2GBYA

Structure of qacr multidrug transcriptional regulator bound to bivalent diamidine berenil
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
186
structure length
186
Chain Sequence
NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKKEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords HTH-type transcriptional regulator qacR
publication title Structure of QacR Multidrug Transcriptional Regulator Bound to Trivalent and Bivalent Diamidine Drugs
rcsb
source organism Staphylococcus aureus
total genus 79
structure length 186
sequence length 186
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2006-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2gbyA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2gbyA02
3BG5A 2VPRA 1ETXA 3NARA 2ID6A 5EFYA 4X1EA 4MLOA 4XRMA 1I3QJ 1MBGA 3HM5A 3E7LA 2ZOZA 3HOXJ 1BA5A 2EZLA 4B1RA 3GTPJ 2D5VA 4M3FA 2GUHA 2X48A 1MH4A 5BNGA 3Q0UA 2G7GA 3PASA 4ACIA 1ZKGA 1APLC 1JTXA 4L62A 3FKIJ 2DMQA 1B72A 2EZHA 5IYCJ 2L7ZA 3K2AA 5J1YA 1ETVA 3MNLA 1D5YA 4W97A 3G1LA 5K58A 3VOXA 3BR2A 3S1MJ 3BTIA 2DA6A 1SGMA 3KNWA 1RETA 2O7TA 4GCLA 1SFOJ 3A02A 4GFBA 3JRAA 1GV5A 3T6NA 4EEFG 1RKTA 3GTKJ 5FKOA 5EG0A 2IEKA 3IV5A 2K40A 1TC3C 1FIAA 2JJ7A 1JKRC 4CYCB 1ETOA 3CRJA 4UDSA 1JJ6C 3ZQFA 3I4NJ 2FX0A 3JRHA 3JRFA 3HDDA 3W6VA 3IH2A 3BR0A 1H89C 1HCRA 4FISA 2DN0A 5E3NA 1GT0C 4QIWN 5C3EJ 4UUSB 2ECCA 3BTJA 4ME9A 3JR9A 1OCTC 4IHYA 3BJBA 5DTDA 4A3DJ 2ELKA 2EQRA 5F27A 1QRYA 2QOPA 4M3EA 5FKMA 3LSJA 1Z0XA 4MXMA 4CYCA 2QF7A 3G1OA 2O8KA 2QCOA 2EBIA 1MNMC 2E2IJ 3G56A 5F0FA 1IV6A 3S17J 4CGRA 3HOZJ 1WI3A 3I4MJ 4DYRA 1HDPA 2JWTA 2CUFA 1DU6A 1HLVA 1IUFA 3TW7A 4UUSA 1HF0A 1NTCA 1A6IA 3IH4A 4L5EA 3ON2A 2CQXA 3EUPA 3PPBA 3S16J 4BY1J 1JT6A 3FISA 4JNNA 2HOSA 2FBQA 2G7LA 5D18A 2NVTJ 3ZQGA 3HIMA 2DMUA 5EZHA 3EGQA 3V78A 3VOKA 2QWTA 1YRNA 2NOGA 2K9NA 2DG8A 3VVZA 1ZTRA 4A3BJ 2XSDC 4A3EJ 2R93J 1U9OA 1MBJA 3CWRA 2LKXA 1BW5A 4BKXA 3Q3SA 5F08A 3S2HJ 2L0KA 1F36A 3DCFA 2M2EA 1X2MA 2X6OA 5K7FA 4MO7A 2REKA 3C2BA 1WGXA 2LK2A 5CXGA 3HBLA 2DA3A 5HSZA 1VI0A 2OI8A 5FLMJ 3PM1A 2OF7A 1H88C 1X58A 2NS8A 1ORKA 3ZQLA 1LE8B 3G7RA 4YZEA 2E19A 3HGGA 4Y7NJ 5EF6A 1BL0A 2VI6A 3NXCA 2HDDA 2R5YB 1K83J 3LSPA 2GFNA 2LFBA 3HOWJ 3JRGA 2R7ZJ 2HYJA 5EDNA 1HOMA 1UHSA 4A3MJ 4GCKA 3DPJA 1MBFA 1JUPA 2DMTA 1R9TJ 5EGOB 4FE7A 3BCGA 3IH3A 2WGBA 1GUUA 3A01A 2XGEA 2H8RA 2XGCA 2FD5A 4JP0A 1B8IB 3B81A 3HOYJ 3WHCA 4A3FJ 3VP5A 3RKQA 3VW1A 1LE8A 3NRGA 2W53A 2HOAA 3MN2A 1ETKA 3LHQA 2OPTA 3CDLA 4M3BA 4B4CA 2O7OA 4GFKA 5K7HA 1RPWA 3OSFA 3O60A 4MFDA 1Q1VA 4JKZA 1XG1A 4C2MJ 2Y9ZA 5J1RA 3P9TA 3SJMA 2DJNA 4C3JJ 4A3GJ 2E2HJ 5M5XJ 3BR5A 5GP9A 5IYBJ 3BQYA 3LSGA 4RDUA 1FEXA 5AQCA 1IDYA 2XRLA 4HKUA 1FTZA 2ZB9A 3GTOJ 2R5ZB 1JGGA 1HDDC 2JK3A 1MSFC 1F43A 2FJ1A 3KKDA 3HKZN 5E3MA 3OIOA 1P7JA 1VFCA 2KT0A 4JL3A 2Q24A 1T56A 5F0CA 1IJWC 2P81A 3GTMJ 2EZIA 5EZGA 3AQTA 2UXPA 2NP3A 4A3CJ 1QVTA 4XRSA 3QKXA 4FE4A 3V6GA 3VW2A 1I6HJ 1O4XA 2K9SA 2Y2ZA 4DZPA 4UUTA 2IBDA 3O8GA 1ZQ3P 4HNVA 1T33A 1LFUP 1POGA 3QBMA 1LFBA 4W1UA 5DAJA 2UXUA 1TWGJ 1GV2A 3B6AA 2JMWA 3M3YJ 3LWJA 1E3OC 2ZOYA 4IHXA 4IHWA 2I10A 3A03A 1UI6A 3DEWA 3S2DJ 1TWCJ 5HODA 3BTLA 2HQ5A 2COBA 4JYKA 4D7NA 4QTRA 2XDNA 2MGQA 2UXHA 2N8GA 2LLKA 1GVDA 1JT0A 1MSEC 2JA6J 3MKLA 5C4XJ 4C3IJ 1AKHB 3JSJA 3BG9A 1BJZA 2LTPA 4JX6A 1CQTA 4IHVA 4M3DA 2NVQJ 4XIDA 1JKPC 3PO2J 1EF4A 3IUVA 1Y1WJ 1AU7A 1IC8A 4AC6A 2QKOA 3JRBA 3HE0A 3FK6A 4QSHA 1XS9A 3C07A 1SANA 2QTQA 2NX4A 3KZ9A 4XICA 3QPLA 2AHQA 2XB0X 2L7FP 4DYCA 3UKGA 3JRIA 3D1NI 4A3LJ 1UMQA 5IPAA 4XK4A 5M3MJ 1VNDA 2E1OA 2Y30A 3TW6A 5IOYA 1AKHA 3VVXA 2Y31A 2CRGA 1MH3A 2TRTA 2DMPA 1IGNA 5HBUA 1MBEA 2JA7J 2DA5A 4M6VA 2B63J 4ICHA 1ETWA 3HEFA 5M3FJ 4MIMA 2R92J 2QIBA 4G12A 1U8BA 2DTZA 1ZGWA 2O9LA 3BRUA 3OSGA 2RHAA 3HTHA 1RKWA 5D19A 1A5JA 2H1KA 5IP9J 3G1MA 4AUXA 5IP6A 2IU5A 1JTYA 1JUSA 2JA5J 5FKNA 2NVXJ 4BBSJ 5H9TA 2R0QC 4J19A 4A3JJ 2NP5A 5EYRA 2ID3A 1RR7A 1PUFB 2LP0A 2YS9A 2VKVA 3BHQA 3BG3A 1X2NA 3CQZJ 3LNQA 4D7MA 3TEDA 3S1RJ 2WUIA 2HI3A 2RASA 5F1JA 3VUQA 1FIPA 4DYQA 4M3GA 4MK6A 2XGDA 1IDZA 5JLXA 4I6ZA 1K61A 4PXIA 2CU7A 5HAWA 1ENHA 4AF5A 2X9DA 2E2JJ 4GFLA 1ETQA 1TWFJ 4D5FA 2TCTA 4NDLA 3HTJA 3TP3A 1FTTA 1QVUA 3GTGJ 2R5YA 3CCYA 3S1NJ 2JN6A 3HB9A 1IG7A 4IEJA 2CQQA 3L1PA 3WHBA 4ABZA 2CUEA 1XC5A 1G2HA 2Y0SN 3BR3A 2GBYA 2CJJA 1B72B 2XPUA 5EGOA 2YU9J 2LY9A 2OERA 5J3LA 1U9NA 2DA1A 3CJDA 2NS7A 3BR1A 1B8IA 2MG4A 2M9HA 2M34A 2XPWA 5J1UA 4JX4A 4AC0A 5IYDJ 3KKCA 2F07A 3FRQA 2D6YA 3SDGA 3B6CA 2MW8A 2XPVA 3F0CA 5GPCA 2GENA 3COLA 2LD5A 1NK2P 2HYTA 4RBOA 3QPSA 5M5WJ 4A93J 1Z77A 5EG0B 4C3HJ 4FTHA 5DS9A 4A3IJ 4Y52J 5C44J 5E3OA 1OJLA 3ZQIA 4A3KJ 1W0TA 3GEUA 3VVYA 3ZOBA 2G3BA 3S14J 3SFIA 5D1RA 2YVHA 2R5ZA 3OOUA 2L7MP 2HXOA 2ZCNA 4NELA 1ITYA 2HKUA 1UG2A 2K9QA 3Q0VA 2M0CA 2ME0A 5FJ8J 4I76A 4XRSG 3GTJJ 4V2FA 3GZIA 5C4YA 3VIBA 2WB1N 2YVEA 2XB5A 4KWAA 2FQ4A 3ZQHA 2GM4A 3NAUA 2MSYA 2GLOA 3ZQCA 1GDTA 5FKKA 5F0HA 3LSRA 2WAQN 1FJLA 1WH5A 2DA2A 5M5YJ 3LOCA 3BTCA 4LOCA 4B3AA 3O8HA 5JLWA 3RD3A 3GBGA 2VUMJ 5FKLA 1H8AC 2PBXA 1JKOC 1ZK8A 2PMZN 5EEAA 1IRZA 2LVSA 2UXIA 3NPIA 2EH3A 5FMPA 1JUMA 1AHDP 2UXOA 3S15J 1BW6A 1ETYA 3QQAA 3VPRA 1ZR2A 2V57A 5K7ZA 1VF9A 1WCMJ 4FCYA 1YRNB 4V2GA 3AQSA 2LR8A 3BNIA 3HTAA 3ANGA 3TP0A 2YUSA 5FLVA 3GTQJ 3HOVJ 3HTIA 3M4OJ 3Q0WA 1TWHJ 4S0HB 3VW0A 3HOUJ 3RZDJ 3CMYA 1JJ8C 2NVYJ 1W0UA 2ZCXA 3ON4A 1I50J 5E3LA 2L9RA 3FK7A 2PZ9A 1OCPA 1QPIA 3S5RA 1P7IA 2RAEA 5F04A 2WV1A 3FIWA 3BR6A 5C4JJ 1JKQC 3F1BA 3RH2A 3H3VK 5GPAA 5CXIA 3NI7A 1S7EA 2G7SA 2DMNA 1DU0A 1OFCX 2JA8J 2DG7A 2VKEA 1WH7A 3BT9A 1ZR4A 2DA4A 5IOZA 1UI5A 3K7AJ 1RESA 3GTLJ 4DW6A 3ANPA 1WPKA 3LJLA 1U78A 2ZCMA 4AYBN 3JREA 2ECBA 2Y9YA 4A69C 2IAIA 3NNRA 3S1QJ 4MFEA 4X6AJ 5FHPA 2G0EA 1MBHA 2ME6A 5CW8A 3A01B 2W48A 5IP7J 4BXXJ 3BQZA 2HXIA 1TWAJ 4DZJA 3JRCA 2AO9A 1MBKA 4JX5A 4BBRJ 1PUFA 4NN1A 5FGLA 1NK3P 4GCTA 3RZOJ 3MVPA 2DA7A 9ANTA 3H0GJ 3E7QA 2KDZA 3JRDA 4D5CA 3PO3J 2M8GX 1Y1VJ 4BY7J 2EZKA 3HGYA 3RQIA 2HOTA
chains in the Genus database with same CATH superfamily
4BQQA 4M71A 2DBBA 2BY1A 2UZKA 3BG5A 2VPRA 1W5TA 2GZWA 1MJAA 5CVIA 4ZZLA 3LAPA 4X1EA 3DTIA 1I3QJ 3RCOA 1MBGA 1ZARA 3HM5A 3E7LA 2ACJA 3F6OA 1BA5A 2EZLA 3I55I 1KU3A 4WXDA 1YX5A 2X51A 2OC6A 3AAFA 4IHSA 4ZDLA 1Z21A 2CUJA 4HZFA 5BNGA 3AG2H 3Q0UA 3PASA 1F1ZA 2PMZA 2BZTA 2ZCWA 1B59A 1ZKGA 2HGCA 3FKIJ 4JQFA 4ZH4F 1R58A 2F5VA 5J1YA 3FF5A 2EIJH 3JTGA 5LHIA 3KZYA 5DYMA 3E3VA 4RGXA 3BPVA 3BTIA 1B9MA 2P6TA 1SGMA 3KNWA 3QP5A 2O7TA 2BY2A 4GCLA 3F23A 3I71A 3A02A 4GFBA 1P4AA 3JRAA 3T6NA 4C30A 1K6OA 2CWEA 1RKTA 3L7WA 1Y0UA 4GGGA 5KHDA 1X1PA 2DO7A 2EILH 2K40A 1FIAA 4CYCB 3L09A 4KMUX 3HDDA 3B73A 4ZYHA 3IH2A 3BR0A 4BU2A 2QEXI 5KAFC 3ZQ7A 4O5VA 1ZAOA 4V19K 2YX7A 3BTJA 1J59A 1OCTC 4OMZA 2ELKA 1JGSA 2CO5A 2EQRA 2KRFA 2OCEA 3MZHA 4MXMA 5DCFA 2Y48A 3G1OA 3CCQI 2O8KA 2QCOA 3REOA 4AU7A 2MD0A 4KT5C 2RKHA 1UHMA 2FSWA 2V6EA 1X1AA 2FOKA 1WI3A 3CMAI 3LSTA 4A0ZA 3I4MJ 3MAJA 1BR4A 1UZCA 3I59B 2R7XA 1DU6A 1USTA 3J7YJ 1HF0A 3IH4A 4L5EA 1RI7A 3VB2A 4L9VA 3AL0C 1YIJI 3S16J 4BY1J 4BH9A 4XKCA 4RB3C 2FBQA 2G7LA 5D18A 3V7CA 3IUOA 1O3SA 2P8TA 5DEQA 2E5NA 2LKSA 2QWTA 2K9NA 3VVZA 3DBHB 4A3BJ 1SFKA 1TNSA 3K1MA 3I54A 2XHKA 5K5QA 3CWRA 4BE1A 3CLOA 1FWZA 4DJAA 1XGNA 1BW5A 4EGZA 1OYYA 2K7LA 2WAEA 5KCMA 5B66C 3DTEA 1VQNI 1G3YA 1XTAA 2E1NA 3OR1C 3L2VA 1JE8A 4RS8A 3MZ8A 3TOBA 5K7FA 4E6KG 4KISA 3ZPLA 3FM5A 1WGXA 2M3AA 2FJI1 1U5TC 2W84A 2OI8A 3CUQA 5FLMJ 3PM1A 3ZN1A 2VJ4A 4KIFA 3OYAA 2NS8A 3WTYC 2CV0A 1ORKA 1Z67A 3VSKA 5BPIA 3IKTA 3VTIA 2HDDA 2O3FA 2ESNA 2F5CA 3GW2A 5IT3A 3OYJA 1WVRA 4XBFA 2LFBA 2KP6A 1EJ9A 2R7ZJ 3CUQC 1U0JA 2HYJA 4Y33A 1UHSA 1MMGA 2E1MB 3FXQA 4GCKA 3DPJA 4HPQA 2RGVA 3DEEA 5F6FA 1R9TJ 2KZVA 1GUUA 2CYYA 3FM3A 4BL0B 2OQRA 1FOKA 2PN6A 2FD5A 1B8IB 3HOYJ 2FMLA 2K4JA 1LE8A 1C0WA 1JHHA 3VW1A 4AVZA 2W53A 2R7WA 2Y69H 3MN2A 1AA7A 2O7OA 3O60A 4JKZA 5EJCA 2KDOA 5L3CA 5J1RA 3P9TA 3BCBA 3SJMA 4C3JJ 4A3GJ 2E2HJ 4BAYA 5M5XJ 3QODA 3BR5A 4UV8A 3ZMDA 5GP9A 3WODF 5ERIA 5AQCA 3I5UA 1FTZA 1IZ1A 1HDDC 4IHTA 1LDKB 4HW0A 1RRJA 5D5UB 1T08B 3K1PA 1VFCA 1HW2A 1T56A 2YU3A 2RC4A 1IJWC 4IVNA 4TV7A 3N97A 1IAWA 3ONQA 2NYXA 4YEJA 4OIRF 2QQBA 1HKSA 1O4XA 3Q9VA 3VDXA 3F8BA 3SXYA 2AXTC 1LFPA 2XVCA 5JVGF 1ZH5A 1POGA 3QBMA 1LFBA 2XRNA 3I53A 1REPC 2M7BA 3KE2A 2Y75A 2RQQA 3BCAA 2BBYA 1ZREA 4KMFA 2ZOYA 2I10A 4HF2A 1UI6A 2O5RA 4I02A 2OV7A 2HTSA 1O3TA 1J5YA 4CCJA 4OIPF 5HODA 3V7RA 4RAFA 4YFKF 3BPXA 2COBA 2CQKA 1ON1A 3PQKA 4QTRA 2KL4A 1PUEE 4NHJA 4JK1X 2K5CA 5JI6A 2Y0MA 4BQAA 2W4SA 3L2RA 5DD8A 3E5XA 3BG7A 2VXDA 4C3IJ 2R7QA 3BG9A 3OS1A 1AKHB 3A2KA 1S9HA 4IHVA 3CCEI 4IO9F 1JKPC 1UFMA 3J80K 2M4GA 2IVMA 2IW5A 1X4OA 3FK6A 2VE9A 3QAHA 4QSHA 3W2AA 2HZTA 2QTQA 1DGWY 4F3QA 3AG3H 3QPLA 5DV5A 2AHQA 2XB0X 3H5RA 4EJVA 3KP6A 2L7FP 3F72A 2Q2EB 3D1NI 1WQ2A 3TL4X 4XK4A 2E1OA 3U2RA 2EFWA 3FWEA 2Y31A 2IPQX 2DDBA 3DPTA 2UWMA 2TRTA 1KA8A 1Y8QB 1IGNA 1O7LA 3V4GA 1MBEA 4IXAA 1VQMI 2DA5A 2QLZA 2A61A 2B63J 3CMMA 4MHGA 3OS0A 1YITI 4MTEA 2QIBA 4G12A 3I4PA 1TW3A 3BRUA 3PJRA 3OSGA 1SEUA 1JXSA 3HTHA 3WTXC 1A5JA 3VYRB 5IP9J 2W85A 4AUXA 1FZPB 2L01A 5AONA 5LHGA 2FXAA 1VQ7I 3L2QA 2K3FA 2ZY9A 3P7NA 2ZJQF 2R0QC 4DNCA 4KITB 1QPMA 2H09A 4ZZDA 1SFUA 1TL8A 3BG3A 3CQZJ 2WUIA 3PSFA 5LGNA 2XAJA 1FNNA 2HI3A 2ZSHB 3VUQA 1FIPA 2ISZA 2QVOA 2QM3A 1J75A 2VBYA 2FE3A 2XGDA 5E20A 1IDZA 2QQ9A 5JLXA 4I6ZA 1K61A 3RKXA 2XAHA 2VQLA 5B1BH 3WU2C 1DGRM 4O3MA 1PP7U 4HG2A 4XMYA 3ZRGA 2X9DA 3FXOA 3CCMI 1XGOA 4XLHA 4XLPF 1FLIA 1ETQA 4XOPA 4GFLA 3GZ6A 4BXUA 5GAHJ 5LFAA 1MGTA 3FHNA 2W7NA 2L7KA 2L3DA 2VLAA 2A05A 2L9NA 3IP4B 2ESHA 3RPUA 4IEJA 3FXRA 5CPRB 4Y13A 3L1PA 4KUMA 2L5QA 5E1WA 4BUPA 3PQJA 2IT0A 2XF5A 2L4MA 1LVKA 2EINH 2BW3A 2KIFA 1H9TA 2KIUA 1B72B 2YU9J 2OERA 