4JL3A

Crystal structure of ms6564-dna complex
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
179
structure length
179
Chain Sequence
SEKSRVAIVEATRALLLERGFDGLSIEAVAAKAGVGKQTIYRWWPSRHALVADVLLEDADKILARMPKTDDVTADLASWAGTLAAALTTRRGHAMLKTLMAASLEHEDTAARLREGFSRPLIESVRDRLRDEDIDADHAQAAADALLGAVVNAVLSEGRSYSRQRAETSARIIVAGLRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, TetR family
publication title Structural basis for interaction between M. smegmatis Ms6564, a TetR family master regulator, and its target DNA.
rcsb
source organism Mycobacterium smegmatis
molecule tags Transcription/dna
total genus 62
structure length 179
sequence length 179
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF16859 TetR_C_11 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 4jl3A00
2FBQA 4M3GA 2O7TA 3VOKA 2UXIA 2RHAA 1QVUA 5D1RA 5FKKA 3BR1A 3V78A 3G1MA 1Z0XA 1QPIA 2ZCXA 3O8HA 4D5CA 3LJLA 5J1UA 3VW1A 3V6GA 3BTIA 4GCTA 2NX4A 3LSPA 3HTHA 3Q0WA 2DTZA 2QKOA 2XDNA 3NXCA 2GBYA 3Q3SA 3EGQA 4AF5A 4V2GA 3VIBA 3FIWA 5K7HA 2OI8A 2UXUA 4W1UA 2QCOA 4I6ZA 3BR2A 4AC6A 3VVXA 3G56A 2XRLA 2IEKA 5J3LA 2NS8A 5DAJA 2ID3A 5FKMA 2XGCA 2D6YA 5F0FA 5K7ZA 3PASA 1T33A 5IP6A 3WHBA 1UI6A 2G7SA 3HTIA 2O7OA 4ACIA 4AUXA 1JTXA 3O60A 2GFNA 3IUVA 3DPJA 2RASA 2HXOA 2QTQA 4B3AA 2HQ5A 3BT9A 3BTCA 1Z77A 2RAEA 3GZIA 3MNLA 3LSRA 5HSZA 2REKA 5K7FA 5F0CA 2VPRA 1QVTA 3G7RA 3KKDA 3FK6A 3ANPA 3B81A 1RKWA 3B6CA 4MK6A 3BR6A 4JNNA 2VKEA 3BR0A 4NELA 2FX0A 4ME9A 2HXIA 4JKZA 5EYRA 3NNRA 3ZQHA 3VW0A 4PXIA 3IH4A 3O8GA 5F27A 3TP0A 3QPLA 2YVHA 2V57A 5FKNA 4X1EA 3TP3A 3QPSA 4AC0A 4GFLA 4ICHA 3HGYA 3SFIA 5GPAA 1VI0A 1U9OA 3VW2A 3ZQLA 5F08A 4D7MA 2XGDA 3WHCA 2XPVA 3BJBA 3KZ9A 2W53A 2HYTA 3PM1A 2GUHA 2IBDA 3NRGA 3LSJA 2X9DA 5CW8A 5C4YA 3RH2A 4G12A 2QIBA 2G7LA 2OERA 4GCLA 2F07A 2XPWA 2Y2ZA 1RPWA 2G0EA 5GPCA 3JSJA 3IH2A 3BR5A 4M3FA 3S5RA 3NPIA 2WGBA 3CJDA 2ID6A 2QOPA 3VUQA 2XB5A 2FQ4A 5FKOA 5HAWA 3NI7A 3BTLA 2ZCMA 5D18A 2UXOA 2XGEA 2XPUA 4CGRA 3G1LA 3ON4A 2EH3A 3BTJA 3F0CA 5FGLA 2TCTA 4M3DA 4MXMA 5CXIA 2OPTA 4ABZA 3F1BA 1SGMA 3CDLA 3MVPA 3ZQIA 2GENA 3DCFA 4W97A 3HTAA 3AQSA 3VOXA 3VP5A 1JT0A 5J1YA 3BCGA 5GP9A 4V2FA 3HIMA 3BRUA 5AQCA 3FRQA 3VPRA 3CCYA 4D5FA 5IOYA 3FK7A 4HKUA 3T6NA 4UDSA 5H9TA 3QKXA 5EZGA 3E7QA 