2NP3A

Crystal structure of tetr-family regulator (sco0857) from streptomyces coelicolor a3.
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
176
structure length
142
Chain Sequence
ILTAARVCFYGTKENLFLQALELPGKIEEAITAAAQGGLDGIGERVVRAHLSVWDDVSSRPALMTMVRSAARLRETATGILARALGGVITGEDAMLRTSMVATQLVGLAMMRYVAHLEPLASADTDTVARHYGRAVQAIVTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Putative TetR-family regulator
publication title Crystal structure of TetR-family regulator (SCO0857) from Streptomyces coelicolor A3.
rcsb
source organism Streptomyces coelicolor
total genus 47
structure length 142
sequence length 176
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17920 TetR_C_16 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2np3A00
3G1MA 2O7OA 3SDGA 3COLA 1JT6A 4JYKA 3BJBA 3QKXA 4GCTA 5HSZA 5F08A 1ORKA 2HQ5A 4MO7A 3AQTA 5FKMA 5IP6A 2G7LA 2HYJA 4AC6A 5K7FA 5J1UA 3EGQA 4NN1A 4KWAA 4AC0A 5F0HA 2G3BA 2OPTA 3LWJA 4B1RA 5EFYA 2VPRA 1QPIA 2IEKA 3G56A 4ICHA 1SGMA 4B3AA 3BHQA 3NXCA 2D6YA 3C2BA 3VOXA 2FX0A 4GCLA 3DPJA 3DEWA 3ZQLA 2Q24A 2VKEA 3NPIA 3F1BA 3QPSA 2WGBA 4UDSA 3Q0UA 3G1OA 3BQZA 2XB5A 2OI8A 2EH3A 4I6ZA 3SFIA 5FHPA 2X9DA 3V78A 2HXIA 3BTLA 4M3EA 2XPVA 3TP3A 1UI6A 3NNRA 3KNWA 3C07A 2XGEA 1ZKGA 2NP3A 3KZ9A 3BNIA 4JL3A 2QOPA 3LSJA 4V2GA 2QIBA 1Z77A 1JUMA 3DCFA 2I10A 4M3GA 4W97A 3QQAA 3AQSA 3CJDA 3KKDA 2GBYA 3V6GA 3LOCA 2XPWA 1BJZA 4AUXA 1RPWA 4YZEA 2ID6A 5GP9A 4GFKA 3CWRA 5K7HA 3BR5A 1U9OA 2F07A 3QBMA 1JT0A 3VVXA 2UXIA 3FIWA 1T33A 5GPCA 3BR2A 5F0FA 3BR0A 2RHAA 2VKVA 3IUVA 2ZOYA 4D5FA 2UXHA 3FK6A 4M3BA 2QTQA 2RASA 3P9TA 2ZCNA 3BR6A 2XRLA 3HE0A 3VPRA 2G7GA 4I76A 3VW2A 4ME9A 2ZOZA 1UI5A 2REKA 2QWTA 2TCTA 2IBDA 3ZQHA 3QPLA 3B81A 2ZCMA 2NX4A 5IOYA 3VP5A 2JK3A 2RAEA 3HTAA 3G1LA 3LJLA 2G0EA 2GUHA 2DTZA 2HXOA 4D7MA 3HGYA 3BRUA 5CXGA 1RKWA 3IH3A 3MVPA 3VOKA 3F0CA 5J3LA 2FJ1A 3ZQIA 2UXOA 1JUSA 2XPUA 2UXUA 3B6AA 3Q3SA 3HTJA 5F0CA 2XGDA 5CXIA 3RD3A 5FKNA 5K58A 2FD5A 3VIBA 2GFNA 3LSRA 2HKUA 1RKTA 3BR1A 3CRJA 4GCKA 5D18A 3NRGA 3O8GA 2JJ7A 4M3DA 5GPAA 5IPAA 4NELA 4DW6A 1A6IA 3BTIA 4AF5A 2FBQA 2X6OA 4V2FA 3FRQA 3FK7A 3VVYA 3VVZA 2OERA 3ON4A 1VI0A 5FKOA 2XGCA 3S5RA 2DG8A 5FGLA 4XK4A 3ZQFA 5F04A 3CDLA 5IOZA 2Y31A 4M3FA 2UXPA 2QKOA 5EYRA 4L62A 2HYTA 