4UV9A 5J3LA 2P7VB 4ITVA 4UUVA 3MFKA 4G6QA 1X4PA 2MG4A 1RUOA 2GIZA 4HF1A 1WRJA 4EVIA 2XPWA 3KZIC 1BBYA 3HSRA 5J1UA 5HLGA 1BR2A 1MNDA 2OAZA 3F22A 2JSPA 1I1SA 3F0CA 5GPCA 3COLA 1YJNI 3KYDB 3KYCB 4IOAF 3H92A 3CP2A 4BJTA 5GTHC 1YLFA 1NK2P 3CESA 3FXMA 4RBOA 3J80Z 3H5NA 1OR7C 2DPUA 5EG0B 4CO8A 4A3IJ 2JZYA 5C44J 2M1BA 3K4LA 1D1AA 1V55H 3JTHA 3HUGA 2W24A 3SFIA 1YFHA 2R7TA 3W2WA 3DLLF 3F9KA 2BE5F 3H5AA 2XAUA 1Z91A 1UG2A 1UG0A 1NHAA 3Q0VA 2ME0A 2XAQA 2V7FA 2B9SA 4V2FA 1QHHD 2WB1N 4LK1F 2YVEA 3SEZA 3DBLB 1O3RA 3NAUA 2TDXA 1W7PA 2CFXA 2MSYA 2P4WA 2P5KA 4ENNA 5TRDA 2GLOA 2O0YA 5HS9A 5FKKA 2IS4A 3OYKA 4BEHB 4I0BA 3MD2A 2DK8A 2RNGA 3KP5A 2R7RA 2WA0A 1XSXA 2UV1A 2XF7A 5LBQA 4LOCA 3BTCA 4B3AA 1YI2I 3NS4A 4OD5A 5E79C 1ZK8A 1IRZA 3NPIA 2L02A 2EV5A 3K6GA 5FMPA 5AIQA 2GXBA 4GYGA 1JUMA 3H3UA 5GTIC 4R8HA 1O57A 4RM2A 3CCJI 2W1OA 3QQAA 2V57A 2JPCA 1WJEA 2F4IA 1IF1A 4AIJA 1WHUA 5DM7F 4FCYA 3HTAA 2LR8A 5LGTA 5FFZA 3WGHA 2FEZA 2CSOA 3TP0A 2DYSH 3NEUA 1IV8A 1ZN2A 5GAEJ 3HTIA 3DKYA 1KYWA 4ZYGA 4EJUA 4S0HB 2Z5UA 2M7AA 5ICEA 4HYEA 1SVMA 3CMYA 1XGSA 1DPUA 1TT0A 1CF7A 4XKVA 1W5CC 3F21A 2FUG2 1QPIA 2D1HA 3TO9A 5E17F 3WG7H 2RAEA 5F04A 1XSDA 2WV1A 3FIWA 1JKQC 3F1BA 1A35A 3S8PA 3H3VK 4FX4A 3EPZA 1S7EA 1BI1A 3LSMA 3CC2I 2JA8J 3BT9A 1ZR4A 2DA4A 5IOZA 4PSXA 4GO1A 3K7AJ 2GXAA 3LJLA 1U78A 1R1VA 1K78B 1G59A 3BJAA 4YIFA 2ECBA 4MNUA 2IS6A 3CLQA 1EH6A 4MFEA 1NG7A 4XONA 1FYKA 2G0EA 1MBHA 1SMTA 1XCVA 4LIVA 3F8NA 2BOLA 2W48A 4BXXJ 2KJCA 2HXIA 3BQZA 3ZGKA 4B48A 4WK8F 3JRCA 1DP3A 2AO9A 3GEZA 1IRFA 1NK3P 4GCTA 2DA7A 1R5GA 1WFXA 3X2QH 4RAYA 1N25A 3JSOA 2BEOA 3JRDA 5J40A 3HPGA 2M8GX 2L4AA 1Z9CA 4U7BA 3KP4A 2FF4A 2DQRA 4HX8A 4XKWA 1BI0A 2WB1A 3K8PC 3OL3A 4M74A 1K79A 3MKZA 3CZ6A 1IW7F 4MLOA 4XRMA 1TW2A 2ZOZA 3TDZC 3EDPA 2FOWA 5EEGA 5CQEA 3WTVC 3DFGA 4DBRA 3G3ZA 4RMNA 2D5VA 3GTPJ 5L3DA 1MH4A 4CZCA 1WWXA 2M0MA 2AQEA 3ROUA 4M6XA 1FBSA 4ACIA 1ZG5A 3T8RA 5HVQC 2DMQA 2D1VA 1LPQA 3JSPA 3KLNA 3VFZA 1ETVA 4IQ4A 3SHFA 3S3OA 3MNLA 2VKDA 2DA6A 4HDVA 3WTWC 1YG2A 1A6QA 1SFOJ 1BC7C 2KISA 4PUSA 5DCMA 3J7AO 3QU3A 3ASNH 1AWCA 2R7SA 1FP1D 4RM3A 5FKOA 3GFJA 3IV5A 1QHGA 1TC3C 2JJ7A 2P5VA 3QYEA 1H0MA 1VQ4I 1X1DA 3MCZA 3JRHA 3JRFA 3E6CC 4ZJZA 4M9SA 1HCRA 3KP7A 3WGGA 4OWRB 2DN0A 5E3NA 2YPRA 2PX9A 1GT0C 2EFQA 5C3EJ 1LEAA 4A5NA 3ABLH 4ME9A 1X3ZB 5F27A 2PJRB 5ICFA 2WV0A 3W6JB 3LSJA 3OR2C 4CYCA 2QF7A 1SD7A 4G6TB 3NQOA 4ZYDA 2HS5A 2GAUA 2LBFB 1IV6A 1PYVA 1FT9A 3Q5FA 1P2FA 4EJWA 4Q4ZF 5EEHA 3HOZJ 1R1UA 2CUFA 1FOYA 3PIOF 3OWTA 2FRHA 1USSA 1NTCA 3KIOA 2CQXA 3EUPA 1PP8F 4LB5A 1JT6A 1FOXA 2OA4A 3BWGA 2HOSA 3GWZA 2V1NA 4LJZF 3ZQGA 2NVTJ 3DKXA 2AQFA 4G9YA 4N0BA 3ESWB 3VOKA 4ZDPA 5CVUA 1YRNA 2DG8A 2LMDA 4U0VA 1IXCA 2F48A 5FROA 4A3EJ 1HXDA 4L9TA 2LKXA 3E97A 4LLLA 1BC8C 1QZZA 2VB6A 1M1EB 4PDKA 3S2HJ 2L0KA 1Q1HA 2IXSA 4C2MA 4E70A 3DCFA 2WAFA 1BM9A 4MO7A 5BPDA 3DEUA 1T8IA 2X4HA 5BQTA 1MDMA 1T38A 3HBLA 1J7KA 3T5XA 4A6EA 5B5EC 2FBKA 4LG0A 4KA4A 3HHGA 4OAYA 4II3A 2GIVA 2ZJ2A 3HYIA 4H4KC 1LKXA 1MIJA 2HYGD 2HWVA 3ZQLA 3HJEA 2E71A 4GCVA 2ELJA 3ABUA 3LA3A 4Y15A 3K4KA 4N4OB 2VI6A 2Z9OA 1X3WB 2R5YB 4CCNA 4CCKA 2CV1A 1AOYA 3ZR8X 3LSPA 3CCSI 3BZKA 1P92A 5K5RA 3MKWB 3ZMVA 1T2KA 3CTAA 3JRGA 1HOMA 3W3CA 4A3MJ 1Z6RA 2VQHA 4D0PA 1JUPA 2DMTA 1XD7A 4P9FA 3KFWX 2PFVA 3BCGA 3FBIB 1BR1A 1SC7A 3A01A 4CUGA 3DPUA 1IRGA 3B81A 3K70C 3TO6A 2P5LC 1D1CA 4A3FJ 1MJ9A 2KRCA 4DGWB 2HOAA 3L00A 2QKLB 2OPTA 3CDLA 2A2FX 3PUBA 1RPWA 3OSFA 4MFDA 3TGNA 1YW9A 2VQCA 4D9JA 2EK5A 4PGGA 4F7ZA 3IHUA 2QSHX 2COMA 2DJNA 2IGMA 4EGYA 2MFZA 1PVEA 2E7XA 3BQYA 3PIPF 4RDUA 1FEXA 2A6EF 2XRLA 4U0YA 1F43A 3VODA 4NQWB 1RZ4A 3HTUA 4XRFA 3OIOA 4JL3A 2KT0A 2CFOA 4CCLA 2JVHA 5F0CA 1XMXA 2A5WA 2Z33A 3LFKA 2UXPA 2E1MC 1XDSA 5DM6F 2QBYB 2PMHA 3KEOA 4P9UA 4UUTA 1ZG1A 1ZRFA 1ZQ3P 4HNVA 1T33A 1LFUP 2LNBA 5DAJA 3IAM2 2RDPA 5J8FA 2V1DA 2EIMH 3M3YJ 3LWJA 4IHWA 4E7KA 4F55A 4BYYA 5D8KB 3S2DJ 1TWCJ 2HQ5A 4KICA 4MEXF 4B47A 2QENA 1RUNA 2LREA 4Z2YA 5JFRA 2X6XA 2XDNA 2JUCA 3H3ZA 2JTVA 1PJRA 2JA6J 1MSEC 2KFDA 1HSJA 5H20A 4OU0A 5C4XJ 3JSJA 2VJ5A 2HVSA 1CQTA 2KJBA 4M3DA 1A04A 3IUVA 2BY0A 1NH3A 1TLHB 2DXIA 3C2HA 1Y1WJ 4Q5SF 4AC6A 2MC4A 1IC8A 2QKOA 5HNFA 4CICA 2MBFA 4OAZA 3FX3A 4M6YA 1XMAA 5TISC 2Z1DA 4PJ0C 5HOOA 1YW7A 4M9ZA 2QWWA 1T6SA 4A3LJ 2RN7A 1LNWA 1UMQA 1G3SA 3HOTA 1HBXG 1ZYRF 3F8CA 1VNDA 1AKHA 2Y30A 2WY8Q 1FSHA 1ZLKA 4QWQA 4HQMA 4UHTA 1ZGJA 1U5TA 3J81Z 1R23A 5HBUA 2JA7J 3PL8A 1SFEA 4M6VA 3V8LA 4ICHA 1ETWA 5M3FJ 3ZMTA 1U8BA 1IXSB 2DTZA 2JT1A 4RB1A 2AS5F 4M72A 5FLXK 1IN6A 4E7IA 1YO5C 3HSFA 3ABKH 2OU2A 1XSVA 2VASA 3GO5A 2H1KA 3K4BA 3G1MA 3DQVC 4UVAA 5FB2A 1TZLA 1WJCA 5IP6A 1D8JA 2Z16A 2NVXJ 2VBZA 5H9TA 2KRHA 4J19A 4AD9A 1RR7A 3LWFA 3MMYB 4L5JA 4EV0A 2DYRH 4LG3A 1X2NA 4KIGA 2HPIA 2CUZA 1G8XA 3KLOA 2DPDA 2RASA 1FP2A 4M3GA 1E3PA 4RAGA 1V54H 3QP6A 1UCRA 4LMYA 3H9JA 1O3QA 4Y4RA 2M4KA 5HDKA 3KPHA 5HAWA 4AF5A 2MH9A 1OPCA 3EUKL 1W4MA 2E2JJ 2ZBKA 2RNJA 4JBAA 2TCTA 4NDLA 2A3SA 3WE2A 5D5XB 2JA2A 1E2XA 3K1NA 1FTTA 1QVUA 2XIGA 2R7VA 1VQLI 3I58A 4HLYA 1IG7A 2CQQA 1B1BA 2DJIA 3D5RC 4IJAA 5TGTA 2BVLA 3CD6I 1XC5A 1ZGAA 1G2HA 2QSFX 2CJJA 1S7AA 5EGOA 1QU3A 1U9NA 2BYVE 4HDUA 3ISPA 2PQ8A 3CJDA 2KZGA 3OYLA 3OYCA 2M34A 1Y56A 1K4SA 4AC0A 4IOCF 3MQ0A 3QYFA 2GENA 3GVAA 2LD5A 2FNPA 2X1CA 3K4JA 5F64A 3GFMA 5E1XA 4XOTA 5M5WJ 4BHCA 1V5FA 1DPRA 1QNTA 5DS9A 4FTHA 2P7CB 1V5GA 4YELA 4A5MA 5E3OA 1W36D 2R7FA 3ZOBA 4D1QA 3S14J 2G3BA 3TMOA 2R5ZA 3OOUA 2MD5A 2VOPA 2KQRA 2HXOA 1KGSA 1O7FA 1R5ID 1YIOA 2M0CA 1S6LA 5C4YA 1I3AA 1E17A 4E7HA 2C6YA 2XB5A 3BG6A 4LIUA 3ZQHA 1D0ZA 4U88A 2ETHA 2DFHA 3K4CA 5HNHA 2W82A 3OY9A 3AL0B 1WH5A 5FLXZ 3ZQQA 1D0YA 4ENKA 5JLWA 3O8HA 3RD3A 2Z99A 3DXJF 4UXNA 1UB9A 3HRUA 1JKOC 3U21A 5EEAA 1KU9A 2ZXJA 2EH3A 3KX2A 3R61A 5FGMA 3OYNA 4Z6YA 2HVQA 3LSIA 3GX4X 1FBUA 1QO0D 4XLAA 4I99C 3MZYA 1ZR2A 4RB0A 5KNLA 3K69A 3IC7A 2X1EA 4B8XA 4BEHA 4EM0B 4IZZA 1PDNC 2L9VA 5TJJA 3AQSA 2B0LA 3ANGA 2YUSA 5ICGA 1TQPA 3CCVI 1HW5A 2WADA 3GTQJ 2MABA 2XGXA 3Q0WA 4HEA2 5CLSA 3WGIA 3HOUJ 2HYFA 2DDAA 5KVRA 3ASOH 3C2GA 3CMEI 3DWLE 1I50J 4NBQA 5E3LA 4I2OA 2LG4A 2F6CA 2O8XA 4UB6C 3V7SA 1YHQI 4N9IA 2L9RA 4PFOA 3OYMA 1OCPA 1SD5A 2L9SA 3S5RA 1P7IA 3ULQB 3FMSA 2UXXA 3BZ6A 3RH2A 5CXIA 3NI7A 3HTSB 1U6GA 4AVPA 1G3WA 2PI0A 3WE3A 3BDDA 2DG7A 5D4RA 2M8EA 1R00A 1UI5A 3GTLJ 3A0BC 2HQNA 5HLIA 2VBXA 4AYBN 3GFLA 2F5EA 1YJ9I 3NNRA 3OYHA 3S1QJ 4BS9A 4RB2C 5H6QA 5HDGA 4BXFA 5LEJA 2QA4I 5CW8A 2YR2A 2CW8A 3HSEA 3O6BB 3L9FA 4DZJA 3QOPA 1PUFA 3ABMH 4BHPA 3MVPA 4P5OA 2STTA 3PO3J 2NNNA 4FX0A 4CH7A 2F2EA 3HGYA 1K78A 4C2TA 1CGPA 5CVJA 2W25A 1MMAA 3DU6A 3DF8A 1OR7A 1Z05A 1ETXA 2IGNA 3IWFA 3CJNA 3F8FA 3HPHA 4Y17A 5EFYA 2DFIA 2NRAC 3FKJA 2EA2A 2M5WA 5E8IA 4B1RA 4HSTA 2X48A 2G7GA 4M9XA 3HC7A 1TTYA 1FC3A 2XF6A 1RR8C 1JTXA 2UUZA 2HDCA 4L62A 2K27A 2X85A 1KU7A 3U1DA 2CG4A 2EV6A 4NC6A 2DOFA 4W97A 4EQQA 1D5YA 4XLFA 4MEYF 4HRIA 2XSJC 3Q9SA 1JHFA 1GXPA 2KIQA 3FXJA 5E8GA 4EEFG 2EJRA 4AIHA 4CXFA 2P0WA 2DU9A 1L3LA 5J8CA 2DOEA 3J7AY 2IEKA 2VQGA 1ULYA 2K9MA 4LB6B 5IY5H 1Z7UA 2VL8A 3QPHA 1VZ0A 1ETOA 1ONVA 4I0AA 1JJ6C 3I4NJ 3M9AA 4XLEA 1X1CA 1I39A 5DUKA 3W6VA 1R6RA 5CYVA 1WKMA 1H89C 1R4MB 3H0DA 4PGHA 4HV5A 4L9JA 3FXKA 5ILUA 4QIWN 3CP8A 4CGZA 2HTJA 4UUSB 3RTRA 4IHYA 3BJBA 5ILSA 3ABTA 1QRYA 3KCCA 3LMMA 3SQNA 1GXQA 2LF8A 3HHHA 5FKMA 1SVLA 4S05A 1BJAA 2G9WA 1I1GA 4P96A 2EBIA 1MNMC 4LK0F 3KEYA 4HBLA 4AYBA 5F0FA 2XKOA 4F92B 4UVCA 2LDUA 5FRNA 2E34A 3H35A 1ERDA 1HDPA 2JWTA 2DT7B 2LH9A 2HDWA 4PJJA 5J4VA 2R4GA 1HLVA 2VJIA 1Z7LA 3M8EA 4KJZA 1VQ8I 2V6CA 1WSUA 1P4XA 2XKPA 2B1EA 1KQ0A 3FISA 4JNNA 3SEQA 2PJRA 2LRDA 1WJBA 2CH0A 3V78A 1OCCH 4QPOA 5EZHA 2PMUA 3GMEA 2PEXA 1FSEA 1YW8A 2BXYA 2LBFA 2R93J 3CO6C 4BDYA 1U9OA 1MBJA 3PNTA 4BE2A 2E60A 5LLQA 3AKZA 1X3UA 2ZO4A 3CCLI 2FBIA 4G94A 1R22A 3ZP5A 5F08A 4NC7A 4U9NA 2WTEA 1OCOH 2IA2A 4MQVA 1IO2A 4IX7A 3EUAA 1LB2A 5CXGA 4N4NB 2HR3A 1IN5A 1VI0A 1HA8A 1H88C 2OF7A 5JHFA 1X58A 2LC2A 1ZRCA 1S72I 4M73A 4WX9A 1TBXA 4J00A 1JI8A 1XB4A 4YZEA 2E19A 1BL0A 4AM3A 3E5UA 4CCOA 1WJAA 3CUOA 2RV8A 3K4NA 4G8XA 3QOEA 4ENJA 3HOWJ 2F4MB 5EDNA 2DW4A 1MBFA 1F4KA 3EYYA 5AIPA 1GLNA 3WTTC 4FE7A 3IH3A 1LJ9A 2WGBA 3TO7A 2XGCA 4JP0A 3CC7I 3VP5A 2ZMEA 3KP2A 3COAC 2BVMA 3KETA 2MLKA 4AIKA 3VYTB 3BC8A 3DTKA 3LHQA 3P5JA 2Z3YA 3LL7A 1G3TA 2R7DA 3RPQA 1FY7A 1R5HA 5K7HA 1MMSA 4GFKA 3G2BA 1Q1VA 3P9KA 3U9GA 1FYMA 4DQ2A 4C2MJ 2Q8KA 2Y9ZA 2VT3A 5HS8A 2HQRA 2FMYA 4FHTA 2HPMA 2ZMEC 4EJTA 4L0ZB 1IDYA 3HUGB 4EJOA 1DP7P 2ZB9A 1UELB 3GTOJ 1D0XA 1JGGA 1YOVB 2JK3A 3KKDA 1TQIA 5E3MA 1D5VA 2LYCA 1P7JA 4U9LA 1KQ8A 2Q24A 3IRQA 2EZIA 3AQTA 4LITA 2NP3A 1QVTA 2VN2A 3BROA 3QKXA 4FE4A 3VW2A 3M8FA 2PG4A 1WJ5A 3DP7A 2A69F 5CVVA 1Z1DA 3O8GA 3J7ZI 2DODA 2A6HF 3OYEA 1TWGJ 1GV2A 1YYVA 3RI4A 2BHYA 3W6KB 3A03A 4XLCA 3DEWA 1ZHFA 1Y8RB 2EPFA 1TP4A 3L2WA 1BN5A 2EFOA 3BTLA 3S32A 5FD6A 4KIBA 4JYKA 5K5OA 3GXOA 3JAMK 2QBYA 3WG9A 1TQMA 3M7GA 2MGQA 2K86A 1T39A 1VQ9I 3GUDA 3CO7C 4BNCA 1JT0A 4AIDA 1XDUA 3U1KA 3ECHA 3MKLA 2EFNA 2G7HA 2JVGA 5LD2C 2LTPA 3H1CA 4A0YA 1S29A 4XIDA 3PO2J 1EF4A 1I5ZA 4GRIA 3K2ZA 1OMIA 3F8MA 3SWHA 2J5OA 3M07A 3EYIA 2Z2SB 1XS9A 1IN4A 4C2UA 3C07A 3T1BA 1SANA 2NX4A 4XICA 2H1LA 5LEKA 2NOJB 2M87A 5CKTA 3BY6A 3IKVA 4II2A 1CF7B 2V9VA 3UKGA 3JRIA 2OTJI 3C1DA 3I9V2 4OINF 1R49A 1V4RA 2RVCA 3A0HC 3TW6A 3FXLA 5JVTA 2CGPA 5A2QK 1Z3YA 2DMPA 2VC1A 2VC0A 1FPQA 1SAXA 4UY8I 1LEBA 4F52A 2E36A 3N05A 3QRFF 4N9HA 3CJQB 3I59A 5IT9K 2ZXWH 3E6DA 2IGOA 3HEFA 4MIMA 2R92J 4YIIA 1ZG3A 3RSNA 3WU1B 1YJWI 3LQQA 1NG6A 1VQKI 2RHAA 5D19A 4LLNA 5CJ9A 2GOMA 1KU2A 2V79A 3VSLA 4BHBA 2Q1ZB 2HNHA 3CCUI 2IU5A 1JTYA 2HKXA 3H36A 4G7OF 5FKNA 4BBSJ 4ZYAA 1MD0A 4IPAA 4JOMA 2NP5A 2GXGA 3K10A 2E5ZA 2YS9A 2KKOA 3BHQA 1W1WE 2AXLA 3LNQA 3CF5F 3M1EA 3TEDA 