1RKWA

Crystal structure of the multidrug binding transcriptional repressor qacr bound to pentamadine
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
186
structure length
186
Chain Sequence
NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKKEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of QacR-diamidine complexes reveal additional multidrug-binding modes and a novel mechanism of drug charge neutralization.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription
molecule keywords Transcriptional regulator qacR
total genus 78
structure length 186
sequence length 186
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2003-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1rkwA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 1rkwA02
4MO7A 3RKQA 1SANA 3QPLA 2D6YA 2ZCMA 5FKNA 3M4OJ 3NAUA 3S1MJ 1U9NA 2G0EA 1H88C 3RH2A 3CRJA 2WUIA 5J1UA 2HXIA 1VFCA 1I3QJ 1JKPC 4I6ZA 4IHYA 3HTAA 4D7NA 5EF6A 3LJLA 5E3OA 2IU5A 2N8GA 3PPBA 2NP3A 1TWHJ 2M9HA 1X58A 1VNDA 4FISA 3SJMA 5EZHA 4JKZA 2W53A 2DA7A 2CRGA 2NVQJ 2E19A 5CXGA 2NX4A 2DMPA 3HDDA 4GFBA 2GM4A 3HKZN 3PM1A 4GCTA 1PUFA 2VKVA 3S17J 1ETOA 2HI3A 5DTDA 4B1RA 4A3DJ 1BW6A 3ZQLA 3TP3A 4Y7NJ 3G7RA 1TWCJ 4MLOA 1JTXA 3HGGA 9ANTA 4GCLA 1UHSA 3BR1A 4FE4A 2ZOYA 1XG1A 1FEXA 3GTLJ 1VF9A 4D5CA 3CJDA 3JRCA 3B6CA 3BG9A 4XRSG 1QVTA 3E7LA 2R5ZA 2V57A 3VVXA 2GFNA 1I50J 2L7MP 3AQSA 1Z0XA 4M3DA 2QOPA 1RKTA 1TWFJ 2PMZN 2DA5A 3BG5A 3BQZA 4ACIA 3BQYA 1AKHA 2EZIA 2XPWA 5IP6A 1X2NA 3GZIA 3RZOJ 4M3BA 2EZLA 4M3GA 4AF5A 1UMQA 2W48A 1BW5A 4ICHA 2VPRA 2QTQA 5EGOA 3ON2A 2CU7A 1U78A 2RHAA 3HIMA 2AHQA 3M3YJ 1POGA 1GDTA 4A3FJ 2WGBA 5FHPA 5JLXA 3QPSA 2Y0SN 2R7ZJ 3ANPA 3GEUA 4A3BJ 1B72B 3FKIJ 1QVUA 3PASA 2DA1A 5HBUA 5EGOB 4IHVA 1GUUA 1IDYA 2P81A 3OOUA 5M5XJ 3IV5A 5IYDJ 1ETVA 4W97A 1GVDA 5K58A 5IP7J 2HYTA 1HCRA 3ON4A 4C3IJ 3P9TA 2OERA 4L5EA 2Y2ZA 4FTHA 2K9QA 2ME0A 1ETYA 4GFLA 1JT6A 2Y30A 3LSJA 1YRNB 2G7LA 2NP5A 3GTQJ 1IRZA 2YS9A 2KDZA 3LSRA 4YZEA 1JJ6C 1P7JA 2O7OA 2M8GX 4A69C 3DPJA 3PO2J 3QBMA 5HSZA 2DG7A 1E3OC 2XDNA 2WB1N 3ANGA 1DU0A 3KNWA 2YUSA 2G3BA 3CDLA 1U8BA 1A6IA 3BTLA 5H9TA 2WAQN 4DZJA 1D5YA 2E1OA 1XS9A 2EQRA 3WHBA 1JGGA 3H0GJ 4AC0A 5E3MA 2H8RA 2FX0A 3VW1A 2XPVA 4AUXA 4X6AJ 1ZR4A 5F1JA 5BNGA 1Q1VA 1OJLA 1Z77A 4X1EA 4GFKA 3HM5A 2G7SA 1LFBA 3ZQIA 3JREA 5M3FJ 1VI0A 1IDZA 2O7TA 5CW8A 2L7ZA 2NOGA 3BR3A 2ZCXA 3GTPJ 3VOXA 4JX6A 2DMNA 2KT0A 3L1PA 1U9OA 4BY7J 3LSGA 2OF7A 1ENHA 1MBEA 3VW2A 3VVZA 4JX4A 1ZQ3P 3D1NI 3IH2A 2UXHA 2EBIA 5DS9A 2MSYA 2CJJA 4UDSA 3C2BA 1FIPA 3A01B 2R5YB 4RBOA 3RZDJ 1LE8B 3DCFA 3S1NJ 5D18A 1RKWA 5FKLA 1DU6A 2GUHA 5F27A 3KKDA 4B4CA 2FBQA 2X48A 3TEDA 1AHDP 5C3EJ 4A3EJ 3EGQA 5AQCA 3ZQCA 3LNQA 5F0FA 4XICA 3GTKJ 2RAEA 2JK3A 1MSEC 2GLOA 3Q0WA 2M0CA 3BT9A 4HNVA 2QIBA 3NPIA 1BA5A 1K83J 1T33A 3RD3A 4JX5A 5GPCA 3VW0A 1T56A 1HDDC 1JUMA 2DMTA 1CQTA 2CQQA 1RPWA 1RR7A 5HODA 1TC3C 3HOXJ 1GT0C 1QRYA 2XSDC 1ETQA 2K9NA 3JRAA 5EFYA 4MFDA 2HOSA 1UI6A 3TP0A 1TWGJ 4D5FA 3SFIA 2VI6A 1ZTRA 2JN6A 4JNNA 3FK7A 4UUSB 1RETA 3HB9A 1MBHA 3BTIA 2AO9A 3HBLA 3LOCA 1ITYA 2JJ7A 3FK6A 5DAJA 1SGMA 3WHCA 5C4XJ 2R93J 2CUFA 4RDUA 5C4YA 2MG4A 3GBGA 3FRQA 2JA6J 2MW8A 2M2EA 4DYQA 2LY9A 4DW6A 2ZCNA 3V78A 2R0QC 1QPIA 1H8AC 3A01A 1HLVA 3MN2A 1AU7A 4A3LJ 5FMPA 2YVHA 1JUPA 3HOWJ 1Y1VJ 3FISA 1FTZA 4UUTA 4MXMA 2ME6A 4M3EA 5IYCJ 2HOTA 3KKCA 3HOUJ 1OCPA 3MKLA 5J3LA 5E3LA 2L9RA 5E3NA 5K7HA 2IBDA 2NS7A 2F07A 5CXIA 3CWRA 3Q0VA 2ID6A 1PUFB 2LLKA 2XB5A 1TWAJ 2DG8A 2FQ4A 2E2JJ 1EF4A 4JL3A 4QSHA 1W0TA 5M5YJ 2LP0A 3JR9A 4J19A 2HKUA 3S16J 1GV2A 3TW7A 4BBSJ 2DMQA 2K9SA 2IEKA 3NI7A 1OCTC 1LFUP 2EZKA 4DZPA 5GPAA 1K61A 1WGXA 2LKXA 4A3CJ 3BCGA 4I76A 2NS8A 5F0HA 5IOZA 4ME9A 4LOCA 3HOZJ 4ABZA 5FLVA 4BKXA 3I4NJ 2FJ1A 3HTIA 2X6OA 5F04A 4A3KJ 3HE0A 2Y31A 1Y1WJ 5C4JJ 2JA8J 3HOYJ 5D1RA 2WV1A 3A02A 2RASA 2B63J 3BTCA 2O8KA 2XGEA 4IHWA 4XRMA 3K2AA 3EUPA 2LR8A 3CMYA 3NRGA 5FGLA 5EZGA 2K40A 2CUEA 2XRLA 3IH3A 3QQAA 3JRGA 1WI3A 2TCTA 2GENA 2UXUA 2ELKA 3BG3A 5EDNA 2UXPA 2PZ9A 4AC6A 1LE8A 3Q3SA 1FTTA 3G56A 2M34A 5FJ8J 5K7ZA 2ZB9A 1WH7A 3FIWA 3V6GA 3PO3J 4FE7A 3QKXA 4QIWN 5F08A 2JWTA 2CQXA 3K7AJ 1F36A 4MK6A 2JA7J 3HEFA 3S1QJ 2COBA 1XC5A 3IH4A 3BR5A 1JUSA 3OSFA 2FD5A 3KZ9A 2LTPA 2UXOA 5EYRA 4KWAA 5C44J 3VVYA 2HXOA 4A3JJ 4C3JJ 1RESA 1IUFA 1JTYA 3GTOJ 2Q24A 3O8GA 2HQ5A 3CQZJ 3T6NA 4MFEA 3NXCA 1H89C 4A3MJ 2UXIA 2DA2A 2IAIA 4NN1A 3JRIA 3IUVA 2R5ZB 2YU9J 2E2HJ 2VKEA 5M5WJ 5M3MJ 3JRHA 1SFOJ 5EG0B 1MBKA 1IGNA 1S7EA 4V2GA 3JRFA 1ETWA 2ID3A 3MVPA 1W0UA 3HTHA 3S2DJ 4HKUA 4FCYA 5IP9J 1NK2P 4Y52J 1MBGA 2DMUA 4XRSA 1JT0A 3O8HA 2NVXJ 2REKA 3BNIA 1B8IA 3JRDA 4AYBN 4DYCA 2XGDA 4QTRA 5IYBJ 2E2IJ 2NVTJ 5IPAA 2R92J 2DA3A 1YRNA 3HOVJ 2EH3A 4DYRA 4C3HJ 2HDDA 1MSFC 1A5JA 3C07A 1WCMJ 4W1UA 1ZR2A 2QKOA 3F1BA 3E7QA 3MNLA 4BXXJ 2MGQA 1JKRC 3GTMJ 2GBYA 3F0CA 4NELA 4V2FA 3BR6A 3OIOA 3VPRA 2ECBA 1P7IA 3A03A 5JLWA 2YVEA 2DTZA 2NVYJ 2LFBA 3DEWA 5F0CA 3ZOBA 1X2MA 2JMWA 2OPTA 3ZQHA 1JKOC 3AQTA 3COLA 3LWJA 4L62A 1GV5A 2XPUA 4B3AA 1HF0A 3BHQA 3OSGA 3GTJJ 3ZQFA 1UI5A 3B81A 1JKQC 2EZHA 4EEFG 1ZKGA 1B8IB 4GCKA 1WPKA 3VUQA 3GTGJ 2R5YA 3S2HJ 3S15J 3HTJA 3S1RJ 2OI8A 5EG0A 2XGCA 1ZGWA 2DJNA 1APLC 2JA5J 1NTCA 3BJBA 4PXIA 2H1KA 5EEAA 4XIDA 4CYCA 3BR2A 2QCOA 4A3IJ 1FIAA 1R9TJ 1BJZA 1HOMA 1MH4A 4JYKA 3VP5A 4JP0A 4G12A 5GP9A 2L7FP 1JJ8C 5FKKA 5J1YA 1MBFA 4NDLA 1IC8A 2HYJA 4M6VA 1AKHB 2O9LA 1HDPA 2LD5A 1MNMC 3JSJA 3G1OA 2QWTA 2Y9ZA 5FLMJ 2LVSA 4A3GJ 4BBRJ 2X9DA 4IEJA 4C2MJ 1G2HA 3VOKA 1ZK8A 1UG2A 2G7GA 3LHQA 1O4XA 4IHXA 4MIMA 3CCYA 3TW6A 1IV6A 1FJLA 1MH3A 4D7MA 3B6AA 2TRTA 5D19A 3G1MA 3BRUA 2ECCA 3BTJA 1WH5A 2L0KA 2XB0X 3ZQGA 3JRBA 3S14J 3VIBA 2LK2A 5K7FA 3NARA 3RQIA 2HOAA 5HAWA 4A93J 2QF7A 1IG7A 1ETXA 4UUSA 2D5VA 2PBXA 3BR0A 3NNRA 2ZOZA 2DN0A 1IJWC 3UKGA 2DA6A 1I6HJ 5IOYA 4S0HB 1MBJA 3LSPA 1B72A 3Q0UA 4CYCB 1OFCX 2DA4A 4BY1J 2I10A 4XK4A 5FKMA 2VUMJ 3I4MJ 1ORKA 3S5RA 3G1LA 1NK3P 4M3FA 3W6VA 3H3VK 3SDGA 2Y9YA 5J1RA 1ETKA 5FKOA 3O60A 1F43A 4CGRA 3HGYA 1BL0A
chains in the Genus database with same CATH superfamily
3ONQA 4BUPA 1L0OC 1YX3A 1SANA 4A5MA 1FBSA 3M4OJ 2X6WA 2VQLA 2ZXWH 4OMYA 2F48A 2G0EA 4RGRA 4XLNF 2WTEA 3NQOA 3RH2A 2BEOA 4BU2A 3FMQA 2KJBA 4IHYA 2RN7A 5FFZA 3E0JB 5E3OA 2IU5A 1TT0A 1WFXA 4Y17A 3B02A 4PFOA 1TWHJ 5BPIA 1OLTA 2IGNA 5TGTA 2HWVA 2R7UA 2Z1DA 1N75A 2IGMA 2FBHA 5CXGA 1FPQA 2Q2EB 2ESNA 2HTJA 3H9JA 4P1WA 3GLLA 4GFBA 3MD2A 2LMDA 2VKVA 2BW3A 1ETOA 2HI3A 2R7DA 3K10A 3IRRA 4XBFA 4A3DJ 1JXSA 3TP3A 3ZP5A 3G7RA 4YFNF 1ZGAA 1H9GA 4PDKA 3FKJA 1JTXA 1BR4A 2AS5F 4GCLA 3QP6A 3BR1A 1J59A 3G73A 3CO6C 1MMNA 4XSZF 2ZOYA 5E20A 3GVAA 1ZG3A 2KRHA 1HW2A 4AVPA 5GTIC 3TL4X 1HC8A 2IS4A 1QVTA 3DEUA 2V57A 4HV5A 5LEKA 1B9NA 4AYBA 2QOPA 4L9TA 3K8PC 2DA5A 3BG5A 2RNGA 3BQYA 1AKHA 4EJOA 2EZIA 2X1EA 2XPWA 1X2NA 3L2QA 2B7EA 3RZOJ 3GZIA 5JI6A 5D5UB 4E7LA 2E1NA 2E5ZA 3VOEA 4AF5A 4UV8A 4F93B 2V1DA 1MNEA 3PNVA 2R7TA 5L3BA 1MW7A 2XRNA 3M3YJ 2Y75A 2Z16A 2WGBA 5FHPA 5GAGJ 5HDNA 2Y0SN 3V42A 1MDMA 1B72B 3FKIJ 2E5NA 3PASA 5HBUA 4P9FA 4IHVA 1IDYA 5B3SH 1YFHA 3F6VA 1GXQA 2LY2A 2VONA 1RNLA 5K58A 5IP7J 4E6KG 4RS8A 3ABUA 4C3IJ 2OERA 2XAFA 2Y2ZA 2DTRA 1V5FA 4G6TB 1C0WA 2BGCA 4U0VA 3KETA 2G7LA 1IRZA 2YS9A 2KDZA 3LSRA 2W85A 2ZXJA 2W7NA 2O7OA 1UHWA 3DPJA 3G6EI 3LWFA 4ENMA 2OBPA 2MLGA 2DDBA 4Y13A 4ZDOA 4OAZA 3LSMA 2WB1N 3ANGA 2EB7A 1KYZA 2ZJ2A 3GYHX 2XAQA 1J9IA 1U8BA 3P5JA 4B8XA 4IO9F 1D0ZA 4DZJA 4AIDA 1D5YA 2G7HA 2E1OA 2IA1A 5HLGA 4NNJA 1BOAA 4LGWA 2OUMA 1ZR4A 1Q1VA 4LG0B 2Z3YA 4J00A 3I0TA 3U2RA 1ZHFA 2A5YB 3SZGA 3ZMZA 1VI0A 3GEZA 5JHFA 2LF7A 1XGNA 1VQ5I 5DV5A 3VYRB 3K69A 1WJEA 3V8LA 5CVUA 4UVCA 2PQ8A 3GTPJ 2FUG2 4CO8A 2OC6A 3OYKA 4NBQA 2DMNA 2KT0A 1U9OA 4BY7J 5J47A 1YE9A 2OF7A 3K4KA 5HNFA 1K6YA 1MBEA 4PZJA 3VW2A 4Z2YA 4DBQA 5DS9A 3JTHA 2RQQA 3DBRB 4IVNA 3DWLE 3K4LA 1FIPA 2X4HA 3I56I 2RV8A 2A2FX 1KU7A 1Z3XA 4J01A 5FLXK 3D0SA 5F27A 5B1AH 1VQ4I 4A3EJ 4E7KA 1MSEC 2H8WA 2F4OB 3H35A 4NC8A 3QRFF 3RD3A 3VW0A 3KEQA 2W82A 1Y56A 1HDDC 2DOFA 3SZTA 3DBHB 2OZ6A 5J8CA 1REPC 3UR3C 1OYIA 3HTUA 1RPWA 1U5TC 4P9UA 2EFOA 2XSDC 3CTAA 1ETQA 5CPRB 3JRAA 2VIXA 2H1LA 1T0FA 3F8BA 3TP0A 4BXUA 4BACA 3AAFA 1ZTRA 1TQIA 1Y8RB 2DAOA 3FK7A 1ZAOA 5L3CA 3E6CC 1Z3YA 4ON0A 3BTIA 3LOCA 3A0HC 5DAJA 1UFMA 1SGMA 4ETSA 5C4XJ 3K70D 5C4YA 3GBGA 2M30A 5J40A 2O6GE 3DBLB 2M2EA 1OR7A 2BE5F 2VKHA 2DFIA 1V55H 2M5WA 2VT3A 3F8FA 2VE9A 2ZCNA 3HL2A 4B47A 1QPIA 1Y39A 4WXDA 2MC3A 1AU7A 2YVHA 1IN8A 1Y1VJ 1FTZA 2VB6A 1X4OA 4M3EA 2PX9A 3T0YA 1P2FA 4CDGA 1B4AA 3CUOA 3TDZC 5E3LA 2F07A 2NS7A 2FE3A 1HXDA 2KQRA 1PUFB 1K78B 2XB5A 1TWAJ 3FDYA 1O3QA 2O03A 4XN3A 1WRJA 2JPCA 3LA7A 2E2JJ 4WXCA 3U1KA 1XGMA 4FX0A 4KT5C 2LP0A 1IXSB 3S16J 1D8JA 3GFJA 2M1BA 2XC7A 1GV2A 3RPUA 1YQAA 4KIBA 3TW7A 4BBSJ 1AWCA 3M8FA 3WU2C 2DMQA 3HSFA 2K9SA 3HZJA 4CCKA 4BE2A 2EINH 1OCTC 1LFUP 2XIGA 1F5TA 4DZPA 1RI7A 1KQ9A 4N0BA 1WGXA 2ZSHB 4E7ZA 2H94A 3CJNA 5D6EA 2XROA 1LUJB 2MBFA 4I76A 5F0HA 5IOZA 4BAYA 1WQ2A 2V6EA 4O6JA 3PFIA 3VDXA 1WI9A 1ZN2A 3E5XA 4E70A 1KONA 3CJRB 3W2WA 3RPQA 5CVIA 1T39A 1K6OA 3EDPA 2V79A 4CZZA 2GIZA 2FRHA 1FNNA 2YPRA 1TQPA 2VQGA 3P9KA 2LNBA 2XGEA 4IHWA 3FXRA 4XRMA 2V9KA 2LR8A 2JZYA 3GXOA 3CMYA 2P6TA 3HOTA 3M8JA 3IH3A 4F55A 2GENA 2UXUA 1WI3A 2NAZA 4BHBA 4BXFA 1DP3A 2HQAA 1I1SA 4AC6A 1I3AA 1LJ9A 1YJWI 4KIGA 2KZVA 1YIJI 2XASA 4BEHB 1RRJA 2DQLA 1S29A 5E79C 4L0YB 3V6GA 4DOZA 1CF7A 4YELA 5F08A 1SMYF 2CQXA 3VSLA 3JSOA 3KZIC 2KMUA 3CZ6A 3KP5A 2JA7J 3BC8A 1KZHA 1D1BA 1ZH5A 1E3HA 4UVBA 3KZ9A 2LTPA 2Y0MA 3VVYA 1O57A 4C3JJ 2QBYA 3G2BA 3MCZA 1KGSA 4HX7A 1BIAA 2Q24A 4MFEA 2P0WA 1H89C 3DEEA 4A3MJ 2DA2A 2IAIA 4U7DA 1D0YA 1VTNC 1XSDA 3IUVA 4PJMA 3V8JA 4A12A 4NN1A 3OS2A 4N9HA 5J6XA 2A6HF 4PSWA 3GFIA 2IVMA 3AG1H 3I58A 1IUYA 4G94A 