2A2FX

Crystal structure of sec15 c-terminal domain
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
317
structure length
296
Chain Sequence
NILWELLHNMRDHYNEVLLQRWVHVFREILDKEQFLPMVVQNTEEYECIIERFPFHSEQLEPKKFPFSRMVPEVYHQAKEFMYACMKFAEELTLSPNEVAAMVRKAANLLLTRSFSGCLSVVFRQPSITLTQLIQIIIDTQYLEKAGPFLDEFVCHMTNTERAMFHVARQDAEKQVGLRICSKIDEFFELSAYDWLPGIASAFITDMISYLKSTFDSFAFKLPHIAQAACRRTFEHIAEKIYSIMYDSTGALTQINLDLMQCEFFAASEPVPGLKEGELSKYFLRNRQLLDLLILE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sec15 interacts with Rab11 via a novel domain and affects Rab11 localization in vivo.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Protein transport
molecule keywords Exocyst complex component Sec15
total genus 109
structure length 296
sequence length 317
ec nomenclature
pdb deposition date 2005-06-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.30 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor; domain 2 2a2fX01
1.20.58.670 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2a2fX02
3FHNA 2A2FX
chains in the Genus database with same CATH superfamily
4U74A 5K58A 4NUVA 4UVAB 4UVBB 3RYHE 3T1HT 2JQQA 2K48A 1U9NA 2XQ3A 2ZCMA 3F57A 2W63A 3LWJA 3ON2A 5L4EA 4YTMA 5C2TA 2VPRA 2M6BA 5HEGA 4ZI3D 3LSVA 3N9NA 5LA6E 1FIOA 5HXCA 4AKRB 5LB7B 3N9PA 2XQYA 3RH2A 4WBOA 1Y01A 2ACXA 2M6IA 5M4YA 4O4JE 2WBLA 2DTZA 4KP3C 3AECA 1UURA 3JADA 4HWCA 2BG9B 1XNRT 3QKXA 3N2OA 2BKPA 2D2SA 4CGRA 3EVYA 3AE6A 3ZC1A 3BQKA 2XM1A 1BR4A 2E9XA 4HEAA 5CW8A 4JKZA 1UGOA 3PE0A 4OX9T 3BQIA 3MACA 4CQIA 4U72A 3C51A 4JI2T 4HFIA 3TLUA 5A1LA 2I10A 4D7NA 4H9PC 4HFEA 1YQ3A 2PG8A 2XZEA 3VKGA 1U9OA 1RPWA 4WZXA 1W9RA 4LFAT 3TLTA 4GK5E 3B5MA 4AKIA 4KWAA 3O1HA 2D9DA 1J5ET 2V5CA 2XY8B 2PJQA 2X66A 5HAXA 2LLYA 3GN5B 4YZEA 3KKDA 2ZOYA 2XPVA 4HFDA 3BR1A 5LGTB 5ABEA 5FXWA 3B81A 2IC9A 3LFMA 4D5FA 1ZKGA 2HPJA 1SA0E 3UU8A 2DNXA 2Y48B 2HQ5A 4IE0A 3BTLA 2LM9A 1DU2A 3RIUA 3BHQA 2Q24A 3EDUA 4PFPA 3ZMTB 3AE9A 2VKOA 3FZHB 4L62A 3RD3A 2X9HA 3ZJ2A 4DO0A 5F1JA 1ZHCA 4W97A 3QUJA 3KBTA 4JI3T 3FB2A 2O7OA 3AE2A 1M62A 4GCKA 3ANGA 4O2BE 1E7PA 3KDSE 5ETWA 1ZP0A 5JTGA 3AXJB 1D1AA 3T1YT 2XUEA 4HWIB 3PUZF 4JEUB 2BVMA 5FKLA 4PJLA 3J9X1 2FBWA 4TWDA 2ZMAA 3RGLA 4X64T 2BG9C 1YKEB 2E8IA 2FJAA 3AE7A 3VRAA 2NP3A 2LKHA 1KK7A 4EEBA 3MK7C 4UV9B 2GK9A 3ZN1B 3S5RA 4HFVA 4ERRA 5K7HA 2X9XA 1HS7A 3PM1A 2ZOZA 2KWHA 2QCOA 4CI2B 1MIVA 4IE4A 4AQFA 3KINB 3QB5A 3LHQA 2B3WA 3VHLA 5EYRA 4DBRA 4CI1B 3FK7A 5JDNA 3VVZA 1JUPA 3L8RA 3WHCA 4O2AE 4QH1A 3ANWA 2YU1A 4O4LE 3UUXB 5JREA 3VP5A 5JDGA 1FEWA 4UDSA 2JIWA 2QGSA 4UVCB 5FY1A 2CHOA 4DR6T 3K3OA 3IH3A 3CQGB 2OI8A 2Q9QB 2PTFA 2UXXB 4DMVA 4LMLA 5GP9A 2V7KA 4JI4T 1T72A 5GPAA 5IYZE 3QQAA 2YOEA 3EHZA 3M65A 4NXMT 2NP9A 4IDQA 2WWVA 4CN6A 3ZKRA 2YDRA 3HKDE 3LOCA 3CRJA 2LRLA 2HXIA 5F04A 4NIQA 4QWNB 5CGMA 3PTRB 5HEJA 2XB5A 2R7TA 4TX5A 4AC0A 3MA9A 3X1DA 2GFNA 4IDPA 5IWAT 4K0UA 2NTYA 4ZS2A 2WUIA 4Z90A 2DHRA 3C98B 5AQKB 3LJCA 1JT0A 1T56A 4O4HE 3ANPA 2ZM8A 4EXTA 2WQYA 5FL0A 2XSBA 2WDVA 3VOXA 2EHOC 5HBUA 1HG2A 4ZS3A 4IE5A 5FHPA 2CE7A 2E9XB 3ZSSA 5AFUL 1MIYA 3GEUA 1XZYA 2OLTA 3Q5WA 2ZB9A 3BR5A 3P4WA 5GONE 3E22E 3VPRA 4IHJE 3SRZA 1KNZA 4U33A 2VB6A 5ABGA 5AQGB 3QOFA 3L39A 3AAEB 3ZMZB 5JVDE 4V2FA 3AE1A 4C90A 5BR8T 1NEKA 4E7SA 2X6OA 1IJ6A 3O8GA 4GYRA 3LJLA 3GA8A 2FJEA 3IHRA 2LSYA 2IAIA 5F27A 3ONXA 2X9DA 2BS4A 3T8OA 3RIUC 2R7OA 3KVBA 3JSJA 4B3ST 3TLSA 2FJBA 3Q0UA 2Y8DA 2YU2A 1W0AA 3RRWA 2VK9A 4PFOA 4NN1A 4AISA 2WM9A 5FNVE 3AE4A 3SFEA 2V1DB 4WW0A 4JI5T 3DU5A 1KNRA 2VL0A 2NW9A 2C5KT 3Q5DA 5AQIB 1NENA 2CWOA 3VOKA 4YXDA 5FVLA 1U5PA 3LSPA 3AAAB 2FD5A 3P50A 5DJQC 3G06A 4PW8A 3N9LA 2B1EA 4O4IE 2LRKA 4DNDA 5EFYA 3IUVA 2BBJA 2MPKA 5F3JA 2WV1A 5LYJE 5JQGE 3UFGA 4TUYE 2UUAT 2JQHA 1FMVA 1UI5A 4A56A 4AUXA 3RYFE 3QPLA 4EYYR 4PJJA 5AQVB 2J62A 4KI0F 3QNUA 2UXCT 4WIBA 3RC3A 5IUXA 1XDOA 3ZCJA 3RLFF 3ZSTA 4PK4A 1UX4A 4L0RA 4GFKA 4AIUA 4DR7T 3VIBA 2IHR1 2Q9QA 1OWAA 1WCRA 4EB6E 3K8PC 5EK3A 4ZZBA 3UQ7A 4AQFC 1N34T 3RRCA 1ZK8A 3RC8A 3PUQA 1HR0T 2VWAA 2N9DA 5J1GA 4LFCT 2D6YA 3JC6D 3CQCB 1Y64B 5GPCA 5DQVA 5LMUT 4U2YA 4DR2T 3ZJ1A 4ANJA 2D5UA 1YKHB 4L5GA 3UUMA 1WYCA 3NNRA 2R7UA 4XK4A 4DR5T 3JCFA 4GCLA 1Z77A 1YXRA 5IOZA 5HEHA 3BR0A 4JI1T 3IA3A 4MK6A 2KT9A 4EZ4A 2Z6EA 2W53A 3CMLA 4IL4A 3N9QA 1W09A 4BJMA 4BJNA 3OYZA 1N36T 1QSDA 3ETVA 5FY0A 4AQGA 2YK0A 4H9QC 4LF9T 4AF5A 5LBQB 1XWMA 3DPJA 3TP3A 2WB5A 3VR9A 3MZKB 5L3EB 2KSRA 2FQ4A 1SUMB 4V2GA 3UU3A 2Y31A 4U9LA 4ABZA 3GMIA 2ES0A 5LBMA 2Q9QC 4OD4A 4A98A 3AEGA 4H63H 4DR4T 3ZEFB 3CX7B 3ETUA 1VI0A 3P4PA 2WU2A 5LJMA 3C4WA 2FJDA 3HKCE 3FHNA 1WRDA 2WAUA 3DP7A 2LJLA 5HEOA 3G7RA 1A6IA 3PU8A 4IE6A 2XDNA 3FXDB 3NPIA 4AKHA 1Z0XA 2NW8A 3EUHA 3BQZA 2R7SA 1ZKEA 4I76A 4JI0T 2X51A 3NRXA 4YSYA 2GUHA 4LMJA 2LSKA 4DV1T 5J3LA 4JNNA 2VASA 2W00A 2WZIA 5LG4A 3KNWA 2G3BA 4GOUA 2VQFT 3VUQA 2NS7A 3F31A 3VVXA 3EDVA 2IMLA 2XQ5A 2A2FX 4YFSA 2R7QA 3CQXC 3KVAA 4JBWF 4ISSA 2WZHA 1FMWA 4X62T 5AQQB 4EIWA 5LNKA 2CWYA 2NOXA 4X1IE 2CBIA 1HG5A 5C3JA 3HA4A 4IE7A 5L3BB 4DBQA 2A9UA 4L9IA 4MO7A 3UUBA 4I55E 3CWRA 3FK6A 2W67A 4GYSA 4UR9A 4F6RC 2XPUA 4TWHA 2F07A 5HWXA 