4MK6A

Crystal structure of probable dihydroxyacetone kinase regulator dhsk_reg from listeria monocytogenes egd-e
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
188
structure length
188
Chain Sequence
SNAMAESLITKKAIAGGLMELCQHKRFEKISIADITNICGLNRQTFYYHFTDKYDLLTWTYENDFFHCLADGITLGNWDKHVLKMLESIKENADFYKNTVSADASILSFCFSKLTNSLFMDLFEKIDTNATVNEADRVFYAEFFSYGCSGVLIKWITRGFKEAPETIANQLFRLAKDTEFLANSMYRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Probable Dihydroxyacetone Kinase Regulator DHSK_reg from Listeria monocytogenes EGD-e
rcsb
source organism Listeria monocytogenes
molecule tags Transcription regulator
molecule keywords Probable Dihydroxyacetone Kinase Regulator DHSK_reg
total genus 69
structure length 188
sequence length 188
ec nomenclature
pdb deposition date 2013-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF14278 TetR_C_8 Transcriptional regulator C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 4mk6A00
2ID6A 3G1OA 5FKMA 5J3LA 5F27A 2TCTA 2OERA 3QBMA 2PBXA 1RKWA 2HYJA 2ZB9A 3NI7A 4ICHA 1ZKGA 3BT9A 2QWTA 3AQTA 5FKOA 5F04A 2IBDA 3SFIA 3DEWA 3LHQA 5D18A 4MXMA 3TP0A 2GENA 2ZCXA 2UXPA 2G0EA 4JNNA 3Q0VA 3LJLA 5DAJA 2YVEA 3B6CA 2DG7A 3LSPA 3TP3A 5F0CA 3VOXA 5J1YA 2REKA 2NS7A 4W1UA 1JTXA 2G7LA 2IU5A 3VP5A 5IOYA 2RHAA 4I76A 1VI0A 4G12A 4W97A 4MK6A 3CRJA 2IAIA 3KKDA 3MNLA 1A6IA 3BTIA 3BTJA 1ZK8A 2VKEA 3GEUA 5F08A 5FMPA 3VUQA 2YVHA 4L62A 5C4YA 2G7SA 3HTIA 3EGQA 3DPJA 1JUMA 1U9NA 2V57A 5FGLA 3BQZA 1QVUA 4B3AA 1JUSA 2UXUA 3NPIA 3O8GA 3LSJA 3F0CA 3G1MA 3VPRA 4GFLA 3ON2A 2FD5A 3HTHA 2HQ5A 3NRGA 2Y2ZA 5HSZA 3CCYA 3NXCA 2XDNA 2OI8A 5EZGA 2FJ1A 2FX0A 3NNRA 2XGCA 5FKLA 3SDGA 4PXIA 5K7ZA 3QQAA 3Q0WA 3FIWA 4AC0A 5HBUA 3BR5A 2VPRA 4GFKA 5CXIA 5J1RA 2Y31A 3IH4A 3FK7A 1Z77A 2O7OA 2W53A 5GPCA 5IP6A 4GCKA 2QTQA 1Z0XA 4M3FA 2G7GA 4MO7A 2XPVA 4M3GA 5CW8A 4CGRA 3LOCA 3HE0A 2WV1A 3HGGA 4DW6A 1UI6A 2X9DA 2I10A 2XRLA 3VW1A 4D5CA 3V6GA 4GCTA 5K7HA 3HTJA 4XK4A 2FBQA 3IH3A 3JSJA 3BR1A 2UXIA 3AQSA 3VVZA 2TRTA 3BNIA 5J1UA 2NS8A 4HKUA 2G3BA 1T33A 2XPWA 3QPLA 2DG8A 1ORKA 1RKTA 4AUXA 3Q0UA 1QVTA 3ANPA 3GZIA 3O8HA 2RAEA 3BCGA 3G56A 1SGMA 3PASA 3MVPA 3VVYA 2FQ4A 3PPBA 4JL3A 2EH3A 3ZQIA 4YZEA 3BRUA 2ZOYA 3ZQHA 5AQCA 2HKUA 4M3EA 3ON4A 3HIMA 2NX4A 3CDLA 1RPWA 5CXGA 5EZHA 2ZCNA 