1ORKA 3Q0UA 2YVEA 2UXHA 3KKCA 4XK4A 1JT6A 1BJZA 4L62A 5FKLA 5IOZA 3G1OA 2NP5A 3ZQGA 5EZHA 3BHQA 2Q24A 5J1RA 1JUSA 2Y30A 2Y31A 3ON2A 5HBUA 2ZB9A 4DW6A 5F04A 3ANGA 3GEUA 4D7NA 1T56A 1JUMA 4JYKA 5F0HA 2G3BA 3HTJA 2TRTA 3BQYA 3HGGA 4KWAA 3DEWA 5D19A 2HYJA 3SDGA 2G7GA 3COLA 3VVZA 4M3EA 3EUPA 4B1RA 2ZOYA 3Q0VA 1UI5A 2JJ7A 1ZKGA 2FD5A 4GFKA 3LOCA 3IH3A 2DG7A 2PBXA 3BNIA 5CXGA 4YZEA 1ZK8A 5F1JA 3BR3A 4NN1A 1RKTA 2NS7A 2X6OA 2I10A 3LWJA 2ZCNA 1JTYA 3QBMA 3CWRA 3VVYA 3PPBA 1A6IA 2UXPA 2NP3A 4JL3A 2VKVA 2WUIA 3CRJA 1JUPA 3AQTA 3P9TA 3C2BA 4GCKA 4MO7A 3BQZA 4M3BA 4I76A 2PZ9A 2DG8A 2ZOZA 3RD3A 3LHQA 5FHPA 2IAIA 3C07A 5FMPA 2OF7A 5K58A 2QWTA 1U9NA 5IPAA 2HKUA 5EFYA 3ZQFA 2IU5A 3KNWA 3B6AA 3HE0A 2JK3A 3QQAA 2WV1A 2FJ1A
chains in the Genus database with same CATH superfamily
2FBQA 4M3GA 2O7TA 3VOKA 2UXIA 2RHAA 3KYLA 2A2FX 1QVUA 5D1RA 5FKKA 3BR1A 3V78A 3G1MA 1Z0XA 1QPIA 2ZCXA 3O8HA 4D5CA 3LJLA 5J1UA 3VW1A 3V6GA 3BTIA 4GCTA 2NX4A 3LSPA 3HTHA 3Q0WA 3DU6A 2DTZA 2QKOA 2XDNA 3NXCA 2GBYA 3Q3SA 3EGQA 4AF5A 2R7SA 4V2GA 3VIBA 3FIWA 5K7HA 2OI8A 2UXUA 4W1UA 2QCOA 4I6ZA 3BR2A 4AC6A 3VVXA 3G56A 2XRLA 2IEKA 5J3LA 2NS8A 5DAJA 2ID3A 5FKMA 2XGCA 2D6YA 5F0FA 5K7ZA 3PASA 1T33A 4OD5A 5IP6A 2ZY9A 3WHBA 1UI6A 2R7OA 2G7SA 3HTIA 2O7OA 4ACIA 4AUXA 1JTXA 3O60A 4OD4A 2GFNA 3IUVA 3DPJA 2RASA 2HXOA 2QTQA 4B3AA 2HQ5A 3BT9A 3BTCA 2B3WA 1Z77A 2RAEA 3GZIA 3MNLA 3LSRA 5HSZA 2REKA 5K7FA 5F0CA 2VPRA 3VTIA 1QVTA 3G7RA 3KKDA 3FK6A 3ANPA 3B81A 1RKWA 3B6CA 2R7TA 4MK6A 3BR6A 4JNNA 2VKEA 3BR0A 4NELA 2FX0A 4ME9A 2HXIA 4JKZA 5EYRA 3NNRA 3ZQHA 3VW0A 4PXIA 3IH4A 4U9LA 3FHNA 3O8GA 5F27A 3TP0A 3QPLA 2YVHA 2V57A 5FKNA 4X1EA 3TP3A 3QPSA 4AC0A 4GFLA 4ICHA 3HGYA 3SFIA 5GPAA 1VI0A 1U9OA 3VW2A 3ZQLA 5F08A 4D7MA 2XGDA 3WHCA 2XPVA 3BJBA 3KZ9A 2W53A 2R7RA 4WIBA 2HYTA 2R7XA 3PM1A 2GUHA 2IBDA 3NRGA 3LSJA 2R7VA 2X9DA 5CW8A 5C4YA 3RH2A 4G12A 2QIBA 2G7LA 2OERA 4GCLA 2F07A 2XPWA 2Y2ZA 1RPWA 2G0EA 5GPCA 3JSJA 3IH2A 3SWHA 3BR5A 4M3FA 3S5RA 3NPIA 2WGBA 3CJDA 2ID6A 2QOPA 3VUQA 2XB5A 2FQ4A 5FKOA 5HAWA 3NI7A 3BTLA 2ZCMA 5D18A 2UXOA 2XGEA 2XPUA 4CGRA 3G1LA 3ON4A 2EH3A 3BTJA 3F0CA 5FGLA 2TCTA 4M3DA 4MXMA 5CXIA 2OPTA 4ABZA 2R7UA 3F1BA 1SGMA 3CDLA 3MVPA 3ZQIA 2GENA 3DCFA 4W97A 3HTAA 2FJI1 3AQSA 3VOXA 3VP5A 1JT0A 2R7WA 5J1YA 