5K7FA

Crystal structure of apo aibr
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
184
structure length
179
Chain Sequence
RYRAILETAARLICDRGYEGTSMQEIAAACRMTKAGLYHHIQNKEQLLFAIMNYGMDLFEEQVLSRVQDIANPVERLRACMRHNILLVTRGWSKEVIIILHEGETRAFIDARKKKYVDFLEEAFSQASQQGLIRPVDPTVGAFSFLGMVLWIYKWFKPDGRLTDEQIADGMVGMLFPPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, TetR family
publication title The AibR-isovaleryl coenzyme A regulator and its DNA binding site - a model for the regulation of alternative de novo isovaleryl coenzyme A biosynthesis in Myxococcus xanthus.
pubmed doi rcsb
source organism Myxococcus xanthus (strain dk 1622)
molecule tags Transcription
total genus 69
structure length 179
sequence length 184
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17932 TetR_C_24 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 5k7fA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 5k7fA02
3HGYA 4ICHA 2W48A 2N8GA 2WAQN 1Z0XA 1JKRC 2L7ZA 2ZCNA 1B72B 2CUEA 1SGMA 3ZOBA 2QKOA 3S1QJ 1JJ6C 5IYDJ 1GVDA 2HYJA 3LSGA 3E7QA 5JLWA 5EF6A 3RZDJ 2HQ5A 3CRJA 2M34A 1Y1WJ 2OERA 5IYCJ 3MKLA 2DMTA 1IDZA 1YRNA 3TP3A 5E3NA 3CMYA 3BJBA 3BTJA 2FD5A 1H88C 4XIDA 2QWTA 3HTJA 4BKXA 3EGQA 1S7EA 1ZR2A 3GTJJ 1MH3A 4XRSA 2COBA 3V78A 2PZ9A 1ZTRA 1MSFC 4MFDA 4S0HB 4G12A 5EDNA 5GPAA 4M3GA 1ITYA 5EEAA 1JKQC 2E1OA 2TCTA 2DA4A 3MNLA 3Q0VA 2X6OA 1YRNB 1JUPA 1ETOA 1AKHA 5HSZA 3LNQA 1XS9A 2E2JJ 2GUHA 2K9QA 1U9NA 5E3LA 3JREA 3BR6A 4KWAA 2R0QC 2JA8J 1GT0C 4MLOA 1FEXA 1BA5A 2F07A 4GCLA 4CGRA 3WHCA 2D5VA 4MXMA 5J1UA 3BRUA 1U9OA 3TW7A 1JT6A 3K7AJ 4IHVA 3O60A 2PMZN 1E3OC 2JMWA 3QBMA 4UDSA 3A03A 3ANGA 1IDYA 3LJLA 5EFYA 5M5XJ 1AKHB 2LP0A 2XB5A 3VOXA 1XC5A 2ECCA 1RR7A 1UI5A 4W97A 2FX0A 1GV2A 1LFBA 1QRYA 2LKXA 3CJDA 2XPWA 3MVPA 4NDLA 3D1NI 1MNMC 1HLVA 2EZLA 2RAEA 4C3HJ 2V57A 4M3FA 2L7FP 3LHQA 2DMNA 2HKUA 2EZIA 1UMQA 4A3FJ 3VUQA 1VFCA 1ETVA 3QPSA 3TW6A 2E2HJ 3HOXJ 1HCRA 2D6YA 1MBHA 4V2FA 2NVYJ 2GENA 4ACIA 3Q3SA 2YU9J 3S2DJ 2W53A 2AO9A 5M3FJ 4A3MJ 2Y9ZA 2O8KA 1I6HJ 3HIMA 1RETA 3VP5A 2JWTA 3JRGA 3A01A 1F43A 4MO7A 1QPIA 4A93J 4MFEA 2JN6A 1IJWC 1SFOJ 1AU7A 4HKUA 4ME9A 4M6VA 3JRIA 2R92J 4CYCA 1AHDP 1BW6A 1QVTA 4QTRA 4A3JJ 2UXHA 2XSDC 3HB9A 2FQ4A 2CUFA 3RQIA 3AQTA 3HBLA 4Y52J 5IP9J 3UKGA 3KKDA 1GUUA 3IH4A 4B4CA 2ECBA 2O7TA 2L9RA 4YZEA 3HOYJ 2DMPA 3NXCA 4I6ZA 3PM1A 3IH2A 4M3DA 3A01B 3JRHA 3IUVA 1W0UA 5C4XJ 4D5FA 3I4MJ 3IH3A 1X58A 2UXPA 2TRTA 2QOPA 4CYCB 3ZQFA 4A3GJ 2XPVA 2ZOZA 3CWRA 5FHPA 3CDLA 3COLA 3VVZA 3HGGA 3S5RA 2REKA 4LOCA 3M3YJ 3G1MA 2DTZA 3RKQA 5IYBJ 5C3EJ 3SJMA 3GTKJ 1VF9A 3HOUJ 2YUSA 3C2BA 3BR2A 5DS9A 1NTCA 1OFCX 3JSJA 2DA5A 2NVTJ 3HOWJ 4C3IJ 2JA7J 2MW8A 1TWFJ 3HEFA 5EYRA 2Y0SN 2QIBA 4IEJA 2R93J 3BTCA 3JRDA 3BNIA 3OSFA 1NK3P 3FKIJ 2K9NA 2K9SA 2CRGA 2G7LA 2FJ1A 3H3VK 3OOUA 2OI8A 3HTHA 3BR3A 3ON2A 4AUXA 3BR0A 5FJ8J 2DG7A 2EH3A 2HI3A 2LR8A 3HM5A 3V6GA 4JNNA 4L5EA 2NS7A 1ZQ3P 3NPIA 4NN1A 5HAWA 4XRSG 2EQRA 4QIWN 3KKCA 1U78A 1IG7A 3M4OJ 3LSPA 4JX4A 3HTAA 5FKKA 4JYKA 3ANPA 1TWGJ 2NP5A 1WI3A 4AF5A 5E3OA 4DYRA 2PBXA 3ZQIA 5FLMJ 4DZPA 2CQQA 3G1OA 1ZKGA 4M3BA 2QTQA 4JP0A 4B3AA 2IU5A 4DYCA 2M9HA 1BW5A 3LSJA 3Q0UA 4A3BJ 2M8GX 2IBDA 5F08A 4D7NA 2KT0A 3BG9A 1HOMA 1IV6A 1D5YA 4BBSJ 5F0FA 1OCTC 3BQZA 1GV5A 3SFIA 1RKTA 3JRFA 5EGOA 5K7ZA 4DYQA 3LSRA 1PUFA 3F1BA 4GCKA 1DU0A 3BR5A 1MBEA 1B8IA 1WH5A 5J3LA 1QVUA 4D7MA 4GFLA 2HXIA 3GZIA 2Y30A 3HDDA 2L0KA 2CU7A 3NAUA 3RD3A 5F0HA 3QKXA 1JKOC 4I76A 1P7JA 1MBKA 3L1PA 1H8AC 2QF7A 5D18A 5FMPA 2JJ7A 1HDPA 2H1KA 2I10A 5HODA 5C4YA 2LVSA 5EZHA 2LTPA 5EGOB 1WH7A 3VW1A 1PUFB 4AYBN 1B8IB 3S14J 3NRGA 4L62A 3A02A 3DCFA 3HOZJ 2XPUA 2G3BA 1MBGA 1VI0A 2M0CA 1BL0A 2XDNA 2DMQA 2Y2ZA 2XB0X 1EF4A 3S1MJ 1JTYA 4DW6A 1UHSA 3K2AA 1X2NA 4FE4A 5J1YA 4GCTA 2DG8A 4JX6A 3BTIA 2LK2A 3C07A 5IOZA 4AC0A 5IOYA 1ZGWA 2ZCXA 2R5ZA 4J19A 3B6CA 2ID3A 4JX5A 1JUSA 2ME6A 3FK6A 1NK2P 3FK7A 2HOTA 2G0EA 3B6AA 5F0CA 1FTZA 3H0GJ 4RBOA 2DA6A 2GM4A 1RESA 1I3QJ 5DAJA 1T56A 2QCOA 4NELA 2LD5A 5M5WJ 2XGDA 5FGLA 2EZKA 2DMUA 4Y7NJ 3GTOJ 2OPTA 5M3MJ 4EEFG 1IC8A 4X1EA 2CJJA 3O8HA 3SDGA 4FCYA 2DJNA 5IP6A 1K61A 2ID6A 2NP3A 1APLC 2R5ZB 3BT9A 3S15J 3B81A 3G1LA 2NX4A 2RASA 3QPLA 2M2EA 3GEUA 1JUMA 3VW2A 3HKZN 3CQZJ 1TC3C 3RZOJ 1IUFA 3CCYA 1RKWA 1CQTA 4QSHA 3E7LA 1TWCJ 4B1RA 3BG5A 3G56A 4JKZA 4HNVA 4MK6A 2GBYA 2WGBA 2XGCA 2GLOA 3LOCA 1JT0A 2O9LA 2NVQJ 4W1UA 3TP0A 4XRMA 1XG1A 2VKVA 2O7OA 3MN2A 3QQAA 2JK3A 1P7IA 3KNWA 3VIBA 4A3DJ 2XGEA 4A3IJ 2G7SA 2CQXA 1ETQA 1TWHJ 2IAIA 5K7FA 2NOGA 3S1RJ 1ZR4A 3IV5A 3VVXA 2X9DA 5EG0A 5FKNA 1W0TA 4A3KJ 5FKMA 3ZQLA 4BY1J 2LLKA 4ABZA 1OCPA 2E2IJ 2JA6J 2WV1A 2AHQA 3AQSA 5FKOA 2HXOA 2MSYA 3VPRA 1FIPA 4AC6A 1UI6A 5AQCA 2YS9A 3BG3A 2Q24A 5GP9A 1I50J 5FLVA 4IHXA 1ETWA 3OIOA 3W6VA 4BXXJ 2VUMJ 1WPKA 1H89C 3PPBA 2ZOYA 5C4JJ 3PO2J 3DPJA 3BQYA 5EG0B 3EUPA 5IPAA 3S17J 3OSGA 3T6NA 2G7GA 3JR9A 3HOVJ 2HDDA 3PASA 2WB1N 4DZJA 1FJLA 4MIMA 1Q1VA 1U8BA 1OJLA 3ZQCA 2XRLA 3S16J 1WCMJ 3GTLJ 1LE8A 1IGNA 3RH2A 3S2HJ 3JRBA 2DA7A 2KDZA 5CXIA 2VKEA 3BTLA 5JLXA 2HYTA 1O4XA 4RDUA 1FIAA 2R5YA 5K58A 2ME0A 2DA3A 2DN0A 2R7ZJ 2RHAA 4A3CJ 4GFKA 2JA5J 1DU6A 1VNDA 4IHWA 3PO3J 3NI7A 4X6AJ 3F0CA 2EZHA 3BR1A 4M3EA 2EBIA 3FIWA 2VI6A 5M5YJ 3KZ9A 3Q0WA 1JJ8C 4XK4A 3DEWA 1Y1VJ 2LFBA 1LE8B 1RPWA 5CXGA 2K40A 3S1NJ 2NS8A 3GTPJ 2HOAA 2LY9A 5FKLA 4FE7A 1LFUP 4BY7J 1HDDC 2YVHA 5D1RA 2R5YB 2H8RA 5F27A 1X2MA 1MSEC 2B63J 4FTHA 3LWJA 4V2GA 1BJZA 5DTDA 3I4NJ 3VW0A 3JRCA 1UG2A 1JKPC 5H9TA 5BNGA 1MBFA 5K7HA 3ZQGA 1ETYA 1SANA 1WGXA 1ENHA 2L7MP 2ZB9A 5F1JA 4PXIA 1ZK8A 1HF0A 4D5CA 4A3LJ 4BBRJ 1ORKA 2MGQA 5E3MA 4C3JJ 3GTMJ 2E19A 2IEKA 5F04A 2DA2A 3BHQA 2Y31A 3O8GA 3NNRA 1K83J 3GTGJ 1JGGA 1POGA 2P81A 4IHYA 3GTQJ 5IP7J 1TWAJ 3GBGA 4UUSA 2NVXJ 4FISA 3JRAA 2UXUA 4GFBA 4JL3A 1R9TJ 3HTIA 3NARA 4A3EJ 2X48A 2YVEA 1FTTA 4XICA 1T33A 5EZGA 1A5JA 1A6IA 3ON4A 2UXOA 2UXIA 2HOSA 4UUTA 2ZCMA 3ZQHA 1MBJA 1B72A 3BCGA 1GDTA 5D19A 1MH4A 5J1RA 2VPRA 1ETXA 5C44J 4UUSB 2FBQA 3FRQA 3G7RA 5HBUA 1G2HA 3VVYA 3TEDA 1F36A 9ANTA 4A69C 4C2MJ 3VOKA 3P9TA 5GPCA 3WHBA 1Z77A 2MG4A 3FISA 2WUIA 5CW8A 1ETKA 2GFNA 2ELKA 1IRZA 2DA1A 2OF7A 1JTXA 2Y9YA 3HE0A
chains in the Genus database with same CATH superfamily
2MC4A 4ICHA 4IX7A 1Z3XA 2WAQN 4GRIA 3K4LA 5GAGJ 2QQBA 5CYVA 3SZTA 1IRXA 2ZCNA 2W00A 2DK5A 2CUEA 1MZBA 2L5QA 2NNNA 2B1EA 2HYJA 3P9IA 4M9ZA 2F4OB 4L0YB 2HQ5A 1WSUA 3K1PA 2M34A 2YVEA 2KKOA 1BN5A 2DODA 1SD6A 1FMWA 4KT5C 2QWTA 2FD5A 4XIDA 2AXLA 1S7EA 4AIKA 3HJEA 2V1UA 4HF0A 1RC9A 3HTUA 1G3YA 2CFXA 2PZ9A 5BQTA 2V6CA 2CYYA 1LDKB 1RRJA 4MFDA 4ENNA 2F5EA 2EFPA 2BW3B 2Z33A 1JKQC 3L9FA 3S93A 2O03A 3REOA 2ICWG 3DEUA 3LMMA 3MNLA 2MLKA 3Q0VA 1E3HA 2X6OA 5HS7A 1YO5C 4WXCA 4LITA 2NNYA 1VQMI 2GUHA 5K1YA 2OD5A 4HF1A 1FP1D 3BCBA 3BR6A 2CV1A 4MLOA 4GCLA 3C18A 4U0YA 2D5VA 3K4CA 1S72I 3E97A 3BRUA 3RCOA 3P9CA 4NC8A 1QHGA 1MGTA 5CVVA 1E3OC 3LJLA 3ZPLA 3HPGA 2K7LA 3ZMZA 4OAZA 4OOIA 2H6BA 5L3CA 2ECCA 2VJIA 2GIZA 3H36A 3K4JA 4RS8A 1QRYA 1BI3A 4GCVA 4E7ZA 2DQLA 2XPWA 4NDLA 4XSZF 1W5TA 2P6TA 4M3FA 3O6BB 3LHQA 1P92A 2X85A 1EH8A 2HKUA 3O3KA 2Q2EA 3VUQA 2EA2A 2O3FA 3VSLA 2E2HJ 2HS5A 1M1EB 1HCRA 4Y15A 4I09A 2HPMA 1FOXA 3KP2A 3CTAA 3CP8A 4E7SA 3QYEA 3R0AA 2GENA 3Q3SA 1IRGA 1XGNA 5DEQA 5H2FC 4BHBA 2LY1A 3OYCA 4A3MJ 1I6HJ 3I0TA 4LMYA 3VP5A 2QSFX 2M7AA 2IA2A 2JWTA 4ZYHA 3A01A 4KYWA 2EV0A 2JTVA 4MO7A 4M9XA 4I2OA 3HXLA 2XVCA 3EUKL 2VODA 3NWSA 4CYCA 2IGOA 1TNSA 5KNLA 1SMYF 2UXHA 5H6RA 3HB9A 3VYSB 5ILSA 2PFVA 4LB6B 2LOOA 2XDVA 4WWCA 4Y52J 1GHCA 2B3WA 3ABMH 3JW4A 1LDJA 3MWMA 4ZYEA 1OLTA 2L9RA 2VQHA 2X1EA 3MZ8A 3NXCA 4N9IA 1R4MB 1G4DA 3IH2A 3K70D 1UAAA 1MD0A 1V55H 3SEZA 3TQNA 1R71A 1W0UA 1KYWA 1X58A 2UXPA 1C0WA 2QOPA 5H6QA 4HX8A 4HZFA 2QENA 5FHPA 2VIXA 3COLA 2PMHA 5JHUA 3C2HA 2XASA 3HOSA 4A6DA 3M3YJ 3RPQA 4BEHA 3FXJA 5IYBJ 5C3EJ 3GTKJ 5CKTA 2YUSA 1UFMA 3WGIA 1I27A 1ZARA 3BZCA 1Z67A 4IOAF 1R1TA 2F2EA 3JSJA 4MGRA 3HOWJ 2MW8A 1TWFJ 1Z3YA 2QIBA 3JRDA 4NC7A 2CQKA 4ZYAA 4Q48A 1V4RA 2K9NA 5GTIC 2K9SA 2CRGA 3PFYA 2ZKZA 1MDMA 4Z6YA 3CCLI 1LPQA 1LJ9A 3FXUA 3ON2A 1P9QC 4AUXA 3ZMUA 4HF2A 2IT0A 1S6LA 2BZTA 4DIQA 2MBFA 3KLNA 4XOPA 3ZQ7A 3AL0B 1ZREA 2E34A 3ERMA 1YS7A 1ZQ3P 2BV6A 2DPUA 3DPTA 5LHHA 3FXQA 3HSFA 4QIWN 4CYDA 2L54A 1K4SA 4EJTA 5E3OA 1REPC 1T98A 4HX7A 3ZQIA 1TQMA 2CQQA 2OA4A 3SHFA 3X2QH 3GO5A 4PJ0C 3AKZA 3ZN1A 5EEGA 4A0XA 1XX5A 1BW5A 1BR4A 3LSJA 4OIQF 1PJRA 4A3BJ 1MMDA 4D7NA 3FBIB 2EB7A 3BG9A 3NQOA 2JZYA 2L9NA 5KK1A 5TJJA 4PDKA 1GV5A 2K02A 3JRFA 3LSRA 4GCKA 2ISYA 3IWFA 3V7SA 1OR7A 1QVUA 5JVTA 1DPUA 4C2MA 4GFLA 2HXIA 4EQQA 4I98B 3HDDA 2V4JC 3H9QA 1R7JA 2E60A 3W3CA 4OD4A 2O61A 2ZJPF 3HPHA 2ISZA 2L4MA 3KP7A 3GYHX 4ESJA 4Y3OA 2B0LA 3HHHA 2UXXA 2QF7A 2OAZA 2XAUA 5EZHA 5EGOB 1WH7A 5CPRB 1WJEA 2YU3A 1PUFB 1G3TA 1T95A 2HFHA 3ABLH 3CCEI 1B8IB 4FASD 3LWFA 3MFKA 3S14J 3NRGA 2LSOA 4KMUX 3JAMZ 3I59A 4AVZA 1JE8A 3HOZJ 2XPUA 2HEOA 1MBGA 4JQFA 1VI0A 2CG4A 2Z16A 1VTNC 4XLNF 2CS3A 2QLZA 2VASA 3FBNB 1YTYA 4F3QA 3M8JA 5FFZA 3ZCOA 4FE4A 1R1UA 2HZTA 2VQCA 4F7ZA 1ZLJA 3SWHA 3BTIA 2HZDA 3F9KA 4OAYA 1W7PA 3M1EA 5IOZA 4AC0A 3OS2A 3GMEA 4L9VA 3B6CA 3OYKA 3GLLA 5GTHC 3TBIA 4RAYA 2EK5A 4RBOA 2DA6A 3DEEA 4BNCA 2UUZA 2LKSA 2VQLA 2Z99A 2XSJC 1VZ0A 1S29A 1UELB 2XGDA 5FGLA 2DMUA 1O57A 3GTOJ 4XM3A 2H8WA 3ESWB 2XROA 2CFOA 1YHQI 4EEFG 4X1EA 4FCYA 2DJNA 4DJAA 2R5ZB 4A0YA 4ZYDA 4ZZDA 4U7DA 1IF1A 4TV7A 1W4MA 3IKVA 1X3WB 4C2TA 3W2AA 3M07A 1B4AA 2E1MC 1F1ZA 2BGCA 3CQZJ 3OOPA 4E7KA 2IVMA 1TC3C 1IUFA 3WG9A 3IC7A 4EJWA 4U7BA 1U6GA 2A6EF 4OWRB 3U1DA 4DBRA 3AG2H 1XSDA 4XBFA 4B1RA 1T08B 5CVIA 4RB1A 2KZVA 4HNVA 5B1AH 2WGBA 2GLOA 2OTJI 2O9LA 4N4OB 3TP0A 3W2WA 3J7AO 2OQGA 1XG1A 2JUCA 2VKVA 2JK3A 1P7IA 1XGSA 1MMGA 1ON1A 1RNLA 4Y33A 1PVEA 2DJIA 4HNUA 3DLAA 1B9NA 2HDWA 