3S5RA

Crystal structure of a putative transcriptional regulator of the tetr family (syn_02108) from syntrophus aciditrophicus at 2.60 a resolution
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
197
structure length
197
Chain Sequence
KNTRELLLDAATTLFAEQGIAATTMAEIAASVGVNPAMIHYYFKTRDSLLDTIIEERIGRIIDMIWEPVTGEEDDPLIMVRDLVNRIVNTCETMLWLPSLWIREIVNEGGALREKMLNNIPIDKMNKFSAKIAEGQKQGVINSGIDSRLLIGSIIGLTMLPLATAKLRDQIPTMKGLSSEDIVCHVTALLFTGLTNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator TetR family
publication title Crystal structure of a Putative transcriptional regulator of the TetR family (SYN_02108) from Syntrophus aciditrophicus SB at 2.60 A resolution
rcsb
source organism Syntrophus aciditrophicus
molecule tags Dna binding protein
total genus 57
structure length 197
sequence length 197
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3s5rA00
5D1RA 3LHQA 3ZQIA 4M3DA 5EYRA 2HXIA 5HBUA 3BR1A 2ID3A 3BCGA 3DCFA 5IP6A 4W1UA 1QVTA 3VVXA 3FK7A 1ORKA 5F27A 2GFNA 3BR2A 2I10A 2QCOA 3ANGA 3LSJA 2X9DA 4JYKA 3VIBA 3BHQA 3IUVA 2QKOA 4NN1A 5F1JA 3QPLA 3B81A 3BQYA 3F0CA 2GBYA 1SGMA 4DW6A 3E7QA 3IH3A 3LSRA 2TCTA 3ON2A 4ICHA 1Z0XA 2ID6A 2XB5A 2HKUA 5FKNA 2G7SA 4GFLA 5EZGA 3Q3SA 3Q0VA 1JT0A 4M3EA 4JNNA 3SFIA 3WHCA 2W53A 5F0HA 2UXHA 3JSJA 3BQZA 5FMPA 2FJ1A 4AF5A 2XDNA 1UI5A 3S5RA 5GP9A 2G7GA 3LOCA 5F04A 4D7MA 1T33A 4D7NA 3BR5A 3KZ9A 3KKDA 3EGQA 2IAIA 4CGRA 4I76A 2WV1A 3VOKA 4I6ZA 1JT6A 2ZOYA 2RASA 2JK3A 3HTJA 4M3FA 4V2FA 4ABZA 2XGDA 4JKZA 2VKEA 5EFYA 3VOXA 4GCLA 3IH2A 5AQCA 1RKWA 3QQAA 2FQ4A 2PBXA 1RPWA 3CRJA 3O60A 2HYJA 5DAJA 5FKKA 3KKCA 3NI7A 4AC6A 3SDGA 2ZB9A 3AQSA 4X1EA 5K7HA 2REKA 4M3GA 3B6CA 3BR0A 4D5CA 4B3AA 2FX0A 3CWRA 2TRTA 1QVUA 5K58A 5K7FA 3VPRA 2Y30A 5HSZA 2IU5A 4PXIA 3COLA 4AUXA 3HTAA 4ACIA 4GCTA 2ZOZA 1ZKGA 2XPVA 3HIMA 4UDSA 2VKVA 5CXIA 5FKMA 3FK6A 3AQTA 5J3LA 2QIBA 3G1LA 5GPCA 2OF7A 1JTYA 5FKLA 3BR3A 2NP3A 2UXOA 4HKUA 3LSPA 3Q0WA 5FKOA 3T6NA 3DEWA 4MXMA 1JUPA 3NPIA 3BTJA 3ZQHA 3RD3A 3VW0A 2PZ9A 4L62A 3NNRA 3BR6A 2NS7A 1U9NA 5K7ZA 1T56A 1A6IA 2RAEA 2HYTA 2DG7A 5H9TA 2ZCMA 3VVZA 3ON4A 3VW2A 5IPAA 2Q24A 5CXGA 2GENA 3BTCA 2G3BA 3PPBA 3B6AA 3CJDA 3LJLA 3F1BA 2Y2ZA 3MNLA 2IBDA 3GEUA 5J1YA 1JUSA 2EH3A 2WUIA 2XPWA 1RKTA 4XK4A 3RH2A 3P9TA 4NELA 