4MK6A

Crystal structure of probable dihydroxyacetone kinase regulator dhsk_reg from listeria monocytogenes egd-e
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
188
structure length
188
Chain Sequence
SNAMAESLITKKAIAGGLMELCQHKRFEKISIADITNICGLNRQTFYYHFTDKYDLLTWTYENDFFHCLADGITLGNWDKHVLKMLESIKENADFYKNTVSADASILSFCFSKLTNSLFMDLFEKIDTNATVNEADRVFYAEFFSYGCSGVLIKWITRGFKEAPETIANQLFRLAKDTEFLANSMYRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable Dihydroxyacetone Kinase Regulator DHSK_reg
publication title Crystal Structure of Probable Dihydroxyacetone Kinase Regulator DHSK_reg from Listeria monocytogenes EGD-e
rcsb
source organism Listeria monocytogenes
molecule tags Transcription regulator
total genus 69
structure length 188
sequence length 188
ec nomenclature
pdb deposition date 2013-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF14278 TetR_C_8 Transcriptional regulator C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 4mk6A00
5FKKA 2HQ5A 3KKCA 5K7ZA 1T56A 2ZB9A 1Z0XA 3KKDA 1RKWA 2RASA 3O60A 3CWRA 3ANPA 3G1MA 1QVUA 4I6ZA 2RHAA 3CJDA 3FIWA 5K58A 4GCLA 4D7NA 2ZOYA 2G7GA 2XDNA 2FBQA 3SDGA 3P9TA 2ID3A 2UXPA 1QVTA 3JSJA 4W97A 3BCGA 2QOPA 5F0CA 3O8HA 4AF5A 2XGCA 3B6AA 3BR1A 1JTXA 3EUPA 5HAWA 3LSPA 2G3BA 3V6GA 3BNIA 5J1YA 3PM1A 1RKTA 2QTQA 2F07A 3BHQA 4JL3A 2QIBA 3BQYA 3LJLA 2NP3A 2UXUA 3HE0A 3IH4A 3VUQA 3HTIA 4JYKA 2HXIA 3BRUA 5C4YA 3ZQFA 4HKUA 2WV1A 4M3EA 4MXMA 2FQ4A 2REKA 3T6NA 4D5FA 2ZCNA 2GFNA 5FHPA 3KZ9A 3FK6A 2G0EA 3BR0A 4AC6A 1UI6A 2XB5A 2OI8A 2HXOA 3KNWA 2DG7A 2VKEA 2PBXA 5GPCA 5AQCA 5DAJA 5EZHA 5FGLA 2QCOA 3Q3SA 3CDLA 2XPVA 5J1RA 4X1EA 3F1BA 3NNRA 2FJ1A 2UXHA 3Q0UA 2Y31A 5F27A 4ME9A 4NELA 1JTYA 1ZKGA 2NX4A 3AQSA 1QPIA 4PXIA 4B3AA 5HBUA 3RD3A 5K7HA 2EH3A 4JKZA 4M3DA 3NI7A 2HYTA 2W53A 3G7RA 2ZCXA 2XGEA 3QQAA 3ZQIA 3Q0VA 3ANGA 3BR3A 3LSJA 2QKOA 3B6CA 2Y2ZA 3QBMA 3VP5A 1UI5A 4DW6A 3VPRA 3DCFA 1BJZA 2FD5A 5F04A 3C07A 3BR5A 3QPLA 4W1UA 3CCYA 2IAIA 4GCKA 3VOXA 2WUIA 4M3BA 4ACIA 4V2FA 1RPWA 5CW8A 2OPTA 2Y30A 5GPAA 1A6IA 4GFKA 3TP3A 2FX0A 2JK3A 2NS8A 2XRLA 3ZQGA 3PPBA 2YVEA 2TRTA 3E7QA 3GEUA 5IOZA 3BT9A 3NXCA 3RH2A 3VVYA 5EYRA 3LOCA 5H9TA 4GFLA 2DG8A 5J1UA 3LWJA 3VW0A 2ID6A 5D19A 2O7OA 5F1JA 4D7MA 2GENA 2X9DA 2OERA 3VW2A 1JUPA 4YZEA 5F0FA 3G1OA 