2G7SA 3R4KA 2BBYA 4PUSA 4HLYA 3ZMVA 2X9DA 2VKHA 2R7DA 2ZBKA 2LLKA 2PJRB 2LNBA 3D5RC 4L5IA 2WV1A 1OQYA 5GAHJ 4GYGA 3L2CA 4BAYA 3IL2A 2YS9A 3Q5FA 3CF2A 5HDGA 5D5XB 2HQNA 2KHMA 4M6XA 4IHXA 1LDDA 3W6VA 4BXXJ 2O0YA 1WPKA 3FMSA 4LG0B 2OC6A 3M8EA 2FMYA 3PO2J 5EG0B 4QPOA 4UUVA 3DQVC 3S17J 4GYIA 1D0XA 2G7GA 2KRCA 1ZGAA 2HDDA 2WB1N 1TTYA 2WAFA 2QBYA 1OCCH 2FXAA 2XAJA 4E70A 3S2HJ 3H9JA 5DD8A 5CXIA 1IN6A 2XF5A 5JLXA 3OYFA 3IKTA 1ZGJA 3SZGA 3B73A 4LG3A 3W2VA 3G71I 4BS9A 4BHCA 1Y39A 5K58A 2RKHA 2DA3A 4A3CJ 4EM0B 4GFKA 1DU6A 2O5RA 3BR1A 2P8TA 1GVJA 3FIWA 2VI6A 4LK0F 2OU2A 3Q0WA 3SZPA 2LF8A 2ELHA 4HQEA 1U0JA 3DEWA 4PSWA 1HKQA 2V9VA 3CMAI 2RVCA 3CD6I 2WC2A 2HOAA 2QQ8A 1T38A 1LFUP 4BL0B 1TQPA 3WTWC 3GZ6A 5D1RA 3ZP5A 2R5YB 2K4BA 4A5MA 1EA3A 3CLQA 1WJDA 5FB2A 2OBPA 2B63J 1X2MA 4FTHA 4Q5SF 4V2GA 1DGWY 5DTDA 3I4NJ 1G8XA 5AONA 4D0PA 4WF2A 3U9GA 1WWXA 3S3MA 1WI9A 5D6EA 2V79A 1ZK8A 3KEYA 4BJ6C 2E1CA 2A61A 2O8XA 4IJAA 4BBRJ 5KCMA 1KQ8A 5E3MA 1TW2A 2IEKA 4Y4RA 5J8FA 3BHQA 3V8KA 4FX4A 3WTUC 3DPLC 3WGHA 1POGA 3FXKA 2FBIA 3PFIA 2PMUA 3WTVC 5IP7J 1TWAJ 1YG2A 1LNWA 3EUAA 3GBGA 5E18F 4AIJA 4FISA 5D4SA 5HLGA 1R9TJ 4WIBA 3NARA 1FTTA 3PUBA 3CCMI 2A6TA 4PFOA 1R36A 2K4JA 5EZGA 1T8IA 1I1GA 3T0YA 1A6IA 4JBAA 3E5XA 4HSRA 3ZQHA 4F91B 1MBJA 1Y56A 3TMOA 4ESBA 2DK8A 2A6HF 3GFMA 3BCGA 1XSXA 2XV4S 1GDTA 4CXFA 1ETXA 3G7RA 4IQJA 1STZA 3GW2A 2A69F 5L3GA 4C2MJ 5BS6A 1FX7A 1Z77A 1J9IA 1YIJI 4A5NA 2QQAA 2GFNA 2DFIA 1NG6A 1JTXA 2LYCA 3ROUA 1KQ9A 2N8GA 1U5TB 3HUGB 5E1WA 4L9NA 5IY5H 2XF7A 1JKRC 1WJAA 2L7ZA 3ZMDA 3H0DA 4RAGA 4YELA 1B72B 2QGUA 3TL4X 1SGMA 3C3WA 3DLLF 1PP8F 1GVDA 4PZJA 3LSGA 4G9YA 3E7QA 5JLWA 1TLHB 2ZJRF 3G6EI 1X3ZB 3NEUA 5HVQC 2OERA 3FHNA 3J80K 3BOQA 3J7AY 1IDZA 3TP3A 1T6SA 4U0VA 2GOMA 3CMYA 3BJBA 2QA4I 3WE2A 3EGQA 2RREA 1MH3A 1WVRA 4XLFA 2COBA 3V78A 1UB9A 3U1KA 3LFUA 2WY7Q 3KZZA 1QNTA 5GPAA 4I7HA 2M30A 1ITYA 5EEAA 2IA1A 3OIPA 1J0RA 1WRJA 4A6EA 2DA4A 2LH9A 4XN3A 1YRNB 3KCCA 5HSZA 4L5JA 3J81K 3FHZA 1YOVB 2QSGX 1OPCA 1FEXA 3OYEA 4CGRA 2K27A 3EQLF 1R49A 2EFNA 3LL7A 2P7CB 4E7LA 3TW7A 1SD4A 2LMDA 5HNFA 1HQCA 2OCEA 2JMWA 4RAZA 3ANGA 1IDYA 1YIOA 4OINF 5EFYA 1AA7A 2LP0A 2XB5A 1AKHB 3LFKA 1XN7A 4HA8A 3ZN0A 1RR7A 3OL3A 3VOXA 3CO6C 4W97A 3VYUB 1U2WA 3I56I 4ENMA 1MNMC 3D1NI 2HDCA 3CCVI 1DDNA 4XKBA 2RAEA 2MLGA 2BEOA 1B1BA 2JVGA 1UMQA 3F22A 3N97A 1W36C 3HTSB 1VFCA 1ETVA 2WBMA 2GXAA 3P9KA 3QPSA 3TW6A 1MKMA 2D6YA 2NVYJ 5E17F 2NRAC 2YU9J 2W53A 2VLAA 1QZYA 2O8KA 2ZMEB 2LRDA 1H0MA 4UVBA 3HHGA 3OYAA 4CCOA 4CCNA 4KN4X 1IJWC 3K4KA 2IJLA 4KMFA 2QUFA 2R92J 3L7WA 4YIIA 4DOZA 1AHDP 1CF7A 1ACIA 1FBUA 2FQ4A 2A5YB 2CUFA 4A0ZA 2R7RA 2X6WA 3AQTA 4I99C 3UKGA 1R5ID 3KKDA 4YRVA 1UHWA 4UXNA 4YZEA 3CJQB 2Z3YA 2DMPA 1N25A 4I6ZA 3PM1A 3MD2A 3CDIA 4KT6A 4M3DA 4G6DA 4NB5A 5J4VA 4EV0A 5J6XA 2DFHA 3JRHA 3F23A 2I8DA 2ZNYA 1AOYA 1LEAA 3SFZA 2OZUA 3A0BC 3K0LA 1FZPB 4HRIA 2RDPA 4P9FA 1I1SA 4JOMA 3ZQFA 1EJ9A 2BOLA 3CDLA 3VVZA 5J4YA 4LOCA 2CV0A 3WTZA 3CDHA 3RKQA 3HOUJ 2V9KA 5DS9A 1OFCX 2VJJA 5DM6F 1QA6A 4HBLA 4G7HF 5D8KB 2L01A 4BACA 2F5VA 1Z21A 2DO7A 2FUG2 2VBYA 4OU0A 3I71A 4BDYA 3OSFA 2BY0A 1X1CA 3E6MA 1QZEA 3WU1B 4QWQA 4HPQA 2PQ8A 2KDOA 2G7HA 4IZZA 5TRDA 2E71A 5LBQA 5TISC 4YIFA 3HTHA 4BJ5C 3KP4A 4MTEA 1X19A 4M71A 3VODA 3H92A 1D8JA 5FJ8J 2VJ5A 3EPZA 2EH3A 1ZELA 2LR8A 3HM5A 4JNNA 3V42A 3BJOA 4LLLA 2NS7A 4AIHA 4KUMA 3NPIA 4BQOA 3J7ZI 3KP6A 3BDDA 2BHZA 4P96A 2VN2A 3P7NA 3QOEA 3HTAA 3IUOA 3ANPA 1WI3A 2KL4A 4DVYP 1X3UA 1K6YA 1VQ4I 1MNDA 4DYRA 5KAIC 4U87A 1FSHA 5FLMJ 3ZXSA 2L2OA 4M3BA 1TL8A 2QTQA 4I01A 3FZVA 2Z5UA 4JP0A 2DT6A 2CUJA 4B3AA 5BMZA 3QPHA 2M9HA 2M1BA 5AIQA 4WX9A 2DBBA 3DBLB 5BPIA 1Y8QB 3CUQC 1K78B 2MFZA 1U3EM 3N05A 3SFIA 5K7ZA 2KIFA 3H3UA 3NWTA 4GXOA 4NHJA 3BR5A 1ZYRF 4RLQA 4KA4A 2AS5F 3GUDA 1VQ6I 5J3LA 2MYSA 4D7MA 2EIJH 5CJ9A 3FXMA 2EFOA 3T1BA 4ENKA 2ZXJA 3J7YJ 4V19K 3NAUA 3AAFA 1Z05A 2E7WA 4HV6A 1KA8A 5F0HA 3QKXA 1GXQA 1I6XA 3G4SI 1P7JA 2A07F 3L1PA 1P2FA 1FPQA 2GAUA 1H8AC 2H1KA 4NQWB 4DBQA 3DTKA 2LVSA 3VW1A 4IL6C 4EGYA 4OMZA 4CGZA 4L62A 2DT5A 3F8CA 3A02A 3FX3A 4G94A 4N9HA 2DOFA 3V8JA 2M0CA 1BL0A 2XF6A 2Y2ZA 2XB0X 4GDFA 1GLNA 1LB2A 2H27A 3RYPA 4IHTA 3AG1H 1W1WE 3TOAA 3S1MJ 4XOTA 3G73A 1PP7U 2QQ9A 2X4HA 2YX4A 3OIQA 2QKLB 4G6TB 5J1YA 4GCTA 3HG9A 2DG8A 4ZDLA 2JPBA 2LK2A 3OL4A 5IOYA 4MNUA 3WU2C 5LHIA 2ID3A 5LD2C 1R23A 1E3PA 4ON0A 1YQAA 2HOTA 2G0EA 3B6AA 1JHHA 3HKZA 2DOAA 3QP5A 1HSTA 1RESA 1I3QJ 3FMQA 1YJNI 5DAJA 1IN8A 1B9MA 3WTXC 1QPMA 2M87A 1BOAA 1ZG5A 2ESHA 4U0WA 2EZKA 3VTIA 4Y7NJ 1MJAA 1X1DA 5DUKA 2BXZA 3SDGA 4BHPA 1K61A 4XLAA 3COAC 2GWRA 2BXYA 1MJ9A 5L3DA 3BT9A 4B8XA 4U88A 5LRRA 1HKTA 3K6GA 1TNTA 3T8RA 2GXGA 3MAJA 1JUMA 2V1DA 3R61A 1ZRCA 2IS6A 3CCYA 1CQTA 1IO2A 4M74A 3PQKA 2Y0MA 1V5GA 1T0FA 4E4HA 1D5VA 1OYYA 3QU6A 3E7LA 2VJ4A 2VQGA 4ZTJA 4P1WA 2GBYA 3QYBA 1MJBA 3RDIA 1LFPA 1D1AA 4W1UA 4XRMA 2O6GE 3GXOA 2W1OA 4KIBA 3PIOF 5B5EC 3KNWA 4HV5A 1J2XA 2HNHA 1Y6IA 4MHGA 5J40A 3KIOA 1Z1DA 2IAIA 3KEQA 3CC4I 3VVXA 5LRSA 3IV5A 3MKZA 3J80Z 5FKNA 1OYIA 3E6BA 4A3KJ 2E36A 3TGNA 1SD7A 1OCPA 5FKOA 5EJCA 4B09A 3VPRA 1BI1A 2K3PA 3ECOA 3KETA 1FYKA 1UI6A 4AC6A 3BG3A 4PK4A 3L2QA 5GP9A 4IOCF 5CVRA 3CP2A 1I50J 4Z2YA 3K69A 5D5WB 4UV9A 3CCSI 1RR8C 2OZ6A 5FLVA 1G3SA 2P6SA 4RM2A 1WJ5A 1QHHD 1XGMA 2R4GA 1ZHFA 3LSKA 1H89C 2J5PA 5C4JJ 2ZSIB 1PYVA 1SAUA 2DU9A 5DDGA 1MW7A 1FYLA 2NXNB 2XC7A 2LG4A 5HS8A 2PEXA 1K79A 5D5UB 3T6NA 2VT3A 4DZJA 5K5QA 4MIMA 2RQPA 3TOBA 1U8BA 1YX5A 1OJLA 3TO9A 2XRLA 2CQ7A 3RPUD 3GTLJ 3ULQB 2CMPA 1DGRM 2XKOA 3ECHA 2QYOA 1IGNA 4CICA 3JRBA 2DA7A 4CO8A 4N0BA 5ICFA 4KN7X 5E8IA 2KDZA 3OS1A 3BPXA 2GOXB 4X0GA 4XRFA 2FNPA 2ME0A 2DN0A 2MH2A 4MEYF 2JA5J 2WTEA 5FGMA 3OYGA 1VNDA 3PO3J 3NI7A 4X6AJ 2PBIA 1ERDA 5M5YJ 3KZ9A 2KLOA 3R6SA 4XK4A 3RYRA 1LE8B 2E1MB 1B6AA 3PL8A 4HX4A 2LBFB 3AL0C 5FKLA 3TKYA 4NC6A 2ZC2A 4HEA2 1HDDC 4XLCA 4XNFA 4L18B 2YVHA 2EIMH 3VEPA 2DOEA 3EDPA 2KJCA 2V1XA 5F27A 3LWJA 3V7RA 1BJZA 4P55A 3VW0A 2H6CA 2R3SA 1E2XA 3ASOH 4XLHA 3ZQGA 4E7HA 1ETYA 2ZB9A 5F1JA 2L7MP 1XCBA 5J8CA 3LQRA 1LQ1A 1G59A 4BQNA 2DLLA 3ISPA 4A3LJ 4Y13A 4E7JA 3FKJA 2DDBA 3OYMA 4C3JJ 3GTMJ 2CGPA 5DCFA 3CUQA 2Y31A 3NNRA 1K83J 1JGGA 4CZZA 4IHYA 2P81A 3H1CA 5JI6A 1BOBA 3DU5A 3KP5A 3WGGA 1D1BA 2KFDA 2NVXJ 3K9TA 4GFBA 2XRNA 3K70C 2W82A 2MD5A 4II2A 4BGDA 1R5HA 3CESA 2R7OA 2FMLA 2HOSA 1YW8A 4IRIA 2NAZA 4M9SA 2ZCMA 5LGTA 2KJBA 2EIKH 5D19A 1SAXA 5J1RA 4UUSB 2VPRA 5AIPA 1ONVA 1NH3A 3E6CC 4IRVA 1G2HA 4WXDA 2GA2A 1NG7A 3P9TA 3F6OA 1SMTA 5GPCA 2UZKA 3KYLA 3HIFA 3FISA 2UV1A 2ELKA 3LA3A 3CZ6A 2HTSA 2DA1A 3K4NA 3QWLA 3RKXA 2HYGD 3HGYA 3HE0A 2W48A 3LSMA 2XIGA 2Z1DA 5HLIA 1HC8A 2FE3A 5DCMB 1K7AA 3ZOBA 1JJ6C 1A6QA 5IYDJ 2BW3A 2IXSA 1IXSB 3CJRB 5ICGA 1FMVA 2AXTC 1Y1WJ 1SFEA 1XMXA 2W85A 3DBRB 3MKLA 1WZ2A 2ELJA 2MC3A 2W7NA 4KIFA 2EFWA 3BPVA 1K6OA 1UCRA 1KGSA 2PN6A 3BTJA 2CO5A 3MZYA 1Z9CA 1H88C 1W5SA 4BKXA 2V6EA 1ZR2A 3TO7A 4XRSA 2ZO4A 1VQNI 1MSFC 4L9JA 1A35A 3K2ZA 2CV2A 4S0HB 5EDNA 3OYBA 2PMZA 3RSNA 1B59A 4RB3C 3CJTB 1IV8A 4M3GA 1D8KA 3CCRI 3CO7C 1YE9A 1BC8C 1ZRDA 2VBZA 1XPXA 2HTJA 4R8HA 3KE2A 1JUPA 3ZRGA 1TQIA 2IGNA 2LF7A 4UV8A 2E2JJ 2K9QA 1U9NA 2R0QC 2JA8J 3HL2A 1GT0C 1BA5A 3Q9SA 3WHCA 4CCLA 3L2WA 4MXMA 1BR2A 1U9OA 1XCVA 4H4KC 4OD5A 1Z6RA 1YLFA 3K7AJ 4DQ2A 4IHVA 4FHTA 4CZCA 3I58A 3QBMA 3A03A 3I3LA 3MKYB 1KONA 5M5XJ 2HVSA 3W6KB 4M6YA 2IGKA 4ZJZA 3HC7A 2PLYA 4MTDA 1GV2A 1LFBA 2LKXA 5LEKA 2JVHA 2COMA 3CJDA 1USTA 3ONQA 4C3HJ 2V57A 2L7FP 1OKRA 2W25A 2KIQA 2K86A 4BE0A 2R7UA 2W24A 2FQ3A 1MBHA 4LK1F 4V2FA 4BH9A 2BYVE 4HOBA 4XSXF 1XMKA 3T8TA 4ACIA 3DKYA 2AO9A 2HQAA 3HIMA 5ICEA 2GIVA 3JRGA 1F43A 2K9LA 1O3SA 1QPIA 4A93J 2JN6A 1YJ9I 1AU7A 2P7VB 1Z6TA 4YIRX 4M6VA 4BE1A 3JRIA 4KITB 5FFXA 1O7LA 4YFXF 3FF5A 2KMUA 2Q2EB 1BW6A 1QVTA 1S7AA 4QTRA 3BC8A 2XSDC 4A3JJ 4FT8A 3OR1C 2L7KA 1OCZH 1UG0A 2ZFUA 3BCAA 3DBHB 5B66C 3ERED 1AWCA 2HGCA 2KRHA 2OQRA 2WY8Q 4LLNA 5FO5A 1NHAA 1TBXA 1GUUA 2GXBA 4CH7A 1QZZA 4D1QA 3RJPA 2Y0SA 5DD4A 2VE9A 3A01B 3IUVA 2DI3A 5LLQA 4WCGA 3R60A 3I4MJ 5C4XJ 3F8FA 3IH3A 1L0OC 4E7IA 2YVXA 4CYCB 2K5CA 4A3GJ 2XPVA 2ZXWH 5LHGA 1HW2A 2ZOZA 3CWRA 3HGGA 2KIUA 2REKA 3F8NA 5HDNA 2E1NA 3E3VA 3G1MA 1J09A 2DTZA 2EILH 1VF9A 3C2BA 2FBKA 3BR2A 5L3EA 4HDVA 1NTCA 1YW9A 2RN7A 1HSJA 2D1VA 2DA5A 1ZG1A 2MA3A 2NVTJ 2HYFA 2LKPA 2DT7B 2P5KA 3WODF 4C3IJ 1IAWA 2FJI1 4YEJA 1KU2A 3HEFA 3EYYA 5JR3A 3BG6A 1NK3P 3FKIJ 3BZKA 1HA8A 2E7XA 2FJ1A 3H3VK 2NYXA 1JXSA 4BDZA 4BEHB 2GA1A 3GF2A 3BR0A 2DG7A 2CW0F 2IS4A 1SVMA 5CVUA 1IXCA 2QWWA 1XGOA 4XONA 2W84A 4F93B 3P5JA 2RV8A 4XN0A 5HAWA 2ZXHA 4XRSG 3I55I 1FP2A 1X1BA 4K2EA 1IG7A 4Q47A 1Q1HA 3LSPA 2X1DA 3T5XA 1QU3A 3VYRB 4F55A 4BYYA 1TP4A 4HSTA 1MDMB 4IF4A 5EEHA 4EJOA 4S04A 4IXAA 4DZPA 2GQQA 3G1OA 2WAEA 3BG7A 1H9GA 2IU5A 4KDPA 3L2VA 2L4AA 2DFEA 3PNTA 2M8GX 2IBDA 1FYMA 2KT0A 1TZLA 1IV6A 1D5YA 1SFKA 2M4GA 4IPAA 4AYBA 1Z7UA 1HKSA 1ON2A 1R4NB 2KISA 1RKTA 3C2GA 5EGOA 1IN4A 5E20A 1PUFA 5FRMA 2XHKA 1DP7P 3VYTB 3PNYA 2ACJA 3F1BA 2XUBA 1MBEA 2HU9A 1B8IA 1WH5A 3BLYA 4AD9A 2Y30A 4XR6A 1UZCA 1R1VA 4XKWA 3RD3A 2JRMA 1U5TC 1V5FA 3OS0A 2FOWA 1FOYA 1IN5A 3LSTA 5F64A 5ILUA 5D18A 1T0FC 2BVLA 4NNJA 1HDPA 5IT3A 1TT0A 5C4YA 2VL8A 2MD0A 2LTPA 1BR1A 3H5AA 4BXUA 2HQRA 5GAEJ 3OYDA 5DYMA 4XORA 1Z91A 2X6YA 1LEBA 1SVOA 3KZYA 3QYFA 5D5VB 3CF5F 1OISA 4OIOF 1S3JA 2XDNA 2DMQA 4LIVA 2GZWA 3C1DA 3HSEA 1FNNA 1UHSA 5B3SH 1FSEA 3K2AA 4KJZA 1O3TA 3JAMK 3F72A 3FM5A 3C07A 2CQNA 2A5WA 2ZCXA 1ZGWA 5E1ZB 2R5ZA 1EKEA 1PUEE 2ME6A 1JUSA 1NK2P 3IHUA 2AQFA 3FK7A 4H0EA 1KU3A 3I59B 4L0ZB 5F0CA 3LA7A 3H0GJ 2RGVA 2LREA 2XKPA 4N4NB 2GM4A 2B9SA 5FROA 1T56A 1KU7A 2QCOA 2F48A 2QVOA 2WWYA 1DP3A 4NELA 2LD5A 3VB2A 4NBQA 3DU6A 5M5WJ 2CUZA 1OMIA 4OMYA 5IT9K 4KFCA 1TW3A 1BIBA 2DQRA 3ZMTA 2OPTA 3QAHA 1ZG3A 1U8RA 1W7PB 4MQ9F 3RPUA 