3BR2A

Crystal structure of the complex of dequalinium bound to qacr(e120q), a mutant of a multidrug binding transcriptional repressor
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
186
structure length
186
Chain Sequence
NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKKEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKTNSINEKMNKLQNKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords HTH-type transcriptional regulator qacR
publication title Formal electrostatic interactions do not govern QacR-cation affinity
rcsb
source organism Staphylococcus aureus
total genus 76
structure length 186
sequence length 186
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2007-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3br2A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3br2A02
5BNGA 3S14J 1LE8A 3LWJA 4CYCB 3S1RJ 1ETOA 2E19A 1BA5A 3BR6A 1JGGA 3PO2J 2XPWA 2G7GA 2E2JJ 4MO7A 2HXIA 3BTIA 1WH7A 3HGGA 5F0HA 2OPTA 4V2FA 4A3JJ 2Y31A 1HOMA 3KKDA 5CXGA 2ME6A 3JRBA 3C2BA 1TWCJ 4Y7NJ 1YRNA 4W97A 5IPAA 2G3BA 2DJNA 5FLMJ 3NARA 1Y1VJ 3QKXA 4GFLA 2QKOA 4GCTA 3Q0UA 4KWAA 2G7LA 3HE0A 2XPUA 4MFEA 2HKUA 3TEDA 3VVYA 3QBMA 3V6GA 1XS9A 2Y9YA 3FK6A 5EF6A 2L7MP 1HDPA 5D1RA 3LJLA 4W1UA 1SFOJ 2O7OA 3RD3A 2M34A 3CQZJ 1DU0A 2DA5A 3NNRA 3DEWA 5JLWA 3B6CA 5DS9A 3AQTA 3IH4A 1MBJA 1GV2A 2LD5A 3S15J 3ON2A 3S1QJ 1T56A 3NPIA 1U9NA 3HTIA 2TCTA 1JKPC 4ACIA 2CU7A 2DA2A 3HOWJ 3VIBA 2LTPA 3F1BA 1IC8A 1G2HA 3Q0VA 3L1PA 3JRGA 3GTLJ 1JUPA 1ENHA 5FKKA 2HDDA 2L7FP 4A3IJ 2K9QA 3UKGA 3G56A 3PPBA 5FKLA 1IGNA 4FE7A 2NVTJ 4B1RA 4MIMA 2PBXA 2V57A 2EZHA 2IBDA 4BKXA 5C44J 3CMYA 1IDZA 4FE4A 1JJ8C 1RKTA 3IH3A 5M5XJ 3SJMA 5F27A 3G1OA 1HLVA 3ANGA 4M3GA 4A3GJ 3LSPA 1MH4A 1TWAJ 2QTQA 1MBHA 2YUSA 1A5JA 2XPVA 2DG8A 3S1NJ 3MN2A 2EZLA 3NRGA 3T6NA 2QOPA 3JSJA 5EGOA 4EEFG 3NI7A 4NELA 2EBIA 3V78A 2ID6A 4L62A 2M2EA 1R9TJ 2UXPA 3HBLA 4S0HB 5C3EJ 5EZGA 3GTJJ 1MBEA 2LKXA 2ECBA 1F43A 1LFBA 3WHBA 4IHVA 1APLC 4C3HJ 1OCPA 5DAJA 1IG7A 2X48A 3BT9A 1UI5A 4BY1J 5EZHA 3MKLA 4M3DA 1BL0A 4XRSG 3O8GA 2G7SA 2JWTA 5FKOA 2DMUA 3FK7A 4G12A 2JJ7A 1TC3C 4JL3A 4M6VA 2F07A 3S1MJ 2MGQA 5IYDJ 3LSRA 5F0FA 2JA6J 2ME0A 4QSHA 2R93J 3OSGA 4MLOA 2Y9ZA 2EH3A 2XGDA 5F0CA 3BR5A 3RZOJ 2JN6A 3B6AA 3BR2A 5HBUA 2LR8A 4A3KJ 2D6YA 4XRMA 2E2IJ 1Y1WJ 3PM1A 1FTTA 3VVZA 3HIMA 2P81A 1H8AC 2I10A 5JLXA 4B3AA 1FTZA 1GVDA 5EEAA 3HB9A 5J1RA 4X6AJ 4ME9A 1RPWA 4C3IJ 3CWRA 4GFKA 5M3FJ 2E2HJ 2IEKA 4A3MJ 3VOKA 5GPCA 3BTCA 2ZCMA 3ZQHA 4BY7J 5IOZA 2UXHA 1Q1VA 5EG0A 2GBYA 2HYTA 1MNMC 2QWTA 2DMTA 3K7AJ 1GV5A 5EGOB 1WI3A 5E3LA 2FJ1A 3VW1A 3DPJA 1FIPA 2B63J 3I4NJ 1ZGWA 3VW0A 1JT0A 1GT0C 1UHSA 2K9SA 5K7HA 3S16J 2M0CA 4QIWN 2MG4A 2JA8J 1SGMA 2DTZA 4FISA 4I6ZA 1ZR2A 1DU6A 3EUPA 3OOUA 1ZR4A 3LNQA 1ETQA 2ELKA 1IDYA 4AC0A 4IHYA 4MFDA 1D5YA 2FBQA 3RKQA 3HOUJ 2O7TA 4V2GA 1LFUP 1NK3P 3S2DJ 4A3EJ 1ETWA 4XRSA 4BBSJ 3CRJA 1BW6A 3JRCA 4DZJA 4D5CA 2R5YA 4AF5A 3HKZN 2M8GX 3QQAA 2E1OA 2XGEA 3BR0A 4M3FA 3LSJA 3RQIA 4NN1A 1IJWC 2UXOA 2GM4A 4RBOA 2ZCNA 1PUFB 3A01B 3BJBA 1ITYA 4GCKA 5F04A 2VKVA 1IRZA 1POGA 3LOCA 5J3LA 1MSFC 1Z0XA 1WCMJ 2H1KA 3M3YJ 2TRTA 4JX6A 2MW8A 4GCLA 5GPAA 2R0QC 1W0TA 1X2MA 3BG3A 3MVPA 4XICA 3O60A 2LY9A 3WHCA 3RH2A 3KZ9A 1F36A 3K2AA 2XRLA 4BBRJ 3BCGA 3C07A 2ZOYA 4LOCA 1Z77A 2DG7A 1LE8B 5M3MJ 5IYCJ 1AU7A 2X6OA 2EZIA 3ZQFA 4XK4A 1NK2P 3ZQGA 1ETKA 2JA7J 5K58A 2WUIA 3F0CA 1WGXA 1JUSA 2YVHA 4ABZA 2W48A 1AHDP 4L5EA 1JUMA 3I4MJ 1U8BA 1YRNB 2XSDC 2REKA 3ANPA 4MXMA 2NX4A 3O8HA 1ETVA 1NTCA 5EYRA 5IP9J 3BHQA 3FIWA 1O4XA 1HDDC 1X58A 4JKZA 4CYCA 2DA7A 3ON4A 1GUUA 4JX4A 2XDNA 3CDLA 1EF4A 4X1EA 5EDNA 2CUFA 4D5FA 2H8RA 2NVXJ 2CJJA 2YVEA 4A3DJ 5M5YJ 4PXIA 1AKHA 1ZTRA 1VNDA 1HF0A 2IAIA 5DTDA 2Y0SN 1H88C 3BQYA 1UMQA 3P9TA 2LK2A 3E7LA 3W6VA 3E7QA 5E3MA 1GDTA 2NP5A 4FTHA 2RASA 3PASA 2DA3A 3VW2A 4DYRA 3A02A 3MNLA 1P7IA 3HOYJ 1I6HJ 2NS7A 5C4XJ 3KKCA 3ZQIA 1SANA 3KNWA 3S2HJ 2HOAA 1OCTC 4MK6A 1JTXA 1MSEC 4DW6A 3B81A 3BR3A 1QRYA 2DMQA 4B4CA 1B8IA 4UDSA 2WGBA 4D7NA 5K7ZA 3BTLA 4C3JJ 3EGQA 3G7RA 3Q3SA 4A3LJ 3IUVA 1HCRA 3M4OJ 3HM5A 4ICHA 2NS8A 4A3FJ 2IU5A 1FEXA 4JX5A 3LHQA 5D18A 3VUQA 4HNVA 5EFYA 3NAUA 2HQ5A 3OIOA 4A69C 4AC6A 1IV6A 1X2NA 2NP3A 2FQ4A 2RAEA 5AQCA 2LVSA 2DMNA 2WV1A 3G1LA 4UUTA 2ZCXA 3JR9A 2UXUA 3JRHA 2QCOA 1JJ6C 1JTYA 1A6IA 2MSYA 1E3OC 2DA6A 2VPRA 5FJ8J 3SFIA 1TWHJ 1RETA 2OF7A 3HDDA 2YS9A 2COBA 2R7ZJ 1T33A 5H9TA 5J1UA 2VI6A 4M3EA 2XB0X 1UG2A 2YU9J 1ZQ3P 4A93J 2OERA 1I3QJ 2L0KA 5HAWA 3HGYA 1WH5A 2HXOA 1OFCX 1ORKA 4YZEA 3FRQA 1VI0A 2ECCA 1QPIA 2X9DA 3TP3A 1AKHB 2O8KA 1RR7A 2G0EA 2Y30A 3Q0WA 1U78A 1IUFA 5FKMA 3BRUA 4J19A 1XC5A 3GTQJ 1TWFJ 3GTKJ 1XG1A 3TW6A 1UI6A 1WPKA 5HSZA 3GTPJ 1B72A 5J1YA 1K83J 1ETXA 3VPRA 1VFCA 3BG5A 3ZOBA 3D1NI 4Y52J 2ZB9A 1TWGJ 2JA5J 3VVXA 4C2MJ 3QPSA 3BTJA 1JT6A 3CCYA 2VUMJ 2GENA 3VP5A 1B8IB 2R5ZA 4NDLA 4CGRA 1MH3A 2Q24A 3HTAA 5C4YA 4JNNA 3GTGJ 5IYBJ 3S17J 2D5VA 4AUXA 2W53A 4A3CJ 1VF9A 3JREA 2M9HA 2CQQA 3JRIA 2CRGA 2PMZN 3HTHA 4RDUA 4IEJA 2GLOA 1P7JA 3JRAA 4BXXJ 3JRDA 1JKQC 2KT0A 2LLKA 2O9LA 3FKIJ 3LSGA 1BJZA 4XIDA 4UUSA 1MBGA 3RZDJ 2K40A 1RKWA 5C4JJ 3HOXJ 2N8GA 3BR1A 2QF7A 2DA4A 5EG0B 2GUHA 2RHAA 2JMWA 2L9RA 1JKOC 3G1MA 2PZ9A 1QVUA 3DCFA 1OJLA 5IP6A 1RESA 3HOZJ 3PO3J 2UXIA 2Y2ZA 5FKNA 3IH2A 3HEFA 2HOSA 2XGCA 1FIAA 3NXCA 5CW8A 5M5WJ 2QIBA 3BNIA 5D19A 2CQXA 4DYQA 1ETYA 4IHWA 3CJDA 1MBFA 3H3VK 3HOVJ 1BW5A 2DA1A 2NOGA 3H0GJ 2JK3A 4DZPA 2R92J 2OI8A 3AQSA 2L7ZA 2HOTA 3ZQCA 3QPLA 5CXIA 2R5YB 3IV5A 1QVTA 4JP0A 4QTRA 1B72B 3GTOJ 2ZOZA 2LP0A 4I76A 5FHPA 3BQZA 1W0UA 5K7FA 5E3OA 3GTMJ 3GEUA 1S7EA 3FISA 2DN0A 1K61A 2K9NA 9ANTA 3COLA 4GFBA 1ZKGA 2FD5A 2HI3A 4A3BJ 3VOXA 3TW7A 2AHQA 5E3NA 2R5ZB 2NVYJ 3GZIA 1I50J 5F08A 2AO9A 3S5RA 1U9OA 2DMPA 2NVQJ 2WB1N 2VKEA 2HYJA 3ZQLA 2GFNA 2KDZA 4FCYA 5IOYA 2FX0A 1MBKA 2WAQN 1PUFA 4AYBN 3A01A 4DYCA 3HTJA 3TP0A 1ZK8A 3SDGA 5FGLA 2LFBA 4UUSB 1H89C 5FMPA 3A03A 5FLVA 3OSFA 2XB5A 4IHXA 5IP7J 2EZKA 1JKRC 2EQRA 4JYKA 2ID3A 4HKUA 4D7MA 4M3BA 1FJLA 2CUEA 1CQTA 5GP9A 3JRFA 3GBGA 5HODA 5F1JA 3BG9A
chains in the Genus database with same CATH superfamily
4FQGA 2HFHA 4CYCB 3S1RJ 1Z91A 3VSKA 3BR6A 1JGGA 2HNHA 2G7GA 3CDHA 5D5UB 3BTIA 1WH7A 4V2FA 4A3JJ 1TLHB 1Z3YA 3FDYA 4E7SA 2PEXA 3HC7A 2KP6A 4BACA 5H6QA 4PFOA 1LVKA 4JBAA 3COAC 3QKXA 4J00A 2DODA 5ERIA 5AIPA 3V42A 1IN4A 3Q0UA 2G7LA 4KJZA 2LY1A 2XPUA 3SDBA 4PZJA 1N77A 3I54A 1R7JA 1Y8RB 1HDPA 3E3VA 2IGMA 2ZJ2A 2H09A 3TL4X 3RD3A 2A6TA 1DU0A 3CLOA 2ZO4A 4MEYF 1P4XA 5HS7A 4OIRF 3QPHA 3C7JA 3WTWC 1FY7A 1GV2A 1FNNA 1TQPA 2LD5A 3S1QJ 3WU1B 4LFUA 1Y8QB 3HTIA 2BYVE 2TCTA 3KYLA 2CU7A 2DA2A 2FNAA 1WJAA 2B7EA 3SHFA 3VIBA 5ED4A 2JA2A 1G2HA 4XOTA 2P5KA 1H0MA 3Q0VA 2OCEA 1JUPA 1ENHA 2HDDA 3FM3A 3UKGA 2HKOA 1R00A 4XLNF 2FUG2 2VPLA 3H9QA 3CUOA 4XOPA 5JFRA 2NXNB 2PBXA 3WE2A 2V57A 2EZHA 1PUEE 4IRVA 3OIPA 1O3QA 3MCZA 2R4GA 1JJ8C 4A5MA 4DQ2A 4E4HA 5HVQC 3IH3A 4OD4A 2ISYA 4B3XA 3G4SI 3WTZA 1DDNA 3BCBA 1SVMA 3FBNB 1S7OA 3K4JA 2Z16A 1VQNI 2ELJA 2VOPA 3OYIA 2RGVA 4EM2A 2Z99A 3RDIA 2V6CA 2KQRA 2IXSA 4G8XA 3OYEA 3OOPA 3L2RA 4BE2A 3NRGA 4GCVA 1ZRCA 4EEFG 3KLOA 3V78A 5FGMA 2UUZA 4NC8A 1TQIA 2G7UA 1R6RA 2O0YA 4RB1A 3QP5A 2R7RA 1UHWA 3AL0C 3GTJJ 3EYIA 3SWHA 3WHBA 2R7WA 4IHVA 2JPCA 2K7LA 1OCPA 4LG0A 4BQQA 2DAOA 3WU0A 2PBIA 4M3DA 3RCOA 1BL0A 2LC2A 1UJ8A 3JTHA 3I56I 2PFBA 2B1EA 5LGTA 4DJAA 2MGQA 2JVHA 2PMUA 3LSRA 5IYDJ 4E7LA 3I59B 4BL0B 2H8WA 3EQLF 2XC7A 1T95A 4MLOA 2BY3A 2XGDA 3BR5A 1U2WA 3PSFA 2HVSA 3AG3H 2XDVA 3B6AA 2CQKA 2E2IJ 2XAFA 2D2WA 5FFZA 4R8HA 2WADA 1Z05A 2V4JC 2A6HF 4CA0A 4HDUA 5LD2C 1GVDA 5E8GA 2PX9A 1G3SA 1YW9A 3BJOA 4PDKA 1MNDA 2K02A 1HC8A 6PAXA 3CD6I 4X6AJ 3DBHB 4UY8I 1EJ9A 3HIFA 3FXQA 1IN5A 3W6KB 1YTYA 2ZCMA 2GZWA 3BG7A 5K5OA 3QPTA 1KQ9A 4ZYDA 2YVXA 2EA2A 2JSCA 5GTIC 5EGOB 4PUSA 3OS0A 3HHHA 2KFDA 1K79A 3OYGA 5K7HA 4AIHA 4RLQA 5DEQA 1YW7A 1OR7A 2VBWA 1A36A 1D0XA 1JE8A 1ZR2A 1MMSA 5J8FA 1DU6A 3EUPA 1MD0A 1QZZA 3KEYA 2ISZA 4BE0A 2CO5A 4ZZDA 2FBQA 2P7VB 3HOUJ 2O7TA 4V2GA 1I27A 4M72A 1S72I 2X6YA 4RLFA 4BBSJ 3MKYB 3CRJA 4D5CA 2R5YA 2M8GX 2F6CA 4HAMA 3BR0A 3ZCOA 5GADJ 2BEOA 4PCQA 2GM4A 1XMKA 2OTLI 1Z3XA 3A01B 3GFMA 4LGWA 3E6DA 3ABLH 2E71A 1YQAA 1WRJA 1TT0A 2ESNA 3ZR8X 2VKVA 3BWGA 1FMWA 2XF5A 1O7FA 2QSGX 1POGA 3V8KA 3WTSC 2KIQA 2JUGA 4HV6A 4EM1A 2MW8A 4R1HA 4GCLA 5GPAA 4EATA 1P2FA 3BG3A 2UXNA 3KE2A 5HLHA 4XRFA 3RH2A 4PJ0C 3RPUD 4RGXA 4MGRA 4LJZF 1E17A 2H94A 2F2EA 1FC3A 1Z77A 5IYCJ 5DM7F 5DM6F 1ZYRF 1XCVA 1I1GA 3DU5A 4XK4A 3K9TA 1QZEA 2OU2A 1SFEA 3AG2H 5CVVA 4BU2A 4ANJA 2LOOA 3F0CA 2WUIA 3F72A 3FZVA 3K1MA 1EH8A 2W48A 1AHDP 2M7AA 2OV7A 1JUMA 1U8BA 1YRNB 2REKA 3M1CA 4A12A 4MXMA 1OMIA 4GDFA 2NX4A 2K4JA 1ETVA 2L4AA 1O4XA 4FHTA 1HDDC 3KYDB 5KK1A 4X1EA 5EDNA 2M87A 2H8RA 2YVEA 2CJJA 2Y75A 3F8FA 5DD4A 3S3MA 1ZRDA 4A3DJ 4F91B 2Y0SN 3PUFA 4IL6C 2XGXA 3LSIA 3LL7A 5E3MA 2WBMA 2GIVA 4FTHA 4P9UA 4DYRA 3M8EA 3W3CA 1P7IA 5AIQA 4M73A 5FLXZ 4RB0A 3PQKA 3QWLA 1XDSA 2HPMA 1OCTC 3LQRA 1HQCA 2DT5A 2W25A 4KN4X 2W24A 1B8IA 4K2EA 4UDSA 3MZ8A 4GXOA 2A05A 1IO2A 4D7NA 5K7ZA 1LEBA 1ULYA 1LDJA 2DYSH 4TV7A 1DPRA 3J80K 4A3LJ 3M4OJ 3HM5A 3BY6A 2VBYA 4A3FJ 1FEXA 1E0EA 4JX5A 2E5NA 3R0JA 3LHQA 3ABKH 2L3DA 4A69C 1IXSB 3EETA 3PNTA 5ILSA 4EJWA 4YFNF 4UXNA 2NP3A 2LVSA 2WV1A 2XKPA 4BDZA 2A69F 1SEUA 4YFKF 2Z33A 4Y13A 3CC7I 1K4SA 1W36D 4C2TA 2VPRA 4EJVA 1RETA 4G6DA 2KLOA 2COBA 2YS9A 3A1YA 1UG0A 4UVBA 4CH7A 4GYIA 5J1UA 1B9NA 2XB0X 1UG2A 3ZP5A 4ZYGA 4OIPF 4LLNA 3A0BC 1I3QJ 4G94A 5EJCA 1OYIA 3HGYA 1V5GA 2DJIA 3CDIA 2KDOA 3BZ6A 2P7CB 4S05A 4YZEA 1VQKI 2DYRH 2W1OA 2A6EF 4HW0A 3AFHA 4G9YA 2E1MC 3PQJA 3CCSI 1AKHB 1A6QA 5TJJA 2O8KA 1FPQA 3G6EI 1VQOI 3Q0WA 2ZY9A 1IUFA 3BRUA 4J19A 1XC5A 2ADUA 4BJ6C 4U87A 3ZQ7A 2DK8A 2AS5F 4OWRB 3DPUA 2P8TA 