4JL3A

Crystal structure of ms6564-dna complex
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
179
structure length
179
Chain Sequence
SEKSRVAIVEATRALLLERGFDGLSIEAVAAKAGVGKQTIYRWWPSRHALVADVLLEDADKILARMPKTDDVTADLASWAGTLAAALTTRRGHAMLKTLMAASLEHEDTAARLREGFSRPLIESVRDRLRDEDIDADHAQAAADALLGAVVNAVLSEGRSYSRQRAETSARIIVAGLRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords Transcriptional regulator, TetR family
publication title Structural basis for interaction between M. smegmatis Ms6564, a TetR family master regulator, and its target DNA.
rcsb
source organism Mycobacterium smegmatis
total genus 62
structure length 179
sequence length 179
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF16859 TetR_C_11 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 4jl3A00
4AF5A 3HTIA 2QIBA 2G0EA 2NX4A 3IH4A 3SFIA 2QTQA 2IBDA 2XDNA 5D18A 3BR1A 2OPTA 4M3EA 4YZEA 3S5RA 3QPLA 1JTXA 3FK6A 4MO7A 5IP6A 3MNLA 5D19A 2QOPA 4AC0A 3G56A 3LJLA 3KZ9A 2W53A 5F1JA 5F27A 3NI7A 1QPIA 3G7RA 5AQCA 3Q0UA 3TP0A 1QVTA 1JUSA 2ZCNA 5D1RA 2QKOA 5J1UA 3BCGA 2PZ9A 2TCTA 3EUPA 2NP5A 2VKVA 5C4YA 3HE0A 3BTIA 2NS8A 3VPRA 5J1RA 5HBUA 3EGQA 2YVHA 3LSPA 2IU5A 5HAWA 3P9TA 4D5CA 5IPAA 2ZCMA 3BR6A 3VW1A 3PM1A 5F08A 5FKLA 3WHBA 3AQSA 3G1OA 3ZQLA 2O7OA 3IUVA 1JUPA 5CW8A 2IAIA 3VOXA 3VVXA 2HQ5A 5EZGA 3QBMA 1JT6A 2GFNA 2GENA 4V2GA 3CWRA 3CDLA 2ZOYA 2VKEA 5J1YA 3CRJA 3DPJA 3LWJA 5K7FA 2WUIA 3BQZA 3LHQA 4I76A 3F0CA 5F0HA 5FGLA 3B6CA 3ANGA 3LSRA 5EYRA 4X1EA 3VP5A 5GPAA 5EFYA 4D7MA 3PPBA 4MK6A 4ABZA 3FIWA 2G7LA 3BRUA 1T56A 2XRLA 5EZHA 5FKKA 2ID6A 2ZCXA 4HKUA 3ZQGA 2Q24A 3O60A 3FRQA 2QCOA 3DEWA 2DG7A 4UDSA 4M3DA 2OI8A 1ORKA 2NS7A 3BTJA 2HYJA 5GPCA 2RHAA 3VUQA 1JUMA 4M3BA 3IH3A 3VVZA 2XGDA 2UXOA 2UXIA 3V78A 3BR3A 5K58A 3FK7A 1ZK8A 3BT9A 3O8GA 3Q0VA 3SDGA 3NXCA 5F0CA 2D6YA 5F0FA 5CXGA 2Y31A 2Y2ZA 3QQAA 2OF7A 3LSJA 3RD3A 2XGEA 1BJZA 4NN1A 1UI5A 3ANPA 3GZIA 3NNRA 3ON2A 4MXMA 4KWAA 3VVYA 2RASA 3BR0A 2VPRA 2RAEA 2WGBA 2XPVA 4GFKA 2JJ7A 4AC6A 1UI6A 4GFLA 2X9DA 2HXIA 4M3FA 2IEKA 3KKDA 2UXHA 4G12A 2QWTA 3GEUA 3HGYA 3IH2A 2ZB9A 4D7NA 3C2BA 1JTYA 3CJDA 4W1UA 5HSZA 2XPWA 3B81A 3G1MA 3HIMA 1RKTA 2TRTA 3VOKA 3ZQFA 1Z0XA 3TP3A 5FKOA 2I10A 3ZQHA 2HYTA 4GCTA 4GCKA 2FD5A 3QKXA 1U9OA 2FJ1A 1U9NA 3JSJA 