3S5RA

Crystal structure of a putative transcriptional regulator of the tetr family (syn_02108) from syntrophus aciditrophicus at 2.60 a resolution
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
197
structure length
197
Chain Sequence
KNTRELLLDAATTLFAEQGIAATTMAEIAASVGVNPAMIHYYFKTRDSLLDTIIEERIGRIIDMIWEPVTGEEDDPLIMVRDLVNRIVNTCETMLWLPSLWIREIVNEGGALREKMLNNIPIDKMNKFSAKIAEGQKQGVINSGIDSRLLIGSIIGLTMLPLATAKLRDQIPTMKGLSSEDIVCHVTALLFTGLTNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator TetR family
publication title Crystal structure of a Putative transcriptional regulator of the TetR family (SYN_02108) from Syntrophus aciditrophicus SB at 2.60 A resolution
rcsb
source organism Syntrophus aciditrophicus
molecule tags Dna binding protein
total genus 57
structure length 197
sequence length 197
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3s5rA00
2NS8A 2UXOA 2WV1A 3LOCA 2QTQA 5FKMA 4GFLA 2OPTA 3BR3A 3HTHA 3QBMA 3PPBA 2VKVA 3ANGA 2XPUA 4G12A 4M3DA 4PXIA 3Q0WA 4D7NA 5F0FA 5GP9A 4M3FA 1QPIA 4GCKA 2XPWA 3BQZA 5GPAA 2VPRA 4MO7A 3ZQFA 1Z0XA 1UI6A 5F08A 2Y30A 3LSJA 4JNNA 2XGCA 5D1RA 5D19A 3KNWA 3NPIA 2HXIA 3CCYA 2OERA 3QQAA 2ZCMA 2NP5A 2NS7A 3LWJA 4XK4A 2TCTA 1JTXA 3C2BA 1RPWA 5K7HA 3BR1A 4GCTA 5K7ZA 2IU5A 3HGYA 5EZGA 4DW6A 2XGDA 4YZEA 4KWAA 2TRTA 2DG8A 2Y2ZA 3VPRA 5IOZA 3GZIA 2REKA 4MXMA 5C4YA 2WGBA 3HGGA 1JT0A 2D6YA 3ON4A 3PM1A 3VW1A 3BR2A 1T56A 3C07A 3DEWA 4W97A 2X9DA 5F0HA 3TP3A 1QVUA 3LHQA 2WUIA 2GFNA 2QCOA 4JL3A 2IBDA 3ZQHA 3WHBA 2XDNA 4M3GA 3B6AA 2ZOZA 2EH3A 5HSZA 3E7QA 3EGQA 3HTAA 5J1UA 4B3AA 3FIWA 3S5RA 3ANPA 3G56A 3KZ9A 3TP0A 3HTIA 2NP3A 2HQ5A 5FKLA 4L62A 4JKZA 4V2FA 3VUQA 4B1RA 5FKOA 3F0CA 3BHQA 2UXUA 2QWTA 3LSPA 2FD5A 3IH2A 1JUMA 3F1BA 2QIBA 4I6ZA 5AQCA 3JSJA 5FHPA 5FKNA 4AC0A 4I76A 3KKCA 4JYKA 2GENA 5F0CA 3BJBA 3FK6A 2FX0A 3T6NA 1ORKA 3GEUA 5F04A 5CW8A 3BR0A 5J3LA 3PASA 3B6CA 3NXCA 3ON2A 2IAIA 3NNRA 4ABZA 2ID6A 4GFKA 2NX4A 3IUVA 5IP6A 2HYJA 3DCFA 4ACIA 2HKUA 2ZCXA 3HE0A 4CGRA 4NN1A 3G1LA 2Q24A 1JUSA 5CXIA 2ZOYA 5EZHA 3B81A 4AUXA 2FJ1A 3VP5A 1SGMA 4HKUA 5K7FA 3G7RA 3BR5A 1ZKGA 3Q0VA 3HTJA 3NI7A 3VW2A 4AF5A 4ICHA 3ZQIA 2VKEA 2DTZA 5H9TA 2RHAA 5HAWA 3O8HA 3COLA 3BTLA 3HIMA 3AQSA 4M3BA 3BQYA 5F1JA 1VI0A 2FBQA 1Z77A 2OF7A 4D5CA 2ID3A 