4JL3A

Crystal structure of ms6564-dna complex
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
179
structure length
179
Chain Sequence
SEKSRVAIVEATRALLLERGFDGLSIEAVAAKAGVGKQTIYRWWPSRHALVADVLLEDADKILARMPKTDDVTADLASWAGTLAAALTTRRGHAMLKTLMAASLEHEDTAARLREGFSRPLIESVRDRLRDEDIDADHAQAAADALLGAVVNAVLSEGRSYSRQRAETSARIIVAGLRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, TetR family
publication title Structural basis for interaction between M. smegmatis Ms6564, a TetR family master regulator, and its target DNA.
rcsb
source organism Mycobacterium smegmatis
molecule tags Transcription/dna
total genus 62
structure length 179
sequence length 179
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF16859 TetR_C_11 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 4jl3A00
3VW0A 3BNIA 3LWJA 3IH3A 2UXOA 3Q0UA 3HTHA 2QWTA 5EYRA 3TP0A 2XRLA 4GCKA 4PXIA 5AQCA 4ACIA 3B6AA 5IP6A 2OERA 2WUIA 2XPWA 3ZQLA 4G12A 4V2GA 5D19A 2ZB9A 2Q24A 3LSRA 3BR5A 1U9NA 2OF7A 2ZOZA 3QKXA 3HIMA 1QVUA 2UXHA 2UXPA 3HTJA 3VW2A 3LJLA 3PM1A 2WV1A 3BR0A 4GFKA 2XPUA 4MO7A 4NELA 2RAEA 4YZEA 4X1EA 3BTCA 3SFIA 1RKTA 2QOPA 5HSZA 3VVYA 4JKZA 3BR1A 5D18A 3BR3A 3FIWA 4AC6A 3QPLA 3FK6A 2RASA 3HTIA 5EZHA 3MVPA 3Q0VA 2HYTA 2ZCNA 2X6OA 2V57A 3CRJA 5HAWA 2F07A 5FKLA 2X9DA 2IBDA 5K7HA 2VKEA 4I76A 4ABZA 3ZQGA 3GEUA 3LHQA 4D7MA 5FKMA 2I10A 5J1RA 4ICHA 2NS8A 5GPCA 3C2BA 2D6YA 5F0FA 3G56A 3HGGA 5H9TA 2O7OA 2GENA 4JL3A 4AF5A 3G1LA 3LOCA 4NN1A 4MXMA 1RPWA 4JYKA 2GUHA 2HKUA 5EFYA 2VPRA 1ORKA 3V78A 4JNNA 4I6ZA 2ID3A 3BQYA 3NXCA 3O8HA 1BJZA 2IAIA 4AUXA 3ZQIA 3BRUA 3IH4A 2PZ9A 3SDGA 2HXIA 1QVTA 3DCFA 4AC0A 3V6GA 5IOYA 2ZOYA 2FBQA 3VW1A 3VOKA 1Z77A 5J1YA 5J1UA 5HBUA 4UDSA 2GFNA 2DG8A 3G1OA 4D5FA 2FJ1A 2HQ5A 3F1BA 1UI5A 3T6NA 3EGQA 3HTAA 4D7NA 5F0HA 2QTQA 4D5CA 4L62A 2RHAA 5FKOA 1Z0XA 1JUPA 2JJ7A 5IOZA 2XDNA 3QQAA 5D1RA 1JT6A 3B81A 3BQZA 3PASA 5FHPA 3KKDA 2G7SA 5F27A 5K7ZA 3IH2A 3MNLA 5CXGA 3VPRA 4MK6A 3AQSA 3DEWA 2O7TA 3VVXA 3E7QA 1T56A 2Y31A 3B6CA 4HKUA 5FGLA 2HXOA 1U9OA 4XK4A 1JT0A 3CDLA 2Y2ZA 2ZCMA 5CW8A 3HGYA 3VVZA 3BTLA 3CWRA 3RH2A 3BHQA 4M3EA 5K58A 3GZIA 2OI8A 5GP9A 3KZ9A 2FQ4A 3LSJA 3BCGA 3WHCA 3ZQHA 2G7GA 2TRTA 3PPBA 4GCLA 1JUSA 2TCTA 3RD3A 3VOXA 1JTXA 2G7LA 4W1UA 3S5RA 2DG7A 3BTJA 2ID6A 