5K7FA

Crystal structure of apo aibr
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
184
structure length
179
Chain Sequence
RYRAILETAARLICDRGYEGTSMQEIAAACRMTKAGLYHHIQNKEQLLFAIMNYGMDLFEEQVLSRVQDIANPVERLRACMRHNILLVTRGWSKEVIIILHEGETRAFIDARKKKYVDFLEEAFSQASQQGLIRPVDPTVGAFSFLGMVLWIYKWFKPDGRLTDEQIADGMVGMLFPPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The AibR-isovaleryl coenzyme A regulator and its DNA binding site - a model for the regulation of alternative de novo isovaleryl coenzyme A biosynthesis in Myxococcus xanthus.
pubmed doi rcsb
source organism Myxococcus xanthus (strain dk 1622)
molecule tags Transcription
molecule keywords Transcriptional regulator, TetR family
total genus 69
structure length 179
sequence length 184
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17932 TetR_C_24 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 5k7fA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 5k7fA02
3QQAA 4A3IJ 1G2HA 1RKWA 3LNQA 4A3DJ 4A3KJ 3IUVA 4X6AJ 3DPJA 3HTHA 3FIWA 3FRQA 3BR5A 4JKZA 1OCTC 3MN2A 3KKCA 2M0CA 1H88C 2ZB9A 3SJMA 2OF7A 3RD3A 2ME6A 3WHCA 2Q24A 3UKGA 1FTTA 5IOZA 2DMPA 3F0CA 3WHBA 1AKHA 3ON2A 4L62A 1MSEC 1AKHB 2M34A 3JRAA 3BTIA 1HDDC 5DAJA 3ZQIA 3NRGA 2HOSA 1T33A 1JT6A 4XRSA 3RZDJ 3GTQJ 3S16J 3DEWA 3HTIA 4D5CA 5HAWA 4GCLA 3PO2J 3SFIA 3S2HJ 2OERA 2GENA 3PM1A 3IH3A 3JRBA 3FISA 2DN0A 3VW1A 3ZOBA 1TWAJ 1HCRA 2DA2A 2GUHA 1WI3A 3MVPA 2NX4A 2X48A 2H8RA 1TWCJ 3JSJA 1MNMC 1ETOA 1MH4A 1FTZA 2ME0A 2DA1A 5EF6A 3I4NJ 5F04A 3KZ9A 2W48A 2D6YA 3BNIA 2NVYJ 1JKPC 1IGNA 4D5FA 3JRHA 2DA6A 3JREA 2KDZA 2O7TA 1ZQ3P 1RKTA 2JA8J 2VPRA 2FD5A 3H3VK 4B1RA 5H9TA 3E7QA 4DYQA 3BR2A 2G3BA 2XPUA 2DTZA 5J3LA 1RETA 1Z77A 2FJ1A 2H1KA 2CQXA 3HIMA 1PUFA 2XB5A 2EBIA 5HODA 5GPCA 2HKUA 1WH5A 4GFKA 2DMUA 4A3GJ 3JRCA 4JX6A 5JLXA 2DMQA 1A6IA 2GM4A 1X2NA 2LFBA 3HBLA 3HGGA 2G7SA 5IOYA 2L7FP 3HTAA 2O9LA 1BA5A 3LHQA 3TW6A 3EGQA 3VVXA 1BJZA 1BW6A 2XGEA 2NS8A 4IEJA 2E1OA 1XC5A 2HQ5A 2IBDA 4BY7J 5CXGA 5FHPA 2VI6A 2ID6A 2B63J 2UXIA 2P81A 2R5ZB 3H0GJ 3MKLA 1RESA 5M5YJ 1ZR4A 1JT0A 1R9TJ 4NELA 3A01B 3NI7A 3OOUA 1UMQA 5F0CA 4D7NA 3HOXJ 3M4OJ 3CWRA 5C4JJ 5M3FJ 3JRDA 2D5VA 1NTCA 5IP7J 1F36A 4A3EJ 2DG8A 1IC8A 2DA3A 3FKIJ 1TWGJ 2L7ZA 3B6CA 4IHWA 2DMNA 4KWAA 3S2DJ 3HM5A 3S1QJ 1JUMA 3HKZN 1WH7A 4FE7A 2XPVA 9ANTA 2ECCA 1IDYA 2QIBA 4DW6A 2EH3A 3JR9A 4CYCB 2CUEA 2G0EA 4HKUA 2Y2ZA 3Q0UA 5K7ZA 1VF9A 4C3JJ 2LTPA 2TRTA 2K40A 3HOVJ 1IG7A 1ETWA 2WAQN 4QTRA 1LFUP 2Y9YA 3GTLJ 4UUTA 2XSDC 3A02A 4W97A 3VW2A 2M8GX 5EZGA 3HEFA 1IDZA 3S1NJ 5F27A 2UXHA 2JA5J 2R5YA 1Q1VA 1TWFJ 1JKQC 2JN6A 4MXMA 1IRZA 2NVXJ 2EZKA 4JP0A 3BR1A 5M3MJ 4M3FA 1SANA 5IYDJ 1U9NA 4AC6A 1X2MA 3OSFA 4V2FA 1MSFC 4ICHA 2M9HA 3LSPA 4M3GA 2WGBA 2NVTJ 2QOPA 4M3EA 3GBGA 2DJNA 3VPRA 4MLOA 2MGQA 1GDTA 2E2JJ 2HYTA 4XICA 2X9DA 2XGDA 1W0TA 2MSYA 3Q0WA 4AYBN 4X1EA 2V57A 3TP0A 2HYJA 1RR7A 3NPIA 2L7MP 2VUMJ 4BKXA 1GV2A 1EF4A 2CUFA 1ETXA 3FK6A 3V78A 1MBFA 2DA4A 4MO7A 3RQIA 3TP3A 4AF5A 1AU7A 1QVUA 1JTXA 2Y31A 4A69C 3G1OA 3PPBA 1AHDP 5FKMA 2ZCMA 2NP3A 2QCOA 3G1LA 2FBQA 3CDLA 3P9TA 2PBXA 4DYCA 2NS7A 3W6VA 3GZIA 3Q0VA 1DU6A 1U78A 3GTGJ 1B72A 3TEDA 2R93J 3LSGA 5GPAA 3LOCA 5E3LA 3MNLA 2PZ9A 2AO9A 1BW5A 5EZHA 2NVQJ 1ETKA 4PXIA 2Y9ZA 2GLOA 3O60A 1H8AC 1QVTA 2LKXA 4MFEA 5M5XJ 2E19A 1IV6A 2L9RA 1YRNA 2JA7J 1W0UA 3D1NI 2JMWA 3BR0A 3BTJA 1IJWC 3BG9A 2ELKA 3O8GA 3VW0A 2N8GA 3QPSA 3B6AA 5F08A 2XB0X 1JJ6C 2TCTA 2COBA 5EG0B 2REKA 4A3JJ 3BQYA 2OPTA 1P7IA 3S1MJ 1K61A 3G7RA 3CRJA 3BR3A 3IH4A 3BT9A 1JJ8C 1TC3C 3COLA 2JK3A 3EUPA 4ME9A 3OIOA 3ZQGA 3RKQA 1TWHJ 4M3DA 2FQ4A 5FKLA 3S17J 1I3QJ 5C3EJ 2Y0SN 4ABZA 4JL3A 3LSRA 5BNGA 2UXOA 2AHQA 4FCYA 2GBYA 3QPLA 2ID3A 3TW7A 1ZGWA 4GFBA 3GTMJ 2ZCNA 5GP9A 2R5YB 4I76A 1JGGA 2VKVA 1Z0XA 2XDNA 2CU7A 4BY1J 3ON4A 2G7LA 5DTDA 3VVYA 2L0KA 4W1UA 4BXXJ 5D19A 1K83J 5IYBJ 3S14J 1S7EA 4Y7NJ 2LR8A 2CJJA 1H89C 3BTLA 1FIPA 2MG4A 3HDDA 3GTOJ 4Y52J 4QSHA 1ORKA 2E2IJ 1GVDA 2WUIA 2RASA 4JX4A 5FLMJ 1GV5A 1WPKA 5EGOB 2LLKA 3C07A 4MK6A 4EEFG 2XPWA 1MBJA 1ZR2A 4XRMA 2R92J 4JX5A 1P7JA 1HF0A 4FE4A 2DA7A 2R0QC 1LE8B 1O4XA 1IUFA 1ITYA 1I50J 1APLC 2O8KA 2G7GA 1X58A 5JLWA 1JKRC 2IAIA 3DCFA 4IHXA 3ZQHA 3RZOJ 5FLVA 1UHSA 1DU0A 2XGCA 3NARA 3CQZJ 2R7ZJ 1MBHA 1OFCX 2JWTA 1GUUA 2LK2A 1LFBA 1ETYA 1NK2P 2I10A 2E2HJ 3M3YJ 5C44J 1VFCA 4MIMA 2CRGA 1GT0C 2ZCXA 3CJDA 2RHAA 1B72B 3NAUA 4CGRA 2EZHA 4UDSA 2FX0A 4G12A 3JRGA 2JA6J 3HE0A 5C4XJ 2KT0A 2K9SA 4XRSG 3S1RJ 3I4MJ 1UI6A 5E3MA 2ZOYA 3A03A 4J19A 1ZK8A 4UUSB 3BQZA 5F0HA 2XRLA 3L1PA 4UUSA 3NNRA 2LP0A 4I6ZA 1WGXA 5M5WJ 1OCPA 3E7LA 3CCYA 3ANGA 3JRFA 3V6GA 4A3LJ 1FEXA 5HBUA 5CXIA 1ETVA 2DMTA 4V2GA 3IV5A 1YRNB 3G56A 5J1RA 2HXIA 2QF7A 1ZTRA 2YS9A 5DS9A 1U9OA 5F1JA 3NXCA 4GCKA 3FK7A 4YZEA 3VIBA 2UXPA 1OJLA 5EDNA 2HI3A 1E3OC 4C3IJ 1JKOC 5F0FA 2DG7A 1JTYA 2RAEA 1ETQA 2R5ZA 3AQSA 5EFYA 5IP9J 4D7MA 3VUQA 1PUFB 3HTJA 3JRIA 3PO3J 5IYCJ 4RDUA 1UG2A 3VVZA 3BR6A 3QKXA 2YVEA 2DA5A 3BCGA 3BG3A 2EZIA 5IP6A 1HOMA 2F07A 3BG5A 4NDLA 3HB9A 5E3OA 3SDGA 3BHQA 1BL0A 2LD5A 4NN1A 1VNDA 2ECBA 4MFDA 2UXUA 4M3BA 3HOYJ 5J1UA 1A5JA 3ZQCA 4XIDA 1MBKA 5K7FA 3F1BA 2NP5A 2YUSA 4BBRJ 2NOGA 1LE8A 2JJ7A 4QIWN 2K9QA 4B3AA 4A3CJ 1JUPA 3BRUA 3K7AJ 2EQRA 2MW8A 3LSJA 3Q3SA 1NK3P 1F43A 1Y1WJ 2LY9A 4BBSJ 2LVSA 3S15J 2YU9J 4A3BJ 1RPWA 3T6NA 4A3FJ 2IU5A 5K7HA 3RH2A 2HOAA 5FKNA 2X6OA 2W53A 4ACIA 2M2EA 4XK4A 4C2MJ 2GFNA 5FMPA 1VI0A 4DZJA 5EEAA 4JNNA 3KNWA 2QTQA 5EGOA 1FIAA 4DZPA 1FJLA 1POGA 4FTHA 1ZKGA 1MH3A 4FISA 3HOWJ 1T56A 3VOXA 1SGMA 4IHVA 3B81A 1MBEA 3HOUJ 5J1YA 2WB1N 1HLVA 5FJ8J 2HOTA 5E3NA 4CYCA 3GTJJ 3C2BA 4L5EA 3GTPJ 3HOZJ 1HDPA 4A3MJ 3K2AA 5AQCA 2WV1A 1XG1A 1B8IB 3IH2A 5CW8A 1MBGA 3OSGA 1I6HJ 4C3HJ 1B8IA 2VKEA 3HGYA 2HXOA 3AQTA 2YVHA 4B4CA 4A93J 2K9NA 1UI5A 4IHYA 3VP5A 3LJLA 4RBOA 4HNVA 3O8HA 3LWJA 2O7OA 4AUXA 5IPAA 2OI8A 5D1RA 3GTKJ 3CMYA 1D5YA 1XS9A 2CQQA 2ZOZA 3BTCA 5K58A 2PMZN 1WCMJ 2HDDA 2Y30A 2QWTA 5EYRA 5C4YA 1QPIA 3GEUA 3ZQLA 2IEKA 3BJBA 3G1MA 3A01A 5FKKA 1QRYA 3ZQFA 3VOKA 4AC0A 2EZLA 4GFLA 4M6VA 3PASA 2QKOA 5HSZA 5FGLA 5FKOA 4JYKA 4LOCA 4DYRA 1CQTA 4GCTA 1ENHA 5EG0A 3ANPA 4S0HB 5D18A 1SFOJ 3KKDA 1Y1VJ 1U8BA 1JUSA 3QBMA 3S5RA
chains in the Genus database with same CATH superfamily
4KMUX 2JZYA 3CLQA 4NQWA 2OV7A 2Z2SB 3OYLA 2MBFA 3WU0A 4A3DJ 1R5HA 4GYIA 4A3KJ 2A6EF 4G8XA 3F22A 4X6AJ 2HTJA 4CCKA 3K70D 2DK5A 2PMHA 2M0CA 4ZZLA 1WJEA 2HYFA 2QKLB 2ZB9A 3PUFA 3SJMA 2OF7A 5ICEA 2BEOA 2LBFA 4HW0A 3UKGA 2HOEA 2DMPA 1O3RA 2ADUA 3RTRA 1FOKA 2H8WA 2M34A 1HSTA 3NRGA 2GIZA 3CZ6A 5J4VA 3W6KB 3TL4X 1U8RA 3DEWA 3O2PE 5KVRA 4B09A 3FBNB 1FMVA 3B73A 2ZXIA 3PO2J 5CQEA 2Q2EB 5FO5A 3N05A 3S2HJ 1X4OA 3VYUB 3EYIA 4BQAA 2QGUA 5LHGA 2QZ8A 1SD4A 4IL6C 4IHSA 1F9NA 2OQGA 1E3HA 1WI3A 3F8BA 1TWCJ 3GZNB 3JSJA 2W57A 4L18B 2ME0A 4HSTA 5F04A 4HV5A 4FQGA 1OCCH 2D6YA 2L9NA 3RYRA 4I99C 1IGNA 3QPHA 4CHUA 3CD6I 4A6DA 2DA6A 1RKTA 5LRRA 2RC4A 1YJNI 2H6CA 3O3KA 4FX4A 4HX8A 2E7WA 2PEXA 3OMYA 4B1RA 3KP6A 1SFUA 2IA2A 1OYYA 4HEA2 2XPUA 2DTZA 5J3LA 2ZJQF 3RIRA 3LMMA 3LSTA 3D0SA 3VEPA 2H1KA 3OYBA 1N75A 4YFNF 4AIJA 2XB5A 2EBIA 4PDKA 1R4NB 2DMUA 5LFAA 1JHFA 2VC1A 2R7OA 2NRAC 2GM4A 4XOPA 4DGWB 1WI9A 1X2NA 3DXJF 5JHUA 2G7SA 2OTLI 4EVIA 3H1CA 4CXFA 3O6BB 2XASA 5BQTA 4HX4A 1BJZA 2ESHA 4LB6B 5LEKA 2KZGA 3JAMZ 4AIDA 2E1OA 5CXGA 2ZSIB 4OD5A 5FHPA 1XD7A 2VI6A 5D5WB 2B63J 2UXIA 3CJNA 5J8CA 4BDZA 1XGSA 3ASOH 1R9TJ 4NELA 1ZRDA 1VQKI 1USTA 3DFGA 3KLOA 3NI7A 3OOUA 4KYWA 3CTAA 3OYNA 4HA8A 3OYEA 2IPQX 3F6VA 3RDIA 3ROUA 3SZTA 3MKZA 1LFPA 5IP7J 1VTNC 2O61A 1DPRA 1RIOH 4F55A 4F93B 2Y75A 3VYTB 4A3EJ 5FLXK 2F6CA 4BQOA 3PNTA 3FXUA 1RI7A 3FKIJ 3GFMA 3FM5A 3B6CA 4KWAA 2DK8A 3HSRA 4M9SA 2FBHA 2KPMA 2DI3A 5A2QZ 4HDUA 5EEHA 4ENJA 4IVNA 4Q5SF 5DUKA 1IDYA 5KAFC 2QIBA 4DW6A 4YRVA 2VT3A 1DPUA 5EEGA 2EFQA 2CUEA 4HKUA 4B44A 1QBJA 1A35A 1VF9A 3KP3A 5JVGF 2R7UA 2WY8Q 2GWRA 2LTPA 4U9NA 3F72A 1ETWA 2A61A 1LFUP 4CGZA 2IRFG 4A5NA 4UUTA 2HZTA 4WWCA 3G6EI 3VW2A 1B4AA 3DLLF 1XCBA 2DPDA 4YIIA 4DJAA 3H5NA 2WWYA 5LD2C 2R5YA 1TWFJ 2E34A 3CUQC 1G3YA 5FLXZ 3OYKA 2EZKA 2NS0A 5HLIA 3BR1A 3COAC 2QYOA 1U9NA 3ECOA 4AC6A 1HQCA 2VKHA 2WGBA 1WJBA 3GBGA 3T5XA 3HYIA 3T8TA 5CVJA 4EJOA 2MGQA 1MJ9A 2ISZA 3KP5A 1LEAA 2QENA 4P1WA 1GXQA 4XICA 2X9DA 2QBYA 2MH2A 4H0EA 4XLFA 1WRJA 3K8PC 1YJWI 4QPQA 1QA6A 2O5RA 1RR7A 2FOKA 1KYZA 2VUMJ 2JRTA 2JVHA 1E2XA 1TTYA 1GV2A 3HL2A 2EIJH 2CUFA 3A0BC 5ED4A 3V78A 3I71A 2DA4A 1IV8A 4MO7A 5HS9A 4AF5A 2Q0OA 1QVUA 1JTXA 2GA1A 1P4XA 3KE2A 3G1OA 3LAPA 4BJ5C 3ZMUA 1UAAA 1AHDP 3L2RA 4P96A 3ZMSA 2P5VA 3PPBA 2VJIA 1V3FA 3DTEA 2PJRB 2NP3A 2PBXA 4DYCA 2DTRA 1J59A 3W6VA 1VQ7I 4LMYA 3SZPA 1KU7A 3GZIA 2KDOA 1F1ZA 1Y8RB 3EUAA 5E20A 1U78A 1YJ9I 2R93J 4ANJA 4E70A 2CV2A 2DT7B 5FGMA 3E5XA 2X0LA 1G3WA 2PQ8A 3M8FA 2L01A 3B02A 3KETA 3CCMI 2H94A 2R4GA 3TGNA 3M1CA 5FFXA 3GWZA 2TDXA 4ZZDA 3UNGC 1QVTA 5D8KB 3KP4A 2FA5A 1V5GA 1R71A 1IV6A 2E19A 2JA7J 3CF2A 2DW4A 3FXMA 2VLAA 2JMWA 2FNPA 1OCRH 2LY2A 3B6AA 2G9WA 1NH3A 2M3AA 2TCTA 2COBA 2ZY9A 2REKA 2Z16A 2G7HA 2OPTA 3QPTA 3S1MJ 3KZYA 4LGWA 1DP7P 3CRJA 3BR3A 3IH4A 2BY2A 1JJ8C 1TC3C 3EUPA 3I58A 3ZQGA 2ACJA 4M3DA 1I3QJ 4GGGA 3PSIA 2M1BA 5FRNA 2WADA 5E17F 2EFWA 4N4NB 1Z7UA 4Y17A 2AHQA 4FCYA 3QPLA 2ID3A 1FBUA 1KQ9A 1UZCA 4OU0A 3GTMJ 5GP9A 4OIRF 2DLLA 3CLOA 1T08B 2QWWA 3C3WA 1JGGA 3ZMZA 3KEYA 3EYYA 2P5LC 1DQUA 3AL0B 2IJLA 4OAYA 2HKXA 4I0BA 2PJPA 2KRCA 1H89C 2L7KA 3HDDA 2L4MA 2LF8A 1GVDA 1YO5C 4HBLA 1FYKA 2XAGA 5J6XA 2VKDA 3HUGA 4JX4A 1ZAOA 3G3ZA 2FE3A 5DCFA 5EGOB 1GV5A 3C07A 3IRRA 2HFHA 1LPQA 1IXSB 4L9TA 4UB8C 5LGUA 3CDHA 1CF7A 2DA7A 1FYLA 1LE8B 3P9IA 4XOTA 3G4SI 4OMZA 1WVRA 2BXYA 2X1CA 5E8IA 2IAIA 5ILUA 2P0WA 4R1HA 1FOYA 3DWLE 1T2KA 3RZOJ 1O7FA 3FX3A 3NARA 4EGYA 1WJAA 4EATA 2JWTA 2O8XA 2LK2A 2XKOA 