5K7FA

Crystal structure of apo aibr
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
184
structure length
179
Chain Sequence
RYRAILETAARLICDRGYEGTSMQEIAAACRMTKAGLYHHIQNKEQLLFAIMNYGMDLFEEQVLSRVQDIANPVERLRACMRHNILLVTRGWSKEVIIILHEGETRAFIDARKKKYVDFLEEAFSQASQQGLIRPVDPTVGAFSFLGMVLWIYKWFKPDGRLTDEQIADGMVGMLFPPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The AibR-isovaleryl coenzyme A regulator and its DNA binding site - a model for the regulation of alternative de novo isovaleryl coenzyme A biosynthesis in Myxococcus xanthus.
pubmed doi rcsb
source organism Myxococcus xanthus (strain dk 1622)
molecule tags Transcription
molecule keywords Transcriptional regulator, TetR family
total genus 69
structure length 179
sequence length 184
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17932 TetR_C_24 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 5k7fA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 5k7fA02
1FEXA 3V6GA 4BKXA 4NN1A 4D5FA 3DPJA 3P9TA 2F07A 1GDTA 2IU5A 3G1OA 3BTLA 5D1RA 3GTKJ 3NNRA 2OPTA 4DW6A 2W53A 4NELA 2DA2A 2JA5J 4M3FA 2WB1N 3GBGA 4BBSJ 2VUMJ 3CQZJ 2DG7A 4BBRJ 2DA6A 2JA8J 5JLWA 4YZEA 2K9SA 3LJLA 1MSFC 4D5CA 3IH2A 3BT9A 4HNVA 3JR9A 3JRDA 4B1RA 2O9LA 5EGOA 2NVYJ 3S5RA 2M2EA 1CQTA 3NI7A 3AQSA 1ETVA 2DA1A 4HKUA 2HKUA 2H1KA 3MNLA 2CRGA 3BG5A 3HE0A 2YVHA 1ZGWA 3NRGA 2L7MP 2P81A 1Z0XA 2VPRA 4RDUA 4A3BJ 1WCMJ 2L7FP 3HOXJ 4EEFG 3WHCA 2DN0A 3S15J 5IYDJ 2DA7A 1ETXA 1EF4A 2UXPA 1U9NA 4A3DJ 1ORKA 1T56A 5FKMA 4S0HB 4AUXA 3PPBA 4JX4A 1Y1VJ 2ZCNA 1JKPC 3GTOJ 1SANA 1PUFA 5FJ8J 5CW8A 2R92J 4A3EJ 1MBFA 2ZCMA 2DTZA 1ZKGA 4QTRA 1FIPA 3PM1A 4DYQA 5J1YA 2DA5A 3ZQIA 3IH4A 3ZQCA 5FLMJ 3S17J 5HSZA 3ZQGA 4DYRA 3QPSA 1X2NA 3VVXA 1IDYA 3TP3A 1AU7A 4DYCA 4X6AJ 3IV5A 2NP3A 5F08A 3LSJA 5C3EJ 3S1MJ 2NP5A 4GCTA 4XIDA 1I3QJ 1MBKA 1JTXA 4XRSG 3RD3A 4PXIA 2JA7J 2M34A 2K9QA 2ME6A 3L1PA 1UI6A 4GCKA 2IEKA 4GFLA 2ZOZA 2I10A 4JX6A 3GTQJ 4A3JJ 4ACIA 1BJZA 3LSGA 2GBYA 2L7ZA 3VP5A 3ZQFA 1AHDP 2UXOA 1MBEA 1POGA 3C2BA 1LFBA 3JRCA 1JKOC 5DTDA 1IUFA 2OF7A 5FMPA 5JLXA 1X58A 4AC6A 3S1QJ 2AHQA 2NS8A 3HM5A 4I6ZA 2YS9A 1JGGA 4I76A 3MVPA 5IYBJ 2REKA 3BRUA 3JREA 5E3MA 2ZB9A 1XS9A 5IP6A 1I6HJ 2DA4A 2PBXA 3CMYA 2V57A 1RESA 2ME0A 1BA5A 4L62A 1TWCJ 4A93J 1BL0A 3LNQA 2NVQJ 2E2JJ 3VW0A 2LLKA 2OI8A 4BY1J 2EH3A 5HAWA 3QBMA 2GLOA 3H0GJ 5E3NA 3SJMA 1R9TJ 1W0UA 2DMUA 4Y7NJ 1TWHJ 3Q0UA 2MG4A 4J19A 5IPAA 5CXGA 3NPIA 1B8IB 5E3OA 2XPVA 4JYKA 1IC8A 4M3GA 4FE7A 5FHPA 4A3FJ 2JN6A 5FKOA 2MSYA 3JRBA 1F43A 3TEDA 1XC5A 4M3DA 2R7ZJ 4FISA 1DU0A 3HTHA 5EDNA 3M4OJ 4XK4A 2UXUA 1MBHA 4B4CA 3EUPA 5EFYA 4JL3A 1SFOJ 5IOYA 2LK2A 2CJJA 2K9NA 1NK3P 1ZR2A 3H3VK 4C2MJ 4D7MA 3OSGA 3S16J 4CGRA 1E3OC 2YUSA 2WV1A 2PMZN 1VI0A 2DMNA 3K2AA 1WI3A 3CJDA 4QSHA 4W97A 2FX0A 3Q0VA 3CRJA 3GZIA 3OIOA 2QF7A 3CDLA 4M3EA 3RZOJ 3O8GA 2Y30A 1ETQA 3VW2A 2Y31A 4V2GA 2XSDC 3KNWA 3SDGA 1GVDA 1OFCX 1JKRC 3JSJA 3BQYA 2JK3A 2XGDA 1P7JA 4M3BA 5IYCJ 4A3KJ 1HOMA 2QTQA 3I4MJ 2XDNA 1RKTA 1MBGA 2O7TA 3D1NI 2E1OA 3QPLA 2HQ5A 5M5YJ 3K7AJ 2ZCXA 5FKLA 3HDDA 2LD5A 4IHVA 3VOKA 4AF5A 4JP0A 2FD5A 3QQAA 2EZIA 3RZDJ 3MKLA 3B81A 2XPWA 1U78A 2WUIA 2AO9A 2WAQN 3BJBA 2VKVA 4ABZA 1JJ8C 2HI3A 2GFNA 1QPIA 1Q1VA 2Y9YA 2ZOYA 1PUFB 2QKOA 3UKGA 4A3GJ 2UXHA 4CYCA 1VNDA 2W48A 1JTYA 2DMPA 2NS7A 5K7FA 5EEAA 5K58A 3HBLA 2R5ZB 4W1UA 3G1MA 1OJLA 1W0TA 1P7IA 2ECBA 2WGBA 1Z77A 1FIAA 3TP0A 4XRMA 3GTLJ 2DG8A 1F36A 1I50J 3DEWA 1G2HA 2FJ1A 1ZR4A 1UMQA 3JRAA 5J1RA 1S7EA 2XGCA 2LVSA 2OERA 2Y0SN 4FTHA 3GTPJ 4FE4A 2ID6A 2CUFA 2QWTA 3G1LA 3LSRA 1JT6A 3BR6A 3EGQA 1RETA 2R5YA 3HGGA 2RHAA 1O4XA 3NAUA 1BW6A 2JMWA 3Q3SA 3T6NA 2O7OA 2CU7A 3AQTA 4XICA 4ME9A 2CQQA 2LR8A 3FRQA 2L0KA 3TW6A 3HB9A 2D5VA 3HIMA 5C4YA 1JJ6C 4L5EA 3JRGA 3I4NJ 1JUPA 2FBQA 1TWAJ 4LOCA 1RR7A 1BW5A 3A01B 3FKIJ 2R5ZA 1VF9A 5CXIA 2NX4A 3ZOBA 2D6YA 3FISA 4A3CJ 2MGQA 5GPCA 3BG9A 3KKCA 4QIWN 2QCOA 3WHBA 1MBJA 4C3HJ 3G56A 3S2DJ 5DS9A 2G7GA 1ENHA 1JUSA 2XRLA 2YVEA 4ICHA 3ZQHA 1ETOA 3E7QA 2X6OA 2TCTA 1JUMA 5M5XJ 3FK6A 3G7RA 3VUQA 2DMQA 4Y52J 2Y2ZA 3LOCA 1H88C 1ITYA 1RKWA 3BHQA 3GTGJ 2KDZA 3GEUA 1B8IA 1IG7A 2H8RA 4MK6A 3BTJA 1WH7A 1TWGJ 3MN2A 3BTIA 1WH5A 5C4JJ 2E2HJ 1ETYA 4V2FA 2M8GX 2LFBA 1LE8A 5H9TA 4A3LJ 9ANTA 3LWJA 4MO7A 5IP9J 1FJLA 5D18A 4BXXJ 4DZJA 1K83J 4IHWA 5J3LA 5FKNA 2EQRA 3BR2A 5AQCA 4MFDA 2VKEA 5HODA 2R93J 3PO2J 3IUVA 2B63J 2LKXA 2ELKA 3M3YJ 4JNNA 1WGXA 5FKKA 2RASA 2O8KA 3VVZA 2K40A 5E3LA 3VOXA 1A6IA 4D7NA 3BCGA 2GENA 3BR0A 3COLA 5M5WJ 5BNGA 3DCFA 1WPKA 1YRNB 3W6VA 1DU6A 2COBA 2R0QC 3S1RJ 4AYBN 2DMTA 3A03A 2X48A 3LHQA 3F0CA 3E7LA 2LTPA 1MH4A 4MIMA 3FK7A 2X9DA 2HDDA 2YU9J 2IBDA 1GUUA 2FQ4A 1H8AC 3GTMJ 2UXIA 4DZPA 3PASA 3KKDA 2EBIA 5DAJA 3RQIA 1FTTA 3NXCA 2G7SA 3A02A 5F0HA 4B3AA 5EGOB 1MNMC 3BG3A 3ANPA 4C3JJ 2G0EA 3FIWA 1OCTC 1IV6A 5F1JA 3O60A 2HOTA 4A3MJ 2N8GA 3BNIA 4MXMA 5FGLA 4RBOA 2NVTJ 1HDPA 1UHSA 3B6AA 4UUSA 3V78A 3TW7A 3HOZJ 3HOUJ 3HKZN 2XPUA 2NVXJ 2E19A 3HOYJ 1QVTA 2NOGA 2JA6J 5J1UA 5HBUA 2EZHA 1X2MA 2RAEA 1ZK8A 3KZ9A 1VFCA 3BTCA 3S14J 2PZ9A 1ZQ3P 1XG1A 1GV2A 2QOPA 3HTIA 3BR3A 2HXIA 4C3IJ 4A3IJ 2JJ7A 2EZKA 4UUSB 2M0CA 4GCLA 1HDDC 1HF0A 5EG0B 3A01A 4IEJA 2TRTA 3BQZA 1OCPA 1Y1WJ 2MW8A 5FLVA 1U9OA 1U8BA 2HOAA 1UG2A 1ETWA 4GFBA 2E2IJ 5F27A 2XB0X 2EZLA 4MLOA 1IDZA 5GPAA 5IP7J 5K7ZA 4IHYA 2HXOA 4XRSA 3VPRA 4BY7J 2KT0A 1JT0A 2R5YB 3JRIA 1TC3C 4NDLA 1MSEC 1H89C 5EYRA 1ZTRA 4MFEA 3JRFA 3BR1A 3BR5A 3B6CA 1UI5A 3OOUA 3GTJJ 2VI6A 1NTCA 2LP0A 2LY9A 4G12A 3OSFA 5GP9A 1K61A 1AKHA 5IOZA 1QVUA 2XB5A 2IAIA 3RH2A 3ON2A 2ID3A 2G3BA 2G7LA 5M3MJ 4KWAA 2GM4A 1ETKA 3CCYA 2GUHA 2CUEA 4CYCB 3JRHA 1IJWC 1B72B 5F0CA 1B72A 4AC0A 2DJNA 3ANGA 1T33A 3CWRA 3SFIA 3HGYA 2HOSA 1D5YA 2DA3A 1YRNA 5EZHA 2Y9ZA 1IRZA 1QRYA 3S1NJ 1AKHB 1APLC 1SGMA 3IH3A 3HOWJ 1NK2P 5M3FJ 1HLVA 5C4XJ 1IGNA 1GV5A 5C44J 3ON4A 4JKZA 4UDSA 3QKXA 2JWTA 1GT0C 1JKQC 1RPWA 3VW1A 1A5JA 5D19A 5EZGA 3HTAA 2QIBA 1LFUP 2M9HA 5F0FA 3HTJA 3Q0WA 4FCYA 3PO3J 3HOVJ 1MH3A 2L9RA 1FTZA 1HCRA 3HEFA 3RKQA 3F1BA 3C07A 1TWFJ 1LE8B 5EF6A 2Q24A 5EG0A 2XGEA 3VVYA 3VIBA 4GFKA 2HYJA 4A69C 5K7HA 4UUTA 3O8HA 4JX5A 2ECCA 3NARA 3LSPA 2CQXA 5F04A 3ZQLA 2HYTA 4X1EA 4M6VA 4IHXA 3S2HJ
chains in the Genus database with same CATH superfamily
4N4OB 2XAHA 2L9NA 2BHZA 3NWSA 2M0MA 3E5XA 3ZP5A 4LGWA 4IHTA 3H92A 4XNFA 3JCUC 2V1NA 4NELA 2DA2A 3SXYA 4BBSJ 1MMAA 1OPCA 4ZH4F 3H3ZA 3V42A 3F3XA 1BC8C 3H0DA 1LB2A 2P7CB 3HTSB 1I39A 3IWFA 3R4KA 4JQFA 3HIFA 2IGKA 4Y33A 5F6FA 1GVJA 4UVCA 1TT0A 5L3EA 3RJPA 1GXQA 4B1RA 5ICCA 5EGOA 5KNLA 1MMNA 4ESJA 3S5RA 4CICA 3HOSA 4N9IA 3G6EI 2CH0A 3DPLC 1TNTA 2VB6A 2W82A 2QSHX 3NI7A 3WTVC 4QWQA 2HKUA 3V8LA 2M4KA 2H1KA 1TW2A 2YVHA 4PJJA 1ZGWA 1IW7F 3V4GA 2P81A 4HX8A 5D6FA 4E7SA 4DIQA 1Z0XA 1WCMJ 1USTA 3OMYA 3HOXJ 1N78A 3I59B 4BE1A 3WHCA 2DN0A 5FD6A 3HRSA 1ETXA 2UXPA 1D8JA 1ORKA 1R1TA 3OOPA 4XKBA 2NOJB 2W25A 2VC0A 4BQOA 5B5EC 4BYYA 4M9ZA 4Y3OA 2YX7A 4G9YA 5J6XA 1EV7A 2RDPA 5FJ8J 2G7UA 3FX3A 4G7ZF 5CW8A 2R92J 2ZCMA 2DTZA 1BI1A 4Z6YA 2V6EA 2DA5A 3ZQIA 2PMZA 1TBXA 1T0FA 5FLMJ 2AXLA 3ZQCA 3BJ6A 4DYRA 3OIPA 3GMEA 4GCVA 1ZRDA 3S17J 3J7ZI 3VVXA 2R7QA 3TP3A 1VQ4I 4X6AJ 1Y8QB 1DDNA 1VQ6I 1S29A 3IRQA 2IT0A 2NP5A 3FXRA 2F5CA 1BIAA 2W84A 4GRIA 3RD3A 4PXIA 2JA7J 2M34A 2K9QA 1UI6A 4GCKA 3VEPA 2EA2A 4ZZDA 4PUSA 2ZOZA 3IWZA 2I10A 4C2MA 4YEJA 2PN6A 1LNWA 4JX6A 4A3JJ 2IS6A 1BJZA 2R7SA 2GBYA 3VP5A 2KJCA 3ZQFA 2UXOA 1LFBA 3F72A 4O5VA 2M30A 2DO7A 1IUFA 1W5CC 2W85A 2KISA 2ISYA 2HVQA 2NS8A 1VQ5I 3HM5A 5E17F 3IC7A 2CW7A 1JGGA 4LB5A 3MVPA 4F93B 2REKA 3BRUA 3G71I 1ZGJA 5E3MA 2FJI1 2DA4A 4U0WA 3CMYA 2KLOA 1SD7A 1RESA 2F4MB 2ME0A 2PBXA 2V57A 4L62A 3NS4A 1MZBA 4OINF 1TQIA 2V6CA 4ETSA 2NVQJ 3OYNA 3HPHA 2L7KA 2Z5UA 4B8XA 3SEQA 4BQAA 3RKYA 3WTTC 2DMUA 4MEYF 3MKWB 4Y7NJ 3Q0UA 5J4YA 4J19A 2XF6A 4AIHA 3W2AA 2KRCA 3M07A 2QA4I 1XDSA 5A2QZ 2NS0A 4PJNA 5LEJA 2JN6A 3U1KA 2W7NA 5FHPA 1W4MA 1XC5A 2K4BA 4FISA 2QZ8A 2EFNA 4BAYA 3OYJA 1LUJB 1BOBA 2MH9A 3TDZC 2RKHA 2VBXA 2HZDA 2EINH 2NXNB 4UV8A 4ZYHA 2K9NA 2XF7A 4XKCA 4BQQA 1ZR2A 3LQRA 4ZYAA 3L2VA 4QPQA 2WV1A 4ENMA 2DYRH 1QGPA 2OV7A 3K2AA 4W97A 3Q0VA 2EFQA 1HW5A 2L9VA 3OIOA 5BS6A 4NC7A 2V1XA 3O8GA 3GLLA 2Z16A 1I5ZA 4BXUA 4BQNA 2ELHA 1M1EB 2C6YA 2UXXA 2Y69H 3VW2A 1U5TC 1KU9A 3SDGA 4F7ZA 1OFCX 3RIRA 2W4SA 3LFKA 3JSJA 2XGDA 4AYBA 2HYGD 2BOLA 5IYCJ 4A3KJ 3DEUA 2QYOA 2M4GA 2ZFUA 3I4MJ 1MBGA 3R60A 2O7TA 2E1OA 2XASA 3OYBA 2ZCXA 5L3GA 1RUOA 3I58A 3VOKA 3BPVA 2HDCA 1HC8A 1FLIA 3OYKA 2HVRA 2FSWA 4Q48A 2FD5A 2DXIA 1DGRM 3KE2A 3PQJA 4XOTA 3RZDJ 1ZH5A 3B81A 2R7TA 4CYDA 4Z2YA 5FLXK 1QZEA 4ENKA 2QUFA 3T0YA 2GFNA 5TRDA 3UKGA 2PJPA 2UXHA 3A1YA 5HS7A 4CYCA 3CJRB 4G6DA 4IL6C 1JTYA 1P4AA 2DMPA 2NS7A 3DKXA 3ASNH 5K7FA 1F4KA 5K5QA 2JA2A 2OQGA 2W00A 3G1MA 4W1UA 1W0TA 4S04A 2XHKA 1D0ZA 3F22A 5EEHA 1F36A 4EJWA 4DOZA 1ZR4A 3DBHB 4KISA 5J1RA 2MA3A 1G3TA 4IQ4A 1ON1A 1H9GA 2E34A 4FHTA 2OERA 2DQRA 3CCEI 2ID6A 3LSRA 3EGQA 1XSXA 2R5YA 4KJZA 1Y6IA 1MD0A 4E7IA 4HZFA 4GDFA 4XN0A 3NAUA 1GHCA 5HDKA 3EUHC 5KVRA 4LLNA 2P7VB 3K1NA 3H5AA 2L01A 1S3JA 3I4NJ 1RR7A 2JPBA 4L18B 1YJWI 1BW5A 3KP4A 3A01B 4HG2A 3K4MA 1XPXA 2MC3A 1X3UA 2YVXA 3W6KB 1SFKA 4LB6B 4OAYA 2Q2EB 3WHBA 1MBJA 5D4SA 3TGNA 3MD2A 1JHFA 4L9NA 2CO5A 3VYUB 2OC6A 1P9QC 3FZVA 2XRLA 4ICHA 1E3HA 1X1CA 2VT3A 2X6OA 3ZRGA 4CHUA 4LJZF 3VUQA 5CPRB 2BW3B 1YS6A 1RKWA 1BR1A 2WADA 1X1PA 3SQNA 2XAJA 3GEUA 2OU2A 2F4IA 4FETA 3WG9A 3BTJA 1G3SA 1AA7A 3L2RA 1WH5A 2L3DA 3ABMH 3BLYA 3ASOH 1QO0D 2FUG2 1Z7UA 5H9TA 4A3LJ 9ANTA 3J7AY 4HPQA 1R58A 5CJ9A 4U9NA 3DKYA 1WI9A 5LHIA 1KU7A 2ZNYA 5FKNA 4HBLA 3BR2A 5AQCA 4IVNA 3PO2J 2HDWA 3M3YJ 1DPUA 2JVGA 2X6WA 3H9GA 1FYLA 1R1VA 3K6GA 5E3LA 1A6IA 2Z99A 3COLA 3KYLA 4B3XA 1WPKA 3CD6I 2X85A 2V7FA 3P9KA 1DU6A 1RNLA 3ML6A 4M74A 4MGRA 2R0QC 