2A2FX

Crystal structure of sec15 c-terminal domain
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
317
structure length
296
Chain Sequence
b'NILWELLHNMRDHYNEVLLQRWVHVFREILDKEQFLPMVVQNTEEYECIIERFPFHSEQLEPKKFPFSRMVPEVYHQAKEFMYACMKFAEELTLSPNEVAAMVRKAANLLLTRSFSGCLSVVFRQPSITLTQLIQIIIDTQYLEKAGPFLDEFVCHMTNTERAMFHVARQDAEKQVGLRICSKIDEFFELSAYDWLPGIASAFITDMISYLKSTFDSFAFKLPHIAQAACRRTFEHIAEKIYSIMYDSTGALTQINLDLMQCEFFAASEPVPGLKEGELSKYFLRNRQLLDLLILE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exocyst complex component Sec15
publication title Sec15 interacts with Rab11 via a novel domain and affects Rab11 localization in vivo.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Protein transport
total genus 109
structure length 296
sequence length 317
ec nomenclature
pdb deposition date 2005-06-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.30 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor; domain 2 2a2fX01
1.20.58.670 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2a2fX02
3FHNA 2A2FX
chains in the Genus database with same CATH superfamily
2XM2A 3G1MA 5M4YA 1KNRA 2OA5A 1VI0A 2W66A 1Z0XA 4HKUA 4ILCA 3MZKB 4MFRA 5L3DB 4LF5T 4AKLA 2ZCNA 4JUYA 3BQKA 5AQJB 5D19A 4JKZA 2QIBA 2CXFA 4W1UA 2BKOA 4IREA 3JAFA 3A5XA 1X79A 2VWAA 4UELA 2XPUA 4IL9A 4X64T 3QC9A 4IDZA 3PUZF 3CX7B 2R7TA 3UU8A 2RHAA 2MOZA 4NPPA 2X68A 2IUBA 2BG9A 2IIUA 2BS2A 2V6XA 4JL3A 2XQ4A 4JEHB 3BR6A 2F07A 2E9XA 3ZQGA 3MKDA 3N9QA 4UR9A 4DV7T 5DAJA 2WMNA 2CEAA 5JRCB 4KMCA 5JDFA 2Q9QB 2V57A 5AQPB 3AXJB 5HEOA 3VUQA 3HR0A 1IZNB 2TCTA 3ONLC 4OK0A 2QOPA 4C2MA 4KHZF 4Z8XA 4BJMA 5AQUB 2J1DG 2E5LT 5LJMA 3AEAA 3I1AA 3LFMA 3LG7A 4CI1B 2IHR1 5BR8T 5J2TE 4WIBA 4L62A 1HF8A 1KEYA 4LFCT 3QB5A 2E8IA 4DV0T 5EK3A 1KNPA 4CQIA 4ZS3A 1T7SA 3UU5A 3RH2A 3VKGA 1XNRT 2CA5A 1SHZC 3ONXA 2XQ9A 3ZQLA 3HKDE 3IUVA 3CQCB 4U9LA 5J0ZA 2M67A 4PK4A 4L0RA 3O1JA 3S4UA 2R7QA 4U72A 5EFYA 4YY3T 5J3LA 2IDOB 2M6BA 4AF5A 5JR9B 4HFIA 2PZ9A 1NAFA 4AKGA 5FKLA 4GFLA 3KBUA 3TLSA 2ODUA 3MA9A 2ACZA 4COFA 2DG8A 3ZSSA 4ZI3D 1D1BA 3H37A 4CI2B 3N9NA 2PG8A 3RYFE 4AQGA 4D5FA 3OPCA 5FY1A 4WW0A 2DHRA 1YQ3A 4PJLA 3PUGA 4ZEYA 2WZIA 2XB5A 3DU5A 4PK5A 1T33A 3O8HA 2NP5A 4U7YA 3IA3A 3FZHB 2WGBA 2V6YB 3AE8A 5LGTB 5FVLA 2UUCT 3AEGA 4TN7B 3KV5A 3QNUA 4YFSA 2QVAA 4X65T 4LF4T 3NWIA 5AQFB 1MIVA 3NRYA 2HKUA 2WS3A 3ABVA 2GENA 2YKSA 2RASA 3FZKB 4P1NA 1YKEB 1Z77A 3I0QA 4KWAA 4AQFA 5LBMA 5EK4A 2X9HA 2A3DA 3VIBA 1MMNA 2E5VA 1DU2A 5JDNA 2ZM2A 4PNIA 3RX6A 2MBGA 2V26A 3AECA 4QXBB 1QLBA 3AAIA 2ZM0A 4X5TA 3FZLB 3OVUA 3RRCA 3AE6A 1ZP0A 1HFAA 1YQ4A 5L47A 1JUSA 5FKYA 2B1EA 3C51A 3N2OA 3VVYA 4DIDB 4H63H 2FJ1A 3FHNA 2IC9A 3TKLB 1UGOA 2CCQA 2XM1A 5L3EB 3P4SA 1HTJF 4UXNB 2BVMA 4IE0A 2ID6A 2AXDS 2ZOYA 4NXNT 2QCOA 2YINA 4YTMA 3RLFF 3BQYA 2XQAA 3T8OA 2LSKA 3Q5DA 4H9NC 3Q2MA 5HCJA 2UXUA 5ABFA 1U5PA 2MAWA 3FB2A 4KUMB 3N2KE 4AISA 3FIWA 2IEKA 3VHLA 3J9X1 2ODVA 2XJ7A 4ME9A 3QB5K 3JC6C 1MMAA 3NPIA 2RP4A 2HXIA 2BBJA 2O7OA 3P4RA 2JPFA 3ZYLA 1LKXA 4JLEA 3HI2A 4Z90A 2VVNA 2E2AA 4GK5E 5FGLA 4U7IA 3EGQA 4YLHA 3HIMA 4IE6A 2ZLYA 5IOYA 3LJCA 3SFDA 3RYHE 3EUPA 3VTIA 3M65A 5HEHA 2KMFA 3PUSA 2LKHA 4IDNA 4Q25A 2YEVC 4PJMA 2LRKA 4QXCB 5HXEA 1IJ5A 2NTXA 2V1DB 3RF1A 2BZBA 3P7IA 4I4TE 4JI2T 3OYZA 3SOLA 3HL6A 4AKRB 1UX5A 3L8RA 3BQIA 3TLUA 5LOVE 4PFOA 5LHIB 3WHCA 5F0FA 2XQYA 3R6NA 2I6HA 1UCUA 2DLRA 5LMNT 1U9NA 3ZLIA 2IW5B 4G63A 3LJLA 2PBIA 3F31A 3TLVA 2WWUA 1JNRA 5F04A 1WLXA 3ZJ1A 3UULA 2LE8A 3QPSA 4EB6E 3FZMB 5FXZA 1JTYA 5J1YA 2X9WA 3GA8A 2RA1A 1WR0A 4D5CA 1D1AA 3BJBA 4AKIA 3QKXA 2WQYA 3RGLA 5AQTB 4ISTA 4MALA 5JDGA 3LBXA 4EV6A 2BBHA 3EDUA 3BT9A 5ADXL 3LSJA 4A98A 3PJAA 3G1OA 3HE0A 3P8CD 5HEJA 1OXZA 1U9OA 3KZ9A 4UIGA 1NEKA 2GBYA 3B81A 2Y6XA 5ABEA 3R84B 4DO0A 2V8SV 2L3LA 4I0UA 5AQCA 3ZT7A 5FKKA 5FYMA 5L2LA 3DEWA 2R7RA 4OYKA 3ZYKA 3CMLA 4LF6T 3PU8A 4ILBA 2DWKA 3AE4A 2X51A 5H6RB 3EHZA 4KX6A 3UUMA 2LLYA 4X1YE 4CXWA 4P0AA 3ZT6A 3O8GA 2A9UA 2CBIA 4QX7B 3GN5B 5L4HA 2D5UA 3IBPA 3JC6D 1Z8UA 4X1KE 1B7TA 3V5UA 2HYJA 2JK3A 4U2ZA 4MBQA 4V2FA 4CXYA 5EYRA 3CIRA 3BCGA 3O60A 3HTJA 3SWHA 4B3AA 4QH1A 2W62A 2FUPA 1RKTA 4UV8B 2G3BA 5LBQB 4I76A 4XBFB 3AAAB 4LMKA 5LNKA 4YZEA 2HYTA 3K8PC 2H88A 2DCFA 2YU2A 4HWCA 1T56A 2KINB 3C2BA 3KVAA 4D7NA 3RYIE 5EK2A 5HXRA 4IIJE 5HBUA 3PDYA 4KP3C 5L4EA 2UXDT 3K1SA 3SRZA 4WBNE 2ZCXA 2QKOA 1OEDE 3O4XE 5JVDE 4OYJA 1UURA 4DNDA 2Q9QC 2OV9A 2UXNB 1LVKA 2BG9B 3ZT5A 3J7Yq 2ZM8A 1XDOA 2E9XB 5LA6E 4LF7T 3BTCA 4DW6A 2D9DA 2XAFB 3E08A 4B3TT 2BS3A 3UUXB 5JQGE 4CGRA 5F1JA 4U74A 2Q24A 3C4ZA 2Y8DA 3RI5A 3FK6A 3P50A 3P4PA 2Y2ZA 3N9LA 4PFPA 2NW8A 4H9QC 3O9XA 1T72A 5LP6E 2YVHA 5JR9C 3RHWA 2V7LA 4U33A 5LHHB 1EZ3A 3RRWA 1D1CA 2OI8A 4HFDA 5AQLB 4AUXA 3I9WA 3ANGA 5ETWA 2EHOB 5GONE 3C64A 2KZ7B 5AQHB 3QQAA 2IC6A 1WR6A 2R6GF 2UXOA 2ZOZA 1NWMX 3KV6A 4YXDA 2W67A 2X0LB 3OKQA 3PTRB 4M3BA 4K0UA 3EABA 3V78A 1E1HB 5F8PA 5F0CA 2VURA 3C07A 2XUEA 2W0GA 2NP9A 2W4XA 3UTKA 3O1HA 4DBRA 4IRVA 5GP9A 1KF6A 4A5XA 3AA6B 2UXXB 3TLTA 1OWAA 3CQXC 3AE7A 5EZHA 1WFDA 3QUJA 1OEDA 2QYWA 4ICHA 2UXBT 3KDSE 5C4YA 2FBQA 2G0UA 3IEEA 1WCRA 2C5JA 4PK6A 5EZYE 