1RKWA

Crystal structure of the multidrug binding transcriptional repressor qacr bound to pentamadine
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
186
structure length
186
Chain Sequence
NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKKEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of QacR-diamidine complexes reveal additional multidrug-binding modes and a novel mechanism of drug charge neutralization.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription
molecule keywords Transcriptional regulator qacR
total genus 78
structure length 186
sequence length 186
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2003-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1rkwA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 1rkwA02
2OPTA 3RD3A 3HOVJ 4UDSA 3CRJA 3HGGA 5FKLA 1SGMA 2QKOA 2D6YA 3EGQA 1WH7A 3QPSA 2Y31A 2DA7A 2UXPA 3ANPA 1JKQC 2LY9A 4UUSB 3GTPJ 3JRAA 2Y30A 2O8KA 1HCRA 4JX5A 5FKOA 1I6HJ 3FISA 2QIBA 1GT0C 2MG4A 3BJBA 5F08A 3PM1A 5IOZA 3RZOJ 3ZQHA 1E3OC 2B63J 1JUPA 1IUFA 3S2DJ 3E7LA 3Q3SA 3ZQLA 5E3NA 5F0CA 1WI3A 1WH5A 4A3LJ 3MNLA 1X2NA 5C4YA 4RBOA 3LWJA 2DA4A 2QWTA 1OCPA 2CQQA 5M5XJ 3ZQIA 1BJZA 2VKEA 2HOSA 4FE7A 3LSRA 4BKXA 1A5JA 2Q24A 3GTQJ 2QF7A 3HE0A 2WGBA 2K9QA 2X48A 3FIWA 4V2FA 2UXHA 5J1YA 3JRBA 2YU9J 2HOTA 4D7MA 3S15J 1I3QJ 4GCKA 5FLMJ 3BR1A 1ZR2A 2WUIA 1MNMC 2LTPA 5IP7J 2ID3A 4A3GJ 2W48A 2GENA 4M3DA 4X1EA 4A3IJ 3BR6A 3Q0VA 3BTIA 5DS9A 4A69C 4FCYA 3LSGA 4MIMA 4HKUA 2RASA 2ZCNA 2WB1N 2D5VA 2EH3A 2LFBA 5GPAA 2JA5J 2R92J 3B81A 3JRHA 3SJMA 3F1BA 3B6AA 3F0CA 2N8GA 1Q1VA 1BL0A 2EQRA 2NOGA 3GTMJ 1MBGA 4JX6A 2M0CA 5M5YJ 1LE8B 3ON4A 1XS9A 1S7EA 5HBUA 3S5RA 2CRGA 2YVHA 1U9OA 2UXIA 5HODA 1ITYA 3JRCA 1TWCJ 2ME0A 3W6VA 5DAJA 1ETXA 2DA2A 1JKOC 3GTOJ 3JRFA 4M3GA 1BA5A 3O8HA 5F27A 1JKRC 3S1MJ 2XPWA 1HDPA 2E2IJ 5BNGA 3HOYJ 1X2MA 4QSHA 3BG3A 1ETWA 1POGA 5IYDJ 4Y52J 3RZDJ 4C3IJ 3LNQA 2VUMJ 2DA1A 3SDGA 4A3EJ 1ZQ3P 5GPCA 3BHQA 5GP9A 3HOUJ 1IRZA 3VW2A 4M6VA 1VI0A 2RAEA 3HBLA 2LD5A 2DTZA 2HKUA 5CW8A 1BW5A 1T56A 2YVEA 3JSJA 1B8IA 2GUHA 2LKXA 3VW0A 4MLOA 5H9TA 2LVSA 2XSDC 2DA5A 4ABZA 2HYTA 4GFLA 3A02A 1MBKA 3NI7A 5EEAA 3QPLA 1R9TJ 5IP9J 2COBA 1ORKA 2IEKA 2JWTA 4ACIA 4C3JJ 4BY7J 2IBDA 3JR9A 2XRLA 5FKMA 1UG2A 2M34A 2XB5A 2REKA 5J3LA 4ICHA 1ETQA 4GCLA 1SFOJ 2UXUA 3E7QA 2H8RA 2LP0A 3G1LA 1DU6A 2NVYJ 1CQTA 2FX0A 3Q0UA 1FJLA 4ME9A 1IG7A 5HAWA 3PO2J 4A3CJ 1DU0A 4Y7NJ 5D1RA 2ZOZA 3CMYA 1FIPA 4AC0A 3ANGA 1MBJA 4D5FA 2DMTA 2UXOA 2DMNA 1W0UA 2HXOA 2O9LA 2G3BA 3BR3A 5IYCJ 2RHAA 1JTXA 2ECCA 3C2BA 3HOWJ 1FIAA 2VPRA 3KNWA 2ELKA 2K9SA 3HTJA 3KZ9A 3DEWA 1IDYA 4JP0A 2Y0SN 3AQTA 1HLVA 4B3AA 1JGGA 1JUMA 4DYCA 4A3FJ 3LSJA 1IJWC 4BY1J 2XPVA 4QTRA 1NK3P 1QRYA 2XGCA 2CJJA 1JJ8C 5M3FJ 2DMUA 5EF6A 4NN1A 3H0GJ 3A01A 5FLVA 4DYRA 2G7SA 5J1RA 2TRTA 1B72B 2KDZA 4L62A 1QVUA 3HM5A 4D5CA 3NXCA 3PO3J 1ZK8A 2R93J 2QCOA 1ZGWA 1F43A 3MKLA 2NVXJ 2MSYA 2R0QC 3K7AJ 5EDNA 5DTDA 3P9TA 2EZIA 2FD5A 5F0FA 4EEFG 2GLOA 2L9RA 4BXXJ 3LOCA 3OIOA 4UUTA 3G1MA 4S0HB 1RPWA 4GFKA 2VI6A 4MK6A 4M3BA 2XPUA 5D18A 3COLA 2LR8A 4LOCA 5EFYA 4MFDA 3LSPA 5EG0B 2DN0A 4FISA 2HXIA 2R5YA 4L5EA 4NELA 1ENHA 5C4JJ 2IU5A 3A01B 1JT0A 4NDLA 1AKHB 1B72A 4XRMA 1MBFA 2PMZN 3BR0A 1LE8A 1G2HA 2G7GA 2NP5A 2ZOYA 1D5YA 3BT9A 4XK4A 2FBQA 3ZQCA 4M3EA 1VF9A 2HDDA 3FKIJ 2GFNA 2P81A 2HYJA 1LFUP 3FK6A 4JNNA 2OI8A 1YRNB 4HNVA 3HTIA 3BCGA 5FKKA 3WHCA 3ZOBA 2JK3A 3BQZA 3JREA 2ZCXA 1XG1A 3ON2A 1F36A 1GUUA 4B1RA 2K40A 3IH3A 3HEFA 1WCMJ 1A6IA 1VNDA 4G12A 3VPRA 1MBEA 3HGYA 4XIDA 2R5YB 2MGQA 1TWHJ 3IH2A 4PXIA 5EZGA 1ETYA 2WV1A 5F0HA 3DPJA 1GDTA 1UI6A 3GTKJ 4AF5A 2DMQA 3BNIA 2K9NA 2L7MP 2F07A 5FKNA 3PASA 1HF0A 2CUEA 2DG8A 1ZKGA 3V6GA 3NAUA 2HOAA 5HSZA 1WPKA 2PZ9A 1ETOA 5C44J 3C07A 2PBXA 2E19A 3B6CA 1AU7A 1B8IB 4A3BJ 1JTYA 2X9DA 2I10A 3IH4A 1IDZA 3ZQGA 2AHQA 3DCFA 1X58A 2XB0X 3RKQA 3AQSA 5IOYA 2LK2A 3MVPA 4I76A 5EGOB 9ANTA 2O7OA 2EZKA 4RDUA 3S17J 4CGRA 5K58A 3G1OA 5K7ZA 3QBMA 2KT0A 5FGLA 4DZJA 1QPIA 1ETVA 3TP3A 3VIBA 3S1NJ 3NARA 5JLWA 2G7LA 4AYBN 1SANA 5C3EJ 1XC5A 1NTCA 4JX4A 2CQXA 1UMQA 2YUSA 4C2MJ 3G56A 3BTLA 1RKWA 2Y9YA 3KKCA 3IV5A 2QOPA 4J19A 2H1KA 1MH4A 1EF4A 5EYRA 4IHWA 3S1QJ 3HKZN 5EGOA 3BG9A 3HDDA 1HDDC 1IGNA 3LJLA 2NVQJ 4A3KJ 1TWFJ 2AO9A 2XGDA 1RETA 3LHQA 5E3LA 2XDNA 1MH3A 1OCTC 2TCTA 1ZR4A 2JN6A 4YZEA 2R7ZJ 1TWGJ 4AUXA 3D1NI 1NK2P 4W1UA 2Y9ZA 4DZPA 4JL3A 2QTQA 5E3MA 2OERA 2W53A 3JRGA 2E1OA 4X6AJ 2R5ZA 2M8GX 2ZB9A 4W97A 4FTHA 2DA6A 2ZCMA 3CJDA 3FRQA 3PPBA 1QVTA 2DA3A 4XICA 1FTTA 3S1RJ 4MFEA 1APLC 1FTZA 3HIMA 2DG7A 1TC3C 4A3DJ 4GFBA 3GTLJ 1ETKA 1MBHA 1RESA 1Y1VJ 3G7RA 3S14J 4DYQA 4MO7A 1PUFB 5IP6A 3UKGA 4AC6A 1K83J 2ECBA 4B4CA 3CQZJ 1I50J 1JUSA 3BQYA 1VFCA 3JRIA 2M2EA 3H3VK 5M3MJ 2NVTJ 3HOXJ 3TEDA 5F1JA 5CXIA 2FJ1A 5JLXA 1WGXA 1T33A 3TW6A 2VKVA 4M3FA 2R5ZB 2EBIA 4BBSJ 3HB9A 3QKXA 1U9NA 5E3OA 5J1UA 5EG0A 1AHDP 1HOMA 5EZHA 1H8AC 3CDLA 3L1PA 4KWAA 3VVZA 3T6NA 1P7IA 1AKHA 1PUFA 1P7JA 4FE4A 5FHPA 1U8BA 3KKDA 3VW1A 3HTAA 5C4XJ 2WAQN 5K7FA 1FEXA 5AQCA 2JA8J 4C3HJ 3BR2A 2JA7J 1Z0XA 1W0TA 2ME6A 3GTJJ 1YRNA 5IYBJ 1OJLA 2M9HA 3CCYA 2IAIA 1GV2A 5IPAA 4IHXA 3VOKA 2E2JJ 2DMPA 3ZQFA 4A3MJ 3GTGJ 3HOZJ 4GCTA 3BTJA 3GEUA 4A93J 3HTHA 3VOXA 3RQIA 5M5WJ 3BRUA 4MXMA 3M3YJ 1GVDA 5F04A 1JT6A 3JRDA 5CXGA 3MN2A 2JJ7A 1MSEC 1OFCX 2EZLA 3NNRA 4XRSG 1GV5A 4D7NA 2X6OA 5K7HA 3K2AA 2HI3A 2O7TA 2XGEA 3NRGA 2OF7A 2L7FP 3O8GA 2NS8A 1RR7A 2NS7A 4BBRJ 4IHYA 1O4XA 2GM4A 4CYCA 5FJ8J 3I4NJ 4IHVA 2HQ5A 3GBGA 1H88C 2L0KA 3QQAA 3O60A 2CU7A 2ID6A 3WHBA 2V57A 5FMPA 2MW8A 4JYKA 3VVXA 1ZTRA 2EZHA 1Z77A 2YS9A 2JA6J 4XRSA 1U78A 3FK7A 1Y1WJ 4A3JJ 1IV6A 3EUPA 3NPIA 4JKZA 4V2GA 5D19A 1TWAJ 2GBYA 3BTCA 1MSFC 1UI5A 2JMWA 3RH2A 3S2HJ 3Q0WA 3OSGA 4DW6A 3BR5A 3SFIA 1IC8A 1JJ6C 3VVYA 1LFBA 2CUFA 3S16J 2DJNA 2L7ZA 3OSFA 3CWRA 2FQ4A 4UUSA 3VP5A 3IUVA 3VUQA 2E2HJ 1BW6A 3I4MJ 3TW7A 1H89C 2NP3A 3V78A 4CYCB 2Y2ZA 2G0EA 2NX4A 3BG5A 4IEJA 3A03A 3M4OJ 1RKTA 2LLKA 4I6ZA 3GZIA 3OOUA 3TP0A 1JKPC 1K61A 4QIWN 1UHSA
chains in the Genus database with same CATH superfamily
3ZMUA 3R0JA 4BU2A 3HOVJ 4EM1A 5CVUA 1YO5C 3LA2A 3Q5FA 2VONA 1SGMA 3OYEA 3EGQA 4XLCA 1T38A 3ZN1A 4LJZF 2IS4A 5CVRA 3CJNA 1J5YA 2ZMEA 2Y30A 4HX8A 2UXNA 3LMMA 1HCRA 4JX5A 3L2QA 5L3CA 3ZQHA 1B59A 5BMZA 1E3OC 2VLAA 4BAYA 3MFKA 1G3YA 4CCJA 4EM0B 2W57A 3N97A 4DNCA 3QU6A 1KYWA 1FOYA 1PJRA 3D5SC 3EUAA 3KEQA 4HPQA 5F0CA 1E3PA 2PJRA 3LWJA 2V1XA 2HKXA 2CQQA 3ZQIA 3P9IA 2W85A 2K3PA 2W82A 1WI9A 3GTQJ 3A0BC 4AVPA 5JHUA 2CV1A 1N75A 2YU9J 2H6CA 2XAUA 1UELB 2E1MC 5D5VB 4I01A 5D6FA 4XM3A 1TW2A 2OU2A 2LTPA 2J5OA 2W48A 4RB2C 4X1EA 4XNFA 1FMWA 4E7SA 4PSWA 4EVIA 2LH9A 4OD5A 3EETA 2XUBA 3LSGA 3SHFA 3ERMA 1K6YA 4ZZLA 1IRXA 1D1CA 1SD7A 2QGUA 5LLQA 1SAUA 1KQ8A 2JA5J 1KQ0A 3B81A 1BOBA 4BS9A 3JRHA 2L01A 3F0CA 2N8GA 4OIQF 2ADUA 2OQGA 3BZKA 1MBGA 2XV4S 3CCVI 3H9JA 3ONQA 3OS2A 5E17F 4PCQA 3ON4A 1XS9A 3VYUB 2XIGA 3E1SA 5HBUA 2EILH 2IA1A 5K5RA 2UXIA 4KIGA 3K1NA 3JRCA 1TWCJ 4ON0A 1T8IA 1Y56A 1YIJI 1R23A 3B02A 3HG9A 3PSFA 2IS1A 4M3GA 1BA5A 4L9VA 1JKRC 3E6CC 4LB6B 4ANJA 1IXCA 1MGTA 2ETHA 3CF2A 5BNGA 3BG3A 4BEHA 4OD4A 5IYDJ 3WGGA 1USTA 1ACIA 2GXGA 4A5NA 3CUQA 2L9NA 3VW2A 3C2GA 3H0DA 4M6VA 1YJ9I 5ICCA 2DTZA 4XN0A 2HKUA 3I58A 4O5VA 2W24A 2OZ6A 4PDKA 2GUHA 3F8CA 1H0MA 2LMDA 2XSDC 2IPQX 1OKRA 5KK1A 4AIJA 1IF1A 2DJIA 1MBKA 3A02A 4XORA 3QWLA 4RAFA 3TDUC 1HW1A 4BY7J 2WV0A 1Z6TA 1K78A 4HZFA 3JR9A 2ZXJA 4BE2A 1ULYA 1YS6A 4DBQA 3PNTA 4CA0A 3SFZA 1OCOH 1WFXA 4PUSA 2KJBA 1B4AA 4EJVA 2OQRA 2H8RA 1QNTA 5FROA 2LP0A 2WADA 3PSIA 4RB3C 1U5TA 1MMGA 2NVYJ 2L3DA 2CO5A 2V6CA 4ME9A 4S05A 1IG7A 1PUEE 3F8FA 4A3CJ 4C2MA 3E5UA 1EKEA 4HV5A 1DU0A 4XKBA 3LAPA 4Y7NJ 1F5TA 2J5PA 3QOEA 1MBJA 4D5FA 1MIJA 3IRQA 2M8EA 5E8IA 3VWBA 2CV0A 4D9JA 2HXOA 3ECHA 3JTGA 1Y8QB 3X2QH 6PAXA 3KNWA 4OAZA 5DUKA 2ELKA 3NEUA 3HTJA 3DEWA 3HIFA 1KU7A 4HSTA 1HLVA 1TNTA 1JGGA 1JUMA 3CMEI 4HSRA 1C0WA 2V9KA 1IJWC 2JTVA 1NK3P 2ZXIA 1QRYA 2XGCA 4EJUA 2JUCA 3MMYB 1E2XA 3WTZA 5EF6A 3AG2H 3M8JA 1IRGA 3OV8A 3RYRA 1Z91A 4U9NA 3HM5A 1W36C 3RKXA 3G6EI 3NXCA 2Q2EB 2MABA 1EH8A 2GA1A 1EA3A 2R93J 2QCOA 1ZGWA 3MKLA 1M1EB 2MSYA 2R0QC 3CUQC 1FYMA 2QM3A 2WY7Q 3G4SI 1VQ9I 1LVAA 5F0FA 1R36A 3H5RA 3OIOA 4B43A 3FXRA 3G1MA 2L9VA 4HQMA 3SQNA 1ZLKA 3CCMI 3A2KA 4MK6A 1R6RA 2VXDA 3M7GA 4M3BA 4N9HA 1Z1DA 2R4GA 2DPUA 5D18A 2LR8A 2VL8A 3MZHA 1X1PA 3IAS2 4MFDA 4CYDA 4Y13A 5E79C 5C4JJ 2B1EA 2IU5A 4ZJZA 1Z21A 4NDLA 3ZMVA 1QPMA 4C9YA 5J4VA 3ZMZA 2PMZN 2G7GA 1P4XA 2ZOYA 2PMHA 1D5YA 3S3MA 2OD5A 2GIVA 3K4NA 2FUG2 3M8FA 3HSFA 2MYSA 2GFNA 4N0BA 2R7VA 3R4KA 1LFUP 3FK6A 4RLFA 2OI8A 3HUGA 1TL8A 4HNVA 1CGPA 3GO5A 4FT8A 3BCGA 2KPMA 3HTUA 3K0LA 2DFIA 5B5EC 5BS6A 3CDHA 1VNDA 1BJAA 1FBUA 2E5NA 2VQLA 2FRHA 3VPRA 4XIDA 2X1CA 3F72A 2KFDA 3CJTB 2E1NA 4PXIA 5HVQC 2IGNA 1K4TA 5F0HA 1MDMA 2VBXA 1UI6A 2RKHA 4G8XA 3BNIA 2L7MP 2F07A 3PASA 1HF0A 2IGMA 1BBYA 2HOAA 1WPKA 3C07A 4LG0B 4U9LA 4U7DA 4AM3A 2R7TA 5KNLA 1JTYA 5J4YA 3IH4A 1IDZA 5E1WA 2KJCA 3RKQA 1HSJA 4JQFA 3IL2A 2BY2A 2LK2A 4I76A 5H20A 3I55I 5HOOA 2O7OA 2LSOA 1S8NA 3ZQ7A 3G2BA 1J09A 5K58A 3QBMA 1WJDA 4DZJA 4XRFA 1P92A 3VSLA 2Z9OA 5AIQA 2XGXA 5FLXZ 2O6GE 4LMYA 2OTJI 3I4PA 1FP1D 2KL4A 3L2WA 2MLKA 3WU0A 2WC2A 2ZJPF 1XPXA 3SDBA 3KKCA 4WXDA 4OIRF 2E1CA 4BNCA 2QOPA 1MH4A 5CVJA 3M8EA 2L54A 5EYRA 2E7WA 3K4CA 4IZZA 2R7OA 3K2ZA 2VE9A 2HDWA 3BG9A 2CW8A 3LJLA 3MKYB 2NVQJ 1X3ZB 2XGDA 4F3QA 4LB5A 3TKYA 2R7ZJ 4B47A 2F48A 5TISC 1JI8A 5DUIA 1SVOA 4DVYP 1WRJA 4YIFA 1LEAA 3N4MA 4XKWA 5AONA 4NNJA 2W53A 3CCSI 1HKTA 2ZY9A 2R5ZA 2X1DA 3R60A 2M8GX 4W97A 4FTHA 2WB1A 5HS9A 2ZCMA 3FRQA 4HF1A 3JSOA 1X1CA 4MFEA 3NS4A 4Z2YA 3HIMA 4KMUX 3IAM2 1T0FA 2NS0A 4ETSA 4A3DJ 4DOZA 2VJ5A 1RESA 1LQ1A 1VQNI 1QBJA 3FMSA 2YSRA 1QHHD 