3IH3A

Tm1030 crystallized at 310k
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
202
structure length
202
Chain Sequence
GHMLSKRDAILKAAVEVFGKKGYDRATTDEIAEKAGVAKGLIFHYFKNKEELYYQAYMSVTEKLQKEFENFLMKNRNRDIFDFMERWIEKKLEYSASHPEEADFLITLVSVDEGLRKRILLDLEKSQRVFFDFVREKLKDLDLAEDVTEEIALKFLMWFFSGFEEVYLRTYQGKPELLKRDMNTLVEEVKVMLRILKKGMTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Transcriptional regulator, TetR family
publication title 'Hot' macromolecular crystals.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 70
structure length 202
sequence length 202
ec nomenclature
pdb deposition date 2009-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3ih3A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3ih3A02
1MBHA 3F0CA 2EZKA 5IOZA 2R5YA 3HEFA 2XPVA 3O8GA 2H1KA 1U9OA 3A02A 3EGQA 1W0TA 1ETYA 3JRBA 2PZ9A 1BA5A 1MH3A 2GBYA 4I6ZA 4A3FJ 4NN1A 2L9RA 2R0QC 4UDSA 5DAJA 1IDYA 2ELKA 3BTIA 4I76A 5EG0B 1JJ8C 3HOVJ 3NI7A 2Y2ZA 3BQZA 1ETWA 4CYCA 5D18A 3GTMJ 4IHWA 2NVQJ 4GCLA 1WH5A 5IP6A 4B4CA 1ZK8A 1ETXA 2EQRA 1RKWA 1Q1VA 2ZOZA 2B63J 3L1PA 3GTPJ 2X9DA 4JX4A 2YUSA 5C4YA 2XGCA 1K83J 3LJLA 2DMPA 4W97A 2HYJA 2YVEA 3P9TA 4JX6A 2Q24A 4X1EA 3KKDA 3TEDA 2HQ5A 3TW6A 5M3FJ 1E3OC 3B6CA 4UUSB 1MBFA 5EF6A 3GTKJ 1IG7A 2HXIA 2R7ZJ 5JLXA 2RHAA 1B8IB 2N8GA 4GFKA 3G56A 1JKPC 1CQTA 1MNMC 2KT0A 3G1OA 2O7TA 2DMUA 1GV5A 2HKUA 4MFDA 3GTGJ 4L5EA 3A01B 3ANPA 1X58A 1TC3C 3S14J 2AHQA 1VI0A 4MLOA 1TWFJ 3EUPA 3BG9A 5HODA 4A3IJ 3BJBA 3PO2J 1F43A 4PXIA 2VKEA 2X48A 4AC6A 2FBQA 4IEJA 2JK3A 3JRCA 4J19A 1H88C 1I6HJ 3RH2A 2DA3A 3KKCA 3CRJA 3SDGA 1H89C 2IEKA 2ID3A 3E7LA 3OSFA 1Z77A 2DA7A 2EZLA 2FD5A 1DU6A 1T56A 3HOZJ 3S5RA 1BJZA 2WAQN 2PBXA 4FISA 4DW6A 3HKZN 4JYKA 5F0CA 5C44J 2JA8J 1F36A 3MN2A 3PO3J 3BNIA 1RESA 1PUFA 1LFBA 2DA5A 1LE8B 5FKNA 4A3KJ 1HDDC 3CQZJ 3Q3SA 5BNGA 2LY9A 4JX5A 3VW2A 3WHCA 5IOYA 2RASA 1JUSA 2LD5A 4MIMA 3HTIA 3BTJA 4FE7A 4A3JJ 2JMWA 1ZR2A 3ZQIA 3LSRA 4BXXJ 2XDNA 3OSGA 2ME0A 5IYCJ 4A3BJ 2L7FP 2NP3A 4ABZA 3BG3A 2JN6A 1JUMA 3VVYA 2DA6A 4IHXA 4XRSA 5C4XJ 1RKTA 3HOXJ 5IP7J 2K9NA 5IP9J 5CXIA 2E1OA 1OJLA 4XIDA 3IV5A 1POGA 1QVTA 5FLVA 5EGOA 2MSYA 1BW6A 5J1RA 1U9NA 3S1RJ 5HAWA 1NK2P 4B1RA 2DN0A 1XG1A 3VUQA 1VFCA 2ECBA 2DG8A 1MBKA 3O8HA 2XB5A 3JRDA 2E19A 2R5YB 2CUEA 2G7GA 3IH4A 2DA4A 3JRGA 3BHQA 2JJ7A 2RAEA 4FCYA 1FIPA 3ON4A 1S7EA 1NK3P 1I3QJ 5EDNA 3D1NI 3ZQGA 3IUVA 3ZQFA 2DA2A 3BR0A 4CYCB 4XRMA 4DYQA 4QTRA 1HCRA 5EZHA 3O60A 4BBSJ 1MBEA 5H9TA 5FMPA 3E7QA 4HNVA 4M3EA 2QTQA 2AO9A 1UMQA 2XPUA 3DPJA 3NAUA 4NDLA 2CRGA 3LHQA 5F1JA 3JRIA 3HOUJ 5JLWA 2G3BA 1BL0A 2R5ZA 2CU7A 2DMNA 2NS8A 2LR8A 2CQQA 4D5CA 3VW1A 2ZOYA 3QPLA 4ME9A 4A69C 1H8AC 3GEUA 1IC8A 2W48A 3S1NJ 1ZQ3P 3FISA 3RZOJ 3GTOJ 4XICA 2OF7A 3AQTA 5D1RA 3COLA 1QVUA 2VKVA 2M34A 2DG7A 2G0EA 1K61A 3JSJA 1I50J 2ECCA 4D7MA 2VI6A 1O4XA 4FE4A 2LK2A 1MH4A 1MSFC 1QPIA 1SANA 3OOUA 1FTTA 3JRFA 2UXIA 5J1UA 4V2FA 1MBGA 4UUTA 3MVPA 1JT6A 2Y0SN 3PM1A 5C4JJ 1XS9A 2GM4A 2K9QA 2FQ4A 2IBDA 1GDTA 1UHSA 4A93J 3GTLJ 4Y52J 3GZIA 3DCFA 5FGLA 3TP0A 2UXUA 2QCOA 1MSEC 1FEXA 3ZQCA 1JTXA 2GENA 2ZB9A 5FKMA 5J1YA 9ANTA 4C2MJ 1GV2A 4MK6A 3S17J 1WH7A 2DA1A 4RBOA 1ORKA 3BRUA 1U78A 3CJDA 4X6AJ 3VOXA 2OPTA 5HBUA 4C3IJ 5C3EJ 2K40A 1W0UA 4QSHA 1ITYA 2GUHA 2NX4A 1OFCX 2XGDA 1D5YA 3K2AA 4BY7J 2HOSA 4IHVA 5F0HA 1IV6A 2MG4A 1ZKGA 2L0KA 2HXOA 5IPAA 4GFBA 2NP5A 4JL3A 1UI6A 3IH2A 5FKLA 4GCTA 1JKRC 2OERA 1AHDP 5K58A 2YS9A 1HOMA 5EGOB 3HTJA 3QPSA 3VOKA 2LTPA 3JRAA 3CCYA 3S15J 3CWRA 4AF5A 2XGEA 2NOGA 3ANGA 2EZIA 3CMYA 1IRZA 4DYCA 2VPRA 1A5JA 1GVDA 1ZTRA 1JUPA 5F0FA 5K7HA 2TRTA 2CUFA 2X6OA 3RQIA 1BW5A 3S2HJ 1YRNB 3S16J 2XB0X 1RPWA 4M3DA 2HOTA 2JA7J 2OI8A 3BG5A 2NVYJ 2UXPA 5J3LA 3VP5A 1ETOA 1B72A 1P7IA 1OCTC 2HI3A 3FRQA 3VVZA 5EEAA 1X2NA 1APLC 4QIWN 2MGQA 1TWAJ 2K9SA 3NXCA 3VIBA 1LE8A 1XC5A 2L7MP 2UXHA 2E2HJ 3FKIJ 1GUUA 4L62A 4D5FA 1TWCJ 3BR5A 3HGYA 2WV1A 4CGRA 2VUMJ 4A3LJ 1T33A 4DZJA 5IYDJ 4A3EJ 2R5ZB 3FIWA 2O9LA 2NS7A 2GFNA 1ETVA 2MW8A 3F1BA 1LFUP 3QBMA 5EFYA 3A03A 1OCPA 2WB1N 1AKHA 2H8RA 1HLVA 3CDLA 1IDZA 3ON2A 5F04A 3I4MJ 1JKQC 5IYBJ 1U8BA 3HIMA 3BCGA 2WGBA 3MNLA 1QRYA 2M9HA 3QKXA 4A3GJ 2R93J 2Y9ZA 3AQSA 2QWTA 5E3NA 5M5WJ 3LOCA 1FTZA 1P7JA 1Y1WJ 4B3AA 1JKOC 3S2DJ 5EYRA 3QQAA 2JA6J 2I10A 4BBRJ 3BTCA 5K7FA 3HOYJ 1FIAA 4DYRA 4MO7A 2LP0A 5HSZA 4BY1J 3MKLA 4GFLA 5FKOA 3JRHA 2E2IJ 3LNQA 1IGNA 4IHYA 2ZCXA 4GCKA 3JR9A 2Y30A 2ME6A 3TW7A 4JP0A 4C3HJ 1X2MA 3PPBA 2IU5A 1AU7A 3HOWJ 1TWHJ 3K7AJ 3VPRA 1ZGWA 3PASA 3HB9A 2XSDC 3Q0VA 1ZR4A 1SGMA 3S1MJ 2LFBA 5E3OA 4MXMA 1RETA 3HBLA 1ETKA 3W6VA 3DEWA 5E3MA 2HYTA 5F08A 5FLMJ 1ENHA 1UG2A 3ZQLA 2W53A 1G2HA 1A6IA 3UKGA 5CXGA 5EG0A 2QIBA 5M5YJ 4NELA 2XPWA 3LSPA 2F07A 2DTZA 3BR2A 1WI3A 4FTHA 1PUFB 3M4OJ 3BQYA 3B6AA 3C2BA 1JJ6C 3T6NA 1Y1VJ 2Y31A 4ICHA 4XRSG 2COBA 2GLOA 5E3LA 1WCMJ 3HE0A 1JTYA 1NTCA 4M3BA 4A3CJ 3TP3A 1EF4A 3S1QJ 4KWAA 3VW0A 2UXOA 3H0GJ 3KNWA 4AC0A 4W1UA 1TWGJ 4BKXA 3JREA 2Y9YA 4C3JJ 2O8KA 2HOAA 2FJ1A 4UUSA 2ZCNA 3NPIA 3BR6A 1VF9A 3Q0UA 5M5XJ 1B8IA 4G12A 3HGGA 1RR7A 2QOPA 4M6VA 1IJWC 1JGGA 2YU9J 3Q0WA 5DTDA 3ZOBA 3SFIA 4M3FA 3A01A 2M0CA 2QF7A 1GT0C 2REKA 2KDZA 2R92J 3RD3A 2XRLA 1B72B 2D6YA 1HDPA 5EZGA 2P81A 1Z0XA 1MBJA 3HM5A 3FK7A 3SJMA 1R9TJ 4JKZA 1JT0A 3HTHA 3G1LA 2ZCMA 4S0HB 5CW8A 1FJLA 2HDDA 3M3YJ 3V78A 3BR3A 4AYBN 5DS9A 2CQXA 3LWJA 4AUXA 2JWTA 4A3MJ 3H3VK 3GTQJ 3OIOA 5GP9A 2M8GX 2D5VA 3RZDJ 2EH3A 3HDDA 3WHBA 2PMZN 2QKOA 1ETQA 3BR1A 4V2GA 5AQCA 4A3DJ 3BT9A 5F27A 2O7OA 4D7NA 2LLKA 1SFOJ 3G7RA 3NNRA 4RDUA 1AKHB 3VVXA 1WPKA 2EBIA 3C07A 3HTAA 5D19A 4LOCA 2E2JJ 2M2EA 2ID6A 5FKKA 2DMTA 5FHPA 4M3GA 4YZEA 1UI5A 4EEFG 3IH3A 2NVXJ 3B81A 3G1MA 2JA5J 3NARA 4ACIA 4DZPA 2YVHA 2NVTJ 3LSGA 4MFEA 1VNDA 3GBGA 2EZHA 2LKXA 1YRNA 5M3MJ 1DU0A 2WUIA 3LSJA 2V57A 3I4NJ 2DJNA 3GTJJ 2IAIA 2G7LA 4XK4A 1HF0A 3FK6A 1WGXA 2DMQA 5FJ8J 4JNNA 3KZ9A 4Y7NJ 4HKUA 2L7ZA 2LVSA 3ZQHA 2TCTA 3BTLA 3V6GA 5GPAA 5GPCA 1IUFA 2G7SA 5K7ZA 3NRGA 2CJJA 3RKQA 2FX0A
chains in the Genus database with same CATH superfamily
1MBHA 2Y69H 1LDJA 1G3SA 4YG2F 2XAUA 5ICFA 2XPVA 4BHBA 1X19A 2CWEA 3EGQA 1W0TA 2AXTC 4XLNF 1P92A 3JRBA 2DFEA 3LQRA 2NVUB 4II2A 4EM0B 5HNHA 4YIRX 1R22A 1XGOA 4I6ZA 4NN1A 2FNPA 1WJ5A 2GOMA 2LKPA 3BTIA 2ADUA 4YFXF 3HOVJ 4XLHA 5E1ZB 2DPDA 3NI7A 4EV0A 2CV2A 1HKSA 4ZYGA 5B5EC 3FM3A 3M8FA 2OQGA 2NVQJ 2UUZA 1ZK8A 5ICEA 1R4NB 1RKWA 3FXOA 4ENNA 2B63J 3ROUA 1D8KA 4ESFA 3OR1C 4JX4A 4QPOA 1AA7A 3NRVA 1WWXA 2DMPA 3P9TA 4JX6A 4EJWA 1BOBA 2DO7A 2ZNYA 3U21A 3G73A 3HOSA 5M3FJ 2Q24A 3KKDA 5GAHJ 3OMYA 1X3ZB 1NHAA 1TNSA 2EV5A 2RHAA 4PJNA 3BDDA 4UVBA 1MNMC 2LF7A 2A69F 2O7TA 1GV5A 1K6YA 2VQCA 2K9LA 3J80Z 5L3EA 2QQ9A 5JHFA 5J6XA 1H9TA 3PUFA 1IUYA 2Y75A 2KISA 2HFHA 1XB4A 4RAFA 4PXIA 3OV8A 3BCAA 4IEJA 3GFMA 4CCJA 2XUBA 1B4AA 3UR3C 1WJFA 3G2BA 3CC7I 2PFBA 4PSWA 5D6FA 3CCMI 2STTA 1J2XA 4BE1A 1F1ZA 2EZLA 4WWCA 1T56A 2DBBA 3S5RA 2XASA 3VWBA 3WTVC 4DW6A 3HKZN 2QBYB 2ISZA 3CJNA 1YJNI 1FBSA 1S7AA 2DA5A 5D8LB 1CGPA 3G6EI 2A61A 3J80K 3SYTA 2KIQA 3LL7A 1JUSA 4LB5A 5CQEA 4A3JJ 2PI0A 3BC8A 5D5VB 2R7TA 4I02A 3E5QA 4ABZA 3I71A 3BG3A 3QU3A 3FWEA 1JUMA 3FMRA 3CCQI 5C4XJ 4NC7A 3OYJA 5IP9J 1OLTA 2L4MA 2Y0SA 2DTRA 1XGNA 3BP8A 1YIJI 1WQ2A 1S5LC 3HSRA 4IVNA 5TISC 4KICA 3OYDA 4RM2A 3S1RJ 4Y3OA 2HZTA 2WTEA 3BZKA 4RB0A 4XN0A 2Z99A 4HF0A 5LEKA 3O8HA 2F4MB 4RGUA 2E19A 1QQIA 4CCMA 3FXKA 2R7FA 3WTXC 1UG0A 3MEXA 1ZGJA 2DA4A 1T95A 1V5FA 1XPXA 2JJ7A 3TQNA 3ZPLA 5DCFA 2V26A 3SZPA 4IOAF 3JAMZ 3W3CA 2WA0A 1R1VA 4DOZA 3OYHA 1FX7A 4XRMA 3CO6C 4Y4RA 2QQBA 2HR3A 1V5GA 2DT5A 2R7DA 4H4KC 1IRFA 2AO9A 2QENA 4N9IA 1YITI 3NAUA 4NDLA 4OU0A 4DNCA 2FOKA 4XR6A 4R1HA 3KEQA 1BL0A 2R5ZA 1NG7A 2ZKZA 3EUKL 4GGGA 1PVEA 2CUZA 3OY9A 4MEXF 4LIVA 3ISPA 4C30A 4A69C 2H8WA 5H6QA 1S3JA 3KFWX 2OC6A 4BQAA 2ZFUA 2W48A 2ZFWA 2V9PA 3FBNB 4IRGA 2W1OA 4OINF 3OIPA 1ZQ3P 2WY7Q 3FISA 5ILVA 3AQTA 2JUGA 4CCLA 2DG7A 4KIBA 3RDIA 5L3GA 3OYMA 1I50J 3W2AA 1IRGA 1WJAA 1Q1HA 2VI6A 3JAMK 2O3FA 3S2WA 3EPZA 2M4GA 4U88A 3OOUA 3GLLA 2UXIA 2JVGA 3I64A 4E7IA 1XSXA 2OU2A 1R36A 2OZ6A 3DF8A 1OCRH 3PM1A 4IXAA 1TT0A 2FMLA 2K9QA 3FDYA 5CQGA 3GTLJ 1WJCA 3GVAA 4XM3A 1XMKA 1VZ0A 5FGLA 3TP0A 2WV0A 3A0BC 1KYZA 3ZQCA 1VQLI 2VN2A 1VQMI 1EKEA 4LJZF 2GXBA 1X1AA 2GENA 4FASD 1QZZA 3T8RA 2XROA 4C2MJ 1GV2A 4MK6A 3S17J 2K85A 4A2UA 2DA1A 3E1SA 4RBOA 3F8MA 3CJDA 5FGMA 4X6AJ 5HBUA 4CGZA 2EJRA 3OR2C 2M8EA 4IO9F 1W0UA 4QSHA 1SFUA 1ZRDA 2QQ8A 2F5VA 3I53A 2WAEA 2B1EA 1MDMA 2JRTA 1W5CC 1MKMA 3CCEI 2MG4A 5IPAA 5FO5A 5CVVA 4C9YA 3ZGKA 3ZMSA 3OS1A 4JL3A 3IH2A 2XDVA 4OIQF 1AHDP 3PIPF 3ASNH 2K4BA 2YS9A 1HOMA 4RA2A 1KU2A 1G3WA 2LTPA 2ZJQF 1Z3XA 1YW7A 4QPQA 3CWRA 4AF5A 2OA4A 3WU0A 2EZIA 1K4TA 2IS4A 4RLFA 4DYCA 1L0OC 1JUPA 5K7HA 2TRTA 2VC0A 4XQFA 2PG4A 5EJCA 2HOTA 2JA7J 4UY8I 5J40A 3BG5A 2A68F 2UXPA 3FM5A 3ZN1A 2MFZA 1KU9A 4F52A 1BIAA 3CD6I 4B3XA 1Z1DA 1X2NA 4XBFA 3U2RA 3WTYC 4HNUA 4KYWA 2MGQA 1IN4A 4L5JA 3F8NA 2F4OB 4BUPA 3FXQA 1LE8A 1XC5A 2JPCA 2L7MP 1JI8A 4BQOA 3FKIJ 2UXHA 4ESJA 3J81Z 1GUUA 1QHGA 3BR5A 2IW5A 4UUVA 1TBXA 2WV1A 4CGRA 2JUCA 2B9SA 2GQQA 5E79C 4Z6YA 2IGKA 2RNJA 2MABA 5E18F 3GYHX 4KNYA 4Y15A 2W24A 1P4WA 2R5ZB 5HS7A 3FIWA 5AIQA 1ZGAA 1K79A 1I3AA 3J7AO 1LFUP 5EFYA 1T2KA 1OQYA 4YEJA 4WXCA 1OCPA 2WB1N 4I98B 1QZEA 4G6QA 2I8DA 3ON2A 1I1SA 2F6CA 1K78A 2HYGD 5LHGA 3I4MJ 2YR2A 3D5LA 5DYMA 5BQTA 4BACA 3SHFA 3VDXA 3HIMA 3BCGA 1FMVA 2RQPA 2WGBA 4GRIA 1BBYA 4MQ9F 3FXMA 1DDNA 2PLYA 4IKFA 3I58A 5M5WJ 4HLXA 2PX9A 1HBXG 2CW8A 1YS6A 1Y1WJ 1KQ8A 4B3AA 4DIQA 3J81K 5EYRA 3QQAA 2VJIA 3FX3A 2CO5A 2LP0A 1OCOH 4KISA 2ZXIA 2E2IJ 4IHYA 1FLIA 2OUMA 2AQFA 3KP7A 4UB8C 4GCKA 3E0JB 2Y30A 3I59A 4C3HJ 3PPBA 2IU5A 3CF5F 1ZAOA 3C3WA 3AG2H 3C2HA 3HB9A 3Q0VA 3S1MJ 3DKYA 3RTRA 3W2VA 1TQMA 3HSFA 4U7BA 