1RKWA

Crystal structure of the multidrug binding transcriptional repressor qacr bound to pentamadine
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
186
structure length
186
Chain Sequence
b'NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKKEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator qacR
publication title Crystal structures of QacR-diamidine complexes reveal additional multidrug-binding modes and a novel mechanism of drug charge neutralization.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription
total genus 78
structure length 186
sequence length 186
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2003-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1rkwA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 1rkwA02
1IDZA 5IP7J 1ITYA 3G1MA 2GLOA 4A3EJ 2QKOA 2IBDA 5IP9J 1HF0A 2XRLA 3VOKA 1D5YA 4LOCA 2RASA 2DG8A 1TWFJ 4G12A 5EFYA 3HBLA 4C3IJ 4RDUA 2L7FP 5J1YA 5EG0A 2JA7J 1U9OA 2NVQJ 3ON2A 2JWTA 5IOZA 3HGYA 4GCTA 4DW6A 3JRDA 4DZJA 4Y7NJ 3NPIA 2EBIA 2XB5A 5EF6A 4A3BJ 5K58A 3NXCA 1MH3A 2K9SA 3B6AA 2G0EA 1JJ8C 4QSHA 2E2HJ 3BCGA 3F1BA 2UXHA 2YVEA 3IH2A 3GTOJ 3EGQA 2MGQA 3HIMA 5M5WJ 1MSEC 2CRGA 5EEAA 4X1EA 5HBUA 2O7TA 2X9DA 3MVPA 3EUPA 3OOUA 5E3OA 5FLMJ 3BR6A 1E3OC 3S1NJ 5IOYA 1DU0A 3BG3A 1ZK8A 1EF4A 3JREA 2GFNA 2ZOZA 3SJMA 3A02A 1TWAJ 4V2GA 1FTZA 3LHQA 5DAJA 1OFCX 3CJDA 2LY9A 2DA6A 2JA8J 4I76A 2LKXA 3MNLA 1MBGA 1JKPC 3BTJA 3IUVA 2NVXJ 4QIWN 5K7FA 4IHWA 5BNGA 1FEXA 3HGGA 3LNQA 2UXUA 3FRQA 1JT6A 2WAQN 1MNMC 3AQSA 2VPRA 1X2NA 2XGCA 3Q3SA 2DG7A 5K7HA 2M8GX 5DS9A 5M3FJ 2XPWA 3V78A 1JUMA 3HEFA 2FD5A 4D5CA 3BHQA 3GBGA 1I6HJ 4KWAA 1JTYA 1P7JA 3LSGA 2RHAA 2DA4A 3BR1A 3PO2J 3GZIA 1ORKA 4B4CA 3NARA 2RAEA 3LWJA 2FBQA 2OPTA 2LVSA 1JKQC 3VP5A 3TP0A 3ZOBA 1SFOJ 4A3CJ 2H8RA 5F27A 3OIOA 2LD5A 2YVHA 2R92J 3S15J 3I4NJ 2NS8A 5F04A 3O60A 4XRSA 3GTJJ 4UUTA 2DMQA 1YRNA 3W6VA 1H8AC 2R93J 1ETKA 3Q0WA 3JRIA 4ICHA 4XRMA 3NAUA 4MFDA 2ZOYA 4V2FA 2M2EA 2FJ1A 4C3HJ 2FQ4A 3LSPA 1F36A 5F08A 3S16J 1LFBA 2JK3A 1UG2A 2L7ZA 3HKZN 1HCRA 1ETYA 1BA5A 5AQCA 3RH2A 2R5ZA 3ZQHA 4L5EA 2MG4A 2L0KA 2NVYJ 5FKLA 4W1UA 5FKKA 4D5FA 1R9TJ 1K61A 2LTPA 1AHDP 3M3YJ 2DA5A 3T6NA 3JRCA 3ZQLA 2HYJA 1WI3A 2ID3A 3H3VK 3ANGA 5IPAA 1U8BA 1B8IA 5FHPA 1RESA 3BR0A 1H89C 2DA7A 1A5JA 3WHCA 2G7GA 2W48A 2LFBA 4X6AJ 4FE7A 3QQAA 3S14J 2GUHA 1AKHA 4JNNA 5D18A 3ZQFA 2YU9J 2UXPA 4MK6A 1JGGA 2MW8A 2DN0A 4ACIA 4AC6A 3BQZA 2X48A 2EZIA 3S17J 2LR8A 4RBOA 3E7LA 2Y9ZA 4M3DA 2NP5A 1SGMA 4GFKA 1DU6A 2Q24A 4BY7J 1U78A 1ZKGA 4JX4A 3HOXJ 5D19A 1ETVA 2CU7A 1WPKA 1XG1A 5EYRA 3O8HA 4NELA 3M4OJ 1MBKA 5F1JA 2LK2A 2XPUA 3E7QA 2CQXA 5FGLA 3MKLA 4I6ZA 4UUSA 1TWHJ 3NI7A 1BW6A 2NX4A 1T33A 3GTKJ 2E19A 1MBEA 3LJLA 2YUSA 1TC3C 2O7OA 4GCKA 3JRAA 1UHSA 1IRZA 3GTMJ 5F0CA 3BG9A 4B1RA 3H0GJ 1PUFA 1O4XA 1JJ6C 2DA3A 1RETA 2IU5A 4C3JJ 4JX6A 4BY1J 3DPJA 1RKTA 1ZQ3P 2EQRA 5FKMA 4A3GJ 1ETOA 1JT0A 1HDPA 1Z0XA 1ZR4A 1JKRC 1IC8A 2TCTA 2P81A 2WV1A 2IEKA 2L7MP 5FJ8J 1ETQA 3LOCA 3AQTA 2PBXA 2DMUA 2LP0A 2EZHA 5GP9A 3ZQGA 5CW8A 2HOAA 1JUSA 2LLKA 3IH3A 4AUXA 3S5RA 3V6GA 3NRGA 3TW7A 4FCYA 3KKDA 3KNWA 1VI0A 1QPIA 3A01A 3OSFA 3P9TA 3CRJA 4JP0A 1VNDA 1LE8A 2ZCXA 4CYCB 2L9RA 4W97A 1HLVA 4IHVA 3O8GA 2DJNA 3JR9A 3S2DJ 2DA2A 2EZLA 1TWCJ 1IG7A 5J3LA 2QCOA 3JRBA 1QVUA 2JN6A 5GPAA 5EGOA 3G1OA 4ME9A 3HOUJ 2ME6A 1OJLA 3IH4A 2GENA 2XSDC 3RKQA 3S2HJ 1A6IA 3HDDA 2R5YA 3F0CA 2GM4A 2PMZN 2Y31A 5E3LA 3FIWA 1SANA 3KKCA 3TW6A 1FTTA 1H88C 3RQIA 5E3MA 1G2HA 3COLA 1Y1WJ 2HYTA 2QIBA 2X6OA 4XRSG 1JTXA 2B63J 3BJBA 3BRUA 1RR7A 4BBRJ 1W0TA 5IP6A 2AO9A 2HXIA 4A3MJ 3TP3A 2W53A 2EH3A 1Z77A 2JMWA 5E3NA 4L62A 4MXMA 1B72A 1JUPA 4QTRA 2COBA 3G1LA 5FKNA 4BXXJ 3ON4A 3L1PA 1MBHA 3VUQA 1Y1VJ 2M0CA 1VFCA 5FLVA 4M6VA 1AKHB 1RKWA 9ANTA 2XB0X 2HDDA 1FIAA 2ELKA 5JLXA 1IDYA 2DMPA 1S7EA 5C3EJ 2QTQA 2NVTJ 4MIMA 1APLC 3HE0A 1CQTA 1GV5A 3PPBA 2VKEA 4A3LJ 3S1QJ 3BNIA 3VW1A 4XK4A 1WH7A 1X2MA 3HOYJ 3CMYA 3BTIA 3PM1A 5M5YJ 1MH4A 3GTQJ 4JX5A 3FK6A 5M5XJ 3HB9A 2QF7A 1JKOC 1K83J 4AC0A 5EG0B 1IV6A 4MFEA 1RPWA 2EZKA 4UUSB 3C07A 2CUEA 3BG5A 4MO7A 1ENHA 3B6CA 4M3FA 5H9TA 1GDTA 3RZOJ 3SDGA 4BKXA 2CQQA 3JRFA 2AHQA 4A3KJ 5IYBJ 2CJJA 3GTPJ 3PO3J 4AF5A 1WH5A 3KZ9A 3BQYA 4FTHA 4S0HB 1PUFB 2XGEA 4DYQA 5IYDJ 3JRHA 1HDDC 3Q0UA 3HOWJ 2G3BA 3C2BA 5HODA 3LSRA 3D1NI 4NDLA 1T56A 2M34A 2UXIA 2HOSA 5D1RA 3PASA 4HKUA 4HNVA 4CGRA 2G7SA 1OCPA 3CDLA 1LFUP 3HTIA 1QRYA 3MN2A 2XPVA 2V57A 3OSGA 3VVXA 1OCTC 3GTGJ 1UI5A 2OI8A 2E1OA 2IAIA 3VOXA 2Y0SN 2JA6J 3VIBA 2ZCMA 2H1KA 5EZHA 3QPLA 1NK3P 3G7RA 4A69C 3JSJA 1NK2P 1BJZA 4MLOA 1GV2A 2VKVA 2R0QC 2WB1N 3BTCA 5EZGA 1IJWC 4A93J 2K40A 2JJ7A 4M3GA 5IYCJ 5CXGA 3CQZJ 4IEJA 3A01B 4IHXA 4BBSJ 3GTLJ 3RZDJ 1LE8B 3TEDA 2ME0A 5C4YA 1GVDA 3BT9A 3FISA 1FJLA 1F43A 4PXIA 4A3DJ 3HOZJ 1VF9A 2DA1A 4DYRA 3VPRA 5CXIA 3QKXA 2YS9A 5J1UA 2DMTA 2D6YA 2WGBA 5EGOB 2O8KA 5FMPA 2HI3A 3UKGA 2JA5J 1GT0C 2QOPA 3WHBA 4FISA 4D7MA 5DTDA 1IUFA 1MBFA 2VI6A 4FE4A 3SFIA 3G56A 3BTLA 3S1RJ 4M3BA 5EDNA 2R5YB 4JL3A 1WCMJ 3GEUA 2GBYA 4NN1A 2KDZA 4M3EA 2HOTA 5GPCA 2XGDA 2XDNA 5M3MJ 2OERA 1QVTA 3ZQCA 3VVZA 2ID6A 2MSYA 1YRNB 5HAWA 1TWGJ 3CWRA 2WUIA 4A3IJ 3HOVJ 2F07A 2NS7A 2G7LA 2FX0A 3HTHA 2R7ZJ 1FIPA 2E2JJ 1BW5A 3A03A 1ZR2A 2CUFA 2DTZA 3I4MJ 2K9QA 4YZEA 4JKZA 4CYCA 2D5VA 4C2MJ 2R5ZB 3VW0A 1AU7A 2KT0A 2O9LA 1B72B 3BR2A 4XIDA 5C4XJ 2REKA 4A3FJ 4DZPA 2K9NA 3K2AA 4DYCA 3VW2A 1HOMA 2HQ5A 3DCFA 1P7IA 3NNRA 1POGA 1Q1VA 3BR5A 1B8IB 5HSZA 1UMQA 1GUUA 1U9NA 4D7NA 3IV5A 1UI6A 3QBMA 3DEWA 1I50J 5FKOA 1NTCA 3BR3A 3HTJA 3ZQIA 1MSFC 4GFLA 1IGNA 1ZGWA 4J19A 2OF7A 3Q0VA 3RD3A 1I3QJ 3FK7A 2ECCA 2ZB9A 2ECBA 2UXOA 2HXOA 1ZTRA 1WGXA 3B81A 2PZ9A 4UDSA 5F0HA 4XICA 4Y52J 5F0FA 2Y9YA 2QWTA 4GCLA 3VVYA 3QPSA 2E2IJ 5C4JJ 2VUMJ 2M9HA 4AYBN 1ETWA 4B3AA 3HM5A 5C44J 1W0UA 3CCYA 2N8GA 1ETXA 2Y30A 1BL0A 2ZCNA 2NOGA 4ABZA 3K7AJ 5K7ZA 5JLWA 3S1MJ 2TRTA 4JYKA 1XC5A 2DMNA 4IHYA 2NP3A 1MBJA 1X58A 3FKIJ 1XS9A 4GFBA 2HKUA 5J1RA 2I10A 2Y2ZA 4EEFG 4A3JJ 3ANPA 3HTAA 3JRGA 3LSJA
chains in the Genus database with same CATH superfamily
1IDZA 3HUGA 2FA5A 3U21A 2IBDA 3RYPA 3KP3A 1KU9A 5HS8A 5ILUA 2BY0A 2ZXHA 2DG8A 4DNCA 4XOTA 3ERMA 2BW3A 3K4KA 5J1YA 4RGXA 1P9QC 1O7LA 4KIBA 4BACA 1PUEE 3GZ5A 3LWFA 2JT1A 3F6VA 1X1AA 3M8JA 1PYVA 1V3FA 4DZJA 3GO5A 3NPIA 2XGXA 2XB5A 5E79C 4F3QA 5EF6A 3NXCA 1MH3A 2NVUB 3IUOA 3H3ZA 3HPHA 2BEOA 3DEUA 1N78A 3FXLA 3HHHA 4LB6B 2W82A 3IH2A 2FE3A 1K79A 2MGQA 3HSFA 5M5WJ 1RNLA 5EEAA 3ERED 3OYNA 2HVRA 2H6CA 2X9DA 4HYEA 2HVSA 3MVPA 3OOUA 3GUDA 2F6CA 1YJ9I 3C18A 1T08B 2TDXA 3AG4H 2O8XA 1S72I 2GFNA 3SJMA 3LFUA 1TWAJ 3Q9SA 4V2GA 4Z6YA 3LHQA 1WJAA 5AIPA 4XLHA 3UR3C 3AL0B 1LEBA 2GA1A 4I76A 1R22A 2R3SA 3CMMA 4PJ0C 3MMYB 3MNLA 4PJLA 4Z2YA 3KIOA 4KNYA 1X4OA 3BTJA 1XPXA 3IUVA 4E7JA 3M9AA 4C9YA 4M9ZA 3M7GA 1FEXA 3HGGA 3GF2A 5DCMB 3KZIC 1MNMC 3AQSA 4BS9A 4HDVA 2Z9OA 4ZTJA 2M8GX 2GQQA 4IOCF 5M3FJ 3V78A 3HEFA 3S3MA 3DU6A 4D5CA 1QBJA 1TTYA 3ZPLA 4EJTA 4KWAA 1JTYA 1P7JA 4B4CA 2HPIA 3HSEA 1ACIA 2H8WA 3LWJA 1LVKA 2FBQA 1FP1D 2LVSA 2QKLB 3TP0A 2H8RA 2MBFA 2VE8A 3OIOA 1WJDA 3DWLE 3S15J 2OTJI 2OJED 1MMNA 3R61A 4BQOA 5LGUA 2WTEA 2JQ7A 5E8IA 4UUTA 3I59B 2R7FA 1H8AC 1VQ4I 4ICHA 5JFRA 2ZOYA 2PBIA 2M2EA 1FOWA 2KZGA 4C3HJ 2FQ4A 2A5YB 5F08A 5B5EC 2DPUA 3CC4I 4EMSA 3HOSA 2JK3A 1MJAA 1MW7A 1D1BA 5JVGF 1R00A 3ABMH 3P5JA 2L7ZA 3HKZN 2OAZA 1HCRA 1BA5A 1JI8A 2E60A 2R5ZA 1I39A 4YG2F 3E3VA 2L0KA 2NVYJ 5IT9Z 1BI2A 3NQOA 2ZJPF 3HRTA 3K1NA 4BXFA 3M3YJ 3KCCA 4AD9A 1T98A 1AOYA 2RC4A 4AYBA 3ANGA 2CV2A 3H9QA 4BDZA 2EK5A 1HQCA 4G8XA 1R1TA 2E1NA 2G7GA 1YOVB 4UXNA 3K8PC 4DIQA 4F93B 4FE7A 5D18A 2XV4S 3S14J 1X4PA 3ZQFA 3KP4A 4UHTA 2UXPA 1JGGA 2MW8A 2DN0A 4Y4RA 5LGNA 3L00A 3V8KA 5CPRB 2K4BA 3S17J 2QM3A 1SMYF 2LR8A 2UV1A 4L0ZB 2EB7A 3RKYA 5GAHJ 3I56I 3SZTA 1U78A 3HOXJ 1XG1A 2IPQX 1I1SA 3I55I 1VQ6I 3M4OJ 2LK2A 5IT9K 3OYIA 3K9TA 5FGLA 5J47A 4OINF 4UUSA 2DOAA 4LLLA 3L2QA 3NI7A 2BVLA 5DD8A 3T8RA 1MBEA 1MGTA 3DPLC 1TC3C 2O7OA 2R7RA 1K6OA 2PN6A 3GTMJ 3L09A 4RGSA 3BG9A 1E3HA 2B0LA 2GOMA 3DKYA 4IRGA 5CLSA 1T39A 4PFOA 3K10A 4LG0B 2A2FX 3O2PE 1ZLJA 4EV0A 2P5VA 2TCTA 2BY3A 2P81A 2WV1A 3OL4A 5GADJ 1P4AA 2L7MP 3WTUC 1ETQA 2VC1A 1VQ8I 3OR2C 4EGZA 1XSXA 2HOAA 1JUSA 2LLKA 3EUHC 4K2EA 2GXBA 2R7VA 3MKYB 1OCRH 3HOTA 4CYDA 2E34A 5CVIA 5KK1A 1IXRC 1WRJA 3AG3H 1QPIA 5FFZA 1Z9CA 2HR3A 3EETA 3KE2A 3I0TA 1VNDA 4JP0A 3A0BC 2J5PA 1LE8A 1XCVA 1R5HA 2UWMA 1IW7F 5HS9A 3JR9A 1FMVA 2K3PA 2DA2A 4CCJA 2FNPA 2K86A 3FDYA 3PIPF 3H5RA 4E6KG 3CLQA 1X1PA 1D1CA 4X0GA 1OJLA 3IH4A 5CVJA 1LVAA 3REOA 2XSDC 1U8RA 4RS8A 3RKQA 3CDHA 3S2HJ 1A6IA 2UXXA 3NWSA 2PMZN 4XLEA 3P7NA 1LEAA 3TMOA 4CXFA 1H88C 3COLA 2HYTA 2QIBA 1FBUA 1V54H 1HW5A 2X6OA 2B63J 3BRUA 4XOPA 4BBRJ 1H9TA 3F72A 3HKZA 4I09A 2XF5A 2HQRA 3ONQA 3QRFF 4RM2A 1OCZH 1WJFA 3FXKA 3HTUA 2EH3A 2I8DA 1PP7U 3N4MA 3OR1C 1SC7A 2LYCA 4HPQA 4N9HA 5KHDA 4QTRA 2F2EA 1YS7A 4FHTA 4CICA 1WJBA 4BXXJ 4I0AA 3OS1A 3DF8A 4KIGA 1MBHA 3VUQA 3K4LA 1K78B 3GLXA 2KPMA 3BCAA 3D5LA 3SXYA 4RB0A 3LQRA 5LRRA 9ANTA 1GLNA 4HAMA 1IDYA 1X1DA 2BY2A 1S7EA 1GV5A 1RUOA 1USTA 5LRSA 2XASA 3H5AA 3CMYA 3HIFA 3OYFA 2DFHA 3H3UA 1ULYA 2XSJC 4LLGF 3S3NA 1XD7A 3WTZA 3HB9A 4HDUA 1LJ9A 2OV7A 4BHBA 4ZH4F 4MFEA 5EG0B 1IV6A 1W7PD 3C07A 2MABA 2K9MA 3OYGA 1QA6A 1ENHA 4G7OF 4RLQA 3GYHX 1E0EA 4HOBA 5IY5H 2AHQA 4A3KJ 3I54A 3BZCA 1C0WA 2M8EA 4HW0A 4AF5A 4BE2A 1T0FA 5HLTA 4FTHA 2HWVA 2XGEA 3GZNB 3DKWA 3JRHA 1EH7A 1HDDC 1A35A 3QOPA 2VE9A 2G3BA 1B59A 1QPMA 4NDLA 2EFNA 2MLKA 5D1RA 4PFPA 4GGGA 5BQTA 3SDBA 2CO5A 2P6TA 6PAXA 4CGRA 2BZTA 5HVQC 1LFUP 2VJ4A 1R71A 3KPHA 3MN2A 2XPVA 3C7JA 3PNYA 3OSGA 4M71A 1LB2A 3GTGJ 1JGSA 5B1BH 2Z3YA 2E1OA 2IAIA 1WHUA 2F4OB 4IVNA 3WTXC 2ZCMA 1NK3P 3QPLA 4O3MA 4G6QA 4CCKA 4A69C 3G7RA 