4OD4A 1FLIA 2FBIA 3J81K 1VQOI 1NK2P 2BBYA 2BVMA 4MIMA 1S9HA 2JA6J 1BN5A 3JRGA 3HE0A 2CW0F 3L9FA 5L3DA 3L2QA 3S1RJ 5L3CA 1XMXA 1VQMI 2XV4S 3OWTA 1J9IA 4NC7A 3DF8A 3RYPA 3W3CA 4Y3OA 4I6ZA 1WGXA 2CW8A 5GAEJ 3E7LA 4NQWB 2WV0A 3ANGA 3JW4A 1FEXA 2FQ3A 1HW1A 2IS6A 5CXIA 2P7CB 3WU2C 1TBXA 2EV0A 2JT1A 2HXIA 2QF7A 5J1RA 4S04A 5F1JA 3NXCA 3OR2C 4M9ZA 6PAXA 1J5YA 2BW3A 3H9QA 4AVPA 4YZEA 3MZHA 2HI3A 4C3IJ 1JKOC 3SXYA 5F0FA 4IQ4A 4KISA 2IGOA 5EFYA 3F21A 3MMYB 3I59B 2ESNA 4U88A 4HNUA 1PUFB 1K78A 1IUYA 1UHMA 1R00A 2DFEA 2EV6A 3VVZA 1IN7A 3QKXA 1BI3A 3HHGA 2FOWA 3BG3A 4LLLA 1HOMA 2XVCA 3HTUA 2A3SA 1IRXA 3JTGA 2RREA 1EH7A 1FP1D 4HDVA 3HOYJ 1A5JA 3QOPA 3VDXA 1MBKA 5K7FA 1FYMA 3I3LA 3M07A 4C2MA 2H1LA 2QQ9A 2NOGA 1LE8A 1S6LA 3V7CA 1MD0A 1LB2A 4A3CJ 1JUPA 3K7AJ 2KJBA 4NB5A 3CO6C 1F43A 4FX0A 2XUBA 2J5PA 1Y1WJ 5E1WA 1ODDA 4JOMA 5IT9Z 4E6KG 5CQGA 2IU5A 5K7HA 3MCZA 1AOYA 1BOBA 2M2EA 3HRTA 4C2MJ 2NNNA 1VI0A 5EEAA 3OYJA 4JNNA 3NQOA 4D9JA 1FIAA 1FJLA 4GO1A 4II2A 4FTHA 2KRFA 1MH3A 1Z9CA 2HQRA 1Z7LA 3HOWJ 5BOXA 4ESBA 1XGNA 2D1HA 5JR3A 2WAEA 1BOAA 2WB1A 3VWBA 4HOBA 4M72A 2K85A 1K6OA 2HOTA 3HOZJ 3WTVC 2KIFA 2W1OA 2YR2A 2M5WA 1XG1A 2WV1A 3OYCA 3RCOA 2YVHA 5CPRB 2GQQA 3AQTA 4A93J 1GVJA 3HSFA 5JFRA 2Y48A 2VBYA 3W2WA 2DU9A 4ZDLA 1MMDA 4EGZA 3GXOA 3IC7A 3S3MA 1TT5B 1K4SA 1XS9A 2CQQA 5K58A 1WCMJ 2Y30A 2OC6A 1YX5A 1MIJA 5EYRA 5C4YA 3ZCOA 1QPIA 4KDPA 1Y6IA 4PJNA 3FHZA 3BG7A 2WY7Q 3HG9A 3KZIC 4RAFA 1QRYA 3DLAA 4YFKF 2L54A 3VOKA 1B59A 3AG4H 4GFLA 2M0MA 2QKOA 1YX3A 5FKOA 4DYRA 5EG0A 3LL7A 2A69F 2OQRA 3K1MA 3BJOA 3RPUA 4CSWA 1YTYA 3KKDA 1JUSA 4II3A 3S5RA 3QQAA 4A3IJ 3ZRGA 1FBSA 1RKWA 2E1MB 3LNQA 1X3ZB 4S05A 3MAJA 3HTHA 5E1XA 2F5VA 3RKYA 4UVCA 3OS0A 2LSOA 4KT5C 4XN0A 3KKCA 3HHHA 2QSHX 3I4PA 3EUHC 3ISPA 2LDUA 1T38A 2ME6A 3J80K 2MFZA 2DDAA 2EFPA 1W7PD 2Q2EA 2YSRA 1AKHA 1Z21A 3JRAA 1HDDC 4UB6C 2HOSA 1DGWY 1T33A 1ZLJA 1JT6A 3GTQJ 3ABKH 4NBQA 3S16J 2B3WA 3GUDA 4D5CA 3HTIA 1R5ID 5HNHA 3KPHA 4XBFA 5L3GA 5TISC 2P7VB 2GENA 1P9QC 2E5ZA 2KP6A 1OYWA 4RM2A 1DGRM 5DCMB 3JRBA 3TMOA 4BXFA 3FISA 2DN0A 3T0YA 3NEUA 4XL9A 3ZOBA 3U1KA 1HCRA 1DUXC 3DPUA 4YIFA 2EFOA 5ILSA 4D1QA 3QYEA 1ETOA 3I4NJ 3DTIA 2CQ7A 5LEJA 3BNIA 3JRHA 4C2TA 1Y8QB 4HQMA 4BJTA 1ZQ3P 4B3XA 1G3SA 4XRFA 2IP2A 3H3UA 4OINF 4Y15A 3GF2A 3HZJA 4B47A 2F4MB 1TL8A 2CQXA 3SHFA 1G3TA 2R7DA 3BCAA 1BJAA 3CUQB 4M74A 5D6FA 2Q1ZB 1F4KA 1ERDA 2Q8KA 4E4HA 3BZKA 2EIMH 3ZMVA 2DMQA 5HLHA 2RQQA 3V8JA 3HGGA 4IXAA 2L7FP 2GA2A 3HTAA 2O9LA 1BA5A 2EIKH 1WSUA 2P4WA 1FC3A 4E7IA 1BW6A 3DPTA 1ZLKA 1STZA 1W7PB 2HQ5A 2L02A 1KGSA 4UVAA 2CO5A 1JI8A 2UV1A 2X6XA 2BHYA 5GTIC 1FPQA 2R5ZB 1T8IA 1RESA 2Z9OA 3H5AA 1R1TA 1QGPA 1EH8A 3CWRA 4JK1X 2BY3A 3PIPF 5M3FJ 3JRDA 1N77A 3J7AY 3MZ8A 1W36C 3PSFA 2DG8A 1SEUA 2P6TA 4Z2YA 3QAHA 3HM5A 1W7PA 3HKZN 2DXIA 1GHCA 1WH7A 4HX7A 2E71A 4FE7A 4P55A 5HDNA 4E7ZA 1UHWA 1WJCA 1R1VA 5TJJA 5HLGA 4G7ZF 1FSHA 4U0YA 3LQRA 2G0EA 3I0TA 3ZR8X 3F9KA 3KP7A 1ONVA 2TRTA 3HOVJ 4Y33A 4Q4ZF 1OCOH 2Z99A 4O5VA 1KQ0A 3K4BA 1KA8A 3OS2A 3WE2A 1B1BA 3TOAA 2VC0A 2V9PA 3AFHA 1LVKA 3LA3A 1JKQC 1H0MA 3V8KA 4OIQF 2VXZA 1IRZA 4BS9A 4UVBA 2NVXJ 4JP0A 4M3FA 5IYDJ 3P5JA 5CLSA 4AM3A 2M9HA 2LNBA 1ULYA 2ZCWA 4M3EA 2DJNA 1PYVA 3VPRA 4DBRA 2E2JJ 4LB5A 3PQKA 4RB3C 2XGDA 2MSYA 3Q9SA 2HYJA 4P9FA 1IF1A 3NPIA 2L7MP 1TQIA 2VODA 2O6GE 3EPZA 3ZQQA 1EF4A 2MYSA 4LLNA 2IW5A 1NG6A 5H2FC 1ETXA 3IAS2 1SD6A 2IS4A 2CS3A 1AU7A 2HQAA 1BR1A 2IGNA 5FKMA 1FX7A 3I5UA 5HDKA 3CC2I 3AL0C 4XORA 2OD5A 3CDLA 3DBLB 2R7WA 3P9TA 1Z05A 3TO6A 5F64A 3Q0VA 2EA2A 1DU6A 3OIQA 3V8LA 3DV8A 4BHCA 3TEDA 3FMSA 3ABUA 3LSGA 5GPAA 3LOCA 4UNOA 4IX7A 3DKWA 5E3LA 1BI1A 1QU3A 4JQFA 4KNYA 4BDYA 1QZYA 4RAGA 4IHTA 1MMAA 2ZO4A 2LMDA 4RS8A 2P5KA 2ZFUA 4PGGA 2PZ9A 2HQNA 2L5QA 2EV5A 1PVEA 3L2CA 3J7AO 1KU3A 5EZHA 2A2FX 3PL8A 1E3PA 5DD4A 2Y9ZA 1TW2A 3PUBA 1T0FC 4LG0B 3CCJI 1YRNA 2NOJB 3E0JB 1EV7A 1W0UA 5HS8A 1B9MA 2LKPA 3D1NI 1OLTA 4IZZA 2F2EA 2ELKA 3BC8A 4U87A 2M8EA 1RR8C 1JJ6C 2M7AA 4LIVA 2LOOA 3WTYC 1LKXA 4F92B 3SDBA 3MEXA 1K61A 1SVLA 3KYDB 4ZYGA 2VN2A 4E7JA 2CQKA 3COLA 1AA7A 4BAYA 1O3SA 2LC2A 1TWHJ 2OZUA 1QZZA 1YS6A 1BI2A 2BY0A 2FQ4A 3H9GA 5C3EJ 3S17J 4ASNA 1X19A 4ABZA 2DT6A 2CFXA 5BNGA 2DQRA 2CV1A 1FSEA 1JHHA 2VQLA 3S32A 3KLNA 4C30A 2H6BA 2CH0A 3TW7A 1YFHA 5D5XB 4FETA 4ITVA 1PP7U 4ESFA 4ENKA 4DQ2A 2IT0A 3VVYA 4W1UA 3ZMTA 5TGTA 5D5UB 2R7RA 4NUBA 1K6YA 1T0FA 2QA4I 4G6QA 1S7EA 2VOOA 2CJJA 3K1PA 3KFWX 3BTLA 4L5IA 2MG4A 1I39A 3DKXA 3S2WA 3GTOJ 5JHFA 1QHHD 3R60A 3GFIA 1ORKA 2BHZA 2EILH 3KIOA 4HG2A 4MNUA 4HF1A 4NNJA 4CUGA 4AWXB 2RNJA 1Y56A 4ZYDA 1WPKA 1K4TA 1FP2A 2XPWA 4HQEA 4UUVA 2CMPA 4XRMA 2DJIA 2R92J 3H35A 4ENNA 2XF5A 2GAUA 1ZREA 1IUFA 1I50J 3HPHA 4F7ZA 4E7HA 3SZGA 1APLC 2FJI1 5KCMA 4A2UA 2DT5A 4TV7A 2EFNA 3VSKA 3ZQHA 1QZEA 1DU0A 2XGCA 1FNNA 3HRMA 2E1MC 2LRDA 1OFCX 1OKRA 1T6SA 3R6SA 4MEXF 3FXLA 4EQQA 2E2HJ 2YPRA 5D6EA 4PJMA 4RM3A 4A0XA 4OIOF 1T98A 2NNYA 5BS6A 1B72B 3NAUA 3WTUC 3IL2A 3W6JB 2FX0A 4G12A 5CVRA 2HPIA 3WE3A 2KT0A 5E3MA 2VOPA 2VJ4A 4KICA 2MD0A 4I7HA 4UUSA 3HUGB 4G94A 2LP0A 3NNRA 2MABA 2NXNB 4L0ZB 2O03A 3CCYA 3JRFA 4XLHA 4A3LJ 2L9VA 1LDKB 3CCQI 2DCEA 3QYBA 5HBUA 2DMTA 2E1NA 4V2GA 3G56A 4KITB 1FOWA 5DS9A 2L2OA 3KEQA 2W85A 3I53A 3NS4A 3VIBA 1XPXA 4CCOA 3K9TA 3M7GA 1Z91A 1ETQA 2RAEA 1W1WE 2R5ZA 1A36A 4D7MA 3F8NA 2DYRH 1HC8A 2NAZA 1UJ8A 3PO3J 1BIBA 2CUJA 4RDUA 4BEHB 2DPUA 2CWEA 4X0GA 5IP6A 2RQPA 5E3OA 3HB9A 3AG1H 3SDGA 3BHQA 5DCMA 4XLCA 1I1SA 2ECBA 2CYYA 3K4KA 4M3BA 3CC4I 2PI0A 1WHUA 1Y0UA 1ZHFA 4IQJA 3F1BA 3EUHA 3LAJA 3C1DA 4A12A 4HF0A 2VASA 2JJ7A 2NVUB 3BRUA 2MW8A 1NK3P 3I64A 3K4JA 4BBSJ 2LVSA 3X2QH 1WJDA 3S15J 3HPGA 1RPWA 3T6NA 3RH2A 5FKNA 3ZXSA 2KISA 3I59A 2X1DA 4WXHA 4J01A 2A5YB 3MFKA 1F5TA 2GFNA 4DZJA 2KL4A 1T39A 1JGSA 2JUGA 2MLKA 1U5TA 2QTQA 3KNWA 1Z6RA 1ACIA 5J47A 1FWZA 2V9VA 1POGA 3JTHA 1U6GA 1MW7A 3K4MA 4FISA 3B81A 5D8LB 3OS1A 1MBEA 3HOUJ 2WB1N 1USSA 1R1UA 3LQQA 5FJ8J 3CF5F 2IVMA 3GTPJ 1XMKA 3QODA 5AQCA 4UY8I 4GRIA 5CKTA 1B8IB 3IH2A 3OSGA 1IZ1A 1I6HJ 1IN6A 4HRIA 1W5TA 2ZJ2A 4B4CA 5HOOA 2QQBA 4AIHA 2K9NA 3VYSB 3LJLA 4PUSA 3FMRA 3H3ZA 3LWJA 5D1RA 3CMYA 2VB6A 1SVOA 5BPDA 2XF6A 2PMZN 2QWTA 4R8HA 3HJEA 3ZQLA 5LRSA 2WBMA 3VB2A 4CO8A 3BP8A 1SAXA 3J81Z 3OL4A 2AQEA 4EJWA 3RKXA 2EZLA 5H20A 4WXCA 4PSXA 2B1EA 1MMGA 4GCTA 2WA0A 2IS1A 3FF5A 3RJPA 4OOIA 5ERIA 1LDJA 3WG7H 4S0HB 4P9UA 4ETSA 5D18A 3F8FA 4I09A 2YX7A 2JQ7A 1I5ZA 3FBIB 2FSWA 5D4RA 4BYYA 1N25A 4U0VA 4XKBA 3K10A 1R7JA 3L2WA 3HOTA 1J2XA 2P6SA 3BR5A 4JKZA 3ZPLA 3MN2A 3IP4B 3RD3A 3RSNA 4KMFA 1PP8F 1S5LC 4MTDA 3I9V2 3F0CA 4AIKA 3ON2A 3D5LA 1MSEC 4L62A 5J4YA 2E5NA 2BVLA 1U5TB 4PJJA 3CO7C 1OYIA 2JRMA 2MC3A 2RVCA 2VQGA 5HAWA 3RI4A 4N9IA 2V6EA 2F48A 1TP4A 5F1RA 3CUOA 3IAM2 1W5SA 1XDSA 2OERA 3PM1A 2LH9A 1I6XA 2DFHA 4LG0A 2HDWA 3LSKA 5FB2A 3OYDA 3VW1A 2GUHA 1XGOA 2DA2A 1JE8A 4XKCA 3S3OA 1X1PA 5ICGA 3J7ZI 2VQCA 1ZRCA 2NX4A 2X48A 2VBZA 4LD5A 1MH4A 5GAGJ 1FTZA 1Z67A 3T1BA 1ZELA 3KZ9A 2A05A 4KA4A 1CF7B 2KQRA 2ZXHA 2R7QA 1I1GA 1JKPC 3KX2A 1XSDA 1HKSA 3ZN1A 1Z6TA 4BU2A 2KDZA 2O7TA 3TO9A 2JA8J 2QSFX 2VPRA 1MJBA 4Y13A 3J7YJ 3H3VK 4XONA 2XGXA 3BZ6A 4DYQA 2QVOA 3BR2A 4XKVA 3ZGKA 3E1SA 3BCBA 3EETA 1RETA 2FJ1A 2M45A 4RGXA 2W25A 3VSLA 4F91B 3Q9VA 3P9CA 2EINH 1TT0A 5HODA 3GCMA 4DOZA 1ZGAA 2RV8A 4M71A 1WH5A 2XROA 4GFKA 3L09A 3U1DA 2YX4A 1R22A 5JLXA 2LG4A 3HBLA 2UUZA 3QYFA 3WGGA 3ERED 3CDIA 1SFEA 1S7OA 2PG4A 2GXBA 1MNDA 5B66C 2QQ8A 4EM2A 2K3FA 3E5UA 2I8DA 3LWFA 3K4LA 4XKWA 2XGEA 3IKTA 2NS8A 4IEJA 3EDPA 4A6EA 2IBDA 2K4JA 4BY7J 2ZXJA 4L5JA 2ID6A 2RGVA 3ZP5A 2P81A 3KYCB 1ZR4A 1JT0A 3I54A 4A5MA 2R7SA 3RPUD 2BYVE 3A01B 1UMQA 4D7NA 2KIQA 3FXOA 5C4JJ 4I02A 4J00A 3LA7A 1S29A 2E7XA 1NTCA 5KHDA 3H5RA 1F36A 4HNTA 2AQFA 1R23A 3V4GA 3H0DA 1IC8A 2DA3A 1TWGJ 3LFUA 5FRMA 2CUZA 4A0YA 4KIBA 4LFUA 3SYTA 3GX4X 3S2DJ 2XDVA 1ZYRF 1EKEA 2HNHA 3S93A 3CC7I 4G6TB 2R7FA 9ANTA 2MD5A 2EH3A 4CYCB 2K9LA 3KEOA 2KFDA 3H9JA 5L3BA 2Y2ZA 3Q0UA 5K7ZA 2K40A 2W82A 5HS7A 4AD9A 1XTAA 2WAQA 2Y9YA 2ZBKA 4L9JA 3GTLJ 4BQNA 2XSDC 4DNCA 1YIOA 4PFPA 2ZXWH 4I01A 3WTZA 5E18F 1G4DA 3GO5A 1FOXA 2FUG2 1I27A 2ZNYA 1VQLI 1WWXA 1WZ2A 3S1NJ 3TQNA 4U7DA 4PJLA 3QP6A 3GEZA 2JA5J 1Q1VA 2JN6A 2B0LA 3IRQA 3GLXA 4LITA 3CCVI 4MXMA 4P5OA 1V5EA 5M3MJ 3CJTB 1SANA 3OSFA 4V2FA 1MSFC 3BJAA 1SD5A 2XRNA 4PCQA 4M3GA 3FM3A 1BR2A 3MZYA 2NVTJ 2QOPA 2Z5UA 4MLOA 2X1EA 4HYEA 3AAFA 4E7KA 5DM7F 2FMYA 2HYTA 2XKPA 1W0TA 4AYBN 3Q0WA 4X1EA 2QKMB 3TP0A 2OUMA 1ZG3A 4RB2C 2D1VA 5F6FA 3CCLI 4BKXA 4RGRA 3I56I 2X6WA 4FHTA 1SFXA 4GDFA 2KJCA 1MBFA 3H92A 3TP3A 2IGKA 2KIMA 2XSJC 2M87A 5FFZA 2EPFA 1P4AA 3OV8A 5LLQA 3WTSC 2QM3A 2JSPA 2PN6A 3F23A 3BROA 1HXDA 1R5GA 5E1ZB 2HVRA 2FBQA 2H27A 2NS7A 3K1NA 3U21A 4KT6A 2HVQA 1KYWA 1MDMA 1Q1HA 3E5QA 3VTIA 1MKMA 2DODA 2JPCA 3DKYA 4EV0A 5AONA 2GIVA 3BY6A 3G73A 1YW7A 1YOVB 4BHPA 3I55I 2ETHA 2DFFA 4EMSA 4G6DA 3OYMA 1T95A 1VQ8I 3GMEA 2AO9A 2VL8A 3FXKA 1BW5A 4BE2A 3OYAA 3JAMK 2LF7A 1B6AA 3HSEA 4PXIA 2GLOA 2HTSA 2V7FA 1H8AC 4WCGA 2KIUA 2DYSH 4BL0B 2LKXA 2L9RA 3DQVC 1J75A 1LJ9A 2XC7A 3LFKA 3BTJA 1D8JA 1MNEA 1IJWC 3BG9A 3O8GA 1KU9A 4CCLA 2ZMEB 2R7TA 4ZYAA 4KUMA 1EH6A 3BQYA 3ULQB 1HW5A 1P7IA 3KYLA 3ZN0A 3G7RA 2XAFA 3HIFA 2E60A 3BT9A 1X3WB 2XHKA 3A1YA 2JK3A 2R7XA 1MMSA 1QQIA 3IKVA 2CG4A 5DV5A 3HOSA 5FKLA 1TNTA 4MHGA 2I5UA 3MD2A 4ESJA 4RA2A 4JL3A 2K02A 3LSRA 2CQNA 4BXUA 3LSMA 5BPIA 2UXOA 2GBYA 1Z3XA 3FXQA 1ZGWA 2FU4A 3QWLA 1KU2A 2R5YB 4ZYHA 2BE5F 1YI2I 1QNTA 1Z0XA 2XDNA 5CYVA 1WFXA 3CJQB 2L0KA 1X4PA 3K2ZA 3CCRI 5D19A 5IYBJ 4ZYEA 4A0ZA 2KHMA 1BC8C 3S14J 2DAOA 2LR8A 2ELJA 2Z1DA 2LY1A 1FIPA 1IXRC 5JVTA 1XMAA 2V26A 1OR7C 1SC7A 4QSHA 1O3QA 1UCRA 4Y52J 2E2IJ 2WUIA 1YLFA 1SVMA 2QBYB 2RASA 3TOBA 4CCMA 4CZCA 4EJVA 2KLOA 2LLKA 4WF2A 2A5WA 4MK6A 2PBIA 3KZZA 4EEFG 3LA2A 4B43A 