3IH3A

Tm1030 crystallized at 310k
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
202
structure length
202
Chain Sequence
b'GHMLSKRDAILKAAVEVFGKKGYDRATTDEIAEKAGVAKGLIFHYFKNKEELYYQAYMSVTEKLQKEFENFLMKNRNRDIFDFMERWIEKKLEYSASHPEEADFLITLVSVDEGLRKRILLDLEKSQRVFFDFVREKLKDLDLAEDVTEEIALKFLMWFFSGFEEVYLRTYQGKPELLKRDMNTLVEEVKVMLRILKKGMTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, TetR family
publication title 'Hot' macromolecular crystals.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transcription regulator
total genus 70
structure length 202
sequence length 202
ec nomenclature
pdb deposition date 2009-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3ih3A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3ih3A02
1GV2A 3A03A 2H1KA 2ZCNA 5D1RA 1UHSA 2WV1A 3OSGA 1B72A 3A01A 4M3EA 2JMWA 5F1JA 1B8IB 2DA5A 2W48A 3BTLA 5IPAA 1POGA 3TEDA 4XRSG 4A93J 2GENA 1H89C 1HDDC 1APLC 1Q1VA 5E3OA 3ZOBA 2JA6J 2QWTA 2NOGA 4B1RA 4UUTA 2DMNA 3RD3A 2EZHA 2Y0SN 3BG5A 1MSFC 1Y1WJ 1I50J 1BL0A 1X2MA 2COBA 2ZCMA 3BNIA 2R5YB 2GBYA 3NAUA 1I3QJ 1FEXA 3RZOJ 2L9RA 1GUUA 1OFCX 2X6OA 4UUSB 2HXOA 3FK6A 3LNQA 3ON4A 3ZQCA 1ITYA 2JWTA 3PPBA 2HOAA 2NX4A 4IHXA 2EZLA 4CYCA 2NVXJ 2K9NA 3NXCA 4S0HB 3HTAA 3DEWA 3BR2A 4M6VA 3JRDA 1DU0A 5C4JJ 5GPCA 1VNDA 4A3EJ 1HCRA 1UI6A 2ZOYA 5EG0B 5C44J 5EFYA 3H3VK 1JKPC 1T33A 2IEKA 3IV5A 3BR6A 3M4OJ 1LFUP 3ANGA 4A69C 2HYTA 1MBGA 3JRHA 3D1NI 1SGMA 2O9LA 3JRIA 3B81A 2EZIA 1ETKA 1RETA 5HAWA 5M5YJ 4BBRJ 5DTDA 1YRNB 2M9HA 2XRLA 4NN1A 3MVPA 1JKRC 4BKXA 1JUSA 4A3MJ 4A3GJ 3Q3SA 5F0HA 3LWJA 1XS9A 4X6AJ 1WPKA 1MH4A 1IG7A 9ANTA 4PXIA 1UI5A 3VVZA 1A5JA 1RPWA 3S1QJ 1D5YA 3GBGA 1FJLA 4ME9A 5J1RA 1LE8B 2ECCA 3QBMA 3TP3A 5HODA 2O8KA 3I4NJ 3S15J 3FRQA 2LD5A 2H8RA 4C3JJ 3BCGA 1JT0A 4ABZA 4AC0A 1I6HJ 1AHDP 5F0CA 3AQTA 1W0TA 2NP5A 5CXIA 3TP0A 4BBSJ 3I4MJ 1W0UA 3L1PA 3HB9A 3T6NA 2QTQA 1UG2A 1WCMJ 4DZPA 2AO9A 4AUXA 3HOWJ 4RDUA 4HNVA 1AKHB 2N8GA 3LHQA 2VKEA 4DYQA 3BT9A 5K7FA 5IP7J 1U8BA 3RQIA 1Z77A 1JJ8C 3BG3A 4MFDA 2LFBA 2PMZN 3VPRA 3JRAA 2GLOA 3GTKJ 2M0CA 1AU7A 1RR7A 3VW2A 5EEAA 1NTCA 2XPWA 5IOYA 1VFCA 2ZOZA 5IP9J 2AHQA 5E3NA 4GFBA 5FLVA 1FIAA 3BTJA 3JR9A 3OIOA 3JRBA 2OI8A 2X48A 5EYRA 1WH7A 1B8IA 4UDSA 1TWFJ 3G7RA 4D7NA 2UXOA 3HGYA 4DZJA 2UXPA 3GTLJ 3BHQA 1QVUA 5F04A 1ZR4A 3S14J 2TRTA 4D7MA 2LTPA 1QPIA 3UKGA 3EGQA 2B63J 2NS8A 4JX4A 4GCTA 4DYCA 3KKDA 2M8GX 3BR0A 3LSRA 2R92J 2M2EA 2R5YA 3V6GA 1FTZA 3G1LA 1MBFA 1RESA 2CJJA 1JUPA 2NP3A 3KKCA 4IHYA 5FKOA 2YUSA 4UUSA 1NK3P 2XB0X 2EBIA 2WB1N 4QSHA 1ORKA 3QKXA 4ACIA 2L7ZA 1ENHA 2HOTA 2CRGA 3P9TA 2CUEA 2DG7A 1IDYA 1VF9A 2G3BA 2EH3A 3VOKA 2DMUA 3S2HJ 3NPIA 2L0KA 2MSYA 3LJLA 2QF7A 4XIDA 1TWGJ 5D18A 1RKWA 2TCTA 2QCOA 2YU9J 2OPTA 2YVEA 4XRMA 3COLA 2DJNA 5EG0A 2E19A 1Y1VJ 1BA5A 4RBOA 1MBEA 1TC3C 4XRSA 4EEFG 2FQ4A 4JP0A 1OJLA 3JSJA 1P7JA 3C2BA 3GTJJ 2RHAA 4HKUA 3S16J 3CDLA 3BR3A 4XICA 2REKA 1OCPA 4W1UA 4I76A 2ECBA 3FISA 2IU5A 2OERA 3NI7A 4MIMA 3HOYJ 1IRZA 4FISA 3BRUA 4GFLA 3BR1A 1VI0A 1MBJA 5FKMA 4V2FA 1IDZA 2Y9YA 3SDGA 2G0EA 3OOUA 4G12A 2R5ZB 4I6ZA 3S1MJ 5H9TA 3S1NJ 1HDPA 4IEJA 2D6YA 3MKLA 2O7OA 3A01B 3DCFA 3HGGA 3RH2A 3CQZJ 2DA4A 3GTQJ 3GTOJ 2L7MP 2LP0A 2M34A 3HM5A 1NK2P 3CRJA 4FE7A 1XC5A 3LSPA 1TWCJ 2Q24A 3KNWA 4MFEA 5IOZA 1ETOA 5F08A 1ETYA 2YVHA 5FKKA 2Y9ZA 1HF0A 2NVYJ 5J3LA 3HE0A 2VUMJ 5FMPA 1O4XA 1MH3A 4A3IJ 1GVDA 3WHBA 3Q0VA 1AKHA 1BW5A 2XB5A 2WUIA 3BQZA 3JRFA 2G7GA 5IYBJ 3CMYA 4FTHA 5AQCA 3VOXA 3S2DJ 2HI3A 3W6VA 5EZHA 2V57A 3G1MA 2G7LA 1U78A 3FIWA 2JA8J 3VW0A 4L62A 5J1YA 2OF7A 3PO2J 3BQYA 1LFBA 2L7FP 2YS9A 3IH2A 5D19A 4GFKA 3F1BA 4JX6A 4DW6A 1IUFA 1ZGWA 2DA2A 1HOMA 1R9TJ 3PASA 3OSFA 1F36A 3BG9A 2IAIA 3QPSA 3ZQGA 4W97A 3GTPJ 4CGRA 3LOCA 3NNRA 1K83J 3LSJA 5CXGA 1UMQA 4Y7NJ 5IP6A 5EGOB 3O60A 4AC6A 1FIPA 1BW6A 4A3CJ 1MBHA 4Y52J 5M5XJ 3A02A 5FGLA 3E7LA 3CCYA 4FCYA 3Q0WA 2LY9A 3HBLA 5J1UA 3H0GJ 3TW7A 2PBXA 1ZKGA 2DN0A 5FHPA 2JK3A 2LKXA 1HLVA 3ZQLA 3FK7A 4QTRA 2FX0A 1JTXA 5C3EJ 3O8GA 3JRCA 2JA7J 3HIMA 1IV6A 2W53A 3MNLA 2CU7A 2HYJA 1RKTA 1H8AC 3ZQFA 5F0FA 2KT0A 2NVQJ 3GTGJ 3VP5A 3ANPA 2DG8A 2PZ9A 3JREA 5IYDJ 1IC8A 3HEFA 3MN2A 2ME0A 1JKQC 1JTYA 2UXUA 3E7QA 1PUFB 5FKNA 4IHWA 2UXIA 1S7EA 1FTTA 1H88C 3O8HA 3IUVA 2XSDC 5IYCJ 1ZR2A 2K9SA 2RASA 1X58A 4C3HJ 2D5VA 4BXXJ 3GZIA 1TWHJ 2K40A 2X9DA 4MK6A 3NARA 2DA1A 4YZEA 3IH4A 3F0CA 1GV5A 3KZ9A 2LR8A 3ON2A 3AQSA 1F43A 4KWAA 4AYBN 2UXHA 3ZQIA 2R5ZA 2K9QA 3GEUA 2ID3A 3JRGA 3BR5A 1ZQ3P 5DAJA 5GPAA 2P81A 3RZDJ 4LOCA 4JKZA 2IBDA 4GCKA 2DA3A 1U9NA 3BJBA 2R0QC 3BTIA 3S5RA 2WAQN 2XGDA 2E2HJ 2XDNA 1OCTC 2FBQA 4A3FJ 1YRNA 2O7TA 3C07A 2VI6A 2Y31A 3GTMJ 3B6AA 4MXMA 2R93J 4JX5A 2I10A 4GCLA 4FE4A 5HSZA 4M3GA 1SFOJ 2XGEA 1JT6A 3IH3A 5F27A 2GUHA 1X2NA 2QKOA 1JUMA 1GDTA 1T56A 1B72B 2E2IJ 1CQTA 1E3OC 1P7IA 3QQAA 4X1EA 1LE8A 5EZGA 3SJMA 4BY1J 4ICHA 1GT0C 4MLOA 3DPJA 1ZTRA 2CUFA 3PM1A 4J19A 2DA7A 3CWRA 4JL3A 2JA5J 5JLWA 1MBKA 2CQXA 3FKIJ 2EQRA 1MSEC 3HOVJ 3Q0UA 3HDDA 1JJ6C 4A3BJ 2NS7A 4B3AA 1JKOC 2E2JJ 5HBUA 3B6CA 3NRGA 5C4YA 4JYKA 2FJ1A 1WI3A 5EDNA 1MNMC 5M3FJ 2HQ5A 3RKQA 1XG1A 5EF6A 3TW6A 4BY7J 3M3YJ 4DYRA 4V2GA 2ME6A 3VVYA 4CYCB 2ELKA 3HOZJ 2DMTA 3VVXA 5E3LA 1QRYA 1WH5A 5EGOA 2HDDA 1IJWC 2DA6A 1U9OA 3HOXJ 3G56A 2Y2ZA 4M3BA 2LVSA 2DTZA 2HKUA 4L5EA 2NVTJ 1ZK8A 4M3FA 1SANA 1JGGA 1ETWA 4MO7A 2VKVA 3HOUJ 1ETXA 2CQQA 3S1RJ 1BJZA 1ETQA 3EUPA 3HKZN 4M3DA 5FKLA 2MW8A 1Z0XA 3ZQHA 3VUQA 1QVTA 5K58A 5FJ8J 2XPUA 2ZB9A 2Y30A 2KDZA 2DMPA 4A3LJ 2QIBA 1ETVA 2DMQA 3VIBA 2VPRA 5GP9A 2F07A 4NELA 1A6IA 1TWAJ 4D5CA 3QPLA 1PUFA 5K7ZA 3G1OA 4A3JJ 2ZCXA 5E3MA 3S17J 3K2AA 3HTJA 3VW1A 3K7AJ 4A3DJ 2WGBA 2LK2A 2E1OA 4NDLA 2MG4A 4A3KJ 5DS9A 2XPVA 5M3MJ 2EZKA 5M5WJ 4QIWN 3CJDA 2FD5A 2GM4A 3HTHA 3SFIA 2R7ZJ 4AF5A 5BNGA 4D5FA 2JJ7A 3WHCA 5FLMJ 2RAEA 3HTIA 4IHVA 2GFNA 5C4XJ 5K7HA 2MGQA 2HOSA 3V78A 4C3IJ 1DU6A 2G7SA 4JNNA 2HXIA 1G2HA 2JN6A 4XK4A 1IGNA 2LLKA 3LSGA 1EF4A 3BTCA 1K61A 2QOPA 5JLXA 2ID6A 2XGCA 5CW8A 4C2MJ 3PO3J 1WGXA 4B4CA
chains in the Genus database with same CATH superfamily
4IF4A 4ENMA 1ACIA 5D4SA 4BQOA 2XHKA 3KLNA 5GTIC 1UG0A 1LVKA 3A01A 2XVCA 4OIPF 3GCMA 3HTSB 4XRSG 4A93J 1H89C 1B59A 1Q1VA 2QWTA 4EM1A 2NOGA 4V19K 5LGNA 2VKHA 2DMNA 3BPXA 3K1PA 2Y0SN 1Y39A 2FMYA 2VBYA 3DQVC 3H9QA 3CUQA 4DJAA 1BL0A 4HLXA 1PP8F 1BR2A 3BNIA 3DP7A 2R5YB 3OYNA 3ABLH 4I2OA 3REOA 1T8IA 1WZ2A 3ZGKA 2L9RA 3ZMUA 3L7WA 5ERIA 1Y56A 2VXDA 4NHJA 3BDDA 3FK6A 4HX7A 4UHTA 3CCQI 1R71A 2EZLA 3DPTA 4Z6YA 2GWRA 2K02A 4WK8F 3QWLA 3DEWA 1O57A 2HPIA 2L4MA 5C4JJ 2R7FA 1VQ5I 4A3EJ 1UI6A 4PJMA 4ESJA 1JKPC 1WJCA 2NOJB 2K3FA 3M4OJ 5JVTA 3P9CA 1LFUP 1V55H 1MBGA 3D1NI 4WX9A 1SGMA 3BP8A 3J7YJ 3JRIA 1X1PA 3HKZA 3G3ZA 4XLFA 4MTEA 2EZIA 1ETKA 1G8XA 1R5HA 1RETA 1X3ZB 3SEZA 5J8FA 5M5YJ 4OIQF 2E7WA 2M9HA 1BM9A 1FP2A 2XRLA 4N9IA 4A3MJ 3I53A 3I4PA 5F0HA 1KZHA 2D1VA 2VKDA 2HKOA 4LG3A 3WE3A 3KP7A 2K3PA 4PXIA 3SZPA 2HVSA 5FO5A 5B1BH 1UI5A 3VVZA 3S1QJ 5D5UB 5J1RA 1LE8B 3VSKA 1C0WA 4EJTA 1SFEA 4E4HA 3IC7A 3J80Z 2QBYB 1AHDP 5F0CA 3LA3A 4UUVA 5J4VA 3PQKA 1ZH5A 5GTHC 2EIKH 3L1PA 3HB9A 3T6NA 1UG2A 4S05A 1DGRM 4DZPA 4AUXA 1R36A 2KLOA 2F6CA 4HNVA 1AKHB 2V79A 3GVAA 3WTZA 3HXLA 3S2WA 4BE2A 1SFKA 2KP6A 1XPXA 3BG3A 1Z91A 1LQ1A 2KZGA 3J7AO 4MFDA 1T6SA 1QZYA 1X3UA 3K10A 1LDDA 2CW7A 1D0XA 4WXCA 3VPRA 2M0CA 1SMTA 4C2MA 4D0PA 1S6LA 4U9LA 4AYBA 2XPWA 5IOYA 1VFCA 5ED4A 2HYGD 4BJ5C 2LF7A 2RREA 3DTKA 3GMEA 5IP9J 1I5ZA 3ABKH 1HKQA 4BEHB 2Y69H 1WJEA 2JVHA 4ENJA 3GWZA 2HDWA 2Z5UA 4BYYA 1FIAA 3OYJA 1O3SA 3JR9A 3OIOA 2VQGA 2X1CA 2X48A 5EYRA 3I3LA 1QZZA 3G7RA 1DQUA 4D7NA 2P7CB 3BHQA 3HHHA 5GADJ 3S14J 4D7MA 4U0WA 1MJBA 2Y0SA 3K70D 1FOWA 3CMAI 3BOQA 1K6OA 2MABA 3UKGA 1MMSA 3W6KB 3GFIA 3FWEA 4DYCA 3KKDA 3OS1A 2M7AA 3BR0A 3CMMA 1KONA 1YE9A 3I9V2 2R7XA 2MD0A 5FKOA 3HUGB 4UUSA 4I99C 1ORKA 4QSHA 3QKXA 5D8LB 2CRGA 3P9TA 2LDUA 2HTSA 2WY8Q 3R4KA 3VOKA 2D1HA 1U5TC 3ZMTA 1R1UA 2E5NA 3NPIA 2L0KA 1DDNA 4A2UA 4XIDA 2TCTA 2YU9J 2OPTA 2YVEA 2M8EA 2DJNA 2YSRA 1ZG5A 4BHCA 5EG0A 2E19A 3PL8A 5IT9Z 1TC3C 4XRSA 3JSJA 4HSRA 3T1BA 2F5VA 3LSTA 5LHIA 3IL2A 4HKUA 3OMYA 2REKA 1JE8A 3QRFF 3BJOA 2GXGA 3RQ4A 2ECBA 3FISA 3OYIA 2OERA 2BVLA 5EJCA 2CV2A 2HKXA 4FISA 2A05A 4EGZA 3BR1A 3HZJA 4LD5A 4E7JA 1RIOH 2VBWA 1W36C 3CZ6A 3TOAA 1TQIA 3FXJA 3VB2A 3P7NA 5L3CA 1XSVA 4IEJA 3MKLA 3A01B 4IZZA 3HRUA 4DQ2A 4HF0A 2VONA 3O6BB 3RH2A 3LMMA 3PUBA 2XAQA 2KHMA 3B73A 2O6GE 2DA4A 3NRVA 2LP0A 3ZRGA 2XV4S 3U9GA 3RKXA 4ANJA 4ZYEA 1WJFA 4FE7A 3K4LA 3EUHA 2W82A 4MFEA 4HDVA 2AQEA 5F08A 4E7HA 1ETYA 2B7EA 5FKKA 3V42A 2Y9ZA 1VQ4I 1BR1A 1HF0A 2NVYJ 4YFXF 2STTA 2HFHA 5BQTA 4BQNA 1MH3A 4A3IJ 4EJWA 2HZDA 4ETSA 3Q0VA 2Q2EA 4FASD 2XB5A 1JGSA 5IYBJ 1USTA 2BW3B 2E1MB 3WU2C 1G4DA 1VQ8I 2UUZA 1XCVA 2EA2A 3FKJA 1J09A 1TNTA 2R4GA 1YLFA 2JA8J 3VW0A 2VQCA 1DPUA 4AIKA 3PO2J 1BOAA 1R1VA 3I56I 4JBAA 3QP5A 4B8XA 3IH2A 4NB5A 4KIFA 5CVUA 3C2HA 1IN8A 1Z21A 2ZC2A 3E6CC 1ZGWA 1U8RA 3PASA 2OCCH 4FT8A 3TGNA 2WAFA 3BG9A 4L9JA 3ZQGA 3DEEA 1G59A 3LOCA 4F55A 3OL3A 2RNGA 4Y7NJ 3HRMA 5EGOB 1ON1A 2F5EA 1BW6A 1OPCA 4GGGA 5CPRB 1I1SA 3FXUA 5FGLA 3CCYA 1Z6TA 2M4KA 2VOOA 3RPUD 3HBLA 2YX4A 4LK0F 3TW7A 1HW1A 5FHPA 1EH8A 2LKXA 2L54A 4ENNA 4TV7A 3EYYA 3O8GA 2JA7J 1IV6A 2DLLA 4EATA 3PQJA 3GZNB 2ELHA 1RKTA 1MD0A 3ZQFA 2RNJA 3IAM2 2X0LA 3CJQB 2STWA 3IP4B 3W6JB 4LLGF 3FHZA 4Y15A 3JREA 4U88A 1LPQA 2ZKZA 2XAJA 1T95A 3HEFA 1JKQC 3H5RA 2BY1A 5FKNA 2KRFA 4UV8A 1YHQI 4RMNA 1QHHD 1SC7A 2KQRA 1H88C 3J7ZI 1CF7A 1U2WA 2QZ8A 1ZR2A 3BY6A 1XMKA 3BCAA 4EVIA 2X85A 4ENKA 1X58A 4C3HJ 4BXXJ 3GZIA 2K40A 3VODA 4MK6A 4N0BA 2DA1A 3IH4A 1GV5A 3FXRA 2VQLA 3JAMK 3K4MA 3MAJA 2FOKA 2IGOA 3ERED 3KEYA 4KN4X 2R5ZA 3V8KA 1RUNA 2K9MA 2QM3A 4RB3C 2UXXA 4CCNA 1V4RA 1G3YA 5KK1A 2DA3A 4GCKA 3A1YA 5TISC 1NH3A 