4MK6A

Crystal structure of probable dihydroxyacetone kinase regulator dhsk_reg from listeria monocytogenes egd-e
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
188
structure length
188
Chain Sequence
b'SNAMAESLITKKAIAGGLMELCQHKRFEKISIADITNICGLNRQTFYYHFTDKYDLLTWTYENDFFHCLADGITLGNWDKHVLKMLESIKENADFYKNTVSADASILSFCFSKLTNSLFMDLFEKIDTNATVNEADRVFYAEFFSYGCSGVLIKWITRGFKEAPETIANQLFRLAKDTEFLANSMYRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable Dihydroxyacetone Kinase Regulator DHSK_reg
publication title Crystal Structure of Probable Dihydroxyacetone Kinase Regulator DHSK_reg from Listeria monocytogenes EGD-e
rcsb
source organism Listeria monocytogenes
molecule tags Transcription regulator
total genus 69
structure length 188
sequence length 188
ec nomenclature
pdb deposition date 2013-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF14278 TetR_C_8 Transcriptional regulator C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 4mk6A00
1JTYA 4D7MA 3VPRA 4NN1A 1QPIA 5D18A 2GUHA 4M3DA 4KWAA 4JNNA 1RKTA 3BNIA 4I76A 4V2GA 3RD3A 2OF7A 2ZCMA 5FKOA 1T56A 2ID3A 3QPLA 3V78A 1BJZA 2VKEA 1RKWA 2G7SA 2NP5A 2XDNA 2WV1A 3HTHA 2GBYA 3WHBA 4ICHA 3CDLA 1ZKGA 3DCFA 3CRJA 3BR3A 2ZOYA 3FRQA 3Q0UA 2XGEA 3HTAA 4I6ZA 3G1MA 4YZEA 3IH4A 2HKUA 4B1RA 2FX0A 1JUPA 4GCKA 5F08A 3NNRA 4ABZA 3LSPA 3VOXA 3JSJA 3FK6A 2QKOA 5K58A 1QVTA 2W53A 1U9NA 3BTIA 2ZB9A 2FD5A 5F1JA 3KKDA 3LSJA 3VP5A 2UXUA 3BT9A 3HE0A 4AC6A 3Q0VA 2IBDA 1Z0XA 4M3FA 5HBUA 5K7FA 3BRUA 2XPWA 3IH2A 2GENA 5H9TA 2XGCA 2RASA 3MVPA 3ZQHA 3ZQIA 5J1RA 3Q3SA 2IAIA 3KNWA 3VW0A 3B81A 4XK4A 2QOPA 5EFYA 3AQTA 3GEUA 3BQZA 5F0FA 5FMPA 2XPUA 3QKXA 1JT0A 3MNLA 5J3LA 5CXIA 5GPAA 3G7RA 3C07A 5GPCA 3FIWA 2QWTA 2NS8A 5C4YA 3HTJA 5F27A 3BTCA 2XRLA 2JK3A 3LSRA 5FKMA 2WUIA 3ZQFA 3IUVA 3LWJA 5IOYA 4AF5A 2G7LA 3NXCA 3FK7A 3B6CA 5IPAA 4V2FA 3GZIA 2OI8A 3BHQA 3VVZA 3EGQA 3PPBA 4D5CA 3ANPA 2G3BA 2JJ7A 4M3BA 4L62A 2UXPA 2OPTA 5D1RA 3SFIA 3B6AA 1JUMA 3VUQA 5DAJA 4HKUA 1SGMA 3ZQLA 1RPWA 3O60A 2OERA 3HGGA 2O7OA 2X9DA 2ZCNA 4ME9A 1JT6A 2HXIA 2G7GA 3BTJA 5IP6A 2V57A 2ID6A 2UXOA 5EZHA 2IU5A 2F07A 2FJ1A 2DTZA 3KKCA 4PXIA 5FKLA 2O7TA 1ZK8A 5EZGA 3DPJA 2ZCXA 2TCTA 2DG7A 2G0EA 3RH2A 2HXOA 3VVYA 4DW6A 3BR0A 3Q0WA 4UDSA 3V6GA 3NI7A 5J1YA 1UI6A 3NPIA 5GP9A 