3IH3A

Tm1030 crystallized at 310k
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
202
structure length
202
Chain Sequence
GHMLSKRDAILKAAVEVFGKKGYDRATTDEIAEKAGVAKGLIFHYFKNKEELYYQAYMSVTEKLQKEFENFLMKNRNRDIFDFMERWIEKKLEYSASHPEEADFLITLVSVDEGLRKRILLDLEKSQRVFFDFVREKLKDLDLAEDVTEEIALKFLMWFFSGFEEVYLRTYQGKPELLKRDMNTLVEEVKVMLRILKKGMTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 'Hot' macromolecular crystals.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transcription regulator
molecule keywords Transcriptional regulator, TetR family
total genus 70
structure length 202
sequence length 202
ec nomenclature
pdb deposition date 2009-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3ih3A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3ih3A02
4YZEA 1ETVA 1ORKA 2EH3A 3S1QJ 1B72B 1ETQA 2GFNA 2OERA 2CUFA 1U78A 1X58A 3JRCA 3NXCA 4DW6A 1HDPA 5C4YA 3Q3SA 1MBJA 5F0CA 2RAEA 1B72A 4A3EJ 2NOGA 4JNNA 1JJ8C 4BBSJ 1JKPC 5IYDJ 1MH4A 5K7ZA 2X48A 3BTCA 3JRGA 4PXIA 2OI8A 4XRSA 2GM4A 2JA5J 1BJZA 3KKCA 3Q0VA 2ME6A 3G56A 2ELKA 5D19A 3C2BA 5FGLA 2MW8A 3ZQHA 1U9OA 4RBOA 1GVDA 2OPTA 1RKWA 1OCTC 3S17J 2DG7A 1U8BA 3EUPA 5EZHA 2I10A 2XRLA 4G12A 2KDZA 1MBKA 2E2JJ 3BR3A 3NI7A 4JX6A 2H1KA 2TCTA 2LK2A 1IGNA 5FHPA 1ETWA 3V6GA 4M3FA 4DZJA 2QOPA 3ANPA 1JT6A 2UXHA 2LR8A 2LD5A 4UUTA 2JA6J 4C2MJ 1ETYA 3RZDJ 1ETXA 5E3OA 1Q1VA 1JKOC 1WH7A 5GP9A 2O7TA 2P81A 3BR6A 4KWAA 4XK4A 2UXUA 2YVEA 1WGXA 2DN0A 3CQZJ 5FMPA 1AKHB 3QQAA 5EG0A 2XB0X 2G7SA 1LE8A 1GDTA 3G1MA 2ZB9A 3JR9A 3SDGA 4AC0A 4MFEA 4J19A 5CXGA 3ZQIA 2VKVA 3A02A 1JUSA 4Y7NJ 1TC3C 1IC8A 3C07A 3HGGA 3ZQFA 4V2GA 4FE4A 1GV5A 2L0KA 2M2EA 3CWRA 4MXMA 3M4OJ 3ZOBA 4RDUA 3NRGA 4XIDA 1X2MA 3ZQGA 1VNDA 2R92J 1A5JA 2MSYA 2E1OA 3L1PA 2KT0A 2JN6A 2LKXA 3G7RA 4IEJA 3JRBA 5E3LA 4FTHA 4CYCB 2UXOA 3COLA 3S5RA 1RESA 1ITYA 2ID3A 1NK3P 2LY9A 3HDDA 3JRIA 2NVYJ 2EZHA 3KKDA 4ICHA 2IU5A 2WV1A 1IJWC 3BG5A 2CQXA 4CYCA 1ZK8A 4ABZA 3LSRA 2DMQA 5AQCA 2QKOA 5IOYA 3CMYA 1CQTA 2H8RA 2JA7J 4BBRJ 4B4CA 4A3JJ 1HLVA 1HDDC 2HYJA 2JK3A 1H8AC 1GT0C 4FE7A 1MSFC 1Y1WJ 3HOYJ 1MH3A 2HDDA 2CJJA 3VOXA 5M5YJ 5M5WJ 5K7HA 4IHVA 3HTAA 1POGA 1IUFA 4W97A 1JJ6C 1ENHA 1K83J 2DA4A 3LSGA 3GTMJ 4C3HJ 2NX4A 3GTPJ 3G1LA 1P7JA 2W48A 4IHWA 3IH3A 1X2NA 4M3EA 1MNMC 3IH4A 1A6IA 2JMWA 1DU6A 3E7LA 1U9NA 2XPVA 3I4NJ 1WI3A 4GCLA 3F1BA 2K40A 2F07A 1I50J 1UG2A 4ACIA 2QF7A 2DA5A 5DAJA 3SJMA 5IP6A 2HOTA 1W0TA 3JRHA 3S1RJ 3VVZA 2COBA 1VI0A 3CDLA 2XSDC 3LJLA 1TWGJ 5EEAA 2VPRA 4D7NA 3HKZN 3DCFA 3OSGA 1D5YA 3LOCA 3HOUJ 3B81A 3BG3A 1JGGA 2ZOYA 4C3JJ 1RR7A 1H89C 5HAWA 1R9TJ 1ZR4A 3KZ9A 3HEFA 3VW2A 2E19A 3S2HJ 3HOZJ 2ECBA 3VW1A 3Q0UA 4BKXA 5C4JJ 2WAQN 4X6AJ 2WUIA 3QPLA 3TP0A 3MKLA 5FKMA 2R5ZA 2PZ9A 3HE0A 2LP0A 2DA3A 2DJNA 1HCRA 2JWTA 3NARA 1UI6A 1TWAJ 4QTRA 2DA7A 3HOVJ 2XB5A 4JKZA 1OFCX 2XPUA 5CW8A 1F36A 5FLMJ 3BJBA 2HXIA 2LLKA 1GUUA 3BR1A 1VFCA 3RD3A 4D7MA 1F43A 3LHQA 2YUSA 1W0UA 4A3FJ 5FLVA 2D5VA 3HIMA 5K58A 4M3BA 5E3NA 2GBYA 3ON4A 1XC5A 4EEFG 5HSZA 2R7ZJ 2QWTA 4IHXA 2NS7A 3QPSA 4B1RA 5EDNA 1UHSA 4XICA 1FJLA 5J1UA 2HOSA 3GTGJ 5EGOB 2L7FP 1YRNB 2ZCMA 4GFKA 1MBHA 4X1EA 3Q0WA 4DZPA 1IG7A 3BRUA 4ME9A 2O7OA 3TEDA 3O8HA 2GENA 3BR2A 5FKLA 4W1UA 4JP0A 5BNGA 2V57A 3HB9A 4JX5A 2W53A 3BTLA 4A3IJ 2CU7A 2TRTA 3B6AA 2AO9A 3D1NI 4AUXA 3PM1A 4GFLA 2CQQA 2NP5A 5EG0B 3LSJA 1QVUA 3CCYA 3VUQA 2G7GA 1TWHJ 3FRQA 1Y1VJ 3HM5A 2DMPA 3HOWJ 2NVTJ 4A3MJ 3VOKA 2XGEA 5D18A 1FIPA 4MO7A 4DYQA 4AC6A 1O4XA 5M3MJ 3DPJA 3S2DJ 4JX4A 3BTJA 3K2AA 1JKRC 2NVXJ 4A93J 1OCPA 4NN1A 1OJLA 2DMUA 3B6CA 4HKUA 3NAUA 2NP3A 2VI6A 3H0GJ 2QIBA 3V78A 4QSHA 4NELA 1APLC 4MK6A 1GV2A 1JKQC 9ANTA 3BT9A 5DTDA 1BL0A 3MN2A 3DEWA 1I3QJ 3HBLA 3GTJJ 3RZOJ 2HYTA 2Y30A 3VP5A 3PO3J 4XRMA 2K9SA 1BW6A 2Y0SN 3BR5A 4M3DA 1RETA 4A69C 3JRAA 4A3KJ 3RKQA 3WHCA 2ZCNA 3GTOJ 2FX0A 2L7ZA 3JRFA 2FD5A 4JL3A 1K61A 3OSFA 1WPKA 2MG4A 1NK2P 4C3IJ 1IDYA 5IP9J 2K9NA 4GFBA 4M6VA 4B3AA 1FTTA 5HODA 3E7QA 2YU9J 2RHAA 2G7LA 2HXOA 3JRDA 2EZLA 2B63J 5GPAA 4Y52J 2DA2A 3BQZA 1HF0A 2Q24A 2VUMJ 2WB1N 4AF5A 2DMNA 2ECCA 1BA5A 3K7AJ 3VPRA 1B8IA 1G2HA 2IAIA 3MVPA 1MBGA 1RPWA 5J3LA 3RH2A 4S0HB 1PUFA 2FJ1A 2Y9YA 3P9TA 2EQRA 2GUHA 5F0HA 1JUPA 1VF9A 5IP7J 4IHYA 5EF6A 2E2HJ 1DU0A 2HI3A 3RQIA 3IH2A 3NNRA 1YRNA 2R5YA 5K7FA 1IDZA 1I6HJ 1QVTA 3FK7A 3W6VA 3HGYA 2EZIA 3BG9A 1AU7A 5M5XJ 1JTXA 4BY1J 2WGBA 4FISA 3PPBA 1ZGWA 1WCMJ 2L9RA 3LWJA 3HTIA 1H88C 3M3YJ 1NTCA 3S1NJ 2DG8A 1AHDP 2R5YB 5JLWA 3HOXJ 3FKIJ 3LSPA 1JUMA 4A3GJ 1UMQA 2G0EA 3A03A 4DYCA 2JA8J 3SFIA 1FIAA 2O9LA 2YVHA 2ID6A 3EGQA 3GEUA 4FCYA 3NPIA 2L7MP 2N8GA 2PMZN 2XGCA 5FKNA 3QBMA 3VVYA 2XPWA 2GLOA 3BQYA 5D1RA 1ETKA 3A01B 3BCGA 2E2IJ 3BNIA 2DA1A 3FISA 2ZOZA 3CJDA 5FKKA 4V2FA 2FQ4A 4XRSG 1MBEA 3BTIA 1JT0A 3S15J 3VW0A 2LTPA 3T6NA 2HKUA 2Y31A 3AQSA 2DTZA 4M3GA 5F0FA 1LFBA 3O60A 2HQ5A 1FEXA 1QRYA 2G3BA 5JLXA 5FJ8J 3PASA 1UI5A 5EGOA 2Y9ZA 3LNQA 1QPIA 3TP3A 1IV6A 2NVQJ 2AHQA 5F1JA 1E3OC 2OF7A 5GPCA 3QKXA 1ZTRA 1S7EA 2RASA 2M9HA 4LOCA 4A3BJ 1FTZA 2R93J 4MLOA 2JJ7A 4MIMA 4D5CA 3GTLJ 1WH5A 2CRGA 5J1RA 2DMTA 3FIWA 2QCOA 5M3FJ 4UDSA 1LE8B 4A3CJ 5C3EJ 1Z0XA 2EBIA 5F08A 1SGMA 2FBQA 2R0QC 2PBXA 2CUEA 4BY7J 4I6ZA 5H9TA 4L62A 4HNVA 5IYCJ 3JREA 3H3VK 4I76A 4BXXJ 5C44J 3AQTA 3O8GA 1Z77A 3OOUA 4QIWN 3GTQJ 3VIBA 3UKGA 1SFOJ 4MFDA 3ZQCA 4GCKA 2X9DA 2YS9A 3TW6A 4L5EA 4NDLA 1ETOA 3I4MJ 2XGDA 5DS9A 1IRZA 3G1OA 1MBFA 3S14J 2Y2ZA 5F27A 4JYKA 3IV5A 2IBDA 1MSEC 5EYRA 5IOZA 3CRJA 1RKTA 4D5FA 2REKA 3GBGA 5EFYA 3ON2A 1XG1A 4DYRA 3WHBA 1T33A 3BR0A 3HTHA 1BW5A 2R5ZB 3MNLA 1JTYA 5J1YA 2UXPA 2D6YA 5C4XJ 2ZCXA 1TWFJ 1AKHA 1ZQ3P 3KNWA 5F04A 4A3LJ 2K9QA 3A01A 2XDNA 2VKEA 3HTJA 2O8KA 2EZKA 1HOMA 3JSJA 5E3MA 3GZIA 2DA6A 2QTQA 1TWCJ 2HOAA 1ZKGA 3F0CA 1XS9A 1B8IB 3S1MJ 2X6OA 4UUSB 1EF4A 4GCTA 1PUFB 5FKOA 3VVXA 4CGRA 3TW7A 1SANA 3IUVA 2M8GX 3OIOA 2M0CA 2MGQA 3FK6A 4UUSA 3ANGA 2LFBA 5CXIA 1ZR2A 3GTKJ 5EZGA 4A3DJ 3BHQA 5IYBJ 1LFUP 3ZQLA 2ME0A 2IEKA 2LVSA 5IPAA 5HBUA 2NS8A 2M34A 1T56A 3S16J 3PO2J 1P7IA 4AYBN 2UXIA
chains in the Genus database with same CATH superfamily
4BQAA 3ABUA 1B72B 4KUMA 3WGIA 2OERA 3J80Z 1QNTA 1R23A 1X58A 2V9KA 3VFZA 2PQ8A 2Z33A 5C4YA 2FXAA 3Q3SA 2VJIA 1CF7A 2K9LA 2WA0A 1IRFA 4XOPA 4Y33A 3TO7A 4IPAA 2FQ3A 4HG2A 4BXFA 4Y4RA 4BE2A 2CG4A 2KKOA 1S7OA 4FETA 2LG4A 1S72I 3Q0VA 3LAJA 5J47A 3BDDA 3PL8A 4OINF 3NS4A 3IC7A 1BN5A 2ZXWH 4LK1F 3E6MA 1U9OA 1RKWA 2DG7A 2HKOA 3NI7A 3BR3A 4Y3OA 3AG2H 2X1CA 4HX4A 3H5RA 4RLFA 2R7SA 1T8IA 4DZJA 4LITA 1VQ4I 2CUJA 3HTUA 4P55A 2DDBA 4C2MJ 4HSRA 1SMTA 2VQHA 2DYRH 4E7JA 1WH7A 2PEXA 1DUXC 2O7TA 4XK4A 3WTXC 2DN0A 2RN7A 4FHTA 2XAFA 3H9GA 4M72A 3F21A 4CO8A 2XB0X 3SFZA 1O3QA 1D0XA 3G1MA 3CC7I 3BJ6A 5HS8A 2WBMA 1MMNA 1I5ZA 2F5VA 2IW5A 2VKVA 4CZZA 1SAUA 4F91B 1TC3C 1R00A 1H0MA 3DKYA 5B1AH 1Z9CA 1GV5A 3CWRA 2M2EA 1XSDA 4MXMA 4RDUA 2W4SA 3T8RA 4XIDA 1X2MA 2L9VA 1VNDA 5H6QA 3CLOA 3ZQGA 3IKTA 1X3UA 3SZTA 2MSYA 4OD5A 1V5GA 3OY9A 3TL4X 4MEXF 3K4KA 1ZRFA 3DWLE 3JRBA 2QA4I 4CYCB 2BYVE 3BG6A 2ZSIB 1KQ0A 2LY9A 4D9JA 4LMYA 2M3AA 2IU5A 2WV1A 2K27A 2DU9A 4P9FA 5HOOA 4CYCA 2CQXA 1W5CC 1D0ZA 2XKPA 3LSRA 1D5VA 2QKOA 2DFFA 3L00A 4BHPA 2CMPA 2A05A 2X6WA 4XKWA 2HQAA 2JPBA 4B4CA 1HLVA 2HYJA 3GFIA 3FDYA 1O57A 2GQQA 2JK3A 4JK1X 1H8AC 1MSFC 3REOA 4Z2YA 1UHWA 4OIRF 1Y39A 2V26A 3V8KA 1IV8A 2W00A 3CC4I 4ANJA 3L2RA 5M5WJ 4HQMA 2H8WA 3HTAA 4U9NA 2XC7A 4W97A 4KITB 5GAEJ 1K83J 4KT5C 2OUMA 3GTPJ 1PUEE 1P7JA 4M71A 2W48A 2HZTA 5DCMA 1MNMC 1BBYA 3IH4A 3P7NA 1YX3A 2JMWA 5LHIA 1LQ1A 3SHFA 3HZJA 2XPVA 1LVAA 3I4NJ 2LKPA 3PNTA 1WZ2A 4GCLA 1FYKA 2WY7Q 3F1BA 1I50J 5LGTA 2MFZA 5DAJA 2W85A 5IP6A 3A4CA 1ZLJA 3VVZA 1TWGJ 3TO9A 4BHBA 1R71A 3SWHA 4C3JJ 3KZ9A 3K70C 3VW2A 1MNDA 2E19A 2JRMA 1R22A 2BOLA 3S2HJ 3HIFA 4WXDA 5CPRB 2WUIA 2YX4A 4C9YA 1XN7A 4IQJA 2PZ9A 2H09A 2XUBA 4ZH4F 3NARA 5JHFA 3V7CA 2XB5A 4JKZA 1UG0A 4LG0B 3KP2A 4HOBA 3BR1A 4EM2A 1VFCA 1E0EA 3LHQA 3F6OA 1SAXA 5FLVA 3RKXA 1WSUA 4ENMA 2OQRA 3JW4A 4E7IA 1XC5A 2R7ZJ 2QWTA 1L0OC 2O3FA 2NS7A 2WB1A 5EDNA 1UHSA 4XSXF 5L3FA 4RB1A 3FBIB 1J75A 1G3TA 2HOSA 5EGOB 2VT2A 1W4MA 4K2EA 2ZCMA 4RLQA 3Q0WA 2CSOA 2DOEA 2M45A 3TEDA 1OYWA 1NH3A 2EA4A 3N05A 2E71A 5FKLA 2P0WA 2BHZA 3IAS2 5BNGA 1OPCA 3HB9A 1XPXA 1X3ZB 5DEQA 5FRNA 4G6TB 4AUXA 2M0MA 1JXSA 2B9SA 2CQQA 1NG7A 2Z99A 3L09A 1BI1A 2YU3A 1SD4A 3FRQA 2WADA 3RI4A 3VOKA 1TNSA 2MC4A 2KL4A 1H9TA 3KE2A 4PJ0C 2EINH 1T38A 3QOEA 4AC6A 1RNLA 4AIJA 5AIQA 4XN0A 5IT9Z 5AONA 4JX4A 3KYCB 3D5LA 3I71A 2NVXJ 2R3SA 1J7KA 2BGCA 3K4LA 4EJUA 5BMZA 1OJLA 5GTIC 1R1UA 1R4MB 2PBIA 4CDGA 3VSKA 4QSHA 5D5WB 3VYSB 1W7PA 4O6JA 2W1OA 4FQGA 2H27A 2IS6A 1I3QJ 5TGTA 1HKTA 1ZG3A 3HBLA 2Y48A 5E20A 3IUOA 2XKOA 2Y30A 3ESWB 2K9SA 1R5HA 3QOPA 3G6EI 1RETA 3JRAA 3RKQA 5FLXZ 4N4OB 2CUZA 3E5UA 2AXTC 4HBLA 3KZYA 3E6CC 2A6TA 2P8TA 3OSFA 5CLSA 4IO9F 2CQKA 2BXYA 4N9HA 4GFBA 3GO5A 3OOPA 2KISA 4B3AA 3J7ZI 3GVAA 5HODA 3E7QA 2YU9J 2GA2A 3PUFA 2EZLA 2B63J 3GWZA 3BQZA 3QU3A 3WGGA 1ZELA 2DPUA 3CCEI 2WB1N 2ECCA 2DDAA 3VPRA 2KZGA 3FHZA 3CCVI 3MVPA 1HW1A 2NAZA 4FT8A 4LJZF 4NQWB 1PUFA 5ICCA 4OMYA 1IXCA 2EQRA 3NQOA 4BACA 1JUPA 2ELHA 4XLPF 1XDUA 4DIQA 1B9MA 5EF6A 3NEUA 2IVMA 3H3ZA 3LSIA 5K7FA 2QSFX 2R5YA 2KQRA 1YRNA 1HQCA 2DLLA 2F48A 1I3AA 3CF5F 2EZIA 3BG9A 5FGMA 2WGBA 4FISA 2OCEA 3ZMTA 2CFOA 4NC6A 1IW7F 2R7FA 3C7JA 3SDBA 2XAJA 1KU7A 3I0TA 3LSPA 1OQYA 2ZCWA 4JBAA 2L02A 4DYCA 2JA8J 3SFIA 1BOAA 3GEUA 1SC7A 5JHUA 3CP8A 2ESHA 5JR3A 3J7AY 2XPWA 1X1PA 2R7WA 1BC8C 1OYYA 2QLZA 2E2IJ 3BNIA 2DA1A 2MYSA 1VQOI 1LJ9A 2MLKA 4PGHA 4LG3A 5FKKA 2LBFB 1FOWA 3LA2A 1C0WA 3VW0A 4BE1A 4B48A 2EIMH 3LQRA 3I54A 3KP3A 3AQSA 2DTZA 3K6GA 4LGWA 5F0FA 3ZXSA 3DEUA 1O3RA 4MQVA 1QRYA 1UELB 1WVRA 6PAXA 1GLNA 2BW3A 2Z1DA 2JT1A 1UI5A 2Y9ZA 1HKSA 3JSPA 2C6YA 1MJAA 4U7BA 2FEZA 