2A2FX

Crystal structure of sec15 c-terminal domain
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
317
structure length
296
Chain Sequence
NILWELLHNMRDHYNEVLLQRWVHVFREILDKEQFLPMVVQNTEEYECIIERFPFHSEQLEPKKFPFSRMVPEVYHQAKEFMYACMKFAEELTLSPNEVAAMVRKAANLLLTRSFSGCLSVVFRQPSITLTQLIQIIIDTQYLEKAGPFLDEFVCHMTNTERAMFHVARQDAEKQVGLRICSKIDEFFELSAYDWLPGIASAFITDMISYLKSTFDSFAFKLPHIAQAACRRTFEHIAEKIYSIMYDSTGALTQINLDLMQCEFFAASEPVPGLKEGELSKYFLRNRQLLDLLILE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exocyst complex component Sec15
publication title Sec15 interacts with Rab11 via a novel domain and affects Rab11 localization in vivo.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Protein transport
total genus 109
structure length 296
sequence length 317
ec nomenclature
pdb deposition date 2005-06-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.30 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor; domain 2 2a2fX01
1.20.58.670 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2a2fX02
3FHNA 2A2FX
chains in the Genus database with same CATH superfamily
3O60A 2VKOA 5HBUA 3KBTA 2KZ7B 2LRLA 3QPLA 1JUPA 2X67A 4P0BA 2E9XB 4B3ST 5AQCA 4EAHA 5HEOA 3AEFA 3P4QA 4O8SA 2R7VA 2KMFA 4JI0T 4QKNA 4CQIA 3CWRA 1O3XA 3JC6D 2W62A 4EV6A 3RX6A 2KT9A 3O4XE 3VPRA 3P8CD 5IPAA 3PU3A 3PV0F 4DNDA 3UU3A 2X0YA 2BG9B 2ZY9A 2VKVA 2G7GA 5LBQB 2IHR1 4FJOA 4MFRA 4KX6A 3A7MA 3DP7A 4DIDB 3PPBA 3VOXA 2EHOB 4XK4A 1W0AA 4D7MA 4G12A 1CHUA 5LGNB 2JQ9A 4CXYA 3MVPA 4IREA 4KP3C 2CA5A 3L09A 3N9PA 2CXDA 3J7Yq 2MPKA 5LYJE 4QWNB 5AQNB 2R7SA 2CHOA 5FVLA 3UUNA 3Q5XA 5C2TA 4TX5A 3EUPA 3CKDA 5JR9A 2M67A 5IUXA 3GZIA 5D19A 3VTIA 4ASKA 2YDSA 2EH3A 2H7OA 2WMNA 1WCRA 1MMDA 4LMKA 4IT4A 3UU6A 4WNKA 2WU2A 2GBYA 3HTHA 3ZSTA 3PUQA 2B76A 3OVUA 5JDFA 2X9YA 1T56A 3QQAA 1YQ3A 3C2BA 5CA1E 4LFCT 2M6IA 2WDRA 4HEAA 4X1EA 3TLVA 3QC9A 4K0UA 3KDSE 5LHIB 4ILAA 2YOEA 2B3WA 5L2LA 3RGLA 3NRGA 4JI6T 4CN6A 4L9IA 1T8BA 3PUVF 5GONE 4QXCB 3AVSA 3ZC0A 3SOLA 3ABVA 4PFPA 1XWMA 2CWOA 1G73A 3KZ9A 4ACIA 1US7B 2PFVA 1MMNA 5LMNT 2O7OA 4AQFC 5JR9B 4H9OC 3BJBA 4NELA 4A97A 2DG8A 3DU5A 3UFGA 2KINB 1LRZA 3DTOA 3T6NA 4OD5A 3AE2A 4XAXB 2NTYA 1E2AA 4IDOA 2LHNA 2H3RA 4U9NA 2DHRA 5JTGA 1XMOT 4X65T 2ZMAA 1WYCA 3IA3A 3N9LA 5FMPA 2O7TA 2X66A 2N9DA 3G1OA 3SFEA 4QH4A 2VWAA 2LJLA 1HF8A 2L3LA 3ZMUB 5F1JA 5FXVA 1SGMA 3VKHA 3FZLB 2DTZA 3F31A 2ZM8A 4DR6T 4H9PC 4IE5A 3LK42 1JT6A 3BR3A 2LM2A 3BRUA 3ZMTB 3FZKB 5J2TE 3FHNA 2HXOA 1YD8G 1T98A 5LB7B 4B3TT 4MALA 2LM9A 4JI2T 5DJQC 3AA0B 3SDGA 3AXJA 1OWAA 1YXRA 4I50E 1D0YA 2BS3A 4HWDA 2CEAA 2UU9T 2CM0A 4IDQA 4CN1A 3COLA 3O1JA 4ILCA 4CI3B 1YKHB 4UVAB 1EZ3A 3OBVE 3S4UA 2WAUA 2WUIA 2Q9QC 1M7KA 3O8HA 2FQ4A 3FBZA 3LSPA 3BQLA 3AA6B 3Q5DA 3BK9A 4D7NA 5F27A 3PJAJ 1SE7A 2BG9E 3ONXA 4TV9E 4V2FA 3G06A 5GPAA 4LF5T 2V5DA 4GYSA 2XZEA 3Q0UA 5D18A 2J4GA 1XMQT 4YJ2E 3K1SA 2QVAA 2NS7A 3NZPA 2RASA 4O2AE 4GK5E 4U33A 5DAJA 2K5BB 4TNVA 1FMWA 2QRXA 2E8IA 2XRLA 2YINA 3Q0WA 3PUSA 2XM1A 4O4HE 2E2AA 2YDQA 2QA7A 4IGUA 3AXJB 1UX4A 2WQYA 3UU4A 2XPWA 3P50A 1KF6A 2D9DA 4JV5T 3LHQA 3NBXX 3PDYA 2IIUA 1L0VA 2PBIA 3Q9DA 4AC0A 2WDQA 1JUMA 3RIFA 1N34T 3RYCE 2W00A 3VIBA 1IBMT 1U5PA 3E0ZA 4HFDA 4PJNA 2YK0A 2R7XA 1GQEA 2JQQA 2F4VT 2R7QA 4QHOA 2G7LA 4JKZA 3HTIA 5HWXA 2K48A 4YXDA 3UT5E 4OFZA 4AQGA 3PUZF 4UEMA 3ZYMA 2LOSA 1MIWA 1T33A 4EYUA 3PU8A 4DBRA 2FUPA 3R6NA 5AQHB 4JI5T 2XQ4A 4H63H 3OJAA 5IWAT 3L8RA 2NS8A 3AE9A 3AA1B 2X0LB 5F0FA 3UFEA 5AQFB 3RYHE 3FXEB 5F3JA 2PZ9A 2LKGA 2OLTA 4JI1T 2FJAA 3ON2A 2ODVA 2V7JA 2BS4A 3VW1A 2A3DA 2DCFA 3FBLA 3UU5A 4NN1A 4JI7T 3R84B 2R6GF 4PK6A 4HE8A 3N2OA 4OK0A 4OYKA 4K0KT 1HNZT 1WFDA 4LFBT 1J5ET 1UGOA 4TN7B 4WYVA 4ILUA 3CJDA 3VUQA 3RPUA 3WI3A 5FNVE 1QVTA 4V2GA 2VL0A 4DV5T 3C51A 3NI7A 3VHLA 4Z91A 4F6RC 4IHJE 4B3MT 1HTJF 2CWYA 4OYJA 3IH2A 3V6GA 3GA8A 2J62A 5CJ5A 4U2ZA 3K3QC 3AE5A 3VW2A 2XSBA 2OF7A 1KNRA 3F1BA 3V78A 3B57A 2FD5A 3ANWA 1D1CA 2XAGB 3EHZA 5FXWA 3D0TA 3SS1A 5L3DB 5LXTE 4C91A 3ZCJA 4HWFA 4ILBA 4EYYR 1MMAA 3OPCA 1XNQT 3Q0VA 3BHQA 1T7SA 3BQZA 4YSYA 2V5CA 3F57A 3VU7H 2IC9A 2XPVA 2QYWA 3AEAA 1FMVA 3QNUA 4NIQA 3RIAA 5LGUB 3AEDA 4AKIA 3C4XA 3UUBA 5EK2A 4O4IE 4H9RC 4HFIA 3ZT6A 3BNIA 4GCTA 2E9XD 3JADA 5JDHA 4L62A 4YFSA 4ZI2C 3ZN0B 4X5TA 1OEDC 5LJMA 2ID6A 2R7UA 5KXJA 1X79A 4H9NC 4COFA 5EZHA 2H88A 3HGGA 4YLHA 1OEDA 4HKAA 3S5RA 4YSXA 3KBUA 4DUZT 1V9DA 2ZCXA 2YU2A 4IIJE 2L8KA 3AE4A 5FY0A 3ANWB 5J1RA 1LKXA 1RPWA 5JH7E 3GEUA 3BT9A 3N9MA 2X9XA 4L0RA 3LOCA 2EHOD 3FZHB 5AQVB 4DV3T 5FY7A 1Z77A 3T1YT 5J0ZA 4ADZA 2UXIA 4JNNA 3H37A 2ZLYA 5D1RA 3CWZB 4GFLA 4WIBA 2FBQA 5EZGA 1WRDA 4I0UA 5FKKA 2ID3A 5EZYE 4D5FA 2F07A 3G1MA 4DW6A 2QKOA 1J1JA 1IZNB 2PBXA 3C4ZA 3FRQA 2GENA 4U2YA 4DVYP 3ZN1B 1J5WA 4UF0A 3JC6C 1OEDB 5HCJA 1QPIA 4KHPT 5GPCA 2WB5A 5L4HA 2G3BA 5EYRA 4LMLA 3NRYA 3QKXA 4CI1B 2W4XA 4CI2B 4CXXA 3UQ4A 2XB5A 2WU5A 2BBHA 3JAFA 3ZYLA 3CQXC 2J47A 3N2GE 2QCOA 2ZOZA 2HKUA 2DNXA 3KV6A 2XAQB 2Y48B 2UXDT 3CX8B 3RRCA 3N9QA 3I1AA 5FYMA 1RKTA 5JQGE 4DV1T 4HWCA 3JAEA 2D2SA 4U9LA 5AQOB 1ZHCA 3C07A 4TNWA 2NP5A 1SA0E 4AKRB 3HGYA 4ME9A 3RQWA 1E1HB 4YSZA 4UF0B 5FVKA 4LF8T 4LMJA 3W15B 4I4TE 2WS3A 5AQMB 2NWBA 2UXHA 4PJLA 1W9RA 4AXPA 2CRBA 4M3GA 3X1DA 5AQGB 1KNPA 4MLKA 2PJQA 1IBLT 5L4EA 1YW0A 4AKGA 2W61A 2IAIA 4HWIB 3PUYF 2IUBA 5J2UE 1HG2A 2JK3A 3KV4A 3T8OA 4CZZB 3LFMA 1H7CA 1MMGA 4GCKA 3FXDB 3C64A 2YU1A 5LHHB 2W63A 3Q2MA 5AQRB 4MBQA 2RPAA 4KI0F 4B1RA 3KVAA 3VR9A 2X68A 1JT0A 2WDVA 1RKWA 4KUMB 4DR4T 4LF4T 4UVBB 1MIYA 3LG7A 3HIMA 5LHGB 2BKNA 2MYSA 4HFHA 2XPUA 5IP6A 3F2EA 3ZMZB 2YEVC 3KNWA 5F0HA 1YKEB 2HN2A 4ZS3A 3MKDA 5IYZE 5J1YA 2XDNA 4AQFA 3ZSSA 2P9BA 4IDZA 2GUHA 3CVRA 4F8HA 1HNWT 3NS4A 5AQJB 2CXLA 3ZC1A 4GYRA 2VQET 4LFAT 3LJLA 2YKSA 5HEUA 5L47A 2Q24A 4DR1T 3QUJA 3PJAA 4U31A 5CB4E 3U78A 1ZEEA 3TLWA 2OA5A 4U3CA 4A5XA 5AFUL 5BR8T 3FZMB 5AQKB 3IF8B 3UU8A 3FK7A 1E7PA 1NWMX 3QB5A 3FZFB 2NOXA 1MNDA 4ZS2A 2HYJA 4EEDA 4AKLA 3QB5K 2KWIB 4PJJA 3BR5A 3BCGA 2DLRA 1UX5A 2I6HA 2QIBA 4PW8A 4H63V 4C2MA 5L3GB 2IU5A 3EVYA 2GK9A 5AQIB 1ORKA 4IL9A 2G0EA 5HWYA 4UELA 2BVMA 5LA6E 4MK6A 4GCLA 2ZM2A 1LVFA 4DUYT 4JI8T 4LF9T 1IAPA 4QX8B 5JREA 2H7VC 2LHRA 2CLYC 5LMUT 3ZPOA 1R8IA 2A72A 3GMIA 4JYKA 1OEDE 3A8YC 4NXMT 2IBDA 4XZCA 5AQUB 4JEUB 1JUSA 4ZEYA 2HXIA 3EI0A 5DQWA 2ZB9A 2MTQA 2OV9A 2NW7A 5AQPB 2Q9QA 4O4JE 4IE6A 4U72A 2M6BA 3BTIA 2VKEA 3BR2A 4MXMA 3QBMA 1WLXA 5ABFA 1KEYA 3RYFE 3ZKRA 5H9TA 3ON4A 3ZMVB 3Q5EA 4HFEA 2JJ9A 2R7WA 3VRBA 3AB3B 3TKLB 3CRJA 3ETVA 1Y64B 3RYIE 1LVKA 2JJ7A 2FBWA 5CA0E 2WSSV 3BR0A 4DMWA 3MK7C 2IDOB 2UXBT 4DR7T 4CGRA 5FP3A 3NRXA 2YVEA 4B3RT 3SFDA 3MNLA 5HYAA 4H9SE 2JQKA 3B6CA 4HKUA 2CPTA 4KHZF 5EFYA 3N9NA 3VVZA 3BQKA 2DL1A 4QXHB 2NW9A 1D1AA 3P4RA 5FKLA 3A5XA 2CLYB 3CQGB 1M62A 2YVXA 1NENA 2UXPA 2LLYA 2XQ6A 2FJ1A 2UXXB 2Q9QB 5JDGA 5HSZA 4P1NA 3G56A 3C50A 5HAWA 2BVLA 2CE7A 4ISSA 5ABFB 4JYAT 3JSJA 3DJBA 2K3WA 4DV6T 5LG4A 3BR1A 4OX9T 2LSIA 3MZKB 1BJZA 3Q3SA 3N5LA 3CX7B 5F04A 1XDPA 4YT0A 2HPLA 2X9DA 5J1GA 4DO0A 2ZM6T 4X20E 5ABGA 2PTFA 2IEKA 3ZJ2A 1ZKEA 4A56A 2CBJA 2QWTA 2MOZA 1IBKT 5KDMC 3TLUA 2ZCMA 3E7QA 2W2UA 2D0UA 5FXZA 2JIWA 4IDNA 2ODUA 4BJNA 4JI3T 1XDOA 2Y31A 2JMKA 2RA1A 3HI2A 2AE9A 2IMLA 4JUYA 4M3BA 3NXCA 4DMVA 4EB6E 3ZMSB 4W97A 4UXNB 2DI4A 3O9XA 2UXOA 3HL6A 4O2BE 4A98A 4YZEA 1DU2A 3LSRA 3LBXA 3TP3A 4M3DA 5FL1A 4W1UA 2FJI1 1WR0A 3NWIA 3EDUA 2ZOYA 2A2FX 2WP9A 1JTXA 2LT3A 2WY2A 4E7ZA 2I0MA 4EXTA 1UURA 2XQ5A 5IOYA 2D6YA 2HQ5A 5J1UA 3RKOA 2NW8A 3ZQGA 2VVSA 4D5CA 3KV9A 5TAOA 2WM9A 4TWDA 3RKGA 2XAFB 2XTLA 1Y01A 1ZK8A 2UUCT 3VKGA 4YTPA 3DEWA 3ONLC 2RAEA 2FJEA 3CMLA 4V1Av 4Z90A 1ZV4X 5AQQB 3AE3A 3IEEA 4N78D 2BKPA 5JVDE 1D0ZA 4HFBA 3LBXB 4KMCA 2WWVA 4GKJT 3ZEFB 3IH4A 4UV8B 3BQYA 4NUVA 5EK4A 1HCIA 3H3AA 2V7MA 5F0CA 3VVXA 3ZQFA 3AAEB 2OI8A 1N32T 2E9XC 4IE7A 2XQYA 1FIOA 2HH7A 1UI5A 3BTLA 2J1DG 2LEHA 4YHHT 2LSJA 5K7FA 4YY3T 4JLEA 2V1DB 2X6OA 3HKBE 1T72A 5L3EB 1W09A 3VP5A 3DU6A 3H3MA 3RHWA 2UXNB 2QOPA 2V8SV 2VKDA 3PTRB 4B6XA 2VASA 3MXZA 3DCFA 4DV4T 5JRCB 1U9NA 4BA9A 4IL4A 2Y30A 2BS2A 4ZZBA 2BZBA 2NP3A 2EHOC 3OYZA 5HCMA 1UI6A 4H9QC 3K3NA 2RHAA 3EUHA 3LK2B 2R7RA 2C0SA 3BQIA 4CXWA 5M4YA 2G7SA 2WBLA 1B7TA 3ZT7A 5FKNA 5JDLA 5CXIA 3P4SA 2L9QA 3FB2A 2Y6XA 1U4QA 2BDEA 1S94A 5AQLB 2CXFA 3NVOA 3N9OA 3CQCB 3TLSA 4ICHA 3IHRA 3HR0A 3AAAB 4X62T 4EIWA 3IBPA 4PNIA 4PXIA 5L3FB 1YQ4A 4X66T 2I59A 2WWUA 4DV0T 5HXEA 3KYLA 3WHCA 2K24A 3TLTA 3RH3A 4EZ4A 4UDSA 4O4LE 3EGQA 1VCTA 2XASB 4NPPA 2Y8DA 4GK0E 4ISTA 2KNDA 4LF7T 1W0BA 4EEBA 2DWGA 4YTNA 4WBNE 3HTJA 2I10A 3NNRA 2V7LA 1IJ5A 5IOZA 3EDVA 2ACXA 5ETWA 2X0HA 4MHCA 4HTEA 3PUAA 2ZM0A 3KVBA 4ZOLE 3F0CA 3P4WA 3AE8A 4IE0A 5CGMA 2WMOA 4KWAA 3ZQHA 3KINB 2V6YA 5BMVE 4PFOA 5FHPA 2LSYA 2AXDS 2XQAA 1WYBA 3PUXF 3ESLA 2WGBA 3NZQA 5L3CB 2GFNA 2MAWA 5JR9C 1JNRA 2XPKA 2XSAA 3MA9A 3NKZA 3HTAA 2SPCA 2R7OA 2CCQA 3GN5A 3HKEE 1HFAA 4U74A 2FJBA 4IDPA 4WBOA 3CX6B 3VRAA 2YN6A 2UUAT 1CUNA 4PJMA 3Q5WA 2VL8A 3SWHA 3T1HT 3E08A 2C5IT 2FJDA 2XQ9A 2LE8A 1D1BA 3AQSA 3UTKA 3VW0A 4M1PA 4PK4A 5K7HA 2X51A 3ZCIA 4I43B 5AQTB 5ABEA 3RQUA 2HN1A 2OERA 3PUWF 2HPJA 1BR0A 3FIWA 2X9HA 1Z0XA 4G63A 2V6YB 1QLBA 3V5SA 3AE6A 1SHZC 3I9YA 1BR2A 3ZLIA 3AEEA 1AJ3A 3RIUC 3RD3A 2XGDA 4ZI7E 4UV9B 3RC8A 4L5GA 1HG5A 3GN5B 4TWFA 5C3JA 3LJCA 2YVHA 5E0OA 3RIUA 4ZI3D 4ZHQE 2ES0A 4E7SA 2VURA 5CQGA 3ZT5A 3LDQB 4ZI3C 2VKHA 1XZYA 1VRBA 1UK5A 3FK6A 5J3LA 2XM2A 3MACA 4GFKA 4EZHA 4X64T 3V5UA 3UUXB 5F5WA 2ZCNA 3B6AA 1ZP0A 4YTMA 3C4WA 5HXCA 3AQTA 4LF6T 2XQ7A 1G8XA 3QOFA 2CBIA 2VPRA 4Z8XA 4MO7A 2W66A 3IUVA 3TP0A 4XBFB 2KLQA 2N1GA 2XHEB 2XJ7A 1ZOYA 3SFIA 2BBJA 1JTYA 5F08A 3OYXA 3KV5A 5C4YA 3RH2A 2W67A 4OHFA 5H6RB 3RI5A 3HKDE 4X1YE 2DG7A 3KFWX 3PM1A 2TCTA 5DABA 3B81A 4ZXLA 1Z8UA 4GOUA 2YDRA 2XAHB 3ANGA 5IHYA 3P9TA 1N36T 2V6XA 5CXGA 5LBMA 2UUBT 5HXSA 2V57A 4I6ZA 3QPSA 4WW0A 1D0XA 2JRKA 4YHJA 3AVRA 3KKCA 4DR2T 2Z6EA 1S35A 5FKMA 4TWHA 3UUMA 4GIWA 2C5KT 2Q9QD 3AE1A 2E5LT 4JI4T 3I0OA 3WAJA 5HEGA 3PUGA 5ADXL 3O8GA 1HNXT 2HHHT 1HS7A 1XNRT 4PAGA 4NUUA 5K7ZA 4JL3A 1HX8A 1VI0A 4DV7T 4AQYT 2LSKA 3P4PA 3NPIA 3G7RA 5LNKA 5L3BB 3BTJA 3LSJA 3L3PA 2VVNA 2RP4A 3SRZA 2XY8B 2QTQA 1UUSA 3VVYA 3E22E 5LJNA 1VCSA 4DV2T 3AEBA 3OKQA 2B1EA 4ZZCA 2HYTA 4DBQA 3L39A 1JNZA 3AA7B 3IH3A 5JDQA 4G2AA 5HAXA 4HN9A 4IRVA 4AC6A 2KSRA 