2XGDA 3BR5A 2UXHA 3NRGA 4W1UA 5F0CA 3PASA 5IOZA 5EYRA 4AC0A 3G1OA 2NX4A 5CXGA 3O8GA 3CJDA 3PM1A 4M3EA 3G1LA 2REKA 2DG8A 3G56A 3DEWA 3F0CA 3BR6A 4JL3A 2I10A 3COLA 3WHCA 3F1BA 4X1EA 3CCYA 4GCTA 2D6YA 3AQSA 3LOCA 2QCOA 4NELA 1JTXA 2UXIA 3BR1A 3LJLA 5K7HA 5CW8A 4D7NA 3S5RA 3BQYA 4D5FA 3HIMA 2Q24A 3C2BA 3VOKA 5AQCA 2YVEA 3T6NA 5FKNA 3VIBA 5J1UA 3BTLA 3VVXA 3ON2A 2HYJA 2NS7A 3HGYA 3O8HA 4JKZA 3SDGA 3BJBA 4GFLA 2XB5A 2Y30A 3QBMA 3QQAA 1UI5A 3ZQGA 2VKVA 2X6OA 2ZOZA 4B3AA 2EH3A 2Y2ZA 2IEKA 3QPSA 5D19A 5HAWA 4JYKA 4GFKA 5FKKA 2FQ4A 3VW1A 4W97A 3HTIA 2TRTA 3TP0A 4MK6A 3ANGA 3BR2A 3EUPA 3KZ9A 4G12A 3CWRA 3TP3A 3P9TA 2GFNA 4CGRA 5HSZA 1Z77A 2FBQA 5FHPA 3VW2A 2QTQA 5K7ZA 2PBXA 1QVUA 5F0HA 5F04A 2RHAA 4AUXA 4ACIA 1JUSA 1T33A 2HYTA 2QIBA 3IH3A 3ON4A 4GCLA 2PZ9A 3BCGA 1A6IA 4MXMA 1VI0A 5FGLA 4M3GA 1U9OA 2RAEA 2XPVA 3LHQA 2NP3A 2YVHA 1ORKA 3E7QA 2WGBA 2Y31A 2HQ5A 4MO7A 2VPRA
chains in the Genus database with same CATH superfamily
1JTYA 4D7MA 3VPRA 4NN1A 1QPIA 5D18A 2GUHA 4M3DA 4KWAA 2B3WA 4JNNA 1RKTA 3BNIA 4I76A 4V2GA 3RD3A 2OF7A 2ZCMA 5FKOA 1T56A 2ID3A 2R7UA 3QPLA 3DU6A 3V78A 1BJZA 2VKEA 1RKWA 2G7SA 2NP5A 2XDNA 2WV1A 3HTHA 2GBYA 3WHBA 4ICHA 2R7WA 3CDLA 1ZKGA 3DCFA 3CRJA 3BR3A 2ZOYA 3FRQA 3Q0UA 2XGEA 3HTAA 4I6ZA 3G1MA 4YZEA 3IH4A 2HKUA 4B1RA 2FX0A 1JUPA 4GCKA 5F08A 3NNRA 4ABZA 3LSPA 3VOXA 3JSJA 3FK6A 2QKOA 5K58A 1QVTA 2W53A 1U9NA 3BTIA 2ZB9A 4U9NA 2FD5A 5F1JA 3KKDA 3LSJA 3VP5A 2UXUA 3BT9A 3HE0A 4AC6A 3Q0VA 2IBDA 1Z0XA 4M3FA 5HBUA 5K7FA 3BRUA 2XPWA 3IH2A 2GENA 5H9TA 2XGCA 2RASA 3MVPA 3ZQHA 3ZQIA 5J1RA 4WIBA 3Q3SA 2IAIA 3KNWA 3VW0A 3B81A 4XK4A 2QOPA 5EFYA 3AQTA 4OD4A 3GEUA 3BQZA 5F0FA 5FMPA 2XPUA 3QKXA 1JT0A 3MNLA 5J3LA 5CXIA 5GPAA 3G7RA 3C07A 3DU5A 2R7TA 5GPCA 3FIWA 2QWTA 2R7VA 2NS8A 5C4YA 3HTJA 5F27A 3BTCA 2XRLA 2JK3A 3LSRA 5FKMA 2WUIA 3ZQFA 3IUVA 3LWJA 5IOYA 4AF5A 2G7LA 3NXCA 3FK7A 3B6CA 5IPAA 4V2FA 3GZIA 2OI8A 3BHQA 3VVZA 3EGQA 3PPBA 4D5CA 3ANPA 2G3BA 2JJ7A 4M3BA 4L62A 2UXPA 2FJI1 2OPTA 5D1RA 3SFIA 4DVYP 3B6AA 1JUMA 3VUQA 5DAJA 4HKUA 1SGMA 3ZQLA 1RPWA 3O60A 2OERA 2A2FX 3HGGA 2O7OA 2X9DA 2ZCNA 4C2MA 3NS4A 4ME9A 1JT6A 2HXIA 2G7GA 3BTJA 5IP6A 2V57A 2ID6A 2UXOA 5EZHA 2IU5A 2F07A 2FJ1A 2DTZA 3KKCA 4PXIA 5FKLA 2O7TA 1ZK8A 5EZGA 3DPJA 2ZCXA 2TCTA 2DG7A 2ZY9A 2G0EA 3RH2A 2HXOA 3VTIA 