3EI0A 2YVXA 3FXEB 4ZXLA 2XASB 2VKEA 5L3CB 2WDVA 4I43B 1T8BA 2CWOA 2FX0A 3FBLA 5EZGA 4I55E 2M6IA 2G7GA 5IUXA 3NKZA 1XWMA 2JQKA 4TWHA 2R7WA 4UVCB 1W0AA 1HG5A 1YXRA 3ONJA 3RKOA 4ZI7E 2DWGA 4DV1T 2I0MA 3V6GA 3L09A 4TWDA 2GUHA 4GKJT 2BS4A 3O1IA 4YJ2E 4TX5A 4TV9E 3ANWA 5KMGP 4IE5A 5BMVE 4MO7A 5FXXA 4MK6A 4AXPA 4ASKA 3NBXX 2QTQA 3HTIA 2L9QA 2Q9QD 5L3BB 1Y01A 2LHRA 2UU9T 4AI6A 2LSJA 4TUYE 4TV8E 3Q5EA 3IH4A 4YSZA 4WNKA 3W15B 3N2GE 4NUUA 3VR9A 3KKCA 3DTOA 4DR3T 2ZY9A 5CXIA 2X0YA 5E0OA 1MIYA 5ABFB 3RIUC 4LMJA 5AQNB 2FJBA 1KNZA 1HX8A 4M3DA 4H9SE 3LSVA 4HWDA 4K0KT 2HPJA 2DNXA 2HPLA 2LOPA 4WBOA 2Z6EA 4J2CA 3CVRA 5LGNB 2XQ8A 3CJDA 3CWZB 2H7OA 1N34T 1JUPA 3E7QA 2Y48B 3ZPOA 2J47A 3Q5WA 2WU2A 1R8IA 3FZFB 4JBWF 4DMVA 4HEAA 2V5CA 4G2AA 2YN6A 4Z91A 3I9YA 1N36T 5FMNA 3ZN1B 2VKOA 2HHHT 2CRBA 4TZ4C 2JJ9A 4HFVA 2WWVA 2IMLA 3L39A 5K7HA 3AE2A 3LK3B 2C5IT 4HWHA 5CGMA 1VCSA 5AFUL 3B6CA 3P4QA 3PURA 3RH3A 4WZXA 4DR6T 5HSZA 4PXIA 3AE9A 5HWXA 3VKHA 2AE9A 3KVBA 1KFYA 2K5BB 3ZMZB 4M1PA 5CB4E 2V6YA 5AQGB 1QPIA 5K7FA 2CBJA 1HR0T 3H3AA 2JIWA 1ZV4X 2WUIA 1RKWA 2XAGB 1W9RA 4HFBA 2FJI1 5JTGA 1W09A 3N9PA 3F1BA 3NVOA 3ZKRA 2OERA 4FI5A 2XPVA 3AA0B 2WM9A 4DV3T 1UUSA 2X6OA 5HWYA 5JREA 3NXCA 1QVUA 4JI1T 3KV9A 2L8KA 2NW7A 3A7MA 5HAWA 5J1GA 4U9NA 3DP7A 3NNRA 5IYZE 4GCTA 1L0VA 2NW9A 3S5RA 3DU6A 3RD3A 4O2BE 5IWAT 3PUQA 1O3XA 2NS7A 3LBXB 1G73A 2V7MA 3N5LA 3VOKA 1SE7A 2ACXA 4JYKA 2VKJA 3ZQHA 2G7LA 4AKHA 4IL4A 2X9YA 4M3EA 4O8SA 3K3QC 4I50E 4DR5T 2CWYA 3BTJA 3GEUA 2XAHB 3KKDA 1KK7A 1N33T 5HEGA 1A6IA 4KI0F 1MMDA 5H6QB 4ACIA 1E7PA 2HN1A 1BR4A 2RPAA 4GIWA 4EZHA 1XMQT 2YDSA 5F0HA 2OF7A 2UXCT 4G12A 2XY8B 5K7ZA 3PUYF 3K3OA 2PTFA 3UFEA 2QA7A 2OLTA 2JQ9A 4KBMB 3SFIA 3LHQA 2KT9A 3BNIA 5DJQC 1SUMB 3ON2A 4HGAA 1HG2A 2SPCA 3UFGA 4NUVA 3EUHA 2LT3A 2WDQA 4D7MA 3B57A 4X1EA 5AQSB 4U3CA 2VL0A 3PPBA 3BR0A 1CUNA 2B76A 3AAEB 3B5MA 2UUBT 1IBMT 3CKDA 3Q5XA 1XMOT 3PUWF 3ZQIA 4N78D 3C4XA 2VVSA 1FIOA 4KHPT 3QOFA 3I0OA 4DV4T 4JI0T 3RQWA 4OD4A 3JCFA 2XGEA 5FXWA 3F57A 4DR2T 3CK6A 3Q9DA 5JDQA 3WAKA 4QH5A 3ZMTB 2R7OA 4MLKA 5CA0E 3C50A 4BA9A 2KXPB 3AQTA 2VKHA 4HKAA 4OHFA 3K3NA 2G0EA 2BG9C 4YHHT 2UXPA 1FMVA 4BAYB 2E9XC 2F4VT 3FBZA 3B13A 4LFBT 2NOXA 4MXMA 3M3ZB 4HE8A 2EH3A 2CXDA 3CDLA 3JAEA 4M3FA 4U2YA 1YKHB 2X0HA 2YDQA 2X66A 3AE5A 1VRBA 1ORKA 2BKPA 3OBVE 4PJJA 2VL8A 4O4IE 4X62T 3BTLA 4ILAA 2UXIA 5HYAA 3FK7A 3VU7H 4GOUA 2Y31A 4UDSA 3KYLA 4PAGA 3G06A 3DJBA 2XGDA 5KDMC 5J1RA 2JRKA 2N1GA 4H9RC 5CA1E 5IPAA 3NRGA 4NXMT 2JJ7A 3VVZA 5D18A 3UUNA 2CHOA 2DG7A 2EHOC 4IDPA 2W53A 4HFCA 4X20E 3HKCE 4O4LE 3AA7B 4GYRA 2LSIA 3KINB 1J5WA 2FBWA 2ZB9A 4TNVA 3ON4A 5AQMB 5FL1A 5HXSA 5ABGA 5J1UA 3ZJ2A 4AC0A 2CE7A 2WMOA 3RPUA 4HWFA 2X9DA 3ZMUB 1IBKT 1JNZA 2VQET 1IJ6A 1UX4A 2WV1A 4UVAB 1LVFA 5LXTE 2X9XA 3AVSA 4L9IA 5FNVE 4XAXB 1ZK8A 5DABA 2QWTA 5AQIB 1IAPA 4ERRA 2XAQB 1RPWA 1OEDB 2R7UA 2CLYB 1BR0A 2RAEA 3VR8A 4JI6T 1JT0A 4TNWA 5JDHA 2VASA 3C98B 4AQFC 1UI5A 3HTHA 4HN9A 3JADA 3RC3A 3ZMVB 2ES0A 4V1Av 2YK0A 5FKOA 2R7XA 1ZHCA 2W63A 3PU3A 2BDEA 1D0XA 4QKNA 4MHCA 3NZQA 3VRAA 3EAMA 1HCIA 5ABHA 4X66T 2IAIA 4UF0A 5AQKB 5H9TA 1S94A 3PUAA 5JDLA 1BJZA 5LMUT 3T1HT 2BVLA 4GKKT 4EXTA 3HGGA 2K24A 3MNLA 2XDNA 4O4HE 3ANWB 1YD8G 3P9TA 2XSAA 1WYBA 2FJAA 4IDQA 3DCFA 2WBLA 2E9XD 4F8HA 4GFKA 3G56A 5LJNA 5HXHA 2VB6A 2X67A 4LF9T 4CN4A 4QWNB 1D0YA 2LRLA 3MVPA 3DPJA 1UK5A 2G7SA 3BRUA 3CWRA 4IE4A 4JI8T 3AE3A 3OYXA 3LK42 1H7CA 2WZHA 2H7VC 2HQ5A 3VVXA 2N9DA 1JT6A 3UU6A 3VW1A 4FJOA 5DQWA 5LG3A 3HKBE 3LOCA 4ZZBA 1N32T 4U31A 1U4QA 3PUVF 5KX5E 4EIWA 2OPTA 3X1DA 2NX4A 4DUZT 3V5SA 1US7B 3NS4A 4HFHA 3UU4A 1MMGA 2XQ5A 3BHQA 2EHOD 3A8YC 4WYVA 4GCKA 2A2FX 3OJAA 3RKGA 3AE1A 1QVTA 2LHNA 4P09A 2EHOA 2H3RA 4YTNA 3GMIA 3EDVA 2XQ7A 1VOMA 2NTYA 5LHGB 2WDRA 3FRQA 3PM1A 5L3GB 2XGCA 5IOZA 3MK7C 3UUBA 2A72A 1BR2A 4QH4A 5FKNA 1E2AA 4DMWA 2CPTA 5JRCA 3BTIA 2Q9QA 1Y64B 2MYSA 3AXJA 4JEUB 3F2EA 2JQHA 1VCTA 4UEMA 2XPKA 5AQOB 1D0ZA 3N9OA 4YTPA 3JSJA 2ZCMA 2K3WA 2IBDA 1HS7A 2XHEB 2YVEA 3BR3A 2YDRA 4DR4T 5F27A 1J1JA 1M7KA 2I59A 3BR2A 3KV4A 1T98A 3T1YT 3ANPA 5JH7E 2FJDA 4F6RC 3E22E 2HH7A 4V2GA 4NELA 2WCAA 4GCLA 1W0BA 4NIQA 3HA4A 5AQVB 4XZCA 5HAXA 2TRTA 4O2AE 2LOSA 3LDQB 2JMKA 2WU5A 3SDGA 2IU5A 4B1RA 2PBXA 3HTAA 2ID3A 4EYYR 1Z0PA 2ZMAA 5JR9A 5F3JA 5CXGA 2MTQA 5LGUB 3VRBA 1BR1A 2XPWA 4YSXA 3ZYMA 1WYCA 2XAJB 3Q0UA 2QRXA 3CRJA 3HGYA 4PW8A 2Y30A 2N2NA 2IAKA 4A56A 4H63V 2CM0A 4LFAT 5HCMA 4EAHA 3RYCE 1ZEEA 3BQLA 4EEDA 2KSRA 3ZC0A 2K9AA 1S35A 2WY2A 4ZS2A 2PJQA 3BR5A 3AEEA 2YU1A 4YSYA 3F0CA 3WHBA 2LSGA 5C2TA 1IBLT 4JYAT 1QSDA 4B6XA 3QBMA 3GZIA 4QHOA 3PE0A 1MIWA 2VQFT 3ZMSB 3UU3A 3COLA 2DI4A 1NENA 2KWIB 5F08A 5GPCA 2LJLA 1HNXT 5FXVA 1AJ3A 3LSPA 5LCYA 4CZZB 4DV6T 5FVKA 1JTXA 3VW0A 3BK9A 2R7VA 4GK0E 1ZOYA 2WP9A 2REKA 5FKMA 3T6NA 2UXHA 2FJEA 1I94T 3D0TA 5FY0A 3AQSA 2V7KA 4JI4T 1FJGT 2J4GA 2V7IA 2V7JA 3B6AA 3C4WA 4H9PC 3UQ7A 4ZOLE 3MJXA 5LG4A 4DBQA 4GYSA 3BQZA 3CX8B 3ZCJA 2VKDA 4H9OC 2J62A 4DVYP 4DV2T 5JDMA 2VKVA 2CMRA 2WSSV 4TWFA 3UT5E 3AB3B 2FD5A 4O4JE 3NRXA 5HEUA 2LM9A 4ZI2C 2W2UA 2XQ3A 3AEBA 4DUYT 1V9DA 3ZCIA 4IE7A 4E7ZA 4QXHB 4B3RT 4C90A 2D0UA 