3LA7A 4OINF 1YQAA 3BTIA 2IT0A 3S5RA 1ZLJA 2XGDA 1QPMA 2DK5A 1YFHA 2WBMA 3FHNA 2O7TA 4XR6A 1XMXA 4A5NA 1KQ8A 5HSZA 4M3GA 1XX5A 1SFOJ 4NC7A 2XGEA 2D2WA 3GYHX 4CGZA 3MKWB 1KYZA 1IV8A 3DU6A 3OIPA 3H3UA 1S5LC 4EQQA 1XGNA 2Y48A 1GDTA 2DYSH 2O61A 2EFPA 4L9TA 3OYMA 3DLAA 1CQTA 1P7IA 2A5WA 3QQAA 4X1EA 3SJMA 4BY1J 4ICHA 1I1GA 2K27A 3A0BC 3CDHA 5H20A 6PAXA 3DPJA 1G3TA 1GLNA 4J19A 4YFNF 3S3MA 2DOFA 2Z3YA 2ZBKA 2EQRA 1HSJA 4Y13A 3Q0UA 4I7HA 1A35A 3HDDA 1KA8A 2E36A 2NAZA 2ELJA 3BG6A 3E6MA 5HLGA 4E7KA 4S04A 3J7AY 3DU5A 2X6YA 1EH6A 4C2TA 2CMPA 4O5VA 5D8KB 3G73A 4R1HA 5EDNA 3BWGA 5M3FJ 4N9HA 3M3YJ 4DYRA 1XD7A 2DCEA 3HG9A 1BR4A 2P0WA 1N78A 1W36D 3IUOA 3HOZJ 2DMTA 2FQ3A 5D5XB 4MQVA 4XLNF 5FD6A 3JSPA 3KP5A 4ZYGA 1IN7A 3HOXJ 2LREA 2CQNA 3CUOA 2QKLB 1Z7LA 2DQRA 3I55I 4BL0B 4F91B 1ZK8A 2YR2A 4BU2A 4MO7A 3VYSB 2F5CA 1VQLI 3EUPA 4RAYA 4M3DA 2I5UA 4R79A 3ZQHA 3VUQA 2B1EA 3M9AA 1R58A 1YW8A 3MCZA 4HQMA 3OYFA 4ON0A 2EK5A 5FRMA 3WU1B 4XRFA 2F48A 3CP2A 2ZXWH 5GP9A 5J6XA 1A6IA 4D5CA 1SVMA 4G8XA 5ILUA 1PUFA 1P6RA 3G1OA 4A3JJ 3HTUA 5KNLA 3AL0C 2WB1A 3HTJA 3VW1A 5KHDA 2UZKA 1YITI 3OYBA 3U1KA 2LK2A 2E1OA 3L2CA 1TLHB 5KVRA 2DAOA 5J47A 1J75A 5TJJA 2XPVA 5M3MJ 5A2QZ 1OYYA 3HYIA 4QIWN 1LNWA 3CJDA 1J2XA 2FD5A 3RPUA 2GM4A 4L0ZB 4QPOA 3U1DA 3MFKA 2BBYA 2BY0A 1X3WB 4D5FA 2JJ7A 4CA0A 5FLMJ 3ZXSA 1HKSA 1BIAA 2MGQA 3SXYA 5D5WB 2Y0MA 5D5VB 4JNNA 3MKZA 1JHHA 4XK4A 4ESFA 2O8XA 2FXAA 2QSHX 5H2FC 2LNBA 4EJUA 4WXHA 3CC7I 1V5EA 2GOMA 4HSTA 1F1ZA 1WGXA 2PJRB 1GV2A 1PVEA 3LQRA 1KYWA 3BC8A 2H1KA 3RJPA 4P96A 1VQ6I 5D1RA 1UHSA 2WV1A 4HV6A 5DCMB 4M3EA 5F1JA 3DBRB 1S8NA 1B8IB 2A2FX 2W4SA 3V8LA 2Q1ZB 1F9NA 2R7QA 1X19A 3ZOBA 2QKMB 2JA6J 1MJ9A 2NS0A 4B1RA 4UUTA 3L2WA 3RD3A 1FMVA 2IJLA 3NEUA 3BG5A 3OR1C 1K78B 2FNPA 4IOCF 1LDKB 1Y1WJ 2ZCMA 1X2MA 2COBA 1D0YA 3ERMA 1RUOA 4B3XA 2GBYA 2V7FA 2HR3A 3KP3A 1I3QJ 5HOOA 2EFNA 2L5QA 2F5FA 2VB6A 3NQOA 4UVBA 4CO8A 1XMAA 4OOIA 2ACJA 2KIQA 3I59A 2LKPA 3EPZA 4Z2YA 3ZQQA 3DTEA 4MHGA 4C9YA 3ON4A 3DLLF 2NX4A 4IHXA 3M1CA 3IAS2 4CYCA 3AG2H 4S0HB 2VBXA 3BR2A 3JRDA 2V6EA 2ZOYA 5EFYA 4CXFA 3H3VK 3E6DA 2IEKA 3TMOA 5E18F 3WTXC 3D0SA 4A69C 4PGGA 3JRHA 4KT6A 1U5TA 1LKXA 2FBIA 3IRRA 5E79C 4CZZA 3DWLE 1RR8C 4HF2A 4EJVA 4WCGA 2DXIA 3IWZA 3T0YA 2X1EA 1UB9A 1SAXA 3O2PE 2OD5A 3IKVA 4A3GJ 2R3SA 2Z2SB 1MJAA 2HU9A 2LBFA 2CUJA 1P4AA 3CJTB 4NBQA 5JFRA 4KDPA 3U2RA 4Y4RA 2KPMA 2HNHA 2A3SA 2LSOA 2MYSA 2V26A 1XS9A 1ZRDA 1WPKA 2ETHA 2EINH 1U0JA 2X51A 5TRDA 3FXMA 1WSUA 2ECCA 3QBMA 3FRQA 4C3JJ 4ABZA 4AC0A 4XLEA 2PG4A 4F52A 2A69F 3TP0A 1SVLA 5LGTA 4BBSJ 3KEQA 3BZCA 4RDUA 4ZYHA 3KZIC 2W57A 1PP7U 5K7FA 4LFUA 4KA4A 2PFVA 2A68F 1JJ8C 1Z77A 4RS8A 4O3MA 3L2QA 4PSWA 2V1DA 2GZWA 1W5TA 4CZCA 4WIBA 1BIBA 2RGVA 2GLOA 3WTWC 3ONQA 3BROA 4G9YA 1AU7A 5EEAA 3VDXA 1EV7A 3RI4A 4BAYA 2P5KA 3E3VA 3ECOA 3LSHA 4IL6C 4OD5A 1WI9A 3HL2A 3K4JA 1VQMI 3NS4A 4RGSA 4KT5C 4IKFA 4C30A 2V1XA 3GW2A 4JK1X 3SEQA 4BQQA 3AKZA 3JRBA 4E7LA 1WQ2A 2OTLI 1PUEE 2WAQA 3L9FA 4OD4A 1N25A 3TKYA 3HGYA 3BJ6A 4DZJA 2UXOA 1W1WE 3G6EI 4Q5SF 5F04A 3DKYA 4AIJA 1S3JA 5CQGA 1ZR4A 4XKWA 1QPIA 3FXKA 4JX4A 4X0GA 3GX4X 3WG9A 4RLQA 2VT2A 3FMQA 2M5WA 2M45A 2ESNA 5E8GA 2ZMEC 4WF2A 4GRIA 2QQBA 1UHWA 3H1CA 1U6GA 2XB0X 2EBIA 1W7PB 2H1LA 2EB7A 2P6TA 3KYCB 3WODF 1UFMA 5FROA 4A0ZA 4UB6C 3RSNA 2HOTA 1KU9A 2G3BA 3EETA 2DMUA 1IW7F 2DYRH 2YPRA 4ZC3A 1S7AA 2FEZA 2MSYA 1UAAA 1W4MA 2XC7A 1RKWA 2HZTA 1QQIA 2B3WA 3COLA 2ZJ2A 4YELA 1Y1VJ 5LHHA 1Y8QB 4H4KC 4RBOA 1MBEA 4BUPA 2XAHA 2VE9A 2KIUA 4U87A 3GTJJ 3W2WA 1IN4A 4XICA 1UHMA 2KISA 1OCPA 4W1UA 1HKTA 1MGTA 4MIMA 1FSEA 1K4TA 4LK1F 4ZZDA 1J59A 4GFLA 1IDZA 1SAUA 2XKOA 1FPQA 4G6QA 3SDGA 2E5ZA 3WGHA 4I6ZA 1MW7A 2ZO4A 3S1NJ 1YG2A 1HDPA 5B3SH 3G2BA 2H8WA 2O7OA 3E6BA 3TDZC 2W84A 2R7SA 1B9MA 4XSZF 5HDGA 3TO9A 1H9GA 3MMYB 1D3YA 3M8JA 3GTQJ 3FM5A 1NK2P 3M1EA 1TT0A 1G3WA 3LSPA 3KNWA 2IS6A 1XCBA 4BH9A 1ETOA 2F5DA 2DT5A 2YVHA 1GXQA 1R49A 4D1QA 2DO7A 2VUMJ 1D1CA 3C1DA 3WHBA 3OS2A 4ZDPA 2C6YA 1RNLA 3HC7A 3BQZA 1QHGA 3KP4A 3JRFA 5BMZA 3F23A 1D8JA 2FNAA 3I54A 1FYKA 5LFAA 3I64A 4AM3A 2P8TA 4FX4A 1V3FA 4L62A 3ZQ7A 5J1YA 3FX3A 2PFBA 2QSFX 1FBUA 2EFOA 2L7FP 5FLXZ 2NXNB 1B1BA 5D19A 3RYPA 4E7IA 4GDFA 1R4MB 3GUDA 4HZFA 4JX6A 4DW6A 2PLYA 1IUFA 2PQ8A 1H0MA 1F36A 2Z99A 4IO9F 2IAIA 2QLZA 3RCOA 4HLYA 4HX8A 4CGRA 2BOLA 2LF8A 3LSJA 2R7WA 5AIPA 1YOVB 1I39A 1OLTA 1ZYRF 2ZNZA 5IP6A 2MFZA 1A6QA 4DIQA 1X4PA 2CUZA 1MDMA 1H9TA 2OU2A 4RLFA 4AC6A 1X1BA 5HS8A 3K69A 2JUGA 4B44A 1KU2A 3Q0WA 3R0AA 4XOTA 4NC8A 1IF1A 1XN7A 1UELB 2IGNA 5J1UA 2CS3A 3DF8A 3KIOA 2OBPA 3WTVC 2DN0A 1R5GA 1EH7A 4QTRA 4NC6A 1JTXA 2K7LA 3J80K 3HIMA 2W85A 4EJOA 1ZN2A 1FOXA 3MNLA 1FX7A 4XOPA 3ZMVA 3CCMI 1H8AC 1BI0A 1BI3A 1USSA 3VP5A 3ZMZA 4OU0A 2DG8A 3LA2A 4U0YA 2DQLA 2NYXA 4MNUA 3MN2A 3N4MA 2JUCA 1P9QC 3QYFA 2G7HA 2UXUA 3E7QA 2UXIA 2OC6A 1S7EA 3L2RA 2IPQX 2XSDC 5IYCJ 2K9SA 3CO6C 1WJDA 1TWHJ 4JOMA 2X9DA 3NARA 5DYMA 4YFKF 1IAWA 2A5YB 3B02A 2ZJQF 3PSFA 2BHYA 3P9IA 3ON2A 2H94A 4PGHA 4GXOA 4OWRB 3C18A 3F8FA 3LAJA 1D0ZA 1ON2A 2ID3A 4HW0A 1ZQ3P 5DAJA 5GPAA 2O03A 4LGWA 5K5QA 2P81A 3CLOA 3HPHA 3KCCA 4LOCA 1Z1DA 3RZDJ 1D1AA 1HW5A 2IBDA 2WADA 3BJBA 1IN5A 2R0QC 3KP2A 4CSWA 1ZRCA 1VTNC 1OCTC 2UV1A 2E60A 1S7OA 4YRVA 4MXMA 1DP7P 2X1DA 4M71A 4GCLA 4PSXA 3AAFA 1JT6A 3F8BA 3IH3A 5IY5H 1OCCH 2GUHA 5FGMA 1Z3XA 5IT3A 1WHUA 2ISYA 1GXPA 2GXBA 2Y75A 4UVCA 1IUYA 2QQ8A 1STZA 2BHZA 5FRNA 4MLOA 2VL8A 1EJ9A 3H92A 3HSRA 2DA7A 5K1YA 4I09A 3K8PC 2CQXA 2KL4A 2RQPA 3CUQB 3VFZA 2W25A 4IVNA 3HOVJ 2Z1DA 5IT9K 4RAFA 1QA6A 2HQAA 4BGDA 1JJ6C 2NS7A 4B3AA 4G94A 3K1MA 2E2JJ 1D8KA 4IHSA 4XL9A 3V4GA 4JYKA 5C4YA 4A12A 2HQRA 3K4BA 4RM3A 4XLHA 1MNMC 1FBSA 1FSHA 5EF6A 4V2GA 1WKMA 2ME6A 1YIJI 3VVYA 3HSEA 2ELKA 2ZXJA 3J81Z 3F6VA 2VJJA 2DA6A 1MZBA 3G56A 4CICA 4M3BA 3ZP5A 3T5XA 1CGPA 1T0FC 2V9KA 2F4IA 4HNTA 4ZH4F 3KFWX 1AA7A 1A36A 3F72A 1FYMA 2IXSA 4DNCA 3S1RJ 3MKYB 2FMLA 2LY2A 2CSOA 5FKLA 2MW8A 1Z0XA 2QSGX 2ZFUA 2CWEA 2ZB9A 2JSPA 4KUMA 2FE3A 1XGSA 2DMPA 1MNDA 3CCEI 2DMQA 2QIBA 3I0TA 3PSIA 3VIBA 2VPRA 2OCEA 4HPQA 4KISA 5ICEA 3PIPF 2FJI1 2F07A 1TWAJ 4GYGA 1LVAA 2M0MA 1ONVA 1ZELA 2OAZA 3KYDB 5E3MA 2H09A 3MZYA 2V9PA 1LUJB 4HAMA 3LSKA 2OZ6A 2RN7A 3K7AJ 3S93A 4GO1A 2HOEA 4A3DJ 4NDLA 1E3PA 2IGKA 3OYKA 4A3KJ 4RGUA 3QPTA 2EZKA 3DV8A 1GHCA 3ZPLA 3OS0A 2M87A 3JAMZ 5DM7F 1R1TA 3RYRA 3UNGC 4LIUA 1RC9A 1YX5A 2RAEA 1P2FA 3HTIA 3DTIA 2QQ9A 4DVYP 1FNNA 4CCOA 3V78A 2HWVA 2XSJC 4EV0A 2EFWA 1W5CC 5K5RA 3K0LA 4F92B 3EUKL 1WWXA 2R7VA 2E1MC 3BTCA 3IWFA 2DW4A 5HLTA 4B43A 4C2MJ 3PO3J 2MLGA 2ZCWA 3X2QH 3ZN1A 4BS9A 1T39A 4B4CA 1ERDA 3A03A 2ZCNA 2L2OA 4ASNA 2VC1A 1N77A 3CMEI 3OSGA 3WTTC 1B72A 5J4YA 2JMWA 2KJCA 4Q47A 2DA5A 5IPAA 3FM3A 1POGA 2OV7A 5H6RA 1Y0NA 1HDDC 5LEJA 2QWWA 1O7FA 2E71A 3OOPA 2EZHA 2KDOA 2ZY9A 1MSFC 4BHBA 2VT3A 4RGXA 3K2ZA 4M6XA 1O3RA 2KIMA 4WWCA 3NAUA 2CYYA 5FFXA 3M07A 2QUFA 5CYVA 4UUSB 1OFCX 2X6OA 5HLIA 2HXOA 1IZ1A 3A2KA 2M7BA 3SHFA 4N4NB 5E8IA 3QPHA 3QU3A 2AQFA 2JWTA 2HOAA 4EGYA 1Z3YA 3SYTA 3F8MA 2V9VA 3AG4H 3PPBA 3M8FA 2ZMEA 5HNHA 1WJBA 3MWMA 4B47A 5GPCA 3BZKA 5EG0B 3H5AA 2RKHA 3BCBA 2WY7Q 3BR6A 5L3EA 1YJNI 3ANGA 2G9WA 4KYWA 1WJAA 2HYTA 3JSOA 3JTHA 4G6TB 5H6QA 1ZRFA 2V6CA 4R8HA 4QWQA 2O9LA 2P5VA 5HAWA 2EWNA 3EUAA 3PNVA 4BBRJ 2XROA 3WU0A 4KIGA 2BGCA 1K79A 4BKXA 5GAGJ 3GEZA 1ZLKA 1R00A 3HJEA 3LWJA 4IQ4A 2VJIA 1XSDA 3KEOA 4X6AJ 1MKMA 1MH4A 4PJLA 9ANTA 4II2A 4P9FA 2MH2A 4LIVA 2HS5A 4YEJA 1D5YA 3QP6A 5D6EA 3GBGA 4ME9A 2R7OA 2LC2A 1OR7C 3TP3A 5HODA 5ICFA 2RVCA 4LB5A 2OUMA 3S15J 2RC4A 2LD5A 3I4NJ 3BCGA 1JT0A 5ILSA 1I6HJ 2JRMA 4ZZLA 4XNFA 2P4WA 5CXIA 3I4MJ 1Z05A 2O5RA 1WCMJ 3VYRB 4HA8A 3HOWJ 4U9NA 3ASNH 2Q2EB 2N8GA 3LHQA 1XSXA 2VKEA 3BT9A 5IP7J 4F93B 2FA5A 1VQPI 3VYTB 3RQIA 1FZPB 2VASA 2PBIA 2L02A 5AIQA 2LFBA 3W2VA 4H0EA 2PMZN 3JRAA 2FU4A 4FHTA 1UJ8A 2K4BA 4UY8I 3OYAA 1NTCA 4I0AA 1V5FA 5JVGF 2AHQA 3KYLA 4AD9A 5FLVA 1LJ9A 1NG6A 1O3TA 2OQRA 2OI8A 1QU3A 1WH7A 5DEQA 4UDSA 2H6CA 4M9XA 4P1WA 2WTEA 4RAGA 4UNOA 3DXJF 1QVUA 3OYCA 3CCJI 2TRTA 3ISPA 3EGQA 2CQKA 2B63J 5HVQC 2VJ5A 2M8GX 3R61A 1G3SA 2R92J 2R5YA 3KP6A 1N75A 2OZUA 4QLCU 3S8PA 1QBJA 1MBFA 3W3CA 1FTZA 3V6GA 5HS9A 2CJJA 5HNFA 3KKCA 2IA0A 1NK3P 4ESBA 4ACIA 2EPFA 3JCUC 2L7ZA 1ENHA 5E1XA 2CUEA 2QEXI 1VF9A 2EH3A 5A2QK 2QGUA 2MLKA 1XGMA 5EEGA 5JR3A 2QF7A 4IXAA 1TWGJ 5D18A 2QCOA 4XRMA 5BPDA 1EKEA 3KLOA 2BV6A 3ASOH 2VN2A 3K4KA 5HDNA 4EEFG 1X1DA 1CF7B 4JP0A 1OJLA 1P7JA 5B66C 1XTAA 3CDLA 1M1EB 3PIOF 4I76A 4HEA2 5LRSA 2IU5A 3NI7A 4KNYA 3F3XA 1IRZA 4YIRX 3BRUA 1VI0A 4AIDA 5FKMA 4V2FA 1SD6A 2Y9YA 5L3GA 2KKOA 2R5ZB 3H9GA 3S1MJ 1XB4A 3ULQB 2D6YA 3HPGA 3VSLA 1QO0D 5LEKA 3DCFA 2DBBA 3CQZJ 3DPUA 3KPHA 3OYDA 2XASA 2ZNYA 1TZLA 5KAIC 2DT7B 2M34A 3HM5A 2QBYA 3CRJA 3TOBA 4XLCA 1XC5A 2RQQA 1B6AA 1TWCJ 2Q24A 3E0JB 2CFOA 2VE8A 3MEXA 4O6JA 5FMPA 1O4XA 2W1OA 1GVDA 2VIXA 3Q9SA 3WTUC 1OISA 1AKHA 2WWYA 4DBQA 3Q5FA 3E5QA 3OWTA 4OMYA 1BW5A 1FLIA 1IXCA 3CMYA 4FTHA 3VOXA 4KICA 5EZHA 1K7AA 1SMYF 2IW5A 3FXQA 4C2UA 3NWTA 2XUBA 3G1MA 2V57A 3FIWA 2CH0A 5E1WA 2OF7A 3I5UA 3SZGA 3CP8A 2LY1A 3N97A 4L9VA 1LFBA 4M73A 5J8CA 5HLHA 3M8EA 2A07F 3DPLC 4BEHA 2FF4A 1JI8A 3KX2A 2DA2A 1HOMA 3OSFA 3VEPA 1SFUA 5B1AH 2GIZA 1R23A 4W97A 3GTPJ 1SD7A 2PJPA 5DD4A 5DV5A 2FRHA 4PK4A 3GF2A 1Z9CA 3O60A 2EJRA 1ZHFA 4XSXF 4XMYA 2EA4A 1L0OC 3E7LA 4FCYA 3EQLF 2VC0A 2IGMA 1LFPA 5CKTA 3H0GJ 2PBXA 1I3AA 1ZKGA 4A6EA 2JK3A 2H27A 1HLVA 3FK7A 2FX0A 5C3EJ 4M6YA 3HUGA 4M74A 2JT1A 2WV0A 4FETA 4EMSA 2W53A 2BVMA 2CU7A 5B5EC 1WFXA 2HYJA 2XIGA 4CCKA 1T0FA 5F0FA 1KQ9A 2EILH 3GTGJ 1P4WA 3M7GA 2AS5F 3H36A 4LMYA 2BE5F 3E5UA 2VBZA 2ME0A 1PUFB 4IHWA 4XQFA 1FTTA 3TQNA 3KE2A 1P92A 4MQ9F 3O8HA 2EIMH 1AOYA 2Z9OA 2HVQA 4I0BA 4RGRA 2D5VA 2RASA 3TBIA 2KIFA 2GAUA 2XAFA 3ECHA 1Y0UA 1Z7UA 3OV8A 