1QUUA 4JYKA 4G63A 2XASB 1YW0A 4U31A 3IH4A 2DCFA 1OXZA 2XAGB 4IDZA 5L47A 5CB4E 2MAWA 1QLBA 4D5CA 4TV8E 2X68A 2GENA 4I6ZA 2QYWA 5HAWA 1J5WA 2WCAA 1O3XA 1OEDC 5L3DB 5FP3A 2LSJA 4LF7T 2QKOA 4TNWA 4CXYA 5KXJA 2RPAA 4PJNA 3Q0VA 1NAFA 3SWHA 4UV8B 4E7ZA 3PDYA 4YHHT 1Z0PA 4B1RA 1MMNA 2I59A 2LOPA 3O8HA 3A7MA 3LSJA 4GCTA 2MYSA 1N33T 3V78A 2QRXA 3FXEB 4HKAA 3BR6A 5AQMB 3UTKA 5HXEA 3ABVA 2IUBA 5J2UE 2CPTA 2XJ7A 1H7CA 3AQTA 4UELA 2UXUA 3FBLA 5JR9B 3PPBA 3BRUA 5CJ5A 2MBGA 3KBUA 3N2KE 2G7LA 4JEHB 5FXVA 3ZMVB 4ZI2C 4EYUA 4J2CA 1JUSA 4ICHA 3JAFA 2UXOA 2HHHT 3WHBA 4DVYP 4OYKA 2R7VA 4Z8XA 5FMNA 3SS1A 4PJMA 3Q5EA 1IBLT 3AE3A 4V1Av 3OBVE 2ZY9A 2G7GA 3B6AA 3OTOT 5AQPB 3VW1A 3O9XA 3AEAA 4LF4T 3VU7H 2D0UA 3F1BA 2ZM2A 1IBMT 1MNDA 4YTPA 4YTNA 3PUVF 2V7IA 2L8KA 4ZHQE 3ZQIA 2KXPB 2B76A 2F4VT 3DCFA 3M3ZB 4ME9A 3QC9A 4UIGA 3EUPA 4M3EA 3NWIA 4XBFB 3LBXB 2KZ7B 1HNXT 2ZLYA 3AA6B 2JMKA 2UXIA 2VKEA 4QH5A 1RKTA 1QVTA 4Q25A 3HTHA 1UI6A 4C2MA 3NRYA 2L3LA 3TLVA 4HGAA 2XRLA 1VCTA 4DR1T 1VOMA 2FJI1 2WGBA 3ZT7A 3CKDA 2XTLA 2V7JA 5DAJA 3UULA 3CJDA 3GZIA 3S4UA 1E1HB 4D7MA 3ZC0A 2BG9E 4YSXA 3EGQA 5FY7A 5HCMA 5L3CB 3CX6B 2X0LB 3C2BA 1D0YA 1VCSA 5H9TA 1MIWA 1XMOT 2M67A 4QXHB 2K5BB 2IAKA 5DABA 4U3CA 4EOZB 4QXBB 1QVUA 3O4XE 1LRZA 2DWGA 3RYCE 3F0CA 3CK6A 5LGNB 2JRKA 1E2AA 3MVPA 3RIFA 2HN2A 1U4QA 4A97A 5D1RA 5HCJA 3H3AA 3VW0A 4DW6A 4I4TE 5LCYA 4EAHA 1WFDA 5HYAA 5AQTB 3COLA 5L3FB 3PJAA 3BJBA 5EZGA 2LSGA 3EABA 2YDSA 4NPPA 3L09A 1FJGT 3FZFB 2BKNA 4CN1A 2OA5A 4PK5A 1HNWT 1JT6A 2W2UA 4AI6A 2QWTA 2X0HA 5LG3A 5FGLA 1I94T 2P9BA 4B3MT 3ONJA 2HH7A 3C4XA 4MXMA 2QIBA 2V5DA 1YQ4A 3Q2MA 3AE8A 3QB5K 4H9SE 3PASA 5FL1A 4F8HA 2W66A 4X1KE 3NVOA 2WSSV 5HSZA 2XQ4A 1IZNB 1T98A 4DV6T 3BTIA 2NS8A 3LBXA 1N32T 5J1RA 1JTYA 3EI0A 5FKNA 1V9DA 1B7TA 3RKGA 5FXXA 4QX8B 1S35A 2WDRA 4C91A 1HF8A 4OYJA 2A3DA 4JV5T 3HTIA 2Y2ZA 2UXNB 2WMNA 1CHUA 4TWFA 2UUBT 2ODVA 2QVAA 3ZT5A 1OEDE 4GKKT 2BG9A 4B3TT 3P4RA 5HXSA 3NRGA 3BR2A 5H6RB 4IREA 1CUNA 4ZOLE 3BTCA 3AVSA 2H88A 3U78A 2FBQA 1X79A 2W61A 2HN1A 5AQOB 1WLXA 5L2LA 4YLHA 1BR0A 2BS2A 3WAKA 2BKOA 4YT0A 4O8SA 3KV6A 5J0ZA 1GQEA 1IJ5A 4IDNA 4DMWA 3D0TA 2QTQA 2ZM0A 1I6ZA 4X5TA 3BK9A 2UU9T 3HR0A 5LMNT 2C0SA 5HXRA 3G56A 2XPWA 1D1CA 2CMRA 2X9YA 2X9WA 4Z91A 5AQHB 1HX1B 3HTAA 3PUAA 4AC6A 1SHZC 3MXZA 4I0UA 4ILBA 3G1OA 4ZEYA 5AQFB 3H3MA 2REKA 2V26A 3O60A 3VVYA 3OYXA 4JYAT 2XM2A 4KHPT 2DLRA 3AEEA 2D0TA 2KNDA 4DV5T 2E9XD 4ILUA 2PBXA 4LF8T 2VVNA 2H7OA 3GWHA 5FVKA 2XHEB 4H9OC 2HKUA 3AA1B 5CXIA 2ODUA 5L4HA 2ZM6T 3Q9DA 3QK6A 2EH3A 3A8YC 2I6HA 2C5JA 3V6GA 5C8YE 3OPCA 3P9TA 3IBPA 4X1EA 2DG7A 2NX4A 2XAHB 4U2ZA 4M3DA 2TRTA 3O1JA 2UXBT 2DG8A 3IH2A 3ZMUB 2LE8A 4NUUA 5F8PA 3Q3SA 3AA0B 1KNPA 3HGGA 4EEDA 2YVEA 2RP4A 3ZLIA 2XQ8A 5FXZA 3TKLB 4P1NA 2J4GA 2IC6A 2LOSA 1KFYA 3FZMB 2IW5B 2WY2A 2VL8A 1S94A 3P7IA 2K24A 3KKCA 4HTEA 2VKHA 1MMAA 2V6YB 4I50E 2IDOB 3NBXX 3K3NA 3NZQA 2UUCT 3OVUA 4COFA 3N9MA 1LKXA 1BJZA 4WNKA 1G73A 3N9OA 4DV3T 4FJOA 3VRBA 4DV0T 2BZBA 4AXPA 4JI7T 3DTOA 4CI3B 5K7FA 3W15B 5FKOA 2YINA 5EZHA 2GBYA 2K9AA 2XGCA 2BBHA 4YSZA 4GKJT 4A5XA 3CCYA 1YD8G 2HYTA 4AQYT 2G7SA 2XPKA 4LMKA 1AJ3A 4ASKA 4JUYA 4KX6A 4W1UA 2AE9A 2V57A 4BAYB 3NS4A 4FI5A 2FJ1A 1Z8UA 1LVFA 2XAFB 3RKOA 4X20E 2C5IT 2VURA 5HXHA 2BDEA 2XAQB 3CPZA 3HTJA 4HFBA 4G2AA 4N78D 4JLEA 3H37A 2HYJA 1G8XA 2N1GA 4HKUA 2K3WA 2OV9A 5BMVE 2PFVA 3VTIA 5LHHB 2CEAA 2TCTA 3MKDA 3PUYF 3ZQFA 4X65T 4DV4T 4WBNE 1UCUA 4LF5T 3F2EA 3HKBE 2UXHA 2BS3A 3UQ4A 3SDGA 2L9QA 4X66T 1WR0A 5KDMC 2DWKA 2CM0A 3R6NA 3RPUA 4HFCA 3A5XA 4ACIA 3G1MA 1XDPA 4IT4A 2EHOD 3UU4A 1D0ZA 5ABFA 4ILCA 1UX5A 3GN5A 5K7ZA 3P8CD 4U7IA 3BQYA 1MNEA 4EV6A 3AE5A 2ZCNA 5F08A 5CFBA 4IRVA 5IP6A 4ADZA 2H89A 2CA5A 3FZKB 5FKKA 4U7YA 4ZXLA 5H6QB 5IPAA 3SFDA 5E0OA 5ABFB 5LP6E 2YVXA 1D1BA 3VR8A 3BCGA 1JNRA 2KLQA 4YJ3E 4GFLA 3K1SA 1T8BA 4M1PA 2YVHA 1D0XA 3V5UA 3NI7A 1L0VA 2SPCA 3AA7B 4HE8A 1EZ3A 2CRBA 4CXXA 2AXDS 5TAOA 3JAEA 2YN6A 5FKMA 5LJNA 4HWFA 5AQSB 2KMFA 3UUNA 2E2AA 2WP9A 2XQ6A 4PAGA 5J1YA 2VKJA 5LGUB 3AEDA 1XMQT 2WU5A 2CXLA 5JDLA 4TN7B 1W0BA 2QOPA 4KHZF 3EAMA 3UU5A 2HXOA 5LHIB 1HX8A 2E5VA 2VVSA 2RAEA 2IEKA 4YY3T 1J1JA 2RA1A 1X9BA 3ZYLA 2DL1A 1RKWA 5HEUA 3B13A 1NWMX 4OFZA 3HL6A 2Y30A 2H3RA 2H7VC 4B6XA 1ZOYA 4MALA 5LOVE 2JK3A 4HFHA 1BR1A 3HI2A 4DR3T 2IIUA 4P09A 3LK42 5IHYA 2XGDA 4PK6A 5FMPA 3U3IA 4QX7B 4UF0B 4ILAA 4TV9E 4KBMB 1HTJF 2V6YA 3DU6A 3J7Yq 2RHAA 3IF8B 2NW7A 1HNZT 3N2GE 4I43B 3OKQA 3I0OA 3BR3A 2LSIA 2ID6A 2LEHA 3V5SA 1JTXA 2HPLA 3PUWF 5F0CA 4YHJA 2CHNA 4YJ2E 4ZI3C 2UXPA 2OPTA 4ISTA 2W62A 4EGWA 3TLWA 4QHOA 5JR9C 5LHGB 3ZQHA 3ZQLA 2XQ9A 2Y6XA 5JRCA 4DV7T 3ON4A 2N2NA 2V8SV 4GK0E 4PXIA 2FUPA 5FYMA 1MMGA 2VQET 3AXJA 3TP0A 3LG7A 3AB3B 5LXTE 5KX5E 5AQCA 2ACZA 4LFBT 4NXNT 4HWHA 3N5LA 2NWBA 2KINB 4G12A 3LDQB 4UF0A 2VKDA 5EZYE 3CDLA 2LHRA 3UFEA 5ABHA 4CXWA 4DV2T 5CA0E 2JMHA 5JH7E 1T7SA 2I0MA 3AAIA 4TZ4C 1JUMA 3RF1A 4NELA 2V6XA 1ZEEA 3BNIA 4HN9A 4CZZB 1ORKA 4M3FA 3PU3A 3ZPOA 3QPSA 5JR9A 1IBKT 3KFWX 4BA9A 2NP5A 4H9RC 5CQGA 3PJAJ 3WI3A 3HE0A 3KZ9A 3ZQGA 2J47A 2W0GA 2WMOA 5AQLB 4IGUA 3RQUA 3I9WA 2CBJA 3FRQA 1ZV4X 4KUMB 3RH3A 2CXDA 3VW2A 