4MK6A

Crystal structure of probable dihydroxyacetone kinase regulator dhsk_reg from listeria monocytogenes egd-e
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
188
structure length
188
Chain Sequence
b'SNAMAESLITKKAIAGGLMELCQHKRFEKISIADITNICGLNRQTFYYHFTDKYDLLTWTYENDFFHCLADGITLGNWDKHVLKMLESIKENADFYKNTVSADASILSFCFSKLTNSLFMDLFEKIDTNATVNEADRVFYAEFFSYGCSGVLIKWITRGFKEAPETIANQLFRLAKDTEFLANSMYRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable Dihydroxyacetone Kinase Regulator DHSK_reg
publication title Crystal Structure of Probable Dihydroxyacetone Kinase Regulator DHSK_reg from Listeria monocytogenes EGD-e
rcsb
source organism Listeria monocytogenes
molecule tags Transcription regulator
total genus 69
structure length 188
sequence length 188
ec nomenclature
pdb deposition date 2013-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF14278 TetR_C_8 Transcriptional regulator C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 4mk6A00
3NRGA 3IH2A 4M3GA 3HTHA 3BTCA 3CWRA 2VPRA 3CRJA 3PM1A 2JK3A 2FQ4A 4PXIA 2D6YA 3C2BA 3B6CA 3HE0A 5EFYA 4KWAA 2X9DA 3E7QA 2HQ5A 4DW6A 3JSJA 5HBUA 3GEUA 3HTIA 1ZK8A 3CCYA 2ZCMA 4D7MA 2F07A 1ZKGA 2QKOA 3VOXA 5AQCA 2REKA 3QPSA 5F0FA 2NP3A 3EUPA 5J3LA 2GFNA 3NXCA 4GFKA 3BQZA 2XGEA 3G1LA 4B3AA 3SFIA 3O8HA 3BTLA 5FKMA 3QBMA 1JT6A 1U9OA 3P9TA 3LSPA 3ON2A 3SDGA 5J1RA 3KKDA 1T56A 3AQTA 5FKOA 1JUPA 1SGMA 1ORKA 4V2FA 3ON4A 3NNRA 4D5FA 5D1RA 3LJLA 3VIBA 3IH4A 2ZCNA 1BJZA 4W1UA 3F1BA 2G7SA 5GP9A 5EZGA 4GCLA 5CXGA 2QCOA 5EZHA 3VUQA 4JYKA 2G3BA 5F0HA 2O7OA 4ME9A 2HXIA 3FRQA 3B81A 2QTQA 3HTAA 4GCKA 3B6AA 2HKUA 4D7NA 3ZQHA 3BT9A 1JTYA 2XGDA 3RH2A 3QPLA 3HGYA 2Y30A 4HKUA 3BR0A 2VKVA 1RPWA 3ZQIA 3RD3A 3BTJA 4ICHA 3ZQFA 5GPCA 5K7HA 1JT0A 3BHQA 3G1MA 4NN1A 2WGBA 2RAEA 3VOKA 4XK4A 2I10A 3Q0UA 4M3BA 4JNNA 5D18A 4ACIA 5IP6A 3QKXA 3V6GA 2OI8A 3GZIA 5HAWA 5IPAA 1QVUA 2PBXA 2FJ1A 4M3FA 5FKNA 3ZQGA 2HXOA 2IBDA 5IOYA 2ZOYA 3BJBA 3WHBA 4W97A 1Z0XA 2XGCA 3VVYA 3G7RA 3VVXA 5CW8A 3Q0VA 2UXIA 4AF5A 4B1RA 3VP5A 4X1EA 2NS7A 3KKCA 3BR6A 3BR2A 3PASA 2G7GA 3BR1A 5FGLA 2GBYA 2V57A 4AC0A 2RASA 4G12A 4JKZA 2WUIA 2Y2ZA 3BTIA 3HGGA 2NP5A 1A6IA 2DTZA 2FD5A 4V2GA 2XPWA 3ZQLA 2IAIA 2HYJA 3TP3A 3G56A 1JUMA 5C4YA 2UXPA 3IH3A 3DEWA 1U9NA 3VW0A 2Y31A 2IU5A 2XDNA 5FHPA 