2NP3A

Crystal structure of tetr-family regulator (sco0857) from streptomyces coelicolor a3.
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
176
structure length
142
Chain Sequence
ILTAARVCFYGTKENLFLQALELPGKIEEAITAAAQGGLDGIGERVVRAHLSVWDDVSSRPALMTMVRSAARLRETATGILARALGGVITGEDAMLRTSMVATQLVGLAMMRYVAHLEPLASADTDTVARHYGRAVQAIVTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of TetR-family regulator (SCO0857) from Streptomyces coelicolor A3.
rcsb
source organism Streptomyces coelicolor
molecule tags Transcription
molecule keywords Putative TetR-family regulator
total genus 47
structure length 142
sequence length 176
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17920 TetR_C_16 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2np3A00
5IP6A 2VKVA 2QOPA 3QQAA 5EZHA 3MNLA 3LWJA 4W97A 2FD5A 4ICHA 3ZQHA 2JJ7A 3IUVA 3VVXA 1Z77A 5FMPA 5GPAA 4GCKA 3BR2A 2YVHA 3CJDA 3BR1A 3FK6A 3G7RA 3BTLA 3NPIA 3KKCA 2IEKA 5H9TA 3VP5A 5IOYA 5K58A 4D7MA 2HXIA 4UDSA 4D7NA 4AC0A 2WGBA 5GPCA 4V2GA 3TP3A 3QBMA 5C4YA 2NP5A 3MVPA 4ACIA 2QKOA 2W53A 3BR6A 5AQCA 2QIBA 5EYRA 3EUPA 2D6YA 3BTCA 5EFYA 1U9NA 3FK7A 1QVTA 2PZ9A 1Z0XA 4MXMA 3ON2A 3BTIA 3VW2A 3C2BA 2XRLA 3VOXA 2OI8A 3EGQA 3G1LA 3LSPA 2QTQA 2G7SA 3BR3A 3LHQA 3ON4A 2QWTA 4M3BA 1JTYA 5K7HA 4CGRA 3ANPA 5J3LA 2FJ1A 2DG7A 3VW0A 4I6ZA 3HTIA 5F0CA 5J1RA 3BT9A 4GFKA 5D19A 3ZQGA 3HIMA 4W1UA 5CW8A 4ME9A 1JT6A 5HBUA 4G12A 4GCTA 4NN1A 1ZKGA 3SFIA 1JTXA 3G1OA 3CCYA 3P9TA 3LSJA 2PBXA 2UXIA 2XGEA 2ZCMA 3F1BA 4M3GA 2ZOZA 2DTZA 3COLA 2XPUA 2XGCA 2Q24A 3Q0VA 3O8GA 3B6AA 3KNWA 2O7TA 2UXHA 1T33A 3QPLA 3ZQIA 3VOKA 1U9OA 2XDNA 5F04A 4MO7A 5K7FA 3JSJA 5IOZA 3VIBA 2WUIA 5CXIA 3GEUA 3TP0A 4D5FA 3RH2A 2I10A 2FBQA 4AF5A 3O8HA 3E7QA 5IPAA 3WHBA 4XK4A 2RASA 3VPRA 2UXOA 1JT0A 5D18A 2G7GA 2RHAA 2ID3A 5FKOA 3DEWA 2IU5A 3Q0UA 2TCTA 2HKUA 3BQYA 2XB5A 3VW1A 2GFNA 1UI6A 2TRTA 2ZB9A 3IH4A 3S5RA 5HSZA 3V78A 2V57A 5F0FA 2RAEA 4GCLA 3HGYA 2O7OA 4I76A 3HTHA 4L62A 3GZIA 4V2FA 5DAJA 2G0EA 3BR5A 1RPWA 4JYKA 2IBDA 5J1YA 2NX4A 3ZQFA 3CWRA 2REKA 2HQ5A 1QVUA 2DG8A 3AQTA 1JUPA 4GFLA 3LJLA 2XPWA 2NS8A 4D5CA 3T6NA 5HAWA 3ANGA 3HTJA 3Q0WA 5CXGA 5FKKA 1JUMA 5FKMA 1T56A 3KKDA 1JUSA 5F27A 4KWAA 1UI5A 3VVZA 3BRUA 3CRJA 4MK6A 3KZ9A 1RKTA 2VKEA 3G1MA 2Y30A 