1VI0A 4MO7A 2UXIA 3BTIA 2FBQA 5F0CA 2OI8A 4GCKA 1QPIA 3CCYA 2XGEA 2XPUA 3MVPA 1ZK8A 2HQ5A 2O7TA 5FGLA 3TP3A 2VPRA 3Q0UA 3G7RA 2WGBA 4JL3A 2F07A 3BJBA 2NP5A 1JTXA 2QOPA 3BRUA 3QPSA 3DPJA 5J1UA 3HTHA 4W97A 3G1OA 2NS8A 2RHAA 3QKXA 3V78A 3G56A 4GFKA 4ME9A 5GPAA 3C07A 3C2BA 3QBMA 2UXPA 3GZIA 3FRQA 3FIWA 1BJZA 2O7OA 5F08A 3NRGA 3PASA 2XRLA 4V2GA 3BNIA 2YVHA 3ANPA 3VVYA 2GUHA 3CDLA 2Y31A 2YVEA 2NX4A 5F0FA 2FD5A 3PM1A 1UI6A 3ZQLA 5CW8A 3VP5A 2IEKA 4D5FA 2G7LA 5D19A 5D18A 3IH4A 2UXUA 2HXOA 1U9OA 2XGCA 2ZCNA 3HE0A 4M3BA 4G12A 3ZQFA 4AC0A 4YZEA 4MK6A 2V57A 2DG8A 3HGYA 3ZQGA 2DTZA 3LWJA 2QWTA 5C4YA 5J1RA 5IOYA 3KNWA 3TP0A 3HGGA 3BT9A 5HAWA 2ZCXA 2OPTA 2G0EA 5FHPA 3O8GA 2X6OA 2D6YA 3V6GA 5IOZA 3WHBA 2OERA 3NXCA 3VUQA 3VW1A 1Z77A 4B1RA 2QTQA 1JUMA 3BTLA 5EZHA 3EUPA 3HTIA 2JJ7A 4KWAA 3O8HA 3G1MA
chains in the Genus database with same CATH superfamily
5D1RA 3LHQA 3ZQIA 4M3DA 5EYRA 2HXIA 5HBUA 3BR1A 2ID3A 3BCGA 3DCFA 5IP6A 4W1UA 1QVTA 3VVXA 3FK7A 1ORKA 5F27A 2GFNA 3DU6A 3BR2A 2I10A 2QCOA 3ANGA 4DVYP 3LSJA 4OD5A 2X9DA 4JYKA 3VIBA 3BHQA 3IUVA 2QKOA 4NN1A 5F1JA 2R7VA 3QPLA 3B81A 3BQYA 3F0CA 2GBYA 1SGMA 4DW6A 3E7QA 3IH3A 2FJI1 3LSRA 2TCTA 3ON2A 4ICHA 1Z0XA 2ID6A 2XB5A 2HKUA 5FKNA 2G7SA 4GFLA 5EZGA 3VTIA 3Q3SA 3Q0VA 1JT0A 4M3EA 4JNNA 3SFIA 3WHCA 2W53A 5F0HA 2UXHA 3JSJA 3BQZA 5FMPA 2FJ1A 4AF5A 2XDNA 1UI5A 3S5RA 2YVXA 5GP9A 2G7GA 3LOCA 5F04A 4D7MA 1T33A 4D7NA 2B3WA 3BR5A 3KZ9A 3KKDA 3EGQA 2IAIA 4CGRA 4I76A 2WV1A 3VOKA 4I6ZA 1JT6A 2ZOYA 2RASA 2JK3A 3HTJA 4M3FA 4V2FA 4ABZA 2XGDA 4JKZA 2VKEA 5EFYA 3VOXA 4GCLA 3IH2A 5AQCA 1RKWA 3QQAA 2FQ4A 2PBXA 1RPWA 3CRJA 3O60A 2HYJA 5DAJA 5FKKA 3KKCA 3NI7A 4AC6A 3SDGA 2ZB9A 3AQSA 4X1EA 5K7HA 2REKA 4M3GA 3B6CA 3BR0A 4D5CA 4B3AA 2FX0A 3CWRA 2TRTA 3KYLA 1QVUA 5K58A 5K7FA 3VPRA 2Y30A 5HSZA 2IU5A 4PXIA 3COLA 4AUXA 3HTAA 4ACIA 4GCTA 2ZOZA 1ZKGA 2XPVA 3HIMA 4UDSA 2VKVA 5CXIA 5FKMA 3FK6A 3AQTA 4C2MA 5J3LA 2QIBA 2ZY9A 3G1LA 5GPCA 2OF7A 1JTYA 5FKLA 3BR3A 2NP3A 2UXOA 5CQGA 4HKUA 4OD4A 3LSPA 3Q0WA 5FKOA 3T6NA 3DEWA 4MXMA 1JUPA 3NPIA 3BTJA 3ZQHA 3RD3A 3VW0A 3DU5A 2PZ9A 4L62A 3NNRA 3BR6A 2NS7A 1U9NA 2R7RA 2R7OA 5K7ZA 1T56A 1A6IA 2RAEA 2HYTA 2DG7A 5H9TA 2ZCMA 3VVZA 3ON4A 3VW2A 5IPAA 2Q24A 5CXGA 2GENA 3BTCA 2G3BA 3PPBA 3K8PC 3B6AA 2B1EA 3CJDA 3LJLA 3F1BA 