2QCOA

Crystal structure of the transcriptional regulator cmer from campylobacter jejuni
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
202
structure length
202
Chain Sequence
TPSQKVLARQEKIKAVALELFLTKGYQETSLSDIIKLSGGSYSNIYDGFKSKEGLFFEILDDICKKHFHLIYSKTQEIKNGTLKEILTSFGLAFIEIFNQPEAVAFGKIIYSQVYDKDRHLANWIENNQQNFSYNILMGFFKQQNNSYMKKNAEKLAVLFCTMLKEPYHHLNVLINAPLKNKKEQKEHVEFVVNVFLNGINS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CmeR
publication title Crystal structure of the transcriptional regulator CmeR from Campylobacter jejuni.
pubmed doi rcsb
source organism Campylobacter jejuni
molecule tags Transcription
total genus 66
structure length 202
sequence length 202
ec nomenclature
pdb deposition date 2007-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2qcoA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2qcoA02
2L7MP 2DA1A 2G7GA 1PUFA 5GP9A 3DEWA 1G2HA 2QKOA 2JN6A 5C3EJ 4JX5A 2UXUA 3IH2A 5F0CA 3GBGA 2LD5A 3S1QJ 3ANPA 2ID3A 3HB9A 2GM4A 2HI3A 2O7TA 4M3EA 2NS8A 2EQRA 3QPLA 1T33A 3HTJA 3VW2A 3OSGA 3C2BA 4FTHA 2VKVA 3QQAA 3E7LA 3JRAA 3NARA 3AQSA 3S2HJ 2O9LA 3IH3A 3F0CA 3HOXJ 1IJWC 3PM1A 5IOYA 3HM5A 3RQIA 2E2IJ 5M3FJ 2XGDA 1ZR2A 2WV1A 4BBSJ 3HTHA 3FIWA 3CMYA 3NI7A 2B63J 2XRLA 3LHQA 3G1OA 2QOPA 1VI0A 5HSZA 2O7OA 1I6HJ 3NPIA 5EDNA 4XRSA 2L7FP 3UKGA 1HDDC 2AO9A 4XRMA 4ME9A 2RHAA 4MIMA 2HOTA 1BW6A 4PXIA 3ZQGA 4GCLA 2GUHA 1JJ6C 1IDZA 5FKMA 1BA5A 4HKUA 2FD5A 1ETQA 4DZPA 4NDLA 1ORKA 3ZQFA 2P81A 2O8KA 3BTLA 2PBXA 1U9OA 4M3GA 2E2JJ 3JSJA 3ZQIA 2HXIA 2IEKA 1VNDA 1AU7A 3O8GA 5M5YJ 3VP5A 3VIBA 1DU6A 4D7MA 4A3JJ 3NAUA 2NOGA 2EZIA 5H9TA 5CXGA 3BTCA 2G7LA 3V6GA 3VPRA 3IH4A 5AQCA 2ZCXA 1MBEA 2M2EA 5IYCJ 2Y2ZA 1F36A 1IUFA 5K58A 4A3GJ 1H88C 2UXHA 1RKWA 5F27A 3B81A 1A6IA 4ICHA 2Q24A 4JNNA 2HDDA 5K7FA 3I4NJ 2L0KA 2QF7A 3LOCA 2X9DA 2R5YB 3FK6A 4V2FA 5F04A 4BKXA 4D5CA 4C3IJ 5C4XJ 4B1RA 2JMWA 4NN1A 3SFIA 2FX0A 5F0HA 2DMTA 1ZKGA 2K9NA 4FCYA 2QIBA 1GT0C 2HYTA 2PZ9A 2WGBA 2K40A 4L5EA 1QRYA 1RKTA 3I4MJ 1ETYA 3GZIA 1H8AC 2IAIA 2LFBA 3TEDA 3QBMA 4Y7NJ 4V2GA 4J19A 1VF9A 1O4XA 1Y1VJ 4A3CJ 4BY7J 1D5YA 1Z0XA 1FJLA 2L7ZA 2PMZN 3LSGA 4FISA 3WHCA 2CJJA 3S16J 3HIMA 5M5WJ 1P7IA 1GV5A 1WH7A 3HOWJ 3BR2A 1MNMC 3RH2A 5J1UA 3TP0A 5FLVA 2D5VA 3ON2A 3F1BA 1U78A 2ZCMA 2ZB9A 1RPWA 5FJ8J 1HOMA 3RZDJ 5FKLA 3HOVJ 3Q0WA 2MW8A 1HCRA 1UI6A 5EFYA 2IU5A 3IUVA 2XGCA 4RDUA 3ON4A 1IDYA 1HDPA 4A3FJ 2NVTJ 4IHYA 3HOUJ 3B6CA 1MBGA 4D5FA 3S17J 2JA6J 5EGOB 3HE0A 5IP7J 2Y9ZA 3QKXA 3TW7A 1B72A 3HOYJ 4IHXA 2UXPA 4GFKA 2XB5A 1IC8A 1MSFC 2EZHA 2DA4A 5IPAA 3M4OJ 3S5RA 4AC6A 5FMPA 3OOUA 5EG0A 3VOXA 1JUSA 4A3DJ 1PUFB 2REKA 2R5ZA 3BQZA 2M8GX 1WPKA 4IEJA 4M3DA 3MNLA 1ETKA 4MO7A 3VOKA 1TWAJ 3A01A 1AKHA 4A3EJ 3OIOA 3BQYA 1W0TA 2H1KA 2XPWA 2LLKA 3BCGA 2DA3A 3KZ9A 2K9QA 2YVHA 4KWAA 3VVXA 2ME0A 1MSEC 1BL0A 5M3MJ 3TP3A 4BBRJ 3S1RJ 3BR0A 1ETWA 2JK3A 1E3OC 1MBFA 5EEAA 1UG2A 2GFNA 1SGMA 2Y0SN 3JRCA 1BJZA 1W0UA 2ZCNA 5JLXA 1X2NA 2I10A 2NP5A 4W1UA 2R0QC 2DMUA 4MK6A 2E2HJ 4DYRA 1CQTA 2UXIA 1TWHJ 5C4YA 4C3HJ 3L1PA 2ME6A 3ZOBA 4ACIA 2DMQA 4EEFG 4A3MJ 3FKIJ 5HODA 3PO3J 1GUUA 2HYJA 4M3FA 4UUTA 2FBQA 2OI8A 3FISA 3E7QA 2MSYA 2XSDC 2TCTA 5EF6A 2AHQA 4RBOA 1LFUP 3S1MJ 3CCYA 1MH3A 2K9SA 2LTPA 3HBLA 3BNIA 2DTZA 1GDTA 2EZLA 2M9HA 2DN0A 1WH5A 1YRNA 1XG1A 2YU9J 2V57A 5EYRA 2Y30A 2GENA 3BHQA 2DA6A 2NP3A 2LVSA 1WGXA 4AUXA 3C07A 1B8IA 5CW8A 4LOCA 1SFOJ 5GPAA 1JT0A 2XPVA 1TWFJ 5GPCA 5D1RA 4XRSG 4CYCA 5J3LA 3DPJA 5IYBJ 1H89C 2HOSA 1UHSA 4JL3A 1APLC 1ZGWA 1IG7A 3JRBA 5IOZA 3HDDA 3IV5A 2G7SA 3HTIA 3JRDA 3BG3A 3RD3A 2G3BA 3G7RA 2E19A 5F1JA 2EH3A 1FIAA 2DA5A 5FLMJ 2HXOA 5HAWA 2RAEA 2VKEA 2HQ5A 2EZKA 1VFCA 2DA7A 1JKQC 3S2DJ 5BNGA 1ETVA 1OCTC 3S14J 1IV6A 3WHBA 2UXOA 3HGGA 3GTQJ 2ECCA 2JA5J 2VPRA 3TW6A 1QVUA 1A5JA 2QTQA 3GTOJ 3JRFA 2NVYJ 3GTKJ 1TWGJ 3BR3A 1K83J 3O60A 1IGNA 2Y31A 2RASA 3HKZN 2ECBA 2JWTA 4A3IJ 1NK2P 1JTYA 4MXMA 3JRIA 3S1NJ 3MKLA 3ZQLA 1I3QJ 4CGRA 3H0GJ 4JKZA 4YZEA 1F43A 1SANA 1LE8A 3BR5A 4A3LJ 1BW5A 2LK2A 3MN2A 3LSJA 1TC3C 3G56A 3HGYA 2W48A 3GTGJ 2ZOYA 5DS9A 4A69C 2VUMJ 2EBIA 4UUSA 5FKOA 4MFDA 3GTJJ 2LP0A 5D19A 3KKCA 3T6NA 5DAJA 2L9RA 1ZR4A 4A93J 1X2MA 4ABZA 1ITYA 3CWRA 4G12A 3Q0VA 4BY1J 3KKDA 3LSPA 1U9NA 2XGEA 2DMNA 5EZGA 5JLWA 4IHVA 2FQ4A 1GV2A 4L62A 1JKPC 3CJDA 2KDZA 2TRTA 2JJ7A 1B72B 4M6VA 3LSRA 2DG8A 1Q1VA 3B6AA 1JJ8C 3BR1A 2MG4A 2WAQN 1K61A 5IP6A 4I6ZA 5IP9J 1RR7A 4DZJA 2X48A 1RETA 3G1MA 5EG0B 3ZQCA 1NK3P 5FKNA 4GFLA 2R5ZB 1JUPA 4DYCA 4JX6A 3PPBA 3S15J 4HNVA 1Y1WJ 2W53A 3A01B 1AKHB 4A3BJ 3VUQA 1I50J 3CQZJ 2XPUA 3FRQA 1WCMJ 3P9TA 3W6VA 2OF7A 1X58A 3BT9A 2JA8J 4JP0A 4X6AJ 1S7EA 5E3LA 1XC5A 2E1OA 2KT0A 4QIWN 2NX4A 3EUPA 4XK4A 3D1NI 3GTPJ 1JGGA 3K2AA 4JYKA 4X1EA 4UDSA 2F07A 5CXIA 2DMPA 1LFBA 3JR9A 2XDNA 2OERA 4XICA 1JTXA 2WUIA 5FGLA 1FIPA 1ENHA 4M3BA 3AQTA 2R92J 3EGQA 5J1RA 1UI5A 4B4CA 2ELKA 3ANGA 2HOAA 2LY9A 3JRGA 4W97A 2YUSA 5M5XJ 3SDGA 4GFBA 2HKUA 3HTAA 2R93J 5E3MA 3FK7A 3SJMA 2FJ1A 5E3NA 1RESA 2ID6A 1WI3A 2Y9YA 1MH4A 1T56A 1JKRC 1MBJA 1JT6A 4MFEA 2NVQJ 3VVYA 3BG5A 5EZHA 3NRGA 3VW1A 1MBKA 3Q0UA 2OPTA 4S0HB 2M34A 4D7NA 3BJBA 3RZOJ 3QPSA 1YRNB 1MBHA 2CRGA 2LKXA 1ETOA 2JA7J 1ETXA 4AC0A 3LWJA 3NXCA 3OSFA 5FKKA 3VW0A 3BTJA 4DW6A 1B8IB 1OCPA 4C3JJ 5J1YA 2GLOA 4AF5A 1QPIA 4CYCB 3BTIA 4QTRA 9ANTA 2DG7A 3V78A 4AYBN 2XB0X 3G1LA 2MGQA 3GEUA 3PASA 1FTZA 5F0FA 4BXXJ 1ZK8A 4Y52J 1JKOC 2CU7A 3O8HA 1QVTA 1P7JA 2LR8A 1FEXA 3KNWA 5F08A 2CUFA 1JUMA 1UMQA 2CQXA 2YS9A 3JREA 3M3YJ 2DJNA 1EF4A 3ZQHA 2N8GA 1ZQ3P 3H3VK 2R5YA 1ZTRA 1FTTA 3BRUA 3LJLA 4GCTA 4MLOA 2YVEA 3CRJA 1OJLA 2NS7A 5C44J 2COBA 1AHDP 2GBYA 2NVXJ 3JRHA 2QCOA 3LNQA 3VVZA 4QSHA 3NNRA 1R9TJ 3MVPA 5C4JJ 3GTMJ 2G0EA 2WB1N 1IRZA 3COLA 1DU0A 2DA2A 3K7AJ 1POGA 2CQQA 3HOZJ 2R7ZJ 3RKQA 3A03A 1TWCJ 1U8BA 5K7HA 2ZOZA 1LE8B 5HBUA 2IBDA 4XIDA 1Z77A 3HEFA 5IYDJ 5K7ZA 3BG9A 1XS9A 3DCFA 2CUEA 4FE4A 4UUSB 4B3AA 3BR6A 2QWTA 5FHPA 1HF0A 4NELA 5D18A 2H8RA 1OFCX 3CDLA 1GVDA 1HLVA 2VI6A 3A02A 5E3OA 5DTDA 5EGOA 4GCKA 4IHWA 3Q3SA 1NTCA 4DYQA 2M0CA 3GTLJ 4FE7A 4C2MJ 4A3KJ 2X6OA 4I76A 2D6YA 4JX4A 3PO2J
chains in the Genus database with same CATH superfamily
3O2PE 2VPLA 2DA1A 3RPUD 5L3GA 2P5LC 2G7GA 1PUFA 1Z21A 4B44A 3G6EI 3HTSB 3CP8A 2QKOA 2RNJA 4UY8I 2LH9A 1LJ9A 1X3WB 5JI6A 1WJDA 2LD5A 2GM4A 3CTAA 3EDPA 2NS8A 3F72A 5EEHA 3P7NA 3E3VA 3C2BA 1R5HA 3R0JA 1VQ8I 3A1YA 3LSTA 4YRVA 3JRAA 4F92B 1QU3A 2XAUA 5GTHC 3IH3A 3SFZA 1IJWC 4HX7A 5CVVA 1VQOI 4GO1A 4XRFA 1W4MA 1XTAA 4F3QA 1G59A 3RQIA 4X0GA 5M3FJ 5E1ZB 2IS1A 3BJAA 3OOPA 2VODA 1R1TA 3HTHA 3D5RC 2K02A 5D8LB 4I02A 3KZYA 3FIWA 4UNOA 1AOYA 2H09A 2B63J 3WGGA 3N97A 3KP7A 3V42A 4UUVA 5D5UB 2GZWA 2KJBA 3NPIA 5EDNA 1WJEA 1V54H 4ZC3A 3M8EA 4RB1A 1V4RA 2E1MB 2P6SA 1DGRM 4KIBA 4LIVA 4MIMA 1G3SA 2NOJB 4GCLA 5FKMA 1NHAA 2W25A 3DTEA 3GWZA 3O6BB 3CO7C 3HIFA 3ZQFA 2JVGA 1S3JA 2PBXA 4M3GA 2HXIA 4AIHA 4BXUA 2ZY9A 5M5YJ 4NHJA 3DPUA 2RKHA 2PQ8A 3NAUA 2NOGA 3SZGA 1JE8A 2GXBA 1IUYA 1XB4A 3AG2H 4EQQA 5H9TA 1ZN2A 3V7RA 3VPRA 4J00A 2VBXA 2ZJPF 1F5TA 4RGUA 4DBQA 1F36A 1IUFA 1KQ8A 2H94A 1RZ4A 3KYLA 2V79A 1H88C 2UXHA 5F27A 1DPUA 1J0RA 1WWXA 4JNNA 2HDDA 3I4NJ 3LOCA 2X9DA 3HKZA 5CKTA 3U1KA 5DCFA 2R5YB 3GFIA 1OQYA 4D5CA 5F04A 4C3IJ 5C4XJ 5HS7A 4NN1A 4E7ZA 3SFIA 1GVJA 1W36C 4L0YB 2YVXA 1GT0C 4EV0A 2PZ9A 2DYRH 4II3A 1RKTA 2BE5F 2IAIA 3FXOA 4EJUA 4Y4RA 1JI8A 3QBMA 4Y7NJ 3OS2A 2QLZA 1O4XA 1ZG1A 3KFWX 2X6WA 1WI9A 3E1SA 1TW3A 2DK5A 3LSGA 3S16J 2CJJA 1UB9A 3KEOA 3OIQA 2IPQX 2PX9A 2KPMA 3BR2A 5ILVA 1R49A 3SEQA 5J1UA 1MMDA 3M7GA 3TP0A 2QSGX 3ON2A 3FXJA 4LG0A 3HOVJ 4KIFA 1SC7A 3F8BA 4IHSA 1OPCA 2IU5A 3OMYA 1HDPA 4AVPA 3BDDA 4IHYA 3HOUJ 3B6CA 4ENJA 2V1DA 3C3WA 4L0ZB 5EGOB 1YX5A 2JUCA 5IP7J 1R5GA 3K9TA 3MZYA 4LD5A 3NWSA 1XDSA 1N25A 3IHUA 4IHXA 3S5RA 2UXXA 3OOUA 4WIBA 3VOXA 4N9HA 2R5ZA 5L3FA 2CQ7A 4M3DA 4HSRA 4B43A 1ETKA 1JGSA 4MO7A 1FOXA 1TWAJ 2XIGA 1AKHA 3M1CA 1UZCA 1YYVA 2M87A 2IGOA 4OIPF 3FM5A 2LLKA 3BCGA 2OZUA 2DA3A 3QYEA 4I7HA 2YVHA 3GFJA 1S8NA 1IN8A 3GMEA 4KWAA 1S29A 2F5EA 2VQCA 3ZQQA 3WTSC 2K5CA 5M3MJ 4LB6B 1TW2A 2DPUA 1YJ9I 2E5ZA 5EEAA 4P5OA 2JSPA 2HWVA 3OYKA 4XLFA 1XD7A 1V3FA 3HSEA 4KIGA 4PSWA 2K4JA 2YU3A 4BE2A 2DT6A 2W84A 1FBQA 5H6QA 3OR1C 1TWHJ 3L1PA 5J40A 3B73A 3ZOBA 4ACIA 2DMQA 1DQUA 3FKIJ 3WGHA 4M3FA 1KU3A 5DCMB 3S8PA 3CDHA 1U2WA 2HYFA 3GZNB 4ZDLA 1LVKA 2ZNYA 5EF6A 2MBFA 3S1MJ 3CCYA 1F1ZA 4J01A 3REOA 4QPQA 2EZLA 3LA7A 4KN4X 1WH5A 4EM2A 3GLXA 5KNLA 2V57A 2Y30A 1ZRCA 4XLCA 3ERED 2GENA 2X0LA 5B3SH 1V5FA 4RM3A 1WFXA 1HW5A 4KICA 2ZJQF 1ZHFA 2E60A 3CO6C 2R3SA 3C07A 2DW4A 1SFOJ 3NEUA 2XPVA 2XUBA 3U9GA 1XGNA 2EK5A 5J3LA 4Q5SF 5IYBJ 1N78A 2ZMEB 1UHSA 1BIAA 2EJRA 1IG7A 1BR2A 4EJTA 2HU9A 5DDGA 2IGMA 5IOZA 3HDDA 3HTIA 3ZCOA 3WTVC 2CUJA 3G7RA 3RD3A 4MTEA 3CMAI 2HVSA 5BMZA 2EH3A 1FIAA 1R23A 1ZGAA 5FLMJ 4IX7A 3R61A 2RAEA 4FASD 2HQ5A 2EZKA 4BACA 3JW4A 3LFKA 1FSHA 4B8XA 3A0HC 3PUBA 3BG7A 3F6VA 1XMXA 4E7LA 3FBNB 5J6XA 3LSKA 3IL2A 3I3LA 2JTVA 4PFOA 2XKPA 3DWLE 3OIPA 1A5JA 2EFWA 1QGPA 3GTOJ 1FP1D 3GTKJ 2BHZA 5JVTA 2GXAA 4S04A 2Y31A 1MNEA 3FKJA 2ECBA 3L2UA 4C30A 2A07F 1FPQA 4WF2A 4XBFA 2CUZA 1GLNA 3JRIA 3S1NJ 3DPLC 4LIUA 4Y3OA 1G6NA 2VASA 5EJCA 4KMUX 4HRIA 4JKZA 2GOXB 4Y33A 1SANA 2VIXA 3K70C 1LE8A 1YJWI 4A3LJ 3MN2A 5D6EA 2QZ8A 1J7KA 3GTGJ 4YIIA 4A69C 2A3SA 1UCRA 3VYSB 1RI7A 2EV6A 5D19A 2D2WA 3CDIA 2L9RA 3K4BA 4A93J 2VBWA 3CJNA 2HZTA 4UV9A 2DMNA 4OWRB 3G73A 5JLWA 2FQ4A 1SFEA 4WXDA 1JKPC 4C2UA 2KDZA 1B72B 2QUFA 4M6VA 2DG8A 2L01A 3LQQA 2MG4A 3TOAA 2ETHA 1K61A 2R7DA 2A6EF 5IP9J 4U0VA 4GFLA 2Z16A 1UAAA 2GIZA 1JUPA 4XKCA 1NH3A 2QEXI 4LMYA 4I09A 2LOOA 5D8KB 4PFPA 1P4WA 3Q9VA 2RNGA 5LBQA 4KJZA 1V55H 5ILSA 5HVQC 3OYJA 3MKZA 1EV7A 1H9GA 1X4PA 3OYAA 2JQ7A 5LHGA 1EKEA 3BT9A 2EB7A 3HOSA 2P7CB 4BHBA 1XC5A 