3PM1A 1JTXA 2IAIA 3MNLA 2OF7A 3Q0WA 2WV1A 4JNNA 3LSPA 4ABZA 3O60A 4D7NA 2YVHA 1QVUA 3G7RA 3GZIA 5C4YA 4D5CA 3ON2A 4X1EA 5EZHA 3KKCA 1JTYA 3PPBA 5FKKA 5HBUA 3B6CA 5FKLA 4MXMA 3WHCA 3IH2A 5AQCA 3IH4A 2QCOA 2IU5A 3BQYA 3O8HA 5J1YA 2V57A 3ANPA 4G12A 3LHQA 3ZQGA 2Y2ZA 3ANGA 5K7ZA 1ZK8A 5HAWA 2O7TA 4GFLA 2ID3A 3BR3A 3PASA 2NS7A 4MK6A 3TP0A 3HGGA 3HIMA 2NP5A 4HKUA 2ZB9A 3T6NA 1T56A 3VW1A 2G7SA 5DAJA 2Y30A 3HTIA 3E7QA 1JUPA 2TRTA 5D19A 2YVEA 3BCGA 3CCYA 2NS8A 4CGRA 2GENA 3BT9A 5D1RA 3Q0VA 2DG7A 2FQ4A 4JKZA 3RH2A 5FMPA 2WUIA 2PBXA 3VUQA 2W53A 2XDNA 4W1UA 3JSJA 3NI7A 3HTHA 3WHBA 5EZGA 1Z0XA 3VW0A 2PZ9A 1QVTA 3EUPA 5J1RA 3BTJA 2ZCXA 4PXIA 5CW8A 5H9TA 3GEUA 4ACIA 3BTCA 5F27A 5F1JA 1U9NA
chains in the Genus database with same CATH superfamily
3G1MA 2O7OA 3SDGA 2R7SA 3COLA 1JT6A 4JYKA 3BJBA 3QKXA 4GCTA 5HSZA 5F08A 2B3WA 1ORKA 2HQ5A 4MO7A 2FJI1 3AQTA 5FKMA 5IP6A 2G7LA 2HYJA 4AC6A 5K7FA 5J1UA 3EGQA 4NN1A 4U9LA 4KWAA 4AC0A 5F0HA 2G3BA 2OPTA 3LWJA 4B1RA 5EFYA 2VPRA 1QPIA 2IEKA 3G56A 4ICHA 1SGMA 4B3AA 3BHQA 3NXCA 2D6YA 3C2BA 3VOXA 2FX0A 4GCLA 3DPJA 3DEWA 3ZQLA 2Q24A 2VKEA 4C2MA 3NPIA 3F1BA 3QPSA 2WGBA 4UDSA 3Q0UA 3G1OA 3BQZA 2XB5A 2OI8A 2EH3A 4I6ZA 4IRVA 3SFIA 5FHPA 3VTIA 2X9DA 3V78A 2HXIA 4WIBA 3BTLA 3KYLA 4M3EA 2XPVA 2R7RA 3TP3A 1UI6A 3NNRA 3KNWA 3C07A 2XGEA 1ZKGA 2NP3A 3KZ9A 3BNIA 4JL3A 2QOPA 3LSJA 4V2GA 2QIBA 1Z77A 1JUMA 3DCFA 2I10A 4M3GA 4W97A 3QQAA 3AQSA 3CJDA 3KKDA 2GBYA 3V6GA 3LOCA 2ZY9A 2R7VA 2XPWA 1BJZA 4AUXA 1RPWA 4YZEA 2ID6A 5GP9A 4GFKA 3CWRA 5K7HA 3BR5A 1U9OA 2F07A 3QBMA 1JT0A 3VVXA 2UXIA 2R7TA 3FIWA 1T33A 5GPCA 3BR2A 5F0FA 3BR0A 2RHAA 2VKVA 3IUVA 2ZOYA 4D5FA 2UXHA 3FK6A 4M3BA 2QTQA 2RASA 3P9TA 2ZCNA 3BR6A 2R7OA 2XRLA 3HE0A 3VPRA 2G7GA 2A2FX 4I76A 3VW2A 4ME9A 3DU6A 2ZOZA 3FHNA 1UI5A 2REKA 2R7WA 2QWTA 2TCTA 2IBDA 3ZQHA 3QPLA 3B81A 2ZCMA 2NX4A 5IOYA 3VP5A 2JK3A 2RAEA 3HTAA 3G1LA 3LJLA 2G0EA 2GUHA 2DTZA 2HXOA 2R7QA 4D7MA 3HGYA 3BRUA 5CXGA 1RKWA 3IH3A 3MVPA 3VOKA 3F0CA 5J3LA 2FJ1A 3ZQIA 2UXOA 1JUSA 2XPUA 2UXUA 3B6AA 3Q3SA 3HTJA 5F0CA 2XGDA 5CXIA 3RD3A 5FKNA 5K58A 2FD5A 3VIBA 2GFNA 3LSRA 2HKUA 1RKTA 3BR1A 3CRJA 4GCKA 5D18A 3NRGA 3O8GA 2JJ7A 2R7UA 4M3DA 5GPAA 2B1EA 5IPAA 4NELA 4DW6A 3SWHA 1A6IA 2PFVA 3BTIA 4AF5A 2FBQA 2X6OA 4V2FA 3FRQA 3FK7A 