2EJRA 1ZTRA 1S7EA 2M9HA 3RQ4A 4BHCA 2E1NA 4ZTFA 4BAYA 2FF4A 3GTLJ 2L2OA 2NOJB 2X1EA 1OCRH 5KAFC 3JAMZ 5C3EJ 4J01A 2PMHA 5F08A 2ZJRF 1FWZA 1I1SA 2DTRA 1DGRM 4G94A 1VQ8I 5H9TA 1MW7A 2G9WA 4HNVA 2UXHA 3BCBA 4ESFA 3PQJA 1YO5C 2OQGA 1UCRA 4G6DA 4I76A 3K8PC 3AQTA 3O8GA 2BE5F 2JA2A 1XB4A 4PFOA 4RAFA 1WHUA 2AXLA 4I0AA 1SFOJ 1MDMA 3ZQCA 4OOIA 2CGPA 3FXRA 1G3YA 3U9GA 2VXZA 4L5EA 5DD8A 4G8XA 1ETOA 4ZYEA 2E36A 1P4WA 1U5TC 5CVUA 2ZJPF 3W2AA 5F27A 2MH9A 1V54H 2FU4A 4JYKA 5DDGA 1W36C 1ZG5A 1DPUA 1GVJA 2X6YA 4MNUA 1RKTA 4D5FA 1PVEA 2IGKA 2A69F 4BQOA 3I55I 1FPQA 1BW5A 1SFEA 2OD5A 2M5WA 4XNFA 4RB0A 3QWLA 3ZMVA 2PFVA 1WI9A 5A2QZ 2ZCXA 4II3A 3KNWA 1LVKA 2A5WA 4HF0A 1R49A 1ZREA 4IHTA 3DKXA 4EGYA 1BR4A 4YFKF 2EZKA 4XKVA 5HS9A 5E3MA 2HTSA 3VSLA 3F0CA 1B8IB 2KMUA 4UUSB 2F4OB 5DUIA 1ZAOA 4RGXA 2XF5A 3DKWA 4HLXA 3FMSA 4ITVA 5D4SA 4ETSA 2AQEA 2A6HF 2K86A 2M8GX 4MHGA 3A2KA 3P5JA 2MA3A 2M0CA 4UV9A 3DPTA 4UUSA 2EB7A 3ANGA 1JHHA 1B59A 3SZGA 3WTTC 4OAYA 3M8FA 2FBIA 2NS0A 1X1AA 5KK1A 1OISA 2IEKA 2ME0A 2LVSA 3V8JA 5IPAA 4ENKA 3ZQQA 2M34A 5FLXK 1FP2A 2HTJA 2FMLA 3EUHA 3IHUA 3F72A 3Q9VA 3RSNA 3OYJA 3PO2J 4OMZA 4YZEA 4V19K 1ORKA 4GO1A 3OIPA 2M7BA 1RIOH 1X1DA 4PSWA 3HRUA 3HPGA 4RAYA 1XGSA 4PFPA 3W2VA 1U78A 5A2QK 3BC8A 3IWZA 1B1BA 3ABKH 2QZ8A 1B72A 2BY0A 4BQQA 2NOGA 4CICA 5F1RA 4A3EJ 1JJ8C 1JKPC 4BL0B 1MH4A 5IYDJ 5GAHJ 2X48A 2UV1A 1MJ9A 1R5ID 1WJDA 4BUPA 2O03A 3LMMA 3CDIA 4J00A 4PXIA 5FD5A 2PFBA 2GM4A 2GOXB 2JA5J 1P6RA 3F22A 2QM3A 2V1UA 1IXSB 2KIQA 2DFIA 2ELKA 2ZNYA 2MW8A 3K1PA 2LOOA 2IS2A 4A2UA 4LIVA 3U1DA 3S17J 3UNGC 1U8BA 2I10A 4XOTA 2XRLA 5EZHA 2XDVA 2KDZA 2LRDA 1QGPA 2TCTA 2LK2A 2ZFWA 2HDWA 1YTYA 2QOPA 5ILSA 1JT6A 4AIKA 1TP4A 2JA6J 1ETYA 1W36D 4CSWA 1JKOC 3KLOA 2ZXJA 3BR6A 4KWAA 2LSOA 1WGXA 2PMUA 3CQZJ 2YVEA 2KJCA 2IS4A 2RQQA 3E6BA 2BVMA 5EG0A 3WTWC 4O3MA 2M1BA 5HVQC 1GDTA 4UXNA 2J5PA 3CJTB 5DV5A 3SDGA 4J19A 3I5UA 3J7YJ 2ZXIA 4IJAA 2DJIA 1JUSA 3C07A 2VBZA 1IC8A 4V2GA 4FE4A 3DU5A 2L0KA 1YQAA 3ZOBA 1LFPA 5DM7F 1YOVB 4NC8A 1A6QA 2PJRB 5L3DA 1RR8C 1KQ8A 3C3WA 3BWGA 3BP8A 2KRFA 3D5RC 3HHHA 2KT0A 2OV7A 1MD0A 3FWEA 3T8TA 4HV6A 2FNPA 2UXOA 3COLA 1WJBA 2PJRA 1RESA 2ID3A 4DBRA 4E7KA 5LFAA 5D8LB 3KKDA 1OCZH 1G3WA 3SYTA 1W5SA 3C1DA 4EJOA 2FNAA 4ABZA 1HC8A 3CO6C 2JA7J 1P9QC 1UB9A 2A68F 3ERED 2ZSHB 1WJ5A 2JVHA 3GX4X 1HDDC 3TDZC 4A0XA 4AIHA 3LSTA 3FHNA 4WXCA 2GAUA 3F3XA 2H6BA 1MMDA 2QQ9A 1Y1WJ 3RPUA 3OYFA 4G7ZF 1HW2A 5E18F 1E17A 3J81Z 2MBFA 1WJFA 3K4CA 4RGRA 3CDHA 3DP7A 5K7HA 5KNLA 1POGA 4KT6A 4B09A 4ZDOA 4GRIA 3LSGA 3OV8A 3KP5A 2L9NA 4IL6C 3OYAA 4I02A 4IHWA 1T2KA 2XSJC 4M3EA 3ONQA 1K6YA 1DU6A 3D0SA 4YIIA 3TOBA 4L0YB 2XF7A 5TJJA 3H1CA 2R4GA 3LQQA 5BOXA 2PX9A 1VQ6I 4HW0A 1W7PB 5LEKA 1G3SA 2CH0A 4BEHA 3MZHA 1A04A 5CYVA 4YG2F 2COBA 4I7HA 1N77A 1ERDA 2XSDC 3GYHX 3LJLA 2HYFA 3HKZN 3DCFA 3EDPA 3EUHC 3OSGA 5KVRA 1JGGA 2EK5A 1U2WA 2ZOYA 2ZNZA 5LLQA 5HAWA 2FE3A 1ZR4A 3FBNB 1MDMB 3E3VA 2QWWA 2B0LA 1QU3A 1ONVA 1Z6TA 3Q0UA 4BKXA 1J0RA 4X6AJ 3O3KA 3QPLA 2MLGA 2JQ7A 2JPCA 4Y15A 3EYYA 2R5ZA 3BROA 4GXOA 2DJNA 2AS5F 1XDSA 2JWTA 2DW4A 2HNHA 2DA7A 4OD4A 4E6KG 1OFCX 2OZ6A 5FROA 4KIFA 1Y0NA 2XPUA 3BJBA 2HXIA 3RD3A 1GUUA 1F43A 2A07F 2L7KA 2YUSA 4WF2A 4A3FJ 2W57A 3ULQB 2GBYA 3FXJA 1G59A 4EEFG 1QZZA 3MZYA 3CESA 2KJBA 4B1RA 2XVCA 2R7TA 3GTGJ 4M9ZA 2D1HA 4GFKA 1MBHA 4X1EA 2Q2EA 4DZPA 5BPDA 4HX8A 4F55A 2GENA 4R8HA 3BR2A 1EH6A 5KAIC 4JP0A 2V57A 4BE0A 2K3PA 2M87A 2W53A 2YSRA 3BTLA 5LEJA 4MGRA 3ZMZA 3B6AA 1R4NB 1H9GA 4HRIA 1LDDA 1QVUA 2F4IA 2V6EA 2ISZA 1U0JA 4ZYHA 4Y17A 5JI6A 2IPQX 3HM5A 3HOWJ 2XASA 1D8KA 4A3MJ 2XGEA 2R7VA 4YEJA 2VASA 5E8GA 3V4GA 5J8CA 3AG4H 2CWEA 1JE8A 4DYQA 1XGNA 5L3GA 3OS0A 1O4XA 2LF8A 3HRTA 3DPUA 1WWXA 1ZHFA 1F5TA 3DPJA 2ZC2A 3BPVA 4A93J 3CCUI 1JKRC 1MIJA 4L5JA 1OCPA 4U0YA 2HPIA 1BC7C 4NN1A 1YE9A 2VKHA 4HSTA 2FBHA 1XMAA 3NAUA 2VI6A 2JTVA 4ZTJA 2DI3A 2K4JA 3K4NA 3QYEA 4MK6A 1FMWA 3ELKA 2OJED 1FMVA 4ZYDA 4HDVA 2K9MA 3WU0A 3DEWA 3CO7C 5DD4A 4FX4A 1ULYA 1XTAA 4Z6YA 3RZOJ 2IXSA 2QVOA 3GLXA 3WE2A 4UVCA 3VP5A 1FBSA 4XRMA 4A69C 4A3KJ 3BR5A 4M3DA 4ESBA 1W7PD 3WHCA 3OYEA 2F6CA 3OYLA 4U9LA 2FX0A 2FA5A 3PNVA 1JI8A 1K4TA 5KHDA 4CYDA 1WFXA 1S9HA 5BQTA 2V9PA 5DM6F 3K1MA 4D0PA 1IDYA 3FM5A 5F64A 5IP9J 4M6VA 1YHQI 2MC3A 2OC6A 2GXBA 2V6CA 2HXOA 2G7LA 5JFRA 1D0YA 5GPAA 2DA2A 3VB2A 3EUAA 2QKMB 1WRJA 2CV1A 3SXYA 3K7AJ 2E7WA 5DYMA 3CJNA 2HDCA 1G2HA 2IAIA 2VBYA 5E79C 3DLLF 1MBGA 2XHKA 2HVQA 4S0HB 1QA6A 2FJ1A 3FXMA 3L2VA 3P9TA 2X85A 3M7GA 4EVIA 1BM9A 3GEZA 1EV7A 4IHYA 4B8XA 1DU0A 1N75A 2E2HJ 3F8CA 2Z9OA 3CCLI 3RQIA 3IH2A 3OWTA 1IDZA 1QVTA 3FK7A 4BGDA 3IRQA 2F5DA 3GMEA 3MKWB 2F5CA 2BVLA 2K7LA 5JVGF 4A12A 4CHUA 3AG3H 2FRHA 3M3YJ 2DG8A 3S1NJ 2R5YB 5JLWA 3HOXJ 1TQMA 5E1WA 1UMQA 2DFHA 2GWRA 1HXDA 5J40A 1VQ9I 2O9LA 2YVHA 2Z5UA 2ID6A 2CQ7A 2VC0A 4FCYA 3OYNA 2P5VA 3C2GA 1Z7UA 2L7MP 1N25A 5FKNA 1J59A 2GLOA 3BQYA 3ZP5A 3HG9A 1YS7A 4UNOA 4OAZA 4IRGA 3H92A 3CJDA 4WWCA 4IRVA 3G2BA 2FQ4A 1DP3A 1JT0A 2LTPA 3BZKA 3HSFA 2DT6A 2Y31A 1AA7A 4M3GA 3O60A 2HQ5A 1S7AA 3CUQC 4F7ZA 2G3BA 5FJ8J 1IRXA 4PJMA 1S6LA 2VQLA 3QU6A 2NVQJ 3VDXA 1X19A 3QRFF 1N78A 4XBFA 2J5OA 4GYGA 1LKXA 1FTZA 1WQ2A 1NHAA 5LGNA 2R93J 3ZN0A 3OYGA 3MD2A 4D5CA 5J1RA 2YVXA 5IT9K 1M1EB 3PSIA 5D5VB 4A3CJ 2LF7A 4LFUA 1SD6A 1Z0XA 2IS1A 2FBQA 2PBXA 4KNYA 4BY7J 4L62A 5E17F 3JREA 3WE3A 1W1WE 5EEHA 4MQ9F 3H3VK 4EM1A 4C2MA 1KYWA 1ZARA 5C44J 4HF1A 2I8DA 3OOUA 4YIFA 3WGHA 3UR3C 3UKGA 4GGGA 3MKYB 3HHGA 4HX7A 2UWMA 1S8NA 2GXGA 5H20A 2DT7B 4IF4A 2VOPA 1SEUA 1FOKA 3ZGKA 2CO5A 1BR1A 1R6RA 5D6EA 1K6OA 5GAGJ 3WODF 2CYYA 1O3SA 2KIUA 2JSPA 2LREA 1MBFA 3W2WA 2A5YB 1DDNA 1BOBA 4AU7A 4MTEA 4G6QA 3IV5A 3I59B 3C2HA 1AOYA 1XGOA 3VYTB 5IOZA 2ZXHA 2DOFA 3PUBA 3OIQA 5D8KB 4ESJA 4UVAA 1XSXA 2KZVA 1V5FA 2FOKA 3DEEA 5LHGA 3E1SA 2EPFA 3GFLA 4DGWB 1T08B 2UXPA 2D6YA 2B3WA 2E1MB 3CLQA 2XRNA 4FASD 3ECOA 2CW7A 4YIRX 1AWCA 4ZDPA 1ZRDA 3FZVA 4A3LJ 1KGSA 1UHMA 2P6TA 3EYIA 2K9QA 2HKXA 4DBQA 3OYKA 3A01A 2F4MB 3HTJA 3N97A 2O5RA 3OYDA 3GZIA 1LNWA 3WG7H 2HOAA 1ZKGA 3DTKA 3T5XA 2LY1A 3WU2C 2K02A 4DVYP 1OR7A 1EF4A 2OA4A 3L2CA 2WAFA 2VQCA 1OLTA 3R0JA 1ZG1A 3IUVA 5ICGA 3KP6A 1IAWA 1FBQA 3WTZA 4BH9A 1LB2A 5CXIA 4DQ2A 4A0YA 1YW8A 4U0WA 5EZGA 4A3DJ 1XMKA 2CS3A 3ZR8X 1KU3A 1LFUP 2O8XA 1ON2A 1TW3A 5L3CA 3ERMA 4PJNA 4OIQF 5HBUA 3RTRA 2NS8A 1T56A 3S16J 1WJAA 3S3OA 4CXFA 1ETQA 2RQPA 1QHGA 2VQGA 4YFXF 3S8PA 4WIBA 2DAOA 3JRCA 4AYBA 5LHHA 2X6XA 3NXCA 2MABA 2V79A 4A0ZA 4DW6A 3ZN1A 3COAC 3H9JA 2STTA 4JNNA 2K3FA 3VYUB 4BBSJ 2ICWG 3HOTA 4IHSA 5K7ZA 1T95A 3BTCA 4HPQA 1VQKI 3GZ5A 3FM3A 3F8NA 2QKLB 3KKCA 1X1CA 2EFNA 4Q5SF 3G56A 2QQ8A 5D19A 3C2BA 1HA8A 5LGUA 5HLGA 2X0LA 1T0FC 5DCFA 3EUPA 4G12A 3U1KA 2E2JJ 5ILVA 5HDNA 4JX6A 2H1KA 5H2FC 1IGNA 4HF2A 2ZMEC 3ANPA 3KEOA 5D4RA 3WTYC 2BY1A 1G6NA 2A3SA 2L54A 1VZ0A 4AVPA 2ADUA 3MAJA 5E3OA 1Q1VA 2W25A 3ASOH 1T6SA 5GP9A 1QO0D 1Z91A 5IY5H 3DXJF 3VODA 2X4HA 5FFZA 2LKSA 2UXUA 5CJ9A 1R7JA 2Y0SA 1A36A 3DBHB 4YELA 1S5LC 3RYRA 1AKHB 4BU2A 2D1VA 4CUGA 1LDJA 1Y6IA 2Y69H 3QYBA 3JR9A 3VOEA 3L2QA 1LE8A 2HR3A 4A5NA 4MFEA 3A0HC 3ROUA 2DYSH 2GXAA 4NC7A 4F93B 2DPDA 3B02A 3HGGA 3ZQFA 3SZPA 4YRVA 2VKDA 5LBQA 3QAHA 2QGUA 3OS1A 3M4OJ 2X51A 4KICA 4LLLA 2F5EA 2JUCA 2R92J 4XMYA 4B47A 5J8FA 3BY6A 2RVCA 1A5JA 2E1OA 4BYYA 2JN6A 4LG0A 4EV0A 2LKXA 4G7OF 3G7RA 3OYHA 2RNGA 4FTHA 2FOWA 2DOAA 2ESNA 2WTEA 1GXPA 2ISYA 2VJ5A 4BS9A 2R7XA 3S5RA 3FF5A 4JQFA 3RDIA 1YJWI 4IZZA 3HDDA 1K7AA 4EMSA 1IO2A 1RC9A 2O61A 3ZMUA 1KONA 3KX2A 2CFXA 3I56I 4ICHA 4QPOA 4XM3A 1FY7A 5HLTA 1WKMA 3SQNA 3BG5A 1CGPA 4KIBA 1ZK8A 2EV5A 2FUG2 2Y0MA 4U88A 5AQCA 5IOYA 1CQTA 2H8RA 4UHTA 3MKZA 2Q1ZB 3DTIA 3GFJA 2XIGA 1KQ9A 2JUGA 4IQ4A 3LA3A 3ZRGA 4RS8A 1TQPA 2I5UA 4FE7A 3K2ZA 3HOYJ 2VN2A 4L0ZB 1MH3A 4PUSA 3P9IA 3R4KA 2KIMA 3N4MA 3H35A 2HDDA 2CJJA 2VT3A 5H6RA 3OYBA 3VOXA 4S05A 1ZRCA 4IHVA 1FZPB 1JJ6C 3ASNH 1ENHA 3K4JA 2VPLA 1IN6A 2LMDA 4C3HJ 4KMFA 3IH3A 1X2NA 5ERIA 3IRRA 4NQWA 2NXNB 3AFHA 3HKZA 2LYCA 3KEYA 2H6CA 2HS5A 3E7LA 1MGTA 3KP7A 3CCSI 1WI3A 3DLAA 4ZZLA 2UXXA 1UJ8A 2IGMA 4UB6C 2K40A 4LLNA 2F07A 3OR1C 4RB2C 1HBXG 3LAPA 2QF7A 3RJPA 3SJMA 4RAZA 4MTDA 1W0TA 2HVRA 4KIGA 4BNCA 2E1CA 2KRHA 4CCJA 5E1XA 3CDLA 4BDYA 3F6VA 1TT0A 2QUFA 2DBBA 1DP7P 2IRFG 2OTLI 3J7AO 3LOCA 3B81A 3MWMA 1Z21A 3ZMSA 4DOZA 1U6GA 3SEZA 4LK0F 1R9TJ 2VE8A 2VC1A 2QSHX 5FD6A 1MKMA 1VQ7I 1I27A 3GXOA 1ODDA 2ECBA 3QYFA 1PDNC 1HSTA 4LB6B 5C4JJ 3TP0A 2BXZA 3RKWA 4OWRB 2EFQA 5FKMA 4Q47A 3ABTA 2DA3A 3CP2A 1OYIA 1TWAJ 4QTRA 4P96A 1X3WB 2CW8A 3KPHA 3HUGB 2CQNA 3DBLB 1YITI 3OL4A 3I59A 2HYGD 4BJ5C 2K85A 5FLMJ 2LLKA 1K78A 5KCMA 4C2TA 1W0UA 1KU9A 5CVVA 4HV5A 2JVGA 1KA8A 4PJJA 4C2UA 4ASNA 4M3BA 5E3NA 3HIMA 5K58A 2KFDA 5HSZA 3BPXA 4U7DA 3HUGA 3H9QA 4ZDLA 4GCVA 5D6FA 1RRJA 1IN7A 5J1UA 2EFWA 1YRNB 4MEYF 3BRUA 1IG7A 2B1EA 1Z3YA 2DQRA 1TNTA 3L7WA 4W1UA 1IXRC 3BJAA 2DXIA 4XSZF 4RB3C 3AKZA 2DCEA 2TRTA 1DGWY 2AO9A 2E1MC 3D1NI 2VODA 2A2FX 4GFLA 2NP5A 1ZN2A 2Z16A 3LSJA 5TISC 3CCYA 4KYWA 2NRAC 3K4BA 2DMPA 2GIVA 2NVTJ 1E3PA 1USSA 1PP8F 2KP6A 3QODA 3KP4A 1OMIA 3PFIA 1TL8A 4L18B 3CUQB 3FXQA 3HSEA 2PI0A 2YR2A 3S2DJ 3BTJA 3CTAA 5E8IA 1U3EM 3FKJA 3GCMA 4HKUA 2NP3A 1SVMA 3WTVC 3V78A 5CVRA 4NELA 5CVJA 2VXDA 1GV2A 1STZA 1JKQC 3BZ6A 3KYLA 1L3LA 3ZCOA 2WWYA 3BT9A 9ANTA 3H5AA 3V42A 1BL0A 3MN2A 3DQVC 2EFOA 4JOMA 3X2QH 2BY2A 3GTJJ 2D2WA 2DK8A 3OMYA 5B3SH 2COMA 3PO3J 2LY2A 2ZCNA 3GTOJ 3JRFA 1BI2A 5J4VA 2H94A 2FD5A 2OZUA 2F2EA 2WAQA 3K9TA 1XD7A 4JL3A 2BZTA 1K61A 3OYIA 4C3IJ 2K9NA 2XAQA 1TLHB 4XRFA 4CH7A 1TBXA 4IKFA 1FTTA 4CCNA 3BLYA 2VJJA 4Y52J 1HF0A 1OCOH 4AF5A 2DMNA 1BA5A 3TQNA 2X1DA 1J5YA 3KYDB 3G71I 4KA4A 3O2PE 1B8IA 3K70D 1RUOA 3Q9SA 2V7FA 4ZZDA 4PK4A 3RH2A 1RPWA 5J3LA 4FX0A 4UY8I 3CC2I 4M6YA 4AD9A 4RGUA 5ICEA 1J2XA 4NHJA 