2XB5A 3BJBA 2FX0A 5GP9A 2GUHA 2OERA 3V6GA 2JK3A 1ZKGA 5K7HA 2ZOZA 3BR5A 2PBXA 3BQYA 3ON4A 3CCYA 3VW0A 4M3GA 2UXUA 3QPSA 5F04A 3BHQA 4W97A 5DAJA 4V2FA 5IOZA 2G7SA 4ME9A 1VI0A 1RPWA 3BR2A 1JT0A 3PASA 3BTLA 3VIBA 3HTAA 2DTZA 5FHPA 2G3BA 3WHCA 2XGCA 3E7QA 2X6OA 3COLA 5FKMA 4D5FA 2NP3A 2UXPA 3DCFA 2REKA 2EH3A 1SGMA 3ZQIA 4I6ZA 4JYKA 1A6IA 5CXIA 4GCLA 2WV1A 4DW6A 2ID3A 3BTCA 5IOYA 2Y30A 3HTHA 3VW2A 3BNIA 4B1RA 2F07A 3F1BA 4CGRA 3Q3SA 4NELA 5FMPA 1RKWA 3NPIA 5J3LA 3LOCA 3NRGA 3KNWA 4JNNA 4JL3A 2HXOA 4ACIA 5K7ZA 2DG8A 5H9TA 5FKNA 3KKCA 4AUXA 3G1LA 4PXIA 2G7GA 2GBYA 2YVEA 3MVPA 3Q0WA 2O7TA 3AQTA 3T6NA 1T33A 2XPUA 3RH2A 2HKUA 3O8HA 3B6AA 4JKZA 3HTJA 3C07A 2FBQA 2FQ4A 2V57A 3HGGA 4B3AA 1Z77A 4XK4A 1QVUA 4L62A 4ICHA
chains in the Genus database with same CATH superfamily
4AF5A 3HTIA 2QIBA 2R7UA 2G0EA 2NX4A 3IH4A 3SFIA 2QTQA 2IBDA 2XDNA 5D18A 4OD5A 3BR1A 2OPTA 4M3EA 4YZEA 3S5RA 3QPLA 1JTXA 2R7XA 3FK6A 4MO7A 5IP6A 3MNLA 5D19A 2QOPA 4AC0A 3G56A 3LJLA 2R7WA 3KZ9A 2W53A 5F1JA 5F27A 4IRVA 3NI7A 1QPIA 3G7RA 5AQCA 3Q0UA 3TP0A 1QVTA 1JUSA 2ZCNA 5D1RA 2QKOA 5J1UA 2R7QA 3BCGA 2PZ9A 2TCTA 3EUPA 2NP5A 2VKVA 5C4YA 3HE0A 3BTIA 2NS8A 3VPRA 5J1RA 5HBUA 3EGQA 2YVHA 3LSPA 2IU5A 5HAWA 3P9TA 4D5CA 5IPAA 2R7SA 2ZCMA 3BR6A 3VW1A 3PM1A 5F08A 5FKLA 3AQSA 3G1OA 3WHBA 3ZQLA 2O7OA 3IUVA 1JUPA 4WIBA 5CW8A 2IAIA 3VOXA 3VVXA 2HQ5A 5EZGA 3QBMA 1JT6A 2GFNA 2GENA 4V2GA 3CWRA 3NS4A 3CDLA 2ZOYA 2VKEA 5J1YA 3CRJA 3DPJA 3SWHA 2B1EA 3LWJA 4U9LA 5K7FA 2WUIA 3BQZA 3LHQA 4I76A 3F0CA 2B3WA 5F0HA 5FGLA 3B6CA 3ANGA 3LSRA 5EYRA 3DU6A 4X1EA 2R7RA 2PFVA 3VP5A 5GPAA 5EFYA 4D7MA 3PPBA 4MK6A 4ABZA 3FIWA 2G7LA 3BRUA 1T56A 2XRLA 5EZHA 5FKKA 2ID6A 2R7OA 2ZCXA 4HKUA 3ZQGA 2Q24A 3O60A 3FRQA 2QCOA 3DEWA 2DG7A 4UDSA 4M3DA 2OI8A 1ORKA 2NS7A 3BTJA 2HYJA 5GPCA 2RHAA 3VUQA 1JUMA 4M3BA 3IH3A 3VVZA 2XGDA 2UXOA 2UXIA 3V78A 3BR3A 5K58A 3FK7A 1ZK8A 3BT9A 3O8GA 3KYLA 3Q0VA 3SDGA 3NXCA 5F0CA 2D6YA 5F0FA 5CXGA 2Y31A 2Y2ZA 3QQAA 2OF7A 3LSJA 3RD3A 2XGEA 1BJZA 4NN1A 1UI5A 3ANPA 3GZIA 3NNRA 3ON2A 4MXMA 4KWAA 3VVYA 2RASA 3BR0A 2VPRA 2RAEA 2WGBA 2XPVA 4GFKA 2JJ7A 4AC6A 1UI6A 4GFLA 2X9DA 2HXIA 4M3FA 2IEKA 3KKDA 2UXHA 4G12A 2QWTA 3GEUA 5CQGA 3HGYA 3IH2A 2ZB9A 4D7NA 3C2BA 1JTYA 3CJDA 4W1UA 3K8PC 5HSZA 2XPWA 3B81A 3G1MA 3HIMA 