4HTEA 2P9BA 3AEFA 5L3FB 2W61A 2YOEA 1SA0E 2O7TA 4JV5T 3KFWX 4B3MT 2JMHA 3KNWA 2HXOA 3VW2A 3HKEE 3TP3A 5LYJE 3RIUA 4A97A 4EYUA 1I6ZA 3ESLA 2WB5A 3ETUA 2DL1A 3MACA 5C8YE 1M62A 2ZM6T 1G8XA 5TAOA 3NZPA 4W97A 2LKGA 4UV9B 4NN1A 1LRZA 2DTZA 2VPRA 2LSYA 4DR1T 3KBTA 2V5DA 3Q0VA 2C5KT 2CHNA 5J2UE 4IHJE 4EEBA 4C91A 4YT0A 3MXZA 2XSBA 2KNDA 3VP5A 2I10A 3U3IA 3G1LA 4OX9T 1FMWA 3Q0WA 4ZZCA 4EGWA 2D2SA 4ILUA 4EZ4A 2NP3A 2FQ4A 4IT4A 1X9BA 2K48A 2D0TA 4L5GA 3ZEFB 3BR1A 2CXLA 1YW0A 3PJAJ 3RQUA 4DR7T 1MNEA 4BJNA 5F5WA 3ZSTA 2MPKA 4AC6A 4CN6A 4YHJA 4ZHQE 3IHRA 4HFEA 4QX8B 4LMLA 4ABZA 4UVBB 4CXXA 4P0BA 1CHUA 1ZKGA 2W00A 3CPZA 4OD5A 3G7RA 3N9MA 4AQYT 1ZKEA 3AEDA 3ZQFA 2XZEA 2QGSA 3Q3SA 4YJ3E 4M3GA 1XDPA 1QUUA 2BKNA 5CFBA 2R7SA 5C3JA 1OEDC 4XK4A 3OTOT 1J5ET 2CLYC 3EVYA 5AQRB 1MNDA 5K58A 2KWHA 3SS1A 4DVDA 3GWHA 3NI7A 5AQQB 4IGUA 4LF8T 2HN2A 2LM2A 5CW8A 3H3MA 3ZC1A 5KXJA 2D6YA 2JQQA 4E7SA 4EOZB 5GPAA 4OFZA 5FP3A 3LK2B 2GK9A 2NR4A 1FEWA 5HXCA 3PASA 3AA1B 5DQVA 4PJNA 5IP6A 5FL0A 2BG9E 3ZN0B 2NS8A 3AVRA 1GQEA 2UUAT 2PFVA 3SFEA 2XQ6A 3IH2A 2H89A 3CCYA 3LWJA 5A1LA 3RIFA 2XTLA 4UF0B 3QK6A 2C0SA 4ZI3C 2LEHA 2XRLA 2B3WA 3VPRA 3QPLA 3U78A 2NWBA 1HNZT 2VK9A 4CN1A 4IDOA 4ZI2D 3RC8A 4HWIB 1SGMA 4JNNA 5CJ5A 5FMPA 4AIUA 3PV0F 4ANJA 3CX6B 5D1RA 4CI3B 3ETVA 3RIAA 2GFNA 5LB7B 4ADZA 3GN5A 2WAUA 4X1IE 3VOXA 4JI3T 3IF8B 3P4WA 2KLQA 1HX1B 4I6ZA 3L3PA 1UI6A 3TP0A 3TLWA 5IHYA 1XNQT 3WAJA 3WI3A 4B3ST 3LSRA 3PUXF 4JI5T 3FXDB 1WRDA 5FHPA 1JUMA 1XZYA 4ISSA 3CQGB 3IH3A 4DV5T 5CQGA 5FY7A 3E0ZA 3UQ4A 1HNWT 4JI7T
chains in the Genus database with same CATH topology
2MYSA 3PU8A 4JEUB 2DWKA 2NW9A 3F2EA 5M4YA 3DU6A 4UEMA 2OA5A 1D0ZA 2X51A 5H6RB 4O2BE 3N9OA 3MZKB 4MFRA 3PUQA 1O3XA 5L3DB 3UUMA 4AKLA 1HS7A 4X1YE 2XHEB 4CXWA 3LBXB 4JUYA 3BQKA 1G73A 4P0AA 2V7MA 2CXFA 3N5LA 4QX7B 2I59A 3GN5B 3KV4A 2ACXA 1T98A 2D5UA 2VKJA 3IBPA 3JC6D 5JH7E 3A5XA 4F6RC 4X1KE 1B7TA 3E22E 2HH7A 1X79A 3V5UA 4AKHA 2VWAA 4UELA 2X9YA 3QC9A 4IDZA 4MBQA 4CXYA 3CX7B 1Y64B 4O8SA 3HA4A 3K3QC 4I50E 4XZCA 2R7TA 3SWHA 5HAXA 4O2AE 2MOZA 2CWYA 2X68A 2W62A 2XAHB 2LOSA 1KK7A 2JMKA 4UV8B 5LBQB 4JEHB 2E9XA 1MMDA 5H6QB 4EYYR 4XBFB 1Z0PA 3AAAB 3MKDA 3N9QA 5LNKA 2WMNA 2ZMAA 5JR9A 1BR4A 2CEAA 4GIWA 5JRCB 4KMCA 5JDFA 2Q9QB 5F3JA 3K8PC 2MTQA 4EZHA 5LGUB 3HR0A 1IZNB 4OK0A 4C2MA 1BR1A 4OYKA 4Z8XA 4BJMA 3ZYMA 2DCFA 2J1DG 2YU2A 1WYCA 2XAJB 2KINB 5LJMA 3I1AA 3LFMA 3KVAA 3RYIE 5EK2A 3K3OA 5HXRA 4PW8A 3LG7A 4IIJE 3UFEA 2QA7A 4CI1B 3PDYA 4KP3C 5J2TE 2N2NA 2IAKA 4KBMB 4A56A 4H63V 3SRZA 2CM0A 2KT9A 4WBNE 5DJQC 1HF8A 4EAHA 2E8IA 4HGAA 1HG2A 3RYCE 2SPCA 5EK3A 4NUVA 4CQIA 3EUHA 3O4XE 4ZS3A 5JVDE 1ZEEA 2LT3A 3BQLA 3B57A 3VKGA 4OYJA 3ZC0A 1CUNA 2K9AA 2CA5A 1S35A 1SHZC 3AAEB 3ONXA 4DNDA 4ZS2A 3CKDA 2PJQA 2Q9QC 3Q5XA 3HKDE 2UXNB 2YU1A 4N78D 1LVKA 3C4XA 3CQCB 1FIOA 3J7Yq 2ZM8A 2M67A 4PK4A 4L0RA 3I0OA 2LSGA 3O1JA 3S4UA 2E9XB 2R7QA 4OD4A 5LA6E 1QSDA 4U72A 5FXWA 3F57A 4B6XA 3Q9DA 5JDQA 3WAKA 5JR9B 3ZMTB 2XAFB 1NAFA 2R7OA 3E08A 4QHOA 4AKGA 3UUXB 3PE0A 5JQGE 1MIWA 3KBUA 2ODUA 3ZMSB 3MA9A 4U74A 2DI4A 4MLKA 4ZI3D 5CA0E 2KWIB 3C50A 4BA9A 1D1BA 2KXPB 3H37A 4CI2B 2LJLA 2VKHA 2Y8DA 3C4ZA 2PG8A 3N9NA 4HKAA 3RYFE 5FXVA 4AQGA 4OHFA 1AJ3A 3K3NA 5FY1A 5LCYA 4WW0A 4CZZB 2DHRA 4PJLA 3PUGA 3BK9A 2R7VA 4GK0E 3DU5A 3N9LA 4PK5A 4PFPA 2NW8A 4H9QC 3O9XA 1FMVA 4BAYB 2E9XC 5LP6E 3D0TA 3FBZA 3B13A 5LGTB 5FY0A 5JR9C 2V7KA 4TN7B 2NOXA 2V7LA 3KV5A 5LHHB 1EZ3A 4YFSA 3RRWA 2V7IA 1D1CA 4HE8A 2V7JA 2CXDA 3C4WA 4H9PC 1YKHB 3I9WA 2X66A 4ZOLE 1MIVA 5ETWA 3MJXA 1VRBA 3NRYA 2EHOB 5LG4A 4DBQA 5GONE 4GYSA 3CX8B 3OBVE 4PJJA 3ZCJA 2VL8A 2VKDA 4H9OC 4O4IE 4DVYP 1YKEB 3C64A 3I0QA 5JDMA 2KZ7B 4AQFA 2CMRA 2IC6A 2WSSV 5LBMA 1WR6A 5EK4A 5HYAA 3VU7H 3UT5E 3AB3B 4GOUA 4O4JE 1NWMX 2X9HA 3KV6A 3NRXA 2X0LB 2A3DA 2LM9A 3OKQA 3KYLA 3PTRB 4K0UA 1MMNA 4PAGA 4ZI2C 5JDNA 3DJBA 2ZM2A 4PNIA 3RX6A 1E1HB 1V9DA 3ZCIA 5KDMC 4IE7A 5F8PA 4E7ZA 4QXHB 2XUEA 2JRKA 2W0GA 2NP9A 2MBGA 4C90A 2N1GA 4H9RC 2D0UA 5CA1E 3UTKA 2V26A 3O1HA 4HTEA 2P9BA 4DBRA 4IRVA 3AAIA 4QXBB 5L3FB 2ZM0A 2W61A 3AA6B 2UXXB 1SA0E 1OWAA 3CQXC 3UUNA 3RRCA 3KFWX 3QUJA 1HFAA 2EHOC 2JMHA 2B1EA 3KDSE 2G0UA 3IEEA 3C51A 4X20E 3HKEE 3HKCE 5LYJE 3N2OA 4O4LE 4H63H 4EYUA 3AA7B 2C5JA 3ESLA 4GYRA 4PK6A 3ETUA 2LSIA 3FHNA 2IC9A 3KINB 3TKLB 5EZYE 2CCQA 3MACA 5C8YE 5L3EB 1G8XA 3FXEB 2XASB 5TAOA 5HXSA 3NZPA 4UV9B 1HTJF 5L3CB 4UXNB 1LRZA 2BVMA 3ZJ2A 4IE0A 4I43B 2CWOA 2LSYA 2CE7A 3FBLA 3KBTA 2WMOA 3RPUA 3ZMUB 4I55E 2YINA 2C5KT 5J2UE 4IHJE 3T8OA 2LSKA 1IJ6A 2R7WA 1UX4A 4UVCB 1HG5A 4C91A 4UVAB 3MXZA 4H9NC 3Q2MA 1LVFA 3RKOA 2KNDA 5LXTE 2X9XA 3AVSA 4ZI7E 4L9IA 3U3IA 1U5PA 2DWGA 5FNVE 4XAXB 1FMWA 3FB2A 3N2KE 4KUMB 3L09A 5DABA 3VHLA 1IAPA 3J9X1 2XAQB 2D2SA 4ERRA 3O1IA 2ODVA 4ILUA 4EZ4A 4YJ2E 3JC6C 1MMAA 4TX5A 2K48A 4TV9E 2R7UA 2D0TA 2RP4A 4L5GA 3ANWA 5KMGP 2CLYB 1BR0A 3ZEFB 3ZYLA 2JPFA 2CXLA 1YW0A 4IE5A 5BMVE 1LKXA 4JLEA 1MNEA 2VASA 3C98B 3HI2A 5FXXA 4AQFC 4BJNA 4AXPA 5JDHA 4ASKA 4GK5E 3NBXX 4HN9A 4YHJA 4YLHA 4ZHQE 3IHRA 2L9QA 3RC3A 3ZMVB 2ES0A 2Q9QD 5L3BB 4V1Av 4IE6A 2ZLYA 2YK0A 3LJCA 2R7XA 1ZHCA 4QX8B 3RYHE 2W63A 2LHRA 