2NP3A

Crystal structure of tetr-family regulator (sco0857) from streptomyces coelicolor a3.
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
176
structure length
142
Chain Sequence
b'ILTAARVCFYGTKENLFLQALELPGKIEEAITAAAQGGLDGIGERVVRAHLSVWDDVSSRPALMTMVRSAARLRETATGILARALGGVITGEDAMLRTSMVATQLVGLAMMRYVAHLEPLASADTDTVARHYGRAVQAIVTD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative TetR-family regulator
publication title Crystal structure of TetR-family regulator (SCO0857) from Streptomyces coelicolor A3.
rcsb
source organism Streptomyces coelicolor
molecule tags Transcription
total genus 47
structure length 142
sequence length 176
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17920 TetR_C_16 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2np3A00
3ZQLA 2W53A 3CJDA 5FKOA 2GENA 2NS7A 2G7LA 3NI7A 3HTAA 3HGYA 5F1JA 3VW0A 5F0CA 3IH4A 2Y30A 5EZHA 3VOXA 3VPRA 3B81A 3TP3A 1A6IA 3LOCA 1JUSA 2XDNA 3LWJA 2HKUA 3JSJA 5IOZA 2XGCA 2ZOYA 2X9DA 4M3EA 2OPTA 5F04A 3CRJA 1UI6A 1BJZA 3QPSA 3BTIA 2XPVA 3RH2A 3FK6A 2NX4A 5F27A 2QTQA 2YVEA 3CCYA 4MXMA 2ID3A 3HTJA 3HIMA 4D7NA 3ZQIA 3QBMA 4D5FA 4KWAA 4PXIA 1RPWA 4CGRA 3TP0A 4GCKA 3VUQA 2REKA 3BR5A 2IAIA 1QVTA 2QCOA 3IUVA 3QKXA 3BR1A 4D5CA 4B1RA 2F07A 5F0HA 2G0EA 5K7HA 4JNNA 2FBQA 4HKUA 2DTZA 3NRGA 1Z0XA 5HBUA 4ME9A 2FQ4A 3BQZA 2OI8A 5HSZA 2WUIA 1JUMA 3O8HA 4ICHA 5D18A 4L62A 3IH2A 2WGBA 2UXUA 1SGMA 5FHPA 5EFYA 4AF5A 3MNLA 4JKZA 5FKNA 2XGEA 3BRUA 5FKKA 3C2BA 4V2FA 2UXHA 1VI0A 1JTYA 3DCFA 5IOYA 5C4YA 3VIBA 4M3FA 2ZOZA 2HXIA 2XPWA 3DPJA 3ANGA 2I10A 1JUPA 3Q3SA 5EZGA 4JL3A 3AQTA 2IBDA 3C07A 3WHCA 2PZ9A 3LSRA 3O8GA 3BTJA 4V2GA 3FIWA 1JT0A 2VKVA 3AQSA 2ZCMA 5K7FA 2QOPA 4JYKA 3LJLA 5CW8A 4ACIA 3IH3A 2ZB9A 3EUPA 3COLA 1QVUA 3ZQHA 3S5RA 2JJ7A 3BHQA 4B3AA 3BT9A 3B6CA 1ORKA 4GFLA 5IP6A 3KZ9A 3HE0A 5K58A 3KKDA 3NXCA 2ID6A 5EYRA 3VVZA 5K7ZA 2V57A 5H9TA 2QKOA 2VPRA 5FGLA 3HTHA 2DG8A 2XB5A 2NS8A 3PPBA 4M3GA 1QPIA 3GEUA 3PASA 2GUHA 5J1UA 2UXOA 5FKMA 5GPCA 3VVXA 4M3BA 3BR2A 3V6GA 2UXIA 4W1UA 4GCTA 2XPUA 3BCGA 4UDSA 4ABZA 1U9NA 2XGDA 3P9TA 3RD3A 1ZKGA 3Q0VA 2FX0A 5F08A 3QPLA 4AC6A 3G1LA 2FJ1A 2TRTA 1UI5A 3BNIA 3MVPA 5FKLA 5HAWA 5CXGA 3B6AA 3LSJA 3BR3A 3VVYA 3GZIA 4NN1A 2G3BA 4MO7A 2Y31A 5J1RA 3G7RA 3FRQA 2G7SA 