3VVXA 5HSZA 2VPRA 5F0HA 4V2GA 3IH3A 3ON4A 2XPUA 3FRQA 5J3LA 2G7LA 5FKOA 2IU5A 4AC0A 1JT6A 2IBDA 3Q0WA 3MVPA 1ORKA 3NRGA 2I10A 2NS7A 2V57A 3HIMA 2UXIA 3NPIA 5EZGA 5IPAA 2WGBA 5GP9A 3HTAA 1Z77A 4NN1A 3ON2A 1JUMA 2DTZA 1ZK8A 2X6OA 3BTJA 3WHBA 3FK7A 3CRJA 3B81A 1T33A 3V78A 2Q24A 3VW1A 4CGRA 4G12A 3SFIA 1VI0A 1U9NA 4ABZA 3ZQHA 4B1RA 2IEKA 5CXIA 4UDSA 5CXGA 3G1LA 1JUSA 3TP0A 2NP5A 3GZIA 3COLA 3HTJA 4M3GA 3AQTA 3PASA 3LHQA 3VIBA 2D6YA 2GUHA 3BTCA 3ZQLA 3C2BA 2XPWA 2G7SA 3BJBA 2JJ7A 3QPSA 1U9OA 2VKVA 2QWTA 3IUVA 1JT0A 5FKMA 5D18A 3S5RA 3HGGA 5FKNA 3HTHA 2YVHA 4JNNA 2ZOZA 5EFYA 4D5CA 3BTLA 2OF7A 5F08A 2ZCMA 4L62A 3BR6A 5FMPA 2RAEA 5K7FA 2HYJA 3VOKA 2TCTA 2XGDA 2HKUA 3MNLA 5IOYA 3IH2A 3BQZA 3G56A 5IP6A 3WHCA 2GBYA 5D1RA 4MK6A 3QKXA 3VVZA 3DEWA 3LSRA 3BR2A 3EGQA 1SGMA 4KWAA 2UXOA 3DPJA 4I76A 4MO7A 4ICHA 3HGYA 3F0CA 2O7TA 2PZ9A 4GCTA 4M3FA 5FKLA 4AUXA 3O8GA 3BTIA 4XK4A
chains in the Genus database with same CATH superfamily
5FKKA 4WIBA 2HQ5A 3KKCA 5K7ZA 1T56A 2ZB9A 3KYLA 1Z0XA 3KKDA 1RKWA 2RASA 3O60A 3CWRA 3ANPA 3G1MA 1QVUA 4I6ZA 2RHAA 3CJDA 3FIWA 5K58A 4GCLA 4D7NA 2ZOYA 2B3WA 2G7GA 2XDNA 2FBQA 3SDGA 3P9TA 2ID3A 2UXPA 1QVTA 3JSJA 4W97A 3BCGA 2QOPA 2R7WA 5F0CA 3O8HA 4AF5A 2XGCA 3B6AA 3BR1A 1JTXA 3EUPA 5HAWA 3LSPA 2G3BA 3V6GA 3BNIA 5J1YA 3PM1A 1RKTA 2QTQA 2F07A 3BHQA 4JL3A 2QIBA 3BQYA 3LJLA 2NP3A 2UXUA 3HE0A 3IH4A 3VUQA 3HTIA 4JYKA 2HXIA 3BRUA 5C4YA 3ZQFA 4HKUA 2WV1A 4M3EA 4MXMA 2FQ4A 2REKA 3T6NA 4D5FA 2ZCNA 2GFNA 5FHPA 3KZ9A 3FK6A 2G0EA 3BR0A 4AC6A 1UI6A 2XB5A 2OI8A 2HXOA 3KNWA 2DG7A 2VKEA 2PBXA 5GPCA 5AQCA 3SWHA 5DAJA 5EZHA 5FGLA 2QCOA 3Q3SA 3CDLA 2XPVA 5J1RA 4X1EA 3F1BA 3NNRA 2FJ1A 2UXHA 3Q0UA 2Y31A 2R7VA 5F27A 4ME9A 4NELA 4OD4A 1JTYA 1ZKGA 2NX4A 3AQSA 1QPIA 4PXIA 4B3AA 5HBUA 3RD3A 5K7HA 2EH3A 4JKZA 4M3DA 3NI7A 2HYTA 2W53A 3G7RA 2ZCXA 2XGEA 3QQAA 3ZQIA 3Q0VA 3ANGA 3BR3A 3LSJA 2QKOA 3B6CA 2Y2ZA 3QBMA 3VP5A 1UI5A 4DW6A 3DU6A 3VPRA 2R7XA 3DCFA 1BJZA 2FD5A 4IRVA 5F04A 3C07A 3BR5A 3QPLA 4W1UA 3CCYA 2IAIA 4GCKA 3VOXA 2WUIA 2ZY9A 4M3BA 4ACIA 4V2FA 1RPWA 5CQGA 5CW8A 2OPTA 2Y30A 5GPAA 1A6IA 4GFKA 3TP3A 2FX0A 2JK3A 2NS8A 3NS4A 2XRLA 2FJI1 3ZQGA 3PPBA 2YVEA 2TRTA 3E7QA 2PFVA 3GEUA 5IOZA 3BT9A 3NXCA 3RH2A 3VVYA 3DU5A 5EYRA 3LOCA 2R7OA 5H9TA 4GFLA 2DG8A 5J1UA 3LWJA 3VW0A 2ID6A 5D19A 