1TP4A 3F0CA 4I02A 4PFOA 2FUG2 3T8RA 2LR8A 5KCMA 3AQSA 3WTYC 2B9SA 4AYBN 3EDPA 2EV6A 4J00A 2UXHA 2XRNA 2GXAA 3R60A 1ZARA 4IJAA 4XKCA 3JRGA 3BR5A 3LAPA 4HYEA 3CJNA 2L3DA 4CYDA 4BE1A 4JKZA 3HIFA 2ZJRF 2DODA 2BZTA 4IPAA 1FP1D 3LQQA 2UWMA 2AXLA 3ESWB 2XF7A 4A3FJ 2ZSIB 1YRNA 3C07A 1YS6A 2VI6A 4ITVA 2Y31A 1HA8A 3GTMJ 3B6AA 1FBQA 4NUBA 2R93J 1FWZA 4JX5A 4ZYAA 1V5GA 1Y8RB 2FBKA 5DDGA 2K86A 2GOXB 2VQHA 5GAEJ 1X2NA 2CW8A 4G7OF 2QKOA 3E97A 3CDIA 5E1ZB 1YW7A 1J5YA 4N4OB 3L00A 4NNJA 1FOKA 1E3OC 2BW3A 1Q1HA 1ZG3A 3AG3H 4MTDA 1OMIA 2MA3A 1GT0C 1NHAA 4Q4ZF 1TBXA 4D9JA 1S72I 2CUFA 3PM1A 3PNYA 5LLQA 5D4RA 1HC8A 3CWRA 3FBIB 3TO6A 1J7KA 3HSFA 2IRFG 1REPC 2JSCA 1MBKA 3FKIJ 3N05A 4P55A 3HHGA 2JPCA 2KRHA 5LGUA 4HDUA 4A3BJ 4JQFA 3C3WA 4LLLA 1L3LA 4ZTFA 5DM6F 1JKOC 5HBUA 4LJZF 2DJIA 1D1BA 3B6CA 3VWBA 3NRGA 2K5CA 2YVXA 1WI3A 1KQ0A 2VJ4A 3DBHB 2HDCA 2HQ5A 2OQGA 4BY7J 2KRCA 2R7RA 3I59B 2WAEA 4FX0A 2L9VA 4CYCB 4I01A 2V1NA 1QRYA 2M1BA 3PFYA 3CLQA 5EGOA 4PJJA 1U9OA 2JA2A 4Q48A 4KITB 2HQNA 3K9TA 1YX3A 2NVUB 3CCVI 4OAYA 4DOZA 2HKUA 1VQOI 3P9KA 4L5EA 1ULYA 3CTAA 1JGGA 1DP3A 1SANA 1D5VA 1ETWA 1U5TB 2VKVA 2ZSHB 2EV0A 2K4JA 4OIRF 3HOUJ 2BXZA 1BJZA 1ETQA 5CVRA 4P9UA 5K58A 5BOXA 5LD2C 4YG2F 3ZCOA 4F3QA 2E35A 4BNCA 1E2XA 3AFHA 2LBFB 3GLLA 4A3LJ 1FOYA 4G6DA 1ETVA 5FD5A 4UV9A 1G6NA 2A6EF 2R7DA 2J5OA 2M30A 4NELA 5K7ZA 2ZCXA 3RIRA 5GAHJ 3BPVA 4HF1A 1RI7A 3IKTA 1UZCA 2XKPA 1ZG1A 1A04A 2QENA 3PJRA 5FLXK 5DS9A 4RB0A 3LWFA 1OYIA 2L4AA 3SQNA 2YU3A 4CDGA 2FBHA 1OR7A 3PFIA 4AF5A 5BNGA 4AVZA 3S32A 2K85A 1YJWI 2COMA 2LH9A 2W24A 1XGOA 1WRJA 2P5LC 4IHVA 4KFCA 5C4XJ 2GFNA 4LG0A 2GQQA 2HOSA 1K4SA 5J40A 3Q9VA 2HXIA 3V7CA 2E7XA 3ZMSA 3F8NA 2CV0A 4LLNA 1EF4A 1K61A 2QOPA 2OJED 2ID6A 3KZYA 1YYVA 1XDSA 4XM3A 4EM2A 5LBQA 4RM2A 1DGWY 4U7DA 2W00A 2VOPA 4PDKA 3CO7C 3R6SA 2W48A 3BTLA 3CCUI 1B4AA 1EA3A 3TEDA 3CC2I 2GENA 4HNUA 3RKWA 1T2KA 1APLC 5E3OA 2HEOA 2H6BA 4EM0B 1O7LA 3QYEA 1OKRA 4HBLA 1I50J 3OYGA 2WC2A 2L7KA 3PNTA 4II3A 2DFFA 1FEXA 4KMUX 3RZOJ 4PZJA 4G7ZF 1GUUA 4DGWB 2DT6A 3DEUA 1BN5A 3W2AA 2DOAA 2JTVA 4RAZA 2KFDA 3LNQA 1RZ4A 3ZQCA 1ITYA 1WJ5A 3GLXA 1T38A 2NVXJ 4XKBA 4M9SA 2K9NA 3NXCA 2ZJPF 3HTAA 4M6VA 1E0EA 2LOOA 1DU0A 2I8DA 1VNDA 1HCRA 5C44J 5CVVA 2CV1A 1ZGAA 1T33A 3IV5A 3LFUA 2ESHA 1PYVA 5CJ9A 3HOSA 1ODDA 3B81A 2L01A 4XN3A 2GA2A 1WVRA 3ABTA 4BDYA 3G4SI 3RTRA 5DTDA 4KJZA 1YRNB 2PEXA 2JZYA 3BLYA 4ZTJA 3MVPA 4NN1A 1JKRC 1JUSA 1S29A 3Q3SA 1F4KA 2VXZA 2RV8A 3CD6I 2B0LA 1LDJA 2BY2A 4HRIA 3T8TA 1HW2A 1IG7A 1QZEA 1Z6RA 2VODA 4IRGA 1RPWA 2JQ7A 1A5JA 1FJLA 4XONA 3ZR8X 2HTJA 3OYLA 2O8KA 2LYCA 2NNYA 4IRIA 3D5RC 1KU3A 2DDBA 4CCLA 3KETA 2H8RA 1QGPA 4M72A 5ILVA 3AQTA 1W0TA 2NP5A 4U0VA 3SZTA 3HRTA 1NG7A 4NQWA 1W0UA 2QTQA 4HOBA 4CUGA 1TQMA 1BI1A 1JXSA 2AO9A 3CESA 1SD4A 3BG7A 4DYQA 3SWHA 4MGRA 3L2UA 1U8BA 2A6TA 3H5NA 2R7TA 2XAGA 3ABMH 2QVOA 1SFXA 2V1UA 4L9NA 3GFJA 1ZAOA 4HQEA 3VTIA 3J81K 1W7PD 3CCSI 5BPIA 1T98A 4AU7A 4B09A 3FXLA 3OYEA 3ROUA 1W5SA 3GTKJ 1IXSB 4XKVA 2DFIA 3R0JA 1RR7A 2DFHA 2Z16A 4Y3OA 3VW2A 2KJBA 2ZOZA 3D5SC 3COAC 3GZ6A 2BYVE 5L3DA 2PJRA 2G7UA 5E3NA 2Z33A 4GFBA 2ISZA 2XDVA 3BTJA 3CUQC 3GO5A 3EYIA 1BC8C 4GYIA 5DCMA 3VOEA 2E1NA 1B9NA 1B8IA 1IRGA 3E1SA 3CCLI 1TWFJ 1FMWA 1IO2A 2P7VB 4RA2A 3GTLJ 2UXPA 1MDMB 3FZVA 3H35A 1TTYA 2LTPA 5CQEA 2V4JC 2A6HF 2NS8A 3FDYA 3TO7A 2BY3A 1K78A 4GCTA 1MMGA 3V7RA 4HG2A 5ICCA 1R5ID 3LSRA 1VQ9I 2M2EA 2X4HA 4L5IA 3G1LA 3QODA 1VQNI 1RESA 2NP3A 1JUPA 1PJRA 4IHYA 5DCFA 2YUSA 5CVJA 2WB1N 3K4NA 5TGTA 3F6OA 4UB8C 2DG7A 1IDYA 3GZ5A 3S2HJ 3LJLA 5JHFA 1TW3A 5CVIA 3MZ8A 2D45A 4ZDOA 2K9LA 5LHGA 1BA5A 2F4MB 5AONA 4BXFA 2TDXA 3LL7A 3U21A 2HVRA 4L5JA 4PJ0C 1SD5A 3HRSA 1BJAA 3CF2A 2FQ4A 3C2BA 4AVPA 3F21A 1YJ9I 4LG0B 4P5OA 2RHAA 3S16J 3BR3A 4FQGA 3OL4A 2LG4A 2IS1A 1I6XA 4LB6B 3HOYJ 3P5JA 2DI3A 4CHUA 1IXRC 3D5LA 2XF5A 1MBJA 3AL0B 3RDIA 2MD5A 2A61A 2MH9A 2G0EA 3OOUA 4G12A 5H9TA 4IRVA 4OAZA 1JHFA 1OQYA 3S3OA 2RDPA 2GIVA 1VQKI 3HGGA 4CCJA 2XF6A 3LSIA 4DBRA 4MEXF 4HV5A 3DKXA 2L7MP 1PDNC 3A4CA 1IN6A 1TT5B 4BQAA 3GTOJ 4E6KG 1OYWA 5LRRA 3QU6A 3SDBA 2DDAA 5IOZA 4BJ6C 5DUIA 2LRDA 3H3ZA 1LEBA 5F64A 2PI0A 1IRFA 5J3LA 3HE0A 1HXDA 2YX7A 4ZYDA 1UCRA 1TW2A 1YTYA 2CO5A 4PCQA 4CH7A 2WUIA 2G7GA 1IRXA 5AQCA 3MD2A 2HI3A 3W6VA 3S2DJ 2F4OB 4UXNA 5DUKA 3CJRB 5F6FA 3L2VA 1J9IA 3MZHA 1U78A 1YS7A 2G7LA 2M3AA 2HYFA 1SEUA 2KZVA 3BQYA 1F5TA 1HSTA 4XBFA 2YS9A 1X1AA 2IP2A 2KMUA 4GFKA 3HOTA 3F1BA 1R9TJ 1OCRH 3WGGA 3QPSA 1P4XA 3I71A 2JRTA 4LITA 2VLAA 3NNRA 1K83J 5CXGA 1UMQA 2BXYA 4BJTA 1FIPA 4A3CJ 1FC3A 1MBHA 1XDUA 3H0DA 4Y52J 2X6WA 3A02A 5M5XJ 2LY9A 2PX9A 3SFZA 5FB2A 2AXTC 2O3FA 1HBXG 1YO5C 3VYUB 5CLSA 3ZQLA 3DFGA 2IA1A 5L3FA 1HQCA 3JRCA 1LB2A 1BBYA 1W7PA 2XGXA 4ZJZA 5D6FA 4A0XA 2DPDA 3TDUC 2OA4A 1X4OA 3WGIA 2QYOA 4E7ZA 4NQWB 1R22A 2P6SA 4AWXB 2QA4I 1GVJA 2KT0A 3BJAA 2NVQJ 2IVMA 3ANPA 3WTSC 2PZ9A 5IYDJ 4E70A 1YI2I 3CCRI 4K2EA 1IC8A 2ADUA 4BXUA 1JTYA 1X1CA 2PN6A 2NRAC 3OR2C 1ZGJA 3V8JA 4BDZA 4RB2C 1V54H 2CGPA 2IS2A 3GFLA 3IUVA 4GCVA 3KZZA 3ELKA 1DPRA 4ZDLA 3IHUA 4YZEA 5E17F 2CFXA 2MC4A 1KGSA 1S9HA 3WG7H 2VPLA 2R7UA 3KZ9A 3L09A 1DUXC 4IX7A 4RB1A 4BACA 1F43A 4KWAA 3LSMA 1SVOA 2EV5A 3ZQIA 5F1RA 2K9QA 3EUHC 1VQ7I 3GEUA 1BC7C 5HS7A 2ZXHA 1TNSA 3OYHA 2L9NA 3UR3C 2FOWA 3V7SA 1OCZH 1R6RA 1U9NA 1MNEA 4IOAF 2WAQN 3ABUA 1K6YA 4CCMA 3FMRA 2E2HJ 4KIBA 2XDNA 5E20A 2FBQA 1MMNA 1VZ0A 5FFZA 4A6DA 2I10A 4FE4A 3K1NA 4PUSA 5K5OA 3ZN0A 3A0HC 5F27A 3GFMA 5HDKA 1BI2A 1BOBA 4XLAA 1JUMA 3QAHA 1T56A 1B72B 2HPMA 2E2IJ 4WXDA 4M9ZA 2PMHA 4A0YA 3JTGA 3QOPA 1LE8A 5EZGA 4PJNA 3ZMDA 3H9JA 2X6XA 4BE0A 2MC3A 3C2GA 1ZTRA 3K6GA 3G71I 1A31A 1ZREA 1RRJA 4JL3A 3S3NA 2JA5J 1TL8A 5JLWA 2IA2A 2DK8A 3FMSA 3DKWA 2HGCA 3E5XA 2F2EA 1E3HA 1MSEC 3F9KA 2ZXIA 3NWSA 2CG4A 4E7SA 4Y17A 4QPQA 1FY7A 1MMAA 4XLPF 2GA1A 3BZ6A 4J01A 2JPBA 4L18B 2FJ1A 2WA0A 3RKQA 1XG1A 1MIJA 1I27A 1Z67A 2LKSA 3O3KA 3TW6A 5ICGA 1AWCA 3RKYA 4BHPA 2NNNA 3QYBA 1FT9A 2PMZA 1MMDA 4IQJA 3VVXA 5E3LA 2J5PA 2QQAA 1WH5A 2ZMEB 2DU9A 1IJWC 2DPUA 2HDDA 2Y2ZA 2LVSA 2DTZA 2O0YA 3K4CA 3AG1H 4YIFA 5KAFC 4I98B 2Q0OA 3FBNB 2NVTJ 4M3FA 1YW9A 5BS6A 4UVAA 4KN7X 1ETXA 2CQQA 4A5MA 4F7ZA 4PFPA 1YIOA 2W7NA 1J0RA 2EFQA 3HKZN 2CQ7A 3WE2A 4IRHA 1QVTA 3CC4I 3TL4X 5FJ8J 4L0YB 2XPUA 2M4GA 2Y30A 4HX4A 3F22A 3IRQA 2ICWG 2MBFA 5JHUA 2KDZA 1FYLA 4IHTA 2FSWA 1KU7A 3F8CA 2EIJH 3K70C 2E1CA 1Y6IA 2L9SA 4OMZA 3QPLA 2OTJI 3OIQA 4MEYF 2CW0F 3FXOA 3K2AA 3S17J 1E17A 1R4NB 2DTRA 5L3BA 3MQ0A 3OY9A 2BEOA 3QOEA 2PMUA 3LFKA 2DOEA 2JVGA 2WGBA 5JI6A 3JW4A 2Q8KA 4XORA 1QNTA 2MG4A 1R7JA 4XN0A 2ZFWA 3PUFA 3DBLB 3I58A 3RPQA 5M5WJ 2DFEA 3CF5F 3HTHA 5EEHA 2UXNA 3SFIA 2R7ZJ 4YIIA 1O3QA 3WHCA 4OIOF 2E34A 2XAUA 3GXOA 1OCOH 4U7BA 5K7HA 4AIHA 4C3IJ 1DU6A 2G7SA 4KMFA 1LEAA 1G2HA 2JN6A 4Y33A 1IGNA 1T08B 2LLKA 1U3EM 3LSGA 5DD8A 3FF5A 4G7HF 2LMDA 5JLXA 2XGCA 1TQPA 4B48A 5CW8A 3C7JA 3ML6A 2IS4A
chains in the Genus database with same CATH topology
1GV2A 3A03A 2H1KA 2ZCNA 5D1RA 1UHSA 2WV1A 3OSGA 1B72A 3A01A 4M3EA 2JMWA 5F1JA 1B8IB 2DA5A 2W48A 3BTLA 5IPAA 1POGA 3TEDA 4XRSG 4A93J 2GENA 1H89C 1HDDC 1APLC 1Q1VA 5E3OA 3ZOBA 2JA6J 2QWTA 2NOGA 4B1RA 4UUTA 2DMNA 3RD3A 2EZHA 2Y0SN 3BG5A 1MSFC 1Y1WJ 1I50J 1BL0A 1X2MA 2COBA 2ZCMA 3BNIA 2R5YB 2GBYA 3NAUA 1I3QJ 1FEXA 3RZOJ 2L9RA 1GUUA 1OFCX 2X6OA 4UUSB 2HXOA 3FK6A 3LNQA 3ON4A 3ZQCA 1ITYA 2JWTA 3PPBA 2HOAA 2NX4A 4IHXA 2EZLA 4CYCA 2NVXJ 2K9NA 3NXCA 4S0HB 3HTAA 3DEWA 3BR2A 4M6VA 3JRDA 1DU0A 5C4JJ 5GPCA 1VNDA 4A3EJ 1HCRA 1UI6A 2ZOYA 5EG0B 5C44J 5EFYA 3H3VK 1JKPC 1T33A 2IEKA 3IV5A 3BR6A 3M4OJ 1LFUP 3ANGA 4A69C 2HYTA 1MBGA 3JRHA 3D1NI 1SGMA 2O9LA 3JRIA 3B81A 2EZIA 1ETKA 1RETA 5HAWA 5M5YJ 4BBRJ 5DTDA 1YRNB 2M9HA 2XRLA 4NN1A 3MVPA 1JKRC 4BKXA 1JUSA 4A3MJ 4A3GJ 3Q3SA 5F0HA 3LWJA 1XS9A 4X6AJ 1WPKA 1MH4A 1IG7A 9ANTA 4PXIA 1UI5A 3VVZA 1A5JA 1RPWA 3S1QJ 1D5YA 3GBGA 1FJLA 4ME9A 5J1RA 1LE8B 2ECCA 3QBMA 3TP3A 5HODA 2O8KA 3I4NJ 3S15J 3FRQA 2LD5A 2H8RA 4C3JJ 3BCGA 1JT0A 4ABZA 4AC0A 1I6HJ 1AHDP 5F0CA 3AQTA 1W0TA 2NP5A 5CXIA 3TP0A 4BBSJ 3I4MJ 1W0UA 3L1PA 3HB9A 3T6NA 2QTQA 1UG2A 1WCMJ 4DZPA 2AO9A 4AUXA 3HOWJ 4RDUA 4HNVA 1AKHB 2N8GA 3LHQA 2VKEA 4DYQA 3BT9A 5K7FA 5IP7J 1U8BA 3RQIA 1Z77A 1JJ8C 3BG3A 4MFDA 2LFBA 2PMZN 3VPRA 3JRAA 2GLOA 3GTKJ 2M0CA 1AU7A 1RR7A 3VW2A 5EEAA 1NTCA 2XPWA 5IOYA 1VFCA 2ZOZA 5IP9J 2AHQA 5E3NA 4GFBA 5FLVA 1FIAA 3BTJA 3JR9A 3OIOA 3JRBA 2OI8A 2X48A 5EYRA 1WH7A 1B8IA 4UDSA 1TWFJ 3G7RA 4D7NA 2UXOA 3HGYA 4DZJA 2UXPA 3GTLJ 3BHQA 1QVUA 5F04A 1ZR4A 3S14J 2TRTA 4D7MA 2LTPA 1QPIA 3UKGA 3EGQA 2B63J 2NS8A 4JX4A 4GCTA 4DYCA 3KKDA 2M8GX 3BR0A 3LSRA 2R92J 2M2EA 2R5YA 3V6GA 1FTZA 3G1LA 1MBFA 1RESA 2CJJA 1JUPA 2NP3A 3KKCA 4IHYA 5FKOA 2YUSA 4UUSA 1NK3P 2XB0X 2EBIA 2WB1N 4QSHA 1ORKA 3QKXA 4ACIA 2L7ZA 1ENHA 2HOTA 2CRGA 3P9TA 2CUEA 2DG7A 1IDYA 1VF9A 2G3BA 2EH3A 3VOKA 2DMUA 3S2HJ 3NPIA 2L0KA 2MSYA 3LJLA 2QF7A 4XIDA 1TWGJ 5D18A 1RKWA 2TCTA 2QCOA 2YU9J 2OPTA 2YVEA 4XRMA 3COLA 2DJNA 5EG0A 2E19A 1Y1VJ 1BA5A 4RBOA 1MBEA 1TC3C 4XRSA 4EEFG 2FQ4A 4JP0A 1OJLA 3JSJA 1P7JA 3C2BA 3GTJJ 2RHAA 4HKUA 3S16J 3CDLA 3BR3A 4XICA 2REKA 1OCPA 4W1UA 4I76A 2ECBA 3FISA 2IU5A 2OERA 3NI7A 4MIMA 3HOYJ 1IRZA 4FISA 3BRUA 4GFLA 3BR1A 1VI0A 1MBJA 5FKMA 4V2FA 1IDZA 2Y9YA 3SDGA 2G0EA 3OOUA 4G12A 2R5ZB 4I6ZA 3S1MJ 5H9TA 3S1NJ 1HDPA 4IEJA 2D6YA 3MKLA 2O7OA 3A01B 3DCFA 3HGGA 3RH2A 3CQZJ 2DA4A 3GTQJ 3GTOJ 2L7MP 2LP0A 2M34A 3HM5A 1NK2P 3CRJA 4FE7A 1XC5A 3LSPA 1TWCJ 2Q24A 3KNWA 4MFEA 5IOZA 1ETOA 5F08A 1ETYA 2YVHA 5FKKA 2Y9ZA 1HF0A 2NVYJ 5J3LA 3HE0A 2VUMJ 5FMPA 1O4XA 1MH3A 4A3IJ 1GVDA 3WHBA 3Q0VA 1AKHA 1BW5A 2XB5A 2WUIA 3BQZA 3JRFA 2G7GA 5IYBJ 3CMYA 4FTHA 5AQCA 3VOXA 3S2DJ 2HI3A 3W6VA 5EZHA 2V57A 3G1MA 2G7LA 1U78A 3FIWA 2JA8J 3VW0A 4L62A 5J1YA 2OF7A 3PO2J 3BQYA 1LFBA 