3S1RJ 4AYBN 2DMTA 2JZYA 3Q9VA 3BP8A 4JBAA 2O6GE 4AD9A 1SFXA 3LA2A 3RYPA 4MIMA 3FK7A 3OIQA 2HDDA 5GAHJ 1YQAA 5DDGA 1SD5A 1H8AC 1XD7A 3VSKA 4UHTA 2E1MC 3RQIA 1BN5A 3R61A 2WY8Q 1B6AA 5ICEA 5F0HA 3AL0B 5K5RA 1I1GA 1Z91A 3ANPA 3KYCB 3VOEA 1OCTC 2IW5A 1P6RA 3CCLI 1K4SA 5ED4A 2VQHA 1VQMI 2HOTA 4YFKF 4HX4A 2WC2A 3HG9A 3MZYA 4MXMA 1OQYA 1YIJI 3T5XA 3TW7A 2G9WA 3MQ0A 2R7UA 3HKZN 2JUGA 2XPUA 2E19A 4ANJA 2BXYA 1X2MA 2R7VA 4HSTA 4RGRA 2HYFA 4ZYGA 2PZ9A 3M7GA 3C3WA 2EPFA 5ICGA 3HTIA 3DU5A 3V8JA 2HXIA 4C9YA 4A12A 1KYWA 3DQVC 2JJ7A 2EZKA 2VASA 4PJMA 1EJ9A 4RMNA 3HHHA 4UUSB 2PFVA 2MYSA 3AAFA 5LBQA 3CCJI 3KEOA 1G4DA 3CUQA 1I27A 5EG0B 4IEJA 4IX7A 5LHGA 3BQZA 1LDDA 3REOA 1U9OA 4KITB 1X4PA 1XX5A 4N9HA 4LITA 4RAYA 4XLCA 2H27A 2ZFWA 1K79A 1PP7U 2EZLA 1TW3A 1UZCA 5K7ZA 4IHYA 3VPRA 3UNGC 1XDUA 4KT6A 2KT0A 4P5OA 3I3LA 2QM3A 1EA3A 1R71A 4ZJZA 4BXFA 4IJAA 1H89C 3BR1A 2P5KA 3SHFA 3GEZA 1YTYA 4LG0B 2VI6A 3HL2A 1G59A 2LY9A 4G12A 1JI8A 2ICWG 2ZCWA 5GP9A 3CCMI 4NC6A 1QVUA 2HFHA 1R7JA 1F5TA 3ON2A 1MMGA 2ID3A 3BJAA 3KLOA 1HSJA 2G7LA 2NRAC 4KWAA 3TDUC 2GM4A 2HU9A 4PZJA 2CUEA 2V26A 3N97A 2EA4A 1IJWC 2DJNA 5GAGJ 3CWRA 4ZC3A 3P7NA 2EIMH 2MLGA 4EM2A 2GOXB 1D5YA 2DA3A 3FF5A 2PMUA 1IRZA 1IRGA 4L0YB 3R0JA 4XLAA 5DD8A 3IAM2 1APLC 1A36A 4UV9A 3E6DA 4LIVA 1HLVA 2CQ7A 5C4XJ 1F9NA 5L3CA 3H5NA 3TBIA 1IGNA 4UVAA 2GAUA 1BR4A 1P4XA 5CQGA 2QENA 3U2RA 2JWTA 5HLIA 3HSRA 3VW1A 1A5JA 5D5VB 4MHGA 1WJAA 4B44A 5CVRA 1XGNA 1XB4A 4E4HA 2DFHA 2FBIA 3V7SA 1VQOI 2L9RA 1YW8A 1VQKI 3PO3J 1FTZA 2RVCA 1XSDA 2ZJ2A 4HF0A 3RYRA 4F52A 1OMIA 2GIZA 2H94A 1X3WB 1Z67A 5EG0A 1ZRCA 2H8WA 3E5QA 2VOPA 3CUQB 3ERMA 1VQ9I 3VIBA 4UUTA 2OZUA 2WAFA 5DCFA 2XKPA 1EKEA 2ECCA 3NARA 3ZQLA 2CQXA 5J8FA 1ZRFA 3GZ5A 2Q0OA 3I9V2 3NWTA 3QODA 4X1EA 4IHXA 1WJCA 3V6GA 1XMKA 3TQNA 4BKXA 4NN1A 2WWYA 4BU2A 3G1OA 3BTLA 1KGSA 3C2GA 1ZARA 5LRSA 1MMSA 5GAEJ 2ZC2A 3VWBA 4BHBA 2BHYA 2CFOA 5JFRA 2OPTA 1YOVB 2DTRA 3JTHA 4LLGF 2WB1N 4MEXF 2QQ8A 2LF8A 2VUMJ 1VZ0A 4BBRJ 5IT9Z 2VBZA 4I0AA 3QU3A 5E79C 2KL4A 5FFZA 2JA8J 3VFZA 3IH2A 5D8LB 4CCNA 5GTIC 3VYTB 5BPDA 2GZWA 1OLTA 4ESBA 2O9LA 2NVYJ 4LIUA 2M2EA 1FT9A 3M8FA 4FQGA 1ZAOA 3OYEA 1MDMA 3OYFA 5B1BH 4NHJA 2ESNA 1SMTA 3BG5A 3HE0A 3L09A 4MNUA 2R7XA 2L2OA 3NRGA 1R4MB 1G8XA 1LJ9A 2VKDA 2LF7A 3ONQA 4A6EA 2QBYA 4I09A 1STZA 2DA7A 3GO5A 3E97A 3OYIA 2KDOA 3BC8A 3J7AO 3PPBA 1W36C 2K4JA 4ZTFA 4A0YA 2ZCNA 2M87A 1JKPC 2GQQA 3JTGA 5CLSA 2FQ3A 1FZPB 2OA4A 4CCMA 4A3EJ 1MBFA 3RCOA 1HQCA 2FE3A 1Z05A 4G6QA 2OUMA 2HQNA 5LGTA 4KN4X 2VQLA 1U2WA 3ZQGA 2BVLA 2F48A 4BL0B 2CV2A 5J8CA 1HKQA 4R8HA 4DYCA 2OAZA 2NP3A 1HA8A 4WXDA 4EGZA 4HDVA 3LSJA 5C3EJ 2P6TA 4PGGA 4XLPF 2Z3YA 4RM3A 4U9LA 2YR2A 3WGIA 3KZZA 4GFLA 2DODA 5HLHA 3LL7A 4C2TA 1BI0A 2D1VA 2L7ZA 1YE9A 3LSGA 3QPHA 5DM6F 1AHDP 3OL3A 4NB5A 3G73A 1FP2A 3C2BA 4IKFA 1ZN2A 3BZKA 2YPRA 2E1CA 2M8EA 2OF7A 2KZGA 1X58A 4AVPA 3HSEA 1FYMA 1FBSA 2ZMEC 2DDBA 3T8TA 3J7YJ 4XRFA 3KZIC 4BNCA 3FXJA 3DKWA 3WTZA 3PIPF 4I76A 2P5LC 3A4CA 2ZB9A 5IP6A 4IOAF 1I6HJ 4CCLA 1RI7A 1A04A 3E3VA 4A93J 4BJ5C 3LNQA 1LPQA 3AKZA 3QBMA 3FM3A 2GLOA 3FHZA 2DQLA 4OIOF 3PJRA 5E3NA 2TDXA 1D1AA 4F55A 1MJ9A 4D1QA 1G3YA 3C1DA 3NPIA 5CXGA 3SZTA 3K4NA 1FOWA 1NH3A 2XPVA 2F5VA 3ZMUA 2R7WA 3ZMVA 4HF2A 1FOYA 4JOMA 3JRBA 2MSYA 4L9JA 1F43A 2CUZA 4DVYP 3G4SI 3ABUA 4M3DA 5FO5A 3CF2A 3M4OJ 2HTJA 3TMOA 4LMYA 1K6OA 4I02A 5EFYA 1SFOJ 3DFGA 1LDKB 3QYFA 5IOYA 2CJJA 1DP3A 2FEZA 1IZ1A 2PQ8A 3S3NA 4C2MJ 4CGRA 1X4OA 5LGNA 2PMZN 4OIQF 2DMNA 4QSHA 1SFUA 3CDLA 1A31A 2DPDA 4HF1A 3RZOJ 2Y30A 4ZYEA 2P4WA 3FWEA 1PDNC 1TQPA 3CCVI 2EV0A 1ETQA 2KQRA 3HKZA 2Y31A 3QP5A 1FWZA 2KP6A 1GVDA 3BQYA 2JK3A 1YW7A 4ZTJA 3GCMA 2XDNA 2HTSA 1Z6TA 3D1NI 3QPLA 3E6CC 2IGOA 2ZXWH 3K4LA 4ASNA 5M5YJ 4ENNA 1Y0NA 5FKLA 2K5CA 4XM3A 3LA3A 3OYHA 3LAPA 1ZLJA 4UNOA 1H9TA 2EZIA 1U5TB 2L4AA 2A5WA 2QGUA 3NEUA 6PAXA 1RIOH 3BJBA 1UFMA 2HI3A 1W36D 1MDMB 1XTAA 1Z6RA 4OD5A 2Y9YA 3CC4I 1PUFB 2ZOYA 2RREA 2QKOA 4NQWA 4A3GJ 3SFZA 2VN2A 2CW8A 3FXQA 1OYWA 3DTIA 5K58A 1R4NB 3HBLA 5KAFC 3AL0C 2LRDA 4EMSA 2MD5A 1H0MA 4NNJA 3ULQB 3J80Z 4A5NA 4XRMA 3EUKL 1I50J 1G2HA 3I59A 3JRAA 5KK1A 1T38A 1VQNI 2KPMA 3GTPJ 2BY2A 1SAXA 2CUFA 3G1LA 2WY7Q 3BR6A 4M72A 2EFPA 4IQJA 3H5RA 2LY1A 2CYYA 2JMWA 2O0YA 3Q3SA 3KCCA 4EQQA 4S05A 3U9GA 3U21A 3EDPA 4U0YA 3JSOA 1CF7B 4OIPF 2O61A 1HXDA 3SDBA 5JR3A 3AQTA 2XAQA 2GXBA 4EM1A 4ESFA 3JRGA 1R36A 3PFIA 3SZPA 2STWA 4OOIA 1S72I 4LOCA 1MGTA 3VSLA 1VF9A 1IXSB 3ZOBA 3W6JB 1RR8C 3R6SA 1V5GA 4A3CJ 4N4NB 3GXOA 4I0BA 3KKCA 1HBXG 2NAZA 5LHHA 3G56A 3S2DJ 4XORA 3WE2A 1PYVA 2F5DA 3I4PA 4H0EA 3VB2A 3ZQHA 1RRJA 1ETOA 5HS9A 4KFCA 3E7QA 2M3AA 3DF8A 2Y75A 1S8NA 1FMVA 3B73A 3BHQA 2R7DA 3KIOA 1QU3A 3GYHX 2IA0A 1VTNC 1IG7A 1ZG5A 1MJBA 4CSWA 2EIKH 1KQ8A 1TWGJ 4KIBA 3BTIA 2R7RA 4NBQA 1ETYA 4V2FA 2XROA 2LFBA 2GWRA 5CVVA 3LWJA 1ZGAA 1FJLA 2HEOA 5D18A 4AWXB 4AU7A 4BXXJ 2JQ7A 2RNGA 2EQRA 1SVMA 5E20A 5J4VA 5JHFA 1S5LC 3I55I 3HYIA 3Q9SA 4CUGA 4E7HA 1R00A 2JSCA 2VQGA 2O8KA 5J40A 2K40A 2RASA 1S7AA 4LD5A 3VOXA 4BH9A 4D7NA 4K2EA 1BM9A 3VYSB 2BXZA 4E7JA 2YU3A 3W6VA 5B3SH 4MQ9F 2OD5A 4KIFA 4HLYA 3KLNA 1SVLA 3BJOA 3K4CA 4BDYA 1WQ2A 1GLNA 2HQRA 1XCBA 5L3BA 5LEKA 1MH4A 4BE2A 2ZNZA 2A6HF 2X9DA 1T08B 2IBDA 2FQ4A 4XBFA 4HYEA 4IRGA 2LMDA 2F2EA 2WTEA 3KKDA 1LVAA 5DAJA 1HSTA 2XSJC 3NXCA 3QU6A 3OYGA 1RUNA 3A02A 3GZ6A 4O3MA 3Q5FA 1MNMC 1K78A 4DGWB 2KKOA 4C3JJ 2I8DA 3BCAA 2G0EA 1E2XA 4XSXF 1IV6A 1E3PA 4KN7X 4WX9A 3O60A 4KMUX 1B9NA 5H2FC 1XGMA 2OCEA 3P9CA 4RBOA 2LBFB 1VQLI 3L00A 1DQUA 4UUSA 4X0GA 3HOZJ 3HOUJ 5CYVA 3E6BA 2JA6J 4I01A 5J1UA 3S3OA 2DFIA 2IS2A 3F6VA 2VE8A 2M7AA 2RAEA 1ZK8A 4AIDA 3GX4X 3CCRI 1VFCA 3LMMA 3S14J 2RQPA 3F6OA 2QQ9A 4FT8A 2UZKA 4I7HA 1V54H 3WU0A 3DLAA 4CCOA 1WZ2A 3FBNB 3PIOF 3C7JA 5L3FA 3A2KA 4F92B 4WCGA 2COMA 5FLVA 1UG2A 3FXLA 1ETWA 1R23A 4OWRB 5F27A 5HS8A 4OD4A 2EV6A 3HPGA 1LQ1A 1QHGA 2ZXIA 3DLLF 2ZO4A 4D9JA 2JPCA 4BY7J 1QZZA 3BCBA 2HKOA 1JT0A 2R5YB 1D0XA 2V1DA 2D2WA 3ZN1A 1TC3C 1B1BA 3FXOA 1ZTRA 3BR5A 2DYSH 5DM7F 1IN5A 2DT5A 4A0XA 3OOUA 2EILH 2LP0A 3OS2A 3CMMA 5JVGF 1K61A 1AKHA 2VOOA 4RLQA 4M9XA 2XB5A 3A0HC 2G3BA 1K78B 4L0ZB 3OYCA 3K0LA 2GUHA 1Z9CA 3V78A 4PGHA 5CVJA 3ANGA 1T33A 2IPQX 2LY2A 1K7AA 1U0JA 2QVOA 3F8MA 2DDAA 3HGYA 2HOSA 3DTEA 3K4JA 5EZHA 2WAQA 1QRYA 4TV7A 2BVMA 1AKHB 3K70D 1TZLA 2E60A 1HW2A 4HLXA 5M3FJ 2P0WA 2L54A 3IUOA 5LLQA 1KYZA 3ISPA 3L2QA 1A35A 1LFPA 3RSNA 3PSFA 2B0LA 4JKZA 1J75A 3JW4A 4A0ZA 1RPWA 1O3TA 4XLNF 2Y0MA 5EZGA 3HTAA 2M9HA 1J09A 5AIPA 1KQ9A 4ZDLA 3HTJA 1FY7A 3Q0WA 4FCYA 2E1NA 4LG0A 3HOVJ 1MH3A 1VQ8I 2DU9A 4A5MA 3HEFA 3F1BA 2DK5A 3CO7C 2K85A 5D5UB 4OIRF 4HA8A 2PJRA 1Z7LA 2XGEA 5KHDA 2YSRA 3VDXA 1VQPI 2HYJA 3OR1C 5TGTA 3L2CA 4JX5A 3LSPA 2FBKA 2HYTA 1B8IB 1NK2P 4YG2F 3S2HJ 2K3FA 1FEXA 2UV1A 1IAWA 2KIFA 3TKYA 5D4RA 3DPJA 2IU5A 1GDTA 3P9TA 2IGMA 2X1EA 3CESA 3FM5A 1QNTA 4IRHA 3GFJA 3EUAA 1IXCA 2HZTA 3FXUA 4DW6A 3D5RC 4Q5SF 2RV8A 3BG7A 3GFLA 4CCKA 2JA5J 2BEOA 4M3FA 3RKWA 3GBGA 4KT5C 1YW9A 5D5XB 2DG7A 2IVMA 1J2XA 2DA6A 1O57A 2KRHA 4HOBA 5ILSA 1R49A 3HRUA 1SD4A 5B66C 1V4RA 3LFUA 2L4MA 3S3MA 4OMYA 1J9IA 3BT9A 3FMSA 4HNVA 3JRDA 1O3RA 4EJOA 1OR7A 2NYXA 1QA6A 1B9MA 1CQTA 2VC1A 2JT1A 4CZZA 4DBQA 4E7KA 3ELKA 1ETVA 5CVIA 4GXOA 1YYVA 4EM0B 3MNLA 2CRGA 1BR2A 2DT6A 2E1MB 2HR3A 2Z33A 2VPRA 4KIGA 2L7FP 2UWMA 3SZGA 3S15J 5IYDJ 5FROA 4RB1A 2J5PA 2I5UA 3J81Z 5BQTA 3ABKH 1DPRA 3CC7I 1USSA 4S0HB 3KP2A 4CGZA 2QQAA 4PK4A 4L5JA 3WTWC 1KZHA 4WWCA 3GFMA 1G3WA 1Y1VJ 2FRHA 4N0BA 3TO9A 3MKZA 2BV6A 4UXNA 3GTOJ 1V55H 1SANA 1PUFA 4XLHA 1FOKA 5IT3A 1FIPA 5J1YA 2R3SA 3NRVA 4U0VA 3IH4A 3QYEA 1WRJA 4LFUA 1X2NA 5E8GA 1AU7A 5HLGA 1YX3A 3S1MJ 4GCTA 1UELB 2L02A 3BG6A 3CDHA 1JTXA 4D0PA 2EIJH 2VJ4A 5D5WB 1D8KA 3L1PA 3M9AA 3QOEA 2HWVA 2E5NA 2MABA 3N05A 1TT5B 1ZYRF 4ZYDA 4ACIA 3PNYA 2R7FA 1QZYA 3T6NA 1FPQA 1POGA 2HOEA 1JKOC 3RPUD 5E1ZB 2A2FX 5FMPA 4AC6A 2E35A 2MBFA 2AHQA 5GADJ 2Z9OA 3BWGA 1D3YA 1W5TA 2XF5A 4LK0F 5K1YA 4I6ZA 2YS9A 4HQEA 3CC2I 1B59A 3JREA 2RN7A 4OAZA 3ZMTA 2ETHA 2JVHA 1XS9A 3GZNB 4P9UA 1MW7A 3K8PC 3FMRA 1BA5A 1W7PB 2F6CA 5F64A 1TWCJ 1BL0A 4HNTA 2E2JJ 4II2A 1T0FC 1HKSA 2FBHA 2A6TA 2HS5A 1HKTA 2OI8A 5HAWA 3AG1H 2BY0A 2XDVA 1NG7A 4IPAA 3OY9A 3EYIA 3RI4A 1BJAA 4YRVA 1C0WA 4HEA2 4HX7A 5IPAA 4F3QA 4UY8I 5E3OA 1IC8A 2X1DA 4Y17A 3HUGB 2UXNA 4G6TB 4A3FJ 4PDKA 2DPUA 3TEDA 3H35A 4UVBA 4M6YA 2CMPA 3KEYA 3DBRB 1DU0A 4YELA 5EDNA 2A61A 4LG3A 1K6YA 3HTHA 5DCMA 2UXUA 1SAUA 1MBHA 2H09A 2E7WA 4JL3A 4J01A 4DQ2A 3OL4A 3LAJA 5JHUA 3H3VK 3OWTA 3OSGA 1E0EA 3S16J 3R0AA 2YUSA 3RPQA 2FX0A 3QPTA 2IA1A 2QF7A 2IS1A 4BEHA 4DBRA 1YITI 4RS8A 4IO9F 4UB8C 1OR7C 1R6RA 1XCVA 4M71A 2XSDC 2HVSA 3KNWA 1KU3A 3AG2H 1PJRA 2CV1A 1P7JA 1IO2A 5BPIA 2CGPA 2QTQA 2KIQA 4BE0A 3ABLH 2MC4A 2HQ5A 5HOOA 2EB7A 1Z21A 3CMEI 2LG4A 1T39A 2W57A 1TLHB 4AF5A 1LEBA 4B48A 1KA8A 2KFDA 1J0RA 2V9KA 1CGPA 4RGXA 4ON0A 3WTXC 4IF4A 1BC7C 3WODF 4U7BA 1ZREA 2A05A 3N4MA 2VIXA 3S32A 3ROUA 2XPWA 1KONA 5FB2A 2WUIA 3K2ZA 3CO6C 2VKVA 1WSUA 3KX2A 1ZHFA 1REPC 2V4JC 1VNDA 2W48A 3IHUA 2VBYA 4XSZF 3KP6A 2R5ZB 1BI2A 1QPMA 2BBYA 1OJLA 2WB1A 1P7IA 2HQAA 4AIJA 2DFEA 1FIAA 1IUYA 3GVAA 2BE5F 3F23A 4PSWA 3DEWA 4GYGA 2CS3A 3ZGKA 1EH7A 1PVEA 1S7EA 2V9VA 2IRFG 2XGCA 1IXRC 2CSOA 2LVSA 5FGMA 3TO6A 1UJ8A 4FE4A 5DCMB 2QWTA 4J00A 5HLTA 1JT6A 3K9TA 1LKXA 3HGGA 3BPXA 2KHMA 3QP6A 1X3ZB 2CU7A 4L9VA 2PFBA 2CQKA 2FMYA 2O5RA 4XKWA 5KAIC 4XICA 1OCZH 4MTEA 3FRQA 3TW6A 3HB9A 5C4YA 1JJ6C 3M8JA 4L5EA 3V7CA 2FBQA 4Q47A 2MLKA 1FC3A 1ZELA 2RQQA 3FKIJ 2R5ZA 3S93A 2D6YA 2X4HA 2LSOA 2MGQA 3I0TA 3BG9A 5GPCA 4QIWN 1W7PA 2QCOA 2PMHA 4C3HJ 2VKHA 5A2QK 3CTAA 2IP2A 1BIBA 1LEAA 2E5ZA 4L5IA 4AVZA 2YVEA 3F9KA 1X1DA 1WJ5A 1MKMA 2VQCA 1IV8A 5M5XJ 1D0YA 3PUBA 3CUOA 3MZ8A 4U88A 2ZSHB 4Y52J 1OYIA 3LOCA 2OQRA 1H88C 3DU6A 3GTGJ 1FYKA 