1IRGA 2DBBA 4JX5A 4BNCA 1JXSA 1HF0A 3SWHA 3R0AA 4FE4A 5GADJ 3PJRA 3CP2A 2R0QC 4NC6A 1L0OC 4B8XA 2HEOA 1BBYA 5DEQA 1PJRA 2MH9A 2B9SA 1VZ0A 3DCFA 1ZN2A 4WXDA 2WAFA 4RAZA 2V1NA 3PQJA 1ZG5A 1UHSA 5FLVA 4IJAA 1G8XA 2E35A 2R7ZJ 2XIGA 1MBHA 2YVXA 1GUUA 3OOPA 2CFOA 1D0ZA 1LFBA 4LIUA 4BHBA 1GT0C 2ZCXA 3A4CA 3CJDA 2VT2A 4IRHA 5FD5A 3BPVA 5K1YA 5LHIA 4HPQA 4UDSA 1I3AA 5AIPA 1SMTA 4XRSG 2ZOYA 1EJ9A 3K4NA 4RGUA 1ZK8A 3BWGA 2STWA 5F0HA 3L1PA 4B48A 4PGHA 3KP2A 1OR7A 4ZJZA 1HSJA 5ILVA 4NHJA 3AG2H 1VQ5I 4OWRB 5M5WJ 1OCPA 3V6GA 4GYGA 1U8BA 2C6YA 4CH7A 1P2FA 1ETVA 5LGNA 3H36A 3D5RC 2VE8A 1RRJA 3TDZC 1U9OA 2BW3B 2JVGA 4GCKA 2HS5A 1C0WA 1Z3YA 5A2QK 1YYVA 1JTYA 3SEQA 3AQSA 4NC8A 5IP9J 4PJ0C 2O3FA 2VJ5A 1VQ6I 3PIOF 4JBAA 1MJAA 5DDGA 1D1AA 4BE1A 3S8PA 2ZC2A 3HTJA 3OY9A 2QQAA 2YVEA 2Y69H 4PK4A 3BCGA 2F07A 1X1CA 2EZIA 3TO7A 2HZDA 1XGMA 4MTEA 3F3XA 4GCVA 2F4OB 1H9TA 1BL0A 3JCUC 4NN1A 4MFDA 3ERMA 3DU5A 3VODA 4YFXF 3GVAA 3DBHB 4XLAA 1G6NA 3ZQCA 1X1DA 2NP5A 5H6RA 1MZBA 2JTVA 4IKFA 4B3AA 4IPAA 4M73A 2L3DA 2LY9A 2LREA 1SMYF 2YU9J 2HVSA 4A3BJ 5GTHC 5KAIC 4EM1A 5K5OA 3NWTA 2X6OA 3C2GA 4ACIA 2F5EA 3OR1C 2OTJI 5FMPA 1W4MA 1ZG1A 5KNLA 1LDDA 2GXAA 5EGOA 1YHQI 3Q5FA 4DZPA 3ABLH 1ZKGA 4XR6A 1OMIA 2H09A 1SGMA 4ZTJA 2JA2A 3A0HC 4RGSA 1U0JA 1TQMA 4WIBA 1HLVA 1Y39A 2EA4A 2FNAA 4L5EA 1HDPA 3K2AA 1E17A 2PX9A 4EJUA 4Q47A 3BOQA 5HNFA 1HKTA 4E7SA 1VQNI 1UB9A 5J40A 3HGYA 2VKEA 2HXOA 2Y0MA 2WC2A 1MGTA 3L2UA 4RBOA 1IXCA 4CICA 4XQFA 2LBFB 2O7OA 4AUXA 1D8KA 5IPAA 2OI8A 1GLNA 4O3MA 1D5YA 1SAUA 3BTCA 4K2EA 5HVQC 3GEUA 4F3QA 4YIRX 5LBQA 2CW7A 1FZPB 3BJBA 3K69A 4LK0F 1DDNA 3HTSB 1TZLA 2FMLA 2K9MA 2OCCH 4MGRA 5FKKA 3DPLC 4M9XA 4M6VA 2UXNA 1A04A 3PASA 5FGLA 5DM6F 4LOCA 1KZHA 4E7LA 4CA0A 4PZJA 1NG7A 3RQ4A 1ZH5A 1RZ4A 2XAUA 1SFOJ 2RDPA 2OU2A 2ZMEC 4BH9A 3BZCA 3HRUA 4MQVA 4I98B 2X4HA 1S7AA 2RNGA 1G2HA 3QU3A 5HLTA 4HZFA 3JSPA 3IUVA 2XF7A 2K4BA 1R4MB 5GAHJ 3DPJA 2QUFA 3FIWA 3FRQA 4M6YA 1HA8A 3BG6A 1KQ8A 1YIJI 1OCTC 1YS7A 1H88C 2AS5F 1V54H 3GZ6A 2VQHA 3RPQA 2FBKA 3CMMA 3MWMA 3IUOA 1ON2A 3WHCA 2V6CA 2Q24A 2WTEA 1BIAA 2XAJA 1FTTA 1Z1DA 5IOZA 2KRHA 3P9KA 4KN7X 3WHBA 1OCZH 1AKHB 2AXLA 3BTIA 3E97A 4U0WA 3ZQIA 5DAJA 4XSXF 2M7BA 3OYHA 4XRSA 3RZDJ 1OPCA 4AYBA 4Y4RA 2MA3A 1KONA 4GCLA 4AVZA 3SFIA 1P4WA 2HDCA 1P92A 1LUJB 4XLPF 3IH3A 3K70C 1R6RA 1TWAJ 1XB4A 2GZWA 3MVPA 3FKJA 4UXNA 2H8RA 2M4KA 1IN8A 4IOCF 3R0JA 5DD8A 3K6GA 1MNMC 2DA1A 5EF6A 2ZMEA 2IGMA 3ABMH 2W48A 3HKZA 1D1BA 4RMNA 2NVYJ 3JSOA 4D5FA 2F5DA 3E6DA 3QOEA 1QHGA 4KIGA 2M30A 3JREA 1YW9A 4R79A 1MMNA 1R49A 2FD5A 3G71I 5H9TA 3E7QA 3VFZA 1J09A 2OCEA 2G3BA 3NRVA 3PNVA 1IW7F 1Z77A 3HIMA 3IWFA 1NHAA 1P6RA 1PUFA 1K78B 2HKUA 5GPCA 1D0XA 4F52A 3J80Z 4A3GJ 3JRCA 4OAZA 4JX6A 1A6QA 3G2BA 1A6IA 3WTTC 1E0EA 2IA0A 2LFBA 2OA4A 5DUIA 3GFLA 5IOYA 2VIXA 2V1XA 5ICCA 1SFKA 2ZSHB 2ZJRF 3TW6A 4FASD 3EGQA 3LHQA 3VVXA 2VJJA 3V42A 1FT9A 2OAZA 1R36A 4D0PA 4ENMA 1XCVA 1HW2A 1XC5A 1EA3A 2PJRA 3K4CA 1TLHB 2OZ6A 3VOEA 3H0GJ 2W84A 3MKLA 5M5YJ 1YITI 1IN5A 3GLLA 3FDYA 3WODF 5F0CA 3M4OJ 3HOXJ 3GZ5A 2D5VA 1PDNC 2V4JC 5B3SH 4UV9A 2A6HF 2L9SA 3OIPA 2UWMA 2MLGA 5ICFA 4RB1A 3MKYB 4XLNF 1TW3A 1H9GA 4BGDA 1SD7A 2A68F 3WTWC 2L7ZA 2EK5A 4IHWA 2DMNA 3E6MA 2M4GA 3S1QJ 2RKHA 1JUMA 4CCJA 4CYDA 2O0YA 5BMZA 1U5TC 1K7AA 2XPVA 2DOEA 5E79C 3TKYA 2ECCA 1QPMA 3JR9A 3L2VA 2UXXA 4DIQA 2DQLA 3LSHA 4Q48A 2PFVA 3U2RA 4MQ9F 4C3JJ 3MQ0A 1BC7C 1PUEE 4Z6YA 1IG7A 2KMUA 2WAQN 4QTRA 1O3TA 3A02A 1YW8A 4LK1F 3FHNA 4W97A 2COMA 4ZDOA 2PFBA 2M8GX 5EZGA 3HEFA 3ELKA 1IDZA 5F27A 2QSGX 5FROA 2UXHA 2Y0SA 4HF2A 4N9HA 4HLXA 2X6YA 2HU9A 4HAMA 1D0YA 4OIPF 1X2MA 3GYHX 2VONA 4ICHA 3LSPA 4BUPA 1XSXA 3F6OA 2V79A 5IT9K 2KZVA 3W2VA 2V1DA 1IO2A 4CZZA 4YELA 3BDDA 1GDTA 1YE9A 4RLFA 2DO7A 1FMWA 4M6XA 3ECHA 4ZH4F 2V57A 3NWSA 3ZQ7A 1U3EM 1K79A 4UHTA 1R58A 5HDGA 4CCNA 2OJED 2W4SA 2G7UA 2HPMA 1FBQA 3FK6A 3QP5A 2Z33A 4IRIA 3RQIA 4KN4X 5B5EC 5B1AH 1FY7A 1ZRFA 3PNYA 4WX9A 2Y31A 3GW2A 4A69C 2VXDA 3L7WA 4IOAF 2VBXA 4ON0A 3RKWA 2ZCMA 1WKMA 2QCOA 3G1LA 2W00A 1S3JA 1S8NA 3MKWB 3L00A 4YEJA 4ZDPA 4DVYP 4V19K 5AIQA 3LSIA 3GTGJ 4BQQA 4L9VA 1GXPA 4G9YA 1B72A 3IHUA 1X1AA 2F5CA 3W2AA 4G7OF 3EQLF 2CV0A 3ONQA 5FD6A 3C2HA 3M8JA 2KKOA 3MNLA 3TDUC 2LYCA 3OL3A 1DP3A 3F8CA 4PFOA 4QLCU 4BJ6C 2NVQJ 1ETKA 2L4AA 3O60A 2ICWG 3M9AA 4MFEA 5M5XJ 3CCSI 3S3NA 3TBIA 2VBWA 3BR0A 2K3PA 1B9NA 1X3UA 2Z3YA 3VW0A 3KCCA 2N8GA 3QPSA 3BPXA 5F08A 4N0BA 2XB0X 3N97A 5EG0B 2FF4A 2J5OA 2DFIA 3C7JA 3V7RA 4A3JJ 3R61A 1MDMB 3CUQA 3PFIA 4QPOA 5L3FA 2XAQA 1LQ1A 4ME9A 2XAHA 1BM9A 1XSVA 3OIOA 3RKQA 3OYFA 3FXJA 2Y0SN 1UG0A 2X51A 3CP8A 3WGIA 3EUKL 2MC4A 1TQPA 3FZVA 4BACA 2IXSA 2X85A 1XN7A 4GFBA 2ZCNA 3AG3H 3A2KA 3M1EA 4I76A 4RB0A 1VQPI 2VKVA 1VQ9I 4RLQA 3DEEA 2CU7A 1RUNA 4BY1J 3ON4A 4U9LA 3WTXC 5DTDA 2G7LA 5D4SA 1IRFA 4AU7A 4BXXJ 2GOXB 3DU6A 1BI0A 1UFMA 1K83J 2F5FA 3M8EA 4QWQA 2K86A 3U9GA 2ZNZA 2JSCA 2W24A 3GFJA 4Y7NJ 2A07F 3DEUA 1D1CA 4FT8A 4IRVA 2R3SA 4L9NA 3WG9A 3E3VA 5K5RA 4H4KC 5FLMJ 1BR4A 4G7HF 4ZTFA 2BXZA 2ZFWA 5IT3A 1MBJA 2ISYA 1ZR2A 3QU6A 1P7JA 1U2WA 4IO9F 4XM3A 3WGHA 1UELB 3ASNH 2QEXI 3SEZA 4DBQA 1O4XA 3DBRB 3CESA 3ESWB 1ITYA 1V5FA 2O8KA 2F4IA 2G7GA 3FMQA 1X58A 4ZC3A 5JLWA 1ZGJA 1D3YA 2RN7A 4O6JA 5LHHA 1JKRC 4IHXA 1LVAA 5TRDA 3CCUI 3CQZJ 4HSRA 1Y0NA 4RAYA 3C18A 1ETYA 2QLZA 2I10A 4IRGA 4MEYF 3M3YJ 5C44J 1VFCA 2CRGA 3ABTA 2RHAA 1J7KA 2CSOA 4EJTA 2DOFA 4CGRA 2EZHA 5CVUA 3CMAI 5C4XJ 2K9SA 1UI6A 5L3EA 3I4MJ 1WJFA 1REPC 3A03A 4PSWA 4J19A 2E36A 2VE9A 4UUSB 3BQZA 2XRLA 3PFYA 5LGTA 3T8RA 3SQNA 2PMZA 1ON1A 3V7SA 1TNSA 2DOAA 3IV5A 1YRNB 1O57A 1OISA 1ZTRA 2YS9A 1HKQA 4L0YB 2FEZA 3OYIA 5EJCA 5J8FA 5CJ9A 3CJRB 1XX5A 3FK7A 2UXPA 2HGCA 1OJLA 1V55H 5EDNA 1E3OC 1O7LA 4N4OB 1M1EB 2DDBA 4GXOA 1W5CC 2DG7A 3P7NA 2ELHA 3VUQA 5D5VB 5DYMA 4LLGF 2EB7A 3JRIA 2HR3A 4BEHA 3HC7A 4C2UA 5IYCJ 4HLYA 1UG2A 2R7VA 3BR6A 2W7NA 2DA5A 1YG2A 1V4RA 3ML6A 3BG5A 4NDLA 2D45A 2K27A 2BGCA 2NYXA 2FXAA 2LD5A 1VNDA 1CGPA 2JUCA 2UXUA 5J1UA 3CCEI 4XIDA 2STTA 2K7LA 2VPLA 2D2WA 2YUSA 4BBRJ 4WK8F 5CVIA 4QIWN 2K9QA 4IF4A 4KFCA 5B1BH 3N4MA 2EQRA 3K0LA 3LSJA 3Q3SA 3AKZA 4XMYA 3OYGA 1S72I 2V1UA 2IS2A 2A6TA 4UV8A 4A3FJ 1RNLA 3UR3C 4XSZF 1N78A 2HOAA 2BZTA 3ZMDA 2ZJPF 3QRFF 1W36D 2W53A 3FXRA 4XK4A 3E6BA 2BV6A 2IA1A 1J0RA 3VYRB 1LNWA 1WJ5A 5H6QA 1X1BA 4BE0A 2PMUA 1IN4A 3REOA 4CDGA 5JI6A 2EWNA 4KIFA 3WU1B 1T56A 3BJ6A 4XNFA 5IY5H 3VOXA 4IHVA 5K5QA 2BY1A 1D5VA 4LJZF 1OQYA 5J1YA 1L3LA 2LKSA 1VQ4I 4YG2F 1RC9A 1QO0D 5E3NA 4CYCA 3C2BA 3GTJJ 2UZKA 4LG3A 3IWZA 4I0AA 4A3MJ 2HKOA 2V9KA 2YU3A 1G59A 2HYGD 5KK1A 5CVVA 1RUOA 3SFZA 1MBGA 5CW8A 4C3HJ 1B8IA 2HWVA 3D5SC 2GOMA 1UI5A 4IHYA 3FWEA 3VP5A 4I2OA 2B7EA 1A31A 2OBPA 1IAWA 1XDUA 2EJRA 2FRHA 3O8HA 4HNVA 3R4KA 4OMYA 2GXGA 2E1CA 3GTKJ 2ZOZA 1LEBA 2HDDA 4XLEA 5E8GA 2AXTC 2IEKA 3F8MA 3DTKA 3G1MA 2PLYA 3A01A 2JPBA 4EM0B 4C9YA 1HBXG 3ZQFA 1AWCA 3HRSA 4KJZA 4XN3A 4AC0A 2CGPA 3DP7A 4U7BA 2K5CA 1YQAA 5HSZA 3CMEI 3HXLA 4JYKA 1CQTA 2BOLA 1ENHA 2P8TA 3ANPA 1WQ2A 3BLYA 2ZKZA 3E6CC 4HV6A 1Y1VJ 1ZARA 3QBMA
chains in the Genus database with same CATH topology
3QQAA 4A3IJ 1G2HA 1RKWA 3LNQA 4A3DJ 4A3KJ 3IUVA 4X6AJ 3DPJA 3HTHA 3FIWA 3FRQA 3BR5A 4JKZA 1OCTC 3MN2A 3KKCA 2M0CA 1H88C 2ZB9A 3SJMA 2OF7A 3RD3A 2ME6A 3WHCA 2Q24A 3UKGA 1FTTA 5IOZA 2DMPA 3F0CA 3WHBA 1AKHA 3ON2A 4L62A 1MSEC 1AKHB 2M34A 3JRAA 3BTIA 1HDDC 5DAJA 3ZQIA 3NRGA 2HOSA 1T33A 1JT6A 4XRSA 3RZDJ 3GTQJ 3S16J 3DEWA 3HTIA 4D5CA 5HAWA 4GCLA 3PO2J 3SFIA 3S2HJ 2OERA 2GENA 3PM1A 3IH3A 3JRBA 3FISA 2DN0A 3VW1A 3ZOBA 1TWAJ 1HCRA 2DA2A 2GUHA 1WI3A 3MVPA 2NX4A 2X48A 2H8RA 1TWCJ 3JSJA 1MNMC 1ETOA 1MH4A 1FTZA 2ME0A 2DA1A 5EF6A 3I4NJ 5F04A 3KZ9A 2W48A 2D6YA 3BNIA 2NVYJ 1JKPC 1IGNA 4D5FA 3JRHA 2DA6A 3JREA 2KDZA 2O7TA 1ZQ3P 1RKTA 2JA8J 2VPRA 2FD5A 3H3VK 4B1RA 5H9TA 3E7QA 4DYQA 3BR2A 2G3BA 2XPUA 2DTZA 5J3LA 1RETA 1Z77A 2FJ1A 2H1KA 2CQXA 3HIMA 1PUFA 2XB5A 2EBIA 5HODA 5GPCA 2HKUA 1WH5A 4GFKA 2DMUA 4A3GJ 3JRCA 4JX6A 5JLXA 2DMQA 1A6IA 2GM4A 1X2NA 2LFBA 3HBLA 3HGGA 2G7SA 5IOYA 2L7FP 3HTAA 2O9LA 1BA5A 3LHQA 3TW6A 3EGQA 3VVXA 1BJZA 1BW6A 2XGEA 2NS8A 4IEJA 2E1OA 1XC5A 2HQ5A 2IBDA 4BY7J 5CXGA 5FHPA 2VI6A 2ID6A 2B63J 2UXIA 2P81A 2R5ZB 3H0GJ 3MKLA 1RESA 5M5YJ 1ZR4A 1JT0A 1R9TJ 4NELA 3A01B 3NI7A 3OOUA 1UMQA 5F0CA 4D7NA 3HOXJ 3M4OJ 3CWRA 5C4JJ 5M3FJ 3JRDA 2D5VA 1NTCA 5IP7J 1F36A 4A3EJ 2DG8A 1IC8A 2DA3A 3FKIJ 1TWGJ 2L7ZA 3B6CA 4IHWA 2DMNA 4KWAA 3S2DJ 3HM5A 3S1QJ 1JUMA 3HKZN 1WH7A 4FE7A 2XPVA 9ANTA 2ECCA 1IDYA 2QIBA 4DW6A 2EH3A 3JR9A 4CYCB 2CUEA 2G0EA 4HKUA 2Y2ZA 3Q0UA 5K7ZA 1VF9A 4C3JJ 2LTPA 2TRTA 2K40A 3HOVJ 1IG7A 1ETWA 2WAQN 4QTRA 1LFUP 2Y9YA 3GTLJ 4UUTA 2XSDC 3A02A 4W97A 3VW2A 2M8GX 5EZGA 3HEFA 1IDZA 3S1NJ 5F27A 2UXHA 2JA5J 2R5YA 1Q1VA 1TWFJ 1JKQC 2JN6A 4MXMA 1IRZA 2NVXJ 2EZKA 4JP0A 3BR1A 5M3MJ 4M3FA 1SANA 5IYDJ 1U9NA 4AC6A 1X2MA 3OSFA 4V2FA 1MSFC 4ICHA 2M9HA 3LSPA 4M3GA 2WGBA 2NVTJ 2QOPA 4M3EA 3GBGA 2DJNA 3VPRA 4MLOA 2MGQA 1GDTA 2E2JJ 2HYTA 4XICA 2X9DA 2XGDA 1W0TA 2MSYA 3Q0WA 4AYBN 4X1EA 2V57A 3TP0A 2HYJA 1RR7A 3NPIA 2L7MP 2VUMJ 4BKXA 1GV2A 1EF4A 2CUFA 1ETXA 3FK6A 3V78A 1MBFA 2DA4A 4MO7A 3RQIA 3TP3A 4AF5A 1AU7A 1QVUA 1JTXA 2Y31A 4A69C 3G1OA 3PPBA 1AHDP 5FKMA 2ZCMA 2NP3A 2QCOA 3G1LA 2FBQA 3CDLA 3P9TA 2PBXA 4DYCA 2NS7A 3W6VA 3GZIA 3Q0VA 1DU6A 1U78A 3GTGJ 1B72A 3TEDA 2R93J 3LSGA 5GPAA 3LOCA 5E3LA 3MNLA 2PZ9A 2AO9A 1BW5A 5EZHA 2NVQJ 1ETKA 4PXIA 2Y9ZA 2GLOA 3O60A 1H8AC 1QVTA 2LKXA 4MFEA 5M5XJ 2E19A 1IV6A 2L9RA 1YRNA 2JA7J 1W0UA 3D1NI 2JMWA 3BR0A 3BTJA 1IJWC 3BG9A 2ELKA 3O8GA 3VW0A 2N8GA 3QPSA 3B6AA 5F08A 2XB0X 1JJ6C 2TCTA 2COBA 5EG0B 2REKA 4A3JJ 3BQYA 2OPTA 1P7IA 3S1MJ 1K61A 3G7RA 3CRJA 3BR3A 3IH4A 3BT9A 1JJ8C 1TC3C 3COLA 2JK3A 3EUPA 4ME9A 3OIOA 3ZQGA 3RKQA 1TWHJ 4M3DA 2FQ4A 5FKLA 3S17J 1I3QJ 5C3EJ 2Y0SN 