3S5RA

Crystal structure of a putative transcriptional regulator of the tetr family (syn_02108) from syntrophus aciditrophicus at 2.60 a resolution
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
197
structure length
197
Chain Sequence
b'KNTRELLLDAATTLFAEQGIAATTMAEIAASVGVNPAMIHYYFKTRDSLLDTIIEERIGRIIDMIWEPVTGEEDDPLIMVRDLVNRIVNTCETMLWLPSLWIREIVNEGGALREKMLNNIPIDKMNKFSAKIAEGQKQGVINSGIDSRLLIGSIIGLTMLPLATAKLRDQIPTMKGLSSEDIVCHVTALLFTGLTNP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator TetR family
molecule tags Dna binding protein
source organism Syntrophus aciditrophicus
publication title Crystal structure of a Putative transcriptional regulator of the TetR family (SYN_02108) from Syntrophus aciditrophicus SB at 2.60 A resolution
rcsb
total genus 57
structure length 197
sequence length 197
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3s5rA00
2V57A 3CRJA 1U9OA 5F1JA 2WV1A 2W53A 1JTYA 3VVYA 3T6NA 3CCYA 1QPIA 3Q0WA 2X6OA 3IH2A 2OF7A 3NXCA 2YVHA 1BJZA 3NI7A 3LWJA 3NPIA 2QCOA 3QBMA 3ZQIA 3VOXA 2ZCNA 2DG7A 4CGRA 5FKKA 3HTIA 3VOKA 2Q24A 3LJLA 2FX0A 1Z77A 4JL3A 3VW0A 1JTXA 3E7QA 4M3FA 2HQ5A 3DCFA 2Y31A 4ABZA 1VI0A 4V2FA 4D5CA 2QTQA 5HBUA 3FIWA 3BNIA 4M3DA 3PASA 3G7RA 2Y30A 2PBXA 1T56A 3QPSA 2HXOA 2ZB9A 3NNRA 3FK6A 2OPTA 3MVPA 3KNWA 5CW8A 3BR5A 5CXGA 4D7MA 2NS8A 3Q0VA 3F0CA 3HGYA 1ORKA 2ZCMA 3MNLA 3G56A 1U9NA 2EH3A 3O8GA 3Q0UA 3C2BA 4V2GA 3BR0A 2G7LA 4JYKA 4YZEA 4I6ZA 3TP3A 2NP3A 3WHCA 3ON2A 1RPWA 1JT6A 5DAJA 3WHBA 2NS7A 2RHAA 5CXIA 3QKXA 2JK3A 2VKVA 5J1UA 5FMPA 2TCTA 2HXIA 2ID6A 3AQSA 3VVZA 3HGGA 4D5FA 2OI8A 3KKDA 3VUQA 2D6YA 3P9TA 3PM1A 4W97A 4UDSA 4ME9A 4AC6A 3V6GA 2HYJA 1A6IA 3IUVA 3HTHA 2FJ1A 5IP6A 5K7HA 3ZQFA 1SGMA 3DEWA 4AF5A 4AC0A 4GFLA 3HIMA 2UXPA 2VPRA 2RAEA 5FGLA 3DPJA 3GZIA 2GUHA 3EUPA 5IPAA 5FKNA 5EYRA 4GCLA 3G1MA 5HAWA 3C07A 3BQZA 2QIBA 3CJDA 5EZGA 3ON4A 2GENA 1T33A 2FBQA 5IOYA 2RASA 3KKCA 3IH3A 3LSRA 2XGCA 3F1BA 5K7FA 2VKEA 5J1YA 3QPLA 2WGBA 2ZOYA 4HKUA 1JUMA 1JUPA 5J1RA 4GCKA 1RKWA 3LOCA 2IAIA 2XDNA 3SFIA 2YVEA 4MXMA 5HSZA 3BR1A 3B6AA 2FQ4A 4W1UA 3BRUA 3ZQLA 3ZQGA 1QVUA 3ANPA 2HKUA 3BTLA 5IOZA 4NN1A 2NP5A 2IEKA 5FKOA 3CWRA 3EGQA 2ZOZA 4M3EA 1RKTA 2I10A 3COLA 3AQTA 3V78A 3HTJA 1Z0XA 3BR3A 1JT0A 3VVXA 3BTJA 2FD5A 4PXIA 2XPWA 