3G1LA 2ZCMA 2XB5A 5D19A 3VIBA 2ZOZA 5K58A 3BR2A 3RD3A 3B81A 5FKKA 2Y30A 2RASA 3BR6A 2HYTA 2X6OA 3F1BA 3VW0A 5D1RA 2UXHA 3P9TA 3IH2A 4KWAA 1JUPA 3S5RA 4AC6A 2HXIA 5GPAA 2D6YA 2NP5A 3BQYA 4AF5A 1T56A 3Q3SA 2NP3A 4NELA 1UI5A 4D5FA 5K7FA 3VOKA 3KZ9A 2GBYA 3BTCA 2XGEA 3DCFA 3VVXA 3QKXA 3IUVA 4D7NA 3C07A 5F0HA 3WHBA 3CWRA 5EYRA 2GUHA 3ZQLA 3VW2A 3E7QA 3B6AA 3HGYA 4ME9A 1U9OA 2HXOA 3WHCA 3RH2A 5H9TA 3FRQA 4X1EA 1QPIA 1BJZA 2XGDA 2WGBA 2IEKA 2OPTA 2QKOA 3O60A 4UDSA 3BJBA 4D7MA 5HAWA 3QPSA 3ZQGA 4ACIA 2Q24A 5FKNA 4V2FA 3ANGA 5IPAA 2GFNA 5IOZA 4B1RA 2VKVA 5FHPA 4M3BA 5EFYA 3BR0A 3COLA 3BHQA 4ABZA 2WUIA 3LSRA 3HTAA 3PM1A 4V2GA 4GCLA 2JK3A 3V78A 3KKCA 3BR3A 3BTLA 4I6ZA 3KNWA 4NN1A 2XPUA 2F07A 2QCOA 1JT0A 1JT6A 4JKZA 2ID3A 4M3DA 3FK6A 3T6NA 3CJDA 1JTYA 5GP9A 2PZ9A 2QIBA 3ZQFA 2QOPA 3EUPA 4JYKA 2JJ7A 2O7TA 3C2BA 3G7RA 5F1JA 3LWJA 2DTZA 2UXOA 2OF7A 5F0FA
chains in the Genus database with same CATH superfamily
2ID6A 3G1OA 5FKMA 5J3LA 2A2FX 5F27A 2TCTA 2OERA 3QBMA 2PBXA 1RKWA 2HYJA 2ZB9A 3NI7A 4ICHA 1ZKGA 3BT9A 2QWTA 3AQTA 5FKOA 5F04A 2IBDA 3SFIA 3DEWA 3LHQA 5D18A 2R7WA 4MXMA 3TP0A 2GENA 2ZCXA 2UXPA 2G0EA 4JNNA 3Q0VA 3LJLA 5DAJA 2YVEA 3B6CA 2DG7A 3LSPA 3TP3A 5F0CA 3VOXA 5J1YA 2REKA 2NS7A 4W1UA 1JTXA 2G7LA 2IU5A 3VP5A 2YVXA 5IOYA 2RHAA 4I76A 1VI0A 4G12A 4W97A 4MK6A 3CRJA 3VTIA 2IAIA 3KKDA 3MNLA 1A6IA 2R7VA 3BTIA 3BTJA 1ZK8A 2VKEA 3GEUA 5F08A 5FMPA 3VUQA 2YVHA 4L62A 5C4YA 2G7SA 3HTIA 3EGQA 3DPJA 1JUMA 1U9NA 2V57A 5FGLA 3BQZA 1QVUA 4B3AA 4WIBA 1JUSA 2UXUA 3NPIA 3O8GA 3LSJA 3F0CA 3G1MA 3VPRA 4GFLA 3ON2A 2FD5A 3HTHA 2HQ5A 3NRGA 2Y2ZA 5HSZA 3CCYA 3NXCA 2XDNA 2OI8A 4C2MA 2R7TA 5EZGA 3KYLA 2FJ1A 2FX0A 3NNRA 2XGCA 5FKLA 3SDGA 4PXIA 5K7ZA 3QQAA 4IRVA 3Q0WA 3FIWA 4AC0A 5HBUA 2ZY9A 3BR5A 2VPRA 4GFKA 5CXIA 5J1RA 2Y31A 3IH4A 3FK7A 1Z77A 2O7OA 2W53A 5GPCA 2R7UA 5IP6A 4GCKA 2PFVA 2QTQA 1Z0XA 4M3FA 2G7GA 4MO7A 2B1EA 2XPVA 4M3GA 5CW8A 4CGRA 3LOCA 3HE0A 2WV1A 3HGGA 4DW6A 1UI6A 2X9DA 2I10A 2XRLA 3VW1A 4D5CA 3V6GA 4GCTA 5K7HA 3HTJA 4XK4A 2FBQA 3IH3A 3JSJA 3BR1A 2UXIA 3AQSA 3VVZA 2TRTA 3BNIA 5J1UA 2NS8A 4HKUA 2G3BA 4DVYP 1T33A 2XPWA 3QPLA 2R7RA 2DG8A 1ORKA 1RKTA 4AUXA 3Q0UA 1QVTA 3ANPA 3GZIA 3O8HA 2RAEA 3BCGA 3G56A 1SGMA 3PASA 3FHNA 3MVPA 3VVYA 2FQ4A 3PPBA 4JL3A 2EH3A 3ZQIA 3NS4A 4YZEA 3BRUA 