3PU3A 2BDEA 3VTIA 4UVBB 4CXXA 4AI6A 4P0BA 2LSJA 2W00A 3CPZA 4OD5A 3M65A 3N9MA 4TV8E 4TUYE 1ZKEA 1D0XA 2KMFA 3PUSA 4QKNA 4MHCA 2QGSA 4WNKA 4YJ3E 3NZQA 1HCIA 3N2GE 1QUUA 3W15B 2YEVC 4NUUA 4PJMA 2R7SA 4QXCB 5HXEA 4UF0A 3DTOA 1IJ5A 2NTXA 2V1DB 2CLYC 1S94A 3EVYA 5E0OA 1MIYA 1MNDA 2BZBA 3P7IA 3PUAA 2KWHA 3SS1A 4I4TE 4DVDA 3GWHA 3OYZA 3SOLA 5JDLA 1KNZA 2BVLA 3HL6A 1HX8A 4AKRB 4H9SE 4EXTA 1UX5A 4IGUA 2HPJA 2K24A 2DNXA 2HPLA 2LOPA 3ZC1A 4WBOA 2Z6EA 3BQIA 4O4HE 3ANWB 4J2CA 4PFOA 5LOVE 1YD8G 3CVRA 5LGNB 1WYBA 3CWZB 5LHIB 2H7OA 2JQQA 4E7SA 4EOZB 2WBLA 2E9XD 2Y48B 2XQYA 3R6NA 5LJNA 3ZPOA 3Q5WA 5HXHA 2VB6A 2X67A 4OFZA 5FP3A 1UCUA 3LK2B 2DLRA 2GK9A 4QWNB 1FEWA 1D0YA 3ZLIA 5HXCA 4DMVA 4HEAA 3AA1B 4G2AA 5DQVA 2IW5B 4PJNA 4G63A 3ZN0B 3I9YA 3AVRA 2PBIA 3F31A 5FMNA 2WWUA 3ZN1B 2VKOA 4IE4A 2PFVA 3OYXA 4TZ4C 1WLXA 2JJ9A 3ZJ1A 3LK42 2LE8A 3UULA 1H7CA 4EB6E 2H7VC 5FXZA 4HFVA 5A1LA 2N9DA 2X9WA 2XTLA 4FJOA 5DQWA 3GA8A 2RA1A 4UF0B 3QK6A 2C0SA 3HKBE 3LK3B 2LEHA 2C5IT 4ZI3C 1D1AA 2B3WA 3U78A 5AFUL 2NWBA 1U4QA 4AKIA 5KX5E 2VK9A 4ZI2D 3RC8A 4EIWA 3PURA 3RH3A 3VKHA 5HWXA 4ISTA 3KVBA 4MALA 2K5BB 3ZMZB 4M1PA 4ANJA 5CB4E 3CX6B 3LBXA 5JDGA 3V5SA 1US7B 3NS4A 4CI3B 3EDUA 3ETVA 3H3AA 1ZV4X 4ADZA 1MMGA 5ADXL 3GN5A 2WAUA 4X1IE 3IF8B 2XAGB 2EHOD 2KLQA 2FJI1 3P8CD 2A2FX 3N9PA 3OJAA 3L3PA 1OXZA 2LHNA 4P09A 2EHOA 4UIGA 4FI5A 5IHYA 2H3RA 3WAJA 3WI3A 5JRCA 3AA0B 2WM9A 3EDVA 2Y6XA 3GMIA 3R84B 5HWYA 5JREA 1VOMA 4DO0A 2NTYA 5LHGB 3FXDB 3KV9A 5L3GB 2L3LA 1WRDA 2L8KA 2NW7A 3MK7C 4ISSA 2A72A 1BR2A 3CQGB 5CQGA 5FY7A 5J1GA 5FYMA 3E0ZA 5L2LA 3DP7A 5IYZE 4DMWA 2R7RA 2Q9QA 3ZYKA 3CMLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FHN A;  2A2F X; 
#chains in the Genus database with same CATH topology
 2XM2 A;  3G1M A;  5M4Y A;  1KNR A;  2OA5 A;  1VI0 A;  2W66 A;  1Z0X A;  4HKU A;  4ILC A;  3MZK B;  4MFR A;  5L3D B;  4LF5 T;  4AKL A;  2ZCN A;  4JUY A;  3BQK A;  5AQJ B;  5D19 A;  4JKZ A;  2QIB A;  2CXF A;  4W1U A;  2BKO A;  4IRE A;  3JAF A;  3A5X A;  1X79 A;  2VWA A;  4UEL A;  2XPU A;  4IL9 A;  4X64 T;  3QC9 A;  4IDZ A;  3PUZ F;  3CX7 B;  2R7T A;  3UU8 A;  2RHA A;  2MOZ A;  4NPP A;  2X68 A;  2IUB A;  2BG9 A;  2IIU A;  2BS2 A;  2V6X A;  4JL3 A;  2XQ4 A;  4JEH B;  3BR6 A;  2F07 A;  2E9X A;  3ZQG A;  3MKD A;  3N9Q A;  4UR9 A;  4DV7 T;  5DAJ A;  2WMN A;  2CEA A;  5JRC B;  4KMC A;  5JDF A;  2Q9Q B;  2V57 A;  5AQP B;  3AXJ B;  5HEO A;  3VUQ A;  3HR0 A;  1IZN B;  2TCT A;  3ONL C;  4OK0 A;  2QOP A;  4C2M A;  4KHZ F;  4Z8X A;  4BJM A;  5AQU B;  2J1D G;  2E5L T;  5LJM A;  3AEA A;  3I1A A;  3LFM A;  3LG7 A;  4CI1 B;  2IHR 1;  5BR8 T;  5J2T E;  4WIB A;  4L62 A;  1HF8 A;  1KEY A;  4LFC T;  3QB5 A;  2E8I A;  4DV0 T;  5EK3 A;  1KNP A;  4CQI A;  4ZS3 A;  1T7S A;  3UU5 A;  3RH2 A;  3VKG A;  1XNR T;  2CA5 A;  1SHZ C;  3ONX A;  2XQ9 A;  3ZQL A;  3HKD E;  3IUV A;  3CQC B;  4U9L A;  5J0Z A;  2M67 A;  4PK4 A;  4L0R A;  3O1J A;  3S4U A;  2R7Q A;  4U72 A;  5EFY A;  4YY3 T;  5J3L A;  2IDO B;  2M6B A;  4AF5 A;  5JR9 B;  4HFI A;  2PZ9 A;  1NAF A;  4AKG A;  5FKL A;  4GFL A;  3KBU A;  3TLS A;  2ODU A;  3MA9 A;  2ACZ A;  4COF A;  2DG8 A;  3ZSS A;  4ZI3 D;  1D1B A;  3H37 A;  4CI2 B;  3N9N A;  2PG8 A;  3RYF E;  4AQG A;  4D5F A;  3OPC A;  5FY1 A;  4WW0 A;  2DHR A;  1YQ3 A;  4PJL A;  3PUG A;  4ZEY A;  2WZI A;  2XB5 A;  3DU5 A;  4PK5 A;  1T33 A;  3O8H A;  2NP5 A;  4U7Y A;  3IA3 A;  3FZH B;  2WGB A;  2V6Y B;  3AE8 A;  5LGT B;  5FVL A;  2UUC T;  3AEG A;  4TN7 B;  3KV5 A;  3QNU A;  4YFS A;  2QVA A;  4X65 T;  4LF4 T;  3NWI A;  5AQF B;  1MIV A;  3NRY A;  2HKU A;  2WS3 A;  3ABV A;  2GEN A;  2YKS A;  2RAS A;  3FZK B;  4P1N A;  1YKE B;  1Z77 A;  3I0Q A;  4KWA A;  4AQF A;  5LBM A;  5EK4 A;  2X9H A;  2A3D A;  3VIB A;  1MMN A;  2E5V A;  1DU2 A;  5JDN A;  2ZM2 A;  4PNI A;  3RX6 A;  2MBG A;  2V26 A;  3AEC A;  4QXB B;  1QLB A;  3AAI A;  2ZM0 A;  4X5T A;  3FZL B;  3OVU A;  3RRC A;  3AE6 A;  1ZP0 A;  1HFA A;  1YQ4 A;  5L47 A;  1JUS A;  5FKY A;  2B1E A;  3C51 A;  3N2O A;  3VVY A;  4DID B;  4H63 H;  2FJ1 A;  3FHN A;  2IC9 A;  3TKL B;  1UGO A;  2CCQ A;  2XM1 A;  5L3E B;  3P4S A;  1HTJ F;  4UXN B;  2BVM A;  4IE0 A;  2ID6 A;  2AXD S;  2ZOY A;  4NXN T;  2QCO A;  2YIN A;  4YTM A;  3RLF F;  3BQY A;  2XQA A;  3T8O A;  2LSK A;  3Q5D A;  4H9N C;  3Q2M A;  5HCJ A;  2UXU A;  5ABF A;  1U5P A;  2MAW A;  3FB2 A;  4KUM B;  3N2K E;  4AIS A;  3FIW A;  2IEK A;  3VHL A;  3J9X 1;  2ODV A;  2XJ7 A;  4ME9 A;  3QB5 K;  3JC6 C;  1MMA A;  3NPI A;  2RP4 A;  2HXI A;  2BBJ A;  2O7O A;  3P4R A;  2JPF A;  3ZYL A;  1LKX A;  4JLE A;  3HI2 A;  4Z90 A;  2VVN A;  2E2A A;  4GK5 E;  5FGL A;  4U7I A;  3EGQ A;  4YLH A;  3HIM A;  4IE6 A;  2ZLY A;  5IOY A;  3LJC A;  3SFD A;  3RYH E;  3EUP A;  3VTI A;  3M65 A;  5HEH A;  2KMF A;  3PUS A;  2LKH A;  4IDN A;  4Q25 A;  2YEV C;  4PJM A;  2LRK A;  4QXC B;  5HXE A;  1IJ5 A;  2NTX A;  2V1D B;  3RF1 A;  2BZB A;  3P7I A;  4I4T E;  4JI2 T;  3OYZ A;  3SOL A;  3HL6 A;  4AKR B;  1UX5 A;  3L8R A;  3BQI A;  3TLU A;  5LOV E;  4PFO A;  5LHI B;  3WHC A;  5F0F A;  2XQY A;  3R6N A;  