4MO7A 3NRGA 2GBYA 5GP9A 2XGEA 4X1EA 2F07A 5F08A 3SDGA 4JKZA 5D1RA 2IBDA 2UXHA 3O60A 5F04A 2NX4A 2ZCXA 3HTAA 1JUSA 3BT9A 3O8HA 4JNNA 4L62A 5FHPA 5H9TA 3S5RA 5FKMA 3GEUA 5D18A 1ZKGA 3LHQA 2XPVA 2DG8A 3KZ9A 3BR6A 5F27A 5C4YA 4G12A 2HYTA 5J3LA 3LSJA 3BQYA 3RD3A 3ZQHA 2GFNA 3BTIA 2OERA 2Y2ZA 4M3BA 4D7NA 2UXUA 2XGDA 2DTZA 2QWTA 5F0CA 2UXOA 4I76A 2G3BA 3JSJA 3BTCA 2O7OA 4B3AA 4DW6A 3G1OA 4NELA 3HE0A 3ANGA 3PPBA 2QOPA 2XRLA 2QKOA 4GCTA 2UXIA 4B1RA 5F0HA 3IH4A 2G0EA 3VW2A 3FK7A 5D19A 2TRTA 5FKLA 2IU5A 2WUIA 2PZ9A 3RH2A 4XK4A 3VP5A 2XPUA 3QQAA 1QVTA 5EZHA 5GPCA 2G7GA 5GPAA 3TP0A 2X9DA 3BCGA 3VIBA 4KWAA 3BR2A 3LSPA 1UI5A 2O7TA 3CDLA 3BHQA 4AUXA 2ID3A 5AQCA 3VW1A 4M3GA 4GFKA 2JJ7A 5K7ZA 3Q3SA 4ICHA 3G1LA 4MK6A 3B6CA 2G7SA 4ACIA 2XB5A 3VPRA 2REKA 5K58A 3BJBA 1ZK8A 5F0FA 1UI6A 3B81A 3FRQA 5EFYA
chains in the Genus database with same CATH superfamily
2V57A 3CRJA 1U9OA 5F1JA 2WV1A 2W53A 1JTYA 3VVYA 3T6NA 3CCYA 1QPIA 3DU6A 3Q0WA 2R7RA 2X6OA 3IH2A 2OF7A 3NXCA 2YVHA 1BJZA 3NI7A 3LWJA 3NPIA 3K8PC 2QCOA 3QBMA 3ZQIA 3VOXA 2ZCNA 2DG7A 4CGRA 5FKKA 3HTIA 3VOKA 2Q24A 3LJLA 2FX0A 1Z77A 4JL3A 3VW0A 1JTXA 3E7QA 4M3FA 2HQ5A 3DCFA 2Y31A 4ABZA 1VI0A 4V2FA 4D5CA 2QTQA 5HBUA 3FIWA 4IRVA 4OD4A 3BNIA 4M3DA 3PASA 2R7WA 3G7RA 2Y30A 2PBXA 2R7QA 2R7SA 1T56A 3QPSA 2HXOA 2ZB9A 3NNRA 3FK6A 2OPTA 3MVPA 3KNWA 5CW8A 3BR5A 5CXGA 4D7MA 2NS8A 3Q0VA 3DU5A 3F0CA 3HGYA 1ORKA 2ZCMA 3MNLA 3G56A 1U9NA 2EH3A 3O8GA 3Q0UA 3C2BA 4V2GA 2FJI1 3BR0A 2G7LA 4JYKA 4U9NA 4YZEA 4I6ZA 3TP3A 2NP3A 3WHCA 3ON2A 1RPWA 1JT6A 5DAJA 3WHBA 2NS7A 2RHAA 5CXIA 3QKXA 2JK3A 2VKVA 5J1UA 5FMPA 2TCTA 2HXIA 2ID6A 3AQSA 3VVZA 3HGGA 4D5FA 2OI8A 3KKDA 3VUQA 2D6YA 3P9TA 3PM1A 4W97A 4UDSA 4ME9A 4AC6A 3V6GA 3NS4A 2HYJA 1A6IA 3IUVA 3HTHA 2FJ1A 5IP6A 5K7HA 3ZQFA 1SGMA 3DEWA 4AF5A 4AC0A 4GFLA 3HIMA 2UXPA 2VPRA 2RAEA 5FGLA 3DPJA 3GZIA 2GUHA 3EUPA 5IPAA 5FKNA 5EYRA 2R7XA 4GCLA 3G1MA 5HAWA 4DVYP 3C07A 3BQZA 2QIBA 3CJDA 2PFVA 5EZGA 3ON4A 2GENA 1T33A 2FBQA 5IOYA 2RASA 3KKCA 3IH3A 3LSRA 2XGCA 3F1BA 5K7FA 2VKEA 5J1YA 3QPLA 2WGBA 2ZOYA 4HKUA 1JUMA 2R7OA 1JUPA 5J1RA 4GCKA 1RKWA 3FHNA 2YVXA 3LOCA 2IAIA 2A2FX 2XDNA 3SFIA 2YVEA 4MXMA 5HSZA 3BR1A 3B6AA 4OD5A 2FQ4A 4W1UA 3BRUA 3ZQLA 3ZQGA 3KYLA 1QVUA 3ANPA 2HKUA 3BTLA 2R7TA 5IOZA 4NN1A 3VTIA 2NP5A 2IEKA 