4MXMA 1SD6A 2A2FX 2MD0A 2MH2A 1Z67A 5E3MA 4ZJZA 5F08A 1UG2A 4YELA 4BXUA 3ZMZA 4EVIA 1KU3A 2QM3A 1MDMB 1LPQA 4U9LA 3LSPA 2Z2SB 5DUKA 3TDZC 1V55H 3ZN0A 3M4OJ 3B6AA 1JJ6C 4LK0F 4RAZA 1P4AA 1YE9A 2KIFA 1W1WE 4PZJA 1V3FA 5FFZA 3TP3A 4BNCA 2W00A 3OL3A 1ZRFA 3H0GJ 3KNWA 2CSOA 2IA0A 4KFCA 4BKXA 2E34A 2ZNZA 3VTIA 2QZ8A 3BR6A 4ANJA 3NPIA 4JBAA 3Q0UA 2PMUA 1B8IA 2QOPA 3DPLC 2OQRA 1IJWC 2QSGX 2YU9J 3BOQA 3Q0WA 2E1MB 4HV5A 3A01A 1GT0C 2EV6A 2F4IA 1RUNA 1S29A 3VYUB 4G7ZF 4OMYA 2M3AA 2OD5A 4BEHA 5HS8A 2EA2A 3BG7A 5L3BA 2VODA 2FQ3A 1HDPA 5EZGA 2O61A 4HW0A 1IRXA 4F55A 2A6EF 3HM5A 4EJOA 1B1BA 1IW7F 2FE3A 1B59A 3GFJA 1CF7A 3G1LA 3LWFA 1VQ9I 4S0HB 2F5FA 1FJLA 2HDDA 3M3YJ 5DS9A 2CQXA 1LFPA 4ZH4F 3WTTC 3H0DA 3H3VK 3GTQJ 3LWJA 3OIOA 1R5HA 3LAPA 3GF2A 1BR1A 4Y17A 2QUFA 1J0RA 1SD4A 3P9IA 3K4LA 1TZLA 2DYRH 3BR1A 4L9TA 4P96A 1IAWA 1MMNA 4PGHA 1J9IA 1SD5A 4QLCU 3NNRA 3VVXA 3WTWC 2V9VA 4ZZDA 1WKMA 3MMYB 4LOCA 4CA0A 3HXLA 3IWFA 3WTZA 1K78B 1ON2A 2M2EA 2E2JJ 1HKQA 2BY2A 3GEZA 3KP2A 1UI5A 1XSVA 3DBLB 1H9GA 3OWTA 2X4HA 3WTUC 3L9FA 3I3LA 4XKCA 1UHMA 4MFEA 1W7PD 3CP2A 2EZHA 3GBGA 2LC2A 5M3MJ 1DUXC 1YRNA 3LSJA 4OIRF 2Q8KA 4P9FA 3GTJJ 1FWZA 2DMQA 5FJ8J 4JNNA 2ICWG 1FOWA 4GYGA 3KP3A 3BTLA 4M9ZA 4K2EA 4PK4A 4HF2A 2G7SA 3NRGA 3I59B 1D8JA 3HKZA 2FX0A 3F0CA 4HNTA 3J7YJ 3IAS2 2BGCA 3F72A 2H1KA 1U9OA 5B1BH 1AOYA 4HQMA 3A02A 1WFXA 5CVUA 4AVZA 5H6RA 1BA5A 2GBYA 2O8XA 1F9NA 4UNOA 5DAJA 4LG3A 1IV8A 1JJ8C 1LJ9A 3M8JA 3PFYA 2Y2ZA 2GXGA 2CW0F 4L9NA 4CYCA 3GTMJ 4IHWA 2DOEA 3A0HC 2UXXA 5IP6A 1FY7A 2K3PA 3CMMA 4BJ5C 1KQ0A 2AQEA 3HYIA 2WADA 3SEZA 4B4CA 4OIOF 2EQRA 2ZOZA 1UZCA 5C4YA 2XGCA 2L9VA 2HYJA 2C6YA 1E17A 2YVEA 2CMPA 2DODA 2KRCA 2BHZA 3ONQA 4X1EA 4XSXF 2W7NA 4PJ0C 4BE0A 2BYVE 1E3OC 1BC7C 3B6CA 1J09A 2HQAA 3ZXSA 2YX7A 2HXIA 1PYVA 5JLXA 1OMIA 1B8IB 3JW4A 2N8GA 3W6JB 5BS6A 1CQTA 5EEHA 2ZSIB 2R3SA 3G1OA 2KMUA 4TV7A 1X3UA 2HKUA 2K4JA 4MFDA 2VC1A 3MQ0A 5D5XB 3A01B 3ANPA 2X6XA 1YX5A 2PQ8A 3WG7H 5HLHA 1MW7A 4G94A 4WK8F 1KGSA 1HC8A 3EUPA 4A3IJ 3BJBA 1XCBA 2L2OA 1F43A 1FPQA 2EINH 4RB2C 2EK5A 1WHUA 4OMZA 4PJJA 2MC3A 4XLFA 1CF7B 2JK3A 2V6EA 3JRCA 4KN4X 4J19A 1I6HJ 2R7UA 1IZ1A 2DA3A 3KKCA 3ZR8X 1ULYA 3SDGA 4E7LA 1H89C 5HLTA 3HTSB 2VOOA 2IEKA 2ID3A 2M7BA 4NQWA 1DU6A 4HAMA 3HSEA 3F3XA 5LFAA 2K02A 1F36A 1ACIA 2OZUA 4PFOA 3CP8A 1BI1A 1LFBA 3WE3A 3K4BA 2PMHA 2WBMA 1LEAA 4A3KJ 2ESHA 1HDDC 2DLLA 5BNGA 3HG9A 2IT0A 3BPXA 2FU4A 4HYEA 2RASA 4MIMA 4FE7A 1ZR2A 1RUOA 2P7CB 2LYCA 1R58A 4NHJA 4LFUA 4PDKA 3ESWB 4RAYA 3IHUA 5H2FC 2NP3A 2RN7A 4HF1A 2JN6A 2HNHA 2HKXA 3F6VA 1MJ9A 3KE2A 3E6CC 1IN5A 1OYIA 2DA6A 3DKWA 2ZY9A 3VSKA 4UV9A 1K4SA 1RKTA 3QOEA 1OJLA 4CSWA 1POGA 4II3A 5FLVA 1DP7P 1GXPA 3OL4A 5FD6A 1S9HA 1OR7C 3V42A 1FC3A 4EMSA 3LSTA 2QA4I 4D9JA 1XG1A 3KIOA 3VUQA 2F48A 2JT1A 1P6RA 1X1PA 4N0BA 1OCZH 2KRHA 2BEOA 2G7GA 2ZXJA 1VQKI 2B7EA 4IX7A 2UWMA 2RAEA 3VFZA 3ON4A 1BIBA 5DCMB 5EDNA 3ZQGA 2FBIA 3BJOA 3BR0A 1N77A 3M8EA 4CYCB 1HKTA 4DYQA 4QTRA 3O60A 2EFWA 1MBEA 3CJQB 2KLOA 1O3TA 3HRUA 2HQRA 1R1UA 5F64A 2QTQA 2CH0A 2XPUA 1UMQA 3NS4A 3V7SA 5L3FA 2H6BA 3GLXA 4IQ4A 2CV0A 2W84A 4XOTA 3HOUJ 1Z91A 1SFEA 2Y0MA 3CMAI 2BOLA 4L18B 2CU7A 2DMNA 1YQAA 3F8BA 3FXUA 2ZOYA 2KDOA 1WZ2A 1LB2A 1SC7A 4E4HA 4AD9A 2XC7A 1YW8A 1IC8A 5FROA 4HSRA 4CCKA 2W85A 4BDYA 3EYIA 3S1NJ 2XAQA 3PIOF 5BPIA 4A0YA 2OF7A 1EH6A 3LAJA 5D1RA 1QVUA 2M34A 2HOEA 2LREA 3OYBA 2EIJH 1O4XA 1QPIA 4XLPF 1TNTA 1W4MA 4MGRA 2PJRA 2RC4A 1TP4A 1FP2A 2G9WA 3C1DA 1FTTA 4Y13A 3V7CA 4F91B 2X0LA 3JRFA 4V2FA 1MBGA 1JT6A 4U7DA 2GM4A 3AG3H 2IBDA 3GFLA 2LY1A 4A93J 2E35A 3FMQA 3GZIA 2DAOA 1A31A 2HYFA 1ERDA 2COMA 3DCFA 3CCSI 4NQWB 1SEUA 2A3SA 1U5TA 1R71A 1FEXA 4O6JA 1ONVA 1E2XA 4ZYAA 3DBRB 4FX4A 5H20A 2ZB9A 1KA8A 1TW3A 4MQVA 9ANTA 1R6RA 4XLEA 4CZCA 2VPLA 1D3YA 1R5ID 1UCRA 3S93A 1FSEA 4PGGA 1Z21A 3K4NA 2BVMA 4XONA 3J7ZI 1UB9A 2WB1A 1U2WA 4C3IJ 1DGWY 5BMZA 5DUIA 1VQPI 1ITYA 1D0YA 3FXJA 1OFCX 2DQLA 2OJED 4LMYA 3ULQB 4DQ2A 1VTNC 5E1WA 3Q5FA 4C2TA 2HOSA 1FMWA 4LD5A 2Z1DA 2WAFA 4CHUA 3FHZA 1UI6A 1T08B 4BXFA 1D1AA 4FHTA 2WY8Q 1T98A 2DI3A 2KRFA 3S15J 4I09A 2AS5F 3ANGA 1IRZA 3CMYA 2VBXA 4YIFA 4RGSA 1X4PA 4G6TB 1GVDA 4A6DA 1ZTRA 4A6EA 3RQIA 4E7JA 3S2HJ 1PUEE 3QOPA 2XB0X 5E8GA 4NNJA 3M07A 3K8PC 2P6TA 2NS0A 5DEQA 5J3LA 1USSA 1FBUA 5E20A 3DTKA 3EETA 2ZBKA 1P7IA 2DOFA 3CESA 1KONA 3ABLH 4F3QA 1VQ8I 3OYFA 1TWAJ 2Z5UA 2K9SA 3NXCA 3VIBA 4LITA 2E2HJ 4EM1A 2TDXA 2DT7B 4L62A 1TWCJ 2EV0A 4PCQA 3MKWB 3GX4X 4BDZA 1N75A 2CUJA 3CF2A 2QKLB 3HHHA 4B44A 4UXNA 2H09A 4JK1X 2FEZA 4KUMA 5KK1A 4HDUA 1BI2A 1ZRCA 2NS7A 1FOXA 2LF8A 4EGZA 2IXSA 4KA4A 1UAAA 4IHSA 1T6SA 3H5AA 1AKHA 2H8RA 3UNGC 1HLVA 3CDLA 3X2QH 1SAXA 1IDZA 2VXZA 2MLKA 5F04A 3REOA 2H94A 1R1TA 4ZDLA 5GTIC 1JKQC 5IYBJ 2HTSA 1FYMA 1G59A 2M9HA 3K10A 2R93J 2QWTA 1ON1A 3R6SA 1MNEA 2IGMA 4CUGA 1JKOC 2K9MA 2W82A 2V1DA 1BR2A 4XKVA 2YVXA 1TLHB 3HRTA 3HOYJ 4DYRA 4MO7A 4PUSA 4BY1J 1U5TB 3MKLA 4BS9A 3DV8A 3M1CA 4XSZF 3DWLE 3EDPA 3RYRA 1QBJA 3CJTB 1AU7A 1ZH5A 4PFPA 1O57A 2M7AA 3K7AJ 2X1CA 3N05A 4A12A 1U5TC 5B66C 4Q47A 3TMOA 1SGMA 4E7HA 3CCLI 4ENMA 1E3PA 4EGYA 4HA8A 3ERMA 4BJ6C 3L2WA 2VXDA 3W6VA 2DFHA 2EWNA 2XF7A 5FLMJ 5CXGA 1QA6A 1G3TA 2JQ7A 3UKGA 1G2HA 3F8FA 2CG4A 5EG0A 2QIBA 2F5EA 3PUBA 2XPWA 2KKOA 2OCCH 3F23A 3VB2A 4FTHA 3C2BA 3T6NA 2Y31A 2GIZA 2DFIA 3HRMA 2RV8A 4KJZA 1WCMJ 1NTCA 4P9UA 1HW2A 4A3CJ 3NQOA 1IN7A 1MNDA 4B48A 2VLAA 5F1RA 2W57A 3CJRB 2HU9A 1RI7A 2V1UA 4C2MA 3FZVA 4AC0A 3QYFA 4W1UA 5CPRB 2ZCNA 4C3JJ 1W7PA 2M4KA 4KMUX 1VF9A 2Z3YA 4D1QA 4G12A 2X6WA 4M6VA 1O3RA 4E7KA 4E7ZA 3MKZA 3SFIA 1VQNI 4M3FA 3P9KA 2M0CA 3KYCB 1IXCA 4HG2A 4E7SA 2ZC2A 3CMEI 4S04A 2KDZA 2EFQA 4UHTA 1EV7A 3RD3A 4U0VA 2XRLA 2K7LA 3A2KA 2M0MA 3KYLA 2KQRA 2VQHA 5GAGJ 2JSCA 4N4OB 1Z0XA 1MBJA 2I5UA 3FK7A 3SJMA 3M1EA 2ESNA 5CYVA 1BC8C 3BZCA 2ZCMA 1BM9A 3U1KA 5CW8A 4CICA 1G3YA 1OYWA 3V78A 4AYBN 2BXYA 3PQJA 2IS6A 2L9NA 4AUXA 3KX2A 1BN5A 4LG0A 3CUOA 1V4RA 3JTGA 1EJ9A 2YX4A 4A0ZA 4HX4A 3DKXA 1SFXA 3HDDA 2FXAA 2PMZN 2QKOA 5HS9A 1FOYA 3K1PA 2JTVA 3R0AA 2BHYA 2BV6A 1S7OA 5F27A 1EH7A 4CYDA 3HJEA 4E70A 1STZA 2O7OA 3BY6A 3G7RA 4RDUA 1AKHB 2E1NA 3IAM2 2BZTA 3E6DA 2EBIA 4EJVA 1WJEA 5D19A 3KP5A 4CZZA 3K6GA 2ZJPF 4OOIA 5FKKA 4M3GA 3IH3A 4OD4A 3G1MA 3NARA 3DPTA 4ACIA 5F6FA 2MLGA 1KU7A 2HDWA 2GAUA 2YVHA 4ZDOA 2E5NA 2L01A 2YU3A 2LKXA 3ZRGA 3H5NA 1I5ZA 2WUIA 2M30A 2V57A 2VBYA 2IAIA 4LGWA 2R7QA 1U3EM 4FT8A 1MGTA 3FBIB 2NNNA 3HRSA 3NWTA 4BQNA 3ECOA 2BVLA 3KCCA 2LVSA 5GPAA 4HEA2 2JPBA 3HOTA 3GW2A 1XGSA 3BCBA 3ZMTA 4L9VA 3KZZA 3E97A 3V7RA 2EZKA 3LQQA 4XRFA 5E17F 1P4XA 1TW2A 2XHKA 3TL4X 3HEFA 2EFOA 4OAYA 4WXHA 2HWVA 1ZLKA 3OS2A 2HEOA 1MMSA 4M71A 2JSPA 2PZ9A 2EIKH 4A3FJ 2V1NA 4UDSA 4DVYP 2CFOA 1IDYA 3JTHA 5EG0B 4EQQA 1ETWA 3V4GA 5D18A 4HX8A 2F5DA 1O7FA 3K1NA 2RDPA 1WH5A 1BI3A 3PSFA 3SDBA 1YTYA 5GAEJ 4J00A 1UHWA 3IWZA 2L54A 4MEYF 3E5XA 2K5CA 3L1PA 3GTPJ 1MMGA 2YUSA 2KPMA 1K83J 2VJ4A 1B9MA 5LGTA 3KP6A 3HC7A 2NXNB 4F92B 1XDSA 4KN7X 1W7PB 5EF6A 2STWA 2HVQA 4I0AA 1RR8C 1JKPC 2KT0A 4XLCA 3QRFF 2HVRA 1M1EB 4L5EA 3W2WA 3GWZA 1TC3C 3S14J 2AHQA 2EA4A 1U0JA 2M87A 2XF6A 2A05A 3BG9A 3HHGA 5LLQA 2DDAA 4XN3A 3CTAA 3MAJA 2X48A 2Q0OA 3EUHC 3F6OA 3R0JA 2VIXA 3VOEA 1T38A 2DQRA 1RIOH 3GUDA 3OS0A 2D1VA 4P5OA 3CRJA 2AXLA 2MBFA 1V5EA 1A36A 1LKXA 3RCOA 1Z77A 2FD5A 2HTJA 3DEUA 5CLSA 2O0YA 3HOZJ 1SD7A 2WAQN 3H35A 2PBXA 3OYEA 3K4KA 3F21A 3BROA 4U87A 4JYKA 5C44J 3HPGA 2RGVA 3T0YA 5FFXA 3MN2A 2EIMH 5J47A 3S3NA 3PO3J 4AIJA 1PUFA 1LE8B 2UXNA 4BU2A 5FKNA 2VL8A 3CQZJ 1QPMA 1HQCA 3OYCA 2O03A 2LY9A 3H5RA 4JX5A 3WU1B 1RRJA 4GDFA 3VW2A 3WHCA 4B43A 2H27A 4CDGA 4PJMA 4PSXA 1FBQA 2XAJA 1G6NA 2JMWA 3BTJA 3ZQIA 2KJBA 2XF5A 1YYVA 2ME0A 3VODA 2XRNA 5AIPA 3ABTA 2L7FP 2ACJA 2HKOA 3AKZA 3IRRA 4ON0A 4HZFA 3VVYA 2FMYA 2LOOA 2D2WA 2V9KA 2DU9A 5E1XA 2V1XA 3HOXJ 5IP7J 1G8XA 2E1OA 2Y48A 2W4SA 4XIDA 1S8NA 3IV5A 2MSYA 2PN6A 2CYYA 1NK2P 3SEQA 4G9YA 4ENJA 4C2UA 1IN6A 4B1RA 1QHHD 5D8KB 1I6XA 4ETSA 4E6KG 3OYNA 3KP4A 1VFCA 2ECBA 3AL0C 2D1HA 1VQ5I 5DD8A 1OR7A 3H3ZA 3JRDA 4UV8A 3QYEA 3T5XA 3VYSB 2Q1ZB 3IH4A 1W36D 3NEUA 2LKSA 3JRGA 2HPIA 1YS7A 4FCYA 3IRQA 4IJAA 3HUGA 2CFXA 5ICGA 1NK3P 1I3QJ 3IL2A 3D1NI 3ZQFA 4RS8A 5J8FA 5EZHA 4BBSJ 3I56I 5H9TA 5KAFC 5FMPA 2ZSHB 4M3EA 5D6EA 1T39A 1FYKA 3RQ4A 3L2UA 3DQVC 3U1DA 3B73A 3RKWA 5JLWA 3C7JA 3K70C 1SMTA 2MD5A 2DFFA 5CJ9A 3MZ8A 2NS8A 2IA2A 2LR8A 3HPHA 1D1CA 4XNFA 2X1DA 4ME9A 2V4JC 4U0YA 3COAC 1XMXA 1PP8F 3W6KB 3RZOJ 4XICA 2PFVA 3COLA 2VKVA 4CCNA 4WX9A 2IP2A 2G0EA 2ZO4A 3ZQQA 1K61A 3JSJA 2QEXI 4D7MA 3A4CA 1RZ4A 2VKDA 2LK2A 3TO6A 2A6HF 1SANA 2DW4A 4RGXA 1U6GA 4KIFA 2F5CA 4NB5A 5J1UA 2VJ5A 3QPTA 1TQPA 5C4JJ 4ITVA 1XS9A 2VQLA 2FQ4A 1GDTA 1HW1A 2A07F 2ZCWA 4Y52J 4NUBA 5D4SA 1EA3A 4BEHB 3Q9VA 2UXUA 3H1CA 1MSEC 5DM6F 4ESBA 1YG2A 2DYSH 4HX7A 5CVJA 2IJLA 4DBQA 5FLXZ 4CCOA 5J1YA 1W5SA 4X0GA 3LSHA 3CCVI 5ERIA 1DGRM 4A5NA 1QGPA 2ZMEC 2HVSA 4I2OA 1YX3A 3CUQC 3BRUA 2OPTA 1MJAA 3MD2A 4CH7A 2E60A 3AFHA 1Z6RA 5C3EJ 1F5TA 2OAZA 3IKVA 4AIHA 1IXSB 3L2RA 3G71I 2GUHA 1ZELA 4FX0A 3KPHA 1D5YA 2MA3A 4BY7J 2LBFA 4DGWB 1YHQI 2B0LA 4M73A 2VT2A 4IHVA 2HXOA 2X51A 3BLYA 3F8CA 2ELJA 2XAFA 4GO1A 5K5RA 1WJBA 1LVAA 5K58A 3OYAA 2LG4A 4KMFA 3TOAA 1Z3YA 3FXRA 3K9TA 2IVMA 3HTJA 3FF5A 5K1YA 5ED4A 5TGTA 3JRAA 3CCYA 4UVAA 3O6BB 1EH8A 2XGEA 1E3HA 1MMAA 1YIOA 3H92A 5FLXK 4XLAA 1I1GA 5F0FA 2CUFA 5K5OA 1UJ8A 2EPFA 1IF1A 4IZZA 1YRNB 2L3DA 5KNLA 2FJI1 4ZYHA 1JXSA 1RPWA 4M3DA 4AIKA 2OI8A 2NVYJ 4AVPA 5BOXA 2UZKA 5KCMA 1Z6TA 2FSWA 2W25A 1OCTC 3HUGB 1LVKA 2M1BA 1HXDA 3KETA 4RLQA 1ODDA 5JFRA 3M7GA 3RI4A 1J5YA 3JCUC 2EILH 4ZTFA 3MKYB 3BPVA 1NG6A 1Y6IA 4I01A 2Z33A 3K0LA 3GFIA 1UELB 2KIUA 4DZJA 4A3EJ 3DPUA 3GMEA 1FSHA 4M6XA 2DK8A 1ETVA 3F1BA 1ZREA 3VYTB 5LGNA 3SQNA 3CLOA 2RQQA 