2L7FP 2YS9A 3IH2A 5D19A 4GFKA 3F1BA 4JX6A 4DW6A 1IUFA 1ZGWA 2DA2A 1HOMA 1R9TJ 3PASA 3OSFA 1F36A 3BG9A 2IAIA 3QPSA 3ZQGA 4W97A 3GTPJ 4CGRA 3LOCA 3NNRA 1K83J 3LSJA 5CXGA 1UMQA 4Y7NJ 5IP6A 5EGOB 3O60A 4AC6A 1FIPA 1BW6A 4A3CJ 1MBHA 4Y52J 5M5XJ 3A02A 5FGLA 3E7LA 3CCYA 4FCYA 3Q0WA 2LY9A 3HBLA 5J1UA 3H0GJ 3TW7A 2PBXA 1ZKGA 2DN0A 5FHPA 2JK3A 2LKXA 1HLVA 3ZQLA 3FK7A 4QTRA 2FX0A 1JTXA 5C3EJ 3O8GA 3JRCA 2JA7J 3HIMA 1IV6A 2W53A 3MNLA 2CU7A 2HYJA 1RKTA 1H8AC 3ZQFA 5F0FA 2KT0A 2NVQJ 3GTGJ 3VP5A 3ANPA 2DG8A 2PZ9A 3JREA 5IYDJ 1IC8A 3HEFA 3MN2A 2ME0A 1JKQC 1JTYA 2UXUA 3E7QA 1PUFB 5FKNA 4IHWA 2UXIA 1S7EA 1FTTA 1H88C 3O8HA 3IUVA 2XSDC 5IYCJ 1ZR2A 2K9SA 2RASA 1X58A 4C3HJ 2D5VA 4BXXJ 3GZIA 1TWHJ 2K40A 2X9DA 4MK6A 3NARA 2DA1A 4YZEA 3IH4A 3F0CA 1GV5A 3KZ9A 2LR8A 3ON2A 3AQSA 1F43A 4KWAA 4AYBN 2UXHA 3ZQIA 2R5ZA 2K9QA 3GEUA 2ID3A 3JRGA 3BR5A 1ZQ3P 5DAJA 5GPAA 2P81A 3RZDJ 4LOCA 4JKZA 2IBDA 4GCKA 2DA3A 1U9NA 3BJBA 2R0QC 3BTIA 3S5RA 2WAQN 2XGDA 2E2HJ 2XDNA 1OCTC 2FBQA 4A3FJ 1YRNA 2O7TA 3C07A 2VI6A 2Y31A 3GTMJ 3B6AA 4MXMA 2R93J 4JX5A 2I10A 4GCLA 4FE4A 5HSZA 4M3GA 1SFOJ 2XGEA 1JT6A 3IH3A 5F27A 2GUHA 1X2NA 2QKOA 1JUMA 1GDTA 1T56A 1B72B 2E2IJ 1CQTA 1E3OC 1P7IA 3QQAA 4X1EA 1LE8A 5EZGA 3SJMA 4BY1J 4ICHA 1GT0C 4MLOA 3DPJA 1ZTRA 2CUFA 3PM1A 4J19A 2DA7A 3CWRA 4JL3A 2JA5J 5JLWA 1MBKA 2CQXA 3FKIJ 2EQRA 1MSEC 3HOVJ 3Q0UA 3HDDA 1JJ6C 4A3BJ 2NS7A 4B3AA 1JKOC 2E2JJ 5HBUA 3B6CA 3NRGA 5C4YA 4JYKA 2FJ1A 1WI3A 5EDNA 1MNMC 5M3FJ 2HQ5A 3RKQA 1XG1A 5EF6A 3TW6A 4BY7J 3M3YJ 4DYRA 4V2GA 2ME6A 3VVYA 4CYCB 2ELKA 3HOZJ 2DMTA 3VVXA 5E3LA 1QRYA 1WH5A 5EGOA 2HDDA 1IJWC 2DA6A 1U9OA 3HOXJ 3G56A 2Y2ZA 4M3BA 2LVSA 2DTZA 2HKUA 4L5EA 2NVTJ 1ZK8A 4M3FA 1SANA 1JGGA 1ETWA 4MO7A 2VKVA 3HOUJ 1ETXA 2CQQA 3S1RJ 1BJZA 1ETQA 3EUPA 3HKZN 4M3DA 5FKLA 2MW8A 1Z0XA 3ZQHA 3VUQA 1QVTA 5K58A 5FJ8J 2XPUA 2ZB9A 2Y30A 2KDZA 2DMPA 4A3LJ 2QIBA 1ETVA 2DMQA 3VIBA 2VPRA 5GP9A 2F07A 4NELA 1A6IA 1TWAJ 4D5CA 3QPLA 1PUFA 5K7ZA 3G1OA 4A3JJ 2ZCXA 5E3MA 3S17J 3K2AA 3HTJA 3VW1A 3K7AJ 4A3DJ 2WGBA 2LK2A 2E1OA 4NDLA 2MG4A 4A3KJ 5DS9A 2XPVA 5M3MJ 2EZKA 5M5WJ 4QIWN 3CJDA 2FD5A 2GM4A 3HTHA 3SFIA 2R7ZJ 4AF5A 5BNGA 4D5FA 2JJ7A 3WHCA 5FLMJ 2RAEA 3HTIA 4IHVA 2GFNA 5C4XJ 5K7HA 2MGQA 2HOSA 3V78A 4C3IJ 1DU6A 2G7SA 4JNNA 2HXIA 1G2HA 2JN6A 4XK4A 1IGNA 2LLKA 3LSGA 1EF4A 3BTCA 1K61A 2QOPA 5JLXA 2ID6A 2XGCA 5CW8A 4C2MJ 3PO3J 1WGXA 4B4CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GV2 A;  3A03 A;  2H1K A;  2ZCN A;  5D1R A;  1UHS A;  2WV1 A;  3OSG A;  1B72 A;  3A01 A;  4M3E A;  2JMW A;  5F1J A;  1B8I B;  2DA5 A;  2W48 A;  3BTL A;  5IPA A;  1POG A;  3TED A;  4XRS G;  4A93 J;  2GEN A;  1H89 C;  1HDD C;  1APL C;  1Q1V A;  5E3O A;  3ZOB A;  2JA6 J;  2QWT A;  2NOG A;  4B1R A;  4UUT A;  2DMN A;  3RD3 A;  2EZH A;  2Y0S N;  3BG5 A;  1MSF C;  1Y1W J;  1I50 J;  1BL0 A;  1X2M A;  2COB A;  2ZCM A;  3BNI A;  2R5Y B;  2GBY A;  3NAU A;  1I3Q J;  1FEX A;  3RZO J;  2L9R A;  1GUU A;  1OFC X;  2X6O A;  4UUS B;  2HXO A;  3FK6 A;  3LNQ A;  3ON4 A;  3ZQC A;  1ITY A;  2JWT A;  3PPB A;  2HOA A;  2NX4 A;  4IHX A;  2EZL A;  4CYC A;  2NVX J;  2K9N A;  3NXC A;  4S0H B;  3HTA A;  3DEW A;  3BR2 A;  4M6V A;  3JRD A;  1DU0 A;  5C4J J;  5GPC A;  1VND A;  4A3E J;  1HCR A;  1UI6 A;  2ZOY A;  5EG0 B;  5C44 J;  5EFY A;  3H3V K;  1JKP C;  1T33 A;  2IEK A;  3IV5 A;  3BR6 A;  3M4O J;  1LFU P;  3ANG A;  4A69 C;  2HYT A;  1MBG A;  3JRH A;  3D1N I;  1SGM A;  2O9L A;  3JRI A;  3B81 A;  2EZI A;  1ETK A;  1RET A;  5HAW A;  5M5Y J;  4BBR J;  5DTD A;  1YRN B;  2M9H A;  2XRL A;  4NN1 A;  3MVP A;  1JKR C;  4BKX A;  1JUS A;  4A3M J;  4A3G J;  3Q3S A;  5F0H A;  3LWJ A;  1XS9 A;  4X6A J;  1WPK A;  1MH4 A;  1IG7 A;  9ANT A;  4PXI A;  1UI5 A;  3VVZ A;  1A5J A;  1RPW A;  3S1Q J;  1D5Y A;  3GBG A;  1FJL A;  4ME9 A;  5J1R A;  1LE8 B;  2ECC A;  3QBM A;  3TP3 A;  5HOD A;  2O8K A;  3I4N J;  3S15 J;  3FRQ A;  2LD5 A;  2H8R A;  4C3J J;  3BCG A;  1JT0 A;  4ABZ A;  4AC0 A;  1I6H J;  1AHD P;  5F0C A;  3AQT A;  1W0T A;  2NP5 A;  5CXI A;  3TP0 A;  4BBS J;  3I4M J;  1W0U A;  3L1P A;  3HB9 A;  3T6N A;  2QTQ A;  1UG2 A;  1WCM J;  4DZP A;  2AO9 A;  4AUX A;  3HOW J;  4RDU A;  4HNV A;  1AKH B;  2N8G A;  3LHQ A;  2VKE A;  4DYQ A;  3BT9 A;  5K7F A;  5IP7 J;  1U8B A;  3RQI A;  1Z77 A;  1JJ8 C;  3BG3 A;  4MFD A;  2LFB A;  2PMZ N;  3VPR A;  3JRA A;  2GLO A;  3GTK J;  2M0C A;  1AU7 A;  1RR7 A;  3VW2 A;  5EEA A;  1NTC A;  2XPW A;  5IOY A;  1VFC A;  2ZOZ A;  5IP9 J;  2AHQ A;  5E3N A;  4GFB A;  5FLV A;  1FIA A;  3BTJ A;  3JR9 A;  3OIO A;  3JRB A;  2OI8 A;  2X48 A;  5EYR A;  1WH7 A;  1B8I A;  4UDS A;  1TWF J;  3G7R A;  4D7N A;  2UXO A;  3HGY A;  4DZJ A;  2UXP A;  3GTL J;  3BHQ A;  1QVU A;  5F04 A;  1ZR4 A;  3S14 J;  2TRT A;  4D7M A;  2LTP A;  1QPI A;  3UKG A;  3EGQ A;  2B63 J;  2NS8 A;  4JX4 A;  4GCT A;  4DYC A;  3KKD A;  2M8G X;  3BR0 A;  3LSR A;  2R92 J;  2M2E A;  2R5Y A;  3V6G A;  1FTZ A;  3G1L A;  1MBF A;  1RES A;  2CJJ A;  1JUP A;  2NP3 A;  3KKC A;  4IHY A;  5FKO A;  2YUS A;  4UUS A;  1NK3 P;  2XB0 X;  2EBI A;  2WB1 N;  4QSH A;  1ORK A;  3QKX A;  4ACI A;  2L7Z A;  1ENH A;  2HOT A;  2CRG A;  3P9T A;  2CUE A;  2DG7 A;  1IDY A;  1VF9 A;  2G3B A;  2EH3 A;  3VOK A;  2DMU A;  3S2H J;  3NPI A;  2L0K A;  2MSY A;  3LJL A;  2QF7 A;  4XID A;  1TWG J;  5D18 A;  1RKW A;  2TCT A;  2QCO A;  2YU9 J;  2OPT A;  2YVE A;  4XRM A;  3COL A;  2DJN A;  5EG0 A;  2E19 A;  1Y1V J;  1BA5 A;  4RBO A;  1MBE A;  1TC3 C;  4XRS A;  4EEF G;  2FQ4 A;  4JP0 A;  1OJL A;  3JSJ A;  1P7J A;  3C2B A;  3GTJ J;  2RHA A;  4HKU A;  3S16 J;  3CDL A;  3BR3 A;  4XIC A;  2REK A;  1OCP A;  4W1U A;  4I76 A;  2ECB A;  3FIS A;  2IU5 A;  2OER A;  3NI7 A;  4MIM A;  3HOY J;  1IRZ A;  4FIS A;  3BRU A;  4GFL A;  3BR1 A;  1VI0 A;  1MBJ A;  5FKM A;  4V2F A;  1IDZ A;  2Y9Y A;  3SDG A;  2G0E A;  3OOU A;  4G12 A;  2R5Z B;  4I6Z A;  3S1M J;  5H9T A;  3S1N J;  1HDP A;  4IEJ A;  2D6Y A;  3MKL A;  2O7O A;  3A01 B;  3DCF A;  3HGG A;  3RH2 A;  3CQZ J;  2DA4 A;  3GTQ J;  3GTO J;  2L7M P;  2LP0 A;  2M34 A;  3HM5 A;  1NK2 P;  3CRJ A;  4FE7 A;  1XC5 A;  3LSP A;  1TWC J;  2Q24 A;  3KNW A;  4MFE A;  5IOZ A;  1ETO A;  5F08 A;  1ETY A;  2YVH A;  5FKK A;  2Y9Z A;  1HF0 A;  2NVY J;  5J3L A;  3HE0 A;  2VUM J;  5FMP A;  1O4X A;  1MH3 A;  4A3I J;  1GVD A;  3WHB A;  3Q0V A;  1AKH A;  1BW5 A;  2XB5 A;  2WUI A;  3BQZ A;  3JRF A;  2G7G A;  5IYB J;  3CMY A;  4FTH A;  5AQC A;  3VOX A;  3S2D J;  2HI3 A;  3W6V A;  5EZH A;  2V57 A;  3G1M A;  2G7L A;  1U78 A;  3FIW A;  2JA8 J;  3VW0 A;  4L62 A;  5J1Y A;  2OF7 A;  3PO2 J;  3BQY A;  1LFB A;  2L7F P;  2YS9 A;  3IH2 A;  5D19 A;  4GFK A;  3F1B A;  4JX6 A;  4DW6 A;  1IUF A;  1ZGW A;  2DA2 A;  1HOM A;  1R9T J;  3PAS A;  3OSF A;  1F36 A;  3BG9 A;  2IAI A;  3QPS A;  3ZQG A;  4W97 A;  3GTP J;  4CGR A;  3LOC A;  3NNR A;  1K83 J;  3LSJ A;  5CXG A;  1UMQ A;  4Y7N J;  5IP6 A;  5EGO B;  3O60 A;  4AC6 A;  1FIP A;  1BW6 A;  4A3C J;  1MBH A;  4Y52 J;  5M5X J;  3A02 A;  5FGL A;  3E7L A;  3CCY A;  4FCY A;  3Q0W A;  2LY9 A;  3HBL A;  5J1U A;  3H0G J;  3TW7 A;  2PBX A;  1ZKG A;  2DN0 A;  5FHP A;  2JK3 A;  2LKX A;  1HLV A;  3ZQL A;  3FK7 A;  4QTR A;  2FX0 A;  1JTX A;  5C3E J;  3O8G A;  3JRC A;  2JA7 J;  3HIM A;  1IV6 A;  2W53 A;  3MNL A;  2CU7 A;  2HYJ A;  1RKT A;  1H8A C;  3ZQF A;  5F0F A;  2KT0 A;  2NVQ J;  3GTG J;  3VP5 A;  3ANP A;  2DG8 A;  2PZ9 A;  3JRE A;  5IYD J;  1IC8 A;  3HEF A;  3MN2 A;  2ME0 A;  1JKQ C;  1JTY A;  2UXU A;  3E7Q A;  1PUF B;  5FKN A;  4IHW A;  2UXI A;  1S7E A;  1FTT A;  1H88 C;  3O8H A;  3IUV A;  2XSD C;  5IYC J;  1ZR2 A;  2K9S A;  2RAS A;  1X58 A;  4C3H J;  2D5V A;  4BXX J;  3GZI A;  1TWH J;  2K40 A;  2X9D A;  4MK6 A;  3NAR A;  2DA1 A;  4YZE A;  3IH4 A;  3F0C A;  1GV5 A;  3KZ9 A;  2LR8 A;  3ON2 A;  3AQS A;  1F43 A;  4KWA A;  4AYB N;  2UXH A;  3ZQI A;  2R5Z A;  2K9Q A;  3GEU A;  2ID3 A;  3JRG A;  3BR5 A;  1ZQ3 P;  5DAJ A;  5GPA A;  2P81 A;  3RZD J;  4LOC A;  4JKZ A;  2IBD A;  4GCK A;  2DA3 A;  1U9N A;  3BJB A;  2R0Q C;  3BTI A;  3S5R A;  2WAQ N;  2XGD A;  2E2H J;  2XDN A;  1OCT C;  2FBQ A;  4A3F J;  1YRN A;  2O7T A;  3C07 A;  2VI6 A;  2Y31 A;  3GTM J;  3B6A A;  4MXM A;  2R93 J;  4JX5 A;  2I10 A;  4GCL A;  4FE4 A;  5HSZ A;  4M3G A;  1SFO J;  2XGE A;  1JT6 A;  3IH3 A;  5F27 A;  2GUH A;  1X2N A;  2QKO A;  1JUM A;  1GDT A;  1T56 A;  1B72 B;  2E2I J;  1CQT A;  1E3O C;  1P7I A;  3QQA A;  4X1E A;  1LE8 A;  5EZG A;  3SJM A;  4BY1 J;  4ICH A;  1GT0 C;  4MLO A;  3DPJ A;  1ZTR A;  2CUF A;  3PM1 A;  4J19 A;  2DA7 A;  3CWR A;  4JL3 A;  2JA5 J;  5JLW A;  1MBK A;  2CQX A;  3FKI J;  2EQR A;  1MSE C;  3HOV J;  3Q0U A;  3HDD A;  1JJ6 C;  4A3B J;  2NS7 A;  4B3A A;  1JKO C;  2E2J J;  5HBU A;  3B6C A;  3NRG A;  5C4Y A;  4JYK A;  2FJ1 A;  1WI3 A;  5EDN A;  1MNM C;  5M3F J;  2HQ5 A;  3RKQ A;  1XG1 A;  5EF6 A;  3TW6 A;  4BY7 J;  3M3Y J;  4DYR A;  4V2G A;  2ME6 A;  3VVY A;  4CYC B;  2ELK A;  3HOZ J;  2DMT A;  3VVX A;  5E3L A;  1QRY A;  1WH5 A;  5EGO A;  2HDD A;  1IJW C;  2DA6 A;  1U9O A;  3HOX J;  3G56 A;  2Y2Z A;  4M3B A;  2LVS A;  2DTZ A;  2HKU A;  4L5E A;  2NVT J;  1ZK8 A;  4M3F A;  1SAN A;  1JGG A;  1ETW A;  4MO7 A;  2VKV A;  3HOU J;  1ETX A;  2CQQ A;  3S1R J;  1BJZ A;  1ETQ A;  3EUP A;  3HKZ N;  4M3D A;  5FKL A;  2MW8 A;  1Z0X A;  3ZQH A;  3VUQ A;  1QVT A;  5K58 A;  5FJ8 J;  2XPU A;  2ZB9 A;  2Y30 A;  2KDZ A;  2DMP A;  4A3L J;  2QIB A;  1ETV A;  2DMQ A;  3VIB A;  2VPR A;  5GP9 A;  2F07 A;  4NEL A;  1A6I A;  1TWA J;  4D5C A;  3QPL A;  1PUF A;  5K7Z A;  3G1O A;  4A3J J;  2ZCX A;  5E3M A;  3S17 J;  3K2A A;  3HTJ A;  3VW1 A;  3K7A J;  4A3D J;  2WGB A;  2LK2 A;  2E1O A;  4NDL A;  2MG4 A;  4A3K J;  5DS9 A;  2XPV A;  5M3M J;  2EZK A;  5M5W J;  4QIW N;  3CJD A;  2FD5 A;  2GM4 A;  3HTH A;  3SFI A;  2R7Z J;  4AF5 A;  5BNG A;  4D5F A;  2JJ7 A;  3WHC A;  5FLM J;  2RAE A;  3HTI A;  4IHV A;  2GFN A;  5C4X J;  5K7H A;  2MGQ A;  2HOS A;  3V78 A;  4C3I J;  1DU6 A;  2G7S A;  4JNN A;  2HXI A;  1G2H A;  2JN6 A;  4XK4 A;  1IGN A;  2LLK A;  3LSG A;  1EF4 A;  3BTC A;  1K61 A;  2QOP A;  5JLX A;  2ID6 A;  2XGC A;  5CW8 A;  4C2M J;  3PO3 J;  1WGX A;  4B4C A; 