5A2QK 2A05A 2ID6A 4PGHA 1WQ2A 1APLC 2ZY9A 2VB6A 1BBYA 3M7GA 2MABA 3S15J 2FNAA 5ILVA 3B81A 3L2RA 3L2UA 1WKMA 2VC1A 3G1LA 2NX4A 2KZGA 1XSVA 1KZHA 4KISA 1KYZA 3MKWB 3QPLA 2M2EA 3GEUA 2D2WA 3KPHA 3HKZN 3H5RA 3RZOJ 2DYRH 4EJVA 3CCQI 4QSHA 4BQQA 1R22A 2BVMA 4G7OF 2MH9A 2V1NA 5HDKA 2C6YA 1TWCJ 2PJRA 5HNHA 3CCJI 2L9SA 1SC7A 3G56A 4JKZA 4PCQA 3S3OA 2HPIA 2XGCA 3IRRA 2VONA 3LOCA 1JT0A 1IRFA 3JTHA 2A3SA 4EVIA 1VQOI 4HNTA 1BC7C 1MMNA 1ZRFA 4XMYA 2O7OA 2OUMA 3MN2A 4B48A 3NS4A 3EUHA 4ASNA 3VIBA 2STTA 3K4BA 4A3DJ 4U9NA 2XGEA 3EYIA 1V3FA 2ZMEC 4LG0A 2CQXA 1TWHJ 5K7FA 3S1RJ 1ZR4A 3ABTA 2R7VA 3CMMA 5EG0A 3I4PA 5FKMA 3BY6A 4RB0A 1Y0NA 3V7CA 3OYNA 3ZQLA 4ABZA 1J75A 1MIJA 3DF8A 3H3ZA 4RMNA 2AHQA 2R7QA 2HXOA 2VOPA 3HYIA 2BHYA 3CUOA 2CH0A 3TO6A 3LAJA 3I64A 2BE5F 3AFHA 2FF4A 1FBSA 1ETWA 3OIOA 3MQ0A 2VUMJ 3PPBA 5LEJA 2ZOYA 3DPJA 1X1PA 2PX9A 1HW5A 1S8NA 2LY2A 2M45A 3PASA 1F9NA 3DWLE 4YFNF 5TGTA 3GX4X 5KAFC 1WCMJ 3D5LA 2TDXA 5E8GA 2ADUA 3RH2A 5CQGA 1XMAA 3BZ6A 5HS9A 4GO1A 1A36A 2HYTA 1O4XA 4RDUA 4XLPF 2L02A 4IQ4A 3F8MA 2ZCWA 3QP6A 3RKYA 3ZMSA 2R5YA 3WE3A 4AIDA 1R00A 4WXHA 4IHWA 4R79A 2EZHA 3K1NA 4II3A 2EBIA 3FMRA 2Y69H 1P4AA 2QBYB 4I0AA 3VSKA 4EGZA 4C2UA 1Y1VJ 2LFBA 3ELKA 1RPWA 3OV8A 3S1NJ 1TT5B 2M8EA 2NS8A 1YW7A 2L9VA 5HLTA 4FE7A 4RGUA 1XDUA 1D0ZA 4F52A 4Q4ZF 1MSEC 3SQNA 2EJRA 3JRCA 3DTEA 4P5OA 5BNGA 5K7HA 3V4GA 1WJCA 2EA4A 4ZH4F 1ENHA 2F5DA 4KNYA 4PXIA 1MMAA 1HF0A 4D5CA 1ORKA 3GVAA 4CCJA 3MZHA 3OMYA 1F5TA 2E19A 1SVLA 2DA2A 3BWGA 3PJRA 4RGXA 3GTQJ 1D3YA 2K85A 4CHUA 2HWVA 1VQ5I 3MCZA 3I54A 3N4MA 3KZIC 4I0BA 2KRFA 4JL3A 4A3EJ 2PI0A 1T33A 2WAQA 4XKVA 1EH6A 4AU7A 2WADA 2KP6A 1IW7F 4NUBA 4CCMA 2UXOA 2UXIA 3HUGA 1P4XA 1U5TA 1ZH5A 3E1SA 4ENJA 1XD7A 2LC2A 1B72A 1A04A 2OCCH 1MH4A 1JGSA 5C44J 3FRQA 5HBUA 5L3FA 3SDBA 3TEDA 2IS2A 4LD5A 1F36A 2EV6A 4A69C 4RM3A 5DM7F 3WHBA 2MG4A 1QO0D 2IPQX 2E5ZA 4B44A 1IRZA 2R7TA 3RQ4A 2OF7A 3AQSA 4AM3A 1IXRC 4MQVA 4IRHA 1BI0A 5FLXK 1UHMA 1Z0XA 4D9JA 2R7WA 1T2KA 2DPDA 2QKOA 3S1QJ 1IUYA 2Q0OA 4ZZLA 2HR3A 2M4KA 2NVUB 5EF6A 5F6FA 1FWZA 3M1CA 2J5OA 3RZDJ 3CRJA 3FM3A 4Y17A 5IYCJ 2VE8A 2BY3A 3L09A 5BPDA 3PNVA 5FD6A 2ZJQF 2DMTA 1SEUA 1YRNA 1R6RA 5E3NA 3CC7I 1VQLI 2K9MA 2FBHA 4R1HA 3HTJA 4KIGA 4PJLA 4O3MA 3ASNH 3K10A 3GTJJ 1RZ4A 2F4MB 1VQKI 3E5UA 2V9PA 1ZTRA 3MEXA 1RUOA 1ODDA 2KPMA 2CSOA 2EINH 2I5UA 4G12A 3FDYA 3J81Z 3S2WA 1SD5A 4XLEA 2IRFG 3A0HC 3OR2C 2E1OA 2A68F 2TCTA 1Z7LA 3IP4B 4AWXB 3SXYA 4RAFA 2V26A 5H20A 1ETOA 2ZJ2A 1AKHA 2JQ7A 3LNQA 1XS9A 5E3LA 2M0MA 4KWAA 3JSOA 1H9TA 3OY9A 4UVAA 2F07A 4UHTA 2H1LA 5ICCA 2W4SA 2F5FA 5J1UA 1LUJB 1JT6A 1ZAOA 3AG3H 2JUGA 3KX2A 2H94A 4HLXA 3O60A 2PMZN 2FSWA 4UDSA 1G3WA 4ITVA 3A1YA 1XC5A 2VBWA 1UI5A 3KEOA 1JHFA 4J01A 2FX0A 4F92B 2ZMEA 2X51A 3DFGA 3MVPA 1HLVA 2EZLA 2XAQA 4CUGA 3R0JA 2DMNA 4PFPA 2KQRA 1J7KA 2EZIA 3TDUC 1YFHA 4BQAA 3LAPA 4A3FJ 2YSRA 2X6XA 3HOXJ 4ZC3A 5DV5A 4BJTA 3TDZC 3S2DJ 2ZSHB 3OYIA 5M3FJ 2Y9ZA 4HYEA 2VPLA 1RETA 3IRQA 3QOPA 3D0SA 4HW0A 1ZN2A 4MFEA 4HKUA 2FRHA 1SFOJ 4ME9A 3DP7A 3RI4A 1YITI 4LB5A 2M5WA 5BOXA 1P4WA 5IT9Z 3RQIA 1YI2I 3HBLA 4G6QA 5IP9J 4HG2A 2FEZA 3IH4A 4B4CA 4IHSA 2ECBA 2O7TA 5A2QZ 4O5VA 3HOYJ 1I39A 2DW4A 3U21A 3VWBA 4D5FA 3HOTA 1J5YA 1OCRH 1VQPI 1K4TA 1E17A 1KU9A 1WHUA 2TRTA 3DXJF 4G8XA 1CF7B 3ABKH 3S5RA 4RA2A 3JTGA 3SJMA 3FXOA 4G7ZF 1QBJA 5J47A 4RGSA 1O3QA 2R7FA 2VC0A 2OV7A 1Y0UA 1BIAA 2JA7J 2D1HA 3DKXA 3DPUA 4RGRA 5EYRA 5KVRA 2Y0SN 4BU2A 4IEJA 2R93J 3BTCA 3BNIA 1FBQA 3F6VA 3I9V2 3WU0A 5HLHA 2XAFA 4MEXF 2UWMA 3ZQQA 4I02A 2G7LA 2CW8A 3OOUA 3DTIA 2DAOA 3DKWA 3GCMA 2Q1ZB 2OI8A 2ESNA 3BR3A 2P5LC 1G6NA 2HI3A 2X1CA 2P4WA 2HVRA 3V6GA 3HRTA 4L5EA 3KP3A 1WFXA 4NN1A 5ED4A 1RI7A 3QODA 2IGMA 1UJ8A 2VT2A 1HXDA 2EQRA 3KKCA 4L9TA 1U78A 3L00A 1K78A 3M4OJ 4JX4A 1GXPA 5FKKA 4JYKA 1HBXG 1E0EA 1TWGJ 1I5ZA 2NP5A 4AF5A 4IVNA 2FOKA 3H5NA 2PBXA 2KIMA 3EETA 2DFFA 2E5NA 3D5SC 2JRTA 4LGWA 1XB4A 2PG4A 1ZKGA 3QU3A 4ZDOA 2Y75A 3JCUC 1SFXA 4ANJA 3OYJA 4HDUA 4DYCA 4EJUA 2A2FX 2IW5A 3Q0UA 3G3ZA 3CCUI 5F08A 5K5RA 5KHDA 1HOMA 4XQFA 4BBSJ 4A12A 2Q8KA 5F0FA 1F4KA 3PIPF 3S32A 1VQ7I 2VXDA 1OCTC 3BQZA 5D6FA 4NQWA 3SEQA 2P0WA 5ERIA 1FC3A 1VQ8I 4DYQA 4WK8F 3E6DA 1O3RA 3CC2I 1DU0A 4DGWB 3WG7H 1BI2A 2JSPA 3KLOA 1J59A 3GZIA 1V5EA 5K5OA 4EM2A 2V7FA 2L0KA 3RIRA 2CU7A 4FQGA 4CCKA 1LVKA 4OIPF 1JKOC 4I76A 1EH7A 3WTSC 1MBKA 4DNCA 5FMPA 4BE2A 2JJ7A 2I10A 5HODA 1DUXC 3F21A 4AYBN 2P5VA 3K4MA 2HVQA 1FY7A 3JSPA 5LGUA 3DCFA 3MMYB 2G3BA 3EUHC 4E6KG 4FETA 1W36D 1EF4A 3ML6A 3A2KA 3FXLA 4B3XA 3VDXA 1JTYA 4ZDPA 2NOJB 4DW6A 1X2NA 3GFLA 1OCOH 1N78A 5CQEA 2VOOA 3FXRA 3VOEA 4PSXA 4JX6A 2D45A 5LGNA 2XGXA 1D0YA 1S9HA 5E1XA 1USSA 2E35A 1YYVA 4UY8I 4J19A 1FOWA 4JX5A 3FK6A 4RLFA 3SYTA 2W57A 1FTZA 3GLXA 4UB6C 2PJPA 3K1MA 2RNJA 3Q9VA 5FRNA 2CW7A 4A2UA 5M3MJ 2HOEA 3OYHA 1IC8A 2CJJA 3O8HA 5IP6A 2NP3A 4EATA 2K3FA 5E79C 3CLOA 1YX3A 3PSIA 5JVGF 2RASA 4UVCA 2OJED 3PSFA 3K8PC 2G7UA 3VW2A 2OTLI 2R7SA 3A4CA 3F3XA 1RKWA 2L3DA 4BXFA 5F1RA 3W6JB 1JI8A 2M7BA 4AVPA 1BM9A 3BG5A 4EMSA 4XL9A 2QM3A 4MK6A 4CSWA 5CVJA 5FLXZ 1R58A 2X0LA 2NVQJ 1S7OA 2F5CA 3BJAA 4PGGA 3QQAA 4C9YA 4PJJA 3UR3C 4YFKF 2YR2A 4A3IJ 3O2PE 3S8PA 2EPFA 4B47A 1ETQA 2NOGA 3GZ5A 1PDNC 2QKMB 3M8FA 1XTAA 4BUPA 1R5GA 1W0TA 4IKFA 2R7XA 4BY1J 4U9LA 2WB1A 4J00A 2JA6J 2E2IJ 3H35A 4OIRF 1OYWA 3GZNB 3HRSA 1W5CC 5D8LB 2DDAA 2MSYA 4XKCA 1DQUA 3I5UA 1FIPA 1N75A 2HKXA 5AQCA 4M72A 2FU4A 2Q24A 3GFIA 1W7PD 4IO9F 2B7EA 1DPRA 4P9UA 4QPQA 3S16J 2IP2A 1FLIA 4PJMA 3WTYC 3BQYA 3EUPA 5IPAA 2G9WA 3M9AA 1RIOH 4UB8C 4ZTFA 3OSGA 5GADJ 3ZR8X 3H9GA 4JK1X 3JR9A 3HOVJ 3IWZA 1MMSA 3CMEI 1YS6A 1FJLA 1LVAA 1A31A 1ULYA 4PJNA 1Q1VA 4UNOA 3LSHA 3CJNA 2M3AA 3BJ6A 3KYCB 3ZGKA 2Y48A 4ETSA 2VXZA 3ZQCA 2EV5A 1LE8A 2UXNA 3I53A 2Z9OA 2LBFA 2VKEA 3BTLA 4RB2C 4GGGA 1QGPA 1X1AA 5JFRA 3FWEA 3PQJA 1FIAA 2VBXA 3NRVA 4LIUA 2R7ZJ 2RHAA 1Y8RB 1IZ1A 2JSCA 1QQIA 5DUIA 2CWEA 3F0CA 2YX7A 1IN7A 4M3EA 2BY2A 3G2BA 3KFWX 1JJ8C 2QSHX 3IAM2 5CXGA 3PUFA 2LDUA 2K40A 5LFAA 5HOOA 2ZFWA 3GTPJ 4C30A 2QZ8A 2LY9A 2Z2SB 2JA2A 4HAMA 3E0JB 3LSIA 4BY7J 3U2RA 2IS1A 4LJZF 1P6RA 4QLCU 3BROA 2H8RA 4O6JA 1N77A 2ZNZA 4LFUA 2VKDA 1UG2A 1JKPC 5H9TA 1MBFA 2XAGA 3HRUA 1MNEA 1SANA 1WGXA 3HZJA 4EM1A 2WV0A 4ESFA 1WJFA 1VQ9I 4IRGA 4M73A 3GEZA 2STWA 1V54H 4CA0A 4S05A 2MGQA 1SFUA 1LKXA 3DV8A 2RNGA 3RKWA 1FOKA 1KQ0A 1HW1A 5F04A 3O8GA 1S5LC 3GWZA 3GTGJ 1T39A 1YJWI 2DYSH 4HQMA 5L3BA 2RQQA 3VFZA 4YG2F 1D1CA 4UUSA 2F4IA 3JRAA 3C7JA 3F8BA 2UXUA 3LA2A 3GFJA 4FX0A 1WJBA 2AQEA 1BJAA 3S3NA 3HTIA 2X48A 2JPCA 1O7FA 2WA0A 3HSRA 3AG4H 5D4RA 4XICA 2NS0A 4ZYGA 1X4PA 5B1BH 4KICA 4CDGA 5FD5A 3V8LA 1EV7A 1ZLKA 3B02A 2IA0A 1A5JA 3ON4A 2JT1A 2DXIA 3ABUA 2DCEA 3KYDB 4UUTA 2XAHA 4B43A 2DTRA 3HRMA 3CUQB 1X4OA 3IAS2 3LQQA 4LLGF 2YPRA 3E5QA 5CLSA 5JHFA 2ETHA 5DCMA 3QPTA 1FT9A 1I3AA 2FBQA 3VVYA 3OYLA 2PFBA 2EWNA 2FA5A 3UNGC 2HKOA 3OWTA 9ANTA 2EFQA 2QEXI 2H09A 2ZXIA 3VOKA 1OR7C 1XDSA 1L3LA 1RUNA 3RTRA 2WUIA 5CW8A 1ETKA 2F6CA 6PAXA 3BP8A 3WTTC 3QRFF 2BY1A 3JREA 1CGPA 2Y9YA 2RC4A
chains in the Genus database with same CATH topology
3HGYA 4ICHA 2W48A 2N8GA 2WAQN 1Z0XA 1JKRC 2L7ZA 2ZCNA 1B72B 2CUEA 1SGMA 3ZOBA 2QKOA 3S1QJ 1JJ6C 5IYDJ 1GVDA 2HYJA 3LSGA 3E7QA 5JLWA 5EF6A 3RZDJ 2HQ5A 3CRJA 2M34A 1Y1WJ 2OERA 5IYCJ 3MKLA 2DMTA 1IDZA 1YRNA 3TP3A 5E3NA 3CMYA 3BJBA 3BTJA 2FD5A 1H88C 4XIDA 2QWTA 3HTJA 4BKXA 3EGQA 1S7EA 1ZR2A 3GTJJ 1MH3A 4XRSA 2COBA 3V78A 2PZ9A 1ZTRA 1MSFC 4MFDA 4S0HB 4G12A 5EDNA 5GPAA 4M3GA 1ITYA 5EEAA 1JKQC 2E1OA 2TCTA 2DA4A 3MNLA 3Q0VA 2X6OA 1YRNB 1JUPA 1ETOA 1AKHA 5HSZA 3LNQA 1XS9A 2E2JJ 2GUHA 2K9QA 1U9NA 5E3LA 3JREA 3BR6A 4KWAA 2R0QC 2JA8J 1GT0C 4MLOA 1FEXA 1BA5A 2F07A 4GCLA 4CGRA 3WHCA 2D5VA 4MXMA 5J1UA 3BRUA 1U9OA 3TW7A 1JT6A 3K7AJ 4IHVA 3O60A 2PMZN 1E3OC 2JMWA 3QBMA 4UDSA 3A03A 3ANGA 1IDYA 3LJLA 5EFYA 5M5XJ 1AKHB 2LP0A 2XB5A 3VOXA 1XC5A 2ECCA 1RR7A 1UI5A 4W97A 2FX0A 1GV2A 1LFBA 1QRYA 2LKXA 3CJDA 2XPWA 3MVPA 4NDLA 3D1NI 1MNMC 1HLVA 2EZLA 2RAEA 4C3HJ 2V57A 4M3FA 2L7FP 3LHQA 2DMNA 2HKUA 2EZIA 1UMQA 4A3FJ 3VUQA 1VFCA 1ETVA 3QPSA 3TW6A 2E2HJ 3HOXJ 1HCRA 2D6YA 1MBHA 4V2FA 2NVYJ 2GENA 4ACIA 3Q3SA 2YU9J 3S2DJ 2W53A 2AO9A 5M3FJ 4A3MJ 2Y9ZA 2O8KA 1I6HJ 3HIMA 1RETA 3VP5A 2JWTA 3JRGA 3A01A 1F43A 4MO7A 1QPIA 4A93J 4MFEA 2JN6A 1IJWC 1SFOJ 1AU7A 4HKUA 4ME9A 4M6VA 3JRIA 2R92J 4CYCA 1AHDP 1BW6A 1QVTA 4QTRA 4A3JJ 2UXHA 2XSDC 3HB9A 2FQ4A 2CUFA 3RQIA 3AQTA 3HBLA 4Y52J 5IP9J 3UKGA 3KKDA 1GUUA 3IH4A 4B4CA 2ECBA 2O7TA 2L9RA 4YZEA 3HOYJ 2DMPA 3NXCA 4I6ZA 3PM1A 3IH2A 4M3DA 3A01B 3JRHA 3IUVA 1W0UA 5C4XJ 4D5FA 3I4MJ 3IH3A 1X58A 2UXPA 2TRTA 2QOPA 4CYCB 3ZQFA 4A3GJ 2XPVA 2ZOZA 3CWRA 5FHPA 3CDLA 3COLA 3VVZA 3HGGA 3S5RA 2REKA 4LOCA 3M3YJ 3G1MA 2DTZA 3RKQA 5IYBJ 5C3EJ 3SJMA 3GTKJ 1VF9A 3HOUJ 2YUSA 3C2BA 3BR2A 5DS9A 1NTCA 1OFCX 3JSJA 2DA5A 2NVTJ 3HOWJ 4C3IJ 2JA7J 2MW8A 1TWFJ 3HEFA 5EYRA 2Y0SN 2QIBA 4IEJA 2R93J 3BTCA 3JRDA 3BNIA 3OSFA 1NK3P 3FKIJ 2K9NA 2K9SA 2CRGA 2G7LA 2FJ1A 3H3VK 3OOUA 2OI8A 3HTHA 3BR3A 3ON2A 4AUXA 3BR0A 5FJ8J 2DG7A 2EH3A 2HI3A 2LR8A 3HM5A 3V6GA 4JNNA 4L5EA 2NS7A 1ZQ3P 3NPIA 4NN1A 5HAWA 4XRSG 2EQRA 4QIWN 3KKCA 1U78A 1IG7A 3M4OJ 3LSPA 4JX4A 3HTAA 5FKKA 4JYKA 3ANPA 1TWGJ 2NP5A 1WI3A 4AF5A 5E3OA 4DYRA 2PBXA 3ZQIA 5FLMJ 4DZPA 2CQQA 3G1OA 1ZKGA 4M3BA 2QTQA 4JP0A 4B3AA 2IU5A 4DYCA 2M9HA 1BW5A 3LSJA 3Q0UA 4A3BJ 2M8GX 2IBDA 5F08A 4D7NA 2KT0A 3BG9A 1HOMA 1IV6A 1D5YA 4BBSJ 5F0FA 1OCTC 3BQZA 1GV5A 3SFIA 1RKTA 3JRFA 5EGOA 5K7ZA 4DYQA 3LSRA 1PUFA 3F1BA 4GCKA 1DU0A 3BR5A 1MBEA 1B8IA 1WH5A 5J3LA 1QVUA 4D7MA 4GFLA 2HXIA 3GZIA 2Y30A 3HDDA 2L0KA 2CU7A 3NAUA 3RD3A 5F0HA 3QKXA 1JKOC 4I76A 1P7JA 1MBKA 3L1PA 1H8AC 2QF7A 5D18A 5FMPA 2JJ7A 1HDPA 2H1KA 2I10A 5HODA 5C4YA 2LVSA 5EZHA 2LTPA 5EGOB 1WH7A 3VW1A 1PUFB 4AYBN 1B8IB 3S14J 3NRGA 4L62A 3A02A 