5K7FA

Crystal structure of apo aibr
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
184
structure length
179
Chain Sequence
b'RYRAILETAARLICDRGYEGTSMQEIAAACRMTKAGLYHHIQNKEQLLFAIMNYGMDLFEEQVLSRVQDIANPVERLRACMRHNILLVTRGWSKEVIIILHEGETRAFIDARKKKYVDFLEEAFSQASQQGLIRPVDPTVGAFSFLGMVLWIYKWFKPDGRLTDEQIADGMVGMLFPPF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, TetR family
publication title The AibR-isovaleryl coenzyme A regulator and its DNA binding site - a model for the regulation of alternative de novo isovaleryl coenzyme A biosynthesis in Myxococcus xanthus.
pubmed doi rcsb
source organism Myxococcus xanthus (strain dk 1622)
molecule tags Transcription
total genus 69
structure length 179
sequence length 184
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17932 TetR_C_24 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 5k7fA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 5k7fA02
1JKOC 3HKZN 1IRZA 9ANTA 1FTTA 4BXXJ 1CQTA 5HAWA 4XRSG 5EGOA 1GV5A 2ZOYA 1H88C 1OJLA 3BR1A 4FCYA 2ME6A 2G7LA 1U9OA 2HKUA 2IAIA 3HTHA 1ETXA 1GT0C 1ETQA 2EH3A 1HDDC 3HB9A 1Q1VA 4I76A 3B6CA 3BHQA 3IUVA 4JNNA 4V2GA 1WCMJ 1G2HA 4KWAA 3FRQA 5EDNA 1IDYA 4UDSA 4A3JJ 1OCPA 2E19A 4A3CJ 1DU6A 5FMPA 4A69C 3G1OA 2XDNA 4L62A 2XPWA 4FE7A 1WH7A 1JKPC 2K9NA 3M3YJ 2ECCA 4DYQA 2JJ7A 4A93J 2L0KA 2CUEA 4CYCA 3BTLA 1ETKA 3C07A 3IV5A 4YZEA 5EFYA 3UKGA 2G0EA 2K40A 4HNVA 3BRUA 2HQ5A 4JX5A 3GTGJ 3NI7A 3VVZA 5K7FA 2JA5J 1IGNA 1W0UA 1JTYA 2NVTJ 3Q0VA 3JRBA 1F36A 4GFBA 2QWTA 1JJ8C 3G1LA 4ME9A 5C4JJ 2FD5A 3NNRA 1HF0A 2CQXA 2CQQA 2XGCA 2LY9A 3DCFA 4D7NA 1XS9A 3ZOBA 5C44J 2ECBA 2QTQA 1D5YA 2LLKA 1GUUA 2DA7A 2GUHA 4MK6A 3HOVJ 3F1BA 3G56A 1RR7A 1Y1WJ 3PASA 5EG0A 2X6OA 3KNWA 4M3BA 3PPBA 1PUFB 1IDZA 1QRYA 3LSPA 3S14J 2HYJA 3O8HA 5C4YA 4IEJA 2QKOA 1F43A 2HI3A 5DTDA 1IG7A 3IH3A 2DA6A 3BTJA 2ZCMA 2FBQA 2CUFA 3LJLA 5AQCA 2E2IJ 3S1NJ 4A3LJ 2MSYA 5F0HA 2OF7A 5FGLA 1GVDA 4A3MJ 3LSGA 5CW8A 4BBSJ 3JRDA 2MGQA 5M3FJ 3O8GA 2ID6A 5IP6A 2RAEA 1B72A 2O7OA 4JYKA 2O7TA 2PMZN 3BTCA 3QQAA 3HTAA 4X1EA 2DMTA 2EQRA 2FJ1A 2M0CA 5FLMJ 2I10A 1MBHA 2R5ZB 3ANGA 1WI3A 1ENHA 1B8IA 5C3EJ 2WAQN 3BCGA 4BY1J 2DTZA 1QVUA 2IU5A 3V6GA 3WHCA 2E2JJ 1OFCX 2JK3A 2XB0X 3VIBA 3Q3SA 3HTJA 1AKHB 2GM4A 2L7MP 4Y7NJ 1QPIA 5FJ8J 1ETYA 3NXCA 3CJDA 1RKTA 3JR9A 2OI8A 5JLWA 3OOUA 3VVYA 3KZ9A 2R92J 4AC0A 4A3IJ 2DA3A 5K7HA 1FIAA 1T56A 2VPRA 1NK2P 1YRNB 2YUSA 3BR6A 2NS7A 5EF6A 2VKEA 1VI0A 3BQYA 1BW6A 2ELKA 4NDLA 2YVEA 2G7GA 2NVYJ 1MBJA 3VPRA 3D1NI 1ZKGA 3ZQFA 2PBXA 2Y2ZA 5F04A 5JLXA 3JRAA 3CRJA 1IUFA 2CJJA 3NPIA 4UUSA 5IOYA 2NP5A 3AQSA 1TWHJ 1ETOA 2REKA 2K9QA 3LSRA 2DG8A 3GZIA 2Y31A 3BJBA 4J19A 1GV2A 2HYTA 3BG9A 5H9TA 2UXUA 3FKIJ 3HGGA 4QIWN 3SJMA 3RD3A 5K7ZA 3RQIA 5J1YA 2LR8A 4MFEA 4B1RA 1LE8B 3PM1A 4ABZA 1MSFC 1ITYA 4LOCA 5IP7J 4NELA 5IP9J 1GDTA 3G1MA 1SFOJ 4PXIA 2DA1A 2N8GA 1VNDA 4C3IJ 1E3OC 1Z77A 1JKRC 1A5JA 5EZGA 2KT0A 4GFLA 1UG2A 5HBUA 1APLC 1JTXA 4AUXA 1LFBA 1AHDP 3BR0A 2DMPA 4DYCA 3LNQA 4L5EA 2EBIA 4AF5A 3BR5A 5DAJA 1JUPA 2QF7A 4JX4A 1JJ6C 3HOZJ 2O8KA 2TCTA 5IYDJ 1EF4A 2XB5A 2ZB9A 3F0CA 3HOYJ 3MKLA 1WH5A 5DS9A 3JRFA 2ID3A 5F27A 3ZQLA 1BJZA 1I50J 2X48A 2XGEA 4IHWA 1FEXA 4GCTA 1VFCA 3MN2A 4M3FA 1TWFJ 4IHYA 1UHSA 3O60A 5D18A 5FKMA 4RDUA 2P81A 2Y0SN 4JL3A 4DZPA 3GTMJ 2HOSA 3A01B 1MH3A 4IHVA 1U78A 3HM5A 3JREA 5IYBJ 3TP3A 5E3NA 3HE0A 3IH2A 3QPLA 1Z0XA 1RESA 2LFBA 2YU9J 5J1RA 3HGYA 1W0TA 2NX4A 1ETWA 5E3LA 3B6AA 4BBRJ 4D5FA 3ANPA 3DPJA 5CXIA 3BR3A 1WPKA 3I4NJ 2MW8A 1U8BA 1NK3P 2M2EA 2R0QC 1FIPA 3S17J 3A03A 4Y52J 2ZOZA 1Y1VJ 3BNIA 3LWJA 1SANA 3VP5A 1RPWA 2DMNA 2XRLA 1ZQ3P 2W48A 2R5YB 2F07A 3SFIA 4BKXA 2HXIA 5D19A 4XRMA 5F0CA 3OSFA 2Y9ZA 2UXOA 3Q0UA 4M3DA 4QSHA 4B3AA 2EZIA 1O4XA 5M3MJ 1DU0A 3IH4A 5E3MA 3HEFA 2RASA 3VUQA 5EEAA 1IC8A 1A6IA 5EGOB 4A3DJ 1UMQA 1MSEC 1JKQC 5HSZA 3B81A 2DA4A 2WGBA 2XPUA 2QIBA 3K2AA 4W97A 3GBGA 3ZQIA 2L7FP 3E7QA 1XG1A 2HXOA 2XGDA 1MBGA 2YS9A 4ACIA 1ZGWA 2UXPA 5M5WJ 4A3KJ 1POGA 1H8AC 3G7RA 3VVXA 3S5RA 2G7SA 3SDGA 5F0FA 4HKUA 1X2MA 5J1UA 4FTHA 3P9TA 3VW1A 4XICA 2VUMJ 2DG7A 3GTLJ 3VW0A 2DN0A 1UI6A 3NARA 4C3HJ 3OIOA 3QPSA 4MIMA 3EGQA 3BG3A 3FISA 3T6NA 2EZLA 1BW5A 3NAUA 4M3GA 1ZR2A 2LTPA 4X6AJ 3ON2A 1ETVA 4MLOA 1IV6A 1FJLA 2DJNA 2IBDA 2X9DA 3HIMA 4JKZA 4M3EA 3WHBA 1NTCA 3JSJA 4GCLA 1U9NA 3JRCA 5EYRA 2WV1A 5F1JA 2CRGA 4CYCB 5E3OA 5FKOA 1HCRA 2O9LA 2G3BA 1PUFA 2DMUA 2VKVA 3MVPA 3M4OJ 2R93J 2M9HA 1HDPA 4D7MA 4V2FA 3BT9A 1UI5A 4QTRA 3C2BA 1MBEA 3LOCA 3PO3J 3QBMA 4NN1A 1TWGJ 3COLA 2KDZA 1FTZA 2D6YA 2OERA 2Y9YA 1MBFA 5GPCA 1H89C 1T33A 3S2DJ 3ON4A 2QOPA 2ZCXA 3BTIA 2DMQA 2AO9A 3ZQHA 5F08A 5HODA 1RKWA 5M5YJ 2JA7J 4A3EJ 4S0HB 1QVTA 2GBYA 3VW2A 3GTJJ 2IEKA 3CWRA 3BR2A 2R5ZA 2QCOA 3FK7A 5IOZA 4C2MJ 3L1PA 3S1RJ 3RH2A 3BG5A 3VOXA 3CMYA 3JRIA 3RZOJ 2EZKA 4UUTA 2M34A 1OCTC 1I6HJ 3W6VA 1ZTRA 2Q24A 4DZJA 1AKHA 3H0GJ 5EG0B 4BY7J 1JUMA 2DA2A 5FHPA 2DA5A 3S1QJ 2MG4A 3NRGA 2E1OA 3I4MJ 2RHAA 3HBLA 1YRNA 3HOUJ 1X58A 1JUSA 3MNLA 2NOGA 4RBOA 3JRGA 1P7JA 5EZHA 1MH4A 3Q0WA 2TRTA 2JA8J 2LP0A 3QKXA 1K61A 5FLVA 3H3VK 1VF9A 1RETA 2OPTA 4B4CA 3K7AJ 1B72B 4D5CA 1P7IA 3GEUA 2LK2A 4ICHA 2NVQJ 1S7EA 1JT6A 1IJWC 4DYRA 4XIDA 1BA5A 1B8IB 2L9RA 2H8RA 3GTOJ 3HOWJ 3HTIA 3TW7A 2NVXJ 1TC3C 3S2HJ 2GFNA 3GTKJ 4GCKA 3TEDA 1ZK8A 3HOXJ 2PZ9A 1BL0A 3CCYA 2L7ZA 4AYBN 1LE8A 3S16J 3FIWA 2JN6A 2GENA 4I6ZA 1LFUP 2ME0A 1JT0A 2YVHA 5D1RA 1ZR4A 2HOTA 2XSDC 3JRHA 3OSGA 2E2HJ 4M6VA 4MXMA 3CQZJ 1MNMC 1MBKA 4IHXA 3TP0A 1WGXA 2M8GX 1TWAJ 3GTPJ 1XC5A 3RKQA 4EEFG 3AQTA 3KKDA 2NS8A 2B63J 1X2NA 1ORKA 4G12A 3GTQJ 3CDLA 3E7LA 4W1UA 2LKXA 3LSJA 4XK4A 2JWTA 4FE4A 4UUSB 5IYCJ 2FX0A 3KKCA 1HOMA 2VI6A 5GP9A 1I3QJ 2R7ZJ 2V57A 2NP3A 2W53A 3ZQGA 2ZCNA 3DEWA 3LHQA 3BQZA 2HOAA 1R9TJ 2LD5A 5GPAA 3VOKA 5M5XJ 3A01A 4CGRA 2GLOA 1TWCJ 4A3FJ 2UXHA 4A3BJ 1SGMA 1K83J 3FK6A 5FKLA 3V78A 3A02A 4DW6A 3PO2J 2EZHA 3S1MJ 2Y30A 4JX6A 2K9SA 1JGGA 3EUPA 4AC6A 4C3JJ 2JMWA 1AU7A 4A3GJ 4JP0A 4FISA 2H1KA 2XPVA 3TW6A 4MFDA 2D5VA 3ZQCA 2COBA 5FKKA 2CU7A 5J3LA 5BNGA 5IPAA 2WB1N 2R5YA 3RZDJ 3S15J 2LVSA 5CXGA 1HLVA 4GFKA 4XRSA 5C4XJ 2HDDA 2JA6J 2AHQA 2UXIA 2WUIA 5K58A 2FQ4A 3HDDA 5FKNA 4MO7A
chains in the Genus database with same CATH superfamily
5CPRB 1SFKA 2DK5A 1YW7A 4LG3A 1K78A 4BXXJ 1U3EM 1Z9CA 5EGOA 1YW8A 2UXNA 2X1CA 2IJLA 3DLLF 2G7LA 2DFIA 4EGYA 2VN2A 3T5XA 1P2FA 2L5QA 4I76A 1S72I 3K4LA 3BHQA 2LRDA 1FYMA 2EPFA 3RTRA 2A2FX 5LEJA 2COMA 2VJ4A 4UDSA 1OCPA 3VTIA 3IAM2 3C7JA 3OR1C 1DU6A 3A0HC 1PJRA 4EJVA 5LHGA 1RRJA 2ESNA 2WBMA 2V79A 3I5UA 4L9TA 2K9NA 1ZYRF 4KIFA 2LREA 4ZZLA 4HRIA 2HQAA 2JJ7A 4A93J 4ENMA 1SD7A 3VYUB 2MBFA 5HNHA 1ODDA 2GA2A 2R7OA 3MKZA 1FYLA 3IRQA 3BTLA 4P1WA 3C07A 2EA4A 4YZEA 5HS8A 2G0EA 2K40A 3WTYC 2DT5A 3CCEI 2R7FA 3EUKL 3NI7A 3VDXA 3GTGJ 1G3SA 1E17A 1J75A 5K7FA 1IGNA 2QSHX 2Z2SB 1X1AA 2K85A 2EV5A 3FZVA 2IW5A 1X1BA 4P55A 4E70A 1VQKI 3G1LA 2W24A 2FD5A 5KVRA 2E7XA 4RA2A 2DU9A 2WAQA 1B4AA 3PJRA 1YFHA 3BJOA 2MD0A 2VBZA 2XGCA 5KAIC 3ZOBA 5C44J 3FM3A 1K4TA 4DBQA 3BZKA 2L9VA 4F55A 1GUUA 2C6YA 1S6LA 1MDMB 3E1SA 3G56A 1BI2A 3SFZA 5EG0A 1NG6A 1DP7P 5CKTA 4LLGF 3S14J 2HYJA 3QU6A 1EKEA 2WADA 2UUZA 3IH3A 3EUHA 1MNDA 2ZCMA 1QZYA 3Q5FA 3CF5F 2LSOA 3KLNA 3RYRA 2L3DA 3S1NJ 4A3LJ 4ON0A 5F6FA 2AQEA 4U0YA 3BPXA 1WJDA 1OISA 2KIFA 2WC2A 2ID6A 3O8GA 5IP6A 2OQGA 4JYKA 4M71A 2O7TA 3IRRA 4XLPF 3QQAA 2XAUA 3HTAA 4X1EA 2RN7A 2M0CA 2R5ZB 2I10A 1FSEA 3PNTA 4WX9A 2KL4A 1YITI 3ABUA 5IT9Z 2DTZA 2ZXHA 2I5UA 4WXHA 4I02A 2CWEA 4GCVA 4FX4A 2JK3A 1SVOA 4HX7A 2EV6A 1DGRM 2OAZA 1AKHB 1VQ4I 5FJ8J 1ETYA 4ZJZA 2XV4S 3ELKA 2NYXA 4U88A 3CJDA 2RQQA 1R36A 3HSFA 3GFIA 1FSHA 2F5VA 3DQVC 2VPRA 4HSRA 3I54A 2J5PA 1VI0A 2OTLI 2BY1A 2KIMA 2YVEA 2O6GE 4EV0A 2VC0A 1TQMA 2G7GA 1NH3A 4OAZA 1R23A 1X1CA 5F04A 3FKJA 5LRRA 1LDJA 3F6OA 1D0XA 3CRJA 3ERED 4XSXF 4GDFA 2FBHA 5FD5A 2F5EA 3ABTA 4Q47A 4RGRA 2QBYB 2NP5A 2PQ8A 4KT5C 1ETOA 5DCMB 2REKA 4E7SA 4BXUA 2GA1A 3K70D 3UR3C 2Y31A 4J19A 3AL0C 5H9TA 1VQMI 3HGGA 4XLEA 5J4VA 3V7CA 5BOXA 3LFUA 3RQIA 2RNGA 4E4HA 3G73A 2LR8A 4BEHB 4MFEA 3L2RA 1ITYA 3GX4X 1OR7A 2QQBA 1GDTA 2L54A 4C30A 3H9GA 5D5UB 5DM7F 5L3DA 4PXIA 3L9FA 5D6EA 2IT0A 1YIOA 1GLNA 4UUVA 1UG2A 5HBUA 4ENNA 3FXQA 4LGWA 3N4MA 1AHDP 2YVXA 2F6CA 5CVIA 3SEZA 3BR0A 3TMOA 3P9CA 3BR5A 2QF7A 2VC1A 1S7OA 4MGRA 2JPCA 4GYGA 5E79C 2F2EA 2IA2A 2XAJA 4EM2A 1N77A 3JRFA 1KYZA 3L09A 3ZQLA 1I50J 2XGEA 5ILSA 4OIPF 4KIGA 3CCQI 3H1CA 1TWFJ 1UHSA 2DI3A 4XL9A 4NUBA 3WTZA 3MWMA 1BOBA 3J81Z 2ZSHB 4DZPA 3ML6A 4P9UA 1Z67A 5HLGA 3SXYA 2PJRB 4IHVA 4MNUA 2VXZA 3HM5A 5DM6F 4I99C 4CSWA 2O3FA 4A6EA 3BZCA 5LGNA 3HE0A 2FMLA 2HDWA 2QBYA 2CYYA 3IH2A 1EJ9A 2YU9J 4N4NB 2NX4A 2CO5A 2W1OA 2XAQA 4BBRJ 3O2PE 4D5FA 3OYBA 1MW7A 4S04A 3FWEA 2P6TA 4HV5A 2DT6A 3FHZA 2JSPA 1G8XA 1SANA 4IRIA 1Z05A 2L9SA 1ZQ3P 2CV0A 2HZTA 2W48A 4WK8F 3QAHA 1EH7A 3BOQA 5F0CA 1MMAA 5GADJ 1XSVA 4QSHA 2HKOA 4B3AA 5D4SA 4ESJA 4UV8A 2KLOA 3HSRA 1DU0A 2RASA 2JSCA 1XGOA 1SD5A 2CGPA 5EEAA 1G6NA 1K79A 1A6IA 4A3DJ 5LRSA 4IX7A 5JVGF 2WGBA 2VBWA 3M8EA 2XPUA 2GXAA 2XGXA 3K2AA 4W97A 5DD4A 3REOA 3ZQIA 2CFOA 2YS9A 1R4NB 2DODA 1ZGWA 4U9LA 1AWCA 1ZG3A 1H8AC 1ZAOA 2IGMA 3S2WA 5EJCA 2DYRH 1RI7A 2Y75A 4UB8C 3GZ5A 2L4AA 1H9GA 4XICA 3J80K 3DWLE 2DG7A 4EJWA 4XNFA 3G2BA 1UI6A 2EV0A 5FB2A 1DDNA 3EGQA 3BG3A 4F91B 2IS4A 4BNCA 5A2QZ 2Z5UA 1BW5A 4M3GA 1RUOA 2RREA 2LTPA 3E0JB 1ETVA 2Y48A 1IV6A 1FJLA 2DJNA 4XONA 3KIOA 3HIMA 4JKZA 1NTCA 3VFZA 2DPUA 4GCLA 5EYRA 2WV1A 2QVOA 4PK4A 1FOXA 5ICFA 1UJ8A 2E5NA 2O9LA 2QUFA 1QHGA 1T95A 1PUFA 2VKVA 2OU2A 3DKXA 1S3JA 2VIXA 2FMYA 4V2FA 3BT9A 5KAFC 3ZP5A 1HSJA 4IRHA 3ZMSA 3C2BA 4CCKA 3QBMA 3RKXA 4UV9A 1P4WA 4A0ZA 4BS9A 1TWGJ 4IPAA 3F8FA 3COLA 2KDZA 2WAFA 3CJQB 3KE2A 1H89C 2IGKA 3WTUC 5DCFA 2QOPA 2ZCXA 4XN3A 2AO9A 1WJBA 