5F0HA 1XX5A 3LL7A 1VF9A 3CJRB 3EUKL 5K5QA 4LIUA 1P92A 1FSEA 2CW0F 2HI3A 1YFHA 3NNRA 3IL2A 2DQLA 2IT0A 4HZFA 3RYPA 3HGYA 1UZCA 1AU7A 4BQNA 2ELJA 5M5XJ 3RPUD 4ZJZA 3PPBA 2L9RA 4O5VA 3LWJA 2CV0A 1H88C 2A6EF 3TO6A 2NYXA 3E97A 3IWFA 3FKIJ 3H3UA 1HKQA 2KIFA 4BDZA 2G0EA 3A03A 3I3LA 4CGZA 1FIAA 3K10A 1FLIA 2IA1A 4L9TA 4XLAA 4XL9A 1YS6A 4ZYAA 1SMYF 2N8GA 2PMZN 2XGCA 1T39A 3QBMA 2OAZA 3VVYA 3PNYA 4H4KC 1ZGAA 3CCJI 3HTSB 4EM0B 3A01B 3BCGA 1R36A 3M07A 1FNNA 1UFMA 1R1VA 2XAGA 3B73A 2ZOZA 4V2FA 4HDUA 3M1CA 4XRSG 1MBEA 2MH2A 2IP2A 2ZO4A 3DV8A 4G7HF 3S15J 3T6NA 1Y0UA 2HKUA 3ABMH 5GTHC 4A6DA 1BIAA 1DPRA 3PASA 4II2A 4OIOF 2W24A 3E5QA 4EJVA 2RDPA 2YPRA 3LFUA 3LA7A 3P9CA 3OR2C 4EGZA 3LNQA 1YIJI 1IV6A 5DCMB 4P9UA 5J6XA 2RGVA 2K4BA 3LWFA 1E3OC 1W5TA 1KZHA 1IN8A 1Y8RB 2JZYA 1RI7A 4LOCA 1V55H 3HYIA 3QP6A 4XR6A 4A3BJ 4MLOA 2JJ7A 1QZYA 4MIMA 3TMOA 3S32A 1E3HA 3VEPA 3PJRA 2CRGA 3MQ0A 3BJOA 3FIWA 2DMTA 2UXNA 2M30A 5M3FJ 3CMEI 4UDSA 3SEQA 3HPHA 2DODA 1LE8B 1TTYA 4CCMA 2R0QC 3V7SA 3WU1B 4D1QA 2L3DA 3QPHA 5IYCJ 2L9SA 1D8JA 2XAUA 1EH7A 4IXAA 3JTGA 4BXXJ 1QPMA 3FMQA 3O6BB 5E1ZB 4BXUA 4MFDA 2BV6A 4GCKA 2FSWA 2X9DA 2G7HA 4XLCA 3T0YA 3ABLH 3TW6A 5B66C 2E7XA 4HAMA 4B43A 5HS7A 4EJTA 3DF8A 2XGDA 1IRZA 4NBQA 4OU0A 3S14J 2Y2ZA 2RNJA 2KHMA 5HNHA 3LSHA 5LRRA 3R0AA 2IBDA 5K1YA 2KDOA 3KFWX 3TGNA 1GHCA 5EYRA 3CRJA 2REKA 3GBGA 5EFYA 3ON2A 4HQEA 4DYRA 4PDKA 3WHBA 4WCGA 1T33A 3BR0A 3FX3A 3HTHA 2R5ZB 3MNLA 3HRSA 4I0BA 5CVIA 5J1YA 1LEBA 2IGNA 3PFYA 5C4XJ 5HLIA 2HPMA 2LH9A 2Q0OA 2V1XA 3KZIC 1AKHA 3K0LA 1YLFA 1A35A 3HOSA 3NWSA 2ZY9A 1B9NA 2VKEA 2FBKA 2O8KA 4ENJA 1HOMA 3J81K 3JSJA 1MNEA 4N0BA 3S1MJ 4IX7A 1FOXA 1YW7A 2A61A 2EFPA 4U87A 2ZJ2A 5FKOA 4XONA 1PUFB 2GOMA 1SANA 2M8EA 1EH8A 3FXUA 4RM2A 3RKYA 1S3JA 5CKTA 4RGSA 5HDKA 4I98B 3F23A 2MD0A 2LFBA 1ZR2A 3GTKJ 1EKEA 1RZ4A 3ISPA 4CCLA 3BHQA 4BEHB 5ICFA 5IYBJ 3F8BA 2LC2A 1Z3XA 4XLEA 5D5UB 2W7NA 1I6XA 1X4OA 2L5QA 1VTNC 2PLYA 4RA2A 1IRGA 3KETA 1J9IA 3S3NA 1FYLA 2JRTA 1P7IA 3GUDA 4AYBN 2O0YA 1ETVA 2EH3A 1REPC 2OCCH 1I39A 3S1QJ 4EQQA 1V4RA 2GFNA 4F52A 1Z1DA 2ZBKA 3V8LA 1Y56A 1FOYA 3CUQA 2CUFA 1HDPA 5IT3A 1MBJA 4LD5A 1P2FA 5F0CA 1IN4A 2UUZA 2RAEA 2LDUA 1MMAA 1FX7A 2Q8KA 1TT5B 3HXLA 3J80K 2HEOA 4UB8C 2F5FA 3C18A 4E4HA 2BHYA 1SFUA 3JRGA 2OI8A 3AG1H 4XRSA 3WTUC 4EATA 2XAHA 2PJPA 2LBFA 1BJZA 4RAGA 2FJI1 2GIZA 2E35A 2H1LA 2QQBA 3K4MA 2ME6A 2WC2A 1USTA 2OTJI 5FGLA 4I99C 4HLYA 3ZQHA 4RBOA 3OS2A 1GVDA 2OPTA 1OCTC 2K5CA 1MBKA 3FXKA 3VWBA 2BW3B 4LB5A 1OCCH 4ON0A 5FHPA 2P7VB 1ETWA 4IVNA 3V6GA 3GLLA 4M3FA 1KYZA 4ZC3A 1XGMA 2Q2EB 4AIDA 2LR8A 3E6DA 4U0VA 1FT9A 1S29A 2BY3A 3ECHA 4P1WA 4UUTA 2LD5A 4ENNA 3RZDJ 1ETXA 2R7DA 4N4NB 3I53A 3S2WA 3BCAA 4KDPA 2HGCA 2P81A 1U5TA 4QPQA 5FMPA 4QLCU 3QQAA 3KLNA 3F9KA 2G7SA 2TDXA 1KU2A 2ZB9A 4AC0A 2O6GE 2DT5A 4KN4X 3VYRB 5CXGA 4N9IA 3ZQIA 3A02A 3I64A 4Y7NJ 5CQEA 1JHFA 1O3TA 2V9VA 1TZLA 3NWTA 4PSXA 1VQMI 3IAM2 2P7CB 1VQPI 4KMUX 4L9NA 1LDKB 4OIPF 4L5IA 3L1PA 1LPQA 2L01A 1TW2A 2HWVA 3PIPF 1IN5A 4IEJA 3A0BC 5E3LA 1SFXA 2PG4A 1Y8QB 3CMMA 1QHHD 1WJEA 3M1EA 2DFEA 1ITYA 1NK3P 3CCMI 1O7LA 3OL3A 3JRIA 2NVYJ 2EZHA 3H5NA 3L9FA 1Z6RA 3GZNB 3BZCA 4HNUA 1IJWC 1J09A 3CZ6A 5LD2C 2DMQA 3CMYA 4PJLA 1YG2A 1MJBA 1B6AA 4BBRJ 4A3JJ 1P4XA 2NVUB 3R60A 4GYIA 2XV4S 1GT0C 2ETHA 2KLOA 3EPZA 3JAMK 1CF7B 2WAEA 1VQ5I 2IGOA 2QQAA 3M9AA 4L9VA 1QBJA 5M5YJ 1F1ZA 2OU2A 4P5OA 1PP7U 2VIXA 2R7UA 1IUFA 2DO7A 2RC4A 2ZMEB 3I9V2 2DA4A 3GTMJ 2NX4A 3G1LA 3DTEA 4LLGF 4UVBA 3CCRI 1A6IA 3R6SA 3ZMDA 2BEOA 1U9NA 2ZMEA 3AL0C 1HW5A 2VLAA 4UUVA 4X0GA 4M6XA 1UG2A 4ACIA 1HSJA 2DA5A 3LFKA 2HOTA 3JRHA 1SFKA 2RREA 3LSMA 3S1RJ 3KCCA 2V1NA 4UV8A 1VI0A 4A5MA 1P4AA 3MZ8A 5EEAA 2EIJH 2EV6A 2VPRA 4D7NA 4GDFA 1D5YA 1BI0A 3HL2A 3HOUJ 3BG3A 3GFMA 2NNNA 1K79A 1RR7A 1H89C 1MZBA 1D1CA 3VTIA 4XLHA 4G9YA 3WG9A 3HEFA 1SVLA 1RUNA 2PMZA 3GF2A 4BJTA 3HOZJ 3F8MA 1E2XA 3VW1A 3OYMA 2WAQN 2M4KA 4QWQA 3TOAA 3MKLA 3FXOA 1SD5A 3HE0A 5D5XB 3NRVA 1BJAA 1ZGJA 2LP0A 1HCRA 1UI6A 3HOVJ 4E7LA 3HRMA 5CW8A 1F36A 4XKCA 3M8EA 3I4PA 2MD5A 5FO5A 4D7MA 4E7HA 3EETA 4S04A 3M8JA 2D5VA 1F4KA 2EILH 3ZQ7A 3ON4A 3W6JB 4IHXA 1FJLA 3QPSA 5F6FA 4XICA 1K78B 4NB5A 4A6EA 2L7FP 2FMYA 4WX9A 4ME9A 1Q1HA 2HQNA 2O7OA 4NNJA 3I58A 1X4PA 3O8HA 3D5SC 4BJ6C 2M4GA 2QSGX 3DFGA 4JX5A 4F3QA 4A3IJ 2D45A 2CU7A 4WK8F 1XCBA 2HVSA 4E7ZA 3PM1A 2W82A 5GADJ 5EG0B 3TBIA 3VUQA 1G8XA 1TWHJ 2P5LC 1ZYRF 1QQIA 1Y1VJ 3OYCA 2G7GA 2Z3YA 4M74A 5D18A 1FIPA 4MO7A 3GW2A 5TRDA 4NUBA 4AVZA 4DNCA 1IUYA 4YFNF 5M3MJ 3BG7A 5B5EC 3K2AA 2OBPA 1V5EA 4I2OA 3RPQA 1GXQA 1Z7LA 2DMUA 3B6CA 3L2WA 3H0GJ 2QIBA 1G4DA 3QP5A 5LRSA 3G4SI 1APLC 1QZEA 4RM3A 3CCQI 2E5ZA 2GZWA 5DTDA 2EWNA 4AWXB 1IF1A 4C30A 4H0EA 3DU6A 3EQLF 3ML6A 3A1YA 2HYTA 3V7RA 1MMSA 4XLNF 3PQKA 1BR2A 2HOEA 1YW9A 1BW6A 1DQUA 1V3FA 1PYVA 2R7QA 2Y0SN 1K4SA 5EEGA 2L7ZA 2W84A 2WV0A 3AAFA 4M9SA 1FC3A 4DJAA 2QBYA 3CD6I 1WPKA 2MG4A 3PSFA 3RIRA 1NK2P 3F8FA 2RHAA 3G3ZA 3JRDA 4Q48A 1IZ1A 4WXHA 1XSVA 1NG6A 1EA3A 2VBXA 2Q24A 2QBYB 2VUMJ 2EA2A 3Q5FA 4KN7X 4F92B 2YX7A 3MMYB 5L3BA 2HU9A 5HNFA 3KEQA 2ACJA 2Y9YA 3PIOF 2GUHA 4HA8A 3BOQA 1Z67A 5IP7J 3CUOA 4E70A 5FRMA 1MMGA 3NRGA 2ZFUA 4E7SA 2EIKH 1U5TB 3W6VA 2JSCA 2KRCA 3TDUC 4CA0A 1I6HJ 4IOCF 4BY1J 1JTXA 2R7RA 1ZGWA 3E5XA 1WCMJ 4KISA 1UAAA 3HTIA 1NTCA 2HQRA 1AHDP 4TV7A 1JUMA 4A3GJ 2KPMA 2QYOA 4L9JA 5AIPA 3H36A 1O7FA 3S3MA 3EGQA 1JGSA 2E60A 3HJEA 3NPIA 4XN3A 3JCUC 2XF6A 2STWA 2BBYA 4PCQA 1R1TA 3RCOA 3AL0B 5D1RA 1ETKA 3H0DA 4EJWA 1YJNI 4AM3A 3WTSC 4I09A 1SVOA 1YJ9I 4CZCA 1LEAA 3FISA 3U2RA 2VE9A 4HEA2 1VQNI 4Y13A 1ZH5A 2XGXA 4KJZA 2E5NA 4HNTA 2ZJQF 2GA1A 3BTIA 4RMNA 2UZKA 3DBRB 4XQFA 3IKVA 1F9NA 3JTHA 1LFBA 2VB6A 3MFKA 1FEXA 1OR7C 1YI2I 5JLXA 2AQFA 5ILUA 3U21A 5L3EA 1U8RA 4I01A 5EGOA 1XCVA 3DPLC 3W6KB 1QPIA 3TP3A 3TKYA 1D3YA 5FFXA 3G73A 2AHQA 4CCKA 5F1JA 2VJ4A 5K5RA 2OF7A 5GPCA 2B7EA 3QKXA 1ACIA 2VBWA 2RASA 4XLFA 3IP4B 5K5OA 2HFHA 1ON1A 1T98A 1WH5A 1WJCA 2LNBA 4IRHA 1FBUA 2QCOA 3KZZA 1I1GA 2IA2A 2EBIA 2HZDA 2G7UA 5BPIA 1SGMA 1T0FA 1B4AA 3L2UA 1A31A 4CCOA 2CUEA 4I6ZA 4Q4ZF 1SD7A 1YIOA 4R1HA 3MEXA 1PJRA 1YYVA 1Z77A 5B1BH 3FXLA 4QIWN 3GTQJ 3VIBA 2E34A 2M7AA 4IRIA 2VOOA 2YS9A 1EJ9A 3HSRA 2L4AA 4NDLA 3I4MJ 2WY8Q 3P9KA 4B44A 2XROA 2P4WA 3LSKA 2V1DA 3CF2A 3KIOA 5DS9A 1OKRA 3G1OA 4M73A 3K1NA 4B3XA 5HDGA 5ED4A 2VONA 2ZKZA 2IJLA 5CQGA 2VL8A 4XKBA 5DUKA 1MSEC 3K69A 1BI3A 2P6SA 2QENA 1VQLI 1XG1A 1D1AA 3T1BA 4HYEA 1D1BA 1R58A 1JTYA 3ZPLA 2DK5A 2EV0A 3E0JB 1LUJB 2CV2A 1TWFJ 2NNYA 4IOAF 1ZQ3P 2Y75A 5EJCA 3MCZA 5F04A 2V4JC 1FYMA 4R79A 1XMXA 2XDNA 2R7OA 4ZYGA 2IA0A 3W3CA 2DA6A 2QTQA 1FP1D 1TWCJ 1XS9A 2PN6A 2RV8A 2L4MA 2X6OA 3CJQB 1R5GA 4PGGA 2QEXI 5J4YA 5HLHA 4GCTA 1Z05A 3CMAI 3VVXA 4CGRA 3TW7A 3OIOA 4M9XA 4PZJA 5FB2A 1BIBA 5JVTA 2MGQA 3FK6A 3FMRA 3HC7A 1YX5A 2P5KA 1X1BA 4XORA 3R61A 3QPTA 2Z2SB 3ZQLA 4KFCA 1FSHA 1TQIA 3GZ6A 3JSOA 1ZLKA 5BS6A 2RKHA 3S93A 2UXIA
chains in the Genus database with same CATH topology
4YZEA 1ETVA 1ORKA 2EH3A 3S1QJ 1B72B 1ETQA 2GFNA 2OERA 2CUFA 1U78A 1X58A 3JRCA 3NXCA 4DW6A 1HDPA 5C4YA 3Q3SA 1MBJA 5F0CA 2RAEA 1B72A 4A3EJ 2NOGA 4JNNA 1JJ8C 4BBSJ 1JKPC 5IYDJ 1MH4A 5K7ZA 2X48A 3BTCA 3JRGA 4PXIA 2OI8A 4XRSA 2GM4A 2JA5J 1BJZA 3KKCA 3Q0VA 2ME6A 3G56A 2ELKA 5D19A 3C2BA 5FGLA 2MW8A 3ZQHA 1U9OA 4RBOA 1GVDA 2OPTA 1RKWA 1OCTC 3S17J 2DG7A 1U8BA 3EUPA 5EZHA 2I10A 2XRLA 4G12A 2KDZA 1MBKA 2E2JJ 3BR3A 3NI7A 4JX6A 2H1KA 2TCTA 2LK2A 1IGNA 5FHPA 1ETWA 3V6GA 4M3FA 4DZJA 2QOPA 3ANPA 1JT6A 2UXHA 2LR8A 2LD5A 4UUTA 2JA6J 4C2MJ 1ETYA 3RZDJ 1ETXA 5E3OA 1Q1VA 1JKOC 1WH7A 5GP9A 2O7TA 2P81A 3BR6A 4KWAA 4XK4A 2UXUA 2YVEA 1WGXA 2DN0A 3CQZJ 5FMPA 1AKHB 3QQAA 5EG0A 2XB0X 2G7SA 1LE8A 1GDTA 3G1MA 2ZB9A 3JR9A 3SDGA 4AC0A 4MFEA 4J19A 5CXGA 3ZQIA 2VKVA 3A02A 1JUSA 4Y7NJ 1TC3C 1IC8A 3C07A 3HGGA 3ZQFA 4V2GA 4FE4A 1GV5A 2L0KA 2M2EA 3CWRA 4MXMA 3M4OJ 3ZOBA 4RDUA 3NRGA 4XIDA 1X2MA 3ZQGA 1VNDA 2R92J 1A5JA 2MSYA 2E1OA 3L1PA 2KT0A 2JN6A 2LKXA 3G7RA 4IEJA 3JRBA 5E3LA 4FTHA 4CYCB 2UXOA 3COLA 3S5RA 1RESA 1ITYA 2ID3A 1NK3P 2LY9A 3HDDA 3JRIA 2NVYJ 2EZHA 3KKDA 4ICHA 2IU5A 2WV1A 1IJWC 3BG5A 2CQXA 4CYCA 1ZK8A 4ABZA 3LSRA 2DMQA 5AQCA 2QKOA 5IOYA 3CMYA 1CQTA 2H8RA 2JA7J 4BBRJ 4B4CA 4A3JJ 1HLVA 1HDDC 2HYJA 2JK3A 1H8AC 1GT0C 4FE7A 1MSFC 1Y1WJ 3HOYJ 1MH3A 2HDDA 2CJJA 3VOXA 5M5YJ 5M5WJ 5K7HA 4IHVA 3HTAA 1POGA 1IUFA 4W97A 1JJ6C 1ENHA 1K83J 2DA4A 3LSGA 3GTMJ 4C3HJ 2NX4A 3GTPJ 3G1LA 1P7JA 2W48A 4IHWA 3IH3A 1X2NA 4M3EA 1MNMC 3IH4A 1A6IA 2JMWA 1DU6A 3E7LA 1U9NA 2XPVA 3I4NJ 1WI3A 4GCLA 3F1BA 2K40A 2F07A 1I50J 1UG2A 4ACIA 2QF7A 2DA5A 5DAJA 3SJMA 5IP6A 2HOTA 1W0TA 3JRHA 3S1RJ 3VVZA 2COBA 1VI0A 3CDLA 2XSDC 3LJLA 1TWGJ 5EEAA 2VPRA 4D7NA 3HKZN 3DCFA 3OSGA 1D5YA 3LOCA 3HOUJ 3B81A 3BG3A 1JGGA 2ZOYA 4C3JJ 1RR7A 1H89C 5HAWA 1R9TJ 1ZR4A 3KZ9A 3HEFA 3VW2A 2E19A 3S2HJ 3HOZJ 2ECBA 3VW1A 3Q0UA 4BKXA 5C4JJ 2WAQN 4X6AJ 2WUIA 3QPLA 3TP0A 3MKLA 5FKMA 2R5ZA 2PZ9A 3HE0A 2LP0A 2DA3A 2DJNA 1HCRA 2JWTA 3NARA 1UI6A 1TWAJ 4QTRA 2DA7A 3HOVJ 2XB5A 4JKZA 1OFCX 2XPUA 5CW8A 1F36A 5FLMJ 3BJBA 2HXIA 2LLKA 1GUUA 3BR1A 1VFCA 3RD3A 4D7MA 1F43A 3LHQA 2YUSA 1W0UA 4A3FJ 5FLVA 2D5VA 3HIMA 5K58A 4M3BA 5E3NA 2GBYA 3ON4A 1XC5A 4EEFG 5HSZA 2R7ZJ 2QWTA 4IHXA 2NS7A 3QPSA 4B1RA 5EDNA 1UHSA 4XICA 1FJLA 5J1UA 2HOSA 3GTGJ 5EGOB 2L7FP 1YRNB 2ZCMA 4GFKA 1MBHA 4X1EA 3Q0WA 4DZPA 1IG7A 3BRUA 4ME9A 2O7OA 3TEDA 3O8HA 2GENA 3BR2A 5FKLA 4W1UA 4JP0A 5BNGA 2V57A 3HB9A 4JX5A 2W53A 3BTLA 4A3IJ 2CU7A 2TRTA 3B6AA 2AO9A 3D1NI 4AUXA 3PM1A 4GFLA 2CQQA 2NP5A 5EG0B 3LSJA 1QVUA 3CCYA 3VUQA 2G7GA 1TWHJ 3FRQA 1Y1VJ 3HM5A 2DMPA 3HOWJ 2NVTJ 4A3MJ 3VOKA 2XGEA 5D18A 1FIPA 4MO7A 4DYQA 4AC6A 1O4XA 5M3MJ 3DPJA 3S2DJ 4JX4A 3BTJA 3K2AA 1JKRC 2NVXJ 4A93J 1OCPA 4NN1A 1OJLA 2DMUA 3B6CA 4HKUA 3NAUA 2NP3A 2VI6A 