3VVYA 4DW6A 3BR0A 3Q0WA 4UDSA 3V6GA 3NI7A 5J1YA 1UI6A 3NPIA 5GP9A 2XGDA 3BR5A 2UXHA 3NRGA 4W1UA 5F0CA 3PASA 5IOZA 5EYRA 4AC0A 3G1OA 2NX4A 2R7XA 5CXGA 3O8GA 3CJDA 3PM1A 4M3EA 3KYLA 2YVXA 3G1LA 2REKA 2DG8A 3G56A 3DEWA 3F0CA 3BR6A 4JL3A 2I10A 3COLA 3WHCA 3F1BA 4X1EA 3CCYA 4GCTA 2D6YA 3AQSA 3LOCA 2QCOA 4NELA 3K8PC 1JTXA 2UXIA 3BR1A 3LJLA 5K7HA 5CW8A 4D7NA 3S5RA 2PFVA 3BQYA 4D5FA 3HIMA 2Q24A 3C2BA 4U9LA 3VOKA 5AQCA 2YVEA 3T6NA 5FKNA 3VIBA 5J1UA 3BTLA 4IRVA 3VVXA 3ON2A 2HYJA 2NS7A 3HGYA 3O8HA 4JKZA 3SDGA 3BJBA 4GFLA 2XB5A 2Y30A 3QBMA 3QQAA 1UI5A 3ZQGA 2VKVA 2X6OA 2ZOZA 4B3AA 2EH3A 2Y2ZA 3FHNA 2IEKA 2B1EA 3QPSA 5D19A 5HAWA 4JYKA 4GFKA 5FKKA 2FQ4A 3VW1A 4W97A 3HTIA 2TRTA 3TP0A 4MK6A 3ANGA 3BR2A 3EUPA 3KZ9A 4G12A 3SWHA 3CWRA 3TP3A 3P9TA 2GFNA 4CGRA 5HSZA 1Z77A 2FBQA 5FHPA 3VW2A 2QTQA 5K7ZA 2PBXA 1QVUA 5F0HA 5F04A 2RHAA 4AUXA 4ACIA 1JUSA 1T33A 2HYTA 2QIBA 3IH3A 2R7RA 4OD5A 2R7OA 2R7SA 3ON4A 4GCLA 2PZ9A 3BCGA 1A6IA 4MXMA 1VI0A 2R7QA 5FGLA 4M3GA 1U9OA 2RAEA 2XPVA 5CQGA 3LHQA 2NP3A 2YVHA 1ORKA 3E7QA 2WGBA 2Y31A 2HQ5A 4MO7A 2VPRA
chains in the Genus database with same CATH topology
1JTYA 4D7MA 3VPRA 4NN1A 1QPIA 5D18A 2GUHA 4M3DA 4KWAA 4JNNA 1RKTA 3BNIA 4I76A 4V2GA 3RD3A 2OF7A 2ZCMA 5FKOA 1T56A 2ID3A 3QPLA 3V78A 1BJZA 2VKEA 1RKWA 2G7SA 2NP5A 2XDNA 2WV1A 3HTHA 2GBYA 3WHBA 4ICHA 3CDLA 1ZKGA 3DCFA 3CRJA 3BR3A 2ZOYA 3FRQA 3Q0UA 2XGEA 3HTAA 4I6ZA 3G1MA 4YZEA 3IH4A 2HKUA 4B1RA 2FX0A 1JUPA 4GCKA 5F08A 3NNRA 4ABZA 3LSPA 3VOXA 3JSJA 3FK6A 2QKOA 5K58A 1QVTA 2W53A 1U9NA 3BTIA 2ZB9A 2FD5A 5F1JA 3KKDA 3LSJA 3VP5A 2UXUA 3BT9A 3HE0A 4AC6A 3Q0VA 2IBDA 1Z0XA 4M3FA 5HBUA 5K7FA 3BRUA 2XPWA 3IH2A 2GENA 5H9TA 2XGCA 2RASA 3MVPA 3ZQHA 3ZQIA 5J1RA 3Q3SA 2IAIA 3KNWA 3VW0A 3B81A 4XK4A 2QOPA 5EFYA 3AQTA 3GEUA 3BQZA 5F0FA 5FMPA 2XPUA 3QKXA 1JT0A 3MNLA 5J3LA 5CXIA 5GPAA 3G7RA 3C07A 5GPCA 3FIWA 2QWTA 2NS8A 5C4YA 3HTJA 5F27A 3BTCA 2XRLA 2JK3A 3LSRA 5FKMA 2WUIA 3ZQFA 3IUVA 3LWJA 5IOYA 4AF5A 2G7LA 3NXCA 3FK7A 3B6CA 5IPAA 4V2FA 3GZIA 2OI8A 3BHQA 3VVZA 3EGQA 3PPBA 4D5CA 3ANPA 2G3BA 2JJ7A 4M3BA 4L62A 2UXPA 2OPTA 5D1RA 3SFIA 3B6AA 1JUMA 3VUQA 5DAJA 4HKUA 1SGMA 3ZQLA 1RPWA 3O60A 2OERA 3HGGA 2O7OA 2X9DA 2ZCNA 4ME9A 1JT6A 2HXIA 2G7GA 3BTJA 5IP6A 2V57A 2ID6A 2UXOA 5EZHA 2IU5A 2F07A 2FJ1A 2DTZA 3KKCA 4PXIA 5FKLA 