2A2FX

Crystal structure of sec15 c-terminal domain
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
317
structure length
296
Chain Sequence
NILWELLHNMRDHYNEVLLQRWVHVFREILDKEQFLPMVVQNTEEYECIIERFPFHSEQLEPKKFPFSRMVPEVYHQAKEFMYACMKFAEELTLSPNEVAAMVRKAANLLLTRSFSGCLSVVFRQPSITLTQLIQIIIDTQYLEKAGPFLDEFVCHMTNTERAMFHVARQDAEKQVGLRICSKIDEFFELSAYDWLPGIASAFITDMISYLKSTFDSFAFKLPHIAQAACRRTFEHIAEKIYSIMYDSTGALTQINLDLMQCEFFAASEPVPGLKEGELSKYFLRNRQLLDLLILE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exocyst complex component Sec15
publication title Sec15 interacts with Rab11 via a novel domain and affects Rab11 localization in vivo.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Protein transport
total genus 109
structure length 296
sequence length 317
ec nomenclature
pdb deposition date 2005-06-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.30 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor; domain 2 2a2fX01
1.20.58.670 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2a2fX02
3FHNA 2A2FX
chains in the Genus database with same CATH superfamily
3EI0A 3EAMA 2PG8A 2LM9A 3N9PA 4PFOA 4CI2B 3VKHA 3N9LA 3CKDA 4WBNE 4MBQA 1I6ZA 2WZIA 4KP3C 1XWMA 5LBMA 2R6GF 1JT6A 2XM2A 2WUIA 3ONJA 4A97A 2A9UA 4DBQA 2L8KA 2V1DB 2CM0A 5HCJA 1W0BA 2WSSV 2FJBA 2Y31A 3ZLIA 3K3QC 1XMQT 3BQKA 1ZV4X 5HXSA 4NN1A 3DU5A 2Q9QD 4IIJE 3M3ZB 1HR0T 2E8IA 3HE0A 2PZ9A 3RI5A 3PUZF 2W63A 1N33T 2UXXB 2CBIA 1VCSA 2E9XD 4U33A 4LF8T 4ICHA 4DVDA 5FKOA 4DUYT 3ANWB 4DBRA 1WFDA 3PTRB 2XASB 3K3OA 2QCOA 2EHOC 3PM1A 2V5CA 3DU6A 5AQOB 3VR9A 3H3MA 4QH1A 3WHCA 4MXMA 3EGQA 3UT5E 5LJMA 3ZQHA 4HFVA 2BG9A 2MTQA 5FXVA 3VRAA 3GEUA 5IYZE 2V7KA 2DG8A 5HYAA 4WW0A 3L8RA 4AI6A 2VVNA 4GFLA 3FB2A 4LFAT 5L3FB 5J2UE 1OWAA 4M1PA 2K9AA 5AQMB 2LOSA 1BR4A 4IL4A 4H9OC 4I4TE 3IEEA 4KX6A 2QTQA 3OVUA 2KINB 5J1YA 4X1YE 3RPUA 3PURA 3BR2A 2LHNA 4KHPT 3R6NA 3IUVA 2GENA 3RQWA 4Q25A 5J1RA 4ZI2D 3AB3B 1MMNA 3QQAA 4BJMA 1WYBA 1H7CA 5BR8T 5LP6E 4CN6A 2MOZA 3G56A 1W9RA 2RASA 1T98A 4YJ3E 3ZC0A 3ZCIA 4TZ4C 4IL9A 4LFCT 3BCGA 4UXNB 1T72A 2HKUA 2DNXA 4XK4A 3UU5A 3W15B 3SS1A 3IF8B 1MNEA 2DLRA 2CCQA 3ZMVB 1AJ3A 4DW6A 2CLYC 4PK6A 1N32T 1MIYA 2V6XA 2DCFA 3O1JA 3AECA 3B6CA 2DHRA 2K3WA 3C4WA 1HFAA 3I0QA 2WAUA 1EZ3A 1KNRA 3MJXA 4NUVA 3MKDA 3GN5A 2Z6EA 1V9DA 1QVTA 5LYJE 2ZM8A 5FNVE 2HXOA 3FZKB 5AQPB 1KK7A 5J1GA 2QOPA 5EK4A 1ZEEA 3K3NA 4YSZA 4HWIB 2LSKA 3C64A 5LCYA 4QXCB 4NELA 3SFEA 5FY1A 1Y01A 1BJZA 2K5BB 3KV5A 4TN7B 5TAOA 3B13A 3VVYA 2R7XA 5HEUA 4AKLA 2W67A 4O2AE 3RIFA 1UK5A 4X65T 2CWOA 4O4JE 4ZS2A 2X51A 4BJNA 4HWDA 2X6OA 4CXWA 2WWUA 3IH3A 2FBWA 2FUPA 4IE6A 3EUHA 3NNRA 4ZI2C 4Z8XA 5ABHA 2BZBA 4MFRA 3IHRA 3BR6A 4DR2T 1JNRA 5HEGA 3GWHA 3O9XA 2RHAA 3BR0A 4ACIA 1Z0PA 1CUNA 4ASKA 1WCRA 2J1DG 2AE9A 1HG2A 1QSDA 2NR4A 2X9HA 2MYSA 5ETWA 2NS7A 5GONE 2X0HA 3ZQLA 2R7VA 4P0BA 4ZI3D 5LMUT 3BQYA 4CN4A 1HG5A 4I0UA 4GYSA 2ZOYA 3N9NA 4EOZB 1UX5A 2NWBA 5AQQB 4D5FA 3NRYA 3RYCE 2WM9A 4DV1T 3WI3A 1YQ4A 3G1MA 3RHWA 1KNPA 2YKSA 5M4YA 3RRCA 5L47A 2V8SV 5FVKA 2NW9A 4YTPA 4EYUA 2IIUA 5J2TE 4EZHA 4AQYT 3ZN1B 4QX7B 2IC6A 4H9RC 3VUQA 3T1HT 2HN1A 4YHJA 2IDOB 2JQKA 3QUJA 4LFBT 4ADZA 1S94A 5CA0E 4HWCA 4PW8A 2KNDA 5IUXA 1ZP0A 2UXPA 2XM1A 3DEWA 2XZEA 1B7TA 1WRDA 3OYZA 2XQYA 4HFIA 2LT3A 3CRJA 2X9WA 3FZMB 4QWNB 3JC6C 3E7QA 1SE7A 2KWHA 2JMKA 4DV0T 4CGRA 5AQUB 3ZN0B 2UXCT 4M3DA 3NBXX 3O8HA 5AQKB 1IAPA 2VPRA 1JT0A 3QPSA 2X68A 2BS3A 3OTOT 1XNRT 2BVMA 5HEJA 4O4HE 3FIWA 1MIVA 4K0UA 3OYXA 3PJAA 2KLQA 3O8GA 4A5XA 4YSYA 2DG7A 2XRLA 5AQCA 2CWYA 4ME9A 1WR0A 3RKOA 5GPCA 4P09A 4IE5A 5FKMA 2V5DA 4JI7T 3CX7B 4PJLA 2R7SA 2HHHT 2G7LA 2O7OA 4IDNA 3G06A 1HNXT 3EUPA 3AE4A 4IGUA 4J2CA 5DJQC 3NRXA 4JNNA 3O60A 1A6IA 1OEDA 2HXIA 3AA1B 5KXJA 2UUBT 2NTXA 5K58A 4DV4T 5LJNA 5FXWA 3VOKA 3ON4A 2XAHB 2EHOB 3N9QA 3LSJA 4IE0A 1NEKA 3C4XA 5JDHA 2V26A 3Q5WA 3RIAA 3UQ7A 4I55E 3KVAA 1FJGT 3BQIA 3UUBA 5EYRA 1XNQT 5F3JA 4LMLA 2CE7A 3JCFA 2BDEA 4H63V 5AQSB 2PTFA 2YEVC 3HI2A 4GCTA 4KWAA 1OEDC 1HTJF 2CBJA 2WU5A 2HYJA 2OLTA 2JQHA 3LDQB 1U9OA 3I1AA 5JR9A 4AKIA 4DVYP 2UXOA 3IH4A 3AE8A 2I59A 3ETUA 3ZQFA 4YSXA 5D1RA 3MA9A 3UUNA 3AQTA 3J9X1 1CHUA 2PBXA 3TLSA 3GZIA 4U7YA 1YW0A 3KYLA 1XDOA 4ZZBA 3CQCB 3KV6A 3C2BA 4YFSA 2MBGA 1M62A 3AXJA 2C5IT 1J5ET 3MZKB 3TKLB 4EXTA 4AC0A 1L0VA 4JYKA 4GK0E 1YKEB 3FBZA 3J7Yq 3UU3A 3RD3A 1D0YA 2DWGA 4A98A 3ZSSA 3RIUC 2H89A 4OD4A 1UI6A 2DL1A 2JPFA 2QYWA 5F27A 2OA5A 4UR9A 5FHPA 2B1EA 5HEOA 2XPKA 1ZKEA 4CXYA 5A1LA 3T1YT 4O4IE 4PK5A 5CW8A 2NTYA 2HYTA 2XPWA 2IW5B 3ANGA 2Q9QB 2X9XA 4HFBA 3COLA 5EZHA 3A7MA 4LMJA 3V6GA 2QGSA 5LA6E 3NKZA 3U3IA 3PUWF 4BA9A 5FMPA 4EAHA 2E9XB 2C0SA 1YKHB 1M7KA 3K1SA 4H9QC 2Q24A 2XTLA 3VVZA 2J62A 2C5KT 5LNKA 4UDSA 2J4GA 2W2UA 4NXNT 2WY2A 3C4ZA 2GUHA 2UXBT 3E08A 2W53A 1UX4A 4JI1T 4ZS3A 2FJAA 3ANPA 2NW8A 3LK2B 5BMVE 3N2GE 1KEYA 1VOMA 3VIBA 4AKRB 3LOCA 3KV4A 2XAJB 2N2NA 2W00A 5EZYE 5HSZA 4E7SA 4ERRA 2ES0A 3BQZA 5EZGA 1QLBA 5HWYA 1G8XA 3VHLA 3VTIA 4KI0F 3I0OA 5JH7E 4DR4T 3B5MA 3LHQA 4UVBB 3RYHE 1HCIA 3LWJA 4YY3T 5IPAA 3NXCA 2XAQB 4ISTA 3WHBA 4UV8B 2CXFA 2E5LT 4HWHA 3UFGA 5AQLB 5F0FA 3AA7B 