2QCOA

Crystal structure of the transcriptional regulator cmer from campylobacter jejuni
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
202
structure length
202
Chain Sequence
TPSQKVLARQEKIKAVALELFLTKGYQETSLSDIIKLSGGSYSNIYDGFKSKEGLFFEILDDICKKHFHLIYSKTQEIKNGTLKEILTSFGLAFIEIFNQPEAVAFGKIIYSQVYDKDRHLANWIENNQQNFSYNILMGFFKQQNNSYMKKNAEKLAVLFCTMLKEPYHHLNVLINAPLKNKKEQKEHVEFVVNVFLNGINS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the transcriptional regulator CmeR from Campylobacter jejuni.
pubmed doi rcsb
source organism Campylobacter jejuni
molecule tags Transcription
molecule keywords CmeR
total genus 66
structure length 202
sequence length 202
ec nomenclature
pdb deposition date 2007-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2qcoA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2qcoA02
1JTYA 1CQTA 1BA5A 1UI6A 1FEXA 1POGA 1ZKGA 3VIBA 2YS9A 2UXIA 2HXOA 2ELKA 1QVTA 3BR6A 3S5RA 4IEJA 4UUSB 1JKQC 4IHXA 4L5EA 4V2GA 3ZQGA 1TWCJ 4JX5A 1SGMA 2MW8A 2N8GA 4V2FA 2E19A 4BY1J 2HOSA 3VVXA 4MK6A 5HAWA 5FJ8J 1BW5A 3E7LA 3GTGJ 2DA2A 1BL0A 4BBRJ 3MN2A 2QTQA 3VOXA 2ZB9A 2L7MP 3HOUJ 3P9TA 5DAJA 1LFBA 3BG9A 3F0CA 1P7IA 4M3BA 4RBOA 5IPAA 4FE4A 2QCOA 3C07A 3HE0A 4MO7A 4X6AJ 4XICA 1IG7A 4MXMA 3OSFA 1I6HJ 3SDGA 1OCTC 2IEKA 3RZOJ 2EZHA 1YRNB 4XK4A 3HOVJ 3OOUA 1APLC 4A3FJ 1FIPA 3HOXJ 4GFKA 1SFOJ 3GTKJ 2VUMJ 3BT9A 2WUIA 2XSDC 2LLKA 3BTCA 2DG8A 4A3GJ 1NK3P 3IH2A 4NELA 1IC8A 1WH7A 5M3FJ 4GCLA 3K7AJ 1IDZA 3F1BA 3CQZJ 4M3DA 1ZR4A 3EUPA 5D19A 3H3VK 1GVDA 5C4YA 3BG3A 1W0TA 1MSFC 2DA7A 2M9HA 2GBYA 2R5ZA 3JRCA 2LK2A 3CRJA 2F07A 2W53A 3ON4A 2OPTA 3TP0A 1JT0A 2Y9ZA 3KZ9A 2E1OA 1MH4A 2DJNA 3BQZA 2XPWA 2GUHA 3HOYJ 4ME9A 1HLVA 2QOPA 1RR7A 2Y2ZA 2L7ZA 2ECBA 4MFEA 3B6CA 5EGOB 1SANA 2XGDA 2YU9J 4DYRA 5K7FA 3S1NJ 1GV2A 2XGEA 5F1JA 5JLXA 1ZQ3P 3MNLA 4IHWA 5EG0A 1FTZA 2O7TA 3BTJA 3NI7A 3BG5A 1ETXA 3G56A 2NOGA 1S7EA 3JRFA 3S2HJ 4I6ZA 3GTOJ 1MBJA 2ZCNA 3HGYA 5K7HA 3FKIJ 3Q0VA 4JYKA 3RH2A 1Y1WJ 4A3JJ 1ETVA 3V6GA 4AUXA 2G7SA 2QF7A 5FLVA 1E3OC 1BJZA 4C3IJ 1VFCA 3QKXA 3V78A 3FIWA 3CMYA 2IAIA 4W1UA 5J1RA 2DMNA 4I76A 4JP0A 3WHBA 2D5VA 2M2EA 2K9SA 3HOWJ 1D5YA 5DTDA 1ETKA 2JN6A 2DMTA 3T6NA 2H1KA 3PM1A 3S1QJ 3BRUA 4MLOA 3B81A 2FD5A 1TC3C 4GFLA 2KT0A 1MBHA 1LE8A 2R5ZB 4A3MJ 2JA7J 3CJDA 3E7QA 3TP3A 2HOTA 2DN0A 1RKWA 3PPBA 5J1UA 3ZQFA 2CUEA 3MVPA 2JJ7A 5C3EJ 4S0HB 5IP9J 4C3HJ 3K2AA 5AQCA 4D5FA 3S1MJ 2ME0A 1GUUA 2AO9A 2E2IJ 3PO2J 3HKZN 1U9NA 2YUSA 5IP7J 3I4NJ 1ETYA 2FJ1A 2ID3A 3A02A 4JX4A 3RQIA 2UXPA 3VW2A 3GZIA 2NS7A 1FJLA 3FK6A 5EG0B 4DYQA 3D1NI 3PO3J 2IBDA 2R7ZJ 1HOMA 3GEUA 3NRGA 3L1PA 1X2NA 1K83J 2M0CA 3FK7A 1R9TJ 3JR9A 4BBSJ 4XIDA 3QBMA 3S1RJ 1IGNA 2CUFA 2VI6A 3HDDA 3JRDA 3LNQA 3JREA 2L7FP 2ME6A 1RESA 1TWAJ 2JMWA 5EF6A 5C4XJ 1OCPA 2JA6J 2FX0A 4J19A 3JRHA 2NS8A 4A3LJ 3UKGA 3BR2A 1AKHA 3LHQA 5CXGA 3JRIA 2NVQJ 4ACIA 4GFBA 3O8HA 1JGGA 2OERA 2MG4A 4GCTA 4A3KJ 3O60A 3A03A 3GBGA 1U9OA 3JRAA 3HTAA 2UXHA 1ENHA 3KKDA 1F43A 3HB9A 1RETA 5C44J 2L0KA 4A93J 2JWTA 4CGRA 3CWRA 2R0QC 2CRGA 3S14J 4CYCA 3ZQHA 4B3AA 4X1EA 5FKLA 4AYBN 3NXCA 3DCFA 5IP6A 1UI5A 2FBQA 2ZOYA 3LWJA 4QTRA 2JK3A 1YRNA 3VUQA 3HBLA 2VKVA 5JLWA 3Q0WA 4D7MA 3HTJA 4B4CA 4IHVA 2EH3A 5FMPA 5GP9A 1F36A 1ZTRA 4MIMA 2E2JJ 3IH3A 5EGOA 3LSPA 3AQSA 1TWGJ 1VI0A 3ZOBA 2G0EA 3AQTA 2B63J 3BJBA 1H8AC 1HDPA 3LSGA 4C3JJ 1U78A 2EZLA 4CYCB 5M5XJ 2CU7A 3DEWA 4M3EA 4D7NA 4YZEA 2HYJA 3VPRA 2LKXA 5FHPA 3BNIA 1EF4A 3FISA 2P81A 2REKA 2W48A 1NK2P 4JL3A 5IOYA 2WB1N 5E3MA 3H0GJ 1JKPC 2X9DA 5F27A 1LFUP 3HOZJ 2RASA 2HYTA 3BR3A 3LOCA 2QWTA 1VF9A 1AHDP 5FLMJ 4DZPA 5GPCA 5HODA 3LSJA 3HM5A 2E2HJ 4NDLA 2VKEA 3G1OA 4Y7NJ 1B8IA 2TCTA 1MBKA 2DA3A 3GTMJ 4GCKA 2XPUA 1U8BA 2NP5A 1AKHB 1MNMC 5D1RA 3HGGA 1OFCX 5IYCJ 5EZHA 1JKOC 1WPKA 1JUMA 4A69C 2DMQA 9ANTA 3WHCA 5IYDJ 5GPAA 1X58A 3NARA 2PBXA 4HKUA 5FKOA 2L9RA 3G7RA 1I3QJ 2QKOA 2ZCXA 2LP0A 4DYCA 1ZR2A 2VPRA 2Y30A 3GTJJ 1WI3A 2LFBA 5FKKA 4FISA 3ANGA 4RDUA 3GTLJ 3SFIA 1GT0C 1ZK8A 4C2MJ 2NVYJ 4Y52J 1ORKA 2LR8A 1UG2A 2EBIA 1Z77A 3S15J 3A01B 2KDZA 2UXUA 2HQ5A 4UUSA 5FKMA 3KKCA 2EQRA 2COBA 2JA5J 3VOKA 1GDTA 4FE7A 4FCYA 3IV5A 1IDYA 1IUFA 3QQAA 4DZJA 2MSYA 4LOCA 1LE8B 3GTPJ 2NP3A 3NPIA 2CQXA 4D5CA 3BTLA 2Y9YA 2WGBA 3W6VA 3BR5A 2R5YB 3VVZA 4M3FA 3RKQA 5FGLA 3QPSA 2UXOA 2HI3A 2XB5A 3RZDJ 5EFYA 5M5YJ 3LSRA 4JX6A 3C2BA 2FQ4A 2ECCA 1ETOA 2DA5A 2TRTA 5EEAA 3GTQJ 3BHQA 2ID6A 3HEFA 2RHAA 1T56A 1A5JA 3FRQA 1T33A 1FIAA 2DA6A 4MFDA 3ON2A 1JJ6C 2G7GA 1JUSA 2LTPA 3I4MJ 1JT6A 2QIBA 2YVHA 2R93J 1MH3A 4PXIA 3COLA 1IRZA 1BW6A 3S17J 2EZIA 3TEDA 3NAUA 2WAQN 2Y31A 2MGQA 3ZQCA 1IJWC 1DU0A 3LJLA 3QPLA 4ICHA 1NTCA 3BR1A 2GFNA 2Y0SN 2YVEA 4NN1A 3VP5A 1PUFB 3IH4A 4EEFG 3NNRA 3SJMA 1MBGA 3PASA 5M5WJ 3VVYA 5C4JJ 4A3BJ 3KNWA 3MKLA 1PUFA 4UDSA 4A3EJ 1P7JA 3CCYA 4FTHA 4HNVA 5K7ZA 5K58A 2AHQA 1QVUA 3Q0UA 3S16J 1DU6A 4A3IJ 4DW6A 1MBEA 5J3LA 1WH5A 3M3YJ 2CQQA 4IHYA 4G12A 2Q24A 1RKTA 3BQYA 4AC6A 3VW0A 2PZ9A 1JJ8C 2X48A 4M6VA 3ZQLA 4AF5A 1H89C 1WCMJ 5F08A 2X6OA 3G1LA 2LVSA 1MBFA 1QRYA 1ETWA 2GENA 2HKUA 5IYBJ 2O8KA 1HF0A 1ZGWA 2HDDA 1A6IA 2CJJA 2M8GX 4QIWN 1JTXA 4KWAA 5FKNA 1H88C 5F0FA 1IV6A 3EGQA 3TW7A 3OSGA 1Y1VJ 3O8GA 2K9NA 3OIOA 5D18A 5BNGA 5IOZA 4QSHA 2G7LA 1AU7A 1GV5A 1FTTA 2XB0X 2G3BA 4L62A 4ABZA 1X2MA 1K61A 5CW8A 2DTZA 2K9QA 1B72A 1QPIA 2NVXJ 3DPJA 2GM4A 2DMUA 2ZOZA 2DG7A 2OI8A 1VNDA 5DS9A 5J1YA 3ZQIA 5M3MJ 4A3DJ 1B72B 2O9LA 3S2DJ 5F0HA 5CXIA 5F0CA 1I50J 2H8RA 3HTHA 2RAEA 2XDNA 2XPVA 5E3NA 3JSJA 2O7OA 3BR0A 1G2HA 3HIMA 4AC0A 1ITYA 4JNNA 2ZCMA 1Z0XA 2HOAA 4W97A 1JKRC 2D6YA 3ANPA 1WGXA 2M34A 2R5YA 3A01A 4BXXJ 3M4OJ 1TWHJ 4B1RA 3CDLA 2XGCA 2DA4A 3JRGA 5F04A 5EZGA 2DMPA 1HDDC 3TW6A 3BTIA 4JKZA 4XRSG 1HCRA 4XRMA 1XS9A 3HTIA 4A3CJ 2LY9A 2R92J 1ETQA 5EYRA 2HXIA 4M3GA 3IUVA 5E3OA 2IU5A 3G1MA 5HBUA 4XRSA 1O4XA 1OJLA 1RPWA 1UMQA 2V57A 1Q1VA 2XRLA 1TWFJ 1XG1A 3RD3A 3BCGA 1JUPA 2NVTJ 5EDNA 2GLOA 3VW1A 1UHSA 2NX4A 2PMZN 4BKXA 2OF7A 1XC5A 3Q3SA 2I10A 2EZKA 1MSEC 1W0UA 1B8IB 5HSZA 3JRBA 4BY7J 5H9TA 2K40A 2WV1A 3B6AA 4UUTA 5E3LA 2JA8J 2LD5A 2DA1A
chains in the Genus database with same CATH superfamily
4ZYGA 2E7WA 1BA5A 1UI6A 4MTDA 1ZKGA 4H4KC 4CYDA 3VIBA 2HXOA 4IZZA 2CG4A 3J80K 2DDBA 4DGWB 2OA4A 2X1CA 3TO6A 2BY0A 4IEJA 4A5MA 2BY2A 5FFXA 2GA2A 4BHPA 3C1DA 2RC4A 3LL7A 2HOSA 2XAGA 3S32A 4IRGA 1LEAA 1BL0A 3MN2A 2ZB9A 1SMYF 2L7MP 3FBNB 4R1HA 1FMWA 4RBOA 1T0FA 2E71A 4FE4A 5E20A 3OMYA 3H3ZA 1QO0D 3OSFA 1WJFA 5FGMA 1OCTC 2IEKA 3TDUC 1MGTA 1BI1A 2G9WA 3EYYA 2LF7A 4XKVA 3RPQA 3EUHC 1SFOJ 2H09A 1X3WB 2VUMJ 3I0TA 2LLKA 4A3GJ 3IH2A 3BJ6A 2UZKA 2VQHA 3I59A 4IO9F 5M3FJ 2ZY9A 2MH2A 1WJEA 1TNSA 1Z91A 2NS0A 3EUPA 4AIHA 1KQ0A 3H1CA 3H3VK 5C4YA 2H1LA 5D6FA 2DA7A 1U5TB 3CCEI 2K4BA 4FX0A 4KJZA 1SVOA 3CRJA 4ZH4F 3IRRA 2CUZA 1RIOH 1QZZA 3DBRB 2K7LA 3M7GA 1XPXA 2XV4S 4I01A 1E0EA 3HOYJ 3RKWA 1M1EB 2ECBA 3K4LA 1R5ID 5HLGA 3GUDA 1Z1DA 1DPRA 1DQUA 4XN3A 4M6YA 3DTEA 1LEBA 2O7TA 5LBQA 1MKMA 2RN7A 3KE2A 3HZJA 1QBJA 3G56A 2NOGA 5CVVA 3WE3A 2EINH 1MBJA 3FX3A 4IPAA 3HGYA 4D9JA 5K7HA 5E8IA 1T39A 3DU6A 1NG6A 1FOXA 3I5UA 3ERED 2E1MC 3OWTA 1VFCA 3QKXA 5E79C 3FIWA 3CMYA 1XMXA 2ZXHA 2LD5A 4W1UA 5DM7F 1YX5A 2CV0A 3HOWJ 4OINF 3A2KA 1MMSA 5DTDA 3PNYA 2QWWA 2DT6A 1DGWY 2M5WA 2JN6A 4HLXA 1DUXC 2F2EA 3DEUA 2HQRA 2FD5A 4U0WA 3R6SA 1K79A 1U5TA 2JA7J 3E7QA 2ETHA 2HOTA 3DV8A 3ZQFA 4B3XA 5LD2C 4Y15A 5D4SA 5C3EJ 2VXDA 3KP6A 4UVAA 3G73A 3EDPA 1KONA 3K2AA 2QKLB 5AQCA 1P4WA 3I4PA 3K70D 1GUUA 2E2IJ 2A6TA 2KZVA 3A02A 3K4KA 2HZTA 2JVHA 4ZTFA 4NC8A 2IBDA 3F23A 1MDMA 3L1PA 4UY8I 1WJBA 3FK7A 4BBSJ 3QBMA 4RLQA 2O3FA 3S1RJ 2CUFA 3HDDA 2LNBA 3GF2A 4XLNF 3LNQA 4AYBA 4XBFA 2HGCA 4XR6A 4F91B 5JI6A 3DP7A 2RVCA 3W6KB 4IKFA 5C4XJ 2X1EA 3K4NA 3CD6I 3BZ6A 5BMZA 2B7EA 2JA6J 4JBAA 4WXHA 1R23A 5E1ZB 3L2VA 1ONVA 2IJLA 2NVQJ 5FD6A 4GFBA 5DV5A 4YFNF 4KT6A 1EKEA 4AIJA 4KISA 4BHBA 1JHHA 1WI9A 3D5RC 5HDGA 3A03A 3DPLC 1TL8A 3GEZA 3G2BA 1MW7A 1ENHA 4XSZF 4HLYA 3ZQ7A 3CLQA 1YJWI 5C44J 3CTAA 3ABLH 2KLOA 2UXNA 4WX9A 2FNPA 3SHFA 4CGRA 3ECHA 1ZN2A 3ELKA 1V4RA 3CESA 2KIQA 4IRHA 2ZJPF 3COAC 4A0ZA 4X1EA 4AYBN 1N75A 4CCMA 1REPC 3FXOA 3VUQA 1PVEA 3W2AA 4D7MA 4P9FA 4B4CA 4IHVA 3I9V2 2W84A 4MIMA 4F93B 2E7XA 3RCOA 2CQKA 4RAYA 5EEGA 1MDMB 2G0EA 3AQTA 2B63J 3AL0B 1H8AC 2HWVA 4Y33A 3ISPA 2HZDA 1U78A 4EV0A 5M5XJ 4M3EA 4D7NA 2ZFWA 5LHHA 2LKXA 3KP4A 2Q8KA 1EF4A 2P81A 1F9NA 2W48A 1NK2P 1MJAA 2H6CA 1T38A 2E5NA 2WB1N 3ABMH 3BP8A 3H0GJ 1S72I 2X9DA 1RI7A 1V5FA 4I0AA 3VSLA 2OBPA 3E6CC 3DLLF 2IGMA 3BR3A 4IHTA 4ESFA 2BE5F 4J01A 2GIVA 2E2HJ 3G1OA 4Y7NJ 2VBWA 1V3FA 2XPUA 3EQLF 4FETA 3K0LA 5A2QZ 1U8BA 2MD0A 5GTIC 5KVRA 2IRFG 5D1RA 2DODA 1Y56A 3HGGA 3ML6A 1UZCA 3WTWC 2O8XA 3ABTA 5A2QK 2HU9A 1WPKA 1JUMA 2JSPA 2XAFA 3WTVC 1K7AA 3WHCA 3HJEA 3PNTA 3V4GA 5D8KB 3NARA 4CDGA 2EV0A 2NVUB 1T0FC 4EGYA 2ZCXA 2K3PA 4YIIA 2LP0A 2NYXA 1QQIA 1WI3A 2LFBA 4HA8A 4FISA 2JUGA 4PGHA 4MQ9F 4E6KG 1ZK8A 1G3SA 2KZGA 2NVYJ 2XIGA 2YPRA 4C2MJ 4CHUA 2LR8A 2EBIA 3CCSI 1Z77A 1VZ0A 2DAOA 2HQ5A 3OYAA 3KKCA 2IGKA 4FE7A 1R1VA 1IUFA 4HQMA 4DZJA 2NP3A 5K5OA 3GTPJ 1VQOI 3NPIA 2BZTA 2XGXA 3LFKA 3WU0A 3ZMZA 1QHHD 2WGBA 3E97A 4LITA 4BEHB 1MJBA 4YIRX 4M3FA 3QPSA 3VSKA 2UXOA 1R00A 3V8KA 3LSRA 4ZYEA 4NBQA 2FQ4A 2OQRA 1ZG5A 3BHQA 2ID6A 2V79A 1H9GA 3FRQA 1N25A 1CF7A 4U88A 1GHCA 1IO2A 1JJ6C 1TT0A 1UHWA 3I53A 1JT6A 1WVRA 5F1RA 2QEXI 3ZR8X 2RV8A 4MTEA 1MNEA 4PXIA 1BW6A 2DPUA 3H0DA 2WAQN 1UCRA 1IJWC 3U21A 2FBIA 1QZEA 3M8EA 1R71A 3QPLA 2Y0SN 3IHUA 1Z6TA 2VPLA 5EJCA 3WGGA 2OD5A 2ZJ2A 2M8EA 3WU1B 2ACJA 4I02A 1W5TA 2O61A 4UV9A 1PUEE 3VVYA 3DKWA 4CCOA 3K8PC 3KNWA 5HNHA 4QPOA 4PUSA 1PP7U 2D1VA 4HNVA 2Q2EB 2AHQA 4KITB 4LLGF 4Y17A 2H94A 2KIFA 1DU6A 1FY7A 4BJ6C 2CQQA 4G12A 4LG0A 5DYMA 4KN4X 4BJ5C 4I0BA 2XAUA 2A2FX 1R1TA 