3IH3A

Tm1030 crystallized at 310k
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
202
structure length
202
Chain Sequence
GHMLSKRDAILKAAVEVFGKKGYDRATTDEIAEKAGVAKGLIFHYFKNKEELYYQAYMSVTEKLQKEFENFLMKNRNRDIFDFMERWIEKKLEYSASHPEEADFLITLVSVDEGLRKRILLDLEKSQRVFFDFVREKLKDLDLAEDVTEEIALKFLMWFFSGFEEVYLRTYQGKPELLKRDMNTLVEEVKVMLRILKKGMTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, TetR family
publication title 'Hot' macromolecular crystals.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transcription regulator
total genus 70
structure length 202
sequence length 202
ec nomenclature
pdb deposition date 2009-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3ih3A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3ih3A02
5C4XJ 5EZHA 3HGGA 3A01A 3HM5A 2DN0A 1WGXA 3S1RJ 2DG8A 2MSYA 1H88C 1GV5A 2DA6A 1GV2A 2M9HA 2WB1N 4D7MA 3JRBA 3O60A 1MBHA 1TWFJ 2LFBA 3B6AA 3QBMA 2ID6A 5EYRA 1XS9A 3FKIJ 1TWAJ 3VVYA 3LSGA 1Y1VJ 1IRZA 4QSHA 4MK6A 3SJMA 2Q24A 1ETOA 2H8RA 4IHYA 3LSPA 1RESA 3VUQA 2M34A 2EZHA 4M3EA 5IPAA 1HDPA 3IUVA 1JKPC 5HAWA 1MSEC 2NVXJ 3ZQIA 1X2MA 5D19A 5K7ZA 1IUFA 3G1MA 2LY9A 2JA7J 2WV1A 1T56A 1OCTC 1WPKA 5M5YJ 2RHAA 2CRGA 1RPWA 4XICA 3UKGA 3G1LA 2E2IJ 4HNVA 1U8BA 5JLXA 1X2NA 3S1QJ 3FIWA 2GLOA 2COBA 5E3NA 3COLA 2EBIA 2Y9YA 1LE8B 2K40A 2UXPA 1F43A 3B81A 3QPSA 4XRSG 2IU5A 1WCMJ 3A01B 4JYKA 2FBQA 2JJ7A 2JK3A 4XK4A 3LWJA 1IV6A 3S2HJ 1OCPA 1TWCJ 4FISA 2E2JJ 3GTOJ 1EF4A 4HKUA 4A3LJ 4D5FA 1FTTA 1SANA 3M3YJ 3V6GA 3ON4A 4ACIA 1IDZA 3VOXA 3BR3A 1NK2P 4D5CA 5IYCJ 2NS8A 2DG7A 5M3FJ 4UUSA 5CW8A 5GPAA 2EZLA 3IH2A 4ABZA 3VW2A 3E7QA 3L1PA 3SDGA 3VP5A 2YVEA 1JT6A 2LLKA 4DYCA 5F1JA 2X9DA 3RZDJ 2DMQA 1TC3C 2G7LA 1JUMA 2HQ5A 2JN6A 2K9NA 1W0TA 1MH4A 2MG4A 3NI7A 1DU6A 4C3HJ 2ZOZA 2FX0A 4NDLA 1JKQC 4MFDA 5HBUA 5E3OA 2LD5A 4ICHA 2XDNA 1G2HA 4FCYA 3OOUA 4MXMA 3BR5A 1K83J 2LKXA 2ELKA 1UI6A 1RKWA 4BY7J 5FJ8J 1JTXA 2VKEA 1DU0A 2ZCNA 4FE7A 2D5VA 2R92J 2YU9J 5CXGA 3HOYJ 4A3IJ 1ETVA 2O7OA 2EH3A 5EGOA 1JUSA 1B72A 5J1RA 3HKZN 1JJ8C 4JKZA 1MNMC 4IHVA 1RETA 2Y31A 3BTJA 2HDDA 3RZOJ 3HE0A 3NNRA 2XRLA 3CJDA 2D6YA 2KT0A 4AYBN 4DZJA 3CCYA 3HGYA 4UUSB 2HOTA 3T6NA 2EZKA 2HYTA 1W0UA 2X48A 2E1OA 3BTCA 2ZOYA 2DTZA 4UDSA 3VIBA 4AUXA 5M3MJ 3HOZJ 2R0QC 2H1KA 1O4XA 3CWRA 2M0CA 1P7JA 4W97A 3JRDA 5CXIA 3ON2A 3FK6A 2CQQA 3VOKA 4CGRA 1ZQ3P 2WAQN 3HIMA 2HXOA 3S16J 2GUHA 3VPRA 5DAJA 5IYDJ 3F0CA 1WH5A 2QTQA 2XPWA 3I4MJ 2M2EA 3NAUA 3JR9A 1IJWC 3PO3J 2UXOA 4FTHA 2RASA 3A03A 4JX6A 2QOPA 3TEDA 1JTYA 2DJNA 3E7LA 1HOMA 3M4OJ 2VPRA 3BT9A 3RH2A 2XGCA 2OERA 2DMTA 1LFUP 2OF7A 1IG7A 3ZQHA 4A3KJ 3A02A 3HOWJ 2HYJA 4A3FJ 1VFCA 2HI3A 2JA6J 4J19A 4MFEA 3WHCA 5M5XJ 5EGOB 4B4CA 5EEAA 3GTLJ 3QPLA 1JUPA 3IH4A 3Q0UA 2CUEA 2PZ9A 5FKKA 2L7ZA 1ETKA 2XB5A 2G7GA 1D5YA 2L7MP 3S1MJ 2UXUA 1UMQA 4LOCA 2K9SA 5E3MA 1Q1VA 3BTIA 2DA3A 1JKOC 2DMPA 1TWHJ 2G7SA 1X58A 1A5JA 3BNIA 3FISA 5C4JJ 2QIBA 2E19A 2HXIA 1JJ6C 1U9NA 2JA5J 2G3BA 3TW6A 5FMPA 1ZKGA 2EZIA 4M3GA 2ZCXA 4JX4A 3HDDA 1HF0A 2R5ZA 2R93J 3RD3A 3WHBA 4DYQA 1FJLA 2XPUA 4EEFG 4L5EA 1FTZA 3BQZA 1PUFA 3HEFA 5F0HA 3ZQFA 5DTDA 4ME9A 1ETWA 2DA4A 2TCTA 4X6AJ 1GVDA 3VVXA 3JRFA 3JREA 2O8KA 1R9TJ 4CYCA 3CDLA 2MGQA 4PXIA 1B8IA 1A6IA 5J1YA 4BXXJ 2L9RA 3Q0WA 3G7RA 1GT0C 3H3VK 3ANGA 4DYRA 2NP5A 3G56A 2IEKA 4MIMA 4A3CJ 3LJLA 1H8AC 1IGNA 1K61A 1UG2A 4GCLA 2G0EA 4C3IJ 1WI3A 1BL0A 1S7EA 4L62A 3K2AA 2LVSA 2ME6A 3AQTA 4C3JJ 1HCRA 5C44J 2FD5A 3GEUA 1UI5A 2P81A 3NARA 4NELA 3P9TA 3H0GJ 4DW6A 3GTQJ 3FRQA 3GBGA 2I10A 3QQAA 1MBFA 4C2MJ 3KZ9A 1H89C 2R5ZB 3KNWA 2UXHA 5C3EJ 4MO7A 4IEJA 4A3DJ 1SGMA 3VW1A 1Z77A 1MBEA 2Y30A 4Y7NJ 1PUFB 1E3OC 3QKXA 1QVUA 2NOGA 3OSGA 3BR6A 2QWTA 5GPCA 3LSJA 4A3MJ 1AKHA 4GFKA 4CYCB 3DEWA 3CQZJ 2K9QA 1B8IB 3NRGA 1ZK8A 2TRTA 4A3EJ 3HB9A 2GFNA 5C4YA 5FHPA 2EQRA 2M8GX 2OI8A 2CUFA 5EF6A 1OFCX 2VUMJ 1GDTA 3PASA 3JRAA 3NPIA 2ID3A 2LR8A 3RKQA 1YRNA 3BHQA 2W53A 3OIOA 4I76A 2QKOA 5EZGA 1GUUA 1WH7A 3Q0VA 2LP0A 4S0HB 3GTMJ 4A3BJ 3AQSA 2O7TA 1I50J 2XGDA 4B3AA 3JRHA 4M3BA 3TP0A 4XRSA 1ZR4A 1IC8A 1Z0XA 5FKLA 5EFYA 2WUIA 3S1NJ 3ANPA 1JGGA 1VF9A 5J3LA 1MBJA 3GTGJ 2CJJA 1ZGWA 3Q3SA 2DA7A 3LHQA 3MN2A 3GTPJ 1NK3P 3HOUJ 4BKXA 3EGQA 1T33A 4A3GJ 4DZPA 1HLVA 4YZEA 3KKCA 3VW0A 2DA2A 1VNDA 5FKNA 1JT0A 3D1NI 3BR1A 1BW6A 3ZQLA 1TWGJ 4I6ZA 2F07A 5F08A 4Y52J 1FEXA 3IV5A 1AKHB 1B72B 4BY1J 1QRYA 2NX4A 1POGA 3SFIA 5IOYA 4BBRJ 5HODA 2NVTJ 5GP9A 2DMNA 5IYBJ 3HOXJ 2PMZN 3W6VA 1VI0A 3CRJA 3HBLA 5F04A 3NXCA 1YRNB 1HDDC 4BBSJ 4JX5A 5FLVA 5IP9J 2DA1A 3JRCA 2R7ZJ 3G1OA 3C07A 3RQIA 1RR7A 3ZOBA 2NP3A 2X6OA 2ZB9A 4GFLA 3LSRA 1ETXA 2NS7A 2JMWA 5IOZA 1P7IA 1I3QJ 4XRMA 5F0FA 2YVHA 5F0CA 5JLWA 1ETYA 1NTCA 5D18A 2O9LA 3KKDA 4D7NA 5IP7J 2L7FP 3F1BA 1AHDP 2HKUA 4GCKA 3PPBA 2Y9ZA 3S15J 2QF7A 3S5RA 1ENHA 2KDZA 2DA5A 3JRGA 1APLC 3GTKJ 4GCTA 2ECBA 4JL3A 4FE4A 4A69C 5FGLA 4RDUA 2R5YA 2GM4A 1MSFC 1SFOJ 4G12A 2LTPA 4X1EA 2XGEA 1U78A 5AQCA 3BG5A 1U9OA 1F36A 1ZTRA 5K7HA 1ITYA 2JWTA 4XIDA 3PM1A 4JNNA 4M3FA 3MNLA 3S17J 3BJBA 4A3JJ 1FIPA 3JSJA 2FJ1A 2ECCA 4B1RA 2JA8J 3LNQA 4GFBA 1ORKA 2VI6A 1I6HJ 3CMYA 3VVZA 1OJLA 5FKOA 3PO2J 1Y1WJ 4MLOA 3BR2A 2B63J 2NVYJ 3BR0A 5H9TA 5J1UA 3HTIA 4AC0A 1MH3A 3O8HA 3GZIA 3BTLA 2GBYA 3DCFA 2N8GA 3ZQGA 1BJZA 4A93J 1BA5A 2W48A 1IDYA 3FK7A 3C2BA 5EG0A 2VKVA 4RBOA 2HOSA 4QIWN 2AHQA 2IAIA 4KWAA 1AU7A 1XG1A 5D1RA 4V2FA 2LK2A 3ZQCA 2E2HJ 3JRIA 5F27A 1BW5A 2GENA 5K58A 2RAEA 2V57A 3V78A 3HTAA 2QCOA 5E3LA 1QPIA 3MVPA 1RKTA 4W1UA 3TP3A 3BRUA 2NVQJ 2L0KA 4AC6A 3BG9A 2YS9A 3K7AJ 2R5YB 3GTJJ 1MBKA 1ETQA 5K7FA 1XC5A 2OPTA 1UHSA 5FLMJ 1LFBA 2XPVA 2ME0A 4QTRA 2REKA 2Y0SN 4AF5A 2AO9A 2CU7A 2MW8A 2PBXA 2IBDA 2XB0X 5M5WJ 3MKLA 1FIAA 4JP0A 2WGBA 2CQXA 3BG3A 2ZCMA 3I4NJ 3HTHA 3IH3A 3BCGA 5BNGA 3DPJA 4NN1A 3S14J 2Y2ZA 5IP6A 2XSDC 9ANTA 3HTJA 4M6VA 2HOAA 5EG0B 3BQYA 2YUSA 2DMUA 1JKRC 5EDNA 1ZR2A 1CQTA 5DS9A 3B6CA 4V2GA 3TW7A 4UUTA 3EUPA 5FKMA 3OSFA 1LE8A 5HSZA 3HOVJ 1QVTA 3O8GA 4IHWA 4M3DA 3S2DJ 1MBGA 2FQ4A 4IHXA 2UXIA 3LOCA
chains in the Genus database with same CATH superfamily