#chains in the Genus database with same CATH topology
 4IF4 A;  4ENM A;  1ACI A;  5D4S A;  4BQO A;  2XHK A;  3KLN A;  5GTI C;  1UG0 A;  1LVK A;  3A01 A;  2XVC A;  4OIP F;  3GCM A;  3HTS B;  4XRS G;  4A93 J;  1H89 C;  1B59 A;  1Q1V A;  2QWT A;  4EM1 A;  2NOG A;  4V19 K;  5LGN A;  2VKH A;  2DMN A;  3BPX A;  3K1P A;  2Y0S N;  1Y39 A;  2FMY A;  2VBY A;  3DQV C;  3H9Q A;  3CUQ A;  4DJA A;  1BL0 A;  4HLX A;  1PP8 F;  1BR2 A;  3BNI A;  3DP7 A;  2R5Y B;  3OYN A;  3ABL H;  4I2O A;  3REO A;  1T8I A;  1WZ2 A;  3ZGK A;  2L9R A;  3ZMU A;  3L7W A;  5ERI A;  1Y56 A;  2VXD A;  4NHJ A;  3BDD A;  3FK6 A;  4HX7 A;  4UHT A;  3CCQ I;  1R71 A;  2EZL A;  3DPT A;  4Z6Y A;  2GWR A;  2K02 A;  4WK8 F;  3QWL A;  3DEW A;  1O57 A;  2HPI A;  2L4M A;  5C4J J;  2R7F A;  1VQ5 I;  4A3E J;  1UI6 A;  4PJM A;  4ESJ A;  1JKP C;  1WJC A;  2NOJ B;  2K3F A;  3M4O J;  5JVT A;  3P9C A;  1LFU P;  1V55 H;  1MBG A;  3D1N I;  4WX9 A;  1SGM A;  3BP8 A;  3J7Y J;  3JRI A;  1X1P A;  3HKZ A;  3G3Z A;  4XLF A;  4MTE A;  2EZI A;  1ETK A;  1G8X A;  1R5H A;  1RET A;  1X3Z B;  3SEZ A;  5J8F A;  5M5Y J;  4OIQ F;  2E7W A;  2M9H A;  1BM9 A;  1FP2 A;  2XRL A;  4N9I A;  4A3M J;  3I53 A;  3I4P A;  5F0H A;  1KZH A;  2D1V A;  2VKD A;  2HKO A;  4LG3 A;  3WE3 A;  3KP7 A;  2K3P A;  4PXI A;  3SZP A;  2HVS A;  5FO5 A;  5B1B H;  1UI5 A;  3VVZ A;  3S1Q J;  5D5U B;  5J1R A;  1LE8 B;  3VSK A;  1C0W A;  4EJT A;  1SFE A;  4E4H A;  3IC7 A;  3J80 Z;  2QBY B;  1AHD P;  5F0C A;  3LA3 A;  4UUV A;  5J4V A;  3PQK A;  1ZH5 A;  5GTH C;  2EIK H;  3L1P A;  3HB9 A;  3T6N A;  1UG2 A;  4S05 A;  1DGR M;  4DZP A;  4AUX A;  1R36 A;  2KLO A;  2F6C A;  4HNV A;  1AKH B;  2V79 A;  3GVA A;  3WTZ A;  3HXL A;  3S2W A;  4BE2 A;  1SFK A;  2KP6 A;  1XPX A;  3BG3 A;  1Z91 A;  1LQ1 A;  2KZG A;  3J7A O;  4MFD A;  1T6S A;  1QZY A;  1X3U A;  3K10 A;  1LDD A;  2CW7 A;  1D0X A;  4WXC A;  3VPR A;  2M0C A;  1SMT A;  4C2M A;  4D0P A;  1S6L A;  4U9L A;  4AYB A;  2XPW A;  5IOY A;  1VFC A;  5ED4 A;  2HYG D;  4BJ5 C;  2LF7 A;  2RRE A;  3DTK A;  3GME A;  5IP9 J;  1I5Z A;  3ABK H;  1HKQ A;  4BEH B;  2Y69 H;  1WJE A;  2JVH A;  4ENJ A;  3GWZ A;  2HDW A;  2Z5U A;  4BYY A;  1FIA A;  3OYJ A;  1O3S A;  3JR9 A;  3OIO A;  2VQG A;  2X1C A;  2X48 A;  5EYR A;  3I3L A;  1QZZ A;  3G7R A;  1DQU A;  4D7N A;  2P7C B;  3BHQ A;  3HHH A;  5GAD J;  3S14 J;  4D7M A;  4U0W A;  1MJB A;  2Y0S A;  3K70 D;  1FOW A;  3CMA I;  3BOQ A;  1K6O A;  2MAB A;  3UKG A;  1MMS A;  3W6K B;  3GFI A;  3FWE A;  4DYC A;  3KKD A;  3OS1 A;  2M7A A;  3BR0 A;  3CMM A;  1KON A;  1YE9 A;  3I9V 2;  2R7X A;  2MD0 A;  5FKO A;  3HUG B;  4UUS A;  4I99 C;  1ORK A;  4QSH A;  3QKX A;  5D8L B;  2CRG A;  3P9T A;  2LDU A;  2HTS A;  2WY8 Q;  3R4K A;  3VOK A;  2D1H A;  1U5T C;  3ZMT A;  1R1U A;  2E5N A;  3NPI A;  2L0K A;  1DDN A;  4A2U A;  4XID A;  2TCT A;  2YU9 J;  2OPT A;  2YVE A;  2M8E A;  2DJN A;  2YSR A;  1ZG5 A;  4BHC A;  5EG0 A;  2E19 A;  3PL8 A;  5IT9 Z;  1TC3 C;  4XRS A;  3JSJ A;  4HSR A;  3T1B A;  2F5V A;  3LST A;  5LHI A;  3IL2 A;  4HKU A;  3OMY A;  2REK A;  1JE8 A;  3QRF F;  3BJO A;  2GXG A;  3RQ4 A;  2ECB A;  3FIS A;  3OYI A;  2OER A;  2BVL A;  5EJC A;  2CV2 A;  2HKX A;  4FIS A;  2A05 A;  4EGZ A;  3BR1 A;  3HZJ A;  4LD5 A;  4E7J A;  1RIO H;  2VBW A;  1W36 C;  3CZ6 A;  3TOA A;  1TQI A;  3FXJ A;  3VB2 A;  3P7N A;  5L3C A;  1XSV A;  4IEJ A;  3MKL A;  3A01 B;  4IZZ A;  3HRU A;  4DQ2 A;  4HF0 A;  2VON A;  3O6B B;  3RH2 A;  3LMM A;  3PUB A;  2XAQ A;  2KHM A;  3B73 A;  2O6G E;  2DA4 A;  3NRV A;  2LP0 A;  3ZRG A;  2XV4 S;  3U9G A;  3RKX A;  4ANJ A;  4ZYE A;  1WJF A;  4FE7 A;  3K4L A;  3EUH A;  2W82 A;  4MFE A;  4HDV A;  2AQE A;  5F08 A;  4E7H A;  1ETY A;  2B7E A;  5FKK A;  3V42 A;  2Y9Z A;  1VQ4 I;  1BR1 A;  1HF0 A;  2NVY J;  4YFX F;  2STT A;  2HFH A;  5BQT A;  4BQN A;  1MH3 A;  4A3I J;  4EJW A;  2HZD A;  4ETS A;  3Q0V A;  2Q2E A;  4FAS D;  2XB5 A;  1JGS A;  5IYB J;  1UST A;  2BW3 B;  2E1M B;  3WU2 C;  1G4D A;  1VQ8 I;  2UUZ A;  1XCV A;  2EA2 A;  3FKJ A;  1J09 A;  1TNT A;  2R4G A;  1YLF A;  2JA8 J;  3VW0 A;  2VQC A;  1DPU A;  4AIK A;  3PO2 J;  1BOA A;  1R1V A;  3I56 I;  4JBA A;  3QP5 A;  4B8X A;  3IH2 A;  4NB5 A;  4KIF A;  5CVU A;  3C2H A;  1IN8 A;  1Z21 A;  2ZC2 A;  3E6C C;  1ZGW A;  1U8R A;  3PAS A;  2OCC H;  4FT8 A;  3TGN A;  2WAF A;  3BG9 A;  4L9J A;  3ZQG A;  3DEE A;  1G59 A;  3LOC A;  4F55 A;  3OL3 A;  2RNG A;  4Y7N J;  3HRM A;  5EGO B;  1ON1 A;  2F5E A;  1BW6 A;  1OPC A;  4GGG A;  5CPR B;  1I1S A;  3FXU A;  5FGL A;  3CCY A;  1Z6T A;  2M4K A;  2VOO A;  3RPU D;  3HBL A;  2YX4 A;  4LK0 F;  3TW7 A;  1HW1 A;  5FHP A;  1EH8 A;  2LKX A;  2L54 A;  4ENN A;  4TV7 A;  3EYY A;  3O8G A;  2JA7 J;  1IV6 A;  2DLL A;  4EAT A;  3PQJ A;  3GZN B;  2ELH A;  1RKT A;  1MD0 A;  3ZQF A;  2RNJ A;  3IAM 2;  2X0L A;  3CJQ B;  2STW A;  3IP4 B;  3W6J B;  4LLG F;  3FHZ A;  4Y15 A;  3JRE A;  4U88 A;  1LPQ A;  2ZKZ A;  2XAJ A;  1T95 A;  3HEF A;  1JKQ C;  3H5R A;  2BY1 A;  5FKN A;  2KRF A;  4UV8 A;  1YHQ I;  4RMN A;  1QHH D;  1SC7 A;  2KQR A;  1H88 C;  3J7Z I;  1CF7 A;  1U2W A;  2QZ8 A;  1ZR2 A;  3BY6 A;  1XMK A;  3BCA A;  4EVI A;  2X85 A;  4ENK A;  1X58 A;  4C3H J;  4BXX J;  3GZI A;  2K40 A;  3VOD A;  4MK6 A;  4N0B A;  2DA1 A;  3IH4 A;  1GV5 A;  3FXR A;  2VQL A;  3JAM K;  3K4M A;  3MAJ A;  2FOK A;  2IGO A;  3ERE D;  3KEY A;  4KN4 X;  2R5Z A;  3V8K A;  1RUN A;  2K9M A;  2QM3 A;  4RB3 C;  2UXX A;  4CCN A;  1V4R A;  1G3Y A;  5KK1 A;  2DA3 A;  4GCK A;  3A1Y A;  5TIS C;  1NH3 A;  3LA7 A;  4OIN F;  1YQA A;  3BTI A;  2IT0 A;  3S5R A;  1ZLJ A;  2XGD A;  1QPM A;  2DK5 A;  1YFH A;  2WBM A;  3FHN A;  2O7T A;  4XR6 A;  1XMX A;  4A5N A;  1KQ8 A;  5HSZ A;  4M3G A;  1XX5 A;  1SFO J;  4NC7 A;  2XGE A;  2D2W A;  3GYH X;  4CGZ A;  3MKW B;  1KYZ A;  1IV8 A;  3DU6 A;  3OIP A;  3H3U A;  1S5L C;  4EQQ A;  1XGN A;  2Y48 A;  1GDT A;  2DYS H;  2O61 A;  2EFP A;  4L9T A;  3OYM A;  3DLA A;  1CQT A;  1P7I A;  2A5W A;  3QQA A;  4X1E A;  3SJM A;  4BY1 J;  4ICH A;  1I1G A;  2K27 A;  3A0B C;  3CDH A;  5H20 A;  6PAX A;  3DPJ A;  1G3T A;  1GLN A;  4J19 A;  4YFN F;  3S3M A;  2DOF A;  2Z3Y A;  2ZBK A;  2EQR A;  1HSJ A;  4Y13 A;  3Q0U A;  4I7H A;  1A35 A;  3HDD A;  1KA8 A;  2E36 A;  2NAZ A;  2ELJ A;  3BG6 A;  3E6M A;  5HLG A;  4E7K A;  4S04 A;  3J7A Y;  3DU5 A;  2X6Y A;  1EH6 A;  4C2T A;  2CMP A;  4O5V A;  5D8K B;  3G73 A;  4R1H A;  5EDN A;  3BWG A;  5M3F J;  4N9H A;  3M3Y J;  4DYR A;  1XD7 A;  2DCE A;  3HG9 A;  1BR4 A;  2P0W A;  1N78 A;  1W36 D;  3IUO A;  3HOZ J;  2DMT A;  2FQ3 A;  5D5X B;  4MQV A;  4XLN F;  5FD6 A;  3JSP A;  3KP5 A;  4ZYG A;  1IN7 A;  3HOX J;  2LRE A;  2CQN A;  3CUO A;  2QKL B;  1Z7L A;  2DQR A;  3I55 I;  4BL0 B;  4F91 B;  1ZK8 A;  2YR2 A;  4BU2 A;  4MO7 A;  3VYS B;  2F5C A;  1VQL I;  3EUP A;  4RAY A;  4M3D A;  2I5U A;  4R79 A;  3ZQH A;  3VUQ A;  2B1E A;  3M9A A;  1R58 A;  1YW8 A;  3MCZ A;  4HQM A;  3OYF A;  4ON0 A;  2EK5 A;  5FRM A;  3WU1 B;  4XRF A;  2F48 A;  3CP2 A;  2ZXW H;  5GP9 A;  5J6X A;  1A6I A;  4D5C A;  1SVM A;  4G8X A;  5ILU A;  1PUF A;  1P6R A;  3G1O A;  4A3J J;  3HTU A;  5KNL A;  3AL0 C;  2WB1 A;  3HTJ A;  3VW1 A;  5KHD A;  2UZK A;  1YIT I;  3OYB A;  3U1K A;  2LK2 A;  2E1O A;  3L2C A;  1TLH B;  5KVR A;  2DAO A;  5J47 A;  1J75 A;  5TJJ A;  2XPV A;  5M3M J;  5A2Q Z;  1OYY A;  3HYI A;  4QIW N;  1LNW A;  3CJD A;  1J2X A;  2FD5 A;  3RPU A;  2GM4 A;  4L0Z B;  4QPO A;  3U1D A;  3MFK A;  2BBY A;  2BY0 A;  1X3W B;  4D5F A;  2JJ7 A;  4CA0 A;  5FLM J;  3ZXS A;  1HKS A;  1BIA A;  2MGQ A;  3SXY A;  5D5W B;  2Y0M A;  5D5V B;  4JNN A;  3MKZ A;  1JHH A;  4XK4 A;  4ESF A;  2O8X A;  2FXA A;  2QSH X;  5H2F C;  2LNB A;  4EJU A;  4WXH A;  3CC7 I;  1V5E A;  2GOM A;  4HST A;  1F1Z A;  1WGX A;  2PJR B;  1GV2 A;  1PVE A;  3LQR A;  1KYW A;  3BC8 A;  2H1K A;  3RJP A;  4P96 A;  1VQ6 I;  5D1R A;  1UHS A;  2WV1 A;  4HV6 A;  5DCM B;  4M3E A;  5F1J A;  3DBR B;  1S8N A;  1B8I B;  2A2F X;  2W4S A;  3V8L A;  2Q1Z B;  1F9N A;  2R7Q A;  1X19 A;  3ZOB A;  2QKM B;  2JA6 J;  1MJ9 A;  2NS0 A;  4B1R A;  4UUT A;  3L2W A;  3RD3 A;  1FMV A;  2IJL A;  3NEU A;  3BG5 A;  3OR1 C;  1K78 B;  2FNP A;  4IOC F;  1LDK B;  1Y1W J;  2ZCM A;  1X2M A;  2COB A;  1D0Y A;  3ERM A;  1RUO A;  4B3X A;  2GBY A;  2V7F A;  2HR3 A;  3KP3 A;  1I3Q J;  5HOO A;  2EFN A;  2L5Q A;  2F5F A;  2VB6 A;  3NQO A;  4UVB A;  4CO8 A;  1XMA A;  4OOI A;  2ACJ A;  2KIQ A;  3I59 A;  2LKP A;  3EPZ A;  4Z2Y A;  3ZQQ A;  3DTE A;  4MHG A;  4C9Y A;  3ON4 A;  3DLL F;  2NX4 A;  4IHX A;  3M1C A;  3IAS 2;  4CYC A;  3AG2 H;  4S0H B;  2VBX A;  3BR2 A;  3JRD A;  2V6E A;  2ZOY A;  5EFY A;  4CXF A;  3H3V K;  3E6D A;  2IEK A;  3TMO A;  5E18 F;  3WTX C;  3D0S A;  4A69 C;  4PGG A;  3JRH A;  4KT6 A;  1U5T A;  1LKX A;  2FBI A;  3IRR A;  5E79 C;  4CZZ A;  3DWL E;  1RR8 C;  4HF2 A;  4EJV A;  4WCG A;  2DXI A;  3IWZ A;  3T0Y A;  2X1E A;  1UB9 A;  1SAX A;  3O2P E;  2OD5 A;  3IKV A;  4A3G J;  2R3S A;  2Z2S B;  1MJA A;  2HU9 A;  2LBF A;  2CUJ A;  1P4A A;  3CJT B;  4NBQ A;  5JFR A;  4KDP A;  3U2R A;  4Y4R A;  2KPM A;  2HNH A;  2A3S A;  2LSO A;  2MYS