2A2FX

Crystal structure of sec15 c-terminal domain
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
317
structure length
296
Chain Sequence
NILWELLHNMRDHYNEVLLQRWVHVFREILDKEQFLPMVVQNTEEYECIIERFPFHSEQLEPKKFPFSRMVPEVYHQAKEFMYACMKFAEELTLSPNEVAAMVRKAANLLLTRSFSGCLSVVFRQPSITLTQLIQIIIDTQYLEKAGPFLDEFVCHMTNTERAMFHVARQDAEKQVGLRICSKIDEFFELSAYDWLPGIASAFITDMISYLKSTFDSFAFKLPHIAQAACRRTFEHIAEKIYSIMYDSTGALTQINLDLMQCEFFAASEPVPGLKEGELSKYFLRNRQLLDLLILE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Exocyst complex component Sec15
publication title Sec15 interacts with Rab11 via a novel domain and affects Rab11 localization in vivo.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 109
structure length 296
sequence length 317
ec nomenclature
pdb deposition date 2005-06-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.30 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor; domain 2 2a2fX01
1.20.58.670 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2a2fX02
2A2FX 3FHNA
chains in the Genus database with same CATH superfamily
4PJMA 2FX0A 3EI0A 4AQGA 5A1LA 5KX5E 4DVYP 2D0UA 4AQFC 2LLYA 3B81A 1J1JA 4YFSA 1I6ZA 3RKGA 2HXIA 4JEHB 1MMDA 4YTNA 2ZCNA 4MALA 5JDFA 2V5CA 4M3GA 3BQLA 4KBMB 2BZBA 1X9BA 1N34T 3MZKB 3FZFB 4HTEA 5CJ5A 2VK9A 4OYJA 3ZYKA 3PUSA 1Z77A 4H9OC 2CXDA 1JTYA 1YKEB 3VW2A 2XQYA 4X1EA 4Q25A 3NVOA 3QPSA 3ZJ1A 3EUHA 5L3DB 5AQOB 2DLRA 4UIGA 1KEYA 2WUIA 3CX6B 3SDGA 4FJOA 4JV5T 3RGLA 2VKVA 5F5WA 5AQGB 3Q5XA 3KV4A 4A98A 3P4PA 3ON2A 2V26A 5K7ZA 2VL8A 4IRVA 4YSYA 4EOZB 1HG2A 4I50E 4Z8XA 2IIUA 3RIUC 1XNRT 3Q5WA 3TLVA 2XZEA 2LT3A 3DU6A 1QSDA 4D5CA 4EEBA 2EHOD 2NW8A 5LBMA 2CE7A 1HCIA 3AE4A 4LMKA 2LSJA 4OK0A 2UXHA 3KV9A 3SFIA 5IP6A 4F8HA 5CQGA 4ZEYA 4HWIB 5FY0A 4IDNA 1E7PA 1OXZA 1YQ3A 2BG9B 4TNVA 3VVZA 3KDSE 4DMVA 3AVSA 5JRCB 4TV8E 5LMNT 2R6GF 1HS7A 1UUSA 2XB5A 2IDOB 1AJ3A 4ANJA 3KKDA 3KBUA 1KNPA 2R7OA 1D0XA 2FJI1 2V6XA 2WWUA 2LSIA 3DU5A 3VKHA 1E2AA 2BG9C 5FXVA 2OA5A 5J1YA 1NEKA 4ZI2C 3HKDE 4A5XA 2ZB9A 5C4YA 4H63V 3OJAA 5DQVA 4X64T 2YOEA 3E0ZA 5JDMA 4MO7A 4DUZT 4AIUA 4YLHA 3O8HA 1SUMB 3BJBA 1RKTA 2X0YA 2DHRA 2V7MA 1IJ5A 4TUYE 5FMPA 5HEUA 5BR8T 3AE3A 1CHUA 3K3NA 4YT0A 4IREA 5HXSA 3BTJA 3N9OA 5F04A 1LVKA 3LSVA 5C3JA 2QVAA 3UU3A 4ACIA 2R7VA 2XGDA 3PDYA 1Z0XA 3EABA 2HYJA 4BAYB 2DWGA 4I43B 2LHNA 3ZKRA 2XY8B 3SOLA 2X9DA 3IBPA 2WZHA 1KK7A 3VKGA 4UVCB 2QGSA 4ZOLE 5D19A 2R7XA 3FZLB 2OERA 2X9HA 5IUXA 3BTIA 4G63A 2C5KT 3V5SA 1YXRA 3RYHE 3ZMUB 2H3RA 2AE9A 3B6AA 5F3JA 4CXXA 2X68A 4B3AA 3R84B 3RRWA 2FJDA 2L8KA 3SRZA 5LNKA 3NRGA 4DR7T 2XPUA 3BQIA 1VCSA 4B3TT 2UUAT 2VKDA 4PW8A 3LG7A 2VB6A 3ZMSB 4AC0A 3Q5DA 3AE6A 1KNZA 3AXJA 3HKCE 3K1SA 1ZKGA 1UI6A 1ZK8A 2CEAA 2CBIA 2CPTA 2YDQA 4ZI3D 3ZQIA 1U9OA 5HCJA 1WRDA 4IE0A 5CFBA 3UULA 3ZC0A 1U9NA 3AVRA 2YVHA 5AQTB 2WDVA 3OBVE 4LFBT 4MK6A 4DR6T 3KBTA 2X0LB 3UQ7A 1Y64B 4ERRA 4GIWA 2IBDA 4HFDA 3ZLIA 2YK0A 2H89A 4P0BA 1RKWA 4PXIA 5AQKB 1LKXA 3HI2A 4NUUA 2JQQA 2D6YA 5L4HA 1OEDB 2GBYA 4HFHA 2ID6A 2HYTA 2F4VT 5AQFB 4V1Av 5AQRB 3BQYA 1O3XA 4JNNA 2ODVA 2OI8A 1BR0A 2VKOA 3ONXA 2GENA 3Q9DA 2I0MA 5FVLA 2X9WA 2XAGB 3ZQHA 4TV9E 5FXWA 2W53A 3MNLA 4YJ3E 3P4RA 4IT4A 4J2CA 1UX4A 3AEBA 2BS2A 2V7KA 3Q2MA 3FHNA 3C4ZA 3K8PC 2YEVC 4AF5A 3H37A 3LFMA 4GFKA 2R7RA 2V6YB 2LSGA 4X1YE 4DR3T 5JDQA 3DEWA 3C4WA 5ABHA 3N9QA 2BDEA 4WBOA 3C64A 2XQ6A 2LSKA 2FUPA 2UXDT 4EYYR 2NW7A 1JUMA 4IE5A 4WBNE 4I76A 4ISTA 1ZHCA 1FIOA 4GCKA 3QNUA 4U3CA 2X9XA 3UU8A 4QH4A 2P9BA 3IH4A 3GA8A 4IDOA 2CA5A 4OD5A 2PBIA 3T1YT 4AKLA 4KHZF 2N2NA 5L3BB 3ZYLA 1JT0A 4U2ZA 4O4IE 3A8YC 3CPZA 5LHHB 2XQ7A 2QA7A 4QXHB 2IW5B 3VIBA 4AQFA 4DUYT 2J4GA 2KMFA 3PPBA 2NP9A 5D1RA 4YY3T 5CW8A 1EZ3A 3N2GE 4DMWA 4AXPA 3KV6A 2IC6A 2IUBA 2NS8A 2XJ7A 3ANPA 3NRYA 3BR3A 2H7VC 1KFYA 4IE6A 3ZT7A 3SFEA 2R7WA 1JUPA 2HKUA 4NUVA 4CN1A 2OLTA 3LSJA 4JKZA 3HTIA 1NWMX 3BCGA 2VURA 5FKOA 2XDNA 4LMLA 3ZT5A 3C98B 5DABA 3O1IA 5D18A 2VASA 5IPAA 5JDHA 2ES0A 3NWIA 3PASA 3GZIA 4GOUA 1J5ET 1ORKA 2JJ9A 4UR9A 3PUYF 1MNEA 2KWHA 3QB5K 2WU2A 3QBMA 5FKLA 3I1AA 3CMLA 3ZQGA 2WDQA 3WAJA 4CQIA 4DV2T 4W1UA 1D1CA 2J62A 3QOFA 4HKAA 2YDSA 5AQNB 2W00A 3IEEA 5ABEA 3RIUA 1FMWA 3HTAA 4TWDA 1FJGT 2WMOA 2W61A 4DV6T 2EH3A 3C50A 2WDRA 2XQ3A 2WBLA 2NP5A 3ZN0B 5LHIB 5DJQC 2E2AA 4K0KT 3ZSSA 3IH3A 4M3EA 4ZHQE 3N5LA 1M7KA 4IIJE 4YXDA 2Y48B 4AC6A 3HKEE 4L62A 2FJEA 2Y31A 2DWKA 2YU2A 3CX8B 4JYAT 3OKQA 2UU9T 3KKCA 3C4XA 4MXMA 3VP5A 5AQQB 3V78A 2BG9A 5JRCA 2JPFA 4CN4A 4ILCA 1T98A 5HBUA 5C8YE 1UX5A 5CA1E 1XDOA 3OTOT 2CHOA 2A72A 4U7YA 4XBFB 5AQLB 2RASA 1YKHB 1N33T 4OYKA 5L4EA 5LB7B 4HFVA 4GKKT 5JTGA 3BHQA 4JI4T 3PUZF 2JQ9A 2CMRA 4I0UA 3CQXC 4M1PA 4DV4T 4U74A 4AKRB 4B3RT 4P0AA 3S5RA 4EZHA 5JREA 2C5IT 2XAFB 3MKDA 2LRLA 2XHEB 4O2BE 3ON4A 1IBLT 1E1HB 3VVXA 2RA1A 5FKKA 2NX4A 5J1GA 3OVUA 2QOPA 2XRLA 4PJJA 4QH5A 3RI5A 2LOSA 2X0HA 4YSZA 1D0YA 3CK6A 1XWMA 2JK3A 4LMJA 2BBJA 4N78D 2KXPB 5BMVE 2G7LA 4BA9A 3UUXB 4MFRA 3ZMVB 4XK4A 4CXYA 5HYAA 3UQ4A 2J47A 3P4SA 3BR2A 2A9UA 3B13A 4ZS2A 4DBQA 4Z91A 3PJAA 4B3ST 3B5MA 4IE7A 2BBHA 3F1BA 3JC6D 4P09A 2Z6EA 3ZC1A 5FL1A 4O4HE 2KNDA 3LK3B 3AE7A 3O8GA 