1RKTA 2TRTA 3VOKA 3ZQFA 1Z0XA 3TP3A 5FKOA 2I10A 3ZQHA 2HYTA 4OD4A 4GCTA 4GCKA 2FD5A 3QKXA 1U9OA 2FJ1A 1U9NA 3JSJA 2XB5A 3BJBA 2FX0A 5GP9A 2GUHA 2OERA 2ZY9A 3V6GA 2JK3A 1ZKGA 5K7HA 2ZOZA 3BR5A 2PBXA 3BQYA 3ON4A 3CCYA 3VW0A 4M3GA 2UXUA 3QPSA 5F04A 3BHQA 4W97A 5DAJA 4V2FA 5IOZA 2G7SA 4ME9A 1VI0A 1RPWA 3BR2A 1JT0A 3PASA 3BTLA 3VIBA 3HTAA 2DTZA 5FHPA 2G3BA 3WHCA 2XGCA 3E7QA 2X6OA 3COLA 5FKMA 4D5FA 2NP3A 2UXPA 3DCFA 2REKA 2EH3A 1SGMA 3ZQIA 4I6ZA 4JYKA 1A6IA 5CXIA 4GCLA 2WV1A 4DW6A 2ID3A 2R7VA 3BTCA 5IOYA 2Y30A 3HTHA 3VW2A 3BNIA 4B1RA 2F07A 3F1BA 4CGRA 2A2FX 3Q3SA 4NELA 5FMPA 1RKWA 3NPIA 5J3LA 3LOCA 3NRGA 3KNWA 4JNNA 4JL3A 2FJI1 2HXOA 4ACIA 5K7ZA 2DG8A 5H9TA 5FKNA 3KKCA 4AUXA 3G1LA 4PXIA 2G7GA 2R7TA 4U9NA 2GBYA 2YVEA 3FHNA 3DU5A 3MVPA 3Q0WA 2O7TA 3AQTA 4C2MA 3T6NA 1T33A 2XPUA 3RH2A 2YVXA 2HKUA 3O8HA 3B6AA 4JKZA 4DVYP 3HTJA 3C07A 2FBQA 2FQ4A 2V57A 3HGGA 4B3AA 1Z77A 4XK4A 1QVUA 3VTIA 4L62A 4ICHA
chains in the Genus database with same CATH topology
4AF5A 3HTIA 2QIBA 2G0EA 2NX4A 3IH4A 3SFIA 2QTQA 2IBDA 2XDNA 5D18A 3BR1A 2OPTA 4M3EA 4YZEA 3S5RA 3QPLA 1JTXA 3FK6A 4MO7A 5IP6A 3MNLA 5D19A 2QOPA 4AC0A 3G56A 3LJLA 3KZ9A 2W53A 5F1JA 5F27A 3NI7A 1QPIA 3G7RA 5AQCA 3Q0UA 3TP0A 1QVTA 1JUSA 2ZCNA 5D1RA 2QKOA 5J1UA 3BCGA 2PZ9A 2TCTA 3EUPA 2NP5A 2VKVA 5C4YA 3HE0A 3BTIA 2NS8A 3VPRA 5J1RA 5HBUA 3EGQA 2YVHA 3LSPA 2IU5A 5HAWA 3P9TA 4D5CA 5IPAA 2ZCMA 3BR6A 3VW1A 3PM1A 5F08A 5FKLA 3WHBA 3AQSA 3G1OA 3ZQLA 2O7OA 3IUVA 1JUPA 5CW8A 2IAIA 3VOXA 3VVXA 2HQ5A 5EZGA 3QBMA 1JT6A 2GFNA 2GENA 4V2GA 3CWRA 3CDLA 2ZOYA 2VKEA 5J1YA 3CRJA 3DPJA 3LWJA 5K7FA 2WUIA 3BQZA 3LHQA 4I76A 3F0CA 5F0HA 5FGLA 3B6CA 3ANGA 3LSRA 5EYRA 4X1EA 3VP5A 5GPAA 5EFYA 4D7MA 3PPBA 4MK6A 4ABZA 3FIWA 2G7LA 3BRUA 1T56A 2XRLA 5EZHA 5FKKA 2ID6A 2ZCXA 4HKUA 3ZQGA 2Q24A 3O60A 3FRQA 2QCOA 3DEWA 2DG7A 4UDSA 4M3DA 2OI8A 1ORKA 2NS7A 3BTJA 2HYJA 5GPCA 2RHAA 3VUQA 1JUMA 4M3BA 3IH3A 3VVZA 2XGDA 2UXOA 2UXIA 3V78A 3BR3A 5K58A 3FK7A 1ZK8A 3BT9A 3O8GA 3Q0VA 3SDGA 3NXCA 5F0CA 2D6YA 5F0FA 5CXGA 2Y31A 2Y2ZA 3QQAA 2OF7A 3LSJA 3RD3A 2XGEA 1BJZA 4NN1A 1UI5A 3ANPA 3GZIA 3NNRA 3ON2A 4MXMA 4KWAA 3VVYA 2RASA 3BR0A 2VPRA 2RAEA 2WGBA 2XPVA 4GFKA 2JJ7A 4AC6A 1UI6A 4GFLA 2X9DA 2HXIA 4M3FA 2IEKA 3KKDA 2UXHA 4G12A 2QWTA 3GEUA 3HGYA 3IH2A 2ZB9A 