3CJDA 3MVPA 1RKWA 2GBYA 2G7LA 2UXIA 3LSRA 2JJ7A 2QOPA 3LJLA 3ZQGA 5F27A 2PZ9A 3RD3A 3SFIA 2UXHA 2RASA 3G1MA 4NELA 4X1EA 1UI5A 2O7TA 2OI8A 5J1RA 2YVEA 3VOKA 2G3BA 5HBUA 2V57A 3BTCA 2RAEA 1RKTA 3AQTA 3QKXA 2QKOA 3WHCA 3BNIA 3CRJA 2XPVA 4D5FA 4ME9A 2O7OA 4UDSA 5IOYA 2W53A 3DPJA 3V6GA 4AC6A 3SDGA 1BJZA 1U9OA 1T33A 1JUPA 3QPSA 5D18A 2XGEA 3VVYA 3O60A 2ZCNA 5CXGA 1QVTA 2DG7A 2PBXA 3P9TA 3IH3A 2Y31A 3CDLA 3Q0UA 3QPLA 3VVZA 2HXOA 4V2GA 2IEKA 2I10A 2G7GA 5FKKA 5DAJA 3Q3SA 1U9NA 2JK3A 2YVHA 3FRQA 3ZQLA 3VIBA 3BTIA 3CWRA 2F07A 3G1OA 2G0EA 3RH2A 1JTYA 3VW0A 3VOXA 4D7MA 2XB5A 1A6IA 3BCGA 5EYRA 2GUHA 5GPCA 3NRGA 5EFYA 4MK6A 2X6OA 3BTJA 2ZB9A 5FMPA 5IPAA 4W1UA 3EUPA 5J1YA 3FK7A 4GCLA 3V78A 3VVXA 5K58A 3O8GA 4M3EA 3IH4A 3KKDA 3BRUA 1ZK8A 2FQ4A 5FGLA 3BT9A 1JT6A 2G7SA 3MNLA 2UXPA 3BR6A 2XRLA 2HYTA
chains in the Genus database with same CATH superfamily
2NS8A 2UXOA 2WV1A 3SWHA 3LOCA 2QTQA 5FKMA 4GFLA 2OPTA 2R7SA 3BR3A 3HTHA 3QBMA 3PPBA 2VKVA 3ANGA 2XPUA 4G12A 4M3DA 4PXIA 3Q0WA 4D7NA 5F0FA 5GP9A 4M3FA 2R7VA 1QPIA 4GCKA 2XPWA 3BQZA 5GPAA 2VPRA 4MO7A 3ZQFA 1Z0XA 1UI6A 5F08A 2R7TA 2Y30A 3LSJA 4JNNA 2XGCA 4WIBA 5D1RA 5D19A 3KNWA 3NPIA 2HXIA 3CCYA 2OERA 3QQAA 2ZCMA 2NP5A 2NS7A 3LWJA 4XK4A 2TCTA 1JTXA 3K8PC 3C2BA 2R7UA 1RPWA 5K7HA 3BR1A 4GCTA 5K7ZA 2IU5A 3HGYA 5EZGA 4DW6A 4OD5A 2XGDA 4C2MA 4YZEA 4KWAA 2TRTA 2DG8A 2Y2ZA 3VPRA 5IOZA 3GZIA 2REKA 4MXMA 5C4YA 2WGBA 3HGGA 1JT0A 2D6YA 3ON4A 3PM1A 3VW1A 3BR2A 1T56A 3C07A 3DEWA 4W97A 2X9DA 5F0HA 3TP3A 1QVUA 3LHQA 2WUIA 2GFNA 2QCOA 4JL3A 2IBDA 3ZQHA 3WHBA 2XDNA 4M3GA 3B6AA 2ZOZA 2EH3A 5HSZA 3E7QA 3DU6A 3EGQA 3HTAA 4OD4A 5J1UA 4B3AA 4DVYP 3FIWA 3S5RA 3ANPA 3G56A 3FHNA 3KZ9A 3TP0A 2YVXA 3HTIA 2NP3A 2HQ5A 5FKLA 4L62A 4JKZA 4V2FA 3VUQA 4B1RA 5FKOA 3F0CA 3BHQA 2UXUA 2QWTA 3LSPA 2FD5A 3IH2A 1JUMA 3F1BA 2QIBA 4I6ZA 5AQCA 3JSJA 5FHPA 5FKNA 4AC0A 4I76A 2R7OA 3KKCA 4U9LA 4JYKA 2GENA 5F0CA 3BJBA 3FK6A 2FX0A 3T6NA 1ORKA 3GEUA 3DU5A 5F04A 5CW8A 3BR0A 5J3LA 3PASA 3B6CA 3NXCA 3ON2A 2IAIA 3NNRA 4ABZA 2ID6A 4GFKA 2NX4A 3IUVA 5IP6A 2HYJA 3DCFA 4ACIA 2HKUA 2ZCXA 3HE0A 4CGRA 2R7RA 4NN1A 3G1LA 2Q24A 1JUSA 5CXIA 2ZOYA 5EZHA 3B81A 4AUXA 2FJ1A 3VP5A 1SGMA 4HKUA 5K7FA 3G7RA 3BR5A 1ZKGA 2B1EA 3Q0VA 3HTJA 3VTIA 3NI7A 3VW2A 4AF5A 4ICHA 3ZQIA 2VKEA 2DTZA 5H9TA 