3S5RA

Crystal structure of a putative transcriptional regulator of the tetr family (syn_02108) from syntrophus aciditrophicus at 2.60 a resolution
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
197
structure length
197
Chain Sequence
KNTRELLLDAATTLFAEQGIAATTMAEIAASVGVNPAMIHYYFKTRDSLLDTIIEERIGRIIDMIWEPVTGEEDDPLIMVRDLVNRIVNTCETMLWLPSLWIREIVNEGGALREKMLNNIPIDKMNKFSAKIAEGQKQGVINSGIDSRLLIGSIIGLTMLPLATAKLRDQIPTMKGLSSEDIVCHVTALLFTGLTNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a Putative transcriptional regulator of the TetR family (SYN_02108) from Syntrophus aciditrophicus SB at 2.60 A resolution
rcsb
source organism Syntrophus aciditrophicus
molecule tags Dna binding protein
molecule keywords Transcriptional regulator TetR family
total genus 57
structure length 197
sequence length 197
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3s5rA00
3F1BA 5GPAA 3HIMA 3BQYA 3BR6A 3HGGA 3COLA 2G0EA 3O8GA 1JUPA 3BR1A 4D5CA 2QCOA 3QBMA 3HE0A 2G7GA 2HXIA 3ZQFA 1BJZA 5J3LA 3IH3A 4X1EA 4NELA 2IAIA 3C2BA 5FMPA 3BR0A 4G12A 2I10A 5D1RA 4D7NA 3LWJA 3VVXA 3PASA 3NRGA 4GFKA 5GP9A 4ABZA 3VOKA 4KWAA 3ANPA 3AQSA 3KZ9A 3GEUA 2XPVA 5J1UA 4L62A 2JK3A 1Z77A 3Q3SA 3RH2A 1UI5A 2QOPA 1JUSA 5F08A 3MVPA 4UDSA 3BQZA 5K7HA 4NN1A 5K7ZA 3ZQLA 5DAJA 1Z0XA 5HBUA 3VUQA 5EZGA 3BRUA 4GCKA 2WV1A 3CRJA 1JT0A 2OI8A 4XK4A 2HYTA 2PBXA 2QIBA 3HGYA 3Q0VA 3P9TA 2WUIA 3VIBA 3LHQA 3ZQGA 4AUXA 3EUPA 3G56A 4CGRA 3DCFA 3IUVA 2OF7A 3FK6A 3VW2A 2JJ7A 4ACIA 2ZCMA 2GFNA 4GCLA 3HTJA 4JYKA 2HKUA 3G1OA 3QKXA 3G1LA 2FBQA 2ZCXA 3BR3A 2QKOA 5H9TA 3ZQIA 1U9NA 1RKWA 3GZIA 3VVZA 5D18A 2O7TA 4GCTA 2PZ9A 3DEWA 2GENA 5EFYA 2XGCA 2X9DA 3NPIA 1JTYA 5IOYA 3G7RA 5FGLA 1VI0A 3NI7A 4ME9A 2ZOZA 3BT9A 2UXHA 2Y2ZA 3VVYA 4M3GA 2D6YA 3Q0UA 2ZOYA 4M3FA 2XPUA 5AQCA 2OPTA 5GPCA 2XDNA 4B1RA 3O8HA 1RPWA 2ZB9A 2DG8A 4W1UA 5FKNA 5F27A 2YVHA 3BNIA 2ID6A 2TCTA 5HSZA 2XGDA 3ON2A 3PPBA 2Y30A 4V2GA 1RKTA 3ANGA 1QPIA 4I6ZA 2WGBA 3RD3A 3LOCA 3BR2A 4W97A 3DPJA 2IU5A 2NX4A 3VW1A 3BR5A 3BJBA 3TP3A 2FQ4A 3ON4A 2DG7A 3BCGA 5F0CA 3ZQHA 4M3DA 3NNRA 2ID3A 2W53A 2VKVA 5HAWA 1JTXA 2G7LA 2NP5A 5F04A 2XB5A 2F07A 2TRTA 5FKOA 5K58A 4D7MA 5EZHA 3KNWA 3BTIA 2UXUA 3CCYA 1T56A 5FKMA 3FIWA 3TP0A 3C07A 3V78A 2HQ5A 3WHCA 4B3AA 3MNLA 3IH4A 2FX0A 