5EK3A 5JR9B 4P0BA 4KMCA 4ZS2A 5ETWA 4WNKA 4AXPA 1LKXA 1D0XA 2XAHB 4UF0B 3E22E 4IHJE 5DQWA 4EZHA 1MNEA 4YHJA 3CPZA 2VKOA 4EOZB 2XAJB 1AJ3A 2N1GA 4N78D 2LSIA 2MBGA 5ADXL 3Q2MA 1SHZC 3FBZA 1MIVA 1IZNB 2Q9QA 3PU3A 3CMLA 5LA6E 2Y48B 5LHHB 2OA5A 2KZ7B 3ZYMA 2NW9A 4O2BE 5KX5E 3CKDA 5JR9A 1FMVA 1MMAA 2R7TA 3MK7C 2W62A 4ISTA 2CLYC 1BR4A 4H9SE 1D0YA 3AA1B 2NW7A 3S4UA 3B57A 1G8XA 4G63A 5JREA 2WSSV 5LHGB 3C64A 2JMKA 4L9IA 4DMVA 2W0GA 2Y6XA 2X68A 4PK4A 1EZ3A 3N9NA 3W15B 2X67A 1WLXA 3O1IA 5FXXA 4I4TE 4PJNA 4HE8A 3RRCA 3O1JA 5H6QB 3R6NA 3MA9A 2LSKA 4NUUA 4KBMB 2KWIB 3ZCJA 2H3RA 2ODUA 4U74A 3SOLA 4ADZA 4ZI7E 4P0AA 3PUAA 5L2LA 3C98B 2K48A 4ASKA 5L3FB 2W00A 4UV9B 4UELA 4MFRA 4YFSA 1BR1A 4E7ZA 5HXEA 5M4YA 3HL6A 4KP3C 4O4LE 1MIYA 2VASA 3CX6B 3HKEE 3PDYA 5FXZA 2W63A 3ZYLA 4IE4A 3IEEA 4J2CA 3AAAB 1HG2A 3PUGA 4AQFA 5L3BB 2J1DG 3V5SA 4TZ4C 4XBFB 3ZJ2A 3GA8A 2R7VA 2DHRA 3HKDE 3PE0A 1Z0PA 4H9QC 4UXNB 3RYCE 1QSDA 5JDGA 4UVBB 5CA0E 3VHLA 4FI5A 2PJQA 2R7QA 2LSJA 4HN9A 3UULA 1UX5A 3HKBE 3ZMZB 3FBLA 5TAOA 3ZMVB 3ZEFB 4I43B 2LEHA 5DABA 4JLEA 4WBOA 2EHOD 5FYMA 3UUMA 3ANWA 5JDHA 1YW0A 2IC6A 2N9DA 2X51A 1HG5A 3VKHA 4EIWA 2ZMAA 4PAGA 4PK5A 2JQQA 4OYKA 3KV9A 4DO0A 1BR0A 2XAGB 3N9PA 3P8CD 2JPFA 4CI3B 2ES0A 3NZQA 3KV6A 4OK0A 3N2GE 4JUYA 2DLRA 2V7IA 1ZHCA 4AKGA 3H3AA 3NS4A 4I50E 3N9OA 5HWYA 4CXXA 3ZPOA 1ZKEA 3I0QA 3OBVE 3RKOA 2CCQA 1MIWA 1IJ6A 3ZN1B 3EDUA 1US7B 2ZM8A 2VB6A 3FXDB 2VK9A 4YJ3E 3Q5WA 5AFUL 3TKLB 5LG4A 1FMWA 3I1AA 2XASB 3BQKA 3BQIA 4ISSA 4UVAB 2YU2A 3MKDA 3N2KE 4TV9E 3PUSA 5FY7A 3Q5XA 2XAFB 5CB4E 2DI4A 2LJLA 2WWUA 4CI1B 5LNKA 5DJQC 4AQGA 2R7SA 3RRWA 2DNXA 2NW8A 3ETUA 5FNVE 2BVMA 1ZV4X 3AA6B 2K9AA 3LFMA 4UIGA 2IW5B 2CEAA 4YJ2E 2ZLYA 4M1PA 2WMNA 4MLKA 2B3WA 3ZLIA 3AA7B 4IRVA 4MHCA 1B7TA 3LG7A 4ILUA 4IIJE 2CXFA 3SRZA 2EHOB 3U3IA 4PNIA 4DVDA 3GMIA 4IE7A 4P09A 4PW8A 4QWNB 3JC6D 3LK2B 3R84B 2CA5A 5EZYE 4L0RA 2A72A 2BDEA 3C4ZA 2A2FX 3E0ZA 5BMVE 2LHNA 2V7JA 3DTOA 2R7OA 2E9XC 3C51A 2C5JA 4ZHQE 5GONE 2P9BA 3H37A 4H9RC 2R7WA 4X1IE 3T8OA 2XAQB 2X9WA 4TX5A 4ZOLE 5LYJE 4C90A 2NOXA 5LBMA 5LCYA 2YINA 3N5LA 2B1EA 2EHOA 2DCFA 3GWHA 5EK4A 2C5IT 2LT3A 1UX4A 4JEHB 5HXCA 3RC3A 4U72A 2ZM0A 3F31A 3JC6C 4HTEA 3BK9A 1OXZA 1T98A 4AKRB 3O1HA 3ETVA 2CMRA 3SWHA 3C4XA 3FB2A 2D5UA 5EK2A 1D1AA 4UVCB 2N2NA 2X66A 3DU6A 2CLYB 3DJBA 4F6RC 5C8YE 5LJMA 2MOZA 4GK0E 5IYZE 3HI2A 1FEWA 4HKAA 4CZZB 1WYCA 4OD4A 2KINB 5CA1E 3KV5A 3GN5A 4DVYP 3AB3B 3ANWB 4X20E 2ACXA 3ESLA 4G2AA 4GIWA 3RYFE 2VWAA 1MMNA 1KNZA 4H9NC 3J7Yq 2D2SA 1QUUA 1UCUA 4OYJA 4ZI2D 1HF8A 1O3XA 3HKCE 5L3GB 1HFAA 3UUNA 2LOSA 2SPCA 3IF8B 2CM0A 3MACA 4HEAA 3SS1A 4ZI3C 4ANJA 5F8PA 1NWMX 4H9OC 5JDFA 2YK0A 4QKNA 2NTXA 4EAHA 4H9PC 4C91A 4CQIA 5F3JA 4EYUA 5JDNA 5LOVE 4XAXB 2G0UA 4X1KE 5IHYA 3P7IA 1S94A 5LGNB 2VKJA 2X9HA 4QX7B 3UTKA 2LOPA 3FHNA 1HX8A 2KNDA 2L3LA 3F2EA 2IAKA 3LK3B 4ZI2C 2W61A 4CI2B 3CQXC 4PJJA 3WAJA 3I9YA 1VRBA 2R7UA 5FY1A 3ZMSB 3ONXA 3CX7B 1X79A 3AAEB 3J9X1 3EUHA 2WAUA 4ZS3A 3U78A 2Q9QC 2X9YA 4DBQA 4CXYA 2V7LA 4GK5E 1G73A 3HA4A 4IE5A 4WW0A 1FIOA 5J2TE 3KDSE 3QUJA 4TN7B 3VTIA 4CXWA 3OYZA 3LBXB 3BQLA 3AA0B 4IE0A 5JR9C 4EXTA 3ZC0A 4GOUA 3C4WA 3RYHE 4MBQA 3PU8A 2L9QA 4KUMB 4XZCA 4O8SA 4NUVA 3VKGA 5KDMC 4O2AE 3O4XE 4BA9A 2KT9A 3IHRA 3CWZB 3I0OA 2FJI1 4QXHB 2V1DB 4GYRA 1NAFA 1YD8G 3CQCB 2KWHA 1LVKA 4IE6A 2E9XD 2HPLA 5JDLA 3Q9DA 5HXSA 3ZC1A 5JVDE 3ZYKA 5JRCA 3KINB 4OD5A 2ODVA 3LK42 1MMGA 3FXEB 3DU5A 5L3CB 4O4HE 3EDVA 3LBXA 2GK9A 4X1YE 4FJOA 2VKHA 1D1CA 2V26A 2UXNB 3NRXA 4AKLA 1MNDA 1HCIA 4OFZA 5L3DB 4QXBB 2A3DA 4DNDA 