5K7FA

Crystal structure of apo aibr
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
184
structure length
179
Chain Sequence
RYRAILETAARLICDRGYEGTSMQEIAAACRMTKAGLYHHIQNKEQLLFAIMNYGMDLFEEQVLSRVQDIANPVERLRACMRHNILLVTRGWSKEVIIILHEGETRAFIDARKKKYVDFLEEAFSQASQQGLIRPVDPTVGAFSFLGMVLWIYKWFKPDGRLTDEQIADGMVGMLFPPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Transcriptional regulator, TetR family
publication title The AibR-isovaleryl coenzyme A regulator and its DNA binding site - a model for the regulation of alternative de novo isovaleryl coenzyme A biosynthesis in Myxococcus xanthus.
pubmed doi rcsb
source organism Myxococcus xanthus (strain dk 1622)
total genus 69
structure length 179
sequence length 184
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17932 TetR_C_24 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 5k7fA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 5k7fA02
4L62A 2CUFA 2JJ7A 2EBIA 3S16J 2F07A 2L9RA 5IP9J 2M8GX 2O8KA 4C3IJ 2EZKA 2FX0A 1Y1WJ 3MNLA 4MXMA 1IDYA 2P81A 1ETKA 1IC8A 4MLOA 1TWAJ 2XPUA 1VI0A 1JTXA 1H88C 2DG8A 1FEXA 2LK2A 3CRJA 3PO2J 2QCOA 2WUIA 2R7ZJ 3AQSA 1HOMA 3KNWA 1HCRA 4D7MA 3K2AA 2K9NA 3JRGA 3EUPA 1QRYA 3NARA 4I6ZA 2D6YA 2Y30A 2X6OA 1ETYA 3JRFA 3GZIA 4DW6A 2X9DA 3LSJA 4ABZA 3S1RJ 2NVQJ 1TWGJ 2JK3A 3BR1A 1U9OA 2AHQA 3F1BA 1S7EA 2E19A 3GBGA 4MIMA 4LOCA 1ETVA 3BCGA 4D5FA 5J1YA 4GFBA 3ANGA 3A03A 2E2IJ 3PASA 4XIDA 2PMZN 2GM4A 5D19A 2ZCMA 2XB5A 2DMPA 1CQTA 5D1RA 2FBQA 2JWTA 1HF0A 4AC0A 1MSEC 3PPBA 4PXIA 2L7ZA 1BW6A 2DA1A 3O8HA 2M2EA 4QTRA 4A3FJ 5FKOA 4ME9A 3WHBA 2K40A 2E1OA 3JSJA 1IDZA 2B63J 1ITYA 1JTYA 5F08A 2O7TA 4XRMA 3HOXJ 1BL0A 2KT0A 5C4XJ 4V2FA 5EF6A 1ZKGA 5HBUA 1Z0XA 2N8GA 1TWFJ 2EQRA 4DYRA 2DG7A 3TP0A 5M3MJ 4FCYA 1IV6A 3CMYA 3DCFA 4BBRJ 1MBJA 5E3MA 4Y52J 1MSFC 3HTAA 2LKXA 5IOZA 2ZCNA 1WPKA 3ZQCA 5FJ8J 2ECCA 2YU9J 2IU5A 2TCTA 3LSPA 4JX6A 3NXCA 3H3VK 2ME6A 3PO3J 3S15J 2YUSA 3B6CA 2NVXJ 5JLWA 3G7RA 5GPAA 3GTKJ 2HXIA 1RPWA 3I4NJ 1XC5A 1JJ8C 5IPAA 4A3BJ 3BRUA 3HEFA 2UXPA 2ID6A 1IUFA 3LSGA 3G56A 2D5VA 3MKLA 1BA5A 2XDNA 3C07A 3JRIA 5J1UA 3G1MA 4HNVA 5D18A 4JX4A 4JNNA 3GTMJ 4A3KJ 3LJLA 1G2HA 2UXIA 4IHVA 3Q0WA 3ZOBA 4M3FA 4EEFG 3LSRA 3RH2A 3VPRA 1GV2A 4GCTA 2PZ9A 3JRDA 2MG4A 1PUFA 3I4MJ 2QTQA 1U78A 2IBDA 2R0QC 1UMQA 3HOVJ 4S0HB 1ENHA 1ORKA 2XPWA 1K83J 2LP0A 4AF5A 3ON4A 5J3LA 3QKXA 3BJBA 5EG0A 4QSHA 3HOYJ 2CU7A 3IH2A 2EZIA 1JUPA 1I3QJ 5IYDJ 2YS9A 1U9NA 3LNQA 4AC6A 1XS9A 4A3JJ 3BHQA 3COLA 2I10A 4L5EA 4BXXJ 2HOTA 3FK6A 1OCTC 1I50J 3HDDA 1MBFA 5FLVA 3JRHA 2ELKA 2WGBA 3ANPA 2Q24A 1K61A 1PUFB 2NVTJ 4IHXA 1POGA 1ZTRA 5CXIA 1Q1VA 2VUMJ 3HTIA 3BTIA 2G7LA 3AQTA 5FMPA 3S17J 2Y2ZA 1U8BA 2DN0A 3VVXA 4M6VA 2UXUA 2R93J 4D5CA 5FKNA 2CQQA 4UDSA 1RETA 1Z77A 5EG0B 2W53A 3NI7A 5CXGA 3QPSA 3CWRA 5C4YA 1F36A 3M3YJ 4ACIA 3NNRA 2MW8A 3SDGA 4YZEA 1TWHJ 2NVYJ 2E2JJ 4GFKA 4DYCA 4XK4A 3WHCA 1FTTA 4AUXA 2RASA 2OI8A 3C2BA 2DA4A 3HGGA 5E3OA 4A93J 1FTZA 2G0EA 2YVHA 4MO7A 3BT9A 3CJDA 2REKA 2ZB9A 4IEJA 2MSYA 3HTHA 1JUMA 4JYKA 5F0CA 3S14J 1OCPA 4A3GJ 2R92J 1FJLA 5EYRA 1GVDA 3O8GA 3O60A 2K9SA 1MH4A 1FIAA 5FLMJ 4B3AA 3VW2A 5K7ZA 2YVEA 1A6IA 2EH3A 5F04A 3DPJA 3VOKA 2ME0A 1OJLA 5EEAA 2DMQA 5C4JJ 1LFUP 1AKHA 2XRLA 5M5XJ 2H1KA 5H9TA 2GBYA 2GENA 4W97A 4C2MJ 3HTJA 3HKZN 1VF9A 2NP5A 4CYCA 1VNDA 1UG2A 4UUTA 5IP6A 1YRNA 1LE8A 4I76A 2LVSA 2GUHA 4DZJA 2O7OA 4B1RA 3JRCA 3D1NI 2WB1N 3BQYA 1QVTA 4D7NA 5M5YJ 4XICA 1JUSA 5HSZA 4A69C 4BKXA 3RQIA 2R5ZA 1F43A 4HKUA 1GDTA 5F0HA 5GP9A 3QQAA 1XG1A 3HIMA 2QOPA 2VKVA 3IH3A 4FE7A 3TP3A 2K9QA 3BR5A 5JLXA 5DTDA 3G1LA 3HOZJ 1BJZA 4FE4A 1QPIA 2XGEA 2IAIA 2G7SA 2ZCXA 4FISA 3TEDA 3OIOA 3JRBA 2DMNA 1AKHB 3QPLA 1UI5A 4NDLA 1WCMJ 2JN6A 4RBOA 5FKKA 2GFNA 2XGCA 2NP3A 3CDLA 1B72A 1IG7A 4M3GA 5HODA 4CYCB 3BG3A 3JR9A 1JGGA 4M3EA 1MBEA 4UUSA 4A3EJ 1R9TJ 1D5YA 3GTGJ 2HI3A 3CCYA 3QBMA 1YRNB 3FKIJ 4DYQA 5IYCJ 1LE8B 1GUUA 3VW1A 3P9TA 1T33A 3BR6A 3GTOJ 2DA3A 4X6AJ 2ZOYA 3GTPJ 2COBA 2R5ZB 2CRGA 2CJJA 4FTHA 5EGOA 4B4CA 2HYJA 3KKCA 1ZQ3P 1T56A 3OOUA 4CGRA 1B8IA 5C3EJ 2HKUA 1ZK8A 3KKDA 3NAUA 2Y9ZA 3Q0VA 5FKLA 4JKZA 5M3FJ 2NS7A 4JX5A 1E3OC 4M3BA 1AU7A 3HE0A 2FD5A 2LR8A 4XRSA 1B72B 2DJNA 1FIPA 4GCKA 4W1UA 2NS8A 5IOYA 2LD5A 1UI6A 2FJ1A 3BTCA 4UUSB 1GT0C 2HYTA 3VVZA 1VFCA 4IHWA 1EF4A 3GEUA 3E7QA 2EZLA 5CW8A 1MBGA 4MK6A 4X1EA 2QIBA 1SGMA 4A3CJ 2QKOA 2EZHA 4DZPA 2W48A 3PM1A 3HGYA 4Y7NJ 3OSGA 3S5RA 3VVYA 2JA5J 2M9HA 3EGQA 1MBHA 1RKWA 5EGOB 1ZGWA 1WH7A 2ID3A 4XRSG 3BR0A 1JKRC 2R5YA 3UKGA 1B8IB 3S1QJ 3VUQA 3OSFA 1DU0A 3FRQA 1H8AC 3RD3A 4A3LJ 2GLOA 2E2HJ 2PBXA 2NOGA 3RZOJ 1WI3A 5K58A 4KWAA 3NPIA 1RR7A 2H8RA 2G7GA 3VW0A 4C3JJ 4ICHA 3FK7A 2DA2A 1WH5A 2CUEA 3L1PA 3A02A 3JREA 3SJMA 1O4XA 1IJWC 1JKPC 5HAWA 1NTCA 4MFEA 1TC3C 3A01A 2OPTA 2Y31A 1I6HJ 2L0KA 4GFLA 1RKTA 1ETOA 5F27A 3G1OA 1IGNA 2DTZA 1RESA 4BY7J 3HB9A 5M5WJ 3GTQJ 1NK2P 1ZR2A 1ETQA 2TRTA 3V6GA 1JJ6C 3IV5A 2DA6A 2RAEA 2JA8J 3ZQLA 3FIWA 2VPRA 2XPVA 3LOCA 5GPCA 2XSDC 2R5YB 2XB0X 1AHDP 5DAJA 2IEKA 3FISA 3T6NA 3H0GJ 1HDPA 5J1RA 2G3BA 2AO9A 2LY9A 5BNGA 1DU6A 5E3NA 1MH3A 5FGLA 4JP0A 3ZQHA 4A3DJ 3ON2A 4NELA 2OF7A 1TWCJ 3IUVA 3BG5A 2NX4A 5AQCA 2ZOZA 1X58A 3A01B 3Q0UA 1JKQC 5IYBJ 3Q3SA 2LLKA 3B6AA 4BBSJ 3E7LA 2VKEA 2L7FP 3VP5A 5DS9A 2JMWA 3BTJA 3B81A 1GV5A 5EFYA 3BR2A 3F0CA 4AYBN 2V57A 3S2DJ 5K7FA 2OERA 1LFBA 2WAQN 3ZQFA 2L7MP 3BR3A 2O9LA 3V78A 2HQ5A 2KDZA 3S1NJ 2CQXA 5EDNA 4RDUA 2LFBA 4C3HJ 3GTLJ 1ETXA 2JA7J 3BTLA 3K7AJ 2M34A 1Y1VJ 1ETWA 4MFDA 2DA5A 1X2MA 4V2GA 2DMUA 3RKQA 3BNIA 1A5JA 1WGXA 5FHPA 3MN2A 3MVPA 3IH4A 3HOWJ 2Y9YA 5EZGA 3ZQIA 5IP7J 5E3LA 2LTPA 2ECBA 3NRGA 1H89C 5K7HA 3ZQGA 1W0TA 3W6VA 2FQ4A 3CQZJ 3DEWA 2HOAA 2M0CA 5F1JA 1JT0A 1MNMC 2Y0SN 2UXHA 3LHQA 2HXOA 5F0FA 1OFCX 3SFIA 3BG9A 2WV1A 1P7IA 1JT6A 1HLVA 1W0UA 3TW6A 1APLC 1SANA 2UXOA 3HOUJ 3KZ9A 4J19A 3HM5A 4A3MJ 3LWJA 1JKOC 1P7JA 4A3IJ 4BY1J 2DA7A 9ANTA 1IRZA 1ZR4A 5C44J 1UHSA 4M3DA 1SFOJ 2DMTA 2JA6J 3VIBA 2MGQA 5EZHA 2QF7A 3RZDJ 3HBLA 2RHAA 4GCLA 3JRAA 4NN1A 2QWTA 1MBKA 4JL3A 3GTJJ 1NK3P 1BW5A 3TW7A 3BQZA 1HDDC 1QVUA 3M4OJ 3S1MJ 4QIWN 3VOXA 1X2NA 4IHYA 2X48A 2XGDA 5FKMA 2VI6A 2HDDA 2HOSA 3S2HJ 4G12A
chains in the Genus database with same CATH superfamily
2PMHA 2P8TA 3GXOA 2YSRA 3H0DA 2JJ7A 2EBIA 2DK8A 2R7OA 4E7IA 4CXFA 4GRIA 3PQKA 4YFNF 4L0YB 1W5SA 4GDFA 2EZKA 1Y1WJ 3JAMZ 1CF7B 2P81A 2VBZA 2CO5A 1T08B 1FOYA 1TWAJ 3PJRA 1VI0A 1K6YA 1BC8C 2WUIA 4IKFA 3AQSA 4IHTA 4NHJA 2BXYA 1HKTA 1D1BA 1MGTA 3JRFA 3R6SA 4ZTFA 2AQEA 3GZIA 2FOWA 2DFFA 4DW6A 3LSJA 4ABZA 3FXQA 2QQ8A 1TWGJ 4RGXA 3RIRA 3ONQA 1U9OA 2QSHX 1Z9CA 1P9QC 1ZGJA 2AHQA 2E19A 3FXUA 4LLLA 1ETVA 1OKRA 1SAUA 1KYWA 2ZY9A 2JPCA 2JUCA 3G4SI 2VXDA 3A03A 1LVKA 2PMZN 4GXOA 3LQQA 4HAMA 5KVRA 2ZCMA 2QLZA 1FP2A 2XB5A 4HV5A 4HLXA 1CQTA 5D1RA 1IV8A 3WU1B 4PFPA 2XGXA 1B6AA 4AC0A 1MSEC 1FOKA 1Y8RB 2FNAA 2BBYA 1S29A 3CTAA 1IRXA 2DA1A 4QTRA 2CGPA 1FBSA 2GQQA 3FZVA 3SYTA 3DEUA 5DM7F 3TDZC 5F08A 1HSTA 3KE2A 3K10A 2KT0A 2KRCA 3P5JA 5C4XJ 3A1YA 2HS5A 4WIBA 1ZKGA 3NS4A 1S5LC 3VYSB 5HS9A 4A2UA 4DYRA 2FEZA 2Q2EA 5HDNA 4XLCA 1XCVA 4EM2A 4FCYA 3A4CA 3KP7A 2V6EA 3DCFA 2Y69H 2WBMA 2BEOA 5DYMA 1X1AA 4RM2A 5E3MA 1XN7A 1Y39A 1M1EB 5TISC 3KETA 5TJJA 2RREA 5IOZA 2LKXA 4ZYHA 1WPKA 1FMWA 2HVSA 1IRFA 3LSPA 5GAEJ 4G8XA 3D5SC 4AVPA 3J81K 1BI1A 3CMAI 5FFZA 1W1WE 3OS2A 1BOBA 2LG4A 1HKQA 4J01A 1FP1D 3I4NJ 5KAIC 4A3BJ 2L3DA 5IPAA 1DP3A 2YX7A 2X4HA 4M6XA 1JE8A 3BRUA 2DI3A 1IUFA 1XX5A 2K02A 2D5VA 1BA5A 2KHMA 4IOAF 3K1PA 3ZN1A 2BY1A 2VE8A 3BP8A 5K1YA 1YG2A 2VQCA 4JNNA 5LGTA 3SHFA 3Q0WA 2P7CB 2V9PA 3U21A 2V79A 4EEFG 3VPRA 4HEA2 1GV2A 2CS3A 3L2WA 4GCTA 3WTUC 2WTEA 4EM1A 3CUQA 1R00A 1ZRCA 2QTQA 3QAHA 1Z21A 3HOVJ 1TNSA 2DQLA 6PAXA 5IT9K 1ORKA 2X6YA 4BE1A 1DP7P 4I99C 4HDVA 3QKXA 4MTDA 5EG0A 1YITI 3HOYJ 4C2TA 3IH2A 4Y17A 3L2CA 1I3QJ 5IYDJ 1STZA 3L00A 4KA4A 4YFXF 1U9NA 2KMUA 4AC6A 4BJ6C 2P5KA 1LEAA 3L2UA 5HLTA 4L5EA 4PJJA 5DUIA 1OCTC 2E1MB 4KICA 1KQ8A 4XKVA 1MBFA 4ZDLA 2CYYA 2ELKA 2ZXWH 1GVJA 3ANPA 2OCEA 3ZQ7A 1PUFB 1TLHB 4IHXA 3DF8A 1ZTRA 3WU2C 2EPFA 3OMYA 2LBFA 4HLYA 4BHCA 1D1CA 2D1HA 2DN0A 3OR2C 4M6VA 1U8BA 1RRJA 2EV6A 4XLNF 3WTXC 4RS8A 1VQ7I 4DVYP 2CQQA 2F4MB 4UDSA 1Z77A 3CUQC 4CYDA 5CXGA 1YIOA 3QPSA 2JT1A 3AG3H 1BR2A 1BR1A 4L9TA 4M73A 3VTIA 1UAAA 2NVYJ 4IVNA 4NUBA 4BDZA 3PUFA 4XK4A 2RQQA 4XSXF 3C2BA 2OI8A 1G3WA 1ULYA 4G9YA 3CJDA 4ESBA 4IEJA 4MQ9F 4M9XA 4ANJA 4E7HA 5F0CA 4ZC3A 3S14J 1OCPA 2CUJA 1FJLA 2R92J 3M8JA 1HBXG 3UR3C 3IL2A 2HTJA 3LA2A 1SMTA 3KZZA 4S04A 5FLMJ 4B3AA 2YVEA 5F04A 4AIDA 5EEAA 5L3EA 4YG2F 3HSFA 1SD6A 5H9TA 5CVIA 2GENA 3CO7C 2M7AA 3HTJA 3HKZN 1VF9A 2DW4A 5FD5A 4CYCA 1D1AA 1B4AA 1VZ0A 1MD0A 1UG2A 3LSHA 3JSOA 5J4YA 1BI3A 5HS8A 2LNBA 1FNNA 2LF8A 2LVSA 2O7OA 5DUKA 2PMZA 2WB1N 1W5CC 3HYIA 4D7NA 3JRCA 2DOEA 5KCMA 4BKXA 1U5TC 4E70A 1XGNA 3N4MA 3CC2I 4HKUA 1GDTA 3DTEA 5F0HA 4HF1A 3RYPA 1P2FA 4Y4RA 3KPHA 4WF2A 4HX4A 3OYGA 2DOFA 5D6EA 1QO0D 5JLXA 4BU2A 3W6KB 2PJPA 3CCSI 3HOZJ 1BJZA 2E5ZA 4FE4A 3TEDA 3OIOA 4BGDA 2IGOA 2ISYA 2GFNA 2XGCA 2KJCA 5E79C 2JA2A 3JR9A 4N9HA 3HTUA 2G7HA 1X1CA 1A31A 1OYIA 3U1DA 2O0YA 4XRFA 2XF7A 3QBMA 2F4IA 3ROUA 2VONA 3I55I 5IYCJ 4PSWA 3A0BC 3VW1A 4HSTA 5HDGA 3BR6A 2KP6A 2O8XA 4YIIA 4X6AJ 1HC8A 1ZN2A 2OD5A 2R5ZB 2CJJA 4BE2A 5EEGA 3LMMA 3MQ0A 3QWLA 3DKYA 3GLLA 4B4CA 4BH9A 2XUBA 4E7LA 1X1DA 2HKUA 2EB7A 4YIRX 4KN4X 3NAUA 2K86A 1VTNC 4GYIA 4J00A 1IN7A 1MDMA 4LB5A 4JX5A 1R49A 1JGSA 2K85A 3LWFA 1QA6A 2VOPA 2AS5F 2LD5A 4WCGA 2UWMA 5J8FA 3J7YJ 2P4WA 1H9GA 1XGMA 2EIJH 3KCCA 3GEUA 1MIJA 2R7VA 1I5ZA 3H3ZA 1V55H 2W48A 2CFXA 1LJ9A 2X51A 1E3PA 2DBBA 1V54H 3LL7A 4Y7NJ 4O3MA 3VVYA 2JA5J 2M9HA 5LGUA 4XKCA 1MBHA 2LF7A 2JTVA 5DD8A 5EGOB 1WH7A 2BZTA 2CUZA 3GFLA 4EJWA 4BJTA 4PZJA 4CO8A 4ZYAA 3BR0A 2R5YA 1B8IB 2Z16A 