3SWHA

Munc13-1, mun domain, c-terminal module
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
316
structure length
295
Chain Sequence
AWFEPFVIQWLDENEEVSRDFLHGALERDKKDGFQQTSEHALFSCSVVDVFSQLNQSFEIIKKLECPDPQIVGHYMRRFAKTISNVLLQYADIVSKDFASYCSKEKEKVPCILMNNTQQLRVQLEKMFEAMGGKELDAEASGTLKELQVKLNNVLDELSHVFATSFQPHIEECVRQMGDILSQVKSVAQDADNVLQPIMDLLDSNLTLFAKICEKTVLKRVLKELWKLVMNTMERTIVLPPEFSKLKDHPKQCAVVELALDTIKQYFHAGGVGLKKTFLEKSPDLQSLRYALSLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Crystal Structure of a Munc13 C-terminal Module Exhibits a Remarkable Similarity to Vesicle Tethering Factors.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Exocytosis
molecule keywords Protein unc-13 homolog A
total genus 130
structure length 295
sequence length 316
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10540 Membr_traf_MHD Munc13 (mammalian uncoordinated) homology domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.50 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor; domain 2 3swhA01
1.20.58.1100 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3swhA02
2FJI1 3SWHA
chains in the Genus database with same CATH superfamily
4MO7A 4Z91A 4ZS2A 2HHHT 4H63V 2EHOB 4TV9E 4O4HE 3RC3A 3O9XA 4DV0T 2FJ1A 4IIJE 4PJJA 3BQIA 2OLTA 3JAFA 2VKVA 3R84B 5L47A 3I1AA 3F2EA 3B5MA 5IOYA 2KZ7B 3AB3B 3UQ4A 3PPBA 4O4IE 4LFAT 3RF1A 3ZSTA 2Y31A 3CJDA 5FYMA 2LOPA 3LG7A 1KNZA 4U2YA 3NZQA 3PUXF 2NTYA 1D1AA 2XQAA 4TN7B 5LHHB 4GCKA 2Y8DA 1DU2A 2CCQA 4CN6A 4JUYA 2ZMAA 5HCJA 1M7KA 2FBQA 4M3BA 2D2SA 3RI5A 4HKAA 5AQRB 3HGGA 2CA5A 5LG4A 4EAHA 3VTIA 2JJ9A 4CZZB 2C5JA 1HFAA 1T56A 2V26A 2XQ9A 4DV6T 4EV6A 1QVTA 3KV9A 4P1NA 2SPCA 2H88A 3NBXX 3BT9A 2CLYC 1UK5A 2YEVC 5LMUT 3AXJB 2XAQB 1FIOA 3FB2A 1JT6A 3AE2A 1Z0PA 1MMDA 4A56A 2WY2A 4DR7T 3C51A 2XPUA 2MOZA 5L4EA 1XNQT 4GIWA 2CWOA 5GONE 4U72A 3PUGA 2XASB 5F5WA 4G63A 2D9DA 1D1CA 5C4YA 4PAGA 5AQJB 4X5TA 4ISSA 2BS2A 5LG3A 3CRJA 2XGEA 3UU5A 1Y64B 4U3CA 4H9OC 2YVHA 2YU2A 3NKZA 4YSYA 5JDQA 3TP0A 3KZ9A 1WYCA 4OD4A 3S5RA 4H63H 3BQKA 2W61A 3RPUA 3E22E 2BZBA 3K3QC 2JK3A 3NZPA 3SFEA 4ANJA 2W67A 3RRCA 5HCMA 4IE4A 3K1SA 3HA4A 2MAWA 5FHPA 4L9IA 4AUXA 4YTNA 3ZJ1A 5F0FA 3VKHA 4AKRB 4ZOLE 2VASA 3E08A 1I94T 3VVZA 1JUMA 1FMVA 2UXDT 1KNPA 2CPTA 2LSGA 3DEWA 1ZOYA 1NAFA 2RP4A 3DU6A 1T33A 4IDNA 4LF6T 3QC9A 3O8HA 3VW1A 4D5FA 3ZEFB 2HXIA 2UU9T 3MNLA 1UI6A 4HFIA 4LF8T 4BAYB 2LSYA 2WDQA 4CI2B 3E7QA 3PDYA 3BNIA 3C2BA 4YHJA 3CX8B 2W62A 2E2AA 4TX5A 3LFMA 1XWMA 3NI7A 2Y48B 3VRBA 1O3XA 4IE0A 4YJ2E 4O4JE 5K7FA 2QIBA 4IRVA 3C4XA 1UUSA 4HGAA 1L0VA 2VQET 4ZI2D 1HNXT 3C4ZA 1D0YA 2A9UA 5AFUL 4GFLA 5BR8T 2OPTA 3ZYLA 3NWIA 5FNVE 1KEYA 4JKZA 2V6YA 2B1EA 4DR2T 3ANPA 1Y01A 2GBYA 4U9LA 1XMOT 3FRQA 4PK4A 4IE7A 3RYHE 5M4YA 3CWZB 2FD5A 4ILUA 4B6XA 5LYJE 4PK6A 3ZMVB 3ON4A 4HEAA 2YDQA 3VU7H 4DMWA 2DHRA 5LGTB 4BA9A 3NXCA 4TZ4C 4AKGA 4U33A 4GYSA 4HFCA 3KV6A 4HFHA 3RIAA 3NVOA 2RHAA 2JRKA 3Q3SA 1Z0XA 1XMQT 4GCTA 4F6RC 2QTQA 3N2OA 2I6HA 5HEJA 5JDNA 2C5KT 4CN4A 1HTJF 5HXSA 4DUYT 4N78D 2VWAA 2R7XA 2FUPA 5FXZA 3N2KE 2G7GA 3LK42 5LXTE 1YW0A 1FEWA 3EAMA 2WDRA 4IDOA 5ABFA 1SHZC 3I9YA 5HWXA 4A5XA 3ABVA 3X1DA 5JDHA 1J5WA 2BVMA 3KKCA 3AA1B 1OEDA 3Q0WA 2R7VA 4CI1B 3IF8B 4LFBT 4IL9A 4LMJA 4ABZA 3B6CA 2R7QA 2CXLA 1AJ3A 3QUJA 4MXMA 4GYRA 2CE7A 4HWFA 4CXYA 5H6RB 4YXDA 2ZM2A 3U78A 4PK5A 5JTGA 3QKXA 5FXXA 3AEAA 2JQ9A 2XGCA 5AQFB 5FXWA 3HE0A 2BVLA 3TLTA 4Z8XA 2W00A 4Z90A 5LB7B 2NP5A 4DVYP 3M3ZB 4LF4T 1YQ4A 3DTOA 4GCLA 2ES0A 3ZQGA 4YLHA 4AQFA 2BKNA 4O2BE 2XAJB 2NX4A 3N9QA 2ZM8A 2VVSA 4CQIA 3G1OA 2KSRA 4AQFC 5LJNA 3Q0UA 1IBKT 2WM9A 3FBLA 4KMCA 1NEKA 2WU5A 3LSVA 3MZKB 5AQUB 4NN1A 3C64A 1XDPA 3F0CA 2QCOA 2OF7A 4AQGA 4G2AA 5CA1E 1M62A 5HEOA 3AA7B 5FMNA 4DBRA 4EZHA 4DR6T 3TLWA 2PFVA 4F8HA 2JQHA 2DNXA 5AQNB 3PUQA 3E0ZA 4PJMA 1SE7A 3AEBA 2UXHA 1W0BA 3Q5XA 2RA1A 3I9WA 4M3DA 3ONXA 3EDVA 3TLUA 5L2LA 3VVXA 2NWBA 5K58A 1I6ZA 3NS4A 5JR9C 5FGLA 1MMNA 3ZMSB 5HXHA 1ZKGA 3O1HA 1WCRA 3AE5A 2DWGA 5CXGA 2XB5A 4JL3A 5EZYE 2HPJA 2X6OA 2CLYB 3V78A 5AQKB 4EYUA 3R6NA 1IJ5A 2XDNA 5LP6E 2XJ7A 3CVRA 5AQQB 3LSPA 3K3NA 4X64T 4IE5A 2XTLA 4B3MT 4NIQA 2XSAA 2V7MA 2C5IT 1VI0A 2FJEA 2Q9QC 3AAAB 1WR0A 3SRZA 1CUNA 1T98A 2X66A 3SFIA 3H3AA 2MTQA 2IBDA 4COFA 2MPKA 4DV7T 5EK4A 3NRGA 1HG5A 2HYJA 5ADXL 4YJ3E 3AVSA 2HQ5A 2B3WA 4QX8B 2J47A 3MXZA 4TWHA 2E9XC 4IGUA 2DL1A 2BDEA 4U2ZA 4K0KT 2OV9A 1OEDC 5HEGA 2A72A 3KYLA 4I6ZA 3ANWA 5CB4E 1HR0T 4PJNA 2BG9A 5AQTB 1E7PA 3D0TA 1EZ3A 4XBFB 3KV4A 3VIBA 4DUZT 3U3IA 4AI6A 4JI2T 2NP3A 2BG9C 4ZXLA 3T1YT 5LNKA 4V2GA 2LKHA 1QSDA 4U7IA 2Z6EA 4P0BA 2BKOA 3ZT7A 2VB6A 3PV0F 2PBXA 2XUEA 2LKGA 4E7SA 2XQYA 2DLRA 3I0OA 2GUHA 4ASKA 3N9LA 2UUCT 1YD8G 2NW9A 5C3JA 3IA3A 4JI5T 3LHQA 2VKEA 4UV8B 2J1DG 2L8KA 3LSRA 2C0SA 4A98A 4ACIA 4HTEA 1J5ET 3K8PC 4DV1T 5J2UE 5AQHB 4FI5A 1IAPA 5FVKA 2H3RA 5ABFB 4LFCT 3Q5EA 1ZHCA 4UVBB 2AXDS 2IUBA 1JUPA 3NNRA 5HAWA 4M3GA 3SWHA 2HKUA 1N34T 4UXNB 1WYBA 2JQQA 2FX0A 5JREA 2UXXB 1U5PA 5HBUA 2NTXA 4MBQA 4AIUA 3B13A 3ZT6A 2EH3A 3TLSA 2R7SA 2BBHA 2LHRA 1ZKEA 4DV3T 3ZQFA 2WQYA 5EK2A 4MFRA 1SGMA 2M6IA 5LGNB 3UUBA 2LM9A 4PNIA 5AQCA 