2E1OA 3QPTA 2W7NA 3BP8A 1T95A 3D1NI 1T6SA 1VQ5I 3EUPA 3K4JA 1LQ1A 2DMPA 1LFBA 1JTXA 1W5SA 3OR2C 4M3BA 1UI5A 3WTZA 4MGRA 2ELKA 4ENMA 1U5TC 3KP5A 1GHCA 2IS6A 2WC2A 2EFOA 2YUSA 3I0TA 4GFBA 4IVNA 3HTAA 2J5PA 5E3MA 5E3NA 3RTRA 1LFPA 2ID6A 2Z3YA 3MCZA 2Y9YA 2VOPA 1T56A 1MMGA 1R4NB 3E97A 1JKRC 2M30A 4MFEA 3HJEA 2Q8KA 3L9FA 1Z6TA 5EZHA 3NRGA 5ICCA 1BC7C 2KQRA 1SD6A 2ESHA 1MBHA 2VT3A 5D5VB 4CH7A 2HDWA 3NXCA 3CJTB 4CCOA 4KN7X 3F8CA 2K9LA 2CV1A 1KONA 5E1WA 4Z6YA 1P6RA 2WV0A 4C3JJ 1FC3A 4CXFA 5J1YA 3OYMA 2KRCA 3L2WA 4HLXA 3EETA 5L3DA 3BTIA 5ICFA 4WK8F 1LKXA 2XB0X 3G1LA 2KRHA 3PASA 4YG2F 3MD2A 4PZJA 4BXXJ 4MEXF 1MMNA 1JKOC 1ZG5A 1FEXA 2ZSIB 3H3ZA 1RC9A 2P0WA 3KNWA 4OD4A 4XM3A 1YTYA 1T8IA 4YFKF 2YS9A 3JREA 1FWZA 2E1MC 2UZKA 3ZQHA 2M1BA 1ZQ3P 1A31A 2R7WA 4I0BA 2R5YA 5LHHA 1DUXC 1FTTA 3BRUA 4MLOA 2NRAC 5DM7F 2YVEA 4OAZA 2L54A 4XR6A 1N77A 2JRTA 1U8RA 4P9FA 2NS7A 4IRVA 2LG4A 2D45A 2E36A 4EGZA 3I71A 2ACJA 3A4CA 3LNQA 3NNRA 4HPQA 1WJ5A 1X3ZB 1A6QA 2CQKA 4LLGF 2NYXA 5C4JJ 2G0EA 2WB1N 1DP3A 3K7AJ 2FSWA 3M8JA 3JAMZ 5HDKA 3KYDB 5K7HA 4CHUA 1OLTA 1IRXA 3RIRA 1LDJA 2IBDA 4XIDA 2JSCA 1Z7LA 1J9IA 5CJ9A 2V1XA 3T5XA 2EINH 2DXIA 2AXLA 3ZR8X 4B3AA 4UUSB 5KAIC 4EJOA 2MFZA 4AU7A 1KQ0A 1D8JA 1Z9CA 2E71A 3FMSA 1GVDA 3ASNH 1XSVA 3LAJA 4GYIA 5E3OA 4F52A 2HQNA 3K8PC 5L3CA 3PNTA 2R7SA 4NQWB 5EGOA 2LSOA 3OWTA 3IC7A 3H35A 3Q3SA 5LRRA 2FUG2 3CUOA 5GAEJ 2P4WA 4C2MJ 5ED4A 3OS0A 2XHKA 4I76A 4MEYF 4CCLA 4A3KJ 4TV7A 3GLLA 3MEXA 2L7MP 1ZLKA 3OL3A 1R22A 4BYYA 4PJMA 5GP9A 3K4NA 3S3MA 4HA8A 2MLGA 4FX0A 3S1QJ 3ANPA 4L9TA 1VQ9I 2O7TA 4M3EA 4BNCA 2EQRA 2PMHA 1VQ6I 4BL0B 3HTJA 2BXYA 3BJOA 1T98A 3OSGA 1OYIA 4FTHA 3SQNA 3KPHA 4L5IA 3BCAA 3UR3C 3AQSA 2KIFA 2MD0A 3S2HJ 2O03A 2BGCA 3HOXJ 2B1EA 4M72A 2HOEA 2QKMB 6PAXA 1BM9A 3GZ6A 2OD5A 1O3TA 2COMA 2DU9A 1T39A 3G1OA 5H20A 3H1CA 4WWCA 3RI4A 4HX4A 5DCMA 1U6GA 3FXUA 1ZYRF 2PN6A 3AL0B 3JCUC 5LEJA 3CF5F 1VQMI 4GDFA 3ONQA 2GIVA 3MWMA 2RHAA 1FOKA 3LL7A 2VONA 1BW6A 1R71A 1BOBA 2GUHA 4RB3C 4QPOA 2QA4I 1BA5A 1NG7A 4DZPA 3DTIA 2KLOA 3VODA 1R5ID 1PUEE 3L2RA 1IN7A 3GEZA 3X2QH 4PJJA 3WTTC 2E2JJ 3JSJA 3IRRA 4QWQA 1VNDA 1AU7A 2ZSHB 3PNVA 3MKYB 1T08B 1DU6A 3F9KA 2LF7A 2D1HA 1XPXA 2ZMEA 3DTKA 3I58A 5J4YA 2G7LA 1FLIA 4UVAA 2M2EA 5IYCJ 5CVRA 4UB8C 5HNFA 2UWMA 2XRNA 3LWFA 1OCRH 4MTDA 5K5QA 5K58A 4A3GJ 4BQNA 4JQFA 1RKWA 1P2FA 2UV1A 2Q24A 3J7AY 4RAZA 2WAEA 5K7FA 1K6YA 4IRIA 4V2FA 4ANJA 4BKXA 2OZ6A 4G7OF 2LRDA 2BV6A 4YEJA 3DP7A 3RJPA 4CGZA 2DMTA 2B0LA 1ZKGA 4H4KC 1XDUA 1X19A 3CP2A 3DBRB 2XF5A 2WGBA 3KX2A 2K40A 3WODF 3COAC 1LB2A 2F5CA 4XSZF 3WTYC 2LFBA 2QQAA 4V2GA 4J19A 2GQQA 1ZGJA 2L9VA 2O8XA 2DBBA 4LK0F 2ZMEC 2AQEA 2YPRA 3CC7I 2VT2A 1ON2A 4I0AA 3E5UA 1I39A 1FYLA 3HIMA 2G7UA 1GV5A 3G71I 1WSUA 3HOWJ 3FHZA 2CO5A 2FOKA 4HDVA 2DOAA 3CCEI 1OKRA 1XGSA 2D5VA 5E1XA 4E7JA 3F1BA 1TQIA 1SFXA 3RPQA 1KGSA 2ZB9A 1RPWA 2A05A 5FJ8J 3GCMA 4D1QA 1FOWA 1R36A 2MW8A 2Q0OA 3AG4H 1U5TB 2XGCA 3DKXA 4RDUA 4ZTFA 3ON4A 5LGNA 1WJAA 4EVIA 1PDNC 1MBGA 4ZZLA 3WTWC 2JA6J 2JVHA 3TW7A 3MFKA 2P5KA 2L7KA 4HOBA 1B72A 3HOYJ 3W6JB 1OMIA 3QOPA 3QRFF 1R00A 3P9IA 5JHFA 2FF4A 2DOEA 3D5LA 4ZYAA 3RYRA 3VYRB 1BN5A 5BPDA 4AC6A 1W5CC 1L0OC 1QHGA 2PBIA 2REKA 3BQZA 3E0JB 4D9JA 3CMMA 4IOCF 3WTUC 5IT9K 3VOKA 2L4MA 4A3EJ 4AWXB 3KYCB 4BDZA 4KT6A 4EM1A 2H1KA 4A5MA 3RKXA 4G7ZF 2KIQA 2LC2A 1GXQA 1HW1A 2QWWA 1P9QC 4O3MA 1MSEC 1VQ4I 1BL0A 1QBJA 2VQGA 3DU6A 3FM3A 3TP3A 2HPIA 2F5VA 4GRIA 3S1RJ 1IZ1A 1ETWA 3BR0A 1E3OC 1TT5B 2IS4A 2QGUA 3K4LA 1SGMA 2Y0SN 3JRCA 1W0UA 2EA4A 2GAUA 3HRTA 1U3EM 2I10A 3C2HA 2DMUA 1XMAA 2WADA 4MK6A 4DYRA 1CQTA 3GF2A 3GZ5A 2MD5A 4DJAA 4A6DA 1SAUA 2KZVA 2V9PA 2ME6A 3EQLF 1FOYA 5HODA 4UUTA 4OIQF 2FBQA 3C7JA 3FISA 4XONA 2TCTA 1XGOA 2BVMA 3OYGA 5K5RA 1BBYA 4YIFA 3VSLA 3S32A 1YG2A 2K9SA 2LTPA 3HBLA 5IY5H 3OYFA 2DTZA 1EH8A 2FJI1 4UHTA 4AYBA 4PGHA 5F64A 5L3BA 2UXNA 2WTEA 3BOQA 3BHQA 1D0ZA 4U88A 4RLQA 2R7OA 4AUXA 2DDBA 3K2ZA 1MMSA 2VKHA 1X4OA 3ZRGA 3FXKA 5D1RA 1SD5A 3DKWA 4HZFA 2Y48A 1APLC 1UJ8A 2CG4A 3CCQI 2LBFB 3JRBA 2VL8A 2I5UA 2LMDA 4IRGA 4GCVA 1OISA 3JRDA 3BG3A 3GFLA 5F1JA 1WVRA 2DODA 3WE2A 2OU2A 1QO0D 5TJJA 4ESJA 5GAHJ 4U0WA 3S2DJ 5BNGA 2IA1A 3HPGA 1BOAA 1BJAA 5IT9Z 1QHHD 1Y0UA 5DYMA 3WHBA 3PQKA 3GTQJ 2DFEA 3TW6A 4IL6C 4E7HA 2FA5A 2QTQA 4ENKA 1D0XA 3BR3A 2VOOA 3O60A 4OU0A 1IGNA 3HKZN 1USTA 4XLPF 2WA0A 4Y15A 3JSPA 1BI0A 4YIRX 2Z2SB 4RAYA 4A0ZA 2CV2A 1FY7A 4A12A 4YZEA 1P4AA 2OBPA 2VKDA 2W4SA 4NUBA 3LSJA 4QLCU 2VBZA 2W48A 3PIPF 2V6EA 4OIOF 5DS9A 4HF2A 4UUSA 2DFFA 3V7CA 3GTJJ 4MFDA 2LP0A 3K4CA 4UV8A 3PIOF 1B9NA 4FT8A 1YFHA 5J4VA 3OYIA 3E6BA 4ABZA 3H9GA 2GWRA 3CWRA 2DLLA 4BGDA 4EJVA 4NQWA 2R7FA 2ELHA 5EZGA 3A2KA 4IHVA 1QZEA 3CJDA 3DPTA 2V7FA 1Q1VA 3B6AA 4G6DA 3BPVA 4MQ9F 3BR1A 3SEZA 1SFKA 3AKZA 2WAQN 3K1PA 4I6ZA 3HL2A 4DZJA 4S05A 3G1MA 2STTA 1E2XA 2K86A 1QPMA 5LLQA 1MD0A 2XV4S 2EWNA 4PGGA 2W53A 3A01B 1D1BA 4EGYA 5E20A 1I50J 4M71A 2XPUA 3FRQA 1WCMJ 4Z2YA 4X6AJ 2MC3A 3QAHA 2KRFA 1W1WE 4WCGA 3J7YJ 4QIWN 2NX4A 3BPXA 2QENA 2DDAA 4KITB 1MZBA 4OOIA 2CW0F 1GXPA 4RA2A 4UDSA 4B3XA 2XDNA 4XLNF 1S5LC 4XICA 5FGLA 3K1MA 1OCOH 1ENHA 4HEA2 4YFXF 3HZJA 2FOWA 2A69F 3AG1H 3CZ6A 3AQTA 2WAFA 3RKWA 4PDKA 4B4CA 3CD6I 3SDBA 2HOAA 2LY9A 3JRGA 3C1DA 5FLXK 1EJ9A 4I2OA 2MC4A 1XCBA 5DM6F 2HKUA 4PJNA 2BOLA 3FXRA 4M74A 2CFOA 4RS8A 2R93J 1E3HA 3SJMA 4U9NA 3LFUA 3O3KA 4IRHA 1O3RA 1WI3A 5HS9A 4KUMA 2DJIA 2G7HA 3KETA 3PQJA 2E1NA 4XKWA 5H6RA 1MBJA 1JT6A 3T0YA 5KAFC 4ENNA 2BBYA 2DTRA 3GYHX 1Y39A 2PI0A 1MBKA 3QYBA 4S0HB 3FXQA 5FRNA 3RZOJ 3BJBA 4XORA 2CRGA 3CUQC 2JA7J 4AC0A 2X6YA 3LWJA 1TZLA 4OMZA 1QZZA 5FKKA 2FRHA 3L2VA 1WQ2A 1ULYA 3VW0A 1IN4A 2H8WA 1B8IB 1MNDA 1R7JA 1YI2I 1BR1A 2XAJA 1UFMA 2K7LA 4BXFA 4AF5A 3HHHA 1TNTA 3FBIB 5JFRA 3KLOA 3GEUA 5KCMA 3ASOH 4ON0A 2FNPA 1TTYA 5F0FA 1J59A 1O3SA 3O8HA 1QVTA 2OTLI 3AL0C 2CUFA 1JUMA 1UMQA 2CQXA 2XF7A 3QPHA 2AXTC 4L9NA 1AWCA 4XQFA 3H3VK 2KKOA 4BUPA 1S7OA 3LJLA 3GXOA 1IRFA 2RV8A 1B4AA 4BAYA 2KIUA 3CRJA 1SVMA 4HW0A 2F5FA 2WY7Q 1SFUA 2COBA 4OINF 1AHDP 4F93B 1ZRDA 3KLNA 1E0EA 1TBXA 3FMRA 2IXSA 3NWTA 1F4KA 2KL4A 4QSHA 2JPBA 1VQ7I 1I6XA 1B9MA 1FT9A 1NG6A 1IRZA 1BI1A 3COLA 1M1EB 2DA2A 2B9SA 1POGA 2X4HA 4HF0A 2ADUA 3RKQA 1O3QA 2O3FA 4KISA 3CLOA 1U8BA 2ZOZA 1Z77A 2HNHA 2HVQA 5LD2C 5FLXZ 3I4PA 1XS9A 3BG9A 3B02A 2HYGD 4NC7A 1ZRFA 1I3AA 4FE4A 4BEHB 4BHCA 2QWTA 1O7LA 1XGMA 1RIOH 3ISPA 2LY2A 4YFNF 1G3YA 3IUOA 4E7IA 3RCOA 1ZAOA 1U5TA 3Q9SA 2MH2A 4HV5A 4F91B 2X1CA 1HLVA 2RDPA 2VI6A 1KU7A 4HDUA 5DTDA 3OYDA 1Z91A 3WTXC 1MIJA 4GGGA 4BJ5C 2PLYA 3BLYA 4IHWA 1DGWY 1KQ9A 1Y6IA 2Z33A 2QKLB 2ICWG 3G2BA 2RN7A 2W24A 5J8CA 3W2VA 3PFIA 3J7ZI 2DQRA 3JTGA 3WG7H 2A61A 1F9NA 1T38A 3DEWA 3TMOA 3SZTA 1U0JA 2F2EA 1WZ2A 3IH2A 5F0CA 3R0AA 4O5VA 3HB9A 4G7HF 4R79A 4XSXF 3J81Z 1KU9A 3QPLA 3E5XA 2V26A 3VEPA 4AIJA 4ZYDA 3F6OA 2HFHA 2D1VA 1T2KA 1YIOA 3F8NA 4HNTA 1G3TA 1X1AA 3TKYA 2VKVA 3QQAA 3E7LA 2ZJ2A 1FNNA 2O9LA 1LPQA 3F0CA 2W85A 3JAMK 2DO7A 4FX4A 1IXSB 2A2FX 4F7ZA 5IOYA 4RGRA 2ZO4A 2VQHA 2BY2A 1ZR2A 3CLQA 2WV1A 4BBSJ 2DPDA 2NS0A 2NNYA 2C6YA 3FWEA 4KMFA 3HYIA 3J7AO 4MHGA 3I9V2 3CMYA 3NI7A 5K1YA 2XRLA 2JRMA 2K85A 3LHQA 1KU2A 1UELB 1VI0A 3P5JA 4NNJA 1FBSA 2L9NA 5E18F 1I6HJ 4BJTA 2L7FP 1HDDC 2CFXA 2AO9A 4CICA 4ME9A 2IW5A 2IP2A 4PXIA 1TQPA 3J80Z 3ZQGA 2RQPA 1TP4A 1IDZA 4CA0A 4HKUA 1KA8A 1IXCA 1ETQA 2YX7A 4GYGA 4IZZA 1IAWA 1HKTA 4G94A 2CH0A 3K0LA 4XLAA 2K3FA 3LSMA 3FXLA 3ZXSA 2DQLA 3QU3A 2GA2A 3CF2A 2EIJH 3DXJF 5CVUA 5FO5A 3VP5A 1SVLA 3KZIC 3VIBA 2H1LA 4D7MA 3TBIA 3S2WA 5B1AH 2EZIA 1D3YA 5CXGA 2LBFA 5AQCA 2JZYA 2XASA 2BW3B 2HTSA 4WXHA 1Z7UA 1VQPI 2ZXIA 3D5SC 2BXZA 3I5UA 4LJZF 5HS8A 4ICHA 1G3WA 1IV8A 1X3UA 2I8DA 2CW7A 3V4GA 2L0KA 2QF7A 3KEYA 4XN0A 4E6KG 2M3AA 4B1RA 2JMWA 2QVOA 2FMLA 3K10A 3P9CA 1SMYF 4A2UA 2R7TA 2QIBA 4FCYA 3LSHA 1QRYA 3I4MJ 2KFDA 4UB6C 4ASNA 1H8AC 1Y8QB 4CCNA 3TEDA 3ZN0A 5KK1A 2QSHX 3ZGKA 3VYTB 1Y1VJ 5E8IA 5F6FA 5B5EC 3OYBA 4BY7J 4E7KA 1D5YA 1Z0XA 1I5ZA 4U87A 2PMZN 1FJLA 3FX3A 4RB2C 2R7RA 1P7IA 5M5WJ 1PYVA 3BWGA 1E17A 3RH2A 3GFMA 3TQNA 2KIMA 2R7QA 1LEAA 1U78A 1PP7U 2ZCMA 1DDNA 1FSEA 1MMAA 3ESWB 2OA4A 1SEUA 4IQ4A 1WHUA 2O6GE 1UI6A 5FD5A 5EFYA 3IUVA 1IW7F 1VZ0A 1IDYA 2VJJA 5J8FA 2PEXA 4KT5C 1YHQI 2NVTJ 4D5FA 3LMMA 3S17J 3M9AA 1OR7A 2RVCA 3H3UA 4GXOA 3S3NA 3GUDA 4GFKA 2XB5A 1MDMB 1IC8A 2DA4A 2QYOA 2A6TA 1MJ9A 4IHTA 4E70A 2X6XA 4PCQA 1J75A 3KP4A 1L3LA 3A01A 3CCMI 3OIOA 5BPIA 3BQYA 2ZJRF 3CUQB 2CGPA 4G9YA 3DLLF 2QBYB 2LDUA 3FZVA 2CYYA 1J2XA 3KZ9A 4DBRA 2V9VA 3CCVI 3VVXA 4Q4ZF 1TLHB 2FNAA 5DD8A 1ZREA 3DBLB 3ZN1A 2JK3A 1W7PD 1HSJA 4CCMA 1UG2A 1Y8RB 4II2A 2HS5A 3TDUC 1BJZA 2AS5F 2ZCNA 4LK1F 1B1BA 1XCVA 2EIKH 2V1NA 2JUGA 2X85A 4HV6A 4RGXA 5AIPA 5E79C 1S6LA 3E6MA 3FF5A 2E2HJ 4DQ2A 1OR7C 5C4YA 3ZMUA 5B66C 1SAXA 1MGTA 4CSWA 1X1BA 1IXRC 2ZKZA 3ML6A 3PO3J 1R4MB 4DOZA 2A5YB 1GUUA 2ZXJA 2HTJA 3U2RA 2HQRA 1BC8C 3IAM2 5TRDA 3EUAA 3MMYB 5GADJ 3PJRA 4JBAA 4IF4A 2AHQA 5D4RA 4RBOA 3SWHA 1LFUP 1YIJI 1YS6A 3HTUA 1WJCA 4XOPA 4IO9F 2M4KA 1X1PA 5FROA 1MJAA 4U0YA 2E1CA 3L7WA 3TOBA 2VQLA 3ZMZA 2YU9J 1XG1A 1JHFA 5F1RA 2L4AA 2XGXA 5EYRA 3LA2A 2FU4A 2DA6A 1SD7A 2XAFA 4G8XA 1S9HA 5FFXA 1TL8A 2NP3A 1J5YA 4C2TA 3T8TA 2NAZA 4M6YA 2E7XA 1B8IA 4F55A 5E17F 5CW8A 1I27A 4U7BA 4LOCA 1TWFJ 4RAGA 5GPCA 1I1SA 3DPJA 3IWFA 5CYVA 5FB2A 4JL3A 1ZGWA 3F8MA 1PJRA 3H9QA 4KA4A 3DU5A 2G3BA 4LFUA 1G8XA 2IJLA 3KEQA 2VXZA 4NB5A 3CCSI 2DA5A 1XN7A 2PJRB 2HXOA 5HAWA 4BE1A 3CCLI 5HDGA 3I64A 3ABUA 2L02A 3KZZA 3WU2C 1VFCA 4XMYA 4G6TB 1WKMA 2K4BA 4M73A 1ETVA 5B1BH 1OCTC 3S14J 1IV6A 3AAFA 2MA3A 2JT1A 2UXOA 4XN3A 2KHMA 2JA5J 3TDZC 1QVUA 4C9YA 3TO7A 2VJIA 3WU0A 2XDVA 1YW9A 1K83J 4E7SA 3ZP5A 1CF7B 2DI3A 2CW8A 4UVCA 2JWTA 3PUFA 2MH9A 2PFBA 1FZPB 3IRQA 4HQMA 3ABTA 4BQAA 3ZQLA 1I3QJ 4XLHA 2JA2A 