3KV5A 3ZYKA 3KV4A 3RHWA 2FX0A 2WWUA 4DUYT 4IDOA 3BQLA 3HIMA 4MHCA 2XAJB 4OK0A 1HFAA 1VRBA 5KMGP 4AKLA 2YDQA 2RASA 2X67A 3T6NA 3CVRA 5HWYA 2G0UA 3P4SA 5C4YA 5F0FA 2MTQA 2R6GF 5ADXL 3PV0F 4ZI7E 2E5LT 4B3AA 5AQUB 3NXCA 3AEFA 2V7LA 2JJ9A 4AKGA 5D19A 2YKSA 3ZN0B 4GIWA 3PUSA 3AQSA 3I1AA 2R7RA 2R7WA 2JPFA 1WYBA 2MOZA 3C64A 4U9NA 3VKHA 3SFIA 1BR2A 2XSAA 3AVRA 2CLYC 4MLKA 1WR6A 4QXCB 3E7QA 1QPIA 3CIRA 3B57A 5AQJB 3K3QC 3RX6A 2G0EA 3E0ZA 2O7TA 1M7KA 3RQWA 4PNIA 3WAJA 4DVDA 2UXDT 2EHOB 3KYLA 4JL3A 2VKVA 5JRCB 3CX8B 4JI6T 5F5WA 3FIWA 3ANWB 4KMCA 3ZCIA 4IIJE 5J1UA 4B3RT 2DI4A 2WDQA 2XQAA 2NTXA 3PURA 1US7B 4UXNB 3B6CA 4XZCA 4M3GA 2EHOA 2JQKA 4M3BA 3JC6C 3BT9A 2OERA 2CXFA 2IU5A 3DEWA 3Q5XA 3KV9A 3MNLA 3HGYA 4DUZT 2IBDA 4MBQA 5D18A 3L3PA 4MFRA 1T33A 1SGMA 3UT5E 2QA7A 2LHNA 3RIAA 2CCQA 2E9XC 4OD5A 3RYIE 3UU6A 4P0AA 5AQNB 2ZCXA 5CXGA 2WS3A 5L3GB 4P0BA 2ID3A 2XGEA 3PUGA 3AEBA 4WYVA 3RI5A 4OHFA 3I9YA 1IAPA 2W4XA 3LK3B 3DJBA 3NZPA 3ZT6A 1UK5A 1KF6A 3C50A 4CN4A 1OEDA 4H63V 4QH4A 3ONLC 2Q9QD 5JDHA 4ZI2D 3BTJA 2X0YA 4EZHA 2LM2A 3P4QA 2OF7A 3ZYMA 3OJAA 5EK4A 4DIDB 4ZZCA 4IL9A 1MMDA 3C07A 2NR4A 2PBIA 3E08A 5JDFA 1OEDB 4JI8T 2R7XA 4QKNA 4K0KT 3MJXA 2A72A 1SE7A 5DQWA 5AQRB 1HCIA 3I0QA 2CLYB 5FKYA 3FZLB 2J1DG 4TNVA 5J2TE 4LF6T 2XQ7A 1UUSA 4X1YE 3C4ZA 1JNZA 3SOLA 3CWZB 2JQ9A 4XAXB 2V7MA 3R84B 1KEYA 5JDQA 3QBMA 5CA1E 3O1IA 3HKEE 4HWDA 4UEMA 1R8IA 2LT3A 3FBZA 3IEEA 2LKGA 3PUXF 2PZ9A 1XNQT 3G1LA 3LK2B 3LSRA 3ZMSB 5EK2A 3ESLA 2KWIB 2YEVC 2BVLA 3Q0WA 5IOYA 4H9NC 5F0HA 1LVKA 2JJ7A 3NKZA 5JDMA
chains in the Genus database with same CATH topology
4U74A 3PUQA 4I4TE 2VWAA 5LCYA 2N9DA 5J1GA 5TAOA 4EAHA 5HYAA 3JC6D 3CQCB 4NUVA 5LJNA 4UVAB 4UVBB 2KMFA 1Y64B 3UUNA 5L3FB 5DQVA 3RYHE 2JQQA 4PAGA 3ZJ1A 2VKJA 4ANJA 2D5UA 1YKHB 2K48A 5LGUB 4L5GA 2LSGA 1WYCA 3UUMA 2R7UA 3L09A 3F57A 2CXLA 5JDLA 2OA5A 2W63A 4PK5A 4TN7B 4AI6A 4ZI3D 3N9NA 5LA6E 1FIOA 5HXCA 4AKRB 3N9PA 2XQYA 4WBOA 2KT9A 4EZ4A 2Z6EA 3CMLA 5LHIB 2P9BA 2ACXA 3N9QA 5M4YA 1HX8A 4BJMA 4O4JE 4BJNA 2HH7A 3C4XA 2WBLA 3OYZA 1QSDA 4KP3C 3ETVA 5FY0A 4AQGA 2YK0A 4H9QC 5LBQB 5L3EB 3MZKB 3N2OA 2D2SA 3EVYA 3Q2MA 3ZC1A 4H9SE 2RA1A 3ZYLA 3BQKA 4X1KE 3GMIA 2ES0A 1BR4A 5LBMA 2Q9QC 4OD4A 3B13A 2E9XA 4HEAA 4H63H 1NWMX 2WSSV 3CX7B 4OFZA 3ZEFB 3ETUA 3HL6A 4B6XA 2H3RA 2H7VC 3PE0A 3BQIA 1IZNB 3MACA 4MALA 5LOVE 1T98A 3C4WA 3HKCE 4U72A 3FHNA 1BR1A 3C51A 5LJMA 1WRDA 3DP7A 2WAUA 2LJLA 3HI2A 4P09A 3LK42 5IHYA 3LBXA 5A1LA 4PK6A 3PU8A 3U3IA 4H9PC 4QX7B 4IE6A 4UF0B 4TV9E 4KBMB 1HTJF 3FXDB 4AKHA 3DU6A 3J7Yq 2PG8A 3VKGA 3IF8B 1V9DA 1B7TA 2NW7A 3N2GE 4I43B 3OKQA 3I0OA 5FXXA 2NW8A 3EUHA 4QX8B 1S35A 2R7SA 2LSIA 1ZKEA 4C91A 2X51A 4GK5E 3NRXA 1HF8A 2LEHA 3V5SA 4AKIA 2HPLA 3O1HA 2LSKA 4OYJA 2A3DA 2VASA 2W00A 4YHJA 5LG4A 2PJQA 2X66A 2UXNB 4YJ2E 2WMNA 5HAXA 4GOUA 2ODVA 3GN5B 4ZI3C 3F31A 3EDVA 4ISTA 2W62A 5LGTB 5FXWA 5HXSA 2A2FX 4YFSA 2R7QA 2IC9A 4QHOA 5H6RB 5JR9C 5LHGB 3LFMA 2Y6XA 1CUNA 4ZOLE 5JRCA 3AVSA 3CQXC 3U78A 3KVAA 2HPJA 2N2NA 4GK0E 1SA0E 5FYMA 1MMGA 2DNXA 2Y48B 1X79A 2W61A 4ISSA 4IE0A 1FMWA 1WLXA 2LM9A 3LG7A 5L2LA 4YLHA 1BR0A 3AB3B 4EIWA 5LXTE 5LNKA 3WAKA 2CWYA 2NOXA 3EDUA 4X1IE 5KX5E 4PFPA 4O8SA 3ZMTB 3KV6A 1IJ5A 2VKOA 1HG5A 3N5LA 3HA4A 4IE7A 4DMWA 3D0TA 2X9HA 5L3BB 2NWBA 3ZJ2A 4DO0A 4DBQA 4L9IA 1ZHCA 3QUJA 2ZM0A 4I55E 2KINB 4GYSA 3BK9A 3KBTA 4F6RC 4UF0A 2VKDA 3FB2A 5EZYE 3HR0A 2LHRA 3UFEA 2C0SA 5HWXA 5HXRA 3RC8A 1QUUA 4O2BE 3KDSE 4G63A 1D1CA 2XASB 1YW0A 5ETWA 4CXWA 5CA0E 2CMRA 2JMHA 2X9YA 5JH7E 2DCFA 1D1AA 1OXZA 2X9WA 2XUEA 3AAIA 2XAGB 4IDZA 4TZ4C 4JEUB 2BVMA 5CB4E 4PJLA 3PUAA 4TV8E 2X68A 3J9X1 1SHZC 2ZMAA 1ZEEA 3MXZA 4HN9A 4CZZB 3PU3A 1O3XA 1YKEB 2E8IA 2V26A 3ZPOA 5JR9A 5L3DB 1KK7A 3OYXA 5FP3A 3KFWX 4BA9A 2LSJA 3MK7C 4UV9B 4H9RC 5CQGA 3WI3A 4CXYA 2DLRA 2GK9A 3ZN1B 2D0TA 4PJNA 2W0GA 4HFVA 4ERRA 1NAFA 2WMOA 2KNDA 3SWHA 4IGUA 1HS7A 2X9XA 2E9XD 3I9WA 4ILUA 4UV8B 4E7ZA 1ZV4X 4KUMB 3RH3A 2KWHA 2CXDA 3PDYA 4CI2B 3KV5A 3ZYKA 1Z0PA 2H7OA 3KV4A 1MMNA 3GWHA 1MIVA 2I59A 4IE4A 4AQFA 2XHEB 3KINB 2WWUA 2LOPA 3VHLA 2B3WA 4H9OC 3AA1B 4DBRA 4CI1B 3BQLA 2ODUA 5JDNA 3Q9DA 3QK6A 4O2AE 3ANWA 2YU1A 4O4LE 2MYSA 3UUXB 4MHCA 5JREA 5JDGA 2C5JA 2XAJB 4HKAA 1FEWA 3FXEB 4OK0A 1HFAA 3UTKA 5C8YE 5HXEA 1VRBA 2QGSA 5KMGP 4AKLA 4UVCB 5FY1A 3IBPA 5J2UE 2X67A 2XAHB 3CVRA 5HWYA 2G0UA 1H7CA 3K3OA 2MTQA 5ADXL 3CQGB 3O1JA 4ZI7E 2Q9QB 3ZMUB 2LE8A 2UXXB 2V7LA 2JJ9A 4DMVA 4NUUA 4AKGA 5F8PA 3ZN0B 2V7KA 4UELA 3AA0B 3PUSA 3FBLA 4GIWA 5JR9B 3I1AA 2R7RA 2R7WA 2JPFA 2MBGA 1WYBA 3KBUA 2MOZA 3N2KE 5IYZE 3C64A 2RP4A 3VKHA 1BR2A 3AVRA 3M65A 2CLYC 4JEHB 4MLKA 3ZLIA 1WR6A 4QXCB 4CXXA 5FXVA 2NP9A 3B57A 3ZMVB 4ZI2C 5FXZA 4EYUA 4J2CA 3K3QC 3RX6A 3HKDE 3E0ZA 3TKLB 4DVYP 4OYKA 2R7VA 4Z8XA 4PNIA 2IC6A 4QWNB 5FMNA 3SS1A 2LOSA 4PJMA 4DVDA 3WAJA 3PTRB 2IW5B 2R7TA 2EHOB 2VL8A 4V1Av 4TX5A 3OBVE 1S94A 3MA9A 3P7IA 3KYLA 2K24A 4HTEA 5JRCB 3CX8B 2NTYA 4K0UA 2VKHA 4ZS2A 1MMAA 4I50E 3O9XA 3ANWB 4KMCA 3ZCIA 3NBXX 3VU7H 2DHRA 3K3NA 3NZQA 3C98B 4IIJE 3LJCA 2D0UA 2DI4A 3N9MA 1LKXA 2NTXA 2ZM2A 3PURA 4O4HE 1G73A 1MNDA 2ZM8A 1US7B 4UXNB 4WNKA 4EXTA 3N9OA 4XZCA 4FJOA 