2A2FX

Crystal structure of sec15 c-terminal domain
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
317
structure length
296
Chain Sequence
NILWELLHNMRDHYNEVLLQRWVHVFREILDKEQFLPMVVQNTEEYECIIERFPFHSEQLEPKKFPFSRMVPEVYHQAKEFMYACMKFAEELTLSPNEVAAMVRKAANLLLTRSFSGCLSVVFRQPSITLTQLIQIIIDTQYLEKAGPFLDEFVCHMTNTERAMFHVARQDAEKQVGLRICSKIDEFFELSAYDWLPGIASAFITDMISYLKSTFDSFAFKLPHIAQAACRRTFEHIAEKIYSIMYDSTGALTQINLDLMQCEFFAASEPVPGLKEGELSKYFLRNRQLLDLLILE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sec15 interacts with Rab11 via a novel domain and affects Rab11 localization in vivo.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Protein transport
molecule keywords Exocyst complex component Sec15
total genus 109
structure length 296
sequence length 317
ec nomenclature
pdb deposition date 2005-06-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.30 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor; domain 2 2a2fX01
1.20.58.670 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2a2fX02
2A2FX 3FHNA
chains in the Genus database with same CATH superfamily
2VURA 2R7UA 3PJAJ 1HCIA 4H63H 3CQXC 5IHYA 3Q0WA 2IEKA 2V7MA 3ON2A 1SUMB 5EK4A 2X9WA 4LMLA 3RKGA 5L3BB 4PK5A 4JYAT 2YKSA 3TLVA 3QB5A 3MJXA 3QPLA 2SPCA 2D6YA 2E5LT 1T72A 2W00A 3OYXA 4H9QC 5ABGA 4BJMA 5JDNA 4DVYP 2XQYA 2WB5A 1X9BA 2WV1A 4H9RC 1OEDB 5KXJA 2G0EA 3CJDA 5EZHA 2BG9E 5JQGE 4GK0E 3ESLA 4MLKA 5K58A 2JK3A 2V5DA 3CVRA 4PFPA 4Q25A 2GFNA 2ZY9A 2XGDA 4KMCA 3AECA 1WR0A 4X5TA 3G06A 4DV2T 1YD8G 2E9XB 4IE7A 5CA0E 2VB6A 2XDNA 2E8IA 2OA5A 4IDNA 2HN1A 4DV0T 3DU6A 4YJ3E 4DR5T 4HFHA 3ABVA 3LJLA 2LKGA 4HGAA 4WW0A 2CBJA 5L4HA 3QK6A 3LOCA 1QPIA 2I0MA 2FBQA 1Z0XA 3COLA 4JUYA 5IUXA 3D0TA 3ZMVB 3K3OA 5HEJA 4PFOA 4LF4T 3C64A 3HTHA 2BKPA 5J1GA 2IAIA 2G0UA 2JQ9A 4ZI7E 4TZ4C 4HN9A 2V7KA 4H9SE 3M3ZB 1IAPA 2Q24A 5JRCA 4COFA 3IBPA 4IREA 4G63A 4GCTA 3EDUA 3PTRB 3A5XA 4CQIA 2LSKA 4YSXA 4B3AA 3J9X1 5LMNT 5KDMC 4I55E 4CXXA 2DWKA 2LSYA 3TP3A 4JNNA 1Z77A 4ZOLE 1UI6A 1HNXT 1YKEB 3VVXA 4HFEA 5JDFA 2YVHA 5JDGA 3Q5DA 3AEDA 5HXEA 1IBKT 3VTIA 4JI5T 3EAMA 4MK6A 3PJAA 3G7RA 3AAIA 2LSGA 3MNLA 3HKDE 4DBQA 3C51A 3A8YC 2BVMA 3CCYA 4YY3T 3BTCA 2UXPA 1QVUA 4LFAT 4IE4A 3U3IA 4GYRA 3RQUA 1UI5A 4X65T 3GMIA 3LK2B 4HFBA 4X1KE 2WBLA 3P9TA 4FI5A 3AE6A 4GOUA 2G7LA 4JLEA 4U7IA 1FEWA 4GCLA 5HCJA 3PASA 3VR8A 4IGUA 4YHJA 3JAFA 4NUVA 3AE8A 4HE8A 1KEYA 3BTIA 5F5WA 2XRLA 4DV5T 5FY1A 2HYTA 3ZN0B 3J7Yq 4X66T 3B5MA 3Q3SA 2CXFA 1W09A 4UEMA 1KNPA 3PUYF 4DBRA 3PUXF 3A7MA 4YTMA 2QYWA 2WAUA 1KF6A 2ES0A 3LDQB 5FNVE 4AKLA 4YSYA 4IDQA 3L09A 3O4XE 2X9HA 2CWOA 4JEHB 2XQ7A 1R8IA 3F1BA 5F3JA 3ZMUB 2WZHA 2MOZA 3UFGA 4O2AE 4QX8B 3EVYA 3I0OA 1HNZT 4NELA 3R84B 2YOEA 2ZCNA 3QOFA 1SE7A 4UVCB 2XPKA 3IEEA 2LRLA 3O60A 4PJMA 5D19A 1D1BA 1KNRA 2JQHA 5FKYA 2RASA 4ADZA 2IHR1 4AQGA 2WMOA 2VKOA 2VL8A 2W62A 3ZCJA 5LCYA 1T98A 4ILCA 4UIGA 2Y31A 2K9AA 3VKGA 3UULA 1U9NA 3BR2A 3B6AA 1N33T 3LBXB 3IF8B 4L0RA 2TCTA 2DG7A 4ILBA 3KDSE 1H7CA 3MKDA 5HXSA 2YN6A 4QKNA 3RX6A 2JMKA 2FJI1 5IOYA 3H3MA 3JCFA 2YK0A 2B76A 4JI0T 4GYSA 5JR9A 2RPAA 2V6YA 3Q2MA 5C3JA 2R7OA 1RKWA 3CK6A 2CHNA 2A9UA 2DL1A 4GFLA 3P7IA 3O1IA 2QKOA 3JC6C 1IBMT 2WDRA 5EZGA 3AQSA 4A98A 3ZC1A 4I6ZA 4UV8B 3OPCA 2JIWA 4UXNB 3ZC0A 5TAOA 3V5UA 3VPRA 2KMFA 4OFZA 2W0GA 3AE1A 3KKCA 4P0AA 3KV5A 3TLUA 3ANPA 3RF1A 4IDPA 1IBLT 5ABHA 4H63V 4JI6T 1G8XA 2N1GA 4JBWF 5KMGP 4JV5T 4M3DA 3OKQA 2UXNB 2Q9QC 2XGEA 2Y2ZA 4JI7T 4JYKA 3EUPA 5JH7E 4LFBT 2XAQB 2VVNA 1HNWT 4X62T 3V78A 4BJNA 2CXDA 4DW6A 4HWHA 3PUAA 3FZKB 2QIBA 3I1AA 3EGQA 3ONLC 2J62A 2NTYA 3CX8B 3P50A 5HEHA 2CXLA 2XSAA 3BQYA 4MFRA 5HCMA 4B3MT 1BJZA 4W97A 2I6HA 2FX0A 3I0QA 4X1YE 4HWIB 2PG8A 2VVSA 2LHNA 2VKEA 2FUPA 3LSVA 5LHIB 3V6GA 3C98B 2PFVA 2G7SA 4DR4T 3VRBA 2JQQA 4ACIA 1XDPA 3F31A 4AI6A 2G3BA 4UDSA 4DMWA 2M6BA 1XZYA 2E2AA 4V2GA 1OEDE 5FKKA 1E7PA 3BK9A 4O8SA 2IDOB 3MVPA 3ZQFA 5LHGB 4ZI3C 2E9XA 3HA4A 2OPTA 3C4XA 2QTQA 1L0VA 3FK6A 4HKAA 2A2FX 3UUBA 3NNRA 3ON4A 3HI2A 3IUVA 1VRBA 4O2BE 4B1RA 1VCTA 1WFDA 3V5SA 1LVKA 3E7QA 4EGWA 2WGBA 1WCRA 4NXNT 1YKHB 4DV3T 1A6IA 2HHHT 1W9RA 2ZM0A 2D5UA 2MBGA 2UXIA 2ID3A 4V2FA 4MBQA 3P4PA 2YINA 3IH4A 2JPFA 5JDQA 4DR7T 4HWCA 2HXOA 5LJNA 2X9DA 1ZV4X 3ONJA 2WWUA 2W53A 2XQ8A 2NR4A 2RHAA 2N9DA 2CHOA 4L5GA 5M4YA 5GP9A 2JQKA 5CFBA 3PUQA 4I76A 5CQGA 3DEWA 3G1LA 4KHPT 4U7YA 5L3EB 2BBJA 1OWAA 3N2GE 2WS3A 1E1HB 2CMRA 3RC3A 5C2TA 2UXUA 2UUCT 4ISSA 2W61A 3AA1B 4HFVA 3L3PA 2X9XA 4O4HE 5LNKA 4O4LE 4O4IE 3AEGA 5F04A 4HFDA 2ZCMA 3LSRA 1JT0A 4QXBB 4AKGA 3BT9A 4TWHA 4C90A 2FJDA 2NWBA 4PXIA 4L9IA 3RPUA 3Q9DA 3RQWA 1MIYA 4P1NA 3TLWA 3WAJA 2XSBA 3RYFE 2M67A 2IC9A 3ZMSB 2MAWA 5CXIA 1W0BA 3FZHB 3UT5E 2UXHA 2R7QA 1U5PA 5LA6E 1ZOYA 3ZLIA 1EZ3A 2CBIA 2FQ4A 3EDVA 3FIWA 2H89A 4DR3T 1O3XA 2CM0A 2GENA 1Z0PA 4YFSA 3RIFA 3NXCA 1SA0E 2XM2A 4QH1A 3SRZA 5IP6A 2Y8DA 3KV6A 3UUNA 4ABZA 1XDOA 3VOKA 5C4YA 5CA1E 2KXPB 3WAKA 3B81A 3CRJA 3PE0A 5F8PA 3ANGA 1CHUA 4I43B 4PAGA 1HG2A 3CQGB 3RYHE 3RH3A 3SS1A 2BKOA 2IMLA 4DV6T 2W4XA 3RC8A 3P4WA 3S5RA 3LJCA 5LMUT 3AA0B 2BZBA 2KLQA 4LF7T 3L39A 3N9QA 3HIMA 1KNZA 3SOLA 2OV9A 3M65A 