4NC6A 4Y3OA 3S1QJ 1ZARA 3FWEA 1DU0A 2BHYA 4NQWA 1J75A 2GLOA 2X6XA 1HXDA 1R71A 3RSNA 5D8LB 3RZOJ 5H6QA 3SXYA 4XLHA 5H20A 2H8RA 2O6GE 2PI0A 2P0WA 2VJJA 4RGSA 3JREA 2CUEA 1TQMA 1JKPC 3A02A 5HAWA 2COMA 3HHHA 5HDKA 2IT0A 3WGHA 3K4LA 3E0JB 1ETOA 1F1ZA 3BG6A 4Q5SF 5FGMA 1ZR2A 1ETQA 1WJAA 2TRTA 4F91B 3V6GA 3IV5A 1U2WA 3BJAA 3T5XA 2XSDC 1AHDP 3M7GA 1D0ZA 2NXNB 4D0PA 2W00A 4ZYGA 3FXMA 4A0ZA 4UVBA 3ZQQA 3WTVC 1MH3A 1C0WA 2RKHA 4FX4A 1U5TB 4F92B 3BY6A 3HRMA 3ECOA 2V1NA 2OF7A 4WK8F 3BZCA 3I59B 4UVCA 3BG5A 2K3PA 3FX3A 5AQCA 2V9KA 3A01B 3Q0UA 1FYMA 5HLGA 4BBSJ 3ESWB 1TZLA 4L5JA 2D1VA 3LAJA 2VKEA 2HZDA 3ZN0A 3N97A 3E6MA 3VP5A 4UVAA 1EH8A 1QGPA 2VIXA 4ZYEA 3J80K 2V57A 3VVXA 3S2DJ 5K7FA 1IUYA 2M30A 2V26A 3ML6A 2EILH 2K3FA 3OIQA 3S1NJ 2CQXA 3OYFA 3K69A 2XAUA 2LFBA 4C3HJ 5JFRA 1ETXA 2JA7J 2L54A 5FO5A 1RUOA 3TOBA 4FX0A 3CCLI 3NEUA 3HKZA 1ERDA 2P6TA 1ETWA 3EDPA 4M71A 2DA5A 2PFVA 1X3WB 4NB5A 5FHPA 1N25A 1ZRFA 5EZGA 1I27A 1A6QA 1MMAA 3G73A 2IGKA 2WB1A 2IPQX 5DCFA 1XD7A 5E3LA 4CZCA 3CDIA 3L9FA 4PGGA 1MNEA 5DM6F 1R1UA 3CQZJ 3TOAA 2HOAA 1JT0A 1LDJA 3ABUA 3H35A 2UXHA 4B8XA 5LRRA 3K70D 5D6FA 3SFIA 4E7KA 4EV0A 3OS0A 4I09A 1JT6A 1HLVA 3TW6A 1XDUA 2XF5A 2A6TA 3HM5A 3M1CA 1R23A 4PGHA 4HNTA 4BY1J 4I0AA 1R6RA 2DA7A 9ANTA 4Q47A 1IRZA 2BY2A 1CF7A 1T39A 2FQ3A 3QP6A 3E5XA 2BW3B 3RZDJ 3QRFF 1ZAOA 4GCLA 1OCRH 2PN6A 3GX4X 3OYJA 2HPIA 2MABA 1V5FA 3PNYA 4JL3A 4WXHA 4I98B 4FT8A 5CVRA 3WTTC 1XMKA 4QIWN 3S1MJ 4NBQA 2VB6A 1X2NA 3IHUA 2XGDA 5FKMA 2IRFG 1PP8F 4D1QA 3HXLA 3CMMA 3ZCOA 2V1UA 3VWBA 4G12A 1HQCA 2YU3A 4RAGA 3X2QH 4L62A 3E5QA 4ZZLA 1P4WA 2ETHA 3GFIA 5B5EC 2X6WA 2K9LA 1FT9A 3MAJA 3PIPF 4JK1X 4PUSA 2L9RA 2O8KA 4C3IJ 2WC2A 2V9VA 3K70C 1T95A 3F3XA 2OTJI 2XPUA 1JTXA 3V7RA 3AG4H 3CRJA 2ZFUA 3MZHA 3I9V2 3L7WA 1HOMA 5L3FA 4IF4A 4QPQA 2VBXA 5FRNA 2EFOA 1HCRA 4LB6B 2ZBKA 3EUPA 3K8PC 3NARA 2M5WA 3HRTA 4I6ZA 4XM3A 2Y30A 2X9DA 4LK0F 3S1RJ 2HQRA 2NVQJ 3CLQA 3SZPA 3RPUD 2RN7A 3T0YA 2ZSHB 1IN4A 2YR2A 4IOCF 3F1BA 1T8IA 3GBGA 4LLNA 1HKSA 4K2EA 3HOTA 1PP7U 3ABMH 1FLIA 2UZKA 3F6OA 2JUGA 3BCGA 1IW7F 1EKEA 1MMNA 4HYEA 2IGMA 2E2IJ 1G3TA 4CZZA 2GM4A 2XSJC 3A2KA 3ZXSA 1G6NA 2KJBA 2CFOA 4JBAA 4AD9A 1IAWA 5F64A 1FZPB 2ZXJA 4LK1F 4BHPA 2CQ7A 1O57A 1BW6A 1SFEA 2M2EA 4A3FJ 4ME9A 3WHBA 1O7LA 5FFXA 1IDZA 2O7TA 4XOPA 1OCOH 1BL0A 2WY7Q 4Q48A 1W4MA 3LAPA 1Z0XA 3G3ZA 2FXAA 5LEJA 4AM3A 4XSZF 2EQRA 2GOXB 2DG7A 3TP0A 1J2XA 1KU9A 2HWVA 2VQLA 3CMYA 2DPUA 4S05A 2R7WA 2R4GA 1NHAA 2QQAA 3PUBA 2ACJA 2DYRH 1D3YA 4BACA 4OIOF 3CP8A 3DPLC 2YU9J 2A6EF 2MLKA 2RQPA 3IKTA 4CUGA 2QGUA 4JX6A 2W7NA 1ZH5A 3H3VK 2ME6A 3S15J 3B6CA 2NVXJ 3GLXA 1FYKA 4UNOA 5GPAA 5LFAA 2IXSA 3GTKJ 2QSGX 1XC5A 1JJ8C 2AXTC 3ULQB 3LSGA 5BS6A 3C18A 3JRIA 1HSJA 3VDXA 3G1MA 2Z33A 2EK5A 2QM3A 5K5QA 2D2WA 1SVMA 1T2KA 3LJLA 3SEQA 1G2HA 3IRQA 5LHIA 3ZOBA 2CW7A 2E35A 5HOOA 3RH2A 3EUHA 3KEYA 3P9KA 3K0LA 2PZ9A 2RGVA 3JRDA 4BAYA 4EJVA 3GYHX 2ZJ2A 1PUFA 2W84A 3I4MJ 5JHUA 1OR7A 3TL4X 3DU5A 2FU4A 2HOEA 1Z67A 2XPWA 4CCNA 2GOMA 2CWEA 1LFPA 4DJAA 3CDHA 3DPUA 4QWQA 2OZ6A 4QLCU 2CU7A 2EZIA 4KIFA 1JUPA 4ZDPA 2YS9A 5K5OA 2IS4A 2IS1A 1D5VA 3LNQA 1K4SA 3GEZA 1AA7A 3TMOA 3VYTB 1RI7A 3BHQA 3COLA 4YRVA 2UUZA 2HOTA 5GAGJ 5D8KB 2XRNA 2LDUA 2R7FA 4UB6C 4RLQA 1MJBA 3CCMI 5KAFC 1UB9A 1F9NA 2XASA 4ESFA 1GXPA 2VUMJ 1V3FA 5CXIA 2CW0F 1WJEA 3C2GA 3AQTA 2E1MC 2Y2ZA 1PVEA 3EUHC 1IF1A 3CC7I 2KISA 4GYGA 1XTAA 3SEZA 1WJDA 3HRUA 4HW0A 3TO7A 1ZHFA 4MQVA 1OR7C 4FASD 4ACIA 2R7TA 1O3SA 2WY8Q 3J80Z 2KIMA 3CCQI 2HTSA 4CSWA 1MNDA 2E2JJ 2DXIA 1FTTA 4NC7A 3HGGA 4XKBA 2OQGA 5GTHC 1XPXA 1VQLI 2ZB9A 3KYCB 3WU0A 4JYKA 3RKYA 4F52A 1T98A 1X4PA 1BN5A 4F3QA 3EYYA 4IHSA 5EYRA 1GVDA 4R79A 3S3NA 3O60A 3VW2A 3DWLE 5K7ZA 2RDPA 3OYMA 1VQ6I 1A36A 3G2BA 2DMQA 3CZ6A 4HX8A 1LFUP 2XRLA 1N78A 1Y0NA 2H1KA 5HVQC 2GBYA 2TDXA 2NP5A 2IVMA 4XLAA 1BR4A 1SVOA 4UUTA 3RJPA 2OTLI 1Y8QB 4EJUA 3CCRI 1S72I 4B1RA 1ZYRF 5CQEA 3RDIA 2IP2A 4A69C 3ASOH 2R5ZA 2DT7B 4EVIA 1JHFA 3QQAA 4I2OA 1IN6A 4Y15A 4OAYA 5DTDA 3G1LA 1VQMI 4RB2C 1QPIA 2XGEA 3HUGB 4ZH4F 2ZCXA 4JQFA 3JRBA 2DMNA 4I01A 3QPLA 1ZLJA 1WCMJ 2JN6A 2EA4A 3OY9A 2P7VB 4Y13A 4M9ZA 4OU0A 1OMIA 3V7SA 1Y0UA 3EQLF 5HODA 1JGGA 3H5NA 4A3EJ 1R9TJ 3GTGJ 3QOPA 1D5YA 2O61A 2BOLA 1Z6TA 2HKXA 3DP7A 3REOA 1YRNB 1FSEA 1O7FA 3OYIA 3CMEI 3GTOJ 3SDBA 4ENJA 1WJFA 1LNWA 1BBYA 5D5VB 1HW1A 3GTPJ 2P6SA 3K4JA 4XOTA 5EGOA 3BWGA 5EEHA 1D0YA 4IQJA 3N05A 5B3SH 1B8IA 5C3EJ 2CMPA 1D8JA 3KZYA 3K1NA 5GADJ 1T6SA 4EM0B 1MMSA 3Q0VA 5FKLA 5M3FJ 1AU7A 2A6HF 2FD5A 3HE0A 2DJNA 2ISZA 4W1UA 4A0XA 2FJ1A 4UUSB 4E7SA 3KP4A 2ZFWA 3GFJA 1EF4A 1ACIA 4KYWA 3FHNA 4G7ZF 2EZLA 1I39A 3CF2A 3GMEA 5IT3A 4MK6A 2QKOA 4A3CJ 2RNJA 3R0AA 4U87A 3WTSC 2FNPA 5BPIA 2X0LA 1YJNI 4XLFA 3EGQA 5EJCA 1W7PD 1GLNA 1Z3XA 2F5EA 2ZMEC 1ZG3A 2W24A 3DTKA 1YX5A 1JKRC 1LPQA 3GO5A 2KKOA 3BZ6A 2HR3A 4XR6A 4KITB 3AL0B 3OYDA 1UCRA 2E2HJ 2PBXA 4AWXB 4UXNA 4ENNA 2STWA 4KMFA 3NPIA 2XKPA 1RR7A 3BROA 4C3JJ 1OYWA 1UZCA 2XAJA 1U5TA 3GZNB 2ZJPF 4YELA 2DA2A 1IJWC 3SJMA 3I59A 3WG9A 1DGRM 1NTCA 4MFEA 1WFXA 5KNLA 4XQFA 2OPTA 3A01A 1LDDA 1QPMA 2QENA 1KU3A 5F27A 4NC8A 4BY7J 2A5WA 5M5WJ 3GTQJ 3H3UA 4CCLA 2DA6A 5LGNA 2M4GA 5CPRB 3KLOA 2H1LA 2VPRA 4L9NA 1KONA 2K7LA 2XB0X 1UHWA 1Z7LA 4A6EA 5DAJA 2FSWA 2ZSIB 2VBYA 3ERMA 2UXXA 5H6RA 3OR1C 1HDPA 5J1RA 2E7XA 2XV4S 2Z5UA 5BNGA 4OD5A 5FGLA 3VSKA 3V8LA 4A3DJ 1I1GA 2HZTA 4MHGA 3VOEA 1TWCJ 2LC2A 5DV5A 3IUVA 2F48A 4XL9A 2NX4A 3OYNA 2ZOZA 2Y75A 1JKQC 3Q3SA 2CG4A 2FJI1 5LBQA 1R1VA 3IWFA 1T0FA 2A5YB 3BTJA 4AU7A 3B81A 2EFPA 4LD5A 5B66C 3OV8A 2X1EA 3ZMUA 2OERA 1LFBA 1R4MB 2VODA 2X85A 2QBYB 2O9LA 5E1ZB 4MEXF 3HSEA 1OISA 4OMZA 2KDZA 2ELJA 4CA0A 2NVUB 4PJLA 1L0OC 3H9QA 2VQHA 2VC0A 3BTLA 4ZZDA 4XNFA 2IA2A 1J7KA 3GFMA 1Y1VJ 3P9CA 5H2FC 3T1BA 1X2MA 2DMUA 3ZP5A 3W2AA 3S2WA 4PJ0C 3BNIA 1Z6RA 5L3GA 1WGXA 4E7ZA 1XDSA 2VXZA 4HNUA 2VBWA 2A61A 2HYFA 5FD6A 1IXRC 2BW3A 2KIUA 1USTA 3ZGKA 1DGWY 3KP2A 3DQVC 1UG0A 1F5TA 2LTPA 2ECBA 2PEXA 3FMRA 3F9KA 1KQ9A 4G6DA 1MJ9A 2QQBA 1Y6IA 2F6CA 2KIFA 2VC1A 1DDNA 3W6VA 5HLIA 2WAQA 2G9WA 3DEWA 2M0CA 4PK4A 4LIVA 1TBXA 2JZYA 4NNJA 5CVUA 1MNMC 2Y0SN 2OBPA 5F0FA 3I4PA 3W2WA 2H27A 1YHQI 4ZYDA 5DD4A 2WV1A 2MFZA 4E7JA 2FA5A 3EPZA 3LQRA 3HOUJ 3KZ9A 1T0FC 4A3MJ 2LRDA 3LWJA 2B3WA 1JKOC 1Y56A 2H94A 4DOZA 5E1WA 1K78B 1QZEA 3QODA 4OMYA 3H5RA 1UHSA 4M3DA 1REPC 1EJ9A 2WA0A 3CP2A 3ECHA 2DMTA 3VIBA 2ZMEB 3F6VA 5EZHA 4H0EA 4LG0B 1WKMA 4IPAA 2M7BA 4OWRB 4DNCA 3GWZA 3HBLA 2ZXIA 5CJ9A 1QZZA 2QWTA 4ON0A 1MBKA 2PG4A 3K4NA 1SD5A 3GTJJ 1NK3P 4UUVA 1VQOI 4XLPF 1S9HA 1YE9A 2QKLB 4IHYA 1TW2A 3MCZA 5JR3A 4UB8C 2VJ5A 3S2HJ 3HOSA 3CF5F 1KU7A 2CUFA 3I0TA 1GXQA 2UXNA 2A2FX 2ZJRF 5BOXA 3F23A 2QWWA 3WGIA 2M8GX 3KYLA 2FX0A 3MNLA 4MXMA 1ZGAA 1IDYA 2FRHA 3FDYA 2BY3A 1IC8A 3RTRA 5JVGF 2EIMH 2L4MA 1H88C 2LK2A 3F72A 2QCOA 4C2UA 3FMSA 1H9TA 2JSCA 4I0BA 2M45A 3S3OA 3VODA 4MGRA 3JTHA 4D9JA 2K9NA 1SFXA 1QRYA 2M1BA 3K4KA 4B09A 2UV1A 2MD5A 1W7PB 1W36D 2D6YA 2NS0A 1TQIA 4L0ZB 1ETYA 1Z3YA 3CESA 1I1SA 2K5CA 3P9IA 3J7AY 4RM3A 3DEEA 3E3VA 2OUMA 1Z1DA 3J81Z 2V7FA 1S7EA 2R7QA 2QYOA 4LOCA 2Z1DA 3BC8A 5J4VA 3FKJA 5J1YA 1KQ0A 1LDKB 2BV6A 2CV0A 4GFBA 3ANGA 2L7KA 4XIDA 5AIPA 5D19A 1YS6A 2L9NA 1MW7A 1XSXA 2FE3A 2DMPA 2JWTA 2MA3A 5DCMB 1HF0A 3PPBA 4U9LA 2L7ZA 3JW4A 3O8HA 4IL6C 4KT5C 3JAMK 2K40A 1WHUA 3PIOF 3TO6A 2B63J 2ZC2A 2NRAC 4EJOA 2FBHA 4XRMA 2CV2A 1LQ1A 4AIHA 4IX7A 2CH0A 5EF6A 5J8CA 4ASNA 2G7UA 2N8GA 3PNTA 1TWFJ 2NNYA 3G6EI 3DXJF 1IV6A 2A07F 4FQGA 1XMXA 1P6RA 2JPBA 4BBRJ 1MKMA 5IT9Z 5A2QK 2DOAA 3H9GA 1RC9A 5LLQA 1MSFC 4EGZA 2ZCNA 3EETA 5FJ8J 2ECCA 3ZRGA 4N0BA 3DU6A 1IN8A 2HFHA 2QUFA 3PNVA 3BZKA 1QQIA 3MFKA 2YUSA 4WXCA 1R4NB 3IC7A 2OZUA 3KZIC 4HQMA 3G7RA 2E34A 4BQAA 2HXIA 3KP3A 2VN2A 2HQAA 1KZHA 3ABTA 3IAS2 2NNNA 2UXPA 2ID6A 3O2PE 3G56A 2EA2A 4G94A 1VQPI 4HBLA 2VL8A 3L2VA 3SZGA 2Q8KA 4JX4A 3V8JA 5HNHA 4CDGA 4A3KJ 2E71A 4IHVA 4IO9F 4HPQA 1K6OA 4DQ2A 1B9MA 4KUMA 2XAGA 4IQ4A 2DJIA 1VQ4I 3PSIA 3RPQA 1RR8C 5LD2C 3LA7A 2DQRA 4YIFA 3B02A 1EV7A 1UMQA 4S0HB 4A6DA 5CKTA 1K83J 3ON4A 2Y0SA 3OL4A 4WXDA 4CH7A 5K5RA 1XSVA 4RA2A 3OYKA 4G6QA 2PLYA 3BOQA 2VQGA 3ZMTA 4ESJA 1VQNI 2V4JC 2P5LC 1XS9A 4A3JJ 5B1AH 2I10A 1JI8A 2R7DA 3FK6A 4ZDOA 4LGWA 2XDVA 2VJIA 3TBIA 4CGZA 3HDDA 1FX7A 3ZMDA 2XIGA 5D4RA 2E5NA 3HHGA 1K61A 3CCJI 1POGA 2JVGA 3HTIA 2I5UA 3PFYA 1FBQA 2KLOA 2G7LA 5FMPA 1WJCA 2LYCA 4BEHB 2DPDA 3MD2A 1HW5A 1I6XA 2DCEA 3QYEA 4HV6A 4RAZA 1V5GA 5FKNA 3U1KA 4A5MA 4CCKA 3F22A 2W53A 2Z99A 4RLFA 1X19A 1F36A 3NNRA 4B44A 1YW8A 2QQ9A 4RB1A 2KPMA 2MW8A 1YI2I 1TWHJ 1X4OA 1G3YA 4HZFA 4DYCA 1QHGA 2VPLA 3RPUA 2D45A 2Z2SB 4AUXA 2RASA 5AIQA 2Y0MA 5E3OA 2DA4A 1FTZA 1X1BA 5L3CA 2Q1ZB 4MO7A 1Z05A 2K27A 2L9SA 3HTHA 1JUMA 1QNTA 2WAEA 4IRGA 4H4KC 1TQPA 2B7EA 4HA8A 2LY2A 5DEQA 1FIAA 2XKOA 3SWHA 4L5IA 2IW5A 1A6IA 2EH3A 2W1OA 2ME0A 3HUGA 5C4JJ 4U9NA 2MD0A 3OYAA 3E1SA 3BJOA 1WI9A 4W97A 1BIAA 4C2MJ 1MJAA 1BI2A 2ELHA 3F8MA 3RCOA 2CW8A 3HRSA 1LB2A 5IP6A 2R7XA 1YRNA 4I76A 2GUHA 4DZJA 4AIKA 4F93B 3CLOA 1QVTA 4ENKA 1FOWA 4XICA 1JUSA 5HSZA 4ZTJA 2FUG2 3BG7A 2XC7A 3HTSB 3WODF 4PCQA 2R7SA 1MMDA 3V42A 3HIMA 4I02A 3IH3A 3PL8A 3TP3A 2K9QA 2LH9A 1NH3A 2BVLA 4II3A 3K4BA 5FRMA 2HPMA 4XN3A 4RAYA 2G7SA 1OQYA 2L2OA 4PDKA 5ILSA 5HNFA 1AKHB 3FXOA 1UI5A 4NDLA 3HL2A 1ZRDA 3LFKA 1TW3A 5FKKA 2FBIA 4C2MA 4PJNA 3CJRB 3CDLA 4U88A 2NP3A 3WTZA 3C3WA 4M3GA 1IG7A 2DFIA 3BG3A 5DDGA 2R7RA 1MBEA 4UUSA 1U3EM 5FLXK 3M9AA 2BY0A 3H9JA 2Z9OA 3DKWA 3FKIJ 4DYQA 3G71I 1LE8B 2MH9A 1T33A 2EJRA 1E17A 2L02A 5D5WB 3VEPA 2DAOA 2HGCA 2ZOYA 2COBA 2BYVE 3WTYC 4FTHA 2Y48A 3HIFA 3V4GA 2HYJA 1ZQ3P 1T56A 5CYVA 3OOUA 4KFCA 4CGRA 2CSOA 2GAUA 3F21A 1ZK8A 1YX3A 2F5VA 3E6BA 3WGGA 1O3QA 3K9TA 1J9IA 3CCEI 1PDNC 4LLGF 1I3AA 4JKZA 4EJTA 4RAFA 4WX9A 2OC6A 4V19K 1B72B 4GCKA 1FIPA 3K4MA 4QPOA 