5FKOA 3CWRA 3EGQA 2ZOZA 4M3EA 2ZY9A 4C2MA 1RKTA 2I10A 3COLA 3AQTA 3V78A 3HTJA 1Z0XA 3BR3A 1JT0A 3VVXA 3BTJA 2FD5A 4PXIA 2XPWA 4MO7A 3NRGA 2GBYA 5GP9A 2XGEA 4X1EA 2F07A 5F08A 3SDGA 4JKZA 5D1RA 2IBDA 2UXHA 3O60A 5F04A 2NX4A 2ZCXA 3HTAA 1JUSA 3BT9A 3O8HA 4JNNA 4L62A 5FHPA 5H9TA 3S5RA 5FKMA 3GEUA 5D18A 1ZKGA 3LHQA 2XPVA 2DG8A 3KZ9A 3BR6A 5F27A 5C4YA 4G12A 2HYTA 5J3LA 3LSJA 3BQYA 3RD3A 3ZQHA 2GFNA 3BTIA 2OERA 2Y2ZA 4M3BA 4D7NA 2R7VA 2UXUA 2XGDA 2DTZA 2QWTA 5F0CA 2UXOA 4I76A 2G3BA 5CQGA 3JSJA 3BTCA 2O7OA 4B3AA 4DW6A 3G1OA 4NELA 3HE0A 3ANGA 3PPBA 2QOPA 2XRLA 2QKOA 2B3WA 4GCTA 2UXIA 4B1RA 5F0HA 3IH4A 2G0EA 3VW2A 3FK7A 5D19A 2TRTA 5FKLA 2IU5A 2WUIA 2R7UA 2PZ9A 3RH2A 2B1EA 4XK4A 3VP5A 2XPUA 3QQAA 4WIBA 1QVTA 5EZHA 5GPCA 2G7GA 5GPAA 3TP0A 2X9DA 3BCGA 4U9LA 3VIBA 4KWAA 3BR2A 1UI5A 3LSPA 2O7TA 3CDLA 3BHQA 4AUXA 2ID3A 5AQCA 3VW1A 4M3GA 4GFKA 2JJ7A 5K7ZA 3Q3SA 4ICHA 3G1LA 4MK6A 3B6CA 2G7SA 4ACIA 2XB5A 3VPRA 3SWHA 2REKA 5K58A 3BJBA 1ZK8A 5F0FA 1UI6A 3B81A 3FRQA 5EFYA
chains in the Genus database with same CATH topology
2V57A 3CRJA 1U9OA 5F1JA 2WV1A 2W53A 1JTYA 3VVYA 3T6NA 3CCYA 1QPIA 3Q0WA 2X6OA 3IH2A 2OF7A 3NXCA 2YVHA 1BJZA 3NI7A 3LWJA 3NPIA 2QCOA 3QBMA 3ZQIA 3VOXA 2ZCNA 2DG7A 4CGRA 5FKKA 3HTIA 3VOKA 2Q24A 3LJLA 2FX0A 1Z77A 4JL3A 3VW0A 1JTXA 3E7QA 4M3FA 2HQ5A 3DCFA 2Y31A 4ABZA 1VI0A 4V2FA 4D5CA 2QTQA 5HBUA 3FIWA 3BNIA 4M3DA 3PASA 3G7RA 2Y30A 2PBXA 1T56A 3QPSA 2HXOA 2ZB9A 3NNRA 3FK6A 2OPTA 3MVPA 3KNWA 5CW8A 3BR5A 5CXGA 4D7MA 2NS8A 3Q0VA 3F0CA 3HGYA 1ORKA 2ZCMA 3MNLA 3G56A 1U9NA 2EH3A 3O8GA 3Q0UA 3C2BA 4V2GA 3BR0A 2G7LA 4JYKA 4YZEA 4I6ZA 3TP3A 2NP3A 3WHCA 3ON2A 1RPWA 1JT6A 5DAJA 3WHBA 2NS7A 2RHAA 5CXIA 3QKXA 2JK3A 2VKVA 5J1UA 5FMPA 2TCTA 2HXIA 2ID6A 3AQSA 3VVZA 3HGGA 4D5FA 2OI8A 3KKDA 3VUQA 2D6YA 3P9TA 3PM1A 4W97A 4UDSA 4ME9A 4AC6A 3V6GA 2HYJA 1A6IA 3IUVA 3HTHA 2FJ1A 5IP6A 5K7HA 3ZQFA 1SGMA 3DEWA 4AF5A 4AC0A 4GFLA 3HIMA 2UXPA 2VPRA 2RAEA 5FGLA 3DPJA 3GZIA 2GUHA 3EUPA 5IPAA 5FKNA 5EYRA 4GCLA 3G1MA 5HAWA 3C07A 3BQZA 2QIBA 3CJDA 5EZGA 3ON4A 2GENA 1T33A 2FBQA 5IOYA 2RASA 3KKCA 3IH3A 3LSRA 2XGCA 3F1BA 5K7FA 2VKEA 5J1YA 3QPLA 2WGBA 2ZOYA 4HKUA 1JUMA 1JUPA 5J1RA 4GCKA 1RKWA 3LOCA 2IAIA 2XDNA 3SFIA 2YVEA 4MXMA 5HSZA 3BR1A 3B6AA 2FQ4A 4W1UA 3BRUA 3ZQLA 3ZQGA 1QVUA 3ANPA 