3JSJA 3FXQA 1GV2A 4RAZA 2EILH 2QZ8A 3R0JA 2WB1N 1IJWC 2XUBA 5CVVA 3TOBA 4BJTA 1IUYA 3IL2A 4M3GA 5IYCJ 4IEJA 1FPQA 3RKWA 4LFUA 1BI0A 2CQKA 4D0PA 5JHFA 3T0YA 4BBSJ 3GTLJ 3LQQA 3TEDA 2VL8A 3BT9A 3LL7A 2HTJA 1FJLA 2VLAA 3VWBA 2QUFA 2MFZA 3GMEA 1R49A 2DA1A 3RJPA 2YVXA 2P8TA 2CUJA 2WGBA 2GA2A 3CUOA 2F48A 2CGPA 3OYEA 5HLIA 4AM3A 2HI3A 3UKGA 1QU3A 2HNHA 2JA5J 1GT0C 2QOPA 4D7MA 4FISA 3VYUB 2DOEA 2DU9A 3J81K 5DTDA 1IUFA 2DAOA 3SFIA 5K5QA 3BTLA 4RGRA 4IJAA 5EDNA 3KZYA 1UB9A 2GBYA 1TQIA 2PG4A 1VQPI 2XDNA 2L02A 3PQJA 1QVTA 3ZQCA 3VVZA 4LK0F 1YLFA 4Q4ZF 2KFDA 2PMZA 3CWRA 2VXDA 5HS7A 2MYSA 2NS7A 2F07A 2JA2A 1G6NA 2KHMA 2YPRA 4G6DA 2E2JJ 2V1DA 3A03A 1DGRM 2CUFA 2DTZA 3I4MJ 2K9QA 2QSGX 4JKZA 3S8PA 4WX9A 3E5QA 4C2MJ 4HX7A 2O9LA 1B72B 1XDUA 3WE2A 2XIGA 2LBFB 3VTIA 2HPMA 3DCFA 3FWEA 2FF4A 3BJ6A 1X3UA 3X2QH 5DV5A 4B44A 3NNRA 3BR5A 3F21A 2Q8KA 1GUUA 4BHPA 4BDYA 1YITI 4IRIA 2VASA 1UI6A 3FXUA 3V8LA 3QBMA 5ILSA 1U5TA 3VSLA 1XX5A 3BR3A 3E6MA 5KNLA 3WGGA 3J7YJ 1MJBA 3T1BA 2V9VA 3Q0VA 3IRQA 3AG1H 4P9UA 3FK7A 1R4MB 4L5IA 4HX4A 4ITVA 5GAGJ 2B7EA 2M4KA 3KLNA 4CCLA 2PZ9A 5F0HA 4DQ2A 2OZUA 2VN2A 5F0FA 3J7AO 2Y9YA 1VQNI 2LY2A 2DQLA 2M9HA 2DQRA 2R7DA 4B3AA 1J7KA 4NC8A 1E17A 2ZCNA 4IXAA 3AG2H 2NNNA 4IL6C 4ABZA 5K7ZA 5JLWA 3I71A 3M8EA 4IHYA 2DI3A 2MH9A 1MBJA 3MCZA 2CV0A 1X58A 2CYYA 2HKUA 2BE5F 4HF1A 2ETHA 2I10A 1ZARA 2CMPA 1W7PB 3CJQB 3ABKH 2OZ6A 3VSKA 3EUAA 5IP7J 3IP4B 4ZJZA 3OYMA 3IRRA 3G1MA 4HG2A 2GLOA 1RUNA 3JTHA 2QKOA 5L3CA 2YX7A 1YIOA 4LOCA 1TWFJ 5J8CA 3JSOA 3RI4A 4C3IJ 3K4NA 4RDUA 3LA2A 3ON2A 3FM3A 2F4IA 4LK1F 4BU2A 4XKCA 2EINH 3COAC 1D5VA 2DBBA 2OQGA 2XHKA 4DW6A 4GCTA 1FBSA 4GXOA 1O3SA 3ZMUA 5K58A 1XMKA 2WB1A 5HDGA 1FYMA 2VQCA 2F5EA 4XR6A 4YIFA 2E2HJ 3I64A 4QSHA 4I7HA 3BCGA 3F1BA 4AIJA 1SVOA 3OIPA 3L2UA 2UXHA 3GTOJ 3EGQA 3HG9A 2PJPA 5HBUA 2NS0A 3ZR8X 2EV5A 4WIBA 5ICGA 2LF7A 3VOEA 1MDMA 4KN7X 2QSHX 1IO2A 1E3OC 3S1NJ 1T8IA 1XTAA 2XDVA 1DU0A 4M9SA 2DT6A 1EF4A 3JREA 1R1UA 4I01A 4CUGA 2JVGA 3CP8A 1H9GA 2DA6A 3KLOA 2JA8J 1XGOA 4HF0A 1FBQA 4U0VA 2FRHA 5DDGA 3AFHA 4KMUX 1MBGA 2EIJH 3J80K 3G73A 1JKPC 3F23A 2MA3A 5IT3A 3MFKA 1XMXA 3G6EI 5BNGA 1I27A 1J2XA 2ZC2A 1J0RA 3H35A 4KYWA 3M8FA 1YYVA 1XSVA 2DG7A 2W57A 1YIJI 5DS9A 3L2CA 4BEHB 2VODA 3PQKA 2XPWA 1FOYA 5H20A 1JUMA 4BXUA 2L3DA 1HBXG 3GBGA 5D8LB 1BJAA 1PJRA 1G4DA 3PO2J 3PSFA 2RVCA 2RAEA 2LRDA 2WC2A 3ZOBA 2K02A 1LUJB 1Z67A 2ZFUA 3O60A 3CTAA 5B66C 4U0YA 1YRNA 4NUBA 1ZGAA 2H1LA 1ETKA 3JRIA 3NAUA 4MFDA 4V2FA 1IN6A 2GZWA 4CCOA 2HEOA 4NHJA 4KISA 3QU6A 3LSPA 3F8FA 4U9LA 5DEQA 2V26A 2D1HA 1LFBA 2VB6A 3NWTA 3S16J 1UCRA 1UG2A 3HYIA 3SEQA 3R60A 3LSHA 4Y13A 3ZQHA 4L5EA 3QAHA 4XLFA 4HSRA 4CSWA 5FKKA 3G4SI 4WK8F 1VQMI 4A6DA 3DPUA 4CZCA 2LG4A 1OYIA 3ZMTA 2ID3A 3SWHA 4FX4A 5IPAA 1LDDA 4Y3OA 1U8BA 1I1GA 1RESA 1WJEA 3CMAI 1D1AA 1SVLA 3CCRI 3BOQA 2DT7B 3QQAA 3FMQA 2ZXJA 1O3RA 2GUHA 4B47A 1QZYA 1YW9A 2VONA 4A2UA 2EPFA 2XAQA 5E1WA 2EJRA 2R7WA 2IP2A 1OISA 3HUGB 5B3SH 3ZN1A 3BQZA 1UHWA 4LITA 1K4TA 2VBWA 4OIQF 2E36A 2Y9ZA 4M3DA 3JW4A 2BW3B 3BP8A 1R6RA 3K70D 5HLGA 2Q24A 1R1VA 4JX4A 1IZ1A 2CS3A 2CFXA 1SMTA 4NELA 5EYRA 4KFCA 5F1JA 3FXOA 1LFPA 3ASNH 3AKZA 3ZRGA 2A69F 3MKLA 3GX4X 4JQFA 3QOEA 1SFXA 3F22A 5BPIA 3BLYA 3QP6A 1WKMA 2MLGA 3MZHA 3WU2C 3JRAA 1W36C 4GCKA 3I3LA 4UY8I 4B1RA 1PUFA 3TDUC 2DA3A 1D0XA 2IU5A 2V4JC 2BBYA 4ENJA 1SFEA 2GAUA 2OA4A 3LSIA 3JSPA 4A5NA 1Y8QB 1W1WE 3VEPA 3L9FA 2FOWA 2NXNB 1V55H 4U9NA 1JT0A 3DBHB 1Z0XA 4MTDA 1IC8A 4E7LA 1DGWY 2LH9A 2MC4A 5CQGA 4CHUA 2DMUA 2HS5A 2Q2EA 4ZDLA 2X0LA 1N77A 3FF5A 5GP9A 3ZQGA 1P4XA 3CD6I 4XBFA 2WA0A 1BR4A 3NRGA 1W36D 2QQAA 2VOOA 3CMEI 3A01A 4CA0A 2C6YA 3U1DA 1XB4A 2VJ5A 3CJNA 1KA8A 4CO8A 1ON2A 4W97A 1HLVA 2IGMA 3MWMA 1TWCJ 1IG7A 5J3LA 3JRBA 3D5SC 5D5WB 2FBKA 2JN6A 5GPAA 1K4SA 2PMHA 4ME9A 3HOUJ 1BR2A 2O03A 4YIIA 1OKRA 4A5MA 2W4SA 2R5YA 2AXTC 2NAZA 2GXAA 5HNFA 4L9TA 4OAYA 3TW6A 5E3MA 1M1EB 1Y1WJ 2JRTA 5HOOA 5D5UB 2CSOA 1V5FA 2M5WA 4I02A 4RMNA 4XRSG 1TL8A 1T0FC 2FMLA 4BGDA 1W0TA 3DTEA 2O5RA 5IP6A 5J6XA 3TP3A 1D0YA 1BIAA 2W53A 2XROA 4GO1A 4LMYA 1KQ8A 4JOMA 3P9CA 4MXMA 4B43A 1LNWA 5K5OA 2X6YA 3QYFA 1AWCA 3H5NA 3FBNB 3C2HA 3ON4A 4UB8C 3V7RA 1VFCA 5D4RA 1O57A 2DO7A 3EDPA 1BBYA 4FASD 1YX3A 4IF4A 3GWZA 4IHTA 3I59A 3PJRA 1JHHA 2ESNA 2ELKA 2QVOA 5JLXA 4NB5A 5F1RA 2R7TA 5C3EJ 2HQAA 1X3WB 2NVTJ 2ELJA 2H09A 2ISYA 4OU0A 3PPBA 5L3GA 1EH8A 1R58A 3KEYA 3SZPA 2ZNZA 4OIPF 1SVMA 1H0MA 1PDNC 3HOYJ 3BTIA 1MD0A 3ELKA 5M5YJ 1MH4A 4JX5A 3FK6A 3HJEA 2R4GA 1ZRFA 1X19A 4CZZA 1TZLA 2HZTA 1DPUA 1JKOC 4PJNA 1K83J 2V6CA 4AC0A 3E6DA 4R79A 4LLNA 4KA4A 2ELHA 1YHQI 3K1MA 4UUSB 4EQQA 2CUEA 1UG0A 3BG5A 4MO7A 4KDPA 2XKOA 4UV8A 3JTGA 4F7ZA 4M3FA 1ERDA 4XM3A 2A6TA 1GDTA 3RZOJ 5LEKA 4YEJA 3F8NA 4N9IA 3TBIA 2DK8A 3PO3J 1WH5A 1WVRA 2B3WA 2F4MB 3BQYA 2BXYA 2ZXWH 2R7XA 5IYDJ 2OUMA 3HOWJ 3GZ6A 3C2BA 5AIQA 3CCJI 2OQRA 5CVRA 2VIXA 1W4MA 3TDZC 1CF7A 4C2UA 2UXIA 4Q5SF 1JE8A 3CO7C 3QYEA 2WWYA 2OTLI 3S2WA 4BAYA 5ICCA 1Z6RA 4BH9A 3VVXA 3ZMZA 1LDKB 4A12A 4HQMA 1DQUA 1MZBA 2Y0SN 1D3YA 2H1KA 1NK2P 4MLOA 2JUCA 5DD4A 2VKVA 3C3WA 4A93J 2JJ7A 4UVAA 5BPDA 5CXGA 4BE0A 4YELA 2X6WA 4ZZLA 1LE8B 2X4HA 3C2GA 2ME0A 5C4YA 1E2XA 1L0OC 3IHUA 2GOXB 1FX7A 2DCEA 1R5ID 2IVMA 2RQQA 1U5TC 3K6GA 4A3DJ 3VPRA 1S7OA 5F6FA 4XKVA 4YFXF 2DMTA 1BC8C 4B8XA 2D6YA 2K7LA 2O8KA 3I5UA 1YI2I 3FM5A 4G7HF 2QENA 3WHBA 5LBQA 2BHYA 1HW1A 4LD5A 2VI6A 3PNVA 4G7ZF 2IS6A 2IS4A 3S1RJ 4M3BA 1R5GA 2M3AA 1WCMJ 3ISPA 4L18B 4NN1A 1XMAA 3K1PA 1ZLKA 2MSYA 1TWGJ 1IN8A 2BGCA 2WUIA 3DP7A 2G7LA 4S05A 2K5CA 2E5NA 2ZMEA 4XSZF 3HTHA 2COMA 2JRMA 3V8JA 3ZMDA 3BG6A 2Z33A 2VQLA 1HA8A 2M4GA 4KUMA 1ZR2A 1MNDA 4MQ9F 4TV7A 3DLAA 1YJWI 1OYYA 1F1ZA 3A1YA 5KAFC 2D5VA 2KT0A 3LAJA 5FD6A 2HDWA 4YFNF 3EQLF 4MHGA 4HNUA 5DCFA 3VW2A 4DVYP 2VJIA 1Z05A 1RI7A 1W5SA 2JPCA 2VKHA 1FWZA 1Q1VA 2UUZA 1B8IB 5HSZA 4H0EA 4YFKF 1U9NA 1E3PA 3K69A 3CLOA 1MMAA 4XRFA 5J4YA 4EVIA 2JZYA 3IV5A 2O0YA 4GDFA 3DEWA 2PLYA 2XAFA 4BL0B 5FKOA 3CCUI 2WBMA 3ZQIA 3RPUD 1WJ5A 3OL3A 4R1HA 1HSTA 4J19A 2OF7A 3DBRB 2ZB9A 1DUXC 2ZFWA 2FOKA 1X1BA 4MEXF 1EA3A 1ZTRA 1V5EA 5EEGA 1PP8F 2RQPA 4LIUA 4AU7A 4UDSA 4GRIA 3S3OA 2YR2A 4Y52J 3CUQA 2BHZA 2YX4A 3VVYA 3QPSA 3CF5F 1YO5C 3OYHA 4CH7A 2E2IJ 2LKSA 4P9FA 3RQ4A 4PDKA 5C44J 2N8GA 2Y30A 1TLHB 3QWLA 1SEUA 2O61A 2DODA 1R7JA 3NRVA 5TJJA 4NC6A 4IHSA 2DJIA 3OYKA 2FBIA 2HDCA 1YTYA 3FKIJ 3VDXA 3P9KA 5FD5A 5J1RA 4EEFG 1SD5A 2G7UA 3DXJF 4HA8A 2EV0A 2DLLA 2XRLA 5TISC 1B4AA 4ZYHA 3RCOA 3W6JB 2A68F 3HBLA 2RNJA 3GXOA 3KYDB 4DOZA 5EG0A 1U9OA 2NVQJ 1ZG1A 2JWTA 2Y0SA 2CQNA 4OMZA 1G3YA 4CGZA 3JRDA 2EBIA 2KLOA 2ZJRF 1NH3A 2K9SA 2MH2A 1OR7A 2G0EA 1JJ8C 1BIBA 1SD6A 2YVEA 3ABTA 2WV0A 1MSEC 3OYBA 2FNAA 5D5VB 4X1EA 5A2QZ 4IOAF 3EUPA 5E3OA 3U2RA 1ZGJA 3FKJA 4ZC3A 2VC0A 2DFIA 1NG6A 1JHFA 2IGOA 3GEZA 1ZREA 3BG3A 3IKVA 3CO6C 3OYLA 2MD5A 1KU2A 2G7HA 3A02A 4NBQA 2F5VA 1FTZA 4XN3A 1TNTA 3PFYA 3I9V2 2CQ7A 4M74A 3BY6A 2FU4A 2NVXJ 2QGUA 4EJOA 5GAEJ 4OD4A 1G3WA 3CZ6A 1JT6A 2WAQN 3OYJA 4BQQA 1X2NA 3E5XA 5DYMA 3Q3SA 2NYXA 3RTRA 4MQVA 5K7HA 1DPRA 4FX0A 3I53A 5FRNA 2DA4A 3BR1A 4MEYF 5L3BA 1ORKA 3NARA 3E1SA 4AIKA 4ZDOA 4J01A 1LQ1A 2OPTA 1YW8A 2HKOA 1JKQC 4A3CJ 2RGVA 3F3XA 5J8FA 5F27A 1RC9A 1FOKA 2A6EF 3HPGA 2R92J 3I4NJ 2NS8A 1U5TB 4B3XA 2KQRA 2L54A 2DMQA 4PK4A 3W6VA 3Q0WA 2GXGA 2KISA 4AIDA 1FOXA 3SZGA 4XRMA 4HQEA 1J09A 3U1KA 2KMUA 1F36A 1Z1DA 3B02A 4XORA 4CDGA 3N97A 3QODA 1QQIA 5E1ZB 3PSIA 3V4GA 3A4CA 1WQ2A 3RH2A 4IRHA 3BZKA 2E1CA 1Z91A 3OIQA 2MG4A 4D5FA 1R9TJ 1JXSA 2DA5A 2RNGA 3H92A 3T6NA 1VQ5I 1ZELA 3BJAA 1BN5A 2HYJA 2BOLA 1ODDA 1ZAOA 3CCMI 3QPHA 4I2OA 5FHPA 3IKTA 4FETA 4JBAA 3S93A 4DBRA 2DA7A 1WI9A 1A5JA 3RPUA 5DM6F 1X3ZB 4FQGA 4BHCA 4KJZA 1AKHA 1LDJA 3ASOH 3OY9A 2PX9A 4WXCA 4XSXF 2H6BA 4MK6A 5E1XA 2UZKA 1FLIA 3RKXA 4ACIA 3SYTA 5B1AH 2R7UA 1WFXA 4HLXA 3MD2A 4BUPA 2DFFA 1XCBA 3E7LA 3DPTA 1A6QA 1KQ9A 3F9KA 2OCCH 2QKMB 1WZ2A 1SGMA 4GFKA 1V4RA 1S6LA 4BY7J 5D19A 1ZKGA 3FMRA 5ILVA 1UZCA 1B9MA 1WPKA 1MBKA 4EJWA 2XPUA 2ZBKA 2CQXA 2P7CB 3KEOA 4I6ZA 1ZN2A 2JSPA 2W25A 3SEZA 2STWA 3ZQQA 3ANPA 1T33A 3GTKJ 2E19A 3VODA 2Q1ZB 1P2FA 2YUSA 3KP2A 4Q48A 3CP2A 3BG7A 1J59A 4MNUA 1UHSA 3IWFA 5F0CA 1KU7A 3H0GJ 1O4XA 4I98B 1RETA 4NQWA 4C3JJ 4JX6A 1QNTA 3FXJA 4G94A 3DPJA 2L5QA 4BJ6C 2EQRA 1FP2A 2L4MA 5FKMA 3T8TA 2PI0A 1ETOA 1O3TA 1IRGA 2Z99A 1HDPA 1VQLI 2EFWA 1ZR4A 1YJNI 1JKRC 4PSWA 2PFBA 3A0HC 1IXCA 2DOFA 3LOCA 3O3KA 1XDSA 3BPVA 3OV8A 2EZHA 1BR1A 5CW8A 4FT8A 4M9XA 4PCQA 3IH3A 4PGHA 1Y8RB 4AUXA 1YW7A 4MGRA 1FSHA 1U0JA 1PVEA 4FCYA 1S7AA 2KIFA 3KNWA 2LKPA 2RREA 1VI0A 2VJJA 2P0WA 2WAQA 3K4BA 3OSFA 2CV1A 3RYRA 3WTVC 3CRJA 3H36A 4C2MA 4CYCB 1GXQA 2W7NA 4IHVA 1BOBA 3O8GA 4ESFA 4DJAA 3TO9A 4PJJA 2ACJA 3S2DJ 4AVPA 1O3QA 4HSTA 3EYIA 2XKPA 2QCOA 2HQNA 1QVUA 2LC2A 5EGOA 4EM0B 3NEUA 3WE3A 1G3SA 1RIOH 3G1OA 1HXDA 2OC6A 2QBYA 1QHHD 2GENA 1VZ0A 5CJ9A 3HDDA 3HHGA 2B9SA 4YIRX 4A0ZA 4OIOF 1FC3A 2E7XA 5E3LA 5LFAA 3FIWA 3FBIB 3CC7I 1FTTA 3BC8A 2A61A 2W85A 4XLPF 3MEXA 1ZH5A 4M6XA 3W2VA 4IO9F 2XRNA 2XVCA 5ERIA 3NS4A 3C1DA 2AO9A 1WWXA 2ZKZA 2HXIA 3WGIA 4L0YB 2ICWG 4A3MJ 2ISZA 5E3NA 2X1CA 4L62A 2G9WA 4RAFA 3K70C 2ZCWA 1WJCA 1JUPA 1KYWA 4AVZA 3TGNA 2X1DA 3WTWC 5D6EA 4ENMA 2PJRA 1Y1VJ 3E6CC 2M0CA 5FLVA 1DDNA 1MMSA 2HFHA 3D0SA 5KAIC 1Z7UA 1CGPA 3WTTC 1W5CC 5FROA 2J5OA 2QWWA 4G9YA 2ZSIB 3ULQB 3CCEI 2XB0X 2VOPA 1FIAA 1XN7A 2NOJB 5J4VA 4P96A 2DMPA 2V7FA 3G2BA 4BNCA 2JUGA 3TO7A 1CQTA 3KFWX 2WAFA 3S1QJ 4HEA2 1Y39A 3VW1A 4P55A 3L7WA 4XONA 3TQNA 1WH7A 1X2MA 2A07F 3CCLI 1IF1A 4WF2A 2F5DA 3PM1A 4B48A 3PIOF 3SHFA 3GTQJ 3MQ0A 3EUKL 3GFIA 2QF7A 2VQHA 2ZXIA 5FB2A 1TT0A 1RPWA 2EZKA 1F9NA 5D4SA 2BXZA 2DTRA 4KIFA 3HRSA 1IRXA 3R4KA 5DUIA 2QEXI 5ICFA 1RRJA 2Z1DA 3QPTA 4LIVA 5TRDA 5H9TA 4U7DA 3SDGA 4BKXA 3GFLA 2QQ8A 