3LSKA 3S1RJ 1G4DA 3PFYA 2LOOA 4DYQA 2ZNZA 5CVRA 3ML6A 1FMVA 4PXIA 4KNYA 1ENHA 2DT6A 4KYWA 5JHUA 2KLOA 2ZXHA 2CS3A 3TP3A 3ZMSA 3IL2A 3R4KA 4DBQA 3QPTA 4OOIA 5DDGA 3CCYA 3GTGJ 1Z3XA 2JN6A 1K6YA 3VEPA 4XL9A 4IQJA 4OD4A 4KT6A 4RA2A 3WHBA 1J0RA 2CUEA 3GZ5A 1VQPI 3JAMZ 2GBYA 5LRSA 1U2WA 2F5FA 2A5YB 2LY9A 2CW0F 3DPLC 4YRVA 3HZJA 5FD5A 3BR1A 5HLHA 1B8IA 2VT2A 3K4MA 4YFXF 4YG2F 5IYDJ 4I09A 1DDNA 3KKCA 3SDGA 3ERED 4DVYP 3B6CA 2XPVA 2K85A 5DCMB 1X1BA 1OQYA 4ZDOA 2EIKH 3QPSA 4P55A 3WTSC 3MKYB 4L5IA 2ZFWA 4A93J 3R0AA 4C3HJ 1OYIA 4Y52J 1OJLA 4A3KJ 1S5LC 1T98A 1W0TA 3GEUA 3RKWA 3VVYA 2HFHA 2YVHA 3NWTA 2L7MP 3K0LA 3ZN0A 4EMSA 1N78A 4BJ5C 1ITYA 2E35A 2BHZA 1XGMA 5A2QZ 1TNTA 5FJ8J 1S7OA 3GTJJ 4I76A 1R7JA 2DI3A 4H0EA 4G7ZF 3VIBA 3OL4A 2PFBA 4KWAA 3UNGC 2FQ4A 3T0YA 3LA2A 1QZYA 1WJFA 3ZQCA 5IT9Z 1EV7A 1L0OC 1GDTA 4GYIA 5D6FA 1VQOI 1LUJB 2ZJPF 2WAQN 3PNYA 2NVUB 1FJLA 2DA2A 3DBRB 5M5YJ 3LOCA 3G73A 1WZ2A 3IWZA 3RIRA 3GBGA 5FKLA 1H8AC 2LVSA 2PLYA 3TQNA 1SVOA 1R36A 3PNVA 4IRHA 1IUYA 3GFIA 3VPRA 5D6EA 3E6BA 1YRNB 1S3JA 3V42A 3BNIA 3OYDA 2RQPA 2D2WA 3D5SC 3GCMA 4ETSA 2O6GE 3BJOA 4WIBA 2V26A 2ZNYA 5FLVA 3FDYA 4HV6A 2VE8A 1TWHJ 4A6DA 3RQ4A 4KN7X 1MKMA 3HRSA 2PJPA 1FMWA 2EA4A 2NVYJ 4WCGA 1W0UA 1IRXA 2ZCXA 2X6WA 1X19A 5H2FC 3LQRA 2Q2EA 2HKOA 1LDJA 5KK1A 1MDMB 2PZ9A 1KONA 2FNAA 4LG0B 4RLFA 5C4JJ 3CDHA 1H9GA 4FETA 4RAZA 4CHUA 4KN4X 1FX7A 1WH7A 1Y6IA 4U7DA 1MMNA 1RESA 4PJMA 3ANPA 1HSTA 1WPKA 2H8WA 4NUBA 2EB7A 3FZVA 4XORA 2XV4S 2ZSIB 3JREA 2XAFA 4A69C 2IAIA 2MYSA 2O61A 3OYGA 5FHPA 1RC9A 2ME6A 4BQNA 5BOXA 3A01B 1S8NA 2IS1A 2QZ8A 2A68F 1MBKA 4JX5A 4UNOA 5FGLA 2OTLI 1BOBA 2FA5A 2DAOA 3E7QA 2KDZA 1ODDA 4BY7J 1Y1VJ 3CJRB 3KZZA 4S04A 3EQLF 4XN3A 4WWCA 5KAIC 1STZA 4G7HF 3RQIA 2HZDA 3R60A 1U8RA 2X1DA 2GOXB 2CQNA 2YVXA 1A31A 3NARA 4B3XA 2ID6A 4F93B 4CZZA 4G6DA 1F5TA 2VOOA 4HNTA 5DUIA 2JQ7A 3HOXJ 3OYBA 5L3EA 2R3SA 2WAQA 5GAGJ 2BGCA 4WXCA 1SD6A 3I0TA 2DCEA 3E0JB 2GUHA 4M3FA 2MLGA 2H6BA 2ADUA 3WTUC 1YQAA 2OQGA 4E7JA 3RPUD 1APLC 3O2PE 5D8LB 4CA0A 1B72A 2EZHA 5IYCJ 2H94A 2L7ZA 3HXLA 3LFUA 4LD5A 3K2AA 2K3PA 4RLQA 4ESFA 1EH8A 5K58A 3G1LA 1D1BA 3VOXA 3BR2A 3S1MJ 1RETA 5D5WB 1MZBA 1GV5A 3FMRA 3KYLA 1OYWA 3A1YA 1HQCA 1SFXA 1XCBA 4BGDA 1ZRDA 4NB5A 4PSWA 2LSOA 3I3LA 3GTKJ 2V9KA 3FMQA 5EG0A 2IA1A 2STWA 1JKRC 2GA1A 2QQ8A 3CRJA 3OMYA 4UDSA 3ZQFA 1XX5A 4YIRX 4PCQA 2FX0A 3VOEA 3CCRI 1RIOH 5K1YA 1IN8A 4FISA 2OBPA 2XROA 3TOAA 1W5SA 1N77A 3DV8A 4XKBA 4CSWA 2ECCA 4UVBA 5HS7A 3JR9A 3L2UA 3QWLA 3K9TA 1OISA 5DTDA 4A3DJ 3AFHA 2ZJRF 5LRRA 3TBIA 1HC8A 2QOPA 4M3EA 1Z0XA 2VIXA 2OD5A 1YS6A 1WI9A 2OZ6A 1W7PD 5J4YA 2E2IJ 4PK4A 4HSRA 5FRMA 1G6NA 3V8JA 4XQFA 3G56A 3GF2A 3FHZA 1QGPA 1P9QC 1QQIA 1U5TB 3S17J 4CGRA 3SFZA 1LDDA 1MNEA 4ZC3A 4DYRA 2BY3A 1IUFA 3B02A 3TW7A 1YE9A 4EM2A 1A6IA 1BI2A 3C3WA 4UUSA 3IRRA 3S3MA 1UHWA 3F6VA 3EUHA 3ON2A 3PPBA 4PJLA 1KYZA 2IJLA 2F4OB 2IA0A 4WXHA 2FBHA 5GADJ 3RYRA 1E0EA 2VJJA 3HRTA 3DU5A 4MQ9F 3HIMA 2DMUA 3EGQA 1LVAA 4YFNF 2DT5A 1VQ5I 3RKYA 2VKHA 2NOGA 5FO5A 1ZTRA 2VBWA 3CUQB 2XSDC 4QLCU 3E6MA 2W57A 3QU6A 4U0WA 2QGUA 4HOBA 4BKXA 1HW1A 5H6RA 3Q3SA 3EUHC 2L2OA 1F36A 4PFPA 2M2EA 1X2MA 2X6OA 1EKEA 4A12A 2REKA 1N75A 1DUXC 1QZEA 3C2BA 4E4HA 4K2EA 4LGWA 2LK2A 4P1WA 2DA3A 5HSZA 2ICWG 4L0YB 2ZKZA 4XN0A 3OIQA 1ON2A 1T0FA 4XSXF 2R7OA 4RGRA 1LE8B 3G7RA 2EFPA 4R1HA 4Y7NJ 1ZLJA 3HGGA 5EF6A 3NXCA 3BZCA 3SZPA 3AG1H 1K83J 2GFNA 1V3FA 4F91B 4L18B 5J47A 4NNJA 2XC7A 4DOZA 2KHMA 2QQAA 5FFXA 2PBIA 1T0FC 2ISYA 2JUGA 4RGUA 5EGOB 3BLYA 2XGEA 2P6SA 2H8RA 2V9PA 3WHCA 4UB8C 3RKQA 3NRGA 3S93A 3C7JA 1XN7A 4HAMA 1ETKA 3MWMA 4B4CA 4M3BA 2XDVA 1UJ8A 4IRIA 1YX3A 1XG1A 3TKYA 1XMKA 4EM1A 3C18A 2GQQA 3H9QA 2NAZA 2X6YA 1OCRH 2FQ3A 2LF7A 4B43A 5IYBJ 2YX4A 3LSGA 1IN7A 4HX4A 4HKUA 5JR3A 4IRGA 2R5ZB 1MSFC 1IXRC 2FJ1A 3HKZN 3PUFA 2LKPA 1FBQA 1OKRA 5LHHA 4LFUA 3V8KA 3BP8A 2P81A 3JCUC 3D0SA 4E7LA 1W36C 3GTMJ 3D5LA 5EZGA 3HIFA 2DK5A 4LLGF 4A3CJ 4XRSA 1T95A 3NWSA 3V6GA 2YSRA 1I6HJ 5ILVA 2K9SA 2Y2ZA 4DZPA 4HQEA 2IBDA 2XUBA 3OV8A 3IAS2 3CC4I 4DIQA 4W1UA 3GLXA 2RREA 2UXUA 5B3SH 3B6AA 3BJ6A 3UR3C 2JMWA 2MA3A 4ESBA 1E3OC 2UXNA 4IHXA 4ESJA 3OOPA 3LAJA 2ZXIA 4I01A 1RNLA 3NRVA 3SDBA 2H6CA 4D7NA 2UXHA 3CDIA 2N8GA 1GVJA 2WBMA 2LLKA 1HKTA 1GVDA 2ZFUA 4ZTFA 4A0XA 3A4CA 4I98B 1BJZA 4JX6A 1FOWA 1YTYA 4ON0A 2NVQJ 3P9CA 3RJPA 4CCMA 2MH2A 1AU7A 4HLXA 3JRBA 4EATA 3KP3A 2NNYA 3HE0A 1P6RA 2ELHA 1R71A 3KZ9A 2G7UA 3W2VA 4J01A 4B44A 3G6EI 2NS0A 4XM3A 4BJ6C 5DD4A 2DFFA 4DYCA 5IPAA 4ANJA 5IOYA 5M3MJ 4QPQA 3VVXA 3FBNB 3WU0A 2CRGA 1MH3A 3QYBA 3RDIA 2OUMA 5BS6A 2XAGA 1Y0NA 1SD4A 2R7UA 1BIAA 2VODA 3ZCOA 2QSGX 1BIBA 1OLTA 2H27A 4HA8A 5CQGA 2D45A 3ZMUA 2O9LA 2VPLA 1ZGWA 2M30A 1RKWA 4HF0A 1DQUA 2K02A 2L54A 4IF4A 3BOQA 2W00A 2X0LA 4OIQF 2E7WA 2JSCA 3OYIA 1ZELA 4WF2A 2K9LA 2KIMA 1MMDA 3ELKA 1JUSA 2JA5J 1Z6TA 4A3JJ 5EYRA 2ID3A 1PUFB 5HLTA 1P4WA 2I8DA 2Q0OA 3RYPA 2LP0A 4IL6C 2VKVA 2VXZA 4D7MA 1R1TA 2WC2A 1LQ1A 2DOAA 2EV0A 3VYSB 2J5PA 3HKZA 5F1JA 3I64A 1SMYF 4XSZF 5E1ZB 4MK6A 2BV6A 1B4AA 2LY2A 1QA6A 3GLLA 3HRMA 2BW3B 2CU7A 3R6SA 3S2WA 3HOSA 3I56I 4FT8A 3OYFA 1GHCA 3ECOA 2K4BA 2DQLA 1TWFJ 4D5FA 1K4TA 3HTJA 5L3GA 3M8JA 2HOEA 2R5YA 3N4MA 3S1NJ 2A6TA 3L2CA 3AG4H 3HB9A 2HVRA 3K70D 1B9NA 2WY7Q 2HU9A 4XLNF 4ABZA 1D8KA 4B09A 3BR3A 3CF2A 2Y0SN 2XPUA 1WJDA 2DA1A 3P9IA 3PFIA 2NS7A 3PSIA 2BXZA 3SZGA 2M9HA 1R4NB 1J9IA 3M1CA 4XNFA 4PZJA 1K7AA 3H9GA 1B6AA 4JX4A 2F07A 3FRQA 2D6YA 1SAUA 3DKWA 2MC3A 2MW8A 2QYOA 3O3KA 5LGUA 5HDNA 3OIPA 2HYTA 2CMPA 4OIOF 4Q47A 4MTDA 1MW7A 1W7PB 1KQ9A 2DTRA 1Z77A 1V5EA 2I5UA 4XR6A 4ASNA 3ZQIA 5L3BA 1A36A 1HKQA 2HQAA 1KZHA 5D1RA 5J6XA 2B7EA 3FXUA 4KDPA 3JW4A 1EH7A 3S3NA 4KFCA 4CDGA 4NQWA 4Y3OA 2CW7A 2IRFG 2ZCNA 4NELA 3DLAA 2HKUA 2K9QA 3G71I 5BMZA 4XRSG 3EETA 3GZIA 1BI3A 3HL2A 4PJNA 3KEQA 2GM4A 3G4SI 1J2XA 2OZUA 3LA7A 4BDZA 1QBJA 5B1AH 2XASA 1J09A 4C9YA 1ACIA 5F0HA 3LSRA 5D5VB 1EA3A 3CJTB 4NC8A 1TT5B 2QKMB 1XPXA 4A2UA 2VUMJ 2B3WA 1UAAA 2PBXA 3GYHX 3T8TA 2PMZN 3VYUB 4L9NA 5D4SA 2UXIA 1E3HA 2JRMA 2JRTA 1AHDP 2UXOA 3S15J 2GWRA 3ERMA 1BW6A 2IGKA 4RGSA 1ETYA 2FU4A 4MGRA 1U3EM 2IP2A 3ZMZA 5K7ZA 1VF9A 1WCMJ 4GXOA 4V2GA 3E5QA 4R79A 4ENMA 2KMUA 2OJED 2QUFA 1MJBA 2OCCH 2DLLA 5E18F 3HOVJ 1YS7A 4IKFA 3M4OJ 4O6JA 3TDUC 4BACA 3VW0A 4ZTJA 3RZDJ 4GDFA 1JJ8C 3ON4A 1D3YA 3MEXA 5F1RA 4BE0A 2V4JC 2ZC2A 4U87A 4FQGA 4X0GA 3FK7A 4E7SA 3ZXSA 3BR6A 5GPAA 2JPBA 3F3XA 2G7SA 2KPMA 2EWNA 2DMNA 4FASD 1OFCX 1DU0A 2Y0SA 2GA2A 4ZYEA 5ED4A 2VKEA 3LSHA 4HX7A 4BQOA 2CQ7A 3R0JA 3WTZA 4I7HA 4DW6A 1VQ6I 4AWXB 1Y39A 2ZCMA 3OS2A 4Q48A 2F5DA 2V1XA 4E7ZA 2Y9YA 1FYLA 2IS2A 1F9NA 3GZNB 2HEOA 4X6AJ 2DFEA 2LY1A 2E1CA 3VWBA 1I27A 5IP7J 5ICCA 5L3FA 1TWAJ 3SZTA 6PAXA 1I6XA 2ZMEB 2NXNB 4BBRJ 4NN1A 4CYDA 3RZOJ 9ANTA 2WWYA 3H0GJ 4HNUA 3SYTA 4D5CA 2A07F 4IRVA 2VONA 2EZKA 2V1UA 2M45A 3HG9A 1BOAA 3E1SA 2O03A 1VTNC 2CV2A 1OCZH 3J81K 4OMYA 2HOTA
chains in the Genus database with same CATH topology
3BG5A 2VPRA 1ETXA 3NARA 2ID6A 5EFYA 4X1EA 4MLOA 4XRMA 1I3QJ 1MBGA 3HM5A 3E7LA 2ZOZA 3HOXJ 1BA5A 2EZLA 4B1RA 3GTPJ 2D5VA 4M3FA 2GUHA 2X48A 1MH4A 5BNGA 3Q0UA 2G7GA 3PASA 4ACIA 1ZKGA 1APLC 1JTXA 4L62A 3FKIJ 2DMQA 1B72A 2EZHA 5IYCJ 2L7ZA 3K2AA 5J1YA 1ETVA 3MNLA 1D5YA 4W97A 3G1LA 5K58A 3VOXA 3BR2A 3S1MJ 3BTIA 2DA6A 1SGMA 3KNWA 1RETA 2O7TA 4GCLA 1SFOJ 3A02A 4GFBA 3JRAA 1GV5A 3T6NA 4EEFG 1RKTA 3GTKJ 5FKOA 5EG0A 2IEKA 3IV5A 2K40A 1TC3C 1FIAA 2JJ7A 1JKRC 4CYCB 1ETOA 3CRJA 4UDSA 1JJ6C 3ZQFA 3I4NJ 2FX0A 3JRHA 3JRFA 3HDDA 3W6VA 3IH2A 3BR0A 1H89C 1HCRA 4FISA 2DN0A 5E3NA 1GT0C 4QIWN 5C3EJ 4UUSB 2ECCA 3BTJA 4ME9A 3JR9A 1OCTC 4IHYA 3BJBA 5DTDA 4A3DJ 2ELKA 2EQRA 5F27A 1QRYA 2QOPA 4M3EA 5FKMA 3LSJA 1Z0XA 4MXMA 4CYCA 2QF7A 3G1OA 2O8KA 2QCOA 2EBIA 1MNMC 2E2IJ 3G56A 5F0FA 1IV6A 3S17J 4CGRA 3HOZJ 1WI3A 3I4MJ 4DYRA 1HDPA 2JWTA 2CUFA 1DU6A 1HLVA 1IUFA 3TW7A 4UUSA 1HF0A 1NTCA 1A6IA 3IH4A 4L5EA 3ON2A 2CQXA 3EUPA 3PPBA 3S16J 4BY1J 1JT6A 3FISA 4JNNA 2HOSA 2FBQA 2G7LA 5D18A 2NVTJ 3ZQGA 3HIMA 2DMUA 5EZHA 3EGQA 3V78A 3VOKA 2QWTA 1YRNA 2NOGA 2K9NA 2DG8A 3VVZA 1ZTRA 4A3BJ 2XSDC 4A3EJ 2R93J 1U9OA 1MBJA 3CWRA 2LKXA 1BW5A 4BKXA 3Q3SA 5F08A 3S2HJ 2L0KA 1F36A 3DCFA 2M2EA 1X2MA 2X6OA 5K7FA 4MO7A 2REKA 3C2BA 1WGXA 2LK2A 5CXGA 3HBLA 2DA3A 5HSZA 1VI0A 2OI8A 5FLMJ 3PM1A 2OF7A 1H88C 1X58A 2NS8A 1ORKA 3ZQLA 1LE8B 3G7RA 4YZEA 2E19A 3HGGA 4Y7NJ 5EF6A 1BL0A 2VI6A 3NXCA 2HDDA 2R5YB 1K83J 3LSPA 2GFNA 2LFBA 3HOWJ 3JRGA 2R7ZJ 2HYJA 5EDNA 1HOMA 1UHSA 4A3MJ 4GCKA 3DPJA 1MBFA 1JUPA 2DMTA 1R9TJ 5EGOB 4FE7A 3BCGA 3IH3A 2WGBA 1GUUA 3A01A 2XGEA 2H8RA 2XGCA 2FD5A 4JP0A 1B8IB 3B81A 3HOYJ 3WHCA 4A3FJ 3VP5A 3RKQA 3VW1A 1LE8A 3NRGA 2W53A 2HOAA 3MN2A 1ETKA 3LHQA 2OPTA 3CDLA 4M3BA 4B4CA 2O7OA 4GFKA 5K7HA 1RPWA 3OSFA 3O60A 4MFDA 1Q1VA 4JKZA 1XG1A 4C2MJ 2Y9ZA 5J1RA 3P9TA 3SJMA 2DJNA 4C3JJ 4A3GJ 2E2HJ 5M5XJ 3BR5A 5GP9A 5IYBJ 3BQYA 3LSGA 4RDUA 1FEXA 5AQCA 1IDYA 2XRLA 4HKUA 1FTZA 2ZB9A 3GTOJ 2R5ZB 1JGGA 1HDDC 2JK3A 1MSFC 1F43A 2FJ1A 3KKDA 3HKZN 5E3MA 3OIOA 1P7JA 1VFCA 2KT0A 4JL3A 2Q24A 1T56A 5F0CA 1IJWC 2P81A 3GTMJ 2EZIA 5EZGA 3AQTA 2UXPA 2NP3A 4A3CJ 1QVTA 4XRSA 3QKXA 4FE4A 3V6GA 3VW2A 1I6HJ 1O4XA 2K9SA 2Y2ZA 4DZPA 4UUTA 2IBDA 3O8GA 1ZQ3P 4HNVA 1T33A 1LFUP 1POGA 3QBMA 1LFBA 4W1UA 5DAJA 2UXUA 1TWGJ 1GV2A 3B6AA 2JMWA 3M3YJ 3LWJA 1E3OC 2ZOYA 4IHXA 4IHWA 2I10A 3A03A 1UI6A 3DEWA 3S2DJ 1TWCJ 5HODA 3BTLA 2HQ5A 2COBA 4JYKA 4D7NA 4QTRA 2XDNA 2MGQA 2UXHA 2N8GA 2LLKA 1GVDA 1JT0A 1MSEC 2JA6J 3MKLA 5C4XJ 4C3IJ 1AKHB 3JSJA 3BG9A 1BJZA 2LTPA 4JX6A 1CQTA 4IHVA 4M3DA 2NVQJ 4XIDA 1JKPC 3PO2J 1EF4A 3IUVA 1Y1WJ 1AU7A 1IC8A 4AC6A 2QKOA 3JRBA 3HE0A 3FK6A 4QSHA 1XS9A 3C07A 1SANA 2QTQA 2NX4A 3KZ9A 4XICA 3QPLA 2AHQA 2XB0X 2L7FP 4DYCA 3UKGA 3JRIA 3D1NI 4A3LJ 1UMQA 5IPAA 4XK4A 5M3MJ 1VNDA 2E1OA 