2O7OA 5F1JA 4D7MA 2GENA 2X9DA 2R7TA 2R7UA 2OERA 3VW2A 1JUPA 4YZEA 3VTIA 5F0FA 3G1OA 3VVXA 5HSZA 2VPRA 5F0HA 4V2GA 3IH3A 3ON4A 2XPUA 3FRQA 4DVYP 5J3LA 2G7LA 5FKOA 2IU5A 4AC0A 1JT6A 2IBDA 3Q0WA 3MVPA 1ORKA 3NRGA 2R7RA 2I10A 2NS7A 2V57A 3HIMA 2UXIA 3NPIA 5EZGA 5IPAA 2WGBA 5GP9A 3HTAA 1Z77A 4NN1A 2R7SA 3ON2A 1JUMA 2DTZA 1ZK8A 2X6OA 3BTJA 3WHBA 3FK7A 3CRJA 3B81A 1T33A 3V78A 2Q24A 3VW1A 4CGRA 4G12A 3SFIA 1VI0A 1U9NA 4ABZA 3ZQHA 4B1RA 2IEKA 5CXIA 4UDSA 3FHNA 2B1EA 5CXGA 4U9LA 3G1LA 2A2FX 1JUSA 3TP0A 2NP5A 3GZIA 3COLA 3HTJA 4M3GA 3AQTA 3PASA 4C2MA 3LHQA 3VIBA 2D6YA 4U9NA 2GUHA 2R7QA 2YVXA 3BTCA 3ZQLA 3C2BA 2XPWA 2G7SA 3BJBA 2JJ7A 3QPSA 1U9OA 2VKVA 2QWTA 3IUVA 1JT0A 5FKMA 5D18A 3S5RA 3HGGA 5FKNA 3HTHA 2YVHA 3K8PC 4JNNA 2ZOZA 5EFYA 4D5CA 3BTLA 2OF7A 5F08A 2ZCMA 4L62A 3BR6A 5FMPA 2RAEA 5K7FA 2HYJA 3VOKA 2TCTA 2XGDA 2HKUA 3MNLA 5IOYA 3IH2A 3BQZA 3G56A 5IP6A 3WHCA 2GBYA 5D1RA 4OD5A 4MK6A 3QKXA 3VVZA 3DEWA 3LSRA 3BR2A 3EGQA 1SGMA 4KWAA 2UXOA 3DPJA 4I76A 4MO7A 4ICHA 3HGYA 3F0CA 2O7TA 2PZ9A 4GCTA 4M3FA 5FKLA 4AUXA 3O8GA 3BTIA 4XK4A
chains in the Genus database with same CATH topology
5FKKA 2HQ5A 3KKCA 5K7ZA 1T56A 2ZB9A 1Z0XA 3KKDA 1RKWA 2RASA 3O60A 3CWRA 3ANPA 3G1MA 1QVUA 4I6ZA 2RHAA 3CJDA 3FIWA 5K58A 4GCLA 4D7NA 2ZOYA 2G7GA 2XDNA 2FBQA 3SDGA 3P9TA 2ID3A 2UXPA 1QVTA 3JSJA 4W97A 3BCGA 2QOPA 5F0CA 3O8HA 4AF5A 2XGCA 3B6AA 3BR1A 1JTXA 3EUPA 5HAWA 3LSPA 2G3BA 3V6GA 3BNIA 5J1YA 3PM1A 1RKTA 2QTQA 2F07A 3BHQA 4JL3A 2QIBA 3BQYA 3LJLA 2NP3A 2UXUA 3HE0A 3IH4A 3VUQA 3HTIA 4JYKA 2HXIA 3BRUA 5C4YA 3ZQFA 4HKUA 2WV1A 4M3EA 4MXMA 2FQ4A 2REKA 3T6NA 4D5FA 2ZCNA 2GFNA 5FHPA 3KZ9A 3FK6A 2G0EA 3BR0A 4AC6A 1UI6A 2XB5A 2OI8A 2HXOA 3KNWA 2DG7A 2VKEA 2PBXA 5GPCA 5AQCA 5DAJA 5EZHA 5FGLA 2QCOA 3Q3SA 3CDLA 2XPVA 5J1RA 4X1EA 3F1BA 3NNRA 2FJ1A 2UXHA 3Q0UA 2Y31A 5F27A 4ME9A 4NELA 1JTYA 1ZKGA 2NX4A 3AQSA 1QPIA 4PXIA 4B3AA 5HBUA 3RD3A 5K7HA 2EH3A 4JKZA 4M3DA 3NI7A 2HYTA 2W53A 3G7RA 2ZCXA 2XGEA 3QQAA 3ZQIA 3Q0VA 3ANGA 3BR3A 3LSJA 2QKOA 3B6CA 2Y2ZA 3QBMA 3VP5A 1UI5A 4DW6A 3VPRA 3DCFA 1BJZA 2FD5A 5F04A 3C07A 3BR5A 3QPLA 4W1UA 3CCYA 2IAIA 4GCKA 3VOXA 2WUIA 4M3BA 4ACIA 4V2FA 1RPWA 5CW8A 2OPTA 2Y30A 5GPAA 1A6IA 4GFKA 3TP3A 2FX0A 2JK3A 2NS8A 2XRLA 3ZQGA 3PPBA 2YVEA 2TRTA 3E7QA 3GEUA 5IOZA 3BT9A 3NXCA 3RH2A 3VVYA 