2QTQA 3AEDA 1W09A 4AKHA 4DR1T 2W66A 4JUYA 2X66A 2PJQA 2YKSA 4DR5T 1X79A 4B1RA 2XGCA 2LEHA 5LG4A 3SS1A 4HWCA 2FBWA 1XDPA 2BS4A 4JL3A 2Q24A 3G1OA 4X62T 3KVAA 3DP7A 2PG8A 1HR0T 4LFAT 2ZM8A 3ANGA 5GPAA 4H9NC 3HKBE 5ADXL 3F0CA 3L3PA 4YHJA 3EHZA 3UU4A 3KFWX 3ZCJA 4M3BA 3ESLA 3UFGA 2ID3A 3I9YA 5FY1A 3JADA 3RC3A 4X1IE 4IGUA 5DAJA 3ZMZB 2UXBT 1VCTA 3FRQA 3I0OA 4NXMT 3VTIA 4F6RC 2Q9QC 2ZLYA 2L9QA 5J2UE 1IJ6A 1MMNA 2VKEA 2LRKA 1YQ4A 3G06A 3N9LA 3U78A 1WYBA 3B57A 1OEDA 4B3MT 4XZCA 2WWVA 3VOXA 4OD4A 4HFBA 4D5FA 2C0SA 2J1DG 5J1RA 1GQEA 3HA4A 3RH2A 2W63A 2VWAA 3RX6A 4UXNB 3AE5A 2VVSA 5FKMA 3ONJA 2JRKA 4JYKA 4O2AE 2A3DA 3O9XA 3COLA 2DI4A 3RRCA 5JVDE 5KDMC 4ILAA 5JDGA 3CWRA 2V6YA 4O8SA 5FHPA 3QPLA 3Q0WA 5H6RB 4CI1B 3AECA 5L3CB 2CXFA 5FNVE 2TCTA 4ZZBA 4HFCA 2NTYA 3PE0A 2K48A 4C90A 3G7RA 5CXIA 3HIMA 3ETUA 2REKA 2VQFT 3IF8B 2RP4A 2WS3A 5LJMA 5F08A 5FP3A 5L2LA 1MNDA 2HQ5A 4QWNB 4COFA 4M3FA 2LM9A 1IAPA 2OV9A 4O4JE 2YVEA 3C07A 3GEUA 3L09A 2NP3A 3PUQA 4ZS3A 2XM2A 2E9XB 4KUMB 1B7TA 2E8IA 3GN5A 2DG7A 1WYCA 3QB5A 3FK6A 4IDQA 3RH3A 2K3WA 2UXUA 2MTQA 4IHJE 4WNKA 5AQIB 3H3MA 2LJLA 1VI0A 4ZZCA 1N36T 2FJ1A 1UCUA 4DV7T 4DV5T 4LF5T 4AKGA 5EFYA 2E9XC 3OYZA 3RYFE 4A97A 2B1EA 5AQSB 3AE2A 2N9DA 2KSRA 1JUSA 3AB3B 3ANWB 1UK5A 2IHR1 5H9TA 1LRZA 4YTPA 4X1KE 3PURA 1HTJF 2K24A 3O1HA 2WCAA 5LXTE 2WZIA 4AQYT 1MMAA 2I6HA 1HX1B 3MACA 4LF7T 2BKPA 2HPJA 4GYRA 4PJLA 3A7MA 1XNQT 3UTKA 3G1MA 3NRXA 3PTRB 2GFNA 5F8PA 4HN9A 3NXCA 4EAHA 3O1JA 5KXJA 3I0QA 5C2TA 1BJZA 2V8SV 4UV8B 2D2SA 4QX7B 5EYRA 3BTCA 1DU2A 3UFEA 3HTJA 3M3ZB 3PUGA 5HXCA 3LK42 3WI3A 1H7CA 3FBLA 4H9RC 4EV6A 4A56A 5JR9B 3PM1A 4L5GA 3CQCB 4OFZA 2HN1A 2OF7A 4I6ZA 3T6NA 1T72A 2A2FX 2XSBA 4X5TA 4DW6A 3LBXB 3P50A 5ABFB 1BR2A 2ACZA 4ICHA 4UDSA 3IH2A 3CVRA 1OWAA 5HWXA 3HGYA 3MK7C 5LGUB 5EK2A 5JR9C 3LDQB 4G12A 2M6IA 2UUCT 2DL1A 4U9NA 1QPIA 5CGMA 4QHOA 5AQMB 2FJAA 3VRAA 3H3AA 3MA9A 2NTXA 1T56A 3BR5A 4DV1T 3P4QA 3FZHB 2CM0A 3E7QA 1WCRA 4JI6T 1KF6A 3ZQFA 3LOCA 3BR0A 3UUNA 4UV9B 2UXIA 2Y30A 1JTXA 5HAXA 2IMLA 1U4QA 2XSAA 2D0TA 3GN5B 3MXZA 4LFCT 3LHQA 2BKOA 4DO0A 4WYVA 2R7QA 4ZI2D 1RPWA 3NKZA 3BT9A 3AE1A 5AFUL 4W97A 3V6GA 1HNZT 2E5LT 3C2BA 2MYSA 2JQHA 3BTLA 5FGLA 4ILBA 1M62A 1CUNA 3AA0B 2VQET 2XUEA 3LJLA 3AAEB 4GKJT 2ZCXA 3BNIA 2UXNB 4JI0T 5HSZA 2YN6A 4O4LE 3RQWA 4GCTA 3ZN1B 4HKUA 5FVKA 1HFAA 4ZXLA 4ABZA 2M67A 4JEUB 3O60A 2YU1A 4TWHA 4NXNT 1SE7A 2JMKA 2UXPA 4H9SE 3FIWA 2EHOC 3N9PA 2X9YA 4EYUA 5F0HA 3PU3A 4HWHA 1I94T 3CWZB 3NZQA 5LP6E 5E0OA 3W15B 2XGEA 3K3QC 2WQYA 2BS3A 3NPIA 2QYWA 3SFDA 2FJBA 2NW9A 3VW0A 4CN6A 2MBGA 5K7FA 2W4XA 2NS7A 2AXDS 3LSPA 3CDLA 2D5UA 2HPLA 2LHRA 4UVBB 3N2KE 4H63H 1Z8UA 3ZPOA 1ZP0A 3QQAA 2K5BB 4JBWF 5FY7A 4I4TE 4GYSA 3KINB 3FK7A 3QUJA 5JDLA 3NS4A 5JQGE 3RKOA 1BR4A 3C51A 5AQVB 1MIVA 2D9DA 3Q0UA 2IAKA 2XQ4A 2ZOYA 3ZCIA 2XM1A 5JDNA 2SPCA 3CIRA 2RPAA 5L3EB 2ODUA 3I9WA 3TP0A 3BR6A 5J0ZA 3RLFF 1MMGA 3PUWF 3RPUA 3ZMTB 2V7LA 1NAFA 4YZEA 2XAJB 4JLEA 1WR0A 4KHPT 2ZM2A 5EK4A 3EVYA 2W67A 2LSYA 3AQTA 5IOZA 2Q9QA 2QCOA 2I10A 4CGRA 2XPWA 1ZOYA 2WAUA 3TLUA 3O4XE 2RHAA 3CRJA 3VVYA 3VPRA 5AQJB 1US7B 4UEMA 3FXDB 2KINB 4EXTA 4GFLA 2G3BA 2KT9A 3M65A 4X65T 2LKGA 1W0BA 2G7SA 2HN2A 4HWDA 4TZ4C 2G0EA 3HGGA 3PU8A 2F07A 2PZ9A 4OX9T 3FZMB 2UXOA 2WY2A 4QXCB 2X6OA 3ABVA 3PV0F 4FI5A 4PFPA 1N32T 1T33A 3ZYMA 3HE0A 2YVXA 3VUQA 3UU5A 4ZI3C 1R8IA 4IL4A 4DIDB 4JI3T 2ZCMA 2W62A 3PUVF 5LA6E 1HNXT 3ONLC 3QK6A 3FBZA 5HXEA 4WIBA 3L39A 3IHRA 2WV1A 4NN1A 5EZYE 1S94A 4X66T 4V2GA 1QLBA 1QVUA 1SHZC 4B6XA 2V7IA 4PFOA 2FBQA 2H7OA 2XAQB 5H6QB 4EIWA 4UF0B 4HE8A 1HNWT 3OYXA 3R6NA 5HEOA 2HHHT 3KV5A 3V5UA 2RAEA 5IWAT 1FMVA 1D1AA 1S35A 4JI5T 2ZOZA 4AISA 3GWHA 2G0UA 3LSRA 3ZSTA 3N9NA 2E9XA 2NWBA 4M3DA 1A6IA 1WFDA 3AQSA 2BVLA 2WP9A 3QC9A 1L0VA 3F2EA 1HF8A 2PTFA 2H88A 5FMNA 1WR6A 1QVTA 5LCYA 5J1UA 4NPPA 1ZV4X 3RIAA 4L0RA 5HXRA 2QRXA 2XAHB 2Q9QB 3ANWA 1XMOT 2QIBA 1XZYA 5LG3A 4EGWA 2WGBA 4EEDA 1G73A 3RD3A 4YSXA 4D7NA 2IEKA 3SWHA 2O7TA 1JNZA 2JJ7A 3CCYA 4LF4T 5GONE 2IAIA 4TWFA 5CXGA 2GK9A 3AA7B 4DVDA 5GP9A 3MVPA 3EDUA 3N2OA 3NZPA 3AA1B 1J5WA 4KWAA 1MIYA 5HAWA 3CX7B 3JAEA 2K9AA 3L8RA 2FQ4A 4G2AA 1UI5A 4QH1A 2BVMA 2R7SA 4QX8B 2CCQA 3ZEFB 3GMIA 2WU5A 3U3IA 5JR9A 3FB2A 3HR0A 3RC8A 2G7GA 2VKJA 2CXLA 3VR9A 3WAKA 4JI2T 3TLWA 5LHGB 2W0GA 3LBXA 3CJDA 3VRBA 5ABFA 3BQZA 3P9TA 3RIFA 3VW1A 2R7UA 5LOVE 2ACXA 3RQUA 3D0TA 4H9QC 3A5XA 2V5DA 4TNWA 2VKHA 4ASKA 5EZHA 1W0AA 2Y2ZA 5JH7E 4BJMA 4H9PC 2BG9E 3BQKA 5FKYA 4HFIA 2XASB 5J2TE 1IZNB 4U9LA 4OHFA 5IHYA 3T1HT 3B6CA 4KX6A 5GPCA 4DV0T 3QKXA 3LWJA 4YHHT 3G56A 4ME9A 2PBXA 4GK5E 5M4YA 4TX5A 4GCLA 3CQGB 3Q5EA 3UU6A 4XAXB 4NELA 5AQUB 2ZY9A 2V7JA 3ETVA 3IA3A 3F31A 3N9MA 1HX8A 3AEEA 1YW0A 3NI7A 4EZ4A 4TN7B 4IE4A 5HEJA 3UT5E 2WMNA 2EHOA 2JQKA 3IUVA 5LGNB 2CLYB 3G1LA 3E22E 3BRUA 5AQCA 1D0ZA 4YJ2E 2L3LA 5CB4E 3P7IA 3ZT6A 2UUBT 5ABGA 3Q3SA 4U31A 3ZJ2A 4HFEA 4DNDA 5HWYA 3ZQLA 1JT6A 2CLYC 4U7IA 3KVBA 3J7Yq 5FYMA 2NOXA 3CKDA 3VR8A 1UGOA 2XQ5A 4V2FA 5L3GB 5HEGA 2XQAA 2Y8DA 3AE9A 2WB5A 2E5VA 2CWYA 5LBQB 4HEAA 4NIQA 5J3LA 4AUXA 2XPKA 1KNRA 4GK0E 2CRBA 4CZZB 2VL0A 2V57A 2DNXA 3AE8A 4D7MA 1HG5A 