4JL3A

Crystal structure of ms6564-dna complex
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
179
structure length
179
Chain Sequence
b'SEKSRVAIVEATRALLLERGFDGLSIEAVAAKAGVGKQTIYRWWPSRHALVADVLLEDADKILARMPKTDDVTADLASWAGTLAAALTTRRGHAMLKTLMAASLEHEDTAARLREGFSRPLIESVRDRLRDEDIDADHAQAAADALLGAVVNAVLSEGRSYSRQRAETSARIIVAGLRP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, TetR family
publication title Structural basis for interaction between M. smegmatis Ms6564, a TetR family master regulator, and its target DNA.
rcsb
source organism Mycobacterium smegmatis
molecule tags Transcription/dna
total genus 62
structure length 179
sequence length 179
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF16859 TetR_C_11 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 4jl3A00
2HKUA 4M3BA 3HIMA 5FKLA 2G7GA 2UXHA 4AF5A 4M3GA 3C2BA 5EZHA 3VW2A 2Q24A 2XB5A 5D18A 3KZ9A 2NP3A 3ZQFA 3BR5A 2G3BA 4ABZA 1JT6A 2ID6A 2HXOA 5EZGA 1JT0A 1QPIA 2FX0A 3HTHA 3C07A 2RHAA 2UXIA 3VPRA 2I10A 3VVXA 5AQCA 1JUMA 3KNWA 5F08A 5GPAA 2XDNA 1A6IA 3SFIA 2WUIA 2DG7A 2W53A 4W97A 5GP9A 5EYRA 3FK6A 3S5RA 3Q0WA 3ON2A 2XRLA 1JTXA 3QPSA 2GENA 3HGGA 3WHBA 5K7ZA 2OPTA 1BJZA 4JL3A 4GFKA 3BTIA 3BHQA 2RAEA 3BTJA 2OI8A 2VPRA 2O7OA 3O8GA 2D6YA 3TP0A 5FKNA 5HBUA 4X1EA 4I76A 3PPBA 3MVPA 3COLA 2G7SA 4W1UA 2ZCMA 3LSPA 2GUHA 3Q0UA 4M3FA 2IBDA 3NPIA 2ZB9A 3AQTA 4M3EA 1RKWA 2ZCXA 3HTAA 3BR0A 2NS7A 4GCTA 5F0HA 5K7FA 2IAIA 2UXOA 3RH2A 4UDSA 2PZ9A 3NXCA 3CRJA 5DAJA 5EFYA 3B6CA 3F0CA 3O60A 2WV1A 3O8HA 1T56A 2XPWA 2Y31A 2IEKA 3G7RA 3IUVA 3PASA 3BNIA 2RASA 4D7MA 2GBYA 1JTYA 3ZQHA 4NN1A 5IOZA 4JKZA 5HAWA 3NNRA 4MO7A 5J1RA 2GFNA 5CXIA 5CXGA 2F07A 4ICHA 3F1BA 3BQYA 2DG8A 5IOYA 4MK6A 3Q0VA 2FQ4A 3IH2A 3BR2A 1UI6A 3BR1A 5J3LA 3BTLA 5J1YA 4HKUA 2FD5A 5C4YA 2QCOA 3LSRA 3LSJA 3SDGA 3G1OA 3BQZA 4XK4A 1RKTA 4AUXA 3VOKA 3LHQA 2QWTA 2UXPA 4AC6A 2HQ5A 4YZEA 3V78A 3FK7A 5FHPA 1ZK8A 3CJDA 3V6GA 3QBMA 2ZOYA 3FRQA 3CCYA 3NI7A 5H9TA 4NELA 3TP3A 1ZKGA 1U9OA 1JUSA 4V2FA 3BJBA 5FMPA 3ZQIA 2Y30A 2REKA 3KKCA 2QIBA 2TRTA 3JSJA 3HE0A 2FBQA 5K7HA 5F0CA 3BRUA 3QKXA 3B6AA 5IPAA 3WHCA 2NS8A 2XGDA 3LOCA 3DEWA 1VI0A 3NRGA 1Z0XA 4ACIA 5J1UA 1JUPA 1QVUA 2NP5A 5K58A 3EUPA 3LJLA 2XPUA 4KWAA 3ON4A 3LWJA 3HTJA 2JJ7A 2VKVA 4V2GA 