2PG4A 3VPRA 2OQGA 4YFXF 4BDYA 2FA5A 2HQNA 2E1CA 5JI6A 3C3WA 5EEHA 2O6GE 2F48A 4IJAA 4RMNA 4BQAA 2GENA 2R5ZA 4PJLA 1IN6A 5C4YA 5JR3A 1Z67A 3GTGJ 5L3DA 3I71A 3HSRA 3DTIA 1UELB 2W53A 3JREA 5JHUA 1FBUA 4IEJA 3F6VA 3FXRA 3JRAA 1HKTA 2O9LA 3HPHA 4N9IA 3AKZA 2Q0OA 4UUSA 3F23A 4IQ4A 3ESWB 3RZDJ 3E0JB 4E7HA 5C4JJ 3HOXJ 2YSRA 2GXBA 1FX7A 3BR1A 5FFXA 1LNWA 3MFKA 1X4PA 5ILUA 2DXIA 2GUHA 2JMWA 4EVIA 4KUMA 3RPQA 2QBYB 1OR7C 2QUFA 3ZMTA 3FXJA 1QVUA 3VWBA 1NG6A 2RDPA 1BC7C 4EQQA 3PO3J 1XGMA 2UXXA 3WG9A 2KKOA 2HOSA 2ZMEA 1O57A 3WGGA 5M5WJ 2GA1A 1O3TA 1XN7A 2DDBA 5J4VA 5CJ9A 2QIBA 1Y0UA 4DYQA 3FHNA 5E18F 1Q1HA 2DT6A 2RN7A 3FMSA 2OBPA 2P6SA 1SFXA 2EFQA 3HOVJ 2STWA 3W2AA 4PK4A 1YS7A 5KNLA 1T0FA 2L7ZA 3B73A 1QA6A 5CXIA 1FBSA 3KX2A 4BEHB 2FQ3A 1X1BA 3BQZA 1T39A 3N05A 1OCOH 3K70D 3GTMJ 3CC4I 2HVRA 2DN0A 5JVTA 3COLA 4E7KA 2K9NA 4ZZLA 3HRTA 3OYFA 4A3BJ 1VQ9I 5E3NA 3AL0B 4QWQA 1L3LA 2VONA 1MKMA 3DEUA 3WGHA 3GZIA 2V7FA 1YS6A 4HQMA 2FEZA 3ZQLA 1YI2I 3C2GA 3TGNA 2KDZA 2KHMA 1YIJI 2KRCA 4L5JA 4AVZA 5FRMA 3GFLA 4DYCA 1U8RA 1HW1A 3PFYA 3K4BA 2R7FA 3TO7A 3OYMA 1H89C 2HPIA 5FLVA 2K9LA 2FOWA 3ZQQA 3L2QA 5E20A 1XSXA 3H5AA 4XORA 3WU2C 2XAJA 3HRMA 2EB7A 1N75A 3KFWX 4M3BA 4AD9A 5HLGA 5DUIA 2V6EA 3ASOH 3IC7A 3GBGA 1RUOA 4E70A 2VJIA 3H35A 3DF8A 5F1JA 3BG9A 2VBXA 4HSRA 1GXQA 1LE8A 3RYRA 3PL8A 2P5VA 5B1AH 1ZG3A 1S9HA 1A04A 1DQUA 3EUAA 1IRXA 4Y4RA 1IXRC 4ZDPA 1R58A 1MMGA 3BOQA 5L3FA 2ME6A 3JRBA 3DPLC 2OD5A 5CQGA 5DD8A 3VFZA 1S5LC 1C0WA 5FLMJ 3NARA 2QQBA 3CJRB 3DBLB 2L9NA 4ZTJA 1SD5A 2CFOA 5H6RA 4GCTA 3GVAA 3HE0A 2VXZA 2JT1A 3QYFA 2K3PA 3LA3A 3CCQI 5D1RA 4IZZA 5F64A 4XMYA 2LF7A 3J7AY 4W1UA 1SFOJ 1VQ5I 2FSWA 2QKLB 3SXYA 4ENJA 3IAS2 2ZSIB 1G3WA 3S8PA 3ML6A 4CCOA 5DS9A 3MD2A 1MBJA 4CCLA 3ZXSA 1MDMB 1OKRA 3HXLA 1T56A 1U9NA 4XN3A 3AG4H 4XKVA 4FASD 4MQ9F 2JQ7A 5LRRA 3DP7A 4NBQA 2W57A 4WF2A 4M6XA 2FE3A 3GTLJ 1ZG5A 2L7FP 1BR1A 3G56A 2HGCA 2VBZA 1W7PB 5FKLA 3BROA 4FE7A 2EV5A 2IW5A 2V79A 2H1LA 1G4DA 3IWFA 1TT5B 1RNLA 5C44J 2L7KA 3CF2A 3CMYA 2VOOA 3R60A 2PFVA 2ZKZA 5FROA 3KP3A 1RKTA 3M8FA 1YJWI 2F4IA 2WAQA 2BZTA 4KIBA 4AYBA 1HLVA 3ANGA 4M3GA 3CO7C 3LSPA 2JSPA 4F3QA 2ICWG 2LRDA 2BOLA 3IHUA 2YUSA 2BW3B 1DUXC 2EIJH 3MN2A 2EZLA 3PIPF 4KDPA 4I0BA 5KAIC 3UR3C 3TDZC 3LA7A 3SEQA 2X6XA 4NELA 2ID6A 4YG2F 4HLXA 4YRVA 4L9VA 3EYYA 2B3WA 2M2EA 2YPRA 2NAZA 5HDGA 3HBLA 3W2VA 3U2RA 1MBEA 4A0XA 1UB9A 2Y0MA 1QNTA 4RS8A 1F43A 2XAGA 2KZGA 1S29A 1APLC 1W5SA 4EGZA 4PJMA 5DAJA 4HPQA 3T8TA 2YU3A 3H36A 4BY1J 5EZHA 3MKLA 2CV1A 4CCKA 3O8GA 2JTVA 2JWTA 3IUOA 1AOYA 3CLQA 2JJ7A 4HOBA 1TC3C 3GFJA 4M6VA 3Q5FA 1P4AA 4AIDA 3JSPA 3S1MJ 5F0FA 2NS0A 3I58A 2PJRB 2JA6J 3IRRA 2Y9ZA 2DW4A 4XM3A 3J7ZI 4P96A 3ULQB 3DQVC 3BR2A 2LR8A 4A3KJ 1TZLA 1SC7A 2IP2A 2Q2EA 1Z21A 1KONA 3NWTA 3VVZA 2ZXWH 2P81A 3EUKL 2KL4A 1LUJB 2GQQA 1BOAA 2ZMEC 2VJ5A 2FBHA 5LGNA 4BE1A 2RV8A 4M71A 2R7DA 2FU4A 2BHYA 5E1XA 2EK5A 5E17F 4WIBA 3MMYB 4Q4ZF 2IEKA 3WTUC 1SAUA 3BTCA 2MLGA 2J5OA 1SD7A 1Y0NA 4N9HA 1T0FC 2QVOA 2ZSHB 2GIZA 3GUDA 3LFKA 5EG0A 1KA8A 3ABUA 5D8LB 2AXLA 2DMTA 3K2ZA 1GV5A 2X1CA 1IN7A 2FJ1A 3QOEA 2LBFB 3DPJA 4BQOA 1EH6A 1DP3A 2FOKA 1JT0A 1GT0C 3MZHA 2M4GA 3E5XA 2VQGA 2K9SA 3S16J 4IRHA 4HF1A 4QIWN 2MG4A 4GO1A 1UFMA 4RGRA 4RGSA 3GCMA 5LEJA 4Q5SF 1FLIA 3CUQA 1WHUA 5BQTA 4IHYA 1D5YA 4I0AA 4XKCA 3MWMA 3NS4A 1WJCA 3S2DJ 4G7OF 4XRSA 1R71A 1BW6A 3TKYA 2MLKA 3I55I 3JRCA 3HKZN 1BM9A 2VE9A 2XGEA 3LSJA 1IJWC 2E1MB 5F1RA 4D9JA 4RBOA 4IHSA 2Z9OA 2ZCNA 5CQEA 1PUFB 3SZGA 5ICGA 1U6GA 1WQ2A 3K1NA 1VQ6I 4GCKA 1SAXA 5HNHA 1KYWA 2ZCWA 2UWMA 3K4KA 2K86A 3V8JA 3OY9A 1FT9A 1MSFC 2RNGA 2R7QA 4D1QA 3SFZA 1WCMJ 1I6XA 3F8CA 3K4MA 1W0TA 1X2MA 4JK1X 1SD6A 3PNVA 3K10A 1F36A 1X1PA 1CF7A 3I53A 2XRLA 5TGTA 3ABTA 2IS6A 3C07A 3QAHA 4XLCA 4Y33A 3CMAI 5M3MJ 1IXCA 2X6OA 1LB2A 2EZIA 2KIMA 1XMAA 5IY5H 2PLYA 4RAZA 3BLYA 1ZREA 2IVMA 4ABZA 4BGDA 2IS2A 4XKWA 4WK8F 3I4MJ 2XSDC 2D1HA 4L0YB 2Z3YA 4Y3OA 3CJNA 4XLFA 3O8HA 1YLFA 2I5UA 2OQRA 1QBJA 5IP9J 5EYRA 1ZARA 4XNFA 3BHQA 4U9NA 3OS2A 4NQWB 2NVUB 4CYCA 1HW5A 4JX4A 5E8IA 1R4NB 2BY1A 3CDLA 5DCMA 4D5FA 3KZIC 5L3GA 2H6BA 4HX8A 4PXIA 3KEQA 1ZGJA 3BQYA 3P9TA 3W6VA 3E7LA 3VB2A 4P5OA 4QLCU 1B1BA 3GF2A 2GOMA 1IRFA 1ACIA 2QYOA 2DA3A 2D45A 4LG3A 3A02A 1R1UA 1W36C 5C4XJ 4Q48A 4IKFA 1D8JA 1E3PA 4G6TB 3ZQIA 2HOAA 2L54A 1T2KA 1JGSA 2XSJC 3H0DA 1BBYA 3BR3A 1QRYA 3I5UA 4RA2A 4B4CA 2JZYA 2ZBKA 1WJ5A 3BTLA 3PIOF 3EGQA 1P92A 2HWVA 4CXFA 3G7RA 1PYVA 5B66C 1GHCA 4DBRA 1ZN2A 1HKQA 3I64A 3HTSB 3WG7H 2VT2A 2NS8A 2IU5A 1K78A 2VIXA 4BH9A 1U5TB 5EFYA 3NAUA 1UCRA 3OIOA 3K4CA 4AC6A 3OYCA 1X2NA 2XAUA 4E7IA 1X1CA 1PP7U 3K6GA 4UUTA 3JR9A 2V1DA 5D5XB 3RSNA 1P9QC 1JJ6C 1JTYA 1A6IA 5F6FA 1E3OC 2IGNA 2OC6A 2W7NA 1BI0A 1MZBA 1K6YA 4C9YA 2ESHA 3CCLI 5IT9K 3NEUA 3JAMZ 2X1DA 2O3FA 3BPXA 4XL9A 4BUPA 2WA0A 3TMOA 3J81Z 4II2A 2G7HA 2XRNA 4U0VA 3OR2C 2OERA 4I98B 3LAJA 4O5VA 3B02A 4FX0A 1V5FA 5HAWA 4OU0A 2J5PA 1LJ9A 4U9LA 2VE8A 2K85A 2X9DA 3TP3A 2CV2A 4C2MA 1XTAA 1USSA 2G0EA 2Y30A 1W4MA 1ZLKA 1TWFJ 3K69A 3CCJI 1XG1A 3TW6A 1WPKA 3D5SC 5HSZA 2GOXB 1TNTA 4G6QA 2WY8Q 1FSEA 1NHAA 3GYHX 1XDUA 2A5WA 5BOXA 3VVXA 2IPQX 1J2XA 3ZMZA 2KZVA 5ICEA 1VQ4I 3OYJA 1X19A 3HZJA 3MQ0A 4LLGF 2LKSA 1B8IB 3VP5A 4CGRA 3L09A 1MH3A 2Y0SA 3DPTA 4Z6YA 4JNNA 4M9ZA 1VTNC 2HR3A 1VF9A 3LA2A 2DCEA 2KJBA 3X2QH 3KZYA 2PMZN 3I59A 1P7JA 2A3SA 2HTJA 4F7ZA 3G71I 2ZXHA 3OYNA 3FKIJ 3LSGA 2EV0A 4ZTFA 4XSXF 1MBGA 2K40A 1S3JA 3DU6A 2LKPA 2K9MA 5HS8A 2VT3A 2HOEA 3RTRA 3NWSA 2XAQA 4P1WA 1FYLA 1FP2A 3BDDA 3U21A 3MKWB 3GW2A 2XAHA 3W2WA 2LMDA 3IAM2 2DPDA 2XIGA 1YE9A 4EJUA 1JKOC 1OCCH 3CUQC 3K70C 4OINF 4CGZA 4RAFA 4HX7A 4XLPF 1OJLA 4JOMA 1FP1D 2CS3A 2PJPA 4ZYAA 1G8XA 3H5NA 2XGCA 1FIAA 4PGGA 2DI3A 2W85A 1J9IA 5D19A 3JTGA 1ETYA 3RQ4A 2X51A 3WGIA 4IHWA 5KVRA 3CJDA 3ZMDA 4PGHA 2BXYA 1LKXA 1I1SA 3RKYA 4DZPA 2Z1DA 2R92J 1WWXA 2OI8A 3AQSA 4ETSA 3ZQCA 3QPLA 3F9KA 3KEOA 3VTIA 1Y56A 3IV5A 1QVTA 2ZJPF 2EFWA 3FXLA 4QTRA 3CZ6A 1LVAA 1YG2A 2KRHA 5CLSA 5FHPA 2R7SA 5E3OA 5BPDA 1V4RA 1JHHA 2LG4A 2BBYA 1K61A 3KIOA 2HI3A 3TW7A 2AHQA 2R5ZB 1SFUA 4CDGA 3ELKA 3QU6A 2L4MA 1YHQI 1X1AA 2DLLA 2HYJA 3CF5F 1MBKA 2VB6A 4O6JA 1VQ7I 2F5DA 3A01A 2M3AA 1ZK8A 3SDGA 1N25A 5FGLA 4UUSB 5FMPA 4UUVA 1E3HA 1IAWA 1BIAA 1TQMA 4XLEA 1J5YA 1R36A 4DGWB 4D7MA 1FJLA 3E1SA 3KZZA 2IGKA 4ESFA 2H27A 1OCRH 1CQTA 1KYZA 3H9JA 4E7ZA 1QQIA 4PFPA 3BP8A 4MQVA 2F4OB 4UB6C 3DEEA 1SVLA 1PP8F 3LWJA 2E19A 4A2UA 1BA5A 2ZMEB 3HYIA 3F8BA 3DLAA 4MO7A 2HXIA 2V1XA 3U9GA 3HGGA 2OPTA 2UV1A 3S3OA 1HOMA 2QGUA 5CXGA 3C2BA 1TWCJ 4Y7NJ 2HZTA 4RB2C 1YRNA 5IPAA 2G3BA 4GGGA 1F1ZA 1Y1VJ 3E5UA 4GFLA 3WTTC 1MGTA 2QKOA 4KWAA 1B59A 3RKWA 3VVYA 3TEDA 3D5LA 5TRDA 3V6GA 2Y9YA 1MNEA 3FK6A 5EF6A 2L7MP 1SFKA 2CUJA 3VYRB 4AVPA 5D5VB 3LJLA 3IRQA 2O7OA 3QOPA 1ODDA 2M34A 3CQZJ 2CW8A 5HLIA 4PSXA 3NNRA 5JLWA 5L3BA 4ZDOA 2DQRA 4IXAA 4U0WA 4B43A 1ONVA 3IH4A 2R7OA 2L02A 3J81K 3V4GA 4G7ZF 1FWZA 2BE5F 3S15J 3ON2A 2Z2SB 3NPIA 4LK1F 5LFAA 3TBIA 4ESBA 1BI2A 2OTJI 1JKPC 4U7DA 2HDCA 4ACIA 2LREA 3UNGC 5GAEJ 5A2QZ 3HRSA 2A61A 3TOBA 3F1BA 1T6SA 2CWEA 5FD5A 3KETA 2DQLA 3JRGA 1XGSA 1X3ZB 1ON1A 2RNJA 1DGWY 2QENA 5FKKA 4O3MA 2K9QA 2BV6A 3BJ6A 1IGNA 1HA8A 4CHUA 3P9KA 3GXOA 3LMMA 4MIMA 4HRIA 3ROUA 4BKXA 2L01A 1VQMI 1IDZA 4FE4A 3GZ5A 1ZG1A 3CCUI 1XPXA 5JHFA 5CPRB 4I99C 4HEA2 5M5XJ 4EV0A 4KFCA 4MTDA 2LNBA 1D1BA 2COMA 2PQ8A 1B4AA 2E5ZA 4A3GJ 1TWAJ 3KCCA 2QTQA 1FOKA 3O2PE 2XPVA 1STZA 1W7PD 1LPQA 1YOVB 2VKHA 3P7NA 3JSJA 1R22A 2CQNA 3GLLA 2DFIA 5J4YA 4LB5A 5J40A 2JRMA 3SZTA 3GEZA 1TL8A 2XROA 3BZCA 1FBQA 5D4SA 3D5RC 4KITB 3G2BA 4S0HB 5C3EJ 4XBFA 2H6CA 2ECBA 2HVQA 4HA8A 1LFBA 2DFEA 2DDAA 3RI4A 3DTKA 2VC1A 4C3HJ 1IG7A 3CTAA 3OYDA 2X48A 4I02A 2Y48A 1OLTA 2DPUA 2EIKH 1HKSA 2DMUA 4G12A 3M8JA 1IZ1A 2F07A 4XSZF 3K0LA 3C18A 5ILVA 3RPUA 4RM2A 4QSHA 1OCZH 1FYKA 2Y69H 4CCNA 3CJTB 3OSGA 3H9GA 1R5HA 4ZYEA 3L2CA 3A0HC 3D0SA 2LDUA 2JN6A 2M45A 2QLZA 1FYMA 1CGPA 4LIVA 5HBUA 2D6YA 4XRMA 4HF0A 1Y1WJ 3PM1A 1UAAA 1FTTA 3OYBA 3HIMA 2XASA 3LSKA 2QM3A 1FMVA 2I10A 5JLXA 3KP6A 3M07A 3WTVC 4NHJA 1KQ0A 5EEAA 2KIFA 5FLXK 3FBIB 3HB9A 3BPVA 1J09A 1RPWA 2V9VA 4NUBA 3HSFA 1JXSA 4ME9A 2KIUA 2YR2A 3HJEA 4A3MJ 5GPCA 4KA4A 3MZYA 4OOIA 3HHGA 5J8CA 2K4BA 4BY7J 3E6CC 2EJRA 1RR8C 3J7YJ 2A07F 2GBYA 2HYTA 1MNMC 4BXFA 3F3XA 4L9TA 3K7AJ 2QBYA 2QWTA 1WI3A 5E3LA 2MH2A 1FIPA 2B63J 4BS9A 1ZGWA 1SMYF 2DFFA 3LSHA 3H5RA 5GAGJ 3H3ZA 4NNJA 1BIBA 2VLAA 1XMXA 2W84A 1HBXG 2JA8J 3ERED 1R1VA 2DU9A 4DIQA 4HX4A 4B44A 2CYYA 1JI8A 4I6ZA 1TTYA 1ZR4A 1V3FA 4HDVA 1ETQA 1WZ2A 4EGYA 4AC0A 4MFDA 3RKQA 1NK3P 4A3EJ 1ETWA 1D8KA 2DK5A 2W00A 5CVRA 4D0PA 4AF5A 3CMEI 4RGUA 4B8XA 5EEGA 2E1OA 3RQIA 4BEHA 2P6TA 4NN1A 2UXOA 2BVMA 2VN2A 5D6FA 5KHDA 1EKEA 4EJOA 1QGPA 2PI0A 3S32A 5FO5A 1G3TA 4Q47A 5F04A 1OISA 4KMFA 2OUMA 2ZNZA 3NQOA 1IRZA 2K3FA 3LOCA 5LBQA 5J3LA 2Q2EB 1W5TA 1TW3A 4CZZA 3ZMVA 2ZFWA 3M3YJ 2TRTA 4JX6A 3L2WA 1N78A 5LEKA 1V5EA 2R0QC 2CV0A 3O60A 3HUGB 4HNTA 4H4KC 1YX5A 4BYYA 4ZJZA 2ZOYA 1OPCA 4LOCA 4CZCA 1AU7A 2KRFA 2L9VA 3ZQFA 4L9NA 2OAZA 4IRGA 5DUKA 1NK2P 4PJJA 2EILH 1HXDA 1ETKA 2NNYA 5K58A 4DOZA 4AIJA 4UNOA 1WGXA 2CG4A 3OYAA 2YVHA 2M30A 4M74A 4IO9F 3H3UA 4F55A 3CESA 3O3KA 4KT6A 2A2FX 3N97A 1WI9A 4YIIA 1J75A 1NTCA 1D3YA 1X58A 4JKZA 1VQPI 3FXUA 4L0ZB 2XDNA 3TOAA 2E35A 2M8EA 4MEXF 2CUFA 2NVXJ 1LQ1A 3CUQB 3BCAA 4QPQA 5M5YJ 1GLNA 1VNDA 1D1AA 1HF0A 2HQAA 5DTDA 2CSOA 4YIFA 3PUBA 1LDKB 3E7QA 2R3SA 1GDTA 2Q8KA 2RASA 3PJRA 2M5WA 4Z2YA 3PASA 3LWFA 2B0LA 3ZMUA 3MNLA 2FNPA 5FRNA 3HSEA 2JRTA 3PFIA 3NRVA 2R7UA 2KMUA 2O8XA 4B09A 5CVUA 3KNWA 2QKMB 3MKZA 3OYHA 2V9PA 1EA3A 2BGCA 4MK6A 1MSEC 2R7TA 2BVLA 2DMQA 4AM3A 4QPOA 2FMLA 3G73A 1OYYA 1YYVA 2DOAA 4NC7A 1MDMA 4C3JJ 5LHIA 2EFPA 2B9SA 3Q3SA 4M6YA 3RYPA 1RIOH 1E2XA 2VASA 2MD0A 1MW7A 