2QGSA 1YKHB 4AKIA 3KBTA 1HS7A 2Y8DA 5J1GA 3N9QA 3EVYA 3N9LA 3PTRB 1WR6A 5FP3A 1E1HB 2C5KT 2CXDA 2PBIA 4AQFC 1OWAA 2H7OA 3RX6A 2MTQA 5LHIB 2K5BB 5JQGE 2BVLA 1D1BA 2VL8A 4H63H 3K8PC 2RP4A 3UUXB 4O4JE 4QXCB 1S35A 3GN5B 1LVFA 4QX8B 5KMGP 3RYIE 2V7KA 3AVSA 1VOMA 5LXTE 3L3PA 3RC8A 5JH7E 1U4QA 3F57A 4UF0A 3NBXX 4BJNA 2M67A 3AAIA 5HXHA 5HAXA 4PJLA 4ERRA 2CXLA 1YKEB 2D0UA 3A5XA 3ZJ1A 3KVAA 3KV4A 3DP7A 3AVRA 5E0OA 3LJCA 5H6RB 3CQGB 1U5PA 2RA1A 4BJMA 2V7MA 4ZI3D 3E08A 3ZN0B 2E9XB 3C50A 3OJAA 2KMFA 5A1LA 1Y64B 3L09A 5LJNA 2K24A 4BAYB 2WMOA 1SA0E 4DBRA 1V9DA 2NWBA 3I9WA 4IGUA 2WBLA 5FXVA 4PK6A 5HXRA 4EB6E 5HYAA 4PJMA 1IAPA 5LGUB 2BZBA 2PFVA 2E8IA 2YEVC 3O9XA 3CX8B 3OKQA 2XHEB 3KBUA 3D0TA 1WRDA 5LP6E 3NRYA 5LBQB 2JRKA 1H7CA 2QA7A 3V5UA 2DWKA 2KXPB 2Q9QD 4K0UA 4YLHA 2E9XA 3K3OA 4WBNE 2UXXB 5FMNA 5FY0A 2HH7A 3WI3A 3CVRA 1WYBA 2YU1A 2VKDA 3PURA 3ZCIA 3KYLA 5L3EB 3MXZA 4MALA 2LHRA 4C2MA 2CWOA 1IJ5A 1HTJF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SWH A;  2FJI 1; 
#chains in the Genus database with same CATH topology
 4O4I E;  2NP9 A;  2R7R A;  3HIM A;  2Z6E A;  3LSJ A;  4TUY E;  2X9X A;  2ZM2 A;  3AE9 A;  5HEH A;  2W4X A;  3SDG A;  5JRC B;  3KFW X;  1KFY A;  4WYV A;  3ANG A;  3OYX A;  4YTM A;  4Z8X A;  4U2Z A;  2LSG A;  1J5W A;  2L8K A;  2PG8 A;  2XDN A;  2TCT A;  4NN1 A;  2JK3 A;  3OTO T;  4AIS A;  4PXI A;  3P4R A;  1XMO T;  3RH3 A;  4U3C A;  2IC9 A;  2W2U A;  1KF6 A;  2KLQ A;  3MZK B;  2H7V C;  3Q0U A;  4OHF A;  1Y01 A;  4CN1 A;  5GPC A;  2LSY A;  2DWG A;  4KMC A;  2XPU A;  5FVL A;  4WNK A;  2UXC T;  4AXP A;  2LRK A;  1LKX A;  4LF6 T;  1D0X A;  4UF0 B;  3NWI A;  3ZQL A;  2XAJ B;  3PV0 F;  2VPR A;  3UQ4 A;  4U31 A;  1SHZ C;  1MIV A;  2NR4 A;  3PU3 A;  5LA6 E;  2WV1 A;  3UU8 A;  5KX5 E;  5HEJ A;  2R7T A;  2W62 A;  2CLY C;  5HEU A;  5CGM A;  2NW7 A;  3CRJ A;  4GCT A;  4NEL A;  5GP9 A;  3TLU A;  2WSS V;  5LHG B;  2O7T A;  5F08 A;  3W15 B;  1KNR A;  2EH3 A;  3O1J A;  3JCF A;  3R6N A;  2LSK A;  4NUU A;  4ABZ A;  3ZCJ A;  2ODU A;  4U74 A;  3SOL A;  4ADZ A;  4ZI7 E;  4P0A A;  5L2L A;  3C98 B;  3VVZ A;  1U9N A;  4UEL A;  4MFR A;  4E7Z A;  5CFB A;  5HXE A;  2J62 A;  1I6Z A;  4KX6 A;  2WDV A;  3ZYL A;  3PUG A;  3V5S A;  2CHO A;  5GPA A;  3PE0 A;  1Z0P A;  2E5V A;  2WGB A;  3UU5 A;  1QSD A;  4OX9 T;  5FKN A;  5ABF A;  4FI5 A;  2F4V T;  4HKU A;  5L4E A;  2XQA A;  2XPK A;  3ZEF B;  5F5W A;  2LEH A;  5IUX A;  5DAB A;  4JLE A;  4LMJ A;  3UUM A;  2IIU A;  3VKH A;  4LFC T;  4OYK A;  1XWM A;  2ES0 A;  3NZQ A;  2AE9 A;  5HWY A;  4CXX A;  2ZM6 T;  3I0Q A;  4HFB A;  3EDU A;  4Q25 A;  4YJ3 E;  2QVA A;  3Q5W A;  3NXC A;  3PUY F;  2A9U A;  2LLY A;  3HTA A;  1A6I A;  3TP0 A;  4ISS A;  4UVA B;  2OV9 A;  2YU2 A;  3N2K E;  5AQO B;  2CRB A;  2LKG A;  2DI4 A;  4V2G A;  5DJQ C;  4AQG A;  2R7S A;  2DNX A;  1ORK A;  4D5F A;  1T8B A;  3KKD A;  1ZV4 X;  1W9R A;  2CEA A;  2B3W A;  5FMP A;  4LF4 T;  1B7T A;  2M6I A;  3IUV A;  3SRZ A;  2X0H A;  3U3I A;  3GMI A;  4QWN B;  3AE7 A;  4L0R A;  2FUP A;  2AXD S;  2BDE A;  5BMV E;  4ME9 A;  2V7J A;  4LF8 T;  1R8I A;  2E9X C;  3Q5D A;  4TX5 A;  4ZOL E;  3BR1 A;  4IDP A;  4X1E A;  2DCF A;  5F0C A;  3GWH A;  5HXC A;  4X5T A;  3RC3 A;  3F31 A;  4QH4 A;  3QOF A;  3BK9 A;  1T98 A;  3L8R A;  4AKR B;  4DR7 T;  3FB2 A;  2D5U A;  1Z77 A;  4DR3 T;  4NIQ A;  2VL0 A;  2B76 A;  2X66 A;  2UUA T;  3DJB A;  5C8Y E;  4DID B;  3ZT5 A;  2MOZ A;  4ZZC A;  1JUM A;  3RIA A;  4JI3 T;  4B3A A;  3KV5 A;  3AB3 B;  3ANW B;  3ESL A;  3O60 A;  2VWA