3E7QA 3ANPA 3Q3SA 3VW0A 3PM1A 3T6NA 2FJ1A 1UI5A 1RPWA 3KKDA 5CW8A 5HSZA 5GPCA 3VOXA 1ORKA 4GFLA 3BTCA 3G1MA 4JYKA 3VVZA 2Y2ZA 4CGRA 3DCFA 2XGCA 3DPJA 3VW1A 2UXUA 2ZCNA 4PXIA 3ZQLA 4B1RA 3AQSA 3VP5A 2DTZA 3BR6A 3ANGA 4JNNA 3G1LA 3MNLA 2TCTA 1QVTA 5FGLA 2QOPA 5FKOA 3EGQA 2ZOZA 3BR3A 3CWRA 2XPVA 3FIWA 2HXIA 2G0EA 1SGMA 3HGYA 2YVHA 3BT9A 4M3DA 2XGEA 2QKOA 2VKEA 3P9TA 5F1JA 2WGBA 5FKKA 4GCKA 3VVYA 5D1RA 4B3AA 5IP6A 2PBXA 3QPLA 4ME9A 5F0FA 2OF7A 3HTIA 3GZIA 4MXMA 4L62A 4AC0A 2EH3A 2QTQA 2NX4A 2IU5A 2HYTA 4G12A 2OERA 5F04A 3GEUA 5F27A 3RD3A 2YVEA 3IH4A 4D5CA 2HYJA 4DW6A 2JK3A 3CDLA 5D19A 4GCLA 1T33A 3BCGA 3G56A 2G7LA 2O7TA 4D5FA 2X6OA 4D7NA 3VIBA 2ID3A 3IH3A 3B81A 2X9DA 3QQAA 2V57A 1U9NA 1Z77A 4I6ZA 3VUQA 3ZQGA 5FKMA
chains in the Genus database with same CATH superfamily
4C2MA 2HKUA 4M3BA 3HIMA 5FKLA 2G7GA 2UXHA 2YVXA 4AF5A 4M3GA 3C2BA 5EZHA 4IRVA 3VW2A 2Q24A 2R7QA 2XB5A 5D18A 3KZ9A 2NP3A 3ZQFA 3BR5A 4WIBA 2G3BA 4ABZA 2B1EA 1JT6A 2ID6A 2HXOA 5EZGA 1JT0A 1QPIA 2FX0A 3HTHA 3C07A 3K8PC 2RHAA 2UXIA 3VPRA 2I10A 3VVXA 5AQCA 1JUMA 3KNWA 5F08A 5GPAA 2R7SA 2XDNA 1A6IA 3SFIA 2WUIA 2DG7A 2W53A 4OD5A 2R7RA 4W97A 5GP9A 5EYRA 3FK6A 3S5RA 3Q0WA 3ON2A 2XRLA 1JTXA 3QPSA 2GENA 3HGGA 3WHBA 5K7ZA 2OPTA 4U9NA 3NS4A 1BJZA 4JL3A 4GFKA 3BTIA 3BHQA 2RAEA 3BTJA 2OI8A 2VPRA 2B3WA 2O7OA 3O8GA 2D6YA 3TP0A 5FKNA 5HBUA 4X1EA 4I76A 3PPBA 3MVPA 3COLA 2G7SA 4W1UA 2ZCMA 3LSPA 2GUHA 3Q0UA 4M3FA 2IBDA 3NPIA 2ZB9A 2R7OA 3AQTA 2A2FX 4M3EA 1RKWA 2ZCXA 3HTAA 3BR0A 2NS7A 4GCTA 5F0HA 5K7FA 3VTIA 2IAIA 2UXOA 3RH2A 4UDSA 2PZ9A 3NXCA 3CRJA 5DAJA 5EFYA 3B6CA 3F0CA 3O60A 2R7WA 2WV1A 3O8HA 1T56A 2PFVA 2XPWA 2Y31A 2IEKA 3G7RA 3IUVA 3PASA 3BNIA 2RASA 4D7MA 2GBYA 1JTYA 3SWHA 3ZQHA 4NN1A 5IOZA 4JKZA 5HAWA 3NNRA 3DU5A 4MO7A 5J1RA 2GFNA 5CXIA 5CXGA 2F07A 4ICHA 3F1BA 3BQYA 2DG8A 5IOYA 4MK6A 3Q0VA 2FQ4A 3IH2A 3BR2A 1UI6A 3BR1A 5J3LA 3BTLA 5J1YA 4HKUA 2FD5A 5C4YA 2QCOA 3LSRA 3LSJA 3SDGA 3G1OA 3BQZA 4XK4A 1RKTA 4AUXA 3VOKA 3LHQA 2QWTA 2UXPA 4AC6A 2HQ5A 4YZEA 3V78A 3FK7A 5FHPA 1ZK8A 3CJDA 3V6GA 3QBMA 2ZOYA 3FRQA 3CCYA 3NI7A 5H9TA 4NELA 3TP3A 1ZKGA 4U9LA 1U9OA 1JUSA 4OD4A 4V2FA 3BJBA 5FMPA 3ZQIA 2Y30A 2REKA 3KKCA 2QIBA 2TRTA 3JSJA 3HE0A 2FBQA 5K7HA 5F0CA 3BRUA 3QKXA 3B6AA 5IPAA 3WHCA 2NS8A 2XGDA 3LOCA 