4AISA 2H89A 5L3BB 4I55E 2BG9B 3C98B 4B3ST 4JI3T 3VOXA 4TWDA 2LT3A 2GENA 3RIUC 2XAFB 3F31A 3G06A 3MKDA 4AKHA 2V5DA 5LCYA 3L09A 4XAXB 2XHEB 4B3RT 2NW7A 4JBWF 4KI0F 4JI7T 2PBIA 1UX5A 5IOZA 3UU3A 3AQSA 1MNDA 4ZI3D 4C2MA 4HFBA 1W0AA 5GP9A 2M67A 2G0UA 3MA9A 5KX5E 4LF9T 4H9RC 3DJBA 3PE0A 3KBTA 2FJDA 3O1JA 1T8BA 5JR9B 4ZEYA 1HF8A 4QH1A 4UDSA 2ZM6T 4EXTA 1LVFA 5F1JA 3TKLB 2BS4A 1D1BA 2IIUA 4GKKT 4B1RA 2CHOA 4OK0A 4UF0B 3GA8A 2RAEA 2QRXA 2D0TA 5JRCB 3V5SA 1S94A 2E8IA 3RIFA 3CMLA 4LMLA 3WI3A 3Q9DA 1KK7A 3A5XA 1LKXA 2KLQA 3L3PA 2WWUA 3IHRA 2Q9QB 2NW8A 2UUAT 3VP5A 3AE3A 5ABGA 2XAHB 4M3EA 4ZI2C 3AXJA 5L3DB 3O60A 3A8YC 2H7VC 4HFDA 4QX7B 4HN9A 2DWKA 3LOCA 2LEHA 4H9QC 3M65A 3V5UA 4JEUB 1JTYA 3EUHA 2YDSA 4EB6E 4G12A 2V6XA 2PG8A 2ID6A 3RX6A 4NXMT 3O8GA 2HN1A 2V5CA 2XPKA 2WU2A 3FZKB 2QKOA 2X0HA 5CFBA 2NS7A 1XZYA 4HWHA 2ACZA 4NXNT 4QKNA 4ZZBA 1G8XA 5AQLB 4YHHT 1VRBA 2H7OA 2WV1A 3JAEA 2D5UA 3COLA 4IDQA 1U9OA 2IU5A 4UELA 4X65T 3AEEA 2UXNB 3HKEE 2KXPB 3IH4A 2R7RA 2X68A 5IP6A 4I43B 3UU4A 2IEKA 2CHNA 4OX9T 3HKDE 3SFDA 2VKOA 4WW0A 5FMPA 3PU3A 4ILBA 4GFKA 3CPZA 4KX6A 4DR4T 3LSJA 3PUVF 3HTIA 4O2AE 3FZLB 1WLXA 3F1BA 2WUIA 5DJQC 3AE7A 3IH3A 1ZP0A 2LRLA 3G56A 4X1KE 4EZ4A 1WFDA 1YKEB 2ZY9A 4ZZCA 3PU8A 2G7LA 3TP3A 4YY3T 3FXDB 3ZKRA 3FK7A 2V7JA 4X1YE 5JDGA 2NR4A 1JT0A 1IBMT 3QB5K 1D0ZA 2HPLA 4ME9A 1HX1B 3ZLIA 2V7KA 2LJLA 4DR1T 2V8SV 2Y6XA 1NENA 2ID3A 5LHIB 1UI5A 5LGUB 2LSJA 3P4RA 4FJOA 3RC8A 4A97A 4KP3C 1MMAA 2WBLA 4M3FA 3GWHA 3MJXA 5EFYA 4EGWA 3WHBA 5F0CA 5JDMA 5J3LA 3RLFF 3AE9A 4WNKA 5FL1A 2CWYA 2BKPA 3HI2A 2G3BA 3OJAA 1QVUA 3BQLA 3LK3B 2VQFT 4QXHB 5ABHA 4TV8E 2WZIA 3ONJA 3RGLA 4ZS3A 3P9TA 2XSBA 4AC6A 5L3EB 3FK6A 2REKA 3BCGA 3KKDA 2MYSA 2IAKA 3ZQLA 2KINB 3RKGA 3RRWA 2QWTA 3KINB 3CX6B 3FIWA 5IYZE 4KUMB 3ANGA 4MALA 4OYKA 2R6GF 2IAIA 3OKQA 2ZCXA 3A7MA 3PUSA 4JI0T 2WGBA 4QH5A 4ILAA 2K48A 2CXDA 3PJAA 4I4TE 5FY1A 1MMGA 4W97A 4YTMA 2WSSV 3VVYA 4MHCA 3FHNA 2I10A 4HKUA 2ZOZA 3HGYA 4ZI3C 2ZM0A 3BQYA 3O4XE 4GOUA 2F07A 2WWVA 2PJQA 4PXIA 3LK2B 1S35A 2L9QA 3VR9A 3LWJA 3VR8A 4DIDB 4AKLA 3UFGA 5LJMA 2ZCMA 2N2NA 4DV2T 5FVLA 3BK9A 2HH7A 5LA6E 2OERA 2XQ5A 2XQ7A 1FMWA 2W0GA 3AE1A 2V7IA 2WP9A 2R7UA 3AE4A 4BJMA 3VPRA 1MIYA 4UEMA 2W63A 2I0MA 4X20E 5FKMA 4TNWA 5HAXA 4C90A 1JNRA 3QOFA 3P4SA 4CXXA 2YDRA 2VKDA 1MIWA 4B3AA 1Z8UA 1HNZT 3VW2A 2WMOA 3UUNA 5KMGP 3G7RA 2QVAA 1ORKA 5DQVA 2GFNA 2JMKA 3WHCA 2LHNA 3O1IA 3ZMTB 2O7TA 1X79A 5LOVE 3PTRB 4WBNE 2FJBA 1D0XA 1ZV4X 3ZYMA 1T72A 4DMVA 2KT9A 4TNVA 4ADZA 3EABA 3GZIA 4V2FA 3OBVE 3BR0A 2BG9E 4IHJE 5LMNT 3AEFA 5IUXA 2Y30A 5FKNA 5J1UA 3IEEA 3VW0A 2QGSA 5AQMB 2W66A 2E9XD 4JYAT 5C8YE 4QHOA 2X0YA 3EUPA 2XM1A 3AAEB 4LMKA 5ETWA 4H9SE 4JLEA 1E2AA 1HS7A 2BS3A 3QPSA 2G7SA 3KFWX 3QB5A 3G1LA 3C50A 3C07A 2X9YA 3CK6A 5F04A 1U4QA 2K5BB 3SOLA 3N9PA 5HWYA 2VKJA 2VURA 3J7Yq 1CHUA 2X9XA 3EVYA 4WBOA 1OEDE 3ZYKA 4L0RA 3VKGA 1BR4A 2V57A 4JNNA 1B7TA 3QPLA 3BR3A 2UUBT 3IUVA 4H9PC 5F8PA 5DQWA 3P4WA 4L5GA 3CX7B 2XAGB 2L3LA 3UU6A 2VK9A 1XNRT 1SUMB 2FBWA 3NRYA 3L8RA 1KFYA 5JDLA 2MBGA 2UXPA 1QPIA 4PFPA 4UIGA 4DW6A 3P8CD 3GN5A 3CWRA 3CQXC 4AKIA 3SDGA 4P09A 3JADA 1KF6A 1RPWA 2KWHA 2XQ3A 3WAKA 4QH4A 5CJ5A 4GK0E 4M1PA 4QWNB 2WDVA 3NPIA 5IWAT 4NUUA 1JNZA 5DABA 4WZXA 4IDZA 4B3TT 5L3CB 3N5LA 4X62T 4KHZF 3TLVA 5H6QB 5FL0A 3N9MA 4YTPA 4IE6A 5FKLA 2DG8A 2J62A 5FKYA 5HSZA 4HWCA 3C4WA 5GPCA 5HEHA 3OPCA 2UXBT 3S4UA 3HTAA 3AEGA 5IPAA 2LSIA 1WR6A 4ICHA 3HTJA 4OD5A 5FY7A 4JEHB 5CA0E 3MK7C 1G73A 2HYTA 2W4XA 4I76A 4AXPA 2HXOA 3AVRA 1ZK8A 3AE6A 2M6BA 1IBLT 4HWIB 1OEDB 5AQIB 3BJBA 5JR9A 4OHFA 3ZQIA 4DR5T 3JCFA 3HR0A 3J9X1 3RYCE 3LJCA 2ODUA 1N36T 3ZMUB 1BR2A 3PJAJ 2NP9A 4MK6A 3VOKA 4CXWA 3ZT5A 3CQGB 2K3WA 4GK5E 3BR6A 3IH2A 4JI8T 4JI4T 3LBXA 2V1DB 3RYIE 1OXZA 3HKCE 1BR0A 2VPRA 4AQYT 2VL8A 2ZB9A 2B76A 4DNDA 4I50E 2F4VT 3HIMA 3PURA 1R8IA 5CXIA 3BTLA 1UURA 2LM2A 2YVXA 1UGOA 4K0UA 4U31A 3BR5A 3AA0B 1BR1A 5JH7E 4JI6T 3JSJA 3MACA 2YKSA 3JC6C 2VL0A 3Q5WA 1VCTA 2CRBA 3BTIA 1X9BA 3AAIA 3VHLA 3H3MA 2JQKA 3ANWB 5HXRA 4ZHQE 3ZCIA 5DAJA 2LLYA 4YSZA 2OA5A 4OFZA 4NPPA 2G0EA 5J1RA 2YINA 3UTKA 1N33T 3LDQB 3AE8A 2E5LT 3P7IA 5BMVE 3WAJA 2V6YB 3SS1A 4HFEA 3RYFE 1HNWT 2X9DA 1WRDA 5JVDE 2KWIB 5CQGA 3PUYF 2ZCNA 2EHOA 4DVDA 1J1JA 4IT4A 3NRXA 4AC0A 2GK9A 3CIRA 5EK3A 3ESLA 3ON2A 4Q25A 5L4HA 3RQUA 5JQGE 3VRAA 5F27A 2KNDA 1VOMA 3LBXB 3RIUA 3Q2MA 4IREA 5CW8A 2Q9QA 1JUSA 3ZJ2A 2IHR1 3KDSE 5J1GA 3L39A 3BR1A 3W15B 2I59A 2VVNA 4ZI7E 3HKBE 2YN6A 4EYYR 2NOXA 2W53A 1SA0E 3KNWA 1IJ6A 2RASA 2IDOB 1T7SA 4X1IE 2YU1A 3OYXA 4EEDA 3RD3A 1VCSA 5AQOB 1KNRA 5TAOA 2CXFA 2WAUA 1FJGT 5KDMC 2IC6A 3FZHB 4CI3B 2XM2A 4MLKA 1W09A 4HWDA 3QNUA 4EIWA 4X66T 3T6NA 2TRTA 3UULA 5EZHA 2QYWA 2UXIA 4XK4A 2XGDA 4YFSA 2NS8A 2FJAA 3KBUA 1UX4A 3ZPOA 3QQAA 2XQ8A 3FBZA 5FKKA 5GPAA 3BQZA 5J2TE 2A3DA 1RKWA 3B81A 2IC9A 3ETUA 5K7HA 4WIBA 4V1Av 1Z77A 3RQWA 3T8OA 2EHOC 2XQ4A 3CQCB 4NELA 3B6AA 1YQ3A 3F57A 3RH3A 4GKJT 5FKOA 1U9NA 3K3OA 2QOPA 4TUYE 5HEUA 4TWFA 3V6GA 4C91A 4IDPA 3RKOA 2ZLYA 2KMFA 4NUVA 3UU8A 4PJLA 1US7B 3T1HT 3RHWA 2LRKA 3Q0VA 4DV5T 3AECA 5EZGA 2XRLA 2XPWA 3KVAA 1RKTA 4I0UA 2N1GA 5L3FB 2Q24A 5D18A 