2EHOA 2EHOC 1HG2A 4ZS3A 4IE5A 2BZBA 4AXPA 3DTOA 2CE7A 3JC6C 2E9XB 4CI3B 3W15B 5AFUL 2YINA 1MIYA 2V7IA 2L8KA 4ZHQE 2CXFA 3Q5XA 3KV9A 2K9AA 2KXPB 4MBQA 3Q5WA 3L3PA 4MFRA 3UT5E 5GONE 3E22E 2QA7A 2LHNA 4IHJE 1YD8G 3SRZA 1KNZA 2CCQA 2VB6A 2E9XC 3QC9A 4OD5A 4UIGA 3RYIE 4P0AA 1AJ3A 4ASKA 4XBFB 4JUYA 3LBXB 3AAEB 2KZ7B 3ZMZB 5JVDE 5L3GB 2ZLYA 4C90A 4P0BA 3AA6B 4BAYB 2JMKA 3NS4A 4FI5A 3PUGA 4E7SA 1IJ6A 4CQIA 1LVFA 4OHFA 3I9YA 4GYRA 1IAPA 2XAFB 3RKOA 4X20E 2C5IT 3GA8A 3LK3B 3IHRA 5HXHA 2LSYA 3DJBA 3NZPA 3ONXA 3T8OA 4C2MA 2R7OA 3NRYA 2BDEA 2XAQB 3CPZA 3C50A 2L3LA 3KVBA 4H63V 4HGAA 4G2AA 4JLEA 4N78D 2Q9QD 5JDHA 4ZI2D 3H37A 1G8XA 2N1GA 4EZHA 2Y8DA 1VOMA 2YU2A 2FJI1 3ZYMA 3RRWA 2VK9A 4PFOA 2WM9A 2PFVA 3OJAA 5BMVE 3VTIA 5FNVE 5EK4A 5LHHB 2CEAA 3CKDA 2V1DB 2XTLA 4WW0A 1MMDA 3MKDA 2PBIA 3E08A 3DU5A 2NW9A 2C5KT 2V7JA 5JDFA 3UULA 2R7XA 4QKNA 3MJXA 2A72A 5DQWA 2CWOA 4WBNE 1HCIA 1UCUA 3I0QA 2CLYB 3F2EA 3HKBE 3S4UA 1U5PA 2L9QA 2J1DG 5KDMC 2DWKA 2CM0A 3AAAB 3R6NA 3RPUA 3A5XA 1E1HB 5DJQC 2EHOD 4PW8A 1D0ZA 3ZC0A 3N9LA 2B1EA 5J2TE 1UX5A 4O4IE 5FY7A 3GN5A 4DNDA 3P8CD 4X1YE 5F3JA 1MNEA 5L3CB 5LYJE 5JQGE 4TUYE 3CX6B 3C4ZA 4IRVA 2X0LB 1FMVA 4ADZA 1D0YA 3SOLA 2CA5A 4A56A 1MIWA 3CWZB 2M67A 4XAXB 2V7MA 3RYFE 3R84B 4EYYR 5H6QB 4QXHB 4PJJA 5JDQA 5CA1E 2K5BB 5E0OA 2IAKA 3O1IA 3RC3A 3HKEE 4UEMA 3FBZA 2LT3A 3ZCJA 3IEEA 5LP6E 4PK4A 1UX4A 5DABA 4L0RA 1D1BA 4EOZB 4QXBB 3O4XE 1LRZA 2Q9QA 2KLQA 2DWGA 4YJ3E 1OWAA 3RYCE 4EB6E 3LK2B 3K8PC 5LGNB 2JRKA 4M1PA 5EK3A 3ZMSB 1D0XA 5EK2A 3ESLA 3V5UA 2KWIB 2SPCA 2YEVC 1U4QA 2BVLA 4H9NC 3AA7B 1LVKA 4HE8A 1EZ3A 4AQFC 3RRCA 5JDMA 3H3AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FHN A;  2A2F X; 
#chains in the Genus database with same CATH topology
 4U74 A;  5K58 A;  4NUV A;  4UVA B;  4UVB B;  3RYH E;  3T1H T;  2JQQ A;  2K48 A;  1U9N A;  2XQ3 A;  2ZCM A;  3F57 A;  2W63 A;  3LWJ A;  3ON2 A;  5L4E A;  4YTM A;  5C2T A;  2VPR A;  2M6B A;  5HEG A;  4ZI3 D;  3LSV A;  3N9N A;  5LA6 E;  1FIO A;  5HXC A;  4AKR B;  5LB7 B;  3N9P A;  2XQY A;  3RH2 A;  4WBO A;  1Y01 A;  2ACX A;  2M6I A;  5M4Y A;  4O4J E;  2WBL A;  2DTZ A;  4KP3 C;  3AEC A;  1UUR A;  3JAD A;  4HWC A;  2BG9 B;  1XNR T;  3QKX A;  3N2O A;  2BKP A;  2D2S A;  4CGR A;  3EVY A;  3AE6 A;  3ZC1 A;  3BQK A;  2XM1 A;  1BR4 A;  2E9X A;  4HEA A;  5CW8 A;  4JKZ A;  1UGO A;  3PE0 A;  4OX9 T;  3BQI A;  3MAC A;  4CQI A;  4U72 A;  3C51 A;  4JI2 T;  4HFI A;  3TLU A;  5A1L A;  2I10 A;  4D7N A;  4H9P C;  4HFE A;  1YQ3 A;  2PG8 A;  2XZE A;  3VKG A;  1U9O A;  1RPW A;  4WZX A;  1W9R A;  4LFA T;  3TLT A;  4GK5 E;  3B5M A;  4AKI A;  4KWA A;  3O1H A;  2D9D A;  1J5E T;  2V5C A;  2XY8 B;  2PJQ A;  2X66 A;  5HAX A;  2LLY A;  3GN5 B;  4YZE A;  3KKD A;  2ZOY A;  2XPV A;  4HFD A;  3BR1 A;  5LGT B;  5ABE A;  5FXW A;  3B81 A;  2IC9 A;  3LFM A;  4D5F A;  1ZKG A;  2HPJ A;  1SA0 E;  3UU8 A;  2DNX A;  2Y48 B;  2HQ5 A;  4IE0 A;  3BTL A;  2LM9 A;  1DU2 A;  3RIU A;  3BHQ A;  2Q24 A;  3EDU A;  4PFP A;  3ZMT B;  3AE9 A;  2VKO A;  3FZH B;  4L62 A;  3RD3 A;  2X9H A;  3ZJ2 A;  4DO0 A;  5F1J A;  1ZHC A;  4W97 A;  3QUJ A;  3KBT A;  4JI3 T;  3FB2 A;  2O7O A;  3AE2 A;  1M62 A;  4GCK A;  3ANG A;  4O2B E;  1E7P A;  3KDS E;  5ETW A;  1ZP0 A;  5JTG A;  3AXJ B;  1D1A A;  3T1Y T;  2XUE A;  4HWI B;  3PUZ F;  4JEU B;  2BVM A;  5FKL A;  4PJL A;  3J9X 1;  2FBW A;  4TWD A;  2ZMA A;  3RGL A;  4X64 T;  2BG9 C;  1YKE B;  2E8I A;  2FJA A;  3AE7 A;  3VRA A;  2NP3 A;  2LKH A;  1KK7 A;  4EEB A;  3MK7 C;  4UV9 B;  2GK9 A;  3ZN1 B;  3S5R A;  4HFV A;  4ERR A;  5K7H A;  2X9X A;  1HS7 A;  3PM1 A;  2ZOZ A;  2KWH A;  2QCO A;  4CI2 B;  1MIV A;  4IE4 A;  4AQF A;  3KIN B;  3QB5 A;  3LHQ A;  2B3W A;  3VHL A;  5EYR A;  4DBR A;  4CI1 B;  3FK7 A;  5JDN A;  3VVZ A;  1JUP A;  3L8R A;  3WHC A;  4O2A E;  4QH1 A;  3ANW A;  2YU1 A;  4O4L E;  3UUX B;  5JRE A;  3VP5 A;  5JDG A;  1FEW A;  4UDS A;  2JIW A;  2QGS A;  4UVC B;  5FY1 A;  2CHO A;  4DR6 T;  3K3O A;  3IH3 A;  3CQG B;  2OI8 A;  2Q9Q B;  2PTF A;  2UXX B;  4DMV A;  4LML A;  5GP9 A;  2V7K A;  4JI4 T;  1T72 A;  5GPA A;  5IYZ E;  3QQA A;  2YOE A;  3EHZ A;  3M65 A;  4NXM T;  2NP9 A;  4IDQ A;  2WWV A;  4CN6 A;  3ZKR A;  2YDR A;  3HKD E;  3LOC A;  3CRJ A;  2LRL A;  2HXI A;  5F04 A;  4NIQ A;  4QWN B;  5CGM A;  3PTR B;  5HEJ A;  2XB5 A;  2R7T A;  4TX5 A;  4AC0 A;  3MA9 A;  3X1D A;  2GFN A;  4IDP A;  5IWA T;  4K0U A;  2NTY A;  4ZS2 A;  2WUI A;  4Z90 A;  2DHR A;  3C98 B;  5AQK B;  3LJC A;  1JT0 A;  1T56 A;  4O4H E;  3ANP A;  2ZM8 A;  4EXT A;  2WQY A;  5FL0 A;  2XSB A;  2WDV A;  3VOX A;  2EHO C;  5HBU A;  1HG2 A;  4ZS3 A;  4IE5 A;  5FHP A;  2CE7 A;  2E9X B;  3ZSS A;  5AFU L;  1MIY A;  3GEU A;  1XZY A;  2OLT A;  3Q5W A;  2ZB9 A;  3BR5 A;  3P4W A;  5GON E;  3E22 E;  3VPR A;  4IHJ E;  3SRZ A;  1KNZ A;  4U33 A;  2VB6 A;  5ABG A;  5AQG B;  3QOF A;  3L39 A;  3AAE B;  3ZMZ B;  5JVD E;  4V2F A;  3AE1 A;  4C90 A;  5BR8 T;  1NEK A;  4E7S A;  2X6O A;  1IJ6 A;  3O8G A;  4GYR A;  3LJL A;  3GA8 A;  2FJE A;  3IHR A;  2LSY A;  2IAI A;  5F27 A;  3ONX A;  2X9D A;  2BS4 A;  