3ZQHA 4D1QA 2JA7J 5M5YJ 1OCZH 1Z7LA 2FEZA 3L2QA 3PIOF 3P9IA 3VW2A 3BR2A 1HKQA 4XQFA 1JI8A 1Z3XA 4IO9F 1HBXG 4BUPA 3K70C 4I98B 3JRIA 1OYWA 2F5FA 4UUTA 2M34A 1IRXA 1X19A 1XX5A 2F4MB 2HTSA 1ZTRA 1IRFA 3IL2A 4CCLA 2RNJA 3WG9A 4BJTA 4CCNA 4FT8A 3I4MJ 2CUZA 1VQ9I 1ZRCA 2P5LC 2VODA 4KN7X 3R0JA 4RBOA 2BHZA 2ZMEA 5EZHA 3WGIA 1MH4A 4Y33A 5FFXA 2NNNA 4HX4A 2LF7A 4U87A 4HOBA 4B44A 1K61A 5FLVA 1VQOI 4R79A 4KICA 4UNOA 3OMYA 3SDBA 1MJ9A 2OPTA 3OYCA 2FJI1 2A6HF 2LYCA 3CJTB 3ISPA 2HQNA 5K1YA 3JTGA 1E2XA 4FASD 2NVQJ 2IA1A 3HUGB 3KP4A 5E17F 3B02A 2VQHA 4U0WA 1LDKB 1B8IB 2PI0A 1BA5A 3HOWJ 3KFWX 2NVXJ 2GFNA 3DEUA 3F8MA 2YPRA 3SQNA 4BHCA 1BL0A 3QYFA 4YIFA 4M73A 2JPBA 5HLTA 1X3WB 2CQNA 3E97A 3PL8A 2ME0A 4ZTFA 2HOTA 3PSFA 1I1GA 2XSDC 3H5NA 3HPGA 3OSGA 4MXMA 3CQZJ 5JI6A 1HW5A 3LSKA 3TP0A 4HF2A 2R7SA 2QA4I 1TWAJ 3GTPJ 1WJCA 3HC7A 3RKQA 3AQTA 1T98A 3KKDA 2XASA 4BQQA 3G4SI 5BPIA 4G12A 4M9ZA 1R7JA 4BE2A 3ASOH 4RAFA 4Q48A 1SD4A 2LKXA 5CQGA 3F8CA 2BY3A 3LA2A 4NBQA 5FRMA 4UUSB 3VOEA 1K4SA 4OD5A 1HOMA 3I9V2 3EUAA 4U7BA 3CZ6A 1XGNA 3ONQA 2NP3A 5TRDA 2H09A 2V57A 5D5VB 4Y3OA 4KFCA 4CZZA 4FX0A 3LHQA 3T8RA 4JOMA 4I0BA 2XAGA 3KYLA 1R9TJ 1MMNA 3VOKA 4NC6A 2GLOA 4M74A 2NOJB 3KEOA 2JRTA 3OYEA 2G7HA 4A3FJ 4A3BJ 4XSZF 4X0GA 1J9IA 3FK6A 5FKLA 5J8FA 2LY2A 3V78A 4Y13A 1W1WE 1XMKA 5DV5A 4A12A 2PN6A 3HTUA 2Q2EA 1B6AA 3OL4A 4E7IA 1SC7A 2VJJA 4JP0A 3LSIA 2A6TA 4XORA 2LY1A 3KEYA 4AIHA 2B9SA 3ZQCA 3FMRA 2COBA 3N05A 1V3FA 2CU7A 5J3LA 3W3CA 2X1EA 4U7DA 1SFEA 4IKFA 3ABMH 1FOYA 4GGGA 1X3UA 3BLYA 2LVSA 3CESA 4E7KA 1RR8C 2RKHA 1W36C 3S3OA 2ZNZA 1OLTA 3L2CA 3OYLA 1L3LA 1X1DA 1V4RA 4MO7A 2XHKA 5HAWA 2DT7B 3MCZA 3SZGA 4XRSG 1R5GA 1TNSA 4XOPA 4CHUA 4EQQA 1H88C 1TNTA 3BR1A 2ZOYA 2ME6A 3ZN1A 4YFNF 2HKUA 4MTDA 1GT0C 1HSTA 2GIZA 1ETQA 3L2WA 3HB9A 3GMEA 3OYIA 3CCLI 3B6CA 2PLYA 2HR3A 2ADUA 3IUVA 3KP6A 4V2GA 5LGUA 4U9NA 1S8NA 3V8JA 1G2HA 2W7NA 4KWAA 2H6BA 4ZDOA 1IDYA 4EM1A 2FNPA 5DUIA 4A3JJ 1ON2A 1Z91A 2X85A 4CYDA 2IA0A 3G1OA 3FBIB 5HS9A 1YJWI 3ZMDA 2E1NA 3ECOA 1XTAA 4L62A 4RAGA 4L0ZB 2XPWA 1JKPC 4WCGA 3WTWC 3M3YJ 3T1BA 5AIQA 3RI4A 3K8PC 3NQOA 2LKPA 4GO1A 4B48A 2GOMA 4CYCA 4HLXA 1VQ7I 2DAOA 2PFBA 3IV5A 4KYWA 5EFYA 3IC7A 3PQKA 5H2FC 2O8XA 1P4AA 2VL8A 3LSHA 4H4KC 2H6CA 1JTYA 4YIRX 3QP5A 1TLHB 2PMZA 3JRBA 4NQWB 4BQNA 4BQOA 2ETHA 3OS0A 3JSPA 1M1EB 3OR2C 3DPTA 2P7CB 2KZGA 4IQ4A 1I39A 2H8WA 3QYEA 4D7NA 5B66C 1R71A 4AVPA 3K0LA 1OMIA 2A5WA 5J4YA 4RAZA 2MH2A 5CVUA 3ZMUA 2VPLA 3PQJA 2KQRA 2BHYA 2DDBA 2QENA 1D5YA 2KRCA 1UB9A 4QPOA 1Z6RA 2GUHA 1D1BA 3H9QA 4O5VA 4RGUA 5JHUA 2L2OA 1WJAA 1VQ8I 1Y1WJ 2M1BA 3DFGA 3H3ZA 1IDZA 4IOCF 1YQAA 1IO2A 5C4YA 4IEJA 1PYVA 2CV2A 3CC7I 4AIKA 2P0WA 2HWVA 2A07F 5AQCA 1BR1A 1E3PA 1R49A 2MSYA 2H27A 4IQJA 5F0HA 3VYSB 4BE1A 1YW9A 2OF7A 1GVDA 4N9HA 2VB6A 3LSGA 4QWQA 4A5NA 4XLNF 2DQLA 2O7OA 1LJ9A 5L3BA 3K1PA 2FJ1A 4BQAA 4L0YB 4AM3A 3ANGA 3TKYA 2ICWG 3I4PA 1F5TA 1Z1DA 5C3EJ 4NQWA 3MKYB 2PX9A 5EEGA 2WAQN 1QVUA 3V6GA 3A1YA 4K2EA 3H35A 4KA4A 2RV8A 3C1DA 3Q3SA 2GM4A 1ZGAA 4Y7NJ 1QPIA 2B3WA 4BYYA 3HTJA 3CLOA 3OOUA 3KZ9A 2LH9A 1D0ZA 4A3IJ 1QBJA 1EH6A 3DU6A 1FIAA 1T56A 1NK2P 1KU2A 3WG7H 2EFQA 3GLXA 4A0XA 2WY7Q 3DXJF 1WJEA 2VQLA 2ELKA 3DU5A 1FNNA 1TBXA 3K4NA 2RDPA 4KN4X 2E1CA 1IN6A 2VE8A 3D1NI 2IS6A 2PBXA 3ZQFA 2R7VA 5JLXA 5DUKA 2NRAC 2NVUB 4IRGA 2ZC2A 3KP5A 3GFLA 2EINH 5ICEA 2CJJA 4F92B 3CCSI 1R1VA 2P7VB 5IOYA 1D5VA 3AQSA 1VQNI 1TWHJ 2NXNB 4HDUA 2FNAA 3KPHA 5GAGJ 2DG8A 3EQLF 3GZIA 1PVEA 2KRHA 3BJBA 2E1MB 1GV2A 4MEXF 4RB3C 2W25A 3QWLA 4IHSA 4QIWN 3RD3A 1XCBA 3ASNH 5K7ZA 2IGOA 5J1YA 2HTJA 4DOZA 1LE8B 4O6JA 4YFKF 1KU7A 1EA3A 2VQCA 5IP7J 2IS2A 4NELA 3VB2A 2NAZA 2MABA 3HXLA 3C18A 4MEYF 3G1MA 1DPUA 5H20A 2DA1A 2N8GA 3IP4B 1DGWY 4C3IJ 2F5CA 4RB1A 1E3OC 1JKRC 1A5JA 5EZGA 5DDGA 4GFLA 4CXFA 3DBLB 1HKTA 2KIUA 1APLC 1MMGA 1KA8A 4AUXA 1J2XA 2PEXA 3U9GA 1F1ZA 1STZA 2M0MA 2DMPA 3ESWB 4HW0A 2D1VA 3LNQA 4AF5A 3W2WA 3I58A 4JX4A 3FMQA 3KCCA 4DGWB 3M9AA 1J59A 1CF7B 2MH9A 5IYDJ 1IUYA 1YI2I 1B9NA 1PDNC 3KP2A 3M1EA 2K9MA 5IT3A 1QZZA 2QKMB 1BJZA 1W5CC 1B1BA 1VFCA 1SVLA 1H0MA 3K2ZA 4RDUA 4ZYGA 2FQ3A 1UHMA 3E6CC 5JHFA 1HXDA 3GTMJ 2X6YA 1MH3A 2YSRA 2BXZA 1U78A 1DQUA 3OYFA 3OV8A 5IYBJ 3F9KA 2DLLA 3JTHA 3QOPA 2CSOA 1BJAA 5LEKA 3QPLA 1Z0XA 5L3CA 1YLFA 3B6AA 1IN4A 3DP7A 1G4DA 5CXIA 2VXDA 3F3XA 1LUJB 2EB7A 2MW8A 1U8BA 5D5XB 2M2EA 3GO5A 2R0QC 3M07A 3A03A 1ZGJA 2VKDA 1Y1VJ 1ZHFA 3Q9VA 3S17J 1T08B 3WGGA 3VP5A 2F07A 2R5YB 3F6VA 4BKXA 3OYNA 5FLXK 2X51A 4XRMA 3D5RC 2Y9ZA 2YU3A 3Q0UA 2V6EA 2BBYA 4TV7A 3JW4A 3CMEI 1JGSA 2V9VA 4CDGA 5E3MA 3G6EI 1BOAA 4J00A 2VJ5A 2AXTC 3AG1H 1ZRDA 2HQRA 2QLZA 1MSEC 3ZN0A 2Z99A 3C2GA 4CA0A 4XN0A 4OMZA 2L7FP 2R7DA 3KETA 5HS7A 2V1NA 2UXPA 1QHHD 3G7RA 2VONA 3LFKA 4FTHA 5KNLA 3ABKH 1T0FA 5L3FA 3OYKA 1AA7A 1YJ9I 3M1CA 2LC2A 1RNLA 3NWSA 2VKHA 3BPVA 3NARA 3ZXSA 4C3HJ 3OIOA 3QPSA 1ZG5A 1YTYA 3CCJI 3DBHB 2RGVA 4PZJA 2WAEA 1U5TB 1K6OA 2L9NA 4LLLA 3ON2A 1OKRA 4Q4ZF 4M3EA 1MDMA 3CCVI 3HZJA 1U8RA 1ERDA 3F72A 4CCJA 3NWTA 5E3OA 1YO5C 1FPQA 1LEAA 1KYWA 5FKOA 2DYSH 3MVPA 3OY9A 3M4OJ 2M9HA 2BGCA 4D7MA 2PMHA 2IRFG 4QTRA 3KEQA 4CICA 4PJNA 2J5OA 4AVZA 2XIGA 4WF2A 2ZNYA 1FTZA 1G3WA 1BR2A 4BJ6C 4R8HA 2LG4A 3ON4A 3BTIA 2DMQA 3AAFA 1VQLI 2WWYA 4A3EJ 4OWRB 4ZYAA 1FYKA 2XKPA 2B0LA 1XB4A 4DVYP 3GTJJ 3RH2A 2MFZA 3FK7A 2R5ZA 1QU3A 3VOXA 3E5XA 3J80Z 3RZOJ 1PUEE 1GVJA 3D5SC 4YRVA 1OCTC 3RPQA 3U2RA 3KLOA 4ZH4F 2Q24A 3BROA 4UVAA 1AKHA 2DPDA 1IXSB 3RKWA 3HOSA 1JUMA 2DA2A 3KX2A 5CQEA 1UFMA 4M72A 3CUQB 4KUMA 3CF2A 2E1OA 3WU0A 2LNBA 4HNTA 4P96A 3MQ0A 3ROUA 3E5QA 5HLHA 1A35A 4XRFA 3BP8A 1PP8F 3FDYA 2K5CA 3QKXA 3H3VK 2HPIA 3ZQQA 1W5SA 1VF9A 1NHAA 4G8XA 3ECHA 4B4CA 1B72B 1AOYA 2CMPA 2UXXA 3RCOA 1P7IA 2FA5A 5LHIA 1S7EA 3GCMA 5DCMA 1JT6A 3NS4A 2GQQA 2A5YB 2QM3A 1SD6A 3RJPA 4XIDA 1VQPI 2L9RA 2E1MC 3TO7A 3ZPLA 1YS7A 3GTKJ 2G7UA 4GCKA 1T8IA 3TEDA 3HOXJ 1TL8A 1W7PB 5F1RA 3S3MA 1MNEA 2PZ9A 2VBYA 2CUJA 1OYIA 3OYMA 4BEHA 4OAYA 3S16J 3FIWA 2JN6A 2V26A 1LFUP 1JT0A 3GZNB 1ZR4A 2E2HJ 3PNVA 2P8TA 4F3QA 6PAXA 1MNMC 1MBKA 2OZ6A 3AKZA 2FF4A 1WGXA 3CMMA 3VODA 4ETSA 3F8BA 1TT0A 1TW3A 2DCEA 2Z33A 1MIJA 1O3TA 3J7ZI 1X2NA 3OWTA 1T2KA 3FBNB 1A36A 2DFFA 2GXGA 1FBQA 4XK4A 2AS5F 2JWTA 2P5KA 4FE4A 3S8PA 1LPQA 4PJ0C 2FX0A 5K5QA 5CVJA 2K3PA 2R7ZJ 2W53A 3DTEA 3L2VA 4LG0B 1YOVB 4UXNA 5E1WA 3QP6A 1W7PD 4ENJA 3PFYA 1V54H 2OD5A 3DF8A 2LD5A 1T0FC 5GPAA 3X2QH 4H0EA 2PJRA 4CGRA 3M8FA 1IN8A 1TWCJ 1K83J 1Q1HA 3G71I 2Y0MA 4NNJA 3F22A 2TDXA 3S1MJ 3PO2J 4JX6A 4AC6A 4C3JJ 4A3GJ 1AU7A 2Z9OA 1BI1A 3S3NA 4FISA 2H1KA 2XPVA 2ZSIB 4FETA 5BNGA 3DTIA 1BIAA 2ELJA 3DKWA 4JBAA 2CW7A 3IKVA 3OS1A 4HQMA 2XRNA 1Y6IA 1ZELA 2R7QA 3FM5A 4ESFA 1T38A 2P4WA 4XRSA 4FHTA 5HDKA 4ZDPA 2UXIA 2FQ4A 4A3CJ 3HKZN 1FTTA 9ANTA 1ULYA 2ISZA 1R5ID 1GV5A 1IXRC 3K1NA 1IF1A 1OJLA 4FCYA 1S5LC 3WTVC 1U9OA 1UHWA 2JT1A 1KQ8A 3HTHA 1ETXA 1WHUA 4GXOA 4XKVA 1FP2A 3TOAA 1YYVA 1Q1VA 1R6RA 3CC2I 1G3YA 2XAHA 4JNNA 2HEOA 2D1HA 1V55H 2K3FA 5EDNA 1Y0NA 3ZQ7A 4RM2A 2JTVA 4AWXB 5TGTA 2R7WA 3HRUA 1Y0UA 3I64A 5FMPA 1XPXA 3BCBA 2XF6A 3LL7A 2OC6A 3I59B 2W84A 3FF5A 2EWNA 3BY6A 1U5TC 1WH7A 2VOPA 4DJAA 3SWHA 4DYQA 4S05A 2LBFB 4AU7A 5JVTA 2L0KA 2CUEA 1FZPB 3AFHA 3N97A 1SMYF 2UV1A 1ETKA 2DW4A 2E7WA 4ITVA 3UNGC 3UKGA 1RC9A 3AG4H 3TQNA 3BRUA 3U1KA 3QYBA 4HQEA 2WA0A 3BC8A 3A0BC 1R00A 4WIBA 2JA5J 3PSIA 2ZFWA 1QQIA 2NVTJ 1F36A 2QWTA 2LDUA 3LSTA 4KISA 1JJ8C 2OBPA 5B3SH 3V8LA 3NNRA 1YHQI 1V5EA 1FC3A 3DCFA 2LY9A 4LD5A 4HG2A 2BW3B 2M4GA 4LIVA 3MZYA 2LLKA 2LF8A 2F5DA 1LVKA 5HNFA 1EH8A 3HOVJ 4PJJA 3F1BA 3PASA 2IPQX 3HKZA 4WXCA 3KNWA 4M3BA 1UZCA 3CUQC 3M7GA 1IN7A 4EM0B 3LSPA 4LK0F 2V6CA 5K5RA 2EIJH 2PG4A 2QKOA 4EGZA 1Y56A 5AONA 2HI3A 5DTDA 1P9QC 1IG7A 5FRNA 2DA6A 4Y52J 2A61A 3LJLA 2E2IJ 1FY7A 2XF5A 3EETA 1R22A 3RIRA 5FGLA 1TZLA 1R58A 5CW8A 2KZVA 2MGQA 2PMZN 3GVAA 2R4GA 2EQRA 1S9HA 1X4PA 2IP2A 2XVCA 3HUGA 4HLYA 3NRVA 1ENHA 4L5JA 3F21A 2X6WA 1B8IA 1IW7F 4RGXA 3E6DA 3D5LA 2IU5A 1USSA 3WHCA 2BV6A 2BZTA 1OFCX 3ERMA 3TBIA 3VIBA 3KZZA 5JR3A 1G59A 3NXCA 3I0TA 3JR9A 5JLWA 1MMSA 2K27A 2OA4A 4KMFA 2QGUA 3H36A 4I09A 4BHPA 4RB2C 1YRNB 2W82A 3OIPA 1ZREA 2HFHA 3ZMVA 4J01A 3PFIA 3BR6A 4B3XA 2VKEA 1UELB 3MAJA 5EF6A 4C2UA 1BW6A 4NDLA 2IS1A 3RDIA 1HC8A 2ZJPF 2NVYJ 1MBJA 1YJNI 1ZKGA 3I3LA 2Y2ZA 3DLAA 3V4GA 1IV8A 5B1BH 1SFUA 3WE3A 1P4XA 3LQRA 2Y0SA 1WZ2A 3V7SA 2JVHA 2KJBA 4UUSA 4UB6C 2R7RA 1R1TA 2FXAA 2K9QA 1RUNA 4XKBA 4UVBA 3BG9A 1FX7A 3KYDB 3CCRI 1BC7C 2V1UA 2UXUA 3FKIJ 3RPUD 3LQQA 4DBRA 4OINF 1XSDA 4U0VA 2ESHA 2MD5A 3FHNA 3PM1A 5CYVA 2QWWA 1REPC 2M8EA 1SFXA 4EJTA 4PSWA 2KPMA 4EATA 3WTXC 1SFOJ 3CJNA 1IXCA 5KK1A 3RSNA 1VNDA 4LK1F 3QPTA 1Z77A 5AIPA 2KT0A 1QPMA 2QSFX 2X0LA 3I55I 2E60A 1JTXA 4G7OF 2ZJ2A 1LFBA 5H6RA 4DYCA 1VTNC 2QSGX 4XLHA 2LMDA 1JUPA 4M9XA 2O8KA 2M3AA 5K5OA 3AG2H 4PJMA 2XB5A 3W6JB 3F0CA 2ID3A 3QU3A 5F27A 4BGDA 4IHWA 3CUOA 5J6XA 2W85A 5D6FA 2Q8KA 4G7HF 3ULQB 1RZ4A 3WODF 5D18A 4KITB 2P81A 1G3TA 4G9YA 3P7NA 2CFXA 2VE9A 3JCUC 4JL3A 1QNTA 2HOSA 3A01B 2BY2A 3HRTA 2Z3YA 3K4BA 3CC4I 2Q1ZB 3JREA 1X1PA 3EYYA 2MLGA 3TP3A 1N78A 4DIQA 2LFBA 1RESA 1I1SA 4I01A 5HOOA 2QQ9A 3SZTA 3ANPA 4KDPA 3I4NJ 1QGPA 1LFPA 1NK3P 3LWJA 3CLQA 2BYVE 2A3SA 2MYSA 4LJZF 2UZKA 2IXSA 2DMNA 4RAYA 3SFIA 4CO8A 1BBYA 5D19A 1XGSA 3HOTA 4E7ZA 3BWGA 2UXOA 4M3DA 1LDDA 2F4OB 2VT2A 1FMVA 1R4MB 5CJ9A 1XSXA 2FBKA 2YX7A 1O4XA 3IH4A 3QOEA 1K78B 1IC8A 4GYIA 4N9IA 2M7BA 5EGOB 1UMQA 4HF1A 2DA4A 2EJRA 4RS8A 2OZUA 3E7QA 1XG1A 2HXOA 2XGDA 1MBGA 2HNHA 2LOOA 4KT6A 3RQ4A 4A3KJ 1POGA 2HZDA 4B47A 3S5RA 3HHGA 2G7SA 3I53A 5E8IA 5F0FA 2GIVA 5DEQA 3WE2A 1O57A 5J1UA 3P9TA 3GWZA 2Z16A 1WFXA 3JSOA 2VUMJ 4MQVA 3VW0A 2X6XA 2V9PA 4MIMA 4LB6B 3FISA 4YIIA 2MLKA 3GYHX 5D5WB 3NAUA 2E35A 3SYTA 4X6AJ 4EJUA 1QO0D 2OQRA 4MLOA 2X4HA 2X9DA 4M6XA 4A2UA 