5GP9A 2GBYA 2UXPA 4NELA 3IH3A 2NS7A 4ABZA 3RD3A 3VUQA 4HKUA 1SGMA 3BCGA 2OPTA 3PASA 3SDGA 2OERA 3FRQA 3G56A 3FIWA 2UXUA 2EH3A 4B3AA 1A6IA 3ZQLA 3AQSA 3CDLA 5EZGA 3LOCA 2F07A 5F0HA 5D1RA 2YVEA 2ZCNA 5F08A 2HYTA 2FQ4A 4M3FA 4M3EA 2XGDA 2ZOYA 3BTJA 2WV1A 4X1EA 3QKXA 3NXCA 3B6CA 3BJBA 3C07A 3PM1A 5F1JA 4B1RA 3V6GA 4DW6A 4AUXA 3BHQA 5FHPA 3HGGA 2OF7A 3HTAA 2HYJA 3DPJA 3DCFA 1ORKA 4JL3A 3IH2A 4YZEA 3HE0A 1ZK8A 2NP3A 2GENA 3VVYA 3LSRA 2ID6A 2FX0A 5K7ZA 1BJZA 2ZCXA 3O60A 2VPRA 2X6OA 2HXOA 4JNNA 4M3DA 1RKWA 2G7LA 5FKLA 2G3BA 3NRGA 3B81A 5FKNA 3NNRA 3BNIA 3PPBA 3WHCA 2JK3A 3NI7A 3BR0A 5FGLA 2IAIA 3Q3SA 5J1UA 1VI0A 4JKZA 2QCOA 2X9DA 4PXIA 3F0CA 1QPIA 2XPVA 3QPSA 2Y2ZA 3BQZA 2Y31A 4AC6A 2GUHA
chains in the Genus database with same CATH superfamily
5IP6A 2VKVA 2QOPA 3QQAA 5EZHA 3MNLA 3LWJA 4W97A 2FD5A 4ICHA 3ZQHA 2JJ7A 3IUVA 3VVXA 1Z77A 2R7OA 5FMPA 5GPAA 4GCKA 3BR2A 2YVHA 3CJDA 3BR1A 3FK6A 3G7RA 3BTLA 3NPIA 3KKCA 2IEKA 5H9TA 3VP5A 5IOYA 5K58A 4D7MA 2HXIA 2R7RA 4UDSA 4D7NA 4AC0A 3K8PC 2WGBA 5GPCA 4V2GA 3TP3A 3QBMA 5C4YA 2NP5A 3MVPA 4ACIA 4U9LA 2QKOA 2W53A 3BR6A 5AQCA 2QIBA 5EYRA 3EUPA 4OD4A 2D6YA 3BTCA 5EFYA 1U9NA 3FK7A 3NS4A 1QVTA 2PZ9A 1Z0XA 4MXMA 3ON2A 3BTIA 3VW2A 3C2BA 2XRLA 3VOXA 2OI8A 3EGQA 2YVXA 3G1LA 3LSPA 2QTQA 2G7SA 3BR3A 3LHQA 3ON4A 4OD5A 2QWTA 4M3BA 1JTYA 5K7HA 2R7QA 4CGRA 3ANPA 5J3LA 2FJ1A 2DG7A 3VW0A 4I6ZA 3HTIA 5F0CA 5J1RA 3BT9A 4GFKA 5D19A 3DU5A 3ZQGA 3HIMA 4W1UA 5CW8A 2R7TA 4ME9A 1JT6A 5HBUA 4G12A 2B1EA 4GCTA 4NN1A 1ZKGA 3SFIA 1JTXA 3G1OA 3CCYA 3DU6A 3P9TA 4C2MA 3LSJA 2PBXA 2UXIA 2XGEA 2ZCMA 3F1BA 4M3GA 2ZOZA 2DTZA 3COLA 2XPUA 2XGCA 2Q24A 3Q0VA 3O8GA 3B6AA 3KNWA 2O7TA 2UXHA 1T33A 2PFVA 3QPLA 3ZQIA 3VOKA 1U9OA 2XDNA 5F04A 4MO7A 2R7VA 5K7FA 3JSJA 5IOZA 3VIBA 2WUIA 5CXIA 3GEUA 3TP0A 4D5FA 3RH2A 2I10A 2FBQA 3KYLA 4AF5A 3O8HA 3E7QA 5IPAA 3WHBA 4XK4A 2RASA 3VPRA 2UXOA 1JT0A 3SWHA 2R7UA 5D18A 2G7GA 2RHAA 2ID3A 5FKOA 3DEWA 2IU5A 3Q0UA 2TCTA 2HKUA 3BQYA 2XB5A 3VW1A 2GFNA 1UI6A 2TRTA 2ZB9A 3IH4A 3S5RA 5HSZA 3V78A 2V57A 5F0FA 2RAEA 4GCLA 3HGYA 2O7OA 4I76A 3HTHA 4L62A 3GZIA 4V2FA 5DAJA 2G0EA 3BR5A 1RPWA 4JYKA 2IBDA 5J1YA 2NX4A 3ZQFA 3CWRA 2REKA 2HQ5A 1QVUA 2DG8A 3AQTA 1JUPA 4GFLA 3LJLA 2XPWA 2R7WA 2NS8A 4D5CA 3T6NA 5HAWA 3ANGA 3HTJA 3Q0WA 