3BCGA 4DVYP 5GP9A 4V2FA 3HIMA 3BRUA 5AQCA 3FRQA 3VPRA 3CCYA 4D5FA 5IOYA 3FK7A 4HKUA 3T6NA 4UDSA 5H9TA 3QKXA 5EZGA 3E7QA 1ORKA 3Q0UA 2YVEA 2UXHA 3KKCA 4XK4A 1JT6A 1BJZA 4L62A 5FKLA 5IOZA 3G1OA 4U9NA 2YVXA 2NP5A 4IRVA 3ZQGA 5EZHA 2B1EA 3BHQA 2Q24A 5J1RA 1JUSA 2Y30A 2Y31A 2PFVA 3ON2A 5HBUA 2ZB9A 4DW6A 5F04A 3ANGA 3GEUA 4D7NA 1T56A 1JUMA 4JYKA 5F0HA 2G3BA 3HTJA 2TRTA 3BQYA 3HGGA 4KWAA 3DEWA 5D19A 2HYJA 3SDGA 2G7GA 2R7QA 3COLA 3VVZA 4M3EA 3EUPA 4B1RA 3K8PC 2ZOYA 3Q0VA 1UI5A 2JJ7A 1ZKGA 2FD5A 4GFKA 3LOCA 3IH3A 2DG7A 2PBXA 4C2MA 3BNIA 5CXGA 4YZEA 1ZK8A 5F1JA 3BR3A 4NN1A 1RKTA 2NS7A 2X6OA 2I10A 3LWJA 2ZCNA 1JTYA 3QBMA 3CWRA 3VVYA 3DU5A 3PPBA 1A6IA 2UXPA 2NP3A 4JL3A 2VKVA 2WUIA 3CRJA 1JUPA 3NS4A 3AQTA 3P9TA 3C2BA 4GCKA 4MO7A 3BQZA 5CQGA 4M3BA 4I76A 2PZ9A 2DG8A 2ZOZA 3RD3A 3LHQA 5FHPA 2IAIA 3C07A 5FMPA 2OF7A 5K58A 2QWTA 1U9NA 5IPAA 2HKUA 5EFYA 3ZQFA 2IU5A 3KNWA 3B6AA 3HE0A 2JK3A 3QQAA 2WV1A 2FJ1A
chains in the Genus database with same CATH topology
2FBQA 4M3GA 2O7TA 3VOKA 2UXIA 2RHAA 1QVUA 5D1RA 5FKKA 3BR1A 3V78A 3G1MA 1Z0XA 1QPIA 2ZCXA 3O8HA 4D5CA 3LJLA 5J1UA 3VW1A 3V6GA 3BTIA 4GCTA 2NX4A 3LSPA 3HTHA 3Q0WA 2DTZA 2QKOA 2XDNA 3NXCA 2GBYA 3Q3SA 3EGQA 4AF5A 4V2GA 3VIBA 3FIWA 5K7HA 2OI8A 2UXUA 4W1UA 2QCOA 4I6ZA 3BR2A 4AC6A 3VVXA 3G56A 2XRLA 2IEKA 5J3LA 2NS8A 5DAJA 2ID3A 5FKMA 2XGCA 2D6YA 5F0FA 5K7ZA 3PASA 1T33A 5IP6A 3WHBA 1UI6A 2G7SA 3HTIA 2O7OA 4ACIA 4AUXA 1JTXA 3O60A 2GFNA 3IUVA 3DPJA 2RASA 2HXOA 2QTQA 4B3AA 2HQ5A 3BT9A 3BTCA 1Z77A 2RAEA 3GZIA 3MNLA 3LSRA 5HSZA 2REKA 5K7FA 5F0CA 2VPRA 1QVTA 3G7RA 3KKDA 3FK6A 3ANPA 3B81A 1RKWA 3B6CA 4MK6A 3BR6A 4JNNA 2VKEA 3BR0A 4NELA 2FX0A 4ME9A 2HXIA 4JKZA 5EYRA 3NNRA 3ZQHA 3VW0A 4PXIA 3IH4A 3O8GA 5F27A 3TP0A 3QPLA 2YVHA 2V57A 5FKNA 4X1EA 3TP3A 3QPSA 4AC0A 4GFLA 4ICHA 3HGYA 3SFIA 5GPAA 1VI0A 1U9OA 3VW2A 3ZQLA 5F08A 4D7MA 2XGDA 3WHCA 2XPVA 3BJBA 3KZ9A 2W53A 2HYTA 3PM1A 2GUHA 2IBDA 3NRGA 3LSJA 2X9DA 5CW8A 5C4YA 3RH2A 4G12A 2QIBA 2G7LA 2OERA 4GCLA 2F07A 2XPWA 2Y2ZA 1RPWA 2G0EA 5GPCA 3JSJA 3IH2A 3BR5A 4M3FA 3S5RA 3NPIA 2WGBA 3CJDA 2ID6A 2QOPA 3VUQA 2XB5A 2FQ4A 5FKOA 5HAWA 3NI7A 3BTLA 2ZCMA 5D18A 2UXOA 2XGEA 2XPUA 4CGRA 3G1LA 3ON4A 2EH3A 3BTJA 3F0CA 5FGLA 2TCTA 4M3DA 4MXMA 5CXIA 2OPTA 4ABZA 3F1BA 1SGMA 3CDLA 3MVPA 