4MK6A

Crystal structure of probable dihydroxyacetone kinase regulator dhsk_reg from listeria monocytogenes egd-e
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
188
structure length
188
Chain Sequence
SNAMAESLITKKAIAGGLMELCQHKRFEKISIADITNICGLNRQTFYYHFTDKYDLLTWTYENDFFHCLADGITLGNWDKHVLKMLESIKENADFYKNTVSADASILSFCFSKLTNSLFMDLFEKIDTNATVNEADRVFYAEFFSYGCSGVLIKWITRGFKEAPETIANQLFRLAKDTEFLANSMYRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Probable Dihydroxyacetone Kinase Regulator DHSK_reg from Listeria monocytogenes EGD-e
rcsb
source organism Listeria monocytogenes
molecule tags Transcription regulator
molecule keywords Probable Dihydroxyacetone Kinase Regulator DHSK_reg
total genus 69
structure length 188
sequence length 188
ec nomenclature
pdb deposition date 2013-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF14278 TetR_C_8 Transcriptional regulator C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 4mk6A00
5FKMA 4L62A 5FHPA 3IH4A 3CWRA 3GEUA 3VW1A 3G1LA 4AC6A 3JSJA 5FMPA 4B1RA 3O60A 2WGBA 3LSPA 1ZK8A 3LOCA 3VP5A 2XRLA 2ZB9A 3HTIA 3EUPA 2X6OA 3IUVA 2OI8A 4ACIA 2HYJA 2IU5A 3G7RA 2FQ4A 1JT0A 2O7TA 3BQYA 2VPRA 4ABZA 5IPAA 3G1MA 2Q24A 3LSJA 4I6ZA 4M3BA 3BR1A 2XGDA 3B6AA 3LWJA 3IH3A 3BR3A 3CCYA 3Q0WA 5EFYA 4GFKA 5FKOA 5EZHA 3Q0VA 2V57A 2RASA 2Y2ZA 3VVZA 3HTHA 2FJ1A 3VUQA 3FIWA 4V2FA 5F0CA 2YVEA 4D5FA 2D6YA 3KNWA 3PPBA 1U9OA 4KWAA 5D19A 3TP0A 2ID3A 3RH2A 2W53A 2G7SA 2UXPA 3B6CA 1SGMA 3BR0A 3HTAA 3GZIA 4M3GA 4ICHA 2UXIA 3NPIA 3T6NA 3VW0A 3DPJA 2ID6A 3ZQGA 5J1UA 2QIBA 5HBUA 2UXHA 3SDGA 2HXIA 2DG7A 4PXIA 4GCTA 1JUMA 4HKUA 3Q3SA 5IOZA 2XDNA 4M3FA 5F08A 3NI7A 4AUXA 3KZ9A 4YZEA 3ZQLA 3MVPA 2OERA 5GP9A 2FBQA 2GBYA 2QCOA 3PASA 4JL3A 2QOPA 3C07A 5CW8A 5C4YA 4AF5A 3CDLA 2XPUA 3F1BA 4GCKA 2FX0A 2HQ5A 4B3AA 4XK4A 1BJZA 4D7MA 5HAWA 5F27A 2G3BA 5HSZA 4I76A 3AQTA 5FKKA 3V78A 3F0CA 4NN1A 3ZQHA 5IP6A 3QPSA 3BJBA 1ZKGA 3ZQFA 5IOYA 2TRTA 3E7QA 4M3EA 5AQCA 3Q0UA 2XPVA 2GFNA 3DCFA 2XGCA 2RHAA 1Z77A 3MNLA 2I10A 2QTQA 2NP5A 4JYKA 2HXOA 2VKEA 3BR6A 2PBXA 3QBMA 5K7ZA 4V2GA 3BRUA 5F04A 2WUIA 3QKXA 4D7NA 4GCLA 2HKUA 2NX4A 1QVTA 2FD5A 2WV1A 2JJ7A 3BNIA 3COLA 3QPLA 4ME9A 3RD3A 3WHCA 3BTIA 4X1EA 3KKCA 1JT6A 4JNNA 3HTJA 2HYTA 3C2BA 2O7OA 3O8GA 2GUHA 3G1OA 3FK7A 3IH2A 2XPWA 