3TKYA 4M6YA 4I99C 1GLNA 4P1WA 1Y8RB 5J8CA 2KL4A 3F9KA 1R23A 1J75A 5IY5H 3PFIA 4A0XA 3QPHA 3ZMVA 4EATA 2LDUA 1TTYA 4G7HF 2FF4A 4R79A 1QRYA 1WVRA 3H9GA 3MNLA 3QKXA 3E5UA 3CCJI 2Y9ZA 3AQSA 5HOOA 5E3NA 5FRMA 3SWHA 3LOCA 3PJRA 1JHHA 1FTZA 1BJAA 1P7JA 2BY3A 4MNUA 5D5WB 2RNGA 3BTCA 3GZ6A 2DPUA 2X6YA 4AYBA 4RM3A 4RAGA 1DPUA 2CS3A 4GFLA 4IL6C 4BHCA 4MHGA 1IGNA 2FUG2 2ME6A 3O2PE 1X2MA 1SVOA 2PMZA 4CXFA 5DV5A 3HOWJ 3VYRB 3VPRA 2ZXWH 1YOVB 2R7VA 3HTUA 5E3OA 4XMYA 4U0WA 3HBLA 1ETKA 3P9CA 1D5VA 1FT9A 2B3WA 2NNYA 2HYTA 3IUOA 5FB2A 1X1CA 1A6IA 2HDCA 2DT6A 4NC8A 4XKBA 1J7KA 5M5YJ 4NELA 2LBFB 2F07A 2DTZA 4NC6A 5AONA 1DP3A 1WI3A 2WWYA 2O5RA 3BQYA 1HA8A 1Y1VJ 2GA1A 4XRSG 4O3MA 1Y8QB 3ZQ7A 3IKTA 1Y0NA 2DDBA 5E3LA 3HE0A 2CV1A 4CO8A 1XD7A 3S1QJ 2M45A 2HGCA 4G8XA 2OV7A 1TWGJ 3LSKA 4UUSA 3DXJF 3FHNA 3VSLA 4KDPA 1LNWA 2IGOA 3GCMA 3HGGA 2Z16A 1RR7A 4F7ZA 5DTDA 2BE5F 3JSOA 1PDNC 2REKA 2LSOA 2R92J 2R7OA 3CCRI 1YW9A 4BJTA 1J59A 3L2VA 2IS1A 5IT3A 1OKRA 2P81A 4ZYDA 3K2ZA 4GXOA 4JKZA 1JT0A 1IN8A 4RGRA 2RREA 1N78A 2E5ZA 4BAYA 3BR3A 1KYWA 2LMDA 3QWLA 2M8GX 3QP6A 4BL0B 1P2FA 2D5VA 1MD0A 2P7VB 1YFHA 2UV1A 3KZIC 3I5UA 3E6BA 5D4RA 2A6TA 4OAZA 1R49A 4I0BA 1Y39A 3DU5A 2LLKA 2PEXA 3RJPA 3HTAA 4Q48A 2EFPA 1FOKA 2ID6A 4IF4A 3K4CA 1KQ9A 3I54A 3H9QA 3LSIA 4EEFG 2NVXJ 4YZEA 3B81A 2BY0A 3I9V2 1MMDA 4DZPA 2FBHA 5LHHA 2Q2EA 1I27A 1R00A 1Z9CA 2XIGA 3LSGA 3TBIA 1ZARA 4MTEA 3K1MA 1R5GA 4WCGA 2NVTJ 1VNDA 3OYGA 1ZG1A 1PJRA 1DU0A 2CQNA 3I4NJ 2HZDA 2P5VA 3L2QA 4HPQA 1HF0A 3FK6A 1XX5A 4IHTA 1XTAA 2VJJA 2L9SA 5B3SH 3KZYA 4Y7NJ 2L7ZA 4KT5C 3HIFA 3ZQHA 3V6GA 5A2QZ 2PJRB 2WAQA 1IUFA 4IPAA 2FRHA 3RPQA 2P8TA 5IOZA 2VONA 3RYPA 2R5YA 3RPUD 6PAXA 1OISA 1D0ZA 2GIVA 2NYXA 3O8GA 4M9SA 1T0FA 3SZTA 3H36A 2XAHA 2D45A 2QGUA 3MWMA 1LEBA 1ETYA 2P0WA 1D1BA 1MH3A 1D0XA 3WG9A 2R7RA 2L9RA 2R0QC 2ELKA 1REPC 1QZYA 2BXZA 2VT3A 4I76A 3BQZA 1F4KA 2NAZA 2GA2A 3CZ6A 3WGIA 4GCLA 2X1EA 5DDGA 2R7WA 1U8RA 2DJIA 3K69A 2R4GA 3KEOA 1A6QA 1DQUA 3PNYA 1ETXA 1H0MA 1Q1VA 2OTLI 4IOCF 1ZG5A 4I7HA 2X9DA 2H6CA 1MZBA 3QODA 1OYYA 4G7OF 3LJLA 1NH3A 4W97A 1I39A 3D5SC 3SFZA 2VBZA 3EQLF 3CDHA 3WGGA 2HQ5A 2V6CA 4LIUA 3TW6A 5A2QK 3TEDA 5GADJ 4UUSB 1MBFA 3GTKJ 2XV4S 1IG7A 2RKHA 2R7ZJ 3WTSC 4GFKA 3G56A 1SVLA 2KFDA 2JVHA 3RKXA 1RC9A 2DOAA 1HSTA 2DMUA 4RB1A 1SAUA 3GTGJ 3OYLA 1N25A 2BY1A 2L02A 1X58A 2CGPA 3C2GA 1VI0A 2K3FA 1TWFJ 4MLOA 4RMNA 4FQGA 3WE2A 2FBKA 3AAFA 1ZLJA 3FKJA 5HODA 1ZHFA 5KAIC 1KZHA 2PBIA 3PO2J 1QU3A 3DBHB 4O5VA 2VKEA 3ABUA 3G3ZA 2FBQA 4AC6A 5D5UB 1X4OA 1H88C 3RH2A 3SZGA 2BW3A 2J5OA 5JI6A 5K5QA 3E7LA 5ILSA 4JOMA 3EUHA 3S32A 3WU2C 2DA7A 3OSFA 2LNBA 1BJZA 2R7XA 5HVQC 5JVTA 3GZ5A 4FISA 2ELHA 2JA8J 5F0CA 2K27A 3NWSA 4ZDPA 1JE8A 5HLGA 5BPDA 5FD5A 3CC2I 1Y0UA 3BNIA 1RESA 1IO2A 1R4MB 1X1DA 2KZGA 2XAGA 3LFKA 3TDUC 3Q3SA 2A5WA 5IOYA 3DTEA 2LD5A 1ZYRF 3HTIA 2YPRA 4BXXJ 3LSRA 3L2CA 2XDNA 4XL9A 1C0WA 2RVCA 3FMSA 3OSGA 4L0YB 3S3MA 5IYCJ 3ASOH 4A3BJ 1LQ1A 3AG1H 3VEPA 2QYOA 5J4YA 1XDUA 2Q2EB 5TRDA 3D5RC 4FETA 3TOBA 3TO7A 4L9JA 2GXAA 4V19K 4NBQA 2PJPA 2JRMA 4IHXA 4HBLA 4XRSA 2K9NA 2GWRA 3I55I 2P5LC 5CXIA 4IQJA 1QVTA 4BH9A 1IXRC 5EGOA 4ZZLA 4OIPF 1BW6A 2NRAC 4Q5SF 4WXDA 4XKWA 1U9NA 4XOPA 5J1RA 5HAWA 1K7AA 3DU6A 1Z7UA 3Q9SA 2DN0A 2KP6A 4AU7A 3KLOA 4HQEA 1HW5A 1HSJA 1MBKA 3QYBA 3N97A 2DG8A 2XB5A 4N9HA 3ABKH 4HV6A 2R5YB 4DJAA 2CUEA 1FNNA 4M72A 3BHQA 3CDIA 4PJLA 3T1BA 5B1AH 3LA3A 1FIPA 1S7EA 2HS5A 4BHPA 3IUVA 1T0FC 1YI2I 2DA2A 5JHUA 3F22A 3PQKA 1Y56A 1HCRA 3E7QA 4HNVA 2IGNA 3DPJA 2CRGA 2JZYA 3LHQA 2XSJC 5F1JA 3L00A 3JRIA 4BE2A 2G3BA 3RIRA 4P55A 1X1BA 1GHCA 4UVCA 5LBQA 4D5CA 2CQQA 3VW1A 2GOXB 3QPLA 5LRRA 2CQKA 1UFMA 1H8AC 3FXLA 3GEUA 4IRVA 1QNTA 1R7JA 1WSUA 3PNTA 2JA2A 3GTOJ 2FOWA 2EFNA 3E6MA 3D0SA 5FRNA 3PNVA 1G4DA 2ECCA 1YO5C 4FE4A 2LH9A 1MH4A 1MSFC 2V79A 4BGDA 2QQAA 4UUTA 4AIDA 3MVPA 2Y0SN 3CO7C 1A04A 3N4MA 3H9JA 1UHSA 2BW3B 2E7WA 3DLLF 4N4NB 1B9NA 2QCOA 4M9XA 4IRHA 5HNFA 4OD5A 3ABMH 3V8KA 1W36C 1SMYF 1JTXA 4LK1F 5LD2C 5FKMA 4ZYEA 3QP5A 1OCCH 3GZNB 1FYLA 5DM7F 4B47A 2IA1A 4WF2A 1WH7A 3U9GA 3ZMDA 1ORKA 3VOXA 1U78A 5HDGA 2QLZA 3ZCOA 4KITB 5E8IA 4LG0B 5JVGF 2CQ7A 2K40A 2MYSA 2XKOA 2ZMEA 5JR3A 1FZPB 4EJTA 3ELKA 1GXQA 5LGUA 3CUQA 2XGDA 3K2AA 1O3QA 1LDKB 5F0HA 4KT6A 1IV6A 1ZKGA 1ZN2A 2L0KA 4RB3C 2F2EA 5ILUA 1S72I 4GFBA 2NP5A 1P9QC 5ICCA 2XKPA 5FKLA 4GCTA 4EM2A 3ECHA 1JKRC 2OERA 4YRVA 4ZC3A 2FA5A 3MZHA 3IC7A 2Z9OA 3RSNA 3G4SI 5J4VA 5EGOB 3LA2A 3QPSA 2VASA 3VOKA 4B09A 2ZXHA 2NOGA 3EYYA 2VPRA 2IRFG 2E1MC 1A5JA 2VKHA 2E36A 5LRSA 2X6OA 1BW5A 2P6SA 3ML6A 2P5KA 2VBWA 2HPMA 3S16J 1BOAA 2K86A 1YLFA 2VB6A 2J5PA 3VP5A 2KIMA 3BJ6A 2ETHA 1ETOA 3AL0B 1VQ4I 3K4JA 1B72A 2QSFX 3BWGA 3LFUA 3ZP5A 2HI3A 4GCVA 3HL2A 3FRQA 1SFKA 3VVZA 3GXOA 5EEAA 3OYIA 3KEYA 5KVRA 1APLC 4QIWN 3TO9A 3LMMA 4ZTJA 4F93B 2FNAA 4Z2YA 4GYIA 3KYDB 2NOJB 2E1CA 1VQ6I 4D5FA 4R8HA 1DPRA 3HGYA 4H0EA 4JQFA 3LA7A 2VUMJ 2V7FA 4A3LJ 3CCUI 1T33A 1TQIA 5IYDJ 1GVJA 3QAHA 4HLYA 4WIBA 4EJUA 3MCZA 3OOPA 1S6LA 2O9LA 2GFNA 2VQGA 3R61A 2MW8A 5TJJA 4U9NA 1OPCA 3QBMA 2L7KA 2IPQX 4QWQA 4XORA 1WJDA 1XN7A 2O6GE 3A03A 2XVCA 5IT9Z 2HQNA 3T8TA 2VE9A 5LEJA 3CC4I 3E3VA 3H3UA 1B6AA 1JGSA 2VE8A 3AG4H 3BG6A 1U8BA 4AM3A 2G7UA 2G7HA 4A3GJ 1W5TA 1YJ9I 4AWXB 2KHMA 3V8JA 1SVMA 2QKMB 1BR4A 2E7XA 2KZVA 3S2DJ 4DBRA 4UB6C 3S8PA 1K6OA 3OIQA 2JA6J 3ZMUA 3OYKA 1WI9A 2I10A 3RKYA 4BBRJ 4YFNF 5K7FA 5LHIA 2LY2A 3TGNA 1FIAA 4YIIA 2H1LA 2L5QA 5HSZA 5FKOA 3JRHA 4LLLA 3LNQA 2GZWA 4HRIA 5DCMA 2ZCXA 3JR9A 1VQ7I 3TW7A 4A5MA 4JP0A 4LLGF 5GTHC 1L3LA 2OTJI 2CW7A 4LB6B 1USTA 4ENKA 1LUJB 4IRIA 1TWHJ 3JSPA 1ZGWA 5IT9K 3A1YA 3PASA 2XSDC 1ZR4A 2LFBA 3P7NA 1RETA 1Z7LA 3MFKA 2R7SA 3DEWA 3I0TA 1ENHA 3ZQLA 2W53A 2ZMEB 3CUQB 2DCEA 2MC4A 3J7AY 1LDDA 2BBYA 3BR2A 3CLQA 4HSTA 5L3CA 1PUFB 3PSIA 3QU6A 4ICHA 5CVRA 5DD4A 3ERED 5EEGA 2QVOA 2XGXA 2COBA 2QWWA 2GLOA 3BJAA 1JTYA 4M3BA 3PL8A 4S05A 1EF4A 3KLNA 5HDKA 1TL8A 5KHDA 4KWAA 3R4KA 3VW0A 1QO0D 2UXOA 4Y33A 3JREA 2Y9YA 2O8KA 2HOAA 2EB7A 2FJ1A 4YFKF 5HDNA 4LLNA 5CVIA 3L09A 3V8LA 4HDVA 3WODF 2MH9A 2M5WA 5M5XJ 2E71A 4BQQA 1JGGA 1XMAA 3B02A 2YSRA 3ZOBA 1YJWI 3BZ6A 3R60A 2QF7A 2WC2A 4J01A 2NX4A 1V54H 3DFGA 3DEEA 1B72B 4G6DA 2D6YA 5HLIA 3HZJA 1O3SA 3DP7A 3GO5A 2ZJRF 2VOPA 3RPUA 1R9TJ 3IP4B 3HTHA 1XGMA 2L4AA 2P4WA 4Q4ZF 4B8XA 3O3KA 1VQOI 1WRJA 4M74A 3K70D 2JWTA 4ASNA 3I4PA 4A3MJ 5GP9A 4BYYA 5L3DA 1X3WB 1MJBA 4D0PA 3RZDJ 2DXIA 2EH3A 4HOBA 1AWCA 3MZYA 3WHBA 1ETQA 1O7LA 1Z05A 3M9AA 2QBYA 5CKTA 2LRDA 4V2GA 5AQCA 4A3DJ 3BT9A 3EUAA 4D7NA 3L7WA 1SFOJ 1WPKA 1PP7U 4L5IA 3DLAA 4OWRB 3C07A 1JHFA 2ISYA 4MTDA 1T8IA 1FP1D 1MIJA 1ZG3A 2DMTA 2DK5A 2IS2A 5FHPA 2OCEA 3DTIA 2JA5J 2QSHX 3P5JA 2OBPA 2KJCA 2X85A 4KIGA 3SXYA 3WGHA 3K4MA 1BI0A 1XCVA 1E0EA 2DJNA 2G7LA 4XK4A 3S3OA 1RNLA 1WGXA 2ZJ2A 4L0ZB 3KZ9A 3LSMA 1XSDA 4HKUA 1A35A 2TCTA 2A5YB 5GPCA 5K7ZA 2CJJA 3C18A 3RKQA 1TT5B
chains in the Genus database with same CATH topology
1MBHA 3F0CA 2EZKA 5IOZA 2R5YA 3HEFA 2XPVA 3O8GA 2H1KA 1U9OA 3A02A 3EGQA 1W0TA 1ETYA 3JRBA 2PZ9A 1BA5A 1MH3A 2GBYA 4I6ZA 4A3FJ 4NN1A 2L9RA 2R0QC 4UDSA 5DAJA 1IDYA 2ELKA 3BTIA 4I76A 5EG0B 1JJ8C 3HOVJ 3NI7A 2Y2ZA 3BQZA 1ETWA 4CYCA 5D18A 3GTMJ 4IHWA 2NVQJ 4GCLA 1WH5A 5IP6A 4B4CA 1ZK8A 1ETXA 2EQRA 1RKWA 1Q1VA 2ZOZA 2B63J 3L1PA 3GTPJ 2X9DA 4JX4A 2YUSA 5C4YA 2XGCA 1K83J 3LJLA 2DMPA 4W97A 2HYJA 2YVEA 3P9TA 4JX6A 2Q24A 4X1EA 3KKDA 3TEDA 2HQ5A 3TW6A 5M3FJ 1E3OC 3B6CA 4UUSB 1MBFA 5EF6A 3GTKJ 1IG7A 2HXIA 2R7ZJ 5JLXA 2RHAA 1B8IB 2N8GA 4GFKA 3G56A 1JKPC 1CQTA 1MNMC 2KT0A 3G1OA 2O7TA 2DMUA 1GV5A 2HKUA 4MFDA 3GTGJ 4L5EA 3A01B 3ANPA 1X58A 1TC3C 3S14J 2AHQA 1VI0A 4MLOA 1TWFJ 3EUPA 3BG9A 5HODA 4A3IJ 3BJBA 3PO2J 1F43A 4PXIA 2VKEA 2X48A 4AC6A 2FBQA 4IEJA 2JK3A 3JRCA 4J19A 1H88C 1I6HJ 3RH2A 2DA3A 3KKCA 3CRJA 3SDGA 1H89C 2IEKA 2ID3A 3E7LA 3OSFA 1Z77A 2DA7A 2EZLA 2FD5A 1DU6A 1T56A 3HOZJ 3S5RA 1BJZA 2WAQN 2PBXA 4FISA 4DW6A 3HKZN 4JYKA 5F0CA 5C44J 2JA8J 1F36A 3MN2A 3PO3J 3BNIA 1RESA 1PUFA 1LFBA 2DA5A 1LE8B 5FKNA 4A3KJ 1HDDC 3CQZJ 3Q3SA 5BNGA 2LY9A 4JX5A 3VW2A 3WHCA 5IOYA 2RASA 1JUSA 2LD5A 4MIMA 3HTIA 3BTJA 4FE7A 4A3JJ 2JMWA 1ZR2A 3ZQIA 3LSRA 4BXXJ 2XDNA 3OSGA 2ME0A 5IYCJ 4A3BJ 2L7FP 2NP3A 4ABZA 3BG3A 2JN6A 1JUMA 3VVYA 2DA6A 4IHXA 4XRSA 5C4XJ 1RKTA 3HOXJ 5IP7J 2K9NA 5IP9J 5CXIA 2E1OA 1OJLA 4XIDA 3IV5A 1POGA 1QVTA 5FLVA 5EGOA 2MSYA 1BW6A 5J1RA 1U9NA 3S1RJ 5HAWA 1NK2P 4B1RA 2DN0A 1XG1A 3VUQA 1VFCA 2ECBA 2DG8A 1MBKA 3O8HA 2XB5A 3JRDA 2E19A 2R5YB 2CUEA 2G7GA 3IH4A 2DA4A 3JRGA 3BHQA 2JJ7A 2RAEA 4FCYA 1FIPA 3ON4A 1S7EA 1NK3P 1I3QJ 5EDNA 3D1NI 3ZQGA 3IUVA 3ZQFA 2DA2A 3BR0A 4CYCB 4XRMA 4DYQA 4QTRA 1HCRA 5EZHA 3O60A 4BBSJ 1MBEA 5H9TA 5FMPA 3E7QA 4HNVA 4M3EA 2QTQA 2AO9A 1UMQA 2XPUA 3DPJA 3NAUA 4NDLA 2CRGA 3LHQA 5F1JA 3JRIA 3HOUJ 5JLWA 2G3BA 1BL0A 2R5ZA 2CU7A 2DMNA 2NS8A 2LR8A 2CQQA 4D5CA 3VW1A 2ZOYA 3QPLA 4ME9A 4A69C 1H8AC 3GEUA 1IC8A 2W48A 3S1NJ 1ZQ3P 3FISA 3RZOJ 3GTOJ 4XICA 2OF7A 3AQTA 5D1RA 3COLA 1QVUA 2VKVA 2M34A 2DG7A 2G0EA 1K61A 3JSJA 1I50J 2ECCA 4D7MA 2VI6A 1O4XA 4FE4A 2LK2A 1MH4A 1MSFC 1QPIA 1SANA 3OOUA 1FTTA 3JRFA 2UXIA 5J1UA 4V2FA 1MBGA 4UUTA 3MVPA 1JT6A 2Y0SN 3PM1A 5C4JJ 1XS9A 2GM4A 2K9QA 2FQ4A 2IBDA 1GDTA 1UHSA 4A93J 3GTLJ 4Y52J 3GZIA 3DCFA 5FGLA 3TP0A 2UXUA 2QCOA 1MSEC 1FEXA 3ZQCA 1JTXA 2GENA 2ZB9A 5FKMA 5J1YA 9ANTA 4C2MJ 1GV2A 4MK6A 3S17J 1WH7A 2DA1A 4RBOA 1ORKA 3BRUA 1U78A 3CJDA 4X6AJ 3VOXA 2OPTA 5HBUA 4C3IJ 5C3EJ 2K40A 1W0UA 4QSHA 1ITYA 2GUHA 2NX4A 1OFCX 2XGDA 1D5YA 3K2AA 4BY7J 2HOSA 4IHVA 5F0HA 1IV6A 2MG4A 1ZKGA 2L0KA 2HXOA 5IPAA 4GFBA 2NP5A 4JL3A 1UI6A 3IH2A 5FKLA 4GCTA 1JKRC 2OERA 1AHDP 5K58A 2YS9A 1HOMA 5EGOB 3HTJA 3QPSA 3VOKA 2LTPA 3JRAA 3CCYA 3S15J 3CWRA 4AF5A 2XGEA 2NOGA 3ANGA 2EZIA 3CMYA 1IRZA 4DYCA 2VPRA 1A5JA 1GVDA 