4MK6A

Crystal structure of probable dihydroxyacetone kinase regulator dhsk_reg from listeria monocytogenes egd-e
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
188
structure length
188
Chain Sequence
SNAMAESLITKKAIAGGLMELCQHKRFEKISIADITNICGLNRQTFYYHFTDKYDLLTWTYENDFFHCLADGITLGNWDKHVLKMLESIKENADFYKNTVSADASILSFCFSKLTNSLFMDLFEKIDTNATVNEADRVFYAEFFSYGCSGVLIKWITRGFKEAPETIANQLFRLAKDTEFLANSMYRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Probable Dihydroxyacetone Kinase Regulator DHSK_reg
publication title Crystal Structure of Probable Dihydroxyacetone Kinase Regulator DHSK_reg from Listeria monocytogenes EGD-e
rcsb
source organism Listeria monocytogenes
total genus 69
structure length 188
sequence length 188
ec nomenclature
pdb deposition date 2013-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF14278 TetR_C_8 Transcriptional regulator C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 4mk6A00
5HAWA 4ICHA 2G0EA 2OERA 4I6ZA 2NP3A 3QPSA 3BRUA 5GP9A 3RH2A 2GBYA 2VKEA 2TRTA 3DPJA 3ZQGA 5EFYA 2DG7A 3BR3A 3Q0UA 2ZOZA 2VPRA 4PXIA 4AC0A 3VVZA 3E7QA 2X6OA 5IOZA 2V57A 4JKZA 4CGRA 3QBMA 5F0CA 3V6GA 3EUPA 5CXGA 2DG8A 3COLA 2ZOYA 5F0HA 5GPAA 2NX4A 5CW8A 2I10A 5FKNA 3ANPA 3RD3A 2O7OA 1JTYA 3LSPA 2QOPA 2JK3A 3VW1A 2O7TA 2QKOA 3Q0WA 5EZHA 5K7FA 4X1EA 3VW0A 3NPIA 2FX0A 4AUXA 3NNRA 3PM1A 4MK6A 2FBQA 1U9OA 1QVTA 3WHBA 3S5RA 2YVHA 3CJDA 1QPIA 4L62A 2RHAA 4M3FA 3LHQA 5FKMA 2FD5A 4D7NA 1RKWA 5FKKA 3VVXA 3FK7A 3BR6A 3F0CA 3BQZA 2ZCNA 3QPLA 2W53A 2UXOA 2DTZA 2RAEA 2OF7A 3FRQA 5EZGA 2XPVA 2WUIA 3KZ9A 3ZQHA 1ZKGA 4W97A 2HYTA 2D6YA 1JTXA 3BNIA 4D7MA 4MO7A 5J1YA 3EGQA 3BTJA 3BR0A 3FK6A 3BR2A 3MVPA 3AQSA 5D19A 4KWAA 3ZQLA 2TCTA 3O60A 1T33A 4D5FA 3HTIA 3HGYA 2JJ7A 2EH3A 3BJBA 4M3EA 5K7ZA 2HQ5A 5AQCA 3PPBA 3VP5A 2YVEA 3BHQA 3G1LA 2RASA 2Q24A 4W1UA 3PASA 4UDSA 3O8HA 1ZK8A 2IAIA 2ZB9A 2HKUA 2REKA 3KKCA 2WGBA 2Y31A 5GPCA 4XK4A 3B6AA 5F27A 3ON2A 2PZ9A 5J1UA 5F1JA 3BT9A 4G12A 4GCLA 3KKDA 3HE0A 3IUVA 3QKXA 1JT6A 3WHCA 2FQ4A 1ORKA 1Z77A 5K58A 3ZQFA 4AF5A 4V2GA 3VIBA 2XPUA 2XRLA 2HXIA 4V2FA 5K7HA 3LSJA 1SGMA 3LSRA 3QQAA 5FGLA 1RPWA 5HBUA 2UXHA 2OPTA 5FKLA 4ABZA 3LOCA 2IBDA 1JT0A 3VOXA 1UI6A 3TP0A 2XPWA 3AQTA 1JUSA 3ZQIA 2G7GA 3TP3A 2Y30A 2WV1A 1RKTA 4GFLA 3HGGA 3SDGA 4HKUA 