5JDFA 2LSKA 2JMHA 2R7WA 4U7YA 3P4QA 2XPVA 2YVEA 3N9NA 2VKHA 4YT0A 5A1LA 5D1RA 5HXCA 5D19A 2UXCT 3CDLA 4UF0A 3ZMZB 2D6YA 2UXUA 5F0HA 1LRZA 4W1UA 2Q9QD 3GN5B 2LE8A 3RH2A 3EDUA 3FZFB 2DG7A 1N32T 1MIVA 2A2FX 3ZQHA 4L62A 4QXBB 2PTFA 4O4LE 3DPJA 4JYKA 4O8SA 4JI1T 1A6IA 1E1HB 2N9DA 4UR9A 4D5CA 3UUXB 3UUMA 2W2UA 3B57A 3ZCJA 4X1EA 3ETVA 4CN1A 4DO0A 2X51A 4DV4T 5CGMA 1JTXA 3UQ7A 2ACXA 1OWAA 4P0AA 3DCFA 2EHOD 2V7LA 2X9WA 1HCIA 3PM1A 5AQPB 2Y2ZA 3P4PA 2P9BA 3HTHA 5C2TA 2K9AA 4DBQA 3FXEB 4IL4A 2WCAA 5LBQB 2E9XB 4CGRA 4JV5T 5LBMA 2DTZA 4LF5T 3N2GE 3ZC1A 4UV9B 5J1YA 1YKHB 1IZNB 4OYJA 5JRCA 5AQSB 3GMIA 3KVBA 5L3GB 3H37A 2XZEA 4XZCA 2FJI1 3FZMB 2WS3A 5K7ZA 2CM0A 3LJLA 3AEDA 4YZEA 4QXCB 3CKDA 5FY0A 2X0LB 5F08A 4ISTA 3JC6D 4J2CA 2O7OA 4YSXA 3MVPA 3EI0A 2OI8A 3Q5DA 4KHPT 3QBMA 3DP7A 2HN2A 3ZSSA 3CCYA 1YXRA 3ZN0B 1LVKA 2CMRA 3BTCA 3KV5A 1HX8A 4ERRA 2J4GA 2DCFA 1ZEEA 4D7MA 5HXEA 3AQTA 3GEUA 4LF7T 2BBJA 2UXOA 4ILCA 5FP3A 3AA6B 4U9NA 2IW5B 2YK0A 2CEAA 5F3JA 4BJNA 3OVUA 1H7CA 4KBMB 3ZN1B 2JPFA 2E9XA 1W9RA 4HFVA 5EYRA 2R7TA 3N9OA 5AQVB 4EOZB 3HL6A 5IHYA 2K24A 5J0ZA 2IMLA 1UCUA 2YOEA 3BHQA 3EGQA 1NWMX 1QLBA 2DI4A 3IBPA 2TCTA 5KXJA 2JIWA 5AQGB 3OYZA 2JJ7A 2ZOYA 1HG2A 1MNEA 4D7NA 2RPAA 3PUZF 3UT5E 5ABEA 5FXVA 2ODVA 2E5VA 4HE8A 4PW8A 2AE9A 4EEBA 5LHGB 5E0OA 2QA7A 3QK6A 4H9NC 3P50A 3OTOT 2X9HA 4DR3T 1V9DA 2WZHA 3EHZA 4U74A 3ZC0A 3VUQA 2CBJA 4E7ZA 4WYVA 2WB5A 2XY8B 2PZ9A 3UFEA 3BRUA 1XDOA 2D0UA 4UVAB 2FQ4A 3PASA 4KWAA 3I0QA 4AF5A 3BR2A 2X67A 2WMNA 3ONLC 1QUUA 2R7OA 2CBIA 1GQEA 4PFOA 4UVCB 3BTJA 5H9TA 2LOSA 3DU5A 5HYAA 1BJZA 3PUWF 3G1MA 2XQ6A 3PUAA
chains in the Genus database with same CATH topology
3ONXA 3EDVA 5L2LA 3RYFE 4ZS2A 5JDMA 2NWBA 4H63V 1WRDA 5JVDE 4WNKA 2KWIB 2EHOB 3NS4A 5JR9C 1MMNA 3ZMSB 5HXHA 5CQGA 4TV9E 3O1HA 2CWYA 4O4HE 3RC3A 3O9XA 3HI2A 4IIJE 4PJJA 3OJAA 2DWGA 3BQLA 3LK3B 2EHOA 4QXHB 4DVDA 4TV8E 5EZYE 3NRXA 2HPJA 4ZS3A 2GK9A 5EK3A 2CLYB 3ESLA 3BQIA 5JQGE 2KNDA 5L3EB 3R84B 1VOMA 3I1AA 3LBXB 3Q2MA 3F2EA 4EYUA 2MYSA 2Q9QA 2KZ7B 3R6NA 1IJ5A 3AB3B 5LP6E 2IAKA 4O4IE 3CVRA 2KINB 3K3NA 3ZJ2A 4IE5A 2XTLA 3RRWA 3KDSE 5J1GA 3KINB 2V7MA 3CX6B 5IYZE 3W15B 4KUMB 2I59A 2C5IT 2Q9QC 3AAAB 4MALA 5FYMA 4OYKA 4ZI7E 3HKBE 4EYYR 2LOPA 2NOXA 3LG7A 3OKQA 1KNZA 3SRZA 1SA0E 1IJ6A 3NZQA 1CUNA 3PUSA 1T98A 2X66A 3H3AA 2MTQA 2NTYA 2K48A 1D1AA 2CXDA 2YU1A 4X1IE 3OYXA 4I4TE 4TN7B 5EK4A 5LHHB 5FY1A 1MMGA 2Y8DA 2CCQA 4JUYA 2ZMAA 1HG5A 2WSSV 4MHCA 3FHNA 5TAOA 2CXFA 2WAUA 2D2SA 5ADXL 5KDMC 2IC6A 4YJ3E 3AVSA 4HKAA 4CI3B 4MLKA 2B3WA 4ZI3C 4QX8B 4EIWA 2ZM0A 3MXZA 2E9XC 4IGUA 2CA5A 2BDEA 5LG4A 3O4XE 4EAHA 3UULA 3VTIA 2JJ9A 4CZZB 4GOUA 2A72A 2C5JA 1HFAA 2V26A 3KYLA 2PJQA 3ANWA 5CB4E 4YFSA 3LK2B 4PJNA 3KV9A 3KBUA 1S35A 2L9QA 2SPCA 3D0TA 1UX4A 1EZ3A 3NBXX 3FBZA 3ZPOA 4AKLA 4XBFB 2CLYC 3KV4A 5LJMA 3U3IA 4AI6A 2N2NA 2YEVC 2A3DA 5J2TE 3BK9A 2HH7A 2XAQB 5LA6E 5LNKA 1QSDA 2Z6EA 1FIOA 2IC9A 3FB2A 4P0BA 1FMWA 3ETUA 1Z0PA 2VB6A 1MMDA 2W0GA 4A56A 2XUEA 4V1Av 3C51A 2V7IA 3T8OA 2EHOC 2R7UA 3CQCB 4BJMA 2MOZA 3RH3A 3F57A 1MIYA 4E7SA 4GIWA 2CWOA 4UEMA 2XQYA 5GONE 3K3OA 4U72A 3PUGA 2XASB 2DLRA 2W63A 4G63A 3I0OA 4X20E 1D1CA 4TUYE 5HAXA 4C90A 4PAGA 4ASKA 3N9LA 4C91A 4ISSA 3RKOA 1YD8G 2ZLYA 2KMFA 2NW9A 4NUVA 4UV8B 1Y64B 4PJLA 2J1DG 2L8KA 2C0SA 4H9OC 1US7B 2YU2A 2VKDA 4CXXA 1MIWA 4HTEA 3K8PC 5JDQA 2WMOA 3UUNA 5J2UE 5KMGP 4FI5A 1IAPA 5DQVA 2H3RA 1WYCA 1ZHCA 4OD4A 3KVAA 4UVBB 2JMKA 2N1GA 4H63H 2LHNA 5L3FB 3O1IA 3BQKA 5JDFA 3ZMTB 2W61A 3RPUA 2LSKA 1X79A 2JMHA 2R7WA 5LOVE 3SWHA 3E22E 2BZBA 3K3QC 3PTRB 4WBNE 3NZPA 1D0XA 1ZV4X 3ZYMA 4UXNB 2JQQA 1WYBA 4ANJA 3RRCA 5JREA 3N9NA 4DMVA 2KT9A 2VKHA 2UXXB 5A1LA 4ADZA 4IE4A 1U5PA 5HXCA 2NTXA 3OBVE 4MBQA 3HA4A 3B13A 4IHJE 4L9IA 4UF0A 3ZMZB 3ZJ1A 3VKHA 4AKRB 1LRZA 4ZOLE 2VASA 2R7SA 2Q9QD 2LHRA 3E08A 1ZKEA 3GN5B 2LE8A 1FMVA 2QGSA 3IEEA 3EDUA 2E9XD 5EK2A 4MFRA 5C8YE 2LSGA 5LGNB 4QHOA 2LM9A 1MIVA 1NAFA 2RP4A 4PNIA 2A2FX 3DU6A 5L3BB 3QC9A 4I55E 3C98B 3AAEB 4QXBB 5ETWA 2LT3A 4O4LE 3ZEFB 4H9SE 4JLEA 4O8SA 2XAFB 1HS7A 3F31A 4BAYB 1E1HB 2N9DA 3MKDA 4AKHA 2LSYA 5LCYA 3KFWX 3L09A 4CI2B 3C50A 4XAXB 3UUXB 2XHEB 3PDYA 2X9YA 3UUMA 4YHJA 2NW7A 3CX8B 3B57A 2W62A 3ZCJA 1U4QA 4TX5A 3ETVA 3LFMA 2PBIA 1UX5A 2Y48B 2K5BB 1O3XA 3SOLA 4DO0A 2X51A 3N9PA 4IE0A 2VKJA 5HWYA 4YJ2E 1MNDA 4O4JE 4ZI3D 4IRVA 3C4XA 4C2MA 2ACXA 1OWAA 3J7Yq 4P0AA 4HGAA 2EHOD 4ZI2D 2V7LA 2X9WA 2M67A 1HCIA 2G0UA 3MA9A 3C4ZA 5KX5E 4H9RC 2X9XA 1D0YA 5AFUL 2P9BA 3DJBA 3PE0A 3KBTA 2K9AA 3EVYA 3ZYLA 4DBQA 3FXEB 4WBOA 5FNVE 3O1JA 5LBQB 4L0RA 2E9XB 3ZYKA 3VKGA 1BR4A 5JR9B 1B7TA 1HF8A 2B1EA 5LBMA 4H9PC 4EXTA 3N2GE 1LVFA 4UV9B 5DQWA 5F8PA 3ZC1A 3TKLB 4PK4A 4L5GA 3CX7B 1D1BA 2XAGB 1YKHB 2L3LA 1IZNB 2VK9A 4OYJA 5JRCA 4IE7A 3RYHE 5M4YA 3NRYA 3GMIA 3KVBA 4OK0A 3CWZB 4UF0B 5L3GB 5JDLA 3GA8A 2MBGA 3H37A 4ILUA 4XZCA 2D0TA 4B6XA 4PFPA 5LYJE 4PK6A 2FJI1 3ZMVB 5JRCB 4UIGA 3V5SA 1S94A 4HEAA 3VU7H 2CM0A 2E8IA 2DHRA 3P8CD 4DMWA 3GN5A 3CMLA 5LGTB 3WI3A 4BA9A 3Q9DA 1KK7A 3CQXC 3A5XA 1LKXA 4AKIA 2KLQA 4TZ4C 4P09A 3L3PA 4AKGA 4QXCB 2WWUA 3IHRA 2Q9QB 3CKDA 2KWHA 4GYSA 5FY0A 2NW8A 2X0LB 3WAKA 4ISTA 