1WKMA 3HKZA 3I3LA 2OJED 3R0AA 3OYLA 1BJAA 5CVIA 5L3EA 3OYKA 4IX7A 5FD6A 3PNYA 3KP4A 4U0YA 3VUQA 1GXPA 4RAYA 3GZ6A 1W7PA 1IV6A 5AQCA 2FQ4A 2RAEA 4KIFA 2DMNA 3G1LA 4L9JA 3J7AO 2F4MB 3EPZA 1QPMA 1XSVA 3JRHA 4HQEA 2QCOA 2VC0A 3P5JA 1L0OC 1RUNA 4UB8C 3TO9A 2R7ZJ 2OF7A 4LIUA 3OS1A 4C2UA 1ERDA 1H9GA 2HS5A 1IV8A 3DWLE 3S93A 2YU9J 1ZQ3P 1R49A 2W82A 3FMQA 4A93J 2HZDA 2RQQA 2M0MA 1NH3A 2L0KA 4N0BA 4N4NB 2ZJRF 1WH5A 5K5QA 2HXOA 4MHGA 2BW3A 1ORKA 3CCRI 3FKJA 3CMMA 2ZJQF 3FRQA 3VODA 2ECCA 4HZFA 5DCMB 2M1BA 2MYSA 2EWNA 3OL3A 4LG0B 3QP6A 4YIRX 3L00A 4YELA 4OMYA 1U78A 4HG2A 4Y17A 3GX4X 4ITVA 1O7LA 3GTKJ 3GTQJ 4KICA 3DTEA 2D1VA 1TW2A 5LHHA 2ACJA 1B72A 5J1YA 1K83J 1VFCA 2KISA 1KQ8A 2ZNYA 3ZOBA 3D1NI 4Y52J 4BJTA 1TWGJ 3IKTA 2LH9A 5AONA 2QEXI 3S2WA 2BY0A 3TDUC 3ZGKA 3R4KA 3FM5A 1TP4A 2EFNA 3QPSA 4OAYA 4C2MJ 1X3WB 2YX7A 3O6BB 1VZ0A 3CCEI 1JT6A 2K5CA 1S8NA 4IQJA 4NDLA 2MC3A 1BOBA 4S04A 5D8KB 1U0JA 1KGSA 2D5VA 3GWZA 4A3CJ 5JVGF 1T8IA 3JRIA 1BI1A 2PJRA 3HTHA 4RDUA 4AWXB 1FOYA 2M4KA 1FOWA 4BXXJ 1JKQC 2CFXA 4C30A 1B9MA 1BJZA 1Z1DA 1PDNC 1K78B 1USTA 1RKWA 1YIOA 2IT0A 3KPHA 2RQPA 4FX4A 4MTEA 4ASNA 4A6EA 4BNCA 2VQLA 2RHAA 1WJFA 2VODA 3G1MA 2ZC2A 3T0YA 4V19K 2PZ9A 3RIRA 4HF2A 4CO8A 3QU3A 3DCFA 1MJBA 1RESA 4GYGA 3HOZJ 3PSIA 2JVGA 2Y2ZA 4P9FA 5FKNA 3IH2A 2CQ7A 3HEFA 3NXCA 5CW8A 2HYFA 2E34A 2OZ6A 3C2HA 2CQXA 3WTXC 1B6AA 2G9WA 3F8NA 3DKYA 4DNCA 1UZCA 2DA1A 1P6RA 1BW5A 2FMYA 2JK3A 2LBFA 3V8LA 2HOTA 3JW4A 2R5YB 1J59A 3J80Z 3ASNH 3OV8A 3GTOJ 2ZOZA 4LK0F 4OIQF 1LEAA 2QQ9A 3IP4B 1OQYA 3OWTA 1Z6TA 2DBBA 3S3NA 5K7FA 1ZH5A 1S7EA 4U7BA 9ANTA 3T8RA 1ZKGA 2FD5A 3LSMA 3VOXA 2FRHA 3K4NA 3VSLA 2V1UA 1I50J 3G3ZA 2E60A 1KZHA 2KJCA 4XR6A 3ZMSA 4AU7A 2VKEA 3H92A 3L2VA 4ON0A 4FCYA 1T08B 5ICCA 1PUFA 1BR2A 3TP0A 4A6DA 5E1WA 2LFBA 2XHKA 2O5RA 3V7SA 2ZFUA 2GXGA 4UVAA 5E79C 3VEPA 1LDDA 3OSFA 2E1NA 2OCCH 1Z6RA 1JKRC 2I8DA 2EQRA 4JYKA 3FXKA 4UV9A 1XGNA 3QYBA 1BC8C 3Q9SA 2F5VA 3W6JB 1YJNI 2EFOA 2M7BA 5K5RA 3LQQA 3JRFA 1XSDA 1T38A 2PMZA 4R79A 1K7AA 3LAPA 2OZUA 5BNGA 2RREA 3KP5A 3S14J 1ETOA 2AQFA 2GA2A 1FOXA 1Z7LA 2XPWA 1KU7A 4ZC3A 4P55A 5KAFC 4A0YA 2E2JJ 2MABA 3PO2J 2IS1A 4DVYP 2IJLA 2ZXIA 5F0HA 1R23A 3FHZA 2MBFA 4XKBA 1MJAA 2Y31A 1WSUA 1DPUA 3KKDA 3FMRA 5DCFA 2EV6A 4W97A 5B1BH 4GRIA 1MMNA 2DJNA 5D4RA 4XN0A 1R1TA 4HBLA 2VXDA 3H1CA 4NQWA 3VYSB 4MFEA 4N4OB 4BJ5C 2HKUA 1I5ZA 2E7XA 2V26A 3QBMA 1XS9A 2A68F 5H2FC 1BN5A 3BC8A 3BZKA 4IOCF 2W4SA 4HLYA 4EMSA 3OMYA 3VYTB 4F52A 2IA0A 4LB6B 2DA5A 1IW7F 3DEWA 4HNUA 3B6CA 4XQFA 1YITI 2O61A 1QU3A 3AQTA 2VKDA 3DKXA 5CYVA 2L5QA 2PN6A 3CP8A 2A5YB 1QZYA 3GMEA 2NNNA 1SVOA 1NG7A 3EUHA 3I0TA 3HOWJ 4UVCA 4KT5C 5D5WB 5TISC 2LTPA 2QSHX 1IC8A 3A4CA 3RKXA 3V7CA 3L1PA 2WTEA 2FBIA 2WAFA 2DTRA 4A3IJ 3PPBA 1G3YA 2STTA 2CW7A 2E36A 4B1RA 2NVTJ 3BG6A 2C6YA 1UHMA 2IBDA 4ZYHA 2XVCA 4IRIA 4WXHA 3KYCB 4ZDLA 3T5XA 3VDXA 3SJMA 5F27A 3G1OA 1U5TA 4RAGA 5IT3A 1MH4A 2QQAA 3L2UA 2X0LA 5J6XA 2IRFG 1D5VA 1RRJA 1MBHA 4LMYA 3DXJF 1A5JA 2XV4S 1K4TA 2XKOA 1PVEA 3S1NJ 2DG8A 3T6NA 2QOPA 4IPAA 1A35A 5EGOA 2R7VA 1W1WE 3HTUA 4BHCA 3NI7A 2EBIA 2VJ4A 2UZKA 2OA4A 2CMPA 4L62A 5DV5A 1VQ8I 5CKTA 3FWEA 1G6NA 1R9TJ 2UXPA 1BR4A 4HV5A 1V54H 2NRAC 3FF5A 1MIJA 3CO6C 1R5GA 1X4OA 5EZGA 5K1YA 2LKXA 4CICA 3HOSA 4YEJA 1IN8A 3VYUB 4KYWA 3E5QA 3BT9A 1UI5A 4XRSG 2G7SA 5FKOA 3FK7A 4KIGA 3ECOA 1ZAOA 4JL3A 2LSOA 4OD5A 1WVRA 3HPGA 3KP2A 2EIMH 2ME0A 2EINH 3ZPLA 1KU9A 2R93J 2EH3A 3WODF 3MAJA 1M1EB 4PJNA 5F0CA 2QWWA 3RZOJ 2TDXA 4I2OA 4LD5A 2ELHA 3E6MA 3R6SA 4B48A 4CSWA 3FX3A 4RM3A 3IL2A 1T98A 4CCJA 1H8AC 4U88A 3ZN1A 3DBRB 1RZ4A 4B3AA 1FTZA 2DT7B 4CUGA 2P4WA 1AA7A 3K8PC 1I39A 1XCBA 5J1RA 4WXDA 3V7RA 2CUZA 4C3IJ 3CWRA 2X4HA 4GFKA 2HTSA 5M3FJ 2E2HJ 1EV7A 3VOKA 1V55H 3HOTA 3ZQHA 1IUYA 5IOZA 2UXHA 4BHPA 1Q1VA 3ZN0A 2AQEA 2L9SA 2QA4I 4NB5A 2YX4A 4UHTA 3VW1A 4EJTA 3A2KA 3I4NJ 1S6LA 4KNYA 3VW0A 3OL4A 1UHSA 4KMUX 1O3SA 2HYGD 5LHGA 2M0CA 3L9FA 4IF4A 3E97A 1HSTA 1SGMA 4MNUA 2DTZA 4LLLA 4FISA 3F21A 2MH9A 3OOUA 3DKWA 3LNQA 2ELKA 1IDYA 2DO7A 3JAMK 4IVNA 3WE3A 1LFUP 3T1BA 1RC9A 3LFUA 4JQFA 5HDKA 4IHTA 3SEZA 4M9SA 2ETHA 1WJBA 4DZJA 3SQNA 4PSWA 2HDWA 2JPBA 2WV0A 3QQAA 5HDNA 2FXAA 4F92B 3GZNB 4M3FA 2F5EA 3QRFF 3K4LA 4XLAA 1WFXA 4Y15A 3BJBA 5E1ZB 2QQ8A 1ITYA 1HW2A 5D6EA 4ESJA 4EM0B 4KN7X 5DDGA 4BAYA 1Z0XA 2X85A 4ENMA 2ZXJA 2H1KA 3I4PA 5B5EC 1HSJA 3OR1C 1REPC 1D1CA 1XGOA 1F5TA 1KU3A 3MVPA 4XICA 2P5LC 1DP7P 2LY9A 3WHCA 3KZ9A 3K2AA 4BBRJ 3BCGA 2DOEA 2VQCA 1J0RA 2MFZA 4J01A 2DG7A 1LE8B 1EH7A 3ZQGA 3GFIA 5DYMA 2JA7J 3P9CA 4B47A 1JUSA 1YJ9I 2PMHA 1PJRA 4L5EA 1Z9CA 1H9TA 4I01A 3ANPA 2WAEA 2IA2A 1R4MB 4ZH4F 5LGUA 3FIWA 3K1PA 3I9V2 2DA7A 4XLHA 1GUUA 3ON4A 4ENKA 2HEOA 1EF4A 5J47A 4A5NA 2FJI1 4A0ZA 5H20A 1ZTRA 4M9XA 1AKHA 1D0ZA 2R7XA 2NYXA 2IAIA 3EUHC 2X1EA 3IKVA 1H88C 1UMQA 3CC2I 2LK2A 3AG1H 3FXMA 4WCGA 2VQHA 1F9NA 2NP5A 5HS9A 3VW2A 2E7WA 1SD4A 1JHFA 4FT8A 2NS7A 3ECHA 1U3EM 3HOYJ 1I6HJ 3ABMH 3KKCA 2KPMA 4F93B 3WTYC 1SANA 3AAFA 3S2HJ 3OIQA 3RJPA 2XUBA 4WX9A 4AIKA 4OIOF 3IWZA 1JTXA 5HNFA 2RVCA 4DW6A 3B81A 2HU9A 4L5IA 5BMZA 2WGBA 2AXTC 1U5TC 2Z5UA 2WWYA 2K27A 2WY7Q 2F5FA 3GLXA 1A31A 3IUVA 1HCRA 1F4KA 2LYCA 4ICHA 2MC4A 3HL2A 4E6KG 3LSTA 5D18A 4HNVA 5CVJA 2HQ5A 3DLLF 3GO5A 4KISA 4I7HA 2ZCXA 1YW8A 2RC4A 2UXUA 1X3UA 4H0EA 3ONQA 3TO6A 1BI3A 2MSYA 2DA6A 5FJ8J 1MJ9A 3CP2A 2IA1A 3SFIA 1TWHJ 2V1NA 3JCUC 4FETA 3HDDA 5H9TA 1T33A 1YFHA 3QODA 2VI6A 1Z7UA 2BY2A 4M3EA 5GTHC 1S7AA 3U1KA 4BQNA 2BHZA 2EA4A 1LFPA 3F22A 1O3RA 1OFCX 1ON2A 3VOEA 1VI0A 3SZPA 4CYDA 1QPIA 5KCMA 1G59A 4OMZA 1RR7A 2X6WA 3HG9A 1D0YA 2WC2A 5FKMA 1MMDA 2QSFX 1P4WA 4WXCA 4II3A 1UI6A 1IRGA 3M7GA 3GTPJ 4I09A 3U1DA 1ETXA 3BG5A 4HSTA 2ZB9A 2VJJA 2JA5J 3E6BA 1X1DA 3ZRGA 4X0GA 3CCMI 3BTJA 3CCYA 3SYTA 2VUMJ 1XD7A 1K6OA 1MMAA 2Q24A 3HTAA 1ZRFA 3M9AA 5FB2A 3M1EA 5IYBJ 3Q9VA 3S17J 4AUXA 4UV8A 1W5CC 2MA3A 2M9HA 2CQQA 2XF7A 2CRGA 4BXUA 4ENNA 2GLOA 3L7WA 3ERMA 1QHHD 1Y39A 3JRDA 2KT0A 2LLKA 2CGPA 1ZGAA 2EPFA 1ZELA 4LITA 2DFHA 4XIDA 1WJEA 5L3CA 3FXOA 5BPIA 1J7KA 2IGOA 2N8GA 2GWRA 3JSOA 2QF7A 1GVJA 1SMTA 1OYWA 2VL8A 3DV8A 2DA4A 2DOFA 5EG0B 3F8MA 4CCMA 2L9RA 3BJAA 5A2QK 3QYEA 2WB1A 2GXAA 2RKHA 1I3AA 1YO5C 5IP6A 1YX3A 2HQRA 2UXIA 2FBKA 1XB4A 1FZPB 3N4MA 3BNIA 1ZLJA 1AWCA 1MBFA 3H3VK 3C1DA 5ICFA 1QHGA 2JUCA 2NOGA 4IOAF 3H0GJ 4HYEA 1DGRM 1XX5A 3R61A 4BHBA 2MD5A 3TQNA 4JP0A 1KU2A 4NC6A 1B72B 2O03A 3P9IA 5LLQA 2LP0A 1WJDA 2CW0F 3KLNA 4I76A 1Y6IA 2NOJB 1W0UA 3GEUA 3FISA 2QZ8A 4GFBA 1TBXA 2L2OA 1VQLI 2P0WA 4E7JA 2BXZA 3EDPA 2NVYJ 5B3SH 5HLTA 5F08A 2AO9A 3ISPA 4G7HF 1U9OA 2CH0A 2DMPA 5BS6A 2NVQJ 2WB1N 3S5RA 2GFNA 4DBQA 4XONA 5IOYA 5IT9Z 1FSHA 2FX0A 2WAQN 3HRUA 2XF6A 4AYBN 1TNSA 3HTJA 3MEXA 1QO0D 1CF7B 1ZHFA 3A03A 4L18B 2XB5A 4IHXA 5IP7J 2EZKA 5HOOA 2LF8A 2Q1ZB 3REOA 3KP7A 2IS4A 4RB3C 2ID3A 3DFGA 4HKUA 4WWCA 3CCVI 2CUEA 1RI7A 1IF1A 5GP9A 2GAUA 5GAHJ 2FF4A 5HODA 3HUGA 5LRSA 1R5ID 2V9KA 3CJQB 3F6OA 2LY2A 4OAZA 2F5CA 2HKXA
chains in the Genus database with same CATH topology
5BNGA 3S14J 1LE8A 3LWJA 4CYCB 3S1RJ 1ETOA 2E19A 1BA5A 3BR6A 1JGGA 3PO2J 2XPWA 2G7GA 2E2JJ 4MO7A 2HXIA 3BTIA 1WH7A 3HGGA 5F0HA 2OPTA 4V2FA 4A3JJ 2Y31A 1HOMA 3KKDA 5CXGA 2ME6A 3JRBA 3C2BA 1TWCJ 4Y7NJ 1YRNA 4W97A 5IPAA 2G3BA 2DJNA 5FLMJ 3NARA 1Y1VJ 3QKXA 4GFLA 2QKOA 4GCTA 3Q0UA 4KWAA 2G7LA 3HE0A 2XPUA 4MFEA 2HKUA 3TEDA 3VVYA 3QBMA 3V6GA 1XS9A 2Y9YA 3FK6A 5EF6A 2L7MP 1HDPA 5D1RA 3LJLA 4W1UA 1SFOJ 2O7OA 3RD3A 2M34A 3CQZJ 1DU0A 2DA5A 3NNRA 3DEWA 5JLWA 3B6CA 5DS9A 3AQTA 3IH4A 1MBJA 1GV2A 2LD5A 3S15J 3ON2A 3S1QJ 1T56A 3NPIA 1U9NA 3HTIA 2TCTA 1JKPC 4ACIA 2CU7A 2DA2A 3HOWJ 3VIBA 2LTPA 3F1BA 1IC8A 1G2HA 3Q0VA 3L1PA 3JRGA 3GTLJ 1JUPA 1ENHA 5FKKA 2HDDA 2L7FP 4A3IJ 2K9QA 3UKGA 3G56A 3PPBA 5FKLA 1IGNA 4FE7A 2NVTJ 4B1RA 4MIMA 2PBXA 2V57A 2EZHA 2IBDA 4BKXA 5C44J 3CMYA 1IDZA 4FE4A 1JJ8C 1RKTA 3IH3A 5M5XJ 3SJMA 5F27A 3G1OA 1HLVA 3ANGA 4M3GA 4A3GJ 3LSPA 1MH4A 1TWAJ 2QTQA 1MBHA 2YUSA 1A5JA 2XPVA 2DG8A 3S1NJ 3MN2A 2EZLA 3NRGA 3T6NA 2QOPA 3JSJA 5EGOA 4EEFG 3NI7A 4NELA 2EBIA 3V78A 2ID6A 4L62A 2M2EA 1R9TJ 2UXPA 3HBLA 4S0HB 5C3EJ 5EZGA 3GTJJ 1MBEA 2LKXA 2ECBA 1F43A 1LFBA 3WHBA 4IHVA 1APLC 4C3HJ 1OCPA 5DAJA 1IG7A 2X48A 3BT9A 1UI5A 4BY1J 5EZHA 3MKLA 4M3DA 1BL0A 4XRSG 3O8GA 2G7SA 2JWTA 5FKOA 2DMUA 3FK7A 4G12A 2JJ7A 1TC3C 4JL3A 4M6VA 2F07A 3S1MJ 2MGQA 5IYDJ 3LSRA 5F0FA 2JA6J 2ME0A 4QSHA 2R93J 3OSGA 4MLOA 2Y9ZA 2EH3A 2XGDA 5F0CA 3BR5A 3RZOJ 2JN6A 3B6AA 3BR2A 5HBUA 2LR8A 4A3KJ 2D6YA 4XRMA 2E2IJ 1Y1WJ 3PM1A 1FTTA 3VVZA 3HIMA 2P81A 1H8AC 2I10A 5JLXA 4B3AA 1FTZA 1GVDA 5EEAA 3HB9A 5J1RA 4X6AJ 4ME9A 1RPWA 4C3IJ 3CWRA 4GFKA 5M3FJ 2E2HJ 2IEKA 4A3MJ 3VOKA 5GPCA 3BTCA 2ZCMA 3ZQHA 4BY7J 5IOZA 2UXHA 1Q1VA 5EG0A 2GBYA 2HYTA 1MNMC 2QWTA 2DMTA 3K7AJ 1GV5A 5EGOB 1WI3A 5E3LA 2FJ1A 3VW1A 3DPJA 1FIPA 2B63J 3I4NJ 1ZGWA 3VW0A 1JT0A 1GT0C 1UHSA 2K9SA 5K7HA 3S16J 2M0CA 4QIWN 2MG4A 2JA8J 1SGMA 2DTZA 4FISA 4I6ZA 1ZR2A 1DU6A 3EUPA 3OOUA 1ZR4A 3LNQA 1ETQA 2ELKA 1IDYA 4AC0A 4IHYA 4MFDA 1D5YA 2FBQA 3RKQA 3HOUJ 2O7TA 4V2GA 1LFUP 1NK3P 3S2DJ 4A3EJ 1ETWA 4XRSA 4BBSJ 3CRJA 1BW6A 3JRCA 4DZJA 4D5CA 2R5YA 4AF5A 3HKZN 2M8GX 3QQAA 2E1OA 2XGEA 3BR0A 4M3FA 3LSJA 3RQIA 4NN1A 1IJWC 2UXOA 2GM4A 4RBOA 2ZCNA 1PUFB 3A01B 3BJBA 1ITYA 4GCKA 5F04A 2VKVA 1IRZA 1POGA 3LOCA 5J3LA 1MSFC 1Z0XA 1WCMJ 2H1KA 3M3YJ 2TRTA 4JX6A 2MW8A 4GCLA 5GPAA 2R0QC 1W0TA 1X2MA 3BG3A 3MVPA 4XICA 3O60A 2LY9A 3WHCA 3RH2A 3KZ9A 1F36A 3K2AA 2XRLA 4BBRJ 3BCGA 3C07A 2ZOYA 4LOCA 1Z77A 2DG7A 1LE8B 5M3MJ 5IYCJ 1AU7A 2X6OA 2EZIA 3ZQFA 4XK4A 1NK2P 3ZQGA 1ETKA 2JA7J 5K58A 2WUIA 3F0CA 1WGXA 1JUSA 2YVHA 4ABZA 2W48A 1AHDP 4L5EA 1JUMA 3I4MJ 1U8BA 1YRNB 2XSDC 2REKA 3ANPA 4MXMA 2NX4A 3O8HA 1ETVA 1NTCA 5EYRA 5IP9J 3BHQA 3FIWA 1O4XA 1HDDC 1X58A 4JKZA 4CYCA 2DA7A 3ON4A 1GUUA 