4JL3A

Crystal structure of ms6564-dna complex
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
179
structure length
179
Chain Sequence
SEKSRVAIVEATRALLLERGFDGLSIEAVAAKAGVGKQTIYRWWPSRHALVADVLLEDADKILARMPKTDDVTADLASWAGTLAAALTTRRGHAMLKTLMAASLEHEDTAARLREGFSRPLIESVRDRLRDEDIDADHAQAAADALLGAVVNAVLSEGRSYSRQRAETSARIIVAGLRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for interaction between M. smegmatis Ms6564, a TetR family master regulator, and its target DNA.
rcsb
source organism Mycobacterium smegmatis
molecule tags Transcription/dna
molecule keywords Transcriptional regulator, TetR family
total genus 62
structure length 179
sequence length 179
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF16859 TetR_C_11 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 4jl3A00
5K7FA 2XGDA 3O8HA 3DCFA 2QIBA 2DG8A 3VOXA 3VVZA 5J1UA 3Q3SA 3ZQHA 3F1BA 5F27A 3WHBA 5F08A 2QWTA 4JNNA 5IPAA 3ZQLA 1SGMA 5EFYA 2OF7A 3GZIA 2UXIA 3GEUA 2X6OA 4JL3A 2NX4A 2O7TA 3JSJA 2NP5A 5D1RA 4V2GA 5K7HA 3B6AA 2XDNA 2REKA 3T6NA 3COLA 5J3LA 3B81A 4NN1A 5F0FA 5IOYA 3NI7A 3ANPA 4JYKA 2ZOYA 2YVEA 3AQSA 5F04A 3V78A 3IH3A 2ZCNA 1RKWA 2ZB9A 1A6IA 2OI8A 4W97A 5FKKA 4M3EA 3CJDA 3F0CA 2XRLA 5F1JA 2XPVA 3B6CA 3BTLA 4PXIA 4MXMA 3FIWA 5J1YA 4AUXA 4D7MA 4ACIA 3VW2A 3PM1A 5FHPA 3BTJA 2DG7A 5D19A 4M3BA 2NS8A 2V57A 2FX0A 2IAIA 3TP0A 3BNIA 2HXIA 3PASA 3VIBA 3BR1A 1Z0XA 4I76A 5K7ZA 2QKOA 3BR3A 3ZQGA 3BR5A 1JTXA 5CXGA 3BJBA 5IOZA 4W1UA 3HE0A 4M3GA 3AQTA 3LWJA 3ON4A 5EZHA 4GCKA 3BCGA 3VVXA 4GCTA 4D7NA 1T33A 3BT9A 5AQCA 3Q0WA 3NPIA 3LHQA 1JT0A 4DW6A 2ZCMA 2UXPA 3ON2A 2VKVA 3IUVA 4GFLA 1RPWA 3QBMA 2DTZA 1ORKA 3G1OA 2XGCA 4ABZA 4CGRA 3O60A 2GBYA 1RKTA 3BRUA 2VKEA 3SDGA 2ZOZA 4HKUA 3NNRA 3QPSA 5CW8A 3BQYA 4D5FA 3LSRA 1BJZA 3C07A 3HTHA 2HQ5A 2O7OA 3PPBA 3QPLA 2WV1A 1T56A 2Y31A 5H9TA 4ME9A 2G3BA 4X1EA 1ZKGA 3VP5A 3VW0A 3CCYA 2W53A 5GPAA 3BR6A 2Y2ZA 3BTIA 5HBUA 3LOCA 1ZK8A 3FK6A 2XB5A 2UXHA 3E7QA 2UXUA 2JJ7A 2IU5A 3ANGA 2JK3A 3DEWA 5J1RA 3VUQA 2QOPA 5EYRA 1U9NA 4G12A 2VPRA 5FKOA 4MK6A 2WUIA 1JT6A 4MO7A 1QPIA 4KWAA 3MNLA 5CXIA 3VW1A 2PZ9A 1U9OA 3HTIA 2RAEA 4AC6A 5FKMA 2UXOA 3S5RA 5GPCA 2HYTA 2FQ4A 4V2FA 4GCLA 5F0HA 2ZCXA 3CRJA 2HXOA 4AC0A 3CDLA 3Q0VA 2XGEA 5EZGA 3BHQA 2ID3A 3CWRA 3BTCA 3QQAA 