1EH7A 3CQZJ 3KETA 1JUSA 1XDUA 3JRIA 1S9HA 2HR3A 3H3VK 3MAJA 1YFHA 3ELKA 1ZYRF 4XL9A 2YX7A 2MH9A 3PNVA 2JVGA 1I3AA 2ZNZA 3V8KA 2ISYA 4CICA 1TT5B 2MBFA 1G8XA 3VYRB 1ZRFA 3R61A 1LDDA 4II2A 3ECOA 4L9TA 1AHDP 3FBNB 1HOMA 5EZHA 3VVZA 3CDLA 4KICA 2QSGX 4CCMA 3T6NA 2X1EA 1AKHA 5L3BA 2STTA 3JSPA 4WX9A 1U8RA 3KKDA 1BR2A 3OYDA 3HRUA 2HVRA 4OINF 2O61A 1OCCH 5C4XJ 2FU4A 2JA8J 2JA7J 3OL3A 2IS6A 2E71A 4CZZA 3I5UA 3DU6A 5JI6A 2W00A 1B9MA 2A3SA 3FX3A 1DP7P 1G3SA 1G6NA 1QGPA 2ZXWH 3VOKA 2ZNYA 3T8RA 4GDFA 2FQ3A 3ABUA 4HG2A 2PN6A 5E8GA 4ZDLA 2DO7A 2ZCWA 4JOMA 5M5WJ 4LITA 3K10A 4A5MA 1JT6A 1N77A 1HA8A 1OFCX 2EZLA 2G7UA 4IRGA 4GRIA 5ERIA 4GXOA 2RNJA 3WG7H 1XSXA 2HZDA 4C2UA 1UG0A 2HI3A 1U3EM 3QP5A 3AL0B 3NRGA 1QU3A 2V1UA 1MNEA 3UR3C 1RR7A 3UNGC 2Y0SA 1O4XA 4EMSA 4KYWA 2XAFA 2HZTA 2HQ5A 3GBGA 4AIKA 1FYKA 2L0KA 5DM7F 2ID6A 3WHBA 2L7KA 3FKJA 3CZ6A 1DQUA 1G3TA 1ZTRA 2EZHA 1NHAA 1Z77A 3WE3A 4CXFA 1HXDA 1RNLA 5HDKA 4XRSA 1U78A 3ZMSA 3F6VA 4V2GA 2GBYA 5GAHJ 4MTEA 4ASNA 5DM6F 3KP7A 2O3FA 5JHFA 2JMWA 3RYPA 3S2HJ 2DTRA 4DW6A 2STWA 4PZJA 1IC8A 1VQLI 3QPHA 4YELA 1JJ6C 3S16J 2DJNA 2L7ZA 3RCOA 2F5FA 2FQ4A 1AOYA 3I4MJ 3PJRA 1H89C 3V78A 4G7ZF 1MMNA 3RKYA 4IEJA 3O3KA 2NRAC 3A03A 1UAAA 1D3YA 5FRMA 5IT9Z 3M4OJ 3TMOA 4RGRA 4MEYF 3RPUD 4II3A 5HNHA 4I09A 1ZRDA 1U2WA 3MWMA 5HS7A 5D5WB 5CJ9A 1JKPC 4Y4RA 1AA7A 4QIWN 1YHQI 2PFBA 3RD3A 2ZFUA 3K4KA 4EQQA 1UFMA 5HDGA 5E20A 1D1AA 5FKLA 1YX3A 4QPOA 2QKOA 3QPSA 2P7VB 2IA0A 3CCUI 4OIOF 1V54H 1GXPA 2LY9A 4UUSB 3RI4A 4BL0B 3IKTA 3GTPJ 1YW9A 3CP8A 3JRAA 3LFKA 1OR7A 2CGPA 4X0GA 5FKOA 4KMFA 3FISA 2V7FA 2FE3A 4EATA 3PM1A 4XLHA 2FEZA 3GW2A 1D0YA 1IUFA 3RSNA 3H1CA 1G4DA 1ONVA 5FRNA 3S3OA 2FBHA 2F5CA 4HF0A 4PJNA 3MNLA 1X2NA 1WKMA 2DA4A 5KCMA 1STZA 3DXJF 3AKZA 1A31A 4L9NA 5FFXA 1OCPA 5M5XJ 2AS5F 1E3HA 1KU3A 2AQFA 4FE7A 3GFIA 2Y0MA 4ZYAA 1A5JA 2Q24A 3L09A 3IKVA 2QF7A 4KN7X 3CDIA 2WGBA 4AD9A 2HTSA 2QQBA 4V2FA 4IHTA 4M72A 5J1YA 2KMUA 5FLXK 2KDOA 1HSTA 3QYBA 2HOTA 3PIPF 3F8NA 1ZN2A 2BBYA 2M1BA 5FLMJ 3LAJA 3TGNA 3BR1A 2WUIA 4EV0A 5IP7J 2KRFA 1FPQA 5CVVA 1FOWA 4M3DA 5CKTA 2WBMA 5LD2C 2JPBA 2M45A 1TZLA 4HKUA 3HRSA 2RASA 3OYIA 4G7HF 1W7PB 5GPAA 1USSA 1R5ID 3DLLF 4CHUA 1BL0A 1Q1VA 5LHGA 3EPZA 2NOGA 3GTMJ 4JX6A 5M5YJ 1LE8B 4Q47A 5DCFA 1W36D 4XMYA 3G71I 2JT1A 1WHUA 1B6AA 2H94A 1RRJA 2ESNA 2P8TA 3R0AA 4GO1A 2YPRA 1LVKA 2CRGA 4NQWA 2YVHA 5J6XA 3OYMA 4F92B 1ODDA 5DCMB 2Z33A 1MJBA 1W1WE 1V4RA 4HEA2 3OYCA 3W6VA 4RM3A 2OTLI 5HLGA 2DA2A 1R22A 1IN7A 1BI2A 2WTEA 4IRHA 3S1MJ 2BHZA 2XPWA 2QSFX 3B73A 2RGVA 1X2MA 4QSHA 1ETWA 2B0LA 3J81K 1ZLJA 4PJJA 3H9GA 2EFPA 1U0JA 2VE8A 3MEXA 4UVBA 3SDGA 1L3LA 3RDIA 1I5ZA 3J80K 2I5UA 1YI2I 1FZPB 3HOUJ 2Y75A 4KT5C 3K70C 2TDXA 4F52A 5HS8A 2V1DA 1JE8A 3CMAI 4UNOA 1BW5A 2FBIA 4MLOA 1XCVA 2LF8A 1R4MB 2VJ4A 3U1KA 1ZGAA 3H9QA 2A07F 2EA4A 3KZIC 1HBXG 4RAYA 3QPLA 1R9TJ 3AAFA 2COBA 1ORKA 2IEKA 2L5QA 2XF6A 2ZSHB 3QP6A 2R7UA 5A2QZ 2IBDA 2RV8A 3FXOA 3V7RA 2IJLA 3ZCOA 2DOFA 4JBAA 2JSPA 3SEZA 3GZ6A 1ZH5A 1UG2A 4ICHA 4UXNA 1D1BA 1ETQA 2PQ8A 2QUFA 2UXUA 2DQLA 3E7QA 2P5LC 2FNPA 5GAEJ 4IQJA 3G1LA 1P4WA 1S72I 2RVCA 2D2WA 5D8KB 4HDVA 2KZVA 2FX0A 5FFZA 1FJLA 3SZGA 4HW0A 4QWQA 5HAWA 3PO2J 2XASA 3KFWX 4BXUA 3BJOA 1UHMA 2P4WA 3CMYA 3ZPLA 1KGSA 1R71A 5ICEA 4RGSA 4XKCA 2OAZA 1ZHFA 4OWRB 4RA2A 1W0UA 3DPTA 4E4HA 3RPQA 3BR3A 2RHAA 2ECCA 3C2BA 2FOKA 2XSJC 3HRTA 3F6OA 1FNNA 1PVEA 5L3GA 3EYIA 3LSTA 2VC0A 3BCBA 1DGWY 2OCEA 4JP0A 2R7FA 5J47A 3AQTA 4MTDA 4LK0F 1SVLA 1T08B 4A3FJ 2PJRB 5K1YA 1QZEA 4G94A 3HSEA 1ZREA 2H27A 3BY6A 3DFGA 4NN1A 3A01A 5FLVA 4G6QA 3FMRA 2G7SA 2TRTA 1T0FC 2KDZA 1B72B 4L62A 3I54A 4D5CA 2CFOA 5KAIC 2BHYA 2KIFA 2M87A 5LGUA 3PO3J 2A68F 2L2OA 3I0TA 3TDZC 3K7AJ 5DTDA 2EZIA 1X19A 2L9RA 2DT7B 3NWTA 4FETA 1D8JA 1GLNA 4GFKA 4C30A 1R7JA 3KLNA 4CCNA 1DGRM 3PQKA 4LOCA 4UY8I 2W84A 4BJ6C 5EG0B 2PG4A 2FA5A 2F5VA 1ENHA 4L5EA 4BXFA 2QKMB 3GYHX 4H0EA 2GXBA 3C1DA 2QQ8A 2OCCH 4XRMA 3BC8A 4GCVA 2BVMA 5KHDA 4BE1A 1TT0A 2FBQA 3ZQCA 5L3EA 4S04A 1VF9A 4PJLA 4TV7A 1HW2A 2NXNB 2PI0A 1FLIA 4G6TB 3W2AA 3WTUC 5DD8A 1YRNB 1CF7B 2AXTC 2V26A 3ZOBA 4E7ZA 1F1ZA 3BQZA 4LK1F 2CQKA 1BI1A 3ON2A 4ZYHA 1F36A 4B1RA 1JXSA 1A6IA 2WAQA 4G12A 1MMDA 5B3SH 3E6MA 1MBEA 3T8TA 2E36A 2Z1DA 2R5YB 2MGQA 1TWHJ 4YG2F 4BEHB 3IH2A 1LEBA 3DPJA 3GTKJ 4AF5A 2DMQA 4KITB 4GYIA 4C2TA 3CUQB 2DG8A 1ON2A 3V6GA 2VC1A 3NAUA 4MQVA 1LB2A 2KIUA 1ETOA 4HAMA 5BPDA 1JGSA 2E19A 2UUZA 3B6CA 1AU7A 3VSKA 2X9DA 3H92A 3QPTA 4XSZF 1A35A 1X58A 3K69A 3AQSA 2QLZA 2OJED 3FXKA 3MVPA 3AG4H 4LLNA 2XF7A 4E7KA 3HPHA 2D45A 1X3WB 2EZKA 1OQYA 3S17J 3HXLA 4CGRA 5K7ZA 2DK8A 3OYBA 1K78B 1FWZA 4O6JA 3VIBA 2AQEA 5JLWA 1SANA 2VKHA 2K4BA 3DTIA 1FY7A 4U0YA 1R1UA 1UMQA 1PP7U 2BY3A 2IW5A 1YG2A 3BTLA 3F3XA 2Y9YA 5GTHC 2BVLA 1FOXA 3TL4X 2C6YA 2H1KA 1P6RA 3ASOH 3HOTA 5EGOA 2WWYA 1IGNA 3ZMTA 4KIBA 1K6OA 2DYRH 2V9PA 4ZDPA 5ED4A 1A6QA 3K9TA 1U5TC 1OCTC 3KYLA 3L00A 1S29A 4P55A 1OYIA 1TWGJ 1XD7A 2EV0A 4B44A 4IJAA 2Y9ZA 4BGDA 2V4JC 5E3MA 2QTQA 5CPRB 1R00A 2X0LA 3S2WA 1B9NA 2E7XA 2W4SA 3VTIA 2A05A 1WJEA 1Y39A 2LKPA 1BIAA 3GFMA 2DA3A 2AXLA 2XF5A 4XICA 2UV1A 1FTTA 2CH0A 2FMLA 2DODA 3E97A 1QZZA 3J80Z 3KCCA 2DG7A 2EV5A 2VOPA 1MBHA 1Y1VJ 1FC3A 4P1WA 3WU2C 3OYHA 3CCJI 1PUFB 2DDAA 2L02A 5ILVA 3IUOA 4BHPA 3BQYA 4YFNF 3BJAA 1X4PA 5M3MJ 2EPFA 3SZTA 1LJ9A 4NC8A 3TEDA 3MQ0A 3COAC 2OC6A 1ZG3A 3V42A 2DPDA 1BIBA 3OYNA 1R1TA 1T33A 3TW6A 4WIBA 3FDYA 2EBIA 4OAYA 5FGMA 3KP2A 3LQRA 2EV6A 2EFWA 4ESBA 4AVZA 1HKQA 1SMTA 3OMYA 1H8AC 5HLTA 3FXJA 4D1QA 1WSUA 1P7IA 1FT9A 5LEKA 1YE9A 2VN2A 2DT5A 4FE4A 4E6KG 1U8BA 3HTAA 2WAQN 4HRIA 3CCQI 1FEXA 1YJWI 1W0TA 4DJAA 2EINH 2PFVA 2D1VA 1V5FA 4P96A 2HU9A 3GF2A 1X3UA 4HNUA 4J01A 2M9HA 2A61A 2Q1ZB 2HQRA 2IAIA 1GV2A 2DMPA 2DOEA 4HF2A 4GCTA 4KN4X 2K86A 3H3UA 3GLLA 3RQIA 1D0XA 3GUDA 2LBFA 1QA6A 3BRUA 3DKYA 4MXMA 2K27A 3WU1B 3JRDA 1MSEC 5CXGA 3BPVA 2YX4A 1VQ8I 2FXAA 2CMPA 3T0YA 1VQ5I 2CUJA 4D7NA 1TW3A 2X6OA 4LG0A 3V8JA 3LL7A 4LFUA 3TQNA 2FOWA 4A6DA 2OF7A 1Z3YA 2NS8A 4XLPF 2NS7A 4IHYA 3S3NA 4CYCA 3I56I 3I4NJ 3FHZA 4IHVA 2I8DA 4L5JA 2EB7A 3QQAA 3AFHA 5FMPA 4HLYA 3OR2C 2MW8A 4UHTA 2YS9A 4XONA 2JA6J 1IV6A 3WG9A 1SD4A 4QLCU 2A5WA 5D19A 1YIOA 1YLFA 1IW7F 2FJI1 3K1MA 4B48A 3K4JA 3SFIA 1FP2A 3SEQA 2BE5F 2CV2A 4QPQA 4LGWA 1VQ6I 3OSFA 2ZMEB 3VP5A 2HOEA 3OWTA 3IUVA 3VUQA 2NP3A 5H6QA 1D5VA 1BC8C 1RKTA 3LA7A 4I6ZA 5DDGA 5F1RA 2KIQA 3OOUA 4LLLA 3ZR8X 3L9FA 1WJCA 5LRRA 1K61A 3K1PA 3LA3A 5H2FC 4UDSA 2HVQA 2NNNA 3A1YA 4V19K 2CFXA 3CRJA 2X6YA 1IN5A 1IRFA 1IO2A 5LGNA 1D0ZA 4RB1A 1KA8A 1WH7A 1Y0NA 3BCAA 3W2WA 1N78A 2Y31A 1EH6A 3F8MA 4MEXF 3GXOA 5IY5H 2X6WA 2UXPA 3H5AA 4HA8A 4EGYA 3HPGA 2DI3A 1ZGJA 1WWXA 2HDCA 1GT0C 2QBYA 4IQ4A 3BJBA 3DBHB 4E7HA 3EYYA 3K6GA 2A69F 5IOZA 2ZBKA 3CD6I 1J59A 5J40A 3PQJA 2B63J 1Z6RA 4KJZA 2EK5A 3HHHA 1ZG1A 2L4AA 3ZQLA 2DDBA 2X51A 1BI3A 1WH5A 4A3LJ 4CH7A 3SZPA 4RBOA 4AIHA 4ZYEA 2G9WA 3KP3A 3E3VA 1WVRA 4PGHA 1REPC 2HOSA 3BJ6A 3GLXA 2DFEA 4BKXA 3IP4B 2A6EF 3HE0A 2WAFA 3QYFA 3BG6A 3FIWA 2ZJQF 2MA3A 2V79A 2UXHA 2BW3B 2XAQA 3QOPA 3WTYC 2RNGA 1MMAA 1S5LC 2H09A 3JRBA 3S15J 2OA4A 3D5RC 1V5GA 3E5XA 5AIPA 4GCKA 1RI7A 2ID3A 1XGSA 1H9TA 3BR6A 3BTIA 4RGXA 3FZVA 3H3ZA 5DS9A 4ZTFA 4FCYA 3W6JB 3S32A 1X1BA 4O3MA 2ZCNA 3CESA 4Y3OA 2WB1N 2EH3A 2LFBA 5LRSA 3Q9VA 4L5IA 3E6DA 4BHCA 3SJMA 3F1BA 3B6AA 2YR2A 1IXSB 1DP3A 2EQRA 3MCZA 5EEGA 3EDPA 2M0CA 2K9MA 1DPUA 3FXMA 2UXXA 4LIUA 3WTSC 1HW5A 3N05A 2H1LA 1XB4A 3LSMA 5HODA 1BM9A 5JR3A 3HRMA 5GAGJ 1MNDA 4Q48A 1NH3A 2ME0A 3OIPA 3DWLE 1ETXA 5DAJA 3GTOJ 2M4GA 4NC6A 3I59A 1HC8A 3QRFF 3IC7A 2JVHA 3OYAA 5BOXA 4IX7A 2E2IJ 1G59A 3HOYJ 1POGA 2MC3A 3F23A 4Y52J 3RZDJ 1T98A 1V55H 2DA1A 2M0MA 4FQGA 1VQOI 4A3EJ 1ZQ3P 3KE2A 3BHQA 3EUHA 1IRZA 1W4MA 4I98B 2W25A 1VI0A 2NOJB 2RAEA 2LD5A 2DFHA 3JSJA 1T56A 3BROA 2YVEA 1B8IA 1WJFA 1IN6A 2JRMA 2JZYA 1QZYA 3OS1A 1T6SA 5H9TA 1OCZH 2FF4A 2LVSA 2DA5A 3MKWB 4GFLA 1OMIA 1FBQA 5IP9J 5DV5A 4C3JJ 4NC7A 1GXQA 5LEJA 2KP6A 2W7NA 2JPCA 1O57A 4IOCF 3ZP5A 1YOVB 5CLSA 2PX9A 2M34A 1OYWA 2DU9A 5J3LA 1IAWA 3K4MA 3TO7A 4GCLA 1SFOJ 4KNYA 2VKDA 1AWCA 3F9KA 2QSHX 1CQTA 2R7DA 2X6XA 1K4SA 1TQMA 4YFXF 2E1MB 2CS3A 4XLFA 2B9SA 2IRFG 2MH2A 1SVMA 1FIPA 3OY9A 2M5WA 4M6XA 4WXCA 3J7AY 3G3ZA 5J8FA 2HQAA 4XLNF 1PDNC 3K4BA 1JTXA 4BHBA 1YITI 3HOWJ 1FIAA 2A5YB 1I27A 2LC2A 2VPRA 1BN5A 3V7CA 5LBQA 1QQIA 1ZARA 2DCEA 3M1CA 1O3QA 5D6EA 2Y0SN 3KPHA 4RLQA 4U88A 3JAMZ 2IT0A 2R7WA 1MMSA 4B09A 4I2OA 4M71A 4ENKA 4BY1J 2XPVA 1J7KA 1NG6A 1IN4A 5M3FJ 2DMUA 2IVMA 3AL0C 2ZKZA 1SD5A 5J1RA 2IS2A 4D0PA 3V4GA 1NG7A 2K02A 2BEOA 4OOIA 1O3RA 3EUHC 2OUMA 3MZ8A 2KKOA 3P9TA 2ACJA 2FD5A 3HUGB 2VJIA 4EEFG 2GLOA 3LOCA 3J7ZI 4XKVA 4EGZA 4ZC3A 1RPWA 2PJPA 2XAJA 5CQGA 2A6HF 4M74A 5CYVA 3LSPA 1FSEA 1W7PA 3OL4A 3LSKA 2DN0A 3BWGA 3KYDB 2HXIA 4UV9A 3DU5A 1BOAA 4U7BA 1ZAOA 1JT0A 1R4NB 1MBFA 1LE8A 4IF4A 2VBWA 4I7HA 2KISA 3DF8A 4UVCA 3BT9A 1TNSA 1Z67A 2JRTA 2HDDA 2ZXHA 5IT9K 2HYJA 4A0XA 3HOSA 1UCRA 3U1DA 2EFQA 4JNNA 3CLQA 3C7JA 1R1VA 5FKKA 2CWEA 2FBKA 4LG3A 3JREA 3I53A 1KYZA 3DV8A 1LDKB 1XG1A 3OR1C 3I3LA 2HPMA 2K40A 3HEFA 2DQRA 5EEHA 1WJBA 3HJEA 2XROA 4XQFA 4N4NB 4OMYA 1YS7A 1J9IA 1ETYA 2EIJH 1VQMI 2EJRA 3P7NA 1GDTA 1JHHA 4AU7A 2L9SA 1LNWA 5FKNA 1UJ8A 3FM5A 2RN7A 5HSZA 1XGNA 2IGKA 2PBXA 3DTKA 3E0JB 4J00A 4BQQA 1H9GA 5TJJA 4A3BJ 2I10A 5D4RA 3DCFA 4H4KC 2XB0X 1FBSA 2O5RA 2E5ZA 4GYGA 4PJ0C 2NNYA 3VFZA 1OISA 4M6YA 3ZQQA 9ANTA 1SFEA 2EFNA 2CW7A 3HSRA 4RDUA 4XLEA 5K5QA 4ENNA 1XX5A 2ICWG 1X1DA 3ML6A 2DW4A 4ZH4F 3VB2A 5FGLA 4HOBA 2BXYA 4IXAA 5D5XB 1ETVA 4ESFA 4FX4A 3S1NJ 3GFLA 3I9V2 3CJRB 1WQ2A 3NARA 3RQ4A 1MDMB 2G7LA 1GVJA 2P5VA 1P4AA 5C3EJ 2RDPA 2F4MB 4LD5A 2V1NA 2XKOA 2ZJ2A 5BPIA 2HFHA 3G56A 3OYGA 1RKWA 1V3FA 1KQ9A 3JTHA 4KFCA 4R8HA 3IV5A 1SFKA 2DBBA 5D4SA 2P5KA 