4JX4A 2XDNA 3CDLA 1EF4A 4X1EA 5EDNA 2CUFA 4D5FA 2H8RA 2NVXJ 2CJJA 2YVEA 4A3DJ 5M5YJ 4PXIA 1AKHA 1ZTRA 1VNDA 1HF0A 2IAIA 5DTDA 2Y0SN 1H88C 3BQYA 1UMQA 3P9TA 2LK2A 3E7LA 3W6VA 3E7QA 5E3MA 1GDTA 2NP5A 4FTHA 2RASA 3PASA 2DA3A 3VW2A 4DYRA 3A02A 3MNLA 1P7IA 3HOYJ 1I6HJ 2NS7A 5C4XJ 3KKCA 3ZQIA 1SANA 3KNWA 3S2HJ 2HOAA 1OCTC 4MK6A 1JTXA 1MSEC 4DW6A 3B81A 3BR3A 1QRYA 2DMQA 4B4CA 1B8IA 4UDSA 2WGBA 4D7NA 5K7ZA 3BTLA 4C3JJ 3EGQA 3G7RA 3Q3SA 4A3LJ 3IUVA 1HCRA 3M4OJ 3HM5A 4ICHA 2NS8A 4A3FJ 2IU5A 1FEXA 4JX5A 3LHQA 5D18A 3VUQA 4HNVA 5EFYA 3NAUA 2HQ5A 3OIOA 4A69C 4AC6A 1IV6A 1X2NA 2NP3A 2FQ4A 2RAEA 5AQCA 2LVSA 2DMNA 2WV1A 3G1LA 4UUTA 2ZCXA 3JR9A 2UXUA 3JRHA 2QCOA 1JJ6C 1JTYA 1A6IA 2MSYA 1E3OC 2DA6A 2VPRA 5FJ8J 3SFIA 1TWHJ 1RETA 2OF7A 3HDDA 2YS9A 2COBA 2R7ZJ 1T33A 5H9TA 5J1UA 2VI6A 4M3EA 2XB0X 1UG2A 2YU9J 1ZQ3P 4A93J 2OERA 1I3QJ 2L0KA 5HAWA 3HGYA 1WH5A 2HXOA 1OFCX 1ORKA 4YZEA 3FRQA 1VI0A 2ECCA 1QPIA 2X9DA 3TP3A 1AKHB 2O8KA 1RR7A 2G0EA 2Y30A 3Q0WA 1U78A 1IUFA 5FKMA 3BRUA 4J19A 1XC5A 3GTQJ 1TWFJ 3GTKJ 1XG1A 3TW6A 1UI6A 1WPKA 5HSZA 3GTPJ 1B72A 5J1YA 1K83J 1ETXA 3VPRA 1VFCA 3BG5A 3ZOBA 3D1NI 4Y52J 2ZB9A 1TWGJ 2JA5J 3VVXA 4C2MJ 3QPSA 3BTJA 1JT6A 3CCYA 2VUMJ 2GENA 3VP5A 1B8IB 2R5ZA 4NDLA 4CGRA 1MH3A 2Q24A 3HTAA 5C4YA 4JNNA 3GTGJ 5IYBJ 3S17J 2D5VA 4AUXA 2W53A 4A3CJ 1VF9A 3JREA 2M9HA 2CQQA 3JRIA 2CRGA 2PMZN 3HTHA 4RDUA 4IEJA 2GLOA 1P7JA 3JRAA 4BXXJ 3JRDA 1JKQC 2KT0A 2LLKA 2O9LA 3FKIJ 3LSGA 1BJZA 4XIDA 4UUSA 1MBGA 3RZDJ 2K40A 1RKWA 5C4JJ 3HOXJ 2N8GA 3BR1A 2QF7A 2DA4A 5EG0B 2GUHA 2RHAA 2JMWA 2L9RA 1JKOC 3G1MA 2PZ9A 1QVUA 3DCFA 1OJLA 5IP6A 1RESA 3HOZJ 3PO3J 2UXIA 2Y2ZA 5FKNA 3IH2A 3HEFA 2HOSA 2XGCA 1FIAA 3NXCA 5CW8A 5M5WJ 2QIBA 3BNIA 5D19A 2CQXA 4DYQA 1ETYA 4IHWA 3CJDA 1MBFA 3H3VK 3HOVJ 1BW5A 2DA1A 2NOGA 3H0GJ 2JK3A 4DZPA 2R92J 2OI8A 3AQSA 2L7ZA 2HOTA 3ZQCA 3QPLA 5CXIA 2R5YB 3IV5A 1QVTA 4JP0A 4QTRA 1B72B 3GTOJ 2ZOZA 2LP0A 4I76A 5FHPA 3BQZA 1W0UA 5K7FA 5E3OA 3GTMJ 3GEUA 1S7EA 3FISA 2DN0A 1K61A 2K9NA 9ANTA 3COLA 4GFBA 1ZKGA 2FD5A 2HI3A 4A3BJ 3VOXA 3TW7A 2AHQA 5E3NA 2R5ZB 2NVYJ 3GZIA 1I50J 5F08A 2AO9A 3S5RA 1U9OA 2DMPA 2NVQJ 2WB1N 2VKEA 2HYJA 3ZQLA 2GFNA 2KDZA 4FCYA 5IOYA 2FX0A 1MBKA 2WAQN 1PUFA 4AYBN 3A01A 4DYCA 3HTJA 3TP0A 1ZK8A 3SDGA 5FGLA 2LFBA 4UUSB 1H89C 5FMPA 3A03A 5FLVA 3OSFA 2XB5A 4IHXA 5IP7J 2EZKA 1JKRC 2EQRA 4JYKA 2ID3A 4HKUA 4D7MA 4M3BA 1FJLA 2CUEA 1CQTA 5GP9A 3JRFA 3GBGA 5HODA 5F1JA 3BG9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BNG A;  3S14 J;  1LE8 A;  3LWJ A;  4CYC B;  3S1R J;  1ETO A;  2E19 A;  1BA5 A;  3BR6 A;  1JGG A;  3PO2 J;  2XPW A;  2G7G A;  2E2J J;  4MO7 A;  2HXI A;  3BTI A;  1WH7 A;  3HGG A;  5F0H A;  2OPT A;  4V2F A;  4A3J J;  2Y31 A;  1HOM A;  3KKD A;  5CXG A;  2ME6 A;  3JRB A;  3C2B A;  1TWC J;  4Y7N J;  1YRN A;  4W97 A;  5IPA A;  2G3B A;  2DJN A;  5FLM J;  3NAR A;  1Y1V J;  3QKX A;  4GFL A;  2QKO A;  4GCT A;  3Q0U A;  4KWA A;  2G7L A;  3HE0 A;  2XPU A;  4MFE A;  2HKU A;  3TED A;  3VVY A;  3QBM A;  3V6G A;  1XS9 A;  2Y9Y A;  3FK6 A;  5EF6 A;  2L7M P;  1HDP A;  5D1R A;  3LJL A;  4W1U A;  1SFO J;  2O7O A;  3RD3 A;  2M34 A;  3CQZ J;  1DU0 A;  2DA5 A;  3NNR A;  3DEW A;  5JLW A;  3B6C A;  5DS9 A;  3AQT A;  3IH4 A;  1MBJ A;  1GV2 A;  2LD5 A;  3S15 J;  3ON2 A;  3S1Q J;  1T56 A;  3NPI A;  1U9N A;  3HTI A;  2TCT A;  1JKP C;  4ACI A;  2CU7 A;  2DA2 A;  3HOW J;  3VIB A;  2LTP A;  3F1B A;  1IC8 A;  1G2H A;  3Q0V A;  3L1P A;  3JRG A;  3GTL J;  1JUP A;  1ENH A;  5FKK A;  2HDD A;  2L7F P;  4A3I J;  2K9Q A;  3UKG A;  3G56 A;  3PPB A;  5FKL A;  1IGN A;  4FE7 A;  2NVT J;  4B1R A;  4MIM A;  2PBX A;  2V57 A;  2EZH A;  2IBD A;  4BKX A;  5C44 J;  3CMY A;  1IDZ A;  4FE4 A;  1JJ8 C;  1RKT A;  3IH3 A;  5M5X J;  3SJM A;  5F27 A;  3G1O A;  1HLV A;  3ANG A;  4M3G A;  4A3G J;  3LSP A;  1MH4 A;  1TWA J;  2QTQ A;  1MBH A;  2YUS A;  1A5J A;  2XPV A;  2DG8 A;  3S1N J;  3MN2 A;  2EZL A;  3NRG A;  3T6N A;  2QOP A;  3JSJ A;  5EGO A;  4EEF G;  3NI7 A;  4NEL A;  2EBI A;  3V78 A;  2ID6 A;  4L62 A;  2M2E A;  1R9T J;  2UXP A;  3HBL A;  4S0H B;  5C3E J;  5EZG A;  3GTJ J;  1MBE A;  2LKX A;  2ECB A;  1F43 A;  1LFB A;  3WHB A;  4IHV A;  1APL C;  4C3H J;  1OCP A;  5DAJ A;  1IG7 A;  2X48 A;  3BT9 A;  1UI5 A;  4BY1 J;  5EZH A;  3MKL A;  4M3D A;  1BL0 A;  4XRS G;  3O8G A;  2G7S A;  2JWT A;  5FKO A;  2DMU A;  3FK7 A;  4G12 A;  2JJ7 A;  1TC3 C;  4JL3 A;  4M6V A;  2F07 A;  3S1M J;  2MGQ A;  5IYD J;  3LSR A;  5F0F A;  2JA6 J;  2ME0 A;  4QSH A;  2R93 J;  3OSG A;  4MLO A;  2Y9Z A;  2EH3 A;  2XGD A;  5F0C A;  3BR5 A;  3RZO J;  2JN6 A;  3B6A A;  3BR2 A;  5HBU A;  2LR8 A;  4A3K J;  2D6Y A;  4XRM A;  2E2I J;  1Y1W J;  3PM1 A;  1FTT A;  3VVZ A;  3HIM A;  2P81 A;  1H8A C;  2I10 A;  5JLX A;  4B3A A;  1FTZ A;  1GVD A;  5EEA A;  3HB9 A;  5J1R A;  4X6A J;  4ME9 A;  1RPW A;  4C3I J;  3CWR A;  4GFK A;  5M3F J;  2E2H J;  2IEK A;  4A3M J;  3VOK A;  5GPC A;  3BTC A;  2ZCM A;  3ZQH A;  4BY7 J;  5IOZ A;  2UXH A;  1Q1V A;  5EG0 A;  2GBY A;  2HYT A;  1MNM C;  2QWT A;  2DMT A;  3K7A J;  1GV5 A;  5EGO B;  1WI3 A;  5E3L A;  2FJ1 A;  3VW1 A;  3DPJ A;  1FIP A;  2B63 J;  3I4N J;  1ZGW A;  3VW0 A;  1JT0 A;  1GT0 C;  1UHS A;  2K9S A;  5K7H A;  3S16 J;  2M0C A;  4QIW N;  2MG4 A;  2JA8 J;  1SGM A;  2DTZ A;  4FIS A;  4I6Z A;  1ZR2 A;  1DU6 A;  3EUP A;  3OOU A;  1ZR4 A;  3LNQ A;  1ETQ A;  2ELK A;  1IDY A;  4AC0 A;  4IHY A;  4MFD A;  1D5Y A;  2FBQ A;  3RKQ A;  3HOU J;  2O7T A;  4V2G A;  1LFU P;  1NK3 P;  3S2D J;  4A3E J;  1ETW A;  4XRS A;  4BBS J;  3CRJ A;  1BW6 A;  3JRC A;  4DZJ A;  4D5C A;  2R5Y A;  4AF5 A;  3HKZ N;  2M8G X;  3QQA A;  2E1O A;  2XGE A;  3BR0 A;  4M3F A;  3LSJ A;  3RQI A;  4NN1 A;  1IJW C;  2UXO A;  2GM4 A;  4RBO A;  2ZCN A;  1PUF B;  3A01 B;  3BJB A;  1ITY A;  4GCK A;  5F04 A;  2VKV A;  1IRZ A;  1POG A;  3LOC A;  5J3L A;  1MSF C;  1Z0X A;  1WCM J;  2H1K A;  3M3Y J;  2TRT A;  4JX6 A;  2MW8 A;  4GCL A;  5GPA A;  2R0Q C;  1W0T A;  1X2M A;  3BG3 A;  3MVP A;  4XIC A;  3O60 A;  2LY9 A;  3WHC A;  3RH2 A;  3KZ9 A;  1F36 A;  3K2A A;  2XRL A;  4BBR J;  3BCG A;  3C07 A;  2ZOY A;  4LOC A;  1Z77 A;  2DG7 A;  1LE8 B;  5M3M J;  5IYC J;  1AU7 A;  2X6O A;  2EZI A;  3ZQF A;  4XK4 A;  1NK2 P;  3ZQG A;  1ETK A;  2JA7 J;  5K58 A;  2WUI A;  3F0C A;  1WGX A;  1JUS A;  2YVH A;  4ABZ A;  2W48 A;  1AHD P;  4L5E A;  1JUM A;  3I4M J;  1U8B A;  1YRN B;  2XSD C;  2REK A;  3ANP A;  4MXM A;  2NX4 A;  3O8H A;  1ETV A;  1NTC A;  5EYR A;  5IP9 J;  3BHQ A;  3FIW A;  1O4X A;  1HDD C;  1X58 A;  4JKZ A;  4CYC A;  2DA7 A;  3ON4 A;  1GUU A;  4JX4 A;  2XDN A;  3CDL A;  1EF4 A;  4X1E A;  5EDN A;  2CUF A;  4D5F A;  2H8R A;  2NVX J;  2CJJ A;  2YVE A;  4A3D J;  5M5Y J;  4PXI A;  1AKH A;  1ZTR A;  1VND A;  1HF0 A;  2IAI A;  5DTD A;  2Y0S N;  1H88 C;  3BQY A;  1UMQ A;  3P9T A;  2LK2 A;  3E7L A;  3W6V A;  3E7Q A;  5E3M A;  1GDT A;  2NP5 A;  4FTH A;  2RAS A;  3PAS A;  2DA3 A;  3VW2 A;  4DYR A;  3A02 A;  3MNL A;  1P7I A;  3HOY J;  1I6H J;  2NS7 A;  5C4X J;  3KKC A;  3ZQI A;  1SAN A;  3KNW A;  3S2H J;  2HOA A;  1OCT C;  4MK6 A;  1JTX A;  1MSE C;  4DW6 A;  3B81 A;  3BR3 A;  1QRY A;  2DMQ A;  4B4C A;  1B8I A;  4UDS A;  2WGB A;  4D7N A;  5K7Z A;  3BTL A;  4C3J J;  3EGQ A;  3G7R A;  3Q3S A;  4A3L J;  3IUV A;  1HCR A;  3M4O J;  3HM5 A;  4ICH A;  2NS8 A;  4A3F J;  2IU5 A;  1FEX A;  4JX5 A;  3LHQ A;  5D18 A;  3VUQ A;  4HNV A;  5EFY A;  3NAU A;  2HQ5 A;  3OIO A;  4A69 C;  4AC6 A;  1IV6 A;  1X2N A;  2NP3 A;  2FQ4 A;  2RAE A;  5AQC A;  2LVS A;  2DMN A;  2WV1 A;  3G1L A;  4UUT A;  2ZCX A;  3JR9 A;  2UXU A;  3JRH A;  2QCO A;  1JJ6 C;  1JTY A;  1A6I A;  2MSY A;  1E3O C;  2DA6 A;  2VPR A;  5FJ8 J;  3SFI A;  1TWH J;  1RET A;  2OF7 A;  3HDD A;  2YS9 A;  2COB A;  2R7Z J;  1T33 A;  5H9T A;  5J1U A;  2VI6 A;  4M3E A;  2XB0 X;  1UG2 A;  2YU9 J;  1ZQ3 P;  4A93 J;  2OER A;  1I3Q J;  2L0K A;  5HAW A;  3HGY A;  1WH5 A;  2HXO A;  1OFC X;  1ORK A;  4YZE A;  3FRQ A;  1VI0 A;  2ECC A;  1QPI A;  2X9D A;  3TP3 A;  1AKH B;  2O8K A;  1RR7 A;  2G0E A;  2Y30 A;  3Q0W A;  1U78 A;  1IUF A;  5FKM A;  3BRU A;  4J19 A;  1XC5 A;  3GTQ J;  1TWF J;  3GTK J;  1XG1 A;  3TW6 A;  1UI6 A;  1WPK A;  5HSZ A;  3GTP J;  1B72 A;  5J1Y A;  1K83 J;  1ETX A;  3VPR A;  1VFC A;  3BG5 A;  3ZOB A;  3D1N I;  4Y52 J;  2ZB9 A;  1TWG J;  2JA5 J;  3VVX A;  4C2M J;  3QPS A;  3BTJ A;  1JT6 A;  3CCY A;  2VUM J;  2GEN A;  3VP5 A;  1B8I B;  2R5Z A;  4NDL A;  4CGR A;  1MH3 A;  2Q24 A;  3HTA A;  5C4Y A;  4JNN A;  3GTG J;  5IYB J;  3S17 J;  2D5V A;  4AUX A;  2W53 A;  4A3C J;  1VF9 A;  3JRE A;  2M9H A;  2CQQ A;  3JRI A;  2CRG A;  2PMZ N;  3HTH A;  4RDU A;  4IEJ A;  2GLO A;  1P7J A;  3JRA A;  4BXX J;  3JRD A;  1JKQ C;  2KT0 A;  2LLK A;  2O9L A;  3FKI J;  3LSG A;  1BJZ A;  4XID A;  4UUS A;  1MBG A;  3RZD J;  2K40 A;  1RKW A;  5C4J J;  3HOX J;  2N8G A;  3BR1 A;  2QF7 A;  2DA4 A;  5EG0 B;  2GUH A;  2RHA A;  2JMW A;  2L9R A;  1JKO C;  3G1M A;  2PZ9 A;  1QVU A;  3DCF A;  1OJL A;  5IP6 A;  1RES A;  3HOZ J;  3PO3 J;  2UXI A;  2Y2Z A;  5FKN A;  3IH2 A;  3HEF A;  2HOS A;  2XGC A;  1FIA A;  3NXC A;  5CW8 A;  5M5W J;  2QIB A;  3BNI A;  5D19 A;  2CQX A;  4DYQ A;  1ETY A;  4IHW A;  3CJD A;  1MBF A;  3H3V K;  3HOV J;  1BW5 A;  2DA1 A;  2NOG A;  3H0G J;  2JK3 A;  4DZP A;  2R92 J;  2OI8 A;  3AQS A;  2L7Z A;  2HOT A;  3ZQC A;  3QPL A;  5CXI A;  2R5Y B;  3IV5 A;  1QVT A;  4JP0 A;  4QTR A;  1B72 B;  3GTO J;  2ZOZ A;  2LP0 A;  4I76 A;  5FHP A;  3BQZ A;  1W0U A;  5K7F A;  5E3O A;  3GTM J;  3GEU A;  1S7E A;  3FIS A;  2DN0 A;  1K61 A;  2K9N A;  9ANT A;  3COL A;  4GFB A;  1ZKG A;  2FD5 A;  2HI3 A;  4A3B J;  3VOX A;  3TW7 A;  2AHQ A;  5E3N A;  2R5Z B;  2NVY J;  3GZI A;  1I50 J;  5F08 A;  2AO9 A;  3S5R A;  1U9O A;  2DMP A;  2NVQ J;  2WB1 N;  2VKE A;  2HYJ A;  3ZQL A;  2GFN A;  2KDZ A;  4FCY A;  5IOY A;  2FX0 A;  1MBK A;  2WAQ N;  1PUF A;  4AYB N;  3A01 A;  4DYC A;  3HTJ A;  3TP0 A;  1ZK8 A;  3SDG A;  5FGL A;  2LFB A;  4UUS B;  1H89 C;  5FMP A;  3A03 A;  5FLV A;  3OSF A;  2XB5 A;  4IHX A;  5IP7 J;  2EZK A;  1JKR C;  2EQR A;  4JYK A;  2ID3 A;  4HKU A;  4D7M A;  4M3B A;  1FJL A;  2CUE A;  1CQT A;  5GP9 A;  3JRF A;  3GBG A;  5HOD A;  5F1J A;  3BG9 A; 