5F0FA 2QIBA 3EGQA 5J3LA 3BTLA 2PBXA 3KNWA 2NP5A 4W97A 3BQYA 2GBYA 3KKCA 1U9OA 3Q0WA 3G1OA 2DG7A 4M3DA 4AUXA 2X6OA 4XK4A 4MK6A 4G12A 3CDLA 5D19A 3FK7A 2O7OA 2WV1A 2VKEA 4X1EA 3BJBA 3QQAA 1RKWA 4I6ZA 2RHAA 2IU5A 1JT6A 4GFKA 2RASA 3ON4A 5CXIA 2FD5A 2UXPA 3V78A 2ZCXA 3G56A 5GPAA 2NP3A 3VP5A 3ZQGA 3ZQFA 3BR0A 2ZCNA 2OF7A 3VW2A 2QWTA 4GCLA 2G7GA 4NELA 3BTCA 5AQCA 2TCTA 3BR6A 3O60A 2HQ5A 3WHBA 3CWRA 2HYTA 1Z77A 3ON2A 3PM1A 4YZEA 5DAJA 2JK3A 2O7TA 3SFIA 3T6NA 2EH3A 3NPIA 2OERA 2HXOA 3VOKA 3E7QA 2Q24A 3F1BA 5J1YA 5FMPA 1T33A 1RKTA 2Y2ZA 3F0CA 1ZK8A 3VW1A 2XRLA 1JTXA 3DEWA 3LHQA 3HGGA 3NNRA 5GP9A 2D6YA 2IEKA 3LSPA 4DW6A 2RAEA 3ANPA 4AC0A 5IPAA 4D7MA 3G1MA 4I76A 3SDGA 2HYJA 5D1RA 3HTIA 3Q0UA 2YVHA 2GFNA 1T56A
chains in the Genus database with same CATH superfamily
3ZQLA 2W53A 3CJDA 5FKOA 2GENA 2NS7A 2G7LA 3NI7A 3HTAA 3HGYA 2A2FX 4C2MA 5F1JA 3VW0A 5F0CA 3IH4A 2Y30A 5EZHA 3VOXA 3VPRA 3B81A 3TP3A 1A6IA 3LOCA 1JUSA 2XDNA 3LWJA 2HKUA 3JSJA 5IOZA 2R7SA 2XGCA 2ZOYA 2X9DA 4M3EA 2OPTA 5F04A 2FJI1 3CRJA 1UI6A 1BJZA 3QPSA 3BTIA 2XPVA 3RH2A 3FK6A 2NX4A 5F27A 2QTQA 2YVEA 3CCYA 4MXMA 2ID3A 3HTJA 3HIMA 3K8PC 4D7NA 3ZQIA 3QBMA 4D5FA 4KWAA 4PXIA 1RPWA 4CGRA 3TP0A 4GCKA 3VUQA 2REKA 3BR5A 2IAIA 1QVTA 2QCOA 3IUVA 3QKXA 3BR1A 4D5CA 4B1RA 2F07A 5F0HA 2G0EA 5K7HA 4JNNA 2FBQA 4HKUA 2DTZA 3NRGA 1Z0XA 5HBUA 4ME9A 2FQ4A 3BQZA 2OI8A 5HSZA 2WUIA 1JUMA 3O8HA 4ICHA 5D18A 4L62A 3IH2A 2WGBA 2UXUA 1SGMA 5FHPA 3DU5A 5EFYA 4AF5A 3MNLA 4JKZA 5FKNA 2XGEA 3BRUA 5FKKA 3C2BA 2YVXA 4V2FA 2UXHA 1VI0A 2B3WA 1JTYA 3DCFA 5IOYA 3FHNA 5C4YA 3VIBA 4M3FA 2ZOZA 2HXIA 2XPWA 3DPJA 3ANGA 2I10A 3SWHA 1JUPA 3Q3SA 2ZY9A 5EZGA 4JL3A 3AQTA 2IBDA 3C07A 3WHCA 2PZ9A 3LSRA 3O8GA 2R7TA 3BTJA 4V2GA 3FIWA 1JT0A 2VKVA 3KYLA 3AQSA 2R7RA 2ZCMA 5K7FA 2QOPA 4JYKA 2R7OA 3LJLA 5CW8A 4ACIA 3IH3A 2ZB9A 3EUPA 3VTIA 4U9NA 3COLA 1QVUA 3ZQHA 3S5RA 2JJ7A 3BHQA 4B3AA 4OD5A 3BT9A 3B6CA 2R7VA 4DVYP 1ORKA 4GFLA 5IP6A 3KZ9A 3HE0A 5K58A 3KKDA 3NXCA 2ID6A 5EYRA 3VVZA 5K7ZA 2R7XA 2B1EA 2V57A 5H9TA 2QKOA 2VPRA 5FGLA 3HTHA 2DG8A 2XB5A 2NS8A 3PPBA 4M3GA 1QPIA 3GEUA 3PASA 2GUHA 5J1UA 2UXOA 5FKMA 5GPCA 3VVXA 4M3BA 3BR2A 3V6GA 2UXIA 4W1UA 4GCTA 2XPUA 3DU6A 3BCGA 4UDSA 4ABZA 1U9NA 2XGDA 3P9TA 3RD3A 1ZKGA 4IRVA 3Q0VA 4WIBA 2FX0A 5F08A 3QPLA 