5FKNA 5FKLA 3QQAA 1T33A 1RKTA 3ANPA 5K58A 2OF7A 2DG8A 4UDSA 1T56A 5CXIA 5H9TA 4JKZA 2UXUA 1JTXA 2G7GA 5GPAA 1UI5A 3NRGA 5F0HA 4M3DA 3NXCA 2XB5A 3BHQA 1JUPA 2UXOA 2REKA 2DTZA 2NS8A 4D5CA 2PZ9A 2ZOYA 5D18A 3BT9A 3BQZA 2TCTA 2NP3A 2NS7A 5EZGA 2RAEA 3BTCA 2IAIA 3ANGA 3VOXA 5J1YA 3VPRA 2GENA 3G56A 1ORKA 4MXMA 4MO7A 3HIMA 5DAJA 2YVHA 3P9TA 3TP3A 5F0FA 3AQSA 1A6IA 2G0EA 3ZQIA 2VKVA 5D1RA 5GPCA 2JK3A 4MK6A 3V6GA 3SFIA 3HGYA 4AC0A 5CXGA 1VI0A 3KKDA 3NNRA 3O8HA 3WHBA 1QPIA 2IBDA 2X9DA 5J3LA 4DW6A 2QKOA 3BR5A 2ZCMA 2Y31A 4G12A 5F1JA 4NELA 3BR2A 5K7HA 4GFLA 3VVXA 3VVYA 1RPWA 2QWTA 1RKWA 3ON4A 3VW2A 5FGLA 3BTJA 2F07A 3EGQA 3CRJA 4CGRA 2OPTA 1JUSA 2IEKA 3S5RA 1U9NA 3FRQA 3LHQA 4W1UA 1JTYA 3BTLA 3VIBA 3DEWA 5K7FA 1Z0XA 1UI6A 3LSRA 3FK6A 3VOKA 3HGGA 3HE0A 2G7LA 3ON2A 2ZOZA 5J1RA 3B81A 3LJLA 1QVUA 2ZCNA 3CJDA 2ZCXA 2XGEA 2Y30A 5EYRA 2EH3A 3BCGA 4W97A 3PM1A
chains in the Genus database with same CATH superfamily
5FKMA 4L62A 5FHPA 3IH4A 2R7RA 3CWRA 3GEUA 3VW1A 3G1LA 4AC6A 3JSJA 5FMPA 3SWHA 4B1RA 3O60A 3K8PC 2WGBA 3LSPA 4U9NA 1ZK8A 3LOCA 3VP5A 2XRLA 2ZB9A 3HTIA 3EUPA 2X6OA 3IUVA 2OI8A 4ACIA 2HYJA 2IU5A 3G7RA 2FQ4A 1JT0A 2O7TA 3BQYA 2VPRA 4ABZA 5IPAA 3G1MA 2Q24A 3LSJA 4I6ZA 4M3BA 3BR1A 2XGDA 3B6AA 3DU5A 3LWJA 3IH3A 3BR3A 3CCYA 3Q0WA 5EFYA 3NS4A 4GFKA 5FKOA 5EZHA 3Q0VA 2V57A 2RASA 2Y2ZA 3VVZA 3HTHA 2FJ1A 3VUQA 3FIWA 4V2FA 5F0CA 2YVEA 4D5FA 3KYLA 2D6YA 3KNWA 3PPBA 1U9OA 4KWAA 5D19A 3TP0A 2ID3A 3RH2A 2W53A 2G7SA 2UXPA 3B6CA 1SGMA 3BR0A 3HTAA 3GZIA 4M3GA 4ICHA 2UXIA 3NPIA 3T6NA 3VW0A 3DPJA 2ID6A 3ZQGA 5J1UA 2QIBA 5HBUA 2UXHA 3SDGA 2HXIA 2DG7A 4PXIA 2R7VA 4GCTA 1JUMA 4HKUA 3Q3SA 5IOZA 4OD5A 2XDNA 5CQGA 4M3FA 5F08A 3NI7A 4AUXA 3KZ9A 2R7OA 4YZEA 3ZQLA 3MVPA 2OERA 5GP9A 2FBQA 2GBYA 2QCOA 3PASA 4JL3A 2QOPA 3C07A 5CW8A 5C4YA 4AF5A 3CDLA 2XPUA 3F1BA 4GCKA 2FX0A 2HQ5A 4B3AA 4XK4A 1BJZA 4D7MA 5HAWA 5F27A 2G3BA 5HSZA 4I76A 3AQTA 5FKKA 3V78A 2R7WA 3F0CA 4NN1A 3ZQHA 5IP6A 3QPSA 3BJBA 1ZKGA 3ZQFA 5IOYA 2TRTA 3E7QA 4M3EA 5AQCA 3Q0UA 2XPVA 2GFNA 4U9LA 2R7UA 3DU6A 3DCFA 2XGCA 2RHAA 1Z77A 2ZY9A 3MNLA 2I10A 2QTQA 2NP5A 2A2FX 4JYKA 2HXOA 2VKEA 2R7TA 3BR6A 2PBXA 3QBMA 5K7ZA 2B3WA 4V2GA 3BRUA 5F04A 2WUIA 3QKXA 4D7NA 4GCLA 2HKUA 2NX4A 1QVTA 2FD5A 2WV1A 2JJ7A 3BNIA 3COLA 3QPLA 4ME9A 3RD3A 3WHCA 3BTIA 