3JRFA 5IYBJ 3F8MA 4C30A 2CJJA 3HRMA 1OCOH 2RDPA 3KZ9A 1PUFB 5L3DA 2QQ9A 2QSFX 1FYKA 3Q0UA 1YS6A 2DDBA 3M1CA 3LSRA 3D1NI 2E71A 2V79A 2OU2A 2HOSA 1QHGA 4HKUA 1OPCA 2ZMEC 2G7SA 4KITB 4J00A 3HTIA 1KGSA 1QRYA 2VPLA 1J9IA 2V57A 2KRFA 3WG7H 4P5OA 1MKMA 4PJMA 1OCTC 2R7SA 2DXIA 2OI8A 4XL9A 4PGGA 1TNSA 1P92A 3DTKA 2Q2EB 1L3LA 1BM9A 5D6FA 5K1YA 1HKQA 2V6EA 1GHCA 1BJZA 2K3FA 2KDOA 2YSRA 2ZNYA 2R0QC 4N0BA 4U87A 3S32A 1YX5A 3E5UA 2GIZA 2K40A 2PEXA 1QGPA 2STTA 3A2KA 4AIHA 2EIMH 4BQNA 3A01B 3RZDJ 4UUVA 1GVDA 3FISA 1AA7A 2P7VB 2HYGD 2P6SA 4EM2A 2JVHA 3DEEA 4PXIA 4IQJA 5E8GA 4ANJA 3HOZJ 2CWEA 1V5GA 4DYRA 3M1EA 1ZG5A 4KT6A 5J1UA 1KU3A 2W1OA 2LDUA 1KYZA 2VT3A 2XAJA 3BCBA 4XLAA 1MMDA 2RKHA 1MBFA 1Z6TA 4FE4A 2FUG2 1UAAA 4LG3A 4JL3A 3CUQC 2R5YB 1QZZA 1YQAA 3GEUA 2KDZA 2HOTA 5GPCA 1Y0NA 2HVQA 5CYVA 5D5XB 3CC2I 2KIQA 2ID6A 2D1VA 2DW4A 2IA1A 4RB3C 2XF6A 1SD4A 3MKZA 3FHZA 2FX0A 2R7ZJ 1BW5A 2EWNA 4BQAA 1XGNA 2FJI1 5DCMA 3JAMZ 3MZ8A 1Z7LA 4YZEA 5BS6A 2IA0A 2R5ZB 3VW0A 4I99C 5CQEA 4QWQA 1AU7A 2RN7A 4M73A 2KIUA 4XIDA 5C4XJ 3OYCA 2PMUA 2VBZA 4GYGA 3K2AA 2KKOA 3R6SA 4DYCA 3LA7A 3Q5FA 1P7IA 2L9NA 3HC7A 2KP6A 3PL8A 1SAUA 2VKDA 4IKFA 1POGA 5GTHC 1DP3A 1FZPB 2X6XA 4H4KC 3ZN0A 1MNEA 3WTSC 2XC7A 4KICA 4PSXA 4II3A 4OAZA 3PNTA 4D7NA 3H1CA 3QYBA 4L9JA 2CH0A 4F91B 2WY7Q 1I6XA 1I50J 1NTCA 1MSFC 2Z16A 4GFLA 5ICEA 1IGNA 1ZGWA 2IA2A 4PZJA 5LD2C 1G3TA 3BDDA 3RD3A 2Y48A 1U6GA 2MD0A 3W2AA 4ESBA 1REPC 1HSJA 2ECBA 2HXOA 1OR7C 3VYTB 1Y56A 4HV5A 4OIRF 3B81A 1S8NA 1R36A 2HGCA 1USSA 2DT5A 3JAMK 1ZG3A 2QWTA 3JCUC 3SFZA 2L01A 1YFHA 5C4JJ 3H0DA 2M7AA 2DFEA 5CVUA 3HM5A 3I58A 4QPQA 3CCYA 1ETXA 5JHUA 3WG9A 2K27A 5BOXA 2NOGA 3RIRA 2IRFG 3J7AY 1D8KA 2FEZA 2EFPA 3S1MJ 4XKBA 3FX3A 2TRTA 4P1WA 4JYKA 1J5YA 1LKXA 2DMNA 3GFJA 3W2WA 4DBQA 2NP3A 3K2ZA 4E7HA 3KYCB 1TQMA 2ZY9A 2P4WA 3P9IA 4PUSA 1Y6IA 1N25A 2DYSH 3KETA 1XS9A 1CF7B 4GFBA 1GVJA 3V7CA 2M7BA 2Y2ZA 3E97A 4XKWA 5H6QA 4E7SA 3M07A 3QU3A 3TL4X 2V1UA 3HTAA 3LSJA 2CFOA 2V1NA 4BJ5C 3MZYA 4KT5C 3WU1B 1ITYA 2BY1A 3KZZA 2Y0MA 4E4HA 4A3EJ 3B73A 3HXLA 2QA4I 1TQPA 5IP9J 3FZVA 1HF0A 3TO6A 3VOKA 2PQ8A 1D5YA 1J75A 1XGMA 2RASA 4G12A 3OMYA 5EFYA 1TBXA 4F92B 3QP5A 4ZYEA 2L7FP 2QQBA 3WTYC 3KYLA 1KZHA 2WAEA 2L7KA 2JA7J 3SQNA 4HLYA 4RA2A 4XNFA 4MTEA 5ED4A 2XAGA 1MIJA 5IOZA 3HGYA 1B6AA 2BV6A 4XLCA 2X85A 4Y7NJ 2FXAA 2M87A 3CDIA 3RDIA 4A3BJ 2O6GE 2L9SA 2LREA 3B6AA 5LHGA 2Z5UA 3HIMA 4KMFA 3D5RC 2CRGA 2O7TA 3BPXA 1IAWA 4M6YA 4O5VA 3CJRB 2DK5A 1OYWA 1NHAA 5EJCA 5FLMJ 1BI3A 3BR6A 3GW2A 4OD5A 4RM3A 3GFMA 5IOYA 4NC7A 4RAGA 1ZK8A 2K85A 3Q9VA 2ZOZA 4LG0A 4LGWA 2LF8A 3DFGA 1OFCX 1YE9A 2K9LA 2LY9A 3CJDA 5DAJA 3L2RA 2LKXA 2K4JA 2LSOA 2ZJ2A 3KP5A 4ZTFA 4WXDA 1MMGA 4E7KA 2ZMEB 5E17F 4EATA 4QIWN 5K7FA 4IHWA 4LJZF 1Q1HA 4IZZA 2OD5A 3WU0A 1DP7P 3LNQA 2UXUA 4ASNA 1SAXA 1SD7A 5K5RA 3FRQA 1A31A 2O3FA 2VPRA 4UVCA 3UNGC 1FT9A 5L3EA 2V9PA 3L2VA 4IX7A 2XGCA 3HTSB 2M1BA 4BE1A 2KJBA 2NNYA 2D45A 2FD5A 3BHQA 2A6HF 2X51A 1I6HJ 4UVBA 3LSGA 2BYVE 2RHAA 2WY8Q 3ML6A 3GZIA 2IGKA 2KRHA 4UB6C 4EM1A 3VP5A 1TW2A 1SFOJ 5BMZA 3F8BA 3W3CA 4ETSA 2EV6A 2LD5A 2YVHA 1STZA 3ABLH 5F04A 4XRSA 3GTJJ 5LGTA 4L9VA 4XMYA 3T5XA 4E70A 4O6JA 4E7ZA 2R93J 2VBXA 5FLXZ 2Y69H 2FJ1A 2ADUA 3CCSI 3V42A 4OMYA 1B1BA 4U0WA 4QPOA 3CUQB 3DKXA 1ETYA 3CJTB 5AQCA 1QO0D 4ZZDA 1BOAA 5FKLA 4XN0A 4W1UA 1AHDP 2Y75A 1K61A 2LTPA 3RPQA 2VXZA 3JRCA 1IRFA 1Z3XA 3ZQLA 5LEJA 1WI3A 3BJOA 3H3VK 2E7WA 4HF2A 1B8IA 2AS5F 1EV7A 3BR0A 4HBLA 4ZYAA 1KQ0A 1P4WA 1OQYA 1H89C 2AQEA 3WHCA 1MJ9A 2W48A 2HZDA 2LFBA 4A6EA 1VTNC 1K78A 4X6AJ 3FHNA 3IC7A 4JNNA 3J7ZI 2GWRA 2YU9J 3OYDA 2GIVA 3WODF 1VQKI 2LNBA 4AC6A 5FLXK 2A05A 2X48A 3GCMA 1Z21A 2EZIA 2QLZA 3ABUA 5FFXA 4RBOA 5FRMA 2NP5A 2KRCA 4HV6A 3CF2A 5H6RA 4XQFA 1DU6A 1FNNA 2B1EA 1VQ9I 1ETVA 4GYIA 2CU7A 2EIKH 1GXPA 3O8HA 5FO5A 5F64A 3E7QA 2XF7A 1Y0UA 1IV8A 1TWHJ 1BW6A 2NX4A 1HKTA 3F8CA 1TW3A 1A36A 3LJLA 1F4KA 2AQFA 1IRZA 2E1MC 3H9JA 3I4PA 2EFQA 1JJ6C 3ESWB 3TKYA 3J81Z 4EJVA 2M45A 4BY1J 5E18F 1RKTA 4S04A 1ZQ3P 4A0YA 2EFOA 3LSMA 4ON0A 4A3GJ 1TP4A 1RZ4A 2Z2SB 2CW7A 2HU9A 3BZ6A 4IQ4A 3LSTA 3VYSB 4QLCU 5L3FA 3PFIA 2CW0F 2W84A 3LMMA 1FYLA 2IEKA 5FJ8J 4DGWB 3FMSA 2ZJQF 2JTVA 3AQTA 1ON1A 4A0XA 1XSDA 2PBXA 2LP0A 2P5KA 1T38A 1S29A 2LMDA 2ZSHB 3GVAA 3VFZA 4C2TA 3LAPA 3S5RA 1FSEA 2IGNA 3V6GA 3CCQI 3TW7A 4EJUA 3KKDA 2FSWA 2ZO4A 1ZYRF 3P9TA 5GTIC 3G3ZA 3N05A 2HTSA 3HRUA 2ZCXA 1QZEA 1R4NB 1O7FA 1OMIA 2L9RA 2RV8A 3KX2A 4HNTA 4ENNA 2XAHA 2DJNA 4AWXB 3BWGA 1T2KA 2EZLA 2PFVA 4KN4X 1IN4A 1A04A 5A2QK 1IN7A 2NRAC 2ME6A 3G71I 1D0ZA 1I3AA 2FQ3A 2Q0OA 2WADA 3IAM2 3VB2A 5JR3A 1X1CA 2I5UA 2XAUA 3H9GA 4JK1X 3F0CA 3HZJA 3ZMSA 2GM4A 2Y31A 5AONA 4HRIA 3O6BB 3F6OA 1D8JA 1SANA 3KKCA 4LB5A 3RQIA 1G2HA 4IPAA 2V9KA 3ZMVA 2IW5A 1VQOI 2DPDA 1JTXA 3BJBA 1RR7A 1S5LC 2IJLA 2W00A 4M72A 1UFMA 5DUKA 4RB1A 1Z77A 2JMWA 3W6KB 2KJCA 3DV8A 1B72A 3IWZA 3OYAA 2COBA 3G1LA 3EUHA 5FKNA 4UNOA 1T95A 2LBFA 2R7OA 3L1PA 3AAFA 4XLNF 5D8KB 5LLQA 4M6VA 3CCVI 2HKXA 1AKHB 3MAJA 2OBPA 1RKWA 4ENKA 5HDKA 2HDDA 3TOAA 2P5LC 2V1XA 4HX8A 5KVRA 2QTQA 1NG7A 4MIMA 1APLC 3HE0A 1I5ZA 2H94A 3E6BA 2VKEA 4A3LJ 4WWCA 2CG4A 3BNIA 4XK4A 1SFUA 1YG2A 4GCVA 3RSNA 4D9JA 1HC8A 5M5XJ 1P6RA 2L2OA 4E7IA 5HNHA 2VQGA 3CESA 2AXLA 4UV9A 2DYRH 1LPQA 1EKEA 4V19K 3B6CA 1K7AA 3ZQ7A 1UJ8A 1ONVA 2CQQA 3GTPJ 3KP6A 4ZYGA 2KL4A 2L4AA 5LHIA 4OOIA 4S0HB 5HDNA 2F5FA 4NQWB 4DYQA 3R0AA 2FBHA 1S9HA 3AL0C 3OOPA 5HODA 4ZDPA 2H27A 1SFKA 1T56A 2M34A 2OCEA 1W7PA 3PASA 4HNVA 3EPZA 2UXNA 2E35A 3HSRA 1OCPA 1MDMB 3CDLA 2LOOA 3PUBA 4HZFA 3LFKA 1UI5A 3J80Z 3VYRB 2IT0A 4Y17A 1BC7C 3VOXA 2JA6J 3VIBA 2IS2A 4Y15A 5EZHA 4U7BA 1G8XA 2IS1A 2D2WA 4CCNA 2HYFA 3IAS2 3EYYA 5JVTA 5EZGA 3BTCA 3E0JB 4ZYDA 2QYOA 5H2FC 3HL2A 1ZHFA 3CQZJ 2M30A 4IHXA 3K4JA 2HOEA 4BYYA 1HKSA 4NNJA 2ESHA 1F43A 4OWRB 5JI6A 5J40A 5EEHA 3BROA 1VF9A 5CXIA 3FXRA 1F5TA 3ZCOA 5TGTA 2W24A 4B09A 3V7SA 3QKXA 2YS9A 3K4CA 2MC3A 4RLFA 5EGOB 1K6YA 4L9NA 5FMPA 5CKTA 4RAYA 2F5CA 1W5TA 1ZRCA 2QBYB 1OLTA 1UHMA 4WXHA 3MKWB 3G56A 2IXSA 2VBYA 2E1MB 1S3JA 2DDAA 2EA2A 3DTIA 4WCGA 3KP7A 3DLLF 4M3EA 2XGDA 5M3MJ 3LSKA 2OERA 4F52A 4RB2C 1YRNB 5HAWA 3DU5A 4A3IJ 3HOVJ 3OS2A 2CW8A 4CCMA 3DBLB 1EJ9A 1FIPA 2KIMA 3ZXSA 5FGMA 1OCCH 2A5WA 2CUZA 4RGUA 3ECOA 3ECHA 1UELB 4CYCA 2JSCA 3OS0A 4D1QA 3GLLA 4BEHA 4YRVA 1HW2A 5LHHA 4II2A 3BR2A 1RR8C 2REKA 4A3FJ 5HLHA 3L2WA 1FMWA 3FXMA 4DZPA 2K9NA 2FMYA 5E20A 5KCMA 2PJRB 1HOMA 2HQ5A 1BI1A 2R7QA 2A3SA 2M0MA 1Z3YA 1EH6A 1UMQA 2JPBA 3U9GA 1WSUA 1U2WA 3K0LA 3PUFA 3WGHA 1R23A 3LA3A 3ZGKA 2BVMA 3HTJA 2X1EA 3OWTA 1TT5B 3K4MA 1T6SA 4U88A 3KEQA 4IRVA 1I3QJ 2ECCA 2L9VA 1KONA 3ZP5A 2UXOA 1WGXA 4XICA 4EGYA 4R8HA 4Y33A 4GCLA 2E5ZA 2EA4A 1G59A 4ESJA 4G6TB 2VUMJ 1XGSA 2VT2A 4AYBN 1ETWA 4I0BA 1W0UA 2YU3A 1IXSB 1BL0A 4N4OB 4F55A 3ROUA 3K7AJ 1FY7A 1N75A 4N4NB 1XC5A 2KZVA 1IN5A 2LY1A 3DQVC 1U3EM 4L5JA 1B9NA 5DM7F 1VQ7I 4A3JJ 1ZRDA 4Q47A 3JRGA
chains in the Genus database with same CATH topology
1IDZA 5IP7J 1ITYA 3G1MA 2GLOA 4A3EJ 2QKOA 2IBDA 5IP9J 1HF0A 2XRLA 3VOKA 1D5YA 4LOCA 2RASA 2DG8A 1TWFJ 4G12A 5EFYA 3HBLA 4C3IJ 4RDUA 2L7FP 5J1YA 5EG0A 2JA7J 1U9OA 2NVQJ 3ON2A 2JWTA 5IOZA 3HGYA 4GCTA 4DW6A 3JRDA 4DZJA 4Y7NJ 3NPIA 2EBIA 2XB5A 5EF6A 4A3BJ 5K58A 3NXCA 1MH3A 2K9SA 3B6AA 2G0EA 1JJ8C 4QSHA 2E2HJ 3BCGA 3F1BA 2UXHA 2YVEA 3IH2A 3GTOJ 3EGQA 2MGQA 3HIMA 5M5WJ 1MSEC 2CRGA 5EEAA 4X1EA 5HBUA 2O7TA 2X9DA 3MVPA 3EUPA 3OOUA 5E3OA 5FLMJ 3BR6A 1E3OC 3S1NJ 5IOYA 1DU0A 3BG3A 1ZK8A 1EF4A 3JREA 2GFNA 2ZOZA 3SJMA 3A02A 1TWAJ 4V2GA 1FTZA 3LHQA 5DAJA 1OFCX 3CJDA 2LY9A 2DA6A 2JA8J 4I76A 2LKXA 3MNLA 1MBGA 1JKPC 3BTJA 3IUVA 2NVXJ 4QIWN 5K7FA 4IHWA 5BNGA 1FEXA 3HGGA 3LNQA 2UXUA 3FRQA 1JT6A 2WAQN 1MNMC 3AQSA 2VPRA 1X2NA 2XGCA 3Q3SA 2DG7A 5K7HA 2M8GX 5DS9A 5M3FJ 2XPWA 3V78A 1JUMA 3HEFA 2FD5A 4D5CA 3BHQA 3GBGA 1I6HJ 4KWAA 1JTYA 1P7JA 3LSGA 2RHAA 2DA4A 3BR1A 3PO2J 3GZIA 1ORKA 4B4CA 3NARA 2RAEA 3LWJA 2FBQA 2OPTA 2LVSA 1JKQC 3VP5A 3TP0A 3ZOBA 1SFOJ 4A3CJ 2H8RA 5F27A 3OIOA 2LD5A 2YVHA 2R92J 3S15J 3I4NJ 2NS8A 5F04A 3O60A 4XRSA 3GTJJ 4UUTA 2DMQA 1YRNA 3W6VA 1H8AC 2R93J 1ETKA 3Q0WA 3JRIA 4ICHA 4XRMA 3NAUA 4MFDA 2ZOYA 4V2FA 2M2EA 2FJ1A 4C3HJ 2FQ4A 3LSPA 1F36A 5F08A 3S16J 1LFBA 2JK3A 1UG2A 2L7ZA 3HKZN 1HCRA 1ETYA 1BA5A 5AQCA 3RH2A 2R5ZA 3ZQHA 4L5EA 2MG4A 2L0KA 2NVYJ 5FKLA 4W1UA 5FKKA 4D5FA 1R9TJ 1K61A 2LTPA 1AHDP 3M3YJ 2DA5A 3T6NA 3JRCA 3ZQLA 2HYJA 1WI3A 2ID3A 3H3VK 3ANGA 5IPAA 1U8BA 1B8IA 5FHPA 1RESA 3BR0A 1H89C 2DA7A 1A5JA 3WHCA 2G7GA 2W48A 2LFBA 4X6AJ 4FE7A 3QQAA 3S14J 2GUHA 1AKHA 4JNNA 5D18A 3ZQFA 2YU9J 2UXPA 4MK6A 1JGGA 2MW8A 2DN0A 4ACIA 4AC6A 3BQZA 2X48A 2EZIA 3S17J 2LR8A 4RBOA 3E7LA 2Y9ZA 4M3DA 2NP5A 1SGMA 4GFKA 1DU6A 2Q24A 4BY7J 1U78A 1ZKGA 4JX4A 3HOXJ 5D19A 1ETVA 2CU7A 1WPKA 1XG1A 5EYRA 3O8HA 4NELA 3M4OJ 1MBKA 5F1JA 2LK2A 2XPUA 3E7QA 2CQXA 5FGLA 3MKLA 4I6ZA 4UUSA 1TWHJ 3NI7A 1BW6A 2NX4A 1T33A 3GTKJ 2E19A 1MBEA 3LJLA 2YUSA 1TC3C 2O7OA 4GCKA 3JRAA 1UHSA 1IRZA 3GTMJ 5F0CA 3BG9A 4B1RA 3H0GJ 1PUFA 1O4XA 1JJ6C 2DA3A 1RETA 2IU5A 4C3JJ 4JX6A 4BY1J 3DPJA 1RKTA 1ZQ3P 2EQRA 5FKMA 4A3GJ 1ETOA 1JT0A 1HDPA 1Z0XA 1ZR4A 1JKRC 1IC8A 2TCTA 2P81A 2WV1A 2IEKA 2L7MP 5FJ8J 1ETQA 3LOCA 3AQTA 2PBXA 2DMUA 2LP0A 2EZHA 5GP9A 3ZQGA 5CW8A 2HOAA 1JUSA 2LLKA 3IH3A 4AUXA 3S5RA 3V6GA 3NRGA 3TW7A 4FCYA 3KKDA 3KNWA 1VI0A 1QPIA 3A01A 3OSFA 3P9TA 3CRJA 4JP0A 1VNDA 1LE8A 2ZCXA 4CYCB 2L9RA 4W97A 1HLVA 4IHVA 3O8GA 2DJNA 3JR9A 3S2DJ 2DA2A 2EZLA 1TWCJ 1IG7A 5J3LA 2QCOA 3JRBA 1QVUA 2JN6A 5GPAA 5EGOA 3G1OA 4ME9A 3HOUJ 2ME6A 1OJLA 3IH4A 2GENA 2XSDC 3RKQA 3S2HJ 1A6IA 3HDDA 2R5YA 3F0CA 2GM4A 2PMZN 2Y31A 5E3LA 3FIWA 1SANA 3KKCA 3TW6A 1FTTA 1H88C 3RQIA 5E3MA 1G2HA 3COLA 1Y1WJ 2HYTA 2QIBA 2X6OA 4XRSG 1JTXA 2B63J 3BJBA 3BRUA 1RR7A 4BBRJ 1W0TA 5IP6A 