2OI8A 3VUQA 4M3BA 3BTLA 5FHPA 2ZCMA 3NRGA 2ID3A 2NS7A 4B1RA 3P9TA 2XGDA 5IOYA 3VPRA 2GUHA 3CRJA 1UI5A 5CXIA 2GENA 5IP6A 5FMPA 2XGEA 2IU5A 2PBXA 4YZEA 4GCKA 3IH3A 2Y2ZA 4MXMA 2UXPA 3GEUA 1QVUA 4DW6A 2G3BA 3C2BA 3SFIA 3G56A 2UXUA 3DEWA 3Q0VA 3BR1A 4ME9A 4D5CA 3BTCA 3LJLA 3Q3SA 5C4YA 2VKVA 4JNNA 2IEKA 4GCTA 2ID6A 2G7SA 2XB5A 3CCYA 1JUPA 3G1OA 5DAJA 5F08A 1BJZA 2G7LA 3F1BA 5F0FA 3DCFA 4NN1A 4M3DA 2XGCA 3MNLA 3V78A 5F04A 5FKOA 2HXOA 3LWJA 3B6CA 5EYRA 2FJ1A 1VI0A 2GFNA 2NS8A 3JSJA 3ANGA 3T6NA 3HIMA 1Z0XA 5D1RA 3BQYA 5D18A 2F07A 3G7RA 3HTAA 4GFKA 2ZCXA 3C07A 3ON4A 3FIWA 2X9DA 5H9TA 2HYJA 5J1RA 5HSZA 3BTIA 4I76A 3GZIA 3HTJA 3O8GA 3IH2A 5IPAA 2QWTA 2QTQA 1JUMA 4B3AA 3KNWA 3CWRA 5J3LA 2QCOA 2XDNA 4AC6A 3CDLA 1U9NA 3B81A 1T56A 3VVYA 4NELA 3NXCA 4M3GA 4JYKA 3BCGA 3G1MA 2NP5A 3HTHA 2QIBA 4JL3A 3VW2A 3VOKA 3BR5A 4ACIA 3IH4A 1A6IA 2UXIA 3NI7A
chains in the Genus database with same CATH superfamily
2R7WA 5HAWA 4ICHA 2G0EA 2OERA 4I6ZA 2NP3A 3QPSA 3BRUA 5GP9A 3RH2A 2GBYA 2VKEA 2TRTA 3DPJA 3ZQGA 5EFYA 2DG7A 3BR3A 3Q0UA 2ZOZA 2VPRA 4PXIA 4AC0A 3VVZA 3E7QA 2X6OA 5IOZA 2V57A 2R7SA 4JKZA 4CGRA 3QBMA 5F0CA 3V6GA 3EUPA 5CXGA 2DG8A 3COLA 2ZOYA 5F0HA 5GPAA 2NX4A 5CW8A 2I10A 5FKNA 3ANPA 3RD3A 2O7OA 1JTYA 3LSPA 2QOPA 2JK3A 3VW1A 2YVXA 2O7TA 3VTIA 2QKOA 3Q0WA 5EZHA 5K7FA 4X1EA 4DVYP 3VW0A 3NPIA 2FX0A 4AUXA 3NNRA 3PM1A 2PFVA 4MK6A 2FBQA 1U9OA 1QVTA 3WHBA 3S5RA 2YVHA 3CJDA 1QPIA 4L62A 2RHAA 4M3FA 3LHQA 5FKMA 2FD5A 4D7NA 1RKWA 5FKKA 3VVXA 3FK7A 3BR6A 3F0CA 3BQZA 2ZCNA 3QPLA 2W53A 2UXOA 2DTZA 2RAEA 2OF7A 3FRQA 5EZGA 2XPVA 2WUIA 3KZ9A 3ZQHA 1ZKGA 4W97A 2HYTA 2B1EA 2D6YA 1JTXA 3BNIA 4D7MA 3NS4A 4MO7A 5J1YA 3EGQA 3BTJA 4U9LA 3BR0A 3FK6A 2R7XA 3BR2A 3MVPA 3AQSA 5D19A 4KWAA 3ZQLA 2TCTA 3O60A 1T33A 4D5FA 3HTIA 3HGYA 2JJ7A 2EH3A 3BJBA 4M3EA 5K7ZA 2HQ5A 5AQCA 3PPBA 3VP5A 2YVEA 3BHQA 3G1LA 2RASA 2Q24A 4W1UA 3PASA 4OD5A 3DU5A 4UDSA 3O8HA 4IRVA 1ZK8A 2IAIA 2ZB9A 2HKUA 2REKA 3KKCA 2WGBA 2Y31A 5GPCA 4XK4A 3B6AA 5F27A 3ON2A 4C2MA 2PZ9A 5J1UA 5F1JA 3BT9A 4G12A 4GCLA 3KKDA 3HE0A 3IUVA 3QKXA 1JT6A 3WHCA 2FQ4A 1ORKA 1Z77A 5K58A 3ZQFA 4AF5A 4V2GA 4U9NA 3VIBA 2XPUA 2XRLA 2HXIA 4V2FA 5K7HA 3LSJA 2A2FX 1SGMA 3LSRA 3QQAA 5FGLA 1RPWA 5HBUA 2UXHA 2OPTA 5FKLA 4ABZA 3LOCA 2IBDA 1JT0A 3VOXA 1UI6A 3TP0A 2XPWA 3AQTA 