5D5WB 3VW0A 2PZ9A 1Q1HA 2O5RA 3K4BA 3E1SA 2A6EF 1SMTA 1FOYA 3NEUA 5HS7A 3EUHA 1BR2A 1XSVA 1JGSA 2DOEA 4M72A 3K70C 2XKPA 3LSKA 5IYBJ 4A12A 2ELHA 2YU3A 1ZGWA 5LRSA 2M8GX 3DF8A 4BYYA 4ZYHA 1D1AA 4KWAA 1SAUA 3FMSA 2VLAA 1XTAA 2G7UA 4GDFA 5B1AH 3TW7A 2OCEA 4ANJA 3WTSC 3GZNB 2L9SA 2VQGA 2G7LA 2M7AA 3LSHA 2VOOA 3HRSA 2JA2A 3GCMA 1GVJA 2XROA 4L62A 1X2MA 1B72A 1QPIA 5L3GA 2DMUA 2KRHA 3GZ5A 4S04A 4NNJA 2KDOA 2D2WA 5DS9A 5J1YA 3PIOF 3MZHA 1B4AA 2OCCH 2R7FA 2K27A 5AIQA 3ROUA 3VB2A 4G6DA 1R4NB 5F0HA 2HS5A 3FXRA 2WB1A 2H8RA 3CCLI 1OYYA 2XAQA 3FKJA 1WJCA 4WCGA 1K6OA 3V7RA 3BR0A 3WGIA 2ZBKA 2RQPA 2WA0A 3HIMA 1ITYA 5FLXK 4JNNA 3DPUA 1Z0XA 2HOAA 2MA3A 4W97A 4ASNA 2Y75A 3F3XA 4PJJA 4DJAA 2R5YA 5J4VA 1IRXA 3CDLA 5LRRA 3HSFA 2ICWG 1Z7LA 4XRMA 4CZZA 2CUJA 4ETSA 3I59B 1DDNA 2HVSA 3RJPA 1ULYA 2LY9A 3PJRA 4M3GA 4AIDA 2O0YA 2VBYA 2KIUA 1FSEA 4MGRA 1Q1VA 2XKOA 2XRLA 3SFZA 3RD3A 3T8TA 4XKWA 2IA1A 3ZMDA 5EDNA 2GLOA 3TBIA 5LEKA 1S7OA 1UHSA 4R8HA 4XORA 2P5KA 1BI0A 1QHGA 2QENA 5FLXZ 1W36C 3WTTC 4BKXA 2IS6A 2EZKA 2OC6A 4BQQA 3AKZA 3CO7C 1W0UA 1OLTA 4EMSA 3JRBA 2W1OA 2AXTC 2MC4A 2XF5A 3QOPA 3VODA 3NWSA 3TKYA 3OYEA 2K40A 5H9TA 1TQPA 2WV1A 4L18B 3HC7A 4OIOF 1OKRA 3S1QJ 2K9MA 2DA1A 1FBQA 1POGA 1S5LC 2YS9A 3H5AA 4RGXA 3OIPA 1RC9A 3V8LA 2V6CA 4RMNA 2I8DA 1JKQC 1SGMA 4V2FA 2FXAA 2AXLA 3Q5FA 4MK6A 4LG0B 4A2UA 4WK8F 3GTGJ 2K86A 2GXBA 3ZMSA 3GLXA 2WBMA 3T0YA 1LFBA 3CDIA 4M3BA 1J5YA 1Z3XA 1YHQI 5IPAA 1W5CC 2QCOA 4CICA 5L3EA 3HE0A 4MO7A 2FQ3A 4X6AJ 1SAXA 1E2XA 2R7OA 3FM3A 4G6TB 4UVCA 4L5JA 2Z9OA 2EZHA 3DXJF 3GLLA 5KNLA 3OV8A 2E34A 3MEXA 1APLC 5DD8A 3JSOA 1FIPA 3HOXJ 1GXPA 2HDWA 1HKTA 3BDDA 2XASA 3N05A 3BT9A 4ENJA 2P7CB 4UB8C 5KAIC 4F55A 3GYHX 1NK3P 2PJPA 2DG8A 3DKYA 4NELA 3SZTA 5FFZA 5D18A 3FHNA 1ZLJA 3I58A 3K10A 1WHUA 3F1BA 2VN2A 3CQZJ 4M3DA 4E7LA 1TQMA 1ZR4A 4ZTJA 4LB6B 1N78A 3BG6A 2M9HA 2EPFA 2BYVE 2HTSA 4FASD 4XLPF 3JRCA 2F07A 3ON4A 2KMUA 3KP5A 3IUOA 3RYPA 3TO9A 2Y48A 2Y9ZA 2K9LA 4XNFA 2IGNA 2L54A 2VJIA 3RPUD 5J6XA 2XPWA 3L2WA 1HLVA 4B43A 3ASOH 3FBIB 2V1XA 2DFFA 2QYOA 4MFEA 5FO5A 3CCVI 4UVBA 2YU9J 5K7FA 1LPQA 2XGEA 2ZMEC 4EJUA 1S9HA 2HQAA 1IN8A 3NI7A 1TQIA 1D0XA 5HLIA 2ZSHB 4EATA 4DBQA 4I6ZA 2RNGA 3ULQB 3GTOJ 3S2HJ 1DPUA 3Q0VA 4O6JA 3LSMA 1Y1WJ 2CFOA 2PJRA 2QF7A 3C2GA 4XLHA 2F5FA 3QWLA 1USTA 4DOZA 3V78A 1R58A 2A69F 1IN6A 2X6WA 1IXCA 2H8WA 2WAQA 4RA2A 1BIBA 2DT5A 3HIFA 3K1PA 3OYJA 2D5VA 4A0YA 3PQJA 1OMIA 1D0YA 2CYYA 3M8FA 3SQNA 1LQ1A 1SD7A 1ETKA 6PAXA 3DBHB 5ILVA 4G6QA 4MHGA 3E3VA 1LVKA 2FNAA 2IA0A 4K2EA 2ISYA 4UHTA 4MLOA 2C6YA 3V7CA 1J0RA 3E5UA 3P5JA 2WY8Q 2NNYA 3FHZA 5JR3A 2J5OA 4A3MJ 1QZYA 1RKWA 4TV7A 5ED4A 4S0HB 2DYRH 4C3HJ 2HKOA 5CKTA 2Q0OA 2QQAA 4OD4A 3QYEA 1CGPA 2HEOA 2HYFA 5JHFA 2ID3A 4JX4A 3RQIA 2BOLA 4PJLA 1NG7A 1USSA 3HG9A 4HZFA 2Z16A 3ABUA 5DUIA 5F6FA 1IW7F 3PO3J 2R7ZJ 3G6EI 3SDBA 1K83J 3T8RA 1HKQA 5LFAA 3JR9A 2DBBA 1IGNA 2VI6A 3JRDA 1HW5A 2L7FP 2GWRA 4E7SA 3S2WA 1RESA 1TWAJ 4Y13A 3MKWB 2JMWA 1YG2A 1B9MA 1KA8A 1OCPA 4Q47A 1BR1A 4EM0B 1SFEA 2EIMH 3BR2A 4HV5A 2ZJQF 5TRDA 5CXGA 2RREA 3JRIA 3IL2A 4GYGA 4ACIA 3QU3A 2QBYB 4AU7A 3KZZA 4GGGA 4NC6A 2PG4A 4U0YA 1R5HA 2QSFX 4JK1X 1JGGA 2MG4A 1R1UA 4A3KJ 2HYGD 3GBGA 3CCUI 3HTAA 3TMOA 1W1WE 4PDKA 1YITI 3HB9A 4XOPA 2L0KA 4A93J 4YEJA 2VIXA 3FM5A 1JHFA 4A6EA 1F4KA 3S3MA 2EFPA 3GFLA 1J2XA 2X4HA 5E18F 3RI4A 3OYFA 3S14J 5GAEJ 1WFXA 4CYCA 2DQRA 3ZQHA 4L9NA 1B59A 1J75A 3DCFA 3NXCA 1B9NA 3CCMI 1JE8A 3BC8A 2FE3A 2PMUA 3KEQA 3HBLA 5JLWA 3Q0WA 3HTJA 4YRVA 5FMPA 4BDYA 5GP9A 2E2JJ 3IH3A 5BPDA 3H5NA 1HSTA 4AD9A 2R7XA 3E5QA 3AQSA 1T95A 4E7HA 3BJBA 1BN5A 3MCZA 1HDPA 2P7VB 4HSTA 1QGPA 4LGWA 5DCMB 3HKZA 1GLNA 3QP5A 1U0JA 4C9YA 3N4MA 2Y0SA 2VBZA 3BNIA 3QODA 4NQWB 1U6GA 2LBFB 4OU0A 3V42A 4QLCU 5E3MA 1J9IA 4JL3A 1WQ2A 1R4MB 4P96A 2F4MB 2F5EA 3VOEA 3J7AY 4HF0A 5H20A 2AS5F 2HYTA 1KZHA 3KLNA 4BAYA 1VQKI 2F4OB 2P0WA 3LOCA 2QWTA 1HW1A 3G3ZA 1YYVA 4DZPA 1G3YA 5GPCA 2L02A 3HM5A 1WJ5A 3HXLA 2NAZA 2TCTA 4BHCA 2B0LA 3FXKA 1AKHB 4BQNA 2M4GA 2E35A 2V1DA 1OFCX 5IYCJ 1A36A 2QQBA 1JKOC 1BC7C 1AOYA 4A69C 3RTRA 1EV7A 1IN5A 2R7DA 1SD6A 3F72A 1J7KA 1KU9A 5IYDJ 3TOBA 1ZHFA 5FKOA 2L9RA 3ZN1A 1I3QJ 3F6OA 1G6NA 1S6LA 1R36A 2ADUA 2DOFA 3DEEA 4RDUA 4ZYDA 1AWCA 2E5ZA 5BS6A 1WWXA 2K02A 3S15J 2UXUA 2KDZA 1O3SA 4CO8A 4C2MA 3KLOA 2QZ8A 2JA5J 1IDYA 2OAZA 2ZNZA 4BH9A 3GFIA 2HKXA 4L9TA 3R61A 4BXUA 5B3SH 1VTNC 2L9NA 1E3HA 3BTLA 4D5CA 2DI3A 3J7ZI 4EQQA 4BNCA 3OYCA 3W6VA 5HVQC 3D5LA 2R5YB 3RKQA 4N4OB 5CVUA 1I5ZA 2IA2A 2PI0A 2UWMA 1D3YA 3HTUA 1ACIA 2KP6A 3KZIC 4JX6A 4KDPA 2RNJA 2TRTA 3L2UA 1FYMA 3GTQJ 5L3FA 4RGUA 1T56A 1EH7A 2DA6A 4MFDA 5HS9A 2NOJB 2G7GA 2FMYA 4EJTA 1NH3A 1XGMA 2DK8A 2X1DA 2YVHA 1MH3A 1IRZA 3HL2A 2EA4A 4E7ZA 3S17J 3NAUA 3ZQCA 2Y31A 3EPZA 4ICHA 1NTCA 5KK1A 1FP1D 3I56I 1PUFB 1ZH5A 2VB6A 4RB0A 3SJMA 1VQPI 1MD0A 2P6SA 4PSWA 2WTEA 3NNRA 3PASA 2Z33A 3HPHA 5M5WJ 1OCZH 3EUAA 2O03A 4N9IA 1YJ9I 2A5WA 3JTHA 5DEQA 5D8LB 4FTHA 2FBKA 4RB3C 4U9LA 2VC0A 1QVUA 3S16J 1IXSB 3SYTA 4A3IJ 1W4MA 1TNTA 5J3LA 1WH5A 1XGNA 4RB2C 4I2OA 3KP7A 4KICA 2E1NA 4L9JA 4IHYA 2Q24A 1B1BA 1RKTA 3L9FA 1LNWA 5FD5A 4AC6A 2MLKA 4B8XA 3OS1A 1BBYA 1HXDA 2DQLA 1TTYA 3A1YA 4CUGA 4DIQA 2A68F 3I55I 2IVMA 3PSIA 4GO1A 4S05A 4PJNA 3L2QA 5ICFA 4NQWA 2GENA 1XGSA 4LMYA 2O8KA 2HKUA 1DGRM 2ZJRF 1HF0A 5ILUA 3LQQA 2VONA 4KT5C 1JTXA 3KIOA 1RUNA 4BU2A 1X1CA 5ICGA 1O3TA 3OSGA 1Y1VJ 4HRIA 3HRMA 2K9NA 4XKCA 3UNGC 3GVAA 4QSHA 1K4TA 2OZ6A 2W85A 1VQ8I 1GV5A 5KHDA 1TT5B 3VFZA 1U8RA 3BZKA 2O6GE 3BPXA 4YG2F 1FTTA 1SD5A 5BPIA 2PBIA 2KL4A 2NXNB 5CW8A 2DTZA 2XUBA 2K9QA 5D5XB 4ENMA 3CC7I 1QNTA 2L01A 2GM4A 4JQFA 2MABA 2AQEA 2OTJI 2ZOZA 1YW9A 2DG7A 2OI8A 2AQFA 4LJZF 4PZJA 4IL6C 1FWZA 1B72B 4PFOA 4XONA 5E17F 2KHMA 2R7VA 1P2FA 2BW3A 3S2DJ 2IPQX 2JPCA 5F0CA 5CXIA 3FMRA 2H6BA 2QSGX 3OYLA 3G4SI 2XDNA 4ON0A 3JSJA 2CQNA 2VE8A 4LB5A 2DLLA 2O7OA 1G2HA 2CMPA 4WIBA 1BI2A 2D6YA 4EGZA 2CW8A 5D4RA 3WODF 1V5EA 3FXUA 2M34A 3F8FA 4G94A 4XKBA 4B1RA 1ZYRF 3B02A 3C3WA 4G9YA 1HDDC 2DA4A 2MD5A 3JRGA 2LBFA 5EZGA 3BTIA 2EB7A 3I54A 2ISZA 3TO7A 4XRFA 2K5CA 3U9GA 5E1WA 4F3QA 4NC7A 2GZWA 2HQNA 2FOKA 1Z6RA 2W4SA 3OR2C 2PLYA 3CLOA 3DQVC 2VASA 5E3OA 1A35A 5E8GA 2EA2A 2LH9A 3F8MA 1V5GA 3LWFA 3GFMA 1TWFJ 3BWGA 2L2OA 3BCGA 1JUPA 3CF5F 2NVTJ 2B1EA 2LDUA 3PQKA 2DFHA 2HPIA 3DFGA 1K4SA 2X85A 2NX4A 1X1DA 4M71A 1LKXA 2BXZA 2I10A 1MSEC 1WSUA 4M9SA 1B8IB 2VQLA 1K78B 3V8JA 3B6AA 1S7AA 2DYSH 1KYWA 1OPCA 1FIAA 3PFYA 3WTUC 5D5VB 1QVTA 2LG4A 3FZVA 4MEYF 3BR6A 3CUQA 4KMUX 4G7OF 4L5EA 2CV1A 3A0HC 2MW8A 2N8GA 3AL0C 3VVXA 1QPMA 4KA4A 1Z9CA 1O3RA 5FJ8J 2LRDA 3E7LA 4LD5A 3U1KA 2DA2A 5D5UB 3REOA 1YFHA 1ZARA 3VOXA 3IWFA 3SEQA 5ERIA 4IOAF 2EFOA 2FJI1 3OYIA 1P7IA 2M4KA 1UG0A 3C07A 2VODA 1LB2A 4XMYA 4XICA 5TGTA 5B66C 5ICEA 3LSTA 4U0VA 1OR7A 3P9CA 1VQMI 2FF4A 1I6HJ 4LG3A 2QKMB 3RZOJ 1YRNB 4XK4A 1YS7A 4OIRF 2R7SA 5K1YA 4BGDA 1T2KA 5K5RA 2V26A 2WAFA 4GFKA 3GTKJ 1G3TA 1KGSA 3BPVA 3BTCA 2PX9A 3DLAA 3ERMA 1UFMA 2V9VA 5LEJA 3QYFA 3LQRA 1IC8A 1WH7A 3K7AJ 1IZ1A 1IDZA 2ZSIB 2MLGA 2QBYA 1GVDA 1O7LA 3BG3A 5H6QA 1MSFC 2R5ZA 2GBYA 3CMAI 2R7QA 5JVTA 2LK2A 2W53A 3TDZC 3CP8A 3TP0A 1JT0A 2DPDA 1X1PA 1TW3A 2GXAA 1LDDA 4OIPF 2DOAA 3BQZA 1RR8C 1XGOA 1R6RA 5LGUA 1YTYA 1RR7A 2Y2ZA 2VT3A 4E7KA 1D8JA 2CSOA 2ZXIA 1SANA 2XGDA 2R7RA 5F1JA 2XRNA 1ZQ3P 3MNLA 4IHWA 1IAWA 5EG0A 1WKMA 3I64A 1IUYA 5LHGA 2OJED 1S7EA 1I3AA 2M1BA 1JXSA 4HX4A 2ZCNA 1XB4A 3FKIJ 4JYKA 4XSXF 3RH2A 1ETVA 1U2WA 3LMMA 3V6GA 4AUXA 3IC7A 4B44A 5FLVA 2DT7B 4M9XA 4RAFA 1BJZA 1TW2A 1OYWA 2W00A 2K3FA 1AA7A 3L2RA 2ZCWA 1E3PA 2DMNA 2VKHA 3AAFA 4JP0A 3WHBA 5GAGJ 2M2EA 2K9SA 2R7UA 2Z2SB 2ZXJA 3QRFF 2F6CA 2HVQA 5L3BA 2DMTA 2IS2A 3T6NA 1HA8A 4XM3A 3KZYA 3SZPA 3QPTA 4CXFA 2NNNA 3BRUA 2FRHA 3LA2A 4OWRB 2A61A 1TC3C 4MEXF 4XOTA 2QA4I 2KT0A 1MBHA 1LE8A 2R5ZB 3ESWB 3GW2A 3TP3A 2IT0A 4ESBA 1KYZA 1T08B 2CFXA 2FMLA 3PPBA 3WG7H 2D1HA 2CUEA 2JJ7A 2JUCA 5IP9J 3S1MJ 2ME0A 3CUQB 4HV6A 4C2UA 3PO2J 2EFNA 2YUSA 3HTSB 1D5VA 4LIVA 1HKSA 3JW4A 4EJVA 1STZA 3VW2A 3IKVA 5DDGA 1P6RA 1UAAA 2NS7A 4P5OA 4BE0A 1Z67A 1FJLA 1TBXA 3FK6A 3H36A 5EG0B 2JRMA 3D1NI 3KP3A 3DKXA 1X3ZB 3NRGA 1X2NA 1SD4A 3K4JA 1R9TJ 4XIDA 1P4XA 2L4AA 3OS2A 4NB5A 2CV2A 1Z05A 3JREA 3OOPA 5EF6A 3FWEA 5L3DA 2ZNYA 1X3UA 3VYSB 4PJ0C 2FX0A 3DTIA 3JRHA 4J19A 5JVGF 1XMKA 4A3LJ 1EH8A 1Y39A 5HLHA 3WGHA 4CZCA 1YIJI 1YS6A 4NHJA 2CO5A 3LHQA 1C0WA 4IHSA 2XAJA 5J8CA 2OERA 4GCTA 2K85A 2EWNA 1VQ4I 4D1QA 1U9OA 2UXHA 3KKDA 4PSXA 3HHHA 4QPQA 1A6QA 3RKXA 3TL4X 1P9QC 2JWTA 5B1BH 4L0ZB 3CWRA 2R0QC 3C2HA 3QYBA 4M6XA 1L3LA 4IF4A 3CDHA 2MFZA 2BGCA 2ESNA 5FKLA 2HR3A 2VKDA 1IV8A 1XN7A 1UI5A 2ZOYA 3LWJA 4QTRA 2YX4A 3W2VA 1ZGJA 3WU2C 1YRNA 2VKVA 4UUVA 4BQOA 1LVAA 5FRMA 4N4NB 3HRTA 1Y8QB 4M74A 1FBSA 2V4JC 1VI0A 2FSWA 1X4OA 4RAZA 3CJRB 3K6GA 3LSGA 4M73A 3HOSA 3BROA 2QSHX 4M9ZA 5D6EA 1BI3A 2HTJA 2CU7A 4CSWA 3BY6A 4KFCA 2R7TA 2HYJA 3VPRA 1T6SA 5FHPA 2VJJA 3FISA 1H9TA 4BL0B 1PDNC 4PCQA 2KJBA 5IOYA 2M7BA 3J81K 1JKPC 4U87A 1NHAA 1Y6IA 1WRJA 2XF6A 3KYCB 4EJOA 3LSJA 1O3QA 1FSHA 5BQTA 4HDUA 5H6RA 3GTMJ 4GCKA 2DA3A 2FBHA 3H92A 2KISA 1ZELA 3ZPLA 3OR1C 2NP5A 3SXYA 1MNMC 3IAM2 4N9HA 3OS0A 3J7YJ 3L09A 3B73A 2GIZA 5EZHA 4KIBA 2CW0F 2DMQA 3ZGKA 2HPMA 5GPAA 2EV5A 3DWLE 3R4KA 1YW8A 4HKUA 3KFWX 3K1NA 4WF2A 2P5LC 2CS3A 3G7RA 4X0GA 2QKOA 5IY5H 1I6XA 4DYCA 1ZR2A 1SC7A 2VPRA 2Y30A 2EILH 2LY2A 4KN7X 2R7WA 3NRVA 1KU3A 3MZYA 3X2QH 1B6AA 3GTLJ 3R0AA 3VEPA 4Y52J 1ORKA 1UG2A 1OR7C 3OYMA 1G8XA 4UUSA 5FKMA 2EQRA 2COBA 3VOKA 3TGNA 3VYUB 5HNFA 5JHUA 2KJCA 1LE8B 2MSYA 1ERDA 2CQXA 4CCNA 3E6DA 4ZDOA 2Y9YA 1LDJA 2HOEA 2X51A 3BR5A 2R4GA 2VBXA 5FGLA 1QU3A 1LJ9A 2HI3A 3ZN0A 3AG4H 3F8CA 3NQOA 4LK0F 5M5YJ 5EFYA 3ZMTA 3JAMK 2ECCA 1ETOA 5EEAA 4HSRA 3HEFA 3VDXA 2RHAA 4BE1A 2FA5A 1MMDA 4OIQF 