A;  4H9N C;  3RLF F;  3JAE A;  3E7Q A;  1O3X A;  1UI5 A;  2WU2 A;  3VVY A;  1HFA A;  2LOS A;  5JDF A;  2YK0 A;  1N36 T;  4IL4 A;  1I94 T;  4EYU A;  4XAX B;  2Y2Z A;  3MVP A;  3ZST A;  2LOP A;  4LFA T;  2KND A;  2D6Y A;  2IAK A;  3F2E A;  4CGR A;  3AEG A;  3WAJ A;  2V8S V;  3I9Y A;  1VRB A;  3J9X 1;  4HWD A;  1KEY A;  5AQC A;  3FK7 A;  3QKX A;  2V7L A;  1FIO A;  4K0K T;  4DV2 T;  5JR9 C;  3ZC0 A;  5CXI A;  4YZE A;  3C4W A;  1UK5 A;  4XZC A;  4NUV A;  2IDO B;  4YY3 T;  2FJI 1;  4QXH B;  2J4G A;  2XSB A;  2UUC T;  3AEA A;  4IE6 A;  5JDL A;  2JQH A;  3EGQ A;  5JVD E;  3ZYK A;  2WUI A;  4OD5 A;  2ODV A;  1T7S A;  3DU5 A;  4U33 A;  1D1C A;  2V26 A;  2XJ7 A;  4AKL A;  1MND A;  1QVU A;  1SUM B;  4QXB B;  5JTG A;  2BG9 C;  2ZCN A;  3KBT A;  1HS7 A;  3N9Q A;  2QKO A;  4MO7 A;  2CXD A;  4Z91 A;  1OWA A;  2IU5 A;  3RX6 A;  2MTQ A;  4KI0 F;  5LHI B;  1D1B A;  4H63 H;  4L62 A;  2G7G A;  3KZ9 A;  3FZL B;  2V7K A;  3AVS A;  5LXT E;  3L3P A;  1U4Q A;  3F57 A;  2M67 A;  4AIU A;  2CXL A;  2W53 A;  3G7R A;  3A5X A;  2RAS A;  2E5L T;  5H6R B;  3RIU C;  5A1L A;  4TNW A;  1Y64 B;  2VQF T;  1WR0 A;  2VVS A;  4BAY B;  4JI2 T;  1SA0 E;  1V9D A;  3I9W A;  2WBL A;  5HYA A;  5HXR A;  3EUP A;  4PJM A;  1IAP A;  2BZB A;  2YEV C;  5F04 A;  1OED C;  2XHE B;  3AEE A;  3PUW F;  3FZM B;  4JI4 T;  3T6N A;  1H7C A;  3V5U A;  2DWK A;  2KXP B;  4K0U A;  5CXG A;  3G1M A;  4QH1 A;  3RD3 A;  3CVR A;  2YU1 A;  5L3E B;  3MXZ A;  4AC0 A;  2R6G F;  2XGE A;  4M3E A;  4A56 A;  5F8P A;  5J0Z A;  3TLW A;  4V1A v;  3SFD A;  3BCG A;  4I76 A;  5J2U E;  3ZQF A;  5HSZ A;  3HR0 A;  3VU7 H;  4HGA A;  3RPU A;  2MYS A;  5LMN T;  5DQV A;  3N9M A;  1KK7 A;  3BHQ A;  3FZK B;  2X0L B;  3T1Y T;  2WM9 A;  5FKY A;  2RAE A;  3BTJ A;  5JDM A;  2FJB A;  3PUZ F;  2YVE A;  4COF A;  2CWY A;  2GFN A;  4WZX A;  3RGL A;  3PUQ A;  4IDZ A;  4EED A;  3BNI A;  5KXJ A;  1X9B A;  2CE7 A;  4TV8 E;  4KWA A;  2Q9Q B;  4EYY R;  2V57 A;  2XUE A;  5HWX A;  1NEK A;  2LM9 A;  3IH3 A;  1XDO A;  1XZY A;  2XQ8 A;  2HPJ A;  2IML A;  3CDL A;  2FD5 A;  4U7Y A;  2XAH B;  2XY8 B;  4ILB A;  5DQW A;  1MNE A;  4A98 A;  4N78 D;  3Q3S A;  3Q5E A;  3VW0 A;  2MBG A;  1XMQ T;  2Q9Q A;  3P50 A;  3CML A;  4NXM T;  5LHH B;  4CN4 A;  2WDQ A;  3PAS A;  5AQK B;  4D5C A;  3ZQH A;  3RQU A;  1G8X A;  1T56 A;  3ZQG A;  1ZP0 A;  2JMK A;  3C64 A;  4HFI A;  4DMV A;  3NNR A;  3NI7 A;  2X68 A;  5HEG A;  5HAW A;  3LDQ B;  1WLX A;  4W97 A;  4I4T E;  4HE8 A;  3B6A A;  3HGY A;  4EGW A;  1SE7 A;  2JQK A;  2I10 A;  2O7O A;  3PUA A;  4DV5 T;  4UV9 B;  1JUS A;  1MIY A;  2VAS A;  3HKE E;  3RF1 A;  3JAF A;  5FKK A;  1UUR A;  3NVO A;  3IEE A;  2BBJ A;  4AQF A;  5L3B B;  4DR5 T;  4TZ4 C;  3O8H A;  2R7V A;  2DHR A;  2MPK A;  3DEW A;  4H9Q C;  3UQ7 A;  5JDG A;  2PJQ A;  3EAM A;  4Z90 A;  4HN9 A;  3ZMZ B;  5TAO A;  3G1O A;  5IWA T;  2V6X A;  2WY2 A;  3HTI A;  4EIW A;  2LKH A;  4PAG A;  2JQQ A;  4A97 A;  4DV6 T;  4DO0 A;  4DR1 T;  2XAG B;  3KV6 A;  1T33 A;  3QB5 A;  4OK0 A;  4JUY A;  1W09 A;  2V7I A;  4AKG A;  3N9O A;  3NRG A;  4HWF A;  1ZKE A;  4YT0 A;  2CCQ A;  5K58 A;  1MIW A;  3ZN1 B;  5DAJ A;  1US7 B;  2VB6 A;  1HNW T;  3TKL B;  5LG4 A;  5FKM A;  3BQI A;  3EAB A;  3RH2 A;  3PUS A;  2WU5 A;  5CB4 E;  2YDS A;  2LJL A;  2XQ6 A;  5F27 A;  3ETU A;  5HCM A;  2K9A A;  3AA6 B;  2IW5 B;  2ZLY A;  4M1P A;  3P4S A;  3ZLI A;  2Q24 A;  4JL3 A;  4KHP T;  2EHO B;  2HKU A;  5K7Z A;  4P09 A;  4PW8 A;  5AQM B;  3JC6 D;  3LK2 B;  2FBW A;  2CA5 A;  5EZY E;  4DV7 