2Y2ZA 3MNLA 2IBDA 3GEUA 5J1YA 1JUSA 2EH3A 2WUIA 2XPWA 1RKTA 4XK4A 3SWHA 3RH2A 3P9TA 4NELA 1VI0A 4MO7A 4WIBA 2UXIA 3BTIA 2FBQA 5F0CA 2OI8A 4GCKA 1QPIA 3CCYA 2XGEA 2XPUA 3MVPA 1ZK8A 2HQ5A 2O7TA 5FGLA 3TP3A 2VPRA 3Q0UA 3G7RA 2WGBA 4JL3A 2R7TA 2F07A 3BJBA 2NP5A 1JTXA 2QOPA 3BRUA 3QPSA 3DPJA 5J1UA 3HTHA 3NS4A 4W97A 3G1OA 2NS8A 2RHAA 3QKXA 3V78A 3G56A 4IRVA 4GFKA 4ME9A 5GPAA 3C07A 3C2BA 3QBMA 2UXPA 3GZIA 3FRQA 3FIWA 1BJZA 2O7OA 5F08A 3NRGA 3PASA 2XRLA 4V2GA 3BNIA 2YVHA 3ANPA 3VVYA 2GUHA 3CDLA 2R7UA 2Y31A 2YVEA 2NX4A 5F0FA 3FHNA 2FD5A 3PM1A 1UI6A 2R7SA 3ZQLA 5CW8A 3VP5A 2IEKA 4D5FA 2G7LA 5D19A 5D18A 2R7WA 3IH4A 2UXUA 2HXOA 1U9OA 2XGCA 2ZCNA 3HE0A 4M3BA 4G12A 3ZQFA 4AC0A 4YZEA 4MK6A 2V57A 2DG8A 4U9LA 3HGYA 3ZQGA 2DTZA 3LWJA 2QWTA 5C4YA 5J1RA 2R7QA 5IOYA 3KNWA 3TP0A 3HGGA 3BT9A 5HAWA 2ZCXA 2OPTA 2G0EA 5FHPA 3O8GA 2X6OA 2D6YA 3V6GA 5IOZA 2PFVA 3WHBA 2OERA 3NXCA 3VUQA 3VW1A 2A2FX 1Z77A 4U9NA 4B1RA 2QTQA 1JUMA 3BTLA 5EZHA 3EUPA 3HTIA 2JJ7A 2R7XA 4KWAA 3O8HA 3G1MA
chains in the Genus database with same CATH topology
5D1RA 3LHQA 3ZQIA 4M3DA 5EYRA 2HXIA 5HBUA 3BR1A 2ID3A 3BCGA 3DCFA 5IP6A 4W1UA 1QVTA 3VVXA 3FK7A 1ORKA 5F27A 2GFNA 3BR2A 2I10A 2QCOA 3ANGA 3LSJA 2X9DA 4JYKA 3VIBA 3BHQA 3IUVA 2QKOA 4NN1A 5F1JA 3QPLA 3B81A 3BQYA 3F0CA 2GBYA 1SGMA 4DW6A 3E7QA 3IH3A 3LSRA 2TCTA 3ON2A 4ICHA 1Z0XA 2ID6A 2XB5A 2HKUA 5FKNA 2G7SA 4GFLA 5EZGA 3Q3SA 3Q0VA 1JT0A 4M3EA 4JNNA 3SFIA 3WHCA 2W53A 5F0HA 2UXHA 3JSJA 3BQZA 5FMPA 2FJ1A 4AF5A 2XDNA 1UI5A 3S5RA 5GP9A 2G7GA 3LOCA 5F04A 4D7MA 1T33A 4D7NA 3BR5A 3KZ9A 3KKDA 3EGQA 2IAIA 4CGRA 4I76A 2WV1A 3VOKA 4I6ZA 1JT6A 2ZOYA 2RASA 2JK3A 3HTJA 4M3FA 4V2FA 4ABZA 2XGDA 4JKZA 2VKEA 5EFYA 3VOXA 4GCLA 3IH2A 5AQCA 1RKWA 3QQAA 2FQ4A 2PBXA 1RPWA 3CRJA 3O60A 2HYJA 5DAJA 5FKKA 3KKCA 3NI7A 4AC6A 3SDGA 2ZB9A 3AQSA 4X1EA 5K7HA 2REKA 4M3GA 3B6CA 3BR0A 4D5CA 4B3AA 2FX0A 3CWRA 2TRTA 1QVUA 5K58A 5K7FA 3VPRA 2Y30A 5HSZA 2IU5A 4PXIA 3COLA 4AUXA 3HTAA 4ACIA 4GCTA 2ZOZA 1ZKGA 2XPVA 3HIMA 4UDSA 2VKVA 5CXIA 5FKMA 3FK6A 3AQTA 5J3LA 2QIBA 3G1LA 5GPCA 2OF7A 1JTYA 5FKLA 3BR3A 2NP3A 2UXOA 4HKUA 3LSPA 3Q0WA 5FKOA 3T6NA 3DEWA 4MXMA 1JUPA 3NPIA 3BTJA 3ZQHA 3RD3A 3VW0A 2PZ9A 4L62A 3NNRA 3BR6A 2NS7A 1U9NA 5K7ZA 1T56A 1A6IA 2RAEA 2HYTA 2DG7A 5H9TA 2ZCMA 3VVZA 3ON4A 3VW2A 5IPAA 