3KV6A 3JC6D 4GK0E 4M1PA 4J2CA 2XAHB 4ZI2C 4QWNB 2JRKA 5L3DB 4NUUA 3DP7A 4F6RC 2H7VC 4QX7B 4HN9A 2DWKA 3ZN0B 3N2OA 1LVKA 2CMRA 2LEHA 4H9QC 2C5KT 3M65A 5DABA 3V5UA 5JDNA 1HTJF 3EUHA 4JEUB 5HXSA 4IDZA 3KV5A 5L3CB 4N78D 3N5LA 1HX8A 4ERRA 4EB6E 2VWAA 5H6QB 2PG8A 3N9MA 3RX6A 2DCFA 1ZEEA 4IE6A 2R7XA 5HXEA 5FXZA 3N2KE 3LK42 5LXTE 1YW0A 1FEWA 5FP3A 3C4WA 3AA6B 2IW5B 2YK0A 2CEAA 5F3JA 4BJNA 3S4UA 1H7CA 4KBMB 4QKNA 2LSIA 3ZN1B 2JPFA 2E9XA 1WR6A 4HFVA 4OD5A 1G8XA 1SHZC 5FY7A 2R7TA 4JEHB 3I9YA 5HWXA 5CA0E 1VRBA 3MK7C 3N9OA 2H7OA 4EOZB 1G73A 5JDHA 2BVMA 3AA1B 2D5UA 3HL6A 5IHYA 4UELA 2R7VA 2K24A 4AXPA 4CI1B 3IF8B 3AVRA 1UCUA 2R7QA 1NWMX 2CXLA 5JR9A 4OHFA 2UXNB 1AJ3A 2DI4A 3HKEE 2KXPB 3IBPA 3HR0A 3QUJA 3J9X1 4GYRA 2CE7A 3RYCE 2R7RA 3LJCA 2X68A 3OYZA 4CXYA 4I43B 2ODUA 1HG2A 5H6RB 3ZMUB 1MNEA 1BR2A 2ZM2A 3HKDE 3U78A 4PK5A 2NP9A 5FXXA 2VKOA 4WW0A 4CXWA 3UT5E 3PU3A 3CQGB 4GK5E 5FXWA 5FXVA 3CPZA 2ODVA 2BVLA 4Z8XA 2W00A 4HE8A 4PW8A 3LBXA 4O2AE 2V1DB 5LHGB 4DVYP 1WLXA 3RYIE 1OXZA 3HKCE 1BR0A 5E0OA 2VL8A 5DJQC 2QA7A 3DTOA 3QK6A 4DNDA 4I50E 4H9NC 3PURA 2ES0A 4X1KE 4YLHA 2X9HA 4AQFA 4EZ4A 1YKEB 4K0UA 1V9DA 4O2BE 2XAJB 3AA0B 1BR1A 3N9QA 2ZM8A 4U74A 3ZC0A 5JH7E 3PU8A 4CQIA 3MACA 4E7ZA 3JC6C 4AQFC 3FXDB 3Q5WA 5LJNA 2WM9A 2V7JA 3UFEA 3FBLA 4KMCA 2D0UA 4X1YE 4UVAB 5JDGA 3MZKB 3AAIA 3I0QA 3VHLA 3C64A 1D0ZA 2HPLA 2X67A 3ANWB 2WMNA 5HXRA 3ZLIA 4AQGA 3ZCIA 4ZHQE 2V7KA 4G2AA 2LJLA 5CA1E 3AA7B 5FMNA 4DBRA 4EZHA 1QUUA 2R7OA 2OA5A 4PFOA 4UVCB 4OFZA 2Y6XA 2PFVA 5LHIB 2YINA 2DNXA 5LGUB 2LSJA 3PUQA 3E0ZA 3UTKA 4FJOA 3RC8A 2LOSA 4KP3C 4PJMA 3DU5A 5HYAA 1MMAA 2WBLA 3GWHA 3P7IA 3MJXA 5BMVE 3WAJA 3Q5XA 3SS1A 2RA1A 3I9WA 3PUAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FJI 1;  3SWH A; 
#chains in the Genus database with same CATH topology
 4MO7 A;  4Z91 A;  4ZS2 A;  2HHH T;  4H63 V;  2EHO B;  4TV9 E;  4O4H E;  3RC3 A;  3O9X A;  4DV0 T;  2FJ1 A;  4IIJ E;  4PJJ A;  3BQI A;  2OLT A;  3JAF A;  2VKV A;  3R84 B;  5L47 A;  3I1A A;  3F2E A;  3B5M A;  5IOY A;  2KZ7 B;  3AB3 B;  3UQ4 A;  3PPB A;  4O4I E;  4LFA T;  3RF1 A;  3ZST A;  2Y31 A;  3CJD A;  5FYM A;  2LOP A;  3LG7 A;  1KNZ A;  4U2Y A;  3NZQ A;  3PUX F;  2NTY A;  1D1A A;  2XQA A;  4TN7 B;  5LHH B;  4GCK A;  2Y8D A;  1DU2 A;  2CCQ A;  4CN6 A;  4JUY A;  2ZMA A;  5HCJ A;  1M7K A;  2FBQ A;  4M3B A;  2D2S A;  3RI5 A;  4HKA A;  5AQR B;  3HGG A;  2CA5 A;  5LG4 A;  4EAH A;  3VTI A;  2JJ9 A;  4CZZ B;  2C5J A;  1HFA A;  1T56 A;  2V26 A;  2XQ9 A;  4DV6 T;  4EV6 A;  1QVT A;  3KV9 A;  4P1N A;  2SPC A;  2H88 A;  3NBX X;  3BT9 A;  2CLY C;  1UK5 A;  2YEV C;  5LMU T;  3AXJ B;  2XAQ B;  1FIO A;  3FB2 A;  1JT6 A;  3AE2 A;  1Z0P A;  1MMD A;  4A56 A;  2WY2 A;  4DR7 T;  3C51 A;  2XPU A;  2MOZ A;  5L4E A;  1XNQ T;  4GIW A;  2CWO A;  5GON E;  4U72 A;  3PUG A;  2XAS B;  5F5W A;  4G63 A;  2D9D A;  1D1C A;  5C4Y A;  4PAG A;  5AQJ B;  4X5T A;  4ISS A;  2BS2 A;  5LG3 A;  3CRJ A;  2XGE A;  3UU5 A;  1Y64 B;  4U3C A;  4H9O C;  2YVH A;  2YU2 A;  3NKZ A;  4YSY A;  5JDQ A;  3TP0 A;  3KZ9 A;  1WYC A;  4OD4 A;  3S5R A;  4H63 H;  3BQK A;  2W61 A;  3RPU A;  3E22 E;  2BZB A;  3K3Q C;  2JK3 A;  3NZP A;  3SFE A;  4ANJ A;  2W67 A;  3RRC A;  5HCM A;  4IE4 A;  3K1S A;  3HA4 A;  2MAW A;  5FHP A;  4L9I A;  4AUX A;  4YTN A;  3ZJ1 A;  5F0F A;  3VKH A;  4AKR B;  4ZOL E;  2VAS A;  3E08 A;  1I94 T;  3VVZ A;  1JUM A;  1FMV A;  2UXD T;  1KNP A;  2CPT A;  2LSG A;  3DEW A;  1ZOY A;  1NAF A;  2RP4 A;  3DU6 A;  1T33 A;  4IDN A;  4LF6 T;  3QC9 A;  3O8H A;  3VW1 A;  4D5F A;  3ZEF B;  2HXI A;  2UU9 T;  3MNL A;  1UI6 A;  4HFI A;  4LF8 T;  4BAY B;  2LSY A;  2WDQ A;  4CI2 B;  3E7Q A;  3PDY A;  3BNI A;  3C2B A;  4YHJ A;  3CX8 B;  2W62 A;  2E2A A;  4TX5 A;  3LFM A;  1XWM A;  3NI7 A;  2Y48 B;  3VRB A;  1O3X A;  4IE0 A;  4YJ2 E;  4O4J E;  5K7F A;  2QIB A;  4IRV A;  3C4X A;  1UUS A;  4HGA A;  1L0V A;  2VQE T;  4ZI2 D;  1HNX T;  3C4Z A;  1D0Y A;  2A9U A;  5AFU L;  4GFL A;  5BR8 T;  2OPT A;  3ZYL A;  3NWI A;  5FNV E;  1KEY A;  4JKZ A;  2V6Y A;  2B1E A;  4DR2 T;  3ANP A;  1Y01 A;  2GBY A;  4U9L A;  1XMO T;  3FRQ A;  4PK4 A;  4IE7 A;  3RYH E;  5M4Y A;  3CWZ B;  2FD5 A;  4ILU A;  4B6X A;  5LYJ E;  4PK6 A;  3ZMV B;  3ON4 A;  4HEA A;  2YDQ A;  3VU7 H;  4DMW A;  2DHR A;  5LGT B;  4BA9 A;  3NXC A;  4TZ4 C;  4AKG A;  4U33 A;  4GYS A;  4HFC A;  3KV6 A;  4HFH A;  3RIA A;  3NVO A;  2RHA A;  2JRK A;  3Q3S A;  1Z0X A;  1XMQ T;  4GCT A;  4F6R C;  2QTQ A;  3N2O A;  2I6H A;  5HEJ A;  5JDN A;  2C5K T;  4CN4 A;  1HTJ F;  5HXS A;  4DUY T;  4N78 D;  2VWA A;  2R7X A;  2FUP A;  5FXZ A;  3N2K E;  2G7G A;  3LK4 2;  5LXT E;  1YW0 A;  1FEW A;  3EAM A;  2WDR A;  4IDO A;  5ABF A;  1SHZ C;  3I9Y A;  5HWX A;  4A5X A;  3ABV A;  3X1D A;  5JDH A;  1J5W A;  2BVM A;  3KKC A;  3AA1 B;  1OED A;  3Q0W A;  2R7V A;  4CI1 B;  3IF8 B;  4LFB T;  4IL9 A;  4LMJ A;  4ABZ A;  3B6C A;  2R7Q A;  2CXL A;  1AJ3 A;  3QUJ A;  4MXM A;  4GYR A;  2CE7 A;  4HWF A;  4CXY A;  5H6R B;  4YXD A;  2ZM2 A;  3U78 A;  4PK5 A;  5JTG A;  3QKX A;  5FXX A;  3AEA A;  2JQ9 A;  2XGC A;  5AQF B;  5FXW A;  3HE0 