T;  4GFK A;  3LOC A;  2R7O A;  3C51 A;  2P9B A;  4X1I E;  1JTX A;  2XAQ B;  5LYJ E;  2HXI A;  2NOX A;  5LCY A;  2EHO A;  4JEH B;  1UUS A;  3WHB A;  3ONJ A;  4U7I A;  3C4X A;  3B5M A;  3EI0 A;  1U9O A;  5ABF B;  2X6O A;  4GCL A;  3DU6 A;  5LJM A;  3PJA A;  2QOP A;  3B6C A;  2KIN B;  5FGL A;  1RPW A;  5F0H A;  2ACX A;  4G2A A;  4GIW A;  2RHA A;  3CK6 A;  2H88 A;  1L0V A;  3J7Y q;  1QUU A;  2VUR A;  3VIB A;  2XQ7 A;  5L3G B;  3UUN A;  4HEA A;  3LSR A;  3IF8 B;  4ANJ A;  3LSV A;  2NTX A;  4H9P C;  2GBY A;  5JDN A;  4V2F A;  3G56 A;  2WB5 A;  2YVX A;  2F07 A;  4JV5 T;  5AQP B;  3UTK A;  3FHN A;  4NXN T;  3BR3 A;  4ZI2 C;  4CI2 B;  2YDR A;  3CQX C;  2R7U A;  4ACI A;  1X79 A;  3AAE B;  3V6G A;  2V5D A;  3EUH A;  2I6H A;  3FK6 A;  5AQT B;  2FJD A;  5L47 A;  4CXY A;  2XSA A;  3QUJ A;  1E7P A;  3OYZ A;  4EXT A;  3HTJ A;  4MBQ A;  3PU8 A;  2L9Q A;  4KUM B;  4O8S A;  5KDM C;  5IPA A;  3O4X E;  1E2A A;  4U9N A;  2KWH A;  1Z8U A;  2UXH A;  3UU6 A;  3ZT7 A;  3LK4 2;  5L3C B;  3FXE B;  3UFG A;  2GK9 A;  4X1Y E;  5C3J A;  3NRX A;  1HCI A;  5L3D B;  2QGS A;  4TWD A;  4IDO A;  4AKI A;  5F0F A;  1M7K A;  5J1G A;  3EVY A;  3N9L A;  3PTR B;  1WR6 A;  3TLV A;  2I0M A;  2PBI A;  2W67 A;  4P1N A;  2H7O A;  2XZE A;  2K5B B;  4ZXL A;  2VL8 A;  3Q0V A;  3UUX B;  3LHQ A;  1S35 A;  4QX8 B;  3L39 A;  3RC8 A;  1JTY A;  4UR9 A;  4BJN A;  3AAI A;  5HAX A;  4PJL A;  5AQF B;  2XQ5 A;  2GEN A;  2D0U A;  3RQW A;  1W0B A;  2OER A;  3KV4 A;  4BJM A;  2V7M A;  3E08 A;  3ZN0 B;  3C50 A;  5AQJ B;  4B3R T;  3SFE A;  4GKJ T;  4D7M A;  5LJN A;  3KKC A;  2K24 A;  2OLT A;  2MAW A;  5AQR B;  2QTQ A;  4X66 T;  2REK A;  3OKQ A;  3KBU A;  4X65 T;  5LP6 E;  1YXR A;  4IDQ A;  2JRK A;  1RKW A;  1UI6 A;  2Q9Q D;  3K3O A;  1XNR T;  2HH7 A;  1HNZ T;  3BTI A;  2VKD A;  3BR0 A;  3WHC A;  4C2M A;  3B13 A;  4LML A;  3RKG A;  5AQG B;  5FXW A;  3UFE A;  1YQ4 A;  2HYJ A;  4JYK A;  3P4Q A;  3N2O A;  3C2B A;  2R7X A;  3ON4 A;  2YKS A;  4I55 E;  3RIU A;  1BR2 A;  2D0T A;  4AI6 A;  1MMD A;  4A5X A;  3IBP A;  2XTL A;  2YVH A;  2NTY A;  4PFP A;  4X64 T;  4XK4 A;  2ZCX A;  3QK6 A;  4DUY T;  1N33 T;  4ZZB A;  2I59 A;  2E2A A;  3UT5 E;  4CN6 A;  4B6X A;  1ZK8 A;  2ZCM A;  4GYS A;  4UV8 B;  2XQY A;  4UEM A;  2LE8 A;  4H63 V;  3LJL A;  3K3N A;  1XDP A;  2FBQ A;  5AQS B;  3K3Q C;  3JAD A;  3VR8 A;  2ZY9 A;  3NZP A;  4IRE A;  3A7M A;  3BJB A;  4ZS2 A;  4DR6 T;  3BQY A;  1SGM A;  3E22 E;  4EZH A;  4DR4 T;  3CPZ A;  4EOZ B;  5D19 A;  2DL1 A;  2LSI A;  3Q2M A;  2NS8 A;  3AE1 A;  3FBZ A;  1IZN B;  2XQ9 A;  4LFB T;  3PUV F;  2Y48 B;  2CBI A;  2VKE A;  3ZYM A;  1FMV A;  4DW6 A;  5C4Y A;  5FHP A;  4IST A;  4M3D A;  4H9S E;  1D0Y A;  3AA1 B;  3B57 A;  4TWH A;  3OVU A;  3VW2 A;  1W0A A;  5JRE A;  2WZI A;  5ABG A;  4L9I A;  2Y6X A;  5ABE A;  5AQL B;  1EZ3 A;  2JIW A;  3N9N A;  2X67 A;  4PJN A;  4HFH A;  3MA9 A;  2KWI B;  5CJ5 A;  2H3R A;  3VOX A;  2K48 A;  5L3F B;  2W00 A;  3HL6 A;  4O4L E;  2YDQ A;  3CX6 B;  4KP3 C;  4EEB A;  3PDY A;  3VPR A;  2W63 A;  3IH2 A;  3GEU A;  4IE4 A;  2UXI A;  3ANP A;  4J2C A;  3HE0 A;  3AAA B;  4IL9 A;  4UXN B;  3X1D A;  3RYC E;  2HQ5 A;  4UVB B;  5CA0 E;  3VHL A;  2OF7 A;  2R7Q A;  2LSJ A;  4M3B A;  3VOK A;  2NX4 A;  4MXM A;  2EHO D;  3BQZ A;  5JDH A;  1YW0 A;  2IC6 A;  2N9D A;  2X51 A;  1HG5 A;  4PK5 A;  3KV9 A;  1BR0 A;  2LRL A;  3N9P A;  2JPF A;  2XPW A;  5EZG A;  2QWT A;  2J47 A;  1J1J A;  3N2G E;  2DLR A;  1ZHC A;  3H3A A;  4I50 E;  3PM1 A;  3RKO A;  4HWC A;  