4M3FA 4M3DA 5FKLA 4NELA 2RASA 4JKZA 3Q0UA 3VOKA 2FBQA 2QCOA 5HSZA 4D5CA 3HTJA 4XK4A 5FGLA 3EUPA 2OPTA 3ZQIA 3O8GA 2G7SA 2GUHA 5FMPA 2X9DA 3EGQA 3G7RA 3QKXA 2XPUA 3V6GA 2XPWA 2GFNA 5GP9A 5D18A 1QVUA 2OERA 1JUPA 3RH2A 3DPJA 2IBDA 3HTAA 3G1MA 3G1LA 3FRQA 3HIMA 4L62A 3MVPA 1QVTA 3LSPA 2G7LA 1JTYA 2F07A 2NS7A 3BR0A 1UI5A 2TCTA 2HKUA 3IH2A 3FK7A 3NRGA 2TRTA 4YZEA 3HGYA 4AF5A 2WGBA 2YVHA 1VI0A 4B3AA 2FD5A 3TP3A 2IEKA 3KZ9A 2G7GA 4ICHA 2Y30A 3KKCA 3VPRA 1UI6A 2I10A 2NP3A 2FJ1A 4I6ZA 3VVYA 3KKDA 3HGGA 2G0EA 2PBXA 3LSJA 3ZQFA 2D6YA 1JUMA 3SFIA 3C2BA 3BQZA 2HYJA 2EH3A 3BR2A 3NXCA 3RD3A 4B1RA 2ID6A 2GENA 3WHCA 3LJLA 2RHAA 5IP6A 4UDSA 3IH4A 5HAWA 3P9TA 5C4YA 3G56A 5FKNA 2QTQA 4GFKA 1JUSA 5F0CA 2Q24A 3KNWA 1Z77A 5DAJA 5K58A
chains in the Genus database with same CATH superfamily
5K7FA 2XGDA 3O8HA 3DCFA 2QIBA 2DG8A 3VOXA 3VVZA 5J1UA 3Q3SA 3ZQHA 3F1BA 5F27A 3WHBA 5F08A 3VTIA 2QWTA 4JNNA 4IRVA 5IPAA 3ZQLA 1SGMA 5EFYA 4C2MA 2OF7A 3GZIA 2UXIA 3GEUA 2X6OA 4JL3A 2NX4A 2O7TA 3JSJA 2NP5A 5D1RA 4V2GA 5K7HA 3B6AA 2XDNA 2REKA 3T6NA 3COLA 5J3LA 3B81A 4NN1A 5F0FA 5IOYA 3NI7A 3ANPA 4JYKA 2ZOYA 2R7SA 2YVEA 3AQSA 5F04A 3V78A 3IH3A 2ZCNA 1RKWA 2ZB9A 1A6IA 4DVYP 3DU5A 2B1EA 2OI8A 5CQGA 4W97A 5FKKA 3NS4A 4M3EA 4OD5A 3CJDA 3F0CA 2XRLA 5F1JA 2XPVA 3B6CA 3BTLA 4PXIA 4MXMA 3FIWA 5J1YA 3K8PC 4AUXA 4D7MA 2R7WA 4ACIA 3VW2A 3PM1A 5FHPA 3BTJA 2DG7A 5D19A 4M3BA 2NS8A 2V57A 2FX0A 2IAIA 3TP0A 3BNIA 2HXIA 3PASA 3VIBA 3BR1A 1Z0XA 4I76A 5K7ZA 2QKOA 3BR3A 3ZQGA 3BR5A 1JTXA 5CXGA 3BJBA 5IOZA 4W1UA 3HE0A 4M3GA 3AQTA 3LWJA 3ON4A 2ZY9A 5EZHA 4GCKA 3BCGA 3VVXA 4GCTA 4D7NA 1T33A 3BT9A 3KYLA 5AQCA 3Q0WA 3NPIA 3LHQA 1JT0A 4DW6A 2ZCMA 2UXPA 3ON2A 2VKVA 3IUVA 4GFLA 1RPWA 3QBMA 4OD4A 2DTZA 1ORKA 3G1OA 2XGCA 4ABZA 4CGRA 3O60A 2GBYA 1RKTA 3BRUA 2VKEA 3SDGA 2ZOZA 4HKUA 3NNRA 3QPSA 5CW8A 3BQYA 4D5FA 2R7OA 3LSRA 1BJZA 3C07A 3HTHA 2B3WA 2HQ5A 2O7OA 3PPBA 3QPLA 2WV1A 1T56A 3SWHA 2Y31A 4ME9A 5H9TA 2G3BA 4X1EA 1ZKGA 3VP5A 3VW0A 3CCYA 2W53A 5GPAA 3BR6A 2Y2ZA 3BTIA 5HBUA 3LOCA 1ZK8A 3FK6A 2XB5A 2UXHA 3E7QA 2UXUA 2JJ7A 2IU5A 3ANGA 2JK3A 3DEWA 5J1RA 3VUQA 2QOPA 5EYRA 1U9NA 4G12A 2VPRA 5FKOA 4MK6A 2WUIA 1JT6A 4MO7A 1QPIA 4KWAA 3MNLA 5CXIA 3VW1A 2R7QA 2PZ9A 1U9OA 3HTIA 2RAEA 4AC6A 5FKMA 2UXOA 3S5RA 5GPCA 2HYTA 