3SDGA 2GUHA 5IP6A 5F0HA 3EGQA 1ORKA 2YVEA 3LJLA 3WHBA 5IPAA 5FKLA 3B6CA 2DTZA 1A6IA 1ZKGA 2NS7A 2QTQA 4MO7A 2HYJA 5IOZA 4DW6A 3VP5A 3VOXA 4MK6A 5CXIA 4AF5A 3VW0A 5EYRA 3LSPA 5F0FA 2UXIA 2RASA 1UI6A 1U9OA 3CWRA 4M3BA 3LSJA 4AC6A 3BTJA 3FRQA 2VKEA 2EH3A 5FHPA 2UXPA 5C4YA 4AC0A 3NXCA 2NS8A 3QPLA 4GFLA 3HTIA 2IBDA 3IH2A 4YZEA 4M3EA 4I76A 5D19A 3B81A 3HTHA 4MXMA 3FK7A 4HKUA 3KKDA 3QPSA 3BTLA 1JT6A 1ZK8A 5J1YA 2V57A 2IEKA 2RAEA 2OERA 1T33A 3S5RA 2QWTA 4V2FA 2REKA 1JUMA 3O60A 3AQTA 3QQAA 3SFIA 1SGMA 4D5FA 3LSRA 2UXOA 5J1RA 3BTCA 5CXGA 3PM1A 3G1MA 2NP3A 3KKCA 2FJ1A 2GBYA 3VPRA 2Y31A 2HXOA 2G7SA 2XPWA 2RHAA 4JL3A 3T6NA 2ZCNA 2XGEA 3F0CA 3B6AA 3CDLA 5FKKA 2O7OA 3HTAA 4JKZA 3JSJA 3Q0WA 5CW8A 4ICHA 2X6OA 3CJDA 2Q24A 1QVUA 2VPRA 1QVTA 2XRLA 2FD5A 5F1JA 4PXIA 3BHQA 2G3BA 3V6GA 4JNNA 3E7QA 5K7FA
chains in the Genus database with same CATH superfamily
3F1BA 5GPAA 3HIMA 3BQYA 3BR6A 3HGGA 3COLA 2G0EA 3O8GA 1JUPA 3BR1A 4D5CA 2QCOA 3QBMA 3HE0A 4C2MA 4OD5A 2YVXA 2G7GA 2HXIA 3ZQFA 1BJZA 5J3LA 3IH3A 3KYLA 4X1EA 4NELA 2R7WA 2IAIA 3C2BA 5FMPA 3BR0A 4G12A 2I10A 5D1RA 4D7NA 3LWJA 3VVXA 3PASA 3NRGA 4GFKA 5GP9A 4ABZA 3VOKA 4KWAA 3ANPA 3AQSA 3KZ9A 3GEUA 2XPVA 5J1UA 4L62A 2JK3A 1Z77A 3Q3SA 3RH2A 1UI5A 2QOPA 1JUSA 5F08A 2R7VA 3MVPA 4UDSA 3BQZA 5K7HA 4NN1A 5K7ZA 3ZQLA 5DAJA 1Z0XA 5HBUA 3VUQA 5EZGA 3BRUA 4GCKA 2WV1A 3CRJA 1JT0A 2OI8A 4XK4A 2HYTA 2PBXA 2QIBA 3HGYA 3Q0VA 3P9TA 2WUIA 3VIBA 3LHQA 3ZQGA 4AUXA 3EUPA 3G56A 4CGRA 3DCFA 4WIBA 3IUVA 2OF7A 3FK6A 3VW2A 2JJ7A 4ACIA 2ZCMA 2GFNA 4GCLA 3HTJA 4JYKA 2HKUA 3G1OA 3QKXA 3G1LA 2FBQA 2ZCXA 3BR3A 2QKOA 5H9TA 3ZQIA 1U9NA 1RKWA 3GZIA 3VVZA 5D18A 2O7TA 4GCTA 2PZ9A 3DEWA 2GENA 5EFYA 2XGCA 2R7TA 2X9DA 3NPIA 5CQGA 1JTYA 5IOYA 3G7RA 5FGLA 1VI0A 3NI7A 4ME9A 2ZOZA 3BT9A 2R7XA 3FHNA 2UXHA 2B3WA 2Y2ZA 3VVYA 4M3GA 2D6YA 3Q0UA 3NS4A 2ZOYA 4M3FA 2XPUA 5AQCA 2OPTA 5GPCA 2XDNA 4B1RA 3O8HA 1RPWA 2ZB9A 2DG8A 4W1UA 5FKNA 5F27A 2YVHA 3BNIA 2ID6A 2TCTA 5HSZA 2XGDA 3ON2A 3PPBA 2Y30A 4V2GA 1RKTA 3ANGA 1QPIA 4I6ZA 2R7RA 2WGBA 3RD3A 3VTIA 3LOCA 3BR2A 4W97A 3DPJA 2IU5A 2NX4A 3VW1A 3BR5A 4OD4A 3BJBA 3TP3A 2ZY9A 2FQ4A 3ON4A 2DG7A 3BCGA 5F0CA 3ZQHA 4M3DA 3NNRA 2ID3A 2W53A 2VKVA 3K8PC 5HAWA 1JTXA 2G7LA 2NP5A 5F04A 2XB5A 2F07A 2TRTA 5FKOA 5K58A 4D7MA 5EZHA 2R7SA 3KNWA 