1YYVA 2PEXA 2XAGA 4J19A 2EWNA 4XSXF 3AG3H 3PUBA 3NWSA 4IHWA 2K85A 3S1QJ 2RQQA 3HKZN 3FXLA 4ZTJA 3HDDA 2VQCA 1TWFJ 2Q0OA 5E3LA 2XDNA 1W7PD 2TCTA 2XAHA 5CQEA 3G73A 4WF2A 2MFZA 1ZR4A 2VIXA 3ROUA 4AUXA 3D1NI 2IGOA 2B3WA 2HS5A 2O03A 4W1UA 5E18F 1SFXA 3BOQA 4JL3A 4LLGF 1DPRA 4YEJA 3ULQB 4HX7A 3V7SA 3JRGA 3MKZA 3KZZA 4X6AJ 2GXAA 2ZB9A 3IHUA 5ICGA 2M30A 3CJDA 3BZ6A 5F6FA 2VASA 2XVCA 3S1RJ 1FTZA 4HLXA 1QHGA 4M9SA 1TC3C 4GFBA 3WGIA 4WK8F 4P9FA 4MO7A 5IP6A 3UKGA 3KP4A 2ECBA 3IWZA 1VFCA 1LDJA 2M2EA 4ENJA 5JFRA 1YX5A 3SYTA 4IHSA 1Q1HA 1G3WA 5CXIA 2HQNA 4M73A 3ZXSA 1WGXA 2COMA 1F4KA 2VKVA 3FBIB 4M3FA 2R5ZB 4NB5A 3IRRA 3HB9A 3QODA 3WTVC 4BBSJ 3QKXA 1U9NA 2BXZA 4F91B 4CSWA 5HLHA 3AG1H 5EG0A 4L0ZB 5CVIA 5TRDA 4KWAA 2FMYA 1SD6A 3W3CA 1BR4A 3C3WA 4BE0A 1B1BA 5A2QK 4MNUA 3FXUA 3VW1A 2X4HA 2R7XA 1TQIA 2LOOA 3LSHA 1VQPI 2VXZA 1Z7UA 1YRNA 3DQVC 1OJLA 3GEZA 1RZ4A 5IYBJ 1VQ4I 3CCYA 4BACA 3MD2A 4P9UA 5IPAA 3RTRA 5ICFA 3ZQFA 3GTGJ 3HOZJ 1TBXA 3GEUA 3HTHA 2M3AA 2DT6A 2P7CB 3KP5A 3OIQA 1I1GA 3M3YJ 4HV6A 5F04A 3VYTB 3DTEA 3HYIA 1S6LA 1R5GA 3DPLC 4KA4A 1Z05A 1TLHB 2EIMH 4R79A 3K2AA 1O7FA 2XGEA 2ESHA 2RC4A 2L7FP 2XRNA 4CCKA 3VEPA 1R5HA 2GM4A 4OU0A 1X4OA 4IO9F 1RUNA 3KX2A 1OYYA 2K5CA 3QYEA 2V57A 3WE2A 5D8LB 4JYKA 3VVXA 2K3FA 3D0SA 1GHCA 4BYYA 3FK7A 1SAXA 4A3JJ 3NPIA 1KONA 3CJQB 1TWAJ 3CP2A 4NHJA 2R7QA 4U0VA 3OSGA 4BUPA 1J75A 3BR5A 3KYCB 4E7JA 4F55A 2QQ9A 3J7AO 4EJTA 2KIMA 3E6BA 3CWRA 4UUSA 1VZ0A 2ZC2A 3DBLB 1BW6A 2E2HJ 1UB9A 3TW7A 4A0YA 2CSOA 4KISA 2G0EA 2NX4A 1RC9A 2QYOA 2RQPA 3T1BA 1YJNI 2QZ8A 1A04A 2LLKA 2PMUA 2XDVA 2CYYA 4BQAA 3HHGA 3GZIA 1XGOA 3TP0A 3DP7A 2QENA 3HL2A 1UHSA 1U5TB 2OPTA 4RB0A 2H6BA 3H36A 2MD5A 1L0OC 2VBYA 4E70A 1HQCA 3HGGA 2BZTA 3H5NA 5L3FA 2KHMA 2D6YA 2DFFA 4UV8A 4UB6C 3S8PA 3O2PE 1BI0A 3DKXA 2DA7A 1TTYA 3ZN0A 1ZRCA 3ANPA 1JKQC 2OV7A 4Y15A 3WGHA 2O8KA 4Y17A 4PJMA 1XN7A 3U21A 4KUMA 1I6HJ 3BPXA 2QIBA 2MG4A 4PFPA 3KP6A 5F08A 2VBZA 3W2VA 4IOAF 3RZOJ 2LY2A 3L2RA 5BQTA 4GGGA 3JAMK 1JUPA 3ZMDA 4RM2A 3PFYA 3S2DJ 4EM2A 3E7LA 3Q3SA 3DEUA 5E3NA 1WI3A 5C4YA 3U2RA 2YVXA 3K4LA 3M1EA 2QWTA 2F4IA 1BJZA 1QO0D 2VKEA 4HQEA 3LSRA 2E35A 3VODA 3VDXA 1WJ5A 3GX4X 1ON1A 3ZRGA 1EV7A 2BY1A 2K9QA 2X48A 4DQ2A 1F9NA 3ZGKA 4NUBA 4UB8C 2Q2EA 4RAGA 5D5UB 3DBRB 4I02A 4D7MA 2VODA 1I3QJ 1K7AA 2CW0F 4U87A 1ZELA 4CDGA 4Q4ZF 1ZR2A 3GCMA 2BY0A 3GZNB 5FD6A 1MNMC 2ELJA 4RS8A 3ESWB 4A3GJ 2GENA 2LG4A 2F5DA 4A3IJ 3Q0VA 5HNFA 2OBPA 4A69C 5FO5A 3TOBA 4MIMA 2VPLA 4RAZA 3M9AA 2D5VA 1JHFA 4F93B 3DLAA 2ZFWA 2R92J 3E5QA 2KLOA 4IPAA 5EJCA 1PYVA 3CLOA 5ILUA 1S7EA 4G9YA 3FHNA 2ZMEC 3S5RA 4AWXB 1U9OA 3PIOF 3OS0A 4CO8A 3KEYA 2MC4A 2ZO4A 3TO9A 2JSCA 3Q9SA 3TO6A 3F22A 1ITYA 1S7AA 3BZCA 4XR6A 1DDNA 2F5EA 1E17A 1JKOC 5HLIA 3JRFA 4A6EA 2HVSA 1Y8RB 3O8HA 5F27A 3S93A 1HDPA 1TP4A 3CMMA 2Y69H 4K2EA 1VQ7I 2F2EA 2BV6A 3J7YJ 1WJAA 1Z7LA 2EA2A 2L4MA 4XOTA 4C3IJ 3O6BB 3LNQA 4Z6YA 2X85A 2VUMJ 5GPCA 2HEOA 2BOLA 5GP9A 3OYJA 1MD0A 4ZYDA 1T95A 4DGWB 5TGTA 3C18A 3HBLA 4FX0A 1IXRC 2EIKH 3R6SA 5CW8A 2V9VA 1RUOA 5DCMA 4L0YB 3FM3A 1DUXC 3VW0A 2LKXA 2QQAA 3DEEA 3FF5A 2D1HA 4JK1X 2M7AA 4MQ9F 4ABZA 2HYTA 4BJTA 2Z2SB 3NI7A 5EEAA 5JVTA 2XKPA 3PL8A 3WTXC 1UHWA 2JWTA 4ACIA 4B3XA 1MKMA 2XRLA 5KVRA 4B8XA 4NBQA 3I64A 5FKMA 3F8BA 2XB5A 2REKA 1XCBA 2OZUA 4F7ZA 1BR1A 2Q8KA 3GFJA 2JQ7A 5E1ZB 1MW7A 2CQNA 2GZWA 1DU6A 1P9QC 3Q0UA 3CO7C 1FX7A 1LFPA 2Z3YA 4PFOA 2HTJA 2VJJA 1O7LA 1IV8A 4EJWA 5B66C 4YFKF 2VOOA 1I39A 2GWRA 5D1RA 1FMVA 2KQRA 2IA2A 4CGZA 3OYLA 2ZOZA 2P6TA 4AC0A 3ANGA 2DMTA 4E7IA 2UXOA 2DMNA 1MJ9A 5ILSA 2LF7A 2O9LA 2QBYB 2G3BA 1Z3XA 2DLLA 1E0EA 5IYCJ 2VQHA 2K4JA 2BYVE 1SC7A 1RIOH 2K9SA 4ZYGA 3KZ9A 1IDYA 2GA2A 3L7WA 2GIZA 2LREA 5IT3A 5DYMA 3CUOA 4B3AA 3NQOA 4DYCA 3LSJA 1VTNC 4QTRA 3VYSB 2CJJA 3W6KB 1JJ8C 3DKWA 3RIRA 3H0GJ 4DYRA 1D8KA 4KDPA 1QVUA 2BW3A 1XMAA 1ZK8A 2LNBA 5LGTA 2XC7A 4A2UA 1F43A 2NVXJ 4BQOA 5EDNA 1O3SA 3LQQA 4I99C 4BDZA 4BXXJ 4UUTA 2R7RA 4S0HB 2A6TA 4OMZA 2VI6A 2VT2A 3L2VA 4IKFA 2XPUA 3L2CA 3COLA 1W5CC 3CO6C 5EFYA 5J8CA 2JA2A 4FISA 2R5YA 3GWZA 4NELA 1XDSA 3CF5F 3A01B 1AKHB 4A12A 3REOA 2ZSIB 1B72A 3BR0A 3NRVA 2LYCA 1G2HA 1HKSA 3P9KA 2NP5A 1J0RA 2E60A 3EQLF 4XK4A 1OPCA 4M3EA 3K70D 3FKIJ 4P5OA 3ASNH 2P6SA 2MLGA 2P81A 3HZJA 1XSDA 4G6DA 2YU3A 3HTIA 4KIFA 1WZ2A 3WHCA 2JK3A 2ZCXA 2KZGA 1XMXA 2QEXI 4FHTA 3I59B 1GUUA 3A0HC 3IH3A 1WCMJ 4BJ5C 3U9GA 3TBIA 4CCOA 2QKLB 2KRCA 1XMKA 4BDYA 3HGYA 2NAZA 2XHKA 1OR7C 3F21A 5EZGA 5B1AH 2WV1A 5GTIC 4L18B 2K9NA 4G7OF 4RGUA 2HYGD 2KRHA 2CUEA 2JUGA 1ZKGA 3FXQA 4PSXA 2NVUB 1KU2A 5JVGF 4ENMA 3CCLI 2PZ9A 1UZCA 5C44J 2IXSA 2DAOA 1XSVA 1IUYA 3DPUA 1B8IB 1BC7C 1CF7A 5LHHA 3CCRI 1LUJB 3ABTA 3SXYA 2AHQA 3ZQGA 4DIQA 3RPUA 2VT3A 1YW7A 5GADJ 5IOYA 4I0AA 3K8PC 5EGOB 1T39A 3P9CA 1SMYF 2WAEA 3A4CA 3G1OA 2HWVA 3ERED 4YIRX 1I6XA 2KT0A 2HGCA 3IWFA 2A2FX 3OYKA 2DK5A 1QPIA 2MD0A 3TP3A 2O8XA 1W5SA 3LFUA 5LHIA 5KAFC 4AYBN 1ZG5A 3FWEA 4UUVA 1XC5A 2Z5UA 1NTCA 4PGGA 4JX4A 1SEUA 2CQXA 2QVOA 1SFUA 2CUZA 2YUSA 1EJ9A 1FOKA 1VQKI 4C2MJ 1Z9CA 5LFAA 4CCLA 4ITVA 2CQ7A 3MZYA 4HBLA 2FSWA 1EF4A 1KZHA 1OCRH 4XN3A 4HDUA 4E7LA 1HDDC 4Y33A 2W1OA 4A3KJ 1R49A 4HYEA 2AO9A 1LKXA 3OYFA 1RETA 3LHQA 3GZ5A 1MH3A 2JN6A 4YZEA 4YIIA 1K79A 5K5OA 1NK2P 4KT6A 4DZPA 3JW4A 3KZYA 2BGCA 3GMEA 3BLYA 2QWWA 2OERA 2K7LA 1RR8C 3RKWA 1V5EA 2E1OA 2GOMA 2ZJRF 4XOPA 2DA6A 2P0WA 2Z99A 3J81Z 2VB6A 1YQAA 1YTYA 1IN8A 4XLAA 1QVTA 4WWCA 3PPBA 4MHGA 1APLC 3WODF 4IRIA 1J2XA 2VQGA 3ISPA 4XBFA 1ETKA 4BQNA 2ISZA 3GTLJ 3G7RA 3S14J 4DYQA 2ELHA 4AC6A 3QAHA 1K83J 3WTWC 2R3SA 4B4CA 1I50J 3BG7A 1N25A 1X1AA 2HPIA 2NVTJ 4CZCA 3HOXJ 5F1JA 2HNHA 3WTTC 2FJ1A 3ABLH 4IVNA 4AIDA 3CCEI 5JLXA 1T2KA 4U0WA 2O0YA 2LRDA 4OIPF 4WXHA 2LDUA 3H35A 5E3OA 5J1UA 3VOEA 2FNAA 3LWFA 1LPQA 2GQQA 4AYBA 2B7EA 5B1BH 4N9IA 4I0BA 3L1PA 4ZDOA 4M9ZA 5F64A 3ABMH 2HKOA 3D5LA 4MGRA 1I1SA 1PUFA 1P7JA 5FHPA 4IL6C 4BH9A 2G7HA 2GOXB 2H8WA 3CTAA 5H6RA 3RJPA 2DYSH 3HC7A 2PBIA 3M07A 3BR2A 4C3HJ 5K7FA 5AQCA 1Z0XA 1FSHA 2DOAA 2WA0A 3PFIA 5E1XA 3BP8A 2ME6A 2NYXA 4M9XA 3GTJJ 3EUKL 4ZZDA 1W5TA 1IZ1A 1KU9A 4L9JA 5L3DA 4A0ZA 2Y48A 2QA4I 4IHXA 4N4OB 3HKZA 5FB2A 2WY8Q 2E2JJ 3C2HA 3L2UA 4A3MJ 3SWHA 4RMNA 2LKSA 4R1HA 3V8LA 3BTJA 4A93J 2DXIA 3TOAA 3VOXA 4NQWB 4DBRA 2PLYA 3HTSB 1GVDA 2F4OB 1MJAA 2Z16A 2RREA 1S7OA 3MN2A 2JJ7A 3GVAA 3KLOA 4EJOA 1R58A 4FASD 5DEQA 3NNRA 1XGMA 4XRSG 1GV5A 3I71A 4CUGA 3LSIA 1FYLA 1ERDA 5K7HA 2F6CA 2M7BA 2O7TA 3OOPA 1XTAA 3O8GA 2CG4A 4BBRJ 4Q5SF 2EFOA 3P5JA 2UZKA 5FJ8J 2UWMA 3T5XA 5DD4A 3KIOA 4ESJA 1H88C 3CC7I 4IRVA 3O60A 2CU7A 2PMZA 1P2FA 3QU3A 4PK4A 2E34A 3KEOA 3CC2I 1PP8F 2LBFB 1MZBA 1Y1WJ 3EUPA 4JKZA 3BTCA 3FMQA 3PNYA 2HYFA 1MSFC 2M4KA 4LIVA 5HDNA 3CC4I 1UI5A 3RH2A 1S3JA 3Q0WA 2V6EA 1A36A 2R7SA 1OLTA 3ABKH 1LFBA 1Y0UA 3JCUC 3VVYA 2CUFA 2LY1A 4HNTA 4WCGA 4UVAA 1O3TA 3BDDA 2GAUA 4CYCB 2Y2ZA 1YW8A 3BG5A 5FD5A 1Y6IA 3PUFA 2K9LA 4HX4A 1TQPA 2IP2A 4YRVA 1U6GA
chains in the Genus database with same CATH topology
2OPTA 3RD3A 3HOVJ 4UDSA 3CRJA 3HGGA 5FKLA 1SGMA 2QKOA 2D6YA 3EGQA 1WH7A 3QPSA 2Y31A 2DA7A 2UXPA 3ANPA 1JKQC 2LY9A 4UUSB 3GTPJ 3JRAA 2Y30A 2O8KA 1HCRA 4JX5A 5FKOA 1I6HJ 3FISA 2QIBA 1GT0C 2MG4A 3BJBA 5F08A 3PM1A 5IOZA 3RZOJ 3ZQHA 1E3OC 2B63J 1JUPA 1IUFA 3S2DJ 3E7LA 3Q3SA 3ZQLA 5E3NA 5F0CA 1WI3A 1WH5A 4A3LJ 3MNLA 1X2NA 5C4YA 4RBOA 3LWJA 2DA4A 2QWTA 1OCPA 2CQQA 5M5XJ 3ZQIA 1BJZA 2VKEA 2HOSA 4FE7A 3LSRA 4BKXA 1A5JA 2Q24A 3GTQJ 2QF7A 3HE0A 2WGBA 2K9QA 2X48A 3FIWA 4V2FA 2UXHA 5J1YA 3JRBA 2YU9J 2HOTA 4D7MA 3S15J 1I3QJ 4GCKA 5FLMJ 3BR1A 1ZR2A 2WUIA 1MNMC 2LTPA 5IP7J 2ID3A 4A3GJ 2W48A 2GENA 4M3DA 4X1EA 4A3IJ 3BR6A 3Q0VA 3BTIA 5DS9A 4A69C 4FCYA 3LSGA 4MIMA 4HKUA 2RASA 2ZCNA 2WB1N 2D5VA 2EH3A 2LFBA 5GPAA 2JA5J 2R92J 3B81A 3JRHA 3SJMA 3F1BA 3B6AA 3F0CA 2N8GA 1Q1VA 1BL0A 2EQRA 2NOGA 3GTMJ 1MBGA 4JX6A 2M0CA 5M5YJ 1LE8B 3ON4A 1XS9A 1S7EA 5HBUA 3S5RA 2CRGA 2YVHA 1U9OA 2UXIA 5HODA 1ITYA 3JRCA 1TWCJ 2ME0A 3W6VA 5DAJA 1ETXA 2DA2A 1JKOC 3GTOJ 3JRFA 4M3GA 1BA5A 3O8HA 5F27A 1JKRC 3S1MJ 2XPWA 1HDPA 2E2IJ 5BNGA 3HOYJ 1X2MA 4QSHA 3BG3A 1ETWA 1POGA 5IYDJ 4Y52J 3RZDJ 4C3IJ 3LNQA 2VUMJ 2DA1A 3SDGA 4A3EJ 1ZQ3P 5GPCA 3BHQA 5GP9A 3HOUJ 1IRZA 3VW2A 4M6VA 1VI0A 2RAEA 3HBLA 2LD5A 2DTZA 2HKUA 5CW8A 1BW5A 1T56A 2YVEA 3JSJA 1B8IA 2GUHA 2LKXA 3VW0A 4MLOA 5H9TA 2LVSA 2XSDC 2DA5A 4ABZA 2HYTA 4GFLA 3A02A 1MBKA 3NI7A 5EEAA 3QPLA 1R9TJ 5IP9J 2COBA 1ORKA 2IEKA 2JWTA 4ACIA 4C3JJ 4BY7J 2IBDA 3JR9A 2XRLA 5FKMA 1UG2A 2M34A 2XB5A 2REKA 5J3LA 4ICHA 1ETQA 4GCLA 1SFOJ 2UXUA 3E7QA 2H8RA 2LP0A 3G1LA 1DU6A 2NVYJ 1CQTA 2FX0A 3Q0UA 1FJLA 4ME9A 1IG7A 5HAWA 3PO2J 4A3CJ 1DU0A 4Y7NJ 5D1RA 2ZOZA 3CMYA 1FIPA 4AC0A 3ANGA 1MBJA 4D5FA 2DMTA 2UXOA 2DMNA 1W0UA 2HXOA 2O9LA 2G3BA 3BR3A 5IYCJ 2RHAA 1JTXA 2ECCA 3C2BA 3HOWJ 1FIAA 2VPRA 3KNWA 2ELKA 2K9SA 3HTJA 3KZ9A 3DEWA 1IDYA 4JP0A 2Y0SN 3AQTA 1HLVA 4B3AA 1JGGA 1JUMA 4DYCA 4A3FJ 3LSJA 1IJWC 4BY1J 2XPVA 4QTRA 1NK3P 1QRYA 2XGCA 2CJJA 1JJ8C 5M3FJ 2DMUA 5EF6A 4NN1A 3H0GJ 3A01A 5FLVA 4DYRA 2G7SA 5J1RA 2TRTA 1B72B 2KDZA 4L62A 1QVUA 3HM5A 4D5CA 3NXCA 3PO3J 1ZK8A 2R93J 2QCOA 1ZGWA 1F43A 3MKLA 2NVXJ 2MSYA 2R0QC 3K7AJ 5EDNA 5DTDA 3P9TA 2EZIA 2FD5A 5F0FA 4EEFG 2GLOA 2L9RA 4BXXJ 3LOCA 3OIOA 4UUTA 3G1MA 4S0HB 1RPWA 4GFKA 2VI6A 4MK6A 4M3BA 2XPUA 5D18A 3COLA 2LR8A 4LOCA 5EFYA 4MFDA 3LSPA 5EG0B 2DN0A 4FISA 2HXIA 2R5YA 4L5EA 4NELA 1ENHA 5C4JJ 2IU5A 3A01B 1JT0A 4NDLA 1AKHB 1B72A 4XRMA 1MBFA 2PMZN 3BR0A 1LE8A 1G2HA 2G7GA 2NP5A 2ZOYA 1D5YA 3BT9A 4XK4A 2FBQA 3ZQCA 4M3EA 1VF9A 2HDDA 3FKIJ 2GFNA 2P81A 2HYJA 1LFUP 3FK6A 4JNNA 2OI8A 1YRNB 4HNVA 3HTIA 3BCGA 5FKKA 3WHCA 3ZOBA 2JK3A 3BQZA 3JREA 2ZCXA 1XG1A 3ON2A 1F36A 1GUUA 4B1RA 2K40A 3IH3A 3HEFA 1WCMJ 1A6IA 1VNDA 4G12A 3VPRA 1MBEA 3HGYA 4XIDA 2R5YB 2MGQA 1TWHJ 3IH2A 4PXIA 5EZGA 