3S5RA

Crystal structure of a putative transcriptional regulator of the tetr family (syn_02108) from syntrophus aciditrophicus at 2.60 a resolution
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
197
structure length
197
Chain Sequence
KNTRELLLDAATTLFAEQGIAATTMAEIAASVGVNPAMIHYYFKTRDSLLDTIIEERIGRIIDMIWEPVTGEEDDPLIMVRDLVNRIVNTCETMLWLPSLWIREIVNEGGALREKMLNNIPIDKMNKFSAKIAEGQKQGVINSGIDSRLLIGSIIGLTMLPLATAKLRDQIPTMKGLSSEDIVCHVTALLFTGLTNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Transcriptional regulator TetR family
publication title Crystal structure of a Putative transcriptional regulator of the TetR family (SYN_02108) from Syntrophus aciditrophicus SB at 2.60 A resolution
rcsb
source organism Syntrophus aciditrophicus
total genus 57
structure length 197
sequence length 197
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3s5rA00
2XPVA 3BR5A 1T56A 3QPLA 1SGMA 2IU5A 2OPTA 5IOZA 5K7HA 3KNWA 5EZHA 3CCYA 2G3BA 2HQ5A 5K7ZA 2D6YA 2ZOYA 3NI7A 3HGYA 5HBUA 1QVUA 3C2BA 3BTLA 2X9DA 2YVHA 3HGGA 4JYKA 5J1YA 2JK3A 3NRGA 4MO7A 3VVYA 5D1RA 2HXOA 3LSPA 3GZIA 3QPSA 4B1RA 2XPUA 3BTCA 3PM1A 3BQYA 5F27A 1VI0A 1RPWA 2VKEA 1QVTA 3BR0A 3Q0UA 3HTJA 3Q3SA 2F07A 4AC6A 3VIBA 2PZ9A 3SFIA 3DCFA 3NPIA 4V2FA 2XRLA 2TRTA 2NP5A 2DG7A 3G7RA 2G7GA 2PBXA 5J1RA 2FJ1A 3MVPA 5FKOA 4D5FA 2OERA 2VPRA 4YZEA 5CXIA 5H9TA 3QQAA 5K7FA 5J3LA 2RASA 3B81A 3LJLA 3O8HA 3WHCA 4AUXA 4MK6A 5FKLA 3ZQIA 5D18A 2XGCA 4PXIA 2ZB9A 5EZGA 4AF5A 2UXHA 3FRQA 2TCTA 1Z77A 3ZQHA 5K58A 3G56A 4MXMA 5F04A 2QOPA 5FHPA 2QTQA 2XB5A 3CRJA 3BRUA 3BR2A 1JT0A 3CJDA 3O60A 3C07A 2XPWA 2UXOA 2OI8A 3CWRA 3BR6A 2FD5A 3F0CA 3G1MA 1U9OA 3KZ9A 5DAJA 5FKKA 1RKWA 2UXUA 5GPAA 2ZCMA 3TP3A 1JTYA 2OF7A 2X6OA 4ABZA 3B6CA 2UXPA 3BTJA 4NN1A 3IH4A 2FBQA 4M3GA 1UI5A 4GCTA 4B3AA 3AQSA 4JNNA 3VW0A 3PASA 5CXGA 4HKUA 3VUQA 2QWTA 3WHBA 3ZQGA 4GCLA 2FX0A 2UXIA 3NXCA 2QKOA 5C4YA 2RAEA 2WV1A 2XGEA 5HAWA 1ZK8A 1U9NA 2IBDA 5GPCA 2Y30A 2Q24A 3LWJA 3LSRA 1RKTA 2Y2ZA 2WUIA 2ZOZA 2O7TA 3IH2A 3FIWA 3LOCA 2G7LA 5D19A 3S5RA 4M3DA 4UDSA 3PPBA 3O8GA 3VP5A 5FMPA 4V2GA 1T33A 3KKCA 3DEWA 3ZQFA 3GEUA 5J1UA 1JTXA 3BQZA 4DW6A 3EGQA 2V57A 3VVXA 4G12A 2WGBA 3IUVA 3LSJA 1ORKA 1A6IA 2GUHA 3Q0VA 3V78A 3BCGA 2ZCNA 2ID3A 5F1JA 2W53A 2GFNA 5EYRA 3ZQLA 2NS7A 