4G6TB 3WHBA 4G6QA 1SMTA 2AXLA 2K02A 3JSJA 5FLXZ 3OYDA 4OIRF 1U9NA 2ZJQF 3FXMA 5F1JA 2CRGA 2GOXB 3V42A 2G3BA 4FQGA 1WQ2A 4CZCA 1X3ZB 2HGCA 2JVGA 2XF7A 1HQCA 3LMMA 2RQPA 2CG4A 2OCCH 1XMAA 4YFXF 4Q5SF 1UI5A 2XUBA 1GHCA 1SAUA 4F7ZA 5LHHA 2OERA 4LMYA 2E71A 2Y9YA 3BJ6A 4LLNA 2P6SA 1T33A 2EK5A 4HV6A 3CCUI 5ERIA 3IKTA 3CP2A 3J7AY 3CP8A 5F08A 1RKWA 4II3A 2OJED 2GWRA 3FXJA 2A68F 2GBYA 3FX3A 1B9MA 2WY8Q 4OOIA 2QCOA 4AYBA 4C2MJ 3L1PA 3DBRB 4G94A 4BU2A 5GAHJ 4RLFA 3W6VA 4CCOA 4DZJA 3F23A 1FMWA 1K6YA 4NB5A 3JAMZ 5EG0B 1TQPA 4CGZA 5FHPA 1ZG1A 2Z1DA 3S1QJ 4PUSA 1MMDA 3NRGA 1O3QA 4F93B 4XLCA 2RHAA 4JK1X 2VOOA 2A69F 2E5ZA 1X58A 4ZC3A 4A5MA 4CCMA 4MHGA 2NOGA 1MGTA 1P7JA 3W2VA 2K4BA 2WV0A 3Q0WA 2TRTA 3FXKA 2LP0A 5ILUA 2JA8J 2CH0A 1BC8C 3MEXA 2HYGD 5ILVA 2GXBA 3KYCB 2ZXIA 4GRIA 1RETA 5CLSA 3ABLH 2DOFA 1YX5A 4G7ZF 3H3UA 1VQ5I 1WKMA 3DEEA 2FBIA 2LK2A 3GW2A 3GEUA 1KU9A 5J40A 2M30A 2Q0OA 5D4RA 3OOPA 4HEA2 2W4SA 4DYRA 2IVMA 2G9WA 3HSEA 3GTOJ 2H8RA 3VUQA 3R61A 1XCVA 1ZK8A 2QQAA 2ISYA 3HRMA 4M9SA 3CCYA 4BL0B 1PP7U 2HKXA 1LE8A 2DBBA 4I6ZA 2YVHA 4XR6A 2ZXJA 2E36A 2OCEA 3SZPA 3P9KA 4D9JA 5BQTA 1N75A 4M6VA 2ZFUA 2WB1A 3QODA 4UHTA 3H5RA 1U6GA 4RGSA 3HRSA 4RLQA 1TTYA 4YELA 5D8LB 2I8DA 4Z6YA 2BY0A 5TJJA 1XC5A 3HJEA 3K10A 3MKWB 3E6MA 3IWFA 3ZRGA 2NS8A 2B63J 5FD6A 1ORKA 3GTQJ 3CDLA 3D0SA 4W1UA 1XGMA 4ESBA 3K4JA 1CF7A 3HG9A 2EFOA 1MD0A 3ZMZA 3KKCA 1VZ0A 2FUG2 1YG2A 4EJOA 4DQ2A 4BDZA 2VI6A 5GP9A 1I3QJ 5CVVA 3ZQGA 1KZHA 2VT3A 4BJ5C 3DEWA 2BE5F 3GXOA 2MC4A 1JHHA 2STWA 3J7AO 1ZLJA 5BS6A 4ZZDA 2EFWA 3BJAA 1SGMA 1D1CA 2DQRA 3A02A 4RMNA 2V7FA 3TL4X 3JAMK 2K4JA 4C9YA 4LFUA 4DW6A 4BDYA 3C2HA 1ON1A 1JGGA 3EUPA 2VASA 2JMWA 2X1DA 4ZYDA 5KCMA 2V1XA 4HZFA 2NNYA 2DJIA 2ZBKA 3CD6I 1FWZA 4QPQA 1U0JA 1LB2A 3WGHA 2R5YA 2DO7A 3RZDJ 3S15J 1JHFA 2QQ8A 5E1ZB 4BAYA 5CXGA 1HLVA 3ZCOA 4OIOF 4GFKA 2JA6J 4Y4RA 5K58A 3HDDA 2GZWA 3RYPA 1FBSA 1JKOC 3TO9A 2OV7A 1IRZA 2HYFA 3KZIC 3EDPA 3T0YA 1CQTA 4XKWA 5HDGA 4XLAA 1T6SA 5GAEJ 5F64A 4HYEA 2RC4A 3WU2C 1SEUA 2IAIA 3GF2A 4HSTA 5E1XA 2EH3A 1HDDC 3K69A 3P5JA 2M4KA 1KONA 2H94A 5JFRA 3KP3A 5L3GA 5HVQC 5FGMA 2V9KA 4YEJA 1FLIA 1WCMJ 1ZH5A 4E6KG 2CW0F 3MD2A 3FXLA 3O6BB 2CV1A 3FRQA 2E34A 4C2TA 3KZYA 2E19A 2FE3A 2R7UA 4WWCA 2XC7A 4A69C 3J7YJ 3CJRB 3A2KA 4MQ9F 1UAAA 2B1EA 2HOEA 2XDNA 5L3EA 3EYIA 5TISC 3AG3H 1KGSA 4FE7A 4II2A 4LITA 1U5TA 3R0AA 1IRGA 4HDVA 4R1HA 2ECCA 3VEPA 3G3ZA 3H9JA 4XKCA 2HVQA 1GXQA 3OL3A 4BACA 3TO6A 1C0WA 2LKSA 4HNVA 2HQ5A 4JX5A 5EEHA 1OPCA 1Z6TA 2EFNA 3VVZA 3HIFA 3GFJA 1W0UA 1K7AA 3Q0VA 5HLIA 2OUMA 2JRMA 2WTEA 4GFBA 2DFEA 1O3RA 2DXIA 4ME9A 5C4JJ 3DPUA 1HF0A 2CQXA 2QYOA 5IT9K 1S29A 2CW8A 2CQQA 4BXFA 1JE8A 2BVLA 2BXYA 1ZN2A 1XS9A 2ECBA 2QTQA 3W2AA 1LNWA 1Z3YA 1BI0A 1OCRH 4JQFA 4A0YA 3WTTC 2AQFA 2DA7A 4MK6A 3MMYB 3H92A 4ENKA 1RR7A 4CH7A 4Y15A 2X6OA 2BEOA 1CGPA 3CUQA 1PUFB 1DUXC 1ZRFA 3PPBA 1QRYA 3S32A 1O3SA 3OIQA 3O8HA 1FP1D 4P9FA 2KIQA 1XDUA 2KMUA 1F43A 5CVRA 3EUHC 3BTJA 1SVMA 2FBQA 2CUFA 3ZGKA 4E7HA 4E7JA 3TDUC 1I5ZA 2P5VA 3RKYA 3SHFA 1F4KA 1V5GA 1EV7A 3OYJA 4A3MJ 3R60A 4D0PA 4E7LA 4BBSJ 3JRDA 3H5AA 5M3FJ 1B72A 1WJFA 1WJ5A 2CQKA 2RAEA 1O7FA 3CDHA 2ZXWH 3OYAA 3L7WA 3GZ6A 3BTCA 1XDSA 2QKLB 2DMTA 5FLMJ 1MBHA 1FBUA 1WI3A 2O03A 2A05A 3BCGA 4BY1J 5LFAA 1ZARA 2EFPA 1R5HA 3VWBA 2E2JJ 1W7PA 3ZMTA 1FOKA 4BH9A 1Y39A 2XB0X 5GTIC 2BVMA 2L7MP 3KP7A 4N0BA 4XM3A 1LQ1A 4XOTA 2HVSA 1RKTA 2OI8A 3VVYA 1Y8RB 2R92J 4AC0A 2PBIA 2DA3A 3EPZA 5K7HA 2JZYA 1VQ6I 2YUSA 3BDDA 1W36D 2NS7A 3FMSA 3BQYA 2ZMEB 3LA3A 2K9LA 4IL6C 2L02A 3CMAI 3LWFA 2DTRA 4EVIA 3HTSB 3VPRA 2QEXI 4M6YA 2MC3A 3JRAA 1IUFA 2FOWA 2HU9A 1OYYA 4WXDA 4ANJA 1TP4A 3NPIA 1FT9A 3J81K 1BR4A 2GAUA 2DK8A 4HBLA 2XAFA 1UG0A 3LSRA 4IZZA 2KDOA 3LA7A 4LG0A 4IOAF 5DD8A 3BCAA 4ZTJA 3PUBA 2HYTA 2KP6A 3DTKA 3DV8A 3R6SA 3SJMA 2PMUA 4ZYHA 1WSUA 2KHMA 3QPHA 3FXRA 4B1RA 4ABZA 1MSFC 4LOCA 1OR7C 1ONVA 4HF0A 4AIDA 3CO6C 5IP9J 3L00A 1LKXA 3ZR8X 1E3HA 2PJPA 3OYGA 3E5UA 4ZYEA 1W4MA 4C2MA 1A6QA 4BE0A 1A04A 2HVRA 5ICGA 4L18B 4IRVA 5DYMA 1JXSA 4L5IA 4L5EA 2EBIA 5DAJA 1QA6A 1JJ6C 3HOZJ 1OCOH 2TCTA 4PJLA 1EF4A 2ZB9A 2EA2A 3OS2A 3HOYJ 3MKLA 1WH5A 5DS9A 2CS3A 4IXAA 4P5OA 2B7EA 2X48A 3S93A 1FEXA 4GCTA 3MN2A 4M3FA 4IHYA 2YR2A 4RM3A 1E0EA 1A31A 3O60A 5FKMA 1GXPA 2D2WA 2Y0SN 1D8JA 2XKOA 3GEZA 3FXOA 4KNYA 4RB0A 1L0OC 1B59A 5E3NA 1WI9A 1OCCH 5J8CA 2STTA 4YG2F 5J1RA 1I27A 3HGYA 1W0TA 1QZEA 1ETWA 5E3LA 5E18F 2Q2EB 3DPJA 3BR3A 1YIJI 1WPKA 1O7LA 2VJIA 1BM9A 5KHDA 3C3WA 5A2QK 3LAJA 3W6KB 1FIPA 2ZOZA 1HKSA 4OMYA 3BNIA 1LVAA 3BG7A 3A4CA 1RPWA 3TDZC 4L9VA 5FFZA 2XRLA 2ZO4A 3I59A 3U1DA 2HXIA 1LEBA 2XDVA 3OSFA 4NC7A 5D8KB 3DKYA 3DPLC 3SEQA 4Y17A 3CTAA 2EZIA 5ICCA 5M3MJ 1ACIA 2DFHA 2LBFA 3HEFA 4B43A 2M5WA 3F8NA 1IZ1A 2FU4A 2L01A 5J47A 2V1DA 1MJAA 1KQ9A 2CQ7A 1P6RA 3GLLA 3L2UA 1JKQC 5HSZA 3B81A 2QIBA 4HNUA 1DPRA 2W00A 2JA2A 2KISA 2O0YA 1J0RA 3GBGA 3T8TA 4ACIA 1KU3A 1NG7A 5GTHC 4I7HA 3GFMA 5M5WJ 1D3YA 3VVXA 3PUFA 2O5RA 3SDGA 1YS6A 4HKUA 3K6GA 1X2MA 5FROA 2IGNA 4IHTA 3VW1A 2M87A 1D1AA 1TW2A 5IY5H 3IHUA 2DOAA 3GTLJ 2DN0A 4O3MA 3M8JA 2BW3A 3COAC 4N4OB 3T6NA 2EZLA 2PFVA 1TQIA 1ZR2A 1YE9A 3I71A 1BN5A 1W5TA 1Z21A 2IBDA 3WU1B 5E20A 4G6DA 3V7RA 3JRCA 3LSMA 3CO7C 4LB5A 3VYRB 4CYCB 1HCRA 2Y69H 2DMUA 4DNCA 1T39A 1FOWA 3LAPA 2R93J 1HDPA 1MBEA 4I0AA 3LOCA 4F52A 3PO3J 2FRHA 4NN1A 5LLQA 3K4CA 4OD4A 4B09A 2KKOA 1J5YA 1WRJA 3HL2A 1BIBA 3K4MA 2D6YA 1MBFA 1TT5B 2M7AA 2L4MA 3R4KA 5GPCA 3S2DJ 5BMZA 4UY8I 5HODA 4IJAA 2EIKH 4ASNA 3VSKA 4S0HB 4Z2YA 1QVTA 4BHBA 1HW1A 3CWRA 2IEKA 5IOZA 2KFDA 4LIUA 3S1RJ 1IN5A 3BG5A 2EILH 2V4JC 3GUDA 3CMYA 3O3KA 2EZKA 3CDIA 3NEUA 3K1MA 1I6HJ 5LGTA 3RPUA 4A6DA 4PSXA 3H0GJ 4BY7J 2DA5A 3Q9SA 2MG4A 1RIOH 1P92A 3MZ8A 4EMSA 1HW2A 2R7XA 2HDCA 1WVRA 1WWXA 3K4KA 3HBLA 1YRNA 3HOUJ 1S7AA 1JUSA 2DOEA 5B1AH 3MNLA 3K9TA 2ACJA 1X4OA 2VQGA 2ZMEC 3PNYA 1R1UA 2DDAA 3JRGA 3CCMI 2ELHA 4UVCA 2NS0A 5FO5A 3HYIA 3OYHA 2KJCA 2ZKZA 4IVNA 3HPHA 3BG6A 2ZJRF 5BPDA 3IWZA 4L9NA 2JUGA 3K7AJ 4B8XA 4HA8A 4D5CA 1BI3A 2MA3A 1D0YA 2BOLA 4ICHA 4PGHA 1HA8A 1IJWC 4PCQA 1DP3A 4NC8A 3E3VA 4PGGA 2R3SA 3U21A 3MFKA 3TW7A 5LD2C 1TC3C 3S2HJ 2UWMA 3HTIA 1MJBA 1U2WA 5E8GA 1V5FA 2YX4A 2XSJC 2R7TA 1MZBA 4PDKA 4HX8A 2HPMA 2JUCA 2FSWA 2L7ZA 4AYBN 1ZLKA 2GENA 2EIMH 2FOKA 5D1RA 4V19K 3BZ6A 3HHHA 3JRHA 4IHXA 2KRFA 2M8GX 1USTA 4AIJA 5HDNA 2VBXA 2W57A 4ZDLA 4EEFG 3VYTB 1XN7A 1XMXA 3B73A 4XMYA 4IF4A 3V8KA 3E7LA 2ZCWA 3E6BA 1YX3A 2K86A 3LSJA 3WTSC 2M45A 4XBFA 2D45A 4HAMA 5IYCJ 4KMUX 1Z7UA 4L9JA 4QLCU 1J09A 4PFOA 4I2OA 1H9TA 3TGNA 2A6EF 2JQ7A 5LBQA 3QRFF 2ZCNA 2QZ8A 3AL0B 3BQZA 3TOBA 2HOAA 4MTEA 1UCRA 5M5XJ 3A01A 3MZHA 2UXHA 1F9NA 4KJZA 2H1LA 1KQ0A 5B5EC 4OU0A 2EZHA 5H6QA 1I3AA 2F4IA 1J7KA 2OTJI 2ZY9A 3PIPF 2Y30A 3H0DA 2K9SA 1I6XA 4HPQA 3I56I 3VSLA 2RVCA 3TW6A 4CUGA 4MFDA 2D5VA 3IUOA 5FKKA 2O61A 1N25A 5IPAA 2WB1N 2L7KA 4KIBA 4NHJA 2XROA 4PFPA 1D8KA 3FXUA 1SAXA 1XD7A 3IAS2 1IAWA 2F48A 2HS5A 4OIQF 4AD9A 1OQYA 1Y8QB 2K7LA 5ED4A 2AHQA 2HDDA 5C4XJ 2WUIA 4XLFA 5FKNA 2VLAA 1MKMA
chains in the Genus database with same CATH topology
1JKOC 3HKZN 1IRZA 9ANTA 1FTTA 4BXXJ 1CQTA 5HAWA 4XRSG 5EGOA 1GV5A 2ZOYA 1H88C 1OJLA 3BR1A 4FCYA 2ME6A 2G7LA 1U9OA 2HKUA 2IAIA 3HTHA 1ETXA 1GT0C 1ETQA 2EH3A 1HDDC 3HB9A 1Q1VA 4I76A 3B6CA 3BHQA 3IUVA 4JNNA 4V2GA 1WCMJ 1G2HA 4KWAA 3FRQA 5EDNA 1IDYA 4UDSA 4A3JJ 1OCPA 2E19A 4A3CJ 1DU6A 5FMPA 4A69C 3G1OA 2XDNA 4L62A 2XPWA 4FE7A 1WH7A 1JKPC 2K9NA 3M3YJ 2ECCA 4DYQA 2JJ7A 4A93J 2L0KA 2CUEA 4CYCA 3BTLA 1ETKA 3C07A 3IV5A 4YZEA 5EFYA 3UKGA 2G0EA 2K40A 4HNVA 3BRUA 2HQ5A 4JX5A 3GTGJ 3NI7A 3VVZA 5K7FA 2JA5J 1IGNA 1W0UA 1JTYA 2NVTJ 3Q0VA 3JRBA 1F36A 4GFBA 2QWTA 1JJ8C 3G1LA 4ME9A 5C4JJ 2FD5A 3NNRA 1HF0A 2CQXA 2CQQA 2XGCA 2LY9A 3DCFA 4D7NA 1XS9A 3ZOBA 5C44J 2ECBA 2QTQA 1D5YA 2LLKA 1GUUA 2DA7A 2GUHA 4MK6A 3HOVJ 3F1BA 3G56A 1RR7A 1Y1WJ 3PASA 5EG0A 2X6OA 3KNWA 4M3BA 3PPBA 1PUFB 1IDZA 1QRYA 3LSPA 3S14J 2HYJA 3O8HA 5C4YA 4IEJA 2QKOA 1F43A 2HI3A 5DTDA 1IG7A 3IH3A 2DA6A 3BTJA 2ZCMA 2FBQA 2CUFA 3LJLA 5AQCA 2E2IJ 3S1NJ 4A3LJ 2MSYA 5F0HA 2OF7A 5FGLA 1GVDA 4A3MJ 3LSGA 5CW8A 4BBSJ 3JRDA 2MGQA 5M3FJ 3O8GA 2ID6A 5IP6A 2RAEA 1B72A 2O7OA 4JYKA 2O7TA 2PMZN 3BTCA 3QQAA 3HTAA 4X1EA 2DMTA 2EQRA 2FJ1A 2M0CA 5FLMJ 2I10A 1MBHA 2R5ZB 3ANGA 1WI3A 1ENHA 1B8IA 5C3EJ 2WAQN 3BCGA 4BY1J 2DTZA 1QVUA 2IU5A 3V6GA 3WHCA 2E2JJ 1OFCX 2JK3A 2XB0X 3VIBA 3Q3SA 3HTJA 1AKHB 2GM4A 2L7MP 4Y7NJ 1QPIA 5FJ8J 1ETYA 3NXCA 3CJDA 1RKTA 3JR9A 2OI8A 5JLWA 3OOUA 3VVYA 3KZ9A 2R92J 4AC0A 4A3IJ 2DA3A 5K7HA 1FIAA 1T56A 2VPRA 1NK2P 1YRNB 2YUSA 3BR6A 2NS7A 5EF6A 2VKEA 1VI0A 3BQYA 1BW6A 2ELKA 4NDLA 2YVEA 2G7GA 2NVYJ 1MBJA 3VPRA 3D1NI 1ZKGA 3ZQFA 2PBXA 2Y2ZA 5F04A 5JLXA 3JRAA 3CRJA 1IUFA 2CJJA 3NPIA 4UUSA 5IOYA 2NP5A 3AQSA 1TWHJ 1ETOA 2REKA 2K9QA 3LSRA 2DG8A 3GZIA 2Y31A 3BJBA 4J19A 1GV2A 2HYTA 3BG9A 5H9TA 2UXUA 3FKIJ 3HGGA 4QIWN 3SJMA 3RD3A 5K7ZA 3RQIA 5J1YA 2LR8A 4MFEA 4B1RA 1LE8B 3PM1A 4ABZA 1MSFC 1ITYA 4LOCA 5IP7J 4NELA 5IP9J 1GDTA 3G1MA 1SFOJ 4PXIA 2DA1A 2N8GA 1VNDA 4C3IJ 1E3OC 1Z77A 1JKRC 1A5JA 5EZGA 2KT0A 4GFLA 1UG2A 5HBUA 1APLC 1JTXA 4AUXA 1LFBA 1AHDP 3BR0A 2DMPA 4DYCA 3LNQA 4L5EA 2EBIA 4AF5A 3BR5A 5DAJA 1JUPA 2QF7A 4JX4A 1JJ6C 3HOZJ 2O8KA 2TCTA 5IYDJ 1EF4A 2XB5A 2ZB9A 3F0CA 3HOYJ 3MKLA 1WH5A 5DS9A 3JRFA 2ID3A 5F27A 3ZQLA 1BJZA 1I50J 2X48A 2XGEA 4IHWA 1FEXA 4GCTA 1VFCA 3MN2A 4M3FA 1TWFJ 4IHYA 1UHSA 3O60A 5D18A 5FKMA 4RDUA 2P81A 2Y0SN 4JL3A 4DZPA 3GTMJ 2HOSA 3A01B 1MH3A 4IHVA 1U78A 3HM5A 3JREA 5IYBJ 3TP3A 5E3NA 3HE0A 3IH2A 3QPLA 1Z0XA 1RESA 2LFBA 2YU9J 5J1RA 3HGYA 1W0TA 2NX4A 1ETWA 5E3LA 3B6AA 4BBRJ 4D5FA 3ANPA 3DPJA 5CXIA 3BR3A 1WPKA 3I4NJ 2MW8A 1U8BA 1NK3P 2M2EA 2R0QC 1FIPA 3S17J 3A03A 4Y52J 2ZOZA 1Y1VJ 3BNIA 3LWJA 1SANA 3VP5A 1RPWA 2DMNA 2XRLA 1ZQ3P 2W48A 2R5YB 