4D7NA 3C2BA 1JTYA 3CJDA 4W1UA 5HSZA 2XPWA 3B81A 3G1MA 3HIMA 1RKTA 2TRTA 3VOKA 3ZQFA 1Z0XA 3TP3A 5FKOA 2I10A 3ZQHA 2HYTA 4GCTA 4GCKA 2FD5A 3QKXA 1U9OA 2FJ1A 1U9NA 3JSJA 2XB5A 3BJBA 2FX0A 5GP9A 2GUHA 2OERA 3V6GA 2JK3A 1ZKGA 5K7HA 2ZOZA 3BR5A 2PBXA 3BQYA 3ON4A 3CCYA 3VW0A 4M3GA 2UXUA 3QPSA 5F04A 3BHQA 4W97A 5DAJA 4V2FA 5IOZA 2G7SA 4ME9A 1VI0A 1RPWA 3BR2A 1JT0A 3PASA 3BTLA 3VIBA 3HTAA 2DTZA 5FHPA 2G3BA 3WHCA 2XGCA 3E7QA 2X6OA 3COLA 5FKMA 4D5FA 2NP3A 2UXPA 3DCFA 2REKA 2EH3A 1SGMA 3ZQIA 4I6ZA 4JYKA 1A6IA 5CXIA 4GCLA 2WV1A 4DW6A 2ID3A 3BTCA 5IOYA 2Y30A 3HTHA 3VW2A 3BNIA 4B1RA 2F07A 3F1BA 4CGRA 3Q3SA 4NELA 5FMPA 1RKWA 3NPIA 5J3LA 3LOCA 3NRGA 3KNWA 4JNNA 4JL3A 2HXOA 4ACIA 5K7ZA 2DG8A 5H9TA 5FKNA 3KKCA 4AUXA 3G1LA 4PXIA 2G7GA 2GBYA 2YVEA 3MVPA 3Q0WA 2O7TA 3AQTA 3T6NA 1T33A 2XPUA 3RH2A 2HKUA 3O8HA 3B6AA 4JKZA 3HTJA 3C07A 2FBQA 2FQ4A 2V57A 3HGGA 4B3AA 1Z77A 4XK4A 1QVUA 4L62A 4ICHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AF5 A;  3HTI A;  2QIB A;  2G0E A;  2NX4 A;  3IH4 A;  3SFI A;  2QTQ A;  2IBD A;  2XDN A;  5D18 A;  3BR1 A;  2OPT A;  4M3E A;  4YZE A;  3S5R A;  3QPL A;  1JTX A;  3FK6 A;  4MO7 A;  5IP6 A;  3MNL A;  5D19 A;  2QOP A;  4AC0 A;  3G56 A;  3LJL A;  3KZ9 A;  2W53 A;  5F1J A;  5F27 A;  3NI7 A;  1QPI A;  3G7R A;  5AQC A;  3Q0U A;  3TP0 A;  1QVT A;  1JUS A;  2ZCN A;  5D1R A;  2QKO A;  5J1U A;  3BCG A;  2PZ9 A;  2TCT A;  3EUP A;  2NP5 A;  2VKV A;  5C4Y A;  3HE0 A;  3BTI A;  2NS8 A;  3VPR A;  5J1R A;  5HBU A;  3EGQ A;  2YVH A;  3LSP A;  2IU5 A;  5HAW A;  3P9T A;  4D5C A;  5IPA A;  2ZCM A;  3BR6 A;  3VW1 A;  3PM1 A;  5F08 A;  5FKL A;  3WHB A;  3AQS A;  3G1O A;  3ZQL A;  2O7O A;  3IUV A;  1JUP A;  5CW8 A;  2IAI A;  3VOX A;  3VVX A;  2HQ5 A;  5EZG A;  3QBM A;  1JT6 A;  2GFN A;  2GEN A;  4V2G A;  3CWR A;  3CDL A;  2ZOY A;  2VKE A;  5J1Y A;  3CRJ A;  3DPJ A;  3LWJ A;  5K7F A;  2WUI A;  3BQZ A;  3LHQ A;  4I76 A;  3F0C A;  5F0H A;  5FGL A;  3B6C A;  3ANG A;  3LSR A;  5EYR A;  4X1E A;  3VP5 A;  5GPA A;  5EFY A;  4D7M A;  3PPB A;  4MK6 A;  4ABZ A;  3FIW A;  2G7L A;  3BRU A;  1T56 A;  2XRL A;  5EZH A;  5FKK A;  2ID6 A;  2ZCX A;  4HKU A;  3ZQG A;  2Q24 A;  3O60 A;  3FRQ A;  2QCO A;  3DEW A;  2DG7 A;  4UDS A;  4M3D A;  2OI8 A;  1ORK A;  2NS7 