4X1EA 2R7SA 3KKCA 1JT6A 4JNNA 3HTJA 2HYTA 3C2BA 2O7OA 3O8GA 2PFVA 2GUHA 3G1OA 3FK7A 3IH2A 2YVXA 2XPWA 5FKNA 5FKLA 3QQAA 1T33A 1RKTA 3ANPA 5K58A 2OF7A 2DG8A 4UDSA 1T56A 5CXIA 5H9TA 4JKZA 2UXUA 1JTXA 2G7GA 5GPAA 1UI5A 3NRGA 5F0HA 4M3DA 3NXCA 2XB5A 3BHQA 1JUPA 2UXOA 2REKA 2DTZA 2NS8A 4D5CA 2PZ9A 2ZOYA 5D18A 3BT9A 2R7QA 3BQZA 2TCTA 2NP3A 2NS7A 5EZGA 2RAEA 3BTCA 2IAIA 3ANGA 3VOXA 5J1YA 3VPRA 2GENA 3G56A 1ORKA 4MXMA 4MO7A 3HIMA 5DAJA 2YVHA 3P9TA 3TP3A 5F0FA 3AQSA 1A6IA 2G0EA 3ZQIA 2VKVA 5D1RA 5GPCA 2JK3A 4MK6A 4WIBA 3V6GA 3SFIA 3VTIA 3HGYA 3FHNA 4AC0A 5CXGA 1VI0A 3KKDA 3NNRA 3O8HA 3WHBA 1QPIA 2IBDA 2X9DA 5J3LA 4DW6A 2QKOA 3BR5A 2ZCMA 2Y31A 4G12A 5F1JA 4NELA 4C2MA 2FJI1 3BR2A 5K7HA 4GFLA 3VVXA 3VVYA 1RPWA 2QWTA 1RKWA 3ON4A 3VW2A 5FGLA 3BTJA 2F07A 3EGQA 3CRJA 4CGRA 2OPTA 2R7XA 1JUSA 2IEKA 3S5RA 1U9NA 3FRQA 3LHQA 4W1UA 1JTYA 3BTLA 3VIBA 3DEWA 5K7FA 1Z0XA 1UI6A 4IRVA 3LSRA 3FK6A 3VOKA 3HGGA 3HE0A 2B1EA 2G7LA 3ON2A 4DVYP 2ZOZA 5J1RA 3B81A 3LJLA 1QVUA 4OD4A 2ZCNA 3CJDA 2ZCXA 2XGEA 2Y30A 5EYRA 2EH3A 3BCGA 4W97A 3PM1A
chains in the Genus database with same CATH topology
5FKMA 4L62A 5FHPA 3IH4A 3CWRA 3GEUA 3VW1A 3G1LA 4AC6A 3JSJA 5FMPA 4B1RA 3O60A 2WGBA 3LSPA 1ZK8A 3LOCA 3VP5A 2XRLA 2ZB9A 3HTIA 3EUPA 2X6OA 3IUVA 2OI8A 4ACIA 2HYJA 2IU5A 3G7RA 2FQ4A 1JT0A 2O7TA 3BQYA 2VPRA 4ABZA 5IPAA 3G1MA 2Q24A 3LSJA 4I6ZA 4M3BA 3BR1A 2XGDA 3B6AA 3LWJA 3IH3A 3BR3A 3CCYA 3Q0WA 5EFYA 4GFKA 5FKOA 5EZHA 3Q0VA 2V57A 2RASA 2Y2ZA 3VVZA 3HTHA 2FJ1A 3VUQA 3FIWA 4V2FA 5F0CA 2YVEA 4D5FA 2D6YA 3KNWA 3PPBA 1U9OA 4KWAA 5D19A 3TP0A 2ID3A 3RH2A 2W53A 2G7SA 2UXPA 3B6CA 1SGMA 3BR0A 3HTAA 3GZIA 4M3GA 4ICHA 2UXIA 3NPIA 3T6NA 3VW0A 3DPJA 2ID6A 3ZQGA 5J1UA 2QIBA 5HBUA 2UXHA 3SDGA 2HXIA 2DG7A 4PXIA 4GCTA 1JUMA 4HKUA 3Q3SA 5IOZA 2XDNA 4M3FA 5F08A 3NI7A 4AUXA 3KZ9A 4YZEA 3ZQLA 3MVPA 2OERA 5GP9A 2FBQA 2GBYA 2QCOA 3PASA 4JL3A 2QOPA 3C07A 5CW8A 5C4YA 4AF5A 3CDLA 2XPUA 3F1BA 4GCKA 2FX0A 2HQ5A 4B3AA 4XK4A 1BJZA 4D7MA 5HAWA 5F27A 2G3BA 5HSZA 4I76A 3AQTA 5FKKA 3V78A 3F0CA 4NN1A 3ZQHA 5IP6A 3QPSA 3BJBA 1ZKGA 3ZQFA 5IOYA 2TRTA 3E7QA 4M3EA 5AQCA 3Q0UA 2XPVA 2GFNA 3DCFA 2XGCA 2RHAA 1Z77A 3MNLA 2I10A 2QTQA 2NP5A 4JYKA 2HXOA 2VKEA 3BR6A 2PBXA 3QBMA 5K7ZA 4V2GA 3BRUA 5F04A 2WUIA 3QKXA 4D7NA 4GCLA 2HKUA 2NX4A 1QVTA 2FD5A 2WV1A 