2AO9A 2HXIA 4A3MJ 3TP3A 2W53A 2EH3A 1Z77A 2JMWA 5E3NA 4L62A 4MXMA 1B72A 1JUPA 4QTRA 2COBA 3G1LA 5FKNA 4BXXJ 3ON4A 3L1PA 1MBHA 3VUQA 1Y1VJ 2M0CA 1VFCA 5FLVA 4M6VA 1AKHB 1RKWA 9ANTA 2XB0X 2HDDA 1FIAA 2ELKA 5JLXA 1IDYA 2DMPA 1S7EA 5C3EJ 2QTQA 2NVTJ 4MIMA 1APLC 3HE0A 1CQTA 1GV5A 3PPBA 2VKEA 4A3LJ 3S1QJ 3BNIA 3VW1A 4XK4A 1WH7A 1X2MA 3HOYJ 3CMYA 3BTIA 3PM1A 5M5YJ 1MH4A 3GTQJ 4JX5A 3FK6A 5M5XJ 3HB9A 2QF7A 1JKOC 1K83J 4AC0A 5EG0B 1IV6A 4MFEA 1RPWA 2EZKA 4UUSB 3C07A 2CUEA 3BG5A 4MO7A 1ENHA 3B6CA 4M3FA 5H9TA 1GDTA 3RZOJ 3SDGA 4BKXA 2CQQA 3JRFA 2AHQA 4A3KJ 5IYBJ 2CJJA 3GTPJ 3PO3J 4AF5A 1WH5A 3KZ9A 3BQYA 4FTHA 4S0HB 1PUFB 2XGEA 4DYQA 5IYDJ 3JRHA 1HDDC 3Q0UA 3HOWJ 2G3BA 3C2BA 5HODA 3LSRA 3D1NI 4NDLA 1T56A 2M34A 2UXIA 2HOSA 5D1RA 3PASA 4HKUA 4HNVA 4CGRA 2G7SA 1OCPA 3CDLA 1LFUP 3HTIA 1QRYA 3MN2A 2XPVA 2V57A 3OSGA 3VVXA 1OCTC 3GTGJ 1UI5A 2OI8A 2E1OA 2IAIA 3VOXA 2Y0SN 2JA6J 3VIBA 2ZCMA 2H1KA 5EZHA 3QPLA 1NK3P 3G7RA 4A69C 3JSJA 1NK2P 1BJZA 4MLOA 1GV2A 2VKVA 2R0QC 2WB1N 3BTCA 5EZGA 1IJWC 4A93J 2K40A 2JJ7A 4M3GA 5IYCJ 5CXGA 3CQZJ 4IEJA 3A01B 4IHXA 4BBSJ 3GTLJ 3RZDJ 1LE8B 3TEDA 2ME0A 5C4YA 1GVDA 3BT9A 3FISA 1FJLA 1F43A 4PXIA 4A3DJ 3HOZJ 1VF9A 2DA1A 4DYRA 3VPRA 5CXIA 3QKXA 2YS9A 5J1UA 2DMTA 2D6YA 2WGBA 5EGOB 2O8KA 5FMPA 2HI3A 3UKGA 2JA5J 1GT0C 2QOPA 3WHBA 4FISA 4D7MA 5DTDA 1IUFA 1MBFA 2VI6A 4FE4A 3SFIA 3G56A 3BTLA 3S1RJ 4M3BA 5EDNA 2R5YB 4JL3A 1WCMJ 3GEUA 2GBYA 4NN1A 2KDZA 4M3EA 2HOTA 5GPCA 2XGDA 2XDNA 5M3MJ 2OERA 1QVTA 3ZQCA 3VVZA 2ID6A 2MSYA 1YRNB 5HAWA 1TWGJ 3CWRA 2WUIA 4A3IJ 3HOVJ 2F07A 2NS7A 2G7LA 2FX0A 3HTHA 2R7ZJ 1FIPA 2E2JJ 1BW5A 3A03A 1ZR2A 2CUFA 2DTZA 3I4MJ 2K9QA 4YZEA 4JKZA 4CYCA 2D5VA 4C2MJ 2R5ZB 3VW0A 1AU7A 2KT0A 2O9LA 1B72B 3BR2A 4XIDA 5C4XJ 2REKA 4A3FJ 4DZPA 2K9NA 3K2AA 4DYCA 3VW2A 1HOMA 2HQ5A 3DCFA 1P7IA 3NNRA 1POGA 1Q1VA 3BR5A 1B8IB 5HSZA 1UMQA 1GUUA 1U9NA 4D7NA 3IV5A 1UI6A 3QBMA 3DEWA 1I50J 5FKOA 1NTCA 3BR3A 3HTJA 3ZQIA 1MSFC 4GFLA 1IGNA 1ZGWA 4J19A 2OF7A 3Q0VA 3RD3A 1I3QJ 3FK7A 2ECCA 2ZB9A 2ECBA 2UXOA 2HXOA 1ZTRA 1WGXA 3B81A 2PZ9A 4UDSA 5F0HA 4XICA 4Y52J 5F0FA 2Y9YA 2QWTA 4GCLA 3VVYA 3QPSA 2E2IJ 5C4JJ 2VUMJ 2M9HA 4AYBN 1ETWA 4B3AA 3HM5A 5C44J 1W0UA 3CCYA 2N8GA 1ETXA 2Y30A 1BL0A 2ZCNA 2NOGA 4ABZA 3K7AJ 5K7ZA 5JLWA 3S1MJ 2TRTA 4JYKA 1XC5A 2DMNA 4IHYA 2NP3A 1MBJA 1X58A 3FKIJ 1XS9A 4GFBA 2HKUA 5J1RA 2I10A 2Y2ZA 4EEFG 4A3JJ 3ANPA 3HTAA 3JRGA 3LSJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IDZ A;  5IP7 J;  1ITY A;  3G1M A;  2GLO A;  4A3E J;  2QKO A;  2IBD A;  5IP9 J;  1HF0 A;  2XRL A;  3VOK A;  1D5Y A;  4LOC A;  2RAS A;  2DG8 A;  1TWF J;  4G12 A;  5EFY A;  3HBL A;  4C3I J;  4RDU A;  2L7F P;  5J1Y A;  5EG0 A;  2JA7 J;  1U9O A;  2NVQ J;  3ON2 A;  2JWT A;  5IOZ A;  3HGY A;  4GCT A;  4DW6 A;  3JRD A;  4DZJ A;  4Y7N J;  3NPI A;  2EBI A;  2XB5 A;  5EF6 A;  4A3B J;  5K58 A;  3NXC A;  1MH3 A;  2K9S A;  3B6A A;  2G0E A;  1JJ8 C;  4QSH A;  2E2H J;  3BCG A;  3F1B A;  2UXH A;  2YVE A;  3IH2 A;  3GTO J;  3EGQ A;  2MGQ A;  3HIM A;  5M5W J;  1MSE C;  2CRG A;  5EEA A;  4X1E A;  5HBU A;  2O7T A;  2X9D A;  3MVP A;  3EUP A;  3OOU A;  5E3O A;  5FLM J;  3BR6 A;  1E3O C;  3S1N J;  5IOY A;  1DU0 A;  3BG3 A;  1ZK8 A;  1EF4 A;  3JRE A;  2GFN A;  2ZOZ A;  3SJM A;  3A02 A;  1TWA J;  4V2G A;  1FTZ A;  3LHQ A;  5DAJ A;  1OFC X;  3CJD A;  2LY9 A;  2DA6 A;  2JA8 J;  4I76 A;  2LKX A;  3MNL A;  1MBG A;  1JKP C;  3BTJ A;  3IUV A;  2NVX J;  4QIW N;  5K7F A;  4IHW A;  5BNG A;  1FEX A;  3HGG A;  3LNQ A;  2UXU A;  3FRQ A;  1JT6 A;  2WAQ N;  1MNM C;  3AQS A;  2VPR A;  1X2N A;  2XGC A;  3Q3S A;  2DG7 A;  5K7H A;  2M8G X;  5DS9 A;  5M3F J;  2XPW A;  3V78 A;  1JUM A;  3HEF A;  2FD5 A;  4D5C A;  3BHQ A;  3GBG A;  1I6H J;  4KWA A;  1JTY A;  1P7J A;  3LSG A;  2RHA A;  2DA4 A;  3BR1 A;  3PO2 J;  3GZI A;  1ORK A;  4B4C A;  3NAR A;  2RAE A;  3LWJ A;  2FBQ A;  2OPT A;  2LVS A;  1JKQ C;  3VP5 A;  3TP0 A;  3ZOB A;  1SFO J;  4A3C J;  2H8R A;  5F27 A;  3OIO A;  2LD5 A;  2YVH A;  2R92 J;  3S15 J;  3I4N J;  2NS8 A;  5F04 A;  3O60 A;  4XRS A;  3GTJ J;  4UUT A;  2DMQ A;  1YRN A;  3W6V A;  1H8A C;  2R93 J;  1ETK A;  3Q0W A;  3JRI A;  4ICH A;  4XRM A;  3NAU A;  4MFD A;  2ZOY A;  4V2F A;  2M2E A;  2FJ1 A;  4C3H J;  2FQ4 A;  3LSP A;  1F36 A;  5F08 A;  3S16 J;  1LFB A;  2JK3 A;  1UG2 A;  2L7Z A;  3HKZ N;  1HCR A;  1ETY A;  1BA5 A;  5AQC A;  3RH2 A;  2R5Z A;  3ZQH A;  4L5E A;  2MG4 A;  2L0K A;  2NVY J;  5FKL A;  4W1U A;  5FKK A;  4D5F A;  1R9T J;  1K61 A;  2LTP A;  1AHD P;  3M3Y J;  2DA5 A;  3T6N A;  3JRC A;  3ZQL A;  2HYJ A;  1WI3 A;  2ID3 A;  3H3V K;  3ANG A;  5IPA A;  1U8B A;  1B8I A;  5FHP A;  1RES A;  3BR0 A;  1H89 C;  2DA7 A;  1A5J A;  3WHC A;  2G7G A;  2W48 A;  2LFB A;  4X6A J;  4FE7 A;  3QQA A;  3S14 J;  2GUH A;  1AKH A;  4JNN A;  5D18 A;  3ZQF A;  2YU9 J;  2UXP A;  4MK6 A;  1JGG A;  2MW8 A;  2DN0 A;  4ACI A;  4AC6 A;  3BQZ A;  2X48 A;  2EZI A;  3S17 J;  2LR8 A;  4RBO A;  3E7L A;  2Y9Z A;  4M3D A;  2NP5 A;  1SGM A;  4GFK A;  1DU6 A;  2Q24 A;  4BY7 J;  1U78 A;  1ZKG A;  4JX4 A;  3HOX J;  5D19 A;  1ETV A;  2CU7 A;  1WPK A;  1XG1 A;  5EYR A;  3O8H A;  4NEL A;  3M4O J;  1MBK A;  5F1J A;  2LK2 A;  2XPU A;  3E7Q A;  2CQX A;  5FGL A;  3MKL A;  4I6Z A;  4UUS A;  1TWH J;  3NI7 A;  1BW6 A;  2NX4 A;  1T33 A;  3GTK J;  2E19 A;  1MBE A;  3LJL A;  2YUS A;  1TC3 C;  2O7O A;  4GCK A;  3JRA A;  1UHS A;  1IRZ A;  3GTM J;  5F0C A;  3BG9 A;  4B1R A;  3H0G J;  1PUF A;  1O4X A;  1JJ6 C;  2DA3 A;  1RET A;  2IU5 A;  4C3J J;  4JX6 A;  4BY1 J;  3DPJ A;  1RKT A;  1ZQ3 P;  2EQR A;  5FKM A;  4A3G J;  1ETO A;  1JT0 A;  1HDP A;  1Z0X A;  1ZR4 A;  1JKR C;  1IC8 A;  2TCT A;  2P81 A;  2WV1 A;  2IEK A;  2L7M P;  5FJ8 J;  1ETQ A;  3LOC A;  3AQT A;  2PBX A;  2DMU A;  2LP0 A;  2EZH A;  5GP9 A;  3ZQG A;  5CW8 A;  2HOA A;  1JUS A;  2LLK A;  3IH3 A;  4AUX A;  3S5R A;  3V6G A;  3NRG A;  3TW7 A;  4FCY A;  3KKD A;  3KNW A;  1VI0 A;  1QPI A;  3A01 A;  3OSF A;  3P9T A;  3CRJ A;  4JP0 A;  1VND A;  1LE8 A;  2ZCX A;  4CYC B;  2L9R A;  4W97 A;  1HLV A;  4IHV A;  3O8G A;  2DJN A;  3JR9 A;  3S2D J;  2DA2 A;  2EZL A;  1TWC J;  1IG7 A;  5J3L A;  2QCO A;  3JRB A;  1QVU A;  2JN6 A;  5GPA A;  5EGO A;  3G1O A;  4ME9 A;  3HOU J;  2ME6 A;  1OJL A;  3IH4 A;  2GEN A;  2XSD C;  3RKQ A;  3S2H J;  1A6I A;  3HDD A;  2R5Y A;  3F0C A;  2GM4 A;  2PMZ N;  2Y31 A;  5E3L A;  3FIW A;  1SAN A;  3KKC A;  3TW6 A;  1FTT A;  1H88 C;  3RQI A;  5E3M A;  1G2H A;  3COL A;  1Y1W J;  2HYT A;  2QIB A;  2X6O A;  4XRS G;  1JTX A;  2B63 J;  3BJB A;  3BRU A;  1RR7 A;  4BBR J;  1W0T A;  5IP6 A;  2AO9 A;  2HXI A;  4A3M J;  3TP3 A;  2W53 A;  2EH3 A;  1Z77 A;  2JMW A;  5E3N A;  4L62 A;  4MXM A;  1B72 A;  1JUP A;  4QTR A;  2COB A;  3G1L A;  5FKN A;  4BXX J;  3ON4 A;  3L1P A;  1MBH A;  3VUQ A;  1Y1V J;  2M0C A;  1VFC A;  5FLV A;  4M6V A;  1AKH B;  1RKW A;  9ANT A;  2XB0 X;  2HDD A;  1FIA A;  2ELK A;  5JLX A;  1IDY A;  2DMP A;  1S7E A;  5C3E J;  2QTQ A;  2NVT J;  4MIM A;  1APL C;  3HE0 A;  1CQT A;  1GV5 A;  3PPB A;  2VKE A;  4A3L J;  3S1Q J;  3BNI A;  3VW1 A;  4XK4 A;  1WH7 A;  1X2M A;  3HOY J;  3CMY A;  3BTI A;  3PM1 A;  5M5Y J;  1MH4 A;  3GTQ J;  4JX5 A;  3FK6 A;  5M5X J;  3HB9 A;  2QF7 A;  1JKO C;  1K83 J;  4AC0 A;  5EG0 B;  1IV6 A;  4MFE A;  1RPW A;  2EZK A;  4UUS B;  3C07 A;  2CUE A;  3BG5 A;  4MO7 A;  1ENH A;  3B6C A;  4M3F A;  5H9T A;  1GDT A;  3RZO J;  3SDG A;  4BKX A;  2CQQ A;  3JRF A;  2AHQ A;  4A3K J;  5IYB J;  2CJJ A;  3GTP J;  3PO3 J;  4AF5 A;  1WH5 A;  3KZ9 A;  3BQY A;  4FTH A;  4S0H B;  1PUF B;  2XGE A;  4DYQ A;  5IYD J;  3JRH A;  1HDD C;  3Q0U A;  3HOW J;  2G3B A;  3C2B A;  5HOD A;  3LSR A;  3D1N I;  4NDL A;  1T56 A;  2M34 A;  2UXI A;  2HOS A;  5D1R A;  3PAS A;  4HKU A;  4HNV A;  4CGR A;  2G7S A;  1OCP A;  3CDL A;  1LFU P;  3HTI A;  1QRY A;  3MN2 A;  2XPV A;  2V57 A;  3OSG A;  3VVX A;  1OCT C;  3GTG J;  1UI5 A;  2OI8 A;  2E1O A;  2IAI A;  3VOX A;  2Y0S N;  2JA6 J;  3VIB A;  2ZCM A;  2H1K A;  5EZH A;  3QPL A;  1NK3 P;  3G7R A;  4A69 C;  3JSJ A;  1NK2 P;  1BJZ A;  4MLO A;  1GV2 A;  2VKV A;  2R0Q C;  2WB1 N;  3BTC A;  5EZG A;  1IJW C;  4A93 J;  2K40 A;  2JJ7 A;  4M3G A;  5IYC J;  5CXG A;  3CQZ J;  4IEJ A;  3A01 B;  4IHX A;  4BBS J;  3GTL J;  3RZD J;  1LE8 B;  3TED A;  2ME0 A;  5C4Y A;  1GVD A;  3BT9 A;  3FIS A;  1FJL A;  1F43 A;  4PXI A;  4A3D J;  3HOZ J;  1VF9 A;  2DA1 A;  4DYR A;  3VPR A;  5CXI A;  3QKX A;  2YS9 A;  5J1U A;  2DMT A;  2D6Y A;  2WGB A;  5EGO B;  2O8K A;  5FMP A;  2HI3 A;  3UKG A;  2JA5 J;  1GT0 C;  2QOP A;  3WHB A;  4FIS A;  4D7M A;  5DTD A;  1IUF A;  1MBF A;  2VI6 A;  4FE4 A;  3SFI A;  3G56 A;  3BTL A;  3S1R J;  4M3B A;  5EDN A;  2R5Y B;  4JL3 A;  1WCM J;  3GEU A;  2GBY A;  4NN1 A;  2KDZ A;  4M3E A;  2HOT A;  5GPC A;  2XGD A;  2XDN A;  5M3M J;  2OER A;  1QVT A;  3ZQC A;  3VVZ A;  2ID6 A;  2MSY A;  1YRN B;  5HAW A;  1TWG J;  3CWR A;  2WUI A;  4A3I J;  3HOV J;  2F07 A;  2NS7 A;  2G7L A;  2FX0 A;  3HTH A;  2R7Z J;  1FIP A;  2E2J J;  1BW5 A;  3A03 A;  1ZR2 A;  2CUF A;  2DTZ A;  3I4M J;  2K9Q A;  4YZE A;  4JKZ A;  4CYC A;  2D5V A;  4C2M J;  2R5Z B;  3VW0 A;  1AU7 A;  2KT0 A;  2O9L A;  1B72 B;  3BR2 A;  4XID A;  5C4X J;  2REK A;  4A3F J;  4DZP A;  2K9N A;  3K2A A;  4DYC A;  3VW2 A;  1HOM A;  2HQ5 A;  3DCF A;  1P7I A;  3NNR A;  1POG A;  1Q1V A;  3BR5 A;  1B8I B;  5HSZ A;  1UMQ A;  1GUU A;  1U9N A;  4D7N A;  3IV5 A;  1UI6 A;  3QBM A;  3DEW A;  1I50 J;  5FKO A;  1NTC A;  3BR3 A;  3HTJ A;  3ZQI A;  1MSF C;  4GFL A;  1IGN A;  1ZGW A;  4J19 A;  2OF7 A;  3Q0V A;  3RD3 A;  1I3Q J;  3FK7 A;  2ECC A;  2ZB9 A;  2ECB A;  2UXO A;  2HXO A;  1ZTR A;  1WGX A;  3B81 A;  2PZ9 A;  4UDS A;  5F0H A;  4XIC A;  4Y52 J;  5F0F A;  2Y9Y A;  2QWT A;  4GCL A;  3VVY A;  3QPS A;  2E2I J;  5C4J J;  2VUM J;  2M9H A;  4AYB N;  1ETW A;  4B3A A;  3HM5 A;  5C44 J;  1W0U A;  3CCY A;  2N8G A;  1ETX A;  2Y30 A;  1BL0 A;  2ZCN A;  2NOG A;  4ABZ A;  3K7A J;  5K7Z A;  5JLW A;  3S1M J;  2TRT A;  4JYK A;  1XC5 A;  2DMN A;  4IHY A;  2NP3 A;  1MBJ A;  1X58 A;  3FKI J;  1XS9 A;  4GFB A;  2HKU A;  5J1R A;  2I10 A;  2Y2Z A;  4EEF G;  4A3J J;  3ANP A;  3HTA A;  3JRG A;  3LSJ A; 