5EYRA 3LOCA 5H9TA 4GFLA 2DG8A 5J1UA 3LWJA 3VW0A 2ID6A 5D19A 2O7OA 5F1JA 4D7MA 2GENA 2X9DA 2OERA 3VW2A 1JUPA 4YZEA 5F0FA 3G1OA 3VVXA 5HSZA 2VPRA 5F0HA 4V2GA 3IH3A 3ON4A 2XPUA 3FRQA 5J3LA 2G7LA 5FKOA 2IU5A 4AC0A 1JT6A 2IBDA 3Q0WA 3MVPA 1ORKA 3NRGA 2I10A 2NS7A 2V57A 3HIMA 2UXIA 3NPIA 5EZGA 5IPAA 2WGBA 5GP9A 3HTAA 1Z77A 4NN1A 3ON2A 1JUMA 2DTZA 1ZK8A 2X6OA 3BTJA 3WHBA 3FK7A 3CRJA 3B81A 1T33A 3V78A 2Q24A 3VW1A 4CGRA 4G12A 3SFIA 1VI0A 1U9NA 4ABZA 3ZQHA 4B1RA 2IEKA 5CXIA 4UDSA 5CXGA 3G1LA 1JUSA 3TP0A 2NP5A 3GZIA 3COLA 3HTJA 4M3GA 3AQTA 3PASA 3LHQA 3VIBA 2D6YA 2GUHA 3BTCA 3ZQLA 3C2BA 2XPWA 2G7SA 3BJBA 2JJ7A 3QPSA 1U9OA 2VKVA 2QWTA 3IUVA 1JT0A 5FKMA 5D18A 3S5RA 3HGGA 5FKNA 3HTHA 2YVHA 4JNNA 2ZOZA 5EFYA 4D5CA 3BTLA 2OF7A 5F08A 2ZCMA 4L62A 3BR6A 5FMPA 2RAEA 5K7FA 2HYJA 3VOKA 2TCTA 2XGDA 2HKUA 3MNLA 5IOYA 3IH2A 3BQZA 3G56A 5IP6A 3WHCA 2GBYA 5D1RA 4MK6A 3QKXA 3VVZA 3DEWA 3LSRA 3BR2A 3EGQA 1SGMA 4KWAA 2UXOA 3DPJA 4I76A 4MO7A 4ICHA 3HGYA 3F0CA 2O7TA 2PZ9A 4GCTA 4M3FA 5FKLA 4AUXA 3O8GA 3BTIA 4XK4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FKK A;  2HQ5 A;  3KKC A;  5K7Z A;  1T56 A;  2ZB9 A;  1Z0X A;  3KKD A;  1RKW A;  2RAS A;  3O60 A;  3CWR A;  3ANP A;  3G1M A;  1QVU A;  4I6Z A;  2RHA A;  3CJD A;  3FIW A;  5K58 A;  4GCL A;  4D7N A;  2ZOY A;  2G7G A;  2XDN A;  2FBQ A;  3SDG A;  3P9T A;  2ID3 A;  2UXP A;  1QVT A;  3JSJ A;  4W97 A;  3BCG A;  2QOP A;  5F0C A;  3O8H A;  4AF5 A;  2XGC A;  3B6A A;  3BR1 A;  1JTX A;  3EUP A;  5HAW A;  3LSP A;  2G3B A;  3V6G A;  3BNI A;  5J1Y A;  3PM1 A;  1RKT A;  2QTQ A;  2F07 A;  3BHQ A;  4JL3 A;  2QIB A;  3BQY A;  3LJL A;  2NP3 A;  2UXU A;  3HE0 A;  3IH4 A;  3VUQ A;  3HTI A;  4JYK A;  2HXI A;  3BRU A;  5C4Y A;  3ZQF A;  4HKU A;  2WV1 A;  4M3E A;  4MXM A;  2FQ4 A;  2REK A;  3T6N A;  4D5F A;  2ZCN A;  2GFN A;  5FHP A;  3KZ9 A;  3FK6 A;  2G0E A;  3BR0 A;  4AC6 A;  1UI6 A;  2XB5 A;  2OI8 A;  2HXO A;  3KNW A;  2DG7 A;  2VKE A;  2PBX A;  5GPC A;  5AQC A;  5DAJ A;  5EZH A;  5FGL A;  2QCO A;  3Q3S A;  3CDL A;  2XPV A;  5J1R A;  4X1E A;  3F1B A;  3NNR A;  2FJ1 A;  2UXH A;  3Q0U A;  2Y31 A;  5F27 A;  4ME9 A;  4NEL A;  1JTY A;  1ZKG A;  2NX4 A;  3AQS A;  1QPI A;  4PXI A;  4B3A A;  5HBU A;  3RD3 A;  5K7H A;  2EH3 A;  4JKZ A;  4M3D A;  3NI7 A;  2HYT A;  