4M3EA 2OERA 2XRLA 2ZOZA 5FMPA 3CJDA 1T33A 5CXIA 2GENA 3NI7A 4L62A 3DPJA 2O7TA 2UXOA 5FKKA 3LWJA 3KZ9A 4YZEA 4MO7A 5F0CA 3IUVA 5D19A 3BQYA 1RKTA 2QWTA 2JJ7A 1VI0A 4CGRA 3FIWA 3VW1A 5F08A 3VW2A 3ANPA 5K58A 3S5RA 1JTXA 2ZCXA 2OF7A 2ZB9A 3O8GA 2IEKA 2NX4A 2OPTA 3O60A 3Q0WA 4NELA 3DCFA 3HTJA 2EH3A 3BCGA 3C07A 1QPIA 2UXUA 1QVTA 3F0CA 3LSJA 3T6NA 1UI6A 4AUXA 3COLA 3NPIA 2XPVA 2XPUA 4M3DA 3QQAA 2YVHA 3FK7A 3BR3A 5HSZA 4GFLA 2XB5A 3BRUA 3PPBA 4AC6A 2G7LA 5FKLA 5J1YA 1JUSA 2ID3A 5H9TA 1Z77A 3FK6A 2DG7A 5DAJA 2X6OA 2NS8A 3MNLA 2UXHA 2G0EA 3BNIA 4ABZA 4MXMA 3V78A 2TRTA 5EYRA 5F27A 2ID6A 3LOCA 3Q3SA 3EGQA 3CDLA 3VPRA 4UDSA 5K7ZA 4GCTA 2VKEA 3TP0A 3LHQA 2DG8A 2FBQA 2TCTA 3AQSA 3G1OA 3KNWA 2PZ9A 4I76A 2YVEA 1RKWA 3HIMA 5GPAA 5F04A 4I6ZA 1UI5A 2W53A 2RHAA 2Q24A 2QIBA 4MK6A 2QOPA 3MVPA 5J1UA 4D5CA 5K7FA 5F1JA 3BR5A 4JL3A 3VVZA 3LSRA 2GUHA 3ANGA 3WHCA 2HYTA 2WV1A 5IOZA 2FX0A
chains in the Genus database with same CATH superfamily
3NRGA 3IH2A 4M3GA 4U9NA 3HTHA 3BTCA 4OD5A 3CWRA 2VPRA 3CRJA 3PM1A 2JK3A 2FQ4A 4PXIA 2D6YA 3C2BA 2R7XA 3B6CA 3HE0A 5EFYA 4KWAA 2X9DA 3E7QA 3NS4A 2HQ5A 4DW6A 3JSJA 4IRVA 3GEUA 5HBUA 3HTIA 1ZK8A 3CCYA 2ZCMA 4D7MA 2F07A 1ZKGA 2QKOA 5AQCA 2REKA 3QPSA 2R7OA 5F0FA 2NP3A 3EUPA 5J3LA 3VOXA 2GFNA 2R7WA 3NXCA 4GFKA 3BQZA 2XGEA 3G1LA 4B3AA 3SFIA 3O8HA 3BTLA 5FKMA 3QBMA 1JT6A 1U9OA 3P9TA 3LSPA 3ON2A 3SDGA 5J1RA 3KKDA 1T56A 3AQTA 2ZY9A 5FKOA 1JUPA 2R7TA 1SGMA 1ORKA 4V2FA 3ON4A 3NNRA 4D5FA 5D1RA 3LJLA 3VIBA 3IH4A 2ZCNA 1BJZA 4W1UA 3F1BA 2G7SA 5GP9A 5EZGA 4GCLA 5CXGA 2QCOA 5EZHA 3VUQA 4JYKA 2G3BA 5F0HA 2O7OA 4ME9A 2HXIA 3FRQA 3B81A 2YVXA 2QTQA 3HTAA 4GCKA 3B6AA 2HKUA 4D7NA 3ZQHA 3BT9A 1JTYA 2XGDA 3RH2A 3QPLA 3HGYA 2Y30A 4HKUA 3BR0A 2VKVA 1RPWA 3ZQIA 3RD3A 3BTJA 4ICHA 3ZQFA 5GPCA 5K7HA 1JT0A 3BHQA 3G1MA 4NN1A 2WGBA 2RAEA 3VOKA 4XK4A 2I10A 3Q0UA 4M3BA 3SWHA 4JNNA 5D18A 4ACIA 5IP6A 3QKXA 3DU6A 3V6GA 2OI8A 3GZIA 2R7UA 5HAWA 5IPAA 1QVUA 2PBXA 2FJ1A 4M3FA 5FKNA 3ZQGA 2HXOA 2IBDA 5IOYA 2ZOYA 3BJBA 3WHBA 4W97A 1Z0XA 3VTIA 2XGCA 3VVYA 3G7RA 3VVXA 5CW8A 3Q0VA 2UXIA 4AF5A 4B1RA 3VP5A 4X1EA 2NS7A 3KKCA 3BR6A 3BR2A 3PASA 2G7GA 3BR1A 5FGLA 2GBYA 2V57A 4AC0A 2RASA 4G12A 4JKZA 2WUIA 2Y2ZA 3BTIA 3HGGA 2NP5A 1A6IA 4OD4A 2DTZA 2FD5A 4V2GA 2XPWA 3ZQLA 2IAIA 2HYJA 3TP3A 3G56A 1JUMA 5C4YA 