2FQ4A 4V2FA 4GCLA 5F0HA 2ZCXA 3CRJA 2HXOA 4AC0A 2R7TA 3CDLA 3Q0VA 2XGEA 5EZGA 3BHQA 2R7UA 2ID3A 3CWRA 4U9LA 3BTCA 3QQAA 4M3FA 4M3DA 5FKLA 4NELA 2RASA 4JKZA 3Q0UA 3VOKA 2FBQA 2QCOA 5HSZA 4D5CA 3HTJA 4XK4A 5FGLA 3EUPA 2OPTA 3ZQIA 3O8GA 2G7SA 2GUHA 5FMPA 2X9DA 3EGQA 3G7RA 3QKXA 2XPUA 3V6GA 2XPWA 4U9NA 2R7RA 4WIBA 2GFNA 5GP9A 5D18A 1QVUA 2OERA 1JUPA 3RH2A 3DPJA 2IBDA 3HTAA 3G1MA 3G1LA 3FRQA 3HIMA 4L62A 3MVPA 1QVTA 3LSPA 2G7LA 1JTYA 2F07A 2A2FX 2NS7A 3BR0A 1UI5A 2TCTA 2HKUA 3FHNA 3IH2A 3FK7A 3NRGA 2TRTA 4YZEA 3HGYA 4AF5A 2R7VA 2WGBA 2YVHA 1VI0A 4B3AA 2FD5A 3TP3A 2IEKA 3KZ9A 2G7GA 4ICHA 2Y30A 3KKCA 2FJI1 3VPRA 1UI6A 2I10A 2NP3A 2R7XA 2FJ1A 4I6ZA 3VVYA 3KKDA 3HGGA 2G0EA 2PBXA 3LSJA 3ZQFA 2PFVA 2D6YA 1JUMA 3SFIA 3C2BA 3BQZA 2HYJA 2EH3A 3BR2A 3NXCA 3RD3A 4B1RA 2ID6A 2GENA 3WHCA 3LJLA 2YVXA 2RHAA 5IP6A 4UDSA 3IH4A 5HAWA 3DU6A 3P9TA 5C4YA 3G56A 5FKNA 2QTQA 4GFKA 1JUSA 5F0CA 2Q24A 3KNWA 1Z77A 5DAJA 5K58A
chains in the Genus database with same CATH topology
5K7FA 2XGDA 3O8HA 3DCFA 2QIBA 2DG8A 3VOXA 3VVZA 5J1UA 3Q3SA 3ZQHA 3F1BA 5F27A 3WHBA 5F08A 2QWTA 4JNNA 5IPAA 3ZQLA 1SGMA 5EFYA 2OF7A 3GZIA 2UXIA 3GEUA 2X6OA 4JL3A 2NX4A 2O7TA 3JSJA 2NP5A 5D1RA 4V2GA 5K7HA 3B6AA 2XDNA 2REKA 3T6NA 3COLA 5J3LA 3B81A 4NN1A 5F0FA 5IOYA 3NI7A 3ANPA 4JYKA 2ZOYA 2YVEA 3AQSA 5F04A 3V78A 3IH3A 2ZCNA 1RKWA 2ZB9A 1A6IA 2OI8A 4W97A 5FKKA 4M3EA 3CJDA 3F0CA 2XRLA 5F1JA 2XPVA 3B6CA 3BTLA 4PXIA 4MXMA 3FIWA 5J1YA 4AUXA 4D7MA 4ACIA 3VW2A 3PM1A 5FHPA 3BTJA 2DG7A 5D19A 4M3BA 2NS8A 2V57A 2FX0A 2IAIA 3TP0A 3BNIA 2HXIA 3PASA 3VIBA 3BR1A 1Z0XA 4I76A 5K7ZA 2QKOA 3BR3A 3ZQGA 3BR5A 1JTXA 5CXGA 3BJBA 5IOZA 4W1UA 3HE0A 4M3GA 3AQTA 3LWJA 3ON4A 5EZHA 4GCKA 3BCGA 3VVXA 4GCTA 4D7NA 1T33A 3BT9A 5AQCA 3Q0WA 3NPIA 3LHQA 1JT0A 4DW6A 2ZCMA 2UXPA 3ON2A 2VKVA 3IUVA 4GFLA 1RPWA 3QBMA 2DTZA 1ORKA 3G1OA 2XGCA 4ABZA 4CGRA 3O60A 2GBYA 1RKTA 3BRUA 2VKEA 3SDGA 2ZOZA 4HKUA 3NNRA 3QPSA 5CW8A 3BQYA 4D5FA 3LSRA 1BJZA 3C07A 3HTHA 2HQ5A 2O7OA 3PPBA 3QPLA 2WV1A 1T56A 2Y31A 5H9TA 4ME9A 2G3BA 4X1EA 1ZKGA 3VP5A 3VW0A 3CCYA 2W53A 5GPAA 3BR6A 2Y2ZA 3BTIA 5HBUA 3LOCA 1ZK8A 3FK6A 2XB5A 2UXHA 3E7QA 2UXUA 2JJ7A 2IU5A 3ANGA 2JK3A 3DEWA 5J1RA 3VUQA 2QOPA 5EYRA 1U9NA 4G12A 2VPRA 5FKOA 4MK6A 2WUIA 1JT6A 4MO7A 1QPIA 4KWAA 3MNLA 5CXIA 