2ZM8 A;  3NKZ A;  5J1Y A;  4DV1 T;  1FMW A;  2VKV A;  3UU3 A;  4ILC A;  3MKD A;  3AQS A;  3Q5X A;  4ILA A;  5D1R A;  4CI1 B;  5LNK A;  2NW8 A;  3LFM A;  4UIG A;  3AEF A;  4YJ2 E;  1DU2 A;  2HN1 A;  4JI1 T;  4IRV A;  4MHC A;  3LG7 A;  4ILU A;  4DUZ T;  4IIJ E;  2CXF A;  5LMU T;  3BR6 A;  4AQY T;  5J1R A;  4PNI A;  2BG9 E;  4IE7 A;  4DR2 T;  3E0Z A;  2A2F X;  2BKN A;  5FL0 A;  2FX0 A;  1J5E T;  3EHZ A;  2X9W A;  1Z0X A;  2HYT A;  3FRQ A;  3UUB A;  4GFL A;  2B1E A;  2C5I T;  2LT3 A;  5AQU B;  1UX4 A;  2ZM0 A;  5J3L A;  4HTE A;  1OXZ A;  3FIW A;  3ETV A;  3SWH A;  4JKZ A;  3G06 A;  1D1A A;  4UVC B;  4HWH A;  2N2N A;  2FJA A;  2CLY B;  2UXB T;  4W1U A;  5IYZ E;  3HI2 A;  4HKA A;  1WYC A;  3GN5 A;  5AQI B;  4JYA T;  5FKL A;  4QH5 A;  1MMN A;  1OED E;  1KNZ A;  2D2S A;  3AE3 A;  4IDN A;  3PPB A;  1HF8 A;  2DTZ A;  3SS1 A;  2SPC A;  2CM0 A;  3MAC A;  2OI8 A;  3H3M A;  4QKN A;  4C91 A;  4CQI A;  3RHW A;  5F3J A;  1JUP A;  2G0U A;  3F1B A;  3O8G A;  1S94 A;  3BTL A;  2L3L A;  2VQE T;  1WFD A;  2IBD A;  4PJJ A;  5EFY A;  2WS3 A;  5FY1 A;  3ZMS B;  3ONX A;  3S5R A;  4ZS3 A;  2Q9Q C;  2WZH A;  2NS7 A;  2RPA A;  4GK5 E;  2G7L A;  3HA4 A;  4WW0 A;  5J2T E;  4M3G A;  2V6Y A;  4TN7 B;  3VTI A;  4CXW A;  3AA0 B;  4IE0 A;  4GOU A;  3AEB A;  2XB5 A;  3VUQ A;  3VKG A;  4BA9 A;  2KT9 A;  3CWZ B;  3I0O A;  4YSX A;  4GKK T;  2HN2 A;  1YD8 G;  1LVK A;  2NP5 A;  1HNX T;  5HXS A;  3ZC1 A;  5JRC A;  2QCO A;  2XGD A;  1MMG A;  4O4H E;  2FQ4 A;  2ID3 A;  2UXN B;  2XRL A;  4OFZ A;  1YKH B;  5FL1 A;  3AXJ B;  2Y8D A;  3AE4 A;  4AQF C;  2JQ9 A;  5JQG E;  2UXD T;  4HWI B;  3K8P C;  2RP4 A;  1XNQ T;  1YQ3 A;  1LVF A;  5KMG P;  3RYI E;  3QQA A;  3ONL C;  4UF0 A;  3AXJ A;  3VRA A;  4ERR A;  1YKE B;  3CJD A;  5E0O A;  3LJC A;  1UGO A;  4TNV A;  2IEK A;  4ZI3 D;  2QYW A;  2E9X B;  3OJA A;  2KMF A;  2PBX A;  3HTH A;  1NEN A;  2WMO A;  3DCF A;  4DBR A;  5H9T A;  2NWB A;  4IGU A;  3AED A;  2WQY A;  4PK6 A;  5LGU B;  3RI5 A;  2PFV A;  2E8I A;  2CHN A;  3CX8 B;  5FKO A;  1WRD A;  4B3S T;  3NRY A;  1M62 A;  5AQV B;  5HCJ A;  2XM2 A;  2QA7 A;  4YLH A;  2E9X A;  4WBN E;  4AC6 A;  5FMN A;  3C07 A;  4UDS A;  1JNR A;  3ZCI A;  1IBK T;  4MAL A;  2QRX A;  3P4P A;  3P4W A;  2CWO A;  1IJ5 A;  4L5G A;  2Y31 A;  5D18 A;  5EZH A;  1LRZ A;  3GZI A;  3QPL A;  5IP6 A;  4JEU B;  4AKH A;  1HX1 B;  3KNW A;  2JJ9 A;  4JBW F;  4E7S A;  1KNP A;  4X62 T;  2CPT A;  4HFD A;  4KHZ F;  3ZMU B;  4DV4 T;  5CQG A;  2WCA A;  4DMW A;  3QB5 K;  5LGT B;  3ZMT B;  1FJG T;  3BR5 A;  2X0Y A;  5IOZ A;  3UU4 A;  3LSP A;  3MJX A;  2VVN A;  5LG3 A;  4YSZ A;  1CUN A;  2JMH A;  3QC9 A;  1HR0 T;  1ZEE A;  5L4H A;  3AE5 A;  2JJ7 A;  4MK6 A;  3K1S A;  3ON2 A;  1D0Z A;  2EHO C;  4HFV A;  3M65 A;  1N34 T;  2BKP A;  2C0S A;  3BT9 A;  3KVB A;  1VCS A;  5JDQ A;  3AEC A;  3WAK A;  4EZ4 A;  4PFO A;  3COL A;  4JI6 T;  2NP3 A;  4QHO A;  3HGG A;  5EK3 A;  5JR9 B;  4P0B A;  5ETW A;  3TLS A;  5LB7 B;  4JI0 T;  3V78 A;  4IHJ E;  4YHJ A;  5C2T A;  3AE2 A;  2VKO A;  1AJ3 A;  2N1G A;  2M6B A;  5ADX L;  2XGC A;  4GCK A;  2G3B A;  5F1J A;  2OA5 A;  2KZ7 B;  2NW9 A;  4O2B E;  3CKD A;  2ZB9 A;  3ZSS A;  5JR9 A;  1MMA A;  3MK7 C;  4U9L A;  1BR4 A;  2G0E A;  2W66 A;  3S4U A;  1VCT A;  4G63 A;  2BG9 B;  3TLT A;  3G1L A;  2W0G A;  3A8Y C;  2DG8 A;  3BTC A;  4PK4 A;  1VI0 A;  5FXX A;  3O1I A;  3F0C A;  3RRC A;  5H6Q B;  3PUX F;  4KBM B;  2TRT A;  4JI5 T;  4ASK A;  1JT6 A;  2GUH A;  2PZ9 A;  3QPS A;  4YFS A;  1BR1 A;  1QPI A;  