1JUSA 3ZQIA 2G7GA 3TP3A 2Y30A 2WV1A 1RKTA 4GFLA 3HGGA 3SDGA 4HKUA 2OI8A 3VUQA 4M3BA 3BTLA 5FHPA 2ZCMA 3NRGA 2ID3A 2R7QA 2NS7A 4B1RA 2R7RA 3P9TA 2XGDA 5IOYA 3VPRA 2GUHA 3CRJA 1UI5A 5CXIA 2GENA 5IP6A 5FMPA 2XGEA 2IU5A 2PBXA 4YZEA 4GCKA 3IH3A 2Y2ZA 4MXMA 3K8PC 2UXPA 3GEUA 2B3WA 1QVUA 4DW6A 2G3BA 3C2BA 3SFIA 3G56A 2UXUA 3DEWA 3Q0VA 3BR1A 4ME9A 4D5CA 3BTCA 3LJLA 4WIBA 3Q3SA 5C4YA 2VKVA 4JNNA 3KYLA 2IEKA 4GCTA 2ID6A 2R7TA 2G7SA 2XB5A 3CCYA 1JUPA 3G1OA 5DAJA 5F08A 3DU6A 1BJZA 2G7LA 3F1BA 5F0FA 3DCFA 4NN1A 4M3DA 2XGCA 3MNLA 3V78A 5F04A 5FKOA 2HXOA 3LWJA 2R7OA 4OD4A 3B6CA 5EYRA 2FJ1A 1VI0A 2GFNA 2NS8A 3JSJA 3ANGA 3T6NA 3HIMA 2R7VA 3FHNA 1Z0XA 5D1RA 3BQYA 5D18A 2F07A 3G7RA 2R7UA 3HTAA 4GFKA 2ZCXA 3C07A 3SWHA 3ON4A 3FIWA 2X9DA 5H9TA 2HYJA 5J1RA 5HSZA 3BTIA 4I76A 3GZIA 3HTJA 3O8GA 3IH2A 5IPAA 2QWTA 2QTQA 1JUMA 4B3AA 3KNWA 3CWRA 5J3LA 2QCOA 2XDNA 2FJI1 4AC6A 3CDLA 1U9NA 3B81A 1T56A 3VVYA 4NELA 3NXCA 4M3GA 4JYKA 3BCGA 3G1MA 2NP5A 3HTHA 2QIBA 4JL3A 5CQGA 3VW2A 3BR5A 4ACIA 3VOKA 2ZY9A 3IH4A 1A6IA 2UXIA 3NI7A
chains in the Genus database with same CATH topology
5HAWA 4ICHA 2G0EA 2OERA 4I6ZA 2NP3A 3QPSA 3BRUA 5GP9A 3RH2A 2GBYA 2VKEA 2TRTA 3DPJA 3ZQGA 5EFYA 2DG7A 3BR3A 3Q0UA 2ZOZA 2VPRA 4PXIA 4AC0A 3VVZA 3E7QA 2X6OA 5IOZA 2V57A 4JKZA 4CGRA 3QBMA 5F0CA 3V6GA 3EUPA 5CXGA 2DG8A 3COLA 2ZOYA 5F0HA 5GPAA 2NX4A 5CW8A 2I10A 5FKNA 3ANPA 3RD3A 2O7OA 1JTYA 3LSPA 2QOPA 2JK3A 3VW1A 2O7TA 2QKOA 3Q0WA 5EZHA 5K7FA 4X1EA 3VW0A 3NPIA 2FX0A 4AUXA 3NNRA 3PM1A 4MK6A 2FBQA 1U9OA 1QVTA 3WHBA 3S5RA 2YVHA 3CJDA 1QPIA 4L62A 2RHAA 4M3FA 3LHQA 5FKMA 2FD5A 4D7NA 1RKWA 5FKKA 3VVXA 3FK7A 3BR6A 3F0CA 3BQZA 2ZCNA 3QPLA 2W53A 2UXOA 2DTZA 2RAEA 2OF7A 3FRQA 5EZGA 2XPVA 2WUIA 3KZ9A 3ZQHA 1ZKGA 4W97A 2HYTA 2D6YA 1JTXA 3BNIA 4D7MA 4MO7A 5J1YA 3EGQA 3BTJA 3BR0A 3FK6A 3BR2A 3MVPA 3AQSA 5D19A 4KWAA 3ZQLA 2TCTA 3O60A 1T33A 4D5FA 3HTIA 3HGYA 2JJ7A 2EH3A 3BJBA 4M3EA 5K7ZA 2HQ5A 5AQCA 3PPBA 3VP5A 2YVEA 3BHQA 3G1LA 2RASA 2Q24A 4W1UA 3PASA 4UDSA 3O8HA 1ZK8A 2IAIA 2ZB9A 2HKUA 2REKA 3KKCA 2WGBA 2Y31A 5GPCA 4XK4A 3B6AA 5F27A 3ON2A 2PZ9A 5J1UA 5F1JA 3BT9A 4G12A 4GCLA 3KKDA 3HE0A 3IUVA 3QKXA 1JT6A 3WHCA 2FQ4A 1ORKA 1Z77A 5K58A 3ZQFA 4AF5A 4V2GA 3VIBA 2XPUA 2XRLA 2HXIA 4V2FA 5K7HA 3LSJA 1SGMA 3LSRA 3QQAA 5FGLA 1RPWA 5HBUA 2UXHA 