4AC6A 3G1LA 2FJ1A 2TRTA 1UI5A 3BNIA 3MVPA 5FKLA 5HAWA 5CXGA 3B6AA 3LSJA 3BR3A 3VVYA 3GZIA 4NN1A 2G3BA 4MO7A 2Y31A 5J1RA 3G7RA 3FRQA 2G7SA 5F0FA 2QIBA 3EGQA 5J3LA 2R7WA 3BTLA 2PBXA 3KNWA 2NP5A 4W97A 2R7QA 3BQYA 2GBYA 3KKCA 1U9OA 3Q0WA 3G1OA 2DG7A 4M3DA 4AUXA 2X6OA 4XK4A 4MK6A 4G12A 3CDLA 5D19A 3FK7A 2O7OA 2PFVA 2WV1A 2VKEA 4X1EA 3BJBA 3QQAA 1RKWA 4I6ZA 2RHAA 2IU5A 1JT6A 4GFKA 2RASA 3ON4A 5CXIA 2FD5A 2UXPA 3V78A 2ZCXA 3G56A 5GPAA 2NP3A 3VP5A 3ZQGA 3ZQFA 3BR0A 2ZCNA 2OF7A 3VW2A 2QWTA 4GCLA 2G7GA 4NELA 3BTCA 5AQCA 2TCTA 3BR6A 3O60A 2HQ5A 3WHBA 4OD4A 3CWRA 2HYTA 1Z77A 3ON2A 3PM1A 4YZEA 5DAJA 2JK3A 4U9LA 2O7TA 3SFIA 3T6NA 2EH3A 3NPIA 2OERA 2R7UA 2HXOA 3VOKA 3E7QA 2Q24A 3F1BA 5J1YA 5FMPA 1T33A 1RKTA 2Y2ZA 3F0CA 1ZK8A 3VW1A 5CQGA 2XRLA 1JTXA 3DEWA 3LHQA 3HGGA 3NNRA 5GP9A 2D6YA 2IEKA 3LSPA 4DW6A 2RAEA 3NS4A 3ANPA 4AC0A 5IPAA 4D7MA 3G1MA 4I76A 3SDGA 2HYJA 5D1RA 3HTIA 3Q0UA 2YVHA 2GFNA 1T56A
chains in the Genus database with same CATH topology
3ZQLA 2W53A 3CJDA 5FKOA 2GENA 2NS7A 2G7LA 3NI7A 3HTAA 3HGYA 5F1JA 3VW0A 5F0CA 3IH4A 2Y30A 5EZHA 3VOXA 3VPRA 3B81A 3TP3A 1A6IA 3LOCA 1JUSA 2XDNA 3LWJA 2HKUA 3JSJA 5IOZA 2XGCA 2ZOYA 2X9DA 4M3EA 2OPTA 5F04A 3CRJA 1UI6A 1BJZA 3QPSA 3BTIA 2XPVA 3RH2A 3FK6A 2NX4A 5F27A 2QTQA 2YVEA 3CCYA 4MXMA 2ID3A 3HTJA 3HIMA 4D7NA 3ZQIA 3QBMA 4D5FA 4KWAA 4PXIA 1RPWA 4CGRA 3TP0A 4GCKA 3VUQA 2REKA 3BR5A 2IAIA 1QVTA 2QCOA 3IUVA 3QKXA 3BR1A 4D5CA 4B1RA 2F07A 5F0HA 2G0EA 5K7HA 4JNNA 2FBQA 4HKUA 2DTZA 3NRGA 1Z0XA 5HBUA 4ME9A 2FQ4A 3BQZA 2OI8A 5HSZA 2WUIA 1JUMA 3O8HA 4ICHA 5D18A 4L62A 3IH2A 2WGBA 2UXUA 1SGMA 5FHPA 5EFYA 4AF5A 3MNLA 4JKZA 5FKNA 2XGEA 3BRUA 5FKKA 3C2BA 4V2FA 2UXHA 1VI0A 1JTYA 3DCFA 5IOYA 5C4YA 3VIBA 4M3FA 2ZOZA 2HXIA 2XPWA 3DPJA 3ANGA 2I10A 1JUPA 3Q3SA 5EZGA 4JL3A 3AQTA 2IBDA 3C07A 3WHCA 2PZ9A 3LSRA 3O8GA 3BTJA 4V2GA 3FIWA 1JT0A 2VKVA 3AQSA 2ZCMA 5K7FA 2QOPA 4JYKA 3LJLA 5CW8A 4ACIA 3IH3A 2ZB9A 3EUPA 3COLA 1QVUA 3ZQHA 3S5RA 2JJ7A 3BHQA 4B3AA 3BT9A 3B6CA 1ORKA 4GFLA 5IP6A 3KZ9A 3HE0A 5K58A 3KKDA 3NXCA 2ID6A 5EYRA 3VVZA 5K7ZA 2V57A 5H9TA 2QKOA 2VPRA 5FGLA 3HTHA 2DG8A 2XB5A 2NS8A 3PPBA 4M3GA 1QPIA 3GEUA 3PASA 2GUHA 5J1UA 2UXOA 5FKMA 5GPCA 3VVXA 4M3BA 3BR2A 3V6GA 2UXIA 4W1UA 4GCTA 2XPUA 3BCGA 4UDSA 4ABZA 1U9NA 2XGDA 3P9TA 