3H0GJ 2QIBA 3V78A 4QSHA 4NELA 1APLC 4MK6A 1GV2A 1JKQC 9ANTA 3BT9A 5DTDA 1BL0A 3MN2A 3DEWA 1I3QJ 3HBLA 3GTJJ 3RZOJ 2HYTA 2Y30A 3VP5A 3PO3J 4XRMA 2K9SA 1BW6A 2Y0SN 3BR5A 4M3DA 1RETA 4A69C 3JRAA 4A3KJ 3RKQA 3WHCA 2ZCNA 3GTOJ 2FX0A 2L7ZA 3JRFA 2FD5A 4JL3A 1K61A 3OSFA 1WPKA 2MG4A 1NK2P 4C3IJ 1IDYA 5IP9J 2K9NA 4GFBA 4M6VA 4B3AA 1FTTA 5HODA 3E7QA 2YU9J 2RHAA 2G7LA 2HXOA 3JRDA 2EZLA 2B63J 5GPAA 4Y52J 2DA2A 3BQZA 1HF0A 2Q24A 2VUMJ 2WB1N 4AF5A 2DMNA 2ECCA 1BA5A 3K7AJ 3VPRA 1B8IA 1G2HA 2IAIA 3MVPA 1MBGA 1RPWA 5J3LA 3RH2A 4S0HB 1PUFA 2FJ1A 2Y9YA 3P9TA 2EQRA 2GUHA 5F0HA 1JUPA 1VF9A 5IP7J 4IHYA 5EF6A 2E2HJ 1DU0A 2HI3A 3RQIA 3IH2A 3NNRA 1YRNA 2R5YA 5K7FA 1IDZA 1I6HJ 1QVTA 3FK7A 3W6VA 3HGYA 2EZIA 3BG9A 1AU7A 5M5XJ 1JTXA 4BY1J 2WGBA 4FISA 3PPBA 1ZGWA 1WCMJ 2L9RA 3LWJA 3HTIA 1H88C 3M3YJ 1NTCA 3S1NJ 2DG8A 1AHDP 2R5YB 5JLWA 3HOXJ 3FKIJ 3LSPA 1JUMA 4A3GJ 1UMQA 2G0EA 3A03A 4DYCA 2JA8J 3SFIA 1FIAA 2O9LA 2YVHA 2ID6A 3EGQA 3GEUA 4FCYA 3NPIA 2L7MP 2N8GA 2PMZN 2XGCA 5FKNA 3QBMA 3VVYA 2XPWA 2GLOA 3BQYA 5D1RA 1ETKA 3A01B 3BCGA 2E2IJ 3BNIA 2DA1A 3FISA 2ZOZA 3CJDA 5FKKA 4V2FA 2FQ4A 4XRSG 1MBEA 3BTIA 1JT0A 3S15J 3VW0A 2LTPA 3T6NA 2HKUA 2Y31A 3AQSA 2DTZA 4M3GA 5F0FA 1LFBA 3O60A 2HQ5A 1FEXA 1QRYA 2G3BA 5JLXA 5FJ8J 3PASA 1UI5A 5EGOA 2Y9ZA 3LNQA 1QPIA 3TP3A 1IV6A 2NVQJ 2AHQA 5F1JA 1E3OC 2OF7A 5GPCA 3QKXA 1ZTRA 1S7EA 2RASA 2M9HA 4LOCA 4A3BJ 1FTZA 2R93J 4MLOA 2JJ7A 4MIMA 4D5CA 3GTLJ 1WH5A 2CRGA 5J1RA 2DMTA 3FIWA 2QCOA 5M3FJ 4UDSA 1LE8B 4A3CJ 5C3EJ 1Z0XA 2EBIA 5F08A 1SGMA 2FBQA 2R0QC 2PBXA 2CUEA 4BY7J 4I6ZA 5H9TA 4L62A 4HNVA 5IYCJ 3JREA 3H3VK 4I76A 4BXXJ 5C44J 3AQTA 3O8GA 1Z77A 3OOUA 4QIWN 3GTQJ 3VIBA 3UKGA 1SFOJ 4MFDA 3ZQCA 4GCKA 2X9DA 2YS9A 3TW6A 4L5EA 4NDLA 1ETOA 3I4MJ 2XGDA 5DS9A 1IRZA 3G1OA 1MBFA 3S14J 2Y2ZA 5F27A 4JYKA 3IV5A 2IBDA 1MSEC 5EYRA 5IOZA 3CRJA 1RKTA 4D5FA 2REKA 3GBGA 5EFYA 3ON2A 1XG1A 4DYRA 3WHBA 1T33A 3BR0A 3HTHA 1BW5A 2R5ZB 3MNLA 1JTYA 5J1YA 2UXPA 2D6YA 5C4XJ 2ZCXA 1TWFJ 1AKHA 1ZQ3P 3KNWA 5F04A 4A3LJ 2K9QA 3A01A 2XDNA 2VKEA 3HTJA 2O8KA 2EZKA 1HOMA 3JSJA 5E3MA 3GZIA 2DA6A 2QTQA 1TWCJ 2HOAA 1ZKGA 3F0CA 1XS9A 1B8IB 3S1MJ 2X6OA 4UUSB 1EF4A 4GCTA 1PUFB 5FKOA 3VVXA 4CGRA 3TW7A 1SANA 3IUVA 2M8GX 3OIOA 2M0CA 2MGQA 3FK6A 4UUSA 3ANGA 2LFBA 5CXIA 1ZR2A 3GTKJ 5EZGA 4A3DJ 3BHQA 5IYBJ 1LFUP 3ZQLA 2ME0A 2IEKA 2LVSA 5IPAA 5HBUA 2NS8A 2M34A 1T56A 3S16J 3PO2J 1P7IA 4AYBN 2UXIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YZE A;  1ETV A;  1ORK A;  2EH3 A;  3S1Q J;  1B72 B;  1ETQ A;  2GFN A;  2OER A;  2CUF A;  1U78 A;  1X58 A;  3JRC A;  3NXC A;  4DW6 A;  1HDP A;  5C4Y A;  3Q3S A;  1MBJ A;  5F0C A;  2RAE A;  1B72 A;  4A3E J;  2NOG A;  4JNN A;  1JJ8 C;  4BBS J;  1JKP C;  5IYD J;  1MH4 A;  5K7Z A;  2X48 A;  3BTC A;  3JRG A;  4PXI A;  2OI8 A;  4XRS A;  2GM4 A;  2JA5 J;  1BJZ A;  3KKC A;  3Q0V A;  2ME6 A;  3G56 A;  2ELK A;  5D19 A;  3C2B A;  5FGL A;  2MW8 A;  3ZQH A;  1U9O A;  4RBO A;  1GVD A;  2OPT A;  1RKW A;  1OCT C;  3S17 J;  2DG7 A;  1U8B A;  3EUP A;  5EZH A;  2I10 A;  2XRL A;  4G12 A;  2KDZ A;  1MBK A;  2E2J J;  3BR3 A;  3NI7 A;  4JX6 A;  2H1K A;  2TCT A;  2LK2 A;  1IGN A;  5FHP A;  1ETW A;  3V6G A;  4M3F A;  4DZJ A;  2QOP A;  3ANP A;  1JT6 A;  2UXH A;  2LR8 A;  2LD5 A;  4UUT A;  2JA6 J;  4C2M J;  1ETY A;  3RZD J;  1ETX A;  5E3O A;  1Q1V A;  1JKO C;  1WH7 A;  5GP9 A;  2O7T A;  2P81 A;  3BR6 A;  4KWA A;  4XK4 A;  2UXU A;  2YVE A;  1WGX A;  2DN0 A;  3CQZ J;  5FMP A;  1AKH B;  3QQA A;  5EG0 A;  2XB0 X;  2G7S A;  1LE8 A;  1GDT A;  3G1M A;  2ZB9 A;  3JR9 A;  3SDG A;  4AC0 A;  4MFE A;  4J19 A;  5CXG A;  3ZQI A;  2VKV A;  3A02 A;  1JUS A;  4Y7N J;  1TC3 C;  1IC8 A;  3C07 A;  3HGG A;  3ZQF A;  4V2G A;  4FE4 A;  1GV5 A;  2L0K A;  2M2E A;  3CWR A;  4MXM A;  3M4O J;  3ZOB A;  4RDU A;  3NRG A;  4XID A;  1X2M A;  3ZQG A;  1VND A;  2R92 J;  1A5J A;  2MSY A;  2E1O A;  3L1P A;  2KT0 A;  2JN6 A;  2LKX A;  3G7R A;  4IEJ A;  3JRB A;  5E3L A;  4FTH A;  4CYC B;  2UXO A;  3COL A;  3S5R A;  1RES A;  1ITY A;  2ID3 A;  1NK3 P;  2LY9 A;  3HDD A;  3JRI A;  2NVY J;  2EZH A;  3KKD A;  4ICH A;  2IU5 A;  2WV1 A;  1IJW C;  3BG5 A;  2CQX A;  4CYC A;  1ZK8 A;  4ABZ A;  3LSR A;  2DMQ A;  5AQC A;  2QKO A;  5IOY A;  3CMY A;  1CQT A;  2H8R A;  2JA7 J;  4BBR J;  4B4C A;  4A3J J;  1HLV A;  1HDD C;  2HYJ A;  2JK3 A;  1H8A C;  1GT0 C;  4FE7 A;  1MSF C;  1Y1W J;  3HOY J;  1MH3 A;  2HDD A;  2CJJ A;  3VOX A;  5M5Y J;  5M5W J;  5K7H A;  4IHV A;  3HTA A;  1POG A;  1IUF A;  4W97 A;  1JJ6 C;  1ENH A;  1K83 J;  2DA4 A;  3LSG A;  3GTM J;  4C3H J;  2NX4 A;  3GTP J;  3G1L A;  1P7J A;  2W48 A;  4IHW A;  3IH3 A;  1X2N A;  4M3E A;  1MNM C;  3IH4 A;  1A6I A;  2JMW A;  1DU6 A;  3E7L A;  1U9N A;  2XPV A;  3I4N J;  1WI3 A;  4GCL A;  3F1B A;  2K40 A;  2F07 A;  1I50 J;  1UG2 A;  4ACI A;  2QF7 A;  2DA5 A;  5DAJ A;  3SJM A;  5IP6 A;  2HOT A;  1W0T A;  3JRH A;  3S1R J;  3VVZ A;  2COB A;  1VI0 A;  3CDL A;  2XSD C;  3LJL A;  1TWG J;  5EEA A;  2VPR A;  4D7N A;  3HKZ N;  3DCF A;  3OSG A;  1D5Y A;  3LOC A;  3HOU J;  3B81 A;  3BG3 A;  1JGG A;  2ZOY A;  4C3J J;  1RR7 A;  1H89 C;  5HAW A;  1R9T J;  1ZR4 A;  3KZ9 A;  3HEF A;  3VW2 A;  2E19 A;  3S2H J;  3HOZ J;  2ECB A;  3VW1 A;  3Q0U A;  4BKX A;  5C4J J;  2WAQ N;  4X6A J;  2WUI A;  3QPL A;  3TP0 A;  3MKL A;  5FKM A;  2R5Z A;  2PZ9 A;  3HE0 A;  2LP0 A;  2DA3 A;  2DJN A;  1HCR A;  2JWT A;  3NAR A;  1UI6 A;  1TWA J;  4QTR A;  2DA7 A;  3HOV J;  2XB5 A;  4JKZ A;  1OFC X;  2XPU A;  5CW8 A;  1F36 A;  5FLM J;  3BJB A;  2HXI A;  2LLK A;  1GUU A;  3BR1 A;  1VFC A;  3RD3 A;  4D7M A;  1F43 A;  3LHQ A;  2YUS A;  1W0U A;  4A3F J;  5FLV A;  2D5V A;  3HIM A;  5K58 A;  4M3B A;  5E3N A;  2GBY A;  3ON4 A;  1XC5 A;  4EEF G;  5HSZ A;  2R7Z J;  2QWT A;  4IHX A;  2NS7 A;  3QPS A;  4B1R A;  5EDN A;  1UHS A;  4XIC A;  1FJL A;  5J1U A;  2HOS A;  3GTG J;  5EGO B;  2L7F P;  1YRN B;  2ZCM A;  4GFK A;  1MBH A;  4X1E A;  3Q0W A;  4DZP A;  1IG7 A;  3BRU A;  4ME9 A;  2O7O A;  3TED A;  3O8H A;  2GEN A;  3BR2 A;  5FKL A;  4W1U A;  4JP0 A;  5BNG A;  2V57 A;  3HB9 A;  4JX5 A;  2W53 A;  3BTL A;  4A3I J;  2CU7 A;  2TRT A;  3B6A A;  2AO9 A;  3D1N I;  4AUX A;  3PM1 A;  4GFL A;  2CQQ A;  2NP5 A;  5EG0 B;  3LSJ A;  1QVU A;  3CCY A;  3VUQ A;  2G7G A;  1TWH J;  3FRQ A;  1Y1V J;  3HM5 A;  2DMP A;  3HOW J;  2NVT J;  4A3M J;  3VOK A;  2XGE A;  5D18 A;  1FIP A;  4MO7 A;  4DYQ A;  4AC6 A;  1O4X A;  5M3M J;  3DPJ A;  3S2D J;  4JX4 A;  3BTJ A;  3K2A A;  1JKR C;  2NVX J;  4A93 J;  1OCP A;  4NN1 A;  1OJL A;  2DMU A;  3B6C A;  4HKU A;  3NAU A;  2NP3 A;  2VI6 A;  3H0G J;  2QIB A;  3V78 A;  4QSH A;  4NEL A;  1APL C;  4MK6 A;  1GV2 A;  1JKQ C;  9ANT A;  3BT9 A;  5DTD A;  1BL0 A;  3MN2 A;  3DEW A;  1I3Q J;  3HBL A;  3GTJ J;  3RZO J;  2HYT A;  2Y30 A;  3VP5 A;  3PO3 J;  4XRM A;  2K9S A;  1BW6 A;  2Y0S N;  3BR5 A;  4M3D A;  1RET A;  4A69 C;  3JRA A;  4A3K J;  3RKQ A;  3WHC A;  2ZCN A;  3GTO J;  2FX0 A;  2L7Z A;  3JRF A;  2FD5 A;  4JL3 A;  1K61 A;  3OSF A;  1WPK A;  2MG4 A;  1NK2 P;  4C3I J;  1IDY A;  5IP9 J;  2K9N A;  4GFB A;  4M6V A;  4B3A A;  1FTT A;  5HOD A;  3E7Q A;  2YU9 J;  2RHA A;  2G7L A;  2HXO A;  3JRD A;  2EZL A;  2B63 J;  5GPA A;  4Y52 J;  2DA2 A;  3BQZ A;  1HF0 A;  2Q24 A;  2VUM J;  2WB1 N;  4AF5 A;  2DMN A;  2ECC A;  1BA5 A;  3K7A J;  3VPR A;  1B8I A;  1G2H A;  2IAI A;  3MVP A;  1MBG A;  1RPW A;  5J3L A;  3RH2 A;  4S0H B;  1PUF A;  2FJ1 A;  2Y9Y A;  3P9T A;  2EQR A;  2GUH A;  5F0H A;  1JUP A;  1VF9 A;  5IP7 J;  4IHY A;  5EF6 A;  2E2H J;  1DU0 A;  2HI3 A;  3RQI A;  3IH2 A;  3NNR A;  1YRN A;  2R5Y A;  5K7F A;  1IDZ A;  1I6H J;  1QVT A;  3FK7 A;  3W6V A;  3HGY A;  2EZI A;  3BG9 A;  1AU7 A;  5M5X J;  1JTX A;  4BY1 J;  2WGB A;  4FIS A;  3PPB A;  1ZGW A;  1WCM J;  2L9R A;  3LWJ A;  3HTI A;  1H88 C;  3M3Y J;  1NTC A;  3S1N J;  2DG8 A;  1AHD P;  2R5Y B;  5JLW A;  3HOX J;  3FKI J;  3LSP A;  1JUM A;  4A3G J;  1UMQ A;  2G0E A;  3A03 A;  4DYC A;  2JA8 J;  3SFI A;  1FIA A;  2O9L A;  2YVH A;  2ID6 A;  3EGQ A;  3GEU A;  4FCY A;  3NPI A;  2L7M P;  2N8G A;  2PMZ N;  2XGC A;  5FKN A;  3QBM A;  3VVY A;  2XPW A;  2GLO A;  3BQY A;  5D1R A;  1ETK A;  3A01 B;  3BCG A;  2E2I J;  3BNI A;  2DA1 A;  3FIS A;  2ZOZ A;  3CJD A;  5FKK A;  4V2F A;  2FQ4 A;  4XRS G;  1MBE A;  3BTI A;  1JT0 A;  3S15 J;  3VW0 A;  2LTP A;  3T6N A;  2HKU A;  2Y31 A;  3AQS A;  2DTZ A;  4M3G A;  5F0F A;  1LFB A;  3O60 A;  2HQ5 A;  1FEX A;  1QRY A;  2G3B A;  5JLX A;  5FJ8 J;  3PAS A;  1UI5 A;  5EGO A;  2Y9Z A;  3LNQ A;  1QPI A;  3TP3 A;  1IV6 A;  2NVQ J;  2AHQ A;  5F1J A;  1E3O C;  2OF7 A;  5GPC A;  3QKX A;  1ZTR A;  1S7E A;  2RAS A;  2M9H A;  4LOC A;  4A3B J;  1FTZ A;  2R93 J;  4MLO A;  2JJ7 A;  4MIM A;  4D5C A;  3GTL J;  1WH5 A;  2CRG A;  5J1R A;  2DMT A;  3FIW A;  2QCO A;  5M3F J;  4UDS A;  1LE8 B;  4A3C J;  5C3E J;  1Z0X A;  2EBI A;  5F08 A;  1SGM A;  2FBQ A;  2R0Q C;  2PBX A;  2CUE A;  4BY7 J;  4I6Z A;  5H9T A;  4L62 A;  4HNV A;  5IYC J;  3JRE A;  3H3V K;  4I76 A;  4BXX J;  5C44 J;  3AQT A;  3O8G A;  1Z77 A;  3OOU A;  4QIW N;  3GTQ J;  3VIB A;  3UKG A;  1SFO J;  4MFD A;  3ZQC A;  4GCK A;  2X9D A;  2YS9 A;  3TW6 A;  4L5E A;  4NDL A;  1ETO A;  3I4M J;  2XGD A;  5DS9 A;  1IRZ A;  3G1O A;  1MBF A;  3S14 J;  2Y2Z A;  5F27 A;  4JYK A;  3IV5 A;  2IBD A;  1MSE C;  5EYR A;  5IOZ A;  3CRJ A;  1RKT A;  4D5F A;  2REK A;  3GBG A;  5EFY A;  3ON2 A;  1XG1 A;  4DYR A;  3WHB A;  1T33 A;  3BR0 A;  3HTH A;  1BW5 A;  2R5Z B;  3MNL A;  1JTY A;  5J1Y A;  2UXP A;  2D6Y A;  5C4X J;  2ZCX A;  1TWF J;  1AKH A;  1ZQ3 P;  3KNW A;  5F04 A;  4A3L J;  2K9Q A;  3A01 A;  2XDN A;  2VKE A;  3HTJ A;  2O8K A;  2EZK A;  1HOM A;  3JSJ A;  5E3M A;  3GZI A;  2DA6 A;  2QTQ A;  1TWC J;  2HOA A;  1ZKG A;  3F0C A;  1XS9 A;  1B8I B;  3S1M J;  2X6O A;  4UUS B;  1EF4 A;  4GCT A;  1PUF B;  5FKO A;  3VVX A;  4CGR A;  3TW7 A;  1SAN A;  3IUV A;  2M8G X;  3OIO A;  2M0C A;  2MGQ A;  3FK6 A;  4UUS A;  3ANG A;  2LFB A;  5CXI A;  1ZR2 A;  3GTK J;  5EZG A;  4A3D J;  3BHQ A;  5IYB J;  1LFU P;  3ZQL A;  2ME0 A;  2IEK A;  2LVS A;  5IPA A;  5HBU A;  2NS8 A;  2M34 A;  1T56 A;  3S16 J;  3PO2 J;  1P7I A;  4AYB N;  2UXI A; 