5CXGA 5FKKA 1JUMA 5FKMA 1T56A 3KKDA 1JUSA 5F27A 4KWAA 1UI5A 3VVZA 3BRUA 2FJI1 3CRJA 4MK6A 3KZ9A 1RKTA 2VKEA 3G1MA 2Y30A 5GP9A 2GBYA 2UXPA 4IRVA 4NELA 3IH3A 2R7XA 2NS7A 4ABZA 3RD3A 3VUQA 4HKUA 1SGMA 3BCGA 2OPTA 3PASA 3SDGA 2OERA 3FRQA 2ZY9A 3G56A 3FIWA 2UXUA 2EH3A 4B3AA 1A6IA 3ZQLA 3AQSA 3CDLA 5EZGA 3LOCA 2F07A 5F0HA 5D1RA 4DVYP 2YVEA 2ZCNA 5F08A 2R7SA 2HYTA 2FQ4A 4M3FA 4M3EA 2XGDA 2ZOYA 3VTIA 3BTJA 2WV1A 4X1EA 3FHNA 3QKXA 3NXCA 3B6CA 3BJBA 3C07A 3PM1A 5F1JA 4B1RA 2B3WA 3V6GA 4DW6A 4AUXA 3BHQA 5FHPA 3HGGA 2OF7A 3HTAA 2HYJA 3DPJA 3DCFA 1ORKA 4JL3A 3IH2A 4YZEA 3HE0A 1ZK8A 2NP3A 2GENA 3VVYA 5CQGA 3LSRA 2ID6A 2FX0A 5K7ZA 1BJZA 2ZCXA 3O60A 2VPRA 2X6OA 2HXOA 4JNNA 4M3DA 1RKWA 2G7LA 5FKLA 4WIBA 2G3BA 3NRGA 3B81A 5FKNA 3NNRA 3BNIA 2A2FX 3PPBA 4U9NA 3WHCA 2JK3A 3NI7A 3BR0A 5FGLA 2IAIA 3Q3SA 5J1UA 1VI0A 4JKZA 2QCOA 2X9DA 4PXIA 3F0CA 1QPIA 2XPVA 3QPSA 2Y2ZA 3BQZA 2Y31A 4AC6A 2GUHA
chains in the Genus database with same CATH topology
5IP6A 2VKVA 2QOPA 3QQAA 5EZHA 3MNLA 3LWJA 4W97A 2FD5A 4ICHA 3ZQHA 2JJ7A 3IUVA 3VVXA 1Z77A 5FMPA 5GPAA 4GCKA 3BR2A 2YVHA 3CJDA 3BR1A 3FK6A 3G7RA 3BTLA 3NPIA 3KKCA 2IEKA 5H9TA 3VP5A 5IOYA 5K58A 4D7MA 2HXIA 4UDSA 4D7NA 4AC0A 2WGBA 5GPCA 4V2GA 3TP3A 3QBMA 5C4YA 2NP5A 3MVPA 4ACIA 2QKOA 2W53A 3BR6A 5AQCA 2QIBA 5EYRA 3EUPA 2D6YA 3BTCA 5EFYA 1U9NA 3FK7A 1QVTA 2PZ9A 1Z0XA 4MXMA 3ON2A 3BTIA 3VW2A 3C2BA 2XRLA 3VOXA 2OI8A 3EGQA 3G1LA 3LSPA 2QTQA 2G7SA 3BR3A 3LHQA 3ON4A 2QWTA 4M3BA 1JTYA 5K7HA 4CGRA 3ANPA 5J3LA 2FJ1A 2DG7A 3VW0A 4I6ZA 3HTIA 5F0CA 5J1RA 3BT9A 4GFKA 5D19A 3ZQGA 3HIMA 4W1UA 5CW8A 4ME9A 1JT6A 5HBUA 4G12A 4GCTA 4NN1A 1ZKGA 3SFIA 1JTXA 3G1OA 3CCYA 3P9TA 3LSJA 2PBXA 2UXIA 2XGEA 2ZCMA 3F1BA 4M3GA 2ZOZA 2DTZA 3COLA 2XPUA 2XGCA 2Q24A 3Q0VA 3O8GA 3B6AA 3KNWA 2O7TA 2UXHA 1T33A 3QPLA 3ZQIA 3VOKA 1U9OA 2XDNA 5F04A 4MO7A 5K7FA 3JSJA 5IOZA 3VIBA 2WUIA 5CXIA 3GEUA 3TP0A 4D5FA 3RH2A 2I10A 2FBQA 4AF5A 3O8HA 3E7QA 5IPAA 3WHBA 4XK4A 2RASA 3VPRA 2UXOA 1JT0A 5D18A 2G7GA 2RHAA 2ID3A 5FKOA 3DEWA 2IU5A 3Q0UA 2TCTA 2HKUA 3BQYA 2XB5A 3VW1A 2GFNA 1UI6A 2TRTA 2ZB9A 3IH4A 3S5RA 5HSZA 3V78A 2V57A 5F0FA 2RAEA 4GCLA 3HGYA 2O7OA 4I76A 3HTHA 4L62A 3GZIA 4V2FA 5DAJA 2G0EA 3BR5A 1RPWA 4JYKA 2IBDA 5J1YA 2NX4A 3ZQFA 3CWRA 2REKA 2HQ5A 1QVUA 2DG8A 3AQTA 