3RD3A 1ZKGA 3Q0VA 2FX0A 5F08A 3QPLA 4AC6A 3G1LA 2FJ1A 2TRTA 1UI5A 3BNIA 3MVPA 5FKLA 5HAWA 5CXGA 3B6AA 3LSJA 3BR3A 3VVYA 3GZIA 4NN1A 2G3BA 4MO7A 2Y31A 5J1RA 3G7RA 3FRQA 2G7SA 5F0FA 2QIBA 3EGQA 5J3LA 3BTLA 2PBXA 3KNWA 2NP5A 4W97A 3BQYA 2GBYA 3KKCA 1U9OA 3Q0WA 3G1OA 2DG7A 4M3DA 4AUXA 2X6OA 4XK4A 4MK6A 4G12A 3CDLA 5D19A 3FK7A 2O7OA 2WV1A 2VKEA 4X1EA 3BJBA 3QQAA 1RKWA 4I6ZA 2RHAA 2IU5A 1JT6A 4GFKA 2RASA 3ON4A 5CXIA 2FD5A 2UXPA 3V78A 2ZCXA 3G56A 5GPAA 2NP3A 3VP5A 3ZQGA 3ZQFA 3BR0A 2ZCNA 2OF7A 3VW2A 2QWTA 4GCLA 2G7GA 4NELA 3BTCA 5AQCA 2TCTA 3BR6A 3O60A 2HQ5A 3WHBA 3CWRA 2HYTA 1Z77A 3ON2A 3PM1A 4YZEA 5DAJA 2JK3A 2O7TA 3SFIA 3T6NA 2EH3A 3NPIA 2OERA 2HXOA 3VOKA 3E7QA 2Q24A 3F1BA 5J1YA 5FMPA 1T33A 1RKTA 2Y2ZA 3F0CA 1ZK8A 3VW1A 2XRLA 1JTXA 3DEWA 3LHQA 3HGGA 3NNRA 5GP9A 2D6YA 2IEKA 3LSPA 4DW6A 2RAEA 3ANPA 4AC0A 5IPAA 4D7MA 3G1MA 4I76A 3SDGA 2HYJA 5D1RA 3HTIA 3Q0UA 2YVHA 2GFNA 1T56A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZQL A;  2W53 A;  3CJD A;  5FKO A;  2GEN A;  2NS7 A;  2G7L A;  3NI7 A;  3HTA A;  3HGY A;  5F1J A;  3VW0 A;  5F0C A;  3IH4 A;  2Y30 A;  5EZH A;  3VOX A;  3VPR A;  3B81 A;  3TP3 A;  1A6I A;  3LOC A;  1JUS A;  2XDN A;  3LWJ A;  2HKU A;  3JSJ A;  5IOZ A;  2XGC A;  2ZOY A;  2X9D A;  4M3E A;  2OPT A;  5F04 A;  3CRJ A;  1UI6 A;  1BJZ A;  3QPS A;  3BTI A;  2XPV A;  3RH2 A;  3FK6 A;  2NX4 A;  5F27 A;  2QTQ A;  2YVE A;  3CCY A;  4MXM A;  2ID3 A;  3HTJ A;  3HIM A;  4D7N A;  3ZQI A;  3QBM A;  4D5F A;  4KWA A;  4PXI A;  1RPW A;  4CGR A;  3TP0 A;  4GCK A;  3VUQ A;  2REK A;  3BR5 A;  2IAI A;  1QVT A;  2QCO A;  3IUV A;  3QKX A;  3BR1 A;  4D5C A;  4B1R A;  2F07 A;  5F0H A;  2G0E A;  5K7H A;  4JNN A;  2FBQ A;  4HKU A;  2DTZ A;  3NRG A;  1Z0X A;  5HBU A;  4ME9 A;  2FQ4 A;  3BQZ A;  2OI8 A;  5HSZ A;  2WUI A;  1JUM A;  3O8H A;  4ICH A;  5D18 A;  4L62 A;  3IH2 A;  2WGB A;  2UXU A;  1SGM A;  5FHP A;  5EFY A;  4AF5 A;  3MNL A;  4JKZ A;  5FKN A;  2XGE A;  3BRU A;  5FKK A;  3C2B A;  4V2F A;  2UXH A;  1VI0 A;  1JTY A;  3DCF A;  5IOY A;  5C4Y A;  3VIB A;  4M3F A;  2ZOZ A;  2HXI A;  2XPW A;  3DPJ A;  3ANG A;  2I10 A;  1JUP A;  3Q3S A;  5EZG A;  4JL3 A;  3AQT A;  2IBD A;  3C07 A;  3WHC A;  2PZ9 A;  3LSR A;  3O8G A;  3BTJ A;  4V2G A;  3FIW A;  1JT0 A;  