3VVYA 3VVZA 2OERA 3ON4A 1VI0A 5FKOA 2XGCA 3S5RA 2DG8A 5FGLA 4XK4A 4OD5A 3ZQFA 5F04A 3CDLA 5IOZA 2Y31A 4M3FA 2UXPA 2QKOA 5EYRA 4L62A 2HYTA 3PM1A 1JTXA 2IAIA 3MNLA 2OF7A 3Q0WA 2WV1A 4JNNA 3LSPA 4ABZA 3O60A 2R7XA 4D7NA 2YVHA 1QVUA 3G7RA 3GZIA 5C4YA 4D5CA 3ON2A 4X1EA 5EZHA 3KKCA 1JTYA 3PPBA 4DVYP 5FKKA 5HBUA 3B6CA 5CQGA 5FKLA 3DU5A 4MXMA 3WHCA 2YVXA 3IH2A 5AQCA 3IH4A 2QCOA 2IU5A 3BQYA 3O8HA 5J1YA 2V57A 3ANPA 4G12A 3LHQA 3ZQGA 2Y2ZA 3ANGA 5K7ZA 1ZK8A 5HAWA 2O7TA 4GFLA 2ID3A 3BR3A 3PASA 2NS7A 4MK6A 3TP0A 3HGGA 3HIMA 2NP5A 4HKUA 2ZB9A 3T6NA 1T56A 3VW1A 2G7SA 5DAJA 2Y30A 3HTIA 3E7QA 1JUPA 2TRTA 5D19A 2YVEA 3BCGA 3CCYA 2NS8A 4CGRA 2GENA 3BT9A 5D1RA 3Q0VA 2DG7A 2FQ4A 4U9NA 4JKZA 3RH2A 5FMPA 2WUIA 2PBXA 3VUQA 2W53A 2XDNA 4W1UA 3JSJA 3NI7A 3HTHA 3WHBA 5EZGA 1Z0XA 3VW0A 2PZ9A 1QVTA 3NS4A 3EUPA 5J1RA 3BTJA 2ZCXA 4PXIA 5CW8A 5H9TA 3GEUA 3K8PC 4ACIA 3BTCA 5F27A 4OD4A 5F1JA 1U9NA
chains in the Genus database with same CATH topology
3G1MA 2O7OA 3SDGA 3COLA 1JT6A 4JYKA 3BJBA 3QKXA 4GCTA 5HSZA 5F08A 1ORKA 2HQ5A 4MO7A 3AQTA 5FKMA 5IP6A 2G7LA 2HYJA 4AC6A 5K7FA 5J1UA 3EGQA 4NN1A 4KWAA 4AC0A 5F0HA 2G3BA 2OPTA 3LWJA 4B1RA 5EFYA 2VPRA 1QPIA 2IEKA 3G56A 4ICHA 1SGMA 4B3AA 3BHQA 3NXCA 2D6YA 3C2BA 3VOXA 2FX0A 4GCLA 3DPJA 3DEWA 3ZQLA 2Q24A 2VKEA 3NPIA 3F1BA 3QPSA 2WGBA 4UDSA 3Q0UA 3G1OA 3BQZA 2XB5A 2OI8A 2EH3A 4I6ZA 3SFIA 5FHPA 2X9DA 3V78A 2HXIA 3BTLA 4M3EA 2XPVA 3TP3A 1UI6A 3NNRA 3KNWA 3C07A 2XGEA 1ZKGA 2NP3A 3KZ9A 3BNIA 4JL3A 2QOPA 3LSJA 4V2GA 2QIBA 1Z77A 1JUMA 3DCFA 2I10A 4M3GA 4W97A 3QQAA 3AQSA 3CJDA 3KKDA 2GBYA 3V6GA 3LOCA 2XPWA 1BJZA 4AUXA 1RPWA 4YZEA 2ID6A 5GP9A 4GFKA 3CWRA 5K7HA 3BR5A 1U9OA 2F07A 3QBMA 1JT0A 3VVXA 2UXIA 3FIWA 1T33A 5GPCA 3BR2A 5F0FA 3BR0A 2RHAA 2VKVA 3IUVA 2ZOYA 4D5FA 2UXHA 3FK6A 4M3BA 2QTQA 2RASA 3P9TA 2ZCNA 3BR6A 2XRLA 3HE0A 3VPRA 2G7GA 4I76A 3VW2A 4ME9A 2ZOZA 1UI5A 2REKA 2QWTA 2TCTA 2IBDA 3ZQHA 3QPLA 3B81A 2ZCMA 2NX4A 5IOYA 3VP5A 2JK3A 2RAEA 3HTAA 3G1LA 3LJLA 2G0EA 2GUHA 2DTZA 2HXOA 4D7MA 3HGYA 3BRUA 5CXGA 1RKWA 3IH3A 3MVPA 3VOKA 3F0CA 5J3LA 2FJ1A 3ZQIA 2UXOA 1JUSA 2XPUA 2UXUA 3B6AA 3Q3SA 3HTJA 5F0CA 2XGDA 5CXIA 3RD3A 5FKNA 5K58A 2FD5A 3VIBA 2GFNA 3LSRA 2HKUA 1RKTA 3BR1A 3CRJA 4GCKA 5D18A 3NRGA 3O8GA 2JJ7A 4M3DA 5GPAA 5IPAA 4NELA 4DW6A 