2GBYA

Structure of qacr multidrug transcriptional regulator bound to bivalent diamidine berenil
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
186
structure length
186
Chain Sequence
NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKKEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator qacR
publication title Structure of QacR Multidrug Transcriptional Regulator Bound to Trivalent and Bivalent Diamidine Drugs
rcsb
source organism Staphylococcus aureus
molecule tags Transcription
total genus 79
structure length 186
sequence length 186
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2006-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2gbyA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2gbyA02
2G7LA 3S1RJ 3O8HA 5EGOB 3IH3A 5IPAA 1FJLA 3LJLA 3NPIA 2ECBA 3K2AA 3Q3SA 1NK3P 4JX4A 2YVEA 3HOUJ 2EZIA 4KWAA 2FBQA 3VP5A 2XGDA 4IHVA 4GFKA 1G2HA 5D19A 4C3JJ 2ID6A 2RAEA 1JTXA 2H1KA 5C3EJ 3HEFA 3JRAA 2HOTA 4QSHA 5F27A 2XPUA 3FK7A 4AF5A 3DCFA 1BJZA 1IC8A 5F1JA 1MBGA 4FCYA 3BR3A 3KKDA 5J1RA 2EH3A 3HM5A 4D5CA 2W53A 2EZLA 4RDUA 3CJDA 2M2EA 3G7RA 2FD5A 1TC3C 1K83J 1HDPA 2NVYJ 4MFEA 3VPRA 1QVUA 3JREA 3JRIA 2MSYA 2VPRA 2R5YB 1PUFB 3GBGA 2R5ZA 1P7IA 1H89C 3HGGA 5DAJA 3EGQA 5FGLA 2ZCXA 2IU5A 2YVHA 4JL3A 3Q0VA 3GTJJ 1TWAJ 3A02A 2LLKA 1RKWA 1MNMC 1TWCJ 1I3QJ 4BXXJ 2M8GX 4CGRA 3ON2A 2EBIA 1IGNA 1ZGWA 2XGCA 3OOUA 3JR9A 2PZ9A 1VI0A 3TP3A 1ETOA 3QPLA 3M3YJ 2HXOA 1JKRC 1JKQC 2NS7A 1B72B 5GPAA 2H8RA 1K61A 5IP9J 2O9LA 1HOMA 2R93J 4DZPA 2HXIA 3BNIA 1F43A 1BW5A 5F08A 1NTCA 5AQCA 4FISA 3UKGA 2L7ZA 1WH7A 2F07A 5J3LA 1VF9A 3BJBA 4I76A 3IH2A 1GV5A 1Z77A 2LTPA 3BQYA 2UXUA 5GPCA 2ELKA 2XPVA 4A3LJ 1IJWC 4A3CJ 2O8KA 4DYRA 1MH3A 1RPWA 3LOCA 2JA6J 1RESA 2ZOYA 4L5EA 5EYRA 3BTIA 5J1UA 5IP6A 1JKPC 2DA1A 1X58A 2IEKA 1U78A 1GVDA 1IV6A 1ETKA 3H3VK 3HOYJ 2PMZN 1LFUP 4A3EJ 1NK2P 2COBA 3ZQLA 3VOKA 1Y1WJ 3ZQGA 1JGGA 3HOVJ 2O7TA 4QTRA 4BY1J 2E2JJ 2PBXA 1A5JA 2IAIA 1ZK8A 3HE0A 3BG5A 3TW6A 2X9DA 2DJNA 3S15J 3SFIA 3M4OJ 3FIWA 4MLOA 1Q1VA 4IHWA 5EDNA 1GDTA 2MGQA 3QQAA 1ETYA 3AQSA 3VW0A 2O7OA 1APLC 3S1MJ 1S7EA 3WHBA 4GFBA 2DA5A 2D6YA 2G7SA 3LHQA 4A3KJ 4A93J 3CCYA 2HYJA 1JT6A 1ETWA 5CW8A 4D5FA 1QRYA 2DMPA 2NVXJ 1TWFJ 5EG0A 3IH4A 1CQTA 4A3IJ 1WCMJ 3MNLA 4M3DA 4GCLA 4ABZA 2R92J 2M34A 2ID3A 4Y52J 1P7JA 4M3EA 1MH4A 2OI8A 3E7QA 1TWGJ 2GLOA 3JSJA 3G1MA 3QKXA 4XRMA 1X2MA 4A3FJ 3MN2A 4PXIA 5BNGA 5M3FJ 3NRGA 3T6NA 3RQIA 2FQ4A 4J19A 2QTQA 2LY9A 2VI6A 3Q0WA 5FLMJ 2EZHA 4QIWN 1MBHA 1AKHB 2LVSA 2ZOZA 2DMUA 2P81A 3VW1A 1HF0A 3MVPA 1R9TJ 2XSDC 1JUSA 1SGMA 5CXIA 2JA7J 5M5WJ 3S1QJ 2UXPA 3PASA 1ENHA 3S16J 2V57A 4M3FA 3COLA 3G1OA 5HODA 1UI6A 3E7LA 3NI7A 2ME0A 2VKVA 3VVYA 3OIOA 3IV5A 2EZKA 2DA7A 2HQ5A 3S17J 1ORKA 4DW6A 4EEFG 3HTHA 4DZJA 1T56A 3BG9A 2DMQA 2YU9J 2NVQJ 2G3BA 2Y0SN 3BG3A 2NP3A 2DA2A 3ON4A 3CQZJ 3LSJA 2M0CA 2N8GA 3AQTA 1YRNB 1AU7A 1B8IA 5C4JJ 3BR2A 4UUSB 5K58A 5K7HA 1H88C 1OCPA 1FIPA 4XRSA 2MW8A 3B6AA 3W6VA 4A3BJ 3ANGA 1JUPA 2WUIA 4ICHA 2LKXA 3G1LA 4CYCA 3H0GJ 3BHQA 5H9TA 3BR0A 2E2IJ 4HNVA 1ZTRA 4LOCA 3ANPA 3OSGA 2RHAA 5E3MA 5M5YJ 3B81A 5CXGA 5EFYA 2G0EA 4I6ZA 1ZQ3P 5IYBJ 2KDZA 4M3BA 3PM1A 1UMQA 3KKCA 2QOPA 1POGA 4UDSA 3S5RA 3C07A 2UXIA 3JRGA 3V6GA 3K7AJ 1E3OC 1JJ8C 5D18A 5DS9A 5M5XJ 5F04A 3NXCA 5EGOA 2DG8A 2EQRA 3I4NJ 2XB5A 2HYTA 4AUXA 4BY7J 5JLWA 5IOZA 4V2FA 1TWHJ 3LWJA 3FRQA 2YUSA 1RKTA 2YS9A 4W1UA 3RKQA 1ITYA 4HKUA 3B6CA 1GUUA 1UI5A 1U9OA 3F1BA 5EF6A 3VUQA 2IBDA 2AHQA 4XICA 1IDYA 1BL0A 1QVTA 2CUEA 2L7MP 1JKOC 1ETVA 4JX6A 2E19A 4DYCA 3JRCA 3HIMA 4ACIA 3BQZA 3S2DJ 3SDGA 2NVTJ 1BA5A 4AC6A 1ETXA 1DU0A 3HBLA 3VVXA 4AYBN 1FIAA 3KNWA 3DEWA 5C4YA 1EF4A 5C44J 2DG7A 4JNNA 2DMNA 2LFBA 4FE7A 4BKXA 2R5YA 1FTZA 2Y9ZA 1PUFA 1I50J 2QKOA 2Q24A 2D5VA 2K9NA 2AO9A 5FKMA 3GTQJ 2QWTA 4M6VA 3BTCA 4MO7A 5EZHA 2NOGA 4IEJA 4JP0A 2R7ZJ 2X6OA 2XPWA 2DA4A 2GM4A 2WB1N 1D5YA 4A3JJ 1A6IA 2LP0A 3HOZJ 5M3MJ 4IHYA 1OCTC 3O60A 4B3AA 2HDDA 2JA5J 2WAQN 1JJ6C 1X2NA 5IOYA 1LE8B 1GT0C 1WPKA 5FKNA 2CRGA 2GBYA 3QPSA 3V78A 2UXOA 1FTTA 1B72A 4A3DJ 4JKZA 3G56A 3L1PA 2GUHA 4MFDA 5FKLA 2ZCNA 3BR5A 3S1NJ 5IYCJ 3PO3J 1BW6A 2R5ZB 1ZKGA 3ZQHA 2LD5A 2Y2ZA 5DTDA 3LSRA 4MIMA 2WGBA 2Y9YA 2UXHA 3LSPA 1JT0A 2LK2A 2OF7A 4GCTA 1WGXA 1IUFA 1SANA 2VKEA 1GV2A 4XRSG 2QIBA 3F0CA 3ZQCA 1DU6A 2ME6A 3JRDA 2JMWA 4C3IJ 3GTOJ 3QBMA 4C2MJ 3P9TA 3SJMA 1WI3A 5FKOA 3GTKJ 3HTAA 2MG4A 1I6HJ 4ME9A 1IRZA 1JTYA 2OERA 2FJ1A 3VIBA 4D7NA 1UHSA 4X1EA 2W48A 1RR7A 3JRBA 3A01B 3NAUA 1XG1A 4IHXA 3TP0A 4L62A 2XB0X 2R0QC 2I10A 2XRLA 1VFCA 3ZQIA 4MK6A 3HOXJ 1RETA 3HDDA 3EUPA 2LR8A 2M9HA 1T33A 2DN0A 4XK4A 3OSFA 3GTLJ 1JUMA 4UUTA 2OPTA 2Y30A 2JK3A 1MBJA 3HB9A 2TCTA 1LE8A 3BTLA 4BBSJ 3S2HJ 3RH2A 4MXMA 3GTPJ 3NARA 2L0KA 5HSZA 1OJLA 5K7FA 1QPIA 3FISA 1ZR4A 3BRUA 3FK6A 2K40A 1XS9A 1HLVA 1MBKA 2JN6A 4D7MA 3GEUA 1OFCX 3HTJA 4NN1A 3RD3A 5GP9A 2CUFA 3Q0UA 2JJ7A 5E3NA 2CQQA 3TEDA 1IDZA 3JRFA 1AKHA 2NP5A 5F0CA 2RASA 3BTJA 1W0UA 3NNRA 3CRJA 3RZDJ 2JA8J 4G12A 2GENA 3ZQFA 2REKA 4GCKA 2VUMJ 3CDLA 3KZ9A 4M3GA 4JYKA 5EG0B 3JRHA 1AHDP 4A3GJ 1UG2A 1SFOJ 4W97A 1MBEA 2E1OA 4Y7NJ 3D1NI 4NDLA 4XIDA 3PPBA 4JX5A 2ZCMA 2DA6A 2QCOA 5F0HA 2B63J 4X6AJ 2XGEA 4NELA 5FHPA 3A01A 1FEXA 1HDDC 2HKUA 4FE4A 2L9RA 2WV1A 4GFLA 5FKKA 2DTZA 1Z0XA 3BR6A 2X48A 3PO2J 3VOXA 3VVZA 5HAWA 2KT0A 4A3MJ 1YRNA 4RBOA 5IP7J 2K9SA 1Y1VJ 2XDNA 5K7ZA 4UUSA 3S14J 5FMPA 2QF7A 3ZOBA 2CU7A 2GFNA 2HOSA 5FLVA 2CQXA 2K9QA 2CJJA 3O8GA 2ECCA 3GTGJ 4A69C 1IG7A 3TW7A 4AC0A 3LNQA 4S0HB 3WHCA 5IYDJ 1O4XA 1XC5A 2HI3A 1MSEC 5E3LA 4YZEA 3BT9A 1WH5A 3HKZN 3BCGA 5EZGA 3GZIA 3RZOJ 1ETQA 5C4XJ 4BBRJ 3VW2A 4V2GA 1ZR2A 1U8BA 1U9NA 5J1YA 1B8IB 1MBFA 3IUVA 3HGYA 3CMYA 2DA3A 2JWTA 2TRTA 1MSFC 5JLXA 4C3HJ 9ANTA 4DYQA 3C2BA 5FJ8J 2HOAA 1F36A 3BR1A 4CYCB 3CWRA 2Y31A 2E2HJ 3FKIJ 1H8AC 2NX4A 3HTIA 4B4CA 4FTHA 3A03A 2L7FP 2NS8A 2ZB9A 5E3OA 3LSGA 5D1RA 1VNDA 5EEAA 3DPJA 3MKLA 1HCRA 3GTMJ 5HBUA 3I4MJ 1W0TA 5F0FA 3HOWJ 4B1RA 2G7GA 2DMTA 2FX0A 1LFBA
chains in the Genus database with same CATH superfamily
5D5XB 1MMSA 3I64A 4WXCA 2Z9OA 5IY5H 3IH3A 2ECBA 1LKXA 1QPMA 1XSDA 1ON2A 2A2FX 1R71A 2EZIA 3BZ6A 2B7EA 3VP5A 3V42A 2WAFA 1RIOH 2ID6A 1EH7A 3SXYA 1D1BA 4LFUA 3OYNA 2CV2A 5KHDA 4I0BA 4GRIA 3H3UA 2VT3A 3PSFA 1IC8A 3OYJA 2IA0A 3FZVA 3BJAA 2EA2A 1STZA 3DP7A 4UV9A 4WK8F 2QSFX 2KJBA 3OYHA 3F6VA 2DOFA 5E18F 1KU2A 2UXNA 2NVYJ 3VPRA 3AG3H 2QSGX 2MSYA 3GXOA 1YITI 1P7IA 4IVNA 5J6XA 4M6YA 2YVHA 1W5SA 5DM6F 3TKYA 3Q0VA 1TWAJ 1MNMC 2LLKA 2I8DA 2HZTA 1I3QJ 2P5KA 3CUQA 3ON2A 1ZGWA 4L5JA 2DFEA 3L9FA 1FP2A 1VQ5I 1VI0A 4LK0F 2WV0A 1OCOH 3CF2A 1ETOA 4Y33A 1ONVA 1EH8A 2ZKZA 2NS7A 3KYCB 3CD6I 1ZGAA 4J01A 5GPAA 1Z3XA 2O9LA 2PBIA 1S3JA 2IRFG 5F08A 3ISPA 3ABKH 1Z6RA 1Y8RB 4A6EA 2F07A 2RREA 2Z2SB 5J3LA 4Q47A 1Y0UA 3C2HA 3OS1A 4I76A 4IRVA 3IH2A 1IRFA 2LTPA 1YIJI 1N25A 2ELKA 4A3LJ 4HYEA 3LOCA 1RESA 2O8XA 4L0ZB 5DCFA 2ISZA 2ESNA 3T1BA 2BEOA 3JCUC 1X58A 1U78A 3CESA 1GVDA 1IV8A 1OR7A 2W24A 2CMPA 2JPBA 4BAYA 1LFUP 2JUCA 2K86A 2CGPA 3OYEA 4NBQA 3ZQGA 2O7TA 1YQAA 3HOVJ 3DF8A 3DKWA 4IX7A 2E2JJ 4U7DA 3F8BA 3PFYA 1A5JA 2OV7A 1SFUA 1ZK8A 2KRHA 3KLOA 3TW6A 3S15J 4MTDA 1UELB 5D5WB 1SVLA 3M4OJ 5EDNA 2X51A 1FMVA 1F1ZA 4XORA 3MKWB 3DQVC 3JAMK 1APLC 1QHGA 2HPMA 3ZMDA 2PI0A 2XF5A 2D6YA 1Z7UA 3H5RA 2DOAA 4A3KJ 3SYTA 4RB1A 3CCYA 1ETWA 3BCBA 5CW8A 4CCJA 1DDNA 4Q5SF 2DMPA 2M1BA 3HKZA 1TWFJ 2ZXHA 5E8GA 1WCMJ 3DKYA 3IUOA 2R92J 2ID3A 4Y52J 3LMMA 1MH4A 4IHTA 2ZFUA 2OI8A 4BEHB 2GLOA 3LAJA 4XRMA 3QYBA 3HYIA 3MN2A 3C1DA 5F1RA 5M3FJ 1SVMA 2P0WA 3BZKA 2FQ4A 1KZHA 2EV0A 3D5RC 2K3FA 3Q0WA 2ZOZA 2LVSA 2VODA 3VOEA 1KYZA 3VW1A 3PIOF 1UZCA 3GFMA 3RKXA 1TW3A 2UXXA 3PASA 1ENHA 3COLA 2V57A 1UI6A 3E7LA 3PNYA 2VE9A 2HQ5A 3S17J 4L9JA 4I01A 2CV1A 3I56I 4AVPA 3CCMI 1H9TA 3OWTA 3S2WA 3HTHA 4DZJA 1S72I 2XC7A 1WQ2A 3AL0C 2G3BA 3ON4A 3BG3A 4HX8A 1I39A 2N8GA 1FY7A 1B8IA 4NC6A 5C4JJ 4UUSB 3I5UA 3P9IA 3BG6A 1FIPA 2FMYA 4A3BJ 3ANGA 3BPVA 3OL4A 3I9V2 3CCRI 4NC8A 4CICA 4HNVA 3M07A 4LOCA 3ANPA 2AXTC 2Y0SA 2RHAA 4NQWA 4DNCA 5K5OA 3KP3A 3V7RA 5CXGA 5DV5A 1FLIA 1ODDA 2CV0A 1R5HA 2K02A 2XAUA 4HBLA 2QOPA 4UDSA 3BWGA 2UXIA 3JRGA 1FX7A 2XAQA 4HDUA 2CFOA 3ELKA 3SFZA 1W5TA 5M5XJ 5EGOA 2EQRA 2BHYA 3I4NJ 1R7JA 2XB5A 2ACJA 4BDYA 2FNAA 1ZN2A 2WAEA 1RKTA 4GCVA 2YS9A 1GUUA 4B44A 1U9OA 1XGSA 5EF6A 1BL0A 4XICA 3EDPA 1IDYA 3MMYB 4RB2C 2PJPA 1QVTA 2CUEA 2ADUA 4ENJA 3GFIA 2M5WA 3BQZA 4OIPF 1IXSB 4UVBA 5FFXA 2JA2A 1OKRA 2ZJQF 1ETXA 2KKOA 1DU0A 1TBXA 4RMNA 3S3MA 2HEOA 4GDFA 4HQEA 1HC8A 2FOWA 5C44J 4BL0B 2LFBA 3K0LA 1QHHD 2R7XA 4XOTA 2HYFA 3T8TA 2QKOA 3RCOA 3M7GA 4AIKA 2RNJA 4KICA 2HZDA 2VBWA 3Q9SA 2V1UA 2XF6A 4JP0A 1XTAA 2M7AA 2WB1N 5J40A 3E5QA 1UFMA 2E35A 4A3JJ 1D5YA 1A6IA 4BJ5C 4M9XA 4G7ZF 4A5MA 1DGWY 1FNNA 4NB5A 3H35A 4I98B 1D8KA 5IOYA 3J7YJ 1V5EA 1GT0C 1LE8B 4M74A 3R4KA 1BR4A 2GBYA 4A5NA 2P7VB 3I4PA 1B72A 1OCCH 1VQ4I 2DPUA 3E3VA 1IN6A 2ZJPF 1BI0A 3OYGA 4ZYEA 3WTUC 1D1CA 3BR5A 5IYCJ 3A4CA 1YO5C 1YE9A 1ZKGA 3E6DA 2XAJA 3J80K 2BXYA 2Y2ZA 4IQ4A 3LSPA 1N75A 2R7DA 3AG2H 1IUFA 2VKEA 5ERIA 3L2RA 2O61A 4MQ9F 1SMTA 2ZY9A 2R4GA 2KIUA 3M8JA 4N9HA 4G7OF 2CUJA 1VQMI 1T6SA 2JMWA 4HLYA 2B3WA 3P9TA 1C0WA 4ZYHA 5FKOA 2CH0A 3GTKJ 2MG4A 1I6HJ 2X6WA 1IRZA 1SMYF 1HKQA 4FQGA 5GTIC 3TGNA 1UHSA 2VL8A 2W48A 1JHHA 3JRBA 1XG1A 1W7PA 2Y75A 3PQJA 2KPMA 2I10A 4BUPA 2JUGA 1WI9A 2WC2A 2IS6A 4MK6A 3C3WA 4LMYA 4CGZA 3HOXJ 2FJI1 2BW3B 4ZDPA 3HDDA 2QKMB 2LR8A 4XK4A 1TZLA 3CUQC 2JRMA 1DGRM 3CJNA 1G4DA 1FOKA 2OPTA 2GXAA 4UB6C 2IXSA 3F8MA 4IHSA 2C6YA 2ZC2A 2ZMEC 2EFPA 2HKOA 1LE8A 1S7AA 3BTLA 3N4MA 3K4BA 4G6TB 2RV8A 1FOXA 1YW7A 3RH2A 3N97A 4MXMA 2XASA 4PCQA 3HTSB 4NHJA 2MC4A 4HF2A 5HSZA 1BI3A 1XGNA 3E5UA 5K7FA 3ERMA 3QU3A 4ENMA 2HQAA 1HW5A 3M8FA 1KU7A 1XS9A 1XGMA 