2OPTA 5FKLA 4ABZA 3LOCA 2IBDA 1JT0A 3VOXA 1UI6A 3TP0A 2XPWA 3AQTA 1JUSA 3ZQIA 2G7GA 3TP3A 2Y30A 2WV1A 1RKTA 4GFLA 3HGGA 3SDGA 4HKUA 2OI8A 3VUQA 4M3BA 3BTLA 5FHPA 2ZCMA 3NRGA 2ID3A 2NS7A 4B1RA 3P9TA 2XGDA 5IOYA 3VPRA 2GUHA 3CRJA 1UI5A 5CXIA 2GENA 5IP6A 5FMPA 2XGEA 2IU5A 2PBXA 4YZEA 4GCKA 3IH3A 2Y2ZA 4MXMA 2UXPA 3GEUA 1QVUA 4DW6A 2G3BA 3C2BA 3SFIA 3G56A 2UXUA 3DEWA 3Q0VA 3BR1A 4ME9A 4D5CA 3BTCA 3LJLA 3Q3SA 5C4YA 2VKVA 4JNNA 2IEKA 4GCTA 2ID6A 2G7SA 2XB5A 3CCYA 1JUPA 3G1OA 5DAJA 5F08A 1BJZA 2G7LA 3F1BA 5F0FA 3DCFA 4NN1A 4M3DA 2XGCA 3MNLA 3V78A 5F04A 5FKOA 2HXOA 3LWJA 3B6CA 5EYRA 2FJ1A 1VI0A 2GFNA 2NS8A 3JSJA 3ANGA 3T6NA 3HIMA 1Z0XA 5D1RA 3BQYA 5D18A 2F07A 3G7RA 3HTAA 4GFKA 2ZCXA 3C07A 3ON4A 3FIWA 2X9DA 5H9TA 2HYJA 5J1RA 5HSZA 3BTIA 4I76A 3GZIA 3HTJA 3O8GA 3IH2A 5IPAA 2QWTA 2QTQA 1JUMA 4B3AA 3KNWA 3CWRA 5J3LA 2QCOA 2XDNA 4AC6A 3CDLA 1U9NA 3B81A 1T56A 3VVYA 4NELA 3NXCA 4M3GA 4JYKA 3BCGA 3G1MA 2NP5A 3HTHA 2QIBA 4JL3A 3VW2A 3VOKA 3BR5A 4ACIA 3IH4A 1A6IA 2UXIA 3NI7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HAW A;  4ICH A;  2G0E A;  2OER A;  4I6Z A;  2NP3 A;  3QPS A;  3BRU A;  5GP9 A;  3RH2 A;  2GBY A;  2VKE A;  2TRT A;  3DPJ A;  3ZQG A;  5EFY A;  2DG7 A;  3BR3 A;  3Q0U A;  2ZOZ A;  2VPR A;  4PXI A;  4AC0 A;  3VVZ A;  3E7Q A;  2X6O A;  5IOZ A;  2V57 A;  4JKZ A;  4CGR A;  3QBM A;  5F0C A;  3V6G A;  3EUP A;  5CXG A;  2DG8 A;  3COL A;  2ZOY A;  5F0H A;  5GPA A;  2NX4 A;  5CW8 A;  2I10 A;  5FKN A;  3ANP A;  3RD3 A;  2O7O A;  1JTY A;  3LSP A;  2QOP A;  2JK3 A;  3VW1 A;  2O7T A;  2QKO A;  3Q0W A;  5EZH A;  5K7F A;  4X1E A;  3VW0 A;  3NPI A;  2FX0 A;  4AUX A;  3NNR A;  3PM1 A;  4MK6 A;  2FBQ A;  1U9O A;  1QVT A;  3WHB A;  3S5R A;  2YVH A;  3CJD A;  1QPI A;  4L62 A;  2RHA A;  4M3F A;  3LHQ A;  5FKM A;  2FD5 A;  4D7N A;  1RKW A;  5FKK A;  3VVX A;  3FK7 A;  3BR6 A;  3F0C A;  3BQZ A;  2ZCN A;  3QPL A;  2W53 A;  2UXO A;  2DTZ A;  2RAE A;  2OF7 A;  3FRQ A;  5EZG A;  2XPV A;  2WUI A;  3KZ9 A;  3ZQH A;  1ZKG A;  4W97 A;  2HYT A;  2D6Y A;  1JTX A;  3BNI A;  4D7M A;  4MO7 A;  5J1Y A;  3EGQ A;  3BTJ A;  3BR0 A;  3FK6 A;  3BR2 A;  3MVP A;  3AQS A;  5D19 A;  4KWA A;  3ZQL A;  2TCT A;  3O60 A;  1T33 A;  4D5F A;  3HTI A;  3HGY A;  2JJ7 A;  2EH3 A;  3BJB A;  4M3E A;  5K7Z