2W53 A;  3G7R A;  2ZCX A;  2XGE A;  3QQA A;  3ZQI A;  3Q0V A;  3ANG A;  3BR3 A;  3LSJ A;  2QKO A;  3B6C A;  2Y2Z A;  3QBM A;  3VP5 A;  1UI5 A;  4DW6 A;  3VPR A;  3DCF A;  1BJZ A;  2FD5 A;  5F04 A;  3C07 A;  3BR5 A;  3QPL A;  4W1U A;  3CCY A;  2IAI A;  4GCK A;  3VOX A;  2WUI A;  4M3B A;  4ACI A;  4V2F A;  1RPW A;  5CW8 A;  2OPT A;  2Y30 A;  5GPA A;  1A6I A;  4GFK A;  3TP3 A;  2FX0 A;  2JK3 A;  2NS8 A;  2XRL A;  3ZQG A;  3PPB A;  2YVE A;  2TRT A;  3E7Q A;  3GEU A;  5IOZ A;  3BT9 A;  3NXC A;  3RH2 A;  3VVY A;  5EYR A;  3LOC A;  5H9T A;  4GFL A;  2DG8 A;  5J1U A;  3LWJ A;  3VW0 A;  2ID6 A;  5D19 A;  2O7O A;  5F1J A;  4D7M A;  2GEN A;  2X9D A;  2OER A;  3VW2 A;  1JUP A;  4YZE A;  5F0F A;  3G1O A;  3VVX A;  5HSZ A;  2VPR A;  5F0H A;  4V2G A;  3IH3 A;  3ON4 A;  2XPU A;  3FRQ A;  5J3L A;  2G7L A;  5FKO A;  2IU5 A;  4AC0 A;  1JT6 A;  2IBD A;  3Q0W A;  3MVP A;  1ORK A;  3NRG A;  2I10 A;  2NS7 A;  2V57 A;  3HIM A;  2UXI A;  3NPI A;  5EZG A;  5IPA A;  2WGB A;  5GP9 A;  3HTA A;  1Z77 A;  4NN1 A;  3ON2 A;  1JUM A;  2DTZ A;  1ZK8 A;  2X6O A;  3BTJ A;  3WHB A;  3FK7 A;  3CRJ A;  3B81 A;  1T33 A;  3V78 A;  2Q24 A;  3VW1 A;  4CGR A;  4G12 A;  3SFI A;  1VI0 A;  1U9N A;  4ABZ A;  3ZQH A;  4B1R A;  2IEK A;  5CXI A;  4UDS A;  5CXG A;  3G1L A;  1JUS A;  3TP0 A;  2NP5 A;  3GZI A;  3COL A;  3HTJ A;  4M3G A;  3AQT A;  3PAS A;  3LHQ A;  3VIB A;  2D6Y A;  2GUH A;  3BTC A;  3ZQL A;  3C2B A;  2XPW A;  2G7S A;  3BJB A;  2JJ7 A;  3QPS A;  1U9O A;  2VKV A;  2QWT A;  3IUV A;  1JT0 A;  5FKM A;  5D18 A;  3S5R A;  3HGG A;  5FKN A;  3HTH A;  2YVH A;  4JNN A;  2ZOZ A;  5EFY A;  4D5C A;  3BTL A;  2OF7 A;  5F08 A;  2ZCM A;  4L62 A;  3BR6 A;  5FMP A;  2RAE A;  5K7F A;  2HYJ A;  3VOK A;  2TCT A;  2XGD A;  2HKU A;  3MNL A;  5IOY A;  3IH2 A;  3BQZ A;  3G56 A;  5IP6 A;  3WHC A;  2GBY A;  5D1R A;  4MK6 A;  3QKX A;  3VVZ A;  3DEW A;  3LSR A;  3BR2 A;  3EGQ A;  1SGM A;  4KWA A;  2UXO A;  3DPJ A;  4I76 A;  4MO7 A;  4ICH A;  3HGY A;  3F0C A;  2O7T A;  2PZ9 A;  4GCT A;  4M3F A;  5FKL A;  4AUX A;  3O8G A;  3BTI A;  4XK4 A; 
#chains in the Genus database with same CATH topology