2RHAA 4IRVA 5HAWA 3O8HA 3COLA 3BTLA 3HIMA 3AQSA 4M3BA 3BQYA 5F1JA 1VI0A 2PFVA 2FBQA 1Z77A 2OF7A 4D5CA 2ID3A 3CJDA 2R7WA 3MVPA 1RKWA 2GBYA 2G7LA 2UXIA 3LSRA 2JJ7A 2QOPA 3LJLA 3ZQGA 5F27A 2PZ9A 3RD3A 3SFIA 2UXHA 2RASA 3G1MA 4NELA 4X1EA 1UI5A 2O7TA 2FJI1 2OI8A 5J1RA 2YVEA 3VOKA 2G3BA 5HBUA 2V57A 3BTCA 2RAEA 1RKTA 3AQTA 3QKXA 2QKOA 3WHCA 3BNIA 3CRJA 2XPVA 4D5FA 4ME9A 2O7OA 4UDSA 5IOYA 2W53A 3DPJA 3V6GA 3NS4A 4AC6A 3SDGA 1BJZA 1U9OA 2ZY9A 1T33A 1JUPA 3QPSA 5D18A 2XGEA 5CQGA 2B3WA 3VVYA 3O60A 2ZCNA 5CXGA 1QVTA 2DG7A 2PBXA 3P9TA 3IH3A 2Y31A 3CDLA 3Q0UA 3QPLA 3VVZA 2HXOA 4V2GA 2IEKA 2I10A 2G7GA 5FKKA 5DAJA 3Q3SA 1U9NA 2JK3A 2YVHA 3FRQA 3ZQLA 3VIBA 3BTIA 3CWRA 2F07A 3G1OA 2G0EA 3RH2A 3KYLA 1JTYA 3VW0A 3VOXA 2R7QA 4D7MA 2XB5A 1A6IA 3BCGA 5EYRA 2GUHA 5GPCA 3NRGA 5EFYA 2R7XA 4MK6A 2X6OA 3BTJA 2ZB9A 5FMPA 5IPAA 4W1UA 4U9NA 3EUPA 5J1YA 3FK7A 4GCLA 3V78A 3VVXA 5K58A 3O8GA 4M3EA 3IH4A 3KKDA 3BRUA 1ZK8A 2FQ4A 5FGLA 3BT9A 1JT6A 2G7SA 3MNLA 2UXPA 3BR6A 2XRLA 2A2FX 2HYTA
chains in the Genus database with same CATH topology
2NS8A 2UXOA 2WV1A 3LOCA 2QTQA 5FKMA 4GFLA 2OPTA 3BR3A 3HTHA 3QBMA 3PPBA 2VKVA 3ANGA 2XPUA 4G12A 4M3DA 4PXIA 3Q0WA 4D7NA 5F0FA 5GP9A 4M3FA 1QPIA 4GCKA 2XPWA 3BQZA 5GPAA 2VPRA 4MO7A 3ZQFA 1Z0XA 1UI6A 5F08A 2Y30A 3LSJA 4JNNA 2XGCA 5D1RA 5D19A 3KNWA 3NPIA 2HXIA 3CCYA 2OERA 3QQAA 2ZCMA 2NP5A 2NS7A 3LWJA 4XK4A 2TCTA 1JTXA 3C2BA 1RPWA 5K7HA 3BR1A 4GCTA 5K7ZA 2IU5A 3HGYA 5EZGA 4DW6A 2XGDA 4YZEA 4KWAA 2TRTA 2DG8A 2Y2ZA 3VPRA 5IOZA 3GZIA 2REKA 4MXMA 5C4YA 2WGBA 3HGGA 1JT0A 2D6YA 3ON4A 3PM1A 3VW1A 3BR2A 1T56A 3C07A 3DEWA 4W97A 2X9DA 5F0HA 3TP3A 1QVUA 3LHQA 2WUIA 2GFNA 2QCOA 4JL3A 2IBDA 3ZQHA 3WHBA 2XDNA 4M3GA 3B6AA 2ZOZA 2EH3A 5HSZA 3E7QA 3EGQA 3HTAA 5J1UA 4B3AA 3FIWA 3S5RA 3ANPA 3G56A 3KZ9A 3TP0A 3HTIA 2NP3A 2HQ5A 5FKLA 4L62A 4JKZA 4V2FA 3VUQA 4B1RA 5FKOA 3F0CA 3BHQA 2UXUA 2QWTA 3LSPA 2FD5A 3IH2A 1JUMA 3F1BA 2QIBA 4I6ZA 5AQCA 3JSJA 5FHPA 5FKNA 4AC0A 4I76A 3KKCA 4JYKA 2GENA 5F0CA 3BJBA 3FK6A 2FX0A 3T6NA 1ORKA 3GEUA 5F04A 5CW8A 3BR0A 5J3LA 3PASA 3B6CA 3NXCA 3ON2A 2IAIA 3NNRA 4ABZA 2ID6A 4GFKA 2NX4A 3IUVA 5IP6A 2HYJA 3DCFA 4ACIA 2HKUA 2ZCXA 3HE0A 4CGRA 4NN1A 3G1LA 2Q24A 1JUSA 5CXIA 2ZOYA 5EZHA 3B81A 4AUXA 2FJ1A 3VP5A 1SGMA 4HKUA 5K7FA 3G7RA 3BR5A 1ZKGA 3Q0VA 3HTJA 