A;  2BVL A;  3TLT A;  4Z8X A;  2W00 A;  4Z90 A;  5LB7 B;  2NP5 A;  4DVY P;  3M3Z B;  4LF4 T;  1YQ4 A;  3DTO A;  4GCL A;  2ES0 A;  3ZQG A;  4YLH A;  4AQF A;  2BKN A;  4O2B E;  2XAJ B;  2NX4 A;  3N9Q A;  2ZM8 A;  2VVS A;  4CQI A;  3G1O A;  2KSR A;  4AQF C;  5LJN A;  3Q0U A;  1IBK T;  2WM9 A;  3FBL A;  4KMC A;  1NEK A;  2WU5 A;  3LSV A;  3MZK B;  5AQU B;  4NN1 A;  3C64 A;  1XDP A;  3F0C A;  2QCO A;  2OF7 A;  4AQG A;  4G2A A;  5CA1 E;  1M62 A;  5HEO A;  3AA7 B;  5FMN A;  4DBR A;  4EZH A;  4DR6 T;  3TLW A;  2PFV A;  4F8H A;  2JQH A;  2DNX A;  5AQN B;  3PUQ A;  3E0Z A;  4PJM A;  1SE7 A;  3AEB A;  2UXH A;  1W0B A;  3Q5X A;  2RA1 A;  3I9W A;  4M3D A;  3ONX A;  3EDV A;  3TLU A;  5L2L A;  3VVX A;  2NWB A;  5K58 A;  1I6Z A;  3NS4 A;  5JR9 C;  5FGL A;  1MMN A;  3ZMS B;  5HXH A;  1ZKG A;  3O1H A;  1WCR A;  3AE5 A;  2DWG A;  5CXG A;  2XB5 A;  4JL3 A;  5EZY E;  2HPJ A;  2X6O A;  2CLY B;  3V78 A;  5AQK B;  4EYU A;  3R6N A;  1IJ5 A;  2XDN A;  5LP6 E;  2XJ7 A;  3CVR A;  5AQQ B;  3LSP A;  3K3N A;  4X64 T;  4IE5 A;  2XTL A;  4B3M T;  4NIQ A;  2XSA A;  2V7M A;  2C5I T;  1VI0 A;  2FJE A;  2Q9Q C;  3AAA B;  1WR0 A;  3SRZ A;  1CUN A;  1T98 A;  2X66 A;  3SFI A;  3H3A A;  2MTQ A;  2IBD A;  4COF A;  2MPK A;  4DV7 T;  5EK4 A;  3NRG A;  1HG5 A;  2HYJ A;  5ADX L;  4YJ3 E;  3AVS A;  2HQ5 A;  2B3W A;  4QX8 B;  2J47 A;  3MXZ A;  4TWH A;  2E9X C;  4IGU A;  2DL1 A;  2BDE A;  4U2Z A;  4K0K T;  2OV9 A;  1OED C;  5HEG A;  2A72 A;  3KYL A;  4I6Z A;  3ANW A;  5CB4 E;  1HR0 T;  4PJN A;  2BG9 A;  5AQT B;  1E7P A;  3D0T A;  1EZ3 A;  4XBF B;  3KV4 A;  3VIB A;  4DUZ T;  3U3I A;  4AI6 A;  4JI2 T;  2NP3 A;  2BG9 C;  4ZXL A;  3T1Y T;  5LNK A;  4V2G A;  2LKH A;  1QSD A;  4U7I A;  2Z6E A;  4P0B A;  2BKO A;  3ZT7 A;  2VB6 A;  3PV0 F;  2PBX A;  2XUE A;  2LKG A;  4E7S A;  2XQY A;  2DLR A;  3I0O A;  2GUH A;  4ASK A;  3N9L A;  2UUC T;  1YD8 G;  2NW9 A;  5C3J A;  3IA3 A;  4JI5 T;  3LHQ A;  2VKE A;  4UV8 B;  2J1D G;  2L8K A;  3LSR A;  2C0S A;  4A98 A;  4ACI A;  4HTE A;  1J5E T;  3K8P C;  4DV1 T;  5J2U E;  5AQH B;  4FI5 A;  1IAP A;  5FVK A;  2H3R A;  5ABF B;  4LFC T;  3Q5E A;  1ZHC A;  4UVB B;  2AXD S;  2IUB A;  1JUP A;  3NNR A;  5HAW A;  4M3G A;  3SWH A;  2HKU A;  1N34 T;  4UXN B;  1WYB A;  2JQQ A;  2FX0 A;  5JRE A;  2UXX B;  1U5P A;  5HBU A;  2NTX A;  4MBQ A;  4AIU A;  3B13 A;  3ZT6 A;  2EH3 A;  3TLS A;  2R7S A;  2BBH A;  2LHR A;  1ZKE A;  4DV3 T;  3ZQF A;  2WQY A;  5EK2 A;  4MFR A;  1SGM A;  2M6I A;  5LGN B;  3UUB A;  2LM9 A;  4PNI A;  5AQC A;  4AIS A;  2H89 A;  5L3B B;  4I55 E;  2BG9 B;  3C98 B;  4B3S T;  4JI3 T;  3VOX A;  4TWD A;  2LT3 A;  2GEN A;  3RIU C;  2XAF B;  3F31 A;  3G06 A;  3MKD A;  4AKH A;  2V5D A;  5LCY A;  3L09 A;  4XAX B;  2XHE B;  4B3R T;  2NW7 A;  4JBW F;  4KI0 F;  4JI7 T;  2PBI A;  1UX5 A;  5IOZ A;  3UU3 A;  3AQS A;  1MND A;  4ZI3 D;  4C2M A;  4HFB A;  1W0A A;  5GP9 A;  2M67 A;  2G0U A;  3MA9 A;  5KX5 E;  4LF9 T;  4H9R C;  3DJB A;  3PE0 A;  3KBT A;  2FJD A;  3O1J A;  1T8B A;  5JR9 B;  4ZEY A;  1HF8 A;  4QH1 A;  4UDS A;  2ZM6 T;  4EXT A;  1LVF A;  5F1J A;  3TKL B;  2BS4 A;  1D1B A;  2IIU A;  4GKK T;  4B1R A;  2CHO A;  4OK0 A;  4UF0 B;  3GA8 A;  2RAE A;  2QRX A;  2D0T A;  5JRC B;  3V5S A;  1S94 A;  2E8I A;  3RIF A;  3CML A;  4LML A;  3WI3 A;  3Q9D A;  1KK7 A;  3A5X A;  1LKX A;  2KLQ A;  3L3P A;  2WWU A;  3IHR A;  2Q9Q B;  2NW8 A;  2UUA T;  3VP5 A;  3AE3 A;  5ABG A;  2XAH B;  4M3E A;  4ZI2 C;  3AXJ A;  5L3D B;  3O60 A;  3A8Y C;  2H7V C;  4HFD A;  4QX7 B;  4HN9 A;  2DWK A;  3LOC A;  2LEH A;  4H9Q C;  3M65 A;  3V5U A;  4JEU B;  1JTY A;  3EUH A;  2YDS A;  4EB6 E;  4G12 A;  2V6X A;  2PG8 A;  2ID6 A;  3RX6 A;  4NXM T;  3O8G A;  2HN1 A;  2V5C A;  2XPK A;  2WU2 A;  3FZK B;  2QKO A;  2X0H A;  5CFB A;  2NS7 A;  1XZY A;  4HWH A;  2ACZ A;  4NXN T;  4QKN A;  4ZZB A;  1G8X A;  5AQL B;  4YHH T;  1VRB A;  2H7O A;  2WV1 A;  3JAE A;  2D5U A;  3COL A;  4IDQ A;  1U9O A;  2IU5 A;  4UEL A;  4X65 T;  3AEE A;  2UXN B;  3HKE E;  2KXP B;  3IH4 A;  2R7R A;  2X68 A;  5IP6 A;  4I43 B;  3UU4 A;  2IEK A;  2CHN A;  4OX9 T;  3HKD E;  3SFD A;  2VKO A;  4WW0 A;  5FMP A;  3PU3 A;  4ILB A;  4GFK A;  3CPZ A;  4KX6 A;  4DR4 T;  3LSJ A;  3PUV F;  3HTI A;  4O2A E;  3FZL B;  1WLX A;  3F1B A;  2WUI A;  5DJQ C;  3AE7 A;  3IH3 A;  1ZP0 A;  2LRL A;  3G56 A;  4X1K E;  4EZ4 A;  1WFD A;  1YKE B;  2ZY9 A;  4ZZC A;  3PU8 A;  2G7L A;  3TP3 A;  4YY3 T;  3FXD B;  3ZKR A;  3FK7 A;  2V7J A;  4X1Y E;  5JDG A;  2NR4 A;  1JT0 A;  1IBM T;  3QB5 K;  1D0Z A;  2HPL A;  4ME9 A;  1HX1 B;  3ZLI A;  2V7K A;  2LJL A;  4DR1 T;  2V8S V;  2Y6X A;  1NEN A;  2ID3 A;  5LHI B;  1UI5 A;  5LGU B;  2LSJ A;  3P4R A;  4FJO A;  3RC8 A;  4A97 A;  4KP3 C;  1MMA A;  2WBL A;  4M3F A;  3GWH A;  3MJX A;  5EFY A;  4EGW A;  3WHB A;  5F0C A;  5JDM A;  5J3L A;  3RLF F;  3AE9 A;  4WNK A;  5FL1 A;  2CWY A;  2BKP A;  3HI2 A;  2G3B A;  3OJA A;  1QVU A;  3BQL A;  3LK3 B;  2VQF T;  4QXH B;  5ABH A;  4TV8 E;  2WZI A;  3ONJ A;  3RGL A;  4ZS3 A;  3P9T A;  2XSB A;  4AC6 A;  5L3E B;  3FK6 A;  2REK A;  3BCG A;  