4JL3A 2NP3A 4KWAA 5FKNA 3E7QA 3HTAA 5FGLA 3VOKA 5IP6A 3G1OA 1ZKGA 2GENA 3COLA 2REKA 1JUMA 3BT9A 4M3EA 3BTIA 2XGDA 2EH3A 5F0CA 3BNIA 2DG8A 3ANPA 1JUPA 4CGRA 3HTIA 5EFYA 4GFKA 3JSJA 3VOXA 2NS8A 3BR3A 3V6GA 4ME9A 2QCOA 4XK4A 5F0FA 2O7OA 4D7NA 3EUPA 4D5CA 2NX4A 2GBYA 3DPJA 4W1UA 3ON2A 4M3FA 2HYJA 3IH3A 2FQ4A 5AQCA 2DTZA 3MNLA 3QBMA 2IEKA 3BJBA 3G1LA 3HTHA 3HIMA 2HXIA 2Y31A 4NELA 3F1BA 3AQTA 4ICHA 4M3BA 4L62A 3FK7A 3VVZA 3SDGA 3Q0WA 3LHQA 3FK6A 3T6NA 4JKZA 3BR1A 2G7SA 5HSZA 5GP9A 2RHAA 2G0EA 1QPIA 3VW2A 4GFLA 4W97A 4I6ZA 5F08A 2VKVA 4X1EA 4AC0A 2JJ7A 5F0HA 3KKDA 3ANGA 1Z0XA 3RH2A 3QKXA 3BHQA 2HKUA 3ON4A 3B6AA 3CDLA 2HYTA 2I10A 1JT6A 3HE0A 3VPRA 3TP0A 1UI6A 2YVEA 4D7MA 3NNRA 3RD3A 2XDNA 3VW1A 2ZCXA 5CW8A 3P9TA 1BJZA 1JUSA 4GCKA 5IOYA 4ACIA 2IAIA 5FKMA 2QIBA 5IPAA 4I76A 2ID6A
chains in the Genus database with same CATH superfamily
2XPVA 3BR5A 1T56A 3QPLA 1SGMA 2IU5A 2OPTA 5IOZA 5K7HA 3KNWA 3DU5A 5EZHA 3CCYA 2G3BA 2HQ5A 5K7ZA 2D6YA 2ZOYA 3NI7A 3HGYA 5HBUA 1QVUA 3C2BA 3BTLA 2X9DA 2YVHA 3HGGA 4JYKA 5J1YA 2B1EA 2JK3A 3NRGA 4MO7A 3VVYA 5D1RA 2HXOA 3LSPA 3GZIA 3QPSA 4B1RA 2XPUA 2R7UA 3BTCA 3PM1A 3BQYA 3FHNA 5F27A 1VI0A 1RPWA 2VKEA 1QVTA 3BR0A 3Q0UA 3HTJA 3Q3SA 2F07A 4AC6A 3VIBA 2PZ9A 3SFIA 3DCFA 3NPIA 4V2FA 2XRLA 2TRTA 2NP5A 2DG7A 3G7RA 2G7GA 2PBXA 5J1RA 2FJ1A 3MVPA 5FKOA 4D5FA 2OERA 2VPRA 4YZEA 5CXIA 5H9TA 4C2MA 3QQAA 5K7FA 5J3LA 2RASA 3B81A 3LJLA 3O8HA 3WHCA 4AUXA 4MK6A 5FKLA 3ZQIA 5D18A 2XGCA 2R7RA 4PXIA 2ZB9A 5EZGA 4AF5A 2UXHA 4U9LA 3FRQA 2R7OA 2TCTA 1Z77A 3ZQHA 5K58A 3G56A 4MXMA 5F04A 2QOPA 5FHPA 2QTQA 2XB5A 2PFVA 3CRJA 3BRUA 3BR2A 1JT0A 3CJDA 3O60A 3C07A 2XPWA 2UXOA 2OI8A 3CWRA 3BR6A 2FD5A 3F0CA 3G1MA 1U9OA 3KZ9A 5DAJA 5FKKA 1RKWA 2UXUA 5GPAA 2ZCMA 4U9NA 3TP3A 1JTYA 2OF7A 2X6OA 4ABZA 3B6CA 2R7XA 2UXPA 3BTJA 4NN1A 3IH4A 2FBQA 5CQGA 4M3GA 1UI5A 3SWHA 4GCTA 4DVYP 4B3AA 3AQSA 2YVXA 4JNNA 3VW0A 3PASA 5CXGA 4HKUA 3VUQA 2QWTA 3WHBA 3ZQGA 4GCLA 2FX0A 2UXIA 3NXCA 2QKOA 5C4YA 2RAEA 2WV1A 2XGEA 5HAWA 1ZK8A 1U9NA 2IBDA 5GPCA 2Y30A 2Q24A 3LWJA 3LSRA 1RKTA 2Y2ZA 2WUIA 2ZOZA 2O7TA 3IH2A 3FIWA 3LOCA 3K8PC 2G7LA 5D19A 3S5RA 4M3DA 4UDSA 3PPBA 3O8GA 3VP5A 5FMPA 4V2GA 1T33A 3KKCA 3DEWA 3ZQFA 2FJI1 3GEUA 5J1UA 1JTXA 3BQZA 4DW6A 3EGQA 2V57A 3VVXA 4G12A 2WGBA 3IUVA 3LSJA 1ORKA 