2TRTA 5DAJA 2CCQA 2BS4A 2V6XA 1VOMA 3QUJA 2MYSA 3Q5WA 4QH5A 4YZEA 1JUSA 1S94A 1T56A 4U72A 3GA8A 3NKZA 4AC6A 2QA7A 1KK7A 4YT0A 3VOXA 2YU2A 2E5VA 2F4VT 4EV6A 2Q9QA 5F08A 3IHRA 3KV9A 2D0UA 3IH2A 4X1IE 1ZKEA 4AIUA 2X66A 4GKKT 5HXCA 2R7VA 4NIQA 5HAWA 3KNWA 4GFKA 4ANJA 2EHOD 2YDSA 3CDLA 5LB7B 1NENA 1KFYA 2YDQA 4U9NA 4NN1A 4AQYT 4ZZBA 4H9NC 4UELA 4QXCB 3BJBA 3AVRA 2XAGB 2OI8A 5GPAA 3F57A 2Y6XA 5LGTB 3CMLA 5LGNB 2F07A 3G1MA 3C4ZA 5AQUB 2LT3A 4ZZCA 1XMOT 5AQOB 2D0TA 4EIWA 3ZKRA 2QOPA 5D1RA 1QSDA 3MACA 1J5ET 4DVDA 5FL0A 3HTIA 3K1SA 4B3ST 4NUUA 2W66A 2E9XC 3C07A 2LJLA 3AE3A 1N34T 2YU1A 2N2NA 1YW0A 3SDGA 1JUMA 5ETWA 4AC0A 3NPIA 4QH4A 3ZQIA 2CEAA 4EYYR 3NRGA 3EI0A 1IJ6A 4D5CA 3C50A 5AQQB 2AE9A 4ERRA 5J2TE 3KBTA 2YVEA 4DO0A 4DIDB 2HKUA 3KKDA 5FKMA 3ZQGA 3KVAA 3E0ZA 4OX9T 3N5LA 4DR1T 4JI2T 2PJQA 4Z8XA 4GK5E 1QLBA 4AF5A 3SFEA 1OEDA 3PUVF 4AQFC 3DU5A 2XAFB 3JADA 2ACZA 3ZSSA 3HGGA 3LG7A 4CI2B 2WUIA 3BTLA 1ZHCA 1Z8UA 3AB3B 2R7XA 2IU5A 3AAAB 4YJ2E 2ZCXA 4ZI2C 4I4TE 3NZPA 3QPSA 5A1LA 1SHZC 2RAEA 5HXHA 5LBQB 5JR9C 4C2MA 4CGRA 2WM9A 5CJ5A 1UUSA 2XQAA 3NS4A 2NX4A 3MK7C 4CN1A 4TWDA 1XNRT 1OXZA 2XY8B 5JR9B 3N9NA 3PUGA 3PURA 2UUBT 2R7RA 4LF6T 3E22E 4LMJA 2X0YA 4IHJE 1Y64B 1U9OA 2BVLA 4KWAA 2UXBT 2IBDA 3RIUC 2KSRA 2UXCT 2QCOA 2EH3A 1MNDA 3GWHA 5ABFA 3WI3A 3FZFB 3LBXA 4DR6T 3ZYMA 2RA1A 3CQCB 3ZMTB 5HEOA 2H88A 4KUMB 2PBXA 4GIWA 2CLYC 2KNDA 2V1DB 3OJAA 2DHRA 4OYJA 2KWIB 5LGUB 4ICHA 5AQJB 2VL0A 3T1HT 4W1UA 4ISTA 1LRZA 1YQ3A 4EXTA 4V1Av 3RLFF 3P8CD 2ZOYA 3HE0A 4XAXB 3ZPOA 2Q9QD 4JKZA 2RP4A 3HGYA 3BR6A 2VKDA 2W2UA 4H9PC 3ZT6A 4LFCT 1UGOA 2DLRA 1S35A 4N78D 2HN2A 3Q0UA 4JI1T 4JI3T 2O7TA 1VI0A 3F2EA 2GUHA 5FXXA 2V7JA 3PV0F 5AQKB 3QKXA 5FKOA 2DCFA 2PTFA 2XQ6A 3G1OA 4IDZA 5HEGA 3FBZA 5JDLA 1HF8A 2W63A 5F0FA 4QHOA 5IYZE 2XUEA 4OD4A 2NW7A 4L62A 5C8YE 1FMWA 2L3LA 2NP5A 1NAFA 4NXMT 2C5JA 2FJEA 1N36T 1ORKA 3HTJA 4YTNA 2EHOB 2P9BA 4X64T 5F0CA 3T8OA 3AXJB 3LK3B 4U31A 3NI7A 5HBUA 3RYIE 5AFUL 3RIUA 3QC9A 5JRCB 5IOZA 3AEEA 2JRKA 3H3AA 4KX6A 4F6RC 2A3DA 5FKLA 4HKUA 4WBNE 1JNZA 3AE4A 1MMAA 2WU5A 2BG9C 2BDEA 1WRDA 3TP0A 3ZT5A 2XPUA 3ZJ2A 2KZ7B 3FB2A 1MIVA 3EUHA 2Y30A 2J4GA 3AAEB 4IDOA 3GEUA 2WMNA 5FXVA 3N2KE 4K0UA 4U33A 1VCSA 2LOPA 4M3GA 2DI4A 3NZQA 4CXYA 4WIBA 2FD5A 4EZ4A 5HXRA 4QWNB 2H7VC 1JUPA 5CXGA 2PZ9A 2VKVA 4M3BA 4WBOA 5J2UE 2BKNA 5AQCA 5EZYE 4G2AA 3WHBA 3SFIA 2J1DG 3FXEB 2XM1A 5FY7A 2YEVC 2WDQA 2NS8A 4ZXLA 4ZS2A 2X6OA 4KI0F 4J2CA 3ZMZB 3VW2A 3UU4A 2NW8A 4G12A 5ADXL 4UVAB 3R6NA 3VUQA 4CXWA 3O9XA 2C0SA 3IH3A 3FXDB 3K8PC 4M3FA 4HFIA 2M6IA 4ILAA 2XAJB 2W67A 2XHEB 5BMVE 3UQ7A 1WYCA 1LKXA 3AQTA 1OEDC 4AKHA 4AQFA 4U2YA 3T6NA 2XJ7A 4Z90A 2CLYB 4OD5A 1JTYA 2DG8A 3GN5A 3RRCA 1IZNB 1QUUA 2YDRA 4U9LA 2X9YA 5FMNA 5H6QB 5L2LA 4M3EA 4P09A 3PUZF 3P4RA 3O1JA 2XQ3A 4JEUB 2CA5A 3LK42 1I94T 3UQ4A 2WSSV 4TNVA 1IJ5A 2IUBA 1NWMX 5J0ZA 3Q5XA 3PU8A 3KYLA 3AEFA 3CKDA 2IW5B 4TX5A 5AQSB 2ODUA 5FL1A 2XZEA 3AEBA 1Y01A 4A56A 4XK4A 1BR0A 5FYMA 1FIOA 2NTXA 2UUAT 2KT9A 1FJGT 4IE0A 4Z91A 3DPJA 3BR5A 3HL6A 5FY0A 2L8KA 5HYAA 2LLYA 2XTLA 2VWAA 1XMQT 1XWMA 2R7WA 4DMVA 4K0KT 1JNRA 3MZKB 4A5XA 2HH7A 2D2SA 1M62A 1YXRA 3VW0A 4AKIA 3RD3A 2IC6A 5F27A 5EFYA 3HKBE 5F0HA 4UF0B 2YVXA 2VKHA 2WZIA 5AQRB 2GK9A 3E08A 4AXPA 2CE7A 2LRKA 2UXDT 5DJQC 2ACXA 4AUXA 5HWXA 5KX5E 1UX5A 3HTAA 4EOZB 2V57A 4YSZA 4D7MA 5JDMA 1ZP0A 3O1HA 5AQMB 3ZYLA 2LE8A 3ETVA 2CPTA 3SWHA 4I50E 5LOVE 2AXDS 1WYBA 2HXIA 4EAHA 4EYUA 4MO7A 1J1JA 4OHFA 2G7GA 4PJLA 3FZMB 2MPKA 2OF7A 5J1YA 5IWAT 5K7FA 2H7OA 3K3NA 1W0AA 2WQYA 5LG3A 4BA9A 2HQ5A 3L8RA 4AISA 3LFMA 3O8HA 5CW8A 2HYJA 5FGLA 1UX4A 2LM9A 3TLSA 3BR0A 2V7IA 3T1YT 3RGLA 4XBFB 5EYRA 4GKJT 5K7ZA 1WLXA 5LYJE 5GONE 3KINB 5AQPB 2Q9QB 5J3LA 4OK0A 5EK2A 2FBWA 1D0YA 4A97A 3BQIA 2Y48B 3N9PA 4UV9B 3AA6B 4TUYE 2V5CA 3CX7B 3FK7A 4GCKA 2MTQA 3CWZB 1MIWA 2LSJA 4IE6A 5LJMA 1BR1A 1QVTA 2I10A 2OLTA 2C5KT 2R7TA 4WYVA 4E7ZA 3LSPA 4P0BA 2R6GF 2LEHA 2ID6A 3PPBA 2HPLA 5CB4E 2KWHA 1M7KA 5H9TA 4YHHT 2QWTA 2B1EA 5HAXA 3X1DA 2NOXA 3O8GA 2O7OA 2JMHA 1E2AA 3OYZA 3PDYA 1LVFA 5JTGA 2FJ1A 2NP9A 3Q0VA 3KFWX 2XQ9A 5JDHA 5EK3A 2X0LB 4IIJE 3VU7H 4ZS3A 2ZOZA 4IL4A 3B57A 3TKLB 3CX6B 1FMVA 2OERA 3KZ9A 4XZCA 4TWFA 3OBVE 3AE2A 5FVLA 1HTJF 3LWJA 2J47A 3BR3A 3NRYA 4HFCA 3FBLA 5LG4A 2FJBA 1JT6A 4DNDA 3RRWA 2FJAA 3QNUA 5LP6E 4E7SA 2HPJA 3FZLB 2I59A 5HEUA 4B6XA 4PW8A 2C5IT 2KINB 4D5FA 3RHWA 4EZHA 1MMDA 4MHCA 4TV8E 4ZHQE 5AQTB 5AQVB 3PUSA 2NP3A 5FP3A 1ZKGA 1V9DA 4B3TT 5JREA 3VVZA 2CRBA 1MMGA 3I9YA 4TN7B 4UR9A 3AA7B 3OVUA 3N9LA 3NBXX 1MMNA 1DU2A 5FXZA 4U3CA 2QGSA 1UCUA 5LHHB 2XAHB 5AQIB 4DV7T 4FJOA 2JJ9A 1YQ4A 4LF5T 2R7SA 2WU2A 3ONXA 4HTEA 3AE7A 1D1AA 2QVAA 3NWIA 4CN6A 3AXJA 4MALA 5CGMA 2XQ5A 1G73A 5L3FB 5DQWA 3DCFA 2DNXA 3MA9A 4CZZB 3UU6A 3UU5A 1D1CA 4AKRB 5FHPA 4YLHA 3BTJA 4QXHB 4IL9A 3VHLA 3KV4A 2BS3A 4B3RT 3ZJ1A 4LF8T 5JVDE 3HR0A 5F1JA 4LF9T 2ZM8A 3IA3A 4ILUA 2WY2A 2LHRA 5LXTE 1B7TA 5J1UA 1HX1B 3QB5K 2LOSA 3ZN1B 2XPWA 2CWYA 3AVSA 1JTXA 5AQNB 1UK5A 5L3CB 4HEAA 5GPCA 4UF0A 2K48A 2NS7A 1BR2A 2K3WA 2V6YB 2ZMAA 3K3QC 2D9DA 3RYCE 4OYKA 3HKEE 2VASA 1CUNA 3OTOT 1U4QA 1T33A 3VKHA 2X0HA 2V7LA 