A;  2HQ5 A;  5AQC A;  3PPB A;  3VP5 A;  2YVE A;  3BHQ A;  3G1L A;  2RAS A;  2Q24 A;  4W1U A;  3PAS A;  4UDS A;  3O8H A;  1ZK8 A;  2IAI A;  2ZB9 A;  2HKU A;  2REK A;  3KKC A;  2WGB A;  2Y31 A;  5GPC A;  4XK4 A;  3B6A A;  5F27 A;  3ON2 A;  2PZ9 A;  5J1U A;  5F1J A;  3BT9 A;  4G12 A;  4GCL A;  3KKD A;  3HE0 A;  3IUV A;  3QKX A;  1JT6 A;  3WHC A;  2FQ4 A;  1ORK A;  1Z77 A;  5K58 A;  3ZQF A;  4AF5 A;  4V2G A;  3VIB A;  2XPU A;  2XRL A;  2HXI A;  4V2F A;  5K7H A;  3LSJ A;  1SGM A;  3LSR A;  3QQA A;  5FGL A;  1RPW A;  5HBU A;  2UXH A;  2OPT A;  5FKL A;  4ABZ A;  3LOC A;  2IBD A;  1JT0 A;  3VOX A;  1UI6 A;  3TP0 A;  2XPW A;  3AQT A;  1JUS A;  3ZQI A;  2G7G A;  3TP3 A;  2Y30 A;  2WV1 A;  1RKT A;  4GFL A;  3HGG A;  3SDG A;  4HKU A;  2OI8 A;  3VUQ A;  4M3B A;  3BTL A;  5FHP A;  2ZCM A;  3NRG A;  2ID3 A;  2NS7 A;  4B1R A;  3P9T A;  2XGD A;  5IOY A;  3VPR A;  2GUH A;  3CRJ A;  1UI5 A;  5CXI A;  2GEN A;  5IP6 A;  5FMP A;  2XGE A;  2IU5 A;  2PBX A;  4YZE A;  4GCK A;  3IH3 A;  2Y2Z A;  4MXM A;  2UXP A;  3GEU A;  1QVU A;  4DW6 A;  2G3B A;  3C2B A;  3SFI A;  3G56 A;  2UXU A;  3DEW A;  3Q0V A;  3BR1 A;  4ME9 A;  4D5C A;  3BTC A;  3LJL A;  3Q3S A;  5C4Y A;  2VKV A;  4JNN A;  2IEK A;  4GCT A;  2ID6 A;  2G7S A;  2XB5 A;  3CCY A;  1JUP A;  3G1O A;  5DAJ A;  5F08 A;  1BJZ A;  2G7L A;  3F1B A;  5F0F A;  3DCF A;  4NN1 A;  4M3D A;  2XGC A;  3MNL A;  3V78 A;  5F04 A;  5FKO A;  2HXO A;  3LWJ A;  3B6C A;  5EYR A;  2FJ1 A;  1VI0 A;  2GFN A;  2NS8 A;  3JSJ A;  3ANG A;  3T6N A;  3HIM A;  1Z0X A;  5D1R A;  3BQY A;  5D18 A;  2F07 A;  3G7R A;  3HTA A;  4GFK A;  2ZCX A;  3C07 A;  3ON4 A;  3FIW A;  2X9D A;  5H9T A;  2HYJ A;  5J1R A;  5HSZ A;  3BTI A;  4I76 A;  3GZI A;  3HTJ A;  3O8G A;  3IH2 A;  5IPA A;  2QWT A;  2QTQ A;  1JUM A;  4B3A A;  3KNW A;  3CWR A;  5J3L A;  2QCO A;  2XDN A;  4AC6 A;  3CDL A;  1U9N A;  3B81 A;  1T56 A;  3VVY A;  4NEL A;  3NXC A;  4M3G A;  4JYK A;  3BCG A;  3G1M A;  2NP5 A;  3HTH A;  2QIB A;  4JL3 A;  3VW2 A;  3VOK A;  3BR5 A;  4ACI A;  3IH4 A;  1A6I A;  2UXI A;  3NI7 A; 
#chains in the Genus database with same CATH topology