2Q24A 5CXGA 2GENA 3BTCA 2G3BA 3PPBA 3B6AA 3CJDA 3LJLA 3F1BA 2Y2ZA 3MNLA 2IBDA 3GEUA 5J1YA 1JUSA 2EH3A 2WUIA 2XPWA 1RKTA 4XK4A 3RH2A 3P9TA 4NELA 1VI0A 4MO7A 2UXIA 3BTIA 2FBQA 5F0CA 2OI8A 4GCKA 1QPIA 3CCYA 2XGEA 2XPUA 3MVPA 1ZK8A 2HQ5A 2O7TA 5FGLA 3TP3A 2VPRA 3Q0UA 3G7RA 2WGBA 4JL3A 2F07A 3BJBA 2NP5A 1JTXA 2QOPA 3BRUA 3QPSA 3DPJA 5J1UA 3HTHA 4W97A 3G1OA 2NS8A 2RHAA 3QKXA 3V78A 3G56A 4GFKA 4ME9A 5GPAA 3C07A 3C2BA 3QBMA 2UXPA 3GZIA 3FRQA 3FIWA 1BJZA 2O7OA 5F08A 3NRGA 3PASA 2XRLA 4V2GA 3BNIA 2YVHA 3ANPA 3VVYA 2GUHA 3CDLA 2Y31A 2YVEA 2NX4A 5F0FA 2FD5A 3PM1A 1UI6A 3ZQLA 5CW8A 3VP5A 2IEKA 4D5FA 2G7LA 5D19A 5D18A 3IH4A 2UXUA 2HXOA 1U9OA 2XGCA 2ZCNA 3HE0A 4M3BA 4G12A 3ZQFA 4AC0A 4YZEA 4MK6A 2V57A 2DG8A 3HGYA 3ZQGA 2DTZA 3LWJA 2QWTA 5C4YA 5J1RA 5IOYA 3KNWA 3TP0A 3HGGA 3BT9A 5HAWA 2ZCXA 2OPTA 2G0EA 5FHPA 3O8GA 2X6OA 2D6YA 3V6GA 5IOZA 3WHBA 2OERA 3NXCA 3VUQA 3VW1A 1Z77A 4B1RA 2QTQA 1JUMA 3BTLA 5EZHA 3EUPA 3HTIA 2JJ7A 4KWAA 3O8HA 3G1MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D1R A;  3LHQ A;  3ZQI A;  4M3D A;  5EYR A;  2HXI A;  5HBU A;  3BR1 A;  2ID3 A;  3BCG A;  3DCF A;  5IP6 A;  4W1U A;  1QVT A;  3VVX A;  3FK7 A;  1ORK A;  5F27 A;  2GFN A;  3BR2 A;  2I10 A;  2QCO A;  3ANG A;  3LSJ A;  2X9D A;  4JYK A;  3VIB A;  3BHQ A;  3IUV A;  2QKO A;  4NN1 A;  5F1J A;  3QPL A;  3B81 A;  3BQY A;  3F0C A;  2GBY A;  1SGM A;  4DW6 A;  3E7Q A;  3IH3 A;  3LSR A;  2TCT A;  3ON2 A;  4ICH A;  1Z0X A;  2ID6 A;  2XB5 A;  2HKU A;  5FKN A;  2G7S A;  4GFL A;  5EZG A;  3Q3S A;  3Q0V A;  1JT0 A;  4M3E A;  4JNN A;  3SFI A;  3WHC A;  2W53 A;  5F0H A;  2UXH A;  3JSJ A;  3BQZ A;  5FMP A;  2FJ1 A;  4AF5 A;  2XDN A;  1UI5 A;  3S5R A;  5GP9 A;  2G7G A;  3LOC A;  5F04 A;  4D7M A;  1T33 A;  4D7N A;  3BR5 A;  3KZ9 A;  3KKD A;  3EGQ A;  2IAI A;  4CGR A;  4I76 A;  2WV1 A;  3VOK A;  4I6Z A;  1JT6 A;  2ZOY A;  2RAS A;  2JK3 A;  3HTJ A;  4M3F A;  4V2F A;  4ABZ A;  2XGD A;  4JKZ A;  2VKE A;  5EFY A;  3VOX A;  4GCL A;  3IH2 A;  5AQC A;  1RKW A;  3QQA A;  2FQ4 A;  2PBX A;  1RPW A;  3CRJ A;  3O60 A;  2HYJ A;  5DAJ A;  5FKK A;  3KKC A;  3NI7 A;  4AC6 A;  3SDG A;  2ZB9 A;  3AQS A;  4X1E A;  5K7H A;  2REK A;  4M3G A;  3B6C A;  3BR0 A;  4D5C A;  4B3A A;  2FX0 A;  3CWR A;  2TRT A;  1QVU A;  5K58 A;  