3VW1A 2PZ9A 1U9OA 3HTIA 2RAEA 4AC6A 5FKMA 2UXOA 3S5RA 5GPCA 2HYTA 2FQ4A 4V2FA 4GCLA 5F0HA 2ZCXA 3CRJA 2HXOA 4AC0A 3CDLA 3Q0VA 2XGEA 5EZGA 3BHQA 2ID3A 3CWRA 3BTCA 3QQAA 4M3FA 4M3DA 5FKLA 4NELA 2RASA 4JKZA 3Q0UA 3VOKA 2FBQA 2QCOA 5HSZA 4D5CA 3HTJA 4XK4A 5FGLA 3EUPA 2OPTA 3ZQIA 3O8GA 2G7SA 2GUHA 5FMPA 2X9DA 3EGQA 3G7RA 3QKXA 2XPUA 3V6GA 2XPWA 2GFNA 5GP9A 5D18A 1QVUA 2OERA 1JUPA 3RH2A 3DPJA 2IBDA 3HTAA 3G1MA 3G1LA 3FRQA 3HIMA 4L62A 3MVPA 1QVTA 3LSPA 2G7LA 1JTYA 2F07A 2NS7A 3BR0A 1UI5A 2TCTA 2HKUA 3IH2A 3FK7A 3NRGA 2TRTA 4YZEA 3HGYA 4AF5A 2WGBA 2YVHA 1VI0A 4B3AA 2FD5A 3TP3A 2IEKA 3KZ9A 2G7GA 4ICHA 2Y30A 3KKCA 3VPRA 1UI6A 2I10A 2NP3A 2FJ1A 4I6ZA 3VVYA 3KKDA 3HGGA 2G0EA 2PBXA 3LSJA 3ZQFA 2D6YA 1JUMA 3SFIA 3C2BA 3BQZA 2HYJA 2EH3A 3BR2A 3NXCA 3RD3A 4B1RA 2ID6A 2GENA 3WHCA 3LJLA 2RHAA 5IP6A 4UDSA 3IH4A 5HAWA 3P9TA 5C4YA 3G56A 5FKNA 2QTQA 4GFKA 1JUSA 5F0CA 2Q24A 3KNWA 1Z77A 5DAJA 5K58A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5K7F A;  2XGD A;  3O8H A;  3DCF A;  2QIB A;  2DG8 A;  3VOX A;  3VVZ A;  5J1U A;  3Q3S A;  3ZQH A;  3F1B A;  5F27 A;  3WHB A;  5F08 A;  2QWT A;  4JNN A;  5IPA A;  3ZQL A;  1SGM A;  5EFY A;  2OF7 A;  3GZI A;  2UXI A;  3GEU A;  2X6O A;  4JL3 A;  2NX4 A;  2O7T A;  3JSJ A;  2NP5 A;  5D1R A;  4V2G A;  5K7H A;  3B6A A;  2XDN A;  2REK A;  3T6N A;  3COL A;  5J3L A;  3B81 A;  4NN1 A;  5F0F A;  5IOY A;  3NI7 A;  3ANP A;  4JYK A;  2ZOY A;  2YVE A;  3AQS A;  5F04 A;  3V78 A;  3IH3 A;  2ZCN A;  1RKW A;  2ZB9 A;  1A6I A;  2OI8 A;  4W97 A;  5FKK A;  4M3E A;  3CJD A;  3F0C A;  2XRL A;  5F1J A;  2XPV A;  3B6C A;  3BTL A;  4PXI A;  4MXM A;  3FIW A;  5J1Y A;  4AUX A;  4D7M A;  4ACI A;  3VW2 A;  3PM1 A;  5FHP A;  3BTJ A;  2DG7 A;  5D19 A;  4M3B A;  2NS8 A;  2V57 A;  2FX0 A;  2IAI A;  3TP0 A;  3BNI A;  2HXI A;  3PAS A;  3VIB A;  3BR1 A;  1Z0X A;  4I76 A;  5K7Z A;  2QKO A;  3BR3 A;  3ZQG A;  3BR5 A;  1JTX A;  5CXG A;  3BJB A;  5IOZ A;  4W1U A;  3HE0 A;  4M3G A;  3AQT A;  3LWJ A;  3ON4 A;  5EZH A;  4GCK A;  3BCG A;  3VVX A;  4GCT A;  4D7N A;  1T33 A;  3BT9 A;  5AQC A;  3Q0W A;  3NPI A;  3LHQ A;  1JT0 A;  4DW6 A;  2ZCM A;  2UXP A;  3ON2 A;  2VKV A;  3IUV A;  4GFL A;  1RPW A;  3QBM A;  2DTZ A;  1ORK A;  3G1O A;  2XGC A;  4ABZ A;  4CGR A;  