1ETYA 2WV1A 5F0HA 3DPJA 1GDTA 1UI6A 3GTKJ 4AF5A 2DMQA 3BNIA 2K9NA 2L7MP 2F07A 5FKNA 3PASA 1HF0A 2CUEA 2DG8A 1ZKGA 3V6GA 3NAUA 2HOAA 5HSZA 1WPKA 2PZ9A 1ETOA 5C44J 3C07A 2PBXA 2E19A 3B6CA 1AU7A 1B8IB 4A3BJ 1JTYA 2X9DA 2I10A 3IH4A 1IDZA 3ZQGA 2AHQA 3DCFA 1X58A 2XB0X 3RKQA 3AQSA 5IOYA 2LK2A 3MVPA 4I76A 5EGOB 9ANTA 2O7OA 2EZKA 4RDUA 3S17J 4CGRA 5K58A 3G1OA 5K7ZA 3QBMA 2KT0A 5FGLA 4DZJA 1QPIA 1ETVA 3TP3A 3VIBA 3S1NJ 3NARA 5JLWA 2G7LA 4AYBN 1SANA 5C3EJ 1XC5A 1NTCA 4JX4A 2CQXA 1UMQA 2YUSA 4C2MJ 3G56A 3BTLA 1RKWA 2Y9YA 3KKCA 3IV5A 2QOPA 4J19A 2H1KA 1MH4A 1EF4A 5EYRA 4IHWA 3S1QJ 3HKZN 5EGOA 3BG9A 3HDDA 1HDDC 1IGNA 3LJLA 2NVQJ 4A3KJ 1TWFJ 2AO9A 2XGDA 1RETA 3LHQA 5E3LA 2XDNA 1MH3A 1OCTC 2TCTA 1ZR4A 2JN6A 4YZEA 2R7ZJ 1TWGJ 4AUXA 3D1NI 1NK2P 4W1UA 2Y9ZA 4DZPA 4JL3A 2QTQA 5E3MA 2OERA 2W53A 3JRGA 2E1OA 4X6AJ 2R5ZA 2M8GX 2ZB9A 4W97A 4FTHA 2DA6A 2ZCMA 3CJDA 3FRQA 3PPBA 1QVTA 2DA3A 4XICA 1FTTA 3S1RJ 4MFEA 1APLC 1FTZA 3HIMA 2DG7A 1TC3C 4A3DJ 4GFBA 3GTLJ 1ETKA 1MBHA 1RESA 1Y1VJ 3G7RA 3S14J 4DYQA 4MO7A 1PUFB 5IP6A 3UKGA 4AC6A 1K83J 2ECBA 4B4CA 3CQZJ 1I50J 1JUSA 3BQYA 1VFCA 3JRIA 2M2EA 3H3VK 5M3MJ 2NVTJ 3HOXJ 3TEDA 5F1JA 5CXIA 2FJ1A 5JLXA 1WGXA 1T33A 3TW6A 2VKVA 4M3FA 2R5ZB 2EBIA 4BBSJ 3HB9A 3QKXA 1U9NA 5E3OA 5J1UA 5EG0A 1AHDP 1HOMA 5EZHA 1H8AC 3CDLA 3L1PA 4KWAA 3VVZA 3T6NA 1P7IA 1AKHA 1PUFA 1P7JA 4FE4A 5FHPA 1U8BA 3KKDA 3VW1A 3HTAA 5C4XJ 2WAQN 5K7FA 1FEXA 5AQCA 2JA8J 4C3HJ 3BR2A 2JA7J 1Z0XA 1W0TA 2ME6A 3GTJJ 1YRNA 5IYBJ 1OJLA 2M9HA 3CCYA 2IAIA 1GV2A 5IPAA 4IHXA 3VOKA 2E2JJ 2DMPA 3ZQFA 4A3MJ 3GTGJ 3HOZJ 4GCTA 3BTJA 3GEUA 4A93J 3HTHA 3VOXA 3RQIA 5M5WJ 3BRUA 4MXMA 3M3YJ 1GVDA 5F04A 1JT6A 3JRDA 5CXGA 3MN2A 2JJ7A 1MSEC 1OFCX 2EZLA 3NNRA 4XRSG 1GV5A 4D7NA 2X6OA 5K7HA 3K2AA 2HI3A 2O7TA 2XGEA 3NRGA 2OF7A 2L7FP 3O8GA 2NS8A 1RR7A 2NS7A 4BBRJ 4IHYA 1O4XA 2GM4A 4CYCA 5FJ8J 3I4NJ 4IHVA 2HQ5A 3GBGA 1H88C 2L0KA 3QQAA 3O60A 2CU7A 2ID6A 3WHBA 2V57A 5FMPA 2MW8A 4JYKA 3VVXA 1ZTRA 2EZHA 1Z77A 2YS9A 2JA6J 4XRSA 1U78A 3FK7A 1Y1WJ 4A3JJ 1IV6A 3EUPA 3NPIA 4JKZA 4V2GA 5D19A 1TWAJ 2GBYA 3BTCA 1MSFC 1UI5A 2JMWA 3RH2A 3S2HJ 3Q0WA 3OSGA 4DW6A 3BR5A 3SFIA 1IC8A 1JJ6C 3VVYA 1LFBA 2CUFA 3S16J 2DJNA 2L7ZA 3OSFA 3CWRA 2FQ4A 4UUSA 3VP5A 3IUVA 3VUQA 2E2HJ 1BW6A 3I4MJ 3TW7A 1H89C 2NP3A 3V78A 4CYCB 2Y2ZA 2G0EA 2NX4A 3BG5A 4IEJA 3A03A 3M4OJ 1RKTA 2LLKA 4I6ZA 3GZIA 3OOUA 3TP0A 1JKPC 1K61A 4QIWN 1UHSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OPT A;  3RD3 A;  3HOV J;  4UDS A;  3CRJ A;  3HGG A;  5FKL A;  1SGM A;  2QKO A;  2D6Y A;  3EGQ A;  1WH7 A;  3QPS A;  2Y31 A;  2DA7 A;  2UXP A;  3ANP A;  1JKQ C;  2LY9 A;  4UUS B;  3GTP J;  3JRA A;  2Y30 A;  2O8K A;  1HCR A;  4JX5 A;  5FKO A;  1I6H J;  3FIS A;  2QIB A;  1GT0 C;  2MG4 A;  3BJB A;  5F08 A;  3PM1 A;  5IOZ A;  3RZO J;  3ZQH A;  1E3O C;  2B63 J;  1JUP A;  1IUF A;  3S2D J;  3E7L A;  3Q3S A;  3ZQL A;  5E3N A;  5F0C A;  1WI3 A;  1WH5 A;  4A3L J;  3MNL A;  1X2N A;  5C4Y A;  4RBO A;  3LWJ A;  2DA4 A;  2QWT A;  1OCP A;  2CQQ A;  5M5X J;  3ZQI A;  1BJZ A;  2VKE A;  2HOS A;  4FE7 A;  3LSR A;  4BKX A;  1A5J A;  2Q24 A;  3GTQ J;  2QF7 A;  3HE0 A;  2WGB A;  2K9Q A;  2X48 A;  3FIW A;  4V2F A;  2UXH A;  5J1Y A;  3JRB A;  2YU9 J;  2HOT A;  4D7M A;  3S15 J;  1I3Q J;  4GCK A;  5FLM J;  3BR1 A;  1ZR2 A;  2WUI A;  1MNM C;  2LTP A;  5IP7 J;  2ID3 A;  4A3G J;  2W48 A;  2GEN A;  4M3D A;  4X1E A;  4A3I J;  3BR6 A;  3Q0V A;  3BTI A;  5DS9 A;  4A69 C;  4FCY A;  3LSG A;  4MIM A;  4HKU A;  2RAS A;  2ZCN A;  2WB1 N;  2D5V A;  2EH3 A;  2LFB A;  5GPA A;  2JA5 J;  2R92 J;  3B81 A;  3JRH A;  3SJM A;  3F1B A;  3B6A A;  3F0C A;  2N8G A;  1Q1V A;  1BL0 A;  2EQR A;  2NOG A;  3GTM J;  1MBG A;  4JX6 A;  2M0C A;  5M5Y J;  1LE8 B;  3ON4 A;  1XS9 A;  1S7E A;  5HBU A;  3S5R A;  2CRG A;  2YVH A;  1U9O A;  2UXI A;  5HOD A;  1ITY A;  3JRC A;  1TWC J;  2ME0 A;  3W6V A;  5DAJ A;  1ETX A;  2DA2 A;  1JKO C;  3GTO J;  3JRF A;  4M3G A;  1BA5 A;  3O8H A;  5F27 A;  1JKR C;  3S1M J;  2XPW A;  1HDP A;  2E2I J;  5BNG A;  3HOY J;  1X2M A;  4QSH A;  3BG3 A;  1ETW A;  1POG A;  5IYD J;  4Y52 J;  3RZD J;  4C3I J;  3LNQ A;  2VUM J;  2DA1 A;  3SDG A;  4A3E J;  1ZQ3 P;  5GPC A;  3BHQ A;  5GP9 A;  3HOU J;  1IRZ A;  3VW2 A;  4M6V A;  1VI0 A;  2RAE A;  3HBL A;  2LD5 A;  2DTZ A;  2HKU A;  5CW8 A;  1BW5 A;  1T56 A;  2YVE A;  3JSJ A;  1B8I A;  2GUH A;  2LKX A;  3VW0 A;  4MLO A;  5H9T A;  2LVS A;  2XSD C;  2DA5 A;  4ABZ A;  2HYT A;  4GFL A;  3A02 A;  1MBK A;  3NI7 A;  5EEA A;  3QPL A;  1R9T J;  5IP9 J;  2COB A;  1ORK A;  2IEK A;  2JWT A;  4ACI A;  4C3J J;  4BY7 J;  2IBD A;  3JR9 A;  2XRL A;  5FKM A;  1UG2 A;  2M34 A;  2XB5 A;  2REK A;  5J3L A;  4ICH A;  1ETQ A;  4GCL A;  1SFO J;  2UXU A;  3E7Q A;  2H8R A;  2LP0 A;  3G1L A;  1DU6 A;  2NVY J;  1CQT A;  2FX0 A;  3Q0U A;  1FJL A;  4ME9 A;  1IG7 A;  5HAW A;  3PO2 J;  4A3C J;  1DU0 A;  4Y7N J;  5D1R A;  2ZOZ A;  3CMY A;  1FIP A;  4AC0 A;  3ANG A;  1MBJ A;  4D5F A;  2DMT A;  2UXO A;  2DMN A;  1W0U A;  2HXO A;  2O9L A;  2G3B A;  3BR3 A;  5IYC J;  2RHA A;  1JTX A;  2ECC A;  3C2B A;  3HOW J;  1FIA A;  2VPR A;  3KNW A;  2ELK A;  2K9S A;  3HTJ A;  3KZ9 A;  3DEW A;  1IDY A;  4JP0 A;  2Y0S N;  3AQT A;  1HLV A;  4B3A A;  1JGG A;  1JUM A;  4DYC A;  4A3F J;  3LSJ A;  1IJW C;  4BY1 J;  2XPV A;  4QTR A;  1NK3 P;  1QRY A;  2XGC A;  2CJJ A;  1JJ8 C;  5M3F J;  2DMU A;  5EF6 A;  4NN1 A;  3H0G J;  3A01 A;  5FLV A;  4DYR A;  2G7S A;  5J1R A;  2TRT A;  1B72 B;  2KDZ A;  4L62 A;  1QVU A;  3HM5 A;  4D5C A;  3NXC A;  3PO3 J;  1ZK8 A;  2R93 J;  2QCO A;  1ZGW A;  1F43 A;  3MKL A;  2NVX J;  2MSY A;  2R0Q C;  3K7A J;  5EDN A;  5DTD A;  3P9T A;  2EZI A;  2FD5 A;  5F0F A;  4EEF G;  2GLO A;  2L9R A;  4BXX J;  3LOC A;  3OIO A;  4UUT A;  3G1M A;  4S0H B;  1RPW A;  4GFK A;  2VI6 A;  4MK6 A;  4M3B A;  2XPU A;  5D18 A;  3COL A;  2LR8 A;  4LOC A;  5EFY A;  4MFD A;  3LSP A;  5EG0 B;  2DN0 A;  4FIS A;  2HXI A;  2R5Y A;  4L5E A;  4NEL A;  1ENH A;  5C4J J;  2IU5 A;  3A01 B;  1JT0 A;  4NDL A;  1AKH B;  1B72 A;  4XRM A;  1MBF A;  2PMZ N;  3BR0 A;  1LE8 A;  1G2H A;  2G7G A;  2NP5 A;  2ZOY A;  1D5Y A;  3BT9 A;  4XK4 A;  2FBQ A;  3ZQC A;  4M3E A;  1VF9 A;  2HDD A;  3FKI J;  2GFN A;  2P81 A;  2HYJ A;  1LFU P;  3FK6 A;  4JNN A;  2OI8 A;  1YRN B;  4HNV A;  3HTI A;  3BCG A;  5FKK A;  3WHC A;  3ZOB A;  2JK3 A;  3BQZ A;  3JRE A;  2ZCX A;  1XG1 A;  3ON2 A;  1F36 A;  1GUU A;  4B1R A;  2K40 A;  3IH3 A;  3HEF A;  1WCM J;  1A6I A;  1VND A;  4G12 A;  3VPR A;  1MBE A;  3HGY A;  4XID A;  2R5Y B;  2MGQ A;  1TWH J;  3IH2 A;  4PXI A;  5EZG A;  1ETY A;  2WV1 A;  5F0H A;  3DPJ A;  1GDT A;  1UI6 A;  3GTK J;  4AF5 A;  2DMQ A;  3BNI A;  2K9N A;  2L7M P;  2F07 A;  5FKN A;  3PAS A;  1HF0 A;  2CUE A;  2DG8 A;  1ZKG A;  3V6G A;  3NAU A;  2HOA A;  5HSZ A;  1WPK A;  2PZ9 A;  1ETO A;  5C44 J;  3C07 A;  2PBX A;  2E19 A;  3B6C A;  1AU7 A;  1B8I B;  4A3B J;  1JTY A;  2X9D A;  2I10 A;  3IH4 A;  1IDZ A;  3ZQG A;  2AHQ A;  3DCF A;  1X58 A;  2XB0 X;  3RKQ A;  3AQS A;  5IOY A;  2LK2 A;  3MVP A;  4I76 A;  5EGO B;  9ANT A;  2O7O A;  2EZK A;  4RDU A;  3S17 J;  4CGR A;  5K58 A;  3G1O A;  5K7Z A;  3QBM A;  2KT0 A;  5FGL A;  4DZJ A;  1QPI A;  1ETV A;  3TP3 A;  3VIB A;  3S1N J;  3NAR A;  5JLW A;  2G7L A;  4AYB N;  1SAN A;  5C3E J;  1XC5 A;  1NTC A;  4JX4 A;  2CQX A;  1UMQ A;  2YUS A;  4C2M J;  3G56 A;  3BTL A;  1RKW A;  2Y9Y A;  3KKC A;  3IV5 A;  2QOP A;  4J19 A;  2H1K A;  1MH4 A;  1EF4 A;  5EYR A;  4IHW A;  3S1Q J;  3HKZ N;  5EGO A;  3BG9 A;  3HDD A;  1HDD C;  1IGN A;  3LJL A;  2NVQ J;  4A3K J;  1TWF J;  2AO9 A;  2XGD A;  1RET A;  3LHQ A;  5E3L A;  2XDN A;  1MH3 A;  1OCT C;  2TCT A;  1ZR4 A;  2JN6 A;  4YZE A;  2R7Z J;  1TWG J;  4AUX A;  3D1N I;  1NK2 P;  4W1U A;  2Y9Z A;  4DZP A;  4JL3 A;  2QTQ A;  5E3M A;  2OER A;  2W53 A;  3JRG A;  2E1O A;  4X6A J;  2R5Z A;  2M8G X;  2ZB9 A;  4W97 A;  4FTH A;  2DA6 A;  2ZCM A;  3CJD A;  3FRQ A;  3PPB A;  1QVT A;  2DA3 A;  4XIC A;  1FTT A;  3S1R J;  4MFE A;  1APL C;  1FTZ A;  3HIM A;  2DG7 A;  1TC3 C;  4A3D J;  4GFB A;  3GTL J;  1ETK A;  1MBH A;  1RES A;  1Y1V J;  3G7R A;  3S14 J;  4DYQ A;  4MO7 A;  1PUF B;  5IP6 A;  3UKG A;  4AC6 A;  1K83 J;  2ECB A;  4B4C A;  3CQZ J;  1I50 J;  1JUS A;  3BQY A;  1VFC A;  3JRI A;  2M2E A;  3H3V K;  5M3M J;  2NVT J;  3HOX J;  3TED A;  5F1J A;  5CXI A;  2FJ1 A;  5JLX A;  1WGX A;  1T33 A;  3TW6 A;  2VKV A;  4M3F A;  2R5Z B;  2EBI A;  4BBS J;  3HB9 A;  3QKX A;  1U9N A;  5E3O A;  5J1U A;  5EG0 A;  1AHD P;  1HOM A;  5EZH A;  1H8A C;  3CDL A;  3L1P A;  4KWA A;  3VVZ A;  3T6N A;  1P7I A;  1AKH A;  1PUF A;  1P7J A;  4FE4 A;  5FHP A;  1U8B A;  3KKD A;  3VW1 A;  3HTA A;  5C4X J;  2WAQ N;  5K7F A;  1FEX A;  5AQC A;  2JA8 J;  4C3H J;  3BR2 A;  2JA7 J;  1Z0X A;  1W0T A;  2ME6 A;  3GTJ J;  1YRN A;  5IYB J;  1OJL A;  2M9H A;  3CCY A;  2IAI A;  1GV2 A;  5IPA A;  4IHX A;  3VOK A;  2E2J J;  2DMP A;  3ZQF A;  4A3M J;  3GTG J;  3HOZ J;  4GCT A;  3BTJ A;  3GEU A;  4A93 J;  3HTH A;  3VOX A;  3RQI A;  5M5W J;  3BRU A;  4MXM A;  3M3Y J;  1GVD A;  5F04 A;  1JT6 A;  3JRD A;  5CXG A;  3MN2 A;  2JJ7 A;  1MSE C;  1OFC X;  2EZL A;  3NNR A;  4XRS G;  1GV5 A;  4D7N A;  2X6O A;  5K7H A;  3K2A A;  2HI3 A;  2O7T A;  2XGE A;  3NRG A;  2OF7 A;  2L7F P;  3O8G A;  2NS8 A;  1RR7 A;  2NS7 A;  4BBR J;  4IHY A;  1O4X A;  2GM4 A;  4CYC A;  5FJ8 J;  3I4N J;  4IHV A;  2HQ5 A;  3GBG A;  1H88 C;  2L0K A;  3QQA A;  3O60 A;  2CU7 A;  2ID6 A;  3WHB A;  2V57 A;  5FMP A;  2MW8 A;  4JYK A;  3VVX A;  1ZTR A;  2EZH A;  1Z77 A;  2YS9 A;  2JA6 J;  4XRS A;  1U78 A;  3FK7 A;  1Y1W J;  4A3J J;  1IV6 A;  3EUP A;  3NPI A;  4JKZ A;  4V2G A;  5D19 A;  1TWA J;  2GBY A;  3BTC A;  1MSF C;  1UI5 A;  2JMW A;  3RH2 A;  3S2H J;  3Q0W A;  3OSG A;  4DW6 A;  3BR5 A;  3SFI A;  1IC8 A;  1JJ6 C;  3VVY A;  1LFB A;  2CUF A;  3S16 J;  2DJN A;  2L7Z A;  3OSF A;  3CWR A;  2FQ4 A;  4UUS A;  3VP5 A;  3IUV A;  3VUQ A;  2E2H J;  1BW6 A;  3I4M J;  3TW7 A;  1H89 C;  2NP3 A;  3V78 A;  4CYC B;  2Y2Z A;  2G0E A;  2NX4 A;  3BG5 A;  4IEJ A;  3A03 A;  3M4O J;  1RKT A;  2LLK A;  4I6Z A;  3GZI A;  3OOU A;  3TP0 A;  1JKP C;  1K61 A;  4QIW N;  1UHS A; 