3ZQIA 2GENA 3DCFA 4W97A 3HTAA 3AQSA 3VOXA 3VP5A 1JT0A 5J1YA 3BCGA 5GP9A 4V2FA 3HIMA 3BRUA 5AQCA 3FRQA 3VPRA 3CCYA 4D5FA 5IOYA 3FK7A 4HKUA 3T6NA 4UDSA 5H9TA 3QKXA 5EZGA 3E7QA 1ORKA 3Q0UA 2YVEA 2UXHA 3KKCA 4XK4A 1JT6A 1BJZA 4L62A 5FKLA 5IOZA 3G1OA 2NP5A 3ZQGA 5EZHA 3BHQA 2Q24A 5J1RA 1JUSA 2Y30A 2Y31A 3ON2A 5HBUA 2ZB9A 4DW6A 5F04A 3ANGA 3GEUA 4D7NA 1T56A 1JUMA 4JYKA 5F0HA 2G3BA 3HTJA 2TRTA 3BQYA 3HGGA 4KWAA 3DEWA 5D19A 2HYJA 3SDGA 2G7GA 3COLA 3VVZA 4M3EA 3EUPA 4B1RA 2ZOYA 3Q0VA 1UI5A 2JJ7A 1ZKGA 2FD5A 4GFKA 3LOCA 3IH3A 2DG7A 2PBXA 3BNIA 5CXGA 4YZEA 1ZK8A 5F1JA 3BR3A 4NN1A 1RKTA 2NS7A 2X6OA 2I10A 3LWJA 2ZCNA 1JTYA 3QBMA 3CWRA 3VVYA 3PPBA 1A6IA 2UXPA 2NP3A 4JL3A 2VKVA 2WUIA 3CRJA 1JUPA 3AQTA 3P9TA 3C2BA 4GCKA 4MO7A 3BQZA 4M3BA 4I76A 2PZ9A 2DG8A 2ZOZA 3RD3A 3LHQA 5FHPA 2IAIA 3C07A 5FMPA 2OF7A 5K58A 2QWTA 1U9NA 5IPAA 2HKUA 5EFYA 3ZQFA 2IU5A 3KNWA 3B6AA 3HE0A 2JK3A 3QQAA 2WV1A 2FJ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FBQ A;  4M3G A;  2O7T A;  3VOK A;  2UXI A;  2RHA A;  1QVU A;  5D1R A;  5FKK A;  3BR1 A;  3V78 A;  3G1M A;  1Z0X A;  1QPI A;  2ZCX A;  3O8H A;  4D5C A;  3LJL A;  5J1U A;  3VW1 A;  3V6G A;  3BTI A;  4GCT A;  2NX4 A;  3LSP A;  3HTH A;  3Q0W A;  2DTZ A;  2QKO A;  2XDN A;  3NXC A;  2GBY A;  3Q3S A;  3EGQ A;  4AF5 A;  4V2G A;  3VIB A;  3FIW A;  5K7H A;  2OI8 A;  2UXU A;  4W1U A;  2QCO A;  4I6Z A;  3BR2 A;  4AC6 A;  3VVX A;  3G56 A;  2XRL A;  2IEK A;  5J3L A;  2NS8 A;  5DAJ A;  2ID3 A;  5FKM A;  2XGC A;  2D6Y A;  5F0F A;  5K7Z A;  3PAS A;  1T33 A;  5IP6 A;  3WHB A;  1UI6 A;  2G7S A;  3HTI A;  2O7O A;  4ACI A;  4AUX A;  1JTX A;  3O60 A;  2GFN A;  3IUV A;  3DPJ A;  2RAS A;  2HXO A;  2QTQ A;  4B3A A;  2HQ5 A;  3BT9 A;  3BTC A;  1Z77 A;  2RAE A;  3GZI A;  3MNL A;  3LSR A;  5HSZ A;  2REK A;  5K7F A;  5F0C A;  2VPR A;  1QVT A;  3G7R A;  3KKD A;  3FK6 A;  3ANP A;  3B81 A;  1RKW A;  3B6C A;  4MK6 A;  3BR6 A;  4JNN A;  2VKE A;  3BR0 A;  4NEL A;  2FX0 A;  4ME9 A;  2HXI A;  4JKZ A;  5EYR A;  3NNR A;  3ZQH A;  3VW0 A;  4PXI A;  3IH4 A;  3O8G A;  5F27 A;  3TP0 A;  3QPL A;  2YVH A;  2V57 A;  5FKN A;  4X1E A;  3TP3 A;  3QPS A;  4AC0 A;  4GFL A;  4ICH A;  3HGY A;  3SFI A;  5GPA A;  1VI0 A;  1U9O A;  3VW2 A;  3ZQL A;  5F08 A;  4D7M A;  2XGD