1A6IA 2GUHA 3Q0VA 3V78A 3KYLA 2R7TA 3BCGA 2ZCNA 2ID3A 5F1JA 2W53A 2GFNA 5EYRA 3ZQLA 2NS7A 4JL3A 2NP3A 4KWAA 5FKNA 3E7QA 3HTAA 5FGLA 3VOKA 5IP6A 3G1OA 1ZKGA 2GENA 3COLA 2REKA 1JUMA 3BT9A 4M3EA 3BTIA 2XGDA 2ZY9A 2A2FX 2EH3A 5F0CA 3BNIA 2DG8A 3ANPA 1JUPA 4CGRA 3HTIA 5EFYA 4GFKA 3JSJA 3VOXA 2NS8A 3NS4A 3BR3A 3V6GA 4ME9A 2QCOA 4XK4A 4OD5A 5F0FA 2R7SA 2O7OA 4D7NA 3EUPA 4D5CA 3VTIA 2NX4A 2GBYA 3DPJA 4W1UA 3ON2A 4M3FA 2HYJA 3IH3A 2FQ4A 5AQCA 2B3WA 2DTZA 3MNLA 3QBMA 2IEKA 3BJBA 3G1LA 3HTHA 3HIMA 2HXIA 2Y31A 2R7VA 4NELA 3F1BA 3AQTA 4ICHA 4M3BA 4WIBA 4L62A 3FK7A 3VVZA 3SDGA 3Q0WA 3LHQA 2R7QA 3FK6A 3T6NA 4JKZA 3BR1A 2G7SA 5HSZA 5GP9A 2RHAA 2G0EA 1QPIA 3VW2A 4GFLA 4W97A 4I6ZA 5F08A 2VKVA 4X1EA 4AC0A 2JJ7A 5F0HA 3KKDA 3ANGA 1Z0XA 3RH2A 3QKXA 3BHQA 2HKUA 3ON4A 3B6AA 3CDLA 2HYTA 2I10A 1JT6A 3DU6A 3HE0A 3VPRA 3TP0A 1UI6A 2YVEA 4D7MA 3NNRA 3RD3A 2XDNA 3VW1A 2ZCXA 5CW8A 3P9TA 1BJZA 1JUSA 4GCKA 5IOYA 4ACIA 2IAIA 5FKMA 2R7WA 2QIBA 5IPAA 4IRVA 4OD4A 4I76A 2ID6A
chains in the Genus database with same CATH topology
2XPVA 3BR5A 1T56A 3QPLA 1SGMA 2IU5A 2OPTA 5IOZA 5K7HA 3KNWA 5EZHA 3CCYA 2G3BA 2HQ5A 5K7ZA 2D6YA 2ZOYA 3NI7A 3HGYA 5HBUA 1QVUA 3C2BA 3BTLA 2X9DA 2YVHA 3HGGA 4JYKA 5J1YA 2JK3A 3NRGA 4MO7A 3VVYA 5D1RA 2HXOA 3LSPA 3GZIA 3QPSA 4B1RA 2XPUA 3BTCA 3PM1A 3BQYA 5F27A 1VI0A 1RPWA 2VKEA 1QVTA 3BR0A 3Q0UA 3HTJA 3Q3SA 2F07A 4AC6A 3VIBA 2PZ9A 3SFIA 3DCFA 3NPIA 4V2FA 2XRLA 2TRTA 2NP5A 2DG7A 3G7RA 2G7GA 2PBXA 5J1RA 2FJ1A 3MVPA 5FKOA 4D5FA 2OERA 2VPRA 4YZEA 5CXIA 5H9TA 3QQAA 5K7FA 5J3LA 2RASA 3B81A 3LJLA 3O8HA 3WHCA 4AUXA 4MK6A 5FKLA 3ZQIA 5D18A 2XGCA 4PXIA 2ZB9A 5EZGA 4AF5A 2UXHA 3FRQA 2TCTA 1Z77A 3ZQHA 5K58A 3G56A 4MXMA 5F04A 2QOPA 5FHPA 2QTQA 2XB5A 3CRJA 3BRUA 3BR2A 1JT0A 3CJDA 3O60A 3C07A 2XPWA 2UXOA 2OI8A 3CWRA 3BR6A 2FD5A 3F0CA 3G1MA 1U9OA 3KZ9A 5DAJA 5FKKA 1RKWA 2UXUA 5GPAA 2ZCMA 3TP3A 1JTYA 2OF7A 2X6OA 4ABZA 3B6CA 2UXPA 3BTJA 4NN1A 3IH4A 2FBQA 4M3GA 1UI5A 4GCTA 4B3AA 3AQSA 4JNNA 3VW0A 3PASA 5CXGA 4HKUA 3VUQA 2QWTA 3WHBA 3ZQGA 4GCLA 2FX0A 2UXIA 3NXCA 2QKOA 5C4YA 2RAEA 2WV1A 2XGEA 5HAWA 1ZK8A 1U9NA 2IBDA 5GPCA 2Y30A 2Q24A 3LWJA 3LSRA 1RKTA 2Y2ZA 2WUIA 2ZOZA 2O7TA 3IH2A 3FIWA 3LOCA 2G7LA 5D19A 3S5RA 4M3DA 4UDSA 3PPBA 3O8GA 3VP5A 5FMPA 4V2GA 1T33A 3KKCA 3DEWA 3ZQFA 3GEUA 