2Y30A 3TW6A 5IOYA 1AKHA 3VVXA 2Y31A 2CRGA 1MH3A 2TRTA 2DMPA 1IGNA 5HBUA 1MBEA 2JA7J 2DA5A 4M6VA 2B63J 4ICHA 1ETWA 3HEFA 5M3FJ 4MIMA 2R92J 2QIBA 4G12A 1U8BA 2DTZA 1ZGWA 2O9LA 3BRUA 3OSGA 2RHAA 3HTHA 1RKWA 5D19A 1A5JA 2H1KA 5IP9J 3G1MA 4AUXA 5IP6A 2IU5A 1JTYA 1JUSA 2JA5J 5FKNA 2NVXJ 4BBSJ 5H9TA 2R0QC 4J19A 4A3JJ 2NP5A 5EYRA 2ID3A 1RR7A 1PUFB 2LP0A 2YS9A 2VKVA 3BHQA 3BG3A 1X2NA 3CQZJ 3LNQA 4D7MA 3TEDA 3S1RJ 2WUIA 2HI3A 2RASA 5F1JA 3VUQA 1FIPA 4DYQA 4M3GA 4MK6A 2XGDA 1IDZA 5JLXA 4I6ZA 1K61A 4PXIA 2CU7A 5HAWA 1ENHA 4AF5A 2X9DA 2E2JJ 4GFLA 1ETQA 1TWFJ 4D5FA 2TCTA 4NDLA 3HTJA 3TP3A 1FTTA 1QVUA 3GTGJ 2R5YA 3CCYA 3S1NJ 2JN6A 3HB9A 1IG7A 4IEJA 2CQQA 3L1PA 3WHBA 4ABZA 2CUEA 1XC5A 1G2HA 2Y0SN 3BR3A 2GBYA 2CJJA 1B72B 2XPUA 5EGOA 2YU9J 2LY9A 2OERA 5J3LA 1U9NA 2DA1A 3CJDA 2NS7A 3BR1A 1B8IA 2MG4A 2M9HA 2M34A 2XPWA 5J1UA 4JX4A 4AC0A 5IYDJ 3KKCA 2F07A 3FRQA 2D6YA 3SDGA 3B6CA 2MW8A 2XPVA 3F0CA 5GPCA 2GENA 3COLA 2LD5A 1NK2P 2HYTA 4RBOA 3QPSA 5M5WJ 4A93J 1Z77A 5EG0B 4C3HJ 4FTHA 5DS9A 4A3IJ 4Y52J 5C44J 5E3OA 1OJLA 3ZQIA 4A3KJ 1W0TA 3GEUA 3VVYA 3ZOBA 2G3BA 3S14J 3SFIA 5D1RA 2YVHA 2R5ZA 3OOUA 2L7MP 2HXOA 2ZCNA 4NELA 1ITYA 2HKUA 1UG2A 2K9QA 3Q0VA 2M0CA 2ME0A 5FJ8J 4I76A 4XRSG 3GTJJ 4V2FA 3GZIA 5C4YA 3VIBA 2WB1N 2YVEA 2XB5A 4KWAA 2FQ4A 3ZQHA 2GM4A 3NAUA 2MSYA 2GLOA 3ZQCA 1GDTA 5FKKA 5F0HA 3LSRA 2WAQN 1FJLA 1WH5A 2DA2A 5M5YJ 3LOCA 3BTCA 4LOCA 4B3AA 3O8HA 5JLWA 3RD3A 3GBGA 2VUMJ 5FKLA 1H8AC 2PBXA 1JKOC 1ZK8A 2PMZN 5EEAA 1IRZA 2LVSA 2UXIA 3NPIA 2EH3A 5FMPA 1JUMA 1AHDP 2UXOA 3S15J 1BW6A 1ETYA 3QQAA 3VPRA 1ZR2A 2V57A 5K7ZA 1VF9A 1WCMJ 4FCYA 1YRNB 4V2GA 3AQSA 2LR8A 3BNIA 3HTAA 3ANGA 3TP0A 2YUSA 5FLVA 3GTQJ 3HOVJ 3HTIA 3M4OJ 3Q0WA 1TWHJ 4S0HB 3VW0A 3HOUJ 3RZDJ 3CMYA 1JJ8C 2NVYJ 1W0UA 2ZCXA 3ON4A 1I50J 5E3LA 2L9RA 3FK7A 2PZ9A 1OCPA 1QPIA 3S5RA 1P7IA 2RAEA 5F04A 2WV1A 3FIWA 3BR6A 5C4JJ 1JKQC 3F1BA 3RH2A 3H3VK 5GPAA 5CXIA 3NI7A 1S7EA 2G7SA 2DMNA 1DU0A 1OFCX 2JA8J 2DG7A 2VKEA 1WH7A 3BT9A 1ZR4A 2DA4A 5IOZA 1UI5A 3K7AJ 1RESA 3GTLJ 4DW6A 3ANPA 1WPKA 3LJLA 1U78A 2ZCMA 4AYBN 3JREA 2ECBA 2Y9YA 4A69C 2IAIA 3NNRA 3S1QJ 4MFEA 4X6AJ 5FHPA 2G0EA 1MBHA 2ME6A 5CW8A 3A01B 2W48A 5IP7J 4BXXJ 3BQZA 2HXIA 1TWAJ 4DZJA 3JRCA 2AO9A 1MBKA 4JX5A 4BBRJ 1PUFA 4NN1A 5FGLA 1NK3P 4GCTA 3RZOJ 3MVPA 2DA7A 9ANTA 3H0GJ 3E7QA 2KDZA 3JRDA 4D5CA 3PO3J 2M8GX 1Y1VJ 4BY7J 2EZKA 3HGYA 3RQIA 2HOTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BG5 A;  2VPR A;  1ETX A;  3NAR A;  2ID6 A;  5EFY A;  4X1E A;  4MLO A;  4XRM A;  1I3Q J;  1MBG A;  3HM5 A;  3E7L A;  2ZOZ A;  3HOX J;  1BA5 A;  2EZL A;  4B1R A;  3GTP J;  2D5V A;  4M3F A;  2GUH A;  2X48 A;  1MH4 A;  5BNG A;  3Q0U A;  2G7G A;  3PAS A;  4ACI A;  1ZKG A;  1APL C;  1JTX A;  4L62 A;  3FKI J;  2DMQ A;  1B72 A;  2EZH A;  5IYC J;  2L7Z A;  3K2A A;  5J1Y A;  1ETV A;  3MNL A;  1D5Y A;  4W97 A;  3G1L A;  5K58 A;  3VOX A;  3BR2 A;  3S1M J;  3BTI A;  2DA6 A;  1SGM A;  3KNW A;  1RET A;  2O7T A;  4GCL A;  1SFO J;  3A02 A;  4GFB A;  3JRA A;  1GV5 A;  3T6N A;  4EEF G;  1RKT A;  3GTK J;  5FKO A;  5EG0 A;  2IEK A;  3IV5 A;  2K40 A;  1TC3 C;  1FIA A;  2JJ7 A;  1JKR C;  4CYC B;  1ETO A;  3CRJ A;  4UDS A;  1JJ6 C;  3ZQF A;  3I4N J;  2FX0 A;  3JRH A;  3JRF A;  3HDD A;  3W6V A;  3IH2 A;  3BR0 A;  1H89 C;  1HCR A;  4FIS A;  2DN0 A;  5E3N A;  1GT0 C;  4QIW N;  5C3E J;  4UUS B;  2ECC A;  3BTJ A;  4ME9 A;  3JR9 A;  1OCT C;  4IHY A;  3BJB A;  5DTD A;  4A3D J;  2ELK A;  2EQR A;  5F27 A;  1QRY A;  2QOP A;  4M3E A;  5FKM A;  3LSJ A;  1Z0X A;  4MXM A;  4CYC A;  2QF7 A;  3G1O A;  2O8K A;  2QCO A;  2EBI A;  1MNM C;  2E2I J;  3G56 A;  5F0F A;  1IV6 A;  3S17 J;  4CGR A;  3HOZ J;  1WI3 A;  3I4M J;  4DYR A;  1HDP A;  2JWT A;  2CUF A;  1DU6 A;  1HLV A;  1IUF A;  3TW7 A;  4UUS A;  1HF0 A;  1NTC A;  1A6I A;  3IH4 A;  4L5E A;  3ON2 A;  2CQX A;  3EUP A;  3PPB A;  3S16 J;  4BY1 J;  1JT6 A;  3FIS A;  4JNN A;  2HOS A;  2FBQ A;  2G7L A;  5D18 A;  2NVT J;  3ZQG A;  3HIM A;  2DMU A;  5EZH A;  3EGQ A;  3V78 A;  3VOK A;  2QWT A;  1YRN A;  2NOG A;  2K9N A;  2DG8 A;  3VVZ A;  1ZTR A;  4A3B J;  2XSD C;  4A3E J;  2R93 J;  1U9O A;  1MBJ A;  3CWR A;  2LKX A;  1BW5 A;  4BKX A;  3Q3S A;  5F08 A;  3S2H J;  2L0K A;  1F36 A;  3DCF A;  2M2E A;  1X2M A;  2X6O A;  5K7F A;  4MO7 A;  2REK A;  3C2B A;  1WGX A;  2LK2 A;  5CXG A;  3HBL A;  2DA3 A;  5HSZ A;  1VI0 A;  2OI8 A;  5FLM J;  3PM1 A;  2OF7 A;  1H88 C;  1X58 A;  2NS8 A;  1ORK A;  3ZQL A;  1LE8 B;  3G7R A;  4YZE A;  2E19 A;  3HGG A;  4Y7N J;  5EF6 A;  1BL0 A;  2VI6 A;  3NXC A;  2HDD A;  2R5Y B;  1K83 J;  3LSP A;  2GFN A;  2LFB A;  3HOW J;  3JRG A;  2R7Z J;  2HYJ A;  5EDN A;  1HOM A;  1UHS A;  4A3M J;  4GCK A;  3DPJ A;  1MBF A;  1JUP A;  2DMT A;  1R9T J;  5EGO B;  4FE7 A;  3BCG A;  3IH3 A;  2WGB A;  1GUU A;  3A01 A;  2XGE A;  2H8R A;  2XGC A;  2FD5 A;  4JP0 A;  1B8I B;  3B81 A;  3HOY J;  3WHC A;  4A3F J;  3VP5 A;  3RKQ A;  3VW1 A;  1LE8 A;  3NRG A;  2W53 A;  2HOA A;  3MN2 A;  1ETK A;  3LHQ A;  2OPT A;  3CDL A;  4M3B A;  4B4C A;  2O7O A;  4GFK A;  5K7H A;  1RPW A;  3OSF A;  3O60 A;  4MFD A;  1Q1V A;  4JKZ A;  1XG1 A;  4C2M J;  2Y9Z A;  5J1R A;  3P9T A;  3SJM A;  2DJN A;  4C3J J;  4A3G J;  2E2H J;  5M5X J;  3BR5 A;  5GP9 A;  5IYB J;  3BQY A;  3LSG A;  4RDU A;  1FEX A;  5AQC A;  1IDY A;  2XRL A;  4HKU A;  1FTZ A;  2ZB9 A;  3GTO J;  2R5Z B;  1JGG A;  1HDD C;  2JK3 A;  1MSF C;  1F43 A;  2FJ1 A;  3KKD A;  3HKZ N;  5E3M A;  3OIO A;  1P7J A;  1VFC A;  2KT0 A;  4JL3 A;  2Q24 A;  1T56 A;  5F0C A;  1IJW C;  2P81 A;  3GTM J;  2EZI A;  5EZG A;  3AQT A;  2UXP A;  2NP3 A;  4A3C J;  1QVT A;  4XRS A;  3QKX A;  4FE4 A;  3V6G A;  3VW2 A;  1I6H J;  1O4X A;  2K9S A;  2Y2Z A;  4DZP A;  4UUT A;  2IBD A;  3O8G A;  1ZQ3 P;  4HNV A;  1T33 A;  1LFU P;  1POG A;  3QBM A;  1LFB A;  4W1U A;  5DAJ A;  2UXU A;  1TWG J;  1GV2 A;  3B6A A;  2JMW A;  3M3Y J;  3LWJ A;  1E3O C;  2ZOY A;  4IHX A;  4IHW A;  2I10 A;  3A03 A;  1UI6 A;  3DEW A;  3S2D J;  1TWC J;  5HOD A;  3BTL A;  2HQ5 A;  2COB A;  4JYK A;  4D7N A;  4QTR A;  2XDN A;  2MGQ A;  2UXH A;  2N8G A;  2LLK A;  1GVD A;  1JT0 A;  1MSE C;  2JA6 J;  3MKL A;  5C4X J;  4C3I J;  1AKH B;  3JSJ A;  3BG9 A;  1BJZ A;  2LTP A;  4JX6 A;  1CQT A;  4IHV A;  4M3D A;  2NVQ J;  4XID A;  1JKP C;  3PO2 J;  1EF4 A;  3IUV A;  1Y1W J;  1AU7 A;  1IC8 A;  4AC6 A;  2QKO A;  3JRB A;  3HE0 A;  3FK6 A;  4QSH A;  1XS9 A;  3C07 A;  1SAN A;  2QTQ A;  2NX4 A;  3KZ9 A;  4XIC A;  3QPL A;  2AHQ A;  2XB0 X;  2L7F P;  4DYC A;  3UKG A;  3JRI A;  3D1N I;  4A3L J;  1UMQ A;  5IPA A;  4XK4 A;  5M3M J;  1VND A;  2E1O A;  2Y30 A;  3TW6 A;  5IOY A;  1AKH A;  3VVX A;  2Y31 A;  2CRG A;  1MH3 A;  2TRT A;  2DMP A;  1IGN A;  5HBU A;  1MBE A;  2JA7 J;  2DA5 A;  4M6V A;  2B63 J;  4ICH A;  1ETW A;  3HEF A;  5M3F J;  4MIM A;  2R92 J;  2QIB A;  4G12 A;  1U8B A;  2DTZ A;  1ZGW A;  2O9L A;  3BRU A;  3OSG A;  2RHA A;  3HTH A;  1RKW A;  5D19 A;  1A5J A;  2H1K A;  5IP9 J;  3G1M A;  4AUX A;  5IP6 A;  2IU5 A;  1JTY A;  1JUS A;  2JA5 J;  5FKN A;  2NVX J;  4BBS J;  5H9T A;  2R0Q C;  4J19 A;  4A3J J;  2NP5 A;  5EYR A;  2ID3 A;  1RR7 A;  1PUF B;  2LP0 A;  2YS9 A;  2VKV A;  3BHQ A;  3BG3 A;  1X2N A;  3CQZ J;  3LNQ A;  4D7M A;  3TED A;  3S1R J;  2WUI A;  2HI3 A;  2RAS A;  5F1J A;  3VUQ A;  1FIP A;  4DYQ A;  4M3G A;  4MK6 A;  2XGD A;  1IDZ A;  5JLX A;  4I6Z A;  1K61 A;  4PXI A;  2CU7 A;  5HAW A;  1ENH A;  4AF5 A;  2X9D A;  2E2J J;  4GFL A;  1ETQ A;  1TWF J;  4D5F A;  2TCT A;  4NDL A;  3HTJ A;  3TP3 A;  1FTT A;  1QVU A;  3GTG J;  2R5Y A;  3CCY A;  3S1N J;  2JN6 A;  3HB9 A;  1IG7 A;  4IEJ A;  2CQQ A;  3L1P A;  3WHB A;  4ABZ A;  2CUE A;  1XC5 A;  1G2H A;  2Y0S N;  3BR3 A;  2GBY A;  2CJJ A;  1B72 B;  2XPU A;  5EGO A;  2YU9 J;  2LY9 A;  2OER A;  5J3L A;  1U9N A;  2DA1 A;  3CJD A;  2NS7 A;  3BR1 A;  1B8I A;  2MG4 A;  2M9H A;  2M34 A;  2XPW A;  5J1U A;  4JX4 A;  4AC0 A;  5IYD J;  3KKC A;  2F07 A;  3FRQ A;  2D6Y A;  3SDG A;  3B6C A;  2MW8 A;  2XPV A;  3F0C A;  5GPC A;  2GEN A;  3COL A;  2LD5 A;  1NK2 P;  2HYT A;  4RBO A;  3QPS A;  5M5W J;  4A93 J;  1Z77 A;  5EG0 B;  4C3H J;  4FTH A;  5DS9 A;  4A3I J;  4Y52 J;  5C44 J;  5E3O A;  1OJL A;  3ZQI A;  4A3K J;  1W0T A;  3GEU A;  3VVY A;  3ZOB A;  2G3B A;  3S14 J;  3SFI A;  5D1R A;  2YVH A;  2R5Z A;  3OOU A;  2L7M P;  2HXO A;  2ZCN A;  4NEL A;  1ITY A;  2HKU A;  1UG2 A;  2K9Q A;  3Q0V A;  2M0C A;  2ME0 A;  5FJ8 J;  4I76 A;  4XRS G;  3GTJ J;  4V2F A;  3GZI A;  5C4Y A;  3VIB A;  2WB1 N;  2YVE A;  2XB5 A;  4KWA A;  2FQ4 A;  3ZQH A;  2GM4 A;  3NAU A;  2MSY A;  2GLO A;  3ZQC A;  1GDT A;  5FKK A;  5F0H A;  3LSR A;  2WAQ N;  1FJL A;  1WH5 A;  2DA2 A;  5M5Y J;  3LOC A;  3BTC A;  4LOC A;  4B3A A;  3O8H A;  5JLW A;  3RD3 A;  3GBG A;  2VUM J;  5FKL A;  1H8A C;  2PBX A;  1JKO C;  1ZK8 A;  2PMZ N;  5EEA A;  1IRZ A;  2LVS A;  2UXI A;  3NPI A;  2EH3 A;  5FMP A;  1JUM A;  1AHD P;  2UXO A;  3S15 J;  1BW6 A;  1ETY A;  3QQA A;  3VPR A;  1ZR2 A;  2V57 A;  5K7Z A;  1VF9 A;  1WCM J;  4FCY A;  1YRN B;  4V2G A;  3AQS A;  2LR8 A;  3BNI A;  3HTA A;  3ANG A;  3TP0 A;  2YUS A;  5FLV A;  3GTQ J;  3HOV J;  3HTI A;  3M4O J;  3Q0W A;  1TWH J;  4S0H B;  3VW0 A;  3HOU J;  3RZD J;  3CMY A;  1JJ8 C;  2NVY J;  1W0U A;  2ZCX A;  3ON4 A;  1I50 J;  5E3L A;  2L9R A;  3FK7 A;  2PZ9 A;  1OCP A;  1QPI A;  3S5R A;  1P7I A;  2RAE A;  5F04 A;  2WV1 A;  3FIW A;  3BR6 A;  5C4J J;  1JKQ C;  3F1B A;  3RH2 A;  3H3V K;  5GPA A;  5CXI A;  3NI7 A;  1S7E A;  2G7S A;  2DMN A;  1DU0 A;  1OFC X;  2JA8 J;  2DG7 A;  2VKE A;  1WH7 A;  3BT9 A;  1ZR4 A;  2DA4 A;  5IOZ A;  1UI5 A;  3K7A J;  1RES A;  3GTL J;  4DW6 A;  3ANP A;  1WPK A;  3LJL A;  1U78 A;  2ZCM A;  4AYB N;  3JRE A;  2ECB A;  2Y9Y A;  4A69 C;  2IAI A;  3NNR A;  3S1Q J;  4MFE A;  4X6A J;  5FHP A;  2G0E A;  1MBH A;  2ME6 A;  5CW8 A;  3A01 B;  2W48 A;  5IP7 J;  4BXX J;  3BQZ A;  2HXI A;  1TWA J;  4DZJ A;  3JRC A;  2AO9 A;  1MBK A;  4JX5 A;  4BBR J;  1PUF A;  4NN1 A;  5FGL A;  1NK3 P;  4GCT A;  3RZO J;  3MVP A;  2DA7 A;  9ANT A;  3H0G J;  3E7Q A;  2KDZ A;  3JRD A;  4D5C A;  3PO3 J;  2M8G X;  1Y1V J;  4BY7 J;  2EZK A;  3HGY A;  3RQI A;  2HOT A; 