3DEWA 3DU6A 1VI0A 3NRGA 1Z0XA 4ACIA 2R7XA 5J1UA 1JUPA 1QVUA 2NP5A 5K58A 3EUPA 3LJLA 2XPUA 4KWAA 3ON4A 3LWJA 3HTJA 2JJ7A 2VKVA 2R7TA 4V2GA 3E7QA 3ANPA 3Q3SA 3VW0A 3PM1A 3T6NA 2FJ1A 1UI5A 1RPWA 3KKDA 5CW8A 5HSZA 5GPCA 3VOXA 1ORKA 4GFLA 3BTCA 3G1MA 4JYKA 3VVZA 2Y2ZA 4CGRA 3DCFA 2XGCA 3DPJA 3VW1A 2UXUA 2ZCNA 2R7UA 4PXIA 3ZQLA 4B1RA 3AQSA 3VP5A 2DTZA 3BR6A 3ANGA 4JNNA 3G1LA 3MNLA 2TCTA 3FHNA 1QVTA 5FGLA 2QOPA 5FKOA 3EGQA 2ZOZA 3BR3A 3CWRA 2XPVA 3FIWA 2HXIA 2G0EA 1SGMA 3HGYA 3KYLA 2YVHA 2FJI1 3BT9A 4M3DA 2XGEA 2R7VA 2QKOA 2VKEA 3P9TA 5F1JA 2WGBA 5FKKA 4GCKA 3VVYA 5D1RA 4B3AA 5IP6A 2PBXA 3QPLA 4ME9A 5F0FA 2OF7A 3HTIA 3GZIA 4MXMA 4L62A 4AC0A 2EH3A 2QTQA 2NX4A 2IU5A 2HYTA 4G12A 2OERA 5F04A 3GEUA 5F27A 3RD3A 2YVEA 3IH4A 4D5CA 2HYJA 4DW6A 2JK3A 3CDLA 5D19A 4GCLA 1T33A 4DVYP 3BCGA 3G56A 2G7LA 5CQGA 2O7TA 4D5FA 2X6OA 4D7NA 3VIBA 2ID3A 3IH3A 3B81A 2ZY9A 2X9DA 3QQAA 2V57A 1U9NA 1Z77A 4I6ZA 3VUQA 3ZQGA 5FKMA
chains in the Genus database with same CATH topology
2HKUA 4M3BA 3HIMA 5FKLA 2G7GA 2UXHA 4AF5A 4M3GA 3C2BA 5EZHA 3VW2A 2Q24A 2XB5A 5D18A 3KZ9A 2NP3A 3ZQFA 3BR5A 2G3BA 4ABZA 1JT6A 2ID6A 2HXOA 5EZGA 1JT0A 1QPIA 2FX0A 3HTHA 3C07A 2RHAA 2UXIA 3VPRA 2I10A 3VVXA 5AQCA 1JUMA 3KNWA 5F08A 5GPAA 2XDNA 1A6IA 3SFIA 2WUIA 2DG7A 2W53A 4W97A 5GP9A 5EYRA 3FK6A 3S5RA 3Q0WA 3ON2A 2XRLA 1JTXA 3QPSA 2GENA 3HGGA 3WHBA 5K7ZA 2OPTA 1BJZA 4JL3A 4GFKA 3BTIA 3BHQA 2RAEA 3BTJA 2OI8A 2VPRA 2O7OA 3O8GA 2D6YA 3TP0A 5FKNA 5HBUA 4X1EA 4I76A 3PPBA 3MVPA 3COLA 2G7SA 4W1UA 2ZCMA 3LSPA 2GUHA 3Q0UA 4M3FA 2IBDA 3NPIA 2ZB9A 3AQTA 4M3EA 1RKWA 2ZCXA 3HTAA 3BR0A 2NS7A 4GCTA 5F0HA 5K7FA 2IAIA 2UXOA 3RH2A 4UDSA 2PZ9A 3NXCA 3CRJA 5DAJA 5EFYA 3B6CA 3F0CA 3O60A 2WV1A 3O8HA 1T56A 2XPWA 2Y31A 2IEKA 3G7RA 3IUVA 3PASA 3BNIA 2RASA 4D7MA 2GBYA 1JTYA 3ZQHA 4NN1A 5IOZA 4JKZA 5HAWA 3NNRA 4MO7A 5J1RA 2GFNA 5CXIA 5CXGA 2F07A 4ICHA 3F1BA 3BQYA 2DG8A 5IOYA 4MK6A 3Q0VA 2FQ4A 3IH2A 3BR2A 1UI6A 3BR1A 5J3LA 3BTLA 5J1YA 4HKUA 2FD5A 5C4YA 2QCOA 3LSRA 3LSJA 3SDGA 3G1OA 3BQZA 4XK4A 1RKTA 4AUXA 3VOKA 3LHQA 2QWTA 2UXPA 4AC6A 2HQ5A 4YZEA 3V78A 3FK7A 5FHPA 1ZK8A 3CJDA 3V6GA 3QBMA 2ZOYA 3FRQA 3CCYA 3NI7A 5H9TA 4NELA 3TP3A 1ZKGA 1U9OA 1JUSA 4V2FA 3BJBA 5FMPA 3ZQIA 2Y30A 2REKA 3KKCA 2QIBA 2TRTA 3JSJA 3HE0A 2FBQA 5K7HA 5F0CA 