A;  2V26 A;  1XS9 A;  1ZRD A;  1WPK A;  2ETH A;  2EIN H;  1U0J A;  2X51 A;  5TRD A;  3FXM A;  1WSU A;  2ECC A;  3QBM A;  3FRQ A;  4C3J J;  4ABZ A;  4AC0 A;  4XLE A;  2PG4 A;  4F52 A;  2A69 F;  3TP0 A;  1SVL A;  5LGT A;  4BBS J;  3KEQ A;  3BZC A;  4RDU A;  4ZYH A;  3KZI C;  2W57 A;  1PP7 U;  5K7F A;  4LFU A;  4KA4 A;  2PFV A;  2A68 F;  1JJ8 C;  1Z77 A;  4RS8 A;  4O3M A;  3L2Q A;  4PSW A;  2V1D A;  2GZW A;  1W5T A;  4CZC A;  4WIB A;  1BIB A;  2RGV A;  2GLO A;  3WTW C;  3ONQ A;  3BRO A;  4G9Y A;  1AU7 A;  5EEA A;  3VDX A;  1EV7 A;  3RI4 A;  4BAY A;  2P5K A;  3E3V A;  3ECO A;  3LSH A;  4IL6 C;  4OD5 A;  1WI9 A;  3HL2 A;  3K4J A;  1VQM I;  3NS4 A;  4RGS A;  4KT5 C;  4IKF A;  4C30 A;  2V1X A;  3GW2 A;  4JK1 X;  3SEQ A;  4BQQ A;  3AKZ A;  3JRB A;  4E7L A;  1WQ2 A;  2OTL I;  1PUE E;  2WAQ A;  3L9F A;  4OD4 A;  1N25 A;  3TKY A;  3HGY A;  3BJ6 A;  4DZJ A;  2UXO A;  1W1W E;  3G6E I;  4Q5S F;  5F04 A;  3DKY A;  4AIJ A;  1S3J A;  5CQG A;  1ZR4 A;  4XKW A;  1QPI A;  3FXK A;  4JX4 A;  4X0G A;  3GX4 X;  3WG9 A;  4RLQ A;  2VT2 A;  3FMQ A;  2M5W A;  2M45 A;  2ESN A;  5E8G A;  2ZME C;  4WF2 A;  4GRI A;  2QQB A;  1UHW A;  3H1C A;  1U6G A;  2XB0 X;  2EBI A;  1W7P B;  2H1L A;  2EB7 A;  2P6T A;  3KYC B;  3WOD F;  1UFM A;  5FRO A;  4A0Z A;  4UB6 C;  3RSN A;  2HOT A;  1KU9 A;  2G3B A;  3EET A;  2DMU A;  1IW7 F;  2DYR H;  2YPR A;  4ZC3 A;  1S7A A;  2FEZ A;  2MSY A;  1UAA A;  1W4M A;  2XC7 A;  1RKW A;  2HZT A;  1QQI A;  2B3W A;  3COL A;  2ZJ2 A;  4YEL A;  1Y1V J;  5LHH A;  1Y8Q B;  4H4K C;  4RBO A;  1MBE A;  4BUP A;  2XAH A;  2VE9 A;  2KIU A;  4U87 A;  3GTJ J;  3W2W A;  1IN4 A;  4XIC A;  1UHM A;  2KIS A;  1OCP A;  4W1U A;  1HKT A;  1MGT A;  4MIM A;  1FSE A;  1K4T A;  4LK1 F;  4ZZD A;  1J59 A;  4GFL A;  1IDZ A;  1SAU A;  2XKO A;  1FPQ A;  4G6Q A;  3SDG A;  2E5Z A;  3WGH A;  4I6Z A;  1MW7 A;  2ZO4 A;  3S1N J;  1YG2 A;  1HDP A;  5B3S H;  3G2B A;  2H8W A;  2O7O A;  3E6B A;  3TDZ C;  2W84 A;  2R7S A;  1B9M A;  4XSZ F;  5HDG A;  3TO9 A;  1H9G A;  3MMY B;  1D3Y A;  3M8J A;  3GTQ J;  3FM5 A;  1NK2 P;  3M1E A;  1TT0 A;  1G3W A;  3LSP A;  3KNW A;  2IS6 A;  1XCB A;  4BH9 A;  1ETO A;  2F5D A;  2DT5 A;  2YVH A;  1GXQ A;  1R49 A;  4D1Q A;  2DO7 A;  2VUM J;  1D1C A;  3C1D A;  3WHB A;  3OS2 A;  4ZDP A;  2C6Y A;  1RNL A;  3HC7 A;  3BQZ A;  1QHG A;  3KP4 A;  3JRF A;  5BMZ A;  3F23 A;  1D8J A;  2FNA A;  3I54 A;  1FYK A;  5LFA A;  3I64 A;  4AM3 A;  2P8T A;  4FX4 A;  1V3F A;  4L62 A;  3ZQ7 A;  5J1Y A;  3FX3 A;  2PFB A;  2QSF X;  1FBU A;  2EFO A;  2L7F P;  5FLX Z;  2NXN B;  1B1B A;  5D19 A;  3RYP A;  4E7I A;  4GDF A;  1R4M B;  3GUD A;  4HZF A;  4JX6 A;  4DW6 A;  2PLY A;  1IUF A;  2PQ8 A;  1H0M A;  1F36 A;  2Z99 A;  4IO9 F;  2IAI A;  2QLZ A;  3RCO A;  4HLY A;  4HX8 A;  4CGR A;  2BOL A;  2LF8 A;  3LSJ A;  2R7W A;  5AIP A;  1YOV B;  1I39 A;  1OLT A;  1ZYR F;  2ZNZ A;  5IP6 A;  2MFZ A;  1A6Q A;  4DIQ A;  1X4P A;  2CUZ A;  1MDM A;  1H9T A;  2OU2 A;  4RLF A;  4AC6 A;  1X1B A;  5HS8 A;  3K69 A;  2JUG A;  4B44 A;  1KU2 A;  3Q0W A;  3R0A A;  4XOT A;  4NC8 A;  1IF1 A;  1XN7 A;  1UEL B;  2IGN A;  5J1U A;  2CS3 A;  3DF8 A;  3KIO A;  2OBP A;  3WTV C;  2DN0 A;  1R5G A;  1EH7 A;  4QTR A;  4NC6 A;  1JTX A;  2K7L A;  3J80 K;  3HIM A;  2W85 A;  4EJO A;  1ZN2 A;  1FOX A;  3MNL A;  1FX7 A;  4XOP A;  3ZMV A;  3CCM I;  1H8A C;  1BI0 A;  1BI3 A;  1USS A;  3VP5 A;  3ZMZ A;  4OU0 A;  2DG8 A;  3LA2 A;  4U0Y A;  2DQL A;  2NYX A;  4MNU A;  3MN2 A;  3N4M A;  2JUC A;  1P9Q C;  3QYF A;  2G7H A;  2UXU A;  3E7Q A;  2UXI A;  2OC6 A;  1S7E A;  3L2R A;  2IPQ X;  2XSD C;  5IYC J;  2K9S A;  3CO6 C;  1WJD A;  1TWH J;  4JOM A;  2X9D A;  3NAR A;  5DYM A;  4YFK F;  1IAW A;  2A5Y B;  3B02 A;  2ZJQ F;  3PSF A;  2BHY A;  3P9I A;  3ON2 A;  2H94 A;  4PGH A;  4GXO A;  4OWR B;  3C18 A;  3F8F A;  3LAJ A;  1D0Z A;  1ON2 A;  2ID3 A;  4HW0 A;  1ZQ3 P;  5DAJ A;  5GPA A;  2O03 A;  4LGW A;  5K5Q A;  2P81 A;  3CLO A;  3HPH A;  3KCC A;  4LOC A;  1Z1D A;  3RZD J;  1D1A A;  1HW5 A;  2IBD A;  2WAD A;  3BJB A;  1IN5 A;  2R0Q C;  3KP2 A;  4CSW A;  1ZRC A;  1VTN C;  1OCT C;  2UV1 A;  2E60 A;  1S7O A;  4YRV A;  4MXM A;  1DP7 P;  2X1D A;  4M71 A;  4GCL A;  4PSX A;  3AAF A;  1JT6 A;  3F8B A;  3IH3 A;  5IY5 H;  1OCC H;  2GUH A;  5FGM A;  1Z3X A;  5IT3 A;  1WHU A;  2ISY A;  1GXP A;  2GXB A;  2Y75 A;  4UVC A;  1IUY A;  2QQ8 A;  1STZ A;  2BHZ A;  5FRN A;  4MLO A;  2VL8 A;  1EJ9 A;  3H92 A;  3HSR A;  2DA7 A;  5K1Y A;  4I09 A;  3K8P C;  2CQX A;  2KL4 A;  2RQP A;  3CUQ B;  3VFZ A;  2W25 A;  4IVN A;  3HOV J;  2Z1D A;  5IT9 K;  4RAF A;  1QA6 A;  2HQA A;  4BGD A;  1JJ6 C;  2NS7 A;  4B3A A;  4G94 A;  3K1M A;  2E2J J;  1D8K A;  4IHS A;  4XL9 A;  3V4G A;  4JYK A;  5C4Y A;  4A12 A;  2HQR A;  3K4B A;  4RM3 A;  4XLH A;  1MNM C;  1FBS A;  1FSH A;  5EF6 A;  4V2G A;  1WKM A;  2ME6 A;  1YIJ I;  3VVY A;  3HSE A;  2ELK A;  2ZXJ A;  3J81 Z;  3F6V A;  2VJJ A;  2DA6 A;  1MZB A;  3G56 A;  4CIC A;  4M3B A;  3ZP5 A;  3T5X A;  1CGP A;  1T0F C;  2V9K A;  2F4I A;  4HNT A;  4ZH4 F;  3KFW X;  1AA7 A;  1A36 A;  3F72 A;  1FYM A;  2IXS A;  4DNC A;  3S1R J;  3MKY B;  2FML A;  2LY2 A;  2CSO A;  5FKL A;  2MW8 A;  1Z0X A;  2QSG X;  2ZFU A;  2CWE A;  2ZB9 A;  2JSP A;  4KUM A;  2FE3 A;  1XGS A;  2DMP A;  1MND A;  3CCE I;  2DMQ A;  2QIB A;  3I0T A;  3PSI A;  3VIB A;  2VPR A;  2OCE A;  4HPQ A;  4KIS A;  5ICE A;  3PIP F;  2FJI 1;  2F07 A;  1TWA J;  4GYG A;  1LVA A;  2M0M A;  1ONV A;  1ZEL A;  2OAZ A;  3KYD B;  5E3M A;  2H09 A;  3MZY A;  2V9P A;  1LUJ B;  4HAM A;  3LSK A;  2OZ6 A;  2RN7 A;  3K7A J;  3S93 A;  4GO1 A;  2HOE A;  4A3D J;  4NDL A;  1E3P A;  2IGK A;  3OYK A;  4A3K J;  4RGU A;  3QPT A;  2EZK A;  3DV8 A;  1GHC A;  3ZPL A;  3OS0 A;  2M87 A;  3JAM Z;  5DM7 F;  1R1T A;  3RYR A;  3UNG C;  4LIU A;  1RC9 A;  1YX5 A;  2RAE A;  1P2F A;  3HTI A;  3DTI A;  2QQ9 A;  4DVY P;  1FNN A;  4CCO A;  3V78 A;  2HWV A;  2XSJ C;  4EV0 A;  2EFW A;  1W5C C;  5K5R A;  3K0L A;  4F92 B;  3EUK L;  1WWX A;  2R7V A;  2E1M C;  3BTC A;  3IWF A;  2DW4 A;  5HLT A;  4B43 A;  4C2M J;  3PO3 J;  2MLG A;  2ZCW A;  3X2Q H;  3ZN1 A;  4BS9 A;  1T39 A;  4B4C A;  1ERD A;  3A03 A;  2ZCN A;  2L2O A;  4ASN A;  2VC1 A;  1N77 A;  3CME I;  3OSG A;  3WTT C;  1B72 A;  5J4Y A;  2JMW A;  2KJC A;  4Q47 A;  2DA5 A;  5IPA A;  3FM3 A;  1POG A;  2OV7 A;  5H6R A;  1Y0N A;  1HDD C;  5LEJ A;  2QWW A;  1O7F A;  2E71 A;  3OOP A;  2EZH A;  2KDO A;  2ZY9 A;  1MSF C;  4BHB A;  2VT3 A;  4RGX A;  3K2Z A;  4M6X A;  1O3R A;  2KIM A;  4WWC A;  3NAU A;  2CYY A;  5FFX A;  3M07 A;  2QUF A;  5CYV A;  4UUS B;  1OFC X;  2X6O A;  5HLI A;  2HXO A;  1IZ1 A;  3A2K A;  2M7B A;  3SHF A;  4N4N B;  5E8I A;  3QPH A;  3QU3 A;  2AQF A;  2JWT A;  2HOA A;  4EGY A;  1Z3Y A;  3SYT A;  3F8M A;  2V9V A;  3AG4 H;  3PPB A;  3M8F A;  2ZME A;  5HNH A;  1WJB A;  3MWM A;  4B47 A;  5GPC A;  3BZK A;  5EG0 B;  3H5A A;  2RKH A;  3BCB A;  2WY7 Q;  3BR6 A;  5L3E A;  1YJN I;  3ANG A;  2G9W A;  4KYW A;  1WJA A;  2HYT A;  3JSO A;  3JTH A;  4G6T B;  5H6Q A;  1ZRF A;  2V6C A;  4R8H A;  4QWQ A;  2O9L A;  2P5V A;  5HAW A;  2EWN A;  3EUA A;  3PNV A;  4BBR J;  2XRO A;  3WU0 A;  4KIG A;  2BGC A;  1K79 A;  4BKX A;  5GAG J;  3GEZ A;  1ZLK A;  1R00 A;  3HJE A;  3LWJ A;  4IQ4 A;  2VJI A;  1XSD A;  3KEO A;  4X6A J;  1MKM A;  1MH4 A;  4PJL A;  9ANT A;  4II2 A;  4P9F A;  2MH2 A;  4LIV A;  2HS5 A;  4YEJ A;  1D5Y A;  3QP6 A;  5D6E A;  3GBG A;  4ME9 A;  2R7O A;  2LC2 A;  1OR7 C;  3TP3 A;  5HOD A;  5ICF A;  2RVC A;  4LB5 A;  2OUM A;  3S15 J;  2RC4 A;  2LD5 A;  3I4N J;  3BCG A;  1JT0 A;  5ILS A;  1I6H J;  2JRM A;  4ZZL A;  4XNF A;  2P4W A;  5CXI A;  3I4M J;  1Z05 A;  2O5R A;  1WCM J;  3VYR B;  4HA8 A;  3HOW J;  4U9N A;  3ASN H;  2Q2E B;  2N8G A;  3LHQ A;  1XSX A;  2VKE A;  3BT9 A;  5IP7 J;  4F93 B;  2FA5 A;  1VQP I;  3VYT B;  3RQI A;  1FZP B;  2VAS A;  2PBI A;  2L02 A;  5AIQ A;  2LFB A;  3W2V A;  4H0E A;  2PMZ N;  3JRA A;  2FU4 A;  4FHT A;  1UJ8 A;  2K4B A;  4UY8 I;  3OYA A;  1NTC A;  4I0A A;  1V5F A;  5JVG F;  2AHQ A;  3KYL A;  4AD9 A;  5FLV A;  1LJ9 A;  1NG6 A;  1O3T A;  2OQR A;  2OI8 A;  1QU3 A;  1WH7 A;  5DEQ A;  4UDS A;  2H6C A;  4M9X A;  4P1W A;  2WTE A;  4RAG A;  4UNO A;  3DXJ F;  1QVU A;  3OYC A;  3CCJ I;  2TRT A;  3ISP A;  3EGQ A;  2CQK A;  2B63 J;  5HVQ C;  2VJ5 A;  2M8G X;  3R61 A;  1G3S A;  2R92 J;  2R5Y A;  3KP6 A;  1N75 A;  2OZU A;  4QLC U;  3S8P A;  1QBJ A;  1MBF A;  3W3C A;  1FTZ A;  3V6G A;  5HS9 A;  2CJJ A;  5HNF A;  3KKC A;  2IA0 A;  1NK3 P;  4ESB A;  4ACI A;  2EPF A;  3JCU C;  2L7Z A;  1ENH A;  5E1X A;  2CUE A;  2QEX I;  1VF9 A;  2EH3 A;  5A2Q K;  2QGU A;  2MLK A;  1XGM A;  5EEG A;  5JR3 A;  2QF7 A;  4IXA A;  1TWG J;  5D18 A;  2QCO A;  4XRM A;  5BPD A;  1EKE A;  3KLO A;  2BV6 A;  3ASO H;  2VN2 A;  3K4K A;  5HDN A;  4EEF G;  1X1D A;  1CF7 B;  4JP0 A;  1OJL A;  1P7J A;  5B66 C;  1XTA A;  3CDL A;  1M1E B;  3PIO F;  4I76 A;  4HEA 2;  5LRS A;  2IU5 A;  3NI7 A;  4KNY A;  3F3X A;  1IRZ A;  4YIR X;  3BRU A;  1VI0 A;  4AID A;  5FKM A;  4V2F A;  1SD6 A;  2Y9Y A;  5L3G A;  2KKO A;  2R5Z B;  3H9G A;  3S1M J;  1XB4 A;  3ULQ B;  2D6Y A;  3HPG A;  3VSL A;  1QO0 D;  5LEK A;  3DCF A;  2DBB A;  3CQZ J;  3DPU A;  3KPH A;  3OYD A;  2XAS A;  2ZNY A;  1TZL A;  5KAI C;  2DT7 B;  2M34 A;  3HM5 A;  2QBY A;  3CRJ A;  3TOB A;  4XLC A;  1XC5 A;  2RQQ A;  1B6A A;  1TWC J;  2Q24 A;  3E0J B;  2CFO A;  2VE8 A;  3MEX A;  4O6J A;  5FMP A;  1O4X A;  2W1O A;  1GVD A;  2VIX A;  3Q9S A;  3WTU C;  1OIS A;  1AKH A;  2WWY A;  4DBQ A;  3Q5F A;  3E5Q A;  3OWT A;  4OMY A;  1BW5 A;  1FLI A;  1IXC A;  3CMY A;  