4MGRA 5C4XJ 2UZKA 3A01A 4HZFA 1G6NA 3OYHA 2KZGA 3FM5A 2BY0A 4XLCA 3K1MA 2R4GA 2PMUA 2MD0A 2ZFUA 3LMMA 5EYRA 1XS9A 3VVYA 1Y1VJ 1IRZA 3U1KA 4QSHA 5ILSA 1QO0D 3F72A 1VQ9I 4BXUA 3LSPA 1IV8A 4M3EA 3TKYA 2XC7A 2L02A 1JKPC 3RSNA 4BXFA 5HAWA 3OMYA 4RB0A 2CFOA 2NVXJ 2OTLI 3E1SA 4Z2YA 3ZQIA 3J7AO 1KYWA 1J0RA 2LOOA 3ELKA 3PUFA 3MKWB 5ICFA 4JBAA 1T56A 1OCTC 3F8NA 2DDAA 3KP2A 3L9FA 5M5YJ 2CRGA 3BOQA 4NC7A 3UKGA 3G1LA 3LSTA 1U8BA 1USSA 3ABMH 4NB5A 2E35A 4IRVA 3S1QJ 2BE5F 2GLOA 4IO9F 4GDFA 4FX0A 3COLA 2Y9YA 5D8KB 1QHGA 3ZMSA 4HYEA 1TQMA 3CD6I 2IGMA 2FOWA 3TMOA 3PNTA 2Q2EA 3H5RA 2E7WA 2JJ7A 4YEJA 1W7PB 1ZGAA 2HVSA 3S2HJ 3B73A 3CUQA 1TWCJ 3GTOJ 4D5FA 1SANA 1HKTA 4ACIA 3MKZA 1IDZA 3BR3A 1NK2P 4D5CA 1FMVA 5IYCJ 2NS8A 3CDIA 3DFGA 4N4OB 2A2FX 5CVJA 2V1UA 3WTZA 5HLTA 3E7QA 4XSXF 3L1PA 2EB7A 4HQEA 4XKCA 3WTWC 3VP5A 5E1ZB 1STZA 4WX9A 3RZDJ 2DMQA 2FMLA 2YSRA 3MWMA 4DBQA 3FMQA 2HDWA 1D1BA 5LFAA 1MH4A 1VQPI 4ETSA 1QU3A 2FX0A 5DDGA 3LAJA 4MFDA 3SWHA 3OIQA 1Z7LA 4ENJA 2XDNA 3KIOA 1V5GA 1OCZH 1V4RA 1J75A 2CQ7A 3TL4X 4LFUA 4BY7J 4HQMA 5FJ8J 2K7LA 3NQOA 4OWRB 2DXIA 1JTXA 2VKEA 1DU0A 2YVXA 3H3UA 2D5VA 2M7BA 3H1CA 2XROA 2R92J 4G7HF 4DOZA 2RREA 4OIOF 3I71A 2O7OA 4PJ0C 1OISA 1XB4A 2EH3A 1EA3A 4P5OA 2V4JC 3L7WA 3X2QH 4MHGA 1B72A 5H6RA 2FBIA 4QPQA 2DJIA 2Y31A 3BTJA 4Y15A 3RZOJ 2EIKH 2KZVA 3ABUA 1UAAA 3HE0A 2D6YA 2MA3A 4DZJA 4I0AA 1IN4A 3HGYA 2HOTA 4UUSB 1RZ4A 2NNYA 1YIJI 1J59A 3BTCA 5L3FA 2PN6A 3FXLA 4BE2A 1J5YA 2H1KA 3L09A 4WCGA 4W97A 3JRDA 1Z21A 3FK6A 1X3ZB 2CQQA 2QQAA 4RM3A 5FLXZ 3ABKH 3IWZA 2WAQN 3HIMA 2HXOA 3FZVA 2CW8A 4LIUA 4A6EA 3CJQB 5DAJA 2O8XA 1WH5A 4UV9A 1MIJA 2QTQA 3I4MJ 1TP4A 3L2VA 1IJWC 2UXOA 2ESNA 2QOPA 2Z1DA 2DJNA 2KQRA 3E7LA 2VJ4A 3M4OJ 4ASNA 3RH2A 3BZCA 4B43A 2STTA 3IAM2 3HUGB 3ZQHA 2H27A 2XAGA 2BW3B 5FD6A 4A3FJ 2DOFA 3WTTC 2HI3A 2HVQA 3M7GA 3OYKA 2CQKA 4F3QA 4J19A 4HDUA 3GO5A 4PGGA 5EGOB 4U9LA 1SAUA 5EEAA 4M9ZA 3BZ6A 3Q0UA 2CUEA 3R60A 2L7ZA 1ETKA 2G7GA 2K4BA 4A12A 4FX4A 5BS6A 3K10A 1D5YA 3L2WA 3S1MJ 2RNJA 1MZBA 5E3MA 3BTIA 1WQ2A 1UB9A 3ZMZA 1O7LA 1TT5B 1XGOA 3O3KA 2JTVA 1Y8RB 4XKBA 2EPFA 2HWVA 3EQLF 1LVKA 2L7KA 4P55A 1SD6A 4XLHA 4ENMA 4PJNA 1Z7UA 3TW6A 2VKDA 4DVYP 2EZIA 2RGVA 3ZMDA 2JSPA 4Q5SF 2R7VA 2QZ8A 1VQLI 3FMSA 2KISA 3WU2C 4Z6YA 2D45A 1FTZA 3TO9A 2ZMEC 2OQRA 3HEFA 5F0HA 3ZQFA 4KN4X 2W85A 5DTDA 1ETWA 5LHHA 1GVDA 4BQOA 1SAXA 1R5HA 2CMPA 2O8KA 4UV8A 2MGQA 4EJVA 4ZTFA 4LLLA 2RNGA 4F92B 3H3VK 1YO5C 3FWEA 4DYRA 3SXYA 4G8XA 3VOEA 2DQLA 3LJLA 2GWRA 1D1CA 1UG2A 2RN7A 4EGYA 2HQNA 2KPMA 2G0EA 3RKXA 3OV8A 3UR3C 3F6OA 2QKLB 4AU7A 2LSOA 3CDHA 3I64A 1SD4A 2ZJPF 5C44J 1RIOH 2V6EA 3GEUA 2XF7A 3NARA 5CLSA 2L9SA 4IHTA 3H0GJ 1VQ8I 3FMRA 2VJIA 4HF1A 4KT6A 3OS0A 1H89C 4MO7A 4IEJA 3BZKA 3VW1A 1NG6A 4XL9A 4Y7NJ 1OPCA 3K4MA 5CPRB 1PUFB 1E3OC 1VQ7I 1QVUA 2FUG2 4BYYA 3TGNA 3BR6A 2EILH 2PFBA 2W24A 1WKMA 3HRTA 3BJOA 4M71A 1LEAA 1GHCA 3NRGA 4A3EJ 5IT3A 4UY8I 2R7OA 4CCMA 4U7DA 5C4YA 2EQRA 4U87A 4XBFA 2CUFA 1OFCX 3JSOA 2J5PA 3JRAA 3PASA 3CCQI 4XM3A 3GFMA 3FBIB 3S3OA 3BG7A 1B9MA 3BHQA 2WAEA 2RQQA 2VQGA 1LUJB 2XAQA 3LWFA 3TO6A 4D1QA 4XN0A 3DLLF 3IKTA 3ZQQA 2H6BA 2QEXI 6PAXA 1I50J 2EWNA 2NOJB 2VE8A 4Q4ZF 3JRHA 2WAFA 2STWA 3NWSA 2QSFX 4M3BA 3H0DA 1FOYA 2QQ8A 1Z0XA 3BJAA 3IRQA 1T38A 3VWBA 1FC3A 2IXSA 4IXAA 3WU1B 1R4NB 3S1NJ 2DYRH 2V1DA 5J3LA 3EPZA 5HS9A 1QZZA 2E1CA 2DA7A 3KFWX 3LHQA 1LJ9A 2MBFA 1YJWI 5B1BH 1NK3P 3HOUJ 4BKXA 5DM7F 3EGQA 2W82A 4BGDA 3F22A 1T33A 5FLXK 2GXGA 3TDZC 5D5XB 2JQ7A 5CVRA 2P7CB 3VW0A 1VNDA 2E34A 3QU3A 3QOEA 5FKNA 4AD9A 1JT0A 5KK1A 5E17F 1IAWA 2VN2A 1HQCA 1TWGJ 3F8CA 4I6ZA 2D1HA 1CF7B 5F08A 4LG0B 3IV5A 1AKHB 1B72B 4BY1J 2VBXA 2XF6A 3SFIA 3QYBA 4E70A 4YFNF 2DMNA 2HZDA 5IYBJ 2DYSH 5KAIC 3EYYA 3W6VA 5AONA 3CRJA 4ITVA 3BCAA 4QPOA 4OINF 2R7XA 3NXCA 1OQYA 2VASA 1LEBA 1JHFA 3GFJA 2L5QA 1H9TA 1HDDC 2P8TA 4Y13A 3CCEI 3CJNA 2MLKA 2H09A 1WJBA 3GLLA 1U3EM 3C07A 2KL4A 1XSXA 2X6OA 2K86A 5GTHC 5LRSA 4GFLA 3HC7A 1T08B 5E8IA 3LSRA 1ETXA 3CC2I 1F5TA 2BV6A 2H1LA 2YVHA 4XRMA 4UVBA 4R79A 5F0CA 5D18A 3PNVA 3KKDA 4HV6A 1OCCH 5IP7J 2KRFA 2Y9ZA 3S5RA 2ZXIA 3MZYA 1APLC 3OY9A 4A0XA 3MKYB 4KFCA 4JL3A 2RV8A 1V3FA 4LK1F 4L9NA 4CCJA 5FGLA 4BQQA 2ZMEB 2R5YA 3K4KA 4UNOA 1B6AA 4X1EA 2LTPA 1HW5A 1SFKA 3TBIA 4E4HA 2KHMA 3T0YA 5J4YA 2Z3YA 1IXSB 3GXOA 5AQCA 4B09A 4EV0A 1YX3A 3HIFA 3PM1A 1A35A 2NS0A 4M3FA 3BJBA 4A3JJ 4B1RA 4EM1A 2JA8J 3J80Z 2L9VA 1WJCA 3CCSI 1SFUA 4BQAA 2LF7A 1YS6A 2J5OA 1ONVA 3PO2J 4MLOA 1USTA 3BR2A 5HS7A 2HOEA 2Y48A 1XSVA 3MEXA 4CDGA 4L5IA 1PJRA 3I0TA 3DCFA 2N8GA 3ZQGA 3RPUD 2FRHA 3DTKA 1V5FA 3OYIA 2VKVA 2QQ9A 2K3FA 1A6QA 2IAIA 4HRIA 5D1RA 2A6EF 3ZQ7A 2ESHA 4V2FA 4U0YA 3JRIA 5F27A 2X6YA 3EYIA 2GENA 2R7FA 4EJOA 2QCOA 4HLXA 1UHMA 5JI6A 4IOCF 3QP6A 3TP3A 2V9PA 1YFHA 5AIPA 2NVQJ 1FPQA 2L0KA 3K9TA 3L2UA 1FNNA 2IRFG 2LDUA 1LDJA 5K7FA 3U9GA 2CUJA 2P6TA 1Z1DA 2EIJH 5CVUA 2X1CA 1Y6IA 5FLMJ 4UUVA 3E3VA 2KJBA 3J7ZI 1BIAA 2B9SA 2Y0SN 1KU2A 1WWXA 2AO9A 2MW8A 3DTEA 1T6SA 2IBDA 2XB0X 3RJPA 2W25A 2C6YA 3PUBA 3MKLA 1FIAA 1UCRA 2CQXA 2R7SA 2ZNZA 3GW2A 3GX4X 3I4NJ 2CV1A 3IH3A 5LEJA 2EFWA 1V5EA 5BNGA 4NN1A 3J7YJ 4ZDLA 3OYEA 4J01A 5HOOA 2Y2ZA 4XORA 3HTJA 3ISPA 3RKYA 4XR6A 4H0EA 2K9LA 5EG0B 4HAMA 3BQYA 1YLFA 2DMUA 4PJJA 3GEZA 2Q1ZB 2F5CA 3UNGC 3S2WA 3HG9A 2HYFA 3O8GA 3BDDA 2ZXWH 4IHWA 3S2DJ 2JSCA 1FSEA 2UXIA 1D1AA 3CTAA 1MJAA 5EZHA 1WGXA 5FRNA 1V54H 4AIKA 3S1RJ 2MSYA 4ZYGA 1W7PA 3CP8A 5KVRA 2IA1A 5IT9Z 2DA6A 1JI8A 1GV2A 2PJPA 2M9HA 4KICA 2B1EA 2JPCA 1MBHA 1XGNA 1T0FA 4A0YA 3DEUA 1EJ9A 3FKIJ 1ZG3A 1FT9A 2FMYA 2NXNB 2OCEA 4MK6A 3SJMA 4IZZA 3LSHA 2H8RA 3CJRB 4RLFA 2K9MA 1RESA 4IHYA 1IUYA 3CMMA 1ERDA 3VUQA 3TOBA 4YG2F 3S93A 2ELHA 5IPAA 1HDPA 2KJCA 4N9IA 1MSEC 4XKVA 2WBMA 1XMKA 2HQAA 2VKHA 5D19A 4B48A 1KQ0A 2DI3A 2OA4A 3G1MA 5K7ZA 2GIVA 2IA0A 3L2RA 3EUHA 2KKOA 1O3SA 1WFXA 4ZZDA 3F8MA 3KZZA 4RGRA 1KQ9A 1A36A 4PUSA 3I4PA 2E7XA 4I01A 1IN7A 2H94A 4J00A 1REPC 5JVGF 2E71A 1LKXA 2CYYA 3DKYA 2XKOA 2KIQA 3P9CA 3V8LA 3GF2A 1EF4A 4HKUA 3H92A 4A3LJ 2DK5A 3DTIA 2VBYA 1OYYA 3E5UA 2V1XA 3ULQB 1P9QC 2DOAA 2W84A 4HX8A 1T2KA 4UUSA 1U8RA 2EZLA 3IH2A 4ABZA 3OL3A 4E7KA 1VQ6I 1W5TA 2ZNYA 1WJEA 1MNDA 2M45A 4IKFA 2VODA 4F55A 5F1JA 5E18F 3J80K 4EJWA 3KYCB 2G7LA 1JUMA 1N25A 2JN6A 2CUZA 2K9NA 1YTYA 2ACJA 3WE3A 1DU6A 2P5LC 4MEXF 5BQTA 4NDLA 5FFXA 5HBUA 2BVLA 2LD5A 4ICHA 4RAZA 1YOVB 2V79A 1X3WB 5E20A 1G2HA 3ASNH 1GXPA 2OZUA 3OOUA 4MXMA 4OD5A 1K83J 3E6MA 3HUGA 1HSTA 1H9GA 3O2PE 4RMNA 3S3NA 4L0ZB 2BW3A 2LNBA 1TNSA 2O61A 2NNNA 4GGGA 3HOYJ 1VQMI 5K5RA 1FBQA 4OU0A 5EGOA 2P5KA 4GRIA 1JUSA 2HR3A 5CVVA 4JKZA 4BNCA 5L3BA 5BOXA 1MNMC 2W00A 1P92A 2HDDA 2ZXHA 1I5ZA 1E3PA 2QVOA 3C1DA 5F64A 4AYBN 3FDYA 3CLOA 3GZ5A 4KUMA 4AYBA 5CYVA 2X48A 4PJMA 4BHCA 4AUXA 4IVNA 5M3MJ 3HOZJ 2R0QC 3GYHX 3MQ0A 2LRDA 2XGXA 3VYRB 1SFEA 3PFYA 2GUHA 2EV0A 3F0CA 5LRRA 2O0YA 1WJFA 1D3YA 1X1AA 2XPWA 5LGTA 3E6DA 3ERMA 3V7RA 3JR9A 2E5ZA 2VBZA 3A03A 3TEDA 1GXQA 2GIZA 2IS4A 4IX7A 