A;  3WHC A;  2XPV A;  3BJB A;  3KZ9 A;  2W53 A;  2HYT A;  3PM1 A;  2GUH A;  2IBD A;  3NRG A;  3LSJ A;  2X9D A;  5CW8 A;  5C4Y A;  3RH2 A;  4G12 A;  2QIB A;  2G7L A;  2OER A;  4GCL A;  2F07 A;  2XPW A;  2Y2Z A;  1RPW A;  2G0E A;  5GPC A;  3JSJ A;  3IH2 A;  3BR5 A;  4M3F A;  3S5R A;  3NPI A;  2WGB A;  3CJD A;  2ID6 A;  2QOP A;  3VUQ A;  2XB5 A;  2FQ4 A;  5FKO A;  5HAW A;  3NI7 A;  3BTL A;  2ZCM A;  5D18 A;  2UXO A;  2XGE A;  2XPU A;  4CGR A;  3G1L A;  3ON4 A;  2EH3 A;  3BTJ A;  3F0C A;  5FGL A;  2TCT A;  4M3D A;  4MXM A;  5CXI A;  2OPT A;  4ABZ A;  3F1B A;  1SGM A;  3CDL A;  3MVP A;  3ZQI A;  2GEN A;  3DCF A;  4W97 A;  3HTA A;  3AQS A;  3VOX A;  3VP5 A;  1JT0 A;  5J1Y A;  3BCG A;  5GP9 A;  4V2F A;  3HIM A;  3BRU A;  5AQC A;  3FRQ A;  3VPR A;  3CCY A;  4D5F A;  5IOY A;  3FK7 A;  4HKU A;  3T6N A;  4UDS A;  5H9T A;  3QKX A;  5EZG A;  3E7Q A;  1ORK A;  3Q0U A;  2YVE A;  2UXH A;  3KKC A;  4XK4 A;  1JT6 A;  1BJZ A;  4L62 A;  5FKL A;  5IOZ A;  3G1O A;  2NP5 A;  3ZQG A;  5EZH A;  3BHQ A;  2Q24 A;  5J1R A;  1JUS A;  2Y30 A;  2Y31 A;  3ON2 A;  5HBU A;  2ZB9 A;  4DW6 A;  5F04 A;  3ANG A;  3GEU A;  4D7N A;  1T56 A;  1JUM A;  4JYK A;  5F0H A;  2G3B A;  3HTJ A;  2TRT A;  3BQY A;  3HGG A;  4KWA A;  3DEW A;  5D19 A;  2HYJ A;  3SDG A;  2G7G A;  3COL A;  3VVZ A;  4M3E A;  3EUP A;  4B1R A;  2ZOY A;  3Q0V A;  1UI5 A;  2JJ7 A;  1ZKG A;  2FD5 A;  4GFK A;  3LOC A;  3IH3 A;  2DG7 A;  2PBX A;  3BNI A;  5CXG A;  4YZE A;  1ZK8 A;  5F1J A;  3BR3 A;  4NN1 A;  1RKT A;  2NS7 A;  2X6O A;  2I10 A;  3LWJ A;  2ZCN A;  1JTY A;  3QBM A;  3CWR A;  3VVY A;  3PPB A;  1A6I A;  2UXP A;  2NP3 A;  4JL3 A;  2VKV A;  2WUI A;  3CRJ A;  1JUP A;  3AQT A;  3P9T A;  3C2B A;  4GCK A;  4MO7 A;  3BQZ A;  4M3B A;  4I76 A;  2PZ9 A;  2DG8 A;  2ZOZ A;  3RD3 A;  3LHQ A;  5FHP A;  2IAI A;  3C07 A;  5FMP A;  2OF7 A;  5K58 A;  2QWT A;  1U9N A;  5IPA A;  2HKU A;  5EFY A;  3ZQF A;  2IU5 A;  3KNW A;  3B6A A;  3HE0 A;  2JK3 A;  3QQA A;  2WV1 A;  2FJ1 A; 
#chains in the Genus database with same CATH topology