2KDZA 4PJLA 1FSHA 2H8RA 3CJNA 2OJED 4GYIA 4MK6A 3MN2A 3OYLA 4BJ6C 2M8GX 3ZQ7A 2FXAA 1LE8A 1WJFA 2XAUA 4MO7A 3O2PE 4DZJA 3W2WA 3EUHA 5DUKA 5HODA 2VKEA 2R93J 2UUZA 3IUVA 2B63J 1U3EM 3IP4B 4JNNA 1FOXA 3DWLE 1KU2A 3OS1A 2QKMB 3VVZA 3K1MA 2MH2A 5J47A 4V19K 4YIRX 3BCGA 2ADUA 5M5WJ 3OYAA 1YRNB 3JAMZ 2IJLA 3O6BB 1YI2I 2EK5A 3OYDA 4XLEA 3FKJA 4EATA 1ODDA 3E7LA 4KYWA 2GIVA 3AFHA 2M7BA 2O03A 1DUXC 1SMYF 3GTMJ 2O8XA 1FSEA 1MJAA 2BYVE 2EBIA 3HUGA 4XL9A 2DW4A 4BS9A 1FTTA 1IRFA 2ZBKA 2HNHA 3I54A 4GGGA 2RGVA 1UG0A 1OCOH 5KCMA 2VJ5A 1QHHD 4B47A 3FIWA 3H36A 1O7LA 1FMWA 4RGSA 3FMQA 2W1OA 3EPZA 3KP5A 5IY5H 1Y8RB 3IKTA 3RKXA 1YO5C 2NVTJ 4C2UA 3B6AA 3KFWX 1S6LA 1SC7A 1R5ID 1R1UA 4O6JA 2FF4A 2LC2A 1WVRA 2QQBA 2EWNA 1SEUA 4H4KC 1FP1D 1QVTA 2NOGA 4BUPA 2XIGA 1JGSA 4C30A 5HBUA 2KIUA 1WJEA 3ABTA 3BTCA 3CCUI 3KYDB 1ZQ3P 2QSGX 2QOPA 3MKYB 2KMUA 1JE8A 3MAJA 3ECOA 2FA5A 4C3IJ 4A3IJ 4ZZLA 3ESWB 2H6BA 1J5YA 2A6EF 3ZMDA 2WAEA 3O3KA 3VYRB 2A68F 4GCLA 2XVCA 1TL8A 1F1ZA 4CZCA 3DPTA 2X1CA 5FRMA 1Y0UA 3KEQA 3KP7A 1WKMA 3PQKA 4DNCA 1DP7P 2E7XA 2HOAA 1ACIA 2MFZA 4KUMA 3F8NA 3F8FA 2XB0X 1IDZA 5GPAA 4LK1F 5IP7J 1BOAA 2B3WA 2HXOA 3CJQB 3I71A 2WA0A 3LSKA 2VT2A 2DOFA 1WJDA 3ZXSA 1IRXA 3JRIA 4NDLA 1MSEC 5EYRA 4MFEA 1O3QA 4M6XA 3CCQI 1YX5A 3HHGA 1UI5A 2F4OB 2EFOA 3GUDA 3EETA 1NTCA 3OSFA 3J81K 1UAAA 2ZXHA 1UCRA 3CLQA 4EGYA 2JTVA 2IAIA 4QPOA 2FU4A 4WF2A 1BI3A 2K27A 4KNYA 3ZN0A 1UHWA 3JRHA 1B72B 1B72A 5F0CA 4RB0A 3TL4X 4AC0A 2PG4A 1TTYA 1TP4A 5JI6A 3RTRA 3K4BA 3CCSI 1W7PD 2DFFA 1YRNA 3I5UA 1SGMA 3MEXA 3HOWJ 2A5YB 2EFWA 2VL8A 1HW1A 5ILUA 3ON4A 5C44J 3CDIA 2V1UA 1D5VA 3OR2C 3QKXA 1JKQC 5D19A 2QIBA 2DBBA 2EV5A 3LQQA 1T98A 4U87A 1LFUP 2BGCA 1BBYA 3ECHA 3HRMA 3AG3H 4ZDPA 2CV0A 1HCRA 1MMDA 3E0JB 3RKQA 1XGOA 3LA7A 4RLFA 1LE8B 5EF6A 2NNNA 2PLYA 1IF1A 4A69C 4CH7A 3O8HA 2JRTA 2HKXA 2K02A 3TOBA 4HSRA 4D5FA 2F07A 5D1RA 1CF7A 1L3LA 3GTKJ 1OKRA 3NNRA 3JAMK 2W53A 2FNPA 4I98B 4EVIA 3U1DA 2LKPA 2A69F 2Q1ZB 2OBPA 3ZCOA 3E5UA 3CQZJ 4UB6C 1FBQA 1I3AA 5JLWA 4YZEA 2K9SA 3QAHA 4CCJA 3LJLA 1MSFC 2BY1A 3NQOA 4D5CA 2V79A 4FX0A 2ELJA 4BGDA 1OYYA 3COAC 1AOYA 3BY6A 2A07F 2Q8KA 2QSFX 3JR9A 5DV5A 1VQ7I 3H1CA 4RAGA 3FXMA 5AIQA 2FOKA 4NQWB 2JSPA 4Y15A 1Z1DA 3AQSA 2DA1A 3J80K 4II3A 4HKUA 5DD4A 4HV6A 4YFNF 2ISZA 2DOEA 5AONA 2AXTC 4EV0A 4KMFA 5HVQC 2XV4S 2L7MP 1R5HA 1N25A 4YIFA 4RDUA 1XMXA 4IZZA 4A3BJ 1R5GA 3W2VA 2ACJA 1YG2A 1EF4A 4PJ0C 1U9NA 5DEQA 4A3DJ 1T56A 5D8KB 3GFIA 5FKMA 4AUXA 3M8EA 3WTUC 2GOMA 1P4WA 2ZMEA 4XOPA 5LRRA 4JX4A 3I56I 2E71A 4XKVA 5LD2C 2ZJQF 2GXGA 4CDGA 3UR3C 3K10A 2OCCH 2H1LA 1ZKGA 4QTRA 1UHMA 2LNBA 3DXJF 3PM1A 4DYQA 5H6RA 4YFXF 4QLCU 5HSZA 2X0LA 3QPSA 1ZLKA 1IDYA 2WBMA 3K69A 1P92A 5DYMA 3IV5A 4B43A 4WIBA 1T95A 5F08A 4L9TA 4NC8A 2ZJPF 4F91B 4XIDA 1I3QJ 1MBKA 4XRSG 3K4KA 5HNHA 3P9IA 2ME6A 1I1SA 3E6MA 2IEKA 2RC4A 3V7RA 4HDUA 2OTJI 4E70A 3T8RA 3GTQJ 1JHHA 3WGHA 3S8PA 2AQEA 3H3UA 2NNYA 1SVOA 1MBEA 3JRCA 2Q2EA 3K1PA 5DTDA 3PSIA 4HQMA 2DCEA 2M1BA 1XSVA 2ZXJA 5JLXA 2QBYB 3S1QJ 3L7WA 4XONA 1KQ0A 2XAFA 3BROA 2DOAA 3M1CA 2O3FA 4RGUA 1X19A 5IYBJ 2X6YA 3WG7H 2K7LA 4PFOA 2J5OA 4R79A 3L2WA 2NVUB 1FBUA 3ZPLA 5ILVA 3VW0A 2LLKA 3GLXA 4BY1J 2EH3A 3H0GJ 3FXKA 3SJMA 1R9TJ 1W0UA 2CG4A 2WV0A 1TWHJ 1RC9A 2MG4A 1WJBA 4M9SA 4M73A 4RM2A 3BZCA 4JYKA 1PUEE 4M3GA 4FE7A 1ZG3A 2BZTA 3H9JA 2K3PA 5FKOA 3SEZA 2VODA 3FBIB 2R7ZJ 2JUCA 4IRVA 3WGGA 4XK4A 4B4CA 1ONVA 2LKSA 4P1WA 3EUPA 1RZ4A 2LK2A 3BZ6A 5LFAA 3CLOA 1NK3P 3HC7A 4B09A 4BHCA 4LLLA 2XAGA 4WXHA 4D7MA 1AWCA 1Q1HA 2FOWA 4WK8F 3ERED 1B4AA 1E3OC 2K9LA 1VI0A 3CJDA 1WI3A 2P5VA 2R7OA 3GZIA 3HXLA 2DT7B 4M3EA 1NG6A 4BJTA 4CA0A 2RNJA 3LSIA 4HW0A 2KRFA 2M5WA 1NHAA 2QKLB 2P6SA 4V2GA 2LYCA 4XMYA 3QYBA 2DK8A 1JKRC 2VBWA 3B02A 2H6CA 2VJIA 3MCZA 4M3BA 1U5TA 3E1SA 4RAFA 4G7HF 1HOMA 3ZR8X 1RKTA 3OV8A 5FD5A 4DJAA 3LWFA 5CKTA 5ERIA 2XGXA 3K7AJ 5CVUA 3IL2A 3HDDA 3BDDA 2LD5A 4IHVA 3G2BA 3PNTA 4JP0A 4Y13A 3QQAA 5D6EA 1V3FA 3D0SA 3MKLA 1ON2A 4RA2A 5H20A 1DGWY 2CWEA 1T2KA 1U78A 5FRNA 2BY3A 3I64A 2AO9A 2WAQN 1JJ8C 4ABZA 4GO1A 1Y39A 3TOAA 1Q1VA 5TJJA 1QPIA 1L0OC 1SD6A 4OU0A 5K5OA 4P9FA 4IXAA 4KA4A 2VPLA 4WXCA 4XQFA 5EEAA 3TO7A 4XLFA 3VODA 3KZYA 2ECBA 2B1EA 2WGBA 3DP7A 4I99C 1Z77A 3TP0A 3GTLJ 2DG8A 4KICA 1OCCH 4AM3A 2LOOA 4G94A 3KP3A 2FJ1A 3CZ6A 1UMQA 2F5EA 5CQEA 2B7EA 5E18F 2Y0SN 4FTHA 2W24A 1YLFA 1RETA 5E8IA 5HDGA 5GTHC 3WTSC 2RHAA 1O4XA 2CQNA 1QQIA 4MQVA 1BW6A 2QLZA 2XKOA 2IA2A 2O7OA 4XN3A 2K86A 3WE3A 2CFXA 4YIIA 5IT9K 4ME9A 2CQQA 2LR8A 2DLLA 2L0KA 2D5VA 3HIMA 1TQMA 5E1WA 1JUPA 3PUFA 1TWAJ 1IN4A 5CXIA 2NX4A 1TNSA 3PFYA 3FISA 3F21A 3IKVA 3GWZA 1ZG1A 3QWLA 2K9MA 5HNFA 3IRRA 1W1WE 1V5EA 5DS9A 2G7GA 1ENHA 1JUSA 2TCTA 5F1RA 1JUMA 1XGSA 3SYTA 4PSXA 4BHPA 3FK6A 3G7RA 3PNVA 2DMQA 4A6DA 2Y2ZA 3L9FA 1ITYA 2EJRA 3CUQC 2HGCA 1B8IA 3D5SC 3C18A 3HJEA 2KJBA 5FLXZ 1WH7A 4U7DA 5C4JJ 2E2HJ 1A6QA 2PJRB 3IAS2 2ZY9A 1S9HA 1J59A 1OISA 1ERDA 5IP9J 2L9SA 1ULYA 1K83J 1T6SA 4P96A 5J3LA 4IHWA 5ICFA 3WTYC 3ZQQA 2PEXA 4MFDA 4BDZA 3CRJA 4RB2C 1YJ9I 4KDPA 3PL8A 2DI3A 3L2UA 4A2UA 2ELKA 3DV8A 4JK1X 4E7LA 2LKXA 5BMZA 2GXAA 1O7FA 3SWHA 1WGXA 5FKKA 2DAOA 1N77A 2G7HA 2L5QA 3EYYA 2FNAA 2GENA 3BR0A 3BOQA 3RDIA 5BNGA 3DCFA 3LSTA 3EQLF 3HOTA 2VLAA 4PCQA 1MNEA 2GA2A 2STTA 3GF2A 2X6XA 2COBA 2KZVA 2JRMA 2CUJA 5E1XA 3A03A 2X48A 3CF5F 3LHQA 2F5FA 2IGNA 3F0CA 5H6QA 2VONA 2IXSA 2LTPA 3RQ4A 4HRIA 1G6NA 4E6KG 3A0BC 2YU9J 3C2HA 2P8TA 2ZMEB 1GUUA 3CMAI 2B9SA 2GA1A 4EJTA 3G3ZA 2UXIA 4DZPA 1P2FA 1D1BA 5EEGA 3OS0A 3ZMZA 3PASA 3KPHA 4E7ZA 3HZJA 4RAZA 3FHNA 2VE9A 2ZJRF 2G7SA 5EGOB 4B3AA 3FDYA 4R1HA 3BG3A 2ZSIB 1R22A 4Q4ZF 2IS4A 2LH9A 1WHUA 3LSHA 4Y4RA 5F1JA 5TISC 4FASD 2CW0F 1FX7A 4ITVA 3DBLB 4A3MJ 2HPIA 2N8GA 1MNDA 5EJCA 4CO8A 3BNIA 5FGLA 2V9PA 1HDPA 3CP2A 5B1AH 2Y0SA 1UHSA 5JVTA 3MMYB 4IHSA 1EH8A 2NVXJ 3HOYJ 5LGUA 4CXFA 2D45A 1T8IA 1S7OA 2BW3A 2EZHA 2AQFA 1SFEA 1IN7A 4P55A 3KZ9A 3HRTA 1XG1A 1FNNA 1GV2A 1Z3YA 3QRFF 1X1AA 2PBIA 3BR3A 1PP8F 1XMAA 3DTKA 1YJNI 3F8CA 3HSFA 2M0CA 4EJUA 4ENJA 5BOXA 2KIMA 2X51A 1HDDC 2M45A 1HF0A 4HAMA 3A01A 2XRNA 2YX4A 4NUBA 2TRTA 2LREA 1Y1WJ 1OCPA 4G8XA 2MW8A 3T1BA 3LSMA 2Z2SB 1K4TA 3V8KA 1U8BA 3P5JA 4ZDOA 2XUBA 3CJTB 1U8RA 2E2IJ 4GFBA 4FX4A 2HPMA 4MLOA 4HNUA 2MD0A 5DUIA 3F8BA 1WFXA 2LBFA 2VXZA 1J7KA 4XRSA 1X1BA 4RB3C 1YHQI 5L3DA 2A3SA 3MZHA 3JRFA 5FFXA 4PFPA 3WU1B 3MWMA 3I53A 1GXPA 4HV5A 3B6CA 3CP8A 3GTJJ 4UUVA 3ZMSA 3S2WA 3K70C 1YS7A 1JXSA 2E36A 5IOZA 1OCRH 1E17A 2PI0A 3W3CA 3RH2A 1Z3XA 3RPUA 3X2QH 2ZKZA 5M3MJ 2VXDA 3KETA 2OZ6A 1ETKA 3CCYA 2Z1DA 4CYCB 1LDJA 2D1HA 5HDNA 1YIOA 2PX9A 3SFIA 2QWWA 2Y48A 1XN7A 1U6GA 2Y9ZA 3S1NJ 3DPUA 3JSPA 3DEEA 2LDUA 3IH3A 2FMLA 4I2OA 1UB9A 3H9QA 2DJIA 2OTLI 4AIKA 2QEXI 1IN8A 1IN6A 4IOCF 3QOPA 3AG4H 1GV5A 4UDSA 4BACA 1I6XA 1GT0C 1Y56A 1MIJA 1D1CA 2ESHA 3GW2A 3MFKA 5F0FA 3D5LA 2XC7A 3OYMA 1LVKA 4MTDA 3C07A 1W5SA 3WU2C 3M1EA 4OMZA 4G7OF 1WWXA 1QBJA 1TWFJ 4BEHB 4EJVA 2Q24A 3VTIA 1N75A 3VVYA 1YFHA 1EH6A 2AS5F 4GFKA 1O3SA 5K7HA 4XR6A 2VJJA 1V5FA 2R4GA 5F04A 4EEFG 4M6VA 3HTUA 4IRIA
chains in the Genus database with same CATH topology
1FEXA 3V6GA 4BKXA 4NN1A 4D5FA 3DPJA 3P9TA 2F07A 1GDTA 2IU5A 3G1OA 3BTLA 5D1RA 3GTKJ 3NNRA 2OPTA 4DW6A 2W53A 4NELA 2DA2A 2JA5J 4M3FA 2WB1N 3GBGA 4BBSJ 2VUMJ 3CQZJ 2DG7A 4BBRJ 2DA6A 2JA8J 5JLWA 4YZEA 2K9SA 3LJLA 1MSFC 4D5CA 3IH2A 3BT9A 4HNVA 3JR9A 3JRDA 4B1RA 2O9LA 5EGOA 2NVYJ 3S5RA 2M2EA 1CQTA 3NI7A 3AQSA 1ETVA 2DA1A 4HKUA 2HKUA 2H1KA 3MNLA 2CRGA 3BG5A 3HE0A 2YVHA 1ZGWA 3NRGA 2L7MP 2P81A 1Z0XA 2VPRA 4RDUA 4A3BJ 1WCMJ 2L7FP 3HOXJ 4EEFG 3WHCA 2DN0A 3S15J 5IYDJ 2DA7A 1ETXA 1EF4A 2UXPA 1U9NA 4A3DJ 1ORKA 1T56A 5FKMA 4S0HB 4AUXA 3PPBA 4JX4A 1Y1VJ 2ZCNA 1JKPC 3GTOJ 1SANA 1PUFA 5FJ8J 5CW8A 2R92J 4A3EJ 1MBFA 2ZCMA 2DTZA 1ZKGA 4QTRA 1FIPA 3PM1A 4DYQA 5J1YA 2DA5A 3ZQIA 3IH4A 3ZQCA 5FLMJ 3S17J 5HSZA 3ZQGA 4DYRA 3QPSA 1X2NA 3VVXA 1IDYA 3TP3A 1AU7A 4DYCA 4X6AJ 3IV5A 2NP3A 5F08A 3LSJA 5C3EJ 3S1MJ 2NP5A 4GCTA 4XIDA 1I3QJ 1MBKA 1JTXA 4XRSG 3RD3A 4PXIA 2JA7J 2M34A 2K9QA 2ME6A 3L1PA 1UI6A 4GCKA 2IEKA 4GFLA 2ZOZA 2I10A 4JX6A 3GTQJ 4A3JJ 4ACIA 1BJZA 3LSGA 2GBYA 2L7ZA 3VP5A 3ZQFA 1AHDP 2UXOA 1MBEA 1POGA 3C2BA 1LFBA 3JRCA 1JKOC 5DTDA 1IUFA 2OF7A 5FMPA 5JLXA 1X58A 4AC6A 3S1QJ 2AHQA 2NS8A 3HM5A 4I6ZA 2YS9A 1JGGA 4I76A 3MVPA 5IYBJ 2REKA 3BRUA 3JREA 5E3MA 2ZB9A 1XS9A 5IP6A 1I6HJ 2DA4A 2PBXA 3CMYA 2V57A 1RESA 2ME0A 1BA5A 4L62A 1TWCJ 4A93J 1BL0A 3LNQA 2NVQJ 2E2JJ 3VW0A 2LLKA 2OI8A 4BY1J 2EH3A 5HAWA 3QBMA 2GLOA 3H0GJ 5E3NA 3SJMA 1R9TJ 1W0UA 2DMUA 4Y7NJ 1TWHJ 3Q0UA 2MG4A 4J19A 5IPAA 5CXGA 3NPIA 1B8IB 5E3OA 2XPVA 4JYKA 1IC8A 4M3GA 4FE7A 5FHPA 4A3FJ 2JN6A 5FKOA 2MSYA 3JRBA 1F43A 3TEDA 1XC5A 4M3DA 2R7ZJ 4FISA 1DU0A 3HTHA 5EDNA 3M4OJ 4XK4A 2UXUA 1MBHA 4B4CA 3EUPA 5EFYA 4JL3A 1SFOJ 5IOYA 2LK2A 2CJJA 2K9NA 1NK3P 1ZR2A 3H3VK 4C2MJ 4D7MA 3OSGA 3S16J 4CGRA 1E3OC 2YUSA 2WV1A 2PMZN 1VI0A 2DMNA 3K2AA 1WI3A 3CJDA 4QSHA 4W97A 2FX0A 3Q0VA 3CRJA 3GZIA 3OIOA 2QF7A 3CDLA 4M3EA 3RZOJ 3O8GA 2Y30A 1ETQA 3VW2A 2Y31A 4V2GA 2XSDC 3KNWA 3SDGA 1GVDA 1OFCX 1JKRC 3JSJA 3BQYA 2JK3A 2XGDA 1P7JA 4M3BA 5IYCJ 4A3KJ 1HOMA 2QTQA 3I4MJ 2XDNA 1RKTA 1MBGA 2O7TA 3D1NI 2E1OA 3QPLA 2HQ5A 5M5YJ 3K7AJ 2ZCXA 5FKLA 3HDDA 2LD5A 4IHVA 3VOKA 4AF5A 4JP0A 2FD5A 3QQAA 2EZIA 3RZDJ 3MKLA 3B81A 2XPWA 1U78A 2WUIA 2AO9A 2WAQN 3BJBA 2VKVA 4ABZA 1JJ8C 2HI3A 2GFNA 1QPIA 1Q1VA 2Y9YA 2ZOYA 1PUFB 2QKOA 3UKGA 4A3GJ 2UXHA 4CYCA 1VNDA 2W48A 1JTYA 2DMPA 2NS7A 5K7FA 5EEAA 5K58A 3HBLA 2R5ZB 4W1UA 3G1MA 1OJLA 1W0TA 1P7IA 2ECBA 2WGBA 1Z77A 1FIAA 3TP0A 4XRMA 3GTLJ 2DG8A 1F36A 1I50J 3DEWA 1G2HA 2FJ1A 1ZR4A 1UMQA 3JRAA 5J1RA 1S7EA 2XGCA 2LVSA 2OERA 2Y0SN 4FTHA 3GTPJ 4FE4A 2ID6A 2CUFA 2QWTA 3G1LA 3LSRA 1JT6A 3BR6A 3EGQA 1RETA 2R5YA 3HGGA 2RHAA 1O4XA 3NAUA 1BW6A 2JMWA 3Q3SA 3T6NA 2O7OA 