2ZOYA 3ZQHA 5AQCA 2HKUA 4M3EA 3ON4A 3HIMA 2NX4A 3CDLA 1RPWA 2FJI1 4OD4A 5CXGA 5EZHA 2ZCNA 3G1LA 2B3WA 2ZCMA 2XB5A 5D19A 3DU6A 3VIBA 2ZOZA 5K58A 3BR2A 3RD3A 3B81A 5FKKA 2Y30A 2R7XA 2RASA 3BR6A 3K8PC 2HYTA 2X6OA 3F1BA 3VW0A 5D1RA 2UXHA 3P9TA 3IH2A 4KWAA 4U9NA 1JUPA 3S5RA 4AC6A 2HXIA 5GPAA 2D6YA 2R7SA 2NP5A 2R7QA 5CQGA 3BQYA 4AF5A 1T56A 3Q3SA 2NP3A 4NELA 1UI5A 4D5FA 5K7FA 3VOKA 3KZ9A 2GBYA 3BTCA 2XGEA 3DCFA 3VVXA 3QKXA 3IUVA 4D7NA 3C07A 5F0HA 3WHBA 3CWRA 5EYRA 2GUHA 3ZQLA 3VW2A 3E7QA 3B6AA 3HGYA 4ME9A 1U9OA 2HXOA 3WHCA 3RH2A 5H9TA 3FRQA 4U9LA 4X1EA 1QPIA 1BJZA 2XGDA 2WGBA 2IEKA 2OPTA 2QKOA 3O60A 4UDSA 3BJBA 4D7MA 5HAWA 3QPSA 3ZQGA 4ACIA 2Q24A 5FKNA 4V2FA 3ANGA 5IPAA 3DU5A 2GFNA 5IOZA 4B1RA 2VKVA 5FHPA 4M3BA 5EFYA 3BR0A 3COLA 3BHQA 4ABZA 2WUIA 2R7OA 3HTAA 3LSRA 3PM1A 4V2GA 4GCLA 2JK3A 3V78A 3KKCA 3BR3A 3BTLA 4I6ZA 3KNWA 4NN1A 2XPUA 2F07A 2QCOA 1JT0A 1JT6A 4JKZA 2ID3A 4M3DA 4OD5A 3FK6A 3T6NA 3CJDA 1JTYA 5GP9A 2PZ9A 2QIBA 3ZQFA 2QOPA 3EUPA 4JYKA 2JJ7A 3SWHA 2O7TA 3C2BA 3G7RA 5F1JA 3LWJA 2DTZA 2UXOA 2OF7A 5F0FA
chains in the Genus database with same CATH topology
2ID6A 3G1OA 5FKMA 5J3LA 5F27A 2TCTA 2OERA 3QBMA 2PBXA 1RKWA 2HYJA 2ZB9A 3NI7A 4ICHA 1ZKGA 3BT9A 2QWTA 3AQTA 5FKOA 5F04A 2IBDA 3SFIA 3DEWA 3LHQA 5D18A 4MXMA 3TP0A 2GENA 2ZCXA 2UXPA 2G0EA 4JNNA 3Q0VA 3LJLA 5DAJA 2YVEA 3B6CA 2DG7A 3LSPA 3TP3A 5F0CA 3VOXA 5J1YA 2REKA 2NS7A 4W1UA 1JTXA 2G7LA 2IU5A 3VP5A 5IOYA 2RHAA 4I76A 1VI0A 4G12A 4W97A 4MK6A 3CRJA 2IAIA 3KKDA 3MNLA 1A6IA 3BTIA 3BTJA 1ZK8A 2VKEA 3GEUA 5F08A 5FMPA 3VUQA 2YVHA 4L62A 5C4YA 2G7SA 3HTIA 3EGQA 3DPJA 1JUMA 1U9NA 2V57A 5FGLA 3BQZA 1QVUA 4B3AA 1JUSA 2UXUA 3NPIA 3O8GA 3LSJA 3F0CA 3G1MA 3VPRA 4GFLA 3ON2A 2FD5A 3HTHA 2HQ5A 3NRGA 2Y2ZA 5HSZA 3CCYA 3NXCA 2XDNA 2OI8A 5EZGA 2FJ1A 2FX0A 3NNRA 2XGCA 5FKLA 3SDGA 4PXIA 5K7ZA 3QQAA 3Q0WA 3FIWA 4AC0A 5HBUA 3BR5A 2VPRA 4GFKA 5CXIA 5J1RA 2Y31A 3IH4A 3FK7A 1Z77A 2O7OA 2W53A 5GPCA 5IP6A 4GCKA 2QTQA 1Z0XA 4M3FA 2G7GA 4MO7A 2XPVA 4M3GA 5CW8A 4CGRA 3LOCA 3HE0A 2WV1A 3HGGA 4DW6A 1UI6A 2X9DA 2I10A 2XRLA 3VW1A 4D5CA 3V6GA 4GCTA 5K7HA 3HTJA 4XK4A 2FBQA 3IH3A 3JSJA 3BR1A 2UXIA 3AQSA 3VVZA 2TRTA 3BNIA 5J1UA 2NS8A 4HKUA 2G3BA 1T33A 2XPWA 3QPLA 2DG8A 1ORKA 1RKTA 4AUXA 3Q0UA 1QVTA 3ANPA 3GZIA 3O8HA 2RAEA 3BCGA 3G56A 1SGMA 3PASA 