 2FBQ A;  4M3G A;  2O7T A;  3VOK A;  2UXI A;  2RHA A;  3KYL A;  2A2F X;  1QVU A;  5D1R A;  5FKK A;  3BR1 A;  3V78 A;  3G1M A;  1Z0X A;  1QPI A;  2ZCX A;  3O8H A;  4D5C A;  3LJL A;  5J1U A;  3VW1 A;  3V6G A;  3BTI A;  4GCT A;  2NX4 A;  3LSP A;  3HTH A;  3Q0W A;  3DU6 A;  2DTZ A;  2QKO A;  2XDN A;  3NXC A;  2GBY A;  3Q3S A;  3EGQ A;  4AF5 A;  2R7S A;  4V2G A;  3VIB A;  3FIW A;  5K7H A;  2OI8 A;  2UXU A;  4W1U A;  2QCO A;  4I6Z A;  3BR2 A;  4AC6 A;  3VVX A;  3G56 A;  2XRL A;  2IEK A;  5J3L A;  2NS8 A;  5DAJ A;  2ID3 A;  5FKM A;  2XGC A;  2D6Y A;  5F0F A;  5K7Z A;  3PAS A;  1T33 A;  4OD5 A;  5IP6 A;  2ZY9 A;  3WHB A;  1UI6 A;  2R7O A;  2G7S A;  3HTI A;  2O7O A;  4ACI A;  4AUX A;  1JTX A;  3O60 A;  4OD4 A;  2GFN A;  3IUV A;  3DPJ A;  2RAS A;  2HXO A;  2QTQ A;  4B3A A;  2HQ5 A;  3BT9 A;  3BTC A;  2B3W A;  1Z77 A;  2RAE A;  3GZI A;  3MNL A;  3LSR A;  5HSZ A;  2REK A;  5K7F A;  5F0C A;  2VPR A;  3VTI A;  1QVT A;  3G7R A;  3KKD A;  3FK6 A;  3ANP A;  3B81 A;  1RKW A;  3B6C A;  2R7T A;  4MK6 A;  3BR6 A;  4JNN A;  2VKE A;  3BR0 A;  4NEL A;  2FX0 A;  4ME9 A;  2HXI A;  4JKZ A;  5EYR A;  3NNR A;  3ZQH A;  3VW0 A;  4PXI A;  3IH4 A;  4U9L A;  3FHN A;  3O8G A;  5F27 A;  3TP0 A;  3QPL A;  2YVH A;  2V57 A;  5FKN A;  4X1E A;  3TP3 A;  3QPS A;  4AC0 A;  4GFL A;  4ICH A;  3HGY A;  3SFI A;  5GPA A;  1VI0 A;  1U9O A;  3VW2 A;  3ZQL A;  5F08 A;  4D7M A;  2XGD A;  3WHC A;  2XPV A;  3BJB A;  3KZ9 A;  2W53 A;  2R7R A;  4WIB A;  2HYT A;  2R7X A;  3PM1 A;  2GUH A;  2IBD A;  3NRG A;  3LSJ A;  2R7V A;  2X9D A;  5CW8 A;  5C4Y A;  3RH2 A;  4G12 A;  2QIB A;  2G7L A;  2OER A;  4GCL A;  2F07 A;  2XPW A;  2Y2Z A;  1RPW A;  2G0E A;  5GPC A;  3JSJ A;  3IH2 A;  3SWH A;  3BR5 A;  4M3F A;  3S5R A;  3NPI A;  2WGB A;  3CJD A;  2ID6 A;  2QOP A;  3VUQ A;  2XB5 A;  2FQ4 A;  5FKO A;  5HAW A;  3NI7 A;  3BTL A;  2ZCM A;  5D18 A;  2UXO A;  2XGE A;  2XPU A;  4CGR A;  3G1L A;  3ON4 A;  2EH3 A;  3BTJ A;  3F0C A;  5FGL A;  2TCT A;  4M3D A;  4MXM A;  5CXI A;  2OPT A;  4ABZ A;  2R7U A;  3F1B A;  1SGM A;  3CDL A;  3MVP A;  3ZQI A;  2GEN A;  3DCF A;  4W97 A;  3HTA A;  2FJI 1;  3AQS A;  3VOX A;  3VP5 A;  1JT0 A;  2R7W A;  5J1Y A;  3BCG A;  4DVY P;  5GP9 A;  4V2F A;  3HIM A;  3BRU A;  5AQC A;  3FRQ A;  3VPR A;  3CCY A;  4D5F A;  5IOY A;  3FK7 A;  4HKU A;  3T6N A;  4UDS A;  5H9T A;  3QKX A;  5EZG A;  3E7Q A;  1ORK A;  3Q0U A;  2YVE A;  2UXH A;  3KKC A;  4XK4 A;  1JT6 A;  1BJZ A;  4L62 A;  5FKL