2O7TA 1ZK8A 5EZGA 3DPJA 2ZCXA 2TCTA 2DG7A 2G0EA 3RH2A 2HXOA 3VVYA 4DW6A 3BR0A 3Q0WA 4UDSA 3V6GA 3NI7A 5J1YA 1UI6A 3NPIA 5GP9A 2XGDA 3BR5A 2UXHA 3NRGA 4W1UA 5F0CA 3PASA 5IOZA 5EYRA 4AC0A 3G1OA 2NX4A 5CXGA 3O8GA 3CJDA 3PM1A 4M3EA 3G1LA 2REKA 2DG8A 3G56A 3DEWA 3F0CA 3BR6A 4JL3A 2I10A 3COLA 3WHCA 3F1BA 4X1EA 3CCYA 4GCTA 2D6YA 3AQSA 3LOCA 2QCOA 4NELA 1JTXA 2UXIA 3BR1A 3LJLA 5K7HA 5CW8A 4D7NA 3S5RA 3BQYA 4D5FA 3HIMA 2Q24A 3C2BA 3VOKA 5AQCA 2YVEA 3T6NA 5FKNA 3VIBA 5J1UA 3BTLA 3VVXA 3ON2A 2HYJA 2NS7A 3HGYA 3O8HA 4JKZA 3SDGA 3BJBA 4GFLA 2XB5A 2Y30A 3QBMA 3QQAA 1UI5A 3ZQGA 2VKVA 2X6OA 2ZOZA 4B3AA 2EH3A 2Y2ZA 2IEKA 3QPSA 5D19A 5HAWA 4JYKA 4GFKA 5FKKA 2FQ4A 3VW1A 4W97A 3HTIA 2TRTA 3TP0A 4MK6A 3ANGA 3BR2A 3EUPA 3KZ9A 4G12A 3CWRA 3TP3A 3P9TA 2GFNA 4CGRA 5HSZA 1Z77A 2FBQA 5FHPA 3VW2A 2QTQA 5K7ZA 2PBXA 1QVUA 5F0HA 5F04A 2RHAA 4AUXA 4ACIA 1JUSA 1T33A 2HYTA 2QIBA 3IH3A 3ON4A 4GCLA 2PZ9A 3BCGA 1A6IA 4MXMA 1VI0A 5FGLA 4M3GA 1U9OA 2RAEA 2XPVA 3LHQA 2NP3A 2YVHA 1ORKA 3E7QA 2WGBA 2Y31A 2HQ5A 4MO7A 2VPRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JTY A;  4D7M A;  3VPR A;  4NN1 A;  1QPI A;  5D18 A;  2GUH A;  4M3D A;  4KWA A;  4JNN A;  1RKT A;  3BNI A;  4I76 A;  4V2G A;  3RD3 A;  2OF7 A;  2ZCM A;  5FKO A;  1T56 A;  2ID3 A;  3QPL A;  3V78 A;  1BJZ A;  2VKE A;  1RKW A;  2G7S A;  2NP5 A;  2XDN A;  2WV1 A;  3HTH A;  2GBY A;  3WHB A;  4ICH A;  3CDL A;  1ZKG A;  3DCF A;  3CRJ A;  3BR3 A;  2ZOY A;  3FRQ A;  3Q0U A;  2XGE A;  3HTA A;  4I6Z A;  3G1M A;  4YZE A;  3IH4 A;  2HKU A;  4B1R A;  2FX0 A;  1JUP A;  4GCK A;  5F08 A;  3NNR A;  4ABZ A;  3LSP A;  3VOX A;  3JSJ A;  3FK6 A;  2QKO A;  5K58 A;  1QVT A;  2W53 A;  1U9N A;  3BTI A;  2ZB9 A;  2FD5 A;  5F1J A;  3KKD A;  3LSJ A;  3VP5 A;  2UXU A;  3BT9 A;  3HE0 A;  4AC6 A;  3Q0V A;  2IBD A;  1Z0X A;  4M3F A;  5HBU A;  5K7F A;  3BRU A;  2XPW A;  3IH2 A;  2GEN A;  5H9T A;  2XGC A;  2RAS A;  3MVP A;  3ZQH A;  3ZQI A;  5J1R A;  3Q3S A;  2IAI A;  3KNW A;  3VW0 A;  3B81 A;  4XK4 A;  2QOP A;  5EFY A;  3AQT A;  3GEU A;  3BQZ A;  5F0F A;  5FMP A;  2XPU A;  3QKX A;  1JT0 A;  3MNL A;  5J3L A;  5CXI A;  5GPA A;  3G7R A;  3C07 A;  5GPC A;  3FIW A;  2QWT A;  2NS8 A;  5C4Y A;  3HTJ A;  5F27 A;  3BTC A;  2XRL A;  2JK3 A;  3LSR A;  5FKM A;  2WUI A;  3ZQF