5M4Y A;  1QVT A;  2BG9 A;  5FXZ A;  1HG2 A;  2J1D G;  4XBF B;  3ZJ2 A;  4YSY A;  3QNU A;  3GA8 A;  5ABH A;  4ICH A;  1BJZ A;  3HKD E;  4B1R A;  3NPI A;  2BS4 A;  2ID6 A;  4JI8 T;  2YOE A;  4DV0 T;  3UUL A;  1UX5 A;  3HKB E;  3FBL A;  3ZMV B;  2FJE A;  4I43 B;  1OED B;  2YN6 A;  2QIB A;  4I0U A;  4WBO A;  3AE8 A;  5FYM A;  3ANW A;  3Q0W A;  3VVX A;  2ZMA A;  1RKT A;  4ZEY A;  5FVK A;  3P8C D;  5AQN B;  4CI3 B;  2UUB T;  4G12 A;  3M3Z B;  3AQT A;  4YTP A;  3NS4 A;  3ZPO A;  1N32 T;  3OBV E;  1IJ6 A;  1OED A;  3FXD B;  2VK9 A;  5AFU L;  3TP3 A;  2LM2 A;  3I1A A;  2HHH T;  2ZOY A;  2XAS B;  4HFE A;  3BQK A;  4AF5 A;  4LMK A;  1CHU A;  4TV9 E;  5FY7 A;  2XAF B;  4B3T T;  2FJ1 A;  2WWU A;  2ACZ A;  3RRW A;  5FNV E;  2BVM A;  4WIB A;  1WCR A;  2UXP A;  3BR2 A;  2WMN A;  1ZOY A;  4MLK A;  3AA7 B;  3BRU A;  5AQQ B;  2CBJ A;  1ZKG A;  3CWR A;  4DVD A;  5BR8 T;  3AE6 A;  3R84 B;  3VRB A;  5K7F A;  2WWV A;  2XQ4 A;  2A72 A;  3C4Z A;  2LHN A;  3DTO A;  4IT4 A;  3VP5 A;  1JNZ A;  4ZHQ E;  2C5J A;  5GON E;  3H37 A;  4H9R C;  2R7W A;  3T8O A;  2Y30 A;  4C90 A;  5LBM A;  1IBL T;  2YIN A;  3N5L A;  5EK4 A;  4U72 A;  2HXO A;  3QBM A;  1JT0 A;  3JC6 C;  3O1H A;  3JSJ A;  2CMR A;  5EK2 A;  4JI7 T;  3DPJ A;  3ZT6 A;  4F6R C;  4YXD A;  4GK0 E;  5K7H A;  1FEW A;  4CZZ B;  4OD4 A;  5CA1 E;  4DVY P;  4X20 E;  2H89 A;  3RYF E;  2KSR A;  3FZH B;  1UCU A;  4OYJ A;  4ZI2 D;  2XM1 A;  3HKC E;  4LF7 T;  2ZOZ A;  4ZI3 C;  1NWM X;  4H9O C;  4U2Y A;  2UXU A;  4EAH A;  5LOV E;  2BS3 A;  4X1K E;  5IHY A;  2WP9 A;  3P7I A;  2G7S A;  3PJA J;  5LGN B;  4I6Z A;  2VKJ A;  2X9H A;  4QX7 B;  4HFC A;  3VW1 A;  1HX8 A;  3LK3 B;  2W61 A;  3CX7 B;  4YHH T;  2WAU A;  3U78 A;  2X9Y A;  4LF9 T;  5HBU A;  4DBQ A;  4IE5 A;  1G73 A;  2WDR A;  4LF5 T;  3SFI A;  3KDS E;  2BBH A;  2DG7 A;  3LBX B;  3BQL A;  3RYH E;  1GQE A;  2K3W A;  3LWJ A;  4D7N A;  4O2A E;  3P9T A;  4EV6 A;  3IHR A;  4M3F A;  4GYR A;  4JNN A;  1NAF A;  2V1D B;  3ZKR A;  3CQC B;  3MNL A;  3FZF B;  2UXO A;  2D9D A;  3OPC A;  2E9X D;  2HPL A;  3Q9D A;  4B3M T;  3KIN B;  2X9D A;  3EDV A;  3LBX A;  4F8H A;  4FJO A;  2VKH A;  5IOY A;  1QLB A;  5EYR A;  2BKO A;  3CIR A;  2A3D A;  4DND A;  2IUB A;  4YTN A;  3IH4 A;  3B81 A;  5FP3 A;  2XQ3 A;  1E1H B;  2C5K T;  3ZQI A;  5AQH B;  2OPT A;  3RIF A;  1T72 A;  3CCY A;  2BVL A;  2V5C A;  5HEO A;  4O4J E;  4QXC B;  3GN5 B;  1VOM A;  5JH7 E;  4NPP A;  3NBX X;  2XPV A;  5HXH A;  2IAI A;  3ZJ1 A;  3KVA A;  3T1H T;  3DP7 A;  3AVR A;  3CQG B;  1U5P A;  2RA1 A;  3IA3 A;  1IBM T;  2PTF A;  3L09 A;  4TWF A;  2IHR 1;  2BS2 A;  5FXV A;  4AUX A;  4EB6 E;  3VR9 A;  4DV3 T;  3O9X A;  3D0T A;  2UU9 T;  5J1U A;  5LBQ B;  5CW8 A;  2UXX B;  5FY0 A;  3WI3 A;  1WYB A;  2V6Y B;  3PUR A;  3KYL A;  2LHR A;  3ABV A;  1HTJ F; 
#chains in the Genus database with same CATH homology
 4L5G A;  4O4I E;  2NP9 A;  4V1A v;  2R7R A;  3B13 A;  1LRZ A;  5J2U E;  4A56 A;  2Z6E A;  4JEU B;  5FXW A;  4AKH A;  3HR0 A;  3UFE A;  4HGA A;  3RPU A;  3VU7 H;  2MYS A;  4TUY E;  2X9X A;  5DQV A;  2ZM2 A;  2JJ9 A;  3N2O A;  3N9M A;  1KK7 A;  4E7S A;  2X0L B;  2R7X A;  5JRC B;  2WM9 A;  4I55 E;  1BR2 A;  3KFW X;  3ZMU B;  5CQG A;  2D0T A;  4DMW A;  5LGT B;  4AI6 A;  1MMD A;  3ZMT B;  3IBP A;  2XTL A;  3OYX A;  4Z8X A;  5JDM A;  2NTY A;  4PFP A;  3MJX A;  2CWY A;  2LSG A;  1CUN A;  2JMH A;  3QC9 A;  3PUQ A;  3QK6 A;  1ZEE A;  2L8K A;  2PG8 A;  4IDZ A;  2I59 A;  3UT5 E;  4B6X A;  4GYS A;  3RH3 A;  1D0Z A;  2EHO C;  