1T33A 2FOWA 3PFIA 3ON2A 2E1CA 1HQCA 4F52A 2PMZA 4BACA 5LHIA 3DBLB 2R93J 4YIFA 4E70A 1BOAA 2GOMA 3F21A 1DU0A 4AIKA 4EJWA 3ZCOA 2WC2A 3BR1A 3GXOA 5LLQA 3A4CA 2EIJH 4RS8A 1G4DA 2P6TA 3M8JA 3PIPF 1MBGA 1BC8C 5J40A 5C4JJ 4RGSA 5HDNA 2QLZA 3HYIA 3MKLA 4RB1A 3MFKA 1PUFA 4A3EJ 3M07A 1P7JA 4UDSA 1R5GA 3L2CA 1X1BA 5HS8A 1RZ4A 2VE9A 2IW5A 3OIQA 1D8KA 4OOIA 1MBEA 1VQ5I 5BOXA 1ZG1A 1XD7A 3VTIA 4L0YB 2V9KA 3IAS2 3BQYA 3OL4A 2XDVA 3MD2A 1OYIA 3IWZA 4RM2A 2F4IA 2IP2A 3GO5A 1HBXG 1ZLKA 3J7AO 2QUFA 1XCVA 5ICCA 4M6VA 1PJRA 3F9KA 3KP2A 4EM1A 4F7ZA 1MIJA 4ZDPA 2BY1A 2D45A 2LVSA 1MBFA 3HRUA 1KQ8A 1ETWA 2LYCA 3C7JA 1T98A 4QIWN 5AIPA 1IRGA 1YQAA 2HDCA 3EGQA 1IV6A 3ZMVA 3DU5A 4FQGA 4UB6C 3O8GA 3OIOA 2Z1DA 5BNGA 5IOZA 2YSRA 5IT9K 1AU7A 1DP3A 1RRJA 1FLIA 1YJNI 2JVGA 2A5YB 3S3NA 4AWXB 2RKHA 2DO7A 5JFRA 4BS9A 2Q2EA 4HQEA 1ON1A 4BXFA 1YIOA 2DJIA 4WWCA 5LGTA 3ABKH 3SEZA 4A3DJ 2ZO4A 2OTLI 4I98B 4ITVA 3FDYA 3NWTA 2OQGA 3HTHA 5E3NA 1VQ7I 3VYTB 2EV6A 3BJAA 4AC0A 1MNDA 4B48A 2ZCMA 4LLNA 4ZDLA 3Q9VA 1SFKA 1WGXA 5IT9Z 1FYLA 1ON2A 4KMFA 1MMGA 5F04A 2L9VA 3TW6A 2RDPA 4XRSG 3JCUC 5DCMA 4OD5A 2DTRA 2QVOA 3HPGA 3KCCA 4LIUA 1XS9A 3HTIA 3JSPA 1FBUA 1D1CA 4HOBA 4A3CJ 1W7PD 1ETQA 2HXIA 4C30A 2V6EA 3IUVA 4IVNA 3BLYA 2IU5A 3G1MA 5TJJA 4CCJA 2DXIA 1BOBA 1OJLA 2V57A 2KIMA 2EFQA 1X19A 3SZGA 1XG1A 3S93A 4IQ4A 2IS1A 2R3SA 1YLFA 3VW1A 4C2TA 3O2PE 2IS4A 2Z5UA 5KAFC 3QAHA 3JAMZ 2W82A 4YFXF 2HFHA 2OF7A 1W36D 5DM6F 2PEXA 3K1MA 3Q3SA 1G59A 1LDKB 5HSZA 4AVPA 1ZGAA 4QWQA 4UUTA 5E3LA 2JA8J 5J4YA 1JTYA 1PP8F 1IRFA 1V54H 1CQTA 2DW4A 1FEXA 2UXIA 3AG3H 1FT9A 2ELKA 3CMEI 5CYVA 2VOPA 4GCVA 4XN0A 2FUG2 3CJQB 3S5RA 4IHXA 4UUSB 1Z7UA 4V2GA 3ZQGA 1TWCJ 2HNHA 4JX5A 3J81Z 2M3AA 2V9PA 2E19A 4BY1J 1XSDA 3HSEA 3OY9A 1YO5C 2LREA 5HAWA 2WV0A 2L5QA 4AVZA 1BW5A 2GA1A 3AFHA 3RQ4A 5CVIA 4BBRJ 3CUQC 4ZC3A 1Y8RB 1S29A 2M0MA 4IRIA 3HOUJ 2QTQA 3P9TA 3MAJA 5DAJA 4U9NA 4A5NA 1BM9A 3BG9A 3F0CA 3W3CA 3ZXSA 1LFPA 3E0JB 5DUKA 2G7HA 5IT3A 3JTGA 2E60A 2ESHA 3IRQA 1IG7A 4MXMA 2LKSA 3NS4A 3SDGA 1LUJB 2ZMEA 3WTXC 2ZXWH 3OOUA 4ENKA 3ECOA 3HOVJ 2OZUA 4A3FJ 2STTA 1S3JA 2OV7A 4V19K 2CWEA 2XSDC 2WUIA 2X6XA 2QGUA 1IXRC 4GCLA 3WTYC 4OAZA 4I7HA 5D19A 1W0TA 1EJ9A 1I1GA 3P9KA 3H35A 4RM3A 2DK5A 3RDIA 4CH7A 4EVIA 3F6VA 1Y0NA 3QP6A 2OPTA 4WXDA 4ZYAA 2GAUA 3KZ9A 2DFIA 2E1OA 2QQ9A 2J5PA 1MH4A 2DJNA 2JT1A 2JQ7A 1O7FA 2GUHA 4ME9A 1FZPB 2QOPA 4HYEA 2XSJC 1MZBA 2L7ZA 3G71I 1TP4A 3B6CA 5EGOB 3ZQQA 3O6BB 1FC3A 4DQ2A 4DYRA 1GV2A 3S1NJ 5JLXA 1FTZA 4P55A 3BTJA 1FOWA 3BG5A 3MWMA 1BR4A 1ETXA 5DCFA 4HDVA 3JRFA 2EJRA 2YVXA 3KYLA 2JTVA 3W2WA 4A3JJ 3I3LA 1W5SA 4N0BA 2G7SA 1Y0UA 5CJ9A 4XQFA 1TZLA 2DU9A 2PFBA 2L7KA 3FXLA 2I5UA 2IXSA 1E3OC 4FT8A 4I09A 4C3IJ 3E5XA 2JSCA 3K4CA 3F8BA 4I99C 2CH0A 2IAIA 4FX4A 4B09A 5J1RA 1CF7B 4CCLA 4YELA 4OMYA 4I76A 3W6JB 1N77A 2BHZA 1D5YA 3MQ0A 4KNYA 5FRNA 1XMAA 3PUFA 4IRVA 3UR3C 1DP7P 2H1KA 3PM1A 2ZFUA 1F1ZA 1K6YA 2LF8A 2KRFA 2VJ4A 3ASNH 3B81A 4GFLA 2RGVA 1KU7A 2M45A 4P1WA 3CJDA 4PFPA 3A0BC 5F64A 1L0OC 2DN0A 3M9AA 3AG2H 5J1UA 2TDXA 3MVPA 1BIAA 4LFUA 3F22A 1W7PA 3AG1H 3LAPA 3CO6C 4BQAA 3IP4B 5CVRA 4D5FA 4JOMA 5GAHJ 2AO9A 3HUGB 3HKZN 1U9NA 2PJRB 1A31A 5IP7J 3I4NJ 1ETYA 2FJ1A 2Q1ZB 3CF2A 1D1BA 3LSIA 3WE2A 2UXPA 1RNLA 5GTHC 3GZIA 4XLEA 2YR2A 4CGZA 2LC2A 4DYQA 2M87A 1HOMA 4XLFA 3BJOA 3GEUA 3FXMA 2M0CA 3I71A 4Q48A 4IX7A 3OYDA 1IN4A 2WADA 2GOXB 3CUOA 2KFDA 4MQVA 5J47A 3DTKA 5KCMA 4HW0A 2ME6A 3TOAA 4GRIA 3H3UA 4XL9A 1MMNA 2PQ8A 3EETA 2L3DA 3H9GA 5J8FA 3L00A 2YX7A 2BBYA 2XAHA 3FMQA 2NS8A 4NUBA 4IJAA 3R0JA 3UKGA 1D0ZA 1T8IA 1AKHA 1JI8A 1OQYA 3K4MA 2V1NA 2ELJA 3O8HA 4ZZDA 2XVCA 4U7BA 2A07F 4Z2YA 3R60A 2V7FA 1ZRCA 2ZC2A 3O60A 2COMA 1GXQA 3KEOA 1ODDA 1XSXA 3JRAA 2CQ7A 2VJ5A 3IKTA 1F43A 1RETA 3ZP5A 1R49A 5FROA 3E6BA 2CRGA 4HG2A 2BEOA 4B3AA 2W7NA 1PYVA 4Q5SF 3OYNA 1VQLI 4HF2A 2FBQA 5IP6A 3OYBA 1VQ9I 1XDSA 1FPQA 3F8NA 4E7IA 2JK3A 1ZRDA 4CCKA 1YI2I 3P9IA 1SFXA 1WZ2A 1IN7A 5AONA 1WJDA 2EH3A 1F36A 1ZTRA 4KIFA 2DCEA 2VQCA 5EGOA 1UJ8A 3T5XA 3LSPA 1TWGJ 3ZOBA 1TLHB 2GXGA 2JZYA 3D5SC 4ESJA 1ZRFA 4U7DA 4L9VA 3VWBA 2XHKA 2BXYA 2Z3YA 3S3OA 4C3JJ 4G7ZF 2EZLA 4CYCB 2BV6A 1U3EM 2HVRA 5H2FC 3DEWA 5DD4A 2Y0MA 1OCCH 4WXCA 4YZEA 3H9JA 3KX2A 4KUMA 4XLAA 2A3SA 4KYWA 3D0SA 2UUZA 2REKA 1EH6A 1IF1A 3FXJA 1YE9A 1Z3YA 5F27A 3CCRI 1LFUP 3HOZJ 4IOCF 1VQNI 1P4AA 2RASA 1X1AA 1A04A 2F5CA 4II2A 5FB2A 1VF9A 2QM3A 1AHDP 3OYGA 5FLMJ 5HODA 4UXNA 5CVJA 4NDLA 2OUMA 2VKEA 1J09A 4RAGA 1B8IA 1MBKA 1G3WA 3ZRGA 1ZAOA 4DBRA 3OL3A 2EFWA 1XCBA 3MZ8A 1OCOH 9ANTA 3Q9SA 3MKZA 3TQNA 3KPHA 4R79A 3L7WA 2X0LA 4II3A 1X58A 2PBXA 2V1UA 2MBFA 1BJAA 4D0PA 3H5RA 3HUGA 1UHMA 5ILSA 3GTJJ 2KPMA 5FKKA 1WJAA 3ANGA 1HC8A 3KETA 3SFIA 3SWHA 1GT0C 1MMAA 5HDKA 4Q4ZF 3A01B 2QQ8A 3FF5A 3FXQA 3M1CA 4P9UA 4ZZLA 4HX8A 1FX7A 3RYRA 1ZG3A 2E1MB 2RQQA 1GDTA 2UV1A 4E4HA 4FCYA 3IV5A 5LGNA 3QQAA 4LOCA 1OCRH 1I27A 3C18A 4KIGA 2DDAA 2K4JA 2OU2A 4EM2A 4ENNA 4HBLA 2BHYA 3VVZA 1W7PB 2X6YA 3BZCA 3ONQA 2XB5A 3RZDJ 3GFJA 4IQJA 2BY3A 3C2BA 2FEZA 4HAMA 2DA5A 3O3KA 5E1XA 3OYKA 5TISC 3K69A 1UELB 1XDUA 4XLCA 2W24A 4Z6YA 2P8TA 1A5JA 3GWZA 1JUSA 4LK1F 3CC2I 4OMZA 2LTPA 3I4MJ 2QIBA 1KU2A 4J00A 3LFUA 4MNUA 2JRTA 4BUPA 3KEYA 2H27A 3BG7A 3COLA 2EZIA 4GXOA 1V55H 3TEDA 1ZREA 2MGQA 2LMDA 3LJLA 3WG9A 5CQEA 4BJTA 5K5QA 1FOKA 3K9TA 2GFNA 4HF1A 2YVEA 4NN1A 3VP5A 4DNCA 4IXAA 3PUBA 4BE2A 3IH4A 4EEFG 3CCQI 2FU4A 1MJ9A 2EIKH 2KQRA 4PJMA 4A3BJ 1KQ9A 3QOEA 2A05A 2PFVA 2WAEA 3CCYA 4PGGA 2P4WA 4YFKF 3P7NA 2Y69H 3BOQA 2P5VA 3Q0UA 3VYRB 2EK5A 3QU6A 5K7ZA 3E6MA 3RKYA 5K58A 4CA0A 3PL8A 1R7JA 5B5EC 2LOOA 4DW6A 3CMMA 3M3YJ 2B3WA 3K2ZA 3HSRA 4G8XA 3CJTB 4OAYA 4Y4RA 2CW7A 1S8NA 3CC4I 3CCJI 1JJ8C 2A6HF 2GQQA 2X48A 4HX7A 3ZQLA 4G7HF 4AF5A 3HOTA 1H89C 1WCMJ 2WY7Q 4FHTA 5F08A 2X6OA 3G1LA 5CQGA 5GADJ 3BCAA 1QRYA 1SEUA 4AM3A 1Z21A 2HDDA 1A6IA 2CJJA 4LLLA 1U5TC 1UB9A 1OISA 2LY1A 5FKNA 3QPHA 2UXXA 1H88C 4ZJZA 5F0FA 2STWA 4A6DA 1HSJA 3PNVA 1EA3A 2VL8A 1FYKA 2WWYA 1E17A 3LA7A 2L4MA 1K78A 3M1EA 2IGOA 2XB0X 4HEA2 3U2RA 4O5VA 2G3BA 2XC7A 4ABZA 2Z99A 3DPTA 3V7SA 2NRAC 1K61A 2ZMEB 5CLSA 1P92A 3DPJA 2NVXJ 3CZ6A 4HPQA 1O57A 3ZMUA 4Y3OA 1XX5A 1VNDA 4RGRA 3ZQIA 3GMEA 1I39A 4UV8A 5M3MJ 2O9LA 1HW2A 1I1SA 1I50J 1SFUA 3RIRA 4A0XA 2RAEA 3OYHA 3N97A 2XPVA 2PN6A 2ZKZA 3RPUA 2M30A 4F92B 1QA6A 2F5DA 4BDZA 3MKYB 3GZ6A 4O3MA 3BCBA 1JKRC 4B47A 3KYDB 1SVMA 1F5TA 2VT2A 3ANPA 2F5VA 4BEHA 3S8PA 3A01A 4H0EA 4BXXJ 3M4OJ 1TWHJ 2XGCA 4DVYP 2DMPA 4JKZA 2XF7A 1HCRA 2W25A 3CP2A 1FNNA 5CPRB 4GYIA 2R92J 5EYRA 2LKPA 1R22A 4RLFA 2VC1A 3MMYB 3J80Z 5HBUA 4XRSA 1O4XA 1RPWA 1UMQA 1FP2A 1YX3A 1YOVB 2JPBA 3T1BA 3EYIA 1RUOA 4UNOA 2DFEA 1X4PA 5HLTA 2MH9A 3LA3A 4HNUA 1J59A 3LAJA 2KRCA 3GX4X 3EUKL 2BVLA 2MYSA 2F48A 2BW3B 2KKOA 2LSOA 1YW7A 2PMZN 5HOOA 2BVMA 3U1DA 3RSNA 1FMVA 1XC5A 1VQ6I 4PK4A 4E7JA 5EEHA 5L3CA 4HNTA 2CGPA 3PSFA 4BY7J 2E36A 3CJNA 3H9QA 2W57A 1H0MA 2PMHA 3WTZA 2MC3A 1SVLA 3HHGA 2VXZA 4L5IA 2B9SA
chains in the Genus database with same CATH topology
1JTYA 1CQTA 1BA5A 1UI6A 1FEXA 1POGA 1ZKGA 3VIBA 2YS9A 2UXIA 2HXOA 2ELKA 1QVTA 3BR6A 3S5RA 4IEJA 4UUSB 1JKQC 4IHXA 4L5EA 4V2GA 3ZQGA 1TWCJ 4JX5A 1SGMA 2MW8A 2N8GA 4V2FA 2E19A 4BY1J 2HOSA 3VVXA 4MK6A 5HAWA 5FJ8J 1BW5A 3E7LA 3GTGJ 2DA2A 1BL0A 4BBRJ 3MN2A 2QTQA 3VOXA 2ZB9A 2L7MP 3HOUJ 3P9TA 5DAJA 1LFBA 3BG9A 3F0CA 1P7IA 4M3BA 4RBOA 5IPAA 4FE4A 2QCOA 3C07A 3HE0A 4MO7A 4X6AJ 4XICA 1IG7A 4MXMA 3OSFA 1I6HJ 3SDGA 1OCTC 2IEKA 3RZOJ 2EZHA 1YRNB 4XK4A 3HOVJ 3OOUA 1APLC 4A3FJ 1FIPA 3HOXJ 4GFKA 1SFOJ 3GTKJ 2VUMJ 3BT9A 2WUIA 2XSDC 2LLKA 3BTCA 2DG8A 4A3GJ 1NK3P 3IH2A 4NELA 1IC8A 1WH7A 5M3FJ 4GCLA 3K7AJ 1IDZA 3F1BA 3CQZJ 4M3DA 1ZR4A 3EUPA 5D19A 3H3VK 1GVDA 5C4YA 3BG3A 1W0TA 1MSFC 2DA7A 2M9HA 2GBYA 2R5ZA 3JRCA 2LK2A 3CRJA 2F07A 2W53A 3ON4A 2OPTA 3TP0A 1JT0A 2Y9ZA 3KZ9A 2E1OA 1MH4A 2DJNA 3BQZA 2XPWA 2GUHA 3HOYJ 4ME9A 1HLVA 2QOPA 1RR7A 2Y2ZA 2L7ZA 2ECBA 4MFEA 3B6CA 5EGOB 1SANA 2XGDA 2YU9J 4DYRA 5K7FA 3S1NJ 1GV2A 2XGEA 5F1JA 5JLXA 1ZQ3P 3MNLA 4IHWA 5EG0A 1FTZA 2O7TA 3BTJA 3NI7A 3BG5A 1ETXA 3G56A 2NOGA 1S7EA 3JRFA 3S2HJ 4I6ZA 3GTOJ 1MBJA 2ZCNA 3HGYA 5K7HA 3FKIJ 3Q0VA 4JYKA 3RH2A 1Y1WJ 4A3JJ 1ETVA 3V6GA 4AUXA 2G7SA 2QF7A 5FLVA 1E3OC 1BJZA 4C3IJ 1VFCA 3QKXA 3V78A 3FIWA 3CMYA 2IAIA 4W1UA 5J1RA 2DMNA 4I76A 4JP0A 3WHBA 2D5VA 2M2EA 2K9SA 3HOWJ 1D5YA 5DTDA 1ETKA 2JN6A 2DMTA 3T6NA 2H1KA 3PM1A 3S1QJ 3BRUA 4MLOA 3B81A 2FD5A 1TC3C 4GFLA 2KT0A 1MBHA 1LE8A 2R5ZB 4A3MJ 2JA7J 3CJDA 3E7QA 3TP3A 2HOTA 2DN0A 1RKWA 3PPBA 5J1UA 3ZQFA 2CUEA 3MVPA 2JJ7A 5C3EJ 4S0HB 5IP9J 4C3HJ 3K2AA 5AQCA 4D5FA 3S1MJ 2ME0A 1GUUA 2AO9A 2E2IJ 3PO2J 3HKZN 1U9NA 2YUSA 5IP7J 3I4NJ 1ETYA 2FJ1A 2ID3A 3A02A 4JX4A 3RQIA 2UXPA 3VW2A 3GZIA 2NS7A 1FJLA 3FK6A 5EG0B 4DYQA 3D1NI 3PO3J 2IBDA 2R7ZJ 1HOMA 3GEUA 3NRGA 3L1PA 1X2NA 1K83J 2M0CA 3FK7A 1R9TJ 3JR9A 4BBSJ 4XIDA 3QBMA 3S1RJ 1IGNA 2CUFA 2VI6A 3HDDA 3JRDA 3LNQA 3JREA 2L7FP 2ME6A 1RESA 1TWAJ 2JMWA 5EF6A 5C4XJ 1OCPA 2JA6J 2FX0A 4J19A 3JRHA 2NS8A 4A3LJ 3UKGA 3BR2A 1AKHA 3LHQA 5CXGA 3JRIA 2NVQJ 4ACIA 4GFBA 3O8HA 1JGGA 2OERA 2MG4A 4GCTA 4A3KJ 3O60A 3A03A 3GBGA 1U9OA 3JRAA 3HTAA 2UXHA 1ENHA 3KKDA 1F43A 3HB9A 1RETA 5C44J 2L0KA 4A93J 2JWTA 4CGRA 3CWRA 2R0QC 2CRGA 3S14J 4CYCA 3ZQHA 4B3AA 4X1EA 5FKLA 4AYBN 3NXCA 3DCFA 5IP6A 1UI5A 2FBQA 2ZOYA 3LWJA 4QTRA 2JK3A 1YRNA 3VUQA 3HBLA 2VKVA 5JLWA 3Q0WA 4D7MA 3HTJA 4B4CA 4IHVA 2EH3A 5FMPA 5GP9A 1F36A 1ZTRA 4MIMA 2E2JJ 3IH3A 5EGOA 3LSPA 3AQSA 1TWGJ 1VI0A 3ZOBA 2G0EA 3AQTA 2B63J 3BJBA 1H8AC 1HDPA 3LSGA 4C3JJ 1U78A 2EZLA 4CYCB 5M5XJ 2CU7A 3DEWA 4M3EA 4D7NA 4YZEA 2HYJA 3VPRA 2LKXA 5FHPA 3BNIA 1EF4A 3FISA 2P81A 2REKA 2W48A 1NK2P 4JL3A 5IOYA 2WB1N 5E3MA 3H0GJ 1JKPC 2X9DA 5F27A 1LFUP 3HOZJ 2RASA 2HYTA 3BR3A 3LOCA 2QWTA 1VF9A 1AHDP 5FLMJ 4DZPA 5GPCA 