A;  3IUV A;  3LWJ A;  5IOY A;  4AF5 A;  2G7L A;  3NXC A;  3FK7 A;  3B6C A;  5IPA A;  4V2F A;  3GZI A;  2OI8 A;  3BHQ A;  3VVZ A;  3EGQ A;  3PPB A;  4D5C A;  3ANP A;  2G3B A;  2JJ7 A;  4M3B A;  4L62 A;  2UXP A;  2OPT A;  5D1R A;  3SFI A;  3B6A A;  1JUM A;  3VUQ A;  5DAJ A;  4HKU A;  1SGM A;  3ZQL A;  1RPW A;  3O60 A;  2OER A;  3HGG A;  2O7O A;  2X9D A;  2ZCN A;  4ME9 A;  1JT6 A;  2HXI A;  2G7G A;  3BTJ A;  5IP6 A;  2V57 A;  2ID6 A;  2UXO A;  5EZH A;  2IU5 A;  2F07 A;  2FJ1 A;  2DTZ A;  3KKC A;  4PXI A;  5FKL A;  2O7T A;  1ZK8 A;  5EZG A;  3DPJ A;  2ZCX A;  2TCT A;  2DG7 A;  2G0E A;  3RH2 A;  2HXO A;  3VVY A;  4DW6 A;  3BR0 A;  3Q0W A;  4UDS A;  3V6G A;  3NI7 A;  5J1Y A;  1UI6 A;  3NPI A;  5GP9 A;  2XGD A;  3BR5 A;  2UXH A;  3NRG A;  4W1U A;  5F0C A;  3PAS A;  5IOZ A;  5EYR A;  4AC0 A;  3G1O A;  2NX4 A;  5CXG A;  3O8G A;  3CJD A;  3PM1 A;  4M3E A;  3G1L A;  2REK A;  2DG8 A;  3G56 A;  3DEW A;  3F0C A;  3BR6 A;  4JL3 A;  2I10 A;  3COL A;  3WHC A;  3F1B A;  4X1E A;  3CCY A;  4GCT A;  2D6Y A;  3AQS A;  3LOC A;  2QCO A;  4NEL A;  1JTX A;  2UXI A;  3BR1 A;  3LJL A;  5K7H A;  5CW8 A;  4D7N A;  3S5R A;  3BQY A;  4D5F A;  3HIM A;  2Q24 A;  3C2B A;  3VOK A;  5AQC A;  2YVE A;  3T6N A;  5FKN A;  3VIB A;  5J1U A;  3BTL A;  3VVX A;  3ON2 A;  2HYJ A;  2NS7 A;  3HGY A;  3O8H A;  4JKZ A;  3SDG A;  3BJB A;  4GFL A;  2XB5 A;  2Y30 A;  3QBM A;  3QQA A;  1UI5 A;  3ZQG A;  2VKV A;  2X6O A;  2ZOZ A;  4B3A A;  2EH3 A;  2Y2Z A;  2IEK A;  3QPS A;  5D19 A;  5HAW A;  4JYK A;  4GFK A;  5FKK A;  2FQ4 A;  3VW1 A;  4W97 A;  3HTI A;  2TRT A;  3TP0 A;  4MK6 A;  3ANG A;  3BR2 A;  3EUP A;  3KZ9 A;  4G12 A;  3CWR A;  3TP3 A;  3P9T A;  2GFN A;  4CGR A;  5HSZ A;  1Z77 A;  2FBQ A;  5FHP A;  3VW2 A;  2QTQ A;  5K7Z A;  2PBX A;  1QVU A;  5F0H A;  5F04 A;  2RHA A;  4AUX A;  4ACI A;  1JUS A;  1T33 A;  2HYT A;  2QIB A;  3IH3 A;  3ON4 A;  4GCL A;  2PZ9 A;  3BCG A;  1A6I A;  4MXM A;  1VI0 A;  5FGL A;  4M3G A;  1U9O A;  2RAE A;  2XPV A;  3LHQ A;  2NP3 A;  2YVH A;  1ORK A;  3E7Q A;  2WGB A;  2Y31 A;  2HQ5 A;  4MO7 A;  2VPR A; 
#chains in the Genus database with same CATH topology