2K4BA 2E36A 2LBFA 4XNFA 1XN7A 2IGKA 1IGNA 3LQRA 4BYYA 3KPHA 1Z1DA 2O5RA 3HTHA 3NS4A 2REKA 1JT0A 1ACIA 2VE8A 3KE2A 3JRDA 4ZDLA 4M6YA 4XR6A 2NVTJ 1P4WA 2BY1A 4QTRA 3OS0A 5IPAA 2R92J 2DA3A 1YRNA 4OIOF 2C6YA 2HDDA 4C3HJ 2JUCA 1S3JA 2A6TA 2HTSA 4U9NA 4YG2F 1MMDA 5FLXZ 1T98A 3WTXC 2WA0A 4MNUA 1OR7C 3FM5A 2MGQA 1JKRC 4A5NA 3F0CA 4PJLA 3VPRA 2A69F 1P7IA 2XF7A 1MMAA 5JLWA 3DEWA 2F5DA 1LQ1A 3E6MA 4RLQA 2F5VA 1GV5A 1MMSA 1BC7C 1R1VA 1HF0A 2QKLB 3GTJJ 4XKWA 3EUHA 4K2EA 1JKQC 4A0XA 4EEFG 2B9SA 2QQ9A 1WPKA 5FRNA 2CUJA 4UXNA 3S2HJ 2LKPA 3DTKA 1XMXA 1FX7A 3ELKA 2WWYA 5EG0A 4D0PA 2XGCA 3F22A 3I9V2 2NNNA 1APLC 4AVZA 2E71A 1NTCA 3BJBA 4CYDA 2FEZA 4XIDA 1FT9A 2XHKA 2QENA 1R9TJ 5JHUA 5A2QZ 4GCVA 5J8FA 2BV6A 4B43A 1EJ9A 2E1MC 3BCAA 2L7FP 1PUEE 1OCRH 2HGCA 5J1YA 5ILUA 3MMYB 1MBFA 1IC8A 2HYJA 2O9LA 2KP6A 3M1EA 5DD8A 3G1OA 2QWTA 3J81K 2HVQA 4A3GJ 4BBRJ 2LRDA 4C2MJ 4DVYP 2XAJA 4XM3A 3OYLA 2Q2EA 3OYAA 2BW3B 1O4XA 2CQNA 2G7UA 1SFXA 2EWNA 3CCYA 4N4OB 2HKOA 4QLCU 2ZNZA 2TRTA 2K7LA 3DTIA 3TO9A 5D8KB 5DD4A 1WH5A 2L0KA 3GFMA 2UZKA 3RJPA 4DGWB 2QZ8A 5TJJA 2AXLA 4NHJA 3IC7A 2HU9A 2CQKA 3KP3A 3RQ4A 1K79A 2QF7A 3K70C 1ETXA 4UUSA 1TL8A 2GWRA 2VKDA 3NNRA 1FMVA 2VJ5A 1IJWC 2ZOZA 3DPUA 2CS3A 3RPUD 3LAJA 2EA4A 3BOQA 3S32A 3S2WA 1MBJA 1S9HA 2XUBA 3OS1A 3K1PA 2IA2A 1OFCX 1HSJA 2VBWA 3ABLH 1MNDA 1TLHB 2HR3A 1BOBA 1XX5A 2IXSA 3S5RA 3I71A 2HYFA 1Z67A 3HUGB 4KNYA 3MFKA 2JSCA 2R4GA 2L4AA 2GXGA 3G1LA 1YW7A 4HDUA 1T38A 2Y9YA 2A3SA 5J1RA 5CYVA 5FKOA 3O60A 1F43A 5D5WB 3QPLA 4LLLA 3KYLA 3E6DA 2WY8Q 1UCRA 4IRHA 3C18A 3ZPLA 3AG3H 4F91B 1JI8A 2NOJB 1NG6A 2HXIA 1I3QJ 2R7OA 1VFCA 3NWTA 4I6ZA 3VTIA 1ZRDA 2QKMB 3HTAA 4YEJA 5EF6A 1W5TA 4MEXF 4IOAF 3LJLA 3MKWB 3CDIA 3H3ZA 3MZHA 4O3MA 4XONA 3PFYA 2X1DA 1X58A 5GTHC 3HIFA 3F21A 1QU3A 4BHPA 4UB8C 4HAMA 5EZHA 4PJNA 4B48A 3OYEA 3SJMA 4JKZA 2DA7A 3SXYA 2CRGA 3MZYA 2E19A 1XDSA 2L9NA 4ZH4F 4R8HA 4NC7A 2GM4A 2ZFUA 3HKZN 1PUFA 1K78A 2BVMA 3S17J 4B1RA 4RB3C 3ZQLA 4Y7NJ 3OV8A 4MLOA 1IXRC 3Q9VA 4XSXF 3TKYA 1MMGA 2K3PA 2O61A 2ETHA 3ZMTA 2V26A 2PG4A 3F23A 1Z05A 4CXFA 2YU3A 1FYMA 3BG9A 4XRSG 3E7LA 3FHZA 3VVXA 3L2CA 5CJ9A 2FQ3A 2K9LA 3AQSA 4M3DA 1RKTA 1XDUA 4LG3A 3BQZA 3OR1C 3HXLA 1H0MA 4ACIA 3ZCOA 1YITI 3SDBA 5IP6A 2QUFA 4M3BA 2E7WA 2EZLA 4M3GA 1UMQA 1BW5A 1V54H 2ICWG 1J5YA 2EV5A 2VPRA 2OV7A 3MZ8A 2CU7A 5FO5A 2RHAA 2QSHX 3HIMA 1HQCA 5EEHA 2AHQA 3KX2A 1W7PD 1GDTA 4A3FJ 1FOKA 1S5LC 4MGRA 5JLXA 3IL2A 5TRDA 3QPSA 1QNTA 3F8CA 4HF0A 2DPDA 4U87A 3A0BC 4EJVA 4A3BJ 2K4JA 2V4JC 2EJRA 2VJIA 3K2ZA 2V9VA 2DA1A 1P6RA 1XB4A 2CW8A 1SEUA 2PFBA 3CUQA 5M5XJ 3J80K 1ETVA 1H9TA 1HCRA 3GX4X 1LFPA 4FTHA 4GFLA 1JT6A 2PN6A 3E1SA 3LSJA 1YIOA 5IY5H 1YRNB 4RAFA 4YZEA 3GTQJ 3CESA 1FP1D 1JJ6C 4DQ2A 2E34A 3HPGA 3BJ6A 2M8GX 4A69C 4S04A 3H92A 4MQVA 4BQOA 5E8GA 1FP2A 2X1CA 3T8RA 1PVEA 3L2WA 4C30A 1R7JA 1DU0A 3KNWA 2UXNA 2G3BA 2JVGA 2J5PA 4U0WA 1A6IA 3BTLA 5H9TA 2WAQN 4FX4A 3LAPA 2ZXIA 1QZEA 3WHBA 4RB2C 1XS9A 1KU3A 4HA8A 3H0GJ 5E3MA 3LSHA 3BCBA 4WIBA 4ZTJA 1P9QC 4EGZA 5D5XB 3OYIA 3TO7A 1EH6A 1WZ2A 4GFKA 1FC3A 4HNTA 4QWQA 2W84A 3ZQIA 3JREA 4BQNA 5M3FJ 1Y0UA 1KA8A 2EFNA 4BQAA 2O7TA 1K4TA 4HSTA 3T8TA 3W6JB 4ENNA 2ZMEC 2ZSIB 5LGUA 3PNYA 4JX6A 5HLTA 3L1PA 3I55I 3L9FA 3LSGA 2K3FA 4OAYA 2D2WA 2M87A 2OU2A 1G3TA 3VVZA 2Q1ZB 5KHDA 1ZQ3P 2UXHA 2EBIA 2RVCA 1DPRA 3HSRA 2CJJA 4LIUA 4XLEA 1ERDA 4QPOA 2ZBKA 3C2BA 4RMNA 2NNYA 3RZDJ 3MEXA 3S1NJ 5J4VA 5FKLA 2GUHA 2HDCA 4TV7A 4IHSA 3KKDA 1FOWA 4B4CA 2FBQA 2LREA 1LDDA 5L3FA 3ZQCA 5F0FA 1W7PB 2RAEA 4G6QA 3S93A 1VQNI 2LDUA 2GLOA 5HDGA 1P4AA 2QIBA 5B66C 3LQQA 2VODA 2CW0F 5K5OA 3IHUA 4JX5A 4N4NB 1JUMA 5D4SA 1X1PA 5AONA 1CQTA 2CQQA 3QOPA 5FROA 4Q48A 3HOXJ 2I5UA 1QRYA 2OA4A 2X6YA 3FMSA 1GT0C 1MDMB 1TZLA 2K9NA 5ICGA 1GXPA 1WJAA 5DCMA 3KYDB 3SQNA 1IN5A 4MFDA 4C2UA 3TMOA 2JSPA 3OYMA 2HPIA 3SFIA 3F8MA 2JN6A 2FU4A 1OMIA 4JNNA 2FJI1 4UUVA 3QU6A 5FB2A 3HBLA 4M74A 2QSFX 2A68F 3PIPF 3GO5A 2R93J 4RDUA 4BS9A 3FRQA 2YSRA 2JA6J 2MW8A 4H4KC 3K1MA 2LY9A 4HV6A 3PIOF 3J81Z 1WJBA 5EEGA 3ZGKA 2XDVA 1XMAA 3N97A 2DBBA 1JUPA 2JTVA 4RAGA 2LBFB 3V7SA 4UUTA 4ESBA 1UZCA 5IYCJ 2HOTA 1YI2I 1IRXA 3MKLA 1YX5A 5HDKA 2BY3A 2DOEA 4ZYEA 2IBDA 3PSIA 2E1CA 3C1DA 3FZVA 3MAJA 3CWRA 2IT0A 2ID6A 3Q0VA 3QU3A 2L02A 5KNLA 1VZ0A 2TDXA 3KZZA 4BQQA 2DG8A 2FQ4A 3IAM2 1STZA 3C7JA 1OQYA 5GADJ 4AIKA 2Z9OA 4QSHA 1Y6IA 4B3XA 1W0TA 3JR9A 4I09A 5HLHA 2EFWA 4KYWA 1D3YA 1ON2A 3I53A 3SWHA 2QBYB 3NI7A 3FXQA 3KEOA 3ECHA 5GPAA 3S8PA 2GXAA 2LKXA 2BHYA 2NS8A 4HYEA 3HOZJ 4EM1A 1TNSA 2E35A 2DW4A 4CZCA 4I01A 1B6AA 3BG6A 1WKMA 1QO0D 2GOXB 4GYIA 1VQPI 3HE0A 2Y31A 2IA0A 3PQJA 3CUQB 1Y1WJ 2HQNA 4PJJA 3WTZA 2P4WA 3HRTA 1HKSA 2WV1A 4U9LA 3A02A 2RASA 2B63J 3QYBA 2D45A 3FM3A 3BTCA 3EUPA 4LLGF 3NRGA 1B59A 1FMWA 5FGLA 1TQMA 4IPAA 3BROA 5IT3A 2CUEA 3QQAA 3M07A 4UV9A 2TCTA 2ADUA 4I7HA 3HTSB 4CUGA 2Q0OA 2UXPA 1Z91A 3Q3SA 1R71A 4BE1A 1LE8A 3FXLA 2M34A 5FJ8J 2ZB9A 1QPMA 4CCNA 4EM2A 3P9CA 3QKXA 3LSTA 1FYLA 4QIWN 2KDOA 2Q8KA 3K7AJ 4LIVA 2L5QA 2R7QA 5FD6A 2A61A 3RYRA 3ZN0A 3ABKH 4CCJA 2UXOA 3GUDA 2PI0A 4KWAA 2NVUB 5C44J 2NYXA 2HXOA 4CCMA 4A3JJ 4NB5A 1RZ4A 2L01A 4PUSA 1L3LA 4RM3A 3W6KB 3SEQA 3GTOJ 3I64A 4YRVA 2HQ5A 2KRCA 3ERMA 3BZKA 3C2GA 3CC2I 2Y0SA 4HOBA 3NXCA 5F6FA 2KKOA 1OCZH 5ICCA 3JRIA 1ZARA 1U2WA 4XLFA 1SD6A 1MJBA 4FETA 3JSPA 3G3ZA 4IRIA 3JRHA 1HA8A 4KN7X 3K4JA 5DYMA 4AD9A 2ID3A 4HKUA 4YIIA 3CUQC 1MBGA 1X3UA 3O8HA 5H6QA 4WF2A 3BNIA 4AYBN 3WTWC 4PK4A 3WE3A 5IYBJ 2VBZA 5HOOA 3COAC 3HOVJ 2Y48A 5IT9K 1T95A 2Z99A 4R1HA 1BI1A 2LG4A 5D4RA 1KU2A 3LA3A 2HS5A 2EFQA 1ZR2A 2QKOA 3F1BA 3E7QA 1M1EB 3T1BA 5L3DA 2WV0A 1SD5A 3BR6A 3K4CA 4V2FA 3OIOA 5CLSA 3HC7A 3WE2A 3J7ZI 2NVYJ 1YS7A 5KK1A 3RIRA 1QGPA 3AQTA 3LWJA 3ZXSA 4L62A 2XPUA 1R1TA 2XAHA 3OYCA 2F5CA 1GVJA 1UI5A 1SAXA 4XOPA 2OCCH 4P5OA 1A04A 2EZHA 1YO5C 2RDPA 4PJ0C 1ZYRF 4E7SA 3LFKA 4GCKA 3A2KA 4LITA 4MEYF 3S15J 3HTJA 1XSVA 2ISYA 1ULYA 1Z9CA 1R5ID 3CCRI 3EUKL 1ZLJA 2ZKZA 4PXIA 2DU9A 5ILVA 4N9IA 3BR2A 2QCOA 4EMSA 1BJZA 2MH2A 1D0XA 4KJZA 2QVOA 5FKKA 2PJRB 3W3CA 2WB1A 3EYIA 4NDLA 5KCMA 2LD5A 1MNMC 1YS6A 1X1BA 3C2HA 3NEUA 2CFOA 4JK1X 2Y9ZA 3KP7A 2MYSA 3R60A 1D5VA 2YR2A 1UAAA 2FNAA 4G9YA 4ITVA 3R0AA 2K86A 2AXTC 3CC7I 3H1CA 4IKFA 1IV6A 4KISA 4LG0A 4D7MA 4BEHA 5HLIA 1FBUA 2P5VA 3BTJA 3IAS2 3ZQGA 3JRBA 2LK2A 5K7FA 3ZQQA 1R36A 2BHZA 1E3PA 1RUNA 1LKXA 3E5UA 2VASA 4A93J 2ESHA 1BM9A 4EATA 3OYGA 2WY7Q 1EV7A 3UKGA 2H6BA 3F8NA 3J7AO 4S0HB 3LSKA 3EUHC 1VQMI 5LD2C 2M7AA 4HQEA 4IRGA 2L4MA 5FKMA 1ORKA 2H09A 5F1RA 3U9GA 2UWMA 4M3FA 3H3VK 3SDGA 4IQJA 5BOXA 1PYVA 1QQIA 2OCEA 3GCMA 5DUIA 3F9KA 4F52A 3RKQA 4XQFA 2D6YA 2ZCMA 4RGXA 1Q1HA 1X1AA 3CJTB 3GZ6A 2GXBA 2V6CA 1R22A 2DO7A 3H0DA 1GLNA 4KA4A 2WUIA 3ABMH 5J1UA 3GFLA 3KP4A 2KPMA 2WC2A 1R4NB 2BBYA 3QP5A 2IS1A 3K0LA 2FOKA 2STTA 1LVKA 2HVSA 3PPBA 3TBIA 2HFHA 2M9HA 3RYPA 4I0BA 4MTDA 4Q47A 3FX3A 2W53A 2QQBA 1S6LA 1JGSA 2CG4A 1ZELA 4ESJA 2NVQJ 5E8IA 3AL0C 3VYUB 2K85A 4GGGA 4HZFA 3HDDA 1VQ6I 4AIJA 1YHQI 1BW6A 4GO1A 2Z33A 2JT1A 5FGMA 5BPDA 1DPUA 3GMEA 3K4NA 4GDFA 2NRAC 1UHSA 3DV8A 1O3RA 2HEOA 3H9QA 1FEXA 2UV1A 4HPQA 2OTLI 3D5LA 1T6SA 1VF9A 4D5CA 3GTLJ 3AFHA 3JRCA 1EH8A 3CJDA 4KMUX 1IN7A 3B6CA 1ZG5A 2VQHA 4KITB 2PFVA 1I50J 3QYEA 2L7MP 4UB6C 5DCMB 2JQ7A 3CC4I 1Z0XA 2ISZA 1BBYA 1TWFJ 4ZC3A 1A35A 3TQNA 2F4MB 3ISPA 4HG2A 2GIVA 2HZDA 1Z7LA 5CKTA 5HNHA 2OQGA 3VEPA 1G4DA 4WCGA 2IRFG 1P4XA 2GA1A 2FF4A 5CVRA 1OPCA 2QTQA 5EGOA 3I54A 1DDNA 1W36D 1POGA 2I8DA 1WVRA 3HKZA 3I59B 3N4MA 2V9PA 3I5UA 3ZRGA 3ZMDA 2R7ZJ 4MTEA 3ANPA 3GEUA 4Y3OA 2MD5A 3UNGC 3PSFA 5ICFA 5EGOB 5JVGF 1VQLI 2P81A 1IF1A 3OOUA 2ZMEB 3IV5A 4W97A 2STWA 2YX7A 3FMRA 5L3EA 1LEBA 4G6DA 3P9TA 3H3UA 2W4SA 2K9QA 4UHTA 3AKZA 1O3SA 4G8XA 2OJED 1WWXA 3FF5A 3U1DA 1P7JA 2R7VA 1USTA 1E0EA 3WU0A 1ZG1A 3DP7A 2VOOA 3QBMA 3PO2J 3MKYB 1ZRCA 2V7FA 2EA2A 1RIOH 2CV1A 4CCOA 2XDNA 1FOXA 2KZGA 2YUSA 2X0LA 3CDLA 4L5JA 1XSXA 4XL9A 3JAMK 1UG0A 2Z5UA 5HS8A 1XTAA 2EQRA 4II2A 4FHTA 3FXMA 1LVAA 2H8RA 3Q9SA 1OCOH 2IS6A 2FX0A 4HLYA 2XPVA 3VW1A 2KHMA 2VPLA 4XKVA 4AUXA 2KISA 5F1JA 4CICA 1OJLA 4X1EA 1FOYA 1SVOA 5JVTA 2DQRA 3GZNB 2FBKA 4UNOA 2GA2A 3OWTA 2K5CA 1D8KA 2CQ7A 2E7XA 3TO6A 2CV2A 4M71A 2X51A 5H2FC 3DKXA 2ZC2A 2F6CA 4HX4A 1PP7U 1SD7A 4CH7A 2AQEA 3F72A 1ENHA 1R5HA 2COMA 1J7KA 3G4SI 1XGOA 4JX4A 3D1NI 3IH2A 1X1CA 1Y0NA 4LJZF 3TOAA 2ZJQF 4E7JA 4ASNA 3CCLI 4UDSA 4U88A 3A01B 2R5YB 4RBOA 3DCFA 2JRMA 3RSNA 5DM7F 4EVIA 3LFUA 1UB9A 2X48A 5E17F 3EGQA 5AQCA 2DODA 2ZO4A 2PMZA 5IT9Z 4XICA 3GTKJ 4M9SA 4HBLA 3OIQA 3Q0WA 3BT9A 4HNVA 2RREA 3NPIA 1BA5A 5GPCA 1QZZA 1R00A 4BNCA 2DMTA 4KIFA 2KIQA 1RR7A 4ZDPA 1TC3C 1JHHA 5EFYA 4XOTA 2DT6A 4M72A 1UELB 3ZMSA 4DJAA 1TWGJ 1SFEA 4L9NA 4D5FA 2DT7B 3V8KA 1FY7A 3QODA 3ERED 5D5VB 3J7YJ 3DF8A 1RETA 2WAEA 3HB9A 4O5VA 2AO9A 4XLHA 4E4HA 3OY9A 2VOPA 2JJ7A 1ITYA 1FBQA 4Y15A 4RB1A 3L09A 3CMMA 3ECOA 1OYWA 1DGRM 4OOIA 3WHCA 2CUFA 5ICEA 2MG4A 4OD5A 2QSGX 3DTEA 4AU7A 2B3WA 4M6XA 1TTYA 4DW6A 3KLOA 2R0QC 1H8AC 3V4GA 1HLVA 4A3LJ 3HOWJ 2P7CB 3FISA 4G7OF 2R7SA 4MXMA 2ME6A 3QWLA 3KKCA 2IGOA 3K4MA 1OCPA 2L9RA 2FSWA 4IL6C 3WTUC 4PGGA 1BI0A 5CXIA 3K1NA 2IJLA 1IXCA 2LLKA 4EQQA 4JQFA 2BOLA 3KP6A 3MKZA 3S3NA 2X6XA 1EF4A 4C2MA 4LD5A 4J19A 2D1HA 3W2AA 1LPQA 2HKUA 2D1VA 1MGTA 3BDDA 4GYGA 4BDZA 3KFWX 4CA0A 2EZKA 1MIJA 1IRGA 3ULQB 1G3WA 4XKBA 1SVMA 4ME9A 4LOCA 2MABA 4BDYA 4ABZA 5FLVA 1G3YA 2WADA 4XLAA 1SD4A 1F1ZA 1X3WB 1EKEA 2FJ1A 2X6OA 3FXUA 4L9VA 3HOSA 2DI3A 3WTYC 4A3KJ 5ILSA 4BHCA 3J7AY 1FLIA 5C4JJ 4OIRF 3IP4B 4ENJA 3OYJA 1SAUA 1YTYA 3GW2A 1A31A 5GAEJ 4IRVA 2O8KA 5DM6F 1ON1A 4UVAA 3RKXA 1UJ8A 3KEYA 3IWZA 5LEJA 3CP2A 2ELHA 1UHMA 2ELKA 5EDNA 1V5GA 2PZ9A 1FTTA 5K7ZA 1TW2A 4G7ZF 3G71I 4RLFA 2IPQX 3FIWA 4A0ZA 3PO3J 4FE7A 2L7KA 3CLQA 3L00A 3RKYA 2JWTA 1BI2A 1CGPA 