1A6IA 3BTIA 4AF5A 2FBQA 2X6OA 4V2FA 3FRQA 3FK7A 3VVYA 3VVZA 2OERA 3ON4A 1VI0A 5FKOA 2XGCA 3S5RA 2DG8A 5FGLA 4XK4A 3ZQFA 5F04A 3CDLA 5IOZA 2Y31A 4M3FA 2UXPA 2QKOA 5EYRA 4L62A 2HYTA 3PM1A 1JTXA 2IAIA 3MNLA 2OF7A 3Q0WA 2WV1A 4JNNA 3LSPA 4ABZA 3O60A 4D7NA 2YVHA 1QVUA 3G7RA 3GZIA 5C4YA 4D5CA 3ON2A 4X1EA 5EZHA 3KKCA 1JTYA 3PPBA 5FKKA 5HBUA 3B6CA 5FKLA 4MXMA 3WHCA 3IH2A 5AQCA 3IH4A 2QCOA 2IU5A 3BQYA 3O8HA 5J1YA 2V57A 3ANPA 4G12A 3LHQA 3ZQGA 2Y2ZA 3ANGA 5K7ZA 1ZK8A 5HAWA 2O7TA 4GFLA 2ID3A 3BR3A 3PASA 2NS7A 4MK6A 3TP0A 3HGGA 3HIMA 2NP5A 4HKUA 2ZB9A 3T6NA 1T56A 3VW1A 2G7SA 5DAJA 2Y30A 3HTIA 3E7QA 1JUPA 2TRTA 5D19A 2YVEA 3BCGA 3CCYA 2NS8A 4CGRA 2GENA 3BT9A 5D1RA 3Q0VA 2DG7A 2FQ4A 4JKZA 3RH2A 5FMPA 2WUIA 2PBXA 3VUQA 2W53A 2XDNA 4W1UA 3JSJA 3NI7A 3HTHA 3WHBA 5EZGA 1Z0XA 3VW0A 2PZ9A 1QVTA 3EUPA 5J1RA 3BTJA 2ZCXA 4PXIA 5CW8A 5H9TA 3GEUA 4ACIA 3BTCA 5F27A 5F1JA 1U9NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G1M A;  2O7O A;  3SDG A;  3COL A;  1JT6 A;  4JYK A;  3BJB A;  3QKX A;  4GCT A;  5HSZ A;  5F08 A;  1ORK A;  2HQ5 A;  4MO7 A;  3AQT A;  5FKM A;  5IP6 A;  2G7L A;  2HYJ A;  4AC6 A;  5K7F A;  5J1U A;  3EGQ A;  4NN1 A;  4KWA A;  4AC0 A;  5F0H A;  2G3B A;  2OPT A;  3LWJ A;  4B1R A;  5EFY A;  2VPR A;  1QPI A;  2IEK A;  3G56 A;  4ICH A;  1SGM A;  4B3A A;  3BHQ A;  3NXC A;  2D6Y A;  3C2B A;  3VOX A;  2FX0 A;  4GCL A;  3DPJ A;  3DEW A;  3ZQL A;  2Q24 A;  2VKE A;  3NPI A;  3F1B A;  3QPS A;  2WGB A;  4UDS A;  3Q0U A;  3G1O A;  3BQZ A;  2XB5 A;  2OI8 A;  2EH3 A;  4I6Z A;  3SFI A;  5FHP A;  2X9D A;  3V78 A;  2HXI A;  3BTL A;  4M3E A;  2XPV A;  3TP3 A;  1UI6 A;  3NNR A;  3KNW A;  3C07 A;  2XGE A;  1ZKG A;  2NP3 A;  3KZ9 A;  3BNI A;  4JL3 A;  2QOP A;  3LSJ A;  4V2G A;  2QIB A;  1Z77 A;  1JUM A;  3DCF A;  2I10 A;  4M3G A;  4W97 A;  3QQA A;  3AQS A;  3CJD A;  3KKD A;  2GBY A;  3V6G A;  3LOC A;  2XPW A;  1BJZ A;  4AUX A;  1RPW A;  4YZE A;  2ID6 A;  5GP9 A;  4GFK A;  3CWR A;  5K7H A;  3BR5 A;  1U9O A;  2F07 A;  3QBM A;  1JT0 A;  3VVX A;  2UXI A;  3FIW A;  1T33 A;  5GPC A;  3BR2 A;  5F0F A;  3BR0 A;  2RHA A;  2VKV A;  3IUV A;  2ZOY A;  4D5F A;  2UXH A;  3FK6 A;  4M3B A;  2QTQ A;  2RAS A;  3P9T A;  2ZCN A;  3BR6 A;  2XRL A;  3HE0 A;  3VPR A;  2G7G A;  4I76 