2CU7A 3AQTA 4XICA 4ME9A 2CQQA 2LR8A 3FRQA 2L0KA 3TW6A 3HB9A 2D5VA 3HIMA 5C4YA 1JJ6C 4L5EA 3JRGA 3I4NJ 1JUPA 2FBQA 1TWAJ 4LOCA 1RR7A 1BW5A 3A01B 3FKIJ 2R5ZA 1VF9A 5CXIA 2NX4A 3ZOBA 2D6YA 3FISA 4A3CJ 2MGQA 5GPCA 3BG9A 3KKCA 4QIWN 2QCOA 3WHBA 1MBJA 4C3HJ 3G56A 3S2DJ 5DS9A 2G7GA 1ENHA 1JUSA 2XRLA 2YVEA 4ICHA 3ZQHA 1ETOA 3E7QA 2X6OA 2TCTA 1JUMA 5M5XJ 3FK6A 3G7RA 3VUQA 2DMQA 4Y52J 2Y2ZA 3LOCA 1H88C 1ITYA 1RKWA 3BHQA 3GTGJ 2KDZA 3GEUA 1B8IA 1IG7A 2H8RA 4MK6A 3BTJA 1WH7A 1TWGJ 3MN2A 3BTIA 1WH5A 5C4JJ 2E2HJ 1ETYA 4V2FA 2M8GX 2LFBA 1LE8A 5H9TA 4A3LJ 9ANTA 3LWJA 4MO7A 5IP9J 1FJLA 5D18A 4BXXJ 4DZJA 1K83J 4IHWA 5J3LA 5FKNA 2EQRA 3BR2A 5AQCA 4MFDA 2VKEA 5HODA 2R93J 3PO2J 3IUVA 2B63J 2LKXA 2ELKA 3M3YJ 4JNNA 1WGXA 5FKKA 2RASA 2O8KA 3VVZA 2K40A 5E3LA 3VOXA 1A6IA 4D7NA 3BCGA 2GENA 3BR0A 3COLA 5M5WJ 5BNGA 3DCFA 1WPKA 1YRNB 3W6VA 1DU6A 2COBA 2R0QC 3S1RJ 4AYBN 2DMTA 3A03A 2X48A 3LHQA 3F0CA 3E7LA 2LTPA 1MH4A 4MIMA 3FK7A 2X9DA 2HDDA 2YU9J 2IBDA 1GUUA 2FQ4A 1H8AC 3GTMJ 2UXIA 4DZPA 3PASA 3KKDA 2EBIA 5DAJA 3RQIA 1FTTA 3NXCA 2G7SA 3A02A 5F0HA 4B3AA 5EGOB 1MNMC 3BG3A 3ANPA 4C3JJ 2G0EA 3FIWA 1OCTC 1IV6A 5F1JA 3O60A 2HOTA 4A3MJ 2N8GA 3BNIA 4MXMA 5FGLA 4RBOA 2NVTJ 1HDPA 1UHSA 3B6AA 4UUSA 3V78A 3TW7A 3HOZJ 3HOUJ 3HKZN 2XPUA 2NVXJ 2E19A 3HOYJ 1QVTA 2NOGA 2JA6J 5J1UA 5HBUA 2EZHA 1X2MA 2RAEA 1ZK8A 3KZ9A 1VFCA 3BTCA 3S14J 2PZ9A 1ZQ3P 1XG1A 1GV2A 2QOPA 3HTIA 3BR3A 2HXIA 4C3IJ 4A3IJ 2JJ7A 2EZKA 4UUSB 2M0CA 4GCLA 1HDDC 1HF0A 5EG0B 3A01A 4IEJA 2TRTA 3BQZA 1OCPA 1Y1WJ 2MW8A 5FLVA 1U9OA 1U8BA 2HOAA 1UG2A 1ETWA 4GFBA 2E2IJ 5F27A 2XB0X 2EZLA 4MLOA 1IDZA 5GPAA 5IP7J 5K7ZA 4IHYA 2HXOA 4XRSA 3VPRA 4BY7J 2KT0A 1JT0A 2R5YB 3JRIA 1TC3C 4NDLA 1MSEC 1H89C 5EYRA 1ZTRA 4MFEA 3JRFA 3BR1A 3BR5A 3B6CA 1UI5A 3OOUA 3GTJJ 2VI6A 1NTCA 2LP0A 2LY9A 4G12A 3OSFA 5GP9A 1K61A 1AKHA 5IOZA 1QVUA 2XB5A 2IAIA 3RH2A 3ON2A 2ID3A 2G3BA 2G7LA 5M3MJ 4KWAA 2GM4A 1ETKA 3CCYA 2GUHA 2CUEA 4CYCB 3JRHA 1IJWC 1B72B 5F0CA 1B72A 4AC0A 2DJNA 3ANGA 1T33A 3CWRA 3SFIA 3HGYA 2HOSA 1D5YA 2DA3A 1YRNA 5EZHA 2Y9ZA 1IRZA 1QRYA 3S1NJ 1AKHB 1APLC 1SGMA 3IH3A 3HOWJ 1NK2P 5M3FJ 1HLVA 5C4XJ 1IGNA 1GV5A 5C44J 3ON4A 4JKZA 4UDSA 3QKXA 2JWTA 1GT0C 1JKQC 1RPWA 3VW1A 1A5JA 5D19A 5EZGA 3HTAA 2QIBA 1LFUP 2M9HA 5F0FA 3HTJA 3Q0WA 4FCYA 3PO3J 3HOVJ 1MH3A 2L9RA 1FTZA 1HCRA 3HEFA 3RKQA 3F1BA 3C07A 1TWFJ 1LE8B 5EF6A 2Q24A 5EG0A 2XGEA 3VVYA 3VIBA 4GFKA 2HYJA 4A69C 5K7HA 4UUTA 3O8HA 4JX5A 2ECCA 3NARA 3LSPA 2CQXA 5F04A 3ZQLA 2HYTA 4X1EA 4M6VA 4IHXA 3S2HJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FEX A;  3V6G A;  4BKX A;  4NN1 A;  4D5F A;  3DPJ A;  3P9T A;  2F07 A;  1GDT A;  2IU5 A;  3G1O A;  3BTL A;  5D1R A;  3GTK J;  3NNR A;  2OPT A;  4DW6 A;  2W53 A;  4NEL A;  2DA2 A;  2JA5 J;  4M3F A;  2WB1 N;  3GBG A;  4BBS J;  2VUM J;  3CQZ J;  2DG7 A;  4BBR J;  2DA6 A;  2JA8 J;  5JLW A;  4YZE A;  2K9S A;  3LJL A;  1MSF C;  4D5C A;  3IH2 A;  3BT9 A;  4HNV A;  3JR9 A;  3JRD A;  4B1R A;  2O9L A;  5EGO A;  2NVY J;  3S5R A;  2M2E A;  1CQT A;  3NI7 A;  3AQS A;  1ETV A;  2DA1 A;  4HKU A;  2HKU A;  2H1K A;  3MNL A;  2CRG A;  3BG5 A;  3HE0 A;  2YVH A;  1ZGW A;  3NRG A;  2L7M P;  2P81 A;  1Z0X A;  2VPR A;  4RDU A;  4A3B J;  1WCM J;  2L7F P;  3HOX J;  4EEF G;  3WHC A;  2DN0 A;  3S15 J;  5IYD J;  2DA7 A;  1ETX A;  1EF4 A;  2UXP A;  1U9N A;  4A3D J;  1ORK A;  1T56 A;  5FKM A;  4S0H B;  4AUX A;  3PPB A;  4JX4 A;  1Y1V J;  2ZCN A;  1JKP C;  3GTO J;  1SAN A;  1PUF A;  5FJ8 J;  5CW8 A;  2R92 J;  4A3E J;  1MBF A;  2ZCM A;  2DTZ A;  1ZKG A;  4QTR A;  1FIP A;  3PM1 A;  4DYQ A;  5J1Y A;  2DA5 A;  3ZQI A;  3IH4 A;  3ZQC A;  5FLM J;  3S17 J;  5HSZ A;  3ZQG A;  4DYR A;  3QPS A;  1X2N A;  3VVX A;  1IDY A;  3TP3 A;  1AU7 A;  4DYC A;  4X6A J;  3IV5 A;  2NP3 A;  5F08 A;  3LSJ A;  5C3E J;  3S1M J;  2NP5 A;  4GCT A;  4XID A;  1I3Q J;  1MBK A;  1JTX A;  4XRS G;  3RD3 A;  4PXI A;  2JA7 J;  2M34 A;  2K9Q A;  2ME6 A;  3L1P A;  1UI6 A;  4GCK A;  2IEK A;  4GFL A;  2ZOZ A;  2I10 A;  4JX6 A;  3GTQ J;  4A3J J;  4ACI A;  1BJZ A;  3LSG A;  2GBY A;  2L7Z A;  3VP5 A;  3ZQF A;  1AHD P;  2UXO A;  1MBE A;  1POG A;  3C2B A;  1LFB A;  3JRC A;  1JKO C;  5DTD A;  1IUF A;  2OF7 A;  5FMP A;  5JLX A;  1X58 A;  4AC6 A;  3S1Q J;  2AHQ A;  2NS8 A;  3HM5 A;  4I6Z A;  2YS9 A;  1JGG A;  4I76 A;  3MVP A;  5IYB J;  2REK A;  3BRU A;  3JRE A;  5E3M A;  2ZB9 A;  1XS9 A;  5IP6 A;  1I6H J;  2DA4 A;  2PBX A;  3CMY A;  2V57 A;  1RES A;  2ME0 A;  1BA5 A;  4L62 A;  1TWC J;  4A93 J;  1BL0 A;  3LNQ A;  2NVQ J;  2E2J J;  3VW0 A;  2LLK A;  2OI8 A;  4BY1 J;  2EH3 A;  5HAW A;  3QBM A;  2GLO A;  3H0G J;  5E3N A;  3SJM A;  1R9T J;  1W0U A;  2DMU A;  4Y7N J;  1TWH J;  3Q0U A;  2MG4 A;  4J19 A;  5IPA A;  5CXG A;  3NPI A;  1B8I B;  5E3O A;  2XPV A;  4JYK A;  1IC8 A;  4M3G A;  4FE7 A;  5FHP A;  4A3F J;  2JN6 A;  5FKO A;  2MSY A;  3JRB A;  1F43 A;  3TED A;  1XC5 A;  4M3D A;  2R7Z J;  4FIS A;  1DU0 A;  3HTH A;  5EDN A;  3M4O J;  4XK4 A;  2UXU A;  1MBH A;  4B4C A;  3EUP A;  5EFY A;  4JL3 A;  1SFO J;  5IOY A;  2LK2 A;  2CJJ A;  2K9N A;  1NK3 P;  1ZR2 A;  3H3V K;  4C2M J;  4D7M A;  3OSG A;  3S16 J;  4CGR A;  1E3O C;  2YUS A;  2WV1 A;  2PMZ N;  1VI0 A;  2DMN A;  3K2A A;  1WI3 A;  3CJD A;  4QSH A;  4W97 A;  2FX0 A;  3Q0V A;  3CRJ A;  3GZI A;  3OIO A;  2QF7 A;  3CDL A;  4M3E A;  3RZO J;  3O8G A;  2Y30 A;  1ETQ A;  3VW2 A;  2Y31 A;  4V2G A;  2XSD C;  3KNW A;  3SDG A;  1GVD A;  1OFC X;  1JKR C;  3JSJ A;  3BQY A;  2JK3 A;  2XGD A;  1P7J A;  4M3B A;  5IYC J;  4A3K J;  1HOM A;  2QTQ A;  3I4M J;  2XDN A;  1RKT A;  1MBG A;  2O7T A;  3D1N I;  2E1O A;  3QPL A;  2HQ5 A;  5M5Y J;  3K7A J;  2ZCX A;  5FKL A;  3HDD A;  2LD5 A;  4IHV A;  3VOK A;  4AF5 A;  4JP0 A;  2FD5 A;  3QQA A;  2EZI A;  3RZD J;  3MKL A;  3B81 A;  2XPW A;  1U78 A;  2WUI A;  2AO9 A;  2WAQ N;  3BJB A;  2VKV A;  4ABZ A;  1JJ8 C;  2HI3 A;  2GFN A;  1QPI A;  1Q1V A;  2Y9Y A;  2ZOY A;  1PUF B;  2QKO A;  3UKG A;  4A3G J;  2UXH A;  4CYC A;  1VND A;  2W48 A;  1JTY A;  2DMP A;  2NS7 A;  5K7F A;  5EEA A;  5K58 A;  3HBL A;  2R5Z B;  4W1U A;  3G1M A;  1OJL A;  1W0T A;  1P7I A;  2ECB A;  2WGB A;  1Z77 A;  1FIA A;  3TP0 A;  4XRM A;  3GTL J;  2DG8 A;  1F36 A;  1I50 J;  3DEW A;  1G2H A;  2FJ1 A;  1ZR4 A;  1UMQ A;  3JRA A;  5J1R A;  1S7E A;  2XGC A;  2LVS A;  2OER A;  2Y0S N;  4FTH A;  3GTP J;  4FE4 A;  2ID6 A;  2CUF A;  2QWT A;  3G1L A;  3LSR A;  1JT6 A;  3BR6 A;  3EGQ A;  1RET A;  2R5Y A;  3HGG A;  2RHA A;  1O4X A;  3NAU A;  1BW6 A;  2JMW A;  3Q3S A;  3T6N A;  2O7O A;  2CU7 A;  3AQT A;  4XIC A;  4ME9 A;  2CQQ A;  2LR8 A;  3FRQ A;  2L0K A;  3TW6 A;  3HB9 A;  2D5V A;  3HIM A;  5C4Y A;  1JJ6 C;  4L5E A;  3JRG A;  3I4N J;  1JUP A;  2FBQ A;  1TWA J;  4LOC A;  1RR7 A;  1BW5 A;  3A01 B;  3FKI J;  2R5Z A;  1VF9 A;  5CXI A;  2NX4 A;  3ZOB A;  2D6Y A;  3FIS A;  4A3C J;  2MGQ A;  5GPC A;  3BG9 A;  3KKC A;  4QIW N;  2QCO A;  3WHB A;  1MBJ A;  4C3H J;  3G56 A;  3S2D J;  5DS9 A;  2G7G A;  1ENH A;  1JUS A;  2XRL A;  2YVE A;  4ICH A;  3ZQH A;  1ETO A;  3E7Q A;  2X6O A;  2TCT A;  1JUM A;  5M5X J;  3FK6 A;  3G7R A;  3VUQ A;  2DMQ A;  4Y52 J;  2Y2Z A;  3LOC A;  1H88 C;  1ITY A;  1RKW A;  3BHQ A;  3GTG J;  2KDZ A;  3GEU A;  1B8I A;  1IG7 A;  2H8R A;  4MK6 A;  3BTJ A;  1WH7 A;  1TWG J;  3MN2 A;  3BTI A;  1WH5 A;  5C4J J;  2E2H J;  1ETY A;  4V2F A;  2M8G X;  2LFB A;  1LE8 A;  5H9T A;  4A3L J;  9ANT A;  3LWJ A;  4MO7 A;  5IP9 J;  1FJL A;  5D18 A;  4BXX J;  4DZJ A;  1K83 J;  4IHW A;  5J3L A;  5FKN A;  2EQR A;  3BR2 A;  5AQC A;  4MFD A;  2VKE A;  5HOD A;  2R93 J;  3PO2 J;  3IUV A;  2B63 J;  2LKX A;  2ELK A;  3M3Y J;  4JNN A;  1WGX A;  5FKK A;  2RAS A;  2O8K A;  3VVZ A;  2K40 A;  5E3L A;  3VOX A;  1A6I A;  4D7N A;  3BCG A;  2GEN A;  3BR0 A;  3COL A;  5M5W J;  5BNG A;  3DCF A;  1WPK A;  1YRN B;  3W6V A;  1DU6 A;  2COB A;  2R0Q C;  3S1R J;  4AYB N;  2DMT A;  3A03 A;  2X48 A;  3LHQ A;  3F0C A;  3E7L A;  2LTP A;  1MH4 A;  4MIM A;  3FK7 A;  2X9D A;  2HDD A;  2YU9 J;  2IBD A;  1GUU A;  2FQ4 A;  1H8A C;  3GTM J;  2UXI A;  4DZP A;  3PAS A;  3KKD A;  2EBI A;  5DAJ A;  3RQI A;  1FTT A;  3NXC A;  2G7S A;  3A02 A;  5F0H A;  4B3A A;  5EGO B;  1MNM C;  3BG3 A;  3ANP A;  4C3J J;  2G0E A;  3FIW A;  1OCT C;  1IV6 A;  5F1J A;  3O60 A;  2HOT A;  4A3M J;  2N8G A;  3BNI A;  4MXM A;  5FGL A;  4RBO A;  2NVT J;  1HDP A;  1UHS A;  3B6A A;  4UUS A;  3V78 A;  3TW7 A;  3HOZ J;  3HOU J;  3HKZ N;  2XPU A;  2NVX J;  2E19 A;  3HOY J;  1QVT A;  2NOG A;  2JA6 J;  5J1U A;  5HBU A;  2EZH A;  1X2M A;  2RAE A;  1ZK8 A;  3KZ9 A;  1VFC A;  3BTC A;  3S14 J;  2PZ9 A;  1ZQ3 P;  1XG1 A;  1GV2 A;  2QOP A;  3HTI A;  3BR3 A;  2HXI A;  4C3I J;  4A3I J;  2JJ7 A;  2EZK A;  4UUS B;  2M0C A;  4GCL A;  1HDD C;  1HF0 A;  5EG0 B;  3A01 A;  4IEJ A;  2TRT A;  3BQZ A;  1OCP A;  1Y1W J;  2MW8 A;  5FLV A;  1U9O A;  1U8B A;  2HOA A;  1UG2 A;  1ETW A;  4GFB A;  2E2I J;  5F27 A;  2XB0 X;  2EZL A;  4MLO A;  1IDZ A;  5GPA A;  5IP7 J;  5K7Z A;  4IHY A;  2HXO A;  4XRS A;  3VPR A;  4BY7 J;  2KT0 A;  1JT0 A;  2R5Y B;  3JRI A;  1TC3 C;  4NDL A;  1MSE C;  1H89 C;  5EYR A;  1ZTR A;  4MFE A;  3JRF A;  3BR1 A;  3BR5 A;  3B6C A;  1UI5 A;  3OOU A;  3GTJ J;  2VI6 A;  1NTC A;  2LP0 A;  2LY9 A;  4G12 A;  3OSF A;  5GP9 A;  1K61 A;  1AKH A;  5IOZ A;  1QVU A;  2XB5 A;  2IAI A;  3RH2 A;  3ON2 A;  2ID3 A;  2G3B A;  2G7L A;  5M3M J;  4KWA A;  2GM4 A;  1ETK A;  3CCY A;  2GUH A;  2CUE A;  4CYC B;  3JRH A;  1IJW C;  1B72 B;  5F0C A;  1B72 A;  4AC0 A;  2DJN A;  3ANG A;  1T33 A;  3CWR A;  3SFI A;  3HGY A;  2HOS A;  1D5Y A;  2DA3 A;  1YRN A;  5EZH A;  2Y9Z A;  1IRZ A;  1QRY A;  3S1N J;  1AKH B;  1APL C;  1SGM A;  3IH3 A;  3HOW J;  1NK2 P;  5M3F J;  1HLV A;  5C4X J;  1IGN A;  1GV5 A;  5C44 J;  3ON4 A;  4JKZ A;  4UDS A;  3QKX A;  2JWT A;  1GT0 C;  1JKQ C;  1RPW A;  3VW1 A;  1A5J A;  5D19 A;  5EZG A;  3HTA A;  2QIB A;  1LFU P;  2M9H A;  5F0F A;  3HTJ A;  3Q0W A;  4FCY A;  3PO3 J;  3HOV J;  1MH3 A;  2L9R A;  1FTZ A;  1HCR A;  3HEF A;  3RKQ A;  3F1B A;  3C07 A;  1TWF J;  1LE8 B;  5EF6 A;  2Q24 A;  5EG0 A;  2XGE A;  3VVY A;  3VIB A;  4GFK A;  2HYJ A;  4A69 C;  5K7H A;  4UUT A;  3O8H A;  4JX5 A;  2ECC A;  3NAR A;  3LSP A;  2CQX A;  5F04 A;  3ZQL A;  2HYT A;  4X1E A;  4M6V A;  4IHX A;  3S2H J; 