#chains in the Genus database with same CATH topology
 3ZMU A;  3R0J A;  4BU2 A;  3HOV J;  4EM1 A;  5CVU A;  1YO5 C;  3LA2 A;  3Q5F A;  2VON A;  1SGM A;  3OYE A;  3EGQ A;  4XLC A;  1T38 A;  3ZN1 A;  4LJZ F;  2IS4 A;  5CVR A;  3CJN A;  1J5Y A;  2ZME A;  2Y30 A;  4HX8 A;  2UXN A;  3LMM A;  1HCR A;  4JX5 A;  3L2Q A;  5L3C A;  3ZQH A;  1B59 A;  5BMZ A;  1E3O C;  2VLA A;  4BAY A;  3MFK A;  1G3Y A;  4CCJ A;  4EM0 B;  2W57 A;  3N97 A;  4DNC A;  3QU6 A;  1KYW A;  1FOY A;  1PJR A;  3D5S C;  3EUA A;  3KEQ A;  4HPQ A;  5F0C A;  1E3P A;  2PJR A;  3LWJ A;  2V1X A;  2HKX A;  2CQQ A;  3ZQI A;  3P9I A;  2W85 A;  2K3P A;  2W82 A;  1WI9 A;  3GTQ J;  3A0B C;  4AVP A;  5JHU A;  2CV1 A;  1N75 A;  2YU9 J;  2H6C A;  2XAU A;  1UEL B;  2E1M C;  5D5V B;  4I01 A;  5D6F A;  4XM3 A;  1TW2 A;  2OU2 A;  2LTP A;  2J5O A;  2W48 A;  4RB2 C;  4X1E A;  4XNF A;  1FMW A;  4E7S A;  4PSW A;  4EVI A;  2LH9 A;  4OD5 A;  3EET A;  2XUB A;  3LSG A;  3SHF A;  3ERM A;  1K6Y A;  4ZZL A;  1IRX A;  1D1C A;  1SD7 A;  2QGU A;  5LLQ A;  1SAU A;  1KQ8 A;  2JA5 J;  1KQ0 A;  3B81 A;  1BOB A;  4BS9 A;  3JRH A;  2L01 A;  3F0C A;  2N8G A;  4OIQ F;  2ADU A;  2OQG A;  3BZK A;  1MBG A;  2XV4 S;  3CCV I;  3H9J A;  3ONQ A;  3OS2 A;  5E17 F;  4PCQ A;  3ON4 A;  1XS9 A;  3VYU B;  2XIG A;  3E1S A;  5HBU A;  2EIL H;  2IA1 A;  5K5R A;  2UXI A;  4KIG A;  3K1N A;  3JRC A;  1TWC J;  4ON0 A;  1T8I A;  1Y56 A;  1YIJ I;  1R23 A;  3B02 A;  3HG9 A;  3PSF A;  2IS1 A;  4M3G A;  1BA5 A;  4L9V A;  1JKR C;  3E6C C;  4LB6 B;  4ANJ A;  1IXC A;  1MGT A;  2ETH A;  3CF2 A;  5BNG A;  3BG3 A;  4BEH A;  4OD4 A;  5IYD J;  3WGG A;  1UST A;  1ACI A;  2GXG A;  4A5N A;  3CUQ A;  2L9N A;  3VW2 A;  3C2G A;  3H0D A;  4M6V A;  1YJ9 I;  5ICC A;  2DTZ A;  4XN0 A;  2HKU A;  3I58 A;  4O5V A;  2W24 A;  2OZ6 A;  4PDK A;  2GUH A;  3F8C A;  1H0M A;  2LMD A;  2XSD C;  2IPQ X;  1OKR A;  5KK1 A;  4AIJ A;  1IF1 A;  2DJI A;  1MBK A;  3A02 A;  4XOR A;  3QWL A;  4RAF A;  3TDU C;  1HW1 A;  4BY7 J;  2WV0 A;  1Z6T A;  1K78 A;  4HZF A;  3JR9 A;  2ZXJ A;  4BE2 A;  1ULY A;  1YS6 A;  4DBQ A;  3PNT A;  4CA0 A;  3SFZ A;  1OCO H;  1WFX A;  4PUS A;  2KJB A;  1B4A A;  4EJV A;  2OQR A;  2H8R A;  1QNT A;  5FRO A;  2LP0 A;  2WAD A;  3PSI A;  4RB3 C;  1U5T A;  1MMG A;  2NVY J;  2L3D A;  2CO5 A;  2V6C A;  4ME9 A;  4S05 A;  1IG7 A;  1PUE E;  3F8F A;  4A3C J;  4C2M A;  3E5U A;  1EKE A;  4HV5 A;  1DU0 A;  4XKB A;  3LAP A;  4Y7N J;  1F5T A;  2J5P A;  3QOE A;  1MBJ A;  4D5F A;  1MIJ A;  3IRQ A;  2M8E A;  5E8I A;  3VWB A;  2CV0 A;  4D9J A;  2HXO A;  3ECH A;  3JTG A;  1Y8Q B;  3X2Q H;  6PAX A;  3KNW A;  4OAZ A;  5DUK A;  2ELK A;  3NEU A;  3HTJ A;  3DEW A;  3HIF A;  1KU7 A;  4HST A;  1HLV A;  1TNT A;  1JGG A;  1JUM A;  3CME I;  4HSR A;  1C0W A;  2V9K A;  1IJW C;  2JTV A;  1NK3 P;  2ZXI A;  1QRY A;  2XGC A;  4EJU A;  2JUC A;  3MMY B;  1E2X A;  3WTZ A;  5EF6 A;  3AG2 H;  3M8J A;  1IRG A;  3OV8 A;  3RYR A;  1Z91 A;  4U9N A;  3HM5 A;  1W36 C;  3RKX A;  3G6E I;  3NXC A;  2Q2E B;  2MAB A;  1EH8 A;  2GA1 A;  1EA3 A;  2R93 J;  2QCO A;  1ZGW A;  3MKL A;  1M1E B;  2MSY A;  2R0Q C;  3CUQ C;  1FYM A;  2QM3 A;  2WY7 Q;  3G4S I;  1VQ9 I;  1LVA A;  5F0F A;  1R36 A;  3H5R A;  3OIO A;  4B43 A;  3FXR A;  3G1M A;  2L9V A;  4HQM A;  3SQN A;  1ZLK A;  3CCM I;  3A2K A;  4MK6 A;  1R6R A;  2VXD A;  3M7G A;  4M3B A;  4N9H A;  1Z1D A;  2R4G A;  2DPU A;  5D18 A;  2LR8 A;  2VL8 A;  3MZH A;  1X1P A;  3IAS 2;  4MFD A;  4CYD A;  4Y13 A;  5E79 C;  5C4J J;  2B1E A;  2IU5 A;  4ZJZ A;  1Z21 A;  4NDL A;  3ZMV A;  1QPM A;  4C9Y A;  5J4V A;  3ZMZ A;  2PMZ N;  2G7G A;  1P4X A;  2ZOY A;  2PMH A;  1D5Y A;  3S3M A;  2OD5 A;  2GIV A;  3K4N A;  2FUG 2;  3M8F A;  3HSF A;  2MYS A;  2GFN A;  4N0B A;  2R7V A;  3R4K A;  1LFU P;  3FK6 A;  4RLF A;  2OI8 A;  3HUG A;  1TL8 A;  4HNV A;  1CGP A;  3GO5 A;  4FT8 A;  3BCG A;  2KPM A;  3HTU A;  3K0L A;  2DFI A;  5B5E C;  5BS6 A;  3CDH A;  1VND A;  1BJA A;  1FBU A;  2E5N A;  2VQL A;  2FRH A;  3VPR A;  4XID A;  2X1C A;  3F72 A;  2KFD A;  3CJT B;  2E1N A;  4PXI A;  5HVQ C;  2IGN A;  1K4T A;  5F0H A;  1MDM A;  2VBX A;  1UI6 A;  2RKH A;  4G8X A;  3BNI A;  2L7M P;  2F07 A;  3PAS A;  1HF0 A;  2IGM A;  1BBY A;  2HOA A;  1WPK A;  3C07 A;  4LG0 B;  4U9L A;  4U7D A;  4AM3 A;  2R7T A;  5KNL A;  1JTY A;  5J4Y A;  3IH4 A;  1IDZ A;  5E1W A;  2KJC A;  3RKQ A;  1HSJ A;  4JQF A;  3IL2 A;  2BY2 A;  2LK2 A;  4I76 A;  5H20 A;  3I55 I;  5HOO A;  2O7O A;  2LSO A;  1S8N A;  3ZQ7 A;  3G2B A;  1J09 A;  5K58 A;  3QBM A;  1WJD A;  4DZJ A;  4XRF A;  1P92 A;  3VSL A;  2Z9O A;  5AIQ A;  2XGX A;  5FLX Z;  2O6G E;  4LMY A;  2OTJ I;  3I4P A;  1FP1 D;  2KL4 A;  3L2W A;  2MLK A;  3WU0 A;  2WC2 A;  2ZJP F;  1XPX A;  3SDB A;  3KKC A;  4WXD A;  4OIR F;  2E1C A;  4BNC A;  2QOP A;  1MH4 A;  5CVJ A;  3M8E A;  2L54 A;  5EYR A;  2E7W A;  3K4C A;  4IZZ A;  2R7O A;  3K2Z A;  2VE9 A;  2HDW A;  3BG9 A;  2CW8 A;  3LJL A;  3MKY B;  2NVQ J;  1X3Z B;  2XGD A;  4F3Q A;  4LB5 A;  3TKY A;  2R7Z J;  4B47 A;  2F48 A;  5TIS C;  1JI8 A;  5DUI A;  1SVO A;  4DVY P;  1WRJ A;  4YIF A;  1LEA A;  3N4M A;  4XKW A;  5AON A;  4NNJ A;  2W53 A;  3CCS I;  1HKT A;  2ZY9 A;  2R5Z A;  2X1D A;  3R60 A;  2M8G X;  4W97 A;  4FTH A;  2WB1 A;  5HS9 A;  2ZCM A;  3FRQ A;  4HF1 A;  3JSO A;  1X1C A;  4MFE A;  3NS4 A;  4Z2Y A;  3HIM A;  4KMU X;  3IAM 2;  1T0F A;  2NS0 A;  4ETS A;  4A3D J;  4DOZ A;  2VJ5 A;  1RES A;  1LQ1 A;  1VQN I;  1QBJ A;  3FMS A;  2YSR A;  1QHH D;  1EH7 A;  3CQZ J;  3KET A;  1JUS A;  1XDU A;  3JRI A;  1S9H A;  2HR3 A;  3H3V K;  3MAJ A;  1YFH A;  3ELK A;  1ZYR F;  4XL9 A;  2YX7 A;  2MH9 A;  3PNV A;  2JVG A;  1I3A A;  2ZNZ A;  3V8K A;  2ISY A;  4CIC A;  1TT5 B;  2MBF A;  1G8X A;  3VYR B;  1ZRF A;  3R61 A;  1LDD A;  4II2 A;  3ECO A;  4L9T A;  1AHD P;  3FBN B;  1HOM A;  5EZH A;  3VVZ A;  3CDL A;  4KIC A;  2QSG X;  4CCM A;  3T6N A;  2X1E A;  1AKH A;  5L3B A;  2STT A;  3JSP A;  4WX9 A;  1U8R A;  3KKD A;  1BR2 A;  3OYD A;  3HRU A;  2HVR A;  4OIN F;  2O61 A;  1OCC H;  5C4X J;  2FU4 A;  2JA8 J;  2JA7 J;  3OL3 A;  2IS6 A;  2E71 A;  4CZZ A;  3I5U A;  3DU6 A;  5JI6 A;  2W00 A;  1B9M A;  2A3S A;  3FX3 A;  1DP7 P;  1G3S A;  1G6N A;  1QGP A;  2ZXW H;  3VOK A;  2ZNY A;  3T8R A;  4GDF A;  2FQ3 A;  3ABU A;  4HG2 A;  2PN6 A;  5E8G A;  4ZDL A;  2DO7 A;  2ZCW A;  4JOM A;  5M5W J;  4LIT A;  3K10 A;  4A5M A;  1JT6 A;  1N77 A;  1HA8 A;  1OFC X;  2EZL A;  2G7U A;  4IRG A;  4GRI A;  5ERI A;  4GXO A;  2RNJ A;  3WG7 H;  1XSX A;  2HZD A;  4C2U A;  1UG0 A;  2HI3 A;  1U3E M;  3QP5 A;  3AL0 B;  3NRG A;  1QU3 A;  2V1U A;  1MNE A;  3UR3 C;  1RR7 A;  3UNG C;  2Y0S A;  1O4X A;  4EMS A;  4KYW A;  2XAF A;  2HZT A;  2HQ5 A;  3GBG A;  4AIK A;  1FYK A;  2L0K A;  5DM7 F;  2ID6 A;  3WHB A;  2L7K A;  3FKJ A;  3CZ6 A;  1DQU A;  1G3T A;  1ZTR A;  2EZH A;  1NHA A;  1Z77 A;  3WE3 A;  4CXF A;  1HXD A;  1RNL A;  5HDK A;  4XRS A;  1U78 A;  3ZMS A;  3F6V A;  4V2G A;  2GBY A;  5GAH J;  4MTE A;  4ASN A;  5DM6 F;  3KP7 A;  2O3F A;  5JHF A;  2JMW A;  3RYP A;  3S2H J;  2DTR A;  4DW6 A;  2STW A;  4PZJ A;  1IC8 A;  1VQL I;  3QPH A;  4YEL A;  1JJ6 C;  3S16 J;  2DJN A;  2L7Z A;  3RCO A;  2F5F A;  2FQ4 A;  1AOY A;  3I4M J;  3PJR A;  1H89 C;  3V78 A;  4G7Z F;  1MMN A;  3RKY A;  4IEJ A;  3O3K A;  2NRA C;  3A03 A;  1UAA A;  1D3Y A;  5FRM A;  5IT9 Z;  3M4O J;  3TMO A;  4RGR A;  4MEY F;  3RPU D;  4II3 A;  5HNH A;  4I09 A;  1ZRD A;  1U2W A;  3MWM A;  5HS7 A;  5D5W B;  5CJ9 A;  1JKP C;  4Y4R A;  1AA7 A;  4QIW N;  1YHQ I;  2PFB A;  3RD3 A;  2ZFU A;  3K4K A;  4EQQ A;  1UFM A;  5HDG A;  5E20 A;  1D1A A;  5FKL A;  1YX3 A;  4QPO A;  2QKO A;  3QPS A;  2P7V B;  2IA0 A;  3CCU I;  4OIO F;  1V54 H;  1GXP A;  2LY9 A;  4UUS B;  3RI4 A;  4BL0 B;  3IKT A;  3GTP J;  1YW9 A;  3CP8 A;  3JRA A;  3LFK A;  1OR7 A;  2CGP A;  4X0G A;  5FKO A;  4KMF A;  3FIS A;  2V7F A;  2FE3 A;  4EAT A;  3PM1 A;  4XLH A;  2FEZ A;  3GW2 A;  1D0Y A;  1IUF A;  3RSN A;  3H1C A;  1G4D A;  1ONV A;  5FRN A;  3S3O A;  2FBH A;  2F5C A;  4HF0 A;  4PJN A;  3MNL A;  1X2N A;  1WKM A;  2DA4 A;  5KCM A;  1STZ A;  3DXJ F;  3AKZ A;  1A31 A;  4L9N A;  5FFX A;  1OCP A;  5M5X J;  2AS5 F;  1E3H A;  1KU3 A;  2AQF A;  4FE7 A;  3GFI A;  2Y0M A;  4ZYA A;  1A5J A;  2Q24 A;  3L09 A;  3IKV A;  2QF7 A;  4KN7 X;  3CDI A;  2WGB A;  4AD9 A;  2HTS A;  2QQB A;  4V2F A;  4IHT A;  4M72 A;  5J1Y A;  2KMU A;  5FLX K;  2KDO A;  1HST A;  3QYB A;  2HOT A;  3PIP F;  3F8N A;  1ZN2 A;  2BBY A;  2M1B A;  5FLM J;  3LAJ A;  3TGN A;  3BR1 A;  2WUI A;  4EV0 A;  5IP7 J;  2KRF A;  1FPQ A;  5CVV A;  1FOW A;  4M3D A;  5CKT A;  2WBM A;  5LD2 C;  2JPB A;  2M45 A;  1TZL A;  4HKU A;  3HRS A;  2RAS A;  3OYI A;  4G7H F;  1W7P B;  5GPA A;  1USS A;  1R5I D;  3DLL F;  4CHU A;  1BL0 A;  1Q1V A;  5LHG A;  3EPZ A;  2NOG A;  3GTM J;  4JX6 A;  5M5Y J;  1LE8 B;  4Q47 A;  5DCF A;  1W36 D;  4XMY A;  3G71 I;  2JT1 A;  1WHU A;  1B6A A;  2H94 A;  1RRJ A;  2ESN A;  2P8T A;  3R0A A;  4GO1 A;  2YPR A;  1LVK A;  2CRG A;  4NQW A;  2YVH A;  5J6X A;  3OYM A;  4F92 B;  1ODD A;  5DCM B;  2Z33 A;  1MJB A;  1W1W E;  