1F36A 3CCMI 4U0YA 1S7AA 3WODF 1LEAA 2MC4A 3HEFA 1XC5A 4ZZLA 2VJJA 3S1QJ 6PAXA 3PL8A 2JRTA 1JUSA 2DLLA 2FD5A 1VQ9I 1ONVA 1Z6TA 1XCVA 3IWFA 4RAZA 4EM0B 1QA6A 1RESA 1JTYA 3FHNA 2KFDA 2A07F 1R1UA 5CQGA 4BGDA 3O8GA 1LNWA 3QPHA 1I1GA 1JE8A 4OIPF 2CH0A 5HVQC 1YYVA 4HW0A 3FXJA 1FSEA 3FWEA 2LOOA 2X85A 3A4CA 2R5ZB 4EV0A 2O8XA 3BPVA 3KP2A 1IO2A 5M3MJ 5EG0B 2XAUA 1S7EA 2XVCA 3I4PA 3ZQ7A 2CUZA 1I39A 3MVPA 1W0UA 1RUOA 5KAFC 1N78A 4XRSA 1IW7F 3VFZA 2F4IA 4DYCA 2PJRA 1AOYA 1R58A 3TDUC 1J2XA 1T2KA 3CO7C 3BPXA 1R5GA 2EH3A 4RGSA 4DYRA 2PLYA 3TOBA 1MSFC 1A5JA 3K4BA 1U8RA 4L5IA 3QAHA 1WCMJ 3R61A 4W1UA 3M8EA 4IQ4A 3KIOA 4BJTA 3GTMJ 2GBYA 4B09A 1J0RA 4ZYHA 3IUOA 2ECBA 3FXOA 2YVEA 2LFBA 4I99C 5F0CA 3V7RA 2CYYA 4D1QA 2YVXA 2LH9A 2RQPA 5H20A 1BR2A 4XLCA 2DCEA 4B3AA 2M45A 5ED4A 3A1YA 3OSGA 4UY8I 2L54A 3C3WA 2K9MA 2HDWA 1U6GA 3BJAA 2W24A 2P5LC 4D9JA 1B8IB 2CV0A 5GAHJ 1VQ8I 3VUQA 3GTGJ 5LHIA 2OAZA 3CMAI 2O0YA 3CF5F 3ML6A 3S1RJ 1Z6RA 2LKSA 1BJAA 2FNPA 3L2RA 1PP8F 3BZ6A 3WGGA 2ZJRF 1SFUA 3VWBA 4CYCA 2M8EA 5CQEA 1WSUA 1LDJA 5CVJA 3REOA 1HOMA 1MH4A 4JYKA 3VP5A 1Y8QB 1Z7UA 2BVLA 2P8TA 3R4KA 4WX9A 4KN4X 1JJ8C 3R0JA 3H5RA 2UUZA 1YW8A 3JSJA 4M6VA 4C9YA 3K6GA 4C2TA 2H27A 1LDKB 3ZR8X 2M4KA 3DQVC 3HRUA 2RGVA 1SFKA 4U7BA 5BS6A 1VQOI 5FLMJ 2LVSA 4IEJA 1HKTA 1SMTA 1G2HA 2BZTA 3VOKA 4AIHA 3JW4A 3LHQA 1OCCH 1WJDA 5D6FA 4IHXA 1FJLA 1CF7B 3HJEA 4H0EA 3BLYA 2PEXA 1DQUA 3B6AA 3BZCA 3J80Z 4A6EA 1S7OA 3G1MA 5LBQA 4NUBA 3S14J 3VIBA 3RTRA 5FD5A 3OYFA 2ZY9A 3FBNB 3H5AA 3HRMA 3RQIA 3ZMUA 5LHGA 3IRQA 3LMMA 4QPQA 1RC9A 1IG7A 2V1UA 3MWMA 3PUBA 4I0AA 2DN0A 1XGSA 2KIFA 5IOYA 3SZPA 3M9AA 1T08B 3KCCA 4KT6A 2JVHA 1B72A 2A6EF 1IV8A 4G7HF 4ENKA 5K5QA 2UXXA 2DA4A 2QEXI 4E7IA 2I10A 4XK4A 3I4MJ 3BWGA 3E97A 4PSXA 5BMZA 1QHHD 1I5ZA 2DK8A 4YIFA 5LRSA 5F64A 2M4GA 4KMFA 1ETKA 2KJCA 1DGWY 3JAMZ 1BL0A 3CDHA 2DYSH 1KU9A 2DK5A 2QYOA 3EETA 4MO7A 1MKMA 5FKNA 4LFUA 1U5TB 1XMKA 3NAUA 1MZBA 4KICA 2VC0A 4LLNA 3S1MJ 1U9NA 3E6BA 4ZZDA 4XRFA 1H88C 1KYWA 3CRJA 5DDGA 3DPLC 3LL7A 3OMYA 1JKPC 4P96A 4ZTFA 2GQQA 4A0YA 4D7NA 3D5SC 2CMPA 2BY0A 2F5EA 2N8GA 2WAFA 3CLOA 5LHHA 1DUXC 2NP3A 3DXJF 2G9WA 2EILH 1VNDA 3O3KA 4FISA 1S8NA 1W1WE 4CHUA 1QBJA 1X4PA 2NX4A 1IRFA 1IZ1A 2DMPA 3M1CA 2DT5A 4WWCA 2XSJC 4V19K 3SYTA 3HPHA 4IXAA 3PM1A 4GCTA 1MD0A 3VYTB 4R79A 5DTDA 3X2QH 1K7AA 2FMLA 2ZNYA 1T8IA 1TWCJ 3HGGA 1O7FA 3OYBA 9ANTA 4JBAA 3R6SA 3SHFA 4FE4A 2VLAA 1XG1A 2CW7A 4XN0A 3O6BB 3CMEI 3HSEA 2CWEA 2PMHA 1EH7A 4A6DA 4RGUA 2R5ZA 2HNHA 2GFNA 1WHUA 3RCOA 3RDIA 2W1OA 3KYCB 3SEZA 1V3FA 4Q4ZF 4Q5SF 2PMZN 3OL4A 3ZMVA 4YFKF 2JPBA 1J09A 2EIMH 5H6RA 2KL4A 2ZCWA 2W48A 4HNUA 2CFXA 4ICHA 2M3AA 3HG9A 4MHGA 5LGTA 3ON2A 2P7VB 2L9SA 1U78A 1IAWA 2DYRH 1YJ9I 2IS2A 3H36A 1YG2A 2DFFA 4EJWA 2R7RA 3GWZA 1T0FC 1XD7A 3CP8A 4FT8A 4BJ5C 1VQ7I 4LK0F 1S72I 4HQMA 1QVUA 1KQ8A 2JA2A 1U5TA 1OKRA 4OD4A 4L0ZB 2DPUA 5DEQA 1G8XA 1GUUA 5HS7A 4OMZA 2M7BA 5IYDJ 1NG7A 2XF5A 1GVDA 4MQ9F 2HYTA 2VQCA 3ON4A 5D8LB 2QLZA 1I6XA 2KIUA 3KLNA 4L5EA 5BQTA 2ME0A 1N25A 3VYSB 3WTTC 1ETYA 2EV0A 5B5EC 2Y30A 4M9XA 2HVRA 2DXIA 4HRIA 3HHGA 2NP5A 4IHTA 4F3QA 3U21A 4BH9A 2WAQA 4FQGA 3WU1B 4I02A 1A36A 5HSZA 1AA7A 2FMYA 3QPTA 4HF2A 2DG7A 4KDPA 3DU6A 1E3OC 1RR8C 1ZGJA 4LMYA 2RC4A 1PDNC 3CCQI 4NQWA 4YIRX 3NWSA 1Z21A 3PNTA 4KUMA 2XF6A 4ANJA 2EV6A 5K1YA 2DFHA 1JGGA 2K02A 4AC0A 3DLAA 3CCEI 4LB6B 1N77A 4IJAA 5TISC 4F7ZA 4X6AJ 5BNGA 1Z77A 4XKCA 1O7LA 4HEA2 2R7WA 3HM5A 2QA4I 3AG2H 3HHHA 3QYFA 2G7SA 1LFBA 3L2UA 1IDZA 1VQKI 4AM3A 1X1DA 5CW8A 2L7ZA 2NOGA 3HYIA 3BR3A 2VN2A 4HSRA 4PCQA 2ZCXA 1E2XA 3VOXA 2FBIA 2MD0A 3WGHA 1B1BA 4AWXB 3GZ5A 3GF2A 4LB5A 2NS0A 5HS9A 3BJOA 3ROUA 2MSYA 2MA3A 4DBRA 5FRMA 1EA3A 4F92B 2GAUA 1LE8B 3VODA 5D18A 1RKWA 1R49A 1DU6A 5K5RA 3SFZA 4OU0A 2B1EA 1K4SA 1HW5A 3TEDA 1AHDP 5C3EJ 3LNQA 3HUGA 2BYVE 4RB0A 2JK3A 1QHGA 2M0CA 2ZMEA 1HKQA 3KZYA 1K83J 1T33A 1WJFA 2HKXA 2K27A 1T56A 5EJCA 2HYGD 2IP2A 2EK5A 3IKTA 2RKHA 3LA2A 2DOAA 3DFGA 5HODA 3E3VA 5DCFA 1QZYA 2HOSA 1UI6A 2Y69H 3W2VA 3BG7A 3CD6I 1DP7P 2FOWA 2VI6A 3BP8A 1IN6A 4I98B 1D1CA 2KLOA 4UUSB 1MBHA 2QM3A 2FXAA 2VC1A 3OIPA 2IW5A 3D5RC 3DU5A 3FK6A 2OZUA 1A6QA 4NC6A 4LK1F 4E7HA 1MJ9A 4BJ6C 1USSA 4KFCA 2LC2A 2XV4S 4ESFA 4DYQA 4HX8A 2HZTA 3T5XA 3V78A 1V5EA 2KRFA 2W25A 2VXDA 3A01A 3MN2A 4IOCF 5FMPA 3CF2A 1W36C 2EIJH 5E1XA 1BIBA 2EPFA 2KIMA 1FZPB 3HOUJ 5J3LA 5E3NA 5K7HA 1TNTA 3N05A 4JOMA 3IKVA 4M9ZA 4RA2A 3L2VA 5L3GA 5A2QK 4CCLA 2JUGA 3FXKA 4YFXF 3OYHA 3ESWB 4JL3A 2MLKA 3BY6A 5M5YJ 2J5OA 2OQRA 2CO5A 2IEKA 1G3SA 3LSIA 1K61A 5AIPA 1TW3A 2HPMA 2AQFA 2F2EA 2XKPA 5LLQA 4A3CJ 4GRIA 5JR3A 3BCGA 3P9IA 2E1MB 2PMUA 4BKXA 1ZREA 3L7WA 3I4NJ 3DKWA 1FSHA 3HTIA 5F04A 5LRRA 2PJPA 4OIQF 2JA8J 5E1ZB 3PQKA 3HOYJ 5D1RA 2L2OA 3TGNA 3QOEA 1HW1A 2RNJA 5E1WA 2L9VA 1X19A 3PUFA 1XPXA 1G6NA 4DIQA 3K2AA 3P7NA 3GLXA 5EZGA 2K40A 2XRLA 2ZXHA 3JRGA 3AL0B 2EIKH 3BG3A 1NHAA 2GOMA 1J75A 2P6SA 3G56A 3PJRA 1WH7A 1GHCA 3CCSI 5DUKA 2VT2A 3S3MA 2QWWA 1I27A 4MK6A 5B1BH 3OOPA 5LGNA 2COBA 4P55A 3IH4A 4XMYA 1V4RA 4OWRB 4XORA 2BXYA 1R23A 3BR5A 3OSFA 3O2PE 3V7CA 2VXZA 2VL8A 5EYRA 3WTSC 4CGZA 3CJQB 1IUFA 4BL0B 3EUAA 1BN5A 1MJAA 3T6NA 3CQZJ 2F5FA 1U0JA 2R7XA 1FYKA 2UXIA 4IF4A 4Z6YA 1YW9A 2YU9J 4BE0A 1P92A 2E2HJ 2CSOA 2VKEA 4S05A 1TP4A 5M5WJ 3F6OA 2QGUA 1HSTA 2R3SA 4M73A 3VB2A 1SFOJ 2QQAA 4II3A 1MBKA 4V2GA 3JRFA 1ETWA 1WJCA 5KVRA 3K9TA 3S2DJ 4FCYA 5IP9J 4ZJZA 4WXHA 2DMUA 1NK2P 2NVXJ 4I2OA 3OYNA 4Y52J 1B8IA 1W4MA 3CCUI 5CVVA 2XGDA 3H5NA 2E2IJ 1HBXG 2M0MA 3Q5FA 2LSOA 3CCVI 1KQ0A 1W5SA 3JTGA 5E18F 2MFZA 2P5KA 1FWZA 3DPTA 2BY2A 2MH9A 3DLLF 2XAGA 3C07A 2V1XA 5J4YA 2CGPA 2ELJA 3MNLA 4BXXJ 4NELA 3ASOH 1F9NA 1X3ZB 1OYYA 3A03A 2OTJI 2DTZA 3I3LA 3WGIA 3ZOBA 4XLPF 1O3TA 1X2MA 4CSWA 2JMWA 2OPTA 3ZQHA 4IZZA 1JKOC 3COLA 3I59A 1U3EM 1ZLKA 3BHQA 4DNCA 1R4MB 2B0LA 3ZQFA 1TBXA 3B81A 3JCUC 2YX4A 1TT5B 3MQ0A 4B44A 2E60A 3HRSA 2VBYA 1D1AA 1ZKGA 4Y33A 1SC7A 2R7FA 2R5YA 3OL3A 5KAIC 4OINF 1YOVB 2OI8A 2W57A 2L3DA 3RI4A 1ZGWA 1W7PA 2DJNA 4ZYAA 3DKYA 1W5CC 2QQ8A 2JA5J 4ZYDA 2ZFWA 4PGHA 2VBXA 4EJUA 2H1KA 5EEAA 4L18B 4EJTA 3WG9A 2PBIA 3H9GA 4A3IJ 1FIAA 2HOEA 5AIQA 4ZYGA 4X0GA 4RAYA 4JP0A 4G12A 5GP9A 1XCBA 4HLXA 3AG4H 5LFAA 1AKHB 1HDPA 2W00A 2LY1A 3ABTA 4Y4RA 3F3XA 4A2UA 4FASD 3E5QA 3M7GA 4HF1A 1B9MA 2X9DA 2DDAA 2O3FA 1YJNI 1ZK8A 1UG2A 4HDVA 2G7GA 2DFEA 1ODDA 2A05A 2EFPA 3B73A 2HQRA 2DJIA 4MIMA 3TW6A 3RKWA 1BR1A 1MH3A 1E17A 2VJ4A 3NRVA 2XKOA 5D19A 1OISA 3OYDA 3WG7H 3BRUA 2ECCA 2H6CA 4IX7A 3CCJI 2XB0X 1YLFA 1R6RA 4WK8F 3S3OA 4NQWB 1SVLA 4RM2A 5ERIA 3EQLF 2NXNB 3NARA 2ZJPF 2BXZA 2ACJA 1F4KA 5HAWA 2HOAA 1ZRFA 5JFRA 2WBMA 2D5VA 2PBXA 3BR0A 1JHFA 4PFPA 2DA6A 1I6HJ 3OR2C 5FFXA 1G59A 2Z2SB 3VSKA 3LSPA 2GZWA 4GXOA 2V1NA 3Q0UA 4CYCB 4EGYA 2LF8A 2XGXA 2OD5A 1WJ5A 2LYCA 4BY1J 3FBIB 1PJRA 4L9JA 2VUMJ 1IN4A 1NK3P 1NH3A 3W6VA 3EPZA 1BI3A 2A5WA 3EYYA 3WTVC 3ZN1A 1LB2A 2FA5A 4CGRA 1BC8C 3HGYA 3ASNH
chains in the Genus database with same CATH topology
4MO7A 3RKQA 1SANA 3QPLA 2D6YA 2ZCMA 5FKNA 3M4OJ 3NAUA 3S1MJ 1U9NA 2G0EA 1H88C 3RH2A 3CRJA 2WUIA 5J1UA 2HXIA 1VFCA 1I3QJ 1JKPC 4I6ZA 4IHYA 3HTAA 4D7NA 5EF6A 3LJLA 5E3OA 2IU5A 2N8GA 3PPBA 2NP3A 1TWHJ 2M9HA 1X58A 1VNDA 4FISA 3SJMA 5EZHA 4JKZA 2W53A 2DA7A 2CRGA 2NVQJ 2E19A 5CXGA 2NX4A 2DMPA 3HDDA 4GFBA 2GM4A 3HKZN 3PM1A 4GCTA 1PUFA 2VKVA 3S17J 1ETOA 2HI3A 5DTDA 4B1RA 4A3DJ 1BW6A 3ZQLA 3TP3A 4Y7NJ 3G7RA 1TWCJ 4MLOA 1JTXA 3HGGA 9ANTA 4GCLA 1UHSA 3BR1A 4FE4A 2ZOYA 1XG1A 1FEXA 3GTLJ 1VF9A 4D5CA 3CJDA 3JRCA 3B6CA 3BG9A 4XRSG 1QVTA 3E7LA 2R5ZA 2V57A 3VVXA 2GFNA 1I50J 2L7MP 3AQSA 1Z0XA 4M3DA 2QOPA 1RKTA 1TWFJ 2PMZN 2DA5A 3BG5A 3BQZA 4ACIA 3BQYA 1AKHA 2EZIA 2XPWA 5IP6A 1X2NA 3GZIA 3RZOJ 4M3BA 2EZLA 4M3GA 4AF5A 1UMQA 2W48A 1BW5A 4ICHA 2VPRA 2QTQA 5EGOA 3ON2A 2CU7A 1U78A 2RHAA 3HIMA 2AHQA 3M3YJ 1POGA 1GDTA 4A3FJ 2WGBA 5FHPA 5JLXA 3QPSA 2Y0SN 2R7ZJ 3ANPA 3GEUA 4A3BJ 1B72B 3FKIJ 1QVUA 3PASA 2DA1A 5HBUA 5EGOB 4IHVA 1GUUA 1IDYA 2P81A 3OOUA 5M5XJ 3IV5A 5IYDJ 1ETVA 4W97A 1GVDA 5K58A 5IP7J 2HYTA 1HCRA 3ON4A 4C3IJ 3P9TA 2OERA 4L5EA 2Y2ZA 4FTHA 2K9QA 2ME0A 1ETYA 4GFLA 1JT6A 2Y30A 3LSJA 1YRNB 2G7LA 2NP5A 3GTQJ 1IRZA 2YS9A 2KDZA 3LSRA 4YZEA 1JJ6C 1P7JA 2O7OA 2M8GX 4A69C 3DPJA 3PO2J 3QBMA 5HSZA 2DG7A 1E3OC 2XDNA 2WB1N 3ANGA 1DU0A 3KNWA 2YUSA 2G3BA 3CDLA 1U8BA 1A6IA 3BTLA 5H9TA 2WAQN 4DZJA 1D5YA 2E1OA 1XS9A 2EQRA 3WHBA 1JGGA 3H0GJ 4AC0A 5E3MA 2H8RA 2FX0A 3VW1A 2XPVA 4AUXA 4X6AJ 1ZR4A 5F1JA 5BNGA 1Q1VA 1OJLA 1Z77A 4X1EA 4GFKA 3HM5A 2G7SA 1LFBA 3ZQIA 3JREA 5M3FJ 1VI0A 1IDZA 2O7TA 5CW8A 2L7ZA 2NOGA 3BR3A 2ZCXA 3GTPJ 3VOXA 4JX6A 2DMNA 2KT0A 3L1PA 1U9OA 4BY7J 3LSGA 2OF7A 1ENHA 1MBEA 3VW2A 3VVZA 4JX4A 1ZQ3P 3D1NI 3IH2A 2UXHA 2EBIA 5DS9A 2MSYA 2CJJA 4UDSA 3C2BA 1FIPA 3A01B 2R5YB 4RBOA 3RZDJ 1LE8B 3DCFA 3S1NJ 5D18A 1RKWA 5FKLA 1DU6A 2GUHA 5F27A 3KKDA 4B4CA 2FBQA 2X48A 3TEDA 1AHDP 5C3EJ 4A3EJ 3EGQA 5AQCA 3ZQCA 3LNQA 5F0FA 4XICA 3GTKJ 2RAEA 2JK3A 1MSEC 2GLOA 3Q0WA 2M0CA 3BT9A 4HNVA 2QIBA 3NPIA 1BA5A 1K83J 1T33A 3RD3A 4JX5A 5GPCA 3VW0A 1T56A 1HDDC 1JUMA 2DMTA 1CQTA 2CQQA 1RPWA 1RR7A 5HODA 1TC3C 3HOXJ 1GT0C 1QRYA 2XSDC 1ETQA 2K9NA 3JRAA 5EFYA 4MFDA 2HOSA 1UI6A 3TP0A 1TWGJ 4D5FA 3SFIA 2VI6A 1ZTRA 2JN6A 4JNNA 3FK7A 4UUSB 1RETA 3HB9A 1MBHA 3BTIA 2AO9A 3HBLA 3LOCA 1ITYA 2JJ7A 3FK6A 5DAJA 1SGMA 3WHCA 5C4XJ 2R93J 2CUFA 4RDUA 5C4YA 2MG4A 3GBGA 3FRQA 2JA6J 2MW8A 2M2EA 4DYQA 2LY9A 4DW6A 2ZCNA 3V78A 2R0QC 1QPIA 1H8AC 3A01A 1HLVA 3MN2A 1AU7A 4A3LJ 5FMPA 2YVHA 1JUPA 3HOWJ 1Y1VJ 3FISA 1FTZA 4UUTA 4MXMA 2ME6A 4M3EA 5IYCJ 2HOTA 3KKCA 3HOUJ 1OCPA 3MKLA 5J3LA 5E3LA 2L9RA 5E3NA 5K7HA 2IBDA 2NS7A 2F07A 5CXIA 3CWRA 3Q0VA 2ID6A 1PUFB 2LLKA 2XB5A 1TWAJ 2DG8A 2FQ4A 2E2JJ 1EF4A 4JL3A 4QSHA 1W0TA 5M5YJ 2LP0A 3JR9A 4J19A 2HKUA 3S16J 1GV2A 3TW7A 