1RKWA

Crystal structure of the multidrug binding transcriptional repressor qacr bound to pentamadine
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
186
structure length
186
Chain Sequence
NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKKEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator qacR
publication title Crystal structures of QacR-diamidine complexes reveal additional multidrug-binding modes and a novel mechanism of drug charge neutralization.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription
total genus 78
structure length 186
sequence length 186
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2003-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1rkwA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 1rkwA02
1FIAA 2KDZA 1RESA 5EG0A 2NX4A 2OPTA 4I76A 1BW5A 2R5YA 4DYQA 1NTCA 3CWRA 3HEFA 3FKIJ 2L7ZA 3QBMA 1TWCJ 4BBSJ 3HTAA 4D5FA 5M5WJ 2QWTA 4GFKA 3BR3A 2ECBA 1AHDP 3I4NJ 2LP0A 1U78A 1RKWA 4X1EA 2EQRA 1H88C 2CRGA 1ITYA 3MN2A 1G2HA 3A01A 3C07A 2XGDA 2ID3A 5FGLA 1DU6A 5CXGA 2CQXA 1JTXA 3E7QA 3V78A 4NN1A 3PM1A 4AC0A 3RZOJ 4UDSA 3BQZA 2HOAA 1Z0XA 4V2FA 5J1YA 1ZGWA 3DEWA 2NVXJ 1W0UA 2QIBA 3HGYA 1TWFJ 1RKTA 2X48A 1POGA 2DN0A 5F0FA 1IC8A 4A3CJ 1FJLA 3QPLA 1U8BA 3HTJA 3JRDA 3VOKA 1E3OC 2RHAA 1WCMJ 2XRLA 1O4XA 4A3GJ 3A01B 3G56A 4ME9A 3G1LA 5CW8A 1UI5A 1MBEA 2TCTA 4JNNA 3B6AA 2DMUA 3UKGA 3S2HJ 3HOVJ 3IH4A 3CMYA 2DMQA 2JK3A 3GTJJ 1AKHA 2VI6A 4V2GA 2REKA 5FLMJ 3BTLA 2LTPA 1GV2A 2LY9A 2JA6J 2GFNA 2HXOA 2PBXA 4MXMA 1Q1VA 2O7OA 2ELKA 4QSHA 2NVQJ 5CXIA 1IJWC 1WI3A 1HLVA 1NK2P 2NP3A 3ZQHA 5C3EJ 2OF7A 3PPBA 2XPUA 4MFEA 3GTQJ 1JT0A 5F0HA 2G7SA 4XRSG 4GCTA 4AC6A 4FTHA 2XGCA 3MKLA 5FJ8J 3Q0WA 4DYCA 2AO9A 2H8RA 3M3YJ 4GFBA 2LVSA 1ETXA 5IP6A 3M4OJ 1GUUA 2HOSA 1QPIA 2R7ZJ 5FHPA 4NDLA 2R5ZA 1IRZA 1WPKA 4FISA 2R92J 3QQAA 4A3LJ 3O60A 2NVYJ 1XS9A 1B72B 1MH4A 3P9TA 2PMZN 4MIMA 5F04A 2GUHA 3RD3A 4A69C 2AHQA 3LNQA 1I6HJ 5IYBJ 1B8IB 4X6AJ 3BCGA 1VFCA 5IYCJ 1SANA 2ZOYA 2Y0SN 3T6NA 4RDUA 5IP7J 2E2IJ 3S1NJ 1RR7A 3TW7A 3BT9A 4DYRA 1SGMA 1YRNB 1Z77A 3Q3SA 1H8AC 4M3FA 4L62A 2XB0X 2HYJA 3A03A 5BNGA 5M3MJ 2KT0A 3HGGA 3JRHA 1IG7A 3NXCA 2FJ1A 2DA1A 1OCTC 3VPRA 3SJMA 2R93J 1XC5A 3BR6A 3PO3J 2ZCXA 1X2MA 1TWAJ 4A3MJ 2DTZA 2L7MP 1R9TJ 3JRFA 4JKZA 3ZQCA 2M2EA 2N8GA 5J1UA 5D1RA 5FKLA 3GBGA 2CU7A 3FK7A 2YUSA 4XK4A 1ZR2A 3D1NI 4MLOA 2ECCA 3F0CA 9ANTA 3JRIA 2IBDA 4Y7NJ 2NP5A 1JUMA 3WHCA 2RASA 3HOYJ 2LFBA 5JLXA 1GT0C 3JRBA 1IDZA 3AQSA 3HB9A 2EZIA 4IHVA 3S1MJ 2NS8A 5FKOA 1ZR4A 2DG8A 5IYDJ 1ZQ3P 3S17J 2Y31A 4CYCB 5HBUA 2K40A 2DG7A 5E3LA 2RAEA 1TWGJ 5IOZA 3W6VA 3V6GA 3WHBA 2VKEA 3H0GJ 2ME6A 3SFIA 2Y9ZA 1JJ8C 3PASA 4B3AA 2HOTA 4RBOA 3KKDA 2ME0A 2L0KA 2P81A 4M3EA 1VF9A 4BY7J 1CQTA 2UXIA 4A3FJ 3G1MA 3B6CA 1WH5A 1F36A 2CUEA 3S16J 1FTZA 2FBQA 2IAIA 2EZHA 2V57A 2HYTA 5F27A 4JL3A 2HDDA 1JKRC 1ZTRA 4GCLA 4XIDA 3IV5A 1S7EA 2E2HJ 3HTHA 3VP5A 1JTYA 4I6ZA 4HKUA 3HOWJ 3CQZJ 3IH2A 4JP0A 2XPWA 2E19A 3LJLA 2DMPA 1XG1A 2UXUA 3NI7A 3BG5A 5K58A 2DJNA 2WB1N 3G1OA 5J1RA 2DMNA 3LSJA 3LHQA 5H9TA 3LOCA 4ABZA 2Y9YA 3GTOJ 2UXOA 5HODA 1ENHA 2WAQN 3G7RA 5EYRA 2NVTJ 1T33A 3TP0A 2DA3A 4A93J 2LD5A 4IHYA 2XSDC 1B72A 3VVXA 3BQYA 1LE8B 3GTGJ 2JJ7A 1T56A 1B8IA 3KZ9A 3BR2A 2CUFA 3LSRA 1ORKA 1ETWA 1GDTA 2FQ4A 3K7AJ 2G3BA 1YRNA 3FRQA 1QVTA 5F1JA 1VI0A 3BTCA 3MVPA 5EZHA 4A3KJ 3ZQFA 3CCYA 5DTDA 3HBLA 4C3IJ 4AYBN 2JA7J 1ZKGA 1LFUP 3OSGA 2GM4A 1APLC 3O8HA 2K9SA 3LSGA 1I50J 5K7HA 4UUSB 4BXXJ 5D19A 4AUXA 4GFLA 3IH3A 2O7TA 2Q24A 3VIBA 4D5CA 3JR9A 4W97A 2CJJA 1OFCX 1TC3C 5FKKA 1MSFC 4FE4A 4A3EJ 3JSJA 3ON4A 4JX5A 1IDYA 4EEFG 3CJDA 3GTKJ 3VVZA 1MBFA 3JREA 2Y2ZA 3Q0VA 3KKCA 2CQQA 3HOUJ 3HIMA 1HDDC 1UMQA 1MNMC 4D7NA 1QRYA 4MK6A 1GVDA 1GV5A 3E7LA 2DMTA 4XRSA 1X2NA 3S1RJ 5F0CA 2NOGA 3MNLA 1MH3A 1AU7A 4BKXA 1HCRA 1BW6A 3FISA 2DA6A 4C3HJ 1IGNA 3S1QJ 2OERA 3BNIA 1D5YA 2COBA 3S2DJ 4YZEA 2JA5J 2YS9A 2LR8A 4DW6A 4CYCA 3VW0A 2ZCNA 2EZLA 2MG4A 5C44J 1JGGA 1DU0A 1Y1WJ 2NS7A 2ZOZA 5E3NA 4BBRJ 3HOZJ 3HDDA 1JKPC 2WGBA 5IPAA 3LWJA 2IEKA 3QPSA 5GP9A 4QTRA 3S14J 2W53A 3BRUA 1FTTA 3HTIA 1FEXA 4IHWA 5EGOB 1UHSA 3COLA 5C4YA 3I4MJ 3TEDA 3GTMJ 1U9NA 3BTIA 3DCFA 2G7LA 4D7MA 3VUQA 5FKMA 2E1OA 2L7FP 2WV1A 3EUPA 3RQIA 3QKXA 1U9OA 3C2BA 3HOXJ 1H89C 3PO2J 5M3FJ 2VKVA 4KWAA 3VVYA 4AF5A 1VNDA 1PUFB 4C2MJ 2GENA 3SDGA 3BHQA 2QTQA 3AQTA 3HE0A 5AQCA 3GEUA 5M5XJ 2JMWA 2XDNA 3BG9A 1JT6A 3TP3A 2XGEA 4MFDA 1RPWA 3JRCA 1FIPA 1HDPA 2G0EA 3ZQIA 4DZPA 2K9NA 2M0CA 2HKUA 1IUFA 1IV6A 2B63J 2O8KA 5DS9A 3BR5A 2EZKA 2JN6A 2WUIA 2O9LA 4M3DA 5K7FA 1F43A 1LE8A 3Q0UA 1OCPA 1X58A 1LFBA 3L1PA 4A3IJ 4B4CA 5M5YJ 2LKXA 5C4XJ 3ZQGA 2G7GA 5EG0B 3VOXA 2R5YB 3EGQA 3CRJA 3A02A 5HSZA 4JYKA 2M8GX 5FKNA 5E3MA 4BY1J 2H1KA 2EBIA 1MBKA 1NK3P 1BL0A 1A5JA 3ON2A 1MSEC 2LLKA 1RETA 1UI6A 1JKQC 3ANPA 2QOPA 4FCYA 2VUMJ 4DZJA 3NNRA 3BJBA 4UUSA 4JX6A 5K7ZA 1K61A 2GLOA 1MBGA 2I10A 1WGXA 2MW8A 2X6OA 1P7IA 2TRTA 3BR0A 3GZIA 2YU9J 2VPRA 1HOMA 3BR1A 3TW6A 3JRGA 5FMPA 3RH2A 2K9QA 1ETVA 2DA4A 1BJZA 4M3GA 4HNVA 3IUVA 1MBHA 3NARA 2MGQA 3ANGA 2QF7A 5IOYA 5F08A 3BTJA 3FK6A 2ZCMA 2DA2A 4IEJA 4J19A 1W0TA 2F07A 1ZK8A 2LK2A 3NPIA 2IU5A 1I3QJ 3OSFA 4XICA 4A3JJ 4QIWN 3OIOA 1QVUA 5FLVA 4ICHA 1P7JA 5DAJA 5IP9J 3FIWA 1AKHB 5GPAA 4PXIA 5JLWA 2E2JJ 2D6YA 4JX4A 2M34A 2DA5A 3K2AA 4B1RA 5GPCA 2ZB9A 2DA7A 5C4JJ 2HXIA 2QCOA 4Y52J 2HQ5A 4L5EA 3DPJA 3ZOBA 2YVEA 4MO7A 2W48A 4G12A 1SFOJ 3ZQLA 1JKOC 1BA5A 5EGOA 5HAWA 3NAUA 4A3BJ 3HM5A 2JA8J 1TWHJ 2JWTA 1MBJA 4M3BA 5EZGA 3H3VK 1WH7A 4FE7A 5E3OA 2GBYA 3F1BA 2M9HA 3O8GA 3BG3A 1OJLA 3GTPJ 1A6IA 3B81A 2QKOA 4NELA 2OI8A 2EH3A 2FX0A 4CGRA 4LOCA 5EFYA 4GCKA 2FD5A 4XRMA 2HI3A 2UXHA 4M6VA 5J3LA 3S5RA 1PUFA 3GTLJ 2D5VA 5D18A 2X9DA 2R5ZB 1UG2A 3RZDJ 2ID6A 1JJ6C 3HKZN 1JUSA 4C3JJ 2R0QC 4S0HB 3JRAA 2YVHA 1Y1VJ 1JUPA 5EDNA 3CDLA 3NRGA 4IHXA 3S15J 3OOUA 2MSYA 1HF0A 1ETKA 1ETQA 2L9RA 4W1UA 2PZ9A 2XB5A 3KNWA 3VW1A 5EEAA 1ETOA 4ACIA 4UUTA 1ETYA 2Y30A 3RKQA 4A3DJ 5EF6A 1K83J 3LSPA 2UXPA 3VW2A 1EF4A 2XPVA
chains in the Genus database with same CATH superfamily
4IO9F 2W00A 4R8HA 1BI0A 2NX4A 3KZZA 4I76A 2FMYA 3H3UA 4QPOA 5K5QA 1ZG3A 3I54A 1TWCJ 4B44A 2ESNA 3CMAI 2L4MA 2QZ8A 3REOA 3V7CA 4G7HF 4EM0B 4S05A 4RLQA 4ESJA 2M3AA 3ZMTA 1U78A 1QHGA 3EUHA 1YS6A 2EQRA 1ZAOA 2CRGA 2V6CA 4DJAA 1R22A 4LB6B 3V8LA 1N77A 2JZYA 3L2RA 2PQ8A 3CD6I 2ID3A 3EPZA 3OYAA 3JSPA 3LSHA 3OV8A 4KMUX 2E60A 5F6FA 4IRGA 4IZZA 3TO7A 3IUOA 3KP5A 1JTXA 3V78A 3OL4A 4M73A 2HR3A 4UDSA 2HTSA 2HOAA 2M45A 4KIGA 2OBPA 4V2FA 3DXJF 5KHDA 2VQGA 3MMYB 2IS4A 3GEZA 4A12A 1XGMA 1LUJB 2HDWA 3WG9A 3DPTA 3JRDA 2ZKZA 1GXQA 2RHAA 2XRLA 1WI9A 2KRHA 4U0WA 2FJI1 2QQ8A 2QA4I 3G1LA 3CJRB 2IA1A 1UI5A 1WJ5A 1OKRA 1MBEA 2K3FA 4JNNA 3B6AA 2DMUA 1KU3A 3HOVJ 4ZYHA 1FBSA 3SQNA 1STZA 4AU7A 2L9VA 4HDVA 3OYHA 1J5YA 2DO7A 4A0YA 2LY9A 2GFNA 2FE3A 2IW5A 1I3AA 4HSTA 2BYVE 4HLYA 4MXMA 1W36C 1ZREA 2M30A 2H6BA 1BC8C 4L9VA 1G8XA 1HSJA 5CXIA 1IJWC 4F92B 1HLVA 1NK2P 3BZKA 1YI2I 2Y69H 4RB2C 3FF5A 2GXAA 1O3TA 3ZQ7A 1TBXA 5TGTA 2EJRA 1Y8QB 3TDUC 2FBIA 4CCKA 2G7SA 4AVPA 3VYUB 2ZJPF 4OAZA 2O8XA 2E5ZA 4DYCA 4ETSA 2AO9A 2V4JC 1TT0A 1ETXA 3K1PA 1V5GA 1QA6A 2HOSA 1QPIA 2JVHA 4HV5A 2OTJI 2UXXA 2R92J 3O60A 3LSTA 3GWZA 1XS9A 4CA0A 3OYIA 4ENMA 5F04A 2RN7A 1B8IB 3GXOA 4CCLA 5J4VA 1R58A 3H5AA 4PJNA 4O6JA 2R7RA 2NS0A 3T6NA 1SFUA 2E2IJ 3TW7A 2CQNA 2MD0A 1YRNB 3WTYC 3LL7A 5E79C 1T39A 1H8AC 4L62A 2IS1A 1W5CC 2EILH 2HYJA 3A03A 4L0ZB 4F7ZA 1VQ9I 3FHNA 1OPCA 1DPUA 4HOBA 2DYRH 2CV2A 2FQ3A 2ZFUA 4A5MA 1QO0D 2VE8A 4QWQA 2DK5A 1X2MA 1TWAJ 3F21A 2DTZA 4A3MJ 3U2RA 5HS8A 4JKZA 5L3DA 2IGKA 1L0OC 4UVAA 5DM6F 2EV6A 3GBGA 5DDGA 2ZFWA 1S7OA 4XK4A 3S3NA 5IT9Z 1NG6A 3U1KA 5JFRA 2IBDA 1JUMA 2RASA 4IRHA 3HOYJ 5E1ZB 1OCRH 1LFPA 4CCOA 2LRDA 1IDZA 3AQSA 4BQAA 3Q9VA 4NNJA 3L2QA 3H5RA 2VB6A 3RYPA 3GVAA 4EM1A 2NS8A 2ZJ2A 1ZR4A 3IHUA 4IVNA 3WTZA 5F64A 4B3XA 3S17J 4CYCB 3K0LA 2K40A 4UUVA 3QPHA 2HNHA 2IGMA 1H0MA 3H0GJ 3WTVC 1YLFA 2VN2A 2HOTA 2V79A 4RB0A 4P9UA 1ZRFA 2DAOA 1DPRA 2L0KA 3VODA 4XORA 1VF9A 4M6XA 2P4WA 3DKXA 1CQTA 2UXIA 3B6CA 2CUEA 1FTZA 4PJMA 3OY9A 2JUGA 1FOWA 2EZHA 2VKHA 1JKRC 1LVKA 3MKWB 4LG3A 3IV5A 4YFKF 1B6AA 3G71I 3HTHA 3ERED 1R49A 1JTYA 5DD8A 4UVBA 1LDJA 3SEQA 3HOWJ 3BCAA 3CQZJ 3W6JB 1REPC 2JTVA 2XPWA 1D1AA 2ISZA 3S8PA 3CUQB 5JVTA 2ADUA 2WB1N 4PGGA 1WJBA 1T38A 3AL0C 5J1RA 3LQRA 4CZZA 2L7KA 3LOCA 2F5VA 2JRTA 2NVTJ 1FLIA 4UV9A 3TP0A 4KDPA 1BI3A 1L3LA 4IHYA 2XSDC 1T08B 3IAS2 3BQYA 5HLIA 2JJ7A 3RJPA 3DBRB 3OYLA 3KZ9A 4KIBA 1DP7P 3CC7I 2XF5A 2LNBA 2V6EA 5GTHC 1EA3A 2R3SA 3FMSA 2IS6A 3H1CA 3FRQA 2LF8A 4PFPA 5DTDA 3HBLA 1W5TA 2DT6A 2NNNA 1ZARA 3U1DA 4N4OB 4PJLA 4Y33A 4E7SA 2G7UA 3TQNA 1HW1A 5LGTA 2GM4A 1APLC 2IRFG 3CJQB 3O8HA 4NB5A 1Z6TA 1BR4A 1TP4A 4XL9A 1EV7A 2CJJA 1TC3C 1JGSA 5FKKA 5HS7A 3EDPA 4M9SA 3JSJA 1IDYA 3GTKJ 1LVAA 3KYDB 2XSJC 3E6CC 1VQLI 4XLFA 3HIMA 3WGIA 2HOEA 3CF5F 2QKMB 4D7NA 4J00A 1VQ4I 4MK6A 1GVDA 3GLLA 2V1UA 1GV5A 3SWHA 1UHMA 3FXKA 4WWCA 4WK8F 1X2NA 2NOGA 3OR2C 3T0YA 3MNLA 1Y6IA 3RPUD 4BKXA 1HCRA 2UWMA 4U0YA 1Y56A 2DA6A 2KPMA 4BQNA 2H27A 3H35A 5K1YA 4XQFA 3CO7C 1YTYA 4LB5A 2LDUA 4L9JA 1U5TA 3T1BA 3K1NA 2LKSA 4YIIA 3C3WA 2EWNA 5CVJA 1W36D 5GAEJ 2XGXA 1ZELA 2VXDA 5DUIA 4BBRJ 3HOZJ 3HDDA 3CCVI 3DU6A 2M4GA 2BY1A 1OYYA 3S14J 2W53A 3BRUA 1ZG5A 4IHWA 5EGOB 1FEXA 1T8IA 3OYFA 3GTMJ 3K70C 3BJ6A 2BXZA 2G7LA 2OQRA 3FXJA 3HRSA 3U9GA 4B09A 1B9MA 1ZLKA 3EUPA 3RQIA 3QKXA 4HF2A 1U9OA 3E3VA 3G2BA 4E7HA 1HXDA 3I0TA 4RA2A 2VKVA 3VVYA 1WJDA 1DQUA 1YO5C 2IXSA 3DPUA 2QTQA 4C2TA 3ABMH 3R4KA 3WTSC 4E4HA 2VODA 3WGGA 1R6RA 2HWVA 4X0GA 2GAUA 2XGEA 4MFDA 3VFZA 3JRCA 3FX3A 3TKYA 4UB6C 5CPRB 2ZC2A 4A0XA 3ZQIA 4DZPA 3ASOH 2HKUA 2M1BA 2LG4A 3EUHC 5HLTA 2JN6A 3BR5A 3L2CA 3EUKL 3Q0UA 