3DCFA 3HOZJ 2XPUA 2G3BA 1MBGA 1VI0A 2M0CA 1BL0A 2XDNA 2DMQA 2Y2ZA 2XB0X 1EF4A 3S1MJ 1JTYA 4DW6A 1UHSA 3K2AA 1X2NA 4FE4A 5J1YA 4GCTA 2DG8A 4JX6A 3BTIA 2LK2A 3C07A 5IOZA 4AC0A 5IOYA 1ZGWA 2ZCXA 2R5ZA 4J19A 3B6CA 2ID3A 4JX5A 1JUSA 2ME6A 3FK6A 1NK2P 3FK7A 2HOTA 2G0EA 3B6AA 5F0CA 1FTZA 3H0GJ 4RBOA 2DA6A 2GM4A 1RESA 1I3QJ 5DAJA 1T56A 2QCOA 4NELA 2LD5A 5M5WJ 2XGDA 5FGLA 2EZKA 2DMUA 4Y7NJ 3GTOJ 2OPTA 5M3MJ 4EEFG 1IC8A 4X1EA 2CJJA 3O8HA 3SDGA 4FCYA 2DJNA 5IP6A 1K61A 2ID6A 2NP3A 1APLC 2R5ZB 3BT9A 3S15J 3B81A 3G1LA 2NX4A 2RASA 3QPLA 2M2EA 3GEUA 1JUMA 3VW2A 3HKZN 3CQZJ 1TC3C 3RZOJ 1IUFA 3CCYA 1RKWA 1CQTA 4QSHA 3E7LA 1TWCJ 4B1RA 3BG5A 3G56A 4JKZA 4HNVA 4MK6A 2GBYA 2WGBA 2XGCA 2GLOA 3LOCA 1JT0A 2O9LA 2NVQJ 4W1UA 3TP0A 4XRMA 1XG1A 2VKVA 2O7OA 3MN2A 3QQAA 2JK3A 1P7IA 3KNWA 3VIBA 4A3DJ 2XGEA 4A3IJ 2G7SA 2CQXA 1ETQA 1TWHJ 2IAIA 5K7FA 2NOGA 3S1RJ 1ZR4A 3IV5A 3VVXA 2X9DA 5EG0A 5FKNA 1W0TA 4A3KJ 5FKMA 3ZQLA 4BY1J 2LLKA 4ABZA 1OCPA 2E2IJ 2JA6J 2WV1A 2AHQA 3AQSA 5FKOA 2HXOA 2MSYA 3VPRA 1FIPA 4AC6A 1UI6A 5AQCA 2YS9A 3BG3A 2Q24A 5GP9A 1I50J 5FLVA 4IHXA 1ETWA 3OIOA 3W6VA 4BXXJ 2VUMJ 1WPKA 1H89C 3PPBA 2ZOYA 5C4JJ 3PO2J 3DPJA 3BQYA 5EG0B 3EUPA 5IPAA 3S17J 3OSGA 3T6NA 2G7GA 3JR9A 3HOVJ 2HDDA 3PASA 2WB1N 4DZJA 1FJLA 4MIMA 1Q1VA 1U8BA 1OJLA 3ZQCA 2XRLA 3S16J 1WCMJ 3GTLJ 1LE8A 1IGNA 3RH2A 3S2HJ 3JRBA 2DA7A 2KDZA 5CXIA 2VKEA 3BTLA 5JLXA 2HYTA 1O4XA 4RDUA 1FIAA 2R5YA 5K58A 2ME0A 2DA3A 2DN0A 2R7ZJ 2RHAA 4A3CJ 4GFKA 2JA5J 1DU6A 1VNDA 4IHWA 3PO3J 3NI7A 4X6AJ 3F0CA 2EZHA 3BR1A 4M3EA 2EBIA 3FIWA 2VI6A 5M5YJ 3KZ9A 3Q0WA 1JJ8C 4XK4A 3DEWA 1Y1VJ 2LFBA 1LE8B 1RPWA 5CXGA 2K40A 3S1NJ 2NS8A 3GTPJ 2HOAA 2LY9A 5FKLA 4FE7A 1LFUP 4BY7J 1HDDC 2YVHA 5D1RA 2R5YB 2H8RA 5F27A 1X2MA 1MSEC 2B63J 4FTHA 3LWJA 4V2GA 1BJZA 5DTDA 3I4NJ 3VW0A 3JRCA 1UG2A 1JKPC 5H9TA 5BNGA 1MBFA 5K7HA 3ZQGA 1ETYA 1SANA 1WGXA 1ENHA 2L7MP 2ZB9A 5F1JA 4PXIA 1ZK8A 1HF0A 4D5CA 4A3LJ 4BBRJ 1ORKA 2MGQA 5E3MA 4C3JJ 3GTMJ 2E19A 2IEKA 5F04A 2DA2A 3BHQA 2Y31A 3O8GA 3NNRA 1K83J 3GTGJ 1JGGA 1POGA 2P81A 4IHYA 3GTQJ 5IP7J 1TWAJ 3GBGA 4UUSA 2NVXJ 4FISA 3JRAA 2UXUA 4GFBA 4JL3A 1R9TJ 3HTIA 3NARA 4A3EJ 2X48A 2YVEA 1FTTA 4XICA 1T33A 5EZGA 1A5JA 1A6IA 3ON4A 2UXOA 2UXIA 2HOSA 4UUTA 2ZCMA 3ZQHA 1MBJA 1B72A 3BCGA 1GDTA 5D19A 1MH4A 5J1RA 2VPRA 1ETXA 5C44J 4UUSB 2FBQA 3FRQA 3G7RA 5HBUA 1G2HA 3VVYA 3TEDA 1F36A 9ANTA 4A69C 4C2MJ 3VOKA 3P9TA 5GPCA 3WHBA 1Z77A 2MG4A 3FISA 2WUIA 5CW8A 1ETKA 2GFNA 2ELKA 1IRZA 2DA1A 2OF7A 1JTXA 2Y9YA 3HE0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HGY A;  4ICH A;  2W48 A;  2N8G A;  2WAQ N;  1Z0X A;  1JKR C;  2L7Z A;  2ZCN A;  1B72 B;  2CUE A;  1SGM A;  3ZOB A;  2QKO A;  3S1Q J;  1JJ6 C;  5IYD J;  1GVD A;  2HYJ A;  3LSG A;  3E7Q A;  5JLW A;  5EF6 A;  3RZD J;  2HQ5 A;  3CRJ A;  2M34 A;  1Y1W J;  2OER A;  5IYC J;  3MKL A;  2DMT A;  1IDZ A;  1YRN A;  3TP3 A;  5E3N A;  3CMY A;  3BJB A;  3BTJ A;  2FD5 A;  1H88 C;  4XID A;  2QWT A;  3HTJ A;  4BKX A;  3EGQ A;  1S7E A;  1ZR2 A;  3GTJ J;  1MH3 A;  4XRS A;  2COB A;  3V78 A;  2PZ9 A;  1ZTR A;  1MSF C;  4MFD A;  4S0H B;  4G12 A;  5EDN A;  5GPA A;  4M3G A;  1ITY A;  5EEA A;  1JKQ C;  2E1O A;  2TCT A;  2DA4 A;  3MNL A;  3Q0V A;  2X6O A;  1YRN B;  1JUP A;  1ETO A;  1AKH A;  5HSZ A;  3LNQ A;  1XS9 A;  2E2J J;  2GUH A;  2K9Q A;  1U9N A;  5E3L A;  3JRE A;  3BR6 A;  4KWA A;  2R0Q C;  2JA8 J;  1GT0 C;  4MLO A;  1FEX A;  1BA5 A;  2F07 A;  4GCL A;  4CGR A;  3WHC A;  2D5V A;  4MXM A;  5J1U A;  3BRU A;  1U9O A;  3TW7 A;  1JT6 A;  3K7A J;  4IHV A;  3O60 A;  2PMZ N;  1E3O C;  2JMW A;  3QBM A;  4UDS A;  3A03 A;  3ANG A;  1IDY A;  3LJL A;  5EFY A;  5M5X J;  1AKH B;  2LP0 A;  2XB5 A;  3VOX A;  1XC5 A;  2ECC A;  1RR7 A;  1UI5 A;  4W97 A;  2FX0 A;  1GV2 A;  1LFB A;  1QRY A;  2LKX A;  3CJD A;  2XPW A;  3MVP A;  4NDL A;  3D1N I;  1MNM C;  1HLV A;  2EZL A;  2RAE A;  4C3H J;  2V57 A;  4M3F A;  2L7F P;  3LHQ A;  2DMN A;  2HKU A;  2EZI A;  1UMQ A;  4A3F J;  3VUQ A;  1VFC A;  1ETV A;  3QPS A;  3TW6 A;  2E2H J;  3HOX J;  1HCR A;  2D6Y A;  1MBH A;  4V2F A;  2NVY J;  2GEN A;  4ACI A;  3Q3S A;  2YU9 J;  3S2D J;  2W53 A;  2AO9 A;  5M3F J;  4A3M J;  2Y9Z A;  2O8K A;  1I6H J;  3HIM A;  1RET A;  3VP5 A;  2JWT A;  3JRG A;  3A01 A;  1F43 A;  4MO7 A;  1QPI A;  4A93 J;  4MFE A;  2JN6 A;  1IJW C;  1SFO J;  1AU7 A;  4HKU A;  4ME9 A;  4M6V A;  3JRI A;  2R92 J;  4CYC A;  1AHD P;  1BW6 A;  1QVT A;  4QTR A;  4A3J J;  2UXH A;  2XSD C;  3HB9 A;  2FQ4 A;  2CUF A;  3RQI A;  3AQT A;  3HBL A;  4Y52 J;  5IP9 J;  3UKG A;  3KKD A;  1GUU A;  3IH4 A;  4B4C A;  2ECB A;  2O7T A;  2L9R A;  4YZE A;  3HOY J;  2DMP A;  3NXC A;  4I6Z A;  3PM1 A;  3IH2 A;  4M3D A;  3A01 B;  3JRH A;  3IUV A;  1W0U A;  5C4X J;  4D5F A;  3I4M J;  3IH3 A;  1X58 A;  2UXP A;  2TRT A;  2QOP A;  4CYC B;  3ZQF A;  4A3G J;  2XPV A;  2ZOZ A;  3CWR A;  5FHP A;  3CDL A;  3COL A;  3VVZ A;  3HGG A;  3S5R A;  2REK A;  4LOC A;  3M3Y J;  3G1M A;  2DTZ A;  3RKQ A;  5IYB J;  5C3E J;  3SJM A;  3GTK J;  1VF9 A;  3HOU J;  2YUS A;  3C2B A;  3BR2 A;  5DS9 A;  1NTC A;  1OFC X;  3JSJ A;  2DA5 A;  2NVT J;  3HOW J;  4C3I J;  2JA7 J;  2MW8 A;  1TWF J;  3HEF A;  5EYR A;  2Y0S N;  2QIB A;  4IEJ A;  2R93 J;  3BTC A;  3JRD A;  3BNI A;  3OSF A;  1NK3 P;  3FKI J;  2K9N A;  2K9S A;  2CRG A;  2G7L A;  2FJ1 A;  3H3V K;  3OOU A;  2OI8 A;  3HTH A;  3BR3 A;  3ON2 A;  4AUX A;  3BR0 A;  5FJ8 J;  2DG7 A;  2EH3 A;  2HI3 A;  2LR8 A;  3HM5 A;  3V6G A;  4JNN A;  4L5E A;  2NS7 A;  1ZQ3 P;  3NPI A;  4NN1 A;  5HAW A;  4XRS G;  2EQR A;  4QIW N;  3KKC A;  1U78 A;  1IG7 A;  3M4O J;  3LSP A;  4JX4 A;  3HTA A;  5FKK A;  4JYK A;  3ANP A;  1TWG J;  2NP5 A;  1WI3 A;  4AF5 A;  5E3O A;  4DYR A;  2PBX A;  3ZQI A;  5FLM J;  4DZP A;  2CQQ A;  3G1O A;  1ZKG A;  4M3B A;  2QTQ A;  4JP0 A;  4B3A A;  2IU5 A;  4DYC A;  2M9H A;  1BW5 A;  3LSJ A;  3Q0U A;  4A3B J;  2M8G X;  2IBD A;  5F08 A;  4D7N A;  2KT0 A;  3BG9 A;  1HOM A;  1IV6 A;  1D5Y A;  4BBS J;  5F0F A;  1OCT C;  3BQZ A;  1GV5 A;  3SFI A;  1RKT A;  3JRF A;  5EGO A;  5K7Z A;  4DYQ A;  3LSR A;  1PUF A;  3F1B A;  4GCK A;  1DU0 A;  3BR5 A;  1MBE A;  1B8I A;  1WH5 A;  5J3L A;  1QVU A;  4D7M A;  4GFL A;  2HXI A;  3GZI A;  2Y30 A;  3HDD A;  2L0K A;  2CU7 A;  3NAU A;  3RD3 A;  5F0H A;  3QKX A;  1JKO C;  4I76 A;  1P7J A;  1MBK A;  3L1P A;  1H8A C;  2QF7 A;  5D18 A;  5FMP A;  2JJ7 A;  1HDP A;  2H1K A;  2I10 A;  5HOD A;  5C4Y A;  2LVS A;  5EZH A;  2LTP A;  5EGO B;  1WH7 A;  3VW1 A;  1PUF B;  4AYB N;  1B8I B;  3S14 J;  3NRG A;  4L62 A;  3A02 A;  3DCF A;  3HOZ J;  2XPU A;  2G3B A;  1MBG A;  1VI0 A;  2M0C A;  1BL0 A;  2XDN A;  2DMQ A;  2Y2Z A;  2XB0 X;  1EF4 A;  3S1M J;  1JTY A;  4DW6 A;  1UHS A;  3K2A A;  1X2N A;  4FE4 A;  5J1Y A;  4GCT A;  2DG8 A;  4JX6 A;  3BTI A;  2LK2 A;  3C07 A;  5IOZ A;  4AC0 A;  5IOY A;  1ZGW A;  2ZCX A;  2R5Z A;  4J19 A;  3B6C A;  2ID3 A;  4JX5 A;  1JUS A;  2ME6 A;  3FK6 A;  1NK2 P;  3FK7 A;  2HOT A;  2G0E A;  3B6A A;  5F0C A;  1FTZ A;  3H0G J;  4RBO A;  2DA6 A;  2GM4 A;  1RES A;  1I3Q J;  5DAJ A;  1T56 A;  2QCO A;  4NEL A;  2LD5 A;  5M5W J;  2XGD A;  5FGL A;  2EZK A;  2DMU A;  4Y7N J;  3GTO J;  2OPT A;  5M3M J;  4EEF G;  1IC8 A;  4X1E A;  2CJJ A;  3O8H A;  3SDG A;  4FCY A;  2DJN A;  5IP6 A;  1K61 A;  2ID6 A;  2NP3 A;  1APL C;  2R5Z B;  3BT9 A;  3S15 J;  3B81 A;  3G1L A;  2NX4 A;  2RAS A;  3QPL A;  2M2E A;  3GEU A;  1JUM A;  3VW2 A;  3HKZ N;  3CQZ J;  1TC3 C;  3RZO J;  1IUF A;  3CCY A;  1RKW A;  1CQT A;  4QSH A;  3E7L A;  1TWC J;  4B1R A;  3BG5 A;  3G56 A;  4JKZ A;  4HNV A;  4MK6 A;  2GBY A;  2WGB A;  2XGC A;  2GLO A;  3LOC A;  1JT0 A;  2O9L A;  2NVQ J;  4W1U A;  3TP0 A;  4XRM A;  1XG1 A;  2VKV A;  2O7O A;  3MN2 A;  3QQA A;  2JK3 A;  1P7I A;  3KNW A;  3VIB A;  4A3D J;  2XGE A;  4A3I J;  2G7S A;  2CQX A;  1ETQ A;  1TWH J;  2IAI A;  5K7F A;  2NOG A;  3S1R J;  1ZR4 A;  3IV5 A;  3VVX A;  2X9D A;  5EG0 A;  5FKN A;  1W0T A;  4A3K J;  5FKM A;  3ZQL A;  4BY1 J;  2LLK A;  4ABZ A;  1OCP A;  2E2I J;  2JA6 J;  2WV1 A;  2AHQ A;  3AQS A;  5FKO A;  2HXO A;  2MSY A;  3VPR A;  1FIP A;  4AC6 A;  1UI6 A;  5AQC A;  2YS9 A;  3BG3 A;  2Q24 A;  5GP9 A;  1I50 J;  5FLV A;  4IHX A;  1ETW A;  3OIO A;  3W6V A;  4BXX J;  2VUM J;  1WPK A;  1H89 C;  3PPB A;  2ZOY A;  5C4J J;  3PO2 J;  3DPJ A;  3BQY A;  5EG0 B;  3EUP A;  5IPA A;  3S17 J;  3OSG A;  3T6N A;  2G7G A;  3JR9 A;  3HOV J;  2HDD A;  3PAS A;  2WB1 N;  4DZJ A;  1FJL A;  4MIM A;  1Q1V A;  1U8B A;  1OJL A;  3ZQC A;  2XRL A;  3S16 J;  1WCM J;  3GTL J;  1LE8 A;  1IGN A;  3RH2 A;  3S2H J;  3JRB A;  2DA7 A;  2KDZ A;  5CXI A;  2VKE A;  3BTL A;  5JLX A;  2HYT A;  1O4X A;  4RDU A;  1FIA A;  2R5Y A;  5K58 A;  2ME0 A;  2DA3 A;  2DN0 A;  2R7Z J;  2RHA A;  4A3C J;  4GFK A;  2JA5 J;  1DU6 A;  1VND A;  4IHW A;  3PO3 J;  3NI7 A;  4X6A J;  3F0C A;  2EZH A;  3BR1 A;  4M3E A;  2EBI A;  3FIW A;  2VI6 A;  5M5Y J;  3KZ9 A;  3Q0W A;  1JJ8 C;  4XK4 A;  3DEW A;  1Y1V J;  2LFB A;  1LE8 B;  1RPW A;  5CXG A;  2K40 A;  3S1N J;  2NS8 A;  3GTP J;  2HOA A;  2LY9 A;  5FKL A;  4FE7 A;  1LFU P;  4BY7 J;  1HDD C;  2YVH A;  5D1R A;  2R5Y B;  2H8R A;  5F27 A;  1X2M A;  1MSE C;  2B63 J;  4FTH A;  3LWJ A;  4V2G A;  1BJZ A;  5DTD A;  3I4N J;  3VW0 A;  3JRC A;  1UG2 A;  1JKP C;  5H9T A;  5BNG A;  1MBF A;  5K7H A;  3ZQG A;  1ETY A;  1SAN A;  1WGX A;  1ENH A;  2L7M P;  2ZB9 A;  5F1J A;  4PXI A;  1ZK8 A;  1HF0 A;  4D5C A;  4A3L J;  4BBR J;  1ORK A;  2MGQ A;  5E3M A;  4C3J J;  3GTM J;  2E19 A;  2IEK A;  5F04 A;  2DA2 A;  3BHQ A;  2Y31 A;  3O8G A;  3NNR A;  1K83 J;  3GTG J;  1JGG A;  1POG A;  2P81 A;  4IHY A;  3GTQ J;  5IP7 J;  1TWA J;  3GBG A;  4UUS A;  2NVX J;  4FIS A;  3JRA A;  2UXU A;  4GFB A;  4JL3 A;  1R9T J;  3HTI A;  3NAR A;  4A3E J;  2X48 A;  2YVE A;  1FTT A;  4XIC A;  1T33 A;  5EZG A;  1A5J A;  1A6I A;  3ON4 A;  2UXO A;  2UXI A;  2HOS A;  4UUT A;  2ZCM A;  3ZQH A;  1MBJ A;  1B72 A;  3BCG A;  1GDT A;  5D19 A;  1MH4 A;  5J1R A;  2VPR A;  1ETX A;  5C44 J;  4UUS B;  2FBQ A;  3FRQ A;  3G7R A;  5HBU A;  1G2H A;  3VVY A;  3TED A;  1F36 A;  9ANT A;  4A69 C;  4C2M J;  3VOK A;  3P9T A;  5GPC A;  3WHB A;  1Z77 A;  2MG4 A;  3FIS A;  2WUI A;  5CW8 A;  1ETK A;  2GFN A;  2ELK A;  1IRZ A;  2DA1 A;  2OF7 A;  1JTX A;  2Y9Y A;  3HE0 A; 