4ANJA 2H89A 1BR1A 1HX1B 5LP6E 3HKCE 4I76A 3U3IA 3RLFF 4TZ4C 3PASA 2N2NA 4YJ3E 5LCYA 3MJXA 4FI5A 3PE0A 3O1HA 2PG8A 2BKOA 2LSGA 5EK3A 5FKOA 3RRWA 5DQVA 4OD4A 2W0GA 1VOMA 5FKYA 2UXCT 3EAMA 2WV1A 4AF5A 3M65A 4ABZA 3ONJA 2X9WA 5A1LA 4JBWF 1I6ZA 2W53A 5FXXA 3PURA 4AUXA 4WZXA 5KX5E 5HXRA 3CDLA 1SUMB 5F8PA 2NTXA 4UIGA 4DR3T 3CIRA 3CCYA 2XQ8A 4QH5A 5LG3A 2K9AA 3BTCA 4EGWA 4BJMA 1NAFA 5C8YE 3JCFA 2UXUA 1FJGT 1OXZA 3OTOT 3UQ7A 2V7IA 4U7IA 3VOKA 2C5JA 2KXPB 5AQSB 4HFVA 2V26A 3ANPA 5LOVE 4TUYE 3O1IA 4UR9A 4X1IE 2A9UA 2LRKA 3KKDA 1I94T 2XAJB 4DVDA 3ZQIA 4AIUA 5FGLA 2Y2ZA 5FMNA 4GKKT 5CFBA 5HEJA 1KNZA 3M3ZB 2NR4A 3ZYKA 4UVCB 3CK6A 4U7YA 1QSDA 1HR0T 2REKA 5HEHA 3BR6A 2DWKA 1UCUA 4JEHB 3LK3B 2WZIA 3B5MA 2XGEA 2CHNA 2JMHA 4QH1A 3WHBA 1KFYA 1MIVA 4IE4A 4I55E 3I9WA 5FY1A 4TV8E 4M3EA 2NX4A 2LOPA 3P7IA 2VKJA 3QK6A 3B13A 1BR4A 2WZHA 4C90A 4M3FA 4P09A 3VR8A 5JRCA 2VQFT 2JPFA 2V7KA 2E5VA 3LWJA 4ERRA 2XGCA 5CW8A 4HGAA 2IW5B 5ABHA 3WAKA 3RC3A 3UULA 3ZQLA 1KK7A 1A6IA 3C98B 4B3AA 2VB6A 4HFCA 4AI6A 2IC6A 2TRTA 1U9OA 3N2KE 1Z0PA 3HA4A 4HWHA 4DR5T 4CN4A 3ZJ1A 2NP9A 5HXHA 1WR6A 5LGTB 5JDMA 3GWHA 4QX7B 2G0UA 2IAKA 2QGSA 2D5UA 4ZI2D 3ETUA 4PK5A 4KBMB 4X1KE 2E9XA 4QXBB 4P0AA 3K8PC 1X9BA 3G1LA 1IJ6A 5JDNA 1ZKGA 4BAYB 5KMGP 2WCAA 3AAIA 4AISA 1QUUA 5H6QB 3K3OA 4EOZB 2FX0A 2KWHA 2BG9C 3AE7A 3LSVA 3HE0A 2R7TA 2CMRA 2JQHA 2MBGA 4AKHA 4Q25A 3RF1A 3EABA 3J9X1 2LKHA 3AECA 2BG9A 1MNEA 2ACZA 2OPTA 5FL0A 1QVUA 5K58A 1N33T 3AEGA 2EHOA 2XUEA 3DPJA 4J2CA 2XQ3A 1FEWA 1NEKA 2VK9A 3I0QA 3CPZA 5GP9A 2D0TA 4NXNT
chains in the Genus database with same CATH topology
2R7WA 2VKOA 1SHZC 3AB3B 3KBTA 3I9YA 3TKLB 2KZ7B 1BR2A 3ZLIA 3ETVA 2X67A 1Y64B 3RYIE 4P0BA 1LVKA 2E9XB 3C51A 3VHLA 5CA0E 4EAHA 4F6RC 4IHJE 1AJ3A 1HTJF 2WSSV 2CWYA 2R7VA 4O8SA 4ZI7E 4UV9B 3MK7C 4DMWA 3RC8A 2KMFA 4OYJA 5FP3A 4QKNA 3GA8A 4CQIA 3NRXA 1O3XA 3JC6D 4L5GA 1HG5A 2W62A 3GN5B 5HYAA 4H9SE 3RX6A 3LJCA 5E0OA 3K3QC 3N9NA 4ZI3D 3BQKA 4ZHQE 2ES0A 2KT9A 4QXHB 4E7SA 3O4XE 2NW9A 5CQGA 3P8CD 1D1AA 4ZI3C 2VKHA 3PU3A 1VRBA 4DNDA 3B57A 3A5XA 2CLYB 3ANWA 1D1CA 2XAGB 3MACA 3CQGB 5FXWA 3D0TA 3SS1A 5L3DB 4EZHA 5LBQB 5LXTE 4FJOA 4MFRA 3V5UA 4C91A 3DP7A 3UUXB 3ZCJA 4EYYR 2UXXB 1MMAA 2EHOB 2Q9QB 5JDGA 3C4WA 5HXCA 3C50A 3F57A 2BVLA 2CE7A 5LGNB 1G8XA 3VU7H 4ISSA 4CXYA 4Z8XA 4KP3C 2IC9A 1FMVA 4XBFB 2CA5A 2KLQA 2N1GA 3DJBA 2XHEB 3L09A 5LGUB 3N9PA 5LG4A 2CXDA 4AKIA 3J7Yq 5LYJE 2LSIA 3C4XA 3MZKB 5EK2A 4O4IE 3OYXA 4H9RC 4QWNB 3KV5A 3S4UA 2E9XD 4OHFA 2R7SA 3N5LA 5H6RB 5JDHA 3HKDE 4X1YE 4YFSA 3UUNA 4ZI2C 3KFWX 3CX7B 3Q5XA 3ZN0B 5DABA 2HPLA 5J1GA 4TX5A 5LJMA 4DO0A 3CKDA 4X20E 4GOUA 2R7UA 2XAHB 5JR9A 2M67A 3ZJ2A 1X79A 4H9NC 1ZKEA 4A56A 4YLHA 5IHYA 3VTIA 2MOZA 4HKAA 4ASKA 5KDMC 3KBUA 5LBMA 1V9DA 2H7OA 2WMNA 5HXSA 2YU2A 4IIJE 1MMDA 2L8KA 2D0UA 4WNKA 5FXZA 5FY0A 4WW0A 3PUQA 2ODUA 3ANWB 1LKXA 1D0XA 4BJNA 2JRKA 4YHJA 3AVRA 2Z6EA 1S35A 5JH7E 2JMKA 3N9MA 2X9XA 4L0RA 5JDFA 2RA1A 2X9YA 3HI2A 3UUMA 4GIWA 4JUYA 2C5KT 2EHOD 2Q9QD 4DMVA 5FY7A 5CA1E 4EB6E 3ZMSB 4HEAA 3QC9A 4UXNB 2DI4A 3I0OA 4K0UA 4ADZA 3KDSE 3HL6A 5LHIB 4O2BE 3WAJA 3O9XA 2B3WA 3PUGA 5L2LA 3H37A 5ADXL 2ZLYA 1HS7A 3LBXA 4PAGA 3CWZB 4L9IA 4NUUA 1WRDA 2FJI1 5GONE 4QXCB 3AVSA 3ZC0A 3SOLA 1HX8A 3EDUA 2A2FX 4PFPA 5EZYE 2CWOA 2LT3A 2LSKA 1G73A 4E7ZA 1US7B 2PFVA 4EXTA 1MMNA 1IZNB 5LNKA 5L3BB 4AQFC 3C4ZA 5JR9B 3L3PA 4DVYP 3RKOA 4H9OC 2NW8A 2RP4A 3ZN1B 3SRZA 4UF0A 3DU5A 3JC6C 3E22E 5LJNA 2KINB 1LRZA 3DTOA 3KV9A 5TAOA 2WM9A 3OKQA 4OD5A 2B1EA 4XAXB 2NTYA 2XAFB 2XTLA 3NRYA 4DBQA 4CI1B 4CI2B 2LHNA 3AA7B 5JDQA 4G2AA 4CXXA 5HAXA 2H3RA 4HN9A 4IRVA 2DHRA 3VKGA 3ZYLA 4ANJA 3CQXC 3CMLA 4V1Av 3N2GE 2ZMAA 1BR1A 1ZV4X 1WYCA 5LP6E 3N9LA 3IEEA 4N78D 2X66A 2N9DA 3HKCE 2DNXA 1D0ZA 5JVDE 3U3IA 3KV6A 2XAQB 2Y48B 4TZ4C 3LBXB 3CX8B 2N2NA 4KMCA 3RRCA 4YJ3E 3ZEFB 2VWAA 4UV8B 5LCYA 2LJLA 1HF8A 2L3LA 3N9QA 3MJXA 3ZMUB 4FI5A 4NUVA 3I1AA 3PE0A 5EK4A 1HCIA 3O1HA 3H3AA 2V7MA 5FXVA 5FYMA 3VKHA 2PG8A 5JQGE 2LSGA 3AAEB 5EK3A 3RRWA 3F31A 5DQVA 2ZM8A 2E9XC 4IE7A 4OD4A 2D2SA 2W0GA 2XQYA 1FIOA 1VOMA 2HH7A 4H9PC 4IE5A 1ZHCA 3LK42 2J1DG 1SA0E 2LEHA 4AKRB 3M65A 2LSJA 1E1HB 2X9WA 5A1LA 4JLEA 4UF0B 2V1DB 5FXXA 3HKBE 3ZMTB 5L3EB 5J2TE 3FHNA 3W15B 4I4TE 3PURA 2NWBA 5KX5E 5HXRA 1YD8G 4PJLA 1T98A 4AXPA 3DU6A 4MALA 2LM9A 5F8PA 5DJQC 2NTXA 4UIGA 4MLKA 2UXNB 3AA0B 2PJQA 2VKDA 2K9AA 1YW0A 1OWAA 4I50E 4AKGA 3PTRB 1D0YA 4B6XA 2CEAA 1NAFA 2VASA 3MXZA 4BJMA 5JRCB 5C8YE 2CM0A 2W61A 1OXZA 4BA9A 2V7IA 3O1JA 4CI3B 5J2UE 1YKHB 4UVAB 1EZ3A 3OBVE 1HG2A 2C5JA 3KV4A 2KXPB 2WAUA 3LFMA 1H7CA 1MMGA 2BZBA 2V26A 4HFVA 3FXDB 5LOVE 4TUYE 3C64A 3O1IA 4X1IE 2EHOC 2Q9QC 2YU1A 3OYZA 5LHHB 2W63A 4H9QC 2XAJB 3FBZA 3K3NA 3Q2MA 3EUHA 4DVDA 3BQLA 3LK2B 3AA6B 4MBQA 3BK9A 2R7RA 5FMNA 2C0SA 3KVAA 3ONXA 3BQIA 1KNZA 2X68A 4TV9E 4CXWA 5M4YA 4KUMB 2WBLA 3ZYKA 4UVCB 1B7TA 4GYSA 1QSDA 5JDLA 2L9QA 3FB2A 1MIYA 2DWKA 4UVBB 3LG7A 4YJ2E 2Y6XA 5LHGB 1UCUA 4JEHB 2MYSA 3LK3B 1U4QA 2BDEA 1S94A 2CXFA 2JMHA 3F2EA 3ZMZB 1MIVA 2YEVC 3N9OA 3CQCB 4I55E 4IE4A 3I9WA 1YKEB 3NZPA 4O2AE 4GK5E 4ZS3A 2K5BB 3IHRA 3HR0A 3AAAB 5FY1A 1FMWA 3MKDA 4EIWA 3IBPA 