3HTHA 4PJNA 5FL0A 4E7ZA 2KWIB 2FD5A 4HWFA 4YTMA 1T7SA 5LMUT 2VVNA 5LYJE 4ISSA 5L3FB 4EB6E 3DPJA 4HGAA 4ADZA 4IDZA 4KMCA 2LM2A 1LVFA 2C5JA 3F57A 5EK3A 3WHCA 1OEDC 2R7TA 4PNIA 4LF8T 4WW0A 3RYIE 5F0CA 1D1BA 5KMGP 3AAAB 3AEGA 3S4UA 1UURA 2LOPA 1XMQT 4DR4T 3P4WA 3BR1A 4IDPA 3PUAA 5TAOA 4ILUA 4JI7T 4MHCA 2XQ8A 2XQ9A 3VHLA 1BR1A 1ZEEA 2UXXB 4DBRA 2ZM6T 1IBMT 3VU7H 3DTOA 1YD8G 2HXOA 3P8CD 4UELA 2N1GA 3NBXX 1FEWA 2Y6XA 3JC6C 2LE8A 1T8BA 3EUPA 3E08A 5CA0E 3EGQA 1G8XA 2Q9QD 1IBKT 1MIWA 4JI1T 2JIWA 5K58A 1OEDE 3TLSA 3RHWA 2I59A 3Q0VA 4UVAB 5DQWA 2O7OA 5HCMA 2EHOB 1SA0E 5IYZE 5ETWA 2IU5A 2DCFA 4KI0F 4AI6A 4QKNA 1W9RA 3JCFA 4PK5A 2LKHA 4CXWA 3FZKB 4U33A 4MBQA 2V1DB 4CI3B 4C91A 5F1JA 3AXJB 3OPCA 3PUXF 5HXHA 2ZMAA 2MAWA 5FXZA 2KLQA 2B76A 3KZ9A 2QWTA 4LF9T 4P1NA 2XPVA 3KYLA 4BJNA 5L47A 4PAGA 3JSJA 1ZKEA 2DG8A 1V9DA 5HEHA 1JNRA 3AAIA 3X1DA 2QKOA 3RF1A 4IL9A 3NNRA 3KNWA 2YINA 1QUUA 2YDRA 1SGMA 4MLKA 4QXBB 5LGTB 5IOYA 4JI8T 2HH7A 4L9IA 3VOKA 1Y01A 4AKIA 3TP3A 3LJCA 3TLTA 1WLXA 3J9X1 3HL6A 3T8OA 3RYCE 2W2UA 4UF0A 3DCFA 4E7SA 2MPKA 3UUBA 4KP3C 2KZ7B 5K7HA 2TRTA 5F27A 2OPTA 2BKNA 2DTZA 3BK9A 2UXCT 2CHNA 4X20E 3PJAJ 1Z0PA 3FXEB 5LJNA 4PK4A 1VRBA 3AEFA 5FXXA 3MJXA 4DV3T 2E9XD 2CBJA 2MOZA 2X67A 5F0FA 3EDVA 4K0UA 4U72A 4PK6A 4Z90A 2NR4A 2B3WA 4CI2B 3AEAA 2VPRA 5EZGA 4ZI7E 3AA6B 4LF6T 2GUHA 2CWOA 3EAMA 2PFVA 2M6BA 4DR2T 1U5PA 3WHBA 3UUMA 4I55E 2WSSV 4WZXA 5AQHB 4U2YA 5FKNA 3LK2B 1VOMA 2IC9A 2JMHA 4C2MA 2X51A 3TKLB 3JAFA 3K3OA 2ZM0A 5AQPB 1NENA 2XTLA 3DJBA 2WM9A
chains in the Genus database with same CATH topology
4PJMA 3CX7B 4PJLA 2R7WA 3UTKA 4NUVA 2K9AA 3NRXA 4G2AA 3PTRB 5F8PA 4HN9A 4AQGA 4EAHA 5A1LA 5KX5E 3O1JA 4DVYP 3I0QA 2D0UA 1NWMX 2BVMA 2R7SA 4QX8B 2CCQA 4AQFC 4UV8B 2D2SA 4QX7B 3ZEFB 3GMIA 3C98B 5DABA 4YFSA 3UFEA 3O1IA 5JR9A 3FB2A 3HR0A 3U3IA 2VASA 3PUGA 5JDHA 2ES0A 5HXCA 3RC8A 4GOUA 2VKJA 4JEHB 2JJ9A 1MMDA 2CXLA 1MNEA 2KWHA 3WAKA 3LK42 3WI3A 4MALA 5LHGB 1H7CA 2W0GA 3FBLA 3LBXA 4H9RC 5JDFA 4A56A 5JR9B 3I1AA 4L5GA 2R7UA 3BQLA 3CQCB 4KBMB 4OFZA 5LOVE 2BZBA 3CMLA 2ACXA 3WAJA 3MZKB 2A2FX 3D0TA 4CQIA 4H9QC 4HTEA 3A5XA 1D1CA 2VK9A 4OYJA 3ZYKA 2VKHA 3LBXB 3PUSA 4ASKA 4HKAA 1BR2A 5JH7E 4H9OC 2W00A 3IEEA 2CXDA 3CVRA 1OWAA 5HWXA 4BJMA 1YKEB 3MK7C 4H9PC 1FMWA 2XQYA 5LGUB 5EK2A 5JR9C 3BQKA 2WMOA 2W61A 5LG4A 2XASB 3C50A 3EUHA 3ZJ1A 5J2TE 2WBLA 5L3DB 4QHOA 2DLRA 1IZNB 4UIGA 4OHFA 3ZN0B 5IHYA 3CX6B 3H3AA 3MA9A 5LHIB 5DJQC 4FJOA 2NTXA 3Q5XA 4ZHQE 3N5LA 4IIJE 2Y48B 3KV4A 3HKEE 4GK5E 5M4YA 2CM0A 4TX5A 2V26A 3CQGB 2DWKA 2VL8A 4IRVA 3UUNA 4XAXB 4EOZB 4UV9B 1HG2A 4I50E 4Z8XA 2YU2A 5HAXA 3CX8B 1U4QA 3Q5WA 2V7JA 3ETVA 3F31A 2D0TA 3N9MA 3GN5B 3OKQA 1HX8A 3MXZA 1YW0A 4EZ4A 2LT3A 3DU6A 3C4XA 1QSDA 4TN7B 4IE4A 4DO0A 2EHOD 3UT5E 2WMNA 2NW8A 2EHOA 2R7QA 5LBMA 2CE7A 1HCIA 5JRCA 4ZI2D 5LGNB 2CLYB 2LSJA 3E22E 2JPFA 4OK0A 5AFUL 1T98A 3KV9A 5C8YE 1UX5A 5CA1E 2MYSA 5CQGA 4IE6A 1D0ZA 5FY0A 4YJ2E 1CUNA 1OXZA 2L3LA 3AA0B 5CB4E 2XUEA 3P7IA 2A72A 4DMVA 3AAEB 3KDSE 3AVSA 5JRCB 4TV8E 2UXNB 3ZJ2A 4XBFB 4DNDA 5HWYA 1YKHB 4OYKA 3ZMTB 1HS7A 4O4LE 3ZN1B 1AJ3A 4HFVA 4ANJA 1HFAA 2CLYC 3KVBA 3KBUA 5FYMA 3J7Yq 2M67A 4JEUB 2CMRA 3CQXC 2NOXA 3CKDA 4M1PA 2YU1A 2R7OA 1D0XA 2FJI1 4U74A 4AKRB 2JMKA 2WWUA 4P0AA 2LSIA 4H9SE 3DU5A 5L3GB 3VKHA 2EHOC 3N9PA 5FXVA 2X9YA 4EYUA 2Y8DA 4EZHA 2C5IT 2XAFB 2OA5A 5JREA 3MKDA 2XHEB 4ZI2C 4O2BE 2CWYA 3HKDE 3PU3A 5LBQB 3CWZB 4HEAA 3NZQA 5LP6E 5E0OA 4H63V 3OJAA 3W15B 1E1HB 3K3QC 2RA1A 5DQVA 4GK0E 5J1GA 4CZZB 2NW9A 4PJJA 3E0ZA 2DNXA 5JDMA 2MBGA 2LOSA 4YLHA 1HG5A 4PJNA 4E7ZA 2KWIB 1D0YA 4N78D 2KXPB 2D5UA 2HPLA 5BMVE 2LHRA 4BA9A 2DHRA 4MFRA 3UUXB 2V7MA 3ZMVB 1IJ5A 4TUYE 4CXYA 5HYAA 4UVBB 3N2KE 4H63H 3ZPOA 5LYJE 2K5BB 4ISSA 5FY7A 5L3FB 4I4TE 3B13A 3K3NA 4ZS2A 4GYSA 4EB6E 4DBQA 4HGAA 5HXSA 3KINB 4ADZA 4IDZA 3QUJA 5JDLA 3N9OA 1LVKA 4KMCA 4IE7A 1LVFA 3NS4A 2C5JA 3F57A 5JQGE 3JC6D 5EK3A 4P09A 2R7TA 2Z6EA 3RKOA 1BR4A 3C51A 3ZC1A 2R7VA 1MIVA 3PDYA 4PNIA 4BAYB 2IAKA 4WW0A 3RYIE 4O4HE 3ZCIA 2KNDA 2DWGA 1D1BA 3LK3B 4I43B 5KMGP 3AAAB 3S4UA 2LHNA 5JDNA 2LOPA 2SPCA 3PUAA 5L3EB 3SOLA 5TAOA 2ODUA 4ILUA 3IBPA 4AKHA 3I9WA 1KK7A 4MHCA 3VKGA 4JUYA 4UVCB 2X66A 3VHLA 2QGSA 2PJQA 4ZOLE 1MMGA 1BR1A 2R7XA 1ZEEA 1X79A 2UXXB 4DBRA 2X9HA 4G63A 2C5KT 2LEHA 3RPUA 3RYHE 3V5SA 2V7LA 2H3RA 3SS1A 1NAFA 3VU7H 3DTOA 3ZMUB 1YD8G 5F3JA 2XAJB 3P8CD 4JLEA 4CXXA 2ZM2A 4UELA 2N1GA 2X68A 3R84B 3NBXX 1FEWA 2Y6XA 3JC6C 3RRWA 5EK4A 2LE8A 3EVYA 3E08A 5CA0E 2L8KA 1G8XA 2LSYA 2Q9QD 3KVAA 2Q9QA 3DP7A 2PG8A 2ZM8A 1MIWA 2WAUA 4H9NC 3HKBE 5ADXL 3SRZA 5LNKA 3BQIA 3L3PA 4YHJA 2I59A 3KFWX 3O4XE 3ZCJA 4UVAB 3ESLA 2VKDA 4PW8A 5DQWA 3LG7A 2EHOB 1SA0E 2VB6A 5IYZE 3ZMSB 3I9YA 5ETWA 5FY1A 3RC3A 1US7B 4UEMA 4X1IE 3FXDB 4IGUA 2KINB 4EXTA 1KNZA 3HKCE 2DCFA 3ZMZB 4AI6A 2KT9A 4QKNA 2CEAA 4ZI3D 3I0OA 1WRDA 3M65A 4PK5A 4IE0A 3VTIA 4F6RC 4CXWA 4MBQA 2Q9QC 2V1DB 4CI3B 2ZLYA 4TZ4C 4C91A 5HXHA 2L9QA 2ZMAA 3PU8A 5FXZA 2KLQA 3UULA 3ZC0A 5J2UE 1IJ6A 3AVRA 1MMNA 3OBVE 3KYLA 3KBTA 4BJNA 4PAGA 2X0LB 1Y64B 3N9LA 1ZKEA 4QXCB 3U78A 1WYBA 3B57A 4ERRA 1V9DA 4GIWA 4XZCA 3AAIA 4OD4A 3ZLIA 2YK0A 