1V4R A;  4HEA 2;  3OYC A;  3W6V A;  4RM3 A;  2OTL I;  5HLG A;  2DA2 A;  1R22 A;  1IN7 A;  1BI2 A;  2WTE A;  4IRH A;  3S1M J;  2BHZ A;  2XPW A;  2QSF X;  3B73 A;  2RGV A;  1X2M A;  4QSH A;  1ETW A;  2B0L A;  3J81 K;  1ZLJ A;  4PJJ A;  3H9G A;  2EFP A;  1U0J A;  2VE8 A;  3MEX A;  4UVB A;  3SDG A;  1L3L A;  3RDI A;  1I5Z A;  3J80 K;  2I5U A;  1YI2 I;  1FZP B;  3HOU J;  2Y75 A;  4KT5 C;  3K70 C;  2TDX A;  4F52 A;  5HS8 A;  2V1D A;  1JE8 A;  3CMA I;  4UNO A;  1BW5 A;  2FBI A;  4MLO A;  1XCV A;  2LF8 A;  1R4M B;  2VJ4 A;  3U1K A;  1ZGA A;  3H9Q A;  2A07 F;  2EA4 A;  3KZI C;  1HBX G;  4RAY A;  3QPL A;  1R9T J;  3AAF A;  2COB A;  1ORK A;  2IEK A;  2L5Q A;  2XF6 A;  2ZSH B;  3QP6 A;  2R7U A;  5A2Q Z;  2IBD A;  2RV8 A;  3FXO A;  3V7R A;  2IJL A;  3ZCO A;  2DOF A;  4JBA A;  2JSP A;  3SEZ A;  3GZ6 A;  1ZH5 A;  1UG2 A;  4ICH A;  4UXN A;  1D1B A;  1ETQ A;  2PQ8 A;  2QUF A;  2UXU A;  2DQL A;  3E7Q A;  2P5L C;  2FNP A;  5GAE J;  4IQJ A;  3G1L A;  1P4W A;  1S72 I;  2RVC A;  2D2W A;  5D8K B;  4HDV A;  2KZV A;  2FX0 A;  5FFZ A;  1FJL A;  3SZG A;  4HW0 A;  4QWQ A;  5HAW A;  3PO2 J;  2XAS A;  3KFW X;  4BXU A;  3BJO A;  1UHM A;  2P4W A;  3CMY A;  3ZPL A;  1KGS A;  1R71 A;  5ICE A;  4RGS A;  4XKC A;  2OAZ A;  1ZHF A;  4OWR B;  4RA2 A;  1W0U A;  3DPT A;  4E4H A;  3RPQ A;  3BR3 A;  2RHA A;  2ECC A;  3C2B A;  2FOK A;  2XSJ C;  3HRT A;  3F6O A;  1FNN A;  1PVE A;  5L3G A;  3EYI A;  3LST A;  2VC0 A;  3BCB A;  1DGW Y;  2OCE A;  4JP0 A;  2R7F A;  5J47 A;  3AQT A;  4MTD A;  4LK0 F;  1SVL A;  1T08 B;  4A3F J;  2PJR B;  5K1Y A;  1QZE A;  4G94 A;  3HSE A;  1ZRE A;  2H27 A;  3BY6 A;  3DFG A;  4NN1 A;  3A01 A;  5FLV A;  4G6Q A;  3FMR A;  2G7S A;  2TRT A;  1T0F C;  2KDZ A;  1B72 B;  4L62 A;  3I54 A;  4D5C A;  2CFO A;  5KAI C;  2BHY A;  2KIF A;  2M87 A;  5LGU A;  3PO3 J;  2A68 F;  2L2O A;  3I0T A;  3TDZ C;  3K7A J;  5DTD A;  2EZI A;  1X19 A;  2L9R A;  2DT7 B;  3NWT A;  4FET A;  1D8J A;  1GLN A;  4GFK A;  4C30 A;  1R7J A;  3KLN A;  4CCN A;  1DGR M;  3PQK A;  4LOC A;  4UY8 I;  2W84 A;  4BJ6 C;  5EG0 B;  2PG4 A;  2FA5 A;  2F5V A;  1ENH A;  4L5E A;  4BXF A;  2QKM B;  3GYH X;  4H0E A;  2GXB A;  3C1D A;  2QQ8 A;  2OCC H;  4XRM A;  3BC8 A;  4GCV A;  2BVM A;  5KHD A;  4BE1 A;  1TT0 A;  2FBQ A;  3ZQC A;  5L3E A;  4S04 A;  1VF9 A;  4PJL A;  4TV7 A;  1HW2 A;  2NXN B;  2PI0 A;  1FLI A;  4G6T B;  3W2A A;  3WTU C;  5DD8 A;  1YRN B;  1CF7 B;  2AXT C;  2V26 A;  3ZOB A;  4E7Z A;  1F1Z A;  3BQZ A;  4LK1 F;  2CQK A;  1BI1 A;  3ON2 A;  4ZYH A;  1F36 A;  4B1R A;  1JXS A;  1A6I A;  2WAQ A;  4G12 A;  1MMD A;  5B3S H;  3E6M A;  1MBE A;  3T8T A;  2E36 A;  2Z1D A;  2R5Y B;  2MGQ A;  1TWH J;  4YG2 F;  4BEH B;  3IH2 A;  1LEB A;  3DPJ A;  3GTK J;  4AF5 A;  2DMQ A;  4KIT B;  4GYI A;  4C2T A;  3CUQ B;  2DG8 A;  1ON2 A;  3V6G A;  2VC1 A;  3NAU A;  4MQV A;  1LB2 A;  2KIU A;  1ETO A;  4HAM A;  5BPD A;  1JGS A;  2E19 A;  2UUZ A;  3B6C A;  1AU7 A;  3VSK A;  2X9D A;  3H92 A;  3QPT A;  4XSZ F;  1A35 A;  1X58 A;  3K69 A;  3AQS A;  2QLZ A;  2OJE D;  3FXK A;  3MVP A;  3AG4 H;  4LLN A;  2XF7 A;  4E7K A;  3HPH A;  2D45 A;  1X3W B;  2EZK A;  1OQY A;  3S17 J;  3HXL A;  4CGR A;  5K7Z A;  2DK8 A;  3OYB A;  1K78 B;  1FWZ A;  4O6J A;  3VIB A;  2AQE A;  5JLW A;  1SAN A;  2VKH A;  2K4B A;  3DTI A;  1FY7 A;  4U0Y A;  1R1U A;  1UMQ A;  1PP7 U;  2BY3 A;  2IW5 A;  1YG2 A;  3BTL A;  3F3X A;  2Y9Y A;  5GTH C;  2BVL A;  1FOX A;  3TL4 X;  2C6Y A;  2H1K A;  1P6R A;  3ASO H;  3HOT A;  5EGO A;  2WWY A;  1IGN A;  3ZMT A;  4KIB A;  1K6O A;  2DYR H;  2V9P A;  4ZDP A;  5ED4 A;  1A6Q A;  3K9T A;  1U5T C;  1OCT C;  3KYL A;  3L00 A;  1S29 A;  4P55 A;  1OYI A;  1TWG J;  1XD7 A;  2EV0 A;  4B44 A;  4IJA A;  2Y9Z A;  4BGD A;  2V4J C;  5E3M A;  2QTQ A;  5CPR B;  1R00 A;  2X0L A;  3S2W A;  1B9N A;  2E7X A;  2W4S A;  3VTI A;  2A05 A;  1WJE A;  1Y39 A;  2LKP A;  1BIA A;  3GFM A;  2DA3 A;  2AXL A;  2XF5 A;  4XIC A;  2UV1 A;  1FTT A;  2CH0 A;  2FML A;  2DOD A;  3E97 A;  1QZZ A;  3J80 Z;  3KCC A;  2DG7 A;  2EV5 A;  2VOP A;  1MBH A;  1Y1V J;  1FC3 A;  4P1W A;  3WU2 C;  3OYH A;  3CCJ I;  1PUF B;  2DDA A;  2L02 A;  5ILV A;  3IUO A;  4BHP A;  3BQY A;  4YFN F;  3BJA A;  1X4P A;  5M3M J;  2EPF A;  3SZT A;  1LJ9 A;  4NC8 A;  3TED A;  3MQ0 A;  3COA C;  2OC6 A;  1ZG3 A;  3V42 A;  2DPD A;  1BIB A;  3OYN A;  1R1T A;  1T33 A;  3TW6 A;  4WIB A;  3FDY A;  2EBI A;  4OAY A;  5FGM A;  3KP2 A;  3LQR A;  2EV6 A;  2EFW A;  4ESB A;  4AVZ A;  1HKQ A;  1SMT A;  3OMY A;  1H8A C;  5HLT A;  3FXJ A;  4D1Q A;  1WSU A;  1P7I A;  1FT9 A;  5LEK A;  1YE9 A;  2VN2 A;  2DT5 A;  4FE4 A;  4E6K G;  1U8B A;  3HTA A;  2WAQ N;  4HRI A;  3CCQ I;  1FEX A;  1YJW I;  1W0T A;  4DJA A;  2EIN H;  2PFV A;  2D1V A;  1V5F A;  4P96 A;  2HU9 A;  3GF2 A;  1X3U A;  4HNU A;  4J01 A;  2M9H A;  2A61 A;  2Q1Z B;  2HQR A;  2IAI A;  1GV2 A;  2DMP A;  2DOE A;  4HF2 A;  4GCT A;  4KN4 X;  2K86 A;  3H3U A;  3GLL A;  3RQI A;  1D0X A;  3GUD A;  2LBF A;  1QA6 A;  3BRU A;  3DKY A;  4MXM A;  2K27 A;  3WU1 B;  3JRD A;  1MSE C;  5CXG A;  3BPV A;  2YX4 A;  1VQ8 I;  2FXA A;  2CMP A;  3T0Y A;  1VQ5 I;  2CUJ A;  4D7N A;  1TW3 A;  2X6O A;  4LG0 A;  3V8J A;  3LL7 A;  4LFU A;  3TQN A;  2FOW A;  4A6D A;  2OF7 A;  1Z3Y A;  2NS8 A;  4XLP F;  2NS7 A;  4IHY A;  3S3N A;  4CYC A;  3I56 I;  3I4N J;  3FHZ A;  4IHV A;  2I8D A;  4L5J A;  2EB7 A;  3QQA A;  3AFH A;  5FMP A;  4HLY A;  3OR2 C;  2MW8 A;  4UHT A;  2YS9 A;  4XON A;  2JA6 J;  1IV6 A;  3WG9 A;  1SD4 A;  4QLC U;  2A5W A;  5D19 A;  1YIO A;  1YLF A;  1IW7 F;  2FJI 1;  3K1M A;  4B48 A;  3K4J A;  3SFI A;  1FP2 A;  3SEQ A;  2BE5 F;  2CV2 A;  4QPQ A;  4LGW A;  1VQ6 I;  3OSF A;  2ZME B;  3VP5 A;  2HOE A;  3OWT A;  3IUV A;  3VUQ A;  2NP3 A;  5H6Q A;  1D5V A;  1BC8 C;  1RKT A;  3LA7 A;  4I6Z A;  5DDG A;  5F1R A;  2KIQ A;  3OOU A;  4LLL A;  3ZR8 X;  3L9F A;  1WJC A;  5LRR A;  1K61 A;  3K1P A;  3LA3 A;  5H2F C;  4UDS A;  2HVQ A;  2NNN A;  3A1Y A;  4V19 K;  2CFX A;  3CRJ A;  2X6Y A;  1IN5 A;  1IRF A;  1IO2 A;  5LGN A;  1D0Z A;  4RB1 A;  1KA8 A;  1WH7 A;  1Y0N A;  3BCA A;  3W2W A;  1N78 A;  2Y31 A;  1EH6 A;  3F8M A;  4MEX F;  3GXO A;  5IY5 H;  2X6W A;  2UXP A;  3H5A A;  4HA8 A;  4EGY A;  3HPG A;  2DI3 A;  1ZGJ A;  1WWX A;  2HDC A;  1GT0 C;  2QBY A;  4IQ4 A;  3BJB A;  3DBH B;  4E7H A;  3EYY A;  3K6G A;  2A69 F;  5IOZ A;  2ZBK A;  3CD6 I;  1J59 A;  5J40 A;  3PQJ A;  2B63 J;  1Z6R A;  4KJZ A;  2EK5 A;  3HHH A;  1ZG1 A;  2L4A A;  3ZQL A;  2DDB A;  2X51 A;  1BI3 A;  1WH5 A;  4A3L J;  4CH7 A;  3SZP A;  4RBO A;  4AIH A;  4ZYE A;  2G9W A;  3KP3 A;  3E3V A;  1WVR A;  4PGH A;  1REP C;  2HOS A;  3BJ6 A;  3GLX A;  2DFE A;  4BKX A;  3IP4 B;  2A6E F;  3HE0 A;  2WAF A;  3QYF A;  3BG6 A;  3FIW A;  2ZJQ F;  2MA3 A;  2V79 A;  2UXH A;  2BW3 B;  2XAQ A;  3QOP A;  3WTY C;  2RNG A;  1MMA A;  1S5L C;  2H09 A;  3JRB A;  3S15 J;  2OA4 A;  3D5R C;  1V5G A;  3E5X A;  5AIP A;  4GCK A;  1RI7 A;  2ID3 A;  1XGS A;  1H9T A;  3BR6 A;  3BTI A;  4RGX A;  3FZV A;  3H3Z A;  5DS9 A;  4ZTF A;  4FCY A;  3W6J B;  3S32 A;  1X1B A;  4O3M A;  2ZCN A;  3CES A;  4Y3O A;  2WB1 N;  2EH3 A;  2LFB A;  5LRS A;  3Q9V A;  4L5I A;  3E6D A;  4BHC A;  3SJM A;  3F1B A;  3B6A A;  2YR2 A;  1IXS B;  1DP3 A;  2EQR A;  3MCZ A;  5EEG A;  3EDP A;  2M0C A;  2K9M A;  1DPU A;  3FXM A;  2UXX A;  4LIU A;  3WTS C;  1HW5 A;  3N05 A;  2H1L A;  1XB4 A;  3LSM A;  5HOD A;  1BM9 A;  5JR3 A;  3HRM A;  5GAG J;  1MND A;  4Q48 A;  1NH3 A;  2ME0 A;  3OIP A;  3DWL E;  1ETX A;  5DAJ A;  3GTO J;  2M4G A;  4NC6 A;  3I59 A;  1HC8 A;  3QRF F;  3IC7 A;  2JVH A;  3OYA A;  5BOX A;  4IX7 A;  2E2I J;  1G59 A;  3HOY J;  1POG A;  2MC3 A;  3F23 A;  4Y52 J;  3RZD J;  1T98 A;  1V55 H;  2DA1 A;  2M0M A;  4FQG A;  1VQO I;  4A3E J;  1ZQ3 P;  3KE2 A;  3BHQ A;  3EUH A;  1IRZ A;  1W4M A;  4I98 B;  2W25 A;  1VI0 A;  2NOJ B;  2RAE A;  2LD5 A;  2DFH A;  3JSJ A;  1T56 A;  3BRO A;  2YVE A;  1B8I A;  1WJF A;  1IN6 A;  2JRM A;  2JZY A;  1QZY A;  3OS1 A;  1T6S A;  5H9T A;  1OCZ H;  2FF4 A;  2LVS A;  2DA5 A;  3MKW B;  4GFL A;  1OMI A;  1FBQ A;  5IP9 J;  5DV5 A;  4C3J J;  4NC7 A;  1GXQ A;  5LEJ A;  2KP6 A;  2W7N A;  2JPC A;  1O57 A;  4IOC F;  3ZP5 A;  1YOV B;  5CLS A;  2PX9 A;  2M34 A;  1OYW A;  2DU9 A;  5J3L A;  1IAW A;  3K4M A;  3TO7 A;  4GCL A;  1SFO J;  4KNY A;  2VKD A;  1AWC A;  3F9K A;  2QSH X;  1CQT A;  2R7D A;  2X6X A;  1K4S A;  1TQM A;  4YFX F;  2E1M B;  2CS3 A;  4XLF A;  2B9S A;  2IRF G;  2MH2 A;  1SVM A;  1FIP A;  3OY9 A;  2M5W A;  4M6X A;  4WXC A;  3J7A Y;  3G3Z A;  5J8F A;  2HQA A;  4XLN F;  1PDN C;  3K4B A;  1JTX A;  4BHB A;  1YIT I;  3HOW J;  1FIA A;  2A5Y B;  1I27 A;  2LC2 A;  2VPR A;  1BN5 A;  3V7C A;  5LBQ A;  1QQI A;  1ZAR A;  2DCE A;  3M1C A;  1O3Q A;  5D6E A;  2Y0S N;  3KPH A;  4RLQ A;  4U88 A;  3JAM Z;  2IT0 A;  2R7W A;  1MMS A;  4B09 A;  4I2O A;  4M71 A;  4ENK A;  4BY1 J;  2XPV A;  1J7K A;  1NG6 A;  1IN4 A;  5M3F J;  2DMU A;  2IVM A;  3AL0 C;  2ZKZ A;  1SD5 A;  5J1R A;  2IS2 A;  4D0P A;  3V4G A;  1NG7 A;  2K02 A;  2BEO A;  4OOI A;  1O3R A;  3EUH C;  2OUM A;  3MZ8 A;  2KKO A;  3P9T A;  2ACJ A;  2FD5 A;  3HUG B;  2VJI A;  4EEF G;  2GLO A;  3LOC A;  3J7Z I;  4XKV A;  4EGZ A;  4ZC3 A;  1RPW A;  2PJP A;  2XAJ A;  5CQG A;  2A6H F;  4M74 A;  5CYV A;  3LSP A;  1FSE A;  1W7P A;  3OL4 A;  3LSK A;  2DN0 A;  3BWG A;  3KYD B;  2HXI A;  4UV9 A;  3DU5 A;  1BOA A;  4U7B A;  1ZAO A;  1JT0 A;  1R4N B;  1MBF A;  1LE8 A;  4IF4 A;  2VBW A;  4I7H A;  2KIS A;  3DF8 A;  4UVC A;  3BT9 A;  1TNS A;  1Z67 A;  2JRT A;  2HDD A;  2ZXH A;  5IT9 K;  2HYJ A;  4A0X A;  3HOS A;  1UCR A;  3U1D A;  2EFQ A;  4JNN A;  3CLQ A;  3C7J A;  1R1V A;  5FKK A;  2CWE A;  2FBK A;  4LG3 A;  3JRE A;  3I53 A;  1KYZ A;  3DV8 A;  1LDK B;  1XG1 A;  3OR1 C;  3I3L A;  2HPM A;  2K40 A;  3HEF A;  2DQR A;  5EEH A;  1WJB A;  3HJE A;  2XRO A;  4XQF A;  4N4N B;  4OMY A;  1YS7 A;  1J9I A;  1ETY A;  2EIJ H;  1VQM I;  2EJR A;  3P7N A;  1GDT A;  1JHH A;  4AU7 A;  2L9S A;  1LNW A;  5FKN A;  1UJ8 A;  3FM5 A;  2RN7 A;  5HSZ A;  1XGN A;  2IGK A;  2PBX A;  3DTK A;  3E0J B;  4J00 A;  4BQQ A;  1H9G A;  5TJJ A;  4A3B J;  2I10 A;  5D4R A;  3DCF A;  4H4K C;  2XB0 X;  1FBS A;  2O5R A;  2E5Z A;  4GYG A;  4PJ0 C;  2NNY A;  3VFZ A;  1OIS A;  4M6Y A;  3ZQQ A;  9ANT A;  1SFE A;  2EFN A;  2CW7 A;  3HSR A;  4RDU A;  4XLE A;  5K5Q A;  4ENN A;  1XX5 A;  2ICW G;  1X1D A;  3ML6 A;  2DW4 A;  4ZH4 F;  3VB2 A;  5FGL A;  4HOB A;  2BXY A;  4IXA A;  5D5X B;  1ETV A;  4ESF A;  4FX4 A;  3S1N J;  3GFL A;  3I9V 2;  3CJR B;  1WQ2 A;  3NAR A;  3RQ4 A;  1MDM B;  2G7L A;  1GVJ A;  2P5V A;  1P4A A;  5C3E J;  2RDP A;  2F4M B;  4LD5 A;  2V1N A;  2XKO A;  2ZJ2 A;  5BPI A;  2HFH A;  3G56 A;  3OYG A;  1RKW A;  1V3F A;  1KQ9 A;  3JTH A;  4KFC A;  4R8H A;  3IV5 A;  1SFK A;  2DBB A;  5D4S A;  2P5K A;  1YYV A;  2PEX A;  2XAG A;  4J19 A;  2EWN A;  4XSX F;  3AG3 H;  3PUB A;  3NWS A;  4IHW A;  2K85 A;  3S1Q J;  2RQQ A;  3HKZ N;  3FXL A;  4ZTJ A;  3HDD A;  2VQC A;  1TWF J;  2Q0O A;  5E3L A;  2XDN A;  1W7P D;  2TCT A;  2XAH A;  5CQE A;  3G73 A;  4WF2 A;  2MFZ A;  1ZR4 A;  2VIX A;  3ROU A;  4AUX A;  3D1N I;  2IGO A;  2B3W A;  2HS5 A;  2O03 A;  4W1U A;  5E18 F;  1SFX A;  3BOQ A;  4JL3 A;  4LLG F;  1DPR A;  4YEJ A;  3ULQ B;  4HX7 A;  3V7S A;  3JRG A;  3MKZ A;  3KZZ A;  4X6A J;  2GXA A;  2ZB9 A;  3IHU A;  5ICG A;  2M30 A;  3CJD A;  3BZ6 A;  5F6F A;  2VAS A;  2XVC A;  3S1R J;  1FTZ A;  4HLX A;  1QHG A;  4M9S A;  1TC3 C;  4GFB A;  3WGI A;  4WK8 F;  4P9F A;  4MO7 A;  5IP6 A;  3UKG A;  3KP4 A;  2ECB A;  3IWZ A;  1VFC A;  1LDJ A;  2M2E A;  4ENJ A;  5JFR A;  1YX5 A;  3SYT A;  4IHS A;  1Q1H A;  1G3W A;  5CXI A;  2HQN A;  4M73 A;  3ZXS A;  1WGX A;  2COM A;  1F4K A;  2VKV A;  3FBI B;  4M3F A;  2R5Z B;  4NB5 A;  3IRR A;  3HB9 A;  3QOD A;  3WTV C;  4BBS J;  3QKX A;  1U9N A;  2BXZ A;  4F91 B;  4CSW A;  5HLH A;  3AG1 H;  5EG0 A;  4L0Z B;  5CVI A;  5TRD A;  4KWA A;  2FMY A;  1SD6 A;  3W3C A;  1BR4 A;  3C3W A;  4BE0 A;  1B1B A;  5A2Q K;  4MNU A;  3FXU A;  3VW1 A;  2X4H A;  2R7X A;  1TQI A;  2LOO A;  3LSH A;  1VQP I;  2VXZ A;  1Z7U A;  1YRN A;  3DQV C;  1OJL A;  3GEZ A;  1RZ4 A;  5IYB J;  1VQ4 I;  3CCY A;  4BAC A;  3MD2 A;  4P9U A;  5IPA A;  3RTR A;  5ICF A;  3ZQF A;  3GTG J;  3HOZ J;  1TBX A;  3GEU A;  3HTH A;  2M3A A;  2DT6 A;  2P7C B;  3KP5 A;  3OIQ A;  1I1G A;  3M3Y J;  4HV6 A;  5F04 A;  3VYT B;  3DTE A;  3HYI A;  1S6L A;  1R5G A;  3DPL C;  4KA4 A;  1Z05 A;  1TLH B;  2EIM H;  4R79 A;  3K2A A;  1O7F A;  2XGE A;  2ESH A;  2RC4 A;  2L7F P;  2XRN A;  4CCK A;  3VEP A;  1R5H A;  2GM4 A;  4OU0 A;  1X4O A;  4IO9 F;  1RUN A;  3KX2 A;  1OYY A;  2K5C A;  3QYE A;  2V57 A;  3WE2 A;  5D8L B;  4JYK A;  3VVX A;  2K3F A;  3D0S A;  1GHC A;  4BYY A;  3FK7 A;  1SAX A;  4A3J J;  3NPI A;  1KON A;  3CJQ B;  1TWA J;  3CP2 A;  4NHJ A;  2R7Q A;  4U0V A;  3OSG A;  4BUP A;  1J75 A;  3BR5 A;  3KYC B;  4E7J A;  4F55 A;  2QQ9 A;  3J7A O;  4EJT A;  2KIM A;  3E6B A;  3CWR A;  4UUS A;  1VZ0 A;  2ZC2 A;  3DBL B;  1BW6 A;  2E2H J;  1UB9 A;  3TW7 A;  4A0Y A;  2CSO A;  4KIS A;  2G0E A;  2NX4 A;  1RC9 A;  2QYO A;  2RQP A;  3T1B A;  1YJN I;  2QZ8 A;  1A04 A;  2LLK A;  2PMU A;  2XDV A;  2CYY A;  4BQA A;  3HHG A;  3GZI A;  1XGO A;  3TP0 A;  3DP7 A;  2QEN A;  3HL2 A;  1UHS A;  1U5T B;  2OPT A;  4RB0 A;  2H6B A;  3H36 A;  2MD5 A;  1L0O C;  2VBY A;  4E70 A;  1HQC A;  3HGG A;  2BZT A;  3H5N A;  5L3F A;  2KHM A;  2D6Y A;  2DFF A;  4UV8 A;  4UB6 C;  3S8P A;  3O2P E;  1BI0 A;  3DKX A;  2DA7 A;  1TTY A;  3ZN0 A;  1ZRC A;  3ANP A;  1JKQ C;  2OV7 A;  4Y15 A;  3WGH A;  2O8K A;  4Y17 A;  4PJM A;  1XN7 A;  3U21 A;  4KUM A;  1I6H J;  3BPX A;  2QIB A;  2MG4 A;  4PFP A;  3KP6 A;  5F08 A;  2VBZ A;  3W2V A;  4IOA F;  3RZO J;  2LY2 A;  3L2R A;  5BQT A;  4GGG A;  3JAM K;  1JUP A;  3ZMD A;  4RM2 A;  3PFY A;  3S2D J;  4EM2 A;  3E7L A;  3Q3S A;  3DEU A;  5E3N A;  1WI3 A;  5C4Y A;  3U2R A;  2YVX A;  3K4L A;  3M1E A;  2QWT A;  2F4I A;  1BJZ A;  1QO0 D;  2VKE A;  4HQE A;  3LSR A;  2E35 A;  3VOD A;  3VDX A;  1WJ5 A;  3GX4 X;  1ON1 A;  3ZRG A;  1EV7 A;  2BY1 A;  2K9Q A;  2X48 A;  4DQ2 A;  1F9N A;  3ZGK A;  4NUB A;  4UB8 C;  2Q2E A;  4RAG A;  5D5U B;  3DBR B;  4I02 A;  4D7M A;  2VOD A;  1I3Q J;  1K7A A;  2CW0 F;  4U87 A;  1ZEL A;  4CDG A;  4Q4Z F;  1ZR2 A;  3GCM A;  2BY0 A;  3GZN B;  5FD6 A;  1MNM C;  2ELJ A;  4RS8 A;  3ESW B;  4A3G J;  2GEN A;  2LG4 A;  2F5D A;  4A3I J;  3Q0V A;  5HNF A;  2OBP A;  4A69 C;  5FO5 A;  3TOB A;  4MIM A;  2VPL A;  4RAZ A;  3M9A A;  2D5V A;  1JHF A;  4F93 B;  3DLA A;  2ZFW A;  2R92 J;  3E5Q A;  2KLO A;  4IPA A;  5EJC A;  1PYV A;  3CLO A;  5ILU A;  1S7E A;  4G9Y A;  3FHN A;  2ZME C;  3S5R A;  4AWX B;  1U9O A;  3PIO F;  3OS0 A;  4CO8 A;  3KEY A;  2MC4 A;  2ZO4 A;  3TO9 A;  2JSC A;  3Q9S A;  3TO6 A;  3F22 A;  1ITY A;  1S7A A;  3BZC A;  4XR6 A;  1DDN A;  2F5E A;  1E17 A;  1JKO C;  5HLI A;  3JRF A;  4A6E A;  2HVS A;  1Y8R B;  3O8H A;  5F27 A;  3S93 A;  1HDP A;  1TP4 A;  3CMM A;  2Y69 H;  4K2E A;  1VQ7 I;  2F2E A;  2BV6 A;  3J7Y J;  1WJA A;  1Z7L A;  2EA2 A;  2L4M A;  4XOT A;  4C3I J;  3O6B B;  3LNQ A;  4Z6Y A;  2X85 A;  2VUM J;  5GPC A;  2HEO A;  2BOL A;  5GP9 A;  3OYJ A;  1MD0 A;  4ZYD A;  1T95 A;  4DGW B;  5TGT A;  3C18 A;  3HBL A;  4FX0 A;  1IXR C;  2EIK H;  3R6S A;  5CW8 A;  2V9V A;  1RUO A;  5DCM A;  4L0Y B;  3FM3 A;  1DUX C;  3VW0 A;  2LKX A;  2QQA A;  3DEE A;  3FF5 A;  2D1H A;  4JK1 X;  2M7A A;  4MQ9 F;  4ABZ A;  2HYT A;  4BJT A;  2Z2S B;  3NI7 A;  5EEA A;  5JVT A;  2XKP A;  3PL8 A;  3WTX C;  1UHW A;  2JWT A;  4ACI A;  4B3X A;  1MKM A;  2XRL A;  5KVR A;  4B8X A;  4NBQ A;  3I64 A;  5FKM A;  3F8B A;  2XB5 A;  2REK A;  1XCB A;  2OZU A;  4F7Z A;  1BR1 A;  2Q8K A;  3GFJ A;  2JQ7 A;  5E1Z B;  1MW7 A;  2CQN A;  2GZW A;  1DU6 A;  1P9Q C;  3Q0U A;  3CO7 C;  1FX7 A;  1LFP A;  2Z3Y A;  4PFO A;  2HTJ A;  2VJJ A;  1O7L A;  1IV8 A;  4EJW A;  5B66 C;  4YFK F;  2VOO A;  1I39 A;  2GWR A;  5D1R A;  1FMV A;  2KQR A;  2IA2 A;  4CGZ A;  3OYL A;  2ZOZ A;  2P6T A;  4AC0 A;  3ANG A;  2DMT A;  4E7I A;  2UXO A;  2DMN A;  1MJ9 A;  5ILS A;  2LF7 A;  2O9L A;  2QBY B;  2G3B A;  1Z3X A;  2DLL A;  1E0E A;  5IYC J;  2VQH A;  2K4J A;  2BYV E;  1SC7 A;  1RIO H;  2K9S A;  4ZYG A;  3KZ9 A;  1IDY A;  2GA2 A;  3L7W A;  2GIZ A;  2LRE A;  5IT3 A;  5DYM A;  3CUO A;  4B3A A;  3NQO A;  4DYC A;  3LSJ A;  1VTN C;  4QTR A;  3VYS B;  2CJJ A;  3W6K B;  1JJ8 C;  3DKW A;  3RIR A;  3H0G J;  4DYR A;  1D8K A;  4KDP A;  1QVU A;  2BW3 A;  1XMA A;  1ZK8 A;  2LNB A;  5LGT A;  2XC7 A;  4A2U A;  1F43 A;  2NVX J;  4BQO A;  5EDN A;  1O3S A;  3LQQ A;  4I99 C;  4BDZ A;  4BXX J;  4UUT A;  2R7R A;  4S0H B;  2A6T A;  4OMZ A;  2VI6 A;  2VT2 A;  3L2V A;  4IKF A;  2XPU A;  3L2C A;  3COL A;  1W5C C;  3CO6 C;  5EFY A;  5J8C A;  2JA2 A;  4FIS A;  2R5Y A;  3GWZ A;  4NEL A;  1XDS A;  3CF5 F;  3A01 B;  1AKH B;  4A12 A;  3REO A;  2ZSI B;  1B72 A;  3BR0 A;  3NRV A;  2LYC A;  1G2H A;  1HKS A;  3P9K A;  2NP5 A;  1J0R A;  2E60 A;  3EQL F;  4XK4 A;  1OPC A;  4M3E A;  3K70 D;  3FKI J;  4P5O A;  3ASN H;  2P6S A;  2MLG A;  2P81 A;  3HZJ A;  1XSD A;  4G6D A;  2YU3 A;  3HTI A;  4KIF A;  1WZ2 A;  3WHC A;  2JK3 A;  2ZCX A;  2KZG A;  1XMX A;  2QEX I;  4FHT A;  3I59 B;  1GUU A;  3A0H C;  3IH3 A;  1WCM J;  4BJ5 C;  3U9G A;  3TBI A;  4CCO A;  2QKL B;  2KRC A;  1XMK A;  4BDY A;  3HGY A;  2NAZ A;  2XHK A;  1OR7 C;  3F21 A;  5EZG A;  5B1A H;  2WV1 A;  5GTI C;  4L18 B;  2K9N A;  4G7O F;  4RGU A;  2HYG D;  2KRH A;  2CUE A;  2JUG A;  1ZKG A;  3FXQ A;  4PSX A;  2NVU B;  1KU2 A;  5JVG F;  4ENM A;  3CCL I;  2PZ9 A;  1UZC A;  5C44 J;  2IXS A;  2DAO A;  1XSV A;  1IUY A;  3DPU A;  1B8I B;  1BC7 C;  1CF7 A;  5LHH A;  3CCR I;  1LUJ B;  3ABT A;  3SXY A;  2AHQ A;  3ZQG A;  4DIQ A;  3RPU A;  2VT3 A;  1YW7 A;  5GAD J;  5IOY A;  4I0A A;  3K8P C;  5EGO B;  1T39 A;  3P9C A;  1SMY F;  2WAE A;  3A4C A;  3G1O A;  2HWV A;  3ERE D;  4YIR X;  1I6X A;  2KT0 A;  2HGC A;  3IWF A;  2A2F X;  3OYK A;  2DK5 A;  1QPI A;  2MD0 A;  3TP3 A;  2O8X A;  1W5S A;  3LFU A;  5LHI A;  5KAF C;  4AYB N;  1ZG5 A;  3FWE A;  4UUV A;  1XC5 A;  2Z5U A;  1NTC A;  4PGG A;  4JX4 A;  1SEU A;  2CQX A;  2QVO A;  1SFU A;  2CUZ A;  2YUS A;  1EJ9 A;  1FOK A;  1VQK I;  4C2M J;  1Z9C A;  5LFA A;  4CCL A;  4ITV A;  2CQ7 A;  3MZY A;  4HBL A;  2FSW A;  1EF4 A;  1KZH A;  1OCR H;  4XN3 A;  4HDU A;  4E7L A;  1HDD C;  4Y33 A;  2W1O A;  4A3K J;  1R49 A;  4HYE A;  2AO9 A;  1LKX A;  3OYF A;  1RET A;  3LHQ A;  3GZ5 A;  1MH3 A;  2JN6 A;  4YZE A;  4YII A;  1K79 A;  5K5O A;  1NK2 P;  4KT6 A;  4DZP A;  3JW4 A;  3KZY A;  2BGC A;  3GME A;  3BLY A;  2QWW A;  2OER A;  2K7L A;  1RR8 C;  3RKW A;  1V5E A;  2E1O A;  2GOM A;  2ZJR F;  4XOP A;  2DA6 A;  2P0W A;  2Z99 A;  3J81 Z;  2VB6 A;  1YQA A;  1YTY A;  1IN8 A;  4XLA A;  1QVT A;  4WWC A;  3PPB A;  4MHG A;  1APL C;  3WOD F;  4IRI A;  1J2X A;  2VQG A;  3ISP A;  4XBF A;  1ETK A;  4BQN A;  2ISZ A;  3GTL J;  3G7R A;  3S14 J;  4DYQ A;  2ELH A;  4AC6 A;  3QAH A;  1K83 J;  3WTW C;  2R3S A;  4B4C A;  1I50 J;  3BG7 A;  1N25 A;  1X1A A;  2HPI A;  2NVT J;  4CZC A;  3HOX J;  5F1J A;  2HNH A;  3WTT C;  2FJ1 A;  3ABL H;  4IVN A;  4AID A;  3CCE I;  5JLX A;  1T2K A;  4U0W A;  2O0Y A;  2LRD