4TV8E 5IYZE 3T8OA 2LOPA 3P7IA 3QK6A 2VKJA 2E8IA 4AQFA 3B13A 1BR4A 2P9BA 4PNIA 2YINA 4IDZA 4C90A 5L3FB 3PUSA 4O4HE 2I59A 2WWUA 2QA7A 4IGUA 3CVRA 4P09A 1UX4A 5HXEA 3NS4A 3KYLA 5JRCA 2K24A 3RH3A 2CXLA 4EZ4A 3ZC1A 4GYRA 2JPFA 2V7KA 3NBXX 4O4LE 3PDYA 2XASB 2Y8DA 2PBIA 3Q9DA 4GK0E 3QUJA 4ISTA 4ERRA 2KNDA 3RYCE 2W00A 4HGAA 5CB4E 2DWGA 3U78A 1ZEEA 2IW5B 4WBNE 1U5PA 2OA5A 3E0ZA 3WAKA 4PJNA 3RC3A 3UULA 2V7LA 5AFUL 1IJ5A 1KK7A 2YK0A 3EDVA 3C98B 2R7XA 2ACXA 2JQQA 2VB6A 5ETWA 3IF8B 2R7QA 4AI6A 4MHCA 4HTEA 4QHOA 2IC6A 3PUAA 2ZM0A 5HWXA 3KVBA 1NWMX 2K48A 4ZOLE 2NOXA 3N2KE 1Z0PA 3HA4A 4IE0A 1MNDA 4ZS2A 3UT5E 2WMOA 3ZJ1A 2NP9A 4OFZA 4AQGA 3KINB 4AKLA 5HXHA 1WR6A 4UEMA 5LGTB 2KWIB 4PJJA 4PFOA 5BMVE 5JDMA 3GWHA 2LSYA 4QX7B 3ZYMA 2DLRA 2G0UA 1MIWA 1UX5A 1WYBA 2IAKA 2LOSA 2QGSA 2D5UA 4ZI2D 3ESLA 3NZQA 4H63V 3ETUA 4PK5A 4KBMB 4C2MA 4PW8A 5L3CB 5L3GB 4EYUA 4X1KE 3EVYA 3PU8A 4DBRA 2E9XA 2GK9A 4QXBB 5JR9C 4P0AA 3K8PC 5HWYA 4UELA 1IJ6A 5JDNA 2BVMA 3R6NA 3MA9A 5LA6E 4BAYB 5KMGP 3AAIA 4H63H 3OJAA 2ZM2A 1LVFA 2SPCA 1IAPA 1QUUA 2R7OA 2CCQA 3AA1B 5H6QB 3GN5A 4QX8B 2X0LB 3K3OA 4EOZB 3UFEA 5JREA 2KWHA 3HKEE 3RYHE 2H7VC 1HFAA 2LHRA 4U74A 2CLYC 3FXEB 3ZPOA 2R7TA 2CMRA 5F3JA 4WBOA 3CX6B 2A72A 2MBGA 1CUNA 3GMIA 3Q5WA 4PJMA 2VL8A 4AKHA 3SWHA 3J9X1 4XZCA 3E08A 2C5IT 4JEUB 2ODVA 2LE8A 1D1BA 1MNEA 2V7JA 2A3DA 2DCFA 3FBLA 3UTKA 4M1PA 5DQWA 4PK4A 2MTQA 3R84B 2X51A 2NW7A 4CZZB 2EHOA 2Q9QA 2XUEA 4O4JE 3ZCIA 4I43B 4HE8A 3N2OA 4IE6A 4OK0A 4J2CA 4OYKA 4PK6A 4U72A 1FEWA 2HPJA 1BR0A 2VK9A 1WLXA 2X9HA 3CPZA 3I0QA 4G63A 4TN7B 4ILUA 3RYFE 3RPUA 2D0TA 3WI3A 3ZMVB 5FNVE 3V5SA 2JJ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FHN A;  2A2F X; 
#chains in the Genus database with same CATH topology
 3O60 A;  2VKO A;  5HBU A;  3KBT A;  2KZ7 B;  2LRL A;  3QPL A;  1JUP A;  2X67 A;  4P0B A;  2E9X B;  4B3S T;  5AQC A;  4EAH A;  5HEO A;  3AEF A;  3P4Q A;  4O8S A;  2R7V A;  2KMF A;  4JI0 T;  4QKN A;  4CQI A;  3CWR A;  1O3X A;  3JC6 D;  2W62 A;  4EV6 A;  3RX6 A;  2KT9 A;  3O4X E;  3VPR A;  3P8C D;  5IPA A;  3PU3 A;  3PV0 F;  4DND A;  3UU3 A;  2X0Y A;  2BG9 B;  2ZY9 A;  2VKV A;  2G7G A;  5LBQ B;  2IHR 1;  4FJO A;  4MFR A;  4KX6 A;  3A7M A;  3DP7 A;  4DID B;  3PPB A;  3VOX A;  2EHO B;  4XK4 A;  1W0A A;  4D7M A;  4G12 A;  1CHU A;  5LGN B;  2JQ9 A;  4CXY A;  3MVP A;  4IRE A;  4KP3 C;  2CA5 A;  3L09 A;  3N9P A;  2CXD A;  3J7Y q;  2MPK A;  5LYJ E;  4QWN B;  5AQN B;  2R7S A;  2CHO A;  5FVL A;  3UUN A;  3Q5X A;  5C2T A;  4TX5 A;  3EUP A;  3CKD A;  5JR9 A;  2M67 A;  5IUX A;  3GZI A;  5D19 A;  3VTI A;  4ASK A;  2YDS A;  2EH3 A;  2H7O A;  2WMN A;  1WCR A;  1MMD A;  4LMK A;  4IT4 A;  3UU6 A;  4WNK A;  2WU2 A;  2GBY A;  3HTH A;  3ZST A;  3PUQ A;  2B76 A;  3OVU A;  5JDF A;  2X9Y A;  1T56 A;  3QQA A;  1YQ3 A;  3C2B A;  5CA1 E;  4LFC T;  2M6I A;  2WDR A;  4HEA A;  4X1E A;  3TLV A;  3QC9 A;  4K0U A;  3KDS E;  5LHI B;  4ILA A;  2YOE A;  2B3W A;  5L2L A;  3RGL A;  3NRG A;  4JI6 T;  4CN6 A;  4L9I A;  1T8B A;  3PUV F;  5GON E;  4QXC B;  3AVS A;  3ZC0 A;  3SOL A;  3ABV A;  4PFP A;  1XWM A;  2CWO A;  1G73 A;  3KZ9 A;  4ACI A;  1US7 B;  2PFV A;  1MMN A;  5LMN T;  2O7O A;  4AQF C;  5JR9 B;  4H9O C;  3BJB A;  4NEL A;  4A97 A;  2DG8 A;  3DU5 A;  3UFG A;  2KIN B;  1LRZ A;  3DTO A;  3T6N A;  4OD5 A;  3AE2 A;  4XAX B;  2NTY A;  1E2A A;  4IDO A;  2LHN A;  2H3R A;  4U9N A;  2DHR A;  5JTG A;  1XMO T;  4X65 T;  2ZMA A;  1WYC A;  3IA3 A;  3N9L A;  5FMP A;  2O7T A;  2X66 A;  2N9D A;  3G1O A;  3SFE A;  4QH4 A;  2VWA A;  2LJL A;  1HF8 A;  2L3L A;  3ZMU B;  5F1J A;  5FXV A;  1SGM A;  3VKH A;  3FZL B;  2DTZ A;  3F31 A;  2ZM8 A;  4DR6 T;  4H9P C;  4IE5 A;  3LK4 2;  1JT6 A;  3BR3 A;  2LM2 A;  3BRU A;  3ZMT B;  3FZK B;  5J2T E;  3FHN A;  2HXO A;  1YD8 G;  1T98 A;  5LB7 B;  4B3T T;  4MAL A;  2LM9 A;  4JI2 T;  5DJQ C;  3AA0 B;  3SDG A;  3AXJ A;  1OWA A;  1YXR A;  4I50 E;  1D0Y A;  2BS3 A;  4HWD A;  2CEA A;  2UU9 T;  2CM0 A;  4IDQ A;  4CN1 A;  3COL A;  3O1J A;  4ILC A;  4CI3 B;  1YKH B;  4UVA B;  1EZ3 A;  3OBV E;  3S4U A;  2WAU A;  2WUI A;  2Q9Q C;  1M7K A;  3O8H A;  2FQ4 A;  3FBZ A;  3LSP A;  3BQL A;  3AA6 B;  3Q5D A;  3BK9 A;  4D7N A;  5F27 A;  3PJA J;  1SE7 A;  2BG9 E;  3ONX A;  4TV9 E;  4V2F A;  3G06 A;  5GPA A;  4LF5 T;  2V5D A;  4GYS A;  2XZE A;  3Q0U A;  5D18 A;  2J4G A;  1XMQ T;  4YJ2 E;  3K1S A;  2QVA A;  2NS7 A;  3NZP A;  2RAS A;  4O2A E;  4GK5 E;  4U33 A;  5DAJ A;  2K5B B;  4TNV A;  1FMW A;  2QRX A;  2E8I A;  2XRL A;  2YIN A;  3Q0W A;  3PUS A;  2XM1 A;  4O4H E;  2E2A A;  2YDQ A;  2QA7 A;  4IGU A;  3AXJ B;  1UX4 A;  2WQY A;  3UU4 A;  2XPW A;  3P50 A;  1KF6 A;  2D9D A;  4JV5 T;  3LHQ A;  3NBX X;  3PDY A;  2IIU A;  1L0V A;  2PBI A;  3Q9D A;  4AC0 A;  2WDQ A;  1JUM A;  3RIF A;  1N34 T;  3RYC E;  2W00 A;  3VIB A;  1IBM T;  1U5P A;  3E0Z A;  4HFD A;  4PJN A;  2YK0 A;  2R7X A;  1GQE A;  2JQQ A;  2F4V T;  2R7Q A;  4QHO A;  2G7L A;  4JKZ A;  3HTI A;  5HWX A;  2K48 A;  4YXD A;  3UT5 E;  4OFZ A;  4AQG A;  3PUZ F;  4UEM A;  3ZYM A;  2LOS A;  1MIW A;  1T33 A;  4EYU A;  