4FI5A 4P0BA 4PFPA 1LKXA 3HI2A 2YINA 2C0SA 4NUUA 1QUUA 2J1DG 3ZYMA 2JQQA 4ZI3C 3HA4A 4MLKA 2W63A 4QXBB 2VWAA 3RX6A 5LGTB 4UXNB 2W62A 2HH7A 4L9IA 5LA6E 4V1Av 4AKIA 3LJCA 1O3XA 2JRKA 2ODVA 1WLXA 3FBZA 3QK6A 3J9X1 3HL6A 4O2AE 3T8OA 2A3DA 5HXEA 3O9XA 3IHRA 1BR0A 2VKOA 3RYCE 3ONXA 2DI4A 3RRCA 3Q9DA 4UF0A 5JVDE 5KDMC 5EZYE 1S94A 5JDGA 2X9WA 4B6XA 4E7SA 1SHZC 2XAGB 4O8SA 2V7IA 4PFOA 4TV9E 4KP3C 4YJ3E 5FXWA 5H6RB 2KZ7B 4CI1B 4J2CA 2H7OA 2XAQB 1UX4A 2V7KA 5L3CB 2CXFA 3Q2MA 3FHNA 3C4ZA 5H6QB 5FNVE 3K8PC 2YEVC 3H37A 3LFMA 4EIWA 2NTYA 3PE0A 4UF0B 2K48A 4HE8A 3BK9A 4C90A 3OYXA 3R6NA 2R7RA 4X20E 2LSGA 3KV5A 4X1YE 3V5UA 1Z0PA 3FXEB 3ETUA 5LJNA 1FMVA 1D1AA 3IF8B 2RP4A 4PK4A 5JDQA 1VRBA 1S35A 3C4WA 5LJMA 5FP3A 5L2LA 5FXXA 3N9QA 2BDEA 3MJXA 4WBOA 1MNDA 3C64A 3GWHA 2G0UA 2LSKA 2E9XD 4QWNB 3N9NA 2E9XA 2NWBA 2MOZA 4EYYR 2LM9A 1IAPA 2NW7A 2X67A 4O4JE 4IE5A 4WBNE 2BVLA 3EDVA 3QC9A 4ISTA 4K0UA 1ZHCA 1FIOA 4U72A 4PK6A 3L09A 3F2EA 3PUQA 4ZS3A 1HF8A 2B3WA 2E9XB 4KUMB 4CI2B 1B7TA 2E8IA 3GN5A 2X9XA 5FMNA 1WR6A 1WYCA 2P9BA 3GA8A 3RH3A 2CA5A 5LCYA 4OD5A 2MTQA 2PBIA 4IHJE 1ZV4X 4WNKA 4L0RA 2LJLA 4AKLA 4ZI7E 5HXRA 2N2NA 3AA6B 2XAHB 1UCUA 5L3BB 2Q9QB 2CWOA 3ANWA 3ZYLA 2PFVA 4AKGA 4O4IE 3CPZA 2E9XC 1G73A 5LHHB 3OYZA 2QA7A 3RYFE 2B1EA 4QXHB 2IW5B 3SWHA 2N9DA 1U5PA 3UUMA 3AB3B 3ANWB 5GONE 4AQFA 4I55E 2KMFA 2WSSV 2NP9A 1LRZA 1EZ3A 3N2GE 4DMWA 4AXPA 2GK9A 3KV6A 4X1KE 3LK2B 3AA7B 1VOMA 2IC6A 4DVDA 1HTJF 2IC9A 4C2MA 2JMHA 2K24A 3O1HA 3PURA 2X51A 5LXTE 3TKLB 3EDUA 3NRYA 3N2OA 2H7VC 1MMAA 3NZPA 3MACA 3K3OA 3AA1B 2ZM0A 2XTLA 3DJBA 2HPJA 1MIYA 4GYRA 2WM9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A2F X;  3FHN A; 
#chains in the Genus database with same CATH topology
 4PJM A;  2FX0 A;  3EI0 A;  4AQG A;  5A1L A;  5KX5 E;  4DVY P;  2D0U A;  4AQF C;  2LLY A;  3B81 A;  1J1J A;  4YFS A;  1I6Z A;  3RKG A;  2HXI A;  4JEH B;  1MMD A;  4YTN A;  2ZCN A;  4MAL A;  5JDF A;  2V5C A;  4M3G A;  3BQL A;  4KBM B;  2BZB A;  1X9B A;  1N34 T;  3MZK B;  3FZF B;  4HTE A;  5CJ5 A;  2VK9 A;  4OYJ A;  3ZYK A;  3PUS A;  1Z77 A;  4H9O C;  2CXD A;  1JTY A;  1YKE B;  3VW2 A;  2XQY A;  4X1E A;  4Q25 A;  3NVO A;  3QPS A;  3ZJ1 A;  3EUH A;  5L3D B;  5AQO B;  2DLR A;  4UIG A;  1KEY A;  2WUI A;  3CX6 B;  3SDG A;  4FJO A;  4JV5 T;  3RGL A;  2VKV A;  5F5W A;  5AQG B;  3Q5X A;  3KV4 A;  4A98 A;  3P4P A;  3ON2 A;  2V26 A;  5K7Z A;  2VL8 A;  4IRV A;  4YSY A;  4EOZ B;  1HG2 A;  4I50 E;  4Z8X A;  2IIU A;  3RIU C;  1XNR T;  3Q5W A;  3TLV A;  2XZE A;  2LT3 A;  3DU6 A;  1QSD A;  4D5C A;  4EEB A;  2EHO D;  2NW8 A;  5LBM A;  2CE7 A;  1HCI A;  3AE4 A;  4LMK A;  2LSJ A;  4OK0 A;  2UXH A;  3KV9 A;  3SFI A;  5IP6 A;  4F8H A;  5CQG A;  4ZEY A;  4HWI B;  5FY0 A;  4IDN A;  1E7P A;  1OXZ A;  1YQ3 A;  2BG9 B;  4TNV A;  3VVZ A;  3KDS E;  4DMV A;  3AVS A;  5JRC B;  4TV8 E;  5LMN T;  2R6G F;  1HS7 A;  1UUS A;  2XB5 A;  2IDO B;  1AJ3 A;  4ANJ A;  3KKD A;  3KBU A;  1KNP A;  2R7O A;  1D0X A;  2FJI 1;  2V6X A;  2WWU A;  2LSI A;  3DU5 A;  3VKH A;  1E2A A;  2BG9 C;  5FXV A;  2OA5 A;  5J1Y A;  1NEK A;  4ZI2 C;  3HKD E;  4A5X A;  2ZB9 A;  5C4Y A;  4H63 V;  3OJA A;  5DQV A;  4X64 T;  2YOE A;  3E0Z A;  5JDM A;  4MO7 A;  4DUZ T;  4AIU A;  4YLH A;  3O8H A;  1SUM B;  3BJB A;  1RKT A;  2X0Y A;  2DHR A;  2V7M A;  1IJ5 A;  4TUY E;  5FMP A;  5HEU A;  5BR8 T;  3AE3 A;  1CHU A;  3K3N A;  4YT0 A;  4IRE A;  5HXS A;  3BTJ A;  3N9O A;  5F04 A;  1LVK A;  3LSV A;  5C3J A;  2QVA A;  3UU3 A;  4ACI A;  2R7V A;  2XGD A;  3PDY A;  1Z0X A;  3EAB A;  2HYJ A;  4BAY B;  2DWG A;  4I43 B;  2LHN A;  3ZKR A;  2XY8 B;  3SOL A;  2X9D A;  3IBP A;  2WZH A;  1KK7 A;  3VKG A;  4UVC B;  2QGS A;  4ZOL E;  5D19 A;  2R7X A;  3FZL B;  2OER A;  2X9H A;  5IUX A;  3BTI A;  4G63 A;  2C5K T;  3V5S A;  1YXR A;  3RYH E;  3ZMU B;  2H3R A;  2AE9 A;  3B6A A;  5F3J A;  4CXX A;  2X68 A;  4B3A A;  3R84 B;  3RRW A;  2FJD A;  2L8K A;  3SRZ A;  5LNK A;  3NRG A;  4DR7 T;  2XPU A;  3BQI A;  1VCS A;  4B3T T;  2UUA T;  2VKD A;  4PW8 A;  3LG7 A;  2VB6 A;  3ZMS B;  4AC0 A;  3Q5D A;  3AE6 A;  1KNZ A;  3AXJ A;  3HKC E;  3K1S A;  1ZKG A;  1UI6 A;  1ZK8 A;  2CEA A;  2CBI A;  2CPT A;  2YDQ A;  4ZI3 D;  3ZQI A;  1U9O A;  5HCJ A;  1WRD A;  4IE0 A;  5CFB A;  3UUL A;  3ZC0 A;  1U9N A;  3AVR A;  2YVH A;  5AQT B;  2WDV A;  3OBV E;  4LFB T;  4MK6 A;  4DR6 T;  3KBT A;  2X0L B;  3UQ7 A;  1Y64 B;  4ERR A;  4GIW A;  2IBD A;  4HFD A;  3ZLI A;  2YK0 A;  2H89 A;  4P0B A;  1RKW A;  4PXI A;  5AQK B;  1LKX A;  3HI2 A;  4NUU A;  2JQQ A;  2D6Y A;  5L4H A;  1OED B;  2GBY A;  4HFH A;  2ID6 A;  2HYT A;  2F4V T;  5AQF B;  4V1A v;  5AQR B;  3BQY A;  1O3X A;  4JNN A;  2ODV A;  2OI8 A;  1BR0 A;  2VKO A;  3ONX A;  2GEN A;  3Q9D A;  2I0M A;  5FVL A;  2X9W A;  2XAG B;  3ZQH A;  4TV9 E;  5FXW A;  2W53 A;  3MNL A;  4YJ3 E;  3P4R A;  4IT4 A;  4J2C A;  1UX4 A;  3AEB A;  2BS2 A;  2V7K A;  3Q2M A;  3FHN A;  3C4Z A;  3K8P C;  2YEV C;  4AF5 A;  3H37 A;  3LFM A;  4GFK A;  2R7R A;  2V6Y B;  2LSG A;  4X1Y E;  4DR3 T;  5JDQ A;  3DEW A;  3C4W A;  5ABH A;  3N9Q A;  2BDE