4ABZA 4JL3A 3LSRA 5BNGA 2UXOA 2AHQA 4FCYA 2GBYA 3QPLA 2ID3A 3TW7A 1ZGWA 4GFBA 3GTMJ 2ZCNA 5GP9A 2R5YB 4I76A 1JGGA 2VKVA 1Z0XA 2XDNA 2CU7A 4BY1J 3ON4A 2G7LA 5DTDA 3VVYA 2L0KA 4W1UA 4BXXJ 5D19A 1K83J 5IYBJ 3S14J 1S7EA 4Y7NJ 2LR8A 2CJJA 1H89C 3BTLA 1FIPA 2MG4A 3HDDA 3GTOJ 4Y52J 4QSHA 1ORKA 2E2IJ 1GVDA 2WUIA 2RASA 4JX4A 5FLMJ 1GV5A 1WPKA 5EGOB 2LLKA 3C07A 4MK6A 4EEFG 2XPWA 1MBJA 1ZR2A 4XRMA 2R92J 4JX5A 1P7JA 1HF0A 4FE4A 2DA7A 2R0QC 1LE8B 1O4XA 1IUFA 1ITYA 1I50J 1APLC 2O8KA 2G7GA 1X58A 5JLWA 1JKRC 2IAIA 3DCFA 4IHXA 3ZQHA 3RZOJ 5FLVA 1UHSA 1DU0A 2XGCA 3NARA 3CQZJ 2R7ZJ 1MBHA 1OFCX 2JWTA 1GUUA 2LK2A 1LFBA 1ETYA 1NK2P 2I10A 2E2HJ 3M3YJ 5C44J 1VFCA 4MIMA 2CRGA 1GT0C 2ZCXA 3CJDA 2RHAA 1B72B 3NAUA 4CGRA 2EZHA 4UDSA 2FX0A 4G12A 3JRGA 2JA6J 3HE0A 5C4XJ 2KT0A 2K9SA 4XRSG 3S1RJ 3I4MJ 1UI6A 5E3MA 2ZOYA 3A03A 4J19A 1ZK8A 4UUSB 3BQZA 5F0HA 2XRLA 3L1PA 4UUSA 3NNRA 2LP0A 4I6ZA 1WGXA 5M5WJ 1OCPA 3E7LA 3CCYA 3ANGA 3JRFA 3V6GA 4A3LJ 1FEXA 5HBUA 5CXIA 1ETVA 2DMTA 4V2GA 3IV5A 1YRNB 3G56A 5J1RA 2HXIA 2QF7A 1ZTRA 2YS9A 5DS9A 1U9OA 5F1JA 3NXCA 4GCKA 3FK7A 4YZEA 3VIBA 2UXPA 1OJLA 5EDNA 2HI3A 1E3OC 4C3IJ 1JKOC 5F0FA 2DG7A 1JTYA 2RAEA 1ETQA 2R5ZA 3AQSA 5EFYA 5IP9J 4D7MA 3VUQA 1PUFB 3HTJA 3JRIA 3PO3J 5IYCJ 4RDUA 1UG2A 3VVZA 3BR6A 3QKXA 2YVEA 2DA5A 3BCGA 3BG3A 2EZIA 5IP6A 1HOMA 2F07A 3BG5A 4NDLA 3HB9A 5E3OA 3SDGA 3BHQA 1BL0A 2LD5A 4NN1A 1VNDA 2ECBA 4MFDA 2UXUA 4M3BA 3HOYJ 5J1UA 1A5JA 3ZQCA 4XIDA 1MBKA 5K7FA 3F1BA 2NP5A 2YUSA 4BBRJ 2NOGA 1LE8A 2JJ7A 4QIWN 2K9QA 4B3AA 4A3CJ 1JUPA 3BRUA 3K7AJ 2EQRA 2MW8A 3LSJA 3Q3SA 1NK3P 1F43A 1Y1WJ 2LY9A 4BBSJ 2LVSA 3S15J 2YU9J 4A3BJ 1RPWA 3T6NA 4A3FJ 2IU5A 5K7HA 3RH2A 2HOAA 5FKNA 2X6OA 2W53A 4ACIA 2M2EA 4XK4A 4C2MJ 2GFNA 5FMPA 1VI0A 4DZJA 5EEAA 4JNNA 3KNWA 2QTQA 5EGOA 1FIAA 4DZPA 1FJLA 1POGA 4FTHA 1ZKGA 1MH3A 4FISA 3HOWJ 1T56A 3VOXA 1SGMA 4IHVA 3B81A 1MBEA 3HOUJ 5J1YA 2WB1N 1HLVA 5FJ8J 2HOTA 5E3NA 4CYCA 3GTJJ 3C2BA 4L5EA 3GTPJ 3HOZJ 1HDPA 4A3MJ 3K2AA 5AQCA 2WV1A 1XG1A 1B8IB 3IH2A 5CW8A 1MBGA 3OSGA 1I6HJ 4C3HJ 1B8IA 2VKEA 3HGYA 2HXOA 3AQTA 2YVHA 4B4CA 4A93J 2K9NA 1UI5A 4IHYA 3VP5A 3LJLA 4RBOA 4HNVA 3O8HA 3LWJA 2O7OA 4AUXA 5IPAA 2OI8A 5D1RA 3GTKJ 3CMYA 1D5YA 1XS9A 2CQQA 2ZOZA 3BTCA 5K58A 2PMZN 1WCMJ 2HDDA 2Y30A 2QWTA 5EYRA 5C4YA 1QPIA 3GEUA 3ZQLA 2IEKA 3BJBA 3G1MA 3A01A 5FKKA 1QRYA 3ZQFA 3VOKA 4AC0A 2EZLA 4GFLA 4M6VA 3PASA 2QKOA 5HSZA 5FGLA 5FKOA 4JYKA 4LOCA 4DYRA 1CQTA 4GCTA 1ENHA 5EG0A 3ANPA 4S0HB 5D18A 1SFOJ 3KKDA 1Y1VJ 1U8BA 1JUSA 3QBMA 3S5RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QQA A;  4A3I J;  1G2H A;  1RKW A;  3LNQ A;  4A3D J;  4A3K J;  3IUV A;  4X6A J;  3DPJ A;  3HTH A;  3FIW A;  3FRQ A;  3BR5 A;  4JKZ A;  1OCT C;  3MN2 A;  3KKC A;  2M0C A;  1H88 C;  2ZB9 A;  3SJM A;  2OF7 A;  3RD3 A;  2ME6 A;  3WHC A;  2Q24 A;  3UKG A;  1FTT A;  5IOZ A;  2DMP A;  3F0C A;  3WHB A;  1AKH A;  3ON2 A;  4L62 A;  1MSE C;  1AKH B;  2M34 A;  3JRA A;  3BTI A;  1HDD C;  5DAJ A;  3ZQI A;  3NRG A;  2HOS A;  1T33 A;  1JT6 A;  4XRS A;  3RZD J;  3GTQ J;  3S16 J;  3DEW A;  3HTI A;  4D5C A;  5HAW A;  4GCL A;  3PO2 J;  3SFI A;  3S2H J;  2OER A;  2GEN A;  3PM1 A;  3IH3 A;  3JRB A;  3FIS A;  2DN0 A;  3VW1 A;  3ZOB A;  1TWA J;  1HCR A;  2DA2 A;  2GUH A;  1WI3 A;  3MVP A;  2NX4 A;  2X48 A;  2H8R A;  1TWC J;  3JSJ A;  1MNM C;  1ETO A;  1MH4 A;  1FTZ A;  2ME0 A;  2DA1 A;  5EF6 A;  3I4N J;  5F04 A;  3KZ9 A;  2W48 A;  2D6Y A;  3BNI A;  2NVY J;  1JKP C;  1IGN A;  4D5F A;  3JRH A;  2DA6 A;  3JRE A;  2KDZ A;  2O7T A;  1ZQ3 P;  1RKT A;  2JA8 J;  2VPR A;  2FD5 A;  3H3V K;  4B1R A;  5H9T A;  3E7Q A;  4DYQ A;  3BR2 A;  2G3B A;  2XPU A;  2DTZ A;  5J3L A;  1RET A;  1Z77 A;  2FJ1 A;  2H1K A;  2CQX A;  3HIM A;  1PUF A;  2XB5 A;  2EBI A;  5HOD A;  5GPC A;  2HKU A;  1WH5 A;  4GFK A;  2DMU A;  4A3G J;  3JRC A;  4JX6 A;  5JLX A;  2DMQ A;  1A6I A;  2GM4 A;  1X2N A;  2LFB A;  3HBL A;  3HGG A;  2G7S A;  5IOY A;  2L7F P;  3HTA A;  2O9L A;  1BA5 A;  3LHQ A;  3TW6 A;  3EGQ A;  3VVX A;  1BJZ A;  1BW6 A;  2XGE A;  2NS8 A;  4IEJ A;  2E1O A;  1XC5 A;  2HQ5 A;  2IBD A;  4BY7 J;  5CXG A;  5FHP A;  2VI6 A;  2ID6 A;  2B63 J;  2UXI A;  2P81 A;  2R5Z B;  3H0G J;  3MKL A;  1RES A;  5M5Y J;  1ZR4 A;  1JT0 A;  1R9T J;  4NEL A;  3A01 B;  3NI7 A;  3OOU A;  1UMQ A;  5F0C A;  4D7N A;  3HOX J;  3M4O J;  3CWR A;  5C4J J;  5M3F J;  3JRD A;  2D5V A;  1NTC A;  5IP7 J;  1F36 A;  4A3E J;  2DG8 A;  1IC8 A;  2DA3 A;  3FKI J;  1TWG J;  2L7Z A;  3B6C A;  4IHW A;  2DMN A;  4KWA A;  3S2D J;  3HM5 A;  3S1Q J;  1JUM A;  3HKZ N;  1WH7 A;  4FE7 A;  2XPV A;  9ANT A;  2ECC A;  1IDY A;  2QIB A;  4DW6 A;  2EH3 A;  3JR9 A;  4CYC B;  2CUE A;  2G0E A;  4HKU A;  2Y2Z A;  3Q0U A;  5K7Z A;  1VF9 A;  4C3J J;  2LTP A;  2TRT A;  2K40 A;  3HOV J;  1IG7 A;  1ETW A;  2WAQ N;  4QTR A;  1LFU P;  2Y9Y A;  3GTL J;  4UUT A;  2XSD C;  3A02 A;  4W97 A;  3VW2 A;  2M8G X;  5EZG A;  3HEF A;  1IDZ A;  3S1N J;  5F27 A;  2UXH A;  2JA5 J;  2R5Y A;  1Q1V A;  1TWF J;  1JKQ C;  2JN6 A;  4MXM A;  1IRZ A;  2NVX J;  2EZK A;  4JP0 A;  3BR1 A;  5M3M J;  4M3F A;  1SAN A;  5IYD J;  1U9N A;  4AC6 A;  1X2M A;  3OSF A;  4V2F A;  1MSF C;  4ICH A;  2M9H A;  3LSP A;  4M3G A;  2WGB A;  2NVT J;  2QOP A;  4M3E A;  3GBG A;  2DJN A;  3VPR A;  4MLO A;  2MGQ A;  1GDT A;  2E2J J;  2HYT A;  4XIC A;  2X9D A;  2XGD A;  1W0T A;  2MSY A;  3Q0W A;  4AYB N;  4X1E A;  2V57 A;  3TP0 A;  2HYJ A;  1RR7 A;  3NPI A;  2L7M P;  2VUM J;  4BKX A;  1GV2 A;  1EF4 A;  2CUF A;  1ETX A;  3FK6 A;  3V78 A;  1MBF A;  2DA4 A;  4MO7 A;  3RQI A;  3TP3 A;  4AF5 A;  1AU7 A;  1QVU A;  1JTX A;  2Y31 A;  4A69 C;  3G1O A;  3PPB A;  1AHD P;  5FKM A;  2ZCM A;  2NP3 A;  2QCO A;  3G1L A;  2FBQ A;  3CDL A;  3P9T A;  2PBX A;  4DYC A;  2NS7 A;  3W6V A;  3GZI A;  3Q0V A;  1DU6 A;  1U78 A;  3GTG J;  1B72 A;  3TED A;  2R93 J;  3LSG A;  5GPA A;  3LOC A;  5E3L A;  3MNL A;  2PZ9 A;  2AO9 A;  1BW5 A;  5EZH A;  2NVQ J;  1ETK A;  4PXI A;  2Y9Z A;  2GLO A;  3O60 A;  1H8A C;  1QVT A;  2LKX A;  4MFE A;  5M5X J;  2E19 A;  1IV6 A;  2L9R A;  1YRN A;  2JA7 J;  1W0U A;  3D1N I;  2JMW A;  3BR0 A;  3BTJ A;  1IJW C;  3BG9 A;  2ELK A;  3O8G A;  3VW0 A;  2N8G A;  3QPS A;  3B6A A;  5F08 A;  2XB0 X;  1JJ6 C;  2TCT A;  2COB A;  5EG0 B;  2REK A;  4A3J J;  3BQY A;  2OPT A;  1P7I A;  3S1M J;  1K61 A;  3G7R A;  3CRJ A;  3BR3 A;  3IH4 A;  3BT9 A;  1JJ8 C;  1TC3 C;  3COL A;  2JK3 A;  3EUP A;  4ME9 A;  3OIO A;  3ZQG A;  3RKQ A;  1TWH J;  4M3D A;  2FQ4 A;  5FKL A;  3S17 J;  1I3Q J;  5C3E J;  2Y0S N;  4ABZ A;  4JL3 A;  3LSR A;  5BNG A;  2UXO A;  2AHQ A;  4FCY A;  2GBY A;  3QPL A;  2ID3 A;  3TW7 A;  1ZGW A;  4GFB A;  3GTM J;  2ZCN A;  5GP9 A;  2R5Y B;  4I76 A;  1JGG A;  2VKV A;  1Z0X A;  2XDN A;  2CU7 A;  4BY1 J;  3ON4 A;  2G7L A;  5DTD A;  3VVY A;  2L0K A;  4W1U A;  4BXX J;  5D19 A;  1K83 J;  5IYB J;  3S14 J;  1S7E A;  4Y7N J;  2LR8 A;  2CJJ A;  1H89 C;  3BTL A;  1FIP A;  2MG4 A;  3HDD A;  3GTO J;  4Y52 J;  4QSH A;  1ORK A;  2E2I J;  1GVD A;  2WUI A;  2RAS A;  4JX4 A;  5FLM J;  1GV5 A;  1WPK A;  5EGO B;  2LLK A;  3C07 A;  4MK6 A;  4EEF G;  2XPW A;  1MBJ A;  1ZR2 A;  4XRM A;  2R92 J;  4JX5 A;  1P7J A;  1HF0 A;  4FE4 A;  2DA7 A;  2R0Q C;  1LE8 B;  1O4X A;  1IUF A;  1ITY A;  1I50 J;  1APL C;  2O8K A;  2G7G A;  1X58 A;  5JLW A;  1JKR C;  2IAI A;  3DCF A;  4IHX A;  3ZQH A;  3RZO J;  5FLV A;  1UHS A;  1DU0 A;  2XGC A;  3NAR A;  3CQZ J;  2R7Z J;  1MBH A;  1OFC X;  2JWT A;  1GUU A;  2LK2 A;  1LFB A;  1ETY A;  1NK2 P;  2I10 A;  2E2H J;  3M3Y J;  5C44 J;  1VFC A;  4MIM A;  2CRG A;  1GT0 C;  2ZCX A;  3CJD A;  2RHA A;  1B72 B;  3NAU A;  4CGR A;  2EZH A;  4UDS A;  2FX0 A;  4G12 A;  3JRG A;  2JA6 J;  3HE0 A;  5C4X J;  2KT0 A;  2K9S A;  4XRS G;  3S1R J;  3I4M J;  1UI6 A;  5E3M A;  2ZOY A;  3A03 A;  4J19 A;  1ZK8 A;  4UUS B;  3BQZ A;  5F0H A;  2XRL A;  3L1P A;  4UUS A;  3NNR A;  2LP0 A;  4I6Z A;  1WGX A;  5M5W J;  1OCP A;  3E7L A;  3CCY A;  3ANG A;  3JRF A;  3V6G A;  4A3L J;  1FEX A;  5HBU A;  5CXI A;  1ETV A;  2DMT A;  4V2G A;  3IV5 A;  1YRN B;  3G56 A;  5J1R A;  2HXI A;  2QF7 A;  1ZTR A;  2YS9 A;  5DS9 A;  1U9O A;  5F1J A;  3NXC A;  4GCK A;  3FK7 A;  4YZE A;  3VIB A;  2UXP A;  1OJL A;  5EDN A;  2HI3 A;  1E3O C;  4C3I J;  1JKO C;  5F0F A;  2DG7 A;  1JTY A;  2RAE A;  1ETQ A;  2R5Z A;  3AQS A;  5EFY A;  5IP9 J;  4D7M A;  3VUQ A;  1PUF B;  3HTJ A;  3JRI A;  3PO3 J;  5IYC J;  4RDU A;  1UG2 A;  3VVZ A;  3BR6 A;  3QKX A;  2YVE A;  2DA5 A;  3BCG A;  3BG3 A;  2EZI A;  5IP6 A;  1HOM A;  2F07 A;  3BG5 A;  4NDL A;  3HB9 A;  5E3O A;  3SDG A;  3BHQ A;  1BL0 A;  2LD5 A;  4NN1 A;  1VND A;  2ECB A;  4MFD A;  2UXU A;  4M3B A;  3HOY J;  5J1U A;  1A5J A;  3ZQC A;  4XID A;  1MBK A;  5K7F A;  3F1B A;  2NP5 A;  2YUS A;  4BBR J;  2NOG A;  1LE8 A;  2JJ7 A;  4QIW N;  2K9Q A;  4B3A A;  4A3C J;  1JUP A;  3BRU A;  3K7A J;  2EQR A;  2MW8 A;  3LSJ A;  3Q3S A;  1NK3 P;  1F43 A;  1Y1W J;  2LY9 A;  4BBS J;  2LVS A;  3S15 J;  2YU9 J;  4A3B J;  1RPW A;  3T6N A;  4A3F J;  2IU5 A;  5K7H A;  3RH2 A;  2HOA A;  5FKN A;  2X6O A;  2W53 A;  4ACI A;  2M2E A;  4XK4 A;  4C2M J;  2GFN A;  5FMP A;  1VI0 A;  4DZJ A;  5EEA A;  4JNN A;  3KNW A;  2QTQ A;  5EGO A;  1FIA A;  4DZP A;  1FJL A;  1POG A;  4FTH A;  1ZKG A;  1MH3 A;  4FIS A;  3HOW J;  1T56 A;  3VOX A;  1SGM A;  4IHV A;  3B81 A;  1MBE A;  3HOU J;  5J1Y A;  2WB1 N;  1HLV A;  5FJ8 J;  2HOT A;  5E3N A;  4CYC A;  3GTJ J;  3C2B A;  4L5E A;  3GTP J;  3HOZ J;  1HDP A;  4A3M J;  3K2A A;  5AQC A;  2WV1 A;  1XG1 A;  1B8I B;  3IH2 A;  5CW8 A;  1MBG A;  3OSG A;  1I6H J;  4C3H J;  1B8I A;  2VKE A;  3HGY A;  2HXO A;  3AQT A;  2YVH A;  4B4C A;  4A93 J;  2K9N A;  1UI5 A;  4IHY A;  3VP5 A;  3LJL A;  4RBO A;  4HNV A;  3O8H A;  3LWJ A;  2O7O A;  4AUX A;  5IPA A;  2OI8 A;  5D1R A;  3GTK J;  3CMY A;  1D5Y A;  1XS9 A;  2CQQ A;  2ZOZ A;  3BTC A;  5K58 A;  2PMZ N;  1WCM J;  2HDD A;  2Y30 A;  2QWT A;  5EYR A;  5C4Y A;  1QPI A;  3GEU A;  3ZQL A;  2IEK A;  3BJB A;  3G1M A;  3A01 A;  5FKK A;  1QRY A;  3ZQF A;  3VOK A;  4AC0 A;  2EZL A;  4GFL A;  4M6V A;  3PAS A;  2QKO A;  5HSZ A;  5FGL A;  5FKO A;  4JYK A;  4LOC A;  4DYR A;  1CQT A;  4GCT A;  1ENH A;  5EG0 A;  3ANP A;  4S0H B;  5D18 A;  1SFO J;  3KKD A;  1Y1V J;  1U8B A;  1JUS A;  3QBM A;  3S5R A; 