#chains in the Genus database with same CATH topology
 4BQA A;  3ABU A;  1B72 B;  4KUM A;  3WGI A;  2OER A;  3J80 Z;  1QNT A;  1R23 A;  1X58 A;  2V9K A;  3VFZ A;  2PQ8 A;  2Z33 A;  5C4Y A;  2FXA A;  3Q3S A;  2VJI A;  1CF7 A;  2K9L A;  2WA0 A;  1IRF A;  4XOP A;  4Y33 A;  3TO7 A;  4IPA A;  2FQ3 A;  4HG2 A;  4BXF A;  4Y4R A;  4BE2 A;  2CG4 A;  2KKO A;  1S7O A;  4FET A;  2LG4 A;  1S72 I;  3Q0V A;  3LAJ A;  5J47 A;  3BDD A;  3PL8 A;  4OIN F;  3NS4 A;  3IC7 A;  1BN5 A;  2ZXW H;  4LK1 F;  3E6M A;  1U9O A;  1RKW A;  2DG7 A;  2HKO A;  3NI7 A;  3BR3 A;  4Y3O A;  3AG2 H;  2X1C A;  4HX4 A;  3H5R A;  4RLF A;  2R7S A;  1T8I A;  4DZJ A;  4LIT A;  1VQ4 I;  2CUJ A;  3HTU A;  4P55 A;  2DDB A;  4C2M J;  4HSR A;  1SMT A;  2VQH A;  2DYR H;  4E7J A;  1WH7 A;  2PEX A;  1DUX C;  2O7T A;  4XK4 A;  3WTX C;  2DN0 A;  2RN7 A;  4FHT A;  2XAF A;  3H9G A;  4M72 A;  3F21 A;  4CO8 A;  2XB0 X;  3SFZ A;  1O3Q A;  1D0X A;  3G1M A;  3CC7 I;  3BJ6 A;  5HS8 A;  2WBM A;  1MMN A;  1I5Z A;  2F5V A;  2IW5 A;  2VKV A;  4CZZ A;  1SAU A;  4F91 B;  1TC3 C;  1R00 A;  1H0M A;  3DKY A;  5B1A H;  1Z9C A;  1GV5 A;  3CWR A;  2M2E A;  1XSD A;  4MXM A;  4RDU A;  2W4S A;  3T8R A;  4XID A;  1X2M A;  2L9V A;  1VND A;  5H6Q A;  3CLO A;  3ZQG A;  3IKT A;  1X3U A;  3SZT A;  2MSY A;  4OD5 A;  1V5G A;  3OY9 A;  3TL4 X;  4MEX F;  3K4K A;  1ZRF A;  3DWL E;  3JRB A;  2QA4 I;  4CYC B;  2BYV E;  3BG6 A;  2ZSI B;  1KQ0 A;  2LY9 A;  4D9J A;  4LMY A;  2M3A A;  2IU5 A;  2WV1 A;  2K27 A;  2DU9 A;  4P9F A;  5HOO A;  4CYC A;  2CQX A;  1W5C C;  1D0Z A;  2XKP A;  3LSR A;  1D5V A;  2QKO A;  2DFF A;  3L00 A;  4BHP A;  2CMP A;  2A05 A;  2X6W A;  4XKW A;  2HQA A;  2JPB A;  4B4C A;  1HLV A;  2HYJ A;  3GFI A;  3FDY A;  1O57 A;  2GQQ A;  2JK3 A;  4JK1 X;  1H8A C;  1MSF C;  3REO A;  4Z2Y A;  1UHW A;  4OIR F;  1Y39 A;  2V26 A;  3V8K A;  1IV8 A;  2W00 A;  3CC4 I;  4ANJ A;  3L2R A;  5M5W J;  4HQM A;  2H8W A;  3HTA A;  4U9N A;  2XC7 A;  4W97 A;  4KIT B;  5GAE J;  1K83 J;  4KT5 C;  2OUM A;  3GTP J;  1PUE E;  1P7J A;  4M71 A;  2W48 A;  2HZT A;  5DCM A;  1MNM C;  1BBY A;  3IH4 A;  3P7N A;  1YX3 A;  2JMW A;  5LHI A;  1LQ1 A;  3SHF A;  3HZJ A;  2XPV A;  1LVA A;  3I4N J;  2LKP A;  3PNT A;  1WZ2 A;  4GCL A;  1FYK A;  2WY7 Q;  3F1B A;  1I50 J;  5LGT A;  2MFZ A;  5DAJ A;  2W85 A;  5IP6 A;  3A4C A;  1ZLJ A;  3VVZ A;  1TWG J;  3TO9 A;  4BHB A;  1R71 A;  3SWH A;  4C3J J;  3KZ9 A;  3K70 C;  3VW2 A;  1MND A;  2E19 A;  2JRM A;  1R22 A;  2BOL A;  3S2H J;  3HIF A;  4WXD A;  5CPR B;  2WUI A;  2YX4 A;  4C9Y A;  1XN7 A;  4IQJ A;  2PZ9 A;  2H09 A;  2XUB A;  4ZH4 F;  3NAR A;  5JHF A;  3V7C A;  2XB5 A;  4JKZ A;  1UG0 A;  4LG0 B;  3KP2 A;  4HOB A;  3BR1 A;  4EM2 A;  1VFC A;  1E0E A;  3LHQ A;  3F6O A;  1SAX A;  5FLV A;  3RKX A;  1WSU A;  4ENM A;  2OQR A;  3JW4 A;  4E7I A;  1XC5 A;  2R7Z J;  2QWT A;  1L0O C;  2O3F A;  2NS7 A;  2WB1 A;  5EDN A;  1UHS A;  4XSX F;  5L3F A;  4RB1 A;  3FBI B;  1J75 A;  1G3T A;  2HOS A;  5EGO B;  2VT2 A;  1W4M A;  4K2E A;  2ZCM A;  4RLQ A;  3Q0W A;  2CSO A;  2DOE A;  2M45 A;  3TED A;  1OYW A;  1NH3 A;  2EA4 A;  3N05 A;  2E71 A;  5FKL A;  2P0W A;  2BHZ A;  3IAS 2;  5BNG A;  1OPC A;  3HB9 A;  1XPX A;  1X3Z B;  5DEQ A;  5FRN A;  4G6T B;  4AUX A;  2M0M A;  1JXS A;  2B9S A;  2CQQ A;  1NG7 A;  2Z99 A;  3L09 A;  1BI1 A;  2YU3 A;  1SD4 A;  3FRQ A;  2WAD A;  3RI4 A;  3VOK A;  1TNS A;  2MC4 A;  2KL4 A;  1H9T A;  3KE2 A;  4PJ0 C;  2EIN H;  1T38 A;  3QOE A;  4AC6 A;  1RNL A;  4AIJ A;  5AIQ A;  4XN0 A;  5IT9 Z;  5AON A;  4JX4 A;  3KYC B;  3D5L A;  3I71 A;  2NVX J;  2R3S A;  1J7K A;  2BGC A;  3K4L A;  4EJU A;  5BMZ A;  1OJL A;  5GTI C;  1R1U A;  1R4M B;  2PBI A;  4CDG A;  3VSK A;  4QSH A;  5D5W B;  3VYS B;  1W7P A;  4O6J A;  2W1O A;  4FQG A;  2H27 A;  2IS6 A;  1I3Q J;  5TGT A;  1HKT A;  1ZG3 A;  3HBL A;  2Y48 A;  5E20 A;  3IUO A;  2XKO A;  2Y30 A;  3ESW B;  2K9S A;  1R5H A;  3QOP A;  3G6E I;  1RET A;  3JRA A;  3RKQ A;  5FLX Z;  4N4O B;  2CUZ A;  3E5U A;  2AXT C;  4HBL A;  3KZY A;  3E6C C;  2A6T A;  2P8T A;  3OSF A;  5CLS A;  4IO9 F;  2CQK A;  2BXY A;  4N9H A;  4GFB A;  3GO5 A;  3OOP A;  2KIS A;  4B3A A;  3J7Z I;  3GVA A;  5HOD A;  3E7Q A;  2YU9 J;  2GA2 A;  3PUF A;  2EZL A;  2B63 J;  3GWZ A;  3BQZ A;  3QU3 A;  3WGG A;  1ZEL A;  2DPU A;  3CCE I;  2WB1 N;  2ECC A;  2DDA A;  3VPR A;  2KZG A;  3FHZ A;  3CCV I;  3MVP A;  1HW1 A;  2NAZ A;  4FT8 A;  4LJZ F;  4NQW B;  1PUF A;  5ICC A;  4OMY A;  1IXC A;  2EQR A;  3NQO A;  4BAC A;  1JUP A;  2ELH A;  4XLP F;  1XDU A;  4DIQ A;  1B9M A;  5EF6 A;  3NEU A;  2IVM A;  3H3Z A;  3LSI A;  5K7F A;  2QSF X;  2R5Y A;  2KQR A;  1YRN A;  1HQC A;  2DLL A;  2F48 A;  1I3A A;  3CF5 F;  2EZI A;  3BG9 A;  5FGM A;  2WGB A;  4FIS A;  2OCE A;  3ZMT A;  2CFO A;  4NC6 A;  1IW7 F;  2R7F A;  3C7J A;  3SDB A;  2XAJ A;  1KU7 A;  3I0T A;  3LSP A;  1OQY A;  2ZCW A;  4JBA A;  2L02 A;  4DYC A;  2JA8 J;  3SFI A;  1BOA A;  3GEU A;  1SC7 A;  5JHU A;  3CP8 A;  2ESH A;  5JR3 A;  3J7A Y;  2XPW A;  1X1P A;  2R7W A;  1BC8 C;  1OYY A;  2QLZ A;  2E2I J;  3BNI A;  2DA1 A;  2MYS A;  1VQO I;  1LJ9 A;  2MLK A;  4PGH A;  4LG3 A;  5FKK A;  2LBF B;  1FOW A;  3LA2 A;  1C0W A;  3VW0 A;  4BE1 A;  4B48 A;  2EIM H;  3LQR A;  3I54 A;  3KP3 A;  3AQS A;  2DTZ A;  3K6G A;  4LGW A;  5F0F A;  3ZXS A;  3DEU A;  1O3R A;  4MQV A;  1QRY A;  1UEL B;  1WVR A;  6PAX A;  1GLN A;  2BW3 A;  2Z1D A;  2JT1 A;  1UI5 A;  2Y9Z A;  1HKS A;  3JSP A;  2C6Y A;  1MJA A;  4U7B A;  2FEZ A;  2EJR A;  1ZTR A;  1S7E A;  2M9H A;  3RQ4 A;  4BHC A;  2E1N A;  4ZTF A;  4BAY A;  2FF4 A;  3GTL J;  2L2O A;  2NOJ B;  2X1E A;  1OCR H;  5KAF C;  3JAM Z;  5C3E J;  4J01 A;  2PMH A;  5F08 A;  2ZJR F;  1FWZ A;  1I1S A;  2DTR A;  1DGR M;  4G94 A;  1VQ8 I;  5H9T A;  1MW7 A;  2G9W A;  4HNV A;  2UXH A;  3BCB A;  4ESF A;  3PQJ A;  1YO5 C;  2OQG A;  1UCR A;  4G6D A;  4I76 A;  3K8P C;  3AQT A;  3O8G A;  2BE5 F;  2JA2 A;  1XB4 A;  4PFO A;  4RAF A;  1WHU A;  2AXL A;  4I0A A;  1SFO J;  1MDM A;  3ZQC A;  4OOI A;  2CGP A;  3FXR A;  1G3Y A;  3U9G A;  2VXZ A;  4L5E A;  5DD8 A;  4G8X A;  1ETO A;  4ZYE A;  2E36 A;  1P4W A;  1U5T C;  5CVU A;  2ZJP F;  3W2A A;  5F27 A;  2MH9 A;  1V54 H;  2FU4 A;  4JYK A;  5DDG A;  1W36 C;  1ZG5 A;  1DPU A;  1GVJ A;  2X6Y A;  4MNU A;  1RKT A;  4D5F A;  1PVE A;  2IGK A;  2A69 F;  4BQO A;  3I55 I;  1FPQ A;  1BW5 A;  1SFE A;  2OD5 A;  2M5W A;  4XNF A;  4RB0 A;  3QWL A;  3ZMV A;  2PFV A;  1WI9 A;  5A2Q Z;  2ZCX A;  4II3 A;  3KNW A;  1LVK A;  2A5W A;  4HF0 A;  1R49 A;  1ZRE A;  4IHT A;  3DKX A;  4EGY A;  1BR4 A;  4YFK F;  2EZK A;  4XKV A;  5HS9 A;  5E3M A;  2HTS A;  3VSL A;  3F0C A;  1B8I B;  2KMU A;  4UUS B;  2F4O B;  5DUI A;  1ZAO A;  4RGX A;  2XF5 A;  3DKW A;  4HLX A;  3FMS A;  4ITV A;  5D4S A;  4ETS A;  2AQE A;  2A6H F;  2K86 A;  2M8G X;  4MHG A;  3A2K A;  3P5J A;  2MA3 A;  2M0C A;  4UV9 A;  3DPT A;  4UUS A;  2EB7 A;  3ANG A;  1JHH A;  1B59 A;  3SZG A;  3WTT C;  4OAY A;  3M8F A;  2FBI A;  2NS0 A;  1X1A A;  5KK1 A;  1OIS A;  2IEK A;  2ME0 A;  2LVS A;  3V8J A;  5IPA A;  4ENK A;  3ZQQ A;  2M34 A;  5FLX K;  1FP2 A;  2HTJ A;  2FML A;  3EUH A;  3IHU A;  3F72 A;  3Q9V A;  3RSN A;  3OYJ A;  3PO2 J;  4OMZ A;  4YZE A;  4V19 K;  1ORK A;  4GO1 A;  3OIP A;  2M7B A;  1RIO H;  1X1D A;  4PSW A;  3HRU A;  3HPG A;  4RAY A;  1XGS A;  4PFP A;  3W2V A;  1U78 A;  5A2Q K;  3BC8 A;  3IWZ A;  1B1B A;  3ABK H;  2QZ8 A;  1B72 A;  2BY0 A;  4BQQ A;  2NOG A;  4CIC A;  5F1R A;  4A3E J;  1JJ8 C;  1JKP C;  4BL0 B;  1MH4 A;  5IYD J;  5GAH J;  2X48 A;  2UV1 A;  1MJ9 A;  1R5I D;  1WJD A;  4BUP A;  2O03 A;  3LMM A;  3CDI A;  4J00 A;  4PXI A;  5FD5 A;  2PFB A;  2GM4 A;  2GOX B;  2JA5 J;  1P6R A;  3F22 A;  2QM3 A;  2V1U A;  1IXS B;  2KIQ A;  2DFI A;  2ELK A;  2ZNY A;  2MW8 A;  3K1P A;  2LOO A;  2IS2 A;  4A2U A;  4LIV A;  3U1D A;  3S17 J;  3UNG C;  1U8B A;  2I10 A;  4XOT A;  2XRL A;  5EZH A;  2XDV A;  2KDZ A;  2LRD A;  1QGP A;  2TCT A;  2LK2 A;  2ZFW A;  2HDW A;  1YTY A;  2QOP A;  5ILS A;  1JT6 A;  4AIK A;  1TP4 A;  2JA6 J;  1ETY A;  1W36 D;  4CSW A;  1JKO C;  3KLO A;  2ZXJ A;  3BR6 A;  4KWA A;  2LSO A;  1WGX A;  2PMU A;  3CQZ J;  2YVE A;  2KJC A;  2IS4 A;  2RQQ A;  3E6B A;  2BVM A;  5EG0 A;  3WTW C;  4O3M A;  2M1B A;  5HVQ C;  1GDT A;  4UXN A;  2J5P A;  3CJT B;  5DV5 A;  3SDG A;  4J19 A;  3I5U A;  3J7Y J;  2ZXI A;  4IJA A;  2DJI A;  1JUS A;  3C07 A;  2VBZ A;  1IC8 A;  4V2G A;  4FE4 A;  3DU5 A;  2L0K A;  1YQA A;  3ZOB A;  1LFP A;  5DM7 F;  1YOV B;  4NC8 A;  1A6Q A;  2PJR B;  5L3D A;  1RR8 C;  1KQ8 A;  3C3W A;  3BWG A;  3BP8 A;  2KRF A;  3D5R C;  3HHH A;  2KT0 A;  2OV7 A;  1MD0 A;  3FWE A;  3T8T A;  4HV6 A;  2FNP A;  2UXO A;  3COL A;  1WJB A;  2PJR A;  1RES A;  2ID3 A;  4DBR A;  4E7K A;  5LFA A;  5D8L B;  3KKD A;  1OCZ H;  1G3W A;  3SYT A;  1W5S A;  3C1D A;  4EJO A;  2FNA A;  4ABZ A;  1HC8 A;  3CO6 C;  2JA7 J;  1P9Q C;  1UB9 A;  2A68 F;  3ERE D;  2ZSH B;  1WJ5 A;  2JVH A;  3GX4 X;  1HDD C;  3TDZ C;  4A0X A;  4AIH A;  3LST A;  3FHN A;  4WXC A;  2GAU A;  3F3X A;  2H6B A;  1MMD A;  2QQ9 A;  1Y1W J;  3RPU A;  3OYF