3NI7A 3VW2A 4AF5A 4ICHA 3ZQIA 2VKEA 2DTZA 5H9TA 2RHAA 5HAWA 3O8HA 3COLA 3BTLA 3HIMA 3AQSA 4M3BA 3BQYA 5F1JA 1VI0A 2FBQA 1Z77A 2OF7A 4D5CA 2ID3A 3CJDA 3MVPA 1RKWA 2GBYA 2G7LA 2UXIA 3LSRA 2JJ7A 2QOPA 3LJLA 3ZQGA 5F27A 2PZ9A 3RD3A 3SFIA 2UXHA 2RASA 3G1MA 4NELA 4X1EA 1UI5A 2O7TA 2OI8A 5J1RA 2YVEA 3VOKA 2G3BA 5HBUA 2V57A 3BTCA 2RAEA 1RKTA 3AQTA 3QKXA 2QKOA 3WHCA 3BNIA 3CRJA 2XPVA 4D5FA 4ME9A 2O7OA 4UDSA 5IOYA 2W53A 3DPJA 3V6GA 4AC6A 3SDGA 1BJZA 1U9OA 1T33A 1JUPA 3QPSA 5D18A 2XGEA 3VVYA 3O60A 2ZCNA 5CXGA 1QVTA 2DG7A 2PBXA 3P9TA 3IH3A 2Y31A 3CDLA 3Q0UA 3QPLA 3VVZA 2HXOA 4V2GA 2IEKA 2I10A 2G7GA 5FKKA 5DAJA 3Q3SA 1U9NA 2JK3A 2YVHA 3FRQA 3ZQLA 3VIBA 3BTIA 3CWRA 2F07A 3G1OA 2G0EA 3RH2A 1JTYA 3VW0A 3VOXA 4D7MA 2XB5A 1A6IA 3BCGA 5EYRA 2GUHA 5GPCA 3NRGA 5EFYA 4MK6A 2X6OA 3BTJA 2ZB9A 5FMPA 5IPAA 4W1UA 3EUPA 5J1YA 3FK7A 4GCLA 3V78A 3VVXA 5K58A 3O8GA 4M3EA 3IH4A 3KKDA 3BRUA 1ZK8A 2FQ4A 5FGLA 3BT9A 1JT6A 2G7SA 3MNLA 2UXPA 3BR6A 2XRLA 2HYTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NS8 A;  2UXO A;  2WV1 A;  3LOC A;  2QTQ A;  5FKM A;  4GFL A;  2OPT A;  3BR3 A;  3HTH A;  3QBM A;  3PPB A;  2VKV A;  3ANG A;  2XPU A;  4G12 A;  4M3D A;  4PXI A;  3Q0W A;  4D7N A;  5F0F A;  5GP9 A;  4M3F A;  1QPI A;  4GCK A;  2XPW A;  3BQZ A;  5GPA A;  2VPR A;  4MO7 A;  3ZQF A;  1Z0X A;  1UI6 A;  5F08 A;  2Y30 A;  3LSJ A;  4JNN A;  2XGC A;  5D1R A;  5D19 A;  3KNW A;  3NPI A;  2HXI A;  3CCY A;  2OER A;  3QQA A;  2ZCM A;  2NP5 A;  2NS7 A;  3LWJ A;  4XK4 A;  2TCT A;  1JTX A;  3C2B A;  1RPW A;  5K7H A;  3BR1 A;  4GCT A;  5K7Z A;  2IU5 A;  3HGY A;  5EZG A;  4DW6 A;  2XGD A;  4YZE A;  4KWA A;  2TRT A;  2DG8 A;  2Y2Z A;  3VPR A;  5IOZ A;  3GZI A;  2REK A;  4MXM A;  5C4Y A;  2WGB A;  3HGG A;  1JT0 A;  2D6Y A;  3ON4 A;  3PM1 A;  3VW1 A;  3BR2 A;  1T56 A;  3C07 A;  3DEW A;  4W97 A;  2X9D A;  5F0H A;  3TP3 A;  1QVU A;  3LHQ A;  2WUI A;  2GFN A;  2QCO A;  4JL3 A;  2IBD A;  3ZQH A;  3WHB A;  2XDN A;  4M3G A;  3B6A A;  2ZOZ A;  2EH3 A;  5HSZ A;  3E7Q A;  3EGQ A;  3HTA A;  5J1U A;  4B3A A;  3FIW A;  3S5R A;  3ANP A;  3G56 A;  3KZ9 A;  3TP0 A;  3HTI A;  2NP3 A;  2HQ5 A;  5FKL A;  4L62 A;  4JKZ A;  4V2F A;  3VUQ A;  4B1R A;  5FKO A;  3F0C A;  3BHQ A;  2UXU A;  2QWT A;  3LSP A;  2FD5 A;  3IH2 A;  