2NP3A

Crystal structure of tetr-family regulator (sco0857) from streptomyces coelicolor a3.
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
176
structure length
142
Chain Sequence
ILTAARVCFYGTKENLFLQALELPGKIEEAITAAAQGGLDGIGERVVRAHLSVWDDVSSRPALMTMVRSAARLRETATGILARALGGVITGEDAMLRTSMVATQLVGLAMMRYVAHLEPLASADTDTVARHYGRAVQAIVTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative TetR-family regulator
publication title Crystal structure of TetR-family regulator (SCO0857) from Streptomyces coelicolor A3.
rcsb
source organism Streptomyces coelicolor
molecule tags Transcription
total genus 47
structure length 142
sequence length 176
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17920 TetR_C_16 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2np3A00
4M3FA 4GFLA 3BR2A 3Q0WA 3P9TA 3BR3A 5D18A 4L62A 5CXIA 4XK4A 3IUVA 5K7ZA 5HSZA 3KZ9A 5CXGA 5FKMA 2Q24A 5D1RA 2ZCNA 5J1RA 3WHBA 4NELA 2HQ5A 3BQZA 5F27A 2W53A 3VVYA 2ZB9A 2ZCXA 3AQTA 2NS7A 2GBYA 4MXMA 2IEKA 1ZK8A 4MK6A 4B1RA 2JJ7A 2RASA 5FKKA 4JL3A 2F07A 3FIWA 3ZQLA 3CRJA 3IH4A 3ON2A 2V57A 4G12A 2FD5A 3CWRA 2G7LA 4D5CA 3CDLA 3TP0A 3S5RA 2EH3A 3O8GA 1QVTA 2DG8A 3VVZA 3ZQHA 3LSJA 2GUHA 3VUQA 5FGLA 2O7TA 4GCLA 2RHAA 4W97A 2HYTA 5EFYA 3KKDA 3VOXA 3DCFA 5C4YA 3PM1A 3VW0A 3TP3A 2ID3A 2G3BA 3O8HA 2NP3A 3QPLA 2ZOZA 2QTQA 3FRQA 1UI6A 1RKWA 2HYJA 4M3GA 4YZEA 5F0FA 1QPIA 4D7MA 5CW8A 3VW1A 5F1JA 3ANGA 4AF5A 3HTJA 4V2GA 1BJZA 4GFKA 3EGQA 1Z77A 2XGCA 2XGEA 2DTZA 4HKUA 2WGBA 2UXIA 4B3AA 3GZIA 4D7NA 3ZQFA 3GEUA 3NRGA 2XPUA 3G7RA 5K58A 3JSJA 4ACIA 1JUMA 1SGMA 2Y2ZA 2FBQA 5IP6A 3LSPA 4ICHA 2ID6A 3LWJA 2XGDA 2X6OA 3C07A 3QBMA 4ABZA 3RD3A 3PASA 3HE0A 3Q3SA 1JT0A 4DW6A 3COLA 3NPIA 3SFIA 2X9DA 4W1UA 2IBDA 5J1UA 1T56A 5AQCA 5F04A 3ZQGA 2G0EA 1VI0A 4PXIA 3F0CA 4MO7A 3HIMA 3O60A 1ZKGA 3RH2A 4GCTA 1JT6A 3AQSA 2OF7A 3KKCA 4NN1A 1U9NA 5IOYA 3BJBA 5DAJA 2IAIA 2UXOA 2NS8A 2FX0A 3BCGA 3VW2A 2I10A 5H9TA 3NI7A 2FJ1A 3BHQA 2DG7A 3DPJA 2HXOA 4I6ZA 3PPBA 2IU5A 3BTJA 2NP5A 4M3EA 2ZOYA 3V6GA 1JUSA 3G1LA 5GPCA 2GFNA 3HGGA 2JK3A 3MNLA 5IPAA 3HTHA 2G7SA 3QPSA 2PBXA 5EZGA 3ANPA 3Q0VA 3BNIA 2QWTA 3F1BA 4AC0A 2QKOA 3CJDA 4KWAA 5FMPA 3BQYA 3IH2A 2YVEA 3VOKA 2VKVA 3BRUA 3VPRA 2WUIA 4GCKA 5F08A 4AC6A 2GENA 2TRTA 2XPWA 3MVPA 