5HODA 3LSJA 3HM5A 2E2HJ 4NDLA 2VKEA 3G1OA 4Y7NJ 1B8IA 2TCTA 1MBKA 2DA3A 3GTMJ 4GCKA 2XPUA 1U8BA 2NP5A 1AKHB 1MNMC 5D1RA 3HGGA 1OFCX 5IYCJ 5EZHA 1JKOC 1WPKA 1JUMA 4A69C 2DMQA 9ANTA 3WHCA 5IYDJ 5GPAA 1X58A 3NARA 2PBXA 4HKUA 5FKOA 2L9RA 3G7RA 1I3QJ 2QKOA 2ZCXA 2LP0A 4DYCA 1ZR2A 2VPRA 2Y30A 3GTJJ 1WI3A 2LFBA 5FKKA 4FISA 3ANGA 4RDUA 3GTLJ 3SFIA 1GT0C 1ZK8A 4C2MJ 2NVYJ 4Y52J 1ORKA 2LR8A 1UG2A 2EBIA 1Z77A 3S15J 3A01B 2KDZA 2UXUA 2HQ5A 4UUSA 5FKMA 3KKCA 2EQRA 2COBA 2JA5J 3VOKA 1GDTA 4FE7A 4FCYA 3IV5A 1IDYA 1IUFA 3QQAA 4DZJA 2MSYA 4LOCA 1LE8B 3GTPJ 2NP3A 3NPIA 2CQXA 4D5CA 3BTLA 2Y9YA 2WGBA 3W6VA 3BR5A 2R5YB 3VVZA 4M3FA 3RKQA 5FGLA 3QPSA 2UXOA 2HI3A 2XB5A 3RZDJ 5EFYA 5M5YJ 3LSRA 4JX6A 3C2BA 2FQ4A 2ECCA 1ETOA 2DA5A 2TRTA 5EEAA 3GTQJ 3BHQA 2ID6A 3HEFA 2RHAA 1T56A 1A5JA 3FRQA 1T33A 1FIAA 2DA6A 4MFDA 3ON2A 1JJ6C 2G7GA 1JUSA 2LTPA 3I4MJ 1JT6A 2QIBA 2YVHA 2R93J 1MH3A 4PXIA 3COLA 1IRZA 1BW6A 3S17J 2EZIA 3TEDA 3NAUA 2WAQN 2Y31A 2MGQA 3ZQCA 1IJWC 1DU0A 3LJLA 3QPLA 4ICHA 1NTCA 3BR1A 2GFNA 2Y0SN 2YVEA 4NN1A 3VP5A 1PUFB 3IH4A 4EEFG 3NNRA 3SJMA 1MBGA 3PASA 5M5WJ 3VVYA 5C4JJ 4A3BJ 3KNWA 3MKLA 1PUFA 4UDSA 4A3EJ 1P7JA 3CCYA 4FTHA 4HNVA 5K7ZA 5K58A 2AHQA 1QVUA 3Q0UA 3S16J 1DU6A 4A3IJ 4DW6A 1MBEA 5J3LA 1WH5A 3M3YJ 2CQQA 4IHYA 4G12A 2Q24A 1RKTA 3BQYA 4AC6A 3VW0A 2PZ9A 1JJ8C 2X48A 4M6VA 3ZQLA 4AF5A 1H89C 1WCMJ 5F08A 2X6OA 3G1LA 2LVSA 1MBFA 1QRYA 1ETWA 2GENA 2HKUA 5IYBJ 2O8KA 1HF0A 1ZGWA 2HDDA 1A6IA 2CJJA 2M8GX 4QIWN 1JTXA 4KWAA 5FKNA 1H88C 5F0FA 1IV6A 3EGQA 3TW7A 3OSGA 1Y1VJ 3O8GA 2K9NA 3OIOA 5D18A 5BNGA 5IOZA 4QSHA 2G7LA 1AU7A 1GV5A 1FTTA 2XB0X 2G3BA 4L62A 4ABZA 1X2MA 1K61A 5CW8A 2DTZA 2K9QA 1B72A 1QPIA 2NVXJ 3DPJA 2GM4A 2DMUA 2ZOZA 2DG7A 2OI8A 1VNDA 5DS9A 5J1YA 3ZQIA 5M3MJ 4A3DJ 1B72B 2O9LA 3S2DJ 5F0HA 5CXIA 5F0CA 1I50J 2H8RA 3HTHA 2RAEA 2XDNA 2XPVA 5E3NA 3JSJA 2O7OA 3BR0A 1G2HA 3HIMA 4AC0A 1ITYA 4JNNA 2ZCMA 1Z0XA 2HOAA 4W97A 1JKRC 2D6YA 3ANPA 1WGXA 2M34A 2R5YA 3A01A 4BXXJ 3M4OJ 1TWHJ 4B1RA 3CDLA 2XGCA 2DA4A 3JRGA 5F04A 5EZGA 2DMPA 1HDDC 3TW6A 3BTIA 4JKZA 4XRSG 1HCRA 4XRMA 1XS9A 3HTIA 4A3CJ 2LY9A 2R92J 1ETQA 5EYRA 2HXIA 4M3GA 3IUVA 5E3OA 2IU5A 3G1MA 5HBUA 4XRSA 1O4XA 1OJLA 1RPWA 1UMQA 2V57A 1Q1VA 2XRLA 1TWFJ 1XG1A 3RD3A 3BCGA 1JUPA 2NVTJ 5EDNA 2GLOA 3VW1A 1UHSA 2NX4A 2PMZN 4BKXA 2OF7A 1XC5A 3Q3SA 2I10A 2EZKA 1MSEC 1W0UA 1B8IB 5HSZA 3JRBA 4BY7J 5H9TA 2K40A 2WV1A 3B6AA 4UUTA 5E3LA 2JA8J 2LD5A 2DA1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JTY A;  1CQT A;  1BA5 A;  1UI6 A;  1FEX A;  1POG A;  1ZKG A;  3VIB A;  2YS9 A;  2UXI A;  2HXO A;  2ELK A;  1QVT A;  3BR6 A;  3S5R A;  4IEJ A;  4UUS B;  1JKQ C;  4IHX A;  4L5E A;  4V2G A;  3ZQG A;  1TWC J;  4JX5 A;  1SGM A;  2MW8 A;  2N8G A;  4V2F A;  2E19 A;  4BY1 J;  2HOS A;  3VVX A;  4MK6 A;  5HAW A;  5FJ8 J;  1BW5 A;  3E7L A;  3GTG J;  2DA2 A;  1BL0 A;  4BBR J;  3MN2 A;  2QTQ A;  3VOX A;  2ZB9 A;  2L7M P;  3HOU J;  3P9T A;  5DAJ A;  1LFB A;  3BG9 A;  3F0C A;  1P7I A;  4M3B A;  4RBO A;  5IPA A;  4FE4 A;  2QCO A;  3C07 A;  3HE0 A;  4MO7 A;  4X6A J;  4XIC A;  1IG7 A;  4MXM A;  3OSF A;  1I6H J;  3SDG A;  1OCT C;  2IEK A;  3RZO J;  2EZH A;  1YRN B;  4XK4 A;  3HOV J;  3OOU A;  1APL C;  4A3F J;  1FIP A;  3HOX J;  4GFK A;  1SFO J;  3GTK J;  2VUM J;  3BT9 A;  2WUI A;  2XSD C;  2LLK A;  3BTC A;  2DG8 A;  4A3G J;  1NK3 P;  3IH2 A;  4NEL A;  1IC8 A;  1WH7 A;  5M3F J;  4GCL A;  3K7A J;  1IDZ A;  3F1B A;  3CQZ J;  4M3D A;  1ZR4 A;  3EUP A;  5D19 A;  3H3V K;  1GVD A;  5C4Y A;  3BG3 A;  1W0T A;  1MSF C;  2DA7 A;  2M9H A;  2GBY A;  2R5Z A;  3JRC A;  2LK2 A;  3CRJ A;  2F07 A;  2W53 A;  3ON4 A;  2OPT A;  3TP0 A;  1JT0 A;  2Y9Z A;  3KZ9 A;  2E1O A;  1MH4 A;  2DJN A;  3BQZ A;  2XPW A;  2GUH A;  3HOY J;  4ME9 A;  1HLV A;  2QOP A;  1RR7 A;  2Y2Z A;  2L7Z A;  2ECB A;  4MFE A;  3B6C A;  5EGO B;  1SAN A;  2XGD A;  2YU9 J;  4DYR A;  5K7F A;  3S1N J;  1GV2 A;  2XGE A;  5F1J A;  5JLX A;  1ZQ3 P;  3MNL A;  4IHW A;  5EG0 A;  1FTZ A;  2O7T A;  3BTJ A;  3NI7 A;  3BG5 A;  1ETX A;  3G56 A;  2NOG A;  1S7E A;  3JRF A;  3S2H J;  4I6Z A;  3GTO J;  1MBJ A;  2ZCN A;  3HGY A;  5K7H A;  3FKI J;  3Q0V A;  4JYK A;  3RH2 A;  1Y1W J;  4A3J J;  1ETV A;  3V6G A;  4AUX A;  2G7S A;  2QF7 A;  5FLV A;  1E3O C;  1BJZ A;  4C3I J;  1VFC A;  3QKX A;  3V78 A;  3FIW A;  3CMY A;  2IAI A;  4W1U A;  5J1R A;  2DMN A;  4I76 A;  4JP0 A;  3WHB A;  2D5V A;  2M2E A;  2K9S A;  3HOW J;  1D5Y A;  5DTD A;  1ETK A;  2JN6 A;  2DMT A;  3T6N A;  2H1K A;  3PM1 A;  3S1Q J;  3BRU A;  4MLO A;  3B81 A;  2FD5 A;  1TC3 C;  4GFL A;  2KT0 A;  1MBH A;  1LE8 A;  2R5Z B;  4A3M J;  2JA7 J;  3CJD A;  3E7Q A;  3TP3 A;  2HOT A;  2DN0 A;  1RKW A;  3PPB A;  5J1U A;  3ZQF A;  2CUE A;  3MVP A;  2JJ7 A;  5C3E J;  4S0H B;  5IP9 J;  4C3H J;  3K2A A;  5AQC A;  4D5F A;  3S1M J;  2ME0 A;  1GUU A;  2AO9 A;  2E2I J;  3PO2 J;  3HKZ N;  1U9N A;  2YUS A;  5IP7 J;  3I4N J;  1ETY A;  2FJ1 A;  2ID3 A;  3A02 A;  4JX4 A;  3RQI A;  2UXP A;  3VW2 A;  3GZI A;  2NS7 A;  1FJL A;  3FK6 A;  5EG0 B;  4DYQ A;  3D1N I;  3PO3 J;  2IBD A;  2R7Z J;  1HOM A;  3GEU A;  3NRG A;  3L1P A;  1X2N A;  1K83 J;  2M0C A;  3FK7 A;  1R9T J;  3JR9 A;  4BBS J;  4XID A;  3QBM A;  3S1R J;  1IGN A;  2CUF A;  2VI6 A;  3HDD A;  3JRD A;  3LNQ A;  3JRE A;  2L7F P;  2ME6 A;  1RES A;  1TWA J;  2JMW A;  5EF6 A;  5C4X J;  1OCP A;  2JA6 J;  2FX0 A;  4J19 A;  3JRH A;  2NS8 A;  4A3L J;  3UKG A;  3BR2 A;  1AKH A;  3LHQ A;  5CXG A;  3JRI A;  2NVQ J;  4ACI A;  4GFB A;  3O8H A;  1JGG A;  2OER A;  2MG4 A;  4GCT A;  4A3K J;  3O60 A;  3A03 A;  3GBG A;  1U9O A;  3JRA A;  3HTA A;  2UXH A;  1ENH A;  3KKD A;  1F43 A;  3HB9 A;  1RET A;  5C44 J;  2L0K A;  4A93 J;  2JWT A;  4CGR A;  3CWR A;  2R0Q C;  2CRG A;  3S14 J;  4CYC A;  3ZQH A;  4B3A A;  4X1E A;  5FKL A;  4AYB N;  3NXC A;  3DCF A;  5IP6 A;  1UI5 A;  2FBQ A;  2ZOY A;  3LWJ A;  4QTR A;  2JK3 A;  1YRN A;  3VUQ A;  3HBL A;  2VKV A;  5JLW A;  3Q0W A;  4D7M A;  3HTJ A;  4B4C A;  4IHV A;  2EH3 A;  5FMP A;  5GP9 A;  1F36 A;  1ZTR A;  4MIM A;  2E2J J;  3IH3 A;  5EGO A;  3LSP A;  3AQS A;  1TWG J;  1VI0 A;  3ZOB A;  2G0E A;  3AQT A;  2B63 J;  3BJB A;  1H8A C;  1HDP A;  3LSG A;  4C3J J;  1U78 A;  2EZL A;  4CYC B;  5M5X J;  2CU7 A;  3DEW A;  4M3E A;  4D7N A;  4YZE A;  2HYJ A;  3VPR A;  2LKX A;  5FHP A;  3BNI A;  1EF4 A;  3FIS A;  2P81 A;  2REK A;  2W48 A;  1NK2 P;  4JL3 A;  5IOY A;  2WB1 N;  5E3M A;  3H0G J;  1JKP C;  2X9D A;  5F27 A;  1LFU P;  3HOZ J;  2RAS A;  2HYT A;  3BR3 A;  3LOC A;  2QWT A;  1VF9 A;  1AHD P;  5FLM J;  4DZP A;  5GPC A;  5HOD A;  3LSJ A;  3HM5 A;  2E2H J;  4NDL A;  2VKE A;  3G1O A;  4Y7N J;  1B8I A;  2TCT A;  1MBK A;  2DA3 A;  3GTM J;  4GCK A;  2XPU A;  1U8B A;  2NP5 A;  1AKH B;  1MNM C;  5D1R A;  3HGG A;  1OFC X;  5IYC J;  5EZH A;  1JKO C;  1WPK A;  1JUM A;  4A69 C;  2DMQ A;  9ANT A;  3WHC A;  5IYD J;  5GPA A;  1X58 A;  3NAR A;  2PBX A;  4HKU A;  5FKO A;  2L9R A;  3G7R A;  1I3Q J;  2QKO A;  2ZCX A;  2LP0 A;  4DYC A;  1ZR2 A;  2VPR A;  2Y30 A;  3GTJ J;  1WI3 A;  2LFB A;  5FKK A;  4FIS A;  3ANG A;  4RDU A;  3GTL J;  3SFI A;  1GT0 C;  1ZK8 A;  4C2M J;  2NVY J;  4Y52 J;  1ORK A;  2LR8 A;  1UG2 A;  2EBI A;  1Z77 A;  3S15 J;  3A01 B;  2KDZ A;  2UXU A;  2HQ5 A;  4UUS A;  5FKM A;  3KKC A;  2EQR A;  2COB A;  2JA5 J;  3VOK A;  1GDT A;  4FE7 A;  4FCY A;  3IV5 A;  1IDY A;  1IUF A;  3QQA A;  4DZJ A;  2MSY A;  4LOC A;  1LE8 B;  3GTP J;  2NP3 A;  3NPI A;  2CQX A;  4D5C A;  3BTL A;  2Y9Y A;  2WGB A;  3W6V A;  3BR5 A;  2R5Y B;  3VVZ A;  4M3F A;  3RKQ A;  5FGL A;  3QPS A;  2UXO A;  2HI3 A;  2XB5 A;  3RZD J;  5EFY A;  5M5Y J;  3LSR A;  4JX6 A;  3C2B A;  2FQ4 A;  2ECC A;  1ETO A;  2DA5 A;  2TRT A;  5EEA A;  3GTQ J;  3BHQ A;  2ID6 A;  3HEF A;  2RHA A;  1T56 A;  1A5J A;  3FRQ A;  1T33 A;  1FIA A;  2DA6 A;  4MFD A;  3ON2 A;  1JJ6 C;  2G7G A;  1JUS A;  2LTP A;  3I4M J;  1JT6 A;  2QIB A;  2YVH A;  2R93 J;  1MH3 A;  4PXI A;  3COL A;  1IRZ A;  1BW6 A;  3S17 J;  2EZI A;  3TED A;  3NAU A;  2WAQ N;  2Y31 A;  2MGQ A;  3ZQC A;  1IJW C;  1DU0 A;  3LJL A;  3QPL A;  4ICH A;  1NTC A;  3BR1 A;  2GFN A;  2Y0S N;  2YVE A;  4NN1 A;  3VP5 A;  1PUF B;  3IH4 A;  4EEF G;  3NNR A;  3SJM A;  1MBG A;  3PAS A;  5M5W J;  3VVY A;  5C4J J;  4A3B J;  3KNW A;  3MKL A;  1PUF A;  4UDS A;  4A3E J;  1P7J A;  3CCY A;  4FTH A;  4HNV A;  5K7Z A;  5K58 A;  2AHQ A;  1QVU A;  3Q0U A;  3S16 J;  1DU6 A;  4A3I J;  4DW6 A;  1MBE A;  5J3L A;  1WH5 A;  3M3Y J;  2CQQ A;  4IHY A;  4G12 A;  2Q24 A;  1RKT A;  3BQY A;  4AC6 A;  3VW0 A;  2PZ9 A;  1JJ8 C;  2X48 A;  4M6V A;  3ZQL A;  4AF5 A;  1H89 C;  1WCM J;  5F08 A;  2X6O A;  3G1L A;  2LVS A;  1MBF A;  1QRY A;  1ETW A;  2GEN A;  2HKU A;  5IYB J;  2O8K A;  1HF0 A;  1ZGW A;  2HDD A;  1A6I A;  2CJJ A;  2M8G X;  4QIW N;  1JTX A;  4KWA A;  5FKN A;  1H88 C;  5F0F A;  1IV6 A;  3EGQ A;  3TW7 A;  3OSG A;  1Y1V J;  3O8G A;  2K9N A;  3OIO A;  5D18 A;  5BNG A;  5IOZ A;  4QSH A;  2G7L A;  1AU7 A;  1GV5 A;  1FTT A;  2XB0 X;  2G3B A;  4L62 A;  4ABZ A;  1X2M A;  1K61 A;  5CW8 A;  2DTZ A;  2K9Q A;  1B72 A;  1QPI A;  2NVX J;  3DPJ A;  2GM4 A;  2DMU A;  2ZOZ A;  2DG7 A;  2OI8 A;  1VND A;  5DS9 A;  5J1Y A;  3ZQI A;  5M3M J;  4A3D J;  1B72 B;  2O9L A;  3S2D J;  5F0H A;  5CXI A;  5F0C A;  1I50 J;  2H8R A;  3HTH A;  2RAE A;  2XDN A;  2XPV A;  5E3N A;  3JSJ A;  2O7O A;  3BR0 A;  1G2H A;  3HIM A;  4AC0 A;  1ITY A;  4JNN A;  2ZCM A;  1Z0X A;  2HOA A;  4W97 A;  1JKR C;  2D6Y A;  3ANP A;  1WGX A;  2M34 A;  2R5Y A;  3A01 A;  4BXX J;  3M4O J;  1TWH J;  4B1R A;  3CDL A;  2XGC A;  2DA4 A;  3JRG A;  5F04 A;  5EZG A;  2DMP A;  1HDD C;  3TW6 A;  3BTI A;  4JKZ A;  4XRS G;  1HCR A;  4XRM A;  1XS9 A;  3HTI A;  4A3C J;  2LY9 A;  2R92 J;  1ETQ A;  5EYR A;  2HXI A;  4M3G A;  3IUV A;  5E3O A;  2IU5 A;  3G1M A;  5HBU A;  4XRS A;  1O4X A;  1OJL A;  1RPW A;  1UMQ A;  2V57 A;  1Q1V A;  2XRL A;  1TWF J;  1XG1 A;  3RD3 A;  3BCG A;  1JUP A;  2NVT J;  5EDN A;  2GLO A;  3VW1 A;  1UHS A;  2NX4 A;  2PMZ N;  4BKX A;  2OF7 A;  1XC5 A;  3Q3S A;  2I10 A;  2EZK A;  1MSE C;  1W0U A;  1B8I B;  5HSZ A;  3JRB A;  4BY7 J;  5H9T A;  2K40 A;  2WV1 A;  3B6A A;  4UUT A;  5E3L A;  2JA8 J;  2LD5 A;  2DA1 A; 