#chains in the Genus database with same CATH topology
 1IDZ A;  3HUG A;  2FA5 A;  3U21 A;  2IBD A;  3RYP A;  3KP3 A;  1KU9 A;  5HS8 A;  5ILU A;  2BY0 A;  2ZXH A;  2DG8 A;  4DNC A;  4XOT A;  3ERM A;  2BW3 A;  3K4K A;  5J1Y A;  4RGX A;  1P9Q C;  1O7L A;  4KIB A;  4BAC A;  1PUE E;  3GZ5 A;  3LWF A;  2JT1 A;  3F6V A;  1X1A A;  3M8J A;  1PYV A;  1V3F A;  4DZJ A;  3GO5 A;  3NPI A;  2XGX A;  2XB5 A;  5E79 C;  4F3Q A;  5EF6 A;  3NXC A;  1MH3 A;  2NVU B;  3IUO A;  3H3Z A;  3HPH A;  2BEO A;  3DEU A;  1N78 A;  3FXL A;  3HHH A;  4LB6 B;  2W82 A;  3IH2 A;  2FE3 A;  1K79 A;  2MGQ A;  3HSF A;  5M5W J;  1RNL A;  5EEA A;  3ERE D;  3OYN A;  2HVR A;  2H6C A;  2X9D A;  4HYE A;  2HVS A;  3MVP A;  3OOU A;  3GUD A;  2F6C A;  1YJ9 I;  3C18 A;  1T08 B;  2TDX A;  3AG4 H;  2O8X A;  1S72 I;  2GFN A;  3SJM A;  3LFU A;  1TWA J;  3Q9S A;  4V2G A;  4Z6Y A;  3LHQ A;  1WJA A;  5AIP A;  4XLH A;  3UR3 C;  3AL0 B;  1LEB A;  2GA1 A;  4I76 A;  1R22 A;  2R3S A;  3CMM A;  4PJ0 C;  3MMY B;  3MNL A;  4PJL A;  4Z2Y A;  3KIO A;  4KNY A;  1X4O A;  3BTJ A;  1XPX A;  3IUV A;  4E7J A;  3M9A A;  4C9Y A;  4M9Z A;  3M7G A;  1FEX A;  3HGG A;  3GF2 A;  5DCM B;  3KZI C;  1MNM C;  3AQS A;  4BS9 A;  4HDV A;  2Z9O A;  4ZTJ A;  2M8G X;  2GQQ A;  4IOC F;  5M3F J;  3V78 A;  3HEF A;  3S3M A;  3DU6 A;  4D5C A;  1QBJ A;  1TTY A;  3ZPL A;  4EJT A;  4KWA A;  1JTY A;  1P7J A;  4B4C A;  2HPI A;  3HSE A;  1ACI A;  2H8W A;  3LWJ A;  1LVK A;  2FBQ A;  1FP1 D;  2LVS A;  2QKL B;  3TP0 A;  2H8R A;  2MBF A;  2VE8 A;  3OIO A;  1WJD A;  3DWL E;  3S15 J;  2OTJ I;  2OJE D;  1MMN A;  3R61 A;  4BQO A;  5LGU A;  2WTE A;  2JQ7 A;  5E8I A;  4UUT A;  3I59 B;  2R7F A;  1H8A C;  1VQ4 I;  4ICH A;  5JFR A;  2ZOY A;  2PBI A;  2M2E A;  1FOW A;  2KZG A;  4C3H J;  2FQ4 A;  2A5Y B;  5F08 A;  5B5E C;  2DPU A;  3CC4 I;  4EMS A;  3HOS A;  2JK3 A;  1MJA A;  1MW7 A;  1D1B A;  5JVG F;  1R00 A;  3ABM H;  3P5J A;  2L7Z A;  3HKZ N;  2OAZ A;  1HCR A;  1BA5 A;  1JI8 A;  2E60 A;  2R5Z A;  1I39 A;  4YG2 F;  3E3V A;  2L0K A;  2NVY J;  5IT9 Z;  1BI2 A;  3NQO A;  2ZJP F;  3HRT A;  3K1N A;  4BXF A;  3M3Y J;  3KCC A;  4AD9 A;  1T98 A;  1AOY A;  2RC4 A;  4AYB A;  3ANG A;  2CV2 A;  3H9Q A;  4BDZ A;  2EK5 A;  1HQC A;  4G8X A;  1R1T A;  2E1N A;  2G7G A;  1YOV B;  4UXN A;  3K8P C;  4DIQ A;  4F93 B;  4FE7 A;  5D18 A;  2XV4 S;  3S14 J;  1X4P A;  3ZQF A;  3KP4 A;  4UHT A;  2UXP A;  1JGG A;  2MW8 A;  2DN0 A;  4Y4R A;  5LGN A;  3L00 A;  3V8K A;  5CPR B;  2K4B A;  3S17 J;  2QM3 A;  1SMY F;  2LR8 A;  2UV1 A;  4L0Z B;  2EB7 A;  3RKY A;  5GAH J;  3I56 I;  3SZT A;  1U78 A;  3HOX J;  1XG1 A;  2IPQ X;  1I1S A;  3I55 I;  1VQ6 I;  3M4O J;  2LK2 A;  5IT9 K;  3OYI A;  3K9T A;  5FGL A;  5J47 A;  4OIN F;  4UUS A;  2DOA A;  4LLL A;  3L2Q A;  3NI7 A;  2BVL A;  5DD8 A;  3T8R A;  1MBE A;  1MGT A;  3DPL C;  1TC3 C;  2O7O A;  2R7R A;  1K6O A;  2PN6 A;  3GTM J;  3L09 A;  4RGS A;  3BG9 A;  1E3H A;  2B0L A;  2GOM A;  3DKY A;  4IRG A;  5CLS A;  1T39 A;  4PFO A;  3K10 A;  4LG0 B;  2A2F X;  3O2P E;  1ZLJ A;  4EV0 A;  2P5V A;  2TCT A;  2BY3 A;  2P81 A;  2WV1 A;  3OL4 A;  5GAD J;  1P4A A;  2L7M P;  3WTU C;  1ETQ A;  2VC1 A;  1VQ8 I;  3OR2 C;  4EGZ A;  1XSX A;  2HOA A;  1JUS A;  2LLK A;  3EUH C;  4K2E A;  2GXB A;  2R7V A;  3MKY B;  1OCR H;  3HOT A;  4CYD A;  2E34 A;  5CVI A;  5KK1 A;  1IXR C;  1WRJ A;  3AG3 H;  1QPI A;  5FFZ A;  1Z9C A;  2HR3 A;  3EET A;  3KE2 A;  3I0T A;  1VND A;  4JP0 A;  3A0B C;  2J5P A;  1LE8 A;  1XCV A;  1R5H A;  2UWM A;  1IW7 F;  5HS9 A;  3JR9 A;  1FMV A;  2K3P A;  2DA2 A;  4CCJ A;  2FNP A;  2K86 A;  3FDY A;  3PIP F;  3H5R A;  4E6K G;  3CLQ A;  1X1P A;  1D1C A;  4X0G A;  1OJL A;  3IH4 A;  5CVJ A;  1LVA A;  3REO A;  2XSD C;  1U8R A;  4RS8 A;  3RKQ A;  3CDH A;  3S2H J;  1A6I A;  2UXX A;  3NWS A;  2PMZ N;  4XLE A;  3P7N A;  1LEA A;  3TMO A;  4CXF A;  1H88 C;  3COL A;  2HYT A;  2QIB A;  1FBU A;  1V54 H;  1HW5 A;  2X6O A;  2B63 J;  3BRU A;  4XOP A;  4BBR J;  1H9T A;  3F72 A;  3HKZ A;  4I09 A;  2XF5 A;  2HQR A;  3ONQ A;  3QRF F;  4RM2 A;  1OCZ H;  1WJF A;  3FXK A;  3HTU A;  2EH3 A;  2I8D A;  1PP7 U;  3N4M A;  3OR1 C;  1SC7 A;  2LYC A;  4HPQ A;  4N9H A;  5KHD A;  4QTR A;  2F2E A;  1YS7 A;  4FHT A;  4CIC A;  1WJB A;  4BXX J;  4I0A A;  3OS1 A;  3DF8 A;  4KIG A;  1MBH A;  3VUQ A;  3K4L A;  1K78 B;  3GLX A;  2KPM A;  3BCA A;  3D5L A;  3SXY A;  4RB0 A;  3LQR A;  5LRR A;  9ANT A;  1GLN A;  4HAM A;  1IDY A;  1X1D A;  2BY2 A;  1S7E A;  1GV5 A;  1RUO A;  1UST A;  5LRS A;  2XAS A;  3H5A A;  3CMY A;  3HIF A;  3OYF A;  2DFH A;  3H3U A;  1ULY A;  2XSJ C;  4LLG F;  3S3N A;  1XD7 A;  3WTZ A;  3HB9 A;  4HDU A;  1LJ9 A;  2OV7 A;  4BHB A;  4ZH4 F;  4MFE A;  5EG0 B;  1IV6 A;  1W7P D;  3C07 A;  2MAB A;  2K9M A;  3OYG A;  1QA6 A;  1ENH A;  4G7O F;  4RLQ A;  3GYH X;  1E0E A;  4HOB A;  5IY5 H;  2AHQ A;  4A3K J;  3I54 A;  3BZC A;  1C0W A;  2M8E A;  4HW0 A;  4AF5 A;  4BE2 A;  1T0F A;  5HLT A;  4FTH A;  2HWV A;  2XGE A;  3GZN B;  3DKW A;  3JRH A;  1EH7 A;  1HDD C;  1A35 A;  3QOP A;  2VE9 A;  2G3B A;  1B59 A;  1QPM A;  4NDL A;  2EFN A;  2MLK A;  5D1R A;  4PFP A;  4GGG A;  5BQT A;  3SDB A;  2CO5 A;  2P6T A;  6PAX A;  4CGR A;  2BZT A;  5HVQ C;  1LFU P;  2VJ4 A;  1R71 A;  3KPH A;  3MN2 A;  2XPV A;  3C7J A;  3PNY A;  3OSG A;  4M71 A;  1LB2 A;  3GTG J;  1JGS A;  5B1B H;  2Z3Y A;  2E1O A;  2IAI A;  1WHU A;  2F4O B;  4IVN A;  3WTX C;  2ZCM A;  1NK3 P;  3QPL A;  4O3M A;  4G6Q A;  4CCK A;  4A69 C;  3G7R A;  3JSJ A;  3FXQ A;  1GV2 A;  4RAZ A;  2EIL H;  2QZ8 A;  3R0J A;  2WB1 N;  1IJW C;  2XUB A;  5CVV A;  3TOB A;  4BJT A;  1IUY A;  3IL2 A;  4M3G A;  5IYC J;  4IEJ A;  1FPQ A;  3RKW A;  4LFU A;  1BI0 A;  2CQK A;  4D0P A;  5JHF A;  3T0Y A;  4BBS J;  3GTL J;  3LQQ A;  3TED A;  2VL8 A;  3BT9 A;  3LL7 A;  2HTJ A;  1FJL A;  2VLA A;  3VWB A;  2QUF A;  2MFZ A;  3GME A;  1R49 A;  2DA1 A;  3RJP A;  2YVX A;  2P8T A;  2CUJ A;  2WGB A;  2GA2 A;  3CUO A;  2F48 A;  2CGP A;  3OYE A;  5HLI A;  4AM3 A;  2HI3 A;  3UKG A;  1QU3 A;  2HNH A;  2JA5 J;  1GT0 C;  2QOP A;  4D7M A;  4FIS A;  3VYU B;  2DOE A;  2DU9 A;  3J81 K;  5DTD A;  1IUF A;  2DAO A;  3SFI A;  5K5Q A;  3BTL A;  4RGR A;  4IJA A;  5EDN A;  3KZY A;  1UB9 A;  2GBY A;  1TQI A;  2PG4 A;  1VQP I;  2XDN A;  2L02 A;  3PQJ A;  1QVT A;  3ZQC A;  3VVZ A;  4LK0 F;  1YLF A;  4Q4Z F;  2KFD A;  2PMZ A;  3CWR A;  2VXD A;  5HS7 A;  2MYS A;  2NS7 A;  2F07 A;  2JA2 A;  1G6N A;  2KHM A;  2YPR A;  4G6D A;  2E2J J;  2V1D A;  3A03 A;  1DGR M;  2CUF A;  2DTZ A;  3I4M J;  2K9Q A;  2QSG X;  4JKZ A;  3S8P A;  4WX9 A;  3E5Q A;  4C2M J;  4HX7 A;  2O9L A;  1B72 B;  1XDU A;  3WE2 A;  2XIG A;  2LBF B;  3VTI A;  2HPM A;  3DCF A;  3FWE A;  2FF4 A;  3BJ6 A;  1X3U A;  3X2Q H;  5DV5 A;  4B44 A;  3NNR A;  3BR5 A;  3F21 A;  2Q8K A;  1GUU A;  4BHP A;  4BDY A;  1YIT I;  4IRI A;  2VAS A;  1UI6 A;  3FXU A;  3V8L A;  3QBM A;  5ILS A;  1U5T A;  3VSL A;  1XX5 A;  3BR3 A;  3E6M A;  5KNL A;  3WGG A;  3J7Y J;  1MJB A;  3T1B A;  2V9V A;  3Q0V A;  3IRQ A;  3AG1 H;  4P9U A;  3FK7 A;  1R4M B;  4L5I A;  4HX4 A;  4ITV A;  5GAG J;  2B7E A;  2M4K A;  3KLN A;  4CCL A;  2PZ9 A;  5F0H A;  4DQ2 A;  2OZU A;  2VN2 A;  5F0F A;  3J7A O;  2Y9Y A;  1VQN I;  2LY2 A;  2DQL A;  2M9H A;  2DQR A;  2R7D A;  4B3A A;  1J7K A;  4NC8 A;  1E17 A;  2ZCN A;  4IXA A;  3AG2 H;  2NNN A;  4IL6 C;  4ABZ A;  5K7Z A;  5JLW A;  3I71 A;  3M8E A;  4IHY A;  2DI3 A;  2MH9 A;  1MBJ A;  3MCZ A;  2CV0 A;  1X58 A;  2CYY A;  2HKU A;  2BE5 F;  4HF1 A;  2ETH A;  2I10 A;  1ZAR A;  2CMP A;  1W7P B;  3CJQ B;  3ABK H;  2OZ6 A;  3VSK A;  3EUA A;  5IP7 J;  3IP4 B;  4ZJZ A;  3OYM A;  3IRR A;  3G1M A;  4HG2 A;  2GLO A;  1RUN A;  3JTH A;  2QKO A;  5L3C A;  2YX7 A;  1YIO A;  4LOC A;  1TWF J;  5J8C A;  3JSO A;  3RI4 A;  4C3I J;  3K4N A;  4RDU A;  3LA2 A;  3ON2 A;  3FM3 A;  2F4I A;  4LK1 F;  4BU2 A;  4XKC A;  2EIN H;  3COA C;  1D5V A;  2DBB A;  2OQG A;  2XHK A;  4DW6 A;  4GCT A;  1FBS A;  4GXO A;  1O3S A;  3ZMU A;  5K58 A;  1XMK A;  2WB1 A;  5HDG A;  1FYM A;  2VQC A;  2F5E A;  4XR6 A;  4YIF A;  2E2H J;  3I64 A;  4QSH A;  4I7H A;  3BCG A;  3F1B A;  4AIJ A;  1SVO A;  3OIP A;  3L2U A;  2UXH A;  3GTO J;  3EGQ A;  3HG9 A;  2PJP A;  5HBU A;  2NS0 A;  3ZR8 X;  2EV5 A;  4WIB A;  5ICG A;  2LF7 A;  3VOE A;  1MDM A;  4KN7 X;  2QSH X;  1IO2 A;  1E3O C;  3S1N J;  1T8I A;  1XTA A;  2XDV A;  1DU0 A;  4M9S A;  2DT6 A;  1EF4 A;  3JRE A;  1R1U A;  4I01 A;  4CUG A;  2JVG A;  3CP8 A;  1H9G A;  2DA6 A;  3KLO A;  2JA8 J;  1XGO A;  4HF0 A;  1FBQ A;  4U0V A;  2FRH A;  5DDG A;  3AFH A;  4KMU X;  1MBG A;  2EIJ H;  3J80 K;  3G73 A;  1JKP C;  3F23 A;  2MA3 A;  5IT3 A;  3MFK A;  1XMX A;  3G6E I;  5BNG A;  1I27 A;  1J2X A;  2ZC2 A;  1J0R A;  3H35 A;  4KYW A;  3M8F A;  1YYV A;  1XSV A;  2DG7 A;  2W57 A;  1YIJ I;  5DS9 A;  3L2C A;  4BEH B;  2VOD A;  3PQK A;  2XPW A;  1FOY A;  5H20 A;  1JUM A;  4BXU A;  2L3D A;  1HBX G;  3GBG A;  5D8L B;  1BJA A;  1PJR A;  1G4D A;  3PO2 J;  3PSF A;  2RVC A;  2RAE A;  2LRD A;  2WC2 A;  3ZOB A;  2K02 A;  1LUJ B;  1Z67 A;  2ZFU A;  3O60 A;  3CTA A;  5B66 C;  