3BRUA 3QKXA 3B6AA 5IPAA 3WHCA 2NS8A 2XGDA 3LOCA 3DEWA 1VI0A 3NRGA 1Z0XA 4ACIA 5J1UA 1JUPA 1QVUA 2NP5A 5K58A 3EUPA 3LJLA 2XPUA 4KWAA 3ON4A 3LWJA 3HTJA 2JJ7A 2VKVA 4V2GA 3E7QA 3ANPA 3Q3SA 3VW0A 3PM1A 3T6NA 2FJ1A 1UI5A 1RPWA 3KKDA 5CW8A 5HSZA 5GPCA 3VOXA 1ORKA 4GFLA 3BTCA 3G1MA 4JYKA 3VVZA 2Y2ZA 4CGRA 3DCFA 2XGCA 3DPJA 3VW1A 2UXUA 2ZCNA 4PXIA 3ZQLA 4B1RA 3AQSA 3VP5A 2DTZA 3BR6A 3ANGA 4JNNA 3G1LA 3MNLA 2TCTA 1QVTA 5FGLA 2QOPA 5FKOA 3EGQA 2ZOZA 3BR3A 3CWRA 2XPVA 3FIWA 2HXIA 2G0EA 1SGMA 3HGYA 2YVHA 3BT9A 4M3DA 2XGEA 2QKOA 2VKEA 3P9TA 5F1JA 2WGBA 5FKKA 4GCKA 3VVYA 5D1RA 4B3AA 5IP6A 2PBXA 3QPLA 4ME9A 5F0FA 2OF7A 3HTIA 3GZIA 4MXMA 4L62A 4AC0A 2EH3A 2QTQA 2NX4A 2IU5A 2HYTA 4G12A 2OERA 5F04A 3GEUA 5F27A 3RD3A 2YVEA 3IH4A 4D5CA 2HYJA 4DW6A 2JK3A 3CDLA 5D19A 4GCLA 1T33A 3BCGA 3G56A 2G7LA 2O7TA 4D5FA 2X6OA 4D7NA 3VIBA 2ID3A 3IH3A 3B81A 2X9DA 3QQAA 2V57A 1U9NA 1Z77A 4I6ZA 3VUQA 3ZQGA 5FKMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HKU A;  4M3B A;  3HIM A;  5FKL A;  2G7G A;  2UXH A;  4AF5 A;  4M3G A;  3C2B A;  5EZH A;  3VW2 A;  2Q24 A;  2XB5 A;  5D18 A;  3KZ9 A;  2NP3 A;  3ZQF A;  3BR5 A;  2G3B A;  4ABZ A;  1JT6 A;  2ID6 A;  2HXO A;  5EZG A;  1JT0 A;  1QPI A;  2FX0 A;  3HTH A;  3C07 A;  2RHA A;  2UXI A;  3VPR A;  2I10 A;  3VVX A;  5AQC A;  1JUM A;  3KNW A;  5F08 A;  5GPA A;  2XDN A;  1A6I A;  3SFI A;  2WUI A;  2DG7 A;  2W53 A;  4W97 A;  5GP9 A;  5EYR A;  3FK6 A;  3S5R A;  3Q0W A;  3ON2 A;  2XRL A;  1JTX A;  3QPS A;  2GEN A;  3HGG A;  3WHB A;  5K7Z A;  2OPT A;  1BJZ A;  4JL3 A;  4GFK A;  3BTI A;  3BHQ A;  2RAE A;  3BTJ A;  2OI8 A;  2VPR A;  2O7O A;  3O8G A;  2D6Y A;  3TP0 A;  5FKN A;  5HBU A;  4X1E A;  4I76 A;  3PPB A;  3MVP A;  3COL A;  2G7S A;  4W1U A;  2ZCM A;  3LSP A;  2GUH A;  3Q0U A;  4M3F A;  2IBD A;  3NPI A;  2ZB9 A;  3AQT A;  4M3E A;  1RKW A;  2ZCX A;  3HTA A;  3BR0 A;  2NS7 A;  4GCT A;  5F0H A;  5K7F A;  2IAI A;  2UXO A;  3RH2 A;  4UDS A;  2PZ9 A;  3NXC A;  3CRJ A;  5DAJ A;  5EFY A;  3B6C A;  3F0C A;  3O60 A;  2WV1 A;  3O8H A;  1T56 A;  2XPW A;  2Y31 A;  2IEK A;  3G7R A;  3IUV A;  3PAS A;  3BNI A;  2RAS A;  4D7M A;  2GBY A;  1JTY A;  3ZQH A;  4NN1 A;  5IOZ A;  4JKZ A;  5HAW A;  3NNR A;  4MO7 A;  5J1R A;  2GFN A;  5CXI A;  5CXG A;  2F07 