2HKUA 3BTLA 5IOZA 4NN1A 2NP5A 2IEKA 5FKOA 3CWRA 3EGQA 2ZOZA 4M3EA 1RKTA 2I10A 3COLA 3AQTA 3V78A 3HTJA 1Z0XA 3BR3A 1JT0A 3VVXA 3BTJA 2FD5A 4PXIA 2XPWA 4MO7A 3NRGA 2GBYA 5GP9A 2XGEA 4X1EA 2F07A 5F08A 3SDGA 4JKZA 5D1RA 2IBDA 2UXHA 3O60A 5F04A 2NX4A 2ZCXA 3HTAA 1JUSA 3BT9A 3O8HA 4JNNA 4L62A 5FHPA 5H9TA 3S5RA 5FKMA 3GEUA 5D18A 1ZKGA 3LHQA 2XPVA 2DG8A 3KZ9A 3BR6A 5F27A 5C4YA 4G12A 2HYTA 5J3LA 3LSJA 3BQYA 3RD3A 3ZQHA 2GFNA 3BTIA 2OERA 2Y2ZA 4M3BA 4D7NA 2UXUA 2XGDA 2DTZA 2QWTA 5F0CA 2UXOA 4I76A 2G3BA 3JSJA 3BTCA 2O7OA 4B3AA 4DW6A 3G1OA 4NELA 3HE0A 3ANGA 3PPBA 2QOPA 2XRLA 2QKOA 4GCTA 2UXIA 4B1RA 5F0HA 3IH4A 2G0EA 3VW2A 3FK7A 5D19A 2TRTA 5FKLA 2IU5A 2WUIA 2PZ9A 3RH2A 4XK4A 3VP5A 2XPUA 3QQAA 1QVTA 5EZHA 5GPCA 2G7GA 5GPAA 3TP0A 2X9DA 3BCGA 3VIBA 4KWAA 3BR2A 3LSPA 1UI5A 2O7TA 3CDLA 3BHQA 4AUXA 2ID3A 5AQCA 3VW1A 4M3GA 4GFKA 2JJ7A 5K7ZA 3Q3SA 4ICHA 3G1LA 4MK6A 3B6CA 2G7SA 4ACIA 2XB5A 3VPRA 2REKA 5K58A 3BJBA 1ZK8A 5F0FA 1UI6A 3B81A 3FRQA 5EFYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V57 A;  3CRJ A;  1U9O A;  5F1J A;  2WV1 A;  2W53 A;  1JTY A;  3VVY A;  3T6N A;  3CCY A;  1QPI A;  3Q0W A;  2X6O A;  3IH2 A;  2OF7 A;  3NXC A;  2YVH A;  1BJZ A;  3NI7 A;  3LWJ A;  3NPI A;  2QCO A;  3QBM A;  3ZQI A;  3VOX A;  2ZCN A;  2DG7 A;  4CGR A;  5FKK A;  3HTI A;  3VOK A;  2Q24 A;  3LJL A;  2FX0 A;  1Z77 A;  4JL3 A;  3VW0 A;  1JTX A;  3E7Q A;  4M3F A;  2HQ5 A;  3DCF A;  2Y31 A;  4ABZ A;  1VI0 A;  4V2F A;  4D5C A;  2QTQ A;  5HBU A;  3FIW A;  3BNI A;  4M3D A;  3PAS A;  3G7R A;  2Y30 A;  2PBX A;  1T56 A;  3QPS A;  2HXO A;  2ZB9 A;  3NNR A;  3FK6 A;  2OPT A;  3MVP A;  3KNW A;  5CW8 A;  3BR5 A;  5CXG A;  4D7M A;  2NS8 A;  3Q0V A;  3F0C A;  3HGY A;  1ORK A;  2ZCM A;  3MNL A;  3G56 A;  1U9N A;  2EH3 A;  3O8G A;  3Q0U A;  3C2B A;  4V2G A;  3BR0 A;  2G7L A;  4JYK A;  4YZE A;  4I6Z A;  3TP3 A;  2NP3 A;  3WHC A;  3ON2 A;  1RPW A;  1JT6 A;  5DAJ A;  3WHB A;  2NS7 A;  2RHA A;  5CXI A;  3QKX A;  2JK3 A;  2VKV A;  5J1U A;  5FMP A;  2TCT A;  2HXI A;  2ID6 A;  3AQS A;  3VVZ A;  3HGG A;  4D5F A;  2OI8 A;  3KKD A;  3VUQ A;  2D6Y A;  3P9T A;  3PM1 A;  4W97 A;  4UDS A;  4ME9 A;  4AC6 A;  3V6G A;  2HYJ A;  1A6I A;  3IUV A;  3HTH A;  2FJ1 A;  5IP6 A;  5K7H A;  3ZQF A;  1SGM A;  3DEW A;  4AF5 