1JUM A;  3F1B A;  2QIB A;  4I6Z A;  5AQC A;  3JSJ A;  5FHP A;  5FKN A;  4AC0 A;  4I76 A;  3KKC A;  4JYK A;  2GEN A;  5F0C A;  3BJB A;  3FK6 A;  2FX0 A;  3T6N A;  1ORK A;  3GEU A;  5F04 A;  5CW8 A;  3BR0 A;  5J3L A;  3PAS A;  3B6C A;  3NXC A;  3ON2 A;  2IAI A;  3NNR A;  4ABZ A;  2ID6 A;  4GFK A;  2NX4 A;  3IUV A;  5IP6 A;  2HYJ A;  3DCF A;  4ACI A;  2HKU A;  2ZCX A;  3HE0 A;  4CGR A;  4NN1 A;  3G1L A;  2Q24 A;  1JUS A;  5CXI A;  2ZOY A;  5EZH A;  3B81 A;  4AUX A;  2FJ1 A;  3VP5 A;  1SGM A;  4HKU A;  5K7F A;  3G7R A;  3BR5 A;  1ZKG A;  3Q0V A;  3HTJ A;  3NI7 A;  3VW2 A;  4AF5 A;  4ICH A;  3ZQI A;  2VKE A;  2DTZ A;  5H9T A;  2RHA A;  5HAW A;  3O8H A;  3COL A;  3BTL A;  3HIM A;  3AQS A;  4M3B A;  3BQY A;  5F1J A;  1VI0 A;  2FBQ A;  1Z77 A;  2OF7 A;  4D5C A;  2ID3 A;  3CJD A;  3MVP A;  1RKW A;  2GBY A;  2G7L A;  2UXI A;  3LSR A;  2JJ7 A;  2QOP A;  3LJL A;  3ZQG A;  5F27 A;  2PZ9 A;  3RD3 A;  3SFI A;  2UXH A;  2RAS A;  3G1M A;  4NEL A;  4X1E A;  1UI5 A;  2O7T A;  2OI8 A;  5J1R A;  2YVE A;  3VOK A;  2G3B A;  5HBU A;  2V57 A;  3BTC A;  2RAE A;  1RKT A;  3AQT A;  3QKX A;  2QKO A;  3WHC A;  3BNI A;  3CRJ A;  2XPV A;  4D5F A;  4ME9 A;  2O7O A;  4UDS A;  5IOY A;  2W53 A;  3DPJ A;  3V6G A;  4AC6 A;  3SDG A;  1BJZ A;  1U9O A;  1T33 A;  1JUP A;  3QPS A;  5D18 A;  2XGE A;  3VVY A;  3O60 A;  2ZCN A;  5CXG A;  1QVT A;  2DG7 A;  2PBX A;  3P9T A;  3IH3 A;  2Y31 A;  3CDL A;  3Q0U A;  3QPL A;  3VVZ A;  2HXO A;  4V2G A;  2IEK A;  2I10 A;  2G7G A;  5FKK A;  5DAJ A;  3Q3S A;  1U9N A;  2JK3 A;  2YVH A;  3FRQ A;  3ZQL A;  3VIB A;  3BTI A;  3CWR A;  2F07 A;  3G1O A;  2G0E A;  3RH2 A;  1JTY A;  3VW0 A;  3VOX A;  4D7M A;  2XB5 A;  1A6I A;  3BCG A;  5EYR A;  2GUH A;  5GPC A;  3NRG A;  5EFY A;  4MK6 A;  2X6O A;  3BTJ A;  2ZB9 A;  5FMP A;  5IPA A;  4W1U A;  3EUP A;  5J1Y A;  3FK7 A;  4GCL A;  3V78 A;  3VVX A;  5K58 A;  3O8G A;  4M3E A;  3IH4 A;  3KKD A;  3BRU A;  1ZK8 A;  2FQ4 A;  5FGL A;  3BT9 A;  1JT6 A;  2G7S A;  3MNL A;  2UXP A;  3BR6 A;  2XRL A;  2HYT A; 
#chains in the Genus database with same CATH topology