2JJ7A 3BNIA 3COLA 3QPLA 4ME9A 3RD3A 3WHCA 3BTIA 4X1EA 3KKCA 1JT6A 4JNNA 3HTJA 2HYTA 3C2BA 2O7OA 3O8GA 2GUHA 3G1OA 3FK7A 3IH2A 2XPWA 5FKNA 5FKLA 3QQAA 1T33A 1RKTA 3ANPA 5K58A 2OF7A 2DG8A 4UDSA 1T56A 5CXIA 5H9TA 4JKZA 2UXUA 1JTXA 2G7GA 5GPAA 1UI5A 3NRGA 5F0HA 4M3DA 3NXCA 2XB5A 3BHQA 1JUPA 2UXOA 2REKA 2DTZA 2NS8A 4D5CA 2PZ9A 2ZOYA 5D18A 3BT9A 3BQZA 2TCTA 2NP3A 2NS7A 5EZGA 2RAEA 3BTCA 2IAIA 3ANGA 3VOXA 5J1YA 3VPRA 2GENA 3G56A 1ORKA 4MXMA 4MO7A 3HIMA 5DAJA 2YVHA 3P9TA 3TP3A 5F0FA 3AQSA 1A6IA 2G0EA 3ZQIA 2VKVA 5D1RA 5GPCA 2JK3A 4MK6A 3V6GA 3SFIA 3HGYA 4AC0A 5CXGA 1VI0A 3KKDA 3NNRA 3O8HA 3WHBA 1QPIA 2IBDA 2X9DA 5J3LA 4DW6A 2QKOA 3BR5A 2ZCMA 2Y31A 4G12A 5F1JA 4NELA 3BR2A 5K7HA 4GFLA 3VVXA 3VVYA 1RPWA 2QWTA 1RKWA 3ON4A 3VW2A 5FGLA 3BTJA 2F07A 3EGQA 3CRJA 4CGRA 2OPTA 1JUSA 2IEKA 3S5RA 1U9NA 3FRQA 3LHQA 4W1UA 1JTYA 3BTLA 3VIBA 3DEWA 5K7FA 1Z0XA 1UI6A 3LSRA 3FK6A 3VOKA 3HGGA 3HE0A 2G7LA 3ON2A 2ZOZA 5J1RA 3B81A 3LJLA 1QVUA 2ZCNA 3CJDA 2ZCXA 2XGEA 2Y30A 5EYRA 2EH3A 3BCGA 4W97A 3PM1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FKM A;  4L62 A;  5FHP A;  3IH4 A;  3CWR A;  3GEU A;  3VW1 A;  3G1L A;  4AC6 A;  3JSJ A;  5FMP A;  4B1R A;  3O60 A;  2WGB A;  3LSP A;  1ZK8 A;  3LOC A;  3VP5 A;  2XRL A;  2ZB9 A;  3HTI A;  3EUP A;  2X6O A;  3IUV A;  2OI8 A;  4ACI A;  2HYJ A;  2IU5 A;  3G7R A;  2FQ4 A;  1JT0 A;  2O7T A;  3BQY A;  2VPR A;  4ABZ A;  5IPA A;  3G1M A;  2Q24 A;  3LSJ A;  4I6Z A;  4M3B A;  3BR1 A;  2XGD A;  3B6A A;  3LWJ A;  3IH3 A;  3BR3 A;  3CCY A;  3Q0W A;  5EFY A;  4GFK A;  5FKO A;  5EZH A;  3Q0V A;  2V57 A;  2RAS A;  2Y2Z A;  3VVZ A;  3HTH A;  2FJ1 A;  3VUQ A;  3FIW A;  4V2F A;  5F0C A;  2YVE A;  4D5F A;  2D6Y A;  3KNW A;  3PPB A;  1U9O A;  4KWA A;  5D19 A;  3TP0 A;  2ID3 A;  3RH2 A;  2W53 A;  2G7S A;  2UXP A;  3B6C A;  1SGM A;  3BR0 A;  3HTA A;  3GZI A;  4M3G A;  4ICH A;  2UXI A;  3NPI A;  3T6N A;  3VW0 A;  3DPJ A;  2ID6 A;  3ZQG A;  5J1U A;  2QIB A;  5HBU A;  2UXH A;  3SDG A;  2HXI A;  2DG7 A;  4PXI A;  4GCT A;  1JUM A;  4HKU A;  3Q3S A;  5IOZ A;  2XDN A;  4M3F A;  5F08 A;  3NI7 A;  4AUX A;  3KZ9 A;  4YZE A;  3ZQL A;  3MVP A;  2OER A;  5GP9 A;  2FBQ A;  2GBY A;  2QCO A;  3PAS A;  4JL3 A;  2QOP A;  3C07 A;  5CW8 A;  5C4Y A;  4AF5 A;  3CDL A;  2XPU A;  3F1B A;  