1JUPA 4GFLA 3LJLA 2XPWA 2NS8A 4D5CA 3T6NA 5HAWA 3ANGA 3HTJA 3Q0WA 5CXGA 5FKKA 1JUMA 5FKMA 1T56A 3KKDA 1JUSA 5F27A 4KWAA 1UI5A 3VVZA 3BRUA 3CRJA 4MK6A 3KZ9A 1RKTA 2VKEA 3G1MA 2Y30A 5GP9A 2GBYA 2UXPA 4NELA 3IH3A 2NS7A 4ABZA 3RD3A 3VUQA 4HKUA 1SGMA 3BCGA 2OPTA 3PASA 3SDGA 2OERA 3FRQA 3G56A 3FIWA 2UXUA 2EH3A 4B3AA 1A6IA 3ZQLA 3AQSA 3CDLA 5EZGA 3LOCA 2F07A 5F0HA 5D1RA 2YVEA 2ZCNA 5F08A 2HYTA 2FQ4A 4M3FA 4M3EA 2XGDA 2ZOYA 3BTJA 2WV1A 4X1EA 3QKXA 3NXCA 3B6CA 3BJBA 3C07A 3PM1A 5F1JA 4B1RA 3V6GA 4DW6A 4AUXA 3BHQA 5FHPA 3HGGA 2OF7A 3HTAA 2HYJA 3DPJA 3DCFA 1ORKA 4JL3A 3IH2A 4YZEA 3HE0A 1ZK8A 2NP3A 2GENA 3VVYA 3LSRA 2ID6A 2FX0A 5K7ZA 1BJZA 2ZCXA 3O60A 2VPRA 2X6OA 2HXOA 4JNNA 4M3DA 1RKWA 2G7LA 5FKLA 2G3BA 3NRGA 3B81A 5FKNA 3NNRA 3BNIA 3PPBA 3WHCA 2JK3A 3NI7A 3BR0A 5FGLA 2IAIA 3Q3SA 5J1UA 1VI0A 4JKZA 2QCOA 2X9DA 4PXIA 3F0CA 1QPIA 2XPVA 3QPSA 2Y2ZA 3BQZA 2Y31A 4AC6A 2GUHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IP6 A;  2VKV A;  2QOP A;  3QQA A;  5EZH A;  3MNL A;  3LWJ A;  4W97 A;  2FD5 A;  4ICH A;  3ZQH A;  2JJ7 A;  3IUV A;  3VVX A;  1Z77 A;  5FMP A;  5GPA A;  4GCK A;  3BR2 A;  2YVH A;  3CJD A;  3BR1 A;  3FK6 A;  3G7R A;  3BTL A;  3NPI A;  3KKC A;  2IEK A;  5H9T A;  3VP5 A;  5IOY A;  5K58 A;  4D7M A;  2HXI A;  4UDS A;  4D7N A;  4AC0 A;  2WGB A;  5GPC A;  4V2G A;  3TP3 A;  3QBM A;  5C4Y A;  2NP5 A;  3MVP A;  4ACI A;  2QKO A;  2W53 A;  3BR6 A;  5AQC A;  2QIB A;  5EYR A;  3EUP A;  2D6Y A;  3BTC A;  5EFY A;  1U9N A;  3FK7 A;  1QVT A;  2PZ9 A;  1Z0X A;  4MXM A;  3ON2 A;  3BTI A;  3VW2 A;  3C2B A;  2XRL A;  3VOX A;  2OI8 A;  3EGQ A;  3G1L A;  3LSP A;  2QTQ A;  2G7S A;  3BR3 A;  3LHQ A;  3ON4 A;  2QWT A;  4M3B A;  1JTY A;  5K7H A;  4CGR A;  3ANP A;  5J3L A;  2FJ1 A;  2DG7 A;  3VW0 A;  4I6Z A;  3HTI A;  5F0C A;  5J1R A;  3BT9 A;  4GFK A;  5D19 A;  3ZQG A;  3HIM A;  4W1U A;  5CW8 A;  4ME9 A;  1JT6 A;  5HBU A;  4G12 A;  4GCT A;  4NN1 A;  1ZKG A;  3SFI A;  1JTX A;  3G1O A;  3CCY A;  3P9T A;  3LSJ A;  2PBX A;  2UXI A;  2XGE A;  2ZCM A;  3F1B A;  4M3G A;  2ZOZ A;  2DTZ A;  3COL A;  2XPU A;  2XGC A;  2Q24 A;  3Q0V A;  3O8G A;  3B6A A;  3KNW A;  2O7T A;  2UXH A;  1T33 A;  3QPL A;  3ZQI A;  3VOK A;  1U9O A;  2XDN A;  5F04 A;  4MO7 A;  5K7F A;  3JSJ A;  