3H0GJ 4CO8A 5IT3A 4CGRA 3BR5A 1BW5A 1HW2A 3RDIA 4LLNA 3H5NA 4IJAA 2V4JC 3HGYA 5GAGJ 1TC3C 3G56A 4ITVA 1QNTA 4BEHA 2FXAA 2VUMJ 2EBIA 5D5WB 4PSXA 5FKOA 3SZPA 5LHIA 1ZG3A 3KKCA 1ON1A 5DAJA 3JSOA 1ZR4A 1KYWA 1X2MA 4FHTA 4G12A 2VE8A 3Q0VA 1JXSA 3LSPA 2B3WA 4KNYA 1EA3A 1GV2A 3ROUA 3VYUB 2A68F 2P6TA 2TRTA 2XAQA 2F4OB 5CVJA 4A0YA 1JJ8C 3ABMH 3DEEA 2IS2A 3K1NA 1RR7A 3OYEA 1RETA 5EG0B 3ZQCA 1TNSA 4ESFA 2DCEA 3R6SA 1D5VA 4L9VA 5H2FC 1Y1WJ 5ERIA 4BQQA 1YO5C 1P4XA 4A3BJ 3VUQA 4V19K 2FBIA 3KE2A 2OF7A 2Q2EB 3W6VA 1X58A 2W1OA 2Y0SA 4PUSA 4JP0A 4U7DA 3N4MA 1RUOA 2JA8J 1S7EA 4A5NA 3BJ6A 3S93A 2LF8A 4XK4A 3NRVA 3K2AA 2XVCA 5CXIA 3JR9A 3LAPA 2OERA 2WUIA 1BIBA 2VJ5A 1FIPA 5HLHA 2R92J 3I59B 3EGQA 5J1RA 4LITA 2O0YA 3ULQB 3D0SA 1Z1DA 2EV0A 3R4KA 4KYWA 1P92A 1N75A 2WBMA 3BZKA 2ZCWA 4W97A 3K69A 5M5XJ 4CYDA 2P5VA 3SDGA 4BH9A 2EIMH 3F22A 3M1EA 3OY9A 3FK7A 1YQAA 3DFGA 2FJ1A 2DK8A 1FMWA 1RESA 4OAYA 3IKTA 3PNYA 1Z05A 1MH4A 4ZJZA 3PFYA 2NVQJ 2AQFA 2ISYA 3BG5A 1XSXA 4H0EA 2OPTA 1R6RA 2M34A 2ISZA 3HHGA 3QPSA 1YRNB 2LKXA 1ETOA 1ODDA 4LLLA 4PJ0C 2NVUB 3BTJA 2LY1A 1CGPA 3OS1A 2XSJC 5DUIA 3GX4X 2QQ9A 4CYCB 1XSDA 1STZA 3BZCA 4HBLA 1IN6A 3EYYA 4QTRA 9ANTA 3V78A 4AYBN 3ABKH 2DYSH 2M7AA 3T1BA 2BW3A 1HKSA 1FTZA 3MQ0A 3L2CA 3DF8A 4CDGA 4Y52J 2JPCA 2CU7A 3ZQ7A 5L3EA 5F08A 2X1DA 4ZTJA 3M3YJ 2DJNA 1EF4A 5JR3A 2N8GA 5LGUA 2M4GA 3H36A 3VTIA 1WJFA 2VBYA 4HAMA 3ZMSA 2LKSA 1ZTRA 4N0BA 1UG0A 4AIDA 2BYVE 3DEUA 4BS9A 1KZHA 3UNGC 3I53A 3HRMA 1OJLA 3QOEA 3I54A 4R1HA 2CSOA 2BY0A 3I56I 3JRHA 2KZGA 2QCOA 1VQLI 4NC6A 5J47A 3HC7A 4AD9A 3EUHA 3MVPA 3QP6A 3QP5A 1HBXG 3GTMJ 4ZH4F 2OCCH 3LQRA 1W36D 1DU0A 4IPAA 1WRJA 2R7ZJ 4AM3A 3A03A 5E8GA 3IP4B 5HBUA 2BVLA 3HEFA 1W7PB 5IYDJ 1BR4A 2KDOA 1RUNA 3BR6A 1LNWA 1HF0A 5D18A 5HNHA 1Z67A 1Z3XA 3HRSA 1K4TA 2H8RA 2F4IA 4RLFA 2E5NA 3A02A 2IA0A 4OD5A 4ETSA 2WAQA 1FBUA 2W82A 5TISC 1ACIA 2QM3A 1NTCA 4DYQA 2M0CA 2QQ8A 2VB6A 4A6EA 3GTLJ 4DGWB 1S7AA 2X6OA 4P9UA 2D6YA 2XAGA 2VJ4A 3U21A 1MDMA 3GW2A 4EATA 1X1CA 4BDYA 3EUHC 4ZYHA 5FRMA 5ILUA 3DV8A 3I55I 2V6CA 1G2HA 2JN6A 2V9KA 3AFHA 5C3EJ 3OYNA 3KP6A 3GVAA 4JX5A 1ZH5A 2EFQA 5HLGA 2UXUA 3F8FA 4E4HA 3GBGA 1S72I 2ID3A 1J09A 2HI3A 3CUQA 5CQEA 2FEZA 1TQMA 4M6XA 2K27A 2ZFUA 2QBYA 2V1UA 1T33A 2FE3A 3PSFA 3IAS2 2HDCA 3VW2A 4KFCA 2X51A 4JOMA 2RC4A 2E34A 5HLIA 2GA1A 1JHHA 3HRUA 3NARA 2VXDA 2PMUA 1YW7A 2DFHA 1R1UA 3PM1A 5D4SA 2LNBA 2OJED 2EFNA 3FXMA 3DBHB 3HM5A 2OV7A 2E2IJ 1A36A 2XGDA 1RRJA 1REPC 3M8FA 2IGNA 2VC1A 2VE9A 3V8LA 4Q47A 4DNCA 2QOPA 5HSZA 2DAOA 2O7OA 4AIKA 3ELKA 4OMYA 3G4SI 4XRSA 3UKGA 1Y56A 2HEOA 5BQTA 4XRMA 3DLAA 5BOXA 2HOTA 1FYMA 3JTHA 3K4KA 5ICEA 4BHPA 2BEOA 1JJ6C 4DVYP 2FD5A 3KIOA 4B47A 4XL9A 4B48A 4NDLA 2WWYA 3MZ8A 1ORKA 2ZFWA 1H0MA 3HUGB 2P81A 2O8KA 3BTLA 1IO2A 1U9OA 3TGNA 3EYIA 3ZQIA 2IEKA 3O8GA 2E35A 3H9JA 3J81K 4HLYA 2J5OA 4A3JJ 1B6AA 2EV5A 3M07A 2BZTA 1DP7P 1KYZA 3BTCA 4PK4A 3V6GA 4ESBA 1B59A 2Y0MA 3IH4A 2ZCXA 1MBEA 1E3PA 2L2OA 1YLFA 2Y2ZA 3CC2I 4HSTA 3H0DA 2R4GA 2PJRA 2P8TA 3B81A 2HKXA 1A6IA 1UHMA 2LKPA 3VWBA 4RB0A 3IWZA 4N4OB 2HR3A 4NC8A 2FBHA 4EMSA 2M7BA 1LVAA 3FK6A 1QZYA 1K78B 4BU2A 1SMTA 2FX0A 3ZMDA 4DIQA 5F0HA 1DPRA 1H9TA 2STWA 2K9NA 4P1WA 2HYTA 2EILH 4L5EA 3WG9A 1Q1HA 3J80K 1CF7A 1ETYA 3GZIA 2A6HF 1LDDA 2PFVA 2YX4A 2E7WA 2OQGA 3ABLH 4XNFA 1VF9A 2BHYA 4A3CJ 4P96A 1Z6RA 1R1VA 3VDXA 2L7ZA 5D6FA 3WHCA 4FISA 1K4SA 2QSFX 1WH7A 2XAHA 1LDKB 3TO6A 4IQJA 5CVIA 1LUJB 1MNMC 4UVBA 4FETA 2ZC2A 5FLVA 1D1AA 2YSRA 5HOOA 3E6DA 2L9SA 3K70D 4LGWA 1HOMA 4RGSA 3RZDJ 5FKLA 3SHFA 1V5EA 3Q0WA 1HCRA 2BY1A 4PJLA 2CQNA 3CESA 3CC4I 4M9ZA 4A3FJ 3ZMTA 1K6OA 1EH7A 3HE0A 1HQCA 1TT0A 2Y9ZA 2Z9OA 5D5XB 3QKXA 5FFZA 3ZMVA 3DKYA 2HGCA 3BROA 2UXPA 1MSFC 2Y69H 1T0FA 2EZHA 5IPAA 3M4OJ 5FMPA 2KMUA 5EG0A 2LYCA 1JUSA 4A3DJ 2DT5A 2P7VB 4ZDOA 1PUFB 1O7FA 2M8GX 1WPKA 4IEJA 3CCUI 3MNLA 3ZPLA 3SYTA 4XKVA 4K2EA 5DV5A 3CMEI 1MJBA 1W0TA 2XPWA 1FX7A 3WE3A 1BI2A 2Q2EA 3BC8A 4FQGA 4B09A 1ONVA 2IT0A 2K9QA 4XLEA 1K7AA 1QA6A 4L5JA 3T8RA 2ME0A 4CCJA 4Y13A 4MQVA 3W2AA 3HG9A 3KCCA 4BBRJ 1YOVB 3L00A 3H5AA 1MBFA 2B7EA 5BS6A 2GFNA 3W6KB 2F4MB 2TDXA 5JLXA 1X2NA 2DFIA 3I59A 5ICGA 5HDNA 3HPHA 2MLKA 4M9XA 2NP5A 4W1UA 2R0QC 1BI3A 2DT7B 2UXIA 2KP6A 4C3HJ 1HKQA 3MKWB 2K9MA 5LRSA 4EEFG 4A3MJ 1T0FC 2HYJA 2OI8A 3BG6A 3E7QA 2GXGA 2MSYA 2OC6A 3LA3A 5KHDA 2XSDC 3CJQB 3FMQA 2UUZA 3V8KA 2K3PA 1OYWA 3NS4A 4N9IA 3F23A 2IVMA 1MH3A 2R7VA 3F3XA 3QYFA 3BNIA 3OYCA 1GDTA 4IKFA 2M9HA 2DN0A 1YRNA 4BJ6C 4XOTA 2FMYA 2Z99A 4HX8A 5CQGA 2LVSA 2XROA 1LEBA 1WGXA 1AA7A 3H92A 2IA2A 2YR2A 2NNNA 4JK1X 3ECHA 5GPAA 1JT0A 5HLTA 4XRSG 4CYCA 1O57A 4HQEA 1H89C 3QU6A 2HOSA 2R7XA 2X1EA 2L5QA 1RR8C 4R8HA 5KVRA 1ERDA 1EH6A 3HXLA 3IV5A 2G7SA 1IN5A 2F6CA 2WY8Q 2O5RA 3L09A 2E19A 1YS7A 3MZHA 3KP2A 3HSRA 3PSIA 1PP8F 2OUMA 4CZCA 2VKEA 2OAZA 2F5DA 2DA7A 1JKQC 4ZZDA 2WB1A 4I01A 2Z5UA 3HGGA 3A0BC 2ECCA 2H6CA 2VPRA 1MKMA 1YX3A 4LG3A 3JRFA 3HSFA 2NVYJ 1TWGJ 5LFAA 4CCKA 3U1DA 1W5TA 2FBKA 2RASA 1HSTA 4A3IJ 3QODA 2PMZA 2XKOA 1NK2P 1JTYA 4MXMA 4L18B 2LREA 3MKLA 2W00A 3FDYA 2PG4A 1F43A 3VB2A 5DD4A 1UHWA 2LK2A 1VQKI 1W7PA 2ZBKA 3SXYA 2ZOYA 1YW8A 3S3OA 2M45A 2CMPA 1MW7A 3T6NA 4LG0B 4P55A 4KDPA 3BCBA 5AONA 3OV8A 4D0PA 1FYKA 1ITYA 4MNUA 1VQNI 4BY1J 3KKDA 1QQIA 1U9NA 2XGEA 3BZ6A 5JVGF 4L62A 5DUKA 3OYLA 2JJ7A 1IRGA 1R58A 3IKVA 2H6BA 3LSRA 1D0YA 1C0WA 5IP6A 4OIRF 3RSNA 2X48A 2MYSA 1NK3P 5FKNA 2VLAA 4L9JA 3CJRB 4WXCA 3RYPA 2R5ZB 2RQQA 3FHNA 4DYCA 4JX6A 2ESNA 3PPBA 2ZNZA 3S15J 3OL4A 1SVOA 4HNVA 3V7SA 2EPFA 1AKHB 3VOEA 1VTNC 3RQ4A 1XX5A 1A35A 3CQZJ 4N4NB 2OQRA 3P9TA 4ZYGA 2CV0A 1XMKA 3H5RA 5E3LA 5JHUA 3KP3A 1USSA 1X1DA 2HKOA 2KT0A 3GTPJ 1OCZH 1Z3YA 1JGGA 4JYKA 4X1EA 2RREA 4IOAF 2F07A 4ZYEA 1YE9A 2ZXWH 2G9WA 2XF6A 4YELA 3MAJA 3EUKL 3PL8A 3ANGA 4IXAA 5A2QK 3LSIA 3QWLA 4CZZA 2XC7A 2R7UA 2RGVA 3VFZA 3V8JA 3NQOA 1K79A 2EFPA 1PVEA 2F48A 1D1CA 2W57A 3P9KA 3OYHA 1YITI 2OTJI 3VVYA 4AVZA 4Q48A 2ZXHA 3VW1A 3Q0UA 2HPMA 2A5WA 4D7NA 3HUGA 3N05A 3ECOA 2FQ3A 4HYEA 1ETXA 4O6JA 2O61A 2BY3A 2EA2A 3VSKA 3OSFA 4WX9A 3F21A 4RMNA 3Q5FA 4DW6A 1OCPA 3EPZA 4M9SA 2CS3A 3TO9A 2GLOA 1QPIA 1D8KA 5AIQA 3RKYA 1IF1A 2DG7A 2Q1ZB 2QQBA 2MGQA 3HOTA 1OYYA 4EJWA 4ZDPA 1HA8A 1ZK8A 2Z1DA 1P7JA 2LR8A 3ERMA 3GO5A 4HNUA 1V5GA 2KJCA 3AG3H 2L3DA 5LEKA 4UXNA 2M8EA 4RM2A 4U9LA 3K4MA 3W3CA 3E6CC 2VC0A 2KISA 5GTIC 2CWEA 4CUGA 5FD6A 4GCTA 1K78A 2ELJA 2DOFA 2HQAA 3C2GA 1OCCH 2MABA 5C44J 1HC8A 2GBYA 1ZELA 2NVXJ 4EM0B 2NXNB 3VVZA 1G4DA 1R9TJ 3RPUA 3TL4X 3W2WA 3WU1B 2M0MA 3CCJI 4HG2A 3K6GA 1WJBA 2CQQA 3HOZJ 1FP2A 1A04A 5TGTA 2PJPA 3R60A 4I98B 2GOMA 1TWCJ 1Y0NA 5CLSA 1LE8B 2OCEA 4BQOA 5A2QZ 1I1GA 1HXDA 4I99C 5FGMA 5DEQA 4C2MA 5K7ZA 3C18A 3DCFA 2CUEA 4A0XA 4BE0A 5K5OA 2IRFG 4HF1A 2IGKA 3DQVC 2M5WA 5FHPA 2HZDA 1YJNI 5EEGA 1ZLJA 2Y75A 5LGTA 4NELA 5CPRB 4LB5A 3BY6A 1OFCX 3CDLA 3E5QA 4XKBA 4RAFA 1FMVA 1SD4A 4G6QA 2HVRA 4NBQA 3CCRI 4GCKA 3G3ZA 2H27A 3L2QA 1ZARA 4Y17A 4FE7A 3WGIA 1RNLA 4JX4A 2VN2A 3PO2J
chains in the Genus database with same CATH topology
2L7MP 2DA1A 2G7GA 1PUFA 5GP9A 3DEWA 1G2HA 2QKOA 2JN6A 5C3EJ 4JX5A 2UXUA 3IH2A 5F0CA 3GBGA 2LD5A 3S1QJ 3ANPA 2ID3A 3HB9A 2GM4A 2HI3A 2O7TA 4M3EA 2NS8A 2EQRA 3QPLA 1T33A 3HTJA 3VW2A 3OSGA 3C2BA 4FTHA 2VKVA 3QQAA 3E7LA 3JRAA 3NARA 3AQSA 3S2HJ 2O9LA 3IH3A 3F0CA 3HOXJ 1IJWC 3PM1A 5IOYA 3HM5A 3RQIA 2E2IJ 5M3FJ 2XGDA 1ZR2A 2WV1A 4BBSJ 3HTHA 3FIWA 3CMYA 3NI7A 2B63J 2XRLA 3LHQA 3G1OA 2QOPA 1VI0A 5HSZA 2O7OA 1I6HJ 3NPIA 5EDNA 4XRSA 2L7FP 3UKGA 1HDDC 2AO9A 4XRMA 4ME9A 2RHAA 4MIMA 2HOTA 1BW6A 4PXIA 3ZQGA 4GCLA 2GUHA 1JJ6C 1IDZA 5FKMA 1BA5A 4HKUA 2FD5A 1ETQA 4DZPA 4NDLA 1ORKA 3ZQFA 2P81A 2O8KA 3BTLA 2PBXA 1U9OA 4M3GA 2E2JJ 3JSJA 3ZQIA 2HXIA 2IEKA 1VNDA 1AU7A 3O8GA 5M5YJ 3VP5A 3VIBA 1DU6A 4D7MA 4A3JJ 3NAUA 2NOGA 2EZIA 5H9TA 5CXGA 3BTCA 2G7LA 3V6GA 3VPRA 3IH4A 5AQCA 2ZCXA 1MBEA 2M2EA 5IYCJ 2Y2ZA 1F36A 1IUFA 5K58A 4A3GJ 1H88C 2UXHA 1RKWA 5F27A 3B81A 1A6IA 4ICHA 2Q24A 4JNNA 2HDDA 5K7FA 3I4NJ 2L0KA 2QF7A 3LOCA 2X9DA 2R5YB 3FK6A 4V2FA 5F04A 4BKXA 4D5CA 4C3IJ 5C4XJ 4B1RA 2JMWA 4NN1A 3SFIA 2FX0A 5F0HA 2DMTA 1ZKGA 2K9NA 4FCYA 2QIBA 1GT0C 2HYTA 2PZ9A 2WGBA 2K40A 4L5EA 1QRYA 1RKTA 3I4MJ 1ETYA 3GZIA 1H8AC 2IAIA 2LFBA 3TEDA 3QBMA 4Y7NJ 4V2GA 4J19A 1VF9A 1O4XA 1Y1VJ 4A3CJ 4BY7J 1D5YA 1Z0XA 1FJLA 2L7ZA 2PMZN 3LSGA 4FISA 3WHCA 2CJJA 3S16J 3HIMA 5M5WJ 1P7IA 1GV5A 1WH7A 3HOWJ 3BR2A 1MNMC 3RH2A 5J1UA 3TP0A 5FLVA 2D5VA 3ON2A 3F1BA 1U78A 2ZCMA 2ZB9A 1RPWA 5FJ8J 1HOMA 3RZDJ 5FKLA 3HOVJ 3Q0WA 2MW8A 1HCRA 1UI6A 5EFYA 2IU5A 3IUVA 2XGCA 4RDUA 3ON4A 1IDYA 1HDPA 4A3FJ 2NVTJ 4IHYA 3HOUJ 3B6CA 1MBGA 4D5FA 3S17J 2JA6J 5EGOB 3HE0A 5IP7J 2Y9ZA 3QKXA 3TW7A 1B72A 3HOYJ 4IHXA 2UXPA 4GFKA 2XB5A 1IC8A 1MSFC 2EZHA 2DA4A 5IPAA 3M4OJ 3S5RA 4AC6A 5FMPA 3OOUA 5EG0A 3VOXA 1JUSA 4A3DJ 1PUFB 2REKA 2R5ZA 3BQZA 2M8GX 1WPKA 4IEJA 4M3DA 3MNLA 1ETKA 4MO7A 3VOKA 1TWAJ 3A01A 1AKHA 4A3EJ 3OIOA 3BQYA 1W0TA 2H1KA 2XPWA 2LLKA 3BCGA 2DA3A 3KZ9A 2K9QA 2YVHA 4KWAA 3VVXA 2ME0A 1MSEC 1BL0A 5M3MJ 3TP3A 4BBRJ 3S1RJ 3BR0A 1ETWA 2JK3A 1E3OC 1MBFA 5EEAA 1UG2A 2GFNA 1SGMA 2Y0SN 3JRCA 1BJZA 1W0UA 2ZCNA 5JLXA 1X2NA 2I10A 2NP5A 4W1UA 2R0QC 2DMUA 4MK6A 2E2HJ 4DYRA 1CQTA 2UXIA 1TWHJ 5C4YA 4C3HJ 3L1PA 2ME6A 3ZOBA 4ACIA 2DMQA 4EEFG 4A3MJ 3FKIJ 5HODA 3PO3J 1GUUA 2HYJA 4M3FA 4UUTA 2FBQA 2OI8A 3FISA 3E7QA 2MSYA 2XSDC 2TCTA 5EF6A 2AHQA 4RBOA 1LFUP 3S1MJ 3CCYA 1MH3A 2K9SA 2LTPA 3HBLA 3BNIA 2DTZA 1GDTA 2EZLA 2M9HA 2DN0A 1WH5A 1YRNA 1XG1A 2YU9J 2V57A 5EYRA 2Y30A 2GENA 3BHQA 2DA6A 2NP3A 2LVSA 1WGXA 4AUXA 3C07A 1B8IA 5CW8A 4LOCA 1SFOJ 5GPAA 1JT0A 2XPVA 1TWFJ 5GPCA 5D1RA 4XRSG 4CYCA 5J3LA 3DPJA 5IYBJ 1H89C 2HOSA 1UHSA 4JL3A 1APLC 1ZGWA 1IG7A 3JRBA 5IOZA 3HDDA 3IV5A 2G7SA 3HTIA 3JRDA 3BG3A 3RD3A 2G3BA 3G7RA 2E19A 5F1JA 2EH3A 1FIAA 2DA5A 