4ETSA 5CQGA 5IOYA 4I7HA 3F8NA 4RGUA 2EINH 1GT0C 2HYTA 2QVOA 2XVCA 4IHWA 1ZG5A 2RV8A 5CW8A 1MBGA 4X1EA 1SGMA 3COAC 2VASA 1IRGA 1WZ2A 3O3KA 2XAQA 3H92A 4OIRF 3HGYA 2ZNYA 1FSHA 3S5RA 3SFZA 2KRFA 2W57A 4M72A 1BC7C 4LITA 3S32A 4RMNA 3DKXA 1HA8A 2LMDA 3UKGA 1R5ID 3DBRB 3CJNA 1EH7A 3VUQA 1S7AA 1YYVA 3OYCA 4Z2YA 3ZMVA 3RD3A 2FOKA 3AG1H 1V4RA 2NOGA 1S7OA 4KWAA 2JVHA 4UV9A 1YQAA 3DLAA 3E6DA 4PSXA 2G7GA 4BS9A 4ICHA 1O3RA 1WH5A 3L1PA 4ITVA 3R0JA 1XSDA 1TC3C 3AL0C 1I6HJ 2L0KA 1RKTA 1FY7A 4GCVA 4WWCA 1IGNA 2DTZA 3WTWC 1IN5A 3HB9A 1OPCA 3GVAA 4ZJZA 3ASNH 2VLAA 3JTGA 2RAEA 2ZO4A 2CQNA 3ZQLA 1YJ9I 3FIWA 3CCUI 2PMUA 2QKMB 5BQTA 3IAM2 5A2QZ 5GPCA 1WVRA 3V8KA 2QBYA 3KP5A 4HRIA 3OL3A 3D5RC 3QYBA 3FISA 3H0GJ 4ENMA 5E8GA 2G3BA 4RB3C 4KT6A 3CD6I 3LSKA 4OIPF 2H8WA 2HDWA 1WQ2A 2LSOA 4JP0A 4EMSA 3IP4B 3ZQHA 3SZTA 1QBJA 3D0SA 4NELA 4A5NA 2FBKA 3FHZA 2JRTA 1YW9A 2VT3A 4AVZA 2GA2A 4LFUA 5IYBJ 3RYRA 2IS2A 2F2EA 3E7LA 3SQNA 5HS7A 3MEXA 5DS9A 5EFYA 3BR2A 4LG3A 4AYBN 3HG9A 2VKDA 2GZWA 2WAQN 3GZ5A 2W25A 3BR3A 4KJZA 4DBQA 5EDNA 2OJED 4M74A 3GTLJ 2OU2A 2M34A 1SAXA 1R22A 1R1TA 1J5YA 4MFDA 1YFHA 1MMGA 1K78A 1TNTA 3MZYA 1YW7A 1A5JA 3MN2A 3DBLB 3ZQIA 3Q9VA 2ZMEA 2AXLA 5IP7J 4LG0A 3K6GA 1DUXC 2YPRA 5J40A 1FYLA 3MKWB 1H89C 2L4AA 2NOJB 5E1XA 1W0TA 3HPGA 2E1NA 2B9SA 3I56I 1SMYF 3I58A 3M1EA 4CHUA 1RUNA 4P55A 2DTRA 4BQQA 2VKHA 1USSA 1W0UA 1SANA 4KIGA 4XONA 4J19A 1IXSB 4O5VA 1PYVA 3LFUA 1P7JA 4BXUA 3RKXA 3WG7H 1ZLKA 1X1PA 3FM3A 5C44J 2EV5A 5BPDA 3CC4I 2MGQA 3KX2A 4BYYA 2QF7A 1SFKA 2B0LA 2HYGD 2PJRB 4UY8I 2RHAA 4NN1A 2LKPA 2DFHA 2HVQA 2HKOA 2EWNA 2A05A 3U2RA 3TW7A 3BQZA 3CCVI 3M4OJ 2DO7A 4HOBA 1D0XA 2XROA 1JXSA 3VOXA 1W7PA 2MYSA 2ADUA 1MZBA 2X48A 3NRVA 4XKWA 2VI6A 5AONA 3NQOA 3VYUB 2HOSA 4CCMA 4CICA 3KIOA 2WADA 5KK1A 2HU9A 2AQFA 1SFUA 1WRJA 1NG6A 2O3FA 3S16J 2F07A 1DPUA 4BJ5C 3IRRA 3CO6C 2HVRA 1L3LA 5IP9J 5ICFA 2HEOA 2RNGA 1JHHA 3E5UA 1N77A 1ETKA 4O6JA 4GO1A 1U0JA 4MLOA 5ICCA 4OIQF 1DQUA 2DG8A 3R4KA 5E20A 1FEXA 3RKWA 3R60A 3AG2H 5DCMA 3MKZA 3PO2J 1ONVA 2ZJQF 1IZ1A 2R7ZJ 1Q1HA 3KNWA 2PQ8A 1P92A 4CCOA 4D7MA 3K2AA 3JRGA 3FXLA 1WWXA 2X6OA 3QPTA 3CJTB 3ZR8X 3FXRA 2ESNA 2ZNZA 2JK3A 3BR1A 3M07A 1EA3A 3K4CA 4P5OA 3F8CA 1BM9A 4BNCA 3KEQA 3FBNB 4HSRA 4MIMA 3M8FA 3S93A 1RZ4A 5F1RA 2GIZA 4GGGA 4B47A 5ERIA 2I8DA 3MMYB 4D5FA 1F4KA 1E2XA 2V1XA 4IRIA 2M8EA 2QSFX 4P9UA 2STTA 3PASA 1YS7A 1XB4A 4MTEA 2L01A 4XMYA 5KHDA 4E6KG 2FBQA 4M6YA 3P7NA 2GWRA 4PXIA 2KL4A 2ZCWA 3AFHA 4BXFA 5FKOA 4F55A 1RNLA 2E1OA 2MC4A 2Z3YA 2E7WA 5LHGA 3I64A 5FLXZ 1JTYA 4B48A 4KISA 2YX4A 1ITYA 3HOXJ 4V2FA 4JOMA 1TTYA 1E3HA 5HBUA 1R5GA 2W82A 5B1BH 1VQ9I 2IA1A 1K4TA 3I3LA 4DBRA 5M3MJ 3FXKA 4L9VA 3HZJA 1HW2A 4YEJA 3AKZA 1T38A 1B9NA 3BPVA 1MBJA 1UFMA 4Y52J 3GF2A 5BMZA 3TKYA 3HTAA 3ZQCA 1R7JA 1V5EA 2IU5A 2TCTA 3NXCA 2XHKA 3PO3J 5D5XB 4F7ZA 2W85A 3WE2A 5JLWA 4AYBA 3HSRA 2BE5F 5LRSA 5E17F 3W6JB 3TGNA 1RPWA 1ODDA 4L18B 3I53A 3KLNA 1GHCA 3HEFA 5GAHJ 5ILUA 3RI4A 2DK5A 3QU6A 1IXCA 1ON1A 3MKLA 2XDNA 3OYEA 3C07A 5J1UA 3GW2A 4HNVA 1Z7UA 5D18A 2GA1A 3ISPA 1OYYA 2Q2EB 3GTMJ 2KDOA 4G7HF 3LSMA 2UXIA 1XMAA 4M3FA 3TDUC 3LSRA 4EGYA 2YVXA 1R58A 1Z91A 1ON2A 4LIUA 2ZKZA 1NG7A 4IXAA 2CV1A 1VQ8I 3OWTA 2MG4A 3KP6A 2F5FA 1U78A 5TGTA 2X1DA 1ZELA 2IBDA 5D4SA 2OQRA 5JVTA 3JSPA 2R0QC 4FHTA 4A12A 1ENHA 2LP0A 4BEHA 1ZREA 2E1CA 3HPHA 1D8KA 4AF5A 4MEYF 3Q9SA 3GCMA 5J3LA 1FOXA 3BJBA 1TT5B 4UHTA 4QSHA 3RQ4A 1G3SA 1BIBA 3L09A 2A68F 3EUKL 2VT2A 2DT6A 3PSFA 3DV8A 4U0WA 3H1CA 4BXXJ 2BGCA 1ZG1A 3K2ZA 1I50J 4P96A 4OAZA 5JI6A 3KFWX 2X1CA 4YFKF 4Z6YA 1WSUA 5FLVA 1G8XA 1OCCH 3JRHA 2WGBA 3CUQB 3Q5FA 2Q24A 4P1WA 3H36A 3MKYB 1OCZH 1TT0A 2NVTJ 5CVVA 3C7JA 4BQNA 1Q1VA 2QEXI 3BTIA 4G7OF 2GXGA 3S17J 1B59A 2UXUA 2BXZA 4U7DA 2R93J 2HQNA 4D5CA 2BHZA 1X3ZB 2K9MA 2H6BA 1RETA 5EG0B 1YJWI 3F8BA 3NI7A 3CWRA 4U0VA 3I54A 5C4YA 4IZZA 3M3YJ 4RB0A 3OIPA 1TP4A 2MC3A 2ICWG 3SDGA 4YZEA 2PFBA 3QOEA 4BQOA 3R61A 4GFKA 4KMUX 4KIBA 2MH2A 3WHCA 5HLHA 2MLGA 2A3SA 1K79A 1FC3A 4C30A 2V6CA 3HJEA 1SD4A 2OA4A 3AAFA 4A93J 3CJQB 2G0EA 2YVHA 3BT9A 2REKA 2MSYA 3WE3A 3OOPA 1SVLA 2W4SA 3T8RA 4A3GJ 2LY1A 3NWSA 3GUDA 3O8GA 4HF2A 3VYRB 2XAFA 4HX7A 2K9SA 2LBFB 1MH4A 3DLLF 2HDCA 1P4AA 1PUEE 3QU3A 1RIOH 3DPJA 3VOKA 4X0GA 1OJLA 4BUPA 5IY5H 1AKHA 1OLTA 5M5XJ 3PQJA 3GZ6A 5JHFA 5ILVA 3MZ8A 1VNDA 3FF5A 4TV7A 1A04A 4OOIA 2R7UA 4A0YA 1W5TA 3QP5A 1LE8A 2O5RA 4PJMA 4B43A 1YTYA 2F5DA 3D1NI 1UJ8A 3BQYA 4EQQA 1EH6A 5M5YJ 1W36C 1J0RA 3VSLA 3RQIA 1F43A 2VE9A 1S6LA 4OINF 4DIQA 4C9YA 3OYLA 5GP9A 1XG1A 2E36A 2QOPA 1X3UA 2VKVA 1J09A 4FE7A 2EV0A 3E6CC 1SEUA 3BR5A 4HDUA 4BDYA 3JSJA 2IAIA 2DU9A 2K4JA 1DPRA 4FISA 3H5AA 3DFGA 2XAHA 2M4KA 2PX9A 1VQKI 4RBOA 3CUOA 3B73A 4L9JA 1B72A 3DBHB 1N75A 4CYCB 4M3EA 2H09A 1FPQA 5F6FA 1WJ5A 3OS1A 2HI3A 2E60A 3I71A 3CCYA 1VQ5I 1FMVA 1K7AA 1AOYA 1GUUA 5E18F 3OYBA 3P9TA 2DLLA 1UHMA 1QZYA 2A69F 4OD4A 2PBIA 2DA3A 4II2A 2J5PA 1LUJB 2IS6A 2CRGA 3ABKH 2ESHA 2MBFA 1H0MA 2DODA 3QPHA 3KKCA 4BE0A 2DT5A 3W3CA 1BJAA 5ICGA 1BI0A 2FMYA 3KKDA 2RVCA 3BJ6A 2L9VA 3EYIA 2Y9ZA 2HNHA 2NS7A 5J47A 4M3BA 1E3OC 3QYFA 3S8PA 2LR8A 4XRSA 2C6YA 1XGOA 2NS8A 1UI6A 2FMLA 1KYZA 3BTCA 1E0EA 1P4XA 3BDDA 3VVZA 2KZGA 4U7BA 1VFCA 3ZPLA 2RC4A 5GTIC 2JRMA 3E7QA 2QIBA 4M9SA 2FF4A 2EZHA 4DZPA 1SC7A 1KA8A 4XN0A 3PM1A 4HQEA 3OSGA 3UNGC 3E97A 4KDPA 2DFEA 5CVJA 1U6GA 4PFOA 2M87A 1RKWA 4N4OB 2CQKA 1ZGWA 2ID3A 3OYHA 5E8IA 4XRSG 5LEKA 2QZ8A 2NYXA 2F4OB 2P5VA 3C1DA 3DPTA 2QA4I 3EUAA 3J7ZI 3OSFA 3FRQA 2KFDA 3BPXA 1H8AC 2VOOA 4A3LJ 4XORA 5ED4A 1MDMB 2GIVA 1WI3A 5K58A 1XCBA 1KGSA 4UV8A 2M3AA 3VW0A 2Q0OA 3LA3A 3MWMA 3FK7A 1O4XA 3T8TA 2K4BA 2VJ4A 2EIKH 2OCCH 5L3DA 4R1HA 4BL0B 5ICEA 2IGNA 2J5OA 2Y31A 3BCBA 4LMYA 4GFLA 3G1OA 2EFWA 1RESA 1J59A 3ZMZA 3JCUC 1NK2P 4MNUA 3KYDB 3FMQA 1JJ6C 2KIQA 3ELKA 3I5UA 2GXAA 2JA8J 1CGPA 2F5CA 1WJBA 1YLFA 2XPVA 3LOCA 5J6XA 1G59A 2R5YB 3VFZA 1YOVB 2V1DA 2IEKA 4G6TB 4NQWB 3T6NA 1B1BA 2AO9A 2LY9A 4HF0A 4HG2A 3C2HA 2JSPA 3O6BB 5E3NA 1DU6A 4IRHA 3ON2A 2IA0A 1U8RA 2JQ7A 4FETA 1AWCA 1YO5C 3L2QA 1QHHD 5LHHA 1X58A 3K1MA 3F8FA 4CCJA 1YIJI 2LLKA 3B6AA 1UELB 2L7FP 2LKSA 1S8NA 2M0MA 2JMWA 1LKXA 2R3SA 1GV5A 3F0CA 3J7AO 5D5UB 4N9IA 2EFNA 4LJZF 3VB2A 2OV7A 2DDAA 3KEOA 3ZQFA 3S3MA 2L7MP 3HC7A 3V78A 2HQ5A 4Y33A 4RGRA 2DDBA 4RDUA 1R36A 3TQNA 5L3BA 3K7AJ 4IJAA 3ERED 4BHBA 4V2GA 3RKQA 3IUOA 1BOAA 1O3TA 1KU2A 3IH4A 3MVPA 1XGSA 2Y9YA 3HOWJ 2L5QA 2BVMA 4XBFA 1QU3A 1S3JA 1IO2A 4DGWB 2PJRA 1LEBA 2ZXHA 3ABLH 3NRGA 4EATA 5K7HA 3ZQGA 3NWTA 4IRVA 2KQRA 2FQ4A 2LREA 4E4HA 5F1JA 1A35A 3L2RA 3LHQA 3ZMSA 2HXOA 2IJLA 1OFCX 4Q4ZF 3BG9A 1FWZA 5CLSA 3W2VA 1P7IA 1APLC 4KNYA 3LSTA 2WAFA 2UXOA 1TL8A 4XLEA 4N4NB 4A3IJ 2OAZA 2H6CA 2WWYA 5FROA 1ZR4A 2B1EA 1SFOJ 2KZVA 2JA6J 3DTIA 2KRHA 3FXJA 4R8HA 1FBUA 2WV0A 3V7CA 3BCAA 3JRAA 4KN7X 2LOOA 4U0YA 1BW5A 3D5LA 5TRDA 1SD7A 2EFQA 4P9FA 3U9GA 1HDDC 1QVUA 3BLYA 1PJRA 1R5HA 3TO9A 4AIJA 2O03A 3PFIA 2GXBA 2DYSH 2XF6A 3FM5A 3LSIA 5FB2A 2NAZA 3IKVA 2HDDA 1LVAA 4B3XA 3FBIB 3M8EA 1G4DA 3IWZA 3A0HC
chains in the Genus database with same CATH topology
4L62A 2CUFA 2JJ7A 2EBIA 3S16J 2F07A 2L9RA 5IP9J 2M8GX 2O8KA 4C3IJ 2EZKA 2FX0A 1Y1WJ 3MNLA 4MXMA 1IDYA 2P81A 1ETKA 1IC8A 4MLOA 1TWAJ 2XPUA 1VI0A 1JTXA 1H88C 2DG8A 1FEXA 2LK2A 3CRJA 3PO2J 2QCOA 2WUIA 2R7ZJ 3AQSA 1HOMA 3KNWA 1HCRA 4D7MA 3K2AA 2K9NA 3JRGA 3EUPA 1QRYA 3NARA 4I6ZA 2D6YA 2Y30A 2X6OA 1ETYA 3JRFA 3GZIA 4DW6A 2X9DA 3LSJA 4ABZA 3S1RJ 2NVQJ 1TWGJ 2JK3A 3BR1A 1U9OA 2AHQA 3F1BA 1S7EA 2E19A 3GBGA 4MIMA 4LOCA 1ETVA 3BCGA 4D5FA 5J1YA 4GFBA 3ANGA 3A03A 2E2IJ 3PASA 4XIDA 2PMZN 2GM4A 5D19A 2ZCMA 2XB5A 2DMPA 1CQTA 5D1RA 2FBQA 2JWTA 1HF0A 4AC0A 1MSEC 3PPBA 4PXIA 2L7ZA 1BW6A 2DA1A 3O8HA 2M2EA 4QTRA 4A3FJ 5FKOA 4ME9A 3WHBA 2K40A 2E1OA 3JSJA 1IDZA 2B63J 1ITYA 1JTYA 5F08A 2O7TA 4XRMA 3HOXJ 1BL0A 2KT0A 5C4XJ 4V2FA 5EF6A 1ZKGA 5HBUA 1Z0XA 2N8GA 1TWFJ 2EQRA 4DYRA 2DG7A 3TP0A 5M3MJ 4FCYA 1IV6A 3CMYA 3DCFA 4BBRJ 1MBJA 5E3MA 4Y52J 1MSFC 3HTAA 2LKXA 5IOZA 2ZCNA 1WPKA 3ZQCA 5FJ8J 2ECCA 2YU9J 2IU5A 2TCTA 3LSPA 4JX6A 3NXCA 3H3VK 2ME6A 3PO3J 3S15J 2YUSA 3B6CA 2NVXJ 5JLWA 3G7RA 5GPAA 3GTKJ 2HXIA 1RPWA 3I4NJ 1XC5A 1JJ8C 5IPAA 4A3BJ 3BRUA 3HEFA 2UXPA 2ID6A 1IUFA 3LSGA 3G56A 2D5VA 3MKLA 1BA5A 2XDNA 3C07A 3JRIA 5J1UA 3G1MA 4HNVA 5D18A 4JX4A 4JNNA 3GTMJ 4A3KJ 3LJLA 1G2HA 2UXIA 4IHVA 3Q0WA 3ZOBA 4M3FA 4EEFG 3LSRA 3RH2A 3VPRA 1GV2A 4GCTA 2PZ9A 3JRDA 2MG4A 1PUFA 3I4MJ 2QTQA 1U78A 2IBDA 2R0QC 1UMQA 3HOVJ 4S0HB 1ENHA 1ORKA 2XPWA 1K83J 2LP0A 4AF5A 3ON4A 5J3LA 3QKXA 3BJBA 5EG0A 4QSHA 3HOYJ 2CU7A 3IH2A 2EZIA 1JUPA 1I3QJ 5IYDJ 2YS9A 1U9NA 3LNQA 4AC6A 1XS9A 4A3JJ 3BHQA 3COLA 2I10A 4L5EA 4BXXJ 2HOTA 3FK6A 1OCTC 1I50J 3HDDA 1MBFA 5FLVA 3JRHA 2ELKA 2WGBA 3ANPA 2Q24A 1K61A 1PUFB 2NVTJ 4IHXA 1POGA 1ZTRA 5CXIA 1Q1VA 2VUMJ 3HTIA 3BTIA 2G7LA 3AQTA 5FMPA 3S17J 2Y2ZA 1U8BA 2DN0A 3VVXA 4M6VA 2UXUA 2R93J 4D5CA 5FKNA 2CQQA 4UDSA 1RETA 1Z77A 5EG0B 2W53A 3NI7A 5CXGA 3QPSA 3CWRA 5C4YA 1F36A 3M3YJ 4ACIA 3NNRA 2MW8A 3SDGA 4YZEA 1TWHJ 2NVYJ 2E2JJ 4GFKA 4DYCA 4XK4A 3WHCA 1FTTA 4AUXA 2RASA 2OI8A 3C2BA 2DA4A 3HGGA 5E3OA 4A93J 1FTZA 2G0EA 2YVHA 4MO7A 3BT9A 3CJDA 2REKA 2ZB9A 4IEJA 2MSYA 3HTHA 1JUMA 4JYKA 5F0CA 3S14J 1OCPA 4A3GJ 2R92J 1FJLA 5EYRA 1GVDA 3O8GA 3O60A 2K9SA 1MH4A 1FIAA 5FLMJ 4B3AA 3VW2A 5K7ZA 2YVEA 1A6IA 2EH3A 5F04A 3DPJA 3VOKA 2ME0A 1OJLA 5EEAA 2DMQA 5C4JJ 1LFUP 1AKHA 2XRLA 5M5XJ 2H1KA 5H9TA 2GBYA 2GENA 4W97A 4C2MJ 3HTJA 3HKZN 1VF9A 2NP5A 4CYCA 1VNDA 1UG2A 4UUTA 5IP6A 1YRNA 1LE8A 4I76A 2LVSA 2GUHA 4DZJA 2O7OA 4B1RA 3JRCA 3D1NI 2WB1N 3BQYA 1QVTA 4D7NA 5M5YJ 4XICA 1JUSA 5HSZA 4A69C 4BKXA 3RQIA 2R5ZA 1F43A 4HKUA 1GDTA 5F0HA 5GP9A 3QQAA 1XG1A 3HIMA 2QOPA 2VKVA 3IH3A 4FE7A 3TP3A 2K9QA 3BR5A 5JLXA 5DTDA 3G1LA 3HOZJ 1BJZA 4FE4A 1QPIA 2XGEA 2IAIA 