5J1UA 1JTXA 3BQZA 4DW6A 3EGQA 2V57A 3VVXA 4G12A 2WGBA 3IUVA 3LSJA 1ORKA 1A6IA 2GUHA 3Q0VA 3V78A 3BCGA 2ZCNA 2ID3A 5F1JA 2W53A 2GFNA 5EYRA 3ZQLA 2NS7A 4JL3A 2NP3A 4KWAA 5FKNA 3E7QA 3HTAA 5FGLA 3VOKA 5IP6A 3G1OA 1ZKGA 2GENA 3COLA 2REKA 1JUMA 3BT9A 4M3EA 3BTIA 2XGDA 2EH3A 5F0CA 3BNIA 2DG8A 3ANPA 1JUPA 4CGRA 3HTIA 5EFYA 4GFKA 3JSJA 3VOXA 2NS8A 3BR3A 3V6GA 4ME9A 2QCOA 4XK4A 5F0FA 2O7OA 4D7NA 3EUPA 4D5CA 2NX4A 2GBYA 3DPJA 4W1UA 3ON2A 4M3FA 2HYJA 3IH3A 2FQ4A 5AQCA 2DTZA 3MNLA 3QBMA 2IEKA 3BJBA 3G1LA 3HTHA 3HIMA 2HXIA 2Y31A 4NELA 3F1BA 3AQTA 4ICHA 4M3BA 4L62A 3FK7A 3VVZA 3SDGA 3Q0WA 3LHQA 3FK6A 3T6NA 4JKZA 3BR1A 2G7SA 5HSZA 5GP9A 2RHAA 2G0EA 1QPIA 3VW2A 4GFLA 4W97A 4I6ZA 5F08A 2VKVA 4X1EA 4AC0A 2JJ7A 5F0HA 3KKDA 3ANGA 1Z0XA 3RH2A 3QKXA 3BHQA 2HKUA 3ON4A 3B6AA 3CDLA 2HYTA 2I10A 1JT6A 3HE0A 3VPRA 3TP0A 1UI6A 2YVEA 4D7MA 3NNRA 3RD3A 2XDNA 3VW1A 2ZCXA 5CW8A 3P9TA 1BJZA 1JUSA 4GCKA 5IOYA 4ACIA 2IAIA 5FKMA 2QIBA 5IPAA 4I76A 2ID6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XPV A;  3BR5 A;  1T56 A;  3QPL A;  1SGM A;  2IU5 A;  2OPT A;  5IOZ A;  5K7H A;  3KNW A;  5EZH A;  3CCY A;  2G3B A;  2HQ5 A;  5K7Z A;  2D6Y A;  2ZOY A;  3NI7 A;  3HGY A;  5HBU A;  1QVU A;  3C2B A;  3BTL A;  2X9D A;  2YVH A;  3HGG A;  4JYK A;  5J1Y A;  2JK3 A;  3NRG A;  4MO7 A;  3VVY A;  5D1R A;  2HXO A;  3LSP A;  3GZI A;  3QPS A;  4B1R A;  2XPU A;  3BTC A;  3PM1 A;  3BQY A;  5F27 A;  1VI0 A;  1RPW A;  2VKE A;  1QVT A;  3BR0 A;  3Q0U A;  3HTJ A;  3Q3S A;  2F07 A;  4AC6 A;  3VIB A;  2PZ9 A;  3SFI A;  3DCF A;  3NPI A;  4V2F A;  2XRL A;  2TRT A;  2NP5 A;  2DG7 A;  3G7R A;  2G7G A;  2PBX A;  5J1R A;  2FJ1 A;  3MVP A;  5FKO A;  4D5F A;  2OER A;  2VPR A;  4YZE A;  5CXI A;  5H9T A;  3QQA A;  5K7F A;  5J3L A;  2RAS A;  3B81 A;  3LJL A;  3O8H A;  3WHC A;  4AUX A;  4MK6 A;  5FKL A;  3ZQI A;  5D18 A;  2XGC A;  4PXI A;  2ZB9 A;  5EZG A;  4AF5 A;  2UXH A;  3FRQ A;  2TCT A;  1Z77 A;  3ZQH A;  5K58 A;  3G56 A;  4MXM A;  5F04 A;  2QOP A;  5FHP A;  2QTQ A;  2XB5 A;  3CRJ A;  3BRU A;  3BR2 A;  1JT0 A;  3CJD A;  3O60 A;  3C07 A;  2XPW A;  2UXO A;  2OI8 A;  3CWR A;  3BR6 A;  2FD5 A;  3F0C A;  3G1M A;  1U9O A;  3KZ9 A;  5DAJ A;  5FKK A;  1RKW A;  2UXU A;  5GPA A;  2ZCM A;  3TP3 A;  1JTY A;  2OF7 A;  2X6O