2HKUA 4JNNA 1ORKA 2D6YA 4D5FA 3BTLA 4M3BA 5HAWA 1Z0XA 2OI8A 2XPVA 3QQAA 3DEWA 5HBUA 2WV1A 3NNRA 5FHPA 3HTIA 2G7GA 2QCOA 4JKZA 3SDGA 2HXIA 4UDSA 3BR0A 5K7HA 5GPAA 1UI5A 3T6NA 1U9OA 2REKA 2UXPA 4M3DA 2FQ4A 3HGYA 5D19A 3HTAA 3VP5A 2TCTA 5F0HA 3E7QA 3G1MA 4ME9A 5F0CA 3BR1A 5EZHA 3VVXA 2UXHA 2VPRA 2OPTA 3LJLA 2XRLA 3B81A 2QOPA 3BR5A 3FK6A 4JYKA 3LSRA 3KNWA 2QIBA 3EUPA 3QKXA 5FKLA 2XB5A 2UXUA 3B6AA 1A6IA 5IOZA 2RAEA 3VIBA 1RKTA 2NX4A 3BTIA 5K7FA 3LOCA 2YVHA 3LHQA 5GP9A 1RPWA 3C2BA 2Y31A 3G1OA 2XDNA 4AUXA 2VKEA 1T33A 3ON4A 3V78A 3FK7A 2PZ9A 4I76A 5FKOA 2Y30A 5FKNA 3BTCA 3BT9A 3B6CA 3IH3A 2O7OA 1JTYA 5J1YA 2OERA 2ZCMA 4V2FA 3WHCA 3G56A 4CGRA 1JTXA 3BR6A 3NXCA 1JUPA 5EYRA 3CCYA 3Q0UA 5J3LA 3ZQIA 1QVUA 4X1EA
chains in the Genus database with same CATH superfamily
4M3FA 4GFLA 3BR2A 3Q0WA 3P9TA 3BR3A 5D18A 4L62A 5CXIA 4XK4A 3IUVA 5K7ZA 5HSZA 3KZ9A 5CXGA 5FKMA 2Q24A 5D1RA 2ZCNA 5J1RA 3WHBA 4NELA 2HQ5A 3BQZA 5F27A 2R7WA 3VTIA 2W53A 3VVYA 2ZB9A 2ZCXA 3AQTA 2NS7A 2GBYA 4MXMA 2IEKA 1ZK8A 4MK6A 5CQGA 4B1RA 2JJ7A 2RASA 5FKKA 4JL3A 2F07A 3FIWA 3ZQLA 3CRJA 3IH4A 3ON2A 2V57A 4G12A 2FD5A 3NS4A 3CWRA 2G7LA 4D5CA 3CDLA 4DVYP 3TP0A 3S5RA 2EH3A 3O8GA 1QVTA 2DG8A 3VVZA 3ZQHA 2FJI1 3LSJA 2GUHA 3VUQA 5FGLA 2O7TA 4GCLA 2RHAA 4W97A 2HYTA 5EFYA 3KKDA 3DCFA 3VOXA 5C4YA 3PM1A 3VW0A 3TP3A 2ID3A 2G3BA 3O8HA 2NP3A 2B1EA 3QPLA 2ZOZA 2QTQA 3FRQA 1UI6A 1RKWA 2HYJA 3KYLA 4M3GA 4YZEA 5F0FA 1QPIA 4D7MA 5CW8A 3VW1A 5F1JA 3ANGA 4AF5A 3HTJA 4V2GA 1BJZA 4GFKA 3EGQA 1Z77A 2XGCA 2XGEA 2DTZA 4HKUA 2WGBA 3FHNA 2UXIA 4B3AA 3GZIA 4D7NA 3ZQFA 3GEUA 3NRGA 2XPUA 3G7RA 5K58A 3JSJA 4ACIA 1JUMA 1SGMA 2Y2ZA 2FBQA 5IP6A 3LSPA 4ICHA 2PFVA 2ID6A 3LWJA 2XGDA 2X6OA 3C07A 3QBMA 4ABZA 3RD3A 3PASA 3HE0A 3Q3SA 1JT0A 4DW6A 2B3WA 3COLA 3NPIA 3SFIA 4OD4A 2X9DA 4W1UA 2ZY9A 4WIBA 2R7RA 2IBDA 5J1UA 1T56A 5AQCA 5F04A 3ZQGA 4OD5A 2G0EA 1VI0A 2R7XA 4PXIA 3F0CA 4MO7A 3HIMA 3O60A 1ZKGA 3RH2A 4GCTA 1JT6A 3AQSA 2OF7A 3KKCA 4NN1A 1U9NA 5IOYA 3BJBA 5DAJA 2IAIA 2UXOA 2NS8A 2R7OA 2FX0A 3BCGA 3VW2A 2I10A 5H9TA 3NI7A 2FJ1A 3BHQA 2DG7A 3DPJA 2HXOA 4I6ZA 3PPBA 2IU5A 3BTJA 2A2FX 2NP5A 4M3EA 2YVXA 2ZOYA 3V6GA 1JUSA 3G1LA 5GPCA 2GFNA 3HGGA 2JK3A 3MNLA 5IPAA 4C2MA 3HTHA 2G7SA 3QPSA 2PBXA 5EZGA 3ANPA 3Q0VA 3BNIA 2QWTA 3F1BA 4AC0A 