3GWZA 2XGCA 1TT0A 1Y0NA 2HTJA 5J8CA 2QENA 2WWYA 1OKRA 1AOYA 2M4KA 1RC9A 4O6JA 2LC2A 5IT9K 2OBPA 1RR8C 1FMWA 3ML6A 3GTLJ 1KQ8A 3D5SC 3IH4A 3LA7A 4GYGA 4MTDA 1Z9CA 3OWTA 2WY7Q 2L7MP 2UXUA 3CESA 3GLXA 2ZXJA 3HHGA 4LG3A 1JKOC 1W4MA 3H5NA 4WWCA 1I1SA 5LGNA 1A5JA 4KYWA 3FISA 1R00A 1WHUA 3R61A 1JJ6C 1FOWA 1U9NA 2JA5J 2AQFA 2R7DA 2XAJA 2XSJC 2CV0A 1ZKGA 3DKXA 2FE3A 2ZCXA 1DPUA 3JAMK 3HDDA 2VJJA 2R7RA 2R93J 1FJLA 2E36A 2AXLA 3E6BA 1MJ9A 5L3EA 1FOKA 4EEFG 3ROUA 1D8KA 1PUFA 1I27A 3FXQA 2ZJ2A 5D8LB 4RS8A 5JVTA 4X6AJ 3VVXA 3KEQA 3JRFA 3DPUA 1NH3A 3FXMA 3PNYA 1R9TJ 2LREA 2XV4S 5HS8A 1S7AA 1SVOA 2Y75A 4CZZA 1EH8A 4I2OA 5F6FA 4B47A 4NHJA 3G7RA 2K85A 2PX9A 4MEYF 4II3A 1JE8A 2NP5A 2M3AA 5GAHJ 2DFHA 2QBYB 2JRTA 4U88A 1H8AC 1IGNA 1X1CA 2CQNA 2CSOA 3ZN1A 4LJZF 3ZMUA 4C3IJ 2Z16A 1SMYF 2EFOA 1R23A 2LMDA 1O3RA 2DFEA 2ME6A 2ZY9A 3ABTA 2FD5A 3WODF 4ESJA 2A5YB 1QHHD 2P81A 3VYUB 4NQWB 1N75A 3P9TA 3I54A 3FRQA 2MFZA 3WTXC 1ULYA 3HHHA 3KNWA 5C3EJ 4ON0A 2RDPA 4A3DJ 1BI0A 4L18B 4G7ZF 2VQHA 2QUFA 1CF7A 2P4WA 3I58A 4LG0A 2QWTA 2IVMA 5GPCA 3OYJA 3CCRI 1AKHA 2B3WA 3OYNA 4CYCB 2ZJRF 3W2WA 1DP3A 3RYPA 3MMYB 2K9QA 2TRTA 3JTHA 4NUBA 4XLPF 5JFRA 2GFNA 3V4GA 3C7JA 3CJTB 3GVAA 3T8TA 2VOOA 1TZLA 2QYOA 2WV0A 1MMGA 3RKQA 2PLYA 3OIOA 4GO1A 5EZGA 3GTMJ 3AQSA 2LP0A 4A3BJ 2O7TA 3VSKA 2V1NA 4PGHA 2QGUA 3IP4B 3L2QA 3I3LA 4RGSA 3A0HC 5ILUA 3K70D 1X4OA 1BJAA 1IC8A 2CW0F 4TV7A 3VYTB 2WAQA 4HBLA 3KP6A 1R5ID 2P0WA 3GTGJ 5D5VB 3W2AA 4CCOA 3Q3SA 3KYDB 4FQGA 2RC4A 3MN2A 3C2HA 1R6RA 4R8HA 1U2WA 3CCJI 4UB6C 2OTJI 4AIDA 1BR1A 1YYVA 1HLVA 4KITB 4YZEA 4EVIA 3K4LA 4ESFA 4XQFA 2ZMEA 3DBHB 1YW8A 1JXSA 3RYRA 4BACA 2F07A 1R58A 3LSKA 2R7TA 3CLQA 2V9VA 1QRYA 4BHBA 3WE2A 5IOYA 2LY2A 1ZLKA 3P7NA 2IS2A 2UUZA 2PMZN 2RQPA 3A0BC 2Z33A 3N4MA 1YJ9I 3HBLA 3DLAA 4MTEA 2VT3A 1O57A 3F8FA 1K6YA 3BPXA 2H6CA 3CC4I 1DQUA 5A2QZ 1YRNB 2F5EA 4D9JA 2DOEA 4JOMA 3VODA 1RNLA 3JRCA 2R7ZJ 2KLOA 3M1CA 3P9KA 1XMAA 3ZR8X 1RR7A 3ZOBA 3HTUA 5H6QA 1BC8C 3CMEI 2ZB9A 3GCMA 2ZJQF 1F9NA 3SQNA 1ZAOA 2DTRA 2NS7A 1W5SA 4XONA 5KHDA 1I3QJ 2HS5A 1ETYA 3O6BB 5E1WA 2IPQX 4A6DA 1Z3YA 2QF7A 3SYTA 2DA5A 4FHTA 4PSXA 3JRGA 1T95A 5D6EA 5FFZA 1BC7C 2DFIA 1E2XA 1IRGA 2ECBA 2YPRA 4FE4A 1ZN2A 2R7QA 2VL8A 4A69C 3T8RA 5HDGA 2G9WA 3WG7H 2EJRA 5KNLA 2JVHA 3AG3H 3JSPA 3L2CA 2BBYA 2M1BA 5J4VA 3IAS2 1HW1A 1L0OC 2M8EA 3IL2A 3BG5A 3G73A 2ZBKA 3VEPA 1ZTRA 5K7HA 3SEZA 1ITYA 3HL2A 2EK5A 3QWLA 4BHPA 2W57A 2R7UA 1RUNA 1ORKA 2MC4A 4FETA 3VVZA 1J2XA 4I09A 2DW4A 3R6SA 1Y1WJ 2B63J 2NVYJ 3BR0A 3MD2A 4IHSA 5J1UA 3HTIA 1S3JA 4XN3A 3N97A 4AC0A 1MH3A 3GZIA 1QGPA 4OAZA 3K70C 4A93J 2MC3A 2W48A 4HW0A 1IDYA 1SFXA 3C2BA 3FK7A 5EG0A 1FLIA 1PP8F 4RBOA 4PFOA 2IGOA 4C2MA 5DV5A 3OYLA 1WJAA 2LK2A 5K58A 3E97A 1O3QA 4PK4A 3V78A 1G3SA 3L00A 2GXAA 1QPIA 3BRUA 1D0YA 3FF5A 3ASOH 1B9NA 4B3XA 1BOBA 4AC6A 4M73A 2YS9A 4Q48A 4L0YB 5JR3A 1DPRA 1QZYA 1UHSA 1YJNI 2XPVA 4F52A 1ZLJA 3K0LA 1YE9A 2GAUA 2CU7A 3DU5A 1ON1A 2Z99A 3I59B 3M8JA 1PUEE 4PSWA 5M5WJ 2PBXA 2WGBA 2LY1A 1K78B 2UXNA 5D5WB 2KIFA 2ZCMA 1QBJA 4I02A 3ERED 4HF2A 1BR4A 2X51A 4KIGA 3A4CA 4BL0B 3BCGA 4CCNA 3J81Z 2DQRA 1DP7P 1XGSA 1QA6A 2E60A 2Q0OA 2XSDC 9ANTA 4U7BA 4E7JA 4D0PA 4EM0B 2VC1A 4EQQA 2YUSA 2KIMA 4YIFA 2P5VA 4V2GA 1MDMB 3EUPA 3OSFA 3RQ4A 1UJ8A 5HSZA 4UB8C 4BAYA 2FQ4A 1ZQ3P 2EV5A 4LB5A 4X0GA 4H4KC 3RDIA 2DN0A 2A69F 4AM3A 3LFKA 2DG8A 3AKZA 3LSIA 3V8JA 1GV5A 2FNAA 3KE2A 1TQIA 2WB1N 5TISC 3M8FA 2F4OB 4BUPA 3JRBA 4DNCA 1O3TA 4XLNF 3PQJA 1O7FA 1TWFJ 1RRJA 2ID6A 5L3CA 1TWAJ 3OS2A 2Q24A 1ETOA 4XLFA 4IRHA 2EINH 1SEUA 1U5TC 2B7EA 2M0MA 2RKHA 1S6LA 2FXAA 2EZHA 4M9XA 4I99C 5A2QK 3IUVA 3FXKA 4IQJA 3SZPA 2JUCA 2PMHA 4HEA2 3T5XA 2VQCA 1IUFA 1K4SA 2JA7J 4YIIA 1X1BA 2WV1A 3EDPA 2RHAA 2I5UA 5DYMA 1KA8A 2XF5A 3AG2H 1RUOA 2JVGA 1D5VA 2B0LA 3HRUA 2XUBA 2NRAC 4EMSA 1G3WA 2COBA 2FNPA 4I98B 1LE8B 2CG4A 3ZPLA 1WI9A 3NRVA 5ED4A 1F43A 4XRSG 2O03A 1PVEA 2IU5A 5B1AH 1ZRCA 2IT0A 2BEOA 4XK4A 3LWJA 3LFUA 1IV6A 1OCPA 2V26A 5CQGA 1KYZA 2TDXA 1F4KA 4ZYDA 3R0AA 4BS9A 3CP2A 3H35A 2KMUA 1Y0UA 3VOXA 4WF2A 3D5RC 2K27A 2MABA 2DG7A 1KU3A 3VTIA 4DIQA 1LVAA 5CW8A 2O5RA 3KLOA 1UELB 4LD5A 2OV7A 3VW2A 3KZYA 4HOBA 2Z5UA 2YVEA 1X4PA 2VONA 1QZEA 2HU9A 3DEEA 1G4DA 3H36A 1TC3C 2PEXA 2IP2A 2HEOA 2HQ5A 4CO8A 2XAFA 5TGTA 1W0TA 2MG4A 3NS4A 3LL7A 3OYMA 5E3OA 3OYFA 1D8JA 1TW3A 3LQRA 4FCYA 2DPUA 3ZP5A 4M6XA 4CH7A 1K7AA 2EFQA 5D5UB 1Z6TA 3GFLA 2ZCNA 5IY5H 3CCVI 1Y8QB 1WJDA 3FXJA 1OCOH 1PDNC 1ETVA 3M8EA 2DLLA 3U1DA 3TOAA 2Y0SA 1G59A 4KMFA 4BDYA 4C2UA 2XAUA 3HKZN 2M4GA 4IHVA 3V7SA 2DAOA 2GQQA 2AS5F 3HOTA 3NNRA 1BI2A 5K1YA 1S8NA 2PJRB 4AIHA 3C3WA 2WTEA 3R4KA 1SMTA 4BJ6C 4B8XA 2EZKA 2E1OA 1LNWA 1IN8A 2EIMH 2ZSIB 1PP7U 3CWRA 1P7JA 4OMZA 3KYLA 3FXRA 4CYDA 4HX4A 3ON2A 2K4JA 3DBLB 3J81K 4CGRA 4PFPA 3E6CC 2HYGD 3BP8A 2W7NA 3S16J 1ZGJA 1MKMA 2K3PA 5ILVA 2M30A 2LKSA 1TL8A 3HPGA 2FU4A 3PO3J 1JGSA 3F9KA 4BJ5C 1HOMA 3RPUA 3BT9A 3A2KA 1BBYA 3T1BA 2X4HA 1LFUP 4KMUX 2OERA 1OCRH 1IG7A 4NBQA 2LH9A 5FO5A 1XDSA 2HYJA 2JA6J 3IUOA 2F48A 1EH6A 3GMEA 2QBYA 5M5XJ 2DT7B 1CGPA 4B4CA 4DJAA 1BN5A 3QPLA 4RA2A 2PZ9A 4FASD 5FKKA 4LLGF 1Y39A 1FBUA 1IW7F 4IRGA 4LOCA 4N9HA 1Q1VA 2Y69H 2DA3A 3S32A 1TWHJ 3AG1H 2G7HA 5KCMA 3ZMTA 4HSRA 3BPVA 3BNIA 4QWQA 1U5TB 2HXIA 4NQWA 2QQBA 4XRFA 3H9JA 3ABLH 4IPAA 4OIRF 2RVCA 4M3GA 3QODA 1HF0A 3QOPA 3RD3A 3WHBA 4DYQA 4XKWA 2XPUA 5CKTA 3BQZA 2ZSHB 2TCTA 1LPQA 5EEGA 1ZH5A 2VQLA 3JREA 2IS6A 4CYCA 4CHUA 3CDLA 2M87A 3IKVA 4WXHA 4PXIA 4KT5C 1MW7A 5FROA 4O5VA 1IXRC 4BXXJ 2L9RA 2FA5A 3ANGA 3A1YA 3G56A 1OMIA 4A3CJ 1XN7A 1Z6RA 1TBXA 4CUGA 1IN5A 2QLZA 2IGKA 1OR7A 3W6KB 1WI3A 1B59A 5EJCA 5B66C 4L62A 3K2AA 4KIFA 1XD7A 1TTYA 3G2BA 2A68F 4C3JJ 5ICEA 3KETA 3KP3A 3LAPA 3OIPA 1C0WA 5J40A 3MFKA 1BM9A 1UI5A 2OU2A 4P9UA 2Q8KA 1TNTA 2L3DA 4DW6A 4EATA 1FWZA 3GBGA 4IOAF 2JA2A 2W1OA 3QQAA 2YX4A 1MBFA 4C2MJ 3KZ9A 3U21A 3KP7A 4KJZA 4E7IA 2R5ZB 2UXHA 4GXOA 1XCBA 3F6VA 2DT6A 2DFFA 1Z77A 2L2OA 1FP1D 1MBEA 3CMAI 4LK0F 3J7AY 1YX5A 3QKXA 2FOKA 3QPHA 3GZ6A 1ON2A 2WA0A 3LSJA 4GFKA 1H0MA 4CSWA 1NG7A 1BIBA 2F5VA 2HGCA 4JK1X 1B8IB 3P5JA 1U0JA 3HB9A 3ZXSA 2EV6A 3W2VA 5FHPA 3VDXA 2M8GX 2OI8A 2VUMJ 2L01A 2XDVA 5BMZA 1GDTA 3RPQA 2DODA 4CA0A 2ID3A 2LR8A 1N77A 1YRNA 3BCBA 1GUUA 1WH7A 3Q0VA 4S0HB 1D0XA 3CCUI 1B1BA 5FRMA 3OOPA 2XGDA 4B3AA 1LFPA 3BWGA 4RAYA 3SZTA 3TP0A 2GXBA 1X1PA 4XRSA 4YFXF 5FKLA 5EFYA 1J9IA 3M1EA 4L9JA 4ZYEA 2DK8A 2XHKA 1JGGA 3ANPA 1MBJA 2CJJA 5DEQA 3WTUC 1V55H 3QPTA 2BGCA 3GTPJ 3Q5FA 4M72A 1LDKB 4XOTA 4HG2A 