 5FKK A;  4WIB A;  2HQ5 A;  3KKC A;  5K7Z A;  1T56 A;  2ZB9 A;  3KYL A;  1Z0X A;  3KKD A;  1RKW A;  2RAS A;  3O60 A;  3CWR A;  3ANP A;  3G1M A;  1QVU A;  4I6Z A;  2RHA A;  3CJD A;  3FIW A;  5K58 A;  4GCL A;  4D7N A;  2ZOY A;  2B3W A;  2G7G A;  2XDN A;  2FBQ A;  3SDG A;  3P9T A;  2ID3 A;  2UXP A;  1QVT A;  3JSJ A;  4W97 A;  3BCG A;  2QOP A;  2R7W A;  5F0C A;  3O8H A;  4AF5 A;  2XGC A;  3B6A A;  3BR1 A;  1JTX A;  3EUP A;  5HAW A;  3LSP A;  2G3B A;  3V6G A;  3BNI A;  5J1Y A;  3PM1 A;  1RKT A;  2QTQ A;  2F07 A;  3BHQ A;  4JL3 A;  2QIB A;  3BQY A;  3LJL A;  2NP3 A;  2UXU A;  3HE0 A;  3IH4 A;  3VUQ A;  3HTI A;  4JYK A;  2HXI A;  3BRU A;  5C4Y A;  3ZQF A;  4HKU A;  2WV1 A;  4M3E A;  4MXM A;  2FQ4 A;  2REK A;  3T6N A;  4D5F A;  2ZCN A;  2GFN A;  5FHP A;  3KZ9 A;  3FK6 A;  2G0E A;  3BR0 A;  4AC6 A;  1UI6 A;  2XB5 A;  2OI8 A;  2HXO A;  3KNW A;  2DG7 A;  2VKE A;  2PBX A;  5GPC A;  5AQC A;  3SWH A;  5DAJ A;  5EZH A;  5FGL A;  2QCO A;  3Q3S A;  3CDL A;  2XPV A;  5J1R A;  4X1E A;  3F1B A;  3NNR A;  2FJ1 A;  2UXH A;  3Q0U A;  2Y31 A;  2R7V A;  5F27 A;  4ME9 A;  4NEL A;  4OD4 A;  1JTY A;  1ZKG A;  2NX4 A;  3AQS A;  1QPI A;  4PXI A;  4B3A A;  5HBU A;  3RD3 A;  5K7H A;  2EH3 A;  4JKZ A;  4M3D A;  3NI7 A;  2HYT A;  2W53 A;  3G7R A;  2ZCX A;  2XGE A;  3QQA A;  3ZQI A;  3Q0V A;  3ANG A;  3BR3 A;  3LSJ A;  2QKO A;  3B6C A;  2Y2Z A;  3QBM A;  3VP5 A;  1UI5 A;  4DW6 A;  3DU6 A;  3VPR A;  2R7X A;  3DCF A;  1BJZ A;  2FD5 A;  4IRV A;  5F04 A;  3C07 A;  3BR5 A;  3QPL A;  4W1U A;  3CCY A;  2IAI A;  4GCK A;  3VOX A;  2WUI A;  2ZY9 A;  4M3B A;  4ACI A;  4V2F A;  1RPW A;  5CQG A;  5CW8 A;  2OPT A;  2Y30 A;  5GPA A;  1A6I A;  4GFK A;  3TP3 A;  2FX0 A;  2JK3 A;  2NS8 A;  3NS4 A;  2XRL A;  2FJI 1;  3ZQG A;  3PPB A;  2YVE A;  2TRT A;  3E7Q A;  2PFV A;  3GEU A;  5IOZ A;  3BT9 A;  3NXC A;  3RH2 A;  3VVY A;  3DU5 A;  5EYR A;  3LOC A;  2R7O A;  5H9T A;  4GFL A;  2DG8 A;  5J1U A;  3LWJ A;  3VW0 A;  2ID6 A;  5D19 A;  2O7O A;  5F1J A;  4D7M A;  2GEN A;  2X9D A;  2R7T A;  2R7U A;  2OER A;  3VW2 A;  1JUP A;  4YZE A;  3VTI A;  5F0F A;  3G1O A;  3VVX A;  5HSZ A;  2VPR A;  5F0H A;  4V2G A;  3IH3 A;  3ON4 A;  2XPU A;  3FRQ A;  4DVY P;  5J3L A;  2G7L A;  5FKO A;  2IU5 A;  4AC0 A;  1JT6 A;  2IBD A;  3Q0W A;  3MVP A;  1ORK A;  3NRG A;  2R7R A;  2I10 A;  2NS7 A;  2V57 A;  3HIM A;  2UXI A;  3NPI A;  5EZG A;  5IPA A;  2WGB A;  5GP9 A;  3HTA