5K7F A;  3VPR A;  2Y30 A;  5HSZ A;  2IU5 A;  4PXI A;  3COL A;  4AUX A;  3HTA A;  4ACI A;  4GCT A;  2ZOZ A;  1ZKG A;  2XPV A;  3HIM A;  4UDS A;  2VKV A;  5CXI A;  5FKM A;  3FK6 A;  3AQT A;  5J3L A;  2QIB A;  3G1L A;  5GPC A;  2OF7 A;  1JTY A;  5FKL A;  3BR3 A;  2NP3 A;  2UXO A;  4HKU A;  3LSP A;  3Q0W A;  5FKO A;  3T6N A;  3DEW A;  4MXM A;  1JUP A;  3NPI A;  3BTJ A;  3ZQH A;  3RD3 A;  3VW0 A;  2PZ9 A;  4L62 A;  3NNR A;  3BR6 A;  2NS7 A;  1U9N A;  5K7Z A;  1T56 A;  1A6I A;  2RAE A;  2HYT A;  2DG7 A;  5H9T A;  2ZCM A;  3VVZ A;  3ON4 A;  3VW2 A;  5IPA A;  2Q24 A;  5CXG A;  2GEN A;  3BTC A;  2G3B A;  3PPB A;  3B6A A;  3CJD A;  3LJL A;  3F1B A;  2Y2Z A;  3MNL A;  2IBD A;  3GEU A;  5J1Y A;  1JUS A;  2EH3 A;  2WUI A;  2XPW A;  1RKT A;  4XK4 A;  3RH2 A;  3P9T A;  4NEL A;  1VI0 A;  4MO7 A;  2UXI A;  3BTI A;  2FBQ A;  5F0C A;  2OI8 A;  4GCK A;  1QPI A;  3CCY A;  2XGE A;  2XPU A;  3MVP A;  1ZK8 A;  2HQ5 A;  2O7T A;  5FGL A;  3TP3 A;  2VPR A;  3Q0U A;  3G7R A;  2WGB A;  4JL3 A;  2F07 A;  3BJB A;  2NP5 A;  1JTX A;  2QOP A;  3BRU A;  3QPS A;  3DPJ A;  5J1U A;  3HTH A;  4W97 A;  3G1O A;  2NS8 A;  2RHA A;  3QKX A;  3V78 A;  3G56 A;  4GFK A;  4ME9 A;  5GPA A;  3C07 A;  3C2B A;  3QBM A;  2UXP A;  3GZI A;  3FRQ A;  3FIW A;  1BJZ A;  2O7O A;  5F08 A;  3NRG A;  3PAS A;  2XRL A;  4V2G A;  3BNI A;  2YVH A;  3ANP A;  3VVY A;  2GUH A;  3CDL A;  2Y31 A;  2YVE A;  2NX4 A;  5F0F A;  2FD5 A;  3PM1 A;  1UI6 A;  3ZQL A;  5CW8 A;  3VP5 A;  2IEK A;  4D5F A;  2G7L A;  5D19 A;  5D18 A;  3IH4 A;  2UXU A;  2HXO A;  1U9O A;  2XGC A;  2ZCN A;  3HE0 A;  4M3B A;  4G12 A;  3ZQF A;  4AC0 A;  4YZE A;  4MK6 A;  2V57 A;  2DG8 A;  3HGY A;  3ZQG A;  2DTZ A;  3LWJ A;  2QWT A;  5C4Y A;  5J1R A;  5IOY A;  3KNW A;  3TP0 A;  3HGG A;  3BT9 A;  5HAW A;  2ZCX A;  2OPT A;  2G0E A;  5FHP A;  3O8G A;  2X6O A;  2D6Y A;  3V6G A;  5IOZ A;  3WHB A;  2OER A;  3NXC A;  3VUQ A;  3VW1 A;  1Z77 A;  4B1R A;  2QTQ A;  1JUM A;  3BTL A;  5EZH A;  3EUP A;  3HTI A;  2JJ7 A;  4KWA A;  3O8H A;  3G1M A; 
#chains in the Genus database with same CATH topology