2VKV A;  3AQS A;  2ZCM A;  5K7F A;  2QOP A;  4JYK A;  3LJL A;  5CW8 A;  4ACI A;  3IH3 A;  2ZB9 A;  3EUP A;  3COL A;  1QVU A;  3ZQH A;  3S5R A;  2JJ7 A;  3BHQ A;  4B3A A;  3BT9 A;  3B6C A;  1ORK A;  4GFL A;  5IP6 A;  3KZ9 A;  3HE0 A;  5K58 A;  3KKD A;  3NXC A;  2ID6 A;  5EYR A;  3VVZ A;  5K7Z A;  2V57 A;  5H9T A;  2QKO A;  2VPR A;  5FGL A;  3HTH A;  2DG8 A;  2XB5 A;  2NS8 A;  3PPB A;  4M3G A;  1QPI A;  3GEU A;  3PAS A;  2GUH A;  5J1U A;  2UXO A;  5FKM A;  5GPC A;  3VVX A;  4M3B A;  3BR2 A;  3V6G A;  2UXI A;  4W1U A;  4GCT A;  2XPU A;  3BCG A;  4UDS A;  4ABZ A;  1U9N A;  2XGD A;  3P9T A;  3RD3 A;  1ZKG A;  3Q0V A;  2FX0 A;  5F08 A;  3QPL A;  4AC6 A;  3G1L A;  2FJ1 A;  2TRT A;  1UI5 A;  3BNI A;  3MVP A;  5FKL A;  5HAW A;  5CXG A;  3B6A A;  3LSJ A;  3BR3 A;  3VVY A;  3GZI A;  4NN1 A;  2G3B A;  4MO7 A;  2Y31 A;  5J1R A;  3G7R A;  3FRQ A;  2G7S A;  5F0F A;  2QIB A;  3EGQ A;  5J3L A;  3BTL A;  2PBX A;  3KNW A;  2NP5 A;  4W97 A;  3BQY A;  2GBY A;  3KKC A;  1U9O A;  3Q0W A;  3G1O A;  2DG7 A;  4M3D A;  4AUX A;  2X6O A;  4XK4 A;  4MK6 A;  4G12 A;  3CDL A;  5D19 A;  3FK7 A;  2O7O A;  2WV1 A;  2VKE A;  4X1E A;  3BJB A;  3QQA A;  1RKW A;  4I6Z A;  2RHA A;  2IU5 A;  1JT6 A;  4GFK A;  2RAS A;  3ON4 A;  5CXI A;  2FD5 A;  2UXP A;  3V78 A;  2ZCX A;  3G56 A;  5GPA A;  2NP3 A;  3VP5 A;  3ZQG A;  3ZQF A;  3BR0 A;  2ZCN A;  2OF7 A;  3VW2 A;  2QWT A;  4GCL A;  2G7G A;  4NEL A;  3BTC A;  5AQC A;  2TCT A;  3BR6 A;  3O60 A;  2HQ5 A;  3WHB A;  3CWR A;  2HYT A;  1Z77 A;  3ON2 A;  3PM1 A;  4YZE A;  5DAJ A;  2JK3 A;  2O7T A;  3SFI A;  3T6N A;  2EH3 A;  3NPI A;  2OER A;  2HXO A;  3VOK A;  3E7Q A;  2Q24 A;  3F1B A;  5J1Y A;  5FMP A;  1T33 A;  1RKT A;  2Y2Z A;  3F0C A;  1ZK8 A;  3VW1 A;  2XRL A;  1JTX A;  3DEW A;  3LHQ A;  3HGG A;  3NNR A;  5GP9 A;  2D6Y A;  2IEK A;  3LSP A;  4DW6 A;  2RAE A;  3ANP A;  4AC0 A;  5IPA A;  4D7M A;  3G1M A;  4I76 A;  3SDG A;  2HYJ A;  5D1R A;  3HTI A;  3Q0U A;  2YVH A;  2GFN A;  1T56 A; 
#chains in the Genus database with same CATH topology