5H9TA 1YXRA 2IHR1 3HTAA 2XDNA 2Y48B 1SHZC 3ZQGA 2M67A 3HA4A 2NP5A 3VRBA 2YDRA 5ABFB 2WU2A 3KV9A 5AQIB 5LOVE 1BR1A 3HTHA 3BJBA 3LSPA 2LSIA 4U2ZA 2OF7A 1MNDA 4TX5A 1G73A 3CQGB 2RAEA 3ZEFB 4CI3B 1HX1B 2KT9A 2CRBA 3TLUA 5FMNA 4U9LA 3OBVE 3LBXA 2V7JA 1N34T 2WDQA 3Q0VA 4C91A 3ZT7A 1XDPA 4HEAA 2D2SA 3UU8A 1HS7A 2ACZA 5F0CA 5JTGA 2FJDA 2E2AA 4NXMT 3QBMA 2NP9A 3MK7C 2BG9C 4OD5A 2MPKA 2PJQA 2V6YB 4DR6T 2ACXA 2L3LA 3BR3A 3VP5A 2R7WA 4O8SA 4ZZCA 3RRWA 4DIDB 2W61A 3HIMA 1JUMA 3HTJA 4UVAB 3Q0UA 4V1Av 3CX8B 3ZYKA 3AAAB 5D18A 3NPIA 2FBQA 2I10A 2XGCA 4JEHB 5DQWA 4DV3T 5AQNB 4ANJA 4M3FA 3KKCA 2OPTA 2CXDA 5F5WA 2R7UA 2HH7A 2R7QA 2VKVA 4HKUA 1W09A 2ZCNA 4OK0A 1XZYA 3P4WA 2WMOA 4O4LE 4JUYA 3FZLB 3P50A 3PUAA 3FHNA 5K7ZA 3FBLA 3F31A 4QX8B 3ZSTA 3NS4A 3S5RA 1VRBA 3A5XA 3HGYA 2KSRA 4L62A 4UVCB 4X66T 2CXLA 4DUZT 4JI8T 4B6XA 1Z77A 2KMFA 5HXCA 3FZFB 5LGTB 3AAIA 4DMWA 5JRCB 5K7HA 2D9DA 2X66A 2XQ8A 4QH5A 4PJJA 3B57A 2LKHA 2M6BA 5HXRA 4JEUB 2D6YA 3F0CA 4B3TT 2XPVA 2VL8A 4DR7T 3CJDA 1JNZA 2WWVA 1E2AA 2R7OA 2UUCT 4NIQA 4B1RA 3V5UA 1HF8A 4WNKA 5FXZA 1SUMB 2G7SA 4W97A 5J3LA 2H3RA 3DPJA 2XY8B 3GMIA 4B3MT 1LRZA 3JC6D 3CX6B 2XHEB 3CQXC 3Q2MA 4ZI7E 4QKNA 5HXEA 5CJ5A 3IH2A 5GPAA 3VU7H 3A8YC 3Q5XA 4PK4A 5DABA 4QXHB 1J5WA 4IDZA 4H9PC 2KZ7B 4B3AA 2OV9A 3ZYLA 2YINA 2VKDA 2SPCA 3EHZA 4EEDA 2XSAA 4GCLA 3AE7A 3DP7A 4LF9T 1UURA 2F4VT 4CZZB 4GFKA 3V78A 3ZCJA 2BKOA 3JADA 4DR1T 3VOXA 2XGEA 3ANWA 3LSVA 3C07A 5F08A 2WB5A 2LJLA 3B6AA 2BG9E 2KXPB 4CXXA 4P0AA 4UIGA 4JI5T 3AEDA 2VVSA 3H3AA 5AFUL 1JTYA 3TP0A 5L3GB 3LSRA 3QNUA 3UQ4A 3RQUA 3O1IA 4HFCA 3U78A 1JUPA 3SFIA 1R8IA 2XQ5A 4UF0B 3FZHB 2HQ5A 3PASA 4B3RT 2H7OA 5LMNT 4WIBA 2OI8A 1X79A 3RC8A 4Z91A 4DR5T 3MNLA 4NPPA 3PUXF 5F1JA 2IU5A 3HKDE 3ETVA 3ZJ2A 1HX8A 4UELA 4JV5T 5AQVB 5LHHB 4LF6T 3I9YA 1UGOA 2N1GA 3AEBA 4UV9B 2Y30A 2REKA 3LFMA 5F04A 2X0YA 3N9OA 5FKYA 2IAIA 4GCKA 3BTIA 4HTEA 3KKDA 1O3XA 3Q0WA 1W0AA 1UI5A 5AQJB 1Z0XA 3PJAJ 3LK3B 4YJ2E 3NI7A 2W4XA 3TLVA 2R7RA 5GP9A 5L2LA 2L9QA 2DTZA 3CK6A 1I94T 1LVKA 5L3CB 2UU9T 1IJ6A 2QA7A 3NVOA 3FK7A 2VK9A 3RLFF 4OYKA 4GKJT 5DQVA 4JI3T 2CMRA 3N2OA 2I0MA 3OPCA 1ZK8A 3C51A 2ZCXA 4V2GA 4YZEA 4AKGA 1QPIA 4EYYR 5AQFB 3AEGA 5C4YA 4G63A 2WS3A 4EB6E 3P4RA 3G1LA 3QB5A 3G1OA 2RP4A 3P4QA 1OXZA 3ZC1A 4L9IA 4PJNA 3LG7A 3KDSE 4X64T 3D0TA 4PJMA 4JI4T 3QOFA 4LF5T 2ZM0A 3PU8A 4L5GA 4E7ZA 4EEBA 2FX0A 2BVLA 4ILCA 2QIBA 2RPAA 3KVBA 2G0UA 3E0ZA 1NWMX 5JQGE 1KF6A 5F8PA 3O1HA 2IEKA 4D5CA 2QWTA 4KHZF 3QB5K 4AQFA 2X67A 2WMNA 1E1HB 5FY7A 4M3EA 3OKQA 1RPWA 3NZQA 4QXBB 5HXHA 2VKEA 3PPBA 2QRXA 5KX5E 4TV8E 4D7MA 5IHYA 4EV6A 1IBLT 2BG9B 3E22E 4AQFC 1SGMA 1D1CA 2YVHA 3SFDA 2ODVA 1UUSA 2GBYA 2D0TA 3HKEE 4JL3A 2ZLYA 5JDMA 3KINB 5L4EA 5JR9C 3F2EA 2GFNA 1FMVA 1QVUA 2UXNB 1IBKT 2YDSA 2LHRA 4K0KT 3CWRA 5C2TA 2RA1A 3IBPA 3NRGA 3KZ9A 3JAEA 4XZCA 3H37A 3UTKA 3ONLC 3ZMTB 1X9BA 4AC6A 3ZPOA 4YTNA 2QKOA 1JTXA 1BR2A 3AE1A 1ZKGA 2CLYB 4IHJE 3AE6A 3ZMZB 2WZHA 2JJ7A 3BRUA 4PXIA 4DV5T 5K7FA 4JBWF 4DR3T 2HPLA 2V57A 4L0RA 5HAXA 2KWIB 4IREA 2VQET 3CPZA 5LB7B 2JQ9A 3QPLA 5CXGA 1MMDA 5LHGB 4H9NC 2WV1A 2LEHA 3ON2A 2B76A 3DJBA 5C8YE 1U5PA 5FKNA 3F1BA 4Z90A 3IA3A 2NS8A 2G7GA 2JQQA 3PUGA 4OYJA 2YVXA 3ZQIA 2VKJA 3RYIE 1YD8G 1IZNB 3ZMSB 3VW2A 4GK5E 3GN5B 4HWFA 2A3DA 1SA0E 3I9WA 4AKHA 3P4PA 4FJOA 3ABVA 4GKKT 1DU2A 2MAWA 2IAKA 4X62T 4ZHQE 5FL1A 2WDVA 2X9YA 3UUMA 3ZKRA 4EIWA 2ODUA 4ILAA 5CGMA 3B81A 3KFWX 5J1UA 4X1EA 1T33A 2ZOZA 3Q3SA 4U9NA 1D0XA 4EGWA 1E7PA 3N2KE 4YT0A 1Z8UA 3MXZA 1NAFA 4YTMA 5LBQB 1ZHCA 5LGUB 4WBOA 2DI4A 3ZT6A 4AIUA 4DV2T 1MIWA 4XBFB 1OEDE 1MMGA 2P9BA 2ZY9A 5KMGP 2CHOA 3SDGA 4AXPA 2J47A 2DWKA 2EHOA 3BTCA 2TRTA 1NENA 2XQ9A 3L39A 2XB5A 2LSYA 3L09A 3RF1A 2W0GA 2OERA 3AE2A 2XQAA 4ISSA 4OFZA 5J0ZA 5AQTB 5AQGB 2UXIA 3TLTA 3PUSA 5JDLA 4TV9E 4P1NA 5C3JA 4WZXA 3AA0B 3EDUA 5CB4E 4HE8A 5FXXA 2UXHA 4AF5A 1JUSA 2LSJA 2WBLA 5AQRB 1T7SA 2FQ4A 3UU6A 4H9SE 2BKPA 4ILUA 1S35A 3BK9A 3X1DA 5FY0A 5ABEA 2Y8DA 3AQSA 2IMLA 3UU4A 3WAKA 5EFYA 5IWAT 1YQ3A 3VKGA 4X5TA 4PNIA 3FXEB 4TWFA 4FI5A 2WP9A 3VR8A 2HPJA 5LGNB 2CEAA 2FJI1 2TCTA 2LE8A 5L4HA 3L3PA 2AXDS 2UUAT 5JREA 3K8PC 2Q9QA 3Q5DA 2H88A 4ZXLA 3BHQA 4F8HA 2A2FX 1RKWA 2ZM2A 3M65A 3R84B 1GQEA 2V7MA 2CA5A 2UXUA 2E9XA 2XGDA 4U7IA 3V5SA 5IOZA 3PUYF 2NOXA 5D19A 2YN6A 2JIWA 2Q9QC 4IRVA 4GOUA 4X1IE 4AUXA 2LRKA 1UCUA 2K48A 3T6NA 2WCAA 5HAWA 3CCYA 3TLWA 3QKXA 2YOEA 4DMVA 5HCMA 2E9XC 3HR0A 3BTJA 3AE9A 1VCTA 4U72A 5CA1E 4MHCA 2LLYA 4JI0T 4WYVA 3FK6A 4GIWA 2D5UA 3TP3A 2K24A 2VKOA 3BR5A 4JI2T 2BS2A 1LKXA 4NUUA 1HNZT 4DO0A 5ABGA 5HBUA 5E0OA 2FD5A 1WYCA 4I43B 2VB6A 5FKKA 1LVFA 4G12A 3BT9A 4ZOLE 3ONXA 4F6RC 3PUQA 3KBTA 1OEDB 3RH3A 2Y6XA 5F0HA 3PV0F 3JAFA 3VVXA 2CPTA 3PDYA 5H6QB 4PFPA 4DV6T 2HN2A 3AEFA 2BBHA 3LJLA 3AE5A 4AISA 2V7LA 4LF4T 1FEWA 5FP3A 3Q5EA 4YXDA 1RKTA 1D1AA 5ABFA 3HTIA 2WQYA 4I76A 4KBMB 5H6RB 2G3BA 5LG4A 5JR9B 1WLXA 4JYAT 4ILBA 4TNWA 4YLHA 2XSBA 3AE3A 2ZCMA 3HKCE 2ZB9A 2NW7A 3AVRA 2VL0A 4MALA 3HKBE 3ZT5A 3AXJB 3KBUA 3CDLA 3SRZA 3AA6B 4HFDA 2R7TA 4OHFA 5L3BB 4DV7T 5JDFA 4HKAA 5LHIB 1KNZA 2IUBA 3OJAA 2ZM6T 2XUEA 2CHNA 3ZMUB 4ABZA 5L3EB 2NX4A 2V6YA 1FIOA 