#chains in the Genus database with same CATH topology
 4BQQ A;  4M71 A;  2DBB A;  2BY1 A;  2UZK A;  3BG5 A;  2VPR A;  1W5T A;  2GZW A;  1MJA A;  5CVI A;  4ZZL A;  3LAP A;  4X1E A;  3DTI A;  1I3Q J;  3RCO A;  1MBG A;  1ZAR A;  3HM5 A;  3E7L A;  2ACJ A;  3F6O A;  1BA5 A;  2EZL A;  3I55 I;  1KU3 A;  4WXD A;  1YX5 A;  2X51 A;  2OC6 A;  3AAF A;  4IHS A;  4ZDL A;  1Z21 A;  2CUJ A;  4HZF A;  5BNG A;  3AG2 H;  3Q0U A;  3PAS A;  1F1Z A;  2PMZ A;  2BZT A;  2ZCW A;  1B59 A;  1ZKG A;  2HGC A;  3FKI J;  4JQF A;  4ZH4 F;  1R58 A;  2F5V A;  5J1Y A;  3FF5 A;  2EIJ H;  3JTG A;  5LHI A;  3KZY A;  5DYM A;  3E3V A;  4RGX A;  3BPV A;  3BTI A;  1B9M A;  2P6T A;  1SGM A;  3KNW A;  3QP5 A;  2O7T A;  2BY2 A;  4GCL A;  3F23 A;  3I71 A;  3A02 A;  4GFB A;  1P4A A;  3JRA A;  3T6N A;  4C30 A;  1K6O A;  2CWE A;  1RKT A;  3L7W A;  1Y0U A;  4GGG A;  5KHD A;  1X1P A;  2DO7 A;  2EIL H;  2K40 A;  1FIA A;  4CYC B;  3L09 A;  4KMU X;  3HDD A;  3B73 A;  4ZYH A;  3IH2 A;  3BR0 A;  4BU2 A;  2QEX I;  5KAF C;  3ZQ7 A;  4O5V A;  1ZAO A;  4V19 K;  2YX7 A;  3BTJ A;  1J59 A;  1OCT C;  4OMZ A;  2ELK A;  1JGS A;  2CO5 A;  2EQR A;  2KRF A;  2OCE A;  3MZH A;  4MXM A;  5DCF A;  2Y48 A;  3G1O A;  3CCQ I;  2O8K A;  2QCO A;  3REO A;  4AU7 A;  2MD0 A;  4KT5 C;  2RKH A;  1UHM A;  2FSW A;  2V6E A;  1X1A A;  2FOK A;  1WI3 A;  3CMA I;  3LST A;  4A0Z A;  3I4M J;  3MAJ A;  1BR4 A;  1UZC A;  3I59 B;  2R7X A;  1DU6 A;  1UST A;  3J7Y J;  1HF0 A;  3IH4 A;  4L5E A;  1RI7 A;  3VB2 A;  4L9V A;  3AL0 C;  1YIJ I;  3S16 J;  4BY1 J;  4BH9 A;  4XKC A;  4RB3 C;  2FBQ A;  2G7L A;  5D18 A;  3V7C A;  3IUO A;  1O3S A;  2P8T A;  5DEQ A;  2E5N A;  2LKS A;  2QWT A;  2K9N A;  3VVZ A;  3DBH B;  4A3B J;  1SFK A;  1TNS A;  3K1M A;  3I54 A;  2XHK A;  5K5Q A;  3CWR A;  4BE1 A;  3CLO A;  1FWZ A;  4DJA A;  1XGN A;  1BW5 A;  4EGZ A;  1OYY A;  2K7L A;  2WAE A;  5KCM A;  5B66 C;  3DTE A;  1VQN I;  1G3Y A;  1XTA A;  2E1N A;  3OR1 C;  3L2V A;  1JE8 A;  4RS8 A;  3MZ8 A;  3TOB A;  5K7F A;  4E6K G;  4KIS A;  3ZPL A;  3FM5 A;  1WGX A;  2M3A A;  2FJI 1;  1U5T C;  2W84 A;  2OI8 A;  3CUQ A;  5FLM J;  3PM1 A;  3ZN1 A;  2VJ4 A;  4KIF A;  3OYA A;  2NS8 A;  3WTY C;  2CV0 A;  1ORK A;  1Z67 A;  3VSK A;  5BPI A;  3IKT A;  3VTI A;  2HDD A;  2O3F A;  2ESN A;  2F5C A;  3GW2 A;  5IT3 A;  3OYJ A;  1WVR A;  4XBF A;  2LFB A;  2KP6 A;  1EJ9 A;  2R7Z J;  3CUQ C;  1U0J A;  2HYJ A;  4Y33 A;  1UHS A;  1MMG A;  2E1M B;  3FXQ A;  4GCK A;  3DPJ A;  4HPQ A;  2RGV A;  3DEE A;  5F6F A;  1R9T J;  2KZV A;  1GUU A;  2CYY A;  3FM3 A;  4BL0 B;  2OQR A;  1FOK A;  2PN6 A;  2FD5 A;  1B8I B;  3HOY J;  2FML A;  2K4J A;  1LE8 A;  1C0W A;  1JHH A;  3VW1 A;  4AVZ A;  2W53 A;  2R7W A;  2Y69 H;  3MN2 A;  1AA7 A;  2O7O A;  3O60 A;  4JKZ A;  5EJC A;  2KDO A;  5L3C A;  5J1R A;  3P9T A;  3BCB A;  3SJM A;  4C3J J;  4A3G J;  2E2H J;  4BAY A;  5M5X J;  3QOD A;  3BR5 A;  4UV8 A;  3ZMD A;  5GP9 A;  3WOD F;  5ERI A;  5AQC A;  3I5U A;  1FTZ A;  1IZ1 A;  1HDD C;  4IHT A;  1LDK B;  4HW0 A;  1RRJ A;  5D5U B;  1T08 B;  3K1P A;  1VFC A;  1HW2 A;  1T56 A;  2YU3 A;  2RC4 A;  1IJW C;  4IVN A;  4TV7 A;  3N97 A;  1IAW A;  3ONQ A;  2NYX A;  4YEJ A;  4OIR F;  2QQB A;  1HKS A;  1O4X A;  3Q9V A;  3VDX A;  3F8B A;  3SXY A;  2AXT C;  1LFP A;  2XVC A;  5JVG F;  1ZH5 A;  1POG A;  3QBM A;  1LFB A;  2XRN A;  3I53 A;  1REP C;  2M7B A;  3KE2 A;  2Y75 A;  2RQQ A;  3BCA A;  2BBY A;  1ZRE A;  4KMF A;  2ZOY A;  2I10 A;  4HF2 A;  1UI6 A;  2O5R A;  4I02 A;  2OV7 A;  2HTS A;  1O3T A;  1J5Y A;  4CCJ A;  4OIP F;  5HOD A;  3V7R A;  4RAF A;  4YFK F;  3BPX A;  2COB A;  2CQK A;  1ON1 A;  3PQK A;  4QTR A;  2KL4 A;  1PUE E;  4NHJ A;  4JK1 X;  2K5C A;  5JI6 A;  2Y0M A;  4BQA A;  2W4S A;  3L2R A;  5DD8 A;  3E5X A;  3BG7 A;  2VXD A;  4C3I J;  2R7Q A;  3BG9 A;  3OS1 A;  1AKH B;  3A2K A;  1S9H A;  4IHV A;  3CCE I;  4IO9 F;  1JKP C;  1UFM A;  3J80 K;  2M4G A;  2IVM A;  2IW5 A;  1X4O A;  3FK6 A;  2VE9 A;  3QAH A;  4QSH A;  3W2A A;  2HZT A;  2QTQ A;  1DGW Y;  4F3Q A;  3AG3 H;  3QPL A;  5DV5 A;  2AHQ A;  2XB0 X;  3H5R A;  4EJV A;  3KP6 A;  2L7F P;  3F72 A;  2Q2E B;  3D1N I;  1WQ2 A;  3TL4 X;  4XK4 A;  2E1O A;  3U2R A;  2EFW A;  3FWE A;  2Y31 A;  2IPQ X;  2DDB A;  3DPT A;  2UWM A;  2TRT A;  1KA8 A;  1Y8Q B;  1IGN A;  1O7L A;  3V4G A;  1MBE A;  4IXA A;  1VQM I;  2DA5 A;  2QLZ A;  2A61 A;  2B63 J;  3CMM A;  4MHG A;  3OS0 A;  1YIT I;  4MTE A;  2QIB A;  4G12 A;  3I4P A;  1TW3 A;  3BRU A;  3PJR A;  3OSG A;  1SEU A;  1JXS A;  3HTH A;  3WTX C;  1A5J A;  3VYR B;  5IP9 J;  2W85 A;  4AUX A;  1FZP B;  2L01 A;  5AON A;  5LHG A;  2FXA A;  1VQ7 I;  3L2Q A;  2K3F A;  2ZY9 A;  3P7N A;  2ZJQ F;  2R0Q C;  4DNC A;  4KIT B;  1QPM A;  2H09 A;  4ZZD A;  1SFU A;  1TL8 A;  3BG3 A;  3CQZ J;  2WUI A;  3PSF A;  5LGN A;  2XAJ A;  1FNN A;  2HI3 A;  2ZSH B;  3VUQ A;  1FIP A;  2ISZ A;  2QVO A;  2QM3 A;  1J75 A;  2VBY A;  2FE3 A;  2XGD A;  5E20 A;  1IDZ A;  2QQ9 A;  5JLX A;  4I6Z A;  1K61 A;  3RKX A;  2XAH A;  2VQL A;  5B1B H;  3WU2 C;  1DGR M;  4O3M A;  1PP7 U;  4HG2 A;  4XMY A;  3ZRG A;  2X9D A;  3FXO A;  3CCM I;  1XGO A;  4XLH A;  4XLP F;  1FLI A;  1ETQ A;  4XOP A;  4GFL A;  3GZ6 A;  4BXU A;  5GAH J;  5LFA A;  1MGT A;  3FHN A;  2W7N A;  2L7K A;  2L3D A;  2VLA A;  2A05 A;  2L9N A;  3IP4 B;  2ESH A;  3RPU A;  4IEJ A;  3FXR A;  5CPR B;  4Y13 A;  3L1P A;  4KUM A;  2L5Q A;  5E1W A;  4BUP A;  3PQJ A;  2IT0 A;  2XF5 A;  2L4M A;  1LVK A;  2EIN H;  2BW3 A;  2KIF A;  1H9T A;  2KIU A;  1B72 B;  2YU9 J;  2OER A;  4UV9 A;  5J3L A;  2P7V B;  4ITV A;  4UUV A;  3MFK A;  4G6Q A;  1X4P A;  2MG4 A;  1RUO A;  2GIZ A;  4HF1 A;  1WRJ A;  4EVI A;  2XPW A;  3KZI C;  1BBY A;  3HSR A;  5J1U A;  5HLG A;  1BR2 A;  1MND A;  2OAZ A;  3F22 A;  2JSP A;  1I1S A;  3F0C A;  5GPC A;  3COL A;  1YJN I;  3KYD B;  3KYC B;  4IOA F;  3H92 A;  3CP2 A;  4BJT A;  5GTH C;  1YLF A;  1NK2 P;  3CES A;  3FXM A;  4RBO A;  3J80 Z;  3H5N A;  1OR7 C;  2DPU A;  5EG0 B;  4CO8 A;  4A3I J;  2JZY A;  5C44 J;  2M1B A;  3K4L A;  1D1A A;  1V55 H;  3JTH A;  3HUG A;  2W24 A;  3SFI A;  1YFH A;  2R7T A;  3W2W A;  3DLL F;  3F9K A;  2BE5 F;  3H5A A;  2XAU A;  1Z91 A;  1UG2 A;  1UG0 A;  1NHA A;  3Q0V A;  2ME0 A;  2XAQ A;  2V7F A;  2B9S A;  4V2F A;  1QHH D;  2WB1 N;  4LK1 F;  2YVE A;  3SEZ A;  3DBL B;  1O3R A;  3NAU A;  2TDX A;  1W7P A;  2CFX A;  2MSY A;  2P4W A;  2P5K A;  4ENN A;  5TRD A;  2GLO A;  2O0Y A;  5HS9 A;  5FKK A;  2IS4 A;  3OYK A;  4BEH B;  4I0B A;  3MD2 A;  2DK8 A;  2RNG A;  3KP5 A;  2R7R A;  2WA0 A;  1XSX A;  2UV1 A;  2XF7 A;  5LBQ A;  4LOC A;  3BTC A;  4B3A A;  1YI2 I;  3NS4 A;  4OD5 A;  5E79 C;  1ZK8 A;  1IRZ A;  3NPI A;  2L02 A;  2EV5 A;  3K6G A;  5FMP A;  5AIQ A;  2GXB A;  4GYG A;  1JUM A;  3H3U A;  5GTI C;  4R8H A;  1O57 A;  4RM2 A;  3CCJ I;  2W1O A;  3QQA A;  2V57 A;  2JPC A;  1WJE A;  2F4I A;  1IF1 A;  4AIJ A;  1WHU A;  5DM7 F;  4FCY A;  3HTA A;  2LR8 A;  5LGT A;  5FFZ A;  3WGH A;  2FEZ A;  2CSO A;  3TP0 A;  2DYS H;  3NEU A;  1IV8 A;  1ZN2 A;  5GAE J;  3HTI A;  3DKY A;  1KYW A;  4ZYG A;  4EJU A;  4S0H B;  2Z5U A;  2M7A A;  5ICE A;  4HYE A;  1SVM A;  3CMY A;  1XGS A;  1DPU A;  1TT0 A;  1CF7 A;  4XKV A;  1W5C C;  3F21 A;  2FUG 2;  1QPI A;  2D1H A;  3TO9 A;  5E17 F;  3WG7 H;  2RAE A;  5F04 A;  1XSD A;  2WV1 A;  3FIW A;  1JKQ C;  3F1B A;  1A35 A;  3S8P A;  3H3V K;  4FX4 A;  3EPZ A;  1S7E A;  1BI1 A;  3LSM A;  3CC2 I;  2JA8 J;  3BT9 A;  1ZR4 A;  2DA4 A;  5IOZ A;  4PSX A;  4GO1 A;  3K7A J;  2GXA A;  3LJL A;  1U78 A;  1R1V A;  1K78 B;  1G59 A;  3BJA A;  4YIF A;  2ECB A;  4MNU A;  2IS6 A;  3CLQ A;  1EH6 A;  4MFE A;  1NG7 A;  4XON A;  1FYK A;  2G0E A;  1MBH A;  1SMT A;  1XCV A;  4LIV A;  3F8N A;  2BOL A;  2W48 A;  4BXX J;  2KJC A;  2HXI A;  3BQZ A;  3ZGK A;  4B48 A;  4WK8 F;  3JRC A;  1DP3 A;  2AO9 A;  3GEZ A;  1IRF A;  1NK3 P;  4GCT A;  2DA7 A;  1R5G A;  1WFX A;  3X2Q H;  4RAY A;  1N25 A;  3JSO A;  2BEO A;  3JRD A;  5J40 A;  3HPG A;  2M8G X;  2L4A A;  1Z9C A;  4U7B A;  3KP4 A;  2FF4 A;  2DQR A;  4HX8 A;  4XKW A;  1BI0 A;  2WB1 A;  3K8P C;  3OL3 A;  4M74 A;  1K79 A;  3MKZ A;  3CZ6 A;  1IW7 F;  4MLO A;  4XRM A;  1TW2 A;  2ZOZ A;  3TDZ C;  3EDP A;  2FOW A;  5EEG A;  5CQE A;  3WTV C;  3DFG A;  4DBR A;  3G3Z A;  4RMN A;  2D5V A;  3GTP J;  5L3D A;  1MH4 A;  4CZC A;  1WWX A;  2M0M A;  2AQE A;  3ROU A;  4M6X A;  1FBS A;  4ACI A;  1ZG5 A;  3T8R A;  5HVQ C;  2DMQ A;  2D1V A;  1LPQ A;  3JSP A;  3KLN A;  3VFZ A;  1ETV A;  4IQ4 A;  3SHF A;  3S3O A;  3MNL A;  2VKD A;  2DA6 A;  4HDV A;  3WTW C;  1YG2 A;  1A6Q A;  1SFO J;  1BC7 C;  2KIS A;  4PUS A;  5DCM A;  3J7A O;  3QU3 A;  3ASN H;  1AWC A;  2R7S A;  1FP1 D;  4RM3 A;  5FKO A;  3GFJ A;  3IV5 A;  1QHG A;  1TC3 C;  2JJ7 A;  2P5V A;  3QYE A;  1H0M A;  1VQ4 I;  1X1D A;  3MCZ A;  3JRH A;  3JRF A;  3E6C C;  4ZJZ A;  4M9S A;  1HCR A;  3KP7 A;  3WGG A;  4OWR B;  2DN0 A;  5E3N A;  2YPR A;  2PX9 A;  1GT0 C;  2EFQ A;  5C3E J;  1LEA A;  4A5N A;  3ABL H;  4ME9 A;  1X3Z B;  5F27 A;  2PJR B;  5ICF A;  2WV0 A;  3W6J B;  3LSJ A;  3OR2 C;  4CYC A;  2QF7 A;  1SD7 A;  4G6T B;  3NQO A;  4ZYD A;  2HS5 