#chains in the Genus database with same CATH topology
 4FQG A;  2HFH A;  4CYC B;  3S1R J;  1Z91 A;  3VSK A;  3BR6 A;  1JGG A;  2HNH A;  2G7G A;  3CDH A;  5D5U B;  3BTI A;  1WH7 A;  4V2F A;  4A3J J;  1TLH B;  1Z3Y A;  3FDY A;  4E7S A;  2PEX A;  3HC7 A;  2KP6 A;  4BAC A;  5H6Q A;  4PFO A;  1LVK A;  4JBA A;  3COA C;  3QKX A;  4J00 A;  2DOD A;  5ERI A;  5AIP A;  3V42 A;  1IN4 A;  3Q0U A;  2G7L A;  4KJZ A;  2LY1 A;  2XPU A;  3SDB A;  4PZJ A;  1N77 A;  3I54 A;  1R7J A;  1Y8R B;  1HDP A;  3E3V A;  2IGM A;  2ZJ2 A;  2H09 A;  3TL4 X;  3RD3 A;  2A6T A;  1DU0 A;  3CLO A;  2ZO4 A;  4MEY F;  1P4X A;  5HS7 A;  4OIR F;  3QPH A;  3C7J A;  3WTW C;  1FY7 A;  1GV2 A;  1FNN A;  1TQP A;  2LD5 A;  3S1Q J;  3WU1 B;  4LFU A;  1Y8Q B;  3HTI A;  2BYV E;  2TCT A;  3KYL A;  2CU7 A;  2DA2 A;  2FNA A;  1WJA A;  2B7E A;  3SHF A;  3VIB A;  5ED4 A;  2JA2 A;  1G2H A;  4XOT A;  2P5K A;  1H0M A;  3Q0V A;  2OCE A;  1JUP A;  1ENH A;  2HDD A;  3FM3 A;  3UKG A;  2HKO A;  1R00 A;  4XLN F;  2FUG 2;  2VPL A;  3H9Q A;  3CUO A;  4XOP A;  5JFR A;  2NXN B;  2PBX A;  3WE2 A;  2V57 A;  2EZH A;  1PUE E;  4IRV A;  3OIP A;  1O3Q A;  3MCZ A;  2R4G A;  1JJ8 C;  4A5M A;  4DQ2 A;  4E4H A;  5HVQ C;  3IH3 A;  4OD4 A;  2ISY A;  4B3X A;  3G4S I;  3WTZ A;  1DDN A;  3BCB A;  1SVM A;  3FBN B;  1S7O A;  3K4J A;  2Z16 A;  1VQN I;  2ELJ A;  2VOP A;  3OYI A;  2RGV A;  4EM2 A;  2Z99 A;  3RDI A;  2V6C A;  2KQR A;  2IXS A;  4G8X A;  3OYE A;  3OOP A;  3L2R A;  4BE2 A;  3NRG A;  4GCV A;  1ZRC A;  4EEF G;  3KLO A;  3V78 A;  5FGM A;  2UUZ A;  4NC8 A;  1TQI A;  2G7U A;  1R6R A;  2O0Y A;  4RB1 A;  3QP5 A;  2R7R A;  1UHW A;  3AL0 C;  3GTJ J;  3EYI A;  3SWH A;  3WHB A;  2R7W A;  4IHV A;  2JPC A;  2K7L A;  1OCP A;  4LG0 A;  4BQQ A;  2DAO A;  3WU0 A;  2PBI A;  4M3D A;  3RCO A;  1BL0 A;  2LC2 A;  1UJ8 A;  3JTH A;  3I56 I;  2PFB A;  2B1E A;  5LGT A;  4DJA A;  2MGQ A;  2JVH A;  2PMU A;  3LSR A;  5IYD J;  4E7L A;  3I59 B;  4BL0 B;  2H8W A;  3EQL F;  2XC7 A;  1T95 A;  4MLO A;  2BY3 A;  2XGD A;  3BR5 A;  1U2W A;  3PSF A;  2HVS A;  3AG3 H;  2XDV A;  3B6A A;  2CQK A;  2E2I J;  2XAF A;  2D2W A;  5FFZ A;  4R8H A;  2WAD A;  1Z05 A;  2V4J C;  2A6H F;  4CA0 A;  4HDU A;  5LD2 C;  1GVD A;  5E8G A;  2PX9 A;  1G3S A;  1YW9 A;  3BJO A;  4PDK A;  1MND A;  2K02 A;  1HC8 A;  6PAX A;  3CD6 I;  4X6A J;  3DBH B;  4UY8 I;  1EJ9 A;  3HIF A;  3FXQ A;  1IN5 A;  3W6K B;  1YTY A;  2ZCM A;  2GZW A;  3BG7 A;  5K5O A;  3QPT A;  1KQ9 A;  4ZYD A;  2YVX A;  2EA2 A;  2JSC A;  5GTI C;  5EGO B;  4PUS A;  3OS0 A;  3HHH A;  2KFD A;  1K79 A;  3OYG A;  5K7H A;  4AIH A;  4RLQ A;  5DEQ A;  1YW7 A;  1OR7 A;  2VBW A;  1A36 A;  1D0X A;  1JE8 A;  1ZR2 A;  1MMS A;  5J8F A;  1DU6 A;  3EUP A;  1MD0 A;  1QZZ A;  3KEY A;  2ISZ A;  4BE0 A;  2CO5 A;  4ZZD A;  2FBQ A;  2P7V B;  3HOU J;  2O7T A;  4V2G A;  1I27 A;  4M72 A;  1S72 I;  2X6Y A;  4RLF A;  4BBS J;  3MKY B;  3CRJ A;  4D5C A;  2R5Y A;  2M8G X;  2F6C A;  4HAM A;  3BR0 A;  3ZCO A;  5GAD J;  2BEO A;  4PCQ A;  2GM4 A;  1XMK A;  2OTL I;  1Z3X A;  3A01 B;  3GFM A;  4LGW A;  3E6D A;  3ABL H;  2E71 A;  1YQA A;  1WRJ A;  1TT0 A;  2ESN A;  3ZR8 X;  2VKV A;  3BWG A;  1FMW A;  2XF5 A;  1O7F A;  2QSG X;  1POG A;  3V8K A;  3WTS C;  2KIQ A;  2JUG A;  4HV6 A;  4EM1 A;  2MW8 A;  4R1H A;  4GCL A;  5GPA A;  4EAT A;  1P2F A;  3BG3 A;  2UXN A;  3KE2 A;  5HLH A;  4XRF A;  3RH2 A;  4PJ0 C;  3RPU D;  4RGX A;  4MGR A;  4LJZ F;  1E17 A;  2H94 A;  2F2E A;  1FC3 A;  1Z77 A;  5IYC J;  5DM7 F;  5DM6 F;  1ZYR F;  1XCV A;  1I1G A;  3DU5 A;  4XK4 A;  3K9T A;  1QZE A;  2OU2 A;  1SFE A;  3AG2 H;  5CVV A;  4BU2 A;  4ANJ A;  2LOO A;  3F0C A;  2WUI A;  3F72 A;  3FZV A;  3K1M A;  1EH8 A;  2W48 A;  1AHD P;  2M7A A;  2OV7 A;  1JUM A;  1U8B A;  1YRN B;  2REK A;  3M1C A;  4A12 A;  4MXM A;  1OMI A;  4GDF A;  2NX4 A;  2K4J A;  1ETV A;  2L4A A;  1O4X A;  4FHT A;  1HDD C;  3KYD B;  5KK1 A;  4X1E A;  5EDN A;  2M87 A;  2H8R A;  2YVE A;  2CJJ A;  2Y75 A;  3F8F A;  5DD4 A;  3S3M A;  1ZRD A;  4A3D J;  4F91 B;  2Y0S N;  3PUF A;  4IL6 C;  2XGX A;  3LSI A;  3LL7 A;  5E3M A;  2WBM A;  2GIV A;  4FTH A;  4P9U A;  4DYR A;  3M8E A;  3W3C A;  1P7I A;  5AIQ A;  4M73 A;  5FLX Z;  4RB0 A;  3PQK A;  3QWL A;  1XDS A;  2HPM A;  1OCT C;  3LQR A;  1HQC A;  2DT5 A;  2W25 A;  4KN4 X;  2W24 A;  1B8I A;  4K2E A;  4UDS A;  3MZ8 A;  4GXO A;  2A05 A;  1IO2 A;  4D7N A;  5K7Z A;  1LEB A;  1ULY A;  1LDJ A;  2DYS H;  4TV7 A;  1DPR A;  3J80 K;  4A3L J;  3M4O J;  3HM5 A;  3BY6 A;  2VBY A;  4A3F J;  1FEX A;  1E0E A;  4JX5 A;  2E5N A;  3R0J A;  3LHQ A;  3ABK H;  2L3D A;  4A69 C;  1IXS B;  3EET A;  3PNT A;  5ILS A;  4EJW A;  4YFN F;  4UXN A;  2NP3 A;  2LVS A;  2WV1 A;  2XKP A;  4BDZ A;  2A69 F;  1SEU A;  4YFK F;  2Z33 A;  4Y13 A;  3CC7 I;  1K4S A;  1W36 D;  4C2T A;  2VPR A;  4EJV A;  1RET A;  4G6D A;  2KLO A;  2COB A;  2YS9 A;  3A1Y A;  1UG0 A;  4UVB A;  4CH7 A;  4GYI A;  5J1U A;  1B9N A;  2XB0 X;  1UG2 A;  3ZP5 A;  4ZYG A;  4OIP F;  4LLN A;  3A0B C;  1I3Q J;  4G94 A;  5EJC A;  1OYI A;  3HGY A;  1V5G A;  2DJI A;  3CDI A;  2KDO A;  3BZ6 A;  2P7C B;  4S05 A;  4YZE A;  1VQK I;  2DYR H;  2W1O A;  2A6E F;  4HW0 A;  3AFH A;  4G9Y A;  2E1M C;  3PQJ A;  3CCS I;  1AKH B;  1A6Q A;  5TJJ A;  2O8K A;  1FPQ A;  3G6E I;  1VQO I;  3Q0W A;  2ZY9 A;  1IUF A;  3BRU A;  4J19 A;  1XC5 A;  2ADU A;  4BJ6 C;  4U87 A;  3ZQ7 A;  2DK8 A;  2AS5 F;  4OWR B;  3DPU A;  2P8T A;  2PG4 A;  3VPR A;  2OQG A;  4YFX F;  4BDY A;  2FA5 A;  2HQN A;  2E1C A;  5JI6 A;  3C3W A;  5EEH A;  2O6G E;  2F48 A;  4IJA A;  4RMN A;  4BQA A;  2GEN A;  2R5Z A;  4PJL A;  1IN6 A;  5C4Y A;  5JR3 A;  1Z67 A;  3GTG J;  5L3D A;  3I71 A;  3HSR A;  3DTI A;  1UEL B;  2W53 A;  3JRE A;  5JHU A;  1FBU A;  4IEJ A;  3F6V A;  3FXR A;  3JRA A;  1HKT A;  2O9L A;  3HPH A;  4N9I A;  3AKZ A;  2Q0O A;  4UUS A;  3F23 A;  4IQ4 A;  3ESW B;  3RZD J;  3E0J B;  4E7H A;  5C4J J;  3HOX J;  2YSR A;  2GXB A;  1FX7 A;  3BR1 A;  5FFX A;  1LNW A;  3MFK A;  1X4P A;  5ILU A;  2DXI A;  2GUH A;  2JMW A;  4EVI A;  4KUM A;  3RPQ A;  2QBY B;  1OR7 C;  2QUF A;  3ZMT A;  3FXJ A;  1QVU A;  3VWB A;  1NG6 A;  2RDP A;  1BC7 C;  4EQQ A;  3PO3 J;  1XGM A;  2UXX A;  3WG9 A;  2KKO A;  2HOS A;  2ZME A;  1O57 A;  3WGG A;  5M5W J;  2GA1 A;  1O3T A;  1XN7 A;  2DDB A;  5J4V A;  5CJ9 A;  2QIB A;  1Y0U A;  4DYQ A;  3FHN A;  5E18 F;  1Q1H A;  2DT6 A;  2RN7 A;  3FMS A;  2OBP A;  2P6S A;  1SFX A;  2EFQ A;  3HOV J;  2STW A;  3W2A A;  4PK4 A;  1YS7 A;  5KNL A;  1T0F A;  2L7Z A;  3B73 A;  1QA6 A;  5CXI A;  1FBS A;  3KX2 A;  4BEH B;  2FQ3 A;  1X1B A;  3BQZ A;  1T39 A;  3N05 A;  1OCO H;  3K70 D;  3GTM J;  3CC4 I;  2HVR A;  2DN0 A;  5JVT A;  3COL A;  4E7K A;  2K9N A;  4ZZL A;  3HRT A;  3OYF A;  4A3B J;  1VQ9 I;  5E3N A;  3AL0 B;  4QWQ A;  1L3L A;  2VON A;  1MKM A;  3DEU A;  3WGH A;  3GZI A;  2V7F A;  1YS6 A;  4HQM A;  2FEZ A;  3ZQL A;  1YI2 I;  3C2G A;  3TGN A;  2KDZ A;  2KHM A;  1YIJ I;  2KRC A;  4L5J A;  4AVZ A;  5FRM A;  3GFL A;  4DYC A;  1U8R A;  1HW1 A;  3PFY A;  3K4B A;  2R7F A;  3TO7 A;  3OYM A;  1H89 C;  2HPI A;  5FLV A;  2K9L A;  2FOW A;  3ZQQ A;  3L2Q A;  5E20 A;  1XSX A;  3H5A A;  4XOR A;  3WU2 C;  2XAJ A;  3HRM A;  2EB7 A;  1N75 A;  3KFW X;  4M3B A;  4AD9 A;  5HLG A;  5DUI A;  2V6E A;  3ASO H;  3IC7 A;  3GBG A;  1RUO A;  4E70 A;  2VJI A;  3H35 A;  3DF8 A;  5F1J A;  3BG9 A;  2VBX A;  4HSR A;  1GXQ A;  1LE8 A;  3RYR A;  3PL8 A;  2P5V A;  5B1A H;  1ZG3 A;  1S9H A;  1A04 A;  1DQU A;  3EUA A;  1IRX A;  4Y4R A;  1IXR C;  4ZDP A;  1R58 A;  1MMG A;  3BOQ A;  5L3F A;  2ME6 A;  3JRB A;  3DPL C;  2OD5 A;  5CQG A;  5DD8 A;  3VFZ A;  1S5L C;  1C0W A;  5FLM J;  3NAR A;  2QQB A;  3CJR B;  3DBL B;  2L9N A;  4ZTJ A;  1SD5 A;  2CFO A;  5H6R A;  4GCT A;  3GVA A;  3HE0 A;  2VXZ A;  2JT1 A;  3QYF A;  2K3P A;  3LA3 A;  3CCQ I;  5D1R A;  4IZZ A;  5F64 A;  4XMY A;  2LF7 A;  3J7A Y;  4W1U A;  1SFO J;  1VQ5 I;  2FSW A;  2QKL B;  3SXY A;  4ENJ A;  3IAS 2;  2ZSI B;  1G3W A;  3S8P A;  3ML6 A;  4CCO A;  5DS9 A;  3MD2 A;  1MBJ A;  4CCL A;  3ZXS A;  1MDM B;  1OKR A;  3HXL A;  1T56 A;  1U9N A;  4XN3 A;  3AG4 H;  4XKV A;  4FAS D;  4MQ9 F;  2JQ7 A;  5LRR A;  3DP7 A;  4NBQ A;  2W57 A;  4WF2 A;  4M6X A;  2FE3 A;  3GTL J;  1ZG5 A;  2L7F P;  1BR1 A;  3G56 A;  2HGC A;  2VBZ A;  1W7P B;  5FKL A;  3BRO A;  4FE7 A;  2EV5 A;  2IW5 A;  2V79 A;  2H1L A;  1G4D A;  3IWF A;  1TT5 B;  1RNL A;  5C44 J;  2L7K A;  3CF2 A;  3CMY A;  2VOO A;  3R60 A;  2PFV A;  2ZKZ A;  5FRO A;  3KP3 A;  1RKT A;  3M8F A;  1YJW I;  2F4I A;  2WAQ A;  2BZT A;  4KIB A;  4AYB A;  1HLV A;  3ANG A;  4M3G A;  3CO7 C;  3LSP A;  2JSP A;  4F3Q A;  2ICW G;  2LRD A;  2BOL A;  3IHU A;  2YUS A;  2BW3 B;  1DUX C;  2EIJ H;  3MN2 A;  2EZL A;  3PIP F;  4KDP A;  4I0B A;  5KAI C;  3UR3 C;  3TDZ C;  3LA7 A;  3SEQ A;  2X6X A;  4NEL A;  2ID6 A;  4YG2 F;  4HLX A;  4YRV A;  4L9V A;  3EYY A;  2B3W A;  2M2E A;  2YPR A;  2NAZ A;  5HDG A;  3HBL A;  3W2V A;  3U2R A;  1MBE A;  4A0X A;  1UB9 A;  2Y0M A;  1QNT A;  4RS8 A;  1F43 A;  2XAG A;  2KZG A;  1S29 A;  1APL C;  1W5S A;  4EGZ A;  4PJM A;  5DAJ A;  4HPQ A;  3T8T A;  2YU3 A;  3H36 A;  4BY1 J;  5EZH A;  3MKL A;  2CV1 A;  4CCK A;  3O8G A;  2JTV A;  2JWT A;  3IUO A;  1AOY A;  3CLQ A;  2JJ7 A;  4HOB A;  1TC3 C;  3GFJ A;  4M6V A;  3Q5F A;  1P4A A;  4AID A;  3JSP A;  3S1M J;  5F0F A;  2NS0 A;  3I58 A;  2PJR B;  2JA6 J;  3IRR A;  2Y9Z A;  2DW4 A;  4XM3 A;  3J7Z I;  4P96 A;  3ULQ B;  3DQV C;  3BR2 A;  2LR8 A;  4A3K J;  1TZL A;  1SC7 A;  2IP2 A;  2Q2E A;  1Z21 A;  1KON A;  3NWT A;  3VVZ A;  2ZXW H;  2P81 A;  3EUK L;  2KL4 A;  1LUJ B;  2GQQ A;  1BOA A;  2ZME C;  2VJ5 A;  2FBH A;  5LGN A;  4BE1 A;  2RV8 A;  4M71 A;  2R7D A;  2FU4 A;  2BHY A;  5E1X A;  2EK5 A;  5E17 F;  4WIB A;  3MMY B;  4Q4Z F;  2IEK A;  3WTU C;  1SAU A;  3BTC A;  2MLG A;  2J5O A;  1SD7 A;  1Y0N A;  4N9H A;  1T0F C;  2QVO A;  2ZSH B;  2GIZ A;  3GUD A;  3LFK A;  5EG0 A;  1KA8 A;  3ABU A;  5D8L B;  2AXL A;  2DMT A;  3K2Z A;  1GV5 A;  2X1C A;  1IN7 A;  2FJ1 A;  3QOE A;  2LBF B;  3DPJ A;  4BQO A;  1EH6 A;  1DP3 A;  2FOK A;  1JT0 A;  1GT0 C;  3MZH A;  2M4G A;  3E5X A;  2VQG A;  2K9S A;  3S16 J;  4IRH A;  4HF1 A;  4QIW N;  2MG4 A;  4GO1 A;  1UFM A;  4RGR A;  4RGS A;  3GCM A;  5LEJ A;  4Q5S F;  1FLI A;  3CUQ A;  1WHU A;  5BQT A;  4IHY A;  1D5Y A;  4I0A A;  4XKC A;  3MWM A;  3NS4 A;  1WJC A;  3S2D J;  4G7O F;  4XRS A;  1R71 A;  1BW6 A;  3TKY A;  2MLK A;  3I55 I;  3JRC A;  3HKZ N;  1BM9 A;  2VE9 A;  2XGE A;  3LSJ A;  1IJW C;  2E1M B;  5F1R A;  4D9J A;  4RBO A;  4IHS A;  2Z9O A;  2ZCN A;  5CQE A;  1PUF B;  3SZG A;  5ICG A;  1U6G A;  1WQ2 A;  3K1N A;  1VQ6 I;  4GCK A;  1SAX A;  5HNH A;  1KYW A;  2ZCW A;  2UWM A;  3K4K A;  2K86 A;  3V8J A;  3OY9 A;  1FT9 A;  1MSF C;  2RNG A;  2R7Q A;  4D1Q A;  3SFZ A;  1WCM J;  1I6X A;  3F8C A;  3K4M A;  1W0T A;  1X2M A;  4JK1 X;  1SD6 A;  3PNV A;  3K10 A;  1F36 A;  1X1P A;  1CF7 A;  3I53 A;  2XRL A;  5TGT A;  3ABT A;  2IS6 A;  3C07 A;  3QAH A;  4XLC A;  4Y33 A;  3CMA I;  5M3M J;  1IXC A;  2X6O A;  1LB2 A;  2EZI A;  2KIM A;  1XMA A;  5IY5 H;  2PLY A;  4RAZ A;  3BLY A;  1ZRE A;  2IVM A;  4ABZ A;  4BGD A;  2IS2 A;  4XKW A;  4WK8 F;  3I4M J;  2XSD C;  2D1H A;  4L0Y B;  2Z3Y A;  4Y3O A;  3CJN A;  4XLF A;  3O8H A;  1YLF A;  2I5U A;  2OQR A;  1QBJ A;  5IP9 J;  5EYR A;  1ZAR A;  4XNF A;  3BHQ A;  4U9N A;  3OS2 A;  4NQW B;  2NVU B;  4CYC A;  1HW5 A;  4JX4 A;  5E8I A;  1R4N B;  2BY1 A;  3CDL A;  5DCM A;  4D5F A;  3KZI C;  5L3G A;  2H6B A;  4HX8 A;  4PXI A;  3KEQ A;  1ZGJ A;  3BQY A;  3P9T A;  3W6V A;  3E7L A;  3VB2 A;  4P5O A;  4QLC U;  1B1B A;  3GF2 A;  2GOM A;  1IRF A;  1ACI A;  2QYO A;  2DA3 A;  2D45 A;  4LG3 A;  3A02 A;  1R1U A;  1W36 C;  5C4X J;  4Q48 A;  4IKF A;  1D8J A;  1E3P A;  4G6T B;  3ZQI A;  2HOA A;  2L54 A;  1T2K A;  1JGS A;  2XSJ C;  3H0D A;  1BBY A;  3BR3 A;  1QRY A;  3I5U A;  4RA2 A;  4B4C A;  2JZY A;  2ZBK A;  1WJ5 A;  3BTL A;  3PIO F;  3EGQ A;  1P92 A;  2HWV A;  4CXF A;  3G7R A;  1PYV A;  5B66 C;  1GHC A;  4DBR A;  1ZN2 A;  1HKQ A;  3I64 A;  3HTS B;  3WG7 H;  2VT2 A;  2NS8 A;  2IU5 A;  1K78 A;  2VIX A;  4BH9 A;  1U5T B;  5EFY A;  3NAU A;  1UCR A;  3OIO A;  3K4C A;  4AC6 A;  3OYC A;  1X2N A;  2XAU A;  4E7I A;  1X1C A;  1PP7 U;  3K6G A;  4UUT A;  3JR9 A;  2V1D A;  5D5X B;  3RSN A;  1P9Q C;  1JJ6 C;  1JTY A;  1A6I A;  5F6F A;  1E3O C;  2IGN A;  2OC6 A;  2W7N A;  1BI0 A;  1MZB A;  1K6Y A;  4C9Y A;  2ESH A;  3CCL I;  5IT9 K;  3NEU A;  3JAM Z;  2X1D A;  2O3F A;  3BPX A;  4XL9 A;  4BUP A;  2WA0 A;  3TMO A;  3J81 Z;  4II2 A;  2G7H A;  2XRN A;  4U0V A;  3OR2 C;  2OER A;  4I98 B;  3LAJ A;  4O5V A;  3B02 A;  4FX0 A;  1V5F A;  5HAW A;  4OU0 A;  2J5P A;  1LJ9 A;  4U9L A;  2VE8 A;  2K85 A;  2X9D A;  3TP3 A;  2CV2 A;  4C2M A;  1XTA A;  1USS A;  2G0E A;  2Y30 A;  1W4M A;  1ZLK A;  1TWF J;  3K69 A;  3CCJ I;  1XG1 A;  3TW6 A;  1WPK A;  3D5S C;  5HSZ A;  2GOX B;  1TNT A;  4G6Q A;  2WY8 Q;  1FSE A;  1NHA A;  3GYH X;  1XDU A;  2A5W A;  5BOX A;  3VVX A;  2IPQ X;  1J2X A;  3ZMZ A;  2KZV A;  5ICE A;  1VQ4 I;  3OYJ A;  1X19 A;  3HZJ A;  3MQ0 A;  4LLG F;  2LKS A;  1B8I B;  3VP5 A;  4CGR A;  3L09 A;  1MH3 A;  2Y0S A;  3DPT A;  4Z6Y A;  4JNN A;  4M9Z A;  1VTN C;  2HR3 A;  1VF9 A;  3LA2 A;  2DCE A;  2KJB A;  3X2Q H;  3KZY A;  2PMZ N;  3I59 A;  1P7J A;  2A3S A;  2HTJ A;  4F7Z A;  3G71 I;  2ZXH A;  3OYN A;  3FKI J;  3LSG A;  2EV0 A;  4ZTF A;  4XSX F;  1MBG A;  2K40 A;  1S3J A;  3DU6 A;  2LKP A;  2K9M A;  5HS8 A;  2VT3 A;  2HOE A;  3RTR A;  3NWS A;  2XAQ A;  4P1W A;  1FYL A;  1FP2 A;  3BDD A;  3U21 A;  3MKW B;  3GW2 A;  2XAH A;  3W2W A;  2LMD A;  3IAM 2;  2DPD A;  2XIG A;  1YE9 A;  4EJU A;  1JKO C;  1OCC H;  3CUQ C;  3K70 C;  4OIN F;  4CGZ A;  4RAF A;  4HX7 A;  4XLP F;  1OJL A;  4JOM A;  1FP1 D;  2CS3 A;  2PJP A;  4ZYA A;  1G8X A;  3H5N A;  2XGC A;  1FIA A;  4PGG A;  2DI3 A;  2W85 A;  1J9I A;  5D19 A;  3JTG A;  1ETY A;  3RQ4 A;  2X51 A;  3WGI A;  4IHW A;  5KVR A;  3CJD A;  3ZMD A;  4PGH A;  2BXY A;  1LKX A;  1I1S A;  3RKY A;  4DZP A;  2Z1D A;  2R92 J;  1WWX A;  2OI8 A;  3AQS A;  4ETS A;  3ZQC A;  3QPL A;  3F9K A;  3KEO A;  3VTI A;  1Y56 A;  3IV5 A;  1QVT A;  2ZJP F;  2EFW A;  3FXL A;  4QTR A;  3CZ6 A;  1LVA A;  1YG2 A;  2KRH A;  5CLS A;  5FHP A;  2R7S A;  5E3O A;  5BPD A;  1V4R A;  1JHH A;  2LG4 A;  2BBY A;  1K61 A;  3KIO A;  2HI3 A;  3TW7 A;  2AHQ A;  2R5Z B;  1SFU A;  4CDG A;  3ELK A;  3QU6 A;  2L4M A;  1YHQ I;  1X1A A;  2DLL A;  2HYJ A;  3CF5 F;  1MBK A;  2VB6 A;  4O6J A;  1VQ7 I;  2F5D A;  3A01 A;  2M3A A;  1ZK8 A;  3SDG A;  1N25 A;  5FGL A;  4UUS B;  5FMP A;  4UUV A;  1E3H A;  1IAW A;  1BIA A;  1TQM A;  4XLE A;  1J5Y A;  1R36 A;  4DGW B;  4D7M A;  1FJL A;  3E1S A;  3KZZ A;  2IGK A;  4ESF A;  2H27 A;  1OCR H;  1CQT A;  1KYZ A;  3H9J A;  4E7Z A;  1QQI A;  4PFP A;  3BP8 A;  4MQV A;  2F4O B;  4UB6 C;  3DEE A;  1SVL A;  1PP8 F;  3LWJ A;  2E19 A;  4A2U A;  1BA5 A;  2ZME B;  3HYI A;  3F8B A;  3DLA A;  4MO7 A;  2HXI A;  2V1X A;  3U9G A;  3HGG A;  2OPT A;  2UV1 A;  3S3O A;  1HOM A;  2QGU A;  5CXG A;  3C2B A;  1TWC J;  4Y7N J;  2HZT A;  4RB2 C;  1YRN A;  5IPA A;  2G3B A;  4GGG A;  1F1Z A;  1Y1V J;  3E5U A;  4GFL A;  3WTT C;  1MGT A;  2QKO A;  4KWA A;  1B59 A;  3RKW A;  3VVY A;  3TED A;  3D5L A;  5TRD A;  3V6G A;  2Y9Y A;  1MNE A;  3FK6 A;  5EF6 A;  2L7M P;  1SFK A;  2CUJ A;  3VYR B;  4AVP A;  5D5V B;  3LJL A;  3IRQ A;  2O7O A;  3QOP A;  1ODD A;  2M34 A;  3CQZ J;  2CW8 A;  5HLI A;  4PSX A;  3NNR A;  5JLW A;  5L3B A;  4ZDO A;  2DQR A;  4IXA A;  4U0W A;  4B43 A;  1ONV A;  3IH4 A;  2R7O A;  2L02 A;  3J81 K;  3V4G A;  4G7Z F;  1FWZ A;  2BE5 F;  3S15 J;  3ON2 A;  2Z2S B;  3NPI A;  4LK1 F;  5LFA A;  3TBI A;  4ESB A;  1BI2 A;  2OTJ I;  1JKP C;  4U7D A;  2HDC A;  4ACI A;  2LRE A;  3UNG C;  5GAE J;  5A2Q Z;  3HRS A;  2A61 A;  3TOB A;  3F1B A;  1T6S A;  2CWE A;  5FD5 A;  3KET A;  2DQL A;  3JRG A;  1XGS A;  1X3Z B;  1ON1 A;  2RNJ A;  1DGW Y;  2QEN A;  5FKK A;  4O3M A;  2K9Q A;  2BV6 A;  3BJ6 A;  1IGN A;  1HA8 A;  4CHU A;  3P9K A;  3GXO A;  3LMM A;  4MIM A;  4HRI A;  3ROU A;  4BKX A;  2L01 A;  1VQM I;  1IDZ A;  4FE4 A;  3GZ5 A;  1ZG1 A;  3CCU I;  1XPX A;  5JHF A;  5CPR B;  4I99 C;  4HEA 2;  5M5X J;  4EV0 A;  4KFC A;  4MTD A;  2LNB A;  1D1B A;  2COM A;  2PQ8 A;  1B4A A;  2E5Z A;  4A3G J;  1TWA J;  3KCC A;  2QTQ A;  1FOK A;  3O2P E;  2XPV A;  1STZ A;  1W7P D;  1LPQ A;  1YOV B;  2VKH A;  3P7N A;  3JSJ A;  1R22 A;  2CQN A;  3GLL A;  2DFI A;  5J4Y A;  4LB5 A;  5J40 A;  2JRM A;  3SZT A;  3GEZ A;  1TL8 A;  2XRO A;  3BZC A;  1FBQ A;  5D4S A;  3D5R C;  4KIT B;  3G2B A;  4S0H B;  5C3E J;  4XBF A;  2H6C A;  2ECB A;  2HVQ A;  4HA8 A;  1LFB A;  2DFE A;  2DDA A;  3RI4 A;  3DTK A;  2VC1 A;  4C3H J;  1IG7 A;  3CTA A;  3OYD A;  2X48 A;  4I02 A;  2Y48 A;  1OLT A;  2DPU A;  2EIK H;  1HKS A;  2DMU A;  4G12 A;  3M8J A;  1IZ1 A;  2F07 A;  4XSZ F;  3K0L A;  3C18 A;  5ILV A;  3RPU A;  4RM2 A;  4QSH A;  1OCZ H;  1FYK A;  2Y69 H;  4CCN A;  3CJT B;  3OSG A;  3H9G A;  1R5H A;  4ZYE A;  3L2C A;  3A0H C;  3D0S A;  2LDU A;  2JN6 A;  2M45 A;  2QLZ A;  1FYM A;  1CGP A;  4LIV A;  5HBU A;  2D6Y A;  4XRM A;  4HF0 A;  1Y1W J;  3PM1 A;  1UAA A;  1FTT A;  3OYB A;  3HIM A;  2XAS A;  3LSK A;  2QM3 A;  1FMV A;  2I10 A;  5JLX A;  3KP6 A;  3M07 A;  3WTV C;  4NHJ A;  1KQ0 A;  5EEA A;  2KIF A;  5FLX K;  3FBI B;  3HB9 A;  3BPV A;  1J09 A;  1RPW A;  2V9V A;  4NUB A;  3HSF A;  1JXS A;  4ME9 A;  2KIU A;  2YR2 A;  3HJE A;  4A3M J;  5GPC A;  4KA4 A;  3MZY A;  4OOI A;  3HHG A;  5J8C A;  2K4B A;  4BY7 J;  3E6C C;  2EJR A;  1RR8 C;  3J7Y J;  2A07 F;  2GBY A;  2HYT A;  1MNM C;  4BXF A;  3F3X A;  4L9T A;  3K7A J;  2QBY A;  2QWT A;  1WI3 A;  5E3L A;  2MH2 A;  1FIP A;  2B63 J;  4BS9 A;  1ZGW A;  1SMY F;  2DFF A;  3LSH A;  3H5R A;  5GAG J;  3H3Z A;  4NNJ A;  1BIB A;  2VLA A;  1XMX A;  2W84 A;  1HBX G;  2JA8 J;  3ERE D;  1R1V A;  2DU9 A;  4DIQ A;  4HX4 A;  4B44 A;  2CYY A;  1JI8 A;  4I6Z A;  1TTY A;  1ZR4 A;  1V3F A;  4HDV A;  1ETQ A;  1WZ2 A;  4EGY A;  4AC0 A;  4MFD A;  3RKQ A;  1NK3 P;  4A3E J;  1ETW A;  1D8K A;  2DK5 A;  2W00 A;  5CVR A;  4D0P A;  4AF5 A;  3CME I;  4RGU A;  4B8X A;  5EEG A;  2E1O A;  3RQI A;  4BEH A;  2P6T A;  4NN1 A;  2UXO A;  2BVM A;  2VN2 A;  5D6F A;  5KHD A;  1EKE A;  4EJO A;  1QGP A;  2PI0 A;  3S32 A;  5FO5 A;  1G3T A;  4Q47 A;  5F04 A;  1OIS A;  4KMF A;  2OUM A;  2ZNZ A;  3NQO A;  1IRZ A;  2K3F A;  3LOC A;  5LBQ A;  5J3L A;  2Q2E B;  1W5T A;  1TW3 A;  4CZZ A;  3ZMV A;  2ZFW A;  3M3Y J;  2TRT A;  4JX6 A;  3L2W A;  1N78 A;  5LEK A;  1V5E A;  2R0Q C;  2CV0 A;  3O60 A;  3HUG B;  4HNT A;  4H4K C;  1YX5 A;  4BYY A;  4ZJZ A;  2ZOY A;  1OPC A;  