4N9HA 2M8EA 1LFBA 2DFFA 2D1HA 2FNAA 1T0FA 3HSFA 5M5YJ 1S9HA 4RM2A 5K5OA 1ZG1A 4DVYP 3VOXA 3L2VA 3CRJA 2RNGA 2R7QA 2XKOA 3HRTA 2EB7A 3GLXA 2WADA 3RIRA 2P7CB 2GWRA 3CJNA 3ON2A 1DUXC 5CVIA 3PL8A 5CVRA 1UI6A 1BI1A 4OD5A 2QOPA 3PJRA 4C9YA 1FYMA 2STTA 4KNYA 4MHGA 5K7ZA 4KN7X 1K61A 2Z9OA 2F5FA 3TDZC 4II2A 3G3ZA 1TNSA 2EFPA 4C30A 1WJFA 3BLYA 2ZXIA 1HW5A 2LY2A 2HZTA 1R1UA 3A0HC 3K9TA 2K9LA 4BEHA 3BR1A 2OUMA 1BR2A 2WAEA 1LQ1A 2WB1A 5FMPA 2K9QA 1D0ZA 3WU1B 1YS7A 1RI7A 1MBHA 2DOEA 2QGUA 5ICGA 2BE5F 2ZCMA 2DA2A 2DFIA 2AXLA 4IEJA 1RRJA 1Q1HA 3RDIA 2XASA 3ULQB 2R7XA 2RGVA 3KP7A 4XLHA 3S3OA 2EFQA 2R7FA 1P7JA 2HQAA 3OIPA 1OR7A 3AG2H 2A69F 1SVLA 1DDNA 2KQRA 1I27A 3AAFA 3K2AA 4GO1A 1HSTA 3M9AA 4XBFA 2HXIA 1D1BA 2YX7A 1R00A 5GAHJ 4L5EA 1D1CA 2UV1A 2LOOA 1I6XA 2EFOA 2W48A 4MO7A 1VQ6I 4LD5A 5HS9A 4A3BJ 2PMZA 1MBJA 3H3VK 1S6LA 1WH7A 4FE7A 4AIHA 2O5RA 1OJLA 3HHGA 3FWEA 2QKOA 2EH3A 5EFYA 1X1BA 4BACA 1X3UA 4HNTA 2JPBA 5D18A 1IXCA 1XMAA 4NBQA 4IL6C 1U0JA 2ID6A 1JJ6C 2NOJB 3V7SA 3K4MA 2QQ9A 3IP4B 4S0HB 1R5GA 1ZYRF 2ZSHB 4LITA 4ENKA 2YVHA 3EQLF 1FX7A 1JUPA 4P5OA 1WJCA 2EA4A 2I5UA 2E1MC 4IRVA 2W84A 1LNWA 2B0LA 3G6EI 2LY1A 1ETQA 3K8PC 4W1UA 2VT2A 2XB5A 2QEXI 2M87A 3VYTB 3IWFA 2W4SA 3E5UA 4BE1A 3VW2A 1XB4A 1EF4A 1X1AA 1UFMA 1U2WA 2QM3A 1KQ0A 1RESA 3GO5A 4ZZLA 5LRSA 2QKLB 3LWFA 3GFIA 2KDZA 1BW5A 2F5EA 2R5YA 1NTCA 1YIOA 4Y3OA 3CWRA 2L7ZA 2DXIA 4XKBA 5D8LB 4AM3A 4BBSJ 3OYEA 3HTAA 5M5WJ 4D0PA 5KAIC 3V8JA 1WZ2A 3ZN1A 4I02A 2QWTA 2Y48A 4GFKA 1J59A 3FZVA 1I39A 3H5NA 4PDKA 4LFUA 1AHDP 2V9VA 3IC7A 4LIUA 4Y4RA 1QGPA 3DEUA 5JVGF 2FF4A 4P55A 1JHHA 3ZMSA 5LD2C 2QBYA 1QPMA 4KT6A 1H88C 3MN2A 3CCMI 2B9SA 3A01A 5DV5A 4N4NB 2XGDA 5FGLA 3EYYA 2A07F 1WJEA 1DP3A 2VT3A 2ZXHA 2DTRA 3E0JB 2M0MA 3IRQA 5JI6A 1Z21A 3PM1A 4PFOA 3BQZA 2BY2A 1Z0XA 3I55I 1P4AA 3KETA 1KONA 1ZGWA 3DEWA 2XAUA 3ZXSA 5IY5H 3FMQA 1K6OA 2QIBA 3HGYA 2F5CA 1MMGA 1RKTA 4KISA 1IRXA 3QPLA 2ZNYA 2CUZA 2VONA 1E3OC 3G56A 1H9TA 4DQ2A 2NXNB 2EV5A 2O0YA 4LK1F 5CW8A 5GAGJ 4HSRA 5JHUA 1YIJI 3BG6A 4MQVA 3UKGA 4A0ZA 1I5ZA 3IH4A 2DMQA 5CQGA 4IHTA 2JK3A 3ABUA 3ABTA 2E34A 3CMMA 4HNUA 4BDYA 1Z9CA 2QUFA 3K70D 3SZGA 4EJUA 3BTLA 2B3WA 2LTPA 1GV2A 3VP5A 2JA6J 4E70A 2V26A 6PAXA 2KRCA 3J81Z 2HXOA 2V1NA 3IL2A 3HSEA 1O57A 2UZKA 1F1ZA 4U87A 2LBFA 2NVQJ 4J01A 3VEPA 1WI3A 2NP3A 2A6TA 4M9ZA 1O7FA 5C3EJ 2DPDA 2OF7A 4PSWA 1SAUA 1JT0A 3FMRA 1DGWY 4XRSG 3W2VA 5GTIC 1FPQA 4AC6A 4D9JA 2O03A 1KU9A 3Q0WA 2H8RA 3M3YJ 4EVIA 2PX9A 5FHPA 3PNTA 2EK5A 3WODF 4Y13A 1WPKA 1IRZA 2X85A 3OS0A 1I1SA 4M6YA 2NVYJ 1F9NA 4BDZA 5FB2A 4A69C 2P6TA 3LNQA 4X6AJ 4FT8A 2IGOA 5IYBJ 3JAMK 1VFCA 5IYCJ 4YFNF 5ILVA 2K4JA 2KHMA 5IP7J 3BT9A 2P5VA 1G6NA 2FMLA 5J6XA 5KVRA 1ZHFA 3D5RC 1YHQI 5TJJA 2VJJA 3A2KA 1BN5A 3RSNA 2VLAA 5CVUA 2O3FA 5BNGA 2R7OA 3V7RA 4P9FA 2Z33A 4RAZA 3JRHA 1IG7A 1R5ID 3NXCA 4GYGA 5B1AH 3N05A 2DA1A 3OYCA 2R93J 2CW7A 4E7ZA 3MD2A 2FOWA 4RGRA 4II3A 1CF7A 2B1EA 1HA8A 1Y8RB 5A2QK 3F72A 2DQLA 4RM3A 2A3SA 2M2EA 5FD6A 5J1UA 4F91B 5BQTA 3E6BA 3GZ5A 1XCBA 2KISA 4AD9A 5FKLA 2WV0A 1MDMA 2HVRA 4M74A 1U5TC 2CU7A 3KCCA 1YW7A 4CCJA 1ZR2A 2CW8A 2VJ5A 3JW4A 3A1YA 1PDNC 3J7AY 3IAM2 4EJTA 3ZR8X 4Y7NJ 2NP5A 2CQ7A 1W7PA 1FP1D 3LSMA 2ZMEC 2GA1A 3ZP5A 1S29A 2JT1A 4EMSA 3HB9A 5FLXZ 1XPXA 1K6YA 2KZVA 3R0JA 2FU4A 1W5SA 4IHVA 1LEAA 2E71A 4ENNA 4IQJA 4BXFA 4YIRX 2Z5UA 5IYDJ 1U5TB 4XSXF 1XCVA 4EGZA 1OYWA 1XX5A 5HLGA 3HPHA 3KYLA 1GXPA 2DJIA 3DV8A 2DG7A 5HBUA 3KP4A 1R36A 1KQ8A 1LDKB 4ZTFA 4HV6A 2VJIA 2WC2A 4P1WA 4ZYEA 5L3CA 2X1DA 3SFIA 5KNLA 1TW2A 3RYRA 2OZ6A 2ZMEB 1X3WB 2QQBA 4U7DA 3PFIA 3KKDA 1SMTA 3FXLA 1XSXA 4M3EA 4Y17A 1TQMA 1T6SA 4OWRB 3G1MA 1WH5A 3S16J 3GFJA 1FP2A 4OU0A 4PSXA 1OQYA 4YEJA 4AIJA 2IAIA 2BHYA 1R1TA 2UUZA 5F27A 4JL3A 1FYLA 2HDDA 1ZTRA 2KJCA 4XIDA 4GCLA 1B1BA 1SMYF 4I6ZA 3T8RA 2K3PA 4HX7A 1T0FC 3LJLA 4UV8A 5CLSA 3QOPA 1S3JA 5D5XB 2DMNA 3KLOA 2DOAA 5H9TA 4ABZA 2CYYA 2Y9YA 1ENHA 2CWEA 2HQRA 4G6TB 2M4KA 3G7RA 5EYRA 2XF6A 5J8CA 3MZYA 5CQEA 1B72A 3IKVA 4XN0A 2RREA 1EJ9A 2F5DA 1TQPA 3BROA 3CP8A 3P9IA 5D5UB 3KE2A 4WXDA 5DD4A 3K69A 4PK4A 5E8GA 1QVTA 5F1JA 1P2FA 2XIGA 2XC7A 3VYRB 3VSLA 4C3IJ 1YJWI 3CTAA 3M1CA 3O6BB 3F22A 2MC4A 3GF2A 2ZBKA 3OSGA 2WY8Q 4B43A 3OYMA 3J7AO 1J9IA 2XDVA 2ZY9A 5D19A 1A31A 4AUXA 1G3SA 3MZHA 3IH3A 4DNCA 2O7TA 1XGOA 4GFLA 3JR9A 3VIBA 4W97A 1D8JA 1OFCX 1MSFC 3COAC 4A3EJ 3BDDA 2GA2A 3NEUA 4GYIA 4I0AA 4BJ5C 4JX5A 4EEFG 2XROA 1IN4A 4PZJA 3CJDA 1MNEA 2W85A 3ON4A 1KU7A 1IXRC 1MBFA 4BEHB 3MKYB 3PNVA 2Y75A 4IF4A 2Q8KA 1HDDC 1UMQA 4HYEA 1MNMC 2VQLA 3NQOA 1S8NA 4OOIA 2ACJA 3QAHA 4XN3A 4NUBA 1BW6A 3S1QJ 4C3HJ 2GZWA 3BNIA 3FXRA 1TL8A 5DM7F 4HQEA 2COBA 3S2DJ 2JA5J 5HDNA 3DTIA 3KX2A 4YG2F 3G4SI 1BOAA 5H6QA 2STWA 3Q9SA 3J80K 2EZLA 2MG4A 5C44J 4H0EA 1JGGA 1D5VA 2NS7A 3GW2A 5EJCA 5E3NA 1G3TA 4RB3C 2QQAA 1W4MA 4QLCU 2WGBA 5IPAA 2MYSA 1UCRA 3QPSA 4N9IA 3FXMA 3HTIA 3ABLH 3MZ8A 2L3DA 1JI8A 4XLAA 3TEDA 3LAJA 4YFXF 2R7WA 4D7MA 1SD7A 5FKMA 3EETA 3E5QA 1H89C 3CO6C 5M3FJ 4C2MJ 2LREA 2GENA 1T95A 3DKWA 1GVJA 1F5TA 4FX0A 2XDNA 3CUQC 2K9MA 4I01A 3RKYA 4CYDA 4BXUA 5DUKA 2A68F 4BL0B 1IUFA 1IV6A 2B63J 2IPQX 2I8DA 1P6RA 4M3DA 1VQ8I 4HF1A 2FUG2 2COMA 3A0BC 3QU3A 1X58A 1FYKA 4A3IJ 4NC7A 3RKXA 3ZQGA 3KZYA 3SDBA 4XR6A 2CUJA 4ANJA 2R5YB 1MJAA 1HQCA 3TMOA 3GMEA 5FFZA 2QWWA 3F8BA 5E3MA 1XSVA 5HVQC 4BY1J 2H1KA 2EBIA 3I5UA 2MBFA 4GGGA 1Y0NA 1NK3P 5AONA 4G8XA 2LLKA 3PSIA 1HC8A 4OD4A 4L0YB 2QBYB 3ANPA 2E36A 1ACIA 4L9NA 1UAAA 3NNRA 2EIKH 1E2XA 4G7ZF 3VDXA 1ON1A 2FNPA 2O61A 3FDYA 2BY3A 2MW8A 1P7IA 1XMXA 2VPLA 2H09A 3OWTA 1ZRCA 3C2GA 2ETHA 2XAQA 3QP6A 1QBJA 3GFMA 4HRIA 4UY8I 1BR1A 1RUNA 1HOMA 1V54H 4Z2YA 1IN6A 3JRGA 3BZCA 3BP8A 2DA4A 4BHBA 3L00A 4HNVA 1ULYA 5LGUA 4CUGA 4C2UA 4AIKA 1IRGA 1UG0A 2VBWA 3MKZA 5IOYA 3BTJA 3FK6A 3SZPA 4HA8A 2CG4A 3SHFA 1KYWA 1ZK8A 2LK2A 5FD5A 2EFWA 1I3QJ 3OSFA 5E17F 3VYSB 4QIWN 4ICHA 3WTUC 5DAJA 1ZRDA 2L54A 4RGUA 3FIWA 4OIQF 4A6DA 3CCQI 5GPAA 1LB2A 3M7GA 4JX4A 1YFHA 2JQ7A 3M07A 4Y52J 3HTUA 3DPJA 3ZOBA 2LBFB 4Q48A 4KYWA 4G12A 3WE3A 3ZQLA 2ZJQF 3NAUA 3QRFF 3HM5A 3MAJA 2JA8J 5LRRA 4EM2A 2HFHA 5EZGA 3HPGA 1SD4A 2QLZA 4KIFA 5E3OA 4ESFA 1HW2A 2PMUA 1WSUA 1YITI 1QNTA 2VQHA 2FX0A 5D4RA 1OYIA 3WE2A 2HI3A 2HPIA 3RQ4A 4M6VA 2UXHA 5F1RA 3GTLJ 2D5VA 1SEUA 5D5VB 5FRMA 4OAYA 3HKZN 3HSRA 2NRAC 4Q5SF 3H3ZA 1KYZA 2R0QC 3IWZA 3LAPA 2FSWA 1HKSA 3DU5A 1MJBA 4ESBA 5EDNA 1IO2A 2KIFA 3CDLA 2A5YB 1E3HA 2MSYA 3OOUA 5AQCA 1EKEA 3F6VA 3IRRA 3CCSI 4ACIA 3VWBA 3PNYA 2EPFA 3N97A 1Z91A 4A3DJ 3WU2C 3F8FA 3LSPA 4L5JA 1XGSA 3ELKA 4GDFA 1FIAA 4BNCA 1WQ2A 2ZNZA 1BOBA 3DLAA 5EG0A 4JQFA 2OPTA 2FRHA 3I58A 4DYQA 4ZDLA 3HEFA 3FKIJ 2W7NA 3WTXC 1CF7B 4XM3A 3SFZA 1ZH5A 1IN8A 3BR3A 2E7WA 2ECBA 3E6DA 4DBQA 3ML6A 1P92A 2CMPA 4LMYA 2P0WA 2ZO4A 4X1EA 1MDMB 4BGDA 3F6OA 4KMFA 3C07A 1R1VA 4A5NA 4ZH4F 1T2KA 1K4TA 1R4MB 1W7PB 2DI3A 3KPHA 1SVMA 3HUGA 1NG7A 3E7QA 4U9NA 2XAHA 3CMEI 2RV8A 2MA3A 2BEOA 3FM5A 5J1YA 2WAFA 3BJOA 3U21A 2X48A 1POGA 2DN0A 3GZ6A 1IC8A 2HYFA 3I9V2 1U8BA 3HTJA 3VOKA 1O4XA 2KIQA 4RLFA 3RPUA 1LKXA 1OCOH 2TCTA 2JSCA 5H20A 1KZHA 4CZCA 3CCEI 2NYXA 2KIMA 3CMYA 4CDGA 4MTDA 2ICWG 1VTNC 1AKHA 4ZDOA 5CJ9A 3H9QA 3DQVC 5FLMJ 1Z05A 3E6MA 2P6SA 2KP6A 1Q1VA 2W1OA 5D8KB 4DGWB 2ELKA 4ITVA 4QSHA 4ZC3A 1SAXA 4L9TA 4XLNF 2R4GA 2Z3YA 4LK0F 5ICCA 3JTHA 5E20A 1Z1DA 3TO6A 1YW9A 4HQMA 4S04A 1N78A 2MC3A 4BU2A 3PPBA 1MNDA 4LLGF 2Z1DA 1X1DA 1SD5A 3QOEA 3CC2I 2L01A 3CC4I 1MZBA 3I59A 1O7LA 2BV6A 2P8TA 2VBXA 4FTHA 2MFZA 3MKLA 4FASD 5IP6A 3M4OJ 2M5WA 2YPRA 2R7ZJ 3VVZA 2CV0A 1RIOH 2HDCA 4FISA 4HZFA 1J2XA 1B72B 4MIMA 1HKQA 3RD3A 1MKMA 2V7FA 2AHQA 2EINH 2XF7A 3BCGA 5HOOA 1K78A 3V8KA 3FBIB 2NNYA 4EQQA 2ZJRF 2Z2SB 4NQWA 4HBLA 2ZOYA 2Y0SN 1MGTA 4RDUA 2E1NA 2D45A 3S1NJ 5L3GA 4DYRA 3W2AA 2GOXB 1RR8C 3Q3SA 4M72A 4HX4A 4H4KC 4E7JA 3FKJA 4BQQA 5M3MJ 3K4JA 2KT0A 2Z99A 1YX3A 1FOXA 3X2QH 3ZCOA 1OCTC 3VPRA 1V4RA 3KEOA 3ZMDA 3ZQQA 2BW3A 3BR6A 3PIPF 3SJMA 4XLCA 3PO3J 2KLOA 2L7MP 5KCMA 3M8FA 3JRFA 3O3KA 3BJAA 4MNUA 3ZQCA 2VL8A 1YQAA 2L5QA 3SZTA 2DFHA 2R7TA 3LSIA 3OYNA 4IXAA 3DTKA 3FK7A 2DW4A 2KKOA 2YUSA 3D1NI 4HPQA 1YG2A 2ECCA 2OAZA 1J75A 9ANTA 4MTEA 5DCMA 1CGPA 1GLNA 2XVCA 3WHCA 2GXGA 3MQ0A 3MCZA 1J09A 1USTA 2LFBA 3ASNH 3LMMA 2HEOA 2V9KA 1I1GA 2AS5F 3CUOA 2EZIA 4BUPA 3JTGA 3MEXA 3OIQA 2HVSA 1LDDA 5J8FA 2ZXJA 4RAGA 3S1MJ 4I7HA 2DLLA 1P4XA 3HHHA 5FRNA 1X19A 4XKCA 2QYOA 1FSHA 4IHSA 1ZQ3P 2Y31A 4LIVA 4I2OA 5E3LA 3DF8A 3W6VA 3C2HA 3CZ6A 3WHBA 4U88A 2VKEA 4WX9A 2Y9ZA 4JBAA 2IA2A 2JVGA 1SFEA 3PASA 1V5EA 2KIUA 2MLGA 5B3SH 3CCRI 1ZGAA 3BPXA 2P81A 2KFDA 4JOMA 4G94A 2HYGD 2LKPA 4A3FJ 1TW3A 3PSFA 3HG9A 1XTAA 1QZEA 2RNJA 1V5FA 2V57A 4CHUA 3L2WA 3VTIA 4XNFA 2BVLA 1S7EA 2MH9A 2E2HJ 1WRJA 2QSGX 2V1DA 4I99C 2W57A 4HKUA 3A4CA 2BGCA 1G3WA 5FO5A 3LA7A 3LQQA 4JP0A 1VQPI 2JRMA 3DLLF 1K7AA 4WF2A 2E19A 3VSKA 1R4NB 4XMYA 2UXUA 3BG5A 1R71A 5ERIA 3G1OA 1PUEE 1XN7A 1FC3A 3JCUC 5LHIA 1PP8F 2UXOA 2EIJH 5HODA 4AVZA 3DPLC 2IT0A 2DA3A 4A93J 2E5NA 2JSPA 3B73A 3VVXA 4G6QA 4NC6A 3GTGJ 2OTLI 1MMAA 1JXSA 3LSRA 2D1VA 2QENA 4C2MA 2FQ4A 3K7AJ 2VC1A 4LJZF 2OC6A 3BTCA 3K4LA 1C0WA 5EZHA 4A3KJ 4WXHA 3ZQFA 4EGYA 1YW8A 3CCYA 3I71A 2LSOA 1U8RA 2OV7A 4HF0A 2DU9A 2DDBA 1LEBA 2X0LA 1EH8A 4O3MA 2BZTA 2JA7J 2K86A 3WG7H 1ZKGA 3IKTA 1O3QA 2A61A 2K9SA 4AWXB 3LSGA 1P4WA 2EIMH 1I50J 5K7HA 4BXXJ 1S7AA 4UB8C 5HLHA 3ROUA 1ODDA 1SC7A 1X4PA 2GIZA 3M8EA 5CVVA 4CSWA 1Z3YA 5HNHA 2VBZA 2E35A 3B02A 4FE4A 4PUSA 1QU3A 1D3YA 2DK8A 4GCVA 2K85A 4UXNA 3GYHX 5J47A 1X1PA 1LPQA 2DYSH 3BC8A 3S93A 5L3FA 3Q0VA 1FNNA 3T8TA 2GXBA 2CQQA 3P5JA 3HOUJ 4PJJA 4XRFA 1WJAA 2BHZA 2HGCA 5AIPA 5HDGA 1QRYA 4CH7A 3CJTB 4EV0A 2CH0A 5A2QZ 1MIJA 1XDUA 1OCCH 2DMTA 4XRSA 2H8WA 5L3EA 4E7IA 1F4KA 1YX5A 1ERDA 1MH3A 1IGNA 3FISA 2OERA 1D5YA 3FBNB 2VOOA 2F2EA 3RCOA 1VQOI 3T5XA 1GHCA 1VQNI 3P7NA 4OMYA 2Q2EA 2ZCNA 1IUYA 1IF1A 1A04A 1MMDA 3HOSA 2AXTC 4KN4X 4L18B 2Z16A 5L3BA 1JKPC 3LWJA 3GZNB 5GP9A 1FTTA 3ECHA 2PEXA 3K4CA 5CKTA 4FX4A 2L2OA 2L9NA 5JHFA 3ZGKA 3LSKA 3I4MJ 4PJ0C 3K2ZA 3MWMA 3F3XA 3VUQA 3KIOA 3L9FA 2E1OA 2ESHA 4UHTA 2W24A 3C2BA 3HOXJ 3D5SC 4IRIA 3PO2J 4CGZA 4AF5A 3TOAA 1MMNA 1B9NA 3BHQA 2F4MB 3KP6A 1RUOA 1WVRA 2CO5A 3AQTA 4XOPA 3HE0A 4V19K 2PI0A 2LMDA 1O3RA 1FBUA 1JT6A 3PUFA 1DGRM 1RPWA 1FIPA 1HDPA 1QHHD 2G0EA 4PGHA 3F9KA 1PYVA 2M0CA 3W2WA 5FLXK 3ZMZA 1G4DA 4FQGA 1FOYA 5ILUA 2O8KA 5DS9A 2WUIA 4OIPF 3KP2A 5K7FA 3K4KA 3I3LA 1LE8A 1OCPA 1JE8A 2MLKA 1XD7A 1Z7LA 2E7XA 2LKXA 5FGMA 2G7GA 1BI2A 3K4BA 5EG0B 1XMKA 1D8KA 1ONVA 3OYJA 3DKYA 4JYKA 5LHGA 2M8GX 2K7LA 1YJ9I 2UXNA 1MBKA 1BL0A 1MW7A 2EA2A 5HNFA 1A5JA 3BPVA 1MSEC 3VB2A 1XSDA 3BY6A 1JKQC 2MH2A 1TTYA 4DZJA 3BJBA 4UUSA 2HU9A 2I10A 2P5KA 3SXYA 3H36A 4RGSA 2X6OA 5DYMA 2TRTA 3BR0A 1N25A 3HUGB 4KT5C 5D5WB 1FSEA 3QODA 3ZN0A 2KL4A 3LA3A 3TW6A 5D6FA 3RH2A 1ETVA 3QYEA 5BS6A 1OLTA 3S3MA 2GIVA 4M3GA 3NARA 2MGQA 2K4BA 2K5CA 3NWTA 1TQIA 2WA0A 1BIBA 5F08A 2F07A 2F4IA 2MD5A 1NH3A 2MABA 2IP2A 4BAYA 4XICA 3CCUI 3OIOA 5FLVA 1BBYA 3OYBA 4ZYGA 1AKHB 1OR7C 3F8CA 4PXIA 3BG7A 5JR3A 5JLWA 2E2JJ 2D6YA 2DA5A 3NRVA 2NVUB 5GPCA 2HVQA 2ZB9A 1X4OA 3ECOA 3WTWC 3MFKA 1S5LC 3AG3H 1USSA 2ELHA 3AG4H 4E6KG 5J40A 4LGWA 5HAWA 3RPQA 2JUCA 1JKOC 2D2WA 2OCCH 4M71A 1TWHJ 2JWTA 2RKHA 2XRNA 4BYYA 4Q4ZF 4XKVA 1AOYA 2IA0A 4BE0A 1K4SA 2GBYA 4L5IA 3OS1A 3J80Z 4QPQA 3I59B 3BG3A 2DPUA 3GTPJ 2H94A 5TRDA 2PMHA 2OI8A 5B66C 1Z3XA 1FT9A 2FD5A 2FXAA 1IAWA 2KJBA 4G6DA 2DBBA 2H6CA 5J3LA 1WWXA 3P9CA 1PUFA 2PJRA 2X9DA 3QWLA 1UG2A 1VQMI 3J7YJ 1JUSA 5H2FC 4C3JJ 4EATA 2P5LC 3Q5FA 1JHFA 3R6SA 4EJWA 1K78B 3W3CA 2C6YA 4NQWB 4A6EA 5LFAA 5B1BH 2PZ9A 1ETKA 2L9RA 3KNWA 1V55H 1YYVA 5EEAA 3V42A 3I53A 2HPMA 2UXPA 2PG4A 1K83J 4N0BA 1Z67A 4DIQA 2XPVA 4WIBA 5BPIA 2A6EF 3PQKA 2PLYA 1O3SA 2OJED 4F93B 2BW3B 2V9PA 2J5OA 3OL3A 5IT9K 5FROA 3ONQA 3QBMA 4Y15A 3BZ6A 4RGXA 4WCGA 4D5FA 1E17A 4G7OF 2YR2A 2XKPA 3I4NJ 1FMVA 4HEA2 2LP0A 2HQNA 3FHZA 1RKWA 2VJ4A 2X6WA 2R7VA 1P9QC 4UVCA 2G9WA 2X1CA 1ITYA 4CCNA 1G2HA 3KEYA 2VKDA 4ENJA 1G3YA 3EYIA 1R7JA 1PP7U 4RMNA 3TOBA 1DU6A 5DCMB 5CXGA 2IJLA 4XKWA 3HYIA 5H6RA 5HDKA 2CQXA 5EEGA 2L4AA 4FETA 1IN7A 4NN1A 4AC0A 2OA4A 3RZOJ 4BQOA 4ZJZA 1U6GA 5BPDA 2NVXJ 1W0UA 1BM9A 1TWFJ 3SEZA 1RNLA 2R7UA 5F0FA 5E18F 4BHCA 4A3CJ 1FJLA 4FHTA 1J7KA 2FEZA 4AIDA 1WCMJ 4A3GJ 3A01B 2IS2A 4ME9A 4CXFA 2O6GE 2RQQA 4MEYF 3VOEA 5BOXA 3S2HJ 1YE9A 3RKWA 2HKOA 3GTJJ 2A2FX 3HRUA 2DDAA 2VI6A 3C7JA 3K1MA 4P96A 4V2GA 2REKA 1HBXG 1TNTA 1FMWA 5J4YA 2PBXA 3DEEA 2O7OA 2NAZA 3NS4A 3KFWX 2X6YA 4IJAA 3TGNA 2KZGA 4LG0A 3N4MA 1V3FA 2E1CA 2PFBA 3ZQHA 4RAYA 3S2WA 2FBKA 5ED4A 3K6GA 2XPUA 4MFEA 3W6KB 3GTQJ 5F0HA 4IOAF 4GCTA 4TV7A 4BJTA 3ISPA 3E5XA 3TO9A 3AL0B 2XGCA 5FJ8J 4ZYAA 3ESWB 4GFBA 2LVSA 1XGNA 1GUUA 1OMIA 4NDLA 3CCLI 2QSFX 2X1EA 2R5ZA 2VE9A 3UR3C 4A3LJ 1SFKA 3QQAA 4E7LA 3DTEA 4Q47A 4PCQA 1MH4A 2BXYA 2GQQA 2PMZN 4M9XA 4RB1A 2GUHA 2R7SA 3P9TA 2W25A 2DT5A 1I6HJ 1N75A 1FBQA 4KA4A 5ICFA 2XUBA 4DBRA 2PFVA 5ICEA 1SANA 1Y0UA 1A6QA 1XDSA 4MGRA 1SGMA 1RR7A 4XLEA 2GOMA 1Z77A 1R23A 4M3FA 3HC7A 2WY7Q 2M7AA 2XB0X 4ZDPA 1Z6RA 3KZIC 2CW0F 2ISYA 4JK1X 1Y39A 3ZPLA 2ELJA 2H1LA 5GADJ 3CDIA 3GCMA 2X4HA 3HGGA 3KYCB 1KU2A 2FJ1A 1UELB 3KP3A 1XC5A 2WBMA 5CYVA 4NC8A 4YRVA 2ZCXA 3FXQA 4OMZA 3AG1H 3KEQA 1R9TJ 1FWZA 1B59A 2VBYA 1EH7A 5LHHA 2N8GA 1KGSA 5D1RA 3CP2A 1IW7F 4HG2A 3WTTC 3D0SA 2FBHA 4MLOA 3F0CA 3H9JA 3TL4X 1H9GA 3JRIA 2RC4A 3F8NA 2CQKA 3DBHB 2X51A 4YIFA 2CGPA 3QYFA 3RTRA 2PN6A 2KDOA 2ZMEA 5JLXA 2OD5A 1GT0C 3JRBA 1QQIA 4IOCF 3H92A 1IV8A 4KICA 3OOPA 5FKOA 3OMYA 3HRMA 4HDUA 2DG8A 5E8IA 1SVOA 1SFXA 3FXUA 4LLNA 2YX4A 2Q2EB 2A05A 2A6HF 2RAEA 4OINF 1TWGJ 5IOZA 5IT3A 3V6GA 3C1DA 2CS3A 3V4GA 2ME6A 5D6EA 3I56I 2QSHX 1JJ8C 4BHPA 3CF2A 4B3AA 4RBOA 2ME0A 1FOKA 4WXCA 2LC2A 2F48A 4BY7J 4I0BA 1UJ8A 3K10A 4BJ6C 5LGNA 3LFUA 3HJEA 3OYGA 2FBQA 1F36A 5KK1A 4K2EA 1AWCA 2HYTA 1SD6A 2IVMA 4DOZA 1IXSB 1Z7UA 3CESA 4BH9A 4KJZA 5LLQA 5LBQA 1HKTA 3IH2A 1D0XA 2B7EA 2DMPA 2V1XA 3EUAA 1XG1A 3NI7A 5K58A 2DJNA 4XOTA 2OZUA 3BCBA 3LSJA 3LHQA 4BS9A 3FXOA 4ZZDA 3GTOJ 2LF7A 2WAQN 4HW0A 4YELA 4LLLA 4KFCA 2RVCA 1T33A 5K5RA 3WGHA 2LD5A 5TISC 4B48A 4CICA 1WFXA 4HX8A 1LE8B 1T56A 4B8XA 1B8IA 3R61A 3BR2A 2FOKA 4BE2A 2CUFA 1ORKA 1ETWA 2K27A 2QVOA 3OR1C 1GDTA 1FZPB 4OIOF 3K4NA 4A2UA 4U9LA 2LYCA 2G3BA 1EH6A 1T98A 3QYBA 1YRNA 3I64A 1VI0A 3MVPA 3GFLA 2WWYA 4RS8A 1U3EM 2XAGA 5B5EC 1E3PA 4AYBN 1B4AA 2F4OB 2KRFA 4CO8A 4ZTJA 4XONA 2K02A 3CCJI 3H0DA 1LFUP 4R79A 1J0RA 3OS2A 1KQ9A 4UUSB 2CV1A 1ZLJA 1IRFA 1UB9A 3F23A 1VQKI 2Q24A 4D5CA 1MJ9A 2DFEA 1BC7C 1QZZA 4HAMA 3ZMUA 3PIOF 2JPCA 4ASNA 3JREA 2Y2ZA 3KKCA 2ZXWH 4R1HA 5LEKA 4F3QA 1ZGJA 4KUMA 2XHKA 4IPAA 2PBIA 1MMSA 3E7LA 2F6CA 2BY0A 1R5HA 2ZCWA 3S1RJ 5F0CA 4EJOA 3SYTA 3HL2A 2FA5A 2DCEA 4F52A 1AU7A 3ZRGA 3QU6A 3DFGA 3QPTA 3RI4A 4YZEA 3QP5A 4HLXA 3J7ZI 2YS9A 2LR8A 1FY7A 1WHUA 3CLQA 4DW6A 4I98B 3PFYA 2CSOA 4CYCA 2CFXA 3ZMVA 4EJVA 3VW0A 2XAFA 1DU0A 2X6XA 1Y1WJ 5D4SA 2ZOZA 4U7BA 4I09A 2IEKA 1NHAA 2RQPA 3HTSB 2IGNA 2M7BA 4QTRA 5DEQA 1K79A 3HKZA 1UHSA 2VQCA 2VXZA 3COLA 5C4YA 1PVEA 3M8JA 2BVMA 1U9NA 3BTIA 2XV4S 5KAFC 3DCFA 2PJPA 3H9GA 1RC9A 3D5LA 1G59A 2L7FP 2WV1A 4KITB 4OIRF 2YSRA 4UNOA 1WKMA 5AIQA 4KWAA 2L9SA 1VNDA 1PUFB 2XAJA 2PJRB 3SDGA 3E97A 2EV0A 4F55A 2R7DA 3CUQA 5M5XJ 2JMWA 3LFKA 3GEUA 5FFXA 3BG9A 2Q1ZB 3F8MA 3TP3A 2E1MB 1A35A 3G73A 2P7VB 3DBLB 2K9NA 1VQ7I 2Y0MA 4B47A 1IN5A 1ZN2A 2EZKA 1W1WE 2O9LA 2OQGA 3OYKA 1F43A 2HZDA 4D1QA 1BJAA 3L1PA 3HOTA 4B4CA 2CFOA 5E1XA 2JA2A 3HZJA 5C4XJ 1E0EA 3ERMA 2AQEA 3EGQA 3A02A 2BOLA 5HSZA 2YU3A 4XLPF 1TT5B 5FKNA 2HS5A 4IQ4A 2VOPA 3PUBA 2BBYA 4IKFA 3HXLA 4Z6YA 1RETA 3UNGC 4MQ9F 3LA2A 4FCYA 4NHJA 1OISA 2VUMJ 1D0YA 2OU2A 3I4PA 3AFHA 1RZ4A 3P9KA 4XSZF 5BMZA 4JX6A 2GLOA 1UZCA 3BOQA 1MBGA 4ON0A 2G7HA 1WGXA 1W7PD 3R60A 5LEJA 3PQJA 3AKZA 2VIXA 3GZIA 3FM3A 3ABKH 3GX4X 2YU9J 2VPRA 2HTJA 3OYDA 1X1CA 3WU0A 1BIAA 3E1SA 1BJZA 1KA8A 3M1EA 3IUVA 3S32A 1UHWA 3JAMZ 1X3ZB 2DOFA 2QF7A 3ANGA 2WAQA 2EFNA 3L2UA 3J81K 1W0TA 4J19A 1LJ9A 1M1EB 3NPIA 2IU5A 2ZSIB 3BWGA 1MD0A 4RAFA 4A3JJ 1TLHB 1QVUA 3JSOA 1VZ0A 3DWLE 2HKXA 1S72I 3CLOA 1VQ5I 5IP9J 4GXOA 1IZ1A 1ON2A 5DCFA 4CCMA 2M34A 4B1RA 4MEXF 3NWSA 2DT7B 2DA7A 5C4JJ 2QCOA 2YVXA 3TBIA 2HQ5A 2KMUA 4AYBA 2DODA 2J5PA 4ZYDA 1A36A 2YVEA 1SFOJ 4LG0B 1BA5A 3HIFA 5EGOA 1YJNI 2A5WA 3L09A 4M3BA 2VASA 3C18A 1PJRA 2L02A 3F1BA 2M9HA 2W82A 3O8GA 3CDHA 2OCEA 1A6IA 1TZLA 2LH9A 2Y0SA 4U0VA 3B81A 4NELA 4CGRA 4LOCA 4GCKA 4XRMA 3KLNA 3R0AA 2AQFA 5ILSA 3S5RA 2VC0A 2R5ZB 3RZDJ 3O2PE 2TDXA 1YOVB 3JRAA 1Y1VJ 3L7WA 2WTEA 2Q0OA 4G9YA 3NRGA 4IHXA 4IX7A 3S15J 1HF0A 1QZYA 2DQRA 4O5VA 3VW1A 4E7KA 1ETOA 4UUTA 2RDPA 3DP7A 1ETYA 1OCZH 2Y30A 4GRIA 5EEHA 5EF6A 3RKQA 3GUDA 5E1WA 1AA7A
chains in the Genus database with same CATH topology
1FIAA 2KDZA 1RESA 5EG0A 2NX4A 2OPTA 4I76A 1BW5A 2R5YA 4DYQA 1NTCA 3CWRA 3HEFA 3FKIJ 2L7ZA 3QBMA 1TWCJ 4BBSJ 3HTAA 4D5FA 5M5WJ 2QWTA 4GFKA 3BR3A 2ECBA 1AHDP 3I4NJ 2LP0A 1U78A 1RKWA 4X1EA 2EQRA 1H88C 2CRGA 1ITYA 3MN2A 1G2HA 3A01A 3C07A 2XGDA 2ID3A 5FGLA 1DU6A 5CXGA 2CQXA 1JTXA 3E7QA 3V78A 4NN1A 3PM1A 4AC0A 3RZOJ 4UDSA 3BQZA 2HOAA 1Z0XA 4V2FA 5J1YA 1ZGWA 3DEWA 2NVXJ 1W0UA 2QIBA 3HGYA 1TWFJ 1RKTA 2X48A 1POGA 2DN0A 5F0FA 1IC8A 4A3CJ 1FJLA 3QPLA 1U8BA 3HTJA 3JRDA 3VOKA 1E3OC 2RHAA 1WCMJ 2XRLA 1O4XA 4A3GJ 3A01B 3G56A 4ME9A 3G1LA 5CW8A 1UI5A 1MBEA 2TCTA 4JNNA 3B6AA 2DMUA 3UKGA 3S2HJ 3HOVJ 3IH4A 3CMYA 2DMQA 2JK3A 3GTJJ 1AKHA 2VI6A 4V2GA 2REKA 5FLMJ 3BTLA 2LTPA 1GV2A 2LY9A 2JA6J 2GFNA 2HXOA 2PBXA 4MXMA 1Q1VA 2O7OA 2ELKA 4QSHA 2NVQJ 5CXIA 1IJWC 1WI3A 1HLVA 1NK2P 2NP3A 3ZQHA 5C3EJ 2OF7A 3PPBA 2XPUA 4MFEA 3GTQJ 1JT0A 5F0HA 2G7SA 4XRSG 4GCTA 4AC6A 4FTHA 2XGCA 3MKLA 5FJ8J 3Q0WA 4DYCA 2AO9A 2H8RA 3M3YJ 4GFBA 2LVSA 1ETXA 5IP6A 3M4OJ 1GUUA 2HOSA 1QPIA 2R7ZJ 5FHPA 4NDLA 2R5ZA 1IRZA 1WPKA 4FISA 2R92J 3QQAA 4A3LJ 3O60A 2NVYJ 1XS9A 1B72B 1MH4A 3P9TA 2PMZN 4MIMA 5F04A 2GUHA 3RD3A 4A69C 2AHQA 3LNQA 1I6HJ 5IYBJ 1B8IB 4X6AJ 3BCGA 1VFCA 5IYCJ 1SANA 2ZOYA 2Y0SN 3T6NA 4RDUA 5IP7J 2E2IJ 3S1NJ 1RR7A 3TW7A 3BT9A 4DYRA 1SGMA 1YRNB 1Z77A 3Q3SA 1H8AC 4M3FA 4L62A 2XB0X 2HYJA 3A03A 5BNGA 5M3MJ 2KT0A 3HGGA 3JRHA 1IG7A 3NXCA 2FJ1A 2DA1A 1OCTC 3VPRA 3SJMA 2R93J 1XC5A 3BR6A 3PO3J 2ZCXA 1X2MA 1TWAJ 4A3MJ 2DTZA 2L7MP 1R9TJ 3JRFA 4JKZA 3ZQCA 2M2EA 2N8GA 5J1UA 5D1RA 5FKLA 3GBGA 2CU7A 3FK7A 2YUSA 4XK4A 1ZR2A 3D1NI 4MLOA 2ECCA 3F0CA 9ANTA 3JRIA 2IBDA 4Y7NJ 2NP5A 1JUMA 3WHCA 2RASA 3HOYJ 2LFBA 5JLXA 1GT0C 3JRBA 1IDZA 3AQSA 3HB9A 2EZIA 4IHVA 3S1MJ 2NS8A 5FKOA 1ZR4A 2DG8A 5IYDJ 1ZQ3P 3S17J 2Y31A 4CYCB 5HBUA 2K40A 2DG7A 5E3LA 2RAEA 1TWGJ 5IOZA 3W6VA 3V6GA 3WHBA 2VKEA 3H0GJ 2ME6A 3SFIA 2Y9ZA 1JJ8C 3PASA 4B3AA 2HOTA 4RBOA 3KKDA 2ME0A 2L0KA 2P81A 4M3EA 1VF9A 4BY7J 1CQTA 2UXIA 4A3FJ 3G1MA 3B6CA 1WH5A 1F36A 2CUEA 3S16J 1FTZA 2FBQA 2IAIA 2EZHA 2V57A 2HYTA 5F27A 4JL3A 2HDDA 1JKRC 1ZTRA 4GCLA 4XIDA 3IV5A 1S7EA 2E2HJ 3HTHA 3VP5A 1JTYA 4I6ZA 4HKUA 3HOWJ 3CQZJ 3IH2A 4JP0A 2XPWA 2E19A 3LJLA 2DMPA 1XG1A 2UXUA 3NI7A 3BG5A 5K58A 2DJNA 2WB1N 3G1OA 5J1RA 2DMNA 3LSJA 3LHQA 5H9TA 3LOCA 4ABZA 2Y9YA 3GTOJ 2UXOA 5HODA 1ENHA 2WAQN 3G7RA 5EYRA 2NVTJ 1T33A 3TP0A 2DA3A 4A93J 2LD5A 4IHYA 2XSDC 1B72A 3VVXA 3BQYA 1LE8B 3GTGJ 2JJ7A 1T56A 1B8IA 3KZ9A 3BR2A 2CUFA 3LSRA 1ORKA 1ETWA 1GDTA 2FQ4A 3K7AJ 2G3BA 1YRNA 3FRQA 1QVTA 5F1JA 1VI0A 3BTCA 3MVPA 5EZHA 4A3KJ 3ZQFA 3CCYA 5DTDA 3HBLA 4C3IJ 4AYBN 2JA7J 1ZKGA 1LFUP 3OSGA 2GM4A 1APLC 3O8HA 2K9SA 3LSGA 1I50J 5K7HA 4UUSB 4BXXJ 5D19A 4AUXA 4GFLA 3IH3A 2O7TA 2Q24A 3VIBA 4D5CA 3JR9A 4W97A 2CJJA 1OFCX 1TC3C 5FKKA 1MSFC 4FE4A 