#chains in the Genus database with same CATH topology
 2MC4 A;  4ICH A;  4IX7 A;  1Z3X A;  2WAQ N;  4GRI A;  3K4L A;  5GAG J;  2QQB A;  5CYV A;  3SZT A;  1IRX A;  2ZCN A;  2W00 A;  2DK5 A;  2CUE A;  1MZB A;  2L5Q A;  2NNN A;  2B1E A;  2HYJ A;  3P9I A;  4M9Z A;  2F4O B;  4L0Y B;  2HQ5 A;  1WSU A;  3K1P A;  2M34 A;  2YVE A;  2KKO A;  1BN5 A;  2DOD A;  1SD6 A;  1FMW A;  4KT5 C;  2QWT A;  2FD5 A;  4XID A;  2AXL A;  1S7E A;  4AIK A;  3HJE A;  2V1U A;  4HF0 A;  1RC9 A;  3HTU A;  1G3Y A;  2CFX A;  2PZ9 A;  5BQT A;  2V6C A;  2CYY A;  1LDK B;  1RRJ A;  4MFD A;  4ENN A;  2F5E A;  2EFP A;  2BW3 B;  2Z33 A;  1JKQ C;  3L9F A;  3S93 A;  2O03 A;  3REO A;  2ICW G;  3DEU A;  3LMM A;  3MNL A;  2MLK A;  3Q0V A;  1E3H A;  2X6O A;  5HS7 A;  1YO5 C;  4WXC A;  4LIT A;  2NNY A;  1VQM I;  2GUH A;  5K1Y A;  2OD5 A;  4HF1 A;  1FP1 D;  3BCB A;  3BR6 A;  2CV1 A;  4MLO A;  4GCL A;  3C18 A;  4U0Y A;  2D5V A;  3K4C A;  1S72 I;  3E97 A;  3BRU A;  3RCO A;  3P9C A;  4NC8 A;  1QHG A;  1MGT A;  5CVV A;  1E3O C;  3LJL A;  3ZPL A;  3HPG A;  2K7L A;  3ZMZ A;  4OAZ A;  4OOI A;  2H6B A;  5L3C A;  2ECC A;  2VJI A;  2GIZ A;  3H36 A;  3K4J A;  4RS8 A;  1QRY A;  1BI3 A;  4GCV A;  4E7Z A;  2DQL A;  2XPW A;  4NDL A;  4XSZ F;  1W5T A;  2P6T A;  4M3F A;  3O6B B;  3LHQ A;  1P92 A;  2X85 A;  1EH8 A;  2HKU A;  3O3K A;  2Q2E A;  3VUQ A;  2EA2 A;  2O3F A;  3VSL A;  2E2H J;  2HS5 A;  1M1E B;  1HCR A;  4Y15 A;  4I09 A;  2HPM A;  1FOX A;  3KP2 A;  3CTA A;  3CP8 A;  4E7S A;  3QYE A;  3R0A A;  2GEN A;  3Q3S A;  1IRG A;  1XGN A;  5DEQ A;  5H2F C;  4BHB A;  2LY1 A;  3OYC A;  4A3M J;  1I6H J;  3I0T A;  4LMY A;  3VP5 A;  2QSF X;  2M7A A;  2IA2 A;  2JWT A;  4ZYH A;  3A01 A;  4KYW A;  2EV0 A;  2JTV A;  4MO7 A;  4M9X A;  4I2O A;  3HXL A;  2XVC A;  3EUK L;  2VOD A;  3NWS A;  4CYC A;  2IGO A;  1TNS A;  5KNL A;  1SMY F;  2UXH A;  5H6R A;  3HB9 A;  3VYS B;  5ILS A;  2PFV A;  4LB6 B;  2LOO A;  2XDV A;  4WWC A;  4Y52 J;  1GHC A;  2B3W A;  3ABM H;  3JW4 A;  1LDJ A;  3MWM A;  4ZYE A;  1OLT A;  2L9R A;  2VQH A;  2X1E A;  3MZ8 A;  3NXC A;  4N9I A;  1R4M B;  1G4D A;  3IH2 A;  3K70 D;  1UAA A;  1MD0 A;  1V55 H;  3SEZ A;  3TQN A;  1R71 A;  1W0U A;  1KYW A;  1X58 A;  2UXP A;  1C0W A;  2QOP A;  5H6Q A;  4HX8 A;  4HZF A;  2QEN A;  5FHP A;  2VIX A;  3COL A;  2PMH A;  5JHU A;  3C2H A;  2XAS A;  3HOS A;  4A6D A;  3M3Y J;  3RPQ A;  4BEH A;  3FXJ A;  5IYB J;  5C3E J;  3GTK J;  5CKT A;  2YUS A;  1UFM A;  3WGI A;  1I27 A;  1ZAR A;  3BZC A;  1Z67 A;  4IOA F;  1R1T A;  2F2E A;  3JSJ A;  4MGR A;  3HOW J;  2MW8 A;  1TWF J;  1Z3Y A;  2QIB A;  3JRD A;  4NC7 A;  2CQK A;  4ZYA A;  4Q48 A;  1V4R A;  2K9N A;  5GTI C;  2K9S A;  2CRG A;  3PFY A;  2ZKZ A;  1MDM A;  4Z6Y A;  3CCL I;  1LPQ A;  1LJ9 A;  3FXU A;  3ON2 A;  1P9Q C;  4AUX A;  3ZMU A;  4HF2 A;  2IT0 A;  1S6L A;  2BZT A;  4DIQ A;  2MBF A;  3KLN A;  4XOP A;  3ZQ7 A;  3AL0 B;  1ZRE A;  2E34 A;  3ERM A;  1YS7 A;  1ZQ3 P;  2BV6 A;  2DPU A;  3DPT A;  5LHH A;  3FXQ A;  3HSF A;  4QIW N;  4CYD A;  2L54 A;  1K4S A;  4EJT A;  5E3O A;  1REP C;  1T98 A;  4HX7 A;  3ZQI A;  1TQM A;  2CQQ A;  2OA4 A;  3SHF A;  3X2Q H;  3GO5 A;  4PJ0 C;  3AKZ A;  3ZN1 A;  5EEG A;  4A0X A;  1XX5 A;  1BW5 A;  1BR4 A;  3LSJ A;  4OIQ F;  1PJR A;  4A3B J;  1MMD A;  4D7N A;  3FBI B;  2EB7 A;  3BG9 A;  3NQO A;  2JZY A;  2L9N A;  5KK1 A;  5TJJ A;  4PDK A;  1GV5 A;  2K02 A;  3JRF A;  3LSR A;  4GCK A;  2ISY A;  3IWF A;  3V7S A;  1OR7 A;  1QVU A;  5JVT A;  1DPU A;  4C2M A;  4GFL A;  2HXI A;  4EQQ A;  4I98 B;  3HDD A;  2V4J C;  3H9Q A;  1R7J A;  2E60 A;  3W3C A;  4OD4 A;  2O61 A;  2ZJP F;  3HPH A;  2ISZ A;  2L4M A;  3KP7 A;  3GYH X;  4ESJ A;  4Y3O A;  2B0L A;  3HHH A;  2UXX A;  2QF7 A;  2OAZ A;  2XAU A;  5EZH A;  5EGO B;  1WH7 A;  5CPR B;  1WJE A;  2YU3 A;  1PUF B;  1G3T A;  1T95 A;  2HFH A;  3ABL H;  3CCE I;  1B8I B;  4FAS D;  3LWF A;  3MFK A;  3S14 J;  3NRG A;  2LSO A;  4KMU X;  3JAM Z;  3I59 A;  4AVZ A;  1JE8 A;  3HOZ J;  2XPU A;  2HEO A;  1MBG A;  4JQF A;  1VI0 A;  2CG4 A;  2Z16 A;  1VTN C;  4XLN F;  2CS3 A;  2QLZ A;  2VAS A;  3FBN B;  1YTY A;  4F3Q A;  3M8J A;  5FFZ A;  3ZCO A;  4FE4 A;  1R1U A;  2HZT A;  2VQC A;  4F7Z A;  1ZLJ A;  3SWH A;  3BTI A;  2HZD A;  3F9K A;  4OAY A;  1W7P A;  3M1E A;  5IOZ A;  4AC0 A;  3OS2 A;  3GME A;  4L9V A;  3B6C A;  3OYK A;  3GLL A;  5GTH C;  3TBI A;  4RAY A;  2EK5 A;  4RBO A;  2DA6 A;  3DEE A;  4BNC A;  2UUZ A;  2LKS A;  2VQL A;  2Z99 A;  2XSJ C;  1VZ0 A;  1S29 A;  1UEL B;  2XGD A;  5FGL A;  2DMU A;  1O57 A;  3GTO J;  4XM3 A;  2H8W A;  3ESW B;  2XRO A;  2CFO A;  1YHQ I;  4EEF G;  4X1E A;  4FCY A;  2DJN A;  4DJA A;  2R5Z B;  4A0Y A;  4ZYD A;  4ZZD A;  4U7D A;  1IF1 A;  4TV7 A;  1W4M A;  3IKV A;  1X3W B;  4C2T A;  3W2A A;  3M07 A;  1B4A A;  2E1M C;  1F1Z A;  2BGC A;  3CQZ J;  3OOP A;  4E7K A;  2IVM A;  1TC3 C;  1IUF A;  3WG9 A;  3IC7 A;  4EJW A;  4U7B A;  1U6G A;  2A6E F;  4OWR B;  3U1D A;  4DBR A;  3AG2 H;  1XSD A;  4XBF A;  4B1R A;  1T08 B;  5CVI A;  4RB1 A;  2KZV A;  4HNV A;  5B1A H;  2WGB A;  2GLO A;  2OTJ I;  2O9L A;  4N4O B;  3TP0 A;  3W2W A;  3J7A O;  2OQG A;  1XG1 A;  2JUC A;  2VKV A;  2JK3 A;  1P7I A;  1XGS A;  1MMG A;  1ON1 A;  1RNL A;  4Y33 A;  1PVE A;  2DJI A;  4HNU A;  3DLA A;  1B9N A;  2HDW A;  2G7S A;  3R4K A;  2BBY A;  4PUS A;  4HLY A;  3ZMV A;  2X9D A;  2VKH A;  2R7D A;  2ZBK A;  2LLK A;  2PJR B;  2LNB A;  3D5R C;  4L5I A;  2WV1 A;  1OQY A;  5GAH J;  4GYG A;  3L2C A;  4BAY A;  3IL2 A;  2YS9 A;  3Q5F A;  3CF2 A;  5HDG A;  5D5X B;  2HQN A;  2KHM A;  4M6X A;  4IHX A;  1LDD A;  3W6V A;  4BXX J;  2O0Y A;  1WPK A;  3FMS A;  4LG0 B;  2OC6 A;  3M8E A;  2FMY A;  3PO2 J;  5EG0 B;  4QPO A;  4UUV A;  3DQV C;  3S17 J;  4GYI A;  1D0X A;  2G7G A;  2KRC A;  1ZGA A;  2HDD A;  2WB1 N;  1TTY A;  2WAF A;  2QBY A;  1OCC H;  2FXA A;  2XAJ A;  4E70 A;  3S2H J;  3H9J A;  5DD8 A;  5CXI A;  1IN6 A;  2XF5 A;  5JLX A;  3OYF A;  3IKT A;  1ZGJ A;  3SZG A;  3B73 A;  4LG3 A;  3W2V A;  3G71 I;  4BS9 A;  4BHC A;  1Y39 A;  5K58 A;  2RKH A;  2DA3 A;  4A3C J;  4EM0 B;  4GFK A;  1DU6 A;  2O5R A;  3BR1 A;  2P8T A;  1GVJ A;  3FIW A;  2VI6 A;  4LK0 F;  2OU2 A;  3Q0W A;  3SZP A;  2LF8 A;  2ELH A;  4HQE A;  1U0J A;  3DEW A;  4PSW A;  1HKQ A;  2V9V A;  3CMA I;  2RVC A;  3CD6 I;  2WC2 A;  2HOA A;  2QQ8 A;  1T38 A;  1LFU P;  4BL0 B;  1TQP A;  3WTW C;  3GZ6 A;  5D1R A;  3ZP5 A;  2R5Y B;  2K4B A;  4A5M A;  1EA3 A;  3CLQ A;  1WJD A;  5FB2 A;  2OBP A;  2B63 J;  1X2M A;  4FTH A;  4Q5S F;  4V2G A;  1DGW Y;  5DTD A;  3I4N J;  1G8X A;  5AON A;  4D0P A;  4WF2 A;  3U9G A;  1WWX A;  3S3M A;  1WI9 A;  5D6E A;  2V79 A;  1ZK8 A;  3KEY A;  4BJ6 C;  2E1C A;  2A61 A;  2O8X A;  4IJA A;  4BBR J;  5KCM A;  1KQ8 A;  5E3M A;  1TW2 A;  2IEK A;  4Y4R A;  5J8F A;  3BHQ A;  3V8K A;  4FX4 A;  3WTU C;  3DPL C;  3WGH A;  1POG A;  3FXK A;  2FBI A;  3PFI A;  2PMU A;  3WTV C;  5IP7 J;  1TWA J;  1YG2 A;  1LNW A;  3EUA A;  3GBG A;  5E18 F;  4AIJ A;  4FIS A;  5D4S A;  5HLG A;  1R9T J;  4WIB A;  3NAR A;  1FTT A;  3PUB A;  3CCM I;  2A6T A;  4PFO A;  1R36 A;  2K4J A;  5EZG A;  1T8I A;  1I1G A;  3T0Y A;  1A6I A;  4JBA A;  3E5X A;  4HSR A;  3ZQH A;  4F91 B;  1MBJ A;  1Y56 A;  3TMO A;  4ESB A;  2DK8 A;  2A6H F;  3GFM A;  3BCG A;  1XSX A;  2XV4 S;  1GDT A;  4CXF A;  1ETX A;  3G7R A;  4IQJ A;  1STZ A;  3GW2 A;  2A69 F;  5L3G A;  4C2M J;  5BS6 A;  1FX7 A;  1Z77 A;  1J9I A;  1YIJ I;  4A5N A;  2QQA A;  2GFN A;  2DFI A;  1NG6 A;  1JTX A;  2LYC A;  3ROU A;  1KQ9 A;  2N8G A;  1U5T B;  3HUG B;  5E1W A;  4L9N A;  5IY5 H;  2XF7 A;  1JKR C;  1WJA A;  2L7Z A;  3ZMD A;  3H0D A;  4RAG A;  4YEL A;  1B72 B;  2QGU A;  3TL4 X;  1SGM A;  3C3W A;  3DLL F;  1PP8 F;  1GVD A;  4PZJ A;  3LSG A;  4G9Y A;  3E7Q A;  5JLW A;  1TLH B;  2ZJR F;  3G6E I;  1X3Z B;  3NEU A;  5HVQ C;  2OER A;  3FHN A;  3J80 K;  3BOQ A;  3J7A Y;  1IDZ A;  3TP3 A;  1T6S A;  4U0V A;  2GOM A;  3CMY A;  3BJB A;  2QA4 I;  3WE2 A;  3EGQ A;  2RRE A;  1MH3 A;  1WVR A;  4XLF A;  2COB A;  3V78 A;  1UB9 A;  3U1K A;  3LFU A;  2WY7 Q;  3KZZ A;  1QNT A;  5GPA A;  4I7H A;  2M30 A;  1ITY A;  5EEA A;  2IA1 A;  3OIP A;  1J0R A;  1WRJ A;  4A6E A;  2DA4 A;  2LH9 A;  4XN3 A;  1YRN B;  3KCC A;  5HSZ A;  4L5J A;  3J81 K;  3FHZ A;  1YOV B;  2QSG X;  1OPC A;  1FEX A;  3OYE A;  4CGR A;  2K27 A;  3EQL F;  1R49 A;  2EFN A;  3LL7 A;  2P7C B;  4E7L A;  3TW7 A;  1SD4 A;  2LMD A;  5HNF A;  1HQC A;  2OCE A;  2JMW A;  4RAZ A;  3ANG A;  1IDY A;  1YIO A;  4OIN F;  5EFY A;  1AA7 A;  2LP0 A;  2XB5 A;  1AKH B;  3LFK A;  1XN7 A;  4HA8 A;  3ZN0 A;  1RR7 A;  3OL3 A;  3VOX A;  3CO6 C;  4W97 A;  3VYU B;  1U2W A;  3I56 I;  4ENM A;  1MNM C;  3D1N I;  2HDC A;  3CCV I;  1DDN A;  4XKB A;  2RAE A;  2MLG A;  2BEO A;  1B1B A;  2JVG A;  1UMQ A;  3F22 A;  3N97 A;  1W36 C;  3HTS B;  1VFC A;  1ETV A;  2WBM A;  2GXA A;  3P9K A;  3QPS A;  3TW6 A;  1MKM A;  2D6Y A;  2NVY J;  5E17 F;  2NRA C;  2YU9 J;  2W53 A;  2VLA A;  1QZY A;  2O8K A;  2ZME B;  2LRD A;  1H0M A;  4UVB A;  3HHG A;  3OYA A;  4CCO A;  4CCN