3MVPA 3VVYA 2FQ4A 3PPBA 4JL3A 2EH3A 3ZQIA 4YZEA 3BRUA 2ZOYA 3ZQHA 5AQCA 2HKUA 4M3EA 3ON4A 3HIMA 2NX4A 3CDLA 1RPWA 5CXGA 5EZHA 2ZCNA 3G1LA 2ZCMA 2XB5A 5D19A 3VIBA 2ZOZA 5K58A 3BR2A 3RD3A 3B81A 5FKKA 2Y30A 2RASA 3BR6A 2HYTA 2X6OA 3F1BA 3VW0A 5D1RA 2UXHA 3P9TA 3IH2A 4KWAA 1JUPA 3S5RA 4AC6A 2HXIA 5GPAA 2D6YA 2NP5A 3BQYA 4AF5A 1T56A 3Q3SA 2NP3A 4NELA 1UI5A 4D5FA 5K7FA 3VOKA 3KZ9A 2GBYA 3BTCA 2XGEA 3DCFA 3VVXA 3QKXA 3IUVA 4D7NA 3C07A 5F0HA 3WHBA 3CWRA 5EYRA 2GUHA 3ZQLA 3VW2A 3E7QA 3B6AA 3HGYA 4ME9A 1U9OA 2HXOA 3WHCA 3RH2A 5H9TA 3FRQA 4X1EA 1QPIA 1BJZA 2XGDA 2WGBA 2IEKA 2OPTA 2QKOA 3O60A 4UDSA 3BJBA 4D7MA 5HAWA 3QPSA 3ZQGA 4ACIA 2Q24A 5FKNA 4V2FA 3ANGA 5IPAA 2GFNA 5IOZA 4B1RA 2VKVA 5FHPA 4M3BA 5EFYA 3BR0A 3COLA 3BHQA 4ABZA 2WUIA 3LSRA 3HTAA 3PM1A 4V2GA 4GCLA 2JK3A 3V78A 3KKCA 3BR3A 3BTLA 4I6ZA 3KNWA 4NN1A 2XPUA 2F07A 2QCOA 1JT0A 1JT6A 4JKZA 2ID3A 4M3DA 3FK6A 3T6NA 3CJDA 1JTYA 5GP9A 2PZ9A 2QIBA 3ZQFA 2QOPA 3EUPA 4JYKA 2JJ7A 2O7TA 3C2BA 3G7RA 5F1JA 3LWJA 2DTZA 2UXOA 2OF7A 5F0FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ID6 A;  3G1O A;  5FKM A;  5J3L A;  5F27 A;  2TCT A;  2OER A;  3QBM A;  2PBX A;  1RKW A;  2HYJ A;  2ZB9 A;  3NI7 A;  4ICH A;  1ZKG A;  3BT9 A;  2QWT A;  3AQT A;  5FKO A;  5F04 A;  2IBD A;  3SFI A;  3DEW A;  3LHQ A;  5D18 A;  4MXM A;  3TP0 A;  2GEN A;  2ZCX A;  2UXP A;  2G0E A;  4JNN A;  3Q0V A;  3LJL A;  5DAJ A;  2YVE A;  3B6C A;  2DG7 A;  3LSP A;  3TP3 A;  5F0C A;  3VOX A;  5J1Y A;  2REK A;  2NS7 A;  4W1U A;  1JTX A;  2G7L A;  2IU5 A;  3VP5 A;  5IOY A;  2RHA A;  4I76 A;  1VI0 A;  4G12 A;  4W97 A;  4MK6 A;  3CRJ A;  2IAI A;  3KKD A;  3MNL A;  1A6I A;  3BTI A;  3BTJ A;  1ZK8 A;  2VKE A;  3GEU A;  5F08 A;  5FMP A;  3VUQ A;  2YVH A;  4L62 A;  5C4Y A;  2G7S A;  3HTI A;  3EGQ A;  3DPJ A;  1JUM A;  1U9N A;  2V57 A;  5FGL A;  3BQZ A;  1QVU A;  4B3A A;  1JUS A;  2UXU A;  3NPI A;  3O8G A;  3LSJ A;  3F0C A;  3G1M A;  3VPR A;  4GFL A;  3ON2 A;  2FD5 A;  3HTH A;  2HQ5 A;  3NRG A;  2Y2Z A;  5HSZ A;  3CCY A;  3NXC A;  2XDN A;  2OI8 A;  5EZG A;  2FJ1 A;  2FX0 A;  3NNR A;  2XGC A;  5FKL A;  3SDG A;  4PXI A;  5K7Z A;  3QQA A;  3Q0W A;  3FIW A;  4AC0 A;  5HBU A;  3BR5 A;  2VPR A;  4GFK A;  5CXI A;  5J1R A;  2Y31 A;  3IH4 A;  3FK7 A;  1Z77 A;  2O7O A;  2W53 A;  