3T8O A;  3RIU C;  2R7O A;  3KVB A;  3JSJ A;  4B3S T;  3TLS A;  2FJB A;  3Q0U A;  2Y8D A;  2YU2 A;  1W0A A;  3RRW A;  2VK9 A;  4PFO A;  4NN1 A;  4AIS A;  2WM9 A;  5FNV E;  3AE4 A;  3SFE A;  2V1D B;  4WW0 A;  4JI5 T;  3DU5 A;  1KNR A;  2VL0 A;  2NW9 A;  2C5K T;  3Q5D A;  5AQI B;  1NEN A;  2CWO A;  3VOK A;  4YXD A;  5FVL A;  1U5P A;  3LSP A;  3AAA B;  2FD5 A;  3P50 A;  5DJQ C;  3G06 A;  4PW8 A;  3N9L A;  2B1E A;  4O4I E;  2LRK A;  4DND A;  5EFY A;  3IUV A;  2BBJ A;  2MPK A;  5F3J A;  2WV1 A;  5LYJ E;  5JQG E;  3UFG A;  4TUY E;  2UUA T;  2JQH A;  1FMV A;  1UI5 A;  4A56 A;  4AUX A;  3RYF E;  3QPL A;  4EYY R;  4PJJ A;  5AQV B;  2J62 A;  4KI0 F;  3QNU A;  2UXC T;  4WIB A;  3RC3 A;  5IUX A;  1XDO A;  3ZCJ A;  3RLF F;  3ZST A;  4PK4 A;  1UX4 A;  4L0R A;  4GFK A;  4AIU A;  4DR7 T;  3VIB A;  2IHR 1;  2Q9Q A;  1OWA A;  1WCR A;  4EB6 E;  3K8P C;  5EK3 A;  4ZZB A;  3UQ7 A;  4AQF C;  1N34 T;  3RRC A;  1ZK8 A;  3RC8 A;  3PUQ A;  1HR0 T;  2VWA A;  2N9D A;  5J1G A;  4LFC T;  2D6Y A;  3JC6 D;  3CQC B;  1Y64 B;  5GPC A;  5DQV A;  5LMU T;  4U2Y A;  4DR2 T;  3ZJ1 A;  4ANJ A;  2D5U A;  1YKH B;  4L5G A;  3UUM A;  1WYC A;  3NNR A;  2R7U A;  4XK4 A;  4DR5 T;  3JCF A;  4GCL A;  1Z77 A;  1YXR A;  5IOZ A;  5HEH A;  3BR0 A;  4JI1 T;  3IA3 A;  4MK6 A;  2KT9 A;  4EZ4 A;  2Z6E A;  2W53 A;  3CML A;  4IL4 A;  3N9Q A;  1W09 A;  4BJM A;  4BJN A;  3OYZ A;  1N36 T;  1QSD A;  3ETV A;  5FY0 A;  4AQG A;  2YK0 A;  4H9Q C;  4LF9 T;  4AF5 A;  5LBQ B;  1XWM A;  3DPJ A;  3TP3 A;  2WB5 A;  3VR9 A;  3MZK B;  5L3E B;  2KSR A;  2FQ4 A;  1SUM B;  4V2G A;  3UU3 A;  2Y31 A;  4U9L A;  4ABZ A;  3GMI A;  2ES0 A;  5LBM A;  2Q9Q C;  4OD4 A;  4A98 A;  3AEG A;  4H63 H;  4DR4 T;  3ZEF B;  3CX7 B;  3ETU A;  1VI0 A;  3P4P A;  2WU2 A;  5LJM A;  3C4W A;  2FJD A;  3HKC E;  3FHN A;  1WRD A;  2WAU A;  3DP7 A;  2LJL A;  5HEO A;  3G7R A;  1A6I A;  3PU8 A;  4IE6 A;  2XDN A;  3FXD B;  3NPI A;  4AKH A;  1Z0X A;  2NW8 A;  3EUH A;  3BQZ A;  2R7S A;  1ZKE A;  4I76 A;  4JI0 T;  2X51 A;  3NRX A;  4YSY A;  2GUH A;  4LMJ A;  2LSK A;  4DV1 T;  5J3L A;  4JNN A;  2VAS A;  2W00 A;  2WZI A;  5LG4 A;  3KNW A;  2G3B A;  4GOU A;  2VQF T;  3VUQ A;  2NS7 A;  3F31 A;  3VVX A;  3EDV A;  2IML A;  2XQ5 A;  2A2F X;  4YFS A;  2R7Q A;  3CQX C;  3KVA A;  4JBW F;  4ISS A;  2WZH A;  1FMW A;  4X62 T;  5AQQ B;  4EIW A;  5LNK A;  2CWY A;  2NOX A;  4X1I E;  2CBI A;  1HG5 A;  5C3J A;  3HA4 A;  4IE7 A;  5L3B B;  4DBQ A;  2A9U A;  4L9I A;  4MO7 A;  3UUB A;  4I55 E;  3CWR A;  3FK6 A;  2W67 A;  4GYS A;  4UR9 A;  4F6R C;  2XPU A;  4TWH A;  2F07 A;  5HWX A;  1QUU A;  4JYK A;  4G63 A;  2XAS B;  1YW0 A;  4U31 A;  3IH4 A;  2DCF A;  1OXZ A;  2XAG B;  4IDZ A;  5L47 A;  5CB4 E;  2MAW A;  1QLB A;  4D5C A;  4TV8 E;  2X68 A;  2GEN A;  4I6Z A;  2QYW A;  5HAW A;  1J5W A;  2WCA A;  1O3X A;  1OED C;  5L3D B;  5FP3 A;  2LSJ A;  4LF7 T;  2QKO A;  4TNW A;  4CXY A;  5KXJ A;  2RPA A;  4PJN A;  3Q0V A;  1NAF A;  3SWH A;  4UV8 B;  4E7Z A;  3PDY A;  4YHH T;  1Z0P A;  4B1R A;  1MMN A;  2I59 A;  2LOP A;  3O8H A;  3A7M A;  3LSJ A;  4GCT A;  2MYS A;  1N33 T;  3V78 A;  2QRX A;  3FXE B;  4HKA A;  3BR6 A;  5AQM B;  3UTK A;  5HXE A;  3ABV A;  2IUB A;  5J2U E;  2CPT A;  2XJ7 A;  1H7C A;  3AQT A;  4UEL A;  2UXU A;  3FBL A;  5JR9 B;  3PPB A;  3BRU A;  5CJ5 A;  2MBG A;  3KBU A;  3N2K E;  2G7L A;  4JEH B;  5FXV A;  3ZMV B;  4ZI2 C;  4EYU A;  4J2C A;  1JUS A;  4ICH A;  3JAF A;  2UXO A;  2HHH T;  3WHB A;  4DVY P;  4OYK A;  2R7V A;  4Z8X A;  5FMN A;  3SS1 A;  4PJM A;  3Q5E A;  1IBL T;  3AE3 A;  4V1A v;  3OBV E;  2ZY9 A;  2G7G A;  3B6A A;  3OTO T;  5AQP B;  3VW1 A;  3O9X A;  3AEA A;  4LF4 T;  3VU7 H;  2D0U A;  3F1B A;  2ZM2 A;  1IBM T;  1MND A;  4YTP A;  4YTN A;  3PUV F;  2V7I A;  2L8K A;  4ZHQ E;  3ZQI A;  2KXP B;  2B76 A;  2F4V T;  3DCF A;  3M3Z B;  4ME9 A;  3QC9 A;  4UIG A;  3EUP A;  4M3E A;  3NWI A;  4XBF B;  3LBX B;  2KZ7 B;  1HNX T;  2ZLY A;  3AA6 B;  2JMK A;  2UXI A;  2VKE A;  4QH5 A;  1RKT A;  1QVT A;  4Q25 A;  3HTH A;  1UI6 A;  4C2M A;  3NRY A;  2L3L A;  3TLV A;  4HGA A;  2XRL A;  1VCT A;  4DR1 T;  1VOM A;  2FJI 1;  2WGB A;  3ZT7 A;  3CKD A;  2XTL A;  2V7J A;  5DAJ A;  3UUL A;  3CJD A;  3GZI A;  3S4U A;  1E1H B;  4D7M A;  3ZC0 A;  2BG9 E;  4YSX A;  3EGQ A;  5FY7 A;  5HCM A;  5L3C B;  3CX6 B;  2X0L B;  3C2B A;  1D0Y A;  1VCS A;  5H9T A;  1MIW A;  1XMO T;  2M67 A;  4QXH B;  2K5B B;  2IAK A;  5DAB A;  4U3C A;  4EOZ B;  4QXB B;  1QVU A;  3O4X E;  1LRZ A;  2DWG A;  3RYC E;  3F0C A;  3CK6 A;  5LGN B;  2JRK A;  1E2A A;  3MVP A;  3RIF A;  2HN2 A;  1U4Q A;  4A97 A;  5D1R A;  5HCJ A;  3H3A A;  3VW0 A;  4DW6 A;  4I4T E;  5LCY A;  4EAH A;  1WFD A;  5HYA A;  5AQT B;  3COL A;  5L3F B;  3PJA A;  3BJB A;  5EZG A;  2LSG A;  3EAB A;  2YDS A;  4NPP A;  3L09 A;  1FJG T;  3FZF B;  2BKN A;  4CN1 A;  2OA5 A;  4PK5 A;  1HNW T;  1JT6 A;  2W2U A;  4AI6 A;  2QWT A;  2X0H A;  5LG3 A;  5FGL A;  1I94 T;  2P9B A;  4B3M T;  3ONJ A;  2HH7 A;  3C4X A;  4MXM A;  2QIB A;  2V5D A;  1YQ4 A;  3Q2M A;  3AE8 A;  3QB5 K;  4H9S E;  3PAS A;  5FL1 