5IOZ A;  3VIB A;  2WUI A;  5CXI A;  3GEU A;  3TP0 A;  4D5F A;  3RH2 A;  2I10 A;  2FBQ A;  4AF5 A;  3O8H A;  3E7Q A;  5IPA A;  3WHB A;  4XK4 A;  2RAS A;  3VPR A;  2UXO A;  1JT0 A;  5D18 A;  2G7G A;  2RHA A;  2ID3 A;  5FKO A;  3DEW A;  2IU5 A;  3Q0U A;  2TCT A;  2HKU A;  3BQY A;  2XB5 A;  3VW1 A;  2GFN A;  1UI6 A;  2TRT A;  2ZB9 A;  3IH4 A;  3S5R A;  5HSZ A;  3V78 A;  2V57 A;  5F0F A;  2RAE A;  4GCL A;  3HGY A;  2O7O A;  4I76 A;  3HTH A;  4L62 A;  3GZI A;  4V2F A;  5DAJ A;  2G0E A;  3BR5 A;  1RPW A;  4JYK A;  2IBD A;  5J1Y A;  2NX4 A;  3ZQF A;  3CWR A;  2REK A;  2HQ5 A;  1QVU A;  2DG8 A;  3AQT A;  1JUP A;  4GFL A;  3LJL A;  2XPW A;  2NS8 A;  4D5C A;  3T6N A;  5HAW A;  3ANG A;  3HTJ A;  3Q0W A;  5CXG A;  5FKK A;  1JUM A;  5FKM A;  1T56 A;  3KKD A;  1JUS A;  5F27 A;  4KWA A;  1UI5 A;  3VVZ A;  3BRU A;  3CRJ A;  4MK6 A;  3KZ9 A;  1RKT A;  2VKE A;  3G1M A;  2Y30 A;  5GP9 A;  2GBY A;  2UXP A;  4NEL A;  3IH3 A;  2NS7 A;  4ABZ A;  3RD3 A;  3VUQ A;  4HKU A;  1SGM A;  3BCG A;  2OPT A;  3PAS A;  3SDG A;  2OER A;  3FRQ A;  3G56 A;  3FIW A;  2UXU A;  2EH3 A;  4B3A A;  1A6I A;  3ZQL A;  3AQS A;  3CDL A;  5EZG A;  3LOC A;  2F07 A;  5F0H A;  5D1R A;  2YVE A;  2ZCN A;  5F08 A;  2HYT A;  2FQ4 A;  4M3F A;  4M3E A;  2XGD A;  2ZOY A;  3BTJ A;  2WV1 A;  4X1E A;  3QKX A;  3NXC A;  3B6C A;  3BJB A;  3C07 A;  3PM1 A;  5F1J A;  4B1R A;  3V6G A;  4DW6 A;  4AUX A;  3BHQ A;  5FHP A;  3HGG A;  2OF7 A;  3HTA A;  2HYJ A;  3DPJ A;  3DCF A;  1ORK A;  4JL3 A;  3IH2 A;  4YZE A;  3HE0 A;  1ZK8 A;  2NP3 A;  2GEN A;  3VVY A;  3LSR A;  2ID6 A;  2FX0 A;  5K7Z A;  1BJZ A;  2ZCX A;  3O60 A;  2VPR A;  2X6O A;  2HXO A;  4JNN A;  4M3D A;  1RKW A;  2G7L A;  5FKL A;  2G3B A;  3NRG A;  3B81 A;  5FKN A;  3NNR A;  3BNI A;  3PPB A;  3WHC A;  2JK3 A;  3NI7 A;  3BR0 A;  5FGL A;  2IAI A;  3Q3S A;  5J1U A;  1VI0 A;  4JKZ A;  2QCO A;  2X9D A;  4PXI A;  3F0C A;  1QPI A;  2XPV A;  3QPS A;  2Y2Z A;  3BQZ A;  2Y31 A;  4AC6 A;  2GUH A; 
#chains in the Genus database with same CATH topology