3W6JB 1BOAA 3K4CA 4RAGA 1X1DA 4DZPA 1X19A 2K5CA 3KKCA 1HKQA 3KCCA 2VXDA 4G6QA 4M9SA 3D1NI 4ZTJA 4U9NA 2ZKZA 1BW6A 2DCEA 2ISYA 3VYSB 1MMSA 4ZC3A 1K4TA 2UV1A 1FEXA 4EJUA 3VSLA 2P7VB 1POGA 4BBRJ 5J6XA 4OD4A 3K6GA 5HODA 1HKSA 4WXCA 5GP9A 3HOXJ 1FOXA 2HPMA 3PIPF 1E17A 5F04A 1JHHA 4OOIA 1P4AA 5DCMB 3LA3A 2VT2A 4S04A 3K4BA 4PJLA 4JX5A 2DA1A 4KIBA 3G1OA 3RQIA 3HOSA 2VLAA 2VBWA 1WJ5A 2KDOA 3RKWA 2Z2SB 3W3CA 4DGWB 1EH7A 2CS3A 3MZ8A 2MD5A 5JLWA 2O9LA 2G7UA 1G8XA 4D7NA 4BEHB 4XOPA 1AHDP 1QPMA 2HKUA 3PPBA 3I56I 1ENHA 2KDZA 4BE0A 2COMA 1DGWY 2O3FA 3U2RA 1UHWA 4RDUA 1MSFC 4XSZF 4C30A 1SFOJ 2L4AA 2L54A 3DKWA 3F3XA 2JPBA 3KP4A 1S9HA 1U78A 4XMYA 1U9OA 2MH2A 2BHZA 2IA2A 3M07A 5F1RA 4XIDA 1PYVA 4M74A 2BXYA 3TQNA 3FXUA 4G6TB 3I59A 4JNNA 3S17J 3OYDA 4AIJA 5GTIC 1LQ1A 2FJ1A 1K78A 3IRRA 5GADJ 3LNQA 1SD5A 1ZHFA 1MD0A 2VI6A 3MZHA 3IWFA 1I6HJ 1OJLA 1K6OA 5GAGJ 3REOA 5H9TA 1ZRFA 3O8HA 1N78A 5LGUA 2QSHX 1G3YA 2GA2A 1BA5A 2AXTC 3ZMVA 2BXZA 2BVMA 2V9KA 2AHQA 3TDUC 4I0BA 3KEYA 1XG1A 3LOCA 1MDMA 3FBNB 4NC8A 1BW5A 3HSEA 3MCZA 5B5EC 2E2HJ 4DBRA 1KONA 3HTAA 4V19K 2BYVE 3MVPA 1I3AA 1RKTA 2IGNA 4RB1A 4LITA 1R7JA 3CUQC 3K7AJ 1WZ2A 1MBKA 2JUGA 2OUMA 3BG6A 4HLYA 1XC5A 1AWCA 2E1MC 1DGRM 1LFBA 1XMXA 2F6CA 5BPDA 4P1WA 3CC7I 2H8WA 4AF5A 4MQ9F 4AVPA 3CF5F 3KZIC 3VB2A 1GVJA 1Z67A 4BE1A 3I53A 3BG3A 5L3DA 4GCVA 4ZYAA 3RTRA 3WGHA 4Y3OA 4YELA 3PIOF 3DPJA 4NC6A 1MMDA 2A6TA 4C9YA 3IHUA 4G6DA 1YIOA 3FHNA 1W5CC 3E5QA 3RCOA 5IP6A 4E7HA 1YS7A 1AA7A 3F23A 3KLNA 4N0BA 5ICGA 1Y56A 2HOAA 3ONQA 5EDNA 1XDUA 5DS9A 2CH0A 1R36A 1VQOI 1VQ4I 2FQ3A 2FEZA 4UUTA 1IF1A 5FKMA 2ZO4A 1LE8A 4YFKF 1QVTA 2GA1A 4M3DA 1YHQI 2HVRA 1W36D 5E79C 3N05A 3S8PA 3C2GA 3HGGA 3SHFA 3BLYA 2WY8Q 3HM5A 2VOPA 3PQKA 1WRJA 3PSFA 5D4RA 1H88C 2PMZA 2V6CA 2W4SA 1A31A 5DUKA 4D7MA 1M1EB 3F8BA 3AL0C 3O60A 5HNHA 4PZJA 3WTVC 3QBMA 2LFBA 1XX5A 3B6AA 3LSGA 2DPDA 1R22A 1R5GA 4RAFA 3K1PA 3BY6A 4HSTA 5CJ9A 4C2TA 1UZCA 1A04A 2M34A 2X6XA 3GZNB 2YR2A 3K4NA 2A61A 4RGUA 4QLCU 3DPLC 4Y17A 5EEHA 2OCCH 1Z91A 2LF8A 3KPHA 4Y33A 5HNFA 1KU9A 2UWMA 4OAYA 3KX2A 1X2MA 2LY9A 2GOMA 3H9QA 4RLQA 2PI0A 1WPKA 2DBBA 3H5AA 2F5FA 3CO7C 1NHAA 1RPWA 4XICA 2E2IJ 4HNVA 5JLXA 1X2NA 3IC7A 4O3MA 2LBFB 3FIWA 3Q9VA 2NVUB 3HXLA 2HPIA 5HDKA 5E3NA 4B44A 2EBIA 3K2ZA 3PL8A 1TQPA 1MMNA 3JTGA 1ZG5A 2K40A 5HLGA 2UXPA 2MH9A 4LB6B 3QPSA 3B81A 2R3SA 3A01B 2JZYA 4JYKA 2FBQA 4ENKA 1SVLA 2JK3A 3DP7A 3FHZA 2ZFWA 3P9IA 4FISA 2E2JJ 5H2FC 4XNFA 3SDBA 1FTTA 3R0JA 3M3YJ 4R1HA 3ON4A 3V6GA 2R7WA 1E0EA 2PJRA 3HJEA 4PDKA 1ZRDA 4K2EA 5M3FJ 2DT5A 4RGXA 4G7OF 1Z3XA 5GPAA 3HSRA 5DCFA 3DV8A 1BR2A 1YW7A 1FP2A 3DF8A 3SDGA 1MGTA 3V42A 1YQAA 2E5NA 1KU7A 1JT6A 2LLKA 4DYCA 2X9DA 4UVCA 4A5MA 4RB3C 1DUXC 2OAZA 1HSJA 2BHYA 2IW5A 2Z9OA 3NI7A 2BOLA 2MLGA 5E1XA 4C3HJ 2ZOZA 4IJAA 5K5QA 3AAFA 1I6XA 1JKQC 5CQEA 3QYFA 3OYGA 4MNUA 2Y0MA 1GLNA 3EUKL 1YG2A 3HZJA 3K4JA 5E8GA 4AVZA 3QYEA 3BR5A 2A07F 2LKXA 2ELKA 1UI6A 1RKWA 4ANJA 4N4NB 3WG9A 1FYKA 4FE7A 1XTAA 2KFDA 2YU9J 3OYBA 5CXGA 2WADA 3EUAA 5D6FA 1W36C 3HSFA 4A3IJ 2Q2EB 1QQIA 3CUQB 1FSHA 5J1RA 5CVIA 3S3MA 5FB2A 1JJ8C 4P96A 2F4MB 4NNJA 1RETA 3DWLE 2ETHA 1LB2A 2XRLA 2E1MB 3CJDA 2KT0A 4G9YA 3T6NA 1X3UA 3CCYA 5D4SA 1VQNI 2HYTA 1W0UA 1TLHB 2ZOYA 2DTZA 3QAHA 1J7KA 5HLIA 3F21A 4UDSA 3VIBA 3HRSA 2EFNA 1U5TA 4KN7X 2FJI1 1O4XA 3I9V2 2M0CA 5CXIA 2DU9A 4HF0A 4IQ4A 1WSUA 2LKPA 1VTNC 3VOKA 1S7OA 2CGPA 1YI2I 3QU6A 3G6EI 2X1DA 5DM6F 2X0LA 4A5NA 3VPRA 5LHIA 5IYDJ 1OLTA 2AQEA 3HRMA 2M2EA 3NAUA 3DQVC 3B02A 4FTHA 2RASA 4JX6A 1JTYA 4KDPA 5LEKA 1ZELA 2IJLA 2VPRA 1FX7A 2FBHA 1FZPB 2DMTA 2OF7A 2VC0A 2WB1A 3BC8A 2OZ6A 4L9VA 4A2UA 4A3KJ 5J47A 1J09A 3A02A 2EA2A 3HOWJ 2F5DA 3WGIA 1VFCA 2PBIA 2FF4A 4LMYA 4MFEA 3WHCA 4HA8A 4OMYA 2QM3A 1VQKI 4IHXA 1JUPA 4HDVA 1HC8A 3AL0B 2XB5A 4KA4A 1E3HA 4E7ZA 1UMQA 3FXOA 2K9SA 3ZN0A 2P6SA 2DDBA 1MNEA 3HYIA 3C18A 3FM3A 2DMPA 1XGMA 4I7HA 1W1WE 2G7SA 2VPLA 1X58A 2XRNA 2M7AA 4UVAA 5C4JJ 2QIBA 2E19A 2WC2A 4BU2A 5TJJA 4EGZA 3WGGA 2G3BA 5FMPA 3OL4A 1P2FA 3I55I 2NYXA 3QP5A 3JCUC 3DPTA 1F1ZA 4JX4A 3KP5A 1XSDA 2R5ZA 1VQ5I 1XCVA 3LQQA 4ZDPA 4MQVA 4L5EA 3G4SI 5DUIA 3QRFF 1IN6A 2A6HF 4LIVA 2UXXA 4II2A 1R1UA 2A3SA 4ESBA 2DA4A 4ME9A 2LG4A 1BI3A 2IS1A 1YW9A 1EKEA 1A6IA 1B8IA 2CV2A 5J1YA 3E0JB 2XIGA 3ECOA 3Q0WA 4AWXB 1GT0C 1MJBA 3AG4H 1S5LC 4Q47A 3WTYC 1FBSA 2MYSA 2VIXA 2IEKA 2F2EA 2L9NA 4MIMA 4LLNA 1K61A 1OYWA 4GCLA 3DBRB 2GZWA 4L5JA 1R49A 1MMAA 3CO6C 4OIQF 1BL0A 1S7EA 3RI4A 1QNTA 4RB2C 3MAJA 2ZC2A 2LVSA 4PCQA 5B3SH 1T8IA 3AQTA 2KIUA 3D5LA 1HCRA 3K69A 3LA2A 2X1EA 3K8PC 3HPHA 2BY1A 4NELA 3BROA 4BDZA 2D1VA 3GTQJ 2I10A 1HA8A 4HX7A 3HTSB 4XLEA 1XPXA 3EETA 1R1VA 1W7PD 2JRMA 2XAHA 1WVRA 1KZHA 1SGMA 2Y30A 3SEQA 4XLAA 2OQGA 3V7CA 1P4WA 2NOGA 3OSGA 4F91B 1B4AA 4ENNA 4A3MJ 4E7SA 1LDDA 3DEWA 2JT1A 3CQZJ 1ZK8A 2ELJA 3HKZA 5FGMA 2BY2A 3PJRA 4U0VA 1T98A 2V7FA 5EF6A 5BPIA 3NPIA 4CCKA 3G3ZA 4WXDA 1SVMA 4P9FA 5DCMA 2W53A 2M5WA 4I76A 2QKOA 4EJTA 3CUOA 4WK8F 4LGWA 1R1TA 1SD7A 1ZR4A 3KEOA 2XVCA 3GUDA 5LHGA 4CXFA 2WUIA 1VF9A 4EM2A 5H20A 2VE9A 1ZGWA 1R71A 3M9AA 1G3TA 4BEHA 4UXNA 2QKMB 1ZG1A 4A3GJ 5GAEJ 2EFPA 3G71I 2DA2A 3NWTA 2OD5A 4ZH4F 3BR1A 3ZQLA 1IXCA 3H9GA 1ZARA 1L3LA 4Y52J 1OYIA 2X6WA 2NX4A 2CFXA 2CWEA 4ZJZA 2NVTJ 1T39A 1HXDA 2PQ8A 1HBXG 1ACIA 3AFHA 1VI0A 4FT8A 3H3ZA 4E7LA 3OR2C 2HDCA 4Y4RA 4OIPF 3FKJA 5DD4A 2VB6A 2YX7A 4BBSJ 3TO7A 5FLVA 1TW2A 4F7ZA 5IP9J 2BZTA 3OYAA 3CCLI 4YRVA 3SFZA 2F4IA 2X85A 2CW7A 4YIRX 2NP3A 1I1GA 2HTSA 5K5OA 2KRHA 2JMWA 1BI1A 1YITI 5IOZA 1P7IA 1P4XA 5F0FA 3JAMZ 2HQRA 2BY3A 1NTCA 5ICCA 1KGSA 2I8DA 4E6KG 5L3GA 2O6GE 2K02A 2L7FP 4BQNA 3F1BA 4GCKA 2KRCA 4CICA 3S15J 4WIBA 1ZYRF 1IO2A 3GTKJ 1ZREA 4G94A 4GCTA 1ODDA 1K79A 2NAZA 2GM4A 3CCMI 3NEUA 2GOXB 4IL6C 1FYMA 3ESWB 4G12A 5JHFA 1S72I 2XGEA 3SZGA 1P6RA 5HDNA 1T0FC 1HW2A 3ZGKA 2DO7A 3JW4A 2ISZA 3OR1C 1F36A 3K1NA 2D2WA 2JWTA 2PFVA 1S29A 1FYLA 3MNLA 4ZYHA 4JQFA 1Q1HA 3Q9SA 4HPQA 4CZCA 1FIPA 3BJ6A 3JSJA 2ECCA 2VXZA 3LSMA 4GFBA 5AIQA 2ADUA 3V8KA 3CMYA 4S05A 5FKOA 5KAFC 2QSGX 1UG0A 4KISA 3ZRGA 2EA4A 3BTLA 2GBYA 3EUHC 1BJZA 3ZCOA 2KP6A 1UFMA 1Z05A 3WTSC 4ZDOA 2LYCA 4HNTA 4QIWN 2HOSA 3CF2A 5DD8A 2QWWA 4F93B 5LLQA 4U0WA 4KWAA 3RIRA 1AU7A 4UHTA 4KNYA 1VZ0A 4CCLA 3WU0A 3ZQCA 2QA4I 2XKPA 2RAEA 5TRDA 2V57A 4IRIA 5E3LA 4W1UA 3VFZA 3E5XA 5HVQC 1RI7A 5FD5A 5LD2C 2ICWG 5HLHA 3DXJF 3BG9A 2FBKA 1U6GA 3GFIA 2R5YB 3GTJJ 2HNHA 5J8FA 1ETQA 1IZ1A 1IRFA 1EV7A 2HFHA 1IRXA 2OPTA 4A0ZA 2OJED 4QTRA 1R4MB 2ME0A 3CZ6A 2REKA 4HNUA 1SC7A 4BH9A 4M6YA 2FSWA 4HV5A 4JP0A 4L9TA 1OR7C 2L4MA 5LBQA 3DU6A 4RM2A 5ERIA 3OS1A 3HTHA 2HZTA 4BJTA 2XASA 2A05A 2OC6A 1FY7A 3COAC 3ECHA 3S14J 2YU3A 1I39A 2CO5A 2ZCWA 3D0SA 5JHUA 3FX3A 4M6VA 4CGZA 3OYCA 1JKRC 2A5WA 2LBFA 1ZR2A 1D0ZA 4GYIA 1CQTA 4DQ2A 3B6CA 2HKOA 3TW7A 2VJ5A 2PG4A 4IF4A 2E1NA 3HOVJ 1DDNA 4ZZLA 3PSIA 1MBGA 3I5UA 2HKXA 1WCMJ 3PFIA