4U0Y A;  1YRN A;  4NUB A;  1ZGA A;  2H1L A;  1ETK A;  3JRI A;  3NAU A;  4MFD A;  4V2F A;  1IN6 A;  2GZW A;  4CCO A;  2HEO A;  4NHJ A;  4KIS A;  3QU6 A;  3LSP A;  3F8F A;  4U9L A;  5DEQ A;  2V26 A;  2D1H A;  1LFB A;  2VB6 A;  3NWT A;  3S16 J;  1UCR A;  1UG2 A;  3HYI A;  3SEQ A;  3R60 A;  3LSH A;  4Y13 A;  3ZQH A;  4L5E A;  3QAH A;  4XLF A;  4HSR A;  4CSW A;  5FKK A;  3G4S I;  4WK8 F;  1VQM I;  4A6D A;  3DPU A;  4CZC A;  2LG4 A;  1OYI A;  3ZMT A;  2ID3 A;  3SWH A;  4FX4 A;  5IPA A;  1LDD A;  4Y3O A;  1U8B A;  1I1G A;  1RES A;  1WJE A;  3CMA I;  1D1A A;  1SVL A;  3CCR I;  3BOQ A;  2DT7 B;  3QQA A;  3FMQ A;  2ZXJ A;  1O3R A;  2GUH A;  4B47 A;  1QZY A;  1YW9 A;  2VON A;  4A2U A;  2EPF A;  2XAQ A;  5E1W A;  2EJR A;  2R7W A;  2IP2 A;  1OIS A;  3HUG B;  5B3S H;  3ZN1 A;  3BQZ A;  1UHW A;  4LIT A;  1K4T A;  2VBW A;  4OIQ F;  2E36 A;  2Y9Z A;  4M3D A;  3JW4 A;  2BW3 B;  3BP8 A;  1R6R A;  3K70 D;  5HLG A;  2Q24 A;  1R1V A;  4JX4 A;  1IZ1 A;  2CS3 A;  2CFX A;  1SMT A;  4NEL A;  5EYR A;  4KFC A;  5F1J A;  3FXO A;  1LFP A;  3ASN H;  3AKZ A;  3ZRG A;  2A69 F;  3MKL A;  3GX4 X;  4JQF A;  3QOE A;  1SFX A;  3F22 A;  5BPI A;  3BLY A;  3QP6 A;  1WKM A;  2MLG A;  3MZH A;  3WU2 C;  3JRA A;  1W36 C;  4GCK A;  3I3L A;  4UY8 I;  4B1R A;  1PUF A;  3TDU C;  2DA3 A;  1D0X A;  2IU5 A;  2V4J C;  2BBY A;  4ENJ A;  1SFE A;  2GAU A;  2OA4 A;  3LSI A;  3JSP A;  4A5N A;  1Y8Q B;  1W1W E;  3VEP A;  3L9F A;  2FOW A;  2NXN B;  1V55 H;  4U9N A;  1JT0 A;  3DBH B;  1Z0X A;  4MTD A;  1IC8 A;  4E7L A;  1DGW Y;  2LH9 A;  2MC4 A;  5CQG A;  4CHU A;  2DMU A;  2HS5 A;  2Q2E A;  4ZDL A;  2X0L A;  1N77 A;  3FF5 A;  5GP9 A;  3ZQG A;  1P4X A;  3CD6 I;  4XBF A;  2WA0 A;  1BR4 A;  3NRG A;  1W36 D;  2QQA A;  2VOO A;  3CME I;  3A01 A;  4CA0 A;  2C6Y A;  3U1D A;  1XB4 A;  2VJ5 A;  3CJN A;  1KA8 A;  4CO8 A;  1ON2 A;  4W97 A;  1HLV A;  2IGM A;  3MWM A;  1TWC J;  1IG7 A;  5J3L A;  3JRB A;  3D5S C;  5D5W B;  2FBK A;  2JN6 A;  5GPA A;  1K4S A;  2PMH A;  4ME9 A;  3HOU J;  1BR2 A;  2O03 A;  4YII A;  1OKR A;  4A5M A;  2W4S A;  2R5Y A;  2AXT C;  2NAZ A;  2GXA A;  5HNF A;  4L9T A;  4OAY A;  3TW6 A;  5E3M A;  1M1E B;  1Y1W J;  2JRT A;  5HOO A;  5D5U B;  2CSO A;  1V5F A;  2M5W A;  4I02 A;  4RMN A;  4XRS G;  1TL8 A;  1T0F C;  2FML A;  4BGD A;  1W0T A;  3DTE A;  2O5R A;  5IP6 A;  5J6X A;  3TP3 A;  1D0Y A;  1BIA A;  2W53 A;  2XRO A;  4GO1 A;  4LMY A;  1KQ8 A;  4JOM A;  3P9C A;  4MXM A;  4B43 A;  1LNW A;  5K5O A;  2X6Y A;  3QYF A;  1AWC A;  3H5N A;  3FBN B;  3C2H A;  3ON4 A;  4UB8 C;  3V7R A;  1VFC A;  5D4R A;  1O57 A;  2DO7 A;  3EDP A;  1BBY A;  4FAS D;  1YX3 A;  4IF4 A;  3GWZ A;  4IHT A;  3I59 A;  3PJR A;  1JHH A;  2ESN A;  2ELK A;  2QVO A;  5JLX A;  4NB5 A;  5F1R A;  2R7T A;  5C3E J;  2HQA A;  1X3W B;  2NVT J;  2ELJ A;  2H09 A;  2ISY A;  4OU0 A;  3PPB A;  5L3G A;  1EH8 A;  1R58 A;  3KEY A;  3SZP A;  2ZNZ A;  4OIP F;  1SVM A;  1H0M A;  1PDN C;  3HOY J;  3BTI A;  1MD0 A;  3ELK A;  5M5Y J;  1MH4 A;  4JX5 A;  3FK6 A;  3HJE A;  2R4G A;  1ZRF A;  1X19 A;  4CZZ A;  1TZL A;  2HZT A;  1DPU A;  1JKO C;  4PJN A;  1K83 J;  2V6C A;  4AC0 A;  3E6D A;  4R79 A;  4LLN A;  4KA4 A;  2ELH A;  1YHQ I;  3K1M A;  4UUS B;  4EQQ A;  2CUE A;  1UG0 A;  3BG5 A;  4MO7 A;  4KDP A;  2XKO A;  4UV8 A;  3JTG A;  4F7Z A;  4M3F A;  1ERD A;  4XM3 A;  2A6T A;  1GDT A;  3RZO J;  5LEK A;  4YEJ A;  3F8N A;  4N9I A;  3TBI A;  2DK8 A;  3PO3 J;  1WH5 A;  1WVR A;  2B3W A;  2F4M B;  3BQY A;  2BXY A;  2ZXW H;  2R7X A;  5IYD J;  2OUM A;  3HOW J;  3GZ6 A;  3C2B A;  5AIQ A;  3CCJ I;  2OQR A;  5CVR A;  2VIX A;  1W4M A;  3TDZ C;  1CF7 A;  4C2U A;  2UXI A;  4Q5S F;  1JE8 A;  3CO7 C;  3QYE A;  2WWY A;  2OTL I;  3S2W A;  4BAY A;  5ICC A;  1Z6R A;  4BH9 A;  3VVX A;  3ZMZ A;  1LDK B;  4A12 A;  4HQM A;  1DQU A;  1MZB A;  2Y0S N;  1D3Y A;  2H1K A;  1NK2 P;  4MLO A;  2JUC A;  5DD4 A;  2VKV A;  3C3W A;  4A93 J;  2JJ7 A;  4UVA A;  5BPD A;  5CXG A;  4BE0 A;  4YEL A;  2X6W A;  4ZZL A;  1LE8 B;  2X4H A;  3C2G A;  2ME0 A;  5C4Y A;  1E2X A;  1L0O C;  3IHU A;  2GOX B;  1FX7 A;  2DCE A;  1R5I D;  2IVM A;  2RQQ A;  1U5T C;  3K6G A;  4A3D J;  3VPR A;  1S7O A;  5F6F A;  4XKV A;  4YFX F;  2DMT A;  1BC8 C;  4B8X A;  2D6Y A;  2K7L A;  2O8K A;  3I5U A;  1YI2 I;  3FM5 A;  4G7H F;  2QEN A;  3WHB A;  5LBQ A;  2BHY A;  1HW1 A;  4LD5 A;  2VI6 A;  3PNV A;  4G7Z F;  2IS6 A;  2IS4 A;  3S1R J;  4M3B A;  1R5G A;  2M3A A;  1WCM J;  3ISP A;  4L18 B;  4NN1 A;  1XMA A;  3K1P A;  1ZLK A;  2MSY A;  1TWG J;  1IN8 A;  2BGC A;  2WUI A;  3DP7 A;  2G7L A;  4S05 A;  2K5C A;  2E5N A;  2ZME A;  4XSZ F;  3HTH A;  2COM A;  2JRM A;  3V8J A;  3ZMD A;  3BG6 A;  2Z33 A;  2VQL A;  1HA8 A;  2M4G A;  4KUM A;  1ZR2 A;  1MND A;  4MQ9 F;  4TV7 A;  3DLA A;  1YJW I;  1OYY A;  1F1Z A;  3A1Y A;  5KAF C;  2D5V A;  2KT0 A;  3LAJ A;  5FD6 A;  2HDW A;  4YFN F;  3EQL F;  4MHG A;  4HNU A;  5DCF A;  3VW2 A;  4DVY P;  2VJI A;  1Z05 A;  1RI7 A;  1W5S A;  2JPC A;  2VKH A;  1FWZ A;  1Q1V A;  2UUZ A;  1B8I B;  5HSZ A;  4H0E A;  4YFK F;  1U9N A;  1E3P A;  3K69 A;  3CLO A;  1MMA A;  4XRF A;  5J4Y A;  4EVI A;  2JZY A;  3IV5 A;  2O0Y A;  4GDF A;  3DEW A;  2PLY A;  2XAF A;  4BL0 B;  5FKO A;  3CCU I;  2WBM A;  3ZQI A;  3RPU D;  1WJ5 A;  3OL3 A;  4R1H A;  1HST A;  4J19 A;  2OF7 A;  3DBR B;  2ZB9 A;  1DUX C;  2ZFW A;  2FOK A;  1X1B A;  4MEX F;  1EA3 A;  1ZTR A;  1V5E A;  5EEG A;  1PP8 F;  2RQP A;  4LIU A;  4AU7 A;  4UDS A;  4GRI A;  3S3O A;  2YR2 A;  4Y52 J;  3CUQ A;  2BHZ A;  2YX4 A;  3VVY A;  3QPS A;  3CF5 F;  1YO5 C;  3OYH A;  4CH7 A;  2E2I J;  2LKS A;  4P9F A;  3RQ4 A;  4PDK A;  5C44 J;  2N8G A;  2Y30 A;  1TLH B;  3QWL A;  1SEU A;  2O61 A;  2DOD A;  1R7J A;  3NRV A;  5TJJ A;  4NC6 A;  4IHS A;  2DJI A;  3OYK A;  2FBI A;  2HDC A;  1YTY A;  3FKI J;  3VDX A;  3P9K A;  5FD5 A;  5J1R A;  4EEF G;  1SD5 A;  2G7U A;  3DXJ F;  4HA8 A;  2EV0 A;  2DLL A;  2XRL A;  5TIS C;  1B4A A;  4ZYH A;  3RCO A;  3W6J B;  2A68 F;  3HBL A;  2RNJ A;  3GXO A;  3KYD B;  4DOZ A;  5EG0 A;  1U9O A;  2NVQ J;  1ZG1 A;  2JWT A;  2Y0S A;  2CQN A;  4OMZ A;  1G3Y A;  4CGZ A;  3JRD A;  2EBI A;  2KLO A;  2ZJR F;  1NH3 A;  2K9S A;  2MH2 A;  1OR7 A;  2G0E A;  1JJ8 C;  1BIB A;  1SD6 A;  2YVE A;  3ABT A;  2WV0 A;  1MSE C;  3OYB A;  2FNA A;  5D5V B;  4X1E A;  5A2Q Z;  4IOA F;  3EUP A;  5E3O A;  3U2R A;  1ZGJ A;  3FKJ A;  4ZC3 A;  2VC0 A;  2DFI A;  1NG6 A;  1JHF A;  2IGO A;  3GEZ A;  1ZRE A;  3BG3 A;  3IKV A;  3CO6 C;  3OYL A;  2MD5 A;  1KU2 A;  2G7H A;  3A02 A;  4NBQ A;  2F5V A;  1FTZ A;  4XN3 A;  1TNT A;  3PFY A;  3I9V 2;  2CQ7 A;  4M74 A;  3BY6 A;  2FU4 A;  2NVX J;  2QGU A;  4EJO A;  5GAE J;  4OD4 A;  1G3W A;  3CZ6 A;  1JT6 A;  2WAQ N;  3OYJ A;  4BQQ A;  1X2N A;  3E5X A;  5DYM A;  3Q3S A;  2NYX A;  3RTR A;  4MQV A;  5K7H A;  1DPR A;  4FX0 A;  3I53 A;  5FRN A;  2DA4 A;  3BR1 A;  4MEY F;  5L3B A;  1ORK A;  3NAR A;  3E1S A;  4AIK A;  4ZDO A;  4J01 A;  1LQ1 A;  2OPT A;  1YW8 A;  2HKO A;  1JKQ C;  4A3C J;  2RGV A;  3F3X A;  5J8F A;  5F27 A;  1RC9 A;  1FOK A;  2A6E F;  3HPG A;  2R92 J;  3I4N J;  2NS8 A;  1U5T B;  4B3X A;  2KQR A;  2L54 A;  2DMQ A;  4PK4 A;  3W6V A;  3Q0W A;  2GXG A;  2KIS A;  4AID A;  1FOX A;  3SZG A;  4XRM A;  4HQE A;  1J09 A;  3U1K A;  2KMU A;  1F36 A;  1Z1D A;  3B02 A;  4XOR A;  4CDG A;  3N97 A;  3QOD A;  1QQI A;  5E1Z B;  3PSI A;  3V4G A;  3A4C A;  1WQ2 A;  3RH2 A;  4IRH A;  3BZK A;  2E1C A;  1Z91 A;  3OIQ A;  2MG4 A;  4D5F A;  1R9T J;  1JXS A;  2DA5 A;  2RNG A;  3H92 A;  3T6N A;  1VQ5 I;  1ZEL A;  3BJA A;  1BN5 A;  2HYJ A;  2BOL A;  1ODD A;  1ZAO A;  3CCM I;  3QPH A;  4I2O A;  5FHP A;  3IKT A;  4FET A;  4JBA A;  3S93 A;  4DBR A;  2DA7 A;  1WI9 A;  1A5J A;  3RPU A;  5DM6 F;  1X3Z B;  4FQG A;  4BHC A;  4KJZ A;  1AKH A;  1LDJ A;  3ASO H;  3OY9 A;  2PX9 A;  4WXC A;  4XSX F;  2H6B A;  4MK6 A;  5E1X A;  2UZK A;  1FLI A;  3RKX A;  4ACI A;  3SYT A;  5B1A H;  2R7U A;  1WFX A;  4HLX A;  3MD2 A;  4BUP A;  2DFF A;  1XCB A;  3E7L A;  3DPT A;  1A6Q A;  1KQ9 A;  3F9K A;  2OCC H;  2QKM B;  1WZ2 A;  1SGM A;  4GFK A;  1V4R A;  1S6L A;  4BY7 J;  5D19 A;  1ZKG A;  3FMR A;  5ILV A;  1UZC A;  1B9M A;  1WPK A;  1MBK A;  4EJW A;  2XPU A;  2ZBK A;  2CQX A;  2P7C B;  3KEO A;  4I6Z A;  1ZN2 A;  2JSP A;  2W25 A;  3SEZ A;  2STW A;  3ZQQ A;  3ANP A;  1T33 A;  3GTK J;  2E19 A;  3VOD A;  2Q1Z B;  1P2F A;  2YUS A;  3KP2 A;  4Q48 A;  3CP2 A;  3BG7 A;  1J59 A;  4MNU A;  1UHS A;  3IWF A;  5F0C A;  1KU7 A;  3H0G J;  1O4X A;  4I98 B;  1RET A;  4NQW A;  4C3J J;  4JX6 A;  1QNT A;  3FXJ A;  4G94 A;  3DPJ A;  2L5Q A;  4BJ6 C;  2EQR A;  1FP2 A;  2L4M A;  5FKM A;  3T8T A;  2PI0 A;  1ETO A;  1O3T A;  1IRG A;  2Z99 A;  1HDP A;  1VQL I;  2EFW A;  1ZR4 A;  1YJN I;  1JKR C;  4PSW A;  2PFB A;  3A0H C;  1IXC A;  2DOF A;  3LOC A;  3O3K A;  1XDS A;  3BPV A;  3OV8 A;  2EZH A;  1BR1 A;  5CW8 A;  4FT8 A;  4M9X A;  4PCQ A;  3IH3 A;  4PGH A;  1Y8R B;  4AUX A;  1YW7 A;  4MGR A;  1FSH A;  1U0J A;  1PVE A;  4FCY A;  1S7A A;  2KIF A;  3KNW A;  2LKP A;  2RRE A;  1VI0 A;  2VJJ A;  2P0W A;  2WAQ A;  3K4B A;  3OSF A;  2CV1 A;  3RYR A;  3WTV C;  3CRJ A;  3H36 A;  4C2M A;  4CYC B;  1GXQ A;  2W7N A;  4IHV A;  1BOB A;  3O8G A;  4ESF A;  4DJA A;  3TO9 A;  4PJJ A;  2ACJ A;  3S2D J;  4AVP A;  1O3Q A;  4HST A;  3EYI A;  2XKP A;  2QCO A;  2HQN A;  1QVU A;  2LC2 A;  5EGO A;  4EM0 B;  3NEU A;  3WE3 A;  1G3S A;  1RIO H;  3G1O A;  1HXD A;  2OC6 A;  2QBY A;  1QHH D;  2GEN A;  1VZ0 A;  5CJ9 A;  3HDD A;  3HHG A;  2B9S A;  4YIR X;  4A0Z A;  4OIO F;  1FC3 A;  2E7X A;  5E3L A;  5LFA A;  3FIW A;  3FBI B;  3CC7 I;  1FTT A;  3BC8 