2XAFB 3BR1A 2B3WA 1VI0A 4COFA 2VURA 1Y64B 4TUYE 4QH4A 2X0LB 4IE7A 4BAYB 2E5VA 4X1KE 4LF7T 4I50E 2JRKA 3ZJ1A 3BQLA 2XQ6A 3RYFE 3CMLA 2G0EA 2D0UA 2YU2A 4EZ4A 5LXTE 1WR6A 2XJ7A 4HFEA 4X20E 3NZPA 5JDGA 3PE0A 2VQFT 3N5LA 3KNWA 2LKGA 3AEAA 3F57A 4C90A 1U4QA 5CQGA 2NP3A 4QHOA 2V7IA 3P4SA 4JI6T 3CWZB 3PUVF 2FJEA 4HGAA 1J1JA 3VW1A 3FXDB 4GYRA 4JKZA 3ESLA 5FL0A 1IJ5A 1T8BA 2ID6A 3BTLA 3S4UA 2O7TA 3P9TA 3MVPA 1D1BA 3C50A 5JRCA 5KDMC 2BBJA 2YDQA 2JK3A 5FYMA 3CVRA 4CI1B 2W62A 2N9DA 4W1UA 3SOLA 4CQIA 4B3ST 2Y2ZA 4XAXB 2YK0A 2PFVA 4TWDA 4AQGA 2XQ3A 4HN9A 4IDQA 4ZI3C 3EDVA 4IDOA 2IC9A 3Q9DA 2XAGB 3PU3A 3JSJA 1KFYA 4C2MA 1XMOT 1BR0A 3P7IA 5CXIA 4U2YA 4JLEA 3UULA 4TNVA 3RKGA 4LMKA 4ZEYA 2XQ7A 4HFHA 2BKNA 4U31A 2GK9A 2M6IA 5EK2A 4UEMA 3C98B 4N78D 4KMCA 4M3GA 1FMWA 2I6HA 2LOPA 2UXDT 2QVAA 2VASA 4DNDA 2W66A 2A72A 2JMHA 3FRQA 3LBXB 3LK42 2C5JA 5HWXA 3RC3A 2EH3A 2ZMAA 3UUXB 3AEEA 2BS4A 3O4XE 4IE4A 5IOYA 3RIUA 3HL6A 4U3CA 5FGLA 3EVYA 2WGBA 5ADXL 5L3DB 2YVEA 2JJ9A 3NWIA 2YU1A 3SWHA 1D0ZA 3WAJA 4D7NA 1T56A 1N36T 1IBMT 5FKLA 4UF0A 1HNWT 3AAEB 3VW0A 4O2BE 3RH2A 3RX6A 5LG3A 4KUMB 5AQHB 3ZYMA 4A56A 5JDNA 4IDPA 2PBIA 1U9NA 5IP6A 2F07A 2VKHA 1ZOYA 2LSGA 2H7VC 3LJCA 5HEHA 2EHOD 2X9DA 1US7B 4OX9T 3BNIA 4M3BA 1QUUA 3DTOA 3QK6A 4MO7A 3N9MA 4IT4A 4TWHA 4I6ZA 4PAGA 5CFBA 2IBDA 3EABA 3AVSA 4H63H 5JVDE 2XPUA 3RGLA 3VPRA 3QC9A 3G7RA 5DAJA 2WDRA 3HGGA 1ORKA 2VWAA 2LRLA 4MK6A 3MACA 2LM2A 3UFEA 3GA8A 1MMAA 5JDQA 2ID3A 3CIRA 2XQ4A 3P8CD 4MLKA 2FJ1A 5FVLA 4U74A 4CN1A 4V2FA 4YHHT 3T8OA 3DCFA 4G2AA 5EK3A
chains in the Genus database with same CATH topology
3H3AA 3K8PC 2Q9QA 4IE0A 5AFUL 3C4XA 2PG8A 2LM9A 5L3GB 3N9PA 4PFOA 5JDHA 2V26A 3Q5WA 4I55E 3KVAA 3BQIA 4CI2B 5F3JA 3N9LA 3VKHA 3CKDA 3O1IA 2A2FX 2CE7A 3U78A 4WBNE 2ZM2A 2BDEA 4MBQA 4H63V 2YEVC 3M65A 3HI2A 4UF0B 3R84B 4KP3C 2V7MA 5LBMA 2CA5A 2E9XA 1HTJF 3V5SA 2H7OA 2L8KA 2V1DB 4DBQA 2CM0A 2NOXA 1X79A 3RC8A 2Q9QC 4IRVA 3I1AA 5JR9A 4AKIA 4DVYP 2WSSV 2I59A 4GOUA 4X1IE 3ZLIA 3ETUA 3HKDE 3ETVA 1UCUA 2K48A 3ZJ2A 3K3QC 1HX8A 3BQKA 4UELA 1ZV4X 3MA9A 3UUNA 5HXSA 3DU5A 2Q9QD 5LHHB 3I9YA 3J9X1 4DMVA 2E9XC 2N1GA 3HR0A 1YW0A 4IIJE 4UV9B 4U72A 3KYLA 5CA1E 3CQCB 3KV6A 4YFSA 2MBGA 2E8IA 4MHCA 2C5IT 4GIWA 2D5UA 3LFMA 3N9OA 3MZKB 2W63A 3TKLB 2UXXB 2E9XD 4EXTA 4GK0E 1YKEB 4HTEA 3FBZA 2K24A 3J7Yq 1O3XA 2VKOA 4DVDA 1LKXA 4NUUA 1D0YA 2DWGA 4DO0A 3ANWB 4DBRA 3LK3B 4YJ2E 3PTRB 2XASB 3K3OA 2EHOC 5E0OA 4OD4A 1WYCA 4I43B 3DU6A 2JPFA 2VB6A 1LVFA 2R7RA 2OA5A 5L2LA 4ZOLE 2B1EA 3ONXA 4F6RC 2L9QA 3PUQA 3UT5E 1LVKA 5LJMA 5L3CB 3KBTA 1IJ6A 1ZKEA 4CXYA 5A1LA 2QA7A 3RH3A 2Y6XA 4HFVA 4O4IE 4PK5A 2MTQA 5FXVA 2NTYA 5IYZE 2IW5B 2VK9A 4OYKA 2V7KA 3PDYA 5H6QB 4PFPA 2Q9QB 5DQVA 2X9XA 2CMRA 3N2OA 4WW0A 5HYAA 4AI6A 2V7LA 3C51A 1FEWA 2QGSA 5FP3A 5LA6E 3FB2A 4AKGA 3U3IA 5L3FB 4EYYR 4BA9A 5J2UE 4G63A 1OWAA 4M1PA 4EB6E 2K9AA 2LOSA 4EAHA 1BR4A 2E9XB 1D1AA 2C0SA 2RP4A 1YKHB 4H9OC 4I4TE 3IEEA 1OXZA 3ZC1A 4KBMB 4L9IA 2KINB 4H9QC 4PJNA 4X1YE 5H6RB 3LG7A 3KDSE 3RPUA 3PURA 5LG4A 5JR9B 3D0TA 2LHNA 2XTLA 4PJMA 1WLXA 3R6NA 2ZM0A 3PU8A 4L5GA 4YLHA 4E7ZA 2C5KT 5LNKA 2BVLA 4ZI2D 3AB3B 1MMNA 3KVBA 2G0UA 3E0ZA 4BJMA 1WYBA 1H7CA 1NWMX 3C4ZA 3HKCE 2NW7A 5JQGE 5LP6E 3E08A 2MOZA 3AVRA 4MALA 1UX4A 5F8PA 3HKBE 3O1HA 1T98A 4YJ3E 4ZS3A 3ZC0A 3KBUA 2NW8A 3LK2B 3SRZA 5BMVE 3ZCIA 3AA6B 3N2GE 2R7TA 4OHFA 4TZ4C 5L3BB 1VOMA 5JDFA 4HKAA 5LHIB 4AKRB 1KNZA 4UXNB 4AQFA 2X67A 2WMNA 3OJAA 2XUEA 3KV4A 3ZMUB 1E1HB 2XAJB 2N2NA 2DNXA 5FY7A 5L3EB 2W00A 5EZYE 3OKQA 1FIOA 2XAFB 3NZQA 4QXBB 4ERRA 4E7SA 5HXHA 2ES0A 3W15B 2B3WA 3SS1A 3IF8B 1MNEA 2DLRA 5HWYA 2CCQA 1G8XA 3VHLA 3VTIA 3ZMVB 1AJ3A 3I0OA 5JH7E 5KX5E 2CLYC 1Y64B 4PK6A 1MIYA 4TV8E 4TUYE 2DCFA 5IHYA 2X0LB 4UVBB 4IE7A 3O1JA 3RYHE 3E22E 1HCIA 2DHRA 4AQFC 4BAYB 1D1CA 2XAQB 4ISTA 4UV8B 2ODVA 3C4WA 2CXFA 1HFAA 2D0TA 3HKEE 4X1KE 3I0QA 2WAUA 1EZ3A 3MJXA 4I50E 2JRKA 4NUVA 2ZLYA 3MKDA 5JDMA 3ZJ1A 3GN5A 2Z6EA 3BQLA 3KINB 1V9DA 3AA7B 3RYFE 5JR9C 3CMLA 3F2EA 2D0UA 1FMVA 2Y48B 2ZM8A 5LYJE 1SHZC 2M67A 5FNVE 2YU2A 4EZ4A 5LXTE 3HA4A 1WR6A 1KK7A 2UXNB 5J1GA 3KV9A 4X20E 2LHRA 3NZPA 5EK4A 5LOVE 1BR1A 5JDGA 1ZEEA 3K3NA 2RA1A 3IBPA 3PE0A 2LSIA 1MNDA 4TX5A 1G73A 3N5LA 3CQGB 4XZCA 3H37A 3UTKA 2LSKA 3F57A 4C90A 3ZEFB 1U4QA 3C64A 5CQGA 4CI3B 5LCYA 4QXCB 3ZMTB 4QHOA 5FY1A 2KT9A 2V7IA 5FMNA 3OBVE 3ZPOA 3LBXA 2V7JA 3CWZB 4HGAA 2K5BB 1BR2A 3FXDB 4GYRA 4C91A 3KV5A 3ESLA 4TN7B 2CLYB 4IHJE 5TAOA 3B13A 2R7XA 4HEAA 2D2SA 3ZMZB 1IJ5A 4AKLA 1HS7A 3S4UA 4O2AE 2CWOA 4O4JE 4ZS2A 2NP9A 2X51A 3MK7C 4BJNA 1D1BA 3C50A 4OD5A 4CXWA 5JRCA 2HPLA 2WWUA 4L0RA 2PJQA 4IE6A 5KDMC 5HAXA 3EUHA 2KWIB 2ACXA 2L3LA 3CPZA 4ZI2C 2R7WA 4O8SA 4Z8XA 3RRWA 5FYMA 1MMDA 3CVRA 2BZBA 5LHGB 4CI1B 2W62A 4MFRA 3IHRA 4H9NC 2W61A 2N9DA 2LEHA 3GWHA 3DJBA 4UVAB 1U5PA 5C8YE 3O9XA 4V1Av 3CX8B 3SOLA 4CQIA 3ZYKA 4XAXB 2YK0A 2PFVA 3AAAB 1Z0PA 1CUNA 4AQGA 4ASKA 2JQQA 4HN9A 2J1DG 3PUGA 4JEHB 4OYJA 4ZI3C 5DQWA 2VKJA 3RYIE 3EDVA 1YD8G 1IZNB 1HG2A 1QSDA 3ZMSB 4ANJA 2IC9A 3Q9DA 4GK5E 2XAGB 2X9HA 2MYSA 3GN5B 3PU3A 1BR0A 4C2MA 5ETWA 2A3DA 2CXDA 1SA0E 3P7IA 2R7UA 3I9WA 4AKHA 5GONE 2R7VA 