A;  4WBO A;  3C64 A;  2XQ6 A;  2LSK A;  2FUP A;  2UXD T;  4EYY R;  2NW7 A;  1JUM A;  4IE5 A;  4WBN E;  4I76 A;  4IST A;  1ZHC A;  1FIO A;  4GCK A;  3QNU A;  4U3C A;  2X9X A;  3UU8 A;  4QH4 A;  2P9B A;  3IH4 A;  3GA8 A;  4IDO A;  2CA5 A;  4OD5 A;  2PBI A;  3T1Y T;  4AKL A;  4KHZ F;  2N2N A;  5L3B B;  3ZYL A;  1JT0 A;  4U2Z A;  4O4I E;  3A8Y C;  3CPZ A;  5LHH B;  2XQ7 A;  2QA7 A;  4QXH B;  2IW5 B;  3VIB A;  4AQF A;  4DUY T;  2J4G A;  2KMF A;  3PPB A;  2NP9 A;  5D1R A;  4YY3 T;  5CW8 A;  1EZ3 A;  3N2G E;  4DMW A;  4AXP A;  3KV6 A;  2IC6 A;  2IUB A;  2NS8 A;  2XJ7 A;  3ANP A;  3NRY A;  3BR3 A;  2H7V C;  1KFY A;  4IE6 A;  3ZT7 A;  3SFE A;  2R7W A;  1JUP A;  2HKU A;  4NUV A;  4CN1 A;  2OLT A;  3LSJ A;  4JKZ A;  3HTI A;  1NWM X;  3BCG A;  2VUR A;  5FKO A;  2XDN A;  4LML A;  3ZT5 A;  3C98 B;  5DAB A;  3O1I A;  5D18 A;  2VAS A;  5IPA A;  5JDH A;  2ES0 A;  3NWI A;  3PAS A;  3GZI A;  4GOU A;  1J5E T;  1ORK A;  2JJ9 A;  4UR9 A;  3PUY F;  1MNE A;  2KWH A;  3QB5 K;  2WU2 A;  3QBM A;  5FKL A;  3I1A A;  3CML A;  3ZQG A;  2WDQ A;  3WAJ A;  4CQI A;  4DV2 T;  4W1U A;  1D1C A;  2J62 A;  3QOF A;  4HKA A;  2YDS A;  5AQN B;  2W00 A;  3IEE A;  5ABE A;  3RIU A;  1FMW A;  3HTA A;  4TWD A;  1FJG T;  2WMO A;  2W61 A;  4DV6 T;  2EH3 A;  3C50 A;  2WDR A;  2XQ3 A;  2WBL A;  2NP5 A;  3ZN0 B;  5LHI B;  5DJQ C;  2E2A A;  4K0K T;  3ZSS A;  3IH3 A;  4M3E A;  4ZHQ E;  3N5L A;  1M7K A;  4IIJ E;  4YXD A;  2Y48 B;  4AC6 A;  3HKE E;  4L62 A;  2FJE A;  2Y31 A;  2DWK A;  2YU2 A;  3CX8 B;  4JYA T;  3OKQ A;  2UU9 T;  3KKC A;  3C4X A;  4MXM A;  3VP5 A;  5AQQ B;  3V78 A;  2BG9 A;  5JRC A;  2JPF A;  4CN4 A;  4ILC A;  1T98 A;  5HBU A;  5C8Y E;  1UX5 A;  5CA1 E;  1XDO A;  3OTO T;  2CHO A;  2A72 A;  4U7Y A;  4XBF B;  5AQL B;  2RAS A;  1YKH B;  1N33 T;  4OYK A;  5L4E A;  5LB7 B;  4HFV A;  4GKK T;  5JTG A;  3BHQ A;  4JI4 T;  3PUZ F;  2JQ9 A;  2CMR A;  4I0U A;  3CQX C;  4M1P A;  4DV4 T;  4U74 A;  4AKR B;  4B3R T;  4P0A A;  3S5R A;  4EZH A;  5JRE A;  2C5I T;  2XAF B;  3MKD A;  2LRL A;  2XHE B;  4O2B E;  3ON4 A;  1IBL T;  1E1H B;  3VVX A;  2RA1 A;  5FKK A;  2NX4 A;  5J1G A;  3OVU A;  2QOP A;  2XRL A;  4PJJ A;  4QH5 A;  3RI5 A;  2LOS A;  2X0H A;  4YSZ A;  1D0Y A;  3CK6 A;  1XWM A;  2JK3 A;  4LMJ A;  2BBJ A;  4N78 D;  2KXP B;  5BMV E;  2G7L A;  4BA9 A;  3UUX B;  4MFR A;  3ZMV B;  4XK4 A;  4CXY A;  5HYA A;  3UQ4 A;  2J47 A;  3P4S A;  3BR2 A;  2A9U A;  3B13 A;  4ZS2 A;  4DBQ A;  4Z91 A;  3PJA A;  4B3S T;  3B5M A;  4IE7 A;  2BBH A;  3F1B A;  3JC6 D;  4P09 A;  2Z6E A;  3ZC1 A;  5FL1 A;  4O4H E;  2KND A;  3LK3 B;  3AE7 A;  3O8G A;  2QTQ A;  3AED A;  1W09 A;  4AKH A;  4DR1 T;  2W66 A;  4JUY A;  2X66 A;  2PJQ A;  2YKS A;  4DR5 T;  1X79 A;  4B1R A;  2XGC A;  2LEH A;  5LG4 A;  3SS1 A;  4HWC A;  2FBW A;  1XDP A;  2BS4 A;  4JL3 A;  2Q24 A;  3G1O A;  4X62 T;  3KVA A;  3DP7 A;  2PG8 A;  1HR0 T;  4LFA T;  2ZM8 A;  3ANG A;  5GPA A;  4H9N C;  3HKB E;  5ADX L;  3F0C A;  3L3P A;  4YHJ A;  3EHZ A;  3UU4 A;  3KFW X;  3ZCJ A;  4M3B A;  3ESL A;  3UFG A;  2ID3 A;  3I9Y A;  5FY1 A;  3JAD A;  3RC3 A;  4X1I E;  4IGU A;  5DAJ A;  3ZMZ B;  2UXB T;  1VCT A;  3FRQ A;  3I0O A;  4NXM T;  3VTI A;  4F6R C;  2Q9Q C;  2ZLY A;  2L9Q A;  5J2U E;  1IJ6 A;  1MMN A;  2VKE A;  2LRK A;  1YQ4 A;  3G06 A;  3N9L A;  3U78 A;  1WYB A;  3B57 A;  1OED A;  4B3M T;  4XZC A;  2WWV A;  3VOX A;  4OD4 A;  4HFB A;  4D5F A;  2C0S A;  2J1D G;  5J1R A;  1GQE A;  3HA4 A;  3RH2 A;  2W63 A;  2VWA A;  3RX6 A;  4UXN B;  3AE5 A;  2VVS A;  5FKM A;  3ONJ A;  2JRK A;  4JYK A;  4O2A E;  2A3D A;  3O9X A;  3COL A;  2DI4 A;  3RRC A;  5JVD E;  5KDM C;  4ILA A;  5JDG A;  3CWR A;  2V6Y A;  4O8S A;  5FHP A;  3QPL A;  3Q0W A;  5H6R B;  4CI1 B;  3AEC A;  5L3C B;  2CXF A;  5FNV E;  2TCT A;  4ZZB A;  4HFC A;  2NTY A;  3PE0 A;  2K48 A;  4C90 A;  3G7R A;  5CXI A;  3HIM A;  3ETU A;  2REK A;  2VQF T;  3IF8 B;  2RP4 A;  2WS3 A;  5LJM A;  5F08 A;  5FP3 A;  5L2L A;  1MND A;  2HQ5 A;  4QWN B;  4COF A;  4M3F A;  2LM9 A;  1IAP A;  2OV9 A;  4O4J E;  2YVE A;  3C07 A;  3GEU A;  3L09 A;  2NP3 A;  3PUQ A;  4ZS3 A;  2XM2 A;  2E9X B;  4KUM B;  1B7T A;  2E8I A;  3GN5 A;  2DG7 A;  1WYC A;  3QB5 A;  3FK6 A;  4IDQ A;  3RH3 A;  2K3W A;  2UXU A;  2MTQ A;  4IHJ E;  4WNK A;  5AQI B;  3H3M A;  2LJL A;  1VI0 A;  4ZZC A;  1N36 T;  2FJ1 A;  1UCU A;  4DV7 T;  4DV5 T;  4LF5 T;  4AKG A;  5EFY A;  2E9X C;  3OYZ A;  3RYF E;  4A97 A;  2B1E A;  5AQS B;  3AE2 A;  2N9D A;  2KSR A;  1JUS A;  3AB3 B;  3ANW B;  1UK5 A;  2IHR 1;  5H9T A;  1LRZ A;  4YTP A;  4X1K E;  3PUR A;  1HTJ F;  2K24 A;  3O1H A;  2WCA A;  5LXT E;  2WZI A;  4AQY T;  1MMA A;  2I6H A;  1HX1 B;  3MAC A;  4LF7 T;  2BKP A;  2HPJ A;  4GYR A;  4PJL A;  3A7M A;  1XNQ T;  3UTK A;  3G1M A;  3NRX A;  3PTR B;  2GFN A;  5F8P A;  4HN9 A;  3NXC A;  4EAH A;  3O1J A;  5KXJ A;  3I0Q A;  5C2T A;  1BJZ A;  2V8S V;  4UV8 B;  2D2S A;  4QX7 B;  5EYR A;  3BTC A;  1DU2 A;  3UFE A;  3HTJ A;  3M3Z B;  3PUG A;  5HXC A;  3LK4 2;  3WI3 A;  1H7C A;  3FBL A;  4H9R C;  4EV6 A;  4A56 A;  5JR9 B;  3PM1 