#chains in the Genus database with same CATH topology
 4N4O B;  2XAH A;  2L9N A;  2BHZ A;  3NWS A;  2M0M A;  3E5X A;  3ZP5 A;  4LGW A;  4IHT A;  3H92 A;  4XNF A;  3JCU C;  2V1N A;  4NEL A;  2DA2 A;  3SXY A;  4BBS J;  1MMA A;  1OPC A;  4ZH4 F;  3H3Z A;  3V42 A;  3F3X A;  1BC8 C;  3H0D A;  1LB2 A;  2P7C B;  3HTS B;  1I39 A;  3IWF A;  3R4K A;  4JQF A;  3HIF A;  2IGK A;  4Y33 A;  5F6F A;  1GVJ A;  4UVC A;  1TT0 A;  5L3E A;  3RJP A;  1GXQ A;  4B1R A;  5ICC A;  5EGO A;  5KNL A;  1MMN A;  4ESJ A;  3S5R A;  4CIC A;  3HOS A;  4N9I A;  3G6E I;  2CH0 A;  3DPL C;  1TNT A;  2VB6 A;  2W82 A;  2QSH X;  3NI7 A;  3WTV C;  4QWQ A;  2HKU A;  3V8L A;  2M4K A;  2H1K A;  1TW2 A;  2YVH A;  4PJJ A;  1ZGW A;  1IW7 F;  3V4G A;  2P81 A;  4HX8 A;  5D6F A;  4E7S A;  4DIQ A;  1Z0X A;  1WCM J;  1UST A;  3OMY A;  3HOX J;  1N78 A;  3I59 B;  4BE1 A;  3WHC A;  2DN0 A;  5FD6 A;  3HRS A;  1ETX A;  2UXP A;  1D8J A;  1ORK A;  1R1T A;  3OOP A;  4XKB A;  2NOJ B;  2W25 A;  2VC0 A;  4BQO A;  5B5E C;  4BYY A;  4M9Z A;  4Y3O A;  2YX7 A;  4G9Y A;  5J6X A;  1EV7 A;  2RDP A;  5FJ8 J;  2G7U A;  3FX3 A;  4G7Z F;  5CW8 A;  2R92 J;  2ZCM A;  2DTZ A;  1BI1 A;  4Z6Y A;  2V6E A;  2DA5 A;  3ZQI A;  2PMZ A;  1TBX A;  1T0F A;  5FLM J;  2AXL A;  3ZQC A;  3BJ6 A;  4DYR A;  3OIP A;  3GME A;  4GCV A;  1ZRD A;  3S17 J;  3J7Z I;  3VVX A;  2R7Q A;  3TP3 A;  1VQ4 I;  4X6A J;  1Y8Q B;  1DDN A;  1VQ6 I;  1S29 A;  3IRQ A;  2IT0 A;  2NP5 A;  3FXR A;  2F5C A;  1BIA A;  2W84 A;  4GRI A;  3RD3 A;  4PXI A;  2JA7 J;  2M34 A;  2K9Q A;  1UI6 A;  4GCK A;  3VEP A;  2EA2 A;  4ZZD A;  4PUS A;  2ZOZ A;  3IWZ A;  2I10 A;  4C2M A;  4YEJ A;  2PN6 A;  1LNW A;  4JX6 A;  4A3J J;  2IS6 A;  1BJZ A;  2R7S A;  2GBY A;  3VP5 A;  2KJC A;  3ZQF A;  2UXO A;  1LFB A;  3F72 A;  4O5V A;  2M30 A;  2DO7 A;  1IUF A;  1W5C C;  2W85 A;  2KIS A;  2ISY A;  2HVQ A;  2NS8 A;  1VQ5 I;  3HM5 A;  5E17 F;  3IC7 A;  2CW7 A;  1JGG A;  4LB5 A;  3MVP A;  4F93 B;  2REK A;  3BRU A;  3G71 I;  1ZGJ A;  5E3M A;  2FJI 1;  2DA4 A;  4U0W A;  3CMY A;  2KLO A;  1SD7 A;  1RES A;  2F4M B;  2ME0 A;  2PBX A;  2V57 A;  4L62 A;  3NS4 A;  1MZB A;  4OIN F;  1TQI A;  2V6C A;  4ETS A;  2NVQ J;  3OYN A;  3HPH A;  2L7K A;  2Z5U A;  4B8X A;  3SEQ A;  4BQA A;  3RKY A;  3WTT C;  2DMU A;  4MEY F;  3MKW B;  4Y7N J;  3Q0U A;  5J4Y A;  4J19 A;  2XF6 A;  4AIH A;  3W2A A;  2KRC A;  3M07 A;  2QA4 I;  1XDS A;  5A2Q Z;  2NS0 A;  4PJN A;  5LEJ A;  2JN6 A;  3U1K A;  2W7N A;  5FHP A;  1W4M A;  1XC5 A;  2K4B A;  4FIS A;  2QZ8 A;  2EFN A;  4BAY A;  3OYJ A;  1LUJ B;  1BOB A;  2MH9 A;  3TDZ C;  2RKH A;  2VBX A;  2HZD A;  2EIN H;  2NXN B;  4UV8 A;  4ZYH A;  2K9N A;  2XF7 A;  4XKC A;  4BQQ A;  1ZR2 A;  3LQR A;  4ZYA A;  3L2V A;  4QPQ A;  2WV1 A;  4ENM A;  2DYR H;  1QGP A;  2OV7 A;  3K2A A;  4W97 A;  3Q0V A;  2EFQ A;  1HW5 A;  2L9V A;  3OIO A;  5BS6 A;  4NC7 A;  2V1X A;  3O8G A;  3GLL A;  2Z16 A;  1I5Z A;  4BXU A;  4BQN A;  2ELH A;  1M1E B;  2C6Y A;  2UXX A;  2Y69 H;  3VW2 A;  1U5T C;  1KU9 A;  3SDG A;  4F7Z A;  1OFC X;  3RIR A;  2W4S A;  3LFK A;  3JSJ A;  2XGD A;  4AYB A;  2HYG D;  2BOL A;  5IYC J;  4A3K J;  3DEU A;  2QYO A;  2M4G A;  2ZFU A;  3I4M J;  1MBG A;  3R60 A;  2O7T A;  2E1O A;  2XAS A;  3OYB A;  2ZCX A;  5L3G A;  1RUO A;  3I58 A;  3VOK A;  3BPV A;  2HDC A;  1HC8 A;  1FLI A;  3OYK A;  2HVR A;  2FSW A;  4Q48 A;  2FD5 A;  2DXI A;  1DGR M;  3KE2 A;  3PQJ A;  4XOT A;  3RZD J;  1ZH5 A;  3B81 A;  2R7T A;  4CYD A;  4Z2Y A;  5FLX K;  1QZE A;  4ENK A;  2QUF A;  3T0Y A;  2GFN A;  5TRD A;  3UKG A;  2PJP A;  2UXH A;  3A1Y A;  5HS7 A;  4CYC A;  3CJR B;  4G6D A;  4IL6 C;  1JTY A;  1P4A A;  2DMP A;  2NS7 A;  3DKX A;  3ASN H;  5K7F A;  1F4K A;  5K5Q A;  2JA2 A;  2OQG A;  2W00 A;  3G1M A;  4W1U A;  1W0T A;  4S04 A;  2XHK A;  1D0Z A;  3F22 A;  5EEH A;  1F36 A;  4EJW A;  4DOZ A;  1ZR4 A;  3DBH B;  4KIS A;  5J1R A;  2MA3 A;  1G3T A;  4IQ4 A;  1ON1 A;  1H9G A;  2E34 A;  4FHT A;  2OER A;  2DQR A;  3CCE I;  2ID6 A;  3LSR A;  3EGQ A;  1XSX A;  2R5Y A;  4KJZ A;  1Y6I A;  1MD0 A;  4E7I A;  4HZF A;  4GDF A;  4XN0 A;  3NAU A;  1GHC A;  5HDK A;  3EUH C;  5KVR A;  4LLN A;  2P7V B;  3K1N A;  3H5A A;  2L01 A;  1S3J A;  3I4N J;  1RR7 A;  2JPB A;  4L18 B;  1YJW I;  1BW5 A;  3KP4 A;  3A01 B;  4HG2 A;  3K4M A;  1XPX A;  2MC3 A;  1X3U A;  2YVX A;  3W6K B;  1SFK A;  4LB6 B;  4OAY A;  2Q2E B;  3WHB A;  1MBJ A;  5D4S A;  3TGN A;  3MD2 A;  1JHF A;  4L9N A;  2CO5 A;  3VYU B;  2OC6 A;  1P9Q C;  3FZV A;  2XRL A;  4ICH A;  1E3H A;  1X1C A;  2VT3 A;  2X6O A;  3ZRG A;  4CHU A;  4LJZ F;  3VUQ A;  5CPR B;  2BW3 B;  1YS6 A;  1RKW A;  1BR1 A;  2WAD A;  1X1P A;  3SQN A;  2XAJ A;  3GEU A;  2OU2 A;  2F4I A;  4FET A;  3WG9 A;  3BTJ A;  1G3S A;  1AA7 A;  3L2R A;  1WH5 A;  2L3D A;  3ABM H;  3BLY A;  3ASO H;  1QO0 D;  2FUG 2;  1Z7U A;  5H9T A;  4A3L J;  9ANT A;  3J7A Y;  4HPQ A;  1R58 A;  5CJ9 A;  4U9N A;  3DKY A;  1WI9 A;  5LHI A;  1KU7 A;  2ZNY A;  5FKN A;  4HBL A;  3BR2 A;  5AQC A;  4IVN A;  3PO2 J;  2HDW A;  3M3Y J;  1DPU A;  2JVG A;  2X6W A;  3H9G A;  1FYL A;  1R1V A;  3K6G A;  5E3L A;  1A6I A;  2Z99 A;  3COL A;  3KYL A;  4B3X A;  1WPK A;  3CD6 I;  2X85 A;  2V7F A;  3P9K A;  1DU6 A;  1RNL A;  3ML6 A;  4M74 A;  4MGR A;  2R0Q C;  3S1R J;  4AYB N;  2DMT A;  2JZY A;  3Q9V A;  3BP8 A;  4JBA A;  2O6G E;  4AD9 A;  1SFX A;  3LA2 A;  3RYP A;  4MIM A;  3FK7 A;  3OIQ A;  2HDD A;  5GAH J;  1YQA A;  5DDG A;  1SD5 A;  1H8A C;  1XD7 A;  3VSK A;  4UHT A;  2E1M C;  3RQI A;  1BN5 A;  3R61 A;  2WY8 Q;  1B6A A;  5ICE A;  5F0H A;  3AL0 B;  5K5R A;  1I1G A;  1Z91 A;  3ANP A;  3KYC B;  3VOE A;  1OCT C;  2IW5 A;  1P6R A;  3CCL I;  1K4S A;  5ED4 A;  2VQH A;  1VQM I;  2HOT A;  4YFK F;  4HX4 A;  2WC2 A;  3HG9 A;  3MZY A;  4MXM A;  1OQY A;  1YIJ I;  3T5X A;  3TW7 A;  2G9W A;  3MQ0 A;  2R7U A;  3HKZ N;  2JUG A;  2XPU A;  2E19 A;  4ANJ A;  2BXY A;  1X2M A;  2R7V A;  4HST A;  4RGR A;  2HYF A;  4ZYG A;  2PZ9 A;  3M7G A;  3C3W A;  2EPF A;  5ICG A;  3HTI A;  3DU5 A;  3V8J A;  2HXI A;  4C9Y A;  4A12 A;  1KYW A;  3DQV C;  2JJ7 A;  2EZK A;  2VAS A;  4PJM A;  1EJ9 A;  4RMN A;  3HHH A;  4UUS B;  2PFV A;  2MYS A;  3AAF A;  5LBQ A;  3CCJ I;  3KEO A;  1G4D A;  3CUQ A;  1I27 A;  5EG0 B;  4IEJ A;  4IX7 A;  5LHG A;  3BQZ A;  1LDD A;  3REO A;  1U9O A;  4KIT B;  1X4P A;  1XX5 A;  4N9H A;  4LIT A;  4RAY A;  4XLC A;  2H27 A;  2ZFW A;  1K79 A;  1PP7 U;  2EZL A;  1TW3 A;  1UZC A;  5K7Z A;  4IHY A;  3VPR A;  3UNG C;  1XDU A;  4KT6 A;  2KT0 A;  4P5O A;  3I3L A;  2QM3 A;  1EA3 A;  1R71 A;  4ZJZ A;  4BXF A;  4IJA A;  1H89 C;  3BR1 A;  2P5K A;  3SHF A;  3GEZ A;  1YTY A;  4LG0 B;  2VI6 A;  3HL2 A;  1G59 A;  2LY9 A;  4G12 A;  1JI8 A;  2ICW G;  2ZCW A;  5GP9 A;  3CCM I;  4NC6 A;  1QVU A;  2HFH A;  1R7J A;  1F5T A;  3ON2 A;  1MMG A;  2ID3 A;  3BJA A;  3KLO A;  1HSJ A;  2G7L A;  2NRA C;  4KWA A;  3TDU C;  2GM4 A;  2HU9 A;  4PZJ A;  2CUE A;  2V26 A;  3N97 A;  2EA4 A;  1IJW C;  2DJN A;  5GAG J;  3CWR A;  4ZC3 A;  3P7N A;  2EIM H;  2MLG A;  4EM2 A;  2GOX B;  1D5Y A;  2DA3 A;  3FF5 A;  2PMU A;  1IRZ A;  1IRG A;  4L0Y B;  3R0J A;  4XLA A;  5DD8 A;  3IAM 2;  1APL C;  1A36 A;  4UV9 A;  3E6D A;  4LIV A;  1HLV A;  2CQ7 A;  5C4X J;  1F9N A;  5L3C A;  3H5N A;  3TBI A;  1IGN A;  4UVA A;  2GAU A;  1BR4 A;  1P4X A;  5CQG A;  2QEN A;  3U2R A;  2JWT A;  5HLI A;  3HSR A;  3VW1 A;  1A5J A;  5D5V B;  4MHG A;  1WJA A;  4B44 A;  5CVR A;  1XGN A;  1XB4 A;  4E4H A;  2DFH A;  2FBI A;  3V7S A;  1VQO I;  2L9R A;  1YW8 A;  1VQK I;  3PO3 J;  1FTZ A;  2RVC A;  1XSD A;  2ZJ2 A;  4HF0 A;  3RYR A;  4F52 A;  1OMI A;  2GIZ A;  2H94 A;  1X3W B;  1Z67 A;  5EG0 A;  1ZRC A;  2H8W A;  3E5Q A;  2VOP A;  3CUQ B;  3ERM A;  1VQ9 I;  3VIB A;  4UUT A;  2OZU A;  2WAF A;  5DCF A;  2XKP A;  1EKE A;  2ECC A;  3NAR A;  3ZQL A;  2CQX A;  5J8F A;  1ZRF A;  3GZ5 A;  2Q0O A;  3I9V 2;  3NWT A;  3QOD A;  4X1E A;  4IHX A;  1WJC A;  3V6G A;  1XMK A;  3TQN A;  4BKX A;  4NN1 A;  2WWY A;  4BU2 A;  3G1O A;  3BTL A;  1KGS A;  3C2G A;  1ZAR A;  5LRS A;  1MMS A;  5GAE J;  2ZC2 A;  3VWB A;  4BHB A;  2BHY A;  2CFO A;  5JFR A;  2OPT A;  1YOV B;  2DTR A;  3JTH A;  4LLG F;  2WB1 N;  4MEX F;  2QQ8 A;  2LF8 A;  2VUM J;  1VZ0 A;  4BBR J;  5IT9 Z;  2VBZ A;  4I0A A;  3QU3 A;  5E79 C;  2KL4 A;  5FFZ A;  2JA8 J;  3VFZ A;  3IH2 A;  5D8L B;  4CCN A;  5GTI C;  3VYT B;  5BPD A;  2GZW A;  1OLT A;  4ESB A;  2O9L A;  2NVY J;  4LIU A;  2M2E A;  1FT9 A;  3M8F A;  4FQG A;  1ZAO A;  3OYE A;  1MDM A;  3OYF A;  5B1B H;  4NHJ A;  2ESN A;  1SMT A;  3BG5 A;  3HE0 A;  3L09 A;  4MNU A;  2R7X A;  2L2O A;  3NRG A;  1R4M B;  1G8X A;  1LJ9 A;  2VKD A;  2LF7 A;  3ONQ A;  4A6E A;  2QBY A;  4I09 A;  1STZ A;  2DA7 A;  3GO5 A;  3E97 A;  3OYI A;  2KDO A;  3BC8 A;  3J7A O;  3PPB A;  1W36 C;  2K4J A;  4ZTF A;  4A0Y A;  2ZCN A;  2M87 A;  1JKP C;  2GQQ A;  3JTG A;  5CLS A;  2FQ3 A;  1FZP B;  2OA4 A;  4CCM A;  4A3E J;  1MBF A;  3RCO A;  1HQC A;  2FE3 A;  1Z05 A;  4G6Q A;  2OUM A;  2HQN A;  5LGT A;  4KN4 X;  2VQL A;  1U2W A;  3ZQG