A;  4OIP F;  4WXH A;  2LDU A;  3H35 A;  5E3O A;  5J1U A;  3VOE A;  2FNA A;  3LWF A;  1LPQ A;  2GQQ A;  4AYB A;  2B7E A;  5B1B H;  4N9I A;  4I0B A;  3L1P A;  4ZDO A;  4M9Z A;  5F64 A;  3ABM H;  2HKO A;  3D5L A;  4MGR A;  1I1S A;  1PUF A;  1P7J A;  5FHP A;  4IL6 C;  4BH9 A;  2G7H A;  2GOX B;  2H8W A;  3CTA A;  5H6R A;  3RJP A;  2DYS H;  3HC7 A;  2PBI A;  3M07 A;  3BR2 A;  4C3H J;  5K7F A;  5AQC A;  1Z0X A;  1FSH A;  2DOA A;  2WA0 A;  3PFI A;  5E1X A;  3BP8 A;  2ME6 A;  2NYX A;  4M9X A;  3GTJ J;  3EUK L;  4ZZD A;  1W5T A;  1IZ1 A;  1KU9 A;  4L9J A;  5L3D A;  4A0Z A;  2Y48 A;  2QA4 I;  4IHX A;  4N4O B;  3HKZ A;  5FB2 A;  2WY8 Q;  2E2J J;  3C2H A;  3L2U A;  4A3M J;  3SWH A;  4RMN A;  2LKS A;  4R1H A;  3V8L A;  3BTJ A;  4A93 J;  2DXI A;  3TOA A;  3VOX A;  4NQW B;  4DBR A;  2PLY A;  3HTS B;  1GVD A;  2F4O B;  1MJA A;  2Z16 A;  2RRE A;  1S7O A;  3MN2 A;  2JJ7 A;  3GVA A;  3KLO A;  4EJO A;  1R58 A;  4FAS D;  5DEQ A;  3NNR A;  1XGM A;  4XRS G;  1GV5 A;  3I71 A;  4CUG A;  3LSI A;  1FYL A;  1ERD A;  5K7H A;  2F6C A;  2M7B A;  2O7T A;  3OOP A;  1XTA A;  3O8G A;  2CG4 A;  4BBR J;  4Q5S F;  2EFO A;  3P5J A;  2UZK A;  5FJ8 J;  2UWM A;  3T5X A;  5DD4 A;  3KIO A;  4ESJ A;  1H88 C;  3CC7 I;  4IRV A;  3O60 A;  2CU7 A;  2PMZ A;  1P2F A;  3QU3 A;  4PK4 A;  2E34 A;  3KEO A;  3CC2 I;  1PP8 F;  2LBF B;  1MZB A;  1Y1W J;  3EUP A;  4JKZ A;  3BTC A;  3FMQ A;  3PNY A;  2HYF A;  1MSF C;  2M4K A;  4LIV A;  5HDN A;  3CC4 I;  1UI5 A;  3RH2 A;  1S3J A;  3Q0W A;  2V6E A;  1A36 A;  2R7S A;  1OLT A;  3ABK H;  1LFB A;  1Y0U A;  3JCU C;  3VVY A;  2CUF A;  2LY1 A;  4HNT A;  4WCG A;  4UVA A;  1O3T A;  3BDD A;  2GAU A;  4CYC B;  2Y2Z A;  1YW8 A;  3BG5 A;  5FD5 A;  1Y6I A;  3PUF A;  2K9L A;  4HX4 A;  1TQP A;  2IP2 A;  4YRV A;  1U6G A; 
#chains in the Genus database with same CATH homology
 2OPT A;  3RD3 A;  3HOV J;  4UDS A;  3CRJ A;  3HGG A;  5FKL A;  1SGM A;  2QKO A;  2D6Y A;  3EGQ A;  1WH7 A;  3QPS A;  2Y31 A;  2DA7 A;  2UXP A;  3ANP A;  1JKQ C;  2LY9 A;  4UUS B;  3GTP J;  3JRA A;  2Y30 A;  2O8K A;  1HCR A;  4JX5 A;  5FKO A;  1I6H J;  3FIS A;  2QIB A;  1GT0 C;  2MG4 A;  3BJB A;  5F08 A;  3PM1 A;  5IOZ A;  3RZO J;  3ZQH A;  1E3O C;  2B63 J;  1JUP A;  1IUF A;  3S2D J;  3E7L A;  3Q3S A;  3ZQL A;  5E3N A;  5F0C A;  1WI3 A;  1WH5 A;  4A3L J;  3MNL A;  1X2N A;  5C4Y A;  4RBO A;  3LWJ A;  2DA4 A;  2QWT A;  1OCP A;  2CQQ A;  5M5X J;  3ZQI A;  1BJZ A;  2VKE A;  2HOS A;  4FE7 A;  3LSR A;  4BKX A;  1A5J A;  2Q24 A;  3GTQ J;  2QF7 A;  3HE0 A;  2WGB A;  2K9Q A;  2X48 A;  3FIW A;  4V2F A;  2UXH A;  5J1Y A;  3JRB A;  2YU9 J;  2HOT A;  4D7M A;  3S15 J;  1I3Q J;  4GCK A;  5FLM J;  3BR1 A;  1ZR2 A;  2WUI A;  1MNM C;  2LTP A;  5IP7 J;  2ID3 A;  4A3G J;  2W48 A;  2GEN A;  4M3D A;  4X1E A;  4A3I J;  3BR6 A;  3Q0V A;  3BTI A;  5DS9 A;  4A69 C;  4FCY A;  3LSG A;  4MIM A;  4HKU A;  2RAS A;  2ZCN A;  2WB1 N;  2D5V A;  2EH3 A;  2LFB A;  5GPA A;  2JA5 J;  2R92 J;  3B81 A;  3JRH A;  3SJM A;  3F1B A;  3B6A A;  3F0C A;  2N8G A;  1Q1V A;  1BL0 A;  2EQR A;  2NOG A;  3GTM J;  1MBG A;  4JX6 A;  2M0C A;  5M5Y J;  1LE8 B;  3ON4 A;  1XS9 A;  1S7E A;  5HBU A;  3S5R A;  2CRG A;  2YVH A;  1U9O A;  2UXI A;  5HOD A;  1ITY A;  3JRC A;  1TWC J;  2ME0 A;  3W6V A;  5DAJ A;  1ETX A;  2DA2 A;  1JKO C;  3GTO J;  3JRF A;  4M3G A;  1BA5 A;  3O8H A;  5F27 A;  1JKR C;  3S1M J;  2XPW A;  1HDP A;  2E2I J;  5BNG A;  3HOY J;  1X2M A;  4QSH A;  3BG3 A;  1ETW A;  1POG A;  5IYD J;  4Y52 J;  3RZD J;  4C3I J;  3LNQ A;  2VUM J;  2DA1 A;  3SDG A;  4A3E J;  1ZQ3 P;  5GPC A;  3BHQ A;  5GP9 A;  3HOU J;  1IRZ A;  3VW2 A;  4M6V A;  1VI0 A;  2RAE A;  3HBL A;  2LD5 A;  2DTZ A;  2HKU A;  5CW8 A;  1BW5 A;  1T56 A;  2YVE A;  3JSJ A;  1B8I A;  2GUH A;  2LKX A;  3VW0 A;  4MLO A;  5H9T A;  2LVS A;  2XSD C;  2DA5 A;  4ABZ A;  2HYT A;  4GFL A;  3A02 A;  1MBK A;  3NI7 A;  5EEA A;  3QPL A;  1R9T J;  5IP9 J;  2COB A;  1ORK A;  2IEK A;  2JWT A;  4ACI A;  4C3J J;  4BY7 J;  2IBD A;  3JR9 A;  2XRL A;  5FKM A;  1UG2 A;  2M34 A;  2XB5 A;  2REK A;  5J3L A;  4ICH A;  1ETQ A;  4GCL A;  1SFO J;  2UXU A;  3E7Q A;  2H8R A;  2LP0 A;  3G1L A;  1DU6 A;  2NVY J;  1CQT A;  2FX0 A;  3Q0U A;  1FJL A;  4ME9 A;  1IG7 A;  5HAW A;  3PO2 J;  4A3C J;  1DU0 A;  4Y7N J;  5D1R A;  2ZOZ A;  3CMY A;  1FIP A;  4AC0 A;  3ANG A;  1MBJ A;  4D5F A;  2DMT A;  2UXO A;  2DMN A;  1W0U A;  2HXO A;  2O9L A;  2G3B A;  3BR3 A;  5IYC J;  2RHA A;  1JTX A;  2ECC A;  3C2B A;  3HOW J;  1FIA A;  2VPR A;  3KNW A;  2ELK A;  2K9S A;  3HTJ A;  3KZ9 A;  3DEW A;  1IDY A;  4JP0 A;  2Y0S N;  3AQT A;  1HLV A;  4B3A A;  1JGG A;  1JUM A;  4DYC A;  4A3F J;  3LSJ A;  1IJW C;  4BY1 J;  2XPV A;  4QTR A;  1NK3 P;  1QRY A;  2XGC A;  2CJJ A;  1JJ8 C;  5M3F J;  2DMU A;  5EF6 A;  4NN1 A;  3H0G J;  3A01 A;  5FLV A;  4DYR A;  2G7S A;  5J1R A;  2TRT A;  1B72 B;  2KDZ A;  4L62 A;  1QVU A;  3HM5 A;  4D5C A;  3NXC A;  3PO3 J;  1ZK8 A;  2R93 J;  2QCO A;  1ZGW A;  1F43 A;  3MKL A;  2NVX J;  2MSY A;  2R0Q C;  3K7A J;  5EDN A;  5DTD A;  3P9T A;  2EZI A;  2FD5 A;  5F0F A;  4EEF G;  2GLO A;  2L9R A;  4BXX J;  3LOC A;  3OIO A;  4UUT A;  3G1M A;  4S0H B;  1RPW A;  4GFK A;  2VI6 A;  4MK6 A;  4M3B A;  2XPU A;  5D18 A;  3COL A;  2LR8 A;  4LOC A;  5EFY A;  4MFD A;  3LSP A;  5EG0 B;  2DN0 A;  4FIS A;  2HXI A;  2R5Y A;  4L5E A;  4NEL A;  1ENH A;  5C4J J;  2IU5 A;  3A01 B;  1JT0 A;  4NDL A;  1AKH B;  1B72 A;  4XRM A;  1MBF A;  2PMZ N;  3BR0 A;  1LE8 A;  1G2H A;  2G7G A;  2NP5 A;  2ZOY A;  1D5Y A;  3BT9 A;  4XK4 A;  2FBQ A;  3ZQC A;  4M3E A;  1VF9 A;  2HDD A;  3FKI J;  2GFN A;  2P81 A;  2HYJ A;  1LFU P;  3FK6 A;  4JNN A;  2OI8 A;  1YRN B;  4HNV A;  3HTI A;  3BCG A;  5FKK A;  3WHC A;  3ZOB A;  2JK3 A;  3BQZ A;  3JRE A;  2ZCX A;  1XG1 A;  3ON2 A;  1F36 A;  1GUU A;  4B1R A;  2K40 A;  3IH3 A;  3HEF A;  1WCM J;  1A6I A;  1VND A;  4G12 A;  3VPR A;  1MBE A;  3HGY A;  4XID A;  2R5Y B;  2MGQ A;  1TWH J;  3IH2 A;  4PXI A;  5EZG A;  1ETY A;  2WV1 A;  5F0H A;  3DPJ A;  1GDT A;  1UI6 A;  3GTK J;  4AF5 A;  2DMQ A;  3BNI A;  2K9N A;  2L7M P;  2F07 A;  5FKN A;  3PAS A;  1HF0 A;  2CUE A;  2DG8 A;  1ZKG A;  3V6G A;  3NAU A;  2HOA A;  5HSZ A;  1WPK A;  2PZ9 A;  1ETO A;  5C44 J;  3C07 A;  2PBX A;  2E19 A;  3B6C A;  1AU7 A;  1B8I B;  4A3B J;  1JTY A;  2X9D A;  2I10 A;  3IH4 A;  1IDZ A;  3ZQG A;  2AHQ A;  3DCF A;  1X58 A;  2XB0 X;  3RKQ A;  3AQS A;  5IOY A;  2LK2 A;  3MVP A;  4I76 A;  5EGO B;  9ANT A;  2O7O A;  2EZK A;  4RDU A;  3S17 J;  4CGR A;  5K58 A;  3G1O A;  5K7Z A;  3QBM A;  2KT0 A;  5FGL A;  4DZJ A;  1QPI A;  1ETV A;  3TP3 A;  3VIB A;  3S1N J;  3NAR A;  5JLW A;  2G7L A;  4AYB N;  1SAN A;  5C3E J;  1XC5 A;  1NTC A;  4JX4 A;  2CQX A;  1UMQ A;  2YUS A;  4C2M J;  3G56 A;  3BTL A;  1RKW A;  2Y9Y A;  3KKC A;  3IV5 A;  2QOP A;  4J19 A;  2H1K A;  1MH4 A;  1EF4 A;  5EYR A;  4IHW A;  3S1Q J;  3HKZ N;  5EGO A;  3BG9 A;  3HDD A;  1HDD C;  1IGN A;  3LJL A;  2NVQ J;  4A3K J;  1TWF J;  2AO9 A;  2XGD A;  1RET A;  3LHQ A;  5E3L A;  2XDN A;  1MH3 A;  1OCT C;  2TCT A;  1ZR4 A;  2JN6 A;  4YZE A;  2R7Z J;  1TWG J;  4AUX A;  3D1N I;  1NK2 P;  4W1U A;  2Y9Z A;  4DZP A;  4JL3 A;  2QTQ A;  5E3M A;  2OER A;  2W53 A;  3JRG A;  2E1O A;  4X6A J;  2R5Z A;  2M8G X;  2ZB9 A;  4W97 A;  4FTH A;  2DA6 A;  2ZCM A;  3CJD A;  3FRQ A;  3PPB A;  1QVT A;  2DA3 A;  4XIC A;  1FTT A;  3S1R J;  4MFE A;  1APL C;  1FTZ A;  3HIM A;  2DG7 A;  1TC3 C;  4A3D J;  4GFB A;  3GTL J;  1ETK A;  1MBH A;  1RES A;  1Y1V J;  3G7R A;  3S14 J;  4DYQ A;  4MO7 A;  1PUF B;  5IP6 A;  3UKG A;  4AC6 A;  1K83 J;  2ECB A;  4B4C A;  3CQZ J;  1I50 J;  1JUS A;  3BQY A;  1VFC A;  3JRI A;  2M2E A;  3H3V K;  5M3M J;  2NVT J;  3HOX J;  3TED A;  5F1J A;  5CXI A;  2FJ1 A;  5JLX A;  1WGX A;  1T33 A;  3TW6 A;  2VKV A;  4M3F A;  2R5Z B;  2EBI A;  4BBS J;  3HB9 A;  3QKX A;  1U9N A;  5E3O A;  5J1U A;  5EG0 A;  1AHD P;  1HOM A;  5EZH A;  1H8A C;  3CDL A;  3L1P A;  4KWA A;  3VVZ A;  3T6N A;  1P7I A;  1AKH A;  1PUF A;  1P7J A;  4FE4 A;  5FHP A;  1U8B A;  3KKD A;  3VW1 A;  3HTA A;  5C4X J;  2WAQ N;  5K7F A;  1FEX A;  5AQC A;  2JA8 J;  4C3H J;  3BR2 A;  2JA7 J;  1Z0X A;  1W0T A;  2ME6 A;  3GTJ J;  1YRN A;  5IYB J;  1OJL A;  2M9H A;  3CCY A;  2IAI A;  1GV2 A;  5IPA A;  4IHX A;  3VOK A;  2E2J J;  2DMP A;  3ZQF A;  4A3M J;  3GTG J;  3HOZ J;  4GCT A;  3BTJ A;  3GEU A;  4A93 J;  3HTH A;  3VOX A;  3RQI A;  5M5W J;  3BRU A;  4MXM A;  3M3Y J;  1GVD A;  5F04 A;  1JT6 A;  3JRD A;  5CXG A;  3MN2 A;  2JJ7 A;  1MSE C;  1OFC X;  2EZL A;  3NNR A;  4XRS G;  1GV5 A;  4D7N A;  2X6O A;  5K7H A;  3K2A A;  2HI3 A;  2O7T A;  2XGE A;  3NRG A;  2OF7 A;  2L7F P;  3O8G A;  2NS8 A;  1RR7 A;  2NS7 A;  4BBR J;  4IHY A;  1O4X A;  2GM4 A;  4CYC A;  5FJ8 J;  3I4N J;  4IHV A;  2HQ5 A;  3GBG A;  1H88 C;  2L0K A;  3QQA A;  3O60 A;  2CU7 A;  2ID6 A;  3WHB A;  2V57 A;  5FMP A;  2MW8 A;  4JYK A;  3VVX A;  1ZTR A;  2EZH A;  1Z77 A;  2YS9 A;  2JA6 J;  4XRS A;  1U78 A;  3FK7 A;  1Y1W J;  4A3J J;  1IV6 A;  3EUP A;  3NPI A;  4JKZ A;  4V2G A;  5D19 A;  1TWA J;  2GBY A;  3BTC A;  1MSF C;  1UI5 A;  2JMW A;  3RH2 A;  3S2H J;  3Q0W A;  3OSG A;  4DW6 A;  3BR5 A;  3SFI A;  1IC8 A;  1JJ6 C;  3VVY A;  1LFB A;  2CUF A;  3S16 J;  2DJN A;  2L7Z A;  3OSF A;  3CWR A;  2FQ4 A;  4UUS A;  3VP5 A;  3IUV A;  3VUQ A;  2E2H J;  1BW6 A;  3I4M J;  3TW7 A;  1H89 C;  2NP3 A;  3V78 A;  4CYC B;  2Y2Z A;  2G0E A;  2NX4 A;  3BG5 A;  4IEJ A;  3A03 A;  3M4O J;  1RKT A;  2LLK A;  4I6Z A;  3GZI A;  3OOU A;  3TP0 A;  1JKP C;  1K61 A;  4QIW N;  1UHS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...