 3ZQL A;  2W53 A;  3CJD A;  5FKO A;  2GEN A;  2NS7 A;  2G7L A;  3NI7 A;  3HTA A;  3HGY A;  2A2F X;  4C2M A;  5F1J A;  3VW0 A;  5F0C A;  3IH4 A;  2Y30 A;  5EZH A;  3VOX A;  3VPR A;  3B81 A;  3TP3 A;  1A6I A;  3LOC A;  1JUS A;  2XDN A;  3LWJ A;  2HKU A;  3JSJ A;  5IOZ A;  2R7S A;  2XGC A;  2ZOY A;  2X9D A;  4M3E A;  2OPT A;  5F04 A;  2FJI 1;  3CRJ A;  1UI6 A;  1BJZ A;  3QPS A;  3BTI A;  2XPV A;  3RH2 A;  3FK6 A;  2NX4 A;  5F27 A;  2QTQ A;  2YVE A;  3CCY A;  4MXM A;  2ID3 A;  3HTJ A;  3HIM A;  3K8P C;  4D7N A;  3ZQI A;  3QBM A;  4D5F A;  4KWA A;  4PXI A;  1RPW A;  4CGR A;  3TP0 A;  4GCK A;  3VUQ A;  2REK A;  3BR5 A;  2IAI A;  1QVT A;  2QCO A;  3IUV A;  3QKX A;  3BR1 A;  4D5C A;  4B1R A;  2F07 A;  5F0H A;  2G0E A;  5K7H A;  4JNN A;  2FBQ A;  4HKU A;  2DTZ A;  3NRG A;  1Z0X A;  5HBU A;  4ME9 A;  2FQ4 A;  3BQZ A;  2OI8 A;  5HSZ A;  2WUI A;  1JUM A;  3O8H A;  4ICH A;  5D18 A;  4L62 A;  3IH2 A;  2WGB A;  2UXU A;  1SGM A;  5FHP A;  3DU5 A;  5EFY A;  4AF5 A;  3MNL A;  4JKZ A;  5FKN A;  2XGE A;  3BRU A;  5FKK A;  3C2B A;  2YVX A;  4V2F A;  2UXH A;  1VI0 A;  2B3W A;  1JTY A;  3DCF A;  5IOY A;  3FHN A;  5C4Y A;  3VIB A;  4M3F A;  2ZOZ A;  2HXI A;  2XPW A;  3DPJ A;  3ANG A;  2I10 A;  3SWH A;  1JUP A;  3Q3S A;  2ZY9 A;  5EZG A;  4JL3 A;  3AQT A;  2IBD A;  3C07 A;  3WHC A;  2PZ9 A;  3LSR A;  3O8G A;  2R7T A;  3BTJ A;  4V2G A;  3FIW A;  1JT0 A;  2VKV A;  3KYL A;  3AQS A;  2R7R A;  2ZCM A;  5K7F A;  2QOP A;  4JYK A;  2R7O A;  3LJL A;  5CW8 A;  4ACI A;  3IH3 A;  2ZB9 A;  3EUP A;  3VTI A;  4U9N A;  3COL A;  1QVU A;  3ZQH A;  3S5R A;  2JJ7 A;  3BHQ A;  4B3A A;  4OD5 A;  3BT9 A;  3B6C A;  2R7V A;  4DVY P;  1ORK A;  4GFL A;  5IP6 A;  3KZ9 A;  3HE0 A;  5K58 A;  3KKD A;  3NXC A;  2ID6 A;  5EYR A;  3VVZ A;  5K7Z A;  2R7X A;  2B1E A;  2V57 A;  5H9T A;  2QKO A;  2VPR A;  5FGL A;  3HTH A;  2DG8 A;  2XB5 A;  2NS8 A;  3PPB A;  4M3G A;  1QPI A;  3GEU A;  3PAS A;  2GUH A;  5J1U A;  2UXO A;  5FKM A;  5GPC A;  3VVX A;  4M3B A;  3BR2 A;  3V6G A;  2UXI A;  4W1U A;  4GCT A;  2XPU A;  3DU6 A;  3BCG A;  4UDS A;  4ABZ A;  1U9N A;  2XGD A;  3P9T A;  3RD3 A;  1ZKG A;  4IRV A;  3Q0V A;  4WIB A;  2FX0 A;  5F08 A;  3QPL A;  4AC6 A;  3G1L A;  2FJ1 A;  2TRT A;  1UI5 A;  3BNI A;  3MVP A;  5FKL A;  5HAW A;  5CXG A;  3B6A A;  3LSJ A;  3BR3 A;  3VVY A;  3GZI A;  4NN1 A;  2G3B A;  4MO7 A;  2Y31 A;  5J1R A;  3G7R A;  3FRQ A;  2G7S A;  5F0F A;  2QIB A;  3EGQ A;  5J3L A;  2R7W A;  3BTL A;  