A;  4ICH A;  3F1B A;  3BQY A;  2DG8 A;  5IOY A;  4MK6 A;  3Q0V A;  2FQ4 A;  3IH2 A;  3BR2 A;  1UI6 A;  3BR1 A;  5J3L A;  3BTL A;  5J1Y A;  4HKU A;  2FD5 A;  5C4Y A;  2QCO A;  3LSR A;  3LSJ A;  3SDG A;  3G1O A;  3BQZ A;  4XK4 A;  1RKT A;  4AUX A;  3VOK A;  3LHQ A;  2QWT A;  2UXP A;  4AC6 A;  2HQ5 A;  4YZE A;  3V78 A;  3FK7 A;  5FHP A;  1ZK8 A;  3CJD A;  3V6G A;  3QBM A;  2ZOY A;  3FRQ A;  3CCY A;  3NI7 A;  5H9T A;  4NEL A;  3TP3 A;  1ZKG A;  1U9O A;  1JUS A;  4V2F A;  3BJB A;  5FMP A;  3ZQI A;  2Y30 A;  2REK A;  3KKC A;  2QIB A;  2TRT A;  3JSJ A;  3HE0 A;  2FBQ A;  5K7H A;  5F0C A;  3BRU A;  3QKX A;  3B6A A;  5IPA A;  3WHC A;  2NS8 A;  2XGD A;  3LOC A;  3DEW A;  1VI0 A;  3NRG A;  1Z0X A;  4ACI A;  5J1U A;  1JUP A;  1QVU A;  2NP5 A;  5K58 A;  3EUP A;  3LJL A;  2XPU A;  4KWA A;  3ON4 A;  3LWJ A;  3HTJ A;  2JJ7 A;  2VKV A;  4V2G A;  3E7Q A;  3ANP A;  3Q3S A;  3VW0 A;  3PM1 A;  3T6N A;  2FJ1 A;  1UI5 A;  1RPW A;  3KKD A;  5CW8 A;  5HSZ A;  5GPC A;  3VOX A;  1ORK A;  4GFL A;  3BTC A;  3G1M A;  4JYK A;  3VVZ A;  2Y2Z A;  4CGR A;  3DCF A;  2XGC A;  3DPJ A;  3VW1 A;  2UXU A;  2ZCN A;  4PXI A;  3ZQL A;  4B1R A;  3AQS A;  3VP5 A;  2DTZ A;  3BR6 A;  3ANG A;  4JNN A;  3G1L A;  3MNL A;  2TCT A;  1QVT A;  5FGL A;  2QOP A;  5FKO A;  3EGQ A;  2ZOZ A;  3BR3 A;  3CWR A;  2XPV A;  3FIW A;  2HXI A;  2G0E A;  1SGM A;  3HGY A;  2YVH A;  3BT9 A;  4M3D A;  2XGE A;  2QKO A;  2VKE A;  3P9T A;  5F1J A;  2WGB A;  5FKK A;  4GCK A;  3VVY A;  5D1R A;  4B3A A;  5IP6 A;  2PBX A;  3QPL A;  4ME9 A;  5F0F A;  2OF7 A;  3HTI A;  3GZI A;  4MXM A;  4L62 A;  4AC0 A;  2EH3 A;  2QTQ A;  2NX4 A;  2IU5 A;  2HYT A;  4G12 A;  2OER A;  5F04 A;  3GEU A;  5F27 A;  3RD3 A;  2YVE A;  3IH4 A;  4D5C A;  2HYJ A;  4DW6 A;  2JK3 A;  3CDL A;  5D19 A;  4GCL A;  1T33 A;  3BCG A;  3G56 A;  2G7L A;  2O7T A;  4D5F A;  2X6O A;  4D7N A;  3VIB A;  2ID3 A;  3IH3 A;  3B81 A;  2X9D A;  3QQA A;  2V57 A;  1U9N A;  1Z77 A;  4I6Z A;  3VUQ A;  3ZQG A;  5FKM A; 
#chains in the Genus database with same CATH topology