4YXDA 1AJ3A 5ABFB 1RKTA 2LKHA 2IAKA 3U78A 3EHZA 4D7NA 3G56A 3P4SA 4PNIA 3LHQA 5AQFB 2REKA 3HKCE 4KBMB 1N32T 1XNQT 3JAEA 1MNEA 4ASKA 4HWDA 4NPPA 3ZSTA 5AQLB 1HS7A 4U2ZA 5FXWA 3CIRA 1HG5A 2X68A 4KHZF 3BQZA 4BAYB 2ZM6T 4MXMA 1T7SA 2IIUA 2L9QA 1HFAA 3KBUA 4QX7B 2BG9B 2DWGA 2BBHA 2ZM2A 2H3RA 2WDVA 3BQLA 2XQ4A 4X20E 5ABEA 5DABA 3BR1A 3WHCA 3F0CA 3PU3A 3BCGA 1WR6A 5HWYA 4C91A 4KP3C 4YTPA 3UUXB 3RIAA 2BG9A 1UURA 3BRUA 3QBMA 5L3GB 4DUZT 5AQGB 2EHOC 4IE5A 3CWRA 3UU3A 5AQHB 3NRXA 4I0UA 3UUMA 3ZYKA 3UFEA 3EABA 1NEKA 2QRXA 3RH2A 3VIBA 4CI3B 5L4EA 3BNIA 3C2BA 3N2OA 4F8HA 3KVBA 2LM2A 4TNWA 3VR9A 1X79A 2VK9A 4EEBA 3PUWF 4PK4A 3GN5B 3BQKA 3JC6D 2UU9T 4WNKA 4CI1B 3Q5EA 1ZK8A 2VPRA 5K7HA 3ANWB 4EEDA 2WCAA 3N9MA 2WP9A 1I6ZA 3ZQHA 1RPWA 3W15B 4DUYT 2A72A 3JSJA 2XPVA 2UXOA 4IRVA 3B13A 4IT4A 3B6CA 2WWVA 2ODVA 2JJ7A 4ZI2D 5LBMA 1ZEEA 2VQET 3ZCIA 2PBIA 2Z6EA 1GQEA 3S4UA 2UXXB 5J1RA 3CPZA 2LSIA 2VQFT 3C4WA 2GBYA 1SGMA 3VVYA 5FMPA 2ZLYA 3ANWA 5H6RB 4JI8T 3P4QA 1US7B 3ZQLA 4DV4T 1J5WA 2K24A 4M1PA 2NW9A 3AE5A 5DQVA 1D0ZA 2K5BB 3GZIA 1BR4A 2E9XD 3FRQA 3VW1A 2ZB9A 3RKOA 3TLTA 3AE9A 3UU8A 1HR0T 3ETUA 4CN4A 5FKNA 4HWFA 4PK6A 5HSZA 3QQAA 5L3DB 3BHQA 2BS2A 2XASB 4ME9A 5IPAA 3N9OA 3ZT7A 3ZEFB 3NVOA 4DR2T 4U74A 3AEAA 4ZEYA 4EB6E 3I9WA 2EHOA 4UVBB 5BR8T 3H37A 2XGCA 4JL3A 3VP5A 3DTOA 3DP7A 4LMKA 5D18A 3LSJA 4H9OC 4WZXA 4X1EA 4PJJA 3PM1A 3VRAA 2DTZA 1D0XA 4O4JE 5L47A 4DV1T 3MXZA 4ZI3D 1T8BA 5E0OA 4JI4T 3FHNA 2VKJA 3SFDA 2B3WA 2X51A 3DJBA 2V8SV 1HX8A 4PJNA 2V26A 3UTKA 2X67A 2XB5A 3RI5A 5FVKA 4TV9E
chains in the Genus database with same CATH topology
5CB4E 2KWHA 2R7RA 2R7UA 3E22E 1HCIA 2JQQA 4H63H 3F31A 3CQXC 4IHJE 1Y64B 4AI6A 5IHYA 2B1EA 4DMWA 5HAXA 2BVLA 2V7MA 2NOXA 5EK4A 2X9WA 2JMHA 3BK9A 5L3BB 3OYZA 4O8SA 3PDYA 1LVFA 4PK5A 1MNDA 3GWHA 5LHGB 3MJXA 2E9XA 4ZI3C 2NP9A 2SPCA 3WI3A 3HA4A 3KFWX 3LBXA 2W00A 3C4XA 5JDHA 3OYXA 4H9QC 3ZYMA 2RA1A 4BJMA 3CQCB 5EK3A 4HKAA 5JDNA 4DVYP 2A2FX 2X0LB 4IIJE 3ZMTB 2XQYA 4KUMB 4H9RC 3VU7H 4GIWA 4ZS3A 2CLYC 5JQGE 2KNDA 2V1DB 3B57A 4GK0E 3ESLA 3TKLB 3CX6B 3OJAA 1FMVA 2DHRA 2KWIB 3HI2A 4MLKA 4OYJA 5LGUB 1VRBA 4XZCA 4O2BE 3OBVE 3V5SA 3CVRA 1HTJF 4ISTA 1LRZA 1LVKA 4EXTA 4PFPA 4V1Av 4XAXB 3P8CD 3NRYA 3ZPOA 3FBLA 1YKHB 5LG4A 4KMCA 2Q9QD 2ZM0A 2D5UA 2MBGA 2RP4A 4MBQA 1YD8G 4DNDA 2E9XB 2YINA 3RRWA 4IE7A 5CA0E 2VB6A 5LP6E 4E7SA 2HPJA 2VKDA 2I59A 2JPFA 2E8IA 2OA5A 4H9PC 5JDQA 4B6XA 4PW8A 2C5IT 2KINB 5LJNA 2DLRA 1S35A 3DU6A 1ZV4X 4YJ3E 2WWUA 4EZHA 1MMDA 4N78D 4MHCA 4TV8E 4ZHQE 2N9DA 3PUSA 5FP3A 3F2EA 1V9DA 5JREA 4L5GA 5FXXA 5M4YA 2V7JA 3PUQA 4HGAA 4WW0A 5CQGA 1MMGA 2DCFA 4IDZA 3QK6A 3FBZA 3I9YA 4TN7B 5JDLA 5L3EB 3AA7B 1OWAA 4JUYA 3N2GE 3N9LA 1E1HB 3NBXX 3D0TA 1HF8A 2CMRA 2W63A 1MMNA 4QHOA 3RC3A 5IYZE 5FXZA 2XUEA 2QGSA 4OD4A 3ZMVB 1UCUA 5LHHB 2XAHB 3K3OA 4PFOA 4ISSA 3C64A 4FJOA 2NW7A 2JJ9A 2W61A 3AA1B 4HFVA 5J1GA 3L3PA 2X9XA 4O4HE 2G0UA 5LNKA 2R7SA 3ONXA 4ZI7E 4HTEA 4O4LE 4TZ4C 4HN9A 1D1AA 2V7KA 4O4IE 5C8YE 1FMWA 2L3LA 4H9SE 4MALA 1NAFA 1IAPA 2C5JA 1G73A 5L3FB 5JRCA 4AKGA 4QXBB 5DQWA 3IBPA 4G63A 2DNXA 3MA9A 4CZZB 4C90A 3EDUA 3PTRB 2NWBA 3A5XA 2EHOB 4CQIA 2LSKA 1D1CA 2P9BA 4L9IA 4AKRB 3RPUA 4YLHA 3J9X1 3Q9DA 4QXHB 1MIYA 3VHLA 3WAJA 3KV4A 5KDMC 4I55E 3RYFE 2M67A 2IC9A 3ZJ1A 3ZMSB 4CXXA 2DWKA 3T8OA 2LSYA 3UT5E 5JVDE 3LK3B 3HR0A 3RYIE 2ZM8A 5AFUL 4ILUA 2R7QA 2LHRA 3QC9A 4ZOLE 5LXTE 1B7TA 1U5PA 5LA6E 3ZLIA 5JRCB 1EZ3A 2JRKA 1YKEB 3H3AA 2LOSA 3ZN1B 4F6RC 3EDVA 2A3DA 2CWYA 3AVSA 5JDFA 5JDGA 4WBNE 5HXEA 5L3CB 1MMAA 1O3XA 4HEAA 3VTIA 2CM0A 2BDEA 1WRDA 4UF0A 1Z0PA 4YFSA 2K48A 3ZJ2A 2KZ7B 1BR2A 1SA0E 1MIVA 3FB2A 3EUHA 3AAIA 3AAEB 2LSGA 2ZMAA 3SRZA 2WMNA 5FXVA 3HKDE 4DBQA 3N2KE 3C51A 2Y8DA 3KV6A 4K0UA 3UUNA 2BVMA 3K3QC 2LOPA 3RYCE 5CA1E 2KXPB 4OYKA 2DI4A 3NZQA 4CXYA 3WAKA 3HKEE 4EZ4A 2VASA 1CUNA 5HXRA 4QWNB 3PE0A 1U4QA 2H7VC 5F8PA 3VKHA 4IE4A 4I43B 4PAGA 2V7LA 3U3IA 4GYRA 1HG2A 1AJ3A 4WBOA 3CQGB 3RYHE 3RH3A 3SS1A 2IAKA 5J2UE 3U78A 3GMIA 3LK2B 5EZYE 4G2AA 2J1DG 4X1KE 3RC8A 2WBLA 3FXEB 5FY7A 4FI5A 2YEVC 4PNIA 4ZS2A 3LJCA 4GOUA 3HKCE 4J2CA 4KBMB 4JLEA 3AA0B 2BZBA 3ZMZB 1FEWA 2KLQA 3N9QA 1MNEA 4ASKA 1KNZA 3SOLA 4IGUA 4YHJA 2NW8A 3M65A 4NUVA 1HS7A 2CCQA 5FXWA 1HG5A 4HE8A 5ADXL 4UVAB 2X68A 3R6NA 1VOMA 5FY1A 4BAYB 3ZN0B 3QUJA 3J7Yq 2MYSA 4CXWA 2CXFA 2L9QA 1HFAA 3Q5WA 4UEMA 3KBUA 3O9XA 2C0SA 3FXDB 3K8PC 4DBRA 4QX7B 2DWGA 2XAJB 1S94A 2ZM2A 2H3RA 3GA8A 4U72A 2XHEB 2WAUA 2ES0A 3BQLA 5BMVE 5FNVE 4AKLA 2QA7A 1KK7A 1WYCA 2YU2A 4X20E 1LKXA 3L09A 2X9HA 2CWOA 3O4XE 2Q9QA 5DABA 4JEHB 4AKHA 3IHRA 4AQFA 3KV9A 2D0UA 3PU3A 5F3JA 3ZMUB 2MOZA 1WR6A 4X1IE 1ZKEA 5HWYA 2CLYB 4OD5A 4C91A 4KP3C 2X66A 4O2AE 5HXCA 3UUXB 2R7VA 3GN5A 4QX8B 3RRCA 1IZNB 1QUUA 3EVYA 3I0OA 5L3GB 2X9YA 5FMNA 5H6QB 5L2LA 4P09A 2EHOC 4IE5A 3R84B 4ANJA 3NRXA 3UUMA 3ZYKA 2EHOD 3O1JA 4UVCB 3UFEA 4JEUB 2CA5A 3IEEA 3LK42 2WSSV 1IJ5A 4PJMA 1D1BA 4CI3B 1NWMX 3Q5XA 3PU8A 4ADZA 3KYLA 3CKDA 2IW5B 4H9NC 3N2OA 4TX5A 4UELA 4QXCB 4AQGA 3AVRA 3KVBA 2ODUA 2WMOA 4A56A 2XAGB 2VKOA 2VL8A 1BR0A 5FYMA 1X79A 2VK9A 1FIOA 2NTXA 2W62A 2KT9A 3F57A 3ZCJA 2Y6XA 5LGTB 5LCYA 4IE0A 3CMLA 