 1JTY A;  4D7M A;  3VPR A;  4NN1 A;  1QPI A;  5D18 A;  2GUH A;  4M3D A;  4KWA A;  2B3W A;  4JNN A;  1RKT A;  3BNI A;  4I76 A;  4V2G A;  3RD3 A;  2OF7 A;  2ZCM A;  5FKO A;  1T56 A;  2ID3 A;  2R7U A;  3QPL A;  3DU6 A;  3V78 A;  1BJZ A;  2VKE A;  1RKW A;  2G7S A;  2NP5 A;  2XDN A;  2WV1 A;  3HTH A;  2GBY A;  3WHB A;  4ICH A;  2R7W A;  3CDL A;  1ZKG A;  3DCF A;  3CRJ A;  3BR3 A;  2ZOY A;  3FRQ A;  3Q0U A;  2XGE A;  3HTA A;  4I6Z A;  3G1M A;  4YZE A;  3IH4 A;  2HKU A;  4B1R A;  2FX0 A;  1JUP A;  4GCK A;  5F08 A;  3NNR A;  4ABZ A;  3LSP A;  3VOX A;  3JSJ A;  3FK6 A;  2QKO A;  5K58 A;  1QVT A;  2W53 A;  1U9N A;  3BTI A;  2ZB9 A;  4U9N A;  2FD5 A;  5F1J A;  3KKD A;  3LSJ A;  3VP5 A;  2UXU A;  3BT9 A;  3HE0 A;  4AC6 A;  3Q0V A;  2IBD A;  1Z0X A;  4M3F A;  5HBU A;  5K7F A;  3BRU A;  2XPW A;  3IH2 A;  2GEN A;  5H9T A;  2XGC A;  2RAS A;  3MVP A;  3ZQH A;  3ZQI A;  5J1R A;  4WIB A;  3Q3S A;  2IAI A;  3KNW A;  3VW0 A;  3B81 A;  4XK4 A;  2QOP A;  5EFY A;  3AQT A;  4OD4 A;  3GEU A;  3BQZ A;  5F0F A;  5FMP A;  2XPU A;  3QKX A;  1JT0 A;  3MNL A;  5J3L A;  5CXI A;  5GPA A;  3G7R A;  3C07 A;  3DU5 A;  2R7T A;  5GPC A;  3FIW A;  2QWT A;  2R7V A;  2NS8 A;  5C4Y A;  3HTJ A;  5F27 A;  3BTC A;  2XRL A;  2JK3 A;  3LSR A;  5FKM A;  2WUI A;  3ZQF A;  3IUV A;  3LWJ A;  5IOY A;  4AF5 A;  2G7L A;  3NXC A;  3FK7 A;  3B6C A;  5IPA A;  4V2F A;  3GZI A;  2OI8 A;  3BHQ A;  3VVZ A;  3EGQ A;  3PPB A;  4D5C A;  3ANP A;  2G3B A;  2JJ7 A;  4M3B A;  4L62 A;  2UXP A;  2FJI 1;  2OPT A;  5D1R A;  3SFI A;  4DVY P;  3B6A A;  1JUM A;  3VUQ A;  5DAJ A;  4HKU A;  1SGM A;  3ZQL A;  1RPW A;  3O60 A;  2OER A;  2A2F X;  3HGG A;  2O7O A;  2X9D A;  2ZCN A;  4C2M A;  3NS4 A;  4ME9 A;  1JT6 A;  2HXI A;  2G7G A;  3BTJ A;  5IP6 A;  2V57 A;  2ID6 A;  2UXO A;  5EZH A;  2IU5 A;  2F07 A;  2FJ1 A;  2DTZ A;  3KKC A;  4PXI A;  5FKL A;  2O7T A;  1ZK8 A;  5EZG A;  3DPJ A;  2ZCX A;  2TCT A;  2DG7 A;  2ZY9 A;  2G0E A;  3RH2 A;  2HXO A;  3VTI A;  3VVY A;  4DW6 A;  3BR0 A;  3Q0W A;  4UDS A;  3V6G A;  3NI7 A;  5J1Y A;  1UI6 A;  3NPI A;  5GP9 A;  2XGD A;  3BR5 A;  2UXH A;  3NRG A;  4W1U A;  5F0C A;  3PAS A;  5IOZ A;  5EYR A;  4AC0 A;  3G1O A;  2NX4 A;  2R7X A;  5CXG A;  3O8G A;  3CJD A;  3PM1 A;  4M3E A;  3KYL A;  2YVX A;  3G1L A;  2REK A;  2DG8 A;  3G56 A;  3DEW A;  3F0C A;  3BR6 A;  4JL3 A;  2I10 A;  3COL A;  3WHC A;  3F1B A;  4X1E A;  3CCY A;  4GCT A;  2D6Y