A;  4ABZ A;  3B6C A;  2UXP A;  3BTJ A;  4NN1 A;  3IH4 A;  2FBQ A;  4M3G A;  1UI5 A;  4GCT A;  4B3A A;  3AQS A;  4JNN A;  3VW0 A;  3PAS A;  5CXG A;  4HKU A;  3VUQ A;  2QWT A;  3WHB A;  3ZQG A;  4GCL A;  2FX0 A;  2UXI A;  3NXC A;  2QKO A;  5C4Y A;  2RAE A;  2WV1 A;  2XGE A;  5HAW A;  1ZK8 A;  1U9N A;  2IBD A;  5GPC A;  2Y30 A;  2Q24 A;  3LWJ A;  3LSR A;  1RKT A;  2Y2Z A;  2WUI A;  2ZOZ A;  2O7T A;  3IH2 A;  3FIW A;  3LOC A;  2G7L A;  5D19 A;  3S5R A;  4M3D A;  4UDS A;  3PPB A;  3O8G A;  3VP5 A;  5FMP A;  4V2G A;  1T33 A;  3KKC A;  3DEW A;  3ZQF A;  3GEU A;  5J1U A;  1JTX A;  3BQZ A;  4DW6 A;  3EGQ A;  2V57 A;  3VVX A;  4G12 A;  2WGB A;  3IUV A;  3LSJ A;  1ORK A;  1A6I A;  2GUH A;  3Q0V A;  3V78 A;  3BCG A;  2ZCN A;  2ID3 A;  5F1J A;  2W53 A;  2GFN A;  5EYR A;  3ZQL A;  2NS7 A;  4JL3 A;  2NP3 A;  4KWA A;  5FKN A;  3E7Q A;  3HTA A;  5FGL A;  3VOK A;  5IP6 A;  3G1O A;  1ZKG A;  2GEN A;  3COL A;  2REK A;  1JUM A;  3BT9 A;  4M3E A;  3BTI A;  2XGD A;  2EH3 A;  5F0C A;  3BNI A;  2DG8 A;  3ANP A;  1JUP A;  4CGR A;  3HTI A;  5EFY A;  4GFK A;  3JSJ A;  3VOX A;  2NS8 A;  3BR3 A;  3V6G A;  4ME9 A;  2QCO A;  4XK4 A;  5F0F A;  2O7O A;  4D7N A;  3EUP A;  4D5C A;  2NX4 A;  2GBY A;  3DPJ A;  4W1U A;  3ON2 A;  4M3F A;  2HYJ A;  3IH3 A;  2FQ4 A;  5AQC A;  2DTZ A;  3MNL A;  3QBM A;  2IEK A;  3BJB A;  3G1L A;  3HTH A;  3HIM A;  2HXI A;  2Y31 A;  4NEL A;  3F1B A;  3AQT A;  4ICH A;  4M3B A;  4L62 A;  3FK7 A;  3VVZ A;  3SDG A;  3Q0W A;  3LHQ A;  3FK6 A;  3T6N A;  4JKZ A;  3BR1 A;  2G7S A;  5HSZ A;  5GP9 A;  2RHA A;  2G0E A;  1QPI A;  3VW2 A;  4GFL A;  4W97 A;  4I6Z A;  5F08 A;  2VKV A;  4X1E A;  4AC0 A;  2JJ7 A;  5F0H A;  3KKD A;  3ANG A;  1Z0X A;  3RH2 A;  3QKX A;  3BHQ A;  2HKU A;  3ON4 A;  3B6A A;  3CDL A;  2HYT A;  2I10 A;  1JT6 A;  3HE0 A;  3VPR A;  3TP0 A;  1UI6 A;  2YVE A;  4D7M A;  3NNR A;  3RD3 A;  2XDN A;  3VW1 A;  2ZCX A;  5CW8 A;  3P9T A;  1BJZ A;  1JUS A;  4GCK A;  5IOY A;  4ACI A;  2IAI A;  5FKM A;  2QIB A;  5IPA A;  4I76 A;  2ID6 A; 
#chains in the Genus database with same CATH topology