 5IP6 A;  2VKV A;  2QOP A;  3QQA A;  5EZH A;  3MNL A;  3LWJ A;  4W97 A;  2FD5 A;  4ICH A;  3ZQH A;  2JJ7 A;  3IUV A;  3VVX A;  1Z77 A;  2R7O A;  5FMP A;  5GPA A;  4GCK A;  3BR2 A;  2YVH A;  3CJD A;  3BR1 A;  3FK6 A;  3G7R A;  3BTL A;  3NPI A;  3KKC A;  2IEK A;  5H9T A;  3VP5 A;  5IOY A;  5K58 A;  4D7M A;  2HXI A;  2R7R A;  4UDS A;  4D7N A;  4AC0 A;  3K8P C;  2WGB A;  5GPC A;  4V2G A;  3TP3 A;  3QBM A;  5C4Y A;  2NP5 A;  3MVP A;  4ACI A;  4U9L A;  2QKO A;  2W53 A;  3BR6 A;  5AQC A;  2QIB A;  5EYR A;  3EUP A;  4OD4 A;  2D6Y A;  3BTC A;  5EFY A;  1U9N A;  3FK7 A;  3NS4 A;  1QVT A;  2PZ9 A;  1Z0X A;  4MXM A;  3ON2 A;  3BTI A;  3VW2 A;  3C2B A;  2XRL A;  3VOX A;  2OI8 A;  3EGQ A;  2YVX A;  3G1L A;  3LSP A;  2QTQ A;  2G7S A;  3BR3 A;  3LHQ A;  3ON4 A;  4OD5 A;  2QWT A;  4M3B A;  1JTY A;  5K7H A;  2R7Q A;  4CGR A;  3ANP A;  5J3L A;  2FJ1 A;  2DG7 A;  3VW0 A;  4I6Z A;  3HTI A;  5F0C A;  5J1R A;  3BT9 A;  4GFK A;  5D19 A;  3DU5 A;  3ZQG A;  3HIM A;  4W1U A;  5CW8 A;  2R7T A;  4ME9 A;  1JT6 A;  5HBU A;  4G12 A;  2B1E A;  4GCT A;  4NN1 A;  1ZKG A;  3SFI A;  1JTX A;  3G1O A;  3CCY A;  3DU6 A;  3P9T A;  4C2M A;  3LSJ A;  2PBX A;  2UXI A;  2XGE A;  2ZCM A;  3F1B A;  4M3G A;  2ZOZ A;  2DTZ A;  3COL A;  2XPU A;  2XGC A;  2Q24 A;  3Q0V A;  3O8G A;  3B6A A;  3KNW A;  2O7T A;  2UXH A;  1T33 A;  2PFV A;  3QPL A;  3ZQI A;  3VOK A;  1U9O A;  2XDN A;  5F04 A;  4MO7 A;  2R7V A;  5K7F A;  3JSJ A;  5IOZ A;  3VIB A;  2WUI A;  5CXI A;  3GEU A;  3TP0 A;  4D5F A;  3RH2 A;  2I10 A;  2FBQ A;  3KYL A;  4AF5 A;  3O8H A;  3E7Q A;  5IPA A;  3WHB A;  4XK4 A;  2RAS A;  3VPR A;  2UXO A;  1JT0 A;  3SWH A;  2R7U A;  5D18 A;  2G7G A;  2RHA A;  2ID3 A;  5FKO A;  3DEW A;  2IU5 A;  3Q0U A;  2TCT A;  2HKU A;  3BQY A;  2XB5 A;  3VW1 A;  2GFN A;  1UI6 A;  2TRT A;  2ZB9 A;  3IH4 A;  3S5R A;  5HSZ A;  3V78 A;  2V57 A;  5F0F A;  2RAE A;  4GCL A;  3HGY A;  2O7O A;  4I76 A;  3HTH A;  4L62 A;  3GZI A;  4V2F A;  5DAJ A;  2G0E A;  3BR5 A;  1RPW A;  4JYK A;  2IBD A;  5J1Y A;  2NX4 A;  3ZQF A;  3CWR A;  2REK A;  2HQ5 A;  1QVU A;  2DG8 A;  3AQT A;  1JUP A;  4GFL A;  3LJL A;  2XPW A;  2R7W A;  2NS8 A;  4D5C A;  3T6N A;  5HAW A;  3ANG A;  3HTJ A;  3Q0W A;  5CXG A;  5FKK A;  1JUM A;  5FKM A;  1T56 A;  3KKD A;  1JUS A;  5F27 A;  4KWA A;  1UI5 A;  3VVZ A;  3BRU A;  2FJI 1;  3CRJ A;  4MK6 A;  3KZ9 A;  1RKT A;  2VKE A;  3G1M A;  2Y30 A;  5GP9 A;  2GBY A;  2UXP A;  4IRV A;  4NEL A;  3IH3 A;  2R7X A;  2NS7 