4HFV A;  2CE7 A;  3M65 A;  4TV8 E;  2XQY A;  2C0S A;  2IC9 A;  2Q9Q B;  2LE8 A;  3KVB A;  4UEM A;  4UV8 B;  4EYY R;  4H63 V;  2XUE A;  2KLQ A;  3MZK B;  3K3N A;  5HWX A;  5JDQ A;  2H7V C;  3WAK A;  4OHF A;  4PFO A;  4EZ4 A;  2LM9 A;  4QHO A;  3K3Q C;  2HPJ A;  2LSY A;  3NZP A;  2DWG A;  5EK3 A;  5JR9 B;  4P0B A;  4KMC A;  4ZS2 A;  5ETW A;  4WNK A;  4AXP A;  1LKX A;  1D0X A;  2XAH B;  4UF0 B;  3E22 E;  4IHJ E;  5DQW A;  4EZH A;  1MNE A;  4YHJ A;  3CPZ A;  2VKO A;  4EOZ B;  2XAJ B;  1AJ3 A;  2N1G A;  4N78 D;  2LSI A;  2MBG A;  5ADX L;  3Q2M A;  1SHZ C;  3FBZ A;  1MIV A;  1IZN B;  2Q9Q A;  3PU3 A;  3CML A;  5LA6 E;  2Y48 B;  5LHH B;  2OA5 A;  2KZ7 B;  3ZYM A;  2NW9 A;  4O2B E;  5KX5 E;  3CKD A;  5JR9 A;  1FMV A;  1MMA A;  2R7T A;  3MK7 C;  2W62 A;  4IST A;  2CLY C;  1BR4 A;  4H9S E;  1D0Y A;  3AA1 B;  2NW7 A;  3S4U A;  3B57 A;  1G8X A;  4G63 A;  5JRE A;  2WSS V;  5LHG B;  3C64 A;  2JMK A;  4L9I A;  4DMV A;  2W0G A;  2Y6X A;  2X68 A;  4PK4 A;  1EZ3 A;  3N9N A;  3W15 B;  2X67 A;  1WLX A;  3O1I A;  5FXX A;  4I4T E;  4PJN A;  4HE8 A;  3RRC A;  3O1J A;  5H6Q B;  3R6N A;  3MA9 A;  2LSK A;  4NUU A;  4KBM B;  2KWI B;  3ZCJ A;  2H3R A;  2ODU A;  4U74 A;  3SOL A;  4ADZ A;  4ZI7 E;  4P0A A;  3PUA A;  5L2L A;  3C98 B;  2K48 A;  4ASK A;  5L3F B;  2W00 A;  4UV9 B;  4UEL A;  4MFR A;  4YFS A;  1BR1 A;  4E7Z A;  5HXE A;  5M4Y A;  3HL6 A;  4KP3 C;  4O4L E;  1MIY A;  2VAS A;  3CX6 B;  3HKE E;  3PDY A;  5FXZ A;  2W63 A;  3ZYL A;  4IE4 A;  3IEE A;  4J2C A;  3AAA B;  1HG2 A;  3PUG A;  4AQF A;  5L3B B;  2J1D G;  3V5S A;  4TZ4 C;  4XBF B;  3ZJ2 A;  3GA8 A;  2R7V A;  2DHR A;  3HKD E;  3PE0 A;  1Z0P A;  4H9Q C;  4UXN B;  3RYC E;  1QSD A;  5JDG A;  4UVB B;  5CA0 E;  3VHL A;  4FI5 A;  2PJQ A;  2R7Q A;  2LSJ A;  4HN9 A;  3UUL A;  1UX5 A;  3HKB E;  3ZMZ B;  3FBL A;  5TAO A;  3ZMV B;  3ZEF B;  4I43 B;  2LEH A;  5DAB A;  4JLE A;  4WBO A;  2EHO D;  5FYM A;  3UUM A;  3ANW A;  5JDH A;  1YW0 A;  2IC6 A;  2N9D A;  2X51 A;  1HG5 A;  3VKH A;  4EIW A;  2ZMA A;  4PAG A;  4PK5 A;  2JQQ A;  4OYK A;  3KV9 A;  4DO0 A;  1BR0 A;  2XAG B;  3N9P A;  3P8C D;  2JPF A;  4CI3 B;  2ES0 A;  3NZQ A;  3KV6 A;  4OK0 A;  3N2G E;  4JUY A;  2DLR A;  2V7I A;  1ZHC A;  4AKG A;  3H3A A;  3NS4 A;  4I50 E;  3N9O A;  5HWY A;  4CXX A;  3ZPO A;  1ZKE A;  3I0Q A;  3OBV E;  3RKO A;  2CCQ A;  1MIW A;  1IJ6 A;  3ZN1 B;  3EDU A;  1US7 B;  2ZM8 A;  2VB6 A;  3FXD B;  2VK9 A;  4YJ3 E;  3Q5W A;  5AFU L;  3TKL B;  5LG4 A;  1FMW A;  3I1A A;  2XAS B;  3BQK A;  3BQI A;  4ISS A;  4UVA B;  2YU2 A;  3MKD A;  3N2K E;  4TV9 E;  3PUS A;  5FY7 A;  3Q5X A;  2XAF B;  5CB4 E;  2DI4 A;  2LJL A;  2WWU A;  4CI1 B;  5LNK A;  5DJQ C;  4AQG A;  2R7S A;  3RRW A;  2DNX A;  2NW8 A;  3ETU A;  5FNV E;  2BVM A;  1ZV4 X;  3AA6 B;  2K9A A;  3LFM A;  4UIG A;  2IW5 B;  2CEA A;  4YJ2 E;  2ZLY A;  4M1P A;  2WMN A;  4MLK A;  2B3W A;  3ZLI A;  3AA7 B;  4IRV A;  4MHC A;  1B7T A;  3LG7 A;  4ILU A;  4IIJ E;  2CXF A;  3SRZ A;  2EHO B;  3U3I A;  4PNI A;  4DVD A;  3GMI A;  4IE7 A;  4P09 A;  4PW8 A;  4QWN B;  3JC6 D;  3LK2 B;  3R84 B;  2CA5 A;  5EZY E;  4L0R A;  2A72 A;  2BDE A;  3C4Z A;  2A2F X;  3E0Z A;  5BMV E;  2LHN A;  2V7J A;  3DTO A;  2R7O A;  2E9X C;  3C51 A;  2C5J A;  4ZHQ E;  5GON E;  2P9B A;  3H37 A;  4H9R C;  2R7W A;  4X1I E;  3T8O A;  2XAQ B;  2X9W A;  4TX5 A;  4ZOL E;  5LYJ E;  4C90 A;  2NOX A;  5LBM A;  5LCY A;  2YIN A;  3N5L A;  2B1E A;  2EHO A;  2DCF A;  3GWH A;  5EK4 A;  2C5I T;  2LT3 A;  1UX4 A;  4JEH B;  5HXC A;  