 2XPV A;  3BR5 A;  1T56 A;  3QPL A;  1SGM A;  2IU5 A;  2OPT A;  5IOZ A;  5K7H A;  3KNW A;  3DU5 A;  5EZH A;  3CCY A;  2G3B A;  2HQ5 A;  5K7Z A;  2D6Y A;  2ZOY A;  3NI7 A;  3HGY A;  5HBU A;  1QVU A;  3C2B A;  3BTL A;  2X9D A;  2YVH A;  3HGG A;  4JYK A;  5J1Y A;  2B1E A;  2JK3 A;  3NRG A;  4MO7 A;  3VVY A;  5D1R A;  2HXO A;  3LSP A;  3GZI A;  3QPS A;  4B1R A;  2XPU A;  2R7U A;  3BTC A;  3PM1 A;  3BQY A;  3FHN A;  5F27 A;  1VI0 A;  1RPW A;  2VKE A;  1QVT A;  3BR0 A;  3Q0U A;  3HTJ A;  3Q3S A;  2F07 A;  4AC6 A;  3VIB A;  2PZ9 A;  3SFI A;  3DCF A;  3NPI A;  4V2F A;  2XRL A;  2TRT A;  2NP5 A;  2DG7 A;  3G7R A;  2G7G A;  2PBX A;  5J1R A;  2FJ1 A;  3MVP A;  5FKO A;  4D5F A;  2OER A;  2VPR A;  4YZE A;  5CXI A;  5H9T A;  4C2M A;  3QQA A;  5K7F A;  5J3L A;  2RAS A;  3B81 A;  3LJL A;  3O8H A;  3WHC A;  4AUX A;  4MK6 A;  5FKL A;  3ZQI A;  5D18 A;  2XGC A;  2R7R A;  4PXI A;  2ZB9 A;  5EZG A;  4AF5 A;  2UXH A;  4U9L A;  3FRQ A;  2R7O A;  2TCT A;  1Z77 A;  3ZQH A;  5K58 A;  3G56 A;  4MXM A;  5F04 A;  2QOP A;  5FHP A;  2QTQ A;  2XB5 A;  2PFV A;  3CRJ A;  3BRU A;  3BR2 A;  1JT0 A;  3CJD A;  3O60 A;  3C07 A;  2XPW A;  2UXO A;  2OI8 A;  3CWR A;  3BR6 A;  2FD5 A;  3F0C A;  3G1M A;  1U9O A;  3KZ9 A;  5DAJ A;  5FKK A;  1RKW A;  2UXU A;  5GPA A;  2ZCM A;  4U9N A;  3TP3 A;  1JTY A;  2OF7 A;  2X6O A;  4ABZ A;  3B6C A;  2R7X A;  2UXP A;  3BTJ A;  4NN1 A;  3IH4 A;  2FBQ A;  5CQG A;  4M3G A;  1UI5 A;  3SWH A;  4GCT A;  4DVY P;  4B3A A;  3AQS A;  2YVX A;  4JNN A;  3VW0 A;  3PAS A;  5CXG A;  4HKU A;  3VUQ A;  2QWT A;  3WHB A;  3ZQG A;  4GCL A;  2FX0 A;  2UXI A;  3NXC A;  2QKO A;  5C4Y A;  2RAE A;  2WV1 A;  2XGE A;  5HAW A;  1ZK8 A;  1U9N A;  2IBD A;  5GPC A;  2Y30 A;  2Q24 A;  3LWJ A;  3LSR A;  1RKT A;  2Y2Z A;  2WUI A;  2ZOZ A;  2O7T A;  3IH2 A;  3FIW A;  3LOC A;  3K8P C;  2G7L A;  5D19 A;  3S5R A;  4M3D A;  4UDS A;  3PPB A;  3O8G A;  3VP5 A;  5FMP A;  4V2G A;  1T33 A;  3KKC A;  3DEW A;  3ZQF A;  2FJI 1;  3GEU A;  5J1U A;  1JTX A;  3BQZ A;  4DW6 A;  3EGQ A;  2V57 A;  3VVX A;  4G12 A;  2WGB A;  3IUV A;  3LSJ A;  1ORK A;  1A6I A;  2GUH A;  3Q0V A;  3V78 A;  3KYL A;  2R7T A;  3BCG A;  2ZCN A;  2ID3 A;  5F1J A;  2W53 A;  2GFN A;  5EYR A;  3ZQL A;  2NS7 A;  4JL3 A;  2NP3 A;  4KWA A;  5FKN A;  3E7Q A;  3HTA A;  5FGL A;  3VOK A;  5IP6 A;  3G1O A;  1ZKG A;  2GEN A;  3COL A;  2REK A;  1JUM A;  3BT9 A;  4M3E A;  3BTI A;  2XGD A;  2ZY9 A;  2A2F X;  2EH3 