A;  2BVL A;  2F48 A;  4BL0 B;  2CV2 A;  5J8C A;  1HKQ A;  4R8H A;  4DYC A;  2OAZ A;  2NP3 A;  1HA8 A;  4WXD A;  4EGZ A;  4HDV A;  3LSJ A;  5C3E J;  2P6T A;  4PGG A;  4XLP F;  2Z3Y A;  4RM3 A;  4U9L A;  2YR2 A;  3WGI A;  3KZZ A;  4GFL A;  2DOD A;  5HLH A;  3LL7 A;  4C2T A;  1BI0 A;  2D1V A;  2L7Z A;  1YE9 A;  3LSG A;  3QPH A;  5DM6 F;  1AHD P;  3OL3 A;  4NB5 A;  3G73 A;  1FP2 A;  3C2B A;  4IKF A;  1ZN2 A;  3BZK A;  2YPR A;  2E1C A;  2M8E A;  2OF7 A;  2KZG A;  1X58 A;  4AVP A;  3HSE A;  1FYM A;  1FBS A;  2ZME C;  2DDB A;  3T8T A;  3J7Y J;  4XRF A;  3KZI C;  4BNC A;  3FXJ A;  3DKW A;  3WTZ A;  3PIP F;  4I76 A;  2P5L C;  3A4C A;  2ZB9 A;  5IP6 A;  4IOA F;  1I6H J;  4CCL A;  1RI7 A;  1A04 A;  3E3V A;  4A93 J;  4BJ5 C;  3LNQ A;  1LPQ A;  3AKZ A;  3QBM A;  3FM3 A;  2GLO A;  3FHZ A;  2DQL A;  4OIO F;  3PJR A;  5E3N A;  2TDX A;  1D1A A;  4F55 A;  1MJ9 A;  4D1Q A;  1G3Y A;  3C1D A;  3NPI A;  5CXG A;  3SZT A;  3K4N A;  1FOW A;  1NH3 A;  2XPV A;  2F5V A;  3ZMU A;  2R7W A;  3ZMV A;  4HF2 A;  1FOY A;  4JOM A;  3JRB A;  2MSY A;  4L9J A;  1F43 A;  2CUZ A;  4DVY P;  3G4S I;  3ABU A;  4M3D A;  5FO5 A;  3CF2 A;  3M4O J;  2HTJ A;  3TMO A;  4LMY A;  1K6O A;  4I02 A;  5EFY A;  1SFO J;  3DFG A;  1LDK B;  3QYF A;  5IOY A;  2CJJ A;  1DP3 A;  2FEZ A;  1IZ1 A;  2PQ8 A;  3S3N A;  4C2M J;  4CGR A;  1X4O A;  5LGN A;  2PMZ N;  4OIQ F;  2DMN A;  4QSH A;  1SFU A;  3CDL A;  1A31 A;  2DPD A;  4HF1 A;  3RZO J;  2Y30 A;  4ZYE A;  2P4W A;  3FWE A;  1PDN C;  1TQP A;  3CCV I;  2EV0 A;  1ETQ A;  2KQR A;  3HKZ A;  2Y31 A;  3QP5 A;  1FWZ A;  2KP6 A;  1GVD A;  3BQY A;  2JK3 A;  1YW7 A;  4ZTJ A;  3GCM A;  2XDN A;  2HTS A;  1Z6T A;  3D1N I;  3QPL A;  3E6C C;  2IGO A;  2ZXW H;  3K4L A;  4ASN A;  5M5Y J;  4ENN A;  1Y0N A;  5FKL A;  2K5C A;  4XM3 A;  3LA3 A;  3OYH A;  3LAP A;  1ZLJ A;  4UNO A;  1H9T A;  2EZI A;  1U5T B;  2L4A A;  2A5W A;  2QGU A;  3NEU A;  6PAX A;  1RIO H;  3BJB A;  1UFM A;  2HI3 A;  1W36 D;  1MDM B;  1XTA A;  1Z6R A;  4OD5 A;  2Y9Y A;  3CC4 I;  1PUF B;  2ZOY A;  2RRE A;  2QKO A;  4NQW A;  4A3G J;  3SFZ A;  2VN2 A;  2CW8 A;  3FXQ A;  1OYW A;  3DTI A;  5K58 A;  1R4N B;  3HBL A;  5KAF C;  3AL0 C;  2LRD A;  4EMS A;  2MD5 A;  1H0M A;  4NNJ A;  3ULQ B;  3J80 Z;  4A5N A;  4XRM A;  3EUK L;  1I50 J;  1G2H A;  3I59 A;  3JRA A;  5KK1 A;  1T38 A;  1VQN I;  2KPM A;  3GTP J;  2BY2 A;  1SAX A;  2CUF A;  3G1L A;  2WY7 Q;  3BR6 A;  4M72 A;  2EFP A;  4IQJ A;  3H5R A;  2LY1 A;  2CYY A;  2JMW A;  2O0Y A;  3Q3S A;  3KCC A;  4EQQ A;  4S05 A;  3U9G A;  3U21 A;  3EDP A;  4U0Y A;  3JSO A;  1CF7 B;  4OIP F;  2O61 A;  1HXD A;  3SDB A;  5JR3 A;  3AQT A;  2XAQ A;  2GXB A;  4EM1 A;  4ESF A;  3JRG A;  1R36 A;  3PFI A;  3SZP A;  2STW A;  4OOI A;  1S72 I;  4LOC A;  1MGT A;  3VSL A;  1VF9 A;  1IXS B;  3ZOB A;  3W6J B;  1RR8 C;  3R6S A;  1V5G A;  4A3C J;  4N4N B;  3GXO A;  4I0B A;  3KKC A;  1HBX G;  2NAZ A;  5LHH A;  3G56 A;  3S2D J;  4XOR A;  3WE2 A;  1PYV A;  2F5D A;  3I4P A;  4H0E A;  3VB2 A;  3ZQH A;  1RRJ A;  1ETO A;  5HS9 A;  4KFC A;  3E7Q A;  2M3A A;  3DF8 A;  2Y75 A;  1S8N A;  1FMV A;  3B73 A;  3BHQ A;  2R7D A;  3KIO A;  1QU3 A;  3GYH X;  2IA0 A;  1VTN C;  1IG7 A;  1ZG5 A;  1MJB A;  4CSW A;  2EIK H;  1KQ8 A;  1TWG J;  4KIB A;  3BTI A;  2R7R A;  4NBQ A;  1ETY A;  4V2F A;  2XRO A;  2LFB A;  2GWR A;  5CVV A;  3LWJ A;  1ZGA A;  1FJL A;  2HEO A;  5D18 A;  4AWX B;  4AU7 A;  4BXX J;  2JQ7 A;  2RNG A;  2EQR A;  1SVM A;  5E20 A;  5J4V A;  5JHF A;  1S5L C;  3I55 I;  3HYI A;  3Q9S A;  4CUG A;  4E7H A;  1R00 A;  2JSC A;  2VQG A;  2O8K A;  5J40 A;  2K40 A;  2RAS A;  1S7A A;  4LD5 A;  3VOX A;  4BH9 A;  4D7N A;  4K2E A;  1BM9 A;  3VYS B;  2BXZ A;  4E7J A;  2YU3 A;  3W6V A;  5B3S H;  4MQ9 F;  2OD5 A;  4KIF A;  4HLY A;  3KLN A;  1SVL A;  3BJO A;  3K4C A;  4BDY A;  1WQ2 A;  1GLN A;  2HQR A;  1XCB A;  5L3B A;  5LEK A;  1MH4 A;  4BE2 A;  2ZNZ A;  2A6H F;  2X9D A;  1T08 B;  2IBD A;  2FQ4 A;  4XBF A;  4HYE A;  4IRG A;  2LMD A;  2F2E A;  2WTE A;  3KKD A;  1LVA A;  5DAJ A;  1HST A;  2XSJ C;  3NXC A;  3QU6 A;  3OYG A;  1RUN A;  3A02 A;  3GZ6 A;  4O3M A;  3Q5F A;  1MNM C;  1K78 A;  4DGW B;  2KKO A;  4C3J J;  2I8D A;  3BCA A;  2G0E A;  1E2X A;  4XSX F;  1IV6 A;  1E3P A;  4KN7 X;  4WX9 A;  3O60 A;  4KMU X;  1B9N A;  5H2F C;  1XGM A;  2OCE A;  3P9C A;  4RBO A;  2LBF B;  1VQL I;  3L00 A;  1DQU A;  4UUS A;  4X0G A;  3HOZ J;  3HOU J;  5CYV A;  3E6B A;  2JA6 J;  4I01 A;  5J1U A;  3S3O A;  2DFI A;  2IS2 A;  3F6V A;  2VE8 A;  2M7A A;  2RAE A;  1ZK8 A;  4AID A;  3GX4 X;  3CCR I;  1VFC A;  3LMM A;  3S14 J;  2RQP A;  3F6O A;  2QQ9 A;  4FT8 A;  2UZK A;  4I7H A;  1V54 H;  3WU0 A;  3DLA A;  4CCO A;  1WZ2 A;  3FBN B;  3PIO F;  3C7J A;  5L3F A;  3A2K A;  4F92 B;  4WCG A;  2COM A;  5FLV A;  1UG2 A;  3FXL A;  1ETW A;  1R23 A;  4OWR B;  5F27 A;  5HS8 A;  4OD4 A;  2EV6 A;  3HPG A;  1LQ1 A;  1QHG A;  2ZXI A;  3DLL F;  2ZO4 A;  4D9J A;  2JPC A;  4BY7 J;  1QZZ A;  3BCB A;  2HKO A;  1JT0 A;  2R5Y B;  1D0X A;  2V1D A;  2D2W A;  3ZN1 A;  1TC3 C;  1B1B A;  3FXO A;  1ZTR A;  3BR5 A;  2DYS H;  5DM7 F;  1IN5 A;  2DT5 A;  4A0X A;  3OOU A;  2EIL H;  2LP0 A;  3OS2 A;  3CMM A;  5JVG F;  1K61 A;  1AKH A;  2VOO A;  4RLQ A;  4M9X A;  2XB5 A;  3A0H C;  2G3B A;  1K78 B;  4L0Z B;  3OYC A;  3K0L A;  2GUH A;  1Z9C A;  3V78 A;  4PGH A;  5CVJ A;  3ANG A;  1T33 A;  2IPQ X;  2LY2 A;  1K7A A;  1U0J A;  2QVO A;  3F8M A;  2DDA A;  3HGY A;  2HOS A;  3DTE A;  3K4J A;  5EZH A;  2WAQ A;  1QRY A;  4TV7 A;  2BVM A;  1AKH B;  3K70 D;  1TZL A;  2E60 A;  1HW2 A;  4HLX A;  5M3F J;  2P0W A;  2L54 A;  3IUO A;  5LLQ A;  1KYZ A;  3ISP A;  3L2Q A;  1A35 A;  1LFP A;  3RSN A;  3PSF A;  2B0L A;  4JKZ A;  1J75 A;  3JW4 A;  4A0Z A;  1RPW A;  1O3T A;  4XLN F;  2Y0M A;  5EZG A;  3HTA A;  2M9H A;  1J09 A;  5AIP A;  1KQ9 A;  4ZDL A;  3HTJ A;  1FY7 A;  3Q0W A;  4FCY A;  2E1N A;  4LG0 A;  3HOV J;  1MH3 A;  1VQ8 I;  2DU9 A;  4A5M A;  3HEF A;  3F1B A;  2DK5 A;  3CO7 C;  2K85 A;  5D5U B;  4OIR F;  4HA8 A;  2PJR A;  1Z7L A;  2XGE A;  5KHD A;  2YSR A;  3VDX A;  1VQP I;  2HYJ A;  3OR1 C;  5TGT A;  3L2C A;  4JX5 A;  3LSP A;  2FBK A;  2HYT A;  1B8I B;  1NK2 P;  4YG2 F;  3S2H J;  2K3F A;  1FEX A;  2UV1 A;  1IAW A;  2KIF A;  3TKY A;  5D4R A;  3DPJ A;  2IU5 A;  1GDT A;  3P9T A;  2IGM A;  2X1E A;  3CES A;  3FM5 A;  1QNT A;  4IRH A;  3GFJ A;  3EUA A;  1IXC A;  2HZT A;  3FXU A;  4DW6 A;  3D5R C;  4Q5S F;  2RV8 A;  3BG7 A;  3GFL A;  4CCK A;  2JA5 J;  2BEO A;  4M3F A;  3RKW A;  3GBG A;  4KT5 C;  1YW9 A;  5D5X B;  2DG7 A;  2IVM A;  1J2X A;  2DA6 A;  1O57 A;  2KRH A;  4HOB A;  5ILS A;  1R49 A;  3HRU A;  1SD4 A;  5B66 C;  1V4R A;  3LFU A;  2L4M A;  3S3M A;  4OMY A;  1J9I A;  3BT9 A;  3FMS A;  4HNV A;  3JRD A;  1O3R A;  4EJO A;  1OR7 A;  2NYX A;  1QA6 A;  1B9M A;  1CQT A;  2VC1 A;  2JT1 A;  4CZZ A;  4DBQ A;  4E7K A;  3ELK A;  1ETV A;  5CVI A;  4GXO A;  1YYV A;  4EM0 B;  3MNL A;  2CRG A;  1BR2 A;  2DT6 A;  2E1M B;  2HR3 A;  2Z33 A;  2VPR A;  4KIG A;  2L7F P;  2UWM A;  3SZG A;  3S15 J;  5IYD J;  5FRO A;  4RB1 A;  2J5P A;  2I5U A;  3J81 Z;  5BQT A;  3ABK H;  1DPR A;  3CC7 I;  1USS A;  4S0H B;  3KP2 A;  4CGZ A;  2QQA A;  4PK4 A;  4L5J A;  3WTW C;  1KZH A;  4WWC A;  3GFM A;  1G3W A;  1Y1V J;  2FRH A;  4N0B A;  3TO9 A;  3MKZ A;  2BV6 A;  4UXN A;  3GTO J;  1V55 H;  1SAN A;  1PUF A;  4XLH A;  1FOK A;  5IT3 A;  1FIP A;  5J1Y A;  2R3S A;  3NRV A;  4U0V A;  3IH4 A;  3QYE A;  1WRJ A;  4LFU A;  1X2N A;  5E8G A;  1AU7 A;  5HLG A;  1YX3 A;  3S1M J;  4GCT A;  1UEL B;  2L02 A;  3BG6 A;  3CDH A;  1JTX A;  4D0P A;  2EIJ H;  2VJ4 A;  5D5W B;  1D8K A;  3L1P A;  3M9A A;  3QOE A;  2HWV A;  2E5N A;  2MAB A;  3N05 A;  1TT5 B;  1ZYR F;  4ZYD A;  4ACI A;  3PNY A;  2R7F A;  1QZY A;  3T6N A;  1FPQ A;  1POG A;  2HOE A;  1JKO C;  3RPU D;  5E1Z B;  2A2F X;  5FMP A;  4AC6 A;  2E35 A;  2MBF A;  2AHQ A;  5GAD J;  2Z9O A;  3BWG A;  1D3Y A;  1W5T A;  2XF5 A;  4LK0 F;  5K1Y A;  4I6Z A;  2YS9 A;  4HQE A;  3CC2 I;  1B59 A;  3JRE A;  2RN7 A;  4OAZ A;  3ZMT A;  2ETH A;  2JVH A;  1XS9 A;  3GZN B;  4P9U A;  1MW7 A;  3K8P C;  3FMR A;  1BA5 A;  1W7P B;  2F6C A;  5F64 A;  1TWC J;  1BL0 A;  4HNT A;  2E2J J;  4II2 A;  1T0F C;  1HKS A;  2FBH A;  2A6T A;  2HS5 A;  1HKT A;  2OI8 A;  5HAW A;  3AG1 H;  2BY0 A;  2XDV A;  1NG7 A;  4IPA A;  3OY9 A;  3EYI A;  3RI4 A;  1BJA A;  4YRV A;  1C0W A;  4HEA 2;  4HX7 A;  5IPA A;  4F3Q A;  4UY8 I;  5E3O A;  1IC8 A;  2X1D A;  4Y17 A;  3HUG B;  2UXN A;  4G6T B;  4A3F J;  4PDK A;  2DPU A;  3TED A;  3H35 A;  4UVB A;  4M6Y A;  2CMP A;  3KEY A;  3DBR B;  1DU0 A;  4YEL A;  5EDN A;  2A61 A;  4LG3 A;  1K6Y A;  3HTH A;  5DCM A;  2UXU A;  1SAU A;  1MBH A;  2H09 A;  2E7W A;  4JL3 A;  4J01 A;  4DQ2 A;  3OL4 A;  3LAJ A;  5JHU A;  3H3V K;  3OWT A;  3OSG A;  1E0E A;  3S16 J;  3R0A A;  2YUS A;  3RPQ A;  2FX0 A;  3QPT A;  2IA1 A;  2QF7 A;  2IS1 A;  4BEH A;  4DBR A;  1YIT I;  4RS8 A;  4IO9 F;  4UB8 C;  1OR7 C;  1R6R A;  1XCV A;  4M71 A;  2XSD C;  2HVS A;  3KNW A;  1KU3 A;  3AG2 H;  1PJR A;  2CV1 A;  1P7J A;  1IO2 A;  5BPI A;  2CGP A;  2QTQ A;  2KIQ A;  4BE0 A;  3ABL H;  2MC4 A;  2HQ5 A;  5HOO A;  2EB7 A;  1Z21 A;  3CME I;  2LG4 A;  1T39 A;  2W57 A;  1TLH B;  4AF5 A;  1LEB A;  4B48 A;  1KA8 A;  2KFD A;  1J0R A;  2V9K A;  1CGP A;  4RGX A;  4ON0 A;  3WTX C;  4IF4 A;  1BC7 C;  3WOD F;  4U7B A;  1ZRE A;  2A05 A;  3N4M A;  2VIX A;  3S32 A;  3ROU A;  2XPW A;  1KON A;  5FB2 A;  2WUI A;  3K2Z A;  3CO6 C;  2VKV A;  1WSU A;  3KX2 A;  1ZHF A;  1REP C;  2V4J C;  1VND A;  2W48 A;  3IHU A;  2VBY A;  4XSZ F;  3KP6 A;  2R5Z B;  1BI2 A;  1QPM A;  2BBY A;  1OJL A;  