#chains in the Genus database with same CATH topology
 4KMU X;  2JZY A;  3CLQ A;  4NQW A;  2OV7 A;  2Z2S B;  3OYL A;  2MBF A;  3WU0 A;  4A3D J;  1R5H A;  4GYI A;  4A3K J;  2A6E F;  4G8X A;  3F22 A;  4X6A J;  2HTJ A;  4CCK A;  3K70 D;  2DK5 A;  2PMH A;  2M0C A;  4ZZL A;  1WJE A;  2HYF A;  2QKL B;  2ZB9 A;  3PUF A;  3SJM A;  2OF7 A;  5ICE A;  2BEO A;  2LBF A;  4HW0 A;  3UKG A;  2HOE A;  2DMP A;  1O3R A;  2ADU A;  3RTR A;  1FOK A;  2H8W A;  2M34 A;  1HST A;  3NRG A;  2GIZ A;  3CZ6 A;  5J4V A;  3W6K B;  3TL4 X;  1U8R A;  3DEW A;  3O2P E;  5KVR A;  4B09 A;  3FBN B;  1FMV A;  3B73 A;  2ZXI A;  3PO2 J;  5CQE A;  2Q2E B;  5FO5 A;  3N05 A;  3S2H J;  1X4O A;  3VYU B;  3EYI A;  4BQA A;  2QGU A;  5LHG A;  2QZ8 A;  1SD4 A;  4IL6 C;  4IHS A;  1F9N A;  2OQG A;  1E3H A;  1WI3 A;  3F8B A;  1TWC J;  3GZN B;  3JSJ A;  2W57 A;  4L18 B;  2ME0 A;  4HST A;  5F04 A;  4HV5 A;  4FQG A;  1OCC H;  2D6Y A;  2L9N A;  3RYR A;  4I99 C;  1IGN A;  3QPH A;  4CHU A;  3CD6 I;  4A6D A;  2DA6 A;  1RKT A;  5LRR A;  2RC4 A;  1YJN I;  2H6C A;  3O3K A;  4FX4 A;  4HX8 A;  2E7W A;  2PEX A;  3OMY A;  4B1R A;  3KP6 A;  1SFU A;  2IA2 A;  1OYY A;  4HEA 2;  2XPU A;  2DTZ A;  5J3L A;  2ZJQ F;  3RIR A;  3LMM A;  3LST A;  3D0S A;  3VEP A;  2H1K A;  3OYB A;  1N75 A;  4YFN F;  4AIJ A;  2XB5 A;  2EBI A;  4PDK A;  1R4N B;  2DMU A;  5LFA A;  1JHF A;  2VC1 A;  2R7O A;  2NRA C;  2GM4 A;  4XOP A;  4DGW B;  1WI9 A;  1X2N A;  3DXJ F;  5JHU A;  2G7S A;  2OTL I;  4EVI A;  3H1C A;  4CXF A;  3O6B B;  2XAS A;  5BQT A;  4HX4 A;  1BJZ A;  2ESH A;  4LB6 B;  5LEK A;  2KZG A;  3JAM Z;  4AID A;  2E1O A;  5CXG A;  2ZSI B;  4OD5 A;  5FHP A;  1XD7 A;  2VI6 A;  5D5W B;  2B63 J;  2UXI A;  3CJN A;  5J8C A;  4BDZ A;  1XGS A;  3ASO H;  1R9T J;  4NEL A;  1ZRD A;  1VQK I;  1UST A;  3DFG A;  3KLO A;  3NI7 A;  3OOU A;  4KYW A;  3CTA A;  3OYN A;  4HA8 A;  3OYE A;  2IPQ X;  3F6V A;  3RDI A;  3ROU A;  3SZT A;  3MKZ A;  1LFP A;  5IP7 J;  1VTN C;  2O61 A;  1DPR A;  1RIO H;  4F55 A;  4F93 B;  2Y75 A;  3VYT B;  4A3E J;  5FLX K;  2F6C A;  4BQO A;  3PNT A;  3FXU A;  1RI7 A;  3FKI J;  3GFM A;  3FM5 A;  3B6C A;  4KWA A;  2DK8 A;  3HSR A;  4M9S A;  2FBH A;  2KPM A;  2DI3 A;  5A2Q Z;  4HDU A;  5EEH A;  4ENJ A;  4IVN A;  4Q5S F;  5DUK A;  1IDY A;  5KAF C;  2QIB A;  4DW6 A;  4YRV A;  2VT3 A;  1DPU A;  5EEG A;  2EFQ A;  2CUE A;  4HKU A;  4B44 A;  1QBJ A;  1A35 A;  1VF9 A;  3KP3 A;  5JVG F;  2R7U A;  2WY8 Q;  2GWR A;  2LTP A;  4U9N A;  3F72 A;  1ETW A;  2A61 A;  1LFU P;  4CGZ A;  2IRF G;  4A5N A;  4UUT A;  2HZT A;  4WWC A;  3G6E I;  3VW2 A;  1B4A A;  3DLL F;  1XCB A;  2DPD A;  4YII A;  4DJA A;  3H5N A;  2WWY A;  5LD2 C;  2R5Y A;  1TWF J;  2E34 A;  3CUQ C;  1G3Y A;  5FLX Z;  3OYK A;  2EZK A;  2NS0 A;  5HLI A;  3BR1 A;  3COA C;  2QYO A;  1U9N A;  3ECO A;  4AC6 A;  1HQC A;  2VKH A;  2WGB A;  1WJB A;  3GBG A;  3T5X A;  3HYI A;  3T8T A;  5CVJ A;  4EJO A;  2MGQ A;  1MJ9 A;  2ISZ A;  3KP5 A;  1LEA A;  2QEN A;  4P1W A;  1GXQ A;  4XIC A;  2X9D A;  2QBY A;  2MH2 A;  4H0E A;  4XLF A;  1WRJ A;  3K8P C;  1YJW I;  4QPQ A;  1QA6 A;  2O5R A;  1RR7 A;  2FOK A;  1KYZ A;  2VUM J;  2JRT A;  2JVH A;  1E2X A;  1TTY A;  1GV2 A;  3HL2 A;  2EIJ H;  2CUF A;  3A0B C;  5ED4 A;  3V78 A;  3I71 A;  2DA4 A;  1IV8 A;  4MO7 A;  5HS9 A;  4AF5 A;  2Q0O A;  1QVU A;  1JTX A;  2GA1 A;  1P4X A;  3KE2 A;  3G1O A;  3LAP A;  4BJ5 C;  3ZMU A;  1UAA A;  1AHD P;  3L2R A;  4P96 A;  3ZMS A;  2P5V A;  3PPB A;  2VJI A;  1V3F A;  3DTE A;  2PJR B;  2NP3 A;  2PBX A;  4DYC A;  2DTR A;  1J59 A;  3W6V A;  1VQ7 I;  4LMY A;  3SZP A;  1KU7 A;  3GZI A;  2KDO A;  1F1Z A;  1Y8R B;  3EUA A;  5E20 A;  1U78 A;  1YJ9 I;  2R93 J;  4ANJ A;  4E70 A;  2CV2 A;  2DT7 B;  5FGM A;  3E5X A;  2X0L A;  1G3W A;  2PQ8 A;  3M8F A;  2L01 A;  3B02 A;  3KET A;  3CCM I;  2H94 A;  2R4G A;  3TGN A;  3M1C A;  5FFX A;  3GWZ A;  2TDX A;  4ZZD A;  3UNG C;  1QVT A;  5D8K B;  3KP4 A;  2FA5 A;  1V5G A;  1R71 A;  1IV6 A;  2E19 A;  2JA7 J;  3CF2 A;  2DW4 A;  3FXM A;  2VLA A;  2JMW A;  2FNP A;  1OCR H;  2LY2 A;  3B6A A;  2G9W A;  1NH3 A;  2M3A A;  2TCT A;  2COB A;  2ZY9 A;  2REK A;  2Z16 A;  2G7H A;  2OPT A;  3QPT A;  3S1M J;  3KZY A;  4LGW A;  1DP7 P;  3CRJ A;  3BR3 A;  3IH4 A;  2BY2 A;  1JJ8 C;  1TC3 C;  3EUP A;  3I58 A;  3ZQG A;  2ACJ A;  4M3D A;  1I3Q J;  4GGG A;  3PSI A;  2M1B A;  5FRN A;  2WAD A;  5E17 F;  2EFW A;  4N4N B;  1Z7U A;  4Y17 A;  2AHQ A;  4FCY A;  3QPL A;  2ID3 A;  1FBU A;  1KQ9 A;  1UZC A;  4OU0 A;  3GTM J;  5GP9 A;  4OIR F;  2DLL A;  3CLO A;  1T08 B;  2QWW A;  3C3W A;  1JGG A;  3ZMZ A;  3KEY A;  3EYY A;  2P5L C;  1DQU A;  3AL0 B;  2IJL A;  4OAY A;  2HKX A;  4I0B A;  2PJP A;  2KRC A;  1H89 C;  2L7K A;  3HDD A;  2L4M A;  2LF8 A;  1GVD A;  1YO5 C;  4HBL A;  1FYK A;  2XAG A;  5J6X A;  2VKD A;  3HUG A;  4JX4 A;  1ZAO A;  3G3Z A;  2FE3 A;  5DCF A;  5EGO B;  1GV5 A;  3C07 A;  3IRR A;  2HFH A;  1LPQ A;  1IXS B;  4L9T A;  4UB8 C;  5LGU A;  3CDH A;  1CF7 A;  2DA7 A;  1FYL A;  1LE8 B;  3P9I A;  4XOT A;  3G4S I;  4OMZ A;  1WVR A;  2BXY A;  2X1C A;  5E8I A;  2IAI A;  5ILU A;  2P0W A;  4R1H A;  1FOY A;  3DWL E;  1T2K A;  3RZO J;  1O7F A;  3FX3 A;  3NAR A;  4EGY A;  1WJA A;  4EAT A;  2JWT A;  2O8X A;  2LK2 A;  2XKO A;  4OD4 A;  1FLI A;  2FBI A;  3J81 K;  1VQO I;  1NK2 P;  2BBY A;  2BVM A;  4MIM A;  1S9H A;  2JA6 J;  1BN5 A;  3JRG A;  3HE0 A;  2CW0 F;  3L9F A;  5L3D A;  3L2Q A;  3S1R J;  5L3C A;  1XMX A;  1VQM I;  2XV4 S;  3OWT A;  1J9I A;  4NC7 A;  3DF8 A;  3RYP A;  3W3C A;  4Y3O A;  4I6Z A;  1WGX A;  2CW8 A;  5GAE J;  3E7L A;  4NQW B;  2WV0 A;  3ANG A;  3JW4 A;  1FEX A;  2FQ3 A;  1HW1 A;  2IS6 A;  5CXI A;  2P7C B;  3WU2 C;  1TBX A;  2EV0 A;  2JT1 A;  2HXI A;  2QF7 A;  5J1R A;  4S04 A;  5F1J A;  3NXC A;  3OR2 C;  4M9Z A;  6PAX A;  1J5Y A;  2BW3 A;  3H9Q A;  4AVP A;  4YZE A;  3MZH A;  2HI3 A;  4C3I J;  1JKO C;  3SXY A;  5F0F A;  4IQ4 A;  4KIS A;  2IGO A;  5EFY A;  3F21 A;  3MMY B;  3I59 B;  2ESN A;  4U88 A;  4HNU A;  1PUF B;  1K78 A;  1IUY A;  1UHM A;  1R00 A;  2DFE A;  2EV6 A;  3VVZ A;  1IN7 A;  3QKX A;  1BI3 A;  3HHG A;  2FOW A;  3BG3 A;  4LLL A;  1HOM A;  2XVC A;  3HTU A;  2A3S A;  1IRX A;  3JTG A;  2RRE A;  1EH7 A;  1FP1 D;  4HDV A;  3HOY J;  1A5J A;  3QOP A;  3VDX A;  1MBK A;  5K7F A;  1FYM A;  3I3L A;  3M07 A;  4C2M A;  2H1L A;  2QQ9 A;  2NOG A;  1LE8 A;  1S6L A;  3V7C A;  1MD0 A;  1LB2 A;  4A3C J;  1JUP A;  3K7A J;  2KJB A;  4NB5 A;  3CO6 C;  1F43 A;  4FX0 A;  2XUB A;  2J5P A;  1Y1W J;  5E1W A;  1ODD A;  4JOM A;  5IT9 Z;  4E6K G;  5CQG A;  2IU5 A;  5K7H A;  3MCZ A;  1AOY A;  1BOB A;  2M2E A;  3HRT A;  4C2M J;  2NNN A;  1VI0 A;  5EEA A;  3OYJ A;  4JNN A;  3NQO A;  4D9J A;  1FIA A;  1FJL A;  4GO1 A;  4II2 A;  4FTH A;  2KRF A;  1MH3 A;  1Z9C A;  2HQR A;  1Z7L A;  3HOW J;  5BOX A;  4ESB A;  1XGN A;  2D1H A;  5JR3 A;  2WAE A;  1BOA A;  2WB1 A;  3VWB A;  4HOB A;  4M72 A;  2K85 A;  1K6O A;  2HOT A;  3HOZ J;  3WTV C;  2KIF A;  2W1O A;  2YR2 A;  2M5W A;  1XG1 A;  2WV1 A;  3OYC A;  3RCO A;  2YVH A;  5CPR B;  2GQQ A;  3AQT A;  4A93 J;  1GVJ A;  3HSF A;  5JFR A;  2Y48 A;  2VBY A;  3W2W A;  2DU9 A;  4ZDL A;  1MMD A;  4EGZ A;  3GXO A;  3IC7 A;  3S3M A;  1TT5 B;  1K4S A;  1XS9 A;  2CQQ A;  5K58 A;  1WCM J;  2Y30 A;  2OC6 A;  1YX5 A;  1MIJ A;  5EYR A;  5C4Y A;  3ZCO A;  1QPI A;  4KDP A;  1Y6I A;  4PJN A;  3FHZ A;  3BG7 A;  2WY7 Q;  3HG9 A;  3KZI C;  4RAF A;  1QRY A;  3DLA A;  4YFK F;  2L54 A;  3VOK A;  1B59 A;  3AG4 H;  4GFL A;  2M0M A;  2QKO A;  1YX3 A;  5FKO A;  4DYR A;  5EG0 A;  3LL7 A;  2A69 F;  2OQR A;  3K1M A;  3BJO A;  3RPU A;  4CSW A;  1YTY A;  3KKD A;  1JUS A;  4II3 A;  3S5R A;  3QQA A;  4A3I J;  3ZRG A;  1FBS A;  1RKW A;  2E1M B;  3LNQ A;  1X3Z B;  4S05 A;  3MAJ A;  3HTH A;  5E1X A;  2F5V A;  3RKY A;  4UVC A;  3OS0 A;  2LSO A;  4KT5 C;  4XN0 A;  3KKC A;  3HHH A;  2QSH X;  3I4P A;  3EUH C;  3ISP A;  2LDU A;  1T38 A;  2ME6 A;  3J80 K;  2MFZ A;  2DDA A;  2EFP A;  1W7P D;  2Q2E A;  2YSR A;  1AKH A;  1Z21 A;  3JRA A;  1HDD C;  4UB6 C;  2HOS A;  1DGW Y;  1T33 A;  1ZLJ A;  1JT6 A;  3GTQ J;  3ABK H;  4NBQ A;  3S16 J;  2B3W A;  3GUD A;  4D5C A;  3HTI A;  1R5I D;  5HNH A;  3KPH A;  4XBF A;  5L3G A;  5TIS C;  2P7V B;  2GEN A;  1P9Q C;  2E5Z A;  2KP6 A;  1OYW A;  4RM2 A;  1DGR M;  5DCM B;  3JRB A;  3TMO A;  4BXF A;  3FIS A;  2DN0 A;  3T0Y A;  3NEU A;  4XL9 A;  3ZOB A;  3U1K A;  1HCR A;  1DUX C;  3DPU A;  4YIF A;  2EFO A;  5ILS A;  4D1Q A;  3QYE A;  1ETO A;  3I4N J;  3DTI A;  2CQ7 A;  5LEJ A;  3BNI A;  3JRH A;  4C2T A;  1Y8Q B;  4HQM A;  4BJT A;  1ZQ3 P;  4B3X A;  1G3S A;  4XRF A;  2IP2 A;  3H3U A;  4OIN F;  4Y15 A;  3GF2 A;  3HZJ A;  4B47 A;  2F4M B;  1TL8 A;  2CQX A;  3SHF A;  1G3T A;  2R7D A;  3BCA A;  1BJA A;  3CUQ B;  4M74 A;  5D6F A;  2Q1Z B;  1F4K A;  1ERD A;  2Q8K A;  4E4H A;  3BZK A;  2EIM H;  3ZMV A;  2DMQ A;  5HLH A;  2RQQ A;  3V8J A;  3HGG A;  4IXA A;  2L7F P;  2GA2 A;  3HTA A;  2O9L A;  1BA5 A;  2EIK H;  1WSU A;  2P4W A;  1FC3 A;  4E7I A;  1BW6 A;  