4P0BA 4ZI3D 4FJOA 4JLEA 2HH7A 3UULA 2R7QA 4OK0A 1HG5A 2IAKA 2WMOA 2GK9A 4O4LE 4ZHQE 2X9YA 4GYSA 3N9NA 3UUMA 4EOZB 5EK2A 4UEMA 1UX5A 2NWBA 4JUYA 3C98B 4N78D 4KMCA 4EIWA 2ODUA 1FMWA 3NRYA 3RYCE 3KFWX 3PUAA 2WM9A 2LOPA 3FHNA 1D0XA 3FBLA 3F31A 3WI3A 4QX8B 2VASA 3N2KE 3NS4A 4DNDA 5M4YA 3RRCA 1VRBA 3A5XA 2A72A 3MXZA 2NW9A 4EYUA 2JMHA 1NAFA 5J2TE 3LBXB 4UVCB 5LBQB 1ZHCA 5LGUB 4WBOA 2DI4A 3LK42 4EZHA 2C5JA 3ZN1B 4QX7B 2CXLA 2IC6A 4H9RC 5HWXA 1MIWA 4XBFB 1MMGA 4YHJA 4B6XA 3RC3A 3QUJA 4ADZA 1S94A 2KMFA 5HXCA 2P9BA 2ZMAA 5CA0E 4PW8A 2KNDA 5LGTB 5KMGP 3UUXB 3AAIA 3O4XE 4DMWA 4IE4A 4AXPA 5JRCB 2DWKA 2EHOA 3HL6A 3EVYA 1B7TA 1WRDA 2X66A 5ADXL 5L3DB 3OYZA 2XQYA 2JJ9A 2LT3A 2LSYA 2YU1A 3L09A 2X9WA 3SWHA 4PJJA 1D0ZA 3WAJA 3B57A 2W0GA 5HXRA 4JEUB 4QWNB 3JC6C 4ISSA 2KWHA 4UF0A 2VL8A 3AAEB 4OFZA 4O2BE 2JMKA 2R7OA 3ZN0B 3V5UA 1HF8A 4WNKA 3RX6A 5FXZA 3NBXX 4KUMB 3PUSA 2H3RA 3ZYMA 5JDLA 3GMIA 4A56A 1IAPA 1LRZA 5JDNA 3JC6D 3CX6B 2X68A 4TV9E 2PBIA 2XHEB 3CQXC 2VKHA 2BVMA 3AA0B 3EDUA 3Q2MA 2LSGA 4ZI7E 4O4HE 2H7VC 4QKNA 3LJCA 5CB4E 5HXEA 1MIVA 4K0UA 3OYXA 2EHOD 2KLQA 1US7B 4HE8A 5FXXA 1QUUA 3DTOA 3QK6A 3N9MA 3VU7H 3Q5XA 2CWYA 4PK4A 5DABA 4QXHB 4PAGA 4IDZA 2LSJA 4H9PC 3AVSA 4H63H 5JVDE 2KZ7B 3RKOA 3ZYLA 2YINA 2WBLA 2VKDA 2SPCA 4P09A 3QC9A 3DP7A 4IE5A 4H9SE 4CZZB 4ILUA 1S35A 2VWAA 3BK9A 3CX7B 5FY0A 3ZCJA 2Y8DA 3MACA 4PJLA 3UFEA 3GA8A 3WAKA 2R7SA 1MMAA 5JDQA 3ANWA 3VKGA 4PNIA 3FXEB 4IGUA 4J2CA 4FI5A 2HPJA 5LGNB 3P8CD 2CEAA 4MLKA 5DJQC 3NRXA 4U74A 2FJI1 2LE8A 2LJLA 3AA1B 2NTXA 3T8OA 5LJNA 2KXPB 4CXXA 3L3PA 4P0AA 5FXWA 4UIGA 5JREA 4G2AA 5EK3A 2XAHB 2EHOB 3N9QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FHN A;  2A2F X; 
#chains in the Genus database with same CATH topology
 3EI0 A;  3EAM A;  2PG8 A;  2LM9 A;  3N9P A;  4PFO A;  4CI2 B;  3VKH A;  3N9L A;  3CKD A;  4WBN E;  4MBQ A;  1I6Z A;  2WZI A;  4KP3 C;  1XWM A;  5LBM A;  2R6G F;  1JT6 A;  2XM2 A;  2WUI A;  3ONJ A;  4A97 A;  2A9U A;  4DBQ A;  2L8K A;  2V1D B;  2CM0 A;  5HCJ A;  1W0B A;  2WSS V;  2FJB A;  2Y31 A;  3ZLI A;  3K3Q C;  1XMQ T;  3BQK A;  1ZV4 X;  5HXS A;  4NN1 A;  3DU5 A;  2Q9Q D;  4IIJ E;  3M3Z B;  1HR0 T;  2E8I A;  3HE0 A;  2PZ9 A;  3RI5 A;  3PUZ F;  2W63 A;  1N33 T;  2UXX B;  2CBI A;  1VCS A;  2E9X D;  4U33 A;  4LF8 T;  4ICH A;  4DVD A;  5FKO A;  4DUY T;  3ANW B;  4DBR A;  1WFD A;  3PTR B;  2XAS B;  3K3O A;  2QCO A;  2EHO C;  3PM1 A;  2V5C A;  3DU6 A;  5AQO B;  3VR9 A;  3H3M A;  4QH1 A;  3WHC A;  4MXM A;  3EGQ A;  3UT5 E;  5LJM A;  3ZQH A;  4HFV A;  2BG9 A;  2MTQ A;  5FXV A;  3VRA A;  3GEU A;  5IYZ E;  2V7K A;  2DG8 A;  5HYA A;  4WW0 A;  3L8R A;  4AI6 A;  2VVN A;  4GFL A;  3FB2 A;  4LFA T;  5L3F B;  5J2U E;  1OWA A;  4M1P A;  2K9A A;  5AQM B;  2LOS A;  1BR4 A;  4IL4 A;  4H9O C;  4I4T E;  3IEE A;  4KX6 A;  2QTQ A;  3OVU A;  2KIN B;  5J1Y A;  4X1Y E;  3RPU A;  3PUR A;  3BR2 A;  2LHN A;  4KHP T;  3R6N A;  3IUV A;  2GEN A;  3RQW A;  4Q25 A;  5J1R A;  4ZI2 D;  3AB3 B;  1MMN A;  3QQA A;  4BJM A;  1WYB A;  1H7C A;  5BR8 T;  5LP6 E;  4CN6 A;  2MOZ A;  3G56 A;  1W9R A;  2RAS A;  1T98 A;  4YJ3 E;  3ZC0 A;  3ZCI A;  4TZ4 C;  4IL9 A;  4LFC T;  3BCG A;  4UXN B;  1T72 A;  2HKU A;  2DNX A;  4XK4 A;  3UU5 A;  3W15 B;  3SS1 A;  3IF8 B;  1MNE A;  2DLR A;  2CCQ A;  3ZMV B;  1AJ3 A;  4DW6 A;  2CLY C;  4PK6 A;  1N32 T;  1MIY A;  2V6X A;  2DCF A;  3O1J A;  3AEC A;  3B6C A;  2DHR A;  2K3W A;  3C4W A;  1HFA A;  3I0Q A;  2WAU A;  1EZ3 A;  1KNR A;  3MJX A;  4NUV A;  3MKD A;  3GN5 A;  2Z6E A;  1V9D A;  1QVT A;  5LYJ E;  2ZM8 A;  5FNV E;  2HXO A;  3FZK B;  5AQP B;  1KK7 A;  5J1G A;  2QOP A;  5EK4 A;  1ZEE A;  3K3N A;  4YSZ A;  4HWI B;  2LSK A;  3C64 A;  5LCY A;  4QXC B;  4NEL A;  3SFE A;  5FY1 A;  1Y01 A;  1BJZ A;  2K5B B;  3KV5 A;  4TN7 B;  5TAO A;  3B13 A;  3VVY A;  2R7X A;  5HEU A;  4AKL A;  2W67 A;  4O2A E;  3RIF A;  1UK5 A;  4X65 T;  2CWO A;  4O4J E;  4ZS2 A;  2X51 A;  4BJN A;  4HWD A;  2X6O A;  4CXW A;  2WWU A;  3IH3 A;  2FBW A;  2FUP A;  4IE6 A;  3EUH A;  3NNR A;  4ZI2 C;  4Z8X A;  5ABH A;  2BZB A;  4MFR A;  3IHR A;  3BR6 A;  4DR2 T;  1JNR A;  5HEG A;  3GWH A;  3O9X A;  2RHA A;  3BR0 A;  4ACI A;  1Z0P A;  1CUN A;  4ASK A;  1WCR A;  2J1D G;  2AE9 A;  1HG2 A;  1QSD A;  2NR4 A;  2X9H A;  2MYS A;  5ETW A;  2NS7 A;  5GON E;  2X0H A;  3ZQL A;  2R7V A;  4P0B A;  4ZI3 D;  5LMU T;  3BQY A;  4CN4 A;  1HG5 A;  4I0U A;  4GYS A;  2ZOY A;  3N9N A;  4EOZ B;  1UX5 A;  2NWB A;  5AQQ B;  4D5F A;  3NRY A;  3RYC E;  2WM9 A;  4DV1 T;  3WI3 A;  1YQ4 A;  3G1M A;  3RHW A;  1KNP A;  2YKS A;  5M4Y A;  3RRC A;  5L47 A;  2V8S V;  5FVK A;  2NW9 A;  4YTP A;  4EYU A;  2IIU A;  5J2T E;  4EZH A;  4AQY T;  3ZN1 B;  4QX7 B;  2IC6 A;  4H9R C;  3VUQ A;  3T1H T;  2HN1 A;  4YHJ A;  2IDO B;  2JQK A;  3QUJ A;  4LFB T;  4ADZ A;  1S94 A;  5CA0 E;  4HWC A;  4PW8 A;  2KND A;  5IUX A;  1ZP0 A;  2UXP A;  2XM1 A;  3DEW A;  2XZE A;  1B7T A;  1WRD A;  3OYZ A;  2XQY A;  4HFI A;  2LT3 A;  3CRJ A;  2X9W A;  3FZM B;  4QWN B;  3JC6 C;  3E7Q A;  1SE7 A;  2KWH A;  2JMK A;  4DV0 T;  4CGR A;  5AQU B;  