5GPC A;  5IP6 A;  4GCK A;  2QTQ A;  1Z0X A;  4M3F A;  2G7G A;  4MO7 A;  2XPV A;  4M3G A;  5CW8 A;  4CGR A;  3LOC A;  3HE0 A;  2WV1 A;  3HGG A;  4DW6 A;  1UI6 A;  2X9D A;  2I10 A;  2XRL A;  3VW1 A;  4D5C A;  3V6G A;  4GCT A;  5K7H A;  3HTJ A;  4XK4 A;  2FBQ A;  3IH3 A;  3JSJ A;  3BR1 A;  2UXI A;  3AQS A;  3VVZ A;  2TRT A;  3BNI A;  5J1U A;  2NS8 A;  4HKU A;  2G3B A;  1T33 A;  2XPW A;  3QPL A;  2DG8 A;  1ORK A;  1RKT A;  4AUX A;  3Q0U A;  1QVT A;  3ANP A;  3GZI A;  3O8H A;  2RAE A;  3BCG A;  3G56 A;  1SGM A;  3PAS A;  3MVP A;  3VVY A;  2FQ4 A;  3PPB A;  4JL3 A;  2EH3 A;  3ZQI A;  4YZE A;  3BRU A;  2ZOY A;  3ZQH A;  5AQC A;  2HKU A;  4M3E A;  3ON4 A;  3HIM A;  2NX4 A;  3CDL A;  1RPW A;  5CXG A;  5EZH A;  2ZCN A;  3G1L A;  2ZCM A;  2XB5 A;  5D19 A;  3VIB A;  2ZOZ A;  5K58 A;  3BR2 A;  3RD3 A;  3B81 A;  5FKK A;  2Y30 A;  2RAS A;  3BR6 A;  2HYT A;  2X6O A;  3F1B A;  3VW0 A;  5D1R A;  2UXH A;  3P9T A;  3IH2 A;  4KWA A;  1JUP A;  3S5R A;  4AC6 A;  2HXI A;  5GPA A;  2D6Y A;  2NP5 A;  3BQY A;  4AF5 A;  1T56 A;  3Q3S A;  2NP3 A;  4NEL A;  1UI5 A;  4D5F A;  5K7F A;  3VOK A;  3KZ9 A;  2GBY A;  3BTC A;  2XGE A;  3DCF A;  3VVX A;  3QKX A;  3IUV A;  4D7N A;  3C07 A;  5F0H A;  3WHB A;  3CWR A;  5EYR A;  2GUH A;  3ZQL A;  3VW2 A;  3E7Q A;  3B6A A;  3HGY A;  4ME9 A;  1U9O A;  2HXO A;  3WHC A;  3RH2 A;  5H9T A;  3FRQ A;  4X1E A;  1QPI A;  1BJZ A;  2XGD A;  2WGB A;  2IEK A;  2OPT A;  2QKO A;  3O60 A;  4UDS A;  3BJB A;  4D7M A;  5HAW A;  3QPS A;  3ZQG A;  4ACI A;  2Q24 A;  5FKN A;  4V2F A;  3ANG A;  5IPA A;  2GFN A;  5IOZ A;  4B1R A;  2VKV A;  5FHP A;  4M3B A;  5EFY A;  3BR0 A;  3COL A;  3BHQ A;  4ABZ A;  2WUI A;  3LSR A;  3HTA A;  3PM1 A;  4V2G A;  4GCL A;  2JK3 A;  3V78 A;  3KKC A;  3BR3 A;  3BTL A;  4I6Z A;  3KNW A;  4NN1 A;  2XPU A;  2F07 A;  2QCO A;  1JT0 A;  1JT6 A;  4JKZ A;  2ID3 A;  4M3D A;  3FK6 A;  3T6N A;  3CJD A;  1JTY A;  5GP9 A;  2PZ9 A;  2QIB A;  3ZQF A;  2QOP A;  3EUP A;  4JYK A;  2JJ7 A;  2O7T A;  3C2B A;  3G7R A;  5F1J A;  3LWJ A;  2DTZ A;  2UXO A;  2OF7 A;  5F0F A; 
#chains in the Genus database with same CATH topology