2WB1 A;  1P7I A;  2HQA A;  4AIJ A;  2DFE A;  1FIA A;  1IUY A;  3GVA A;  2BE5 F;  3F23 A;  4PSW A;  3DEW A;  4GYG A;  2CS3 A;  3ZGK A;  1EH7 A;  1PVE A;  1S7E A;  2V9V A;  2IRF G;  2XGC A;  1IXR C;  2CSO A;  2LVS A;  5FGM A;  3TO6 A;  1UJ8 A;  4FE4 A;  5DCM B;  2QWT A;  4J00 A;  5HLT A;  1JT6 A;  3K9T A;  1LKX A;  3HGG A;  3BPX A;  2KHM A;  3QP6 A;  1X3Z B;  2CU7 A;  4L9V A;  2PFB A;  2CQK A;  2FMY A;  2O5R A;  4XKW A;  5KAI C;  4XIC A;  1OCZ H;  4MTE A;  3FRQ A;  3TW6 A;  3HB9 A;  5C4Y A;  1JJ6 C;  3M8J A;  4L5E A;  3V7C A;  2FBQ A;  4Q47 A;  2MLK A;  1FC3 A;  1ZEL A;  2RQQ A;  3FKI J;  2R5Z A;  3S93 A;  2D6Y A;  2X4H A;  2LSO A;  2MGQ A;  3I0T A;  3BG9 A;  5GPC A;  4QIW N;  1W7P A;  2QCO A;  2PMH A;  4C3H J;  2VKH A;  5A2Q K;  3CTA A;  2IP2 A;  1BIB A;  1LEA A;  2E5Z A;  4L5I A;  4AVZ A;  2YVE A;  3F9K A;  1X1D A;  1WJ5 A;  1MKM A;  2VQC A;  1IV8 A;  5M5X J;  1D0Y A;  3PUB A;  3CUO A;  3MZ8 A;  4U88 A;  2ZSH B;  4Y52 J;  1OYI A;  3LOC A;  2OQR A;  1H88 C;  3DU6 A;  3GTG J;  1FYK A;  2KDZ A;  4PJL A;  1FSH A;  2H8R A;  3CJN A;  2OJE D;  4GYI A;  4MK6 A;  3MN2 A;  3OYL A;  4BJ6 C;  2M8G X;  3ZQ7 A;  2FXA A;  1LE8 A;  1WJF A;  2XAU A;  4MO7 A;  3O2P E;  4DZJ A;  3W2W A;  3EUH A;  5DUK A;  5HOD A;  2VKE A;  2R93 J;  2UUZ A;  3IUV A;  2B63 J;  1U3E M;  3IP4 B;  4JNN A;  1FOX A;  3DWL E;  1KU2 A;  3OS1 A;  2QKM B;  3VVZ A;  3K1M A;  2MH2 A;  5J47 A;  4V19 K;  4YIR X;  3BCG A;  2ADU A;  5M5W J;  3OYA A;  1YRN B;  3JAM Z;  2IJL A;  3O6B B;  1YI2 I;  2EK5 A;  3OYD A;  4XLE A;  3FKJ A;  4EAT A;  1ODD A;  3E7L A;  4KYW A;  2GIV A;  3AFH A;  2M7B A;  2O03 A;  1DUX C;  1SMY F;  3GTM J;  2O8X A;  1FSE A;  1MJA A;  2BYV E;  2EBI A;  3HUG A;  4XL9 A;  2DW4 A;  4BS9 A;  1FTT A;  1IRF A;  2ZBK A;  2HNH A;  3I54 A;  4GGG A;  2RGV A;  1UG0 A;  1OCO H;  5KCM A;  2VJ5 A;  1QHH D;  4B47 A;  3FIW A;  3H36 A;  1O7L A;  1FMW A;  4RGS A;  3FMQ A;  2W1O A;  3EPZ A;  3KP5 A;  5IY5 H;  1Y8R B;  3IKT A;  3RKX A;  1YO5 C;  2NVT J;  4C2U A;  3B6A A;  3KFW X;  1S6L A;  1SC7 A;  1R5I D;  1R1U A;  4O6J A;  2FF4 A;  2LC2 A;  1WVR A;  2QQB A;  2EWN A;  1SEU A;  4H4K C;  1FP1 D;  1QVT A;  2NOG A;  4BUP A;  2XIG A;  1JGS A;  4C30 A;  5HBU A;  2KIU A;  1WJE A;  3ABT A;  3BTC A;  3CCU I;  3KYD B;  1ZQ3 P;  2QSG X;  2QOP A;  3MKY B;  2KMU A;  1JE8 A;  3MAJ A;  3ECO A;  2FA5 A;  4C3I J;  4A3I J;  4ZZL A;  3ESW B;  2H6B A;  1J5Y A;  2A6E F;  3ZMD A;  2WAE A;  3O3K A;  3VYR B;  2A68 F;  4GCL A;  2XVC A;  1TL8 A;  1F1Z A;  4CZC A;  3DPT A;  2X1C A;  5FRM A;  1Y0U A;  3KEQ A;  3KP7 A;  1WKM A;  3PQK A;  4DNC A;  1DP7 P;  2E7X A;  2HOA A;  1ACI A;  2MFZ A;  4KUM A;  3F8N A;  3F8F A;  2XB0 X;  1IDZ A;  5GPA A;  4LK1 F;  5IP7 J;  1BOA A;  2B3W A;  2HXO A;  3CJQ B;  3I71 A;  2WA0 A;  3LSK A;  2VT2 A;  2DOF A;  1WJD A;  3ZXS A;  1IRX A;  3JRI A;  4NDL A;  1MSE C;  5EYR A;  4MFE A;  1O3Q A;  4M6X A;  3CCQ I;  1YX5 A;  3HHG A;  1UI5 A;  2F4O B;  2EFO A;  3GUD A;  3EET A;  1NTC A;  3OSF A;  3J81 K;  1UAA A;  2ZXH A;  1UCR A;  3CLQ A;  4EGY A;  2JTV A;  2IAI A;  4QPO A;  2FU4 A;  4WF2 A;  1BI3 A;  2K27 A;  4KNY A;  3ZN0 A;  1UHW A;  3JRH A;  1B72 B;  1B72 A;  5F0C A;  4RB0 A;  3TL4 X;  4AC0 A;  2PG4 A;  1TTY A;  1TP4 A;  5JI6 A;  3RTR A;  3K4B A;  3CCS I;  1W7P D;  2DFF A;  1YRN A;  3I5U A;  1SGM A;  3MEX A;  3HOW J;  2A5Y B;  2EFW A;  2VL8 A;  1HW1 A;  5ILU A;  3ON4 A;  5C44 J;  3CDI A;  2V1U A;  1D5V A;  3OR2 C;  3QKX A;  1JKQ C;  5D19 A;  2QIB A;  2DBB A;  2EV5 A;  3LQQ A;  1T98 A;  4U87 A;  1LFU P;  2BGC A;  1BBY A;  3ECH A;  3HRM A;  3AG3 H;  4ZDP A;  2CV0 A;  1HCR A;  1MMD A;  3E0J B;  3RKQ A;  1XGO A;  3LA7 A;  4RLF A;  1LE8 B;  5EF6 A;  2NNN A;  2PLY A;  1IF1 A;  4A69 C;  4CH7 A;  3O8H A;  2JRT A;  2HKX A;  2K02 A;  3TOB A;  4HSR A;  4D5F A;  2F07 A;  5D1R A;  1CF7 A;  1L3L A;  3GTK J;  1OKR A;  3NNR A;  3JAM K;  2W53 A;  2FNP A;  4I98 B;  4EVI A;  3U1D A;  2LKP A;  2A69 F;  2Q1Z B;  2OBP A;  3ZCO A;  3E5U A;  3CQZ J;  4UB6 C;  1FBQ A;  1I3A A;  5JLW A;  4YZE A;  2K9S A;  3QAH A;  4CCJ A;  3LJL A;  1MSF C;  2BY1 A;  3NQO A;  4D5C A;  2V79 A;  4FX0 A;  2ELJ A;  4BGD A;  1OYY A;  3COA C;  1AOY A;  3BY6 A;  2A07 F;  2Q8K A;  2QSF X;  3JR9 A;  5DV5 A;  1VQ7 I;  3H1C A;  4RAG A;  3FXM A;  5AIQ A;  2FOK A;  4NQW B;  2JSP A;  4Y15 A;  1Z1D A;  3AQS A;  2DA1 A;  3J80 K;  4II3 A;  4HKU A;  5DD4 A;  4HV6 A;  4YFN F;  2ISZ A;  2DOE A;  5AON A;  2AXT C;  4EV0 A;  4KMF A;  5HVQ C;  2XV4 S;  2L7M P;  1R5H A;  1N25 A;  4YIF A;  4RDU A;  1XMX A;  4IZZ A;  4A3B J;  1R5G A;  3W2V A;  2ACJ A;  1YG2 A;  1EF4 A;  4PJ0 C;  1U9N A;  5DEQ A;  4A3D J;  1T56 A;  5D8K B;  3GFI A;  5FKM A;  4AUX A;  3M8E A;  3WTU C;  2GOM A;  1P4W A;  2ZME A;  4XOP A;  5LRR A;  4JX4 A;  3I56 I;  2E71 A;  4XKV A;  5LD2 C;  2ZJQ F;  2GXG A;  4CDG A;  3UR3 C;  3K10 A;  2OCC H;  2H1L A;  1ZKG A;  4QTR A;  1UHM A;  2LNB A;  3DXJ F;  3PM1 A;  4DYQ A;  5H6R A;  4YFX F;  4QLC U;  5HSZ A;  2X0L A;  3QPS A;  1ZLK A;  1IDY A;  2WBM A;  3K69 A;  1P92 A;  5DYM A;  3IV5 A;  4B43 A;  4WIB A;  1T95 A;  5F08 A;  4L9T A;  4NC8 A;  2ZJP F;  4F91 B;  4XID A;  1I3Q J;  1MBK A;  4XRS G;  3K4K A;  5HNH A;  3P9I A;  2ME6 A;  1I1S A;  3E6M A;  2IEK A;  2RC4 A;  3V7R A;  4HDU A;  2OTJ I;  4E70 A;  3T8R A;  3GTQ J;  1JHH A;  3WGH A;  3S8P A;  2AQE A;  3H3U A;  2NNY A;  1SVO A;  1MBE A;  3JRC A;  2Q2E A;  3K1P A;  5DTD A;  3PSI A;  4HQM A;  2DCE A;  2M1B A;  1XSV A;  2ZXJ A;  5JLX A;  2QBY B;  3S1Q J;  3L7W A;  4XON A;  1KQ0 A;  2XAF A;  3BRO A;  2DOA A;  3M1C A;  2O3F A;  4RGU A;  1X19 A;  5IYB J;  2X6Y A;  3WG7 H;  2K7L A;  4PFO A;  2J5O A;  4R79 A;  3L2W A;  2NVU B;  1FBU A;  3ZPL A;  5ILV A;  3VW0 A;  2LLK A;  3GLX A;  4BY1 J;  2EH3 A;  3H0G J;  3FXK A;  3SJM A;  1R9T J;  1W0U A;  2CG4 A;  2WV0 A;  1TWH J;  1RC9 A;  2MG4 A;  1WJB A;  4M9S A;  4M73 A;  4RM2 A;  3BZC A;  4JYK A;  1PUE E;  4M3G A;  4FE7 A;  1ZG3 A;  2BZT A;  3H9J A;  2K3P A;  5FKO A;  3SEZ A;  2VOD A;  3FBI B;  2R7Z J;  2JUC A;  4IRV A;  3WGG A;  4XK4 A;  4B4C A;  1ONV A;  2LKS A;  4P1W A;  3EUP A;  1RZ4 A;  2LK2 A;  3BZ6 A;  5LFA A;  3CLO A;  1NK3 P;  3HC7 A;  4B09 A;  4BHC A;  4LLL A;  2XAG A;  4WXH A;  4D7M A;  1AWC A;  1Q1H A;  2FOW A;  4WK8 F;  3ERE D;  1B4A A;  1E3O C;  2K9L A;  1VI0 A;  3CJD A;  1WI3 A;  2P5V A;  2R7O A;  3GZI A;  3HXL A;  2DT7 B;  4M3E A;  1NG6 A;  4BJT A;  4CA0 A;  2RNJ A;  3LSI A;  4HW0 A;  2KRF A;  2M5W A;  1NHA A;  2QKL B;  2P6S A;  4V2G A;  2LYC A;  4XMY A;  3QYB A;  2DK8 A;  1JKR C;  2VBW A;  3B02 A;  2H6C A;  2VJI A;  3MCZ A;  4M3B A;  1U5T A;  3E1S A;  4RAF A;  4G7H F;  1HOM A;  3ZR8 X;  1RKT A;  3OV8 A;  5FD5 A;  4DJA A;  3LWF A;  5CKT A;  5ERI A;  2XGX A;  3K7A J;  5CVU A;  3IL2 A;  3HDD A;  3BDD A;  2LD5 A;  4IHV A;  3G2B A;  3PNT A;  4JP0 A;  4Y13 A;  3QQA A;  5D6E A;  1V3F A;  3D0S A;  3MKL A;  1ON2 A;  4RA2 A;  5H20 A;  1DGW Y;  2CWE A;  1T2K A;  1U78 A;  5FRN A;  2BY3 A;  3I64 A;  2AO9 A;  2WAQ N;  1JJ8 C;  4ABZ A;  4GO1 A;  1Y39 A;  3TOA A;  1Q1V A;  5TJJ A;  1QPI A;  1L0O C;  1SD6 A;  4OU0 A;  5K5O A;  4P9F A;  4IXA A;  4KA4 A;  2VPL A;  4WXC A;  4XQF A;  5EEA A;  3TO7 A;  4XLF A;  3VOD A;  3KZY A;  2ECB A;  2B1E A;  2WGB A;  3DP7 A;  4I99 C;  1Z77 A;  3TP0 A;  3GTL J;  2DG8 A;  4KIC A;  1OCC H;  4AM3 A;  2LOO A;  4G94 A;  3KP3 A;  2FJ1 A;  3CZ6 A;  1UMQ A;  2F5E A;  5CQE A;  2B7E A;  5E18 F;  2Y0S N;  4FTH A;  2W24 A;  1YLF A;  1RET A;  5E8I A;  5HDG A;  5GTH C;  3WTS C;  2RHA A;  1O4X A;  2CQN A;  1QQI A;  4MQV A;  1BW6 A;  2QLZ A;  2XKO A;  2IA2 A;  2O7O A;  4XN3 A;  2K86 A;  3WE3 A;  2CFX A;  4YII A;  5IT9 K;  4ME9 A;  2CQQ A;  2LR8 A;  2DLL A;  2L0K A;  2D5V A;  3HIM A;  1TQM A;  5E1W A;  1JUP A;  3PUF A;  1TWA J;  1IN4 A;  5CXI A;  2NX4 A;  1TNS A;  3PFY A;  3FIS A;  3F21 A;  3IKV A;  3GWZ A;  1ZG1 A;  3QWL A;  2K9M A;  5HNF A;  3IRR A;  1W1W E;  1V5E A;  5DS9 A;  2G7G A;  1ENH A;  1JUS A;  2TCT A;  5F1R A;  1JUM A;  1XGS A;  3SYT A;  4PSX A;  4BHP A;  3FK6 A;  3G7R A;  3PNV A;  2DMQ A;  4A6D A;  2Y2Z A;  3L9F A;  1ITY A;  2EJR A;  3CUQ C;  2HGC A;  1B8I A;  3D5S C;  3C18 A;  3HJE A;  2KJB A;  5FLX Z;  1WH7 A;  4U7D A;  5C4J J;  2E2H J;  1A6Q A;  2PJR B;  3IAS 2;  2ZY9 A;  1S9H A;  1J59 A;  1OIS A;  1ERD A;  5IP9 J;  2L9S A;  1ULY A;  1K83 J;  1T6S A;  4P96 A;  5J3L A;  4IHW A;  5ICF A;  3WTY C;  3ZQQ A;  2PEX A;  4MFD A;  4BDZ A;  3CRJ A;  4RB2 C;  1YJ9 I;  4KDP A;  3PL8 A;  2DI3 A;  3L2U A;  4A2U A;  2ELK A;  3DV8 A;  4JK1 X;  4E7L A;  2LKX A;  5BMZ A;  2GXA A;  1O7F A;  3SWH A;  1WGX A;  5FKK A;  2DAO A;  1N77 A;  2G7H A;  2L5Q A;  3EYY A;  2FNA A;  2GEN A;  3BR0 A;  3BOQ A;  3RDI A;  5BNG A;  3DCF A;  3LST A;  3EQL F;  3HOT A;  2VLA A;  4PCQ A;  1MNE A;  2GA2 A;  2STT A;  3GF2 A;  2X6X A;  2COB A;  2KZV A;  2JRM A;  2CUJ A;  5E1X A;  3A03 A;  2X48 A;  3CF5 F;  3LHQ A;  2F5F A;  2IGN A;  3F0C A;  5H6Q A;  2VON A;  2IXS A;  2LTP A;  3RQ4 A;  4HRI A;  1G6N A;  4E6K G;  3A0B C;  2YU9 J;  3C2H A;  2P8T A;  2ZME B;  1GUU A;  3CMA I;  2B9S A;  2GA1 A;  4EJT A;  3G3Z A;  2UXI A;  4DZP A;  1P2F A;  1D1B A;  5EEG A;  3OS0 A;  3ZMZ A;  3PAS A;  3KPH A;  4E7Z A;  3HZJ A;  4RAZ A;  3FHN A;  2VE9 A;  2ZJR F;  2G7S A;  5EGO B;  4B3A A;  3FDY A;  4R1H A;  3BG3 A;  2ZSI B;  1R22 A;  4Q4Z F;  2IS4 A;  2LH9 A;  1WHU A;  3LSH A;  4Y4R A;  5F1J A;  5TIS C;  4FAS D;  2CW0 F;  1FX7 A;  4ITV A;  3DBL B;  4A3M J;  2HPI A;  2N8G A;  1MND A;  5EJC A;  4CO8 A;  3BNI A;  5FGL A;  2V9P A;  1HDP A;  3CP2 A;  5B1A H;  2Y0S A;  1UHS A;  5JVT A;  3MMY B;  4IHS A;  1EH8 A;  2NVX J;  3HOY J;  5LGU A;  4CXF A;  2D45 A;  1T8I A;  1S7O A;  2BW3 A;  2EZH A;  2AQF A;  1SFE A;  1IN7 A;  4P55 A;  3KZ9 A;  3HRT A;  1XG1 A;  1FNN A;  1GV2 A;  1Z3Y A;  3QRF F;  1X1A A;  2PBI A;  3BR3 A;  1PP8 F;  1XMA A;  3DTK A;  1YJN I;  3F8C A;  3HSF A;  2M0C A;  4EJU A;  4ENJ A;  5BOX A;  2KIM A;  2X51 A;  1HDD C;  2M45 A;  1HF0 A;  4HAM A;  3A01 A;  2XRN A;  2YX4 A;  4NUB A;  2TRT A;  2LRE A;  1Y1W J;  1OCP A;  4G8X A;  2MW8 A;  3T1B A;  3LSM A;  2Z2S B;  1K4T A;  3V8K A;  1U8B A;  3P5J A;  4ZDO A;  2XUB A;  3CJT B;  1U8R A;  2E2I J;  4GFB A;  4FX4 A;  2HPM A;  4MLO A;  4HNU A;  2MD0 A;  5DUI A;  3F8B A;  1WFX A;  2LBF A;  2VXZ A;  1J7K A;  4XRS A;  1X1B A;  4RB3 C;  1YHQ I;  5L3D A;  2A3S A;  3MZH A;  3JRF A;  5FFX A;  4PFP A;  3WU1 B;  3MWM A;  3I53 A;  1GXP A;  4HV5 A;  3B6C A;  3CP8 A;  3GTJ J;  4UUV A;  3ZMS A;  3S2W A;  3K70 C;  1YS7 A;  1JXS A;  2E36 A;  5IOZ A;  1OCR H;  1E17 A;  2PI0 A;  3W3C A;  3RH2 A;  1Z3X A;  3RPU A;  3X2Q H;  2ZKZ A;  5M3M J;  2VXD A;  3KET A;  2OZ6 A;  1ETK A;  3CCY A;  2Z1D A;  4CYC B;  1LDJ A;  2D1H A;  5HDN A;  1YIO A;  2PX9 A;  3SFI A;  2QWW A;  2Y48 A;  1XN7 A;  1U6G A;  2Y9Z A;  3S1N J;  3DPU A;  3JSP A;  3DEE A;  2LDU A;  3IH3 A;  2FML A;  4I2O A;  1UB9 A;  3H9Q A;  2DJI A;  2OTL I;  4AIK A;  2QEX I;  1IN8 A;  1IN6 A;  4IOC F;  3QOP A;  3AG4 H;  1GV5 A;  4UDS A;  4BAC A;  1I6X A;  1GT0 C;  1Y56 A;  1MIJ A;  1D1C A;  2ESH A;  3GW2 A;  3MFK A;  5F0F A;  3D5L A;  2XC7 A;  3OYM A;  1LVK A;  4MTD A;  3C07 A;  1W5S A;  3WU2 C;  3M1E A;  4OMZ A;  4G7O F;  1WWX A;  1QBJ A;  1TWF J;  4BEH B;  4EJV A;  2Q24 A;  3VTI A;  1N75 A;  3VVY A;  1YFH A;  1EH6 A;  2AS5 F;  4GFK A;  1O3S A;  5K7H A;  4XR6 A;  2VJJ A;  1V5F A;  2R4G A;  5F04 A;  4EEF G;  4M6V A;  3HTU A;  4IRI A; 
#chains in the Genus database with same CATH homology
 1FEX A;  3V6G A;  4BKX A;  4NN1 A;  4D5F A;  3DPJ A;  3P9T A;  2F07 A;  1GDT A;  2IU5 A;  3G1O A;  3BTL A;  5D1R A;  3GTK J;  3NNR A;  2OPT A;  4DW6 A;  2W53 A;  4NEL A;  2DA2 A;  2JA5 J;  4M3F A;  2WB1 N;  3GBG A;  4BBS J;  2VUM J;  3CQZ J;  2DG7 A;  4BBR J;  2DA6 A;  2JA8 J;  5JLW A;  4YZE A;  2K9S A;  3LJL A;  1MSF C;  4D5C A;  3IH2 A;  3BT9 A;  4HNV A;  3JR9 A;  3JRD A;  4B1R A;  2O9L A;  5EGO A;  2NVY J;  3S5R A;  2M2E A;  1CQT A;  3NI7 A;  3AQS A;  1ETV A;  2DA1 A;  4HKU A;  2HKU A;  2H1K A;  3MNL A;  2CRG A;  3BG5 A;  3HE0 A;  2YVH A;  1ZGW A;  3NRG A;  2L7M P;  2P81 A;  1Z0X A;  2VPR A;  4RDU A;  4A3B J;  1WCM J;  2L7F P;  3HOX J;  4EEF G;  3WHC A;  2DN0 A;  3S15 J;  5IYD J;  2DA7 A;  1ETX A;  1EF4 A;  2UXP A;  1U9N A;  4A3D J;  1ORK A;  1T56 A;  5FKM A;  4S0H B;  4AUX A;  3PPB A;  4JX4 A;  1Y1V J;  2ZCN A;  1JKP C;  3GTO J;  1SAN A;  1PUF A;  5FJ8 J;  5CW8 A;  2R92 J;  4A3E J;  1MBF A;  2ZCM A;  2DTZ A;  1ZKG A;  4QTR A;  1FIP A;  3PM1 A;  4DYQ A;  5J1Y A;  2DA5 A;  3ZQI A;  3IH4 A;  3ZQC A;  5FLM J;  3S17 J;  5HSZ A;  3ZQG A;  4DYR A;  3QPS A;  1X2N A;  3VVX A;  1IDY A;  3TP3 A;  1AU7 A;  4DYC A;  4X6A J;  3IV5 A;  2NP3 A;  5F08 A;  3LSJ A;  5C3E J;  3S1M J;  2NP5 A;  4GCT A;  4XID A;  1I3Q J;  1MBK A;  1JTX A;  4XRS G;  3RD3 A;  4PXI A;  2JA7 J;  2M34 A;  2K9Q A;  2ME6 A;  3L1P A;  1UI6 A;  4GCK A;  2IEK A;  4GFL A;  2ZOZ A;  2I10 A;  4JX6 A;  3GTQ J;  4A3J J;  4ACI A;  1BJZ A;  3LSG A;  2GBY A;  2L7Z A;  3VP5 A;  3ZQF A;  1AHD P;  2UXO A;  1MBE A;  1POG A;  3C2B A;  1LFB A;  3JRC A;  1JKO C;  5DTD A;  1IUF A;  2OF7 A;  5FMP A;  5JLX A;  1X58 A;  4AC6 A;  3S1Q J;  2AHQ A;  2NS8 A;  3HM5 A;  4I6Z A;  2YS9 A;  1JGG A;  4I76 A;  3MVP A;  5IYB J;  2REK A;  3BRU A;  3JRE A;  5E3M A;  2ZB9 A;  1XS9 A;  5IP6 A;  1I6H J;  2DA4 A;  2PBX A;  3CMY A;  2V57 A;  1RES A;  2ME0 A;  1BA5 A;  4L62 A;  1TWC J;  4A93 J;  1BL0 A;  3LNQ A;  2NVQ J;  2E2J J;  3VW0 A;  2LLK A;  2OI8 A;  4BY1 J;  2EH3 A;  5HAW A;  3QBM A;  2GLO A;  3H0G J;  5E3N A;  3SJM A;  1R9T J;  1W0U A;  2DMU A;  4Y7N J;  1TWH J;  3Q0U A;  2MG4 A;  4J19 A;  5IPA A;  5CXG A;  3NPI A;  1B8I B;  5E3O A;  2XPV A;  4JYK A;  1IC8 A;  4M3G A;  4FE7 A;  5FHP A;  4A3F J;  2JN6 A;  5FKO A;  2MSY A;  3JRB A;  1F43 A;  3TED A;  1XC5 A;  4M3D A;  2R7Z J;  4FIS A;  1DU0 A;  3HTH A;  5EDN A;  3M4O J;  4XK4 A;  2UXU A;  1MBH A;  4B4C A;  3EUP A;  5EFY A;  4JL3 A;  1SFO J;  5IOY A;  2LK2 A;  2CJJ A;  2K9N A;  1NK3 P;  1ZR2 A;  3H3V K;  4C2M J;  4D7M A;  3OSG A;  3S16 J;  4CGR A;  1E3O C;  2YUS A;  2WV1 A;  2PMZ N;  1VI0 A;  2DMN A;  3K2A A;  1WI3 A;  3CJD A;  4QSH A;  4W97 A;  2FX0 A;  3Q0V A;  3CRJ A;  3GZI A;  3OIO A;  2QF7 A;  3CDL A;  4M3E A;  3RZO J;  3O8G A;  2Y30 A;  1ETQ A;  3VW2 A;  2Y31 A;  4V2G A;  2XSD C;  3KNW A;  3SDG A;  1GVD A;  1OFC X;  1JKR C;  3JSJ A;  3BQY A;  2JK3 A;  2XGD A;  1P7J A;  4M3B A;  5IYC J;  4A3K J;  1HOM A;  2QTQ A;  3I4M J;  2XDN A;  1RKT A;  1MBG A;  2O7T A;  3D1N I;  2E1O A;  3QPL A;  2HQ5 A;  5M5Y J;  3K7A J;  2ZCX A;  5FKL A;  3HDD A;  2LD5 A;  4IHV A;  3VOK A;  4AF5 A;  4JP0 A;  2FD5 A;  3QQA A;  2EZI A;  3RZD J;  3MKL A;  3B81 A;  2XPW A;  1U78 A;  2WUI A;  2AO9 A;  2WAQ N;  3BJB A;  2VKV A;  4ABZ A;  1JJ8 C;  2HI3 A;  2GFN A;  1QPI A;  1Q1V A;  2Y9Y A;  2ZOY A;  1PUF B;  2QKO A;  3UKG A;  4A3G J;  2UXH A;  4CYC A;  1VND A;  2W48 A;  1JTY A;  2DMP A;  2NS7 A;  5K7F A;  5EEA A;  5K58 A;  3HBL A;  2R5Z B;  4W1U A;  3G1M A;  1OJL A;  1W0T A;  1P7I A;  2ECB A;  2WGB A;  1Z77 A;  1FIA A;  3TP0 A;  4XRM A;  3GTL J;  2DG8 A;  1F36 A;  1I50 J;  3DEW A;  1G2H A;  2FJ1 A;  1ZR4 A;  1UMQ A;  3JRA A;  5J1R A;  1S7E A;  2XGC A;  2LVS A;  2OER A;  2Y0S N;  4FTH A;  3GTP J;  4FE4 A;  2ID6 A;  2CUF A;  2QWT A;  3G1L A;  3LSR A;  1JT6 A;  3BR6 A;  3EGQ A;  1RET A;  2R5Y A;  3HGG A;  2RHA A;  1O4X A;  3NAU A;  1BW6 A;  2JMW A;  3Q3S A;  3T6N A;  2O7O A;  2CU7 A;  3AQT A;  4XIC A;  4ME9 A;  2CQQ A;  2LR8 A;  3FRQ A;  2L0K A;  3TW6 A;  3HB9 A;  2D5V A;  3HIM A;  5C4Y A;  1JJ6 C;  4L5E A;  3JRG A;  3I4N J;  1JUP A;  2FBQ A;  1TWA J;  4LOC A;  1RR7 A;  1BW5 A;  3A01 B;  3FKI J;  2R5Z A;  1VF9 A;  5CXI A;  2NX4 A;  3ZOB A;  2D6Y A;  3FIS A;  4A3C J;  2MGQ A;  5GPC A;  3BG9 A;  3KKC A;  4QIW N;  2QCO A;  3WHB A;  1MBJ A;  4C3H J;  3G56 A;  3S2D J;  5DS9 A;  2G7G A;  1ENH A;  1JUS A;  2XRL A;  2YVE A;  4ICH A;  3ZQH A;  1ETO A;  3E7Q A;  2X6O A;  2TCT A;  1JUM A;  5M5X J;  3FK6 A;  3G7R A;  3VUQ A;  2DMQ A;  4Y52 J;  2Y2Z A;  3LOC A;  1H88 C;  1ITY A;  1RKW A;  3BHQ A;  3GTG J;  2KDZ A;  3GEU A;  1B8I A;  1IG7 A;  2H8R A;  4MK6 A;  3BTJ A;  1WH7 A;  1TWG J;  3MN2 A;  3BTI A;  1WH5 A;  5C4J J;  2E2H J;  1ETY A;  4V2F A;  2M8G X;  2LFB A;  1LE8 A;  5H9T A;  4A3L J;  9ANT A;  3LWJ A;  4MO7 A;  5IP9 J;  1FJL A;  5D18 A;  4BXX J;  4DZJ A;  1K83 J;  4IHW A;  5J3L A;  5FKN A;  2EQR A;  3BR2 A;  5AQC A;  4MFD A;  2VKE A;  5HOD A;  2R93 J;  3PO2 J;  3IUV A;  2B63 J;  2LKX A;  2ELK A;  3M3Y J;  4JNN A;  1WGX A;  5FKK A;  2RAS A;  2O8K A;  3VVZ A;  2K40 A;  5E3L A;  3VOX A;  1A6I A;  4D7N A;  3BCG A;  2GEN A;  3BR0 A;  3COL A;  5M5W J;  5BNG A;  3DCF A;  1WPK A;  1YRN B;  3W6V A;  1DU6 A;  2COB A;  2R0Q C;  3S1R J;  4AYB N;  2DMT A;  3A03 A;  2X48 A;  3LHQ A;  3F0C A;  3E7L A;  2LTP A;  1MH4 A;  4MIM A;  3FK7 A;  2X9D A;  2HDD A;  2YU9 J;  2IBD A;  1GUU A;  2FQ4 A;  1H8A C;  3GTM J;  2UXI A;  4DZP A;  3PAS A;  3KKD A;  2EBI A;  5DAJ A;  3RQI A;  1FTT A;  3NXC A;  2G7S A;  3A02 A;  5F0H A;  4B3A A;  5EGO B;  1MNM C;  3BG3 A;  3ANP A;  4C3J J;  2G0E A;  3FIW A;  1OCT C;  1IV6 A;  5F1J A;  3O60 A;  2HOT A;  4A3M J;  2N8G A;  3BNI A;  4MXM A;  5FGL A;  4RBO A;  2NVT J;  1HDP A;  1UHS A;  3B6A A;  4UUS A;  3V78 A;  3TW7 A;  3HOZ J;  3HOU J;  3HKZ N;  2XPU A;  2NVX J;  2E19 A;  3HOY J;  1QVT A;  2NOG A;  2JA6 J;  5J1U A;  5HBU A;  2EZH A;  1X2M A;  2RAE A;  1ZK8 A;  3KZ9 A;  1VFC A;  3BTC A;  3S14 J;  2PZ9 A;  1ZQ3 P;  1XG1 A;  1GV2 A;  2QOP A;  3HTI A;  3BR3 A;  2HXI A;  4C3I J;  4A3I J;  2JJ7 A;  2EZK A;  4UUS B;  2M0C A;  4GCL A;  1HDD C;  1HF0 A;  5EG0 B;  3A01 A;  4IEJ A;  2TRT A;  3BQZ A;  1OCP A;  1Y1W J;  2MW8 A;  5FLV A;  1U9O A;  1U8B A;  2HOA A;  1UG2 A;  1ETW A;  4GFB A;  2E2I J;  5F27 A;  2XB0 X;  2EZL A;  4MLO A;  1IDZ A;  5GPA A;  5IP7 J;  5K7Z A;  4IHY A;  2HXO A;  4XRS A;  3VPR A;  4BY7 J;  2KT0 A;  1JT0 A;  2R5Y B;  3JRI A;  1TC3 C;  4NDL A;  1MSE C;  1H89 C;  5EYR A;  1ZTR A;  4MFE A;  3JRF A;  3BR1 A;  3BR5 A;  3B6C A;  1UI5 A;  3OOU A;  3GTJ J;  2VI6 A;  1NTC A;  2LP0 A;  2LY9 A;  4G12 A;  3OSF A;  5GP9 A;  1K61 A;  1AKH A;  5IOZ A;  1QVU A;  2XB5 A;  2IAI A;  3RH2 A;  3ON2 A;  2ID3 A;  2G3B A;  2G7L A;  5M3M J;  4KWA A;  2GM4 A;  1ETK A;  3CCY A;  2GUH A;  2CUE A;  4CYC B;  3JRH A;  1IJW C;  1B72 B;  5F0C A;  1B72 A;  4AC0 A;  2DJN A;  3ANG A;  1T33 A;  3CWR A;  3SFI A;  3HGY A;  2HOS A;  1D5Y A;  2DA3 A;  1YRN A;  5EZH A;  2Y9Z A;  1IRZ A;  1QRY A;  3S1N J;  1AKH B;  1APL C;  1SGM A;  3IH3 A;  3HOW J;  1NK2 P;  5M3F J;  1HLV A;  5C4X J;  1IGN A;  1GV5 A;  5C44 J;  3ON4 A;  4JKZ A;  4UDS A;  3QKX A;  2JWT A;  1GT0 C;  1JKQ C;  1RPW A;  3VW1 A;  1A5J A;  5D19 A;  5EZG A;  3HTA A;  2QIB A;  1LFU P;  2M9H A;  5F0F A;  3HTJ A;  3Q0W A;  4FCY A;  3PO3 J;  3HOV J;  1MH3 A;  2L9R A;  1FTZ A;  1HCR A;  3HEF A;  3RKQ A;  3F1B A;  3C07 A;  1TWF J;  1LE8 B;  5EF6 A;  2Q24 A;  5EG0 A;  2XGE A;  3VVY A;  3VIB A;  4GFK A;  2HYJ A;  4A69 C;  5K7H A;  4UUT A;  3O8H A;  4JX5 A;  2ECC A;  3NAR A;  3LSP A;  2CQX A;  5F04 A;  3ZQL A;  2HYT A;  4X1E A;  4M6V A;  4IHX A;  3S2H J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...