2G7SA 2ZCXA 4FISA 3TEDA 3OIOA 3JRBA 2DMNA 1AKHB 3QPLA 1UI5A 4NDLA 1WCMJ 2JN6A 4RBOA 5FKKA 2GFNA 2XGCA 2NP3A 3CDLA 1B72A 1IG7A 4M3GA 5HODA 4CYCB 3BG3A 3JR9A 1JGGA 4M3EA 1MBEA 4UUSA 4A3EJ 1R9TJ 1D5YA 3GTGJ 2HI3A 3CCYA 3QBMA 1YRNB 3FKIJ 4DYQA 5IYCJ 1LE8B 1GUUA 3VW1A 3P9TA 1T33A 3BR6A 3GTOJ 2DA3A 4X6AJ 2ZOYA 3GTPJ 2COBA 2R5ZB 2CRGA 2CJJA 4FTHA 5EGOA 4B4CA 2HYJA 3KKCA 1ZQ3P 1T56A 3OOUA 4CGRA 1B8IA 5C3EJ 2HKUA 1ZK8A 3KKDA 3NAUA 2Y9ZA 3Q0VA 5FKLA 4JKZA 5M3FJ 2NS7A 4JX5A 1E3OC 4M3BA 1AU7A 3HE0A 2FD5A 2LR8A 4XRSA 1B72B 2DJNA 1FIPA 4GCKA 4W1UA 2NS8A 5IOYA 2LD5A 1UI6A 2FJ1A 3BTCA 4UUSB 1GT0C 2HYTA 3VVZA 1VFCA 4IHWA 1EF4A 3GEUA 3E7QA 2EZLA 5CW8A 1MBGA 4MK6A 4X1EA 2QIBA 1SGMA 4A3CJ 2QKOA 2EZHA 4DZPA 2W48A 3PM1A 3HGYA 4Y7NJ 3OSGA 3S5RA 3VVYA 2JA5J 2M9HA 3EGQA 1MBHA 1RKWA 5EGOB 1ZGWA 1WH7A 2ID3A 4XRSG 3BR0A 1JKRC 2R5YA 3UKGA 1B8IB 3S1QJ 3VUQA 3OSFA 1DU0A 3FRQA 1H8AC 3RD3A 4A3LJ 2GLOA 2E2HJ 2PBXA 2NOGA 3RZOJ 1WI3A 5K58A 4KWAA 3NPIA 1RR7A 2H8RA 2G7GA 3VW0A 4C3JJ 4ICHA 3FK7A 2DA2A 1WH5A 2CUEA 3L1PA 3A02A 3JREA 3SJMA 1O4XA 1IJWC 1JKPC 5HAWA 1NTCA 4MFEA 1TC3C 3A01A 2OPTA 2Y31A 1I6HJ 2L0KA 4GFLA 1RKTA 1ETOA 5F27A 3G1OA 1IGNA 2DTZA 1RESA 4BY7J 3HB9A 5M5WJ 3GTQJ 1NK2P 1ZR2A 1ETQA 2TRTA 3V6GA 1JJ6C 3IV5A 2DA6A 2RAEA 2JA8J 3ZQLA 3FIWA 2VPRA 2XPVA 3LOCA 5GPCA 2XSDC 2R5YB 2XB0X 1AHDP 5DAJA 2IEKA 3FISA 3T6NA 3H0GJ 1HDPA 5J1RA 2G3BA 2AO9A 2LY9A 5BNGA 1DU6A 5E3NA 1MH3A 5FGLA 4JP0A 3ZQHA 4A3DJ 3ON2A 4NELA 2OF7A 1TWCJ 3IUVA 3BG5A 2NX4A 5AQCA 2ZOZA 1X58A 3A01B 3Q0UA 1JKQC 5IYBJ 3Q3SA 2LLKA 3B6AA 4BBSJ 3E7LA 2VKEA 2L7FP 3VP5A 5DS9A 2JMWA 3BTJA 3B81A 1GV5A 5EFYA 3BR2A 3F0CA 4AYBN 2V57A 3S2DJ 5K7FA 2OERA 1LFBA 2WAQN 3ZQFA 2L7MP 3BR3A 2O9LA 3V78A 2HQ5A 2KDZA 3S1NJ 2CQXA 5EDNA 4RDUA 2LFBA 4C3HJ 3GTLJ 1ETXA 2JA7J 3BTLA 3K7AJ 2M34A 1Y1VJ 1ETWA 4MFDA 2DA5A 1X2MA 4V2GA 2DMUA 3RKQA 3BNIA 1A5JA 1WGXA 5FHPA 3MN2A 3MVPA 3IH4A 3HOWJ 2Y9YA 5EZGA 3ZQIA 5IP7J 5E3LA 2LTPA 2ECBA 3NRGA 1H89C 5K7HA 3ZQGA 1W0TA 3W6VA 2FQ4A 3CQZJ 3DEWA 2HOAA 2M0CA 5F1JA 1JT0A 1MNMC 2Y0SN 2UXHA 3LHQA 2HXOA 5F0FA 1OFCX 3SFIA 3BG9A 2WV1A 1P7IA 1JT6A 1HLVA 1W0UA 3TW6A 1APLC 1SANA 2UXOA 3HOUJ 3KZ9A 4J19A 3HM5A 4A3MJ 3LWJA 1JKOC 1P7JA 4A3IJ 4BY1J 2DA7A 9ANTA 1IRZA 1ZR4A 5C44J 1UHSA 4M3DA 1SFOJ 2DMTA 2JA6J 3VIBA 2MGQA 5EZHA 2QF7A 3RZDJ 3HBLA 2RHAA 4GCLA 3JRAA 4NN1A 2QWTA 1MBKA 4JL3A 3GTJJ 1NK3P 1BW5A 3TW7A 3BQZA 1HDDC 1QVUA 3M4OJ 3S1MJ 4QIWN 3VOXA 1X2NA 4IHYA 2X48A 2XGDA 5FKMA 2VI6A 2HDDA 2HOSA 3S2HJ 4G12A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L62 A;  2CUF A;  2JJ7 A;  2EBI A;  3S16 J;  2F07 A;  2L9R A;  5IP9 J;  2M8G X;  2O8K A;  4C3I J;  2EZK A;  2FX0 A;  1Y1W J;  3MNL A;  4MXM A;  1IDY A;  2P81 A;  1ETK A;  1IC8 A;  4MLO A;  1TWA J;  2XPU A;  1VI0 A;  1JTX A;  1H88 C;  2DG8 A;  1FEX A;  2LK2 A;  3CRJ A;  3PO2 J;  2QCO A;  2WUI A;  2R7Z J;  3AQS A;  1HOM A;  3KNW A;  1HCR A;  4D7M A;  3K2A A;  2K9N A;  3JRG A;  3EUP A;  1QRY A;  3NAR A;  4I6Z A;  2D6Y A;  2Y30 A;  2X6O A;  1ETY A;  3JRF A;  3GZI A;  4DW6 A;  2X9D A;  3LSJ A;  4ABZ A;  3S1R J;  2NVQ J;  1TWG J;  2JK3 A;  3BR1 A;  1U9O A;  2AHQ A;  3F1B A;  1S7E A;  2E19 A;  3GBG A;  4MIM A;  4LOC A;  1ETV A;  3BCG A;  4D5F A;  5J1Y A;  4GFB A;  3ANG A;  3A03 A;  2E2I J;  3PAS A;  4XID A;  2PMZ N;  2GM4 A;  5D19 A;  2ZCM A;  2XB5 A;  2DMP A;  1CQT A;  5D1R A;  2FBQ A;  2JWT A;  1HF0 A;  4AC0 A;  1MSE C;  3PPB A;  4PXI A;  2L7Z A;  1BW6 A;  2DA1 A;  3O8H A;  2M2E A;  4QTR A;  4A3F J;  5FKO A;  4ME9 A;  3WHB A;  2K40 A;  2E1O A;  3JSJ A;  1IDZ A;  2B63 J;  1ITY A;  1JTY A;  5F08 A;  2O7T A;  4XRM A;  3HOX J;  1BL0 A;  2KT0 A;  5C4X J;  4V2F A;  5EF6 A;  1ZKG A;  5HBU A;  1Z0X A;  2N8G A;  1TWF J;  2EQR A;  4DYR A;  2DG7 A;  3TP0 A;  5M3M J;  4FCY A;  1IV6 A;  3CMY A;  3DCF A;  4BBR J;  1MBJ A;  5E3M A;  4Y52 J;  1MSF C;  3HTA A;  2LKX A;  5IOZ A;  2ZCN A;  1WPK A;  3ZQC A;  5FJ8 J;  2ECC A;  2YU9 J;  2IU5 A;  2TCT A;  3LSP A;  4JX6 A;  3NXC A;  3H3V K;  2ME6 A;  3PO3 J;  3S15 J;  2YUS A;  3B6C A;  2NVX J;  5JLW A;  3G7R A;  5GPA A;  3GTK J;  2HXI A;  1RPW A;  3I4N J;  1XC5 A;  1JJ8 C;  5IPA A;  4A3B J;  3BRU A;  3HEF A;  2UXP A;  2ID6 A;  1IUF A;  3LSG A;  3G56 A;  2D5V A;  3MKL A;  1BA5 A;  2XDN A;  3C07 A;  3JRI A;  5J1U A;  3G1M A;  4HNV A;  5D18 A;  4JX4 A;  4JNN A;  3GTM J;  4A3K J;  3LJL A;  1G2H A;  2UXI A;  4IHV A;  3Q0W A;  3ZOB A;  4M3F A;  4EEF G;  3LSR A;  3RH2 A;  3VPR A;  1GV2 A;  4GCT A;  2PZ9 A;  3JRD A;  2MG4 A;  1PUF A;  3I4M J;  2QTQ A;  1U78 A;  2IBD A;  2R0Q C;  1UMQ A;  3HOV J;  4S0H B;  1ENH A;  1ORK A;  2XPW A;  1K83 J;  2LP0 A;  4AF5 A;  3ON4 A;  5J3L A;  3QKX A;  3BJB A;  5EG0 A;  4QSH A;  3HOY J;  2CU7 A;  3IH2 A;  2EZI A;  1JUP A;  1I3Q J;  5IYD J;  2YS9 A;  1U9N A;  3LNQ A;  4AC6 A;  1XS9 A;  4A3J J;  3BHQ A;  3COL A;  2I10 A;  4L5E A;  4BXX J;  2HOT A;  3FK6 A;  1OCT C;  1I50 J;  3HDD A;  1MBF A;  5FLV A;  3JRH A;  2ELK A;  2WGB A;  3ANP A;  2Q24 A;  1K61 A;  1PUF B;  2NVT J;  4IHX A;  1POG A;  1ZTR A;  5CXI A;  1Q1V A;  2VUM J;  3HTI A;  3BTI A;  2G7L A;  3AQT A;  5FMP A;  3S17 J;  2Y2Z A;  1U8B A;  2DN0 A;  3VVX A;  4M6V A;  2UXU A;  2R93 J;  4D5C A;  5FKN A;  2CQQ A;  4UDS A;  1RET A;  1Z77 A;  5EG0 B;  2W53 A;  3NI7 A;  5CXG A;  3QPS A;  3CWR A;  5C4Y A;  1F36 A;  3M3Y J;  4ACI A;  3NNR A;  2MW8 A;  3SDG A;  4YZE A;  1TWH J;  2NVY J;  2E2J J;  4GFK A;  4DYC A;  4XK4 A;  3WHC A;  1FTT A;  4AUX A;  2RAS A;  2OI8 A;  3C2B A;  2DA4 A;  3HGG A;  5E3O A;  4A93 J;  1FTZ A;  2G0E A;  2YVH A;  4MO7 A;  3BT9 A;  3CJD A;  2REK A;  2ZB9 A;  4IEJ A;  2MSY A;  3HTH A;  1JUM A;  4JYK A;  5F0C A;  3S14 J;  1OCP A;  4A3G J;  2R92 J;  1FJL A;  5EYR A;  1GVD A;  3O8G A;  3O60 A;  2K9S A;  1MH4 A;  1FIA A;  5FLM J;  4B3A A;  3VW2 A;  5K7Z A;  2YVE A;  1A6I A;  2EH3 A;  5F04 A;  3DPJ A;  3VOK A;  2ME0 A;  1OJL A;  5EEA A;  2DMQ A;  5C4J J;  1LFU P;  1AKH A;  2XRL A;  5M5X J;  2H1K A;  5H9T A;  2GBY A;  2GEN A;  4W97 A;  4C2M J;  3HTJ A;  3HKZ N;  1VF9 A;  2NP5 A;  4CYC A;  1VND A;  1UG2 A;  4UUT A;  5IP6 A;  1YRN A;  1LE8 A;  4I76 A;  2LVS A;  2GUH A;  4DZJ A;  2O7O A;  4B1R A;  3JRC A;  3D1N I;  2WB1 N;  3BQY A;  1QVT A;  4D7N A;  5M5Y J;  4XIC A;  1JUS A;  5HSZ A;  4A69 C;  4BKX A;  3RQI A;  2R5Z A;  1F43 A;  4HKU A;  1GDT A;  5F0H A;  5GP9 A;  3QQA A;  1XG1 A;  3HIM A;  2QOP A;  2VKV A;  3IH3 A;  4FE7 A;  3TP3 A;  2K9Q A;  3BR5 A;  5JLX A;  5DTD A;  3G1L A;  3HOZ J;  1BJZ A;  4FE4 A;  1QPI A;  2XGE A;  2IAI A;  2G7S A;  2ZCX A;  4FIS A;  3TED A;  3OIO A;  3JRB A;  2DMN A;  1AKH B;  3QPL A;  1UI5 A;  4NDL A;  1WCM J;  2JN6 A;  4RBO A;  5FKK A;  2GFN A;  2XGC A;  2NP3 A;  3CDL A;  1B72 A;  1IG7 A;  4M3G A;  5HOD A;  4CYC B;  3BG3 A;  3JR9 A;  1JGG A;  4M3E A;  1MBE A;  4UUS A;  4A3E J;  1R9T J;  1D5Y A;  3GTG J;  2HI3 A;  3CCY A;  3QBM A;  1YRN B;  3FKI J;  4DYQ A;  5IYC J;  1LE8 B;  1GUU A;  3VW1 A;  3P9T A;  1T33 A;  3BR6 A;  3GTO J;  2DA3 A;  4X6A J;  2ZOY A;  3GTP J;  2COB A;  2R5Z B;  2CRG A;  2CJJ A;  4FTH A;  5EGO A;  4B4C A;  2HYJ A;  3KKC A;  1ZQ3 P;  1T56 A;  3OOU A;  4CGR A;  1B8I A;  5C3E J;  2HKU A;  1ZK8 A;  3KKD A;  3NAU A;  2Y9Z A;  3Q0V A;  5FKL A;  4JKZ A;  5M3F J;  2NS7 A;  4JX5 A;  1E3O C;  4M3B A;  1AU7 A;  3HE0 A;  2FD5 A;  2LR8 A;  4XRS A;  1B72 B;  2DJN A;  1FIP A;  4GCK A;  4W1U A;  2NS8 A;  5IOY A;  2LD5 A;  1UI6 A;  2FJ1 A;  3BTC A;  4UUS B;  1GT0 C;  2HYT A;  3VVZ A;  1VFC A;  4IHW A;  1EF4 A;  3GEU A;  3E7Q A;  2EZL A;  5CW8 A;  1MBG A;  4MK6 A;  4X1E A;  2QIB A;  1SGM A;  4A3C J;  2QKO A;  2EZH A;  4DZP A;  2W48 A;  3PM1 A;  3HGY A;  4Y7N J;  3OSG A;  3S5R A;  3VVY A;  2JA5 J;  2M9H A;  3EGQ A;  1MBH A;  1RKW A;  5EGO B;  1ZGW A;  1WH7 A;  2ID3 A;  4XRS G;  3BR0 A;  1JKR C;  2R5Y A;  3UKG A;  1B8I B;  3S1Q J;  3VUQ A;  3OSF A;  1DU0 A;  3FRQ A;  1H8A C;  3RD3 A;  4A3L J;  2GLO A;  2E2H J;  2PBX A;  2NOG A;  3RZO J;  1WI3 A;  5K58 A;  4KWA A;  3NPI A;  1RR7 A;  2H8R A;  2G7G A;  3VW0 A;  4C3J J;  4ICH A;  3FK7 A;  2DA2 A;  1WH5 A;  2CUE A;  3L1P A;  3A02 A;  3JRE A;  3SJM A;  1O4X A;  1IJW C;  1JKP C;  5HAW A;  1NTC A;  4MFE A;  1TC3 C;  3A01 A;  2OPT A;  2Y31 A;  1I6H J;  2L0K A;  4GFL A;  1RKT A;  1ETO A;  5F27 A;  3G1O A;  1IGN A;  2DTZ A;  1RES A;  4BY7 J;  3HB9 A;  5M5W J;  3GTQ J;  1NK2 P;  1ZR2 A;  1ETQ A;  2TRT A;  3V6G A;  1JJ6 C;  3IV5 A;  2DA6 A;  2RAE A;  2JA8 J;  3ZQL A;  3FIW A;  2VPR A;  2XPV A;  3LOC A;  5GPC A;  2XSD C;  2R5Y B;  2XB0 X;  1AHD P;  5DAJ A;  2IEK A;  3FIS A;  3T6N A;  3H0G J;  1HDP A;  5J1R A;  2G3B A;  2AO9 A;  2LY9 A;  5BNG A;  1DU6 A;  5E3N A;  1MH3 A;  5FGL A;  4JP0 A;  3ZQH A;  4A3D J;  3ON2 A;  4NEL A;  2OF7 A;  1TWC J;  3IUV A;  3BG5 A;  2NX4 A;  5AQC A;  2ZOZ A;  1X58 A;  3A01 B;  3Q0U A;  1JKQ C;  5IYB J;  3Q3S A;  2LLK A;  3B6A A;  4BBS J;  3E7L A;  2VKE A;  2L7F P;  3VP5 A;  5DS9 A;  2JMW A;  3BTJ A;  3B81 A;  1GV5 A;  5EFY A;  3BR2 A;  3F0C A;  4AYB N;  2V57 A;  3S2D J;  5K7F A;  2OER A;  1LFB A;  2WAQ N;  3ZQF A;  2L7M P;  3BR3 A;  2O9L A;  3V78 A;  2HQ5 A;  2KDZ A;  3S1N J;  2CQX A;  5EDN A;  4RDU A;  2LFB A;  4C3H J;  3GTL J;  1ETX A;  2JA7 J;  3BTL A;  3K7A J;  2M34 A;  1Y1V J;  1ETW A;  4MFD A;  2DA5 A;  1X2M A;  4V2G A;  2DMU A;  3RKQ A;  3BNI A;  1A5J A;  1WGX A;  5FHP A;  3MN2 A;  3MVP A;  3IH4 A;  3HOW J;  2Y9Y A;  5EZG A;  3ZQI A;  5IP7 J;  5E3L A;  2LTP A;  2ECB A;  3NRG A;  1H89 C;  5K7H A;  3ZQG A;  1W0T A;  3W6V A;  2FQ4 A;  3CQZ J;  3DEW A;  2HOA A;  2M0C A;  5F1J A;  1JT0 A;  1MNM C;  2Y0S N;  2UXH A;  3LHQ A;  2HXO A;  5F0F A;  1OFC X;  3SFI A;  3BG9 A;  2WV1 A;  1P7I A;  1JT6 A;  1HLV A;  1W0U A;  3TW6 A;  1APL C;  1SAN A;  2UXO A;  3HOU J;  3KZ9 A;  4J19 A;  3HM5 A;  4A3M J;  3LWJ A;  1JKO C;  1P7J A;  4A3I J;  4BY1 J;  2DA7 A;  9ANT A;  1IRZ A;  1ZR4 A;  5C44 J;  1UHS A;  4M3D A;  1SFO J;  2DMT A;  2JA6 J;  3VIB A;  2MGQ A;  5EZH A;  2QF7 A;  3RZD J;  3HBL A;  2RHA A;  4GCL A;  3JRA A;  4NN1 A;  2QWT A;  1MBK A;  4JL3 A;  3GTJ J;  1NK3 P;  1BW5 A;  3TW7 A;  3BQZ A;  1HDD C;  1QVU A;  3M4O J;  3S1M J;  4QIW N;  3VOX A;  1X2N A;  4IHY A;  2X48 A;  2XGD A;  5FKM A;  2VI6 A;  2HDD A;  2HOS A;  3S2H J;  4G12 A; 