4M3GA 3HE0A 4GCTA 3QBMA 2UXUA 2NP5A 2PBXA 3Q3SA 3LSPA 3VIBA 3NI7A 4B1RA 2QKOA 3BTIA 2DTZA 3CCYA 5FMPA 3F0CA 3QPSA 2WGBA 5F1JA 3IUVA 1A6IA 3WHBA 2GBYA 2UXIA 5C4YA 3BR6A 3G7RA 4M3BA 4DW6A 3ON4A 4CGRA 2JK3A 3BJBA 2G3BA 3NRGA 5J3LA 1QPIA 3P9TA 3VUQA 3G1MA 3CJDA 2NX4A 2REKA 1UI6A 2FX0A 2XPVA 4GFLA 1SGMA 1T33A 2XGCA 3KNWA 4ME9A 5EZGA 2YVEA 5F04A 3NNRA 5GPAA 2FD5A 2IU5A 3C07A 3Q0WA 2QIBA 2NP3A 2VKVA 4B3AA 4M3DA 5F08A 2XB5A 3ANGA 4W97A 2XGDA 5FKNA 3FK7A 3KKCA 5F0CA 3O8GA 3COLA 3AQTA 1JUMA 2W53A 5CXIA 2G0EA 3BT9A 2QCOA 5IPAA 4M3FA 3BR2A 5FKKA 2HYJA 1ZKGA 1ZK8A 4V2FA 2YVHA 2NS7A 3FRQA 5K7FA 3NPIA 5DAJA 3ANPA 3ON2A 3DPJA 2IEKA 2EH3A 4KWAA 1JTYA 3JSJA 1RKWA 3ZQFA 2OPTA 3O60A 2XGEA 3TP3A 1VI0A 3VP5A 3EUPA 2ZCXA 2Y30A
chains in the Genus database with same CATH superfamily
3VW0A 3BNIA 3LWJA 3IH3A 2UXOA 3Q0UA 2R7QA 3HTHA 2QWTA 5EYRA 3DU6A 3TP0A 2XRLA 4GCKA 4PXIA 4WIBA 5AQCA 4ACIA 3B6AA 5IP6A 2OERA 2WUIA 2XPWA 3ZQLA 4G12A 4V2GA 5D19A 2ZB9A 2Q24A 3LSRA 3BR5A 1U9NA 2OF7A 2ZOZA 2YVXA 3QKXA 3HIMA 1QVUA 2UXHA 2UXPA 3HTJA 3VW2A 3LJLA 3PM1A 5CQGA 2WV1A 3BR0A 4GFKA 2R7XA 2XPUA 4MO7A 4NELA 2RAEA 4YZEA 4X1EA 3BTCA 3SFIA 1RKTA 4DVYP 2QOPA 5HSZA 3VVYA 4JKZA 3BR1A 5D18A 3BR3A 3FIWA 4AC6A 3QPLA 3FK6A 2R7SA 2RASA 3HTIA 5EZHA 3MVPA 3Q0VA 2HYTA 2ZCNA 2X6OA 2V57A 3CRJA 5HAWA 2F07A 5FKLA 2X9DA 2IBDA 5K7HA 2VKEA 4I76A 4ABZA 3ZQGA 3GEUA 3LHQA 4D7MA 5FKMA 2I10A 5J1RA 4ICHA 2NS8A 5GPCA 3C2BA 2D6YA 5F0FA 3G56A 2ZY9A 4OD4A 3HGGA 5H9TA 2O7OA 2GENA 4JL3A 4AF5A 3G1LA 3LOCA 4NN1A 4MXMA 1RPWA 4JYKA 2GUHA 2HKUA 5EFYA 2VPRA 1ORKA 3V78A 3DU5A 4JNNA 4I6ZA 2ID3A 3BQYA 3NXCA 3O8HA 1BJZA 2IAIA 4AUXA 4OD5A 3ZQIA 3BRUA 3IH4A 2PZ9A 3SDGA 2HXIA 1QVTA 3DCFA 4AC0A 3V6GA 5IOYA 2ZOYA 2FBQA 3VW1A 2A2FX 3VOKA 3K8PC 1Z77A 5J1YA 5J1UA 5HBUA 4UDSA 2GFNA 2FJI1 2DG8A 3G1OA 4D5FA 2FJ1A 2HQ5A 3F1BA 1UI5A 3T6NA 3EGQA 3HTAA 2R7WA 4D7NA 2R7OA 5F0HA 2QTQA 2R7UA 4D5CA 4L62A 2RHAA 5FKOA 1Z0XA 1JUPA 2JJ7A 5IOZA 2XDNA 3QQAA 5D1RA 1JT6A 3B81A 3BQZA 3PASA 5FHPA 3KKDA 2G7SA 5F27A 5K7ZA 3IH2A 3MNLA 5CXGA 3VPRA 4MK6A 3AQSA 3DEWA 2O7TA 3VVXA 3E7QA 1T56A 2Y31A 3B6CA 4HKUA 5FGLA 2HXOA 1U9OA 4XK4A 1JT0A 3CDLA 2Y2ZA 2ZCMA 5CW8A 2B1EA 3HGYA 3VVZA 3BTLA 3CWRA 3RH2A 3BHQA 4M3EA 5K58A 3GZIA 2OI8A 3SWHA 2R7VA 5GP9A 3KZ9A 2FQ4A 