A;  5IOZ A;  3G1O A;  4U9N A;  2YVX A;  2NP5 A;  4IRV A;  3ZQG A;  5EZH A;  2B1E A;  3BHQ A;  2Q24 A;  5J1R A;  1JUS A;  2Y30 A;  2Y31 A;  2PFV A;  3ON2 A;  5HBU A;  2ZB9 A;  4DW6 A;  5F04 A;  3ANG A;  3GEU A;  4D7N A;  1T56 A;  1JUM A;  4JYK A;  5F0H A;  2G3B A;  3HTJ A;  2TRT A;  3BQY A;  3HGG A;  4KWA A;  3DEW A;  5D19 A;  2HYJ A;  3SDG A;  2G7G A;  2R7Q A;  3COL A;  3VVZ A;  4M3E A;  3EUP A;  4B1R A;  3K8P C;  2ZOY A;  3Q0V A;  1UI5 A;  2JJ7 A;  1ZKG A;  2FD5 A;  4GFK A;  3LOC A;  3IH3 A;  2DG7 A;  2PBX A;  4C2M A;  3BNI A;  5CXG A;  4YZE A;  1ZK8 A;  5F1J A;  3BR3 A;  4NN1 A;  1RKT A;  2NS7 A;  2X6O A;  2I10 A;  3LWJ A;  2ZCN A;  1JTY A;  3QBM A;  3CWR A;  3VVY A;  3DU5 A;  3PPB A;  1A6I A;  2UXP A;  2NP3 A;  4JL3 A;  2VKV A;  2WUI A;  3CRJ A;  1JUP A;  3NS4 A;  3AQT A;  3P9T A;  3C2B A;  4GCK A;  4MO7 A;  3BQZ A;  5CQG A;  4M3B A;  4I76 A;  2PZ9 A;  2DG8 A;  2ZOZ A;  3RD3 A;  3LHQ A;  5FHP A;  2IAI A;  3C07 A;  5FMP A;  2OF7 A;  5K58 A;  2QWT A;  1U9N A;  5IPA A;  2HKU A;  5EFY A;  3ZQF A;  2IU5 A;  3KNW A;  3B6A A;  3HE0 A;  2JK3 A;  3QQA A;  2WV1 A;  2FJ1 A; 
#chains in the Genus database with same CATH homology
 2FBQ A;  4M3G A;  2O7T A;  3VOK A;  2UXI A;  2RHA A;  1QVU A;  5D1R A;  5FKK A;  3BR1 A;  3V78 A;  3G1M A;  1Z0X A;  1QPI A;  2ZCX A;  3O8H A;  4D5C A;  3LJL A;  5J1U A;  3VW1 A;  3V6G A;  3BTI A;  4GCT A;  2NX4 A;  3LSP A;  3HTH A;  3Q0W A;  2DTZ A;  2QKO A;  2XDN A;  3NXC A;  2GBY A;  3Q3S A;  3EGQ A;  4AF5 A;  4V2G A;  3VIB A;  3FIW A;  5K7H A;  2OI8 A;  2UXU A;  4W1U A;  2QCO A;  4I6Z A;  3BR2 A;  4AC6 A;  3VVX A;  3G56 A;  2XRL A;  2IEK A;  5J3L A;  2NS8 A;  5DAJ A;  2ID3 A;  5FKM A;  2XGC A;  2D6Y A;  5F0F A;  5K7Z A;  3PAS A;  1T33 A;  5IP6 A;  3WHB A;  1UI6 A;  2G7S A;  3HTI A;  2O7O A;  4ACI A;  4AUX A;  1JTX A;  3O60 A;  2GFN A;  3IUV A;  3DPJ A;  2RAS A;  2HXO A;  2QTQ A;  4B3A A;  2HQ5 A;  3BT9 A;  3BTC A;  1Z77 A;  2RAE A;  3GZI A;  3MNL A;  3LSR A;  5HSZ A;  2REK A;  5K7F A;  5F0C A;  2VPR A;  1QVT A;  3G7R A;  3KKD A;  3FK6 A;  3ANP A;  3B81 A;  1RKW A;  3B6C A;  4MK6 A;  3BR6 A;  4JNN A;  2VKE A;  3BR0 A;  4NEL A;  2FX0 A;  4ME9 A;  2HXI A;  4JKZ A;  5EYR A;  3NNR A;  3ZQH A;  3VW0 A;  4PXI A;  3IH4 A;  