2QKOA 3CJDA 4KWAA 5FMPA 3BQYA 3IH2A 4U9LA 2YVEA 3VOKA 2VKVA 3BRUA 3VPRA 2R7SA 2WUIA 4GCKA 5F08A 4AC6A 3K8PC 2GENA 2TRTA 3DU5A 2XPWA 3MVPA 2HKUA 4JNNA 1ORKA 2D6YA 4D5FA 3BTLA 4U9NA 4M3BA 5HAWA 1Z0XA 2OI8A 2XPVA 3QQAA 3DEWA 5HBUA 2WV1A 3NNRA 5FHPA 3HTIA 3DU6A 2G7GA 2QCOA 4JKZA 3SDGA 2HXIA 4UDSA 3BR0A 5K7HA 5GPAA 1UI5A 2R7TA 3T6NA 1U9OA 2REKA 2UXPA 4M3DA 2FQ4A 3HGYA 5D19A 3HTAA 3VP5A 2TCTA 5F0HA 3E7QA 3G1MA 4ME9A 5F0CA 3BR1A 5EZHA 3VVXA 2UXHA 2VPRA 2OPTA 3LJLA 2XRLA 3B81A 2QOPA 3BR5A 3FK6A 4JYKA 3LSRA 3KNWA 2QIBA 3EUPA 3QKXA 5FKLA 2XB5A 2UXUA 3B6AA 1A6IA 5IOZA 2RAEA 3VIBA 1RKTA 2NX4A 3BTIA 5K7FA 3LOCA 2YVHA 2R7VA 3LHQA 5GP9A 1RPWA 3C2BA 2Y31A 3G1OA 2XDNA 4AUXA 2VKEA 1T33A 3ON4A 3V78A 3FK7A 2PZ9A 4I76A 5FKOA 2Y30A 5FKNA 3BTCA 3BT9A 3SWHA 3B6CA 2R7UA 3IH3A 2O7OA 1JTYA 5J1YA 2OERA 2ZCMA 4V2FA 3WHCA 3G56A 4CGRA 1JTXA 3BR6A 3NXCA 1JUPA 5EYRA 2R7QA 3CCYA 3Q0UA 4IRVA 5J3LA 3ZQIA 1QVUA 4X1EA
chains in the Genus database with same CATH topology
4M3FA 4GFLA 3BR2A 3Q0WA 3P9TA 3BR3A 5D18A 4L62A 5CXIA 4XK4A 3IUVA 5K7ZA 5HSZA 3KZ9A 5CXGA 5FKMA 2Q24A 5D1RA 2ZCNA 5J1RA 3WHBA 4NELA 2HQ5A 3BQZA 5F27A 2W53A 3VVYA 2ZB9A 2ZCXA 3AQTA 2NS7A 2GBYA 4MXMA 2IEKA 1ZK8A 4MK6A 4B1RA 2JJ7A 2RASA 5FKKA 4JL3A 2F07A 3FIWA 3ZQLA 3CRJA 3IH4A 3ON2A 2V57A 4G12A 2FD5A 3CWRA 2G7LA 4D5CA 3CDLA 3TP0A 3S5RA 2EH3A 3O8GA 1QVTA 2DG8A 3VVZA 3ZQHA 3LSJA 2GUHA 3VUQA 5FGLA 2O7TA 4GCLA 2RHAA 4W97A 2HYTA 5EFYA 3KKDA 3VOXA 3DCFA 5C4YA 3PM1A 3VW0A 3TP3A 2ID3A 2G3BA 3O8HA 2NP3A 3QPLA 2ZOZA 2QTQA 3FRQA 1UI6A 1RKWA 2HYJA 4M3GA 4YZEA 5F0FA 1QPIA 4D7MA 5CW8A 3VW1A 5F1JA 3ANGA 4AF5A 3HTJA 4V2GA 1BJZA 4GFKA 3EGQA 1Z77A 2XGCA 2XGEA 2DTZA 4HKUA 2WGBA 2UXIA 4B3AA 3GZIA 4D7NA 3ZQFA 3GEUA 3NRGA 2XPUA 3G7RA 5K58A 3JSJA 4ACIA 1JUMA 1SGMA 2Y2ZA 2FBQA 5IP6A 3LSPA 4ICHA 2ID6A 3LWJA 2XGDA 2X6OA 3C07A 3QBMA 4ABZA 3RD3A 3PASA 3HE0A 3Q3SA 1JT0A 4DW6A 3COLA 3NPIA 3SFIA 2X9DA 4W1UA 2IBDA 5J1UA 1T56A 5AQCA 5F04A 3ZQGA 2G0EA 1VI0A 4PXIA 3F0CA 4MO7A 3HIMA 3O60A 1ZKGA 3RH2A 4GCTA 1JT6A 3AQSA 2OF7A 3KKCA 4NN1A 1U9NA 5IOYA 3BJBA 5DAJA 2IAIA 2UXOA 2NS8A 2FX0A 3BCGA 3VW2A 2I10A 5H9TA 3NI7A 2FJ1A 3BHQA 2DG7A 3DPJA 2HXOA 4I6ZA 3PPBA 2IU5A 3BTJA 2NP5A 4M3EA 2ZOYA 3V6GA 1JUSA 3G1LA 5GPCA 2GFNA 3HGGA 2JK3A 3MNLA 5IPAA 3HTHA 2G7SA 