5FLMJ 2HXOA 5HAWA 2RAEA 2VKEA 2HQ5A 2EZKA 1VFCA 2DA7A 1JKQC 3S2DJ 5BNGA 1ETVA 1OCTC 3S14J 1IV6A 3WHBA 2UXOA 3HGGA 3GTQJ 2ECCA 2JA5J 2VPRA 3TW6A 1QVUA 1A5JA 2QTQA 3GTOJ 3JRFA 2NVYJ 3GTKJ 1TWGJ 3BR3A 1K83J 3O60A 1IGNA 2Y31A 2RASA 3HKZN 2ECBA 2JWTA 4A3IJ 1NK2P 1JTYA 4MXMA 3JRIA 3S1NJ 3MKLA 3ZQLA 1I3QJ 4CGRA 3H0GJ 4JKZA 4YZEA 1F43A 1SANA 1LE8A 3BR5A 4A3LJ 1BW5A 2LK2A 3MN2A 3LSJA 1TC3C 3G56A 3HGYA 2W48A 3GTGJ 2ZOYA 5DS9A 4A69C 2VUMJ 2EBIA 4UUSA 5FKOA 4MFDA 3GTJJ 2LP0A 5D19A 3KKCA 3T6NA 5DAJA 2L9RA 1ZR4A 4A93J 1X2MA 4ABZA 1ITYA 3CWRA 4G12A 3Q0VA 4BY1J 3KKDA 3LSPA 1U9NA 2XGEA 2DMNA 5EZGA 5JLWA 4IHVA 2FQ4A 1GV2A 4L62A 1JKPC 3CJDA 2KDZA 2TRTA 2JJ7A 1B72B 4M6VA 3LSRA 2DG8A 1Q1VA 3B6AA 1JJ8C 3BR1A 2MG4A 2WAQN 1K61A 5IP6A 4I6ZA 5IP9J 1RR7A 4DZJA 2X48A 1RETA 3G1MA 5EG0B 3ZQCA 1NK3P 5FKNA 4GFLA 2R5ZB 1JUPA 4DYCA 4JX6A 3PPBA 3S15J 4HNVA 1Y1WJ 2W53A 3A01B 1AKHB 4A3BJ 3VUQA 1I50J 3CQZJ 2XPUA 3FRQA 1WCMJ 3P9TA 3W6VA 2OF7A 1X58A 3BT9A 2JA8J 4JP0A 4X6AJ 1S7EA 5E3LA 1XC5A 2E1OA 2KT0A 4QIWN 2NX4A 3EUPA 4XK4A 3D1NI 3GTPJ 1JGGA 3K2AA 4JYKA 4X1EA 4UDSA 2F07A 5CXIA 2DMPA 1LFBA 3JR9A 2XDNA 2OERA 4XICA 1JTXA 2WUIA 5FGLA 1FIPA 1ENHA 4M3BA 3AQTA 2R92J 3EGQA 5J1RA 1UI5A 4B4CA 2ELKA 3ANGA 2HOAA 2LY9A 3JRGA 4W97A 2YUSA 5M5XJ 3SDGA 4GFBA 2HKUA 3HTAA 2R93J 5E3MA 3FK7A 3SJMA 2FJ1A 5E3NA 1RESA 2ID6A 1WI3A 2Y9YA 1MH4A 1T56A 1JKRC 1MBJA 1JT6A 4MFEA 2NVQJ 3VVYA 3BG5A 5EZHA 3NRGA 3VW1A 1MBKA 3Q0UA 2OPTA 4S0HB 2M34A 4D7NA 3BJBA 3RZOJ 3QPSA 1YRNB 1MBHA 2CRGA 2LKXA 1ETOA 2JA7J 1ETXA 4AC0A 3LWJA 3NXCA 3OSFA 5FKKA 3VW0A 3BTJA 4DW6A 1B8IB 1OCPA 4C3JJ 5J1YA 2GLOA 4AF5A 1QPIA 4CYCB 3BTIA 4QTRA 9ANTA 2DG7A 3V78A 4AYBN 2XB0X 3G1LA 2MGQA 3GEUA 3PASA 1FTZA 5F0FA 4BXXJ 1ZK8A 4Y52J 1JKOC 2CU7A 3O8HA 1QVTA 1P7JA 2LR8A 1FEXA 3KNWA 5F08A 2CUFA 1JUMA 1UMQA 2CQXA 2YS9A 3JREA 3M3YJ 2DJNA 1EF4A 3ZQHA 2N8GA 1ZQ3P 3H3VK 2R5YA 1ZTRA 1FTTA 3BRUA 3LJLA 4GCTA 4MLOA 2YVEA 3CRJA 1OJLA 2NS7A 5C44J 2COBA 1AHDP 2GBYA 2NVXJ 3JRHA 2QCOA 3LNQA 3VVZA 4QSHA 3NNRA 1R9TJ 3MVPA 5C4JJ 3GTMJ 2G0EA 2WB1N 1IRZA 3COLA 1DU0A 2DA2A 3K7AJ 1POGA 2CQQA 3HOZJ 2R7ZJ 3RKQA 3A03A 1TWCJ 1U8BA 5K7HA 2ZOZA 1LE8B 5HBUA 2IBDA 4XIDA 1Z77A 3HEFA 5IYDJ 5K7ZA 3BG9A 1XS9A 3DCFA 2CUEA 4FE4A 4UUSB 4B3AA 3BR6A 2QWTA 5FHPA 1HF0A 4NELA 5D18A 2H8RA 1OFCX 3CDLA 1GVDA 1HLVA 2VI6A 3A02A 5E3OA 5DTDA 5EGOA 4GCKA 4IHWA 3Q3SA 1NTCA 4DYQA 2M0CA 3GTLJ 4FE7A 4C2MJ 4A3KJ 2X6OA 4I76A 2D6YA 4JX4A 3PO2J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L7M P;  2DA1 A;  2G7G A;  1PUF A;  5GP9 A;  3DEW A;  1G2H A;  2QKO A;  2JN6 A;  5C3E J;  4JX5 A;  2UXU A;  3IH2 A;  5F0C A;  3GBG A;  2LD5 A;  3S1Q J;  3ANP A;  2ID3 A;  3HB9 A;  2GM4 A;  2HI3 A;  2O7T A;  4M3E A;  2NS8 A;  2EQR A;  3QPL A;  1T33 A;  3HTJ A;  3VW2 A;  3OSG A;  3C2B A;  4FTH A;  2VKV A;  3QQA A;  3E7L A;  3JRA A;  3NAR A;  3AQS A;  3S2H J;  2O9L A;  3IH3 A;  3F0C A;  3HOX J;  1IJW C;  3PM1 A;  5IOY A;  3HM5 A;  3RQI A;  2E2I J;  5M3F J;  2XGD A;  1ZR2 A;  2WV1 A;  4BBS J;  3HTH A;  3FIW A;  3CMY A;  3NI7 A;  2B63 J;  2XRL A;  3LHQ A;  3G1O A;  2QOP A;  1VI0 A;  5HSZ A;  2O7O A;  1I6H J;  3NPI A;  5EDN A;  4XRS A;  2L7F P;  3UKG A;  1HDD C;  2AO9 A;  4XRM A;  4ME9 A;  2RHA A;  4MIM A;  2HOT A;  1BW6 A;  4PXI A;  3ZQG A;  4GCL A;  2GUH A;  1JJ6 C;  1IDZ A;  5FKM A;  1BA5 A;  4HKU A;  2FD5 A;  1ETQ A;  4DZP A;  4NDL A;  1ORK A;  3ZQF A;  2P81 A;  2O8K A;  3BTL A;  2PBX A;  1U9O A;  4M3G A;  2E2J J;  3JSJ A;  3ZQI A;  2HXI A;  2IEK A;  1VND A;  1AU7 A;  3O8G A;  5M5Y J;  3VP5 A;  3VIB A;  1DU6 A;  4D7M A;  4A3J J;  3NAU A;  2NOG A;  2EZI A;  5H9T A;  5CXG A;  3BTC A;  2G7L A;  3V6G A;  3VPR A;  3IH4 A;  5AQC A;  2ZCX A;  1MBE A;  2M2E A;  5IYC J;  2Y2Z A;  1F36 A;  1IUF A;  5K58 A;  4A3G J;  1H88 C;  2UXH A;  1RKW A;  5F27 A;  3B81 A;  1A6I A;  4ICH A;  2Q24 A;  4JNN A;  2HDD A;  5K7F A;  3I4N J;  2L0K A;  2QF7 A;  3LOC A;  2X9D A;  2R5Y B;  3FK6 A;  4V2F A;  5F04 A;  4BKX A;  4D5C A;  4C3I J;  5C4X J;  4B1R A;  2JMW A;  4NN1 A;  3SFI A;  2FX0 A;  5F0H A;  2DMT A;  1ZKG A;  2K9N A;  4FCY A;  2QIB A;  1GT0 C;  2HYT A;  2PZ9 A;  2WGB A;  2K40 A;  4L5E A;  1QRY A;  1RKT A;  3I4M J;  1ETY A;  3GZI A;  1H8A C;  2IAI A;  2LFB A;  3TED A;  3QBM A;  4Y7N J;  4V2G A;  4J19 A;  1VF9 A;  1O4X A;  1Y1V J;  4A3C J;  4BY7 J;  1D5Y A;  1Z0X A;  1FJL A;  2L7Z A;  2PMZ N;  3LSG A;  4FIS A;  3WHC A;  2CJJ A;  3S16 J;  3HIM A;  5M5W J;  1P7I A;  1GV5 A;  1WH7 A;  3HOW J;  3BR2 A;  1MNM C;  3RH2 A;  5J1U A;  3TP0 A;  5FLV A;  2D5V A;  3ON2 A;  3F1B A;  1U78 A;  2ZCM A;  2ZB9 A;  1RPW A;  5FJ8 J;  1HOM A;  3RZD J;  5FKL A;  3HOV J;  3Q0W A;  2MW8 A;  1HCR A;  1UI6 A;  5EFY A;  2IU5 A;  3IUV A;  2XGC A;  4RDU A;  3ON4 A;  1IDY A;  1HDP A;  4A3F J;  2NVT J;  4IHY A;  3HOU J;  3B6C A;  1MBG A;  4D5F A;  3S17 J;  2JA6 J;  5EGO B;  3HE0 A;  5IP7 J;  2Y9Z A;  3QKX A;  3TW7 A;  1B72 A;  3HOY J;  4IHX A;  2UXP A;  4GFK A;  2XB5 A;  1IC8 A;  1MSF C;  2EZH A;  2DA4 A;  5IPA A;  3M4O J;  3S5R A;  4AC6 A;  5FMP A;  3OOU A;  5EG0 A;  3VOX A;  1JUS A;  4A3D J;  1PUF B;  2REK A;  2R5Z A;  3BQZ A;  2M8G X;  1WPK A;  4IEJ A;  4M3D A;  3MNL A;  1ETK A;  4MO7 A;  3VOK A;  1TWA J;  3A01 A;  1AKH A;  4A3E J;  3OIO A;  3BQY A;  1W0T A;  2H1K A;  2XPW A;  2LLK A;  3BCG A;  2DA3 A;  3KZ9 A;  2K9Q A;  2YVH A;  4KWA A;  3VVX A;  2ME0 A;  1MSE C;  1BL0 A;  5M3M J;  3TP3 A;  4BBR J;  3S1R J;  3BR0 A;  1ETW A;  2JK3 A;  1E3O C;  1MBF A;  5EEA A;  1UG2 A;  2GFN A;  1SGM A;  2Y0S N;  3JRC A;  1BJZ A;  1W0U A;  2ZCN A;  5JLX A;  1X2N A;  2I10 A;  2NP5 A;  4W1U A;  2R0Q C;  2DMU A;  4MK6 A;  2E2H J;  4DYR A;  1CQT A;  2UXI A;  1TWH J;  5C4Y A;  4C3H J;  3L1P A;  2ME6 A;  3ZOB A;  4ACI A;  2DMQ A;  4EEF G;  4A3M J;  3FKI J;  5HOD A;  3PO3 J;  1GUU A;  2HYJ A;  4M3F A;  4UUT A;  2FBQ A;  2OI8 A;  3FIS A;  3E7Q A;  2MSY A;  2XSD C;  2TCT A;  5EF6 A;  2AHQ A;  4RBO A;  1LFU P;  3S1M J;  3CCY A;  1MH3 A;  2K9S A;  2LTP A;  3HBL A;  3BNI A;  2DTZ A;  1GDT A;  2EZL A;  2M9H A;  2DN0 A;  1WH5 A;  1YRN A;  1XG1 A;  2YU9 J;  2V57 A;  5EYR A;  2Y30 A;  2GEN A;  3BHQ A;  2DA6 A;  2NP3 A;  2LVS A;  1WGX A;  4AUX A;  3C07 A;  1B8I A;  5CW8 A;  4LOC A;  1SFO J;  5GPA A;  1JT0 A;  2XPV A;  1TWF J;  5GPC A;  5D1R A;  4XRS G;  4CYC A;  5J3L A;  3DPJ A;  5IYB J;  1H89 C;  2HOS A;  1UHS A;  4JL3 A;  1APL C;  1ZGW A;  1IG7 A;  3JRB A;  5IOZ A;  3HDD A;  3IV5 A;  2G7S A;  3HTI A;  3JRD A;  3BG3 A;  3RD3 A;  2G3B A;  3G7R A;  2E19 A;  5F1J A;  2EH3 A;  1FIA A;  2DA5 A;  5FLM J;  2HXO A;  5HAW A;  2RAE A;  2VKE A;  2HQ5 A;  2EZK A;  1VFC A;  2DA7 A;  1JKQ C;  3S2D J;  5BNG A;  1ETV A;  1OCT C;  3S14 J;  1IV6 A;  3WHB A;  2UXO A;  3HGG A;  3GTQ J;  2ECC A;  2JA5 J;  2VPR A;  3TW6 A;  1QVU A;  1A5J A;  2QTQ A;  3GTO J;  3JRF A;  2NVY J;  3GTK J;  1TWG J;  3BR3 A;  1K83 J;  3O60 A;  1IGN A;  2Y31 A;  2RAS A;  3HKZ N;  2ECB A;  2JWT A;  4A3I J;  1NK2 P;  1JTY A;  4MXM A;  3JRI A;  3S1N J;  3MKL A;  3ZQL A;  1I3Q J;  4CGR A;  3H0G J;  4JKZ A;  4YZE A;  1F43 A;  1SAN A;  1LE8 A;  3BR5 A;  4A3L J;  1BW5 A;  2LK2 A;  3MN2 A;  3LSJ A;  1TC3 C;  3G56 A;  3HGY A;  2W48 A;  3GTG J;  2ZOY A;  5DS9 A;  4A69 C;  2VUM J;  2EBI A;  4UUS A;  5FKO A;  4MFD A;  3GTJ J;  2LP0 A;  5D19 A;  3KKC A;  3T6N A;  5DAJ A;  2L9R A;  1ZR4 A;  4A93 J;  1X2M A;  4ABZ A;  1ITY A;  3CWR A;  4G12 A;  3Q0V A;  4BY1 J;  3KKD A;  3LSP A;  1U9N A;  2XGE A;  2DMN A;  5EZG A;  5JLW A;  4IHV A;  2FQ4 A;  1GV2 A;  4L62 A;  1JKP C;  3CJD A;  2KDZ A;  2TRT A;  2JJ7 A;  1B72 B;  4M6V A;  3LSR A;  2DG8 A;  1Q1V A;  3B6A A;  1JJ8 C;  3BR1 A;  2MG4 A;  2WAQ N;  1K61 A;  5IP6 A;  4I6Z A;  5IP9 J;  1RR7 A;  4DZJ A;  2X48 A;  1RET A;  3G1M A;  5EG0 B;  3ZQC A;  1NK3 P;  5FKN A;  4GFL A;  2R5Z B;  1JUP A;  4DYC A;  4JX6 A;  3PPB A;  3S15 J;  4HNV A;  1Y1W J;  2W53 A;  3A01 B;  1AKH B;  4A3B J;  3VUQ A;  1I50 J;  3CQZ J;  2XPU A;  3FRQ A;  1WCM J;  3P9T A;  3W6V A;  2OF7 A;  1X58 A;  3BT9 A;  2JA8 J;  4JP0 A;  4X6A J;  1S7E A;  5E3L A;  1XC5 A;  2E1O A;  2KT0 A;  4QIW N;  2NX4 A;  3EUP A;  4XK4 A;  3D1N I;  3GTP J;  1JGG A;  3K2A A;  4JYK A;  4X1E A;  4UDS A;  2F07 A;  5CXI A;  2DMP A;  1LFB A;  3JR9 A;  2XDN A;  2OER A;  4XIC A;  1JTX A;  2WUI A;  5FGL A;  1FIP A;  1ENH A;  4M3B A;  3AQT A;  2R92 J;  3EGQ A;  5J1R A;  1UI5 A;  4B4C A;  2ELK A;  3ANG A;  2HOA A;  2LY9 A;  3JRG A;  4W97 A;  2YUS A;  5M5X J;  3SDG A;  4GFB A;  2HKU A;  3HTA A;  2R93 J;  5E3M A;  3FK7 A;  3SJM A;  2FJ1 A;  5E3N A;  1RES A;  2ID6 A;  1WI3 A;  2Y9Y A;  1MH4 A;  1T56 A;  1JKR C;  1MBJ A;  1JT6 A;  4MFE A;  2NVQ J;  3VVY A;  3BG5 A;  5EZH A;  3NRG A;  3VW1 A;  1MBK A;  3Q0U A;  2OPT A;  4S0H B;  2M34 A;  4D7N A;  3BJB A;  3RZO J;  3QPS A;  1YRN B;  1MBH A;  2CRG A;  2LKX A;  1ETO A;  2JA7 J;  1ETX A;  4AC0 A;  3LWJ A;  3NXC A;  3OSF A;  5FKK A;  3VW0 A;  3BTJ A;  4DW6 A;  1B8I B;  1OCP A;  4C3J J;  5J1Y A;  2GLO A;  4AF5 A;  1QPI A;  4CYC B;  3BTI A;  4QTR A;  9ANT A;  2DG7 A;  3V78 A;  4AYB N;  2XB0 X;  3G1L A;  2MGQ A;  3GEU A;  3PAS A;  1FTZ A;  5F0F A;  4BXX J;  1ZK8 A;  4Y52 J;  1JKO C;  2CU7 A;  3O8H A;  1QVT A;  1P7J A;  2LR8 A;  1FEX A;  3KNW A;  5F08 A;  2CUF A;  1JUM A;  1UMQ A;  2CQX A;  2YS9 A;  3JRE A;  3M3Y J;  2DJN A;  1EF4 A;  3ZQH A;  2N8G A;  1ZQ3 P;  3H3V K;  2R5Y A;  1ZTR A;  1FTT A;  3BRU A;  3LJL A;  4GCT A;  4MLO A;  2YVE A;  3CRJ A;  1OJL A;  2NS7 A;  5C44 J;  2COB A;  1AHD P;  2GBY A;  2NVX J;  3JRH A;  2QCO A;  3LNQ A;  3VVZ A;  4QSH A;  3NNR A;  1R9T J;  3MVP A;  5C4J J;  3GTM J;  2G0E A;  2WB1 N;  1IRZ A;  3COL A;  1DU0 A;  2DA2 A;  3K7A J;  1POG A;  2CQQ A;  3HOZ J;  2R7Z J;  3RKQ A;  3A03 A;  1TWC J;  1U8B A;  5K7H A;  2ZOZ A;  1LE8 B;  5HBU A;  2IBD A;  4XID A;  1Z77 A;  3HEF A;  5IYD J;  5K7Z A;  3BG9 A;  1XS9 A;  3DCF A;  2CUE A;  4FE4 A;  4UUS B;  4B3A A;  3BR6 A;  2QWT A;  5FHP A;  1HF0 A;  4NEL A;  5D18 A;  2H8R A;  1OFC X;  3CDL A;  1GVD A;  1HLV A;  2VI6 A;  3A02 A;  5E3O A;  5DTD A;  5EGO A;  4GCK A;  4IHW A;  3Q3S A;  1NTC A;  4DYQ A;  2M0C A;  3GTL J;  4FE7 A;  4C2M J;  4A3K J;  2X6O A;  4I76 A;  2D6Y A;  4JX4 A;  3PO2 J; 