2I6H A;  1UCU A;  2DLR A;  5LMN T;  1U9N A;  3ZLI A;  2IW5 B;  4G63 A;  3LJL A;  2PBI A;  3F31 A;  3TLV A;  2WWU A;  1JNR A;  5F04 A;  1WLX A;  3ZJ1 A;  3UUL A;  2LE8 A;  3QPS A;  4EB6 E;  3FZM B;  5FXZ A;  1JTY A;  5J1Y A;  2X9W A;  3GA8 A;  2RA1 A;  1WR0 A;  4D5C A;  1D1A A;  3BJB A;  4AKI A;  3QKX A;  2WQY A;  3RGL A;  5AQT B;  4IST A;  4MAL A;  5JDG A;  3LBX A;  4EV6 A;  2BBH A;  3EDU A;  3BT9 A;  5ADX L;  3LSJ A;  4A98 A;  3PJA A;  3G1O A;  3HE0 A;  3P8C D;  5HEJ A;  1OXZ A;  1U9O A;  3KZ9 A;  4UIG A;  1NEK A;  2GBY A;  3B81 A;  2Y6X A;  5ABE A;  3R84 B;  4DO0 A;  2V8S V;  2L3L A;  4I0U A;  5AQC A;  3ZT7 A;  5FKK A;  5FYM A;  5L2L A;  3DEW A;  2R7R A;  4OYK A;  3ZYK A;  3CML A;  4LF6 T;  3PU8 A;  4ILB A;  2DWK A;  3AE4 A;  2X51 A;  5H6R B;  3EHZ A;  4KX6 A;  3UUM A;  2LLY A;  4X1Y E;  4CXW A;  4P0A A;  3ZT6 A;  3O8G A;  2A9U A;  2CBI A;  4QX7 B;  3GN5 B;  5L4H A;  2D5U A;  3IBP A;  3JC6 D;  1Z8U A;  4X1K E;  1B7T A;  3V5U A;  2HYJ A;  2JK3 A;  4U2Z A;  4MBQ A;  4V2F A;  4CXY A;  5EYR A;  3CIR A;  3BCG A;  3O60 A;  3HTJ A;  3SWH A;  4B3A A;  4QH1 A;  2W62 A;  2FUP A;  1RKT A;  4UV8 B;  2G3B A;  5LBQ B;  4I76 A;  4XBF B;  3AAA B;  4LMK A;  5LNK A;  4YZE A;  2HYT A;  3K8P C;  2H88 A;  2DCF A;  2YU2 A;  4HWC A;  1T56 A;  2KIN B;  3C2B A;  3KVA A;  4D7N A;  3RYI E;  5EK2 A;  5HXR A;  4IIJ E;  5HBU A;  3PDY A;  4KP3 C;  5L4E A;  2UXD T;  3K1S A;  3SRZ A;  4WBN E;  2ZCX A;  2QKO A;  1OED E;  3O4X E;  5JVD E;  4OYJ A;  1UUR A;  4DND A;  2Q9Q C;  2OV9 A;  2UXN B;  1LVK A;  2BG9 B;  3ZT5 A;  3J7Y q;  2ZM8 A;  1XDO A;  2E9X B;  5LA6 E;  4LF7 T;  3BTC A;  4DW6 A;  2D9D A;  2XAF B;  3E08 A;  4B3T T;  2BS3 A;  3UUX B;  5JQG E;  4CGR A;  5F1J A;  4U74 A;  2Q24 A;  3C4Z A;  2Y8D A;  3RI5 A;  3FK6 A;  3P50 A;  3P4P A;  2Y2Z A;  3N9L A;  4PFP A;  2NW8 A;  4H9Q C;  3O9X A;  1T72 A;  5LP6 E;  2YVH A;  5JR9 C;  3RHW A;  2V7L A;  4U33 A;  5LHH B;  1EZ3 A;  3RRW A;  1D1C A;  2OI8 A;  4HFD A;  5AQL B;  4AUX A;  3I9W A;  3ANG A;  5ETW A;  2EHO B;  5GON E;  3C64 A;  2KZ7 B;  5AQH B;  3QQA A;  2IC6 A;  1WR6 A;  2R6G F;  2UXO A;  2ZOZ A;  1NWM X;  3KV6 A;  4YXD A;  2W67 A;  2X0L B;  3OKQ A;  3PTR B;  4M3B A;  4K0U A;  3EAB A;  3V78 A;  1E1H B;  5F8P A;  5F0C A;  2VUR A;  3C07 A;  2XUE A;  2W0G A;  2NP9 A;  2W4X A;  3UTK A;  3O1H A;  4DBR A;  4IRV A;  5GP9 A;  1KF6 A;  4A5X A;  3AA6 B;  2UXX B;  3TLT A;  1OWA A;  3CQX C;  3AE7 A;  5EZH A;  1WFD A;  3QUJ A;  1OED A;  2QYW A;  4ICH A;  2UXB T;  3KDS E;  5C4Y A;  2FBQ A;  2G0U A;  3IEE A;  1WCR A;  2C5J A;  4PK6 A;  5EZY E;  3EI0 A;  2YVX A;  3FXE B;  4ZXL A;  2XAS B;  2VKE A;  5L3C B;  2WDV A;  4I43 B;  1T8B A;  2CWO A;  2FX0 A;  3FBL A;  5EZG A;  4I55 E;  2M6I A;  2G7G A;  5IUX A;  3NKZ A;  1XWM A;  2JQK A;  4TWH A;  2R7W A;  4UVC B;  1W0A A;  1HG5 A;  1YXR A;  3ONJ A;  3RKO A;  4ZI7 E;  2DWG A;  4DV1 T;  2I0M A;  3V6G A;  3L09 A;  4TWD A;  2GUH A;  4GKJ T;  2BS4 A;  3O1I A;  4YJ2 E;  4TX5 A;  4TV9 E;  3ANW A;  5KMG P;  4IE5 A;  5BMV E;  4MO7 A;  5FXX A;  4MK6 A;  4AXP A;  4ASK A;  3NBX X;  2QTQ A;  3HTI A;  2L9Q A;  2Q9Q D;  5L3B B;  1Y01 A;  2LHR A;  2UU9 T;  4AI6 A;  2LSJ A;  4TUY E;  4TV8 E;  3Q5E A;  3IH4 A;  4YSZ A;  4WNK A;  3W15 B;  3N2G E;  4NUU A;  3VR9 A;  3KKC A;  3DTO A;  4DR3 T;  2ZY9 A;  5CXI A;  2X0Y A;  5E0O A;  1MIY A;  5ABF B;  3RIU C;  4LMJ A;  5AQN B;  2FJB A;  1KNZ A;  1HX8 A;  4M3D A;  4H9S E;  3LSV A;  4HWD A;  4K0K T;  2HPJ A;  2DNX A;  2HPL A;  2LOP A;  4WBO A;  2Z6E A;  4J2C A;  3CVR A;  5LGN B;  2XQ8 A;  3CJD A;  3CWZ B;  2H7O A;  1N34 T;  1JUP A;  3E7Q A;  2Y48 B;  3ZPO A;  2J47 A;  3Q5W A;  2WU2 A;  1R8I A;  3FZF B;  4JBW F;  4DMV A;  4HEA A;  2V5C A;  4G2A A;  2YN6 A;  4Z91 A;  3I9Y A;  1N36 T;  5FMN A;  3ZN1 B;  2VKO A;  2HHH T;  2CRB A;  4TZ4 C;  2JJ9 A;  4HFV A;  2WWV A;  2IML A;  3L39 A;  5K7H A;  3AE2 A;  3LK3 B;  2C5I T;  4HWH A;  5CGM A;  1VCS A;  5AFU L;  3B6C A;  3P4Q A;  3PUR A;  3RH3 A;  4WZX A;  4DR6 T;  5HSZ A;  4PXI A;  3AE9 A;  5HWX A;  3VKH A;  2AE9 A;  3KVB A;  1KFY A;  2K5B B;  3ZMZ B;  4M1P A;  5CB4 E;  2V6Y A;  5AQG B;  1QPI A;  5K7F A;  2CBJ A;  1HR0 T;  3H3A A;  2JIW A;  1ZV4 X;  2WUI A;  1RKW A;  2XAG B;  1W9R A;  4HFB A;  2FJI 1;  5JTG A;  1W09 A;  3N9P A;  3F1B A;  3NVO A;  3ZKR A;  2OER A;  4FI5 A;  2XPV A;  3AA0 B;  2WM9 A;  4DV3 T;  1UUS A;  2X6O A;  5HWY A;  5JRE A;  3NXC A;  1QVU A;  4JI1 T;  3KV9 A;  2L8K A;  2NW7 A;  3A7M A;  5HAW A;  5J1G A;  4U9N A;  3DP7 A;  3NNR A;  5IYZ E;  4GCT A;  1L0V A;  2NW9 A;  3S5R A;  3DU6 A;  3RD3 A;  4O2B E;  5IWA T;  3PUQ A;  1O3X A;  2NS7 A;  3LBX B;  1G73 A;  2V7M A;  3N5L A;  3VOK A;  1SE7 A;  2ACX A;  4JYK A;  2VKJ A;  3ZQH A;  2G7L A;  4AKH A;  4IL4 A;  2X9Y A;  4M3E A;  4O8S A;  3K3Q C;  4I50 E;  4DR5 T;  2CWY A;  3BTJ A;  3GEU A;  2XAH B;  3KKD A;  1KK7 A;  1N33 T;  5HEG A;  1A6I A;  4KI0 F;  1MMD A;  5H6Q B;  4ACI A;  1E7P A;  2HN1 A;  1BR4 A;  2RPA A;  4GIW A;  4EZH A;  1XMQ T;  2YDS A;  5F0H A;  2OF7 A;  2UXC T;  4G12 A;  2XY8 B;  5K7Z