3RC3 A;  4U72 A;  2ZM0 A;  3F31 A;  3JC6 C;  4HTE A;  3BK9 A;  1OXZ A;  1T98 A;  4AKR B;  3O1H A;  3ETV A;  2CMR A;  3SWH A;  3C4X A;  3FB2 A;  2D5U A;  5EK2 A;  1D1A A;  4UVC B;  2N2N A;  2X66 A;  3DU6 A;  2CLY B;  3DJB A;  4F6R C;  5C8Y E;  5LJM A;  2MOZ A;  4GK0 E;  5IYZ E;  3HI2 A;  1FEW A;  4HKA A;  4CZZ B;  1WYC A;  4OD4 A;  2KIN B;  5CA1 E;  3KV5 A;  3GN5 A;  4DVY P;  3AB3 B;  3ANW B;  4X20 E;  2ACX A;  3ESL A;  4G2A A;  4GIW A;  3RYF E;  2VWA A;  1MMN A;  1KNZ A;  4H9N C;  3J7Y q;  2D2S A;  1QUU A;  1UCU A;  4OYJ A;  4ZI2 D;  1HF8 A;  1O3X A;  3HKC E;  5L3G B;  1HFA A;  3UUN A;  2LOS A;  2SPC A;  3IF8 B;  2CM0 A;  3MAC A;  4HEA A;  3SS1 A;  4ZI3 C;  4ANJ A;  5F8P A;  1NWM X;  4H9O C;  5JDF A;  2YK0 A;  4QKN A;  2NTX A;  4EAH A;  4H9P C;  4C91 A;  4CQI A;  5F3J A;  4EYU A;  5JDN A;  5LOV E;  4XAX B;  2G0U A;  4X1K E;  5IHY A;  3P7I A;  1S94 A;  5LGN B;  2VKJ A;  2X9H A;  4QX7 B;  3UTK A;  2LOP A;  3FHN A;  1HX8 A;  2KND A;  2L3L A;  3F2E A;  2IAK A;  3LK3 B;  4ZI2 C;  2W61 A;  4CI2 B;  3CQX C;  4PJJ A;  3WAJ A;  3I9Y A;  1VRB A;  2R7U A;  5FY1 A;  3ZMS B;  3ONX A;  3CX7 B;  1X79 A;  3AAE B;  3J9X 1;  3EUH A;  2WAU A;  4ZS3 A;  3U78 A;  2Q9Q C;  2X9Y A;  4DBQ A;  4CXY A;  2V7L A;  4GK5 E;  1G73 A;  3HA4 A;  4IE5 A;  4WW0 A;  1FIO A;  5J2T E;  3KDS E;  3QUJ A;  4TN7 B;  3VTI A;  4CXW A;  3OYZ A;  3LBX B;  3BQL A;  3AA0 B;  4IE0 A;  5JR9 C;  4EXT A;  3ZC0 A;  4GOU A;  3C4W A;  3RYH E;  4MBQ A;  3PU8 A;  2L9Q A;  4KUM B;  4XZC A;  4O8S A;  4NUV A;  3VKG A;  5KDM C;  4O2A E;  3O4X E;  4BA9 A;  2KT9 A;  3IHR A;  3CWZ B;  3I0O A;  2FJI 1;  4QXH B;  2V1D B;  4GYR A;  1NAF A;  1YD8 G;  3CQC B;  2KWH A;  1LVK A;  4IE6 A;  2E9X D;  2HPL A;  5JDL A;  3Q9D A;  5HXS A;  3ZC1 A;  5JVD E;  3ZYK A;  5JRC A;  3KIN B;  4OD5 A;  2ODV A;  3LK4 2;  1MMG A;  3FXE B;  3DU5 A;  5L3C B;  4O4H E;  3EDV A;  3LBX A;  2GK9 A;  4X1Y E;  4FJO A;  2VKH A;  1D1C A;  2V26 A;  2UXN B;  3NRX A;  4AKL A;  1MND A;  1HCI A;  4OFZ A;  5L3D B;  4QXB B;  2A3D A;  4DND A;  2QGS A;  1YKH B;  4AKI A;  3KBT A;  1HS7 A;  2Y8D A;  5J1G A;  3N9Q A;  3EVY A;  3N9L A;  3PTR B;  1WR6 A;  5FP3 A;  1E1H B;  2C5K T;  2CXD A;  2PBI A;  4AQF C;  1OWA A;  2H7O A;  3RX6 A;  2MTQ A;  5LHI B;  2K5B B;  5JQG E;  2BVL A;  1D1B A;  2VL8 A;  4H63 H;  3K8P C;  2RP4 A;  3UUX B;  4O4J E;  4QXC B;  1S35 A;  3GN5 B;  1LVF A;  4QX8 B;  5KMG P;  3RYI E;  2V7K A;  3AVS A;  1VOM A;  5LXT E;  3L3P A;  3RC8 A;  5JH7 E;  1U4Q A;  3F57 A;  4UF0 A;  3NBX X;  4BJN A;  2M67 A;  3AAI A;  5HXH A;  5HAX A;  4PJL A;  4ERR A;  2CXL A;  1YKE B;  2D0U A;  3A5X A;  3ZJ1 A;  3KVA A;  3KV4 A;  3DP7 A;  3AVR A;  5E0O A;  3LJC A;  5H6R B;  3CQG B;  1U5P A;  2RA1 A;  4BJM A;  2V7M A;  4ZI3 D;  3E08 A;  3ZN0 B;  2E9X B;  3C50 A;  3OJA A;  2KMF A;  5A1L A;  1Y64 B;  3L09 A;  5LJN A;  2K24 A;  4BAY B;  2WMO A;  1SA0 E;  4DBR A;  1V9D A;  2NWB A;  3I9W A;  4IGU A;  2WBL A;  5FXV A;  4PK6 A;  5HXR A;  4EB6 E;  5HYA A;  4PJM A;  1IAP A;  5LGU B;  2BZB A;  2PFV A;  2E8I A;  2YEV C;  3O9X A;  3CX8 B;  3OKQ A;  2XHE B;  3KBU A;  3D0T A;  1WRD A;  5LP6 E;  3NRY A;  5LBQ B;  2JRK A;  1H7C A;  2QA7 A;  3V5U A;  2DWK A;  2KXP B;  2Q9Q D;  4K0U A;  4YLH A;  2E9X A;  3K3O A;  4WBN E;  2UXX B;  5FMN A;  5FY0 A;  2HH7 A;  3WI3 A;  3CVR A;  1WYB A;  2YU1 A;  2VKD A;  3PUR A;  3ZCI A;  3KYL A;  5L3E B;  3MXZ A;  4MAL A;  2LHR A;  4C2M A;  2CWO A;  1IJ5 A;  1HTJ F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...