2F07A 3SFIA 4BKXA 2HXIA 5D19A 4XRMA 5F0CA 3OSFA 2Y9ZA 2UXOA 3Q0UA 4M3DA 4QSHA 4B3AA 2EZIA 1O4XA 5M3MJ 1DU0A 3IH4A 5E3MA 3HEFA 2RASA 3VUQA 5EEAA 1IC8A 1A6IA 5EGOB 4A3DJ 1UMQA 1MSEC 1JKQC 5HSZA 3B81A 2DA4A 2WGBA 2XPUA 2QIBA 3K2AA 4W97A 3GBGA 3ZQIA 2L7FP 3E7QA 1XG1A 2HXOA 2XGDA 1MBGA 2YS9A 4ACIA 1ZGWA 2UXPA 5M5WJ 4A3KJ 1POGA 1H8AC 3G7RA 3VVXA 3S5RA 2G7SA 3SDGA 5F0FA 4HKUA 1X2MA 5J1UA 4FTHA 3P9TA 3VW1A 4XICA 2VUMJ 2DG7A 3GTLJ 3VW0A 2DN0A 1UI6A 3NARA 4C3HJ 3OIOA 3QPSA 4MIMA 3EGQA 3BG3A 3FISA 3T6NA 2EZLA 1BW5A 3NAUA 4M3GA 1ZR2A 2LTPA 4X6AJ 3ON2A 1ETVA 4MLOA 1IV6A 1FJLA 2DJNA 2IBDA 2X9DA 3HIMA 4JKZA 4M3EA 3WHBA 1NTCA 3JSJA 4GCLA 1U9NA 3JRCA 5EYRA 2WV1A 5F1JA 2CRGA 4CYCB 5E3OA 5FKOA 1HCRA 2O9LA 2G3BA 1PUFA 2DMUA 2VKVA 3MVPA 3M4OJ 2R93J 2M9HA 1HDPA 4D7MA 4V2FA 3BT9A 1UI5A 4QTRA 3C2BA 1MBEA 3LOCA 3PO3J 3QBMA 4NN1A 1TWGJ 3COLA 2KDZA 1FTZA 2D6YA 2OERA 2Y9YA 1MBFA 5GPCA 1H89C 1T33A 3S2DJ 3ON4A 2QOPA 2ZCXA 3BTIA 2DMQA 2AO9A 3ZQHA 5F08A 5HODA 1RKWA 5M5YJ 2JA7J 4A3EJ 4S0HB 1QVTA 2GBYA 3VW2A 3GTJJ 2IEKA 3CWRA 3BR2A 2R5ZA 2QCOA 3FK7A 5IOZA 4C2MJ 3L1PA 3S1RJ 3RH2A 3BG5A 3VOXA 3CMYA 3JRIA 3RZOJ 2EZKA 4UUTA 2M34A 1OCTC 1I6HJ 3W6VA 1ZTRA 2Q24A 4DZJA 1AKHA 3H0GJ 5EG0B 4BY7J 1JUMA 2DA2A 5FHPA 2DA5A 3S1QJ 2MG4A 3NRGA 2E1OA 3I4MJ 2RHAA 3HBLA 1YRNA 3HOUJ 1X58A 1JUSA 3MNLA 2NOGA 4RBOA 3JRGA 1P7JA 5EZHA 1MH4A 3Q0WA 2TRTA 2JA8J 2LP0A 3QKXA 1K61A 5FLVA 3H3VK 1VF9A 1RETA 2OPTA 4B4CA 3K7AJ 1B72B 4D5CA 1P7IA 3GEUA 2LK2A 4ICHA 2NVQJ 1S7EA 1JT6A 1IJWC 4DYRA 4XIDA 1BA5A 1B8IB 2L9RA 2H8RA 3GTOJ 3HOWJ 3HTIA 3TW7A 2NVXJ 1TC3C 3S2HJ 2GFNA 3GTKJ 4GCKA 3TEDA 1ZK8A 3HOXJ 2PZ9A 1BL0A 3CCYA 2L7ZA 4AYBN 1LE8A 3S16J 3FIWA 2JN6A 2GENA 4I6ZA 1LFUP 2ME0A 1JT0A 2YVHA 5D1RA 1ZR4A 2HOTA 2XSDC 3JRHA 3OSGA 2E2HJ 4M6VA 4MXMA 3CQZJ 1MNMC 1MBKA 4IHXA 3TP0A 1WGXA 2M8GX 1TWAJ 3GTPJ 1XC5A 3RKQA 4EEFG 3AQTA 3KKDA 2NS8A 2B63J 1X2NA 1ORKA 4G12A 3GTQJ 3CDLA 3E7LA 4W1UA 2LKXA 3LSJA 4XK4A 2JWTA 4FE4A 4UUSB 5IYCJ 2FX0A 3KKCA 1HOMA 2VI6A 5GP9A 1I3QJ 2R7ZJ 2V57A 2NP3A 2W53A 3ZQGA 2ZCNA 3DEWA 3LHQA 3BQZA 2HOAA 1R9TJ 2LD5A 5GPAA 3VOKA 5M5XJ 3A01A 4CGRA 2GLOA 1TWCJ 4A3FJ 2UXHA 4A3BJ 1SGMA 1K83J 3FK6A 5FKLA 3V78A 3A02A 4DW6A 3PO2J 2EZHA 3S1MJ 2Y30A 4JX6A 2K9SA 1JGGA 3EUPA 4AC6A 4C3JJ 2JMWA 1AU7A 4A3GJ 4JP0A 4FISA 2H1KA 2XPVA 3TW6A 4MFDA 2D5VA 3ZQCA 2COBA 5FKKA 2CU7A 5J3LA 5BNGA 5IPAA 2WB1N 2R5YA 3RZDJ 3S15J 2LVSA 5CXGA 1HLVA 4GFKA 4XRSA 5C4XJ 2HDDA 2JA6J 2AHQA 2UXIA 2WUIA 5K58A 2FQ4A 3HDDA 5FKNA 4MO7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JKO C;  3HKZ N;  1IRZ A;  9ANT A;  1FTT A;  4BXX J;  1CQT A;  5HAW A;  4XRS G;  5EGO A;  1GV5 A;  2ZOY A;  1H88 C;  1OJL A;  3BR1 A;  4FCY A;  2ME6 A;  2G7L A;  1U9O A;  2HKU A;  2IAI A;  3HTH A;  1ETX A;  1GT0 C;  1ETQ A;  2EH3 A;  1HDD C;  3HB9 A;  1Q1V A;  4I76 A;  3B6C A;  3BHQ A;  3IUV A;  4JNN A;  4V2G A;  1WCM J;  1G2H A;  4KWA A;  3FRQ A;  5EDN A;  1IDY A;  4UDS A;  4A3J J;  1OCP A;  2E19 A;  4A3C J;  1DU6 A;  5FMP A;  4A69 C;  3G1O A;  2XDN A;  4L62 A;  2XPW A;  4FE7 A;  1WH7 A;  1JKP C;  2K9N A;  3M3Y J;  2ECC A;  4DYQ A;  2JJ7 A;  4A93 J;  2L0K A;  2CUE A;  4CYC A;  3BTL A;  1ETK A;  3C07 A;  3IV5 A;  4YZE A;  5EFY A;  3UKG A;  2G0E A;  2K40 A;  4HNV A;  3BRU A;  2HQ5 A;  4JX5 A;  3GTG J;  3NI7 A;  3VVZ A;  5K7F A;  2JA5 J;  1IGN A;  1W0U A;  1JTY A;  2NVT J;  3Q0V A;  3JRB A;  1F36 A;  4GFB A;  2QWT A;  1JJ8 C;  3G1L A;  4ME9 A;  5C4J J;  2FD5 A;  3NNR A;  1HF0 A;  2CQX A;  2CQQ A;  2XGC A;  2LY9 A;  3DCF A;  4D7N A;  1XS9 A;  3ZOB A;  5C44 J;  2ECB A;  2QTQ A;  1D5Y A;  2LLK A;  1GUU A;  2DA7 A;  2GUH A;  4MK6 A;  3HOV J;  3F1B A;  3G56 A;  1RR7 A;  1Y1W J;  3PAS A;  5EG0 A;  2X6O A;  3KNW A;  4M3B A;  3PPB A;  1PUF B;  1IDZ A;  1QRY A;  3LSP A;  3S14 J;  2HYJ A;  3O8H A;  5C4Y A;  4IEJ A;  2QKO A;  1F43 A;  2HI3 A;  5DTD A;  1IG7 A;  3IH3 A;  2DA6 A;  3BTJ A;  2ZCM A;  2FBQ A;  2CUF A;  3LJL A;  5AQC A;  2E2I J;  3S1N J;  4A3L J;  2MSY A;  5F0H A;  2OF7 A;  5FGL A;  1GVD A;  4A3M J;  3LSG A;  5CW8 A;  4BBS J;  3JRD A;  2MGQ A;  5M3F J;  3O8G A;  2ID6 A;  5IP6 A;  2RAE A;  1B72 A;  2O7O A;  4JYK A;  2O7T A;  2PMZ N;  3BTC A;  3QQA A;  3HTA A;  4X1E A;  2DMT A;  2EQR A;  2FJ1 A;  2M0C A;  5FLM J;  2I10 A;  1MBH A;  2R5Z B;  3ANG A;  1WI3 A;  1ENH A;  1B8I A;  5C3E J;  2WAQ N;  3BCG A;  4BY1 J;  2DTZ A;  1QVU A;  2IU5 A;  3V6G A;  3WHC A;  2E2J J;  1OFC X;  2JK3 A;  2XB0 X;  3VIB A;  3Q3S A;  3HTJ A;  1AKH B;  2GM4 A;  2L7M P;  4Y7N J;  1QPI A;  5FJ8 J;  1ETY A;  3NXC A;  3CJD A;  1RKT A;  3JR9 A;  2OI8 A;  5JLW A;  3OOU A;  3VVY A;  3KZ9 A;  2R92 J;  4AC0 A;  4A3I J;  2DA3 A;  5K7H A;  1FIA A;  1T56 A;  2VPR A;  1NK2 P;  1YRN B;  2YUS A;  3BR6 A;  2NS7 A;  5EF6 A;  2VKE A;  1VI0 A;  3BQY A;  1BW6 A;  2ELK A;  4NDL A;  2YVE A;  2G7G A;  2NVY J;  1MBJ A;  3VPR A;  3D1N I;  1ZKG A;  3ZQF A;  2PBX A;  2Y2Z A;  5F04 A;  5JLX A;  3JRA A;  3CRJ A;  1IUF A;  2CJJ A;  3NPI A;  4UUS A;  5IOY A;  2NP5 A;  3AQS A;  1TWH J;  1ETO A;  2REK A;  2K9Q A;  3LSR A;  2DG8 A;  3GZI A;  2Y31 A;  3BJB A;  4J19 A;  1GV2 A;  2HYT A;  3BG9 A;  5H9T A;  2UXU A;  3FKI J;  3HGG A;  4QIW N;  3SJM A;  3RD3 A;  5K7Z A;  3RQI A;  5J1Y A;  2LR8 A;  4MFE A;  4B1R A;  1LE8 B;  3PM1 A;  4ABZ A;  1MSF C;  1ITY A;  4LOC A;  5IP7 J;  4NEL A;  5IP9 J;  1GDT A;  3G1M A;  1SFO J;  4PXI A;  2DA1 A;  2N8G A;  1VND A;  4C3I J;  1E3O C;  1Z77 A;  1JKR C;  1A5J A;  5EZG A;  2KT0 A;  4GFL A;  1UG2 A;  5HBU A;  1APL C;  1JTX A;  4AUX A;  1LFB A;  1AHD P;  3BR0 A;  2DMP A;  4DYC A;  3LNQ A;  4L5E A;  2EBI A;  4AF5 A;  3BR5 A;  5DAJ A;  1JUP A;  2QF7 A;  4JX4 A;  1JJ6 C;  3HOZ J;  2O8K A;  2TCT A;  5IYD J;  1EF4 A;  2XB5 A;  2ZB9 A;  3F0C A;  3HOY J;  3MKL A;  1WH5 A;  5DS9 A;  3JRF A;  2ID3 A;  5F27 A;  3ZQL A;  1BJZ A;  1I50 J;  2X48 A;  2XGE A;  4IHW A;  1FEX A;  4GCT A;  1VFC A;  3MN2 A;  4M3F A;  1TWF J;  4IHY A;  1UHS A;  3O60 A;  5D18 A;  5FKM A;  4RDU A;  2P81 A;  2Y0S N;  4JL3 A;  4DZP A;  3GTM J;  2HOS A;  3A01 B;  1MH3 A;  4IHV A;  1U78 A;  3HM5 A;  3JRE A;  5IYB J;  3TP3 A;  5E3N A;  3HE0 A;  3IH2 A;  3QPL A;  1Z0X A;  1RES A;  2LFB A;  2YU9 J;  5J1R A;  3HGY A;  1W0T A;  2NX4 A;  1ETW A;  5E3L A;  3B6A A;  4BBR J;  4D5F A;  3ANP A;  3DPJ A;  5CXI A;  3BR3 A;  1WPK A;  3I4N J;  2MW8 A;  1U8B A;  1NK3 P;  2M2E A;  2R0Q C;  1FIP A;  3S17 J;  3A03 A;  4Y52 J;  2ZOZ A;  1Y1V J;  3BNI A;  3LWJ A;  1SAN A;  3VP5 A;  1RPW A;  2DMN A;  2XRL A;  1ZQ3 P;  2W48 A;  2R5Y B;  2F07 A;  3SFI A;  4BKX A;  2HXI A;  5D19 A;  4XRM A;  5F0C A;  3OSF A;  2Y9Z A;  2UXO A;  3Q0U A;  4M3D A;  4QSH A;  4B3A A;  2EZI A;  1O4X A;  5M3M J;  1DU0 A;  3IH4 A;  5E3M A;  3HEF A;  2RAS A;  3VUQ A;  5EEA A;  1IC8 A;  1A6I A;  5EGO B;  4A3D J;  1UMQ A;  1MSE C;  1JKQ C;  5HSZ A;  3B81 A;  2DA4 A;  2WGB A;  2XPU A;  2QIB A;  3K2A A;  4W97 A;  3GBG A;  3ZQI A;  2L7F P;  3E7Q A;  1XG1 A;  2HXO A;  2XGD A;  1MBG A;  2YS9 A;  4ACI A;  1ZGW A;  2UXP A;  5M5W J;  4A3K J;  1POG A;  1H8A C;  3G7R A;  3VVX A;  3S5R A;  2G7S A;  3SDG A;  5F0F A;  4HKU A;  1X2M A;  5J1U A;  4FTH A;  3P9T A;  3VW1 A;  4XIC A;  2VUM J;  2DG7 A;  3GTL J;  3VW0 A;  2DN0 A;  1UI6 A;  3NAR A;  4C3H J;  3OIO A;  3QPS A;  4MIM A;  3EGQ A;  3BG3 A;  3FIS A;  3T6N A;  2EZL A;  1BW5 A;  3NAU A;  4M3G A;  1ZR2 A;  2LTP A;  4X6A J;  3ON2 A;  1ETV A;  4MLO A;  1IV6 A;  1FJL A;  2DJN A;  2IBD A;  2X9D A;  3HIM A;  4JKZ A;  4M3E A;  3WHB A;  1NTC A;  3JSJ A;  4GCL A;  1U9N A;  3JRC A;  5EYR A;  2WV1 A;  5F1J A;  2CRG A;  4CYC B;  5E3O A;  5FKO A;  1HCR A;  2O9L A;  2G3B A;  1PUF A;  2DMU A;  2VKV A;  3MVP A;  3M4O J;  2R93 J;  2M9H A;  1HDP A;  4D7M A;  4V2F A;  3BT9 A;  1UI5 A;  4QTR A;  3C2B A;  1MBE A;  3LOC A;  3PO3 J;  3QBM A;  4NN1 A;  1TWG J;  3COL A;  2KDZ A;  1FTZ A;  2D6Y A;  2OER A;  2Y9Y A;  1MBF A;  5GPC A;  1H89 C;  1T33 A;  3S2D J;  3ON4 A;  2QOP A;  2ZCX A;  3BTI A;  2DMQ A;  2AO9 A;  3ZQH A;  5F08 A;  5HOD A;  1RKW A;  5M5Y J;  2JA7 J;  4A3E J;  4S0H B;  1QVT A;  2GBY A;  3VW2 A;  3GTJ J;  2IEK A;  3CWR A;  3BR2 A;  2R5Z A;  2QCO A;  3FK7 A;  5IOZ A;  4C2M J;  3L1P A;  3S1R J;  3RH2 A;  3BG5 A;  3VOX A;  3CMY A;  3JRI A;  3RZO J;  2EZK A;  4UUT A;  2M34 A;  1OCT C;  1I6H J;  3W6V A;  1ZTR A;  2Q24 A;  4DZJ A;  1AKH A;  3H0G J;  5EG0 B;  4BY7 J;  1JUM A;  2DA2 A;  5FHP A;  2DA5 A;  3S1Q J;  2MG4 A;  3NRG A;  2E1O A;  3I4M J;  2RHA A;  3HBL A;  1YRN A;  3HOU J;  1X58 A;  1JUS A;  3MNL A;  2NOG A;  4RBO A;  3JRG A;  1P7J A;  5EZH A;  1MH4 A;  3Q0W A;  2TRT A;  2JA8 J;  2LP0 A;  3QKX A;  1K61 A;  5FLV A;  3H3V K;  1VF9 A;  1RET A;  2OPT A;  4B4C A;  3K7A J;  1B72 B;  4D5C A;  1P7I A;  3GEU A;  2LK2 A;  4ICH A;  2NVQ J;  1S7E A;  1JT6 A;  1IJW C;  4DYR A;  4XID A;  1BA5 A;  1B8I B;  2L9R A;  2H8R A;  3GTO J;  3HOW J;  3HTI A;  3TW7 A;  2NVX J;  1TC3 C;  3S2H J;  2GFN A;  3GTK J;  4GCK A;  3TED A;  1ZK8 A;  3HOX J;  2PZ9 A;  1BL0 A;  3CCY A;  2L7Z A;  4AYB N;  1LE8 A;  3S16 J;  3FIW A;  2JN6 A;  2GEN A;  4I6Z A;  1LFU P;  2ME0 A;  1JT0 A;  2YVH A;  5D1R A;  1ZR4 A;  2HOT A;  2XSD C;  3JRH A;  3OSG A;  2E2H J;  4M6V A;  4MXM A;  3CQZ J;  1MNM C;  1MBK A;  4IHX A;  3TP0 A;  1WGX A;  2M8G X;  1TWA J;  3GTP J;  1XC5 A;  3RKQ A;  4EEF G;  3AQT A;  3KKD A;  2NS8 A;  2B63 J;  1X2N A;  1ORK A;  4G12 A;  3GTQ J;  3CDL A;  3E7L A;  4W1U A;  2LKX A;  3LSJ A;  4XK4 A;  2JWT A;  4FE4 A;  4UUS B;  5IYC J;  2FX0 A;  3KKC A;  1HOM A;  2VI6 A;  5GP9 A;  1I3Q J;  2R7Z J;  2V57 A;  2NP3 A;  2W53 A;  3ZQG A;  2ZCN A;  3DEW A;  3LHQ A;  3BQZ A;  2HOA A;  1R9T J;  2LD5 A;  5GPA A;  3VOK A;  5M5X J;  3A01 A;  4CGR A;  2GLO A;  1TWC J;  4A3F J;  2UXH A;  4A3B J;  1SGM A;  1K83 J;  3FK6 A;  5FKL A;  3V78 A;  3A02 A;  4DW6 A;  3PO2 J;  2EZH A;  3S1M J;  2Y30 A;  4JX6 A;  2K9S A;  1JGG A;  3EUP A;  4AC6 A;  4C3J J;  2JMW A;  1AU7 A;  4A3G J;  4JP0 A;  4FIS A;  2H1K A;  2XPV A;  3TW6 A;  4MFD A;  2D5V A;  3ZQC A;  2COB A;  5FKK A;  2CU7 A;  5J3L A;  5BNG A;  5IPA A;  2WB1 N;  2R5Y A;  3RZD J;  3S15 J;  2LVS A;  5CXG A;  1HLV A;  4GFK A;  4XRS A;  5C4X J;  2HDD A;  2JA6 J;  2AHQ A;  2UXI A;  2WUI A;  5K58 A;  2FQ4 A;  3HDD A;  5FKN A;  4MO7 A; 