3DPT A;  1ZLK A;  1STZ A;  1W7P B;  2HQ5 A;  2L02 A;  1KGS A;  4UVA A;  2CO5 A;  1JI8 A;  2UV1 A;  2X6X A;  2BHY A;  5GTI C;  1FPQ A;  2R5Z B;  1T8I A;  1RES A;  2Z9O A;  3H5A A;  1R1T A;  1QGP A;  1EH8 A;  3CWR A;  4JK1 X;  2BY3 A;  3PIP F;  5M3F J;  3JRD A;  1N77 A;  3J7A Y;  3MZ8 A;  1W36 C;  3PSF A;  2DG8 A;  1SEU A;  2P6T A;  4Z2Y A;  3QAH A;  3HM5 A;  1W7P A;  3HKZ N;  2DXI A;  1GHC A;  1WH7 A;  4HX7 A;  2E71 A;  4FE7 A;  4P55 A;  5HDN A;  4E7Z A;  1UHW A;  1WJC A;  1R1V A;  5TJJ A;  5HLG A;  4G7Z F;  1FSH A;  4U0Y A;  3LQR A;  2G0E A;  3I0T A;  3ZR8 X;  3F9K A;  3KP7 A;  1ONV A;  2TRT A;  3HOV J;  4Y33 A;  4Q4Z F;  1OCO H;  2Z99 A;  4O5V A;  1KQ0 A;  3K4B A;  1KA8 A;  3OS2 A;  3WE2 A;  1B1B A;  3TOA A;  2VC0 A;  2V9P A;  3AFH A;  1LVK A;  3LA3 A;  1JKQ C;  1H0M A;  3V8K A;  4OIQ F;  2VXZ A;  1IRZ A;  4BS9 A;  4UVB A;  2NVX J;  4JP0 A;  4M3F A;  5IYD J;  3P5J A;  5CLS A;  4AM3 A;  2M9H A;  2LNB A;  1ULY A;  2ZCW A;  4M3E A;  2DJN A;  1PYV A;  3VPR A;  4DBR A;  2E2J J;  4LB5 A;  3PQK A;  4RB3 C;  2XGD A;  2MSY A;  3Q9S A;  2HYJ A;  4P9F A;  1IF1 A;  3NPI A;  2L7M P;  1TQI A;  2VOD A;  2O6G E;  3EPZ A;  3ZQQ A;  1EF4 A;  2MYS A;  4LLN A;  2IW5 A;  1NG6 A;  5H2F C;  1ETX A;  3IAS 2;  1SD6 A;  2IS4 A;  2CS3 A;  1AU7 A;  2HQA A;  1BR1 A;  2IGN A;  5FKM A;  1FX7 A;  3I5U A;  5HDK A;  3CC2 I;  3AL0 C;  4XOR A;  2OD5 A;  3CDL A;  3DBL B;  2R7W A;  3P9T A;  1Z05 A;  3TO6 A;  5F64 A;  3Q0V A;  2EA2 A;  1DU6 A;  3OIQ A;  3V8L A;  3DV8 A;  4BHC A;  3TED A;  3FMS A;  3ABU A;  3LSG A;  5GPA A;  3LOC A;  4UNO A;  4IX7 A;  3DKW A;  5E3L A;  1BI1 A;  1QU3 A;  4JQF A;  4KNY A;  4BDY A;  1QZY A;  4RAG A;  4IHT A;  1MMA A;  2ZO4 A;  2LMD A;  4RS8 A;  2P5K A;  2ZFU A;  4PGG A;  2PZ9 A;  2HQN A;  2L5Q A;  2EV5 A;  1PVE A;  3L2C A;  3J7A O;  1KU3 A;  5EZH A;  2A2F X;  3PL8 A;  1E3P A;  5DD4 A;  2Y9Z A;  1TW2 A;  3PUB A;  1T0F C;  4LG0 B;  3CCJ I;  1YRN A;  2NOJ B;  3E0J B;  1EV7 A;  1W0U A;  5HS8 A;  1B9M A;  2LKP A;  3D1N I;  1OLT A;  4IZZ A;  2F2E A;  2ELK A;  3BC8 A;  4U87 A;  2M8E A;  1RR8 C;  1JJ6 C;  2M7A A;  4LIV A;  2LOO A;  3WTY C;  1LKX A;  4F92 B;  3SDB A;  3MEX A;  1K61 A;  1SVL A;  3KYD B;  4ZYG A;  2VN2 A;  4E7J A;  2CQK A;  3COL A;  1AA7 A;  4BAY A;  1O3S A;  2LC2 A;  1TWH J;  2OZU A;  1QZZ A;  1YS6 A;  1BI2 A;  2BY0 A;  2FQ4 A;  3H9G A;  5C3E J;  3S17 J;  4ASN A;  1X19 A;  4ABZ A;  2DT6 A;  2CFX A;  5BNG A;  2DQR A;  2CV1 A;  1FSE A;  1JHH A;  2VQL A;  3S32 A;  3KLN A;  4C30 A;  2H6B A;  2CH0 A;  3TW7 A;  1YFH A;  5D5X B;  4FET A;  4ITV A;  1PP7 U;  4ESF A;  4ENK A;  4DQ2 A;  2IT0 A;  3VVY A;  4W1U A;  3ZMT A;  5TGT A;  5D5U B;  2R7R A;  4NUB A;  1K6Y A;  1T0F A;  2QA4 I;  4G6Q A;  1S7E A;  2VOO A;  2CJJ A;  3K1P A;  3KFW X;  3BTL A;  4L5I A;  2MG4 A;  1I39 A;  3DKX A;  3S2W A;  3GTO J;  5JHF A;  1QHH D;  3R60 A;  3GFI A;  1ORK A;  2BHZ A;  2EIL H;  3KIO A;  4HG2 A;  4MNU A;  4HF1 A;  4NNJ A;  4CUG A;  4AWX B;  2RNJ A;  1Y56 A;  4ZYD A;  1WPK A;  1K4T A;  1FP2 A;  2XPW A;  4HQE A;  4UUV A;  2CMP A;  4XRM A;  2DJI A;  2R92 J;  3H35 A;  4ENN A;  2XF5 A;  2GAU A;  1ZRE A;  1IUF A;  1I50 J;  3HPH A;  4F7Z A;  4E7H A;  3SZG A;  1APL C;  2FJI 1;  5KCM A;  4A2U A;  2DT5 A;  4TV7 A;  2EFN A;  3VSK A;  3ZQH A;  1QZE A;  1DU0 A;  2XGC A;  1FNN A;  3HRM A;  2E1M C;  2LRD A;  1OFC X;  1OKR A;  1T6S A;  3R6S A;  4MEX F;  3FXL A;  4EQQ A;  2E2H J;  2YPR A;  5D6E A;  4PJM A;  4RM3 A;  4A0X A;  4OIO F;  1T98 A;  2NNY A;  5BS6 A;  1B72 B;  3NAU A;  3WTU C;  3IL2 A;  3W6J B;  2FX0 A;  4G12 A;  5CVR A;  2HPI A;  3WE3 A;  2KT0 A;  5E3M A;  2VOP A;  2VJ4 A;  4KIC A;  2MD0 A;  4I7H A;  4UUS A;  3HUG B;  4G94 A;  2LP0 A;  3NNR A;  2MAB A;  2NXN B;  4L0Z B;  2O03 A;  3CCY A;  3JRF A;  4XLH A;  4A3L J;  2L9V A;  1LDK B;  3CCQ I;  2DCE A;  3QYB A;  5HBU A;  2DMT A;  2E1N A;  4V2G A;  3G56 A;  4KIT B;  1FOW A;  5DS9 A;  2L2O A;  3KEQ A;  2W85 A;  3I53 A;  3NS4 A;  3VIB A;  1XPX A;  4CCO A;  3K9T A;  3M7G A;  1Z91 A;  1ETQ A;  2RAE A;  1W1W E;  2R5Z A;  1A36 A;  4D7M A;  3F8N A;  2DYR H;  1HC8 A;  2NAZ A;  1UJ8 A;  3PO3 J;  1BIB A;  2CUJ A;  4RDU A;  4BEH B;  2DPU A;  2CWE A;  4X0G A;  5IP6 A;  2RQP A;  5E3O A;  3HB9 A;  3AG1 H;  3SDG A;  3BHQ A;  5DCM A;  4XLC A;  1I1S A;  2ECB A;  2CYY A;  3K4K A;  4M3B A;  3CC4 I;  2PI0 A;  1WHU A;  1Y0U A;  1ZHF A;  4IQJ A;  3F1B A;  3EUH A;  3LAJ A;  3C1D A;  4A12 A;  4HF0 A;  2VAS A;  2JJ7 A;  2NVU B;  3BRU A;  2MW8 A;  1NK3 P;  3I64 A;  3K4J A;  4BBS J;  2LVS A;  3X2Q H;  1WJD A;  3S15 J;  3HPG A;  1RPW A;  3T6N A;  3RH2 A;  5FKN A;  3ZXS A;  2KIS A;  3I59 A;  2X1D A;  4WXH A;  4J01 A;  2A5Y B;  3MFK A;  1F5T A;  2GFN A;  4DZJ A;  2KL4 A;  1T39 A;  1JGS A;  2JUG A;  2MLK A;  1U5T A;  2QTQ A;  3KNW A;  1Z6R A;  1ACI A;  5J47 A;  1FWZ A;  2V9V A;  1POG A;  3JTH A;  1U6G A;  1MW7 A;  3K4M A;  4FIS A;  3B81 A;  5D8L B;  3OS1 A;  1MBE A;  3HOU J;  2WB1 N;  1USS A;  1R1U A;  3LQQ A;  5FJ8 J;  3CF5 F;  2IVM A;  3GTP J;  1XMK A;  3QOD A;  5AQC A;  4UY8 I;  4GRI A;  5CKT A;  1B8I B;  3IH2 A;  3OSG A;  1IZ1 A;  1I6H J;  1IN6 A;  4HRI A;  1W5T A;  2ZJ2 A;  4B4C A;  5HOO A;  2QQB A;  4AIH A;  2K9N A;  3VYS B;  3LJL A;  4PUS A;  3FMR A;  3H3Z A;  3LWJ A;  5D1R A;  3CMY A;  2VB6 A;  1SVO A;  5BPD A;  2XF6 A;  2PMZ N;  2QWT A;  4R8H A;  3HJE A;  3ZQL A;  5LRS A;  2WBM A;  3VB2 A;  4CO8 A;  3BP8 A;  1SAX A;  3J81 Z;  3OL4 A;  2AQE A;  4EJW A;  3RKX A;  2EZL A;  5H20 A;  4WXC A;  4PSX A;  2B1E A;  1MMG A;  4GCT A;  2WA0 A;  2IS1 A;  3FF5 A;  3RJP A;  4OOI A;  5ERI A;  1LDJ A;  3WG7 H;  4S0H B;  4P9U A;  4ETS A;  5D18 A;  3F8F A;  4I09 A;  2YX7 A;  2JQ7 A;  1I5Z A;  3FBI B;  2FSW A;  5D4R A;  4BYY A;  1N25 A;  4U0V A;  4XKB A;  3K10 A;  1R7J A;  3L2W A;  3HOT A;  1J2X A;  2P6S A;  3BR5 A;  4JKZ A;  3ZPL A;  3MN2 A;  3IP4 B;  3RD3 A;  3RSN A;  4KMF A;  1PP8 F;  1S5L C;  4MTD A;  3I9V 2;  3F0C A;  4AIK A;  3ON2 A;  3D5L A;  1MSE C;  4L62 A;  5J4Y A;  2E5N A;  2BVL A;  1U5T B;  4PJJ A;  3CO7 C;  1OYI A;  2JRM A;  2MC3 A;  2RVC A;  2VQG A;  5HAW A;  3RI4 A;  4N9I A;  2V6E A;  2F48 A;  1TP4 A;  5F1R A;  3CUO A;  3IAM 2;  1W5S A;  1XDS A;  2OER A;  3PM1 A;  2LH9 A;  1I6X A;  2DFH A;  4LG0 A;  2HDW A;  3LSK A;  5FB2 A;  3OYD A;  3VW1 A;  2GUH A;  1XGO A;  2DA2 A;  1JE8 A;  4XKC A;  3S3O A;  1X1P A;  5ICG A;  3J7Z I;  2VQC A;  1ZRC A;  2NX4 A;  2X48 A;  2VBZ A;  4LD5 A;  1MH4 A;  5GAG J;  1FTZ A;  1Z67 A;  3T1B A;  1ZEL A;  3KZ9 A;  2A05 A;  4KA4 A;  1CF7 B;  2KQR A;  2ZXH A;  2R7Q A;  1I1G A;  1JKP C;  3KX2 A;  1XSD A;  1HKS A;  3ZN1 A;  1Z6T A;  4BU2 A;  2KDZ A;  2O7T A;  3TO9 A;  2JA8 J;  2QSF X;  2VPR A;  1MJB A;  4Y13 A;  3J7Y J;  3H3V K;  4XON A;  2XGX A;  3BZ6 A;  4DYQ A;  2QVO A;  3BR2 A;  4XKV A;  3ZGK A;  3E1S A;  3BCB A;  3EET A;  1RET A;  2FJ1 A;  2M45 A;  4RGX A;  2W25 A;  3VSL A;  4F91 B;  3Q9V A;  3P9C A;  2EIN H;  1TT0 A;  5HOD A;  3GCM A;  4DOZ A;  1ZGA A;  2RV8 A;  4M71 A;  1WH5 A;  2XRO A;  4GFK A;  3L09 A;  3U1D A;  2YX4 A;  1R22 A;  5JLX A;  2LG4 A;  3HBL A;  2UUZ A;  3QYF A;  3WGG A;  3ERE D;  3CDI A;  1SFE A;  1S7O A;  2PG4 A;  2GXB A;  1MND A;  5B66 C;  2QQ8 A;  4EM2 A;  2K3F A;  3E5U A;  2I8D A;  3LWF A;  3K4L A;  4XKW A;  2XGE A;  3IKT A;  2NS8 A;  4IEJ A;  3EDP A;  4A6E A;  2IBD A;  2K4J A;  4BY7 J;  2ZXJ A;  4L5J A;  2ID6 A;  2RGV A;  3ZP5 A;  2P81 A;  3KYC B;  1ZR4 A;  1JT0 A;  3I54 A;  4A5M A;  2R7S A;  3RPU D;  2BYV E;  3A01 B;  1UMQ A;  4D7N A;  2KIQ A;  3FXO A;  5C4J J;  4I02 A;  4J00 A;  3LA7 A;  1S29 A;  2E7X A;  1NTC A;  5KHD A;  3H5R A;  1F36 A;  4HNT A;  2AQF A;  1R23 A;  3V4G A;  3H0D A;  1IC8 A;  2DA3 A;  1TWG J;  3LFU A;  5FRM A;  2CUZ A;  4A0Y A;  4KIB A;  4LFU A;  3SYT A;  3GX4 X;  3S2D J;  2XDV A;  1ZYR F;  1EKE A;  2HNH A;  3S93 A;  3CC7 I;  4G6T B;  2R7F A;  9ANT A;  2MD5 A;  2EH3 A;  4CYC B;  2K9L A;  3KEO A;  2KFD A;  3H9J A;  5L3B A;  2Y2Z A;  3Q0U A;  5K7Z A;  2K40 A;  2W82 A;  5HS7 A;  4AD9 A;  1XTA A;  2WAQ A;  2Y9Y A;  2ZBK A;  4L9J A;  3GTL J;  4BQN A;  2XSD C;  4DNC A;  1YIO A;  4PFP A;  2ZXW H;  4I01 A;  3WTZ A;  5E18 F;  1G4D A;  3GO5 A;  1FOX A;  2FUG 2;  1I27 A;  2ZNY A;  1VQL I;  1WWX A;  1WZ2 A;  3S1N J;  3TQN A;  4U7D A;  4PJL A;  3QP6 A;  3GEZ A;  2JA5 J;  1Q1V A;  2JN6 A;  2B0L A;  3IRQ A;  3GLX A;  4LIT A;  3CCV I;  4MXM A;  4P5O A;  1V5E A;  5M3M J;  3CJT B;  1SAN A;  3OSF A;  4V2F A;  1MSF C;  3BJA A;  1SD5 A;  2XRN A;  4PCQ A;  4M3G A;  3FM3 A;  1BR2 A;  3MZY A;  2NVT J;  2QOP A;  2Z5U A;  4MLO A;  2X1E A;  4HYE A;  3AAF A;  4E7K A;  5DM7 F;  2FMY A;  2HYT A;  2XKP A;  1W0T A;  4AYB N;  3Q0W A;  4X1E A;  2QKM B;  3TP0 A;  2OUM A;  1ZG3 A;  4RB2 C;  2D1V A;  5F6F A;  3CCL I;  4BKX A;  4RGR A;  3I56 I;  2X6W A;  4FHT A;  1SFX A;  4GDF A;  2KJC A;  1MBF A;  3H92 A;  3TP3 A;  2IGK A;  2KIM A;  2XSJ C;  2M87 A;  5FFZ A;  2EPF A;  1P4A A;  3OV8 A;  5LLQ A;  3WTS C;  2QM3 A;  2JSP A;  2PN6 A;  3F23 A;  3BRO A;  1HXD A;  1R5G A;  5E1Z B;  2HVR A;  2FBQ A;  2H27 A;  2NS7 A;  3K1N A;  3U21 A;  4KT6 A;  2HVQ A;  1KYW A;  1MDM A;  1Q1H A;  3E5Q A;  3VTI A;  1MKM A;  2DOD A;  2JPC A;  3DKY A;  4EV0 A;  5AON A;  2GIV A;  3BY6 A;  3G73 A;  1YW7 A;  1YOV B;  4BHP A;  3I55 I;  2ETH A;  2DFF A;  4EMS A;  4G6D A;  3OYM A;  1T95 A;  1VQ8 I;  3GME A;  2AO9 A;  2VL8 A;  3FXK A;  1BW5 A;  4BE2 A;  3OYA A;  3JAM K;  2LF7 A;  1B6A A;  3HSE A;  4PXI A;  2GLO A;  2HTS A;  2V7F A;  1H8A C;  4WCG A;  2KIU A;  2DYS H;  4BL0 B;  2LKX A;  2L9R A;  3DQV C;  1J75 A;  1LJ9 A;  2XC7 A;  3LFK A;  3BTJ A;  1D8J A;  1MNE