#chains in the Genus database with same CATH topology
 4ZYG A;  2E7W A;  1BA5 A;  1UI6 A;  4MTD A;  1ZKG A;  4H4K C;  4CYD A;  3VIB A;  2HXO A;  4IZZ A;  2CG4 A;  3J80 K;  2DDB A;  4DGW B;  2OA4 A;  2X1C A;  3TO6 A;  2BY0 A;  4IEJ A;  4A5M A;  2BY2 A;  5FFX A;  2GA2 A;  4BHP A;  3C1D A;  2RC4 A;  3LL7 A;  2HOS A;  2XAG A;  3S32 A;  4IRG A;  1LEA A;  1BL0 A;  3MN2 A;  2ZB9 A;  1SMY F;  2L7M P;  3FBN B;  4R1H A;  1FMW A;  4RBO A;  1T0F A;  2E71 A;  4FE4 A;  5E20 A;  3OMY A;  3H3Z A;  1QO0 D;  3OSF A;  1WJF A;  5FGM A;  1OCT C;  2IEK A;  3TDU C;  1MGT A;  1BI1 A;  2G9W A;  3EYY A;  2LF7 A;  4XKV A;  3RPQ A;  3EUH C;  1SFO J;  2H09 A;  1X3W B;  2VUM J;  3I0T A;  2LLK A;  4A3G J;  3IH2 A;  3BJ6 A;  2UZK A;  2VQH A;  3I59 A;  4IO9 F;  5M3F J;  2ZY9 A;  2MH2 A;  1WJE A;  1TNS A;  1Z91 A;  2NS0 A;  3EUP A;  4AIH A;  1KQ0 A;  3H1C A;  3H3V K;  5C4Y A;  2H1L A;  5D6F A;  2DA7 A;  1U5T B;  3CCE I;  2K4B A;  4FX0 A;  4KJZ A;  1SVO A;  3CRJ A;  4ZH4 F;  3IRR A;  2CUZ A;  1RIO H;  1QZZ A;  3DBR B;  2K7L A;  3M7G A;  1XPX A;  2XV4 S;  4I01 A;  1E0E A;  3HOY J;  3RKW A;  1M1E B;  2ECB A;  3K4L A;  1R5I D;  5HLG A;  3GUD A;  1Z1D A;  1DPR A;  1DQU A;  4XN3 A;  4M6Y A;  3DTE A;  1LEB A;  2O7T A;  5LBQ A;  1MKM A;  2RN7 A;  3KE2 A;  3HZJ A;  1QBJ A;  3G56 A;  2NOG A;  5CVV A;  3WE3 A;  2EIN H;  1MBJ A;  3FX3 A;  4IPA A;  3HGY A;  4D9J A;  5K7H A;  5E8I A;  1T39 A;  3DU6 A;  1NG6 A;  1FOX A;  3I5U A;  3ERE D;  2E1M C;  3OWT A;  1VFC A;  3QKX A;  5E79 C;  3FIW A;  3CMY A;  1XMX A;  2ZXH A;  2LD5 A;  4W1U A;  5DM7 F;  1YX5 A;  2CV0 A;  3HOW J;  4OIN F;  3A2K A;  1MMS A;  5DTD A;  3PNY A;  2QWW A;  2DT6 A;  1DGW Y;  2M5W A;  2JN6 A;  4HLX A;  1DUX C;  2F2E A;  3DEU A;  2HQR A;  2FD5 A;  4U0W A;  3R6S A;  1K79 A;  1U5T A;  2JA7 J;  3E7Q A;  2ETH A;  2HOT A;  3DV8 A;  3ZQF A;  4B3X A;  5LD2 C;  4Y15 A;  5D4S A;  5C3E J;  2VXD A;  3KP6 A;  4UVA A;  3G73 A;  3EDP A;  1KON A;  3K2A A;  2QKL B;  5AQC A;  1P4W A;  3I4P A;  3K70 D;  1GUU A;  2E2I J;  2A6T A;  2KZV A;  3A02 A;  3K4K A;  2HZT A;  2JVH A;  4ZTF A;  4NC8 A;  2IBD A;  3F23 A;  1MDM A;  3L1P A;  4UY8 I;  1WJB A;  3FK7 A;  4BBS J;  3QBM A;  4RLQ A;  2O3F A;  3S1R J;  2CUF A;  3HDD A;  2LNB A;  3GF2 A;  4XLN F;  3LNQ A;  4AYB A;  4XBF A;  2HGC A;  4XR6 A;  4F91 B;  5JI6 A;  3DP7 A;  2RVC A;  3W6K B;  4IKF A;  5C4X J;  2X1E A;  3K4N A;  3CD6 I;  3BZ6 A;  5BMZ A;  2B7E A;  2JA6 J;  4JBA A;  4WXH A;  1R23 A;  5E1Z B;  3L2V A;  1ONV A;  2IJL A;  2NVQ J;  5FD6 A;  4GFB A;  5DV5 A;  4YFN F;  4KT6 A;  1EKE A;  4AIJ A;  4KIS A;  4BHB A;  1JHH A;  1WI9 A;  3D5R C;  5HDG A;  3A03 A;  3DPL C;  1TL8 A;  3GEZ A;  3G2B A;  1MW7 A;  1ENH A;  4XSZ F;  4HLY A;  3ZQ7 A;  3CLQ A;  1YJW I;  5C44 J;  3CTA A;  3ABL H;  2KLO A;  2UXN A;  4WX9 A;  2FNP A;  3SHF A;  4CGR A;  3ECH A;  1ZN2 A;  3ELK A;  1V4R A;  3CES A;  2KIQ A;  4IRH A;  2ZJP F;  3COA C;  4A0Z A;  4X1E A;  4AYB N;  1N75 A;  4CCM A;  1REP C;  3FXO A;  3VUQ A;  1PVE A;  3W2A A;  4D7M A;  4P9F A;  4B4C A;  4IHV A;  3I9V 2;  2W84 A;  4MIM A;  4F93 B;  2E7X A;  3RCO A;  2CQK A;  4RAY A;  5EEG A;  1MDM B;  2G0E A;  3AQT A;  2B63 J;  3AL0 B;  1H8A C;  2HWV A;  4Y33 A;  3ISP A;  2HZD A;  1U78 A;  4EV0 A;  5M5X J;  4M3E A;  4D7N A;  2ZFW A;  5LHH A;  2LKX A;  3KP4 A;  2Q8K A;  1EF4 A;  2P81 A;  1F9N A;  2W48 A;  1NK2 P;  1MJA A;  2H6C A;  1T38 A;  2E5N A;  2WB1 N;  3ABM H;  3BP8 A;  3H0G J;  1S72 I;  2X9D A;  1RI7 A;  1V5F A;  4I0A A;  3VSL A;  2OBP A;  3E6C C;  3DLL F;  2IGM A;  3BR3 A;  4IHT A;  4ESF A;  2BE5 F;  4J01 A;  2GIV A;  2E2H J;  3G1O A;  4Y7N J;  2VBW A;  1V3F A;  2XPU A;  3EQL F;  4FET A;  3K0L A;  5A2Q Z;  1U8B A;  2MD0 A;  5GTI C;  5KVR A;  2IRF G;  5D1R A;  2DOD A;  1Y56 A;  3HGG A;  3ML6 A;  1UZC A;  3WTW C;  2O8X A;  3ABT A;  5A2Q K;  2HU9 A;  1WPK A;  1JUM A;  2JSP A;  2XAF A;  3WTV C;  1K7A A;  3WHC A;  3HJE A;  3PNT A;  3V4G A;  5D8K B;  3NAR A;  4CDG A;  2EV0 A;  2NVU B;  1T0F C;  4EGY A;  2ZCX A;  2K3P A;  4YII A;  2LP0 A;  2NYX A;  1QQI A;  1WI3 A;  2LFB A;  4HA8 A;  4FIS A;  2JUG A;  4PGH A;  4MQ9 F;  4E6K G;  1ZK8 A;  1G3S A;  2KZG A;  2NVY J;  2XIG A;  2YPR A;  4C2M J;  4CHU A;  2LR8 A;  2EBI A;  3CCS I;  1Z77 A;  1VZ0 A;  2DAO A;  2HQ5 A;  3OYA A;  3KKC A;  2IGK A;  4FE7 A;  1R1V A;  1IUF A;  4HQM A;  4DZJ A;  2NP3 A;  5K5O A;  3GTP J;  1VQO I;  3NPI A;  2BZT A;  2XGX A;  3LFK A;  3WU0 A;  3ZMZ A;  1QHH D;  2WGB A;  3E97 A;  4LIT A;  4BEH B;  1MJB A;  4YIR X;  4M3F A;  3QPS A;  3VSK A;  2UXO A;  1R00 A;  3V8K A;  3LSR A;  4ZYE A;  4NBQ A;  2FQ4 A;  2OQR A;  1ZG5 A;  3BHQ A;  2ID6 A;  2V79 A;  1H9G A;  3FRQ A;  1N25 A;  1CF7 A;  4U88 A;  1GHC A;  1IO2 A;  1JJ6 C;  1TT0 A;  1UHW A;  3I53 A;  1JT6 A;  1WVR A;  5F1R A;  2QEX I;  3ZR8 X;  2RV8 A;  4MTE A;  1MNE A;  4PXI A;  1BW6 A;  2DPU A;  3H0D A;  2WAQ N;  1UCR A;  1IJW C;  3U21 A;  2FBI A;  1QZE A;  3M8E A;  1R71 A;  3QPL A;  2Y0S N;  3IHU A;  1Z6T A;  2VPL A;  5EJC A;  3WGG A;  2OD5 A;  2ZJ2 A;  2M8E A;  3WU1 B;  2ACJ A;  4I02 A;  1W5T A;  2O61 A;  4UV9 A;  1PUE E;  3VVY A;  3DKW A;  4CCO A;  3K8P C;  3KNW A;  5HNH A;  4QPO A;  4PUS A;  1PP7 U;  2D1V A;  4HNV A;  2Q2E B;  2AHQ A;  4KIT B;  4LLG F;  4Y17 A;  2H94 A;  2KIF A;  1DU6 A;  1FY7 A;  4BJ6 C;  2CQQ A;  4G12 A;  4LG0 A;  5DYM A;  4KN4 X;  4BJ5 C;  4I0B A;  2XAU A;  2A2F X;  1R1T A;  5D5W B;  3VW0 A;  2PZ9 A;  1Q1H A;  2O5R A;  3K4B A;  3E1S A;  2A6E F;  1SMT A;  1FOY A;  3NEU A;  5HS7 A;  3EUH A;  1BR2 A;  1XSV A;  1JGS A;  2DOE A;  4M72 A;  3K70 C;  2XKP A;  3LSK A;  5IYB J;  4A12 A;  2ELH A;  2YU3 A;  1ZGW A;  5LRS A;  2M8G X;  3DF8 A;  4BYY A;  4ZYH A;  1D1A A;  4KWA A;  1SAU A;  3FMS A;  2VLA A;  1XTA A;  2G7U A;  4GDF A;  5B1A H;  3TW7 A;  2OCE A;  4ANJ A;  3WTS C;  3GZN B;  2L9S A;  2VQG A;  2G7L A;  2M7A A;  3LSH A;  2VOO A;  3HRS A;  2JA2 A;  3GCM A;  1GVJ A;  2XRO A;  4L62 A;  1X2M A;  1B72 A;  1QPI A;  5L3G A;  2DMU A;  2KRH A;  3GZ5 A;  4S04 A;  4NNJ A;  2KDO A;  2D2W A;  5DS9 A;  5J1Y A;  3PIO F;  3MZH A;  1B4A A;  2OCC H;  2R7F A;  2K27 A;  5AIQ A;  3ROU A;  3VB2 A;  4G6D A;  1R4N B;  5F0H A;  2HS5 A;  3FXR A;  2WB1 A;  2H8R A;  3CCL I;  1OYY A;  2XAQ A;  3FKJ A;  1WJC A;  4WCG A;  1K6O A;  3V7R A;  3BR0 A;  3WGI A;  2ZBK A;  2RQP A;  2WA0 A;  3HIM A;  1ITY A;  5FLX K;  4JNN A;  3DPU A;  1Z0X A;  2HOA A;  2MA3 A;  4W97 A;  4ASN A;  2Y75 A;  3F3X A;  4PJJ A;  4DJA A;  2R5Y A;  5J4V A;  1IRX A;  3CDL A;  5LRR A;  3HSF A;  2ICW G;  1Z7L A;  4XRM A;  4CZZ A;  2CUJ A;  4ETS A;  3I59 B;  1DDN A;  2HVS A;  3RJP A;  1ULY A;  2LY9 A;  3PJR A;  4M3G A;  4AID A;  2O0Y A;  2VBY A;  2KIU A;  1FSE A;  4MGR A;  1Q1V A;  2XKO A;  2XRL A;  3SFZ A;  3RD3 A;  3T8T A;  4XKW A;  2IA1 A;  3ZMD A;  5EDN A;  2GLO A;  3TBI A;  5LEK A;  1S7O A;  1UHS A;  4R8H A;  4XOR A;  2P5K A;  1BI0 A;  1QHG A;  2QEN A;  5FLX Z;  1W36 C;  3WTT C;  4BKX A;  2IS6 A;  2EZK A;  2OC6 A;  4BQQ A;  3AKZ A;  3CO7 C;  1W0U A;  1OLT A;  4EMS A;  3JRB A;  2W1O A;  2AXT C;  2MC4 A;  2XF5 A;  3QOP A;  3VOD A;  3NWS A;  3TKY A;  3OYE A;  2K40 A;  5H9T A;  1TQP A;  2WV1 A;  4L18 B;  3HC7 A;  4OIO F;  1OKR A;  3S1Q J;  2K9M A;  2DA1 A;  1FBQ A;  1POG A;  1S5L C;  2YS9 A;  3H5A A;  4RGX A;  3OIP A;  1RC9 A;  3V8L A;  2V6C A;  4RMN A;  2I8D A;  1JKQ C;  1SGM A;  4V2F A;  2FXA A;  2AXL A;  3Q5F A;  4MK6 A;  4LG0 B;  4A2U A;  4WK8 F;  3GTG J;  2K86 A;  2GXB A;  3ZMS A;  3GLX A;  2WBM A;  3T0Y A;  1LFB A;  3CDI A;  4M3B A;  1J5Y A;  1Z3X A;  1YHQ I;  5IPA A;  1W5C C;  2QCO A;  4CIC A;  5L3E A;  3HE0 A;  4MO7 A;  2FQ3 A;  4X6A J;  1SAX A;  1E2X A;  2R7O A;  3FM3 A;  4G6T B;  4UVC A;  4L5J A;  2Z9O A;  2EZH A;  3DXJ F;  3GLL A;  5KNL A;  3OV8 A;  2E34 A;  3MEX A;  1APL C;  5DD8 A;  3JSO A;  1FIP A;  3HOX J;  1GXP A;  2HDW A;  1HKT A;  3BDD A;  2XAS A;  3N05 A;  3BT9 A;  4ENJ A;  2P7C B;  4UB8 C;  5KAI C;  4F55 A;  3GYH X;  1NK3 P;  2PJP A;  2DG8 A;  3DKY A;  4NEL A;  3SZT A;  5FFZ A;  5D18 A;  3FHN A;  1ZLJ A;  3I58 A;  3K10 A;  1WHU A;  3F1B A;  2VN2 A;  3CQZ J;  4M3D A;  4E7L A;  1TQM A;  1ZR4 A;  4ZTJ A;  4LB6 B;  1N78 A;  3BG6 A;  2M9H A;  2EPF A;  2BYV E;  2HTS A;  4FAS D;  4XLP F;  3JRC A;  2F07 A;  3ON4 A;  2KMU A;  3KP5 A;  3IUO A;  3RYP A;  3TO9 A;  2Y48 A;  2Y9Z A;  2K9L A;  4XNF A;  2IGN A;  2L54 A;  2VJI A;  3RPU D;  5J6X A;  2XPW A;  3L2W A;  1HLV A;  4B43 A;  3ASO H;  3FBI B;  2V1X A;  2DFF A;  2QYO A;  4MFE A;  5FO5 A;  3CCV I;  4UVB A;  2YU9 J;  5K7F A;  1LPQ A;  2XGE A;  2ZME C;  4EJU A;  1S9H A;  2HQA A;  1IN8 A;  3NI7 A;  1TQI A;  1D0X A;  5HLI A;  2ZSH B;  4EAT A;  4DBQ A;  4I6Z A;  2RNG A;  3ULQ B;  3GTO J;  3S2H J;  1DPU A;  3Q0V A;  4O6J A;  3LSM A;  1Y1W J;  2CFO A;  2PJR A;  2QF7 A;  3C2G A;  4XLH A;  2F5F A;  3QWL A;  1UST A;  4DOZ A;  3V78 A;  1R58 A;  2A69 F;  1IN6 A;  2X6W A;  1IXC A;  2H8W A;  2WAQ A;  4RA2 A;  1BIB A;  2DT5 A;  3HIF A;  3K1P A;  3OYJ A;  2D5V A;  4A0Y A;  3PQJ A;  1OMI A;  1D0Y A;  2CYY A;  3M8F A;  3SQN A;  