2UXPA 2B3WA 3IH3A 3DEWA 1U9NA 3VW0A 2Y31A 2IU5A 2XDNA 5FHPA 4M3EA 2OERA 2XRLA 2ZOZA 5FMPA 3CJDA 1T33A 5CXIA 2GENA 3NI7A 4L62A 3FHNA 3DPJA 2O7TA 2UXOA 5FKKA 3LWJA 3KZ9A 4YZEA 4C2MA 4MO7A 5F0CA 3IUVA 5D19A 3BQYA 1RKTA 2QWTA 2JJ7A 1VI0A 4CGRA 3FIWA 3VW1A 5F08A 3VW2A 3ANPA 5K58A 3S5RA 1JTXA 2ZCXA 2OF7A 2R7RA 2FJI1 2ZB9A 3O8GA 2IEKA 2NX4A 2OPTA 3O60A 3Q0WA 4NELA 3DCFA 3HTJA 2EH3A 3BCGA 3C07A 1QPIA 2UXUA 2R7VA 1QVTA 3F0CA 3LSJA 3T6NA 1UI6A 3DU5A 4AUXA 2A2FX 3COLA 3NPIA 2XPVA 2XPUA 4M3DA 3QQAA 2YVHA 3FK7A 3BR3A 5HSZA 4GFLA 2XB5A 3BRUA 3PPBA 4AC6A 2G7LA 5FKLA 5J1YA 1JUSA 2ID3A 5H9TA 1Z77A 3FK6A 2DG7A 5DAJA 2X6OA 2NS8A 3MNLA 2UXHA 2G0EA 5CQGA 3BNIA 4ABZA 4MXMA 3V78A 2TRTA 5EYRA 5F27A 2B1EA 2ID6A 3LOCA 3Q3SA 4WIBA 3EGQA 3CDLA 3VPRA 4UDSA 5K7ZA 4GCTA 2VKEA 3TP0A 3LHQA 2DG8A 2FBQA 2TCTA 3AQSA 3G1OA 3KNWA 2PZ9A 4I76A 2YVEA 1RKWA 3K8PC 3HIMA 5GPAA 5F04A 4I6ZA 1UI5A 2W53A 2RHAA 2Q24A 2QIBA 2PFVA 4DVYP 4MK6A 2QOPA 3MVPA 5J1UA 4D5CA 2R7SA 5K7FA 5F1JA 2R7QA 3BR5A 4JL3A 3VVZA 3LSRA 2GUHA 3ANGA 3KYLA 3WHCA 2HYTA 2WV1A 5IOZA 4U9LA 2FX0A
chains in the Genus database with same CATH topology
3NRGA 3IH2A 4M3GA 3HTHA 3BTCA 3CWRA 2VPRA 3CRJA 3PM1A 2JK3A 2FQ4A 4PXIA 2D6YA 3C2BA 3B6CA 3HE0A 5EFYA 4KWAA 2X9DA 3E7QA 2HQ5A 4DW6A 3JSJA 5HBUA 3GEUA 3HTIA 1ZK8A 3CCYA 2ZCMA 4D7MA 2F07A 1ZKGA 2QKOA 3VOXA 5AQCA 2REKA 3QPSA 5F0FA 2NP3A 3EUPA 5J3LA 2GFNA 3NXCA 4GFKA 3BQZA 2XGEA 3G1LA 4B3AA 3SFIA 3O8HA 3BTLA 5FKMA 3QBMA 1JT6A 1U9OA 3P9TA 3LSPA 3ON2A 3SDGA 5J1RA 3KKDA 1T56A 3AQTA 5FKOA 1JUPA 1SGMA 1ORKA 4V2FA 3ON4A 3NNRA 4D5FA 5D1RA 3LJLA 3VIBA 3IH4A 2ZCNA 1BJZA 4W1UA 3F1BA 2G7SA 5GP9A 5EZGA 4GCLA 5CXGA 2QCOA 5EZHA 3VUQA 4JYKA 2G3BA 5F0HA 2O7OA 4ME9A 2HXIA 3FRQA 3B81A 2QTQA 3HTAA 4GCKA 3B6AA 2HKUA 4D7NA 3ZQHA 3BT9A 1JTYA 2XGDA 3RH2A 3QPLA 3HGYA 2Y30A 4HKUA 3BR0A 2VKVA 1RPWA 3ZQIA 3RD3A 3BTJA 4ICHA 3ZQFA 5GPCA 5K7HA 1JT0A 3BHQA 3G1MA 4NN1A 2WGBA 2RAEA 3VOKA 4XK4A 2I10A 3Q0UA 4M3BA 4JNNA 5D18A 4ACIA 5IP6A 3QKXA 3V6GA 2OI8A 3GZIA 5HAWA 5IPAA 1QVUA 2PBXA 2FJ1A 4M3FA 5FKNA 3ZQGA 2HXOA 2IBDA 5IOYA 2ZOYA 3BJBA 3WHBA 4W97A 1Z0XA 2XGCA 3VVYA 3G7RA 3VVXA 5CW8A 3Q0VA 2UXIA 4AF5A 4B1RA 3VP5A 4X1EA 2NS7A 3KKCA 3BR6A 3BR2A 3PASA 2G7GA 3BR1A 5FGLA 2GBYA 2V57A 4AC0A 2RASA 4G12A 4JKZA 2WUIA 2Y2ZA 3BTIA 3HGGA 2NP5A 