A;  3PUY F;  3K3O A;  2PTF A;  3UFE A;  2QA7 A;  2OLT A;  2JQ9 A;  4KBM B;  3SFI A;  3LHQ A;  2KT9 A;  3BNI A;  5DJQ C;  1SUM B;  3ON2 A;  4HGA A;  1HG2 A;  2SPC A;  3UFG A;  4NUV A;  3EUH A;  2LT3 A;  2WDQ A;  4D7M A;  3B57 A;  4X1E A;  5AQS B;  4U3C A;  2VL0 A;  3PPB A;  3BR0 A;  1CUN A;  2B76 A;  3AAE B;  3B5M A;  2UUB T;  1IBM T;  3CKD A;  3Q5X A;  1XMO T;  3PUW F;  3ZQI A;  4N78 D;  3C4X A;  2VVS A;  1FIO A;  4KHP T;  3QOF A;  3I0O A;  4DV4 T;  4JI0 T;  3RQW A;  4OD4 A;  3JCF A;  2XGE A;  5FXW A;  3F57 A;  4DR2 T;  3CK6 A;  3Q9D A;  5JDQ A;  3WAK A;  4QH5 A;  3ZMT B;  2R7O A;  4MLK A;  5CA0 E;  3C50 A;  4BA9 A;  2KXP B;  3AQT A;  2VKH A;  4HKA A;  4OHF A;  3K3N A;  2G0E A;  2BG9 C;  4YHH T;  2UXP A;  1FMV A;  4BAY B;  2E9X C;  2F4V T;  3FBZ A;  3B13 A;  4LFB T;  2NOX A;  4MXM A;  3M3Z B;  4HE8 A;  2EH3 A;  2CXD A;  3CDL A;  3JAE A;  4M3F A;  4U2Y A;  1YKH B;  2X0H A;  2YDQ A;  2X66 A;  3AE5 A;  1VRB A;  1ORK A;  2BKP A;  3OBV E;  4PJJ A;  2VL8 A;  4O4I E;  4X62 T;  3BTL A;  4ILA A;  2UXI A;  5HYA A;  3FK7 A;  3VU7 H;  4GOU A;  2Y31 A;  4UDS A;  3KYL A;  4PAG A;  3G06 A;  3DJB A;  2XGD A;  5KDM C;  5J1R A;  2JRK A;  2N1G A;  4H9R C;  5CA1 E;  5IPA A;  3NRG A;  4NXM T;  2JJ7 A;  3VVZ A;  5D18 A;  3UUN A;  2CHO A;  2DG7 A;  2EHO C;  4IDP A;  2W53 A;  4HFC A;  4X20 E;  3HKC E;  4O4L E;  3AA7 B;  4GYR A;  2LSI A;  3KIN B;  1J5W A;  2FBW A;  2ZB9 A;  4TNV A;  3ON4 A;  5AQM B;  5FL1 A;  5HXS A;  5ABG A;  5J1U A;  3ZJ2 A;  4AC0 A;  2CE7 A;  2WMO A;  3RPU A;  4HWF A;  2X9D A;  3ZMU B;  1IBK T;  1JNZ A;  2VQE T;  1IJ6 A;  1UX4 A;  2WV1 A;  4UVA B;  1LVF A;  5LXT E;  2X9X A;  3AVS A;  4L9I A;  5FNV E;  4XAX B;  1ZK8 A;  5DAB A;  2QWT A;  5AQI B;  1IAP A;  4ERR A;  2XAQ B;  1RPW A;  1OED B;  2R7U A;  2CLY B;  1BR0 A;  2RAE A;  3VR8 A;  4JI6 T;  1JT0 A;  4TNW A;  5JDH A;  2VAS A;  3C98 B;  4AQF C;  1UI5 A;  3HTH A;  4HN9 A;  3JAD A;  3RC3 A;  3ZMV B;  2ES0 A;  4V1A v;  2YK0 A;  5FKO A;  2R7X A;  1ZHC A;  2W63 A;  3PU3 A;  2BDE A;  1D0X A;  4QKN A;  4MHC A;  3NZQ A;  3VRA A;  3EAM A;  1HCI A;  5ABH A;  4X66 T;  2IAI A;  4UF0 A;  5AQK B;  5H9T A;  1S94 A;  3PUA A;  5JDL A;  1BJZ A;  5LMU T;  3T1H T;  2BVL A;  4GKK T;  4EXT A;  3HGG A;  2K24 A;  3MNL A;  2XDN A;  4O4H E;  3ANW B;  1YD8 G;  3P9T A;  2XSA A;  1WYB A;  2FJA A;  4IDQ A;  3DCF A;  2WBL A;  2E9X D;  4F8H A;  4GFK A;  3G56 A;  5LJN A;  5HXH A;  2VB6 A;  2X67 A;  4LF9 T;  4CN4 A;  4QWN B;  1D0Y A;  2LRL A;  3MVP A;  3DPJ A;  1UK5 A;  2G7S A;  3BRU A;  3CWR A;  4IE4 A;  4JI8 T;  3AE3 A;  3OYX A;  3LK4 2;  1H7C A;  2WZH A;  2H7V C;  2HQ5 A;  3VVX A;  2N9D A;  1JT6 A;  3UU6 A;  3VW1 A;  4FJO A;  5DQW A;  5LG3 A;  3HKB E;  3LOC A;  4ZZB A;  1N32 T;  4U31 A;  1U4Q A;  3PUV F;  5KX5 E;  4EIW A;  2OPT A;  3X1D A;  2NX4 A;  4DUZ T;  3V5S A;  1US7 B;  3NS4 A;  4HFH A;  3UU4 A;  1MMG A;  2XQ5 A;  3BHQ A;  2EHO D;  3A8Y C;  4WYV A;  4GCK A;  2A2F X;  3OJA A;  3RKG A;  3AE1 A;  1QVT A;  2LHN A;  4P09 A;  2EHO A;  2H3R A;  4YTN A;  3GMI A;  3EDV A;  2XQ7 A;  1VOM A;  2NTY A;  5LHG B;  2WDR A;  3FRQ A;  3PM1 A;  5L3G B;  2XGC A;  5IOZ A;  3MK7 C;  3UUB A;  2A72 A;  1BR2 A;  4QH4 A;  5FKN A;  1E2A A;  4DMW A;  2CPT A;  5JRC A;  3BTI A;  2Q9Q A;  1Y64 B;  2MYS A;  3AXJ A;  4JEU B;  3F2E A;  2JQH A;  1VCT A;  4UEM A;  2XPK A;  5AQO B;  1D0Z A;  3N9O A;  4YTP A;  3JSJ A;  2ZCM A;  2K3W A;  2IBD A;  1HS7 A;  2XHE B;  2YVE A;  3BR3 A;  2YDR A;  4DR4 T;  5F27 A;  1J1J A;  1M7K A;  2I59 A;  3BR2 A;  3KV4 A;  1T98 A;  3T1Y T;  3ANP A;  5JH7 E;  2FJD A;  4F6R C;  3E22 E;  2HH7 A;  4V2G A;  4NEL A;  2WCA A;  4GCL A;  1W0B A;  4NIQ A;  3HA4 A;  5AQV B;  4XZC A;  5HAX A;  2TRT A;  4O2A E;  2LOS A;  3LDQ B;  2JMK A;  2WU5 A;  3SDG A;  2IU5 A;  4B1R A;  2PBX A;  3HTA A;  2ID3 A;  4EYY R;  1Z0P A;  2ZMA A;  5JR9 A;  5F3J A;  5CXG A;  2MTQ A;  5LGU B;  3VRB A;  1BR1 A;  2XPW A;  4YSX A;  3ZYM A;  1WYC A;  2XAJ B;  3Q0U A;  2QRX A;  3CRJ A;  3HGY A;  4PW8 A;  2Y30 A;  2N2N A;  2IAK A;  4A56 A;  4H63 V;  2CM0 A;  4LFA T;  5HCM A;  4EAH A;  3RYC E;  1ZEE A;  3BQL A;  4EED A;  2KSR A;  3ZC0 A;  2K9A A;  1S35 A;  2WY2 A;  4ZS2 A;  2PJQ A;  3BR5 A;  3AEE A;  2YU1 A;  4YSY A;  3F0C A;  3WHB A;  2LSG A;  5C2T A;  1IBL T;  4JYA T;  1QSD A;  4B6X A;  3QBM A;  3GZI A;  4QHO A;  3PE0 A;  1MIW A;  2VQF T;  3ZMS B;  3UU3 A;  3COL A;  2DI4 A;  1NEN A;  2KWI B;  5F08 A;  5GPC A;  2LJL A;  1HNX T;  5FXV A;  1AJ3 A;  3LSP A;  5LCY A;  4CZZ B;  4DV6 T;  5FVK A;  1JTX A;  3VW0 A;  3BK9 A;  2R7V A;  4GK0 E;  1ZOY A;  2WP9 A;  2REK A;  5FKM A;  3T6N A;  2UXH A;  2FJE A;  1I94 T;  3D0T A;  5FY0 A;  3AQS A;  2V7K A;  4JI4 T;  1FJG T;  2J4G A;  2V7I A;  2V7J A;  3B6A A;  3C4W A;  4H9P C;  3UQ7 A;  4ZOL E;  3MJX A;  5LG4 A;  4DBQ A;  4GYS A;  3BQZ A;  3CX8 B;  3ZCJ A;  2VKD A;  4H9O C;  2J62 A;  4DVY P;  4DV2 T;  5JDM A;  2VKV A;  2CMR A;  2WSS V;  4TWF A;  3UT5 E;  3AB3 B;  2FD5 A;  4O4J E;  3NRX A;  5HEU A;  2LM9 A;  4ZI2 C;  2W2U A;  2XQ3 A;  3AEB A;  4DUY T;  1V9D A;  