A;  2A61 A;  2W85 A;  4XLP F;  3MEX A;  1ZH5 A;  4M6X A;  3W2V A;  4IO9 F;  2XRN A;  2XVC A;  5ERI A;  3NS4 A;  3C1D A;  2AO9 A;  1WWX A;  2ZKZ A;  2HXI A;  3WGI A;  4L0Y B;  2ICW G;  4A3M J;  2ISZ A;  5E3N A;  2X1C A;  4L62 A;  2G9W A;  4RAF A;  3K70 C;  2ZCW A;  1WJC A;  1JUP A;  1KYW A;  4AVZ A;  3TGN A;  2X1D A;  3WTW C;  5D6E A;  4ENM A;  2PJR A;  1Y1V J;  3E6C C;  2M0C A;  5FLV A;  1DDN A;  1MMS A;  2HFH A;  3D0S A;  5KAI C;  1Z7U A;  1CGP A;  3WTT C;  1W5C C;  5FRO A;  2J5O A;  2QWW A;  4G9Y A;  2ZSI B;  3ULQ B;  3CCE I;  2XB0 X;  2VOP A;  1FIA A;  1XN7 A;  2NOJ B;  5J4V A;  4P96 A;  2DMP A;  2V7F A;  3G2B A;  4BNC A;  2JUG A;  3TO7 A;  1CQT A;  3KFW X;  2WAF A;  3S1Q J;  4HEA 2;  1Y39 A;  3VW1 A;  4P55 A;  3L7W A;  4XON A;  3TQN A;  1WH7 A;  1X2M A;  2A07 F;  3CCL I;  1IF1 A;  4WF2 A;  2F5D A;  3PM1 A;  4B48 A;  3PIO F;  3SHF A;  3GTQ J;  3MQ0 A;  3EUK L;  3GFI A;  2QF7 A;  2VQH A;  2ZXI A;  5FB2 A;  1TT0 A;  1RPW A;  2EZK A;  1F9N A;  5D4S A;  2BXZ A;  2DTR A;  4KIF A;  3HRS A;  1IRX A;  3R4K A;  5DUI A;  2QEX I;  5ICF A;  1RRJ A;  2Z1D A;  3QPT A;  4LIV A;  5TRD A;  5H9T A;  4U7D A;  3SDG A;  4BKX A;  3GFL A;  2QQ8 A;  3JRF A;  5IYB J;  3F8M A;  4C30 A;  2CJJ A;  3HRM A;  1OCO H;  2RDP A;  3KZ9 A;  1PUF B;  5L3D A;  2QQ9 A;  2QSF X;  1FYK A;  3Q0U A;  1YS6 A;  2DDB A;  3M1C A;  3LSR A;  3D1N I;  2E71 A;  2V79 A;  2OU2 A;  2HOS A;  1QHG A;  4HKU A;  1OPC A;  2ZME C;  2G7S A;  4KIT B;  4J00 A;  3HTI A;  1KGS A;  1QRY A;  2VPL A;  1J9I A;  2V57 A;  2KRF A;  3WG7 H;  4P5O A;  1MKM A;  4PJM A;  1OCT C;  2R7S A;  2DXI A;  2OI8 A;  4XL9 A;  4PGG A;  1TNS A;  1P92 A;  3DTK A;  2Q2E B;  1L3L A;  1BM9 A;  5D6F A;  5K1Y A;  1HKQ A;  2V6E A;  1GHC A;  1BJZ A;  2K3F A;  2KDO A;  2YSR A;  2ZNY A;  2R0Q C;  4N0B A;  4U87 A;  3S32 A;  1YX5 A;  3E5U A;  2GIZ A;  2K40 A;  2PEX A;  1QGP A;  2STT A;  3A2K A;  4AIH A;  2EIM H;  4BQN A;  3A01 B;  3RZD J;  4UUV A;  1GVD A;  3FIS A;  1AA7 A;  2P7V B;  2HYG D;  2P6S A;  4EM2 A;  2JVH A;  3DEE A;  4PXI A;  4IQJ A;  5E8G A;  4ANJ A;  3HOZ J;  2CWE A;  1V5G A;  4DYR A;  3M1E A;  1ZG5 A;  4KT6 A;  5J1U A;  1KU3 A;  2W1O A;  2LDU A;  1KYZ A;  2VT3 A;  2XAJ A;  3BCB A;  4XLA A;  1MMD A;  2RKH A;  1MBF A;  1Z6T A;  4FE4 A;  2FUG 2;  1UAA A;  4LG3 A;  4JL3 A;  3CUQ C;  2R5Y B;  1QZZ A;  1YQA A;  3GEU A;  2KDZ A;  2HOT A;  5GPC A;  1Y0N A;  2HVQ A;  5CYV A;  5D5X B;  3CC2 I;  2KIQ A;  2ID6 A;  2D1V A;  2DW4 A;  2IA1 A;  4RB3 C;  2XF6 A;  1SD4 A;  3MKZ A;  3FHZ A;  2FX0 A;  2R7Z J;  1BW5 A;  2EWN A;  4BQA A;  1XGN A;  2FJI 1;  5DCM A;  3JAM Z;  3MZ8 A;  1Z7L A;  4YZE A;  5BS6 A;  2IA0 A;  2R5Z B;  3VW0 A;  4I99 C;  5CQE A;  4QWQ A;  1AU7 A;  2RN7 A;  4M73 A;  2KIU A;  4XID A;  5C4X J;  3OYC A;  2PMU A;  2VBZ A;  4GYG A;  3K2A A;  2KKO A;  3R6S A;  4DYC A;  3LA7 A;  3Q5F A;  1P7I A;  2L9N A;  3HC7 A;  2KP6 A;  3PL8 A;  1SAU A;  2VKD A;  4IKF A;  1POG A;  5GTH C;  1DP3 A;  1FZP B;  2X6X A;  4H4K C;  3ZN0 A;  1MNE A;  3WTS C;  2XC7 A;  4KIC A;  4PSX A;  4II3 A;  4OAZ A;  3PNT A;  4D7N A;  3H1C A;  3QYB A;  4L9J A;  2CH0 A;  4F91 B;  2WY7 Q;  1I6X A;  1I50 J;  1NTC A;  1MSF C;  2Z16 A;  4GFL A;  5ICE A;  1IGN A;  1ZGW A;  2IA2 A;  4PZJ A;  5LD2 C;  1G3T A;  3BDD A;  3RD3 A;  2Y48 A;  1U6G A;  2MD0 A;  3W2A A;  4ESB A;  1REP C;  1HSJ A;  2ECB A;  2HXO A;  1OR7 C;  3VYT B;  1Y56 A;  4HV5 A;  4OIR F;  3B81 A;  1S8N A;  1R36 A;  2HGC A;  1USS A;  2DT5 A;  3JAM K;  1ZG3 A;  2QWT A;  3JCU C;  3SFZ A;  2L01 A;  1YFH A;  5C4J J;  3H0D A;  2M7A A;  2DFE A;  5CVU A;  3HM5 A;  3I58 A;  4QPQ A;  3CCY A;  1ETX A;  5JHU A;  3WG9 A;  2K27 A;  5BOX A;  2NOG A;  3RIR A;  2IRF G;  3J7A Y;  1D8K A;  2FEZ A;  2EFP A;  3S1M J;  4XKB A;  3FX3 A;  2TRT A;  4P1W A;  4JYK A;  1J5Y A;  1LKX A;  2DMN A;  3GFJ A;  3W2W A;  4DBQ A;  2NP3 A;  3K2Z A;  4E7H A;  3KYC B;  1TQM A;  2ZY9 A;  2P4W A;  3P9I A;  4PUS A;  1Y6I A;  1N25 A;  2DYS H;  3KET A;  1XS9 A;  1CF7 B;  4GFB A;  1GVJ A;  3V7C A;  2M7B A;  2Y2Z A;  3E97 A;  4XKW A;  5H6Q A;  4E7S A;  3M07 A;  3QU3 A;  3TL4 X;  2V1U A;  3HTA A;  3LSJ A;  2CFO A;  2V1N A;  4BJ5 C;  3MZY A;  4KT5 C;  3WU1 B;  1ITY A;  2BY1 A;  3KZZ A;  2Y0M A;  4E4H A;  4A3E J;  3B73 A;  3HXL A;  2QA4 I;  1TQP A;  5IP9 J;  3FZV A;  1HF0 A;  3TO6 A;  3VOK A;  2PQ8 A;  1D5Y A;  1J75 A;  1XGM A;  2RAS A;  4G12 A;  3OMY A;  5EFY A;  1TBX A;  4F92 B;  3QP5 A;  4ZYE A;  2L7F P;  2QQB A;  3WTY C;  3KYL A;  1KZH A;  2WAE A;  2L7K A;  2JA7 J;  3SQN A;  4HLY A;  4RA2 A;  4XNF A;  4MTE A;  5ED4 A;  2XAG A;  1MIJ A;  5IOZ A;  3HGY A;  1B6A A;  2BV6 A;  4XLC A;  2X85 A;  4Y7N J;  2FXA A;  2M87 A;  3CDI A;  3RDI A;  4A3B J;  2O6G E;  2L9S A;  2LRE A;  3B6A A;  5LHG A;  2Z5U A;  3HIM A;  4KMF A;  3D5R C;  2CRG A;  2O7T A;  3BPX A;  1IAW A;  4M6Y A;  4O5V A;  3CJR B;  2DK5 A;  1OYW A;  1NHA A;  5EJC A;  5FLM J;  1BI3 A;  3BR6 A;  3GW2 A;  4OD5 A;  4RM3 A;  3GFM A;  5IOY A;  4NC7 A;  4RAG A;  1ZK8 A;  2K85 A;  3Q9V A;  2ZOZ A;  4LG0 A;  4LGW A;  2LF8 A;  3DFG A;  1OFC X;  1YE9 A;  2K9L A;  2LY9 A;  3CJD A;  5DAJ A;  3L2R A;  2LKX A;  2K4J A;  2LSO A;  2ZJ2 A;  3KP5 A;  4ZTF A;  4WXD A;  1MMG A;  4E7K A;  2ZME B;  5E17 F;  4EAT A;  4QIW N;  5K7F A;  4IHW A;  4LJZ F;  1Q1H A;  4IZZ A;  2OD5 A;  3WU0 A;  1DP7 P;  3LNQ A;  2UXU A;  4ASN A;  1SAX A;  1SD7 A;  5K5R A;  3FRQ A;  1A31 A;  2O3F A;  2VPR A;  4UVC A;  3UNG C;  1FT9 A;  5L3E A;  2V9P A;  3L2V A;  4IX7 A;  2XGC A;  3HTS B;  2M1B A;  4BE1 A;  2KJB A;  2NNY A;  2D45 A;  2FD5 A;  3BHQ A;  2A6H F;  2X51 A;  1I6H J;  4UVB A;  3LSG A;  2BYV E;  2RHA A;  2WY8 Q;  3ML6 A;  3GZI A;  2IGK A;  2KRH A;  4UB6 C;  4EM1 A;  3VP5 A;  1TW2 A;  1SFO J;  5BMZ A;  3F8B A;  3W3C A;  4ETS A;  2EV6 A;  2LD5 A;  2YVH A;  1STZ A;  3ABL H;  5F04 A;  4XRS A;  3GTJ J;  5LGT A;  4L9V A;  4XMY A;  3T5X A;  4E70 A;  4O6J A;  4E7Z A;  2R93 J;  2VBX A;  5FLX Z;  2Y69 H;  2FJ1 A;  2ADU A;  3CCS I;  3V42 A;  4OMY A;  1B1B A;  4U0W A;  4QPO A;  3CUQ B;  3DKX A;  1ETY A;  3CJT B;  5AQC A;  1QO0 D;  4ZZD A;  1BOA A;  5FKL A;  4XN0 A;  4W1U A;  1AHD P;  2Y75 A;  1K61 A;  2LTP A;  3RPQ A;  2VXZ A;  3JRC A;  1IRF A;  1Z3X A;  3ZQL A;  5LEJ A;  1WI3 A;  3BJO A;  3H3V K;  2E7W A;  4HF2 A;  1B8I A;  2AS5 F;  1EV7 A;  3BR0 A;  4HBL A;  4ZYA A;  1KQ0 A;  1P4W A;  1OQY A;  1H89 C;  2AQE A;  3WHC A;  1MJ9 A;  2W48 A;  2HZD A;  2LFB A;  4A6E A;  1VTN C;  1K78 A;  4X6A J;  3FHN A;  3IC7 A;  4JNN A;  3J7Z I;  2GWR A;  2YU9 J;  3OYD A;  2GIV A;  3WOD F;  1VQK I;  2LNB A;  4AC6 A;  5FLX K;  2A05 A;  2X48 A;  3GCM A;  1Z21 A;  2EZI A;  2QLZ A;  3ABU A;  5FFX A;  4RBO A;  5FRM A;  2NP5 A;  2KRC A;  4HV6 A;  3CF2 A;  5H6R A;  4XQF A;  1DU6 A;  1FNN A;  2B1E A;  1VQ9 I;  1ETV A;  4GYI A;  2CU7 A;  2EIK H;  1GXP A;  3O8H A;  5FO5 A;  5F64 A;  3E7Q A;  2XF7 A;  1Y0U A;  1IV8 A;  1TWH J;  1BW6 A;  2NX4 A;  1HKT A;  3F8C A;  1TW3 A;  1A36 A;  3LJL A;  1F4K A;  2AQF A;  1IRZ A;  2E1M C;  3H9J A;  3I4P A;  2EFQ A;  1JJ6 C;  3ESW B;  3TKY A;  3J81 Z;  4EJV A;  2M45 A;  4BY1 J;  5E18 F;  1RKT A;  4S04 A;  1ZQ3 P;  4A0Y A;  2EFO A;  3LSM A;  4ON0 A;  4A3G J;  1TP4 A;  1RZ4 A;  2Z2S B;  2CW7 A;  2HU9 A;  3BZ6 A;  4IQ4 A;  3LST A;  3VYS B;  4QLC U;  5L3F A;  3PFI A;  2CW0 F;  2W84 A;  3LMM A;  1FYL A;  2IEK A;  5FJ8 J;  4DGW B;  3FMS A;  2ZJQ F;  2JTV A;  3AQT A;  1ON1 A;  4A0X A;  1XSD A;  2PBX A;  2LP0 A;  2P5K A;  1T38 A;  1S29 A;  2LMD A;  2ZSH B;  3GVA A;  3VFZ A;  4C2T A;  3LAP A;  3S5R A;  1FSE A;  2IGN A;  3V6G A;  3CCQ I;  3TW7 A;  4EJU A;  3KKD A;  2FSW A;  2ZO4 A;  1ZYR F;  3P9T A;  5GTI C;  3G3Z A;  3N05 A;  2HTS A;  3HRU A;  2ZCX A;  1QZE A;  1R4N B;  1O7F A;  1OMI A;  2L9R A;  2RV8 A;  3KX2 A;  4HNT A;  4ENN A;  2XAH A;  2DJN A;  4AWX B;  3BWG A;  1T2K A;  2EZL A;  2PFV A;  4KN4 X;  1IN4 A;  1A04 A;  5A2Q K;  1IN7 A;  2NRA C;  2ME6 A;  3G71 I;  1D0Z A;  1I3A A;  2FQ3 A;  2Q0O A;  2WAD A;  3IAM 2;  3VB2 A;  5JR3 A;  1X1C A;  2I5U A;  2XAU A;  3H9G A;  4JK1 X;  3F0C A;  3HZJ A;  3ZMS A;  2GM4 A;  2Y31 A;  5AON A;  4HRI A;  3O6B B;  3F6O A;  1D8J A;  1SAN A;  3KKC A;  4LB5 A;  3RQI A;  1G2H A;  4IPA A;  2V9K A;  3ZMV A;  2IW5 A;  1VQO I;  2DPD A;  1JTX A;  3BJB A;  1RR7 A;  1S5L C;  2IJL A;  2W00 A;  4M72 A;  1UFM A;  5DUK A;  4RB1 A;  1Z77 A;  2JMW A;  3W6K B;  2KJC A;  3DV8 A;  1B72 A;  3IWZ A;  3OYA A;  2COB A;  3G1L A;  3EUH A;  5FKN A;  4UNO A;  1T95 A;  2LBF A;  2R7O A;  3L1P A;  3AAF A;  4XLN F;  5D8K B;  5LLQ A;  4M6V A;  3CCV I;  2HKX A;  1AKH B;  3MAJ A;  2OBP A;  1RKW A;  4ENK A;  5HDK A;  2HDD A;  3TOA A;  2P5L C;  2V1X A;  4HX8 A;  5KVR A;  2QTQ A;  1NG7 A;  4MIM A;  1APL C;  3HE0 A;  1I5Z A;  2H94 A;  3E6B A;  2VKE A;  4A3L J;  4WWC A;  2CG4 A;  3BNI A;  4XK4 A;  1SFU A;  1YG2 A;  4GCV A;  3RSN A;  4D9J A;  1HC8 A;  5M5X J;  1P6R A;  2L2O A;  4E7I A;  5HNH A;  2VQG A;  3CES A;  2AXL A;  4UV9 A;  2DYR H;  1LPQ A;  1EKE A;  4V19 K;  3B6C A;  1K7A A;  3ZQ7 A;  1UJ8 A;  1ONV A;  2CQQ A;  3GTP J;  3KP6 A;  4ZYG A;  2KL4 A;  2L4A A;  5LHI A;  4OOI A;  4S0H B;  5HDN A;  2F5F A;  4NQW B;  4DYQ A;  3R0A A;  2FBH A;  1S9H A;  3AL0 C;  3OOP A;  5HOD A;  4ZDP A;  2H27 A;  1SFK A;  1T56 A;  2M34 A;  2OCE A;  1W7P A;  3PAS A;  4HNV A;  3EPZ A;  2UXN A;  2E35 A;  3HSR A;  1OCP A;  1MDM B;  3CDL A;  2LOO A;  3PUB A;  4HZF A;  3LFK A;  1UI5 A;  3J80 Z;  3VYR B;  2IT0 A;  4Y17 A;  1BC7 C;  3VOX A;  2JA6 J;  3VIB A;  2IS2 A;  4Y15 A;  5EZH A;  4U7B A;  1G8X A;  2IS1 A;  2D2W A;  4CCN A;  2HYF A;  3IAS 2;  3EYY A;  5JVT