1ZTRA 1JUPA 5F0FA 5K7HA 2TRTA 2CUFA 2X6OA 3RQIA 1BW5A 3S2HJ 1YRNB 3S16J 2XB0X 1RPWA 4M3DA 2HOTA 2JA7J 2OI8A 3BG5A 2NVYJ 2UXPA 5J3LA 3VP5A 1ETOA 1B72A 1P7IA 1OCTC 2HI3A 3FRQA 3VVZA 5EEAA 1X2NA 1APLC 4QIWN 2MGQA 1TWAJ 2K9SA 3NXCA 3VIBA 1LE8A 1XC5A 2L7MP 2UXHA 2E2HJ 3FKIJ 1GUUA 4L62A 4D5FA 1TWCJ 3BR5A 3HGYA 2WV1A 4CGRA 2VUMJ 4A3LJ 1T33A 4DZJA 5IYDJ 4A3EJ 2R5ZB 3FIWA 2O9LA 2NS7A 2GFNA 1ETVA 2MW8A 3F1BA 1LFUP 3QBMA 5EFYA 3A03A 1OCPA 2WB1N 1AKHA 2H8RA 1HLVA 3CDLA 1IDZA 3ON2A 5F04A 3I4MJ 1JKQC 5IYBJ 1U8BA 3HIMA 3BCGA 2WGBA 3MNLA 1QRYA 2M9HA 3QKXA 4A3GJ 2R93J 2Y9ZA 3AQSA 2QWTA 5E3NA 5M5WJ 3LOCA 1FTZA 1P7JA 1Y1WJ 4B3AA 1JKOC 3S2DJ 5EYRA 3QQAA 2JA6J 2I10A 4BBRJ 3BTCA 5K7FA 3HOYJ 1FIAA 4DYRA 4MO7A 2LP0A 5HSZA 4BY1J 3MKLA 4GFLA 5FKOA 3JRHA 2E2IJ 3LNQA 1IGNA 4IHYA 2ZCXA 4GCKA 3JR9A 2Y30A 2ME6A 3TW7A 4JP0A 4C3HJ 1X2MA 3PPBA 2IU5A 1AU7A 3HOWJ 1TWHJ 3K7AJ 3VPRA 1ZGWA 3PASA 3HB9A 2XSDC 3Q0VA 1ZR4A 1SGMA 3S1MJ 2LFBA 5E3OA 4MXMA 1RETA 3HBLA 1ETKA 3W6VA 3DEWA 5E3MA 2HYTA 5F08A 5FLMJ 1ENHA 1UG2A 3ZQLA 2W53A 1G2HA 1A6IA 3UKGA 5CXGA 5EG0A 2QIBA 5M5YJ 4NELA 2XPWA 3LSPA 2F07A 2DTZA 3BR2A 1WI3A 4FTHA 1PUFB 3M4OJ 3BQYA 3B6AA 3C2BA 1JJ6C 3T6NA 1Y1VJ 2Y31A 4ICHA 4XRSG 2COBA 2GLOA 5E3LA 1WCMJ 3HE0A 1JTYA 1NTCA 4M3BA 4A3CJ 3TP3A 1EF4A 3S1QJ 4KWAA 3VW0A 2UXOA 3H0GJ 3KNWA 4AC0A 4W1UA 1TWGJ 4BKXA 3JREA 2Y9YA 4C3JJ 2O8KA 2HOAA 2FJ1A 4UUSA 2ZCNA 3NPIA 3BR6A 1VF9A 3Q0UA 5M5XJ 1B8IA 4G12A 3HGGA 1RR7A 2QOPA 4M6VA 1IJWC 1JGGA 2YU9J 3Q0WA 5DTDA 3ZOBA 3SFIA 4M3FA 3A01A 2M0CA 2QF7A 1GT0C 2REKA 2KDZA 2R92J 3RD3A 2XRLA 1B72B 2D6YA 1HDPA 5EZGA 2P81A 1Z0XA 1MBJA 3HM5A 3FK7A 3SJMA 1R9TJ 4JKZA 1JT0A 3HTHA 3G1LA 2ZCMA 4S0HB 5CW8A 1FJLA 2HDDA 3M3YJ 3V78A 3BR3A 4AYBN 5DS9A 2CQXA 3LWJA 4AUXA 2JWTA 4A3MJ 3H3VK 3GTQJ 3OIOA 5GP9A 2M8GX 2D5VA 3RZDJ 2EH3A 3HDDA 3WHBA 2PMZN 2QKOA 1ETQA 3BR1A 4V2GA 5AQCA 4A3DJ 3BT9A 5F27A 2O7OA 4D7NA 2LLKA 1SFOJ 3G7RA 3NNRA 4RDUA 1AKHB 3VVXA 1WPKA 2EBIA 3C07A 3HTAA 5D19A 4LOCA 2E2JJ 2M2EA 2ID6A 5FKKA 2DMTA 5FHPA 4M3GA 4YZEA 1UI5A 4EEFG 3IH3A 2NVXJ 3B81A 3G1MA 2JA5J 3NARA 4ACIA 4DZPA 2YVHA 2NVTJ 3LSGA 4MFEA 1VNDA 3GBGA 2EZHA 2LKXA 1YRNA 5M3MJ 1DU0A 2WUIA 3LSJA 2V57A 3I4NJ 2DJNA 3GTJJ 2IAIA 2G7LA 4XK4A 1HF0A 3FK6A 1WGXA 2DMQA 5FJ8J 4JNNA 3KZ9A 4Y7NJ 4HKUA 2L7ZA 2LVSA 3ZQHA 2TCTA 3BTLA 3V6GA 5GPAA 5GPCA 1IUFA 2G7SA 5K7ZA 3NRGA 2CJJA 3RKQA 2FX0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MBH A;  3F0C A;  2EZK A;  5IOZ A;  2R5Y A;  3HEF A;  2XPV A;  3O8G A;  2H1K A;  1U9O A;  3A02 A;  3EGQ A;  1W0T A;  1ETY A;  3JRB A;  2PZ9 A;  1BA5 A;  1MH3 A;  2GBY A;  4I6Z A;  4A3F J;  4NN1 A;  2L9R A;  2R0Q C;  4UDS A;  5DAJ A;  1IDY A;  2ELK A;  3BTI A;  4I76 A;  5EG0 B;  1JJ8 C;  3HOV J;  3NI7 A;  2Y2Z A;  3BQZ A;  1ETW A;  4CYC A;  5D18 A;  3GTM J;  4IHW A;  2NVQ J;  4GCL A;  1WH5 A;  5IP6 A;  4B4C A;  1ZK8 A;  1ETX A;  2EQR A;  1RKW A;  1Q1V A;  2ZOZ A;  2B63 J;  3L1P A;  3GTP J;  2X9D A;  4JX4 A;  2YUS A;  5C4Y A;  2XGC A;  1K83 J;  3LJL A;  2DMP A;  4W97 A;  2HYJ A;  2YVE A;  3P9T A;  4JX6 A;  2Q24 A;  4X1E A;  3KKD A;  3TED A;  2HQ5 A;  3TW6 A;  5M3F J;  1E3O C;  3B6C A;  4UUS B;  1MBF A;  5EF6 A;  3GTK J;  1IG7 A;  2HXI A;  2R7Z J;  5JLX A;  2RHA A;  1B8I B;  2N8G A;  4GFK A;  3G56 A;  1JKP C;  1CQT A;  1MNM C;  2KT0 A;  3G1O A;  2O7T A;  2DMU A;  1GV5 A;  2HKU A;  4MFD A;  3GTG J;  4L5E A;  3A01 B;  3ANP A;  1X58 A;  1TC3 C;  3S14 J;  2AHQ A;  1VI0 A;  4MLO A;  1TWF J;  3EUP A;  3BG9 A;  5HOD A;  4A3I J;  3BJB A;  3PO2 J;  1F43 A;  4PXI A;  2VKE A;  2X48 A;  4AC6 A;  2FBQ A;  4IEJ A;  2JK3 A;  3JRC A;  4J19 A;  1H88 C;  1I6H J;  3RH2 A;  2DA3 A;  3KKC A;  3CRJ A;  3SDG A;  1H89 C;  2IEK A;  2ID3 A;  3E7L A;  3OSF A;  1Z77 A;  2DA7 A;  2EZL A;  2FD5 A;  1DU6 A;  1T56 A;  3HOZ J;  3S5R A;  1BJZ A;  2WAQ N;  2PBX A;  4FIS A;  4DW6 A;  3HKZ N;  4JYK A;  5F0C A;  5C44 J;  2JA8 J;  1F36 A;  3MN2 A;  3PO3 J;  3BNI A;  1RES A;  1PUF A;  1LFB A;  2DA5 A;  1LE8 B;  5FKN A;  4A3K J;  1HDD C;  3CQZ J;  3Q3S A;  5BNG A;  2LY9 A;  4JX5 A;  3VW2 A;  3WHC A;  5IOY A;  2RAS A;  1JUS A;  2LD5 A;  4MIM A;  3HTI A;  3BTJ A;  4FE7 A;  4A3J J;  2JMW A;  1ZR2 A;  3ZQI A;  3LSR A;  4BXX J;  2XDN A;  3OSG A;  2ME0 A;  5IYC J;  4A3B J;  2L7F P;  2NP3 A;  4ABZ A;  3BG3 A;  2JN6 A;  1JUM A;  3VVY A;  2DA6 A;  4IHX A;  4XRS A;  5C4X J;  1RKT A;  3HOX J;  5IP7 J;  2K9N A;  5IP9 J;  5CXI A;  2E1O A;  1OJL A;  4XID A;  3IV5 A;  1POG A;  1QVT A;  5FLV A;  5EGO A;  2MSY A;  1BW6 A;  5J1R A;  1U9N A;  3S1R J;  5HAW A;  1NK2 P;  4B1R A;  2DN0 A;  1XG1 A;  3VUQ A;  1VFC A;  2ECB A;  2DG8 A;  1MBK A;  3O8H A;  2XB5 A;  3JRD A;  2E19 A;  2R5Y B;  2CUE A;  2G7G A;  3IH4 A;  2DA4 A;  3JRG A;  3BHQ A;  2JJ7 A;  2RAE A;  4FCY A;  1FIP A;  3ON4 A;  1S7E A;  1NK3 P;  1I3Q J;  5EDN A;  3D1N I;  3ZQG A;  3IUV A;  3ZQF A;  2DA2 A;  3BR0 A;  4CYC B;  4XRM A;  4DYQ A;  4QTR A;  1HCR A;  5EZH A;  3O60 A;  4BBS J;  1MBE A;  5H9T A;  5FMP A;  3E7Q A;  4HNV A;  4M3E A;  2QTQ A;  2AO9 A;  1UMQ A;  2XPU A;  3DPJ A;  3NAU A;  4NDL A;  2CRG A;  3LHQ A;  5F1J A;  3JRI A;  3HOU J;  5JLW A;  2G3B A;  1BL0 A;  2R5Z A;  2CU7 A;  2DMN A;  2NS8 A;  2LR8 A;  2CQQ A;  4D5C A;  3VW1 A;  2ZOY A;  3QPL A;  4ME9 A;  4A69 C;  1H8A C;  3GEU A;  1IC8 A;  2W48 A;  3S1N J;  1ZQ3 P;  3FIS A;  3RZO J;  3GTO J;  4XIC A;  2OF7 A;  3AQT A;  5D1R A;  3COL A;  1QVU A;  2VKV A;  2M34 A;  2DG7 A;  2G0E A;  1K61 A;  3JSJ A;  1I50 J;  2ECC A;  4D7M A;  2VI6 A;  1O4X A;  4FE4 A;  2LK2 A;  1MH4 A;  1MSF C;  1QPI A;  1SAN A;  3OOU A;  1FTT A;  3JRF A;  2UXI A;  5J1U A;  4V2F A;  1MBG A;  4UUT A;  3MVP A;  1JT6 A;  2Y0S N;  3PM1 A;  5C4J J;  1XS9 A;  2GM4 A;  2K9Q A;  2FQ4 A;  2IBD A;  1GDT A;  1UHS A;  4A93 J;  3GTL J;  4Y52 J;  3GZI A;  3DCF A;  5FGL A;  3TP0 A;  2UXU A;  2QCO A;  1MSE C;  1FEX A;  3ZQC A;  1JTX A;  2GEN A;  2ZB9 A;  5FKM A;  5J1Y A;  9ANT A;  4C2M J;  1GV2 A;  4MK6 A;  3S17 J;  1WH7 A;  2DA1 A;  4RBO A;  1ORK A;  3BRU A;  1U78 A;  3CJD A;  4X6A J;  3VOX A;  2OPT A;  5HBU A;  4C3I J;  5C3E J;  2K40 A;  1W0U A;  4QSH A;  1ITY A;  2GUH A;  2NX4 A;  1OFC X;  2XGD A;  1D5Y A;  3K2A A;  4BY7 J;  2HOS A;  4IHV A;  5F0H A;  1IV6 A;  2MG4 A;  1ZKG A;  2L0K A;  2HXO A;  5IPA A;  4GFB A;  2NP5 A;  4JL3 A;  1UI6 A;  3IH2 A;  5FKL A;  4GCT A;  1JKR C;  2OER A;  1AHD P;  5K58 A;  2YS9 A;  1HOM A;  5EGO B;  3HTJ A;  3QPS A;  3VOK A;  2LTP A;  3JRA A;  3CCY A;  3S15 J;  3CWR A;  4AF5 A;  2XGE A;  2NOG A;  3ANG A;  2EZI A;  3CMY A;  1IRZ A;  4DYC A;  2VPR A;  1A5J A;  1GVD A;  1ZTR A;  1JUP A;  5F0F A;  5K7H A;  2TRT A;  2CUF A;  2X6O A;  3RQI A;  1BW5 A;  3S2H J;  1YRN B;  3S16 J;  2XB0 X;  1RPW A;  4M3D A;  2HOT A;  2JA7 J;  2OI8 A;  3BG5 A;  2NVY J;  2UXP A;  5J3L A;  3VP5 A;  1ETO A;  1B72 A;  1P7I A;  1OCT C;  2HI3 A;  3FRQ A;  3VVZ A;  5EEA A;  1X2N A;  1APL C;  4QIW N;  2MGQ A;  1TWA J;  2K9S A;  3NXC A;  3VIB A;  1LE8 A;  1XC5 A;  2L7M P;  2UXH A;  2E2H J;  3FKI J;  1GUU A;  4L62 A;  4D5F A;  1TWC J;  3BR5 A;  3HGY A;  2WV1 A;  4CGR A;  2VUM J;  4A3L J;  1T33 A;  4DZJ A;  5IYD J;  4A3E J;  2R5Z B;  3FIW A;  2O9L A;  2NS7 A;  2GFN A;  1ETV A;  2MW8 A;  3F1B A;  1LFU P;  3QBM A;  5EFY A;  3A03 A;  1OCP A;  2WB1 N;  1AKH A;  2H8R A;  1HLV A;  3CDL A;  1IDZ A;  3ON2 A;  5F04 A;  3I4M J;  1JKQ C;  5IYB J;  1U8B A;  3HIM A;  3BCG A;  2WGB A;  3MNL A;  1QRY A;  2M9H A;  3QKX A;  4A3G J;  2R93 J;  2Y9Z A;  3AQS A;  2QWT A;  5E3N A;  5M5W J;  3LOC A;  1FTZ A;  1P7J A;  1Y1W J;  4B3A A;  1JKO C;  3S2D J;  5EYR A;  3QQA A;  2JA6 J;  2I10 A;  4BBR J;  3BTC A;  5K7F A;  3HOY J;  1FIA A;  4DYR A;  4MO7 A;  2LP0 A;  5HSZ A;  4BY1 J;  3MKL A;  4GFL A;  5FKO A;  3JRH A;  2E2I J;  3LNQ A;  1IGN A;  4IHY A;  2ZCX A;  4GCK A;  3JR9 A;  2Y30 A;  2ME6 A;  3TW7 A;  4JP0 A;  4C3H J;  1X2M A;  3PPB A;  2IU5 A;  1AU7 A;  3HOW J;  1TWH J;  3K7A J;  3VPR A;  1ZGW A;  3PAS A;  3HB9 A;  2XSD C;  3Q0V A;  1ZR4 A;  1SGM A;  3S1M J;  2LFB A;  5E3O A;  4MXM A;  1RET A;  3HBL A;  1ETK A;  3W6V A;  3DEW A;  5E3M A;  2HYT A;  5F08 A;  5FLM J;  1ENH A;  1UG2 A;  3ZQL A;  2W53 A;  1G2H A;  1A6I A;  3UKG A;  5CXG A;  5EG0 A;  2QIB A;  5M5Y J;  4NEL A;  2XPW A;  3LSP A;  2F07 A;  2DTZ A;  3BR2 A;  1WI3 A;  4FTH A;  1PUF B;  3M4O J;  3BQY A;  3B6A A;  3C2B A;  1JJ6 C;  3T6N A;  1Y1V J;  2Y31 A;  4ICH A;  4XRS G;  2COB A;  2GLO A;  5E3L A;  1WCM J;  3HE0 A;  1JTY A;  1NTC A;  4M3B A;  4A3C J;  3TP3 A;  1EF4 A;  3S1Q J;  4KWA A;  3VW0 A;  2UXO A;  3H0G J;  3KNW A;  4AC0 A;  4W1U A;  1TWG J;  4BKX A;  3JRE A;  2Y9Y A;  4C3J J;  2O8K A;  2HOA A;  2FJ1 A;  4UUS A;  2ZCN A;  3NPI A;  3BR6 A;  1VF9 A;  3Q0U A;  5M5X J;  1B8I A;  4G12 A;  3HGG A;  1RR7 A;  2QOP A;  4M6V A;  1IJW C;  1JGG A;  2YU9 J;  3Q0W A;  5DTD A;  3ZOB A;  3SFI A;  4M3F A;  3A01 A;  2M0C A;  2QF7 A;  1GT0 C;  2REK A;  2KDZ A;  2R92 J;  3RD3 A;  2XRL A;  1B72 B;  2D6Y A;  1HDP A;  5EZG A;  2P81 A;  1Z0X A;  1MBJ A;  3HM5 A;  3FK7 A;  3SJM A;  1R9T J;  4JKZ A;  1JT0 A;  3HTH A;  3G1L A;  2ZCM A;  4S0H B;  5CW8 A;  1FJL A;  2HDD A;  3M3Y J;  3V78 A;  3BR3 A;  4AYB N;  5DS9 A;  2CQX A;  3LWJ A;  4AUX A;  2JWT A;  4A3M J;  3H3V K;  3GTQ J;  3OIO A;  5GP9 A;  2M8G X;  2D5V A;  3RZD J;  2EH3 A;  3HDD A;  3WHB A;  2PMZ N;  2QKO A;  1ETQ A;  3BR1 A;  4V2G A;  5AQC A;  4A3D J;  3BT9 A;  5F27 A;  2O7O A;  4D7N A;  2LLK A;  1SFO J;  3G7R A;  3NNR A;  4RDU A;  1AKH B;  3VVX A;  1WPK A;  2EBI A;  3C07 A;  3HTA A;  5D19 A;  4LOC A;  2E2J J;  2M2E A;  2ID6 A;  5FKK A;  2DMT A;  5FHP A;  4M3G A;  4YZE A;  1UI5 A;  4EEF G;  3IH3 A;  2NVX J;  3B81 A;  3G1M A;  2JA5 J;  3NAR A;  4ACI A;  4DZP A;  2YVH A;  2NVT J;  3LSG A;  4MFE A;  1VND A;  3GBG A;  2EZH A;  2LKX A;  1YRN A;  5M3M J;  1DU0 A;  2WUI A;  3LSJ A;  2V57 A;  3I4N J;  2DJN A;  3GTJ J;  2IAI A;  2G7L A;  4XK4 A;  1HF0 A;  3FK6 A;  1WGX A;  2DMQ A;  5FJ8 J;  4JNN A;  3KZ9 A;  4Y7N J;  4HKU A;  2L7Z A;  2LVS A;  3ZQH A;  2TCT A;  3BTL A;  3V6G A;  5GPA A;  5GPC A;  1IUF A;  2G7S A;  5K7Z A;  3NRG A;  2CJJ A;  3RKQ A;  2FX0 A; 