3KKD A;  2MYS A;  2IAK A;  3ZQL A;  2KIN B;  3RKG A;  3RRW A;  2QWT A;  3KIN B;  3CX6 B;  3FIW A;  5IYZ E;  4KUM B;  3ANG A;  4MAL A;  4OYK A;  2R6G F;  2IAI A;  3OKQ A;  2ZCX A;  3A7M A;  3PUS A;  4JI0 T;  2WGB A;  4QH5 A;  4ILA A;  2K48 A;  2CXD A;  3PJA A;  4I4T E;  5FY1 A;  1MMG A;  4W97 A;  4YTM A;  2WSS V;  3VVY A;  4MHC A;  3FHN A;  2I10 A;  4HKU A;  2ZOZ A;  3HGY A;  4ZI3 C;  2ZM0 A;  3BQY A;  3O4X E;  4GOU A;  2F07 A;  2WWV A;  2PJQ A;  4PXI A;  3LK2 B;  1S35 A;  2L9Q A;  3VR9 A;  3LWJ A;  3VR8 A;  4DID B;  4AKL A;  3UFG A;  5LJM A;  2ZCM A;  2N2N A;  4DV2 T;  5FVL A;  3BK9 A;  2HH7 A;  5LA6 E;  2OER A;  2XQ5 A;  2XQ7 A;  1FMW A;  2W0G A;  3AE1 A;  2V7I A;  2WP9 A;  2R7U A;  3AE4 A;  4BJM A;  3VPR A;  1MIY A;  4UEM A;  2W63 A;  2I0M A;  4X20 E;  5FKM A;  4TNW A;  5HAX A;  4C90 A;  1JNR A;  3QOF A;  3P4S A;  4CXX A;  2YDR A;  2VKD A;  1MIW A;  4B3A A;  1Z8U A;  1HNZ T;  3VW2 A;  2WMO A;  3UUN A;  5KMG P;  3G7R A;  2QVA A;  1ORK A;  5DQV A;  2GFN A;  2JMK A;  3WHC A;  2LHN A;  3O1I A;  3ZMT B;  2O7T A;  1X79 A;  5LOV E;  3PTR B;  4WBN E;  2FJB A;  1D0X A;  1ZV4 X;  3ZYM A;  1T72 A;  4DMV A;  2KT9 A;  4TNV A;  4ADZ A;  3EAB A;  3GZI A;  4V2F A;  3OBV E;  3BR0 A;  2BG9 E;  4IHJ E;  5LMN T;  3AEF A;  5IUX A;  2Y30 A;  5FKN A;  5J1U A;  3IEE A;  3VW0 A;  2QGS A;  5AQM B;  2W66 A;  2E9X D;  4JYA T;  5C8Y E;  4QHO A;  2X0Y A;  3EUP A;  2XM1 A;  3AAE B;  4LMK A;  5ETW A;  4H9S E;  4JLE A;  1E2A A;  1HS7 A;  2BS3 A;  3QPS A;  2G7S A;  3KFW X;  3QB5 A;  3G1L A;  3C50 A;  3C07 A;  2X9Y A;  3CK6 A;  5F04 A;  1U4Q A;  2K5B B;  3SOL A;  3N9P A;  5HWY A;  2VKJ A;  2VUR A;  3J7Y q;  1CHU A;  2X9X A;  3EVY A;  4WBO A;  1OED E;  3ZYK A;  4L0R A;  3VKG A;  1BR4 A;  2V57 A;  4JNN A;  1B7T A;  3QPL A;  3BR3 A;  2UUB T;  3IUV A;  4H9P C;  5F8P A;  5DQW A;  3P4W A;  4L5G A;  3CX7 B;  2XAG B;  2L3L A;  3UU6 A;  2VK9 A;  1XNR T;  1SUM B;  2FBW A;  3NRY A;  3L8R A;  1KFY A;  5JDL A;  2MBG A;  2UXP A;  1QPI A;  4PFP A;  4UIG A;  4DW6 A;  3P8C D;  3GN5 A;  3CWR A;  3CQX C;  4AKI A;  3SDG A;  4P09 A;  3JAD A;  1KF6 A;  1RPW A;  2KWH A;  2XQ3 A;  3WAK A;  4QH4 A;  5CJ5 A;  4GK0 E;  4M1P A;  4QWN B;  2WDV A;  3NPI A;  5IWA T;  4NUU A;  1JNZ A;  5DAB A;  4WZX A;  4IDZ A;  4B3T T;  5L3C B;  3N5L A;  4X62 T;  4KHZ F;  3TLV A;  5H6Q B;  5FL0 A;  3N9M A;  4YTP A;  4IE6 A;  5FKL A;  2DG8 A;  2J62 A;  5FKY A;  5HSZ A;  4HWC A;  3C4W A;  5GPC A;  5HEH A;  3OPC A;  2UXB T;  3S4U A;  3HTA A;  3AEG A;  5IPA A;  2LSI A;  1WR6 A;  4ICH A;  3HTJ A;  4OD5 A;  5FY7 A;  4JEH B;  5CA0 E;  3MK7 C;  1G73 A;  2HYT A;  2W4X A;  4I76 A;  4AXP A;  2HXO A;  3AVR A;  1ZK8 A;  3AE6 A;  2M6B A;  1IBL T;  4HWI B;  1OED B;  5AQI B;  3BJB A;  5JR9 A;  4OHF A;  3ZQI A;  4DR5 T;  3JCF A;  3HR0 A;  3J9X 1;  3RYC E;  3LJC A;  2ODU A;  1N36 T;  3ZMU B;  1BR2 A;  3PJA J;  2NP9 A;  4MK6 A;  3VOK A;  4CXW A;  3ZT5 A;  3CQG B;  2K3W A;  4GK5 E;  3BR6 A;  3IH2 A;  4JI8 T;  4JI4 T;  3LBX A;  2V1D B;  3RYI E;  1OXZ A;  3HKC E;  1BR0 A;  2VPR A;  4AQY T;  2VL8 A;  2ZB9 A;  2B76 A;  4DND A;  4I50 E;  2F4V T;  3HIM A;  3PUR A;  1R8I A;  5CXI A;  3BTL A;  1UUR A;  2LM2 A;  2YVX A;  1UGO A;  4K0U A;  4U31 A;  3BR5 A;  3AA0 B;  1BR1 A;  5JH7 E;  4JI6 T;  3JSJ A;  3MAC A;  2YKS A;  3JC6 C;  2VL0 A;  3Q5W A;  1VCT A;  2CRB A;  3BTI A;  1X9B A;  3AAI A;  3VHL A;  3H3M A;  2JQK A;  3ANW B;  5HXR A;  4ZHQ E;  3ZCI A;  5DAJ A;  2LLY A;  4YSZ A;  2OA5 A;  4OFZ A;  4NPP A;  2G0E A;  5J1R A;  2YIN A;  3UTK A;  1N33 T;  3LDQ B;  3AE8 A;  2E5L T;  3P7I A;  5BMV E;  3WAJ A;  2V6Y B;  3SS1 A;  4HFE A;  3RYF E;  1HNW T;  2X9D A;  1WRD A;  5JVD E;  2KWI B;  5CQG A;  3PUY F;  2ZCN A;  2EHO A;  4DVD A;  1J1J A;  4IT4 A;  3NRX A;  4AC0 A;  2GK9 A;  3CIR A;  5EK3 A;  3ESL A;  3ON2 A;  4Q25 A;  5L4H A;  3RQU A;  5JQG E;  3VRA A;  5F27 A;  2KND A;  1VOM A;  3LBX B;  3RIU A;  3Q2M A;  4IRE A;  5CW8 A;  2Q9Q A;  1JUS A;  3ZJ2 A;  2IHR 1;  3KDS E;  5J1G A;  3L39 A;  3BR1 A;  3W15 B;  2I59 A;  2VVN A;  4ZI7 E;  3HKB E;  2YN6 A;  4EYY R;  2NOX A;  2W53 A;  1SA0 E;  3KNW A;  1IJ6 A;  2RAS A;  2IDO B;  1T7S A;  4X1I E;  2YU1 A;  3OYX A;  4EED A;  3RD3 A;  1VCS A;  5AQO B;  1KNR A;  5TAO A;  2CXF A;  2WAU A;  1FJG T;  5KDM C;  2IC6 A;  3FZH B;  4CI3 B;  2XM2 A;  4MLK A;  1W09 A;  4HWD A;  3QNU A;  4EIW A;  4X66 T;  3T6N A;  2TRT A;  3UUL A;  5EZH A;  2QYW A;  2UXI A;  4XK4 A;  2XGD A;  4YFS A;  2NS8 A;  2FJA A;  3KBU A;  1UX4 A;  3ZPO A;  3QQA A;  2XQ8 A;  3FBZ A;  5FKK A;  5GPA A;  3BQZ A;  5J2T E;  2A3D A;  1RKW A;  3B81 A;  2IC9 A;  3ETU A;  5K7H A;  4WIB A;  4V1A v;  1Z77 A;  3RQW A;  3T8O A;  2EHO C;  2XQ4 A;  3CQC B;  4NEL A;  3B6A A;  1YQ3 A;  3F57 A;  3RH3 A;  4GKJ T;  5FKO A;  1U9N A;  3K3O A;  2QOP A;  4TUY E;  5HEU A;  4TWF A;  3V6G A;  4C91 A;  4IDP A;  3RKO A;  2ZLY A;  2KMF A;  4NUV A;  3UU8 A;  4PJL A;  1US7 B;  3T1H T;  3RHW A;  2LRK A;  3Q0V A;  4DV5 T;  3AEC A;  5EZG A;  2XRL A;  2XPW A;  3KVA A;  1RKT A;  4I0U A;  2N1G A;  5L3F B;  2Q24 A;  5D18 A;  5JDF