A;  4G7Z F;  1HW2 A;  5E18 F;  1E17 A;  3J81 Z;  2MBF A;  1WJF A;  3K4C A;  4RGR A;  3CDH A;  3DP7 A;  5K7H A;  5KNL A;  1POG A;  4KT6 A;  4B09 A;  4ZDO A;  4GRI A;  3LSG A;  3OV8 A;  3KP5 A;  2L9N A;  4IL6 C;  3OYA A;  4I02 A;  4IHW A;  1T2K A;  2XSJ C;  4M3E A;  3ONQ A;  1K6Y A;  1DU6 A;  3D0S A;  4YII A;  3TOB A;  4L0Y B;  2XF7 A;  5TJJ A;  3H1C A;  2R4G A;  3LQQ A;  5BOX A;  2PX9 A;  1VQ6 I;  4HW0 A;  1W7P B;  5LEK A;  1G3S A;  2CH0 A;  4BEH A;  3MZH A;  1A04 A;  5CYV A;  4YG2 F;  2COB A;  4I7H A;  1N77 A;  1ERD A;  2XSD C;  3GYH X;  3LJL A;  2HYF A;  3HKZ N;  3DCF A;  3EDP A;  3EUH C;  3OSG A;  5KVR A;  1JGG A;  2EK5 A;  1U2W A;  2ZOY A;  2ZNZ A;  5LLQ A;  5HAW A;  2FE3 A;  1ZR4 A;  3FBN B;  1MDM B;  3E3V A;  2QWW A;  2B0L A;  1QU3 A;  1ONV A;  1Z6T A;  3Q0U A;  4BKX A;  1J0R A;  4X6A J;  3O3K A;  3QPL A;  2MLG A;  2JQ7 A;  2JPC A;  4Y15 A;  3EYY A;  2R5Z A;  3BRO A;  4GXO A;  2DJN A;  2AS5 F;  1XDS A;  2JWT A;  2DW4 A;  2HNH A;  2DA7 A;  4OD4 A;  4E6K G;  1OFC X;  2OZ6 A;  5FRO A;  4KIF A;  1Y0N A;  2XPU A;  3BJB A;  2HXI A;  3RD3 A;  1GUU A;  1F43 A;  2A07 F;  2L7K A;  2YUS A;  4WF2 A;  4A3F J;  2W57 A;  3ULQ B;  2GBY A;  3FXJ A;  1G59 A;  4EEF G;  1QZZ A;  3MZY A;  3CES A;  2KJB A;  4B1R A;  2XVC A;  2R7T A;  3GTG J;  4M9Z A;  2D1H A;  4GFK A;  1MBH A;  4X1E A;  2Q2E A;  4DZP A;  5BPD A;  4HX8 A;  4F55 A;  2GEN A;  4R8H A;  3BR2 A;  1EH6 A;  5KAI C;  4JP0 A;  2V57 A;  4BE0 A;  2K3P A;  2M87 A;  2W53 A;  2YSR A;  3BTL A;  5LEJ A;  4MGR A;  3ZMZ A;  3B6A A;  1R4N B;  1H9G A;  4HRI A;  1LDD A;  1QVU A;  2F4I A;  2V6E A;  2ISZ A;  1U0J A;  4ZYH A;  4Y17 A;  5JI6 A;  2IPQ X;  3HM5 A;  3HOW J;  2XAS A;  1D8K A;  4A3M J;  2XGE A;  2R7V A;  4YEJ A;  2VAS A;  5E8G A;  3V4G A;  5J8C A;  3AG4 H;  2CWE A;  1JE8 A;  4DYQ A;  1XGN A;  5L3G A;  3OS0 A;  1O4X A;  2LF8 A;  3HRT A;  3DPU A;  1WWX A;  1ZHF A;  1F5T A;  3DPJ A;  2ZC2 A;  3BPV A;  4A93 J;  3CCU I;  1JKR C;  1MIJ A;  4L5J A;  1OCP A;  4U0Y A;  2HPI A;  1BC7 C;  4NN1 A;  1YE9 A;  2VKH A;  4HST A;  2FBH A;  1XMA A;  3NAU A;  2VI6 A;  2JTV A;  4ZTJ A;  2DI3 A;  2K4J A;  3K4N A;  3QYE A;  4MK6 A;  1FMW A;  3ELK A;  2OJE D;  1FMV A;  4ZYD A;  4HDV A;  2K9M A;  3WU0 A;  3DEW A;  3CO7 C;  5DD4 A;  4FX4 A;  1ULY A;  1XTA A;  4Z6Y A;  3RZO J;  2IXS A;  2QVO A;  3GLX A;  3WE2 A;  4UVC A;  3VP5 A;  1FBS A;  4XRM A;  4A69 C;  4A3K J;  3BR5 A;  4M3D A;  4ESB A;  1W7P D;  3WHC A;  3OYE A;  2F6C A;  3OYL A;  4U9L A;  2FX0 A;  2FA5 A;  3PNV A;  1JI8 A;  1K4T A;  5KHD A;  4CYD A;  1WFX A;  1S9H A;  5BQT A;  2V9P A;  5DM6 F;  3K1M A;  4D0P A;  1IDY A;  3FM5 A;  5F64 A;  5IP9 J;  4M6V A;  1YHQ I;  2MC3 A;  2OC6 A;  2GXB A;  2V6C A;  2HXO A;  2G7L A;  5JFR A;  1D0Y A;  5GPA A;  2DA2 A;  3VB2 A;  3EUA A;  2QKM B;  1WRJ A;  2CV1 A;  3SXY A;  3K7A J;  2E7W A;  5DYM A;  3CJN A;  2HDC A;  1G2H A;  2IAI A;  2VBY A;  5E79 C;  3DLL F;  1MBG A;  2XHK A;  2HVQ A;  4S0H B;  1QA6 A;  2FJ1 A;  3FXM A;  3L2V A;  3P9T A;  2X85 A;  3M7G A;  4EVI A;  1BM9 A;  3GEZ A;  1EV7 A;  4IHY A;  4B8X A;  1DU0 A;  1N75 A;  2E2H J;  3F8C A;  2Z9O A;  3CCL I;  3RQI A;  3IH2 A;  3OWT A;  1IDZ A;  1QVT A;  3FK7 A;  4BGD A;  3IRQ A;  2F5D A;  3GME A;  3MKW B;  2F5C A;  2BVL A;  2K7L A;  5JVG F;  4A12 A;  4CHU A;  3AG3 H;  2FRH A;  3M3Y J;  2DG8 A;  3S1N J;  2R5Y B;  5JLW A;  3HOX J;  1TQM A;  5E1W A;  1UMQ A;  2DFH A;  2GWR A;  1HXD A;  5J40 A;  1VQ9 I;  2O9L A;  2YVH A;  2Z5U A;  2ID6 A;  2CQ7 A;  2VC0 A;  4FCY A;  3OYN A;  2P5V A;  3C2G A;  1Z7U A;  2L7M P;  1N25 A;  5FKN A;  1J59 A;  2GLO A;  3BQY A;  3ZP5 A;  3HG9 A;  1YS7 A;  4UNO A;  4OAZ A;  4IRG A;  3H92 A;  3CJD A;  4WWC A;  4IRV A;  3G2B A;  2FQ4 A;  1DP3 A;  1JT0 A;  2LTP A;  3BZK A;  3HSF A;  2DT6 A;  2Y31 A;  1AA7 A;  4M3G A;  3O60 A;  2HQ5 A;  1S7A A;  3CUQ C;  4F7Z A;  2G3B A;  5FJ8 J;  1IRX A;  4PJM A;  1S6L A;  2VQL A;  3QU6 A;  2NVQ J;  3VDX A;  1X19 A;  3QRF F;  1N78 A;  4XBF A;  2J5O A;  4GYG A;  1LKX A;  1FTZ A;  1WQ2 A;  1NHA A;  5LGN A;  2R93 J;  3ZN0 A;  3OYG A;  3MD2 A;  4D5C A;  5J1R A;  2YVX A;  5IT9 K;  1M1E B;  3PSI A;  5D5V B;  4A3C J;  2LF7 A;  4LFU A;  1SD6 A;  1Z0X A;  2IS1 A;  2FBQ A;  2PBX A;  4KNY A;  4BY7 J;  4L62 A;  5E17 F;  3JRE A;  3WE3 A;  1W1W E;  5EEH A;  4MQ9 F;  3H3V K;  4EM1 A;  4C2M A;  1KYW A;  1ZAR A;  5C44 J;  4HF1 A;  2I8D A;  3OOU A;  4YIF A;  3WGH A;  3UR3 C;  3UKG A;  4GGG A;  3MKY B;  3HHG A;  4HX7 A;  2UWM A;  1S8N A;  2GXG A;  5H20 A;  2DT7 B;  4IF4 A;  2VOP A;  1SEU A;  1FOK A;  3ZGK A;  2CO5 A;  1BR1 A;  1R6R A;  5D6E A;  1K6O A;  5GAG J;  3WOD F;  2CYY A;  1O3S A;  2KIU A;  2JSP A;  2LRE A;  1MBF A;  3W2W A;  2A5Y B;  1DDN A;  1BOB A;  4AU7 A;  4MTE A;  4G6Q A;  3IV5 A;  3I59 B;  3C2H A;  1AOY A;  1XGO A;  3VYT B;  5IOZ A;  2ZXH A;  2DOF A;  3PUB A;  3OIQ A;  5D8K B;  4ESJ A;  4UVA A;  1XSX A;  2KZV A;  1V5F A;  2FOK A;  3DEE A;  5LHG A;  3E1S A;  2EPF A;  3GFL A;  4DGW B;  1T08 B;  2UXP A;  2D6Y A;  2B3W A;  2E1M B;  3CLQ A;  2XRN A;  4FAS D;  3ECO A;  2CW7 A;  4YIR X;  1AWC A;  4ZDP A;  1ZRD A;  3FZV A;  4A3L J;  1KGS A;  1UHM A;  2P6T A;  3EYI A;  2K9Q A;  2HKX A;  4DBQ A;  3OYK A;  3A01 A;  2F4M B;  3HTJ A;  3N97 A;  2O5R A;  3OYD A;  3GZI A;  1LNW A;  3WG7 H;  2HOA A;  1ZKG A;  3DTK A;  3T5X A;  2LY1 A;  3WU2 C;  2K02 A;  4DVY P;  1OR7 A;  1EF4 A;  2OA4 A;  3L2C A;  2WAF A;  2VQC A;  1OLT A;  3R0J A;  1ZG1 A;  3IUV A;  5ICG A;  3KP6 A;  1IAW A;  1FBQ A;  3WTZ A;  4BH9 A;  1LB2 A;  5CXI A;  4DQ2 A;  4A0Y A;  1YW8 A;  4U0W A;  5EZG A;  4A3D J;  1XMK A;  2CS3 A;  3ZR8 X;  1KU3 A;  1LFU P;  2O8X A;  1ON2 A;  1TW3 A;  5L3C A;  3ERM A;  4PJN A;  4OIQ F;  5HBU A;  3RTR A;  2NS8 A;  1T56 A;  3S16 J;  1WJA A;  3S3O A;  4CXF A;  1ETQ A;  2RQP A;  1QHG A;  2VQG A;  4YFX F;  3S8P A;  4WIB A;  2DAO A;  3JRC A;  4AYB A;  5LHH A;  2X6X A;  3NXC A;  2MAB A;  2V79 A;  4A0Z A;  4DW6 A;  3ZN1 A;  3COA C;  3H9J A;  2STT A;  4JNN A;  2K3F A;  3VYU B;  4BBS J;  2ICW G;  3HOT A;  4IHS A;  5K7Z A;  1T95 A;  3BTC A;  4HPQ A;  1VQK I;  3GZ5 A;  3FM3 A;  3F8N A;  2QKL B;  3KKC A;  1X1C A;  2EFN A;  4Q5S F;  3G56 A;  2QQ8 A;  5D19 A;  3C2B A;  1HA8 A;  5LGU A;  5HLG A;  2X0L A;  1T0F C;  5DCF A;  3EUP A;  4G12 A;  3U1K A;  2E2J J;  5ILV A;  5HDN A;  4JX6 A;  2H1K A;  5H2F C;  1IGN A;  4HF2 A;  2ZME C;  3ANP A;  3KEO A;  5D4R A;  3WTY C;  2BY1 A;  1G6N A;  2A3S A;  2L54 A;  1VZ0 A;  4AVP A;  2ADU A;  3MAJ A;  5E3O A;  1Q1V A;  2W25 A;  3ASO H;  1T6S A;  5GP9 A;  1QO0 D;  1Z91 A;  5IY5 H;  3DXJ F;  3VOD A;  2X4H A;  5FFZ A;  2LKS A;  2UXU A;  5CJ9 A;  1R7J A;  2Y0S A;  1A36 A;  3DBH B;  4YEL A;  1S5L C;  3RYR A;  1AKH B;  4BU2 A;  2D1V A;  4CUG A;  1LDJ A;  1Y6I A;  2Y69 H;  3QYB A;  3JR9 A;  3VOE A;  3L2Q A;  1LE8 A;  2HR3 A;  4A5N A;  4MFE A;  3A0H C;  3ROU A;  2DYS H;  2GXA A;  4NC7 A;  4F93 B;  2DPD A;  3B02 A;  3HGG A;  3ZQF A;  3SZP A;  4YRV A;  2VKD A;  5LBQ A;  3QAH A;  2QGU A;  3OS1 A;  3M4O J;  2X51 A;  4KIC A;  4LLL A;  2F5E A;  2JUC A;  2R92 J;  4XMY A;  4B47 A;  5J8F A;  3BY6 A;  2RVC A;  1A5J A;  2E1O A;  4BYY A;  2JN6 A;  4LG0 A;  4EV0 A;  2LKX A;  4G7O F;  3G7R A;  3OYH A;  2RNG A;  4FTH A;  2FOW A;  2DOA A;  2ESN A;  2WTE A;  1GXP A;  2ISY A;  2VJ5 A;  4BS9 A;  2R7X A;  3S5R A;  3FF5 A;  4JQF A;  3RDI A;  1YJW I;  4IZZ A;  3HDD A;  1K7A A;  4EMS A;  1IO2 A;  1RC9 A;  2O61 A;  3ZMU A;  1KON A;  3KX2 A;  2CFX A;  3I56 I;  4ICH A;  4QPO A;  4XM3 A;  1FY7 A;  5HLT A;  1WKM A;  3SQN A;  3BG5 A;  1CGP A;  4KIB A;  1ZK8 A;  2EV5 A;  2FUG 2;  2Y0M A;  4U88 A;  5AQC A;  5IOY A;  1CQT A;  2H8R A;  4UHT A;  3MKZ A;  2Q1Z B;  3DTI A;  3GFJ A;  2XIG A;  1KQ9 A;  2JUG A;  4IQ4 A;  3LA3 A;  3ZRG A;  4RS8 A;  1TQP A;  2I5U A;  4FE7 A;  3K2Z A;  3HOY J;  2VN2 A;  4L0Z B;  1MH3 A;  4PUS A;  3P9I A;  3R4K A;  2KIM A;  3N4M A;  3H35 A;  2HDD A;  2CJJ A;  2VT3 A;  5H6R A;  3OYB A;  3VOX A;  4S05 A;  1ZRC A;  4IHV A;  1FZP B;  1JJ6 C;  3ASN H;  1ENH A;  3K4J A;  2VPL A;  1IN6 A;  2LMD A;  4C3H J;  4KMF A;  3IH3 A;  1X2N A;  5ERI A;  3IRR A;  4NQW A;  2NXN B;  3AFH A;  3HKZ A;  2LYC A;  3KEY A;  2H6C A;  2HS5 A;  3E7L A;  1MGT A;  3KP7 A;  3CCS I;  1WI3 A;  3DLA A;  4ZZL A;  2UXX A;  1UJ8 A;  2IGM A;  4UB6 C;  2K40 A;  4LLN A;  2F07 A;  3OR1 C;  4RB2 C;  1HBX G;  3LAP A;  2QF7 A;  3RJP A;  3SJM A;  4RAZ A;  4MTD A;  1W0T A;  2HVR A;  4KIG A;  4BNC A;  2E1C A;  2KRH A;  4CCJ A;  5E1X A;  3CDL A;  4BDY A;  3F6V A;  1TT0 A;  2QUF A;  2DBB A;  1DP7 P;  2IRF G;  2OTL I;  3J7A O;  3LOC A;  3B81 A;  3MWM A;  1Z21 A;  3ZMS A;  4DOZ A;  1U6G A;  3SEZ A;  4LK0 F;  1R9T J;  2VE8 A;  2VC1 A;  2QSH X;  5FD6 A;  1MKM A;  1VQ7 I;  1I27 A;  3GXO A;  1ODD A;  2ECB A;  3QYF A;  1PDN C;  1HST A;  4LB6 B;  5C4J J;  3TP0 A;  2BXZ A;  3RKW A;  4OWR B;  2EFQ A;  5FKM A;  4Q47 A;  3ABT A;  2DA3 A;  3CP2 A;  1OYI A;  1TWA J;  4QTR A;  4P96 A;  1X3W B;  2CW8 A;  3KPH A;  3HUG B;  2CQN A;  3DBL B;  1YIT I;  3OL4 A;  3I59 A;  2HYG D;  4BJ5 C;  2K85 A;  5FLM J;  2LLK A;  1K78 A;  5KCM A;  4C2T A;  1W0U A;  1KU9 A;  5CVV A;  4HV5 A;  2JVG A;  1KA8 A;  4PJJ A;  4C2U A;  4ASN A;  4M3B A;  5E3N A;  3HIM A;  5K58 A;  2KFD A;  5HSZ A;  3BPX A;  4U7D A;  3HUG A;  3H9Q A;  4ZDL A;  4GCV A;  5D6F A;  1RRJ A;  1IN7 A;  5J1U A;  2EFW A;  1YRN B;  4MEY F;  3BRU A;  1IG7 A;  2B1E A;  1Z3Y A;  2DQR A;  1TNT A;  3L7W A;  4W1U A;  1IXR C;  3BJA A;  2DXI A;  4XSZ F;  4RB3 C;  3AKZ A;  2DCE A;  2TRT A;  1DGW Y;  2AO9 A;  2E1M C;  3D1N I;  2VOD A;  2A2F X;  4GFL A;  2NP5 A;  1ZN2 