#chains in the Genus database with same CATH topology
 1MBH A;  2Y69 H;  1LDJ A;  1G3S A;  4YG2 F;  2XAU A;  5ICF A;  2XPV A;  4BHB A;  1X19 A;  2CWE A;  3EGQ A;  1W0T A;  2AXT C;  4XLN F;  1P92 A;  3JRB A;  2DFE A;  3LQR A;  2NVU B;  4II2 A;  4EM0 B;  5HNH A;  4YIR X;  1R22 A;  1XGO A;  4I6Z A;  4NN1 A;  2FNP A;  1WJ5 A;  2GOM A;  2LKP A;  3BTI A;  2ADU A;  4YFX F;  3HOV J;  4XLH A;  5E1Z B;  2DPD A;  3NI7 A;  4EV0 A;  2CV2 A;  1HKS A;  4ZYG A;  5B5E C;  3FM3 A;  3M8F A;  2OQG A;  2NVQ J;  2UUZ A;  1ZK8 A;  5ICE A;  1R4N B;  1RKW A;  3FXO A;  4ENN A;  2B63 J;  3ROU A;  1D8K A;  4ESF A;  3OR1 C;  4JX4 A;  4QPO A;  1AA7 A;  3NRV A;  1WWX A;  2DMP A;  3P9T A;  4JX6 A;  4EJW A;  1BOB A;  2DO7 A;  2ZNY A;  3U21 A;  3G73 A;  3HOS A;  5M3F J;  2Q24 A;  3KKD A;  5GAH J;  3OMY A;  1X3Z B;  1NHA A;  1TNS A;  2EV5 A;  2RHA A;  4PJN A;  3BDD A;  4UVB A;  1MNM C;  2LF7 A;  2A69 F;  2O7T A;  1GV5 A;  1K6Y A;  2VQC A;  2K9L A;  3J80 Z;  5L3E A;  2QQ9 A;  5JHF A;  5J6X A;  1H9T A;  3PUF A;  1IUY A;  2Y75 A;  2KIS A;  2HFH A;  1XB4 A;  4RAF A;  4PXI A;  3OV8 A;  3BCA A;  4IEJ A;  3GFM A;  4CCJ A;  2XUB A;  1B4A A;  3UR3 C;  1WJF A;  3G2B A;  3CC7 I;  2PFB A;  4PSW A;  5D6F A;  3CCM I;  2STT A;  1J2X A;  4BE1 A;  1F1Z A;  2EZL A;  4WWC A;  1T56 A;  2DBB A;  3S5R A;  2XAS A;  3VWB A;  3WTV C;  4DW6 A;  3HKZ N;  2QBY B;  2ISZ A;  3CJN A;  1YJN I;  1FBS A;  1S7A A;  2DA5 A;  5D8L B;  1CGP A;  3G6E I;  2A61 A;  3J80 K;  3SYT A;  2KIQ A;  3LL7 A;  1JUS A;  4LB5 A;  5CQE A;  4A3J J;  2PI0 A;  3BC8 A;  5D5V B;  2R7T A;  4I02 A;  3E5Q A;  4ABZ A;  3I71 A;  3BG3 A;  3QU3 A;  3FWE A;  1JUM A;  3FMR A;  3CCQ I;  5C4X J;  4NC7 A;  3OYJ A;  5IP9 J;  1OLT A;  2L4M A;  2Y0S A;  2DTR A;  1XGN A;  3BP8 A;  1YIJ I;  1WQ2 A;  1S5L C;  3HSR A;  4IVN A;  5TIS C;  4KIC A;  3OYD A;  4RM2 A;  3S1R J;  4Y3O A;  2HZT A;  2WTE A;  3BZK A;  4RB0 A;  4XN0 A;  2Z99 A;  4HF0 A;  5LEK A;  3O8H A;  2F4M B;  4RGU A;  2E19 A;  1QQI A;  4CCM A;  3FXK A;  2R7F A;  3WTX C;  1UG0 A;  3MEX A;  1ZGJ A;  2DA4 A;  1T95 A;  1V5F A;  1XPX A;  2JJ7 A;  3TQN A;  3ZPL A;  5DCF A;  2V26 A;  3SZP A;  4IOA F;  3JAM Z;  3W3C A;  2WA0 A;  1R1V A;  4DOZ A;  3OYH A;  1FX7 A;  4XRM A;  3CO6 C;  4Y4R A;  2QQB A;  2HR3 A;  1V5G A;  2DT5 A;  2R7D A;  4H4K C;  1IRF A;  2AO9 A;  2QEN A;  4N9I A;  1YIT I;  3NAU A;  4NDL A;  4OU0 A;  4DNC A;  2FOK A;  4XR6 A;  4R1H A;  3KEQ A;  1BL0 A;  2R5Z A;  1NG7 A;  2ZKZ A;  3EUK L;  4GGG A;  1PVE A;  2CUZ A;  3OY9 A;  4MEX F;  4LIV A;  3ISP A;  4C30 A;  4A69 C;  2H8W A;  5H6Q A;  1S3J A;  3KFW X;  2OC6 A;  4BQA A;  2ZFU A;  2W48 A;  2ZFW A;  2V9P A;  3FBN B;  4IRG A;  2W1O A;  4OIN F;  3OIP A;  1ZQ3 P;  2WY7 Q;  3FIS A;  5ILV A;  3AQT A;  2JUG A;  4CCL A;  2DG7 A;  4KIB A;  3RDI A;  5L3G A;  3OYM A;  1I50 J;  3W2A A;  1IRG A;  1WJA A;  1Q1H A;  2VI6 A;  3JAM K;  2O3F A;  3S2W A;  3EPZ A;  2M4G A;  4U88 A;  3OOU A;  3GLL A;  2UXI A;  2JVG A;  3I64 A;  4E7I A;  1XSX A;  2OU2 A;  1R36 A;  2OZ6 A;  3DF8 A;  1OCR H;  3PM1 A;  4IXA A;  1TT0 A;  2FML A;  2K9Q A;  3FDY A;  5CQG A;  3GTL J;  1WJC A;  3GVA A;  4XM3 A;  1XMK A;  1VZ0 A;  5FGL A;  3TP0 A;  2WV0 A;  3A0B C;  1KYZ A;  3ZQC A;  1VQL I;  2VN2 A;  1VQM I;  1EKE A;  4LJZ F;  2GXB A;  1X1A A;  2GEN A;  4FAS D;  1QZZ A;  3T8R A;  2XRO A;  4C2M J;  1GV2 A;  4MK6 A;  3S17 J;  2K85 A;  4A2U A;  2DA1 A;  3E1S A;  4RBO A;  3F8M A;  3CJD A;  5FGM A;  4X6A J;  5HBU A;  4CGZ A;  2EJR A;  3OR2 C;  2M8E A;  4IO9 F;  1W0U A;  4QSH A;  1SFU A;  1ZRD A;  2QQ8 A;  2F5V A;  3I53 A;  2WAE A;  2B1E A;  1MDM A;  2JRT A;  1W5C C;  1MKM A;  3CCE I;  2MG4 A;  5IPA A;  5FO5 A;  5CVV A;  4C9Y A;  3ZGK A;  3ZMS A;  3OS1 A;  4JL3 A;  3IH2 A;  2XDV A;  4OIQ F;  1AHD P;  3PIP F;  3ASN H;  2K4B A;  2YS9 A;  1HOM A;  4RA2 A;  1KU2 A;  1G3W A;  2LTP A;  2ZJQ F;  1Z3X A;  1YW7 A;  4QPQ A;  3CWR A;  4AF5 A;  2OA4 A;  3WU0 A;  2EZI A;  1K4T A;  2IS4 A;  4RLF A;  4DYC A;  1L0O C;  1JUP A;  5K7H A;  2TRT A;  2VC0 A;  4XQF A;  2PG4 A;  5EJC A;  2HOT A;  2JA7 J;  4UY8 I;  5J40 A;  3BG5 A;  2A68 F;  2UXP A;  3FM5 A;  3ZN1 A;  2MFZ A;  1KU9 A;  4F52 A;  1BIA A;  3CD6 I;  4B3X A;  1Z1D A;  1X2N A;  4XBF A;  3U2R A;  3WTY C;  4HNU A;  4KYW A;  2MGQ A;  1IN4 A;  4L5J A;  3F8N A;  2F4O B;  4BUP A;  3FXQ A;  1LE8 A;  1XC5 A;  2JPC A;  2L7M P;  1JI8 A;  4BQO A;  3FKI J;  2UXH A;  4ESJ A;  3J81 Z;  1GUU A;  1QHG A;  3BR5 A;  2IW5 A;  4UUV A;  1TBX A;  2WV1 A;  4CGR A;  2JUC A;  2B9S A;  2GQQ A;  5E79 C;  4Z6Y A;  2IGK A;  2RNJ A;  2MAB A;  5E18 F;  3GYH X;  4KNY A;  4Y15 A;  2W24 A;  1P4W A;  2R5Z B;  5HS7 A;  3FIW A;  5AIQ A;  1ZGA A;  1K79 A;  1I3A A;  3J7A O;  1LFU P;  5EFY A;  1T2K A;  1OQY A;  4YEJ A;  4WXC A;  1OCP A;  2WB1 N;  4I98 B;  1QZE A;  4G6Q A;  2I8D A;  3ON2 A;  1I1S A;  2F6C A;  1K78 A;  2HYG D;  5LHG A;  3I4M J;  2YR2 A;  3D5L A;  5DYM A;  5BQT A;  4BAC A;  3SHF A;  3VDX A;  3HIM A;  3BCG A;  1FMV A;  2RQP A;  2WGB A;  4GRI A;  1BBY A;  4MQ9 F;  3FXM A;  1DDN A;  2PLY A;  4IKF A;  3I58 A;  5M5W J;  4HLX A;  2PX9 A;  1HBX G;  2CW8 A;  1YS6 A;  1Y1W J;  1KQ8 A;  4B3A A;  4DIQ A;  3J81 K;  5EYR A;  3QQA A;  2VJI A;  3FX3 A;  2CO5 A;  2LP0 A;  1OCO H;  4KIS A;  2ZXI A;  2E2I J;  4IHY A;  1FLI A;  2OUM A;  2AQF A;  3KP7 A;  4UB8 C;  4GCK A;  3E0J B;  2Y30 A;  3I59 A;  4C3H J;  3PPB A;  2IU5 A;  3CF5 F;  1ZAO A;  3C3W A;  3AG2 H;  3C2H A;  3HB9 A;  3Q0V A;  3S1M J;  3DKY A;  3RTR A;  3W2V A;  1TQM A;  3HSF A;  4U7B A;  4MXM A;  1SD6 A;  2A2F X;  2MD0 A;  2MH2 A;  1Z67 A;  5E3M A;  4ZJZ A;  5F08 A;  1UG2 A;  4YEL A;  4BXU A;  3ZMZ A;  4EVI A;  1KU3 A;  2QM3 A;  1MDM B;  1LPQ A;  4U9L A;  3LSP A;  2Z2S B;  5DUK A;  3TDZ C;  1V55 H;  3ZN0 A;  3M4O J;  3B6A A;  1JJ6 C;  4LK0 F;  4RAZ A;  1P4A A;  1YE9 A;  2KIF A;  1W1W E;  4PZJ A;  1V3F A;  5FFZ A;  3TP3 A;  4BNC A;  2W00 A;  3OL3 A;  1ZRF A;  3H0G J;  3KNW A;  2CSO A;  2IA0 A;  4KFC A;  4BKX A;  2E34 A;  2ZNZ A;  3VTI A;  2QZ8 A;  3BR6 A;  4ANJ A;  3NPI A;  4JBA A;  3Q0U A;  2PMU A;  1B8I A;  2QOP A;  3DPL C;  2OQR A;  1IJW C;  2QSG X;  2YU9 J;  3BOQ A;  3Q0W A;  2E1M B;  4HV5 A;  3A01 A;  1GT0 C;  2EV6 A;  2F4I A;  1RUN A;  1S29 A;  3VYU B;  4G7Z F;  4OMY A;  2M3A A;  2OD5 A;  4BEH A;  5HS8 A;  2EA2 A;  3BG7 A;  5L3B A;  2VOD A;  2FQ3 A;  1HDP A;  5EZG A;  2O61 A;  4HW0 A;  1IRX A;  4F55 A;  2A6E F;  3HM5 A;  4EJO A;  1B1B A;  1IW7 F;  2FE3 A;  1B59 A;  3GFJ A;  1CF7 A;  3G1L A;  3LWF A;  1VQ9 I;  4S0H B;  2F5F A;  1FJL A;  2HDD A;  3M3Y J;  5DS9 A;  2CQX A;  1LFP A;  4ZH4 F;  3WTT C;  3H0D A;  3H3V K;  3GTQ J;  3LWJ A;  3OIO A;  1R5H A;  3LAP A;  3GF2 A;  1BR1 A;  4Y17 A;  2QUF A;  1J0R A;  1SD4 A;  3P9I A;  3K4L A;  1TZL A;  2DYR H;  3BR1 A;  4L9T A;  4P96 A;  1IAW A;  1MMN A;  4PGH A;  1J9I A;  1SD5 A;  4QLC U;  3NNR A;  3VVX A;  3WTW C;  2V9V A;  4ZZD A;  1WKM A;  3MMY B;  4LOC A;  4CA0 A;  3HXL A;  3IWF A;  3WTZ A;  1K78 B;  1ON2 A;  2M2E A;  2E2J J;  1HKQ A;  2BY2 A;  3GEZ A;  3KP2 A;  1UI5 A;  1XSV A;  3DBL B;  1H9G A;  3OWT A;  2X4H A;  3WTU C;  3L9F A;  3I3L A;  4XKC A;  1UHM A;  4MFE A;  1W7P D;  3CP2 A;  2EZH A;  3GBG A;  2LC2 A;  5M3M J;  1DUX C;  1YRN A;  3LSJ A;  4OIR F;  2Q8K A;  4P9F A;  3GTJ J;  1FWZ A;  2DMQ A;  5FJ8 J;  4JNN A;  2ICW G;  1FOW A;  4GYG A;  3KP3 A;  3BTL A;  4M9Z A;  4K2E A;  4PK4 A;  4HF2 A;  2G7S A;  3NRG A;  3I59 B;  1D8J A;  3HKZ A;  2FX0 A;  3F0C A;  4HNT A;  3J7Y J;  3IAS 2;  2BGC A;  3F72 A;  2H1K A;  1U9O A;  5B1B H;  1AOY A;  4HQM A;  3A02 A;  1WFX A;  5CVU A;  4AVZ A;  5H6R A;  1BA5 A;  2GBY A;  2O8X A;  1F9N A;  4UNO A;  5DAJ A;  4LG3 A;  1IV8 A;  1JJ8 C;  1LJ9 A;  3M8J A;  3PFY A;  2Y2Z A;  2GXG A;  2CW0 F;  4L9N A;  4CYC A;  3GTM J;  4IHW A;  2DOE A;  3A0H C;  2UXX A;  5IP6 A;  1FY7 A;  2K3P A;  3CMM A;  4BJ5 C;  1KQ0 A;  2AQE A;  3HYI A;  2WAD A;  3SEZ A;  4B4C A;  4OIO F;  2EQR A;  2ZOZ A;  1UZC A;  5C4Y A;  2XGC A;  2L9V A;  2HYJ A;  2C6Y A;  1E17 A;  2YVE A;  2CMP A;  2DOD A;  2KRC A;  2BHZ A;  3ONQ A;  4X1E A;  4XSX F;  2W7N A;  4PJ0 C;  4BE0 A;  2BYV E;  1E3O C;  1BC7 C;  3B6C A;  1J09 A;  2HQA A;  3ZXS A;  2YX7 A;  2HXI A;  1PYV A;  5JLX A;  1OMI A;  1B8I B;  3JW4 A;  2N8G A;  3W6J B;  5BS6 A;  1CQT A;  5EEH A;  2ZSI B;  2R3S A;  3G1O A;  2KMU A;  4TV7 A;  1X3U A;  2HKU A;  2K4J A;  4MFD A;  2VC1 A;  3MQ0 A;  5D5X B;  3A01 B;  3ANP A;  2X6X A;  1YX5 A;  2PQ8 A;  3WG7 H;  5HLH A;  1MW7 A;  4G94 A;  4WK8 F;  1KGS A;  1HC8 A;  3EUP A;  4A3I J;  3BJB A;  1XCB A;  2L2O A;  1F43 A;  1FPQ A;  2EIN H;  4RB2 C;  2EK5 A;  1WHU A;  4OMZ A;  4PJJ A;  2MC3 A;  4XLF A;  1CF7 B;  2JK3 A;  2V6E A;  3JRC A;  4KN4 X;  4J19 A;  1I6H J;  2R7U A;  1IZ1 A;  2DA3 A;  3KKC A;  3ZR8 X;  1ULY A;  3SDG A;  4E7L A;  1H89 C;  5HLT A;  3HTS B;  2VOO A;  2IEK A;  2ID3 A;  2M7B A;  4NQW A;  1DU6 A;  4HAM A;  3HSE A;  3F3X A;  5LFA A;  2K02 A;  1F36 A;  1ACI A;  2OZU A;  4PFO A;  3CP8 A;  1BI1 A;  1LFB A;  3WE3 A;  3K4B A;  2PMH A;  2WBM A;  1LEA A;  4A3K J;  2ESH A;  1HDD C;  2DLL A;  5BNG A;  