3PU8 A;  4DBR A;  2FUP A;  3R6N A;  5AQH B;  4JI5 T;  2XQ4 A;  4H63 H;  3OJA A;  5IWA T;  3L8R A;  2NS8 A;  3AE9 A;  3AA1 B;  2X0L B;  5F0F A;  3UFE A;  5AQF B;  3RYH E;  3FXE B;  5F3J A;  2PZ9 A;  2LKG A;  2OLT A;  4JI1 T;  2FJA A;  3ON2 A;  2ODV A;  2V7J A;  2BS4 A;  3VW1 A;  2A3D A;  2DCF A;  3FBL A;  3UU5 A;  4NN1 A;  4JI7 T;  3R84 B;  2R6G F;  4PK6 A;  4HE8 A;  3N2O A;  4OK0 A;  4OYK A;  4K0K T;  1HNZ T;  1WFD A;  4LFB T;  1J5E T;  1UGO A;  4TN7 B;  4WYV A;  4ILU A;  3CJD A;  3VUQ A;  3RPU A;  3WI3 A;  5FNV E;  1QVT A;  4V2G A;  2VL0 A;  4DV5 T;  3C51 A;  3NI7 A;  3VHL A;  4Z91 A;  4F6R C;  4IHJ E;  4B3M T;  1HTJ F;  2CWY A;  4OYJ A;  3IH2 A;  3V6G A;  3GA8 A;  2J62 A;  5CJ5 A;  4U2Z A;  3K3Q C;  3AE5 A;  3VW2 A;  2XSB A;  2OF7 A;  1KNR A;  3F1B A;  3V78 A;  3B57 A;  2FD5 A;  3ANW A;  1D1C A;  2XAG B;  3EHZ A;  5FXW A;  3D0T A;  3SS1 A;  5L3D B;  5LXT E;  4C91 A;  3ZCJ A;  4HWF A;  4ILB A;  4EYY R;  1MMA A;  3OPC A;  1XNQ T;  3Q0V A;  3BHQ A;  1T7S A;  3BQZ A;  4YSY A;  2V5C A;  3F57 A;  3VU7 H;  2IC9 A;  2XPV A;  2QYW A;  3AEA A;  1FMV A;  3QNU A;  4NIQ A;  3RIA A;  5LGU B;  3AED A;  4AKI A;  3C4X A;  3UUB A;  5EK2 A;  4O4I E;  4H9R C;  4HFI A;  3ZT6 A;  3BNI A;  4GCT A;  2E9X D;  3JAD A;  5JDH A;  4L62 A;  4YFS A;  4ZI2 C;  3ZN0 B;  4X5T A;  1OED C;  5LJM A;  2ID6 A;  2R7U A;  5KXJ A;  1X79 A;  4H9N C;  4COF A;  5EZH A;  2H88 A;  3HGG A;  4YLH A;  1OED A;  4HKA A;  3S5R A;  4YSX A;  3KBU A;  4DUZ T;  1V9D A;  2ZCX A;  2YU2 A;  4IIJ E;  2L8K A;  3AE4 A;  5FY0 A;  3ANW B;  5J1R A;  1LKX A;  1RPW A;  5JH7 E;  3GEU A;  3BT9 A;  3N9M A;  2X9X A;  4L0R A;  3LOC A;  2EHO D;  3FZH B;  5AQV B;  4DV3 T;  5FY7 A;  1Z77 A;  3T1Y T;  5J0Z A;  4ADZ A;  2UXI A;  4JNN A;  3H37 A;  2ZLY A;  5D1R A;  3CWZ B;  4GFL A;  4WIB A;  2FBQ A;  5EZG A;  1WRD A;  4I0U A;  5FKK A;  2ID3 A;  5EZY E;  4D5F A;  2F07 A;  3G1M A;  4DW6 A;  2QKO A;  1J1J A;  1IZN B;  2PBX A;  3C4Z A;  3FRQ A;  2GEN A;  4U2Y A;  4DVY P;  3ZN1 B;  1J5W A;  4UF0 A;  3JC6 C;  1OED B;  5HCJ A;  1QPI A;  4KHP T;  5GPC A;  2WB5 A;  5L4H A;  2G3B A;  5EYR A;  4LML A;  3NRY A;  3QKX A;  4CI1 B;  2W4X A;  4CI2 B;  4CXX A;  3UQ4 A;  2XB5 A;  2WU5 A;  2BBH A;  3JAF A;  3ZYL A;  3CQX C;  2J47 A;  3N2G E;  2QCO A;  2ZOZ A;  2HKU A;  2DNX A;  3KV6 A;  2XAQ B;  2Y48 B;  2UXD T;  3CX8 B;  3RRC A;  3N9Q A;  3I1A A;  5FYM A;  1RKT A;  5JQG E;  4DV1 T;  4HWC A;  3JAE A;  2D2S A;  4U9L A;  5AQO B;  1ZHC A;  3C07 A;  4TNW A;  2NP5 A;  1SA0 E;  4AKR B;  3HGY A;  4ME9 A;  3RQW A;  1E1H B;  4YSZ A;  4UF0 B;  5FVK A;  4LF8 T;  4LMJ A;  3W15 B;  4I4T E;  2WS3 A;  5AQM B;  2NWB A;  2UXH A;  4PJL A;  1W9R A;  4AXP A;  2CRB A;  4M3G A;  3X1D A;  5AQG B;  1KNP A;  4MLK A;  2PJQ A;  1IBL T;  5L4E A;  1YW0 A;  4AKG A;  2W61 A;  2IAI A;  4HWI B;  3PUY F;  2IUB A;  5J2U E;  1HG2 A;  2JK3 A;  3KV4 A;  3T8O A;  4CZZ B;  3LFM A;  1H7C A;  1MMG A;  4GCK A;  3FXD B;  3C64 A;  2YU1 A;  5LHH B;  2W63 A;  3Q2M A;  5AQR B;  4MBQ A;  2RPA A;  4KI0 F;  4B1R A;  3KVA A;  3VR9 A;  2X68 A;  1JT0 A;  2WDV A;  1RKW A;  4KUM B;  4DR4 T;  4LF4 T;  4UVB B;  1MIY A;  3LG7 A;  3HIM A;  5LHG B;  2BKN A;  2MYS A;  4HFH A;  2XPU A;  5IP6 A;  3F2E A;  3ZMZ B;  2YEV C;  3KNW A;  5F0H A;  1YKE B;  2HN2 A;  4ZS3 A;  3MKD A;  5IYZ E;  5J1Y A;  2XDN A;  4AQF A;  3ZSS A;  2P9B A;  4IDZ A;  2GUH A;  3CVR A;  4F8H A;  1HNW T;  3NS4 A;  5AQJ B;  2CXL A;  3ZC1 A;  4GYR A;  2VQE T;  4LFA T;  3LJL A;  2YKS A;  5HEU A;  5L47 A;  2Q24 A;  4DR1 T;  3QUJ A;  3PJA A;  4U31 A;  5CB4 E;  3U78 A;  1ZEE A;  3TLW A;  2OA5 A;  4U3C A;  4A5X A;  5AFU L;  5BR8 T;  3FZM B;  5AQK B;  3IF8 B;  3UU8 A;  3FK7 A;  1E7P A;  1NWM X;  3QB5 A;  3FZF B;  2NOX A;  1MND A;  4ZS2 A;  2HYJ A;  4EED A;  4AKL A;  3QB5 K;  2KWI B;  4PJJ A;  3BR5 A;  3BCG A;  2DLR A;  1UX5 A;  2I6H A;  2QIB A;  4PW8 A;  4H63 V;  4C2M A;  5L3G B;  2IU5 A;  3EVY A;  2GK9 A;  5AQI B;  1ORK A;  4IL9 A;  2G0E A;  5HWY A;  4UEL A;  2BVM A;  5LA6 E;  4MK6 A;  4GCL A;  2ZM2 A;  1LVF A;  4DUY T;  4JI8 T;  4LF9 T;  1IAP A;  4QX8 B;  5JRE A;  2H7V C;  2LHR A;  2CLY C;  5LMU T;  3ZPO A;  1R8I A;  2A72 A;  3GMI A;  4JYK A;  1OED E;  3A8Y C;  4NXM T;  2IBD A;  4XZC A;  5AQU B;  4JEU B;  1JUS A;  4ZEY A;  2HXI A;  3EI0 A;  5DQW A;  2ZB9 A;  2MTQ A;  2OV9 A;  2NW7 A;  5AQP B;  2Q9Q A;  4O4J E;  4IE6 A;  4U72 A;  2M6B A;  3BTI A;  2VKE A;  3BR2 A;  4MXM A;  3QBM A;  1WLX A;  5ABF A;  1KEY A;  3RYF E;  3ZKR A;  5H9T A;  3ON4 A;  3ZMV B;  3Q5E A;  4HFE A;  2JJ9 A;  2R7W A;  3VRB A;  3AB3 B;  3TKL B;  3CRJ A;  3ETV A;  1Y64 B;  3RYI E;  1LVK A;  2JJ7 A;  2FBW A;  5CA0 E;  2WSS V;  3BR0 A;  4DMW A;  3MK7 C;  2IDO B;  2UXB T;  4DR7 T;  4CGR A;  5FP3 A;  3NRX A;  2YVE A;  4B3R T;  3SFD A;  3MNL A;  5HYA A;  4H9S E;  2JQK A;  3B6C A;  4HKU A;  2CPT A;  4KHZ F;  5EFY A;  3N9N A;  3VVZ A;  3BQK A;  2DL1 A;  4QXH B;  2NW9 A;  1D1A A;  3P4R A;  5FKL A;  3A5X A;  2CLY B;  3CQG B;  1M62 A;  2YVX A;  1NEN A;  2UXP A;  2LLY A;  2XQ6 A;  2FJ1 A;  2UXX B;  2Q9Q