2PBX A;  3KNW A;  2NP5 A;  4W97 A;  2R7Q A;  3BQY A;  2GBY A;  3KKC A;  1U9O A;  3Q0W A;  3G1O A;  2DG7 A;  4M3D A;  4AUX A;  2X6O A;  4XK4 A;  4MK6 A;  4G12 A;  3CDL A;  5D19 A;  3FK7 A;  2O7O A;  2PFV A;  2WV1 A;  2VKE A;  4X1E A;  3BJB A;  3QQA A;  1RKW A;  4I6Z A;  2RHA A;  2IU5 A;  1JT6 A;  4GFK A;  2RAS A;  3ON4 A;  5CXI A;  2FD5 A;  2UXP A;  3V78 A;  2ZCX A;  3G56 A;  5GPA A;  2NP3 A;  3VP5 A;  3ZQG A;  3ZQF A;  3BR0 A;  2ZCN A;  2OF7 A;  3VW2 A;  2QWT A;  4GCL A;  2G7G A;  4NEL A;  3BTC A;  5AQC A;  2TCT A;  3BR6 A;  3O60 A;  2HQ5 A;  3WHB A;  4OD4 A;  3CWR A;  2HYT A;  1Z77 A;  3ON2 A;  3PM1 A;  4YZE A;  5DAJ A;  2JK3 A;  4U9L A;  2O7T A;  3SFI A;  3T6N A;  2EH3 A;  3NPI A;  2OER A;  2R7U A;  2HXO A;  3VOK A;  3E7Q A;  2Q24 A;  3F1B A;  5J1Y A;  5FMP A;  1T33 A;  1RKT A;  2Y2Z A;  3F0C A;  1ZK8 A;  3VW1 A;  5CQG A;  2XRL A;  1JTX A;  3DEW A;  3LHQ A;  3HGG A;  3NNR A;  5GP9 A;  2D6Y A;  2IEK A;  3LSP A;  4DW6 A;  2RAE A;  3NS4 A;  3ANP A;  4AC0 A;  5IPA A;  4D7M A;  3G1M A;  4I76 A;  3SDG A;  2HYJ A;  5D1R A;  3HTI A;  3Q0U A;  2YVH A;  2GFN A;  1T56 A; 
#chains in the Genus database with same CATH homology
 3ZQL A;  2W53 A;  3CJD A;  5FKO A;  2GEN A;  2NS7 A;  2G7L A;  3NI7 A;  3HTA A;  3HGY A;  5F1J A;  3VW0 A;  5F0C A;  3IH4 A;  2Y30 A;  5EZH A;  3VOX A;  3VPR A;  3B81 A;  3TP3 A;  1A6I A;  3LOC A;  1JUS A;  2XDN A;  3LWJ A;  2HKU A;  3JSJ A;  5IOZ A;  2XGC A;  2ZOY A;  2X9D A;  4M3E A;  2OPT A;  5F04 A;  3CRJ A;  1UI6 A;  1BJZ A;  3QPS A;  3BTI A;  2XPV A;  3RH2 A;  3FK6 A;  2NX4 A;  5F27 A;  2QTQ A;  2YVE A;  3CCY A;  4MXM A;  2ID3 A;  3HTJ A;  3HIM A;  4D7N A;  3ZQI A;  3QBM A;  4D5F A;  4KWA A;  4PXI A;  1RPW A;  4CGR A;  3TP0 A;  4GCK A;  3VUQ A;  2REK A;  3BR5 A;  2IAI A;  1QVT A;  2QCO A;  3IUV A;  3QKX A;  3BR1 A;  4D5C A;  4B1R A;  2F07 A;  5F0H A;  2G0E A;  5K7H A;  4JNN A;  2FBQ A;  4HKU A;  2DTZ A;  3NRG A;  1Z0X A;  5HBU A;  4ME9 A;  2FQ4 A;  3BQZ A;  2OI8 A;  5HSZ A;  2WUI A;  1JUM A;  3O8H A;  4ICH A;  5D18 A;  4L62 A;  3IH2 A;  2WGB A;  2UXU A;  1SGM A;  5FHP A;  5EFY A;  4AF5 A;  3MNL A;  4JKZ A;  5FKN A;  2XGE A;  3BRU A;  5FKK A;  3C2B A;  4V2F A;  2UXH A;  1VI0 A;  1JTY A;  3DCF A;  5IOY A;  5C4Y A;  3VIB