A;  2Z16 A;  3LSJ A;  5TIS C;  3CCY A;  4KYW A;  2NRA C;  3K4B A;  2DMP A;  2GIV A;  2NVT J;  1E3P A;  1USS A;  1PP8 F;  2KP6 A;  3QOD A;  3KP4 A;  1OMI A;  3PFI A;  1TL8 A;  4L18 B;  3CUQ B;  3FXQ A;  3HSE A;  2PI0 A;  2YR2 A;  3S2D J;  3BTJ A;  3CTA A;  5E8I A;  1U3E M;  3FKJ A;  3GCM A;  4HKU A;  2NP3 A;  1SVM A;  3WTV C;  3V78 A;  5CVR A;  4NEL A;  5CVJ A;  2VXD A;  1GV2 A;  1STZ A;  1JKQ C;  3BZ6 A;  3KYL A;  1L3L A;  3ZCO A;  2WWY A;  3BT9 A;  9ANT A;  3H5A A;  3V42 A;  1BL0 A;  3MN2 A;  3DQV C;  2EFO A;  4JOM A;  3X2Q H;  2BY2 A;  3GTJ J;  2D2W A;  2DK8 A;  3OMY A;  5B3S H;  2COM A;  3PO3 J;  2LY2 A;  2ZCN A;  3GTO J;  3JRF A;  1BI2 A;  5J4V A;  2H94 A;  2FD5 A;  2OZU A;  2F2E A;  2WAQ A;  3K9T A;  1XD7 A;  4JL3 A;  2BZT A;  1K61 A;  3OYI A;  4C3I J;  2K9N A;  2XAQ A;  1TLH B;  4XRF A;  4CH7 A;  1TBX A;  4IKF A;  1FTT A;  4CCN A;  3BLY A;  2VJJ A;  4Y52 J;  1HF0 A;  1OCO H;  4AF5 A;  2DMN A;  1BA5 A;  3TQN A;  2X1D A;  1J5Y A;  3KYD B;  3G71 I;  4KA4 A;  3O2P E;  1B8I A;  3K70 D;  1RUO A;  3Q9S A;  2V7F A;  4ZZD A;  4PK4 A;  3RH2 A;  1RPW A;  5J3L A;  4FX0 A;  4UY8 I;  3CC2 I;  4M6Y A;  4AD9 A;  4RGU A;  5ICE A;  1J2X A;  4NHJ A;  5F0H A;  1XX5 A;  3LL7 A;  1VF9 A;  3CJR B;  3EUK L;  5K5Q A;  4LIU A;  1P92 A;  1FSE A;  2CW0 F;  2HI3 A;  1YFH A;  3NNR A;  3IL2 A;  2DQL A;  2IT0 A;  4HZF A;  3RYP A;  3HGY A;  1UZC A;  1AU7 A;  4BQN A;  2ELJ A;  5M5X J;  3RPU D;  4ZJZ A;  3PPB A;  2L9R A;  4O5V A;  3LWJ A;  2CV0 A;  1H88 C;  2A6E F;  3TO6 A;  2NYX A;  3E97 A;  3IWF A;  3FKI J;  3H3U A;  1HKQ A;  2KIF A;  4BDZ A;  2G0E A;  3A03 A;  3I3L A;  4CGZ A;  1FIA A;  3K10 A;  1FLI A;  2IA1 A;  4L9T A;  4XLA A;  4XL9 A;  1YS6 A;  4ZYA A;  1SMY F;  2N8G A;  2PMZ N;  2XGC A;  1T39 A;  3QBM A;  2OAZ A;  3VVY A;  3PNY A;  4H4K C;  1ZGA A;  3CCJ I;  3HTS B;  4EM0 B;  3A01 B;  3BCG A;  1R36 A;  3M07 A;  1FNN A;  1UFM A;  1R1V A;  2XAG A;  3B73 A;  2ZOZ A;  4V2F A;  4HDU A;  3M1C A;  4XRS G;  1MBE A;  2MH2 A;  2IP2 A;  2ZO4 A;  3DV8 A;  4G7H F;  3S15 J;  3T6N A;  1Y0U A;  2HKU A;  3ABM H;  5GTH C;  4A6D A;  1BIA A;  1DPR A;  3PAS A;  4II2 A;  4OIO F;  2W24 A;  3E5Q A;  4EJV A;  2RDP A;  2YPR A;  3LFU A;  3LA7 A;  3P9C A;  3OR2 C;  4EGZ A;  3LNQ A;  1YIJ I;  1IV6 A;  5DCM B;  4P9U A;  5J6X A;  2RGV A;  2K4B A;  3LWF A;  1E3O C;  1W5T A;  1KZH A;  1IN8 A;  1Y8R B;  2JZY A;  1RI7 A;  4LOC A;  1V55 H;  3HYI A;  3QP6 A;  4XR6 A;  4A3B J;  4MLO A;  2JJ7 A;  1QZY A;  4MIM A;  3TMO A;  3S32 A;  1E3H A;  3VEP A;  3PJR A;  2CRG A;  3MQ0 A;  3BJO A;  3FIW A;  2DMT A;  2UXN A;  2M30 A;  5M3F J;  3CME I;  4UDS A;  3SEQ A;  3HPH A;  2DOD A;  1LE8 B;  1TTY A;  4CCM A;  2R0Q C;  3V7S A;  3WU1 B;  4D1Q A;  2L3D A;  3QPH A;  5IYC J;  2L9S A;  1D8J A;  2XAU A;  1EH7 A;  4IXA A;  3JTG A;  4BXX J;  1QPM A;  3FMQ A;  3O6B B;  5E1Z B;  4BXU A;  4MFD A;  2BV6 A;  4GCK A;  2FSW A;  2X9D A;  2G7H A;  4XLC A;  3T0Y A;  3ABL H;  3TW6 A;  5B66 C;  2E7X A;  4HAM A;  4B43 A;  5HS7 A;  4EJT A;  3DF8 A;  2XGD A;  1IRZ A;  4NBQ A;  4OU0 A;  3S14 J;  2Y2Z A;  2RNJ A;  2KHM A;  5HNH A;  3LSH A;  5LRR A;  3R0A A;  2IBD A;  5K1Y A;  2KDO A;  3KFW X;  3TGN A;  1GHC A;  5EYR A;  3CRJ A;  2REK A;  3GBG A;  5EFY A;  3ON2 A;  4HQE A;  4DYR A;  4PDK A;  3WHB A;  4WCG A;  1T33 A;  3BR0 A;  3FX3 A;  3HTH A;  2R5Z B;  3MNL A;  3HRS A;  4I0B A;  5CVI A;  5J1Y A;  1LEB A;  2IGN A;  3PFY A;  5C4X J;  5HLI A;  2HPM A;  2LH9 A;  2Q0O A;  2V1X A;  3KZI C;  1AKH A;  3K0L A;  1YLF A;  1A35 A;  3HOS A;  3NWS A;  2ZY9 A;  1B9N A;  2VKE A;  2FBK A;  2O8K A;  4ENJ A;  1HOM A;  3J81 K;  3JSJ A;  1MNE A;  4N0B A;  3S1M J;  4IX7 A;  1FOX A;  1YW7 A;  2A61 A;  2EFP A;  4U87 A;  2ZJ2 A;  5FKO A;  4XON A;  1PUF B;  2GOM A;  1SAN A;  2M8E A;  1EH8 A;  3FXU A;  4RM2 A;  3RKY A;  1S3J A;  5CKT A;  4RGS A;  5HDK A;  4I98 B;  3F23 A;  2MD0 A;  2LFB A;  1ZR2 A;  3GTK J;  1EKE A;  1RZ4 A;  3ISP A;  4CCL A;  3BHQ A;  4BEH B;  5ICF A;  5IYB J;  3F8B A;  2LC2 A;  1Z3X A;  4XLE A;  5D5U B;  2W7N A;  1I6X A;  1X4O A;  2L5Q A;  1VTN C;  2PLY A;  4RA2 A;  1IRG A;  3KET A;  1J9I A;  3S3N A;  1FYL A;  2JRT A;  1P7I A;  3GUD A;  4AYB N;  2O0Y A;  1ETV A;  2EH3 A;  1REP C;  2OCC H;  1I39 A;  3S1Q J;  4EQQ A;  1V4R A;  2GFN A;  4F52 A;  1Z1D A;  2ZBK A;  3V8L A;  1Y56 A;  1FOY A;  3CUQ A;  2CUF A;  1HDP A;  5IT3 A;  1MBJ A;  4LD5 A;  1P2F A;  5F0C A;  1IN4 A;  2UUZ A;  2RAE A;  2LDU A;  1MMA A;  1FX7 A;  2Q8K A;  1TT5 B;  3HXL A;  3J80 K;  2HEO A;  4UB8 C;  2F5F A;  3C18 A;  4E4H A;  2BHY A;  1SFU A;  3JRG A;  2OI8 A;  3AG1 H;  4XRS A;  3WTU C;  4EAT A;  2XAH A;  2PJP A;  2LBF A;  1BJZ A;  4RAG A;  2FJI 1;  2GIZ A;  2E35 A;  2H1L A;  2QQB A;  3K4M A;  2ME6 A;  2WC2 A;  1UST A;  2OTJ I;  5FGL A;  4I99 C;  4HLY A;  3ZQH A;  4RBO A;  3OS2 A;  1GVD A;  2OPT A;  1OCT C;  2K5C A;  1MBK A;  3FXK A;  3VWB A;  2BW3 B;  4LB5 A;  1OCC H;  4ON0 A;  5FHP A;  2P7V B;  1ETW A;  4IVN A;  3V6G A;  3GLL A;  4M3F A;  1KYZ A;  4ZC3 A;  1XGM A;  2Q2E B;  4AID A;  2LR8 A;  3E6D A;  4U0V A;  1FT9 A;  1S29 A;  2BY3 A;  3ECH A;  4P1W A;  4UUT A;  2LD5 A;  4ENN A;  3RZD J;  1ETX A;  2R7D A;  4N4N B;  3I53 A;  3S2W A;  3BCA A;  4KDP A;  2HGC A;  2P81 A;  1U5T A;  4QPQ A;  5FMP A;  4QLC U;  3QQA A;  3KLN A;  3F9K A;  2G7S A;  2TDX A;  1KU2 A;  2ZB9 A;  4AC0 A;  2O6G E;  2DT5 A;  4KN4 X;  3VYR B;  5CXG A;  4N9I A;  3ZQI A;  3A02 A;  3I64 A;  4Y7N J;  5CQE A;  1JHF A;  1O3T A;  2V9V A;  1TZL A;  3NWT A;  4PSX A;  1VQM I;  3IAM 2;  2P7C B;  1VQP I;  4KMU X;  4L9N A;  1LDK B;  4OIP F;  4L5I A;  3L1P A;  1LPQ A;  2L01 A;  1TW2 A;  2HWV A;  3PIP F;  1IN5 A;  4IEJ A;  3A0B C;  5E3L A;  1SFX A;  2PG4 A;  1Y8Q B;  3CMM A;  1QHH D;  1WJE A;  3M1E A;  2DFE A;  1ITY A;  1NK3 P;  3CCM I;  1O7L A;  3OL3 A;  3JRI A;  2NVY J;  2EZH A;  3H5N A;  3L9F A;  1Z6R A;  3GZN B;  3BZC A;  4HNU A;  1IJW C;  1J09 A;  3CZ6 A;  5LD2 C;  2DMQ A;  3CMY A;  4PJL A;  1YG2 A;  1MJB A;  1B6A A;  4BBR J;  4A3J J;  1P4X A;  2NVU B;  3R60 A;  4GYI A;  2XV4 S;  1GT0 C;  2ETH A;  2KLO A;  3EPZ A;  3JAM K;  1CF7 B;  2WAE A;  1VQ5 I;  2IGO A;  2QQA A;  3M9A A;  4L9V A;  1QBJ A;  5M5Y J;  1F1Z A;  2OU2 A;  4P5O A;  1PP7 U;  2VIX A;  2R7U A;  1IUF A;  2DO7 A;  2RC4 A;  2ZME B;  3I9V 2;  2DA4 A;  3GTM J;  2NX4 A;  3G1L A;  3DTE A;  4LLG F;  4UVB A;  3CCR I;  1A6I A;  3R6S A;  3ZMD A;  2BEO A;  1U9N A;  2ZME A;  3AL0 C;  1HW5 A;  2VLA A;  4UUV A;  4X0G A;  4M6X A;  1UG2 A;  4ACI A;  1HSJ A;  2DA5 A;  3LFK A;  2HOT A;  3JRH A;  1SFK A;  2RRE A;  3LSM A;  3S1R J;  3KCC A;  2V1N A;  4UV8 A;  1VI0 A;  4A5M A;  1P4A A;  3MZ8 A;  5EEA A;  2EIJ H;  2EV6 A;  2VPR A;  4D7N A;  4GDF A;  1D5Y A;  1BI0 A;  3HL2 A;  3HOU J;  3BG3 A;  3GFM A;  2NNN A;  1K79 A;  1RR7 A;  1H89 C;  1MZB A;  1D1C A;  3VTI A;  4XLH A;  4G9Y A;  3WG9 A;  3HEF A;  1SVL A;  1RUN A;  2PMZ A;  3GF2 A;  4BJT A;  3HOZ J;  3F8M A;  1E2X A;  3VW1 A;  3OYM A;  2WAQ N;  2M4K A;  4QWQ A;  3TOA A;  3MKL A;  3FXO A;  1SD5 A;  3HE0 A;  5D5X B;  3NRV A;  1BJA A;  1ZGJ A;  2LP0 A;  1HCR A;  1UI6 A;  3HOV J;  4E7L A;  3HRM A;  5CW8 A;  1F36 A;  4XKC A;  3M8E A;  3I4P A;  2MD5 A;  5FO5 A;  4D7M A;  4E7H A;  3EET A;  4S04 A;  3M8J A;  2D5V A;  1F4K A;  2EIL H;  3ZQ7 A;  3ON4 A;  3W6J B;  4IHX A;  1FJL A;  3QPS A;  5F6F A;  4XIC A;  1K78 B;  4NB5 A;  4A6E A;  2L7F P;  2FMY A;  4WX9 A;  4ME9 A;  1Q1H A;  2HQN A;  2O7O A;  4NNJ A;  3I58 A;  1X4P A;  3O8H A;  3D5S C;  4BJ6 C;  2M4G A;  2QSG X;  3DFG A;  4JX5 A;  4F3Q A;  4A3I J;  2D45 A;  2CU7 A;  4WK8 F;  1XCB A;  2HVS A;  4E7Z A;  3PM1 A;  2W82 A;  5GAD J;  5EG0 B;  3TBI A;  3VUQ A;  1G8X A;  1TWH J;  2P5L C;  1ZYR F;  1QQI A;  1Y1V J;  3OYC A;  2G7G A;  2Z3Y A;  4M74 A;  5D18 A;  1FIP A;  4MO7 A;  3GW2 A;  5TRD A;  4NUB A;  4AVZ A;  4DNC A;  1IUY A;  4YFN F;  5M3M J;  3BG7 A;  5B5E C;  3K2A A;  2OBP A;  1V5E A;  4I2O A;  3RPQ A;  1GXQ A;  1Z7L A;  2DMU A;  3B6C A;  3L2W A;  3H0G J;  2QIB A;  1G4D A;  3QP5 A;  5LRS A;  3G4S I;  1APL C;  1QZE A;  4RM3 A;  3CCQ I;  2E5Z A;  2GZW A;  5DTD A;  2EWN A;  4AWX B;  1IF1 A;  4C30 A;  4H0E A;  3DU6 A;  3EQL F;  3ML6 A;  3A1Y A;  2HYT A;  3V7R A;  1MMS A;  4XLN F;  3PQK A;  1BR2 A;  2HOE A;  1YW9 A;  1BW6 A;  1DQU A;  1V3F A;  1PYV A;  2R7Q A;  2Y0S N;  1K4S A;  5EEG A;  2L7Z A;  2W84 A;  2WV0 A;  3AAF A;  4M9S A;  1FC3 A;  4DJA A;  2QBY A;  3CD6 I;  1WPK A;  2MG4 A;  3PSF A;  3RIR A;  1NK2 P;  3F8F A;  2RHA A;  3G3Z A;  3JRD A;  4Q48 A;  1IZ1 A;  4WXH A;  1XSV A;  1NG6 A;  1EA3 A;  2VBX A;  2Q24 A;  2QBY B;  2VUM J;  2EA2 A;  3Q5F A;  4KN7 X;  4F92 B;  2YX7 A;  3MMY B;  5L3B A;  2HU9 A;  5HNF A;  3KEQ A;  2ACJ A;  2Y9Y A;  3PIO F;  2GUH A;  4HA8 A;  3BOQ A;  1Z67 A;  5IP7 J;  3CUO A;  4E70 A;  5FRM A;  1MMG A;  3NRG A;  2ZFU A;  4E7S A;  2EIK H;  1U5T B;  3W6V A;  2JSC A;  2KRC A;  3TDU C;  4CA0 A;  1I6H J;  4IOC F;  4BY1 J;  1JTX A;  2R7R A;  1ZGW A;  3E5X A;  1WCM J;  4KIS A;  1UAA A;  3HTI A;  1NTC A;  2HQR A;  1AHD P;  4TV7 A;  1JUM A;  4A3G J;  2KPM A;  2QYO A;  4L9J A;  5AIP A;  3H36 A;  1O7F A;  3S3M A;  3EGQ A;  1JGS A;  2E60 A;  3HJE A;  3NPI A;  4XN3 A;  3JCU C;  2XF6 A;  2STW A;  2BBY A;  4PCQ A;  1R1T A;  3RCO A;  3AL0 B;  5D1R A;  1ETK A;  3H0D A;  4EJW A;  1YJN I;  4AM3 A;  3WTS C;  4I09 A;  1SVO A;  1YJ9 I;  4CZC A;  1LEA A;  3FIS A;  3U2R A;  2VE9 A;  4HEA 2;  1VQN I;  4Y13 A;  1ZH5 A;  2XGX A;  4KJZ A;  2E5N A;  4HNT A;  2ZJQ F;  2GA1 A;  3BTI A;  4RMN A;  2UZK A;  3DBR B;  4XQF A;  3IKV A;  1F9N A;  3JTH A;  1LFB A;  2VB6 A;  3MFK