 2ID6 A;  3G1O A;  5FKM A;  5J3L A;  2A2F X;  5F27 A;  2TCT A;  2OER A;  3QBM A;  2PBX A;  1RKW A;  2HYJ A;  2ZB9 A;  3NI7 A;  4ICH A;  1ZKG A;  3BT9 A;  2QWT A;  3AQT A;  5FKO A;  5F04 A;  2IBD A;  3SFI A;  3DEW A;  3LHQ A;  5D18 A;  2R7W A;  4MXM A;  3TP0 A;  2GEN A;  2ZCX A;  2UXP A;  2G0E A;  4JNN A;  3Q0V A;  3LJL A;  5DAJ A;  2YVE A;  3B6C A;  2DG7 A;  3LSP A;  3TP3 A;  5F0C A;  3VOX A;  5J1Y A;  2REK A;  2NS7 A;  4W1U A;  1JTX A;  2G7L A;  2IU5 A;  3VP5 A;  2YVX A;  5IOY A;  2RHA A;  4I76 A;  1VI0 A;  4G12 A;  4W97 A;  4MK6 A;  3CRJ A;  3VTI A;  2IAI A;  3KKD A;  3MNL A;  1A6I A;  2R7V A;  3BTI A;  3BTJ A;  1ZK8 A;  2VKE A;  3GEU A;  5F08 A;  5FMP A;  3VUQ A;  2YVH A;  4L62 A;  5C4Y A;  2G7S A;  3HTI A;  3EGQ A;  3DPJ A;  1JUM A;  1U9N A;  2V57 A;  5FGL A;  3BQZ A;  1QVU A;  4B3A A;  4WIB A;  1JUS A;  2UXU A;  3NPI A;  3O8G A;  3LSJ A;  3F0C A;  3G1M A;  3VPR A;  4GFL A;  3ON2 A;  2FD5 A;  3HTH A;  2HQ5 A;  3NRG A;  2Y2Z A;  5HSZ A;  3CCY A;  3NXC A;  2XDN A;  2OI8 A;  4C2M A;  2R7T A;  5EZG A;  3KYL A;  2FJ1 A;  2FX0 A;  3NNR A;  2XGC A;  5FKL A;  3SDG A;  4PXI A;  5K7Z A;  3QQA A;  4IRV A;  3Q0W A;  3FIW A;  4AC0 A;  5HBU A;  2ZY9 A;  3BR5 A;  2VPR A;  4GFK A;  5CXI A;  5J1R A;  2Y31 A;  3IH4 A;  3FK7 A;  1Z77 A;  2O7O A;  2W53 A;  5GPC A;  2R7U A;  5IP6 A;  4GCK A;  2PFV A;  2QTQ A;  1Z0X A;  4M3F A;  2G7G A;  4MO7 A;  2B1E A;  2XPV A;  4M3G A;  5CW8 A;  4CGR A;  3LOC A;  3HE0 A;  2WV1 A;  3HGG A;  4DW6 A;  1UI6 A;  2X9D A;  2I10 A;  2XRL A;  3VW1 A;  4D5C A;  3V6G A;  4GCT A;  5K7H A;  3HTJ A;  4XK4 A;  2FBQ A;  3IH3 A;  3JSJ A;  3BR1 A;  2UXI A;  3AQS A;  3VVZ A;  2TRT A;  3BNI A;  5J1U A;  2NS8 A;  4HKU A;  2G3B A;  4DVY P;  1T33 A;  2XPW A;  3QPL A;  2R7R A;  2DG8 A;  1ORK A;  1RKT A;  4AUX A;  3Q0U A;  1QVT A;  3ANP A;  3GZI A;  3O8H A;  2RAE A;  3BCG A;  3G56 A;  1SGM A;  3PAS A;  3FHN A;  3MVP A;  3VVY A;  2FQ4 A;  3PPB A;  4JL3 A;  2EH3 A;  3ZQI A;  3NS4 A;  4YZE A;  3BRU A;  2ZOY A;  3ZQH A;  5AQC A;  2HKU A;  4M3E A;  3ON4 A;  3HIM A;  2NX4 A;  3CDL A;  1RPW A;  2FJI 1;  4OD4 A;  5CXG A;  5EZH A;  2ZCN A;  3G1L A;  2B3W A;  2ZCM A;  2XB5 A;  5D19 A;  3DU6 A;  3VIB A;  2ZOZ A;  5K58 A;  3BR2 A;  3RD3 A;  3B81 A;  5FKK A;  2Y30 A;  2R7X A;  2RAS A;  3BR6 A;  3K8P C;  2HYT A;  2X6O A;  3F1B A;  3VW0 A;  5D1R A;  2UXH A;  3P9T A;  3IH2 A;  4KWA A;  4U9N A;  1JUP A;  3S5R A;  