 2R7W A;  5HAW A;  4ICH A;  2G0E A;  2OER A;  4I6Z A;  2NP3 A;  3QPS A;  3BRU A;  5GP9 A;  3RH2 A;  2GBY A;  2VKE A;  2TRT A;  3DPJ A;  3ZQG A;  5EFY A;  2DG7 A;  3BR3 A;  3Q0U A;  2ZOZ A;  2VPR A;  4PXI A;  4AC0 A;  3VVZ A;  3E7Q A;  2X6O A;  5IOZ A;  2V57 A;  2R7S A;  4JKZ A;  4CGR A;  3QBM A;  5F0C A;  3V6G A;  3EUP A;  5CXG A;  2DG8 A;  3COL A;  2ZOY A;  5F0H A;  5GPA A;  2NX4 A;  5CW8 A;  2I10 A;  5FKN A;  3ANP A;  3RD3 A;  2O7O A;  1JTY A;  3LSP A;  2QOP A;  2JK3 A;  3VW1 A;  2YVX A;  2O7T A;  3VTI A;  2QKO A;  3Q0W A;  5EZH A;  5K7F A;  4X1E A;  4DVY P;  3VW0 A;  3NPI A;  2FX0 A;  4AUX A;  3NNR A;  3PM1 A;  2PFV A;  4MK6 A;  2FBQ A;  1U9O A;  1QVT A;  3WHB A;  3S5R A;  2YVH A;  3CJD A;  1QPI A;  4L62 A;  2RHA A;  4M3F A;  3LHQ A;  5FKM A;  2FD5 A;  4D7N A;  1RKW A;  5FKK A;  3VVX A;  3FK7 A;  3BR6 A;  3F0C A;  3BQZ A;  2ZCN A;  3QPL A;  2W53 A;  2UXO A;  2DTZ A;  2RAE A;  2OF7 A;  3FRQ A;  5EZG A;  2XPV A;  2WUI A;  3KZ9 A;  3ZQH A;  1ZKG A;  4W97 A;  2HYT A;  2B1E A;  2D6Y A;  1JTX A;  3BNI A;  4D7M A;  3NS4 A;  4MO7 A;  5J1Y A;  3EGQ A;  3BTJ A;  4U9L A;  3BR0 A;  3FK6 A;  2R7X A;  3BR2 A;  3MVP A;  3AQS A;  5D19 A;  4KWA A;  3ZQL A;  2TCT A;  3O60 A;  1T33 A;  4D5F A;  3HTI A;  3HGY A;  2JJ7 A;  2EH3 A;  3BJB A;  4M3E A;  5K7Z A;  2HQ5 A;  5AQC A;  3PPB A;  3VP5 A;  2YVE A;  3BHQ A;  3G1L A;  2RAS A;  2Q24 A;  4W1U A;  3PAS A;  4OD5 A;  3DU5 A;  4UDS A;  3O8H A;  4IRV A;  1ZK8 A;  2IAI A;  2ZB9 A;  2HKU A;  2REK A;  3KKC A;  2WGB A;  2Y31 A;  5GPC A;  4XK4 A;  3B6A A;  5F27 A;  3ON2 A;  4C2M A;  2PZ9 A;  5J1U A;  5F1J A;  3BT9 A;  4G12 A;  4GCL A;  3KKD A;  3HE0 A;  3IUV A;  3QKX A;  1JT6 A;  3WHC A;  2FQ4 A;  1ORK A;  1Z77 A;  5K58 A;  3ZQF A;  4AF5 A;  4V2G A;  4U9N A;  3VIB A;  2XPU A;  2XRL A;  2HXI A;  4V2F A;  5K7H A;  3LSJ A;  2A2F X;  1SGM A;  3LSR A;  3QQA A;  5FGL A;  1RPW A;  5HBU A;  2UXH A;  2OPT A;  5FKL A;  4ABZ A;  3LOC A;  2IBD A;  1JT0 A;  3VOX A;  1UI6 A;  3TP0 A;  2XPW A;  3AQT A;  1JUS A;  3ZQI A;  2G7G A;  3TP3 A;  2Y30 A;  2WV1 A;  1RKT A;  4GFL A;  3HGG A;  3SDG A;  4HKU A;  2OI8 A;  3VUQ A;  4M3B A;  3BTL A;  5FHP A;  2ZCM A;  3NRG A;  2ID3 A;  2R7Q A;  2NS7 A;  4B1R A;  2R7R A;  3P9T A;  2XGD A;  5IOY A;  3VPR A;  2GUH A;  3CRJ A;  1UI5 A;  5CXI A;  2GEN A;  5IP6 A;  5FMP A;  2XGE A;  2IU5 A;  2PBX A;  4YZE A;  4GCK A;  3IH3 A;  2Y2Z A;  4MXM A;  3K8P C;  2UXP