A;  3AQS A;  3LOC A;  2QCO A;  4NEL A;  3K8P C;  1JTX A;  2UXI A;  3BR1 A;  3LJL A;  5K7H A;  5CW8 A;  4D7N A;  3S5R A;  2PFV A;  3BQY A;  4D5F A;  3HIM A;  2Q24 A;  3C2B A;  4U9L A;  3VOK A;  5AQC A;  2YVE A;  3T6N A;  5FKN A;  3VIB A;  5J1U A;  3BTL A;  4IRV A;  3VVX A;  3ON2 A;  2HYJ A;  2NS7 A;  3HGY A;  3O8H A;  4JKZ A;  3SDG A;  3BJB A;  4GFL A;  2XB5 A;  2Y30 A;  3QBM A;  3QQA A;  1UI5 A;  3ZQG A;  2VKV A;  2X6O A;  2ZOZ A;  4B3A A;  2EH3 A;  2Y2Z A;  3FHN A;  2IEK A;  2B1E A;  3QPS A;  5D19 A;  5HAW A;  4JYK A;  4GFK A;  5FKK A;  2FQ4 A;  3VW1 A;  4W97 A;  3HTI A;  2TRT A;  3TP0 A;  4MK6 A;  3ANG A;  3BR2 A;  3EUP A;  3KZ9 A;  4G12 A;  3SWH A;  3CWR A;  3TP3 A;  3P9T A;  2GFN A;  4CGR A;  5HSZ A;  1Z77 A;  2FBQ A;  5FHP A;  3VW2 A;  2QTQ A;  5K7Z A;  2PBX A;  1QVU A;  5F0H A;  5F04 A;  2RHA A;  4AUX A;  4ACI A;  1JUS A;  1T33 A;  2HYT A;  2QIB A;  3IH3 A;  2R7R A;  4OD5 A;  2R7O A;  2R7S A;  3ON4 A;  4GCL A;  2PZ9 A;  3BCG A;  1A6I A;  4MXM A;  1VI0 A;  2R7Q A;  5FGL A;  4M3G A;  1U9O A;  2RAE A;  2XPV A;  5CQG A;  3LHQ A;  2NP3 A;  2YVH A;  1ORK A;  3E7Q A;  2WGB A;  2Y31 A;  2HQ5 A;  4MO7 A;  2VPR A; 
#chains in the Genus database with same CATH homology
 1JTY A;  4D7M A;  3VPR A;  4NN1 A;  1QPI A;  5D18 A;  2GUH A;  4M3D A;  4KWA A;  4JNN A;  1RKT A;  3BNI A;  4I76 A;  4V2G A;  3RD3 A;  2OF7 A;  2ZCM A;  5FKO A;  1T56 A;  2ID3 A;  3QPL A;  3V78 A;  1BJZ A;  2VKE A;  1RKW A;  2G7S A;  2NP5 A;  2XDN A;  2WV1 A;  3HTH A;  2GBY A;  3WHB A;  4ICH A;  3CDL A;  1ZKG A;  3DCF A;  3CRJ A;  3BR3 A;  2ZOY A;  3FRQ A;  3Q0U A;  2XGE A;  3HTA A;  4I6Z A;  3G1M A;  4YZE A;  3IH4 A;  2HKU A;  4B1R A;  2FX0 A;  1JUP A;  4GCK A;  5F08 A;  3NNR A;  4ABZ A;  3LSP A;  3VOX A;  3JSJ A;  3FK6 A;  2QKO A;  5K58 A;  1QVT A;  2W53 A;  1U9N A;  3BTI A;  2ZB9 A;  2FD5 A;  5F1J A;  3KKD A;  3LSJ A;  3VP5 A;  2UXU A;  3BT9 A;  3HE0 A;  4AC6 A;  3Q0V A;  2IBD A;  1Z0X A;  4M3F A;  5HBU A;  5K7F A;  3BRU A;  2XPW A;  3IH2 A;  2GEN A;  5H9T A;  2XGC A;  2RAS A;  3MVP A;  3ZQH A;  3ZQI A;  5J1R A;  3Q3S A;  2IAI A;  3KNW A;  3VW0 A;  3B81 A;  4XK4 A;  2QOP A;  5EFY A;  3AQT A;  3GEU A;  3BQZ A;  5F0F A;  5FMP A;  2XPU A;  3QKX A;  1JT0 A;  3MNL A;  5J3L A;  5CXI A;  5GPA A;  3G7R