A;  4AC0 A;  4GFL A;  3HIM A;  2UXP A;  2VPR A;  2RAE A;  5FGL A;  3DPJ A;  3GZI A;  2GUH A;  3EUP A;  5IPA A;  5FKN A;  5EYR A;  4GCL A;  3G1M A;  5HAW A;  3C07 A;  3BQZ A;  2QIB A;  3CJD A;  5EZG A;  3ON4 A;  2GEN A;  1T33 A;  2FBQ A;  5IOY A;  2RAS A;  3KKC A;  3IH3 A;  3LSR A;  2XGC A;  3F1B A;  5K7F A;  2VKE A;  5J1Y A;  3QPL A;  2WGB A;  2ZOY A;  4HKU A;  1JUM A;  1JUP A;  5J1R A;  4GCK A;  1RKW A;  3LOC A;  2IAI A;  2XDN A;  3SFI A;  2YVE A;  4MXM A;  5HSZ A;  3BR1 A;  3B6A A;  2FQ4 A;  4W1U A;  3BRU A;  3ZQL A;  3ZQG A;  1QVU A;  3ANP A;  2HKU A;  3BTL A;  5IOZ A;  4NN1 A;  2NP5 A;  2IEK A;  5FKO A;  3CWR A;  3EGQ A;  2ZOZ A;  4M3E A;  1RKT A;  2I10 A;  3COL A;  3AQT A;  3V78 A;  3HTJ A;  1Z0X A;  3BR3 A;  1JT0 A;  3VVX A;  3BTJ A;  2FD5 A;  4PXI A;  2XPW A;  4MO7 A;  3NRG A;  2GBY A;  5GP9 A;  2XGE A;  4X1E A;  2F07 A;  5F08 A;  3SDG A;  4JKZ A;  5D1R A;  2IBD A;  2UXH A;  3O60 A;  5F04 A;  2NX4 A;  2ZCX A;  3HTA A;  1JUS A;  3BT9 A;  3O8H A;  4JNN A;  4L62 A;  5FHP A;  5H9T A;  3S5R A;  5FKM A;  3GEU A;  5D18 A;  1ZKG A;  3LHQ A;  2XPV A;  2DG8 A;  3KZ9 A;  3BR6 A;  5F27 A;  5C4Y A;  4G12 A;  2HYT A;  5J3L A;  3LSJ A;  3BQY A;  3RD3 A;  3ZQH A;  2GFN A;  3BTI A;  2OER A;  2Y2Z A;  4M3B A;  4D7N A;  2UXU A;  2XGD A;  2DTZ A;  2QWT A;  5F0C A;  2UXO A;  4I76 A;  2G3B A;  3JSJ A;  3BTC A;  2O7O A;  4B3A A;  4DW6 A;  3G1O A;  4NEL A;  3HE0 A;  3ANG A;  3PPB A;  2QOP A;  2XRL A;  2QKO A;  4GCT A;  2UXI A;  4B1R A;  5F0H A;  3IH4 A;  2G0E A;  3VW2 A;  3FK7 A;  5D19 A;  2TRT A;  5FKL A;  2IU5 A;  2WUI A;  2PZ9 A;  3RH2 A;  4XK4 A;  3VP5 A;  2XPU A;  3QQA A;  1QVT A;  5EZH A;  5GPC A;  2G7G A;  5GPA A;  3TP0 A;  2X9D A;  3BCG A;  3VIB A;  4KWA A;  3BR2 A;  3LSP A;  1UI5 A;  2O7T A;  3CDL A;  3BHQ A;  4AUX A;  2ID3 A;  5AQC A;  3VW1 A;  4M3G A;  4GFK A;  2JJ7 A;  5K7Z A;  3Q3S A;  4ICH A;  3G1L A;  4MK6 A;  3B6C A;  2G7S A;  4ACI A;  2XB5 A;  3VPR A;  2REK A;  5K58 A;  3BJB A;  1ZK8 A;  5F0F A;  1UI6 A;  3B81 A;  3FRQ A;  5EFY A; 
#chains in the Genus database with same CATH topology