3O60 A;  2GBY A;  1RKT A;  3BRU A;  2VKE A;  3SDG A;  2ZOZ A;  4HKU A;  3NNR A;  3QPS A;  5CW8 A;  3BQY A;  4D5F A;  3LSR A;  1BJZ A;  3C07 A;  3HTH A;  2HQ5 A;  2O7O A;  3PPB A;  3QPL A;  2WV1 A;  1T56 A;  2Y31 A;  5H9T A;  4ME9 A;  2G3B A;  4X1E A;  1ZKG A;  3VP5 A;  3VW0 A;  3CCY A;  2W53 A;  5GPA A;  3BR6 A;  2Y2Z A;  3BTI A;  5HBU A;  3LOC A;  1ZK8 A;  3FK6 A;  2XB5 A;  2UXH A;  3E7Q A;  2UXU A;  2JJ7 A;  2IU5 A;  3ANG A;  2JK3 A;  3DEW A;  5J1R A;  3VUQ A;  2QOP A;  5EYR A;  1U9N A;  4G12 A;  2VPR A;  5FKO A;  4MK6 A;  2WUI A;  1JT6 A;  4MO7 A;  1QPI A;  4KWA A;  3MNL A;  5CXI A;  3VW1 A;  2PZ9 A;  1U9O A;  3HTI A;  2RAE A;  4AC6 A;  5FKM A;  2UXO A;  3S5R A;  5GPC A;  2HYT A;  2FQ4 A;  4V2F A;  4GCL A;  5F0H A;  2ZCX A;  3CRJ A;  2HXO A;  4AC0 A;  3CDL A;  3Q0V A;  2XGE A;  5EZG A;  3BHQ A;  2ID3 A;  3CWR A;  3BTC A;  3QQA A;  4M3F A;  4M3D A;  5FKL A;  4NEL A;  2RAS A;  4JKZ A;  3Q0U A;  3VOK A;  2FBQ A;  2QCO A;  5HSZ A;  4D5C A;  3HTJ A;  4XK4 A;  5FGL A;  3EUP A;  2OPT A;  3ZQI A;  3O8G A;  2G7S A;  2GUH A;  5FMP A;  2X9D A;  3EGQ A;  3G7R A;  3QKX A;  2XPU A;  3V6G A;  2XPW A;  2GFN A;  5GP9 A;  5D18 A;  1QVU A;  2OER A;  1JUP A;  3RH2 A;  3DPJ A;  2IBD A;  3HTA A;  3G1M A;  3G1L A;  3FRQ A;  3HIM A;  4L62 A;  3MVP A;  1QVT A;  3LSP A;  2G7L A;  1JTY A;  2F07 A;  2NS7 A;  3BR0 A;  1UI5 A;  2TCT A;  2HKU A;  3IH2 A;  3FK7 A;  3NRG A;  2TRT A;  4YZE A;  3HGY A;  4AF5 A;  2WGB A;  2YVH A;  1VI0 A;  4B3A A;  2FD5 A;  3TP3 A;  2IEK A;  3KZ9 A;  2G7G A;  4ICH A;  2Y30 A;  3KKC A;  3VPR A;  1UI6 A;  2I10 A;  2NP3 A;  2FJ1 A;  4I6Z A;  3VVY A;  3KKD A;  3HGG A;  2G0E A;  2PBX A;  3LSJ A;  3ZQF A;  2D6Y A;  1JUM A;  3SFI A;  3C2B A;  3BQZ A;  2HYJ A;  2EH3 A;  3BR2 A;  3NXC A;  3RD3 A;  4B1R A;  2ID6 A;  2GEN A;  3WHC A;  3LJL A;  2RHA A;  5IP6 A;  4UDS A;  3IH4 A;  5HAW A;  3P9T A;  5C4Y A;  3G56 A;  5FKN A;  2QTQ A;  4GFK A;  1JUS A;  5F0C A;  2Q24 A;  3KNW A;  1Z77 A;  5DAJ A;  5K58 A; 
#chains in the Genus database with same CATH topology