4A3EJ 3JSJA 3ON4A 4JX5A 1IDYA 4EEFG 3CJDA 3GTKJ 3VVZA 1MBFA 3JREA 2Y2ZA 3Q0VA 3KKCA 2CQQA 3HOUJ 3HIMA 1HDDC 1UMQA 1MNMC 4D7NA 1QRYA 4MK6A 1GVDA 1GV5A 3E7LA 2DMTA 4XRSA 1X2NA 3S1RJ 5F0CA 2NOGA 3MNLA 1MH3A 1AU7A 4BKXA 1HCRA 1BW6A 3FISA 2DA6A 4C3HJ 1IGNA 3S1QJ 2OERA 3BNIA 1D5YA 2COBA 3S2DJ 4YZEA 2JA5J 2YS9A 2LR8A 4DW6A 4CYCA 3VW0A 2ZCNA 2EZLA 2MG4A 5C44J 1JGGA 1DU0A 1Y1WJ 2NS7A 2ZOZA 5E3NA 4BBRJ 3HOZJ 3HDDA 1JKPC 2WGBA 5IPAA 3LWJA 2IEKA 3QPSA 5GP9A 4QTRA 3S14J 2W53A 3BRUA 1FTTA 3HTIA 1FEXA 4IHWA 5EGOB 1UHSA 3COLA 5C4YA 3I4MJ 3TEDA 3GTMJ 1U9NA 3BTIA 3DCFA 2G7LA 4D7MA 3VUQA 5FKMA 2E1OA 2L7FP 2WV1A 3EUPA 3RQIA 3QKXA 1U9OA 3C2BA 3HOXJ 1H89C 3PO2J 5M3FJ 2VKVA 4KWAA 3VVYA 4AF5A 1VNDA 1PUFB 4C2MJ 2GENA 3SDGA 3BHQA 2QTQA 3AQTA 3HE0A 5AQCA 3GEUA 5M5XJ 2JMWA 2XDNA 3BG9A 1JT6A 3TP3A 2XGEA 4MFDA 1RPWA 3JRCA 1FIPA 1HDPA 2G0EA 3ZQIA 4DZPA 2K9NA 2M0CA 2HKUA 1IUFA 1IV6A 2B63J 2O8KA 5DS9A 3BR5A 2EZKA 2JN6A 2WUIA 2O9LA 4M3DA 5K7FA 1F43A 1LE8A 3Q0UA 1OCPA 1X58A 1LFBA 3L1PA 4A3IJ 4B4CA 5M5YJ 2LKXA 5C4XJ 3ZQGA 2G7GA 5EG0B 3VOXA 2R5YB 3EGQA 3CRJA 3A02A 5HSZA 4JYKA 2M8GX 5FKNA 5E3MA 4BY1J 2H1KA 2EBIA 1MBKA 1NK3P 1BL0A 1A5JA 3ON2A 1MSEC 2LLKA 1RETA 1UI6A 1JKQC 3ANPA 2QOPA 4FCYA 2VUMJ 4DZJA 3NNRA 3BJBA 4UUSA 4JX6A 5K7ZA 1K61A 2GLOA 1MBGA 2I10A 1WGXA 2MW8A 2X6OA 1P7IA 2TRTA 3BR0A 3GZIA 2YU9J 2VPRA 1HOMA 3BR1A 3TW6A 3JRGA 5FMPA 3RH2A 2K9QA 1ETVA 2DA4A 1BJZA 4M3GA 4HNVA 3IUVA 1MBHA 3NARA 2MGQA 3ANGA 2QF7A 5IOYA 5F08A 3BTJA 3FK6A 2ZCMA 2DA2A 4IEJA 4J19A 1W0TA 2F07A 1ZK8A 2LK2A 3NPIA 2IU5A 1I3QJ 3OSFA 4XICA 4A3JJ 4QIWN 3OIOA 1QVUA 5FLVA 4ICHA 1P7JA 5DAJA 5IP9J 3FIWA 1AKHB 5GPAA 4PXIA 5JLWA 2E2JJ 2D6YA 4JX4A 2M34A 2DA5A 3K2AA 4B1RA 5GPCA 2ZB9A 2DA7A 5C4JJ 2HXIA 2QCOA 4Y52J 2HQ5A 4L5EA 3DPJA 3ZOBA 2YVEA 4MO7A 2W48A 4G12A 1SFOJ 3ZQLA 1JKOC 1BA5A 5EGOA 5HAWA 3NAUA 4A3BJ 3HM5A 2JA8J 1TWHJ 2JWTA 1MBJA 4M3BA 5EZGA 3H3VK 1WH7A 4FE7A 5E3OA 2GBYA 3F1BA 2M9HA 3O8GA 3BG3A 1OJLA 3GTPJ 1A6IA 3B81A 2QKOA 4NELA 2OI8A 2EH3A 2FX0A 4CGRA 4LOCA 5EFYA 4GCKA 2FD5A 4XRMA 2HI3A 2UXHA 4M6VA 5J3LA 3S5RA 1PUFA 3GTLJ 2D5VA 5D18A 2X9DA 2R5ZB 1UG2A 3RZDJ 2ID6A 1JJ6C 3HKZN 1JUSA 4C3JJ 2R0QC 4S0HB 3JRAA 2YVHA 1Y1VJ 1JUPA 5EDNA 3CDLA 3NRGA 4IHXA 3S15J 3OOUA 2MSYA 1HF0A 1ETKA 1ETQA 2L9RA 4W1UA 2PZ9A 2XB5A 3KNWA 3VW1A 5EEAA 1ETOA 4ACIA 4UUTA 1ETYA 2Y30A 3RKQA 4A3DJ 5EF6A 1K83J 3LSPA 2UXPA 3VW2A 1EF4A 2XPVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FIA A;  2KDZ A;  1RES A;  5EG0 A;  2NX4 A;  2OPT A;  4I76 A;  1BW5 A;  2R5Y A;  4DYQ A;  1NTC A;  3CWR A;  3HEF A;  3FKI J;  2L7Z A;  3QBM A;  1TWC J;  4BBS J;  3HTA A;  4D5F A;  5M5W J;  2QWT A;  4GFK A;  3BR3 A;  2ECB A;  1AHD P;  3I4N J;  2LP0 A;  1U78 A;  1RKW A;  4X1E A;  2EQR A;  1H88 C;  2CRG A;  1ITY A;  3MN2 A;  1G2H A;  3A01 A;  3C07 A;  2XGD A;  2ID3 A;  5FGL A;  1DU6 A;  5CXG A;  2CQX A;  1JTX A;  3E7Q A;  3V78 A;  4NN1 A;  3PM1 A;  4AC0 A;  3RZO J;  4UDS A;  3BQZ A;  2HOA A;  1Z0X A;  4V2F A;  5J1Y A;  1ZGW A;  3DEW A;  2NVX J;  1W0U A;  2QIB A;  3HGY A;  1TWF J;  1RKT A;  2X48 A;  1POG A;  2DN0 A;  5F0F A;  1IC8 A;  4A3C J;  1FJL A;  3QPL A;  1U8B A;  3HTJ A;  3JRD A;  3VOK A;  1E3O C;  2RHA A;  1WCM J;  2XRL A;  1O4X A;  4A3G J;  3A01 B;  3G56 A;  4ME9 A;  3G1L A;  5CW8 A;  1UI5 A;  1MBE A;  2TCT A;  4JNN A;  3B6A A;  2DMU A;  3UKG A;  3S2H J;  3HOV J;  3IH4 A;  3CMY A;  2DMQ A;  2JK3 A;  3GTJ J;  1AKH A;  2VI6 A;  4V2G A;  2REK A;  5FLM J;  3BTL A;  2LTP A;  1GV2 A;  2LY9 A;  2JA6 J;  2GFN A;  2HXO A;  2PBX A;  4MXM A;  1Q1V A;  2O7O A;  2ELK A;  4QSH A;  2NVQ J;  5CXI A;  1IJW C;  1WI3 A;  1HLV A;  1NK2 P;  2NP3 A;  3ZQH A;  5C3E J;  2OF7 A;  3PPB A;  2XPU A;  4MFE A;  3GTQ J;  1JT0 A;  5F0H A;  2G7S A;  4XRS G;  4GCT A;  4AC6 A;  4FTH A;  2XGC A;  3MKL A;  5FJ8 J;  3Q0W A;  4DYC A;  2AO9 A;  2H8R A;  3M3Y J;  4GFB A;  2LVS A;  1ETX A;  5IP6 A;  3M4O J;  1GUU A;  2HOS A;  1QPI A;  2R7Z J;  5FHP A;  4NDL A;  2R5Z A;  1IRZ A;  1WPK A;  4FIS A;  2R92 J;  3QQA A;  4A3L J;  3O60 A;  2NVY J;  1XS9 A;  1B72 B;  1MH4 A;  3P9T A;  2PMZ N;  4MIM A;  5F04 A;  2GUH A;  3RD3 A;  4A69 C;  2AHQ A;  3LNQ A;  1I6H J;  5IYB J;  1B8I B;  4X6A J;  3BCG A;  1VFC A;  5IYC J;  1SAN A;  2ZOY A;  2Y0S N;  3T6N A;  4RDU A;  5IP7 J;  2E2I J;  3S1N J;  1RR7 A;  3TW7 A;  3BT9 A;  4DYR A;  1SGM A;  1YRN B;  1Z77 A;  3Q3S A;  1H8A C;  4M3F A;  4L62 A;  2XB0 X;  2HYJ A;  3A03 A;  5BNG A;  5M3M J;  2KT0 A;  3HGG A;  3JRH A;  1IG7 A;  3NXC A;  2FJ1 A;  2DA1 A;  1OCT C;  3VPR A;  3SJM A;  2R93 J;  1XC5 A;  3BR6 A;  3PO3 J;  2ZCX A;  1X2M A;  1TWA J;  4A3M J;  2DTZ A;  2L7M P;  1R9T J;  3JRF A;  4JKZ A;  3ZQC A;  2M2E A;  2N8G A;  5J1U A;  5D1R A;  5FKL A;  3GBG A;  2CU7 A;  3FK7 A;  2YUS A;  4XK4 A;  1ZR2 A;  3D1N I;  4MLO A;  2ECC A;  3F0C A;  9ANT A;  3JRI A;  2IBD A;  4Y7N J;  2NP5 A;  1JUM A;  3WHC A;  2RAS A;  3HOY J;  2LFB A;  5JLX A;  1GT0 C;  3JRB A;  1IDZ A;  3AQS A;  3HB9 A;  2EZI A;  4IHV A;  3S1M J;  2NS8 A;  5FKO A;  1ZR4 A;  2DG8 A;  5IYD J;  1ZQ3 P;  3S17 J;  2Y31 A;  4CYC B;  5HBU A;  2K40 A;  2DG7 A;  5E3L A;  2RAE A;  1TWG J;  5IOZ A;  3W6V A;  3V6G A;  3WHB A;  2VKE A;  3H0G J;  2ME6 A;  3SFI A;  2Y9Z A;  1JJ8 C;  3PAS A;  4B3A A;  2HOT A;  4RBO A;  3KKD A;  2ME0 A;  2L0K A;  2P81 A;  4M3E A;  1VF9 A;  4BY7 J;  1CQT A;  2UXI A;  4A3F J;  3G1M A;  3B6C A;  1WH5 A;  1F36 A;  2CUE A;  3S16 J;  1FTZ A;  2FBQ A;  2IAI A;  2EZH A;  2V57 A;  2HYT A;  5F27 A;  4JL3 A;  2HDD A;  1JKR C;  1ZTR A;  4GCL A;  4XID A;  3IV5 A;  1S7E A;  2E2H J;  3HTH A;  3VP5 A;  1JTY A;  4I6Z A;  4HKU A;  3HOW J;  3CQZ J;  3IH2 A;  4JP0 A;  2XPW A;  2E19 A;  3LJL A;  2DMP A;  1XG1 A;  2UXU A;  3NI7 A;  3BG5 A;  5K58 A;  2DJN A;  2WB1 N;  3G1O A;  5J1R A;  2DMN A;  3LSJ A;  3LHQ A;  5H9T A;  3LOC A;  4ABZ A;  2Y9Y A;  3GTO J;  2UXO A;  5HOD A;  1ENH A;  2WAQ N;  3G7R A;  5EYR A;  2NVT J;  1T33 A;  3TP0 A;  2DA3 A;  4A93 J;  2LD5 A;  4IHY A;  2XSD C;  1B72 A;  3VVX A;  3BQY A;  1LE8 B;  3GTG J;  2JJ7 A;  1T56 A;  1B8I A;  3KZ9 A;  3BR2 A;  2CUF A;  3LSR A;  1ORK A;  1ETW A;  1GDT A;  2FQ4 A;  3K7A J;  2G3B A;  1YRN A;  3FRQ A;  1QVT A;  5F1J A;  1VI0 A;  3BTC A;  3MVP A;  5EZH A;  4A3K J;  3ZQF A;  3CCY A;  5DTD A;  3HBL A;  4C3I J;  4AYB N;  2JA7 J;  1ZKG A;  1LFU P;  3OSG A;  2GM4 A;  1APL C;  3O8H A;  2K9S A;  3LSG A;  1I50 J;  5K7H A;  4UUS B;  4BXX J;  5D19 A;  4AUX A;  4GFL A;  3IH3 A;  2O7T A;  2Q24 A;  3VIB A;  4D5C A;  3JR9 A;  4W97 A;  2CJJ A;  1OFC X;  1TC3 C;  5FKK A;  1MSF C;  4FE4 A;  4A3E J;  3JSJ A;  3ON4 A;  4JX5 A;  1IDY A;  4EEF G;  3CJD A;  3GTK J;  3VVZ A;  1MBF A;  3JRE A;  2Y2Z A;  3Q0V A;  3KKC A;  2CQQ A;  3HOU J;  3HIM A;  1HDD C;  1UMQ A;  1MNM C;  4D7N A;  1QRY A;  4MK6 A;  1GVD A;  1GV5 A;  3E7L A;  2DMT A;  4XRS A;  1X2N A;  3S1R J;  5F0C A;  2NOG A;  3MNL A;  1MH3 A;  1AU7 A;  4BKX A;  1HCR A;  1BW6 A;  3FIS A;  2DA6 A;  4C3H J;  1IGN A;  3S1Q J;  2OER A;  3BNI A;  1D5Y A;  2COB A;  3S2D J;  4YZE A;  2JA5 J;  2YS9 A;  2LR8 A;  4DW6 A;  4CYC A;  3VW0 A;  2ZCN A;  2EZL A;  2MG4 A;  5C44 J;  1JGG A;  1DU0 A;  1Y1W J;  2NS7 A;  2ZOZ A;  5E3N A;  4BBR J;  3HOZ J;  3HDD A;  1JKP C;  2WGB A;  5IPA A;  3LWJ A;  2IEK A;  3QPS A;  5GP9 A;  4QTR A;  3S14 J;  2W53 A;  3BRU A;  1FTT A;  3HTI A;  1FEX A;  4IHW A;  5EGO B;  1UHS A;  3COL A;  5C4Y A;  3I4M J;  3TED A;  3GTM J;  1U9N A;  3BTI A;  3DCF A;  2G7L A;  4D7M A;  3VUQ A;  5FKM A;  2E1O A;  2L7F P;  2WV1 A;  3EUP A;  3RQI A;  3QKX A;  1U9O A;  3C2B A;  3HOX J;  1H89 C;  3PO2 J;  5M3F J;  2VKV A;  4KWA A;  3VVY A;  4AF5 A;  1VND A;  1PUF B;  4C2M J;  2GEN A;  3SDG A;  3BHQ A;  2QTQ A;  3AQT A;  3HE0 A;  5AQC A;  3GEU A;  5M5X J;  2JMW A;  2XDN A;  3BG9 A;  1JT6 A;  3TP3 A;  2XGE A;  4MFD A;  1RPW A;  3JRC A;  1FIP A;  1HDP A;  2G0E A;  3ZQI A;  4DZP A;  2K9N A;  2M0C A;  2HKU A;  1IUF A;  1IV6 A;  2B63 J;  2O8K A;  5DS9 A;  3BR5 A;  2EZK A;  2JN6 A;  2WUI A;  2O9L A;  4M3D A;  5K7F A;  1F43 A;  1LE8 A;  3Q0U A;  1OCP A;  1X58 A;  1LFB A;  3L1P A;  4A3I J;  4B4C A;  5M5Y J;  2LKX A;  5C4X J;  3ZQG A;  2G7G A;  5EG0 B;  3VOX A;  2R5Y B;  3EGQ A;  3CRJ A;  3A02 A;  5HSZ A;  4JYK A;  2M8G X;  5FKN A;  5E3M A;  4BY1 J;  2H1K A;  2EBI A;  1MBK A;  1NK3 P;  1BL0 A;  1A5J A;  3ON2 A;  1MSE C;  2LLK A;  1RET A;  1UI6 A;  1JKQ C;  3ANP A;  2QOP A;  4FCY A;  2VUM J;  4DZJ A;  3NNR A;  3BJB A;  4UUS A;  4JX6 A;  5K7Z A;  1K61 A;  2GLO A;  1MBG A;  2I10 A;  1WGX A;  2MW8 A;  2X6O A;  1P7I A;  2TRT A;  3BR0 A;  3GZI A;  2YU9 J;  2VPR A;  1HOM A;  3BR1 A;  3TW6 A;  3JRG A;  5FMP A;  3RH2 A;  2K9Q A;  1ETV A;  2DA4 A;  1BJZ A;  4M3G A;  4HNV A;  3IUV A;  1MBH A;  3NAR A;  2MGQ A;  3ANG A;  2QF7 A;  5IOY A;  5F08 A;  3BTJ A;  3FK6 A;  2ZCM A;  2DA2 A;  4IEJ A;  4J19 A;  1W0T A;  2F07 A;  1ZK8 A;  2LK2 A;  3NPI A;  2IU5 A;  1I3Q J;  3OSF A;  4XIC A;  4A3J J;  4QIW N;  3OIO A;  1QVU A;  5FLV A;  4ICH A;  1P7J A;  5DAJ A;  5IP9 J;  3FIW A;  1AKH B;  5GPA A;  4PXI A;  5JLW A;  2E2J J;  2D6Y A;  4JX4 A;  2M34 A;  2DA5 A;  3K2A A;  4B1R A;  5GPC A;  2ZB9 A;  2DA7 A;  5C4J J;  2HXI A;  2QCO A;  4Y52 J;  2HQ5 A;  4L5E A;  3DPJ A;  3ZOB A;  2YVE A;  4MO7 A;  2W48 A;  4G12 A;  1SFO J;  3ZQL A;  1JKO C;  1BA5 A;  5EGO A;  5HAW A;  3NAU A;  4A3B J;  3HM5 A;  2JA8 J;  1TWH J;  2JWT A;  1MBJ A;  4M3B A;  5EZG A;  3H3V K;  1WH7 A;  4FE7 A;  5E3O A;  2GBY A;  3F1B A;  2M9H A;  3O8G A;  3BG3 A;  1OJL A;  3GTP J;  1A6I A;  3B81 A;  2QKO A;  4NEL A;  2OI8 A;  2EH3 A;  2FX0 A;  4CGR A;  4LOC A;  5EFY A;  4GCK A;  2FD5 A;  4XRM A;  2HI3 A;  2UXH A;  4M6V A;  5J3L A;  3S5R A;  1PUF A;  3GTL J;  2D5V A;  5D18 A;  2X9D A;  2R5Z B;  1UG2 A;  3RZD J;  2ID6 A;  1JJ6 C;  3HKZ N;  1JUS A;  4C3J J;  2R0Q C;  4S0H B;  3JRA A;  2YVH A;  1Y1V J;  1JUP A;  5EDN A;  3CDL A;  3NRG A;  4IHX A;  3S15 J;  3OOU A;  2MSY A;  1HF0 A;  1ETK A;  1ETQ A;  2L9R A;  4W1U A;  2PZ9 A;  2XB5 A;  3KNW A;  3VW1 A;  5EEA A;  1ETO A;  4ACI A;  4UUT A;  1ETY A;  2Y30 A;  3RKQ A;  4A3D J;  5EF6 A;  1K83 J;  3LSP A;  2UXP A;  3VW2 A;  1EF4 A;  2XPV A; 