3QPSA 2PBXA 5EZGA 3ANPA 3Q0VA 3BNIA 2QWTA 3F1BA 4AC0A 2QKOA 3CJDA 4KWAA 5FMPA 3BQYA 3IH2A 2YVEA 3VOKA 2VKVA 3BRUA 3VPRA 2WUIA 4GCKA 5F08A 4AC6A 2GENA 2TRTA 2XPWA 3MVPA 2HKUA 4JNNA 1ORKA 2D6YA 4D5FA 3BTLA 4M3BA 5HAWA 1Z0XA 2OI8A 2XPVA 3QQAA 3DEWA 5HBUA 2WV1A 3NNRA 5FHPA 3HTIA 2G7GA 2QCOA 4JKZA 3SDGA 2HXIA 4UDSA 3BR0A 5K7HA 5GPAA 1UI5A 3T6NA 1U9OA 2REKA 2UXPA 4M3DA 2FQ4A 3HGYA 5D19A 3HTAA 3VP5A 2TCTA 5F0HA 3E7QA 3G1MA 4ME9A 5F0CA 3BR1A 5EZHA 3VVXA 2UXHA 2VPRA 2OPTA 3LJLA 2XRLA 3B81A 2QOPA 3BR5A 3FK6A 4JYKA 3LSRA 3KNWA 2QIBA 3EUPA 3QKXA 5FKLA 2XB5A 2UXUA 3B6AA 1A6IA 5IOZA 2RAEA 3VIBA 1RKTA 2NX4A 3BTIA 5K7FA 3LOCA 2YVHA 3LHQA 5GP9A 1RPWA 3C2BA 2Y31A 3G1OA 2XDNA 4AUXA 2VKEA 1T33A 3ON4A 3V78A 3FK7A 2PZ9A 4I76A 5FKOA 2Y30A 5FKNA 3BTCA 3BT9A 3B6CA 3IH3A 2O7OA 1JTYA 5J1YA 2OERA 2ZCMA 4V2FA 3WHCA 3G56A 4CGRA 1JTXA 3BR6A 3NXCA 1JUPA 5EYRA 3CCYA 3Q0UA 5J3LA 3ZQIA 1QVUA 4X1EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M3F A;  4GFL A;  3BR2 A;  3Q0W A;  3P9T A;  3BR3 A;  5D18 A;  4L62 A;  5CXI A;  4XK4 A;  3IUV A;  5K7Z A;  5HSZ A;  3KZ9 A;  5CXG A;  5FKM A;  2Q24 A;  5D1R A;  2ZCN A;  5J1R A;  3WHB A;  4NEL A;  2HQ5 A;  3BQZ A;  5F27 A;  2W53 A;  3VVY A;  2ZB9 A;  2ZCX A;  3AQT A;  2NS7 A;  2GBY A;  4MXM A;  2IEK A;  1ZK8 A;  4MK6 A;  4B1R A;  2JJ7 A;  2RAS A;  5FKK A;  4JL3 A;  2F07 A;  3FIW A;  3ZQL A;  3CRJ A;  3IH4 A;  3ON2 A;  2V57 A;  4G12 A;  2FD5 A;  3CWR A;  2G7L A;  4D5C A;  3CDL A;  3TP0 A;  3S5R A;  2EH3 A;  3O8G A;  1QVT A;  2DG8 A;  3VVZ A;  3ZQH A;  3LSJ A;  2GUH A;  3VUQ A;  5FGL A;  2O7T A;  4GCL A;  2RHA A;  4W97 A;  2HYT A;  5EFY A;  3KKD A;  3VOX A;  3DCF A;  5C4Y A;  3PM1 A;  3VW0 A;  3TP3 A;  2ID3 A;  2G3B A;  3O8H A;  2NP3 A;  3QPL A;  2ZOZ A;  2QTQ A;  3FRQ A;  1UI6 A;  1RKW A;  2HYJ A;  4M3G A;  4YZE A;  5F0F A;  1QPI A;  4D7M A;  5CW8 A;  3VW1 A;  5F1J A;  3ANG A;  4AF5 A;  3HTJ A;  4V2G A;  1BJZ A;  4GFK A;  3EGQ A;  1Z77 A;  2XGC A;  2XGE A;  2DTZ A;  4HKU A;  2WGB A;  2UXI A;  4B3A A;  3GZI A;  4D7N A;  3ZQF A;  3GEU A;  3NRG A;  2XPU A;  3G7R A;  5K58 A;  3JSJ A;  4ACI A;  1JUM A;  1SGM A;  2Y2Z A;  2FBQ A;  5IP6 A;  3LSP A;  4ICH A;  2ID6 A;  3LWJ A;  2XGD A;  2X6O A;  3C07 A;  3QBM A;  4ABZ A;  3RD3 A;  