5LGNB 4PK4A 3GN5B 3HL6A 3BQKA 3C4ZA 1T98A 3JC6D 5FY0A 2LT3A 4WNKA 2L8KA 4UIGA 2XTLA 4CI1B 5HYAA 2K9AA 2VWAA 3VKGA 3UULA 2D0TA 3ANWB 4EIWA 2R7WA 4DMVA 3MZKB 3N9MA 2HH7A 2D2SA 1QSDA 3MACA 3W15B 3LBXB 4DVDA 2A72A 3IF8B 4L0RA 4IRVA 4NUUA 3KDSE 4AKIA 2IC6A 3B13A 1H7CA 3MKDA 5HXSA 4QKNA 2E9XC 3RX6A 2JMKA 3HKBE 2FJI1 2ODVA 4UF0B 4ZI2D 5LBMA 2VKHA 2LJLA 2YK0A 2YU1A 2N2NA 1ZEEA 4GYSA 2GK9A 5JR9A 3ZCIA 2PBIA 1YW0A 2Z6EA 3Q2MA 2R7OA 3S4UA 3E08A 2UXXB 4AXPA 3CPZA 5ETWA 2LSIA 2CE7A 5DJQC 2ACXA 3C4WA 3P7IA 2CEAA 5HWXA 5KX5E 4EYYR 1UX5A 3O1IA 2ZLYA 4EOZB 3JC6C 3ANWA 5H6RB 1IJ6A 5JDMA 3C50A 3O1HA 3ZYLA 2LE8A 1US7B 3ETVA 3SWHA 4I50E 5LOVE 2K24A 3ZC1A 4ERRA 1WYBA 4M1PA 2NW9A 5DQVA 4EAHA 4UV8B 5J2TE 1D0ZA 2K5BB 3KBTA 4EYUA 4OHFA 4DO0A 4UXNB 1BR4A 3ZC0A 2E9XD 5TAOA 3V5UA 4PJLA 3RKOA 2KMFA 4OFZA 2W0GA 3ETUA 2H7OA 3KVAA 4P0AA 3KV5A 3E0ZA 3N5LA 3K3NA 4PK6A 4BA9A 4H63V 1G8XA 2N1GA 2PJQA 3LFMA 4Z8XA 4GK5E 5L3DB 5KMGP 2XASB 3OKQA 3N9OA 2UXNB 2Q9QC 3ZEFB 1UX4A 3DU5A 2LM9A 2XAFB 4AQFC 2V7IA 4U74A 4XBFB 5JH7E 4EB6E 1WLXA 2XAQB 3I9WA 5LYJE 3LG7A 5GONE 4CI2B 2EHOA 3KINB 4BJNA 1ZHCA 4UVBB 2Q9QB 4OK0A 3AB3B 2CXDA 3H37A 2R7XA 5EK2A 3AAAB 3PUAA 4YJ2E 3DTOA 3I1AA 3DP7A 4H9OC 2NTYA 1D0YA 4I4TE 3BQIA 3NZPA 4ZI2C 3CX8B 5A1LA 4PJJA 1SHZC 2Y48B 3N9PA 4UV9B 3AA6B 2CXLA 4TUYE 5HXHA 3CX7B 1D0XA 4O4JE 5LBQB 3MXZA 5JR9C 4ZI3D 4MFRA 4C2MA 2WM9A 5E0OA 2MTQA 3CWZB 3FHNA 1MIWA 2LSJA 2VKJA 4IE6A 5LJMA 2B3WA 1BR1A 3NS4A 2X51A 3I0QA 3DJBA 4X1YE 2C5KT 2R7TA 3MK7C 4E7ZA 2PG8A 2LHNA 4P0BA 1HX8A 1OXZA 4PJNA 2LEHA 5JR9B 5LHIB 2HPLA 2V26A 3UTKA 2X67A 3C98B 3N9NA 4TV9E 2PFVA 3PUGA 3PURA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A2F X;  3FHN A; 
#chains in the Genus database with same CATH topology
 2VUR A;  2R7U A;  3PJA J;  1HCI A;  4H63 H;  3CQX C;  5IHY A;  3Q0W A;  2IEK A;  2V7M A;  3ON2 A;  1SUM B;  5EK4 A;  2X9W A;  4LML A;  3RKG A;  5L3B B;  4PK5 A;  4JYA T;  2YKS A;  3TLV A;  3QB5 A;  3MJX A;  3QPL A;  2SPC A;  2D6Y A;  2E5L T;  1T72 A;  2W00 A;  3OYX A;  4H9Q C;  5ABG A;  4BJM A;  5JDN A;  4DVY P;  2XQY A;  2WB5 A;  1X9B A;  2WV1 A;  4H9R C;  1OED B;  5KXJ A;  2G0E A;  3CJD A;  5EZH A;  2BG9 E;  5JQG E;  4GK0 E;  3ESL A;  4MLK A;  5K58 A;  2JK3 A;  2V5D A;  3CVR A;  4PFP A;  4Q25 A;  2GFN A;  2ZY9 A;  2XGD A;  4KMC A;  3AEC A;  1WR0 A;  4X5T A;  3G06 A;  4DV2 T;  1YD8 G;  2E9X B;  4IE7 A;  5CA0 E;  2VB6 A;  2XDN A;  2E8I A;  2OA5 A;  4IDN A;  2HN1 A;  4DV0 T;  3DU6 A;  4YJ3 E;  4DR5 T;  4HFH A;  3ABV A;  3LJL A;  2LKG A;  4HGA A;  4WW0 A;  2CBJ A;  5L4H A;  3QK6 A;  3LOC A;  1QPI A;  2I0M A;  2FBQ A;  1Z0X A;  3COL A;  4JUY A;  5IUX A;  3D0T A;  3ZMV B;  3K3O A;  5HEJ A;  4PFO A;  4LF4 T;  3C64 A;  3HTH A;  2BKP A;  5J1G A;  2IAI A;  2G0U A;  2JQ9 A;  4ZI7 E;  4TZ4 C;  4HN9 A;  2V7K A;  4H9S E;  3M3Z B;  1IAP A;  2Q24 A;  5JRC A;  4COF A;  3IBP A;  4IRE A;  4G63 A;  4GCT A;  3EDU A;  3PTR B;  3A5X A;  4CQI A;  2LSK A;  4YSX A;  4B3A A;  3J9X 1;  5LMN T;  5KDM C;  4I55 E;  4CXX A;  2DWK A;  2LSY A;  3TP3 A;  4JNN A;  1Z77 A;  4ZOL E;  1UI6 A;  1HNX T;  1YKE B;  3VVX A;  4HFE A;  5JDF A;  2YVH A;  5JDG A;  3Q5D A;  3AED A;  5HXE A;  1IBK T;  3VTI A;  4JI5 T;  3EAM A;  4MK6 A;  3PJA A;  3G7R A;  3AAI A;  2LSG A;  3MNL A;  3HKD E;  4DBQ A;  3C51 A;  3A8Y C;  2BVM A;  3CCY A;  4YY3 T;  3BTC A;  2UXP A;  1QVU A;  4LFA T;  4IE4 A;  3U3I A;  4GYR A;  3RQU A;  1UI5 A;  4X65 T;  3GMI A;  3LK2 B;  4HFB A;  4X1K E;  2WBL A;  3P9T A;  4FI5 A;  3AE6 A;  4GOU A;  2G7L A;  4JLE A;  4U7I A;  1FEW A;  4GCL A;  5HCJ A;  3PAS A;  3VR8 A;  4IGU A;  4YHJ A;  3JAF A;  4NUV A;  3AE8 A;  4HE8 A;  1KEY A;  3BTI A;  5F5W A;  2XRL A;  4DV5 T;  5FY1 A;  2HYT A;  3ZN0 B;  3J7Y q;  4X66 T;  3B5M A;  3Q3S A;  2CXF A;  1W09 A;  4UEM A;  1KNP A;  3PUY F;  4DBR A;  3PUX F;  3A7M A;  4YTM A;  2QYW A;  2WAU A;  1KF6 A;  2ES0 A;  3LDQ B;  5FNV E;  4AKL A;  4YSY A;  4IDQ A;  3L09 A;  3O4X E;  2X9H A;  2CWO A;  4JEH B;  2XQ7 A;  1R8I A;  3F1B A;  5F3J A;  3ZMU B;  2WZH A;  2MOZ A;  3UFG A;  4O2A E;  4QX8 B;  3EVY A;  3I0O A;  1HNZ T;  4NEL A;  3R84 B;  2YOE A;  2ZCN A;  3QOF A;  1SE7 A;  4UVC B;  2XPK A;  3IEE A;  2LRL A;  3O60 A;  4PJM A;  5D19 A;  1D1B A;  1KNR A;  2JQH A;  5FKY A;  2RAS A;  4ADZ A;  2IHR 1;  4AQG A;  2WMO A;  2VKO A;  2VL8 A;  2W62 A;  3ZCJ A;  5LCY A;  1T98 A;  4ILC A;  4UIG A;  2Y31 A;  2K9A A;  3VKG A;  3UUL A;  1U9N A;  3BR2 A;  3B6A A;  1N33 T;  3LBX B;  3IF8 B;  4L0R A;  2TCT A;  2DG7 A;  4ILB A;  3KDS E;  1H7C A;  3MKD A;  5HXS A;  2YN6 A;  4QKN A;  3RX6 A;  2JMK A;  2FJI 1;  5IOY A;  3H3M A;  3JCF A;  2YK0 A;  2B76 A;  4JI0 T;  4GYS A;  5JR9 A;  2RPA A;  2V6Y A;  3Q2M A;  5C3J A;  2R7O A;  1RKW A;  3CK6 A;  2CHN A;  2A9U A;  2DL1 A;  4GFL A;  3P7I A;  3O1I A;  2QKO A;  3JC6 C;  1IBM T;  2WDR A;  5EZG A;  3AQS A;  4A98 A;  3ZC1 A;  4I6Z A;  4UV8 B;  3OPC A;  2JIW A;  4UXN B;  3ZC0 A;  5TAO A;  3V5U A;  3VPR A;  2KMF A;  4OFZ A;  2W0G A;  3AE1 A;  3KKC A;  4P0A A;  3KV5 A;  3TLU A;  3ANP A;  3RF1 A;  4IDP A;  1IBL T;  