B;  5JDG A;  5HSZ A;  4P1N A;  3G56 A;  3C50 A;  5HAW A;  2BVL A;  2CE7 A;  4ISS A;  5ABF B;  4JYA T;  3JSJ A;  3DJB A;  2K3W A;  4DV6 T;  5LG4 A;  3BR1 A;  4OX9 T;  2LSI A;  3MZK B;  1BJZ A;  3Q3S A;  3N5L A;  3CX7 B;  5F04 A;  1XDP A;  4YT0 A;  2HPL A;  2X9D A;  5J1G A;  4DO0 A;  2ZM6 T;  4X20 E;  5ABG A;  2PTF A;  2IEK A;  3ZJ2 A;  1ZKE A;  4A56 A;  2CBJ A;  2QWT A;  2MOZ A;  1IBK T;  5KDM C;  3TLU A;  2ZCM A;  3E7Q A;  2W2U A;  2D0U A;  5FXZ A;  2JIW A;  4IDN A;  2ODU A;  4BJN A;  4JI3 T;  1XDO A;  2Y31 A;  2JMK A;  2RA1 A;  3HI2 A;  2AE9 A;  2IML A;  4JUY A;  4M3B A;  3NXC A;  4DMV A;  4EB6 E;  3ZMS B;  4W97 A;  4UXN B;  2DI4 A;  3O9X A;  2UXO A;  3HL6 A;  4O2B E;  4A98 A;  4YZE A;  1DU2 A;  3LSR A;  3LBX A;  3TP3 A;  4M3D A;  5FL1 A;  4W1U A;  2FJI 1;  1WR0 A;  3NWI A;  3EDU A;  2ZOY A;  2A2F X;  2WP9 A;  1JTX A;  2LT3 A;  2WY2 A;  4E7Z A;  2I0M A;  4EXT A;  1UUR A;  2XQ5 A;  5IOY A;  2D6Y A;  2HQ5 A;  5J1U A;  3RKO A;  2NW8 A;  3ZQG A;  2VVS A;  4D5C A;  3KV9 A;  5TAO A;  2WM9 A;  4TWD A;  3RKG A;  2XAF B;  2XTL A;  1Y01 A;  1ZK8 A;  2UUC T;  3VKG A;  4YTP A;  3DEW A;  3ONL C;  2RAE A;  2FJE A;  3CML A;  4V1A v;  4Z90 A;  1ZV4 X;  5AQQ B;  3AE3 A;  3IEE A;  4N78 D;  2BKP A;  5JVD E;  1D0Z A;  4HFB A;  3LBX B;  4KMC A;  2WWV A;  4GKJ T;  3ZEF B;  3IH4 A;  4UV8 B;  3BQY A;  4NUV A;  5EK4 A;  1HCI A;  3H3A A;  2V7M A;  5F0C A;  3VVX A;  3ZQF A;  3AAE B;  2OI8 A;  1N32 T;  2E9X C;  4IE7 A;  2XQY A;  1FIO A;  2HH7 A;  1UI5 A;  3BTL A;  2J1D G;  2LEH A;  4YHH T;  2LSJ A;  5K7F A;  4YY3 T;  4JLE A;  2V1D B;  2X6O A;  3HKB E;  1T72 A;  5L3E B;  1W09 A;  3VP5 A;  3DU6 A;  3H3M A;  3RHW A;  2UXN B;  2QOP A;  2V8S V;  2VKD A;  3PTR B;  4B6X A;  2VAS A;  3MXZ A;  3DCF A;  4DV4 T;  5JRC B;  1U9N A;  4BA9 A;  4IL4 A;  2Y30 A;  2BS2 A;  4ZZB A;  2BZB A;  2NP3 A;  2EHO C;  3OYZ A;  5HCM A;  1UI6 A;  4H9Q C;  3K3N A;  2RHA A;  3EUH A;  3LK2 B;  2R7R A;  2C0S A;  3BQI A;  4CXW A;  5M4Y A;  2G7S A;  2WBL A;  1B7T A;  3ZT7 A;  5FKN A;  5JDL A;  5CXI A;  3P4S A;  2L9Q A;  3FB2 A;  2Y6X A;  1U4Q A;  2BDE A;  1S94 A;  5AQL B;  2CXF A;  3NVO A;  3N9O A;  3CQC B;  3TLS A;  4ICH A;  3IHR A;  3HR0 A;  3AAA B;  4X62 T;  4EIW A;  3IBP A;  4PNI A;  4PXI A;  5L3F B;  1YQ4 A;  4X66 T;  2I59 A;  2WWU A;  4DV0 T;  5HXE A;  3KYL A;  3WHC A;  2K24 A;  3TLT A;  3RH3 A;  4EZ4 A;  4UDS A;  4O4L E;  3EGQ A;  1VCT A;  2XAS B;  4NPP A;  2Y8D A;  4GK0 E;  4IST A;  2KND A;  4LF7 T;  1W0B A;  4EEB A;  2DWG A;  4YTN A;  4WBN E;  3HTJ A;  2I10 A;  3NNR A;  2V7L A;  1IJ5 A;  5IOZ A;  3EDV A;  2ACX A;  5ETW A;  2X0H A;  4MHC A;  4HTE A;  3PUA A;  2ZM0 A;  3KVB A;  4ZOL E;  3F0C A;  3P4W A;  3AE8 A;  4IE0 A;  5CGM A;  2WMO A;  4KWA A;  3ZQH A;  3KIN B;  2V6Y A;  5BMV E;  4PFO A;  5FHP A;  2LSY A;  2AXD S;  2XQA A;  1WYB A;  3PUX F;  3ESL A;  2WGB A;  3NZQ A;  5L3C B;  2GFN A;  2MAW A;  5JR9 C;  1JNR A;  2XPK A;  2XSA A;  3MA9 A;  3NKZ A;  3HTA A;  2SPC A;  2R7O A;  2CCQ A;  3GN5 A;  3HKE E;  1HFA A;  4U74 A;  2FJB A;  4IDP A;  4WBO A;  3CX6 B;  3VRA A;  2YN6 A;  2UUA T;  1CUN A;  4PJM A;  3Q5W A;  2VL8 A;  3SWH A;  3T1H T;  3E08 A;  2C5I T;  2FJD A;  2XQ9 A;  2LE8 A;  1D1B A;  3AQS A;  3UTK A;  3VW0 A;  4M1P A;  4PK4 A;  5K7H A;  2X51 A;  3ZCI A;  4I43 B;  5AQT B;  5ABE A;  3RQU A;  2HN1 A;  2OER A;  3PUW F;  2HPJ A;  1BR0 A;  3FIW A;  2X9H A;  1Z0X A;  4G63 A;  2V6Y B;  1QLB A;  3V5S A;  3AE6 A;  1SHZ C;  3I9Y A;  1BR2 A;  3ZLI A;  3AEE A;  1AJ3 A;  3RIU C;  3RD3 A;  2XGD A;  4ZI7 E;  4UV9 B;  3RC8 A;  4L5G A;  1HG5 A;  3GN5 B;  4TWF A;  5C3J A;  3LJC A;  2YVH A;  5E0O A;  3RIU A;  4ZI3 D;  4ZHQ E;  2ES0 A;  4E7S A;  2VUR A;  5CQG A;  3ZT5 A;  3LDQ B;  4ZI3 C;  2VKH A;  1XZY A;  1VRB A;  1UK5 A;  3FK6 A;  5J3L A;  2XM2 A;  3MAC A;  4GFK A;  4EZH A;  4X64 T;  3V5U A;  3UUX B;  5F5W A;  2ZCN A;  3B6A A;  1ZP0 A;  4YTM A;  3C4W A;  5HXC A;  3AQT A;  4LF6 T;  2XQ7 A;  1G8X A;  3QOF A;  2CBI A;  2VPR A;  4Z8X A;  4MO7 A;  2W66 A;  3IUV A;  3TP0 A;  4XBF B;  2KLQ A;  2N1G A;  2XHE B;  2XJ7 A;  1ZOY A;  3SFI A;  2BBJ A;  1JTY A;  5F08 A;  3OYX A;  3KV5 A;  5C4Y A;  3RH2 A;  2W67 A;  4OHF A;  5H6R B;  3RI5 A;  3HKD E;  4X1Y E;  2DG7 A;  3KFW X;  3PM1 A;  2TCT A;  5DAB A;  3B81 A;  4ZXL A;  1Z8U A;  4GOU A;  2YDR A;  2XAH B;  3ANG A;  5IHY A;  3P9T A;  1N36 T;  2V6X A;  5CXG A;  5LBM A;  2UUB T;  5HXS A;  2V57 A;  4I6Z A;  3QPS A;  4WW0 A;  1D0X A;  2JRK A;  4YHJ A;  3AVR A;  3KKC A;  4DR2 T;  2Z6E A;  1S35 A;  5FKM A;  4TWH A;  3UUM A;  4GIW A;  2C5K T;  2Q9Q D;  3AE1 A;  2E5L T;  4JI4 T;  3I0O A;  3WAJ A;  5HEG A;  3PUG A;  5ADX L;  3O8G A;  1HNX T;  2HHH T;  1HS7 A;  1XNR T;  4PAG A;  4NUU A;  5K7Z A;  4JL3 A;  1HX8 A;  1VI0 A;  4DV7 T;  4AQY T;  2LSK A;  3P4P A;  3NPI A;  3G7R A;  5LNK A;  5L3B B;  3BTJ A;  3LSJ A;  3L3P A;  2VVN A;  2RP4 A;  3SRZ A;  2XY8 B;  2QTQ A;  1UUS A;  3VVY A;  3E22 E;  5LJN A;  1VCS A;  4DV2 T;  3AEB A;  3OKQ A;  2B1E A;  4ZZC A;  2HYT A;  4DBQ A;  3L39 A;  1JNZ A;  3AA7 B;  3IH3 A;  