1LQ1 A;  1SD7 A;  1ETK A;  6PAX A;  3DBH B;  5ILV A;  4G6Q A;  4MHG A;  3E3V A;  1LVK A;  2FNA A;  2IA0 A;  4K2E A;  2ISY A;  4UHT A;  4MLO A;  2C6Y A;  3V7C A;  1J0R A;  3E5U A;  3P5J A;  2WY8 Q;  2NNY A;  3FHZ A;  5JR3 A;  2J5O A;  4A3M J;  1QZY A;  1RKW A;  4TV7 A;  5ED4 A;  4S0H B;  2DYR H;  4C3H J;  2HKO A;  5CKT A;  2Q0O A;  2QQA A;  4OD4 A;  3QYE A;  1CGP A;  2HEO A;  2HYF A;  5JHF A;  2ID3 A;  4JX4 A;  3RQI A;  2BOL A;  4PJL A;  1NG7 A;  1USS A;  3HG9 A;  4HZF A;  2Z16 A;  3ABU A;  5DUI A;  5F6F A;  1IW7 F;  3PO3 J;  2R7Z J;  3G6E I;  3SDB A;  1K83 J;  3T8R A;  1HKQ A;  5LFA A;  3JR9 A;  2DBB A;  1IGN A;  2VI6 A;  3JRD A;  1HW5 A;  2L7F P;  2GWR A;  4E7S A;  3S2W A;  1RES A;  1TWA J;  4Y13 A;  3MKW B;  2JMW A;  1YG2 A;  1B9M A;  1KA8 A;  1OCP A;  4Q47 A;  1BR1 A;  4EM0 B;  1SFE A;  2EIM H;  3BR2 A;  4HV5 A;  2ZJQ F;  5TRD A;  5CXG A;  2RRE A;  3JRI A;  3IL2 A;  4GYG A;  4ACI A;  3QU3 A;  2QBY B;  4AU7 A;  3KZZ A;  4GGG A;  4NC6 A;  2PG4 A;  4U0Y A;  1R5H A;  2QSF X;  4JK1 X;  1JGG A;  2MG4 A;  1R1U A;  4A3K J;  2HYG D;  3GBG A;  3CCU I;  3HTA A;  3TMO A;  1W1W E;  4PDK A;  1YIT I;  3HB9 A;  4XOP A;  2L0K A;  4A93 J;  4YEJ A;  2VIX A;  3FM5 A;  1JHF A;  4A6E A;  1F4K A;  3S3M A;  2EFP A;  3GFL A;  1J2X A;  2X4H A;  5E18 F;  3RI4 A;  3OYF A;  3S14 J;  5GAE J;  1WFX A;  4CYC A;  2DQR A;  3ZQH A;  4L9N A;  1B59 A;  1J75 A;  3DCF A;  3NXC A;  1B9N A;  3CCM I;  1JE8 A;  3BC8 A;  2FE3 A;  2PMU A;  3KEQ A;  3HBL A;  5JLW A;  3Q0W A;  3HTJ A;  4YRV A;  5FMP A;  4BDY A;  5GP9 A;  2E2J J;  3IH3 A;  5BPD A;  3H5N A;  1HST A;  4AD9 A;  2R7X A;  3E5Q A;  3AQS A;  1T95 A;  4E7H A;  3BJB A;  1BN5 A;  3MCZ A;  1HDP A;  2P7V B;  4HST A;  1QGP A;  4LGW A;  5DCM B;  3HKZ A;  1GLN A;  3QP5 A;  1U0J A;  4C9Y A;  3N4M A;  2Y0S A;  2VBZ A;  3BNI A;  3QOD A;  4NQW B;  1U6G A;  2LBF B;  4OU0 A;  3V42 A;  4QLC U;  5E3M A;  1J9I A;  4JL3 A;  1WQ2 A;  1R4M B;  4P96 A;  2F4M B;  2F5E A;  3VOE A;  3J7A Y;  4HF0 A;  5H20 A;  2AS5 F;  2HYT A;  1KZH A;  3KLN A;  4BAY A;  1VQK I;  2F4O B;  2P0W A;  3LOC A;  2QWT A;  1HW1 A;  3G3Z A;  1YYV A;  4DZP A;  1G3Y A;  5GPC A;  2L02 A;  3HM5 A;  1WJ5 A;  3HXL A;  2NAZ A;  2TCT A;  4BHC A;  2B0L A;  3FXK A;  1AKH B;  4BQN A;  2M4G A;  2E35 A;  2V1D A;  1OFC X;  5IYC J;  1A36 A;  2QQB A;  1JKO C;  1BC7 C;  1AOY A;  4A69 C;  3RTR A;  1EV7 A;  1IN5 A;  2R7D A;  1SD6 A;  3F72 A;  1J7K A;  1KU9 A;  5IYD J;  3TOB A;  1ZHF A;  5FKO A;  2L9R A;  3ZN1 A;  1I3Q J;  3F6O A;  1G6N A;  1S6L A;  1R36 A;  2ADU A;  2DOF A;  3DEE A;  4RDU A;  4ZYD A;  1AWC A;  2E5Z A;  5BS6 A;  1WWX A;  2K02 A;  3S15 J;  2UXU A;  2KDZ A;  1O3S A;  4CO8 A;  4C2M A;  3KLO A;  2QZ8 A;  2JA5 J;  1IDY A;  2OAZ A;  2ZNZ A;  4BH9 A;  3GFI A;  2HKX A;  4L9T A;  3R61 A;  4BXU A;  5B3S H;  1VTN C;  2L9N A;  1E3H A;  3BTL A;  4D5C A;  2DI3 A;  3J7Z I;  4EQQ A;  4BNC A;  3OYC A;  3W6V A;  5HVQ C;  3D5L A;  2R5Y B;  3RKQ A;  4N4O B;  5CVU A;  1I5Z A;  2IA2 A;  2PI0 A;  2UWM A;  1D3Y A;  3HTU A;  1ACI A;  2KP6 A;  3KZI C;  4JX6 A;  4KDP A;  2RNJ A;  2TRT A;  3L2U A;  1FYM A;  3GTQ J;  5L3F A;  4RGU A;  1T56 A;  1EH7 A;  2DA6 A;  4MFD A;  5HS9 A;  2NOJ B;  2G7G A;  2FMY A;  4EJT A;  1NH3 A;  1XGM A;  2DK8 A;  2X1D A;  2YVH A;  1MH3 A;  1IRZ A;  3HL2 A;  2EA4 A;  4E7Z A;  3S17 J;  3NAU A;  3ZQC A;  2Y31 A;  3EPZ A;  4ICH A;  1NTC A;  5KK1 A;  1FP1 D;  3I56 I;  1PUF B;  1ZH5 A;  2VB6 A;  4RB0 A;  3SJM A;  1VQP I;  1MD0 A;  2P6S A;  4PSW A;  2WTE A;  3NNR A;  3PAS A;  2Z33 A;  3HPH A;  5M5W J;  1OCZ H;  3EUA A;  2O03 A;  4N9I A;  1YJ9 I;  2A5W A;  3JTH A;  5DEQ A;  5D8L B;  4FTH A;  2FBK A;  4RB3 C;  4U9L A;  2VC0 A;  1QVU A;  3S16 J;  1IXS B;  3SYT A;  4A3I J;  1W4M A;  1TNT A;  5J3L A;  1WH5 A;  1XGN A;  4RB2 C;  4I2O A;  3KP7 A;  4KIC A;  2E1N A;  4L9J A;  4IHY A;  2Q24 A;  1B1B A;  1RKT A;  3L9F A;  1LNW A;  5FD5 A;  4AC6 A;  2MLK A;  4B8X A;  3OS1 A;  1BBY A;  1HXD A;  2DQL A;  1TTY A;  3A1Y A;  4CUG A;  4DIQ A;  2A68 F;  3I55 I;  2IVM A;  3PSI A;  4GO1 A;  4S05 A;  4PJN A;  3L2Q A;  5ICF A;  4NQW A;  2GEN A;  1XGS A;  4LMY A;  2O8K A;  2HKU A;  1DGR M;  2ZJR F;  1HF0 A;  5ILU A;  3LQQ A;  2VON A;  4KT5 C;  1JTX A;  3KIO A;  1RUN A;  4BU2 A;  1X1C A;  5ICG A;  1O3T A;  3OSG A;  1Y1V J;  4HRI A;  3HRM A;  2K9N A;  4XKC A;  3UNG C;  3GVA A;  4QSH A;  1K4T A;  2OZ6 A;  2W85 A;  1VQ8 I;  1GV5 A;  5KHD A;  1TT5 B;  3VFZ A;  1U8R A;  3BZK A;  2O6G E;  3BPX A;  4YG2 F;  1FTT A;  1SD5 A;  5BPI A;  2PBI A;  2KL4 A;  2NXN B;  5CW8 A;  2DTZ A;  2XUB A;  2K9Q A;  5D5X B;  4ENM A;  3CC7 I;  1QNT A;  2L01 A;  2GM4 A;  4JQF A;  2MAB A;  2AQE A;  2OTJ I;  2ZOZ A;  1YW9 A;  2DG7 A;  2OI8 A;  2AQF A;  4LJZ F;  4PZJ A;  4IL6 C;  1FWZ A;  1B72 B;  4PFO A;  4XON A;  5E17 F;  2KHM A;  2R7V A;  1P2F A;  2BW3 A;  3S2D J;  2IPQ X;  2JPC A;  5F0C A;  5CXI A;  3FMR A;  2H6B A;  2QSG X;  3OYL A;  3G4S I;  2XDN A;  4ON0 A;  3JSJ A;  2CQN A;  2VE8 A;  4LB5 A;  2DLL A;  2O7O A;  1G2H A;  2CMP A;  4WIB A;  1BI2 A;  2D6Y A;  4EGZ A;  2CW8 A;  5D4R A;  3WOD F;  1V5E A;  3FXU A;  2M34 A;  3F8F A;  4G94 A;  4XKB A;  4B1R A;  1ZYR F;  3B02 A;  3C3W A;  4G9Y A;  1HDD C;  2DA4 A;  2MD5 A;  3JRG A;  2LBF A;  5EZG A;  3BTI A;  2EB7 A;  3I54 A;  2ISZ A;  3TO7 A;  4XRF A;  2K5C A;  3U9G A;  5E1W A;  4F3Q A;  4NC7 A;  2GZW A;  2HQN A;  2FOK A;  1Z6R A;  2W4S A;  3OR2 C;  2PLY A;  3CLO A;  3DQV C;  2VAS A;  5E3O A;  1A35 A;  5E8G A;  2EA2 A;  2LH9 A;  3F8M A;  1V5G A;  3LWF A;  3GFM A;  1TWF J;  3BWG A;  2L2O A;  3BCG A;  1JUP A;  3CF5 F;  2NVT J;  2B1E A;  2LDU A;  3PQK A;  2DFH A;  2HPI A;  3DFG A;  1K4S A;  2X85 A;  2NX4 A;  1X1D A;  4M71 A;  1LKX A;  2BXZ A;  2I10 A;  1MSE C;  1WSU A;  4M9S A;  1B8I B;  2VQL A;  1K78 B;  3V8J A;  3B6A A;  1S7A A;  2DYS H;  1KYW A;  1OPC A;  1FIA A;  3PFY A;  3WTU C;  5D5V B;  1QVT A;  2LG4 A;  3FZV A;  4MEY F;  3BR6 A;  3CUQ A;  4KMU X;  4G7O F;  4L5E A;  2CV1 A;  3A0H C;  2MW8 A;  2N8G A;  3AL0 C;  3VVX A;  1QPM A;  4KA4 A;  1Z9C A;  1O3R A;  5FJ8 J;  2LRD A;  3E7L A;  4LD5 A;  3U1K A;  2DA2 A;  5D5U B;  3REO A;  1YFH A;  1ZAR A;  3VOX A;  3IWF A;  3SEQ A;  5ERI A;  4IOA F;  2EFO A;  2FJI 1;  3OYI A;  1P7I A;  2M4K A;  1UG0 A;  3C07 A;  2VOD A;  1LB2 A;  4XMY A;  4XIC A;  5TGT A;  5B66 C;  5ICE A;  3LST A;  4U0V A;  1OR7 A;  3P9C A;  1VQM I;  2FF4 A;  1I6H J;  4LG3 A;  2QKM B;  3RZO J;  1YRN B;  4XK4 A;  1YS7 A;  4OIR F;  2R7S A;  5K1Y A;  4BGD A;  1T2K A;  5K5R A;  2V26 A;  2WAF A;  4GFK A;  3GTK J;  1G3T A;  1KGS A;  3BPV A;  3BTC A;  2PX9 A;  3DLA A;  3ERM A;  1UFM A;  2V9V A;  5LEJ A;  3QYF A;  3LQR A;  1IC8 A;  1WH7 A;  3K7A J;  1IZ1 A;  1IDZ A;  2ZSI B;  2MLG A;  2QBY A;  1GVD A;  1O7L A;  3BG3 A;  5H6Q A;  1MSF C;  2R5Z A;  2GBY A;  3CMA I;  2R7Q A;  5JVT A;  2LK2 A;  2W53 A;  3TDZ C;  3CP8 A;  3TP0 A;  1JT0 A;  2DPD A;  1X1P A;  1TW3 A;  2GXA A;  1LDD A;  4OIP F;  2DOA A;  3BQZ A;  1RR8 C;  1XGO A;  1R6R A;  5LGU A;  1YTY A;  1RR7 A;  2Y2Z A;  2VT3 A;  4E7K A;  1D8J A;  2CSO A;  2ZXI A;  1SAN A;  2XGD A;  2R7R A;  5F1J A;  2XRN A;  1ZQ3 P;  3MNL A;  4IHW A;  1IAW A;  5EG0 A;  1WKM A;  3I64 A;  1IUY A;  5LHG A;  2OJE D;  1S7E A;  1I3A A;  2M1B A;  1JXS A;  4HX4 A;  2ZCN A;  1XB4 A;  3FKI J;  4JYK A;  4XSX F;  3RH2 A;  1ETV A;  1U2W A;  3LMM A;  3V6G A;  4AUX A;  3IC7 A;  4B44 A;  5FLV A;  2DT7 B;  4M9X A;  4RAF A;  1BJZ A;  1TW2 A;  1OYW A;  2W00 A;  2K3F A;  1AA7 A;  3L2R A;  2ZCW A;  1E3P A;  2DMN A;  2VKH A;  3AAF A;  4JP0 A;  3WHB A;  5GAG J;  2M2E A;  2K9S A;  2R7U A;  2Z2S B;  2ZXJ A;  3QRF F;  2F6C A;  2HVQ A;  5L3B A;  2DMT A;  2IS2 A;  3T6N A;  1HA8 A;  4XM3 A;  3KZY A;  3SZP A;  3QPT A;  4CXF A;  2NNN A;  3BRU A;  2FRH A;  3LA2 A;  4OWR B;  2A61 A;  1TC3 C;  4MEX F;  4XOT A;  2QA4 I;  2KT0 A;  1MBH A;  1LE8 A;  2R5Z B;  3ESW B;  3GW2 A;  3TP3 A;  2IT0 A;  4ESB A;  1KYZ A;  1T08 B;  2CFX A;  2FML A;  3PPB A;  3WG7 H;  2D1H A;  2CUE A;  2JJ7 A;  2JUC A;  5IP9 J;  3S1M J;  2ME0 A;  3CUQ B;  4HV6 A;  4C2U A;  3PO2 J;  2EFN A;  2YUS A;  3HTS B;  1D5V A;  4LIV A;  1HKS A;  3JW4 A;  4EJV A;  1STZ A;  3VW2 A;  3IKV A;  5DDG A;  1P6R A;  1UAA A;  2NS7 A;  4P5O A;  4BE0 A;  1Z67 A;  1FJL A;  1TBX A;  3FK6 A;  3H36 A;  5EG0 B;  2JRM A;  3D1N I;  3KP3 A;  3DKX A;  1X3Z B;  3NRG A;  1X2N A;  1SD4 A;  3K4J A;  1R9T J;  4XID A;  1P4X A;  2L4A A;  3OS2 A;  4NB5 A;  2CV2 A;  1Z05 A;  3JRE A;  3OOP A;  5EF6 A;  3FWE A;  5L3D A;  2ZNY A;  1X3U A;  3VYS B;  4PJ0 C;  2FX0 A;  3DTI A;  3JRH A;  4J19 A;  5JVG F;  1XMK A;  4A3L J;  1EH8 A;  1Y39 A;  5HLH A;  3WGH A;  4CZC A;  1YIJ I;  1YS6 A;  4NHJ A;  2CO5 A;  3LHQ A;  1C0W A;  4IHS A;  2XAJ A;  5J8C A;  2OER A;  4GCT A;  2K85 A;  2EWN A;  1VQ4 I;  4D1Q A;  1U9O A;  2UXH A;  3KKD A;  4PSX A;  3HHH A;  4QPQ A;  1A6Q A;  3RKX A;  3TL4 X;  1P9Q C;  2JWT A;  5B1B H;  4L0Z B;  3CWR A;  2R0Q C;  3C2H A;  3QYB A;  4M6X A;  1L3L A;  4IF4 A;  3CDH A;  2MFZ A;  2BGC A;  2ESN A;  5FKL A;  2HR3 A;  2VKD A;  1IV8 A;  1XN7 A;  1UI5 A;  2ZOY A;  3LWJ A;  4QTR A;  2YX4 A;  3W2V A;  1ZGJ A;  3WU2 C;  1YRN A;  2VKV A;  4UUV A;  4BQO A;  1LVA A;  5FRM A;  4N4N B;  3HRT A;  1Y8Q B;  4M74 A;  1FBS A;  2V4J C;  1VI0 A;  2FSW A;  1X4O A;  4RAZ A;  3CJR B;  3K6G A;  3LSG A;  4M73 A;  3HOS A;  3BRO A;  2QSH X;  4M9Z A;  5D6E A;  1BI3 A;  2HTJ A;  2CU7 A;  4CSW A;  3BY6 A;  4KFC A;  2R7T A;  2HYJ A;  3VPR A;  1T6S A;  5FHP A;  2VJJ A;  3FIS A;  1H9T A;  4BL0 B;  1PDN C;  4PCQ A;  2KJB A;  5IOY A;  2M7B A;  3J81 K;  1JKP C;  4U87 A;  1NHA A;  