3HG9 A;  2IT0 A;  3BPX A;  2FU4 A;  4HYE A;  2RAS A;  4MIM A;  4FE7 A;  1ZR2 A;  1RUO A;  2P7C B;  2LYC A;  1R58 A;  4NHJ A;  4LFU A;  4PDK A;  3ESW B;  4RAY A;  3IHU A;  5H2F C;  2NP3 A;  2RN7 A;  4HF1 A;  2JN6 A;  2HNH A;  2HKX A;  3F6V A;  1MJ9 A;  3KE2 A;  3E6C C;  1IN5 A;  1OYI A;  2DA6 A;  3DKW A;  2ZY9 A;  3VSK A;  4UV9 A;  1K4S A;  1RKT A;  3QOE A;  1OJL A;  4CSW A;  1POG A;  4II3 A;  5FLV A;  1DP7 P;  1GXP A;  3OL4 A;  5FD6 A;  1S9H A;  1OR7 C;  3V42 A;  1FC3 A;  4EMS A;  3LST A;  2QA4 I;  4D9J A;  1XG1 A;  3KIO A;  3VUQ A;  2F48 A;  2JT1 A;  1P6R A;  1X1P A;  4N0B A;  1OCZ H;  2KRH A;  2BEO A;  2G7G A;  2ZXJ A;  1VQK I;  2B7E A;  4IX7 A;  2UWM A;  2RAE A;  3VFZ A;  3ON4 A;  1BIB A;  5DCM B;  5EDN A;  3ZQG A;  2FBI A;  3BJO A;  3BR0 A;  1N77 A;  3M8E A;  4CYC B;  1HKT A;  4DYQ A;  4QTR A;  3O60 A;  2EFW A;  1MBE A;  3CJQ B;  2KLO A;  1O3T A;  3HRU A;  2HQR A;  1R1U A;  5F64 A;  2QTQ A;  2CH0 A;  2XPU A;  1UMQ A;  3NS4 A;  3V7S A;  5L3F A;  2H6B A;  3GLX A;  4IQ4 A;  2CV0 A;  2W84 A;  4XOT A;  3HOU J;  1Z91 A;  1SFE A;  2Y0M A;  3CMA I;  2BOL A;  4L18 B;  2CU7 A;  2DMN A;  1YQA A;  3F8B A;  3FXU A;  2ZOY A;  2KDO A;  1WZ2 A;  1LB2 A;  1SC7 A;  4E4H A;  4AD9 A;  2XC7 A;  1YW8 A;  1IC8 A;  5FRO A;  4HSR A;  4CCK A;  2W85 A;  4BDY A;  3EYI A;  3S1N J;  2XAQ A;  3PIO F;  5BPI A;  4A0Y A;  2OF7 A;  1EH6 A;  3LAJ A;  5D1R A;  1QVU A;  2M34 A;  2HOE A;  2LRE A;  3OYB A;  2EIJ H;  1O4X A;  1QPI A;  4XLP F;  1TNT A;  1W4M A;  4MGR A;  2PJR A;  2RC4 A;  1TP4 A;  1FP2 A;  2G9W A;  3C1D A;  1FTT A;  4Y13 A;  3V7C A;  4F91 B;  2X0L A;  3JRF A;  4V2F A;  1MBG A;  1JT6 A;  4U7D A;  2GM4 A;  3AG3 H;  2IBD A;  3GFL A;  2LY1 A;  4A93 J;  2E35 A;  3FMQ A;  3GZI A;  2DAO A;  1A31 A;  2HYF A;  1ERD A;  2COM A;  3DCF A;  3CCS I;  4NQW B;  1SEU A;  2A3S A;  1U5T A;  1R71 A;  1FEX A;  4O6J A;  1ONV A;  1E2X A;  4ZYA A;  3DBR B;  4FX4 A;  5H20 A;  2ZB9 A;  1KA8 A;  1TW3 A;  4MQV A;  9ANT A;  1R6R A;  4XLE A;  4CZC A;  2VPL A;  1D3Y A;  1R5I D;  1UCR A;  3S93 A;  1FSE A;  4PGG A;  1Z21 A;  3K4N A;  2BVM A;  4XON A;  3J7Z I;  1UB9 A;  2WB1 A;  1U2W A;  4C3I J;  1DGW Y;  5BMZ A;  5DUI A;  1VQP I;  1ITY A;  1D0Y A;  3FXJ A;  1OFC X;  2DQL A;  2OJE D;  4LMY A;  3ULQ B;  4DQ2 A;  1VTN C;  5E1W A;  3Q5F A;  4C2T A;  2HOS A;  1FMW A;  4LD5 A;  2Z1D A;  2WAF A;  4CHU A;  3FHZ A;  1UI6 A;  1T08 B;  4BXF A;  1D1A A;  4FHT A;  2WY8 Q;  1T98 A;  2DI3 A;  2KRF A;  3S15 J;  4I09 A;  2AS5 F;  3ANG A;  1IRZ A;  3CMY A;  2VBX A;  4YIF A;  4RGS A;  1X4P A;  4G6T B;  1GVD A;  4A6D A;  1ZTR A;  4A6E A;  3RQI A;  4E7J A;  3S2H J;  1PUE E;  3QOP A;  2XB0 X;  5E8G A;  4NNJ A;  3M07 A;  3K8P C;  2P6T A;  2NS0 A;  5DEQ A;  5J3L A;  1USS A;  1FBU A;  5E20 A;  3DTK A;  3EET A;  2ZBK A;  1P7I A;  2DOF A;  3CES A;  1KON A;  3ABL H;  4F3Q A;  1VQ8 I;  3OYF A;  1TWA J;  2Z5U A;  2K9S A;  3NXC A;  3VIB A;  4LIT A;  2E2H J;  4EM1 A;  2TDX A;  2DT7 B;  4L62 A;  1TWC J;  2EV0 A;  4PCQ A;  3MKW B;  3GX4 X;  4BDZ A;  1N75 A;  2CUJ A;  3CF2 A;  2QKL B;  3HHH A;  4B44 A;  4UXN A;  2H09 A;  4JK1 X;  2FEZ A;  4KUM A;  5KK1 A;  4HDU A;  1BI2 A;  1ZRC A;  2NS7 A;  1FOX A;  2LF8 A;  4EGZ A;  2IXS A;  4KA4 A;  1UAA A;  4IHS A;  1T6S A;  3H5A A;  1AKH A;  2H8R A;  3UNG C;  1HLV A;  3CDL A;  3X2Q H;  1SAX A;  1IDZ A;  2VXZ A;  2MLK A;  5F04 A;  3REO A;  2H94 A;  1R1T A;  4ZDL A;  5GTI C;  1JKQ C;  5IYB J;  2HTS A;  1FYM A;  1G59 A;  2M9H A;  3K10 A;  2R93 J;  2QWT A;  1ON1 A;  3R6S A;  1MNE A;  2IGM A;  4CUG A;  1JKO C;  2K9M A;  2W82 A;  2V1D A;  1BR2 A;  4XKV A;  2YVX A;  1TLH B;  3HRT A;  3HOY J;  4DYR A;  4MO7 A;  4PUS A;  4BY1 J;  1U5T B;  3MKL A;  4BS9 A;  3DV8 A;  3M1C A;  4XSZ F;  3DWL E;  3EDP A;  3RYR A;  1QBJ A;  3CJT B;  1AU7 A;  1ZH5 A;  4PFP A;  1O57 A;  2M7A A;  3K7A J;  2X1C A;  3N05 A;  4A12 A;  1U5T C;  5B66 C;  4Q47 A;  3TMO A;  1SGM A;  4E7H A;  3CCL I;  4ENM A;  1E3P A;  4EGY A;  4HA8 A;  3ERM A;  4BJ6 C;  3L2W A;  2VXD A;  3W6V A;  2DFH A;  2EWN A;  2XF7 A;  5FLM J;  5CXG A;  1QA6 A;  1G3T A;  2JQ7 A;  3UKG A;  1G2H A;  3F8F A;  2CG4 A;  5EG0 A;  2QIB A;  2F5E A;  3PUB A;  2XPW A;  2KKO A;  2OCC H;  3F23 A;  3VB2 A;  4FTH A;  3C2B A;  3T6N A;  2Y31 A;  2GIZ A;  2DFI A;  3HRM A;  2RV8 A;  4KJZ A;  1WCM J;  1NTC A;  4P9U A;  1HW2 A;  4A3C J;  3NQO A;  1IN7 A;  1MND A;  4B48 A;  2VLA A;  5F1R A;  2W57 A;  3CJR B;  2HU9 A;  1RI7 A;  2V1U A;  4C2M A;  3FZV A;  4AC0 A;  3QYF A;  4W1U A;  5CPR B;  2ZCN A;  4C3J J;  1W7P A;  2M4K A;  4KMU X;  1VF9 A;  2Z3Y A;  4D1Q A;  4G12 A;  2X6W A;  4M6V A;  1O3R A;  4E7K A;  4E7Z A;  3MKZ A;  3SFI A;  1VQN I;  4M3F A;  3P9K A;  2M0C A;  3KYC B;  1IXC A;  4HG2 A;  4E7S A;  2ZC2 A;  3CME I;  4S04 A;  2KDZ A;  2EFQ A;  4UHT A;  1EV7 A;  3RD3 A;  4U0V A;  2XRL A;  2K7L A;  3A2K A;  2M0M A;  3KYL A;  2KQR A;  2VQH A;  5GAG J;  2JSC A;  4N4O B;  1Z0X A;  1MBJ A;  2I5U A;  3FK7 A;  3SJM A;  3M1E A;  2ESN A;  5CYV A;  1BC8 C;  3BZC A;  2ZCM A;  1BM9 A;  3U1K A;  5CW8 A;  4CIC A;  1G3Y A;  1OYW A;  3V78 A;  4AYB N;  2BXY A;  3PQJ A;  2IS6 A;  2L9N A;  4AUX A;  3KX2 A;  1BN5 A;  4LG0 A;  3CUO A;  1V4R A;  3JTG A;  1EJ9 A;  2YX4 A;  4A0Z A;  4HX4 A;  3DKX A;  1SFX A;  3HDD A;  2FXA A;  2PMZ N;  2QKO A;  5HS9 A;  1FOY A;  3K1P A;  2JTV A;  3R0A A;  2BHY A;  2BV6 A;  1S7O A;  5F27 A;  1EH7 A;  4CYD A;  3HJE A;  4E70 A;  1STZ A;  2O7O A;  3BY6 A;  3G7R A;  4RDU A;  1AKH B;  2E1N A;  3IAM 2;  2BZT A;  3E6D A;  2EBI A;  4EJV A;  1WJE A;  5D19 A;  3KP5 A;  4CZZ A;  3K6G A;  2ZJP F;  4OOI A;  5FKK A;  4M3G A;  3IH3 A;  4OD4 A;  3G1M A;  3NAR A;  3DPT A;  4ACI A;  5F6F A;  2MLG A;  1KU7 A;  2HDW A;  2GAU A;  2YVH A;  4ZDO A;  2E5N A;  2L01 A;  2YU3 A;  2LKX A;  3ZRG A;  3H5N A;  1I5Z A;  2WUI A;  2M30 A;  2V57 A;  2VBY A;  2IAI A;  4LGW A;  2R7Q A;  1U3E M;  4FT8 A;  1MGT A;  3FBI B;  2NNN A;  3HRS A;  3NWT A;  4BQN A;  3ECO A;  2BVL A;  3KCC A;  2LVS A;  5GPA A;  4HEA 2;  2JPB A;  3HOT A;  3GW2 A;  1XGS A;  3BCB A;  3ZMT A;  4L9V A;  3KZZ A;  3E97 A;  3V7R A;  2EZK A;  3LQQ A;  4XRF A;  5E17 F;  1P4X A;  1TW2 A;  2XHK A;  3TL4 X;  3HEF A;  2EFO A;  4OAY A;  4WXH A;  2HWV A;  1ZLK A;  3OS2 A;  2HEO A;  1MMS A;  4M71 A;  2JSP A;  2PZ9 A;  2EIK H;  4A3F J;  2V1N A;  4UDS A;  4DVY P;  2CFO A;  1IDY A;  3JTH A;  5EG0 B;  4EQQ A;  1ETW A;  3V4G A;  5D18 A;  4HX8 A;  2F5D A;  1O7F A;  3K1N A;  2RDP A;  1WH5 A;  1BI3 A;  3PSF A;  3SDB A;  1YTY A;  5GAE J;  4J00 A;  1UHW A;  3IWZ A;  2L54 A;  4MEY F;  3E5X A;  2K5C A;  3L1P A;  3GTP J;  1MMG A;  2YUS A;  2KPM A;  1K83 J;  2VJ4 A;  1B9M A;  5LGT A;  3KP6 A;  3HC7 A;  2NXN B;  4F92 B;  1XDS A;  4KN7 X;  1W7P B;  5EF6 A;  2STW A;  2HVQ A;  4I0A A;  1RR8 C;  1JKP C;  2KT0 A;  4XLC A;  3QRF F;  2HVR A;  1M1E B;  4L5E A;  3W2W A;  3GWZ A;  1TC3 C;  3S14 J;  2AHQ A;  2EA4 A;  1U0J A;  2M87 A;  2XF6 A;  2A05 A;  3BG9 A;  3HHG A;  5LLQ A;  2DDA A;  4XN3 A;  3CTA A;  3MAJ A;  2X48 A;  2Q0O A;  3EUH C;  3F6O A;  3R0J A;  2VIX A;  3VOE A;  1T38 A;  2DQR A;  1RIO H;  3GUD A;  3OS0 A;  2D1V A;  4P5O A;  3CRJ A;  2AXL A;  2MBF A;  1V5E A;  1A36 A;  1LKX A;  3RCO A;  1Z77 A;  2FD5 A;  2HTJ A;  3DEU A;  5CLS A;  2O0Y A;  3HOZ J;  1SD7 A;  2WAQ N;  3H35 A;  2PBX A;  3OYE A;  3K4K A;  3F21 A;  3BRO A;  4U87 A;  4JYK A;  5C44 J;  3HPG A;  2RGV A;  3T0Y A;  5FFX A;  3MN2 A;  2EIM H;  5J47 A;  3S3N A;  3PO3 J;  4AIJ A;  1PUF A;  1LE8 B;  2UXN A;  4BU2 A;  5FKN A;  2VL8 A;  3CQZ J;  1QPM A;  1HQC A;  3OYC A;  2O03 A;  2LY9 A;  3H5R A;  4JX5 A;  3WU1 B;  1RRJ A;  4GDF A;  3VW2 A;  3WHC A;  4B43 A;  2H27 A;  4CDG A;  4PJM A;  4PSX A;  1FBQ A;  2XAJ A;  1G6N A;  2JMW A;  3BTJ A;  3ZQI A;  2KJB A;  2XF5 A;  1YYV A;  2ME0 A;  3VOD A;  2XRN A;  5AIP A;  3ABT A;  2L7F P;  2ACJ A;  2HKO A;  3AKZ A;  3IRR A;  4ON0 A;  4HZF A;  3VVY A;  2FMY A;  2LOO A;  2D2W A;  2V9K A;  2DU9 A;  5E1X A;  2V1X A;  3HOX J;  5IP7 J;  1G8X A;  2E1O A;  2Y48 A;  2W4S A;  4XID A;  1S8N A;  3IV5 A;  2MSY A;  2PN6 A;  2CYY A;  1NK2 P;  3SEQ A;  4G9Y A;  4ENJ A;  4C2U A;  1IN6 A;  4B1R A;  1QHH D;  5D8K B;  1I6X A;  4ETS A;  4E6K G;  3OYN A;  3KP4 A;  1VFC A;  2ECB A;  3AL0 C;  2D1H A;  1VQ5 I;  5DD8 A;  1OR7 A;  3H3Z A;  3JRD A;  4UV8 A;  3QYE A;  3T5X A;  3VYS B;  2Q1Z B;  3IH4 A;  1W36 D;  3NEU A;  2LKS A;  3JRG A;  2HPI A;  1YS7 A;  4FCY A;  3IRQ A;  4IJA A;  3HUG A;  2CFX A;  5ICG A;  1NK3 P;  1I3Q J;  3IL2 A;  3D1N I;  3ZQF A;  4RS8 A;  5J8F A;  5EZH A;  4BBS J;  3I56 I;  5H9T A;  5KAF C;  5FMP A;  2ZSH B;  4M3E A;  5D6E A;  1T39 A;  1FYK A;  3RQ4 A;  3L2U A;  3DQV C;  3U1D A;  3B73 A;  3RKW A;  5JLW A;  3C7J A;  3K70 C;  1SMT A;  2MD5 A;  2DFF A;  5CJ9 A;  3MZ8 A;  2NS8 A;  2IA2 A;  2LR8 A;  3HPH A;  1D1C A;  4XNF A;  2X1D A;  4ME9 A;  2V4J C;  4U0Y A;  3COA C;  1XMX A;  1PP8 F;  3W6K B;  3RZO J;  4XIC A;  2PFV A;  3COL A;  2VKV A;  4CCN A;  4WX9 A;  2IP2 A;  2G0E A;  2ZO4 A;  3ZQQ A;  1K61 A;  3JSJ A;  2QEX I;  4D7M A;  3A4C A;  1RZ4 A;  2VKD A;  2LK2 A;  3TO6 A;  2A6H F;  1SAN A;  2DW4 A;  4RGX A;  1U6G A;  4KIF A;  2F5C A;  4NB5 A;  5J1U A;  2VJ5 A;  3QPT A;  1TQP A;  5C4J J;  4ITV A;  1XS9 A;  2VQL A;  2FQ4 A;  1GDT A;  1HW1 A;  2A07 F;  2ZCW A;  4Y52 J;  4NUB A;  5D4S A;  1EA3 A;  4BEH B;  3Q9V A;  2UXU A;  3H1C A;  1MSE C;  5DM6 F;  4ESB A;  1YG2 A;  2DYS H;  4HX7 A;  5CVJ A;  2IJL A;  4DBQ A;  5FLX Z;  4CCO A;  5J1Y A;  1W5S A;  4X0G A;  3LSH A;  3CCV I;  5ERI A;  1DGR M;  4A5N A;  1QGP A;  2ZME C;  2HVS A;  4I2O A;  1YX3 A;  3CUQ C;  3BRU