3ZCI A;  4IE7 A;  4E7Z A;  4QXH B;  4B3R T;  4C90 A;  2D0U A;  4HTE A;  2P9B A;  3AEF A;  5L3F B;  2W61 A;  2YOE A;  1SA0 E;  2O7T A;  4JV5 T;  3KFW X;  4B3M T;  2JMH A;  3KNW A;  2HXO A;  3VW2 A;  3HKE E;  3TP3 A;  5LYJ E;  3RIU A;  4A97 A;  4EYU A;  1I6Z A;  3ESL A;  2WB5 A;  3ETU A;  2DL1 A;  3MAC A;  5C8Y E;  1M62 A;  2ZM6 T;  1G8X A;  5TAO A;  3NZP A;  4W97 A;  2LKG A;  4UV9 B;  4NN1 A;  1LRZ A;  2DTZ A;  2VPR A;  2LSY A;  4DR1 T;  3KBT A;  2V5D A;  3Q0V A;  2C5K T;  2CHN A;  5J2U E;  4IHJ E;  4EEB A;  4C91 A;  4YT0 A;  3MXZ A;  2XSB A;  2KND A;  3VP5 A;  2I10 A;  3U3I A;  3G1L A;  4OX9 T;  1FMW A;  3Q0W A;  4ZZC A;  4EGW A;  2D2S A;  4ILU A;  4EZ4 A;  2NP3 A;  2FQ4 A;  4IT4 A;  1X9B A;  2K48 A;  2D0T A;  4L5G A;  3ZEF B;  3BR1 A;  2CXL A;  1YW0 A;  3PJA J;  3RQU A;  4DR7 T;  1MNE A;  4BJN A;  5F5W A;  3ZST A;  2MPK A;  4AC6 A;  4CN6 A;  4YHJ A;  4ZHQ E;  3IHR A;  4HFE A;  4QX8 B;  4LML A;  4ABZ A;  4UVB B;  4CXX A;  4P0B A;  1CHU A;  1ZKG A;  2W00 A;  3CPZ A;  4OD5 A;  3G7R A;  3N9M A;  4AQY T;  1ZKE A;  3AED A;  3ZQF A;  2XZE A;  2QGS A;  3Q3S A;  4YJ3 E;  4M3G A;  1XDP A;  1QUU A;  2BKN A;  5CFB A;  2R7S A;  5C3J A;  1OED C;  4XK4 A;  3OTO T;  1J5E T;  2CLY C;  3EVY A;  5AQR B;  1MND A;  5K58 A;  2KWH A;  3SS1 A;  4DVD A;  3GWH A;  3NI7 A;  5AQQ B;  4IGU A;  4LF8 T;  2HN2 A;  2LM2 A;  5CW8 A;  3H3M A;  3ZC1 A;  5KXJ A;  2D6Y A;  2JQQ A;  4E7S A;  4EOZ B;  5GPA A;  4OFZ A;  5FP3 A;  3LK2 B;  2GK9 A;  2NR4 A;  1FEW A;  5HXC A;  3PAS A;  3AA1 B;  5DQV A;  4PJN A;  5IP6 A;  5FL0 A;  2BG9 E;  3ZN0 B;  2NS8 A;  3AVR A;  1GQE A;  2UUA T;  2PFV A;  3SFE A;  2XQ6 A;  3IH2 A;  2H89 A;  3CCY A;  3LWJ A;  5A1L A;  3RIF A;  2XTL A;  4UF0 B;  3QK6 A;  2C0S A;  4ZI3 C;  2LEH A;  2XRL A;  2B3W A;  3VPR A;  3QPL A;  3U78 A;  2NWB A;  1HNZ T;  2VK9 A;  4CN1 A;  4IDO A;  4ZI2 D;  3RC8 A;  4HWI B;  1SGM A;  4JNN A;  5CJ5 A;  5FMP A;  4AIU A;  3PV0 F;  4ANJ A;  3CX6 B;  5D1R A;  4CI3 B;  3ETV A;  3RIA A;  2GFN A;  5LB7 B;  4ADZ A;  3GN5 A;  2WAU A;  4X1I E;  3VOX A;  4JI3 T;  3IF8 B;  3P4W A;  2KLQ A;  1HX1 B;  4I6Z A;  3L3P A;  1UI6 A;  3TP0 A;  3TLW A;  5IHY A;  1XNQ T;  3WAJ A;  3WI3 A;  4B3S T;  3LSR A;  3PUX F;  4JI5 T;  3FXD B;  1WRD A;  5FHP A;  1JUM A;  1XZY A;  4ISS A;  3CQG B;  3IH3 A;  4DV5 T;  5CQG A;  5FY7 A;  3E0Z A;  3UQ4 A;  1HNW T;  4JI7 T; 
#chains in the Genus database with same CATH homology
 2MYS A;  3PU8 A;  4JEU B;  2DWK A;  2NW9 A;  3F2E A;  5M4Y A;  3DU6 A;  4UEM A;  2OA5 A;  1D0Z A;  2X51 A;  5H6R B;  4O2B E;  3N9O A;  3MZK B;  4MFR A;  3PUQ A;  1O3X A;  5L3D B;  3UUM A;  4AKL A;  1HS7 A;  4X1Y E;  2XHE B;  4CXW A;  3LBX B;  4JUY A;  3BQK A;  1G73 A;  4P0A A;  2V7M A;  2CXF A;  3N5L A;  4QX7 B;  2I59 A;  3GN5 B;  3KV4 A;  2ACX A;  1T98 A;  2D5U A;  2VKJ A;  3IBP A;  3JC6 D;  5JH7 E;  3A5X A;  4F6R C;  4X1K E;  1B7T A;  3E22 E;  2HH7 A;  1X79 A;  3V5U A;  4AKH A;  2VWA A;  4UEL A;  2X9Y A;  3QC9 A;  4IDZ A;  4MBQ A;  4CXY A;  3CX7 B;  1Y64 B;  4O8S A;  3HA4 A;  3K3Q C;  4I50 E;  4XZC A;  2R7T A;  3SWH A;  5HAX A;  4O2A E;  2MOZ A;  2CWY A;  2X68 A;  2W62 A;  2XAH B;  2LOS A;  1KK7 A;  2JMK A;  4UV8 B;  5LBQ B;  4JEH B;  2E9X A;  1MMD A;  5H6Q B;  4EYY R;  4XBF B;  1Z0P A;  3AAA B;  3MKD A;  3N9Q A;  5LNK A;  2WMN A;  2ZMA A;  5JR9 A;  1BR4 A;  2CEA A;  4GIW A;  5JRC B;  4KMC A;  5JDF A;  2Q9Q B;  5F3J A;  3K8P C;  2MTQ A;  4EZH A;  5LGU B;  3HR0 A;  1IZN B;  4OK0 A;  4C2M A;  1BR1 A;  4OYK A;  4Z8X A;  4BJM A;  3ZYM A;  2DCF A;  2J1D G;  2YU2 A;  1WYC A;  2XAJ B;  2KIN B;  5LJM A;  3I1A A;  3LFM A;  3KVA A;  3RYI E;  5EK2 A;  3K3O A;  5HXR A;  4PW8 A;  3LG7 A;  4IIJ E;  3UFE A;  2QA7 A;  4CI1 B;  3PDY A;  4KP3 C;  5J2T E;  2N2N A;  2IAK A;  4KBM B;  4A56 A;  4H63 V;  3SRZ A;  2CM0 A;  2KT9 A;  4WBN E;  5DJQ C;  1HF8 A;  4EAH A;  2E8I A;  4HGA A;  1HG2 A;  3RYC E;  2SPC A;  5EK3 A;  4NUV A;  4CQI A;  3EUH A;  3O4X E;  4ZS3 A;  5JVD E;  1ZEE A;  2LT3 A;  3BQL A;  3B57 A;  3VKG A;  4OYJ A;  3ZC0 A;  1CUN A;  2K9A A;  2CA5 A;  1S35 A;  1SHZ C;  3AAE B;  3ONX A;  4DND A;  4ZS2 A;  3CKD A;  2PJQ A;  2Q9Q C;  3Q5X A;  3HKD E;  2UXN B;  2YU1 A;  4N78 D;  1LVK A;  3C4X A;  3CQC B;  1FIO A;  3J7Y q;  2ZM8 A;  2M67 A;  4PK4 A;  4L0R A;  3I0O A;  2LSG A;  3O1J A;  3S4U A;  2E9X B;  2R7Q A;  4OD4 A;  5LA6 E;  1QSD A;  4U72 A;  5FXW A;  3F57 A;  4B6X A;  3Q9D A;  5JDQ A;  3WAK A;  5JR9 B;  3ZMT B;  2XAF B;  1NAF A;  2R7O A;  3E08 A;  4QHO A;  4AKG A;  3UUX B;  3PE0 A;  5JQG E;  1MIW A;  3KBU A;  2ODU A;  3ZMS B;  3MA9 A;  4U74 A;  2DI4 A;  4MLK A;  4ZI3 D;  5CA0 E;  2KWI B;  3C50 A;  4BA9 A;  1D1B A;  2KXP B;  3H37 A;  4CI2 B;  2LJL A;  2VKH A;  2Y8D A;  3C4Z A;  2PG8 A;  3N9N A;  4HKA A;  3RYF E;  5FXV A;  4AQG A;  4OHF A;  1AJ3 A;  3K3N A;  5FY1 A;  5LCY A;  4WW0 A;  4CZZ B;  2DHR A;  4PJL A;  3PUG A;  3BK9 A;  2R7V A;  4GK0 E;  3DU5 A;  3N9L A;  4PK5 A;  4PFP A;  2NW8 A;  4H9Q C;  3O9X A;  1FMV A;  4BAY B;  2E9X C;  5LP6 E;  3D0T A;  3FBZ A;  3B13 A;  5LGT B;  5FY0 