A;  2LSK A;  2JMH A;  2R7W A;  4U7Y A;  3P4Q A;  2XPV A;  2YVE A;  3N9N A;  2VKH A;  4YT0 A;  5A1L A;  5D1R A;  5HXC A;  5D19 A;  2UXC T;  3CDL A;  4UF0 A;  3ZMZ B;  2D6Y A;  2UXU A;  5F0H A;  1LRZ A;  4W1U A;  2Q9Q D;  3GN5 B;  2LE8 A;  3RH2 A;  3EDU A;  3FZF B;  2DG7 A;  1N32 T;  1MIV A;  2A2F X;  3ZQH A;  4L62 A;  4QXB B;  2PTF A;  4O4L E;  3DPJ A;  4JYK A;  4O8S A;  4JI1 T;  1A6I A;  1E1H B;  2N9D A;  4UR9 A;  4D5C A;  3UUX B;  3UUM A;  2W2U A;  3B57 A;  3ZCJ A;  4X1E A;  3ETV A;  4CN1 A;  4DO0 A;  2X51 A;  4DV4 T;  5CGM A;  1JTX A;  3UQ7 A;  2ACX A;  1OWA A;  4P0A A;  3DCF A;  2EHO D;  2V7L A;  2X9W A;  1HCI A;  3PM1 A;  5AQP B;  2Y2Z A;  3P4P A;  2P9B A;  3HTH A;  5C2T A;  2K9A A;  4DBQ A;  3FXE B;  4IL4 A;  2WCA A;  5LBQ B;  2E9X B;  4CGR A;  4JV5 T;  5LBM A;  2DTZ A;  4LF5 T;  3N2G E;  3ZC1 A;  4UV9 B;  5J1Y A;  1YKH B;  1IZN B;  4OYJ A;  5JRC A;  5AQS B;  3GMI A;  3KVB A;  5L3G B;  3H37 A;  2XZE A;  4XZC A;  2FJI 1;  3FZM B;  2WS3 A;  5K7Z A;  2CM0 A;  3LJL A;  3AED A;  4YZE A;  4QXC B;  3CKD A;  5FY0 A;  2X0L B;  5F08 A;  4IST A;  3JC6 D;  4J2C A;  2O7O A;  4YSX A;  3MVP A;  3EI0 A;  2OI8 A;  3Q5D A;  4KHP T;  3QBM A;  3DP7 A;  2HN2 A;  3ZSS A;  3CCY A;  1YXR A;  3ZN0 B;  1LVK A;  2CMR A;  3BTC A;  3KV5 A;  1HX8 A;  4ERR A;  2J4G A;  2DCF A;  1ZEE A;  4D7M A;  5HXE A;  3AQT A;  3GEU A;  4LF7 T;  2BBJ A;  2UXO A;  4ILC A;  5FP3 A;  3AA6 B;  4U9N A;  2IW5 B;  2YK0 A;  2CEA A;  5F3J A;  4BJN A;  3OVU A;  1H7C A;  4KBM B;  3ZN1 B;  2JPF A;  2E9X A;  1W9R A;  4HFV A;  5EYR A;  2R7T A;  3N9O A;  5AQV B;  4EOZ B;  3HL6 A;  5IHY A;  2K24 A;  5J0Z A;  2IML A;  1UCU A;  2YOE A;  3BHQ A;  3EGQ A;  1NWM X;  1QLB A;  2DI4 A;  3IBP A;  2TCT A;  5KXJ A;  2JIW A;  5AQG B;  3OYZ A;  2JJ7 A;  2ZOY A;  1HG2 A;  1MNE A;  4D7N A;  2RPA A;  3PUZ F;  3UT5 E;  5ABE A;  5FXV A;  2ODV A;  2E5V A;  4HE8 A;  4PW8 A;  2AE9 A;  4EEB A;  5LHG B;  5E0O A;  2QA7 A;  3QK6 A;  4H9N C;  3P50 A;  3OTO T;  2X9H A;  4DR3 T;  1V9D A;  2WZH A;  3EHZ A;  4U74 A;  3ZC0 A;  3VUQ A;  2CBJ A;  4E7Z A;  4WYV A;  2WB5 A;  2XY8 B;  2PZ9 A;  3UFE A;  3BRU A;  1XDO A;  2D0U A;  4UVA B;  2FQ4 A;  3PAS A;  4KWA A;  3I0Q A;  4AF5 A;  3BR2 A;  2X67 A;  2WMN A;  3ONL C;  1QUU A;  2R7O A;  2CBI A;  1GQE A;  4PFO A;  4UVC B;  3BTJ A;  5H9T A;  2LOS A;  3DU5 A;  5HYA A;  1BJZ A;  3PUW F;  3G1M A;  2XQ6 A;  3PUA A; 
#chains in the Genus database with same CATH homology
 3ONX A;  3EDV A;  5L2L A;  3RYF E;  4ZS2 A;  5JDM A;  2NWB A;  4H63 V;  1WRD A;  5JVD E;  4WNK A;  2KWI B;  2EHO B;  3NS4 A;  5JR9 C;  1MMN A;  3ZMS B;  5HXH A;  5CQG A;  4TV9 E;  3O1H A;  2CWY A;  4O4H E;  3RC3 A;  3O9X A;  3HI2 A;  4IIJ E;  4PJJ A;  3OJA A;  2DWG A;  3BQL A;  3LK3 B;  2EHO A;  4QXH B;  4DVD A;  4TV8 E;  5EZY E;  3NRX A;  2HPJ A;  4ZS3 A;  2GK9 A;  5EK3 A;  2CLY B;  3ESL A;  3BQI A;  5JQG E;  2KND A;  5L3E B;  3R84 B;  1VOM A;  3I1A A;  3LBX B;  3Q2M A;  3F2E A;  4EYU A;  2MYS A;  2Q9Q A;  2KZ7 B;  3R6N A;  1IJ5 A;  3AB3 B;  5LP6 E;  2IAK A;  4O4I E;  3CVR A;  2KIN B;  3K3N A;  3ZJ2 A;  4IE5 A;  2XTL A;  3RRW A;  3KDS E;  5J1G A;  3KIN B;  2V7M A;  3CX6 B;  5IYZ E;  3W15 B;  4KUM B;  2I59 A;  2C5I T;  2Q9Q C;  3AAA B;  4MAL A;  5FYM A;  4OYK A;  4ZI7 E;  3HKB E;  4EYY R;  2LOP A;  2NOX A;  3LG7 A;  3OKQ A;  1KNZ A;  3SRZ A;  1SA0 E;  1IJ6 A;  3NZQ A;  1CUN A;  3PUS A;  1T98 A;  2X66 A;  3H3A A;  2MTQ A;  2NTY A;  2K48 A;  1D1A A;  2CXD A;  2YU1 A;  4X1I E;  3OYX A;  4I4T E;  4TN7 B;  5EK4 A;  5LHH B;  5FY1 A;  1MMG A;  2Y8D A;  2CCQ A;  4JUY A;  2ZMA A;  1HG5 A;  2WSS V;  4MHC A;  3FHN A;  5TAO A;  2CXF A;  2WAU A;  2D2S A;  5ADX L;  5KDM C;  2IC6 A;  4YJ3 E;  3AVS A;  4HKA A;  4CI3 B;  4MLK A;  2B3W A;  4ZI3 C;  4QX8 B;  4EIW A;  2ZM0 A;  3MXZ A;  2E9X C;  4IGU A;  2CA5 A;  2BDE A;  5LG4 A;  3O4X E;  4EAH A;  3UUL A;  3VTI A;  2JJ9 A;  4CZZ B;  4GOU A;  2A72 A;  2C5J A;  1HFA A;  2V26 A;  3KYL A;  2PJQ A;  3ANW A;  5CB4 E;  4YFS A;  3LK2 B;  4PJN A;  3KV9 A;  3KBU A;  1S35 A;  2L9Q A;  2SPC A;  3D0T A;  1UX4 A;  1EZ3 A;  3NBX X;  3FBZ A;  3ZPO A;  4AKL A;  4XBF B;  2CLY C;  3KV4 A;  5LJM A;  3U3I A;  4AI6 A;  2N2N A;  2YEV C;  2A3D A;  5J2T E;  3BK9 A;  2HH7 A;  2XAQ B;  5LA6 E;  5LNK A;  1QSD A;  2Z6E A;  1FIO A;  2IC9 A;  3FB2 A;  4P0B A;  1FMW A;  3ETU A;  1Z0P A;  2VB6 A;  1MMD A;  2W0G A;  4A56 A;  2XUE A;  4V1A v;  3C51 A;  2V7I A;  3T8O A;  2EHO C;  2R7U A;  3CQC B;  4BJM A;  2MOZ A;  3RH3 A;  3F57 A;  1MIY A;  4E7S A;  4GIW A;  2CWO A;  4UEM A;  2XQY A;  5GON E;  3K3O A;  4U72 A;  3PUG A;  2XAS B;  2DLR A;  2W63 A;  4G63 A;  3I0O A;  4X20 E;  1D1C A;  4TUY E;  5HAX A;  4C90 A;  4PAG A;  4ASK A;  3N9L A;  4C91 A;  4ISS A;  3RKO A;  1YD8 G;  2ZLY A;  2KMF A;  2NW9 A;  4NUV A;  4UV8 B;  1Y64 B;  4PJL A;  2J1D G;  2L8K A;  2C0S A;  4H9O C;  1US7 B;  2YU2 A;  2VKD A;  4CXX A;  1MIW A;  4HTE A;  3K8P C;  5JDQ A;  2WMO A;  3UUN A;  5J2U E;  5KMG P;  4FI5 A;  1IAP A;  5DQV A;  2H3R A;  1WYC A;  1ZHC A;  4OD4 A;  3KVA A;  4UVB B;  2JMK A;  