2LKSA 2AQEA 4BHBA 3LL7A 2BVLA 1OFCX 4WXHA 1R00A 3RD3A 5CVIA 4NUBA 1PJRA 2JJ7A 2DDBA 2V9PA 3JRFA 1N77A 1IAWA 5F0CA 1WJ5A 4L9NA 1SD7A 3OY9A 2GENA 2K27A 2KJCA 3ZQFA 1TNTA 2IW5A 1BJAA 4JYKA 5L3FA 3JRHA 1UG2A 1SFOJ 4UUVA 4XBFA 3O6BB 4NDLA 3L2QA 5B1AH 2BGCA 4EJVA 1PP8F 2F4IA 3ML6A 1O3QA 4JBAA 1DP3A 2QBYB 4NELA 2V4JC 5FHPA 2ETHA 3K70D 4L0YB 5JI6A 5LGTA 4BJ6C 5HDGA 3EETA 2MLKA 5FKKA 1HBXG 3BR6A 3VVZA 3PO2J 5HAWA 4A0YA 3LQQA 2L9VA 2Y48A 1X3ZB 2EFWA 5IP7J 4CXFA 1V55H 1S29A 3R6SA 5K7ZA 2L4MA 5HNFA 3S14J 3G2BA 2FBIA 1FBQA 2HOSA 3GWZA 2K9QA 3ABTA 4MEYF 1TLHB 4II3A 2DBBA 2W85A 2KISA 4TV7A 3REOA 4BE0A 2KIMA 3KIOA 3I53A 3ROUA 3EUKL 4C30A 4E7SA 1E3HA 3QPTA 3BG7A 5IYDJ 1O4XA 4JQFA 2HI3A 5HDNA 3BT9A 2HWVA 3PJRA 1MNDA 2R7UA 4HNUA 2JVHA 3RZOJ 1ETQA 5C4XJ 4ZJZA 4BBRJ 3VW2A 3PUFA 3DLAA 4V2GA 3LSTA 2P4WA 2Z99A 2DFHA 4KIBA 4MHGA 5FLXZ 3CMYA 2F4MB 2H27A 5JLXA 4LG0A 3X2QH 1VZ0A 5FJ8J 1F36A 3LA2A 2G7HA 2EPFA 4CYCB 4QLCU 1LEBA 2GZWA 3GF2A 2E2HJ 3FKIJ 4RM3A 3M9AA 5ICFA 4HV6A 3U21A 3SEZA 4B4CA 4E70A 3HTIA 4B8XA 3HHHA 4OU0A 4XMYA 4PGGA 1R22A 3LSGA 2A6EF 3L09A 2A6TA 5AIPA 4XOPA 3K1MA 5CVJA 3RYPA 3I4MJ 3K10A 3PSIA 4EJOA 2V9KA 1LFBA 3GYHX 1G3WA 1IG7A 4O3MA 2G7LA 3IRRA 2QYOA 2IGNA 1FP1D 4H4KC 3NPIA 1DQUA 2F5EA 2P7CB 2A05A 1FC3A 2KLOA 1REPC 3PIPF 1L3LA 4JX4A 4F7ZA 1FMWA 2JZYA 4KWAA 3TDUC 4GFKA 5D19A 1R5ID 1LUJB 2DI3A 2H1KA 5C3EJ 3HEFA 3WGIA 3TBIA 2HOTA 4QSHA 2XPUA 3K6GA 4RLQA 1VQ9I 2MH2A 1A6QA 5TISC 2WY7Q 3OYDA 2XGXA 5J1RA 3WU2C 5HLHA 1W4MA 4ZDOA 2O3FA 4D5CA 4CCOA 1DPUA 3WGGA 3FHZA 4HDVA 2V9VA 2FD5A 4Q4ZF 1KQ8A 5D5VB 1M1EB 2GOMA 1X3WB 3LSHA 4CCKA 5JHFA 3JREA 2VPRA 2R5YB 3FF5A 4N4OB 3GBGA 3TMOA 2R5ZA 2VC1A 3GUDA 1H89C 4L18B 2FBHA 4U9NA 1IRGA 3QPHA 3P5JA 4BHCA 5DAJA 4JL3A 5J8CA 3FXQA 4CDGA 1D0YA 2IJLA 2H09A 2OA4A 1D0ZA 5FROA 4HRIA 2VOPA 3KLNA 2JT1A 4BQNA 1R6RA 4V19K 3VB2A 3AAFA 2R93J 2V1NA 5J8FA 3BNIA 3ZRGA 5AQCA 4ZZDA 1KONA 2ZO4A 3ZGKA 4RGSA 3EYIA 1S6LA 3FDYA 2OBPA 2ZNZA 4WWCA 1R36A 1A36A 2UXUA 5GPCA 5CPRB 1IJWC 2CS3A 1SD6A 3TO9A 2O8KA 4YFXF 4DYRA 1MH3A 2CO5A 2W00A 1A35A 1J7KA 5JVTA 3HL2A 1P4WA 4ZC3A 3WTVC 2ZOYA 3BTIA 1LVKA 3U9GA 5IP6A 2IEKA 4XL9A 2VJ5A 5IT9K 1IV6A 1W36C 2MD5A 2BVMA 1NK2P 4ENKA 2COBA 3ZQLA 1O7LA 1Y1WJ 1JGGA 3QYEA 1MZBA 5E1ZB 2VJJA 2PBXA 2DQLA 4DJAA 4Q48A 2EK5A 2F5DA 4HV5A 1A04A 3QP5A 4XKVA 1Q1VA 2XRNA 3WE2A 1U0JA 2PMHA 5CLSA 1ETYA 3AQSA 3VW0A 3KZYA 4EM0B 3HRMA 5H2FC 4LIUA 2H94A 3S1MJ 2NRAC 2IP2A 3QYFA 3WHBA 3KEQA 3TO6A 3CF5F 5FB2A 2HYJA 1JT6A 2CQKA 2K3PA 1MMDA 4HQMA 3QODA 4D5FA 3RDIA 1QRYA 5HLIA 4B09A 3ZMTA 2HNHA 2K85A 5ICEA 3MNLA 2M7BA 1WWXA 3GEZA 5D8LB 4M3EA 2V6EA 2KRFA 1YI2I 1K78B 5ICGA 3G1MA 1X2MA 2CG4A 2V6CA 4M71A 2A68F 4OIOF 3RQIA 4KT5C 4C2MA 4QIWN 1MBHA 1X1PA 1AKHB 4P96A 3MCZA 2P81A 5LRRA 1ZH5A 4HX7A 4N0BA 2VXDA 1R9TJ 2XSDC 5CXIA 1JHFA 2PLYA 5H6RA 2JA7J 3M8EA 3M1EA 5M5WJ 1GVJA 3S16J 3G1OA 2BZTA 2K4JA 2E5ZA 2KIQA 1KQ0A 4E7ZA 2VKVA 4C2TA 3OIOA 3IV5A 2RGVA 3JTGA 2LOOA 2L3DA 4EEFG 3KEYA 5DUIA 5CVRA 1T56A 3BG9A 2DMQA 2EFQA 4KT6A 4CZZA 4Z6YA 5KNLA 2G9WA 2O03A 4B48A 3G3ZA 4B43A 1J75A 2Y0SN 3VYSB 4HW0A 3LSJA 4H0EA 5L3CA 3AQTA 3F72A 4HZFA 3WODF 1YRNB 1AU7A 2STTA 3ABMH 1VQNI 2X6YA 3ABUA 3BR2A 2DLLA 5K58A 1H9GA 2R7QA 2LBFB 3A2KA 1OCPA 2E60A 1T8IA 3ZMZA 3NEUA 1Z7LA 4ICHA 2LKXA 2YX4A 1OYWA 5CQGA 4UNOA 3BR0A 3W6JB 4BGDA 4DIQA 1G3TA 5A2QK 5BPIA 3OSGA 3S8PA 4GGGA 5EFYA 1SD4A 3L7WA 2ZMEA 4XLNF 2KDOA 4A12A 2A5WA 4M3BA 3PM1A 2GWRA 1VQ8I 5FRNA 3KE2A 2Z1DA 3C07A 1Z1DA 2XUBA 3MWMA 1ZLJA 4Y3OA 1YS7A 1FBUA 3RPUA 1J5YA 1AWCA 2NVUB 1QO0D 2XIGA 1ZG5A 1HKTA 5F04A 3NXCA 2WBMA 4AUXA 4IXAA 5IOZA 1WFXA 1P4XA 1QQIA 2X4HA 4NNJA 1TWHJ 3DPLC 4E6KG 5FD5A 4KITB 2YUSA 1R1UA 2HFHA 1HKSA 4W1UA 3RKQA 1ITYA 3B6CA 1UI5A 3F1BA 5EEHA 1KA8A 4BHPA 1JKOC 1ETVA 4AWXB 4DYCA 1BR1A 2FBKA 4PJ0C 3HIMA 3EYYA 1X4OA 1T2KA 2LF8A 1J09A 1MGTA 1YX5A 2NVTJ 1FSHA 3BJ6A 3WU1B 3GMEA 3OIQA 3VVXA 1B6AA 1LJ9A 2HS5A 4HEA2 1EKEA 1Y0NA 3SZTA 5D4RA 1SAXA 3DEWA 5C4YA 3CUOA 3BJOA 4PSWA 4BKXA 2LBFA 3VODA 3A0HC 3CLQA 2D5VA 2LDUA 5FD6A 5FRMA 5EZHA 3BTCA 3KP4A 2NOGA 3MEXA 3E5XA 2XPWA 4U0VA 2EFNA 3P9KA 3E97A 3T0YA 2FUG2 3I3LA 2QENA 2KQRA 3RQ4A 1UHMA 1QZEA 2M4GA 2H8WA 4M6XA 4YEJA 4AYBA 5M3MJ 4IHYA 4B3AA 2E36A 3FMSA 1X2NA 3HPGA 3ONQA 1JJ6C 1EH6A 3BCAA 2A61A 2NYXA 2UXOA 1FTTA 2XSJC 3MZHA 3W3CA 3HXLA 2DW4A 2R7VA 1IRXA 3G56A 2XHKA 5LLQA 3V8KA 2OQRA 3L1PA 5IT3A 5LEKA 2VBYA 3ZMSA 3PO3J 2W57A 1BW6A 1TT5B 5HS8A 3F6OA 3J7AY 3HUGB 3K9TA 5KK1A 1B59A 3ZCOA 4XLCA 5DTDA 2WAQA 2ZSHB 2LK2A 1D5VA 5LGUA 1WGXA 1SANA 1BIAA 3RKWA 3GX4X 3ZQCA 3I0TA 1ZRFA 3CTAA 1LNWA 2ME6A 3ZN0A 2KZVA 1P4AA 3SJMA 1WI3A 3CMEI 2F2EA 2VASA 4UY8I 1YJ9I 4U88A 3DTEA 3K4JA 4G6DA 1RI7A 2DT6A 5TRDA 1XSXA 4X1EA 2RQPA 1LDKB 5L3DA 3NAUA 1S5LC 2RC4A 1R1VA 3OYCA 4L62A 3F8FA 2XRLA 2ZNYA 1WZ2A 3H0DA 4P9UA 1OQYA 1TL8A 3QAHA 5DUKA 2E7XA 5CVVA 3EUPA 1Q1HA 4HLXA 1BC7C 1T33A 2DN0A 4XN3A 1JUMA 2DQRA 4QPOA 2JK3A 2QQAA 2OJED 4M9SA 3HOSA 2HVQA 2HVSA 2LY1A 1J9IA 2DDAA 1XGOA 3PL8A 2YR2A 3HRSA 3CJQB 3NWTA 4G9YA 2YSRA 1X1CA 2QUFA 1MMGA 4RGUA 4LLLA 4F52A 2VIXA 3BRUA 4BEHA 3FK6A 3J81Z 1X1DA 2K40A 5E17F 4AU7A 4KYWA 3GZ5A 2NAZA 4LGWA 4OMYA 2BV6A 3LAPA 2HPIA 4RAYA 2M4KA 3TDZC 3HTJA 1PVEA 3DV8A 3D0SA 4NN1A 3Q0UA 2E71A 3WTTC 2CQQA 3EQLF 3QWLA 3TEDA 1TNSA 3FXMA 3GZ6A 2NP5A 4ZYGA 3F9KA 4O5VA 3PNTA 5H20A 4Y13A 3CRJA 2M87A 4LIVA 2DODA 1IN7A 1G59A 3OIPA 2FRHA 1S8NA 2JA8J 4GCKA 5BMZA 4C9YA 2LF7A 5EG0B 4ZYDA 1AHDP 4HNTA 1MBEA 1OLTA 2E1OA 4Y7NJ 3D1NI 3LWFA 1FWZA 3FMRA 3PPBA 3QOPA 1H0MA 2ZCMA 1MMAA 2DA6A 4X6AJ 2B63J 3IP4B 4CYDA 4FE4A 2HU9A 3MQ0A 3J80Z 1U3EM 2HDWA 1Z0XA 2H1LA 1FYLA 2HGCA 4RBOA 4RGRA 2IS1A 2EFOA 2K9SA 1Y1VJ 1Z91A 1NH3A 4UUSA 4BQAA 1MJBA 2QF7A 5FMPA 2CU7A 3WU0A 4FETA 3OL3A 2JQ7A 2QWWA 5FLVA 4DBRA 2FU4A 2W25A 3F8NA 3KCCA 4IRHA 2PFVA 1BOBA 2BYVE 4A69C 1IW7F 2F48A 1CGPA 4AIHA 2Q0OA 1VQPI 3LNQA 4IZZA 1T39A 4ESBA 3WHCA 2ZCWA 1MSEC 5E3LA 3O3KA 4YZEA 2TDXA 4G7HF 4D0PA 5EZGA 4ZTFA 4LITA 4FASD 3ASNH 2VT2A 1X19A 1G6NA 1U9NA 4I0AA 3BLYA 1MBFA 2HVRA 3HG9A 3C18A 2D2WA 3HGYA 3WE3A 2JWTA 4IJAA 3KP2A 3IWFA 4C3HJ 4DYQA 3C2BA 2IA2A 3U1KA 5LHGA 3VEPA 1NG6A 1GHCA 3W6KB 1TW2A 5BOXA 3G73A 2XF7A 4GXOA 2DPDA 1O3TA 4UHTA 3H9GA 5LEJA 2EWNA 1LPQA 1OISA 1RC9A 4FTHA 1TP4A 2ELHA 2Q8KA 1U5TB 4PDKA 5E3OA 5EEAA 2LKPA 1HCRA 1G3YA 2QSHX 1ZLKA 5HBUA 4KJZA 5KAFC 3RSNA 1W0TA 4B1RA 4LB6B 2DMTA 4ZZLA 1HSJA 2P6SA 2F5VA 3VYTB 2GAUA 4U0YA 3O8HA 3LJLA 2GA2A 3LSIA 3K2AA 3CCVI 5HDKA 1WSUA 1YJNI 2YVEA 1E3PA 3HOUJ 3OS2A 2A69F 2FBQA 4E7JA 5TGTA 4IHVA 2FOKA 4BE1A 4C3JJ 1XB4A 3MAJA 2BY3A 2RAEA 1JTXA 2XV4S 3O2PE 3AG1H 4O6JA 4A0XA 4KDPA 4C2UA 5ICCA 1XPXA 2R7FA 3DCFA 4DGWB 4WIBA 3ZQ7A 1MIJA 1V54H 3S32A 1YHQI 1FT9A 3EUAA 3KKDA 2EH3A 1E2XA 2L2OA 3HM5A 1SEUA 4PJMA 3CJDA 2M2EA 2QQ8A 3G7RA 1IN4A 2XVCA 1HDPA 4MFEA 1QVUA 2EIJH 5DCMB 2MC3A 3FX3A 3T8RA 1PUFB 3VSLA 1YG2A 5FGLA 1QNTA 4L5IA 1ACIA 2IU5A 1W36D 2ZCXA 2IGKA 5BPDA 3A02A 1X1AA 2VKHA 2HOEA 1TWCJ 3KX2A 1LFPA 5EJCA 4EM1A 2M8GX 1B1BA 4FX4A 1R49A 1JI8A 4CGRA 2PJRB 2B1EA 1IGNA 4PGHA 1TT0A 2ZJ2A 1XCVA 3QPLA 1MD0A 1JKRC 1GXPA 1I6XA 5E20A 2GOXB 1A31A 3CJRB 1SVOA 2RKHA 1HOMA 2HXIA 4BJTA 1F43A 1NTCA 4FISA 5B66C 3UKGA 2L7ZA 3SDBA 3CCSI 4LLGF 5JVGF 4E4HA 3WG9A 1YLFA 3CC4I 2RVCA 4UV8A 3BQYA 2BW3A 2GXGA 4A3CJ 4OAZA 3V7SA 3HRUA 3MKZA 2HKXA 2VXZA 1D0XA 3CC7I 5LGNA 2NS0A 4KMFA 1FBSA 3HZJA 4L5EA 2CUZA 5EYRA 1RR8C 5J1UA 3VTIA 3TL4X 1HQCA 1JKPC 1FYMA 1W7PD 5TJJA 4J00A 3K69A 3H3VK 3HOYJ 4OMZA 3B02A 1ZG1A 3LQRA 4JK1X 4EJTA 1IXCA 1T08B 4L9TA 2LMDA 1V5FA 4HAMA 4BY1J 2W82A 1IO2A 1B4AA 1DUXC 2X9DA 3F23A 2Z5UA 2CYYA 5ILVA 2DJNA 3ECHA 3SFIA 3FIWA 3P7NA 3CDIA 3ZMUA 4LK1F 3IKVA 2MGQA 3QQAA 3KFWX 3DKXA 3R0JA 3GFJA 2PMZA 2O7OA 2HQRA 3KEOA 2O0YA 3DLLF 2PN6A 2EB7A 4RA2A 2EILH 4GFBA 2G7SA 2DT5A 3LHQA 3TO7A 5L3GA 1OPCA 1YYVA 3CCEI 4PZJA 6PAXA 5JR3A 4M73A 3KETA 2NVXJ 1AOYA 3FWEA 2CSOA 3MZ8A 3VDXA 3S3NA 4ABZA 2VC0A 2UV1A 1P7JA 2ZJRF 2QBYA 3E7QA 3KP7A 1DPRA 1TWGJ 3JSJA 4A3FJ 5B5EC 1ZRDA 5BNGA 3NRGA 4XONA 2QA4I 2QTQA 1S7OA 2VI6A 1QA6A 3KPHA 5FLMJ 2EZHA 4P5OA 4LG3A 3M1CA 3OYKA 3OYIA 4IKFA 4EVIA 2HTJA 2NOJB 1F5TA 1JUSA 1SGMA 2HYGD 1QU3A 3RI4A 4YG2F 4KA4A 3WGHA 2LY2A 2UXPA 4F93B 2L9SA 1XCBA 4M3FA 1N78A 3HRTA 5HODA 4ASNA 2WADA 4I09A 2ME0A 3LA7A 4N4NB 4BNCA 1UB9A 3NWSA 4MNUA 1OCZH 1SFXA 1XDSA 3K4CA 4AIDA 2MD0A 3AG4H 3BY6A 3R0AA 2NVQJ 1LDDA 3JTHA 1UHWA 1IN8A 2DA2A 2NP3A 3CC2I 2QQ9A 3F8CA 2M0CA 1KU9A 3F3XA 4KN7X 2YU3A 3KP6A 1V5GA 5LBQA 3F21A 1W5CC 2MFZA 1H88C 4GYGA 3I54A 2F6CA 5GADJ 1JUPA 1FYKA 3GO5A 4P1WA 3FM3A 3G4SI 1QZYA 2W84A 2DK8A 2MA3A 3RTRA 4IF4A 4F91B 4CYCA 3MFKA 2UZKA 5IT9Z 3BHQA 2KZGA 3OOPA 1ZTRA 1FZPB 5E3MA 5M5YJ 3B81A 2G0EA 2KHMA 2O6GE 2Q2EB 4RAGA 1CF7B 2KFDA 1ZQ3P 5IYBJ 3G71I 4XRFA 1XMKA 1UMQA 3GLXA 1EA3A 3KKCA 4G6QA 3V6GA 1Z21A 2RQQA 3K7AJ 1WVRA 1JJ8C 1BR2A 3WTSC 3OR2C 5D18A 2JPCA 4PJJA 4D9JA 5DS9A 2IT0A 2DG8A 1MW7A 3HHGA 3RPQA 2HYTA 3RIRA 4BY7J 1MDMB 5JLWA 2VN2A 3I59B 3BPXA 4P55A 5ED4A 4ESJA 1G3SA 1BN5A 3IRQA 4HKUA 3HTUA 1G8XA 3VUQA 1WJAA 4GYIA 1K4TA 2IBDA 3DU6A 1ZAOA 1FOWA 1XMXA 2FF4A 2ZFWA 5L3EA 4BH9A 1EV7A 3S2DJ 3B73A 3SDGA 2ZSIB 4LJZF 1U2WA 4MTEA 1BA5A 5CQEA 4FHTA 2B9SA 2R7TA 3H36A 4AYBN 2OQGA 3DBLB 1K79A 3PQKA 1EF4A 2RDPA 1I1SA 2DMNA 2HR3A 1FTZA 2R5YA 2Y9ZA 1I50J 3K8PC 2Q24A 3LSKA 2QWTA 3GTQJ 2L02A 1EJ9A 4M6VA 4MO7A 1X3UA 4HF0A 4D1QA 2X6OA 4YIIA 4PFOA 4PJLA 2Y0MA 2GM4A 3DPTA 1JE8A 5DEQA 2LP0A 1IXRC 1Y39A 3COAC 2K5CA 1OCTC 3J7AO 1V4RA 2KRCA 5B3SH 2WAQN 4RB0A 3ZPLA 1WPKA 2VQGA 3R60A 5FKNA 3QPSA 3V78A 1ZRCA 1Y6IA 3HSRA 3MKYB 1WRJA 4A3DJ 2E34A 1XSVA 2GUHA 5LFAA 4MFDA 5FKLA 2E1NA 3TOBA 3K4LA 2OD5A 1LEAA 5E79C 5JHUA 3ZQHA 1ERDA 2LD5A 5J4YA 3LSRA 4MIMA 1I5ZA 2Y9YA 2UXHA 4UVAA 2OF7A 4F3QA 3CUQB 5J4VA 3L2UA 5A2QZ 2BXZA 3ULQB 1GV2A 4XRSG 2QIBA 5L3BA 2UUZA 3F0CA 2XDVA 5DD4A 4B47A 4QWQA 5KCMA 3JRDA 4C3IJ 4FX0A 3GTOJ 3QBMA 4C2MJ 4K2EA 2IA1A 3A0BC 1OYYA 1S9HA 4ME9A 2LSOA 3VIBA 4A6DA 4EM2A 1MKMA 2MBFA 1KU3A 3BROA 4XLAA 3CMMA 2RN7A 1RZ4A 3TP0A 1O3SA 2XB0X 1QGPA 2V26A 2R0QC 3H3ZA 3K4KA 1F4KA 2Z16A 4XKCA 1YOVB 3LFKA 1RETA 4XN0A 1IF1A 4BQQA 4UB8C 1P92A 1WHUA 2MABA 4UUTA 2RNGA 3D5LA 2R7OA 3OS0A 2FXAA 1MBJA 4ZYAA 1QBJA 1U5TC 2TCTA 4WCGA 3EPZA 2Q1ZB 1KGSA 2X85A 1J0RA 4BBSJ 2EIMH 2ZXJA 1I27A 3NARA 2A3SA 1YW8A 2L0KA 2E7WA 1YJWI 1OJLA 1Z9CA 1QPIA 2HQNA 2P6TA 3FISA 1ZR4A 1K78A 4IL6C 3CZ6A 3NQOA 2W7NA 2CW0F 3OYAA 4WX9A 2CWEA 1F9NA 1MBKA 3IAS2 1VQOI 3GEUA 3ECOA 3OV8A 2Z3YA 3JAMZ 2XROA 5E3NA 2CW8A 4ENNA 1IDZA 1AKHA 4CZCA 3V8LA 2RASA 3C7JA 3BTJA 3FHNA 3HJEA 3RJPA 2ISYA 2LH9A 5GAEJ 4BQOA 3RZDJ 2E5NA 5HLGA 1HA8A 2VKDA 4WF2A 3CDLA 1FOYA 3QU6A 3KZ9A 4A3GJ 4KMUX 2OTJI 3ZQQA 4W97A 5E1WA 4BU2A 4EMSA 4DBQA 3WTYC 5K5RA 4XIDA 2VJ4A 4JX5A 2DYSH 1HW1A 1T0FA 2QCOA 3FKJA 1FEXA 1DP7P 5HLTA 2HKUA 1ZARA 3WG7H 1VQKI 3VOXA 2OZ6A 2KT0A 4A3MJ 1KQ9A 5GTHC 1YRNA 2DK5A 2HDCA 2XDNA 2LC2A 3U1DA 5GAHJ 3KP5A 3ZOBA 4OIQF 2GFNA 2F5CA 4PJNA 1WJCA 2CQXA 2CJJA 1NG7A 3ZN1A 1VTNC 4KISA 3GZNB 1P6RA 3GTGJ 3TW7A 4I2OA 1UG0A 1XN7A 2A5YB 3L2WA 1MNEA 2OAZA 3OYMA 1LVAA 3CJTB 1WH5A 1VQ7I 4KNYA 3BCGA 2LNBA 3W2VA 2L54A 1VQLI 4YFKF 2DOEA 5J1YA 1B8IB 5JFRA 3IUVA 4I02A 2DXIA 3IWZA 5D6EA 1MSFC 2VBZA 9ANTA 2HOAA 3BR1A 3FXOA 1USTA 4BXFA 1OMIA 3SZGA 3H9QA 3VWBA 2CFXA 1P2FA 3H9JA 2YPRA 3ABLH 1H8AC 2M45A 4IRIA 2E1MB 4XR6A 4XSZF 3RPUD 2NX4A 4NQWB 3A03A 3ZXSA 2NS8A 4CA0A 2FNPA 2ZB9A 1MJAA 4HX4A 3DPJA 2EV6A 3DXJF 3OYBA 4YRVA 3GW2A 2W1OA 3GTMJ 3DWLE 5F0FA 3HOWJ 2ICWG 2FX0A 2K4BA 2KP6A 3S1RJ 4L9VA 5EGOB 1FJLA 5IPAA 2IGMA 3EUHC 3Q5FA 4R79A 2FEZA 3Q3SA 1B9NA 1MJ9A 3KZIC 1NK3P 1WJDA 4RLFA 1YFHA 2XGDA 4UXNA 1G2HA 4E7LA 1E17A 2YVXA 2R3SA 3JRAA 5F27A 1RUOA 2D1VA 3FK7A 4AF5A 1BJZA 1U6GA 5F1JA 4Z2YA 4G8XA 1Z6TA 2QKLB 4I99C 1WJFA 1MBGA 4OD5A 4FCYA 3BR3A 1D1AA 4PFPA 1BBYA 4RS8A 2W53A 2EZLA 4RDUA 3IHUA 1TC3C 1K83J 4MEXF 3DEEA 2MH9A 3JRIA 2DFFA 3BZCA 5E8IA 1FPQA 2DAOA 3HGGA 4IOCF 3HUGA 3EGQA 4KN4X 3UNGC 3BC8A 3GTJJ 1RKWA 3ASOH 3QRFF 1X4PA 4EJWA 2VB6A 4BXXJ 2MLGA 2EBIA 2JRTA 2QGUA 5DD8A 5HS7A 3W2WA 2XGCA 3OOUA 3JR9A 2PZ9A 4CCMA 4XLEA 3TP3A 5HVQC 1BC8C 3M3YJ 2HXOA 4AM3A 4XLHA 3F22A 1JKQC 2R7RA 4XQFA 4OAYA 3HPHA 1B72B 2H8RA 1K61A 5IP9J 4OINF 4DZPA 2QVOA 1HW2A 1BW5A 1BI2A 1YIOA 2IS4A 2KMUA 3KZZA 1R23A 1WH7A 2NXNB 1VF9A 2L9NA 3BJBA 3MZYA 2UWMA 1P9QC 4ITVA 1GV5A 2A6HF 1Z77A 2IS2A 2M3AA 2XPVA 4M9ZA 2J5PA 1T38A 2JA6J 1RPWA 3HIFA 3H5NA 3H92A 2VE8A 5HS9A 3CMAI 2ZBKA 2DA1A 2WY8Q 1UJ8A 1ETKA 2PMZN 1HSTA 4A3EJ 5D5UB 2AXLA 3PFIA 3VOKA 3E0JB 4HPQA 4QTRA 2VBXA 3FXLA 2V1XA 1Z3YA 1JXSA 3QOEA 1ZREA 2IAIA 3HE0A 3BG5A 1W7PB 2H6BA 4G94A 3J81K 2X0LA 3E6BA 3ZMVA 3OYFA 4MLOA 2WA0A 4HSRA 4IHWA 2QLZA 1GDTA 1TTYA 4E7KA 1AA7A 1Z05A 3FXUA 3IC7A 3V8JA 1S7EA 1MMNA 3E6CC 2DA5A 1ZELA 4A93J 4YIRX 1ULYA 3ZR8X 3FM5A 3JW4A 2H6CA 3DPUA 5EG0A 1R4MB 3IH4A 5CKTA 3V4GA 3DFGA 1CQTA 3G6EI 4A3IJ 1NHAA 2VLAA 4M3DA 4GCLA 2PQ8A 2QM3A 4XNFA 1OYIA 2M34A 4EGZA 5CYVA 2KIFA 3BP8A 3I58A 2NNYA 3FBIB 2GA1A 3QKXA 4PXIA 3T6NA 1SAUA 3H1CA 3AKZA 1TQPA 4J19A 2LY9A 4M72A 4ON0A 1W1WE 1Y56A 4BXUA 2QEXI 2EIKH 3TOAA 3V7CA 2DMUA 2XKPA 5D4SA 2IGOA 2IVMA 1HF0A 3MVPA 2OC6A 5LD2C 4LB5A 5AIQA 2STWA 2L7KA 5ILSA 3S1QJ 1UAAA 3DTIA 1BIBA 3ERED 3NI7A 1Z67A 2J5OA 3PNVA 4DQ2A 3VVYA 1GLNA 3LSMA 2EZKA 3JSOA 2DA7A 5KVRA 2A07F 1ORKA 4DW6A 1PUEE 2GIVA 1HXDA 4LD5A 2YU9J 1LQ1A 4YIFA 3GLLA 4DVYP 4AIJA 2FA5A 4IRGA 3DBHB 3CQZJ 3S93A 4E7HA 3CCUI 2Z33A 2W4SA 4QPQA 2OCEA 1SC7A 4YELA 1ZYRF 1D3YA 2D1HA 5K7HA 1B9MA 5KAIC 1R58A 1T95A 2MW8A 3B6AA 3T5XA 4F92B 3UR3C 4XRSA 3IL2A 1U8RA 3W6VA 2WUIA 2VOOA 1R4NB 4BE2A 5DDGA 5ILUA 1XMAA 3G1LA 2X1DA 4BS9A 1WJEA 2K9MA 3CP2A 3H0GJ 2NNNA 2E2IJ 5H9TA 3A1YA 3VSKA 1J2XA 1LDJA 2L5QA 1T98A 3BDDA 3IAM2 4AD9A 2IPQX 1VQ6I 3DBRB 1U5TA 5B1BH 3S3OA 4I6ZA 4MQVA 4HF1A 1T0FC 2KDZA 3H5AA 5D8KB 3R61A 4ANJA 4BDZA 2Y69H 1RNLA 1POGA 2D45A 3S5RA 4XLFA 2DT7B 3RKYA 1E3OC 2L01A 3AFHA 4F55A 4ZTJA 1YTYA 1GXQA 4S05A 2LREA 3P9CA 2M30A 4U87A 2AS5F 1USSA 2X1EA 2ZXWH 4LG0B 4V2FA 3LWJA 2OU2A 2WWYA 3FRQA 2F4OB 4IPAA 3N05A 2FE3A 3HSFA 4OD4A 1OR7C 1RUNA 2PFBA 4WXDA 2AHQA 4NC7A 3CP8A 2L4AA 2L7MP 4Y17A 1WKMA 4JX6A 2E19A 3JRCA 4E7IA 4ACIA 3IKTA 2K9LA 4EATA 5K5QA 2VQLA 3OYLA 2DO7A 4AC6A 5FFZA 3I71A 2FSWA 3HBLA 4B3XA 5LHHA 1FIAA 2F5FA 4HSTA 4R8HA 3VFZA 2OTLI 3KNWA 1YS6A 3K1PA 4U7BA 2DG7A 1E0EA 4FE7A 4JNNA 3FXRA 5DCMA 3W2AA 2P5VA 1PUFA 1WJBA 2DCEA 4ZH4F 5H6QA 2K9NA 2AO9A 1UCRA 4OOIA 5FKMA 2P8TA 2ESHA 3FXKA 2G7UA 1I1GA 2V1DA 1TQMA 4IEJA 2R7ZJ 3SQNA 5J47A 3CO7C 4OWRB 2V7FA 2DA4A 3OR1C 4CH7A 3CO6C 1XDUA 4KIGA 2CW7A 1YX3A 2PJRA 4YFNF 1J59A 2DU9A 2DJIA 3HOZJ 4N9IA 5FO5A 3O60A 1RRJA 2CQNA 5LHIA 2HDDA 2JA5J 1ZGJA 2R7WA 3L2VA 3SWHA 5DM7F 1O7FA 1TQIA 2CRGA 5HOOA 1PDNC 2M8EA 4RM2A 4JKZA 1ON1A 3K2ZA 2I5UA 5K1YA 2BY1A 1IN5A 3Q9VA 4ETSA 4KIFA 1ZHFA 2ZCNA 3CCQI 2WB1A 3C2GA 2LG4A 4FT8A 3S1NJ 3AL0B 1O57A 2COMA 2X1CA 3ESWB 2R5ZB 2VONA 2DYRH 2XKOA 2WGBA 2DFIA 1JT0A 4GCTA 1BM9A 2GXBA 5LRSA 2DTRA 3NRVA 4IO9F 1Y8QB 2VQHA 1DU6A 4U0WA 5CJ9A 4LLNA 3FMQA 3K4MA 3HTAA 1JGSA 5FGMA 3CDHA 2XAGA 4X0GA 3DEUA 4KFCA 2XAFA 1JTYA 4PUSA 2ZXIA 3K1NA 2FJ1A 5CVUA 1LB2A 2OERA 4D7NA 1PP7U 1RR7A 4CCNA 2MYSA 3A01B 4I7HA 4EQQA 4IHXA 4U9LA 4P9FA 3WTXC 1VFCA 2WTEA 5AONA 3ZQIA 2ELJA 4ESFA 2BHZA 2OUMA 4GO1A 3EUHA 3WTZA 2M9HA 3E6MA 3GFLA 2PMUA 3LA3A 4HG2A 3CCJI 3OSFA 4AVZA 2YX7A 3GTLJ 5FLXK 1L0OC 1SFEA 2JSPA 2E1MC 2OCCH 2Y30A 2AQFA 4RGXA 3ZP5A 3HB9A 4XLPF 4HOBA 2BY0A 4RAFA 3S2HJ 4KUMA 5F64A 1KYWA 3GTPJ 1BI1A 1SD5A 2GQQA 3L00A 1IUYA 3L2CA 4IOAF 1IZ1A 1K7AA 4CHUA 4Y4RA 3D5SC 1HLVA 2QQBA 4BACA 2M0MA 4Y15A 3TQNA 4DOZA 2JN6A 4D7MA 1D8JA 3OMYA 2XAHA 2CUFA 5D6FA 5GP9A 1SFKA 5GAGJ 2PG4A 3CLOA 1W0UA 3NNRA 3PUBA 3FBNB 4G12A 2CQ7A 2OZUA 2REKA 2PEXA 3U2RA 2VUMJ 3SZPA 2VQCA 4M3GA 2E1CA 4XSXF 2B0LA 1PYVA 2VPLA 5BQTA 3LFUA 1ZG3A 4XKWA 5BS6A 4CSWA 4ZDLA 5F0HA 4S04A 2XGEA 2BBYA 2JTVA 3A01A 2HTSA 4RB3C 2VJIA 2P5LC 1X1BA 1K6OA 1HDDC 2L9RA 2PX9A 2WV1A 4PK4A 4JOMA 4XKBA 4GFLA 2GIZA 2JSCA 5DYMA 2DTZA 3SEQA 2X48A 2BOLA 3VYRB 4OIRF 2QZ8A 2KL4A 1BOAA 1R1TA 1V3FA 4EGYA 3DU5A 2BE5F 1OCRH 3O8GA 2ECCA 4EV0A 1R5GA 2FQ3A 5F6FA 3DTKA 3GCMA 3FXJA 2EA4A 2BY2A 4AC0A 2O5RA 4S0HB 2Q2EA 4XM3A 3RYRA 1CF7A 1XC5A 4II2A 3NS4A 4A2UA 4R1HA 2JVGA 1FSEA 3HKZN 3E1SA 3KYDB 3GZIA 4IQJA 4BYYA 3K4NA 3KYLA 1XX5A 2EINH 4CCLA 2LYCA 1XD7A 1ZR2A 2X6XA 1U8BA 3CCLI 3I55I 3HSEA 3QP6A 4CUGA 4EJUA 3VYUB 3HC7A 4RAZA 2FMLA 2DA3A 4A0ZA 1MDMA 2TRTA 3WTWC 3K70C 1O3RA 1K4SA 3I59A 1K6YA 4UVCA 5E1XA 3J7ZI 3CWRA 4CO8A 2Y31A 4PSXA 4MGRA 5HNHA 5EEGA 2L7FP 3SHFA 3MD2A 2V79A 1QZZA 3BOQA 1I3AA 5D1RA 2ZMEB 2R7SA 1VNDA 2EV5A 2K7LA 2EJRA 1YW9A 3MKLA 4HA8A 3GVAA 3JSPA 2LRDA 2G7GA 3HOTA
chains in the Genus database with same CATH topology
2G7LA 3S1RJ 3O8HA 5EGOB 3IH3A 5IPAA 1FJLA 3LJLA 3NPIA 2ECBA 3K2AA 3Q3SA 1NK3P 4JX4A 2YVEA 3HOUJ 2EZIA 4KWAA 2FBQA 3VP5A 2XGDA 4IHVA 4GFKA 1G2HA 5D19A 4C3JJ 2ID6A 2RAEA 1JTXA 2H1KA 5C3EJ 3HEFA 3JRAA 2HOTA 4QSHA 5F27A 2XPUA 3FK7A 4AF5A 3DCFA 1BJZA 1IC8A 5F1JA 1MBGA 4FCYA 3BR3A 3KKDA 5J1RA 2EH3A 3HM5A 4D5CA 2W53A 2EZLA 4RDUA 3CJDA 2M2EA 3G7RA 2FD5A 1TC3C 1K83J 1HDPA 2NVYJ 4MFEA 3VPRA 1QVUA 3JREA 3JRIA 2MSYA 2VPRA 2R5YB 1PUFB 3GBGA 2R5ZA 1P7IA 1H89C 3HGGA 5DAJA 3EGQA 5FGLA 2ZCXA 2IU5A 2YVHA 4JL3A 3Q0VA 3GTJJ 1TWAJ 3A02A 2LLKA 1RKWA 1MNMC 1TWCJ 1I3QJ 4BXXJ 2M8GX 4CGRA 3ON2A 2EBIA 1IGNA 1ZGWA 2XGCA 3OOUA 3JR9A 2PZ9A 1VI0A 3TP3A 1ETOA 3QPLA 3M3YJ 2HXOA 1JKRC 1JKQC 2NS7A 1B72B 5GPAA 2H8RA 1K61A 5IP9J 2O9LA 1HOMA 2R93J 4DZPA 2HXIA 3BNIA 1F43A 1BW5A 5F08A 1NTCA 5AQCA 4FISA 3UKGA 2L7ZA 1WH7A 2F07A 5J3LA 1VF9A 3BJBA 4I76A 3IH2A 1GV5A 1Z77A 2LTPA 3BQYA 2UXUA 5GPCA 2ELKA 2XPVA 4A3LJ 1IJWC 4A3CJ 2O8KA 4DYRA 1MH3A 1RPWA 3LOCA 2JA6J 1RESA 2ZOYA 4L5EA 5EYRA 3BTIA 5J1UA 5IP6A 1JKPC 2DA1A 1X58A 2IEKA 1U78A 1GVDA 1IV6A 1ETKA 3H3VK 3HOYJ 2PMZN 1LFUP 4A3EJ 1NK2P 2COBA 3ZQLA 3VOKA 1Y1WJ 3ZQGA 1JGGA 3HOVJ 2O7TA 4QTRA 4BY1J 2E2JJ 2PBXA 1A5JA 2IAIA 1ZK8A 3HE0A 3BG5A 3TW6A 2X9DA 2DJNA 3S15J 3SFIA 3M4OJ 3FIWA 4MLOA 1Q1VA 4IHWA 5EDNA 1GDTA 2MGQA 3QQAA 1ETYA 3AQSA 3VW0A 2O7OA 1APLC 3S1MJ 1S7EA 3WHBA 4GFBA 2DA5A 2D6YA 2G7SA 3LHQA 4A3KJ 4A93J 3CCYA 2HYJA 1JT6A 1ETWA 5CW8A 4D5FA 1QRYA 2DMPA 2NVXJ 1TWFJ 5EG0A 3IH4A 1CQTA 4A3IJ 1WCMJ 3MNLA 4M3DA 4GCLA 4ABZA 2R92J 2M34A 2ID3A 4Y52J 1P7JA 4M3EA 1MH4A 2OI8A 3E7QA 1TWGJ 2GLOA 3JSJA 3G1MA 3QKXA 4XRMA 1X2MA 4A3FJ 3MN2A 4PXIA 5BNGA 5M3FJ 3NRGA 3T6NA 3RQIA 2FQ4A 4J19A 2QTQA 2LY9A 2VI6A 3Q0WA 5FLMJ 2EZHA 4QIWN 1MBHA 1AKHB 2LVSA 2ZOZA 2DMUA 2P81A 3VW1A 1HF0A 3MVPA 1R9TJ 2XSDC 1JUSA 1SGMA 5CXIA 2JA7J 5M5WJ 3S1QJ 2UXPA 3PASA 1ENHA 3S16J 2V57A 4M3FA 3COLA 3G1OA 5HODA 1UI6A 3E7LA 3NI7A 2ME0A 2VKVA 3VVYA 3OIOA 3IV5A 2EZKA 2DA7A 2HQ5A 3S17J 1ORKA 4DW6A 4EEFG 3HTHA 4DZJA 1T56A 3BG9A 2DMQA 2YU9J 2NVQJ 2G3BA 2Y0SN 3BG3A 2NP3A 2DA2A 3ON4A 3CQZJ 3LSJA 2M0CA 2N8GA 3AQTA 1YRNB 1AU7A 1B8IA 5C4JJ 3BR2A 4UUSB 5K58A 5K7HA 1H88C 1OCPA 1FIPA 4XRSA 2MW8A 3B6AA 3W6VA 4A3BJ 3ANGA 1JUPA 2WUIA 4ICHA 2LKXA 3G1LA 4CYCA 3H0GJ 3BHQA 5H9TA 3BR0A 2E2IJ 4HNVA 1ZTRA 4LOCA 3ANPA 3OSGA 2RHAA 5E3MA 5M5YJ 3B81A 5CXGA 5EFYA 2G0EA 4I6ZA 1ZQ3P 5IYBJ 2KDZA 4M3BA 3PM1A 1UMQA 3KKCA 2QOPA 1POGA 4UDSA 3S5RA 3C07A 2UXIA 3JRGA 3V6GA 3K7AJ 1E3OC 1JJ8C 5D18A 5DS9A 5M5XJ 5F04A 3NXCA 5EGOA 2DG8A 2EQRA 3I4NJ 2XB5A 2HYTA 4AUXA 4BY7J 5JLWA 5IOZA 4V2FA 1TWHJ 3LWJA 3FRQA 2YUSA 1RKTA 2YS9A 4W1UA 3RKQA 1ITYA 4HKUA 3B6CA 1GUUA 1UI5A 1U9OA 3F1BA 5EF6A 3VUQA 2IBDA 2AHQA 4XICA 1IDYA 1BL0A 1QVTA 2CUEA 2L7MP 1JKOC 1ETVA 4JX6A 2E19A 4DYCA 3JRCA 3HIMA 4ACIA 