5ABH A;  4H63 V;  4JI6 T;  1G8X A;  2N1G A;  4JBW F;  5KMG P;  4JV5 T;  4M3D A;  3OKQ A;  2UXN B;  2Q9Q C;  2XGE A;  2Y2Z A;  4JI7 T;  4JYK A;  3EUP A;  5JH7 E;  4LFB T;  2XAQ B;  2VVN A;  1HNW T;  4X62 T;  3V78 A;  4BJN A;  2CXD A;  4DW6 A;  4HWH A;  3PUA A;  3FZK B;  2QIB A;  3I1A A;  3EGQ A;  3ONL C;  2J62 A;  2NTY A;  3CX8 B;  3P50 A;  5HEH A;  2CXL A;  2XSA A;  3BQY A;  4MFR A;  5HCM A;  4B3M T;  1BJZ A;  4W97 A;  2I6H A;  2FX0 A;  3I0Q A;  4X1Y E;  4HWI B;  2PG8 A;  2VVS A;  2LHN A;  2VKE A;  2FUP A;  3LSV A;  5LHI B;  3V6G A;  3C98 B;  2PFV A;  2G7S A;  4DR4 T;  3VRB A;  2JQQ A;  4ACI A;  1XDP A;  3F31 A;  4AI6 A;  2G3B A;  4UDS A;  4DMW A;  2M6B A;  1XZY A;  2E2A A;  4V2G A;  1OED E;  5FKK A;  1E7P A;  3BK9 A;  4O8S A;  2IDO B;  3MVP A;  3ZQF A;  5LHG B;  4ZI3 C;  2E9X A;  3HA4 A;  2OPT A;  3C4X A;  2QTQ A;  1L0V A;  3FK6 A;  4HKA A;  2A2F X;  3UUB A;  3NNR A;  3ON4 A;  3HI2 A;  3IUV A;  1VRB A;  4O2B E;  4B1R A;  1VCT A;  1WFD A;  3V5S A;  1LVK A;  3E7Q A;  4EGW A;  2WGB A;  1WCR A;  4NXN T;  1YKH B;  4DV3 T;  1A6I A;  2HHH T;  1W9R A;  2ZM0 A;  2D5U A;  2MBG A;  2UXI A;  2ID3 A;  4V2F A;  4MBQ A;  3P4P A;  2YIN A;  3IH4 A;  2JPF A;  5JDQ A;  4DR7 T;  4HWC A;  2HXO A;  5LJN A;  2X9D A;  1ZV4 X;  3ONJ A;  2WWU A;  2W53 A;  2XQ8 A;  2NR4 A;  2RHA A;  2N9D A;  2CHO A;  4L5G A;  5M4Y A;  5GP9 A;  2JQK A;  5CFB A;  3PUQ A;  4I76 A;  5CQG A;  3DEW A;  3G1L A;  4KHP T;  4U7Y A;  5L3E B;  2BBJ A;  1OWA A;  3N2G E;  2WS3 A;  1E1H B;  2CMR A;  3RC3 A;  5C2T A;  2UXU A;  2UUC T;  4ISS A;  2W61 A;  3AA1 B;  4HFV A;  3L3P A;  2X9X A;  4O4H E;  5LNK A;  4O4L E;  4O4I E;  3AEG A;  5F04 A;  4HFD A;  2ZCM A;  3LSR A;  1JT0 A;  4QXB B;  4AKG A;  3BT9 A;  4TWH A;  4C90 A;  2FJD A;  2NWB A;  4PXI A;  4L9I A;  3RPU A;  3Q9D A;  3RQW A;  1MIY A;  4P1N A;  3TLW A;  3WAJ A;  2XSB A;  3RYF E;  2M67 A;  2IC9 A;  3ZMS B;  2MAW A;  5CXI A;  1W0B A;  3FZH B;  3UT5 E;  2UXH A;  2R7Q A;  1U5P A;  5LA6 E;  1ZOY A;  3ZLI A;  1EZ3 A;  2CBI A;  2FQ4 A;  3EDV A;  3FIW A;  2H89 A;  4DR3 T;  1O3X A;  2CM0 A;  2GEN A;  1Z0P A;  4YFS A;  3RIF A;  3NXC A;  1SA0 E;  2XM2 A;  4QH1 A;  3SRZ A;  5IP6 A;  2Y8D A;  3KV6 A;  3UUN A;  4ABZ A;  1XDO A;  3VOK A;  5C4Y A;  5CA1 E;  2KXP B;  3WAK A;  3B81 A;  3CRJ A;  3PE0 A;  5F8P A;  3ANG A;  1CHU A;  4I43 B;  4PAG A;  1HG2 A;  3CQG B;  3RYH E;  3RH3 A;  3SS1 A;  2BKO A;  2IML A;  4DV6 T;  2W4X A;  3RC8 A;  3P4W A;  3S5R A;  3LJC A;  5LMU T;  3AA0 B;  2BZB A;  2KLQ A;  4LF7 T;  3L39 A;  3N9Q A;  3HIM A;  1KNZ A;  3SOL A;  2OV9 A;  3M65 A;  2TRT A;  5DAJ A;  2CCQ A;  2BS4 A;  2V6X A;  1VOM A;  3QUJ A;  2MYS A;  3Q5W A;  4QH5 A;  4YZE A;  1JUS A;  1S94 A;  1T56 A;  4U72 A;  3GA8 A;  3NKZ A;  4AC6 A;  2QA7 A;  1KK7 A;  4YT0 A;  3VOX A;  2YU2 A;  2E5V A;  2F4V T;  4EV6 A;  2Q9Q A;  5F08 A;  3IHR A;  3KV9 A;  2D0U A;  3IH2 A;  4X1I E;  1ZKE A;  4AIU A;  2X66 A;  4GKK T;  5HXC A;  2R7V A;  4NIQ A;  5HAW A;  3KNW A;  4GFK A;  4ANJ A;  2EHO D;  2YDS A;  3CDL A;  5LB7 B;  1NEN A;  1KFY A;  2YDQ A;  4U9N A;  4NN1 A;  4AQY T;  4ZZB A;  4H9N C;  4UEL A;  4QXC B;  3BJB A;  3AVR A;  2XAG B;  2OI8 A;  5GPA A;  3F57 A;  2Y6X A;  5LGT B;  3CML A;  5LGN B;  2F07 A;  3G1M A;  3C4Z A;  5AQU B;  2LT3 A;  4ZZC A;  1XMO T;  5AQO B;  2D0T A;  4EIW A;  3ZKR A;  2QOP A;  5D1R A;  1QSD A;  3MAC A;  1J5E T;  4DVD A;  5FL0 A;  3HTI A;  3K1S A;  4B3S T;  4NUU A;  2W66 A;  2E9X C;  3C07 A;  2LJL A;  3AE3 A;  1N34 T;  2YU1 A;  2N2N A;  1YW0 A;  3SDG A;  1JUM A;  5ETW A;  4AC0 A;  3NPI A;  4QH4 A;  3ZQI A;  2CEA A;  4EYY R;  3NRG A;  3EI0 A;  1IJ6 A;  4D5C A;  3C50 A;  5AQQ B;  2AE9 A;  4ERR A;  5J2T E;  3KBT A;  2YVE A;  4DO0 A;  4DID B;  2HKU A;  3KKD A;  5FKM A;  3ZQG A;  3KVA A;  3E0Z A;  4OX9 T;  3N5L A;  4DR1 T;  4JI2 T;  2PJQ A;  4Z8X A;  4GK5 E;  1QLB A;  4AF5 A;  3SFE A;  1OED A;  3PUV F;  4AQF C;  3DU5 A;  2XAF B;  3JAD A;  2ACZ A;  3ZSS A;  3HGG A;  3LG7 A;  4CI2 B;  2WUI A;  3BTL A;  1ZHC A;  1Z8U A;  3AB3 B;  2R7X A;  2IU5 A;  3AAA B;  4YJ2 E;  2ZCX A;  4ZI2 C;  4I4T E;  3NZP A;  3QPS A;  5A1L A;  1SHZ C;  2RAE A;  5HXH A;  5LBQ B;  5JR9 C;  4C2M A;  4CGR A;  2WM9 A;  5CJ5 A;  1UUS A;  2XQA A;  3NS4 A;  2NX4 A;  3MK7 C;  4CN1 A;  4TWD A;  1XNR T;  1OXZ A;  2XY8 B;  5JR9 B;  3N9N A;  3PUG A;  3PUR A;  2UUB T;  2R7R A;  4LF6 T;  3E22 E;  4LMJ A;  2X0Y A;  4IHJ E;  1Y64 B;  1U9O A;  2BVL A;  4KWA A;  2UXB T;  2IBD A;  3RIU C;  2KSR A;  2UXC T;  2QCO A;  2EH3 A;  1MND A;  3GWH A;  5ABF A;  3WI3 A;  3FZF B;  3LBX A;  4DR6 T;  3ZYM A;  2RA1 A;  3CQC B;  3ZMT B;  5HEO A;  2H88 A;  4KUM B;  2PBX A;  4GIW A;  2CLY C;  2KND A;  2V1D B;  3OJA A;  2DHR A;  4OYJ A;  2KWI B;  5LGU B;  4ICH A;  5AQJ B;  2VL0 A;  3T1H T;  4W1U A;  4IST A;  1LRZ A;  1YQ3 A;  4EXT A;  4V1A v;  3RLF F;  3P8C D;  2ZOY A;  3HE0 A;  4XAX B;  3ZPO A;  2Q9Q D;  4JKZ A;  2RP4 A;  3HGY A;  3BR6 A;  2VKD A;  2W2U A;  4H9P C;  3ZT6 A;  4LFC T;  1UGO A;  2DLR A;  1S35 A;  4N78 D;  2HN2 A;  3Q0U A;  4JI1 T;  4JI3 T;  2O7T