4LOC A;  4CZC A;  1AU7 A;  2KRF A;  2L9V A;  3ZQF A;  4L9N A;  2OAZ A;  4IRG A;  5DUK A;  1NK2 P;  4PJJ A;  2EIL H;  1HXD A;  1ETK A;  2NNY A;  5K58 A;  4DOZ A;  4AIJ A;  4UNO A;  1WGX A;  2CG4 A;  3OYA A;  2YVH A;  2M30 A;  4M74 A;  4IO9 F;  3H3U A;  4F55 A;  3CES A;  3O3K A;  4KT6 A;  2A2F X;  3N97 A;  1WI9 A;  4YII A;  1J75 A;  1NTC A;  1D3Y A;  1X58 A;  4JKZ A;  1VQP I;  3FXU A;  4L0Z B;  2XDN A;  3TOA A;  2E35 A;  2M8E A;  4MEX F;  2CUF A;  2NVX J;  1LQ1 A;  3CUQ B;  3BCA A;  4QPQ A;  5M5Y J;  1GLN A;  1VND A;  1D1A A;  1HF0 A;  2HQA A;  5DTD A;  2CSO A;  4YIF A;  3PUB A;  1LDK B;  3E7Q A;  2R3S A;  1GDT A;  2Q8K A;  2RAS A;  3PJR A;  2M5W A;  4Z2Y A;  3PAS A;  3LWF A;  2B0L A;  3ZMU A;  3MNL A;  2FNP A;  5FRN A;  3HSE A;  2JRT A;  3PFI A;  3NRV A;  2R7U A;  2KMU A;  2O8X A;  4B09 A;  5CVU A;  3KNW A;  2QKM B;  3MKZ A;  3OYH A;  2V9P A;  1EA3 A;  2BGC A;  4MK6 A;  1MSE C;  2R7T A;  2BVL A;  2DMQ A;  4AM3 A;  4QPO A;  2FML A;  3G73 A;  1OYY A;  1YYV A;  2DOA A;  4NC7 A;  1MDM A;  4C3J J;  5LHI A;  2EFP A;  2B9S A;  3Q3S A;  4M6Y A;  3RYP A;  1RIO H;  1E2X A;  2VAS A;  2MD0 A;  1MW7 A;  1WKM A;  3HKZ A;  3I3L A;  2OJE D;  3R0A A;  3OYL A;  1BJA A;  5CVI A;  5L3E A;  3OYK A;  4IX7 A;  5FD6 A;  3PNY A;  3KP4 A;  4U0Y A;  3VUQ A;  1GXP A;  4RAY A;  3GZ6 A;  1W7P A;  1IV6 A;  5AQC A;  2FQ4 A;  2RAE A;  4KIF A;  2DMN A;  3G1L A;  4L9J A;  3J7A O;  2F4M B;  3EPZ A;  1QPM A;  1XSV A;  3JRH A;  4HQE A;  2QCO A;  2VC0 A;  3P5J A;  1L0O C;  1RUN A;  4UB8 C;  3TO9 A;  2R7Z J;  2OF7 A;  4LIU A;  3OS1 A;  4C2U A;  1ERD A;  1H9G A;  2HS5 A;  1IV8 A;  3DWL E;  3S93 A;  2YU9 J;  1ZQ3 P;  1R49 A;  2W82 A;  3FMQ A;  4A93 J;  2HZD A;  2RQQ A;  2M0M A;  1NH3 A;  2L0K A;  4N0B A;  4N4N B;  2ZJR F;  1WH5 A;  5K5Q A;  2HXO A;  4MHG A;  2BW3 A;  1ORK A;  3CCR I;  3FKJ A;  3CMM A;  2ZJQ F;  3FRQ A;  3VOD A;  2ECC A;  4HZF A;  5DCM B;  2M1B A;  2MYS A;  2EWN A;  3OL3 A;  4LG0 B;  3QP6 A;  4YIR X;  3L00 A;  4YEL A;  4OMY A;  1U78 A;  4HG2 A;  4Y17 A;  3GX4 X;  4ITV A;  1O7L A;  3GTK J;  3GTQ J;  4KIC A;  3DTE A;  2D1V A;  1TW2 A;  5LHH A;  2ACJ A;  1B72 A;  5J1Y A;  1K83 J;  1VFC A;  2KIS A;  1KQ8 A;  2ZNY A;  3ZOB A;  3D1N I;  4Y52 J;  4BJT A;  1TWG J;  3IKT A;  2LH9 A;  5AON A;  2QEX I;  3S2W A;  2BY0 A;  3TDU C;  3ZGK A;  3R4K A;  3FM5 A;  1TP4 A;  2EFN A;  3QPS A;  4OAY A;  4C2M J;  1X3W B;  2YX7 A;  3O6B B;  1VZ0 A;  3CCE I;  1JT6 A;  2K5C A;  1S8N A;  4IQJ A;  4NDL A;  2MC3 A;  1BOB A;  4S04 A;  5D8K B;  1U0J A;  1KGS A;  2D5V A;  3GWZ A;  4A3C J;  5JVG F;  1T8I A;  3JRI A;  1BI1 A;  2PJR A;  3HTH A;  4RDU A;  4AWX B;  1FOY A;  2M4K A;  1FOW A;  4BXX J;  1JKQ C;  2CFX A;  4C30 A;  1B9M A;  1BJZ A;  1Z1D A;  1PDN C;  1K78 B;  1UST A;  1RKW A;  1YIO A;  2IT0 A;  3KPH A;  2RQP A;  4FX4 A;  4MTE A;  4ASN A;  4A6E A;  4BNC A;  2VQL A;  2RHA A;  1WJF A;  2VOD A;  3G1M A;  2ZC2 A;  3T0Y A;  4V19 K;  2PZ9 A;  3RIR A;  4HF2 A;  4CO8 A;  3QU3 A;  3DCF A;  1MJB A;  1RES A;  4GYG A;  3HOZ J;  3PSI A;  2JVG A;  2Y2Z A;  4P9F A;  5FKN A;  3IH2 A;  2CQ7 A;  3HEF A;  3NXC A;  5CW8 A;  2HYF A;  2E34 A;  2OZ6 A;  3C2H A;  2CQX A;  3WTX C;  1B6A A;  2G9W A;  3F8N A;  3DKY A;  4DNC A;  1UZC A;  2DA1 A;  1P6R A;  1BW5 A;  2FMY A;  2JK3 A;  2LBF A;  3V8L A;  2HOT A;  3JW4 A;  2R5Y B;  1J59 A;  3J80 Z;  3ASN H;  3OV8 A;  3GTO J;  2ZOZ A;  4LK0 F;  4OIQ F;  1LEA A;  2QQ9 A;  3IP4 B;  1OQY A;  3OWT A;  1Z6T A;  2DBB A;  3S3N A;  5K7F A;  1ZH5 A;  1S7E A;  4U7B A;  9ANT A;  3T8R A;  1ZKG A;  2FD5 A;  3LSM A;  3VOX A;  2FRH A;  3K4N A;  3VSL A;  2V1U A;  1I50 J;  3G3Z A;  2E60 A;  1KZH A;  2KJC A;  4XR6 A;  3ZMS A;  4AU7 A;  2VKE A;  3H92 A;  3L2V A;  4ON0 A;  4FCY A;  1T08 B;  5ICC A;  1PUF A;  1BR2 A;  3TP0 A;  4A6D A;  5E1W A;  2LFB A;  2XHK A;  2O5R A;  3V7S A;  2ZFU A;  2GXG A;  4UVA A;  5E79 C;  3VEP A;  1LDD A;  3OSF A;  2E1N A;  2OCC H;  1Z6R A;  1JKR C;  2I8D A;  2EQR A;  4JYK A;  3FXK A;  4UV9 A;  1XGN A;  3QYB A;  1BC8 C;  3Q9S A;  2F5V A;  3W6J B;  1YJN I;  2EFO A;  2M7B A;  5K5R A;  3LQQ A;  3JRF A;  1XSD A;  1T38 A;  2PMZ A;  4R79 A;  1K7A A;  3LAP A;  2OZU A;  5BNG A;  2RRE A;  3KP5 A;  3S14 J;  1ETO A;  2AQF A;  2GA2 A;  1FOX A;  1Z7L A;  2XPW A;  1KU7 A;  4ZC3 A;  4P55 A;  5KAF C;  4A0Y A;  2E2J J;  2MAB A;  3PO2 J;  2IS1 A;  4DVY P;  2IJL A;  2ZXI A;  5F0H A;  1R23 A;  3FHZ A;  2MBF A;  4XKB A;  1MJA A;  2Y31 A;  1WSU A;  1DPU A;  3KKD A;  3FMR A;  5DCF A;  2EV6 A;  4W97 A;  5B1B H;  4GRI A;  1MMN A;  2DJN A;  5D4R A;  4XN0 A;  1R1T A;  4HBL A;  2VXD A;  3H1C A;  4NQW A;  3VYS B;  4MFE A;  4N4O B;  4BJ5 C;  2HKU A;  1I5Z A;  2E7X A;  2V26 A;  3QBM A;  1XS9 A;  2A68 F;  5H2F C;  1BN5 A;  3BC8 A;  3BZK A;  4IOC F;  2W4S A;  4HLY A;  4EMS A;  3OMY A;  3VYT B;  4F52 A;  2IA0 A;  4LB6 B;  2DA5 A;  1IW7 F;  3DEW A;  4HNU A;  3B6C A;  4XQF A;  1YIT I;  2O61 A;  1QU3 A;  3AQT A;  2VKD A;  3DKX A;  5CYV A;  2L5Q A;  2PN6 A;  3CP8 A;  2A5Y B;  1QZY A;  3GME A;  2NNN A;  1SVO A;  1NG7 A;  3EUH A;  3I0T A;  3HOW J;  4UVC A;  4KT5 C;  5D5W B;  5TIS C;  2LTP A;  2QSH X;  1IC8 A;  3A4C A;  3RKX A;  3V7C A;  3L1P A;  2WTE A;  2FBI A;  2WAF A;  2DTR A;  4A3I J;  3PPB A;  1G3Y A;  2STT A;  2CW7 A;  2E36 A;  4B1R A;  2NVT J;  3BG6 A;  2C6Y A;  1UHM A;  2IBD A;  4ZYH A;  2XVC A;  4IRI A;  4WXH A;  3KYC B;  4ZDL A;  3T5X A;  3VDX A;  3SJM A;  5F27 A;  3G1O A;  1U5T A;  4RAG A;  5IT3 A;  1MH4 A;  2QQA A;  3L2U A;  2X0L A;  5J6X A;  2IRF G;  1D5V A;  1RRJ A;  1MBH A;  4LMY A;  3DXJ F;  1A5J A;  2XV4 S;  1K4T A;  2XKO A;  1PVE A;  3S1N J;  2DG8 A;  3T6N A;  2QOP A;  4IPA A;  1A35 A;  5EGO A;  2R7V A;  1W1W E;  3HTU A;  4BHC A;  3NI7 A;  2EBI A;  2VJ4 A;  2UZK A;  2OA4 A;  2CMP A;  4L62 A;  5DV5 A;  1VQ8 I;  5CKT A;  3FWE A;  1G6N A;  1R9T J;  2UXP A;  1BR4 A;  4HV5 A;  1V54 H;  2NRA C;  3FF5 A;  1MIJ A;  3CO6 C;  1R5G A;  1X4O A;  5EZG A;  5K1Y A;  2LKX A;  4CIC A;  3HOS A;  4YEJ A;  1IN8 A;  3VYU B;  4KYW A;  3E5Q A;  3BT9 A;  1UI5 A;  4XRS G;  2G7S A;  5FKO A;  3FK7 A;  4KIG A;  3ECO A;  1ZAO A;  4JL3 A;  2LSO A;  4OD5 A;  1WVR A;  3HPG A;  3KP2 A;  2EIM H;  2ME0 A;  2EIN H;  3ZPL A;  1KU9 A;  2R93 J;  2EH3 A;  3WOD F;  3MAJ A;  1M1E B;  4PJN A;  5F0C A;  2QWW A;  3RZO J;  2TDX A;  4I2O A;  4LD5 A;  2ELH A;  3E6M A;  3R6S A;  4B48 A;  4CSW A;  3FX3 A;  4RM3 A;  3IL2 A;  1T98 A;  4CCJ A;  1H8A C;  4U88 A;  3ZN1 A;  3DBR B;  1RZ4 A;  4B3A A;  1FTZ A;  2DT7 B;  4CUG A;  2P4W A;  1AA7 A;  3K8P C;  1I39 A;  1XCB A;  5J1R A;  4WXD A;  3V7R A;  2CUZ A;  4C3I J;  3CWR A;  2X4H A;  4GFK A;  2HTS A;  5M3F J;  2E2H J;  1EV7 A;  3VOK A;  1V55 H;  3HOT A;  3ZQH A;  1IUY A;  5IOZ A;  2UXH A;  4BHP A;  1Q1V A;  3ZN0 A;  2AQE A;  2L9S A;  2QA4 I;  4NB5 A;  2YX4 A;  4UHT A;  3VW1 A;  4EJT A;  3A2K A;  3I4N J;  1S6L A;  4KNY A;  3VW0 A;  3OL4 A;  1UHS A;  4KMU X;  1O3S A;  2HYG D;  5LHG A;  2M0C A;  3L9F A;  4IF4 A;  3E97 A;  1HST A;  1SGM A;  4MNU A;  2DTZ A;  4LLL A;  4FIS A;  3F21 A;  2MH9 A;  3OOU A;  3DKW A;  3LNQ A;  2ELK A;  1IDY A;  2DO7 A;  3JAM K;  4IVN A;  3WE3 A;  1LFU P;  3T1B A;  1RC9 A;  3LFU A;  4JQF A;  5HDK A;  4IHT A;  3SEZ A;  4M9S A;  2ETH A;  1WJB A;  4DZJ A;  3SQN A;  4PSW A;  2HDW A;  2JPB A;  2WV0 A;  3QQA A;  5HDN A;  2FXA A;  4F92 B;  3GZN B;  4M3F A;  2F5E A;  3QRF F;  3K4L A;  4XLA A;  1WFX A;  4Y15 A;  3BJB A;  5E1Z B;  2QQ8 A;  1ITY A;  1HW2 A;  5D6E A;  4ESJ A;  4EM0 B;  4KN7 X;  5DDG A;  4BAY A;  1Z0X A;  2X85 A;  4ENM A;  2ZXJ A;  2H1K A;  3I4P A;  5B5E C;  1HSJ A;  3OR1 C;  1REP C;  1D1C A;  1XGO A;  1F5T A;  1KU3 A;  3MVP A;  4XIC A;  2P5L C;  1DP7 P;  2LY9 A;  3WHC A;  3KZ9 A;  3K2A A;  4BBR J;  3BCG A;  2DOE A;  2VQC A;  1J0R A;  2MFZ A;  4J01 A;  2DG7 A;  1LE8 B;  1EH7 A;  3ZQG A;  3GFI A;  5DYM A;  2JA7 J;  3P9C A;  4B47 A;  1JUS A;  1YJ9 I;  2PMH A;  1PJR A;  4L5E A;  1Z9C A;  1H9T A;  4I01 A;  3ANP A;  2WAE A;  2IA2 A;  1R4M B;  4ZH4 F;  5LGU A;  3FIW A;  3K1P A;  3I9V 2;  2DA7 A;  4XLH A;  1GUU A;  3ON4 A;  4ENK A;  2HEO A;  1EF4 A;  5J47 A;  4A5N A;  2FJI 1;  4A0Z A;  5H20 A;  1ZTR A;  4M9X A;  1AKH A;  1D0Z A;  2R7X A;  2NYX A;  2IAI A;  3EUH C;  2X1E A;  3IKV A;  1H88 C;  1UMQ A;  3CC2 I;  2LK2 A;  3AG1 H;  3FXM A;  4WCG A;  2VQH A;  1F9N A;  2NP5 A;  5HS9 A;  3VW2 A;  2E7W A;  1SD4 A;  1JHF A;  4FT8 A;  2NS7 A;  3ECH A;  1U3E M;  3HOY J;  1I6H J;  3ABM H;  3KKC A;  2KPM A;  4F93 B;  3WTY C;  1SAN A;  3AAF A;  3S2H J;  3OIQ A;  3RJP A;  2XUB A;  4WX9 A;  4AIK A;  4OIO F;  3IWZ A;  1JTX A;  5HNF A;  2RVC A;  4DW6 A;  3B81 A;  2HU9 A;  4L5I A;  5BMZ A;  2WGB A;  2AXT C;  1U5T C;  2Z5U A;  2WWY A;  2K27 A;  2WY7 Q;  2F5F A;  3GLX A;  1A31 A;  3IUV A;  1HCR A;  1F4K A;  2LYC A;  4ICH A;  2MC4 A;  3HL2 A;  4E6K G;  3LST A;  5D18 A;  4HNV A;  5CVJ A;  2HQ5 A;  3DLL F;  3GO5 A;  4KIS A;  4I7H A;  2ZCX A;  1YW8 A;  2RC4 A;  2UXU A;  1X3U A;  4H0E A;  3ONQ A;  3TO6 A;  1BI3 A;  2MSY A;  2DA6 A;  5FJ8 J;  1MJ9 A;  3CP2 A;  2IA1 A;  3SFI A;  1TWH J;  2V1N A;  3JCU C;  4FET A;  3HDD A;  5H9T A;  1T33 A;  1YFH A;  3QOD A;  2VI6 A;  1Z7U A;  2BY2 A;  4M3E A;  5GTH C;  1S7A A;  3U1K A;  4BQN A;  2BHZ A;  2EA4 A;  1LFP A;  3F22 A;  1O3R A;  1OFC X;  1ON2 A;  3VOE A;  1VI0 A;  3SZP A;  4CYD A;  1QPI A;  5KCM A;  1G59 A;  4OMZ A;  1RR7 A;  2X6W A;  3HG9 A;  1D0Y A;  2WC2 A;  5FKM A;  1MMD A;  2QSF X;  1P4W A;  4WXC A;  4II3 A;  1UI6 A;  1IRG A;  3M7G A;  3GTP J;  4I09 A;  3U1D A;  1ETX A;  3BG5 A;  4HST A;  2ZB9 A;  2VJJ A;  2JA5 J;  3E6B A;  1X1D A;  3ZRG A;  