3BQZA 3S2DJ 3SDGA 2NVTJ 1BA5A 4AC6A 1ETXA 1DU0A 3HBLA 3VVXA 4AYBN 1FIAA 3KNWA 3DEWA 5C4YA 1EF4A 5C44J 2DG7A 4JNNA 2DMNA 2LFBA 4FE7A 4BKXA 2R5YA 1FTZA 2Y9ZA 1PUFA 1I50J 2QKOA 2Q24A 2D5VA 2K9NA 2AO9A 5FKMA 3GTQJ 2QWTA 4M6VA 3BTCA 4MO7A 5EZHA 2NOGA 4IEJA 4JP0A 2R7ZJ 2X6OA 2XPWA 2DA4A 2GM4A 2WB1N 1D5YA 4A3JJ 1A6IA 2LP0A 3HOZJ 5M3MJ 4IHYA 1OCTC 3O60A 4B3AA 2HDDA 2JA5J 2WAQN 1JJ6C 1X2NA 5IOYA 1LE8B 1GT0C 1WPKA 5FKNA 2CRGA 2GBYA 3QPSA 3V78A 2UXOA 1FTTA 1B72A 4A3DJ 4JKZA 3G56A 3L1PA 2GUHA 4MFDA 5FKLA 2ZCNA 3BR5A 3S1NJ 5IYCJ 3PO3J 1BW6A 2R5ZB 1ZKGA 3ZQHA 2LD5A 2Y2ZA 5DTDA 3LSRA 4MIMA 2WGBA 2Y9YA 2UXHA 3LSPA 1JT0A 2LK2A 2OF7A 4GCTA 1WGXA 1IUFA 1SANA 2VKEA 1GV2A 4XRSG 2QIBA 3F0CA 3ZQCA 1DU6A 2ME6A 3JRDA 2JMWA 4C3IJ 3GTOJ 3QBMA 4C2MJ 3P9TA 3SJMA 1WI3A 5FKOA 3GTKJ 3HTAA 2MG4A 1I6HJ 4ME9A 1IRZA 1JTYA 2OERA 2FJ1A 3VIBA 4D7NA 1UHSA 4X1EA 2W48A 1RR7A 3JRBA 3A01B 3NAUA 1XG1A 4IHXA 3TP0A 4L62A 2XB0X 2R0QC 2I10A 2XRLA 1VFCA 3ZQIA 4MK6A 3HOXJ 1RETA 3HDDA 3EUPA 2LR8A 2M9HA 1T33A 2DN0A 4XK4A 3OSFA 3GTLJ 1JUMA 4UUTA 2OPTA 2Y30A 2JK3A 1MBJA 3HB9A 2TCTA 1LE8A 3BTLA 4BBSJ 3S2HJ 3RH2A 4MXMA 3GTPJ 3NARA 2L0KA 5HSZA 1OJLA 5K7FA 1QPIA 3FISA 1ZR4A 3BRUA 3FK6A 2K40A 1XS9A 1HLVA 1MBKA 2JN6A 4D7MA 3GEUA 1OFCX 3HTJA 4NN1A 3RD3A 5GP9A 2CUFA 3Q0UA 2JJ7A 5E3NA 2CQQA 3TEDA 1IDZA 3JRFA 1AKHA 2NP5A 5F0CA 2RASA 3BTJA 1W0UA 3NNRA 3CRJA 3RZDJ 2JA8J 4G12A 2GENA 3ZQFA 2REKA 4GCKA 2VUMJ 3CDLA 3KZ9A 4M3GA 4JYKA 5EG0B 3JRHA 1AHDP 4A3GJ 1UG2A 1SFOJ 4W97A 1MBEA 2E1OA 4Y7NJ 3D1NI 4NDLA 4XIDA 3PPBA 4JX5A 2ZCMA 2DA6A 2QCOA 5F0HA 2B63J 4X6AJ 2XGEA 4NELA 5FHPA 3A01A 1FEXA 1HDDC 2HKUA 4FE4A 2L9RA 2WV1A 4GFLA 5FKKA 2DTZA 1Z0XA 3BR6A 2X48A 3PO2J 3VOXA 3VVZA 5HAWA 2KT0A 4A3MJ 1YRNA 4RBOA 5IP7J 2K9SA 1Y1VJ 2XDNA 5K7ZA 4UUSA 3S14J 5FMPA 2QF7A 3ZOBA 2CU7A 2GFNA 2HOSA 5FLVA 2CQXA 2K9QA 2CJJA 3O8GA 2ECCA 3GTGJ 4A69C 1IG7A 3TW7A 4AC0A 3LNQA 4S0HB 3WHCA 5IYDJ 1O4XA 1XC5A 2HI3A 1MSEC 5E3LA 4YZEA 3BT9A 1WH5A 3HKZN 3BCGA 5EZGA 3GZIA 3RZOJ 1ETQA 5C4XJ 4BBRJ 3VW2A 4V2GA 1ZR2A 1U8BA 1U9NA 5J1YA 1B8IB 1MBFA 3IUVA 3HGYA 3CMYA 2DA3A 2JWTA 2TRTA 1MSFC 5JLXA 4C3HJ 9ANTA 4DYQA 3C2BA 5FJ8J 2HOAA 1F36A 3BR1A 4CYCB 3CWRA 2Y31A 2E2HJ 3FKIJ 1H8AC 2NX4A 3HTIA 4B4CA 4FTHA 3A03A 2L7FP 2NS8A 2ZB9A 5E3OA 3LSGA 5D1RA 1VNDA 5EEAA 3DPJA 3MKLA 1HCRA 3GTMJ 5HBUA 3I4MJ 1W0TA 5F0FA 3HOWJ 4B1RA 2G7GA 2DMTA 2FX0A 1LFBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G7L A;  3S1R J;  3O8H A;  5EGO B;  3IH3 A;  5IPA A;  1FJL A;  3LJL A;  3NPI A;  2ECB A;  3K2A A;  3Q3S A;  1NK3 P;  4JX4 A;  2YVE A;  3HOU J;  2EZI A;  4KWA A;  2FBQ A;  3VP5 A;  2XGD A;  4IHV A;  4GFK A;  1G2H A;  5D19 A;  4C3J J;  2ID6 A;  2RAE A;  1JTX A;  2H1K A;  5C3E J;  3HEF A;  3JRA A;  2HOT A;  4QSH A;  5F27 A;  2XPU A;  3FK7 A;  4AF5 A;  3DCF A;  1BJZ A;  1IC8 A;  5F1J A;  1MBG A;  4FCY A;  3BR3 A;  3KKD A;  5J1R A;  2EH3 A;  3HM5 A;  4D5C A;  2W53 A;  2EZL A;  4RDU A;  3CJD A;  2M2E A;  3G7R A;  2FD5 A;  1TC3 C;  1K83 J;  1HDP A;  2NVY J;  4MFE A;  3VPR A;  1QVU A;  3JRE A;  3JRI A;  2MSY A;  2VPR A;  2R5Y B;  1PUF B;  3GBG A;  2R5Z A;  1P7I A;  1H89 C;  3HGG A;  5DAJ A;  3EGQ A;  5FGL A;  2ZCX A;  2IU5 A;  2YVH A;  4JL3 A;  3Q0V A;  3GTJ J;  1TWA J;  3A02 A;  2LLK A;  1RKW A;  1MNM C;  1TWC J;  1I3Q J;  4BXX J;  2M8G X;  4CGR A;  3ON2 A;  2EBI A;  1IGN A;  1ZGW A;  2XGC A;  3OOU A;  3JR9 A;  2PZ9 A;  1VI0 A;  3TP3 A;  1ETO A;  3QPL A;  3M3Y J;  2HXO A;  1JKR C;  1JKQ C;  2NS7 A;  1B72 B;  5GPA A;  2H8R A;  1K61 A;  5IP9 J;  2O9L A;  1HOM A;  2R93 J;  4DZP A;  2HXI A;  3BNI A;  1F43 A;  1BW5 A;  5F08 A;  1NTC A;  5AQC A;  4FIS A;  3UKG A;  2L7Z A;  1WH7 A;  2F07 A;  5J3L A;  1VF9 A;  3BJB A;  4I76 A;  3IH2 A;  1GV5 A;  1Z77 A;  2LTP A;  3BQY A;  2UXU A;  5GPC A;  2ELK A;  2XPV A;  4A3L J;  1IJW C;  4A3C J;  2O8K A;  4DYR A;  1MH3 A;  1RPW A;  3LOC A;  2JA6 J;  1RES A;  2ZOY A;  4L5E A;  5EYR A;  3BTI A;  5J1U A;  5IP6 A;  1JKP C;  2DA1 A;  1X58 A;  2IEK A;  1U78 A;  1GVD A;  1IV6 A;  1ETK A;  3H3V K;  3HOY J;  2PMZ N;  1LFU P;  4A3E J;  1NK2 P;  2COB A;  3ZQL A;  3VOK A;  1Y1W J;  3ZQG A;  1JGG A;  3HOV J;  2O7T A;  4QTR A;  4BY1 J;  2E2J J;  2PBX A;  1A5J A;  2IAI A;  1ZK8 A;  3HE0 A;  3BG5 A;  3TW6 A;  2X9D A;  2DJN A;  3S15 J;  3SFI A;  3M4O J;  3FIW A;  4MLO A;  1Q1V A;  4IHW A;  5EDN A;  1GDT A;  2MGQ A;  3QQA A;  1ETY A;  3AQS A;  3VW0 A;  2O7O A;  1APL C;  3S1M J;  1S7E A;  3WHB A;  4GFB A;  2DA5 A;  2D6Y A;  2G7S A;  3LHQ A;  4A3K J;  4A93 J;  3CCY A;  2HYJ A;  1JT6 A;  1ETW A;  5CW8 A;  4D5F A;  1QRY A;  2DMP A;  2NVX J;  1TWF J;  5EG0 A;  3IH4 A;  1CQT A;  4A3I J;  1WCM J;  3MNL A;  4M3D A;  4GCL A;  4ABZ A;  2R92 J;  2M34 A;  2ID3 A;  4Y52 J;  1P7J A;  4M3E A;  1MH4 A;  2OI8 A;  3E7Q A;  1TWG J;  2GLO A;  3JSJ A;  3G1M A;  3QKX A;  4XRM A;  1X2M A;  4A3F J;  3MN2 A;  4PXI A;  5BNG A;  5M3F J;  3NRG A;  3T6N A;  3RQI A;  2FQ4 A;  4J19 A;  2QTQ A;  2LY9 A;  2VI6 A;  3Q0W A;  5FLM J;  2EZH A;  4QIW N;  1MBH A;  1AKH B;  2LVS A;  2ZOZ A;  2DMU A;  2P81 A;  3VW1 A;  1HF0 A;  3MVP A;  1R9T J;  2XSD C;  1JUS A;  1SGM A;  5CXI A;  2JA7 J;  5M5W J;  3S1Q J;  2UXP A;  3PAS A;  1ENH A;  3S16 J;  2V57 A;  4M3F A;  3COL A;  3G1O A;  5HOD A;  1UI6 A;  3E7L A;  3NI7 A;  2ME0 A;  2VKV A;  3VVY A;  3OIO A;  3IV5 A;  2EZK A;  2DA7 A;  2HQ5 A;  3S17 J;  1ORK A;  4DW6 A;  4EEF G;  3HTH A;  4DZJ A;  1T56 A;  3BG9 A;  2DMQ A;  2YU9 J;  2NVQ J;  2G3B A;  2Y0S N;  3BG3 A;  2NP3 A;  2DA2 A;  3ON4 A;  3CQZ J;  3LSJ A;  2M0C A;  2N8G A;  3AQT A;  1YRN B;  1AU7 A;  1B8I A;  5C4J J;  3BR2 A;  4UUS B;  5K58 A;  5K7H A;  1H88 C;  1OCP A;  1FIP A;  4XRS A;  2MW8 A;  3B6A A;  3W6V A;  4A3B J;  3ANG A;  1JUP A;  2WUI A;  4ICH A;  2LKX A;  3G1L A;  4CYC A;  3H0G J;  3BHQ A;  5H9T A;  3BR0 A;  2E2I J;  4HNV A;  1ZTR A;  4LOC A;  3ANP A;  3OSG A;  2RHA A;  5E3M A;  5M5Y J;  3B81 A;  5CXG A;  5EFY A;  2G0E A;  4I6Z A;  1ZQ3 P;  5IYB J;  2KDZ A;  4M3B A;  3PM1 A;  1UMQ A;  3KKC A;  2QOP A;  1POG A;  4UDS A;  3S5R A;  3C07 A;  2UXI A;  3JRG A;  3V6G A;  3K7A J;  1E3O C;  1JJ8 C;  5D18 A;  5DS9 A;  5M5X J;  5F04 A;  3NXC A;  5EGO A;  2DG8 A;  2EQR A;  3I4N J;  2XB5 A;  2HYT A;  4AUX A;  4BY7 J;  5JLW A;  5IOZ A;  4V2F A;  1TWH J;  3LWJ A;  3FRQ A;  2YUS A;  1RKT A;  2YS9 A;  4W1U A;  3RKQ A;  1ITY A;  4HKU A;  3B6C A;  1GUU A;  1UI5 A;  1U9O A;  3F1B A;  5EF6 A;  3VUQ A;  2IBD A;  2AHQ A;  4XIC A;  1IDY A;  1BL0 A;  1QVT A;  2CUE A;  2L7M P;  1JKO C;  1ETV A;  4JX6 A;  2E19 A;  4DYC A;  3JRC A;  3HIM A;  4ACI A;  3BQZ A;  3S2D J;  3SDG A;  2NVT J;  1BA5 A;  4AC6 A;  1ETX A;  1DU0 A;  3HBL A;  3VVX A;  4AYB N;  1FIA A;  3KNW A;  3DEW A;  5C4Y A;  1EF4 A;  5C44 J;  2DG7 A;  4JNN A;  2DMN A;  2LFB A;  4FE7 A;  4BKX A;  2R5Y A;  1FTZ A;  2Y9Z A;  1PUF A;  1I50 J;  2QKO A;  2Q24 A;  2D5V A;  2K9N A;  2AO9 A;  5FKM A;  3GTQ J;  2QWT A;  4M6V A;  3BTC A;  4MO7 A;  5EZH A;  2NOG A;  4IEJ A;  4JP0 A;  2R7Z J;  2X6O A;  2XPW A;  2DA4 A;  2GM4 A;  2WB1 N;  1D5Y A;  4A3J J;  1A6I A;  2LP0 A;  3HOZ J;  5M3M J;  4IHY A;  1OCT C;  3O60 A;  4B3A A;  2HDD A;  2JA5 J;  2WAQ N;  1JJ6 C;  1X2N A;  5IOY A;  1LE8 B;  1GT0 C;  1WPK A;  5FKN A;  2CRG A;  2GBY A;  3QPS A;  3V78 A;  2UXO A;  1FTT A;  1B72 A;  4A3D J;  4JKZ A;  3G56 A;  3L1P A;  2GUH A;  4MFD A;  5FKL A;  2ZCN A;  3BR5 A;  3S1N J;  5IYC J;  3PO3 J;  1BW6 A;  2R5Z B;  1ZKG A;  3ZQH A;  2LD5 A;  2Y2Z A;  5DTD A;  3LSR A;  4MIM A;  2WGB A;  2Y9Y A;  2UXH A;  3LSP A;  1JT0 A;  2LK2 A;  2OF7 A;  4GCT A;  1WGX A;  1IUF A;  1SAN A;  2VKE A;  1GV2 A;  4XRS G;  2QIB A;  3F0C A;  3ZQC A;  1DU6 A;  2ME6 A;  3JRD A;  2JMW A;  4C3I J;  3GTO J;  3QBM A;  4C2M J;  3P9T A;  3SJM A;  1WI3 A;  5FKO A;  3GTK J;  3HTA A;  2MG4 A;  1I6H J;  4ME9 A;  1IRZ A;  1JTY A;  2OER A;  2FJ1 A;  3VIB A;  4D7N A;  1UHS A;  4X1E A;  2W48 A;  1RR7 A;  3JRB A;  3A01 B;  3NAU A;  1XG1 A;  4IHX A;  3TP0 A;  4L62 A;  2XB0 X;  2R0Q C;  2I10 A;  2XRL A;  1VFC A;  3ZQI A;  4MK6 A;  3HOX J;  1RET A;  3HDD A;  3EUP A;  2LR8 A;  2M9H A;  1T33 A;  2DN0 A;  4XK4 A;  3OSF A;  3GTL J;  1JUM A;  4UUT A;  2OPT A;  2Y30 A;  2JK3 A;  1MBJ A;  3HB9 A;  2TCT A;  1LE8 A;  3BTL A;  4BBS J;  3S2H J;  3RH2 A;  4MXM A;  3GTP J;  3NAR A;  2L0K A;  5HSZ A;  1OJL A;  5K7F A;  1QPI A;  3FIS A;  1ZR4 A;  3BRU A;  3FK6 A;  2K40 A;  1XS9 A;  1HLV A;  1MBK A;  2JN6 A;  4D7M A;  3GEU A;  1OFC X;  3HTJ A;  4NN1 A;  3RD3 A;  5GP9 A;  2CUF A;  3Q0U A;  2JJ7 A;  5E3N A;  2CQQ A;  3TED A;  1IDZ A;  3JRF A;  1AKH A;  2NP5 A;  5F0C A;  2RAS A;  3BTJ A;  1W0U A;  3NNR A;  3CRJ A;  3RZD J;  2JA8 J;  4G12 A;  2GEN A;  3ZQF A;  2REK A;  4GCK A;  2VUM J;  3CDL A;  3KZ9 A;  4M3G A;  4JYK A;  5EG0 B;  3JRH A;  1AHD P;  4A3G J;  1UG2 A;  1SFO J;  4W97 A;  1MBE A;  2E1O A;  4Y7N J;  3D1N I;  4NDL A;  4XID A;  3PPB A;  4JX5 A;  2ZCM A;  2DA6 A;  2QCO A;  5F0H A;  2B63 J;  4X6A J;  2XGE A;  4NEL A;  5FHP A;  3A01 A;  1FEX A;  1HDD C;  2HKU A;  4FE4 A;  2L9R A;  2WV1 A;  4GFL A;  5FKK A;  2DTZ A;  1Z0X A;  3BR6 A;  2X48 A;  3PO2 J;  3VOX A;  3VVZ A;  5HAW A;  2KT0 A;  4A3M J;  1YRN A;  4RBO A;  5IP7 J;  2K9S A;  1Y1V J;  2XDN A;  5K7Z A;  4UUS A;  3S14 J;  5FMP A;  2QF7 A;  3ZOB A;  2CU7 A;  2GFN A;  2HOS A;  5FLV A;  2CQX A;  2K9Q A;  2CJJ A;  3O8G A;  2ECC A;  3GTG J;  4A69 C;  1IG7 A;  3TW7 A;  4AC0 A;  3LNQ A;  4S0H B;  3WHC A;  5IYD J;  1O4X A;  1XC5 A;  2HI3 A;  1MSE C;  5E3L A;  4YZE A;  3BT9 A;  1WH5 A;  3HKZ N;  3BCG A;  5EZG A;  3GZI A;  3RZO J;  1ETQ A;  5C4X J;  4BBR J;  3VW2 A;  4V2G A;  1ZR2 A;  1U8B A;  1U9N A;  5J1Y A;  1B8I B;  1MBF A;  3IUV A;  3HGY A;  3CMY A;  2DA3 A;  2JWT A;  2TRT A;  1MSF C;  5JLX A;  4C3H J;  9ANT A;  4DYQ A;  3C2B A;  5FJ8 J;  2HOA A;  1F36 A;  3BR1 A;  4CYC B;  3CWR A;  2Y31 A;  2E2H J;  3FKI J;  1H8A C;  2NX4 A;  3HTI A;  4B4C A;  4FTH A;  3A03 A;  2L7F P;  2NS8 A;  2ZB9 A;  5E3O A;  3LSG A;  5D1R A;  1VND A;  5EEA A;  3DPJ A;  3MKL A;  1HCR A;  3GTM J;  5HBU A;  3I4M J;  1W0T A;  5F0F A;  3HOW J;  4B1R A;  2G7G A;  2DMT A;  2FX0 A;  1LFB A; 