A;  1Z77 A;  4NN1 A;  2R7S A;  3ON2 A;  1JUM A;  2DTZ A;  1ZK8 A;  2X6O A;  3BTJ A;  3WHB A;  3FK7 A;  3CRJ A;  3B81 A;  1T33 A;  3V78 A;  2Q24 A;  3VW1 A;  4CGR A;  4G12 A;  3SFI A;  1VI0 A;  1U9N A;  4ABZ A;  3ZQH A;  4B1R A;  2IEK A;  5CXI A;  4UDS A;  3FHN A;  2B1E A;  5CXG A;  4U9L A;  3G1L A;  2A2F X;  1JUS A;  3TP0 A;  2NP5 A;  3GZI A;  3COL A;  3HTJ A;  4M3G A;  3AQT A;  3PAS A;  4C2M A;  3LHQ A;  3VIB A;  2D6Y A;  4U9N A;  2GUH A;  2R7Q A;  2YVX A;  3BTC A;  3ZQL A;  3C2B A;  2XPW A;  2G7S A;  3BJB A;  2JJ7 A;  3QPS A;  1U9O A;  2VKV A;  2QWT A;  3IUV A;  1JT0 A;  5FKM A;  5D18 A;  3S5R A;  3HGG A;  5FKN A;  3HTH A;  2YVH A;  3K8P C;  4JNN A;  2ZOZ A;  5EFY A;  4D5C A;  3BTL A;  2OF7 A;  5F08 A;  2ZCM A;  4L62 A;  3BR6 A;  5FMP A;  2RAE A;  5K7F A;  2HYJ A;  3VOK A;  2TCT A;  2XGD A;  2HKU A;  3MNL A;  5IOY A;  3IH2 A;  3BQZ A;  3G56 A;  5IP6 A;  3WHC A;  2GBY A;  5D1R A;  4OD5 A;  4MK6 A;  3QKX A;  3VVZ A;  3DEW A;  3LSR A;  3BR2 A;  3EGQ A;  1SGM A;  4KWA A;  2UXO A;  3DPJ A;  4I76 A;  4MO7 A;  4ICH A;  3HGY A;  3F0C A;  2O7T A;  2PZ9 A;  4GCT A;  4M3F A;  5FKL A;  4AUX A;  3O8G A;  3BTI A;  4XK4 A; 
#chains in the Genus database with same CATH homology
 5FKK A;  2HQ5 A;  3KKC A;  5K7Z A;  1T56 A;  2ZB9 A;  1Z0X A;  3KKD A;  1RKW A;  2RAS A;  3O60 A;  3CWR A;  3ANP A;  3G1M A;  1QVU A;  4I6Z A;  2RHA A;  3CJD A;  3FIW A;  5K58 A;  4GCL A;  4D7N A;  2ZOY A;  2G7G A;  2XDN A;  2FBQ A;  3SDG A;  3P9T A;  2ID3 A;  2UXP A;  1QVT A;  3JSJ A;  4W97 A;  3BCG A;  2QOP A;  5F0C A;  3O8H A;  4AF5 A;  2XGC A;  3B6A A;  3BR1 A;  1JTX A;  3EUP A;  5HAW A;  3LSP A;  2G3B A;  3V6G A;  3BNI A;  5J1Y A;  3PM1 A;  1RKT A;  2QTQ A;  2F07 A;  3BHQ A;  4JL3 A;  2QIB A;  3BQY A;  3LJL A;  2NP3 A;  2UXU A;  3HE0 A;  3IH4 A;  3VUQ A;  3HTI A;  4JYK A;  2HXI A;  3BRU A;  5C4Y A;  3ZQF A;  4HKU A;  2WV1 A;  4M3E A;  4MXM A;  2FQ4 A;  2REK A;  3T6N A;  4D5F A;  2ZCN A;  2GFN A;  5FHP A;  3KZ9 A;  3FK6 A;  2G0E A;  3BR0 A;  4AC6 A;  1UI6 A;  2XB5 A;  2OI8 A;  2HXO A;  3KNW A;  2DG7 A;  2VKE A;  2PBX A;  5GPC A;  5AQC A;  5DAJ A;  5EZH A;  5FGL A;  2QCO A;  3Q3S A;  3CDL A;  2XPV A;  5J1R A;  4X1E A;  3F1B A;  3NNR A;  2FJ1 A;  2UXH A;  3Q0U A;  2Y31 A;  5F27 A;  4ME9 A;  4NEL