5JDQ A;  4G2A A;  5HAX A;  4HN9 A;  4IRV A;  4AC6 A;  2KSR A;  4ANJ A;  2H89 A;  1BR1 A;  1HX1 B;  5LP6 E;  3HKC E;  4I76 A;  3U3I A;  3RLF F;  4TZ4 C;  3PAS A;  2N2N A;  4YJ3 E;  5LCY A;  3MJX A;  4FI5 A;  3PE0 A;  3O1H A;  2PG8 A;  2BKO A;  2LSG A;  5EK3 A;  5FKO A;  3RRW A;  5DQV A;  4OD4 A;  2W0G A;  1VOM A;  5FKY A;  2UXC T;  3EAM A;  2WV1 A;  4AF5 A;  3M65 A;  4ABZ A;  3ONJ A;  2X9W A;  5A1L A;  4JBW F;  1I6Z A;  2W53 A;  5FXX A;  3PUR A;  4AUX A;  4WZX A;  5KX5 E;  5HXR A;  3CDL A;  1SUM B;  5F8P A;  2NTX A;  4UIG A;  4DR3 T;  3CIR A;  3CCY A;  2XQ8 A;  4QH5 A;  5LG3 A;  2K9A A;  3BTC A;  4EGW A;  4BJM A;  1NAF A;  5C8Y E;  3JCF A;  2UXU A;  1FJG T;  1OXZ A;  3OTO T;  3UQ7 A;  2V7I A;  4U7I A;  3VOK A;  2C5J A;  2KXP B;  5AQS B;  4HFV A;  2V26 A;  3ANP A;  5LOV E;  4TUY E;  3O1I A;  4UR9 A;  4X1I E;  2A9U A;  2LRK A;  3KKD A;  1I94 T;  2XAJ B;  4DVD A;  3ZQI A;  4AIU A;  5FGL A;  2Y2Z A;  5FMN A;  4GKK T;  5CFB A;  5HEJ A;  1KNZ A;  3M3Z B;  2NR4 A;  3ZYK A;  4UVC B;  3CK6 A;  4U7Y A;  1QSD A;  1HR0 T;  2REK A;  5HEH A;  3BR6 A;  2DWK A;  1UCU A;  4JEH B;  3LK3 B;  2WZI A;  3B5M A;  2XGE A;  2CHN A;  2JMH A;  4QH1 A;  3WHB A;  1KFY A;  1MIV A;  4IE4 A;  4I55 E;  3I9W A;  5FY1 A;  4TV8 E;  4M3E A;  2NX4 A;  2LOP A;  3P7I A;  2VKJ A;  3QK6 A;  3B13 A;  1BR4 A;  2WZH A;  4C90 A;  4M3F A;  4P09 A;  3VR8 A;  5JRC A;  2VQF T;  2JPF A;  2V7K A;  2E5V A;  3LWJ A;  4ERR A;  2XGC A;  5CW8 A;  4HGA A;  2IW5 B;  5ABH A;  3WAK A;  3RC3 A;  3UUL A;  3ZQL A;  1KK7 A;  1A6I A;  3C98 B;  4B3A A;  2VB6 A;  4HFC A;  4AI6 A;  2IC6 A;  2TRT A;  1U9O A;  3N2K E;  1Z0P A;  3HA4 A;  4HWH A;  4DR5 T;  4CN4 A;  3ZJ1 A;  2NP9 A;  5HXH A;  1WR6 A;  5LGT B;  5JDM A;  3GWH A;  4QX7 B;  2G0U A;  2IAK A;  2QGS A;  2D5U A;  4ZI2 D;  3ETU A;  4PK5 A;  4KBM B;  4X1K E;  2E9X A;  4QXB B;  4P0A A;  3K8P C;  1X9B A;  3G1L A;  1IJ6 A;  5JDN A;  1ZKG A;  4BAY B;  5KMG P;  2WCA A;  3AAI A;  4AIS A;  1QUU A;  5H6Q B;  3K3O A;  4EOZ B;  2FX0 A;  2KWH A;  2BG9 C;  3AE7 A;  3LSV A;  3HE0 A;  2R7T A;  2CMR A;  2JQH A;  2MBG A;  4AKH A;  4Q25 A;  3RF1 A;  3EAB A;  3J9X 1;  2LKH A;  3AEC A;  2BG9 A;  1MNE A;  2ACZ A;  2OPT A;  5FL0 A;  1QVU A;  5K58 A;  1N33 T;  3AEG A;  2EHO A;  2XUE A;  3DPJ A;  4J2C A;  2XQ3 A;  1FEW A;  1NEK A;  2VK9 A;  3I0Q A;  3CPZ A;  5GP9 A;  2D0T A;  4NXN T; 
#chains in the Genus database with same CATH homology
 2R7W A;  2VKO A;  1SHZ C;  3AB3 B;  3KBT A;  3I9Y A;  3TKL B;  2KZ7 B;  1BR2 A;  3ZLI A;  3ETV A;  2X67 A;  1Y64 B;  3RYI E;  4P0B A;  1LVK A;  2E9X B;  3C51 A;  3VHL A;  5CA0 E;  4EAH A;  4F6R C;  4IHJ E;  1AJ3 A;  1HTJ F;  2WSS V;  2CWY A;  2R7V A;  4O8S A;  4ZI7 E;  4UV9 B;  3MK7 C;  4DMW A;  3RC8 A;  2KMF A;  4OYJ A;  5FP3 A;  4QKN A;  3GA8 A;  4CQI A;  3NRX A;  1O3X A;  3JC6 D;  4L5G A;  1HG5 A;  2W62 A;  3GN5 B;  5HYA A;  4H9S E;  3RX6 A;  3LJC A;  5E0O A;  3K3Q C;  3N9N A;  4ZI3 D;  3BQK A;  4ZHQ E;  2ES0 A;  2KT9 A;  4QXH B;  4E7S A;  3O4X E;  2NW9 A;  5CQG A;  3P8C D;  1D1A A;  4ZI3 C;  2VKH A;  3PU3 A;  1VRB A;  4DND A;  3B57 A;  3A5X A;  2CLY B;  3ANW A;  1D1C A;  2XAG B;  3MAC A;  3CQG B;  5FXW A;  3D0T A;  3SS1 A;  5L3D B;  4EZH A;  5LBQ B;  5LXT E;  4FJO A;  4MFR A;  3V5U A;  4C91 A;  3DP7 A;  3UUX B;  3ZCJ A;  4EYY R;  2UXX B;  1MMA A;  2EHO B;  2Q9Q B;  5JDG A;  3C4W A;  5HXC A;  3C50 A;  3F57 A;  2BVL A;  2CE7 A;  5LGN B;  1G8X A;  3VU7 H;  4ISS A;  4CXY A;  4Z8X A;  4KP3 C;  2IC9 A;  1FMV A;  4XBF B;  2CA5 A;  2KLQ A;  2N1G A;  3DJB A;  2XHE B;  3L09 A;  5LGU B;  3N9P A;  5LG4 A;  2CXD A;  4AKI A;  3J7Y q;  5LYJ E;  2LSI A;  3C4X A;  3MZK B;  5EK2 A;  4O4I E;  3OYX A;  4H9R C;  4QWN B;  3KV5 A;  3S4U A;  2E9X D;  4OHF A;  2R7S A;  3N5L A;  5H6R B;  5JDH A;  3HKD E;  4X1Y E;  4YFS A;  3UUN A;  4ZI2 C;  3KFW X;  3CX7 B;  3Q5X A;  3ZN0 B;  5DAB A;  2HPL A;  5J1G A;  4TX5 A;  5LJM A;  4DO0 A;  3CKD A;  4X20 E;  4GOU A;  2R7U A;  2XAH B;  5JR9 A;  2M67 A;  3ZJ2 A;  1X79 A;  4H9N C;  1ZKE A;  4A56 A;  4YLH A;  5IHY A;  3VTI A;  2MOZ A;  4HKA A;  4ASK A;  5KDM C;  3KBU A;  5LBM A;  1V9D A;  2H7O A;  2WMN A;  5HXS A;  2YU2 A;  4IIJ E;  1MMD A;  2L8K A;  2D0U A;  4WNK A;  5FXZ A;  5FY0 A;  4WW0 A;  3PUQ A;  2ODU A;  3ANW B;  1LKX A;  1D0X A;  4BJN A;  2JRK A;  4YHJ A;  3AVR A;  2Z6E A;  1S35 A;  5JH7 E;  2JMK A;  3N9M A;  2X9X A;  4L0R A;  5JDF A;  2RA1 A;  2X9Y A;  3HI2 A;  3UUM A;  4GIW A;  4JUY A;  2C5K T;  2EHO D;  2Q9Q D;  4DMV A;  5FY7 A;  5CA1 E;  4EB6 E;  3ZMS B;  4HEA A;  3QC9 A;  4UXN B;  2DI4 A;  3I0O A;  4K0U A;  4ADZ A;  3KDS E;  3HL6 A;  5LHI B;  4O2B E;  3WAJ A;  3O9X A;  2B3W A;  3PUG A;  5L2L A;  3H37 A;  5ADX L;  2ZLY A;  1HS7 A;  3LBX A;  4PAG A;  3CWZ B;  4L9I A;  4NUU A;  1WRD A;  2FJI 1;  5GON E;  4QXC B;  3AVS A;  3ZC0 A;  3SOL A;  1HX8 A;  3EDU A;  2A2F X;  4PFP A;  5EZY E;  2CWO A;  2LT3 A;  2LSK A;  1G73 A;  4E7Z A;  1US7 B;  2PFV A;  4EXT A;  1MMN A;  1IZN B;  5LNK A;  5L3B B;  4AQF C;  3C4Z A;  5JR9 B;  3L3P A;  4DVY P;  3RKO A;  