3LSJA 3BCGA 3WHCA 3ZQHA 2G7GA 2TRTA 3PPBA 4GCLA 1JUSA 2TCTA 3RD3A 3VOXA 2R7TA 1JTXA 2G7LA 4W1UA 3S5RA 2DG7A 3BTJA 3KYLA 2ID6A 4M3GA 3HE0A 4GCTA 3QBMA 2UXUA 2NP5A 2PBXA 3Q3SA 3LSPA 3VIBA 3NI7A 4B1RA 2R7RA 2QKOA 3BTIA 2DTZA 3CCYA 5FMPA 3F0CA 3QPSA 2WGBA 5F1JA 3IUVA 1A6IA 3WHBA 2GBYA 2UXIA 5C4YA 3BR6A 4C2MA 3G7RA 4M3BA 4DW6A 3ON4A 4CGRA 2JK3A 3BJBA 2G3BA 3NRGA 3VTIA 5J3LA 1QPIA 3P9TA 3VUQA 3G1MA 3CJDA 2NX4A 2REKA 1UI6A 2FX0A 2XPVA 4GFLA 1SGMA 1T33A 2XGCA 3KNWA 4ME9A 5EZGA 2YVEA 5F04A 3NNRA 5GPAA 2FD5A 2IU5A 3C07A 3Q0WA 2QIBA 2NP3A 3NS4A 2VKVA 4B3AA 4M3DA 5F08A 2XB5A 3ANGA 4W97A 2XGDA 2B3WA 5FKNA 3FK7A 3KKCA 5F0CA 3O8GA 4U9LA 3COLA 3AQTA 1JUMA 2W53A 5CXIA 2G0EA 3BT9A 2QCOA 5IPAA 4M3FA 3BR2A 5FKKA 2HYJA 1ZKGA 1ZK8A 4V2FA 2YVHA 3FHNA 2NS7A 3FRQA 5K7FA 3NPIA 5DAJA 3ANPA 3ON2A 4IRVA 3DPJA 2IEKA 2EH3A 4KWAA 1JTYA 3JSJA 1RKWA 3ZQFA 2OPTA 3O60A 2XGEA 4U9NA 3TP3A 2PFVA 1VI0A 3VP5A 3EUPA 2ZCXA 2Y30A
chains in the Genus database with same CATH topology
3VW0A 3BNIA 3LWJA 3IH3A 2UXOA 3Q0UA 3HTHA 2QWTA 5EYRA 3TP0A 2XRLA 4GCKA 4PXIA 5AQCA 4ACIA 3B6AA 5IP6A 2OERA 2WUIA 2XPWA 3ZQLA 4G12A 4V2GA 5D19A 2ZB9A 2Q24A 3LSRA 3BR5A 1U9NA 2OF7A 2ZOZA 3QKXA 3HIMA 1QVUA 2UXHA 2UXPA 3HTJA 3VW2A 3LJLA 3PM1A 2WV1A 3BR0A 4GFKA 2XPUA 4MO7A 4NELA 2RAEA 4YZEA 4X1EA 3BTCA 3SFIA 1RKTA 2QOPA 5HSZA 3VVYA 4JKZA 3BR1A 5D18A 3BR3A 3FIWA 4AC6A 3QPLA 3FK6A 2RASA 3HTIA 5EZHA 3MVPA 3Q0VA 2HYTA 2ZCNA 2X6OA 2V57A 3CRJA 5HAWA 2F07A 5FKLA 2X9DA 2IBDA 5K7HA 2VKEA 4I76A 4ABZA 3ZQGA 3GEUA 3LHQA 4D7MA 5FKMA 2I10A 5J1RA 4ICHA 2NS8A 5GPCA 3C2BA 2D6YA 5F0FA 3G56A 3HGGA 5H9TA 2O7OA 2GENA 4JL3A 4AF5A 3G1LA 3LOCA 4NN1A 4MXMA 1RPWA 4JYKA 2GUHA 2HKUA 5EFYA 2VPRA 1ORKA 3V78A 4JNNA 4I6ZA 2ID3A 3BQYA 3NXCA 3O8HA 1BJZA 2IAIA 4AUXA 3ZQIA 3BRUA 3IH4A 2PZ9A 3SDGA 2HXIA 1QVTA 3DCFA 4AC0A 3V6GA 5IOYA 2ZOYA 2FBQA 3VW1A 3VOKA 1Z77A 5J1YA 5J1UA 5HBUA 4UDSA 2GFNA 2DG8A 3G1OA 4D5FA 2FJ1A 2HQ5A 3F1BA 1UI5A 3T6NA 3EGQA 3HTAA 4D7NA 5F0HA 2QTQA 4D5CA 4L62A 2RHAA 5FKOA 1Z0XA 1JUPA 2JJ7A 5IOZA 2XDNA 3QQAA 5D1RA 1JT6A 3B81A 3BQZA 3PASA 5FHPA 3KKDA 2G7SA 5F27A 5K7ZA 3IH2A 3MNLA 5CXGA 3VPRA 4MK6A 3AQSA 3DEWA 2O7TA 3VVXA 3E7QA 1T56A 2Y31A 3B6CA 4HKUA 5FGLA 2HXOA 1U9OA 4XK4A 1JT0A 3CDLA 2Y2ZA 2ZCMA 5CW8A 3HGYA 3VVZA 3BTLA 3CWRA 