1A6IA 2DTZA 2FD5A 4V2GA 2XPWA 3ZQLA 2IAIA 2HYJA 3TP3A 3G56A 1JUMA 5C4YA 2UXPA 3IH3A 3DEWA 1U9NA 3VW0A 2Y31A 2IU5A 2XDNA 5FHPA 4M3EA 2OERA 2XRLA 2ZOZA 5FMPA 3CJDA 1T33A 5CXIA 2GENA 3NI7A 4L62A 3DPJA 2O7TA 2UXOA 5FKKA 3LWJA 3KZ9A 4YZEA 4MO7A 5F0CA 3IUVA 5D19A 3BQYA 1RKTA 2QWTA 2JJ7A 1VI0A 4CGRA 3FIWA 3VW1A 5F08A 3VW2A 3ANPA 5K58A 3S5RA 1JTXA 2ZCXA 2OF7A 2ZB9A 3O8GA 2IEKA 2NX4A 2OPTA 3O60A 3Q0WA 4NELA 3DCFA 3HTJA 2EH3A 3BCGA 3C07A 1QPIA 2UXUA 1QVTA 3F0CA 3LSJA 3T6NA 1UI6A 4AUXA 3COLA 3NPIA 2XPVA 2XPUA 4M3DA 3QQAA 2YVHA 3FK7A 3BR3A 5HSZA 4GFLA 2XB5A 3BRUA 3PPBA 4AC6A 2G7LA 5FKLA 5J1YA 1JUSA 2ID3A 5H9TA 1Z77A 3FK6A 2DG7A 5DAJA 2X6OA 2NS8A 3MNLA 2UXHA 2G0EA 3BNIA 4ABZA 4MXMA 3V78A 2TRTA 5EYRA 5F27A 2ID6A 3LOCA 3Q3SA 3EGQA 3CDLA 3VPRA 4UDSA 5K7ZA 4GCTA 2VKEA 3TP0A 3LHQA 2DG8A 2FBQA 2TCTA 3AQSA 3G1OA 3KNWA 2PZ9A 4I76A 2YVEA 1RKWA 3HIMA 5GPAA 5F04A 4I6ZA 1UI5A 2W53A 2RHAA 2Q24A 2QIBA 4MK6A 2QOPA 3MVPA 5J1UA 4D5CA 5K7FA 5F1JA 3BR5A 4JL3A 3VVZA 3LSRA 2GUHA 3ANGA 3WHCA 2HYTA 2WV1A 5IOZA 2FX0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NRG A;  3IH2 A;  4M3G A;  3HTH A;  3BTC A;  3CWR A;  2VPR A;  3CRJ A;  3PM1 A;  2JK3 A;  2FQ4 A;  4PXI A;  2D6Y A;  3C2B A;  3B6C A;  3HE0 A;  5EFY A;  4KWA A;  2X9D A;  3E7Q A;  2HQ5 A;  4DW6 A;  3JSJ A;  5HBU A;  3GEU A;  3HTI A;  1ZK8 A;  3CCY A;  2ZCM A;  4D7M A;  2F07 A;  1ZKG A;  2QKO A;  3VOX A;  5AQC A;  2REK A;  3QPS A;  5F0F A;  2NP3 A;  3EUP A;  5J3L A;  2GFN A;  3NXC A;  4GFK A;  3BQZ A;  2XGE A;  3G1L A;  4B3A A;  3SFI A;  3O8H A;  3BTL A;  5FKM A;  3QBM A;  1JT6 A;  1U9O A;  3P9T A;  3LSP A;  3ON2 A;  3SDG A;  5J1R A;  3KKD A;  1T56 A;  3AQT A;  5FKO A;  1JUP A;  1SGM A;  1ORK A;  4V2F A;  3ON4 A;  3NNR A;  4D5F A;  5D1R A;  3LJL A;  3VIB A;  3IH4 A;  2ZCN A;  1BJZ A;  4W1U A;  3F1B A;  2G7S A;  5GP9 A;  5EZG A;  4GCL A;  5CXG A;  2QCO A;  5EZH A;  3VUQ A;  4JYK A;  2G3B A;  5F0H A;  2O7O A;  4ME9 A;  2HXI A;  3FRQ A;  3B81 A;  2QTQ A;  3HTA A;  4GCK A;  3B6A A;  2HKU A;  4D7N A;  3ZQH A;  3BT9 A;  1JTY A;  2XGD A;  3RH2 A;  3QPL A;  3HGY A;  2Y30 A;  4HKU A;  3BR0 A;  2VKV A;  1RPW A;  3ZQI A;  3RD3 A;  3BTJ A;  4ICH A;  3ZQF A;  5GPC A;  5K7H A;  1JT0 A;  3BHQ A;  3G1M A;  4NN1 A;  2WGB A;  2RAE A;  3VOK A;  4XK4 