A;  3VW2 A;  4ME9 A;  2ZOZ A;  1UI5 A;  2REK A;  2QWT A;  2TCT A;  2IBD A;  3ZQH A;  3QPL A;  3B81 A;  2ZCM A;  2NX4 A;  5IOY A;  3VP5 A;  2JK3 A;  2RAE A;  3HTA A;  3G1L A;  3LJL A;  2G0E A;  2GUH A;  2DTZ A;  2HXO A;  4D7M A;  3HGY A;  3BRU A;  5CXG A;  1RKW A;  3IH3 A;  3MVP A;  3VOK A;  3F0C A;  5J3L A;  2FJ1 A;  3ZQI A;  2UXO A;  1JUS A;  2XPU A;  2UXU A;  3B6A A;  3Q3S A;  3HTJ A;  5F0C A;  2XGD A;  5CXI A;  3RD3 A;  5FKN A;  5K58 A;  2FD5 A;  3VIB A;  2GFN A;  3LSR A;  2HKU A;  1RKT A;  3BR1 A;  3CRJ A;  4GCK A;  5D18 A;  3NRG A;  3O8G A;  2JJ7 A;  4M3D A;  5GPA A;  5IPA A;  4NEL A;  4DW6 A;  1A6I A;  3BTI A;  4AF5 A;  2FBQ A;  2X6O A;  4V2F A;  3FRQ A;  3FK7 A;  3VVY A;  3VVZ A;  2OER A;  3ON4 A;  1VI0 A;  5FKO A;  2XGC A;  3S5R A;  2DG8 A;  5FGL A;  4XK4 A;  3ZQF A;  5F04 A;  3CDL A;  5IOZ A;  2Y31 A;  4M3F A;  2UXP A;  2QKO A;  5EYR A;  4L62 A;  2HYT A;  3PM1 A;  1JTX A;  2IAI A;  3MNL A;  2OF7 A;  3Q0W A;  2WV1 A;  4JNN A;  3LSP A;  4ABZ A;  3O60 A;  4D7N A;  2YVH A;  1QVU A;  3G7R A;  3GZI A;  5C4Y A;  4D5C A;  3ON2 A;  4X1E A;  5EZH A;  3KKC A;  1JTY A;  3PPB A;  5FKK A;  5HBU A;  3B6C A;  5FKL A;  4MXM A;  3WHC A;  3IH2 A;  5AQC A;  3IH4 A;  2QCO A;  2IU5 A;  3BQY A;  3O8H A;  5J1Y A;  2V57 A;  3ANP A;  4G12 A;  3LHQ A;  3ZQG A;  2Y2Z A;  3ANG A;  5K7Z A;  1ZK8 A;  5HAW A;  2O7T A;  4GFL A;  2ID3 A;  3BR3 A;  3PAS A;  2NS7 A;  4MK6 A;  3TP0 A;  3HGG A;  3HIM A;  2NP5 A;  4HKU A;  2ZB9 A;  3T6N A;  1T56 A;  3VW1 A;  2G7S A;  5DAJ A;  2Y30 A;  3HTI A;  3E7Q A;  1JUP A;  2TRT A;  5D19 A;  2YVE A;  3BCG A;  3CCY A;  2NS8 A;  4CGR A;  2GEN A;  3BT9 A;  5D1R A;  3Q0V A;  2DG7 A;  2FQ4 A;  4JKZ A;  3RH2 A;  5FMP A;  2WUI A;  2PBX A;  3VUQ A;  2W53 A;  2XDN A;  4W1U A;  3JSJ A;  3NI7 A;  3HTH A;  3WHB A;  5EZG A;  1Z0X A;  3VW0 A;  2PZ9 A;  1QVT A;  3EUP A;  5J1R A;  3BTJ A;  2ZCX A;  4PXI A;  5CW8 A;  5H9T A;  3GEU A;  4ACI A;  3BTC A;  5F27 A;  5F1J A;  1U9N A; 
#chains in the Genus database with same CATH topology