4GCK A;  2FX0 A;  2HQ5 A;  4B3A A;  4XK4 A;  1BJZ A;  4D7M A;  5HAW A;  5F27 A;  2G3B A;  5HSZ A;  4I76 A;  3AQT A;  5FKK A;  3V78 A;  3F0C A;  4NN1 A;  3ZQH A;  5IP6 A;  3QPS A;  3BJB A;  1ZKG A;  3ZQF A;  5IOY A;  2TRT A;  3E7Q A;  4M3E A;  5AQC A;  3Q0U A;  2XPV A;  2GFN A;  3DCF A;  2XGC A;  2RHA A;  1Z77 A;  3MNL A;  2I10 A;  2QTQ A;  2NP5 A;  4JYK A;  2HXO A;  2VKE A;  3BR6 A;  2PBX A;  3QBM A;  5K7Z A;  4V2G A;  3BRU A;  5F04 A;  2WUI A;  3QKX A;  4D7N A;  4GCL A;  2HKU A;  2NX4 A;  1QVT A;  2FD5 A;  2WV1 A;  2JJ7 A;  3BNI A;  3COL A;  3QPL A;  4ME9 A;  3RD3 A;  3WHC A;  3BTI A;  4X1E A;  3KKC A;  1JT6 A;  4JNN A;  3HTJ A;  2HYT A;  3C2B A;  2O7O A;  3O8G A;  2GUH A;  3G1O A;  3FK7 A;  3IH2 A;  2XPW A;  5FKN A;  5FKL A;  3QQA A;  1T33 A;  1RKT A;  3ANP A;  5K58 A;  2OF7 A;  2DG8 A;  4UDS A;  1T56 A;  5CXI A;  5H9T A;  4JKZ A;  2UXU A;  1JTX A;  2G7G A;  5GPA A;  1UI5 A;  3NRG A;  5F0H A;  4M3D A;  3NXC A;  2XB5 A;  3BHQ A;  1JUP A;  2UXO A;  2REK A;  2DTZ A;  2NS8 A;  4D5C A;  2PZ9 A;  2ZOY A;  5D18 A;  3BT9 A;  3BQZ A;  2TCT A;  2NP3 A;  2NS7 A;  5EZG A;  2RAE A;  3BTC A;  2IAI A;  3ANG A;  3VOX A;  5J1Y A;  3VPR A;  2GEN A;  3G56 A;  1ORK A;  4MXM A;  4MO7 A;  3HIM A;  5DAJ A;  2YVH A;  3P9T A;  3TP3 A;  5F0F A;  3AQS A;  1A6I A;  2G0E A;  3ZQI A;  2VKV A;  5D1R A;  5GPC A;  2JK3 A;  4MK6 A;  3V6G A;  3SFI A;  3HGY A;  4AC0 A;  5CXG A;  1VI0 A;  3KKD A;  3NNR A;  3O8H A;  3WHB A;  1QPI A;  2IBD A;  2X9D A;  5J3L A;  4DW6 A;  2QKO A;  3BR5 A;  2ZCM A;  2Y31 A;  4G12 A;  5F1J A;  4NEL A;  3BR2 A;  5K7H A;  4GFL A;  3VVX A;  3VVY A;  1RPW A;  2QWT A;  1RKW A;  3ON4 A;  3VW2 A;  5FGL A;  3BTJ A;  2F07 A;  3EGQ A;  3CRJ A;  4CGR A;  2OPT A;  1JUS A;  2IEK A;  3S5R A;  1U9N A;  3FRQ A;  3LHQ A;  4W1U A;  1JTY A;  3BTL A;  3VIB A;  3DEW A;  5K7F A;  1Z0X A;  1UI6 A;  3LSR A;  3FK6 A;  3VOK A;  3HGG A;  3HE0 A;  2G7L A;  3ON2 A;  2ZOZ A;  5J1R A;  3B81 A;  3LJL A;  1QVU A;  2ZCN A;  3CJD A;  2ZCX A;  2XGE A;  2Y30 A;  5EYR A;  2EH3 A;  3BCG A;  4W97 A;  3PM1 A; 
#chains in the Genus database with same CATH topology