A;  4M3F A;  2ZOZ A;  2HXI A;  2XPW A;  3DPJ A;  3ANG A;  2I10 A;  1JUP A;  3Q3S A;  5EZG A;  4JL3 A;  3AQT A;  2IBD A;  3C07 A;  3WHC A;  2PZ9 A;  3LSR A;  3O8G A;  3BTJ A;  4V2G A;  3FIW A;  1JT0 A;  2VKV A;  3AQS A;  2ZCM A;  5K7F A;  2QOP A;  4JYK A;  3LJL A;  5CW8 A;  4ACI A;  3IH3 A;  2ZB9 A;  3EUP A;  3COL A;  1QVU A;  3ZQH A;  3S5R A;  2JJ7 A;  3BHQ A;  4B3A A;  3BT9 A;  3B6C A;  1ORK A;  4GFL A;  5IP6 A;  3KZ9 A;  3HE0 A;  5K58 A;  3KKD A;  3NXC A;  2ID6 A;  5EYR A;  3VVZ A;  5K7Z A;  2V57 A;  5H9T A;  2QKO A;  2VPR A;  5FGL A;  3HTH A;  2DG8 A;  2XB5 A;  2NS8 A;  3PPB A;  4M3G A;  1QPI A;  3GEU A;  3PAS A;  2GUH A;  5J1U A;  2UXO A;  5FKM A;  5GPC A;  3VVX A;  4M3B A;  3BR2 A;  3V6G A;  2UXI A;  4W1U A;  4GCT A;  2XPU A;  3BCG A;  4UDS A;  4ABZ A;  1U9N A;  2XGD A;  3P9T A;  3RD3 A;  1ZKG A;  3Q0V A;  2FX0 A;  5F08 A;  3QPL A;  4AC6 A;  3G1L A;  2FJ1 A;  2TRT A;  1UI5 A;  3BNI A;  3MVP A;  5FKL A;  5HAW A;  5CXG A;  3B6A A;  3LSJ A;  3BR3 A;  3VVY A;  3GZI A;  4NN1 A;  2G3B A;  4MO7 A;  2Y31 A;  5J1R A;  3G7R A;  3FRQ A;  2G7S A;  5F0F A;  2QIB A;  3EGQ A;  5J3L A;  3BTL A;  2PBX A;  3KNW A;  2NP5 A;  4W97 A;  3BQY A;  2GBY A;  3KKC A;  1U9O A;  3Q0W A;  3G1O A;  2DG7 A;  4M3D A;  4AUX A;  2X6O A;  4XK4 A;  4MK6 A;  4G12 A;  3CDL A;  5D19 A;  3FK7 A;  2O7O A;  2WV1 A;  2VKE A;  4X1E A;  3BJB A;  3QQA A;  1RKW A;  4I6Z A;  2RHA A;  2IU5 A;  1JT6 A;  4GFK A;  2RAS A;  3ON4 A;  5CXI A;  2FD5 A;  2UXP A;  3V78 A;  2ZCX A;  3G56 A;  5GPA A;  2NP3 A;  3VP5 A;  3ZQG A;  3ZQF A;  3BR0 A;  2ZCN A;  2OF7 A;  3VW2 A;  2QWT A;  4GCL A;  2G7G A;  4NEL A;  3BTC A;  5AQC A;  2TCT A;  3BR6 A;  3O60 A;  2HQ5 A;  3WHB A;  3CWR A;  2HYT A;  1Z77 A;  3ON2 A;  3PM1 A;  4YZE A;  5DAJ A;  2JK3 A;  2O7T A;  3SFI A;  3T6N A;  2EH3 A;  3NPI A;  2OER A;  2HXO A;  3VOK A;  3E7Q A;  2Q24 A;  3F1B A;  5J1Y A;  5FMP A;  1T33 A;  1RKT A;  2Y2Z A;  3F0C A;  1ZK8 A;  3VW1 A;  2XRL A;  1JTX A;  3DEW A;  3LHQ A;  3HGG A;  3NNR A;  5GP9 A;  2D6Y A;  2IEK A;  3LSP A;  4DW6 A;  2RAE A;  3ANP A;  4AC0 A;  5IPA A;  4D7M A;  3G1M A;  4I76 A;  3SDG A;  2HYJ A;  5D1R A;  3HTI A;  3Q0U A;  2YVH A;  2GFN A;  1T56 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...