#chains in the Genus database with same CATH topology
 2PMH A;  2P8T A;  3GXO A;  2YSR A;  3H0D A;  2JJ7 A;  2EBI A;  2DK8 A;  2R7O A;  4E7I A;  4CXF A;  4GRI A;  3PQK A;  4YFN F;  4L0Y B;  1W5S A;  4GDF A;  2EZK A;  1Y1W J;  3JAM Z;  1CF7 B;  2P81 A;  2VBZ A;  2CO5 A;  1T08 B;  1FOY A;  1TWA J;  3PJR A;  1VI0 A;  1K6Y A;  1BC8 C;  2WUI A;  4IKF A;  3AQS A;  4IHT A;  4NHJ A;  2BXY A;  1HKT A;  1D1B A;  1MGT A;  3JRF A;  3R6S A;  4ZTF A;  2AQE A;  3GZI A;  2FOW A;  2DFF A;  4DW6 A;  3LSJ A;  4ABZ A;  3FXQ A;  2QQ8 A;  1TWG J;  4RGX A;  3RIR A;  3ONQ A;  1U9O A;  2QSH X;  1Z9C A;  1P9Q C;  1ZGJ A;  2AHQ A;  2E19 A;  3FXU A;  4LLL A;  1ETV A;  1OKR A;  1SAU A;  1KYW A;  2ZY9 A;  2JPC A;  2JUC A;  3G4S I;  2VXD A;  3A03 A;  1LVK A;  2PMZ N;  4GXO A;  3LQQ A;  4HAM A;  5KVR A;  2ZCM A;  2QLZ A;  1FP2 A;  2XB5 A;  4HV5 A;  4HLX A;  1CQT A;  5D1R A;  1IV8 A;  3WU1 B;  4PFP A;  2XGX A;  1B6A A;  4AC0 A;  1MSE C;  1FOK A;  1Y8R B;  2FNA A;  2BBY A;  1S29 A;  3CTA A;  1IRX A;  2DA1 A;  4QTR A;  2CGP A;  1FBS A;  2GQQ A;  3FZV A;  3SYT A;  3DEU A;  5DM7 F;  3TDZ C;  5F08 A;  1HST A;  3KE2 A;  3K10 A;  2KT0 A;  2KRC A;  3P5J A;  5C4X J;  3A1Y A;  2HS5 A;  4WIB A;  1ZKG A;  3NS4 A;  1S5L C;  3VYS B;  5HS9 A;  4A2U A;  4DYR A;  2FEZ A;  2Q2E A;  5HDN A;  4XLC A;  1XCV A;  4EM2 A;  4FCY A;  3A4C A;  3KP7 A;  2V6E A;  3DCF A;  2Y69 H;  2WBM A;  2BEO A;  5DYM A;  1X1A A;  4RM2 A;  5E3M A;  1XN7 A;  1Y39 A;  1M1E B;  5TIS C;  3KET A;  5TJJ A;  2RRE A;  5IOZ A;  2LKX A;  4ZYH A;  1WPK A;  1FMW A;  2HVS A;  1IRF A;  3LSP A;  5GAE J;  4G8X A;  3D5S C;  4AVP A;  3J81 K;  1BI1 A;  3CMA I;  5FFZ A;  1W1W E;  3OS2 A;  1BOB A;  2LG4 A;  1HKQ A;  4J01 A;  1FP1 D;  3I4N J;  5KAI C;  4A3B J;  2L3D A;  5IPA A;  1DP3 A;  2YX7 A;  2X4H A;  4M6X A;  1JE8 A;  3BRU A;  2DI3 A;  1IUF A;  1XX5 A;  2K02 A;  2D5V A;  1BA5 A;  2KHM A;  4IOA F;  3K1P A;  3ZN1 A;  2BY1 A;  2VE8 A;  3BP8 A;  5K1Y A;  1YG2 A;  2VQC A;  4JNN A;  5LGT A;  3SHF A;  3Q0W A;  2P7C B;  2V9P A;  3U21 A;  2V79 A;  4EEF G;  3VPR A;  4HEA 2;  1GV2 A;  2CS3 A;  3L2W A;  4GCT A;  3WTU C;  2WTE A;  4EM1 A;  3CUQ A;  1R00 A;  1ZRC A;  2QTQ A;  3QAH A;  1Z21 A;  3HOV J;  1TNS A;  2DQL A;  6PAX A;  5IT9 K;  1ORK A;  2X6Y A;  4BE1 A;  1DP7 P;  4I99 C;  4HDV A;  3QKX A;  4MTD A;  5EG0 A;  1YIT I;  3HOY J;  4C2T A;  3IH2 A;  4Y17 A;  3L2C A;  1I3Q J;  5IYD J;  1STZ A;  3L00 A;  4KA4 A;  4YFX F;  1U9N A;  2KMU A;  4AC6 A;  4BJ6 C;  2P5K A;  1LEA A;  3L2U A;  5HLT A;  4L5E A;  4PJJ A;  5DUI A;  1OCT C;  2E1M B;  4KIC A;  1KQ8 A;  4XKV A;  1MBF A;  4ZDL A;  2CYY A;  2ELK A;  2ZXW H;  1GVJ A;  3ANP A;  2OCE A;  3ZQ7 A;  1PUF B;  1TLH B;  4IHX A;  3DF8 A;  1ZTR A;  3WU2 C;  2EPF A;  3OMY A;  2LBF A;  4HLY A;  4BHC A;  1D1C A;  2D1H A;  2DN0 A;  3OR2 C;  4M6V A;  1U8B A;  1RRJ A;  2EV6 A;  4XLN F;  3WTX C;  4RS8 A;  1VQ7 I;  4DVY P;  2CQQ A;  2F4M B;  4UDS A;  1Z77 A;  3CUQ C;  4CYD A;  5CXG A;  1YIO A;  3QPS A;  2JT1 A;  3AG3 H;  1BR2 A;  1BR1 A;  4L9T A;  4M73 A;  3VTI A;  1UAA A;  2NVY J;  4IVN A;  4NUB A;  4BDZ A;  3PUF A;  4XK4 A;  2RQQ A;  4XSX F;  3C2B A;  2OI8 A;  1G3W A;  1ULY A;  4G9Y A;  3CJD A;  4ESB A;  4IEJ A;  4MQ9 F;  4M9X A;  4ANJ A;  4E7H A;  5F0C A;  4ZC3 A;  3S14 J;  1OCP A;  2CUJ A;  1FJL A;  2R92 J;  3M8J A;  1HBX G;  3UR3 C;  3IL2 A;  2HTJ A;  3LA2 A;  1SMT A;  3KZZ A;  4S04 A;  5FLM J;  4B3A A;  2YVE A;  5F04 A;  4AID A;  5EEA A;  5L3E A;  4YG2 F;  3HSF A;  1SD6 A;  5H9T A;  5CVI A;  2GEN A;  3CO7 C;  2M7A A;  3HTJ A;  3HKZ N;  1VF9 A;  2DW4 A;  5FD5 A;  4CYC A;  1D1A A;  1B4A A;  1VZ0 A;  1MD0 A;  1UG2 A;  3LSH A;  3JSO A;  5J4Y A;  1BI3 A;  5HS8 A;  2LNB A;  1FNN A;  2LF8 A;  2LVS A;  2O7O A;  5DUK A;  2PMZ A;  2WB1 N;  1W5C C;  3HYI A;  4D7N A;  3JRC A;  2DOE A;  5KCM A;  4BKX A;  1U5T C;  4E70 A;  1XGN A;  3N4M A;  3CC2 I;  4HKU A;  1GDT A;  3DTE A;  5F0H A;  4HF1 A;  3RYP A;  1P2F A;  4Y4R A;  3KPH A;  4WF2 A;  4HX4 A;  3OYG A;  2DOF A;  5D6E A;  1QO0 D;  5JLX A;  4BU2 A;  3W6K B;  2PJP A;  3CCS I;  3HOZ J;  1BJZ A;  2E5Z A;  4FE4 A;  3TED A;  3OIO A;  4BGD A;  2IGO A;  2ISY A;  2GFN A;  2XGC A;  2KJC A;  5E79 C;  2JA2 A;  3JR9 A;  4N9H A;  3HTU A;  2G7H A;  1X1C A;  1A31 A;  1OYI A;  3U1D A;  2O0Y A;  4XRF A;  2XF7 A;  3QBM A;  2F4I A;  3ROU A;  2VON A;  3I55 I;  5IYC J;  4PSW A;  3A0B C;  3VW1 A;  4HST A;  5HDG A;  3BR6 A;  2KP6 A;  2O8X A;  4YII A;  4X6A J;  1HC8 A;  1ZN2 A;  2OD5 A;  2R5Z B;  2CJJ A;  4BE2 A;  5EEG A;  3LMM A;  3MQ0 A;  3QWL A;  3DKY A;  3GLL A;  4B4C A;  4BH9 A;  2XUB A;  4E7L A;  1X1D A;  2HKU A;  2EB7 A;  4YIR X;  4KN4 X;  3NAU A;  2K86 A;  1VTN C;  4GYI A;  4J00 A;  1IN7 A;  1MDM A;  4LB5 A;  4JX5 A;  1R49 A;  1JGS A;  2K85 A;  3LWF A;  1QA6 A;  2VOP A;  2AS5 F;  2LD5 A;  4WCG A;  2UWM A;  5J8F A;  3J7Y J;  2P4W A;  1H9G A;  1XGM A;  2EIJ H;  3KCC A;  3GEU A;  1MIJ A;  2R7V A;  1I5Z A;  3H3Z A;  1V55 H;  2W48 A;  2CFX A;  1LJ9 A;  2X51 A;  1E3P A;  2DBB A;  1V54 H;  3LL7 A;  4Y7N J;  4O3M A;  3VVY A;  2JA5 J;  2M9H A;  5LGU A;  4XKC A;  1MBH A;  2LF7 A;  2JTV A;  5DD8 A;  5EGO B;  1WH7 A;  2BZT A;  2CUZ A;  3GFL A;  4EJW A;  4BJT A;  4PZJ A;  4CO8 A;  4ZYA A;  3BR0 A;  2R5Y A;  1B8I B;  2Z16 A;  4NC6 A;  4Y3O A;  3S1Q J;  1ZAR A;  3FWE A;  1DU0 A;  2BHY A;  4NQW A;  1J75 A;  2GLO A;  2X6X A;  1HXD A;  1R71 A;  3RSN A;  5D8L B;  3RZO J;  5H6Q A;  3SXY A;  4XLH A;  5H20 A;  2H8R A;  2O6G E;  2PI0 A;  2P0W A;  2VJJ A;  4RGS A;  3JRE A;  2CUE A;  1TQM A;  1JKP C;  3A02 A;  5HAW A;  2COM A;  3HHH A;  5HDK A;  2IT0 A;  3WGH A;  3K4L A;  3E0J B;  1ETO A;  1F1Z A;  3BG6 A;  4Q5S F;  5FGM A;  1ZR2 A;  1ETQ A;  1WJA A;  2TRT A;  4F91 B;  3V6G A;  3IV5 A;  1U2W A;  3BJA A;  3T5X A;  2XSD C;  1AHD P;  3M7G A;  1D0Z A;  2NXN B;  4D0P A;  2W00 A;  4ZYG A;  3FXM A;  4A0Z A;  4UVB A;  3ZQQ A;  3WTV C;  1MH3 A;  1C0W A;  2RKH A;  4FX4 A;  1U5T B;  4F92 B;  3BY6 A;  3HRM A;  3ECO A;  2V1N A;  2OF7 A;  4WK8 F;  3BZC A;  3I59 B;  4UVC A;  3BG5 A;  2K3P A;  3FX3 A;  5AQC A;  2V9K A;  3A01 B;  3Q0U A;  1FYM A;  5HLG A;  4BBS J;  3ESW B;  1TZL A;  4L5J A;  2D1V A;  3LAJ A;  2VKE A;  2HZD A;  3ZN0 A;  3N97 A;  3E6M A;  3VP5 A;  4UVA A;  1EH8 A;  1QGP A;  2VIX A;  4ZYE A;  3J80 K;  2V57 A;  3VVX A;  3S2D J;  5K7F A;  1IUY A;  2M30 A;  2V26 A;  3ML6 A;  2EIL H;  2K3F A;  3OIQ A;  3S1N J;  2CQX A;  3OYF A;  3K69 A;  2XAU A;  2LFB A;  4C3H J;  5JFR A;  1ETX A;  2JA7 J;  2L54 A;  5FO5 A;  1RUO A;  3TOB A;  4FX0 A;  3CCL I;  3NEU A;  3HKZ A;  1ERD A;  2P6T A;  1ETW A;  3EDP A;  4M71 A;  2DA5 A;  2PFV A;  1X3W B;  4NB5 A;  5FHP A;  1N25 A;  1ZRF A;  5EZG A;  1I27 A;  1A6Q A;  1MMA A;  3G73 A;  2IGK A;  2WB1 A;  2IPQ X;  5DCF A;  1XD7 A;  5E3L A;  4CZC A;  3CDI A;  3L9F A;  4PGG A;  1MNE A;  5DM6 F;  1R1U A;  3CQZ J;  3TOA A;  2HOA A;  1JT0 A;  1LDJ A;  3ABU A;  3H35 A;  2UXH A;  4B8X A;  5LRR A;  3K70 D;  5D6F A;  3SFI A;  4E7K A;  4EV0 A;  3OS0 A;  4I09 A;  1JT6 A;  1HLV A;  3TW6 A;  1XDU A;  2XF5 A;  2A6T A;  3HM5 A;  3M1C A;  1R23 A;  4PGH A;  4HNT A;  4BY1 J;  4I0A A;  1R6R A;  2DA7 A;  9ANT A;  4Q47 A;  1IRZ A;  2BY2 A;  1CF7 A;  1T39 A;  2FQ3 A;  3QP6 A;  3E5X A;  2BW3 B;  3RZD J;  3QRF F;  1ZAO A;  4GCL A;  1OCR H;  2PN6 A;  3GX4 X;  3OYJ A;  2HPI A;  2MAB A;  1V5F A;  3PNY A;  4JL3 A;  4WXH A;  4I98 B;  4FT8 A;  5CVR A;  3WTT C;  1XMK A;  4QIW N;  3S1M J;  4NBQ A;  2VB6 A;  1X2N A;  3IHU A;  2XGD A;  5FKM A;  2IRF G;  1PP8 F;  4D1Q A;  3HXL A;  3CMM A;  3ZCO A;  2V1U A;  3VWB A;  4G12 A;  1HQC A;  2YU3 A;  4RAG A;  3X2Q H;  4L62 A;  3E5Q A;  4ZZL A;  1P4W A;  2ETH A;  3GFI A;  5B5E C;  2X6W A;  2K9L A;  1FT9 A;  3MAJ A;  3PIP F;  4JK1 X;  4PUS A;  2L9R A;  2O8K A;  4C3I J;  2WC2 A;  2V9V A;  3K70 C;  1T95 A;  3F3X A;  2OTJ I;  2XPU A;  1JTX A;  3V7R A;  3AG4 H;  3CRJ A;  2ZFU A;  3MZH A;  3I9V 2;  3L7W A;  1HOM A;  5L3F A;  4IF4 A;  4QPQ A;  2VBX A;  5FRN A;  2EFO A;  1HCR A;  4LB6 B;  2ZBK A;  3EUP A;  3K8P C;  3NAR A;  2M5W A;  3HRT A;  4I6Z A;  4XM3 A;  2Y30 A;  2X9D A;  4LK0 F;  3S1R J;  2HQR A;  2NVQ J;  3CLQ A;  3SZP A;  3RPU D;  2RN7 A;  3T0Y A;  2ZSH B;  1IN4 A;  2YR2 A;  4IOC F;  3F1B A;  1T8I A;  3GBG A;  4LLN A;  1HKS A;  4K2E A;  3HOT A;  1PP7 U;  3ABM H;  1FLI A;  2UZK A;  3F6O A;  2JUG A;  3BCG A;  1IW7 F;  1EKE A;  1MMN A;  4HYE A;  2IGM A;  2E2I J;  1G3T A;  4CZZ A;  2GM4 A;  2XSJ C;  3A2K A;  3ZXS A;  1G6N A;  2KJB A;  2CFO A;  4JBA A;  4AD9 A;  1IAW A;  5F64 A;  1FZP B;  2ZXJ A;  4LK1 F;  4BHP A;  2CQ7 A;  1O57 A;  1BW6 A;  1SFE A;  2M2E A;  4A3F J;  4ME9 A;  3WHB A;  1O7L A;  5FFX A;  1IDZ A;  2O7T A;  4XOP A;  1OCO H;  1BL0 A;  2WY7 Q;  4Q48 A;  1W4M A;  3LAP A;  1Z0X A;  3G3Z A;  2FXA A;  5LEJ A;  4AM3 A;  4XSZ F;  2EQR A;  2GOX B;  2DG7 A;  3TP0 A;  1J2X A;  1KU9 A;  2HWV A;  2VQL A;  3CMY A;  2DPU A;  4S05 A;  2R7W A;  2R4G A;  1NHA A;  2QQA A;  3PUB A;  2ACJ A;  2DYR H;  1D3Y A;  4BAC A;  4OIO F;  3CP8 