 2NS8 A;  2UXO A;  2WV1 A;  3SWH A;  3LOC A;  2QTQ A;  5FKM A;  4GFL A;  2OPT A;  2R7S A;  3BR3 A;  3HTH A;  3QBM A;  3PPB A;  2VKV A;  3ANG A;  2XPU A;  4G12 A;  4M3D A;  4PXI A;  3Q0W A;  4D7N A;  5F0F A;  5GP9 A;  4M3F A;  2R7V A;  1QPI A;  4GCK A;  2XPW A;  3BQZ A;  5GPA A;  2VPR A;  4MO7 A;  3ZQF A;  1Z0X A;  1UI6 A;  5F08 A;  2R7T A;  2Y30 A;  3LSJ A;  4JNN A;  2XGC A;  4WIB A;  5D1R A;  5D19 A;  3KNW A;  3NPI A;  2HXI A;  3CCY A;  2OER A;  3QQA A;  2ZCM A;  2NP5 A;  2NS7 A;  3LWJ A;  4XK4 A;  2TCT A;  1JTX A;  3K8P C;  3C2B A;  2R7U A;  1RPW A;  5K7H A;  3BR1 A;  4GCT A;  5K7Z A;  2IU5 A;  3HGY A;  5EZG A;  4DW6 A;  4OD5 A;  2XGD A;  4C2M A;  4YZE A;  4KWA A;  2TRT A;  2DG8 A;  2Y2Z A;  3VPR A;  5IOZ A;  3GZI A;  2REK A;  4MXM A;  5C4Y A;  2WGB A;  3HGG A;  1JT0 A;  2D6Y A;  3ON4 A;  3PM1 A;  3VW1 A;  3BR2 A;  1T56 A;  3C07 A;  3DEW A;  4W97 A;  2X9D A;  5F0H A;  3TP3 A;  1QVU A;  3LHQ A;  2WUI A;  2GFN A;  2QCO A;  4JL3 A;  2IBD A;  3ZQH A;  3WHB A;  2XDN A;  4M3G A;  3B6A A;  2ZOZ A;  2EH3 A;  5HSZ A;  3E7Q A;  3DU6 A;  3EGQ A;  3HTA A;  4OD4 A;  5J1U A;  4B3A A;  4DVY P;  3FIW A;  3S5R A;  3ANP A;  3G56 A;  3FHN A;  3KZ9 A;  3TP0 A;  2YVX A;  3HTI A;  2NP3 A;  2HQ5 A;  5FKL A;  4L62 A;  4JKZ A;  4V2F A;  3VUQ A;  4B1R A;  5FKO A;  3F0C A;  3BHQ A;  2UXU A;  2QWT A;  3LSP A;  2FD5 A;  3IH2 A;  1JUM A;  3F1B A;  2QIB A;  4I6Z A;  5AQC A;  3JSJ A;  5FHP A;  5FKN A;  4AC0 A;  4I76 A;  2R7O A;  3KKC A;  4U9L A;  4JYK A;  2GEN A;  5F0C A;  3BJB A;  3FK6 A;  2FX0 A;  3T6N A;  1ORK A;  3GEU A;  3DU5 A;  5F04 A;  5CW8 A;  3BR0 A;  5J3L A;  3PAS A;  3B6C A;  3NXC A;  3ON2 A;  2IAI A;  3NNR A;  4ABZ A;  2ID6 A;  4GFK A;  2NX4 A;  3IUV A;  5IP6 A;  2HYJ A;  3DCF A;  4ACI A;  2HKU A;  2ZCX A;  3HE0 A;  4CGR A;  2R7R A;  4NN1 A;  3G1L A;  2Q24 A;  1JUS A;  5CXI A;  2ZOY A;  5EZH A;  3B81 A;  4AUX A;  2FJ1 A;  3VP5 A;  1SGM A;  4HKU A;  5K7F A;  3G7R A;  3BR5 A;  1ZKG A;  2B1E A;  3Q0V A;  3HTJ A;  3VTI A;  3NI7 A;  3VW2 A;  4AF5 A;  4ICH A;  3ZQI A;  2VKE A;  2DTZ A;  5H9T A;  2RHA A;  4IRV A;  5HAW A;  3O8H A;  3COL A;  3BTL A;  3HIM A;  3AQS A;  4M3B A;  3BQY A;  5F1J A;  1VI0 A;  2PFV A;  2FBQ A;  1Z77 A;  2OF7 A;  4D5C A;  2ID3 A;  3CJD A;  2R7W A;  3MVP A;  1RKW A;  2GBY A;  2G7L A;  2UXI A;  3LSR A;  2JJ7 A;  2QOP A;  3LJL A;  3ZQG A;  5F27 A;  2PZ9 A;  3RD3 A;  3SFI A;  2UXH A;  2RAS A;  3G1M A;  4NEL A;  