3PAS A;  3HE0 A;  3Q3S A;  1JT0 A;  4DW6 A;  3COL A;  3NPI A;  3SFI A;  2X9D A;  4W1U A;  2IBD A;  5J1U A;  1T56 A;  5AQC A;  5F04 A;  3ZQG A;  2G0E A;  1VI0 A;  4PXI A;  3F0C A;  4MO7 A;  3HIM A;  3O60 A;  1ZKG A;  3RH2 A;  4GCT A;  1JT6 A;  3AQS A;  2OF7 A;  3KKC A;  4NN1 A;  1U9N A;  5IOY A;  3BJB A;  5DAJ A;  2IAI A;  2UXO A;  2NS8 A;  2FX0 A;  3BCG A;  3VW2 A;  2I10 A;  5H9T A;  3NI7 A;  2FJ1 A;  3BHQ A;  2DG7 A;  3DPJ A;  2HXO A;  4I6Z A;  3PPB A;  2IU5 A;  3BTJ A;  2NP5 A;  4M3E A;  2ZOY A;  3V6G A;  1JUS A;  3G1L A;  5GPC A;  2GFN A;  3HGG A;  2JK3 A;  3MNL A;  5IPA A;  3HTH A;  2G7S A;  3QPS A;  2PBX A;  5EZG A;  3ANP A;  3Q0V A;  3BNI A;  2QWT A;  3F1B A;  4AC0 A;  2QKO A;  3CJD A;  4KWA A;  5FMP A;  3BQY A;  3IH2 A;  2YVE A;  3VOK A;  2VKV A;  3BRU A;  3VPR A;  2WUI A;  4GCK A;  5F08 A;  4AC6 A;  2GEN A;  2TRT A;  2XPW A;  3MVP A;  2HKU A;  4JNN A;  1ORK A;  2D6Y A;  4D5F A;  3BTL A;  4M3B A;  5HAW A;  1Z0X A;  2OI8 A;  2XPV A;  3QQA A;  3DEW A;  5HBU A;  2WV1 A;  3NNR A;  5FHP A;  3HTI A;  2G7G A;  2QCO A;  4JKZ A;  3SDG A;  2HXI A;  4UDS A;  3BR0 A;  5K7H A;  5GPA A;  1UI5 A;  3T6N A;  1U9O A;  2REK A;  2UXP A;  4M3D A;  2FQ4 A;  3HGY A;  5D19 A;  3HTA A;  3VP5 A;  2TCT A;  5F0H A;  3E7Q A;  3G1M A;  4ME9 A;  5F0C A;  3BR1 A;  5EZH A;  3VVX A;  2UXH A;  2VPR A;  2OPT A;  3LJL A;  2XRL A;  3B81 A;  2QOP A;  3BR5 A;  3FK6 A;  4JYK A;  3LSR A;  3KNW A;  2QIB A;  3EUP A;  3QKX A;  5FKL A;  2XB5 A;  2UXU A;  3B6A A;  1A6I A;  5IOZ A;  2RAE A;  3VIB A;  1RKT A;  2NX4 A;  3BTI A;  5K7F A;  3LOC A;  2YVH A;  3LHQ A;  5GP9 A;  1RPW A;  3C2B A;  2Y31 A;  3G1O A;  2XDN A;  4AUX A;  2VKE A;  1T33 A;  3ON4 A;  3V78 A;  3FK7 A;  2PZ9 A;  4I76 A;  5FKO A;  2Y30 A;  5FKN A;  3BTC A;  3BT9 A;  3B6C A;  3IH3 A;  2O7O A;  1JTY A;  5J1Y A;  2OER A;  2ZCM A;  4V2F A;  3WHC A;  3G56 A;  4CGR A;  1JTX A;  3BR6 A;  3NXC A;  1JUP A;  5EYR A;  3CCY A;  3Q0U A;  5J3L A;  3ZQI A;  1QVU A;  4X1E A; 
#chains in the Genus database with same CATH topology