 5FKM A;  4L62 A;  5FHP A;  3IH4 A;  2R7R A;  3CWR A;  3GEU A;  3VW1 A;  3G1L A;  4AC6 A;  3JSJ A;  5FMP A;  3SWH A;  4B1R A;  3O60 A;  3K8P C;  2WGB A;  3LSP A;  4U9N A;  1ZK8 A;  3LOC A;  3VP5 A;  2XRL A;  2ZB9 A;  3HTI A;  3EUP A;  2X6O A;  3IUV A;  2OI8 A;  4ACI A;  2HYJ A;  2IU5 A;  3G7R A;  2FQ4 A;  1JT0 A;  2O7T A;  3BQY A;  2VPR A;  4ABZ A;  5IPA A;  3G1M A;  2Q24 A;  3LSJ A;  4I6Z A;  4M3B A;  3BR1 A;  2XGD A;  3B6A A;  3DU5 A;  3LWJ A;  3IH3 A;  3BR3 A;  3CCY A;  3Q0W A;  5EFY A;  3NS4 A;  4GFK A;  5FKO A;  5EZH A;  3Q0V A;  2V57 A;  2RAS A;  2Y2Z A;  3VVZ A;  3HTH A;  2FJ1 A;  3VUQ A;  3FIW A;  4V2F A;  5F0C A;  2YVE A;  4D5F A;  3KYL A;  2D6Y A;  3KNW A;  3PPB A;  1U9O A;  4KWA A;  5D19 A;  3TP0 A;  2ID3 A;  3RH2 A;  2W53 A;  2G7S A;  2UXP A;  3B6C A;  1SGM A;  3BR0 A;  3HTA A;  3GZI A;  4M3G A;  4ICH A;  2UXI A;  3NPI A;  3T6N A;  3VW0 A;  3DPJ A;  2ID6 A;  3ZQG A;  5J1U A;  2QIB A;  5HBU A;  2UXH A;  3SDG A;  2HXI A;  2DG7 A;  4PXI A;  2R7V A;  4GCT A;  1JUM A;  4HKU A;  3Q3S A;  5IOZ A;  4OD5 A;  2XDN A;  5CQG A;  4M3F A;  5F08 A;  3NI7 A;  4AUX A;  3KZ9 A;  2R7O A;  4YZE A;  3ZQL A;  3MVP A;  2OER A;  5GP9 A;  2FBQ A;  2GBY A;  2QCO A;  3PAS A;  4JL3 A;  2QOP A;  3C07 A;  5CW8 A;  5C4Y A;  4AF5 A;  3CDL A;  2XPU A;  3F1B A;  4GCK A;  2FX0 A;  2HQ5 A;  4B3A A;  4XK4 A;  1BJZ A;  4D7M A;  5HAW A;  5F27 A;  2G3B A;  5HSZ A;  4I76 A;  3AQT A;  5FKK A;  3V78 A;  2R7W A;  3F0C A;  4NN1 A;  3ZQH A;  5IP6 A;  3QPS A;  3BJB A;  1ZKG A;  3ZQF A;  5IOY A;  2TRT A;  3E7Q A;  4M3E A;  5AQC A;  3Q0U A;  2XPV A;  2GFN A;  4U9L A;  2R7U A;  3DU6 A;  3DCF A;  2XGC A;  2RHA A;  1Z77 A;  2ZY9 A;  3MNL A;  2I10 A;  2QTQ A;  2NP5 A;  2A2F X;  4JYK A;  2HXO A;  2VKE A;  2R7T A;  3BR6 A;  2PBX A;  3QBM A;  5K7Z A;  2B3W A;  4V2G A;  3BRU A;  5F04 A;  2WUI A;  3QKX A;  4D7N A;  4GCL A;  2HKU A;  2NX4 A;  1QVT A;  2FD5 A;  2WV1 A;  2JJ7 A;  3BNI A;  3COL A;  3QPL A;  4ME9 A;  3RD3 A;  3WHC A;  3BTI A;  4X1E A;  2R7S A;  3KKC A;  1JT6 A;  4JNN A;  3HTJ A;  2HYT A;  3C2B A;  2O7O A;  3O8G A;  2PFV A;  2GUH A;  3G1O A;  3FK7 A;  3IH2 A;  2YVX A;  2XPW A;  5FKN A;  5FKL A;  3QQA A;  1T33 A;  1RKT A;  3ANP A;  5K58 A;  2OF7 A;  2DG8 A;  4UDS A;  1T56 A;  5CXI A;  5H9T A;  4JKZ A;  2UXU A;  1JTX A;  2G7G A;  5GPA A;  1UI5 A;  3NRG A;  5F0H A;  4M3D A;  3NXC A;  2XB5 A;  3BHQ A;  1JUP A;  2UXO A;  2REK A;  