 4C2M A;  2HKU A;  4M3B A;  3HIM A;  5FKL A;  2G7G A;  2UXH A;  2YVX A;  4AF5 A;  4M3G A;  3C2B A;  5EZH A;  4IRV A;  3VW2 A;  2Q24 A;  2R7Q A;  2XB5 A;  5D18 A;  3KZ9 A;  2NP3 A;  3ZQF A;  3BR5 A;  4WIB A;  2G3B A;  4ABZ A;  2B1E A;  1JT6 A;  2ID6 A;  2HXO A;  5EZG A;  1JT0 A;  1QPI A;  2FX0 A;  3HTH A;  3C07 A;  3K8P C;  2RHA A;  2UXI A;  3VPR A;  2I10 A;  3VVX A;  5AQC A;  1JUM A;  3KNW A;  5F08 A;  5GPA A;  2R7S A;  2XDN A;  1A6I A;  3SFI A;  2WUI A;  2DG7 A;  2W53 A;  4OD5 A;  2R7R A;  4W97 A;  5GP9 A;  5EYR A;  3FK6 A;  3S5R A;  3Q0W A;  3ON2 A;  2XRL A;  1JTX A;  3QPS A;  2GEN A;  3HGG A;  3WHB A;  5K7Z A;  2OPT A;  4U9N A;  3NS4 A;  1BJZ A;  4JL3 A;  4GFK A;  3BTI A;  3BHQ A;  2RAE A;  3BTJ A;  2OI8 A;  2VPR A;  2B3W A;  2O7O A;  3O8G A;  2D6Y A;  3TP0 A;  5FKN A;  5HBU A;  4X1E A;  4I76 A;  3PPB A;  3MVP A;  3COL A;  2G7S A;  4W1U A;  2ZCM A;  3LSP A;  2GUH A;  3Q0U A;  4M3F A;  2IBD A;  3NPI A;  2ZB9 A;  2R7O A;  3AQT A;  2A2F X;  4M3E A;  1RKW A;  2ZCX A;  3HTA A;  3BR0 A;  2NS7 A;  4GCT A;  5F0H A;  5K7F A;  3VTI A;  2IAI A;  2UXO A;  3RH2 A;  4UDS A;  2PZ9 A;  3NXC A;  3CRJ A;  5DAJ A;  5EFY A;  3B6C A;  3F0C A;  3O60 A;  2R7W A;  2WV1 A;  3O8H A;  1T56 A;  2PFV A;  2XPW A;  2Y31 A;  2IEK A;  3G7R A;  3IUV A;  3PAS A;  3BNI A;  2RAS A;  4D7M A;  2GBY A;  1JTY A;  3SWH A;  3ZQH A;  4NN1 A;  5IOZ A;  4JKZ A;  5HAW A;  3NNR A;  3DU5 A;  4MO7 A;  5J1R A;  2GFN A;  5CXI A;  5CXG A;  2F07 A;  4ICH A;  3F1B A;  3BQY A;  2DG8 A;  5IOY A;  4MK6 A;  3Q0V A;  2FQ4 A;  3IH2 A;  3BR2 A;  1UI6 A;  3BR1 A;  5J3L A;  3BTL A;  5J1Y A;  4HKU A;  2FD5 A;  5C4Y A;  2QCO A;  3LSR A;  3LSJ A;  3SDG A;  3G1O A;  3BQZ A;  4XK4 A;  1RKT A;  4AUX A;  3VOK A;  3LHQ A;  2QWT A;  2UXP A;  4AC6 A;  2HQ5 A;  4YZE A;  3V78 A;  3FK7 A;  5FHP A;  1ZK8 A;  3CJD A;  3V6G A;  3QBM A;  2ZOY A;  3FRQ A;  3CCY A;  3NI7 A;  5H9T A;  4NEL A;  3TP3 A;  1ZKG A;  4U9L A;  1U9O A;  1JUS A;  4OD4 A;  4V2F A;  3BJB A;  5FMP A;  3ZQI A;  2Y30 A;  2REK A;  3KKC A;  2QIB A;  2TRT A;  3JSJ A;  3HE0 A;  2FBQ A;  5K7H A;  5F0C A;  3BRU A;  3QKX A;  3B6A A;  5IPA A;  3WHC A;  2NS8 A;  2XGD A;  3LOC A;  3DEW A;  3DU6 A;  1VI0 A;  3NRG A;  1Z0X A;  4ACI A;  2R7X A;  5J1U A;  1JUP A;  1QVU A;  2NP5 A;  5K58 A;  3EUP A;  3LJL A;  2XPU A;  4KWA A;  3ON4 A;  3LWJ A;  3HTJ A;  2JJ7 A;  2VKV A;  2R7T A;  4V2G A;  3E7Q A;  3ANP A;  3Q3S A;  3VW0 A;  3PM1 A;  3T6N A;  2FJ1 A;  1UI5 