A;  2OPT A;  1MJA A;  3MD2 A;  4CH7 A;  2E60 A;  3AFH A;  1Z6R A;  5C3E J;  1F5T A;  2OAZ A;  3IKV A;  4AIH A;  1IXS B;  3L2R A;  3G71 I;  2GUH A;  1ZEL A;  4FX0 A;  3KPH A;  1D5Y A;  2MA3 A;  4BY7 J;  2LBF A;  4DGW B;  1YHQ I;  2B0L A;  4M73 A;  2VT2 A;  4IHV A;  2HXO A;  2X51 A;  3BLY A;  3F8C A;  2ELJ A;  2XAF A;  4GO1 A;  5K5R A;  1WJB A;  1LVA A;  5K58 A;  3OYA A;  2LG4 A;  4KMF A;  3TOA A;  1Z3Y A;  3FXR A;  3K9T A;  2IVM A;  3HTJ A;  3FF5 A;  5K1Y A;  5ED4 A;  5TGT A;  3JRA A;  3CCY A;  4UVA A;  3O6B B;  1EH8 A;  2XGE A;  1E3H A;  1MMA A;  1YIO A;  3H92 A;  5FLX K;  4XLA A;  1I1G A;  5F0F A;  2CUF A;  5K5O A;  1UJ8 A;  2EPF A;  1IF1 A;  4IZZ A;  1YRN B;  2L3D A;  5KNL A;  2FJI 1;  4ZYH A;  1JXS A;  1RPW A;  4M3D A;  4AIK A;  2OI8 A;  2NVY J;  4AVP A;  5BOX A;  2UZK A;  5KCM A;  1Z6T A;  2FSW A;  2W25 A;  1OCT C;  3HUG B;  1LVK A;  2M1B A;  1HXD A;  3KET A;  4RLQ A;  1ODD A;  5JFR A;  3M7G A;  3RI4 A;  1J5Y A;  3JCU C;  2EIL H;  4ZTF A;  3MKY B;  3BPV A;  1NG6 A;  1Y6I A;  4I01 A;  2Z33 A;  3K0L A;  3GFI A;  1UEL B;  2KIU A;  4DZJ A;  4A3E J;  3DPU A;  3GME A;  1FSH A;  4M6X A;  2DK8 A;  1ETV A;  3F1B A;  1ZRE A;  3VYT B;  5LGN A;  3SQN A;  3CLO A;  2RQQ A;  3TKY A;  4M6Y A;  4I99 C;  1GLN A;  4P1W A;  1Y8R B;  5J8C A;  2KL4 A;  3F9K A;  1R23 A;  1J75 A;  5IY5 H;  3PFI A;  4A0X A;  3QPH A;  3ZMV A;  4EAT A;  2LDU A;  1TTY A;  4G7H F;  2FF4 A;  4R79 A;  1QRY A;  1WVR A;  3H9G A;  3MNL A;  3QKX A;  3E5U A;  3CCJ I;  2Y9Z A;  3AQS A;  5HOO A;  5E3N A;  5FRM A;  3SWH A;  3LOC A;  3PJR A;  1JHH A;  1FTZ A;  1BJA A;  1P7J A;  2BY3 A;  4MNU A;  5D5W B;  2RNG A;  3BTC A;  3GZ6 A;  2DPU A;  2X6Y A;  4AYB A;  4RM3 A;  4RAG A;  1DPU A;  2CS3 A;  4GFL A;  4IL6 C;  4BHC A;  4MHG A;  1IGN A;  2FUG 2;  2ME6 A;  3O2P E;  1X2M A;  1SVO A;  2PMZ A;  4CXF A;  5DV5 A;  3HOW J;  3VYR B;  3VPR A;  2ZXW H;  1YOV B;  2R7V A;  3HTU A;  5E3O A;  4XMY A;  4U0W A;  3HBL A;  1ETK A;  3P9C A;  1D5V A;  1FT9 A;  2B3W A;  2NNY A;  2HYT A;  3IUO A;  5FB2 A;  1X1C A;  1A6I A;  2HDC A;  2DT6 A;  4NC8 A;  4XKB A;  1J7K A;  5M5Y J;  4NEL A;  2LBF B;  2F07 A;  2DTZ A;  4NC6 A;  5AON A;  1DP3 A;  1WI3 A;  2WWY A;  2O5R A;  3BQY A;  1HA8 A;  1Y1V J;  2GA1 A;  4XRS G;  4O3M A;  1Y8Q B;  3ZQ7 A;  3IKT A;  1Y0N A;  2DDB A;  5E3L A;  3HE0 A;  2CV1 A;  4CO8 A;  1XD7 A;  3S1Q J;  2M45 A;  2HGC A;  4G8X A;  2OV7 A;  1TWG J;  3LSK A;  4UUS A;  3DXJ F;  3FHN A;  3VSL A;  4KDP A;  1LNW A;  2IGO A;  3GCM A;  3HGG A;  2Z16 A;  1RR7 A;  4F7Z A;  5DTD A;  2BE5 F;  3JSO A;  1PDN C;  2REK A;  2LSO A;  2R92 J;  2R7O A;  3CCR I;  1YW9 A;  4BJT A;  1J59 A;  3L2V A;  2IS1 A;  5IT3 A;  1OKR A;  2P81 A;  4ZYD A;  3K2Z A;  4GXO A;  4JKZ A;  1JT0 A;  1IN8 A;  4RGR A;  2RRE A;  1N78 A;  2E5Z A;  4BAY A;  3BR3 A;  1KYW A;  2LMD A;  3QWL A;  2M8G X;  3QP6 A;  4BL0 B;  1P2F A;  2D5V A;  1MD0 A;  2P7V B;  1YFH A;  2UV1 A;  3KZI C;  3I5U A;  3E6B A;  5D4R A;  2A6T A;  4OAZ A;  1R49 A;  4I0B A;  1Y39 A;  3DU5 A;  2LLK A;  2PEX A;  3RJP A;  3HTA A;  4Q48 A;  2EFP A;  1FOK A;  2ID6 A;  4IF4 A;  3K4C A;  1KQ9 A;  3I54 A;  3H9Q A;  3LSI A;  4EEF G;  2NVX J;  4YZE A;  3B81 A;  2BY0 A;  3I9V 2;  1MMD A;  4DZP A;  2FBH A;  5LHH A;  2Q2E A;  1I27 A;  1R00 A;  1Z9C A;  2XIG A;  3LSG A;  3TBI A;  1ZAR A;  4MTE A;  3K1M A;  1R5G A;  4WCG A;  2NVT J;  1VND A;  3OYG A;  1ZG1 A;  1PJR A;  1DU0 A;  2CQN A;  3I4N J;  2HZD A;  2P5V A;  3L2Q A;  4HPQ A;  1HF0 A;  3FK6 A;  1XX5 A;  4IHT A;  1XTA A;  2VJJ A;  2L9S A;  5B3S H;  3KZY A;  4Y7N J;  2L7Z A;  4KT5 C;  3HIF A;  3ZQH A;  3V6G A;  5A2Q Z;  2PJR B;  2WAQ A;  1IUF A;  4IPA A;  2FRH A;  3RPQ A;  2P8T A;  5IOZ A;  2VON A;  3RYP A;  2R5Y A;  3RPU D;  6PAX A;  1OIS A;  1D0Z A;  2GIV A;  2NYX A;  3O8G A;  4M9S A;  1T0F A;  3SZT A;  3H36 A;  2XAH A;  2D45 A;  2QGU A;  3MWM A;  1LEB A;  1ETY A;  2P0W A;  1D1B A;  1MH3 A;  1D0X A;  3WG9 A;  2R7R A;  2L9R A;  2R0Q C;  2ELK A;  1REP C;  1QZY A;  2BXZ A;  2VT3 A;  4I76 A;  3BQZ A;  1F4K A;  2NAZ A;  2GA2 A;  3CZ6 A;  3WGI A;  4GCL A;  2X1E A;  5DDG A;  2R7W A;  1U8R A;  2DJI A;  3K69 A;  2R4G A;  3KEO A;  1A6Q A;  1DQU A;  3PNY A;  1ETX A;  1H0M A;  1Q1V A;  2OTL I;  4IOC F;  1ZG5 A;  4I7H A;  2X9D A;  2H6C A;  1MZB A;  3QOD A;  1OYY A;  4G7O F;  3LJL A;  1NH3 A;  4W97 A;  1I39 A;  3D5S C;  3SFZ A;  2VBZ A;  3EQL F;  3CDH A;  3WGG A;  2HQ5 A;  2V6C A;  4LIU A;  3TW6 A;  5A2Q K;  3TED A;  5GAD J;  4UUS B;  1MBF A;  3GTK J;  2XV4 S;  1IG7 A;  2RKH A;  2R7Z J;  3WTS C;  4GFK A;  3G56 A;  1SVL A;  2KFD A;  2JVH A;  3RKX A;  1RC9 A;  2DOA A;  1HST A;  2DMU A;  4RB1 A;  1SAU A;  3GTG J;  3OYL A;  1N25 A;  2BY1 A;  2L02 A;  1X58 A;  2CGP A;  3C2G A;  1VI0 A;  2K3F A;  1TWF J;  4MLO A;  4RMN A;  4FQG A;  3WE2 A;  2FBK A;  3AAF A;  1ZLJ A;  3FKJ A;  5HOD A;  1ZHF A;  5KAI C;  1KZH A;  2PBI A;  3PO2 J;  1QU3 A;  3DBH B;  4O5V A;  2VKE A;  3ABU A;  3G3Z A;  2FBQ A;  4AC6 A;  5D5U B;  1X4O A;  1H88 C;  3RH2 A;  3SZG A;  2BW3 A;  2J5O A;  5JI6 A;  5K5Q A;  3E7L A;  5ILS A;  4JOM A;  3EUH A;  3S32 A;  3WU2 C;  2DA7 A;  3OSF A;  2LNB A;  1BJZ A;  2R7X A;  5HVQ C;  5JVT A;  3GZ5 A;  4FIS A;  2ELH A;  2JA8 J;  5F0C A;  2K27 A;  3NWS A;  4ZDP A;  1JE8 A;  5HLG A;  5BPD A;  5FD5 A;  3CC2 I;  1Y0U A;  3BNI A;  1RES A;  1IO2 A;  1R4M B;  1X1D A;  2KZG A;  2XAG A;  3LFK A;  3TDU C;  3Q3S A;  2A5W A;  5IOY A;  3DTE A;  2LD5 A;  1ZYR F;  3HTI A;  2YPR A;  4BXX J;  3LSR A;  3L2C A;  2XDN A;  4XL9 A;  1C0W A;  2RVC A;  3FMS A;  3OSG A;  4L0Y B;  3S3M A;  5IYC J;  3ASO H;  4A3B J;  1LQ1 A;  3AG1 H;  3VEP A;  2QYO A;  5J4Y A;  1XDU A;  2Q2E B;  5TRD A;  3D5R C;  4FET A;  3TOB A;  3TO7 A;  4L9J A;  2GXA A;  4V19 K;  4NBQ A;  2PJP A;  2JRM A;  4IHX A;  4HBL A;  4XRS A;  2K9N A;  2GWR A;  3I55 I;  2P5L C;  5CXI A;  4IQJ A;  1QVT A;  4BH9 A;  1IXR C;  5EGO A;  4ZZL A;  4OIP F;  1BW6 A;  2NRA C;  4Q5S F;  4WXD A;  4XKW A;  1U9N A;  4XOP A;  5J1R A;  5HAW A;  1K7A A;  3DU6 A;  1Z7U A;  3Q9S A;  2DN0 A;  2KP6 A;  4AU7 A;  3KLO A;  4HQE A;  1HW5 A;  1HSJ A;  1MBK A;  3QYB A;  3N97 A;  2DG8 A;  2XB5 A;  4N9H A;  3ABK H;  4HV6 A;  2R5Y B;  4DJA A;  2CUE A;  1FNN A;  4M72 A;  3BHQ A;  3CDI A;  4PJL A;  3T1B A;  5B1A H;  3LA3 A;  1FIP A;  1S7E A;  2HS5 A;  4BHP A;  3IUV A;  1T0F C;  1YI2 I;  2DA2 A;  5JHU A;  3F22 A;  3PQK A;  1Y56 A;  1HCR A;  3E7Q A;  4HNV A;  2IGN A;  3DPJ A;  2CRG A;  2JZY A;  3LHQ A;  2XSJ C;  5F1J A;  3L00 A;  3JRI A;  4BE2 A;  2G3B A;  3RIR A;  4P55 A;  1X1B A;  1GHC A;  4UVC A;  5LBQ A;  4D5C A;  2CQQ A;  3VW1 A;  2GOX B;  3QPL A;  5LRR A;  2CQK A;  1UFM A;  1H8A C;  3FXL A;  3GEU A;  4IRV A;  1QNT A;  1R7J A;  1WSU A;  3PNT A;  2JA2 A;  3GTO J;  2FOW A;  2EFN A;  3E6M A;  3D0S A;  5FRN A;  3PNV A;  1G4D A;  2ECC A;  1YO5 C;  4FE4 A;  2LH9 A;  1MH4 A;  1MSF C;  2V79 A;  4BGD A;  2QQA A;  4UUT A;  4AID A;  3MVP A;  2Y0S N;  3CO7 C;  1A04 A;  3N4M A;  3H9J A;  1UHS A;  2BW3 B;  2E7W A;  3DLL F;  4N4N B;  1B9N A;  2QCO A;  4M9X A;  4IRH A;  5HNF A;  4OD5 A;  3ABM H;  3V8K A;  1W36 C;  1SMY F;  1JTX A;  4LK1 F;  5LD2 C;  5FKM A;  4ZYE A;  3QP5 A;  1OCC H;  3GZN B;  1FYL A;  5DM7 F;  4B47 A;  2IA1 A;  4WF2 A;  1WH7 A;  3U9G A;  3ZMD A;  1ORK A;  3VOX A;  1U78 A;  5HDG A;  2QLZ A;  3ZCO A;  4KIT B;  5E8I A;  4LG0 B;  5JVG F;  2CQ7 A;  2K40 A;  2MYS A;  2XKO A;  2ZME A;  5JR3 A;  1FZP B;  4EJT A;  3ELK A;  1GXQ A;  5LGU A;  3CUQ A;  2XGD A;  3K2A A;  1O3Q A;  1LDK B;  5F0H A;  4KT6 A;  1IV6 A;  1ZKG A;  1ZN2 A;  2L0K A;  4RB3 C;  2F2E A;  5ILU A;  1S72 I;  4GFB A;  2NP5 A;  1P9Q C;  5ICC A;  2XKP A;  5FKL A;  4GCT A;  4EM2 A;  3ECH A;  1JKR C;  2OER A;  4YRV A;  4ZC3 A;  2FA5 A;  3MZH A;  3IC7 A;  2Z9O A;  3RSN A;  3G4S I;  5J4V A;  5EGO B;  3LA2 A;  3QPS A;  2VAS A;  3VOK A;  4B09 A;  2ZXH A;  2NOG A;  3EYY A;  2VPR A;  2IRF G;  2E1M C;  1A5J A;  2VKH A;  2E36 A;  5LRS A;  2X6O A;  1BW5 A;  2P6S A;  3ML6 A;  2P5K A;  2VBW A;  2HPM A;  3S16 J;  1BOA A;  2K86 A;  1YLF A;  2VB6 A;  2J5P A;  3VP5 A;  2KIM A;  3BJ6 A;  2ETH A;  1ETO A;  3AL0 B;  1VQ4 I;  3K4J A;  1B72 A;  2QSF X;  3BWG A;  3LFU A;  3ZP5 A;  2HI3 A;  4GCV A;  3HL2 A;  3FRQ A;  1SFK A;  3VVZ A;  3GXO A;  5EEA A;  3OYI A;  3KEY A;  5KVR A;  1APL C;  4QIW N;  3TO9 A;  3LMM A;  4ZTJ A;  4F93 B;  2FNA A;  4Z2Y A;  4GYI A;  3KYD B;  2NOJ B;  2E1C A;  1VQ6 I;  4D5F A;  4R8H A;  1DPR A;  3HGY A;  4H0E A;  4JQF A;  3LA7 A;  2VUM J;  2V7F A;  4A3L J;  3CCU I;  1T33 A;  1TQI A;  5IYD J;  1GVJ A;  3QAH A;  4HLY A;  4WIB A;  4EJU A;  3MCZ A;  3OOP A;  1S6L A;  2O9L A;  2GFN A;  2VQG A;  3R61 A;  2MW8 A;  5TJJ A;  4U9N A;  1OPC A;  3QBM A;  2L7K A;  2IPQ X;  4QWQ A;  4XOR A;  1WJD A;  1XN7 A;  2O6G E;  3A03 A;  2XVC A;  5IT9 Z;  2HQN A;  3T8T A;  2VE9 A;  5LEJ A;  3CC4 I;  3E3V A;  3H3U A;  1B6A A;  1JGS A;  2VE8 A;  3AG4 H;  3BG6 A;  1U8B A;  4AM3 A;  2G7U A;  2G7H A;  4A3G J;  1W5T A;  1YJ9 I;  4AWX B;  2KHM A;  3V8J A;  1SVM A;  2QKM B;  1BR4 A;  2E7X A;  2KZV A;  3S2D J;  4DBR A;  4UB6 C;  3S8P A;  1K6O A;  3OIQ A;  2JA6 J;  3ZMU A;  3OYK A;  1WI9 A;  2I10 A;  3RKY A;  4BBR J;  4YFN F;  5K7F A;  5LHI A;  2LY2 A;  3TGN A;  1FIA A;  4YII A;  2H1L A;  2L5Q A;  5HSZ A;  5FKO A;  3JRH A;  4LLL A;  3LNQ A;  2GZW A;  4HRI A;  5DCM A;  2ZCX A;  3JR9 A;  1VQ7 I;  3TW7 A;  4A5M A;  4JP0 A;  4LLG F;  5GTH C;  1L3L A;  2OTJ I;  2CW7 A;  4LB6 B;  1UST A;  4ENK A;  1LUJ B;  4IRI A;  1TWH J;  3JSP A;  1ZGW A;  5IT9 K;  3A1Y A;  3PAS A;  2XSD C;  1ZR4 A;  2LFB A;  3P7N A;  1RET A;  