A;  3GEU A;  2B3W A;  1QVU A;  4DW6 A;  2G3B A;  3C2B A;  3SFI A;  3G56 A;  2UXU A;  3DEW A;  3Q0V A;  3BR1 A;  4ME9 A;  4D5C A;  3BTC A;  3LJL A;  4WIB A;  3Q3S A;  5C4Y A;  2VKV A;  4JNN A;  3KYL A;  2IEK A;  4GCT A;  2ID6 A;  2R7T A;  2G7S A;  2XB5 A;  3CCY A;  1JUP A;  3G1O A;  5DAJ A;  5F08 A;  3DU6 A;  1BJZ A;  2G7L A;  3F1B A;  5F0F A;  3DCF A;  4NN1 A;  4M3D A;  2XGC A;  3MNL A;  3V78 A;  5F04 A;  5FKO A;  2HXO A;  3LWJ A;  2R7O A;  4OD4 A;  3B6C A;  5EYR A;  2FJ1 A;  1VI0 A;  2GFN A;  2NS8 A;  3JSJ A;  3ANG A;  3T6N A;  3HIM A;  2R7V A;  3FHN A;  1Z0X A;  5D1R A;  3BQY A;  5D18 A;  2F07 A;  3G7R A;  2R7U A;  3HTA A;  4GFK A;  2ZCX A;  3C07 A;  3SWH A;  3ON4 A;  3FIW A;  2X9D A;  5H9T A;  2HYJ A;  5J1R A;  5HSZ A;  3BTI A;  4I76 A;  3GZI A;  3HTJ A;  3O8G A;  3IH2 A;  5IPA A;  2QWT A;  2QTQ A;  1JUM A;  4B3A A;  3KNW A;  3CWR A;  5J3L A;  2QCO A;  2XDN A;  2FJI 1;  4AC6 A;  3CDL A;  1U9N A;  3B81 A;  1T56 A;  3VVY A;  4NEL A;  3NXC A;  4M3G A;  4JYK A;  3BCG A;  3G1M A;  2NP5 A;  3HTH A;  2QIB A;  4JL3 A;  5CQG A;  3VW2 A;  3BR5 A;  4ACI A;  3VOK A;  2ZY9 A;  3IH4 A;  1A6I A;  2UXI A;  3NI7 A; 
#chains in the Genus database with same CATH homology
 5HAW A;  4ICH A;  2G0E A;  2OER A;  4I6Z A;  2NP3 A;  3QPS A;  3BRU A;  5GP9 A;  3RH2 A;  2GBY A;  2VKE A;  2TRT A;  3DPJ A;  3ZQG A;  5EFY A;  2DG7 A;  3BR3 A;  3Q0U A;  2ZOZ A;  2VPR A;  4PXI A;  4AC0 A;  3VVZ A;  3E7Q A;  2X6O A;  5IOZ A;  2V57 A;  4JKZ A;  4CGR A;  3QBM A;  5F0C A;  3V6G A;  3EUP A;  5CXG A;  2DG8 A;  3COL A;  2ZOY A;  5F0H A;  5GPA A;  2NX4 A;  5CW8 A;  2I10 A;  5FKN A;  3ANP A;  3RD3 A;  2O7O A;  1JTY A;  3LSP A;  2QOP A;  2JK3 A;  3VW1 A;  2O7T A;  2QKO A;  3Q0W A;  5EZH A;  5K7F A;  4X1E A;  3VW0 A;  3NPI A;  2FX0 A;  4AUX A;  3NNR A;  3PM1 A;  4MK6 A;  2FBQ A;  1U9O A;  1QVT A;  3WHB A;  3S5R A;  2YVH A;  3CJD A;  1QPI A;  4L62 A;  2RHA A;  4M3F A;  3LHQ A;  5FKM A;  2FD5 A;  4D7N A;  1RKW A;  5FKK A;  3VVX A;  3FK7 A;  3BR6 A;  3F0C A;  3BQZ A;  2ZCN A;  3QPL A;  2W53 A;  2UXO A;  2DTZ A;  2RAE A;  2OF7 A;  3FRQ A;  5EZG A;  2XPV A;  2WUI A;  3KZ9 A;  3ZQH A;  1ZKG A;  4W97 A;  2HYT A;  2D6Y A;  1JTX A;  3BNI A;  4D7M A;  4MO7 A;  5J1Y A;  3EGQ A;  3BTJ A;  3BR0 A;  3FK6 A;  