#chains in the Genus database with same CATH topology
 5CPR B;  1SFK A;  2DK5 A;  1YW7 A;  4LG3 A;  1K78 A;  4BXX J;  1U3E M;  1Z9C A;  5EGO A;  1YW8 A;  2UXN A;  2X1C A;  2IJL A;  3DLL F;  2G7L A;  2DFI A;  4EGY A;  2VN2 A;  3T5X A;  1P2F A;  2L5Q A;  4I76 A;  1S72 I;  3K4L A;  3BHQ A;  2LRD A;  1FYM A;  2EPF A;  3RTR A;  2A2F X;  5LEJ A;  2COM A;  2VJ4 A;  4UDS A;  1OCP A;  3VTI A;  3IAM 2;  3C7J A;  3OR1 C;  1DU6 A;  3A0H C;  1PJR A;  4EJV A;  5LHG A;  1RRJ A;  2ESN A;  2WBM A;  2V79 A;  3I5U A;  4L9T A;  2K9N A;  1ZYR F;  4KIF A;  2LRE A;  4ZZL A;  4HRI A;  2HQA A;  2JJ7 A;  4A93 J;  4ENM A;  1SD7 A;  3VYU B;  2MBF A;  5HNH A;  1ODD A;  2GA2 A;  2R7O A;  3MKZ A;  1FYL A;  3IRQ A;  3BTL A;  4P1W A;  3C07 A;  2EA4 A;  4YZE A;  5HS8 A;  2G0E A;  2K40 A;  3WTY C;  2DT5 A;  3CCE I;  2R7F A;  3EUK L;  3NI7 A;  3VDX A;  3GTG J;  1G3S A;  1E17 A;  1J75 A;  5K7F A;  1IGN A;  2QSH X;  2Z2S B;  1X1A A;  2K85 A;  2EV5 A;  3FZV A;  2IW5 A;  1X1B A;  4P55 A;  4E70 A;  1VQK I;  3G1L A;  2W24 A;  2FD5 A;  5KVR A;  2E7X A;  4RA2 A;  2DU9 A;  2WAQ A;  1B4A A;  3PJR A;  1YFH A;  3BJO A;  2MD0 A;  2VBZ A;  2XGC A;  5KAI C;  3ZOB A;  5C44 J;  3FM3 A;  1K4T A;  4DBQ A;  3BZK A;  2L9V A;  4F55 A;  1GUU A;  2C6Y A;  1S6L A;  1MDM B;  3E1S A;  3G56 A;  1BI2 A;  3SFZ A;  5EG0 A;  1NG6 A;  1DP7 P;  5CKT A;  4LLG F;  3S14 J;  2HYJ A;  3QU6 A;  1EKE A;  2WAD A;  2UUZ A;  3IH3 A;  3EUH A;  1MND A;  2ZCM A;  1QZY A;  3Q5F A;  3CF5 F;  2LSO A;  3KLN A;  3RYR A;  2L3D A;  3S1N J;  4A3L J;  4ON0 A;  5F6F A;  2AQE A;  4U0Y A;  3BPX A;  1WJD A;  1OIS A;  2KIF A;  2WC2 A;  2ID6 A;  3O8G A;  5IP6 A;  2OQG A;  4JYK A;  4M71 A;  2O7T A;  3IRR A;  4XLP F;  3QQA A;  2XAU A;  3HTA A;  4X1E A;  2RN7 A;  2M0C A;  2R5Z B;  2I10 A;  1FSE A;  3PNT A;  4WX9 A;  2KL4 A;  1YIT I;  3ABU A;  5IT9 Z;  2DTZ A;  2ZXH A;  2I5U A;  4WXH A;  4I02 A;  2CWE A;  4GCV A;  4FX4 A;  2JK3 A;  1SVO A;  4HX7 A;  2EV6 A;  1DGR M;  2OAZ A;  1AKH B;  1VQ4 I;  5FJ8 J;  1ETY A;  4ZJZ A;  2XV4 S;  3ELK A;  2NYX A;  4U88 A;  3CJD A;  2RQQ A;  1R36 A;  3HSF A;  3GFI A;  1FSH A;  2F5V A;  3DQV C;  2VPR A;  4HSR A;  3I54 A;  2J5P A;  1VI0 A;  2OTL I;  2BY1 A;  2KIM A;  2YVE A;  2O6G E;  4EV0 A;  2VC0 A;  1TQM A;  2G7G A;  1NH3 A;  4OAZ A;  1R23 A;  1X1C A;  5F04 A;  3FKJ A;  5LRR A;  1LDJ A;  3F6O A;  1D0X A;  3CRJ A;  3ERE D;  4XSX F;  4GDF A;  2FBH A;  5FD5 A;  2F5E A;  3ABT A;  4Q47 A;  4RGR A;  2QBY B;  2NP5 A;  2PQ8 A;  4KT5 C;  1ETO A;  5DCM B;  2REK A;  4E7S A;  4BXU A;  2GA1 A;  3K70 D;  3UR3 C;  2Y31 A;  4J19 A;  3AL0 C;  5H9T A;  1VQM I;  3HGG A;  4XLE A;  5J4V A;  3V7C A;  5BOX A;  3LFU A;  3RQI A;  2RNG A;  4E4H A;  3G73 A;  2LR8 A;  4BEH B;  4MFE A;  3L2R A;  1ITY A;  3GX4 X;  1OR7 A;  2QQB A;  1GDT A;  2L54 A;  4C30 A;  3H9G A;  5D5U B;  5DM7 F;  5L3D A;  4PXI A;  3L9F A;  5D6E A;  2IT0 A;  1YIO A;  1GLN A;  4UUV A;  1UG2 A;  5HBU A;  4ENN A;  3FXQ A;  4LGW A;  3N4M A;  1AHD P;  2YVX A;  2F6C A;  5CVI A;  3SEZ A;  3BR0 A;  3TMO A;  3P9C A;  3BR5 A;  2QF7 A;  2VC1 A;  1S7O A;  4MGR A;  2JPC A;  4GYG A;  5E79 C;  2F2E A;  2IA2 A;  2XAJ A;  4EM2 A;  1N77 A;  3JRF A;  1KYZ A;  3L09 A;  3ZQL A;  1I50 J;  2XGE A;  5ILS A;  4OIP F;  4KIG A;  3CCQ I;  3H1C A;  1TWF J;  1UHS A;  2DI3 A;  4XL9 A;  4NUB A;  3WTZ A;  3MWM A;  1BOB A;  3J81 Z;  2ZSH B;  4DZP A;  3ML6 A;  4P9U A;  1Z67 A;  5HLG A;  3SXY A;  2PJR B;  4IHV A;  4MNU A;  2VXZ A;  3HM5 A;  5DM6 F;  4I99 C;  4CSW A;  2O3F A;  4A6E A;  3BZC A;  5LGN A;  3HE0 A;  2FML A;  2HDW A;  2QBY A;  2CYY A;  3IH2 A;  1EJ9 A;  2YU9 J;  4N4N B;  2NX4 A;  2CO5 A;  2W1O A;  2XAQ A;  4BBR J;  3O2P E;  4D5F A;  3OYB A;  1MW7 A;  4S04 A;  3FWE A;  2P6T A;  4HV5 A;  2DT6 A;  3FHZ A;  2JSP A;  1G8X A;  1SAN A;  4IRI A;  1Z05 A;  2L9S A;  1ZQ3 P;  2CV0 A;  2HZT A;  2W48 A;  4WK8 F;  3QAH A;  1EH7 A;  3BOQ A;  5F0C A;  1MMA A;  5GAD J;  1XSV A;  4QSH A;  2HKO A;  4B3A A;  5D4S A;  4ESJ A;  4UV8 A;  2KLO A;  3HSR A;  1DU0 A;  2RAS A;  2JSC A;  1XGO A;  1SD5 A;  2CGP A;  5EEA A;  1G6N A;  1K79 A;  1A6I A;  4A3D J;  5LRS A;  4IX7 A;  5JVG F;  2WGB A;  2VBW A;  3M8E A;  2XPU A;  2GXA A;  2XGX A;  3K2A A;  4W97 A;  5DD4 A;  3REO A;  3ZQI A;  2CFO A;  2YS9 A;  1R4N B;  2DOD A;  1ZGW A;  4U9L A;  1AWC A;  1ZG3 A;  1H8A C;  1ZAO A;  2IGM A;  3S2W A;  5EJC A;  2DYR H;  1RI7 A;  2Y75 A;  4UB8 C;  3GZ5 A;  2L4A A;  1H9G A;  4XIC A;  3J80 K;  3DWL E;  2DG7 A;  4EJW A;  4XNF A;  3G2B A;  1UI6 A;  2EV0 A;  5FB2 A;  1DDN A;  3EGQ A;  3BG3 A;  4F91 B;  2IS4 A;  4BNC A;  5A2Q Z;  2Z5U A;  1BW5 A;  4M3G A;  1RUO A;  2RRE A;  2LTP A;  3E0J B;  1ETV A;  2Y48 A;  1IV6 A;  1FJL A;  2DJN A;  4XON A;  3KIO A;  3HIM A;  4JKZ A;  1NTC A;  3VFZ A;  2DPU A;  4GCL A;  5EYR A;  2WV1 A;  2QVO A;  4PK4 A;  1FOX A;  5ICF A;  1UJ8 A;  2E5N A;  2O9L A;  2QUF A;  1QHG A;  1T95 A;  1PUF A;  2VKV A;  2OU2 A;  3DKX A;  1S3J A;  2VIX A;  2FMY A;  4V2F A;  3BT9 A;  5KAF C;  3ZP5 A;  1HSJ A;  4IRH A;  3ZMS A;  3C2B A;  4CCK A;  3QBM A;  3RKX A;  4UV9 A;  1P4W A;  4A0Z A;  4BS9 A;  1TWG J;  4IPA A;  3F8F A;  3COL A;  2KDZ A;  2WAF A;  3CJQ B;  3KE2 A;  1H89 C;  2IGK A;  3WTU C;  5DCF A;  2QOP A;  2ZCX A;  4XN3 A;  2AO9 A;  1WJB A;  3ZQH A;  4D1Q A;  2JA7 J;  5M5Y J;  1OCZ H;  1Z7L A;  2FEZ A;  3L2Q A;  3PIO F;  3P9I A;  3VW2 A;  3BR2 A;  1HKQ A;  4XQF A;  1JI8 A;  1Z3X A;  4IO9 F;  1HBX G;  4BUP A;  3K70 C;  4I98 B;  3JRI A;  1OYW A;  2F5F A;  4UUT A;  2M34 A;  1IRX A;  1X19 A;  1XX5 A;  2F4M B;  2HTS A;  1ZTR A;  1IRF A;  3IL2 A;  4CCL A;  2RNJ A;  3WG9 A;  4BJT A;  4CCN A;  4FT8 A;  3I4M J;  2CUZ A;  1VQ9 I;  1ZRC A;  2P5L C;  2VOD A;  4KN7 X;  3R0J A;  4RBO A;  2BHZ A;  2ZME A;  5EZH A;  3WGI A;  1MH4 A;  4Y33 A;  5FFX A;  2NNN A;  4HX4 A;  2LF7 A;  4U87 A;  4HOB A;  4B44 A;  1K61 A;  5FLV A;  1VQO I;  4R79 A;  4KIC A;  4UNO A;  3OMY A;  3SDB A;  1MJ9 A;  2OPT A;  3OYC A;  2FJI 1;  2A6H F;  2LYC A;  3CJT B;  3ISP A;  2HQN A;  5K1Y A;  3JTG A;  1E2X A;  4FAS D;  2NVQ J;  2IA1 A;  3HUG B;  3KP4 A;  5E17 F;  3B02 A;  2VQH A;  4U0W A;  1LDK B;  1B8I B;  2PI0 A;  1BA5 A;  3HOW J;  3KFW X;  2NVX J;  2GFN A;  3DEU A;  3F8M A;  2YPR A;  3SQN A;  4BHC A;  1BL0 A;  3QYF A;  4YIF A;  4M73 A;  2JPB A;  5HLT A;  1X3W B;  2CQN A;  3E97 A;  3PL8 A;  2ME0 A;  4ZTF A;  2HOT A;  3PSF A;  1I1G A;  2XSD C;  3H5N A;  3HPG A;  3OSG A;  4MXM A;  3CQZ J;  5JI6 A;  1HW5 A;  3LSK A;  3TP0 A;  4HF2 A;  2R7S A;  2QA4 I;  1TWA J;  3GTP J;  1WJC A;  3HC7 A;  3RKQ A;  3AQT A;  1T98 A;  3KKD A;  2XAS A;  4BQQ A;  3G4S I;  5BPI A;  4G12 A;  4M9Z A;  1R7J A;  4BE2 A;  3ASO H;  4RAF A;  4Q48 A;  1SD4 A;  2LKX A;  5CQG A;  3F8C A;  2BY3 A;  3LA2 A;  4NBQ A;  5FRM A;  4UUS B;  3VOE A;  1K4S A;  4OD5 A;  1HOM A;  3I9V 2;  3EUA A;  4U7B A;  3CZ6 A;  1XGN A;  3ONQ A;  2NP3 A;  5TRD A;  2H09 A;  2V57 A;  5D5V B;  4Y3O A;  4KFC A;  4CZZ A;  4FX0 A;  3LHQ A;  3T8R A;  4JOM A;  4I0B A;  2XAG A;  3KYL A;  1R9T J;  1MMN A;  3VOK A;  4NC6 A;  2GLO A;  4M74 A;  2NOJ B;  3KEO A;  2JRT A;  3OYE A;  2G7H A;  4A3F J;  4A3B J;  4XSZ F;  4X0G A;  1J9I A;  3FK6 A;  5FKL A;  5J8F A;  2LY2 A;  3V78 A;  4Y13 A;  1W1W E;  1XMK A;  5DV5 A;  4A12 A;  2PN6 A;  3HTU A;  2Q2E A;  1B6A A;  3OL4 A;  4E7I A;  1SC7 A;  2VJJ A;  4JP0 A;  3LSI A;  2A6T A;  4XOR A;  2LY1 A;  3KEY A;  4AIH A;  2B9S A;  3ZQC A;  3FMR A;  2COB A;  3N05 A;  1V3F A;  2CU7 A;  5J3L A;  3W3C A;  2X1E A;  4U7D A;  1SFE A;  4IKF A;  3ABM H;  1FOY A;  4GGG A;  1X3U A;  3BLY A;  2LVS A;  3CES A;  4E7K A;  1RR8 C;  2RKH A;  1W36 C;  3S3O A;  2ZNZ A;  1OLT A;  3L2C A;  3OYL A;  1L3L A;  1X1D A;  1V4R A;  4MO7 A;  2XHK A;  5HAW A;  2DT7 B;  3MCZ A;  3SZG A;  4XRS G;  1R5G A;  1TNS A;  4XOP A;  4CHU A;  4EQQ A;  1H88 C;  1TNT A;  3BR1 A;  2ZOY A;  2ME6 A;  3ZN1 A;  4YFN F;  2HKU A;  4MTD A;  1GT0 C;  1HST A;  2GIZ A;  1ETQ A;  3L2W A;  3HB9 A;  3GME A;  3OYI A;  3CCL I;  3B6C A;  2PLY A;  2HR3 A;  2ADU A;  3IUV A;  3KP6 A;  4V2G A;  5LGU A;  4U9N A;  1S8N A;  3V8J A;  1G2H A;  2W7N A;  4KWA A;  2H6B A;  4ZDO A;  1IDY A;  4EM1 A;  2FNP A;  5DUI A;  4A3J J;  1ON2 A;  1Z91 A;  2X85 A;  4CYD A;  2IA0 A;  3G1O A;  3FBI B;  5HS9 A;  1YJW I;  3ZMD A;  2E1N A;  3ECO A;  1XTA A;  4L62 A;  4RAG A;  4L0Z B;  2XPW A;  1JKP C;  4WCG A;  3WTW C;  3M3Y J;  3T1B A;  5AIQ A;  3RI4 A;  3K8P C;  3NQO A;  2LKP A;  4GO1 A;  4B48 A;  2GOM A;  4CYC A;  4HLX A;  1VQ7 I;  2DAO A;  2PFB A;  3IV5 A;  4KYW A;  5EFY A;  3IC7 A;  3PQK A;  5H2F C;  2O8X A;  1P4A A;  2VL8 A;  3LSH A;  4H4K C;  2H6C A;  1JTY A;  4YIR X;  3QP5 A;  1TLH B;  2PMZ A;  3JRB A;  4NQW B;  4BQN A;  4BQO A;  2ETH A;  3OS0 A;  3JSP A;  1M1E B;  3OR2 C;  3DPT A;  2P7C B;  2KZG A;  4IQ4 A;  1I39 A;  2H8W A;  3QYE A;  4D7N A;  5B66 C;  1R71 A;  4AVP A;  3K0L A;  1OMI A;  2A5W A;  5J4Y A;  4RAZ A;  2MH2 A;  5CVU A;  3ZMU A;  2VPL A;  3PQJ A;  2KQR A;  2BHY A;  2DDB A;  2QEN A;  1D5Y A;  2KRC A;  1UB9 A;  