A;  1JTY A;  1ZKG A;  2NX4 A;  3AQS A;  1QPI A;  4PXI A;  4B3A A;  5HBU A;  3RD3 A;  5K7H A;  2EH3 A;  4JKZ A;  4M3D A;  3NI7 A;  2HYT A;  2W53 A;  3G7R A;  2ZCX A;  2XGE A;  3QQA A;  3ZQI A;  3Q0V A;  3ANG A;  3BR3 A;  3LSJ A;  2QKO A;  3B6C A;  2Y2Z A;  3QBM A;  3VP5 A;  1UI5 A;  4DW6 A;  3VPR A;  3DCF A;  1BJZ A;  2FD5 A;  5F04 A;  3C07 A;  3BR5 A;  3QPL A;  4W1U A;  3CCY A;  2IAI A;  4GCK A;  3VOX A;  2WUI A;  4M3B A;  4ACI A;  4V2F A;  1RPW A;  5CW8 A;  2OPT A;  2Y30 A;  5GPA A;  1A6I A;  4GFK A;  3TP3 A;  2FX0 A;  2JK3 A;  2NS8 A;  2XRL A;  3ZQG A;  3PPB A;  2YVE A;  2TRT A;  3E7Q A;  3GEU A;  5IOZ A;  3BT9 A;  3NXC A;  3RH2 A;  3VVY A;  5EYR A;  3LOC A;  5H9T A;  4GFL A;  2DG8 A;  5J1U A;  3LWJ A;  3VW0 A;  2ID6 A;  5D19 A;  2O7O A;  5F1J A;  4D7M A;  2GEN A;  2X9D A;  2OER A;  3VW2 A;  1JUP A;  4YZE A;  5F0F A;  3G1O A;  3VVX A;  5HSZ A;  2VPR A;  5F0H A;  4V2G A;  3IH3 A;  3ON4 A;  2XPU A;  3FRQ A;  5J3L A;  2G7L A;  5FKO A;  2IU5 A;  4AC0 A;  1JT6 A;  2IBD A;  3Q0W A;  3MVP A;  1ORK A;  3NRG A;  2I10 A;  2NS7 A;  2V57 A;  3HIM A;  2UXI A;  3NPI A;  5EZG A;  5IPA A;  2WGB A;  5GP9 A;  3HTA A;  1Z77 A;  4NN1 A;  3ON2 A;  1JUM A;  2DTZ A;  1ZK8 A;  2X6O A;  3BTJ A;  3WHB A;  3FK7 A;  3CRJ A;  3B81 A;  1T33 A;  3V78 A;  2Q24 A;  3VW1 A;  4CGR A;  4G12 A;  3SFI A;  1VI0 A;  1U9N A;  4ABZ A;  3ZQH A;  4B1R A;  2IEK A;  5CXI A;  4UDS A;  5CXG A;  3G1L A;  1JUS A;  3TP0 A;  2NP5 A;  3GZI A;  3COL A;  3HTJ A;  4M3G A;  3AQT A;  3PAS A;  3LHQ A;  3VIB A;  2D6Y A;  2GUH A;  3BTC A;  3ZQL A;  3C2B A;  2XPW A;  2G7S A;  3BJB A;  2JJ7 A;  3QPS A;  1U9O A;  2VKV A;  2QWT A;  3IUV A;  1JT0 A;  5FKM A;  5D18 A;  3S5R A;  3HGG A;  5FKN A;  3HTH A;  2YVH A;  4JNN A;  2ZOZ A;  5EFY A;  4D5C A;  3BTL A;  2OF7 A;  5F08 A;  2ZCM A;  4L62 A;  3BR6 A;  5FMP A;  2RAE A;  5K7F A;  2HYJ A;  3VOK A;  2TCT A;  2XGD A;  2HKU A;  3MNL A;  5IOY A;  3IH2 A;  3BQZ A;  3G56 A;  5IP6 A;  3WHC A;  2GBY A;  5D1R A;  4MK6 A;  3QKX A;  3VVZ A;  3DEW A;  3LSR A;  3BR2 A;  3EGQ A;  1SGM A;  4KWA A;  2UXO A;  3DPJ A;  4I76 A;  4MO7 A;  4ICH A;  3HGY A;  3F0C A;  2O7T A;  2PZ9 A;  4GCT A;  4M3F A;  5FKL A;  4AUX A;  3O8G A;  3BTI A;  4XK4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...