A;  4F8H A;  2W66 A;  4X1K E;  3NVO A;  2WSS V;  5HSZ A;  2XQ4 A;  1IZN B;  1T98 A;  4DV6 T;  3BTI A;  2NS8 A;  3LBX A;  1N32 T;  5J1R A;  1JTY A;  3EI0 A;  5FKN A;  1V9D A;  1B7T A;  3RKG A;  5FXX A;  4QX8 B;  1S35 A;  2WDR A;  4C91 A;  1HF8 A;  4OYJ A;  2A3D A;  4JV5 T;  3HTI A;  2Y2Z A;  2UXN B;  2WMN A;  1CHU A;  4TWF A;  2UUB T;  2ODV A;  2QVA A;  3ZT5 A;  1OED E;  4GKK T;  2BG9 A;  4B3T T;  3P4R A;  5HXS A;  3NRG A;  3BR2 A;  5H6R B;  4IRE A;  1CUN A;  4ZOL E;  3BTC A;  3AVS A;  2H88 A;  3U78 A;  2FBQ A;  1X79 A;  2W61 A;  2HN1 A;  5AQO B;  1WLX A;  5L2L A;  4YLH A;  1BR0 A;  2BS2 A;  3WAK A;  2BKO A;  4YT0 A;  4O8S A;  3KV6 A;  5J0Z A;  1GQE A;  1IJ5 A;  4IDN A;  4DMW A;  3D0T A;  2QTQ A;  2ZM0 A;  1I6Z A;  4X5T A;  3BK9 A;  2UU9 T;  3HR0 A;  5LMN T;  2C0S A;  5HXR A;  3G56 A;  2XPW A;  1D1C A;  2CMR A;  2X9Y A;  2X9W A;  4Z91 A;  5AQH B;  1HX1 B;  3HTA A;  3PUA A;  4AC6 A;  1SHZ C;  3MXZ A;  4I0U A;  4ILB A;  3G1O A;  4ZEY A;  5AQF B;  3H3M A;  2REK A;  2V26 A;  3O60 A;  3VVY A;  3OYX A;  4JYA T;  2XM2 A;  4KHP T;  2DLR A;  3AEE A;  2D0T A;  2KND A;  4DV5 T;  2E9X D;  4ILU A;  2PBX A;  4LF8 T;  2VVN A;  2H7O A;  3GWH A;  5FVK A;  2XHE B;  4H9O C;  2HKU A;  3AA1 B;  5CXI A;  2ODU A;  5L4H A;  2ZM6 T;  3Q9D A;  3QK6 A;  2EH3 A;  3A8Y C;  2I6H A;  2C5J A;  3V6G A;  5C8Y E;  3OPC A;  3P9T A;  3IBP A;  4X1E A;  2DG7 A;  2NX4 A;  2XAH B;  4U2Z A;  4M3D A;  2TRT A;  3O1J A;  2UXB T;  2DG8 A;  3IH2 A;  3ZMU B;  2LE8 A;  4NUU A;  5F8P A;  3Q3S A;  3AA0 B;  1KNP A;  3HGG A;  4EED A;  2YVE A;  2RP4 A;  3ZLI A;  2XQ8 A;  5FXZ A;  3TKL B;  4P1N A;  2J4G A;  2IC6 A;  2LOS A;  1KFY A;  3FZM B;  2IW5 B;  2WY2 A;  2VL8 A;  1S94 A;  3P7I A;  2K24 A;  3KKC A;  4HTE A;  2VKH A;  1MMA A;  2V6Y B;  4I50 E;  2IDO B;  3NBX X;  3K3N A;  3NZQ A;  2UUC T;  3OVU A;  4COF A;  3N9M A;  1LKX A;  1BJZ A;  4WNK A;  1G73 A;  3N9O A;  4DV3 T;  4FJO A;  3VRB A;  4DV0 T;  2BZB A;  4AXP A;  4JI7 T;  3DTO A;  4CI3 B;  5K7F A;  3W15 B;  5FKO A;  2YIN A;  5EZH A;  2GBY A;  2K9A A;  2XGC A;  2BBH A;  4YSZ A;  4GKJ T;  4A5X A;  3CCY A;  1YD8 G;  2HYT A;  4AQY T;  2G7S A;  2XPK A;  4LMK A;  1AJ3 A;  4ASK A;  4JUY A;  4KX6 A;  4W1U A;  2AE9 A;  2V57 A;  4BAY B;  3NS4 A;  4FI5 A;  2FJ1 A;  1Z8U A;  1LVF A;  2XAF B;  3RKO A;  4X20 E;  2C5I T;  2VUR A;  5HXH A;  2BDE A;  2XAQ B;  3CPZ A;  3HTJ A;  4HFB A;  4G2A A;  4N78 D;  4JLE A;  3H37 A;  2HYJ A;  1G8X A;  2N1G A;  4HKU A;  2K3W A;  2OV9 A;  5BMV E;  2PFV A;  3VTI A;  5LHH B;  2CEA A;  2TCT A;  3MKD A;  3PUY F;  3ZQF A;  4X65 T;  4DV4 T;  4WBN E;  1UCU A;  4LF5 T;  3F2E A;  3HKB E;  2UXH A;  2BS3 A;  3UQ4 A;  3SDG A;  2L9Q A;  4X66 T;  1WR0 A;  5KDM C;  2DWK A;  2CM0 A;  3R6N A;  3RPU A;  4HFC A;  3A5X A;  4ACI A;  3G1M A;  1XDP A;  4IT4 A;  2EHO D;  3UU4 A;  1D0Z A;  5ABF A;  4ILC A;  1UX5 A;  3GN5 A;  5K7Z A;  3P8C D;  4U7I A;  3BQY A;  1MNE A;  4EV6 A;  3AE5 A;  2ZCN A;  5F08 A;  5CFB A;  4IRV A;  5IP6 A;  4ADZ A;  2H89 A;  2CA5 A;  3FZK B;  5FKK A;  4U7Y A;  4ZXL A;  5H6Q B;  5IPA A;  3SFD A;  5E0O A;  5ABF B;  5LP6 E;  2YVX A;  1D1B A;  3VR8 A;  3BCG A;  1JNR A;  2KLQ A;  4YJ3 E;  4GFL A;  3K1S A;  1T8B A;  4M1P A;  2YVH A;  1D0X A;  3V5U A;  3NI7 A;  1L0V A;  2SPC A;  3AA7 B;  4HE8 A;  1EZ3 A;  2CRB A;  4CXX A;  2AXD S;  5TAO A;  3JAE A;  2YN6 A;  5FKM A;  5LJN A;  4HWF A;  5AQS B;  2KMF A;  3UUN A;  2E2A A;  2WP9 A;  2XQ6 A;  4PAG A;  5J1Y A;  2VKJ A;  5LGU B;  3AED A;  1XMQ T;  2WU5 A;  2CXL A;  5JDL A;  4TN7 B;  1W0B A;  2QOP A;  4KHZ F;  3EAM A;  3UU5 A;  2HXO A;  5LHI B;  1HX8 A;  2E5V A;  2VVS A;  2RAE A;  2IEK A;  4YY3 T;  1J1J A;  2RA1 A;  1X9B A;  3ZYL A;  2DL1 A;  1RKW A;  5HEU A;  3B13 A;  1NWM X;  4OFZ A;  3HL6 A;  2Y30 A;  2H3R A;  2H7V C;  4B6X A;  1ZOY A;  4MAL A;  5LOV E;  2JK3 A;  4HFH A;  1BR1 A;  3HI2 A;  4DR3 T;  2IIU A;  4P09 A;  3LK4 2;  5IHY A;  2XGD A;  4PK6 A;  5FMP A;  3U3I A;  4QX7 B;  4UF0 B;  4ILA A;  4TV9 E;  4KBM B;  1HTJ F;  2V6Y A;  3DU6 A;  3J7Y q;  2RHA A;  3IF8 B;  2NW7 A;  1HNZ T;  3N2G E;  4I43 B;  3OKQ A;  3I0O A;  3BR3 A;  2LSI A;  2ID6 A;  2LEH A;  3V5S A;  1JTX A;  2HPL A;  3PUW F;  5F0C A;  4YHJ A;  2CHN A;  4YJ2 E;  4ZI3 C;  2UXP A;  2OPT A;  4IST A;  2W62 A;  4EGW A;  3TLW A;  4QHO A;  5JR9 C;  5LHG B;  3ZQH A;  3ZQL A;  2XQ9 A;  2Y6X A;  5JRC A;  4DV7 T;  3ON4 A;  2N2N A;  2V8S V;  4GK0 E;  4PXI A;  2FUP A;  5FYM A;  1MMG A;  2VQE T;  3AXJ A;  3TP0 A;  3LG7 A;  3AB3 B;  5LXT E;  5KX5 E;  5AQC A;  2ACZ A;  4LFB T;  4NXN T;  4HWH A;  3N5L A;  2NWB A;  2KIN B;  4G12 A;  3LDQ B;  4UF0 A;  2VKD A;  5EZY E;  3CDL A;  2LHR A;  3UFE A;  5ABH A;  4CXW A;  4DV2 T;  5CA0 E;  2JMH A;  5JH7 E;  1T7S A;  2I0M A;  3AAI A;  4TZ4 C;  1JUM A;  3RF1 A;  4NEL A;  2V6X A;  1ZEE A;  3BNI A;  4HN9 A;  4CZZ B;  1ORK A;  4M3F A;  3PU3 A;  3ZPO A;  3QPS A;  5JR9 A;  1IBK T;  3KFW X;  4BA9 A;  2NP5 A;  4H9R C;  5CQG A;  3PJA J;  3WI3 A;  3HE0 A;  3KZ9 A;  3ZQG A;  2J47 A;  2W0G A;  2WMO A;  5AQL B;  4IGU A;  3RQU A;  3I9W A;  