A;  2I10 A;  3Q0U A;  4M3B A;  4JNN A;  5D18 A;  4ACI A;  5IP6 A;  3QKX A;  3V6G A;  2OI8 A;  3GZI A;  5HAW A;  5IPA A;  1QVU A;  2PBX A;  2FJ1 A;  4M3F A;  5FKN A;  3ZQG A;  2HXO A;  2IBD A;  5IOY A;  2ZOY A;  3BJB A;  3WHB A;  4W97 A;  1Z0X A;  2XGC A;  3VVY A;  3G7R A;  3VVX A;  5CW8 A;  3Q0V A;  2UXI A;  4AF5 A;  4B1R A;  3VP5 A;  4X1E A;  2NS7 A;  3KKC A;  3BR6 A;  3BR2 A;  3PAS A;  2G7G A;  3BR1 A;  5FGL A;  2GBY A;  2V57 A;  4AC0 A;  2RAS A;  4G12 A;  4JKZ A;  2WUI A;  2Y2Z A;  3BTI A;  3HGG A;  2NP5 A;  1A6I A;  2DTZ A;  2FD5 A;  4V2G A;  2XPW A;  3ZQL A;  2IAI A;  2HYJ A;  3TP3 A;  3G56 A;  1JUM A;  5C4Y A;  2UXP A;  3IH3 A;  3DEW A;  1U9N A;  3VW0 A;  2Y31 A;  2IU5 A;  2XDN A;  5FHP A;  4M3E A;  2OER A;  2XRL A;  2ZOZ A;  5FMP A;  3CJD A;  1T33 A;  5CXI A;  2GEN A;  3NI7 A;  4L62 A;  3DPJ A;  2O7T A;  2UXO A;  5FKK A;  3LWJ A;  3KZ9 A;  4YZE A;  4MO7 A;  5F0C A;  3IUV A;  5D19 A;  3BQY A;  1RKT A;  2QWT A;  2JJ7 A;  1VI0 A;  4CGR A;  3FIW A;  3VW1 A;  5F08 A;  3VW2 A;  3ANP A;  5K58 A;  3S5R A;  1JTX A;  2ZCX A;  2OF7 A;  2ZB9 A;  3O8G A;  2IEK A;  2NX4 A;  2OPT A;  3O60 A;  3Q0W A;  4NEL A;  3DCF A;  3HTJ A;  2EH3 A;  3BCG A;  3C07 A;  1QPI A;  2UXU A;  1QVT A;  3F0C A;  3LSJ A;  3T6N A;  1UI6 A;  4AUX A;  3COL A;  3NPI A;  2XPV A;  2XPU A;  4M3D A;  3QQA A;  2YVH A;  3FK7 A;  3BR3 A;  5HSZ A;  4GFL A;  2XB5 A;  3BRU A;  3PPB A;  4AC6 A;  2G7L A;  5FKL A;  5J1Y A;  1JUS A;  2ID3 A;  5H9T A;  1Z77 A;  3FK6 A;  2DG7 A;  5DAJ A;  2X6O A;  2NS8 A;  3MNL A;  2UXH A;  2G0E A;  3BNI A;  4ABZ A;  4MXM A;  3V78 A;  2TRT A;  5EYR A;  5F27 A;  2ID6 A;  3LOC A;  3Q3S A;  3EGQ A;  3CDL A;  3VPR A;  4UDS A;  5K7Z A;  4GCT A;  2VKE A;  3TP0 A;  3LHQ A;  2DG8 A;  2FBQ A;  2TCT A;  3AQS A;  3G1O A;  3KNW A;  2PZ9 A;  4I76 A;  2YVE A;  1RKW A;  3HIM A;  5GPA A;  5F04 A;  4I6Z A;  1UI5 A;  2W53 A;  2RHA A;  2Q24 A;  2QIB A;  4MK6 A;  2QOP A;  3MVP A;  5J1U A;  4D5C A;  5K7F A;  5F1J A;  3BR5 A;  4JL3 A;  3VVZ A;  3LSR A;  2GUH A;  3ANG A;  3WHC A;  2HYT A;  2WV1 A;  5IOZ A;  2FX0 A; 
#chains in the Genus database with same CATH topology