3RH2A 3BHQA 4M3EA 5K58A 3GZIA 2OI8A 5GP9A 3KZ9A 2FQ4A 3LSJA 3BCGA 3WHCA 3ZQHA 2G7GA 2TRTA 3PPBA 4GCLA 1JUSA 2TCTA 3RD3A 3VOXA 1JTXA 2G7LA 4W1UA 3S5RA 2DG7A 3BTJA 2ID6A 4M3GA 3HE0A 4GCTA 3QBMA 2UXUA 2NP5A 2PBXA 3Q3SA 3LSPA 3VIBA 3NI7A 4B1RA 2QKOA 3BTIA 2DTZA 3CCYA 5FMPA 3F0CA 3QPSA 2WGBA 5F1JA 3IUVA 1A6IA 3WHBA 2GBYA 2UXIA 5C4YA 3BR6A 3G7RA 4M3BA 4DW6A 3ON4A 4CGRA 2JK3A 3BJBA 2G3BA 3NRGA 5J3LA 1QPIA 3P9TA 3VUQA 3G1MA 3CJDA 2NX4A 2REKA 1UI6A 2FX0A 2XPVA 4GFLA 1SGMA 1T33A 2XGCA 3KNWA 4ME9A 5EZGA 2YVEA 5F04A 3NNRA 5GPAA 2FD5A 2IU5A 3C07A 3Q0WA 2QIBA 2NP3A 2VKVA 4B3AA 4M3DA 5F08A 2XB5A 3ANGA 4W97A 2XGDA 5FKNA 3FK7A 3KKCA 5F0CA 3O8GA 3COLA 3AQTA 1JUMA 2W53A 5CXIA 2G0EA 3BT9A 2QCOA 5IPAA 4M3FA 3BR2A 5FKKA 2HYJA 1ZKGA 1ZK8A 4V2FA 2YVHA 2NS7A 3FRQA 5K7FA 3NPIA 5DAJA 3ANPA 3ON2A 3DPJA 2IEKA 2EH3A 4KWAA 1JTYA 3JSJA 1RKWA 3ZQFA 2OPTA 3O60A 2XGEA 3TP3A 1VI0A 3VP5A 3EUPA 2ZCXA 2Y30A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VW0 A;  3BNI A;  3LWJ A;  3IH3 A;  2UXO A;  3Q0U A;  3HTH A;  2QWT A;  5EYR A;  3TP0 A;  2XRL A;  4GCK A;  4PXI A;  5AQC A;  4ACI A;  3B6A A;  5IP6 A;  2OER A;  2WUI A;  2XPW A;  3ZQL A;  4G12 A;  4V2G A;  5D19 A;  2ZB9 A;  2Q24 A;  3LSR A;  3BR5 A;  1U9N A;  2OF7 A;  2ZOZ A;  3QKX A;  3HIM A;  1QVU A;  2UXH A;  2UXP A;  3HTJ A;  3VW2 A;  3LJL A;  3PM1 A;  2WV1 A;  3BR0 A;  4GFK A;  2XPU A;  4MO7 A;  4NEL A;  2RAE A;  4YZE A;  4X1E A;  3BTC A;  3SFI A;  1RKT A;  2QOP A;  5HSZ A;  3VVY A;  4JKZ A;  3BR1 A;  5D18 A;  3BR3 A;  3FIW A;  4AC6 A;  3QPL A;  3FK6 A;  2RAS A;  3HTI A;  5EZH A;  3MVP A;  3Q0V A;  2HYT A;  2ZCN A;  2X6O A;  2V57 A;  3CRJ A;  5HAW A;  2F07 A;  5FKL A;  2X9D A;  2IBD A;  5K7H A;  2VKE A;  4I76 A;  4ABZ A;  3ZQG A;  3GEU A;  3LHQ A;  4D7M A;  5FKM A;  2I10 A;  5J1R A;  4ICH A;  2NS8 A;  5GPC A;  3C2B A;  2D6Y A;  5F0F A;  3G56 A;  3HGG A;  5H9T A;  2O7O A;  2GEN A;  4JL3 A;  4AF5 A;  3G1L A;  3LOC A;  4NN1 A;  4MXM A;  1RPW A;  4JYK A;  2GUH A;  2HKU A;  5EFY A;  2VPR A;  1ORK A;  3V78 A;  4JNN A;  4I6Z A;  2ID3 A;  3BQY A;  3NXC A;  3O8H A;  1BJZ A;  2IAI A;  4AUX A;  3ZQI A;  3BRU A;  3IH4 A;  2PZ9 A;  3SDG A;  2HXI A;  1QVT A;  3DCF A;  4AC0 A;  3V6G A;  5IOY A;  2ZOY A;  2FBQ A;  3VW1 A;  3VOK