4H9O C;  2NW8 A;  2RP4 A;  3ZN1 B;  3SRZ A;  4UF0 A;  3DU5 A;  3JC6 C;  3E22 E;  5LJN A;  2KIN B;  1LRZ A;  3DTO A;  3KV9 A;  5TAO A;  2WM9 A;  3OKQ A;  4OD5 A;  2B1E A;  4XAX B;  2NTY A;  2XAF B;  2XTL A;  3NRY A;  4DBQ A;  4CI1 B;  4CI2 B;  2LHN A;  3AA7 B;  5JDQ A;  4G2A A;  4CXX A;  5HAX A;  2H3R A;  4HN9 A;  4IRV A;  2DHR A;  3VKG A;  3ZYL A;  4ANJ A;  3CQX C;  3CML A;  4V1A v;  3N2G E;  2ZMA A;  1BR1 A;  1ZV4 X;  1WYC A;  5LP6 E;  3N9L A;  3IEE A;  4N78 D;  2X66 A;  2N9D A;  3HKC E;  2DNX A;  1D0Z A;  5JVD E;  3U3I A;  3KV6 A;  2XAQ B;  2Y48 B;  4TZ4 C;  3LBX B;  3CX8 B;  2N2N A;  4KMC A;  3RRC A;  4YJ3 E;  3ZEF B;  2VWA A;  4UV8 B;  5LCY A;  2LJL A;  1HF8 A;  2L3L A;  3N9Q A;  3MJX A;  3ZMU B;  4FI5 A;  4NUV A;  3I1A A;  3PE0 A;  5EK4 A;  1HCI A;  3O1H A;  3H3A A;  2V7M A;  5FXV A;  5FYM A;  3VKH A;  2PG8 A;  5JQG E;  2LSG A;  3AAE B;  5EK3 A;  3RRW A;  3F31 A;  5DQV A;  2ZM8 A;  2E9X C;  4IE7 A;  4OD4 A;  2D2S A;  2W0G A;  2XQY A;  1FIO A;  1VOM A;  2HH7 A;  4H9P C;  4IE5 A;  1ZHC A;  3LK4 2;  2J1D G;  1SA0 E;  2LEH A;  4AKR B;  3M65 A;  2LSJ A;  1E1H B;  2X9W A;  5A1L A;  4JLE A;  4UF0 B;  2V1D B;  5FXX A;  3HKB E;  3ZMT B;  5L3E B;  5J2T E;  3FHN A;  3W15 B;  4I4T E;  3PUR A;  2NWB A;  5KX5 E;  5HXR A;  1YD8 G;  4PJL A;  1T98 A;  4AXP A;  3DU6 A;  4MAL A;  2LM9 A;  5F8P A;  5DJQ C;  2NTX A;  4UIG A;  4MLK A;  2UXN B;  3AA0 B;  2PJQ A;  2VKD A;  2K9A A;  1YW0 A;  1OWA A;  4I50 E;  4AKG A;  3PTR B;  1D0Y A;  4B6X A;  2CEA A;  1NAF A;  2VAS A;  3MXZ A;  4BJM A;  5JRC B;  5C8Y E;  2CM0 A;  2W61 A;  1OXZ A;  4BA9 A;  2V7I A;  3O1J A;  4CI3 B;  5J2U E;  1YKH B;  4UVA B;  1EZ3 A;  3OBV E;  1HG2 A;  2C5J A;  3KV4 A;  2KXP B;  2WAU A;  3LFM A;  1H7C A;  1MMG A;  2BZB A;  2V26 A;  4HFV A;  3FXD B;  5LOV E;  4TUY E;  3C64 A;  3O1I A;  4X1I E;  2EHO C;  2Q9Q C;  2YU1 A;  3OYZ A;  5LHH B;  2W63 A;  4H9Q C;  2XAJ B;  3FBZ A;  3K3N A;  3Q2M A;  3EUH A;  4DVD A;  3BQL A;  3LK2 B;  3AA6 B;  4MBQ A;  3BK9 A;  2R7R A;  5FMN A;  2C0S A;  3KVA A;  3ONX A;  3BQI A;  1KNZ A;  2X68 A;  4TV9 E;  4CXW A;  5M4Y A;  4KUM B;  2WBL A;  3ZYK A;  4UVC B;  1B7T A;  4GYS A;  1QSD A;  5JDL A;  2L9Q A;  3FB2 A;  1MIY A;  2DWK A;  4UVB B;  3LG7 A;  4YJ2 E;  2Y6X A;  5LHG B;  1UCU A;  4JEH B;  2MYS A;  3LK3 B;  1U4Q A;  2BDE A;  1S94 A;  2CXF A;  2JMH A;  3F2E A;  3ZMZ B;  1MIV A;  2YEV C;  3N9O A;  3CQC B;  4I55 E;  4IE4 A;  3I9W A;  1YKE B;  3NZP A;  4O2A E;  4GK5 E;  4ZS3 A;  2K5B B;  3IHR A;  3HR0 A;  3AAA B;  5FY1 A;  1FMW A;  3MKD A;  4EIW A;  3IBP A;  4TV8 E;  5IYZ E;  3T8O A;  2LOP A;  3P7I A;  3QK6 A;  2VKJ A;  2E8I A;  4AQF A;  3B13 A;  1BR4 A;  2P9B A;  4PNI A;  2YIN A;  4IDZ A;  4C90 A;  5L3F B;  3PUS A;  4O4H E;  2I59 A;  2WWU A;  2QA7 A;  4IGU A;  3CVR A;  4P09 A;  1UX4 A;  5HXE A;  3NS4 A;  3KYL A;  5JRC A;  2K24 A;  3RH3 A;  2CXL A;  4EZ4 A;  3ZC1 A;  4GYR A;  2JPF A;  2V7K A;  3NBX X;  4O4L E;  3PDY A;  2XAS B;  2Y8D A;  2PBI A;  3Q9D A;  4GK0 E;  3QUJ A;  4IST A;  4ERR A;  2KND A;  3RYC E;  2W00 A;  4HGA A;  5CB4 E;  2DWG A;  3U78 A;  1ZEE A;  2IW5 B;  4WBN E;  1U5P A;  2OA5 A;  3E0Z A;  3WAK A;  4PJN A;  3RC3 A;  3UUL A;  2V7L A;  5AFU L;  1IJ5 A;  1KK7 A;  2YK0 A;  3EDV A;  3C98 B;  2R7X A;  2ACX A;  2JQQ A;  2VB6 A;  5ETW A;  3IF8 B;  2R7Q A;  4AI6 A;  4MHC A;  4HTE A;  4QHO A;  2IC6 A;  3PUA A;  2ZM0 A;  5HWX A;  3KVB A;  1NWM X;  2K48 A;  4ZOL E;  2NOX A;  3N2K E;  1Z0P A;  3HA4 A;  4IE0 A;  1MND A;  4ZS2 A;  3UT5 E;  2WMO A;  3ZJ1 A;  2NP9 A;  4OFZ A;  4AQG A;  3KIN B;  4AKL A;  5HXH A;  1WR6 A;  4UEM A;  5LGT B;  2KWI B;  4PJJ A;  4PFO A;  5BMV E;  5JDM A;  3GWH A;  2LSY A;  4QX7 B;  3ZYM A;  2DLR A;  2G0U A;  1MIW A;  1UX5 A;  1WYB A;  2IAK A;  2LOS A;  2QGS A;  2D5U A;  4ZI2 D;  3ESL A;  3NZQ A;  4H63 V;  3ETU A;  4PK5 A;  4KBM B;  4C2M A;  4PW8 A;  5L3C B;  5L3G B;  4EYU A;  4X1K E;  3EVY A;  3PU8 A;  4DBR A;  2E9X A;  2GK9 A;  4QXB B;  5JR9 C;  4P0A A;  3K8P C;  5HWY A;  4UEL A;  1IJ6 A;  5JDN A;  2BVM A;  3R6N A;  3MA9 A;  5LA6 E;  4BAY B;  5KMG P;  3AAI A;  4H63 H;  3OJA A;  2ZM2 A;  1LVF A;  2SPC A;  1IAP A;  1QUU A;  2R7O A;  2CCQ A;  3AA1 B;  5H6Q B;  3GN5 A;  4QX8 B;  2X0L B;  3K3O A;  4EOZ B;  3UFE A;  5JRE A;  2KWH A;  3HKE E;  3RYH E;  2H7V C;  1HFA A;  2LHR A;  4U74 A;  2CLY C;  3FXE B;  3ZPO A;  2R7T A;  2CMR A;  5F3J A;  4WBO A;  3CX6 B;  2A72 A;  2MBG A;  1CUN A;  3GMI A;  3Q5W A;  4PJM A;  2VL8 A;  4AKH A;  3SWH A;  3J9X 1;  4XZC A;  3E08 A;  2C5I T;  4JEU B;  2ODV A;  2LE8 A;  1D1B A;  1MNE A;  2V7J A;  2A3D A;  2DCF A;  3FBL A;  3UTK A;  4M1P A;  5DQW A;  4PK4 A;  2MTQ A;  3R84 B;  2X51 A;  2NW7 A;  4CZZ B;  2EHO A;  2Q9Q A;  2XUE A;  4O4J E;  3ZCI A;  4I43 B;  4HE8 A;  3N2O A;  4IE6 A;  4OK0 A;  4J2C A;  4OYK A;  4PK6 A;  4U72 A;  1FEW A;  2HPJ A;  1BR0 A;  2VK9 A;  1WLX A;  2X9H A;  3CPZ A;  3I0Q A;  4G63 A;  4TN7 B;  4ILU A;  3RYF E;  3RPU A;  2D0T A;  3WI3 A;  3ZMV B;  5FNV E;  3V5S A;  2JJ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...