3ZN0 B;  2UXC T;  4M3D A;  3NBX X;  3O8H A;  5AQK B;  1IAP A;  2VPR A;  1JT0 A;  3QPS A;  2X68 A;  2BS3 A;  3OTO T;  1XNR T;  2BVM A;  5HEJ A;  4O4H E;  3FIW A;  1MIV A;  4K0U A;  3OYX A;  3PJA A;  2KLQ A;  3O8G A;  4A5X A;  4YSY A;  2DG7 A;  2XRL A;  5AQC A;  2CWY A;  4ME9 A;  1WR0 A;  3RKO A;  5GPC A;  4P09 A;  4IE5 A;  5FKM A;  2V5D A;  4JI7 T;  3CX7 B;  4PJL A;  2R7S A;  2HHH T;  2G7L A;  2O7O A;  4IDN A;  3G06 A;  1HNX T;  3EUP A;  3AE4 A;  4IGU A;  4J2C A;  5DJQ C;  3NRX A;  4JNN A;  3O60 A;  1A6I A;  1OED A;  2HXI A;  3AA1 B;  5KXJ A;  2UUB T;  2NTX A;  5K58 A;  4DV4 T;  5LJN A;  5FXW A;  3VOK A;  3ON4 A;  2XAH B;  2EHO B;  3N9Q A;  3LSJ A;  4IE0 A;  1NEK A;  3C4X A;  5JDH A;  2V26 A;  3Q5W A;  3RIA A;  3UQ7 A;  4I55 E;  3KVA A;  1FJG T;  3BQI A;  3UUB A;  5EYR A;  1XNQ T;  5F3J A;  4LML A;  2CE7 A;  3JCF A;  2BDE A;  4H63 V;  5AQS B;  2PTF A;  2YEV C;  3HI2 A;  4GCT A;  4KWA A;  1OED C;  1HTJ F;  2CBJ A;  2WU5 A;  2HYJ A;  2OLT A;  2JQH A;  3LDQ B;  1U9O A;  3I1A A;  5JR9 A;  4AKI A;  4DVY P;  2UXO A;  3IH4 A;  3AE8 A;  2I59 A;  3ETU A;  3ZQF A;  4YSX A;  5D1R A;  3MA9 A;  3UUN A;  3AQT A;  3J9X 1;  1CHU A;  2PBX A;  3TLS A;  3GZI A;  4U7Y A;  1YW0 A;  3KYL A;  1XDO A;  4ZZB A;  3CQC B;  3KV6 A;  3C2B A;  4YFS A;  2MBG A;  1M62 A;  3AXJ A;  2C5I T;  1J5E T;  3MZK B;  3TKL B;  4EXT A;  4AC0 A;  1L0V A;  4JYK A;  4GK0 E;  1YKE B;  3FBZ A;  3J7Y q;  3UU3 A;  3RD3 A;  1D0Y A;  2DWG A;  4A98 A;  3ZSS A;  3RIU C;  2H89 A;  4OD4 A;  1UI6 A;  2DL1 A;  2JPF A;  2QYW A;  5F27 A;  2OA5 A;  4UR9 A;  5FHP A;  2B1E A;  5HEO A;  2XPK A;  1ZKE A;  4CXY A;  5A1L A;  3T1Y T;  4O4I E;  4PK5 A;  5CW8 A;  2NTY A;  2HYT A;  2XPW A;  2IW5 B;  3ANG A;  2Q9Q B;  2X9X A;  4HFB A;  3COL A;  5EZH A;  3A7M A;  4LMJ A;  3V6G A;  2QGS A;  5LA6 E;  3NKZ A;  3U3I A;  3PUW F;  4BA9 A;  5FMP A;  4EAH A;  2E9X B;  2C0S A;  1YKH B;  1M7K A;  3K1S A;  4H9Q C;  2Q24 A;  2XTL A;  3VVZ A;  2J62 A;  2C5K T;  5LNK A;  4UDS A;  2J4G A;  2W2U A;  4NXN T;  2WY2 A;  3C4Z A;  2GUH A;  2UXB T;  3E08 A;  2W53 A;  1UX4 A;  4JI1 T;  4ZS3 A;  2FJA A;  3ANP A;  2NW8 A;  3LK2 B;  5BMV E;  3N2G E;  1KEY A;  1VOM A;  3VIB A;  4AKR B;  3LOC A;  3KV4 A;  2XAJ B;  2N2N A;  2W00 A;  5EZY E;  5HSZ A;  4E7S A;  4ERR A;  2ES0 A;  3BQZ A;  5EZG A;  1QLB A;  5HWY A;  1G8X A;  3VHL A;  3VTI A;  4KI0 F;  3I0O A;  5JH7 E;  4DR4 T;  3B5M A;  3LHQ A;  4UVB B;  3RYH E;  1HCI A;  3LWJ A;  4YY3 T;  5IPA A;  3NXC A;  2XAQ B;  4IST A;  3WHB A;  4UV8 B;  2CXF A;  2E5L T;  4HWH A;  3UFG A;  5AQL B;  5F0F A;  3AA7 B;  5H9T A;  1YXR A;  2IHR 1;  3HTA A;  2XDN A;  2Y48 B;  1SHZ C;  3ZQG A;  2M67 A;  3HA4 A;  2NP5 A;  3VRB A;  2YDR A;  5ABF B;  2WU2 A;  3KV9 A;  5AQI B;  5LOV E;  1BR1 A;  3HTH A;  3BJB A;  3LSP A;  2LSI A;  4U2Z A;  2OF7 A;  1MND A;  4TX5 A;  1G73 A;  3CQG B;  2RAE A;  3ZEF B;  4CI3 B;  1HX1 B;  2KT9 A;  2CRB A;  3TLU A;  5FMN A;  4U9L A;  3OBV E;  3LBX A;  2V7J A;  1N34 T;  2WDQ A;  3Q0V A;  4C91 A;  3ZT7 A;  1XDP A;  4HEA A;  2D2S A;  3UU8 A;  1HS7 A;  2ACZ A;  5F0C A;  5JTG A;  2FJD A;  2E2A A;  4NXM T;  3QBM A;  2NP9 A;  3MK7 C;  2BG9 C;  4OD5 A;  2MPK A;  2PJQ A;  2V6Y B;  4DR6 T;  2ACX A;  2L3L A;  3BR3 A;  3VP5 A;  2R7W A;  4O8S A;  4ZZC A;  3RRW A;  4DID B;  2W61 A;  3HIM A;  1JUM A;  3HTJ A;  4UVA B;  3Q0U A;  4V1A v;  3CX8 B;  3ZYK A;  3AAA B;  5D18 A;  3NPI A;  2FBQ A;  2I10 A;  2XGC A;  4JEH B;  5DQW A;  4DV3 T;  5AQN B;  4ANJ A;  4M3F A;  3KKC A;  2OPT A;  2CXD A;  5F5W A;  2R7U A;  2HH7 A;  2R7Q A;  2VKV A;  4HKU A;  1W09 A;  2ZCN A;  4OK0 A;  1XZY A;  3P4W A;  2WMO A;  4O4L E;  4JUY A;  3FZL B;  3P50 A;  3PUA A;  3FHN A;  5K7Z A;  3FBL A;  3F31 A;  4QX8 B;  3ZST A;  3NS4 A;  3S5R A;  1VRB A;  3A5X A;  3HGY A;  2KSR A;  4L62 A;  4UVC B;  4X66 T;  2CXL A;  4DUZ T;  4JI8 T;  4B6X A;  1Z77 A;  2KMF A;  5HXC A;  3FZF B;  5LGT B;  3AAI A;  4DMW A;  5JRC B;  5K7H A;  2D9D A;  2X66 A;  2XQ8 A;  4QH5 A;  4PJJ A;  3B57 A;  2LKH A;  2M6B A;  5HXR A;  4JEU B;  2D6Y A;  3F0C A;  4B3T T;  2XPV A;  2VL8 A;  4DR7 T;  3CJD A;  1JNZ A;  2WWV A;  1E2A A;  2R7O A;  2UUC T;  4NIQ A;  4B1R A;  3V5U A;  1HF8 A;  4WNK A;  5FXZ A;  1SUM B;  2G7S A;  4W97 A;  5J3L A;  2H3R A;  3DPJ A;  2XY8 B;  3GMI A;  4B3M T;  1LRZ A;  3JC6 D;  3CX6 B;  2XHE B;  3CQX C;  3Q2M A;  4ZI7 E;  4QKN A;  5HXE A;  5CJ5 A;  3IH2 A;  5GPA A;  3VU7 H;  3A8Y C;  3Q5X A;  4PK4 A;  5DAB A;  4QXH B;  1J5W A;  4IDZ A;  4H9P C;  2KZ7 B;  4B3A A;  2OV9 A;  3ZYL A;  2YIN A;  2VKD A;  2SPC A;  3EHZ A;  4EED A;  2XSA A;  4GCL A;  3AE7 A;  3DP7 A;  4LF9 T;  1UUR A;  2F4V T;  4CZZ B;  4GFK A;  3V78 A;  3ZCJ A;  2BKO A;  3JAD A;  4DR1 T;  3VOX A;  2XGE A;  3ANW A;  3LSV A;  3C07 A;  5F08 A;  2WB5 A;  2LJL A;  3B6A A;  2BG9 E;  2KXP B;  4CXX A;  4P0A A;  4UIG A;  4JI5 T;  3AED A;  2VVS A;  3H3A A;  5AFU L;  1JTY A;  3TP0 A;  5L3G B;  3LSR A;  3QNU A;  3UQ4 A;  3RQU A;  3O1I A;  4HFC A;  3U78 A;  1JUP A;  3SFI A;  1R8I A;  2XQ5 A;  4UF0 B;  3FZH B;  2HQ5 A;  3PAS A;  4B3R