A;  4L5G A;  3CQC B;  4OFZ A;  2HN1 A;  2OF7 A;  4I6Z A;  3T6N A;  1T72 A;  2A2F X;  2XSB A;  4X5T A;  4DW6 A;  3LBX B;  3P50 A;  5ABF B;  1BR2 A;  2ACZ A;  4ICH A;  4UDS A;  3IH2 A;  3CVR A;  1OWA A;  5HWX A;  3HGY A;  3MK7 C;  5LGU B;  5EK2 A;  5JR9 C;  3LDQ B;  4G12 A;  2M6I A;  2UUC T;  2DL1 A;  4U9N A;  1QPI A;  5CGM A;  4QHO A;  5AQM B;  2FJA A;  3VRA A;  3H3A A;  3MA9 A;  2NTX A;  1T56 A;  3BR5 A;  4DV1 T;  3P4Q A;  3FZH B;  2CM0 A;  3E7Q A;  1WCR A;  4JI6 T;  1KF6 A;  3ZQF A;  3LOC A;  3BR0 A;  3UUN A;  4UV9 B;  2UXI A;  2Y30 A;  1JTX A;  5HAX A;  2IML A;  1U4Q A;  2XSA A;  2D0T A;  3GN5 B;  3MXZ A;  4LFC T;  3LHQ A;  2BKO A;  4DO0 A;  4WYV A;  2R7Q A;  4ZI2 D;  1RPW A;  3NKZ A;  3BT9 A;  3AE1 A;  5AFU L;  4W97 A;  3V6G A;  1HNZ T;  2E5L T;  3C2B A;  2MYS A;  2JQH A;  3BTL A;  5FGL A;  4ILB A;  1M62 A;  1CUN A;  3AA0 B;  2VQE T;  2XUE A;  3LJL A;  3AAE B;  4GKJ T;  2ZCX A;  3BNI A;  2UXN B;  4JI0 T;  5HSZ A;  2YN6 A;  4O4L E;  3RQW A;  4GCT A;  3ZN1 B;  4HKU A;  5FVK A;  1HFA A;  4ZXL A;  4ABZ A;  2M67 A;  4JEU B;  3O60 A;  2YU1 A;  4TWH A;  4NXN T;  1SE7 A;  2JMK A;  2UXP A;  4H9S E;  3FIW A;  2EHO C;  3N9P A;  2X9Y A;  4EYU A;  5F0H A;  3PU3 A;  4HWH A;  1I94 T;  3CWZ B;  3NZQ A;  5LP6 E;  5E0O A;  3W15 B;  2XGE A;  3K3Q C;  2WQY A;  2BS3 A;  3NPI A;  2QYW A;  3SFD A;  2FJB A;  2NW9 A;  3VW0 A;  4CN6 A;  2MBG A;  5K7F A;  2W4X A;  2NS7 A;  2AXD S;  3LSP A;  3CDL A;  2D5U A;  2HPL A;  2LHR A;  4UVB B;  3N2K E;  4H63 H;  1Z8U A;  3ZPO A;  1ZP0 A;  3QQA A;  2K5B B;  4JBW F;  5FY7 A;  4I4T E;  4GYS A;  3KIN B;  3FK7 A;  3QUJ A;  5JDL A;  3NS4 A;  5JQG E;  3RKO A;  1BR4 A;  3C51 A;  5AQV B;  1MIV A;  2D9D A;  3Q0U A;  2IAK A;  2XQ4 A;  2ZOY A;  3ZCI A;  2XM1 A;  5JDN A;  2SPC A;  3CIR A;  2RPA A;  5L3E B;  2ODU A;  3I9W A;  3TP0 A;  3BR6 A;  5J0Z A;  3RLF F;  1MMG A;  3PUW F;  3RPU A;  3ZMT B;  2V7L A;  1NAF A;  4YZE A;  2XAJ B;  4JLE A;  1WR0 A;  4KHP T;  2ZM2 A;  5EK4 A;  3EVY A;  2W67 A;  2LSY A;  3AQT A;  5IOZ A;  2Q9Q A;  2QCO A;  2I10 A;  4CGR A;  2XPW A;  1ZOY A;  2WAU A;  3TLU A;  3O4X E;  2RHA A;  3CRJ A;  3VVY A;  3VPR A;  5AQJ B;  1US7 B;  4UEM A;  3FXD B;  2KIN B;  4EXT A;  4GFL A;  2G3B A;  2KT9 A;  3M65 A;  4X65 T;  2LKG A;  1W0B A;  2G7S A;  2HN2 A;  4HWD A;  4TZ4 C;  2G0E A;  3HGG A;  3PU8 A;  2F07 A;  2PZ9 A;  4OX9 T;  3FZM B;  2UXO A;  2WY2 A;  4QXC B;  2X6O A;  3ABV A;  3PV0 F;  4FI5 A;  4PFP A;  1N32 T;  1T33 A;  3ZYM A;  3HE0 A;  2YVX A;  3VUQ A;  3UU5 A;  4ZI3 C;  1R8I A;  4IL4 A;  4DID B;  4JI3 T;  2ZCM A;  2W62 A;  3PUV F;  5LA6 E;  1HNX T;  3ONL C;  3QK6 A;  3FBZ A;  5HXE A;  4WIB A;  3L39 A;  3IHR A;  2WV1 A;  4NN1 A;  5EZY E;  1S94 A;  4X66 T;  4V2G A;  1QLB A;  1QVU A;  1SHZ C;  4B6X A;  2V7I A;  4PFO A;  2FBQ A;  2H7O A;  2XAQ B;  5H6Q B;  4EIW A;  4UF0 B;  4HE8 A;  1HNW T;  3OYX A;  3R6N A;  5HEO A;  2HHH T;  3KV5 A;  3V5U A;  2RAE A;  5IWA T;  1FMV A;  1D1A A;  1S35 A;  4JI5 T;  2ZOZ A;  4AIS A;  3GWH A;  2G0U A;  3LSR A;  3ZST A;  3N9N A;  2E9X A;  2NWB A;  4M3D A;  1A6I A;  1WFD A;  3AQS A;  2BVL A;  2WP9 A;  3QC9 A;  1L0V A;  3F2E A;  1HF8 A;  2PTF A;  2H88 A;  5FMN A;  1WR6 A;  1QVT A;  5LCY A;  5J1U A;  4NPP A;  1ZV4 X;  3RIA A;  4L0R A;  5HXR A;  2QRX A;  2XAH B;  2Q9Q B;  3ANW A;  1XMO T;  2QIB A;  1XZY A;  5LG3 A;  4EGW A;  2WGB A;  4EED A;  1G73 A;  3RD3 A;  4YSX A;  4D7N A;  2IEK A;  3SWH A;  2O7T A;  1JNZ A;  2JJ7 A;  3CCY A;  4LF4 T;  5GON E;  2IAI A;  4TWF A;  5CXG A;  2GK9 A;  3AA7 B;  4DVD A;  5GP9 A;  3MVP A;  3EDU A;  3N2O A;  3NZP A;  3AA1 B;  1J5W A;  4KWA A;  1MIY A;  5HAW A;  3CX7 B;  3JAE A;  2K9A A;  3L8R A;  2FQ4 A;  4G2A A;  1UI5 A;  4QH1 A;  2BVM A;  2R7S A;  4QX8 B;  2CCQ A;  3ZEF B;  3GMI A;  2WU5 A;  3U3I A;  5JR9 A;  3FB2 A;  3HR0 A;  3RC8 A;  2G7G A;  2VKJ A;  2CXL A;  3VR9 A;  3WAK A;  4JI2 T;  3TLW A;  5LHG B;  2W0G A;  3LBX A;  3CJD A;  3VRB A;  5ABF A;  3BQZ A;  3P9T A;  3RIF A;  3VW1 A;  2R7U A;  5LOV E;  2ACX A;  3RQU A;  3D0T A;  4H9Q C;  3A5X A;  2V5D A;  4TNW A;  2VKH A;  4ASK A;  5EZH A;  1W0A A;  2Y2Z A;  5JH7 E;  4BJM A;  4H9P C;  2BG9 E;  3BQK A;  5FKY A;  4HFI A;  2XAS B;  5J2T E;  1IZN B;  4U9L A;  4OHF A;  5IHY A;  3T1H T;  3B6C A;  4KX6 A;  5GPC A;  4DV0 T;  3QKX A;  3LWJ A;  4YHH T;  3G56 A;  4ME9 A;  2PBX A;  4GK5 E;  5M4Y A;  4TX5 A;  4GCL A;  3CQG B;  3Q5E A;  3UU6 A;  4XAX B;  4NEL A;  5AQU B;  2ZY9 A;  2V7J A;  3ETV A;  3IA3 A;  3F31 A;  3N9M A;  1HX8 A;  3AEE A;  1YW0 A;  3NI7 A;  4EZ4 A;  4TN7 B;  4IE4 A;  5HEJ A;  3UT5 E;  2WMN A;  2EHO A;  2JQK A;  3IUV A;  5LGN B;  2CLY B;  3G1L A;  3E22 E;  3BRU A;  5AQC A;  1D0Z A;  4YJ2 E;  2L3L A;  5CB4 E;  3P7I A;  3ZT6 A;  2UUB T;  5ABG A;  3Q3S A;  4U31 A;  3ZJ2 A;  4HFE A;  4DND A;  5HWY A;  3ZQL A;  1JT6 A;  2CLY C;  4U7I A;  3KVB A;  3J7Y q;  5FYM A;  2NOX A;  3CKD A;  3VR8 A;  1UGO A;  2XQ5 A;  4V2F A;  5L3G B;  5HEG A;  2XQA A;  2Y8D A;  3AE9 A;  2WB5 A;  2E5V A;  2CWY A;  5LBQ B;  4HEA A;  4NIQ A;  5J3L A;  4AUX A;  2XPK