 5D1R A;  3LHQ A;  3ZQI A;  4M3D A;  5EYR A;  2HXI A;  5HBU A;  3BR1 A;  2ID3 A;  3BCG A;  3DCF A;  5IP6 A;  4W1U A;  1QVT A;  3VVX A;  3FK7 A;  1ORK A;  5F27 A;  2GFN A;  3DU6 A;  3BR2 A;  2I10 A;  2QCO A;  3ANG A;  4DVY P;  3LSJ A;  4OD5 A;  2X9D A;  4JYK A;  3VIB A;  3BHQ A;  3IUV A;  2QKO A;  4NN1 A;  5F1J A;  2R7V A;  3QPL A;  3B81 A;  3BQY A;  3F0C A;  2GBY A;  1SGM A;  4DW6 A;  3E7Q A;  3IH3 A;  2FJI 1;  3LSR A;  2TCT A;  3ON2 A;  4ICH A;  1Z0X A;  2ID6 A;  2XB5 A;  2HKU A;  5FKN A;  2G7S A;  4GFL A;  5EZG A;  3VTI A;  3Q3S A;  3Q0V A;  1JT0 A;  4M3E A;  4JNN A;  3SFI A;  3WHC A;  2W53 A;  5F0H A;  2UXH A;  3JSJ A;  3BQZ A;  5FMP A;  2FJ1 A;  4AF5 A;  2XDN A;  1UI5 A;  3S5R A;  2YVX A;  5GP9 A;  2G7G A;  3LOC A;  5F04 A;  4D7M A;  1T33 A;  4D7N A;  2B3W A;  3BR5 A;  3KZ9 A;  3KKD A;  3EGQ A;  2IAI A;  4CGR A;  4I76 A;  2WV1 A;  3VOK A;  4I6Z A;  1JT6 A;  2ZOY A;  2RAS A;  2JK3 A;  3HTJ A;  4M3F A;  4V2F A;  4ABZ A;  2XGD A;  4JKZ A;  2VKE A;  5EFY A;  3VOX A;  4GCL A;  3IH2 A;  5AQC A;  1RKW A;  3QQA A;  2FQ4 A;  2PBX A;  1RPW A;  3CRJ A;  3O60 A;  2HYJ A;  5DAJ A;  5FKK A;  3KKC A;  3NI7 A;  4AC6 A;  3SDG A;  2ZB9 A;  3AQS A;  4X1E A;  5K7H A;  2REK A;  4M3G A;  3B6C A;  3BR0 A;  4D5C A;  4B3A A;  2FX0 A;  3CWR A;  2TRT A;  3KYL A;  1QVU A;  5K58 A;  5K7F A;  3VPR A;  2Y30 A;  5HSZ A;  2IU5 A;  4PXI A;  3COL A;  4AUX A;  3HTA A;  4ACI A;  4GCT A;  2ZOZ A;  1ZKG A;  2XPV A;  3HIM A;  4UDS A;  2VKV A;  5CXI A;  5FKM A;  3FK6 A;  3AQT A;  4C2M A;  5J3L A;  2QIB A;  2ZY9 A;  3G1L A;  5GPC A;  2OF7 A;  1JTY A;  5FKL A;  3BR3 A;  2NP3 A;  2UXO A;  5CQG A;  4HKU A;  4OD4 A;  3LSP A;  3Q0W A;  5FKO A;  3T6N A;  3DEW A;  4MXM A;  1JUP A;  3NPI A;  3BTJ A;  3ZQH A;  3RD3 A;  3VW0 A;  3DU5 A;  2PZ9 A;  4L62 A;  3NNR A;  3BR6 A;  2NS7 A;  1U9N A;  2R7R A;  2R7O A;  5K7Z A;  1T56 A;  1A6I A;  2RAE A;  2HYT A;  2DG7 A;  5H9T A;  2ZCM A;  3VVZ A;  3ON4 A;  3VW2 A;  5IPA A;  2Q24 A;  5CXG A;  2GEN A;  3BTC A;  2G3B A;  3PPB A;  3K8P C;  3B6A A;  2B1E A;  3CJD A;  3LJL A;  3F1B A;  2Y2Z A;  3MNL A;  2IBD A;  3GEU A;  5J1Y A;  1JUS A;  2EH3 A;  2WUI A;  2XPW A;  1RKT A;  4XK4 A;  3SWH A;  3RH2 A;  3P9T A;  4NEL A;  1VI0 A;  4MO7 A;  4WIB A;  2UXI A;  3BTI A;  2FBQ A;  5F0C A;  2OI8 A;  4GCK A;  1QPI A;  3CCY A;  2XGE A;  2XPU A;  3MVP A;  1ZK8 A;  2HQ5 A;  2O7T A;  5FGL A;  3TP3 A;  2VPR A;  3Q0U A;  3G7R A;  2WGB A;  