2DTZ A;  2NS8 A;  4D5C A;  2PZ9 A;  2ZOY A;  5D18 A;  3BT9 A;  2R7Q A;  3BQZ A;  2TCT A;  2NP3 A;  2NS7 A;  5EZG A;  2RAE A;  3BTC A;  2IAI A;  3ANG A;  3VOX A;  5J1Y A;  3VPR A;  2GEN A;  3G56 A;  1ORK A;  4MXM A;  4MO7 A;  3HIM A;  5DAJ A;  2YVH A;  3P9T A;  3TP3 A;  5F0F A;  3AQS A;  1A6I A;  2G0E A;  3ZQI A;  2VKV A;  5D1R A;  5GPC A;  2JK3 A;  4MK6 A;  4WIB A;  3V6G A;  3SFI A;  3VTI A;  3HGY A;  3FHN A;  4AC0 A;  5CXG A;  1VI0 A;  3KKD A;  3NNR A;  3O8H A;  3WHB A;  1QPI A;  2IBD A;  2X9D A;  5J3L A;  4DW6 A;  2QKO A;  3BR5 A;  2ZCM A;  2Y31 A;  4G12 A;  5F1J A;  4NEL A;  4C2M A;  2FJI 1;  3BR2 A;  5K7H A;  4GFL A;  3VVX A;  3VVY A;  1RPW A;  2QWT A;  1RKW A;  3ON4 A;  3VW2 A;  5FGL A;  3BTJ A;  2F07 A;  3EGQ A;  3CRJ A;  4CGR A;  2OPT A;  2R7X A;  1JUS A;  2IEK A;  3S5R A;  1U9N A;  3FRQ A;  3LHQ A;  4W1U A;  1JTY A;  3BTL A;  3VIB A;  3DEW A;  5K7F A;  1Z0X A;  1UI6 A;  4IRV A;  3LSR A;  3FK6 A;  3VOK A;  3HGG A;  3HE0 A;  2B1E A;  2G7L A;  3ON2 A;  4DVY P;  2ZOZ A;  5J1R A;  3B81 A;  3LJL A;  1QVU A;  4OD4 A;  2ZCN A;  3CJD A;  2ZCX A;  2XGE A;  2Y30 A;  5EYR A;  2EH3 A;  3BCG A;  4W97 A;  3PM1 A; 
#chains in the Genus database with same CATH homology
 5FKM A;  4L62 A;  5FHP A;  3IH4 A;  3CWR A;  3GEU A;  3VW1 A;  3G1L A;  4AC6 A;  3JSJ A;  5FMP A;  4B1R A;  3O60 A;  2WGB A;  3LSP A;  1ZK8 A;  3LOC A;  3VP5 A;  2XRL A;  2ZB9 A;  3HTI A;  3EUP A;  2X6O A;  3IUV A;  2OI8 A;  4ACI A;  2HYJ A;  2IU5 A;  3G7R A;  2FQ4 A;  1JT0 A;  2O7T A;  3BQY A;  2VPR A;  4ABZ A;  5IPA A;  3G1M A;  2Q24 A;  3LSJ A;  4I6Z A;  4M3B A;  3BR1 A;  2XGD A;  3B6A A;  3LWJ A;  3IH3 A;  3BR3 A;  3CCY A;  3Q0W A;  5EFY A;  4GFK A;  5FKO A;  5EZH A;  3Q0V A;  2V57 A;  2RAS A;  2Y2Z A;  3VVZ A;  3HTH A;  2FJ1 A;  3VUQ A;  3FIW A;  4V2F A;  5F0C A;  2YVE A;  4D5F A;  2D6Y A;  3KNW A;  3PPB A;  1U9O A;  4KWA A;  5D19 A;  3TP0 A;  2ID3 A;  3RH2 A;  2W53 A;  2G7S A;  2UXP A;  3B6C A;  1SGM A;  3BR0 A;  3HTA A;  3GZI A;  4M3G A;  4ICH A;  2UXI A;  3NPI A;  3T6N A;  3VW0 A;  3DPJ A;  2ID6 A;  3ZQG A;  5J1U A;  2QIB A;  5HBU A;  2UXH A;  3SDG A;  2HXI A;  2DG7 A;  4PXI A;  4GCT A;  1JUM A;  4HKU A;  3Q3S A;  5IOZ A;  2XDN A;  4M3F A;  5F08 A;  3NI7 A;  4AUX A;  3KZ9 A;  4YZE A;  3ZQL A;  