A;  1VI0 A;  3F2E A;  2GUH A;  5FXX A;  2V7J A;  3PV0 F;  5AQK B;  3QKX A;  5FKO A;  2DCF A;  2PTF A;  2XQ6 A;  3G1O A;  4IDZ A;  5HEG A;  3FBZ A;  5JDL A;  1HF8 A;  2W63 A;  5F0F A;  4QHO A;  5IYZ E;  2XUE A;  4OD4 A;  2NW7 A;  4L62 A;  5C8Y E;  1FMW A;  2L3L A;  2NP5 A;  1NAF A;  4NXM T;  2C5J A;  2FJE A;  1N36 T;  1ORK A;  3HTJ A;  4YTN A;  2EHO B;  2P9B A;  4X64 T;  5F0C A;  3T8O A;  3AXJ B;  3LK3 B;  4U31 A;  3NI7 A;  5HBU A;  3RYI E;  5AFU L;  3RIU A;  3QC9 A;  5JRC B;  5IOZ A;  3AEE A;  2JRK A;  3H3A A;  4KX6 A;  4F6R C;  2A3D A;  5FKL A;  4HKU A;  4WBN E;  1JNZ A;  3AE4 A;  1MMA A;  2WU5 A;  2BG9 C;  2BDE A;  1WRD A;  3TP0 A;  3ZT5 A;  2XPU A;  3ZJ2 A;  2KZ7 B;  3FB2 A;  1MIV A;  3EUH A;  2Y30 A;  2J4G A;  3AAE B;  4IDO A;  3GEU A;  2WMN A;  5FXV A;  3N2K E;  4K0U A;  4U33 A;  1VCS A;  2LOP A;  4M3G A;  2DI4 A;  3NZQ A;  4CXY A;  4WIB A;  2FD5 A;  4EZ4 A;  5HXR A;  4QWN B;  2H7V C;  1JUP A;  5CXG A;  2PZ9 A;  2VKV A;  4M3B A;  4WBO A;  5J2U E;  2BKN A;  5AQC A;  5EZY E;  4G2A A;  3WHB A;  3SFI A;  2J1D G;  3FXE B;  2XM1 A;  5FY7 A;  2YEV C;  2WDQ A;  2NS8 A;  4ZXL A;  4ZS2 A;  2X6O A;  4KI0 F;  4J2C A;  3ZMZ B;  3VW2 A;  3UU4 A;  2NW8 A;  4G12 A;  5ADX L;  4UVA B;  3R6N A;  3VUQ A;  4CXW A;  3O9X A;  2C0S A;  3IH3 A;  3FXD B;  3K8P C;  4M3F A;  4HFI A;  2M6I A;  4ILA A;  2XAJ B;  2W67 A;  2XHE B;  5BMV E;  3UQ7 A;  1WYC A;  1LKX A;  3AQT A;  1OED C;  4AKH A;  4AQF A;  4U2Y A;  3T6N A;  2XJ7 A;  4Z90 A;  2CLY B;  4OD5 A;  1JTY A;  2DG8 A;  3GN5 A;  3RRC A;  1IZN B;  1QUU A;  2YDR A;  4U9L A;  2X9Y A;  5FMN A;  5H6Q B;  5L2L A;  4M3E A;  4P09 A;  3PUZ F;  3P4R A;  3O1J A;  2XQ3 A;  4JEU B;  2CA5 A;  3LK4 2;  1I94 T;  3UQ4 A;  2WSS V;  4TNV A;  1IJ5 A;  2IUB A;  1NWM X;  5J0Z A;  3Q5X A;  3PU8 A;  3KYL A;  3AEF A;  3CKD A;  2IW5 B;  4TX5 A;  5AQS B;  2ODU A;  5FL1 A;  2XZE A;  3AEB A;  1Y01 A;  4A56 A;  4XK4 A;  1BR0 A;  5FYM A;  1FIO A;  2NTX A;  2UUA T;  2KT9 A;  1FJG T;  4IE0 A;  4Z91 A;  3DPJ A;  3BR5 A;  3HL6 A;  5FY0 A;  2L8K A;  5HYA A;  2LLY A;  2XTL A;  2VWA A;  1XMQ T;  1XWM A;  2R7W A;  4DMV A;  4K0K T;  1JNR A;  3MZK B;  4A5X A;  2HH7 A;  2D2S A;  1M62 A;  1YXR A;  3VW0 A;  4AKI A;  3RD3 A;  2IC6 A;  5F27 A;  5EFY A;  3HKB E;  5F0H A;  4UF0 B;  2YVX A;  2VKH A;  2WZI A;  5AQR B;  2GK9 A;  3E08 A;  4AXP A;  2CE7 A;  2LRK A;  2UXD T;  5DJQ C;  2ACX A;  4AUX A;  5HWX A;  5KX5 E;  1UX5 A;  3HTA A;  4EOZ B;  2V57 A;  4YSZ A;  4D7M A;  5JDM A;  1ZP0 A;  3O1H A;  5AQM B;  3ZYL A;  2LE8 A;  3ETV A;  2CPT A;  3SWH A;  4I50 E;  5LOV E;  2AXD S;  1WYB A;  2HXI A;  4EAH A;  4EYU A;  4MO7 A;  1J1J A;  4OHF A;  2G7G A;  4PJL A;  3FZM B;  2MPK A;  2OF7 A;  5J1Y A;  5IWA T;  5K7F A;  2H7O A;  3K3N A;  1W0A A;  2WQY A;  5LG3 A;  4BA9 A;  2HQ5 A;  3L8R A;  4AIS A;  3LFM A;  3O8H A;  5CW8 A;  2HYJ A;  5FGL A;  1UX4 A;  2LM9 A;  3TLS A;  3BR0 A;  2V7I A;  3T1Y T;  3RGL A;  4XBF B;  5EYR A;  4GKJ T;  5K7Z A;  1WLX A;  5LYJ E;  5GON E;  3KIN B;  5AQP B;  2Q9Q B;  5J3L A;  4OK0 A;  5EK2 A;  2FBW A;  1D0Y A;  4A97 A;  3BQI A;  2Y48 B;  3N9P A;  4UV9 B;  3AA6 B;  4TUY E;  2V5C A;  3CX7 B;  3FK7 A;  4GCK A;  2MTQ A;  3CWZ B;  1MIW A;  2LSJ A;  4IE6 A;  5LJM A;  1BR1 A;  1QVT A;  2I10 A;  2OLT A;  2C5K T;  2R7T A;  4WYV A;  4E7Z A;  3LSP A;  4P0B A;  2R6G F;  2LEH A;  2ID6 A;  3PPB A;  2HPL A;  5CB4 E;  2KWH A;  1M7K A;  5H9T A;  4YHH T;  2QWT A;  2B1E A;  5HAX A;  3X1D A;  2NOX A;  3O8G A;  2O7O A;  2JMH A;  1E2A A;  3OYZ A;  3PDY A;  1LVF A;  5JTG A;  2FJ1 A;  2NP9 A;  3Q0V A;  3KFW X;  2XQ9 A;  5JDH A;  5EK3 A;  2X0L B;  4IIJ E;  3VU7 H;  4ZS3 A;  2ZOZ A;  4IL4 A;  3B57 A;  3TKL B;  3CX6 B;  1FMV A;  2OER A;  3KZ9 A;  4XZC A;  4TWF A;  3OBV E;  3AE2 A;  5FVL A;  1HTJ F;  3LWJ A;  2J47 A;  3BR3 A;  3NRY A;  4HFC A;  3FBL A;  5LG4 A;  2FJB A;  1JT6 A;  4DND A;  3RRW A;  2FJA A;  3QNU A;  5LP6 E;  4E7S A;  2HPJ A;  3FZL B;  2I59 A;  5HEU A;  4B6X A;  4PW8 A;  2C5I T;  2KIN B;  4D5F A;  3RHW A;  4EZH A;  1MMD A;  4MHC A;  4TV8 E;  4ZHQ E;  5AQT B;  5AQV B;  3PUS A;  2NP3 A;  5FP3 A;  1ZKG A;  1V9D A;  4B3T T;  5JRE A;  3VVZ A;  2CRB A;  1MMG A;  3I9Y A;  4TN7 B;  4UR9 A;  3AA7 B;  3OVU A;  3N9L A;  3NBX X;  1MMN A;  1DU2 A;  5FXZ A;  4U3C A;  2QGS A;  1UCU A;  5LHH B;  2XAH B;  5AQI B;  4DV7 T;  4FJO A;  2JJ9 A;  1YQ4 A;  4LF5 T;  2R7S A;  2WU2 A;  3ONX A;  4HTE A;  3AE7 A;  1D1A A;  2QVA A;  3NWI A;  4CN6 A;  3AXJ A;  4MAL A;  5CGM A;  2XQ5 A;  1G73 A;  5L3F B;  5DQW A;  3DCF A;  2DNX A;  3MA9 A;  4CZZ B;  3UU6 A;  3UU5 A;  1D1C A;  4AKR B;  5FHP A;  4YLH A;  3BTJ A;  4QXH B;  4IL9 A;  3VHL A;  3KV4 A;  2BS3 A;  4B3R T;  3ZJ1 A;  4LF8 T;  5JVD E;  3HR0 A;  5F1J A;  4LF9 T;  2ZM8 A;  3IA3 A;  4ILU A;  2WY2 A;  2LHR A;  5LXT E;  1B7T A;  5J1U A;  1HX1 B;  3QB5 K;  2LOS A;  3ZN1 B;  2XPW A;  2CWY A;  3AVS A;  1JTX A;  5AQN B;  1UK5 A;  5L3C B;  4HEA A;  5GPC A;  4UF0 A;  2K48 A;  2NS7 A;  1BR2 A;  2K3W A;  2V6Y B;  2ZMA A;  3K3Q C;  2D9D A;  3RYC E;  4OYK A;  3HKE E;  2VAS A;  