4BBSJ 2DMQA 2K9SA 2IEKA 3NI7A 1OCTC 1LFUP 2EZKA 4DZPA 5GPAA 1K61A 1WGXA 2LKXA 4A3CJ 3BCGA 4I76A 2NS8A 5F0HA 5IOZA 4ME9A 4LOCA 3HOZJ 4ABZA 5FLVA 4BKXA 3I4NJ 2FJ1A 3HTIA 2X6OA 5F04A 4A3KJ 3HE0A 2Y31A 1Y1WJ 5C4JJ 2JA8J 3HOYJ 5D1RA 2WV1A 3A02A 2RASA 2B63J 3BTCA 2O8KA 2XGEA 4IHWA 4XRMA 3K2AA 3EUPA 2LR8A 3CMYA 3NRGA 5FGLA 5EZGA 2K40A 2CUEA 2XRLA 3IH3A 3QQAA 3JRGA 1WI3A 2TCTA 2GENA 2UXUA 2ELKA 3BG3A 5EDNA 2UXPA 2PZ9A 4AC6A 1LE8A 3Q3SA 1FTTA 3G56A 2M34A 5FJ8J 5K7ZA 2ZB9A 1WH7A 3FIWA 3V6GA 3PO3J 4FE7A 3QKXA 4QIWN 5F08A 2JWTA 2CQXA 3K7AJ 1F36A 4MK6A 2JA7J 3HEFA 3S1QJ 2COBA 1XC5A 3IH4A 3BR5A 1JUSA 3OSFA 2FD5A 3KZ9A 2LTPA 2UXOA 5EYRA 4KWAA 5C44J 3VVYA 2HXOA 4A3JJ 4C3JJ 1RESA 1IUFA 1JTYA 3GTOJ 2Q24A 3O8GA 2HQ5A 3CQZJ 3T6NA 4MFEA 3NXCA 1H89C 4A3MJ 2UXIA 2DA2A 2IAIA 4NN1A 3JRIA 3IUVA 2R5ZB 2YU9J 2E2HJ 2VKEA 5M5WJ 5M3MJ 3JRHA 1SFOJ 5EG0B 1MBKA 1IGNA 1S7EA 4V2GA 3JRFA 1ETWA 2ID3A 3MVPA 1W0UA 3HTHA 3S2DJ 4HKUA 4FCYA 5IP9J 1NK2P 4Y52J 1MBGA 2DMUA 4XRSA 1JT0A 3O8HA 2NVXJ 2REKA 3BNIA 1B8IA 3JRDA 4AYBN 4DYCA 2XGDA 4QTRA 5IYBJ 2E2IJ 2NVTJ 5IPAA 2R92J 2DA3A 1YRNA 3HOVJ 2EH3A 4DYRA 4C3HJ 2HDDA 1MSFC 1A5JA 3C07A 1WCMJ 4W1UA 1ZR2A 2QKOA 3F1BA 3E7QA 3MNLA 4BXXJ 2MGQA 1JKRC 3GTMJ 2GBYA 3F0CA 4NELA 4V2FA 3BR6A 3OIOA 3VPRA 2ECBA 1P7IA 3A03A 5JLWA 2YVEA 2DTZA 2NVYJ 2LFBA 3DEWA 5F0CA 3ZOBA 1X2MA 2JMWA 2OPTA 3ZQHA 1JKOC 3AQTA 3COLA 3LWJA 4L62A 1GV5A 2XPUA 4B3AA 1HF0A 3BHQA 3OSGA 3GTJJ 3ZQFA 1UI5A 3B81A 1JKQC 2EZHA 4EEFG 1ZKGA 1B8IB 4GCKA 1WPKA 3VUQA 3GTGJ 2R5YA 3S2HJ 3S15J 3HTJA 3S1RJ 2OI8A 5EG0A 2XGCA 1ZGWA 2DJNA 1APLC 2JA5J 1NTCA 3BJBA 4PXIA 2H1KA 5EEAA 4XIDA 4CYCA 3BR2A 2QCOA 4A3IJ 1FIAA 1R9TJ 1BJZA 1HOMA 1MH4A 4JYKA 3VP5A 4JP0A 4G12A 5GP9A 2L7FP 1JJ8C 5FKKA 5J1YA 1MBFA 4NDLA 1IC8A 2HYJA 4M6VA 1AKHB 2O9LA 1HDPA 2LD5A 1MNMC 3JSJA 3G1OA 2QWTA 2Y9ZA 5FLMJ 2LVSA 4A3GJ 4BBRJ 2X9DA 4IEJA 4C2MJ 1G2HA 3VOKA 1ZK8A 1UG2A 2G7GA 3LHQA 1O4XA 4IHXA 4MIMA 3CCYA 3TW6A 1IV6A 1FJLA 1MH3A 4D7MA 3B6AA 2TRTA 5D19A 3G1MA 3BRUA 2ECCA 3BTJA 1WH5A 2L0KA 2XB0X 3ZQGA 3JRBA 3S14J 3VIBA 2LK2A 5K7FA 3NARA 3RQIA 2HOAA 5HAWA 4A93J 2QF7A 1IG7A 1ETXA 4UUSA 2D5VA 2PBXA 3BR0A 3NNRA 2ZOZA 2DN0A 1IJWC 3UKGA 2DA6A 1I6HJ 5IOYA 4S0HB 1MBJA 3LSPA 1B72A 3Q0UA 4CYCB 1OFCX 2DA4A 4BY1J 2I10A 4XK4A 5FKMA 2VUMJ 3I4MJ 1ORKA 3S5RA 3G1LA 1NK3P 4M3FA 3W6VA 3H3VK 3SDGA 2Y9YA 5J1RA 1ETKA 5FKOA 3O60A 1F43A 4CGRA 3HGYA 1BL0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MO7 A;  3RKQ A;  1SAN A;  3QPL A;  2D6Y A;  2ZCM A;  5FKN A;  3M4O J;  3NAU A;  3S1M J;  1U9N A;  2G0E A;  1H88 C;  3RH2 A;  3CRJ A;  2WUI A;  5J1U A;  2HXI A;  1VFC A;  1I3Q J;  1JKP C;  4I6Z A;  4IHY A;  3HTA A;  4D7N A;  5EF6 A;  3LJL A;  5E3O A;  2IU5 A;  2N8G A;  3PPB A;  2NP3 A;  1TWH J;  2M9H A;  1X58 A;  1VND A;  4FIS A;  3SJM A;  5EZH A;  4JKZ A;  2W53 A;  2DA7 A;  2CRG A;  2NVQ J;  2E19 A;  5CXG A;  2NX4 A;  2DMP A;  3HDD A;  4GFB A;  2GM4 A;  3HKZ N;  3PM1 A;  4GCT A;  1PUF A;  2VKV A;  3S17 J;  1ETO A;  2HI3 A;  5DTD A;  4B1R A;  4A3D J;  1BW6 A;  3ZQL A;  3TP3 A;  4Y7N J;  3G7R A;  1TWC J;  4MLO A;  1JTX A;  3HGG A;  9ANT A;  4GCL A;  1UHS A;  3BR1 A;  4FE4 A;  2ZOY A;  1XG1 A;  1FEX A;  3GTL J;  1VF9 A;  4D5C A;  3CJD A;  3JRC A;  3B6C A;  3BG9 A;  4XRS G;  1QVT A;  3E7L A;  2R5Z A;  2V57 A;  3VVX A;  2GFN A;  1I50 J;  2L7M P;  3AQS A;  1Z0X A;  4M3D A;  2QOP A;  1RKT A;  1TWF J;  2PMZ N;  2DA5 A;  3BG5 A;  3BQZ A;  4ACI A;  3BQY A;  1AKH A;  2EZI A;  2XPW A;  5IP6 A;  1X2N A;  3GZI A;  3RZO J;  4M3B A;  2EZL A;  4M3G A;  4AF5 A;  1UMQ A;  2W48 A;  1BW5 A;  4ICH A;  2VPR A;  2QTQ A;  5EGO A;  3ON2 A;  2CU7 A;  1U78 A;  2RHA A;  3HIM A;  2AHQ A;  3M3Y J;  1POG A;  1GDT A;  4A3F J;  2WGB A;  5FHP A;  5JLX A;  3QPS A;  2Y0S N;  2R7Z J;  3ANP A;  3GEU A;  4A3B J;  1B72 B;  3FKI J;  1QVU A;  3PAS A;  2DA1 A;  5HBU A;  5EGO B;  4IHV A;  1GUU A;  1IDY A;  2P81 A;  3OOU A;  5M5X J;  3IV5 A;  5IYD J;  1ETV A;  4W97 A;  1GVD A;  5K58 A;  5IP7 J;  2HYT A;  1HCR A;  3ON4 A;  4C3I J;  3P9T A;  2OER A;  4L5E A;  2Y2Z A;  4FTH A;  2K9Q A;  2ME0 A;  1ETY A;  4GFL A;  1JT6 A;  2Y30 A;  3LSJ A;  1YRN B;  2G7L A;  2NP5 A;  3GTQ J;  1IRZ A;  2YS9 A;  2KDZ A;  3LSR A;  4YZE A;  1JJ6 C;  1P7J A;  2O7O A;  2M8G X;  4A69 C;  3DPJ A;  3PO2 J;  3QBM A;  5HSZ A;  2DG7 A;  1E3O C;  2XDN A;  2WB1 N;  3ANG A;  1DU0 A;  3KNW A;  2YUS A;  2G3B A;  3CDL A;  1U8B A;  1A6I A;  3BTL A;  5H9T A;  2WAQ N;  4DZJ A;  1D5Y A;  2E1O A;  1XS9 A;  2EQR A;  3WHB A;  1JGG A;  3H0G J;  4AC0 A;  5E3M A;  2H8R A;  2FX0 A;  3VW1 A;  2XPV A;  4AUX A;  4X6A J;  1ZR4 A;  5F1J A;  5BNG A;  1Q1V A;  1OJL A;  1Z77 A;  4X1E A;  4GFK A;  3HM5 A;  2G7S A;  1LFB A;  3ZQI A;  3JRE A;  5M3F J;  1VI0 A;  1IDZ A;  2O7T A;  5CW8 A;  2L7Z A;  2NOG A;  3BR3 A;  2ZCX A;  3GTP J;  3VOX A;  4JX6 A;  2DMN A;  2KT0 A;  3L1P A;  1U9O A;  4BY7 J;  3LSG A;  2OF7 A;  1ENH A;  1MBE A;  3VW2 A;  3VVZ A;  4JX4 A;  1ZQ3 P;  3D1N I;  3IH2 A;  2UXH A;  2EBI A;  5DS9 A;  2MSY A;  2CJJ A;  4UDS A;  3C2B A;  1FIP A;  3A01 B;  2R5Y B;  4RBO A;  3RZD J;  1LE8 B;  3DCF A;  3S1N J;  5D18 A;  1RKW A;  5FKL A;  1DU6 A;  2GUH A;  5F27 A;  3KKD A;  4B4C A;  2FBQ A;  2X48 A;  3TED A;  1AHD P;  5C3E J;  4A3E J;  3EGQ A;  5AQC A;  3ZQC A;  3LNQ A;  5F0F A;  4XIC A;  3GTK J;  2RAE A;  2JK3 A;  1MSE C;  2GLO A;  3Q0W A;  2M0C A;  3BT9 A;  4HNV A;  2QIB A;  3NPI A;  1BA5 A;  1K83 J;  1T33 A;  3RD3 A;  4JX5 A;  5GPC A;  3VW0 A;  1T56 A;  1HDD C;  1JUM A;  2DMT A;  1CQT A;  2CQQ A;  1RPW A;  1RR7 A;  5HOD A;  1TC3 C;  3HOX J;  1GT0 C;  1QRY A;  2XSD C;  1ETQ A;  2K9N A;  3JRA A;  5EFY A;  4MFD A;  2HOS A;  1UI6 A;  3TP0 A;  1TWG J;  4D5F A;  3SFI A;  2VI6 A;  1ZTR A;  2JN6 A;  4JNN A;  3FK7 A;  4UUS B;  1RET A;  3HB9 A;  1MBH A;  3BTI A;  2AO9 A;  3HBL A;  3LOC A;  1ITY A;  2JJ7 A;  3FK6 A;  5DAJ A;  1SGM A;  3WHC A;  5C4X J;  2R93 J;  2CUF A;  4RDU A;  5C4Y A;  2MG4 A;  3GBG A;  3FRQ A;  2JA6 J;  2MW8 A;  2M2E A;  4DYQ A;  2LY9 A;  4DW6 A;  2ZCN A;  3V78 A;  2R0Q C;  1QPI A;  1H8A C;  3A01 A;  1HLV A;  3MN2 A;  1AU7 A;  4A3L J;  5FMP A;  2YVH A;  1JUP A;  3HOW J;  1Y1V J;  3FIS A;  1FTZ A;  4UUT A;  4MXM A;  2ME6 A;  4M3E A;  5IYC J;  2HOT A;  3KKC A;  3HOU J;  1OCP A;  3MKL A;  5J3L A;  5E3L A;  2L9R A;  5E3N A;  5K7H A;  2IBD A;  2NS7 A;  2F07 A;  5CXI A;  3CWR A;  3Q0V A;  2ID6 A;  1PUF B;  2LLK A;  2XB5 A;  1TWA J;  2DG8 A;  2FQ4 A;  2E2J J;  1EF4 A;  4JL3 A;  4QSH A;  1W0T A;  5M5Y J;  2LP0 A;  3JR9 A;  4J19 A;  2HKU A;  3S16 J;  1GV2 A;  3TW7 A;  4BBS J;  2DMQ A;  2K9S A;  2IEK A;  3NI7 A;  1OCT C;  1LFU P;  2EZK A;  4DZP A;  5GPA A;  1K61 A;  1WGX A;  2LKX A;  4A3C J;  3BCG A;  4I76 A;  2NS8 A;  5F0H A;  5IOZ A;  4ME9 A;  4LOC A;  3HOZ J;  4ABZ A;  5FLV A;  4BKX A;  3I4N J;  2FJ1 A;  3HTI A;  2X6O A;  5F04 A;  4A3K J;  3HE0 A;  2Y31 A;  1Y1W J;  5C4J J;  2JA8 J;  3HOY J;  5D1R A;  2WV1 A;  3A02 A;  2RAS A;  2B63 J;  3BTC A;  2O8K A;  2XGE A;  4IHW A;  4XRM A;  3K2A A;  3EUP A;  2LR8 A;  3CMY A;  3NRG A;  5FGL A;  5EZG A;  2K40 A;  2CUE A;  2XRL A;  3IH3 A;  3QQA A;  3JRG A;  1WI3 A;  2TCT A;  2GEN A;  2UXU A;  2ELK A;  3BG3 A;  5EDN A;  2UXP A;  2PZ9 A;  4AC6 A;  1LE8 A;  3Q3S A;  1FTT A;  3G56 A;  2M34 A;  5FJ8 J;  5K7Z A;  2ZB9 A;  1WH7 A;  3FIW A;  3V6G A;  3PO3 J;  4FE7 A;  3QKX A;  4QIW N;  5F08 A;  2JWT A;  2CQX A;  3K7A J;  1F36 A;  4MK6 A;  2JA7 J;  3HEF A;  3S1Q J;  2COB A;  1XC5 A;  3IH4 A;  3BR5 A;  1JUS A;  3OSF A;  2FD5 A;  3KZ9 A;  2LTP A;  2UXO A;  5EYR A;  4KWA A;  5C44 J;  3VVY A;  2HXO A;  4A3J J;  4C3J J;  1RES A;  1IUF A;  1JTY A;  3GTO J;  2Q24 A;  3O8G A;  2HQ5 A;  3CQZ J;  3T6N A;  4MFE A;  3NXC A;  1H89 C;  4A3M J;  2UXI A;  2DA2 A;  2IAI A;  4NN1 A;  3JRI A;  3IUV A;  2R5Z B;  2YU9 J;  2E2H J;  2VKE A;  5M5W J;  5M3M J;  3JRH A;  1SFO J;  5EG0 B;  1MBK A;  1IGN A;  1S7E A;  4V2G A;  3JRF A;  1ETW A;  2ID3 A;  3MVP A;  1W0U A;  3HTH A;  3S2D J;  4HKU A;  4FCY A;  5IP9 J;  1NK2 P;  4Y52 J;  1MBG A;  2DMU A;  4XRS A;  1JT0 A;  3O8H A;  2NVX J;  2REK A;  3BNI A;  1B8I A;  3JRD A;  4AYB N;  4DYC A;  2XGD A;  4QTR A;  5IYB J;  2E2I J;  2NVT J;  5IPA A;  2R92 J;  2DA3 A;  1YRN A;  3HOV J;  2EH3 A;  4DYR A;  4C3H J;  2HDD A;  1MSF C;  1A5J A;  3C07 A;  1WCM J;  4W1U A;  1ZR2 A;  2QKO A;  3F1B A;  3E7Q A;  3MNL A;  4BXX J;  2MGQ A;  1JKR C;  3GTM J;  2GBY A;  3F0C A;  4NEL A;  4V2F A;  3BR6 A;  3OIO A;  3VPR A;  2ECB A;  1P7I A;  3A03 A;  5JLW A;  2YVE A;  2DTZ A;  2NVY J;  2LFB A;  3DEW A;  5F0C A;  3ZOB A;  1X2M A;  2JMW A;  2OPT A;  3ZQH A;  1JKO C;  3AQT A;  3COL A;  3LWJ A;  4L62 A;  1GV5 A;  2XPU A;  4B3A A;  1HF0 A;  3BHQ A;  3OSG A;  3GTJ J;  3ZQF A;  1UI5 A;  3B81 A;  1JKQ C;  2EZH A;  4EEF G;  1ZKG A;  1B8I B;  4GCK A;  1WPK A;  3VUQ A;  3GTG J;  2R5Y A;  3S2H J;  3S15 J;  3HTJ A;  3S1R J;  2OI8 A;  5EG0 A;  2XGC A;  1ZGW A;  2DJN A;  1APL C;  2JA5 J;  1NTC A;  3BJB A;  4PXI A;  2H1K A;  5EEA A;  4XID A;  4CYC A;  3BR2 A;  2QCO A;  4A3I J;  1FIA A;  1R9T J;  1BJZ A;  1HOM A;  1MH4 A;  4JYK A;  3VP5 A;  4JP0 A;  4G12 A;  5GP9 A;  2L7F P;  1JJ8 C;  5FKK A;  5J1Y A;  1MBF A;  4NDL A;  1IC8 A;  2HYJ A;  4M6V A;  1AKH B;  2O9L A;  1HDP A;  2LD5 A;  1MNM C;  3JSJ A;  3G1O A;  2QWT A;  2Y9Z A;  5FLM J;  2LVS A;  4A3G J;  4BBR J;  2X9D A;  4IEJ A;  4C2M J;  1G2H A;  3VOK A;  1ZK8 A;  1UG2 A;  2G7G A;  3LHQ A;  1O4X A;  4IHX A;  4MIM A;  3CCY A;  3TW6 A;  1IV6 A;  1FJL A;  1MH3 A;  4D7M A;  3B6A A;  2TRT A;  5D19 A;  3G1M A;  3BRU A;  2ECC A;  3BTJ A;  1WH5 A;  2L0K A;  2XB0 X;  3ZQG A;  3JRB A;  3S14 J;  3VIB A;  2LK2 A;  5K7F A;  3NAR A;  3RQI A;  2HOA A;  5HAW A;  4A93 J;  2QF7 A;  1IG7 A;  1ETX A;  4UUS A;  2D5V A;  2PBX A;  3BR0 A;  3NNR A;  2ZOZ A;  2DN0 A;  1IJW C;  3UKG A;  2DA6 A;  1I6H J;  5IOY A;  4S0H B;  1MBJ A;  3LSP A;  1B72 A;  3Q0U A;  4CYC B;  1OFC X;  2DA4 A;  4BY1 J;  2I10 A;  4XK4 A;  5FKM A;  2VUM J;  3I4M J;  1ORK A;  3S5R A;  3G1L A;  1NK3 P;  4M3F A;  3W6V A;  3H3V K;  3SDG A;  2Y9Y A;  5J1R A;  1ETK A;  5FKO A;  3O60 A;  1F43 A;  4CGR A;  3HGY A;  1BL0 A; 