T;  2H7O A;  5LMN T;  4WIB A;  2OI8 A;  1X79 A;  3RC8 A;  4Z91 A;  4DR5 T;  3MNL A;  4NPP A;  3PUX F;  5F1J A;  2IU5 A;  3HKD E;  3ETV A;  3ZJ2 A;  1HX8 A;  4UEL A;  4JV5 T;  5AQV B;  5LHH B;  4LF6 T;  3I9Y A;  1UGO A;  2N1G A;  3AEB A;  4UV9 B;  2Y30 A;  2REK A;  3LFM A;  5F04 A;  2X0Y A;  3N9O A;  5FKY A;  2IAI A;  4GCK A;  3BTI A;  4HTE A;  3KKD A;  1O3X A;  3Q0W A;  1W0A A;  1UI5 A;  5AQJ B;  1Z0X A;  3PJA J;  3LK3 B;  4YJ2 E;  3NI7 A;  2W4X A;  3TLV A;  2R7R A;  5GP9 A;  5L2L A;  2L9Q A;  2DTZ A;  3CK6 A;  1I94 T;  1LVK A;  5L3C B;  2UU9 T;  1IJ6 A;  2QA7 A;  3NVO A;  3FK7 A;  2VK9 A;  3RLF F;  4OYK A;  4GKJ T;  5DQV A;  4JI3 T;  2CMR A;  3N2O A;  2I0M A;  3OPC A;  1ZK8 A;  3C51 A;  2ZCX A;  4V2G A;  4YZE A;  4AKG A;  1QPI A;  4EYY R;  5AQF B;  3AEG A;  5C4Y A;  4G63 A;  2WS3 A;  4EB6 E;  3P4R A;  3G1L A;  3QB5 A;  3G1O A;  2RP4 A;  3P4Q A;  1OXZ A;  3ZC1 A;  4L9I A;  4PJN A;  3LG7 A;  3KDS E;  4X64 T;  3D0T A;  4PJM A;  4JI4 T;  3QOF A;  4LF5 T;  2ZM0 A;  3PU8 A;  4L5G A;  4E7Z A;  4EEB A;  2FX0 A;  2BVL A;  4ILC A;  2QIB A;  2RPA A;  3KVB A;  2G0U A;  3E0Z A;  1NWM X;  5JQG E;  1KF6 A;  5F8P A;  3O1H A;  2IEK A;  4D5C A;  2QWT A;  4KHZ F;  3QB5 K;  4AQF A;  2X67 A;  2WMN A;  1E1H B;  5FY7 A;  4M3E A;  3OKQ A;  1RPW A;  3NZQ A;  4QXB B;  5HXH A;  2VKE A;  3PPB A;  2QRX A;  5KX5 E;  4TV8 E;  4D7M A;  5IHY A;  4EV6 A;  1IBL T;  2BG9 B;  3E22 E;  4AQF C;  1SGM A;  1D1C A;  2YVH A;  3SFD A;  2ODV A;  1UUS A;  2GBY A;  2D0T A;  3HKE E;  4JL3 A;  2ZLY A;  5JDM A;  3KIN B;  5L4E A;  5JR9 C;  3F2E A;  2GFN A;  1FMV A;  1QVU A;  2UXN B;  1IBK T;  2YDS A;  2LHR A;  4K0K T;  3CWR A;  5C2T A;  2RA1 A;  3IBP A;  3NRG A;  3KZ9 A;  3JAE A;  4XZC A;  3H37 A;  3UTK A;  3ONL C;  3ZMT B;  1X9B A;  4AC6 A;  3ZPO A;  4YTN A;  2QKO A;  1JTX A;  1BR2 A;  3AE1 A;  1ZKG A;  2CLY B;  4IHJ E;  3AE6 A;  3ZMZ B;  2WZH A;  2JJ7 A;  3BRU A;  4PXI A;  4DV5 T;  5K7F A;  4JBW F;  4DR3 T;  2HPL A;  2V57 A;  4L0R A;  5HAX A;  2KWI B;  4IRE A;  2VQE T;  3CPZ A;  5LB7 B;  2JQ9 A;  3QPL A;  5CXG A;  1MMD A;  5LHG B;  4H9N C;  2WV1 A;  2LEH A;  3ON2 A;  2B76 A;  3DJB A;  5C8Y E;  1U5P A;  5FKN A;  3F1B A;  4Z90 A;  3IA3 A;  2NS8 A;  2G7G A;  2JQQ A;  3PUG A;  4OYJ A;  2YVX A;  3ZQI A;  2VKJ A;  3RYI E;  1YD8 G;  1IZN B;  3ZMS B;  3VW2 A;  4GK5 E;  3GN5 B;  4HWF A;  2A3D A;  1SA0 E;  3I9W A;  4AKH A;  3P4P A;  4FJO A;  3ABV A;  4GKK T;  1DU2 A;  2MAW A;  2IAK A;  4X62 T;  4ZHQ E;  5FL1 A;  2WDV A;  2X9Y A;  3UUM A;  3ZKR A;  4EIW A;  2ODU A;  4ILA A;  5CGM A;  3B81 A;  3KFW X;  5J1U A;  4X1E A;  1T33 A;  2ZOZ A;  3Q3S A;  4U9N A;  1D0X A;  4EGW A;  1E7P A;  3N2K E;  4YT0 A;  1Z8U A;  3MXZ A;  1NAF A;  4YTM A;  5LBQ B;  1ZHC A;  5LGU B;  4WBO A;  2DI4 A;  3ZT6 A;  4AIU A;  4DV2 T;  1MIW A;  4XBF B;  1OED E;  1MMG A;  2P9B A;  2ZY9 A;  5KMG P;  2CHO A;  3SDG A;  4AXP A;  2J47 A;  2DWK A;  2EHO A;  3BTC A;  2TRT A;  1NEN A;  2XQ9 A;  3L39 A;  2XB5 A;  2LSY A;  3L09 A;  3RF1 A;  2W0G A;  2OER A;  3AE2 A;  2XQA A;  4ISS A;  4OFZ A;  5J0Z A;  5AQT B;  5AQG B;  2UXI A;  3TLT A;  3PUS A;  5JDL A;  4TV9 E;  4P1N A;  5C3J A;  4WZX A;  3AA0 B;  3EDU A;  5CB4 E;  4HE8 A;  5FXX A;  2UXH A;  4AF5 A;  1JUS A;  2LSJ A;  2WBL A;  5AQR B;  1T7S A;  2FQ4 A;  3UU6 A;  4H9S E;  2BKP A;  4ILU A;  1S35 A;  3BK9 A;  3X1D A;  5FY0 A;  5ABE A;  2Y8D A;  3AQS A;  2IML A;  3UU4 A;  3WAK A;  5EFY A;  5IWA T;  1YQ3 A;  3VKG A;  4X5T A;  4PNI A;  3FXE B;  4TWF A;  4FI5 A;  2WP9 A;  3VR8 A;  2HPJ A;  5LGN B;  2CEA A;  2FJI 1;  2TCT A;  2LE8 A;  5L4H A;  3L3P A;  2AXD S;  2UUA T;  5JRE A;  3K8P C;  2Q9Q A;  3Q5D A;  2H88 A;  4ZXL A;  3BHQ A;  4F8H A;  2A2F X;  1RKW A;  2ZM2 A;  3M65 A;  3R84 B;  1GQE A;  2V7M A;  2CA5 A;  2UXU A;  2E9X A;  2XGD A;  4U7I A;  3V5S A;  5IOZ A;  3PUY F;  2NOX A;  5D19 A;  2YN6 A;  2JIW A;  2Q9Q C;  4IRV A;  4GOU A;  4X1I E;  4AUX A;  2LRK A;  1UCU A;  2K48 A;  3T6N A;  2WCA A;  5HAW A;  3CCY A;  3TLW A;  3QKX A;  2YOE A;  4DMV A;  5HCM A;  2E9X C;  3HR0 A;  3BTJ A;  3AE9 A;  1VCT A;  4U72 A;  5CA1 E;  4MHC A;  2LLY A;  4JI0 T;  4WYV A;  3FK6 A;  4GIW A;  2D5U A;  3TP3 A;  2K24 A;  2VKO A;  3BR5 A;  4JI2 T;  2BS2 A;  1LKX A;  4NUU A;  1HNZ T;  4DO0 A;  5ABG A;  5HBU A;  5E0O A;  2FD5 A;  1WYC A;  4I43 B;  2VB6 A;  5FKK A;  1LVF A;  4G12 A;  3BT9 A;  4ZOL E;  3ONX A;  4F6R C;  3PUQ A;  3KBT A;  1OED B;  3RH3 A;  2Y6X A;  5F0H A;  3PV0 F;  3JAF A;  3VVX A;  2CPT A;  3PDY A;  5H6Q B;  4PFP A;  4DV6 T;  2HN2 A;  3AEF A;  2BBH A;  3LJL A;  3AE5 A;  4AIS A;  2V7L A;  4LF4 T;  1FEW A;  5FP3 A;  3Q5E A;  4YXD A;  1RKT A;  1D1A A;  5ABF A;  3HTI A;  2WQY A;  4I76 A;  4KBM B;  5H6R B;  2G3B A;  5LG4 A;  5JR9 B;  1WLX A;  4JYA T;  4ILB A;  4TNW A;  4YLH A;  2XSB A;  3AE3 A;  2ZCM A;  3HKC E;  2ZB9 A;  2NW7 A;  3AVR A;  2VL0 A;  4MAL A;  3HKB E;  3ZT5 A;  3AXJ B;  3KBU A;  3CDL A;  3SRZ A;  3AA6 B;  4HFD A;  2R7T A;  4OHF A;  5L3B B;  4DV7 T;  5JDF A;  4HKA A;  5LHI B;  1KNZ A;  2IUB A;  3OJA A;  2ZM6 T;  2XUE