 4M3F A;  4GFL A;  3BR2 A;  3Q0W A;  3P9T A;  3BR3 A;  5D18 A;  4L62 A;  5CXI A;  4XK4 A;  3IUV A;  5K7Z A;  5HSZ A;  3KZ9 A;  5CXG A;  5FKM A;  2Q24 A;  5D1R A;  2ZCN A;  5J1R A;  3WHB A;  4NEL A;  2HQ5 A;  3BQZ A;  5F27 A;  2R7W A;  3VTI A;  2W53 A;  3VVY A;  2ZB9 A;  2ZCX A;  3AQT A;  2NS7 A;  2GBY A;  4MXM A;  2IEK A;  1ZK8 A;  4MK6 A;  5CQG A;  4B1R A;  2JJ7 A;  2RAS A;  5FKK A;  4JL3 A;  2F07 A;  3FIW A;  3ZQL A;  3CRJ A;  3IH4 A;  3ON2 A;  2V57 A;  4G12 A;  2FD5 A;  3NS4 A;  3CWR A;  2G7L A;  4D5C A;  3CDL A;  4DVY P;  3TP0 A;  3S5R A;  2EH3 A;  3O8G A;  1QVT A;  2DG8 A;  3VVZ A;  3ZQH A;  2FJI 1;  3LSJ A;  2GUH A;  3VUQ A;  5FGL A;  2O7T A;  4GCL A;  2RHA A;  4W97 A;  2HYT A;  5EFY A;  3KKD A;  3DCF A;  3VOX A;  5C4Y A;  3PM1 A;  3VW0 A;  3TP3 A;  2ID3 A;  2G3B A;  3O8H A;  2NP3 A;  2B1E A;  3QPL A;  2ZOZ A;  2QTQ A;  3FRQ A;  1UI6 A;  1RKW A;  2HYJ A;  3KYL A;  4M3G A;  4YZE A;  5F0F A;  1QPI A;  4D7M A;  5CW8 A;  3VW1 A;  5F1J A;  3ANG A;  4AF5 A;  3HTJ A;  4V2G A;  1BJZ A;  4GFK A;  3EGQ A;  1Z77 A;  2XGC A;  2XGE A;  2DTZ A;  4HKU A;  2WGB A;  3FHN A;  2UXI A;  4B3A A;  3GZI A;  4D7N A;  3ZQF A;  3GEU A;  3NRG A;  2XPU A;  3G7R A;  5K58 A;  3JSJ A;  4ACI A;  1JUM A;  1SGM A;  2Y2Z A;  2FBQ A;  5IP6 A;  3LSP A;  4ICH A;  2PFV A;  2ID6 A;  3LWJ A;  2XGD A;  2X6O A;  3C07 A;  3QBM A;  4ABZ A;  3RD3 A;  3PAS A;  3HE0 A;  3Q3S A;  1JT0 A;  4DW6 A;  2B3W A;  3COL A;  3NPI A;  3SFI A;  4OD4 A;  2X9D A;  4W1U A;  2ZY9 A;  4WIB A;  2R7R A;  2IBD A;  5J1U A;  1T56 A;  5AQC A;  5F04 A;  3ZQG A;  4OD5 A;  2G0E A;  1VI0 A;  2R7X A;  4PXI A;  3F0C A;  4MO7 A;  3HIM A;  3O60 A;  1ZKG A;  3RH2 A;  4GCT A;  1JT6 A;  3AQS A;  2OF7 A;  3KKC A;  4NN1 A;  1U9N A;  5IOY A;  3BJB A;  5DAJ A;  2IAI A;  2UXO A;  2NS8 A;  2R7O A;  2FX0 A;  3BCG A;  3VW2 A;  2I10 A;  5H9T A;  3NI7 A;  2FJ1 A;  3BHQ A;  2DG7 A;  3DPJ A;  2HXO A;  4I6Z A;  3PPB A;  2IU5 A;  3BTJ A;  2A2F X;  2NP5 A;  4M3E A;  2YVX A;  2ZOY A;  3V6G A;  1JUS A;  3G1L A;  5GPC A;  2GFN A;  3HGG A;  2JK3 A;  3MNL A;  5IPA A;  4C2M A;  3HTH A;  2G7S A;  3QPS A;  2PBX A;  5EZG A;  3ANP A;  3Q0V A;  3BNI A;  2QWT A;  3F1B A;  4AC0 A;  2QKO A;  3CJD A;  4KWA A;  5FMP A;  3BQY A;  3IH2 A;  4U9L A;  2YVE A;  3VOK A;  2VKV A;  3BRU A;  3VPR A;  2R7S A;  2WUI A;  4GCK A;  5F08 A;  4AC6 A;  3K8P C;  2GEN A;  2TRT A;  3DU5 A;  2XPW A;  3MVP A;  2HKU A;  4JNN A;  1ORK A;  2D6Y A;  4D5F A;  3BTL A;  