2CBJ A;  3FRQ A;  1ZV4 X;  4KUM B;  3RH3 A;  2CXD A;  3VW2 A;  3KV5 A;  3ZYK A;  3KV4 A;  3RHW A;  2FX0 A;  2WWU A;  4DUY T;  4IDO A;  3BQL A;  3HIM A;  4MHC A;  2XAJ B;  4OK0 A;  1HFA A;  1VRB A;  5KMG P;  4AKL A;  2YDQ A;  2RAS A;  2X67 A;  3T6N A;  3CVR A;  5HWY A;  2G0U A;  3P4S A;  5C4Y A;  5F0F A;  2MTQ A;  2R6G F;  5ADX L;  3PV0 F;  4ZI7 E;  2E5L T;  4B3A A;  5AQU B;  3NXC A;  3AEF A;  2V7L A;  2JJ9 A;  4AKG A;  5D19 A;  2YKS A;  3ZN0 B;  4GIW A;  3PUS A;  3AQS A;  3I1A A;  2R7R A;  2R7W A;  2JPF A;  1WYB A;  2MOZ A;  3C64 A;  4U9N A;  3VKH A;  3SFI A;  1BR2 A;  2XSA A;  3AVR A;  2CLY C;  4MLK A;  1WR6 A;  4QXC B;  3E7Q A;  1QPI A;  3CIR A;  3B57 A;  5AQJ B;  3K3Q C;  3RX6 A;  2G0E A;  3E0Z A;  2O7T A;  1M7K A;  3RQW A;  4PNI A;  3WAJ A;  4DVD A;  2UXD T;  2EHO B;  3KYL A;  4JL3 A;  2VKV A;  5JRC B;  3CX8 B;  4JI6 T;  5F5W A;  3FIW A;  3ANW B;  4KMC A;  3ZCI A;  4IIJ E;  5J1U A;  4B3R T;  2DI4 A;  2WDQ A;  2XQA A;  2NTX A;  3PUR A;  1US7 B;  4UXN B;  3B6C A;  4XZC A;  4M3G A;  2EHO A;  2JQK A;  4M3B A;  3JC6 C;  3BT9 A;  2OER A;  2CXF A;  2IU5 A;  3DEW A;  3Q5X A;  3KV9 A;  3MNL A;  3HGY A;  4DUZ T;  2IBD A;  4MBQ A;  5D18 A;  3L3P A;  4MFR A;  1T33 A;  1SGM A;  3UT5 E;  2QA7 A;  2LHN A;  3RIA A;  2CCQ A;  2E9X C;  4OD5 A;  3RYI E;  3UU6 A;  4P0A A;  5AQN B;  2ZCX A;  5CXG A;  2WS3 A;  5L3G B;  4P0B A;  2ID3 A;  2XGE A;  3PUG A;  3AEB A;  4WYV A;  3RI5 A;  4OHF A;  3I9Y A;  1IAP A;  2W4X A;  3LK3 B;  3DJB A;  3NZP A;  3ZT6 A;  1UK5 A;  1KF6 A;  3C50 A;  4CN4 A;  1OED A;  4H63 V;  4QH4 A;  3ONL C;  2Q9Q D;  5JDH A;  4ZI2 D;  3BTJ A;  2X0Y A;  4EZH A;  2LM2 A;  3P4Q A;  2OF7 A;  3ZYM A;  3OJA A;  5EK4 A;  4DID B;  4ZZC A;  4IL9 A;  1MMD A;  3C07 A;  2NR4 A;  2PBI A;  3E08 A;  5JDF A;  1OED B;  4JI8 T;  2R7X A;  4QKN A;  4K0K T;  3MJX A;  2A72 A;  1SE7 A;  5DQW A;  5AQR B;  1HCI A;  3I0Q A;  2CLY B;  5FKY A;  3FZL B;  2J1D G;  4TNV A;  5J2T E;  4LF6 T;  2XQ7 A;  1UUS A;  4X1Y E;  3C4Z A;  1JNZ A;  3SOL A;  3CWZ B;  2JQ9 A;  4XAX B;  2V7M A;  3R84 B;  1KEY A;  5JDQ A;  3QBM A;  5CA1 E;  3O1I A;  3HKE E;  4HWD A;  4UEM A;  1R8I A;  2LT3 A;  3FBZ A;  3IEE A;  2LKG A;  3PUX F;  2PZ9 A;  1XNQ T;  3G1L A;  3LK2 B;  3LSR A;  3ZMS B;  5EK2 A;  3ESL A;  2KWI B;  2YEV C;  2BVL A;  3Q0W A;  5IOY A;  4H9N C;  5F0H A;  1LVK A;  2JJ7 A;  3NKZ A;  5JDM A; 
#chains in the Genus database with same CATH homology
 4U74 A;  3PUQ A;  4I4T E;  2VWA A;  5LCY A;  2N9D A;  5J1G A;  5TAO A;  4EAH A;  5HYA A;  3JC6 D;  3CQC B;  4NUV A;  5LJN A;  4UVA B;  4UVB B;  2KMF A;  1Y64 B;  3UUN A;  5L3F B;  5DQV A;  3RYH E;  2JQQ A;  4PAG A;  3ZJ1 A;  2VKJ A;  4ANJ A;  2D5U A;  1YKH B;  2K48 A;  5LGU B;  4L5G A;  2LSG A;  1WYC A;  3UUM A;  2R7U A;  3L09 A;  3F57 A;  2CXL A;  5JDL A;  2OA5 A;  2W63 A;  4PK5 A;  4TN7 B;  4AI6 A;  4ZI3 D;  3N9N A;  5LA6 E;  1FIO A;  5HXC A;  4AKR B;  3N9P A;  2XQY A;  4WBO A;  2KT9 A;  4EZ4 A;  2Z6E A;  3CML A;  5LHI B;  2P9B A;  2ACX A;  3N9Q A;  5M4Y A;  1HX8 A;  4BJM A;  4O4J E;  4BJN A;  2HH7 A;  3C4X A;  2WBL A;  3OYZ A;  1QSD A;  4KP3 C;  3ETV A;  5FY0 A;  4AQG A;  2YK0 A;  4H9Q C;  5LBQ B;  5L3E B;  3MZK B;  3N2O A;  2D2S A;  3EVY A;  3Q2M A;  3ZC1 A;  4H9S E;  2RA1 A;  3ZYL A;  3BQK A;  4X1K E;  3GMI A;  2ES0 A;  1BR4 A;  5LBM A;  2Q9Q C;  4OD4 A;  3B13 A;  2E9X A;  4HEA A;  4H63 H;  1NWM X;  2WSS V;  3CX7 B;  4OFZ A;  3ZEF B;  3ETU A;  3HL6 A;  4B6X A;  2H3R A;  2H7V C;  3PE0 A;  3BQI A;  1IZN B;  3MAC A;  4MAL A;  5LOV E;  1T98 A;  3C4W A;  3HKC E;  4U72 A;  3FHN A;  1BR1 A;  3C51 A;  5LJM A;  1WRD A;  3DP7 A;  2WAU A;  2LJL A;  3HI2 A;  4P09 A;  3LK4 2;  5IHY A;  3LBX A;  5A1L A;  4PK6 A;  3PU8 A;  3U3I A;  4H9P C;  4QX7 B;  4IE6 A;  4UF0 B;  4TV9 E;  4KBM B;  1HTJ F;  3FXD B;  4AKH A;  3DU6 A;  3J7Y q;  2PG8 A;  3VKG A;  3IF8 B;  1V9D A;  1B7T A;  2NW7 A;  3N2G E;  4I43 B;  3OKQ A;  3I0O A;  5FXX A;  2NW8 A;  3EUH A;  4QX8 B;  1S35 A;  2R7S A;  2LSI A;  1ZKE A;  4C91 A;  2X51 A;  4GK5 E;  3NRX A;  1HF8 A;  2LEH A;  3V5S A;  4AKI A;  2HPL A;  3O1H A;  2LSK A;  4OYJ A;  2A3D A;  2VAS A;  2W00 A;  4YHJ A;  5LG4 A;  2PJQ A;  2X66 A;  2UXN B;  4YJ2 E;  2WMN A;  5HAX A;  4GOU A;  2ODV A;  3GN5 B;  4ZI3 C;  3F31 A;  3EDV A;  4IST A;  2W62 A;  5LGT B;  5FXW A;  5HXS A;  2A2F X;  4YFS A;  2R7Q A;  2IC9 A;  4QHO A;  5H6R B;  5JR9 C;  5LHG B;  3LFM A;  2Y6X A;  1CUN A;  4ZOL E;  5JRC A;  3AVS A;  3CQX C;  3U78 A;  3KVA A;  2HPJ A;  2N2N A;  4GK0 E;  1SA0 E;  5FYM A;  1MMG A;  2DNX A;  2Y48 B;  1X79 A;  2W61 A;  4ISS A;  4IE0 A;  1FMW A;  1WLX A;  2LM9 A;  3LG7 A;  5L2L A;  4YLH A;  1BR0 A;  3AB3 B;  4EIW A;  5LXT E;  5LNK A;  3WAK A;  2CWY A;  2NOX A;  3EDU A;  4X1I E;  5KX5 E;  4PFP A;  4O8S A;  3ZMT B;  3KV6 A;  1IJ5 A;  2VKO A;  1HG5 A;  3N5L A;  3HA4 A;  4IE7 A;  4DMW A;  3D0T A;  2X9H A;  5L3B B;  2NWB A;  3ZJ2 A;  4DO0 A;  4DBQ A;  4L9I A;  1ZHC A;  3QUJ A;  2ZM0 A;  4I55 E;  2KIN B;  4GYS A;  3BK9 A;  3KBT A;  4F6R C;  4UF0 A;  2VKD A;  3FB2 A;  5EZY E;  