4QPO A;  1Z6R A;  2GUH A;  1D1B A;  3H9Q A;  4O5V A;  4RGU A;  5JHU A;  2L2O A;  1WJA A;  1VQ8 I;  1Y1W J;  2M1B A;  3DFG A;  3H3Z A;  1IDZ A;  4IOC F;  1YQA A;  1IO2 A;  5C4Y A;  4IEJ A;  1PYV A;  2CV2 A;  3CC7 I;  4AIK A;  2P0W A;  2HWV A;  2A07 F;  5AQC A;  1BR1 A;  1E3P A;  1R49 A;  2MSY A;  2H27 A;  4IQJ A;  5F0H A;  3VYS B;  4BE1 A;  1YW9 A;  2OF7 A;  1GVD A;  4N9H A;  2VB6 A;  3LSG A;  4QWQ A;  4A5N A;  4XLN F;  2DQL A;  2O7O A;  1LJ9 A;  5L3B A;  3K1P A;  2FJ1 A;  4BQA A;  4L0Y B;  4AM3 A;  3ANG A;  3TKY A;  2ICW G;  3I4P A;  1F5T A;  1Z1D A;  5C3E J;  4NQW A;  3MKY B;  2PX9 A;  5EEG A;  2WAQ N;  1QVU A;  3V6G A;  3A1Y A;  4K2E A;  3H35 A;  4KA4 A;  2RV8 A;  3C1D A;  3Q3S A;  2GM4 A;  1ZGA A;  4Y7N J;  1QPI A;  2B3W A;  4BYY A;  3HTJ A;  3CLO A;  3OOU A;  3KZ9 A;  2LH9 A;  1D0Z A;  4A3I J;  1QBJ A;  1EH6 A;  3DU6 A;  1FIA A;  1T56 A;  1NK2 P;  1KU2 A;  3WG7 H;  2EFQ A;  3GLX A;  4A0X A;  2WY7 Q;  3DXJ F;  1WJE A;  2VQL A;  2ELK A;  3DU5 A;  1FNN A;  1TBX A;  3K4N A;  2RDP A;  4KN4 X;  2E1C A;  1IN6 A;  2VE8 A;  3D1N I;  2IS6 A;  2PBX A;  3ZQF A;  2R7V A;  5JLX A;  5DUK A;  2NRA C;  2NVU B;  4IRG A;  2ZC2 A;  3KP5 A;  3GFL A;  2EIN H;  5ICE A;  2CJJ A;  4F92 B;  3CCS I;  1R1V A;  2P7V B;  5IOY A;  1D5V A;  3AQS A;  1VQN I;  1TWH J;  2NXN B;  4HDU A;  2FNA A;  3KPH A;  5GAG J;  2DG8 A;  3EQL F;  3GZI A;  1PVE A;  2KRH A;  3BJB A;  2E1M B;  1GV2 A;  4MEX F;  4RB3 C;  2W25 A;  3QWL A;  4IHS A;  4QIW N;  3RD3 A;  1XCB A;  3ASN H;  5K7Z A;  2IGO A;  5J1Y A;  2HTJ A;  4DOZ A;  1LE8 B;  4O6J A;  4YFK F;  1KU7 A;  1EA3 A;  2VQC A;  5IP7 J;  2IS2 A;  4NEL A;  3VB2 A;  2NAZ A;  2MAB A;  3HXL A;  3C18 A;  4MEY F;  3G1M A;  1DPU A;  5H20 A;  2DA1 A;  2N8G A;  3IP4 B;  1DGW Y;  4C3I J;  2F5C A;  4RB1 A;  1E3O C;  1JKR C;  1A5J A;  5EZG A;  5DDG A;  4GFL A;  4CXF A;  3DBL B;  1HKT A;  2KIU A;  1APL C;  1MMG A;  1KA8 A;  4AUX A;  1J2X A;  2PEX A;  3U9G A;  1F1Z A;  1STZ A;  2M0M A;  2DMP A;  3ESW B;  4HW0 A;  2D1V A;  3LNQ A;  4AF5 A;  3W2W A;  3I58 A;  4JX4 A;  3FMQ A;  3KCC A;  4DGW B;  3M9A A;  1J59 A;  1CF7 B;  2MH9 A;  5IYD J;  1IUY A;  1YI2 I;  1B9N A;  1PDN C;  3KP2 A;  3M1E A;  2K9M A;  5IT3 A;  1QZZ A;  2QKM B;  1BJZ A;  1W5C C;  1B1B A;  1VFC A;  1SVL A;  1H0M A;  3K2Z A;  4RDU A;  4ZYG A;  2FQ3 A;  1UHM A;  3E6C C;  5JHF A;  1HXD A;  3GTM J;  2X6Y A;  1MH3 A;  2YSR A;  2BXZ A;  1U78 A;  1DQU A;  3OYF A;  3OV8 A;  5IYB J;  3F9K A;  2DLL A;  3JTH A;  3QOP A;  2CSO A;  1BJA A;  5LEK A;  3QPL A;  1Z0X A;  5L3C A;  1YLF A;  3B6A A;  1IN4 A;  3DP7 A;  1G4D A;  5CXI A;  2VXD A;  3F3X A;  1LUJ B;  2EB7 A;  2MW8 A;  1U8B A;  5D5X B;  2M2E A;  3GO5 A;  2R0Q C;  3M07 A;  3A03 A;  1ZGJ A;  2VKD A;  1Y1V J;  1ZHF A;  3Q9V A;  3S17 J;  1T08 B;  3WGG A;  3VP5 A;  2F07 A;  2R5Y B;  3F6V A;  4BKX A;  3OYN A;  5FLX K;  2X51 A;  4XRM A;  3D5R C;  2Y9Z A;  2YU3 A;  3Q0U A;  2V6E A;  2BBY A;  4TV7 A;  3JW4 A;  3CME I;  1JGS A;  2V9V A;  4CDG A;  5E3M A;  3G6E I;  1BOA A;  4J00 A;  2VJ5 A;  2AXT C;  3AG1 H;  1ZRD A;  2HQR A;  2QLZ A;  1MSE C;  3ZN0 A;  2Z99 A;  3C2G A;  4CA0 A;  4XN0 A;  4OMZ A;  2L7F P;  2R7D A;  3KET A;  5HS7 A;  2V1N A;  2UXP A;  1QHH D;  3G7R A;  2VON A;  3LFK A;  4FTH A;  5KNL A;  3ABK H;  1T0F A;  5L3F A;  3OYK A;  1AA7 A;  1YJ9 I;  3M1C A;  2LC2 A;  1RNL A;  3NWS A;  2VKH A;  3BPV A;  3NAR A;  3ZXS A;  4C3H J;  3OIO A;  3QPS A;  1ZG5 A;  1YTY A;  3CCJ I;  3DBH B;  2RGV A;  4PZJ A;  2WAE A;  1U5T B;  1K6O A;  2L9N A;  4LLL A;  3ON2 A;  1OKR A;  4Q4Z F;  4M3E A;  1MDM A;  3CCV I;  3HZJ A;  1U8R A;  1ERD A;  3F72 A;  4CCJ A;  3NWT A;  5E3O A;  1YO5 C;  1FPQ A;  1LEA A;  1KYW A;  5FKO A;  2DYS H;  3MVP A;  3OY9 A;  3M4O J;  2M9H A;  2BGC A;  4D7M A;  2PMH A;  2IRF G;  4QTR A;  3KEQ A;  4CIC A;  4PJN A;  2J5O A;  4AVZ A;  2XIG A;  4WF2 A;  2ZNY A;  1FTZ A;  1G3W A;  1BR2 A;  4BJ6 C;  4R8H A;  2LG4 A;  3ON4 A;  3BTI A;  2DMQ A;  3AAF A;  1VQL I;  2WWY A;  4A3E J;  4OWR B;  4ZYA A;  1FYK A;  2XKP A;  2B0L A;  1XB4 A;  4DVY P;  3GTJ J;  3RH2 A;  2MFZ A;  3FK7 A;  2R5Z A;  1QU3 A;  3VOX A;  3E5X A;  3J80 Z;  3RZO J;  1PUE E;  1GVJ A;  3D5S C;  4YRV A;  1OCT C;  3RPQ A;  3U2R A;  3KLO A;  4ZH4 F;  2Q24 A;  3BRO A;  4UVA A;  1AKH A;  2DPD A;  1IXS B;  3RKW A;  3HOS A;  1JUM A;  2DA2 A;  3KX2 A;  5CQE A;  1UFM A;  4M72 A;  3CUQ B;  4KUM A;  3CF2 A;  2E1O A;  3WU0 A;  2LNB A;  4HNT A;  4P96 A;  3MQ0 A;  3ROU A;  3E5Q A;  5HLH A;  1A35 A;  4XRF A;  3BP8 A;  1PP8 F;  3FDY A;  2K5C A;  3QKX A;  3H3V K;  2HPI A;  3ZQQ A;  1W5S A;  1VF9 A;  1NHA A;  4G8X A;  3ECH A;  4B4C A;  1B72 B;  1AOY A;  2CMP A;  2UXX A;  3RCO A;  1P7I A;  2FA5 A;  5LHI A;  1S7E A;  3GCM A;  5DCM A;  1JT6 A;  3NS4 A;  2GQQ A;  2A5Y B;  2QM3 A;  1SD6 A;  3RJP A;  4XID A;  1VQP I;  2L9R A;  2E1M C;  3TO7 A;  3ZPL A;  1YS7 A;  3GTK J;  2G7U A;  4GCK A;  1T8I A;  3TED A;  3HOX J;  1TL8 A;  1W7P B;  5F1R A;  3S3M A;  1MNE A;  2PZ9 A;  2VBY A;  2CUJ A;  1OYI A;  3OYM A;  4BEH A;  4OAY A;  3S16 J;  3FIW A;  2JN6 A;  2V26 A;  1LFU P;  1JT0 A;  3GZN B;  1ZR4 A;  2E2H J;  3PNV A;  2P8T A;  4F3Q A;  6PAX A;  1MNM C;  1MBK A;  2OZ6 A;  3AKZ A;  2FF4 A;  1WGX A;  3CMM A;  3VOD A;  4ETS A;  3F8B A;  1TT0 A;  1TW3 A;  2DCE A;  2Z33 A;  1MIJ A;  1O3T A;  3J7Z I;  1X2N A;  3OWT A;  1T2K A;  3FBN B;  1A36 A;  2DFF A;  2GXG A;  1FBQ A;  4XK4 A;  2AS5 F;  2JWT A;  2P5K A;  4FE4 A;  3S8P A;  1LPQ A;  4PJ0 C;  2FX0 A;  5K5Q A;  5CVJ A;  2K3P A;  2R7Z J;  2W53 A;  3DTE A;  3L2V A;  4LG0 B;  1YOV B;  4UXN A;  5E1W A;  3QP6 A;  1W7P D;  4ENJ A;  3PFY A;  1V54 H;  2OD5 A;  3DF8 A;  2LD5 A;  1T0F C;  5GPA A;  3X2Q H;  4H0E A;  2PJR A;  4CGR A;  3M8F A;  1IN8 A;  1TWC J;  1K83 J;  1Q1H A;  3G71 I;  2Y0M A;  4NNJ A;  3F22 A;  2TDX A;  3S1M J;  3PO2 J;  4JX6 A;  4AC6 A;  4C3J J;  4A3G J;  1AU7 A;  2Z9O A;  1BI1 A;  3S3N A;  4FIS A;  2H1K A;  2XPV A;  2ZSI B;  4FET A;  5BNG A;  3DTI A;  1BIA A;  2ELJ A;  3DKW A;  4JBA A;  2CW7 A;  3IKV A;  3OS1 A;  4HQM A;  2XRN A;  1Y6I A;  1ZEL A;  2R7Q A;  3FM5 A;  4ESF A;  1T38 A;  2P4W A;  4XRS A;  4FHT A;  5HDK A;  4ZDP A;  2UXI A;  2FQ4 A;  4A3C J;  3HKZ N;  1FTT A;  9ANT A;  1ULY A;  2ISZ A;  1R5I D;  1GV5 A;  1IXR C;  3K1N A;  1IF1 A;  1OJL A;  4FCY A;  1S5L C;  3WTV C;  1U9O A;  1UHW A;  2JT1 A;  1KQ8 A;  3HTH A;  1ETX A;  1WHU A;  4GXO A;  4XKV A;  1FP2 A;  3TOA A;  1YYV A;  1Q1V A;  1R6R A;  3CC2 I;  1G3Y A;  2XAH A;  4JNN A;  2HEO A;  2D1H A;  1V55 H;  2K3F A;  5EDN A;  1Y0N A;  3ZQ7 A;  4RM2 A;  2JTV A;  4AWX B;  5TGT A;  2R7W A;  3HRU A;  1Y0U A;  3I64 A;  5FMP A;  1XPX A;  3BCB A;  2XF6 A;  3LL7 A;  2OC6 A;  3I59 B;  2W84 A;  3FF5 A;  2EWN A;  3BY6 A;  1U5T C;  1WH7 A;  2VOP A;  4DJA A;  3SWH A;  4DYQ A;  4S05 A;  2LBF B;  4AU7 A;  5JVT A;  2L0K A;  2CUE A;  1FZP B;  3AFH A;  3N97 A;  1SMY F;  2UV1 A;  1ETK A;  2DW4 A;  2E7W A;  4ITV A;  3UNG C;  3UKG A;  1RC9 A;  3AG4 H;  3TQN A;  3BRU A;  3U1K A;  3QYB A;  4HQE A;  2WA0 A;  3BC8 A;  3A0B C;  1R00 A;  4WIB A;  2JA5 J;  3PSI A;  2ZFW A;  1QQI A;  2NVT J;  1F36 A;  2QWT A;  2LDU A;  3LST A;  4KIS A;  1JJ8 C;  2OBP A;  5B3S H;  3V8L A;  3NNR A;  1YHQ I;  1V5E A;  1FC3 A;  3DCF A;  2LY9 A;  4LD5 A;  4HG2 A;  2BW3 B;  2M4G A;  4LIV A;  3MZY A;  2LLK A;  2LF8 A;  2F5D A;  1LVK A;  5HNF A;  1EH8 A;  3HOV J;  4PJJ A;  3F1B A;  3PAS A;  2IPQ X;  3HKZ A;  4WXC A;  3KNW A;  4M3B A;  1UZC A;  3CUQ C;  3M7G A;  1IN7 A;  4EM0 B;  3LSP A;  4LK0 F;  2V6C A;  5K5R A;  2EIJ H;  2PG4 A;  2QKO A;  4EGZ A;  1Y56 A;  5AON A;  2HI3 A;  5DTD A;  1P9Q C;  1IG7 A;  5FRN A;  2DA6 A;  4Y52 J;  2A61 A;  3LJL A;  2E2I J;  1FY7 A;  2XF5 A;  3EET A;  1R22 A;  3RIR A;  5FGL A;  1TZL A;  1R58 A;  5CW8 A;  2KZV A;  2MGQ A;  2PMZ N;  3GVA A;  2R4G A;  2EQR A;  1S9H A;  1X4P A;  2IP2 A;  2XVC A;  3HUG A;  4HLY A;  3NRV A;  1ENH A;  4L5J A;  3F21 A;  2X6W A;  1B8I A;  1IW7 F;  4RGX A;  3E6D A;  3D5L A;  2IU5 A;  1USS A;  3WHC A;  2BV6 A;  2BZT A;  1OFC X;  3ERM A;  3TBI A;  3VIB A;  3KZZ A;  5JR3 A;  1G59 A;  3NXC A;  3I0T A;  3JR9 A;  5JLW A;  1MMS A;  2K27 A;  2OA4 A;  4KMF A;  2QGU A;  3H36 A;  4I09 A;  4BHP A;  4RB2 C;  1YRN B;  2W82 A;  3OIP A;  1ZRE A;  2HFH A;  3ZMV A;  4J01 A;  3PFI A;  3BR6 A;  4B3X A;  2VKE A;  1UEL B;  3MAJ A;  5EF6 A;  4C2U A;  1BW6 A;  4NDL A;  2IS1 A;  3RDI A;  1HC8 A;  2ZJP F;  2NVY J;  1MBJ A;  1YJN I;  1ZKG A;  3I3L A;  2Y2Z A;  3DLA A;  3V4G A;  1IV8 A;  5B1B H;  1SFU A;  3WE3 A;  1P4X A;  3LQR A;  2Y0S A;  1WZ2 A;  3V7S A;  2JVH A;  2KJB A;  4UUS A;  4UB6 C;  2R7R A;  1R1T A;  2FXA A;  2K9Q A;  1RUN A;  4XKB A;  4UVB A;  3BG9 A;  1FX7 A;  3KYD B;  3CCR I;  1BC7 C;  2V1U A;  2UXU A;  3FKI J;  3RPU D;  3LQQ A;  4DBR A;  4OIN F;  1XSD A;  4U0V A;  2ESH A;  2MD5 A;  3FHN A;  3PM1 A;  5CYV A;  2QWW A;  1REP C;  2M8E A;  1SFX A;  4EJT A;  4PSW A;  2KPM A;  4EAT A;  3WTX C;  1SFO J;  3CJN A;  1IXC A;  5KK1 A;  3RSN A;  1VND A;  4LK1 F;  3QPT A;  1Z77 A;  5AIP A;  2KT0 A;  1QPM A;  2QSF X;  2X0L A;  3I55 I;  2E60 A;  1JTX A;  4G7O F;  2ZJ2 A;  1LFB A;  5H6R A;  4DYC A;  1VTN C;  2QSG X;  4XLH A;  2LMD A;  1JUP A;  4M9X A;  2O8K A;  2M3A A;  5K5O A;  3AG2 H;  4PJM A;  2XB5 A;  3W6J B;  3F0C A;  2ID3 A;  3QU3 A;  5F27 A;  4BGD A;  4IHW A;  3CUO A;  5J6X A;  2W85 A;  5D6F A;  2Q8K A;  4G7H F;  3ULQ B;  1RZ4 A;  3WOD F;  5D18 A;  4KIT B;  2P81 A;  1G3T A;  4G9Y A;  3P7N A;  2CFX A;  2VE9 A;  3JCU C;  4JL3 A;  1QNT A;  2HOS A;  3A01 B;  2BY2 A;  3HRT A;  2Z3Y A;  3K4B A;  3CC4 I;  2Q1Z B;  3JRE A;  1X1P A;  3EYY A;  2MLG