3BTIA 2UXUA 3CCYA 1T56A 5FKMA 3FIWA 3TP0A 3C07A 3V78A 2HQ5A 3WHCA 4B3AA 3MNLA 3IH4A 2FX0A 3SDGA 2GUHA 5IP6A 5F0HA 3EGQA 1ORKA 2YVEA 3LJLA 3WHBA 5IPAA 5FKLA 3B6CA 2DTZA 1A6IA 1ZKGA 2NS7A 2QTQA 4MO7A 2R7UA 2HYJA 5IOZA 4DW6A 3VP5A 3VOXA 4MK6A 5CXIA 4AF5A 3VW0A 5EYRA 2FJI1 3LSPA 5F0FA 2UXIA 2RASA 1UI6A 1U9OA 3CWRA 4M3BA 3LSJA 4AC6A 3BTJA 3FRQA 2VKEA 2EH3A 5FHPA 2UXPA 5C4YA 2R7QA 4AC0A 3NXCA 2NS8A 3QPLA 4GFLA 3HTIA 2IBDA 3IH2A 4YZEA 4M3EA 4I76A 5D19A 3B81A 3HTHA 2R7OA 4MXMA 3FK7A 4HKUA 3KKDA 3QPSA 3BTLA 1JT6A 1ZK8A 5J1YA 2V57A 2IEKA 2PFVA 3DU6A 2RAEA 2OERA 4DVYP 1T33A 3S5RA 2B1EA 2QWTA 4V2FA 2REKA 1JUMA 3O60A 3AQTA 3DU5A 3QQAA 3SFIA 1SGMA 4D5FA 3LSRA 2UXOA 5J1RA 4U9LA 3BTCA 5CXGA 3PM1A 3G1MA 2NP3A 3KKCA 2FJ1A 2GBYA 3VPRA 2Y31A 2HXOA 4IRVA 2G7SA 2XPWA 2RHAA 4JL3A 3T6NA 2ZCNA 2XGEA 3F0CA 3B6AA 3CDLA 5FKKA 4U9NA 2O7OA 3HTAA 4JKZA 3JSJA 3Q0WA 5CW8A 4ICHA 2X6OA 3CJDA 2Q24A 1QVUA 2VPRA 1QVTA 2XRLA 2FD5A 5F1JA 4PXIA 3BHQA 2G3BA 3V6GA 2A2FX 4JNNA 3E7QA 3SWHA 5K7FA
chains in the Genus database with same CATH topology
3F1BA 5GPAA 3HIMA 3BQYA 3BR6A 3HGGA 3COLA 2G0EA 3O8GA 1JUPA 3BR1A 4D5CA 2QCOA 3QBMA 3HE0A 2G7GA 2HXIA 3ZQFA 1BJZA 5J3LA 3IH3A 4X1EA 4NELA 2IAIA 3C2BA 5FMPA 3BR0A 4G12A 2I10A 5D1RA 4D7NA 3LWJA 3VVXA 3PASA 3NRGA 4GFKA 5GP9A 4ABZA 3VOKA 4KWAA 3ANPA 3AQSA 3KZ9A 3GEUA 2XPVA 5J1UA 4L62A 2JK3A 1Z77A 3Q3SA 3RH2A 1UI5A 2QOPA 1JUSA 5F08A 3MVPA 4UDSA 3BQZA 5K7HA 4NN1A 5K7ZA 3ZQLA 5DAJA 1Z0XA 5HBUA 3VUQA 5EZGA 3BRUA 4GCKA 2WV1A 3CRJA 1JT0A 2OI8A 4XK4A 2HYTA 2PBXA 2QIBA 3HGYA 3Q0VA 3P9TA 2WUIA 3VIBA 3LHQA 3ZQGA 4AUXA 3EUPA 3G56A 4CGRA 3DCFA 3IUVA 2OF7A 3FK6A 3VW2A 2JJ7A 4ACIA 2ZCMA 2GFNA 4GCLA 3HTJA 4JYKA 2HKUA 3G1OA 3QKXA 3G1LA 2FBQA 2ZCXA 3BR3A 2QKOA 5H9TA 3ZQIA 1U9NA 1RKWA 3GZIA 3VVZA 5D18A 2O7TA 4GCTA 2PZ9A 3DEWA 2GENA 5EFYA 2XGCA 2X9DA 3NPIA 1JTYA 5IOYA 3G7RA 5FGLA 1VI0A 3NI7A 4ME9A 2ZOZA 3BT9A 2UXHA 2Y2ZA 3VVYA 4M3GA 2D6YA 3Q0UA 2ZOYA 4M3FA 2XPUA 5AQCA 2OPTA 5GPCA 2XDNA 4B1RA 3O8HA 1RPWA 2ZB9A 2DG8A 4W1UA 5FKNA 5F27A 2YVHA 3BNIA 2ID6A 2TCTA 5HSZA 2XGDA 3ON2A 3PPBA 2Y30A 4V2GA 1RKTA 3ANGA 1QPIA 4I6ZA 2WGBA 3RD3A 3LOCA 3BR2A 4W97A 3DPJA 2IU5A 2NX4A 3VW1A 3BR5A 3BJBA 3TP3A 2FQ4A 3ON4A 2DG7A 3BCGA 5F0CA 3ZQHA 4M3DA 3NNRA 2ID3A 2W53A 2VKVA 5HAWA 1JTXA 2G7LA 2NP5A 