A;  1IJW C;  3BG9 A;  3O8G A;  1KU9 A;  4CCL A;  2ZME B;  2R7T A;  4ZYA A;  4KUM A;  1EH6 A;  3BQY A;  3ULQ B;  1HW5 A;  1P7I A;  3KYL A;  3ZN0 A;  3G7R A;  2XAF A;  3HIF A;  2E60 A;  3BT9 A;  1X3W B;  2XHK A;  3A1Y A;  2JK3 A;  2R7X A;  1MMS A;  1QQI A;  3IKV A;  2CG4 A;  5DV5 A;  3HOS A;  5FKL A;  1TNT A;  4MHG A;  2I5U A;  3MD2 A;  4ESJ A;  4RA2 A;  4JL3 A;  2K02 A;  3LSR A;  2CQN A;  4BXU A;  3LSM A;  5BPI A;  2UXO A;  2GBY A;  1Z3X A;  3FXQ A;  1ZGW A;  2FU4 A;  3QWL A;  1KU2 A;  2R5Y B;  4ZYH A;  2BE5 F;  1YI2 I;  1QNT A;  1Z0X A;  2XDN A;  5CYV A;  1WFX A;  3CJQ B;  2L0K A;  1X4P A;  3K2Z A;  3CCR I;  5D19 A;  5IYB J;  4ZYE A;  4A0Z A;  2KHM A;  1BC8 C;  3S14 J;  2DAO A;  2LR8 A;  2ELJ A;  2Z1D A;  2LY1 A;  1FIP A;  1IXR C;  5JVT A;  1XMA A;  2V26 A;  1OR7 C;  1SC7 A;  4QSH A;  1O3Q A;  1UCR A;  4Y52 J;  2E2I J;  2WUI A;  1YLF A;  1SVM A;  2QBY B;  2RAS A;  3TOB A;  4CCM A;  4CZC A;  4EJV A;  2KLO A;  2LLK A;  4WF2 A;  2A5W A;  4MK6 A;  2PBI A;  3KZZ A;  4EEF G;  3LA2 A;  4B43 A;  1IRG A;  2DBB A;  4JX5 A;  4BNC A;  1JXS A;  1HF0 A;  3SWH A;  3R0A A;  4FE4 A;  5GAD J;  3PJR A;  3CP2 A;  2R0Q C;  4NC6 A;  1L0O C;  4B8X A;  2HEO A;  1BBY A;  5DEQ A;  1PJR A;  2MH9 A;  2B9S A;  1VZ0 A;  3DCF A;  1ZN2 A;  4WXD A;  2WAF A;  4RAZ A;  2V1N A;  3PQJ A;  1ZG5 A;  1UHS A;  5FLV A;  4IJA A;  1G8X A;  2E35 A;  2R7Z J;  2XIG A;  1MBH A;  2YVX A;  1GUU A;  3OOP A;  2CFO A;  1D0Z A;  1LFB A;  4LIU A;  4BHB A;  1GT0 C;  2ZCX A;  3A4C A;  3CJD A;  2VT2 A;  4IRH A;  5FD5 A;  3BPV A;  5K1Y A;  5LHI A;  4HPQ A;  4UDS A;  1I3A A;  5AIP A;  1SMT A;  4XRS G;  2ZOY A;  1EJ9 A;  3K4N A;  4RGU A;  1ZK8 A;  3BWG A;  2STW A;  5F0H A;  3L1P A;  4B48 A;  4PGH A;  3KP2 A;  1OR7 A;  4ZJZ A;  1HSJ A;  5ILV A;  4NHJ A;  3AG2 H;  1VQ5 I;  4OWR B;  5M5W J;  1OCP A;  3V6G A;  4GYG A;  1U8B A;  2C6Y A;  4CH7 A;  1P2F A;  1ETV A;  5LGN A;  3H36 A;  3D5R C;  2VE8 A;  1RRJ A;  3TDZ C;  1U9O A;  2BW3 B;  2JVG A;  4GCK A;  2HS5 A;  1C0W A;  1Z3Y A;  5A2Q K;  1YYV A;  1JTY A;  3SEQ A;  3AQS A;  4NC8 A;  5IP9 J;  4PJ0 C;  2O3F A;  2VJ5 A;  1VQ6 I;  3PIO F;  4JBA A;  1MJA A;  5DDG A;  1D1A A;  4BE1 A;  3S8P A;  2ZC2 A;  3HTJ A;  3OY9 A;  2QQA A;  2YVE A;  2Y69 H;  4PK4 A;  3BCG A;  2F07 A;  1X1C A;  2EZI A;  3TO7 A;  2HZD A;  1XGM A;  4MTE A;  3F3X A;  4GCV A;  2F4O B;  1H9T A;  1BL0 A;  3JCU C;  4NN1 A;  4MFD A;  3ERM A;  3DU5 A;  3VOD A;  4YFX F;  3GVA A;  3DBH B;  4XLA A;  1G6N A;  3ZQC A;  1X1D A;  2NP5 A;  5H6R A;  1MZB A;  2JTV A;  4IKF A;  4B3A A;  4IPA A;  4M73 A;  2L3D A;  2LY9 A;  2LRE A;  1SMY F;  2YU9 J;  2HVS A;  4A3B J;  5GTH C;  5KAI C;  4EM1 A;  5K5O A;  3NWT A;  2X6O A;  3C2G A;  4ACI A;  2F5E A;  3OR1 C;  2OTJ I;  5FMP A;  1W4M A;  1ZG1 A;  5KNL A;  1LDD A;  2GXA A;  5EGO A;  1YHQ I;  3Q5F A;  4DZP A;  3ABL H;  1ZKG A;  4XR6 A;  1OMI A;  2H09 A;  1SGM A;  4ZTJ A;  2JA2 A;  3A0H C;  4RGS A;  1U0J A;  1TQM A;  4WIB A;  1HLV A;  1Y39 A;  2EA4 A;  2FNA A;  4L5E A;  1HDP A;  3K2A A;  1E17 A;  2PX9 A;  4EJU A;  4Q47 A;  3BOQ A;  5HNF A;  1HKT A;  4E7S A;  1VQN I;  1UB9 A;  5J40 A;  3HGY A;  2VKE A;  2HXO A;  2Y0M A;  2WC2 A;  1MGT A;  3L2U A;  4RBO A;  1IXC A;  4CIC A;  4XQF A;  2LBF B;  2O7O A;  4AUX A;  1D8K A;  5IPA A;  2OI8 A;  1GLN A;  4O3M A;  1D5Y A;  1SAU A;  3BTC A;  4K2E A;  5HVQ C;  3GEU A;  4F3Q A;  4YIR X;  5LBQ A;  2CW7 A;  1FZP B;  3BJB A;  3K69 A;  4LK0 F;  1DDN A;  3HTS B;  1TZL A;  2FML A;  2K9M A;  2OCC H;  4MGR A;  5FKK A;  3DPL C;  4M9X A;  4M6V A;  2UXN A;  1A04 A;  3PAS A;  5FGL A;  5DM6 F;  4LOC A;  1KZH A;  4E7L A;  4CA0 A;  4PZJ A;  1NG7 A;  3RQ4 A;  1ZH5 A;  1RZ4 A;  2XAU A;  1SFO J;  2RDP A;  2OU2 A;  2ZME C;  4BH9 A;  3BZC A;  3HRU A;  4MQV A;  4I98 B;  2X4H A;  1S7A A;  2RNG A;  1G2H A;  3QU3 A;  5HLT A;  4HZF A;  3JSP A;  3IUV A;  2XF7 A;  2K4B A;  1R4M B;  5GAH J;  3DPJ A;  2QUF A;  3FIW A;  3FRQ A;  4M6Y A;  1HA8 A;  3BG6 A;  1KQ8 A;  1YIJ I;  1OCT C;  1YS7 A;  1H88 C;  2AS5 F;  1V54 H;  3GZ6 A;  2VQH A;  3RPQ A;  2FBK A;  3CMM A;  3MWM A;  3IUO A;  1ON2 A;  3WHC A;  2V6C A;  2Q24 A;  2WTE A;  1BIA A;  2XAJ A;  1FTT A;  1Z1D A;  5IOZ A;  2KRH A;  3P9K A;  4KN7 X;  3WHB A;  1OCZ H;  1AKH B;  2AXL A;  3BTI A;  3E97 A;  4U0W A;  3ZQI A;  5DAJ A;  4XSX F;  2M7B A;  3OYH A;  4XRS A;  3RZD J;  1OPC A;  4AYB A;  4Y4R A;  2MA3 A;  1KON A;  4GCL A;  4AVZ A;  3SFI A;  1P4W A;  2HDC A;  1P92 A;  1LUJ B;  4XLP F;  3IH3 A;  3K70 C;  1R6R A;  1TWA J;  1XB4 A;  2GZW A;  3MVP A;  3FKJ A;  4UXN A;  2H8R A;  2M4K A;  1IN8 A;  4IOC F;  3R0J A;  5DD8 A;  3K6G A;  1MNM C;  2DA1 A;  5EF6 A;  2ZME A;  2IGM A;  3ABM H;  2W48 A;  3HKZ A;  1D1B A;  4RMN A;  2NVY J;  3JSO A;  4D5F A;  2F5D A;  3E6D A;  3QOE A;  1QHG A;  4KIG A;  2M30 A;  3JRE A;  1YW9 A;  4R79 A;  1MMN A;  1R49 A;  2FD5 A;  3G71 I;  5H9T A;  3E7Q A;  3VFZ A;  1J09 A;  2OCE A;  2G3B A;  3NRV A;  3PNV A;  1IW7 F;  1Z77 A;  3HIM A;  3IWF A;  1NHA A;  1P6R A;  1PUF A;  1K78 B;  2HKU A;  5GPC A;  1D0X A;  4F52 A;  3J80 Z;  4A3G J;  3JRC A;  4OAZ A;  4JX6 A;  1A6Q A;  3G2B A;  1A6I A;  3WTT C;  1E0E A;  2IA0 A;  2LFB A;  2OA4 A;  5DUI A;  3GFL A;  5IOY A;  2VIX A;  2V1X A;  5ICC A;  1SFK A;  2ZSH B;  2ZJR F;  3TW6 A;  4FAS D;  3EGQ A;  3LHQ A;  3VVX A;  2VJJ A;  3V42 A;  1FT9 A;  2OAZ A;  1R36 A;  4D0P A;  4ENM A;  1XCV A;  1HW2 A;  1XC5 A;  1EA3 A;  2PJR A;  3K4C A;  1TLH B;  2OZ6 A;  3VOE A;  3H0G J;  2W84 A;  3MKL A;  5M5Y J;  1YIT I;  1IN5 A;  3GLL A;  3FDY A;  3WOD F;  5F0C A;  3M4O J;  3HOX J;  3GZ5 A;  2D5V A;  1PDN C;  2V4J C;  5B3S H;  4UV9 A;  2A6H F;  2L9S A;  3OIP A;  2UWM A;  2MLG A;  5ICF A;  4RB1 A;  3MKY B;  4XLN F;  1TW3 A;  1H9G A;  4BGD A;  1SD7 A;  2A68 F;  3WTW C;  2L7Z A;  2EK5 A;  4IHW A;  2DMN A;  3E6M A;  2M4G A;  3S1Q J;  2RKH A;  1JUM A;  4CCJ A;  4CYD A;  2O0Y A;  5BMZ A;  1U5T C;  1K7A A;  2XPV A;  2DOE A;  5E79 C;  3TKY A;  2ECC A;  1QPM A;  3JR9 A;  3L2V A;  2UXX A;  4DIQ A;  2DQL A;  3LSH A;  4Q48 A;  2PFV A;  3U2R A;  4MQ9 F;  4C3J J;  3MQ0 A;  1BC7 C;  1PUE E;  4Z6Y A;  1IG7 A;  2KMU A;  2WAQ N;  4QTR A;  1O3T A;  3A02 A;  1YW8 A;  4LK1 F;  3FHN A;  4W97 A;  2COM A;  4ZDO A;  2PFB A;  2M8G X;  5EZG A;  3HEF A;  3ELK A;  1IDZ A;  5F27 A;  2QSG X;  5FRO A;  2UXH A;  2Y0S A;  4HF2 A;  4N9H A;  4HLX A;  2X6Y A;  2HU9 A;  4HAM A;  1D0Y A;  4OIP F;  1X2M A;  3GYH X;  2VON A;  4ICH A;  3LSP A;  4BUP A;  1XSX A;  3F6O A;  2V79 A;  5IT9 K;  2KZV A;  3W2V A;  2V1D A;  1IO2 A;  4CZZ A;  4YEL A;  3BDD A;  1GDT A;  1YE9 A;  4RLF A;  2DO7 A;  1FMW A;  4M6X A;  3ECH A;  4ZH4 F;  2V57 A;  3NWS A;  3ZQ7 A;  1U3E M;  1K79 A;  4UHT A;  1R58 A;  5HDG A;  4CCN A;  2OJE D;  2W4S A;  2G7U A;  2HPM A;  1FBQ A;  3FK6 A;  3QP5 A;  2Z33 A;  4IRI A;  3RQI A;  4KN4 X;  5B5E C;  5B1A H;  1FY7 A;  1ZRF A;  3PNY A;  4WX9 A;  2Y31 A;  3GW2 A;  4A69 C;  2VXD A;  3L7W A;  4IOA F;  2VBX A;  4ON0 A;  3RKW A;  2ZCM A;  1WKM A;  2QCO A;  3G1L A;  2W00 A;  1S3J A;  1S8N A;  3MKW B;  3L00 A;  4YEJ A;  4ZDP A;  4DVY P;  4V19 K;  5AIQ A;  3LSI A;  3GTG J;  4BQQ A;  4L9V A;  1GXP A;  4G9Y A;  1B72 A;  3IHU A;  1X1A A;  2F5C A;  3W2A A;  4G7O F;  3EQL F;  2CV0 A;  3ONQ A;  5FD6 A;  3C2H A;  3M8J A;  2KKO A;  3MNL A;  3TDU C;  2LYC A;  3OL3 A;  1DP3 A;  3F8C A;  4PFO A;  4QLC U;  4BJ6 C;  2NVQ J;  1ETK A;  2L4A A;  3O60 A;  2ICW G;  3M9A A;  4MFE A;  5M5X J;  3CCS I;  3S3N A;  3TBI A;  2VBW A;  3BR0 A;  2K3P A;  1B9N A;  1X3U A;  2Z3Y A;  3VW0 A;  3KCC A;  2N8G A;  3QPS A;  3BPX A;  5F08 A;  4N0B A;  2XB0 X;  3N97 A;  5EG0 B;  2FF4 A;  2J5O A;  2DFI A;  3C7J A;  3V7R A;  4A3J J;  3R61 A;  1MDM B;  3CUQ A;  3PFI A;  4QPO A;  5L3F A;  2XAQ A;  1LQ1 A;  4ME9 A;  2XAH A;  1BM9 A;  1XSV A;  3OIO A;  3RKQ A;  3OYF A;  3FXJ A;  2Y0S N;  1UG0 A;  2X51 A;  3CP8 A;  3WGI A;  3EUK L;  2MC4 A;  1TQP A;  3FZV A;  4BAC A;  2IXS A;  2X85 A;  1XN7 A;  4GFB A;  2ZCN A;  3AG3 H;  3A2K A;  3M1E A;  4I76 A;  4RB0 A;  1VQP I;  2VKV A;  1VQ9 I;  4RLQ A;  3DEE A;  2CU7 A;  1RUN A;  4BY1 J;  3ON4 A;  4U9L A;  3WTX C;  5DTD A;  2G7L A;  5D4S A;  1IRF A;  4AU7 A;  4BXX J;  2GOX B;  3DU6 A;  1BI0 A;  1UFM A;  1K83 J;  2F5F A;  3M8E A;  4QWQ A;  2K86 A;  3U9G A;  2ZNZ A;  2JSC A;  2W24 A;  3GFJ A;  4Y7N J;  2A07 F;  3DEU A;  1D1C A;  4FT8 A;  4IRV A;  2R3S A;  4L9N A;  3WG9 A;  3E3V A;  5K5R A;  4H4K C;  5FLM J;  1BR4 A;  4G7H F;  4ZTF A;  2BXZ A;  2ZFW A;  5IT3 A;  1MBJ A;  2ISY A;  1ZR2 A;  3QU6 A;  1P7J A;  1U2W A;  4IO9 F;  4XM3 A;  3WGH A;  1UEL B;  3ASN H;  2QEX I;  3SEZ A;  4DBQ A;  1O4X A;  3DBR B;  3CES A;  3ESW B;  1ITY A;  1V5F A;  2O8K A;  2F4I A;  2G7G A;  3FMQ A;  1X58 A;  4ZC3 A;  5JLW A;  1ZGJ A;  1D3Y A;  2RN7 A;  4O6J A;  5LHH A;  1JKR C;  4IHX A;  1LVA A;  5TRD A;  3CCU I;  3CQZ J;  4HSR A;  1Y0N A;  4RAY A;  3C18 A;  1ETY A;  2QLZ A;  2I10 A;  4IRG A;  4MEY F;  3M3Y J;  5C44 J;  1VFC A;  2CRG A;  3ABT A;  2RHA A;  1J7K A;  2CSO A;  4EJT A;  2DOF A;  4CGR A;  2EZH A;  5CVU A;  3CMA I;  5C4X J;  2K9S A;  1UI6 A;  5L3E A;  3I4M J;  1WJF A;  1REP C;  3A03 A;  4PSW A;  4J19 A;  2E36 A;  2VE9 A;  4UUS B;  3BQZ A;  2XRL A;  3PFY A;  5LGT A;  3T8R A;  3SQN A;  2PMZ A;  1ON1 A;  3V7S A;  1TNS A;  2DOA A;  3IV5 A;  1YRN B;  1O57 A;  1OIS A;  1ZTR A;  2YS9 A;  1HKQ A;  4L0Y B;  2FEZ A;  3OYI A;  5EJC A;  5J8F A;  5CJ9 A;  3CJR B;  1XX5 A;  3FK7 A;  2UXP A;  2HGC A;  1OJL A;  1V55 H;  5EDN A;  1E3O C;  1O7L A;  4N4O B;  1M1E B;  2DDB A;  4GXO A;  1W5C C;  2DG7 A;  3P7N A;  2ELH A;  3VUQ A;  5D5V B;  5DYM A;  4LLG F;  2EB7 A;  