A;  4KN4 X;  1IJW C;  3K4K A;  2IJL A;  4KMF A;  2QUF A;  2R92 J;  3L7W A;  4YII A;  4DOZ A;  1AHD P;  1CF7 A;  1ACI A;  1FBU A;  2FQ4 A;  2A5Y B;  2CUF A;  4A0Z A;  2R7R A;  2X6W A;  3AQT A;  4I99 C;  3UKG A;  1R5I D;  3KKD A;  4YRV A;  1UHW A;  4UXN A;  4YZE A;  3CJQ B;  2Z3Y A;  2DMP A;  1N25 A;  4I6Z A;  3PM1 A;  3MD2 A;  3CDI A;  4KT6 A;  4M3D A;  4G6D A;  4NB5 A;  5J4V A;  4EV0 A;  5J6X A;  2DFH A;  3JRH A;  3F23 A;  2I8D A;  2ZNY A;  1AOY A;  1LEA A;  3SFZ A;  2OZU A;  3A0B C;  3K0L A;  1FZP B;  4HRI A;  2RDP A;  4P9F A;  1I1S A;  4JOM A;  3ZQF A;  1EJ9 A;  2BOL A;  3CDL A;  3VVZ A;  5J4Y A;  4LOC A;  2CV0 A;  3WTZ A;  3CDH A;  3RKQ A;  3HOU J;  2V9K A;  5DS9 A;  1OFC X;  2VJJ A;  5DM6 F;  1QA6 A;  4HBL A;  4G7H F;  5D8K B;  2L01 A;  4BAC A;  2F5V A;  1Z21 A;  2DO7 A;  2FUG 2;  2VBY A;  4OU0 A;  3I71 A;  4BDY A;  3OSF A;  2BY0 A;  1X1C A;  3E6M A;  1QZE A;  3WU1 B;  4QWQ A;  4HPQ A;  2PQ8 A;  2KDO A;  2G7H A;  4IZZ A;  5TRD A;  2E71 A;  5LBQ A;  5TIS C;  4YIF A;  3HTH A;  4BJ5 C;  3KP4 A;  4MTE A;  1X19 A;  4M71 A;  3VOD A;  3H92 A;  1D8J A;  5FJ8 J;  2VJ5 A;  3EPZ A;  2EH3 A;  1ZEL A;  2LR8 A;  3HM5 A;  4JNN A;  3V42 A;  3BJO A;  4LLL A;  2NS7 A;  4AIH A;  4KUM A;  3NPI A;  4BQO A;  3J7Z I;  3KP6 A;  3BDD A;  2BHZ A;  4P96 A;  2VN2 A;  3P7N A;  3QOE A;  3HTA A;  3IUO A;  3ANP A;  1WI3 A;  2KL4 A;  4DVY P;  1X3U A;  1K6Y A;  1VQ4 I;  1MND A;  4DYR A;  5KAI C;  4U87 A;  1FSH A;  5FLM J;  3ZXS A;  2L2O A;  4M3B A;  1TL8 A;  2QTQ A;  4I01 A;  3FZV A;  2Z5U A;  4JP0 A;  2DT6 A;  2CUJ A;  4B3A A;  5BMZ A;  3QPH A;  2M9H A;  2M1B A;  5AIQ A;  4WX9 A;  2DBB A;  3DBL B;  5BPI A;  1Y8Q B;  3CUQ C;  1K78 B;  2MFZ A;  1U3E M;  3N05 A;  3SFI A;  5K7Z A;  2KIF A;  3H3U A;  3NWT A;  4GXO A;  4NHJ A;  3BR5 A;  1ZYR F;  4RLQ A;  4KA4 A;  2AS5 F;  3GUD A;  1VQ6 I;  5J3L A;  2MYS A;  4D7M A;  2EIJ H;  5CJ9 A;  3FXM A;  2EFO A;  3T1B A;  4ENK A;  2ZXJ A;  3J7Y J;  4V19 K;  3NAU A;  3AAF A;  1Z05 A;  2E7W A;  4HV6 A;  1KA8 A;  5F0H A;  3QKX A;  1GXQ A;  1I6X A;  3G4S I;  1P7J A;  2A07 F;  3L1P A;  1P2F A;  1FPQ A;  2GAU A;  1H8A C;  2H1K A;  4NQW B;  4DBQ A;  3DTK A;  2LVS A;  3VW1 A;  4IL6 C;  4EGY A;  4OMZ A;  4CGZ A;  4L62 A;  2DT5 A;  3F8C A;  3A02 A;  3FX3 A;  4G94 A;  4N9H A;  2DOF A;  3V8J A;  2M0C A;  1BL0 A;  2XF6 A;  2Y2Z A;  2XB0 X;  4GDF A;  1GLN A;  1LB2 A;  2H27 A;  3RYP A;  4IHT A;  3AG1 H;  1W1W E;  3TOA A;  3S1M J;  4XOT A;  3G73 A;  1PP7 U;  2QQ9 A;  2X4H A;  2YX4 A;  3OIQ A;  2QKL B;  4G6T B;  5J1Y A;  4GCT A;  3HG9 A;  2DG8 A;  4ZDL A;  2JPB A;  2LK2 A;  3OL4 A;  5IOY A;  4MNU A;  3WU2 C;  5LHI A;  2ID3 A;  5LD2 C;  1R23 A;  1E3P A;  4ON0 A;  1YQA A;  2HOT A;  2G0E A;  3B6A A;  1JHH A;  3HKZ A;  2DOA A;  3QP5 A;  1HST A;  1RES A;  1I3Q J;  3FMQ A;  1YJN I;  5DAJ A;  1IN8 A;  1B9M A;  3WTX C;  1QPM A;  2M87 A;  1BOA A;  1ZG5 A;  2ESH A;  4U0W A;  2EZK A;  3VTI A;  4Y7N J;  1MJA A;  1X1D A;  5DUK A;  2BXZ A;  3SDG A;  4BHP A;  1K61 A;  4XLA A;  3COA C;  2GWR A;  2BXY A;  1MJ9 A;  5L3D A;  3BT9 A;  4B8X A;  4U88 A;  5LRR A;  1HKT A;  3K6G A;  1TNT A;  3T8R A;  2GXG A;  3MAJ A;  1JUM A;  2V1D A;  3R61 A;  1ZRC A;  2IS6 A;  3CCY A;  1CQT A;  1IO2 A;  4M74 A;  3PQK A;  2Y0M A;  1V5G A;  1T0F A;  4E4H A;  1D5V A;  1OYY A;  3QU6 A;  3E7L A;  2VJ4 A;  2VQG A;  4ZTJ A;  4P1W A;  2GBY A;  3QYB A;  1MJB A;  3RDI A;  1LFP A;  1D1A A;  4W1U A;  4XRM A;  2O6G E;  3GXO A;  2W1O A;  4KIB A;  3PIO F;  5B5E C;  3KNW A;  4HV5 A;  1J2X A;  2HNH A;  1Y6I A;  4MHG A;  5J40 A;  3KIO A;  1Z1D A;  2IAI A;  3KEQ A;  3CC4 I;  3VVX A;  5LRS A;  3IV5 A;  3MKZ A;  3J80 Z;  5FKN A;  1OYI A;  3E6B A;  4A3K J;  2E36 A;  3TGN A;  1SD7 A;  1OCP A;  5FKO A;  5EJC A;  4B09 A;  3VPR A;  1BI1 A;  2K3P A;  3ECO A;  3KET A;  1FYK A;  1UI6 A;  4AC6 A;  3BG3 A;  4PK4 A;  3L2Q A;  5GP9 A;  4IOC F;  5CVR A;  3CP2 A;  1I50 J;  4Z2Y A;  3K69 A;  5D5W B;  4UV9 A;  3CCS I;  1RR8 C;  2OZ6 A;  5FLV A;  1G3S A;  2P6S A;  4RM2 A;  1WJ5 A;  1QHH D;  1XGM A;  2R4G A;  1ZHF A;  3LSK A;  1H89 C;  2J5P A;  5C4J J;  2ZSI B;  1PYV A;  1SAU A;  2DU9 A;  5DDG A;  1MW7 A;  1FYL A;  2NXN B;  2XC7 A;  2LG4 A;  5HS8 A;  2PEX A;  1K79 A;  5D5U B;  3T6N A;  2VT3 A;  4DZJ A;  5K5Q A;  4MIM A;  2RQP A;  3TOB A;  1U8B A;  1YX5 A;  1OJL A;  3TO9 A;  2XRL A;  2CQ7 A;  3RPU D;  3GTL J;  3ULQ B;  2CMP A;  1DGR M;  2XKO A;  3ECH A;  2QYO A;  1IGN A;  4CIC A;  3JRB A;  2DA7 A;  4CO8 A;  4N0B A;  5ICF A;  4KN7 X;  5E8I A;  2KDZ A;  3OS1 A;  3BPX A;  2GOX B;  4X0G A;  4XRF A;  2FNP A;  2ME0 A;  2DN0 A;  2MH2 A;  4MEY F;  2JA5 J;  2WTE A;  5FGM A;  3OYG A;  1VND A;  3PO3 J;  3NI7 A;  4X6A J;  2PBI A;  1ERD A;  5M5Y J;  3KZ9 A;  2KLO A;  3R6S A;  4XK4 A;  3RYR A;  1LE8 B;  2E1M B;  1B6A A;  3PL8 A;  4HX4 A;  2LBF B;  3AL0 C;  5FKL A;  3TKY A;  4NC6 A;  2ZC2 A;  4HEA 2;  1HDD C;  4XLC A;  4XNF A;  4L18 B;  2YVH A;  2EIM H;  3VEP A;  2DOE A;  3EDP A;  2KJC A;  2V1X A;  5F27 A;  3LWJ A;  3V7R A;  1BJZ A;  4P55 A;  3VW0 A;  2H6C A;  2R3S A;  1E2X A;  3ASO H;  4XLH A;  3ZQG A;  4E7H A;  1ETY A;  2ZB9 A;  5F1J A;  2L7M P;  1XCB A;  5J8C A;  3LQR A;  1LQ1 A;  1G59 A;  4BQN A;  2DLL A;  3ISP A;  4A3L J;  4Y13 A;  4E7J A;  3FKJ A;  2DDB A;  3OYM A;  4C3J J;  3GTM J;  2CGP A;  5DCF A;  3CUQ A;  2Y31 A;  3NNR A;  1K83 J;  1JGG A;  4CZZ A;  4IHY A;  2P81 A;  3H1C A;  5JI6 A;  1BOB A;  3DU5 A;  3KP5 A;  3WGG A;  1D1B A;  2KFD A;  2NVX J;  3K9T A;  4GFB A;  2XRN A;  3K70 C;  2W82 A;  2MD5 A;  4II2 A;  4BGD A;  1R5H A;  3CES A;  2R7O A;  2FML A;  2HOS A;  1YW8 A;  4IRI A;  2NAZ A;  4M9S A;  2ZCM A;  5LGT A;  2KJB A;  2EIK H;  5D19 A;  1SAX A;  5J1R A;  4UUS B;  2VPR A;  5AIP A;  1ONV A;  1NH3 A;  3E6C C;  4IRV A;  1G2H A;  4WXD A;  2GA2 A;  1NG7 A;  3P9T A;  3F6O A;  1SMT A;  5GPC A;  2UZK A;  3KYL A;  3HIF A;  3FIS A;  2UV1 A;  2ELK A;  3LA3 A;  3CZ6 A;  2HTS A;  2DA1 A;  3K4N A;  3QWL A;  3RKX A;  2HYG D;  3HGY A;  3HE0 A;  2W48 A;  3LSM A;  2XIG A;  2Z1D A;  5HLI A;  1HC8 A;  2FE3 A;  5DCM B;  1K7A A;  3ZOB A;  1JJ6 C;  1A6Q A;  5IYD J;  2BW3 A;  2IXS A;  1IXS B;  3CJR B;  5ICG A;  1FMV A;  2AXT C;  1Y1W J;  1SFE A;  1XMX A;  2W85 A;  3DBR B;  3MKL A;  1WZ2 A;  2ELJ A;  2MC3 A;  2W7N A;  4KIF A;  2EFW A;  3BPV A;  1K6O A;  1UCR A;  1KGS A;  2PN6 A;  3BTJ A;  2CO5 A;  3MZY A;  1Z9C A;  1H88 C;  1W5S A;  4BKX A;  2V6E A;  1ZR2 A;  3TO7 A;  4XRS A;  2ZO4 A;  1VQN I;  1MSF C;  4L9J A;  1A35 A;  3K2Z A;  2CV2 A;  4S0H B;  5EDN A;  3OYB A;  2PMZ A;  3RSN A;  1B59 A;  4RB3 C;  3CJT B;  1IV8 A;  4M3G A;  1D8K A;  3CCR I;  3CO7 C;  1YE9 A;  1BC8 C;  1ZRD A;  2VBZ A;  1XPX A;  2HTJ A;  4R8H A;  3KE2 A;  1JUP A;  3ZRG A;  1TQI A;  2IGN A;  2LF7 A;  4UV8 A;  2E2J J;  2K9Q A;  1U9N A;  2R0Q C;  2JA8 J;  3HL2 A;  1GT0 C;  1BA5 A;  3Q9S A;  3WHC A;  4CCL A;  3L2W A;  4MXM A;  1BR2 A;  1U9O A;  1XCV A;  4H4K C;  4OD5 A;  1Z6R A;  1YLF A;  3K7A J;  4DQ2 A;  4IHV A;  4FHT A;  4CZC A;  3I58 A;  3QBM A;  3A03 A;  3I3L A;  3MKY B;  1KON A;  5M5X J;  2HVS A;  3W6K B;  4M6Y A;  2IGK A;  4ZJZ A;  3HC7 A;  2PLY A;  4MTD A;  1GV2 A;  1LFB A;  2LKX A;  5LEK A;  2JVH A;  2COM A;  3CJD A;  1UST A;  3ONQ A;  4C3H J;  2V57 A;  2L7F P;  1OKR A;  2W25 A;  2KIQ A;  2K86 A;  4BE0 A;  2R7U A;  2W24 A;  2FQ3 A;  1MBH A;  4LK1 F;  4V2F A;  4BH9 A;  2BYV E;  4HOB A;  4XSX F;  1XMK A;  3T8T A;  4ACI A;  3DKY A;  2AO9 A;  2HQA A;  3HIM A;  5ICE A;  2GIV A;  3JRG A;  1F43 A;  2K9L A;  1O3S A;  1QPI A;  4A93 J;  2JN6 A;  1YJ9 I;  1AU7 A;  2P7V B;  1Z6T A;  4YIR X;  4M6V A;  4BE1 A;  3JRI A;  4KIT B;  5FFX A;  1O7L A;  4YFX F;  3FF5 A;  2KMU A;  2Q2E B;  1BW6 A;  1QVT A;  1S7A A;  4QTR A;  3BC8 A;  2XSD C;  4A3J J;  4FT8 A;  3OR1 C;  2L7K A;  1OCZ H;  1UG0 A;  2ZFU A;  3BCA A;  3DBH B;  5B66 C;  3ERE D;  1AWC A;  2HGC A;  2KRH A;  2OQR A;  2WY8 Q;  4LLN A;  5FO5 A;  1NHA A;  1TBX A;  1GUU A;  2GXB A;  4CH7 A;  1QZZ A;  4D1Q A;  3RJP A;  2Y0S A;  5DD4 A;  2VE9 A;  3A01 B;  3IUV A;  2DI3 A;  5LLQ A;  4WCG A;  3R60 A;  3I4M J;  5C4X J;  3F8F A;  3IH3 A;  1L0O C;  4E7I A;  2YVX A;  4CYC B;  2K5C A;  4A3G J;  2XPV A;  2ZXW H;  5LHG A;  1HW2 A;  2ZOZ A;  3CWR A;  3HGG A;  2KIU A;  2REK A;  3F8N A;  5HDN A;  2E1N A;  3E3V A;  3G1M A;  1J09 A;  2DTZ A;  2EIL H;  1VF9 A;  3C2B A;  2FBK A;  3BR2 A;  5L3E A;  4HDV A;  1NTC A;  1YW9 A;  2RN7 A;  1HSJ A;  2D1V A;  2DA5 A;  1ZG1 A;  2MA3 A;  2NVT J;  2HYF A;  2LKP A;  2DT7 B;  2P5K A;  3WOD F;  4C3I J;  1IAW A;  2FJI 1;  4YEJ A;  1KU2 A;  3HEF A;  3EYY A;  5JR3 A;  3BG6 A;  1NK3 P;  3FKI J;  3BZK A;  1HA8 A;  2E7X A;  2FJ1 A;  3H3V K;  2NYX A;  1JXS A;  4BDZ A;  4BEH B;  2GA1 A;  3GF2 A;  3BR0 A;  2DG7 A;  2CW0 F;  2IS4 A;  1SVM A;  5CVU A;  1IXC A;  2QWW A;  1XGO A;  4XON A;  2W84 A;  4F93 B;  3P5J A;  2RV8 A;  4XN0 A;  5HAW A;  2ZXH A;  4XRS G;  3I55 I;  1FP2 A;  1X1B A;  4K2E A;  1IG7 A;  4Q47 A;  1Q1H A;  3LSP A;  2X1D A;  3T5X A;  1QU3 A;  3VYR B;  4F55 A;  4BYY A;  1TP4 A;  4HST A;  1MDM B;  4IF4 A;  5EEH A;  4EJO A;  4S04 A;  4IXA A;  4DZP A;  2GQQ A;  3G1O A;  2WAE A;  3BG7 A;  1H9G A;  2IU5 A;  4KDP A;  3L2V A;  2L4A A;  2DFE A;  3PNT A;  2M8G X;  2IBD A;  1FYM A;  2KT0 A;  1TZL A;  1IV6 A;  1D5Y A;  1SFK A;  2M4G A;  4IPA A;  4AYB A;  1Z7U A;  1HKS A;  1ON2 A;  1R4N B;  2KIS A;  1RKT A;  3C2G A;  5EGO A;  1IN4 A;  5E20 A;  1PUF A;  5FRM A;  2XHK A;  1DP7 P;  3VYT B;  3PNY A;  2ACJ A;  3F1B A;  2XUB A;  1MBE A;  2HU9 A;  1B8I A;  1WH5 A;  3BLY A;  4AD9 A;  2Y30 A;  4XR6 A;  1UZC A;  1R1V A;  4XKW A;  3RD3 A;  2JRM