 3G1M A;  2O7O A;  3SDG A;  2R7S A;  3COL A;  1JT6 A;  4JYK A;  3BJB A;  3QKX A;  4GCT A;  5HSZ A;  5F08 A;  2B3W A;  1ORK A;  2HQ5 A;  4MO7 A;  2FJI 1;  3AQT A;  5FKM A;  5IP6 A;  2G7L A;  2HYJ A;  4AC6 A;  5K7F A;  5J1U A;  3EGQ A;  4NN1 A;  4U9L A;  4KWA A;  4AC0 A;  5F0H A;  2G3B A;  2OPT A;  3LWJ A;  4B1R A;  5EFY A;  2VPR A;  1QPI A;  2IEK A;  3G56 A;  4ICH A;  1SGM A;  4B3A A;  3BHQ A;  3NXC A;  2D6Y A;  3C2B A;  3VOX A;  2FX0 A;  4GCL A;  3DPJ A;  3DEW A;  3ZQL A;  2Q24 A;  2VKE A;  4C2M A;  3NPI A;  3F1B A;  3QPS A;  2WGB A;  4UDS A;  3Q0U A;  3G1O A;  3BQZ A;  2XB5 A;  2OI8 A;  2EH3 A;  4I6Z A;  4IRV A;  3SFI A;  5FHP A;  3VTI A;  2X9D A;  3V78 A;  2HXI A;  4WIB A;  3BTL A;  3KYL A;  4M3E A;  2XPV A;  2R7R A;  3TP3 A;  1UI6 A;  3NNR A;  3KNW A;  3C07 A;  2XGE A;  1ZKG A;  2NP3 A;  3KZ9 A;  3BNI A;  4JL3 A;  2QOP A;  3LSJ A;  4V2G A;  2QIB A;  1Z77 A;  1JUM A;  3DCF A;  2I10 A;  4M3G A;  4W97 A;  3QQA A;  3AQS A;  3CJD A;  3KKD A;  2GBY A;  3V6G A;  3LOC A;  2ZY9 A;  2R7V A;  2XPW A;  1BJZ A;  4AUX A;  1RPW A;  4YZE A;  2ID6 A;  5GP9 A;  4GFK A;  3CWR A;  5K7H A;  3BR5 A;  1U9O A;  2F07 A;  3QBM A;  1JT0 A;  3VVX A;  2UXI A;  2R7T A;  3FIW A;  1T33 A;  5GPC A;  3BR2 A;  5F0F A;  3BR0 A;  2RHA A;  2VKV A;  3IUV A;  2ZOY A;  4D5F A;  2UXH A;  3FK6 A;  4M3B A;  2QTQ A;  2RAS A;  3P9T A;  2ZCN A;  3BR6 A;  2R7O A;  2XRL A;  3HE0 A;  3VPR A;  2G7G A;  2A2F X;  4I76 A;  3VW2 A;  4ME9 A;  3DU6 A;  2ZOZ A;  3FHN A;  1UI5 A;  2REK A;  2R7W A;  2QWT A;  2TCT A;  2IBD A;  3ZQH A;  3QPL A;  3B81 A;  2ZCM A;  2NX4 A;  5IOY A;  3VP5 A;  2JK3 A;  2RAE A;  3HTA A;  3G1L A;  3LJL A;  2G0E A;  2GUH A;  2DTZ A;  2HXO A;  2R7Q A;  4D7M A;  3HGY A;  3BRU A;  5CXG A;  1RKW A;  3IH3 A;  3MVP A;  3VOK A;  3F0C A;  5J3L A;  2FJ1 A;  3ZQI A;  2UXO A;  1JUS A;  2XPU A;  2UXU A;  3B6A A;  3Q3S A;  3HTJ A;  5F0C A;  2XGD A;  5CXI A;  3RD3 A;  5FKN A;  5K58 A;  2FD5 A;  3VIB A;  2GFN A;  3LSR A;  2HKU A;  1RKT A;  3BR1 A;  3CRJ A;  4GCK A;  5D18 A;  3NRG A;  3O8G A;  2JJ7 A;  2R7U A;  4M3D A;  5GPA A;  2B1E A;  5IPA A;  4NEL A;  4DW6 A;  3SWH A;  1A6I A;  2PFV A;  3BTI A;  4AF5 A;  2FBQ A;  2X6O A;  4V2F A;  3FRQ A;  3FK7 A;  3VVY A;  3VVZ A;  2OER A;  3ON4 A;  1VI0 A;  5FKO A;  2XGC A;  3S5R A;  2DG8 A;  5FGL A;  4XK4 A;  4OD5 A;  3ZQF A;  5F04 A;  3CDL A;  5IOZ A;  2Y31 A;  4M3F A;  2UXP A;  2QKO A;  5EYR A;  4L62 A;  2HYT A;  3PM1 A;  1JTX A;  2IAI A;  3MNL