#chains in the Genus database with same CATH topology
 4IO9 F;  2W00 A;  4R8H A;  1BI0 A;  2NX4 A;  3KZZ A;  4I76 A;  2FMY A;  3H3U A;  4QPO A;  5K5Q A;  1ZG3 A;  3I54 A;  1TWC J;  4B44 A;  2ESN A;  3CMA I;  2L4M A;  2QZ8 A;  3REO A;  3V7C A;  4G7H F;  4EM0 B;  4S05 A;  4RLQ A;  4ESJ A;  2M3A A;  3ZMT A;  1U78 A;  1QHG A;  3EUH A;  1YS6 A;  2EQR A;  1ZAO A;  2CRG A;  2V6C A;  4DJA A;  1R22 A;  4LB6 B;  3V8L A;  1N77 A;  2JZY A;  3L2R A;  2PQ8 A;  3CD6 I;  2ID3 A;  3EPZ A;  3OYA A;  3JSP A;  3LSH A;  3OV8 A;  4KMU X;  2E60 A;  5F6F A;  4IRG A;  4IZZ A;  3TO7 A;  3IUO A;  3KP5 A;  1JTX A;  3V78 A;  3OL4 A;  4M73 A;  2HR3 A;  4UDS A;  2HTS A;  2HOA A;  2M45 A;  4KIG A;  2OBP A;  4V2F A;  3DXJ F;  5KHD A;  2VQG A;  3MMY B;  2IS4 A;  3GEZ A;  4A12 A;  1XGM A;  1LUJ B;  2HDW A;  3WG9 A;  3DPT A;  3JRD A;  2ZKZ A;  1GXQ A;  2RHA A;  2XRL A;  1WI9 A;  2KRH A;  4U0W A;  2FJI 1;  2QQ8 A;  2QA4 I;  3G1L A;  3CJR B;  2IA1 A;  1UI5 A;  1WJ5 A;  1OKR A;  1MBE A;  2K3F A;  4JNN A;  3B6A A;  2DMU A;  1KU3 A;  3HOV J;  4ZYH A;  1FBS A;  3SQN A;  1STZ A;  4AU7 A;  2L9V A;  4HDV A;  3OYH A;  1J5Y A;  2DO7 A;  4A0Y A;  2LY9 A;  2GFN A;  2FE3 A;  2IW5 A;  1I3A A;  4HST A;  2BYV E;  4HLY A;  4MXM A;  1W36 C;  1ZRE A;  2M30 A;  2H6B A;  1BC8 C;  4L9V A;  1G8X A;  1HSJ A;  5CXI A;  1IJW C;  4F92 B;  1HLV A;  1NK2 P;  3BZK A;  1YI2 I;  2Y69 H;  4RB2 C;  3FF5 A;  2GXA A;  1O3T A;  3ZQ7 A;  1TBX A;  5TGT A;  2EJR A;  1Y8Q B;  3TDU C;  2FBI A;  4CCK A;  2G7S A;  4AVP A;  3VYU B;  2ZJP F;  4OAZ A;  2O8X A;  2E5Z A;  4DYC A;  4ETS A;  2AO9 A;  2V4J C;  1TT0 A;  1ETX A;  3K1P A;  1V5G A;  1QA6 A;  2HOS A;  1QPI A;  2JVH A;  4HV5 A;  2OTJ I;  2UXX A;  2R92 J;  3O60 A;  3LST A;  3GWZ A;  1XS9 A;  4CA0 A;  3OYI A;  4ENM A;  5F04 A;  2RN7 A;  1B8I B;  3GXO A;  4CCL A;  5J4V A;  1R58 A;  3H5A A;  4PJN A;  4O6J A;  2R7R A;  2NS0 A;  3T6N A;  1SFU A;  2E2I J;  3TW7 A;  2CQN A;  2MD0 A;  1YRN B;  3WTY C;  3LL7 A;  5E79 C;  1T39 A;  1H8A C;  4L62 A;  2IS1 A;  1W5C C;  2EIL H;  2HYJ A;  3A03 A;  4L0Z B;  4F7Z A;  1VQ9 I;  3FHN A;  1OPC A;  1DPU A;  4HOB A;  2DYR H;  2CV2 A;  2FQ3 A;  2ZFU A;  4A5M A;  1QO0 D;  2VE8 A;  4QWQ A;  2DK5 A;  1X2M A;  1TWA J;  3F21 A;  2DTZ A;  4A3M J;  3U2R A;  5HS8 A;  4JKZ A;  5L3D A;  2IGK A;  1L0O C;  4UVA A;  5DM6 F;  2EV6 A;  3GBG A;  5DDG A;  2ZFW A;  1S7O A;  4XK4 A;  3S3N A;  5IT9 Z;  1NG6 A;  3U1K A;  5JFR A;  2IBD A;  1JUM A;  2RAS A;  4IRH A;  3HOY J;  5E1Z B;  1OCR H;  1LFP A;  4CCO A;  2LRD A;  1IDZ A;  3AQS A;  4BQA A;  3Q9V A;  4NNJ A;  3L2Q A;  3H5R A;  2VB6 A;  3RYP A;  3GVA A;  4EM1 A;  2NS8 A;  2ZJ2 A;  1ZR4 A;  3IHU A;  4IVN A;  3WTZ A;  5F64 A;  4B3X A;  3S17 J;  4CYC B;  3K0L A;  2K40 A;  4UUV A;  3QPH A;  2HNH A;  2IGM A;  1H0M A;  3H0G J;  3WTV C;  1YLF A;  2VN2 A;  2HOT A;  2V79 A;  4RB0 A;  4P9U A;  1ZRF A;  2DAO A;  1DPR A;  2L0K A;  3VOD A;  4XOR A;  1VF9 A;  4M6X A;  2P4W A;  3DKX A;  1CQT A;  2UXI A;  3B6C A;  2CUE A;  1FTZ A;  4PJM A;  3OY9 A;  2JUG A;  1FOW A;  2EZH A;  2VKH A;  1JKR C;  1LVK A;  3MKW B;  4LG3 A;  3IV5 A;  4YFK F;  1B6A A;  3G71 I;  3HTH A;  3ERE D;  1R49 A;  1JTY A;  5DD8 A;  4UVB A;  1LDJ A;  3SEQ A;  3HOW J;  3BCA A;  3CQZ J;  3W6J B;  1REP C;  2JTV A;  2XPW A;  1D1A A;  2ISZ A;  3S8P A;  3CUQ B;  5JVT A;  2ADU A;  2WB1 N;  4PGG A;  1WJB A;  1T38 A;  3AL0 C;  5J1R A;  3LQR A;  4CZZ A;  2L7K A;  3LOC A;  2F5V A;  2JRT A;  2NVT J;  1FLI A;  4UV9 A;  3TP0 A;  4KDP A;  1BI3 A;  1L3L A;  4IHY A;  2XSD C;  1T08 B;  3IAS 2;  3BQY A;  5HLI A;  2JJ7 A;  3RJP A;  3DBR B;  3OYL A;  3KZ9 A;  4KIB A;  1DP7 P;  3CC7 I;  2XF5 A;  2LNB A;  2V6E A;  5GTH C;  1EA3 A;  2R3S A;  3FMS A;  2IS6 A;  3H1C A;  3FRQ A;  2LF8 A;  4PFP A;  5DTD A;  3HBL A;  1W5T A;  2DT6 A;  2NNN A;  1ZAR A;  3U1D A;  4N4O B;  4PJL A;  4Y33 A;  4E7S A;  2G7U A;  3TQN A;  1HW1 A;  5LGT A;  2GM4 A;  1APL C;  2IRF G;  3CJQ B;  3O8H A;  4NB5 A;  1Z6T A;  1BR4 A;  1TP4 A;  4XL9 A;  1EV7 A;  2CJJ A;  1TC3 C;  1JGS A;  5FKK A;  5HS7 A;  3EDP A;  4M9S A;  3JSJ A;  1IDY A;  3GTK J;  1LVA A;  3KYD B;  2XSJ C;  3E6C C;  1VQL I;  4XLF A;  3HIM A;  3WGI A;  2HOE A;  3CF5 F;  2QKM B;  4D7N A;  4J00 A;  1VQ4 I;  4MK6 A;  1GVD A;  3GLL A;  2V1U A;  1GV5 A;  3SWH A;  1UHM A;  3FXK A;  4WWC A;  4WK8 F;  1X2N A;  2NOG A;  3OR2 C;  3T0Y A;  3MNL A;  1Y6I A;  3RPU D;  4BKX A;  1HCR A;  2UWM A;  4U0Y A;  1Y56 A;  2DA6 A;  2KPM A;  4BQN A;  2H27 A;  3H35 A;  5K1Y A;  4XQF A;  3CO7 C;  1YTY A;  4LB5 A;  2LDU A;  4L9J A;  1U5T A;  3T1B A;  3K1N A;  2LKS A;  4YII A;  3C3W A;  2EWN A;  5CVJ A;  1W36 D;  5GAE J;  2XGX A;  1ZEL A;  2VXD A;  5DUI A;  4BBR J;  3HOZ J;  3HDD A;  3CCV I;  3DU6 A;  2M4G A;  2BY1 A;  1OYY A;  3S14 J;  2W53 A;  3BRU A;  1ZG5 A;  4IHW A;  5EGO B;  1FEX A;  1T8I A;  3OYF A;  3GTM J;  3K70 C;  3BJ6 A;  2BXZ A;  2G7L A;  2OQR A;  3FXJ A;  3HRS A;  3U9G A;  4B09 A;  1B9M A;  1ZLK A;  3EUP A;  3RQI A;  3QKX A;  4HF2 A;  1U9O A;  3E3V A;  3G2B A;  4E7H A;  1HXD A;  3I0T A;  4RA2 A;  2VKV A;  3VVY A;  1WJD A;  1DQU A;  1YO5 C;  2IXS A;  3DPU A;  2QTQ A;  4C2T A;  3ABM H;  3R4K A;  3WTS C;  4E4H A;  2VOD A;  3WGG A;  1R6R A;  2HWV A;  4X0G A;  2GAU A;  2XGE A;  4MFD A;  3VFZ A;  3JRC A;  3FX3 A;  3TKY A;  4UB6 C;  5CPR B;  2ZC2 A;  4A0X A;  3ZQI A;  4DZP A;  3ASO H;  2HKU A;  2M1B A;  2LG4 A;  3EUH C;  5HLT A;  2JN6 A;  3BR5 A;  3L2C A;  3EUK L;  3Q0U A;  4N9H A;  2M8E A;  1LFB A;  2DFF A;  2D1H A;  2FNA A;  1T0F A;  3HSF A;  5M5Y J;  1S9H A;  4RM2 A;  5K5O A;  1ZG1 A;  4DVY P;  3VOX A;  3L2V A;  3CRJ A;  2RNG A;  2R7Q A;  2XKO A;  3HRT A;  2EB7 A;  3GLX A;  2WAD A;  3RIR A;  2P7C B;  2GWR A;  3CJN A;  3ON2 A;  1DUX C;  5CVI A;  3PL8 A;  5CVR A;  1UI6 A;  1BI1 A;  4OD5 A;  2QOP A;  3PJR A;  4C9Y A;  1FYM A;  2STT A;  4KNY A;  4MHG A;  5K7Z A;  4KN7 X;  1K61 A;  2Z9O A;  2F5F A;  3TDZ C;  4II2 A;  3G3Z A;  1TNS A;  2EFP A;  4C30 A;  1WJF A;  3BLY A;  2ZXI A;  1HW5 A;  2LY2 A;  2HZT A;  1R1U A;  3A0H C;  3K9T A;  2K9L A;  4BEH A;  3BR1 A;  2OUM A;  1BR2 A;  2WAE A;  1LQ1 A;  2WB1 A;  5FMP A;  2K9Q A;  1D0Z A;  3WU1 B;  1YS7 A;  1RI7 A;  1MBH A;  2DOE A;  2QGU A;  5ICG A;  2BE5 F;  2ZCM A;  2DA2 A;  2DFI A;  2AXL A;  4IEJ A;  1RRJ A;  1Q1H A;  3RDI A;  2XAS A;  3ULQ B;  2R7X A;  2RGV A;  3KP7 A;  4XLH A;  3S3O A;  2EFQ A;  2R7F A;  1P7J A;  2HQA A;  3OIP A;  1OR7 A;  3AG2 H;  2A69 F;  1SVL A;  1DDN A;  2KQR A;  1I27 A;  3AAF A;  3K2A A;  4GO1 A;  1HST A;  3M9A A;  4XBF A;  2HXI A;  1D1B A;  2YX7 A;  1R00 A;  5GAH J;  4L5E A;  1D1C A;  2UV1 A;  2LOO A;  1I6X A;  2EFO A;  2W48 A;  4MO7 A;  1VQ6 I;  4LD5 A;  5HS9 A;  4A3B J;  2PMZ A;  1MBJ A;  3H3V K;  1S6L A;  1WH7 A;  4FE7 A;  4AIH A;  2O5R A;  1OJL A;  3HHG A;  3FWE A;  2QKO A;  2EH3 A;  5EFY A;  1X1B A;  4BAC A;  1X3U A;  4HNT A;  2JPB A;  5D18 A;  1IXC A;  1XMA A;  4NBQ A;  4IL6 C;  1U0J A;  2ID6 A;  1JJ6 C;  2NOJ B;  3V7S A;  3K4M A;  2QQ9 A;  3IP4 B;  4S0H B;  1R5G A;  1ZYR F;  2ZSH B;  4LIT A;  4ENK A;  2YVH A;  3EQL F;  1FX7 A;  1JUP A;  4P5O A;  1WJC A;  2EA4 A;  2I5U A;  2E1M C;  4IRV A;  2W84 A;  1LNW A;  2B0L A;  3G6E I;  2LY1 A;  1ETQ A;  3K8P C;  4W1U A;  2VT2 A;  2XB5 A;  2QEX I;  2M87 A;  3VYT B;  3IWF A;  2W4S A;  3E5U A;  4BE1 A;  3VW2 A;  1XB4 A;  1EF4 A;  1X1A A;  1UFM A;  1U2W A;  2QM3 A;  1KQ0 A;  1RES A;  3GO5 A;  4ZZL A;  5LRS A;  2QKL B;  3LWF A;  3GFI A;  2KDZ A;  1BW5 A;  2F5E A;  2R5Y A;  1NTC A;  1YIO A;  4Y3O A;  3CWR A;  2L7Z A;  2DXI A;  4XKB A;  5D8L B;  4AM3 A;  4BBS J;  3OYE A;  3HTA A;  5M5W J;  4D0P A;  5KAI C;  3V8J A;  1WZ2 A;  3ZN1 A;  4I02 A;  2QWT A;  2Y48 A;  4GFK A;  1J59 A;  3FZV A;  1I39 A;  3H5N A;  4PDK A;  4LFU A;  1AHD P;  2V9V A;  3IC7 A;  4LIU A;  4Y4R A;  1QGP A;  3DEU A;  5JVG F;  2FF4 A;  4P55 A;  1JHH A;  3ZMS A;  5LD2 C;  2QBY A;  1QPM A;  4KT6 A;  1H88 C;  3MN2 A;  3CCM I;  2B9S A;  3A01 A;  5DV5 A;  4N4N B;  2XGD A;  5FGL A;  3EYY A;  2A07 F;  1WJE A;  1DP3 A;  2VT3 A;  2ZXH A;  2DTR A;  3E0J B;  2M0M A;  3IRQ A;  5JI6 A;  1Z21 A;  3PM1 A;  4PFO A;  3BQZ A;  2BY2 A;  1Z0X A;  3I55 I;  1P4A A;  3KET A;  1KON A;  1ZGW A;  3DEW A;  2XAU A;  3ZXS A;  5IY5 H;  3FMQ A;  1K6O A;  2QIB A;  3HGY A;  2F5C A;  1MMG A;  1RKT A;  4KIS A;  1IRX A;  3QPL A;  2ZNY A;  2CUZ A;  2VON A;  1E3O C;  3G56 A;  1H9T A;  4DQ2 A;  2NXN B;  2EV5 A;  2O0Y A;  4LK1 F;  5CW8 A;  5GAG J;  4HSR A;  5JHU A;  1YIJ I;  3BG6 A;  4MQV A;  3UKG A;  4A0Z A;  1I5Z A;  3IH4 A;  2DMQ A;  5CQG A;  4IHT A;  2JK3 A;  3ABU A;  3ABT A;  2E34 A;  3CMM A;  4HNU A;  4BDY A;  1Z9C A;  2QUF A;  3K70 D;  3SZG A;  4EJU A;  3BTL A;  2B3W A;  2LTP A;  1GV2 A;  3VP5 A;  2JA6 J;  4E70 A;  2V26 A;  6PAX A;  2KRC A;  3J81 Z;  2HXO A;  2V1N A;  3IL2 A;  3HSE A;  1O57 A;  2UZK A;  1F1Z A;  4U87 A;  2LBF A;  2NVQ J;  4J01 A;  3VEP A;  1WI3 A;  2NP3 A;  2A6T A;  4M9Z A;  1O7F A;  5C3E J;  2DPD A;  2OF7 A;  4PSW A;  1SAU A;  1JT0 A;  3FMR A;  1DGW Y;  4XRS G;  3W2V A;  5GTI C;  1FPQ A;  4AC6 A;  