4AC6 A;  2HXI A;  5GPA A;  2D6Y A;  2R7S A;  2NP5 A;  2R7Q A;  5CQG A;  3BQY A;  4AF5 A;  1T56 A;  3Q3S A;  2NP3 A;  4NEL A;  1UI5 A;  4D5F A;  5K7F A;  3VOK A;  3KZ9 A;  2GBY A;  3BTC A;  2XGE A;  3DCF A;  3VVX A;  3QKX A;  3IUV A;  4D7N A;  3C07 A;  5F0H A;  3WHB A;  3CWR A;  5EYR A;  2GUH A;  3ZQL A;  3VW2 A;  3E7Q A;  3B6A A;  3HGY A;  4ME9 A;  1U9O A;  2HXO A;  3WHC A;  3RH2 A;  5H9T A;  3FRQ A;  4U9L A;  4X1E A;  1QPI A;  1BJZ A;  2XGD A;  2WGB A;  2IEK A;  2OPT A;  2QKO A;  3O60 A;  4UDS A;  3BJB A;  4D7M A;  5HAW A;  3QPS A;  3ZQG A;  4ACI A;  2Q24 A;  5FKN A;  4V2F A;  3ANG A;  5IPA A;  3DU5 A;  2GFN A;  5IOZ A;  4B1R A;  2VKV A;  5FHP A;  4M3B A;  5EFY A;  3BR0 A;  3COL A;  3BHQ A;  4ABZ A;  2WUI A;  2R7O A;  3HTA A;  3LSR A;  3PM1 A;  4V2G A;  4GCL A;  2JK3 A;  3V78 A;  3KKC A;  3BR3 A;  3BTL A;  4I6Z A;  3KNW A;  4NN1 A;  2XPU A;  2F07 A;  2QCO A;  1JT0 A;  1JT6 A;  4JKZ A;  2ID3 A;  4M3D A;  4OD5 A;  3FK6 A;  3T6N A;  3CJD A;  1JTY A;  5GP9 A;  2PZ9 A;  2QIB A;  3ZQF A;  2QOP A;  3EUP A;  4JYK A;  2JJ7 A;  3SWH A;  2O7T A;  3C2B A;  3G7R A;  5F1J A;  3LWJ A;  2DTZ A;  2UXO A;  2OF7 A;  5F0F A; 
#chains in the Genus database with same CATH homology
 2ID6 A;  3G1O A;  5FKM A;  5J3L A;  5F27 A;  2TCT A;  2OER A;  3QBM A;  2PBX A;  1RKW A;  2HYJ A;  2ZB9 A;  3NI7 A;  4ICH A;  1ZKG A;  3BT9 A;  2QWT A;  3AQT A;  5FKO A;  5F04 A;  2IBD A;  3SFI A;  3DEW A;  3LHQ A;  5D18 A;  4MXM A;  3TP0 A;  2GEN A;  2ZCX A;  2UXP A;  2G0E A;  4JNN A;  3Q0V A;  3LJL A;  5DAJ A;  2YVE A;  3B6C A;  2DG7 A;  3LSP A;  3TP3 A;  5F0C A;  3VOX A;  5J1Y A;  2REK A;  2NS7 A;  4W1U A;  1JTX A;  2G7L A;  2IU5 A;  3VP5 A;  5IOY A;  2RHA A;  4I76 A;  1VI0 A;  4G12 A;  4W97 A;  4MK6 A;  3CRJ A;  2IAI A;  3KKD A;  3MNL A;  1A6I A;  3BTI A;  3BTJ A;  1ZK8 A;  2VKE A;  3GEU A;  5F08 A;  5FMP A;  3VUQ A;  2YVH A;  4L62 A;  5C4Y A;  2G7S A;  3HTI A;  3EGQ A;  3DPJ A;  1JUM A;  1U9N A;  2V57 A;  5FGL A;  3BQZ A;  1QVU A;  4B3A A;  1JUS A;  2UXU A;  3NPI A;  3O8G A;  3LSJ A;  3F0C A;  3G1M A;  3VPR A;  4GFL A;  3ON2 A;  2FD5 A;  3HTH A;  2HQ5 A;  3NRG A;  2Y2Z A;  5HSZ A;  3CCY A;  3NXC A;  2XDN A;  2OI8 A;  5EZG A;  2FJ1 A;  2FX0 A;  3NNR A;  2XGC A;  5FKL A;  3SDG A;  4PXI A;  5K7Z A;  