A;  2OF7 A;  3Q0W A;  2WV1 A;  4JNN A;  3LSP A;  4ABZ A;  3O60 A;  2R7X A;  4D7N A;  2YVH A;  1QVU A;  3G7R A;  3GZI A;  5C4Y A;  4D5C A;  3ON2 A;  4X1E A;  5EZH A;  3KKC A;  1JTY A;  3PPB A;  4DVY P;  5FKK A;  5HBU A;  3B6C A;  5CQG A;  5FKL A;  3DU5 A;  4MXM A;  3WHC A;  2YVX A;  3IH2 A;  5AQC A;  3IH4 A;  2QCO A;  2IU5 A;  3BQY A;  3O8H A;  5J1Y A;  2V57 A;  3ANP A;  4G12 A;  3LHQ A;  3ZQG A;  2Y2Z A;  3ANG A;  5K7Z A;  1ZK8 A;  5HAW A;  2O7T A;  4GFL A;  2ID3 A;  3BR3 A;  3PAS A;  2NS7 A;  4MK6 A;  3TP0 A;  3HGG A;  3HIM A;  2NP5 A;  4HKU A;  2ZB9 A;  3T6N A;  1T56 A;  3VW1 A;  2G7S A;  5DAJ A;  2Y30 A;  3HTI A;  3E7Q A;  1JUP A;  2TRT A;  5D19 A;  2YVE A;  3BCG A;  3CCY A;  2NS8 A;  4CGR A;  2GEN A;  3BT9 A;  5D1R A;  3Q0V A;  2DG7 A;  2FQ4 A;  4U9N A;  4JKZ A;  3RH2 A;  5FMP A;  2WUI A;  2PBX A;  3VUQ A;  2W53 A;  2XDN A;  4W1U A;  3JSJ A;  3NI7 A;  3HTH A;  3WHB A;  5EZG A;  1Z0X A;  3VW0 A;  2PZ9 A;  1QVT A;  3NS4 A;  3EUP A;  5J1R A;  3BTJ A;  2ZCX A;  4PXI A;  5CW8 A;  5H9T A;  3GEU A;  3K8P C;  4ACI A;  3BTC A;  5F27 A;  4OD4 A;  5F1J A;  1U9N A; 
#chains in the Genus database with same CATH homology
 3G1M A;  2O7O A;  3SDG A;  3COL A;  1JT6 A;  4JYK A;  3BJB A;  3QKX A;  4GCT A;  5HSZ A;  5F08 A;  1ORK A;  2HQ5 A;  4MO7 A;  3AQT A;  5FKM A;  5IP6 A;  2G7L A;  2HYJ A;  4AC6 A;  5K7F A;  5J1U A;  3EGQ A;  4NN1 A;  4KWA A;  4AC0 A;  5F0H A;  2G3B A;  2OPT A;  3LWJ A;  4B1R A;  5EFY A;  2VPR A;  1QPI A;  2IEK A;  3G56 A;  4ICH A;  1SGM A;  4B3A A;  3BHQ A;  3NXC A;  2D6Y A;  3C2B A;  3VOX A;  2FX0 A;  4GCL A;  3DPJ A;  3DEW A;  3ZQL A;  2Q24 A;  2VKE A;  3NPI A;  3F1B A;  3QPS A;  2WGB A;  4UDS A;  3Q0U A;  3G1O A;  3BQZ A;  2XB5 A;  2OI8 A;  2EH3 A;  4I6Z A;  3SFI A;  5FHP A;  2X9D A;  3V78 A;  2HXI A;  3BTL A;  4M3E A;  2XPV A;  3TP3 A;  1UI6 A;  3NNR A;  3KNW A;  3C07 A;  2XGE A;  1ZKG A;  2NP3 A;  3KZ9 A;  3BNI A;  4JL3 A;  2QOP A;  3LSJ A;  4V2G A;  2QIB A;  1Z77 A;  1JUM A;  3DCF A;  2I10 A;  4M3G A;  4W97 A;  3QQA A;  3AQS A;  3CJD A;  3KKD A;  2GBY A;  3V6G A;  3LOC A;  2XPW A;  1BJZ A;  4AUX A;  1RPW A;  4YZE A;  2ID6 A;  5GP9 A;  4GFK A;  3CWR A;  5K7H A;  3BR5 A;  1U9O A;  2F07 A;  3QBM A;  1JT0 A;  3VVX A;  2UXI