4X0G A;  3CCM I;  3BTJ A;  3CCY A;  3SYT A;  2VUM J;  1XD7 A;  1K6O A;  1MMA A;  2Q24 A;  3HTA A;  1ZRF A;  3M9A A;  5FB2 A;  3M1E A;  5IYB J;  3Q9V A;  3S17 J;  4AUX A;  4UV8 A;  1W5C C;  2MA3 A;  2M9H A;  2CQQ A;  2XF7 A;  2CRG A;  4BXU A;  4ENN A;  2GLO A;  3L7W A;  3ERM A;  1QHH D;  1Y39 A;  3JRD A;  2KT0 A;  2LLK A;  2CGP A;  1ZGA A;  2EPF A;  1ZEL A;  4LIT A;  2DFH A;  4XID A;  1WJE A;  5L3C A;  3FXO A;  5BPI A;  1J7K A;  2IGO A;  2N8G A;  2GWR A;  3JSO A;  2QF7 A;  1GVJ A;  1SMT A;  1OYW A;  2VL8 A;  3DV8 A;  2DA4 A;  2DOF A;  5EG0 B;  3F8M A;  4CCM A;  2L9R A;  3BJA A;  5A2Q K;  3QYE A;  2WB1 A;  2GXA A;  2RKH A;  1I3A A;  1YO5 C;  5IP6 A;  1YX3 A;  2HQR A;  2UXI A;  2FBK A;  1XB4 A;  1FZP B;  3N4M A;  3BNI A;  1ZLJ A;  1AWC A;  1MBF A;  3H3V K;  3C1D A;  5ICF A;  1QHG A;  2JUC A;  2NOG A;  4IOA F;  3H0G J;  4HYE A;  1DGR M;  1XX5 A;  3R61 A;  4BHB A;  2MD5 A;  3TQN A;  4JP0 A;  1KU2 A;  4NC6 A;  1B72 B;  2O03 A;  3P9I A;  5LLQ A;  2LP0 A;  1WJD A;  2CW0 F;  3KLN A;  4I76 A;  1Y6I A;  2NOJ B;  1W0U A;  3GEU A;  3FIS A;  2QZ8 A;  4GFB A;  1TBX A;  2L2O A;  1VQL I;  2P0W A;  4E7J A;  2BXZ A;  3EDP A;  2NVY J;  5B3S H;  5HLT A;  5F08 A;  2AO9 A;  3ISP A;  4G7H F;  1U9O A;  2CH0 A;  2DMP A;  5BS6 A;  2NVQ J;  2WB1 N;  3S5R A;  2GFN A;  4DBQ A;  4XON A;  5IOY A;  5IT9 Z;  1FSH A;  2FX0 A;  2WAQ N;  3HRU A;  2XF6 A;  4AYB N;  1TNS A;  3HTJ A;  3MEX A;  1QO0 D;  1CF7 B;  1ZHF A;  3A03 A;  4L18 B;  2XB5 A;  4IHX A;  5IP7 J;  2EZK A;  5HOO A;  2LF8 A;  2Q1Z B;  3REO A;  3KP7 A;  2IS4 A;  4RB3 C;  2ID3 A;  3DFG A;  4HKU A;  4WWC A;  3CCV I;  2CUE A;  1RI7 A;  1IF1 A;  5GP9 A;  2GAU A;  5GAH J;  2FF4 A;  5HOD A;  3HUG A;  5LRS A;  1R5I D;  2V9K A;  3CJQ B;  3F6O A;  2LY2 A;  4OAZ A;  2F5C A;  2HKX A; 
#chains in the Genus database with same CATH homology
 5BNG A;  3S14 J;  1LE8 A;  3LWJ A;  4CYC B;  3S1R J;  1ETO A;  2E19 A;  1BA5 A;  3BR6 A;  1JGG A;  3PO2 J;  2XPW A;  2G7G A;  2E2J J;  4MO7 A;  2HXI A;  3BTI A;  1WH7 A;  3HGG A;  5F0H A;  2OPT A;  4V2F A;  4A3J J;  2Y31 A;  1HOM A;  3KKD A;  5CXG A;  2ME6 A;  3JRB A;  3C2B A;  1TWC J;  4Y7N J;  1YRN A;  4W97 A;  5IPA A;  2G3B A;  2DJN A;  5FLM J;  3NAR A;  1Y1V J;  3QKX A;  4GFL A;  2QKO A;  4GCT A;  3Q0U A;  4KWA A;  2G7L A;  3HE0 A;  2XPU A;  4MFE A;  2HKU A;  3TED A;  3VVY A;  3QBM A;  3V6G A;  1XS9 A;  2Y9Y A;  3FK6 A;  5EF6 A;  2L7M P;  1HDP A;  5D1R A;  3LJL A;  4W1U A;  1SFO J;  2O7O A;  3RD3 A;  2M34 A;  3CQZ J;  1DU0 A;  2DA5 A;  3NNR A;  3DEW A;  5JLW A;  3B6C A;  5DS9 A;  3AQT A;  3IH4 A;  1MBJ A;  1GV2 A;  2LD5 A;  3S15 J;  3ON2 A;  3S1Q J;  1T56 A;  3NPI A;  1U9N A;  3HTI A;  2TCT A;  1JKP C;  4ACI A;  2CU7 A;  2DA2 A;  3HOW J;  3VIB A;  2LTP A;  3F1B A;  1IC8 A;  1G2H A;  3Q0V A;  3L1P A;  3JRG A;  3GTL J;  1JUP A;  1ENH A;  5FKK A;  2HDD A;  2L7F P;  4A3I J;  2K9Q A;  3UKG A;  3G56 A;  3PPB A;  5FKL A;  1IGN A;  4FE7 A;  2NVT J;  4B1R A;  4MIM A;  2PBX A;  2V57 A;  2EZH A;  2IBD A;  4BKX A;  5C44 J;  3CMY A;  1IDZ A;  4FE4 A;  1JJ8 C;  1RKT A;  3IH3 A;  5M5X J;  3SJM A;  5F27 A;  3G1O A;  1HLV A;  3ANG A;  4M3G A;  4A3G J;  3LSP A;  1MH4 A;  1TWA J;  2QTQ A;  1MBH A;  2YUS A;  1A5J A;  2XPV A;  2DG8 A;  3S1N J;  3MN2 A;  2EZL A;  3NRG A;  3T6N A;  2QOP A;  3JSJ A;  5EGO A;  4EEF G;  3NI7 A;  4NEL A;  2EBI A;  3V78 A;  2ID6 A;  4L62 A;  2M2E A;  1R9T J;  2UXP A;  3HBL A;  4S0H B;  5C3E J;  5EZG A;  3GTJ J;  1MBE A;  2LKX A;  2ECB A;  1F43 A;  1LFB A;  3WHB A;  4IHV A;  1APL C;  4C3H J;  1OCP A;  5DAJ A;  1IG7 A;  2X48 A;  3BT9 A;  1UI5 A;  4BY1 J;  5EZH A;  3MKL A;  4M3D A;  1BL0 A;  4XRS G;  3O8G A;  2G7S A;  2JWT A;  5FKO A;  2DMU A;  3FK7 A;  4G12 A;  2JJ7 A;  1TC3 C;  4JL3 A;  4M6V A;  2F07 A;  3S1M J;  2MGQ A;  5IYD J;  3LSR A;  5F0F A;  2JA6 J;  2ME0 A;  4QSH A;  2R93 J;  3OSG A;  4MLO A;  2Y9Z A;  2EH3 A;  2XGD A;  5F0C A;  3BR5 A;  3RZO J;  2JN6 A;  3B6A A;  3BR2 A;  5HBU A;  2LR8 A;  4A3K J;  2D6Y A;  4XRM A;  2E2I J;  1Y1W J;  3PM1 A;  1FTT A;  3VVZ A;  3HIM A;  2P81 A;  1H8A C;  2I10 A;  5JLX A;  4B3A A;  1FTZ A;  1GVD A;  5EEA A;  3HB9 A;  5J1R A;  4X6A J;  4ME9 A;  1RPW A;  4C3I J;  3CWR A;  4GFK A;  5M3F J;  2E2H J;  2IEK A;  4A3M J;  3VOK A;  5GPC A;  3BTC A;  2ZCM A;  3ZQH A;  4BY7 J;  5IOZ A;  2UXH A;  1Q1V A;  5EG0 A;  2GBY A;  2HYT A;  1MNM C;  2QWT A;  2DMT A;  3K7A J;  1GV5 A;  5EGO B;  1WI3 A;  5E3L A;  2FJ1 A;  3VW1 A;  3DPJ A;  1FIP A;  2B63 J;  3I4N J;  1ZGW A;  3VW0 A;  1JT0 A;  1GT0 C;  1UHS A;  2K9S A;  5K7H A;  3S16 J;  2M0C A;  4QIW N;  2MG4 A;  2JA8 J;  1SGM A;  2DTZ A;  4FIS A;  4I6Z A;  1ZR2 A;  1DU6 A;  3EUP A;  3OOU A;  1ZR4 A;  3LNQ A;  1ETQ A;  2ELK A;  1IDY A;  4AC0 A;  4IHY A;  4MFD A;  1D5Y A;  2FBQ A;  3RKQ A;  3HOU J;  2O7T A;  4V2G A;  1LFU P;  1NK3 P;  3S2D J;  4A3E J;  1ETW A;  4XRS A;  4BBS J;  3CRJ A;  1BW6 A;  3JRC A;  4DZJ A;  4D5C A;  2R5Y A;  4AF5 A;  3HKZ N;  2M8G X;  3QQA A;  2E1O A;  2XGE A;  3BR0 A;  4M3F A;  3LSJ A;  3RQI A;  4NN1 A;  1IJW C;  2UXO A;  2GM4 A;  4RBO A;  2ZCN A;  1PUF B;  3A01 B;  3BJB A;  1ITY A;  4GCK A;  5F04 A;  2VKV A;  1IRZ A;  1POG A;  3LOC A;  5J3L A;  1MSF C;  1Z0X A;  1WCM J;  2H1K A;  3M3Y J;  2TRT A;  4JX6 A;  2MW8 A;  4GCL A;  5GPA A;  2R0Q C;  1W0T A;  1X2M A;  3BG3 A;  3MVP A;  4XIC A;  3O60 A;  2LY9 A;  3WHC A;  3RH2 A;  3KZ9 A;  1F36 A;  3K2A A;  2XRL A;  4BBR J;  3BCG A;  3C07 A;  2ZOY A;  4LOC A;  1Z77 A;  2DG7 A;  1LE8 B;  5M3M J;  5IYC J;  1AU7 A;  2X6O A;  2EZI A;  3ZQF A;  4XK4 A;  1NK2 P;  3ZQG A;  1ETK A;  2JA7 J;  5K58 A;  2WUI A;  3F0C A;  1WGX A;  1JUS A;  2YVH A;  4ABZ A;  2W48 A;  1AHD P;  4L5E A;  1JUM A;  3I4M J;  1U8B A;  1YRN B;  2XSD C;  2REK A;  3ANP A;  4MXM A;  2NX4 A;  3O8H A;  1ETV A;  1NTC A;  5EYR A;  5IP9 J;  3BHQ A;  3FIW A;  1O4X A;  1HDD C;  1X58 A;  4JKZ A;  4CYC A;  2DA7 A;  3ON4 A;  1GUU A;  4JX4 A;  2XDN A;  3CDL A;  1EF4 A;  4X1E A;  5EDN A;  2CUF A;  4D5F A;  2H8R A;  2NVX J;  2CJJ A;  2YVE A;  4A3D J;  5M5Y J;  4PXI A;  1AKH A;  1ZTR A;  1VND A;  1HF0 A;  2IAI A;  5DTD A;  2Y0S N;  1H88 C;  3BQY A;  1UMQ A;  3P9T A;  2LK2 A;  3E7L A;  3W6V A;  3E7Q A;  5E3M A;  1GDT A;  2NP5 A;  4FTH A;  2RAS A;  3PAS A;  2DA3 A;  3VW2 A;  4DYR A;  3A02 A;  3MNL A;  1P7I A;  3HOY J;  1I6H J;  2NS7 A;  5C4X J;  3KKC A;  3ZQI A;  1SAN A;  3KNW A;  3S2H J;  2HOA A;  1OCT C;  4MK6 A;  1JTX A;  1MSE C;  4DW6 A;  3B81 A;  3BR3 A;  1QRY A;  2DMQ A;  4B4C A;  1B8I A;  4UDS A;  2WGB A;  4D7N A;  5K7Z A;  3BTL A;  4C3J J;  3EGQ A;  3G7R A;  3Q3S A;  4A3L J;  3IUV A;  1HCR A;  3M4O J;  3HM5 A;  4ICH A;  2NS8 A;  4A3F J;  2IU5 A;  1FEX A;  4JX5 A;  3LHQ A;  5D18 A;  3VUQ A;  4HNV A;  5EFY A;  3NAU A;  2HQ5 A;  3OIO A;  4A69 C;  4AC6 A;  1IV6 A;  1X2N A;  2NP3 A;  2FQ4 A;  2RAE A;  5AQC A;  2LVS A;  2DMN A;  2WV1 A;  3G1L A;  4UUT A;  2ZCX A;  3JR9 A;  2UXU A;  3JRH A;  2QCO A;  1JJ6 C;  1JTY A;  1A6I A;  2MSY A;  1E3O C;  2DA6 A;  2VPR A;  5FJ8 J;  3SFI A;  1TWH J;  1RET A;  2OF7 A;  3HDD A;  2YS9 A;  2COB A;  2R7Z J;  1T33 A;  5H9T A;  5J1U A;  2VI6 A;  4M3E A;  2XB0 X;  1UG2 A;  2YU9 J;  1ZQ3 P;  4A93 J;  2OER A;  1I3Q J;  2L0K A;  5HAW A;  3HGY A;  1WH5 A;  2HXO A;  1OFC X;  1ORK A;  4YZE A;  3FRQ A;  1VI0 A;  2ECC A;  1QPI A;  2X9D A;  3TP3 A;  1AKH B;  2O8K A;  1RR7 A;  2G0E A;  2Y30 A;  3Q0W A;  1U78 A;  1IUF A;  5FKM A;  3BRU A;  4J19 A;  1XC5 A;  3GTQ J;  1TWF J;  3GTK J;  1XG1 A;  3TW6 A;  1UI6 A;  1WPK A;  5HSZ A;  3GTP J;  1B72 A;  5J1Y A;  1K83 J;  1ETX A;  3VPR A;  1VFC A;  3BG5 A;  3ZOB A;  3D1N I;  4Y52 J;  2ZB9 A;  1TWG J;  2JA5 J;  3VVX A;  4C2M J;  3QPS A;  3BTJ A;  1JT6 A;  3CCY A;  2VUM J;  2GEN A;  3VP5 A;  1B8I B;  2R5Z A;  4NDL A;  4CGR A;  1MH3 A;  2Q24 A;  3HTA A;  5C4Y A;  4JNN A;  3GTG J;  5IYB J;  3S17 J;  2D5V A;  4AUX A;  2W53 A;  4A3C J;  1VF9 A;  3JRE A;  2M9H A;  2CQQ A;  3JRI A;  2CRG A;  2PMZ N;  3HTH A;  4RDU A;  4IEJ A;  2GLO A;  1P7J A;  3JRA A;  4BXX J;  3JRD A;  1JKQ C;  2KT0 A;  2LLK A;  2O9L A;  3FKI J;  3LSG A;  1BJZ A;  4XID A;  4UUS A;  1MBG A;  3RZD J;  2K40 A;  1RKW A;  5C4J J;  3HOX J;  2N8G A;  3BR1 A;  2QF7 A;  2DA4 A;  5EG0 B;  2GUH A;  2RHA A;  2JMW A;  2L9R A;  1JKO C;  3G1M A;  2PZ9 A;  1QVU A;  3DCF A;  1OJL A;  5IP6 A;  1RES A;  3HOZ J;  3PO3 J;  2UXI A;  2Y2Z A;  5FKN A;  3IH2 A;  3HEF A;  2HOS A;  2XGC A;  1FIA A;  3NXC A;  5CW8 A;  5M5W J;  2QIB A;  3BNI A;  5D19 A;  2CQX A;  4DYQ A;  1ETY A;  4IHW A;  3CJD A;  1MBF A;  3H3V K;  3HOV J;  1BW5 A;  2DA1 A;  2NOG A;  3H0G J;  2JK3 A;  4DZP A;  2R92 J;  2OI8 A;  3AQS A;  2L7Z A;  2HOT A;  3ZQC A;  3QPL A;  5CXI A;  2R5Y B;  3IV5 A;  1QVT A;  4JP0 A;  4QTR A;  1B72 B;  3GTO J;  2ZOZ A;  2LP0 A;  4I76 A;  5FHP A;  3BQZ A;  1W0U A;  5K7F A;  5E3O A;  3GTM J;  3GEU A;  1S7E A;  3FIS A;  2DN0 A;  1K61 A;  2K9N A;  9ANT A;  3COL A;  4GFB A;  1ZKG A;  2FD5 A;  2HI3 A;  4A3B J;  3VOX A;  3TW7 A;  2AHQ A;  5E3N A;  2R5Z B;  2NVY J;  3GZI A;  1I50 J;  5F08 A;  2AO9 A;  3S5R A;  1U9O A;  2DMP A;  2NVQ J;  2WB1 N;  2VKE A;  2HYJ A;  3ZQL A;  2GFN A;  2KDZ A;  4FCY A;  5IOY A;  2FX0 A;  1MBK A;  2WAQ N;  1PUF A;  4AYB N;  3A01 A;  4DYC A;  3HTJ A;  3TP0 A;  1ZK8 A;  3SDG A;  5FGL A;  2LFB A;  4UUS B;  1H89 C;  5FMP A;  3A03 A;  5FLV A;  3OSF A;  2XB5 A;  4IHX A;  5IP7 J;  2EZK A;  1JKR C;  2EQR A;  4JYK A;  2ID3 A;  4HKU A;  4D7M A;  4M3B A;  1FJL A;  2CUE A;  1CQT A;  5GP9 A;  3JRF A;  3GBG A;  5HOD A;  5F1J A;  3BG9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...