A;  5F0C A;  3BNI A;  2DG8 A;  3ANP A;  1JUP A;  4CGR A;  3HTI A;  5EFY A;  4GFK A;  3JSJ A;  3VOX A;  2NS8 A;  3NS4 A;  3BR3 A;  3V6G A;  4ME9 A;  2QCO A;  4XK4 A;  4OD5 A;  5F0F A;  2R7S A;  2O7O A;  4D7N A;  3EUP A;  4D5C A;  3VTI A;  2NX4 A;  2GBY A;  3DPJ A;  4W1U A;  3ON2 A;  4M3F A;  2HYJ A;  3IH3 A;  2FQ4 A;  5AQC A;  2B3W A;  2DTZ A;  3MNL A;  3QBM A;  2IEK A;  3BJB A;  3G1L A;  3HTH A;  3HIM A;  2HXI A;  2Y31 A;  2R7V A;  4NEL A;  3F1B A;  3AQT A;  4ICH A;  4M3B A;  4WIB A;  4L62 A;  3FK7 A;  3VVZ A;  3SDG A;  3Q0W A;  3LHQ A;  2R7Q A;  3FK6 A;  3T6N A;  4JKZ A;  3BR1 A;  2G7S A;  5HSZ A;  5GP9 A;  2RHA A;  2G0E A;  1QPI A;  3VW2 A;  4GFL A;  4W97 A;  4I6Z A;  5F08 A;  2VKV A;  4X1E A;  4AC0 A;  2JJ7 A;  5F0H A;  3KKD A;  3ANG A;  1Z0X A;  3RH2 A;  3QKX A;  3BHQ A;  2HKU A;  3ON4 A;  3B6A A;  3CDL A;  2HYT A;  2I10 A;  1JT6 A;  3DU6 A;  3HE0 A;  3VPR A;  3TP0 A;  1UI6 A;  2YVE A;  4D7M A;  3NNR A;  3RD3 A;  2XDN A;  3VW1 A;  2ZCX A;  5CW8 A;  3P9T A;  1BJZ A;  1JUS A;  4GCK A;  5IOY A;  4ACI A;  2IAI A;  5FKM A;  2R7W A;  2QIB A;  5IPA A;  4IRV A;  4OD4 A;  4I76 A;  2ID6 A; 
#chains in the Genus database with same CATH homology
 2XPV A;  3BR5 A;  1T56 A;  3QPL A;  1SGM A;  2IU5 A;  2OPT A;  5IOZ A;  5K7H A;  3KNW A;  5EZH A;  3CCY A;  2G3B A;  2HQ5 A;  5K7Z A;  2D6Y A;  2ZOY A;  3NI7 A;  3HGY A;  5HBU A;  1QVU A;  3C2B A;  3BTL A;  2X9D A;  2YVH A;  3HGG A;  4JYK A;  5J1Y A;  2JK3 A;  3NRG A;  4MO7 A;  3VVY A;  5D1R A;  2HXO A;  3LSP A;  3GZI A;  3QPS A;  4B1R A;  2XPU A;  3BTC A;  3PM1 A;  3BQY A;  5F27 A;  1VI0 A;  1RPW A;  2VKE A;  1QVT A;  3BR0 A;  3Q0U A;  3HTJ A;  3Q3S A;  2F07 A;  4AC6 A;  3VIB A;  2PZ9 A;  3SFI A;  3DCF A;  3NPI A;  4V2F A;  2XRL A;  2TRT A;  2NP5 A;  2DG7 A;  3G7R A;  2G7G A;  2PBX A;  5J1R A;  2FJ1 A;  3MVP A;  5FKO A;  4D5F A;  2OER A;  2VPR A;  4YZE A;  5CXI A;  5H9T A;  3QQA A;  5K7F A;  5J3L A;  2RAS A;  3B81 A;  3LJL A;  3O8H A;  3WHC A;  4AUX A;  4MK6 A;  5FKL A;  3ZQI A;  5D18 A;  2XGC A;  4PXI A;  2ZB9 A;  5EZG A;  4AF5 A;  2UXH A;  3FRQ A;  2TCT A;  1Z77 A;  3ZQH A;  5K58 A;  3G56 A;  4MXM A;  5F04 A;  2QOP A;  5FHP A;  2QTQ A;  2XB5 A;  3CRJ A;  3BRU A;  3BR2 A;  1JT0 A;  3CJD A;  3O60 A;  3C07 A;  