A;  3BTJ A;  2HYJ A;  5GPC A;  2RHA A;  3VUQ A;  1JUM A;  4M3B A;  3IH3 A;  3VVZ A;  2XGD A;  2UXO A;  2UXI A;  3V78 A;  3BR3 A;  5K58 A;  3FK7 A;  1ZK8 A;  3BT9 A;  3O8G A;  3Q0V A;  3SDG A;  3NXC A;  5F0C A;  2D6Y A;  5F0F A;  5CXG A;  2Y31 A;  2Y2Z A;  3QQA A;  2OF7 A;  3LSJ A;  3RD3 A;  2XGE A;  1BJZ A;  4NN1 A;  1UI5 A;  3ANP A;  3GZI A;  3NNR A;  3ON2 A;  4MXM A;  4KWA A;  3VVY A;  2RAS A;  3BR0 A;  2VPR A;  2RAE A;  2WGB A;  2XPV A;  4GFK A;  2JJ7 A;  4AC6 A;  1UI6 A;  4GFL A;  2X9D A;  2HXI A;  4M3F A;  2IEK A;  3KKD A;  2UXH A;  4G12 A;  2QWT A;  3GEU A;  3HGY A;  3IH2 A;  2ZB9 A;  4D7N A;  3C2B A;  1JTY A;  3CJD A;  4W1U A;  5HSZ A;  2XPW A;  3B81 A;  3G1M A;  3HIM A;  1RKT A;  2TRT A;  3VOK A;  3ZQF A;  1Z0X A;  3TP3 A;  5FKO A;  2I10 A;  3ZQH A;  2HYT A;  4GCT A;  4GCK A;  2FD5 A;  3QKX A;  1U9O A;  2FJ1 A;  1U9N A;  3JSJ A;  2XB5 A;  3BJB A;  2FX0 A;  5GP9 A;  2GUH A;  2OER A;  3V6G A;  2JK3 A;  1ZKG A;  5K7H A;  2ZOZ A;  3BR5 A;  2PBX A;  3BQY A;  3ON4 A;  3CCY A;  3VW0 A;  4M3G A;  2UXU A;  3QPS A;  5F04 A;  3BHQ A;  4W97 A;  5DAJ A;  4V2F A;  5IOZ A;  2G7S A;  4ME9 A;  1VI0 A;  1RPW A;  3BR2 A;  1JT0 A;  3PAS A;  3BTL A;  3VIB A;  3HTA A;  2DTZ A;  5FHP A;  2G3B A;  3WHC A;  2XGC A;  3E7Q A;  2X6O A;  3COL A;  5FKM A;  4D5F A;  2NP3 A;  2UXP A;  3DCF A;  2REK A;  2EH3 A;  1SGM A;  3ZQI A;  4I6Z A;  4JYK A;  1A6I A;  5CXI A;  4GCL A;  2WV1 A;  4DW6 A;  2ID3 A;  3BTC A;  5IOY A;  2Y30 A;  3HTH A;  3VW2 A;  3BNI A;  4B1R A;  2F07 A;  3F1B A;  4CGR A;  3Q3S A;  4NEL A;  5FMP A;  1RKW A;  3NPI A;  5J3L A;  3LOC A;  3NRG A;  3KNW A;  4JNN A;  4JL3 A;  2HXO A;  4ACI A;  5K7Z A;  2DG8 A;  5H9T A;  5FKN A;  3KKC A;  4AUX A;  3G1L A;  4PXI A;  2G7G A;  2GBY A;  2YVE A;  3MVP A;  3Q0W A;  2O7T A;  3AQT A;  3T6N A;  1T33 A;  2XPU A;  3RH2 A;  2HKU A;  3O8H A;  3B6A A;  4JKZ A;  3HTJ A;  3C07 A;  2FBQ A;  2FQ4 A;  2V57 A;  3HGG A;  4B3A A;  1Z77 A;  4XK4 A;  1QVU A;  4L62 A;  4ICH A; 
#chains in the Genus database with same CATH topology