A;  2GAU A;  2LBF B;  1IV6 A;  1PYV A;  1FT9 A;  3Q5F A;  1P2F A;  4EJW A;  4Q4Z F;  5EEH A;  3HOZ J;  1R1U A;  2CUF A;  1FOY A;  3PIO F;  3OWT A;  2FRH A;  1USS A;  1NTC A;  3KIO A;  2CQX A;  3EUP A;  1PP8 F;  4LB5 A;  1JT6 A;  1FOX A;  2OA4 A;  3BWG A;  2HOS A;  3GWZ A;  2V1N A;  4LJZ F;  3ZQG A;  2NVT J;  3DKX A;  2AQF A;  4G9Y A;  4N0B A;  3ESW B;  3VOK A;  4ZDP A;  5CVU A;  1YRN A;  2DG8 A;  2LMD A;  4U0V A;  1IXC A;  2F48 A;  5FRO A;  4A3E J;  1HXD A;  4L9T A;  2LKX A;  3E97 A;  4LLL A;  1BC8 C;  1QZZ A;  2VB6 A;  1M1E B;  4PDK A;  3S2H J;  2L0K A;  1Q1H A;  2IXS A;  4C2M A;  4E70 A;  3DCF A;  2WAF A;  1BM9 A;  4MO7 A;  5BPD A;  3DEU A;  1T8I A;  2X4H A;  5BQT A;  1MDM A;  1T38 A;  3HBL A;  1J7K A;  3T5X A;  4A6E A;  5B5E C;  2FBK A;  4LG0 A;  4KA4 A;  3HHG A;  4OAY A;  4II3 A;  2GIV A;  2ZJ2 A;  3HYI A;  4H4K C;  1LKX A;  1MIJ A;  2HYG D;  2HWV A;  3ZQL A;  3HJE A;  2E71 A;  4GCV A;  2ELJ A;  3ABU A;  3LA3 A;  4Y15 A;  3K4K A;  4N4O B;  2VI6 A;  2Z9O A;  1X3W B;  2R5Y B;  4CCN A;  4CCK A;  2CV1 A;  1AOY A;  3ZR8 X;  3LSP A;  3CCS I;  3BZK A;  1P92 A;  5K5R A;  3MKW B;  3ZMV A;  1T2K A;  3CTA A;  3JRG A;  1HOM A;  3W3C A;  4A3M J;  1Z6R A;  2VQH A;  4D0P A;  1JUP A;  2DMT A;  1XD7 A;  4P9F A;  3KFW X;  2PFV A;  3BCG A;  3FBI B;  1BR1 A;  1SC7 A;  3A01 A;  4CUG A;  3DPU A;  1IRG A;  3B81 A;  3K70 C;  3TO6 A;  2P5L C;  1D1C A;  4A3F J;  1MJ9 A;  2KRC A;  4DGW B;  2HOA A;  3L00 A;  2QKL B;  2OPT A;  3CDL A;  2A2F X;  3PUB A;  1RPW A;  3OSF A;  4MFD A;  3TGN A;  1YW9 A;  2VQC A;  4D9J A;  2EK5 A;  4PGG A;  4F7Z A;  3IHU A;  2QSH X;  2COM A;  2DJN A;  2IGM A;  4EGY A;  2MFZ A;  1PVE A;  2E7X A;  3BQY A;  3PIP F;  4RDU A;  1FEX A;  2A6E F;  2XRL A;  4U0Y A;  1F43 A;  3VOD A;  4NQW B;  1RZ4 A;  3HTU A;  4XRF A;  3OIO A;  4JL3 A;  2KT0 A;  2CFO A;  4CCL A;  2JVH A;  5F0C A;  1XMX A;  2A5W A;  2Z33 A;  3LFK A;  2UXP A;  2E1M C;  1XDS A;  5DM6 F;  2QBY B;  2PMH A;  3KEO A;  4P9U A;  4UUT A;  1ZG1 A;  1ZRF A;  1ZQ3 P;  4HNV A;  1T33 A;  1LFU P;  2LNB A;  5DAJ A;  3IAM 2;  2RDP A;  5J8F A;  2V1D A;  2EIM H;  3M3Y J;  3LWJ A;  4IHW A;  4E7K A;  4F55 A;  4BYY A;  5D8K B;  3S2D J;  1TWC J;  2HQ5 A;  4KIC A;  4MEX F;  4B47 A;  2QEN A;  1RUN A;  2LRE A;  4Z2Y A;  5JFR A;  2X6X A;  2XDN A;  2JUC A;  3H3Z A;  2JTV A;  1PJR A;  2JA6 J;  1MSE C;  2KFD A;  1HSJ A;  5H20 A;  4OU0 A;  5C4X J;  3JSJ A;  2VJ5 A;  2HVS A;  1CQT A;  2KJB A;  4M3D A;  1A04 A;  3IUV A;  2BY0 A;  1NH3 A;  1TLH B;  2DXI A;  3C2H A;  1Y1W J;  4Q5S F;  4AC6 A;  2MC4 A;  1IC8 A;  2QKO A;  5HNF A;  4CIC A;  2MBF A;  4OAZ A;  3FX3 A;  4M6Y A;  1XMA A;  5TIS C;  2Z1D A;  4PJ0 C;  5HOO A;  1YW7 A;  4M9Z A;  2QWW A;  1T6S A;  4A3L J;  2RN7 A;  1LNW A;  1UMQ A;  1G3S A;  3HOT A;  1HBX G;  1ZYR F;  3F8C A;  1VND A;  1AKH A;  2Y30 A;  2WY8 Q;  1FSH A;  1ZLK A;  4QWQ A;  4HQM A;  4UHT A;  1ZGJ A;  1U5T A;  3J81 Z;  1R23 A;  5HBU A;  2JA7 J;  3PL8 A;  1SFE A;  4M6V A;  3V8L A;  4ICH A;  1ETW A;  5M3F J;  3ZMT A;  1U8B A;  1IXS B;  2DTZ A;  2JT1 A;  4RB1 A;  2AS5 F;  4M72 A;  5FLX K;  1IN6 A;  4E7I A;  1YO5 C;  3HSF A;  3ABK H;  2OU2 A;  1XSV A;  2VAS A;  3GO5 A;  2H1K A;  3K4B A;  3G1M A;  3DQV C;  4UVA A;  5FB2 A;  1TZL A;  1WJC A;  5IP6 A;  1D8J A;  2Z16 A;  2NVX J;  2VBZ A;  5H9T A;  2KRH A;  4J19 A;  4AD9 A;  1RR7 A;  3LWF A;  3MMY B;  4L5J A;  4EV0 A;  2DYR H;  4LG3 A;  1X2N A;  4KIG A;  2HPI A;  2CUZ A;  1G8X A;  3KLO A;  2DPD A;  2RAS A;  1FP2 A;  4M3G A;  1E3P A;  4RAG A;  1V54 H;  3QP6 A;  1UCR A;  4LMY A;  3H9J A;  1O3Q A;  4Y4R A;  2M4K A;  5HDK A;  3KPH A;  5HAW A;  4AF5 A;  2MH9 A;  1OPC A;  3EUK L;  1W4M A;  2E2J J;  2ZBK A;  2RNJ A;  4JBA A;  2TCT A;  4NDL A;  2A3S A;  3WE2 A;  5D5X B;  2JA2 A;  1E2X A;  3K1N A;  1FTT A;  1QVU A;  2XIG A;  2R7V A;  1VQL I;  3I58 A;  4HLY A;  1IG7 A;  2CQQ A;  1B1B A;  2DJI A;  3D5R C;  4IJA A;  5TGT A;  2BVL A;  3CD6 I;  1XC5 A;  1ZGA A;  1G2H A;  2QSF X;  2CJJ A;  1S7A A;  5EGO A;  1QU3 A;  1U9N A;  2BYV E;  4HDU A;  3ISP A;  2PQ8 A;  3CJD A;  2KZG A;  3OYL A;  3OYC A;  2M34 A;  1Y56 A;  1K4S A;  4AC0 A;  4IOC F;  3MQ0 A;  3QYF A;  2GEN A;  3GVA A;  2LD5 A;  2FNP A;  2X1C A;  3K4J A;  5F64 A;  3GFM A;  5E1X A;  4XOT A;  5M5W J;  4BHC A;  1V5F A;  1DPR A;  1QNT A;  5DS9 A;  4FTH A;  2P7C B;  1V5G A;  4YEL A;  4A5M A;  5E3O A;  1W36 D;  2R7F A;  3ZOB A;  4D1Q A;  3S14 J;  2G3B A;  3TMO A;  2R5Z A;  3OOU A;  2MD5 A;  2VOP A;  2KQR A;  2HXO A;  1KGS A;  1O7F A;  1R5I D;  1YIO A;  2M0C A;  1S6L A;  5C4Y A;  1I3A A;  1E17 A;  4E7H A;  2C6Y A;  2XB5 A;  3BG6 A;  4LIU A;  3ZQH A;  1D0Z A;  4U88 A;  2ETH A;  2DFH A;  3K4C A;  5HNH A;  2W82 A;  3OY9 A;  3AL0 B;  1WH5 A;  5FLX Z;  3ZQQ A;  1D0Y A;  4ENK A;  5JLW A;  3O8H A;  3RD3 A;  2Z99 A;  3DXJ F;  4UXN A;  1UB9 A;  3HRU A;  1JKO C;  3U21 A;  5EEA A;  1KU9 A;  2ZXJ A;  2EH3 A;  3KX2 A;  3R61 A;  5FGM A;  3OYN A;  4Z6Y A;  2HVQ A;  3LSI A;  3GX4 X;  1FBU A;  1QO0 D;  4XLA A;  4I99 C;  3MZY A;  1ZR2 A;  4RB0 A;  5KNL A;  3K69 A;  3IC7 A;  2X1E A;  4B8X A;  4BEH A;  4EM0 B;  4IZZ A;  1PDN C;  2L9V A;  5TJJ A;  3AQS A;  2B0L A;  3ANG A;  2YUS A;  5ICG A;  1TQP A;  3CCV I;  1HW5 A;  2WAD A;  3GTQ J;  2MAB A;  2XGX A;  3Q0W A;  4HEA 2;  5CLS A;  3WGI A;  3HOU J;  2HYF A;  2DDA A;  5KVR A;  3ASO H;  3C2G A;  3CME I;  3DWL E;  1I50 J;  4NBQ A;  5E3L A;  4I2O A;  2LG4 A;  2F6C A;  2O8X A;  4UB6 C;  3V7S A;  1YHQ I;  4N9I A;  2L9R A;  4PFO A;  3OYM A;  1OCP A;  1SD5 A;  2L9S A;  3S5R A;  1P7I A;  3ULQ B;  3FMS A;  2UXX A;  3BZ6 A;  3RH2 A;  5CXI A;  3NI7 A;  3HTS B;  1U6G A;  4AVP A;  1G3W A;  2PI0 A;  3WE3 A;  3BDD A;  2DG7 A;  5D4R A;  2M8E A;  1R00 A;  1UI5 A;  3GTL J;  3A0B C;  2HQN A;  5HLI A;  2VBX A;  4AYB N;  3GFL A;  2F5E A;  1YJ9 I;  3NNR A;  3OYH A;  3S1Q J;  4BS9 A;  4RB2 C;  5H6Q A;  5HDG A;  4BXF A;  5LEJ A;  2QA4 I;  5CW8 A;  2YR2 A;  2CW8 A;  3HSE A;  3O6B B;  3L9F A;  4DZJ A;  3QOP A;  1PUF A;  3ABM H;  4BHP A;  3MVP A;  4P5O A;  2STT A;  3PO3 J;  2NNN A;  4FX0 A;  4CH7 A;  2F2E A;  3HGY A;  1K78 A;  4C2T A;  1CGP A;  5CVJ A;  2W25 A;  1MMA A;  3DU6 A;  3DF8 A;  1OR7 A;  1Z05 A;  1ETX A;  2IGN A;  3IWF A;  3CJN A;  3F8F A;  3HPH A;  4Y17 A;  5EFY A;  2DFI A;  2NRA C;  3FKJ A;  2EA2 A;  2M5W A;  5E8I A;  4B1R A;  4HST A;  2X48 A;  2G7G A;  4M9X A;  3HC7 A;  1TTY A;  1FC3 A;  2XF6 A;  1RR8 C;  1JTX A;  2UUZ A;  2HDC A;  4L62 A;  2K27 A;  2X85 A;  1KU7 A;  3U1D A;  2CG4 A;  2EV6 A;  4NC6 A;  2DOF A;  4W97 A;  4EQQ A;  1D5Y A;  4XLF A;  4MEY F;  4HRI A;  2XSJ C;  3Q9S A;  1JHF A;  1GXP A;  2KIQ A;  3FXJ A;  5E8G A;  4EEF G;  2EJR A;  4AIH A;  4CXF A;  2P0W A;  2DU9 A;  1L3L A;  5J8C A;  2DOE A;  3J7A Y;  2IEK A;  2VQG A;  1ULY A;  2K9M A;  4LB6 B;  5IY5 H;  1Z7U A;  2VL8 A;  3QPH A;  1VZ0 A;  1ETO A;  1ONV A;  4I0A A;  1JJ6 C;  3I4N J;  3M9A A;  4XLE A;  1X1C A;  1I39 A;  5DUK A;  3W6V A;  1R6R A;  5CYV A;  1WKM A;  1H89 C;  1R4M B;  3H0D A;  4PGH A;  4HV5 A;  4L9J A;  3FXK A;  5ILU A;  4QIW N;  3CP8 A;  4CGZ A;  2HTJ A;  4UUS B;  3RTR A;  4IHY A;  3BJB A;  5ILS A;  3ABT A;  1QRY A;  3KCC A;  3LMM A;  3SQN A;  1GXQ A;  2LF8 A;  3HHH A;  5FKM A;  1SVL A;  4S05 A;  1BJA A;  2G9W A;  1I1G A;  4P96 A;  2EBI A;  1MNM C;  4LK0 F;  3KEY A;  4HBL A;  4AYB A;  5F0F A;  2XKO A;  4F92 B;  4UVC A;  2LDU A;  5FRN A;  2E34 A;  3H35 A;  1ERD A;  1HDP A;  2JWT A;  2DT7 B;  2LH9 A;  2HDW A;  4PJJ A;  5J4V A;  2R4G A;  1HLV A;  2VJI A;  1Z7L A;  3M8E A;  4KJZ A;  1VQ8 I;  2V6C A;  1WSU A;  1P4X A;  2XKP A;  2B1E A;  1KQ0 A;  3FIS A;  4JNN A;  3SEQ A;  2PJR A;  2LRD A;  1WJB A;  2CH0 A;  3V78 A;  1OCC H;  4QPO A;  5EZH A;  2PMU A;  3GME A;  2PEX A;  1FSE A;  1YW8 A;  2BXY A;  2LBF A;  2R93 J;  3CO6 C;  4BDY A;  1U9O A;  1MBJ A;  3PNT A;  4BE2 A;  2E60 A;  5LLQ A;  3AKZ A;  1X3U A;  2ZO4 A;  3CCL I;  2FBI A;  4G94 A;  1R22 A;  3ZP5 A;  5F08 A;  4NC7 A;  4U9N A;  2WTE A;  1OCO H;  2IA2 A;  4MQV A;  1IO2 A;  4IX7 A;  3EUA A;  1LB2 A;  5CXG A;  4N4N B;  2HR3 A;  1IN5 A;  1VI0 A;  1HA8 A;  1H88 C;  2OF7 A;  5JHF A;  1X58 A;  2LC2 A;  1ZRC A;  1S72 I;  4M73 A;  4WX9 A;  1TBX A;  4J00 A;  1JI8 A;  1XB4 A;  4YZE A;  2E19 A;  1BL0 A;  4AM3 A;  3E5U A;  4CCO A;  1WJA A;  3CUO A;  2RV8 A;  3K4N A;  4G8X A;  3QOE A;  4ENJ A;  3HOW J;  2F4M B;  5EDN A;  2DW4 A;  1MBF A;  1F4K A;  3EYY A;  5AIP A;  1GLN A;  3WTT C;  4FE7 A;  3IH3 A;  1LJ9 A;  2WGB A;  3TO7 A;  2XGC A;  4JP0 A;  3CC7 I;  3VP5 A;  2ZME A;  3KP2 A;  3COA C;  2BVM A;  3KET A;  2MLK A;  4AIK A;  3VYT B;  3BC8 A;  3DTK A;  3LHQ A;  3P5J A;  2Z3Y A;  3LL7 A;  1G3T A;  2R7D A;  3RPQ A;  1FY7 A;  1R5H A;  5K7H A;  1MMS A;  4GFK A;  3G2B A;  1Q1V A;  3P9K A;  3U9G A;  1FYM A;  4DQ2 A;  4C2M J;  2Q8K A;  2Y9Z A;  2VT3 A;  5HS8 A;  2HQR A;  2FMY A;  4FHT A;  2HPM A;  2ZME C;  4EJT A;  4L0Z B;  1IDY A;  3HUG B;  4EJO A;  1DP7 P;  2ZB9 A;  1UEL B;  3GTO J;  1D0X A;  1JGG A;  1YOV B;  2JK3 A;  3KKD A;  1TQI A;  5E3M A;  1D5V A;  2LYC A;  1P7J A;  4U9L A;  1KQ8 A;  2Q24 A;  3IRQ A;  2EZI A;  3AQT A;  4LIT A;  2NP3 A;  1QVT A;  2VN2 A;  3BRO A;  3QKX A;  4FE4 A;  3VW2 A;  3M8F A;  2PG4 A;  1WJ5 A;  3DP7 A;  2A69 F;  5CVV A;  1Z1D A;  3O8G A;  3J7Z I;  2DOD A;  2A6H F;  3OYE A;  1TWG J;  1GV2 A;  1YYV A;  3RI4 A;  2BHY A;  3W6K B;  3A03 A;  4XLC A;  3DEW A;  1ZHF A;  1Y8R B;  2EPF A;  1TP4 A;  3L2W A;  1BN5 A;  2EFO A;  3BTL A;  3S32 A;  5FD6 A;  4KIB A;  4JYK A;  5K5O A;  3GXO A;  3JAM K;  2QBY A;  3WG9 A;  1TQM A;  3M7G A;  2MGQ A;  2K86 A;  1T39 A;  