1Y6I A;  1WRJ A;  2XF6 A;  3KYC B;  4EJO A;  3LSJ A;  1O3Q A;  1FSH A;  5BQT A;  4HDU A;  5H6R A;  3GTM J;  4GCK A;  2DA3 A;  2FBH A;  3H92 A;  2KIS A;  1ZEL A;  3ZPL A;  3OR1 C;  2NP5 A;  3SXY A;  1MNM C;  3IAM 2;  4N9H A;  3OS0 A;  3J7Y J;  3L09 A;  3B73 A;  2GIZ A;  5EZH A;  4KIB A;  2CW0 F;  2DMQ A;  3ZGK A;  2HPM A;  5GPA A;  2EV5 A;  3DWL E;  3R4K A;  1YW8 A;  4HKU A;  3KFW X;  3K1N A;  4WF2 A;  2P5L C;  2CS3 A;  3G7R A;  4X0G A;  2QKO A;  5IY5 H;  1I6X A;  4DYC A;  1ZR2 A;  1SC7 A;  2VPR A;  2Y30 A;  2EIL H;  2LY2 A;  4KN7 X;  2R7W A;  3NRV A;  1KU3 A;  3MZY A;  3X2Q H;  1B6A A;  3GTL J;  3R0A A;  3VEP A;  4Y52 J;  1ORK A;  1UG2 A;  1OR7 C;  3OYM A;  1G8X A;  4UUS A;  5FKM A;  2EQR A;  2COB A;  3VOK A;  3TGN A;  3VYU B;  5HNF A;  5JHU A;  2KJC A;  1LE8 B;  2MSY A;  1ERD A;  2CQX A;  4CCN A;  3E6D A;  4ZDO A;  2Y9Y A;  1LDJ A;  2HOE A;  2X51 A;  3BR5 A;  2R4G A;  2VBX A;  5FGL A;  1QU3 A;  1LJ9 A;  2HI3 A;  3ZN0 A;  3AG4 H;  3F8C A;  3NQO A;  4LK0 F;  5M5Y J;  5EFY A;  3ZMT A;  3JAM K;  2ECC A;  1ETO A;  5EEA A;  4HSR A;  3HEF A;  3VDX A;  2RHA A;  4BE1 A;  2FA5 A;  1MMD A;  4OIQ F;  1T33 A;  2FOW A;  3PFI A;  3ON2 A;  2E1C A;  1HQC A;  4F52 A;  2PMZ A;  4BAC A;  5LHI A;  3DBL B;  2R93 J;  4YIF A;  4E70 A;  1BOA A;  2GOM A;  3F21 A;  1DU0 A;  4AIK A;  4EJW A;  3ZCO A;  2WC2 A;  3BR1 A;  3GXO A;  5LLQ A;  3A4C A;  2EIJ H;  4RS8 A;  1G4D A;  2P6T A;  3M8J A;  3PIP F;  1MBG A;  1BC8 C;  5J40 A;  5C4J J;  4RGS A;  5HDN A;  2QLZ A;  3HYI A;  3MKL A;  4RB1 A;  3MFK A;  1PUF A;  4A3E J;  3M07 A;  1P7J A;  4UDS A;  1R5G A;  3L2C A;  1X1B A;  5HS8 A;  1RZ4 A;  2VE9 A;  2IW5 A;  3OIQ A;  1D8K A;  4OOI A;  1MBE A;  1VQ5 I;  5BOX A;  1ZG1 A;  1XD7 A;  3VTI A;  4L0Y B;  2V9K A;  3IAS 2;  3BQY A;  3OL4 A;  2XDV A;  3MD2 A;  1OYI A;  3IWZ A;  4RM2 A;  2F4I A;  2IP2 A;  3GO5 A;  1HBX G;  1ZLK A;  3J7A O;  2QUF A;  1XCV A;  5ICC A;  4M6V A;  1PJR A;  3F9K A;  3KP2 A;  4EM1 A;  4F7Z A;  1MIJ A;  4ZDP A;  2BY1 A;  2D45 A;  2LVS A;  1MBF A;  3HRU A;  1KQ8 A;  1ETW A;  2LYC A;  3C7J A;  1T98 A;  4QIW N;  5AIP A;  1IRG A;  1YQA A;  2HDC A;  3EGQ A;  1IV6 A;  3ZMV A;  3DU5 A;  4FQG A;  4UB6 C;  3O8G A;  3OIO A;  2Z1D A;  5BNG A;  5IOZ A;  2YSR A;  5IT9 K;  1AU7 A;  1DP3 A;  1RRJ A;  1FLI A;  1YJN I;  2JVG A;  2A5Y B;  3S3N A;  4AWX B;  2RKH A;  2DO7 A;  5JFR A;  4BS9 A;  2Q2E A;  4HQE A;  1ON1 A;  4BXF A;  1YIO A;  2DJI A;  4WWC A;  5LGT A;  3ABK H;  3SEZ A;  4A3D J;  2ZO4 A;  2OTL I;  4I98 B;  4ITV A;  3FDY A;  3NWT A;  2OQG A;  3HTH A;  5E3N A;  1VQ7 I;  3VYT B;  2EV6 A;  3BJA A;  4AC0 A;  1MND A;  4B48 A;  2ZCM A;  4LLN A;  4ZDL A;  3Q9V A;  1SFK A;  1WGX A;  5IT9 Z;  1FYL A;  1ON2 A;  4KMF A;  1MMG A;  5F04 A;  2L9V A;  3TW6 A;  2RDP A;  4XRS G;  3JCU C;  5DCM A;  4OD5 A;  2DTR A;  2QVO A;  3HPG A;  3KCC A;  4LIU A;  1XS9 A;  3HTI A;  3JSP A;  1FBU A;  1D1C A;  4HOB A;  4A3C J;  1W7P D;  1ETQ A;  2HXI A;  4C30 A;  2V6E A;  3IUV A;  4IVN A;  3BLY A;  2IU5 A;  3G1M A;  5TJJ A;  4CCJ A;  2DXI A;  1BOB A;  1OJL A;  2V57 A;  2KIM A;  2EFQ A;  1X19 A;  3SZG A;  1XG1 A;  3S93 A;  4IQ4 A;  2IS1 A;  2R3S A;  1YLF A;  3VW1 A;  4C2T A;  3O2P E;  2IS4 A;  2Z5U A;  5KAF C;  3QAH A;  3JAM Z;  2W82 A;  4YFX F;  2HFH A;  2OF7 A;  1W36 D;  5DM6 F;  2PEX A;  3K1M A;  3Q3S A;  1G59 A;  1LDK B;  5HSZ A;  4AVP A;  1ZGA A;  4QWQ A;  4UUT A;  5E3L A;  2JA8 J;  5J4Y A;  1JTY A;  1PP8 F;  1IRF A;  1V54 H;  1CQT A;  2DW4 A;  1FEX A;  2UXI A;  3AG3 H;  1FT9 A;  2ELK A;  3CME I;  5CYV A;  2VOP A;  4GCV A;  4XN0 A;  2FUG 2;  3CJQ B;  3S5R A;  4IHX A;  4UUS B;  1Z7U A;  4V2G A;  3ZQG A;  1TWC J;  2HNH A;  4JX5 A;  3J81 Z;  2M3A A;  2V9P A;  2E19 A;  4BY1 J;  1XSD A;  3HSE A;  3OY9 A;  1YO5 C;  2LRE A;  5HAW A;  2WV0 A;  2L5Q A;  4AVZ A;  1BW5 A;  2GA1 A;  3AFH A;  3RQ4 A;  5CVI A;  4BBR J;  3CUQ C;  4ZC3 A;  1Y8R B;  1S29 A;  2M0M A;  4IRI A;  3HOU J;  2QTQ A;  3P9T A;  3MAJ A;  5DAJ A;  4U9N A;  4A5N A;  1BM9 A;  3BG9 A;  3F0C A;  3W3C A;  3ZXS A;  1LFP A;  3E0J B;  5DUK A;  2G7H A;  5IT3 A;  3JTG A;  2E60 A;  2ESH A;  3IRQ A;  1IG7 A;  4MXM A;  2LKS A;  3NS4 A;  3SDG A;  1LUJ B;  2ZME A;  3WTX C;  2ZXW H;  3OOU A;  4ENK A;  3ECO A;  3HOV J;  2OZU A;  4A3F J;  2STT A;  1S3J A;  2OV7 A;  4V19 K;  2CWE A;  2XSD C;  2WUI A;  2X6X A;  2QGU A;  1IXR C;  4GCL A;  3WTY C;  4OAZ A;  4I7H A;  5D19 A;  1W0T A;  1EJ9 A;  1I1G A;  3P9K A;  3H35 A;  4RM3 A;  2DK5 A;  3RDI A;  4CH7 A;  4EVI A;  3F6V A;  1Y0N A;  3QP6 A;  2OPT A;  4WXD A;  4ZYA A;  2GAU A;  3KZ9 A;  2DFI A;  2E1O A;  2QQ9 A;  2J5P A;  1MH4 A;  2DJN A;  2JT1 A;  2JQ7 A;  1O7F A;  2GUH A;  4ME9 A;  1FZP B;  2QOP A;  4HYE A;  2XSJ C;  1MZB A;  2L7Z A;  3G71 I;  1TP4 A;  3B6C A;  5EGO B;  3ZQQ A;  3O6B B;  1FC3 A;  4DQ2 A;  4DYR A;  1GV2 A;  3S1N J;  5JLX A;  1FTZ A;  4P55 A;  3BTJ A;  1FOW A;  3BG5 A;  3MWM A;  1BR4 A;  1ETX A;  5DCF A;  4HDV A;  3JRF A;  2EJR A;  2YVX A;  3KYL A;  2JTV A;  3W2W A;  4A3J J;  3I3L A;  1W5S A;  4N0B A;  2G7S A;  1Y0U A;  5CJ9 A;  4XQF A;  1TZL A;  2DU9 A;  2PFB A;  2L7K A;  3FXL A;  2I5U A;  2IXS A;  1E3O C;  4FT8 A;  4I09 A;  4C3I J;  3E5X A;  2JSC A;  3K4C A;  3F8B A;  4I99 C;  2CH0 A;  2IAI A;  4FX4 A;  4B09 A;  5J1R A;  1CF7 B;  4CCL A;  4YEL A;  4OMY A;  4I76 A;  3W6J B;  1N77 A;  2BHZ A;  1D5Y A;  3MQ0 A;  4KNY A;  5FRN A;  1XMA A;  3PUF A;  4IRV A;  3UR3 C;  1DP7 P;  2H1K A;  3PM1 A;  2ZFU A;  1F1Z A;  1K6Y A;  2LF8 A;  2KRF A;  2VJ4 A;  3ASN H;  3B81 A;  4GFL A;  2RGV A;  1KU7 A;  2M45 A;  4P1W A;  3CJD A;  4PFP A;  3A0B C;  5F64 A;  1L0O C;  2DN0 A;  3M9A A;  3AG2 H;  5J1U A;  2TDX A;  3MVP A;  1BIA A;  4LFU A;  3F22 A;  1W7P A;  3AG1 H;  3LAP A;  3CO6 C;  4BQA A;  3IP4 B;  5CVR A;  4D5F A;  4JOM A;  5GAH J;  2AO9 A;  3HUG B;  3HKZ N;  1U9N A;  2PJR B;  1A31 A;  5IP7 J;  3I4N J;  1ETY A;  2FJ1 A;  2Q1Z B;  3CF2 A;  1D1B A;  3LSI A;  3WE2 A;  2UXP A;  1RNL A;  5GTH C;  3GZI A;  4XLE A;  2YR2 A;  4CGZ A;  2LC2 A;  4DYQ A;  2M87 A;  1HOM A;  4XLF A;  3BJO A;  3GEU A;  3FXM A;  2M0C A;  3I71 A;  4Q48 A;  4IX7 A;  3OYD A;  1IN4 A;  2WAD A;  2GOX B;  3CUO A;  2KFD A;  4MQV A;  5J47 A;  3DTK A;  5KCM A;  4HW0 A;  2ME6 A;  3TOA A;  4GRI A;  3H3U A;  4XL9 A;  1MMN A;  2PQ8 A;  3EET A;  2L3D A;  3H9G A;  5J8F A;  3L00 A;  2YX7 A;  2BBY A;  2XAH A;  3FMQ A;  2NS8 A;  4NUB A;  4IJA A;  3R0J A;  3UKG A;  1D0Z A;  1T8I A;  1AKH A;  1JI8 A;  1OQY A;  3K4M A;  2V1N A;  2ELJ A;  3O8H A;  4ZZD A;  2XVC A;  4U7B A;  2A07 F;  4Z2Y A;  3R60 A;  2V7F A;  1ZRC A;  2ZC2 A;  3O60 A;  2COM A;  1GXQ A;  3KEO A;  1ODD A;  1XSX A;  3JRA A;  2CQ7 A;  2VJ5 A;  3IKT A;  1F43 A;  1RET A;  3ZP5 A;  1R49 A;  5FRO A;  3E6B A;  2CRG A;  4HG2 A;  2BEO A;  4B3A A;  2W7N A;  1PYV A;  4Q5S F;  3OYN A;  1VQL I;  4HF2 A;  2FBQ A;  5IP6 A;  3OYB A;  1VQ9 I;  1XDS A;  1FPQ A;  3F8N A;  4E7I A;  2JK3 A;  1ZRD A;  4CCK A;  1YI2 I;  3P9I A;  1SFX A;  1WZ2 A;  1IN7 A;  5AON A;  1WJD A;  2EH3 A;  1F36 A;  1ZTR A;  4KIF A;  2DCE A;  2VQC A;  5EGO A;  1UJ8 A;  3T5X A;  3LSP A;  1TWG J;  3ZOB A;  1TLH B;  2GXG A;  2JZY A;  3D5S C;  4ESJ A;  1ZRF A;  4U7D A;  4L9V A;  3VWB A;  2XHK A;  2BXY A;  2Z3Y A;  3S3O A;  4C3J J;  4G7Z F;  2EZL A;  4CYC B;  2BV6 A;  1U3E M;  2HVR A;  5H2F C;  3DEW A;  5DD4 A;  2Y0M A;  1OCC H;  4WXC A;  4YZE A;  3H9J A;  3KX2 A;  4KUM A;  4XLA A;  2A3S A;  4KYW A;  3D0S A;  2UUZ A;  2REK A;  1EH6 A;  1IF1 A;  3FXJ A;  1YE9 A;  1Z3Y A;  5F27 A;  3CCR I;  1LFU P;  3HOZ J;  4IOC F;  1VQN I;  1P4A A;  2RAS A;  1X1A A;  1A04 A;  2F5C A;  4II2 A;  5FB2 A;  1VF9 A;  2QM3 A;  1AHD P;  3OYG A;  5FLM J;  5HOD A;  4UXN A;  5CVJ A;  4NDL A;  2OUM A;  2VKE A;  1J09 A;  4RAG A;  1B8I A;  1MBK A;  1G3W A;  3ZRG A;  1ZAO A;  4DBR A;  3OL3 A;  2EFW A;  1XCB A;  3MZ8 A;  1OCO H;  9ANT A;  3Q9S A;  3MKZ A;  3TQN A;  3KPH A;  4R79 A;  3L7W A;  2X0L A;  4II3 A;  1X58 A;  2PBX A;  2V1U A;  2MBF A;  1BJA A;  4D0P A;  3H5R A;  3HUG A;  1UHM A;  5ILS A;  3GTJ J;  2KPM A;  5FKK A;  1WJA A;  3ANG A;  1HC8 A;  3KET A;  3SFI A;  3SWH A;  1GT0 C;  1MMA A;  5HDK A;  4Q4Z F;  3A01 B;  2QQ8 A;  3FF5 A;  3FXQ A;  3M1C A;  4P9U A;  4ZZL A;  4HX8 A;  1FX7 A;  3RYR A;  1ZG3 A;  2E1M B;  2RQQ A;  1GDT A;  2UV1 A;  4E4H A;  4FCY A;  3IV5 A;  5LGN A;  3QQA A;  4LOC A;  1OCR H;  1I27 A;  3C18 A;  4KIG A;  2DDA A;  2K4J A;  2OU2 A;  4EM2 A;  4ENN A;  4HBL A;  2BHY A;  3VVZ A;  1W7P B;  2X6Y A;  3BZC A;  3ONQ A;  2XB5 A;  3RZD J;  3GFJ A;  4IQJ A;  2BY3 A;  3C2B A;  2FEZ A;  4HAM A;  2DA5 A;  3O3K A;  5E1X A;  3OYK A;  5TIS C;  3K69 A;  1UEL B;  1XDU A;  4XLC A;  2W24 A;  4Z6Y A;  2P8T A;  1A5J A;  3GWZ A;  1JUS A;  4LK1 F;  3CC2 I;  4OMZ A;  2LTP A;  3I4M J;  2QIB A;  1KU2 A;  4J00 A;  3LFU A;  4MNU A;  2JRT A;  4BUP A;  3KEY A;  2H27 A;  3BG7 A;  3COL A;  2EZI A;  4GXO A;  1V55 H;  3TED A;  1ZRE A;  2MGQ A;  2LMD A;  3LJL A;  3WG9 A;  5CQE A;  4BJT A;  5K5Q A;  1FOK A;  3K9T A;  2GFN A;  4HF1 A;  2YVE A;  4NN1 A;  3VP5 A;  4DNC A;  4IXA A;  3PUB A;  4BE2 A;  3IH4 A;  4EEF G;  3CCQ I;  2FU4 A;  1MJ9 A;  2EIK H;  2KQR A;  4PJM A;  4A3B J;  1KQ9 A;  3QOE A;  2A05 A;  2PFV A;  2WAE A;  3CCY A;  4PGG A;  2P4W A;  4YFK F;  3P7N A;  2Y69 H;  3BOQ A;  2P5V A;  3Q0U A;  3VYR B;  2EK5 A;  3QU6 A;  5K7Z A;  3E6M A;  3RKY A;  5K58 A;  4CA0 A;  3PL8 A;  1R7J A;  5B5E C;  2LOO A;  4DW6 A;  3CMM A;  3M3Y J;  2B3W A;  3K2Z A;  3HSR A;  4G8X A;  3CJT B;  4OAY A;  4Y4R A;  2CW7 A;  1S8N A;  3CC4 I;  3CCJ I;  1JJ8 C;  2A6H F;  2GQQ A;  2X48 A;  4HX7 A;  3ZQL A;  