4FTH A;  3VOX A;  4KIC A;  5EZH A;  1K7A A;  1SMY F;  2IW5 A;  3FXQ A;  4C2U A;  3NWT A;  2XUB A;  3G1M A;  2V57 A;  3FIW A;  2CH0 A;  5E1W A;  2OF7 A;  3I5U A;  3SZG A;  3CP8 A;  2LY1 A;  3N97 A;  4L9V A;  1LFB A;  4M73 A;  5J8C A;  5HLH A;  3M8E A;  2A07 F;  3DPL C;  4BEH A;  2FF4 A;  1JI8 A;  3KX2 A;  2DA2 A;  1HOM A;  3OSF A;  3VEP A;  1SFU A;  5B1A H;  2GIZ A;  1R23 A;  4W97 A;  3GTP J;  1SD7 A;  2PJP A;  5DD4 A;  5DV5 A;  2FRH A;  4PK4 A;  3GF2 A;  1Z9C A;  3O60 A;  2EJR A;  1ZHF A;  4XSX F;  4XMY A;  2EA4 A;  1L0O C;  3E7L A;  4FCY A;  3EQL F;  2VC0 A;  2IGM A;  1LFP A;  5CKT A;  3H0G J;  2PBX A;  1I3A A;  1ZKG A;  4A6E A;  2JK3 A;  2H27 A;  1HLV A;  3FK7 A;  2FX0 A;  5C3E J;  4M6Y A;  3HUG A;  4M74 A;  2JT1 A;  2WV0 A;  4FET A;  4EMS A;  2W53 A;  2BVM A;  2CU7 A;  5B5E C;  1WFX A;  2HYJ A;  2XIG A;  4CCK A;  1T0F A;  5F0F A;  1KQ9 A;  2EIL H;  3GTG J;  1P4W A;  3M7G A;  2AS5 F;  3H36 A;  4LMY A;  2BE5 F;  3E5U A;  2VBZ A;  2ME0 A;  1PUF B;  4IHW A;  4XQF A;  1FTT A;  3TQN A;  3KE2 A;  1P92 A;  4MQ9 F;  3O8H A;  2EIM H;  1AOY A;  2Z9O A;  2HVQ A;  4I0B A;  4RGR A;  2D5V A;  2RAS A;  3TBI A;  2KIF A;  2GAU A;  2XAF A;  3ECH A;  1Y0U A;  1Z7U A;  3OV8 A;  1TP4 A;  3F0C A;  4I02 A;  4PFO A;  2FUG 2;  3T8R A;  2LR8 A;  5KCM A;  3AQS A;  3WTY C;  2B9S A;  4AYB N;  3EDP A;  2EV6 A;  4J00 A;  2UXH A;  2XRN A;  2GXA A;  3R60 A;  1ZAR A;  4IJA A;  4XKC A;  3JRG A;  3BR5 A;  3LAP A;  4HYE A;  3CJN A;  2L3D A;  4CYD A;  4BE1 A;  4JKZ A;  3HIF A;  2ZJR F;  2DOD A;  2BZT A;  4IPA A;  1FP1 D;  3LQQ A;  2UWM A;  2AXL A;  3ESW B;  2XF7 A;  4A3F J;  2ZSI B;  1YRN A;  3C07 A;  1YS6 A;  2VI6 A;  4ITV A;  2Y31 A;  1HA8 A;  3GTM J;  3B6A A;  1FBQ A;  4NUB A;  2R93 J;  1FWZ A;  4JX5 A;  4ZYA A;  1V5G A;  1Y8R B;  2FBK A;  5DDG A;  2K86 A;  2GOX B;  2VQH A;  5GAE J;  1X2N A;  2CW8 A;  4G7O F;  2QKO A;  3E97 A;  3CDI A;  5E1Z B;  1YW7 A;  1J5Y A;  4N4O B;  3L00 A;  4NNJ A;  1FOK A;  1E3O C;  2BW3 A;  1Q1H A;  1ZG3 A;  3AG3 H;  4MTD A;  1OMI A;  2MA3 A;  1GT0 C;  1NHA A;  4Q4Z F;  1TBX A;  4D9J A;  1S72 I;  2CUF A;  3PM1 A;  3PNY A;  5LLQ A;  5D4R A;  1HC8 A;  3CWR A;  3FBI B;  3TO6 A;  1J7K A;  3HSF A;  2IRF G;  1REP C;  2JSC A;  1MBK A;  3FKI J;  3N05 A;  4P55 A;  3HHG A;  2JPC A;  2KRH A;  5LGU A;  4HDU A;  4A3B J;  4JQF A;  3C3W A;  4LLL A;  1L3L A;  4ZTF A;  5DM6 F;  1JKO C;  5HBU A;  4LJZ F;  2DJI A;  1D1B A;  3B6C A;  3VWB A;  3NRG A;  2K5C A;  2YVX A;  1WI3 A;  1KQ0 A;  2VJ4 A;  3DBH B;  2HDC A;  2HQ5 A;  2OQG A;  4BY7 J;  2KRC A;  2R7R A;  3I59 B;  2WAE A;  4FX0 A;  2L9V A;  4CYC B;  4I01 A;  2V1N A;  1QRY A;  2M1B A;  3PFY A;  3CLQ A;  5EGO A;  4PJJ A;  1U9O A;  2JA2 A;  4Q48 A;  4KIT B;  2HQN A;  3K9T A;  1YX3 A;  2NVU B;  3CCV I;  4OAY A;  4DOZ A;  2HKU A;  1VQO I;  3P9K A;  4L5E A;  1ULY A;  3CTA A;  1JGG A;  1DP3 A;  1SAN A;  1D5V A;  1ETW A;  1U5T B;  2VKV A;  2ZSH B;  2EV0 A;  2K4J A;  4OIR F;  3HOU J;  2BXZ A;  1BJZ A;  1ETQ A;  5CVR A;  4P9U A;  5K58 A;  5BOX A;  5LD2 C;  4YG2 F;  3ZCO A;  4F3Q A;  2E35 A;  4BNC A;  1E2X A;  3AFH A;  2LBF B;  3GLL A;  4A3L J;  1FOY A;  4G6D A;  1ETV A;  5FD5 A;  4UV9 A;  1G6N A;  2A6E F;  2R7D A;  2J5O A;  2M30 A;  4NEL A;  5K7Z A;  2ZCX A;  3RIR A;  5GAH J;  3BPV A;  4HF1 A;  1RI7 A;  3IKT A;  1UZC A;  2XKP A;  1ZG1 A;  1A04 A;  2QEN A;  3PJR A;  5FLX K;  5DS9 A;  4RB0 A;  3LWF A;  1OYI A;  2L4A A;  3SQN A;  2YU3 A;  4CDG A;  2FBH A;  1OR7 A;  3PFI A;  4AF5 A;  5BNG A;  4AVZ A;  3S32 A;  2K85 A;  1YJW I;  2COM A;  2LH9 A;  2W24 A;  1XGO A;  1WRJ A;  2P5L C;  4IHV A;  4KFC A;  5C4X J;  2GFN A;  4LG0 A;  2GQQ A;  2HOS A;  1K4S A;  5J40 A;  3Q9V A;  2HXI A;  3V7C A;  2E7X A;  3ZMS A;  3F8N A;  2CV0 A;  4LLN A;  1EF4 A;  1K61 A;  2QOP A;  2OJE D;  2ID6 A;  3KZY A;  1YYV A;  1XDS A;  4XM3 A;  4EM2 A;  5LBQ A;  4RM2 A;  1DGW Y;  4U7D A;  2W00 A;  2VOP A;  4PDK A;  3CO7 C;  3R6S A;  2W48 A;  3BTL A;  3CCU I;  1B4A A;  1EA3 A;  3TED A;  3CC2 I;  2GEN A;  4HNU A;  3RKW A;  1T2K A;  1APL C;  5E3O A;  2HEO A;  2H6B A;  4EM0 B;  1O7L A;  3QYE A;  1OKR A;  4HBL A;  1I50 J;  3OYG A;  2WC2 A;  2L7K A;  3PNT A;  4II3 A;  2DFF A;  1FEX A;  4KMU X;  3RZO J;  4PZJ A;  4G7Z F;  1GUU A;  4DGW B;  2DT6 A;  3DEU A;  1BN5 A;  3W2A A;  2DOA A;  2JTV A;  4RAZ A;  2KFD A;  3LNQ A;  1RZ4 A;  3ZQC A;  1ITY A;  1WJ5 A;  3GLX A;  1T38 A;  2NVX J;  4XKB A;  4M9S A;  2K9N A;  3NXC A;  2ZJP F;  3HTA A;  4M6V A;  1E0E A;  2LOO A;  1DU0 A;  2I8D A;  1VND A;  1HCR A;  5C44 J;  5CVV A;  2CV1 A;  1ZGA A;  1T33 A;  3IV5 A;  3LFU A;  2ESH A;  1PYV A;  5CJ9 A;  3HOS A;  1ODD A;  3B81 A;  2L01 A;  4XN3 A;  2GA2 A;  1WVR A;  3ABT A;  4BDY A;  3G4S I;  3RTR A;  5DTD A;  4KJZ A;  1YRN B;  2PEX A;  2JZY A;  3BLY A;  4ZTJ A;  3MVP A;  4NN1 A;  1JKR C;  1JUS A;  1S29 A;  3Q3S A;  1F4K A;  2VXZ A;  2RV8 A;  3CD6 I;  2B0L A;  1LDJ A;  2BY2 A;  4HRI A;  3T8T A;  1HW2 A;  1IG7 A;  1QZE A;  1Z6R A;  2VOD A;  4IRG A;  1RPW A;  2JQ7 A;  1A5J A;  1FJL A;  4XON A;  3ZR8 X;  2HTJ A;  3OYL A;  2O8K A;  2LYC A;  2NNY A;  4IRI A;  3D5R C;  1KU3 A;  2DDB A;  4CCL A;  3KET A;  2H8R A;  1QGP A;  4M72 A;  5ILV A;  3AQT A;  1W0T A;  2NP5 A;  4U0V A;  3SZT A;  3HRT A;  1NG7 A;  4NQW A;  1W0U A;  2QTQ A;  4HOB A;  4CUG A;  1TQM A;  1BI1 A;  1JXS A;  2AO9 A;  3CES A;  1SD4 A;  3BG7 A;  4DYQ A;  3SWH A;  4MGR A;  3L2U A;  1U8B A;  2A6T A;  3H5N A;  2R7T A;  2XAG A;  3ABM H;  2QVO A;  1SFX A;  2V1U A;  4L9N A;  3GFJ A;  1ZAO A;  4HQE A;  3VTI A;  3J81 K;  1W7P D;  3CCS I;  5BPI A;  1T98 A;  4AU7 A;  4B09 A;  3FXL A;  3OYE A;  3ROU A;  1W5S A;  3GTK J;  1IXS B;  4XKV A;  2DFI A;  3R0J A;  1RR7 A;  2DFH A;  2Z16 A;  4Y3O A;  3VW2 A;  2KJB A;  2ZOZ A;  3D5S C;  3COA C;  3GZ6 A;  2BYV E;  5L3D A;  2PJR A;  2G7U A;  5E3N A;  2Z33 A;  4GFB A;  2ISZ A;  2XDV A;  3BTJ A;  3CUQ C;  3GO5 A;  3EYI A;  1BC8 C;  4GYI A;  5DCM A;  3VOE A;  2E1N A;  1B9N A;  1B8I A;  1IRG A;  3E1S A;  3CCL I;  1TWF J;  1FMW A;  1IO2 A;  2P7V B;  4RA2 A;  3GTL J;  2UXP A;  1MDM B;  3FZV A;  3H35 A;  1TTY A;  2LTP A;  5CQE A;  2V4J C;  2A6H F;  2NS8 A;  3FDY A;  3TO7 A;  2BY3 A;  1K78 A;  4GCT A;  1MMG A;  3V7R A;  4HG2 A;  5ICC A;  1R5I D;  3LSR A;  1VQ9 I;  2M2E A;  2X4H A;  4L5I A;  3G1L A;  3QOD A;  1VQN I;  1RES A;  2NP3 A;  1JUP A;  1PJR A;  4IHY A;  5DCF A;  2YUS A;  5CVJ A;  2WB1 N;  3K4N A;  5TGT A;  3F6O A;  4UB8 C;  2DG7 A;  1IDY A;  3GZ5 A;  3S2H J;  3LJL A;  5JHF A;  1TW3 A;  5CVI A;  3MZ8 A;  2D45 A;  4ZDO A;  2K9L A;  5LHG A;  1BA5 A;  2F4M B;  5AON A;  4BXF A;  2TDX A;  3LL7 A;  3U21 A;  2HVR A;  4L5J A;  4PJ0 C;  1SD5 A;  3HRS A;  1BJA A;  3CF2 A;  2FQ4 A;  3C2B A;  4AVP A;  3F21 A;  1YJ9 I;  4LG0 B;  4P5O A;  2RHA A;  3S16 J;  3BR3 A;  4FQG A;  3OL4 A;  2LG4 A;  2IS1 A;  1I6X A;  4LB6 B;  3HOY J;  3P5J A;  2DI3 A;  4CHU A;  1IXR C;  3D5L A;  2XF5 A;  1MBJ A;  3AL0 B;  3RDI A;  2MD5 A;  2A61 A;  2MH9 A;  2G0E A;  3OOU A;  4G12 A;  5H9T A;  4IRV A;  4OAZ A;  1JHF A;  1OQY A;  3S3O A;  2RDP A;  2GIV A;  1VQK I;  3HGG A;  4CCJ A;  2XF6 A;  3LSI A;  4DBR A;  4MEX F;  4HV5 A;  3DKX A;  2L7M P;  1PDN C;  3A4C A;  1IN6 A;  1TT5 B;  4BQA A;  3GTO J;  4E6K G;  1OYW A;  5LRR A;  3QU6 A;  3SDB A;  2DDA A;  5IOZ A;  4BJ6 C;  5DUI A;  2LRD A;  3H3Z A;  1LEB A;  5F64 A;  2PI0 A;  1IRF A;  5J3L A;  3HE0 A;  1HXD A;  2YX7 A;  4ZYD A;  1UCR A;  1TW2 A;  1YTY A;  2CO5 A;  4PCQ A;  4CH7 A;  2WUI A;  2G7G A;  1IRX A;  5AQC A;  3MD2 A;  2HI3 A;  3W6V A;  3S2D J;  2F4O B;  4UXN A;  5DUK A;  3CJR B;  5F6F A;  3L2V A;  1J9I A;  3MZH A;  1U78 A;  1YS7 A;  2G7L A;  2M3A A;  2HYF A;  1SEU A;  2KZV A;  3BQY A;  1F5T A;  1HST A;  4XBF A;  2YS9 A;  1X1A A;  2IP2 A;  2KMU A;  4GFK A;  3HOT A;  3F1B A;  1R9T J;  1OCR H;  3WGG A;  3QPS A;  1P4X A;  3I71 A;  2JRT A;  4LIT A;  2VLA A;  3NNR A;  1K83 J;  5CXG A;  1UMQ A;  2BXY A;  4BJT A;  1FIP A;  4A3C J;  1FC3 A;  1MBH A;  1XDU A;  3H0D A;  4Y52 J;  2X6W A;  3A02 A;  5M5X J;  2LY9 A;  2PX9 A;  3SFZ A;  5FB2 A;  2AXT C;  2O3F A;  1HBX G;  1YO5 C;  3VYU B;  5CLS A;  3ZQL A;  3DFG A;  2IA1 A;  5L3F A;  1HQC A;  3JRC A;  1LB2 A;  1BBY A;  1W7P A;  2XGX A;  4ZJZ A;  5D6F A;  4A0X A;  2DPD A;  3TDU C;  2OA4 A;  1X4O A;  3WGI A;  2QYO A;  4E7Z A;  4NQW B;  1R22 A;  2P6S A;  4AWX B;  2QA4 I;  1GVJ A;  2KT0 A;  3BJA A;  2NVQ J;  2IVM A;  3ANP A;  3WTS C;  2PZ9 A;  5IYD J;  4E70 A;  1YI2 I;  3CCR I;  4K2E A;  1IC8 A;  2ADU A;  4BXU A;  1JTY A;  1X1C A;  2PN6 A;  2NRA C;  3OR2 C;  1ZGJ A;  3V8J A;  4BDZ A;  4RB2 C;  1V54 H;  2CGP A;  2IS2 A;  3GFL A;  3IUV A;  4GCV A;  3KZZ A;  3ELK A;  1DPR A;  4ZDL A;  3IHU A;  4YZE A;  5E17 F;  2CFX A;  2MC4 A;  1KGS A;  1S9H A;  3WG7 H;  2VPL A;  2R7U A;  3KZ9 A;  3L09 A;  1DUX C;  4IX7 A;  4RB1 A;  4BAC A;  1F43 A;  4KWA A;  3LSM A;  1SVO A;  2EV5 A;  3ZQI A;  5F1R A;  2K9Q A;  3EUH C;  1VQ7 I;  3GEU A;  1BC7 C;  5HS7 A;  2ZXH A;  1TNS A;  3OYH A;  2L9N A;  3UR3 C;  2FOW A;  3V7S A;  1OCZ H;  1R6R A;  1U9N A;  1MNE A;  4IOA F;  2WAQ N;  3ABU A;  1K6Y A;  4CCM A;  3FMR A;  2E2H J;  4KIB A;  2XDN A;  5E20 A;  2FBQ A;  1MMN A;  1VZ0 A;  5FFZ A;  4A6D A;  2I10 A;  4FE4 A;  3K1N A;  4PUS A;  5K5O A;  3ZN0 A;  3A0H C;  5F27 A;  3GFM A;  5HDK A;  1BI2 A;  1BOB A;  4XLA A;  1JUM A;  3QAH A;  1T56 A;  1B72 B;  2HPM A;  2E2I J;  4WXD A;  4M9Z A;  2PMH A;  4A0Y A;  3JTG A;  3QOP A;  1LE8 A;  5EZG A;  4PJN A;  3ZMD A;  3H9J A;  2X6X A;  4BE0 A;  2MC3 A;  3C2G A;  1ZTR A;  3K6G A;  3G71 I;  1A31 A;  1ZRE A;  1RRJ A;  4JL3 A;  3S3N A;  