A;  3C07 A;  5GPC A;  3FIW A;  2QWT A;  2NS8 A;  5C4Y A;  3HTJ A;  5F27 A;  3BTC A;  2XRL A;  2JK3 A;  3LSR A;  5FKM A;  2WUI A;  3ZQF A;  3IUV A;  3LWJ A;  5IOY A;  4AF5 A;  2G7L A;  3NXC A;  3FK7 A;  3B6C A;  5IPA A;  4V2F A;  3GZI A;  2OI8 A;  3BHQ A;  3VVZ A;  3EGQ A;  3PPB A;  4D5C A;  3ANP A;  2G3B A;  2JJ7 A;  4M3B A;  4L62 A;  2UXP A;  2OPT A;  5D1R A;  3SFI A;  3B6A A;  1JUM A;  3VUQ A;  5DAJ A;  4HKU A;  1SGM A;  3ZQL A;  1RPW A;  3O60 A;  2OER A;  3HGG A;  2O7O A;  2X9D A;  2ZCN A;  4ME9 A;  1JT6 A;  2HXI A;  2G7G A;  3BTJ A;  5IP6 A;  2V57 A;  2ID6 A;  2UXO A;  5EZH A;  2IU5 A;  2F07 A;  2FJ1 A;  2DTZ A;  3KKC A;  4PXI A;  5FKL A;  2O7T A;  1ZK8 A;  5EZG A;  3DPJ A;  2ZCX A;  2TCT A;  2DG7 A;  2G0E A;  3RH2 A;  2HXO A;  3VVY A;  4DW6 A;  3BR0 A;  3Q0W A;  4UDS A;  3V6G A;  3NI7 A;  5J1Y A;  1UI6 A;  3NPI A;  5GP9 A;  2XGD A;  3BR5 A;  2UXH A;  3NRG A;  4W1U A;  5F0C A;  3PAS A;  5IOZ A;  5EYR A;  4AC0 A;  3G1O A;  2NX4 A;  5CXG A;  3O8G A;  3CJD A;  3PM1 A;  4M3E A;  3G1L A;  2REK A;  2DG8 A;  3G56 A;  3DEW A;  3F0C A;  3BR6 A;  4JL3 A;  2I10 A;  3COL A;  3WHC A;  3F1B A;  4X1E A;  3CCY A;  4GCT A;  2D6Y A;  3AQS A;  3LOC A;  2QCO A;  4NEL A;  1JTX A;  2UXI A;  3BR1 A;  3LJL A;  5K7H A;  5CW8 A;  4D7N A;  3S5R A;  3BQY A;  4D5F A;  3HIM A;  2Q24 A;  3C2B A;  3VOK A;  5AQC A;  2YVE A;  3T6N A;  5FKN A;  3VIB A;  5J1U A;  3BTL A;  3VVX A;  3ON2 A;  2HYJ A;  2NS7 A;  3HGY A;  3O8H A;  4JKZ A;  3SDG A;  3BJB A;  4GFL A;  2XB5 A;  2Y30 A;  3QBM A;  3QQA A;  1UI5 A;  3ZQG A;  2VKV A;  2X6O A;  2ZOZ A;  4B3A A;  2EH3 A;  2Y2Z A;  2IEK A;  3QPS A;  5D19 A;  5HAW A;  4JYK A;  4GFK A;  5FKK A;  2FQ4 A;  3VW1 A;  4W97 A;  3HTI A;  2TRT A;  3TP0 A;  4MK6 A;  3ANG A;  3BR2 A;  3EUP A;  3KZ9 A;  4G12 A;  3CWR A;  3TP3 A;  3P9T A;  2GFN A;  4CGR A;  5HSZ A;  1Z77 A;  2FBQ A;  5FHP A;  3VW2 A;  2QTQ A;  5K7Z A;  2PBX A;  1QVU A;  5F0H A;  5F04 A;  2RHA A;  4AUX A;  4ACI A;  1JUS A;  1T33 A;  2HYT A;  2QIB A;  3IH3 A;  3ON4 A;  4GCL A;  2PZ9 A;  3BCG A;  1A6I A;  4MXM A;  1VI0 A;  5FGL A;  4M3G A;  1U9O A;  2RAE A;  2XPV A;  3LHQ A;  2NP3 A;  2YVH A;  1ORK A;  3E7Q A;  2WGB A;  2Y31 A;  2HQ5 A;  4MO7 A;  2VPR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...