A;  5JR9 C;  2V7K A;  4TN7 B;  2NOX A;  2V7L A;  3KV5 A;  5LHH B;  1EZ3 A;  4YFS A;  3RRW A;  2V7I A;  1D1C A;  4HE8 A;  2V7J A;  2CXD A;  3C4W A;  4H9P C;  1YKH B;  3I9W A;  2X66 A;  4ZOL E;  1MIV A;  5ETW A;  3MJX A;  1VRB A;  3NRY A;  2EHO B;  5LG4 A;  4DBQ A;  5GON E;  4GYS A;  3CX8 B;  3OBV E;  4PJJ A;  3ZCJ A;  2VL8 A;  2VKD A;  4H9O C;  4O4I E;  4DVY P;  1YKE B;  3C64 A;  3I0Q A;  5JDM A;  2KZ7 B;  4AQF A;  2CMR A;  2IC6 A;  2WSS V;  5LBM A;  1WR6 A;  5EK4 A;  5HYA A;  3VU7 H;  3UT5 E;  3AB3 B;  4GOU A;  4O4J E;  1NWM X;  2X9H A;  3KV6 A;  3NRX A;  2X0L B;  2A3D A;  2LM9 A;  3OKQ A;  3KYL A;  3PTR B;  4K0U A;  1MMN A;  4PAG A;  4ZI2 C;  5JDN A;  3DJB A;  2ZM2 A;  4PNI A;  3RX6 A;  1E1H B;  1V9D A;  3ZCI A;  5KDM C;  4IE7 A;  5F8P A;  4E7Z A;  4QXH B;  2XUE A;  2JRK A;  2W0G A;  2NP9 A;  2MBG A;  4C90 A;  2N1G A;  4H9R C;  2D0U A;  5CA1 E;  3UTK A;  2V26 A;  3O1H A;  4HTE A;  2P9B A;  4DBR A;  4IRV A;  3AAI A;  4QXB B;  5L3F B;  2ZM0 A;  2W61 A;  3AA6 B;  2UXX B;  1SA0 E;  1OWA A;  3CQX C;  3UUN A;  3RRC A;  3KFW X;  3QUJ A;  1HFA A;  2EHO C;  2JMH A;  2B1E A;  3KDS E;  2G0U A;  3IEE A;  3C51 A;  4X20 E;  3HKE E;  3HKC E;  5LYJ E;  3N2O A;  4O4L E;  4H63 H;  4EYU A;  3AA7 B;  2C5J A;  3ESL A;  4GYR A;  4PK6 A;  3ETU A;  2LSI A;  3FHN A;  2IC9 A;  3KIN B;  3TKL B;  5EZY E;  2CCQ A;  3MAC A;  5C8Y E;  5L3E B;  1G8X A;  3FXE B;  2XAS B;  5TAO A;  5HXS A;  3NZP A;  4UV9 B;  1HTJ F;  5L3C B;  4UXN B;  1LRZ A;  2BVM A;  3ZJ2 A;  4IE0 A;  4I43 B;  2CWO A;  2LSY A;  2CE7 A;  3FBL A;  3KBT A;  2WMO A;  3RPU A;  3ZMU B;  4I55 E;  2YIN A;  2C5K T;  5J2U E;  4IHJ E;  3T8O A;  2LSK A;  1IJ6 A;  2R7W A;  1UX4 A;  4UVC B;  1HG5 A;  4C91 A;  4UVA B;  3MXZ A;  4H9N C;  3Q2M A;  1LVF A;  3RKO A;  2KND A;  5LXT E;  2X9X A;  3AVS A;  4ZI7 E;  4L9I A;  3U3I A;  1U5P A;  2DWG A;  5FNV E;  4XAX B;  1FMW A;  3FB2 A;  3N2K E;  4KUM B;  3L09 A;  5DAB A;  3VHL A;  1IAP A;  3J9X 1;  2XAQ B;  2D2S A;  4ERR A;  3O1I A;  2ODV A;  4ILU A;  4EZ4 A;  4YJ2 E;  3JC6 C;  1MMA A;  4TX5 A;  2K48 A;  4TV9 E;  2R7U A;  2D0T A;  2RP4 A;  4L5G A;  3ANW A;  5KMG P;  2CLY B;  1BR0 A;  3ZEF B;  3ZYL A;  2JPF A;  2CXL A;  1YW0 A;  4IE5 A;  5BMV E;  1LKX A;  4JLE A;  1MNE A;  2VAS A;  3C98 B;  3HI2 A;  5FXX A;  4AQF C;  4BJN A;  4AXP A;  5JDH A;  4ASK A;  4GK5 E;  3NBX X;  4HN9 A;  4YHJ A;  4YLH A;  4ZHQ E;  3IHR A;  2L9Q A;  3RC3 A;  3ZMV B;  2ES0 A;  2Q9Q D;  5L3B B;  4V1A v;  4IE6 A;  2ZLY A;  2YK0 A;  3LJC A;  2R7X A;  1ZHC A;  4QX8 B;  3RYH E;  2W63 A;  2LHR A;  3PU3 A;  2BDE A;  3VTI A;  4UVB B;  4CXX A;  4AI6 A;  4P0B A;  2LSJ A;  2W00 A;  3CPZ A;  4OD5 A;  3M65 A;  3N9M A;  4TV8 E;  4TUY E;  1ZKE A;  1D0X A;  2KMF A;  3PUS A;  4QKN A;  4MHC A;  2QGS A;  4WNK A;  4YJ3 E;  3NZQ A;  1HCI A;  3N2G E;  1QUU A;  3W15 B;  2YEV C;  4NUU A;  4PJM A;  2R7S A;  4QXC B;  5HXE A;  4UF0 A;  3DTO A;  1IJ5 A;  2NTX A;  2V1D B;  2CLY C;  1S94 A;  3EVY A;  5E0O A;  1MIY A;  1MND A;  2BZB A;  3P7I A;  3PUA A;  2KWH A;  3SS1 A;  4I4T E;  4DVD A;  3GWH A;  3OYZ A;  3SOL A;  5JDL A;  1KNZ A;  2BVL A;  3HL6 A;  1HX8 A;  4AKR B;  4H9S E;  4EXT A;  1UX5 A;  4IGU A;  2HPJ A;  2K24 A;  2DNX A;  2HPL A;  2LOP A;  3ZC1 A;  4WBO A;  2Z6E A;  3BQI A;  4O4H E;  3ANW B;  4J2C A;  4PFO A;  5LOV E;  1YD8 G;  3CVR A;  5LGN B;  1WYB A;  3CWZ B;  5LHI B;  2H7O A;  2JQQ A;  4E7S A;  4EOZ B;  2WBL A;  2E9X D;  2Y48 B;  2XQY A;  3R6N A;  5LJN A;  3ZPO A;  3Q5W A;  5HXH A;  2VB6 A;  2X67 A;  4OFZ A;  5FP3 A;  1UCU A;  3LK2 B;  2DLR A;  2GK9 A;  4QWN B;  1FEW A;  1D0Y A;  3ZLI A;  5HXC A;  4DMV A;  4HEA A;  3AA1 B;  4G2A A;  5DQV A;  2IW5 B;  4PJN A;  4G63 A;  3ZN0 B;  3I9Y A;  3AVR A;  2PBI A;  3F31 A;  5FMN A;  2WWU A;  3ZN1 B;  2VKO A;  4IE4 A;  2PFV A;  3OYX A;  4TZ4 C;  1WLX A;  2JJ9 A;  3ZJ1 A;  3LK4 2;  2LE8 A;  3UUL A;  1H7C A;  4EB6 E;  2H7V C;  5FXZ A;  4HFV A;  5A1L A;  2N9D A;  2X9W A;  2XTL A;  4FJO A;  5DQW A;  3GA8 A;  2RA1 A;  4UF0 B;  3QK6 A;  2C0S A;  3HKB E;  3LK3 B;  2LEH A;  2C5I T;  4ZI3 C;  1D1A A;  2B3W A;  3U78 A;  5AFU L;  2NWB A;  1U4Q A;  4AKI A;  5KX5 E;  2VK9 A;  4ZI2 D;  3RC8 A;  4EIW A;  3PUR A;  3RH3 A;  3VKH A;  5HWX A;  4IST A;  3KVB A;  4MAL A;  2K5B B;  3ZMZ B;  4M1P A;  4ANJ A;  5CB4 E;  3CX6 B;  3LBX A;  5JDG A;  3V5S A;  1US7 B;  3NS4 A;  4CI3 B;  3EDU A;  3ETV A;  3H3A A;  1ZV4 X;  4ADZ A;  1MMG A;  5ADX L;  3GN5 A;  2WAU A;  4X1I E;  3IF8 B;  2XAG B;  2EHO D;  2KLQ A;  2FJI 1;  3P8C D;  2A2F X;  3N9P A;  3OJA A;  3L3P A;  1OXZ A;  2LHN A;  4P09 A;  2EHO A;  4UIG A;  4FI5 A;  5IHY A;  2H3R A;  3WAJ A;  3WI3 A;  5JRC A;  3AA0 B;  2WM9 A;  3EDV A;  2Y6X A;  3GMI A;  3R84 B;  5HWY A;  5JRE A;  1VOM A;  4DO0 A;  2NTY A;  5LHG B;  3FXD B;  3KV9 A;  5L3G B;  2L3L A;  1WRD A;  2L8K A;  2NW7 A;  3MK7 C;  4ISS A;  2A72 A;  1BR2 A;  3CQG B;  5CQG A;  5FY7 A;  5J1G A;  5FYM A;  3E0Z A;  5L2L A;  3DP7 A;  5IYZ E;  4DMW A;  2R7R A;  2Q9Q A;  3ZYK A;  3CML A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...