A;  3DPL C;  2YU9 J;  2A6E F;  2MLK A;  2RQP A;  3IKT A;  4CUG A;  2QGU A;  4JX6 A;  2W7N A;  1ZH5 A;  3H3V K;  2ME6 A;  3S15 J;  3B6C A;  2NVX J;  3GLX A;  1FYK A;  4UNO A;  5GPA A;  5LFA A;  2IXS A;  3GTK J;  2QSG X;  1XC5 A;  1JJ8 C;  2AXT C;  3ULQ B;  3LSG A;  5BS6 A;  3C18 A;  3JRI A;  1HSJ A;  3VDX A;  3G1M A;  2Z33 A;  2EK5 A;  2QM3 A;  5K5Q A;  2D2W A;  1SVM A;  1T2K A;  3LJL A;  3SEQ A;  1G2H A;  3IRQ A;  5LHI A;  3ZOB A;  2CW7 A;  2E35 A;  5HOO A;  3RH2 A;  3EUH A;  3KEY A;  3P9K A;  3K0L A;  2PZ9 A;  2RGV A;  3JRD A;  4BAY A;  4EJV A;  3GYH X;  2ZJ2 A;  1PUF A;  2W84 A;  3I4M J;  5JHU A;  1OR7 A;  3TL4 X;  3DU5 A;  2FU4 A;  2HOE A;  1Z67 A;  2XPW A;  4CCN A;  2GOM A;  2CWE A;  1LFP A;  4DJA A;  3CDH A;  3DPU A;  4QWQ A;  2OZ6 A;  4QLC U;  2CU7 A;  2EZI A;  4KIF A;  1JUP A;  4ZDP A;  2YS9 A;  5K5O A;  2IS4 A;  2IS1 A;  1D5V A;  3LNQ A;  1K4S A;  3GEZ A;  1AA7 A;  3TMO A;  3VYT B;  1RI7 A;  3BHQ A;  3COL A;  4YRV A;  2UUZ A;  2HOT A;  5GAG J;  5D8K B;  2XRN A;  2LDU A;  2R7F A;  4UB6 C;  4RLQ A;  1MJB A;  3CCM I;  5KAF C;  1UB9 A;  1F9N A;  2XAS A;  4ESF A;  1GXP A;  2VUM J;  1V3F A;  5CXI A;  2CW0 F;  1WJE A;  3C2G A;  3AQT A;  2E1M C;  2Y2Z A;  1PVE A;  3EUH C;  1IF1 A;  3CC7 I;  2KIS A;  4GYG A;  1XTA A;  3SEZ A;  1WJD A;  3HRU A;  4HW0 A;  3TO7 A;  1ZHF A;  4MQV A;  1OR7 C;  4FAS D;  4ACI A;  2R7T A;  1O3S A;  2WY8 Q;  3J80 Z;  2KIM A;  3CCQ I;  2HTS A;  4CSW A;  1MND A;  2E2J J;  2DXI A;  1FTT A;  4NC7 A;  3HGG A;  4XKB A;  2OQG A;  5GTH C;  1XPX A;  1VQL I;  2ZB9 A;  3KYC B;  3WU0 A;  4JYK A;  3RKY A;  4F52 A;  1T98 A;  1X4P A;  1BN5 A;  4F3Q A;  3EYY A;  4IHS A;  5EYR A;  1GVD A;  4R79 A;  3S3N A;  3O60 A;  3VW2 A;  3DWL E;  5K7Z A;  2RDP A;  3OYM A;  1VQ6 I;  1A36 A;  3G2B A;  2DMQ A;  3CZ6 A;  4HX8 A;  1LFU P;  2XRL A;  1N78 A;  1Y0N A;  2H1K A;  5HVQ C;  2GBY A;  2TDX A;  2NP5 A;  2IVM A;  4XLA A;  1BR4 A;  1SVO A;  4UUT A;  3RJP A;  2OTL I;  1Y8Q B;  4EJU A;  3CCR I;  1S72 I;  4B1R A;  1ZYR F;  5CQE A;  3RDI A;  2IP2 A;  4A69 C;  3ASO H;  2R5Z A;  2DT7 B;  4EVI A;  1JHF A;  3QQA A;  4I2O A;  1IN6 A;  4Y15 A;  4OAY A;  5DTD A;  3G1L A;  1VQM I;  4RB2 C;  1QPI A;  2XGE A;  3HUG B;  4ZH4 F;  2ZCX A;  4JQF A;  3JRB A;  2DMN A;  4I01 A;  3QPL A;  1ZLJ A;  1WCM J;  2JN6 A;  2EA4 A;  3OY9 A;  2P7V B;  4Y13 A;  4M9Z A;  4OU0 A;  1OMI A;  3V7S A;  1Y0U A;  3EQL F;  5HOD A;  1JGG A;  3H5N A;  4A3E J;  1R9T J;  3GTG J;  3QOP A;  1D5Y A;  2O61 A;  2BOL A;  1Z6T A;  2HKX A;  3DP7 A;  3REO A;  1YRN B;  1FSE A;  1O7F A;  3OYI A;  3CME I;  3GTO J;  3SDB A;  4ENJ A;  1WJF A;  1LNW A;  1BBY A;  5D5V B;  1HW1 A;  3GTP J;  2P6S A;  3K4J A;  4XOT A;  5EGO A;  3BWG A;  5EEH A;  1D0Y A;  4IQJ A;  3N05 A;  5B3S H;  1B8I A;  5C3E J;  2CMP A;  1D8J A;  3KZY A;  3K1N A;  5GAD J;  1T6S A;  4EM0 B;  1MMS A;  3Q0V A;  5FKL A;  5M3F J;  1AU7 A;  2A6H F;  2FD5 A;  3HE0 A;  2DJN A;  2ISZ A;  4W1U A;  4A0X A;  2FJ1 A;  4UUS B;  4E7S A;  3KP4 A;  2ZFW A;  3GFJ A;  1EF4 A;  1ACI A;  4KYW A;  3FHN A;  4G7Z F;  2EZL A;  1I39 A;  3CF2 A;  3GME A;  5IT3 A;  4MK6 A;  2QKO A;  4A3C J;  2RNJ A;  3R0A A;  4U87 A;  3WTS C;  2FNP A;  5BPI A;  2X0L A;  1YJN I;  4XLF A;  3EGQ A;  5EJC A;  1W7P D;  1GLN A;  1Z3X A;  2F5E A;  2ZME C;  1ZG3 A;  2W24 A;  3DTK A;  1YX5 A;  1JKR C;  1LPQ A;  3GO5 A;  2KKO A;  3BZ6 A;  2HR3 A;  4XR6 A;  4KIT B;  3AL0 B;  3OYD A;  1UCR A;  2E2H J;  2PBX A;  4AWX B;  4UXN A;  4ENN A;  2STW A;  4KMF A;  3NPI A;  2XKP A;  1RR7 A;  3BRO A;  4C3J J;  1OYW A;  1UZC A;  2XAJ A;  1U5T A;  3GZN B;  2ZJP F;  4YEL A;  2DA2 A;  1IJW C;  3SJM A;  3I59 A;  3WG9 A;  1DGR M;  1NTC A;  4MFE A;  1WFX A;  5KNL A;  4XQF A;  2OPT A;  3A01 A;  1LDD A;  1QPM A;  2QEN A;  1KU3 A;  5F27 A;  4NC8 A;  4BY7 J;  2A5W A;  5M5W J;  3GTQ J;  3H3U A;  4CCL A;  2DA6 A;  5LGN A;  2M4G A;  5CPR B;  3KLO A;  2H1L A;  2VPR A;  4L9N A;  1KON A;  2K7L A;  2XB0 X;  1UHW A;  1Z7L A;  4A6E A;  5DAJ A;  2FSW A;  2ZSI B;  2VBY A;  3ERM A;  2UXX A;  5H6R A;  3OR1 C;  1HDP A;  5J1R A;  2E7X A;  2XV4 S;  2Z5U A;  5BNG A;  4OD5 A;  5FGL A;  3VSK A;  3V8L A;  4A3D J;  1I1G A;  2HZT A;  4MHG A;  3VOE A;  1TWC J;  2LC2 A;  5DV5 A;  3IUV A;  2F48 A;  4XL9 A;  2NX4 A;  3OYN A;  2ZOZ A;  2Y75 A;  1JKQ C;  3Q3S A;  2CG4 A;  2FJI 1;  5LBQ A;  1R1V A;  3IWF A;  1T0F A;  2A5Y B;  3BTJ A;  4AU7 A;  3B81 A;  2EFP A;  4LD5 A;  5B66 C;  3OV8 A;  2X1E A;  3ZMU A;  2OER A;  1LFB A;  1R4M B;  2VOD A;  2X85 A;  2QBY B;  2O9L A;  5E1Z B;  4MEX F;  3HSE A;  1OIS A;  4OMZ A;  2KDZ A;  2ELJ A;  4CA0 A;  2NVU B;  4PJL A;  1L0O C;  3H9Q A;  2VQH A;  2VC0 A;  3BTL A;  4ZZD A;  4XNF A;  2IA2 A;  1J7K A;  3GFM A;  1Y1V J;  3P9C A;  5H2F C;  3T1B A;  1X2M A;  2DMU A;  3ZP5 A;  3W2A A;  3S2W A;  4PJ0 C;  3BNI A;  1Z6R A;  5L3G A;  1WGX A;  4E7Z A;  1XDS A;  2VXZ A;  4HNU A;  2VBW A;  2A61 A;  2HYF A;  5FD6 A;  1IXR C;  2BW3 A;  2KIU A;  1UST A;  3ZGK A;  1DGW Y;  3KP2 A;  3DQV C;  1UG0 A;  1F5T A;  2LTP A;  2ECB A;  2PEX A;  3FMR A;  3F9K A;  1KQ9 A;  4G6D A;  1MJ9 A;  2QQB A;  1Y6I A;  2F6C A;  2KIF A;  2VC1 A;  1DDN A;  3W6V A;  5HLI A;  2WAQ A;  2G9W A;  3DEW A;  2M0C A;  4PK4 A;  4LIV A;  1TBX A;  2JZY A;  4NNJ A;  5CVU A;  1MNM C;  2Y0S N;  2OBP A;  5F0F A;  3I4P A;  3W2W A;  2H27 A;  1YHQ I;  4ZYD A;  5DD4 A;  2WV1 A;  2MFZ A;  4E7J A;  2FA5 A;  3EPZ A;  3LQR A;  3HOU J;  3KZ9 A;  1T0F C;  4A3M J;  2LRD A;  3LWJ A;  2B3W A;  1JKO C;  1Y56 A;  2H94 A;  4DOZ A;  5E1W A;  1K78 B;  1QZE A;  3QOD A;  4OMY A;  3H5R A;  1UHS A;  4M3D A;  1REP C;  1EJ9 A;  2WA0 A;  3CP2 A;  3ECH A;  2DMT A;  3VIB A;  2ZME B;  3F6V A;  5EZH A;  4H0E A;  4LG0 B;  1WKM A;  4IPA A;  2M7B A;  4OWR B;  4DNC A;  3GWZ A;  3HBL A;  2ZXI A;  5CJ9 A;  1QZZ A;  2QWT A;  4ON0 A;  1MBK A;  2PG4 A;  3K4N A;  1SD5 A;  3GTJ J;  1NK3 P;  4UUV A;  1VQO I;  4XLP F;  1S9H A;  1YE9 A;  2QKL B;  4IHY A;  1TW2 A;  3MCZ A;  5JR3 A;  4UB8 C;  2VJ5 A;  3S2H J;  3HOS A;  3CF5 F;  1KU7 A;  2CUF A;  3I0T A;  1GXQ A;  2UXN A;  2A2F X;  2ZJR F;  5BOX A;  3F23 A;  2QWW A;  3WGI A;  2M8G X;  3KYL A;  2FX0 A;  3MNL A;  4MXM A;  1ZGA A;  1IDY A;  2FRH A;  3FDY A;  2BY3 A;  1IC8 A;  3RTR A;  5JVG F;  2EIM H;  2L4M A;  1H88 C;  2LK2 A;  3F72 A;  2QCO A;  4C2U A;  3FMS A;  1H9T A;  2JSC A;  4I0B A;  2M45 A;  3S3O A;  3VOD A;  4MGR A;  3JTH A;  4D9J A;  2K9N A;  1SFX A;  1QRY A;  2M1B A;  3K4K A;  4B09 A;  2UV1 A;  2MD5 A;  1W7P B;  1W36 D;  2D6Y A;  2NS0 A;  1TQI A;  4L0Z B;  1ETY A;  1Z3Y A;  3CES A;  1I1S A;  2K5C A;  3P9I A;  3J7A Y;  4RM3 A;  3DEE A;  3E3V A;  2OUM A;  1Z1D A;  3J81 Z;  2V7F A;  1S7E A;  2R7Q A;  2QYO A;  4LOC A;  2Z1D A;  3BC8 A;  5J4V A;  3FKJ A;  5J1Y A;  1KQ0 A;  1LDK B;  2BV6 A;  2CV0 A;  4GFB A;  3ANG A;  2L7K A;  4XID A;  5AIP A;  5D19 A;  1YS6 A;  2L9N A;  1MW7 A;  1XSX A;  2FE3 A;  2DMP A;  2JWT A;  2MA3 A;  5DCM B;  1HF0 A;  3PPB A;  4U9L A;  2L7Z A;  3JW4 A;  3O8H A;  4IL6 C;  4KT5 C;  3JAM K;  2K40 A;  1WHU A;  3PIO F;  3TO6 A;  2B63 J;  2ZC2 A;  2NRA C;  4EJO A;  2FBH A;  4XRM A;  2CV2 A;  1LQ1 A;  4AIH A;  4IX7 A;  2CH0 A;  5EF6 A;  5J8C A;  4ASN A;  2G7U A;  2N8G A;  3PNT A;  1TWF J;  2NNY A;  3G6E I;  3DXJ F;  1IV6 A;  2A07 F;  4FQG A;  1XMX A;  1P6R A;  2JPB A;  4BBR J;  1MKM A;  5IT9 Z;  5A2Q K;  2DOA A;  3H9G A;  1RC9 A;  5LLQ A;  1MSF C;  4EGZ A;  2ZCN A;  3EET A;  5FJ8 J;  2ECC A;  3ZRG A;  4N0B A;  3DU6 A;  1IN8 A;  2HFH A;  2QUF A;  3PNV A;  3BZK A;  1QQI A;  3MFK A;  2YUS A;  4WXC A;  1R4N B;  3IC7 A;  2OZU A;  3KZI C;  4HQM A;  3G7R A;  2E34 A;  4BQA A;  2HXI A;  3KP3 A;  2VN2 A;  2HQA A;  1KZH A;  3ABT A;  3IAS 2;  2NNN A;  2UXP A;  2ID6 A;  3O2P E;  3G56 A;  2EA2 A;  4G94 A;  1VQP I;  4HBL A;  2VL8 A;  3L2V A;  3SZG A;  2Q8K A;  4JX4 A;  3V8J A;  5HNH A;  4CDG A;  4A3K J;  2E71 A;  4IHV A;  4IO9 F;  4HPQ A;  1K6O A;  4DQ2 A;  1B9M A;  4KUM A;  2XAG A;  4IQ4 A;  2DJI A;  1VQ4 I;  3PSI A;  3RPQ A;  1RR8 C;  5LD2 C;  3LA7 A;  2DQR A;  4YIF A;  3B02 A;  1EV7 A;  1UMQ A;  4S0H B;  4A6D A;  5CKT A;  1K83 J;  3ON4 A;  2Y0S A;  3OL4 A;  4WXD A;  4CH7 A;  5K5R A;  1XSV A;  4RA2 A;  3OYK A;  4G6Q A;  2PLY A;  3BOQ A;  2VQG A;  3ZMT A;  4ESJ A;  1VQN I;  2V4J C;  2P5L C;  1XS9 A;  4A3J J;  5B1A H;  2I10 A;  1JI8 A;  2R7D A;  3FK6 A;  4ZDO A;  4LGW A;  2XDV A;  2VJI A;  3TBI A;  4CGZ A;  3HDD A;  1FX7 A;  3ZMD A;  2XIG A;  5D4R A;  2E5N A;  3HHG A;  1K61 A;  3CCJ I;  1POG A;  2JVG A;  3HTI A;  2I5U A;  3PFY A;  1FBQ A;  2KLO A;  2G7L A;  5FMP A;  1WJC A;  2LYC A;  4BEH B;  2DPD A;  3MD2 A;  1HW5 A;  1I6X A;  2DCE A;  3QYE A;  4HV6 A;  4RAZ A;  1V5G A;  5FKN A;  3U1K A;  4A5M A;  4CCK A;  3F22 A;  2W53 A;  2Z99 A;  4RLF A;  1X19 A;  1F36 A;  3NNR A;  4B44 A;  1YW8 A;  2QQ9 A;  4RB1 A;  2KPM A;  2MW8 A;  1YI2 I;  1TWH J;  1X4O A;  1G3Y A;  4HZF A;  4DYC A;  1QHG A;  2VPL A;  3RPU A;  2D45 A;  2Z2S B;  4AUX A;  2RAS A;  5AIQ A;  2Y0M A;  5E3O A;  2DA4 A;  1FTZ A;  1X1B A;  5L3C A;  2Q1Z B;  4MO7 A;  1Z05 A;  2K27 A;  2L9S A;  3HTH A;  1JUM A;  1QNT A;  2WAE A;  4IRG A;  4H4K C;  1TQP A;  2B7E A;  4HA8 A;  2LY2 A;  5DEQ A;  1FIA A;  2XKO A;  3SWH A;  4L5I A;  2IW5 A;  1A6I A;  2EH3 A;  2W1O A;  2ME0 A;  3HUG A;  5C4J J;  4U9N A;  2MD0 A;  3OYA A;  3E1S A;  3BJO A;  1WI9 A;  4W97 A;  1BIA A;  4C2M J;  1MJA A;  1BI2 A;  2ELH A;  3F8M A;  3RCO A;  2CW8 A;  3HRS A;  1LB2 A;  5IP6 A;  2R7X A;  1YRN A;  4I76 A;  2GUH A;  4DZJ A;  4AIK A;  4F93 B;  3CLO A;  1QVT A;  4ENK A;  1FOW A;  4XIC A;  1JUS A;  5HSZ A;  4ZTJ A;  2FUG 2;  3BG7 A;  2XC7 