4X1E A;  1UI5 A;  2O7T A;  2FJI 1;  2OI8 A;  5J1R A;  2YVE A;  3VOK A;  2G3B A;  5HBU A;  2V57 A;  3BTC A;  2RAE A;  1RKT A;  3AQT A;  3QKX A;  2QKO A;  3WHC A;  3BNI A;  3CRJ A;  2XPV A;  4D5F A;  4ME9 A;  2O7O A;  4UDS A;  5IOY A;  2W53 A;  3DPJ A;  3V6G A;  3NS4 A;  4AC6 A;  3SDG A;  1BJZ A;  1U9O A;  2ZY9 A;  1T33 A;  1JUP A;  3QPS A;  5D18 A;  2XGE A;  5CQG A;  2B3W A;  3VVY A;  3O60 A;  2ZCN A;  5CXG A;  1QVT A;  2DG7 A;  2PBX A;  3P9T A;  3IH3 A;  2Y31 A;  3CDL A;  3Q0U A;  3QPL A;  3VVZ A;  2HXO A;  4V2G A;  2IEK A;  2I10 A;  2G7G A;  5FKK A;  5DAJ A;  3Q3S A;  1U9N A;  2JK3 A;  2YVH A;  3FRQ A;  3ZQL A;  3VIB A;  3BTI A;  3CWR A;  2F07 A;  3G1O A;  2G0E A;  3RH2 A;  3KYL A;  1JTY A;  3VW0 A;  3VOX A;  2R7Q A;  4D7M A;  2XB5 A;  1A6I A;  3BCG A;  5EYR A;  2GUH A;  5GPC A;  3NRG A;  5EFY A;  2R7X A;  4MK6 A;  2X6O A;  3BTJ A;  2ZB9 A;  5FMP A;  5IPA A;  4W1U A;  4U9N A;  3EUP A;  5J1Y A;  3FK7 A;  4GCL A;  3V78 A;  3VVX A;  5K58 A;  3O8G A;  4M3E A;  3IH4 A;  3KKD A;  3BRU A;  1ZK8 A;  2FQ4 A;  5FGL A;  3BT9 A;  1JT6 A;  2G7S A;  3MNL A;  2UXP A;  3BR6 A;  2XRL A;  2A2F X;  2HYT A; 
#chains in the Genus database with same CATH homology
 2NS8 A;  2UXO A;  2WV1 A;  3LOC A;  2QTQ A;  5FKM A;  4GFL A;  2OPT A;  3BR3 A;  3HTH A;  3QBM A;  3PPB A;  2VKV A;  3ANG A;  2XPU A;  4G12 A;  4M3D A;  4PXI A;  3Q0W A;  4D7N A;  5F0F A;  5GP9 A;  4M3F A;  1QPI A;  4GCK A;  2XPW A;  3BQZ A;  5GPA A;  2VPR A;  4MO7 A;  3ZQF A;  1Z0X A;  1UI6 A;  5F08 A;  2Y30 A;  3LSJ A;  4JNN A;  2XGC A;  5D1R A;  5D19 A;  3KNW A;  3NPI A;  2HXI A;  3CCY A;  2OER A;  3QQA A;  2ZCM A;  2NP5 A;  2NS7 A;  3LWJ A;  4XK4 A;  2TCT A;  1JTX A;  3C2B A;  1RPW A;  5K7H A;  3BR1 A;  4GCT A;  5K7Z A;  2IU5 A;  3HGY A;  5EZG A;  4DW6 A;  2XGD A;  4YZE A;  4KWA A;  2TRT A;  2DG8 A;  2Y2Z A;  3VPR A;  5IOZ A;  3GZI A;  2REK A;  4MXM A;  5C4Y A;  2WGB A;  3HGG A;  1JT0 A;  2D6Y A;  3ON4 A;  3PM1 A;  3VW1 A;  3BR2 A;  1T56 A;  3C07 A;  3DEW A;  4W97 A;  2X9D A;  5F0H A;  3TP3 A;  1QVU A;  3LHQ A;  2WUI A;  2GFN A;  2QCO A;  4JL3 A;  2IBD A;  3ZQH A;  3WHB A;  2XDN A;  4M3G A;  3B6A A;  2ZOZ A;  2EH3 A;  5HSZ A;  3E7Q A;  3EGQ A;  3HTA A;  5J1U A;  4B3A A;  3FIW A;  3S5R A;  3ANP A;  3G56 A;  