A;  1Z77 A;  5J1Y A;  5J1U A;  5HBU A;  4UDS A;  2GFN A;  2DG8 A;  3G1O A;  4D5F A;  2FJ1 A;  2HQ5 A;  3F1B A;  1UI5 A;  3T6N A;  3EGQ A;  3HTA A;  4D7N A;  5F0H A;  2QTQ A;  4D5C A;  4L62 A;  2RHA A;  5FKO A;  1Z0X A;  1JUP A;  2JJ7 A;  5IOZ A;  2XDN A;  3QQA A;  5D1R A;  1JT6 A;  3B81 A;  3BQZ A;  3PAS A;  5FHP A;  3KKD A;  2G7S A;  5F27 A;  5K7Z A;  3IH2 A;  3MNL A;  5CXG A;  3VPR A;  4MK6 A;  3AQS A;  3DEW A;  2O7T A;  3VVX A;  3E7Q A;  1T56 A;  2Y31 A;  3B6C A;  4HKU A;  5FGL A;  2HXO A;  1U9O A;  4XK4 A;  1JT0 A;  3CDL A;  2Y2Z A;  2ZCM A;  5CW8 A;  3HGY A;  3VVZ A;  3BTL A;  3CWR A;  3RH2 A;  3BHQ A;  4M3E A;  5K58 A;  3GZI A;  2OI8 A;  5GP9 A;  3KZ9 A;  2FQ4 A;  3LSJ A;  3BCG A;  3WHC A;  3ZQH A;  2G7G A;  2TRT A;  3PPB A;  4GCL A;  1JUS A;  2TCT A;  3RD3 A;  3VOX A;  1JTX A;  2G7L A;  4W1U A;  3S5R A;  2DG7 A;  3BTJ A;  2ID6 A;  4M3G A;  3HE0 A;  4GCT A;  3QBM A;  2UXU A;  2NP5 A;  2PBX A;  3Q3S A;  3LSP A;  3VIB A;  3NI7 A;  4B1R A;  2QKO A;  3BTI A;  2DTZ A;  3CCY A;  5FMP A;  3F0C A;  3QPS A;  2WGB A;  5F1J A;  3IUV A;  1A6I A;  3WHB A;  2GBY A;  2UXI A;  5C4Y A;  3BR6 A;  3G7R A;  4M3B A;  4DW6 A;  3ON4 A;  4CGR A;  2JK3 A;  3BJB A;  2G3B A;  3NRG A;  5J3L A;  1QPI A;  3P9T A;  3VUQ A;  3G1M A;  3CJD A;  2NX4 A;  2REK A;  1UI6 A;  2FX0 A;  2XPV A;  4GFL A;  1SGM A;  1T33 A;  2XGC A;  3KNW A;  4ME9 A;  5EZG A;  2YVE A;  5F04 A;  3NNR A;  5GPA A;  2FD5 A;  2IU5 A;  3C07 A;  3Q0W A;  2QIB A;  2NP3 A;  2VKV A;  4B3A A;  4M3D A;  5F08 A;  2XB5 A;  3ANG A;  4W97 A;  2XGD A;  5FKN A;  3FK7 A;  3KKC A;  5F0C A;  3O8G A;  3COL A;  3AQT A;  1JUM A;  2W53 A;  5CXI A;  2G0E A;  3BT9 A;  2QCO A;  5IPA A;  4M3F A;  3BR2 A;  5FKK A;  2HYJ A;  1ZKG A;  1ZK8 A;  4V2F A;  2YVH A;  2NS7 A;  3FRQ A;  5K7F A;  3NPI A;  5DAJ A;  3ANP A;  3ON2 A;  3DPJ A;  2IEK A;  2EH3 A;  4KWA A;  1JTY A;  3JSJ A;  1RKW A;  3ZQF A;  2OPT A;  3O60 A;  2XGE A;  3TP3 A;  1VI0 A;  3VP5 A;  3EUP A;  2ZCX A;  2Y30 A; 
#chains in the Genus database with same CATH topology