 3NRG A;  3IH2 A;  4M3G A;  4U9N A;  3HTH A;  3BTC A;  4OD5 A;  3CWR A;  2VPR A;  3CRJ A;  3PM1 A;  2JK3 A;  2FQ4 A;  4PXI A;  2D6Y A;  3C2B A;  2R7X A;  3B6C A;  3HE0 A;  5EFY A;  4KWA A;  2X9D A;  3E7Q A;  3NS4 A;  2HQ5 A;  4DW6 A;  3JSJ A;  4IRV A;  3GEU A;  5HBU A;  3HTI A;  1ZK8 A;  3CCY A;  2ZCM A;  4D7M A;  2F07 A;  1ZKG A;  2QKO A;  5AQC A;  2REK A;  3QPS A;  2R7O A;  5F0F A;  2NP3 A;  3EUP A;  5J3L A;  3VOX A;  2GFN A;  2R7W A;  3NXC A;  4GFK A;  3BQZ A;  2XGE A;  3G1L A;  4B3A A;  3SFI A;  3O8H A;  3BTL A;  5FKM A;  3QBM A;  1JT6 A;  1U9O A;  3P9T A;  3LSP A;  3ON2 A;  3SDG A;  5J1R A;  3KKD A;  1T56 A;  3AQT A;  2ZY9 A;  5FKO A;  1JUP A;  2R7T A;  1SGM A;  1ORK A;  4V2F A;  3ON4 A;  3NNR A;  4D5F A;  5D1R A;  3LJL A;  3VIB A;  3IH4 A;  2ZCN A;  1BJZ A;  4W1U A;  3F1B A;  2G7S A;  5GP9 A;  5EZG A;  4GCL A;  5CXG A;  2QCO A;  5EZH A;  3VUQ A;  4JYK A;  2G3B A;  5F0H A;  2O7O A;  4ME9 A;  2HXI A;  3FRQ A;  3B81 A;  2YVX A;  2QTQ A;  3HTA A;  4GCK A;  3B6A A;  2HKU A;  4D7N A;  3ZQH A;  3BT9 A;  1JTY A;  2XGD A;  3RH2 A;  3QPL A;  3HGY A;  2Y30 A;  4HKU A;  3BR0 A;  2VKV A;  1RPW A;  3ZQI A;  3RD3 A;  3BTJ A;  4ICH A;  3ZQF A;  5GPC A;  5K7H A;  1JT0 A;  3BHQ A;  3G1M A;  4NN1 A;  2WGB A;  2RAE A;  3VOK A;  4XK4 A;  2I10 A;  3Q0U A;  4M3B A;  3SWH A;  4JNN A;  5D18 A;  4ACI A;  5IP6 A;  3QKX A;  3DU6 A;  3V6G A;  2OI8 A;  3GZI A;  2R7U A;  5HAW A;  5IPA A;  1QVU A;  2PBX A;  2FJ1 A;  4M3F A;  5FKN A;  3ZQG A;  2HXO A;  2IBD A;  5IOY A;  2ZOY A;  3BJB A;  3WHB A;  4W97 A;  1Z0X A;  3VTI A;  2XGC A;  3VVY A;  3G7R A;  3VVX A;  5CW8 A;  3Q0V A;  2UXI A;  4AF5 A;  4B1R A;  3VP5 A;  4X1E A;  2NS7 A;  3KKC A;  3BR6 A;  3BR2 A;  3PAS A;  2G7G A;  3BR1 A;  5FGL A;  2GBY A;  2V57 A;  4AC0 A;  2RAS A;  4G12 A;  4JKZ A;  2WUI A;  2Y2Z A;  3BTI A;  3HGG A;  2NP5 A;  1A6I A;  4OD4 A;  2DTZ A;  2FD5 A;  4V2G A;  2XPW A;  3ZQL A;  2IAI A;  2HYJ A;  3TP3 A;  3G56 A;  1JUM A;  5C4Y A;  2UXP A;  2B3W A;  3IH3 A;  3DEW A;  1U9N A;  3VW0 A;  2Y31 A;  2IU5 A;  2XDN A;  5FHP A;  4M3E A;  2OER A;  2XRL A;  2ZOZ A;  5FMP A;  3CJD A;  1T33 A;  5CXI A;  2GEN A;  3NI7 A;  4L62 A;  3FHN A;  3DPJ A;  2O7T A;  2UXO A;  5FKK A;  3LWJ A;  3KZ9 A;  4YZE A;  4C2M A;  4MO7 A;  5F0C A;  3IUV A;  5D19 A;  3BQY A;  1RKT A;  2QWT A;  2JJ7 A;  1VI0 A;  4CGR A;  3FIW A;  3VW1 A;  5F08 A;  3VW2 A;  3ANP A;  5K58 A;  3S5R A;  1JTX A;  2ZCX A;  2OF7 A;  2R7R A;  2FJI 1;  2ZB9 A;  3O8G A;  2IEK A;  2NX4 A;  2OPT A;  3O60 A;  3Q0W A;  4NEL A;  3DCF A;  3HTJ A;  2EH3 A;  3BCG A;  3C07 A;  1QPI A;  2UXU A;  2R7V A;  1QVT A;  3F0C A;  3LSJ A;  3T6N A;  1UI6 A;  3DU5 A;  4AUX A;  2A2F X;  3COL A;  3NPI A;  2XPV A;  2XPU A;  4M3D A;  3QQA A;  2YVH A;  3FK7 A;  3BR3 A;  5HSZ A;  4GFL A;  2XB5 A;  3BRU A;  3PPB A;  4AC6 A;  2G7L A;  5FKL A;  5J1Y A;  1JUS A;  2ID3 A;  5H9T A;  1Z77 A;  3FK6 A;  2DG7 A;  5DAJ A;  2X6O A;  2NS8 A;  3MNL A;  2UXH A;  2G0E A;  5CQG A;  3BNI A;  4ABZ A;  4MXM A;  3V78 A;  2TRT A;  5EYR A;  5F27 A;  2B1E A;  2ID6 A;  3LOC A;  3Q3S A;  4WIB A;  3EGQ A;  3CDL A;  3VPR A;  4UDS A;  5K7Z A;  4GCT A;  2VKE A;  3TP0 A;  3LHQ A;  2DG8 A;  2FBQ A;  2TCT A;  3AQS A;  3G1O A;  3KNW A;  2PZ9 A;  4I76 A;  2YVE A;  1RKW A;  3K8P C;  3HIM A;  5GPA A;  5F04 A;  4I6Z A;  1UI5 A;  2W53 A;  2RHA A;  2Q24 A;  2QIB A;  2PFV A;  4DVY P;  4MK6 A;  2QOP A;  3MVP A;  5J1U A;  4D5C A;  2R7S A;  5K7F A;  5F1J A;  2R7Q A;  3BR5 A;  4JL3 A;  3VVZ A;  3LSR A;  2GUH A;  3ANG A;  3KYL A;  3WHC A;  2HYT A;  2WV1 A;  5IOZ A;  4U9L A;  2FX0 A; 
#chains in the Genus database with same CATH homology
 3NRG A;  3IH2 A;  4M3G A;  3HTH A;  3BTC A;  3CWR A;  2VPR A;  3CRJ A;  3PM1 A;  2JK3 A;  2FQ4 A;  4PXI A;  2D6Y A;  3C2B A;  3B6C A;  3HE0 A;  5EFY A;  4KWA A;  2X9D A;  3E7Q A;  2HQ5 A;  4DW6 A;  3JSJ A;  5HBU A;  3GEU A;  3HTI A;  1ZK8 A;  3CCY A;  2ZCM A;  4D7M A;  2F07 A;  1ZKG A;  2QKO A;  3VOX A;  5AQC A;  2REK A;  3QPS A;  5F0F A;  2NP3 A;  3EUP A;  5J3L A;  2GFN A;  3NXC A;  4GFK A;  3BQZ A;  2XGE A;  3G1L A;  4B3A A;  3SFI A;  3O8H A;  3BTL A;  5FKM A;  3QBM A;  1JT6 A;  1U9O A;  3P9T A;  3LSP A;  3ON2 A;  3SDG A;  5J1R A;  3KKD A;  1T56 A;  3AQT A;  5FKO A;  1JUP A;  1SGM A;  1ORK A;  4V2F A;  3ON4 A;  3NNR A;  4D5F A;  5D1R A;  3LJL A;  3VIB A;  3IH4 A;  2ZCN A;  1BJZ A;  4W1U A;  3F1B A;  2G7S A;  5GP9 A;  5EZG A;  4GCL A;  5CXG A;  2QCO A;  5EZH A;  3VUQ A;  4JYK A;  2G3B A;  5F0H A;  2O7O A;  4ME9 A;  2HXI A;  3FRQ A;  3B81 A;  2QTQ A;  3HTA A;  4GCK A;  3B6A A;  2HKU A;  4D7N A;  3ZQH A;  3BT9 A;  1JTY A;  2XGD A;  3RH2 A;  3QPL A;  3HGY A;  2Y30 A;  4HKU A;  3BR0 A;  2VKV A;  1RPW