#chains in the Genus database with same CATH topology
 5D5X B;  1MMS A;  3I64 A;  4WXC A;  2Z9O A;  5IY5 H;  3IH3 A;  2ECB A;  1LKX A;  1QPM A;  1XSD A;  1ON2 A;  2A2F X;  1R71 A;  2EZI A;  3BZ6 A;  2B7E A;  3VP5 A;  3V42 A;  2WAF A;  1RIO H;  2ID6 A;  1EH7 A;  3SXY A;  1D1B A;  4LFU A;  3OYN A;  2CV2 A;  5KHD A;  4I0B A;  4GRI A;  3H3U A;  2VT3 A;  3PSF A;  1IC8 A;  3OYJ A;  2IA0 A;  3FZV A;  3BJA A;  2EA2 A;  1STZ A;  3DP7 A;  4UV9 A;  4WK8 F;  2QSF X;  2KJB A;  3OYH A;  3F6V A;  2DOF A;  5E18 F;  1KU2 A;  2UXN A;  2NVY J;  3VPR A;  3AG3 H;  2QSG X;  2MSY A;  3GXO A;  1YIT I;  1P7I A;  4IVN A;  5J6X A;  4M6Y A;  2YVH A;  1W5S A;  5DM6 F;  3TKY A;  3Q0V A;  1TWA J;  1MNM C;  2LLK A;  2I8D A;  2HZT A;  1I3Q J;  2P5K A;  3CUQ A;  3ON2 A;  1ZGW A;  4L5J A;  2DFE A;  3L9F A;  1FP2 A;  1VQ5 I;  1VI0 A;  4LK0 F;  2WV0 A;  1OCO H;  3CF2 A;  1ETO A;  4Y33 A;  1ONV A;  1EH8 A;  2ZKZ A;  2NS7 A;  3KYC B;  3CD6 I;  1ZGA A;  4J01 A;  5GPA A;  1Z3X A;  2O9L A;  2PBI A;  1S3J A;  2IRF G;  5F08 A;  3ISP A;  3ABK H;  1Z6R A;  1Y8R B;  4A6E A;  2F07 A;  2RRE A;  2Z2S B;  5J3L A;  4Q47 A;  1Y0U A;  3C2H A;  3OS1 A;  4I76 A;  4IRV A;  3IH2 A;  1IRF A;  2LTP A;  1YIJ I;  1N25 A;  2ELK A;  4A3L J;  4HYE A;  3LOC A;  1RES A;  2O8X A;  4L0Z B;  5DCF A;  2ISZ A;  2ESN A;  3T1B A;  2BEO A;  3JCU C;  1X58 A;  1U78 A;  3CES A;  1GVD A;  1IV8 A;  1OR7 A;  2W24 A;  2CMP A;  2JPB A;  4BAY A;  1LFU P;  2JUC A;  2K86 A;  2CGP A;  3OYE A;  4NBQ A;  3ZQG A;  2O7T A;  1YQA A;  3HOV J;  3DF8 A;  3DKW A;  4IX7 A;  2E2J J;  4U7D A;  3F8B A;  3PFY A;  1A5J A;  2OV7 A;  1SFU A;  1ZK8 A;  2KRH A;  3KLO A;  3TW6 A;  3S15 J;  4MTD A;  1UEL B;  5D5W B;  1SVL A;  3M4O J;  5EDN A;  2X51 A;  1FMV A;  1F1Z A;  4XOR A;  3MKW B;  3DQV C;  3JAM K;  1APL C;  1QHG A;  2HPM A;  3ZMD A;  2PI0 A;  2XF5 A;  2D6Y A;  1Z7U A;  3H5R A;  2DOA A;  4A3K J;  3SYT A;  4RB1 A;  3CCY A;  1ETW A;  3BCB A;  5CW8 A;  4CCJ A;  1DDN A;  4Q5S F;  2DMP A;  2M1B A;  3HKZ A;  1TWF J;  2ZXH A;  5E8G A;  1WCM J;  3DKY A;  3IUO A;  2R92 J;  2ID3 A;  4Y52 J;  3LMM A;  1MH4 A;  4IHT A;  2ZFU A;  2OI8 A;  4BEH B;  2GLO A;  3LAJ A;  4XRM A;  3QYB A;  3HYI A;  3MN2 A;  3C1D A;  5F1R A;  5M3F J;  1SVM A;  2P0W A;  3BZK A;  2FQ4 A;  1KZH A;  2EV0 A;  3D5R C;  2K3F A;  3Q0W A;  2ZOZ A;  2LVS A;  2VOD A;  3VOE A;  1KYZ A;  3VW1 A;  3PIO F;  1UZC A;  3GFM A;  3RKX A;  1TW3 A;  2UXX A;  3PAS A;  1ENH A;  3COL A;  2V57 A;  1UI6 A;  3E7L A;  3PNY A;  2VE9 A;  2HQ5 A;  3S17 J;  4L9J A;  4I01 A;  2CV1 A;  3I56 I;  4AVP A;  3CCM I;  1H9T A;  3OWT A;  3S2W A;  3HTH A;  4DZJ A;  1S72 I;  2XC7 A;  1WQ2 A;  3AL0 C;  2G3B A;  3ON4 A;  3BG3 A;  4HX8 A;  1I39 A;  2N8G A;  1FY7 A;  1B8I A;  4NC6 A;  5C4J J;  4UUS B;  3I5U A;  3P9I A;  3BG6 A;  1FIP A;  2FMY A;  4A3B J;  3ANG A;  3BPV A;  3OL4 A;  3I9V 2;  3CCR I;  4NC8 A;  4CIC A;  4HNV A;  3M07 A;  4LOC A;  3ANP A;  2AXT C;  2Y0S A;  2RHA A;  4NQW A;  4DNC A;  5K5O A;  3KP3 A;  3V7R A;  5CXG A;  5DV5 A;  1FLI A;  1ODD A;  2CV0 A;  1R5H A;  2K02 A;  2XAU A;  4HBL A;  2QOP A;  4UDS A;  3BWG A;  2UXI A;  3JRG A;  1FX7 A;  2XAQ A;  4HDU A;  2CFO A;  3ELK A;  3SFZ A;  1W5T A;  5M5X J;  5EGO A;  2EQR A;  2BHY A;  3I4N J;  1R7J A;  2XB5 A;  2ACJ A;  4BDY A;  2FNA A;  1ZN2 A;  2WAE A;  1RKT A;  4GCV A;  2YS9 A;  1GUU A;  4B44 A;  1U9O A;  1XGS A;  5EF6 A;  1BL0 A;  4XIC A;  3EDP A;  1IDY A;  3MMY B;  4RB2 C;  2PJP A;  1QVT A;  2CUE A;  2ADU A;  4ENJ A;  3GFI A;  2M5W A;  3BQZ A;  4OIP F;  1IXS B;  4UVB A;  5FFX A;  2JA2 A;  1OKR A;  2ZJQ F;  1ETX A;  2KKO A;  1DU0 A;  1TBX A;  4RMN A;  3S3M A;  2HEO A;  4GDF A;  4HQE A;  1HC8 A;  2FOW A;  5C44 J;  4BL0 B;  2LFB A;  3K0L A;  1QHH D;  2R7X A;  4XOT A;  2HYF A;  3T8T A;  2QKO A;  3RCO A;  3M7G A;  4AIK A;  2RNJ A;  4KIC A;  2HZD A;  2VBW A;  3Q9S A;  2V1U A;  2XF6 A;  4JP0 A;  1XTA A;  2M7A A;  2WB1 N;  5J40 A;  3E5Q A;  1UFM A;  2E35 A;  4A3J J;  1D5Y A;  1A6I A;  4BJ5 C;  4M9X A;  4G7Z F;  4A5M A;  1DGW Y;  1FNN A;  4NB5 A;  3H35 A;  4I98 B;  1D8K A;  5IOY A;  3J7Y J;  1V5E A;  1GT0 C;  1LE8 B;  4M74 A;  3R4K A;  1BR4 A;  2GBY A;  4A5N A;  2P7V B;  3I4P A;  1B72 A;  1OCC H;  1VQ4 I;  2DPU A;  3E3V A;  1IN6 A;  2ZJP F;  1BI0 A;  3OYG A;  4ZYE A;  3WTU C;  1D1C A;  3BR5 A;  5IYC J;  3A4C A;  1YO5 C;  1YE9 A;  1ZKG A;  3E6D A;  2XAJ A;  3J80 K;  2BXY A;  2Y2Z A;  4IQ4 A;  3LSP A;  1N75 A;  2R7D A;  3AG2 H;  1IUF A;  2VKE A;  5ERI A;  3L2R A;  2O61 A;  4MQ9 F;  1SMT A;  2ZY9 A;  2R4G A;  2KIU A;  3M8J A;  4N9H A;  4G7O F;  2CUJ A;  1VQM I;  1T6S A;  2JMW A;  4HLY A;  2B3W A;  3P9T A;  1C0W A;  4ZYH A;  5FKO A;  2CH0 A;  3GTK J;  2MG4 A;  1I6H J;  2X6W A;  1IRZ A;  1SMY F;  1HKQ A;  4FQG A;  5GTI C;  3TGN A;  1UHS A;  2VL8 A;  2W48 A;  1JHH A;  3JRB A;  1XG1 A;  1W7P A;  2Y75 A;  3PQJ A;  2KPM A;  2I10 A;  4BUP A;  2JUG A;  1WI9 A;  2WC2 A;  2IS6 A;  4MK6 A;  3C3W A;  4LMY A;  4CGZ A;  3HOX J;  2FJI 1;  2BW3 B;  4ZDP A;  3HDD A;  2QKM B;  2LR8 A;  4XK4 A;  1TZL A;  3CUQ C;  2JRM A;  1DGR M;  3CJN A;  1G4D A;  1FOK A;  2OPT A;  2GXA A;  4UB6 C;  2IXS A;  3F8M A;  4IHS A;  2C6Y A;  2ZC2 A;  2ZME C;  2EFP A;  2HKO A;  1LE8 A;  1S7A A;  3BTL A;  3N4M A;  3K4B A;  4G6T B;  2RV8 A;  1FOX A;  1YW7 A;  3RH2 A;  3N97 A;  4MXM A;  2XAS A;  4PCQ A;  3HTS B;  4NHJ A;  2MC4 A;  4HF2 A;  5HSZ A;  1BI3 A;  1XGN A;  3E5U A;  5K7F A;  3ERM A;  3QU3 A;  4ENM A;  2HQA A;  1HW5 A;  3M8F A;  1KU7 A;  1XS9 A;  1XGM A;  2LKS A;  2AQE A;  4BHB A;  3LL7 A;  2BVL A;  1OFC X;  4WXH A;  1R00 A;  3RD3 A;  5CVI A;  4NUB A;  1PJR A;  2JJ7 A;  2DDB A;  2V9P A;  3JRF A;  1N77 A;  1IAW A;  5F0C A;  1WJ5 A;  4L9N A;  1SD7 A;  3OY9 A;  2GEN A;  2K27 A;  2KJC A;  3ZQF A;  1TNT A;  2IW5 A;  1BJA A;  4JYK A;  5L3F A;  3JRH A;  1UG2 A;  1SFO J;  4UUV A;  4XBF A;  3O6B B;  4NDL A;  3L2Q A;  5B1A H;  2BGC A;  4EJV A;  1PP8 F;  2F4I A;  3ML6 A;  1O3Q A;  4JBA A;  1DP3 A;  2QBY B;  4NEL A;  2V4J C;  5FHP A;  2ETH A;  3K70 D;  4L0Y B;  5JI6 A;  5LGT A;  4BJ6 C;  5HDG A;  3EET A;  2MLK A;  5FKK A;  1HBX G;  3BR6 A;  3VVZ A;  3PO2 J;  5HAW A;  4A0Y A;  3LQQ A;  2L9V A;  2Y48 A;  1X3Z B;  2EFW A;  5IP7 J;  4CXF A;  1V55 H;  1S29 A;  3R6S A;  5K7Z A;  2L4M A;  5HNF A;  3S14 J;  3G2B A;  2FBI A;  1FBQ A;  2HOS A;  3GWZ A;  2K9Q A;  3ABT A;  4MEY F;  1TLH B;  4II3 A;  2DBB A;  2W85 A;  2KIS A;  4TV7 A;  3REO A;  4BE0 A;  2KIM A;  3KIO A;  3I53 A;  3ROU A;  3EUK L;  4C30 A;  4E7S A;  1E3H A;  3QPT A;  3BG7 A;  5IYD J;  1O4X A;  4JQF A;  2HI3 A;  5HDN A;  3BT9 A;  2HWV A;  3PJR A;  1MND A;  2R7U A;  4HNU A;  2JVH A;  3RZO J;  1ETQ A;  5C4X J;  4ZJZ A;  4BBR J;  3VW2 A;  3PUF A;  3DLA A;  4V2G A;  3LST A;  2P4W A;  2Z99 A;  2DFH A;  4KIB A;  4MHG A;  5FLX Z;  3CMY A;  2F4M B;  2H27 A;  5JLX A;  4LG0 A;  3X2Q H;  1VZ0 A;  5FJ8 J;  1F36 A;  3LA2 A;  2G7H A;  2EPF A;  4CYC B;  4QLC U;  1LEB A;  2GZW A;  3GF2 A;  2E2H J;  3FKI J;  4RM3 A;  3M9A A;  5ICF A;  4HV6 A;  3U21 A;  3SEZ A;  4B4C A;  4E70 A;  3HTI A;  4B8X A;  3HHH A;  4OU0 A;  4XMY A;  4PGG A;  1R22 A;  3LSG A;  2A6E F;  3L09 A;  2A6T A;  5AIP A;  4XOP A;  3K1M A;  5CVJ A;  3RYP A;  3I4M J;  3K10 A;  3PSI A;  4EJO A;  2V9K A;  1LFB A;  3GYH X;  1G3W A;  1IG7 A;  4O3M A;  2G7L A;  3IRR A;  2QYO A;  2IGN A;  1FP1 D;  4H4K C;  3NPI A;  1DQU A;  2F5E A;  2P7C B;  2A05 A;  1FC3 A;  2KLO A;  1REP C;  3PIP F;  1L3L A;  4JX4 A;  4F7Z A;  1FMW A;  2JZY A;  4KWA A;  3TDU C;  4GFK A;  5D19 A;  1R5I D;  1LUJ B;  2DI3 A;  2H1K A;  5C3E J;  3HEF A;  3WGI A;  3TBI A;  2HOT A;  4QSH A;  2XPU A;  3K6G A;  4RLQ A;  1VQ9 I;  2MH2 A;  1A6Q A;  5TIS C;  2WY7 Q;  3OYD A;  2XGX A;  5J1R A;  3WU2 C;  5HLH A;  1W4M A;  4ZDO A;  2O3F A;  4D5C A;  4CCO A;  1DPU A;  3WGG A;  3FHZ A;  4HDV A;  2V9V A;  2FD5 A;  4Q4Z F;  1KQ8 A;  5D5V B;  1M1E B;  2GOM A;  1X3W B;  3LSH A;  4CCK A;  5JHF A;  3JRE A;  2VPR A;  2R5Y B;  3FF5 A;  4N4O B;  3GBG A;  3TMO A;  2R5Z A;  2VC1 A;  3GUD A;  1H89 C;  4L18 B;  2FBH A;  4U9N A;  1IRG A;  3QPH A;  3P5J A;  4BHC A;  5DAJ A;  4JL3 A;  5J8C A;  3FXQ A;  4CDG A;  1D0Y A;  2IJL A;  2H09 A;  2OA4 A;  1D0Z A;  5FRO A;  4HRI A;  2VOP A;  3KLN A;  2JT1 A;  4BQN A;  1R6R A;  4V19 K;  3VB2 A;  3AAF A;  2R93 J;  2V1N A;  5J8F A;  3BNI A;  3ZRG A;  5AQC A;  4ZZD A;  1KON A;  2ZO4 A;  3ZGK A;  4RGS A;  3EYI A;  1S6L A;  3FDY A;  2OBP A;  2ZNZ A;  4WWC A;  1R36 A;  1A36 A;  2UXU A;  5GPC A;  5CPR B;  1IJW C;  2CS3 A;  1SD6 A;  3TO9 A;  2O8K A;  4YFX F;  4DYR A;  1MH3 A;  2CO5 A;  2W00 A;  1A35 A;  1J7K A;  5JVT A;  3HL2 A;  1P4W A;  4ZC3 A;  3WTV C;  2ZOY A;  3BTI A;  1LVK A;  3U9G A;  5IP6 A;  2IEK A;  4XL9 A;  2VJ5 A;  5IT9 K;  1IV6 A;  1W36 C;  2MD5 A;  2BVM A;  1NK2 P;  4ENK A;  2COB A;  3ZQL A;  1O7L A;  1Y1W J;  1JGG A;  3QYE A;  1MZB A;  5E1Z B;  2VJJ A;  2PBX A;  2DQL A;  4DJA A;  4Q48 A;  2EK5 A;  2F5D A;  4HV5 A;  1A04 A;  3QP5 A;  4XKV A;  1Q1V A;  2XRN A;  3WE2 A;  1U0J A;  2PMH A;  5CLS A;  1ETY A;  3AQS A;  3VW0 A;  3KZY A;  4EM0 B;  3HRM