 5K7F A;  2XGD A;  3O8H A;  3DCF A;  2QIB A;  2DG8 A;  3VOX A;  3VVZ A;  5J1U A;  3Q3S A;  3ZQH A;  3F1B A;  5F27 A;  3WHB A;  5F08 A;  3VTI A;  2QWT A;  4JNN A;  4IRV A;  5IPA A;  3ZQL A;  1SGM A;  5EFY A;  4C2M A;  2OF7 A;  3GZI A;  2UXI A;  3GEU A;  2X6O A;  4JL3 A;  2NX4 A;  2O7T A;  3JSJ A;  2NP5 A;  5D1R A;  4V2G A;  5K7H A;  3B6A A;  2XDN A;  2REK A;  3T6N A;  3COL A;  5J3L A;  3B81 A;  4NN1 A;  5F0F A;  5IOY A;  3NI7 A;  3ANP A;  4JYK A;  2ZOY A;  2R7S A;  2YVE A;  3AQS A;  5F04 A;  3V78 A;  3IH3 A;  2ZCN A;  1RKW A;  2ZB9 A;  1A6I A;  4DVY P;  3DU5 A;  2B1E A;  2OI8 A;  5CQG A;  4W97 A;  5FKK A;  3NS4 A;  4M3E A;  4OD5 A;  3CJD A;  3F0C A;  2XRL A;  5F1J A;  2XPV A;  3B6C A;  3BTL A;  4PXI A;  4MXM A;  3FIW A;  5J1Y A;  3K8P C;  4AUX A;  4D7M A;  2R7W A;  4ACI A;  3VW2 A;  3PM1 A;  5FHP A;  3BTJ A;  2DG7 A;  5D19 A;  4M3B A;  2NS8 A;  2V57 A;  2FX0 A;  2IAI A;  3TP0 A;  3BNI A;  2HXI A;  3PAS A;  3VIB A;  3BR1 A;  1Z0X A;  4I76 A;  5K7Z A;  2QKO A;  3BR3 A;  3ZQG A;  3BR5 A;  1JTX A;  5CXG A;  3BJB A;  5IOZ A;  4W1U A;  3HE0 A;  4M3G A;  3AQT A;  3LWJ A;  3ON4 A;  2ZY9 A;  5EZH A;  4GCK A;  3BCG A;  3VVX A;  4GCT A;  4D7N A;  1T33 A;  3BT9 A;  3KYL A;  5AQC A;  3Q0W A;  3NPI A;  3LHQ A;  1JT0 A;  4DW6 A;  2ZCM A;  2UXP A;  3ON2 A;  2VKV A;  3IUV A;  4GFL A;  1RPW A;  3QBM A;  4OD4 A;  2DTZ A;  1ORK A;  3G1O A;  2XGC A;  4ABZ A;  4CGR A;  3O60 A;  2GBY A;  1RKT A;  3BRU A;  2VKE A;  3SDG A;  2ZOZ A;  4HKU A;  3NNR A;  3QPS A;  5CW8 A;  3BQY A;  4D5F A;  2R7O A;  3LSR A;  1BJZ A;  3C07 A;  3HTH A;  2B3W A;  2HQ5 A;  2O7O A;  3PPB A;  3QPL A;  2WV1 A;  1T56 A;  3SWH A;  2Y31 A;  4ME9 A;  5H9T A;  2G3B A;  4X1E A;  1ZKG A;  3VP5 A;  3VW0 A;  3CCY A;  2W53 A;  5GPA A;  3BR6 A;  2Y2Z A;  3BTI A;  5HBU A;  3LOC A;  1ZK8 A;  3FK6 A;  2XB5 A;  2UXH A;  3E7Q A;  2UXU A;  2JJ7 A;  2IU5 A;  3ANG A;  2JK3 A;  3DEW A;  5J1R A;  3VUQ A;  2QOP A;  5EYR A;  1U9N A;  4G12 A;  2VPR A;  5FKO A;  4MK6 A;  2WUI A;  1JT6 A;  4MO7 A;  1QPI A;  4KWA A;  3MNL A;  5CXI A;  3VW1 A;  2R7Q A;  2PZ9 A;  1U9O A;  3HTI A;  2RAE A;  4AC6 A;  5FKM A;  2UXO A;  3S5R A;  5GPC A;  2HYT A;  2FQ4 A;  4V2F A;  4GCL A;  5F0H A;  2ZCX A;  3CRJ A;  2HXO A;  4AC0 A;  2R7T A;  3CDL A;  3Q0V A;  2XGE A;  5EZG A;  3BHQ A;  2R7U A;  2ID3 A;  3CWR A;  4U9L A;  3BTC A;  3QQA A;  4M3F A;  4M3D A;  5FKL A;  4NEL A;  2RAS A;  4JKZ A;  3Q0U A;  3VOK A;  2FBQ A;  2QCO A;  5HSZ A;  4D5C A;  3HTJ A;  4XK4 A;  5FGL A;  3EUP A;  2OPT A;  3ZQI A;  3O8G A;  2G7S A;  2GUH A;  5FMP A;  2X9D A;  3EGQ A;  3G7R A;  3QKX A;  2XPU A;  3V6G A;  2XPW A;  4U9N A;  2R7R A;  4WIB A;  2GFN A;  5GP9 A;  5D18 A;  1QVU A;  2OER A;  1JUP A;  3RH2 A;  3DPJ A;  2IBD A;  3HTA A;  3G1M A;  3G1L A;  3FRQ A;  3HIM A;  4L62 A;  3MVP A;  1QVT A;  3LSP A;  2G7L A;  1JTY A;  2F07 A;  2A2F X;  2NS7 A;  3BR0 A;  1UI5 A;  2TCT A;  2HKU A;  3FHN A;  3IH2 A;  3FK7 A;  3NRG A;  2TRT A;  4YZE A;  3HGY A;  4AF5 A;  2R7V A;  2WGB A;  2YVH A;  1VI0 A;  4B3A A;  2FD5 A;  3TP3 A;  2IEK A;  3KZ9 A;  2G7G A;  4ICH A;  2Y30 A;  3KKC A;  2FJI 1;  3VPR A;  1UI6 A;  2I10 A;  2NP3 A;  2R7X A;  2FJ1 A;  4I6Z A;  3VVY A;  3KKD A;  3HGG A;  2G0E A;  2PBX A;  3LSJ A;  3ZQF A;  2PFV A;  2D6Y A;  1JUM A;  3SFI A;  3C2B A;  3BQZ A;  2HYJ A;  2EH3 A;  3BR2 A;  3NXC A;  3RD3 A;  4B1R A;  2ID6 A;  2GEN A;  3WHC A;  3LJL A;  2YVX A;  2RHA A;  5IP6 A;  4UDS A;  3IH4 A;  5HAW A;  3DU6 A;  3P9T A;  5C4Y A;  3G56 A;  5FKN A;  2QTQ A;  4GFK A;  1JUS A;  5F0C A;  2Q24 A;  3KNW A;  1Z77 A;  5DAJ A;  5K58 A; 
#chains in the Genus database with same CATH homology
 5K7F A;  2XGD A;  3O8H A;  3DCF A;  2QIB A;  2DG8 A;  3VOX A;  3VVZ A;  5J1U A;  3Q3S A;  3ZQH A;  3F1B A;  5F27 A;  3WHB A;  5F08 A;  2QWT A;  4JNN A;  5IPA A;  3ZQL A;  1SGM A;  5EFY A;  2OF7 A;  3GZI A;  2UXI A;  3GEU A;  2X6O A;  4JL3 A;  2NX4 A;  2O7T A;  3JSJ A;  2NP5 A;  5D1R A;  4V2G A;  5K7H A;  3B6A A;  2XDN A;  2REK A;  3T6N A;  3COL A;  5J3L A;  3B81 A;  4NN1 A;  5F0F A;  5IOY A;  3NI7 A;  3ANP A;  4JYK A;  2ZOY A;  2YVE A;  3AQS A;  5F04 A;  3V78 A;  3IH3 A;  2ZCN A;  1RKW A;  2ZB9 A;  1A6I A;  2OI8 A;  4W97 A;  5FKK A;  4M3E A;  3CJD A;  3F0C A;  2XRL A;  5F1J A;  2XPV A;  3B6C A;  3BTL A;  4PXI A;  4MXM A;  3FIW A;  5J1Y A;  4AUX A;  4D7M A;  4ACI A;  3VW2 A;  3PM1 A;  5FHP A;  3BTJ A;  2DG7 A;  5D19 A;  4M3B A;  2NS8 A;  2V57 A;  2FX0 A;  2IAI A;  3TP0 A;  3BNI A;  2HXI A;  3PAS A;  3VIB A;  3BR1 A;  1Z0X A;  4I76 A;  5K7Z A;  2QKO A;  3BR3 A;  3ZQG A;  3BR5 A;  1JTX A;  5CXG A;  3BJB A;  5IOZ A;  4W1U A;  3HE0 A;  4M3G A;  3AQT A;  3LWJ A;  3ON4 A;  5EZH A;  4GCK A;  3BCG A;  3VVX A;  4GCT A;  4D7N A;  