4U9N A;  4M3B A;  5HAW A;  1Z0X A;  2OI8 A;  2XPV A;  3QQA A;  3DEW A;  5HBU A;  2WV1 A;  3NNR A;  5FHP A;  3HTI A;  3DU6 A;  2G7G A;  2QCO A;  4JKZ A;  3SDG A;  2HXI A;  4UDS A;  3BR0 A;  5K7H A;  5GPA A;  1UI5 A;  2R7T A;  3T6N A;  1U9O A;  2REK A;  2UXP A;  4M3D A;  2FQ4 A;  3HGY A;  5D19 A;  3HTA A;  3VP5 A;  2TCT A;  5F0H A;  3E7Q A;  3G1M A;  4ME9 A;  5F0C A;  3BR1 A;  5EZH A;  3VVX A;  2UXH A;  2VPR A;  2OPT A;  3LJL A;  2XRL A;  3B81 A;  2QOP A;  3BR5 A;  3FK6 A;  4JYK A;  3LSR A;  3KNW A;  2QIB A;  3EUP A;  3QKX A;  5FKL A;  2XB5 A;  2UXU A;  3B6A A;  1A6I A;  5IOZ A;  2RAE A;  3VIB A;  1RKT A;  2NX4 A;  3BTI A;  5K7F A;  3LOC A;  2YVH A;  2R7V A;  3LHQ A;  5GP9 A;  1RPW A;  3C2B A;  2Y31 A;  3G1O A;  2XDN A;  4AUX A;  2VKE A;  1T33 A;  3ON4 A;  3V78 A;  3FK7 A;  2PZ9 A;  4I76 A;  5FKO A;  2Y30 A;  5FKN A;  3BTC A;  3BT9 A;  3SWH A;  3B6C A;  2R7U A;  3IH3 A;  2O7O A;  1JTY A;  5J1Y A;  2OER A;  2ZCM A;  4V2F A;  3WHC A;  3G56 A;  4CGR A;  1JTX A;  3BR6 A;  3NXC A;  1JUP A;  5EYR A;  2R7Q A;  3CCY A;  3Q0U A;  4IRV A;  5J3L A;  3ZQI A;  1QVU A;  4X1E A; 
#chains in the Genus database with same CATH homology
 4M3F A;  4GFL A;  3BR2 A;  3Q0W A;  3P9T A;  3BR3 A;  5D18 A;  4L62 A;  5CXI A;  4XK4 A;  3IUV A;  5K7Z A;  5HSZ A;  3KZ9 A;  5CXG A;  5FKM A;  2Q24 A;  5D1R A;  2ZCN A;  5J1R A;  3WHB A;  4NEL A;  2HQ5 A;  3BQZ A;  5F27 A;  2W53 A;  3VVY A;  2ZB9 A;  2ZCX A;  3AQT A;  2NS7 A;  2GBY A;  4MXM A;  2IEK A;  1ZK8 A;  4MK6 A;  4B1R A;  2JJ7 A;  2RAS A;  5FKK A;  4JL3 A;  2F07 A;  3FIW A;  3ZQL A;  3CRJ A;  3IH4 A;  3ON2 A;  2V57 A;  4G12 A;  2FD5 A;  3CWR A;  2G7L A;  4D5C A;  3CDL A;  3TP0 A;  3S5R A;  2EH3 A;  3O8G A;  1QVT A;  2DG8 A;  3VVZ A;  3ZQH A;  3LSJ A;  2GUH A;  3VUQ A;  5FGL A;  2O7T A;  4GCL A;  2RHA A;  4W97 A;  2HYT A;  5EFY A;  3KKD A;  3VOX A;  3DCF A;  5C4Y A;  3PM1 A;  3VW0 A;  3TP3 A;  2ID3 A;  2G3B A;  3O8H A;  2NP3 A;  3QPL A;  2ZOZ A;  2QTQ A;  3FRQ A;  1UI6 A;  1RKW A;  2HYJ A;  4M3G A;  4YZE A;  5F0F A;  1QPI A;  4D7M A;  5CW8 A;  3VW1 A;  5F1J A;  3ANG A;  4AF5 A;  3HTJ A;  4V2G A;  1BJZ A;  4GFK A;  3EGQ A;  1Z77 A;  2XGC A;  2XGE A;  2DTZ A;  4HKU A;  2WGB A;  2UXI A;  4B3A A;  3GZI A;  4D7N A;  