A;  5H2F C;  4LIU A;  2H94 A;  3S1M J;  2NRA C;  2IP2 A;  3QYF A;  3WHB A;  3KEQ A;  3TO6 A;  3CF5 F;  5FB2 A;  2HYJ A;  1JT6 A;  2CQK A;  2K3P A;  1MMD A;  4HQM A;  3QOD A;  4D5F A;  3RDI A;  1QRY A;  5HLI A;  4B09 A;  3ZMT A;  2HNH A;  2K85 A;  5ICE A;  3MNL A;  2M7B A;  1WWX A;  3GEZ A;  5D8L B;  4M3E A;  2V6E A;  2KRF A;  1YI2 I;  1K78 B;  5ICG A;  3G1M A;  1X2M A;  2CG4 A;  2V6C A;  4M71 A;  2A68 F;  4OIO F;  3RQI A;  4KT5 C;  4C2M A;  4QIW N;  1MBH A;  1X1P A;  1AKH B;  4P96 A;  3MCZ A;  2P81 A;  5LRR A;  1ZH5 A;  4HX7 A;  4N0B A;  2VXD A;  1R9T J;  2XSD C;  5CXI A;  1JHF A;  2PLY A;  5H6R A;  2JA7 J;  3M8E A;  3M1E A;  5M5W J;  1GVJ A;  3S16 J;  3G1O A;  2BZT A;  2K4J A;  2E5Z A;  2KIQ A;  1KQ0 A;  4E7Z A;  2VKV A;  4C2T A;  3OIO A;  3IV5 A;  2RGV A;  3JTG A;  2LOO A;  2L3D A;  4EEF G;  3KEY A;  5DUI A;  5CVR A;  1T56 A;  3BG9 A;  2DMQ A;  2EFQ A;  4KT6 A;  4CZZ A;  4Z6Y A;  5KNL A;  2G9W A;  2O03 A;  4B48 A;  3G3Z A;  4B43 A;  1J75 A;  2Y0S N;  3VYS B;  4HW0 A;  3LSJ A;  4H0E A;  5L3C A;  3AQT A;  3F72 A;  4HZF A;  3WOD F;  1YRN B;  1AU7 A;  2STT A;  3ABM H;  1VQN I;  2X6Y A;  3ABU A;  3BR2 A;  2DLL A;  5K58 A;  1H9G A;  2R7Q A;  2LBF B;  3A2K A;  1OCP A;  2E60 A;  1T8I A;  3ZMZ A;  3NEU A;  1Z7L A;  4ICH A;  2LKX A;  2YX4 A;  1OYW A;  5CQG A;  4UNO A;  3BR0 A;  3W6J B;  4BGD A;  4DIQ A;  1G3T A;  5A2Q K;  5BPI A;  3OSG A;  3S8P A;  4GGG A;  5EFY A;  1SD4 A;  3L7W A;  2ZME A;  4XLN F;  2KDO A;  4A12 A;  2A5W A;  4M3B A;  3PM1 A;  2GWR A;  1VQ8 I;  5FRN A;  3KE2 A;  2Z1D A;  3C07 A;  1Z1D A;  2XUB A;  3MWM A;  1ZLJ A;  4Y3O A;  1YS7 A;  1FBU A;  3RPU A;  1J5Y A;  1AWC A;  2NVU B;  1QO0 D;  2XIG A;  1ZG5 A;  1HKT A;  5F04 A;  3NXC A;  2WBM A;  4AUX A;  4IXA A;  5IOZ A;  1WFX A;  1P4X A;  1QQI A;  2X4H A;  4NNJ A;  1TWH J;  3DPL C;  4E6K G;  5FD5 A;  4KIT B;  2YUS A;  1R1U A;  2HFH A;  1HKS A;  4W1U A;  3RKQ A;  1ITY A;  3B6C A;  1UI5 A;  3F1B A;  5EEH A;  1KA8 A;  4BHP A;  1JKO C;  1ETV A;  4AWX B;  4DYC A;  1BR1 A;  2FBK A;  4PJ0 C;  3HIM A;  3EYY A;  1X4O A;  1T2K A;  2LF8 A;  1J09 A;  1MGT A;  1YX5 A;  2NVT J;  1FSH A;  3BJ6 A;  3WU1 B;  3GME A;  3OIQ A;  3VVX A;  1B6A A;  1LJ9 A;  2HS5 A;  4HEA 2;  1EKE A;  1Y0N A;  3SZT A;  5D4R A;  1SAX A;  3DEW A;  5C4Y A;  3CUO A;  3BJO A;  4PSW A;  4BKX A;  2LBF A;  3VOD A;  3A0H C;  3CLQ A;  2D5V A;  2LDU A;  5FD6 A;  5FRM A;  5EZH A;  3BTC A;  3KP4 A;  2NOG A;  3MEX A;  3E5X A;  2XPW A;  4U0V A;  2EFN A;  3P9K A;  3E97 A;  3T0Y A;  2FUG 2;  3I3L A;  2QEN A;  2KQR A;  3RQ4 A;  1UHM A;  1QZE A;  2M4G A;  2H8W A;  4M6X A;  4YEJ A;  4AYB A;  5M3M J;  4IHY A;  4B3A A;  2E36 A;  3FMS A;  1X2N A;  3HPG A;  3ONQ A;  1JJ6 C;  1EH6 A;  3BCA A;  2A61 A;  2NYX A;  2UXO A;  1FTT A;  2XSJ C;  3MZH A;  3W3C A;  3HXL A;  2DW4 A;  2R7V A;  1IRX A;  3G56 A;  2XHK A;  5LLQ A;  3V8K A;  2OQR A;  3L1P A;  5IT3 A;  5LEK A;  2VBY A;  3ZMS A;  3PO3 J;  2W57 A;  1BW6 A;  1TT5 B;  5HS8 A;  3F6O A;  3J7A Y;  3HUG B;  3K9T A;  5KK1 A;  1B59 A;  3ZCO A;  4XLC A;  5DTD A;  2WAQ A;  2ZSH B;  2LK2 A;  1D5V A;  5LGU A;  1WGX A;  1SAN A;  1BIA A;  3RKW A;  3GX4 X;  3ZQC A;  3I0T A;  1ZRF A;  3CTA A;  1LNW A;  2ME6 A;  3ZN0 A;  2KZV A;  1P4A A;  3SJM A;  1WI3 A;  3CME I;  2F2E A;  2VAS A;  4UY8 I;  1YJ9 I;  4U88 A;  3DTE A;  3K4J A;  4G6D A;  1RI7 A;  2DT6 A;  5TRD A;  1XSX A;  4X1E A;  2RQP A;  1LDK B;  5L3D A;  3NAU A;  1S5L C;  2RC4 A;  1R1V A;  3OYC A;  4L62 A;  3F8F A;  2XRL A;  2ZNY A;  1WZ2 A;  3H0D A;  4P9U A;  1OQY A;  1TL8 A;  3QAH A;  5DUK A;  2E7X A;  5CVV A;  3EUP A;  1Q1H A;  4HLX A;  1BC7 C;  1T33 A;  2DN0 A;  4XN3 A;  1JUM A;  2DQR A;  4QPO A;  2JK3 A;  2QQA A;  2OJE D;  4M9S A;  3HOS A;  2HVQ A;  2HVS A;  2LY1 A;  1J9I A;  2DDA A;  1XGO A;  3PL8 A;  2YR2 A;  3HRS A;  3CJQ B;  3NWT A;  4G9Y A;  2YSR A;  1X1C A;  2QUF A;  1MMG A;  4RGU A;  4LLL A;  4F52 A;  2VIX A;  3BRU A;  4BEH A;  3FK6 A;  3J81 Z;  1X1D A;  2K40 A;  5E17 F;  4AU7 A;  4KYW A;  3GZ5 A;  2NAZ A;  4LGW A;  4OMY A;  2BV6 A;  3LAP A;  2HPI A;  4RAY A;  2M4K A;  3TDZ C;  3HTJ A;  1PVE A;  3DV8 A;  3D0S A;  4NN1 A;  3Q0U A;  2E71 A;  3WTT C;  2CQQ A;  3EQL F;  3QWL A;  3TED A;  1TNS A;  3FXM A;  3GZ6 A;  2NP5 A;  4ZYG A;  3F9K A;  4O5V A;  3PNT A;  5H20 A;  4Y13 A;  3CRJ A;  2M87 A;  4LIV A;  2DOD A;  1IN7 A;  1G59 A;  3OIP A;  2FRH A;  1S8N A;  2JA8 J;  4GCK A;  5BMZ A;  4C9Y A;  2LF7 A;  5EG0 B;  4ZYD A;  1AHD P;  4HNT A;  1MBE A;  1OLT A;  2E1O A;  4Y7N J;  3D1N I;  3LWF A;  1FWZ A;  3FMR A;  3PPB A;  3QOP A;  1H0M A;  2ZCM A;  1MMA A;  2DA6 A;  4X6A J;  2B63 J;  3IP4 B;  4CYD A;  4FE4 A;  2HU9 A;  3MQ0 A;  3J80 Z;  1U3E M;  2HDW A;  1Z0X A;  2H1L A;  1FYL A;  2HGC A;  4RBO A;  4RGR A;  2IS1 A;  2EFO A;  2K9S A;  1Y1V J;  1Z91 A;  1NH3 A;  4UUS A;  4BQA A;  1MJB A;  2QF7 A;  5FMP A;  2CU7 A;  3WU0 A;  4FET A;  3OL3 A;  2JQ7 A;  2QWW A;  5FLV A;  4DBR A;  2FU4 A;  2W25 A;  3F8N A;  3KCC A;  4IRH A;  2PFV A;  1BOB A;  2BYV E;  4A69 C;  1IW7 F;  2F48 A;  1CGP A;  4AIH A;  2Q0O A;  1VQP I;  3LNQ A;  4IZZ A;  1T39 A;  4ESB A;  3WHC A;  2ZCW A;  1MSE C;  5E3L A;  3O3K A;  4YZE A;  2TDX A;  4G7H F;  4D0P A;  5EZG A;  4ZTF A;  4LIT A;  4FAS D;  3ASN H;  2VT2 A;  1X19 A;  1G6N A;  1U9N A;  4I0A A;  3BLY A;  1MBF A;  2HVR A;  3HG9 A;  3C18 A;  2D2W A;  3HGY A;  3WE3 A;  2JWT A;  4IJA A;  3KP2 A;  3IWF A;  4C3H J;  4DYQ A;  3C2B A;  2IA2 A;  3U1K A;  5LHG A;  3VEP A;  1NG6 A;  1GHC A;  3W6K B;  1TW2 A;  5BOX A;  3G73 A;  2XF7 A;  4GXO A;  2DPD A;  1O3T A;  4UHT A;  3H9G A;  5LEJ A;  2EWN A;  1LPQ A;  1OIS A;  1RC9 A;  4FTH A;  1TP4 A;  2ELH A;  2Q8K A;  1U5T B;  4PDK A;  5E3O A;  5EEA A;  2LKP A;  1HCR A;  1G3Y A;  2QSH X;  1ZLK A;  5HBU A;  4KJZ A;  5KAF C;  3RSN A;  1W0T A;  4B1R A;  4LB6 B;  2DMT A;  4ZZL A;  1HSJ A;  2P6S A;  2F5V A;  3VYT B;  2GAU A;  4U0Y A;  3O8H A;  3LJL A;  2GA2 A;  3LSI A;  3K2A A;  3CCV I;  5HDK A;  1WSU A;  1YJN I;  2YVE A;  1E3P A;  3HOU J;  3OS2 A;  2A69 F;  2FBQ A;  4E7J A;  5TGT A;  4IHV A;  2FOK A;  4BE1 A;  4C3J J;  1XB4 A;  3MAJ A;  2BY3 A;  2RAE A;  1JTX A;  2XV4 S;  3O2P E;  3AG1 H;  4O6J A;  4A0X A;  4KDP A;  4C2U A;  5ICC A;  1XPX A;  2R7F A;  3DCF A;  4DGW B;  4WIB A;  3ZQ7 A;  1MIJ A;  1V54 H;  3S32 A;  1YHQ I;  1FT9 A;  3EUA A;  3KKD A;  2EH3 A;  1E2X A;  2L2O A;  3HM5 A;  1SEU A;  4PJM A;  3CJD A;  2M2E A;  2QQ8 A;  3G7R A;  1IN4 A;  2XVC A;  1HDP A;  4MFE A;  1QVU A;  2EIJ H;  5DCM B;  2MC3 A;  3FX3 A;  3T8R A;  1PUF B;  3VSL A;  1YG2 A;  5FGL A;  1QNT A;  4L5I A;  1ACI A;  2IU5 A;  1W36 D;  2ZCX A;  2IGK A;  5BPD A;  3A02 A;  1X1A A;  2VKH A;  2HOE A;  1TWC J;  3KX2 A;  1LFP A;  5EJC A;  4EM1 A;  2M8G X;  1B1B A;  4FX4 A;  1R49 A;  1JI8 A;  4CGR A;  2PJR B;  2B1E A;  1IGN A;  4PGH A;  1TT0 A;  2ZJ2 A;  1XCV A;  3QPL A;  1MD0 A;  1JKR C;  1GXP A;  1I6X A;  5E20 A;  2GOX B;  1A31 A;  3CJR B;  1SVO A;  2RKH A;  1HOM A;  2HXI A;  4BJT A;  1F43 A;  1NTC A;  4FIS A;  5B66 C;  3UKG A;  2L7Z A;  3SDB A;  3CCS I;  4LLG F;  5JVG F;  4E4H A;  3WG9 A;  1YLF A;  3CC4 I;  2RVC A;  4UV8 A;  3BQY A;  2BW3 A;  2GXG A;  4A3C J;  4OAZ A;  3V7S A;  3HRU A;  3MKZ A;  2HKX A;  2VXZ A;  1D0X A;  3CC7 I;  5LGN A;  2NS0 A;  4KMF A;  1FBS A;  3HZJ A;  4L5E A;  2CUZ A;  5EYR A;  1RR8 C;  5J1U A;  3VTI A;  3TL4 X;  1HQC A;  1JKP C;  1FYM A;  1W7P D;  5TJJ A;  4J00 A;  3K69 A;  3H3V K;  3HOY J;  4OMZ A;  3B02 A;  1ZG1 A;  3LQR A;  4JK1 X;  4EJT A;  1IXC A;  1T08 B;  4L9T A;  2LMD A;  1V5F A;  4HAM A;  4BY1 J;  2W82 A;  1IO2 A;  1B4A A;  1DUX C;  2X9D A;  3F23 A;  2Z5U A;  2CYY A;  5ILV A;  2DJN A;  3ECH A;  3SFI A;  3FIW A;  3P7N A;  3CDI A;  3ZMU A;  4LK1 F;  3IKV A;  2MGQ A;  3QQA A;  3KFW X;  3DKX A;  3R0J A;  3GFJ A;  2PMZ A;  2O7O A;  2HQR A;  3KEO A;  2O0Y A;  3DLL F;  2PN6 A;  2EB7 A;  4RA2 A;  2EIL H;  4GFB A;  2G7S A;  2DT5 A;  3LHQ A;  3TO7 A;  5L3G A;  1OPC A;  1YYV A;  3CCE I;  4PZJ A;  6PAX A;  5JR3 A;  4M73 A;  3KET A;  2NVX J;  1AOY A;  3FWE A;  2CSO A;  3MZ8 A;  3VDX A;  3S3N A;  4ABZ A;  2VC0 A;  2UV1 A;  1P7J A;  2ZJR F;  2QBY A;  3E7Q A;  3KP7 A;  1DPR A;  1TWG J;  3JSJ A;  4A3F J;  5B5E C;  1ZRD A;  5BNG A;  3NRG A;  4XON A;  2QA4 I;  2QTQ A;  1S7O A;  2VI6 A;  1QA6 A;  3KPH A;  5FLM J;  2EZH A;  4P5O A;  4LG3 A;  3M1C A;  3OYK A;  3OYI A;  4IKF A;  4EVI A;  2HTJ A;  2NOJ B;  1F5T A;  1JUS A;  1SGM A;  2HYG D;  1QU3 A;  3RI4 A;  4YG2 F;  4KA4 A;  3WGH A;  2LY2 A;  2UXP A;  4F93 B;  2L9S A;  1XCB A;  4M3F A;  1N78 A;  3HRT A;  5HOD A;  4ASN A;  2WAD A;  4I09 A;  2ME0 A;  3LA7 A;  4N4N B;  4BNC A;  1UB9 A;  3NWS A;  4MNU A;  1OCZ H;  1SFX A;  1XDS A;  3K4C A;  4AID A;  2MD0 A;  3AG4 H;  3BY6 A;  3R0A A;  2NVQ J;  1LDD A;  3JTH A;  1UHW A;  1IN8 A;  2DA2 A;  2NP3 A;  3CC2 I;  2QQ9 A;  3F8C A;  2M0C A;  1KU9 A;  3F3X A;  4KN7 X;  2YU3 A;  3KP6 A;  1V5G A;  5LBQ A;  3F21 A;  1W5C C;  2MFZ A;  1H88 C;  4GYG A;  3I54 A;  2F6C A;  5GAD J;  1JUP A;  1FYK A;  3GO5 A;  4P1W A;  3FM3 A;  3G4S I;  1QZY A;  2W84 A;  2DK8 A;  2MA3 A;  3RTR A;  4IF4 A;  4F91 B;  4CYC A;  3MFK A;  2UZK A;  5IT9 Z;  3BHQ A;  2KZG A;  3OOP A;  1ZTR A;  1FZP B;  5E3M A;  5M5Y J;  3B81 A;  2G0E A;  2KHM A;  2O6G E;  2Q2E B;  4RAG A;  1CF7 B;  2KFD A;  1ZQ3 P;  5IYB J;  3G71 I;  4XRF A;  1XMK A;  1UMQ A;  3GLX A;  1EA3 A;  3KKC A;  4G6Q A;  3V6G A;  1Z21 A;  2RQQ A;  3K7A J;  1WVR A;  1JJ8 C;  1BR2 A;  3WTS C;  3OR2 C;  5D18 A;  2JPC A;  4PJJ A;  4D9J A;  5DS9 A;  2IT0 A;  2DG8 A;  1MW7 A;  3HHG A;  3RPQ A;  2HYT A;  3RIR A;  4BY7 