A;  1RPW A;  3KKD A;  5CW8 A;  5HSZ A;  5GPC A;  3VOX A;  1ORK A;  4GFL A;  3BTC A;  3G1M A;  4JYK A;  3VVZ A;  2Y2Z A;  4CGR A;  3DCF A;  2XGC A;  3DPJ A;  3VW1 A;  2UXU A;  2ZCN A;  2R7U A;  4PXI A;  3ZQL A;  4B1R A;  3AQS A;  3VP5 A;  2DTZ A;  3BR6 A;  3ANG A;  4JNN A;  3G1L A;  3MNL A;  2TCT A;  3FHN A;  1QVT A;  5FGL A;  2QOP A;  5FKO A;  3EGQ A;  2ZOZ A;  3BR3 A;  3CWR A;  2XPV A;  3FIW A;  2HXI A;  2G0E A;  1SGM A;  3HGY A;  3KYL A;  2YVH A;  2FJI 1;  3BT9 A;  4M3D A;  2XGE A;  2R7V A;  2QKO A;  2VKE A;  3P9T A;  5F1J A;  2WGB A;  5FKK A;  4GCK A;  3VVY A;  5D1R A;  4B3A A;  5IP6 A;  2PBX A;  3QPL A;  4ME9 A;  5F0F A;  2OF7 A;  3HTI A;  3GZI A;  4MXM A;  4L62 A;  4AC0 A;  2EH3 A;  2QTQ A;  2NX4 A;  2IU5 A;  2HYT A;  4G12 A;  2OER A;  5F04 A;  3GEU A;  5F27 A;  3RD3 A;  2YVE A;  3IH4 A;  4D5C A;  2HYJ A;  4DW6 A;  2JK3 A;  3CDL A;  5D19 A;  4GCL A;  1T33 A;  4DVY P;  3BCG A;  3G56 A;  2G7L A;  5CQG A;  2O7T A;  4D5F A;  2X6O A;  4D7N A;  3VIB A;  2ID3 A;  3IH3 A;  3B81 A;  2ZY9 A;  2X9D A;  3QQA A;  2V57 A;  1U9N A;  1Z77 A;  4I6Z A;  3VUQ A;  3ZQG A;  5FKM A; 
#chains in the Genus database with same CATH homology
 2HKU A;  4M3B A;  3HIM A;  5FKL A;  2G7G A;  2UXH A;  4AF5 A;  4M3G A;  3C2B A;  5EZH A;  3VW2 A;  2Q24 A;  2XB5 A;  5D18 A;  3KZ9 A;  2NP3 A;  3ZQF A;  3BR5 A;  2G3B A;  4ABZ A;  1JT6 A;  2ID6 A;  2HXO A;  5EZG A;  1JT0 A;  1QPI A;  2FX0 A;  3HTH A;  3C07 A;  2RHA A;  2UXI A;  3VPR A;  2I10 A;  3VVX A;  5AQC A;  1JUM A;  3KNW A;  5F08 A;  5GPA A;  2XDN A;  1A6I A;  3SFI A;  2WUI A;  2DG7 A;  2W53 A;  4W97 A;  5GP9 A;  5EYR A;  3FK6 A;  3S5R A;  3Q0W A;  3ON2 A;  2XRL A;  1JTX A;  3QPS A;  2GEN A;  3HGG A;  3WHB A;  5K7Z A;  2OPT A;  1BJZ A;  4JL3 A;  4GFK A;  3BTI A;  3BHQ A;  2RAE A;  3BTJ A;  2OI8 A;  2VPR A;  2O7O A;  3O8G A;  2D6Y A;  3TP0 A;  5FKN A;  5HBU A;  4X1E A;  4I76 A;  3PPB A;  3MVP A;  3COL A;  2G7S A;  4W1U A;  2ZCM A;  3LSP A;  2GUH A;  3Q0U A;  4M3F A;  2IBD A;  3NPI A;  2ZB9 A;  3AQT A;  4M3E A;  1RKW A;  2ZCX A;  3HTA A;  3BR0 A;  2NS7 A;  4GCT A;  5F0H A;  5K7F A;  2IAI A;  2UXO A;  3RH2 A;  4UDS A;  2PZ9 A;  3NXC A;  3CRJ A;  5DAJ A;  5EFY A;  3B6C A;  3F0C A;  3O60 A;  2WV1 A;  3O8H A;  1T56 A;  