A;  1KNR A;  4GK0 E;  2CRB A;  4CZZ B;  2VL0 A;  2V57 A;  2DNX A;  3AE8 A;  4D7M A;  1HG5 A;  3HTH A;  4PJN A;  5FL0 A;  4E7Z A;  2KWI B;  2FD5 A;  4HWF A;  4YTM A;  1T7S A;  5LMU T;  2VVN A;  5LYJ E;  4ISS A;  5L3F B;  4EB6 E;  3DPJ A;  4HGA A;  4ADZ A;  4IDZ A;  4KMC A;  2LM2 A;  1LVF A;  2C5J A;  3F57 A;  5EK3 A;  3WHC A;  1OED C;  2R7T A;  4PNI A;  4LF8 T;  4WW0 A;  3RYI E;  5F0C A;  1D1B A;  5KMG P;  3AAA B;  3AEG A;  3S4U A;  1UUR A;  2LOP A;  1XMQ T;  4DR4 T;  3P4W A;  3BR1 A;  4IDP A;  3PUA A;  5TAO A;  4ILU A;  4JI7 T;  4MHC A;  2XQ8 A;  2XQ9 A;  3VHL A;  1BR1 A;  1ZEE A;  2UXX B;  4DBR A;  2ZM6 T;  1IBM T;  3VU7 H;  3DTO A;  1YD8 G;  2HXO A;  3P8C D;  4UEL A;  2N1G A;  3NBX X;  1FEW A;  2Y6X A;  3JC6 C;  2LE8 A;  1T8B A;  3EUP A;  3E08 A;  5CA0 E;  3EGQ A;  1G8X A;  2Q9Q D;  1IBK T;  1MIW A;  4JI1 T;  2JIW A;  5K58 A;  1OED E;  3TLS A;  3RHW A;  2I59 A;  3Q0V A;  4UVA B;  5DQW A;  2O7O A;  5HCM A;  2EHO B;  1SA0 E;  5IYZ E;  5ETW A;  2IU5 A;  2DCF A;  4KI0 F;  4AI6 A;  4QKN A;  1W9R A;  3JCF A;  4PK5 A;  2LKH A;  4CXW A;  3FZK B;  4U33 A;  4MBQ A;  2V1D B;  4CI3 B;  4C91 A;  5F1J A;  3AXJ B;  3OPC A;  3PUX F;  5HXH A;  2ZMA A;  2MAW A;  5FXZ A;  2KLQ A;  2B76 A;  3KZ9 A;  2QWT A;  4LF9 T;  4P1N A;  2XPV A;  3KYL A;  4BJN A;  5L47 A;  4PAG A;  3JSJ A;  1ZKE A;  2DG8 A;  1V9D A;  5HEH A;  1JNR A;  3AAI A;  3X1D A;  2QKO A;  3RF1 A;  4IL9 A;  3NNR A;  3KNW A;  2YIN A;  1QUU A;  2YDR A;  1SGM A;  4MLK A;  4QXB B;  5LGT B;  5IOY A;  4JI8 T;  2HH7 A;  4L9I A;  3VOK A;  1Y01 A;  4AKI A;  3TP3 A;  3LJC A;  3TLT A;  1WLX A;  3J9X 1;  3HL6 A;  3T8O A;  3RYC E;  2W2U A;  4UF0 A;  3DCF A;  4E7S A;  2MPK A;  3UUB A;  4KP3 C;  2KZ7 B;  5K7H A;  2TRT A;  5F27 A;  2OPT A;  2BKN A;  2DTZ A;  3BK9 A;  2UXC T;  2CHN A;  4X20 E;  3PJA J;  1Z0P A;  3FXE B;  5LJN A;  4PK4 A;  1VRB A;  3AEF A;  5FXX A;  3MJX A;  4DV3 T;  2E9X D;  2CBJ A;  2MOZ A;  2X67 A;  5F0F A;  3EDV A;  4K0U A;  4U72 A;  4PK6 A;  4Z90 A;  2NR4 A;  2B3W A;  4CI2 B;  3AEA A;  2VPR A;  5EZG A;  4ZI7 E;  3AA6 B;  4LF6 T;  2GUH A;  2CWO A;  3EAM A;  2PFV A;  2M6B A;  4DR2 T;  1U5P A;  3WHB A;  3UUM A;  4I55 E;  2WSS V;  4WZX A;  5AQH B;  4U2Y A;  5FKN A;  3LK2 B;  1VOM A;  2IC9 A;  2JMH A;  4C2M A;  2X51 A;  3TKL B;  3JAF A;  3K3O A;  2ZM0 A;  5AQP B;  1NEN A;  2XTL A;  3DJB A;  2WM9 A; 
#chains in the Genus database with same CATH homology
 4PJM A;  3CX7 B;  4PJL A;  2R7W A;  3UTK A;  4NUV A;  2K9A A;  3NRX A;  4G2A A;  3PTR B;  5F8P A;  4HN9 A;  4AQG A;  4EAH A;  5A1L A;  5KX5 E;  3O1J A;  4DVY P;  3I0Q A;  2D0U A;  1NWM X;  2BVM A;  2R7S A;  4QX8 B;  2CCQ A;  4AQF C;  4UV8 B;  2D2S A;  4QX7 B;  3ZEF B;  3GMI A;  3C98 B;  5DAB A;  4YFS A;  3UFE A;  3O1I A;  5JR9 A;  3FB2 A;  3HR0 A;  3U3I A;  2VAS A;  3PUG A;  5JDH A;  2ES0 A;  5HXC A;  3RC8 A;  4GOU A;  2VKJ A;  4JEH B;  2JJ9 A;  1MMD A;  2CXL A;  1MNE A;  2KWH A;  3WAK A;  3LK4 2;  3WI3 A;  4MAL A;  5LHG B;  1H7C A;  2W0G A;  3FBL A;  3LBX A;  4H9R C;  5JDF A;  4A56 A;  5JR9 B;  3I1A A;  4L5G A;  2R7U A;  3BQL A;  3CQC B;  4KBM B;  4OFZ A;  5LOV E;  2BZB A;  3CML A;  2ACX A;  3WAJ A;  3MZK B;  2A2F X;  3D0T A;  4CQI A;  4H9Q C;  4HTE A;  3A5X A;  1D1C A;  2VK9 A;  4OYJ A;  3ZYK A;  2VKH A;  3LBX B;  3PUS A;  4ASK A;  4HKA A;  1BR2 A;  5JH7 E;  4H9O C;  2W00 A;  3IEE A;  2CXD A;  3CVR A;  1OWA A;  5HWX A;  4BJM A;  1YKE B;  3MK7 C;  4H9P C;  1FMW A;  2XQY A;  5LGU B;  5EK2 A;  5JR9 C;  3BQK A;  2WMO A;  2W61 A;  5LG4 A;  2XAS B;  3C50 A;  3EUH A;  3ZJ1 A;  5J2T E;  2WBL A;  5L3D B;  4QHO A;  2DLR A;  1IZN B;  4UIG A;  4OHF A;  3ZN0 B;  5IHY A;  3CX6 B;  3H3A A;  3MA9 A;  5LHI B;  5DJQ C;  4FJO A;  2NTX A;  3Q5X A;  4ZHQ E;  3N5L A;  4IIJ E;  2Y48 B;  3KV4 A;  3HKE E;  4GK5 E;  5M4Y A;  2CM0 A;  4TX5 A;  2V26 A;  3CQG B;  2DWK A;  2VL8 A;  4IRV A;  3UUN A;  4XAX B;  4EOZ B;  4UV9 B;  1HG2 A;  4I50 E;  4Z8X A;  2YU2 A;  5HAX A;  3CX8 B;  1U4Q A;  3Q5W A;  2V7J A;  3ETV A;  3F31 A;  2D0T A;  3N9M A;  3GN5 B;  3OKQ A;  1HX8 A;  3MXZ A;  1YW0 A;  4EZ4 A;  2LT3 A;  3DU6 A;  3C4X A;  1QSD A;  4TN7 B;  4IE4 A;  4DO0 A;  2EHO D;  3UT5 E;  2WMN A;  2NW8 A;  2EHO A;  2R7Q A;  5LBM A;  2CE7 A;  1HCI A;  5JRC A;  4ZI2 D;  5LGN B;  2CLY B;  2LSJ A;  3E22 E;  2JPF A;  4OK0 A;  5AFU L;  1T98 A;  3KV9 A;  5C8Y E;  1UX5 A;  5CA1 E;  2MYS A;  5CQG A;  4IE6 A;  1D0Z A;  5FY0 A;  4YJ2 E;  1CUN A;  1OXZ A;  2L3L A;  3AA0 B;  5CB4 E;  2XUE A;  3P7I A;  2A72 A;  4DMV A;  3AAE B;  3KDS E;  3AVS A;  5JRC B;  4TV8 E;  2UXN B;  3ZJ2 A;  4XBF B;  4DND A;  5HWY A;  1YKH B;  4OYK A;  3ZMT B;  1HS7 A;  4O4L E;  3ZN1 B;  1AJ3 A;  4HFV A;  4ANJ A;  1HFA A;  2CLY C;  3KVB A;  3KBU A;  5FYM A;  3J7Y q;  2M67 A;  4JEU B;  2CMR A;  3CQX C;  2NOX A;  3CKD A;  4M1P A;  2YU1 A;  2R7O A;  1D0X A;  2FJI 1;  4U74 A;  4AKR B;  2JMK A;  2WWU A;  4P0A A;  2LSI A;  4H9S E;  3DU5 A;  5L3G B;  3VKH A;  2EHO C;  3N9P A;  5FXV A;  2X9Y A;  4EYU A;  2Y8D A;  4EZH A;  2C5I T;  2XAF B;  2OA5 A;  5JRE A;  3MKD