A;  2CHN A;  3ZMU B;  4ABZ A;  5L3E B;  2NX4 A;  2V6Y A;  1FIO A;  2XAF B;  3BR1 A;  2B3W A;  1VI0 A;  4COF A;  2VUR A;  1Y64 B;  4TUY E;  4QH4 A;  2X0L B;  4IE7 A;  4BAY B;  2E5V A;  4X1K E;  4LF7 T;  4I50 E;  2JRK A;  3ZJ1 A;  3BQL A;  2XQ6 A;  3RYF E;  3CML A;  2G0E A;  2D0U A;  2YU2 A;  4EZ4 A;  5LXT E;  1WR6 A;  2XJ7 A;  4HFE A;  4X20 E;  3NZP A;  5JDG A;  3PE0 A;  2VQF T;  3N5L A;  3KNW A;  2LKG A;  3AEA A;  3F57 A;  4C90 A;  1U4Q A;  5CQG A;  2NP3 A;  4QHO A;  2V7I A;  3P4S A;  4JI6 T;  3CWZ B;  3PUV F;  2FJE A;  4HGA A;  1J1J A;  3VW1 A;  3FXD B;  4GYR A;  4JKZ A;  3ESL A;  5FL0 A;  1IJ5 A;  1T8B A;  2ID6 A;  3BTL A;  3S4U A;  2O7T A;  3P9T A;  3MVP A;  1D1B A;  3C50 A;  5JRC A;  5KDM C;  2BBJ A;  2YDQ A;  2JK3 A;  5FYM A;  3CVR A;  4CI1 B;  2W62 A;  2N9D A;  4W1U A;  3SOL A;  4CQI A;  4B3S T;  2Y2Z A;  4XAX B;  2YK0 A;  2PFV A;  4TWD A;  4AQG A;  2XQ3 A;  4HN9 A;  4IDQ A;  4ZI3 C;  3EDV A;  4IDO A;  2IC9 A;  3Q9D A;  2XAG B;  3PU3 A;  3JSJ A;  1KFY A;  4C2M A;  1XMO T;  1BR0 A;  3P7I A;  5CXI A;  4U2Y A;  4JLE A;  3UUL A;  4TNV A;  3RKG A;  4LMK A;  4ZEY A;  2XQ7 A;  4HFH A;  2BKN A;  4U31 A;  2GK9 A;  2M6I A;  5EK2 A;  4UEM A;  3C98 B;  4N78 D;  4KMC A;  4M3G A;  1FMW A;  2I6H A;  2LOP A;  2UXD T;  2QVA A;  2VAS A;  4DND A;  2W66 A;  2A72 A;  2JMH A;  3FRQ A;  3LBX B;  3LK4 2;  2C5J A;  5HWX A;  3RC3 A;  2EH3 A;  2ZMA A;  3UUX B;  3AEE A;  2BS4 A;  3O4X E;  4IE4 A;  5IOY A;  3RIU A;  3HL6 A;  4U3C A;  5FGL A;  3EVY A;  2WGB A;  5ADX L;  5L3D B;  2YVE A;  2JJ9 A;  3NWI A;  2YU1 A;  3SWH A;  1D0Z A;  3WAJ A;  4D7N A;  1T56 A;  1N36 T;  1IBM T;  5FKL A;  4UF0 A;  1HNW T;  3AAE B;  3VW0 A;  4O2B E;  3RH2 A;  3RX6 A;  5LG3 A;  4KUM B;  5AQH B;  3ZYM A;  4A56 A;  5JDN A;  4IDP A;  2PBI A;  1U9N A;  5IP6 A;  2F07 A;  2VKH A;  1ZOY A;  2LSG A;  2H7V C;  3LJC A;  5HEH A;  2EHO D;  2X9D A;  1US7 B;  4OX9 T;  3BNI A;  4M3B A;  1QUU A;  3DTO A;  3QK6 A;  4MO7 A;  3N9M A;  4IT4 A;  4TWH A;  4I6Z A;  4PAG A;  5CFB A;  2IBD A;  3EAB A;  3AVS A;  4H63 H;  5JVD E;  2XPU A;  3RGL A;  3VPR A;  3QC9 A;  3G7R A;  5DAJ A;  2WDR A;  3HGG A;  1ORK A;  2VWA A;  2LRL A;  4MK6 A;  3MAC A;  2LM2 A;  3UFE A;  3GA8 A;  1MMA A;  5JDQ A;  2ID3 A;  3CIR A;  2XQ4 A;  3P8C D;  4MLK A;  2FJ1 A;  5FVL A;  4U74 A;  4CN1 A;  4V2F A;  4YHH T;  3T8O A;  3DCF A;  4G2A A;  5EK3 A; 
#chains in the Genus database with same CATH homology
 3H3A A;  3K8P C;  2Q9Q A;  4IE0 A;  5AFU L;  3C4X A;  2PG8 A;  2LM9 A;  5L3G B;  3N9P A;  4PFO A;  5JDH A;  2V26 A;  3Q5W A;  4I55 E;  3KVA A;  3BQI A;  4CI2 B;  5F3J A;  3N9L A;  3VKH A;  3CKD A;  3O1I A;  2A2F X;  2CE7 A;  3U78 A;  4WBN E;  2ZM2 A;  2BDE A;  4MBQ A;  4H63 V;  2YEV C;  3M65 A;  3HI2 A;  4UF0 B;  3R84 B;  4KP3 C;  2V7M A;  5LBM A;  2CA5 A;  2E9X A;  1HTJ F;  3V5S A;  2H7O A;  2L8K A;  2V1D B;  4DBQ A;  2CM0 A;  2NOX A;  1X79 A;  3RC8 A;  2Q9Q C;  4IRV A;  3I1A A;  5JR9 A;  4AKI A;  4DVY P;  2WSS V;  2I59 A;  4GOU A;  4X1I E;  3ZLI A;  3ETU A;  3HKD E;  3ETV A;  1UCU A;  2K48 A;  3ZJ2 A;  3K3Q C;  1HX8 A;  3BQK A;  4UEL A;  1ZV4 X;  3MA9 A;  3UUN A;  5HXS A;  3DU5 A;  2Q9Q D;  5LHH B;  3I9Y A;  3J9X 1;  4DMV A;  2E9X C;  2N1G A;  3HR0 A;  1YW0 A;  4IIJ E;  4UV9 B;  4U72 A;  3KYL A;  5CA1 E;  3CQC B;  3KV6 A;  4YFS A;  2MBG A;  2E8I A;  4MHC A;  2C5I T;  4GIW A;  2D5U A;  3LFM A;  3N9O A;  3MZK B;  2W63 A;  3TKL B;  2UXX B;  2E9X D;  4EXT A;  4GK0 E;  1YKE B;  4HTE A;  3FBZ A;  2K24 A;  3J7Y q;  1O3X A;  2VKO A;  4DVD A;  1LKX A;  4NUU A;  1D0Y A;  2DWG A;  4DO0 A;  3ANW B;  4DBR A;  3LK3 B;  4YJ2 E;  3PTR B;  2XAS B;  3K3O A;  2EHO C;  5E0O A;  4OD4 A;  1WYC A;  4I43 B;  3DU6 A;  2JPF A;  2VB6 A;  1LVF A;  2R7R A;  2OA5 A;  5L2L A;  4ZOL E;  2B1E A;  3ONX A;  4F6R C;  2L9Q A;  3PUQ A;  3UT5 E;  1LVK A;  5LJM A;  5L3C B;  3KBT A;  1IJ6 A;  1ZKE A;  4CXY A;  5A1L A;  2QA7 A;  3RH3 A;  2Y6X A;  4HFV A;  4O4I E;  4PK5 A;  2MTQ A;  5FXV A;  2NTY A;  5IYZ E;  2IW5 B;  2VK9 A;  4OYK A;  2V7K A;  3PDY A;  5H6Q B;  4PFP A;  2Q9Q B;  5DQV A;  2X9X A;  2CMR A;  3N2O A;  4WW0 A;  5HYA A;  4AI6 A;  2V7L A;  3C51 A;  1FEW A;  2QGS A;  5FP3 A;  5LA6 E;  3FB2 A;  4AKG A;  3U3I A;  5L3F B;  4EYY R;  4BA9 A;  5J2U E;  4G63 A;  1OWA A;  4M1P A;  4EB6 E;  2K9A A;  2LOS A;  4EAH A;  1BR4 A;  2E9X B;  1D1A A;  2C0S A;  2RP4 A;  1YKH B;  4H9O C;  4I4T E;  3IEE A;  1OXZ A;  3ZC1 A;  4KBM B;  4L9I A;  2KIN B;  4H9Q C;  4PJN A;  4X1Y E;  5H6R B;  3LG7 A;  3KDS E;  3RPU A;  3PUR A;  5LG4 A;  5JR9 B;  3D0T A;  2LHN A;  2XTL A;  4PJM A;  1WLX A;  3R6N A;  2ZM0 A;  3PU8 A;  4L5G A;  4YLH A;  4E7Z A;  2C5K T;  5LNK A;  2BVL A;  4ZI2 D;  3AB3 B;  1MMN A;  3KVB A;  2G0U A;  3E0Z A;  4BJM A;  1WYB A;  1H7C A;  1NWM X;  3C4Z A;  3HKC E;  2NW7 A;  5JQG E;  5LP6 E;  3E08 A;  2MOZ A;  3AVR A;  4MAL A;  1UX4 A;  5F8P A;  3HKB E;  3O1H A;  1T98 A;  4YJ3 E;  4ZS3 A;  3ZC0 A;  3KBU A;  2NW8 A;  3LK2 B;  3SRZ A;  5BMV E;  3ZCI A;  3AA6 B;  3N2G E;  2R7T A;  4OHF A;  4TZ4 C;  5L3B B;  1VOM A;  