#chains in the Genus database with same CATH topology
 3O2P E;  2VPL A;  2DA1 A;  3RPU D;  5L3G A;  2P5L C;  2G7G A;  1PUF A;  1Z21 A;  4B44 A;  3G6E I;  3HTS B;  3CP8 A;  2QKO A;  2RNJ A;  4UY8 I;  2LH9 A;  1LJ9 A;  1X3W B;  5JI6 A;  1WJD A;  2LD5 A;  2GM4 A;  3CTA A;  3EDP A;  2NS8 A;  3F72 A;  5EEH A;  3P7N A;  3E3V A;  3C2B A;  1R5H A;  3R0J A;  1VQ8 I;  3A1Y A;  3LST A;  4YRV A;  3JRA A;  4F92 B;  1QU3 A;  2XAU A;  5GTH C;  3IH3 A;  3SFZ A;  1IJW C;  4HX7 A;  5CVV A;  1VQO I;  4GO1 A;  4XRF A;  1W4M A;  1XTA A;  4F3Q A;  1G59 A;  3RQI A;  4X0G A;  5M3F J;  5E1Z B;  2IS1 A;  3BJA A;  3OOP A;  2VOD A;  1R1T A;  3HTH A;  3D5R C;  2K02 A;  5D8L B;  4I02 A;  3KZY A;  3FIW A;  4UNO A;  1AOY A;  2H09 A;  2B63 J;  3WGG A;  3N97 A;  3KP7 A;  3V42 A;  4UUV A;  5D5U B;  2GZW A;  2KJB A;  3NPI A;  5EDN A;  1WJE A;  1V54 H;  4ZC3 A;  3M8E A;  4RB1 A;  1V4R A;  2E1M B;  2P6S A;  1DGR M;  4KIB A;  4LIV A;  4MIM A;  1G3S A;  2NOJ B;  4GCL A;  5FKM A;  1NHA A;  2W25 A;  3DTE A;  3GWZ A;  3O6B B;  3CO7 C;  3HIF A;  3ZQF A;  2JVG A;  1S3J A;  2PBX A;  4M3G A;  2HXI A;  4AIH A;  4BXU A;  2ZY9 A;  5M5Y J;  4NHJ A;  3DPU A;  2RKH A;  2PQ8 A;  3NAU A;  2NOG A;  3SZG A;  1JE8 A;  2GXB A;  1IUY A;  1XB4 A;  3AG2 H;  4EQQ A;  5H9T A;  1ZN2 A;  3V7R A;  3VPR A;  4J00 A;  2VBX A;  2ZJP F;  1F5T A;  4RGU A;  4DBQ A;  1F36 A;  1IUF A;  1KQ8 A;  2H94 A;  1RZ4 A;  3KYL A;  2V79 A;  1H88 C;  2UXH A;  5F27 A;  1DPU A;  1J0R A;  1WWX A;  4JNN A;  2HDD A;  3I4N J;  3LOC A;  2X9D A;  3HKZ A;  5CKT A;  3U1K A;  5DCF A;  2R5Y B;  3GFI A;  1OQY A;  4D5C A;  5F04 A;  4C3I J;  5C4X J;  5HS7 A;  4NN1 A;  4E7Z A;  3SFI A;  1GVJ A;  1W36 C;  4L0Y B;  2YVX A;  1GT0 C;  4EV0 A;  2PZ9 A;  2DYR H;  4II3 A;  1RKT A;  2BE5 F;  2IAI A;  3FXO A;  4EJU A;  4Y4R A;  1JI8 A;  3QBM A;  4Y7N J;  3OS2 A;  2QLZ A;  1O4X A;  1ZG1 A;  3KFW X;  2X6W A;  1WI9 A;  3E1S A;  1TW3 A;  2DK5 A;  3LSG A;  3S16 J;  2CJJ A;  1UB9 A;  3KEO A;  3OIQ A;  2IPQ X;  2PX9 A;  2KPM A;  3BR2 A;  5ILV A;  1R49 A;  3SEQ A;  5J1U A;  1MMD A;  3M7G A;  3TP0 A;  2QSG X;  3ON2 A;  3FXJ A;  4LG0 A;  3HOV J;  4KIF A;  1SC7 A;  3F8B A;  4IHS A;  1OPC A;  2IU5 A;  3OMY A;  1HDP A;  4AVP A;  3BDD A;  4IHY A;  3HOU J;  3B6C A;  4ENJ A;  2V1D A;  3C3W A;  4L0Z B;  5EGO B;  1YX5 A;  2JUC A;  5IP7 J;  1R5G A;  3K9T A;  3MZY A;  4LD5 A;  3NWS A;  1XDS A;  1N25 A;  3IHU A;  4IHX A;  3S5R A;  2UXX A;  3OOU A;  4WIB A;  3VOX A;  4N9H A;  2R5Z A;  5L3F A;  2CQ7 A;  4M3D A;  4HSR A;  4B43 A;  1ETK A;  1JGS A;  4MO7 A;  1FOX A;  1TWA J;  2XIG A;  1AKH A;  3M1C A;  1UZC A;  1YYV A;  2M87 A;  2IGO A;  4OIP F;  3FM5 A;  2LLK A;  3BCG A;  2OZU A;  2DA3 A;  3QYE A;  4I7H A;  2YVH A;  3GFJ A;  1S8N A;  1IN8 A;  3GME A;  4KWA A;  1S29 A;  2F5E A;  2VQC A;  3ZQQ A;  3WTS C;  2K5C A;  5M3M J;  4LB6 B;  1TW2 A;  2DPU A;  1YJ9 I;  2E5Z A;  5EEA A;  4P5O A;  2JSP A;  2HWV A;  3OYK A;  4XLF A;  1XD7 A;  1V3F A;  3HSE A;  4KIG A;  4PSW A;  2K4J A;  2YU3 A;  4BE2 A;  2DT6 A;  2W84 A;  1FBQ A;  5H6Q A;  3OR1 C;  1TWH J;  3L1P A;  5J40 A;  3B73 A;  3ZOB A;  4ACI A;  2DMQ A;  1DQU A;  3FKI J;  3WGH A;  4M3F A;  1KU3 A;  5DCM B;  3S8P A;  3CDH A;  1U2W A;  2HYF A;  3GZN B;  4ZDL A;  1LVK A;  2ZNY A;  5EF6 A;  2MBF A;  3S1M J;  3CCY A;  1F1Z A;  4J01 A;  3REO A;  4QPQ A;  2EZL A;  3LA7 A;  4KN4 X;  1WH5 A;  4EM2 A;  3GLX A;  5KNL A;  2V57 A;  2Y30 A;  1ZRC A;  4XLC A;  3ERE D;  2GEN A;  2X0L A;  5B3S H;  1V5F A;  4RM3 A;  1WFX A;  1HW5 A;  4KIC A;  2ZJQ F;  1ZHF A;  2E60 A;  3CO6 C;  2R3S A;  3C07 A;  2DW4 A;  1SFO J;  3NEU A;  2XPV A;  2XUB A;  3U9G A;  1XGN A;  2EK5 A;  5J3L A;  4Q5S F;  5IYB J;  1N78 A;  2ZME B;  1UHS A;  1BIA A;  2EJR A;  1IG7 A;  1BR2 A;  4EJT A;  2HU9 A;  5DDG A;  2IGM A;  5IOZ A;  3HDD A;  3HTI A;  3ZCO A;  3WTV C;  2CUJ A;  3G7R A;  3RD3 A;  4MTE A;  3CMA I;  2HVS A;  5BMZ A;  2EH3 A;  1FIA A;  1R23 A;  1ZGA A;  5FLM J;  4IX7 A;  3R61 A;  2RAE A;  4FAS D;  2HQ5 A;  2EZK A;  4BAC A;  3JW4 A;  3LFK A;  1FSH A;  4B8X A;  3A0H C;  3PUB A;  3BG7 A;  3F6V A;  1XMX A;  4E7L A;  3FBN B;  5J6X A;  3LSK A;  3IL2 A;  3I3L A;  2JTV A;  4PFO A;  2XKP A;  3DWL E;  3OIP A;  1A5J A;  2EFW A;  1QGP A;  3GTO J;  1FP1 D;  3GTK J;  2BHZ A;  5JVT A;  2GXA A;  4S04 A;  2Y31 A;  1MNE A;  3FKJ A;  2ECB A;  3L2U A;  4C30 A;  2A07 F;  1FPQ A;  4WF2 A;  4XBF A;  2CUZ A;  1GLN A;  3JRI A;  3S1N J;  3DPL C;  4LIU A;  4Y3O A;  1G6N A;  2VAS A;  5EJC A;  4KMU X;  4HRI A;  4JKZ A;  2GOX B;  4Y33 A;  1SAN A;  2VIX A;  3K70 C;  1LE8 A;  1YJW I;  4A3L J;  3MN2 A;  5D6E A;  2QZ8 A;  1J7K A;  3GTG J;  4YII A;  4A69 C;  2A3S A;  1UCR A;  3VYS B;  1RI7 A;  2EV6 A;  5D19 A;  2D2W A;  3CDI A;  2L9R A;  3K4B A;  4A93 J;  2VBW A;  3CJN A;  2HZT A;  4UV9 A;  2DMN A;  4OWR B;  3G73 A;  5JLW A;  2FQ4 A;  1SFE A;  4WXD A;  1JKP C;  4C2U A;  2KDZ A;  1B72 B;  2QUF A;  4M6V A;  2DG8 A;  2L01 A;  3LQQ A;  2MG4 A;  3TOA A;  2ETH A;  1K61 A;  2R7D A;  2A6E F;  5IP9 J;  4U0V A;  4GFL A;  2Z16 A;  1UAA A;  2GIZ A;  1JUP A;  4XKC A;  1NH3 A;  2QEX I;  4LMY A;  4I09 A;  2LOO A;  5D8K B;  4PFP A;  1P4W A;  3Q9V A;  2RNG A;  5LBQ A;  4KJZ A;  1V55 H;  5ILS A;  5HVQ C;  3OYJ A;  3MKZ A;  1EV7 A;  1H9G A;  1X4P A;  3OYA A;  2JQ7 A;  5LHG A;  1EKE A;  3BT9 A;  2EB7 A;  3HOS A;  2P7C B;  4BHB A;  1XC5 A;  2E1O A;  3QPT A;  2W7N A;  3BP8 A;  1T95 A;  3D1N I;  1T6S A;  1VQ5 I;  3EUP A;  3K4J A;  1LQ1 A;  2DMP A;  1LFB A;  1JTX A;  1W5S A;  3OR2 C;  4M3B A;  1UI5 A;  3WTZ A;  4MGR A;  2ELK A;  4ENM A;  1U5T C;  3KP5 A;  1GHC A;  2IS6 A;  2WC2 A;  2EFO A;  2YUS A;  3I0T A;  4GFB A;  4IVN A;  3HTA A;  2J5P A;  5E3M A;  5E3N A;  3RTR A;  1LFP A;  2ID6 A;  2Z3Y A;  3MCZ A;  2Y9Y A;  2VOP A;  1T56 A;  1MMG A;  1R4N B;  3E97 A;  1JKR C;  2M30 A;  4MFE A;  3HJE A;  2Q8K A;  3L9F A;  1Z6T A;  5EZH A;  3NRG A;  5ICC A;  1BC7 C;  2KQR A;  1SD6 A;  2ESH A;  1MBH A;  2VT3 A;  5D5V B;  4CH7 A;  2HDW A;  3NXC A;  3CJT B;  4CCO A;  4KN7 X;  3F8C A;  2K9L A;  2CV1 A;  1KON A;  5E1W A;  4Z6Y A;  1P6R A;  2WV0 A;  4C3J J;  1FC3 A;  4CXF A;  5J1Y A;  3OYM A;  2KRC A;  3L2W A;  4HLX A;  3EET A;  5L3D A;  3BTI A;  5ICF A;  4WK8 F;  1LKX A;  2XB0 X;  3G1L A;  2KRH A;  3PAS A;  4YG2 F;  3MD2 A;  4PZJ A;  4BXX J;  4MEX F;  1MMN A;  1JKO C;  1ZG5 A;  1FEX A;  2ZSI B;  3H3Z A;  1RC9 A;  2P0W A;  3KNW A;  4OD4 A;  4XM3 A;  1YTY A;  1T8I A;  4YFK F;  2YS9 A;  3JRE A;  1FWZ A;  2E1M C;  2UZK A;  3ZQH A;  2M1B A;  1ZQ3 P;  1A31 A;  2R7W A;  4I0B A;  2R5Y A;  5LHH A;  1DUX C;  1FTT A;  3BRU A;  4MLO A;  2NRA C;  5DM7 F;  2YVE A;  4OAZ A;  2L54 A;  4XR6 A;  1N77 A;  2JRT A;  1U8R A;  4P9F A;  2NS7 A;  4IRV A;  2LG4 A;  2D45 A;  2E36 A;  4EGZ A;  3I71 A;  2ACJ A;  3A4C A;  3LNQ A;  3NNR A;  4HPQ A;  1WJ5 A;  1X3Z B;  1A6Q A;  2CQK A;  4LLG F;  2NYX A;  5C4J J;  2G0E A;  2WB1 N;  1DP3 A;  3K7A J;  2FSW A;  3M8J A;  3JAM Z;  5HDK A;  3KYD B;  5K7H A;  4CHU A;  1OLT A;  1IRX A;  3RIR A;  1LDJ A;  2IBD A;  4XID A;  2JSC A;  1Z7L A;  1J9I A;  5CJ9 A;  2V1X A;  3T5X A;  2EIN H;  2DXI A;  2AXL A;  3ZR8 X;  4B3A A;  4UUS B;  5KAI C;  4EJO A;  2MFZ A;  4AU7 A;  1KQ0 A;  1D8J A;  1Z9C A;  2E71 A;  3FMS A;  1GVD A;  3ASN H;  1XSV A;  3LAJ A;  4GYI A;  5E3O A;  4F52 A;  2HQN A;  3K8P C;  5L3C A;  3PNT A;  2R7S A;  4NQW B;  5EGO A;  2LSO A;  3OWT A;  3IC7 A;  3H35 A;  3Q3S A;  5LRR A;  2FUG 2;  3CUO A;  5GAE J;  2P4W A;  4C2M J;  5ED4 A;  3OS0 A;  2XHK A;  4I76 A;  4MEY F;  4CCL A;  4A3K J;  4TV7 A;  3GLL A;  3MEX A;  2L7M P;  1ZLK A;  3OL3 A;  1R22 A;  4BYY A;  4PJM A;  5GP9 A;  3K4N A;  3S3M A;  4HA8 A;  2MLG A;  4FX0 A;  3S1Q J;  3ANP A;  4L9T A;  1VQ9 I;  2O7T A;  4M3E A;  4BNC A;  2EQR A;  2PMH A;  1VQ6 I;  4BL0 B;  3HTJ A;  2BXY A;  3BJO A;  1T98 A;  3OSG A;  1OYI A;  4FTH A;  3SQN A;  3KPH A;  4L5I A;  3BCA A;  3UR3 C;  3AQS A;  2KIF A;  2MD0 A;  3S2H J;  2O03 A;  2BGC A;  3HOX J;  2B1E A;  4M72 A;  2HOE A;  2QKM B;  6PAX A;  1BM9 A;  3GZ6 A;  2OD5 A;  1O3T A;  2COM A;  2DU9 A;  1T39 A;  3G1O A;  5H20 A;  3H1C A;  4WWC A;  3RI4 A;  4HX4 A;  5DCM A;  1U6G A;  3FXU A;  1ZYR F;  2PN6 A;  3AL0 B;  3JCU C;  5LEJ A;  3CF5 F;  1VQM I;  4GDF A;  3ONQ A;  2GIV A;  3MWM A;  2RHA A;  1FOK A;  3LL7 A;  2VON A;  1BW6 A;  1R71 A;  1BOB A;  2GUH A;  4RB3 C;  4QPO A;  2QA4 I;  1BA5 A;  1NG7 A;  4DZP A;  3DTI A;  2KLO A;  3VOD A;  1R5I D;  1PUE E;  3L2R A;  1IN7 A;  3GEZ A;  3X2Q H;  4PJJ A;  3WTT C;  2E2J J;  3JSJ A;  3IRR A;  4QWQ A;  1VND A;  1AU7 A;  2ZSH B;  3PNV A;  3MKY B;  1T08 B;  1DU6 A;  3F9K A;  2LF7 A;  2D1H A;  1XPX A;  2ZME A;  3DTK A;  3I58 A;  5J4Y A;  2G7L A;  1FLI A;  4UVA A;  2M2E A;  5IYC J;  5CVR A;  4UB8 C;  5HNF A;  2UWM A;  2XRN A;  3LWF A;  1OCR H;  4MTD A;  5K5Q A;  5K58 A;  4A3G J;  4BQN A;  4JQF A;  1RKW A;  1P2F A;  2UV1 A;  2Q24 A;  3J7A Y;  4RAZ A;  2WAE A;  5K7F A;  1K6Y A;  4IRI A;  4V2F A;  4ANJ A;  4BKX A;  2OZ6 A;  4G7O F;  2LRD A;  2BV6 A;  4YEJ A;  3DP7 A;  3RJP A;  4CGZ A;  2DMT A;  2B0L A;  1ZKG A;  4H4K C;  1XDU A;  1X19 A;  3CP2 A;  3DBR B;  2XF5 A;  2WGB A;  3KX2 A;  2K40 A;  3WOD F;  3COA C;  1LB2 A;  2F5C A;  4XSZ F;  3WTY C;  2LFB A;  2QQA A;  4V2G A;  4J19 A;  2GQQ A;  1ZGJ A;  2L9V A;  2O8X A;  2DBB A;  4LK0 F;  2ZME C;  2AQE A;  2YPR A;  3CC7 I;  2VT2 A;  1ON2 A;  4I0A A;  3E5U A;  1I39 A;  1FYL A;  3HIM A;  2G7U A;  1GV5 A;  3G71 I;  1WSU A;  3HOW J;  3FHZ A;  2CO5 A;  2FOK A;  4HDV A;  2DOA A;  3CCE I;  1OKR A;  1XGS A;  2D5V A;  5E1X A;  4E7J A;  3F1B A;  1TQI A;  1SFX A;  3RPQ A;  1KGS A;  2ZB9 A;  1RPW A;  2A05 A;  5FJ8 J;  3GCM A;  4D1Q A;  1FOW A;  1R36 A;  2MW8 A;  2Q0O A;  3AG4 H;  1U5T B;  2XGC A;  3DKX A;  4RDU A;  4ZTF A;  3ON4 A;  5LGN A;  1WJA A;  4EVI A;  1PDN C;  1MBG A;  4ZZL A;  3WTW C;  2JA6 J;  2JVH A;  3TW7 A;  3MFK A;  2P5K A;  2L7K A;  4HOB A;  1B72 A;  3HOY J;  3W6J B;  1OMI A;  3QOP A;  3QRF F;  1R00 A;  3P9I A;  5JHF A;  2FF4 A;  2DOE A;  3D5L A;  4ZYA A;  3RYR A;  3VYR B;  1BN5 A;  5BPD A;  4AC6 A;  1W5C C;  1L0O C;  1QHG A;  2PBI A;  2REK A;  3BQZ A;  3E0J B;  4D9J A;  3CMM A;  4IOC F;  3WTU C;  5IT9 K;  3VOK A;  2L4M A;  4A3E J;  4AWX B;  3KYC B;  4BDZ A;  4KT6 A;  4EM1 A;  2H1K A;  4A5M A;  3RKX A;  4G7Z F;  2KIQ A;  2LC2 A;  1GXQ A;  1HW1 A;  2QWW A;  1P9Q C;  4O3M A;  1MSE C;  1VQ4 I;  1BL0 A;  1QBJ A;  2VQG A;  3DU6 A;  3FM3 A;  3TP3 A;  2HPI A;  2F5V A;  4GRI A;  3S1R J;  1IZ1 A;  1ETW A;  3BR0 A;  1E3O C;  1TT5 B;  2IS4 A;  2QGU A;  3K4L A;  1SGM A;  2Y0S N;  3JRC A;  1W0U A;  2EA4 A;  2GAU A;  3HRT A;  1U3E M;  2I10 A;  3C2H A;  2DMU A;  1XMA A;  2WAD A;  4MK6 A;  4DYR A;  1CQT A;  3GF2 A;  3GZ5 A;  2MD5 A;  4DJA A;  4A6D A;  1SAU A;  2KZV A;  2V9P A;  2ME6 A;  3EQL F;  1FOY A;  5HOD A;  4UUT A;  4OIQ F;  2FBQ A;  3C7J A;  3FIS A;  4XON A;  2TCT A;  1XGO A;  2BVM A;  3OYG A;  5K5R A;  1BBY A;  4YIF A;  3VSL A;  3S32 A;  1YG2 A;  2K9S A;  2LTP A;  3HBL A;  5IY5 H;  3OYF A;  2DTZ A;  1EH8 A;  2FJI 1;  4UHT A;  4AYB A;  4PGH A;  5F64 A;  5L3B A;  2UXN A;  2WTE A;  3BOQ A;  3BHQ A;  1D0Z A;  4U88 A;  4RLQ A;  2R7O A;  4AUX A;  2DDB A;  3K2Z A;  1MMS A;  2VKH A;  1X4O A;  3ZRG A;  3FXK A;  5D1R A;  1SD5 A;  3DKW A;  4HZF A;  2Y48 A;  1APL C;  1UJ8 A;  2CG4 A;  3CCQ I;  2LBF B;  3JRB A;  2VL8 A;  2I5U A;  2LMD A;  4IRG A;  4GCV A;  1OIS A;  3JRD A;  3BG3 A;  3GFL A;  5F1J A;  1WVR A;  2DOD A;  3WE2 A;  2OU2 A;  1QO0 D;  5TJJ A;  4ESJ A;  5GAH J;  4U0W A;  3S2D J;  5BNG A;  2IA1 A;  3HPG A;  1BOA A;  1BJA A;  5IT9 Z;  1QHH D;  1Y0U A;  5DYM A;  3WHB A;  3PQK A;  3GTQ J;  2DFE A;  3TW6 A;  4IL6 C;  4E7H A;  2FA5 A;  2QTQ A;  4ENK A;  1D0X A;  3BR3 A;  2VOO A;  3O60 A;  4OU0 A;  1IGN A;  3HKZ N;  1UST A;  4XLP F;  2WA0 A;  4Y15 A;  3JSP A;  1BI0 A;  4YIR X;  2Z2S B;  4RAY A;  4A0Z A;  2CV2 A;  1FY7 A;  4A12 A;  4YZE A;  1P4A A;  2OBP A;  2VKD A;  2W4S A;  4NUB A;  3LSJ A;  4QLC U;  2VBZ A;  2W48 A;  3PIP F;  2V6E A;  4OIO F;  5DS9 A;  4HF2 A;  4UUS A;  2DFF A;  3V7C A;  3GTJ J;  4MFD A;  2LP0 A;  3K4C A;  4UV8 A;  3PIO F;  1B9N A;  4FT8 A;  1YFH A;  5J4V A;  3OYI A;  3E6B A;  4ABZ A;  3H9G A;  2GWR A;  3CWR A;  2DLL A;  4BGD A;  4EJV A;  4NQW A;  2R7F A;  2ELH A;  5EZG A;  3A2K A;  4IHV A;  1QZE A;  3CJD A;  3DPT A;  2V7F A;  1Q1V A;  3B6A A;  4G6D A;  3BPV A;  4MQ9 F;  3BR1 A;  3SEZ A;  1SFK A;  3AKZ A;  2WAQ N;  3K1P A;  4I6Z A;  3HL2 A;  4DZJ A;  4S05 A;  3G1M A;  2STT A;  1E2X A;  2K86 A;  1QPM A;  5LLQ A;  1MD0 A;  2XV4 S;  2EWN A;  4PGG A;  2W53 A;  3A01 B;  1D1B A;  4EGY A;  5E20 A;  1I50 J;  4M71 A;  2XPU A;  3FRQ A;  1WCM J;  4Z2Y A;  4X6A J;  2MC3 A;  3QAH A;  2KRF A;  1W1W E;  4WCG A;  3J7Y J;  4QIW N;  2NX4 A;  3BPX A;  2QEN A;  2DDA A;  4KIT B;  1MZB A;  4OOI A;  2CW0 F;  1GXP A;  4RA2 A;  4UDS A;  4B3X A;  2XDN A;  4XLN F;  1S5L C;  4XIC A;  5FGL A;  3K1M A;  1OCO H;  1ENH A;  4HEA 2;  4YFX F;  3HZJ A;  2FOW A;  2A69 F;  3AG1 H;  3CZ6 A;  3AQT A;  2WAF A;  3RKW A;  4PDK A;  4B4C A;  3CD6 I;  3SDB A;  2HOA A;  2LY9 A;  3JRG A;  3C1D A;  5FLX K;  1EJ9 A;  4I2O A;  2MC4 A;  1XCB A;  5DM6 F;  2HKU A;  4PJN A;  2BOL A;  3FXR A;  4M74 A;  2CFO A;  4RS8 A;  2R93 J;  1E3H A;  3SJM A;  4U9N A;  3LFU A;  3O3K A;  4IRH A;  1O3R A;  1WI3 A;  5HS9 A;  4KUM A;  2DJI A;  2G7H A;  3KET A;  3PQJ A;  2E1N A;  4XKW A;  5H6R A;  1MBJ A;  1JT6 A;  3T0Y A;  5KAF C;  4ENN A;  2BBY A;  2DTR A;  3GYH X;  1Y39 A;  2PI0 A;  1MBK A;  3QYB A;  4S0H B;  3FXQ A;  5FRN A;  3RZO J;  3BJB A;  4XOR A;  2CRG A;  3CUQ C;  2JA7 J;  4AC0 A;  2X6Y A;  3LWJ A;  1TZL A;  4OMZ A;  1QZZ A;  5FKK A;  2FRH A;  3L2V A;  1WQ2 A;  1ULY A;  3VW0 A;  1IN4 A;  2H8W A;  1B8I B;  1MND A;  1R7J A;  1YI2 I;  1BR1 A;  2XAJ A;  1UFM A;  2K7L A;  4BXF A;  4AF5 A;  3HHH A;  1TNT A;  3FBI B;  5JFR A;  3KLO A;  3GEU A;  5KCM A;  3ASO H;  4ON0 A;  2FNP A;  1TTY A;  5F0F A;  1J59 A;  1O3S A;  3O8H A;  1QVT A;  2OTL I;  3AL0 C;  2CUF A;  1JUM A;  1UMQ A;  2CQX A;  2XF7 A;  3QPH A;  2AXT C;  4L9N A;  1AWC A;  4XQF A;  3H3V K;  2KKO A;  4BUP A;  1S7O A;  3LJL A;  3GXO A;  1IRF A;  2RV8 A;  1B4A A;  4BAY A;  2KIU A;  3CRJ A;  1SVM A;  4HW0 A;  2F5F A;  2WY7 Q;  1SFU A;  2COB A;  4OIN F;  1AHD P;  4F93 B;  1ZRD A;  3KLN A;  1E0E A;  1TBX A;  3FMR A;  2IXS A;  3NWT A;  1F4K A;  2KL4 A;  4QSH A;  2JPB A;  1VQ7 I;  1I6X A;  1B9M A;  1FT9 A;  1NG6 A;  1IRZ A;  1BI1 A;  3COL A;  1M1E B;  2DA2 A;  2B9S A;  1POG A;  2X4H A;  4HF0 A;  2ADU A;  3RKQ A;  1O3Q A;  2O3F A;  4KIS A;  3CLO A;  1U8B A;  2ZOZ A;  1Z77 A;  2HNH A;  2HVQ A;  5LD2 C;  5FLX Z;  3I4P A;  1XS9 A;  3BG9 A;  3B02 A;  2HYG D;  4NC7 A;  1ZRF A;  1I3A A;  4FE4 A;  4BEH B;  4BHC A;  2QWT A;  1O7L A;  1XGM A;  1RIO H;  3ISP A;  2LY2 A;  4YFN F;  1G3Y A;  3IUO A;  4E7I A;  3RCO A;  1ZAO A;  1U5T A;  3Q9S A;  2MH2 A;  4HV5 A;  4F91 B;  2X1C A;  1HLV A;  2RDP A;  2VI6 A;  1KU7 A;  4HDU A;  5DTD A;  3OYD A;  1Z91 A;  3WTX C;  1MIJ A;  4GGG A;  4BJ5 C;  2PLY A;  3BLY A;  4IHW A;  1DGW Y;  1KQ9 A;  1Y6I A;  2Z33 A;  2QKL B;  2ICW G;  3G2B A;  2RN7 A;  2W24 A;  5J8C A;  3W2V A;  3PFI A;  3J7Z I;  2DQR A;  3JTG A;  3WG7 H;  2A61 A;  1F9N A;  1T38 A;  3DEW A;  3TMO A;  3SZT A;  1U0J A;  2F2E A;  1WZ2 A;  3IH2 A;  5F0C A;  3R0A A;  4O5V A;  3HB9 A;  4G7H F;  4R79 A;  4XSX F;  3J81 Z;  1KU9 A;  3QPL A;  3E5X A;  2V26 A;  3VEP A;  4AIJ A;  4ZYD A;  3F6O A;  2HFH A;  2D1V A;  1T2K A;  1YIO A;  3F8N A;  4HNT A;  1G3T A;  1X1A A;  3TKY A;  2VKV A;  3QQA A;  3E7L A;  2ZJ2 A;  1FNN A;  2O9L A;  1LPQ A;  3F0C A;  2W85 A;  3JAM K;  2DO7 A;  4FX4 A;  1IXS B;  2A2F X;  4F7Z A;  5IOY A;  4RGR A;  2ZO4 A;  2VQH A;  2BY2 A;  1ZR2 A;  3CLQ A;  2WV1 A;  4BBS J;  2DPD A;  2NS0 A;  2NNY A;  2C6Y A;  3FWE A;  4KMF A;  3HYI A;  3J7A O;  4MHG A;  3I9V 2;  3CMY A;  3NI7 A;  5K1Y A;  2XRL A;  2JRM A;  2K85 A;  3LHQ A;  1KU2 A;  1UEL B;  1VI0 A;  3P5J A;  4NNJ A;  1FBS A;  2L9N A;  5E18 F;  1I6H J;  4BJT A;  2L7F P;  1HDD C;  2CFX A;  2AO9 A;  4CIC A;  4ME9 A;  2IW5 A;  2IP2 A;  4PXI A;  1TQP A;  3J80 Z;  3ZQG A;  2RQP A;  1TP4 A;  1IDZ A;  4CA0 A;  4HKU A;  1KA8 A;  1IXC A;  1ETQ A;  2YX7 A;  4GYG A;  4IZZ A;  1IAW A;  1HKT A;  4G94 A;  2CH0 A;  3K0L A;  4XLA A;  2K3F A;  3LSM A;  3FXL A;  3ZXS A;  2DQL A;  3QU3 A;  2GA2 A;  3CF2 A;  2EIJ H;  3DXJ F;  5CVU A;  5FO5 A;  3VP5 A;  1SVL A;  3KZI C;  3VIB A;  2H1L A;  4D7M A;  3TBI A;  3S2W A;  5B1A H;  2EZI A;  1D3Y A;  5CXG A;  2LBF A;  5AQC A;  2JZY A;  2XAS A;  2BW3 B;  2HTS A;  4WXH A;  1Z7U A;  1VQP I;  2ZXI A;  3D5S C;  2BXZ A;  3I5U A;  4LJZ F;  5HS8 A;  4ICH A;  1G3W A;  1IV8 A;  1X3U A;  2I8D A;  2CW7 A;  3V4G A;  2L0K A;  2QF7 A;  3KEY A;  4XN0 A;  4E6K G;  2M3A A;  4B1R A;  2JMW A;  2QVO A;  2FML A;  3K10 A;  3P9C A;  1SMY F;  4A2U A;  2R7T A;  2QIB A;  4FCY A;  3LSH A;  1QRY A;  3I4M J;  2KFD A;  4UB6 C;  4ASN A;  1H8A C;  1Y8Q B;  4CCN A;  3TED A;  3ZN0 A;  5KK1 A;  2QSH X;  3ZGK A;  3VYT B;  1Y1V J;  5E8I A;  5F6F A;  5B5E C;  3OYB A;  4BY7 J;  4E7K A;  1D5Y A;  1Z0X A;  1I5Z A;  4U87 A;  2PMZ N;  1FJL A;  3FX3 A;  4RB2 C;  2R7R A;  1P7I A;  5M5W J;  1PYV A;  3BWG A;  1E17 A;  3RH2 A;  3GFM A;  3TQN A;  2KIM A;  2R7Q A;  1LEA A;  1U78 A;  1PP7 U;  2ZCM A;  1DDN A;  1FSE A;  1MMA A;  3ESW B;  2OA4 A;  1SEU A;  4IQ4 A;  1WHU A;  2O6G E;  1UI6 A;  5FD5 A;  5EFY A;  3IUV A;  1IW7 F;  1VZ0 A;  1IDY A;  2VJJ A;  5J8F A;  2PEX A;  4KT5 C;  1YHQ I;  2NVT J;  4D5F A;  3LMM A;  3S17 J;  3M9A A;  1OR7 A;  2RVC A;  3H3U A;  4GXO A;  3S3N A;  3GUD A;  4GFK A;  2XB5 A;  1MDM B;  1IC8 A;  2DA4 A;  2QYO A;  2A6T A;  1MJ9 A;  4IHT A;  4E70 A;  2X6X A;  4PCQ A;  1J75 A;  3KP4 A;  1L3L A;  3A01 A;  3CCM I;  3OIO A;  5BPI A;  3BQY A;  2ZJR F;  3CUQ B;  2CGP A;  4G9Y A;  3DLL F;  2QBY B;  2LDU A;  3FZV A;  2CYY A;  1J2X A;  3KZ9 A;  4DBR A;  2V9V A;  3CCV I;  3VVX A;  4Q4Z F;  1TLH B;  2FNA A;  5DD8 A;  1ZRE A;  3DBL B;  3ZN1 A;  2JK3 A;  1W7P D;  1HSJ A;  4CCM A;  1UG2 A;  1Y8R B;  4II2 A;  2HS5 A;  3TDU C;  1BJZ A;  2AS5 F;  2ZCN A;  4LK1 F;  1B1B A;  1XCV A;  2EIK H;  2V1N A;  2JUG A;  2X85 A;  4HV6 A;  4RGX A;  5AIP A;  5E79 C;  1S6L A;  3E6M A;  3FF5 A;  2E2H J;  4DQ2 A;  1OR7 C;  5C4Y A;  3ZMU A;  5B66 C;  1SAX A;  1MGT A;  4CSW A;  1X1B A;  1IXR C;  2ZKZ A;  3ML6 A;  3PO3 J;  1R4M B;  4DOZ A;  2A5Y B;  1GUU A;  2ZXJ A;  2HTJ A;  3U2R A;  2HQR A;  1BC8 C;  3IAM 2;  5TRD A;  3EUA A;  3MMY B;  5GAD J;  3PJR A;  4JBA A;  4IF4 A;  2AHQ A;  5D4R A;  4RBO A;  3SWH A;  1LFU P;  1YIJ I;  1YS6 A;  3HTU A;  1WJC A;  4XOP A;  4IO9 F;  2M4K A;  1X1P