1CUN A;  3OTO T;  1U4Q A;  1T33 A;  3VKH A;  2X0H A;  2V7L A;  4YXD A;  1AJ3 A;  5ABF B;  1RKT A;  2LKH A;  2IAK A;  3U78 A;  3EHZ A;  4D7N A;  3G56 A;  3P4S A;  4PNI A;  3LHQ A;  5AQF B;  2REK A;  3HKC E;  4KBM B;  1N32 T;  1XNQ T;  3JAE A;  1MNE A;  4ASK A;  4HWD A;  4NPP A;  3ZST A;  5AQL B;  1HS7 A;  4U2Z A;  5FXW A;  3CIR A;  1HG5 A;  2X68 A;  4KHZ F;  3BQZ A;  4BAY B;  2ZM6 T;  4MXM A;  1T7S A;  2IIU A;  2L9Q A;  1HFA A;  3KBU A;  4QX7 B;  2BG9 B;  2DWG A;  2BBH A;  2ZM2 A;  2H3R A;  2WDV A;  3BQL A;  2XQ4 A;  4X20 E;  5ABE A;  5DAB A;  3BR1 A;  3WHC A;  3F0C A;  3PU3 A;  3BCG A;  1WR6 A;  5HWY A;  4C91 A;  4KP3 C;  4YTP A;  3UUX B;  3RIA A;  2BG9 A;  1UUR A;  3BRU A;  3QBM A;  5L3G B;  4DUZ T;  5AQG B;  2EHO C;  4IE5 A;  3CWR A;  3UU3 A;  5AQH B;  3NRX A;  4I0U A;  3UUM A;  3ZYK A;  3UFE A;  3EAB A;  1NEK A;  2QRX A;  3RH2 A;  3VIB A;  4CI3 B;  5L4E A;  3BNI A;  3C2B A;  3N2O A;  4F8H A;  3KVB A;  2LM2 A;  4TNW A;  3VR9 A;  1X79 A;  2VK9 A;  4EEB A;  3PUW F;  4PK4 A;  3GN5 B;  3BQK A;  3JC6 D;  2UU9 T;  4WNK A;  4CI1 B;  3Q5E A;  1ZK8 A;  2VPR A;  5K7H A;  3ANW B;  4EED A;  2WCA A;  3N9M A;  2WP9 A;  1I6Z A;  3ZQH A;  1RPW A;  3W15 B;  4DUY T;  2A72 A;  3JSJ A;  2XPV A;  2UXO A;  4IRV A;  3B13 A;  4IT4 A;  3B6C A;  2WWV A;  2ODV A;  2JJ7 A;  4ZI2 D;  5LBM A;  1ZEE A;  2VQE T;  3ZCI A;  2PBI A;  2Z6E A;  1GQE A;  3S4U A;  2UXX B;  5J1R A;  3CPZ A;  2LSI A;  2VQF T;  3C4W A;  2GBY A;  1SGM A;  3VVY A;  5FMP A;  2ZLY A;  3ANW A;  5H6R B;  4JI8 T;  3P4Q A;  1US7 B;  3ZQL A;  4DV4 T;  1J5W A;  2K24 A;  4M1P A;  2NW9 A;  3AE5 A;  5DQV A;  1D0Z A;  2K5B B;  3GZI A;  1BR4 A;  2E9X D;  3FRQ A;  3VW1 A;  2ZB9 A;  3RKO A;  3TLT A;  3AE9 A;  3UU8 A;  1HR0 T;  3ETU A;  4CN4 A;  5FKN A;  4HWF A;  4PK6 A;  5HSZ A;  3QQA A;  5L3D B;  3BHQ A;  2BS2 A;  2XAS B;  4ME9 A;  5IPA A;  3N9O A;  3ZT7 A;  3ZEF B;  3NVO A;  4DR2 T;  4U74 A;  3AEA A;  4ZEY A;  4EB6 E;  3I9W A;  2EHO A;  4UVB B;  5BR8 T;  3H37 A;  2XGC A;  4JL3 A;  3VP5 A;  3DTO A;  3DP7 A;  4LMK A;  5D18 A;  3LSJ A;  4H9O C;  4WZX A;  4X1E A;  4PJJ A;  3PM1 A;  3VRA A;  2DTZ A;  1D0X A;  4O4J E;  5L47 A;  4DV1 T;  3MXZ A;  4ZI3 D;  1T8B A;  5E0O A;  4JI4 T;  3FHN A;  2VKJ A;  3SFD A;  2B3W A;  2X51 A;  3DJB A;  2V8S V;  1HX8 A;  4PJN A;  2V26 A;  3UTK A;  2X67 A;  2XB5 A;  3RI5 A;  5FVK A;  4TV9 E; 
#chains in the Genus database with same CATH homology
 5CB4 E;  2KWH A;  2R7R A;  2R7U A;  3E22 E;  1HCI A;  2JQQ A;  4H63 H;  3F31 A;  3CQX C;  4IHJ E;  1Y64 B;  4AI6 A;  5IHY A;  2B1E A;  4DMW A;  5HAX A;  2BVL A;  2V7M A;  2NOX A;  5EK4 A;  2X9W A;  2JMH A;  3BK9 A;  5L3B B;  3OYZ A;  4O8S A;  3PDY A;  1LVF A;  4PK5 A;  1MND A;  3GWH A;  5LHG B;  3MJX A;  2E9X A;  4ZI3 C;  2NP9 A;  2SPC A;  3WI3 A;  3HA4 A;  3KFW X;  3LBX A;  2W00 A;  3C4X A;  5JDH A;  3OYX A;  4H9Q C;  3ZYM A;  2RA1 A;  4BJM A;  3CQC B;  5EK3 A;  4HKA A;  5JDN A;  4DVY P;  2A2F X;  2X0L B;  4IIJ E;  3ZMT B;  2XQY A;  4KUM B;  4H9R C;  3VU7 H;  4GIW A;  4ZS3 A;  2CLY C;  5JQG E;  2KND A;  2V1D B;  3B57 A;  4GK0 E;  3ESL A;  3TKL B;  3CX6 B;  3OJA A;  1FMV A;  2DHR A;  2KWI B;  3HI2 A;  4MLK A;  4OYJ A;  5LGU B;  1VRB A;  4XZC A;  4O2B E;  3OBV E;  3V5S A;  3CVR A;  1HTJ F;  4IST A;  1LRZ A;  1LVK A;  4EXT A;  4PFP A;  4V1A v;  4XAX B;  3P8C D;  3NRY A;  3ZPO A;  3FBL A;  1YKH B;  5LG4 A;  4KMC A;  2Q9Q D;  2ZM0 A;  2D5U A;  2MBG A;  2RP4 A;  4MBQ A;  1YD8 G;  4DND A;  2E9X B;  2YIN A;  3RRW A;  4IE7 A;  5CA0 E;  2VB6 A;  5LP6 E;  4E7S A;  2HPJ A;  2VKD A;  2I59 A;  2JPF A;  2E8I A;  2OA5 A;  4H9P C;  5JDQ A;  4B6X A;  4PW8 A;  2C5I T;  2KIN B;  5LJN A;  2DLR A;  1S35 A;  3DU6 A;  1ZV4 X;  4YJ3 E;  2WWU A;  4EZH A;  1MMD A;  4N78 D;  4MHC A;  4TV8 E;  4ZHQ E;  2N9D A;  3PUS A;  5FP3 A;  3F2E A;  1V9D A;  5JRE A;  4L5G A;  5FXX A;  5M4Y A;  2V7J A;  3PUQ A;  4HGA A;  4WW0 A;  5CQG A;  1MMG A;  2DCF A;  4IDZ A;  3QK6 A;  3FBZ A;  3I9Y A;  4TN7 B;  5JDL A;  5L3E B;  3AA7 B;  1OWA A;  4JUY A;  3N2G E;  3N9L A;  1E1H B;  3NBX X;  3D0T A;  1HF8 A;  2CMR A;  2W63 A;  1MMN A;  4QHO A;  3RC3 A;  5IYZ E;  5FXZ A;  2XUE A;  2QGS A;  4OD4 A;  3ZMV B;  1UCU A;  5LHH B;  2XAH B;  3K3O A;  4PFO A;  4ISS A;  3C64 A;  4FJO A;  2NW7 A;  2JJ9 A;  2W61 A;  3AA1 B;  4HFV A;  5J1G A;  3L3P A;  2X9X A;  4O4H E;  2G0U A;  5LNK A;  2R7S A;  3ONX A;  4ZI7 E;  4HTE A;  4O4L E;  4TZ4 C;  4HN9 A;  1D1A A;  2V7K A;  4O4I E;  5C8Y E;  1FMW A;  2L3L A;  4H9S E;  4MAL A;  1NAF A;  1IAP A;  2C5J A;  1G73 A;  5L3F B;  5JRC A;  4AKG A;  4QXB B;  5DQW A;  3IBP A;  4G63 A;  2DNX A;  3MA9 A;  4CZZ B;  4C90 A;  3EDU A;  3PTR B;  2NWB A;  3A5X A;  2EHO B;  4CQI A;  2LSK A;  1D1C A;  2P9B A;  4L9I A;  4AKR B;  3RPU A;  4YLH A;  3J9X 1;  3Q9D A;  4QXH B;  1MIY A;  3VHL A;  3WAJ A;  3KV4 A;  5KDM C;  4I55 E;  3RYF E;  2M67 A;  2IC9 A;  3ZJ1 A;  3ZMS B;  4CXX A;  2DWK A;  3T8O A;  2LSY A;  3UT5 E;  5JVD E;  3LK3 B;  3HR0 A;  3RYI E;  2ZM8 A;  5AFU L;  4ILU A;  2R7Q A;  2LHR A;  3QC9 A;  4ZOL E;  