2XPW A;  2UXO A;  2OI8 A;  3CWR A;  3BR6 A;  2FD5 A;  3F0C A;  3G1M A;  1U9O A;  3KZ9 A;  5DAJ A;  5FKK A;  1RKW A;  2UXU A;  5GPA A;  2ZCM A;  3TP3 A;  1JTY A;  2OF7 A;  2X6O A;  4ABZ A;  3B6C A;  2UXP A;  3BTJ A;  4NN1 A;  3IH4 A;  2FBQ A;  4M3G A;  1UI5 A;  4GCT A;  4B3A A;  3AQS A;  4JNN A;  3VW0 A;  3PAS A;  5CXG A;  4HKU A;  3VUQ A;  2QWT A;  3WHB A;  3ZQG A;  4GCL A;  2FX0 A;  2UXI A;  3NXC A;  2QKO A;  5C4Y A;  2RAE A;  2WV1 A;  2XGE A;  5HAW A;  1ZK8 A;  1U9N A;  2IBD A;  5GPC A;  2Y30 A;  2Q24 A;  3LWJ A;  3LSR A;  1RKT A;  2Y2Z A;  2WUI A;  2ZOZ A;  2O7T A;  3IH2 A;  3FIW A;  3LOC A;  2G7L A;  5D19 A;  3S5R A;  4M3D A;  4UDS A;  3PPB A;  3O8G A;  3VP5 A;  5FMP A;  4V2G A;  1T33 A;  3KKC A;  3DEW A;  3ZQF A;  3GEU A;  5J1U A;  1JTX A;  3BQZ A;  4DW6 A;  3EGQ A;  2V57 A;  3VVX A;  4G12 A;  2WGB A;  3IUV A;  3LSJ A;  1ORK A;  1A6I A;  2GUH A;  3Q0V A;  3V78 A;  3BCG A;  2ZCN A;  2ID3 A;  5F1J A;  2W53 A;  2GFN A;  5EYR A;  3ZQL A;  2NS7 A;  4JL3 A;  2NP3 A;  4KWA A;  5FKN A;  3E7Q A;  3HTA A;  5FGL A;  3VOK A;  5IP6 A;  3G1O A;  1ZKG A;  2GEN A;  3COL A;  2REK A;  1JUM A;  3BT9 A;  4M3E A;  3BTI A;  2XGD A;  2EH3 A;  5F0C A;  3BNI A;  2DG8 A;  3ANP A;  1JUP A;  4CGR A;  3HTI A;  5EFY A;  4GFK A;  3JSJ A;  3VOX A;  2NS8 A;  3BR3 A;  3V6G A;  4ME9 A;  2QCO A;  4XK4 A;  5F0F A;  2O7O A;  4D7N A;  3EUP A;  4D5C A;  2NX4 A;  2GBY A;  3DPJ A;  4W1U A;  3ON2 A;  4M3F A;  2HYJ A;  3IH3 A;  2FQ4 A;  5AQC A;  2DTZ A;  3MNL A;  3QBM A;  2IEK A;  3BJB A;  3G1L A;  3HTH A;  3HIM A;  2HXI A;  2Y31 A;  4NEL A;  3F1B A;  3AQT A;  4ICH A;  4M3B A;  4L62 A;  3FK7 A;  3VVZ A;  3SDG A;  3Q0W A;  3LHQ A;  3FK6 A;  3T6N A;  4JKZ A;  3BR1 A;  2G7S A;  5HSZ A;  5GP9 A;  2RHA A;  2G0E A;  1QPI A;  3VW2 A;  4GFL A;  4W97 A;  4I6Z A;  5F08 A;  2VKV A;  4X1E A;  4AC0 A;  2JJ7 A;  5F0H A;  3KKD A;  3ANG A;  1Z0X A;  3RH2 A;  3QKX A;  3BHQ A;  2HKU A;  3ON4 A;  3B6A A;  3CDL A;  2HYT A;  2I10 A;  1JT6 A;  3HE0 A;  3VPR A;  3TP0 A;  1UI6 A;  2YVE A;  4D7M A;  3NNR A;  3RD3 A;  2XDN A;  3VW1 A;  2ZCX A;  5CW8 A;  3P9T A;  1BJZ A;  1JUS A;  4GCK A;  5IOY A;  4ACI A;  2IAI A;  5FKM A;  2QIB A;  5IPA A;  4I76 A;  2ID6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...