A;  1FEX A;  1OR7 C;  1YI2 I;  5JLX A;  2AQF A;  5ILU A;  3U21 A;  5L3E A;  1U8R A;  4I01 A;  5EGO A;  1XCV A;  3DPL C;  3W6K B;  1QPI A;  3TP3 A;  3TKY A;  1D3Y A;  5FFX A;  3G73 A;  2AHQ A;  4CCK A;  5F1J A;  2VJ4 A;  5K5R A;  2OF7 A;  5GPC A;  2B7E A;  3QKX A;  1ACI A;  2VBW A;  2RAS A;  4XLF A;  3IP4 B;  5K5O A;  2HFH A;  1ON1 A;  1T98 A;  1WH5 A;  1WJC A;  2LNB A;  4IRH A;  1FBU A;  2QCO A;  3KZZ A;  1I1G A;  2IA2 A;  2EBI A;  2HZD A;  2G7U A;  5BPI A;  1SGM A;  1T0F A;  1B4A A;  3L2U A;  1A31 A;  4CCO A;  2CUE A;  4I6Z A;  4Q4Z F;  1SD7 A;  1YIO A;  4R1H A;  3MEX A;  1PJR A;  1YYV A;  1Z77 A;  5B1B H;  3FXL A;  4QIW N;  3GTQ J;  3VIB A;  2E34 A;  2M7A A;  4IRI A;  2VOO A;  2YS9 A;  1EJ9 A;  3HSR A;  2L4A A;  4NDL A;  3I4M J;  2WY8 Q;  3P9K A;  4B44 A;  2XRO A;  2P4W A;  3LSK A;  2V1D A;  3CF2 A;  3KIO A;  5DS9 A;  1OKR A;  3G1O A;  4M73 A;  3K1N A;  4B3X A;  5HDG A;  5ED4 A;  2VON A;  2ZKZ A;  2IJL A;  5CQG A;  2VL8 A;  4XKB A;  5DUK A;  1MSE C;  3K69 A;  1BI3 A;  2P6S A;  2QEN A;  1VQL I;  1XG1 A;  1D1A A;  3T1B A;  4HYE A;  1D1B A;  1R58 A;  1JTY A;  3ZPL A;  2DK5 A;  2EV0 A;  3E0J B;  1LUJ B;  2CV2 A;  1TWF J;  2NNY A;  4IOA F;  1ZQ3 P;  2Y75 A;  5EJC A;  3MCZ A;  5F04 A;  2V4J C;  1FYM A;  4R79 A;  1XMX A;  2XDN A;  2R7O A;  4ZYG A;  2IA0 A;  3W3C A;  2DA6 A;  2QTQ A;  1FP1 D;  1TWC J;  1XS9 A;  2PN6 A;  2RV8 A;  2L4M A;  2X6O A;  3CJQ B;  1R5G A;  4PGG A;  2QEX I;  5J4Y A;  5HLH A;  4GCT A;  1Z05 A;  3CMA I;  3VVX A;  4CGR A;  3TW7 A;  3OIO A;  4M9X A;  4PZJ A;  5FB2 A;  1BIB A;  5JVT A;  2MGQ A;  3FK6 A;  3FMR A;  3HC7 A;  1YX5 A;  2P5K A;  1X1B A;  4XOR A;  3R61 A;  3QPT A;  2Z2S B;  3ZQL A;  4KFC A;  1FSH A;  1TQI A;  3GZ6 A;  3JSO A;  1ZLK A;  5BS6 A;  2RKH A;  3S93 A;  2UXI A; 
#chains in the Genus database with same CATH homology
 4YZE A;  1ETV A;  1ORK A;  2EH3 A;  3S1Q J;  1B72 B;  1ETQ A;  2GFN A;  2OER A;  2CUF A;  1U78 A;  1X58 A;  3JRC A;  3NXC A;  4DW6 A;  1HDP A;  5C4Y A;  3Q3S A;  1MBJ A;  5F0C A;  2RAE A;  1B72 A;  4A3E J;  2NOG A;  4JNN A;  1JJ8 C;  4BBS J;  1JKP C;  5IYD J;  1MH4 A;  5K7Z A;  2X48 A;  3BTC A;  3JRG A;  4PXI A;  2OI8 A;  4XRS A;  2GM4 A;  2JA5 J;  1BJZ A;  3KKC A;  3Q0V A;  2ME6 A;  3G56 A;  2ELK A;  5D19 A;  3C2B A;  5FGL A;  2MW8 A;  3ZQH A;  1U9O A;  4RBO A;  1GVD A;  2OPT A;  1RKW A;  1OCT C;  3S17 J;  2DG7 A;  1U8B A;  3EUP A;  5EZH A;  2I10 A;  2XRL A;  4G12 A;  2KDZ A;  1MBK A;  2E2J J;  3BR3 A;  3NI7 A;  4JX6 A;  2H1K A;  2TCT A;  2LK2 A;  1IGN A;  5FHP A;  1ETW A;  3V6G A;  4M3F A;  4DZJ A;  2QOP A;  3ANP A;  1JT6 A;  2UXH A;  2LR8 A;  2LD5 A;  4UUT A;  2JA6 J;  4C2M J;  1ETY A;  3RZD J;  1ETX A;  5E3O A;  1Q1V A;  1JKO C;  1WH7 A;  5GP9 A;  2O7T A;  2P81 A;  3BR6 A;  4KWA A;  4XK4 A;  2UXU A;  2YVE A;  1WGX A;  2DN0 A;  3CQZ J;  5FMP A;  1AKH B;  3QQA A;  5EG0 A;  2XB0 X;  2G7S A;  1LE8 A;  1GDT A;  3G1M A;  2ZB9 A;  3JR9 A;  3SDG A;  4AC0 A;  4MFE A;  4J19 A;  5CXG A;  3ZQI A;  2VKV A;  3A02 A;  1JUS A;  4Y7N J;  1TC3 C;  1IC8 A;  3C07 A;  3HGG A;  3ZQF A;  4V2G A;  4FE4 A;  1GV5 A;  2L0K A;  2M2E A;  3CWR A;  4MXM A;  3M4O J;  3ZOB A;  4RDU A;  3NRG A;  4XID A;  1X2M A;  3ZQG A;  1VND A;  2R92 J;  1A5J A;  2MSY A;  2E1O A;  3L1P A;  2KT0 A;  2JN6 A;  2LKX A;  3G7R A;  4IEJ A;  3JRB A;  5E3L A;  4FTH A;  4CYC B;  2UXO A;  3COL A;  3S5R A;  1RES A;  1ITY A;  2ID3 A;  1NK3 P;  2LY9 A;  3HDD A;  3JRI A;  2NVY J;  2EZH A;  3KKD A;  4ICH A;  2IU5 A;  2WV1 A;  1IJW C;  3BG5 A;  2CQX A;  4CYC A;  1ZK8 A;  4ABZ A;  3LSR A;  2DMQ A;  5AQC A;  2QKO A;  5IOY A;  3CMY A;  1CQT A;  2H8R A;  2JA7 J;  4BBR J;  4B4C A;  4A3J J;  1HLV A;  1HDD C;  2HYJ A;  2JK3 A;  1H8A C;  1GT0 C;  4FE7 A;  1MSF C;  1Y1W J;  3HOY J;  1MH3 A;  2HDD A;  2CJJ A;  3VOX A;  5M5Y J;  5M5W J;  5K7H A;  4IHV A;  3HTA A;  1POG A;  1IUF A;  4W97 A;  1JJ6 C;  1ENH A;  1K83 J;  2DA4 A;  3LSG A;  3GTM J;  4C3H J;  2NX4 A;  3GTP J;  3G1L A;  1P7J A;  2W48 A;  4IHW A;  3IH3 A;  1X2N A;  4M3E A;  1MNM C;  3IH4 A;  1A6I A;  2JMW A;  1DU6 A;  3E7L A;  1U9N A;  2XPV A;  3I4N J;  1WI3 A;  4GCL A;  3F1B A;  2K40 A;  2F07 A;  1I50 J;  1UG2 A;  4ACI A;  2QF7 A;  2DA5 A;  5DAJ A;  3SJM A;  5IP6 A;  2HOT A;  1W0T A;  3JRH A;  3S1R J;  3VVZ A;  2COB A;  1VI0 A;  3CDL A;  2XSD C;  3LJL A;  1TWG J;  5EEA A;  2VPR A;  4D7N A;  3HKZ N;  3DCF A;  3OSG A;  1D5Y A;  3LOC A;  3HOU J;  3B81 A;  3BG3 A;  1JGG A;  2ZOY A;  4C3J J;  1RR7 A;  1H89 C;  5HAW A;  1R9T J;  1ZR4 A;  3KZ9 A;  3HEF A;  3VW2 A;  2E19 A;  3S2H J;  3HOZ J;  2ECB A;  3VW1 A;  3Q0U A;  4BKX A;  5C4J J;  2WAQ N;  4X6A J;  2WUI A;  3QPL A;  3TP0 A;  3MKL A;  5FKM A;  2R5Z A;  2PZ9 A;  3HE0 A;  2LP0 A;  2DA3 A;  2DJN A;  1HCR A;  2JWT A;  3NAR A;  1UI6 A;  1TWA J;  4QTR A;  2DA7 A;  3HOV J;  2XB5 A;  4JKZ A;  1OFC X;  2XPU A;  5CW8 A;  1F36 A;  5FLM J;  3BJB A;  2HXI A;  2LLK A;  1GUU A;  3BR1 A;  1VFC A;  3RD3 A;  4D7M A;  1F43 A;  3LHQ A;  2YUS A;  1W0U A;  4A3F J;  5FLV A;  2D5V A;  3HIM A;  5K58 A;  4M3B A;  5E3N A;  2GBY A;  3ON4 A;  1XC5 A;  4EEF G;  5HSZ A;  2R7Z J;  2QWT A;  4IHX A;  2NS7 A;  3QPS A;  4B1R A;  5EDN A;  1UHS A;  4XIC A;  1FJL A;  5J1U A;  2HOS A;  3GTG J;  5EGO B;  2L7F P;  1YRN B;  2ZCM A;  4GFK A;  1MBH A;  4X1E A;  3Q0W A;  4DZP A;  1IG7 A;  3BRU A;  4ME9 A;  2O7O A;  3TED A;  3O8H A;  2GEN A;  3BR2 A;  5FKL A;  4W1U A;  4JP0 A;  5BNG A;  2V57 A;  3HB9 A;  4JX5 A;  2W53 A;  3BTL A;  4A3I J;  2CU7 A;  2TRT A;  3B6A A;  2AO9 A;  3D1N I;  4AUX A;  3PM1 A;  4GFL A;  2CQQ A;  2NP5 A;  5EG0 B;  3LSJ A;  1QVU A;  3CCY A;  3VUQ A;  2G7G A;  1TWH J;  3FRQ A;  1Y1V J;  3HM5 A;  2DMP A;  3HOW J;  2NVT J;  4A3M J;  3VOK A;  2XGE A;  5D18 A;  1FIP A;  4MO7 A;  4DYQ A;  4AC6 A;  1O4X A;  5M3M J;  3DPJ A;  3S2D J;  4JX4 A;  3BTJ A;  3K2A A;  1JKR C;  2NVX J;  4A93 J;  1OCP A;  4NN1 A;  1OJL A;  2DMU A;  3B6C A;  4HKU A;  3NAU A;  2NP3 A;  2VI6 A;  3H0G J;  2QIB A;  3V78 A;  4QSH A;  4NEL A;  1APL C;  4MK6 A;  1GV2 A;  1JKQ C;  9ANT A;  3BT9 A;  5DTD A;  1BL0 A;  3MN2 A;  3DEW A;  1I3Q J;  3HBL A;  3GTJ J;  3RZO J;  2HYT A;  2Y30 A;  3VP5 A;  3PO3 J;  4XRM A;  2K9S A;  1BW6 A;  2Y0S N;  3BR5 A;  4M3D A;  1RET A;  4A69 C;  3JRA A;  4A3K J;  3RKQ A;  3WHC A;  2ZCN A;  3GTO J;  2FX0 A;  2L7Z A;  3JRF A;  2FD5 A;  4JL3 A;  1K61 A;  3OSF A;  1WPK A;  2MG4 A;  1NK2 P;  4C3I J;  1IDY A;  5IP9 J;  2K9N A;  4GFB A;  4M6V A;  4B3A A;  1FTT A;  5HOD A;  3E7Q A;  2YU9 J;  2RHA A;  2G7L A;  2HXO A;  3JRD A;  2EZL A;  2B63 J;  5GPA A;  4Y52 J;  2DA2 A;  3BQZ A;  1HF0 A;  2Q24 A;  2VUM J;  2WB1 N;  4AF5 A;  2DMN A;  2ECC A;  1BA5 A;  3K7A J;  3VPR A;  1B8I A;  1G2H A;  2IAI A;  3MVP A;  1MBG A;  1RPW A;  5J3L A;  3RH2 A;  4S0H B;  1PUF A;  2FJ1 A;  2Y9Y A;  3P9T A;  2EQR A;  2GUH A;  5F0H A;  1JUP A;  1VF9 A;  5IP7 J;  4IHY A;  5EF6 A;  2E2H J;  1DU0 A;  2HI3 A;  3RQI A;  3IH2 A;  3NNR A;  1YRN A;  2R5Y A;  5K7F A;  1IDZ A;  1I6H J;  1QVT A;  3FK7 A;  3W6V A;  3HGY A;  2EZI A;  3BG9 A;  1AU7 A;  5M5X J;  1JTX A;  4BY1 J;  2WGB A;  4FIS A;  3PPB A;  1ZGW A;  1WCM J;  2L9R A;  3LWJ A;  3HTI A;  1H88 C;  3M3Y J;  1NTC A;  3S1N J;  2DG8 A;  1AHD P;  2R5Y B;  5JLW A;  3HOX J;  3FKI J;  3LSP A;  1JUM A;  4A3G J;  1UMQ A;  2G0E A;  3A03 A;  4DYC A;  2JA8 J;  3SFI A;  1FIA A;  2O9L A;  2YVH A;  2ID6 A;  3EGQ A;  3GEU A;  4FCY A;  3NPI A;  2L7M P;  2N8G A;  2PMZ N;  2XGC A;  5FKN A;  3QBM A;  3VVY A;  2XPW A;  2GLO A;  3BQY A;  5D1R A;  1ETK A;  3A01 B;  3BCG A;  2E2I J;  3BNI A;  2DA1 A;  3FIS A;  2ZOZ A;  3CJD A;  5FKK A;  4V2F A;  2FQ4 A;  4XRS G;  1MBE A;  3BTI A;  1JT0 A;  3S15 J;  3VW0 A;  2LTP A;  3T6N A;  2HKU A;  2Y31 A;  3AQS A;  2DTZ A;  4M3G A;  5F0F A;  1LFB A;  3O60 A;  2HQ5 A;  1FEX A;  1QRY A;  2G3B A;  5JLX A;  5FJ8 J;  3PAS A;  1UI5 A;  5EGO A;  2Y9Z A;  3LNQ A;  1QPI A;  3TP3 A;  1IV6 A;  2NVQ J;  2AHQ A;  5F1J A;  1E3O C;  2OF7 A;  5GPC A;  3QKX A;  1ZTR A;  1S7E A;  2RAS A;  2M9H A;  4LOC A;  4A3B J;  1FTZ A;  2R93 J;  4MLO A;  2JJ7 A;  4MIM A;  4D5C A;  3GTL J;  1WH5 A;  2CRG A;  5J1R A;  2DMT A;  3FIW A;  2QCO A;  5M3F J;  4UDS A;  1LE8 B;  4A3C J;  5C3E J;  1Z0X A;  2EBI A;  5F08 A;  1SGM A;  2FBQ A;  2R0Q C;  2PBX A;  2CUE A;  4BY7 J;  4I6Z A;  5H9T A;  4L62 A;  4HNV A;  5IYC J;  3JRE A;  3H3V K;  4I76 A;  4BXX J;  5C44 J;  3AQT A;  3O8G A;  1Z77 A;  3OOU A;  4QIW N;  3GTQ J;  3VIB A;  3UKG A;  1SFO J;  4MFD A;  3ZQC A;  4GCK A;  2X9D A;  2YS9 A;  3TW6 A;  4L5E A;  4NDL A;  1ETO A;  3I4M J;  2XGD A;  5DS9 A;  1IRZ A;  3G1O A;  1MBF A;  3S14 J;  2Y2Z A;  5F27 A;  4JYK A;  3IV5 A;  2IBD A;  1MSE C;  5EYR A;  5IOZ A;  3CRJ A;  1RKT A;  4D5F A;  2REK A;  3GBG A;  5EFY A;  3ON2 A;  1XG1 A;  4DYR A;  3WHB A;  1T33 A;  3BR0 A;  3HTH A;  1BW5 A;  2R5Z B;  3MNL A;  1JTY A;  5J1Y A;  2UXP A;  2D6Y A;  5C4X J;  2ZCX A;  1TWF J;  1AKH A;  1ZQ3 P;  3KNW A;  5F04 A;  4A3L J;  2K9Q A;  3A01 A;  2XDN A;  2VKE A;  3HTJ A;  2O8K A;  2EZK A;  1HOM A;  3JSJ A;  5E3M A;  3GZI A;  2DA6 A;  2QTQ A;  1TWC J;  2HOA A;  1ZKG A;  3F0C A;  1XS9 A;  1B8I B;  3S1M J;  2X6O A;  4UUS B;  1EF4 A;  4GCT A;  1PUF B;  5FKO A;  3VVX A;  4CGR A;  3TW7 A;  1SAN A;  3IUV A;  2M8G X;  3OIO A;  2M0C A;  2MGQ A;  3FK6 A;  4UUS A;  3ANG A;  2LFB A;  5CXI A;  1ZR2 A;  3GTK J;  5EZG A;  4A3D J;  3BHQ A;  5IYB J;  1LFU P;  3ZQL A;  2ME0 A;  2IEK A;  2LVS A;  5IPA A;  5HBU A;  2NS8 A;  2M34 A;  1T56 A;  3S16 J;  3PO2 J;  1P7I A;  4AYB N;  2UXI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...