 4AF5 A;  3HTI A;  2QIB A;  2R7U A;  2G0E A;  2NX4 A;  3IH4 A;  3SFI A;  2QTQ A;  2IBD A;  2XDN A;  5D18 A;  4OD5 A;  3BR1 A;  2OPT A;  4M3E A;  4YZE A;  3S5R A;  3QPL A;  1JTX A;  2R7X A;  3FK6 A;  4MO7 A;  5IP6 A;  3MNL A;  5D19 A;  2QOP A;  4AC0 A;  3G56 A;  3LJL A;  2R7W A;  3KZ9 A;  2W53 A;  5F1J A;  5F27 A;  4IRV A;  3NI7 A;  1QPI A;  3G7R A;  5AQC A;  3Q0U A;  3TP0 A;  1QVT A;  1JUS A;  2ZCN A;  5D1R A;  2QKO A;  5J1U A;  2R7Q A;  3BCG A;  2PZ9 A;  2TCT A;  3EUP A;  2NP5 A;  2VKV A;  5C4Y A;  3HE0 A;  3BTI A;  2NS8 A;  3VPR A;  5J1R A;  5HBU A;  3EGQ A;  2YVH A;  3LSP A;  2IU5 A;  5HAW A;  3P9T A;  4D5C A;  5IPA A;  2R7S A;  2ZCM A;  3BR6 A;  3VW1 A;  3PM1 A;  5F08 A;  5FKL A;  3AQS A;  3G1O A;  3WHB A;  3ZQL A;  2O7O A;  3IUV A;  1JUP A;  4WIB A;  5CW8 A;  2IAI A;  3VOX A;  3VVX A;  2HQ5 A;  5EZG A;  3QBM A;  1JT6 A;  2GFN A;  2GEN A;  4V2G A;  3CWR A;  3NS4 A;  3CDL A;  2ZOY A;  2VKE A;  5J1Y A;  3CRJ A;  3DPJ A;  3SWH A;  2B1E A;  3LWJ A;  4U9L A;  5K7F A;  2WUI A;  3BQZ A;  3LHQ A;  4I76 A;  3F0C A;  2B3W A;  5F0H A;  5FGL A;  3B6C A;  3ANG A;  3LSR A;  5EYR A;  3DU6 A;  4X1E A;  2R7R A;  2PFV A;  3VP5 A;  5GPA A;  5EFY A;  4D7M A;  3PPB A;  4MK6 A;  4ABZ A;  3FIW A;  2G7L A;  3BRU A;  1T56 A;  2XRL A;  5EZH A;  5FKK A;  2ID6 A;  2R7O A;  2ZCX A;  4HKU A;  3ZQG A;  2Q24 A;  3O60 A;  3FRQ A;  2QCO A;  3DEW A;  2DG7 A;  4UDS A;  4M3D A;  2OI8 A;  1ORK A;  2NS7 A;  3BTJ A;  2HYJ A;  5GPC A;  2RHA A;  3VUQ A;  1JUM A;  4M3B A;  3IH3 A;  3VVZ A;  2XGD A;  2UXO A;  2UXI A;  3V78 A;  3BR3 A;  5K58 A;  3FK7 A;  1ZK8 A;  3BT9 A;  3O8G A;  3KYL A;  3Q0V A;  3SDG A;  3NXC A;  5F0C A;  2D6Y A;  5F0F A;  5CXG A;  2Y31 A;  2Y2Z A;  3QQA A;  2OF7 A;  3LSJ A;  3RD3 A;  2XGE A;  1BJZ A;  4NN1 A;  1UI5 A;  3ANP A;  3GZI A;  3NNR A;  3ON2 A;  4MXM A;  4KWA A;  3VVY A;  2RAS A;  3BR0 A;  2VPR A;  2RAE A;  2WGB A;  2XPV A;  4GFK A;  2JJ7 A;  4AC6 A;  1UI6 A;  4GFL A;  2X9D A;  2HXI A;  4M3F A;  2IEK A;  3KKD A;  2UXH A;  4G12 A;  2QWT A;  3GEU A;  5CQG A;  3HGY A;  3IH2 A;  2ZB9 A;  4D7N A;  3C2B A;  1JTY A;  3CJD A;  4W1U A;  3K8P C;  5HSZ A;  2XPW A;  3B81 A;  3G1M A;  3HIM A;  1RKT A;  2TRT A;  3VOK A;  3ZQF A;  1Z0X A;  3TP3 A;  5FKO A;  2I10 A;  3ZQH A;  2HYT A;  4OD4 A;  4GCT A;  4GCK A;  2FD5 A;  3QKX A;  1U9O A;  2FJ1 A;  1U9N A;  3JSJ A;  2XB5 A;  3BJB A;  2FX0 A;  5GP9 A;  2GUH A;  2OER A;  2ZY9 A;  3V6G A;  2JK3 A;  1ZKG A;  5K7H