4D9J A;  2O03 A;  1KU9 A;  3Q0W A;  2H8R A;  3M3Y J;  4EVI A;  2PX9 A;  5FHP A;  3PNT A;  2EK5 A;  3WOD F;  4Y13 A;  1WPK A;  1IRZ A;  2X85 A;  3OS0 A;  1I1S A;  4M6Y A;  2NVY J;  1F9N A;  4BDZ A;  5FB2 A;  4A69 C;  2P6T A;  3LNQ A;  4X6A J;  4FT8 A;  2IGO A;  5IYB J;  3JAM K;  1VFC A;  5IYC J;  4YFN F;  5ILV A;  2K4J A;  2KHM A;  5IP7 J;  3BT9 A;  2P5V A;  1G6N A;  2FML A;  5J6X A;  5KVR A;  1ZHF A;  3D5R C;  1YHQ I;  5TJJ A;  2VJJ A;  3A2K A;  1BN5 A;  3RSN A;  2VLA A;  5CVU A;  2O3F A;  5BNG A;  2R7O A;  3V7R A;  4P9F A;  2Z33 A;  4RAZ A;  3JRH A;  1IG7 A;  1R5I D;  3NXC A;  4GYG A;  5B1A H;  3N05 A;  2DA1 A;  3OYC A;  2R93 J;  2CW7 A;  4E7Z A;  3MD2 A;  2FOW A;  4RGR A;  4II3 A;  1CF7 A;  2B1E A;  1HA8 A;  1Y8R B;  5A2Q K;  3F72 A;  2DQL A;  4RM3 A;  2A3S A;  2M2E A;  5FD6 A;  5J1U A;  4F91 B;  5BQT A;  3E6B A;  3GZ5 A;  1XCB A;  2KIS A;  4AD9 A;  5FKL A;  2WV0 A;  1MDM A;  2HVR A;  4M74 A;  1U5T C;  2CU7 A;  3KCC A;  1YW7 A;  4CCJ A;  1ZR2 A;  2CW8 A;  2VJ5 A;  3JW4 A;  3A1Y A;  1PDN C;  3J7A Y;  3IAM 2;  4EJT A;  3ZR8 X;  4Y7N J;  2NP5 A;  2CQ7 A;  1W7P A;  1FP1 D;  3LSM A;  2ZME C;  2GA1 A;  3ZP5 A;  1S29 A;  2JT1 A;  4EMS A;  3HB9 A;  5FLX Z;  1XPX A;  1K6Y A;  2KZV A;  3R0J A;  2FU4 A;  1W5S A;  4IHV A;  1LEA A;  2E71 A;  4ENN A;  4IQJ A;  4BXF A;  4YIR X;  2Z5U A;  5IYD J;  1U5T B;  4XSX F;  1XCV A;  4EGZ A;  1OYW A;  1XX5 A;  5HLG A;  3HPH A;  3KYL A;  1GXP A;  2DJI A;  3DV8 A;  2DG7 A;  5HBU A;  3KP4 A;  1R36 A;  1KQ8 A;  1LDK B;  4ZTF A;  4HV6 A;  2VJI A;  2WC2 A;  4P1W A;  4ZYE A;  5L3C A;  2X1D A;  3SFI A;  5KNL A;  1TW2 A;  3RYR A;  2OZ6 A;  2ZME B;  1X3W B;  2QQB A;  4U7D A;  3PFI A;  3KKD A;  1SMT A;  3FXL A;  1XSX A;  4M3E A;  4Y17 A;  1TQM A;  1T6S A;  4OWR B;  3G1M A;  1WH5 A;  3S16 J;  3GFJ A;  1FP2 A;  4OU0 A;  4PSX A;  1OQY A;  4YEJ A;  4AIJ A;  2IAI A;  2BHY A;  1R1T A;  2UUZ A;  5F27 A;  4JL3 A;  1FYL A;  2HDD A;  1ZTR A;  2KJC A;  4XID A;  4GCL A;  1B1B A;  1SMY F;  4I6Z A;  3T8R A;  2K3P A;  4HX7 A;  1T0F C;  3LJL A;  4UV8 A;  5CLS A;  3QOP A;  1S3J A;  5D5X B;  2DMN A;  3KLO A;  2DOA A;  5H9T A;  4ABZ A;  2CYY A;  2Y9Y A;  1ENH A;  2CWE A;  2HQR A;  4G6T B;  2M4K A;  3G7R A;  5EYR A;  2XF6 A;  5J8C A;  3MZY A;  5CQE A;  1B72 A;  3IKV A;  4XN0 A;  2RRE A;  1EJ9 A;  2F5D A;  1TQP A;  3BRO A;  3CP8 A;  3P9I A;  5D5U B;  3KE2 A;  4WXD A;  5DD4 A;  3K69 A;  4PK4 A;  5E8G A;  1QVT A;  5F1J A;  1P2F A;  2XIG A;  2XC7 A;  3VYR B;  3VSL A;  4C3I J;  1YJW I;  3CTA A;  3M1C A;  3O6B B;  3F22 A;  2MC4 A;  3GF2 A;  2ZBK A;  3OSG A;  2WY8 Q;  4B43 A;  3OYM A;  3J7A O;  1J9I A;  2XDV A;  2ZY9 A;  5D19 A;  1A31 A;  4AUX A;  1G3S A;  3MZH A;  3IH3 A;  4DNC A;  2O7T A;  1XGO A;  4GFL A;  3JR9 A;  3VIB A;  4W97 A;  1D8J A;  1OFC X;  1MSF C;  3COA C;  4A3E J;  3BDD A;  2GA2 A;  3NEU A;  4GYI A;  4I0A A;  4BJ5 C;  4JX5 A;  4EEF G;  2XRO A;  1IN4 A;  4PZJ A;  3CJD A;  1MNE A;  2W85 A;  3ON4 A;  1KU7 A;  1IXR C;  1MBF A;  4BEH B;  3MKY B;  3PNV A;  2Y75 A;  4IF4 A;  2Q8K A;  1HDD C;  1UMQ A;  4HYE A;  1MNM C;  2VQL A;  3NQO A;  1S8N A;  4OOI A;  2ACJ A;  3QAH A;  4XN3 A;  4NUB A;  1BW6 A;  3S1Q J;  4C3H J;  2GZW A;  3BNI A;  3FXR A;  1TL8 A;  5DM7 F;  4HQE A;  2COB A;  3S2D J;  2JA5 J;  5HDN A;  3DTI A;  3KX2 A;  4YG2 F;  3G4S I;  1BOA A;  5H6Q A;  2STW A;  3Q9S A;  3J80 K;  2EZL A;  2MG4 A;  5C44 J;  4H0E A;  1JGG A;  1D5V A;  2NS7 A;  3GW2 A;  5EJC A;  5E3N A;  1G3T A;  4RB3 C;  2QQA A;  1W4M A;  4QLC U;  2WGB A;  5IPA A;  2MYS A;  1UCR A;  3QPS A;  4N9I A;  3FXM A;  3HTI A;  3ABL H;  3MZ8 A;  2L3D A;  1JI8 A;  4XLA A;  3TED A;  3LAJ A;  4YFX F;  2R7W A;  4D7M A;  1SD7 A;  5FKM A;  3EET A;  3E5Q A;  1H89 C;  3CO6 C;  5M3F J;  4C2M J;  2LRE A;  2GEN A;  1T95 A;  3DKW A;  1GVJ A;  1F5T A;  4FX0 A;  2XDN A;  3CUQ C;  2K9M A;  4I01 A;  3RKY A;  4CYD A;  4BXU A;  5DUK A;  2A68 F;  4BL0 B;  1IUF A;  1IV6 A;  2B63 J;  2IPQ X;  2I8D A;  1P6R A;  4M3D A;  1VQ8 I;  4HF1 A;  2FUG 2;  2COM A;  3A0B C;  3QU3 A;  1X58 A;  1FYK A;  4A3I J;  4NC7 A;  3RKX A;  3ZQG A;  3KZY A;  3SDB A;  4XR6 A;  2CUJ A;  4ANJ A;  2R5Y B;  1MJA A;  1HQC A;  3TMO A;  3GME A;  5FFZ A;  2QWW A;  3F8B A;  5E3M A;  1XSV A;  5HVQ C;  4BY1 J;  2H1K A;  2EBI A;  3I5U A;  2MBF A;  4GGG A;  1Y0N A;  1NK3 P;  5AON A;  4G8X A;  2LLK A;  3PSI A;  1HC8 A;  4OD4 A;  4L0Y B;  2QBY B;  3ANP A;  2E36 A;  1ACI A;  4L9N A;  1UAA A;  3NNR A;  2EIK H;  1E2X A;  4G7Z F;  3VDX A;  1ON1 A;  2FNP A;  2O61 A;  3FDY A;  2BY3 A;  2MW8 A;  1P7I A;  1XMX A;  2VPL A;  2H09 A;  3OWT A;  1ZRC A;  3C2G A;  2ETH A;  2XAQ A;  3QP6 A;  1QBJ A;  3GFM A;  4HRI A;  4UY8 I;  1BR1 A;  1RUN A;  1HOM A;  1V54 H;  4Z2Y A;  1IN6 A;  3JRG A;  3BZC A;  3BP8 A;  2DA4 A;  4BHB A;  3L00 A;  4HNV A;  1ULY A;  5LGU A;  4CUG A;  4C2U A;  4AIK A;  1IRG A;  1UG0 A;  2VBW A;  3MKZ A;  5IOY A;  3BTJ A;  3FK6 A;  3SZP A;  4HA8 A;  2CG4 A;  3SHF A;  1KYW A;  1ZK8 A;  2LK2 A;  5FD5 A;  2EFW A;  1I3Q J;  3OSF A;  5E17 F;  3VYS B;  4QIW N;  4ICH A;  3WTU C;  5DAJ A;  1ZRD A;  2L54 A;  4RGU A;  3FIW A;  4OIQ F;  4A6D A;  3CCQ I;  5GPA A;  1LB2 A;  3M7G A;  4JX4 A;  1YFH A;  2JQ7 A;  3M07 A;  4Y52 J;  3HTU A;  3DPJ A;  3ZOB A;  2LBF B;  4Q48 A;  4KYW A;  4G12 A;  3WE3 A;  3ZQL A;  2ZJQ F;  3NAU A;  3QRF F;  3HM5 A;  3MAJ A;  2JA8 J;  5LRR A;  4EM2 A;  2HFH A;  5EZG A;  3HPG A;  1SD4 A;  2QLZ A;  4KIF A;  5E3O A;  4ESF A;  1HW2 A;  2PMU A;  1WSU A;  1YIT I;  1QNT A;  2VQH A;  2FX0 A;  5D4R A;  1OYI A;  3WE2 A;  2HI3 A;  2HPI A;  3RQ4 A;  4M6V A;  2UXH A;  5F1R A;  3GTL J;  2D5V A;  1SEU A;  5D5V B;  5FRM A;  4OAY A;  3HKZ N;  3HSR A;  2NRA C;  4Q5S F;  3H3Z A;  1KYZ A;  2R0Q C;  3IWZ A;  3LAP A;  2FSW A;  1HKS A;  3DU5 A;  1MJB A;  4ESB A;  5EDN A;  1IO2 A;  2KIF A;  3CDL A;  2A5Y B;  1E3H A;  2MSY A;  3OOU A;  5AQC A;  1EKE A;  3F6V A;  3IRR A;  3CCS I;  4ACI A;  3VWB A;  3PNY A;  2EPF A;  3N97 A;  1Z91 A;  4A3D J;  3WU2 C;  3F8F A;  3LSP A;  4L5J A;  1XGS A;  3ELK A;  4GDF A;  1FIA A;  4BNC A;  1WQ2 A;  2ZNZ A;  1BOB A;  3DLA A;  5EG0 A;  4JQF A;  2OPT A;  2FRH A;  3I58 A;  4DYQ A;  4ZDL A;  3HEF A;  3FKI J;  2W7N A;  3WTX C;  1CF7 B;  4XM3 A;  3SFZ A;  1ZH5 A;  1IN8 A;  3BR3 A;  2E7W A;  2ECB A;  3E6D A;  4DBQ A;  3ML6 A;  1P92 A;  2CMP A;  4LMY A;  2P0W A;  2ZO4 A;  4X1E A;  1MDM B;  4BGD A;  3F6O A;  4KMF A;  3C07 A;  1R1V A;  4A5N A;  4ZH4 F;  1T2K A;  1K4T A;  1R4M B;  1W7P B;  2DI3 A;  3KPH A;  1SVM A;  3HUG A;  1NG7 A;  3E7Q A;  4U9N A;  2XAH A;  3CME I;  2RV8 A;  2MA3 A;  2BEO A;  3FM5 A;  5J1Y A;  2WAF A;  3BJO A;  3U21 A;  2X48 A;  1POG A;  2DN0 A;  3GZ6 A;  1IC8 A;  2HYF A;  3I9V 2;  1U8B A;  3HTJ A;  3VOK A;  1O4X A;  2KIQ A;  4RLF A;  3RPU A;  1LKX A;  1OCO H;  2TCT A;  2JSC A;  5H20 A;  1KZH A;  4CZC A;  3CCE I;  2NYX A;  2KIM A;  3CMY A;  4CDG A;  4MTD A;  2ICW G;  1VTN C;  1AKH A;  4ZDO A;  5CJ9 A;  3H9Q A;  3DQV C;  5FLM J;  1Z05 A;  3E6M A;  2P6S A;  2KP6 A;  1Q1V A;  2W1O A;  5D8K B;  4DGW B;  2ELK A;  4ITV A;  4QSH A;  4ZC3 A;  1SAX A;  4L9T A;  4XLN F;  2R4G A;  2Z3Y A;  4LK0 F;  5ICC A;  3JTH A;  5E20 A;  1Z1D A;  3TO6 A;  1YW9 A;  4HQM A;  4S04 A;  1N78 A;  2MC3 A;  4BU2 A;  3PPB A;  1MND A;  4LLG F;  2Z1D A;  1X1D A;  1SD5 A;  3QOE A;  3CC2 I;  2L01 A;  3CC4 I;  1MZB A;  3I59 A;  1O7L A;  2BV6 A;  2P8T A;  2VBX A;  4FTH A;  2MFZ A;  3MKL A;  4FAS D;  5IP6 A;  3M4O J;  2M5W A;  2YPR A;  2R7Z J;  3VVZ A;  2CV0 A;  1RIO H;  2HDC A;  4FIS A;  4HZF A;  1J2X A;  1B72 B;  4MIM A;  1HKQ A;  3RD3 A;  1MKM A;  2V7F A;  2AHQ A;  2EIN H;  2XF7 A;  3BCG A;  5HOO A;  1K78 A;  3V8K A;  3FBI B;  2NNY A;  4EQQ A;  2ZJR F;  2Z2S B;  4NQW A;  4HBL A;  2ZOY A;  2Y0S N;  1MGT A;  4RDU A;  2E1N A;  2D45 A;  3S1N J;  5L3G A;  4DYR A;  3W2A A;  2GOX B;  1RR8 C;  3Q3S A;  4M72 A;  4HX4 A;  4H4K C;  4E7J A;  3FKJ A;  4BQQ A;  5M3M J;  3K4J A;  2KT0 A;  2Z99 A;  1YX3 A;  1FOX A;  3X2Q H;  3ZCO A;  1OCT C;  3VPR A;  1V4R A;  3KEO A;  3ZMD A;  3ZQQ A;  2BW3 A;  3BR6 A;  3PIP F;  3SJM A;  4XLC A;  3PO3 J;  2KLO A;  2L7M P;  5KCM A;  3M8F A;  3JRF A;  3O3K A;  3BJA A;  4MNU A;  3ZQC A;  2VL8 A;  1YQA A;  2L5Q A;  3SZT A;  2DFH A;  2R7T A;  3LSI A;  3OYN A;  4IXA A;  3DTK A;  3FK7 A;  2DW4 A;  2KKO A;  2YUS A;  3D1N I;  4HPQ A;  1YG2 A;  2ECC A;  2OAZ A;  1J75 A;  9ANT A;  4MTE A;  5DCM A;  1CGP A;  1GLN A;  2XVC A;  3WHC A;  2GXG A;  3MQ0 A;  3MCZ A;  1J09 A;  1UST A;  2LFB A;  3ASN H;  3LMM A;  2HEO A;  2V9K A;  1I1G A;  2AS5 F;  3CUO A;  2EZI A;  4BUP A;  3JTG A;  3MEX A;  3OIQ A;  2HVS A;  1LDD A;  5J8F A;  2ZXJ A;  4RAG A;  3S1M J;  4I7H A;  2DLL A;  1P4X A;  3HHH A;  5FRN A;  1X19 A;  4XKC A;  2QYO A;  1FSH A;  4IHS A;  1ZQ3 P;  2Y31 A;  4LIV A;  4I2O A;  5E3L A;  3DF8 A;  3W6V A;  3C2H A;  3CZ6 A;  3WHB A;  4U88 A;  2VKE A;  4WX9 A;  2Y9Z A;  4JBA A;  2IA2 A;  2JVG A;  1SFE A;  3PAS A;  1V5E A;  2KIU A;  2MLG A;  5B3S H;  3CCR I;  1ZGA A;  3BPX A;  2P81 A;  2KFD A;  4JOM A;  4G94 A;  2HYG D;  2LKP A;  4A3F J;  1TW3 A;  3PSF A;  3HG9 A;  1XTA A;  1QZE A;  2RNJ A;  1V5F A;  2V57 A;  4CHU A;  3L2W A;  3VTI A;  4XNF A;  2BVL A;  1S7E A;  2MH9 A;  2E2H J;  1WRJ A;  2QSG X;  2V1D A;  4I99 C;  2W57 A;  4HKU A;  3A4C A;  2BGC A;  1G3W A;  5FO5 A;  3LA7 A;  3LQQ A;  4JP0 A;  1VQP I;  2JRM A;  3DLL F;  1K7A A;  4WF2 A;  2E19 A;  3VSK A;  1R4N B;  4XMY A;  2UXU A;  3BG5 A;  1R71 A;  5ERI A;  3G1O A;  1PUE E;  1XN7 A;  1FC3 A;  3JCU C;  5LHI A;  1PP8 F;  2UXO A;  2EIJ H;  5HOD A;  4AVZ A;  3DPL C;  2IT0 A;  2DA3 A;  4A93 