A;  3ZQI A;  3RD3 A;  3BTJ A;  4ICH A;  3ZQF A;  5GPC A;  5K7H A;  1JT0 A;  3BHQ A;  3G1M A;  4NN1 A;  2WGB A;  2RAE A;  3VOK A;  4XK4 A;  2I10 A;  3Q0U A;  4M3B A;  4JNN A;  5D18 A;  4ACI A;  5IP6 A;  3QKX A;  3V6G A;  2OI8 A;  3GZI A;  5HAW A;  5IPA A;  1QVU A;  2PBX A;  2FJ1 A;  4M3F A;  5FKN A;  3ZQG A;  2HXO A;  2IBD A;  5IOY A;  2ZOY A;  3BJB A;  3WHB A;  4W97 A;  1Z0X A;  2XGC A;  3VVY A;  3G7R A;  3VVX A;  5CW8 A;  3Q0V A;  2UXI A;  4AF5 A;  4B1R A;  3VP5 A;  4X1E A;  2NS7 A;  3KKC A;  3BR6 A;  3BR2 A;  3PAS A;  2G7G A;  3BR1 A;  5FGL A;  2GBY A;  2V57 A;  4AC0 A;  2RAS A;  4G12 A;  4JKZ A;  2WUI A;  2Y2Z A;  3BTI A;  3HGG A;  2NP5 A;  1A6I A;  2DTZ A;  2FD5 A;  4V2G A;  2XPW A;  3ZQL A;  2IAI A;  2HYJ A;  3TP3 A;  3G56 A;  1JUM A;  5C4Y A;  2UXP A;  3IH3 A;  3DEW A;  1U9N A;  3VW0 A;  2Y31 A;  2IU5 A;  2XDN A;  5FHP A;  4M3E A;  2OER A;  2XRL A;  2ZOZ A;  5FMP A;  3CJD A;  1T33 A;  5CXI A;  2GEN A;  3NI7 A;  4L62 A;  3DPJ A;  2O7T A;  2UXO A;  5FKK A;  3LWJ A;  3KZ9 A;  4YZE A;  4MO7 A;  5F0C A;  3IUV A;  5D19 A;  3BQY A;  1RKT A;  2QWT A;  2JJ7 A;  1VI0 A;  4CGR A;  3FIW A;  3VW1 A;  5F08 A;  3VW2 A;  3ANP A;  5K58 A;  3S5R A;  1JTX A;  2ZCX A;  2OF7 A;  2ZB9 A;  3O8G A;  2IEK A;  2NX4 A;  2OPT A;  3O60 A;  3Q0W A;  4NEL A;  3DCF A;  3HTJ A;  2EH3 A;  3BCG A;  3C07 A;  1QPI A;  2UXU A;  1QVT A;  3F0C A;  3LSJ A;  3T6N A;  1UI6 A;  4AUX A;  3COL A;  3NPI A;  2XPV A;  2XPU A;  4M3D A;  3QQA A;  2YVH A;  3FK7 A;  3BR3 A;  5HSZ A;  4GFL A;  2XB5 A;  3BRU A;  3PPB A;  4AC6 A;  2G7L A;  5FKL A;  5J1Y A;  1JUS A;  2ID3 A;  5H9T A;  1Z77 A;  3FK6 A;  2DG7 A;  5DAJ A;  2X6O A;  2NS8 A;  3MNL A;  2UXH A;  2G0E A;  3BNI A;  4ABZ A;  4MXM A;  3V78 A;  2TRT A;  5EYR A;  5F27 A;  2ID6 A;  3LOC A;  3Q3S A;  3EGQ A;  3CDL A;  3VPR A;  4UDS A;  5K7Z A;  4GCT A;  2VKE A;  3TP0 A;  3LHQ A;  2DG8 A;  2FBQ A;  2TCT A;  3AQS A;  3G1O A;  3KNW A;  2PZ9 A;  4I76 A;  2YVE A;  1RKW A;  3HIM A;  5GPA A;  5F04 A;  4I6Z A;  1UI5 A;  2W53 A;  2RHA A;  2Q24 A;  2QIB A;  4MK6 A;  2QOP A;  3MVP A;  5J1U A;  4D5C A;  5K7F A;  5F1J A;  3BR5 A;  4JL3 A;  3VVZ A;  3LSR A;  2GUH A;  3ANG A;  3WHC A;  2HYT A;  2WV1 A;  5IOZ A;  2FX0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...