5F04A 2XB5A 2F07A 2TRTA 5FKOA 5K58A 4D7MA 5EZHA 3KNWA 3BTIA 2UXUA 3CCYA 1T56A 5FKMA 3FIWA 3TP0A 3C07A 3V78A 2HQ5A 3WHCA 4B3AA 3MNLA 3IH4A 2FX0A 3SDGA 2GUHA 5IP6A 5F0HA 3EGQA 1ORKA 2YVEA 3LJLA 3WHBA 5IPAA 5FKLA 3B6CA 2DTZA 1A6IA 1ZKGA 2NS7A 2QTQA 4MO7A 2HYJA 5IOZA 4DW6A 3VP5A 3VOXA 4MK6A 5CXIA 4AF5A 3VW0A 5EYRA 3LSPA 5F0FA 2UXIA 2RASA 1UI6A 1U9OA 3CWRA 4M3BA 3LSJA 4AC6A 3BTJA 3FRQA 2VKEA 2EH3A 5FHPA 2UXPA 5C4YA 4AC0A 3NXCA 2NS8A 3QPLA 4GFLA 3HTIA 2IBDA 3IH2A 4YZEA 4M3EA 4I76A 5D19A 3B81A 3HTHA 4MXMA 3FK7A 4HKUA 3KKDA 3QPSA 3BTLA 1JT6A 1ZK8A 5J1YA 2V57A 2IEKA 2RAEA 2OERA 1T33A 3S5RA 2QWTA 4V2FA 2REKA 1JUMA 3O60A 3AQTA 3QQAA 3SFIA 1SGMA 4D5FA 3LSRA 2UXOA 5J1RA 3BTCA 5CXGA 3PM1A 3G1MA 2NP3A 3KKCA 2FJ1A 2GBYA 3VPRA 2Y31A 2HXOA 2G7SA 2XPWA 2RHAA 4JL3A 3T6NA 2ZCNA 2XGEA 3F0CA 3B6AA 3CDLA 5FKKA 2O7OA 3HTAA 4JKZA 3JSJA 3Q0WA 5CW8A 4ICHA 2X6OA 3CJDA 2Q24A 1QVUA 2VPRA 1QVTA 2XRLA 2FD5A 5F1JA 4PXIA 3BHQA 2G3BA 3V6GA 4JNNA 3E7QA 5K7FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F1B A;  5GPA A;  3HIM A;  3BQY A;  3BR6 A;  3HGG A;  3COL A;  2G0E A;  3O8G A;  1JUP A;  3BR1 A;  4D5C A;  2QCO A;  3QBM A;  3HE0 A;  2G7G A;  2HXI A;  3ZQF A;  1BJZ A;  5J3L A;  3IH3 A;  4X1E A;  4NEL A;  2IAI A;  3C2B A;  5FMP A;  3BR0 A;  4G12 A;  2I10 A;  5D1R A;  4D7N A;  3LWJ A;  3VVX A;  3PAS A;  3NRG A;  4GFK A;  5GP9 A;  4ABZ A;  3VOK A;  4KWA A;  3ANP A;  3AQS A;  3KZ9 A;  3GEU A;  2XPV A;  5J1U A;  4L62 A;  2JK3 A;  1Z77 A;  3Q3S A;  3RH2 A;  1UI5 A;  2QOP A;  1JUS A;  5F08 A;  3MVP A;  4UDS A;  3BQZ A;  5K7H A;  4NN1 A;  5K7Z A;  3ZQL A;  5DAJ A;  1Z0X A;  5HBU A;  3VUQ A;  5EZG A;  3BRU A;  4GCK A;  2WV1 A;  3CRJ A;  1JT0 A;  2OI8 A;  4XK4 A;  2HYT A;  2PBX A;  2QIB A;  3HGY A;  3Q0V A;  3P9T A;  2WUI A;  3VIB A;  3LHQ A;  3ZQG A;  4AUX A;  3EUP A;  3G56 A;  4CGR A;  3DCF A;  3IUV A;  2OF7 A;  3FK6 A;  3VW2 A;  2JJ7 A;  4ACI A;  2ZCM A;  2GFN A;  4GCL A;  3HTJ A;  4JYK A;  2HKU A;  3G1O A;  3QKX A;  3G1L A;  2FBQ A;  2ZCX A;  3BR3 A;  2QKO A;  5H9T A;  3ZQI A;  1U9N A;  1RKW A;  3GZI A;  3VVZ A;  5D18 A;  2O7T A;  4GCT A;  2PZ9 A;  3DEW A;  2GEN A;  5EFY A;  2XGC A;  2X9D A;  3NPI A;  1JTY A;  5IOY A;  3G7R A;  5FGL A;  1VI0 A;  3NI7 A;  4ME9 A;  2ZOZ A;  3BT9 A;  