A;  4ABZ A;  3RD3 A;  3VUQ A;  4HKU A;  1SGM A;  3BCG A;  2OPT A;  3PAS A;  3SDG A;  2OER A;  3FRQ A;  2ZY9 A;  3G56 A;  3FIW A;  2UXU A;  2EH3 A;  4B3A A;  1A6I A;  3ZQL A;  3AQS A;  3CDL A;  5EZG A;  3LOC A;  2F07 A;  5F0H A;  5D1R A;  4DVY P;  2YVE A;  2ZCN A;  5F08 A;  2R7S A;  2HYT A;  2FQ4 A;  4M3F A;  4M3E A;  2XGD A;  2ZOY A;  3VTI A;  3BTJ A;  2WV1 A;  4X1E A;  3FHN A;  3QKX A;  3NXC A;  3B6C A;  3BJB A;  3C07 A;  3PM1 A;  5F1J A;  4B1R A;  2B3W A;  3V6G A;  4DW6 A;  4AUX A;  3BHQ A;  5FHP A;  3HGG A;  2OF7 A;  3HTA A;  2HYJ A;  3DPJ A;  3DCF A;  1ORK A;  4JL3 A;  3IH2 A;  4YZE A;  3HE0 A;  1ZK8 A;  2NP3 A;  2GEN A;  3VVY A;  5CQG A;  3LSR A;  2ID6 A;  2FX0 A;  5K7Z A;  1BJZ A;  2ZCX A;  3O60 A;  2VPR A;  2X6O A;  2HXO A;  4JNN A;  4M3D A;  1RKW A;  2G7L A;  5FKL A;  4WIB A;  2G3B A;  3NRG A;  3B81 A;  5FKN A;  3NNR A;  3BNI A;  2A2F X;  3PPB A;  4U9N A;  3WHC A;  2JK3 A;  3NI7 A;  3BR0 A;  5FGL A;  2IAI A;  3Q3S A;  5J1U A;  1VI0 A;  4JKZ A;  2QCO A;  2X9D A;  4PXI A;  3F0C A;  1QPI A;  2XPV A;  3QPS A;  2Y2Z A;  3BQZ A;  2Y31 A;  4AC6 A;  2GUH A; 
#chains in the Genus database with same CATH homology
 5IP6 A;  2VKV A;  2QOP A;  3QQA A;  5EZH A;  3MNL A;  3LWJ A;  4W97 A;  2FD5 A;  4ICH A;  3ZQH A;  2JJ7 A;  3IUV A;  3VVX A;  1Z77 A;  5FMP A;  5GPA A;  4GCK A;  3BR2 A;  2YVH A;  3CJD A;  3BR1 A;  3FK6 A;  3G7R A;  3BTL A;  3NPI A;  3KKC A;  2IEK A;  5H9T A;  3VP5 A;  5IOY A;  5K58 A;  4D7M A;  2HXI A;  4UDS A;  4D7N A;  4AC0 A;  2WGB A;  5GPC A;  4V2G A;  3TP3 A;  3QBM A;  5C4Y A;  2NP5 A;  3MVP A;  4ACI A;  2QKO A;  2W53 A;  3BR6 A;  5AQC A;  2QIB A;  5EYR A;  3EUP A;  2D6Y A;  3BTC A;  5EFY A;  1U9N A;  3FK7 A;  1QVT A;  2PZ9 A;  1Z0X A;  4MXM A;  3ON2 A;  3BTI A;  3VW2 A;  3C2B A;  2XRL A;  3VOX A;  2OI8 A;  3EGQ A;  3G1L A;  3LSP A;  2QTQ A;  2G7S A;  3BR3 A;  3LHQ A;  3ON4 A;  2QWT A;  4M3B A;  1JTY A;  5K7H A;  4CGR A;  3ANP A;  5J3L A;  2FJ1 A;  2DG7 A;  3VW0 A;  4I6Z A;  3HTI A;  5F0C A;  5J1R A;  3BT9 A;  4GFK A;  5D19 A;  3ZQG A;  3HIM A;  4W1U A;  5CW8 A;  4ME9 A;  1JT6 A;  5HBU A;  4G12 A;  4GCT A;  4NN1 A;  1ZKG A;  3SFI A;  1JTX A;  3G1O A;  3CCY A;  3P9T A;  3LSJ A;  2PBX A;  2UXI A;  2XGE A;  2ZCM A;  3F1B