chains in the Genus database with same CATH topology
5C4XJ 5EZHA 3HGGA 3A01A 3HM5A 2DN0A 1WGXA 3S1RJ 2DG8A 2MSYA 1H88C 1GV5A 2DA6A 1GV2A 2M9HA 2WB1N 4D7MA 3JRBA 3O60A 1MBHA 1TWFJ 2LFBA 3B6AA 3QBMA 2ID6A 5EYRA 1XS9A 3FKIJ 1TWAJ 3VVYA 3LSGA 1Y1VJ 1IRZA 4QSHA 4MK6A 3SJMA 2Q24A 1ETOA 2H8RA 4IHYA 3LSPA 1RESA 3VUQA 2M34A 2EZHA 4M3EA 5IPAA 1HDPA 3IUVA 1JKPC 5HAWA 1MSEC 2NVXJ 3ZQIA 1X2MA 5D19A 5K7ZA 1IUFA 3G1MA 2LY9A 2JA7J 2WV1A 1T56A 1OCTC 1WPKA 5M5YJ 2RHAA 2CRGA 1RPWA 4XICA 3UKGA 3G1LA 2E2IJ 4HNVA 1U8BA 5JLXA 1X2NA 3S1QJ 3FIWA 2GLOA 2COBA 5E3NA 3COLA 2EBIA 2Y9YA 1LE8B 2K40A 2UXPA 1F43A 3B81A 3QPSA 4XRSG 2IU5A 1WCMJ 3A01B 4JYKA 2FBQA 2JJ7A 2JK3A 4XK4A 3LWJA 1IV6A 3S2HJ 1OCPA 1TWCJ 4FISA 2E2JJ 3GTOJ 1EF4A 4HKUA 4A3LJ 4D5FA 1FTTA 1SANA 3M3YJ 3V6GA 3ON4A 4ACIA 1IDZA 3VOXA 3BR3A 1NK2P 4D5CA 5IYCJ 2NS8A 2DG7A 5M3FJ 4UUSA 5CW8A 5GPAA 2EZLA 3IH2A 4ABZA 3VW2A 3E7QA 3L1PA 3SDGA 3VP5A 2YVEA 1JT6A 2LLKA 4DYCA 5F1JA 2X9DA 3RZDJ 2DMQA 1TC3C 2G7LA 1JUMA 2HQ5A 2JN6A 2K9NA 1W0TA 1MH4A 2MG4A 3NI7A 1DU6A 4C3HJ 2ZOZA 2FX0A 4NDLA 1JKQC 4MFDA 5HBUA 5E3OA 2LD5A 4ICHA 2XDNA 1G2HA 4FCYA 3OOUA 4MXMA 3BR5A 1K83J 2LKXA 2ELKA 1UI6A 1RKWA 4BY7J 5FJ8J 1JTXA 2VKEA 1DU0A 2ZCNA 4FE7A 2D5VA 2R92J 2YU9J 5CXGA 3HOYJ 4A3IJ 1ETVA 2O7OA 2EH3A 5EGOA 1JUSA 1B72A 5J1RA 3HKZN 1JJ8C 4JKZA 1MNMC 4IHVA 1RETA 2Y31A 3BTJA 2HDDA 3RZOJ 3HE0A 3NNRA 2XRLA 3CJDA 2D6YA 2KT0A 4AYBN 4DZJA 3CCYA 3HGYA 4UUSB 2HOTA 3T6NA 2EZKA 2HYTA 1W0UA 2X48A 2E1OA 3BTCA 2ZOYA 2DTZA 4UDSA 3VIBA 4AUXA 5M3MJ 3HOZJ 2R0QC 2H1KA 1O4XA 3CWRA 2M0CA 1P7JA 4W97A 3JRDA 5CXIA 3ON2A 3FK6A 2CQQA 3VOKA 4CGRA 1ZQ3P 2WAQN 3HIMA 2HXOA 3S16J 2GUHA 3VPRA 5DAJA 5IYDJ 3F0CA 1WH5A 2QTQA 2XPWA 3I4MJ 2M2EA 3NAUA 3JR9A 1IJWC 3PO3J 2UXOA 4FTHA 2RASA 3A03A 4JX6A 2QOPA 3TEDA 1JTYA 2DJNA 3E7LA 1HOMA 3M4OJ 2VPRA 3BT9A 3RH2A 2XGCA 2OERA 2DMTA 1LFUP 2OF7A 1IG7A 3ZQHA 4A3KJ 3A02A 3HOWJ 2HYJA 4A3FJ 1VFCA 2HI3A 2JA6J 4J19A 4MFEA 3WHCA 5M5XJ 5EGOB 4B4CA 5EEAA 3GTLJ 3QPLA 1JUPA 3IH4A 3Q0UA 2CUEA 2PZ9A 5FKKA 2L7ZA 1ETKA 2XB5A 2G7GA 1D5YA 2L7MP 3S1MJ 2UXUA 1UMQA 4LOCA 2K9SA 5E3MA 1Q1VA 3BTIA 2DA3A 1JKOC 2DMPA 1TWHJ 2G7SA 1X58A 1A5JA 3BNIA 3FISA 5C4JJ 2QIBA 2E19A 2HXIA 1JJ6C 1U9NA 2JA5J 2G3BA 3TW6A 5FMPA 1ZKGA 2EZIA 4M3GA 2ZCXA 4JX4A 3HDDA 1HF0A 2R5ZA 2R93J 3RD3A 3WHBA 4DYQA 1FJLA 2XPUA 4EEFG 4L5EA 1FTZA 3BQZA 1PUFA 3HEFA 5F0HA 3ZQFA 5DTDA 4ME9A 1ETWA 2DA4A 2TCTA 4X6AJ 1GVDA 3VVXA 3JRFA 3JREA 2O8KA 1R9TJ 4CYCA 3CDLA 2MGQA 4PXIA 1B8IA 1A6IA 5J1YA 4BXXJ 2L9RA 3Q0WA 3G7RA 1GT0C 3H3VK 3ANGA 4DYRA 2NP5A 3G56A 2IEKA 4MIMA 4A3CJ 3LJLA 1H8AC 1IGNA 1K61A 1UG2A 4GCLA 2G0EA 4C3IJ 1WI3A 1BL0A 1S7EA 4L62A 3K2AA 2LVSA 2ME6A 3AQTA 4C3JJ 1HCRA 5C44J 2FD5A 3GEUA 1UI5A 2P81A 3NARA 4NELA 3P9TA 3H0GJ 4DW6A 3GTQJ 3FRQA 3GBGA 2I10A 3QQAA 1MBFA 4C2MJ 3KZ9A 1H89C 2R5ZB 3KNWA 2UXHA 5C3EJ 4MO7A 4IEJA 4A3DJ 1SGMA 3VW1A 1Z77A 1MBEA 2Y30A 4Y7NJ 1PUFB 1E3OC 3QKXA 1QVUA 2NOGA 3OSGA 3BR6A 2QWTA 5GPCA 3LSJA 4A3MJ 1AKHA 4GFKA 4CYCB 3DEWA 3CQZJ 2K9QA 1B8IB 3NRGA 1ZK8A 2TRTA 4A3EJ 3HB9A 2GFNA 5C4YA 5FHPA 2EQRA 2M8GX 2OI8A 2CUFA 5EF6A 1OFCX 2VUMJ 1GDTA 3PASA 3JRAA 3NPIA 2ID3A 2LR8A 3RKQA 1YRNA 3BHQA 2W53A 3OIOA 4I76A 2QKOA 5EZGA 1GUUA 1WH7A 3Q0VA 2LP0A 4S0HB 3GTMJ 4A3BJ 3AQSA 2O7TA 1I50J 2XGDA 4B3AA 3JRHA 4M3BA 3TP0A 4XRSA 1ZR4A 1IC8A 1Z0XA 5FKLA 5EFYA 2WUIA 3S1NJ 3ANPA 1JGGA 1VF9A 5J3LA 1MBJA 3GTGJ 2CJJA 1ZGWA 3Q3SA 2DA7A 3LHQA 3MN2A 3GTPJ 1NK3P 3HOUJ 4BKXA 3EGQA 1T33A 4A3GJ 4DZPA 1HLVA 4YZEA 3KKCA 3VW0A 2DA2A 1VNDA 5FKNA 1JT0A 3D1NI 3BR1A 1BW6A 3ZQLA 1TWGJ 4I6ZA 2F07A 5F08A 4Y52J 1FEXA 3IV5A 1AKHB 1B72B 4BY1J 1QRYA 2NX4A 1POGA 3SFIA 5IOYA 4BBRJ 5HODA 2NVTJ 5GP9A 2DMNA 5IYBJ 3HOXJ 2PMZN 3W6VA 1VI0A 3CRJA 3HBLA 5F04A 3NXCA 1YRNB 1HDDC 4BBSJ 4JX5A 5FLVA 5IP9J 2DA1A 3JRCA 2R7ZJ 3G1OA 3C07A 3RQIA 1RR7A 3ZOBA 2NP3A 2X6OA 2ZB9A 4GFLA 3LSRA 1ETXA 2NS7A 2JMWA 5IOZA 1P7IA 1I3QJ 4XRMA 5F0FA 2YVHA 5F0CA 5JLWA 1ETYA 1NTCA 5D18A 2O9LA 3KKDA 4D7NA 5IP7J 2L7FP 3F1BA 1AHDP 2HKUA 4GCKA 3PPBA 2Y9ZA 3S15J 2QF7A 3S5RA 1ENHA 2KDZA 2DA5A 3JRGA 1APLC 3GTKJ 4GCTA 2ECBA 4JL3A 4FE4A 4A69C 5FGLA 4RDUA 2R5YA 2GM4A 1MSFC 1SFOJ 4G12A 2LTPA 4X1EA 2XGEA 1U78A 5AQCA 3BG5A 1U9OA 1F36A 1ZTRA 5K7HA 1ITYA 2JWTA 4XIDA 3PM1A 4JNNA 4M3FA 3MNLA 3S17J 3BJBA 4A3JJ 1FIPA 3JSJA 2FJ1A 2ECCA 4B1RA 2JA8J 3LNQA 4GFBA 1ORKA 2VI6A 1I6HJ 3CMYA 3VVZA 1OJLA 5FKOA 3PO2J 1Y1WJ 4MLOA 3BR2A 2B63J 2NVYJ 3BR0A 5H9TA 5J1UA 3HTIA 4AC0A 1MH3A 3O8HA 3GZIA 3BTLA 2GBYA 3DCFA 2N8GA 3ZQGA 1BJZA 4A93J 1BA5A 2W48A 1IDYA 3FK7A 3C2BA 5EG0A 2VKVA 4RBOA 2HOSA 4QIWN 2AHQA 2IAIA 4KWAA 1AU7A 1XG1A 5D1RA 4V2FA 2LK2A 3ZQCA 2E2HJ 3JRIA 5F27A 1BW5A 2GENA 5K58A 2RAEA 2V57A 3V78A 3HTAA 2QCOA 5E3LA 1QPIA 3MVPA 1RKTA 4W1UA 3TP3A 3BRUA 2NVQJ 2L0KA 4AC6A 3BG9A 2YS9A 3K7AJ 2R5YB 3GTJJ 1MBKA 1ETQA 5K7FA 1XC5A 2OPTA 1UHSA 5FLMJ 1LFBA 2XPVA 2ME0A 4QTRA 2REKA 2Y0SN 4AF5A 2AO9A 2CU7A 2MW8A 2PBXA 2IBDA 2XB0X 5M5WJ 3MKLA 1FIAA 4JP0A 2WGBA 2CQXA 3BG3A 2ZCMA 3I4NJ 3HTHA 3IH3A 3BCGA 5BNGA 3DPJA 4NN1A 3S14J 2Y2ZA 5IP6A 2XSDC 9ANTA 3HTJA 4M6VA 2HOAA 5EG0B 3BQYA 2YUSA 2DMUA 1JKRC 5EDNA 1ZR2A 1CQTA 5DS9A 3B6CA 4V2GA 3TW7A 4UUTA 3EUPA 5FKMA 3OSFA 1LE8A 5HSZA 3HOVJ 1QVTA 3O8GA 4IHWA 4M3DA 3S2DJ 1MBGA 2FQ4A 4IHXA 2UXIA 3LOCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C4X J;  5EZH A;  3HGG A;  3A01 A;  3HM5 A;  2DN0 A;  1WGX A;  3S1R J;  2DG8 A;  2MSY A;  1H88 C;  1GV5 A;  2DA6 A;  1GV2 A;  2M9H A;  2WB1 N;  4D7M A;  3JRB A;  3O60 A;  1MBH A;  1TWF J;  2LFB A;  3B6A A;  3QBM A;  2ID6 A;  5EYR A;  1XS9 A;  3FKI J;  1TWA J;  3VVY A;  3LSG A;  1Y1V J;  1IRZ A;  4QSH A;  4MK6 A;  3SJM A;  2Q24 A;  1ETO A;  2H8R A;  4IHY A;  3LSP A;  1RES A;  3VUQ A;  2M34 A;  2EZH A;  4M3E A;  5IPA A;  1HDP A;  3IUV A;  1JKP C;  5HAW A;  1MSE C;  2NVX J;  3ZQI A;  1X2M A;  5D19 A;  5K7Z A;  1IUF A;  3G1M A;  2LY9 A;  2JA7 J;  2WV1 A;  1T56 A;  1OCT C;  1WPK A;  5M5Y J;  2RHA A;  2CRG A;  1RPW A;  4XIC A;  3UKG A;  3G1L A;  2E2I J;  4HNV A;  1U8B A;  5JLX A;  1X2N A;  3S1Q J;  3FIW A;  2GLO A;  2COB A;  5E3N A;  3COL A;  2EBI A;  2Y9Y A;  1LE8 B;  2K40 