A;  3TP3 A;  1N78 A;  4DIQ A;  2LFB A;  1RES A;  1I1S A;  4I01 A;  5HOO A;  2QQ9 A;  3SZT A;  3ANP A;  4KDP A;  3I4N J;  1QGP A;  1LFP A;  1NK3 P;  3LWJ A;  3CLQ A;  2BYV E;  2A3S A;  2MYS A;  4LJZ F;  2UZK A;  2IXS A;  2DMN A;  4RAY A;  3SFI A;  4CO8 A;  1BBY A;  5D19 A;  1XGS A;  3HOT A;  4E7Z A;  3BWG A;  2UXO A;  4M3D A;  1LDD A;  2F4O B;  2VT2 A;  1FMV A;  1R4M B;  5CJ9 A;  1XSX A;  2FBK A;  2YX7 A;  1O4X A;  3IH4 A;  3QOE A;  1K78 B;  1IC8 A;  4GYI A;  4N9I A;  2M7B A;  5EGO B;  1UMQ A;  4HF1 A;  2DA4 A;  2EJR A;  4RS8 A;  2OZU A;  3E7Q A;  1XG1 A;  2HXO A;  2XGD A;  1MBG A;  2HNH A;  2LOO A;  4KT6 A;  3RQ4 A;  4A3K J;  1POG A;  2HZD A;  4B47 A;  3S5R A;  3HHG A;  2G7S A;  3I53 A;  5E8I A;  5F0F A;  2GIV A;  5DEQ A;  3WE2 A;  1O57 A;  5J1U A;  3P9T A;  3GWZ A;  2Z16 A;  1WFX A;  3JSO A;  2VUM J;  4MQV A;  3VW0 A;  2X6X A;  2V9P A;  4MIM A;  4LB6 B;  3FIS A;  4YII A;  2MLK A;  3GYH X;  5D5W B;  3NAU A;  2E35 A;  3SYT A;  4X6A J;  4EJU A;  1QO0 D;  2OQR A;  4MLO A;  2X4H A;  2X9D A;  4M6X A;  4A2U A;  4G6T B;  3WHB A;  4G6Q A;  1SMT A;  2AXL A;  2K02 A;  3JSJ A;  5FLX Z;  3OYD A;  4OIR F;  1U9N A;  2ZJQ F;  3FXM A;  5F1J A;  2CRG A;  2GOX B;  3V42 A;  2G3B A;  4FQG A;  1WQ2 A;  4CZC A;  1X3Z B;  2HGC A;  2JVG A;  2XF7 A;  1HQC A;  3LMM A;  2RQP A;  2CG4 A;  2OCC H;  1XMA A;  4YFX F;  4Q5S F;  1UI5 A;  2XUB A;  1GHC A;  1SAU A;  4F7Z A;  5LHH A;  2OER A;  4LMY A;  2E71 A;  2Y9Y A;  3BJ6 A;  4LLN A;  2P6S A;  1T33 A;  2EK5 A;  4HV6 A;  3CCU I;  5ERI A;  3IKT A;  3CP2 A;  3J7A Y;  3CP8 A;  5F08 A;  1RKW A;  4II3 A;  2OJE D;  2GWR A;  3FXJ A;  2A68 F;  2GBY A;  3FX3 A;  1B9M A;  2WY8 Q;  4OOI A;  2QCO A;  4AYB A;  4C2M J;  3L1P A;  3DBR B;  4G94 A;  4BU2 A;  5GAH J;  4RLF A;  3W6V A;  4CCO A;  4DZJ A;  3F23 A;  1FMW A;  1K6Y A;  4NB5 A;  3JAM Z;  5EG0 B;  1TQP A;  4CGZ A;  5FHP A;  1ZG1 A;  2Z1D A;  3S1Q J;  4PUS A;  1MMD A;  3NRG A;  1O3Q A;  4F93 B;  4XLC A;  2RHA A;  4JK1 X;  2VOO A;  2A69 F;  2E5Z A;  1X58 A;  4ZC3 A;  4A5M A;  4CCM A;  4MHG A;  2NOG A;  1MGT A;  1P7J A;  3W2V A;  2K4B A;  2WV0 A;  3Q0W A;  2TRT A;  3FXK A;  2LP0 A;  5ILU A;  2JA8 J;  2CH0 A;  1BC8 C;  3MEX A;  2HYG D;  5ILV A;  2GXB A;  3KYC B;  2ZXI A;  4GRI A;  1RET A;  5CLS A;  3ABL H;  2DOF A;  1YX5 A;  4G7Z F;  3H3U A;  1VQ5 I;  1WKM A;  3DEE A;  2FBI A;  2LK2 A;  3GW2 A;  3GEU A;  1KU9 A;  5J40 A;  2M30 A;  2Q0O A;  5D4R A;  3OOP A;  4HEA 2;  2W4S A;  4DYR A;  2IVM A;  2G9W A;  3HSE A;  3GTO J;  2H8R A;  3VUQ A;  3R61 A;  1XCV A;  1ZK8 A;  2QQA A;  2ISY A;  3HRM A;  4M9S A;  3CCY A;  4BL0 B;  1PP7 U;  2HKX A;  1LE8 A;  2DBB A;  4I6Z A;  2YVH A;  4XR6 A;  2ZXJ A;  2E36 A;  2OCE A;  3SZP A;  3P9K A;  4D9J A;  5BQT A;  1N75 A;  4M6V A;  2ZFU A;  2WB1 A;  3QOD A;  4UHT A;  3H5R A;  1U6G A;  4RGS A;  3HRS A;  4RLQ A;  1TTY A;  4YEL A;  5D8L B;  2I8D A;  4Z6Y A;  2BY0 A;  5TJJ A;  1XC5 A;  3HJE A;  3K10 A;  3MKW B;  3E6M A;  3IWF A;  3ZRG A;  2NS8 A;  2B63 J;  5FD6 A;  1ORK A;  3GTQ J;  3CDL A;  3D0S A;  4W1U A;  1XGM A;  4ESB A;  3K4J A;  1CF7 A;  3HG9 A;  2EFO A;  1MD0 A;  3ZMZ A;  3KKC A;  1VZ0 A;  2FUG 2;  1YG2 A;  4EJO A;  4DQ2 A;  4BDZ A;  2VI6 A;  5GP9 A;  1I3Q J;  5CVV A;  3ZQG A;  1KZH A;  2VT3 A;  4BJ5 C;  3DEW A;  2BE5 F;  3GXO A;  2MC4 A;  1JHH A;  2STW A;  3J7A O;  1ZLJ A;  5BS6 A;  4ZZD A;  2EFW A;  3BJA A;  1SGM A;  1D1C A;  2DQR A;  3A02 A;  4RMN A;  2V7F A;  3TL4 X;  3JAM K;  2K4J A;  4C9Y A;  4LFU A;  4DW6 A;  4BDY A;  3C2H A;  1ON1 A;  1JGG A;  3EUP A;  2VAS A;  2JMW A;  2X1D A;  4ZYD A;  5KCM A;  2V1X A;  4HZF A;  2NNY A;  2DJI A;  2ZBK A;  3CD6 I;  1FWZ A;  4QPQ A;  1U0J A;  1LB2 A;  3WGH A;  2R5Y A;  2DO7 A;  3RZD J;  3S15 J;  1JHF A;  2QQ8 A;  5E1Z B;  4BAY A;  5CXG A;  1HLV A;  3ZCO A;  4OIO F;  4GFK A;  2JA6 J;  4Y4R A;  5K58 A;  3HDD A;  2GZW A;  3RYP A;  1FBS A;  1JKO C;  3TO9 A;  2OV7 A;  1IRZ A;  2HYF A;  3KZI C;  3EDP A;  3T0Y A;  1CQT A;  4XKW A;  5HDG A;  4XLA A;  1T6S A;  5GAE J;  5F64 A;  4HYE A;  2RC4 A;  3WU2 C;  1SEU A;  2IAI A;  3GF2 A;  4HST A;  5E1X A;  2EH3 A;  1HDD C;  3K69 A;  3P5J A;  2M4K A;  1KON A;  2H94 A;  5JFR A;  3KP3 A;  5L3G A;  5HVQ C;  5FGM A;  2V9K A;  4YEJ A;  1FLI A;  1WCM J;  1ZH5 A;  4E6K G;  2CW0 F;  3MD2 A;  3FXL A;  3O6B B;  2CV1 A;  3FRQ A;  2E34 A;  4C2T A;  3KZY A;  2E19 A;  2FE3 A;  2R7U A;  4WWC A;  2XC7 A;  4A69 C;  3J7Y J;  3CJR B;  3A2K A;  4MQ9 F;  1UAA A;  2B1E A;  2HOE A;  2XDN A;  5L3E A;  3EYI A;  5TIS C;  3AG3 H;  1KGS A;  4FE7 A;  4II2 A;  4LIT A;  1U5T A;  3R0A A;  1IRG A;  4HDV A;  4R1H A;  2ECC A;  3VEP A;  3G3Z A;  3H9J A;  4XKC A;  2HVQ A;  1GXQ A;  3OL3 A;  4BAC A;  3TO6 A;  1C0W A;  2LKS A;  4HNV A;  2HQ5 A;  4JX5 A;  5EEH A;  1OPC A;  1Z6T A;  2EFN A;  3VVZ A;  3HIF A;  3GFJ A;  1W0U A;  1K7A A;  3Q0V A;  5HLI A;  2OUM A;  2JRM A;  2WTE A;  4GFB A;  2DFE A;  1O3R A;  2DXI A;  4ME9 A;  5C4J J;  3DPU A;  1HF0 A;  2CQX A;  2QYO A;  5IT9 K;  1S29 A;  2CW8 A;  2CQQ A;  4BXF A;  1JE8 A;  2BVL A;  2BXY A;  1ZN2 A;  1XS9 A;  2ECB A;  2QTQ A;  3W2A A;  1LNW A;  1Z3Y A;  1BI0 A;  1OCR H;  4JQF A;  4A0Y A;  3WTT C;  2AQF A;  2DA7 A;  4MK6 A;  3MMY B;  3H92 A;  4ENK A;  1RR7 A;  4CH7 A;  4Y15 A;  2X6O A;  2BEO A;  1CGP A;  3CUQ A;  1PUF B;  1DUX C;  1ZRF A;  3PPB A;  1QRY A;  3S32 A;  1O3S A;  3OIQ A;  3O8H A;  1FP1 D;  4P9F A;  2KIQ A;  1XDU A;  2KMU A;  1F43 A;  5CVR A;  3EUH C;  3BTJ A;  1SVM A;  2FBQ A;  2CUF A;  3ZGK A;  4E7H A;  4E7J A;  3TDU C;  1I5Z A;  2P5V A;  3RKY A;  3SHF A;  1F4K A;  1V5G A;  1EV7 A;  3OYJ A;  4A3M J;  3R60 A;  4D0P A;  4E7L A;  4BBS J;  3JRD A;  3H5A A;  5M3F J;  1B72 A;  1WJF A;  1WJ5 A;  2CQK A;  2RAE A;  1O7F A;  3CDH A;  2ZXW H;  3OYA A;  3L7W A;  3GZ6 A;  3BTC A;  1XDS A;  2QKL B;  2DMT A;  5FLM J;  1MBH A;  1FBU A;  1WI3 A;  2O03 A;  2A05 A;  3BCG A;  4BY1 J;  5LFA A;  1ZAR A;  2EFP A;  1R5H A;  3VWB A;  2E2J J;  1W7P A;  3ZMT A;  1FOK A;  4BH9 A;  1Y39 A;  2XB0 X;  5GTI C;  2BVM A;  2L7M P;  3KP7 A;  4N0B A;  4XM3 A;  1LQ1 A;  4XOT A;  2HVS A;  1RKT A;  2OI8 A;  3VVY A;  1Y8R B;  2R92 J;  4AC0 A;  2PBI A;  2DA3 A;  3EPZ A;  5K7H A;  2JZY A;  1VQ6 I;  2YUS A;  3BDD A;  1W36 D;  2NS7 A;  3FMS A;  3BQY A;  2ZME B;  3LA3 A;  2K9L A;  4IL6 C;  2L02 A;  3CMA I;  3LWF A;  2DTR A;  4EVI A;  3HTS B;  3VPR A;  2QEX I;  4M6Y A;  2MC3 A;  3JRA A;  1IUF A;  2FOW A;  2HU9 A;  1OYY A;  4WXD A;  4ANJ A;  1TP4 A;  3NPI A;  1FT9 A;  3J81 K;  1BR4 A;  2GAU A;  2DK8 A;  4HBL A;  2XAF A;  1UG0 A;  3LSR A;  4IZZ A;  2KDO A;  3LA7 A;  4LG0 A;  4IOA F;  5DD8 A;  3BCA A;  4ZTJ A;  3PUB A;  2HYT A;  2KP6 A;  3DTK A;  3DV8 A;  3R6S A;  3SJM A;  2PMU A;  4ZYH A;  1WSU A;  2KHM A;  3QPH A;  3FXR A;  4B1R A;  4ABZ A;  1MSF C;  4LOC A;  1OR7 C;  1ONV A;  4HF0 A;  4AID A;  3CO6 C;  5IP9 J;  3L00 A;  1LKX A;  3ZR8 X;  1E3H A;  2PJP A;  3OYG A;  3E5U A;  4ZYE A;  1W4M A;  4C2M A;  1A6Q A;  4BE0 A;  1A04 A;  2HVR A;  5ICG A;  4L18 B;  4IRV A;  5DYM A;  1JXS A;  4L5I A;  4L5E A;  2EBI A;  5DAJ A;  1QA6 A;  1JJ6 C;  3HOZ J;  1OCO H;  2TCT A;  4PJL A;  1EF4 A;  2ZB9 A;  2EA2 A;  3OS2 A;  3HOY J;  3MKL A;  1WH5 A;  5DS9 A;  2CS3 A;  4IXA A;  4P5O A;  2B7E A;  2X48 A;  3S93 A;  1FEX A;  4GCT A;  3MN2 A;  4M3F A;  4IHY A;  2YR2 A;  4RM3 A;  1E0E A;  1A31 A;  3O60 A;  5FKM A;  1GXP A;  2D2W A;  2Y0S N;  1D8J A;  2XKO A;  3GEZ A;  3FXO A;  4KNY A;  4RB0 A;  1L0O C;  1B59 A;  5E3N A;  1WI9 A;  1OCC H;  5J8C A;  2STT A;  4YG2 F;  5J1R A;  1I27 A;  3HGY A;  1W0T A;  1QZE A;  1ETW A;  5E3L A;  5E18 F;  2Q2E B;  3DPJ A;  3BR3 A;  1YIJ I;  1WPK A;  1O7L A;  2VJI A;  1BM9 A;  5KHD A;  3C3W A;  5A2Q K;  3LAJ A;  3W6K B;  1FIP A;  2ZOZ A;  1HKS A;  4OMY A;  3BNI A;  1LVA A;  3BG7 A;  3A4C A;  1RPW A;  3TDZ C;  4L9V A;  5FFZ A;  2XRL A;  2ZO4 A;  3I59 A;  3U1D A;  2HXI A;  1LEB A;  2XDV A;  3OSF A;  4NC7 A;  5D8K B;  3DKY A;  3DPL C;  3SEQ A;  4Y17 A;  3CTA A;  2EZI A;  5ICC A;  5M3M J;  1ACI A;  2DFH A;  2LBF A;  3HEF A;  4B43 A;  2M5W A;  3F8N A;  1IZ1 A;  2FU4 A;  2L01 A;  5J47 A;  2V1D A;  1MJA A;  1KQ9 A;  2CQ7 A;  1P6R A;  3GLL A;  3L2U A;  1JKQ C;  5HSZ A;  3B81 A;  2QIB A;  4HNU A;  1DPR A;  2W00 A;  2JA2 A;  2KIS A;  2O0Y A;  1J0R A;  3GBG A;  3T8T A;  4ACI A;  1KU3 A;  1NG7 A;  5GTH C;  4I7H A;  3GFM A;  5M5W J;  1D3Y A;  3VVX A;  3PUF A;  2O5R A;  3SDG A;  1YS6 A;  4HKU A;  3K6G A;  1X2M A;  5FRO A;  2IGN A;  4IHT A;  3VW1 A;  2M87 A;  1D1A A;  1TW2 A;  5IY5 H;  3IHU A;  2DOA A;  3GTL J;  2DN0 A;  4O3M A;  3M8J A;  2BW3 A;  3COA C;  4N4O B;  3T6N A;  2EZL A;  2PFV A;  1TQI A;  1ZR2 A;  1YE9 A;  3I71 A;  1BN5 A;  1W5T A;  1Z21 A;  2IBD A;  3WU1 B;  5E20 A;  4G6D A;  3V7R A;  3JRC A;  3LSM A;  3CO7 C;  4LB5 A;  3VYR B;  4CYC B;  1HCR A;  2Y69 H;  2DMU A;  4DNC A;  1T39 A;  1FOW A;  3LAP A;  2R93 J;  1HDP A;  1MBE A;  4I0A A;  3LOC A;  4F52 A;  3PO3 J;  2FRH A;  4NN1 A;  5LLQ A;  3K4C A;  4OD4 A;  4B09 A;  2KKO A;  1J5Y A;  1WRJ A;  3HL2 A;  1BIB A;  3K4M A;  2D6Y A;  1MBF A;  1TT5 B;  2M7A A;  2L4M A;  3R4K A;  5GPC A;  3S2D J;  5BMZ A;  4UY8 I;  5HOD A;  4IJA A;  2EIK H;  4ASN A;  3VSK A;  4S0H B;  4Z2Y A;  1QVT A;  4BHB A;  1HW1 A;  3CWR A;  2IEK A;  5IOZ A;  2KFD A;  4LIU A;  3S1R J;  1IN5 A;  3BG5 A;  2EIL H;  2V4J C;  3GUD A;  3CMY A;  3O3K A;  2EZK A;  3CDI A;  3NEU A;  3K1M A;  1I6H J;  5LGT A;  3RPU A;  4A6D A;  4PSX A;  3H0G J;  4BY7 J;  2DA5 A;  3Q9S A;  2MG4 A;  1RIO H;  1P92 A;  3MZ8 A;  4EMS A;  1HW2 A;  2R7X A;  2HDC A;  1WVR A;  1WWX A;  3K4K A;  3HBL A;  1YRN A;  3HOU J;  1S7A