A;  5FRO A;  1MJA A;  4U0Y A;  2E1C A;  3L7W A;  3TOB A;  2VQL A;  3ZMZ A;  2YU9 J;  1XG1 A;  1JHF A;  5F1R A;  2L4A A;  2XGX A;  5EYR A;  3LA2 A;  2FU4 A;  2DA6 A;  1SD7 A;  2XAF A;  4G8X A;  1S9H A;  5FFX A;  1TL8 A;  2NP3 A;  1J5Y A;  4C2T A;  3T8T A;  2NAZ A;  4M6Y A;  2E7X A;  1B8I A;  4F55 A;  5E17 F;  5CW8 A;  1I27 A;  4U7B A;  4LOC A;  1TWF J;  4RAG A;  5GPC A;  1I1S A;  3DPJ A;  3IWF A;  5CYV A;  5FB2 A;  4JL3 A;  1ZGW A;  3F8M A;  1PJR A;  3H9Q A;  4KA4 A;  3DU5 A;  2G3B A;  4LFU A;  1G8X A;  2IJL A;  3KEQ A;  2VXZ A;  4NB5 A;  3CCS I;  2DA5 A;  1XN7 A;  2PJR B;  2HXO A;  5HAW A;  4BE1 A;  3CCL I;  5HDG A;  3I64 A;  3ABU A;  2L02 A;  3KZZ A;  3WU2 C;  1VFC A;  4XMY A;  4G6T B;  1WKM A;  2K4B A;  4M73 A;  1ETV A;  5B1B H;  1OCT C;  3S14 J;  1IV6 A;  3AAF A;  2MA3 A;  2JT1 A;  2UXO A;  4XN3 A;  2KHM A;  2JA5 J;  3TDZ C;  1QVU A;  4C9Y A;  3TO7 A;  2VJI A;  3WU0 A;  2XDV A;  1YW9 A;  1K83 J;  4E7S A;  3ZP5 A;  1CF7 B;  2DI3 A;  2CW8 A;  4UVC A;  2JWT A;  3PUF A;  2MH9 A;  2PFB A;  1FZP B;  3IRQ A;  4HQM A;  3ABT A;  4BQA A;  3ZQL A;  1I3Q J;  4XLH A;  2JA2 A;  3H0G J;  4CO8 A;  5IT3 A;  4CGR A;  3BR5 A;  1BW5 A;  1HW2 A;  3RDI A;  4LLN A;  3H5N A;  4IJA A;  2V4J C;  3HGY A;  5GAG J;  1TC3 C;  3G56 A;  4ITV A;  1QNT A;  4BEH A;  2FXA A;  2VUM J;  2EBI A;  5D5W B;  4PSX A;  5FKO A;  3SZP A;  5LHI A;  1ZG3 A;  3KKC A;  1ON1 A;  5DAJ A;  3JSO A;  1ZR4 A;  1KYW A;  1X2M A;  4FHT A;  4G12 A;  2VE8 A;  3Q0V A;  1JXS A;  3LSP A;  2B3W A;  4KNY A;  1EA3 A;  1GV2 A;  3ROU A;  3VYU B;  2A68 F;  2P6T A;  2TRT A;  2XAQ A;  2F4O B;  5CVJ A;  4A0Y A;  1JJ8 C;  3ABM H;  3DEE A;  2IS2 A;  3K1N A;  1RR7 A;  3OYE A;  1RET A;  5EG0 B;  3ZQC A;  1TNS A;  4ESF A;  2DCE A;  3R6S A;  1D5V A;  4L9V A;  5H2F C;  1Y1W J;  5ERI A;  4BQQ A;  1YO5 C;  1P4X A;  4A3B J;  3VUQ A;  4V19 K;  2FBI A;  3KE2 A;  2OF7 A;  2Q2E B;  3W6V A;  1X58 A;  2W1O A;  2Y0S A;  4PUS A;  4JP0 A;  4U7D A;  3N4M A;  1RUO A;  2JA8 J;  1S7E A;  4A5N A;  3BJ6 A;  3S93 A;  2LF8 A;  4XK4 A;  3NRV A;  3K2A A;  2XVC A;  5CXI A;  3JR9 A;  3LAP A;  2OER A;  2WUI A;  1BIB A;  2VJ5 A;  1FIP A;  5HLH A;  2R92 J;  3I59 B;  3EGQ A;  5J1R A;  4LIT A;  2O0Y A;  3ULQ B;  3D0S A;  1Z1D A;  2EV0 A;  3R4K A;  4KYW A;  1P92 A;  1N75 A;  2WBM A;  3BZK A;  2ZCW A;  4W97 A;  3K69 A;  5M5X J;  4CYD A;  2P5V A;  3SDG A;  4BH9 A;  2EIM H;  3F22 A;  3M1E A;  3OY9 A;  3FK7 A;  1YQA A;  3DFG A;  2FJ1 A;  2DK8 A;  1FMW A;  1RES A;  4OAY A;  3IKT A;  3PNY A;  1Z05 A;  1MH4 A;  4ZJZ A;  3PFY A;  2NVQ J;  2AQF A;  2ISY A;  3BG5 A;  1XSX A;  4H0E A;  2OPT A;  1R6R A;  2M34 A;  2ISZ A;  3HHG A;  3QPS A;  1YRN B;  2LKX A;  1ETO A;  1ODD A;  4LLL A;  4PJ0 C;  2NVU B;  3BTJ A;  2LY1 A;  1CGP A;  3OS1 A;  2XSJ C;  5DUI A;  3GX4 X;  2QQ9 A;  4CYC B;  1XSD A;  1STZ A;  3BZC A;  4HBL A;  1IN6 A;  3EYY A;  4QTR A;  9ANT A;  3V78 A;  4AYB N;  3ABK H;  2DYS H;  2M7A A;  3T1B A;  2BW3 A;  1HKS A;  1FTZ A;  3MQ0 A;  3L2C A;  3DF8 A;  4CDG A;  4Y52 J;  2JPC A;  2CU7 A;  3ZQ7 A;  5L3E A;  5F08 A;  2X1D A;  4ZTJ A;  3M3Y J;  2DJN A;  1EF4 A;  5JR3 A;  2N8G A;  5LGU A;  2M4G A;  3H36 A;  3VTI A;  1WJF A;  2VBY A;  4HAM A;  3ZMS A;  2LKS A;  1ZTR A;  4N0B A;  1UG0 A;  4AID A;  2BYV E;  3DEU A;  4BS9 A;  1KZH A;  3UNG C;  3I53 A;  3HRM A;  1OJL A;  3QOE A;  3I54 A;  4R1H A;  2CSO A;  2BY0 A;  3I56 I;  3JRH A;  2KZG A;  2QCO A;  1VQL I;  4NC6 A;  5J47 A;  3HC7 A;  4AD9 A;  3EUH A;  3MVP A;  3QP6 A;  3QP5 A;  1HBX G;  3GTM J;  4ZH4 F;  2OCC H;  3LQR A;  1W36 D;  1DU0 A;  4IPA A;  1WRJ A;  2R7Z J;  4AM3 A;  3A03 A;  5E8G A;  3IP4 B;  5HBU A;  2BVL A;  3HEF A;  1W7P B;  5IYD J;  1BR4 A;  2KDO A;  1RUN A;  3BR6 A;  1LNW A;  1HF0 A;  5D18 A;  5HNH A;  1Z67 A;  1Z3X A;  3HRS A;  1K4T A;  2H8R A;  2F4I A;  4RLF A;  2E5N A;  3A02 A;  2IA0 A;  4OD5 A;  4ETS A;  2WAQ A;  1FBU A;  2W82 A;  5TIS C;  1ACI A;  2QM3 A;  1NTC A;  4DYQ A;  2M0C A;  2QQ8 A;  2VB6 A;  4A6E A;  3GTL J;  4DGW B;  1S7A A;  2X6O A;  4P9U A;  2D6Y A;  2XAG A;  2VJ4 A;  3U21 A;  1MDM A;  3GW2 A;  4EAT A;  1X1C A;  4BDY A;  3EUH C;  4ZYH A;  5FRM A;  5ILU A;  3DV8 A;  3I55 I;  2V6C A;  1G2H A;  2JN6 A;  2V9K A;  3AFH A;  5C3E J;  3OYN A;  3KP6 A;  3GVA A;  4JX5 A;  1ZH5 A;  2EFQ A;  5HLG A;  2UXU A;  3F8F A;  4E4H A;  3GBG A;  1S72 I;  2ID3 A;  1J09 A;  2HI3 A;  3CUQ A;  5CQE A;  2FEZ A;  1TQM A;  4M6X A;  2K27 A;  2ZFU A;  2QBY A;  2V1U A;  1T33 A;  2FE3 A;  3PSF A;  3IAS 2;  2HDC A;  3VW2 A;  4KFC A;  2X51 A;  4JOM A;  2RC4 A;  2E34 A;  5HLI A;  2GA1 A;  1JHH A;  3HRU A;  3NAR A;  2VXD A;  2PMU A;  1YW7 A;  2DFH A;  1R1U A;  3PM1 A;  5D4S A;  2LNB A;  2OJE D;  2EFN A;  3FXM A;  3DBH B;  3HM5 A;  2OV7 A;  2E2I J;  1A36 A;  2XGD A;  1RRJ A;  1REP C;  3M8F A;  2IGN A;  2VC1 A;  2VE9 A;  3V8L A;  4Q47 A;  4DNC A;  2QOP A;  5HSZ A;  2DAO A;  2O7O A;  4AIK A;  3ELK A;  4OMY A;  3G4S I;  4XRS A;  3UKG A;  1Y56 A;  2HEO A;  5BQT A;  4XRM A;  3DLA A;  5BOX A;  2HOT A;  1FYM A;  3JTH A;  3K4K A;  5ICE A;  4BHP A;  2BEO A;  1JJ6 C;  4DVY P;  2FD5 A;  3KIO A;  4B47 A;  4XL9 A;  4B48 A;  4NDL A;  2WWY A;  3MZ8 A;  1ORK A;  2ZFW A;  1H0M A;  3HUG B;  2P81 A;  2O8K A;  3BTL A;  1IO2 A;  1U9O A;  3TGN A;  3EYI A;  3ZQI A;  2IEK A;  3O8G A;  2E35 A;  3H9J A;  3J81 K;  4HLY A;  2J5O A;  4A3J J;  1B6A A;  2EV5 A;  3M07 A;  2BZT A;  1DP7 P;  1KYZ A;  3BTC A;  4PK4 A;  3V6G A;  4ESB A;  1B59 A;  2Y0M A;  3IH4 A;  2ZCX A;  1MBE A;  1E3P A;  2L2O A;  1YLF A;  2Y2Z A;  3CC2 I;  4HST A;  3H0D A;  2R4G A;  2PJR A;  2P8T A;  3B81 A;  2HKX A;  1A6I A;  1UHM A;  2LKP A;  3VWB A;  4RB0 A;  3IWZ A;  4N4O B;  2HR3 A;  4NC8 A;  2FBH A;  4EMS A;  2M7B A;  1LVA A;  3FK6 A;  1QZY A;  1K78 B;  4BU2 A;  1SMT A;  2FX0 A;  3ZMD A;  4DIQ A;  5F0H A;  1DPR A;  1H9T A;  2STW A;  2K9N A;  4P1W A;  2HYT A;  2EIL H;  4L5E A;  3WG9 A;  1Q1H A;  3J80 K;  1CF7 A;  1ETY A;  3GZI A;  2A6H F;  1LDD A;  2PFV A;  2YX4 A;  2E7W A;  2OQG A;  3ABL H;  4XNF A;  1VF9 A;  2BHY A;  4A3C J;  4P96 A;  1Z6R A;  1R1V A;  3VDX A;  2L7Z A;  5D6F A;  3WHC A;  4FIS A;  1K4S A;  2QSF X;  1WH7 A;  2XAH A;  1LDK B;  3TO6 A;  4IQJ A;  5CVI A;  1LUJ B;  1MNM C;  4UVB A;  4FET A;  2ZC2 A;  5FLV A;  1D1A A;  2YSR A;  5HOO A;  3E6D A;  2L9S A;  3K70 D;  4LGW A;  1HOM A;  4RGS A;  3RZD J;  5FKL A;  3SHF A;  1V5E A;  3Q0W A;  1HCR A;  2BY1 A;  4PJL A;  2CQN A;  3CES A;  3CC4 I;  4M9Z A;  4A3F J;  3ZMT A;  1K6O A;  1EH7 A;  3HE0 A;  1HQC A;  1TT0 A;  2Y9Z A;  2Z9O A;  5D5X B;  3QKX A;  5FFZ A;  3ZMV A;  3DKY A;  2HGC A;  3BRO A;  2UXP A;  1MSF C;  2Y69 H;  1T0F A;  2EZH A;  5IPA A;  3M4O J;  5FMP A;  2KMU A;  5EG0 A;  2LYC A;  1JUS A;  4A3D J;  2DT5 A;  2P7V B;  4ZDO A;  1PUF B;  1O7F A;  2M8G X;  1WPK A;  4IEJ A;  3CCU I;  3MNL A;  3ZPL A;  3SYT A;  4XKV A;  4K2E A;  5DV5 A;  3CME I;  1MJB A;  1W0T A;  2XPW A;  1FX7 A;  3WE3 A;  1BI2 A;  2Q2E A;  3BC8 A;  4FQG A;  4B09 A;  1ONV A;  2IT0 A;  2K9Q A;  4XLE A;  1K7A A;  1QA6 A;  4L5J A;  3T8R A;  2ME0 A;  4CCJ A;  4Y13 A;  4MQV A;  3W2A A;  3HG9 A;  3KCC A;  4BBR J;  1YOV B;  3L00 A;  3H5A A;  1MBF A;  2B7E A;  5BS6 A;  2GFN A;  3W6K B;  2F4M B;  2TDX A;  5JLX A;  1X2N A;  2DFI A;  3I59 A;  5ICG A;  5HDN A;  3HPH A;  2MLK A;  4M9X A;  2NP5 A;  4W1U A;  2R0Q C;  1BI3 A;  2DT7 B;  2UXI A;  2KP6 A;  4C3H J;  1HKQ A;  3MKW B;  2K9M A;  5LRS A;  4EEF G;  4A3M J;  1T0F C;  2HYJ A;  2OI8 A;  3BG6 A;  3E7Q A;  2GXG A;  2MSY A;  2OC6 A;  3LA3 A;  5KHD A;  2XSD C;  3CJQ B;  3FMQ A;  2UUZ A;  3V8K A;  2K3P A;  1OYW A;  3NS4 A;  4N9I A;  3F23 A;  2IVM A;  1MH3 A;  2R7V A;  3F3X A;  3QYF A;  3BNI A;  3OYC A;  1GDT A;  4IKF A;  2M9H A;  2DN0 A;  1YRN A;  4BJ6 C;  4XOT A;  2FMY A;  2Z99 A;  4HX8 A;  5CQG A;  2LVS A;  2XRO A;  1LEB A;  1WGX A;  1AA7 A;  3H92 A;  2IA2 A;  2YR2 A;  2NNN A;  4JK1 X;  3ECH A;  5GPA A;  1JT0 A;  5HLT A;  4XRS G;  4CYC A;  1O57 A;  4HQE A;  1H89 C;  3QU6 A;  2HOS A;  2R7X A;  2X1E A;  2L5Q A;  1RR8 C;  4R8H A;  5KVR A;  1ERD A;  1EH6 A;  3HXL A;  3IV5 A;  2G7S A;  1IN5 A;  2F6C A;  2WY8 Q;  2O5R A;  3L09 A;  2E19 A;  1YS7 A;  3MZH A;  3KP2 A;  3HSR A;  3PSI A;  1PP8 F;  2OUM A;  4CZC A;  2VKE A;  2OAZ A;  2F5D A;  2DA7 A;  1JKQ C;  4ZZD A;  2WB1 A;  4I01 A;  2Z5U A;  3HGG A;  3A0B C;  2ECC A;  2H6C A;  2VPR A;  1MKM A;  1YX3 A;  4LG3 A;  3JRF A;  3HSF A;  2NVY J;  1TWG J;  5LFA A;  4CCK A;  3U1D A;  1W5T A;  2FBK A;  2RAS A;  1HST A;  4A3I J;  3QOD A;  2PMZ A;  2XKO A;  1NK2 P;  1JTY A;  4MXM A;  4L18 B;  2LRE A;  3MKL A;  2W00 A;  3FDY A;  2PG4 A;  1F43 A;  3VB2 A;  5DD4 A;  1UHW A;  2LK2 A;  1VQK I;  1W7P A;  2ZBK A;  3SXY A;  2ZOY A;  1YW8 A;  3S3O A;  2M45 A;  2CMP A;  1MW7 A;  3T6N A;  4LG0 B;  4P55 A;  4KDP A;  3BCB A;  5AON A;  3OV8 A;  4D0P A;  1FYK A;  1ITY A;  4MNU A;  1VQN I;  4BY1 J;  3KKD A;  1QQI A;  1U9N A;  2XGE A;  3BZ6 A;  5JVG F;  4L62 A;  5DUK A;  3OYL A;  2JJ7 A;  1IRG A;  1R58 A;  3IKV A;  2H6B A;  3LSR A;  1D0Y A;  1C0W A;  5IP6 A;  4OIR F;  3RSN A;  2X48 A;  2MYS A;  1NK3 P;  5FKN A;  2VLA A;  4L9J A;  3CJR B;  4WXC A;  3RYP A;  2R5Z B;  2RQQ A;  3FHN A;  4DYC A;  4JX6 A;  2ESN A;  3PPB A;  2ZNZ A;  3S15 J;  3OL4 A;  1SVO A;  4HNV A;  3V7S A;  2EPF A;  1AKH B;  3VOE A;  1VTN C;  3RQ4 A;  1XX5 A;  1A35 A;  3CQZ J;  4N4N B;  2OQR A;  3P9T A;  4ZYG A;  2CV0 A;  1XMK A;  3H5R A;  5E3L A;  5JHU A;  3KP3 A;  1USS A;  1X1D A;  2HKO A;  2KT0 A;  3GTP J;  1OCZ H;  1Z3Y A;  1JGG A;  4JYK A;  4X1E A;  2RRE A;  4IOA F;  2F07 A;  4ZYE A;  1YE9 A;  2ZXW H;  2G9W A;  2XF6 