4JL3 A;  2R7T A;  2F07 A;  3BJB A;  2NP5 A;  1JTX A;  2QOP A;  3BRU A;  3QPS A;  3DPJ A;  5J1U A;  3HTH A;  3NS4 A;  4W97 A;  3G1O A;  2NS8 A;  2RHA A;  3QKX A;  3V78 A;  3G56 A;  4IRV A;  4GFK A;  4ME9 A;  5GPA A;  3C07 A;  3C2B A;  3QBM A;  2UXP A;  3GZI A;  3FRQ A;  3FIW A;  1BJZ A;  2O7O A;  5F08 A;  3NRG A;  3PAS A;  2XRL A;  4V2G A;  3BNI A;  2YVH A;  3ANP A;  3VVY A;  2GUH A;  3CDL A;  2R7U A;  2Y31 A;  2YVE A;  2NX4 A;  5F0F A;  3FHN A;  2FD5 A;  3PM1 A;  1UI6 A;  2R7S A;  3ZQL A;  5CW8 A;  3VP5 A;  2IEK A;  4D5F A;  2G7L A;  5D19 A;  5D18 A;  2R7W A;  3IH4 A;  2UXU A;  2HXO A;  1U9O A;  2XGC A;  2ZCN A;  3HE0 A;  4M3B A;  4G12 A;  3ZQF A;  4AC0 A;  4YZE A;  4MK6 A;  2V57 A;  2DG8 A;  4U9L A;  3HGY A;  3ZQG A;  2DTZ A;  3LWJ A;  2QWT A;  5C4Y A;  5J1R A;  2R7Q A;  5IOY A;  3KNW A;  3TP0 A;  3HGG A;  3BT9 A;  5HAW A;  2ZCX A;  2OPT A;  2G0E A;  5FHP A;  3O8G A;  2X6O A;  2D6Y A;  3V6G A;  5IOZ A;  2PFV A;  3WHB A;  2OER A;  3NXC A;  3VUQ A;  3VW1 A;  2A2F X;  1Z77 A;  4U9N A;  4B1R A;  2QTQ A;  1JUM A;  3BTL A;  5EZH A;  3EUP A;  3HTI A;  2JJ7 A;  2R7X A;  4KWA A;  3O8H A;  3G1M A; 
#chains in the Genus database with same CATH homology
 5D1R A;  3LHQ A;  3ZQI A;  4M3D A;  5EYR A;  2HXI A;  5HBU A;  3BR1 A;  2ID3 A;  3BCG A;  3DCF A;  5IP6 A;  4W1U A;  1QVT A;  3VVX A;  3FK7 A;  1ORK A;  5F27 A;  2GFN A;  3BR2 A;  2I10 A;  2QCO A;  3ANG A;  3LSJ A;  2X9D A;  4JYK A;  3VIB A;  3BHQ A;  3IUV A;  2QKO A;  4NN1 A;  5F1J A;  3QPL A;  3B81 A;  3BQY A;  3F0C A;  2GBY A;  1SGM A;  4DW6 A;  3E7Q A;  3IH3 A;  3LSR A;  2TCT A;  3ON2 A;  4ICH A;  1Z0X A;  2ID6 A;  2XB5 A;  2HKU A;  5FKN A;  2G7S A;  4GFL A;  5EZG A;  3Q3S A;  3Q0V A;  1JT0 A;  4M3E A;  4JNN A;  3SFI A;  3WHC A;  2W53 A;  5F0H A;  2UXH A;  3JSJ A;  3BQZ A;  5FMP A;  2FJ1 A;  4AF5 A;  2XDN A;  1UI5 A;  3S5R A;  5GP9 A;  2G7G A;  3LOC A;  5F04 A;  4D7M A;  1T33 A;  4D7N A;  3BR5 A;  3KZ9 A;  3KKD A;  3EGQ A;  2IAI A;  4CGR A;  4I76 A;  2WV1 A;  3VOK A;  4I6Z A;  1JT6 A;  2ZOY A;  2RAS A;  2JK3 A;  3HTJ A;  4M3F A;  4V2F A;  4ABZ A;  2XGD A;  4JKZ A;  2VKE A;  5EFY A;  3VOX A;  4GCL A;  3IH2 A;  5AQC A;  1RKW A;  3QQA A;  2FQ4 A;  2PBX A;  1RPW A;  3CRJ A;  3O60 A;  2HYJ A;  5DAJ A;  5FKK A;  