3HR0 A;  2LHR A;  3UFE A;  2C0S A;  5HWX A;  5HXR A;  3RC8 A;  1QUU A;  4O2B E;  3KDS E;  4G63 A;  1D1C A;  2XAS B;  1YW0 A;  5ETW A;  4CXW A;  5CA0 E;  2CMR A;  2JMH A;  2X9Y A;  5JH7 E;  2DCF A;  1D1A A;  1OXZ A;  2X9W A;  2XUE A;  3AAI A;  2XAG B;  4IDZ A;  4TZ4 C;  4JEU B;  2BVM A;  5CB4 E;  4PJL A;  3PUA A;  4TV8 E;  2X68 A;  3J9X 1;  1SHZ C;  2ZMA A;  1ZEE A;  3MXZ A;  4HN9 A;  4CZZ B;  3PU3 A;  1O3X A;  1YKE B;  2E8I A;  2V26 A;  3ZPO A;  5JR9 A;  5L3D B;  1KK7 A;  3OYX A;  5FP3 A;  3KFW X;  4BA9 A;  2LSJ A;  3MK7 C;  4UV9 B;  4H9R C;  5CQG A;  3WI3 A;  4CXY A;  2DLR A;  2GK9 A;  3ZN1 B;  2D0T A;  4PJN A;  2W0G A;  4HFV A;  4ERR A;  1NAF A;  2WMO A;  2KND A;  3SWH A;  4IGU A;  1HS7 A;  2X9X A;  2E9X D;  3I9W A;  4ILU A;  4UV8 B;  4E7Z A;  1ZV4 X;  4KUM B;  3RH3 A;  2KWH A;  2CXD A;  3PDY A;  4CI2 B;  3KV5 A;  3ZYK A;  1Z0P A;  2H7O A;  3KV4 A;  1MMN A;  3GWH A;  1MIV A;  2I59 A;  4IE4 A;  4AQF A;  2XHE B;  3KIN B;  2WWU A;  2LOP A;  3VHL A;  2B3W A;  4H9O C;  3AA1 B;  4DBR A;  4CI1 B;  3BQL A;  2ODU A;  5JDN A;  3Q9D A;  3QK6 A;  4O2A E;  3ANW A;  2YU1 A;  4O4L E;  2MYS A;  3UUX B;  4MHC A;  5JRE A;  5JDG A;  2C5J A;  2XAJ B;  4HKA A;  1FEW A;  3FXE B;  4OK0 A;  1HFA A;  3UTK A;  5C8Y E;  5HXE A;  1VRB A;  2QGS A;  5KMG P;  4AKL A;  4UVC B;  5FY1 A;  3IBP A;  5J2U E;  2X67 A;  2XAH B;  3CVR A;  5HWY A;  2G0U A;  1H7C A;  3K3O A;  2MTQ A;  5ADX L;  3CQG B;  3O1J A;  4ZI7 E;  2Q9Q B;  3ZMU B;  2LE8 A;  2UXX B;  2V7L A;  2JJ9 A;  4DMV A;  4NUU A;  4AKG A;  5F8P A;  3ZN0 B;  2V7K A;  4UEL A;  3AA0 B;  3PUS A;  3FBL A;  4GIW A;  5JR9 B;  3I1A A;  2R7R A;  2R7W A;  2JPF A;  2MBG A;  1WYB A;  3KBU A;  2MOZ A;  3N2K E;  5IYZ E;  3C64 A;  2RP4 A;  3VKH A;  1BR2 A;  3AVR A;  3M65 A;  2CLY C;  4JEH B;  4MLK A;  3ZLI A;  1WR6 A;  4QXC B;  4CXX A;  5FXV A;  2NP9 A;  3B57 A;  3ZMV B;  4ZI2 C;  5FXZ A;  4EYU A;  4J2C A;  3K3Q C;  3RX6 A;  3HKD E;  3E0Z A;  3TKL B;  4DVY P;  4OYK A;  2R7V A;  4Z8X A;  4PNI A;  2IC6 A;  4QWN B;  5FMN A;  3SS1 A;  2LOS A;  4PJM A;  4DVD A;  3WAJ A;  3PTR B;  2IW5 B;  2R7T A;  2EHO B;  2VL8 A;  4V1A v;  4TX5 A;  3OBV E;  1S94 A;  3MA9 A;  3P7I A;  3KYL A;  2K24 A;  4HTE A;  5JRC B;  3CX8 B;  2NTY A;  4K0U A;  2VKH A;  4ZS2 A;  1MMA A;  4I50 E;  3O9X A;  3ANW B;  4KMC A;  3ZCI A;  3NBX X;  3VU7 H;  2DHR A;  3K3N A;  3NZQ A;  3C98 B;  4IIJ E;  3LJC A;  2D0U A;  2DI4 A;  3N9M A;  1LKX A;  2NTX A;  2ZM2 A;  3PUR A;  4O4H E;  1G73 A;  1MND A;  2ZM8 A;  1US7 B;  4UXN B;  4WNK A;  4EXT A;  3N9O A;  4XZC A;  4FJO A;  2EHO A;  2EHO C;  1HG2 A;  4ZS3 A;  4IE5 A;  2BZB A;  4AXP A;  3DTO A;  2CE7 A;  3JC6 C;  2E9X B;  4CI3 B;  3W15 B;  5AFU L;  2YIN A;  1MIY A;  2V7I A;  2L8K A;  4ZHQ E;  2CXF A;  3Q5X A;  3KV9 A;  2K9A A;  2KXP B;  4MBQ A;  3Q5W A;  3L3P A;  4MFR A;  3UT5 E;  5GON E;  3E22 E;  2QA7 A;  2LHN A;  4IHJ E;  1YD8 G;  3SRZ A;  1KNZ A;  2CCQ A;  2VB6 A;  2E9X C;  3QC9 A;  4OD5 A;  4UIG A;  3RYI E;  4P0A A;  1AJ3 A;  4ASK A;  4XBF B;  4JUY A;  3LBX B;  3AAE B;  2KZ7 B;  3ZMZ B;  5JVD E;  5L3G B;  2ZLY A;  4C90 A;  4P0B A;  3AA6 B;  4BAY B;  2JMK A;  3NS4 A;  4FI5 A;  3PUG A;  4E7S A;  1IJ6 A;  4CQI A;  1LVF A;  4OHF A;  3I9Y A;  4GYR A;  1IAP A;  2XAF B;  3RKO A;  4X20 E;  2C5I T;  3GA8 A;  3LK3 B;  3IHR A;  5HXH A;  2LSY A;  3DJB A;  3NZP A;  3ONX A;  3T8O A;  4C2M A;  2R7O A;  3NRY A;  2BDE A;  2XAQ B;  3CPZ A;  3C50 A;  2L3L A;  3KVB A;  4H63 V;  4HGA A;  4G2A A;  4JLE A;  4N78 D;  2Q9Q D;  5JDH A;  4ZI2 D;  3H37 A;  1G8X A;  2N1G A;  4EZH A;  2Y8D A;  1VOM A;  2YU2 A;  2FJI 1;  3ZYM A;  3RRW A;  2VK9 A;  4PFO A;  2WM9 A;  2PFV A;  3OJA A;  5BMV E;  3VTI A;  5FNV E;  5EK4 A;  5LHH B;  2CEA A;  3CKD A;  2V1D B;  2XTL A;  4WW0 A;  1MMD A;  3MKD A;  2PBI A;  3E08 A;  3DU5 A;  2NW9 A;  2C5K T;  2V7J A;  5JDF A;  3UUL A;  2R7X A;  4QKN A;  3MJX A;  2A72 A;  5DQW A;  2CWO A;  4WBN E;  1HCI A;  1UCU A;  3I0Q A;  2CLY B;  3F2E A;  3HKB E;  3S4U A;  1U5P A;  2L9Q A;  2J1D G;  5KDM C;  2DWK A;  2CM0 A;  3AAA B;  3R6N A;  3RPU A;  3A5X A;  1E1H B;  5DJQ C;  2EHO D;  4PW8 A;  1D0Z A;  3ZC0 A;  3N9L A;  2B1E A;  5J2T E;  1UX5 A;  4O4I E;  5FY7 A;  3GN5 A;  4DND A;  3P8C D;  4X1Y E;  5F3J A;  1MNE A;  5L3C B;  5LYJ E;  5JQG E;  4TUY E;  3CX6 B;  3C4Z A;  4IRV A;  2X0L B;  1FMV A;  4ADZ A;  1D0Y A;  3SOL A;  2CA5 A;  4A56 A;  1MIW A;  3CWZ B;  2M67 A;  4XAX B;  2V7M A;  3RYF E;  3R84 B;  4EYY R;  5H6Q B;  4QXH B;  4PJJ A;  5JDQ A;  5CA1 E;  2K5B B;  5E0O A;  2IAK A;  3O1I A;  3RC3 A;  3HKE E;  4UEM A;  3FBZ A;  2LT3 A;  3ZCJ A;  3IEE A;  5LP6 E;  4PK4 A;  1UX4 A;  5DAB A;  4L0R A;  1D1B A;  4EOZ B;  4QXB B;  3O4X E;  1LRZ A;  2Q9Q A;  2KLQ A;  2DWG A;  4YJ3 E;  1OWA A;  3RYC E;  4EB6 E;  3LK2 B;  3K8P C;  5LGN B;  2JRK A;  4M1P A;  5EK3 A;  3ZMS B;  1D0X A;  5EK2 A;  3ESL A;  3V5U A;  2KWI B;  2SPC A;  2YEV C;  1U4Q A;  2BVL A;  4H9N C;  3AA7 B;  1LVK A;  4HE8 A;  1EZ3 A;  4AQF C;  3RRC A;  5JDM A;  3H3A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...