 3VW0 A;  3BNI A;  3LWJ A;  3IH3 A;  2UXO A;  3Q0U A;  2R7Q A;  3HTH A;  2QWT A;  5EYR A;  3DU6 A;  3TP0 A;  2XRL A;  4GCK A;  4PXI A;  4WIB A;  5AQC A;  4ACI A;  3B6A A;  5IP6 A;  2OER A;  2WUI A;  2XPW A;  3ZQL A;  4G12 A;  4V2G A;  5D19 A;  2ZB9 A;  2Q24 A;  3LSR A;  3BR5 A;  1U9N A;  2OF7 A;  2ZOZ A;  2YVX A;  3QKX A;  3HIM A;  1QVU A;  2UXH A;  2UXP A;  3HTJ A;  3VW2 A;  3LJL A;  3PM1 A;  5CQG A;  2WV1 A;  3BR0 A;  4GFK A;  2R7X A;  2XPU A;  4MO7 A;  4NEL A;  2RAE A;  4YZE A;  4X1E A;  3BTC A;  3SFI A;  1RKT A;  4DVY P;  2QOP A;  5HSZ A;  3VVY A;  4JKZ A;  3BR1 A;  5D18 A;  3BR3 A;  3FIW A;  4AC6 A;  3QPL A;  3FK6 A;  2R7S A;  2RAS A;  3HTI A;  5EZH A;  3MVP A;  3Q0V A;  2HYT A;  2ZCN A;  2X6O A;  2V57 A;  3CRJ A;  5HAW A;  2F07 A;  5FKL A;  2X9D A;  2IBD A;  5K7H A;  2VKE A;  4I76 A;  4ABZ A;  3ZQG A;  3GEU A;  3LHQ A;  4D7M A;  5FKM A;  2I10 A;  5J1R A;  4ICH A;  2NS8 A;  5GPC A;  3C2B A;  2D6Y A;  5F0F A;  3G56 A;  2ZY9 A;  4OD4 A;  3HGG A;  5H9T A;  2O7O A;  2GEN A;  4JL3 A;  4AF5 A;  3G1L A;  3LOC A;  4NN1 A;  4MXM A;  1RPW A;  4JYK A;  2GUH A;  2HKU A;  5EFY A;  2VPR A;  1ORK A;  3V78 A;  3DU5 A;  4JNN A;  4I6Z A;  2ID3 A;  3BQY A;  3NXC A;  3O8H A;  1BJZ A;  2IAI A;  4AUX A;  4OD5 A;  3ZQI A;  3BRU A;  3IH4 A;  2PZ9 A;  3SDG A;  2HXI A;  1QVT A;  3DCF A;  4AC0 A;  3V6G A;  5IOY A;  2ZOY A;  2FBQ A;  3VW1 A;  2A2F X;  3VOK A;  3K8P C;  1Z77 A;  5J1Y A;  5J1U A;  5HBU A;  4UDS A;  2GFN A;  2FJI 1;  2DG8 A;  3G1O A;  4D5F A;  2FJ1 A;  2HQ5 A;  3F1B A;  1UI5 A;  3T6N A;  3EGQ A;  3HTA A;  2R7W A;  4D7N A;  2R7O A;  5F0H A;  2QTQ A;  2R7U A;  4D5C A;  4L62 A;  2RHA A;  5FKO A;  1Z0X A;  1JUP A;  2JJ7 A;  5IOZ A;  2XDN A;  3QQA A;  5D1R A;  1JT6 A;  3B81 A;  3BQZ A;  3PAS A;  5FHP A;  3KKD A;  2G7S A;  5F27 A;  5K7Z A;  3IH2 A;  3MNL A;  5CXG A;  3VPR A;  4MK6 A;  3AQS A;  3DEW A;  2O7T A;  3VVX A;  3E7Q A;  1T56 A;  2Y31 A;  3B6C A;  4HKU A;  5FGL A;  2HXO A;  1U9O A;  4XK4 A;  1JT0 A;  3CDL A;  2Y2Z A;  2ZCM A;  5CW8 A;  2B1E A;  3HGY A;  3VVZ A;  3BTL A;  3CWR A;  3RH2 A;  3BHQ A;  4M3E A;  5K58 A;  3GZI A;  2OI8 A;  3SWH A;  2R7V A;  5GP9 A;  3KZ9 A;  2FQ4 A;  3LSJ A;  3BCG A;  3WHC A;  3ZQH A;  2G7G A;  2TRT A;  3PPB A;  4GCL A;  1JUS A;  2TCT A;  3RD3 A;  3VOX A;  2R7T A;  1JTX A;  2G7L A;  4W1U A;  3S5R A;  2DG7 A;  3BTJ A;  3KYL A;  2ID6 A;  4M3G A;  3HE0 A;  4GCT A;  3QBM A;  2UXU A;  2NP5 A;  2PBX A;  3Q3S A;  3LSP