5JDF A;  4HKA A;  5LHI B;  4AKR B;  1KNZ A;  4UXN B;  4AQF A;  2X67 A;  2WMN A;  3OJA A;  2XUE A;  3KV4 A;  3ZMU B;  1E1H B;  2XAJ B;  2N2N A;  2DNX A;  5FY7 A;  5L3E B;  2W00 A;  5EZY E;  3OKQ A;  1FIO A;  2XAF B;  3NZQ A;  4QXB B;  4ERR A;  4E7S A;  5HXH A;  2ES0 A;  3W15 B;  2B3W A;  3SS1 A;  3IF8 B;  1MNE A;  2DLR A;  5HWY A;  2CCQ A;  1G8X A;  3VHL A;  3VTI A;  3ZMV B;  1AJ3 A;  3I0O A;  5JH7 E;  5KX5 E;  2CLY C;  1Y64 B;  4PK6 A;  1MIY A;  4TV8 E;  4TUY E;  2DCF A;  5IHY A;  2X0L B;  4UVB B;  4IE7 A;  3O1J A;  3RYH E;  3E22 E;  1HCI A;  2DHR A;  4AQF C;  4BAY B;  1D1C A;  2XAQ B;  4IST A;  4UV8 B;  2ODV A;  3C4W A;  2CXF A;  1HFA A;  2D0T A;  3HKE E;  4X1K E;  3I0Q A;  2WAU A;  1EZ3 A;  3MJX A;  4I50 E;  2JRK A;  4NUV A;  2ZLY A;  3MKD A;  5JDM A;  3ZJ1 A;  3GN5 A;  2Z6E A;  3BQL A;  3KIN B;  1V9D A;  3AA7 B;  3RYF E;  5JR9 C;  3CML A;  3F2E A;  2D0U A;  1FMV A;  2Y48 B;  2ZM8 A;  5LYJ E;  1SHZ C;  2M67 A;  5FNV E;  2YU2 A;  4EZ4 A;  5LXT E;  3HA4 A;  1WR6 A;  1KK7 A;  2UXN B;  5J1G A;  3KV9 A;  4X20 E;  2LHR A;  3NZP A;  5EK4 A;  5LOV E;  1BR1 A;  5JDG A;  1ZEE A;  3K3N A;  2RA1 A;  3IBP A;  3PE0 A;  2LSI A;  1MND A;  4TX5 A;  1G73 A;  3N5L A;  3CQG B;  4XZC A;  3H37 A;  3UTK A;  2LSK A;  3F57 A;  4C90 A;  3ZEF B;  1U4Q A;  3C64 A;  5CQG A;  4CI3 B;  5LCY A;  4QXC B;  3ZMT B;  4QHO A;  5FY1 A;  2KT9 A;  2V7I A;  5FMN A;  3OBV E;  3ZPO A;  3LBX A;  2V7J A;  3CWZ B;  4HGA A;  2K5B B;  1BR2 A;  3FXD B;  4GYR A;  4C91 A;  3KV5 A;  3ESL A;  4TN7 B;  2CLY B;  4IHJ E;  5TAO A;  3B13 A;  2R7X A;  4HEA A;  2D2S A;  3ZMZ B;  1IJ5 A;  4AKL A;  1HS7 A;  3S4U A;  4O2A E;  2CWO A;  4O4J E;  4ZS2 A;  2NP9 A;  2X51 A;  3MK7 C;  4BJN A;  1D1B A;  3C50 A;  4OD5 A;  4CXW A;  5JRC A;  2HPL A;  2WWU A;  4L0R A;  2PJQ A;  4IE6 A;  5KDM C;  5HAX A;  3EUH A;  2KWI B;  2ACX A;  2L3L A;  3CPZ A;  4ZI2 C;  2R7W A;  4O8S A;  4Z8X A;  3RRW A;  5FYM A;  1MMD A;  3CVR A;  2BZB A;  5LHG B;  4CI1 B;  2W62 A;  4MFR A;  3IHR A;  4H9N C;  2W61 A;  2N9D A;  2LEH A;  3GWH A;  3DJB A;  4UVA B;  1U5P A;  5C8Y E;  3O9X A;  4V1A v;  3CX8 B;  3SOL A;  4CQI A;  3ZYK A;  4XAX B;  2YK0 A;  2PFV A;  3AAA B;  1Z0P A;  1CUN A;  4AQG A;  4ASK A;  2JQQ A;  4HN9 A;  2J1D G;  3PUG A;  4JEH B;  4OYJ A;  4ZI3 C;  5DQW A;  2VKJ A;  3RYI E;  3EDV A;  1YD8 G;  1IZN B;  1HG2 A;  1QSD A;  3ZMS B;  4ANJ A;  2IC9 A;  3Q9D A;  4GK5 E;  2XAG B;  2X9H A;  2MYS A;  3GN5 B;  3PU3 A;  1BR0 A;  4C2M A;  5ETW A;  2A3D A;  2CXD A;  1SA0 E;  3P7I A;  2R7U A;  3I9W A;  4AKH A;  5GON E;  2R7V A;  4P0B A;  4ZI3 D;  4FJO A;  4JLE A;  2HH7 A;  3UUL A;  2R7Q A;  4OK0 A;  1HG5 A;  2IAK A;  2WMO A;  2GK9 A;  4O4L E;  4ZHQ E;  2X9Y A;  4GYS A;  3N9N A;  3UUM A;  4EOZ B;  5EK2 A;  4UEM A;  1UX5 A;  2NWB A;  4JUY A;  3C98 B;  4N78 D;  4KMC A;  4EIW A;  2ODU A;  1FMW A;  3NRY A;  3RYC E;  3KFW X;  3PUA A;  2WM9 A;  2LOP A;  3FHN A;  1D0X A;  3FBL A;  3F31 A;  3WI3 A;  4QX8 B;  2VAS A;  3N2K E;  3NS4 A;  4DND A;  5M4Y A;  3RRC A;  1VRB A;  3A5X A;  2A72 A;  3MXZ A;  2NW9 A;  4EYU A;  2JMH A;  1NAF A;  5J2T E;  3LBX B;  4UVC B;  5LBQ B;  1ZHC A;  5LGU B;  4WBO A;  2DI4 A;  3LK4 2;  4EZH A;  2C5J A;  3ZN1 B;  4QX7 B;  2CXL A;  2IC6 A;  4H9R C;  5HWX A;  1MIW A;  4XBF B;  1MMG A;  4YHJ A;  4B6X A;  3RC3 A;  3QUJ A;  4ADZ A;  1S94 A;  2KMF A;  5HXC A;  2P9B A;  2ZMA A;  5CA0 E;  4PW8 A;  2KND A;  5LGT B;  5KMG P;  3UUX B;  3AAI A;  3O4X E;  4DMW A;  4IE4 A;  4AXP A;  5JRC B;  2DWK A;  2EHO A;  3HL6 A;  3EVY A;  1B7T A;  1WRD A;  2X66 A;  5ADX L;  5L3D B;  3OYZ A;  2XQY A;  2JJ9 A;  2LT3 A;  2LSY A;  2YU1 A;  3L09 A;  2X9W A;  3SWH A;  4PJJ A;  1D0Z A;  3WAJ A;  3B57 A;  2W0G A;  5HXR A;  4JEU B;  4QWN B;  3JC6 C;  4ISS A;  2KWH A;  4UF0 A;  2VL8 A;  3AAE B;  4OFZ A;  4O2B E;  2JMK A;  2R7O A;  3ZN0 B;  3V5U A;  1HF8 A;  4WNK A;  3RX6 A;  5FXZ A;  3NBX X;  4KUM B;  3PUS A;  2H3R A;  3ZYM A;  5JDL A;  3GMI A;  4A56 A;  1IAP A;  1LRZ A;  5JDN A;  3JC6 D;  3CX6 B;  2X68 A;  4TV9 E;  2PBI A;  2XHE B;  3CQX C;  2VKH A;  2BVM A;  3AA0 B;  3EDU A;  3Q2M A;  2LSG A;  4ZI7 E;  4O4H E;  2H7V C;  4QKN A;  3LJC A;  5CB4 E;  5HXE A;  1MIV A;  4K0U A;  3OYX A;  2EHO D;  2KLQ A;  1US7 B;  4HE8 A;  5FXX A;  1QUU A;  3DTO A;  3QK6 A;  3N9M A;  3VU7 H;  3Q5X A;  2CWY A;  4PK4 A;  5DAB A;  4QXH B;  4PAG A;  4IDZ A;  2LSJ A;  4H9P C;  3AVS A;  4H63 H;  5JVD E;  2KZ7 B;  3RKO A;  3ZYL A;  2YIN A;  2WBL A;  2VKD A;  2SPC A;  4P09 A;  3QC9 A;  3DP7 A;  4IE5 A;  4H9S E;  4CZZ B;  4ILU A;  1S35 A;  2VWA A;  3BK9 A;  3CX7 B;  5FY0 A;  3ZCJ A;  2Y8D A;  3MAC A;  4PJL A;  3UFE A;  3GA8 A;  3WAK A;  2R7S A;  1MMA A;  5JDQ A;  3ANW A;  3VKG A;  4PNI A;  3FXE B;  4IGU A;  4J2C A;  4FI5 A;  2HPJ A;  5LGN B;  3P8C D;  2CEA A;  4MLK A;  5DJQ C;  3NRX A;  4U74 A;  2FJI 1;  2LE8 A;  2LJL A;  3AA1 B;  2NTX A;  3T8O A;  5LJN A;  2KXP B;  4CXX A;  3L3P A;  4P0A A;  5FXW A;  4UIG A;  5JRE A;  4G2A A;  5EK3 A;  2XAH B;  2EHO B;  3N9Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...