A;  4YEL A;  3MAJ A;  3EUK L;  3PL8 A;  3ANG A;  4IXA A;  5A2Q K;  3LSI A;  3QWL A;  4CZZ A;  2XC7 A;  2R7U A;  2RGV A;  3VFZ A;  3V8J A;  3NQO A;  1K79 A;  2EFP A;  1PVE A;  2F48 A;  1D1C A;  2W57 A;  3P9K A;  3OYH A;  1YIT I;  2OTJ I;  3VVY A;  4AVZ A;  4Q48 A;  2ZXH A;  3VW1 A;  3Q0U A;  2HPM A;  2A5W A;  4D7N A;  3HUG A;  3N05 A;  3ECO A;  2FQ3 A;  4HYE A;  1ETX A;  4O6J A;  2O61 A;  2BY3 A;  2EA2 A;  3VSK A;  3OSF A;  4WX9 A;  3F21 A;  4RMN A;  3Q5F A;  4DW6 A;  1OCP A;  3EPZ A;  4M9S A;  2CS3 A;  3TO9 A;  2GLO A;  1QPI A;  1D8K A;  5AIQ A;  3RKY A;  1IF1 A;  2DG7 A;  2Q1Z B;  2QQB A;  2MGQ A;  3HOT A;  1OYY A;  4EJW A;  4ZDP A;  1HA8 A;  1ZK8 A;  2Z1D A;  1P7J A;  2LR8 A;  3ERM A;  3GO5 A;  4HNU A;  1V5G A;  2KJC A;  3AG3 H;  2L3D A;  5LEK A;  4UXN A;  2M8E A;  4RM2 A;  4U9L A;  3K4M A;  3W3C A;  3E6C C;  2VC0 A;  2KIS A;  5GTI C;  2CWE A;  4CUG A;  5FD6 A;  4GCT A;  1K78 A;  2ELJ A;  2DOF A;  2HQA A;  3C2G A;  1OCC H;  2MAB A;  5C44 J;  1HC8 A;  2GBY A;  1ZEL A;  2NVX J;  4EM0 B;  2NXN B;  3VVZ A;  1G4D A;  1R9T J;  3RPU A;  3TL4 X;  3W2W A;  3WU1 B;  2M0M A;  3CCJ I;  4HG2 A;  3K6G A;  1WJB A;  2CQQ A;  3HOZ J;  1FP2 A;  1A04 A;  5TGT A;  2PJP A;  3R60 A;  4I98 B;  2GOM A;  1TWC J;  1Y0N A;  5CLS A;  1LE8 B;  2OCE A;  4BQO A;  5A2Q Z;  1I1G A;  1HXD A;  4I99 C;  5FGM A;  5DEQ A;  4C2M A;  5K7Z A;  3C18 A;  3DCF A;  2CUE A;  4A0X A;  4BE0 A;  5K5O A;  2IRF G;  4HF1 A;  2IGK A;  3DQV C;  2M5W A;  5FHP A;  2HZD A;  1YJN I;  5EEG A;  1ZLJ A;  2Y75 A;  5LGT A;  4NEL A;  5CPR B;  4LB5 A;  3BY6 A;  1OFC X;  3CDL A;  3E5Q A;  4XKB A;  4RAF A;  1FMV A;  1SD4 A;  4G6Q A;  2HVR A;  4NBQ A;  3CCR I;  4GCK A;  3G3Z A;  2H27 A;  3L2Q A;  1ZAR A;  4Y17 A;  4FE7 A;  3WGI A;  1RNL A;  4JX4 A;  2VN2 A;  3PO2 J; 
#chains in the Genus database with same CATH homology
 2L7M P;  2DA1 A;  2G7G A;  1PUF A;  5GP9 A;  3DEW A;  1G2H A;  2QKO A;  2JN6 A;  5C3E J;  4JX5 A;  2UXU A;  3IH2 A;  5F0C A;  3GBG A;  2LD5 A;  3S1Q J;  3ANP A;  2ID3 A;  3HB9 A;  2GM4 A;  2HI3 A;  2O7T A;  4M3E A;  2NS8 A;  2EQR A;  3QPL A;  1T33 A;  3HTJ A;  3VW2 A;  3OSG A;  3C2B A;  4FTH A;  2VKV A;  3QQA A;  3E7L A;  3JRA A;  3NAR A;  3AQS A;  3S2H J;  2O9L A;  3IH3 A;  3F0C A;  3HOX J;  1IJW C;  3PM1 A;  5IOY A;  3HM5 A;  3RQI A;  2E2I J;  5M3F J;  2XGD A;  1ZR2 A;  2WV1 A;  4BBS J;  3HTH A;  3FIW A;  3CMY A;  3NI7 A;  2B63 J;  2XRL A;  3LHQ A;  3G1O A;  2QOP A;  1VI0 A;  5HSZ A;  2O7O A;  1I6H J;  3NPI A;  5EDN A;  4XRS A;  2L7F P;  3UKG A;  1HDD C;  2AO9 A;  4XRM A;  4ME9 A;  2RHA A;  4MIM A;  2HOT A;  1BW6 A;  4PXI A;  3ZQG A;  4GCL A;  2GUH A;  1JJ6 C;  1IDZ A;  5FKM A;  1BA5 A;  4HKU A;  2FD5 A;  1ETQ A;  4DZP A;  4NDL A;  1ORK A;  3ZQF A;  2P81 A;  2O8K A;  3BTL A;  2PBX A;  1U9O A;  4M3G A;  2E2J J;  3JSJ A;  3ZQI A;  2HXI A;  2IEK A;  1VND A;  1AU7 A;  3O8G A;  5M5Y J;  3VP5 A;  3VIB A;  1DU6 A;  4D7M A;  4A3J J;  3NAU A;  2NOG A;  2EZI A;  5H9T A;  5CXG A;  3BTC A;  2G7L A;  3V6G A;  3VPR A;  3IH4 A;  5AQC A;  2ZCX A;  1MBE A;  2M2E A;  5IYC J;  2Y2Z A;  1F36 A;  1IUF A;  5K58 A;  4A3G J;  1H88 C;  2UXH A;  1RKW A;  5F27 A;  3B81 A;  1A6I A;  4ICH A;  2Q24 A;  4JNN A;  2HDD A;  5K7F A;  3I4N J;  2L0K A;  2QF7 A;  3LOC A;  2X9D A;  2R5Y B;  3FK6 A;  4V2F A;  5F04 A;  4BKX A;  4D5C A;  4C3I J;  5C4X J;  4B1R A;  2JMW A;  4NN1 A;  3SFI A;  2FX0 A;  5F0H A;  2DMT A;  1ZKG A;  2K9N A;  4FCY A;  2QIB A;  1GT0 C;  2HYT A;  2PZ9 A;  2WGB A;  2K40 A;  4L5E A;  1QRY A;  1RKT A;  3I4M J;  1ETY A;  3GZI A;  1H8A C;  2IAI A;  2LFB A;  3TED A;  3QBM A;  4Y7N J;  4V2G A;  4J19 A;  1VF9 A;  1O4X A;  1Y1V J;  4A3C J;  4BY7 J;  1D5Y A;  1Z0X A;  1FJL A;  2L7Z A;  2PMZ N;  3LSG A;  4FIS A;  3WHC A;  2CJJ A;  3S16 J;  3HIM A;  5M5W J;  1P7I A;  1GV5 A;  1WH7 A;  3HOW J;  3BR2 A;  1MNM C;  3RH2 A;  5J1U A;  3TP0 A;  5FLV A;  2D5V A;  3ON2 A;  3F1B A;  1U78 A;  2ZCM A;  2ZB9 A;  1RPW A;  5FJ8 J;  1HOM A;  3RZD J;  5FKL A;  3HOV J;  3Q0W A;  2MW8 A;  1HCR A;  1UI6 A;  5EFY A;  2IU5 A;  3IUV A;  2XGC A;  4RDU A;  3ON4 A;  1IDY A;  1HDP A;  4A3F J;  2NVT J;  4IHY A;  3HOU J;  3B6C A;  1MBG A;  4D5F A;  3S17 J;  2JA6 J;  5EGO B;  3HE0 A;  5IP7 J;  2Y9Z A;  3QKX A;  3TW7 A;  1B72 A;  3HOY J;  4IHX A;  2UXP A;  4GFK A;  2XB5 A;  1IC8 A;  1MSF C;  2EZH A;  2DA4 A;  5IPA A;  3M4O J;  3S5R A;  4AC6 A;  5FMP A;  3OOU A;  5EG0 A;  3VOX A;  1JUS A;  4A3D J;  1PUF B;  2REK A;  2R5Z A;  3BQZ A;  2M8G X;  1WPK A;  4IEJ A;  4M3D A;  3MNL A;  1ETK A;  4MO7 A;  3VOK A;  1TWA J;  3A01 A;  1AKH A;  4A3E J;  3OIO A;  3BQY A;  1W0T A;  2H1K A;  2XPW A;  2LLK A;  3BCG A;  2DA3 A;  3KZ9 A;  2K9Q A;  2YVH A;  4KWA A;  3VVX A;  2ME0 A;  1MSE C;  1BL0 A;  5M3M J;  3TP3 A;  4BBR J;  3S1R J;  3BR0 A;  1ETW A;  2JK3 A;  1E3O C;  1MBF A;  5EEA A;  1UG2 A;  2GFN A;  1SGM A;  2Y0S N;  3JRC A;  1BJZ A;  1W0U A;  2ZCN A;  5JLX A;  1X2N A;  2I10 A;  2NP5 A;  4W1U A;  2R0Q C;  2DMU A;  4MK6 A;  2E2H J;  4DYR A;  1CQT A;  2UXI A;  1TWH J;  5C4Y A;  4C3H J;  3L1P A;  2ME6 A;  3ZOB A;  4ACI A;  2DMQ A;  4EEF G;  4A3M J;  3FKI J;  5HOD A;  3PO3 J;  1GUU A;  2HYJ A;  4M3F A;  4UUT A;  2FBQ A;  2OI8 A;  3FIS A;  3E7Q A;  2MSY A;  2XSD C;  2TCT A;  5EF6 A;  2AHQ A;  4RBO A;  1LFU P;  3S1M J;  3CCY A;  1MH3 A;  2K9S A;  2LTP A;  3HBL A;  3BNI A;  2DTZ A;  1GDT A;  2EZL A;  2M9H A;  2DN0 A;  1WH5 A;  1YRN A;  1XG1 A;  2YU9 J;  2V57 A;  5EYR A;  2Y30 A;  2GEN A;  3BHQ A;  2DA6 A;  2NP3 A;  2LVS A;  1WGX A;  4AUX A;  3C07 A;  1B8I A;  5CW8 A;  4LOC A;  1SFO J;  5GPA A;  1JT0 A;  2XPV A;  1TWF J;  5GPC A;  5D1R A;  4XRS G;  4CYC A;  5J3L A;  3DPJ A;  5IYB J;  1H89 C;  2HOS A;  1UHS A;  4JL3 A;  1APL C;  1ZGW A;  1IG7 A;  3JRB A;  5IOZ A;  3HDD A;  3IV5 A;  2G7S A;  3HTI A;  3JRD A;  3BG3 A;  3RD3 A;  2G3B A;  3G7R A;  2E19 A;  5F1J A;  2EH3 A;  1FIA A;  2DA5 A;  5FLM J;  2HXO A;  5HAW A;  2RAE A;  2VKE A;  2HQ5 A;  2EZK A;  1VFC A;  2DA7 A;  1JKQ C;  3S2D J;  5BNG A;  1ETV A;  1OCT C;  3S14 J;  1IV6 A;  3WHB A;  2UXO A;  3HGG A;  3GTQ J;  2ECC A;  2JA5 J;  2VPR A;  3TW6 A;  1QVU A;  1A5J A;  2QTQ A;  3GTO J;  3JRF A;  2NVY J;  3GTK J;  1TWG J;  3BR3 A;  1K83 J;  3O60 A;  1IGN A;  2Y31 A;  2RAS A;  3HKZ N;  2ECB A;  2JWT A;  4A3I J;  1NK2 P;  1JTY A;  4MXM A;  3JRI A;  3S1N J;  3MKL A;  3ZQL A;  1I3Q J;  4CGR A;  3H0G J;  4JKZ A;  4YZE A;  1F43 A;  1SAN A;  1LE8 A;  3BR5 A;  4A3L J;  1BW5 A;  2LK2 A;  3MN2 A;  3LSJ A;  1TC3 C;  3G56 A;  3HGY A;  2W48 A;  3GTG J;  2ZOY A;  5DS9 A;  4A69 C;  2VUM J;  2EBI A;  4UUS A;  5FKO A;  4MFD A;  3GTJ J;  2LP0 A;  5D19 A;  3KKC A;  3T6N A;  5DAJ A;  2L9R A;  1ZR4 A;  4A93 J;  1X2M A;  4ABZ A;  1ITY A;  3CWR A;  4G12 A;  3Q0V A;  4BY1 J;  3KKD A;  3LSP A;  1U9N A;  2XGE A;  2DMN A;  5EZG A;  5JLW A;  4IHV A;  2FQ4 A;  1GV2 A;  4L62 A;  1JKP C;  3CJD A;  2KDZ A;  2TRT A;  2JJ7 A;  1B72 B;  4M6V A;  3LSR A;  2DG8 A;  1Q1V A;  3B6A A;  1JJ8 C;  3BR1 A;  2MG4 A;  2WAQ N;  1K61 A;  5IP6 A;  4I6Z A;  5IP9 J;  1RR7 A;  4DZJ A;  2X48 A;  1RET A;  3G1M A;  5EG0 B;  3ZQC A;  1NK3 P;  5FKN A;  4GFL A;  2R5Z B;  1JUP A;  4DYC A;  4JX6 A;  3PPB A;  3S15 J;  4HNV A;  1Y1W J;  2W53 A;  3A01 B;  1AKH B;  4A3B J;  3VUQ A;  1I50 J;  3CQZ J;  2XPU A;  3FRQ A;  1WCM J;  3P9T A;  3W6V A;  2OF7 A;  1X58 A;  3BT9 A;  2JA8 J;  4JP0 A;  4X6A J;  1S7E A;  5E3L A;  1XC5 A;  2E1O A;  2KT0 A;  4QIW N;  2NX4 A;  3EUP A;  4XK4 A;  3D1N I;  3GTP J;  1JGG A;  3K2A A;  4JYK A;  4X1E A;  4UDS A;  2F07 A;  5CXI A;  2DMP A;  1LFB A;  3JR9 A;  2XDN A;  2OER A;  4XIC A;  1JTX A;  2WUI A;  5FGL A;  1FIP A;  1ENH A;  4M3B A;  3AQT A;  2R92 J;  3EGQ A;  5J1R A;  1UI5 A;  4B4C A;  2ELK A;  3ANG A;  2HOA A;  2LY9 A;  3JRG A;  4W97 A;  2YUS A;  5M5X J;  3SDG A;  4GFB A;  2HKU A;  3HTA A;  2R93 J;  5E3M A;  3FK7 A;  3SJM A;  2FJ1 A;  5E3N A;  1RES A;  2ID6 A;  1WI3 A;  2Y9Y A;  1MH4 A;  1T56 A;  1JKR C;  1MBJ A;  1JT6 A;  4MFE A;  2NVQ J;  3VVY A;  3BG5 A;  5EZH A;  3NRG A;  3VW1 A;  1MBK A;  3Q0U A;  2OPT A;  4S0H B;  2M34 A;  4D7N A;  3BJB A;  3RZO J;  3QPS A;  1YRN B;  1MBH A;  2CRG A;  2LKX A;  1ETO A;  2JA7 J;  1ETX A;  4AC0 A;  3LWJ A;  3NXC A;  3OSF A;  5FKK A;  3VW0 A;  3BTJ A;  4DW6 A;  1B8I B;  1OCP A;  4C3J J;  5J1Y A;  2GLO A;  4AF5 A;  1QPI A;  4CYC B;  3BTI A;  4QTR A;  9ANT A;  2DG7 A;  3V78 A;  4AYB N;  2XB0 X;  3G1L A;  2MGQ A;  3GEU A;  3PAS A;  1FTZ A;  5F0F A;  4BXX J;  1ZK8 A;  4Y52 J;  1JKO C;  2CU7 A;  3O8H A;  1QVT A;  1P7J A;  2LR8 A;  1FEX A;  3KNW A;  5F08 A;  2CUF A;  1JUM A;  1UMQ A;  2CQX A;  2YS9 A;  3JRE A;  3M3Y J;  2DJN A;  1EF4 A;  3ZQH A;  2N8G A;  1ZQ3 P;  3H3V K;  2R5Y A;  1ZTR A;  1FTT A;  3BRU A;  3LJL A;  4GCT A;  4MLO A;  2YVE A;  3CRJ A;  1OJL A;  2NS7 A;  5C44 J;  2COB A;  1AHD P;  2GBY A;  2NVX J;  3JRH A;  2QCO A;  3LNQ A;  3VVZ A;  4QSH A;  3NNR A;  1R9T J;  3MVP A;  5C4J J;  3GTM J;  2G0E A;  2WB1 N;  1IRZ A;  3COL A;  1DU0 A;  2DA2 A;  3K7A J;  1POG A;  2CQQ A;  3HOZ J;  2R7Z J;  3RKQ A;  3A03 A;  1TWC J;  1U8B A;  5K7H A;  2ZOZ A;  1LE8 B;  5HBU A;  2IBD A;  4XID A;  1Z77 A;  3HEF A;  5IYD J;  5K7Z A;  3BG9 A;  1XS9 A;  3DCF A;  2CUE A;  4FE4 A;  4UUS B;  4B3A A;  3BR6 A;  2QWT A;  5FHP A;  1HF0 A;  4NEL A;  5D18 A;  2H8R A;  1OFC X;  3CDL A;  1GVD A;  1HLV A;  2VI6 A;  3A02 A;  5E3O A;  5DTD A;  5EGO A;  4GCK A;  4IHW A;  3Q3S A;  1NTC A;  4DYQ A;  2M0C A;  3GTL J;  4FE7 A;  4C2M J;  4A3K J;  2X6O A;  4I76 A;  2D6Y A;  4JX4 A;  3PO2 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...