A;  1U5T C;  1V5F A;  3OS0 A;  2FOW A;  1FOY A;  1IN5 A;  3LST A;  5F64 A;  5ILU A;  5D18 A;  1T0F C;  2BVL A;  4NNJ A;  1HDP A;  5IT3 A;  1TT0 A;  5C4Y A;  2VL8 A;  2MD0 A;  2LTP A;  1BR1 A;  3H5A A;  4BXU A;  2HQR A;  5GAE J;  3OYD A;  5DYM A;  4XOR A;  1Z91 A;  2X6Y A;  1LEB A;  1SVO A;  3KZY A;  3QYF A;  5D5V B;  3CF5 F;  1OIS A;  4OIO F;  1S3J A;  2XDN A;  2DMQ A;  4LIV A;  2GZW A;  3C1D A;  3HSE A;  1FNN A;  1UHS A;  5B3S H;  1FSE A;  3K2A A;  4KJZ A;  1O3T A;  3JAM K;  3F72 A;  3FM5 A;  3C07 A;  2CQN A;  2A5W A;  2ZCX A;  1ZGW A;  5E1Z B;  2R5Z A;  1EKE A;  1PUE E;  2ME6 A;  1JUS A;  1NK2 P;  3IHU A;  2AQF A;  3FK7 A;  4H0E A;  1KU3 A;  3I59 B;  4L0Z B;  5F0C A;  3LA7 A;  3H0G J;  2RGV A;  2LRE A;  2XKP A;  4N4N B;  2GM4 A;  2B9S A;  5FRO A;  1T56 A;  1KU7 A;  2QCO A;  2F48 A;  2QVO A;  2WWY A;  1DP3 A;  4NEL A;  2LD5 A;  3VB2 A;  4NBQ A;  3DU6 A;  5M5W J;  2CUZ A;  1OMI A;  4OMY A;  5IT9 K;  4KFC A;  1TW3 A;  1BIB A;  2DQR A;  3ZMT A;  2OPT A;  3QAH A;  1ZG3 A;  1U8R A;  1W7P B;  4MQ9 F;  3RPU A;  5A2Q K;  2A05 A;  2ID6 A;  4PGH A;  1WQ2 A;  1APL C;  2ZY9 A;  2VB6 A;  1BBY A;  3M7G A;  2MAB A;  3S15 J;  2FNA A;  5ILV A;  3B81 A;  3L2R A;  3L2U A;  1WKM A;  2VC1 A;  3G1L A;  2NX4 A;  2KZG A;  1XSV A;  1KZH A;  4KIS A;  1KYZ A;  3MKW B;  3QPL A;  2M2E A;  3GEU A;  2D2W A;  3KPH A;  3HKZ N;  3H5R A;  3RZO J;  2DYR H;  4EJV A;  3CCQ I;  4QSH A;  4BQQ A;  1R22 A;  2BVM A;  4G7O F;  2MH9 A;  2V1N A;  5HDK A;  2C6Y A;  1TWC J;  2PJR A;  5HNH A;  3CCJ I;  2L9S A;  1SC7 A;  3G56 A;  4JKZ A;  4PCQ A;  3S3O A;  2HPI A;  2XGC A;  3IRR A;  2VON A;  3LOC A;  1JT0 A;  1IRF A;  3JTH A;  2A3S A;  4EVI A;  1VQO I;  4HNT A;  1BC7 C;  1MMN A;  1ZRF A;  4XMY A;  2O7O A;  2OUM A;  3MN2 A;  4B48 A;  3NS4 A;  3EUH A;  4ASN A;  3VIB A;  2STT A;  3K4B A;  4A3D J;  4U9N A;  2XGE A;  3EYI A;  1V3F A;  2ZME C;  4LG0 A;  2CQX A;  1TWH J;  5K7F A;  3S1R J;  1ZR4 A;  3ABT A;  2R7V A;  3CMM A;  5EG0 A;  3I4P A;  5FKM A;  3BY6 A;  4RB0 A;  1Y0N A;  3V7C A;  3OYN A;  3ZQL A;  4ABZ A;  1J75 A;  1MIJ A;  3DF8 A;  3H3Z A;  4RMN A;  2AHQ A;  2R7Q A;  2HXO A;  2VOP A;  3HYI A;  2BHY A;  3CUO A;  2CH0 A;  3TO6 A;  3LAJ A;  3I64 A;  2BE5 F;  3AFH A;  2FF4 A;  1FBS A;  1ETW A;  3OIO A;  3MQ0 A;  2VUM J;  3PPB A;  5LEJ A;  2ZOY A;  3DPJ A;  1X1P A;  2PX9 A;  1HW5 A;  1S8N A;  2LY2 A;  2M45 A;  3PAS A;  1F9N A;  3DWL E;  4YFN F;  5TGT A;  3GX4 X;  5KAF C;  1WCM J;  3D5L A;  2TDX A;  5E8G A;  2ADU A;  3RH2 A;  5CQG A;  1XMA A;  3BZ6 A;  5HS9 A;  4GO1 A;  1A36 A;  2HYT A;  1O4X A;  4RDU A;  4XLP F;  2L02 A;  4IQ4 A;  3F8M A;  2ZCW A;  3QP6 A;  3RKY A;  3ZMS A;  2R5Y A;  3WE3 A;  4AID A;  1R00 A;  4WXH A;  4IHW A;  4R79 A;  2EZH A;  3K1N A;  4II3 A;  2EBI A;  3FMR A;  2Y69 H;  1P4A A;  2QBY B;  4I0A A;  3VSK A;  4EGZ A;  4C2U A;  1Y1V J;  2LFB A;  3ELK A;  1RPW A;  3OV8 A;  3S1N J;  1TT5 B;  2M8E A;  2NS8 A;  1YW7 A;  2L9V A;  5HLT A;  4FE7 A;  4RGU A;  1XDU A;  1D0Z A;  4F52 A;  4Q4Z F;  1MSE C;  3SQN A;  2EJR A;  3JRC A;  3DTE A;  4P5O A;  5BNG A;  5K7H A;  3V4G A;  1WJC A;  2EA4 A;  4ZH4 F;  1ENH A;  2F5D A;  4KNY A;  4PXI A;  1MMA A;  1HF0 A;  4D5C A;  1ORK A;  3GVA A;  4CCJ A;  3MZH A;  3OMY A;  1F5T A;  2E19 A;  1SVL A;  2DA2 A;  3BWG A;  3PJR A;  4RGX A;  3GTQ J;  1D3Y A;  2K85 A;  4CHU A;  2HWV A;  1VQ5 I;  3MCZ A;  3I54 A;  3N4M A;  3KZI C;  4I0B A;  2KRF A;  4JL3 A;  4A3E J;  2PI0 A;  1T33 A;  2WAQ A;  4XKV A;  1EH6 A;  4AU7 A;  2WAD A;  2KP6 A;  1IW7 F;  4NUB A;  4CCM A;  2UXO A;  2UXI A;  3HUG A;  1P4X A;  1U5T A;  1ZH5 A;  3E1S A;  4ENJ A;  1XD7 A;  2LC2 A;  1B72 A;  1A04 A;  2OCC H;  1MH4 A;  1JGS A;  5C44 J;  3FRQ A;  5HBU A;  5L3F A;  3SDB A;  3TED A;  2IS2 A;  4LD5 A;  1F36 A;  2EV6 A;  4A69 C;  4RM3 A;  5DM7 F;  3WHB A;  2MG4 A;  1QO0 D;  2IPQ X;  2E5Z A;  4B44 A;  1IRZ A;  2R7T A;  3RQ4 A;  2OF7 A;  3AQS A;  4AM3 A;  1IXR C;  4MQV A;  4IRH A;  1BI0 A;  5FLX K;  1UHM A;  1Z0X A;  4D9J A;  2R7W A;  1T2K A;  2DPD A;  2QKO A;  3S1Q J;  1IUY A;  2Q0O A;  4ZZL A;  2HR3 A;  2M4K A;  2NVU B;  5EF6 A;  5F6F A;  1FWZ A;  3M1C A;  2J5O A;  3RZD J;  3CRJ A;  3FM3 A;  4Y17 A;  5IYC J;  2VE8 A;  2BY3 A;  3L09 A;  5BPD A;  3PNV A;  5FD6 A;  2ZJQ F;  2DMT A;  1SEU A;  1YRN A;  1R6R A;  5E3N A;  3CC7 I;  1VQL I;  2K9M A;  2FBH A;  4R1H A;  3HTJ A;  4KIG A;  4PJL A;  4O3M A;  3ASN H;  3K10 A;  3GTJ J;  1RZ4 A;  2F4M B;  1VQK I;  3E5U A;  2V9P A;  1ZTR A;  3MEX A;  1RUO A;  1ODD A;  2KPM A;  2CSO A;  2EIN H;  2I5U A;  4G12 A;  3FDY A;  3J81 Z;  3S2W A;  1SD5 A;  4XLE A;  2IRF G;  3A0H C;  3OR2 C;  2E1O A;  2A68 F;  2TCT A;  1Z7L A;  3IP4 B;  4AWX B;  3SXY A;  4RAF A;  2V26 A;  5H20 A;  1ETO A;  2ZJ2 A;  1AKH A;  2JQ7 A;  3LNQ A;  1XS9 A;  5E3L A;  2M0M A;  4KWA A;  3JSO A;  1H9T A;  3OY9 A;  4UVA A;  2F07 A;  4UHT A;  2H1L A;  5ICC A;  2W4S A;  2F5F A;  5J1U A;  1LUJ B;  1JT6 A;  1ZAO A;  3AG3 H;  2JUG A;  3KX2 A;  2H94 A;  4HLX A;  3O60 A;  2PMZ N;  2FSW A;  4UDS A;  1G3W A;  4ITV A;  3A1Y A;  1XC5 A;  2VBW A;  1UI5 A;  3KEO A;  1JHF A;  4J01 A;  2FX0 A;  4F92 B;  2ZME A;  2X51 A;  3DFG A;  3MVP A;  1HLV A;  2EZL A;  2XAQ A;  4CUG A;  3R0J A;  2DMN A;  4PFP A;  2KQR A;  1J7K A;  2EZI A;  3TDU C;  1YFH A;  4BQA A;  3LAP A;  4A3F J;  2YSR A;  2X6X A;  3HOX J;  4ZC3 A;  5DV5 A;  4BJT A;  3TDZ C;  3S2D J;  2ZSH B;  3OYI A;  5M3F J;  2Y9Z A;  4HYE A;  2VPL A;  1RET A;  3IRQ A;  3QOP A;  3D0S A;  4HW0 A;  1ZN2 A;  4MFE A;  4HKU A;  2FRH A;  1SFO J;  4ME9 A;  3DP7 A;  3RI4 A;  1YIT I;  4LB5 A;  2M5W A;  5BOX A;  1P4W A;  5IT9 Z;  3RQI A;  1YI2 I;  3HBL A;  4G6Q A;  5IP9 J;  4HG2 A;  2FEZ A;  3IH4 A;  4B4C A;  4IHS A;  2ECB A;  2O7T A;  5A2Q Z;  4O5V A;  3HOY J;  1I39 A;  2DW4 A;  3U21 A;  3VWB A;  4D5F A;  3HOT A;  1J5Y A;  1OCR H;  1VQP I;  1K4T A;  1E17 A;  1KU9 A;  1WHU A;  2TRT A;  3DXJ F;  4G8X A;  1CF7 B;  3ABK H;  3S5R A;  4RA2 A;  3JTG A;  3SJM A;  3FXO A;  4G7Z F;  1QBJ A;  5J47 A;  4RGS A;  1O3Q A;  2R7F A;  2VC0 A;  2OV7 A;  1Y0U A;  1BIA A;  2JA7 J;  2D1H A;  3DKX A;  3DPU A;  4RGR A;  5EYR A;  5KVR A;  2Y0S N;  4BU2 A;  4IEJ A;  2R93 J;  3BTC A;  3BNI A;  1FBQ A;  3F6V A;  3I9V 2;  3WU0 A;  5HLH A;  2XAF A;  4MEX F;  2UWM A;  3ZQQ A;  4I02 A;  2G7L A;  2CW8 A;  3OOU A;  3DTI A;  2DAO A;  3DKW A;  3GCM A;  2Q1Z B;  2OI8 A;  2ESN A;  3BR3 A;  2P5L C;  1G6N A;  2HI3 A;  2X1C A;  2P4W A;  2HVR A;  3V6G A;  3HRT A;  4L5E A;  3KP3 A;  1WFX A;  4NN1 A;  5ED4 A;  1RI7 A;  3QOD A;  2IGM A;  1UJ8 A;  2VT2 A;  1HXD A;  2EQR A;  3KKC A;  4L9T A;  1U78 A;  3L00 A;  1K78 A;  3M4O J;  4JX4 A;  1GXP A;  5FKK A;  4JYK A;  1HBX G;  1E0E A;  1TWG J;  1I5Z A;  2NP5 A;  4AF5 A;  4IVN A;  2FOK A;  3H5N A;  2PBX A;  2KIM A;  3EET A;  2DFF A;  2E5N A;  3D5S C;  2JRT A;  4LGW A;  1XB4 A;  2PG4 A;  1ZKG A;  3QU3 A;  4ZDO A;  2Y75 A;  3JCU C;  1SFX A;  4ANJ A;  3OYJ A;  4HDU A;  4DYC A;  4EJU A;  2A2F X;  2IW5 A;  3Q0U A;  3G3Z A;  3CCU I;  5F08 A;  5K5R A;  5KHD A;  1HOM A;  4XQF A;  4BBS J;  4A12 A;  2Q8K A;  5F0F A;  1F4K A;  3PIP F;  3S32 A;  1VQ7 I;  2VXD A;  1OCT C;  3BQZ A;  5D6F A;  4NQW A;  3SEQ A;  2P0W A;  5ERI A;  1FC3 A;  1VQ8 I;  4DYQ A;  4WK8 F;  3E6D A;  1O3R A;  3CC2 I;  1DU0 A;  4DGW B;  3WG7 H;  1BI2 A;  2JSP A;  3KLO A;  1J59 A;  3GZI A;  1V5E A;  5K5O A;  4EM2 A;  2V7F A;  2L0K A;  3RIR A;  2CU7 A;  4FQG A;  4CCK A;  1LVK A;  4OIP F;  1JKO C;  4I76 A;  1EH7 A;  3WTS C;  1MBK A;  4DNC A;  5FMP A;  4BE2 A;  2JJ7 A;  2I10 A;  5HOD A;  1DUX C;  3F21 A;  4AYB N;  2P5V A;  3K4M A;  2HVQ A;  1FY7 A;  3JSP A;  5LGU A;  3DCF A;  3MMY B;  2G3B A;  3EUH C;  4E6K G;  4FET A;  1W36 D;  1EF4 A;  3ML6 A;  3A2K A;  3FXL A;  4B3X A;  3VDX A;  1JTY A;  4ZDP A;  2NOJ B;  4DW6 A;  1X2N A;  3GFL A;  1OCO H;  1N78 A;  5CQE A;  2VOO A;  3FXR A;  3VOE A;  4PSX A;  4JX6 A;  2D45 A;  5LGN A;  2XGX A;  1D0Y A;  1S9H A;  5E1X A;  1USS A;  2E35 A;  1YYV A;  4UY8 I;  4J19 A;  1FOW A;  4JX5 A;  3FK6 A;  4RLF A;  3SYT A;  2W57 A;  1FTZ A;  3GLX A;  4UB6 C;  2PJP A;  3K1M A;  2RNJ A;  3Q9V A;  5FRN A;  2CW7 A;  4A2U A;  5M3M J;  2HOE A;  3OYH A;  1IC8 A;  2CJJ A;  3O8H A;  5IP6 A;  2NP3 A;  4EAT A;  2K3F A;  5E79 C;  3CLO A;  1YX3 A;  3PSI A;  5JVG F;  2RAS A;  4UVC A;  2OJE D;  3PSF A;  3K8P C;  2G7U A;  3VW2 A;  2OTL I;  2R7S A;  3A4C A;  3F3X A;  1RKW A;  2L3D A;  4BXF A;  5F1R A;  3W6J B;  1JI8 A;  2M7B A;  4AVP A;  1BM9 A;  3BG5 A;  4EMS A;  4XL9 A;  2QM3 A;  4MK6 A;  4CSW A;  5CVJ A;  5FLX Z;  1R58 A;  2X0L A;  2NVQ J;  1S7O A;  2F5C A;  3BJA A;  4PGG A;  3QQA A;  4C9Y A;  4PJJ A;  3UR3 C;  4YFK F;  2YR2 A;  4A3I J;  3O2P E;  3S8P A;  2EPF A;  4B47 A;  1ETQ A;  2NOG A;  3GZ5 A;  1PDN C;  2QKM B;  3M8F A;  1XTA A;  4BUP A;  1R5G A;  1W0T A;  4IKF A;  2R7X A;  4BY1 J;  4U9L A;  2WB1 A;  4J00 A;  2JA6 J;  2E2I J;  3H35 A;  4OIR F;  1OYW A;  3GZN B;  3HRS A;  1W5C C;  5D8L B;  2DDA A;  2MSY A;  4XKC A;  1DQU A;  3I5U A;  1FIP A;  1N75 A;  2HKX A;  5AQC A;  4M72 A;  2FU4 A;  2Q24 A;  3GFI A;  1W7P D;  4IO9 F;  2B7E A;  1DPR A;  4P9U A;  4QPQ A;  3S16 J;  2IP2 A;  1FLI A;  4PJM A;  3WTY C;  3BQY A;  3EUP A;  5IPA A;  2G9W A;  3M9A A;  1RIO H;  4UB8 C;  4ZTF A;  3OSG A;  5GAD J;  3ZR8 X;  3H9G A;  4JK1 X;  3JR9 A;  3HOV J;  3IWZ A;  1MMS A;  3CME I;  1YS6 A;  1FJL A;  1LVA A;  1A31 A;  1ULY A;  4PJN A;  1Q1V A;  4UNO A;  3LSH A;  3CJN A;  2M3A A;  3BJ6 A;  3KYC B;  3ZGK A;  2Y48 A;  4ETS A;  2VXZ A;  3ZQC A;  2EV5 A;  1LE8 A;  2UXN A;  3I53 A;  2Z9O A;  2LBF A;  2VKE A;  3BTL A;  4RB2 C;  4GGG A;  1QGP