A;  2UXP A;  1F43 A;  3B81 A;  3QPS A;  4XRS G;  2IU5 A;  1WCM J;  3A01 B;  4JYK A;  2FBQ A;  2JJ7 A;  2JK3 A;  4XK4 A;  3LWJ A;  1IV6 A;  3S2H J;  1OCP A;  1TWC J;  4FIS A;  2E2J J;  3GTO J;  1EF4 A;  4HKU A;  4A3L J;  4D5F A;  1FTT A;  1SAN A;  3M3Y J;  3V6G A;  3ON4 A;  4ACI A;  1IDZ A;  3VOX A;  3BR3 A;  1NK2 P;  4D5C A;  5IYC J;  2NS8 A;  2DG7 A;  5M3F J;  4UUS A;  5CW8 A;  5GPA A;  2EZL A;  3IH2 A;  4ABZ A;  3VW2 A;  3E7Q A;  3L1P A;  3SDG A;  3VP5 A;  2YVE A;  1JT6 A;  2LLK A;  4DYC A;  5F1J A;  2X9D A;  3RZD J;  2DMQ A;  1TC3 C;  2G7L A;  1JUM A;  2HQ5 A;  2JN6 A;  2K9N A;  1W0T A;  1MH4 A;  2MG4 A;  3NI7 A;  1DU6 A;  4C3H J;  2ZOZ A;  2FX0 A;  4NDL A;  1JKQ C;  4MFD A;  5HBU A;  5E3O A;  2LD5 A;  4ICH A;  2XDN A;  1G2H A;  4FCY A;  3OOU A;  4MXM A;  3BR5 A;  1K83 J;  2LKX A;  2ELK A;  1UI6 A;  1RKW A;  4BY7 J;  5FJ8 J;  1JTX A;  2VKE A;  1DU0 A;  2ZCN A;  4FE7 A;  2D5V A;  2R92 J;  2YU9 J;  5CXG A;  3HOY J;  4A3I J;  1ETV A;  2O7O A;  2EH3 A;  5EGO A;  1JUS A;  1B72 A;  5J1R A;  3HKZ N;  1JJ8 C;  4JKZ A;  1MNM C;  4IHV A;  1RET A;  2Y31 A;  3BTJ A;  2HDD A;  3RZO J;  3HE0 A;  3NNR A;  2XRL A;  3CJD A;  2D6Y A;  2KT0 A;  4AYB N;  4DZJ A;  3CCY A;  3HGY A;  4UUS B;  2HOT A;  3T6N A;  2EZK A;  2HYT A;  1W0U A;  2X48 A;  2E1O A;  3BTC A;  2ZOY A;  2DTZ A;  4UDS A;  3VIB A;  4AUX A;  5M3M J;  3HOZ J;  2R0Q C;  2H1K A;  1O4X A;  3CWR A;  2M0C A;  1P7J A;  4W97 A;  3JRD A;  5CXI A;  3ON2 A;  3FK6 A;  2CQQ A;  3VOK A;  4CGR A;  1ZQ3 P;  2WAQ N;  3HIM A;  2HXO A;  3S16 J;  2GUH A;  3VPR A;  5DAJ A;  5IYD J;  3F0C A;  1WH5 A;  2QTQ A;  2XPW A;  3I4M J;  2M2E A;  3NAU A;  3JR9 A;  1IJW C;  3PO3 J;  2UXO A;  4FTH A;  2RAS A;  3A03 A;  4JX6 A;  2QOP A;  3TED A;  1JTY A;  2DJN A;  3E7L A;  1HOM A;  3M4O J;  2VPR A;  3BT9 A;  3RH2 A;  2XGC A;  2OER A;  2DMT A;  1LFU P;  2OF7 A;  1IG7 A;  3ZQH A;  4A3K J;  3A02 A;  3HOW J;  2HYJ A;  4A3F J;  1VFC A;  2HI3 A;  2JA6 J;  4J19 A;  4MFE A;  3WHC A;  5M5X J;  5EGO B;  4B4C A;  5EEA A;  3GTL J;  3QPL A;  1JUP A;  3IH4 A;  3Q0U A;  2CUE A;  2PZ9 A;  5FKK A;  2L7Z A;  1ETK A;  2XB5 A;  2G7G A;  1D5Y A;  2L7M P;  3S1M J;  2UXU A;  1UMQ A;  4LOC A;  2K9S A;  5E3M A;  1Q1V A;  3BTI A;  2DA3 A;  1JKO C;  2DMP A;  1TWH J;  2G7S A;  1X58 A;  1A5J A;  3BNI A;  3FIS A;  5C4J J;  2QIB A;  2E19 A;  2HXI A;  1JJ6 C;  1U9N A;  2JA5 J;  2G3B A;  3TW6 A;  5FMP A;  1ZKG A;  2EZI A;  4M3G A;  2ZCX A;  4JX4 A;  3HDD A;  1HF0 A;  2R5Z A;  2R93 J;  3RD3 A;  3WHB A;  4DYQ A;  1FJL A;  2XPU A;  4EEF G;  4L5E A;  1FTZ A;  3BQZ A;  1PUF A;  3HEF A;  5F0H A;  3ZQF A;  5DTD A;  4ME9 A;  1ETW A;  2DA4 A;  2TCT A;  4X6A J;  1GVD A;  3VVX A;  3JRF A;  3JRE A;  2O8K A;  1R9T J;  4CYC A;  3CDL A;  2MGQ A;  4PXI A;  1B8I A;  1A6I A;  5J1Y A;  4BXX J;  2L9R A;  3Q0W A;  3G7R A;  1GT0 C;  3H3V K;  3ANG A;  4DYR A;  2NP5 A;  3G56 A;  2IEK A;  4MIM A;  4A3C J;  3LJL A;  1H8A C;  1IGN A;  1K61 A;  1UG2 A;  4GCL A;  2G0E A;  4C3I J;  1WI3 A;  1BL0 A;  1S7E A;  4L62 A;  3K2A A;  2LVS A;  2ME6 A;  3AQT A;  4C3J J;  1HCR A;  5C44 J;  2FD5 A;  3GEU A;  1UI5 A;  2P81 A;  3NAR A;  4NEL A;  3P9T A;  3H0G J;  4DW6 A;  3GTQ J;  3FRQ A;  3GBG A;  2I10 A;  3QQA A;  1MBF A;  4C2M J;  3KZ9 A;  1H89 C;  2R5Z B;  3KNW A;  2UXH A;  5C3E J;  4MO7 A;  4IEJ A;  4A3D J;  1SGM A;  3VW1 A;  1Z77 A;  1MBE A;  2Y30 A;  4Y7N J;  1PUF B;  1E3O C;  3QKX A;  1QVU A;  2NOG A;  3OSG A;  3BR6 A;  2QWT A;  5GPC A;  3LSJ A;  4A3M J;  1AKH A;  4GFK A;  4CYC B;  3DEW A;  3CQZ J;  2K9Q A;  1B8I B;  3NRG A;  1ZK8 A;  2TRT A;  4A3E J;  3HB9 A;  2GFN A;  5C4Y A;  5FHP A;  2EQR A;  2M8G X;  2OI8 A;  2CUF A;  5EF6 A;  1OFC X;  2VUM J;  1GDT A;  3PAS A;  3JRA A;  3NPI A;  2ID3 A;  2LR8 A;  3RKQ A;  1YRN A;  3BHQ A;  2W53 A;  3OIO A;  4I76 A;  2QKO A;  5EZG A;  1GUU A;  1WH7 A;  3Q0V A;  2LP0 A;  4S0H B;  3GTM J;  4A3B J;  3AQS A;  2O7T A;  1I50 J;  2XGD A;  4B3A A;  3JRH A;  4M3B A;  3TP0 A;  4XRS A;  1ZR4 A;  1IC8 A;  1Z0X A;  5FKL A;  5EFY A;  2WUI A;  3S1N J;  3ANP A;  1JGG A;  1VF9 A;  5J3L A;  1MBJ A;  3GTG J;  2CJJ A;  1ZGW A;  3Q3S A;  2DA7 A;  3LHQ A;  3MN2 A;  3GTP J;  1NK3 P;  3HOU J;  4BKX A;  3EGQ A;  1T33 A;  4A3G J;  4DZP A;  1HLV A;  4YZE A;  3KKC A;  3VW0 A;  2DA2 A;  1VND A;  5FKN A;  1JT0 A;  3D1N I;  3BR1 A;  1BW6 A;  3ZQL A;  1TWG J;  4I6Z A;  2F07 A;  5F08 A;  4Y52 J;  1FEX A;  3IV5 A;  1AKH B;  1B72 B;  4BY1 J;  1QRY A;  2NX4 A;  1POG A;  3SFI A;  5IOY A;  4BBR J;  5HOD A;  2NVT J;  5GP9 A;  2DMN A;  5IYB J;  3HOX J;  2PMZ N;  3W6V A;  1VI0 A;  3CRJ A;  3HBL A;  5F04 A;  3NXC A;  1YRN B;  1HDD C;  4BBS J;  4JX5 A;  5FLV A;  5IP9 J;  2DA1 A;  3JRC A;  2R7Z J;  3G1O A;  3C07 A;  3RQI A;  1RR7 A;  3ZOB A;  2NP3 A;  2X6O A;  2ZB9 A;  4GFL A;  3LSR A;  1ETX A;  2NS7 A;  2JMW A;  5IOZ A;  1P7I A;  1I3Q J;  4XRM A;  5F0F A;  2YVH A;  5F0C A;  5JLW A;  1ETY A;  1NTC A;  5D18 A;  2O9L A;  3KKD A;  4D7N A;  5IP7 J;  2L7F P;  3F1B A;  1AHD P;  2HKU A;  4GCK A;  3PPB A;  2Y9Z A;  3S15 J;  2QF7 A;  3S5R A;  1ENH A;  2KDZ A;  2DA5 A;  3JRG A;  1APL C;  3GTK J;  4GCT A;  2ECB A;  4JL3 A;  4FE4 A;  4A69 C;  5FGL A;  4RDU A;  2R5Y A;  2GM4 A;  1MSF C;  1SFO J;  4G12 A;  2LTP A;  4X1E A;  2XGE A;  1U78 A;  5AQC A;  3BG5 A;  1U9O A;  1F36 A;  1ZTR A;  5K7H A;  1ITY A;  2JWT A;  4XID A;  3PM1 A;  4JNN A;  4M3F A;  3MNL A;  3S17 J;  3BJB A;  4A3J J;  1FIP A;  3JSJ A;  2FJ1 A;  2ECC A;  4B1R A;  2JA8 J;  3LNQ A;  4GFB A;  1ORK A;  2VI6 A;  1I6H J;  3CMY A;  3VVZ A;  1OJL A;  5FKO A;  3PO2 J;  1Y1W J;  4MLO A;  3BR2 A;  2B63 J;  2NVY J;  3BR0 A;  5H9T A;  5J1U A;  3HTI A;  4AC0 A;  1MH3 A;  3O8H A;  3GZI A;  3BTL A;  2GBY A;  3DCF A;  2N8G A;  3ZQG A;  1BJZ A;  4A93 J;  1BA5 A;  2W48 A;  1IDY A;  3FK7 A;  3C2B A;  5EG0 A;  2VKV A;  4RBO A;  2HOS A;  4QIW N;  2AHQ A;  2IAI A;  4KWA A;  1AU7 A;  1XG1 A;  5D1R A;  4V2F A;  2LK2 A;  3ZQC A;  2E2H J;  3JRI A;  5F27 A;  1BW5 A;  2GEN A;  5K58 A;  2RAE A;  2V57 A;  3V78 A;  3HTA A;  2QCO A;  5E3L A;  1QPI A;  3MVP A;  1RKT A;  4W1U A;  3TP3 A;  3BRU A;  2NVQ J;  2L0K A;  4AC6 A;  3BG9 A;  2YS9 A;  3K7A J;  2R5Y B;  3GTJ J;  1MBK A;  1ETQ A;  5K7F A;  1XC5 A;  2OPT A;  1UHS A;  5FLM J;  1LFB A;  2XPV A;  2ME0 A;  4QTR A;  2REK A;  2Y0S N;  4AF5 A;  2AO9 A;  2CU7 A;  2MW8 A;  2PBX A;  2IBD A;  2XB0 X;  5M5W J;  3MKL A;  1FIA A;  4JP0 A;  2WGB A;  2CQX A;  3BG3 A;  2ZCM A;  3I4N J;  3HTH A;  3IH3 A;  3BCG A;  5BNG A;  3DPJ A;  4NN1 A;  3S14 J;  2Y2Z A;  5IP6 A;  2XSD C;  9ANT A;  3HTJ A;  4M6V A;  2HOA A;  5EG0 B;  3BQY A;  2YUS A;  2DMU A;  1JKR C;  5EDN A;  1ZR2 A;  1CQT A;  5DS9 A;  3B6C A;  4V2G A;  3TW7 A;  4UUT A;  3EUP A;  5FKM A;  3OSF A;  1LE8 A;  5HSZ A;  3HOV J;  1QVT A;  3O8G A;  4IHW A;  4M3D A;  3S2D J;  1MBG A;  2FQ4 A;  4IHX A;  2UXI A;  3LOC A; 