#chains in the Genus database with same CATH topology
 3ONQ A;  4BUP A;  1L0O C;  1YX3 A;  1SAN A;  4A5M A;  1FBS A;  3M4O J;  2X6W A;  2VQL A;  2ZXW H;  4OMY A;  2F48 A;  2G0E A;  4RGR A;  4XLN F;  2WTE A;  3NQO A;  3RH2 A;  2BEO A;  4BU2 A;  3FMQ A;  2KJB A;  4IHY A;  2RN7 A;  5FFZ A;  3E0J B;  5E3O A;  2IU5 A;  1TT0 A;  1WFX A;  4Y17 A;  3B02 A;  4PFO A;  1TWH J;  5BPI A;  1OLT A;  2IGN A;  5TGT A;  2HWV A;  2R7U A;  2Z1D A;  1N75 A;  2IGM A;  2FBH A;  5CXG A;  1FPQ A;  2Q2E B;  2ESN A;  2HTJ A;  3H9J A;  4P1W A;  3GLL A;  4GFB A;  3MD2 A;  2LMD A;  2VKV A;  2BW3 A;  1ETO A;  2HI3 A;  2R7D A;  3K10 A;  3IRR A;  4XBF A;  4A3D J;  1JXS A;  3TP3 A;  3ZP5 A;  3G7R A;  4YFN F;  1ZGA A;  1H9G A;  4PDK A;  3FKJ A;  1JTX A;  1BR4 A;  2AS5 F;  4GCL A;  3QP6 A;  3BR1 A;  1J59 A;  3G73 A;  3CO6 C;  1MMN A;  4XSZ F;  2ZOY A;  5E20 A;  3GVA A;  1ZG3 A;  2KRH A;  1HW2 A;  4AVP A;  5GTI C;  3TL4 X;  1HC8 A;  2IS4 A;  1QVT A;  3DEU A;  2V57 A;  4HV5 A;  5LEK A;  1B9N A;  4AYB A;  2QOP A;  4L9T A;  3K8P C;  2DA5 A;  3BG5 A;  2RNG A;  3BQY A;  1AKH A;  4EJO A;  2EZI A;  2X1E A;  2XPW A;  1X2N A;  3L2Q A;  2B7E A;  3RZO J;  3GZI A;  5JI6 A;  5D5U B;  4E7L A;  2E1N A;  2E5Z A;  3VOE A;  4AF5 A;  4UV8 A;  4F93 B;  2V1D A;  1MNE A;  3PNV A;  2R7T A;  5L3B A;  1MW7 A;  2XRN A;  3M3Y J;  2Y75 A;  2Z16 A;  2WGB A;  5FHP A;  5GAG J;  5HDN A;  2Y0S N;  3V42 A;  1MDM A;  1B72 B;  3FKI J;  2E5N A;  3PAS A;  5HBU A;  4P9F A;  4IHV A;  1IDY A;  5B3S H;  1YFH A;  3F6V A;  1GXQ A;  2LY2 A;  2VON A;  1RNL A;  5K58 A;  5IP7 J;  4E6K G;  4RS8 A;  3ABU A;  4C3I J;  2OER A;  2XAF A;  2Y2Z A;  2DTR A;  1V5F A;  4G6T B;  1C0W A;  2BGC A;  4U0V A;  3KET A;  2G7L A;  1IRZ A;  2YS9 A;  2KDZ A;  3LSR A;  2W85 A;  2ZXJ A;  2W7N A;  2O7O A;  1UHW A;  3DPJ A;  3G6E I;  3LWF A;  4ENM A;  2OBP A;  2MLG A;  2DDB A;  4Y13 A;  4ZDO A;  4OAZ A;  3LSM A;  2WB1 N;  3ANG A;  2EB7 A;  1KYZ A;  2ZJ2 A;  3GYH X;  2XAQ A;  1J9I A;  1U8B A;  3P5J A;  4B8X A;  4IO9 F;  1D0Z A;  4DZJ A;  4AID A;  1D5Y A;  2G7H A;  2E1O A;  2IA1 A;  5HLG A;  4NNJ A;  1BOA A;  4LGW A;  2OUM A;  1ZR4 A;  1Q1V A;  4LG0 B;  2Z3Y A;  4J00 A;  3I0T A;  3U2R A;  1ZHF A;  2A5Y B;  3SZG A;  3ZMZ A;  1VI0 A;  3GEZ A;  5JHF A;  2LF7 A;  1XGN A;  1VQ5 I;  5DV5 A;  3VYR B;  3K69 A;  1WJE A;  3V8L A;  5CVU A;  4UVC A;  2PQ8 A;  3GTP J;  2FUG 2;  4CO8 A;  2OC6 A;  3OYK A;  4NBQ A;  2DMN A;  2KT0 A;  1U9O A;  4BY7 J;  5J47 A;  1YE9 A;  2OF7 A;  3K4K A;  5HNF A;  1K6Y A;  1MBE A;  4PZJ A;  3VW2 A;  4Z2Y A;  4DBQ A;  5DS9 A;  3JTH A;  2RQQ A;  3DBR B;  4IVN A;  3DWL E;  3K4L A;  1FIP A;  2X4H A;  3I56 I;  2RV8 A;  2A2F X;  1KU7 A;  1Z3X A;  4J01 A;  5FLX K;  3D0S A;  5F27 A;  5B1A H;  1VQ4 I;  4A3E J;  4E7K A;  1MSE C;  2H8W A;  2F4O B;  3H35 A;  4NC8 A;  3QRF F;  3RD3 A;  3VW0 A;  3KEQ A;  2W82 A;  1Y56 A;  1HDD C;  2DOF A;  3SZT A;  3DBH B;  2OZ6 A;  5J8C A;  1REP C;  3UR3 C;  1OYI A;  3HTU A;  1RPW A;  1U5T C;  4P9U A;  2EFO A;  2XSD C;  3CTA A;  1ETQ A;  5CPR B;  3JRA A;  2VIX A;  2H1L A;  1T0F A;  3F8B A;  3TP0 A;  4BXU A;  4BAC A;  3AAF A;  1ZTR A;  1TQI A;  1Y8R B;  2DAO A;  3FK7 A;  1ZAO A;  5L3C A;  3E6C C;  1Z3Y A;  4ON0 A;  3BTI A;  3LOC A;  3A0H C;  5DAJ A;  1UFM A;  1SGM A;  4ETS A;  5C4X J;  3K70 D;  5C4Y A;  3GBG A;  2M30 A;  5J40 A;  2O6G E;  3DBL B;  2M2E A;  1OR7 A;  2BE5 F;  2VKH A;  2DFI A;  1V55 H;  2M5W A;  2VT3 A;  3F8F A;  2VE9 A;  2ZCN A;  3HL2 A;  4B47 A;  1QPI A;  1Y39 A;  4WXD A;  2MC3 A;  1AU7 A;  2YVH A;  1IN8 A;  1Y1V J;  1FTZ A;  2VB6 A;  1X4O A;  4M3E A;  2PX9 A;  3T0Y A;  1P2F A;  4CDG A;  1B4A A;  3CUO A;  3TDZ C;  5E3L A;  2F07 A;  2NS7 A;  2FE3 A;  1HXD A;  2KQR A;  1PUF B;  1K78 B;  2XB5 A;  1TWA J;  3FDY A;  1O3Q A;  2O03 A;  4XN3 A;  1WRJ A;  2JPC A;  3LA7 A;  2E2J J;  4WXC A;  3U1K A;  1XGM A;  4FX0 A;  4KT5 C;  2LP0 A;  1IXS B;  3S16 J;  1D8J A;  3GFJ A;  2M1B A;  2XC7 A;  1GV2 A;  3RPU A;  1YQA A;  4KIB A;  3TW7 A;  4BBS J;  1AWC A;  3M8F A;  3WU2 C;  2DMQ A;  3HSF A;  2K9S A;  3HZJ A;  4CCK A;  4BE2 A;  2EIN H;  1OCT C;  1LFU P;  2XIG A;  1F5T A;  4DZP A;  1RI7 A;  1KQ9 A;  4N0B A;  1WGX A;  2ZSH B;  4E7Z A;  2H94 A;  3CJN A;  5D6E A;  2XRO A;  1LUJ B;  2MBF A;  4I76 A;  5F0H A;  5IOZ A;  4BAY A;  1WQ2 A;  2V6E A;  4O6J A;  3PFI A;  3VDX A;  1WI9 A;  1ZN2 A;  3E5X A;  4E70 A;  1KON A;  3CJR B;  3W2W A;  3RPQ A;  5CVI A;  1T39 A;  1K6O A;  3EDP A;  2V79 A;  4CZZ A;  2GIZ A;  2FRH A;  1FNN A;  2YPR A;  1TQP A;  2VQG A;  3P9K A;  2LNB A;  2XGE A;  4IHW A;  3FXR A;  4XRM A;  2V9K A;  2LR8 A;  2JZY A;  3GXO A;  3CMY A;  2P6T A;  3HOT A;  3M8J A;  3IH3 A;  4F55 A;  2GEN A;  2UXU A;  1WI3 A;  2NAZ A;  4BHB A;  4BXF A;  1DP3 A;  2HQA A;  1I1S A;  4AC6 A;  1I3A A;  1LJ9 A;  1YJW I;  4KIG A;  2KZV A;  1YIJ I;  2XAS A;  4BEH B;  1RRJ A;  2DQL A;  1S29 A;  5E79 C;  4L0Y B;  3V6G A;  4DOZ A;  1CF7 A;  4YEL A;  5F08 A;  1SMY F;  2CQX A;  3VSL A;  3JSO A;  3KZI C;  2KMU A;  3CZ6 A;  3KP5 A;  2JA7 J;  3BC8 A;  1KZH A;  1D1B A;  1ZH5 A;  1E3H A;  4UVB A;  3KZ9 A;  2LTP A;  2Y0M A;  3VVY A;  1O57 A;  4C3J J;  2QBY A;  3G2B A;  3MCZ A;  1KGS A;  4HX7 A;  1BIA A;  2Q24 A;  4MFE A;  2P0W A;  1H89 C;  3DEE A;  4A3M J;  2DA2 A;  2IAI A;  4U7D A;  1D0Y A;  1VTN C;  1XSD A;  3IUV A;  4PJM A;  3V8J A;  4A12 A;  4NN1 A;  3OS2 A;  4N9H A;  5J6X A;  2A6H F;  4PSW A;  3GFI A;  2IVM A;  3AG1 H;  3I58 A;  1IUY A;  4G94 A;  2K4B A;  2E36 A;  2LBF A;  4XNF A;  1XN7 A;  2IGK A;  1IGN A;  3LQR A;  4BYY A;  3KPH A;  1Z1D A;  2O5R A;  3HTH A;  3NS4 A;  2REK A;  1JT0 A;  1ACI A;  2VE8 A;  3KE2 A;  3JRD A;  4ZDL A;  4M6Y A;  4XR6 A;  2NVT J;  1P4W A;  2BY1 A;  4QTR A;  3OS0 A;  5IPA A;  2R92 J;  2DA3 A;  1YRN A;  4OIO F;  2C6Y A;  2HDD A;  4C3H J;  2JUC A;  1S3J A;  2A6T A;  2HTS A;  4U9N A;  4YG2 F;  1MMD A;  5FLX Z;  1T98 A;  3WTX C;  2WA0 A;  4MNU A;  1OR7 C;  3FM5 A;  2MGQ A;  1JKR C;  4A5N A;  3F0C A;  4PJL A;  3VPR A;  2A69 F;  1P7I A;  2XF7 A;  1MMA A;  5JLW A;  3DEW A;  2F5D A;  1LQ1 A;  3E6M A;  4RLQ A;  2F5V A;  1GV5 A;  1MMS A;  1BC7 C;  1R1V A;  1HF0 A;  2QKL B;  3GTJ J;  4XKW A;  3EUH A;  4K2E A;  1JKQ C;  4A0X A;  4EEF G;  2B9S A;  2QQ9 A;  1WPK A;  5FRN A;  2CUJ A;  4UXN A;  3S2H J;  2LKP A;  3DTK A;  1XMX A;  1FX7 A;  3ELK A;  2WWY A;  5EG0 A;  4D0P A;  2XGC A;  3F22 A;  3I9V 2;  2NNN A;  1APL C;  4AVZ A;  2E71 A;  1NTC A;  3BJB A;  4CYD A;  2FEZ A;  4XID A;  1FT9 A;  2XHK A;  2QEN A;  1R9T J;  5JHU A;  5A2Q Z;  4GCV A;  5J8F A;  2BV6 A;  4B43 A;  1EJ9 A;  2E1M C;  3BCA A;  2L7F P;  1PUE E;  1OCR H;  2HGC A;  5J1Y A;  5ILU A;  3MMY B;  1MBF A;  1IC8 A;  2HYJ A;  2O9L A;  2KP6 A;  3M1E A;  5DD8 A;  3G1O A;  2QWT A;  3J81 K;  2HVQ A;  4A3G J;  4BBR J;  2LRD A;  4C2M J;  4DVY P;  2XAJ A;  4XM3 A;  3OYL A;  2Q2E A;  3OYA A;  2BW3 B;  1O4X A;  2CQN A;  2G7U A;  1SFX A;  2EWN A;  3CCY A;  4N4O B;  2HKO A;  4QLC U;  2ZNZ A;  2TRT A;  2K7L A;  3DTI A;  3TO9 A;  5D8K B;  5DD4 A;  1WH5 A;  2L0K A;  3GFM A;  2UZK A;  3RJP A;  4DGW B;  2QZ8 A;  5TJJ A;  2AXL A;  4NHJ A;  3IC7 A;  2HU9 A;  2CQK A;  3KP3 A;  3RQ4 A;  1K79 A;  2QF7 A;  3K70 C;  1ETX A;  4UUS A;  1TL8 A;  2GWR A;  2VKD A;  3NNR A;  1FMV A;  2VJ5 A;  1IJW C;  2ZOZ A;  3DPU A;  2CS3 A;  3RPU D;  3LAJ A;  2EA4 A;  3BOQ A;  3S32 A;  3S2W A;  1MBJ A;  1S9H A;  2XUB A;  3OS1 A;  3K1P A;  2IA2 A;  1OFC X;  1HSJ A;  2VBW A;  3ABL H;  1MND A;  1TLH B;  2HR3 A;  1BOB A;  1XX5 A;  2IXS A;  3S5R A;  3I71 A;  2HYF A;  1Z67 A;  3HUG B;  4KNY A;  3MFK A;  2JSC A;  2R4G A;  2L4A A;  2GXG A;  3G1L A;  1YW7 A;  4HDU A;  1T38 A;  2Y9Y A;  2A3S A;  5J1R A;  5CYV A;  5FKO A;  3O60 A;  1F43 A;  5D5W B;  3QPL A;  4LLL A;  3KYL A;  3E6D A;  2WY8 Q;  1UCR A;  4IRH A;  3C18 A;  3ZPL A;  3AG3 H;  4F91 B;  1JI8 A;  2NOJ B;  1NG6 A;  2HXI A;  1I3Q J;  2R7O A;  1VFC A;  3NWT A;  4I6Z A;  3VTI A;  1ZRD A;  2QKM B;  3HTA A;  4YEJ A;  5EF6 A;  1W5T A;  4MEX F;  4IOA F;  3LJL A;  3MKW B;  3CDI A;  3H3Z A;  3MZH A;  4O3M A;  4XON A;  3PFY A;  2X1D A;  1X58 A;  5GTH C;  3HIF A;  3F21 A;  1QU3 A;  4BHP A;  4UB8 C;  4HAM A;  5EZH A;  4PJN A;  4B48 A;  3OYE A;  3SJM A;  4JKZ A;  2DA7 A;  3SXY A;  2CRG A;  3MZY A;  2E19 A;  1XDS A;  2L9N A;  4ZH4 F;  4R8H A;  4NC7 A;  2GM4 A;  2ZFU A;  3HKZ N;  1PUF A;  1K78 A;  2BVM A;  3S17 J;  4B1R A;  4RB3 C;  3ZQL A;  4Y7N J;  3OV8 A;  4MLO A;  1IXR C;  3Q9V A;  4XSX F;  3TKY A;  1MMG A;  2K3P A;  2O61 A;  2ETH A;  3ZMT A;  2V26 A;  2PG4 A;  3F23 A;  1Z05 A;  4CXF A;  2YU3 A;  1FYM A;  3BG9 A;  4XRS G;  3E7L A;  3FHZ A;  3VVX A;  3L2C A;  5CJ9 A;  2FQ3 A;  2K9L A;  3AQS A;  4M3D A;  1RKT A;  1XDU A;  4LG3 A;  3BQZ A;  3OR1 C;  3HXL A;  1H0M A;  4ACI A;  3ZCO A;  1YIT I;  3SDB A;  5IP6 A;  2QUF A;  4M3B A;  2E7W A;  2EZL A;  4M3G A;  1UMQ A;  1BW5 A;  1V54 H;  2ICW G;  1J5Y A;  2EV5 A;  2VPR A;  2OV7 A;  3MZ8 A;  2CU7 A;  5FO5 A;  2RHA A;  2QSH X;  3HIM A;  1HQC A;  5EEH A;  2AHQ A;  3KX2 A;  1W7P D;  1GDT A;  4A3F J;  1FOK A;  1S5L C;  4MGR A;  