A;  3FIW A;  1T33 A;  5GPC A;  3BR2 A;  5F0F A;  3BR0 A;  2RHA A;  2VKV A;  3IUV A;  2ZOY A;  4D5F A;  2UXH A;  3FK6 A;  4M3B A;  2QTQ A;  2RAS A;  3P9T A;  2ZCN A;  3BR6 A;  2XRL A;  3HE0 A;  3VPR A;  2G7G A;  4I76 A;  3VW2 A;  4ME9 A;  2ZOZ A;  1UI5 A;  2REK A;  2QWT A;  2TCT A;  2IBD A;  3ZQH A;  3QPL A;  3B81 A;  2ZCM A;  2NX4 A;  5IOY A;  3VP5 A;  2JK3 A;  2RAE A;  3HTA A;  3G1L A;  3LJL A;  2G0E A;  2GUH A;  2DTZ A;  2HXO A;  4D7M A;  3HGY A;  3BRU A;  5CXG A;  1RKW A;  3IH3 A;  3MVP A;  3VOK A;  3F0C A;  5J3L A;  2FJ1 A;  3ZQI A;  2UXO A;  1JUS A;  2XPU A;  2UXU A;  3B6A A;  3Q3S A;  3HTJ A;  5F0C A;  2XGD A;  5CXI A;  3RD3 A;  5FKN A;  5K58 A;  2FD5 A;  3VIB A;  2GFN A;  3LSR A;  2HKU A;  1RKT A;  3BR1 A;  3CRJ A;  4GCK A;  5D18 A;  3NRG A;  3O8G A;  2JJ7 A;  4M3D A;  5GPA A;  5IPA A;  4NEL A;  4DW6 A;  1A6I A;  3BTI A;  4AF5 A;  2FBQ A;  2X6O A;  4V2F A;  3FRQ A;  3FK7 A;  3VVY A;  3VVZ A;  2OER A;  3ON4 A;  1VI0 A;  5FKO A;  2XGC A;  3S5R A;  2DG8 A;  5FGL A;  4XK4 A;  3ZQF A;  5F04 A;  3CDL A;  5IOZ A;  2Y31 A;  4M3F A;  2UXP A;  2QKO A;  5EYR A;  4L62 A;  2HYT A;  3PM1 A;  1JTX A;  2IAI A;  3MNL A;  2OF7 A;  3Q0W A;  2WV1 A;  4JNN A;  3LSP A;  4ABZ A;  3O60 A;  4D7N A;  2YVH A;  1QVU A;  3G7R A;  3GZI A;  5C4Y A;  4D5C A;  3ON2 A;  4X1E A;  5EZH A;  3KKC A;  1JTY A;  3PPB A;  5FKK A;  5HBU A;  3B6C A;  5FKL A;  4MXM A;  3WHC A;  3IH2 A;  5AQC A;  3IH4 A;  2QCO A;  2IU5 A;  3BQY A;  3O8H A;  5J1Y A;  2V57 A;  3ANP A;  4G12 A;  3LHQ A;  3ZQG A;  2Y2Z A;  3ANG A;  5K7Z A;  1ZK8 A;  5HAW A;  2O7T A;  4GFL A;  2ID3 A;  3BR3 A;  3PAS A;  2NS7 A;  4MK6 A;  3TP0 A;  3HGG A;  3HIM A;  2NP5 A;  4HKU A;  2ZB9 A;  3T6N A;  1T56 A;  3VW1 A;  2G7S A;  5DAJ A;  2Y30 A;  3HTI A;  3E7Q A;  1JUP A;  2TRT A;  5D19 A;  2YVE A;  3BCG A;  3CCY A;  2NS8 A;  4CGR A;  2GEN A;  3BT9 A;  5D1R A;  3Q0V A;  2DG7 A;  2FQ4 A;  4JKZ A;  3RH2 A;  5FMP A;  2WUI A;  2PBX A;  3VUQ A;  2W53 A;  2XDN A;  4W1U A;  3JSJ A;  3NI7 A;  3HTH A;  3WHB A;  5EZG A;  1Z0X A;  3VW0 A;  2PZ9 A;  1QVT A;  3EUP A;  5J1R A;  3BTJ A;  2ZCX A;  4PXI A;  5CW8 A;  5H9T A;  3GEU A;  4ACI A;  3BTC A;  5F27 A;  5F1J A;  1U9N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...