1VQ9 I;  3GUD A;  3CO7 C;  4BNC A;  1JT0 A;  4AID A;  1XDU A;  3U1K A;  3ECH A;  3MKL A;  2EFN A;  2G7H A;  2JVG A;  5LD2 C;  2LTP A;  3H1C A;  4A0Y A;  1S29 A;  4XID A;  3PO2 J;  1EF4 A;  1I5Z A;  4GRI A;  3K2Z A;  1OMI A;  3F8M A;  3SWH A;  2J5O A;  3M07 A;  3EYI A;  2Z2S B;  1XS9 A;  1IN4 A;  4C2U A;  3C07 A;  3T1B A;  1SAN A;  2NX4 A;  4XIC A;  2H1L A;  5LEK A;  2NOJ B;  2M87 A;  5CKT A;  3BY6 A;  3IKV A;  4II2 A;  1CF7 B;  2V9V A;  3UKG A;  3JRI A;  2OTJ I;  3C1D A;  3I9V 2;  4OIN F;  1R49 A;  1V4R A;  2RVC A;  3A0H C;  3TW6 A;  3FXL A;  5JVT A;  2CGP A;  5A2Q K;  1Z3Y A;  2DMP A;  2VC1 A;  2VC0 A;  1FPQ A;  1SAX A;  4UY8 I;  1LEB A;  4F52 A;  2E36 A;  3N05 A;  3QRF F;  4N9H A;  3CJQ B;  3I59 A;  5IT9 K;  2ZXW H;  3E6D A;  2IGO A;  3HEF A;  4MIM A;  2R92 J;  4YII A;  1ZG3 A;  3RSN A;  3WU1 B;  1YJW I;  3LQQ A;  1NG6 A;  1VQK I;  2RHA A;  5D19 A;  4LLN A;  5CJ9 A;  2GOM A;  1KU2 A;  2V79 A;  3VSL A;  4BHB A;  2Q1Z B;  2HNH A;  3CCU I;  2IU5 A;  1JTY A;  2HKX A;  3H36 A;  4G7O F;  5FKN A;  4BBS J;  4ZYA A;  1MD0 A;  4IPA A;  4JOM A;  2NP5 A;  2GXG A;  3K10 A;  2E5Z A;  2YS9 A;  2KKO A;  3BHQ A;  1W1W E;  2AXL A;  3LNQ A;  3CF5 F;  3M1E A;  3TED A;  3LSK A;  3S1R J;  1G4D A;  3PFY A;  2LOO A;  4DYQ A;  2ZNZ A;  5CVR A;  3ML6 A;  1FMV A;  4PXI A;  4KNY A;  1ENH A;  2DT6 A;  4KYW A;  5JHU A;  2KLO A;  2ZXH A;  2CS3 A;  3TP3 A;  3ZMS A;  3IL2 A;  3R4K A;  4DBQ A;  3QPT A;  4OOI A;  5DDG A;  3CCY A;  3GTG J;  1Z3X A;  2JN6 A;  1K6Y A;  3VEP A;  4XL9 A;  4IQJ A;  4OD4 A;  4KT6 A;  4RA2 A;  3WHB A;  1J0R A;  2CUE A;  3GZ5 A;  1VQP I;  3JAM Z;  2GBY A;  5LRS A;  1U2W A;  2F5F A;  2A5Y B;  2LY9 A;  2CW0 F;  3DPL C;  4YRV A;  3HZJ A;  5FD5 A;  3BR1 A;  5HLH A;  1B8I A;  2VT2 A;  3K4M A;  4YFX F;  4YG2 F;  5IYD J;  4I09 A;  1DDN A;  3KKC A;  3SDG A;  3ERE D;  4DVY P;  3B6C A;  2XPV A;  2K85 A;  5DCM B;  1X1B A;  1OQY A;  4ZDO A;  2EIK H;  3QPS A;  4P55 A;  3WTS C;  3MKY B;  4L5I A;  2ZFW A;  4A93 J;  3R0A A;  4C3H J;  1OYI A;  4Y52 J;  1OJL A;  4A3K J;  1S5L C;  1T98 A;  1W0T A;  3GEU A;  3RKW A;  3VVY A;  2HFH A;  2YVH A;  3NWT A;  2L7M P;  3K0L A;  3ZN0 A;  4EMS A;  1N78 A;  4BJ5 C;  1ITY A;  2E35 A;  2BHZ A;  1XGM A;  5A2Q Z;  1TNT A;  5FJ8 J;  1S7O A;  3GTJ J;  4I76 A;  1R7J A;  2DI3 A;  4H0E A;  4G7Z F;  3VIB A;  3OL4 A;  2PFB A;  4KWA A;  3UNG C;  2FQ4 A;  3T0Y A;  3LA2 A;  1QZY A;  1WJF A;  3ZQC A;  5IT9 Z;  1EV7 A;  1L0O C;  1GDT A;  4GYI A;  5D6F A;  1VQO I;  1LUJ B;  2ZJP F;  2WAQ N;  3PNY A;  2NVU B;  1FJL A;  2DA2 A;  3DBR B;  5M5Y J;  3LOC A;  3G73 A;  1WZ2 A;  3IWZ A;  3RIR A;  3GBG A;  5FKL A;  1H8A C;  2LVS A;  2PLY A;  3TQN A;  1SVO A;  1R36 A;  3PNV A;  4IRH A;  1IUY A;  3GFI A;  3VPR A;  5D6E A;  3E6B A;  1YRN B;  1S3J A;  3V42 A;  3BNI A;  3OYD A;  2RQP A;  2D2W A;  3D5S C;  3GCM A;  4ETS A;  2O6G E;  3BJO A;  4WIB A;  2V26 A;  2ZNY A;  5FLV A;  3FDY A;  4HV6 A;  2VE8 A;  1TWH J;  4A6D A;  3RQ4 A;  4KN7 X;  1MKM A;  3HRS A;  2PJP A;  1FMW A;  2EA4 A;  2NVY J;  4WCG A;  1W0U A;  1IRX A;  2ZCX A;  2X6W A;  1X19 A;  5H2F C;  3LQR A;  2Q2E A;  2HKO A;  1LDJ A;  5KK1 A;  1MDM B;  2PZ9 A;  1KON A;  2FNA A;  4LG0 B;  4RLF A;  5C4J J;  3CDH A;  1H9G A;  4FET A;  4RAZ A;  4CHU A;  4KN4 X;  1FX7 A;  1WH7 A;  1Y6I A;  4U7D A;  1MMN A;  1RES A;  4PJM A;  3ANP A;  1HST A;  1WPK A;  2H8W A;  4NUB A;  2EB7 A;  3FZV A;  4XOR A;  2XV4 S;  2ZSI B;  3JRE A;  2XAF A;  4A69 C;  2IAI A;  2MYS A;  2O61 A;  3OYG A;  5FHP A;  1RC9 A;  2ME6 A;  4BQN A;  5BOX A;  3A01 B;  1S8N A;  2IS1 A;  2QZ8 A;  2A68 F;  1MBK A;  4JX5 A;  4UNO A;  5FGL A;  2OTL I;  1BOB A;  2FA5 A;  2DAO A;  3E7Q A;  2KDZ A;  1ODD A;  4BY7 J;  1Y1V J;  3CJR B;  3KZZ A;  4S04 A;  3EQL F;  4XN3 A;  4WWC A;  5KAI C;  1STZ A;  4G7H F;  3RQI A;  2HZD A;  3R60 A;  1U8R A;  2X1D A;  2GOX B;  2CQN A;  2YVX A;  1A31 A;  3NAR A;  4B3X A;  2ID6 A;  4F93 B;  4CZZ A;  4G6D A;  1F5T A;  2VOO A;  4HNT A;  5DUI A;  2JQ7 A;  3HOX J;  3OYB A;  5L3E A;  2R3S A;  2WAQ A;  5GAG J;  2BGC A;  4WXC A;  1SD6 A;  3I0T A;  2DCE A;  3E0J B;  2GUH A;  4M3F A;  2MLG A;  2H6B A;  2ADU A;  3WTU C;  1YQA A;  2OQG A;  4E7J A;  3RPU D;  1APL C;  3O2P E;  5D8L B;  4CA0 A;  1B72 A;  2EZH A;  5IYC J;  2H94 A;  2L7Z A;  3HXL A;  3LFU A;  4LD5 A;  3K2A A;  2K3P A;  4RLQ A;  4ESF A;  1EH8 A;  5K58 A;  3G1L A;  1D1B A;  3VOX A;  3BR2 A;  3S1M J;  1RET A;  5D5W B;  1MZB A;  1GV5 A;  3FMR A;  3KYL A;  1OYW A;  3A1Y A;  1HQC A;  1SFX A;  1XCB A;  4BGD A;  1ZRD A;  4NB5 A;  4PSW A;  2LSO A;  3I3L A;  3GTK J;  2V9K A;  3FMQ A;  5EG0 A;  2IA1 A;  2STW A;  1JKR C;  2GA1 A;  2QQ8 A;  3CRJ A;  3OMY A;  4UDS A;  3ZQF A;  1XX5 A;  4YIR X;  4PCQ A;  2FX0 A;  3VOE A;  3CCR I;  1RIO H;  5K1Y A;  1IN8 A;  4FIS A;  2OBP A;  2XRO A;  3TOA A;  1W5S A;  1N77 A;  3DV8 A;  4XKB A;  4CSW A;  2ECC A;  4UVB A;  5HS7 A;  3JR9 A;  3L2U A;  3QWL A;  3K9T A;  1OIS A;  5DTD A;  4A3D J;  3AFH A;  2ZJR F;  5LRR A;  3TBI A;  1HC8 A;  2QOP A;  4M3E A;  1Z0X A;  2VIX A;  2OD5 A;  1YS6 A;  1WI9 A;  2OZ6 A;  1W7P D;  5J4Y A;  2E2I J;  4PK4 A;  4HSR A;  5FRM A;  1G6N A;  3V8J A;  4XQF A;  3G56 A;  3GF2 A;  3FHZ A;  1QGP A;  1P9Q C;  1QQI A;  1U5T B;  3S17 J;  4CGR A;  3SFZ A;  1LDD A;  1MNE A;  4ZC3 A;  4DYR A;  2BY3 A;  1IUF A;  3B02 A;  3TW7 A;  1YE9 A;  4EM2 A;  1A6I A;  1BI2 A;  3C3W A;  4UUS A;  3IRR A;  3S3M A;  1UHW A;  3F6V A;  3EUH A;  3ON2 A;  3PPB A;  4PJL A;  1KYZ A;  2IJL A;  2F4O B;  2IA0 A;  4WXH A;  2FBH A;  5GAD J;  3RYR A;  1E0E A;  2VJJ A;  3HRT A;  3DU5 A;  4MQ9 F;  3HIM A;  2DMU A;  3EGQ A;  1LVA A;  4YFN F;  2DT5 A;  1VQ5 I;  3RKY A;  2VKH A;  2NOG A;  5FO5 A;  1ZTR A;  2VBW A;  3CUQ B;  2XSD C;  4QLC U;  3E6M A;  2W57 A;  3QU6 A;  4U0W A;  2QGU A;  4HOB A;  4BKX A;  1HW1 A;  5H6R A;  3Q3S A;  3EUH C;  2L2O A;  1F36 A;  4PFP A;  2M2E A;  1X2M A;  2X6O A;  1EKE A;  4A12 A;  2REK A;  1N75 A;  1DUX C;  1QZE A;  3C2B A;  4E4H A;  4K2E A;  4LGW A;  2LK2 A;  4P1W A;  2DA3 A;  5HSZ A;  2ICW G;  4L0Y B;  2ZKZ A;  4XN0 A;  3OIQ A;  1ON2 A;  1T0F A;  4XSX F;  2R7O A;  4RGR A;  1LE8 B;  3G7R A;  2EFP A;  4R1H A;  4Y7N J;  1ZLJ A;  3HGG A;  5EF6 A;  3NXC A;  3BZC A;  3SZP A;  3AG1 H;  1K83 J;  2GFN A;  1V3F A;  4F91 B;  4L18 B;  5J47 A;  4NNJ A;  2XC7 A;  4DOZ A;  2KHM A;  2QQA A;  5FFX A;  2PBI A;  1T0F C;  2ISY A;  2JUG A;  4RGU A;  5EGO B;  3BLY A;  2XGE A;  2P6S A;  2H8R A;  2V9P A;  3WHC A;  4UB8 C;  3RKQ A;  3NRG A;  3S93 A;  3C7J A;  1XN7 A;  4HAM A;  1ETK A;  3MWM A;  4B4C A;  4M3B A;  2XDV A;  1UJ8 A;  4IRI A;  1YX3 A;  1XG1 A;  3TKY A;  1XMK A;  4EM1 A;  3C18 A;  2GQQ A;  3H9Q A;  2NAZ A;  2X6Y A;  1OCR H;  2FQ3 A;  2LF7 A;  4B43 A;  5IYB J;  2YX4 A;  3LSG A;  1IN7 A;  4HX4 A;  4HKU A;  5JR3 A;  4IRG A;  2R5Z B;  1MSF C;  1IXR C;  2FJ1 A;  3HKZ N;  3PUF A;  2LKP A;  1FBQ A;  1OKR A;  5LHH A;  4LFU A;  3V8K A;  3BP8 A;  2P81 A;  3JCU C;  3D0S A;  4E7L A;  1W36 C;  3GTM J;  3D5L A;  5EZG A;  3HIF A;  2DK5 A;  4LLG F;  4A3C J;  4XRS A;  1T95 A;  3NWS A;  3V6G A;  2YSR A;  1I6H J;  5ILV A;  2K9S A;  2Y2Z A;  4DZP A;  4HQE A;  2IBD A;  2XUB A;  3OV8 A;  3IAS 2;  3CC4 I;  4DIQ A;  4W1U A;  3GLX A;  2RRE A;  2UXU A;  5B3S H;  3B6A A;  3BJ6 A;  3UR3 C;  2JMW A;  2MA3 A;  4ESB A;  1E3O C;  2UXN A;  4IHX A;  4ESJ A;  3OOP A;  3LAJ A;  2ZXI A;  4I01 A;  1RNL A;  3NRV A;  3SDB A;  2H6C A;  4D7N A;  2UXH A;  3CDI A;  2N8G A;  1GVJ A;  2WBM A;  2LLK A;  1HKT A;  1GVD A;  2ZFU A;  4ZTF A;  4A0X A;  3A4C A;  4I98 B;  1BJZ A;  4JX6 A;  1FOW A;  1YTY A;  4ON0 A;  2NVQ J;  3P9C A;  3RJP A;  4CCM A;  2MH2 A;  1AU7 A;  4HLX A;  3JRB A;  4EAT A;  3KP3 A;  2NNY A;  3HE0 A;  1P6R A;  2ELH A;  1R71 A;  3KZ9 A;  2G7U A;  3W2V A;  4J01 A;  4B44 A;  3G6E I;  2NS0 A;  4XM3 A;  4BJ6 C;  5DD4 A;  2DFF A;  4DYC A;  5IPA A;  4ANJ A;  5IOY A;  5M3M J;  4QPQ A;  3VVX A;  3FBN B;  3WU0 A;  2CRG A;  1MH3 A;  3QYB A;  3RDI A;  2OUM A;  5BS6 A;  2XAG A;  1Y0N A;  1SD4 A;  2R7U A;  1BIA A;  2VOD A;  3ZCO A;  2QSG X;  1BIB A;  1OLT A;  2H27 A;  4HA8 A;  5CQG A;  2D45 A;  3ZMU A;  2O9L A;  2VPL A;  1ZGW A;  2M30 A;  1RKW A;  4HF0 A;  1DQU A;  2K02 A;  2L54 A;  4IF4 A;  3BOQ A;  2W00 A;  2X0L A;  4OIQ F;  2E7W A;  2JSC A;  3OYI A;  1ZEL A;  4WF2 A;  2K9L A;  2KIM A;  1MMD A;  3ELK A;  1JUS A;  2JA5 J;  1Z6T A;  4A3J J;  5EYR A;  2ID3 A;  1PUF B;  5HLT A;  1P4W A;  2I8D A;  2Q0O A;  3RYP A;  2LP0 A;  4IL6 C;  2VKV A;  2VXZ A;  4D7M A;  1R1T A;  2WC2 A;  1LQ1 A;  2DOA A;  2EV0 A;  3VYS B;  2J5P A;  3HKZ A;  5F1J A;  3I64 A;  1SMY F;  4XSZ F;  5E1Z B;  4MK6 A;  2BV6 A;  1B4A A;  2LY2 A;  1QA6 A;  3GLL A;  3HRM A;  2BW3 B;  2CU7 A;  3R6S A;  3S2W A;  3HOS A;  3I56 I;  4FT8 A;  3OYF A;  1GHC A;  3ECO A;  2K4B A;  2DQL A;  1TWF J;  4D5F A;  1K4T A;  3HTJ A;  5L3G A;  3M8J A;  2HOE A;  2R5Y A;  3N4M A;  3S1N J;  2A6T A;  3L2C A;  3AG4 H;  3HB9 A;  2HVR A;  3K70 D;  1B9N A;  2WY7 Q;  2HU9 A;  4XLN F;  4ABZ A;  1D8K A;  4B09 A;  3BR3 A;  3CF2 A;  2Y0S N;  2XPU A;  1WJD A;  2DA1 A;  3P9I A;  3PFI A;  2NS7 A;  3PSI A;  2BXZ A;  3SZG A;  2M9H A;  1R4N B;  1J9I A;  3M1C A;  4XNF A;  4PZJ A;  1K7A A;  3H9G A;  1B6A A;  4JX4 A;  2F07 A;  3FRQ A;  2D6Y A;  1SAU A;  3DKW A;  2MC3 A;  2MW8 A;  2QYO A;  3O3K A;  5LGU A;  5HDN A;  3OIP A;  2HYT A;  2CMP A;  4OIO F;  4Q47 A;  4MTD A;  1MW7 A;  1W7P B;  1KQ9 A;  2DTR A;  1Z77 A;  1V5E A;  2I5U A;  4XR6 A;  4ASN A;  3ZQI A;  5L3B A;  1A36 A;  1HKQ A;  2HQA A;  1KZH A;  5D1R A;  5J6X A;  2B7E A;  3FXU A;  4KDP A;  3JW4 A;  1EH7 A;  