1Z7L A;  3MFK A;  2R7S A;  3DEW A;  3I0T A;  1ENH A;  3ZQL A;  2W53 A;  2ZME B;  3CUQ B;  2DCE A;  2MC4 A;  3J7A Y;  1LDD A;  2BBY A;  3BR2 A;  3CLQ A;  4HST A;  5L3C A;  1PUF B;  3PSI A;  3QU6 A;  4ICH A;  5CVR A;  5DD4 A;  3ERE D;  5EEG A;  2QVO A;  2XGX A;  2COB A;  2QWW A;  2GLO A;  3BJA A;  1JTY A;  4M3B A;  3PL8 A;  4S05 A;  1EF4 A;  3KLN A;  5HDK A;  1TL8 A;  5KHD A;  4KWA A;  3R4K A;  3VW0 A;  1QO0 D;  2UXO A;  4Y33 A;  3JRE A;  2Y9Y A;  2O8K A;  2HOA A;  2EB7 A;  2FJ1 A;  4YFK F;  5HDN A;  4LLN A;  5CVI A;  3L09 A;  3V8L A;  4HDV A;  3WOD F;  2MH9 A;  2M5W A;  5M5X J;  2E71 A;  4BQQ A;  1JGG A;  1XMA A;  3B02 A;  2YSR A;  3ZOB A;  1YJW I;  3BZ6 A;  3R60 A;  2QF7 A;  2WC2 A;  4J01 A;  2NX4 A;  1V54 H;  3DFG A;  3DEE A;  1B72 B;  4G6D A;  2D6Y A;  5HLI A;  3HZJ A;  1O3S A;  3DP7 A;  3GO5 A;  2ZJR F;  2VOP A;  3RPU A;  1R9T J;  3IP4 B;  3HTH A;  1XGM A;  2L4A A;  2P4W A;  4Q4Z F;  4B8X A;  3O3K A;  1VQO I;  1WRJ A;  4M74 A;  3K70 D;  2JWT A;  4ASN A;  3I4P A;  4A3M J;  5GP9 A;  4BYY A;  5L3D A;  1X3W B;  1MJB A;  4D0P A;  3RZD J;  2DXI A;  2EH3 A;  4HOB A;  1AWC A;  3MZY A;  3WHB A;  1ETQ A;  1O7L A;  1Z05 A;  3M9A A;  2QBY A;  5CKT A;  2LRD A;  4V2G A;  5AQC A;  4A3D J;  3BT9 A;  3EUA A;  4D7N A;  3L7W A;  1SFO J;  1WPK A;  1PP7 U;  4L5I A;  3DLA A;  4OWR B;  3C07 A;  1JHF A;  2ISY A;  4MTD A;  1T8I A;  1FP1 D;  1MIJ A;  1ZG3 A;  2DMT A;  2DK5 A;  2IS2 A;  5FHP A;  2OCE A;  3DTI A;  2JA5 J;  2QSH X;  3P5J A;  2OBP A;  2KJC A;  2X85 A;  4KIG A;  3SXY A;  3WGH A;  3K4M A;  1BI0 A;  1XCV A;  1E0E A;  2DJN A;  2G7L A;  4XK4 A;  3S3O A;  1RNL A;  1WGX A;  2ZJ2 A;  4L0Z B;  3KZ9 A;  3LSM A;  1XSD A;  4HKU A;  1A35 A;  2TCT A;  2A5Y B;  5GPC A;  5K7Z A;  2CJJ A;  3C18 A;  3RKQ A;  1TT5 B; 
#chains in the Genus database with same CATH homology
 1MBH A;  3F0C A;  2EZK A;  5IOZ A;  2R5Y A;  3HEF A;  2XPV A;  3O8G A;  2H1K A;  1U9O A;  3A02 A;  3EGQ A;  1W0T A;  1ETY A;  3JRB A;  2PZ9 A;  1BA5 A;  1MH3 A;  2GBY A;  4I6Z A;  4A3F J;  4NN1 A;  2L9R A;  2R0Q C;  4UDS A;  5DAJ A;  1IDY A;  2ELK A;  3BTI A;  4I76 A;  5EG0 B;  1JJ8 C;  3HOV J;  3NI7 A;  2Y2Z A;  3BQZ A;  1ETW A;  4CYC A;  5D18 A;  3GTM J;  4IHW A;  2NVQ J;  4GCL A;  1WH5 A;  5IP6 A;  4B4C A;  1ZK8 A;  1ETX A;  2EQR A;  1RKW A;  1Q1V A;  2ZOZ A;  2B63 J;  3L1P A;  3GTP J;  2X9D A;  4JX4 A;  2YUS A;  5C4Y A;  2XGC A;  1K83 J;  3LJL A;  2DMP A;  4W97 A;  2HYJ A;  2YVE A;  3P9T A;  4JX6 A;  2Q24 A;  4X1E A;  3KKD A;  3TED A;  2HQ5 A;  3TW6 A;  5M3F J;  1E3O C;  3B6C A;  4UUS B;  1MBF A;  5EF6 A;  3GTK J;  1IG7 A;  2HXI A;  2R7Z J;  5JLX A;  2RHA A;  1B8I B;  2N8G A;  4GFK A;  3G56 A;  1JKP C;  1CQT A;  1MNM C;  2KT0 A;  3G1O A;  2O7T A;  2DMU A;  1GV5 A;  2HKU A;  4MFD A;  3GTG J;  4L5E A;  3A01 B;  3ANP A;  1X58 A;  1TC3 C;  3S14 J;  2AHQ A;  1VI0 A;  4MLO A;  1TWF J;  3EUP A;  3BG9 A;  5HOD A;  4A3I J;  3BJB A;  3PO2 J;  1F43 A;  4PXI A;  2VKE A;  2X48 A;  4AC6 A;  2FBQ A;  4IEJ A;  2JK3 A;  3JRC A;  4J19 A;  1H88 C;  1I6H J;  3RH2 A;  2DA3 A;  3KKC A;  3CRJ A;  3SDG A;  1H89 C;  2IEK A;  2ID3 A;  3E7L A;  3OSF A;  1Z77 A;  2DA7 A;  2EZL A;  2FD5 A;  1DU6 A;  1T56 A;  3HOZ J;  3S5R A;  1BJZ A;  2WAQ N;  2PBX A;  4FIS A;  4DW6 A;  3HKZ N;  4JYK A;  5F0C A;  5C44 J;  2JA8 J;  1F36 A;  3MN2 A;  3PO3 J;  3BNI A;  1RES A;  1PUF A;  1LFB A;  2DA5 A;  1LE8 B;  5FKN A;  4A3K J;  1HDD C;  3CQZ J;  3Q3S A;  5BNG A;  2LY9 A;  4JX5 A;  3VW2 A;  3WHC A;  5IOY A;  2RAS A;  1JUS A;  2LD5 A;  4MIM A;  3HTI A;  3BTJ A;  4FE7 A;  4A3J J;  2JMW A;  1ZR2 A;  3ZQI A;  3LSR A;  4BXX J;  2XDN A;  3OSG A;  2ME0 A;  5IYC J;  4A3B J;  2L7F P;  2NP3 A;  4ABZ A;  3BG3 A;  2JN6 A;  1JUM A;  3VVY A;  2DA6 A;  4IHX A;  4XRS A;  5C4X J;  1RKT A;  3HOX J;  5IP7 J;  2K9N A;  5IP9 J;  5CXI A;  2E1O A;  1OJL A;  4XID A;  3IV5 A;  1POG A;  1QVT A;  5FLV A;  5EGO A;  2MSY A;  1BW6 A;  5J1R A;  1U9N A;  3S1R J;  5HAW A;  1NK2 P;  4B1R A;  2DN0 A;  1XG1 A;  3VUQ A;  1VFC A;  2ECB A;  2DG8 A;  1MBK A;  3O8H A;  2XB5 A;  3JRD A;  2E19 A;  2R5Y B;  2CUE A;  2G7G A;  3IH4 A;  2DA4 A;  3JRG A;  3BHQ A;  2JJ7 A;  2RAE A;  4FCY A;  1FIP A;  3ON4 A;  1S7E A;  1NK3 P;  1I3Q J;  5EDN A;  3D1N I;  3ZQG A;  3IUV A;  3ZQF A;  2DA2 A;  3BR0 A;  4CYC B;  4XRM A;  4DYQ A;  4QTR A;  1HCR A;  5EZH A;  3O60 A;  4BBS J;  1MBE A;  5H9T A;  5FMP A;  3E7Q A;  4HNV A;  4M3E A;  2QTQ A;  2AO9 A;  1UMQ A;  2XPU A;  3DPJ A;  3NAU A;  4NDL A;  2CRG A;  3LHQ A;  5F1J A;  3JRI A;  3HOU J;  5JLW A;  2G3B A;  1BL0 A;  2R5Z A;  2CU7 A;  2DMN A;  2NS8 A;  2LR8 A;  2CQQ A;  4D5C A;  3VW1 A;  2ZOY A;  3QPL A;  4ME9 A;  4A69 C;  1H8A C;  3GEU A;  1IC8 A;  2W48 A;  3S1N J;  1ZQ3 P;  3FIS A;  3RZO J;  3GTO J;  4XIC A;  2OF7 A;  3AQT A;  5D1R A;  3COL A;  1QVU A;  2VKV A;  2M34 A;  2DG7 A;  2G0E A;  1K61 A;  3JSJ A;  1I50 J;  2ECC A;  4D7M A;  2VI6 A;  1O4X A;  4FE4 A;  2LK2 A;  1MH4 A;  1MSF C;  1QPI A;  1SAN A;  3OOU A;  1FTT A;  3JRF A;  2UXI A;  5J1U A;  4V2F A;  1MBG A;  4UUT A;  3MVP A;  1JT6 A;  2Y0S N;  3PM1 A;  5C4J J;  1XS9 A;  2GM4 A;  2K9Q A;  2FQ4 A;  2IBD A;  1GDT A;  1UHS A;  4A93 J;  3GTL J;  4Y52 J;  3GZI A;  3DCF A;  5FGL A;  3TP0 A;  2UXU A;  2QCO A;  1MSE C;  1FEX A;  3ZQC A;  1JTX A;  2GEN A;  2ZB9 A;  5FKM A;  5J1Y A;  9ANT A;  4C2M J;  1GV2 A;  4MK6 A;  3S17 J;  1WH7 A;  2DA1 A;  4RBO A;  1ORK A;  3BRU A;  1U78 A;  3CJD A;  4X6A J;  3VOX A;  2OPT A;  5HBU A;  4C3I J;  5C3E J;  2K40 A;  1W0U A;  4QSH A;  1ITY A;  2GUH A;  2NX4 A;  1OFC X;  2XGD A;  1D5Y A;  3K2A A;  4BY7 J;  2HOS A;  4IHV A;  5F0H A;  1IV6 A;  2MG4 A;  1ZKG A;  2L0K A;  2HXO A;  5IPA A;  4GFB A;  2NP5 A;  4JL3 A;  1UI6 A;  3IH2 A;  5FKL A;  4GCT A;  1JKR C;  2OER A;  1AHD P;  5K58 A;  2YS9 A;  1HOM A;  5EGO B;  3HTJ A;  3QPS A;  3VOK A;  2LTP A;  3JRA A;  3CCY A;  3S15 J;  3CWR A;  4AF5 A;  2XGE A;  2NOG A;  3ANG A;  2EZI A;  3CMY A;  1IRZ A;  4DYC A;  2VPR A;  1A5J A;  1GVD A;  1ZTR A;  1JUP A;  5F0F A;  5K7H A;  2TRT A;  2CUF A;  2X6O A;  3RQI A;  1BW5 A;  3S2H J;  1YRN B;  3S16 J;  2XB0 X;  1RPW A;  4M3D A;  2HOT A;  2JA7 J;  2OI8 A;  3BG5 A;  2NVY J;  2UXP A;  5J3L A;  3VP5 A;  1ETO A;  1B72 A;  1P7I A;  1OCT C;  2HI3 A;  3FRQ A;  3VVZ A;  5EEA A;  1X2N A;  1APL C;  4QIW N;  2MGQ A;  1TWA J;  2K9S A;  3NXC A;  3VIB A;  1LE8 A;  1XC5 A;  2L7M P;  2UXH A;  2E2H J;  3FKI J;  1GUU A;  4L62 A;  4D5F A;  1TWC J;  3BR5 A;  3HGY A;  2WV1 A;  4CGR A;  2VUM J;  4A3L J;  1T33 A;  4DZJ A;  5IYD J;  4A3E J;  2R5Z B;  3FIW A;  2O9L A;  2NS7 A;  2GFN A;  1ETV A;  2MW8 A;  3F1B A;  1LFU P;  3QBM A;  5EFY A;  3A03 A;  1OCP A;  2WB1 N;  1AKH A;  2H8R A;  1HLV A;  3CDL A;  1IDZ A;  3ON2 A;  5F04 A;  3I4M J;  1JKQ C;  5IYB J;  1U8B A;  3HIM A;  3BCG A;  2WGB A;  3MNL A;  1QRY A;  2M9H A;  3QKX A;  4A3G J;  2R93 J;  2Y9Z A;  3AQS A;  2QWT A;  5E3N A;  5M5W J;  3LOC A;  1FTZ A;  1P7J A;  1Y1W J;  4B3A A;  1JKO C;  3S2D J;  5EYR A;  3QQA A;  2JA6 J;  2I10 A;  4BBR J;  3BTC A;  5K7F A;  3HOY J;  1FIA A;  4DYR A;  4MO7 A;  2LP0 A;  5HSZ A;  4BY1 J;  3MKL A;  4GFL A;  5FKO A;  3JRH A;  2E2I J;  3LNQ A;  1IGN A;  4IHY A;  2ZCX A;  4GCK A;  3JR9 A;  2Y30 A;  2ME6 A;  3TW7 A;  4JP0 A;  4C3H J;  1X2M A;  3PPB A;  2IU5 A;  1AU7 A;  3HOW J;  1TWH J;  3K7A J;  3VPR A;  1ZGW A;  3PAS A;  3HB9 A;  2XSD C;  3Q0V A;  1ZR4 A;  1SGM A;  3S1M J;  2LFB A;  5E3O A;  4MXM A;  1RET A;  3HBL A;  1ETK A;  3W6V A;  3DEW A;  5E3M A;  2HYT A;  5F08 A;  5FLM J;  1ENH A;  1UG2 A;  3ZQL A;  2W53 A;  1G2H A;  1A6I A;  3UKG A;  5CXG A;  5EG0 A;  2QIB A;  5M5Y J;  4NEL A;  2XPW A;  3LSP A;  2F07 A;  2DTZ A;  3BR2 A;  1WI3 A;  4FTH A;  1PUF B;  3M4O J;  3BQY A;  3B6A A;  3C2B A;  1JJ6 C;  3T6N A;  1Y1V J;  2Y31 A;  4ICH A;  4XRS G;  2COB A;  2GLO A;  5E3L A;  1WCM J;  3HE0 A;  1JTY A;  1NTC A;  4M3B A;  4A3C J;  3TP3 A;  1EF4 A;  3S1Q J;  4KWA A;  3VW0 A;  2UXO A;  3H0G J;  3KNW A;  4AC0 A;  4W1U A;  1TWG J;  4BKX A;  3JRE A;  2Y9Y A;  4C3J J;  2O8K A;  2HOA A;  2FJ1 A;  4UUS A;  2ZCN A;  3NPI A;  3BR6 A;  1VF9 A;  3Q0U A;  5M5X J;  1B8I A;  4G12 A;  3HGG A;  1RR7 A;  2QOP A;  4M6V A;  1IJW C;  1JGG A;  2YU9 J;  3Q0W A;  5DTD A;  3ZOB A;  3SFI A;  4M3F A;  3A01 A;  2M0C A;  2QF7 A;  1GT0 C;  2REK A;  2KDZ A;  2R92 J;  3RD3 A;  2XRL A;  1B72 B;  2D6Y A;  1HDP A;  5EZG A;  2P81 A;  1Z0X A;  1MBJ A;  3HM5 A;  3FK7 A;  3SJM A;  1R9T J;  4JKZ A;  1JT0 A;  3HTH A;  3G1L A;  2ZCM A;  4S0H B;  5CW8 A;  1FJL A;  2HDD A;  3M3Y J;  3V78 A;  3BR3 A;  4AYB N;  5DS9 A;  2CQX A;  3LWJ A;  4AUX A;  2JWT A;  4A3M J;  3H3V K;  3GTQ J;  3OIO A;  5GP9 A;  2M8G X;  2D5V A;  3RZD J;  2EH3 A;  3HDD A;  3WHB A;  2PMZ N;  2QKO A;  1ETQ A;  3BR1 A;  4V2G A;  5AQC A;  4A3D J;  3BT9 A;  5F27 A;  2O7O A;  4D7N A;  2LLK A;  1SFO J;  3G7R A;  3NNR A;  4RDU A;  1AKH B;  3VVX A;  1WPK A;  2EBI A;  3C07 A;  3HTA A;  5D19 A;  4LOC A;  2E2J J;  2M2E A;  2ID6 A;  5FKK A;  2DMT A;  5FHP A;  4M3G A;  4YZE A;  1UI5 A;  4EEF G;  3IH3 A;  2NVX J;  3B81 A;  3G1M A;  2JA5 J;  3NAR A;  4ACI A;  4DZP A;  2YVH A;  2NVT J;  3LSG A;  4MFE A;  1VND A;  3GBG A;  2EZH A;  2LKX A;  1YRN A;  5M3M J;  1DU0 A;  2WUI A;  3LSJ A;  2V57 A;  3I4N J;  2DJN A;  3GTJ J;  2IAI A;  2G7L A;  4XK4 A;  1HF0 A;  3FK6 A;  1WGX A;  2DMQ A;  5FJ8 J;  4JNN A;  3KZ9 A;  4Y7N J;  4HKU A;  2L7Z A;  2LVS A;  3ZQH A;  2TCT A;  3BTL A;  3V6G A;  5GPA A;  5GPC A;  1IUF A;  2G7S A;  5K7Z A;  3NRG A;  2CJJ A;  3RKQ A;  2FX0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...