2UXH A;  2Y2Z A;  3VVY A;  4M3G A;  2D6Y A;  3Q0U A;  2ZOY A;  4M3F A;  2XPU A;  5AQC A;  2OPT A;  5GPC A;  2XDN A;  4B1R A;  3O8H A;  1RPW A;  2ZB9 A;  2DG8 A;  4W1U A;  5FKN A;  5F27 A;  2YVH A;  3BNI A;  2ID6 A;  2TCT A;  5HSZ A;  2XGD A;  3ON2 A;  3PPB A;  2Y30 A;  4V2G A;  1RKT A;  3ANG A;  1QPI A;  4I6Z A;  2WGB A;  3RD3 A;  3LOC A;  3BR2 A;  4W97 A;  3DPJ A;  2IU5 A;  2NX4 A;  3VW1 A;  3BR5 A;  3BJB A;  3TP3 A;  2FQ4 A;  3ON4 A;  2DG7 A;  3BCG A;  5F0C A;  3ZQH A;  4M3D A;  3NNR A;  2ID3 A;  2W53 A;  2VKV A;  5HAW A;  1JTX A;  2G7L A;  2NP5 A;  5F04 A;  2XB5 A;  2F07 A;  2TRT A;  5FKO A;  5K58 A;  4D7M A;  5EZH A;  3KNW A;  3BTI A;  2UXU A;  3CCY A;  1T56 A;  5FKM A;  3FIW A;  3TP0 A;  3C07 A;  3V78 A;  2HQ5 A;  3WHC A;  4B3A A;  3MNL A;  3IH4 A;  2FX0 A;  3SDG A;  2GUH A;  5IP6 A;  5F0H A;  3EGQ A;  1ORK A;  2YVE A;  3LJL A;  3WHB A;  5IPA A;  5FKL A;  3B6C A;  2DTZ A;  1A6I A;  1ZKG A;  2NS7 A;  2QTQ A;  4MO7 A;  2HYJ A;  5IOZ A;  4DW6 A;  3VP5 A;  3VOX A;  4MK6 A;  5CXI A;  4AF5 A;  3VW0 A;  5EYR A;  3LSP A;  5F0F A;  2UXI A;  2RAS A;  1UI6 A;  1U9O A;  3CWR A;  4M3B A;  3LSJ A;  4AC6 A;  3BTJ A;  3FRQ A;  2VKE A;  2EH3 A;  5FHP A;  2UXP A;  5C4Y A;  4AC0 A;  3NXC A;  2NS8 A;  3QPL A;  4GFL A;  3HTI A;  2IBD A;  3IH2 A;  4YZE A;  4M3E A;  4I76 A;  5D19 A;  3B81 A;  3HTH A;  4MXM A;  3FK7 A;  4HKU A;  3KKD A;  3QPS A;  3BTL A;  1JT6 A;  1ZK8 A;  5J1Y A;  2V57 A;  2IEK A;  2RAE A;  2OER A;  1T33 A;  3S5R A;  2QWT A;  4V2F A;  2REK A;  1JUM A;  3O60 A;  3AQT A;  3QQA A;  3SFI A;  1SGM A;  4D5F A;  3LSR A;  2UXO A;  5J1R A;  3BTC A;  5CXG A;  3PM1 A;  3G1M A;  2NP3 A;  3KKC A;  2FJ1 A;  2GBY A;  3VPR A;  2Y31 A;  2HXO A;  2G7S A;  2XPW A;  2RHA A;  4JL3 A;  3T6N A;  2ZCN A;  2XGE A;  3F0C A;  3B6A A;  3CDL A;  5FKK A;  2O7O A;  3HTA A;  4JKZ A;  3JSJ A;  3Q0W A;  5CW8 A;  4ICH A;  2X6O A;  3CJD A;  2Q24 A;  1QVU A;  2VPR A;  1QVT A;  2XRL A;  2FD5 A;  5F1J A;  4PXI A;  3BHQ A;  2G3B A;  3V6G A;  4JNN A;  3E7Q A;  5K7F A; 
#chains in the Genus database with same CATH topology