2N1G A;  4H63 H;  2LHN A;  5L3F B;  3O1I A;  3BQK A;  5JDF A;  3ZMT B;  2W61 A;  3RPU A;  2LSK A;  1X79 A;  2JMH A;  2R7W A;  5LOV E;  3SWH A;  3E22 E;  2BZB A;  3K3Q C;  3PTR B;  4WBN E;  3NZP A;  1D0X A;  1ZV4 X;  3ZYM A;  4UXN B;  2JQQ A;  1WYB A;  4ANJ A;  3RRC A;  5JRE A;  3N9N A;  4DMV A;  2KT9 A;  2VKH A;  2UXX B;  5A1L A;  4ADZ A;  4IE4 A;  1U5P A;  5HXC A;  2NTX A;  3OBV E;  4MBQ A;  3HA4 A;  3B13 A;  4IHJ E;  4L9I A;  4UF0 A;  3ZMZ B;  3ZJ1 A;  3VKH A;  4AKR B;  1LRZ A;  4ZOL E;  2VAS A;  2R7S A;  2Q9Q D;  2LHR A;  3E08 A;  1ZKE A;  3GN5 B;  2LE8 A;  1FMV A;  2QGS A;  3IEE A;  3EDU A;  2E9X D;  5EK2 A;  4MFR A;  5C8Y E;  2LSG A;  5LGN B;  4QHO A;  2LM9 A;  1MIV A;  1NAF A;  2RP4 A;  4PNI A;  2A2F X;  3DU6 A;  5L3B B;  3QC9 A;  4I55 E;  3C98 B;  3AAE B;  4QXB B;  5ETW A;  2LT3 A;  4O4L E;  3ZEF B;  4H9S E;  4JLE A;  4O8S A;  2XAF B;  1HS7 A;  3F31 A;  4BAY B;  1E1H B;  2N9D A;  3MKD A;  4AKH A;  2LSY A;  5LCY A;  3KFW X;  3L09 A;  4CI2 B;  3C50 A;  4XAX B;  3UUX B;  2XHE B;  3PDY A;  2X9Y A;  3UUM A;  4YHJ A;  2NW7 A;  3CX8 B;  3B57 A;  2W62 A;  3ZCJ A;  1U4Q A;  4TX5 A;  3ETV A;  3LFM A;  2PBI A;  1UX5 A;  2Y48 B;  2K5B B;  1O3X A;  3SOL A;  4DO0 A;  2X51 A;  3N9P A;  4IE0 A;  2VKJ A;  5HWY A;  4YJ2 E;  1MND A;  4O4J E;  4ZI3 D;  4IRV A;  3C4X A;  4C2M A;  2ACX A;  1OWA A;  3J7Y q;  4P0A A;  4HGA A;  2EHO D;  4ZI2 D;  2V7L A;  2X9W A;  2M67 A;  1HCI A;  2G0U A;  3MA9 A;  3C4Z A;  5KX5 E;  4H9R C;  2X9X A;  1D0Y A;  5AFU L;  2P9B A;  3DJB A;  3PE0 A;  3KBT A;  2K9A A;  3EVY A;  3ZYL A;  4DBQ A;  3FXE B;  4WBO A;  5FNV E;  3O1J A;  5LBQ B;  4L0R A;  2E9X B;  3ZYK A;  3VKG A;  1BR4 A;  5JR9 B;  1B7T A;  1HF8 A;  2B1E A;  5LBM A;  4H9P C;  4EXT A;  3N2G E;  1LVF A;  4UV9 B;  5DQW A;  5F8P A;  3ZC1 A;  3TKL B;  4PK4 A;  4L5G A;  3CX7 B;  1D1B A;  2XAG B;  1YKH B;  2L3L A;  1IZN B;  2VK9 A;  4OYJ A;  5JRC A;  4IE7 A;  3RYH E;  5M4Y A;  3NRY A;  3GMI A;  3KVB A;  4OK0 A;  3CWZ B;  4UF0 B;  5L3G B;  5JDL A;  3GA8 A;  2MBG A;  3H37 A;  4ILU A;  4XZC A;  2D0T A;  4B6X A;  4PFP A;  5LYJ E;  4PK6 A;  2FJI 1;  3ZMV B;  5JRC B;  4UIG A;  3V5S A;  1S94 A;  4HEA A;  3VU7 H;  2CM0 A;  2E8I A;  2DHR A;  3P8C D;  4DMW A;  3GN5 A;  3CML A;  5LGT B;  3WI3 A;  4BA9 A;  3Q9D A;  1KK7 A;  3CQX C;  3A5X A;  1LKX A;  4AKI A;  2KLQ A;  4TZ4 C;  4P09 A;  3L3P A;  4AKG A;  4QXC B;  2WWU A;  3IHR A;  2Q9Q B;  3CKD A;  2KWH A;  4GYS A;  5FY0 A;  2NW8 A;  2X0L B;  3WAK A;  4IST A;  3KV6 A;  3JC6 D;  4GK0 E;  4M1P A;  4J2C A;  2XAH B;  4ZI2 C;  4QWN B;  2JRK A;  5L3D B;  4NUU A;  3DP7 A;  4F6R C;  2H7V C;  4QX7 B;  4HN9 A;  2DWK A;  3ZN0 B;  3N2O A;  1LVK A;  2CMR A;  2LEH A;  4H9Q C;  2C5K T;  3M65 A;  5DAB A;  3V5U A;  5JDN A;  1HTJ F;  3EUH A;  4JEU B;  5HXS A;  4IDZ A;  3KV5 A;  5L3C B;  4N78 D;  3N5L A;  1HX8 A;  4ERR A;  4EB6 E;  2VWA A;  5H6Q B;  2PG8 A;  3N9M A;  3RX6 A;  2DCF A;  1ZEE A;  4IE6 A;  2R7X A;  5HXE A;  5FXZ A;  3N2K E;  3LK4 2;  5LXT E;  1YW0 A;  1FEW A;  5FP3 A;  3C4W A;  3AA6 B;  2IW5 B;  2YK0 A;  2CEA A;  5F3J A;  4BJN A;  3S4U A;  1H7C A;  4KBM B;  4QKN A;  2LSI A;  3ZN1 B;  2JPF A;  2E9X A;  1WR6 A;  4HFV A;  4OD5 A;  1G8X A;  1SHZ C;  5FY7 A;  2R7T A;  4JEH B;  3I9Y A;  5HWX A;  5CA0 E;  1VRB A;  3MK7 C;  3N9O A;  2H7O A;  4EOZ B;  1G73 A;  5JDH A;  2BVM A;  3AA1 B;  2D5U A;  3HL6 A;  5IHY A;  4UEL A;  2R7V A;  2K24 A;  4AXP A;  4CI1 B;  3IF8 B;  3AVR A;  1UCU A;  2R7Q A;  1NWM X;  2CXL A;  5JR9 A;  4OHF A;  2UXN B;  1AJ3 A;  2DI4 A;  3HKE E;  2KXP B;  3IBP A;  3HR0 A;  3QUJ A;  3J9X 1;  4GYR A;  2CE7 A;  3RYC E;  2R7R A;  3LJC A;  2X68 A;  3OYZ A;  4CXY A;  4I43 B;  2ODU A;  1HG2 A;  5H6R B;  3ZMU B;  1MNE A;  1BR2 A;  2ZM2 A;  3HKD E;  3U78 A;  4PK5 A;  2NP9 A;  5FXX A;  2VKO A;  4WW0 A;  4CXW A;  3UT5 E;  3PU3 A;  3CQG B;  4GK5 E;  5FXW A;  5FXV A;  3CPZ A;  2ODV A;  2BVL A;  4Z8X A;  2W00 A;  4HE8 A;  4PW8 A;  3LBX A;  4O2A E;  2V1D B;  5LHG B;  4DVY P;  1WLX A;  3RYI E;  1OXZ A;  3HKC E;  1BR0 A;  5E0O A;  2VL8 A;  5DJQ C;  2QA7 A;  3DTO A;  3QK6 A;  4DND A;  4I50 E;  4H9N C;  3PUR A;  2ES0 A;  4X1K E;  4YLH A;  2X9H A;  4AQF A;  4EZ4 A;  1YKE B;  4K0U A;  1V9D A;  4O2B E;  2XAJ B;  3AA0 B;  1BR1 A;  3N9Q A;  2ZM8 A;  4U74 A;  3ZC0 A;  5JH7 E;  3PU8 A;  4CQI A;  3MAC A;  4E7Z A;  3JC6 C;  4AQF C;  3FXD B;  3Q5W A;  5LJN A;  2WM9 A;  2V7J A;  3UFE A;  3FBL A;  4KMC A;  2D0U A;  4X1Y E;  4UVA B;  5JDG A;  3MZK B;  3AAI A;  3I0Q A;  3VHL A;  3C64 A;  1D0Z A;  2HPL A;  2X67 A;  3ANW B;  2WMN A;  5HXR A;  3ZLI A;  4AQG A;  3ZCI A;  4ZHQ E;  2V7K A;  4G2A A;  2LJL A;  5CA1 E;  3AA7 B;  5FMN A;  4DBR A;  4EZH A;  1QUU A;  2R7O A;  2OA5 A;  4PFO A;  4UVC B;  4OFZ A;  2Y6X A;  2PFV A;  5LHI B;  2YIN A;  2DNX A;  5LGU B;  2LSJ A;  3PUQ A;  3E0Z A;  3UTK A;  4FJO A;  3RC8 A;  2LOS A;  4KP3 C;  4PJM A;  3DU5 A;  5HYA A;  1MMA A;  2WBL A;  3GWH A;  3P7I A;  3MJX A;  5BMV E;  3WAJ A;  3Q5X A;  3SS1 A;  2RA1 A;  3I9W A;  3PUA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...