J;  2E5N A;  2JSP A;  3B73 A;  3VVX A;  4G6Q A;  4NC6 A;  3GTG J;  2OTL I;  1MMA A;  1JXS A;  3LSR A;  2D1V A;  2QEN A;  4C2M A;  2FQ4 A;  3K7A J;  2VC1 A;  4LJZ F;  2OC6 A;  3BTC A;  3K4L A;  1C0W A;  5EZH A;  4A3K J;  4WXH A;  3ZQF A;  4EGY A;  1YW8 A;  3CCY A;  3I71 A;  2LSO A;  1U8R A;  2OV7 A;  4HF0 A;  2DU9 A;  2DDB A;  1LEB A;  2X0L A;  1EH8 A;  4O3M A;  2BZT A;  2JA7 J;  2K86 A;  3WG7 H;  1ZKG A;  3IKT A;  1O3Q A;  2A61 A;  2K9S A;  4AWX B;  3LSG A;  1P4W A;  2EIM H;  1I50 J;  5K7H A;  4BXX J;  1S7A A;  4UB8 C;  5HLH A;  3ROU A;  1ODD A;  1SC7 A;  1X4P A;  2GIZ A;  3M8E A;  5CVV A;  4CSW A;  1Z3Y A;  5HNH A;  2VBZ A;  2E35 A;  3B02 A;  4FE4 A;  4PUS A;  1QU3 A;  1D3Y A;  2DK8 A;  4GCV A;  2K85 A;  4UXN A;  3GYH X;  5J47 A;  1X1P A;  1LPQ A;  2DYS H;  3BC8 A;  3S93 A;  5L3F A;  3Q0V A;  1FNN A;  3T8T A;  2GXB A;  2CQQ A;  3P5J A;  3HOU J;  4PJJ A;  4XRF A;  1WJA A;  2BHZ A;  2HGC A;  5AIP A;  5HDG A;  1QRY A;  4CH7 A;  3CJT B;  4EV0 A;  2CH0 A;  5A2Q Z;  1MIJ A;  1XDU A;  1OCC H;  2DMT A;  4XRS A;  2H8W A;  5L3E A;  4E7I A;  1F4K A;  1YX5 A;  1ERD A;  1MH3 A;  1IGN A;  3FIS A;  2OER A;  1D5Y A;  3FBN B;  2VOO A;  2F2E A;  3RCO A;  1VQO I;  3T5X A;  1GHC A;  1VQN I;  3P7N A;  4OMY A;  2Q2E A;  2ZCN A;  1IUY A;  1IF1 A;  1A04 A;  1MMD A;  3HOS A;  2AXT C;  4KN4 X;  4L18 B;  2Z16 A;  5L3B A;  1JKP C;  3LWJ A;  3GZN B;  5GP9 A;  1FTT A;  3ECH A;  2PEX A;  3K4C A;  5CKT A;  4FX4 A;  2L2O A;  2L9N A;  5JHF A;  3ZGK A;  3LSK A;  3I4M J;  4PJ0 C;  3K2Z A;  3MWM A;  3F3X A;  3VUQ A;  3KIO A;  3L9F A;  2E1O A;  2ESH A;  4UHT A;  2W24 A;  3C2B A;  3HOX J;  3D5S C;  4IRI A;  3PO2 J;  4CGZ A;  4AF5 A;  3TOA A;  1MMN A;  1B9N A;  3BHQ A;  2F4M B;  3KP6 A;  1RUO A;  1WVR A;  2CO5 A;  3AQT A;  4XOP A;  3HE0 A;  4V19 K;  2PI0 A;  2LMD A;  1O3R A;  1FBU A;  1JT6 A;  3PUF A;  1DGR M;  1RPW A;  1FIP A;  1HDP A;  1QHH D;  2G0E A;  4PGH A;  3F9K A;  1PYV A;  2M0C A;  3W2W A;  5FLX K;  3ZMZ A;  1G4D A;  4FQG A;  1FOY A;  5ILU A;  2O8K A;  5DS9 A;  2WUI A;  4OIP F;  3KP2 A;  5K7F A;  3K4K A;  3I3L A;  1LE8 A;  1OCP A;  1JE8 A;  2MLK A;  1XD7 A;  1Z7L A;  2E7X A;  2LKX A;  5FGM A;  2G7G A;  1BI2 A;  3K4B A;  5EG0 B;  1XMK A;  1D8K A;  1ONV A;  3OYJ A;  3DKY A;  4JYK A;  5LHG A;  2M8G X;  2K7L A;  1YJ9 I;  2UXN A;  1MBK A;  1BL0 A;  1MW7 A;  2EA2 A;  5HNF A;  1A5J A;  3BPV A;  1MSE C;  3VB2 A;  1XSD A;  3BY6 A;  1JKQ C;  2MH2 A;  1TTY A;  4DZJ A;  3BJB A;  4UUS A;  2HU9 A;  2I10 A;  2P5K A;  3SXY A;  3H36 A;  4RGS A;  2X6O A;  5DYM A;  2TRT A;  3BR0 A;  1N25 A;  3HUG B;  4KT5 C;  5D5W B;  1FSE A;  3QOD A;  3ZN0 A;  2KL4 A;  3LA3 A;  3TW6 A;  5D6F A;  3RH2 A;  1ETV A;  3QYE A;  5BS6 A;  1OLT A;  3S3M A;  2GIV A;  4M3G A;  3NAR A;  2MGQ A;  2K4B A;  2K5C A;  3NWT A;  1TQI A;  2WA0 A;  1BIB A;  5F08 A;  2F07 A;  2F4I A;  2MD5 A;  1NH3 A;  2MAB A;  2IP2 A;  4BAY A;  4XIC A;  3CCU I;  3OIO A;  5FLV A;  1BBY A;  3OYB A;  4ZYG A;  1AKH B;  1OR7 C;  3F8C A;  4PXI A;  3BG7 A;  5JR3 A;  5JLW A;  2E2J J;  2D6Y A;  2DA5 A;  3NRV A;  2NVU B;  5GPC A;  2HVQ A;  2ZB9 A;  1X4O A;  3ECO A;  3WTW C;  3MFK A;  1S5L C;  3AG3 H;  1USS A;  2ELH A;  3AG4 H;  4E6K G;  5J40 A;  4LGW A;  5HAW A;  3RPQ A;  2JUC A;  1JKO C;  2D2W A;  2OCC H;  4M71 A;  1TWH J;  2JWT A;  2RKH A;  2XRN A;  4BYY A;  4Q4Z F;  4XKV A;  1AOY A;  2IA0 A;  4BE0 A;  1K4S A;  2GBY A;  4L5I A;  3OS1 A;  3J80 Z;  4QPQ A;  3I59 B;  3BG3 A;  2DPU A;  3GTP J;  2H94 A;  5TRD A;  2PMH A;  2OI8 A;  5B66 C;  1Z3X A;  1FT9 A;  2FD5 A;  2FXA A;  1IAW A;  2KJB A;  4G6D A;  2DBB A;  2H6C A;  5J3L A;  1WWX A;  3P9C A;  1PUF A;  2PJR A;  2X9D A;  3QWL A;  1UG2 A;  1VQM I;  3J7Y J;  1JUS A;  5H2F C;  4C3J J;  4EAT A;  2P5L C;  3Q5F A;  1JHF A;  3R6S A;  4EJW A;  1K78 B;  3W3C A;  2C6Y A;  4NQW B;  4A6E A;  5LFA A;  5B1B H;  2PZ9 A;  1ETK A;  2L9R A;  3KNW A;  1V55 H;  1YYV A;  5EEA A;  3V42 A;  3I53 A;  2HPM A;  2UXP A;  2PG4 A;  1K83 J;  4N0B A;  1Z67 A;  4DIQ A;  2XPV A;  4WIB A;  5BPI A;  2A6E F;  3PQK A;  2PLY A;  1O3S A;  2OJE D;  4F93 B;  2BW3 B;  2V9P A;  2J5O A;  3OL3 A;  5IT9 K;  5FRO A;  3ONQ A;  3QBM A;  4Y15 A;  3BZ6 A;  4RGX A;  4WCG A;  4D5F A;  1E17 A;  4G7O F;  2YR2 A;  2XKP A;  3I4N J;  1FMV A;  4HEA 2;  2LP0 A;  2HQN A;  3FHZ A;  1RKW A;  2VJ4 A;  2X6W A;  2R7V A;  1P9Q C;  4UVC A;  2G9W A;  2X1C A;  1ITY A;  4CCN A;  1G2H A;  3KEY A;  2VKD A;  4ENJ A;  1G3Y A;  3EYI A;  1R7J A;  1PP7 U;  4RMN A;  3TOB A;  1DU6 A;  5DCM B;  5CXG A;  2IJL A;  4XKW A;  3HYI A;  5H6R A;  5HDK A;  2CQX A;  5EEG A;  2L4A A;  4FET A;  1IN7 A;  4NN1 A;  4AC0 A;  2OA4 A;  3RZO J;  4BQO A;  4ZJZ A;  1U6G A;  5BPD A;  2NVX J;  1W0U A;  1BM9 A;  1TWF J;  3SEZ A;  1RNL A;  2R7U A;  5F0F A;  5E18 F;  4BHC A;  4A3C J;  1FJL A;  4FHT A;  1J7K A;  2FEZ A;  4AID A;  1WCM J;  4A3G J;  3A01 B;  2IS2 A;  4ME9 A;  4CXF A;  2O6G E;  2RQQ A;  4MEY F;  3VOE A;  5BOX A;  3S2H J;  1YE9 A;  3RKW A;  2HKO A;  3GTJ J;  2A2F X;  3HRU A;  2DDA A;  2VI6 A;  3C7J A;  3K1M A;  4P96 A;  4V2G A;  2REK A;  1HBX G;  1TNT A;  1FMW A;  5J4Y A;  2PBX A;  3DEE A;  2O7O A;  2NAZ A;  3NS4 A;  3KFW X;  2X6Y A;  4IJA A;  3TGN A;  2KZG A;  4LG0 A;  3N4M A;  1V3F A;  2E1C A;  2PFB A;  3ZQH A;  4RAY A;  3S2W A;  2FBK A;  5ED4 A;  3K6G A;  2XPU A;  4MFE A;  3W6K B;  3GTQ J;  5F0H A;  4IOA F;  4GCT A;  4TV7 A;  4BJT A;  3ISP A;  3E5X A;  3TO9 A;  3AL0 B;  2XGC A;  5FJ8 J;  4ZYA A;  3ESW B;  4GFB A;  2LVS A;  1XGN A;  1GUU A;  1OMI A;  4NDL A;  3CCL I;  2QSF X;  2X1E A;  2R5Z A;  2VE9 A;  3UR3 C;  4A3L J;  1SFK A;  3QQA A;  4E7L A;  3DTE A;  4Q47 A;  4PCQ A;  1MH4 A;  2BXY A;  2GQQ A;  2PMZ N;  4M9X A;  4RB1 A;  2GUH A;  2R7S A;  3P9T A;  2W25 A;  2DT5 A;  1I6H J;  1N75 A;  1FBQ A;  4KA4 A;  5ICF A;  2XUB A;  4DBR A;  2PFV A;  5ICE A;  1SAN A;  1Y0U A;  1A6Q A;  1XDS A;  4MGR A;  1SGM A;  1RR7 A;  4XLE A;  2GOM A;  1Z77 A;  1R23 A;  4M3F A;  3HC7 A;  2WY7 Q;  2M7A A;  2XB0 X;  4ZDP A;  1Z6R A;  3KZI C;  2CW0 F;  2ISY A;  4JK1 X;  1Y39 A;  3ZPL A;  2ELJ A;  2H1L A;  5GAD J;  3CDI A;  3GCM A;  2X4H A;  3HGG A;  3KYC B;  1KU2 A;  2FJ1 A;  1UEL B;  3KP3 A;  1XC5 A;  2WBM A;  5CYV A;  4NC8 A;  4YRV A;  2ZCX A;  3FXQ A;  4OMZ A;  3AG1 H;  3KEQ A;  1R9T J;  1FWZ A;  1B59 A;  2VBY A;  1EH7 A;  5LHH A;  2N8G A;  1KGS A;  5D1R A;  3CP2 A;  1IW7 F;  4HG2 A;  3WTT C;  3D0S A;  2FBH A;  4MLO A;  3F0C A;  3H9J A;  3TL4 X;  1H9G A;  3JRI A;  2RC4 A;  3F8N A;  2CQK A;  3DBH B;  2X51 A;  4YIF A;  2CGP A;  3QYF A;  3RTR A;  2PN6 A;  2KDO A;  2ZME A;  5JLX A;  2OD5 A;  1GT0 C;  3JRB A;  1QQI A;  4IOC F;  3H92 A;  1IV8 A;  4KIC A;  3OOP A;  5FKO A;  3OMY A;  3HRM A;  4HDU A;  2DG8 A;  5E8I A;  1SVO A;  1SFX A;  3FXU A;  4LLN A;  2YX4 A;  2Q2E B;  2A05 A;  2A6H F;  2RAE A;  4OIN F;  1TWG J;  5IOZ A;  5IT3 A;  3V6G A;  3C1D A;  2CS3 A;  3V4G A;  2ME6 A;  5D6E A;  3I56 I;  2QSH X;  1JJ8 C;  4BHP A;  3CF2 A;  4B3A A;  4RBO A;  2ME0 A;  1FOK A;  4WXC A;  2LC2 A;  2F48 A;  4BY7 J;  4I0B A;  1UJ8 A;  3K10 A;  4BJ6 C;  5LGN A;  3LFU A;  3HJE A;  3OYG A;  2FBQ A;  1F36 A;  5KK1 A;  4K2E A;  1AWC A;  2HYT A;  1SD6 A;  2IVM A;  4DOZ A;  1IXS B;  1Z7U A;  3CES A;  4BH9 A;  4KJZ A;  5LLQ A;  5LBQ A;  1HKT A;  3IH2 A;  1D0X A;  2B7E A;  2DMP A;  2V1X A;  3EUA A;  1XG1 A;  3NI7 A;  5K58 A;  2DJN A;  4XOT A;  2OZU A;  3BCB A;  3LSJ A;  3LHQ A;  4BS9 A;  3FXO A;  4ZZD A;  3GTO J;  2LF7 A;  2WAQ N;  4HW0 A;  4YEL A;  4LLL A;  4KFC A;  2RVC A;  1T33 A;  5K5R A;  3WGH A;  2LD5 A;  5TIS C;  4B48 A;  4CIC A;  1WFX A;  4HX8 A;  1LE8 B;  1T56 A;  4B8X A;  1B8I A;  3R61 A;  3BR2 A;  2FOK A;  4BE2 A;  2CUF A;  1ORK A;  1ETW A;  2K27 A;  2QVO A;  3OR1 C;  1GDT A;  1FZP B;  4OIO F;  3K4N A;  4A2U A;  4U9L A;  2LYC A;  2G3B A;  1EH6 A;  1T98 A;  3QYB A;  1YRN A;  3I64 A;  1VI0 A;  3MVP A;  3GFL A;  2WWY A;  4RS8 A;  1U3E M;  2XAG A;  5B5E C;  1E3P A;  4AYB N;  1B4A A;  2F4O B;  2KRF A;  4CO8 A;  4ZTJ A;  4XON A;  2K02 A;  3CCJ I;  3H0D A;  1LFU P;  4R79 A;  1J0R A;  3OS2 A;  1KQ9 A;  4UUS B;  2CV1 A;  1ZLJ A;  1IRF A;  1UB9 A;  3F23 A;  1VQK I;  2Q24 A;  4D5C A;  1MJ9 A;  2DFE A;  1BC7 C;  1QZZ A;  4HAM A;  3ZMU A;  3PIO F;  2JPC A;  4ASN A;  3JRE A;  2Y2Z A;  3KKC A;  2ZXW H;  4R1H A;  5LEK A;  4F3Q A;  1ZGJ A;  4KUM A;  2XHK A;  4IPA A;  2PBI A;  1MMS A;  3E7L A;  2F6C A;  2BY0 A;  1R5H A;  2ZCW A;  3S1R J;  5F0C A;  4EJO A;  3SYT A;  3HL2 A;  2FA5 A;  2DCE A;  4F52 A;  1AU7 A;  3ZRG A;  3QU6 A;  3DFG A;  3QPT A;  3RI4 A;  4YZE A;  3QP5 A;  4HLX A;  3J7Z I;  2YS9 A;  2LR8 A;  1FY7 A;  1WHU A;  3CLQ A;  4DW6 A;  4I98 B;  3PFY A;  2CSO A;  4CYC A;  2CFX A;  3ZMV A;  4EJV A;  3VW0 A;  2XAF A;  1DU0 A;  2X6X A;  1Y1W J;  5D4S A;  2ZOZ A;  4U7B A;  4I09 A;  2IEK A;  1NHA A;  2RQP A;  3HTS B;  2IGN A;  2M7B A;  4QTR A;  5DEQ A;  1K79 A;  3HKZ A;  1UHS A;  2VQC A;  2VXZ A;  3COL A;  5C4Y A;  1PVE A;  3M8J A;  2BVM A;  1U9N A;  3BTI A;  2XV4 S;  5KAF C;  3DCF A;  2PJP A;  3H9G A;  1RC9 A;  3D5L A;  1G59 A;  2L7F P;  2WV1 A;  4KIT B;  4OIR F;  2YSR A;  4UNO A;  1WKM A;  5AIQ A;  4KWA A;  2L9S A;  1VND A;  1PUF B;  2XAJ A;  2PJR B;  3SDG A;  3E97 A;  2EV0 A;  4F55 A;  2R7D A;  3CUQ A;  5M5X J;  2JMW A;  3LFK A;  3GEU A;  5FFX A;  3BG9 A;  2Q1Z B;  3F8M A;  3TP3 A;  2E1M B;  1A35 A;  3G73 A;  2P7V B;  3DBL B;  2K9N A;  1VQ7 I;  2Y0M A;  4B47 A;  1IN5 A;  1ZN2 A;  2EZK A;  1W1W E;  2O9L A;  2OQG A;  3OYK A;  1F43 A;  2HZD A;  4D1Q A;  1BJA A;  3L1P A;  3HOT A;  4B4C A;  2CFO A;  5E1X A;  2JA2 A;  3HZJ A;  5C4X