5JLX A;  3IL2 A;  5TRD A;  3QPS A;  1QNT A;  3F8C A;  4HF0 A;  2DPD A;  4U87 A;  3A0B C;  4EJV A;  4A3B J;  2K4J A;  2V4J C;  2EJR A;  2VJI A;  3K2Z A;  2V9V A;  2DA1 A;  1P6R A;  1XB4 A;  2CW8 A;  1SEU A;  2PFB A;  3CUQ A;  5M5X J;  3J80 K;  1ETV A;  1H9T A;  1HCR A;  3GX4 X;  1LFP A;  4FTH A;  4GFL A;  1JT6 A;  2PN6 A;  3E1S A;  3LSJ A;  1YIO A;  5IY5 H;  1YRN B;  4RAF A;  4YZE A;  3GTQ J;  3CES A;  1FP1 D;  1JJ6 C;  4DQ2 A;  2E34 A;  3HPG A;  3BJ6 A;  2M8G X;  4A69 C;  4S04 A;  3H92 A;  4MQV A;  4BQO A;  5E8G A;  1FP2 A;  2X1C A;  3T8R A;  1PVE A;  3L2W A;  4C30 A;  1R7J A;  1DU0 A;  3KNW A;  2UXN A;  2G3B A;  2JVG A;  2J5P A;  4U0W A;  1A6I A;  3BTL A;  5H9T A;  2WAQ N;  4FX4 A;  3LAP A;  2ZXI A;  1QZE A;  3WHB A;  4RB2 C;  1XS9 A;  1KU3 A;  4HA8 A;  3H0G J;  5E3M A;  3LSH A;  3BCB A;  4WIB A;  4ZTJ A;  1P9Q C;  4EGZ A;  5D5X B;  3OYI A;  3TO7 A;  1EH6 A;  1WZ2 A;  4GFK A;  1FC3 A;  4HNT A;  4QWQ A;  2W84 A;  3ZQI A;  3JRE A;  4BQN A;  5M3F J;  1Y0U A;  1KA8 A;  2EFN A;  4BQA A;  2O7T A;  1K4T A;  4HST A;  3T8T A;  3W6J B;  4ENN A;  2ZME C;  2ZSI B;  5LGU A;  3PNY A;  4JX6 A;  5HLT A;  3L1P A;  3I55 I;  3L9F A;  3LSG A;  2K3F A;  4OAY A;  2D2W A;  2M87 A;  2OU2 A;  1G3T A;  3VVZ A;  2Q1Z B;  5KHD A;  1ZQ3 P;  2UXH A;  2EBI A;  2RVC A;  1DPR A;  3HSR A;  2CJJ A;  4LIU A;  4XLE A;  1ERD A;  4QPO A;  2ZBK A;  3C2B A;  4RMN A;  2NNY A;  3RZD J;  3MEX A;  3S1N J;  5J4V A;  5FKL A;  2GUH A;  2HDC A;  4TV7 A;  4IHS A;  3KKD A;  1FOW A;  4B4C A;  2FBQ A;  2LRE A;  1LDD A;  5L3F A;  3ZQC A;  5F0F A;  1W7P B;  2RAE A;  4G6Q A;  3S93 A;  1VQN I;  2LDU A;  2GLO A;  5HDG A;  1P4A A;  2QIB A;  5B66 C;  3LQQ A;  2VOD A;  2CW0 F;  5K5O A;  3IHU A;  4JX5 A;  4N4N B;  1JUM A;  5D4S A;  1X1P A;  5AON A;  1CQT A;  2CQQ A;  3QOP A;  5FRO A;  4Q48 A;  3HOX J;  2I5U A;  1QRY A;  2OA4 A;  2X6Y A;  3FMS A;  1GT0 C;  1MDM B;  1TZL A;  2K9N A;  5ICG A;  1GXP A;  1WJA A;  5DCM A;  3KYD B;  3SQN A;  1IN5 A;  4MFD A;  4C2U A;  3TMO A;  2JSP A;  3OYM A;  2HPI A;  3SFI A;  3F8M A;  2JN6 A;  2FU4 A;  1OMI A;  4JNN A;  2FJI 1;  4UUV A;  3QU6 A;  5FB2 A;  3HBL A;  4M74 A;  2QSF X;  2A68 F;  3PIP F;  3GO5 A;  2R93 J;  4RDU A;  4BS9 A;  3FRQ A;  2YSR A;  2JA6 J;  2MW8 A;  4H4K C;  3K1M A;  2LY9 A;  4HV6 A;  3PIO F;  3J81 Z;  1WJB A;  5EEG A;  3ZGK A;  2XDV A;  1XMA A;  3N97 A;  2DBB A;  1JUP A;  2JTV A;  4RAG A;  2LBF B;  3V7S A;  4UUT A;  4ESB A;  1UZC A;  5IYC J;  2HOT A;  1YI2 I;  1IRX A;  3MKL A;  1YX5 A;  5HDK A;  2BY3 A;  2DOE A;  4ZYE A;  2IBD A;  3PSI A;  2E1C A;  3C1D A;  3FZV A;  3MAJ A;  3CWR A;  2IT0 A;  2ID6 A;  3Q0V A;  3QU3 A;  2L02 A;  5KNL A;  1VZ0 A;  2TDX A;  3KZZ A;  4BQQ A;  2DG8 A;  2FQ4 A;  3IAM 2;  1STZ A;  3C7J A;  1OQY A;  5GAD J;  4AIK A;  2Z9O A;  4QSH A;  1Y6I A;  4B3X A;  1W0T A;  3JR9 A;  4I09 A;  5HLH A;  2EFW A;  4KYW A;  1D3Y A;  1ON2 A;  3I53 A;  3SWH A;  2QBY B;  3NI7 A;  3FXQ A;  3KEO A;  3ECH A;  5GPA A;  3S8P A;  2GXA A;  2LKX A;  2BHY A;  2NS8 A;  4HYE A;  3HOZ J;  4EM1 A;  1TNS A;  2E35 A;  2DW4 A;  4CZC A;  4I01 A;  1B6A A;  3BG6 A;  1WKM A;  1QO0 D;  2GOX B;  4GYI A;  1VQP I;  3HE0 A;  2Y31 A;  2IA0 A;  3PQJ A;  3CUQ B;  1Y1W J;  2HQN A;  4PJJ A;  3WTZ A;  2P4W A;  3HRT A;  1HKS A;  2WV1 A;  4U9L A;  3A02 A;  2RAS A;  2B63 J;  3QYB A;  2D45 A;  3FM3 A;  3BTC A;  3EUP A;  4LLG F;  3NRG A;  1B59 A;  1FMW A;  5FGL A;  1TQM A;  4IPA A;  3BRO A;  5IT3 A;  2CUE A;  3QQA A;  3M07 A;  4UV9 A;  2TCT A;  2ADU A;  4I7H A;  3HTS B;  4CUG A;  2Q0O A;  2UXP A;  1Z91 A;  3Q3S A;  1R71 A;  4BE1 A;  1LE8 A;  3FXL A;  2M34 A;  5FJ8 J;  2ZB9 A;  1QPM A;  4CCN A;  4EM2 A;  3P9C A;  3QKX A;  3LST A;  1FYL A;  4QIW N;  2KDO A;  2Q8K A;  3K7A J;  4LIV A;  2L5Q A;  2R7Q A;  5FD6 A;  2A61 A;  3RYR A;  3ZN0 A;  3ABK H;  4CCJ A;  2UXO A;  3GUD A;  2PI0 A;  4KWA A;  2NVU B;  5C44 J;  2NYX A;  2HXO A;  4CCM A;  4A3J J;  4NB5 A;  1RZ4 A;  2L01 A;  4PUS A;  1L3L A;  4RM3 A;  3W6K B;  3SEQ A;  3GTO J;  3I64 A;  4YRV A;  2HQ5 A;  2KRC A;  3ERM A;  3BZK A;  3C2G A;  3CC2 I;  2Y0S A;  4HOB A;  3NXC A;  5F6F A;  2KKO A;  1OCZ H;  5ICC A;  3JRI A;  1ZAR A;  1U2W A;  4XLF A;  1SD6 A;  1MJB A;  4FET A;  3JSP A;  3G3Z A;  4IRI A;  3JRH A;  1HA8 A;  4KN7 X;  3K4J A;  5DYM A;  4AD9 A;  2ID3 A;  4HKU A;  4YII A;  3CUQ C;  1MBG A;  1X3U A;  3O8H A;  5H6Q A;  4WF2 A;  3BNI A;  4AYB N;  3WTW C;  4PK4 A;  3WE3 A;  5IYB J;  2VBZ A;  5HOO A;  3COA C;  3HOV J;  2Y48 A;  5IT9 K;  1T95 A;  2Z99 A;  4R1H A;  1BI1 A;  2LG4 A;  5D4R A;  1KU2 A;  3LA3 A;  2HS5 A;  2EFQ A;  1ZR2 A;  2QKO A;  3F1B A;  3E7Q A;  1M1E B;  3T1B A;  5L3D A;  2WV0 A;  1SD5 A;  3BR6 A;  3K4C A;  4V2F A;  3OIO A;  5CLS A;  3HC7 A;  3WE2 A;  3J7Z I;  2NVY J;  1YS7 A;  5KK1 A;  3RIR A;  1QGP A;  3AQT A;  3LWJ A;  3ZXS A;  4L62 A;  2XPU A;  1R1T A;  2XAH A;  3OYC A;  2F5C A;  1GVJ A;  1UI5 A;  1SAX A;  4XOP A;  2OCC H;  4P5O A;  1A04 A;  2EZH A;  1YO5 C;  2RDP A;  4PJ0 C;  1ZYR F;  4E7S A;  3LFK A;  4GCK A;  3A2K A;  4LIT A;  4MEY F;  3S15 J;  3HTJ A;  1XSV A;  2ISY A;  1ULY A;  1Z9C A;  1R5I D;  3CCR I;  3EUK L;  1ZLJ A;  2ZKZ A;  4PXI A;  2DU9 A;  5ILV A;  4N9I A;  3BR2 A;  2QCO A;  4EMS A;  1BJZ A;  2MH2 A;  1D0X A;  4KJZ A;  2QVO A;  5FKK A;  2PJR B;  3W3C A;  2WB1 A;  3EYI A;  4NDL A;  5KCM A;  2LD5 A;  1MNM C;  1YS6 A;  1X1B A;  3C2H A;  3NEU A;  2CFO A;  4JK1 X;  2Y9Z A;  3KP7 A;  2MYS A;  3R60 A;  1D5V A;  2YR2 A;  1UAA A;  2FNA A;  4G9Y A;  4ITV A;  3R0A A;  2K86 A;  2AXT C;  3CC7 I;  3H1C A;  4IKF A;  1IV6 A;  4KIS A;  4LG0 A;  4D7M A;  4BEH A;  5HLI A;  1FBU A;  2P5V A;  3BTJ A;  3IAS 2;  3ZQG A;  3JRB A;  2LK2 A;  5K7F A;  3ZQQ A;  1R36 A;  2BHZ A;  1E3P A;  1RUN A;  1LKX A;  3E5U A;  2VAS A;  4A93 J;  2ESH A;  1BM9 A;  4EAT A;  3OYG A;  2WY7 Q;  1EV7 A;  3UKG A;  2H6B A;  3F8N A;  3J7A O;  4S0H B;  3LSK A;  3EUH C;  1VQM I;  5LD2 C;  2M7A A;  4HQE A;  4IRG A;  2L4M A;  5FKM A;  1ORK A;  2H09 A;  5F1R A;  3U9G A;  2UWM A;  4M3F A;  3H3V K;  3SDG A;  4IQJ A;  5BOX A;  1PYV A;  1QQI A;  2OCE A;  3GCM A;  5DUI A;  3F9K A;  4F52 A;  3RKQ A;  4XQF A;  2D6Y A;  2ZCM A;  4RGX A;  1Q1H A;  1X1A A;  3CJT B;  3GZ6 A;  2GXB A;  2V6C A;  1R22 A;  2DO7 A;  3H0D A;  1GLN A;  4KA4 A;  2WUI A;  3ABM H;  5J1U A;  3GFL A;  3KP4 A;  2KPM A;  2WC2 A;  1R4N B;  2BBY A;  3QP5 A;  2IS1 A;  3K0L A;  2FOK A;  2STT A;  1LVK A;  2HVS A;  3PPB A;  3TBI A;  2HFH A;  2M9H A;  3RYP A;  4I0B A;  4MTD A;  4Q47 A;  3FX3 A;  2W53 A;  2QQB A;  1S6L A;  1JGS A;  2CG4 A;  1ZEL A;  4ESJ A;  2NVQ J;  5E8I A;  3AL0 C;  3VYU B;  2K85 A;  4GGG A;  4HZF A;  3HDD A;  1VQ6 I;  4AIJ A;  1YHQ I;  1BW6 A;  4GO1 A;  2Z33 A;  2JT1 A;  5FGM A;  5BPD A;  1DPU A;  3GME A;  3K4N A;  4GDF A;  2NRA C;  1UHS A;  3DV8 A;  1O3R A;  2HEO A;  3H9Q A;  1FEX A;  2UV1 A;  4HPQ A;  2OTL I;  3D5L A;  1T6S A;  1VF9 A;  4D5C A;  3GTL J;  3AFH A;  3JRC A;  1EH8 A;  3CJD A;  4KMU X;  1IN7 A;  3B6C A;  1ZG5 A;  2VQH A;  4KIT B;  2PFV A;  1I50 J;  3QYE A;  2L7M P;  4UB6 C;  5DCM B;  2JQ7 A;  3CC4 I;  1Z0X A;  2ISZ A;  1BBY A;  1TWF J;  4ZC3 A;  1A35 A;  3TQN A;  2F4M B;  3ISP A;  4HG2 A;  2GIV A;  2HZD A;  1Z7L A;  5CKT A;  5HNH A;  2OQG A;  3VEP A;  1G4D A;  4WCG A;  2IRF G;  1P4X A;  2GA1 A;  2FF4 A;  5CVR A;  1OPC A;  2QTQ A;  5EGO A;  3I54 A;  1DDN A;  1W36 D;  1POG A;  2I8D A;  1WVR A;  3HKZ A;  3I59 B;  3N4M A;  2V9P A;  3I5U A;  3ZRG A;  3ZMD A;  2R7Z J;  4MTE A;  3ANP A;  3GEU A;  4Y3O A;  2MD5 A;  3UNG C;  3PSF A;  5ICF A;  5EGO B;  5JVG F;  1VQL I;  2P81 A;  1IF1 A;  3OOU A;  2ZME B;  3IV5 A;  4W97 A;  2STW A;  2YX7 A;  3FMR A;  5L3E A;  1LEB A;  4G6D A;  3P9T A;  3H3U A;  2W4S A;  2K9Q A;  4UHT A;  3AKZ A;  1O3S A;  4G8X A;  2OJE D;  1WWX A;  3FF5 A;  3U1D A;  1P7J A;  2R7V A;  1UST A;  1E0E A;  3WU0 A;  1ZG1 A;  3DP7 A;  2VOO A;  3QBM A;  3PO2 J;  3MKY B;  1ZRC A;  2V7F A;  2EA2 A;  1RIO H;  2CV1 A;  4CCO A;  2XDN A;  1FOX A;  2KZG A;  2YUS A;  2X0L A;  3CDL A;  4L5J A;  1XSX A;  4XL9 A;  3JAM K;  1UG0 A;  2Z5U A;  5HS8 A;  1XTA A;  2EQR A;  4II2 A;  4FHT A;  3FXM A;  1LVA A;  2H8R A;  3Q9S A;  1OCO H;  2IS6 A;  2FX0 A;  4HLY A;  2XPV A;  3VW1 A;  2KHM A;  2VPL A;  4XKV A;  4AUX A;  2KIS A;  5F1J A;  4CIC A;  1OJL A;  4X1E A;  1FOY A;  1SVO A;  5JVT A;  2DQR A;  3GZN B;  2FBK A;  4UNO A;  2GA2 A;  3OWT A;  2K5C A;  1D8K A;  2CQ7 A;  2E7X A;  3TO6 A;  2CV2 A;  4M71 A;  2X51 A;  5H2F C;  3DKX A;  2ZC2 A;  2F6C A;  4HX4 A;  1PP7 U;  1SD7 A;  4CH7 A;  2AQE A;  3F72 A;  1ENH A;  1R5H A;  2COM A;  1J7K A;  3G4S I;  1XGO A;  4JX4 A;  3D1N I;  3IH2 A;  1X1C A;  1Y0N A;  4LJZ F;  3TOA A;  2ZJQ F;  4E7J A;  4ASN A;  3CCL I;  4UDS A;  4U88 A;  3A01 B;  2R5Y B;  4RBO A;  3DCF A;  2JRM A;  3RSN A;  5DM7 F;  4EVI A;  3LFU A;  1UB9 A;  2X48 A;  5E17 F;  3EGQ A;  5AQC A;  2DOD A;  2ZO4 A;  2PMZ A;  5IT9 Z;  4XIC A;  3GTK J;  4M9S A;  4HBL A;  3OIQ A;  3Q0W A;  3BT9 A;  4HNV A;  2RRE A;  3NPI A;  1BA5 A;  5GPC A;  1QZZ A;  1R00 A;  4BNC A;  2DMT A;  4KIF A;  2KIQ A;  1RR7 A;  4ZDP A;  1TC3 C;  1JHH A;  5EFY A;  4XOT A;  2DT6 A;  4M72 A;  1UEL B;  3ZMS A;  4DJA A;  1TWG J;  1SFE A;  4L9N A;  4D5F A;  2DT7 B;  3V8K A;  1FY7 A;  3QOD A;  3ERE D;  5D5V B;  3J7Y J;  3DF8 A;  1RET A;  2WAE A;  3HB9 A;  4O5V A;  2AO9 A;  4XLH A;  4E4H A;  3OY9 A;  2VOP A;  2JJ7 A;  1ITY A;  1FBQ A;  4Y15 A;  4RB1 A;  3L09 A;  3CMM A;  3ECO A;  1OYW A;  1DGR M;  4OOI A;  3WHC A;  2CUF A;  5ICE A;  2MG4 A;  4OD5 A;  2QSG X;  3DTE A;  4AU7 A;  2B3W A;  4M6X A;  1TTY A;  4DW6 A;  3KLO