3JRI A;  2HR3 A;  4BEH A;  3HC7 A;  4C2U A;  5IYC J;  4HLY A;  1UG2 A;  2R7V A;  3BR6 A;  2W7N A;  2DA5 A;  1YG2 A;  1V4R A;  3ML6 A;  3BG5 A;  4NDL A;  2D45 A;  2K27 A;  2BGC A;  2NYX A;  2FXA A;  2LD5 A;  1VND A;  1CGP A;  2JUC A;  2UXU A;  5J1U A;  3CCE I;  4XID A;  2STT A;  2K7L A;  2VPL A;  2D2W A;  2YUS A;  4BBR J;  4WK8 F;  5CVI A;  4QIW N;  2K9Q A;  4IF4 A;  4KFC A;  5B1B H;  3N4M A;  2EQR A;  3K0L A;  3LSJ A;  3Q3S A;  3AKZ A;  4XMY A;  3OYG A;  1S72 I;  2V1U A;  2IS2 A;  2A6T A;  4UV8 A;  4A3F J;  1RNL A;  3UR3 C;  4XSZ F;  1N78 A;  2HOA A;  2BZT A;  3ZMD A;  2ZJP F;  3QRF F;  1W36 D;  2W53 A;  3FXR A;  4XK4 A;  3E6B A;  2BV6 A;  2IA1 A;  1J0R A;  3VYR B;  1LNW A;  1WJ5 A;  5H6Q A;  1X1B A;  4BE0 A;  2PMU A;  1IN4 A;  3REO A;  4CDG A;  5JI6 A;  2EWN A;  4KIF A;  3WU1 B;  1T56 A;  3BJ6 A;  4XNF A;  5IY5 H;  3VOX A;  4IHV A;  5K5Q A;  2BY1 A;  1D5V A;  4LJZ F;  1OQY A;  5J1Y A;  1L3L A;  2LKS A;  1VQ4 I;  4YG2 F;  1RC9 A;  1QO0 D;  5E3N A;  4CYC A;  3C2B A;  3GTJ J;  2UZK A;  4LG3 A;  3IWZ A;  4I0A A;  4A3M J;  2HKO A;  2V9K A;  2YU3 A;  1G59 A;  2HYG D;  5KK1 A;  5CVV A;  1RUO A;  3SFZ A;  1MBG A;  5CW8 A;  4C3H J;  1B8I A;  2HWV A;  3D5S C;  2GOM A;  1UI5 A;  4IHY A;  3FWE A;  3VP5 A;  4I2O A;  2B7E A;  1A31 A;  2OBP A;  1IAW A;  1XDU A;  2EJR A;  2FRH A;  3O8H A;  4HNV A;  3R4K A;  4OMY A;  2GXG A;  2E1C A;  3GTK J;  2ZOZ A;  1LEB A;  2HDD A;  4XLE A;  5E8G A;  2AXT C;  2IEK A;  3F8M A;  3DTK A;  3G1M A;  2PLY A;  3A01 A;  2JPB A;  4EM0 B;  4C9Y A;  1HBX G;  3ZQF A;  1AWC A;  3HRS A;  4KJZ A;  4XN3 A;  4AC0 A;  2CGP A;  3DP7 A;  4U7B A;  2K5C A;  1YQA A;  5HSZ A;  3CME I;  3HXL A;  4JYK A;  1CQT A;  2BOL A;  1ENH A;  2P8T A;  3ANP A;  1WQ2 A;  3BLY A;  2ZKZ A;  3E6C C;  4HV6 A;  1Y1V J;  1ZAR A;  3QBM A; 
#chains in the Genus database with same CATH homology
 3QQA A;  4A3I J;  1G2H A;  1RKW A;  3LNQ A;  4A3D J;  4A3K J;  3IUV A;  4X6A J;  3DPJ A;  3HTH A;  3FIW A;  3FRQ A;  3BR5 A;  4JKZ A;  1OCT C;  3MN2 A;  3KKC A;  2M0C A;  1H88 C;  2ZB9 A;  3SJM A;  2OF7 A;  3RD3 A;  2ME6 A;  3WHC A;  2Q24 A;  3UKG A;  1FTT A;  5IOZ A;  2DMP A;  3F0C A;  3WHB A;  1AKH A;  3ON2 A;  4L62 A;  1MSE C;  1AKH B;  2M34 A;  3JRA A;  3BTI A;  1HDD C;  5DAJ A;  3ZQI A;  3NRG A;  2HOS A;  1T33 A;  1JT6 A;  4XRS A;  3RZD J;  3GTQ J;  3S16 J;  3DEW A;  3HTI A;  4D5C A;  5HAW A;  4GCL A;  3PO2 J;  3SFI A;  3S2H J;  2OER A;  2GEN A;  3PM1 A;  3IH3 A;  3JRB A;  3FIS A;  2DN0 A;  3VW1 A;  3ZOB A;  1TWA J;  1HCR A;  2DA2 A;  2GUH A;  1WI3 A;  3MVP A;  2NX4 A;  2X48 A;  2H8R A;  1TWC J;  3JSJ A;  1MNM C;  1ETO A;  1MH4 A;  1FTZ A;  2ME0 A;  2DA1 A;  5EF6 A;  3I4N J;  5F04 A;  3KZ9 A;  2W48 A;  2D6Y A;  3BNI A;  2NVY J;  1JKP C;  1IGN A;  4D5F A;  3JRH A;  2DA6 A;  3JRE A;  2KDZ A;  2O7T A;  1ZQ3 P;  1RKT A;  2JA8 J;  2VPR A;  2FD5 A;  3H3V K;  4B1R A;  5H9T A;  3E7Q A;  4DYQ A;  3BR2 A;  2G3B A;  2XPU A;  2DTZ A;  5J3L A;  1RET A;  1Z77 A;  2FJ1 A;  2H1K A;  2CQX A;  3HIM A;  1PUF A;  2XB5 A;  2EBI A;  5HOD A;  5GPC A;  2HKU A;  1WH5 A;  4GFK A;  2DMU A;  4A3G J;  3JRC A;  4JX6 A;  5JLX A;  2DMQ A;  1A6I A;  2GM4 A;  1X2N A;  2LFB A;  3HBL A;  3HGG A;  2G7S A;  5IOY A;  2L7F P;  3HTA A;  2O9L A;  1BA5 A;  3LHQ A;  3TW6 A;  3EGQ A;  3VVX A;  1BJZ A;  1BW6 A;  2XGE A;  2NS8 A;  4IEJ A;  2E1O A;  1XC5 A;  2HQ5 A;  2IBD A;  4BY7 J;  5CXG A;  5FHP A;  2VI6 A;  2ID6 A;  2B63 J;  2UXI A;  2P81 A;  2R5Z B;  3H0G J;  3MKL A;  1RES A;  5M5Y J;  1ZR4 A;  1JT0 A;  1R9T J;  4NEL A;  3A01 B;  3NI7 A;  3OOU A;  1UMQ A;  5F0C A;  4D7N A;  3HOX J;  3M4O J;  3CWR A;  5C4J J;  5M3F J;  3JRD A;  2D5V A;  1NTC A;  5IP7 J;  1F36 A;  4A3E J;  2DG8 A;  1IC8 A;  2DA3 A;  3FKI J;  1TWG J;  2L7Z A;  3B6C A;  4IHW A;  2DMN A;  4KWA A;  3S2D J;  3HM5 A;  3S1Q J;  1JUM A;  3HKZ N;  1WH7 A;  4FE7 A;  2XPV A;  9ANT A;  2ECC A;  1IDY A;  2QIB A;  4DW6 A;  2EH3 A;  3JR9 A;  4CYC B;  2CUE A;  2G0E A;  4HKU A;  2Y2Z A;  3Q0U A;  5K7Z A;  1VF9 A;  4C3J J;  2LTP A;  2TRT A;  2K40 A;  3HOV J;  1IG7 A;  1ETW A;  2WAQ N;  4QTR A;  1LFU P;  2Y9Y A;  3GTL J;  4UUT A;  2XSD C;  3A02 A;  4W97 A;  3VW2 A;  2M8G X;  5EZG A;  3HEF A;  1IDZ A;  3S1N J;  5F27 A;  2UXH A;  2JA5 J;  2R5Y A;  1Q1V A;  1TWF J;  1JKQ C;  2JN6 A;  4MXM A;  1IRZ A;  2NVX J;  2EZK A;  4JP0 A;  3BR1 A;  5M3M J;  4M3F A;  1SAN A;  5IYD J;  1U9N A;  4AC6 A;  1X2M A;  3OSF A;  4V2F A;  1MSF C;  4ICH A;  2M9H A;  3LSP A;  4M3G A;  2WGB A;  2NVT J;  2QOP A;  4M3E A;  3GBG A;  2DJN A;  3VPR A;  4MLO A;  2MGQ A;  1GDT A;  2E2J J;  2HYT A;  4XIC A;  2X9D A;  2XGD A;  1W0T A;  2MSY A;  3Q0W A;  4AYB N;  4X1E A;  2V57 A;  3TP0 A;  2HYJ A;  1RR7 A;  3NPI A;  2L7M P;  2VUM J;  4BKX A;  1GV2 A;  1EF4 A;  2CUF A;  1ETX A;  3FK6 A;  3V78 A;  1MBF A;  2DA4 A;  4MO7 A;  3RQI A;  3TP3 A;  4AF5 A;  1AU7 A;  1QVU A;  1JTX A;  2Y31 A;  4A69 C;  3G1O A;  3PPB A;  1AHD P;  5FKM A;  2ZCM A;  2NP3 A;  2QCO A;  3G1L A;  2FBQ A;  3CDL A;  3P9T A;  2PBX A;  4DYC A;  2NS7 A;  3W6V A;  3GZI A;  3Q0V A;  1DU6 A;  1U78 A;  3GTG J;  1B72 A;  3TED A;  2R93 J;  3LSG A;  5GPA A;  3LOC A;  5E3L A;  3MNL A;  2PZ9 A;  2AO9 A;  1BW5 A;  5EZH A;  2NVQ J;  1ETK A;  4PXI A;  2Y9Z A;  2GLO A;  3O60 A;  1H8A C;  1QVT A;  2LKX A;  4MFE A;  5M5X J;  2E19 A;  1IV6 A;  2L9R A;  1YRN A;  2JA7 J;  1W0U A;  3D1N I;  2JMW A;  3BR0 A;  3BTJ A;  1IJW C;  3BG9 A;  2ELK A;  3O8G A;  3VW0 A;  2N8G A;  3QPS A;  3B6A A;  5F08 A;  2XB0 X;  1JJ6 C;  2TCT A;  2COB A;  5EG0 B;  2REK A;  4A3J J;  3BQY A;  2OPT A;  1P7I A;  3S1M J;  1K61 A;  3G7R A;  3CRJ A;  3BR3 A;  3IH4 A;  3BT9 A;  1JJ8 C;  1TC3 C;  3COL A;  2JK3 A;  3EUP A;  4ME9 A;  3OIO A;  3ZQG A;  3RKQ A;  1TWH J;  4M3D A;  2FQ4 A;  5FKL A;  3S17 J;  1I3Q J;  5C3E J;  2Y0S N;  4ABZ A;  4JL3 A;  3LSR A;  5BNG A;  2UXO A;  2AHQ A;  4FCY A;  2GBY A;  3QPL A;  2ID3 A;  3TW7 A;  1ZGW A;  4GFB A;  3GTM J;  2ZCN A;  5GP9 A;  2R5Y B;  4I76 A;  1JGG A;  2VKV A;  1Z0X A;  2XDN A;  2CU7 A;  4BY1 J;  3ON4 A;  2G7L A;  5DTD A;  3VVY A;  2L0K A;  4W1U A;  4BXX J;  5D19 A;  1K83 J;  5IYB J;  3S14 J;  1S7E A;  4Y7N J;  2LR8 A;  2CJJ A;  1H89 C;  3BTL A;  1FIP A;  2MG4 A;  3HDD A;  3GTO J;  4Y52 J;  4QSH A;  1ORK A;  2E2I J;  1GVD A;  2WUI A;  2RAS A;  4JX4 A;  5FLM J;  1GV5 A;  1WPK A;  5EGO B;  2LLK A;  3C07 A;  4MK6 A;  4EEF G;  2XPW A;  1MBJ A;  1ZR2 A;  4XRM A;  2R92 J;  4JX5 A;  1P7J A;  1HF0 A;  4FE4 A;  2DA7 A;  2R0Q C;  1LE8 B;  1O4X A;  1IUF A;  1ITY A;  1I50 J;  1APL C;  2O8K A;  2G7G A;  1X58 A;  5JLW A;  1JKR C;  2IAI A;  3DCF A;  4IHX A;  3ZQH A;  3RZO J;  5FLV A;  1UHS A;  1DU0 A;  2XGC A;  3NAR A;  3CQZ J;  2R7Z J;  1MBH A;  1OFC X;  2JWT A;  1GUU A;  2LK2 A;  1LFB A;  1ETY A;  1NK2 P;  2I10 A;  2E2H J;  3M3Y J;  5C44 J;  1VFC A;  4MIM A;  2CRG A;  1GT0 C;  2ZCX A;  3CJD A;  2RHA A;  1B72 B;  3NAU A;  4CGR A;  2EZH A;  4UDS A;  2FX0 A;  4G12 A;  3JRG A;  2JA6 J;  3HE0 A;  5C4X J;  2KT0 A;  2K9S A;  4XRS G;  3S1R J;  3I4M J;  1UI6 A;  5E3M A;  2ZOY A;  3A03 A;  4J19 A;  1ZK8 A;  4UUS B;  3BQZ A;  5F0H A;  2XRL A;  3L1P A;  4UUS A;  3NNR A;  2LP0 A;  4I6Z A;  1WGX A;  5M5W J;  1OCP A;  3E7L A;  3CCY A;  3ANG A;  3JRF A;  3V6G A;  4A3L J;  1FEX A;  5HBU A;  5CXI A;  1ETV A;  2DMT A;  4V2G A;  3IV5 A;  1YRN B;  3G56 A;  5J1R A;  2HXI A;  2QF7 A;  1ZTR A;  2YS9 A;  5DS9 A;  1U9O A;  5F1J A;  3NXC A;  4GCK A;  3FK7 A;  4YZE A;  3VIB A;  2UXP A;  1OJL A;  5EDN A;  2HI3 A;  1E3O C;  4C3I J;  1JKO C;  5F0F A;  2DG7 A;  1JTY A;  2RAE A;  1ETQ A;  2R5Z A;  3AQS A;  5EFY A;  5IP9 J;  4D7M A;  3VUQ A;  1PUF B;  3HTJ A;  3JRI A;  3PO3 J;  5IYC J;  4RDU A;  1UG2 A;  3VVZ A;  3BR6 A;  3QKX A;  2YVE A;  2DA5 A;  3BCG A;  3BG3 A;  2EZI A;  5IP6 A;  1HOM A;  2F07 A;  3BG5 A;  4NDL A;  3HB9 A;  5E3O A;  3SDG A;  3BHQ A;  1BL0 A;  2LD5 A;  4NN1 A;  1VND A;  2ECB A;  4MFD A;  2UXU A;  4M3B A;  3HOY J;  5J1U A;  1A5J A;  3ZQC A;  4XID A;  1MBK A;  5K7F A;  3F1B A;  2NP5 A;  2YUS A;  4BBR J;  2NOG A;  1LE8 A;  2JJ7 A;  4QIW N;  2K9Q A;  4B3A A;  4A3C J;  1JUP A;  3BRU A;  3K7A J;  2EQR A;  2MW8 A;  3LSJ A;  3Q3S A;  1NK3 P;  1F43 A;  1Y1W J;  2LY9 A;  4BBS J;  2LVS A;  3S15 J;  2YU9 J;  4A3B J;  1RPW A;  3T6N A;  4A3F J;  2IU5 A;  5K7H A;  3RH2 A;  2HOA A;  5FKN A;  2X6O A;  2W53 A;  4ACI A;  2M2E A;  4XK4 A;  4C2M J;  2GFN A;  5FMP A;  1VI0 A;  4DZJ A;  5EEA A;  4JNN A;  3KNW A;  2QTQ A;  5EGO A;  1FIA A;  4DZP A;  1FJL A;  1POG A;  4FTH A;  1ZKG A;  1MH3 A;  4FIS A;  3HOW J;  1T56 A;  3VOX A;  1SGM A;  4IHV A;  3B81 A;  1MBE A;  3HOU J;  5J1Y A;  2WB1 N;  1HLV A;  5FJ8 J;  2HOT A;  5E3N A;  4CYC A;  3GTJ J;  3C2B A;  4L5E A;  3GTP J;  3HOZ J;  1HDP A;  4A3M J;  3K2A A;  5AQC A;  2WV1 A;  1XG1 A;  1B8I B;  3IH2 A;  5CW8 A;  1MBG A;  3OSG A;  1I6H J;  4C3H J;  1B8I A;  2VKE A;  3HGY A;  2HXO A;  3AQT A;  2YVH A;  4B4C A;  4A93 J;  2K9N A;  1UI5 A;  4IHY A;  3VP5 A;  3LJL A;  4RBO A;  4HNV A;  3O8H A;  3LWJ A;  2O7O A;  4AUX A;  5IPA A;  2OI8 A;  5D1R A;  3GTK J;  3CMY A;  1D5Y A;  1XS9 A;  2CQQ A;  2ZOZ A;  3BTC A;  5K58 A;  2PMZ N;  1WCM J;  2HDD A;  2Y30 A;  2QWT A;  5EYR A;  5C4Y A;  1QPI A;  3GEU A;  3ZQL A;  2IEK A;  3BJB A;  3G1M A;  3A01 A;  5FKK A;  1QRY A;  3ZQF A;  3VOK A;  4AC0 A;  2EZL A;  4GFL A;  4M6V A;  3PAS A;  2QKO A;  5HSZ A;  5FGL A;  5FKO A;  4JYK A;  4LOC A;  4DYR A;  1CQT A;  4GCT A;  1ENH A;  5EG0 A;  3ANP A;  4S0H B;  5D18 A;  1SFO J;  3KKD A;  1Y1V J;  1U8B A;  1JUS A;  3QBM A;  3S5R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...