3O8G A;  5F27 A;  3TP0 A;  3QPL A;  2YVH A;  2V57 A;  5FKN A;  4X1E A;  3TP3 A;  3QPS A;  4AC0 A;  4GFL A;  4ICH A;  3HGY A;  3SFI A;  5GPA A;  1VI0 A;  1U9O A;  3VW2 A;  3ZQL A;  5F08 A;  4D7M A;  2XGD A;  3WHC A;  2XPV A;  3BJB A;  3KZ9 A;  2W53 A;  2HYT A;  3PM1 A;  2GUH A;  2IBD A;  3NRG A;  3LSJ A;  2X9D A;  5CW8 A;  5C4Y A;  3RH2 A;  4G12 A;  2QIB A;  2G7L A;  2OER A;  4GCL A;  2F07 A;  2XPW A;  2Y2Z A;  1RPW A;  2G0E A;  5GPC A;  3JSJ A;  3IH2 A;  3BR5 A;  4M3F A;  3S5R A;  3NPI A;  2WGB A;  3CJD A;  2ID6 A;  2QOP A;  3VUQ A;  2XB5 A;  2FQ4 A;  5FKO A;  5HAW A;  3NI7 A;  3BTL A;  2ZCM A;  5D18 A;  2UXO A;  2XGE A;  2XPU A;  4CGR A;  3G1L A;  3ON4 A;  2EH3 A;  3BTJ A;  3F0C A;  5FGL A;  2TCT A;  4M3D A;  4MXM A;  5CXI A;  2OPT A;  4ABZ A;  3F1B A;  1SGM A;  3CDL A;  3MVP A;  3ZQI A;  2GEN A;  3DCF A;  4W97 A;  3HTA A;  3AQS A;  3VOX A;  3VP5 A;  1JT0 A;  5J1Y A;  3BCG A;  5GP9 A;  4V2F A;  3HIM A;  3BRU A;  5AQC A;  3FRQ A;  3VPR A;  3CCY A;  4D5F A;  5IOY A;  3FK7 A;  4HKU A;  3T6N A;  4UDS A;  5H9T A;  3QKX A;  5EZG A;  3E7Q A;  1ORK A;  3Q0U A;  2YVE A;  2UXH A;  3KKC A;  4XK4 A;  1JT6 A;  1BJZ A;  4L62 A;  5FKL A;  5IOZ A;  3G1O A;  2NP5 A;  3ZQG A;  5EZH A;  3BHQ A;  2Q24 A;  5J1R A;  1JUS A;  2Y30 A;  2Y31 A;  3ON2 A;  5HBU A;  2ZB9 A;  4DW6 A;  5F04 A;  3ANG A;  3GEU A;  4D7N A;  1T56 A;  1JUM A;  4JYK A;  5F0H A;  2G3B A;  3HTJ A;  2TRT A;  3BQY A;  3HGG A;  4KWA A;  3DEW A;  5D19 A;  2HYJ A;  3SDG A;  2G7G A;  3COL A;  3VVZ A;  4M3E A;  3EUP A;  4B1R A;  2ZOY A;  3Q0V A;  1UI5 A;  2JJ7 A;  1ZKG A;  2FD5 A;  4GFK A;  3LOC A;  3IH3 A;  2DG7 A;  2PBX A;  3BNI A;  5CXG A;  4YZE A;  1ZK8 A;  5F1J A;  3BR3 A;  4NN1 A;  1RKT A;  2NS7 A;  2X6O A;  2I10 A;  3LWJ A;  2ZCN A;  1JTY A;  3QBM A;  3CWR A;  3VVY A;  3PPB A;  1A6I A;  2UXP A;  2NP3 A;  4JL3 A;  2VKV A;  2WUI A;  3CRJ A;  1JUP A;  3AQT A;  3P9T A;  3C2B A;  4GCK A;  4MO7 A;  3BQZ A;  4M3B A;  4I76 A;  2PZ9 A;  2DG8 A;  2ZOZ A;  3RD3 A;  3LHQ A;  5FHP A;  2IAI A;  3C07 A;  5FMP A;  2OF7 A;  5K58 A;  2QWT A;  1U9N A;  5IPA A;  2HKU A;  5EFY A;  3ZQF A;  2IU5 A;  3KNW A;  3B6A A;  3HE0 A;  2JK3 A;  3QQA A;  2WV1 A;  2FJ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...