3MVP A;  2OER A;  5GP9 A;  2FBQ A;  2GBY A;  2QCO A;  3PAS A;  4JL3 A;  2QOP A;  3C07 A;  5CW8 A;  5C4Y A;  4AF5 A;  3CDL A;  2XPU A;  3F1B A;  4GCK A;  2FX0 A;  2HQ5 A;  4B3A A;  4XK4 A;  1BJZ A;  4D7M A;  5HAW A;  5F27 A;  2G3B A;  5HSZ A;  4I76 A;  3AQT A;  5FKK A;  3V78 A;  3F0C A;  4NN1 A;  3ZQH A;  5IP6 A;  3QPS A;  3BJB A;  1ZKG A;  3ZQF A;  5IOY A;  2TRT A;  3E7Q A;  4M3E A;  5AQC A;  3Q0U A;  2XPV A;  2GFN A;  3DCF A;  2XGC A;  2RHA A;  1Z77 A;  3MNL A;  2I10 A;  2QTQ A;  2NP5 A;  4JYK A;  2HXO A;  2VKE A;  3BR6 A;  2PBX A;  3QBM A;  5K7Z A;  4V2G A;  3BRU A;  5F04 A;  2WUI A;  3QKX A;  4D7N A;  4GCL A;  2HKU A;  2NX4 A;  1QVT A;  2FD5 A;  2WV1 A;  2JJ7 A;  3BNI A;  3COL A;  3QPL A;  4ME9 A;  3RD3 A;  3WHC A;  3BTI A;  4X1E A;  3KKC A;  1JT6 A;  4JNN A;  3HTJ A;  2HYT A;  3C2B A;  2O7O A;  3O8G A;  2GUH A;  3G1O A;  3FK7 A;  3IH2 A;  2XPW A;  5FKN A;  5FKL A;  3QQA A;  1T33 A;  1RKT A;  3ANP A;  5K58 A;  2OF7 A;  2DG8 A;  4UDS A;  1T56 A;  5CXI A;  5H9T A;  4JKZ A;  2UXU A;  1JTX A;  2G7G A;  5GPA A;  1UI5 A;  3NRG A;  5F0H A;  4M3D A;  3NXC A;  2XB5 A;  3BHQ A;  1JUP A;  2UXO A;  2REK A;  2DTZ A;  2NS8 A;  4D5C A;  2PZ9 A;  2ZOY A;  5D18 A;  3BT9 A;  3BQZ A;  2TCT A;  2NP3 A;  2NS7 A;  5EZG A;  2RAE A;  3BTC A;  2IAI A;  3ANG A;  3VOX A;  5J1Y A;  3VPR A;  2GEN A;  3G56 A;  1ORK A;  4MXM A;  4MO7 A;  3HIM A;  5DAJ A;  2YVH A;  3P9T A;  3TP3 A;  5F0F A;  3AQS A;  1A6I A;  2G0E A;  3ZQI A;  2VKV A;  5D1R A;  5GPC A;  2JK3 A;  4MK6 A;  3V6G A;  3SFI A;  3HGY A;  4AC0 A;  5CXG A;  1VI0 A;  3KKD A;  3NNR A;  3O8H A;  3WHB A;  1QPI A;  2IBD A;  2X9D A;  5J3L A;  4DW6 A;  2QKO A;  3BR5 A;  2ZCM A;  2Y31 A;  4G12 A;  5F1J A;  4NEL A;  3BR2 A;  5K7H A;  4GFL A;  3VVX A;  3VVY A;  1RPW A;  2QWT A;  1RKW A;  3ON4 A;  3VW2 A;  5FGL A;  3BTJ A;  2F07 A;  3EGQ A;  3CRJ A;  4CGR A;  2OPT A;  1JUS A;  2IEK A;  3S5R A;  1U9N A;  3FRQ A;  3LHQ A;  4W1U A;  1JTY A;  3BTL A;  3VIB A;  3DEW A;  5K7F A;  1Z0X A;  1UI6 A;  3LSR A;  3FK6 A;  3VOK A;  3HGG A;  3HE0 A;  2G7L A;  3ON2 A;  2ZOZ A;  5J1R A;  3B81 A;  3LJL A;  1QVU A;  2ZCN A;  3CJD A;  2ZCX A;  2XGE A;  2Y30 A;  5EYR A;  2EH3 A;  3BCG A;  4W97 A;  3PM1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...