A;  2ZOZ A;  3BR5 A;  2PBX A;  3BQY A;  3ON4 A;  3CCY A;  3VW0 A;  4M3G A;  2UXU A;  3QPS A;  5F04 A;  3BHQ A;  4W97 A;  5DAJ A;  4V2F A;  5IOZ A;  2G7S A;  4ME9 A;  1VI0 A;  1RPW A;  3BR2 A;  1JT0 A;  3PAS A;  3BTL A;  3VIB A;  3HTA A;  2DTZ A;  5FHP A;  2G3B A;  3WHC A;  2XGC A;  3E7Q A;  2X6O A;  3COL A;  5FKM A;  4D5F A;  2NP3 A;  2UXP A;  3DCF A;  2REK A;  2EH3 A;  1SGM A;  3ZQI A;  4I6Z A;  4JYK A;  1A6I A;  5CXI A;  4GCL A;  2WV1 A;  4DW6 A;  2ID3 A;  2R7V A;  3BTC A;  5IOY A;  2Y30 A;  3HTH A;  3VW2 A;  3BNI A;  4B1R A;  2F07 A;  3F1B A;  4CGR A;  2A2F X;  3Q3S A;  4NEL A;  5FMP A;  1RKW A;  3NPI A;  5J3L A;  3LOC A;  3NRG A;  3KNW A;  4JNN A;  4JL3 A;  2FJI 1;  2HXO A;  4ACI A;  5K7Z A;  2DG8 A;  5H9T A;  5FKN A;  3KKC A;  4AUX A;  3G1L A;  4PXI A;  2G7G A;  2R7T A;  4U9N A;  2GBY A;  2YVE A;  3FHN A;  3DU5 A;  3MVP A;  3Q0W A;  2O7T A;  3AQT A;  4C2M A;  3T6N A;  1T33 A;  2XPU A;  3RH2 A;  2YVX A;  2HKU A;  3O8H A;  3B6A A;  4JKZ A;  4DVY P;  3HTJ A;  3C07 A;  2FBQ A;  2FQ4 A;  2V57 A;  3HGG A;  4B3A A;  1Z77 A;  4XK4 A;  1QVU A;  3VTI A;  4L62 A;  4ICH A; 
#chains in the Genus database with same CATH homology
 4AF5 A;  3HTI A;  2QIB A;  2G0E A;  2NX4 A;  3IH4 A;  3SFI A;  2QTQ A;  2IBD A;  2XDN A;  5D18 A;  3BR1 A;  2OPT A;  4M3E A;  4YZE A;  3S5R A;  3QPL A;  1JTX A;  3FK6 A;  4MO7 A;  5IP6 A;  3MNL A;  5D19 A;  2QOP A;  4AC0 A;  3G56 A;  3LJL A;  3KZ9 A;  2W53 A;  5F1J A;  5F27 A;  3NI7 A;  1QPI A;  3G7R A;  5AQC A;  3Q0U A;  3TP0 A;  1QVT A;  1JUS A;  2ZCN A;  5D1R A;  2QKO A;  5J1U A;  3BCG A;  2PZ9 A;  2TCT A;  3EUP A;  2NP5 A;  2VKV A;  5C4Y A;  3HE0 A;  3BTI A;  2NS8 A;  3VPR A;  5J1R A;  5HBU A;  3EGQ A;  2YVH A;  3LSP A;  2IU5 A;  5HAW A;  3P9T A;  4D5C A;  5IPA A;  2ZCM A;  3BR6 A;  3VW1 A;  3PM1 A;  5F08 A;  5FKL A;  3WHB A;  3AQS A;  3G1O A;  3ZQL A;  2O7O A;  3IUV A;  1JUP A;  5CW8 A;  2IAI A;  3VOX A;  3VVX A;  2HQ5 A;  5EZG A;  3QBM A;  1JT6 A;  2GFN A;  2GEN A;  4V2G A;  3CWR A;  3CDL A;  2ZOY A;  2VKE A;  5J1Y A;  3CRJ A;  3DPJ A;  3LWJ A;  5K7F A;  2WUI A;  3BQZ A;  3LHQ A;  4I76 A;  3F0C A;  5F0H A;  5FGL A;  3B6C A;  3ANG A;  3LSR A;  5EYR A;  4X1E A;  3VP5 A;  5GPA A;  5EFY A;  4D7M A;  3PPB A;  4MK6 A;  