 3F1B A;  5GPA A;  3HIM A;  3BQY A;  3BR6 A;  3HGG A;  3COL A;  2G0E A;  3O8G A;  1JUP A;  3BR1 A;  4D5C A;  2QCO A;  3QBM A;  3HE0 A;  4C2M A;  4OD5 A;  2YVX A;  2G7G A;  2HXI A;  3ZQF A;  1BJZ A;  5J3L A;  3IH3 A;  3KYL A;  4X1E A;  4NEL A;  2R7W A;  2IAI A;  3C2B A;  5FMP A;  3BR0 A;  4G12 A;  2I10 A;  5D1R A;  4D7N A;  3LWJ A;  3VVX A;  3PAS A;  3NRG A;  4GFK A;  5GP9 A;  4ABZ A;  3VOK A;  4KWA A;  3ANP A;  3AQS A;  3KZ9 A;  3GEU A;  2XPV A;  5J1U A;  4L62 A;  2JK3 A;  1Z77 A;  3Q3S A;  3RH2 A;  1UI5 A;  2QOP A;  1JUS A;  5F08 A;  2R7V A;  3MVP A;  4UDS A;  3BQZ A;  5K7H A;  4NN1 A;  5K7Z A;  3ZQL A;  5DAJ A;  1Z0X A;  5HBU A;  3VUQ A;  5EZG A;  3BRU A;  4GCK A;  2WV1 A;  3CRJ A;  1JT0 A;  2OI8 A;  4XK4 A;  2HYT A;  2PBX A;  2QIB A;  3HGY A;  3Q0V A;  3P9T A;  2WUI A;  3VIB A;  3LHQ A;  3ZQG A;  4AUX A;  3EUP A;  3G56 A;  4CGR A;  3DCF A;  4WIB A;  3IUV A;  2OF7 A;  3FK6 A;  3VW2 A;  2JJ7 A;  4ACI A;  2ZCM A;  2GFN A;  4GCL A;  3HTJ A;  4JYK A;  2HKU A;  3G1O A;  3QKX A;  3G1L A;  2FBQ A;  2ZCX A;  3BR3 A;  2QKO A;  5H9T A;  3ZQI A;  1U9N A;  1RKW A;  3GZI A;  3VVZ A;  5D18 A;  2O7T A;  4GCT A;  2PZ9 A;  3DEW A;  2GEN A;  5EFY A;  2XGC A;  2R7T A;  2X9D A;  3NPI A;  5CQG A;  1JTY A;  5IOY A;  3G7R A;  5FGL A;  1VI0 A;  3NI7 A;  4ME9 A;  2ZOZ A;  3BT9 A;  2R7X A;  3FHN A;  2UXH A;  2B3W A;  2Y2Z A;  3VVY A;  4M3G A;  2D6Y A;  3Q0U A;  3NS4 A;  2ZOY A;  4M3F A;  2XPU A;  5AQC A;  2OPT A;  5GPC A;  2XDN A;  4B1R A;  3O8H A;  1RPW A;  2ZB9 A;  2DG8 A;  4W1U A;  5FKN A;  5F27 A;  2YVH A;  3BNI A;  2ID6 A;  2TCT A;  5HSZ A;  2XGD A;  3ON2 A;  3PPB A;  2Y30 A;  4V2G A;  1RKT A;  3ANG A;  1QPI A;  4I6Z A;  2R7R A;  2WGB A;  3RD3 A;  3VTI A;  3LOC A;  3BR2 A;  4W97 A;  3DPJ A;  2IU5 A;  2NX4 A;  3VW1 A;  3BR5 A;  4OD4 A;  3BJB A;  3TP3 A;  2ZY9 A;  2FQ4 A;  3ON4 A;  2DG7 A;  3BCG A;  5F0C A;  3ZQH A;  4M3D A;  3NNR A;  2ID3 A;  2W53 A;  2VKV A;  3K8P C;  5HAW A;  1JTX A;  2G7L A;  2NP5 A;  5F04 A;  2XB5 A;  2F07 A;  2TRT A;  5FKO A;  5K58 A;  4D7M A;  5EZH A;  2R7S A;  3KNW A;  3BTI A;  2UXU A;  3CCY A;  1T56 A;  5FKM A;  3FIW A;  3TP0 A;  3C07 A;  3V78 A;  2HQ5 A;  3WHC A;  4B3A A;  3MNL A;  3IH4 A;  2FX0 A;  3SDG A;  2GUH A;  5IP6 A;  5F0H A;  3EGQ A;  1ORK A;  2YVE A;  3LJL A;  3WHB A;  5IPA A;  5FKL A;  3B6C A;  2DTZ A;  1A6I A;  1ZKG A;  2NS7 A;  2QTQ A;  4MO7 A;  2R7U A;  2HYJ A;  5IOZ A;  4DW6 A;  3VP5 A;  