 2V57 A;  3CRJ A;  1U9O A;  5F1J A;  2WV1 A;  2W53 A;  1JTY A;  3VVY A;  3T6N A;  3CCY A;  1QPI A;  3DU6 A;  3Q0W A;  2R7R A;  2X6O A;  3IH2 A;  2OF7 A;  3NXC A;  2YVH A;  1BJZ A;  3NI7 A;  3LWJ A;  3NPI A;  3K8P C;  2QCO A;  3QBM A;  3ZQI A;  3VOX A;  2ZCN A;  2DG7 A;  4CGR A;  5FKK A;  3HTI A;  3VOK A;  2Q24 A;  3LJL A;  2FX0 A;  1Z77 A;  4JL3 A;  3VW0 A;  1JTX A;  3E7Q A;  4M3F A;  2HQ5 A;  3DCF A;  2Y31 A;  4ABZ A;  1VI0 A;  4V2F A;  4D5C A;  2QTQ A;  5HBU A;  3FIW A;  4IRV A;  4OD4 A;  3BNI A;  4M3D A;  3PAS A;  2R7W A;  3G7R A;  2Y30 A;  2PBX A;  2R7Q A;  2R7S A;  1T56 A;  3QPS A;  2HXO A;  2ZB9 A;  3NNR A;  3FK6 A;  2OPT A;  3MVP A;  3KNW A;  5CW8 A;  3BR5 A;  5CXG A;  4D7M A;  2NS8 A;  3Q0V A;  3DU5 A;  3F0C A;  3HGY A;  1ORK A;  2ZCM A;  3MNL A;  3G56 A;  1U9N A;  2EH3 A;  3O8G A;  3Q0U A;  3C2B A;  4V2G A;  2FJI 1;  3BR0 A;  2G7L A;  4JYK A;  4U9N A;  4YZE A;  4I6Z A;  3TP3 A;  2NP3 A;  3WHC A;  3ON2 A;  1RPW A;  1JT6 A;  5DAJ A;  3WHB A;  2NS7 A;  2RHA A;  5CXI A;  3QKX A;  2JK3 A;  2VKV A;  5J1U A;  5FMP A;  2TCT A;  2HXI A;  2ID6 A;  3AQS A;  3VVZ A;  3HGG A;  4D5F A;  2OI8 A;  3KKD A;  3VUQ A;  2D6Y A;  3P9T A;  3PM1 A;  4W97 A;  4UDS A;  4ME9 A;  4AC6 A;  3V6G A;  3NS4 A;  2HYJ A;  1A6I A;  3IUV A;  3HTH A;  2FJ1 A;  5IP6 A;  5K7H A;  3ZQF A;  1SGM A;  3DEW A;  4AF5 A;  4AC0 A;  4GFL A;  3HIM A;  2UXP A;  2VPR A;  2RAE A;  5FGL A;  3DPJ A;  3GZI A;  2GUH A;  3EUP A;  5IPA A;  5FKN A;  5EYR A;  2R7X A;  4GCL A;  3G1M A;  5HAW A;  4DVY P;  3C07 A;  3BQZ A;  2QIB A;  3CJD A;  2PFV A;  5EZG A;  3ON4 A;  2GEN A;  1T33 A;  2FBQ A;  5IOY A;  2RAS A;  3KKC A;  3IH3 A;  3LSR A;  2XGC A;  3F1B A;  5K7F A;  2VKE A;  5J1Y A;  3QPL A;  2WGB A;  2ZOY A;  4HKU A;  1JUM A;  2R7O A;  1JUP A;  5J1R A;  4GCK A;  1RKW A;  3FHN A;  2YVX A;  3LOC A;  2IAI A;  2A2F X;  2XDN A;  3SFI A;  2YVE A;  4MXM A;  5HSZ A;  3BR1 A;  3B6A A;  4OD5 A;  2FQ4 A;  4W1U A;  3BRU A;  3ZQL A;  3ZQG A;  3KYL A;  1QVU A;  3ANP A;  2HKU A;  3BTL A;  2R7T A;  5IOZ A;  4NN1 A;  3VTI A;  2NP5 A;  2IEK A;  5FKO A;  3CWR A;  3EGQ A;  2ZOZ A;  4M3E A;  2ZY9 A;  4C2M A;  1RKT A;  2I10 A;  3COL A;  3AQT A;  3V78 A;  3HTJ A;  1Z0X A;  3BR3 A;  1JT0 A;  3VVX A;  3BTJ A;  2FD5 A;  4PXI A;  2XPW A;  4MO7 A;  3NRG A;  2GBY A;  5GP9 A;  2XGE A;  4X1E A;  2F07 A;  5F08 A;  3SDG A;  4JKZ A;  5D1R A;  2IBD A;  2UXH A;  3O60 A;  5F04 A;  2NX4 A;  2ZCX A;  