A;  2XHE B;  4ZI2 C;  4O2B E;  2CWY A;  3HKD E;  3PU3 A;  5LBQ B;  3CWZ B;  4HEA A;  3NZQ A;  5LP6 E;  5E0O A;  4H63 V;  3OJA A;  3W15 B;  1E1H B;  3K3Q C;  2RA1 A;  5DQV A;  4GK0 E;  5J1G A;  4CZZ B;  2NW9 A;  4PJJ A;  3E0Z A;  2DNX A;  5JDM A;  2MBG A;  2LOS A;  4YLH A;  1HG5 A;  4PJN A;  4E7Z A;  2KWI B;  1D0Y A;  4N78 D;  2KXP B;  2D5U A;  2HPL A;  5BMV E;  2LHR A;  4BA9 A;  2DHR A;  4MFR A;  3UUX B;  2V7M A;  3ZMV B;  1IJ5 A;  4TUY E;  4CXY A;  5HYA A;  4UVB B;  3N2K E;  4H63 H;  3ZPO A;  5LYJ E;  2K5B B;  4ISS A;  5FY7 A;  5L3F B;  4I4T E;  3B13 A;  3K3N A;  4ZS2 A;  4GYS A;  4EB6 E;  4DBQ A;  4HGA A;  5HXS A;  3KIN B;  4ADZ A;  4IDZ A;  3QUJ A;  5JDL A;  3N9O A;  1LVK A;  4KMC A;  4IE7 A;  1LVF A;  3NS4 A;  2C5J A;  3F57 A;  5JQG E;  3JC6 D;  5EK3 A;  4P09 A;  2R7T A;  2Z6E A;  3RKO A;  1BR4 A;  3C51 A;  3ZC1 A;  2R7V A;  1MIV A;  3PDY A;  4PNI A;  4BAY B;  2IAK A;  4WW0 A;  3RYI E;  4O4H E;  3ZCI A;  2KND A;  2DWG A;  1D1B A;  3LK3 B;  4I43 B;  5KMG P;  3AAA B;  3S4U A;  2LHN A;  5JDN A;  2LOP A;  2SPC A;  3PUA A;  5L3E B;  3SOL A;  5TAO A;  2ODU A;  4ILU A;  3IBP A;  4AKH A;  3I9W A;  1KK7 A;  4MHC A;  3VKG A;  4JUY A;  4UVC B;  2X66 A;  3VHL A;  2QGS A;  2PJQ A;  4ZOL E;  1MMG A;  1BR1 A;  2R7X A;  1ZEE A;  1X79 A;  2UXX B;  4DBR A;  2X9H A;  4G63 A;  2C5K T;  2LEH A;  3RPU A;  3RYH E;  3V5S A;  2V7L A;  2H3R A;  3SS1 A;  1NAF A;  3VU7 H;  3DTO A;  3ZMU B;  1YD8 G;  5F3J A;  2XAJ B;  3P8C D;  4JLE A;  4CXX A;  2ZM2 A;  4UEL A;  2N1G A;  2X68 A;  3R84 B;  3NBX X;  1FEW A;  2Y6X A;  3JC6 C;  3RRW A;  5EK4 A;  2LE8 A;  3EVY A;  3E08 A;  5CA0 E;  2L8K A;  1G8X A;  2LSY A;  2Q9Q D;  3KVA A;  2Q9Q A;  3DP7 A;  2PG8 A;  2ZM8 A;  1MIW A;  2WAU A;  4H9N C;  3HKB E;  5ADX L;  3SRZ A;  5LNK A;  3BQI A;  3L3P A;  4YHJ A;  2I59 A;  3KFW X;  3O4X E;  3ZCJ A;  4UVA B;  3ESL A;  2VKD A;  4PW8 A;  5DQW A;  3LG7 A;  2EHO B;  1SA0 E;  2VB6 A;  5IYZ E;  3ZMS B;  3I9Y A;  5ETW A;  5FY1 A;  3RC3 A;  1US7 B;  4UEM A;  4X1I E;  3FXD B;  4IGU A;  2KIN B;  4EXT A;  1KNZ A;  3HKC E;  2DCF A;  3ZMZ B;  4AI6 A;  2KT9 A;  4QKN A;  2CEA A;  4ZI3 D;  3I0O A;  1WRD A;  3M65 A;  4PK5 A;  4IE0 A;  3VTI A;  4F6R C;  4CXW A;  4MBQ A;  2Q9Q C;  2V1D B;  4CI3 B;  2ZLY A;  4TZ4 C;  4C91 A;  5HXH A;  2L9Q A;  2ZMA A;  3PU8 A;  5FXZ A;  2KLQ A;  3UUL A;  3ZC0 A;  5J2U E;  1IJ6 A;  3AVR A;  1MMN A;  3OBV E;  3KYL A;  3KBT A;  4BJN A;  4PAG A;  2X0L B;  1Y64 B;  3N9L A;  1ZKE A;  4QXC B;  3U78 A;  1WYB A;  3B57 A;  4ERR A;  1V9D A;  4GIW A;  4XZC A;  3AAI A;  4OD4 A;  3ZLI A;  2YK0 A;  4FI5 A;  4P0B A;  4PFP A;  1LKX A;  3HI2 A;  2YIN A;  2C0S A;  4NUU A;  1QUU A;  2J1D G;  3ZYM A;  2JQQ A;  4ZI3 C;  3HA4 A;  4MLK A;  2W63 A;  4QXB B;  2VWA A;  3RX6 A;  5LGT B;  4UXN B;  2W62 A;  2HH7 A;  4L9I A;  5LA6 E;  4V1A v;  4AKI A;  3LJC A;  1O3X A;  2JRK A;  2ODV A;  1WLX A;  3FBZ A;  3QK6 A;  3J9X 1;  3HL6 A;  4O2A E;  3T8O A;  2A3D A;  5HXE A;  3O9X A;  3IHR A;  1BR0 A;  2VKO A;  3RYC E;  3ONX A;  2DI4 A;  3RRC A;  3Q9D A;  4UF0 A;  5JVD E;  5KDM C;  5EZY E;  1S94 A;  5JDG A;  2X9W A;  4B6X A;  4E7S A;  1SHZ C;  2XAG B;  4O8S A;  2V7I A;  4PFO A;  4TV9 E;  4KP3 C;  4YJ3 E;  5FXW A;  5H6R B;  2KZ7 B;  4CI1 B;  4J2C A;  2H7O A;  2XAQ B;  1UX4 A;  2V7K A;  5L3C B;  2CXF A;  3Q2M A;  3FHN A;  3C4Z A;  5H6Q B;  5FNV E;  3K8P C;  2YEV C;  3H37 A;  3LFM A;  4EIW A;  2NTY A;  3PE0 A;  4UF0 B;  2K48 A;  4HE8 A;  3BK9 A;  4C90 A;  3OYX A;  3R6N A;  2R7R A;  4X20 E;  2LSG A;  3KV5 A;  4X1Y E;  3V5U A;  1Z0P A;  3FXE B;  3ETU A;  5LJN A;  1FMV A;  1D1A A;  3IF8 B;  2RP4 A;  4PK4 A;  5JDQ A;  1VRB A;  1S35 A;  3C4W A;  5LJM A;  5FP3 A;  5L2L A;  5FXX A;  3N9Q A;  2BDE A;  3MJX A;  4WBO A;  1MND A;  3C64 A;  3GWH A;  2G0U A;  2LSK A;  2E9X D;  4QWN B;  3N9N A;  2E9X A;  2NWB A;  2MOZ A;  4EYY R;  2LM9 A;  1IAP A;  2NW7 A;  2X67 A;  4O4J E;  4IE5 A;  4WBN E;  2BVL A;  3EDV A;  3QC9 A;  4IST A;  4K0U A;  1ZHC A;  1FIO A;  4U72 A;  4PK6 A;  3L09 A;  3F2E A;  3PUQ A;  4ZS3 A;  1HF8 A;  2B3W A;  2E9X B;  4KUM B;  4CI2 B;  1B7T A;  2E8I A;  3GN5 A;  2X9X A;  5FMN A;  1WR6 A;  1WYC A;  2P9B A;  3GA8 A;  3RH3 A;  2CA5 A;  5LCY A;  4OD5 A;  2MTQ A;  2PBI A;  4IHJ E;  1ZV4 X;  4WNK A;  4L0R A;  2LJL A;  4AKL A;  4ZI7 E;  5HXR A;  2N2N A;  3AA6 B;  2XAH B;  1UCU A;  5L3B B;  2Q9Q B;  2CWO A;  3ANW A;  3ZYL A;  2PFV A;  4AKG A;  4O4I E;  3CPZ A;  2E9X C;  1G73 A;  5LHH B;  3OYZ A;  2QA7 A;  3RYF E;  2B1E A;  4QXH B;  2IW5 B;  3SWH A;  2N9D A;  1U5P A;  3UUM A;  3AB3 B;  3ANW B;  5GON E;  4AQF A;  4I55 E;  2KMF A;  2WSS V;  2NP9 A;  1LRZ A;  1EZ3 A;  3N2G E;  4DMW A;  4AXP A;  2GK9 A;  3KV6 A;  4X1K E;  3LK2 B;  3AA7 B;  1VOM A;  2IC6 A;  4DVD A;  1HTJ F;  2IC9 A;  4C2M A;  2JMH A;  2K24 A;  3O1H A;  3PUR A;  2X51 A;  5LXT E;  3TKL B;  3EDU A;  3NRY A;  3N2O A;  2H7V C;  1MMA A;  3NZP A;  3MAC A;  3K3O A;  3AA1 B;  2ZM0 A;  2XTL A;  3DJB A;  2HPJ A;  1MIY A;  4GYR A;  2WM9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...