3VOX A;  4MK6 A;  5CXI A;  4AF5 A;  3VW0 A;  5EYR A;  2FJI 1;  3LSP A;  5F0F A;  2UXI A;  2RAS A;  1UI6 A;  1U9O A;  3CWR A;  4M3B A;  3LSJ A;  4AC6 A;  3BTJ A;  3FRQ A;  2VKE A;  2EH3 A;  5FHP A;  2UXP A;  5C4Y A;  2R7Q A;  4AC0 A;  3NXC A;  2NS8 A;  3QPL A;  4GFL A;  3HTI A;  2IBD A;  3IH2 A;  4YZE A;  4M3E A;  4I76 A;  5D19 A;  3B81 A;  3HTH A;  2R7O A;  4MXM A;  3FK7 A;  4HKU A;  3KKD A;  3QPS A;  3BTL A;  1JT6 A;  1ZK8 A;  5J1Y A;  2V57 A;  2IEK A;  2PFV A;  3DU6 A;  2RAE A;  2OER A;  4DVY P;  1T33 A;  3S5R A;  2B1E A;  2QWT A;  4V2F A;  2REK A;  1JUM A;  3O60 A;  3AQT A;  3DU5 A;  3QQA A;  3SFI A;  1SGM A;  4D5F A;  3LSR A;  2UXO A;  5J1R A;  4U9L A;  3BTC A;  5CXG A;  3PM1 A;  3G1M A;  2NP3 A;  3KKC A;  2FJ1 A;  2GBY A;  3VPR A;  2Y31 A;  2HXO A;  4IRV A;  2G7S A;  2XPW A;  2RHA A;  4JL3 A;  3T6N A;  2ZCN A;  2XGE A;  3F0C A;  3B6A A;  3CDL A;  5FKK A;  4U9N A;  2O7O A;  3HTA A;  4JKZ A;  3JSJ A;  3Q0W A;  5CW8 A;  4ICH A;  2X6O A;  3CJD A;  2Q24 A;  1QVU A;  2VPR A;  1QVT A;  2XRL A;  2FD5 A;  5F1J A;  4PXI A;  3BHQ A;  2G3B A;  3V6G A;  2A2F X;  4JNN A;  3E7Q A;  3SWH A;  5K7F A; 
#chains in the Genus database with same CATH homology
 3F1B A;  5GPA A;  3HIM A;  3BQY A;  3BR6 A;  3HGG A;  3COL A;  2G0E A;  3O8G A;  1JUP A;  3BR1 A;  4D5C A;  2QCO A;  3QBM A;  3HE0 A;  2G7G A;  2HXI A;  3ZQF A;  1BJZ A;  5J3L A;  3IH3 A;  4X1E A;  4NEL A;  2IAI A;  3C2B A;  5FMP A;  3BR0 A;  4G12 A;  2I10 A;  5D1R A;  4D7N A;  3LWJ A;  3VVX A;  3PAS A;  3NRG A;  4GFK A;  5GP9 A;  4ABZ A;  3VOK A;  4KWA A;  3ANP A;  3AQS A;  3KZ9 A;  3GEU A;  2XPV A;  5J1U A;  4L62 A;  2JK3 A;  1Z77 A;  3Q3S A;  3RH2 A;  1UI5 A;  2QOP A;  1JUS A;  5F08 A;  3MVP A;  4UDS A;  3BQZ A;  5K7H A;  4NN1 A;  5K7Z A;  3ZQL A;  5DAJ A;  1Z0X A;  5HBU A;  3VUQ A;  5EZG A;  3BRU A;  4GCK A;  2WV1 A;  3CRJ A;  1JT0 A;  2OI8 A;  4XK4 A;  2HYT A;  2PBX A;  2QIB A;  3HGY A;  3Q0V A;  3P9T A;  2WUI A;  3VIB A;  3LHQ A;  3ZQG A;  4AUX A;  3EUP A;  3G56 A;  4CGR A;  3DCF A;  3IUV A;  2OF7 A;  3FK6 A;  3VW2 A;  2JJ7 A;  4ACI A;  2ZCM A;  2GFN A;  4GCL A;  3HTJ A;  4JYK A;  2HKU A;  3G1O A;  3QKX A;  3G1L A;  2FBQ A;  2ZCX A;  3BR3 A;  2QKO A;  5H9T A;  3ZQI A;  1U9N A;  1RKW A;  3GZI A;  3VVZ A;  