4ABZ A;  3FIW A;  2G7L A;  3BRU A;  1T56 A;  2XRL A;  5EZH A;  5FKK A;  2ID6 A;  2ZCX A;  4HKU A;  3ZQG A;  2Q24 A;  3O60 A;  3FRQ A;  2QCO A;  3DEW A;  2DG7 A;  4UDS A;  4M3D A;  2OI8 A;  1ORK A;  2NS7 A;  3BTJ A;  2HYJ A;  5GPC A;  2RHA A;  3VUQ A;  1JUM A;  4M3B A;  3IH3 A;  3VVZ A;  2XGD A;  2UXO A;  2UXI A;  3V78 A;  3BR3 A;  5K58 A;  3FK7 A;  1ZK8 A;  3BT9 A;  3O8G A;  3Q0V A;  3SDG A;  3NXC A;  5F0C A;  2D6Y A;  5F0F A;  5CXG A;  2Y31 A;  2Y2Z A;  3QQA A;  2OF7 A;  3LSJ A;  3RD3 A;  2XGE A;  1BJZ A;  4NN1 A;  1UI5 A;  3ANP A;  3GZI A;  3NNR A;  3ON2 A;  4MXM A;  4KWA A;  3VVY A;  2RAS A;  3BR0 A;  2VPR A;  2RAE A;  2WGB A;  2XPV A;  4GFK A;  2JJ7 A;  4AC6 A;  1UI6 A;  4GFL A;  2X9D A;  2HXI A;  4M3F A;  2IEK A;  3KKD A;  2UXH A;  4G12 A;  2QWT A;  3GEU A;  3HGY A;  3IH2 A;  2ZB9 A;  4D7N A;  3C2B A;  1JTY A;  3CJD A;  4W1U A;  5HSZ A;  2XPW A;  3B81 A;  3G1M A;  3HIM A;  1RKT A;  2TRT A;  3VOK A;  3ZQF A;  1Z0X A;  3TP3 A;  5FKO A;  2I10 A;  3ZQH A;  2HYT A;  4GCT A;  4GCK A;  2FD5 A;  3QKX A;  1U9O A;  2FJ1 A;  1U9N A;  3JSJ A;  2XB5 A;  3BJB A;  2FX0 A;  5GP9 A;  2GUH A;  2OER A;  3V6G A;  2JK3 A;  1ZKG A;  5K7H A;  2ZOZ A;  3BR5 A;  2PBX A;  3BQY A;  3ON4 A;  3CCY A;  3VW0 A;  4M3G A;  2UXU A;  3QPS A;  5F04 A;  3BHQ A;  4W97 A;  5DAJ A;  4V2F A;  5IOZ A;  2G7S A;  4ME9 A;  1VI0 A;  1RPW A;  3BR2 A;  1JT0 A;  3PAS A;  3BTL A;  3VIB A;  3HTA A;  2DTZ A;  5FHP A;  2G3B A;  3WHC A;  2XGC A;  3E7Q A;  2X6O A;  3COL A;  5FKM A;  4D5F A;  2NP3 A;  2UXP A;  3DCF A;  2REK A;  2EH3 A;  1SGM A;  3ZQI A;  4I6Z A;  4JYK A;  1A6I A;  5CXI A;  4GCL A;  2WV1 A;  4DW6 A;  2ID3 A;  3BTC A;  5IOY A;  2Y30 A;  3HTH A;  3VW2 A;  3BNI A;  4B1R A;  2F07 A;  3F1B A;  4CGR A;  3Q3S A;  4NEL A;  5FMP A;  1RKW A;  3NPI A;  5J3L A;  3LOC A;  3NRG A;  3KNW A;  4JNN A;  4JL3 A;  2HXO A;  4ACI A;  5K7Z A;  2DG8 A;  5H9T A;  5FKN A;  3KKC A;  4AUX A;  3G1L A;  4PXI A;  2G7G A;  2GBY A;  2YVE A;  3MVP A;  3Q0W A;  2O7T A;  3AQT A;  3T6N A;  1T33 A;  2XPU A;  3RH2 A;  2HKU A;  3O8H A;  3B6A A;  4JKZ A;  3HTJ A;  3C07 A;  2FBQ A;  2FQ4 A;  2V57 A;  3HGG A;  4B3A A;  1Z77 A;  4XK4 A;  1QVU A;  4L62 A;  4ICH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...