J;  1MDM B;  5JLW A;  2VN2 A;  3I59 B;  3BPX A;  4P55 A;  5ED4 A;  4ESJ A;  1G3S A;  1BN5 A;  3IRQ A;  4HKU A;  3HTU A;  1G8X A;  3VUQ A;  1WJA A;  4GYI A;  1K4T A;  2IBD A;  3DU6 A;  1ZAO A;  1FOW A;  1XMX A;  2FF4 A;  2ZFW A;  5L3E A;  4BH9 A;  1EV7 A;  3S2D J;  3B73 A;  3SDG A;  2ZSI B;  4LJZ F;  1U2W A;  4MTE A;  1BA5 A;  5CQE A;  4FHT A;  2B9S A;  2R7T A;  3H36 A;  4AYB N;  2OQG A;  3DBL B;  1K79 A;  3PQK A;  1EF4 A;  2RDP A;  1I1S A;  2DMN A;  2HR3 A;  1FTZ A;  2R5Y A;  2Y9Z A;  1I50 J;  3K8P C;  2Q24 A;  3LSK A;  2QWT A;  3GTQ J;  2L02 A;  1EJ9 A;  4M6V A;  4MO7 A;  1X3U A;  4HF0 A;  4D1Q A;  2X6O A;  4YII A;  4PFO A;  4PJL A;  2Y0M A;  2GM4 A;  3DPT A;  1JE8 A;  5DEQ A;  2LP0 A;  1IXR C;  1Y39 A;  3COA C;  2K5C A;  1OCT C;  3J7A O;  1V4R A;  2KRC A;  5B3S H;  2WAQ N;  4RB0 A;  3ZPL A;  1WPK A;  2VQG A;  3R60 A;  5FKN A;  3QPS A;  3V78 A;  1ZRC A;  1Y6I A;  3HSR A;  3MKY B;  1WRJ A;  4A3D J;  2E34 A;  1XSV A;  2GUH A;  5LFA A;  4MFD A;  5FKL A;  2E1N A;  3TOB A;  3K4L A;  2OD5 A;  1LEA A;  5E79 C;  5JHU A;  3ZQH A;  1ERD A;  2LD5 A;  5J4Y A;  3LSR A;  4MIM A;  1I5Z A;  2Y9Y A;  2UXH A;  4UVA A;  2OF7 A;  4F3Q A;  3CUQ B;  5J4V A;  3L2U A;  5A2Q Z;  2BXZ A;  3ULQ B;  1GV2 A;  4XRS G;  2QIB A;  5L3B A;  2UUZ A;  3F0C A;  2XDV A;  5DD4 A;  4B47 A;  4QWQ A;  5KCM A;  3JRD A;  4C3I J;  4FX0 A;  3GTO J;  3QBM A;  4C2M J;  4K2E A;  2IA1 A;  3A0B C;  1OYY A;  1S9H A;  4ME9 A;  2LSO A;  3VIB A;  4A6D A;  4EM2 A;  1MKM A;  2MBF A;  1KU3 A;  3BRO A;  4XLA A;  3CMM A;  2RN7 A;  1RZ4 A;  3TP0 A;  1O3S A;  2XB0 X;  1QGP A;  2V26 A;  2R0Q C;  3H3Z A;  3K4K A;  1F4K A;  2Z16 A;  4XKC A;  1YOV B;  3LFK A;  1RET A;  4XN0 A;  1IF1 A;  4BQQ A;  4UB8 C;  1P92 A;  1WHU A;  2MAB A;  4UUT A;  2RNG A;  3D5L A;  2R7O A;  3OS0 A;  2FXA A;  1MBJ A;  4ZYA A;  1QBJ A;  1U5T C;  2TCT A;  4WCG A;  3EPZ A;  2Q1Z B;  1KGS A;  2X85 A;  1J0R A;  4BBS J;  2EIM H;  2ZXJ A;  1I27 A;  3NAR A;  2A3S A;  1YW8 A;  2L0K A;  2E7W A;  1YJW I;  1OJL A;  1Z9C A;  1QPI A;  2HQN A;  2P6T A;  3FIS A;  1ZR4 A;  1K78 A;  4IL6 C;  3CZ6 A;  3NQO A;  2W7N A;  2CW0 F;  3OYA A;  4WX9 A;  2CWE A;  1F9N A;  1MBK A;  3IAS 2;  1VQO I;  3GEU A;  3ECO A;  3OV8 A;  2Z3Y A;  3JAM Z;  2XRO A;  5E3N A;  2CW8 A;  4ENN A;  1IDZ A;  1AKH A;  4CZC A;  3V8L A;  2RAS A;  3C7J A;  3BTJ A;  3FHN A;  3HJE A;  3RJP A;  2ISY A;  2LH9 A;  5GAE J;  4BQO A;  3RZD J;  2E5N A;  5HLG A;  1HA8 A;  2VKD A;  4WF2 A;  3CDL A;  1FOY A;  3QU6 A;  3KZ9 A;  4A3G J;  4KMU X;  2OTJ I;  3ZQQ A;  4W97 A;  5E1W A;  4BU2 A;  4EMS A;  4DBQ A;  3WTY C;  5K5R A;  4XID A;  2VJ4 A;  4JX5 A;  2DYS H;  1HW1 A;  1T0F A;  2QCO A;  3FKJ A;  1FEX A;  1DP7 P;  5HLT A;  2HKU A;  1ZAR A;  3WG7 H;  1VQK I;  3VOX A;  2OZ6 A;  2KT0 A;  4A3M J;  1KQ9 A;  5GTH C;  1YRN A;  2DK5 A;  2HDC A;  2XDN A;  2LC2 A;  3U1D A;  5GAH J;  3KP5 A;  3ZOB A;  4OIQ F;  2GFN A;  2F5C A;  4PJN A;  1WJC A;  2CQX A;  2CJJ A;  1NG7 A;  3ZN1 A;  1VTN C;  4KIS A;  3GZN B;  1P6R A;  3GTG J;  3TW7 A;  4I2O A;  1UG0 A;  1XN7 A;  2A5Y B;  3L2W A;  1MNE A;  2OAZ A;  3OYM A;  1LVA A;  3CJT B;  1WH5 A;  1VQ7 I;  4KNY A;  3BCG A;  2LNB A;  3W2V A;  2L54 A;  1VQL I;  4YFK F;  2DOE A;  5J1Y A;  1B8I B;  5JFR A;  3IUV A;  4I02 A;  2DXI A;  3IWZ A;  5D6E A;  1MSF C;  2VBZ A;  9ANT A;  2HOA A;  3BR1 A;  3FXO A;  1UST A;  4BXF A;  1OMI A;  3SZG A;  3H9Q A;  3VWB A;  2CFX A;  1P2F A;  3H9J A;  2YPR A;  3ABL H;  1H8A C;  2M45 A;  4IRI A;  2E1M B;  4XR6 A;  4XSZ F;  3RPU D;  2NX4 A;  4NQW B;  3A03 A;  3ZXS A;  2NS8 A;  4CA0 A;  2FNP A;  2ZB9 A;  1MJA A;  4HX4 A;  3DPJ A;  2EV6 A;  3DXJ F;  3OYB A;  4YRV A;  3GW2 A;  2W1O A;  3GTM J;  3DWL E;  5F0F A;  3HOW J;  2ICW G;  2FX0 A;  2K4B A;  2KP6 A;  3S1R J;  4L9V A;  5EGO B;  1FJL A;  5IPA A;  2IGM A;  3EUH C;  3Q5F A;  4R79 A;  2FEZ A;  3Q3S A;  1B9N A;  1MJ9 A;  3KZI C;  1NK3 P;  1WJD A;  4RLF A;  1YFH A;  2XGD A;  4UXN A;  1G2H A;  4E7L A;  1E17 A;  2YVX A;  2R3S A;  3JRA A;  5F27 A;  1RUO A;  2D1V A;  3FK7 A;  4AF5 A;  1BJZ A;  1U6G A;  5F1J A;  4Z2Y A;  4G8X A;  1Z6T A;  2QKL B;  4I99 C;  1WJF A;  1MBG A;  4OD5 A;  4FCY A;  3BR3 A;  1D1A A;  4PFP A;  1BBY A;  4RS8 A;  2W53 A;  2EZL A;  4RDU A;  3IHU A;  1TC3 C;  1K83 J;  4MEX F;  3DEE A;  2MH9 A;  3JRI A;  2DFF A;  3BZC A;  5E8I A;  1FPQ A;  2DAO A;  3HGG A;  4IOC F;  3HUG A;  3EGQ A;  4KN4 X;  3UNG C;  3BC8 A;  3GTJ J;  1RKW A;  3ASO H;  3QRF F;  1X4P A;  4EJW A;  2VB6 A;  4BXX J;  2MLG A;  2EBI A;  2JRT A;  2QGU A;  5DD8 A;  5HS7 A;  3W2W A;  2XGC A;  3OOU A;  3JR9 A;  2PZ9 A;  4CCM A;  4XLE A;  3TP3 A;  5HVQ C;  1BC8 C;  3M3Y J;  2HXO A;  4AM3 A;  4XLH A;  3F22 A;  1JKQ C;  2R7R A;  4XQF A;  4OAY A;  3HPH A;  1B72 B;  2H8R A;  1K61 A;  5IP9 J;  4OIN F;  4DZP A;  2QVO A;  1HW2 A;  1BW5 A;  1BI2 A;  1YIO A;  2IS4 A;  2KMU A;  3KZZ A;  1R23 A;  1WH7 A;  2NXN B;  1VF9 A;  2L9N A;  3BJB A;  3MZY A;  2UWM A;  1P9Q C;  4ITV A;  1GV5 A;  2A6H F;  1Z77 A;  2IS2 A;  2M3A A;  2XPV A;  4M9Z A;  2J5P A;  1T38 A;  2JA6 J;  1RPW A;  3HIF A;  3H5N A;  3H92 A;  2VE8 A;  5HS9 A;  3CMA I;  2ZBK A;  2DA1 A;  2WY8 Q;  1UJ8 A;  1ETK A;  2PMZ N;  1HST A;  4A3E J;  5D5U B;  2AXL A;  3PFI A;  3VOK A;  3E0J B;  4HPQ A;  4QTR A;  2VBX A;  3FXL A;  2V1X A;  1Z3Y A;  1JXS A;  3QOE A;  1ZRE A;  2IAI A;  3HE0 A;  3BG5 A;  1W7P B;  2H6B A;  4G94 A;  3J81 K;  2X0L A;  3E6B A;  3ZMV A;  3OYF A;  4MLO A;  2WA0 A;  4HSR A;  4IHW A;  2QLZ A;  1GDT A;  1TTY A;  4E7K A;  1AA7 A;  1Z05 A;  3FXU A;  3IC7 A;  3V8J A;  1S7E A;  1MMN A;  3E6C C;  2DA5 A;  1ZEL A;  4A93 J;  4YIR X;  1ULY A;  3ZR8 X;  3FM5 A;  3JW4 A;  2H6C A;  3DPU A;  5EG0 A;  1R4M B;  3IH4 A;  5CKT A;  3V4G A;  3DFG A;  1CQT A;  3G6E I;  4A3I J;  1NHA A;  2VLA A;  4M3D A;  4GCL A;  2PQ8 A;  2QM3 A;  4XNF A;  1OYI A;  2M34 A;  4EGZ A;  5CYV A;  2KIF A;  3BP8 A;  3I58 A;  2NNY A;  3FBI B;  2GA1 A;  3QKX A;  4PXI A;  3T6N A;  1SAU A;  3H1C A;  3AKZ A;  1TQP A;  4J19 A;  2LY9 A;  4M72 A;  4ON0 A;  1W1W E;  1Y56 A;  4BXU A;  2QEX I;  2EIK H;  3TOA A;  3V7C A;  2DMU A;  2XKP A;  5D4S A;  2IGO A;  2IVM A;  1HF0 A;  3MVP A;  2OC6 A;  5LD2 C;  4LB5 A;  5AIQ A;  2STW A;  2L7K A;  5ILS A;  3S1Q J;  1UAA A;  3DTI A;  1BIB A;  3ERE D;  3NI7 A;  1Z67 A;  2J5O A;  3PNV A;  4DQ2 A;  3VVY A;  1GLN A;  3LSM A;  2EZK A;  3JSO A;  2DA7 A;  5KVR A;  2A07 F;  1ORK A;  4DW6 A;  1PUE E;  2GIV A;  1HXD A;  4LD5 A;  2YU9 J;  1LQ1 A;  4YIF A;  3GLL A;  4DVY P;  4AIJ A;  2FA5 A;  4IRG A;  3DBH B;  3CQZ J;  3S93 A;  4E7H A;  3CCU I;  2Z33 A;  2W4S A;  4QPQ A;  2OCE A;  1SC7 A;  4YEL A;  1ZYR F;  1D3Y A;  2D1H A;  5K7H A;  1B9M A;  5KAI C;  1R58 A;  1T95 A;  2MW8 A;  3B6A A;  3T5X A;  4F92 B;  3UR3 C;  4XRS A;  3IL2 A;  1U8R A;  3W6V A;  2WUI A;  2VOO A;  1R4N B;  4BE2 A;  5DDG A;  5ILU A;  1XMA A;  3G1L A;  2X1D A;  4BS9 A;  1WJE A;  2K9M A;  3CP2 A;  3H0G J;  2NNN A;  2E2I J;  5H9T A;  3A1Y A;  3VSK A;  1J2X A;  1LDJ A;  2L5Q A;  1T98 A;  3BDD A;  3IAM 2;  4AD9 A;  2IPQ X;  1VQ6 I;  3DBR B;  1U5T A;  5B1B H;  3S3O A;  4I6Z A;  4MQV A;  4HF1 A;  1T0F C;  2KDZ A;  3H5A A;  5D8K B;  3R61 A;  4ANJ A;  4BDZ A;  2Y69 H;  1RNL A;  1POG A;  2D45 A;  3S5R A;  4XLF A;  2DT7 B;  3RKY A;  1E3O C;  2L01 A;  3AFH A;  4F55 A;  4ZTJ A;  1YTY A;  1GXQ A;  4S05 A;  2LRE A;  3P9C A;  2M30 A;  4U87 A;  2AS5 F;  1USS A;  2X1E A;  2ZXW H;  4LG0 B;  4V2F A;  3LWJ A;  2OU2 A;  2WWY A;  3FRQ A;  2F4O B;  4IPA A;  3N05 A;  2FE3 A;  3HSF A;  4OD4 A;  1OR7 C;  1RUN A;  2PFB A;  4WXD A;  2AHQ A;  4NC7 A;  3CP8 A;  2L4A A;  2L7M P;  4Y17 A;  1WKM A;  4JX6 A;  2E19 A;  3JRC A;  4E7I A;  4ACI A;  3IKT A;  2K9L A;  4EAT A;  5K5Q A;  2VQL A;  3OYL A;  2DO7 A;  4AC6 A;  5FFZ A;  3I71 A;  2FSW A;  3HBL A;  4B3X A;  5LHH A;  1FIA A;  2F5F A;  4HST A;  4R8H A;  3VFZ A;  2OTL I;  3KNW A;  1YS6 A;  3K1P A;  4U7B A;  2DG7 A;  1E0E A;  4FE7 A;  4JNN A;  3FXR A;  5DCM A;  3W2A A;  2P5V A;  1PUF A;  1WJB A;  2DCE A;  4ZH4 F;  5H6Q A;  2K9N A;  2AO9 A;  1UCR A;  4OOI A;  5FKM A;  2P8T A;  2ESH A;  3FXK A;  2G7U A;  1I1G A;  2V1D A;  1TQM A;  4IEJ A;  2R7Z J;  3SQN A;  5J47 A;  3CO7 C;  4OWR B;  2V7F A;  2DA4 A;  3OR1 C;  4CH7 A;  3CO6 C;  1XDU A;  4KIG A;  2CW7 A;  1YX3 A;  2PJR A;  4YFN F;  1J59 A;  2DU9 A;  2DJI A;  3HOZ J;  4N9I A;  5FO5 A;  3O60 A;  1RRJ A;  2CQN A;  5LHI A;  2HDD A;  2JA5 J;  1ZGJ A;  2R7W A;  3L2V A;  3SWH A;  5DM7 F;  1O7F A;  1TQI A;  2CRG A;  5HOO A;  1PDN C;  2M8E A;  4RM2 A;  4JKZ A;  1ON1 A;  3K2Z A;  2I5U A;  5K1Y A;  2BY1 A;  1IN5 A;  3Q9V A;  4ETS A;  4KIF A;  1ZHF A;  2ZCN A;  3CCQ I;  2WB1 A;  3C2G A;  2LG4 A;  4FT8 A;  3S1N J;  3AL0 B;  1O57 A;  2COM A;  2X1C A;  3ESW B;  2R5Z B;  2VON A;  2DYR H;  2XKO A;  2WGB A;  2DFI A;  1JT0 A;  4GCT A;  1BM9 A;  2GXB A;  5LRS A;  2DTR A;  3NRV A;  4IO9 F;  1Y8Q B;  2VQH A;  1DU6 A;  4U0W A;  5CJ9 A;  4LLN A;  3FMQ A;  3K4M A;  3HTA A;  1JGS A;  5FGM A;  3CDH A;  2XAG A;  4X0G A;  3DEU A;  4KFC A;  2XAF A;  1JTY A;  4PUS A;  2ZXI A;  3K1N A;  2FJ1 A;  5CVU A;  1LB2 A;  2OER A;  4D7N A;  1PP7 U;  1RR7 A;  4CCN A;  2MYS A;  3A01 B;  4I7H A;  4EQQ A;  4IHX A;  4U9L A;  4P9F A;  3WTX C;  1VFC A;  2WTE A;  5AON A;  3ZQI A;  2ELJ A;  4ESF A;  2BHZ A;  2OUM A;  4GO1 A;  3EUH A;  3WTZ A;  2M9H A;  3E6M A;  3GFL A;  2PMU A;  3LA3 A;  4HG2 A;  3CCJ I;  3OSF A;  4AVZ A;  2YX7 A;  3GTL J;  5FLX K;  1L0O C;  1SFE A;  2JSP A;  2E1M C;  2OCC H;  2Y30 A;  2AQF A;  4RGX A;  3ZP5 A;  3HB9 A;  4XLP F;  4HOB A;  2BY0 A;  4RAF A;  3S2H J;  4KUM A;  