1T33 A;  3BT9 A;  5AQC A;  3Q0W A;  3NPI A;  3LHQ A;  1JT0 A;  4DW6 A;  2ZCM A;  2UXP A;  3ON2 A;  2VKV A;  3IUV A;  4GFL A;  1RPW A;  3QBM A;  2DTZ A;  1ORK A;  3G1O A;  2XGC A;  4ABZ A;  4CGR A;  3O60 A;  2GBY A;  1RKT A;  3BRU A;  2VKE A;  3SDG A;  2ZOZ A;  4HKU A;  3NNR A;  3QPS A;  5CW8 A;  3BQY A;  4D5F A;  3LSR A;  1BJZ A;  3C07 A;  3HTH A;  2HQ5 A;  2O7O A;  3PPB A;  3QPL A;  2WV1 A;  1T56 A;  2Y31 A;  5H9T A;  4ME9 A;  2G3B A;  4X1E A;  1ZKG A;  3VP5 A;  3VW0 A;  3CCY A;  2W53 A;  5GPA A;  3BR6 A;  2Y2Z A;  3BTI A;  5HBU A;  3LOC A;  1ZK8 A;  3FK6 A;  2XB5 A;  2UXH A;  3E7Q A;  2UXU A;  2JJ7 A;  2IU5 A;  3ANG A;  2JK3 A;  3DEW A;  5J1R A;  3VUQ A;  2QOP A;  5EYR A;  1U9N A;  4G12 A;  2VPR A;  5FKO A;  4MK6 A;  2WUI A;  1JT6 A;  4MO7 A;  1QPI A;  4KWA A;  3MNL A;  5CXI A;  3VW1 A;  2PZ9 A;  1U9O A;  3HTI A;  2RAE A;  4AC6 A;  5FKM A;  2UXO A;  3S5R A;  5GPC A;  2HYT A;  2FQ4 A;  4V2F A;  4GCL A;  5F0H A;  2ZCX A;  3CRJ A;  2HXO A;  4AC0 A;  3CDL A;  3Q0V A;  2XGE A;  5EZG A;  3BHQ A;  2ID3 A;  3CWR A;  3BTC A;  3QQA A;  4M3F A;  4M3D A;  5FKL A;  4NEL A;  2RAS A;  4JKZ A;  3Q0U A;  3VOK A;  2FBQ A;  2QCO A;  5HSZ A;  4D5C A;  3HTJ A;  4XK4 A;  5FGL A;  3EUP A;  2OPT A;  3ZQI A;  3O8G A;  2G7S A;  2GUH A;  5FMP A;  2X9D A;  3EGQ A;  3G7R A;  3QKX A;  2XPU A;  3V6G A;  2XPW A;  2GFN A;  5GP9 A;  5D18 A;  1QVU A;  2OER A;  1JUP A;  3RH2 A;  3DPJ A;  2IBD A;  3HTA A;  3G1M A;  3G1L A;  3FRQ A;  3HIM A;  4L62 A;  3MVP A;  1QVT A;  3LSP A;  2G7L A;  1JTY A;  2F07 A;  2NS7 A;  3BR0 A;  1UI5 A;  2TCT A;  2HKU A;  3IH2 A;  3FK7 A;  3NRG A;  2TRT A;  4YZE A;  3HGY A;  4AF5 A;  2WGB A;  2YVH A;  1VI0 A;  4B3A A;  2FD5 A;  3TP3 A;  2IEK A;  3KZ9 A;  2G7G A;  4ICH A;  2Y30 A;  3KKC A;  3VPR A;  1UI6 A;  2I10 A;  2NP3 A;  2FJ1 A;  4I6Z A;  3VVY A;  3KKD A;  3HGG A;  2G0E A;  2PBX A;  3LSJ A;  3ZQF A;  2D6Y A;  1JUM A;  3SFI A;  3C2B A;  3BQZ A;  2HYJ A;  2EH3 A;  3BR2 A;  3NXC A;  3RD3 A;  4B1R A;  2ID6 A;  2GEN A;  3WHC A;  3LJL A;  2RHA A;  5IP6 A;  4UDS A;  3IH4 A;  5HAW A;  3P9T A;  5C4Y A;  3G56 A;  5FKN A;  2QTQ A;  4GFK A;  1JUS A;  5F0C A;  2Q24 A;  3KNW A;  1Z77 A;  5DAJ A;  5K58 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...