5LXT E;  1B7T A;  1U5P A;  5LA6 E;  3ZLI A;  5JRC B;  1EZ3 A;  2JRK A;  1YKE B;  3H3A A;  2LOS A;  3ZN1 B;  4F6R C;  3EDV A;  2A3D A;  2CWY A;  3AVS A;  5JDF A;  5JDG A;  4WBN E;  5HXE A;  5L3C B;  1MMA A;  1O3X A;  4HEA A;  3VTI A;  2CM0 A;  2BDE A;  1WRD A;  4UF0 A;  1Z0P A;  4YFS A;  2K48 A;  3ZJ2 A;  2KZ7 B;  1BR2 A;  1SA0 E;  1MIV A;  3FB2 A;  3EUH A;  3AAI A;  3AAE B;  2LSG A;  2ZMA A;  3SRZ A;  2WMN A;  5FXV A;  3HKD E;  4DBQ A;  3N2K E;  3C51 A;  2Y8D A;  3KV6 A;  4K0U A;  3UUN A;  2BVM A;  3K3Q C;  2LOP A;  3RYC E;  5CA1 E;  2KXP B;  4OYK A;  2DI4 A;  3NZQ A;  4CXY A;  3WAK A;  3HKE E;  4EZ4 A;  2VAS A;  1CUN A;  5HXR A;  4QWN B;  3PE0 A;  1U4Q A;  2H7V C;  5F8P A;  3VKH A;  4IE4 A;  4I43 B;  4PAG A;  2V7L A;  3U3I A;  4GYR A;  1HG2 A;  1AJ3 A;  4WBO A;  3CQG B;  3RYH E;  3RH3 A;  3SS1 A;  2IAK A;  5J2U E;  3U78 A;  3GMI A;  3LK2 B;  5EZY E;  4G2A A;  2J1D G;  4X1K E;  3RC8 A;  2WBL A;  3FXE B;  5FY7 A;  4FI5 A;  2YEV C;  4PNI A;  4ZS2 A;  3LJC A;  4GOU A;  3HKC E;  4J2C A;  4KBM B;  4JLE A;  3AA0 B;  2BZB A;  3ZMZ B;  1FEW A;  2KLQ A;  3N9Q A;  1MNE A;  4ASK A;  1KNZ A;  3SOL A;  4IGU A;  4YHJ A;  2NW8 A;  3M65 A;  4NUV A;  1HS7 A;  2CCQ A;  5FXW A;  1HG5 A;  4HE8 A;  5ADX L;  4UVA B;  2X68 A;  3R6N A;  1VOM A;  5FY1 A;  4BAY B;  3ZN0 B;  3QUJ A;  3J7Y q;  2MYS A;  4CXW A;  2CXF A;  2L9Q A;  1HFA A;  3Q5W A;  4UEM A;  3KBU A;  3O9X A;  2C0S A;  3FXD B;  3K8P C;  4DBR A;  4QX7 B;  2DWG A;  2XAJ B;  1S94 A;  2ZM2 A;  2H3R A;  3GA8 A;  4U72 A;  2XHE B;  2WAU A;  2ES0 A;  3BQL A;  5BMV E;  5FNV E;  4AKL A;  2QA7 A;  1KK7 A;  1WYC A;  2YU2 A;  4X20 E;  1LKX A;  3L09 A;  2X9H A;  2CWO A;  3O4X E;  2Q9Q A;  5DAB A;  4JEH B;  4AKH A;  3IHR A;  4AQF A;  3KV9 A;  2D0U A;  3PU3 A;  5F3J A;  3ZMU B;  2MOZ A;  1WR6 A;  4X1I E;  1ZKE A;  5HWY A;  2CLY B;  4OD5 A;  4C91 A;  4KP3 C;  2X66 A;  4O2A E;  5HXC A;  3UUX B;  2R7V A;  3GN5 A;  4QX8 B;  3RRC A;  1IZN B;  1QUU A;  3EVY A;  3I0O A;  5L3G B;  2X9Y A;  5FMN A;  5H6Q B;  5L2L A;  4P09 A;  2EHO C;  4IE5 A;  3R84 B;  4ANJ A;  3NRX A;  3UUM A;  3ZYK A;  2EHO D;  3O1J A;  4UVC B;  3UFE A;  4JEU B;  2CA5 A;  3IEE A;  3LK4 2;  2WSS V;  1IJ5 A;  4PJM A;  1D1B A;  4CI3 B;  1NWM X;  3Q5X A;  3PU8 A;  4ADZ A;  3KYL A;  3CKD A;  2IW5 B;  4H9N C;  3N2O A;  4TX5 A;  4UEL A;  4QXC B;  4AQG A;  3AVR A;  3KVB A;  2ODU A;  2WMO A;  4A56 A;  2XAG B;  2VKO A;  2VL8 A;  1BR0 A;  5FYM A;  1X79 A;  2VK9 A;  1FIO A;  2NTX A;  2W62 A;  2KT9 A;  3F57 A;  3ZCJ A;  2Y6X A;  5LGT B;  5LCY A;  4IE0 A;  3CML A;  5LGN B;  4PK4 A;  3GN5 B;  3HL6 A;  3BQK A;  3C4Z A;  1T98 A;  3JC6 D;  5FY0 A;  2LT3 A;  4WNK A;  2L8K A;  4UIG A;  2XTL A;  4CI1 B;  5HYA A;  2K9A A;  2VWA A;  3VKG A;  3UUL A;  2D0T A;  3ANW B;  4EIW A;  2R7W A;  4DMV A;  3MZK B;  3N9M A;  2HH7 A;  2D2S A;  1QSD A;  3MAC A;  3W15 B;  3LBX B;  4DVD A;  2A72 A;  3IF8 B;  4L0R A;  4IRV A;  4NUU A;  3KDS E;  4AKI A;  2IC6 A;  3B13 A;  1H7C A;  3MKD A;  5HXS A;  4QKN A;  2E9X C;  3RX6 A;  2JMK A;  3HKB E;  2FJI 1;  2ODV A;  4UF0 B;  4ZI2 D;  5LBM A;  2VKH A;  2LJL A;  2YK0 A;  2YU1 A;  2N2N A;  1ZEE A;  4GYS A;  2GK9 A;  5JR9 A;  3ZCI A;  2PBI A;  1YW0 A;  2Z6E A;  3Q2M A;  2R7O A;  3S4U A;  3E08 A;  2UXX B;  4AXP A;  3CPZ A;  5ETW A;  2LSI A;  2CE7 A;  5DJQ C;  2ACX A;  3C4W A;  3P7I A;  2CEA A;  5HWX A;  5KX5 E;  4EYY R;  1UX5 A;  3O1I A;  2ZLY A;  4EOZ B;  3JC6 C;  3ANW A;  5H6R B;  1IJ6 A;  5JDM A;  3C50 A;  3O1H A;  3ZYL A;  2LE8 A;  1US7 B;  3ETV A;  3SWH A;  4I50 E;  5LOV E;  2K24 A;  3ZC1 A;  4ERR A;  1WYB A;  4M1P A;  2NW9 A;  5DQV A;  4EAH A;  4UV8 B;  5J2T E;  1D0Z A;  2K5B B;  3KBT A;  4EYU A;  4OHF A;  4DO0 A;  4UXN B;  1BR4 A;  3ZC0 A;  2E9X D;  5TAO A;  3V5U A;  4PJL A;  3RKO A;  2KMF A;  4OFZ A;  2W0G A;  3ETU A;  2H7O A;  3KVA A;  4P0A A;  3KV5 A;  3E0Z A;  3N5L A;  3K3N A;  4PK6 A;  4BA9 A;  4H63 V;  1G8X A;  2N1G A;  2PJQ A;  3LFM A;  4Z8X A;  4GK5 E;  5L3D B;  5KMG P;  2XAS B;  3OKQ A;  3N9O A;  2UXN B;  2Q9Q C;  3ZEF B;  1UX4 A;  3DU5 A;  2LM9 A;  2XAF B;  4AQF C;  2V7I A;  4U74 A;  4XBF B;  5JH7 E;  4EB6 E;  1WLX A;  2XAQ B;  3I9W A;  5LYJ E;  3LG7 A;  5GON E;  4CI2 B;  2EHO A;  3KIN B;  4BJN A;  1ZHC A;  4UVB B;  2Q9Q B;  4OK0 A;  3AB3 B;  2CXD A;  3H37 A;  2R7X A;  5EK2 A;  3AAA B;  3PUA A;  4YJ2 E;  3DTO A;  3I1A A;  3DP7 A;  4H9O C;  2NTY A;  1D0Y A;  4I4T E;  3BQI A;  3NZP A;  4ZI2 C;  3CX8 B;  5A1L A;  4PJJ A;  1SHZ C;  2Y48 B;  3N9P A;  4UV9 B;  3AA6 B;  2CXL A;  4TUY E;  5HXH A;  3CX7 B;  1D0X A;  4O4J E;  5LBQ B;  3MXZ A;  5JR9 C;  4ZI3 D;  4MFR A;  4C2M A;  2WM9 A;  5E0O A;  2MTQ A;  3CWZ B;  3FHN A;  1MIW A;  2LSJ A;  2VKJ A;  4IE6 A;  5LJM A;  2B3W A;  1BR1 A;  3NS4 A;  2X51 A;  3I0Q A;  3DJB A;  4X1Y E;  2C5K T;  2R7T A;  3MK7 C;  4E7Z A;  2PG8 A;  2LHN A;  4P0B A;  1HX8 A;  1OXZ A;  4PJN A;  2LEH A;  5JR9 B;  5LHI B;  2HPL A;  2V26 A;  3UTK A;  2X67 A;  3C98 B;  3N9N A;  4TV9 E;  2PFV A;  3PUG A;  3PUR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...