3BR2 A;  3MVP A;  3AQS A;  5D19 A;  4KWA A;  3ZQL A;  2TCT A;  3O60 A;  1T33 A;  4D5F A;  3HTI A;  3HGY A;  2JJ7 A;  2EH3 A;  3BJB A;  4M3E A;  5K7Z A;  2HQ5 A;  5AQC A;  3PPB A;  3VP5 A;  2YVE A;  3BHQ A;  3G1L A;  2RAS A;  2Q24 A;  4W1U A;  3PAS A;  4UDS A;  3O8H A;  1ZK8 A;  2IAI A;  2ZB9 A;  2HKU A;  2REK A;  3KKC A;  2WGB A;  2Y31 A;  5GPC A;  4XK4 A;  3B6A A;  5F27 A;  3ON2 A;  2PZ9 A;  5J1U A;  5F1J A;  3BT9 A;  4G12 A;  4GCL A;  3KKD A;  3HE0 A;  3IUV A;  3QKX A;  1JT6 A;  3WHC A;  2FQ4 A;  1ORK A;  1Z77 A;  5K58 A;  3ZQF A;  4AF5 A;  4V2G A;  3VIB A;  2XPU A;  2XRL A;  2HXI A;  4V2F A;  5K7H A;  3LSJ A;  1SGM A;  3LSR A;  3QQA A;  5FGL A;  1RPW A;  5HBU A;  2UXH A;  2OPT A;  5FKL A;  4ABZ A;  3LOC A;  2IBD A;  1JT0 A;  3VOX A;  1UI6 A;  3TP0 A;  2XPW A;  3AQT A;  1JUS A;  3ZQI A;  2G7G A;  3TP3 A;  2Y30 A;  2WV1 A;  1RKT A;  4GFL A;  3HGG A;  3SDG A;  4HKU A;  2OI8 A;  3VUQ A;  4M3B A;  3BTL A;  5FHP A;  2ZCM A;  3NRG A;  2ID3 A;  2NS7 A;  4B1R A;  3P9T A;  2XGD A;  5IOY A;  3VPR A;  2GUH A;  3CRJ A;  1UI5 A;  5CXI A;  2GEN A;  5IP6 A;  5FMP A;  2XGE A;  2IU5 A;  2PBX A;  4YZE A;  4GCK A;  3IH3 A;  2Y2Z A;  4MXM A;  2UXP A;  3GEU A;  1QVU A;  4DW6 A;  2G3B A;  3C2B A;  3SFI A;  3G56 A;  2UXU A;  3DEW A;  3Q0V A;  3BR1 A;  4ME9 A;  4D5C A;  3BTC A;  3LJL A;  3Q3S A;  5C4Y A;  2VKV A;  4JNN A;  2IEK A;  4GCT A;  2ID6 A;  2G7S A;  2XB5 A;  3CCY A;  1JUP A;  3G1O A;  5DAJ A;  5F08 A;  1BJZ A;  2G7L A;  3F1B A;  5F0F A;  3DCF A;  4NN1 A;  4M3D A;  2XGC A;  3MNL A;  3V78 A;  5F04 A;  5FKO A;  2HXO A;  3LWJ A;  3B6C A;  5EYR A;  2FJ1 A;  1VI0 A;  2GFN A;  2NS8 A;  3JSJ A;  3ANG A;  3T6N A;  3HIM A;  1Z0X A;  5D1R A;  3BQY A;  5D18 A;  2F07 A;  3G7R A;  3HTA A;  4GFK A;  2ZCX A;  3C07 A;  3ON4 A;  3FIW A;  2X9D A;  5H9T A;  2HYJ A;  5J1R A;  5HSZ A;  3BTI A;  4I76 A;  3GZI A;  3HTJ A;  3O8G A;  3IH2 A;  5IPA A;  2QWT A;  2QTQ A;  1JUM A;  4B3A A;  3KNW A;  3CWR A;  5J3L A;  2QCO A;  2XDN A;  4AC6 A;  3CDL A;  1U9N A;  3B81 A;  1T56 A;  3VVY A;  4NEL A;  3NXC A;  4M3G A;  4JYK A;  3BCG A;  3G1M A;  2NP5 A;  3HTH A;  2QIB A;  4JL3 A;  3VW2 A;  3VOK A;  3BR5 A;  4ACI A;  3IH4 A;  1A6I A;  2UXI A;  3NI7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...