3HTA A;  1JUS A;  3BT9 A;  3O8H A;  4JNN A;  4L62 A;  5FHP A;  5H9T A;  3S5R A;  5FKM A;  3GEU A;  5D18 A;  1ZKG A;  3LHQ A;  2XPV A;  2DG8 A;  3KZ9 A;  3BR6 A;  5F27 A;  5C4Y A;  4G12 A;  2HYT A;  5J3L A;  3LSJ A;  3BQY A;  3RD3 A;  3ZQH A;  2GFN A;  3BTI A;  2OER A;  2Y2Z A;  4M3B A;  4D7N A;  2R7V A;  2UXU A;  2XGD A;  2DTZ A;  2QWT A;  5F0C A;  2UXO A;  4I76 A;  2G3B A;  5CQG A;  3JSJ A;  3BTC A;  2O7O A;  4B3A A;  4DW6 A;  3G1O A;  4NEL A;  3HE0 A;  3ANG A;  3PPB A;  2QOP A;  2XRL A;  2QKO A;  2B3W A;  4GCT A;  2UXI A;  4B1R A;  5F0H A;  3IH4 A;  2G0E A;  3VW2 A;  3FK7 A;  5D19 A;  2TRT A;  5FKL A;  2IU5 A;  2WUI A;  2R7U A;  2PZ9 A;  3RH2 A;  2B1E A;  4XK4 A;  3VP5 A;  2XPU A;  3QQA A;  4WIB A;  1QVT A;  5EZH A;  5GPC A;  2G7G A;  5GPA A;  3TP0 A;  2X9D A;  3BCG A;  4U9L A;  3VIB A;  4KWA A;  3BR2 A;  1UI5 A;  3LSP A;  2O7T A;  3CDL A;  3BHQ A;  4AUX A;  2ID3 A;  5AQC A;  3VW1 A;  4M3G A;  4GFK A;  2JJ7 A;  5K7Z A;  3Q3S A;  4ICH A;  3G1L A;  4MK6 A;  3B6C A;  2G7S A;  4ACI A;  2XB5 A;  3VPR A;  3SWH A;  2REK A;  5K58 A;  3BJB A;  1ZK8 A;  5F0F A;  1UI6 A;  3B81 A;  3FRQ A;  5EFY A; 
#chains in the Genus database with same CATH homology
 2V57 A;  3CRJ A;  1U9O A;  5F1J A;  2WV1 A;  2W53 A;  1JTY A;  3VVY A;  3T6N A;  3CCY A;  1QPI A;  3Q0W A;  2X6O A;  3IH2 A;  2OF7 A;  3NXC A;  2YVH A;  1BJZ A;  3NI7 A;  3LWJ A;  3NPI A;  2QCO A;  3QBM A;  3ZQI A;  3VOX A;  2ZCN A;  2DG7 A;  4CGR A;  5FKK A;  3HTI A;  3VOK A;  2Q24 A;  3LJL A;  2FX0 A;  1Z77 A;  4JL3 A;  3VW0 A;  1JTX A;  3E7Q A;  4M3F A;  2HQ5 A;  3DCF A;  2Y31 A;  4ABZ A;  1VI0 A;  4V2F A;  4D5C A;  2QTQ A;  5HBU A;  3FIW A;  3BNI A;  4M3D A;  3PAS A;  3G7R A;  2Y30 A;  2PBX A;  1T56 A;  3QPS A;  2HXO A;  2ZB9 A;  3NNR A;  3FK6 A;  2OPT A;  3MVP A;  3KNW A;  5CW8 A;  3BR5 A;  5CXG A;  4D7M A;  2NS8 A;  3Q0V A;  3F0C A;  3HGY A;  1ORK A;  2ZCM A;  3MNL A;  3G56 A;  1U9N A;  2EH3 A;  3O8G A;  3Q0U A;  3C2B A;  4V2G A;  3BR0 A;  2G7L A;  4JYK A;  4YZE A;  4I6Z A;  3TP3 A;  2NP3 A;  3WHC A;  3ON2 A;  1RPW A;  1JT6 A;  5DAJ A;  3WHB A;  2NS7 A;  2RHA A;  5CXI A;  3QKX A;  2JK3 A;  2VKV A;  5J1U A;  5FMP A;  2TCT A;  2HXI A;  2ID6 A;  3AQS A;  3VVZ A;  3HGG A;  4D5F A;  2OI8 A;  3KKD A;  3VUQ A;  