A;  1X1A A;  5JFR A;  3FWE A;  3PQJ A;  1FIA A;  2VBX A;  3NRV A;  4LIU A;  2R7Z J;  2RHA A;  1Y8R B;  1IZ1 A;  2JSC A;  1QQI A;  5DUI A;  2CWE A;  3F0C A;  2YX7 A;  1IN7 A;  4M3E A;  2BY2 A;  3G2B A;  3KFW X;  1JJ8 C;  2QSH X;  3IAM 2;  5CXG A;  3PUF A;  2LDU A;  2K40 A;  5LFA A;  5HOO A;  2ZFW A;  3GTP J;  4C30 A;  2QZ8 A;  2LY9 A;  2Z2S B;  2JA2 A;  4HAM A;  3E0J B;  3LSI A;  4BY7 J;  3U2R A;  2IS1 A;  4LJZ F;  1P6R A;  4QLC U;  3BRO A;  2H8R A;  4O6J A;  1N77 A;  2ZNZ A;  4LFU A;  2VKD A;  1UG2 A;  1JKP C;  5H9T A;  1MBF A;  2XAG A;  3HRU A;  1MNE A;  1SAN A;  1WGX A;  3HZJ A;  4EM1 A;  2WV0 A;  4ESF A;  1WJF A;  1VQ9 I;  4IRG A;  4M73 A;  3GEZ A;  2STW A;  1V54 H;  4CA0 A;  4S05 A;  2MGQ A;  1SFU A;  1LKX A;  3DV8 A;  2RNG A;  3RKW A;  1FOK A;  1KQ0 A;  1HW1 A;  5F04 A;  3O8G A;  1S5L C;  3GWZ A;  3GTG J;  1T39 A;  1YJW I;  2DYS H;  4HQM A;  5L3B A;  2RQQ A;  3VFZ A;  4YG2 F;  1D1C A;  4UUS A;  2F4I A;  3JRA A;  3C7J A;  3F8B A;  2UXU A;  3LA2 A;  3GFJ A;  4FX0 A;  1WJB A;  2AQE A;  1BJA A;  3S3N A;  3HTI A;  2X48 A;  2JPC A;  1O7F A;  2WA0 A;  3HSR A;  3AG4 H;  5D4R A;  4XIC A;  2NS0 A;  4ZYG A;  1X4P A;  5B1B H;  4KIC A;  4CDG A;  5FD5 A;  3V8L A;  1EV7 A;  1ZLK A;  3B02 A;  2IA0 A;  1A5J A;  3ON4 A;  2JT1 A;  2DXI A;  3ABU A;  2DCE A;  3KYD B;  4UUT A;  2XAH A;  4B43 A;  2DTR A;  3HRM A;  3CUQ B;  1X4O A;  3IAS 2;  3LQQ A;  4LLG F;  2YPR A;  3E5Q A;  5CLS A;  5JHF A;  2ETH A;  5DCM A;  3QPT A;  1FT9 A;  1I3A A;  2FBQ A;  3VVY A;  3OYL A;  2PFB A;  2EWN A;  2FA5 A;  3UNG C;  2HKO A;  3OWT A;  9ANT A;  2EFQ A;  2QEX I;  2H09 A;  2ZXI A;  3VOK A;  1OR7 C;  1XDS A;  1L3L A;  1RUN A;  3RTR A;  2WUI A;  5CW8 A;  1ETK A;  2F6C A;  6PAX A;  3BP8 A;  3WTT C;  3QRF F;  2BY1 A;  3JRE A;  1CGP A;  2Y9Y A;  2RC4 A; 
#chains in the Genus database with same CATH homology
 3HGY A;  4ICH A;  2W48 A;  2N8G A;  2WAQ N;  1Z0X A;  1JKR C;  2L7Z A;  2ZCN A;  1B72 B;  2CUE A;  1SGM A;  3ZOB A;  2QKO A;  3S1Q J;  1JJ6 C;  5IYD J;  1GVD A;  2HYJ A;  3LSG A;  3E7Q A;  5JLW A;  5EF6 A;  3RZD J;  2HQ5 A;  3CRJ A;  2M34 A;  1Y1W J;  2OER A;  5IYC J;  3MKL A;  2DMT A;  1IDZ A;  1YRN A;  3TP3 A;  5E3N A;  3CMY A;  3BJB A;  3BTJ A;  2FD5 A;  1H88 C;  4XID A;  2QWT A;  3HTJ A;  4BKX A;  3EGQ A;  1S7E A;  1ZR2 A;  3GTJ J;  1MH3 A;  4XRS A;  2COB A;  3V78 A;  2PZ9 A;  1ZTR A;  1MSF C;  4MFD A;  4S0H B;  4G12 A;  5EDN A;  5GPA A;  4M3G A;  1ITY A;  5EEA A;  1JKQ C;  2E1O A;  2TCT A;  2DA4 A;  3MNL A;  3Q0V A;  2X6O A;  1YRN B;  1JUP A;  1ETO A;  1AKH A;  5HSZ A;  3LNQ A;  1XS9 A;  2E2J J;  2GUH A;  2K9Q A;  1U9N A;  5E3L A;  3JRE A;  3BR6 A;  4KWA A;  2R0Q C;  2JA8 J;  1GT0 C;  4MLO A;  1FEX A;  1BA5 A;  2F07 A;  4GCL A;  4CGR A;  3WHC A;  2D5V A;  4MXM A;  5J1U A;  3BRU A;  1U9O A;  3TW7 A;  1JT6 A;  3K7A J;  4IHV A;  3O60 A;  2PMZ N;  1E3O C;  2JMW A;  3QBM A;  4UDS A;  3A03 A;  3ANG A;  1IDY A;  3LJL A;  5EFY A;  5M5X J;  1AKH B;  2LP0 A;  2XB5 A;  3VOX A;  1XC5 A;  2ECC A;  1RR7 A;  1UI5 A;  4W97 A;  2FX0 A;  1GV2 A;  1LFB A;  1QRY A;  2LKX A;  3CJD A;  2XPW A;  3MVP A;  4NDL A;  3D1N I;  1MNM C;  1HLV A;  2EZL A;  2RAE A;  4C3H J;  2V57 A;  4M3F A;  2L7F P;  3LHQ A;  2DMN A;  2HKU A;  2EZI A;  1UMQ A;  4A3F J;  3VUQ A;  1VFC A;  1ETV A;  3QPS A;  3TW6 A;  2E2H J;  3HOX J;  1HCR A;  2D6Y A;  1MBH A;  4V2F A;  2NVY J;  2GEN A;  4ACI A;  3Q3S A;  2YU9 J;  3S2D J;  2W53 A;  2AO9 A;  5M3F J;  4A3M J;  2Y9Z A;  2O8K A;  1I6H J;  3HIM A;  1RET A;  3VP5 A;  2JWT A;  3JRG A;  3A01 A;  1F43 A;  4MO7 A;  1QPI A;  4A93 J;  4MFE A;  2JN6 A;  1IJW C;  1SFO J;  1AU7 A;  4HKU A;  4ME9 A;  4M6V A;  3JRI A;  2R92 J;  4CYC A;  1AHD P;  1BW6 A;  1QVT A;  4QTR A;  4A3J J;  2UXH A;  2XSD C;  3HB9 A;  2FQ4 A;  2CUF A;  3RQI A;  3AQT A;  3HBL A;  4Y52 J;  5IP9 J;  3UKG A;  3KKD A;  1GUU A;  3IH4 A;  4B4C A;  2ECB A;  2O7T A;  2L9R A;  4YZE A;  3HOY J;  2DMP A;  3NXC A;  4I6Z A;  3PM1 A;  3IH2 A;  4M3D A;  3A01 B;  3JRH A;  3IUV A;  1W0U A;  5C4X J;  4D5F A;  3I4M J;  3IH3 A;  1X58 A;  2UXP A;  2TRT A;  2QOP A;  4CYC B;  3ZQF A;  4A3G J;  2XPV A;  2ZOZ A;  3CWR A;  5FHP A;  3CDL A;  3COL A;  3VVZ A;  3HGG A;  3S5R A;  2REK A;  4LOC A;  3M3Y J;  3G1M A;  2DTZ A;  3RKQ A;  5IYB J;  5C3E J;  3SJM A;  3GTK J;  1VF9 A;  3HOU J;  2YUS A;  3C2B A;  3BR2 A;  5DS9 A;  1NTC A;  1OFC X;  3JSJ A;  2DA5 A;  2NVT J;  3HOW J;  4C3I J;  2JA7 J;  2MW8 A;  1TWF J;  3HEF A;  5EYR A;  2Y0S N;  2QIB A;  4IEJ A;  2R93 J;  3BTC A;  3JRD A;  3BNI A;  3OSF A;  1NK3 P;  3FKI J;  2K9N A;  2K9S A;  2CRG A;  2G7L A;  2FJ1 A;  3H3V K;  3OOU A;  2OI8 A;  3HTH A;  3BR3 A;  3ON2 A;  4AUX A;  3BR0 A;  5FJ8 J;  2DG7 A;  2EH3 A;  2HI3 A;  2LR8 A;  3HM5 A;  3V6G A;  4JNN A;  4L5E A;  2NS7 A;  1ZQ3 P;  3NPI A;  4NN1 A;  5HAW A;  4XRS G;  2EQR A;  4QIW N;  3KKC A;  1U78 A;  1IG7 A;  3M4O J;  3LSP A;  4JX4 A;  3HTA A;  5FKK A;  4JYK A;  3ANP A;  1TWG J;  2NP5 A;  1WI3 A;  4AF5 A;  5E3O A;  4DYR A;  2PBX A;  3ZQI A;  5FLM J;  4DZP A;  2CQQ A;  3G1O A;  1ZKG A;  4M3B A;  2QTQ A;  4JP0 A;  4B3A A;  2IU5 A;  4DYC A;  2M9H A;  1BW5 A;  3LSJ A;  3Q0U A;  4A3B J;  2M8G X;  2IBD A;  5F08 A;  4D7N A;  2KT0 A;  3BG9 A;  1HOM A;  1IV6 A;  1D5Y A;  4BBS J;  5F0F A;  1OCT C;  3BQZ A;  1GV5 A;  3SFI A;  1RKT A;  3JRF A;  5EGO A;  5K7Z A;  4DYQ A;  3LSR A;  1PUF A;  3F1B A;  4GCK A;  1DU0 A;  3BR5 A;  1MBE A;  1B8I A;  1WH5 A;  5J3L A;  1QVU A;  4D7M A;  4GFL A;  2HXI A;  3GZI A;  2Y30 A;  3HDD A;  2L0K A;  2CU7 A;  3NAU A;  3RD3 A;  5F0H A;  3QKX A;  1JKO C;  4I76 A;  1P7J A;  1MBK A;  3L1P A;  1H8A C;  2QF7 A;  5D18 A;  5FMP A;  2JJ7 A;  1HDP A;  2H1K A;  2I10 A;  5HOD A;  5C4Y A;  2LVS A;  5EZH A;  2LTP A;  5EGO B;  1WH7 A;  3VW1 A;  1PUF B;  4AYB N;  1B8I B;  3S14 J;  3NRG A;  4L62 A;  3A02 A;  3DCF A;  3HOZ J;  2XPU A;  2G3B A;  1MBG A;  1VI0 A;  2M0C A;  1BL0 A;  2XDN A;  2DMQ A;  2Y2Z A;  2XB0 X;  1EF4 A;  3S1M J;  1JTY A;  4DW6 A;  1UHS A;  3K2A A;  1X2N A;  4FE4 A;  5J1Y A;  4GCT A;  2DG8 A;  4JX6 A;  3BTI A;  2LK2 A;  3C07 A;  5IOZ A;  4AC0 A;  5IOY A;  1ZGW A;  2ZCX A;  2R5Z A;  4J19 A;  3B6C A;  2ID3 A;  4JX5 A;  1JUS A;  2ME6 A;  3FK6 A;  1NK2 P;  3FK7 A;  2HOT A;  2G0E A;  3B6A A;  5F0C A;  1FTZ A;  3H0G J;  4RBO A;  2DA6 A;  2GM4 A;  1RES A;  1I3Q J;  5DAJ A;  1T56 A;  2QCO A;  4NEL A;  2LD5 A;  5M5W J;  2XGD A;  5FGL A;  2EZK A;  2DMU A;  4Y7N J;  3GTO J;  2OPT A;  5M3M J;  4EEF G;  1IC8 A;  4X1E A;  2CJJ A;  3O8H A;  3SDG A;  4FCY A;  2DJN A;  5IP6 A;  1K61 A;  2ID6 A;  2NP3 A;  1APL C;  2R5Z B;  3BT9 A;  3S15 J;  3B81 A;  3G1L A;  2NX4 A;  2RAS A;  3QPL A;  2M2E A;  3GEU A;  1JUM A;  3VW2 A;  3HKZ N;  3CQZ J;  1TC3 C;  3RZO J;  1IUF A;  3CCY A;  1RKW A;  1CQT A;  4QSH A;  3E7L A;  1TWC J;  4B1R A;  3BG5 A;  3G56 A;  4JKZ A;  4HNV A;  4MK6 A;  2GBY A;  2WGB A;  2XGC A;  2GLO A;  3LOC A;  1JT0 A;  2O9L A;  2NVQ J;  4W1U A;  3TP0 A;  4XRM A;  1XG1 A;  2VKV A;  2O7O A;  3MN2 A;  3QQA A;  2JK3 A;  1P7I A;  3KNW A;  3VIB A;  4A3D J;  2XGE A;  4A3I J;  2G7S A;  2CQX A;  1ETQ A;  1TWH J;  2IAI A;  5K7F A;  2NOG A;  3S1R J;  1ZR4 A;  3IV5 A;  3VVX A;  2X9D A;  5EG0 A;  5FKN A;  1W0T A;  4A3K J;  5FKM A;  3ZQL A;  4BY1 J;  2LLK A;  4ABZ A;  1OCP A;  2E2I J;  2JA6 J;  2WV1 A;  2AHQ A;  3AQS A;  5FKO A;  2HXO A;  2MSY A;  3VPR A;  1FIP A;  4AC6 A;  1UI6 A;  5AQC A;  2YS9 A;  3BG3 A;  2Q24 A;  5GP9 A;  1I50 J;  5FLV A;  4IHX A;  1ETW A;  3OIO A;  3W6V A;  4BXX J;  2VUM J;  1WPK A;  1H89 C;  3PPB A;  2ZOY A;  5C4J J;  3PO2 J;  3DPJ A;  3BQY A;  5EG0 B;  3EUP A;  5IPA A;  3S17 J;  3OSG A;  3T6N A;  2G7G A;  3JR9 A;  3HOV J;  2HDD A;  3PAS A;  2WB1 N;  4DZJ A;  1FJL A;  4MIM A;  1Q1V A;  1U8B A;  1OJL A;  3ZQC A;  2XRL A;  3S16 J;  1WCM J;  3GTL J;  1LE8 A;  1IGN A;  3RH2 A;  3S2H J;  3JRB A;  2DA7 A;  2KDZ A;  5CXI A;  2VKE A;  3BTL A;  5JLX A;  2HYT A;  1O4X A;  4RDU A;  1FIA A;  2R5Y A;  5K58 A;  2ME0 A;  2DA3 A;  2DN0 A;  2R7Z J;  2RHA A;  4A3C J;  4GFK A;  2JA5 J;  1DU6 A;  1VND A;  4IHW A;  3PO3 J;  3NI7 A;  4X6A J;  3F0C A;  2EZH A;  3BR1 A;  4M3E A;  2EBI A;  3FIW A;  2VI6 A;  5M5Y J;  3KZ9 A;  3Q0W A;  1JJ8 C;  4XK4 A;  3DEW A;  1Y1V J;  2LFB A;  1LE8 B;  1RPW A;  5CXG A;  2K40 A;  3S1N J;  2NS8 A;  3GTP J;  2HOA A;  2LY9 A;  5FKL A;  4FE7 A;  1LFU P;  4BY7 J;  1HDD C;  2YVH A;  5D1R A;  2R5Y B;  2H8R A;  5F27 A;  1X2M A;  1MSE C;  2B63 J;  4FTH A;  3LWJ A;  4V2G A;  1BJZ A;  5DTD A;  3I4N J;  3VW0 A;  3JRC A;  1UG2 A;  1JKP C;  5H9T A;  5BNG A;  1MBF A;  5K7H A;  3ZQG A;  1ETY A;  1SAN A;  1WGX A;  1ENH A;  2L7M P;  2ZB9 A;  5F1J A;  4PXI A;  1ZK8 A;  1HF0 A;  4D5C A;  4A3L J;  4BBR J;  1ORK A;  2MGQ A;  5E3M A;  4C3J J;  3GTM J;  2E19 A;  2IEK A;  5F04 A;  2DA2 A;  3BHQ A;  2Y31 A;  3O8G A;  3NNR A;  1K83 J;  3GTG J;  1JGG A;  1POG A;  2P81 A;  4IHY A;  3GTQ J;  5IP7 J;  1TWA J;  3GBG A;  4UUS A;  2NVX J;  4FIS A;  3JRA A;  2UXU A;  4GFB A;  4JL3 A;  1R9T J;  3HTI A;  3NAR A;  4A3E J;  2X48 A;  2YVE A;  1FTT A;  4XIC A;  1T33 A;  5EZG A;  1A5J A;  1A6I A;  3ON4 A;  2UXO A;  2UXI A;  2HOS A;  4UUT A;  2ZCM A;  3ZQH A;  1MBJ A;  1B72 A;  3BCG A;  1GDT A;  5D19 A;  1MH4 A;  5J1R A;  2VPR A;  1ETX A;  5C44 J;  4UUS B;  2FBQ A;  3FRQ A;  3G7R A;  5HBU A;  1G2H A;  3VVY A;  3TED A;  1F36 A;  9ANT A;  4A69 C;  4C2M J;  3VOK A;  3P9T A;  5GPC A;  3WHB A;  1Z77 A;  2MG4 A;  3FIS A;  2WUI A;  5CW8 A;  1ETK A;  2GFN A;  2ELK A;  1IRZ A;  2DA1 A;  2OF7 A;  1JTX A;  2Y9Y A;  3HE0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...