5F64 A;  1KYW A;  3GTP J;  1BI1 A;  1SD5 A;  2GQQ A;  3L00 A;  1IUY A;  3L2C A;  4IOA F;  1IZ1 A;  1K7A A;  4CHU A;  4Y4R A;  3D5S C;  1HLV A;  2QQB A;  4BAC A;  2M0M A;  4Y15 A;  3TQN A;  4DOZ A;  2JN6 A;  4D7M A;  1D8J A;  3OMY A;  2XAH A;  2CUF A;  5D6F A;  5GP9 A;  1SFK A;  5GAG J;  2PG4 A;  3CLO A;  1W0U A;  3NNR A;  3PUB A;  3FBN B;  4G12 A;  2CQ7 A;  2OZU A;  2REK A;  2PEX A;  3U2R A;  2VUM J;  3SZP A;  2VQC A;  4M3G A;  2E1C A;  4XSX F;  2B0L A;  1PYV A;  2VPL A;  5BQT A;  3LFU A;  1ZG3 A;  4XKW A;  5BS6 A;  4CSW A;  4ZDL A;  5F0H A;  4S04 A;  2XGE A;  2BBY A;  2JTV A;  3A01 A;  2HTS A;  4RB3 C;  2VJI A;  2P5L C;  1X1B A;  1K6O A;  1HDD C;  2L9R A;  2PX9 A;  2WV1 A;  4PK4 A;  4JOM A;  4XKB A;  4GFL A;  2GIZ A;  2JSC A;  5DYM A;  2DTZ A;  3SEQ A;  2X48 A;  2BOL A;  3VYR B;  4OIR F;  2QZ8 A;  2KL4 A;  1BOA A;  1R1T A;  1V3F A;  4EGY A;  3DU5 A;  2BE5 F;  1OCR H;  3O8G A;  2ECC A;  4EV0 A;  1R5G A;  2FQ3 A;  5F6F A;  3DTK A;  3GCM A;  3FXJ A;  2EA4 A;  2BY2 A;  4AC0 A;  2O5R A;  4S0H B;  2Q2E A;  4XM3 A;  3RYR A;  1CF7 A;  1XC5 A;  4II2 A;  3NS4 A;  4A2U A;  4R1H A;  2JVG A;  1FSE A;  3HKZ N;  3E1S A;  3KYD B;  3GZI A;  4IQJ A;  4BYY A;  3K4N A;  3KYL A;  1XX5 A;  2EIN H;  4CCL A;  2LYC A;  1XD7 A;  1ZR2 A;  2X6X A;  1U8B A;  3CCL I;  3I55 I;  3HSE A;  3QP6 A;  4CUG A;  4EJU A;  3VYU B;  3HC7 A;  4RAZ A;  2FML A;  2DA3 A;  4A0Z A;  1MDM A;  2TRT A;  3WTW C;  3K70 C;  1O3R A;  1K4S A;  3I59 A;  1K6Y A;  4UVC A;  5E1X A;  3J7Z I;  3CWR A;  4CO8 A;  2Y31 A;  4PSX A;  4MGR A;  5HNH A;  5EEG A;  2L7F P;  3SHF A;  3MD2 A;  2V79 A;  1QZZ A;  3BOQ A;  1I3A A;  5D1R A;  2ZME B;  2R7S A;  1VND A;  2EV5 A;  2K7L A;  2EJR A;  1YW9 A;  3MKL A;  4HA8 A;  3GVA A;  3JSP A;  2LRD A;  2G7G A;  3HOT A; 
#chains in the Genus database with same CATH homology
 2G7L A;  3S1R J;  3O8H A;  5EGO B;  3IH3 A;  5IPA A;  1FJL A;  3LJL A;  3NPI A;  2ECB A;  3K2A A;  3Q3S A;  1NK3 P;  4JX4 A;  2YVE A;  3HOU J;  2EZI A;  4KWA A;  2FBQ A;  3VP5 A;  2XGD A;  4IHV A;  4GFK A;  1G2H A;  5D19 A;  4C3J J;  2ID6 A;  2RAE A;  1JTX A;  2H1K A;  5C3E J;  3HEF A;  3JRA A;  2HOT A;  4QSH A;  5F27 A;  2XPU A;  3FK7 A;  4AF5 A;  3DCF A;  1BJZ A;  1IC8 A;  5F1J A;  1MBG A;  4FCY A;  3BR3 A;  3KKD A;  5J1R A;  2EH3 A;  3HM5 A;  4D5C A;  2W53 A;  2EZL A;  4RDU A;  3CJD A;  2M2E A;  3G7R A;  2FD5 A;  1TC3 C;  1K83 J;  1HDP A;  2NVY J;  4MFE A;  3VPR A;  1QVU A;  3JRE A;  3JRI A;  2MSY A;  2VPR A;  2R5Y B;  1PUF B;  3GBG A;  2R5Z A;  1P7I A;  1H89 C;  3HGG A;  5DAJ A;  3EGQ A;  5FGL A;  2ZCX A;  2IU5 A;  2YVH A;  4JL3 A;  3Q0V A;  3GTJ J;  1TWA J;  3A02 A;  2LLK A;  1RKW A;  1MNM C;  1TWC J;  1I3Q J;  4BXX J;  2M8G X;  4CGR A;  3ON2 A;  2EBI A;  1IGN A;  1ZGW A;  2XGC A;  3OOU A;  3JR9 A;  2PZ9 A;  1VI0 A;  3TP3 A;  1ETO A;  3QPL A;  3M3Y J;  2HXO A;  1JKR C;  1JKQ C;  2NS7 A;  1B72 B;  5GPA A;  2H8R A;  1K61 A;  5IP9 J;  2O9L A;  1HOM A;  2R93 J;  4DZP A;  2HXI A;  3BNI A;  1F43 A;  1BW5 A;  5F08 A;  1NTC A;  5AQC A;  4FIS A;  3UKG A;  2L7Z A;  1WH7 A;  2F07 A;  5J3L A;  1VF9 A;  3BJB A;  4I76 A;  3IH2 A;  1GV5 A;  1Z77 A;  2LTP A;  3BQY A;  2UXU A;  5GPC A;  2ELK A;  2XPV A;  4A3L J;  1IJW C;  4A3C J;  2O8K A;  4DYR A;  1MH3 A;  1RPW A;  3LOC A;  2JA6 J;  1RES A;  2ZOY A;  4L5E A;  5EYR A;  3BTI A;  5J1U A;  5IP6 A;  1JKP C;  2DA1 A;  1X58 A;  2IEK A;  1U78 A;  1GVD A;  1IV6 A;  1ETK A;  3H3V K;  3HOY J;  2PMZ N;  1LFU P;  4A3E J;  1NK2 P;  2COB A;  3ZQL A;  3VOK A;  1Y1W J;  3ZQG A;  1JGG A;  3HOV J;  2O7T A;  4QTR A;  4BY1 J;  2E2J J;  2PBX A;  1A5J A;  2IAI A;  1ZK8 A;  3HE0 A;  3BG5 A;  3TW6 A;  2X9D A;  2DJN A;  3S15 J;  3SFI A;  3M4O J;  3FIW A;  4MLO A;  1Q1V A;  4IHW A;  5EDN A;  1GDT A;  2MGQ A;  3QQA A;  1ETY A;  3AQS A;  3VW0 A;  2O7O A;  1APL C;  3S1M J;  1S7E A;  3WHB A;  4GFB A;  2DA5 A;  2D6Y A;  2G7S A;  3LHQ A;  4A3K J;  4A93 J;  3CCY A;  2HYJ A;  1JT6 A;  1ETW A;  5CW8 A;  4D5F A;  1QRY A;  2DMP A;  2NVX J;  1TWF J;  5EG0 A;  3IH4 A;  1CQT A;  4A3I J;  1WCM J;  3MNL A;  4M3D A;  4GCL A;  4ABZ A;  2R92 J;  2M34 A;  2ID3 A;  4Y52 J;  1P7J A;  4M3E A;  1MH4 A;  2OI8 A;  3E7Q A;  1TWG J;  2GLO A;  3JSJ A;  3G1M A;  3QKX A;  4XRM A;  1X2M A;  4A3F J;  3MN2 A;  4PXI A;  5BNG A;  5M3F J;  3NRG A;  3T6N A;  3RQI A;  2FQ4 A;  4J19 A;  2QTQ A;  2LY9 A;  2VI6 A;  3Q0W A;  5FLM J;  2EZH A;  4QIW N;  1MBH A;  1AKH B;  2LVS A;  2ZOZ A;  2DMU A;  2P81 A;  3VW1 A;  1HF0 A;  3MVP A;  1R9T J;  2XSD C;  1JUS A;  1SGM A;  5CXI A;  2JA7 J;  5M5W J;  3S1Q J;  2UXP A;  3PAS A;  1ENH A;  3S16 J;  2V57 A;  4M3F A;  3COL A;  3G1O A;  5HOD A;  1UI6 A;  3E7L A;  3NI7 A;  2ME0 A;  2VKV A;  3VVY A;  3OIO A;  3IV5 A;  2EZK A;  2DA7 A;  2HQ5 A;  3S17 J;  1ORK A;  4DW6 A;  4EEF G;  3HTH A;  4DZJ A;  1T56 A;  3BG9 A;  2DMQ A;  2YU9 J;  2NVQ J;  2G3B A;  2Y0S N;  3BG3 A;  2NP3 A;  2DA2 A;  3ON4 A;  3CQZ J;  3LSJ A;  2M0C A;  2N8G A;  3AQT A;  1YRN B;  1AU7 A;  1B8I A;  5C4J J;  3BR2 A;  4UUS B;  5K58 A;  5K7H A;  1H88 C;  1OCP A;  1FIP A;  4XRS A;  2MW8 A;  3B6A A;  3W6V A;  4A3B J;  3ANG A;  1JUP A;  2WUI A;  4ICH A;  2LKX A;  3G1L A;  4CYC A;  3H0G J;  3BHQ A;  5H9T A;  3BR0 A;  2E2I J;  4HNV A;  1ZTR A;  4LOC A;  3ANP A;  3OSG A;  2RHA A;  5E3M A;  5M5Y J;  3B81 A;  5CXG A;  5EFY A;  2G0E A;  4I6Z A;  1ZQ3 P;  5IYB J;  2KDZ A;  4M3B A;  3PM1 A;  1UMQ A;  3KKC A;  2QOP A;  1POG A;  4UDS A;  3S5R A;  3C07 A;  2UXI A;  3JRG A;  3V6G A;  3K7A J;  1E3O C;  1JJ8 C;  5D18 A;  5DS9 A;  5M5X J;  5F04 A;  3NXC A;  5EGO A;  2DG8 A;  2EQR A;  3I4N J;  2XB5 A;  2HYT A;  4AUX A;  4BY7 J;  5JLW A;  5IOZ A;  4V2F A;  1TWH J;  3LWJ A;  3FRQ A;  2YUS A;  1RKT A;  2YS9 A;  4W1U A;  3RKQ A;  1ITY A;  4HKU A;  3B6C A;  1GUU A;  1UI5 A;  1U9O A;  3F1B A;  5EF6 A;  3VUQ A;  2IBD A;  2AHQ A;  4XIC A;  1IDY A;  1BL0 A;  1QVT A;  2CUE A;  2L7M P;  1JKO C;  1ETV A;  4JX6 A;  2E19 A;  4DYC A;  3JRC A;  3HIM A;  4ACI A;  3BQZ A;  3S2D J;  3SDG A;  2NVT J;  1BA5 A;  4AC6 A;  1ETX A;  1DU0 A;  3HBL A;  3VVX A;  4AYB N;  1FIA A;  3KNW A;  3DEW A;  5C4Y A;  1EF4 A;  5C44 J;  2DG7 A;  4JNN A;  2DMN A;  2LFB A;  4FE7 A;  4BKX A;  2R5Y A;  1FTZ A;  2Y9Z A;  1PUF A;  1I50 J;  2QKO A;  2Q24 A;  2D5V A;  2K9N A;  2AO9 A;  5FKM A;  3GTQ J;  2QWT A;  4M6V A;  3BTC A;  4MO7 A;  5EZH A;  2NOG A;  4IEJ A;  4JP0 A;  2R7Z J;  2X6O A;  2XPW A;  2DA4 A;  2GM4 A;  2WB1 N;  1D5Y A;  4A3J J;  1A6I A;  2LP0 A;  3HOZ J;  5M3M J;  4IHY A;  1OCT C;  3O60 A;  4B3A A;  2HDD A;  2JA5 J;  2WAQ N;  1JJ6 C;  1X2N A;  5IOY A;  1LE8 B;  1GT0 C;  1WPK A;  5FKN A;  2CRG A;  2GBY A;  3QPS A;  3V78 A;  2UXO A;  1FTT A;  1B72 A;  4A3D J;  4JKZ A;  3G56 A;  3L1P A;  2GUH A;  4MFD A;  5FKL A;  2ZCN A;  3BR5 A;  3S1N J;  5IYC J;  3PO3 J;  1BW6 A;  2R5Z B;  1ZKG A;  3ZQH A;  2LD5 A;  2Y2Z A;  5DTD A;  3LSR A;  4MIM A;  2WGB A;  2Y9Y A;  2UXH A;  3LSP A;  1JT0 A;  2LK2 A;  2OF7 A;  4GCT A;  1WGX A;  1IUF A;  1SAN A;  2VKE A;  1GV2 A;  4XRS G;  2QIB A;  3F0C A;  3ZQC A;  1DU6 A;  2ME6 A;  3JRD A;  2JMW A;  4C3I J;  3GTO J;  3QBM A;  4C2M J;  3P9T A;  3SJM A;  1WI3 A;  5FKO A;  3GTK J;  3HTA A;  2MG4 A;  1I6H J;  4ME9 A;  1IRZ A;  1JTY A;  2OER A;  2FJ1 A;  3VIB A;  4D7N A;  1UHS A;  4X1E A;  2W48 A;  1RR7 A;  3JRB A;  3A01 B;  3NAU A;  1XG1 A;  4IHX A;  3TP0 A;  4L62 A;  2XB0 X;  2R0Q C;  2I10 A;  2XRL A;  1VFC A;  3ZQI A;  4MK6 A;  3HOX J;  1RET A;  3HDD A;  3EUP A;  2LR8 A;  2M9H A;  1T33 A;  2DN0 A;  4XK4 A;  3OSF A;  3GTL J;  1JUM A;  4UUT A;  2OPT A;  2Y30 A;  2JK3 A;  1MBJ A;  3HB9 A;  2TCT A;  1LE8 A;  3BTL A;  4BBS J;  3S2H J;  3RH2 A;  4MXM A;  3GTP J;  3NAR A;  2L0K A;  5HSZ A;  1OJL A;  5K7F A;  1QPI A;  3FIS A;  1ZR4 A;  3BRU A;  3FK6 A;  2K40 A;  1XS9 A;  1HLV A;  1MBK A;  2JN6 A;  4D7M A;  3GEU A;  1OFC X;  3HTJ A;  4NN1 A;  3RD3 A;  5GP9 A;  2CUF A;  3Q0U A;  2JJ7 A;  5E3N A;  2CQQ A;  3TED A;  1IDZ A;  3JRF A;  1AKH A;  2NP5 A;  5F0C A;  2RAS A;  3BTJ A;  1W0U A;  3NNR A;  3CRJ A;  3RZD J;  2JA8 J;  4G12 A;  2GEN A;  3ZQF A;  2REK A;  4GCK A;  2VUM J;  3CDL A;  3KZ9 A;  4M3G A;  4JYK A;  5EG0 B;  3JRH A;  1AHD P;  4A3G J;  1UG2 A;  1SFO J;  4W97 A;  1MBE A;  2E1O A;  4Y7N J;  3D1N I;  4NDL A;  4XID A;  3PPB A;  4JX5 A;  2ZCM A;  2DA6 A;  2QCO A;  5F0H A;  2B63 J;  4X6A J;  2XGE A;  4NEL A;  5FHP A;  3A01 A;  1FEX A;  1HDD C;  2HKU A;  4FE4 A;  2L9R A;  2WV1 A;  4GFL A;  5FKK A;  2DTZ A;  1Z0X A;  3BR6 A;  2X48 A;  3PO2 J;  3VOX A;  3VVZ A;  5HAW A;  2KT0 A;  4A3M J;  1YRN A;  4RBO A;  5IP7 J;  2K9S A;  1Y1V J;  2XDN A;  5K7Z A;  4UUS A;  3S14 J;  5FMP A;  2QF7 A;  3ZOB A;  2CU7 A;  2GFN A;  2HOS A;  5FLV A;  2CQX A;  2K9Q A;  2CJJ A;  3O8G A;  2ECC A;  3GTG J;  4A69 C;  1IG7 A;  3TW7 A;  4AC0 A;  3LNQ A;  4S0H B;  3WHC A;  5IYD J;  1O4X A;  1XC5 A;  2HI3 A;  1MSE C;  5E3L A;  4YZE A;  3BT9 A;  1WH5 A;  3HKZ N;  3BCG A;  5EZG A;  3GZI A;  3RZO J;  1ETQ A;  5C4X J;  4BBR J;  3VW2 A;  4V2G A;  1ZR2 A;  1U8B A;  1U9N A;  5J1Y A;  1B8I B;  1MBF A;  3IUV A;  3HGY A;  3CMY A;  2DA3 A;  2JWT A;  2TRT A;  1MSF C;  5JLX A;  4C3H J;  9ANT A;  4DYQ A;  3C2B A;  5FJ8 J;  2HOA A;  1F36 A;  3BR1 A;  4CYC B;  3CWR A;  2Y31 A;  2E2H J;  3FKI J;  1H8A C;  2NX4 A;  3HTI A;  4B4C A;  4FTH A;  3A03 A;  2L7F P;  2NS8 A;  2ZB9 A;  5E3O A;  3LSG A;  5D1R A;  1VND A;  5EEA A;  3DPJ A;  3MKL A;  1HCR A;  3GTM J;  5HBU A;  3I4M J;  1W0T A;  5F0F A;  3HOW J;  4B1R A;  2G7G A;  2DMT A;  2FX0 A;  1LFB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...