A;  2R0Q C;  1H8A C;  3V4G A;  1HLV A;  4A3L J;  3HOW J;  2P7C B;  3FIS A;  4G7O F;  2R7S A;  4MXM A;  2ME6 A;  3QWL A;  3KKC A;  2IGO A;  3K4M A;  1OCP A;  2L9R A;  2FSW A;  4IL6 C;  3WTU C;  4PGG A;  1BI0 A;  5CXI A;  3K1N A;  2IJL A;  1IXC A;  2LLK A;  4EQQ A;  4JQF A;  2BOL A;  3KP6 A;  3MKZ A;  3S3N A;  2X6X A;  1EF4 A;  4C2M A;  4LD5 A;  4J19 A;  2D1H A;  3W2A A;  1LPQ A;  2HKU A;  2D1V A;  1MGT A;  3BDD A;  4GYG A;  4BDZ A;  3KFW X;  4CA0 A;  2EZK A;  1MIJ A;  1IRG A;  3ULQ B;  1G3W A;  4XKB A;  1SVM A;  4ME9 A;  4LOC A;  2MAB A;  4BDY A;  4ABZ A;  5FLV A;  1G3Y A;  2WAD A;  4XLA A;  1SD4 A;  1F1Z A;  1X3W B;  1EKE A;  2FJ1 A;  2X6O A;  3FXU A;  4L9V A;  3HOS A;  2DI3 A;  3WTY C;  4A3K J;  5ILS A;  4BHC A;  3J7A Y;  1FLI A;  5C4J J;  4OIR F;  3IP4 B;  4ENJ A;  3OYJ A;  1SAU A;  1YTY A;  3GW2 A;  1A31 A;  5GAE J;  4IRV A;  2O8K A;  5DM6 F;  1ON1 A;  4UVA A;  3RKX A;  1UJ8 A;  3KEY A;  3IWZ A;  5LEJ A;  3CP2 A;  2ELH A;  1UHM A;  2ELK A;  5EDN A;  1V5G A;  2PZ9 A;  1FTT A;  5K7Z A;  1TW2 A;  4G7Z F;  3G71 I;  4RLF A;  2IPQ X;  3FIW A;  4A0Z A;  3PO3 J;  4FE7 A;  2L7K A;  3CLQ A;  3L00 A;  3RKY A;  2JWT A;  1BI2 A;  1CGP A;  1F36 A;  3CCM I;  4U0Y A;  1S7A A;  3WOD F;  1LEA A;  2MC4 A;  3HEF A;  1XC5 A;  4ZZL A;  2VJJ A;  3S1Q J;  6PAX A;  3PL8 A;  2JRT A;  1JUS A;  2DLL A;  2FD5 A;  1VQ9 I;  1ONV A;  1Z6T A;  1XCV A;  3IWF A;  4RAZ A;  4EM0 B;  1QA6 A;  1RES A;  1JTY A;  3FHN A;  2KFD A;  2A07 F;  1R1U A;  5CQG A;  4BGD A;  3O8G A;  1LNW A;  3QPH A;  1I1G A;  1JE8 A;  4OIP F;  2CH0 A;  5HVQ C;  1YYV A;  4HW0 A;  3FXJ A;  1FSE A;  3FWE A;  2LOO A;  2X85 A;  3A4C A;  2R5Z B;  4EV0 A;  2O8X A;  3BPV A;  3KP2 A;  1IO2 A;  5M3M J;  5EG0 B;  2XAU A;  1S7E A;  2XVC A;  3I4P A;  3ZQ7 A;  2CUZ A;  1I39 A;  3MVP A;  1W0U A;  1RUO A;  5KAF C;  1N78 A;  4XRS A;  1IW7 F;  3VFZ A;  2F4I A;  4DYC A;  2PJR A;  1AOY A;  1R58 A;  3TDU C;  1J2X A;  1T2K A;  3CO7 C;  3BPX A;  1R5G A;  2EH3 A;  4RGS A;  4DYR A;  2PLY A;  3TOB A;  1MSF C;  1A5J A;  3K4B A;  1U8R A;  4L5I A;  3QAH A;  1WCM J;  3R61 A;  4W1U A;  3M8E A;  4IQ4 A;  3KIO A;  4BJT A;  3GTM J;  2GBY A;  4B09 A;  1J0R A;  4ZYH A;  3IUO A;  2ECB A;  3FXO A;  2YVE A;  2LFB A;  4I99 C;  5F0C A;  3V7R A;  2CYY A;  4D1Q A;  2YVX A;  2LH9 A;  2RQP A;  5H20 A;  1BR2 A;  4XLC A;  2DCE A;  4B3A A;  2M45 A;  5ED4 A;  3A1Y A;  3OSG A;  4UY8 I;  2L54 A;  3C3W A;  2K9M A;  2HDW A;  1U6G A;  3BJA A;  2W24 A;  2P5L C;  4D9J A;  1B8I B;  2CV0 A;  5GAH J;  1VQ8 I;  3VUQ A;  3GTG J;  5LHI A;  2OAZ A;  3CMA I;  2O0Y A;  3CF5 F;  3ML6 A;  3S1R J;  1Z6R A;  2LKS A;  1BJA A;  2FNP A;  3L2R A;  1PP8 F;  3BZ6 A;  3WGG A;  2ZJR F;  1SFU A;  3VWB A;  4CYC A;  2M8E A;  5CQE A;  1WSU A;  1LDJ A;  5CVJ A;  3REO A;  1HOM A;  1MH4 A;  4JYK A;  3VP5 A;  1Y8Q B;  1Z7U A;  2BVL A;  2P8T A;  3R4K A;  4WX9 A;  4KN4 X;  1JJ8 C;  3R0J A;  3H5R A;  2UUZ A;  1YW8 A;  3JSJ A;  4M6V A;  4C9Y A;  3K6G A;  4C2T A;  2H27 A;  1LDK B;  3ZR8 X;  2M4K A;  3DQV C;  3HRU A;  2RGV A;  1SFK A;  4U7B A;  5BS6 A;  1VQO I;  5FLM J;  2LVS A;  4IEJ A;  1HKT A;  1SMT A;  1G2H A;  2BZT A;  3VOK A;  4AIH A;  3JW4 A;  3LHQ A;  1OCC H;  1WJD A;  5D6F A;  4IHX A;  1FJL A;  1CF7 B;  3HJE A;  4H0E A;  3BLY A;  2PEX A;  1DQU A;  3B6A A;  3BZC A;  3J80 Z;  4A6E A;  1S7O A;  3G1M A;  5LBQ A;  4NUB A;  3S14 J;  3VIB A;  3RTR A;  5FD5 A;  3OYF A;  2ZY9 A;  3FBN B;  3H5A A;  3HRM A;  3RQI A;  3ZMU A;  5LHG A;  3IRQ A;  3LMM A;  4QPQ A;  1RC9 A;  1IG7 A;  2V1U A;  3MWM A;  3PUB A;  4I0A A;  2DN0 A;  1XGS A;  2KIF A;  5IOY A;  3SZP A;  3M9A A;  1T08 B;  3KCC A;  4KT6 A;  2JVH A;  1B72 A;  2A6E F;  1IV8 A;  4G7H F;  4ENK A;  5K5Q A;  2UXX A;  2DA4 A;  2QEX I;  4E7I A;  2I10 A;  4XK4 A;  3I4M J;  3BWG A;  3E97 A;  4PSX A;  5BMZ A;  1QHH D;  1I5Z A;  2DK8 A;  4YIF A;  5LRS A;  5F64 A;  2M4G A;  4KMF A;  1ETK A;  2KJC A;  1DGW Y;  3JAM Z;  1BL0 A;  3CDH A;  2DYS H;  1KU9 A;  2DK5 A;  2QYO A;  3EET A;  4MO7 A;  1MKM A;  5FKN A;  4LFU A;  1U5T B;  1XMK A;  3NAU A;  1MZB A;  4KIC A;  2VC0 A;  4LLN A;  3S1M J;  1U9N A;  3E6B A;  4ZZD A;  4XRF A;  1H88 C;  1KYW A;  3CRJ A;  5DDG A;  3DPL C;  3LL7 A;  3OMY A;  1JKP C;  4P96 A;  4ZTF A;  2GQQ A;  4A0Y A;  4D7N A;  3D5S C;  2CMP A;  2BY0 A;  2F5E A;  2N8G A;  2WAF A;  3CLO A;  5LHH A;  1DUX C;  2NP3 A;  3DXJ F;  2G9W A;  2EIL H;  1VND A;  3O3K A;  4FIS A;  1S8N A;  1W1W E;  4CHU A;  1QBJ A;  1X4P A;  2NX4 A;  1IRF A;  1IZ1 A;  2DMP A;  3M1C A;  2DT5 A;  4WWC A;  2XSJ C;  4V19 K;  3SYT A;  3HPH A;  4IXA A;  3PM1 A;  4GCT A;  1MD0 A;  3VYT B;  4R79 A;  5DTD A;  3X2Q H;  1K7A A;  2FML A;  2ZNY A;  1T8I A;  1TWC J;  3HGG A;  1O7F A;  3OYB A;  9ANT A;  4JBA A;  3R6S A;  3SHF A;  4FE4 A;  2VLA A;  1XG1 A;  2CW7 A;  4XN0 A;  3O6B B;  3CME I;  3HSE A;  2CWE A;  2PMH A;  1EH7 A;  4A6D A;  4RGU A;  2R5Z A;  2HNH A;  2GFN A;  1WHU A;  3RCO A;  3RDI A;  2W1O A;  3KYC B;  3SEZ A;  1V3F A;  4Q4Z F;  4Q5S F;  2PMZ N;  3OL4 A;  3ZMV A;  4YFK F;  2JPB A;  1J09 A;  2EIM H;  5H6R A;  2KL4 A;  2ZCW A;  2W48 A;  4HNU A;  2CFX A;  4ICH A;  2M3A A;  3HG9 A;  4MHG A;  5LGT A;  3ON2 A;  2P7V B;  2L9S A;  1U78 A;  1IAW A;  2DYR H;  1YJ9 I;  2IS2 A;  3H36 A;  1YG2 A;  2DFF A;  4EJW A;  2R7R A;  3GWZ A;  1T0F C;  1XD7 A;  3CP8 A;  4FT8 A;  4BJ5 C;  1VQ7 I;  4LK0 F;  1S72 I;  4HQM A;  1QVU A;  1KQ8 A;  2JA2 A;  1U5T A;  1OKR A;  4OD4 A;  4L0Z B;  2DPU A;  5DEQ A;  1G8X A;  1GUU A;  5HS7 A;  4OMZ A;  2M7B A;  5IYD J;  1NG7 A;  2XF5 A;  1GVD A;  4MQ9 F;  2HYT A;  2VQC A;  3ON4 A;  5D8L B;  2QLZ A;  1I6X A;  2KIU A;  3KLN A;  4L5E A;  5BQT A;  2ME0 A;  1N25 A;  3VYS B;  3WTT C;  1ETY A;  2EV0 A;  5B5E C;  2Y30 A;  4M9X A;  2HVR A;  2DXI A;  4HRI A;  3HHG A;  2NP5 A;  4IHT A;  4F3Q A;  3U21 A;  4BH9 A;  2WAQ A;  4FQG A;  3WU1 B;  4I02 A;  1A36 A;  5HSZ A;  1AA7 A;  2FMY A;  3QPT A;  4HF2 A;  2DG7 A;  4KDP A;  3DU6 A;  1E3O C;  1RR8 C;  1ZGJ A;  4LMY A;  2RC4 A;  1PDN C;  3CCQ I;  4NQW A;  4YIR X;  3NWS A;  1Z21 A;  3PNT A;  4KUM A;  2XF6 A;  4ANJ A;  2EV6 A;  5K1Y A;  2DFH A;  1JGG A;  2K02 A;  4AC0 A;  3DLA A;  3CCE I;  4LB6 B;  1N77 A;  4IJA A;  5TIS C;  4F7Z A;  4X6A J;  5BNG A;  1Z77 A;  4XKC A;  1O7L A;  4HEA 2;  2R7W A;  3HM5 A;  2QA4 I;  3AG2 H;  3HHH A;  3QYF A;  2G7S A;  1LFB A;  3L2U A;  1IDZ A;  1VQK I;  4AM3 A;  1X1D A;  5CW8 A;  2L7Z A;  2NOG A;  3HYI A;  3BR3 A;  2VN2 A;  4HSR A;  4PCQ A;  2ZCX A;  1E2X A;  3VOX A;  2FBI A;  2MD0 A;  3WGH A;  1B1B A;  4AWX B;  3GZ5 A;  3GF2 A;  4LB5 A;  2NS0 A;  5HS9 A;  3BJO A;  3ROU A;  2MSY A;  2MA3 A;  4DBR A;  5FRM A;  1EA3 A;  4F92 B;  2GAU A;  1LE8 B;  3VOD A;  5D18 A;  1RKW A;  1R49 A;  1DU6 A;  5K5R A;  3SFZ A;  4OU0 A;  2B1E A;  1K4S A;  1HW5 A;  3TED A;  1AHD P;  5C3E J;  3LNQ A;  3HUG A;  2BYV E;  4RB0 A;  2JK3 A;  1QHG A;  2M0C A;  2ZME A;  1HKQ A;  3KZY A;  1K83 J;  1T33 A;  1WJF A;  2HKX A;  2K27 A;  1T56 A;  5EJC A;  2HYG D;  2IP2 A;  2EK5 A;  3IKT A;  2RKH A;  3LA2 A;  2DOA A;  3DFG A;  5HOD A;  3E3V A;  5DCF A;  1QZY A;  2HOS A;  1UI6 A;  2Y69 H;  3W2V A;  3BG7 A;  3CD6 I;  1DP7 P;  2FOW A;  2VI6 A;  3BP8 A;  1IN6 A;  4I98 B;  1D1C A;  2KLO A;  4UUS B;  1MBH A;  2QM3 A;  2FXA A;  2VC1 A;  3OIP A;  2IW5 A;  3D5R C;  3DU5 A;  3FK6 A;  2OZU A;  1A6Q A;  4NC6 A;  4LK1 F;  4E7H A;  1MJ9 A;  4BJ6 C;  1USS A;  4KFC A;  2LC2 A;  2XV4 S;  4ESF A;  4DYQ A;  4HX8 A;  2HZT A;  3T5X A;  3V78 A;  1V5E A;  2KRF A;  2W25 A;  2VXD A;  3A01 A;  3MN2 A;  4IOC F;  5FMP A;  3CF2 A;  1W36 C;  2EIJ H;  5E1X A;  1BIB A;  2EPF A;  2KIM A;  1FZP B;  3HOU J;  5J3L A;  5E3N A;  5K7H A;  1TNT A;  3N05 A;  4JOM A;  3IKV A;  4M9Z A;  4RA2 A;  3L2V A;  5L3G A;  5A2Q K;  4CCL A;  2JUG A;  3FXK A;  4YFX F;  3OYH A;  3ESW B;  4JL3 A;  2MLK A;  3BY6 A;  5M5Y J;  2J5O A;  2OQR A;  2CO5 A;  2IEK A;  1G3S A;  3LSI A;  1K61 A;  5AIP A;  1TW3 A;  2HPM A;  2AQF A;  2F2E A;  2XKP A;  5LLQ A;  4A3C J;  4GRI A;  5JR3 A;  3BCG A;  3P9I A;  2E1M B;  2PMU A;  4BKX A;  1ZRE A;  3L7W A;  3I4N J;  3DKW A;  1FSH A;  3HTI A;  5F04 A;  5LRR A;  2PJP A;  4OIQ F;  2JA8 J;  5E1Z B;  3PQK A;  3HOY J;  5D1R A;  2L2O A;  3TGN A;  3QOE A;  1HW1 A;  2RNJ A;  5E1W A;  2L9V A;  1X19 A;  3PUF A;  1XPX A;  1G6N A;  4DIQ A;  3K2A A;  3P7N A;  3GLX A;  5EZG A;  2K40 A;  2XRL A;  2ZXH A;  3JRG A;  3AL0 B;  2EIK H;  3BG3 A;  1NHA A;  2GOM A;  1J75 A;  2P6S A;  3G56 A;  3PJR A;  1WH7 A;  1GHC A;  3CCS I;  5DUK A;  2VT2 A;  3S3M A;  2QWW A;  1I27 A;  4MK6 A;  5B1B H;  3OOP A;  5LGN A;  2COB A;  4P55 A;  3IH4 A;  4XMY A;  1V4R A;  4OWR B;  4XOR A;  2BXY A;  1R23 A;  3BR5 A;  3OSF A;  3O2P E;  3V7C A;  2VXZ A;  2VL8 A;  5EYR A;  3WTS C;  4CGZ A;  3CJQ B;  1IUF A;  4BL0 B;  3EUA A;  1BN5 A;  1MJA A;  3T6N A;  3CQZ J;  2F5F A;  1U0J A;  2R7X A;  1FYK A;  2UXI A;  4IF4 A;  4Z6Y A;  1YW9 A;  2YU9 J;  4BE0 A;  1P92 A;  2E2H J;  2CSO A;  2VKE A;  4S05 A;  1TP4 A;  5M5W J;  3F6O A;  2QGU A;  1HST A;  2R3S A;  4M73 A;  3VB2 A;  1SFO J;  2QQA A;  4II3 A;  1MBK A;  4V2G A;  3JRF A;  1ETW A;  1WJC A;  5KVR A;  3K9T A;  3S2D J;  4FCY A;  5IP9 J;  4ZJZ A;  4WXH A;  2DMU A;  1NK2 P;  2NVX J;  4I2O A;  3OYN A;  4Y52 J;  1B8I A;  1W4M A;  3CCU I;  5CVV A;  2XGD A;  3H5N A;  2E2I J;  1HBX G;  2M0M A;  3Q5F A;  2LSO A;  3CCV I;  1KQ0 A;  1W5S A;  3JTG A;  5E18 F;  2MFZ A;  2P5K A;  1FWZ A;  3DPT A;  2BY2 A;  2MH9 A;  3DLL F;  2XAG A;  3C07 A;  2V1X A;  5J4Y A;  2CGP A;  2ELJ A;  3MNL A;  4BXX J;  4NEL A;  3ASO H;  1F9N A;  1X3Z B;  1OYY A;  3A03 A;  2OTJ I;  2DTZ A;  3I3L A;  3WGI A;  3ZOB A;  4XLP F;  1O3T A;  1X2M A;  4CSW A;  2JMW A;  2OPT A;  3ZQH A;  4IZZ A;  1JKO C;  3COL A;  3I59 A;  1U3E M;  1ZLK A;  3BHQ A;  4DNC A;  1R4M B;  2B0L A;  3ZQF A;  1TBX A;  3B81 A;  3JCU C;  2YX4 A;  1TT5 B;  3MQ0 A;  4B44 A;  2E60 A;  3HRS A;  2VBY A;  1D1A A;  1ZKG A;  4Y33 A;  1SC7 A;  2R7F A;  2R5Y A;  3OL3 A;  5KAI C;  4OIN F;  1YOV B;  2OI8 A;  2W57 A;  2L3D A;  3RI4 A;  1ZGW A;  1W7P A;  2DJN A;  4ZYA A;  3DKY A;  1W5C C;  2QQ8 A;  2JA5 J;  4ZYD A;  2ZFW A;  4PGH A;  2VBX A;  4EJU A;  2H1K A;  5EEA A;  4L18 B;  4EJT A;  3WG9 A;  2PBI A;  3H9G A;  4A3I J;  1FIA A;  2HOE A;  5AIQ A;  4ZYG A;  4X0G A;  4RAY A;  4JP0 A;  4G12 A;  5GP9 A;  1XCB A;  4HLX A;  3AG4 H;  5LFA A;  1AKH B;  1HDP A;  2W00 A;  2LY1 A;  3ABT A;  4Y4R A;  3F3X A;  4A2U A;  4FAS D;  3E5Q A;  3M7G A;  4HF1 A;  1B9M A;  2X9D A;  2DDA A;  2O3F A;  1YJN I;  1ZK8 A;  1UG2 A;  4HDV A;  2G7G A;  2DFE A;  1ODD A;  2A05 A;  2EFP A;  3B73 A;  2HQR A;  2DJI A;  4MIM A;  3TW6 A;  3RKW A;  1BR1 A;  1MH3 A;  1E17 A;  2VJ4 A;  3NRV A;  2XKO A;  5D19 A;  1OIS A;  3OYD A;  3WG7 H;  3BRU A;  2ECC A;  2H6C A;  4IX7 A;  3CCJ I;  2XB0 X;  1YLF A;  1R6R A;  4WK8 F;  3S3O A;  4NQW B;  1SVL A;  4RM2 A;  5ERI A;  3EQL F;  2NXN B;  3NAR A;  2ZJP F;  2BXZ A;  2ACJ A;  1F4K A;  5HAW A;  2HOA A;  1ZRF A;  5JFR A;  2WBM A;  2D5V A;  2PBX A;  3BR0 A;  1JHF A;  4PFP A;  2DA6 A;  1I6H J;  3OR2 C;  5FFX A;  1G59 A;  2Z2S B;  3VSK A;  3LSP A;  2GZW A;  4GXO A;  2V1N A;  3Q0U A;  4CYC B;  4EGY A;  2LF8 A;  2XGX A;  2OD5 A;  1WJ5 A;  2LYC A;  4BY1 J;  3FBI B;  1PJR A;  4L9J A;  2VUM J;  1IN4 A;  1NK3 P;  1NH3 A;  3W6V A;  3EPZ A;  1BI3 A;  2A5W A;  3EYY A;  3WTV C;  3ZN1 A;  1LB2 A;  2FA5 A;  4CGR A;  1BC8 C;  3HGY A;  3ASN H; 
#chains in the Genus database with same CATH homology
 4MO7 A;  3RKQ A;  1SAN A;  3QPL A;  2D6Y A;  2ZCM A;  5FKN A;  3M4O J;  3NAU A;  3S1M J;  1U9N A;  2G0E A;  1H88 C;  3RH2 A;  3CRJ A;  2WUI A;  5J1U A;  2HXI A;  1VFC A;  1I3Q J;  1JKP C;  4I6Z A;  4IHY A;  3HTA A;  4D7N A;  5EF6 A;  3LJL A;  5E3O A;  2IU5 A;  2N8G A;  3PPB A;  2NP3 A;  1TWH J;  2M9H A;  1X58 A;  1VND A;  4FIS A;  3SJM A;  5EZH A;  4JKZ A;  2W53 A;  2DA7 A;  2CRG A;  2NVQ J;  2E19 A;  5CXG A;  2NX4 A;  2DMP A;  3HDD A;  4GFB A;  2GM4 A;  3HKZ N;  3PM1 A;  4GCT A;  1PUF A;  2VKV A;  3S17 J;  1ETO A;  2HI3 A;  5DTD A;  4B1R A;  4A3D J;  1BW6 A;  3ZQL A;  3TP3 A;  4Y7N J;  3G7R A;  1TWC J;  4MLO A;  1JTX A;  3HGG A;  9ANT A;  4GCL A;  1UHS A;  3BR1 A;  4FE4 A;  2ZOY A;  1XG1 A;  1FEX A;  3GTL J;  1VF9 A;  4D5C A;  3CJD A;  3JRC A;  3B6C A;  3BG9 A;  4XRS G;  1QVT A;  3E7L A;  2R5Z A;  2V57 A;  3VVX A;  2GFN A;  1I50 J;  2L7M P;  3AQS A;  1Z0X A;  4M3D A;  2QOP A;  1RKT A;  1TWF J;  2PMZ N;  2DA5 A;  3BG5 A;  3BQZ A;  4ACI A;  3BQY A;  1AKH A;  2EZI A;  2XPW A;  5IP6 A;  1X2N A;  3GZI A;  3RZO J;  4M3B A;  2EZL A;  4M3G A;  4AF5 A;  1UMQ A;  2W48 A;  1BW5 A;  4ICH A;  2VPR A;  2QTQ A;  5EGO A;  3ON2 A;  2CU7 A;  1U78 A;  2RHA A;  3HIM A;  2AHQ A;  3M3Y J;  1POG A;  1GDT A;  4A3F J;  2WGB A;  5FHP A;  5JLX A;  3QPS A;  2Y0S N;  2R7Z J;  3ANP A;  3GEU A;  4A3B J;  1B72 B;  3FKI J;  1QVU A;  3PAS A;  2DA1 A;  5HBU A;  5EGO B;  4IHV A;  1GUU A;  1IDY A;  2P81 A;  3OOU A;  5M5X J;  3IV5 A;  5IYD J;  1ETV A;  4W97 A;  1GVD A;  5K58 A;  5IP7 J;  2HYT A;  1HCR A;  3ON4 A;  4C3I J;  3P9T A;  2OER A;  4L5E A;  2Y2Z A;  4FTH A;  2K9Q A;  2ME0 A;  1ETY A;  4GFL A;  1JT6 A;  2Y30 A;  3LSJ A;  1YRN B;  2G7L A;  2NP5 A;  3GTQ J;  1IRZ A;  2YS9 A;  2KDZ A;  3LSR A;  4YZE A;  1JJ6 C;  1P7J A;  2O7O A;  2M8G X;  4A69 C;  3DPJ A;  3PO2 J;  3QBM A;  5HSZ A;  2DG7 A;  1E3O C;  2XDN A;  2WB1 N;  3ANG A;  1DU0 A;  3KNW A;  2YUS A;  2G3B A;  3CDL A;  1U8B A;  1A6I A;  3BTL A;  5H9T A;  2WAQ N;  4DZJ A;  1D5Y A;  2E1O A;  1XS9 A;  2EQR A;  3WHB A;  1JGG A;  3H0G J;  4AC0 A;  5E3M A;  2H8R A;  2FX0 A;  3VW1 A;  2XPV A;  4AUX A;  4X6A J;  1ZR4 A;  5F1J A;  5BNG A;  1Q1V A;  1OJL A;  1Z77 A;  4X1E A;  4GFK A;  3HM5 A;  2G7S A;  1LFB A;  3ZQI A;  3JRE A;  5M3F J;  1VI0 A;  1IDZ A;  2O7T A;  5CW8 A;  2L7Z A;  2NOG A;  3BR3 A;  2ZCX A;  3GTP J;  3VOX A;  4JX6 A;  2DMN A;  2KT0 A;  3L1P A;  1U9O A;  4BY7 J;  3LSG A;  2OF7 A;  1ENH A;  1MBE A;  3VW2 A;  3VVZ A;  4JX4 A;  1ZQ3 P;  3D1N I;  3IH2 A;  2UXH A;  2EBI A;  5DS9 A;  2MSY A;  2CJJ A;  4UDS A;  3C2B A;  1FIP A;  3A01 B;  2R5Y B;  4RBO A;  3RZD J;  1LE8 B;  3DCF A;  3S1N J;  5D18 A;  1RKW A;  5FKL A;  1DU6 A;  2GUH A;  5F27 A;  3KKD A;  4B4C A;  2FBQ A;  2X48 A;  3TED A;  1AHD P;  5C3E J;  4A3E J;  3EGQ A;  5AQC A;  3ZQC A;  3LNQ A;  5F0F A;  4XIC A;  3GTK J;  2RAE A;  2JK3 A;  1MSE C;  2GLO A;  3Q0W A;  2M0C A;  3BT9 A;  4HNV A;  2QIB A;  3NPI A;  1BA5 A;  1K83 J;  1T33 A;  3RD3 A;  4JX5 A;  5GPC A;  3VW0 A;  1T56 A;  1HDD C;  1JUM A;  2DMT A;  1CQT A;  2CQQ A;  1RPW A;  1RR7 A;  5HOD A;  1TC3 C;  3HOX J;  1GT0 C;  1QRY A;  2XSD C;  1ETQ A;  2K9N A;  3JRA A;  5EFY A;  4MFD A;  2HOS A;  1UI6 A;  3TP0 A;  1TWG J;  4D5F A;  3SFI A;  2VI6 A;  1ZTR A;  2JN6 A;  4JNN A;  3FK7 A;  4UUS B;  1RET A;  3HB9 A;  1MBH A;  3BTI A;  2AO9 A;  3HBL A;  3LOC A;  1ITY A;  2JJ7 A;  3FK6 A;  5DAJ A;  1SGM A;  3WHC A;  5C4X J;  2R93 J;  2CUF A;  4RDU A;  5C4Y A;  2MG4 A;  3GBG A;  3FRQ A;  2JA6 J;  2MW8 A;  2M2E A;  4DYQ A;  2LY9 A;  4DW6 A;  2ZCN A;  3V78 A;  2R0Q C;  1QPI A;  1H8A C;  3A01 A;  1HLV A;  3MN2 A;  1AU7 A;  4A3L J;  5FMP A;  2YVH A;  1JUP A;  3HOW J;  1Y1V J;  3FIS A;  1FTZ A;  4UUT A;  4MXM A;  2ME6 A;  4M3E A;  5IYC J;  2HOT A;  3KKC A;  3HOU J;  1OCP A;  3MKL A;  5J3L A;  5E3L A;  2L9R A;  5E3N A;  5K7H A;  2IBD A;  2NS7 A;  2F07 A;  5CXI A;  3CWR A;  3Q0V A;  2ID6 A;  1PUF B;  2LLK A;  2XB5 A;  1TWA J;  2DG8 A;  2FQ4 A;  2E2J J;  1EF4 A;  4JL3 A;  4QSH A;  1W0T A;  5M5Y J;  2LP0 A;  3JR9 A;  4J19 A;  2HKU A;  3S16 J;  1GV2 A;  3TW7 A;  4BBS J;  2DMQ A;  2K9S A;  2IEK A;  3NI7 A;  1OCT C;  1LFU P;  2EZK A;  4DZP A;  5GPA A;  1K61 A;  1WGX A;  2LKX A;  4A3C J;  3BCG A;  4I76 A;  2NS8 A;  5F0H A;  5IOZ A;  4ME9 A;  4LOC A;  3HOZ J;  4ABZ A;  5FLV A;  4BKX A;  3I4N J;  2FJ1 A;  3HTI A;  2X6O A;  5F04 A;  4A3K J;  3HE0 A;  2Y31 A;  1Y1W J;  5C4J J;  2JA8 J;  3HOY J;  5D1R A;  2WV1 A;  3A02 A;  2RAS A;  2B63 J;  3BTC A;  2O8K A;  2XGE A;  4IHW A;  4XRM A;  3K2A A;  3EUP A;  2LR8 A;  3CMY A;  3NRG A;  5FGL A;  5EZG A;  2K40 A;  2CUE A;  2XRL A;  3IH3 A;  3QQA A;  3JRG A;  1WI3 A;  2TCT A;  2GEN A;  2UXU A;  2ELK A;  3BG3 A;  5EDN A;  2UXP A;  2PZ9 A;  4AC6 A;  1LE8 A;  3Q3S A;  1FTT A;  3G56 A;  2M34 A;  5FJ8 J;  5K7Z A;  2ZB9 A;  1WH7 A;  3FIW A;  3V6G A;  3PO3 J;  4FE7 A;  3QKX A;  4QIW N;  5F08 A;  2JWT A;  2CQX A;  3K7A J;  1F36 A;  4MK6 A;  2JA7 J;  3HEF A;  3S1Q J;  2COB A;  1XC5 A;  3IH4 A;  3BR5 A;  1JUS A;  3OSF A;  2FD5 A;  3KZ9 A;  2LTP A;  2UXO A;  5EYR A;  4KWA A;  5C44 J;  3VVY A;  2HXO A;  4A3J J;  4C3J J;  1RES A;  1IUF A;  1JTY A;  3GTO J;  2Q24 A;  3O8G A;  2HQ5 A;  3CQZ J;  3T6N A;  4MFE A;  3NXC A;  1H89 C;  4A3M J;  2UXI A;  2DA2 A;  2IAI A;  4NN1 A;  3JRI A;  3IUV A;  2R5Z B;  2YU9 J;  2E2H J;  2VKE A;  5M5W J;  5M3M J;  3JRH A;  1SFO J;  5EG0 B;  1MBK A;  1IGN A;  1S7E A;  4V2G A;  3JRF A;  1ETW A;  2ID3 A;  3MVP A;  1W0U A;  3HTH A;  3S2D J;  4HKU A;  4FCY A;  5IP9 J;  1NK2 P;  4Y52 J;  1MBG A;  2DMU A;  4XRS A;  1JT0 A;  3O8H A;  2NVX J;  2REK A;  3BNI A;  1B8I A;  3JRD A;  4AYB N;  4DYC A;  2XGD A;  4QTR A;  5IYB J;  2E2I J;  2NVT J;  5IPA A;  2R92 J;  2DA3 A;  1YRN A;  3HOV J;  2EH3 A;  4DYR A;  4C3H J;  2HDD A;  1MSF C;  1A5J A;  3C07 A;  1WCM J;  4W1U A;  1ZR2 A;  2QKO A;  3F1B A;  3E7Q A;  3MNL A;  4BXX J;  2MGQ A;  1JKR C;  3GTM J;  2GBY A;  3F0C A;  4NEL A;  4V2F A;  3BR6 A;  3OIO A;  3VPR A;  2ECB A;  1P7I A;  3A03 A;  5JLW A;  2YVE A;  2DTZ A;  2NVY J;  2LFB A;  3DEW A;  5F0C A;  3ZOB A;  1X2M A;  2JMW A;  2OPT A;  3ZQH A;  1JKO C;  3AQT A;  3COL A;  3LWJ A;  4L62 A;  1GV5 A;  2XPU A;  4B3A A;  1HF0 A;  3BHQ A;  3OSG A;  3GTJ J;  3ZQF A;  1UI5 A;  3B81 A;  1JKQ C;  2EZH A;  4EEF G;  1ZKG A;  1B8I B;  4GCK A;  1WPK A;  3VUQ A;  3GTG J;  2R5Y A;  3S2H J;  3S15 J;  3HTJ A;  3S1R J;  2OI8 A;  5EG0 A;  2XGC A;  1ZGW A;  2DJN A;  1APL C;  2JA5 J;  1NTC A;  3BJB A;  4PXI A;  2H1K A;  5EEA A;  4XID A;  4CYC A;  3BR2 A;  2QCO A;  4A3I J;  1FIA A;  1R9T J;  1BJZ A;  1HOM A;  1MH4 A;  4JYK A;  3VP5 A;  4JP0 A;  4G12 A;  5GP9 A;  2L7F P;  1JJ8 C;  5FKK A;  5J1Y A;  1MBF A;  4NDL A;  1IC8 A;  2HYJ A;  4M6V A;  1AKH B;  2O9L A;  1HDP A;  2LD5 A;  1MNM C;  3JSJ A;  3G1O A;  2QWT A;  2Y9Z A;  5FLM J;  2LVS A;  4A3G J;  4BBR J;  2X9D A;  4IEJ A;  4C2M J;  1G2H A;  3VOK A;  1ZK8 A;  1UG2 A;  2G7G A;  3LHQ A;  1O4X A;  4IHX A;  4MIM A;  3CCY A;  3TW6 A;  1IV6 A;  1FJL A;  1MH3 A;  4D7M A;  3B6A A;  2TRT A;  5D19 A;  3G1M A;  3BRU A;  2ECC A;  3BTJ A;  1WH5 A;  2L0K A;  2XB0 X;  3ZQG A;  3JRB A;  3S14 J;  3VIB A;  2LK2 A;  5K7F A;  3NAR A;  3RQI A;  2HOA A;  5HAW A;  4A93 J;  2QF7 A;  1IG7 A;  1ETX A;  4UUS A;  2D5V A;  2PBX A;  3BR0 A;  3NNR A;  2ZOZ A;  2DN0 A;  1IJW C;  3UKG A;  2DA6 A;  1I6H J;  5IOY A;  4S0H B;  1MBJ A;  3LSP A;  1B72 A;  3Q0U A;  4CYC B;  1OFC X;  2DA4 A;  4BY1 J;  2I10 A;  4XK4 A;  5FKM A;  2VUM J;  3I4M J;  1ORK A;  3S5R A;  3G1L A;  1NK3 P;  4M3F A;  3W6V A;  3H3V K;  3SDG A;  2Y9Y A;  5J1R A;  1ETK A;  5FKO A;  3O60 A;  1F43 A;  4CGR A;  3HGY A;  1BL0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...