3S3N A;  4KFC A;  4CDG A;  4NQW A;  4Y3O A;  2CW7 A;  2IRF G;  2ZCN A;  4NEL A;  3DLA A;  2HKU A;  2K9Q A;  3G71 I;  5BMZ A;  4XRS G;  3EET A;  3GZI A;  1BI3 A;  3HL2 A;  4PJN A;  3KEQ A;  2GM4 A;  3G4S I;  1J2X A;  2OZU A;  3LA7 A;  4BDZ A;  1QBJ A;  5B1A H;  2XAS A;  1J09 A;  4C9Y A;  1ACI A;  5F0H A;  3LSR A;  5D5V B;  1EA3 A;  3CJT B;  4NC8 A;  1TT5 B;  2QKM B;  1XPX A;  4A2U A;  2VUM J;  2B3W A;  1UAA A;  2PBX A;  3GYH X;  3T8T A;  2PMZ N;  3VYU B;  4L9N A;  5D4S A;  2UXI A;  1E3H A;  2JRM A;  2JRT A;  1AHD P;  2UXO A;  3S15 J;  2GWR A;  3ERM A;  1BW6 A;  2IGK A;  4RGS A;  1ETY A;  2FU4 A;  4MGR A;  1U3E M;  2IP2 A;  3ZMZ A;  5K7Z A;  1VF9 A;  1WCM J;  4GXO A;  4V2G A;  3E5Q A;  4R79 A;  4ENM A;  2KMU A;  2OJE D;  2QUF A;  1MJB A;  2OCC H;  2DLL A;  5E18 F;  3HOV J;  1YS7 A;  4IKF A;  3M4O J;  4O6J A;  3TDU C;  4BAC A;  3VW0 A;  4ZTJ A;  3RZD J;  4GDF A;  1JJ8 C;  3ON4 A;  1D3Y A;  3MEX A;  5F1R A;  4BE0 A;  2V4J C;  2ZC2 A;  4U87 A;  4FQG A;  4X0G A;  3FK7 A;  4E7S A;  3ZXS A;  3BR6 A;  5GPA A;  2JPB A;  3F3X A;  2G7S A;  2KPM A;  2EWN A;  2DMN A;  4FAS D;  1OFC X;  1DU0 A;  2Y0S A;  2GA2 A;  4ZYE A;  5ED4 A;  2VKE A;  3LSH A;  4HX7 A;  4BQO A;  2CQ7 A;  3R0J A;  3WTZ A;  4I7H A;  4DW6 A;  1VQ6 I;  4AWX B;  1Y39 A;  2ZCM A;  3OS2 A;  4Q48 A;  2F5D A;  2V1X A;  4E7Z A;  2Y9Y A;  1FYL A;  2IS2 A;  1F9N A;  3GZN B;  2HEO A;  4X6A J;  2DFE A;  2LY1 A;  2E1C A;  3VWB A;  1I27 A;  5IP7 J;  5ICC A;  5L3F A;  1TWA J;  3SZT A;  6PAX A;  1I6X A;  2ZME B;  2NXN B;  4BBR J;  4NN1 A;  4CYD A;  3RZO J;  9ANT A;  2WWY A;  3H0G J;  4HNU A;  3SYT A;  4D5C A;  2A07 F;  4IRV A;  2VON A;  2EZK A;  2V1U A;  2M45 A;  3HG9 A;  1BOA A;  3E1S A;  2O03 A;  1VTN C;  2CV2 A;  1OCZ H;  3J81 K;  4OMY A;  2HOT A; 
#chains in the Genus database with same CATH homology
 3BG5 A;  2VPR A;  1ETX A;  3NAR A;  2ID6 A;  5EFY A;  4X1E A;  4MLO A;  4XRM A;  1I3Q J;  1MBG A;  3HM5 A;  3E7L A;  2ZOZ A;  3HOX J;  1BA5 A;  2EZL A;  4B1R A;  3GTP J;  2D5V A;  4M3F A;  2GUH A;  2X48 A;  1MH4 A;  5BNG A;  3Q0U A;  2G7G A;  3PAS A;  4ACI A;  1ZKG A;  1APL C;  1JTX A;  4L62 A;  3FKI J;  2DMQ A;  1B72 A;  2EZH A;  5IYC J;  2L7Z A;  3K2A A;  5J1Y A;  1ETV A;  3MNL A;  1D5Y A;  4W97 A;  3G1L A;  5K58 A;  3VOX A;  3BR2 A;  3S1M J;  3BTI A;  2DA6 A;  1SGM A;  3KNW A;  1RET A;  2O7T A;  4GCL A;  1SFO J;  3A02 A;  4GFB A;  3JRA A;  1GV5 A;  3T6N A;  4EEF G;  1RKT A;  3GTK J;  5FKO A;  5EG0 A;  2IEK A;  3IV5 A;  2K40 A;  1TC3 C;  1FIA A;  2JJ7 A;  1JKR C;  4CYC B;  1ETO A;  3CRJ A;  4UDS A;  1JJ6 C;  3ZQF A;  3I4N J;  2FX0 A;  3JRH A;  3JRF A;  3HDD A;  3W6V A;  3IH2 A;  3BR0 A;  1H89 C;  1HCR A;  4FIS A;  2DN0 A;  5E3N A;  1GT0 C;  4QIW N;  5C3E J;  4UUS B;  2ECC A;  3BTJ A;  4ME9 A;  3JR9 A;  1OCT C;  4IHY A;  3BJB A;  5DTD A;  4A3D J;  2ELK A;  2EQR A;  5F27 A;  1QRY A;  2QOP A;  4M3E A;  5FKM A;  3LSJ A;  1Z0X A;  4MXM A;  4CYC A;  2QF7 A;  3G1O A;  2O8K A;  2QCO A;  2EBI A;  1MNM C;  2E2I J;  3G56 A;  5F0F A;  1IV6 A;  3S17 J;  4CGR A;  3HOZ J;  1WI3 A;  3I4M J;  4DYR A;  1HDP A;  2JWT A;  2CUF A;  1DU6 A;  1HLV A;  1IUF A;  3TW7 A;  4UUS A;  1HF0 A;  1NTC A;  1A6I A;  3IH4 A;  4L5E A;  3ON2 A;  2CQX A;  3EUP A;  3PPB A;  3S16 J;  4BY1 J;  1JT6 A;  3FIS A;  4JNN A;  2HOS A;  2FBQ A;  2G7L A;  5D18 A;  2NVT J;  3ZQG A;  3HIM A;  2DMU A;  5EZH A;  3EGQ A;  3V78 A;  3VOK A;  2QWT A;  1YRN A;  2NOG A;  2K9N A;  2DG8 A;  3VVZ A;  1ZTR A;  4A3B J;  2XSD C;  4A3E J;  2R93 J;  1U9O A;  1MBJ A;  3CWR A;  2LKX A;  1BW5 A;  4BKX A;  3Q3S A;  5F08 A;  3S2H J;  2L0K A;  1F36 A;  3DCF A;  2M2E A;  1X2M A;  2X6O A;  5K7F A;  4MO7 A;  2REK A;  3C2B A;  1WGX A;  2LK2 A;  5CXG A;  3HBL A;  2DA3 A;  5HSZ A;  1VI0 A;  2OI8 A;  5FLM J;  3PM1 A;  2OF7 A;  1H88 C;  1X58 A;  2NS8 A;  1ORK A;  3ZQL A;  1LE8 B;  3G7R A;  4YZE A;  2E19 A;  3HGG A;  4Y7N J;  5EF6 A;  1BL0 A;  2VI6 A;  3NXC A;  2HDD A;  2R5Y B;  1K83 J;  3LSP A;  2GFN A;  2LFB A;  3HOW J;  3JRG A;  2R7Z J;  2HYJ A;  5EDN A;  1HOM A;  1UHS A;  4A3M J;  4GCK A;  3DPJ A;  1MBF A;  1JUP A;  2DMT A;  1R9T J;  5EGO B;  4FE7 A;  3BCG A;  3IH3 A;  2WGB A;  1GUU A;  3A01 A;  2XGE A;  2H8R A;  2XGC A;  2FD5 A;  4JP0 A;  1B8I B;  3B81 A;  3HOY J;  3WHC A;  4A3F J;  3VP5 A;  3RKQ A;  3VW1 A;  1LE8 A;  3NRG A;  2W53 A;  2HOA A;  3MN2 A;  1ETK A;  3LHQ A;  2OPT A;  3CDL A;  4M3B A;  4B4C A;  2O7O A;  4GFK A;  5K7H A;  1RPW A;  3OSF A;  3O60 A;  4MFD A;  1Q1V A;  4JKZ A;  1XG1 A;  4C2M J;  2Y9Z A;  5J1R A;  3P9T A;  3SJM A;  2DJN A;  4C3J J;  4A3G J;  2E2H J;  5M5X J;  3BR5 A;  5GP9 A;  5IYB J;  3BQY A;  3LSG A;  4RDU A;  1FEX A;  5AQC A;  1IDY A;  2XRL A;  4HKU A;  1FTZ A;  2ZB9 A;  3GTO J;  2R5Z B;  1JGG A;  1HDD C;  2JK3 A;  1MSF C;  1F43 A;  2FJ1 A;  3KKD A;  3HKZ N;  5E3M A;  3OIO A;  1P7J A;  1VFC A;  2KT0 A;  4JL3 A;  2Q24 A;  1T56 A;  5F0C A;  1IJW C;  2P81 A;  3GTM J;  2EZI A;  5EZG A;  3AQT A;  2UXP A;  2NP3 A;  4A3C J;  1QVT A;  4XRS A;  3QKX A;  4FE4 A;  3V6G A;  3VW2 A;  1I6H J;  1O4X A;  2K9S A;  2Y2Z A;  4DZP A;  4UUT A;  2IBD A;  3O8G A;  1ZQ3 P;  4HNV A;  1T33 A;  1LFU P;  1POG A;  3QBM A;  1LFB A;  4W1U A;  5DAJ A;  2UXU A;  1TWG J;  1GV2 A;  3B6A A;  2JMW A;  3M3Y J;  3LWJ A;  1E3O C;  2ZOY A;  4IHX A;  4IHW A;  2I10 A;  3A03 A;  1UI6 A;  3DEW A;  3S2D J;  1TWC J;  5HOD A;  3BTL A;  2HQ5 A;  2COB A;  4JYK A;  4D7N A;  4QTR A;  2XDN A;  2MGQ A;  2UXH A;  2N8G A;  2LLK A;  1GVD A;  1JT0 A;  1MSE C;  2JA6 J;  3MKL A;  5C4X J;  4C3I J;  1AKH B;  3JSJ A;  3BG9 A;  1BJZ A;  2LTP A;  4JX6 A;  1CQT A;  4IHV A;  4M3D A;  2NVQ J;  4XID A;  1JKP C;  3PO2 J;  1EF4 A;  3IUV A;  1Y1W J;  1AU7 A;  1IC8 A;  4AC6 A;  2QKO A;  3JRB A;  3HE0 A;  3FK6 A;  4QSH A;  1XS9 A;  3C07 A;  1SAN A;  2QTQ A;  2NX4 A;  3KZ9 A;  4XIC A;  3QPL A;  2AHQ A;  2XB0 X;  2L7F P;  4DYC A;  3UKG A;  3JRI A;  3D1N I;  4A3L J;  1UMQ A;  5IPA A;  4XK4 A;  5M3M J;  1VND A;  2E1O A;  2Y30 A;  3TW6 A;  5IOY A;  1AKH A;  3VVX A;  2Y31 A;  2CRG A;  1MH3 A;  2TRT A;  2DMP A;  1IGN A;  5HBU A;  1MBE A;  2JA7 J;  2DA5 A;  4M6V A;  2B63 J;  4ICH A;  1ETW A;  3HEF A;  5M3F J;  4MIM A;  2R92 J;  2QIB A;  4G12 A;  1U8B A;  2DTZ A;  1ZGW A;  2O9L A;  3BRU A;  3OSG A;  2RHA A;  3HTH A;  1RKW A;  5D19 A;  1A5J A;  2H1K A;  5IP9 J;  3G1M A;  4AUX A;  5IP6 A;  2IU5 A;  1JTY A;  1JUS A;  2JA5 J;  5FKN A;  2NVX J;  4BBS J;  5H9T A;  2R0Q C;  4J19 A;  4A3J J;  2NP5 A;  5EYR A;  2ID3 A;  1RR7 A;  1PUF B;  2LP0 A;  2YS9 A;  2VKV A;  3BHQ A;  3BG3 A;  1X2N A;  3CQZ J;  3LNQ A;  4D7M A;  3TED A;  3S1R J;  2WUI A;  2HI3 A;  2RAS A;  5F1J A;  3VUQ A;  1FIP A;  4DYQ A;  4M3G A;  4MK6 A;  2XGD A;  1IDZ A;  5JLX A;  4I6Z A;  1K61 A;  4PXI A;  2CU7 A;  5HAW A;  1ENH A;  4AF5 A;  2X9D A;  2E2J J;  4GFL A;  1ETQ A;  1TWF J;  4D5F A;  2TCT A;  4NDL A;  3HTJ A;  3TP3 A;  1FTT A;  1QVU A;  3GTG J;  2R5Y A;  3CCY A;  3S1N J;  2JN6 A;  3HB9 A;  1IG7 A;  4IEJ A;  2CQQ A;  3L1P A;  3WHB A;  4ABZ A;  2CUE A;  1XC5 A;  1G2H A;  2Y0S N;  3BR3 A;  2GBY A;  2CJJ A;  1B72 B;  2XPU A;  5EGO A;  2YU9 J;  2LY9 A;  2OER A;  5J3L A;  1U9N A;  2DA1 A;  3CJD A;  2NS7 A;  3BR1 A;  1B8I A;  2MG4 A;  2M9H A;  2M34 A;  2XPW A;  5J1U A;  4JX4 A;  4AC0 A;  5IYD J;  3KKC A;  2F07 A;  3FRQ A;  2D6Y A;  3SDG A;  3B6C A;  2MW8 A;  2XPV A;  3F0C A;  5GPC A;  2GEN A;  3COL A;  2LD5 A;  1NK2 P;  2HYT A;  4RBO A;  3QPS A;  5M5W J;  4A93 J;  1Z77 A;  5EG0 B;  4C3H J;  4FTH A;  5DS9 A;  4A3I J;  4Y52 J;  5C44 J;  5E3O A;  1OJL A;  3ZQI A;  4A3K J;  1W0T A;  3GEU A;  3VVY A;  3ZOB A;  2G3B A;  3S14 J;  3SFI A;  5D1R A;  2YVH A;  2R5Z A;  3OOU A;  2L7M P;  2HXO A;  2ZCN A;  4NEL A;  1ITY A;  2HKU A;  1UG2 A;  2K9Q A;  3Q0V A;  2M0C A;  2ME0 A;  5FJ8 J;  4I76 A;  4XRS G;  3GTJ J;  4V2F A;  3GZI A;  5C4Y A;  3VIB A;  2WB1 N;  2YVE A;  2XB5 A;  4KWA A;  2FQ4 A;  3ZQH A;  2GM4 A;  3NAU A;  2MSY A;  2GLO A;  3ZQC A;  1GDT A;  5FKK A;  5F0H A;  3LSR A;  2WAQ N;  1FJL A;  1WH5 A;  2DA2 A;  5M5Y J;  3LOC A;  3BTC A;  4LOC A;  4B3A A;  3O8H A;  5JLW A;  3RD3 A;  3GBG A;  2VUM J;  5FKL A;  1H8A C;  2PBX A;  1JKO C;  1ZK8 A;  2PMZ N;  5EEA A;  1IRZ A;  2LVS A;  2UXI A;  3NPI A;  2EH3 A;  5FMP A;  1JUM A;  1AHD P;  2UXO A;  3S15 J;  1BW6 A;  1ETY A;  3QQA A;  3VPR A;  1ZR2 A;  2V57 A;  5K7Z A;  1VF9 A;  1WCM J;  4FCY A;  1YRN B;  4V2G A;  3AQS A;  2LR8 A;  3BNI A;  3HTA A;  3ANG A;  3TP0 A;  2YUS A;  5FLV A;  3GTQ J;  3HOV J;  3HTI A;  3M4O J;  3Q0W A;  1TWH J;  4S0H B;  3VW0 A;  3HOU J;  3RZD J;  3CMY A;  1JJ8 C;  2NVY J;  1W0U A;  2ZCX A;  3ON4 A;  1I50 J;  5E3L A;  2L9R A;  3FK7 A;  2PZ9 A;  1OCP A;  1QPI A;  3S5R A;  1P7I A;  2RAE A;  5F04 A;  2WV1 A;  3FIW A;  3BR6 A;  5C4J J;  1JKQ C;  3F1B A;  3RH2 A;  3H3V K;  5GPA A;  5CXI A;  3NI7 A;  1S7E A;  2G7S A;  2DMN A;  1DU0 A;  1OFC X;  2JA8 J;  2DG7 A;  2VKE A;  1WH7 A;  3BT9 A;  1ZR4 A;  2DA4 A;  5IOZ A;  1UI5 A;  3K7A J;  1RES A;  3GTL J;  4DW6 A;  3ANP A;  1WPK A;  3LJL A;  1U78 A;  2ZCM A;  4AYB N;  3JRE A;  2ECB A;  2Y9Y A;  4A69 C;  2IAI A;  3NNR A;  3S1Q J;  4MFE A;  4X6A J;  5FHP A;  2G0E A;  1MBH A;  2ME6 A;  5CW8 A;  3A01 B;  2W48 A;  5IP7 J;  4BXX J;  3BQZ A;  2HXI A;  1TWA J;  4DZJ A;  3JRC A;  2AO9 A;  1MBK A;  4JX5 A;  4BBR J;  1PUF A;  4NN1 A;  5FGL A;  1NK3 P;  4GCT A;  3RZO J;  3MVP A;  2DA7 A;  9ANT A;  3H0G J;  3E7Q A;  2KDZ A;  3JRD A;  4D5C A;  3PO3 J;  2M8G X;  1Y1V J;  4BY7 J;  2EZK A;  3HGY A;  3RQI A;  2HOT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...