#chains in the Genus database with same CATH topology
 4MGR A;  5C4X J;  2UZK A;  3A01 A;  4HZF A;  1G6N A;  3OYH A;  2KZG A;  3FM5 A;  2BY0 A;  4XLC A;  3K1M A;  2R4G A;  2PMU A;  2MD0 A;  2ZFU A;  3LMM A;  5EYR A;  1XS9 A;  3VVY A;  1Y1V J;  1IRZ A;  3U1K A;  4QSH A;  5ILS A;  1QO0 D;  3F72 A;  1VQ9 I;  4BXU A;  3LSP A;  1IV8 A;  4M3E A;  3TKY A;  2XC7 A;  2L02 A;  1JKP C;  3RSN A;  4BXF A;  5HAW A;  3OMY A;  4RB0 A;  2CFO A;  2NVX J;  2OTL I;  3E1S A;  4Z2Y A;  3ZQI A;  3J7A O;  1KYW A;  1J0R A;  2LOO A;  3ELK A;  3PUF A;  3MKW B;  5ICF A;  4JBA A;  1T56 A;  1OCT C;  3F8N A;  2DDA A;  3KP2 A;  3L9F A;  5M5Y J;  2CRG A;  3BOQ A;  4NC7 A;  3UKG A;  3G1L A;  3LST A;  1U8B A;  1USS A;  3ABM H;  4NB5 A;  2E35 A;  4IRV A;  3S1Q J;  2BE5 F;  2GLO A;  4IO9 F;  4GDF A;  4FX0 A;  3COL A;  2Y9Y A;  5D8K B;  1QHG A;  3ZMS A;  4HYE A;  1TQM A;  3CD6 I;  2IGM A;  2FOW A;  3TMO A;  3PNT A;  2Q2E A;  3H5R A;  2E7W A;  2JJ7 A;  4YEJ A;  1W7P B;  1ZGA A;  2HVS A;  3S2H J;  3B73 A;  3CUQ A;  1TWC J;  3GTO J;  4D5F A;  1SAN A;  1HKT A;  4ACI A;  3MKZ A;  1IDZ A;  3BR3 A;  1NK2 P;  4D5C A;  1FMV A;  5IYC J;  2NS8 A;  3CDI A;  3DFG A;  4N4O B;  2A2F X;  5CVJ A;  2V1U A;  3WTZ A;  5HLT A;  3E7Q A;  4XSX F;  3L1P A;  2EB7 A;  4HQE A;  4XKC A;  3WTW C;  3VP5 A;  5E1Z B;  1STZ A;  4WX9 A;  3RZD J;  2DMQ A;  2FML A;  2YSR A;  3MWM A;  4DBQ A;  3FMQ A;  2HDW A;  1D1B A;  5LFA A;  1MH4 A;  1VQP I;  4ETS A;  1QU3 A;  2FX0 A;  5DDG A;  3LAJ A;  4MFD A;  3SWH A;  3OIQ A;  1Z7L A;  4ENJ A;  2XDN A;  3KIO A;  1V5G A;  1OCZ H;  1V4R A;  1J75 A;  2CQ7 A;  3TL4 X;  4LFU A;  4BY7 J;  4HQM A;  5FJ8 J;  2K7L A;  3NQO A;  4OWR B;  2DXI A;  1JTX A;  2VKE A;  1DU0 A;  2YVX A;  3H3U A;  2D5V A;  2M7B A;  3H1C A;  2XRO A;  2R92 J;  4G7H F;  4DOZ A;  2RRE A;  4OIO F;  3I71 A;  2O7O A;  4PJ0 C;  1OIS A;  1XB4 A;  2EH3 A;  1EA3 A;  4P5O A;  2V4J C;  3L7W A;  3X2Q H;  4MHG A;  1B72 A;  5H6R A;  2FBI A;  4QPQ A;  2DJI A;  2Y31 A;  3BTJ A;  4Y15 A;  3RZO J;  2EIK H;  2KZV A;  3ABU A;  1UAA A;  3HE0 A;  2D6Y A;  2MA3 A;  4DZJ A;  4I0A A;  1IN4 A;  3HGY A;  2HOT A;  4UUS B;  1RZ4 A;  2NNY A;  1YIJ I;  1J59 A;  3BTC A;  5L3F A;  2PN6 A;  3FXL A;  4BE2 A;  1J5Y A;  2H1K A;  3L09 A;  4WCG A;  4W97 A;  3JRD A;  1Z21 A;  3FK6 A;  1X3Z B;  2CQQ A;  2QQA A;  4RM3 A;  5FLX Z;  3ABK H;  3IWZ A;  2WAQ N;  3HIM A;  2HXO A;  3FZV A;  2CW8 A;  4LIU A;  4A6E A;  3CJQ B;  5DAJ A;  2O8X A;  1WH5 A;  4UV9 A;  1MIJ A;  2QTQ A;  3I4M J;  1TP4 A;  3L2V A;  1IJW C;  2UXO A;  2ESN A;  2QOP A;  2Z1D A;  2DJN A;  2KQR A;  3E7L A;  2VJ4 A;  3M4O J;  4ASN A;  3RH2 A;  3BZC A;  4B43 A;  2STT A;  3IAM 2;  3HUG B;  3ZQH A;  2H27 A;  2XAG A;  2BW3 B;  5FD6 A;  4A3F J;  2DOF A;  3WTT C;  2HI3 A;  2HVQ A;  3M7G A;  3OYK A;  2CQK A;  4F3Q A;  4J19 A;  4HDU A;  3GO5 A;  4PGG A;  5EGO B;  4U9L A;  1SAU A;  5EEA A;  4M9Z A;  3BZ6 A;  3Q0U A;  2CUE A;  3R60 A;  2L7Z A;  1ETK A;  2G7G A;  2K4B A;  4A12 A;  4FX4 A;  5BS6 A;  3K10 A;  1D5Y A;  3L2W A;  3S1M J;  2RNJ A;  1MZB A;  5E3M A;  3BTI A;  1WQ2 A;  1UB9 A;  3ZMZ A;  1O7L A;  1TT5 B;  1XGO A;  3O3K A;  2JTV A;  1Y8R B;  4XKB A;  2EPF A;  2HWV A;  3EQL F;  1LVK A;  2L7K A;  4P55 A;  1SD6 A;  4XLH A;  4ENM A;  4PJN A;  1Z7U A;  3TW6 A;  2VKD A;  4DVY P;  2EZI A;  2RGV A;  3ZMD A;  2JSP A;  4Q5S F;  2R7V A;  2QZ8 A;  1VQL I;  3FMS A;  2KIS A;  3WU2 C;  4Z6Y A;  2D45 A;  1FTZ A;  3TO9 A;  2ZME C;  2OQR A;  3HEF A;  5F0H A;  3ZQF A;  4KN4 X;  2W85 A;  5DTD A;  1ETW A;  5LHH A;  1GVD A;  4BQO A;  1SAX A;  1R5H A;  2CMP A;  2O8K A;  4UV8 A;  2MGQ A;  4EJV A;  4ZTF A;  4LLL A;  2RNG A;  4F92 B;  3H3V K;  1YO5 C;  3FWE A;  4DYR A;  3SXY A;  4G8X A;  3VOE A;  2DQL A;  3LJL A;  2GWR A;  1D1C A;  1UG2 A;  2RN7 A;  4EGY A;  2HQN A;  2KPM A;  2G0E A;  3RKX A;  3OV8 A;  3UR3 C;  3F6O A;  2QKL B;  4AU7 A;  2LSO A;  3CDH A;  3I64 A;  1SD4 A;  2ZJP F;  5C44 J;  1RIO H;  2V6E A;  3GEU A;  2XF7 A;  3NAR A;  5CLS A;  2L9S A;  4IHT A;  3H0G J;  1VQ8 I;  3FMR A;  2VJI A;  4HF1 A;  4KT6 A;  3OS0 A;  1H89 C;  4MO7 A;  4IEJ A;  3BZK A;  3VW1 A;  1NG6 A;  4XL9 A;  4Y7N J;  1OPC A;  3K4M A;  5CPR B;  1PUF B;  1E3O C;  1VQ7 I;  1QVU A;  2FUG 2;  4BYY A;  3TGN A;  3BR6 A;  2EIL H;  2PFB A;  2W24 A;  1WKM A;  3HRT A;  3BJO A;  4M71 A;  1LEA A;  1GHC A;  3NRG A;  4A3E J;  5IT3 A;  4UY8 I;  2R7O A;  4CCM A;  4U7D A;  5C4Y A;  2EQR A;  4U87 A;  4XBF A;  2CUF A;  1OFC X;  3JSO A;  2J5P A;  3JRA A;  3PAS A;  3CCQ I;  4XM3 A;  3GFM A;  3FBI B;  3S3O A;  3BG7 A;  1B9M A;  3BHQ A;  2WAE A;  2RQQ A;  2VQG A;  1LUJ B;  2XAQ A;  3LWF A;  3TO6 A;  4D1Q A;  4XN0 A;  3DLL F;  3IKT A;  3ZQQ A;  2H6B A;  2QEX I;  6PAX A;  1I50 J;  2EWN A;  2NOJ B;  2VE8 A;  4Q4Z F;  3JRH A;  2WAF A;  2STW A;  3NWS A;  2QSF X;  4M3B A;  3H0D A;  1FOY A;  2QQ8 A;  1Z0X A;  3BJA A;  3IRQ A;  1T38 A;  3VWB A;  1FC3 A;  2IXS A;  4IXA A;  3WU1 B;  1R4N B;  3S1N J;  2DYR H;  2V1D A;  5J3L A;  3EPZ A;  5HS9 A;  1QZZ A;  2E1C A;  2DA7 A;  3KFW X;  3LHQ A;  1LJ9 A;  2MBF A;  1YJW I;  5B1B H;  1NK3 P;  3HOU J;  4BKX A;  5DM7 F;  3EGQ A;  2W82 A;  4BGD A;  3F22 A;  1T33 A;  5FLX K;  2GXG A;  3TDZ C;  5D5X B;  2JQ7 A;  5CVR A;  2P7C B;  3VW0 A;  1VND A;  2E34 A;  3QU3 A;  3QOE A;  5FKN A;  4AD9 A;  1JT0 A;  5KK1 A;  5E17 F;  1IAW A;  2VN2 A;  1HQC A;  1TWG J;  3F8C A;  4I6Z A;  2D1H A;  1CF7 B;  5F08 A;  4LG0 B;  3IV5 A;  1AKH B;  1B72 B;  4BY1 J;  2VBX A;  2XF6 A;  3SFI A;  3QYB A;  4E70 A;  4YFN F;  2DMN A;  2HZD A;  5IYB J;  2DYS H;  5KAI C;  3EYY A;  3W6V A;  5AON A;  3CRJ A;  4ITV A;  3BCA A;  4QPO A;  4OIN F;  2R7X A;  3NXC A;  1OQY A;  2VAS A;  1LEB A;  1JHF A;  3GFJ A;  2L5Q A;  1H9T A;  1HDD C;  2P8T A;  4Y13 A;  3CCE I;  3CJN A;  2MLK A;  2H09 A;  1WJB A;  3GLL A;  1U3E M;  3C07 A;  2KL4 A;  1XSX A;  2X6O A;  2K86 A;  5GTH C;  5LRS A;  4GFL A;  3HC7 A;  1T08 B;  5E8I