2JA5 J;  1TL8 A;  5JLW A;  2IA2 A;  2DK8 A;  3FMS A;  3DKW A;  2HGC A;  3E5X A;  2F2E A;  1E3H A;  1MSE C;  3F9K A;  2ZXI A;  3NWS A;  2CG4 A;  4E7S A;  4Y17 A;  4QPQ A;  1FY7 A;  1MMA A;  4XLP F;  2GA1 A;  3BZ6 A;  4J01 A;  2JPB A;  4L18 B;  2FJ1 A;  2WA0 A;  3RKQ A;  1XG1 A;  1MIJ A;  1I27 A;  1Z67 A;  2LKS A;  3O3K A;  3TW6 A;  5ICG A;  1AWC A;  3RKY A;  4BHP A;  2NNN A;  3QYB A;  1FT9 A;  2PMZ A;  1MMD A;  4IQJ A;  3VVX A;  5E3L A;  2J5P A;  2QQA A;  1WH5 A;  2ZME B;  2DU9 A;  1IJW C;  2DPU A;  2HDD A;  2Y2Z A;  2LVS A;  2DTZ A;  2O0Y A;  3K4C A;  3AG1 H;  4YIF A;  5KAF C;  4I98 B;  2Q0O A;  3FBN B;  2NVT J;  4M3F A;  1YW9 A;  5BS6 A;  4UVA A;  4KN7 X;  1ETX A;  2CQQ A;  4A5M A;  4F7Z A;  4PFP A;  1YIO A;  2W7N A;  1J0R A;  2EFQ A;  3HKZ N;  2CQ7 A;  3WE2 A;  4IRH A;  1QVT A;  3CC4 I;  3TL4 X;  5FJ8 J;  4L0Y B;  2XPU A;  2M4G A;  2Y30 A;  4HX4 A;  3F22 A;  3IRQ A;  2ICW G;  2MBF A;  5JHU A;  2KDZ A;  1FYL A;  4IHT A;  2FSW A;  1KU7 A;  3F8C A;  2EIJ H;  3K70 C;  2E1C A;  1Y6I A;  2L9S A;  4OMZ A;  3QPL A;  2OTJ I;  3OIQ A;  4MEY F;  2CW0 F;  3FXO A;  3K2A A;  3S17 J;  1E17 A;  1R4N B;  2DTR A;  5L3B A;  3MQ0 A;  3OY9 A;  2BEO A;  3QOE A;  2PMU A;  3LFK A;  2DOE A;  2JVG A;  2WGB A;  5JI6 A;  3JW4 A;  2Q8K A;  4XOR A;  1QNT A;  2MG4 A;  1R7J A;  4XN0 A;  2ZFW A;  3PUF A;  3DBL B;  3I58 A;  3RPQ A;  5M5W J;  2DFE A;  3CF5 F;  3HTH A;  5EEH A;  2UXN A;  3SFI A;  2R7Z J;  4YII A;  1O3Q A;  3WHC A;  4OIO F;  2E34 A;  2XAU A;  3GXO A;  1OCO H;  4U7B A;  5K7H A;  4AIH A;  4C3I J;  1DU6 A;  2G7S A;  4KMF A;  1LEA A;  1G2H A;  2JN6 A;  4Y33 A;  1IGN A;  1T08 B;  2LLK A;  1U3E M;  3LSG A;  5DD8 A;  3FF5 A;  4G7H F;  2LMD A;  5JLX A;  2XGC A;  1TQP A;  4B48 A;  5CW8 A;  3C7J A;  3ML6 A;  2IS4 A; 
#chains in the Genus database with same CATH homology
 1GV2 A;  3A03 A;  2H1K A;  2ZCN A;  5D1R A;  1UHS A;  2WV1 A;  3OSG A;  1B72 A;  3A01 A;  4M3E A;  2JMW A;  5F1J A;  1B8I B;  2DA5 A;  2W48 A;  3BTL A;  5IPA A;  1POG A;  3TED A;  4XRS G;  4A93 J;  2GEN A;  1H89 C;  1HDD C;  1APL C;  1Q1V A;  5E3O A;  3ZOB A;  2JA6 J;  2QWT A;  2NOG A;  4B1R A;  4UUT A;  2DMN A;  3RD3 A;  2EZH A;  2Y0S N;  3BG5 A;  1MSF C;  1Y1W J;  1I50 J;  1BL0 A;  1X2M A;  2COB A;  2ZCM A;  3BNI A;  2R5Y B;  2GBY A;  3NAU A;  1I3Q J;  1FEX A;  3RZO J;  2L9R A;  1GUU A;  1OFC X;  2X6O A;  4UUS B;  2HXO A;  3FK6 A;  3LNQ A;  3ON4 A;  3ZQC A;  1ITY A;  2JWT A;  3PPB A;  2HOA A;  2NX4 A;  4IHX A;  2EZL A;  4CYC A;  2NVX J;  2K9N A;  3NXC A;  4S0H B;  3HTA A;  3DEW A;  3BR2 A;  4M6V A;  3JRD A;  1DU0 A;  5C4J J;  5GPC A;  1VND A;  4A3E J;  1HCR A;  1UI6 A;  2ZOY A;  5EG0 B;  5C44 J;  5EFY A;  3H3V K;  1JKP C;  1T33 A;  2IEK A;  3IV5 A;  3BR6 A;  3M4O J;  1LFU P;  3ANG A;  4A69 C;  2HYT A;  1MBG A;  3JRH A;  3D1N I;  1SGM A;  2O9L A;  3JRI A;  3B81 A;  2EZI A;  1ETK A;  1RET A;  5HAW A;  5M5Y J;  4BBR J;  5DTD A;  1YRN B;  2M9H A;  2XRL A;  4NN1 A;  3MVP A;  1JKR C;  4BKX A;  1JUS A;  4A3M J;  4A3G J;  3Q3S A;  5F0H A;  3LWJ A;  1XS9 A;  4X6A J;  1WPK A;  1MH4 A;  1IG7 A;  9ANT A;  4PXI A;  1UI5 A;  3VVZ A;  1A5J A;  1RPW A;  3S1Q J;  1D5Y A;  3GBG A;  1FJL A;  4ME9 A;  5J1R A;  1LE8 B;  2ECC A;  3QBM A;  3TP3 A;  5HOD A;  2O8K A;  3I4N J;  3S15 J;  3FRQ A;  2LD5 A;  2H8R A;  4C3J J;  3BCG A;  1JT0 A;  4ABZ A;  4AC0 A;  1I6H J;  1AHD P;  5F0C A;  3AQT A;  1W0T A;  2NP5 A;  5CXI A;  3TP0 A;  4BBS J;  3I4M J;  1W0U A;  3L1P A;  3HB9 A;  3T6N A;  2QTQ A;  1UG2 A;  1WCM J;  4DZP A;  2AO9 A;  4AUX A;  3HOW J;  4RDU A;  4HNV A;  1AKH B;  2N8G A;  3LHQ A;  2VKE A;  4DYQ A;  3BT9 A;  5K7F A;  5IP7 J;  1U8B A;  3RQI A;  1Z77 A;  1JJ8 C;  3BG3 A;  4MFD A;  2LFB A;  2PMZ N;  3VPR A;  3JRA A;  2GLO A;  3GTK J;  2M0C A;  1AU7 A;  1RR7 A;  3VW2 A;  5EEA A;  1NTC A;  2XPW A;  5IOY A;  1VFC A;  2ZOZ A;  5IP9 J;  2AHQ A;  5E3N A;  4GFB A;  5FLV A;  1FIA A;  3BTJ A;  3JR9 A;  3OIO A;  3JRB A;  2OI8 A;  2X48 A;  5EYR A;  1WH7 A;  1B8I A;  4UDS A;  1TWF J;  3G7R A;  4D7N A;  2UXO A;  3HGY A;  4DZJ A;  2UXP A;  3GTL J;  3BHQ A;  1QVU A;  5F04 A;  1ZR4 A;  3S14 J;  2TRT A;  4D7M A;  2LTP A;  1QPI A;  3UKG A;  3EGQ A;  2B63 J;  2NS8 A;  4JX4 A;  4GCT A;  4DYC A;  3KKD A;  2M8G X;  3BR0 A;  3LSR A;  2R92 J;  2M2E A;  2R5Y A;  3V6G A;  1FTZ A;  3G1L A;  1MBF A;  1RES A;  2CJJ A;  1JUP A;  2NP3 A;  3KKC A;  4IHY A;  5FKO A;  2YUS A;  4UUS A;  1NK3 P;  2XB0 X;  2EBI A;  2WB1 N;  4QSH A;  1ORK A;  3QKX A;  4ACI A;  2L7Z A;  1ENH A;  2HOT A;  2CRG A;  3P9T A;  2CUE A;  2DG7 A;  1IDY A;  1VF9 A;  2G3B A;  2EH3 A;  3VOK A;  2DMU A;  3S2H J;  3NPI A;  2L0K A;  2MSY A;  3LJL A;  2QF7 A;  4XID A;  1TWG J;  5D18 A;  1RKW A;  2TCT A;  2QCO A;  2YU9 J;  2OPT A;  2YVE A;  4XRM A;  3COL A;  2DJN A;  5EG0 A;  2E19 A;  1Y1V J;  1BA5 A;  4RBO A;  1MBE A;  1TC3 C;  4XRS A;  4EEF G;  2FQ4 A;  4JP0 A;  1OJL A;  3JSJ A;  1P7J A;  3C2B A;  3GTJ J;  2RHA A;  4HKU A;  3S16 J;  3CDL A;  3BR3 A;  4XIC A;  2REK A;  1OCP A;  4W1U A;  4I76 A;  2ECB A;  3FIS A;  2IU5 A;  2OER A;  3NI7 A;  4MIM A;  3HOY J;  1IRZ A;  4FIS A;  3BRU A;  4GFL A;  3BR1 A;  1VI0 A;  1MBJ A;  5FKM A;  4V2F A;  1IDZ A;  2Y9Y A;  3SDG A;  2G0E A;  3OOU A;  4G12 A;  2R5Z B;  4I6Z A;  3S1M J;  5H9T A;  3S1N J;  1HDP A;  4IEJ A;  2D6Y A;  3MKL A;  2O7O A;  3A01 B;  3DCF A;  3HGG A;  3RH2 A;  3CQZ J;  2DA4 A;  3GTQ J;  3GTO J;  2L7M P;  2LP0 A;  2M34 A;  3HM5 A;  1NK2 P;  3CRJ A;  4FE7 A;  1XC5 A;  3LSP A;  1TWC J;  2Q24 A;  3KNW A;  4MFE A;  5IOZ A;  1ETO A;  5F08 A;  1ETY A;  2YVH A;  5FKK A;  2Y9Z A;  1HF0 A;  2NVY J;  5J3L A;  3HE0 A;  2VUM J;  5FMP A;  1O4X A;  1MH3 A;  4A3I J;  1GVD A;  3WHB A;  3Q0V A;  1AKH A;  1BW5 A;  2XB5 A;  2WUI A;  3BQZ A;  3JRF A;  2G7G A;  5IYB J;  3CMY A;  4FTH A;  5AQC A;  3VOX A;  3S2D J;  2HI3 A;  3W6V A;  5EZH A;  2V57 A;  3G1M A;  2G7L A;  1U78 A;  3FIW A;  2JA8 J;  3VW0 A;  4L62 A;  5J1Y A;  2OF7 A;  3PO2 J;  3BQY A;  1LFB A;  2L7F P;  2YS9 A;  3IH2 A;  5D19 A;  4GFK A;  3F1B A;  4JX6 A;  4DW6 A;  1IUF A;  1ZGW A;  2DA2 A;  1HOM A;  1R9T J;  3PAS A;  3OSF A;  1F36 A;  3BG9 A;  2IAI A;  3QPS A;  3ZQG A;  4W97 A;  3GTP J;  4CGR A;  3LOC A;  3NNR A;  1K83 J;  3LSJ A;  5CXG A;  1UMQ A;  4Y7N J;  5IP6 A;  5EGO B;  3O60 A;  4AC6 A;  1FIP A;  1BW6 A;  4A3C J;  1MBH A;  4Y52 J;  5M5X J;  3A02 A;  5FGL A;  3E7L A;  3CCY A;  4FCY A;  3Q0W A;  2LY9 A;  3HBL A;  5J1U A;  3H0G J;  3TW7 A;  2PBX A;  1ZKG A;  2DN0 A;  5FHP A;  2JK3 A;  2LKX A;  1HLV A;  3ZQL A;  3FK7 A;  4QTR A;  2FX0 A;  1JTX A;  5C3E J;  3O8G A;  3JRC A;  2JA7 J;  3HIM A;  1IV6 A;  2W53 A;  3MNL A;  2CU7 A;  2HYJ A;  1RKT A;  1H8A C;  3ZQF A;  5F0F A;  2KT0 A;  2NVQ J;  3GTG J;  3VP5 A;  3ANP A;  2DG8 A;  2PZ9 A;  3JRE A;  5IYD J;  1IC8 A;  3HEF A;  3MN2 A;  2ME0 A;  1JKQ C;  1JTY A;  2UXU A;  3E7Q A;  1PUF B;  5FKN A;  4IHW A;  2UXI A;  1S7E A;  1FTT A;  1H88 C;  3O8H A;  3IUV A;  2XSD C;  5IYC J;  1ZR2 A;  2K9S A;  2RAS A;  1X58 A;  4C3H J;  2D5V A;  4BXX J;  3GZI A;  1TWH J;  2K40 A;  2X9D A;  4MK6 A;  3NAR A;  2DA1 A;  4YZE A;  3IH4 A;  3F0C A;  1GV5 A;  3KZ9 A;  2LR8 A;  3ON2 A;  3AQS A;  1F43 A;  4KWA A;  4AYB N;  2UXH A;  3ZQI A;  2R5Z A;  2K9Q A;  3GEU A;  2ID3 A;  3JRG A;  3BR5 A;  1ZQ3 P;  5DAJ A;  5GPA A;  2P81 A;  3RZD J;  4LOC A;  4JKZ A;  2IBD A;  4GCK A;  2DA3 A;  1U9N A;  3BJB A;  2R0Q C;  3BTI A;  3S5R A;  2WAQ N;  2XGD A;  2E2H J;  2XDN A;  1OCT C;  2FBQ A;  4A3F J;  1YRN A;  2O7T A;  3C07 A;  2VI6 A;  2Y31 A;  3GTM J;  3B6A A;  4MXM A;  2R93 J;  4JX5 A;  2I10 A;  4GCL A;  4FE4 A;  5HSZ A;  4M3G A;  1SFO J;  2XGE A;  1JT6 A;  3IH3 A;  5F27 A;  2GUH A;  1X2N A;  2QKO A;  1JUM A;  1GDT A;  1T56 A;  1B72 B;  2E2I J;  1CQT A;  1E3O C;  1P7I A;  3QQA A;  4X1E A;  1LE8 A;  5EZG A;  3SJM A;  4BY1 J;  4ICH A;  1GT0 C;  4MLO A;  3DPJ A;  1ZTR A;  2CUF A;  3PM1 A;  4J19 A;  2DA7 A;  3CWR A;  4JL3 A;  2JA5 J;  5JLW A;  1MBK A;  2CQX A;  3FKI J;  2EQR A;  1MSE C;  3HOV J;  3Q0U A;  3HDD A;  1JJ6 C;  4A3B J;  2NS7 A;  4B3A A;  1JKO C;  2E2J J;  5HBU A;  3B6C A;  3NRG A;  5C4Y A;  4JYK A;  2FJ1 A;  1WI3 A;  5EDN A;  1MNM C;  5M3F J;  2HQ5 A;  3RKQ A;  1XG1 A;  5EF6 A;  3TW6 A;  4BY7 J;  3M3Y J;  4DYR A;  4V2G A;  2ME6 A;  3VVY A;  4CYC B;  2ELK A;  3HOZ J;  2DMT A;  3VVX A;  5E3L A;  1QRY A;  1WH5 A;  5EGO A;  2HDD A;  1IJW C;  2DA6 A;  1U9O A;  3HOX J;  3G56 A;  2Y2Z A;  4M3B A;  2LVS A;  2DTZ A;  2HKU A;  4L5E A;  2NVT J;  1ZK8 A;  4M3F A;  1SAN A;  1JGG A;  1ETW A;  4MO7 A;  2VKV A;  3HOU J;  1ETX A;  2CQQ A;  3S1R J;  1BJZ A;  1ETQ A;  3EUP A;  3HKZ N;  4M3D A;  5FKL A;  2MW8 A;  1Z0X A;  3ZQH A;  3VUQ A;  1QVT A;  5K58 A;  5FJ8 J;  2XPU A;  2ZB9 A;  2Y30 A;  2KDZ A;  2DMP A;  4A3L J;  2QIB A;  1ETV A;  2DMQ A;  3VIB A;  2VPR A;  5GP9 A;  2F07 A;  4NEL A;  1A6I A;  1TWA J;  4D5C A;  3QPL A;  1PUF A;  5K7Z A;  3G1O A;  4A3J J;  2ZCX A;  5E3M A;  3S17 J;  3K2A A;  3HTJ A;  3VW1 A;  3K7A J;  4A3D J;  2WGB A;  2LK2 A;  2E1O A;  4NDL A;  2MG4 A;  4A3K J;  5DS9 A;  2XPV A;  5M3M J;  2EZK A;  5M5W J;  4QIW N;  3CJD A;  2FD5 A;  2GM4 A;  3HTH A;  3SFI A;  2R7Z J;  4AF5 A;  5BNG A;  4D5F A;  2JJ7 A;  3WHC A;  5FLM J;  2RAE A;  3HTI A;  4IHV A;  2GFN A;  5C4X J;  5K7H A;  2MGQ A;  2HOS A;  3V78 A;  4C3I J;  1DU6 A;  2G7S A;  4JNN A;  2HXI A;  1G2H A;  2JN6 A;  4XK4 A;  1IGN A;  2LLK A;  3LSG A;  1EF4 A;  3BTC A;  1K61 A;  2QOP A;  5JLX A;  2ID6 A;  2XGC A;  5CW8 A;  4C2M J;  3PO3 J;  1WGX A;  4B4C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...