2XPW A;  2Y31 A;  2IEK A;  3G7R A;  3IUV A;  3PAS A;  3BNI A;  2RAS A;  4D7M A;  2GBY A;  1JTY A;  3ZQH A;  4NN1 A;  5IOZ A;  4JKZ A;  5HAW A;  3NNR A;  4MO7 A;  5J1R A;  2GFN A;  5CXI A;  5CXG A;  2F07 A;  4ICH A;  3F1B A;  3BQY A;  2DG8 A;  5IOY A;  4MK6 A;  3Q0V A;  2FQ4 A;  3IH2 A;  3BR2 A;  1UI6 A;  3BR1 A;  5J3L A;  3BTL A;  5J1Y A;  4HKU A;  2FD5 A;  5C4Y A;  2QCO A;  3LSR A;  3LSJ A;  3SDG A;  3G1O A;  3BQZ A;  4XK4 A;  1RKT A;  4AUX A;  3VOK A;  3LHQ A;  2QWT A;  2UXP A;  4AC6 A;  2HQ5 A;  4YZE A;  3V78 A;  3FK7 A;  5FHP A;  1ZK8 A;  3CJD A;  3V6G A;  3QBM A;  2ZOY A;  3FRQ A;  3CCY A;  3NI7 A;  5H9T A;  4NEL A;  3TP3 A;  1ZKG A;  1U9O A;  1JUS A;  4V2F A;  3BJB A;  5FMP A;  3ZQI A;  2Y30 A;  2REK A;  3KKC A;  2QIB A;  2TRT A;  3JSJ A;  3HE0 A;  2FBQ A;  5K7H A;  5F0C A;  3BRU A;  3QKX A;  3B6A A;  5IPA A;  3WHC A;  2NS8 A;  2XGD A;  3LOC A;  3DEW A;  1VI0 A;  3NRG A;  1Z0X A;  4ACI A;  5J1U A;  1JUP A;  1QVU A;  2NP5 A;  5K58 A;  3EUP A;  3LJL A;  2XPU A;  4KWA A;  3ON4 A;  3LWJ A;  3HTJ A;  2JJ7 A;  2VKV A;  4V2G A;  3E7Q A;  3ANP A;  3Q3S A;  3VW0 A;  3PM1 A;  3T6N A;  2FJ1 A;  1UI5 A;  1RPW A;  3KKD A;  5CW8 A;  5HSZ A;  5GPC A;  3VOX A;  1ORK A;  4GFL A;  3BTC A;  3G1M A;  4JYK A;  3VVZ A;  2Y2Z A;  4CGR A;  3DCF A;  2XGC A;  3DPJ A;  3VW1 A;  2UXU A;  2ZCN A;  4PXI A;  3ZQL A;  4B1R A;  3AQS A;  3VP5 A;  2DTZ A;  3BR6 A;  3ANG A;  4JNN A;  3G1L A;  3MNL A;  2TCT A;  1QVT A;  5FGL A;  2QOP A;  5FKO A;  3EGQ A;  2ZOZ A;  3BR3 A;  3CWR A;  2XPV A;  3FIW A;  2HXI A;  2G0E A;  1SGM A;  3HGY A;  2YVH A;  3BT9 A;  4M3D A;  2XGE A;  2QKO A;  2VKE A;  3P9T A;  5F1J A;  2WGB A;  5FKK A;  4GCK A;  3VVY A;  5D1R A;  4B3A A;  5IP6 A;  2PBX A;  3QPL A;  4ME9 A;  5F0F A;  2OF7 A;  3HTI A;  3GZI A;  4MXM A;  4L62 A;  4AC0 A;  2EH3 A;  2QTQ A;  2NX4 A;  2IU5 A;  2HYT A;  4G12 A;  2OER A;  5F04 A;  3GEU A;  5F27 A;  3RD3 A;  2YVE A;  3IH4 A;  4D5C A;  2HYJ A;  4DW6 A;  2JK3 A;  3CDL A;  5D19 A;  4GCL A;  1T33 A;  3BCG A;  3G56 A;  2G7L A;  2O7T A;  4D5F A;  2X6O A;  4D7N A;  3VIB A;  2ID3 A;  3IH3 A;  3B81 A;  2X9D A;  3QQA A;  2V57 A;  1U9N A;  1Z77 A;  4I6Z A;  3VUQ A;  3ZQG A;  5FKM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...