J;  1E0E A;  3ERM A;  2AQE A;  3EGQ A;  3A02 A;  2BOL A;  5HSZ A;  2YU3 A;  4XLP F;  1TT5 B;  5FKN A;  2HS5 A;  4IQ4 A;  2VOP A;  3PUB A;  2BBY A;  4IKF A;  3HXL A;  4Z6Y A;  1RET A;  3UNG C;  4MQ9 F;  3LA2 A;  4FCY A;  4NHJ A;  1OIS A;  2VUM J;  1D0Y A;  2OU2 A;  3I4P A;  3AFH A;  1RZ4 A;  3P9K A;  4XSZ F;  5BMZ A;  4JX6 A;  2GLO A;  1UZC A;  3BOQ A;  1MBG A;  4ON0 A;  2G7H A;  1WGX A;  1W7P D;  3R60 A;  5LEJ A;  3PQJ A;  3AKZ A;  2VIX A;  3GZI A;  3FM3 A;  3ABK H;  3GX4 X;  2YU9 J;  2VPR A;  2HTJ A;  3OYD A;  1X1C A;  3WU0 A;  1BIA A;  3E1S A;  1BJZ A;  1KA8 A;  3M1E A;  3IUV A;  3S32 A;  1UHW A;  3JAM Z;  1X3Z B;  2DOF A;  2QF7 A;  3ANG A;  2WAQ A;  2EFN A;  3L2U A;  3J81 K;  1W0T A;  4J19 A;  1LJ9 A;  1M1E B;  3NPI A;  2IU5 A;  2ZSI B;  3BWG A;  1MD0 A;  4RAF A;  4A3J J;  1TLH B;  1QVU A;  3JSO A;  1VZ0 A;  3DWL E;  2HKX A;  1S72 I;  3CLO A;  1VQ5 I;  5IP9 J;  4GXO A;  1IZ1 A;  1ON2 A;  5DCF A;  4CCM A;  2M34 A;  4B1R A;  4MEX F;  3NWS A;  2DT7 B;  2DA7 A;  5C4J J;  2QCO A;  2YVX A;  3TBI A;  2HQ5 A;  2KMU A;  4AYB A;  2DOD A;  2J5P A;  4ZYD A;  1A36 A;  2YVE A;  1SFO J;  4LG0 B;  1BA5 A;  3HIF A;  5EGO A;  1YJN I;  2A5W A;  3L09 A;  4M3B A;  2VAS A;  3C18 A;  1PJR A;  2L02 A;  3F1B A;  2M9H A;  2W82 A;  3O8G A;  3CDH A;  2OCE A;  1A6I A;  1TZL A;  2LH9 A;  2Y0S A;  4U0V A;  3B81 A;  4NEL A;  4CGR A;  4LOC A;  4GCK A;  4XRM A;  3KLN A;  3R0A A;  2AQF A;  5ILS A;  3S5R A;  2VC0 A;  2R5Z B;  3RZD J;  3O2P E;  2TDX A;  1YOV B;  3JRA A;  1Y1V J;  3L7W A;  2WTE A;  2Q0O A;  4G9Y A;  3NRG A;  4IHX A;  4IX7 A;  3S15 J;  1HF0 A;  1QZY A;  2DQR A;  4O5V A;  3VW1 A;  4E7K A;  1ETO A;  4UUT A;  2RDP A;  3DP7 A;  1ETY A;  1OCZ H;  2Y30 A;  4GRI A;  5EEH A;  5EF6 A;  3RKQ A;  3GUD A;  5E1W A;  1AA7 A; 
#chains in the Genus database with same CATH homology
 1FIA A;  2KDZ A;  1RES A;  5EG0 A;  2NX4 A;  2OPT A;  4I76 A;  1BW5 A;  2R5Y A;  4DYQ A;  1NTC A;  3CWR A;  3HEF A;  3FKI J;  2L7Z A;  3QBM A;  1TWC J;  4BBS J;  3HTA A;  4D5F A;  5M5W J;  2QWT A;  4GFK A;  3BR3 A;  2ECB A;  1AHD P;  3I4N J;  2LP0 A;  1U78 A;  1RKW A;  4X1E A;  2EQR A;  1H88 C;  2CRG A;  1ITY A;  3MN2 A;  1G2H A;  3A01 A;  3C07 A;  2XGD A;  2ID3 A;  5FGL A;  1DU6 A;  5CXG A;  2CQX A;  1JTX A;  3E7Q A;  3V78 A;  4NN1 A;  3PM1 A;  4AC0 A;  3RZO J;  4UDS A;  3BQZ A;  2HOA A;  1Z0X A;  4V2F A;  5J1Y A;  1ZGW A;  3DEW A;  2NVX J;  1W0U A;  2QIB A;  3HGY A;  1TWF J;  1RKT A;  2X48 A;  1POG A;  2DN0 A;  5F0F A;  1IC8 A;  4A3C J;  1FJL A;  3QPL A;  1U8B A;  3HTJ A;  3JRD A;  3VOK A;  1E3O C;  2RHA A;  1WCM J;  2XRL A;  1O4X A;  4A3G J;  3A01 B;  3G56 A;  4ME9 A;  3G1L A;  5CW8 A;  1UI5 A;  1MBE A;  2TCT A;  4JNN A;  3B6A A;  2DMU A;  3UKG A;  3S2H J;  3HOV J;  3IH4 A;  3CMY A;  2DMQ A;  2JK3 A;  3GTJ J;  1AKH A;  2VI6 A;  4V2G A;  2REK A;  5FLM J;  3BTL A;  2LTP A;  1GV2 A;  2LY9 A;  2JA6 J;  2GFN A;  2HXO A;  2PBX A;  4MXM A;  1Q1V A;  2O7O A;  2ELK A;  4QSH A;  2NVQ J;  5CXI A;  1IJW C;  1WI3 A;  1HLV A;  1NK2 P;  2NP3 A;  3ZQH A;  5C3E J;  2OF7 A;  3PPB A;  2XPU A;  4MFE A;  3GTQ J;  1JT0 A;  5F0H A;  2G7S A;  4XRS G;  4GCT A;  4AC6 A;  4FTH A;  2XGC A;  3MKL A;  5FJ8 J;  3Q0W A;  4DYC A;  2AO9 A;  2H8R A;  3M3Y J;  4GFB A;  2LVS A;  1ETX A;  5IP6 A;  3M4O J;  1GUU A;  2HOS A;  1QPI A;  2R7Z J;  5FHP A;  4NDL A;  2R5Z A;  1IRZ A;  1WPK A;  4FIS A;  2R92 J;  3QQA A;  4A3L J;  3O60 A;  2NVY J;  1XS9 A;  1B72 B;  1MH4 A;  3P9T A;  2PMZ N;  4MIM A;  5F04 A;  2GUH A;  3RD3 A;  4A69 C;  2AHQ A;  3LNQ A;  1I6H J;  5IYB J;  1B8I B;  4X6A J;  3BCG A;  1VFC A;  5IYC J;  1SAN A;  2ZOY A;  2Y0S N;  3T6N A;  4RDU A;  5IP7 J;  2E2I J;  3S1N J;  1RR7 A;  3TW7 A;  3BT9 A;  4DYR A;  1SGM A;  1YRN B;  1Z77 A;  3Q3S A;  1H8A C;  4M3F A;  4L62 A;  2XB0 X;  2HYJ A;  3A03 A;  5BNG A;  5M3M J;  2KT0 A;  3HGG A;  3JRH A;  1IG7 A;  3NXC A;  2FJ1 A;  2DA1 A;  1OCT C;  3VPR A;  3SJM A;  2R93 J;  1XC5 A;  3BR6 A;  3PO3 J;  2ZCX A;  1X2M A;  1TWA J;  4A3M J;  2DTZ A;  2L7M P;  1R9T J;  3JRF A;  4JKZ A;  3ZQC A;  2M2E A;  2N8G A;  5J1U A;  5D1R A;  5FKL A;  3GBG A;  2CU7 A;  3FK7 A;  2YUS A;  4XK4 A;  1ZR2 A;  3D1N I;  4MLO A;  2ECC A;  3F0C A;  9ANT A;  3JRI A;  2IBD A;  4Y7N J;  2NP5 A;  1JUM A;  3WHC A;  2RAS A;  3HOY J;  2LFB A;  5JLX A;  1GT0 C;  3JRB A;  1IDZ A;  3AQS A;  3HB9 A;  2EZI A;  4IHV A;  3S1M J;  2NS8 A;  5FKO A;  1ZR4 A;  2DG8 A;  5IYD J;  1ZQ3 P;  3S17 J;  2Y31 A;  4CYC B;  5HBU A;  2K40 A;  2DG7 A;  5E3L A;  2RAE A;  1TWG J;  5IOZ A;  3W6V A;  3V6G A;  3WHB A;  2VKE A;  3H0G J;  2ME6 A;  3SFI A;  2Y9Z A;  1JJ8 C;  3PAS A;  4B3A A;  2HOT A;  4RBO A;  3KKD A;  2ME0 A;  2L0K A;  2P81 A;  4M3E A;  1VF9 A;  4BY7 J;  1CQT A;  2UXI A;  4A3F J;  3G1M A;  3B6C A;  1WH5 A;  1F36 A;  2CUE A;  3S16 J;  1FTZ A;  2FBQ A;  2IAI A;  2EZH A;  2V57 A;  2HYT A;  5F27 A;  4JL3 A;  2HDD A;  1JKR C;  1ZTR A;  4GCL A;  4XID A;  3IV5 A;  1S7E A;  2E2H J;  3HTH A;  3VP5 A;  1JTY A;  4I6Z A;  4HKU A;  3HOW J;  3CQZ J;  3IH2 A;  4JP0 A;  2XPW A;  2E19 A;  3LJL A;  2DMP A;  1XG1 A;  2UXU A;  3NI7 A;  3BG5 A;  5K58 A;  2DJN A;  2WB1 N;  3G1O A;  5J1R A;  2DMN A;  3LSJ A;  3LHQ A;  5H9T A;  3LOC A;  4ABZ A;  2Y9Y A;  3GTO J;  2UXO A;  5HOD A;  1ENH A;  2WAQ N;  3G7R A;  5EYR A;  2NVT J;  1T33 A;  3TP0 A;  2DA3 A;  4A93 J;  2LD5 A;  4IHY A;  2XSD C;  1B72 A;  3VVX A;  3BQY A;  1LE8 B;  3GTG J;  2JJ7 A;  1T56 A;  1B8I A;  3KZ9 A;  3BR2 A;  2CUF A;  3LSR A;  1ORK A;  1ETW A;  1GDT A;  2FQ4 A;  3K7A J;  2G3B A;  1YRN A;  3FRQ A;  1QVT A;  5F1J A;  1VI0 A;  3BTC A;  3MVP A;  5EZH A;  4A3K J;  3ZQF A;  3CCY A;  5DTD A;  3HBL A;  4C3I J;  4AYB N;  2JA7 J;  1ZKG A;  1LFU P;  3OSG A;  2GM4 A;  1APL C;  3O8H A;  2K9S A;  3LSG A;  1I50 J;  5K7H A;  4UUS B;  4BXX J;  5D19 A;  4AUX A;  4GFL A;  3IH3 A;  2O7T A;  2Q24 A;  3VIB A;  4D5C A;  3JR9 A;  4W97 A;  2CJJ A;  1OFC X;  1TC3 C;  5FKK A;  1MSF C;  4FE4 A;  4A3E J;  3JSJ A;  3ON4 A;  4JX5 A;  1IDY A;  4EEF G;  3CJD A;  3GTK J;  3VVZ A;  1MBF A;  3JRE A;  2Y2Z A;  3Q0V A;  3KKC A;  2CQQ A;  3HOU J;  3HIM A;  1HDD C;  1UMQ A;  1MNM C;  4D7N A;  1QRY A;  4MK6 A;  1GVD A;  1GV5 A;  3E7L A;  2DMT A;  4XRS A;  1X2N A;  3S1R J;  5F0C A;  2NOG A;  3MNL A;  1MH3 A;  1AU7 A;  4BKX A;  1HCR A;  1BW6 A;  3FIS A;  2DA6 A;  4C3H J;  1IGN A;  3S1Q J;  2OER A;  3BNI A;  1D5Y A;  2COB A;  3S2D J;  4YZE A;  2JA5 J;  2YS9 A;  2LR8 A;  4DW6 A;  4CYC A;  3VW0 A;  2ZCN A;  2EZL A;  2MG4 A;  5C44 J;  1JGG A;  1DU0 A;  1Y1W J;  2NS7 A;  2ZOZ A;  5E3N A;  4BBR J;  3HOZ J;  3HDD A;  1JKP C;  2WGB A;  5IPA A;  3LWJ A;  2IEK A;  3QPS A;  5GP9 A;  4QTR A;  3S14 J;  2W53 A;  3BRU A;  1FTT A;  3HTI A;  1FEX A;  4IHW A;  5EGO B;  1UHS A;  3COL A;  5C4Y A;  3I4M J;  3TED A;  3GTM J;  1U9N A;  3BTI A;  3DCF A;  2G7L A;  4D7M A;  3VUQ A;  5FKM A;  2E1O A;  2L7F P;  2WV1 A;  3EUP A;  3RQI A;  3QKX A;  1U9O A;  3C2B A;  3HOX J;  1H89 C;  3PO2 J;  5M3F J;  2VKV A;  4KWA A;  3VVY A;  4AF5 A;  1VND A;  1PUF B;  4C2M J;  2GEN A;  3SDG A;  3BHQ A;  2QTQ A;  3AQT A;  3HE0 A;  5AQC A;  3GEU A;  5M5X J;  2JMW A;  2XDN A;  3BG9 A;  1JT6 A;  3TP3 A;  2XGE A;  4MFD A;  1RPW A;  3JRC A;  1FIP A;  1HDP A;  2G0E A;  3ZQI A;  4DZP A;  2K9N A;  2M0C A;  2HKU A;  1IUF A;  1IV6 A;  2B63 J;  2O8K A;  5DS9 A;  3BR5 A;  2EZK A;  2JN6 A;  2WUI A;  2O9L A;  4M3D A;  5K7F A;  1F43 A;  1LE8 A;  3Q0U A;  1OCP A;  1X58 A;  1LFB A;  3L1P A;  4A3I J;  4B4C A;  5M5Y J;  2LKX A;  5C4X J;  3ZQG A;  2G7G A;  5EG0 B;  3VOX A;  2R5Y B;  3EGQ A;  3CRJ A;  3A02 A;  5HSZ A;  4JYK A;  2M8G X;  5FKN A;  5E3M A;  4BY1 J;  2H1K A;  2EBI A;  1MBK A;  1NK3 P;  1BL0 A;  1A5J A;  3ON2 A;  1MSE C;  2LLK A;  1RET A;  1UI6 A;  1JKQ C;  3ANP A;  2QOP A;  4FCY A;  2VUM J;  4DZJ A;  3NNR A;  3BJB A;  4UUS A;  4JX6 A;  5K7Z A;  1K61 A;  2GLO A;  1MBG A;  2I10 A;  1WGX A;  2MW8 A;  2X6O A;  1P7I A;  2TRT A;  3BR0 A;  3GZI A;  2YU9 J;  2VPR A;  1HOM A;  3BR1 A;  3TW6 A;  3JRG A;  5FMP A;  3RH2 A;  2K9Q A;  1ETV A;  2DA4 A;  1BJZ A;  4M3G A;  4HNV A;  3IUV A;  1MBH A;  3NAR A;  2MGQ A;  3ANG A;  2QF7 A;  5IOY A;  5F08 A;  3BTJ A;  3FK6 A;  2ZCM A;  2DA2 A;  4IEJ A;  4J19 A;  1W0T A;  2F07 A;  1ZK8 A;  2LK2 A;  3NPI A;  2IU5 A;  1I3Q J;  3OSF A;  4XIC A;  4A3J J;  4QIW N;  3OIO A;  1QVU A;  5FLV A;  4ICH A;  1P7J A;  5DAJ A;  5IP9 J;  3FIW A;  1AKH B;  5GPA A;  4PXI A;  5JLW A;  2E2J J;  2D6Y A;  4JX4 A;  2M34 A;  2DA5 A;  3K2A A;  4B1R A;  5GPC A;  2ZB9 A;  2DA7 A;  5C4J J;  2HXI A;  2QCO A;  4Y52 J;  2HQ5 A;  4L5E A;  3DPJ A;  3ZOB A;  2YVE A;  4MO7 A;  2W48 A;  4G12 A;  1SFO J;  3ZQL A;  1JKO C;  1BA5 A;  5EGO A;  5HAW A;  3NAU A;  4A3B J;  3HM5 A;  2JA8 J;  1TWH J;  2JWT A;  1MBJ A;  4M3B A;  5EZG A;  3H3V K;  1WH7 A;  4FE7 A;  5E3O A;  2GBY A;  3F1B A;  2M9H A;  3O8G A;  3BG3 A;  1OJL A;  3GTP J;  1A6I A;  3B81 A;  2QKO A;  4NEL A;  2OI8 A;  2EH3 A;  2FX0 A;  4CGR A;  4LOC A;  5EFY A;  4GCK A;  2FD5 A;  4XRM A;  2HI3 A;  2UXH A;  4M6V A;  5J3L A;  3S5R A;  1PUF A;  3GTL J;  2D5V A;  5D18 A;  2X9D A;  2R5Z B;  1UG2 A;  3RZD J;  2ID6 A;  1JJ6 C;  3HKZ N;  1JUS A;  4C3J J;  2R0Q C;  4S0H B;  3JRA A;  2YVH A;  1Y1V J;  1JUP A;  5EDN A;  3CDL A;  3NRG A;  4IHX A;  3S15 J;  3OOU A;  2MSY A;  1HF0 A;  1ETK A;  1ETQ A;  2L9R A;  4W1U A;  2PZ9 A;  2XB5 A;  3KNW A;  3VW1 A;  5EEA A;  1ETO A;  4ACI A;  4UUT A;  1ETY A;  2Y30 A;  3RKQ A;  4A3D J;  5EF6 A;  1K83 J;  3LSP A;  2UXP A;  3VW2 A;  1EF4 A;  2XPV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...