A;  3VIB A;  3NI7 A;  4B1R A;  2R7R A;  2QKO A;  3BTI A;  2DTZ A;  3CCY A;  5FMP A;  3F0C A;  3QPS A;  2WGB A;  5F1J A;  3IUV A;  1A6I A;  3WHB A;  2GBY A;  2UXI A;  5C4Y A;  3BR6 A;  4C2M A;  3G7R A;  4M3B A;  4DW6 A;  3ON4 A;  4CGR A;  2JK3 A;  3BJB A;  2G3B A;  3NRG A;  3VTI A;  5J3L A;  1QPI A;  3P9T A;  3VUQ A;  3G1M A;  3CJD A;  2NX4 A;  2REK A;  1UI6 A;  2FX0 A;  2XPV A;  4GFL A;  1SGM A;  1T33 A;  2XGC A;  3KNW A;  4ME9 A;  5EZG A;  2YVE A;  5F04 A;  3NNR A;  5GPA A;  2FD5 A;  2IU5 A;  3C07 A;  3Q0W A;  2QIB A;  2NP3 A;  3NS4 A;  2VKV A;  4B3A A;  4M3D A;  5F08 A;  2XB5 A;  3ANG A;  4W97 A;  2XGD A;  2B3W A;  5FKN A;  3FK7 A;  3KKC A;  5F0C A;  3O8G A;  4U9L A;  3COL A;  3AQT A;  1JUM A;  2W53 A;  5CXI A;  2G0E A;  3BT9 A;  2QCO A;  5IPA A;  4M3F A;  3BR2 A;  5FKK A;  2HYJ A;  1ZKG A;  1ZK8 A;  4V2F A;  2YVH A;  3FHN A;  2NS7 A;  3FRQ A;  5K7F A;  3NPI A;  5DAJ A;  3ANP A;  3ON2 A;  4IRV A;  3DPJ A;  2IEK A;  2EH3 A;  4KWA A;  1JTY A;  3JSJ A;  1RKW A;  3ZQF A;  2OPT A;  3O60 A;  2XGE A;  4U9N A;  3TP3 A;  2PFV A;  1VI0 A;  3VP5 A;  3EUP A;  2ZCX A;  2Y30 A; 
#chains in the Genus database with same CATH homology
 3VW0 A;  3BNI A;  3LWJ A;  3IH3 A;  2UXO A;  3Q0U A;  3HTH A;  2QWT A;  5EYR A;  3TP0 A;  2XRL A;  4GCK A;  4PXI A;  5AQC A;  4ACI A;  3B6A A;  5IP6 A;  2OER A;  2WUI A;  2XPW A;  3ZQL A;  4G12 A;  4V2G A;  5D19 A;  2ZB9 A;  2Q24 A;  3LSR A;  3BR5 A;  1U9N A;  2OF7 A;  2ZOZ A;  3QKX A;  3HIM A;  1QVU A;  2UXH A;  2UXP A;  3HTJ A;  3VW2 A;  3LJL A;  3PM1 A;  2WV1 A;  3BR0 A;  4GFK A;  2XPU A;  4MO7 A;  4NEL A;  2RAE A;  4YZE A;  4X1E A;  3BTC A;  3SFI A;  1RKT A;  2QOP A;  5HSZ A;  3VVY A;  4JKZ A;  3BR1 A;  5D18 A;  3BR3 A;  3FIW A;  4AC6 A;  3QPL A;  3FK6 A;  2RAS A;  3HTI A;  5EZH A;  3MVP A;  3Q0V A;  2HYT A;  2ZCN A;  2X6O A;  2V57 A;  3CRJ A;  5HAW A;  2F07 A;  5FKL A;  2X9D A;  2IBD A;  5K7H A;  2VKE A;  4I76 A;  4ABZ A;  3ZQG A;  3GEU A;  3LHQ A;  4D7M A;  5FKM A;  2I10 A;  5J1R A;  4ICH A;  2NS8 A;  5GPC A;  3C2B A;  2D6Y A;  5F0F A;  3G56 A;  3HGG A;  5H9T A;  2O7O A;  2GEN A;  4JL3 A;  4AF5 A;  3G1L A;  3LOC A;  4NN1 A;  4MXM A;  1RPW A;  4JYK A;  2GUH A;  2HKU A;  5EFY A;  2VPR A;  1ORK A;  3V78 A;  4JNN A;  