A;  3HTS B;  3WOD F;  4PCQ A;  2R7S A;  1MMD A;  3V42 A;  3HIM A;  4I02 A;  3IH3 A;  3PL8 A;  3TP3 A;  2K9Q A;  2LH9 A;  1NH3 A;  2BVL A;  4II3 A;  3K4B A;  5FRM A;  2HPM A;  4XN3 A;  4RAY A;  2G7S A;  1OQY A;  2L2O A;  4PDK A;  5ILS A;  5HNF A;  1AKH B;  3FXO A;  1UI5 A;  4NDL A;  3HL2 A;  1ZRD A;  3LFK A;  1TW3 A;  5FKK A;  2FBI A;  4C2M A;  4PJN A;  3CJR B;  3CDL A;  4U88 A;  2NP3 A;  3WTZ A;  3C3W A;  4M3G A;  1IG7 A;  2DFI A;  3BG3 A;  5DDG A;  2R7R A;  1MBE A;  4UUS A;  1U3E M;  5FLX K;  3M9A A;  2BY0 A;  3H9J A;  2Z9O A;  3DKW A;  3FKI J;  4DYQ A;  3G71 I;  1LE8 B;  2MH9 A;  1T33 A;  2EJR A;  1E17 A;  2L02 A;  5D5W B;  3VEP A;  2DAO A;  2HGC A;  2ZOY A;  2COB A;  2BYV E;  3WTY C;  4FTH A;  2Y48 A;  3HIF A;  3V4G A;  2HYJ A;  1ZQ3 P;  1T56 A;  5CYV A;  3OOU A;  4KFC A;  4CGR A;  2CSO A;  2GAU A;  3F21 A;  1ZK8 A;  1YX3 A;  2F5V A;  3E6B A;  3WGG A;  1O3Q A;  3K9T A;  1J9I A;  3CCE I;  1PDN C;  4LLG F;  1I3A A;  4JKZ A;  4EJT A;  4RAF A;  4WX9 A;  2OC6 A;  4V19 K;  1B72 B;  4GCK A;  1FIP A;  3K4M A;  4QPO A;  4ETS A;  5CQG A;  5IOY A;  4I7H A;  3F8N A;  4RGU A;  2EIN H;  1GT0 C;  2HYT A;  2QVO A;  2XVC A;  4IHW A;  1ZG5 A;  2RV8 A;  5CW8 A;  1MBG A;  4X1E A;  1SGM A;  3COA C;  2VAS A;  1IRG A;  1WZ2 A;  3O3K A;  2XAQ A;  3H92 A;  4OIR F;  3HGY A;  2ZNY A;  1FSH A;  3S5R A;  3SFZ A;  2KRF A;  2W57 A;  4M72 A;  1BC7 C;  4LIT A;  3S32 A;  4RMN A;  3DKX A;  1HA8 A;  2LMD A;  3UKG A;  1R5I D;  3DBR B;  3CJN A;  1EH7 A;  3VUQ A;  1S7A A;  1YYV A;  3OYC A;  4Z2Y A;  3ZMV A;  3RD3 A;  2FOK A;  3AG1 H;  1V4R A;  2NOG A;  1S7O A;  4KWA A;  2JVH A;  4UV9 A;  1YQA A;  3DLA A;  3E6D A;  4PSX A;  2G7G A;  4BS9 A;  4ICH A;  1O3R A;  1WH5 A;  3L1P A;  4ITV A;  3R0J A;  1XSD A;  1TC3 C;  3AL0 C;  1I6H J;  2L0K A;  1RKT A;  1FY7 A;  4GCV A;  4WWC A;  1IGN A;  2DTZ A;  3WTW C;  1IN5 A;  3HB9 A;  1OPC A;  3GVA A;  4ZJZ A;  3ASN H;  2VLA A;  3JTG A;  2RAE A;  2ZO4 A;  2CQN A;  3ZQL A;  1YJ9 I;  3FIW A;  3CCU I;  2PMU A;  2QKM B;  5BQT A;  3IAM 2;  5A2Q Z;  5GPC A;  1WVR A;  3V8K A;  2QBY A;  3KP5 A;  4HRI A;  3OL3 A;  3D5R C;  3QYB A;  3FIS A;  3H0G J;  4ENM A;  5E8G A;  2G3B A;  4RB3 C;  4KT6 A;  3CD6 I;  3LSK A;  4OIP F;  2H8W A;  2HDW A;  1WQ2 A;  2LSO A;  4JP0 A;  4EMS A;  3IP4 B;  3ZQH A;  3SZT A;  1QBJ A;  3D0S A;  4NEL A;  4A5N A;  2FBK A;  3FHZ A;  2JRT A;  1YW9 A;  2VT3 A;  4AVZ A;  2GA2 A;  4LFU A;  5IYB J;  3RYR A;  2IS2 A;  2F2E A;  3E7L A;  3SQN A;  5HS7 A;  3MEX A;  5DS9 A;  5EFY A;  3BR2 A;  4LG3 A;  4AYB N;  3HG9 A;  2VKD A;  2GZW A;  2WAQ N;  3GZ5 A;  2W25 A;  3BR3 A;  4KJZ A;  4DBQ A;  5EDN A;  2OJE D;  4M74 A;  3GTL J;  2OU2 A;  2M34 A;  1SAX A;  1R22 A;  1R1T A;  1J5Y A;  4MFD A;  1YFH A;  1MMG A;  1K78 A;  1TNT A;  3MZY A;  1YW7 A;  1A5J A;  3MN2 A;  3DBL B;  3ZQI A;  3Q9V A;  2ZME A;  2AXL A;  5IP7 J;  4LG0 A;  3K6G A;  1DUX C;  2YPR A;  5J40 A;  1FYL A;  3MKW B;  1H89 C;  2L4A A;  2NOJ B;  5E1X A;  1W0T A;  3HPG A;  2E1N A;  2B9S A;  3I56 I;  1SMY F;  3I58 A;  3M1E A;  4CHU A;  1RUN A;  4P55 A;  2DTR A;  4BQQ A;  2VKH A;  1USS A;  1W0U A;  1SAN A;  4KIG A;  4XON A;  4J19 A;  1IXS B;  4O5V A;  1PYV A;  3LFU A;  1P7J A;  4BXU A;  3RKX A;  3WG7 H;  1ZLK A;  1X1P A;  3FM3 A;  5C44 J;  2EV5 A;  5BPD A;  3CC4 I;  2MGQ A;  3KX2 A;  4BYY A;  2QF7 A;  1SFK A;  2B0L A;  2HYG D;  2PJR B;  4UY8 I;  2RHA A;  4NN1 A;  2LKP A;  2DFH A;  2HVQ A;  2HKO A;  2EWN A;  2A05 A;  3U2R A;  3TW7 A;  3BQZ A;  3CCV I;  3M4O J;  2DO7 A;  4HOB A;  1D0X A;  2XRO A;  1JXS A;  3VOX A;  1W7P A;  2MYS A;  2ADU A;  1MZB A;  2X48 A;  3NRV A;  4XKW A;  2VI6 A;  5AON A;  3NQO A;  3VYU B;  2HOS A;  4CCM A;  4CIC A;  3KIO A;  2WAD A;  5KK1 A;  2HU9 A;  2AQF A;  1SFU A;  1WRJ A;  1NG6 A;  2O3F A;  3S16 J;  2F07 A;  1DPU A;  4BJ5 C;  3IRR A;  3CO6 C;  2HVR A;  1L3L A;  5IP9 J;  5ICF A;  2HEO A;  2RNG A;  1JHH A;  3E5U A;  1N77 A;  1ETK A;  4O6J A;  4GO1 A;  1U0J A;  4MLO A;  5ICC A;  4OIQ F;  1DQU A;  2DG8 A;  3R4K A;  5E20 A;  1FEX A;  3RKW A;  3R60 A;  3AG2 H;  5DCM A;  3MKZ A;  3PO2 J;  1ONV A;  2ZJQ F;  1IZ1 A;  2R7Z J;  1Q1H A;  3KNW A;  2PQ8 A;  1P92 A;  4CCO A;  4D7M A;  3K2A A;  3JRG A;  3FXL A;  1WWX A;  2X6O A;  3QPT A;  3CJT B;  3ZR8 X;  3FXR A;  2ESN A;  2ZNZ A;  2JK3 A;  3BR1 A;  3M07 A;  1EA3 A;  3K4C A;  4P5O A;  3F8C A;  1BM9 A;  4BNC A;  3KEQ A;  3FBN B;  4HSR A;  4MIM A;  3M8F A;  3S93 A;  1RZ4 A;  5F1R A;  2GIZ A;  4GGG A;  4B47 A;  5ERI A;  2I8D A;  3MMY B;  4D5F A;  1F4K A;  1E2X A;  2V1X A;  4IRI A;  2M8E A;  2QSF X;  4P9U A;  2STT A;  3PAS A;  1YS7 A;  1XB4 A;  4MTE A;  2L01 A;  4XMY A;  5KHD A;  4E6K G;  2FBQ A;  4M6Y A;  3P7N A;  2GWR A;  4PXI A;  2KL4 A;  2ZCW A;  3AFH A;  4BXF A;  5FKO A;  4F55 A;  1RNL A;  2E1O A;  2MC4 A;  2Z3Y A;  2E7W A;  5LHG A;  3I64 A;  5FLX Z;  1JTY A;  4B48 A;  4KIS A;  2YX4 A;  1ITY A;  3HOX J;  4V2F A;  4JOM A;  1TTY A;  1E3H A;  5HBU A;  1R5G A;  2W82 A;  5B1B H;  1VQ9 I;  2IA1 A;  1K4T A;  3I3L A;  4DBR A;  5M3M J;  3FXK A;  4L9V A;  3HZJ A;  1HW2 A;  4YEJ A;  3AKZ A;  1T38 A;  1B9N A;  3BPV A;  1MBJ A;  1UFM A;  4Y52 J;  3GF2 A;  5BMZ A;  3TKY A;  3HTA A;  3ZQC A;  1R7J A;  1V5E A;  2IU5 A;  2TCT A;  3NXC A;  2XHK A;  3PO3 J;  5D5X B;  4F7Z A;  2W85 A;  3WE2 A;  5JLW A;  4AYB A;  3HSR A;  2BE5 F;  5LRS A;  5E17 F;  3W6J B;  3TGN A;  1RPW A;  1ODD A;  4L18 B;  3I53 A;  3KLN A;  1GHC A;  3HEF A;  5GAH J;  5ILU A;  3RI4 A;  2DK5 A;  3QU6 A;  1IXC A;  1ON1 A;  3MKL A;  2XDN A;  3OYE A;  3C07 A;  5J1U A;  3GW2 A;  4HNV A;  1Z7U A;  5D18 A;  2GA1 A;  3ISP A;  1OYY A;  2Q2E B;  3GTM J;  2KDO A;  4G7H F;  3LSM A;  2UXI A;  1XMA A;  4M3F A;  3TDU C;  3LSR A;  4EGY A;  2YVX A;  1R58 A;  1Z91 A;  1ON2 A;  4LIU A;  2ZKZ A;  1NG7 A;  4IXA A;  2CV1 A;  1VQ8 I;  3OWT A;  2MG4 A;  3KP6 A;  2F5F A;  1U78 A;  5TGT A;  2X1D A;  1ZEL A;  2IBD A;  5D4S A;  2OQR A;  5JVT A;  3JSP A;  2R0Q C;  4FHT A;  4A12 A;  1ENH A;  2LP0 A;  4BEH A;  1ZRE A;  2E1C A;  3HPH A;  1D8K A;  4AF5 A;  4MEY F;  3Q9S A;  3GCM A;  5J3L A;  1FOX A;  3BJB A;  1TT5 B;  4UHT A;  4QSH A;  3RQ4 A;  1G3S A;  1BIB A;  3L09 A;  2A68 F;  3EUK L;  2VT2 A;  2DT6 A;  3PSF A;  3DV8 A;  4U0W A;  3H1C A;  4BXX J;  2BGC A;  1ZG1 A;  3K2Z A;  1I50 J;  4P96 A;  4OAZ A;  5JI6 A;  3KFW X;  2X1C A;  4YFK F;  4Z6Y A;  1WSU A;  5FLV A;  1G8X A;  1OCC H;  3JRH A;  2WGB A;  3CUQ B;  3Q5F A;  2Q24 A;  4P1W A;  3H36 A;  3MKY B;  1OCZ H;  1TT0 A;  2NVT J;  5CVV A;  3C7J A;  4BQN A;  1Q1V A;  2QEX I;  3BTI A;  4G7O F;  2GXG A;  3S17 J;  1B59 A;  2UXU A;  2BXZ A;  4U7D A;  2R93 J;  2HQN A;  4D5C A;  2BHZ A;  1X3Z B;  2K9M A;  2H6B A;  1RET A;  5EG0 B;  1YJW I;  3F8B A;  3NI7 A;  3CWR A;  4U0V A;  3I54 A;  5C4Y A;  4IZZ A;  3M3Y J;  4RB0 A;  3OIP A;  1TP4 A;  2MC3 A;  2ICW G;  3SDG A;  4YZE A;  2PFB A;  3QOE A;  4BQO A;  3R61 A;  4GFK A;  4KMU X;  4KIB A;  2MH2 A;  3WHC A;  5HLH A;  2MLG A;  2A3S A;  1K79 A;  1FC3 A;  4C30 A;  2V6C A;  3HJE A;  1SD4 A;  2OA4 A;  3AAF A;  4A93 J;  3CJQ B;  2G0E A;  2YVH A;  3BT9 A;  2REK A;  2MSY A;  3WE3 A;  3OOP A;  1SVL A;  2W4S A;  3T8R A;  4A3G J;  2LY1 A;  3NWS A;  3GUD A;  3O8G A;  4HF2 A;  3VYR B;  2XAF A;  4HX7 A;  2K9S A;  2LBF B;  1MH4 A;  3DLL F;  2HDC A;  1P4A A;  1PUE E;  3QU3 A;  1RIO H;  3DPJ A;  3VOK A;  4X0G A;  1OJL A;  4BUP A;  5IY5 H;  1AKH A;  1OLT A;  5M5X J;  3PQJ A;  3GZ6 A;  5JHF A;  5ILV A;  3MZ8 A;  1VND A;  3FF5 A;  4TV7 A;  1A04 A;  4OOI A;  2R7U A;  4A0Y A;  1W5T A;  3QP5 A;  1LE8 A;  2O5R A;  4PJM A;  4B43 A;  1YTY A;  2F5D A;  3D1N I;  1UJ8 A;  3BQY A;  4EQQ A;  1EH6 A;  5M5Y J;  1W36 C;  1J0R A;  3VSL A;  3RQI A;  1F43 A;  2VE9 A;  1S6L A;  4OIN F;  4DIQ A;  4C9Y A;  3OYL A;  5GP9 A;  1XG1 A;  2E36 A;  2QOP A;  1X3U A;  2VKV A;  1J09 A;  4FE7 A;  2EV0 A;  3E6C C;  1SEU A;  3BR5 A;  4HDU A;  4BDY A;  3JSJ A;  2IAI A;  2DU9 A;  2K4J A;  1DPR A;  4FIS A;  3H5A A;  3DFG A;  2XAH A;  2M4K A;  2PX9 A;  1VQK I;  4RBO A;  3CUO A;  3B73 A;  4L9J A;  1B72 A;  3DBH B;  1N75 A;  4CYC B;  4M3E A;  2H09 A;  1FPQ A;  5F6F A;  1WJ5 A;  3OS1 A;  2HI3 A;  2E60 A;  3I71 A;  3CCY A;  1VQ5 I;  1FMV A;  1K7A A;  1AOY A;  1GUU A;  5E18 F;  3OYB A;  3P9T A;  2DLL A;  1UHM A;  1QZY A;  2A69 F;  4OD4 A;  2PBI A;  2DA3 A;  4II2 A;  2J5P A;  1LUJ B;  2IS6 A;  2CRG A;  3ABK H;  2ESH A;  2MBF A;  1H0M A;  2DOD A;  3QPH A;  3KKC A;  4BE0 A;  2DT5 A;  3W3C A;  1BJA A;  5ICG A;  1BI0 A;  2FMY A;  3KKD A;  2RVC A;  3BJ6 A;  2L9V A;  3EYI A;  2Y9Z A;  2HNH A;  2NS7 A;  5J47 A;  4M3B A;  1E3O C;  3QYF A;  3S8P A;  2LR8 A;  4XRS A;  2C6Y A;  1XGO A;  2NS8 A;  1UI6 A;  2FML A;  1KYZ A;  3BTC A;  1E0E A;  1P4X A;  3BDD A;  3VVZ A;  2KZG A;  4U7B A;  1VFC A;  3ZPL A;  2RC4 A;  5GTI C;  2JRM A;  3E7Q A;  2QIB A;  4M9S A;  2FF4 A;  2EZH A;  4DZP A;  1SC7 A;  1KA8 A;  4XN0 A;  3PM1 A;  4HQE A;  3OSG A;  3UNG C;  3E97 A;  4KDP A;  2DFE A;  5CVJ A;  1U6G A;  4PFO A;  2M87 A;  1RKW A;  4N4O B;  2CQK A;  1ZGW A;  2ID3 A;  3OYH A;  5E8I A;  4XRS G;  5LEK A;  2QZ8 A;  2NYX A;  2F4O B;  2P5V A;  3C1D A;  3DPT A;  2QA4 I;  3EUA A;  3J7Z I;  3OSF A;  3FRQ A;  2KFD A;  3BPX A;  1H8A C;  2VOO A;  4A3L J;  4XOR A;  5ED4 A;  1MDM B;  2GIV A;  1WI3 A;  5K58 A;  1XCB A;  1KGS A;  4UV8 A;  2M3A A;  3VW0 A;  2Q0O A;  3LA3 A;  3MWM A;  3FK7 A;  1O4X A;  3T8T A;  2K4B A;  2VJ4 A;  2EIK H;  2OCC H;  5L3D A;  4R1H A;  4BL0 B;  5ICE A;  2IGN A;  2J5O A;  2Y31 A;  3BCB A;  4LMY A;  4GFL A;  3G1O A;  2EFW A;  1RES A;  1J59 A;  3ZMZ A;  3JCU C;  1NK2 P;  4MNU A;  3KYD B;  3FMQ A;  1JJ6 