3KZ9 A;  3TP0 A;  3HTI A;  2NP3 A;  2HQ5 A;  5FKL A;  4L62 A;  4JKZ A;  4V2F A;  3VUQ A;  4B1R A;  5FKO A;  3F0C A;  3BHQ A;  2UXU A;  2QWT A;  3LSP A;  2FD5 A;  3IH2 A;  1JUM A;  3F1B A;  2QIB A;  4I6Z A;  5AQC A;  3JSJ A;  5FHP A;  5FKN A;  4AC0 A;  4I76 A;  3KKC A;  4JYK A;  2GEN A;  5F0C A;  3BJB A;  3FK6 A;  2FX0 A;  3T6N A;  1ORK A;  3GEU A;  5F04 A;  5CW8 A;  3BR0 A;  5J3L A;  3PAS A;  3B6C A;  3NXC A;  3ON2 A;  2IAI A;  3NNR A;  4ABZ A;  2ID6 A;  4GFK A;  2NX4 A;  3IUV A;  5IP6 A;  2HYJ A;  3DCF A;  4ACI A;  2HKU A;  2ZCX A;  3HE0 A;  4CGR A;  4NN1 A;  3G1L A;  2Q24 A;  1JUS A;  5CXI A;  2ZOY A;  5EZH A;  3B81 A;  4AUX A;  2FJ1 A;  3VP5 A;  1SGM A;  4HKU A;  5K7F A;  3G7R A;  3BR5 A;  1ZKG A;  3Q0V A;  3HTJ A;  3NI7 A;  3VW2 A;  4AF5 A;  4ICH A;  3ZQI A;  2VKE A;  2DTZ A;  5H9T A;  2RHA A;  5HAW A;  3O8H A;  3COL A;  3BTL A;  3HIM A;  3AQS A;  4M3B A;  3BQY A;  5F1J A;  1VI0 A;  2FBQ A;  1Z77 A;  2OF7 A;  4D5C A;  2ID3 A;  3CJD A;  3MVP A;  1RKW A;  2GBY A;  2G7L A;  2UXI A;  3LSR A;  2JJ7 A;  2QOP A;  3LJL A;  3ZQG A;  5F27 A;  2PZ9 A;  3RD3 A;  3SFI A;  2UXH A;  2RAS A;  3G1M A;  4NEL A;  4X1E A;  1UI5 A;  2O7T A;  2OI8 A;  5J1R A;  2YVE A;  3VOK A;  2G3B A;  5HBU A;  2V57 A;  3BTC A;  2RAE A;  1RKT A;  3AQT A;  3QKX A;  2QKO A;  3WHC A;  3BNI A;  3CRJ A;  2XPV A;  4D5F A;  4ME9 A;  2O7O A;  4UDS A;  5IOY A;  2W53 A;  3DPJ A;  3V6G A;  4AC6 A;  3SDG A;  1BJZ A;  1U9O A;  1T33 A;  1JUP A;  3QPS A;  5D18 A;  2XGE A;  3VVY A;  3O60 A;  2ZCN A;  5CXG A;  1QVT A;  2DG7 A;  2PBX A;  3P9T A;  3IH3 A;  2Y31 A;  3CDL A;  3Q0U A;  3QPL A;  3VVZ A;  2HXO A;  4V2G A;  2IEK A;  2I10 A;  2G7G A;  5FKK A;  5DAJ A;  3Q3S A;  1U9N A;  2JK3 A;  2YVH A;  3FRQ A;  3ZQL A;  3VIB A;  3BTI A;  3CWR A;  2F07 A;  3G1O A;  2G0E A;  3RH2 A;  1JTY A;  3VW0 A;  3VOX A;  4D7M A;  2XB5 A;  1A6I A;  3BCG A;  5EYR A;  2GUH A;  5GPC A;  3NRG A;  5EFY A;  4MK6 A;  2X6O A;  3BTJ A;  2ZB9 A;  5FMP A;  5IPA A;  4W1U A;  3EUP A;  5J1Y A;  3FK7 A;  4GCL A;  3V78 A;  3VVX A;  5K58 A;  3O8G A;  4M3E A;  3IH4 A;  3KKD A;  3BRU A;  1ZK8 A;  2FQ4 A;  5FGL A;  3BT9 A;  1JT6 A;  2G7S A;  3MNL A;  2UXP A;  3BR6 A;  2XRL A;  2HYT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...