4I6Z A;  2ID3 A;  3BQY A;  3NXC A;  3O8H A;  1BJZ A;  2IAI A;  4AUX A;  3ZQI A;  3BRU A;  3IH4 A;  2PZ9 A;  3SDG A;  2HXI A;  1QVT A;  3DCF A;  4AC0 A;  3V6G A;  5IOY A;  2ZOY A;  2FBQ A;  3VW1 A;  3VOK A;  1Z77 A;  5J1Y A;  5J1U A;  5HBU A;  4UDS A;  2GFN A;  2DG8 A;  3G1O A;  4D5F A;  2FJ1 A;  2HQ5 A;  3F1B A;  1UI5 A;  3T6N A;  3EGQ A;  3HTA A;  4D7N A;  5F0H A;  2QTQ A;  4D5C A;  4L62 A;  2RHA A;  5FKO A;  1Z0X A;  1JUP A;  2JJ7 A;  5IOZ A;  2XDN A;  3QQA A;  5D1R A;  1JT6 A;  3B81 A;  3BQZ A;  3PAS A;  5FHP A;  3KKD A;  2G7S A;  5F27 A;  5K7Z A;  3IH2 A;  3MNL A;  5CXG A;  3VPR A;  4MK6 A;  3AQS A;  3DEW A;  2O7T A;  3VVX A;  3E7Q A;  1T56 A;  2Y31 A;  3B6C A;  4HKU A;  5FGL A;  2HXO A;  1U9O A;  4XK4 A;  1JT0 A;  3CDL A;  2Y2Z A;  2ZCM A;  5CW8 A;  3HGY A;  3VVZ A;  3BTL A;  3CWR A;  3RH2 A;  3BHQ A;  4M3E A;  5K58 A;  3GZI A;  2OI8 A;  5GP9 A;  3KZ9 A;  2FQ4 A;  3LSJ A;  3BCG A;  3WHC A;  3ZQH A;  2G7G A;  2TRT A;  3PPB A;  4GCL A;  1JUS A;  2TCT A;  3RD3 A;  3VOX A;  1JTX A;  2G7L A;  4W1U A;  3S5R A;  2DG7 A;  3BTJ A;  2ID6 A;  4M3G A;  3HE0 A;  4GCT A;  3QBM A;  2UXU A;  2NP5 A;  2PBX A;  3Q3S A;  3LSP A;  3VIB A;  3NI7 A;  4B1R A;  2QKO A;  3BTI A;  2DTZ A;  3CCY A;  5FMP A;  3F0C A;  3QPS A;  2WGB A;  5F1J A;  3IUV A;  1A6I A;  3WHB A;  2GBY A;  2UXI A;  5C4Y A;  3BR6 A;  3G7R A;  4M3B A;  4DW6 A;  3ON4 A;  4CGR A;  2JK3 A;  3BJB A;  2G3B A;  3NRG A;  5J3L A;  1QPI A;  3P9T A;  3VUQ A;  3G1M A;  3CJD A;  2NX4 A;  2REK A;  1UI6 A;  2FX0 A;  2XPV A;  4GFL A;  1SGM A;  1T33 A;  2XGC A;  3KNW A;  4ME9 A;  5EZG A;  2YVE A;  5F04 A;  3NNR A;  5GPA A;  2FD5 A;  2IU5 A;  3C07 A;  3Q0W A;  2QIB A;  2NP3 A;  2VKV A;  4B3A A;  4M3D A;  5F08 A;  2XB5 A;  3ANG A;  4W97 A;  2XGD A;  5FKN A;  3FK7 A;  3KKC A;  5F0C A;  3O8G A;  3COL A;  3AQT A;  1JUM A;  2W53 A;  5CXI A;  2G0E A;  3BT9 A;  2QCO A;  5IPA A;  4M3F A;  3BR2 A;  5FKK A;  2HYJ A;  1ZKG A;  1ZK8 A;  4V2F A;  2YVH A;  2NS7 A;  3FRQ A;  5K7F A;  3NPI A;  5DAJ A;  3ANP A;  3ON2 A;  3DPJ A;  2IEK A;  2EH3 A;  4KWA A;  1JTY A;  3JSJ A;  1RKW A;  3ZQF A;  2OPT A;  3O60 A;  2XGE A;  3TP3 A;  1VI0 A;  3VP5 A;  3EUP A;  2ZCX A;  2Y30 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...