A;  1JUS A;  2DOE A;  5B1A H;  3MNL A;  3K9T A;  2ACJ A;  1X4O A;  2VQG A;  2ZME C;  3PNY A;  1R1U A;  2DDA A;  3JRG A;  3CCM I;  2ELH A;  4UVC A;  2NS0 A;  5FO5 A;  3HYI A;  3OYH A;  2KJC A;  2ZKZ A;  4IVN A;  3HPH A;  3BG6 A;  2ZJR F;  5BPD A;  3IWZ A;  4L9N A;  2JUG A;  3K7A J;  4B8X A;  4HA8 A;  4D5C A;  1BI3 A;  2MA3 A;  1D0Y A;  2BOL A;  4ICH A;  4PGH A;  1HA8 A;  1IJW C;  4PCQ A;  1DP3 A;  4NC8 A;  3E3V A;  4PGG A;  2R3S A;  3U21 A;  3MFK A;  3TW7 A;  5LD2 C;  1TC3 C;  3S2H J;  2UWM A;  3HTI A;  1MJB A;  1U2W A;  5E8G A;  1V5F A;  2YX4 A;  2XSJ C;  2R7T A;  1MZB A;  4PDK A;  4HX8 A;  2HPM A;  2JUC A;  2FSW A;  2L7Z A;  4AYB N;  1ZLK A;  2GEN A;  2EIM H;  2FOK A;  5D1R A;  4V19 K;  3BZ6 A;  3HHH A;  3JRH A;  4IHX A;  2KRF A;  2M8G X;  1UST A;  4AIJ A;  5HDN A;  2VBX A;  2W57 A;  4ZDL A;  4EEF G;  3VYT B;  1XN7 A;  1XMX A;  3B73 A;  4XMY A;  4IF4 A;  3V8K A;  3E7L A;  2ZCW A;  3E6B A;  1YX3 A;  2K86 A;  3LSJ A;  3WTS C;  2M45 A;  4XBF A;  2D45 A;  4HAM A;  5IYC J;  4KMU X;  1Z7U A;  4L9J A;  4QLC U;  1J09 A;  4PFO A;  4I2O A;  1H9T A;  3TGN A;  2A6E F;  2JQ7 A;  5LBQ A;  3QRF F;  2ZCN A;  2QZ8 A;  3AL0 B;  3BQZ A;  3TOB A;  2HOA A;  4MTE A;  1UCR A;  5M5X J;  3A01 A;  3MZH A;  2UXH A;  1F9N A;  4KJZ A;  2H1L A;  1KQ0 A;  5B5E C;  4OU0 A;  2EZH A;  5H6Q A;  1I3A A;  2F4I A;  1J7K A;  2OTJ I;  2ZY9 A;  3PIP F;  2Y30 A;  3H0D A;  2K9S A;  1I6X A;  4HPQ A;  3I56 I;  3VSL A;  2RVC A;  3TW6 A;  4CUG A;  4MFD A;  2D5V A;  3IUO A;  5FKK A;  2O61 A;  1N25 A;  5IPA A;  2WB1 N;  2L7K A;  4KIB A;  4NHJ A;  2XRO A;  4PFP A;  1D8K A;  3FXU A;  1SAX A;  1XD7 A;  3IAS 2;  1IAW A;  2F48 A;  2HS5 A;  4OIQ F;  4AD9 A;  1OQY A;  1Y8Q B;  2K7L A;  5ED4 A;  2AHQ A;  2HDD A;  5C4X J;  2WUI A;  4XLF A;  5FKN A;  2VLA A;  1MKM A; 
#chains in the Genus database with same CATH homology
 1JKO C;  3HKZ N;  1IRZ A;  9ANT A;  1FTT A;  4BXX J;  1CQT A;  5HAW A;  4XRS G;  5EGO A;  1GV5 A;  2ZOY A;  1H88 C;  1OJL A;  3BR1 A;  4FCY A;  2ME6 A;  2G7L A;  1U9O A;  2HKU A;  2IAI A;  3HTH A;  1ETX A;  1GT0 C;  1ETQ A;  2EH3 A;  1HDD C;  3HB9 A;  1Q1V A;  4I76 A;  3B6C A;  3BHQ A;  3IUV A;  4JNN A;  4V2G A;  1WCM J;  1G2H A;  4KWA A;  3FRQ A;  5EDN A;  1IDY A;  4UDS A;  4A3J J;  1OCP A;  2E19 A;  4A3C J;  1DU6 A;  5FMP A;  4A69 C;  3G1O A;  2XDN A;  4L62 A;  2XPW A;  4FE7 A;  1WH7 A;  1JKP C;  2K9N A;  3M3Y J;  2ECC A;  4DYQ A;  2JJ7 A;  4A93 J;  2L0K A;  2CUE A;  4CYC A;  3BTL A;  1ETK A;  3C07 A;  3IV5 A;  4YZE A;  5EFY A;  3UKG A;  2G0E A;  2K40 A;  4HNV A;  3BRU A;  2HQ5 A;  4JX5 A;  3GTG J;  3NI7 A;  3VVZ A;  5K7F A;  2JA5 J;  1IGN A;  1W0U A;  1JTY A;  2NVT J;  3Q0V A;  3JRB A;  1F36 A;  4GFB A;  2QWT A;  1JJ8 C;  3G1L A;  4ME9 A;  5C4J J;  2FD5 A;  3NNR A;  1HF0 A;  2CQX A;  2CQQ A;  2XGC A;  2LY9 A;  3DCF A;  4D7N A;  1XS9 A;  3ZOB A;  5C44 J;  2ECB A;  2QTQ A;  1D5Y A;  2LLK A;  1GUU A;  2DA7 A;  2GUH A;  4MK6 A;  3HOV J;  3F1B A;  3G56 A;  1RR7 A;  1Y1W J;  3PAS A;  5EG0 A;  2X6O A;  3KNW A;  4M3B A;  3PPB A;  1PUF B;  1IDZ A;  1QRY A;  3LSP A;  3S14 J;  2HYJ A;  3O8H A;  5C4Y A;  4IEJ A;  2QKO A;  1F43 A;  2HI3 A;  5DTD A;  1IG7 A;  3IH3 A;  2DA6 A;  3BTJ A;  2ZCM A;  2FBQ A;  2CUF A;  3LJL A;  5AQC A;  2E2I J;  3S1N J;  4A3L J;  2MSY A;  5F0H A;  2OF7 A;  5FGL A;  1GVD A;  4A3M J;  3LSG A;  5CW8 A;  4BBS J;  3JRD A;  2MGQ A;  5M3F J;  3O8G A;  2ID6 A;  5IP6 A;  2RAE A;  1B72 A;  2O7O A;  4JYK A;  2O7T A;  2PMZ N;  3BTC A;  3QQA A;  3HTA A;  4X1E A;  2DMT A;  2EQR A;  2FJ1 A;  2M0C A;  5FLM J;  2I10 A;  1MBH A;  2R5Z B;  3ANG A;  1WI3 A;  1ENH A;  1B8I A;  5C3E J;  2WAQ N;  3BCG A;  4BY1 J;  2DTZ A;  1QVU A;  2IU5 A;  3V6G A;  3WHC A;  2E2J J;  1OFC X;  2JK3 A;  2XB0 X;  3VIB A;  3Q3S A;  3HTJ A;  1AKH B;  2GM4 A;  2L7M P;  4Y7N J;  1QPI A;  5FJ8 J;  1ETY A;  3NXC A;  3CJD A;  1RKT A;  3JR9 A;  2OI8 A;  5JLW A;  3OOU A;  3VVY A;  3KZ9 A;  2R92 J;  4AC0 A;  4A3I J;  2DA3 A;  5K7H A;  1FIA A;  1T56 A;  2VPR A;  1NK2 P;  1YRN B;  2YUS A;  3BR6 A;  2NS7 A;  5EF6 A;  2VKE A;  1VI0 A;  3BQY A;  1BW6 A;  2ELK A;  4NDL A;  2YVE A;  2G7G A;  2NVY J;  1MBJ A;  3VPR A;  3D1N I;  1ZKG A;  3ZQF A;  2PBX A;  2Y2Z A;  5F04 A;  5JLX A;  3JRA A;  3CRJ A;  1IUF A;  2CJJ A;  3NPI A;  4UUS A;  5IOY A;  2NP5 A;  3AQS A;  1TWH J;  1ETO A;  2REK A;  2K9Q A;  3LSR A;  2DG8 A;  3GZI A;  2Y31 A;  3BJB A;  4J19 A;  1GV2 A;  2HYT A;  3BG9 A;  5H9T A;  2UXU A;  3FKI J;  3HGG A;  4QIW N;  3SJM A;  3RD3 A;  5K7Z A;  3RQI A;  5J1Y A;  2LR8 A;  4MFE A;  4B1R A;  1LE8 B;  3PM1 A;  4ABZ A;  1MSF C;  1ITY A;  4LOC A;  5IP7 J;  4NEL A;  5IP9 J;  1GDT A;  3G1M A;  1SFO J;  4PXI A;  2DA1 A;  2N8G A;  1VND A;  4C3I J;  1E3O C;  1Z77 A;  1JKR C;  1A5J A;  5EZG A;  2KT0 A;  4GFL A;  1UG2 A;  5HBU A;  1APL C;  1JTX A;  4AUX A;  1LFB A;  1AHD P;  3BR0 A;  2DMP A;  4DYC A;  3LNQ A;  4L5E A;  2EBI A;  4AF5 A;  3BR5 A;  5DAJ A;  1JUP A;  2QF7 A;  4JX4 A;  1JJ6 C;  3HOZ J;  2O8K A;  2TCT A;  5IYD J;  1EF4 A;  2XB5 A;  2ZB9 A;  3F0C A;  3HOY J;  3MKL A;  1WH5 A;  5DS9 A;  3JRF A;  2ID3 A;  5F27 A;  3ZQL A;  1BJZ A;  1I50 J;  2X48 A;  2XGE A;  4IHW A;  1FEX A;  4GCT A;  1VFC A;  3MN2 A;  4M3F A;  1TWF J;  4IHY A;  1UHS A;  3O60 A;  5D18 A;  5FKM A;  4RDU A;  2P81 A;  2Y0S N;  4JL3 A;  4DZP A;  3GTM J;  2HOS A;  3A01 B;  1MH3 A;  4IHV A;  1U78 A;  3HM5 A;  3JRE A;  5IYB J;  3TP3 A;  5E3N A;  3HE0 A;  3IH2 A;  3QPL A;  1Z0X A;  1RES A;  2LFB A;  2YU9 J;  5J1R A;  3HGY A;  1W0T A;  2NX4 A;  1ETW A;  5E3L A;  3B6A A;  4BBR J;  4D5F A;  3ANP A;  3DPJ A;  5CXI A;  3BR3 A;  1WPK A;  3I4N J;  2MW8 A;  1U8B A;  1NK3 P;  2M2E A;  2R0Q C;  1FIP A;  3S17 J;  3A03 A;  4Y52 J;  2ZOZ A;  1Y1V J;  3BNI A;  3LWJ A;  1SAN A;  3VP5 A;  1RPW A;  2DMN A;  2XRL A;  1ZQ3 P;  2W48 A;  2R5Y B;  2F07 A;  3SFI A;  4BKX A;  2HXI A;  5D19 A;  4XRM A;  5F0C A;  3OSF A;  2Y9Z A;  2UXO A;  3Q0U A;  4M3D A;  4QSH A;  4B3A A;  2EZI A;  1O4X A;  5M3M J;  1DU0 A;  3IH4 A;  5E3M A;  3HEF A;  2RAS A;  3VUQ A;  5EEA A;  1IC8 A;  1A6I A;  5EGO B;  4A3D J;  1UMQ A;  1MSE C;  1JKQ C;  5HSZ A;  3B81 A;  2DA4 A;  2WGB A;  2XPU A;  2QIB A;  3K2A A;  4W97 A;  3GBG A;  3ZQI A;  2L7F P;  3E7Q A;  1XG1 A;  2HXO A;  2XGD A;  1MBG A;  2YS9 A;  4ACI A;  1ZGW A;  2UXP A;  5M5W J;  4A3K J;  1POG A;  1H8A C;  3G7R A;  3VVX A;  3S5R A;  2G7S A;  3SDG A;  5F0F A;  4HKU A;  1X2M A;  5J1U A;  4FTH A;  3P9T A;  3VW1 A;  4XIC A;  2VUM J;  2DG7 A;  3GTL J;  3VW0 A;  2DN0 A;  1UI6 A;  3NAR A;  4C3H J;  3OIO A;  3QPS A;  4MIM A;  3EGQ A;  3BG3 A;  3FIS A;  3T6N A;  2EZL A;  1BW5 A;  3NAU A;  4M3G A;  1ZR2 A;  2LTP A;  4X6A J;  3ON2 A;  1ETV A;  4MLO A;  1IV6 A;  1FJL A;  2DJN A;  2IBD A;  2X9D A;  3HIM A;  4JKZ A;  4M3E A;  3WHB A;  1NTC A;  3JSJ A;  4GCL A;  1U9N A;  3JRC A;  5EYR A;  2WV1 A;  5F1J A;  2CRG A;  4CYC B;  5E3O A;  5FKO A;  1HCR A;  2O9L A;  2G3B A;  1PUF A;  2DMU A;  2VKV A;  3MVP A;  3M4O J;  2R93 J;  2M9H A;  1HDP A;  4D7M A;  4V2F A;  3BT9 A;  1UI5 A;  4QTR A;  3C2B A;  1MBE A;  3LOC A;  3PO3 J;  3QBM A;  4NN1 A;  1TWG J;  3COL A;  2KDZ A;  1FTZ A;  2D6Y A;  2OER A;  2Y9Y A;  1MBF A;  5GPC A;  1H89 C;  1T33 A;  3S2D J;  3ON4 A;  2QOP A;  2ZCX A;  3BTI A;  2DMQ A;  2AO9 A;  3ZQH A;  5F08 A;  5HOD A;  1RKW A;  5M5Y J;  2JA7 J;  4A3E J;  4S0H B;  1QVT A;  2GBY A;  3VW2 A;  3GTJ J;  2IEK A;  3CWR A;  3BR2 A;  2R5Z A;  2QCO A;  3FK7 A;  5IOZ A;  4C2M J;  3L1P A;  3S1R J;  3RH2 A;  3BG5 A;  3VOX A;  3CMY A;  3JRI A;  3RZO J;  2EZK A;  4UUT A;  2M34 A;  1OCT C;  1I6H J;  3W6V A;  1ZTR A;  2Q24 A;  4DZJ A;  1AKH A;  3H0G J;  5EG0 B;  4BY7 J;  1JUM A;  2DA2 A;  5FHP A;  2DA5 A;  3S1Q J;  2MG4 A;  3NRG A;  2E1O A;  3I4M J;  2RHA A;  3HBL A;  1YRN A;  3HOU J;  1X58 A;  1JUS A;  3MNL A;  2NOG A;  4RBO A;  3JRG A;  1P7J A;  5EZH A;  1MH4 A;  3Q0W A;  2TRT A;  2JA8 J;  2LP0 A;  3QKX A;  1K61 A;  5FLV A;  3H3V K;  1VF9 A;  1RET A;  2OPT A;  4B4C A;  3K7A J;  1B72 B;  4D5C A;  1P7I A;  3GEU A;  2LK2 A;  4ICH A;  2NVQ J;  1S7E A;  1JT6 A;  1IJW C;  4DYR A;  4XID A;  1BA5 A;  1B8I B;  2L9R A;  2H8R A;  3GTO J;  3HOW J;  3HTI A;  3TW7 A;  2NVX J;  1TC3 C;  3S2H J;  2GFN A;  3GTK J;  4GCK A;  3TED A;  1ZK8 A;  3HOX J;  2PZ9 A;  1BL0 A;  3CCY A;  2L7Z A;  4AYB N;  1LE8 A;  3S16 J;  3FIW A;  2JN6 A;  2GEN A;  4I6Z A;  1LFU P;  2ME0 A;  1JT0 A;  2YVH A;  5D1R A;  1ZR4 A;  2HOT A;  2XSD C;  3JRH A;  3OSG A;  2E2H J;  4M6V A;  4MXM A;  3CQZ J;  1MNM C;  1MBK A;  4IHX A;  3TP0 A;  1WGX A;  2M8G X;  1TWA J;  3GTP J;  1XC5 A;  3RKQ A;  4EEF G;  3AQT A;  3KKD A;  2NS8 A;  2B63 J;  1X2N A;  1ORK A;  4G12 A;  3GTQ J;  3CDL A;  3E7L A;  4W1U A;  2LKX A;  3LSJ A;  4XK4 A;  2JWT A;  4FE4 A;  4UUS B;  5IYC J;  2FX0 A;  3KKC A;  1HOM A;  2VI6 A;  5GP9 A;  1I3Q J;  2R7Z J;  2V57 A;  2NP3 A;  2W53 A;  3ZQG A;  2ZCN A;  3DEW A;  3LHQ A;  3BQZ A;  2HOA A;  1R9T J;  2LD5 A;  5GPA A;  3VOK A;  5M5X J;  3A01 A;  4CGR A;  2GLO A;  1TWC J;  4A3F J;  2UXH A;  4A3B J;  1SGM A;  1K83 J;  3FK6 A;  5FKL A;  3V78 A;  3A02 A;  4DW6 A;  3PO2 J;  2EZH A;  3S1M J;  2Y30 A;  4JX6 A;  2K9S A;  1JGG A;  3EUP A;  4AC6 A;  4C3J J;  2JMW A;  1AU7 A;  4A3G J;  4JP0 A;  4FIS A;  2H1K A;  2XPV A;  3TW6 A;  4MFD A;  2D5V A;  3ZQC A;  2COB A;  5FKK A;  2CU7 A;  5J3L A;  5BNG A;  5IPA A;  2WB1 N;  2R5Y A;  3RZD J;  3S15 J;  2LVS A;  5CXG A;  1HLV A;  4GFK A;  4XRS A;  5C4X J;  2HDD A;  2JA6 J;  2AHQ A;  2UXI A;  2WUI A;  5K58 A;  2FQ4 A;  3HDD A;  5FKN A;  4MO7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...