A;  4M3G A;  2ZOZ A;  2DTZ A;  3COL A;  2XPU A;  2XGC A;  2Q24 A;  3Q0V A;  3O8G A;  3B6A A;  3KNW A;  2O7T A;  2UXH A;  1T33 A;  3QPL A;  3ZQI A;  3VOK A;  1U9O A;  2XDN A;  5F04 A;  4MO7 A;  5K7F A;  3JSJ A;  5IOZ A;  3VIB A;  2WUI A;  5CXI A;  3GEU A;  3TP0 A;  4D5F A;  3RH2 A;  2I10 A;  2FBQ A;  4AF5 A;  3O8H A;  3E7Q A;  5IPA A;  3WHB A;  4XK4 A;  2RAS A;  3VPR A;  2UXO A;  1JT0 A;  5D18 A;  2G7G A;  2RHA A;  2ID3 A;  5FKO A;  3DEW A;  2IU5 A;  3Q0U A;  2TCT A;  2HKU A;  3BQY A;  2XB5 A;  3VW1 A;  2GFN A;  1UI6 A;  2TRT A;  2ZB9 A;  3IH4 A;  3S5R A;  5HSZ A;  3V78 A;  2V57 A;  5F0F A;  2RAE A;  4GCL A;  3HGY A;  2O7O A;  4I76 A;  3HTH A;  4L62 A;  3GZI A;  4V2F A;  5DAJ A;  2G0E A;  3BR5 A;  1RPW A;  4JYK A;  2IBD A;  5J1Y A;  2NX4 A;  3ZQF A;  3CWR A;  2REK A;  2HQ5 A;  1QVU A;  2DG8 A;  3AQT A;  1JUP A;  4GFL A;  3LJL A;  2XPW A;  2NS8 A;  4D5C A;  3T6N A;  5HAW A;  3ANG A;  3HTJ A;  3Q0W A;  5CXG A;  5FKK A;  1JUM A;  5FKM A;  1T56 A;  3KKD A;  1JUS A;  5F27 A;  4KWA A;  1UI5 A;  3VVZ A;  3BRU A;  3CRJ A;  4MK6 A;  3KZ9 A;  1RKT A;  2VKE A;  3G1M A;  2Y30 A;  5GP9 A;  2GBY A;  2UXP A;  4NEL A;  3IH3 A;  2NS7 A;  4ABZ A;  3RD3 A;  3VUQ A;  4HKU A;  1SGM A;  3BCG A;  2OPT A;  3PAS A;  3SDG A;  2OER A;  3FRQ A;  3G56 A;  3FIW A;  2UXU A;  2EH3 A;  4B3A A;  1A6I A;  3ZQL A;  3AQS A;  3CDL A;  5EZG A;  3LOC A;  2F07 A;  5F0H A;  5D1R A;  2YVE A;  2ZCN A;  5F08 A;  2HYT A;  2FQ4 A;  4M3F A;  4M3E A;  2XGD A;  2ZOY A;  3BTJ A;  2WV1 A;  4X1E A;  3QKX A;  3NXC A;  3B6C A;  3BJB A;  3C07 A;  3PM1 A;  5F1J A;  4B1R A;  3V6G A;  4DW6 A;  4AUX A;  3BHQ A;  5FHP A;  3HGG A;  2OF7 A;  3HTA A;  2HYJ A;  3DPJ A;  3DCF A;  1ORK A;  4JL3 A;  3IH2 A;  4YZE A;  3HE0 A;  1ZK8 A;  2NP3 A;  2GEN A;  3VVY A;  3LSR A;  2ID6 A;  2FX0 A;  5K7Z A;  1BJZ A;  2ZCX A;  3O60 A;  2VPR A;  2X6O A;  2HXO A;  4JNN A;  4M3D A;  1RKW A;  2G7L A;  5FKL A;  2G3B A;  3NRG A;  3B81 A;  5FKN A;  3NNR A;  3BNI A;  3PPB A;  3WHC A;  2JK3 A;  3NI7 A;  3BR0 A;  5FGL A;  2IAI A;  3Q3S A;  5J1U A;  1VI0 A;  4JKZ A;  2QCO A;  2X9D A;  4PXI A;  3F0C A;  1QPI A;  2XPV A;  3QPS A;  2Y2Z A;  3BQZ A;  2Y31 A;  4AC6 A;  2GUH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...