3KKC A;  3NI7 A;  4AC6 A;  3SDG A;  2ZB9 A;  3AQS A;  4X1E A;  5K7H A;  2REK A;  4M3G A;  3B6C A;  3BR0 A;  4D5C A;  4B3A A;  2FX0 A;  3CWR A;  2TRT A;  1QVU A;  5K58 A;  5K7F A;  3VPR A;  2Y30 A;  5HSZ A;  2IU5 A;  4PXI A;  3COL A;  4AUX A;  3HTA A;  4ACI A;  4GCT A;  2ZOZ A;  1ZKG A;  2XPV A;  3HIM A;  4UDS A;  2VKV A;  5CXI A;  5FKM A;  3FK6 A;  3AQT A;  5J3L A;  2QIB A;  3G1L A;  5GPC A;  2OF7 A;  1JTY A;  5FKL A;  3BR3 A;  2NP3 A;  2UXO A;  4HKU A;  3LSP A;  3Q0W A;  5FKO A;  3T6N A;  3DEW A;  4MXM A;  1JUP A;  3NPI A;  3BTJ A;  3ZQH A;  3RD3 A;  3VW0 A;  2PZ9 A;  4L62 A;  3NNR A;  3BR6 A;  2NS7 A;  1U9N A;  5K7Z A;  1T56 A;  1A6I A;  2RAE A;  2HYT A;  2DG7 A;  5H9T A;  2ZCM A;  3VVZ A;  3ON4 A;  3VW2 A;  5IPA A;  2Q24 A;  5CXG A;  2GEN A;  3BTC A;  2G3B A;  3PPB A;  3B6A A;  3CJD A;  3LJL A;  3F1B A;  2Y2Z A;  3MNL A;  2IBD A;  3GEU A;  5J1Y A;  1JUS A;  2EH3 A;  2WUI A;  2XPW A;  1RKT A;  4XK4 A;  3RH2 A;  3P9T A;  4NEL A;  1VI0 A;  4MO7 A;  2UXI A;  3BTI A;  2FBQ A;  5F0C A;  2OI8 A;  4GCK A;  1QPI A;  3CCY A;  2XGE A;  2XPU A;  3MVP A;  1ZK8 A;  2HQ5 A;  2O7T A;  5FGL A;  3TP3 A;  2VPR A;  3Q0U A;  3G7R A;  2WGB A;  4JL3 A;  2F07 A;  3BJB A;  2NP5 A;  1JTX A;  2QOP A;  3BRU A;  3QPS A;  3DPJ A;  5J1U A;  3HTH A;  4W97 A;  3G1O A;  2NS8 A;  2RHA A;  3QKX A;  3V78 A;  3G56 A;  4GFK A;  4ME9 A;  5GPA A;  3C07 A;  3C2B A;  3QBM A;  2UXP A;  3GZI A;  3FRQ A;  3FIW A;  1BJZ A;  2O7O A;  5F08 A;  3NRG A;  3PAS A;  2XRL A;  4V2G A;  3BNI A;  2YVH A;  3ANP A;  3VVY A;  2GUH A;  3CDL A;  2Y31 A;  2YVE A;  2NX4 A;  5F0F A;  2FD5 A;  3PM1 A;  1UI6 A;  3ZQL A;  5CW8 A;  3VP5 A;  2IEK A;  4D5F A;  2G7L A;  5D19 A;  5D18 A;  3IH4 A;  2UXU A;  2HXO A;  1U9O A;  2XGC A;  2ZCN A;  3HE0 A;  4M3B A;  4G12 A;  3ZQF A;  4AC0 A;  4YZE A;  4MK6 A;  2V57 A;  2DG8 A;  3HGY A;  3ZQG A;  2DTZ A;  3LWJ A;  2QWT A;  5C4Y A;  5J1R A;  5IOY A;  3KNW A;  3TP0 A;  3HGG A;  3BT9 A;  5HAW A;  2ZCX A;  2OPT A;  2G0E A;  5FHP A;  3O8G A;  2X6O A;  2D6Y A;  3V6G A;  5IOZ A;  3WHB A;  2OER A;  3NXC A;  3VUQ A;  3VW1 A;  1Z77 A;  4B1R A;  2QTQ A;  1JUM A;  3BTL A;  5EZH A;  3EUP A;  3HTI A;  2JJ7 A;  4KWA A;  3O8H A;  3G1M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...