3QQA A;  3Q0W A;  3FIW A;  4AC0 A;  5HBU A;  3BR5 A;  2VPR A;  4GFK A;  5CXI A;  5J1R A;  2Y31 A;  3IH4 A;  3FK7 A;  1Z77 A;  2O7O A;  2W53 A;  5GPC A;  5IP6 A;  4GCK A;  2QTQ A;  1Z0X A;  4M3F A;  2G7G A;  4MO7 A;  2XPV A;  4M3G A;  5CW8 A;  4CGR A;  3LOC A;  3HE0 A;  2WV1 A;  3HGG A;  4DW6 A;  1UI6 A;  2X9D A;  2I10 A;  2XRL A;  3VW1 A;  4D5C A;  3V6G A;  4GCT A;  5K7H A;  3HTJ A;  4XK4 A;  2FBQ A;  3IH3 A;  3JSJ A;  3BR1 A;  2UXI A;  3AQS A;  3VVZ A;  2TRT A;  3BNI A;  5J1U A;  2NS8 A;  4HKU A;  2G3B A;  1T33 A;  2XPW A;  3QPL A;  2DG8 A;  1ORK A;  1RKT A;  4AUX A;  3Q0U A;  1QVT A;  3ANP A;  3GZI A;  3O8H A;  2RAE A;  3BCG A;  3G56 A;  1SGM A;  3PAS A;  3MVP A;  3VVY A;  2FQ4 A;  3PPB A;  4JL3 A;  2EH3 A;  3ZQI A;  4YZE A;  3BRU A;  2ZOY A;  3ZQH A;  5AQC A;  2HKU A;  4M3E A;  3ON4 A;  3HIM A;  2NX4 A;  3CDL A;  1RPW A;  5CXG A;  5EZH A;  2ZCN A;  3G1L A;  2ZCM A;  2XB5 A;  5D19 A;  3VIB A;  2ZOZ A;  5K58 A;  3BR2 A;  3RD3 A;  3B81 A;  5FKK A;  2Y30 A;  2RAS A;  3BR6 A;  2HYT A;  2X6O A;  3F1B A;  3VW0 A;  5D1R A;  2UXH A;  3P9T A;  3IH2 A;  4KWA A;  1JUP A;  3S5R A;  4AC6 A;  2HXI A;  5GPA A;  2D6Y A;  2NP5 A;  3BQY A;  4AF5 A;  1T56 A;  3Q3S A;  2NP3 A;  4NEL A;  1UI5 A;  4D5F A;  5K7F A;  3VOK A;  3KZ9 A;  2GBY A;  3BTC A;  2XGE A;  3DCF A;  3VVX A;  3QKX A;  3IUV A;  4D7N A;  3C07 A;  5F0H A;  3WHB A;  3CWR A;  5EYR A;  2GUH A;  3ZQL A;  3VW2 A;  3E7Q A;  3B6A A;  3HGY A;  4ME9 A;  1U9O A;  2HXO A;  3WHC A;  3RH2 A;  5H9T A;  3FRQ A;  4X1E A;  1QPI A;  1BJZ A;  2XGD A;  2WGB A;  2IEK A;  2OPT A;  2QKO A;  3O60 A;  4UDS A;  3BJB A;  4D7M A;  5HAW A;  3QPS A;  3ZQG A;  4ACI A;  2Q24 A;  5FKN A;  4V2F A;  3ANG A;  5IPA A;  2GFN A;  5IOZ A;  4B1R A;  2VKV A;  5FHP A;  4M3B A;  5EFY A;  3BR0 A;  3COL A;  3BHQ A;  4ABZ A;  2WUI A;  3LSR A;  3HTA A;  3PM1 A;  4V2G A;  4GCL A;  2JK3 A;  3V78 A;  3KKC A;  3BR3 A;  3BTL A;  4I6Z A;  3KNW A;  4NN1 A;  2XPU A;  2F07 A;  2QCO A;  1JT0 A;  1JT6 A;  4JKZ A;  2ID3 A;  4M3D A;  3FK6 A;  3T6N A;  3CJD A;  1JTY A;  5GP9 A;  2PZ9 A;  2QIB A;  3ZQF A;  2QOP A;  3EUP A;  4JYK A;  2JJ7 A;  2O7T A;  3C2B A;  3G7R A;  5F1J A;  3LWJ A;  2DTZ A;  2UXO A;  2OF7 A;  5F0F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...