4G7H F;  4AF5 A;  3HOT A;  1H89 C;  1WCM J;  2WY7 Q;  4FHT A;  5F08 A;  2X6O A;  3G1L A;  5CQG A;  5GAD J;  3BCA A;  1QRY A;  1SEU A;  4AM3 A;  1Z21 A;  2HDD A;  1A6I A;  2CJJ A;  4LLL A;  1U5T C;  1UB9 A;  1OIS A;  2LY1 A;  5FKN A;  3QPH A;  2UXX A;  1H88 C;  4ZJZ A;  5F0F A;  2STW A;  4A6D A;  1HSJ A;  3PNV A;  1EA3 A;  2VL8 A;  1FYK A;  2WWY A;  1E17 A;  3LA7 A;  2L4M A;  1K78 A;  3M1E A;  2IGO A;  2XB0 X;  4HEA 2;  3U2R A;  4O5V A;  2G3B A;  2XC7 A;  4ABZ A;  2Z99 A;  3DPT A;  3V7S A;  2NRA C;  1K61 A;  2ZME B;  5CLS A;  1P92 A;  3DPJ A;  2NVX J;  3CZ6 A;  4HPQ A;  1O57 A;  3ZMU A;  4Y3O A;  1XX5 A;  1VND A;  4RGR A;  3ZQI A;  3GME A;  1I39 A;  4UV8 A;  5M3M J;  2O9L A;  1HW2 A;  1I1S A;  1I50 J;  1SFU A;  3RIR A;  4A0X A;  2RAE A;  3OYH A;  3N97 A;  2XPV A;  2PN6 A;  2ZKZ A;  3RPU A;  2M30 A;  4F92 B;  1QA6 A;  2F5D A;  4BDZ A;  3MKY B;  3GZ6 A;  4O3M A;  3BCB A;  1JKR C;  4B47 A;  3KYD B;  1SVM A;  1F5T A;  2VT2 A;  3ANP A;  2F5V A;  4BEH A;  3S8P A;  3A01 A;  4H0E A;  4BXX J;  3M4O J;  1TWH J;  2XGC A;  4DVY P;  2DMP A;  4JKZ A;  2XF7 A;  1HCR A;  2W25 A;  3CP2 A;  1FNN A;  5CPR B;  4GYI A;  2R92 J;  5EYR A;  2LKP A;  1R22 A;  4RLF A;  2VC1 A;  3MMY B;  3J80 Z;  5HBU A;  4XRS A;  1O4X A;  1RPW A;  1UMQ A;  1FP2 A;  1YX3 A;  1YOV B;  2JPB A;  3T1B A;  3EYI A;  1RUO A;  4UNO A;  2DFE A;  1X4P A;  5HLT A;  2MH9 A;  3LA3 A;  4HNU A;  1J59 A;  3LAJ A;  2KRC A;  3GX4 X;  3EUK L;  2BVL A;  2MYS A;  2F48 A;  2BW3 B;  2KKO A;  2LSO A;  1YW7 A;  2PMZ N;  5HOO A;  2BVM A;  3U1D A;  3RSN A;  1FMV A;  1XC5 A;  1VQ6 I;  4PK4 A;  4E7J A;  5EEH A;  5L3C A;  4HNT A;  2CGP A;  3PSF A;  4BY7 J;  2E36 A;  3CJN A;  3H9Q A;  2W57 A;  1H0M A;  2PMH A;  3WTZ A;  2MC3 A;  1SVL A;  3HHG A;  2VXZ A;  4L5I A;  2B9S A; 
#chains in the Genus database with same CATH homology
 1JTY A;  1CQT A;  1BA5 A;  1UI6 A;  1FEX A;  1POG A;  1ZKG A;  3VIB A;  2YS9 A;  2UXI A;  2HXO A;  2ELK A;  1QVT A;  3BR6 A;  3S5R A;  4IEJ A;  4UUS B;  1JKQ C;  4IHX A;  4L5E A;  4V2G A;  3ZQG A;  1TWC J;  4JX5 A;  1SGM A;  2MW8 A;  2N8G A;  4V2F A;  2E19 A;  4BY1 J;  2HOS A;  3VVX A;  4MK6 A;  5HAW A;  5FJ8 J;  1BW5 A;  3E7L A;  3GTG J;  2DA2 A;  1BL0 A;  4BBR J;  3MN2 A;  2QTQ A;  3VOX A;  2ZB9 A;  2L7M P;  3HOU J;  3P9T A;  5DAJ A;  1LFB A;  3BG9 A;  3F0C A;  1P7I A;  4M3B A;  4RBO A;  5IPA A;  4FE4 A;  2QCO A;  3C07 A;  3HE0 A;  4MO7 A;  4X6A J;  4XIC A;  1IG7 A;  4MXM A;  3OSF A;  1I6H J;  3SDG A;  1OCT C;  2IEK A;  3RZO J;  2EZH A;  1YRN B;  4XK4 A;  3HOV J;  3OOU A;  1APL C;  4A3F J;  1FIP A;  3HOX J;  4GFK A;  1SFO J;  3GTK J;  2VUM J;  3BT9 A;  2WUI A;  2XSD C;  2LLK A;  3BTC A;  2DG8 A;  4A3G J;  1NK3 P;  3IH2 A;  4NEL A;  1IC8 A;  1WH7 A;  5M3F J;  4GCL A;  3K7A J;  1IDZ A;  3F1B A;  3CQZ J;  4M3D A;  1ZR4 A;  3EUP A;  5D19 A;  3H3V K;  1GVD A;  5C4Y A;  3BG3 A;  1W0T A;  1MSF C;  2DA7 A;  2M9H A;  2GBY A;  2R5Z A;  3JRC A;  2LK2 A;  3CRJ A;  2F07 A;  2W53 A;  3ON4 A;  2OPT A;  3TP0 A;  1JT0 A;  2Y9Z A;  3KZ9 A;  2E1O A;  1MH4 A;  2DJN A;  3BQZ A;  2XPW A;  2GUH A;  3HOY J;  4ME9 A;  1HLV A;  2QOP A;  1RR7 A;  2Y2Z A;  2L7Z A;  2ECB A;  4MFE A;  3B6C A;  5EGO B;  1SAN A;  2XGD A;  2YU9 J;  4DYR A;  5K7F A;  3S1N J;  1GV2 A;  2XGE A;  5F1J A;  5JLX A;  1ZQ3 P;  3MNL A;  4IHW A;  5EG0 A;  1FTZ A;  2O7T A;  3BTJ A;  3NI7 A;  3BG5 A;  1ETX A;  3G56 A;  2NOG A;  1S7E A;  3JRF A;  3S2H J;  4I6Z A;  3GTO J;  1MBJ A;  2ZCN A;  3HGY A;  5K7H A;  3FKI J;  3Q0V A;  4JYK A;  3RH2 A;  1Y1W J;  4A3J J;  1ETV A;  3V6G A;  4AUX A;  2G7S A;  2QF7 A;  5FLV A;  1E3O C;  1BJZ A;  4C3I J;  1VFC A;  3QKX A;  3V78 A;  3FIW A;  3CMY A;  2IAI A;  4W1U A;  5J1R A;  2DMN A;  4I76 A;  4JP0 A;  3WHB A;  2D5V A;  2M2E A;  2K9S A;  3HOW J;  1D5Y A;  5DTD A;  1ETK A;  2JN6 A;  2DMT A;  3T6N A;  2H1K A;  3PM1 A;  3S1Q J;  3BRU A;  4MLO A;  3B81 A;  2FD5 A;  1TC3 C;  4GFL A;  2KT0 A;  1MBH A;  1LE8 A;  2R5Z B;  4A3M J;  2JA7 J;  3CJD A;  3E7Q A;  3TP3 A;  2HOT A;  2DN0 A;  1RKW A;  3PPB A;  5J1U A;  3ZQF A;  2CUE A;  3MVP A;  2JJ7 A;  5C3E J;  4S0H B;  5IP9 J;  4C3H J;  3K2A A;  5AQC A;  4D5F A;  3S1M J;  2ME0 A;  1GUU A;  2AO9 A;  2E2I J;  3PO2 J;  3HKZ N;  1U9N A;  2YUS A;  5IP7 J;  3I4N J;  1ETY A;  2FJ1 A;  2ID3 A;  3A02 A;  4JX4 A;  3RQI A;  2UXP A;  3VW2 A;  3GZI A;  2NS7 A;  1FJL A;  3FK6 A;  5EG0 B;  4DYQ A;  3D1N I;  3PO3 J;  2IBD A;  2R7Z J;  1HOM A;  3GEU A;  3NRG A;  3L1P A;  1X2N A;  1K83 J;  2M0C A;  3FK7 A;  1R9T J;  3JR9 A;  4BBS J;  4XID A;  3QBM A;  3S1R J;  1IGN A;  2CUF A;  2VI6 A;  3HDD A;  3JRD A;  3LNQ A;  3JRE A;  2L7F P;  2ME6 A;  1RES A;  1TWA J;  2JMW A;  5EF6 A;  5C4X J;  1OCP A;  2JA6 J;  2FX0 A;  4J19 A;  3JRH A;  2NS8 A;  4A3L J;  3UKG A;  3BR2 A;  1AKH A;  3LHQ A;  5CXG A;  3JRI A;  2NVQ J;  4ACI A;  4GFB A;  3O8H A;  1JGG A;  2OER A;  2MG4 A;  4GCT A;  4A3K J;  3O60 A;  3A03 A;  3GBG A;  1U9O A;  3JRA A;  3HTA A;  2UXH A;  1ENH A;  3KKD A;  1F43 A;  3HB9 A;  1RET A;  5C44 J;  2L0K A;  4A93 J;  2JWT A;  4CGR A;  3CWR A;  2R0Q C;  2CRG A;  3S14 J;  4CYC A;  3ZQH A;  4B3A A;  4X1E A;  5FKL A;  4AYB N;  3NXC A;  3DCF A;  5IP6 A;  1UI5 A;  2FBQ A;  2ZOY A;  3LWJ A;  4QTR A;  2JK3 A;  1YRN A;  3VUQ A;  3HBL A;  2VKV A;  5JLW A;  3Q0W A;  4D7M A;  3HTJ A;  4B4C A;  4IHV A;  2EH3 A;  5FMP A;  5GP9 A;  1F36 A;  1ZTR A;  4MIM A;  2E2J J;  3IH3 A;  5EGO A;  3LSP A;  3AQS A;  1TWG J;  1VI0 A;  3ZOB A;  2G0E A;  3AQT A;  2B63 J;  3BJB A;  1H8A C;  1HDP A;  3LSG A;  4C3J J;  1U78 A;  2EZL A;  4CYC B;  5M5X J;  2CU7 A;  3DEW A;  4M3E A;  4D7N A;  4YZE A;  2HYJ A;  3VPR A;  2LKX A;  5FHP A;  3BNI A;  1EF4 A;  3FIS A;  2P81 A;  2REK A;  2W48 A;  1NK2 P;  4JL3 A;  5IOY A;  2WB1 N;  5E3M A;  3H0G J;  1JKP C;  2X9D A;  5F27 A;  1LFU P;  3HOZ J;  2RAS A;  2HYT A;  3BR3 A;  3LOC A;  2QWT A;  1VF9 A;  1AHD P;  5FLM J;  4DZP A;  5GPC A;  5HOD A;  3LSJ A;  3HM5 A;  2E2H J;  4NDL A;  2VKE A;  3G1O A;  4Y7N J;  1B8I A;  2TCT A;  1MBK A;  2DA3 A;  3GTM J;  4GCK A;  2XPU A;  1U8B A;  2NP5 A;  1AKH B;  1MNM C;  5D1R A;  3HGG A;  1OFC X;  5IYC J;  5EZH A;  1JKO C;  1WPK A;  1JUM A;  4A69 C;  2DMQ A;  9ANT A;  3WHC A;  5IYD J;  5GPA A;  1X58 A;  3NAR A;  2PBX A;  4HKU A;  5FKO A;  2L9R A;  3G7R A;  1I3Q J;  2QKO A;  2ZCX A;  2LP0 A;  4DYC A;  1ZR2 A;  2VPR A;  2Y30 A;  3GTJ J;  1WI3 A;  2LFB A;  5FKK A;  4FIS A;  3ANG A;  4RDU A;  3GTL J;  3SFI A;  1GT0 C;  1ZK8 A;  4C2M J;  2NVY J;  4Y52 J;  1ORK A;  2LR8 A;  1UG2 A;  2EBI A;  1Z77 A;  3S15 J;  3A01 B;  2KDZ A;  2UXU A;  2HQ5 A;  4UUS A;  5FKM A;  3KKC A;  2EQR A;  2COB A;  2JA5 J;  3VOK A;  1GDT A;  4FE7 A;  4FCY A;  3IV5 A;  1IDY A;  1IUF A;  3QQA A;  4DZJ A;  2MSY A;  4LOC A;  1LE8 B;  3GTP J;  2NP3 A;  3NPI A;  2CQX A;  4D5C A;  3BTL A;  2Y9Y A;  2WGB A;  3W6V A;  3BR5 A;  2R5Y B;  3VVZ A;  4M3F A;  3RKQ A;  5FGL A;  3QPS A;  2UXO A;  2HI3 A;  2XB5 A;  3RZD J;  5EFY A;  5M5Y J;  3LSR A;  4JX6 A;  3C2B A;  2FQ4 A;  2ECC A;  1ETO A;  2DA5 A;  2TRT A;  5EEA A;  3GTQ J;  3BHQ A;  2ID6 A;  3HEF A;  2RHA A;  1T56 A;  1A5J A;  3FRQ A;  1T33 A;  1FIA A;  2DA6 A;  4MFD A;  3ON2 A;  1JJ6 C;  2G7G A;  1JUS A;  2LTP A;  3I4M J;  1JT6 A;  2QIB A;  2YVH A;  2R93 J;  1MH3 A;  4PXI A;  3COL A;  1IRZ A;  1BW6 A;  3S17 J;  2EZI A;  3TED A;  3NAU A;  2WAQ N;  2Y31 A;  2MGQ A;  3ZQC A;  1IJW C;  1DU0 A;  3LJL A;  3QPL A;  4ICH A;  1NTC A;  3BR1 A;  2GFN A;  2Y0S N;  2YVE A;  4NN1 A;  3VP5 A;  1PUF B;  3IH4 A;  4EEF G;  3NNR A;  3SJM A;  1MBG A;  3PAS A;  5M5W J;  3VVY A;  5C4J J;  4A3B J;  3KNW A;  3MKL A;  1PUF A;  4UDS A;  4A3E J;  1P7J A;  3CCY A;  4FTH A;  4HNV A;  5K7Z A;  5K58 A;  2AHQ A;  1QVU A;  3Q0U A;  3S16 J;  1DU6 A;  4A3I J;  4DW6 A;  1MBE A;  5J3L A;  1WH5 A;  3M3Y J;  2CQQ A;  4IHY A;  4G12 A;  2Q24 A;  1RKT A;  3BQY A;  4AC6 A;  3VW0 A;  2PZ9 A;  1JJ8 C;  2X48 A;  4M6V A;  3ZQL A;  4AF5 A;  1H89 C;  1WCM J;  5F08 A;  2X6O A;  3G1L A;  2LVS A;  1MBF A;  1QRY A;  1ETW A;  2GEN A;  2HKU A;  5IYB J;  2O8K A;  1HF0 A;  1ZGW A;  2HDD A;  1A6I A;  2CJJ A;  2M8G X;  4QIW N;  1JTX A;  4KWA A;  5FKN A;  1H88 C;  5F0F A;  1IV6 A;  3EGQ A;  3TW7 A;  3OSG A;  1Y1V J;  3O8G A;  2K9N A;  3OIO A;  5D18 A;  5BNG A;  5IOZ A;  4QSH A;  2G7L A;  1AU7 A;  1GV5 A;  1FTT A;  2XB0 X;  2G3B A;  4L62 A;  4ABZ A;  1X2M A;  1K61 A;  5CW8 A;  2DTZ A;  2K9Q A;  1B72 A;  1QPI A;  2NVX J;  3DPJ A;  2GM4 A;  2DMU A;  2ZOZ A;  2DG7 A;  2OI8 A;  1VND A;  5DS9 A;  5J1Y A;  3ZQI A;  5M3M J;  4A3D J;  1B72 B;  2O9L A;  3S2D J;  5F0H A;  5CXI A;  5F0C A;  1I50 J;  2H8R A;  3HTH A;  2RAE A;  2XDN A;  2XPV A;  5E3N A;  3JSJ A;  2O7O A;  3BR0 A;  1G2H A;  3HIM A;  4AC0 A;  1ITY A;  4JNN A;  2ZCM A;  1Z0X A;  2HOA A;  4W97 A;  1JKR C;  2D6Y A;  3ANP A;  1WGX A;  2M34 A;  2R5Y A;  3A01 A;  4BXX J;  3M4O J;  1TWH J;  4B1R A;  3CDL A;  2XGC A;  2DA4 A;  3JRG A;  5F04 A;  5EZG A;  2DMP A;  1HDD C;  3TW6 A;  3BTI A;  4JKZ A;  4XRS G;  1HCR A;  4XRM A;  1XS9 A;  3HTI A;  4A3C J;  2LY9 A;  2R92 J;  1ETQ A;  5EYR A;  2HXI A;  4M3G A;  3IUV A;  5E3O A;  2IU5 A;  3G1M A;  5HBU A;  4XRS A;  1O4X A;  1OJL A;  1RPW A;  1UMQ A;  2V57 A;  1Q1V A;  2XRL A;  1TWF J;  1XG1 A;  3RD3 A;  3BCG A;  1JUP A;  2NVT J;  5EDN A;  2GLO A;  3VW1 A;  1UHS A;  2NX4 A;  2PMZ N;  4BKX A;  2OF7 A;  1XC5 A;  3Q3S A;  2I10 A;  2EZK A;  1MSE C;  1W0U A;  1B8I B;  5HSZ A;  3JRB A;  4BY7 J;  5H9T A;  2K40 A;  2WV1 A;  3B6A A;  4UUT A;  5E3L A;  2JA8 J;  2LD5 A;  2DA1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...