5D18 A;  2O7T A;  4GCT A;  2PZ9 A;  3DEW A;  2GEN A;  5EFY A;  2XGC A;  2X9D A;  3NPI A;  1JTY A;  5IOY A;  3G7R A;  5FGL A;  1VI0 A;  3NI7 A;  4ME9 A;  2ZOZ A;  3BT9 A;  2UXH A;  2Y2Z A;  3VVY A;  4M3G A;  2D6Y A;  3Q0U A;  2ZOY A;  4M3F A;  2XPU A;  5AQC A;  2OPT A;  5GPC A;  2XDN A;  4B1R A;  3O8H A;  1RPW A;  2ZB9 A;  2DG8 A;  4W1U A;  5FKN A;  5F27 A;  2YVH A;  3BNI A;  2ID6 A;  2TCT A;  5HSZ A;  2XGD A;  3ON2 A;  3PPB A;  2Y30 A;  4V2G A;  1RKT A;  3ANG A;  1QPI A;  4I6Z A;  2WGB A;  3RD3 A;  3LOC A;  3BR2 A;  4W97 A;  3DPJ A;  2IU5 A;  2NX4 A;  3VW1 A;  3BR5 A;  3BJB A;  3TP3 A;  2FQ4 A;  3ON4 A;  2DG7 A;  3BCG A;  5F0C A;  3ZQH A;  4M3D A;  3NNR A;  2ID3 A;  2W53 A;  2VKV A;  5HAW A;  1JTX A;  2G7L A;  2NP5 A;  5F04 A;  2XB5 A;  2F07 A;  2TRT A;  5FKO A;  5K58 A;  4D7M A;  5EZH A;  3KNW A;  3BTI A;  2UXU A;  3CCY A;  1T56 A;  5FKM A;  3FIW A;  3TP0 A;  3C07 A;  3V78 A;  2HQ5 A;  3WHC A;  4B3A A;  3MNL A;  3IH4 A;  2FX0 A;  3SDG A;  2GUH A;  5IP6 A;  5F0H A;  3EGQ A;  1ORK A;  2YVE A;  3LJL A;  3WHB A;  5IPA A;  5FKL A;  3B6C A;  2DTZ A;  1A6I A;  1ZKG A;  2NS7 A;  2QTQ A;  4MO7 A;  2HYJ A;  5IOZ A;  4DW6 A;  3VP5 A;  3VOX A;  4MK6 A;  5CXI A;  4AF5 A;  3VW0 A;  5EYR A;  3LSP A;  5F0F A;  2UXI A;  2RAS A;  1UI6 A;  1U9O A;  3CWR A;  4M3B A;  3LSJ A;  4AC6 A;  3BTJ A;  3FRQ A;  2VKE A;  2EH3 A;  5FHP A;  2UXP A;  5C4Y A;  4AC0 A;  3NXC A;  2NS8 A;  3QPL A;  4GFL A;  3HTI A;  2IBD A;  3IH2 A;  4YZE A;  4M3E A;  4I76 A;  5D19 A;  3B81 A;  3HTH A;  4MXM A;  3FK7 A;  4HKU A;  3KKD A;  3QPS A;  3BTL A;  1JT6 A;  1ZK8 A;  5J1Y A;  2V57 A;  2IEK A;  2RAE A;  2OER A;  1T33 A;  3S5R A;  2QWT A;  4V2F A;  2REK A;  1JUM A;  3O60 A;  3AQT A;  3QQA A;  3SFI A;  1SGM A;  4D5F A;  3LSR A;  2UXO A;  5J1R A;  3BTC A;  5CXG A;  3PM1 A;  3G1M A;  2NP3 A;  3KKC A;  2FJ1 A;  2GBY A;  3VPR A;  2Y31 A;  2HXO A;  2G7S A;  2XPW A;  2RHA A;  4JL3 A;  3T6N A;  2ZCN A;  2XGE A;  3F0C A;  3B6A A;  3CDL A;  5FKK A;  2O7O A;  3HTA A;  4JKZ A;  3JSJ A;  3Q0W A;  5CW8 A;  4ICH A;  2X6O A;  3CJD A;  2Q24 A;  1QVU A;  2VPR A;  1QVT A;  2XRL A;  2FD5 A;  5F1J A;  4PXI A;  3BHQ A;  2G3B A;  3V6G A;  4JNN A;  3E7Q A;  5K7F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...