2D6Y A;  3P9T A;  3PM1 A;  4W97 A;  4UDS A;  4ME9 A;  4AC6 A;  3V6G A;  2HYJ A;  1A6I A;  3IUV A;  3HTH A;  2FJ1 A;  5IP6 A;  5K7H A;  3ZQF A;  1SGM A;  3DEW A;  4AF5 A;  4AC0 A;  4GFL A;  3HIM A;  2UXP A;  2VPR A;  2RAE A;  5FGL A;  3DPJ A;  3GZI A;  2GUH A;  3EUP A;  5IPA A;  5FKN A;  5EYR A;  4GCL A;  3G1M A;  5HAW A;  3C07 A;  3BQZ A;  2QIB A;  3CJD A;  5EZG A;  3ON4 A;  2GEN A;  1T33 A;  2FBQ A;  5IOY A;  2RAS A;  3KKC A;  3IH3 A;  3LSR A;  2XGC A;  3F1B A;  5K7F A;  2VKE A;  5J1Y A;  3QPL A;  2WGB A;  2ZOY A;  4HKU A;  1JUM A;  1JUP A;  5J1R A;  4GCK A;  1RKW A;  3LOC A;  2IAI A;  2XDN A;  3SFI A;  2YVE A;  4MXM A;  5HSZ A;  3BR1 A;  3B6A A;  2FQ4 A;  4W1U A;  3BRU A;  3ZQL A;  3ZQG A;  1QVU A;  3ANP A;  2HKU A;  3BTL A;  5IOZ A;  4NN1 A;  2NP5 A;  2IEK A;  5FKO A;  3CWR A;  3EGQ A;  2ZOZ A;  4M3E A;  1RKT A;  2I10 A;  3COL A;  3AQT A;  3V78 A;  3HTJ A;  1Z0X A;  3BR3 A;  1JT0 A;  3VVX A;  3BTJ A;  2FD5 A;  4PXI A;  2XPW A;  4MO7 A;  3NRG A;  2GBY A;  5GP9 A;  2XGE A;  4X1E A;  2F07 A;  5F08 A;  3SDG A;  4JKZ A;  5D1R A;  2IBD A;  2UXH A;  3O60 A;  5F04 A;  2NX4 A;  2ZCX A;  3HTA A;  1JUS A;  3BT9 A;  3O8H A;  4JNN A;  4L62 A;  5FHP A;  5H9T A;  3S5R A;  5FKM A;  3GEU A;  5D18 A;  1ZKG A;  3LHQ A;  2XPV A;  2DG8 A;  3KZ9 A;  3BR6 A;  5F27 A;  5C4Y A;  4G12 A;  2HYT A;  5J3L A;  3LSJ A;  3BQY A;  3RD3 A;  3ZQH A;  2GFN A;  3BTI A;  2OER A;  2Y2Z A;  4M3B A;  4D7N A;  2UXU A;  2XGD A;  2DTZ A;  2QWT A;  5F0C A;  2UXO A;  4I76 A;  2G3B A;  3JSJ A;  3BTC A;  2O7O A;  4B3A A;  4DW6 A;  3G1O A;  4NEL A;  3HE0 A;  3ANG A;  3PPB A;  2QOP A;  2XRL A;  2QKO A;  4GCT A;  2UXI A;  4B1R A;  5F0H A;  3IH4 A;  2G0E A;  3VW2 A;  3FK7 A;  5D19 A;  2TRT A;  5FKL A;  2IU5 A;  2WUI A;  2PZ9 A;  3RH2 A;  4XK4 A;  3VP5 A;  2XPU A;  3QQA A;  1QVT A;  5EZH A;  5GPC A;  2G7G A;  5GPA A;  3TP0 A;  2X9D A;  3BCG A;  3VIB A;  4KWA A;  3BR2 A;  3LSP A;  1UI5 A;  2O7T A;  3CDL A;  3BHQ A;  4AUX A;  2ID3 A;  5AQC A;  3VW1 A;  4M3G A;  4GFK A;  2JJ7 A;  5K7Z A;  3Q3S A;  4ICH A;  3G1L A;  4MK6 A;  3B6C A;  2G7S A;  4ACI A;  2XB5 A;  3VPR A;  2REK A;  5K58 A;  3BJB A;  1ZK8 A;  5F0F A;  1UI6 A;  3B81 A;  3FRQ A;  5EFY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...