C;  2KIQ A;  3ELK A;  3I5U A;  2GXA A;  2JA8 J;  1CGP A;  2F5C A;  1WJB A;  1YLF A;  2XPV A;  3LOC A;  5J6X A;  1G59 A;  2R5Y B;  3VFZ A;  1YOV B;  2V1D A;  2IEK A;  4G6T B;  4NQW B;  3T6N A;  1B1B A;  2AO9 A;  2LY9 A;  4HF0 A;  4HG2 A;  3C2H A;  2JSP A;  3O6B B;  5E3N A;  1DU6 A;  4IRH A;  3ON2 A;  2IA0 A;  1U8R A;  2JQ7 A;  4FET A;  1AWC A;  1YO5 C;  3L2Q A;  1QHH D;  5LHH A;  1X58 A;  3K1M A;  3F8F A;  4CCJ A;  1YIJ I;  2LLK A;  3B6A A;  1UEL B;  2L7F P;  2LKS A;  1S8N A;  2M0M A;  2JMW A;  1LKX A;  2R3S A;  1GV5 A;  3F0C A;  3J7A O;  5D5U B;  4N9I A;  2EFN A;  4LJZ F;  3VB2 A;  2OV7 A;  2DDA A;  3KEO A;  3ZQF A;  3S3M A;  2L7M P;  3HC7 A;  3V78 A;  2HQ5 A;  4Y33 A;  4RGR A;  2DDB A;  4RDU A;  1R36 A;  3TQN A;  5L3B A;  3K7A J;  4IJA A;  3ERE D;  4BHB A;  4V2G A;  3RKQ A;  3IUO A;  1BOA A;  1O3T A;  1KU2 A;  3IH4 A;  3MVP A;  1XGS A;  2Y9Y A;  3HOW J;  2L5Q A;  2BVM A;  4XBF A;  1QU3 A;  1S3J A;  1IO2 A;  4DGW B;  2PJR A;  1LEB A;  2ZXH A;  3ABL H;  3NRG A;  4EAT A;  5K7H A;  3ZQG A;  3NWT A;  4IRV A;  2KQR A;  2FQ4 A;  2LRE A;  4E4H A;  5F1J A;  1A35 A;  3L2R A;  3LHQ A;  3ZMS A;  2HXO A;  2IJL A;  1OFC X;  4Q4Z F;  3BG9 A;  1FWZ A;  5CLS A;  3W2V A;  1P7I A;  1APL C;  4KNY A;  3LST A;  2WAF A;  2UXO A;  1TL8 A;  4XLE A;  4N4N B;  4A3I J;  2OAZ A;  2H6C A;  2WWY A;  5FRO A;  1ZR4 A;  2B1E A;  1SFO J;  2KZV A;  2JA6 J;  3DTI A;  2KRH A;  3FXJ A;  4R8H A;  1FBU A;  2WV0 A;  3V7C A;  3BCA A;  3JRA A;  4KN7 X;  2LOO A;  4U0Y A;  1BW5 A;  3D5L A;  5TRD A;  1SD7 A;  2EFQ A;  4P9F A;  3U9G A;  1HDD C;  1QVU A;  3BLY A;  1PJR A;  1R5H A;  3TO9 A;  4AIJ A;  2O03 A;  3PFI A;  2GXB A;  2DYS H;  2XF6 A;  3FM5 A;  3LSI A;  5FB2 A;  2NAZ A;  3IKV A;  2HDD A;  1LVA A;  4B3X A;  3FBI B;  3M8E A;  1G4D A;  3IWZ A;  3A0H C; 
#chains in the Genus database with same CATH homology
 4L62 A;  2CUF A;  2JJ7 A;  2EBI A;  3S16 J;  2F07 A;  2L9R A;  5IP9 J;  2M8G X;  2O8K A;  4C3I J;  2EZK A;  2FX0 A;  1Y1W J;  3MNL A;  4MXM A;  1IDY A;  2P81 A;  1ETK A;  1IC8 A;  4MLO A;  1TWA J;  2XPU A;  1VI0 A;  1JTX A;  1H88 C;  2DG8 A;  1FEX A;  2LK2 A;  3CRJ A;  3PO2 J;  2QCO A;  2WUI A;  2R7Z J;  3AQS A;  1HOM A;  3KNW A;  1HCR A;  4D7M A;  3K2A A;  2K9N A;  3JRG A;  3EUP A;  1QRY A;  3NAR A;  4I6Z A;  2D6Y A;  2Y30 A;  2X6O A;  1ETY A;  3JRF A;  3GZI A;  4DW6 A;  2X9D A;  3LSJ A;  4ABZ A;  3S1R J;  2NVQ J;  1TWG J;  2JK3 A;  3BR1 A;  1U9O A;  2AHQ A;  3F1B A;  1S7E A;  2E19 A;  3GBG A;  4MIM A;  4LOC A;  1ETV A;  3BCG A;  4D5F A;  5J1Y A;  4GFB A;  3ANG A;  3A03 A;  2E2I J;  3PAS A;  4XID A;  2PMZ N;  2GM4 A;  5D19 A;  2ZCM A;  2XB5 A;  2DMP A;  1CQT A;  5D1R A;  2FBQ A;  2JWT A;  1HF0 A;  4AC0 A;  1MSE C;  3PPB A;  4PXI A;  2L7Z A;  1BW6 A;  2DA1 A;  3O8H A;  2M2E A;  4QTR A;  4A3F J;  5FKO A;  4ME9 A;  3WHB A;  2K40 A;  2E1O A;  3JSJ A;  1IDZ A;  2B63 J;  1ITY A;  1JTY A;  5F08 A;  2O7T A;  4XRM A;  3HOX J;  1BL0 A;  2KT0 A;  5C4X J;  4V2F A;  5EF6 A;  1ZKG A;  5HBU A;  1Z0X A;  2N8G A;  1TWF J;  2EQR A;  4DYR A;  2DG7 A;  3TP0 A;  5M3M J;  4FCY A;  1IV6 A;  3CMY A;  3DCF A;  4BBR J;  1MBJ A;  5E3M A;  4Y52 J;  1MSF C;  3HTA A;  2LKX A;  5IOZ A;  2ZCN A;  1WPK A;  3ZQC A;  5FJ8 J;  2ECC A;  2YU9 J;  2IU5 A;  2TCT A;  3LSP A;  4JX6 A;  3NXC A;  3H3V K;  2ME6 A;  3PO3 J;  3S15 J;  2YUS A;  3B6C A;  2NVX J;  5JLW A;  3G7R A;  5GPA A;  3GTK J;  2HXI A;  1RPW A;  3I4N J;  1XC5 A;  1JJ8 C;  5IPA A;  4A3B J;  3BRU A;  3HEF A;  2UXP A;  2ID6 A;  1IUF A;  3LSG A;  3G56 A;  2D5V A;  3MKL A;  1BA5 A;  2XDN A;  3C07 A;  3JRI A;  5J1U A;  3G1M A;  4HNV A;  5D18 A;  4JX4 A;  4JNN A;  3GTM J;  4A3K J;  3LJL A;  1G2H A;  2UXI A;  4IHV A;  3Q0W A;  3ZOB A;  4M3F A;  4EEF G;  3LSR A;  3RH2 A;  3VPR A;  1GV2 A;  4GCT A;  2PZ9 A;  3JRD A;  2MG4 A;  1PUF A;  3I4M J;  2QTQ A;  1U78 A;  2IBD A;  2R0Q C;  1UMQ A;  3HOV J;  4S0H B;  1ENH A;  1ORK A;  2XPW A;  1K83 J;  2LP0 A;  4AF5 A;  3ON4 A;  5J3L A;  3QKX A;  3BJB A;  5EG0 A;  4QSH A;  3HOY J;  2CU7 A;  3IH2 A;  2EZI A;  1JUP A;  1I3Q J;  5IYD J;  2YS9 A;  1U9N A;  3LNQ A;  4AC6 A;  1XS9 A;  4A3J J;  3BHQ A;  3COL A;  2I10 A;  4L5E A;  4BXX J;  2HOT A;  3FK6 A;  1OCT C;  1I50 J;  3HDD A;  1MBF A;  5FLV A;  3JRH A;  2ELK A;  2WGB A;  3ANP A;  2Q24 A;  1K61 A;  1PUF B;  2NVT J;  4IHX A;  1POG A;  1ZTR A;  5CXI A;  1Q1V A;  2VUM J;  3HTI A;  3BTI A;  2G7L A;  3AQT A;  5FMP A;  3S17 J;  2Y2Z A;  1U8B A;  2DN0 A;  3VVX A;  4M6V A;  2UXU A;  2R93 J;  4D5C A;  5FKN A;  2CQQ A;  4UDS A;  1RET A;  1Z77 A;  5EG0 B;  2W53 A;  3NI7 A;  5CXG A;  3QPS A;  3CWR A;  5C4Y A;  1F36 A;  3M3Y J;  4ACI A;  3NNR A;  2MW8 A;  3SDG A;  4YZE A;  1TWH J;  2NVY J;  2E2J J;  4GFK A;  4DYC A;  4XK4 A;  3WHC A;  1FTT A;  4AUX A;  2RAS A;  2OI8 A;  3C2B A;  2DA4 A;  3HGG A;  5E3O A;  4A93 J;  1FTZ A;  2G0E A;  2YVH A;  4MO7 A;  3BT9 A;  3CJD A;  2REK A;  2ZB9 A;  4IEJ A;  2MSY A;  3HTH A;  1JUM A;  4JYK A;  5F0C A;  3S14 J;  1OCP A;  4A3G J;  2R92 J;  1FJL A;  5EYR A;  1GVD A;  3O8G A;  3O60 A;  2K9S A;  1MH4 A;  1FIA A;  5FLM J;  4B3A A;  3VW2 A;  5K7Z A;  2YVE A;  1A6I A;  2EH3 A;  5F04 A;  3DPJ A;  3VOK A;  2ME0 A;  1OJL A;  5EEA A;  2DMQ A;  5C4J J;  1LFU P;  1AKH A;  2XRL A;  5M5X J;  2H1K A;  5H9T A;  2GBY A;  2GEN A;  4W97 A;  4C2M J;  3HTJ A;  3HKZ N;  1VF9 A;  2NP5 A;  4CYC A;  1VND A;  1UG2 A;  4UUT A;  5IP6 A;  1YRN A;  1LE8 A;  4I76 A;  2LVS A;  2GUH A;  4DZJ A;  2O7O A;  4B1R A;  3JRC A;  3D1N I;  2WB1 N;  3BQY A;  1QVT A;  4D7N A;  5M5Y J;  4XIC A;  1JUS A;  5HSZ A;  4A69 C;  4BKX A;  3RQI A;  2R5Z A;  1F43 A;  4HKU A;  1GDT A;  5F0H A;  5GP9 A;  3QQA A;  1XG1 A;  3HIM A;  2QOP A;  2VKV A;  3IH3 A;  4FE7 A;  3TP3 A;  2K9Q A;  3BR5 A;  5JLX A;  5DTD A;  3G1L A;  3HOZ J;  1BJZ A;  4FE4 A;  1QPI A;  2XGE A;  2IAI A;  2G7S A;  2ZCX A;  4FIS A;  3TED A;  3OIO A;  3JRB A;  2DMN A;  1AKH B;  3QPL A;  1UI5 A;  4NDL A;  1WCM J;  2JN6 A;  4RBO A;  5FKK A;  2GFN A;  2XGC A;  2NP3 A;  3CDL A;  1B72 A;  1IG7 A;  4M3G A;  5HOD A;  4CYC B;  3BG3 A;  3JR9 A;  1JGG A;  4M3E A;  1MBE A;  4UUS A;  4A3E J;  1R9T J;  1D5Y A;  3GTG J;  2HI3 A;  3CCY A;  3QBM A;  1YRN B;  3FKI J;  4DYQ A;  5IYC J;  1LE8 B;  1GUU A;  3VW1 A;  3P9T A;  1T33 A;  3BR6 A;  3GTO J;  2DA3 A;  4X6A J;  2ZOY A;  3GTP J;  2COB A;  2R5Z B;  2CRG A;  2CJJ A;  4FTH A;  5EGO A;  4B4C A;  2HYJ A;  3KKC A;  1ZQ3 P;  1T56 A;  3OOU A;  4CGR A;  1B8I A;  5C3E J;  2HKU A;  1ZK8 A;  3KKD A;  3NAU A;  2Y9Z A;  3Q0V A;  5FKL A;  4JKZ A;  5M3F J;  2NS7 A;  4JX5 A;  1E3O C;  4M3B A;  1AU7 A;  3HE0 A;  2FD5 A;  2LR8 A;  4XRS A;  1B72 B;  2DJN A;  1FIP A;  4GCK A;  4W1U A;  2NS8 A;  5IOY A;  2LD5 A;  1UI6 A;  2FJ1 A;  3BTC A;  4UUS B;  1GT0 C;  2HYT A;  3VVZ A;  1VFC A;  4IHW A;  1EF4 A;  3GEU A;  3E7Q A;  2EZL A;  5CW8 A;  1MBG A;  4MK6 A;  4X1E A;  2QIB A;  1SGM A;  4A3C J;  2QKO A;  2EZH A;  4DZP A;  2W48 A;  3PM1 A;  3HGY A;  4Y7N J;  3OSG A;  3S5R A;  3VVY A;  2JA5 J;  2M9H A;  3EGQ A;  1MBH A;  1RKW A;  5EGO B;  1ZGW A;  1WH7 A;  2ID3 A;  4XRS G;  3BR0 A;  1JKR C;  2R5Y A;  3UKG A;  1B8I B;  3S1Q J;  3VUQ A;  3OSF A;  1DU0 A;  3FRQ A;  1H8A C;  3RD3 A;  4A3L J;  2GLO A;  2E2H J;  2PBX A;  2NOG A;  3RZO J;  1WI3 A;  5K58 A;  4KWA A;  3NPI A;  1RR7 A;  2H8R A;  2G7G A;  3VW0 A;  4C3J J;  4ICH A;  3FK7 A;  2DA2 A;  1WH5 A;  2CUE A;  3L1P A;  3A02 A;  3JRE A;  3SJM A;  1O4X A;  1IJW C;  1JKP C;  5HAW A;  1NTC A;  4MFE A;  1TC3 C;  3A01 A;  2OPT A;  2Y31 A;  1I6H J;  2L0K A;  4GFL A;  1RKT A;  1ETO A;  5F27 A;  3G1O A;  1IGN A;  2DTZ A;  1RES A;  4BY7 J;  3HB9 A;  5M5W J;  3GTQ J;  1NK2 P;  1ZR2 A;  1ETQ A;  2TRT A;  3V6G A;  1JJ6 C;  3IV5 A;  2DA6 A;  2RAE A;  2JA8 J;  3ZQL A;  3FIW A;  2VPR A;  2XPV A;  3LOC A;  5GPC A;  2XSD C;  2R5Y B;  2XB0 X;  1AHD P;  5DAJ A;  2IEK A;  3FIS A;  3T6N A;  3H0G J;  1HDP A;  5J1R A;  2G3B A;  2AO9 A;  2LY9 A;  5BNG A;  1DU6 A;  5E3N A;  1MH3 A;  5FGL A;  4JP0 A;  3ZQH A;  4A3D J;  3ON2 A;  4NEL A;  2OF7 A;  1TWC J;  3IUV A;  3BG5 A;  2NX4 A;  5AQC A;  2ZOZ A;  1X58 A;  3A01 B;  3Q0U A;  1JKQ C;  5IYB J;  3Q3S A;  2LLK A;  3B6A A;  4BBS J;  3E7L A;  2VKE A;  2L7F P;  3VP5 A;  5DS9 A;  2JMW A;  3BTJ A;  3B81 A;  1GV5 A;  5EFY A;  3BR2 A;  3F0C A;  4AYB N;  2V57 A;  3S2D J;  5K7F A;  2OER A;  1LFB A;  2WAQ N;  3ZQF A;  2L7M P;  3BR3 A;  2O9L A;  3V78 A;  2HQ5 A;  2KDZ A;  3S1N J;  2CQX A;  5EDN A;  4RDU A;  2LFB A;  4C3H J;  3GTL J;  1ETX A;  2JA7 J;  3BTL A;  3K7A J;  2M34 A;  1Y1V J;  1ETW A;  4MFD A;  2DA5 A;  1X2M A;  4V2G A;  2DMU A;  3RKQ A;  3BNI A;  1A5J A;  1WGX A;  5FHP A;  3MN2 A;  3MVP A;  3IH4 A;  3HOW J;  2Y9Y A;  5EZG A;  3ZQI A;  5IP7 J;  5E3L A;  2LTP A;  2ECB A;  3NRG A;  1H89 C;  5K7H A;  3ZQG A;  1W0T A;  3W6V A;  2FQ4 A;  3CQZ J;  3DEW A;  2HOA A;  2M0C A;  5F1J A;  1JT0 A;  1MNM C;  2Y0S N;  2UXH A;  3LHQ A;  2HXO A;  5F0F A;  1OFC X;  3SFI A;  3BG9 A;  2WV1 A;  1P7I A;  1JT6 A;  1HLV A;  1W0U A;  3TW6 A;  1APL C;  1SAN A;  2UXO A;  3HOU J;  3KZ9 A;  4J19 A;  3HM5 A;  4A3M J;  3LWJ A;  1JKO C;  1P7J A;  4A3I J;  4BY1 J;  2DA7 A;  9ANT A;  1IRZ A;  1ZR4 A;  5C44 J;  1UHS A;  4M3D A;  1SFO J;  2DMT A;  2JA6 J;  3VIB A;  2MGQ A;  5EZH A;  2QF7 A;  3RZD J;  3HBL A;  2RHA A;  4GCL A;  3JRA A;  4NN1 A;  2QWT A;  1MBK A;  4JL3 A;  3GTJ J;  1NK3 P;  1BW5 A;  3TW7 A;  3BQZ A;  1HDD C;  1QVU A;  3M4O J;  3S1M J;  4QIW N;  3VOX A;  1X2N A;  4IHY A;  2X48 A;  2XGD A;  5FKM A;  2VI6 A;  2HDD A;  2HOS A;  3S2H J;  4G12 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...