A;  5EZG A;  3BTC A;  3E0J B;  4ZYD A;  2QYO A;  5H2F C;  3HL2 A;  1ZHF A;  3CQZ J;  2M30 A;  4IHX A;  3K4J A;  2HOE A;  4BYY A;  1HKS A;  4NNJ A;  2ESH A;  1F43 A;  4OWR B;  5JI6 A;  5J40 A;  5EEH A;  3BRO A;  1VF9 A;  5CXI A;  3FXR A;  1F5T A;  3ZCO A;  5TGT A;  2W24 A;  4B09 A;  3V7S A;  3QKX A;  2YS9 A;  3K4C A;  2MC3 A;  4RLF A;  5EGO B;  1K6Y A;  4L9N A;  5FMP A;  5CKT A;  4RAY A;  2F5C A;  1W5T A;  1ZRC A;  2QBY B;  1OLT A;  1UHM A;  4WXH A;  3MKW B;  3G56 A;  2IXS A;  2VBY A;  2E1M B;  1S3J A;  2DDA A;  2EA2 A;  3DTI A;  4WCG A;  3KP7 A;  3DLL F;  4M3E A;  2XGD A;  5M3M J;  3LSK A;  2OER A;  4F52 A;  4RB2 C;  1YRN B;  5HAW A;  3DU5 A;  4A3I J;  3HOV J;  3OS2 A;  2CW8 A;  4CCM A;  3DBL B;  1EJ9 A;  1FIP A;  2KIM A;  3ZXS A;  5FGM A;  1OCC H;  2A5W A;  2CUZ A;  4RGU A;  3ECO A;  3ECH A;  1UEL B;  4CYC A;  2JSC A;  3OS0 A;  4D1Q A;  3GLL A;  4BEH A;  4YRV A;  1HW2 A;  5LHH A;  4II2 A;  3BR2 A;  1RR8 C;  2REK A;  4A3F J;  5HLH A;  3L2W A;  1FMW A;  3FXM A;  4DZP A;  2K9N A;  2FMY A;  5E20 A;  5KCM A;  2PJR B;  1HOM A;  2HQ5 A;  1BI1 A;  2R7Q A;  2A3S A;  2M0M A;  1Z3Y A;  1EH6 A;  1UMQ A;  2JPB A;  3U9G A;  1WSU A;  1U2W A;  3K0L A;  3PUF A;  3WGH A;  1R23 A;  3LA3 A;  3ZGK A;  2BVM A;  3HTJ A;  2X1E A;  3OWT A;  1TT5 B;  3K4M A;  1T6S A;  4U88 A;  3KEQ A;  4IRV A;  1I3Q J;  2ECC A;  2L9V A;  1KON A;  3ZP5 A;  2UXO A;  1WGX A;  4XIC A;  4EGY A;  4R8H A;  4Y33 A;  4GCL A;  2E5Z A;  2EA4 A;  1G59 A;  4ESJ A;  4G6T B;  2VUM J;  1XGS A;  2VT2 A;  4AYB N;  1ETW A;  4I0B A;  1W0U A;  2YU3 A;  1IXS B;  1BL0 A;  4N4O B;  4F55 A;  3ROU A;  3K7A J;  1FY7 A;  1N75 A;  4N4N B;  1XC5 A;  2KZV A;  1IN5 A;  2LY1 A;  3DQV C;  1U3E M;  4L5J A;  1B9N A;  5DM7 F;  1VQ7 I;  4A3J J;  1ZRD A;  4Q47 A;  3JRG A; 
#chains in the Genus database with same CATH homology
 1IDZ A;  5IP7 J;  1ITY A;  3G1M A;  2GLO A;  4A3E J;  2QKO A;  2IBD A;  5IP9 J;  1HF0 A;  2XRL A;  3VOK A;  1D5Y A;  4LOC A;  2RAS A;  2DG8 A;  1TWF J;  4G12 A;  5EFY A;  3HBL A;  4C3I J;  4RDU A;  2L7F P;  5J1Y A;  5EG0 A;  2JA7 J;  1U9O A;  2NVQ J;  3ON2 A;  2JWT A;  5IOZ A;  3HGY A;  4GCT A;  4DW6 A;  3JRD A;  4DZJ A;  4Y7N J;  3NPI A;  2EBI A;  2XB5 A;  5EF6 A;  4A3B J;  5K58 A;  3NXC A;  1MH3 A;  2K9S A;  3B6A A;  2G0E A;  1JJ8 C;  4QSH A;  2E2H J;  3BCG A;  3F1B A;  2UXH A;  2YVE A;  3IH2 A;  3GTO J;  3EGQ A;  2MGQ A;  3HIM A;  5M5W J;  1MSE C;  2CRG A;  5EEA A;  4X1E A;  5HBU A;  2O7T A;  2X9D A;  3MVP A;  3EUP A;  3OOU A;  5E3O A;  5FLM J;  3BR6 A;  1E3O C;  3S1N J;  5IOY A;  1DU0 A;  3BG3 A;  1ZK8 A;  1EF4 A;  3JRE A;  2GFN A;  2ZOZ A;  3SJM A;  3A02 A;  1TWA J;  4V2G A;  1FTZ A;  3LHQ A;  5DAJ A;  1OFC X;  3CJD A;  2LY9 A;  2DA6 A;  2JA8 J;  4I76 A;  2LKX A;  3MNL A;  1MBG A;  1JKP C;  3BTJ A;  3IUV A;  2NVX J;  4QIW N;  5K7F A;  4IHW A;  5BNG A;  1FEX A;  3HGG A;  3LNQ A;  2UXU A;  3FRQ A;  1JT6 A;  2WAQ N;  1MNM C;  3AQS A;  2VPR A;  1X2N A;  2XGC A;  3Q3S A;  2DG7 A;  5K7H A;  2M8G X;  5DS9 A;  5M3F J;  2XPW A;  3V78 A;  1JUM A;  3HEF A;  2FD5 A;  4D5C A;  3BHQ A;  3GBG A;  1I6H J;  4KWA A;  1JTY A;  1P7J A;  3LSG A;  2RHA A;  2DA4 A;  3BR1 A;  3PO2 J;  3GZI A;  1ORK A;  4B4C A;  3NAR A;  2RAE A;  3LWJ A;  2FBQ A;  2OPT A;  2LVS A;  1JKQ C;  3VP5 A;  3TP0 A;  3ZOB A;  1SFO J;  4A3C J;  2H8R A;  5F27 A;  3OIO A;  2LD5 A;  2YVH A;  2R92 J;  3S15 J;  3I4N J;  2NS8 A;  5F04 A;  3O60 A;  4XRS A;  3GTJ J;  4UUT A;  2DMQ A;  1YRN A;  3W6V A;  1H8A C;  2R93 J;  1ETK A;  3Q0W A;  3JRI A;  4ICH A;  4XRM A;  3NAU A;  4MFD A;  2ZOY A;  4V2F A;  2M2E A;  2FJ1 A;  4C3H J;  2FQ4 A;  3LSP A;  1F36 A;  5F08 A;  3S16 J;  1LFB A;  2JK3 A;  1UG2 A;  2L7Z A;  3HKZ N;  1HCR A;  1ETY A;  1BA5 A;  5AQC A;  3RH2 A;  2R5Z A;  3ZQH A;  4L5E A;  2MG4 A;  2L0K A;  2NVY J;  5FKL A;  4W1U A;  5FKK A;  4D5F A;  1R9T J;  1K61 A;  2LTP A;  1AHD P;  3M3Y J;  2DA5 A;  3T6N A;  3JRC A;  3ZQL A;  2HYJ A;  1WI3 A;  2ID3 A;  3H3V K;  3ANG A;  5IPA A;  1U8B A;  1B8I A;  5FHP A;  1RES A;  3BR0 A;  1H89 C;  2DA7 A;  1A5J A;  3WHC A;  2G7G A;  2W48 A;  2LFB A;  4X6A J;  4FE7 A;  3QQA A;  3S14 J;  2GUH A;  1AKH A;  4JNN A;  5D18 A;  3ZQF A;  2YU9 J;  2UXP A;  4MK6 A;  1JGG A;  2MW8 A;  2DN0 A;  4ACI A;  4AC6 A;  3BQZ A;  2X48 A;  2EZI A;  3S17 J;  2LR8 A;  4RBO A;  3E7L A;  2Y9Z A;  4M3D A;  2NP5 A;  1SGM A;  4GFK A;  1DU6 A;  2Q24 A;  4BY7 J;  1U78 A;  1ZKG A;  4JX4 A;  3HOX J;  5D19 A;  1ETV A;  2CU7 A;  1WPK A;  1XG1 A;  5EYR A;  3O8H A;  4NEL A;  3M4O J;  1MBK A;  5F1J A;  2LK2 A;  2XPU A;  3E7Q A;  2CQX A;  5FGL A;  3MKL A;  4I6Z A;  4UUS A;  1TWH J;  3NI7 A;  1BW6 A;  2NX4 A;  1T33 A;  3GTK J;  2E19 A;  1MBE A;  3LJL A;  2YUS A;  1TC3 C;  2O7O A;  4GCK A;  3JRA A;  1UHS A;  1IRZ A;  3GTM J;  5F0C A;  3BG9 A;  4B1R A;  3H0G J;  1PUF A;  1O4X A;  1JJ6 C;  2DA3 A;  1RET A;  2IU5 A;  4C3J J;  4JX6 A;  4BY1 J;  3DPJ A;  1RKT A;  1ZQ3 P;  2EQR A;  5FKM A;  4A3G J;  1ETO A;  1JT0 A;  1HDP A;  1Z0X A;  1ZR4 A;  1JKR C;  1IC8 A;  2TCT A;  2P81 A;  2WV1 A;  2IEK A;  2L7M P;  5FJ8 J;  1ETQ A;  3LOC A;  3AQT A;  2PBX A;  2DMU A;  2LP0 A;  2EZH A;  5GP9 A;  3ZQG A;  5CW8 A;  2HOA A;  1JUS A;  2LLK A;  3IH3 A;  4AUX A;  3S5R A;  3V6G A;  3NRG A;  3TW7 A;  4FCY A;  3KKD A;  3KNW A;  1VI0 A;  1QPI A;  3A01 A;  3OSF A;  3P9T A;  3CRJ A;  4JP0 A;  1VND A;  1LE8 A;  2ZCX A;  4CYC B;  2L9R A;  4W97 A;  1HLV A;  4IHV A;  3O8G A;  2DJN A;  3JR9 A;  3S2D J;  2DA2 A;  2EZL A;  1TWC J;  1IG7 A;  5J3L A;  2QCO A;  3JRB A;  1QVU A;  2JN6 A;  5GPA A;  5EGO A;  3G1O A;  4ME9 A;  3HOU J;  2ME6 A;  1OJL A;  3IH4 A;  2GEN A;  2XSD C;  3RKQ A;  3S2H J;  1A6I A;  3HDD A;  2R5Y A;  3F0C A;  2GM4 A;  2PMZ N;  2Y31 A;  5E3L A;  3FIW A;  1SAN A;  3KKC A;  3TW6 A;  1FTT A;  1H88 C;  3RQI A;  5E3M A;  1G2H A;  3COL A;  1Y1W J;  2HYT A;  2QIB A;  2X6O A;  4XRS G;  1JTX A;  2B63 J;  3BJB A;  3BRU A;  1RR7 A;  4BBR J;  1W0T A;  5IP6 A;  2AO9 A;  2HXI A;  4A3M J;  3TP3 A;  2W53 A;  2EH3 A;  1Z77 A;  2JMW A;  5E3N A;  4L62 A;  4MXM A;  1B72 A;  1JUP A;  4QTR A;  2COB A;  3G1L A;  5FKN A;  4BXX J;  3ON4 A;  3L1P A;  1MBH A;  3VUQ A;  1Y1V J;  2M0C A;  1VFC A;  5FLV A;  4M6V A;  1AKH B;  1RKW A;  9ANT A;  2XB0 X;  2HDD A;  1FIA A;  2ELK A;  5JLX A;  1IDY A;  2DMP A;  1S7E A;  5C3E J;  2QTQ A;  2NVT J;  4MIM A;  1APL C;  3HE0 A;  1CQT A;  1GV5 A;  3PPB A;  2VKE A;  4A3L J;  3S1Q J;  3BNI A;  3VW1 A;  4XK4 A;  1WH7 A;  1X2M A;  3HOY J;  3CMY A;  3BTI A;  3PM1 A;  5M5Y J;  1MH4 A;  3GTQ J;  4JX5 A;  3FK6 A;  5M5X J;  3HB9 A;  2QF7 A;  1JKO C;  1K83 J;  4AC0 A;  5EG0 B;  1IV6 A;  4MFE A;  1RPW A;  2EZK A;  4UUS B;  3C07 A;  2CUE A;  3BG5 A;  4MO7 A;  1ENH A;  3B6C A;  4M3F A;  5H9T A;  1GDT A;  3RZO J;  3SDG A;  4BKX A;  2CQQ A;  3JRF A;  2AHQ A;  4A3K J;  5IYB J;  2CJJ A;  3GTP J;  3PO3 J;  4AF5 A;  1WH5 A;  3KZ9 A;  3BQY A;  4FTH A;  4S0H B;  1PUF B;  2XGE A;  4DYQ A;  5IYD J;  3JRH A;  1HDD C;  3Q0U A;  3HOW J;  2G3B A;  3C2B A;  5HOD A;  3LSR A;  3D1N I;  4NDL A;  1T56 A;  2M34 A;  2UXI A;  2HOS A;  5D1R A;  3PAS A;  4HKU A;  4HNV A;  4CGR A;  2G7S A;  1OCP A;  3CDL A;  1LFU P;  3HTI A;  1QRY A;  3MN2 A;  2XPV A;  2V57 A;  3OSG A;  3VVX A;  1OCT C;  3GTG J;  1UI5 A;  2OI8 A;  2E1O A;  2IAI A;  3VOX A;  2Y0S N;  2JA6 J;  3VIB A;  2ZCM A;  2H1K A;  5EZH A;  3QPL A;  1NK3 P;  3G7R A;  4A69 C;  3JSJ A;  1NK2 P;  1BJZ A;  4MLO A;  1GV2 A;  2VKV A;  2R0Q C;  2WB1 N;  3BTC A;  5EZG A;  1IJW C;  4A93 J;  2K40 A;  2JJ7 A;  4M3G A;  5IYC J;  5CXG A;  3CQZ J;  4IEJ A;  3A01 B;  4IHX A;  4BBS J;  3GTL J;  3RZD J;  1LE8 B;  3TED A;  2ME0 A;  5C4Y A;  1GVD A;  3BT9 A;  3FIS A;  1FJL A;  1F43 A;  4PXI A;  4A3D J;  3HOZ J;  1VF9 A;  2DA1 A;  4DYR A;  3VPR A;  5CXI A;  3QKX A;  2YS9 A;  5J1U A;  2DMT A;  2D6Y A;  2WGB A;  5EGO B;  2O8K A;  5FMP A;  2HI3 A;  3UKG A;  2JA5 J;  1GT0 C;  2QOP A;  3WHB A;  4FIS A;  4D7M A;  5DTD A;  1IUF A;  1MBF A;  2VI6 A;  4FE4 A;  3SFI A;  3G56 A;  3BTL A;  3S1R J;  4M3B A;  5EDN A;  2R5Y B;  4JL3 A;  1WCM J;  3GEU A;  2GBY A;  4NN1 A;  2KDZ A;  4M3E A;  2HOT A;  5GPC A;  2XGD A;  2XDN A;  5M3M J;  2OER A;  1QVT A;  3ZQC A;  3VVZ A;  2ID6 A;  2MSY A;  1YRN B;  5HAW A;  1TWG J;  3CWR A;  2WUI A;  4A3I J;  3HOV J;  2F07 A;  2NS7 A;  2G7L A;  2FX0 A;  3HTH A;  2R7Z J;  1FIP A;  2E2J J;  1BW5 A;  3A03 A;  1ZR2 A;  2CUF A;  2DTZ A;  3I4M J;  2K9Q A;  4YZE A;  4JKZ A;  4CYC A;  2D5V A;  4C2M J;  2R5Z B;  3VW0 A;  1AU7 A;  2KT0 A;  2O9L A;  1B72 B;  3BR2 A;  4XID A;  5C4X J;  2REK A;  4A3F J;  4DZP A;  2K9N A;  3K2A A;  4DYC A;  3VW2 A;  1HOM A;  2HQ5 A;  3DCF A;  1P7I A;  3NNR A;  1POG A;  1Q1V A;  3BR5 A;  1B8I B;  5HSZ A;  1UMQ A;  1GUU A;  1U9N A;  4D7N A;  3IV5 A;  1UI6 A;  3QBM A;  3DEW A;  1I50 J;  5FKO A;  1NTC A;  3BR3 A;  3HTJ A;  3ZQI A;  1MSF C;  4GFL A;  1IGN A;  1ZGW A;  4J19 A;  2OF7 A;  3Q0V A;  3RD3 A;  1I3Q J;  3FK7 A;  2ECC A;  2ZB9 A;  2ECB A;  2UXO A;  2HXO A;  1ZTR A;  1WGX A;  3B81 A;  2PZ9 A;  4UDS A;  5F0H A;  4XIC A;  4Y52 J;  5F0F A;  2Y9Y A;  2QWT A;  4GCL A;  3VVY A;  3QPS A;  2E2I J;  5C4J J;  2VUM J;  2M9H A;  4AYB N;  1ETW A;  4B3A A;  3HM5 A;  5C44 J;  1W0U A;  3CCY A;  2N8G A;  1ETX A;  2Y30 A;  1BL0 A;  2ZCN A;  2NOG A;  4ABZ A;  3K7A J;  5K7Z A;  5JLW A;  3S1M J;  2TRT A;  4JYK A;  1XC5 A;  2DMN A;  4IHY A;  2NP3 A;  1MBJ A;  1X58 A;  3FKI J;  1XS9 A;  4GFB A;  2HKU A;  5J1R A;  2I10 A;  2Y2Z A;  4EEF G;  4A3J J;  3ANP A;  3HTA A;  3JRG A;  3LSJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...