3ZQF A;  3GEU A;  3NRG A;  2XPU A;  3G7R A;  5K58 A;  3JSJ A;  4ACI A;  1JUM A;  1SGM A;  2Y2Z A;  2FBQ A;  5IP6 A;  3LSP A;  4ICH A;  2ID6 A;  3LWJ A;  2XGD A;  2X6O A;  3C07 A;  3QBM A;  4ABZ A;  3RD3 A;  3PAS A;  3HE0 A;  3Q3S A;  1JT0 A;  4DW6 A;  3COL A;  3NPI A;  3SFI A;  2X9D A;  4W1U A;  2IBD A;  5J1U A;  1T56 A;  5AQC A;  5F04 A;  3ZQG A;  2G0E A;  1VI0 A;  4PXI A;  3F0C A;  4MO7 A;  3HIM A;  3O60 A;  1ZKG A;  3RH2 A;  4GCT A;  1JT6 A;  3AQS A;  2OF7 A;  3KKC A;  4NN1 A;  1U9N A;  5IOY A;  3BJB A;  5DAJ A;  2IAI A;  2UXO A;  2NS8 A;  2FX0 A;  3BCG A;  3VW2 A;  2I10 A;  5H9T A;  3NI7 A;  2FJ1 A;  3BHQ A;  2DG7 A;  3DPJ A;  2HXO A;  4I6Z A;  3PPB A;  2IU5 A;  3BTJ A;  2NP5 A;  4M3E A;  2ZOY A;  3V6G A;  1JUS A;  3G1L A;  5GPC A;  2GFN A;  3HGG A;  2JK3 A;  3MNL A;  5IPA A;  3HTH A;  2G7S A;  3QPS A;  2PBX A;  5EZG A;  3ANP A;  3Q0V A;  3BNI A;  2QWT A;  3F1B A;  4AC0 A;  2QKO A;  3CJD A;  4KWA A;  5FMP A;  3BQY A;  3IH2 A;  2YVE A;  3VOK A;  2VKV A;  3BRU A;  3VPR A;  2WUI A;  4GCK A;  5F08 A;  4AC6 A;  2GEN A;  2TRT A;  2XPW A;  3MVP A;  2HKU A;  4JNN A;  1ORK A;  2D6Y A;  4D5F A;  3BTL A;  4M3B A;  5HAW A;  1Z0X A;  2OI8 A;  2XPV A;  3QQA A;  3DEW A;  5HBU A;  2WV1 A;  3NNR A;  5FHP A;  3HTI A;  2G7G A;  2QCO A;  4JKZ A;  3SDG A;  2HXI A;  4UDS A;  3BR0 A;  5K7H A;  5GPA A;  1UI5 A;  3T6N A;  1U9O A;  2REK A;  2UXP A;  4M3D A;  2FQ4 A;  3HGY A;  5D19 A;  3HTA A;  3VP5 A;  2TCT A;  5F0H A;  3E7Q A;  3G1M A;  4ME9 A;  5F0C A;  3BR1 A;  5EZH A;  3VVX A;  2UXH A;  2VPR A;  2OPT A;  3LJL A;  2XRL A;  3B81 A;  2QOP A;  3BR5 A;  3FK6 A;  4JYK A;  3LSR A;  3KNW A;  2QIB A;  3EUP A;  3QKX A;  5FKL A;  2XB5 A;  2UXU A;  3B6A A;  1A6I A;  5IOZ A;  2RAE A;  3VIB A;  1RKT A;  2NX4 A;  3BTI A;  5K7F A;  3LOC A;  2YVH A;  3LHQ A;  5GP9 A;  1RPW A;  3C2B A;  2Y31 A;  3G1O A;  2XDN A;  4AUX A;  2VKE A;  1T33 A;  3ON4 A;  3V78 A;  3FK7 A;  2PZ9 A;  4I76 A;  5FKO A;  2Y30 A;  5FKN A;  3BTC A;  3BT9 A;  3B6C A;  3IH3 A;  2O7O A;  1JTY A;  5J1Y A;  2OER A;  2ZCM A;  4V2F A;  3WHC A;  3G56 A;  4CGR A;  1JTX A;  3BR6 A;  3NXC A;  1JUP A;  5EYR A;  3CCY A;  3Q0U A;  5J3L A;  3ZQI A;  1QVU A;  4X1E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...