A;  3LSR A;  1ETX A;  3CC2 I;  1F5T A;  2BV6 A;  2H1L A;  2YVH A;  4XRM A;  4UVB A;  4R79 A;  5F0C A;  5D18 A;  3PNV A;  3KKD A;  4HV6 A;  1OCC H;  5IP7 J;  2KRF A;  2Y9Z A;  3S5R A;  2ZXI A;  3MZY A;  1APL C;  3OY9 A;  4A0X A;  3MKY B;  4KFC A;  4JL3 A;  2RV8 A;  1V3F A;  4LK1 F;  4L9N A;  4CCJ A;  5FGL A;  4BQQ A;  2ZME B;  2R5Y A;  3K4K A;  4UNO A;  1B6A A;  4X1E A;  2LTP A;  1HW5 A;  1SFK A;  3TBI A;  4E4H A;  2KHM A;  3T0Y A;  5J4Y A;  2Z3Y A;  1IXS B;  3GXO A;  5AQC A;  4B09 A;  4EV0 A;  1YX3 A;  3HIF A;  3PM1 A;  1A35 A;  2NS0 A;  4M3F A;  3BJB A;  4A3J J;  4B1R A;  4EM1 A;  2JA8 J;  3J80 Z;  2L9V A;  1WJC A;  3CCS I;  1SFU A;  4BQA A;  2LF7 A;  1YS6 A;  2J5O A;  1ONV A;  3PO2 J;  4MLO A;  1UST A;  3BR2 A;  5HS7 A;  2HOE A;  2Y48 A;  1XSV A;  3MEX A;  4CDG A;  4L5I A;  1PJR A;  3I0T A;  3DCF A;  2N8G A;  3ZQG A;  3RPU D;  2FRH A;  3DTK A;  1V5F A;  3OYI A;  2VKV A;  2QQ9 A;  2K3F A;  1A6Q A;  2IAI A;  4HRI A;  5D1R A;  2A6E F;  3ZQ7 A;  2ESH A;  4V2F A;  4U0Y A;  3JRI A;  5F27 A;  2X6Y A;  3EYI A;  2GEN A;  2R7F A;  4EJO A;  2QCO A;  4HLX A;  1UHM A;  5JI6 A;  4IOC F;  3QP6 A;  3TP3 A;  2V9P A;  1YFH A;  5AIP A;  2NVQ J;  1FPQ A;  2L0K A;  3K9T A;  3L2U A;  1FNN A;  2IRF G;  2LDU A;  1LDJ A;  5K7F A;  3U9G A;  2CUJ A;  2P6T A;  1Z1D A;  2EIJ H;  5CVU A;  2X1C A;  1Y6I A;  5FLM J;  4UUV A;  3E3V A;  2KJB A;  3J7Z I;  1BIA A;  2B9S A;  2Y0S N;  1KU2 A;  1WWX A;  2AO9 A;  2MW8 A;  3DTE A;  1T6S A;  2IBD A;  2XB0 X;  3RJP A;  2W25 A;  2C6Y A;  3PUB A;  3MKL A;  1FIA A;  1UCR A;  2CQX A;  2R7S A;  2ZNZ A;  3GW2 A;  3GX4 X;  3I4N J;  2CV1 A;  3IH3 A;  5LEJ A;  2EFW A;  1V5E A;  5BNG A;  4NN1 A;  3J7Y J;  4ZDL A;  3OYE A;  4J01 A;  5HOO A;  2Y2Z A;  4XOR A;  3HTJ A;  3ISP A;  3RKY A;  4XR6 A;  4H0E A;  2K9L A;  5EG0 B;  4HAM A;  3BQY A;  1YLF A;  2DMU A;  4PJJ A;  3GEZ A;  2Q1Z B;  2F5C A;  3UNG C;  3S2W A;  3HG9 A;  2HYF A;  3O8G A;  3BDD A;  2ZXW H;  4IHW A;  3S2D J;  2JSC A;  1FSE A;  2UXI A;  1D1A A;  3CTA A;  1MJA A;  5EZH A;  1WGX A;  5FRN A;  1V54 H;  4AIK A;  3S1R J;  2MSY A;  4ZYG A;  1W7P A;  3CP8 A;  5KVR A;  2IA1 A;  5IT9 Z;  2DA6 A;  1JI8 A;  1GV2 A;  2PJP A;  2M9H A;  4KIC A;  2B1E A;  2JPC A;  1MBH A;  1XGN A;  1T0F A;  4A0Y A;  3DEU A;  1EJ9 A;  3FKI J;  1ZG3 A;  1FT9 A;  2FMY A;  2NXN B;  2OCE A;  4MK6 A;  3SJM A;  4IZZ A;  3LSH A;  2H8R A;  3CJR B;  4RLF A;  2K9M A;  1RES A;  4IHY A;  1IUY A;  3CMM A;  1ERD A;  3VUQ A;  3TOB A;  4YG2 F;  3S93 A;  2ELH A;  5IPA A;  1HDP A;  2KJC A;  4N9I A;  1MSE C;  4XKV A;  2WBM A;  1XMK A;  2HQA A;  2VKH A;  5D19 A;  4B48 A;  1KQ0 A;  2DI3 A;  2OA4 A;  3G1M A;  5K7Z A;  2GIV A;  2IA0 A;  3L2R A;  3EUH A;  2KKO A;  1O3S A;  1WFX A;  4ZZD A;  3F8M A;  3KZZ A;  4RGR A;  1KQ9 A;  1A36 A;  4PUS A;  3I4P A;  2E7X A;  4I01 A;  1IN7 A;  2H94 A;  4J00 A;  1REP C;  5JVG F;  2E71 A;  1LKX A;  2CYY A;  3DKY A;  2XKO A;  2KIQ A;  3P9C A;  3V8L A;  3GF2 A;  1EF4 A;  4HKU A;  3H92 A;  4A3L J;  2DK5 A;  3DTI A;  2VBY A;  1OYY A;  3E5U A;  2V1X A;  3ULQ B;  1P9Q C;  2DOA A;  2W84 A;  4HX8 A;  1T2K A;  4UUS A;  1U8R A;  2EZL A;  3IH2 A;  4ABZ A;  3OL3 A;  4E7K A;  1VQ6 I;  1W5T A;  2ZNY A;  1WJE A;  1MND A;  2M45 A;  4IKF A;  2VOD A;  4F55 A;  5F1J A;  5E18 F;  3J80 K;  4EJW A;  3KYC B;  2G7L A;  1JUM A;  1N25 A;  2JN6 A;  2CUZ A;  2K9N A;  1YTY A;  2ACJ A;  3WE3 A;  1DU6 A;  2P5L C;  4MEX F;  5BQT A;  4NDL A;  5FFX A;  5HBU A;  2BVL A;  2LD5 A;  4ICH A;  4RAZ A;  1YOV B;  2V79 A;  1X3W B;  5E20 A;  1G2H A;  3ASN H;  1GXP A;  2OZU A;  3OOU A;  4MXM A;  4OD5 A;  1K83 J;  3E6M A;  3HUG A;  1HST A;  1H9G A;  3O2P E;  4RMN A;  3S3N A;  4L0Z B;  2BW3 A;  2LNB A;  1TNS A;  2O61 A;  2NNN A;  4GGG A;  3HOY J;  1VQM I;  5K5R A;  1FBQ A;  4OU0 A;  5EGO A;  2P5K A;  4GRI A;  1JUS A;  2HR3 A;  5CVV A;  4JKZ A;  4BNC A;  5L3B A;  5BOX A;  1MNM C;  2W00 A;  1P92 A;  2HDD A;  2ZXH A;  1I5Z A;  1E3P A;  2QVO A;  3C1D A;  5F64 A;  4AYB N;  3FDY A;  3CLO A;  3GZ5 A;  4KUM A;  4AYB A;  5CYV A;  2X48 A;  4PJM A;  4BHC A;  4AUX A;  4IVN A;  5M3M J;  3HOZ J;  2R0Q C;  3GYH X;  3MQ0 A;  2LRD A;  2XGX A;  3VYR B;  1SFE A;  3PFY A;  2GUH A;  2EV0 A;  3F0C A;  5LRR A;  2O0Y A;  1WJF A;  1D3Y A;  1X1A A;  2XPW A;  5LGT A;  3E6D A;  3ERM A;  3V7R A;  3JR9 A;  2E5Z A;  2VBZ A;  3A03 A;  3TED A;  1GXQ A;  2GIZ A;  2IS4 A;  4IX7 A;  3GWZ A;  2XGC A;  1TT0 A;  1Y0N A;  2HTJ A;  5J8C A;  2QEN A;  2WWY A;  1OKR A;  1AOY A;  2M4K A;  1RC9 A;  4O6J A;  2LC2 A;  5IT9 K;  2OBP A;  1RR8 C;  1FMW A;  3ML6 A;  3GTL J;  1KQ8 A;  3D5S C;  3IH4 A;  3LA7 A;  4GYG A;  4MTD A;  1Z9C A;  3OWT A;  2WY7 Q;  2L7M P;  2UXU A;  3CES A;  3GLX A;  2ZXJ A;  3HHG A;  4LG3 A;  1JKO C;  1W4M A;  3H5N A;  4WWC A;  1I1S A;  5LGN A;  1A5J A;  4KYW A;  3FIS A;  1R00 A;  1WHU A;  3R61 A;  1JJ6 C;  1FOW A;  1U9N A;  2JA5 J;  2AQF A;  2R7D A;  2XAJ A;  2XSJ C;  2CV0 A;  1ZKG A;  3DKX A;  2FE3 A;  2ZCX A;  1DPU A;  3JAM K;  3HDD A;  2VJJ A;  2R7R A;  2R93 J;  1FJL A;  2E36 A;  2AXL A;  3E6B A;  1MJ9 A;  5L3E A;  1FOK A;  4EEF G;  3ROU A;  1D8K A;  1PUF A;  1I27 A;  3FXQ A;  2ZJ2 A;  5D8L B;  4RS8 A;  5JVT A;  4X6A J;  3VVX A;  3KEQ A;  3JRF A;  3DPU A;  1NH3 A;  3FXM A;  3PNY A;  1R9T J;  2LRE A;  2XV4 S;  5HS8 A;  1S7A A;  1SVO A;  2Y75 A;  4CZZ A;  1EH8 A;  4I2O A;  5F6F A;  4B47 A;  4NHJ A;  3G7R A;  2K85 A;  2PX9 A;  4MEY F;  4II3 A;  1JE8 A;  2NP5 A;  2M3A A;  5GAH J;  2DFH A;  2QBY B;  2JRT A;  4U88 A;  1H8A C;  1IGN A;  1X1C A;  2CQN A;  2CSO A;  3ZN1 A;  4LJZ F;  3ZMU A;  4C3I J;  2Z16 A;  1SMY F;  2EFO A;  1R23 A;  2LMD A;  1O3R A;  2DFE A;  2ME6 A;  2ZY9 A;  3ABT A;  2FD5 A;  3WOD F;  4ESJ A;  2A5Y B;  1QHH D;  2P81 A;  3VYU B;  4NQW B;  1N75 A;  3P9T A;  3I54 A;  3FRQ A;  2MFZ A;  3WTX C;  1ULY A;  3HHH A;  3KNW A;  5C3E J;  4ON0 A;  2RDP A;  4A3D J;  1BI0 A;  4L18 B;  4G7Z F;  2VQH A;  2QUF A;  1CF7 A;  2P4W A;  3I58 A;  4LG0 A;  2QWT A;  2IVM A;  5GPC A;  3OYJ A;  3CCR I;  1AKH A;  2B3W A;  3OYN A;  4CYC B;  2ZJR F;  3W2W A;  1DP3 A;  3RYP A;  3MMY B;  2K9Q A;  2TRT A;  3JTH A;  4NUB A;  4XLP F;  5JFR A;  2GFN A;  3V4G A;  3C7J A;  3CJT B;  3GVA A;  3T8T A;  2VOO A;  1TZL A;  2QYO A;  2WV0 A;  1MMG A;  3RKQ A;  2PLY A;  3OIO A;  4GO1 A;  5EZG A;  3GTM J;  3AQS A;  2LP0 A;  4A3B J;  2O7T A;  3VSK A;  2V1N A;  4PGH A;  2QGU A;  3IP4 B;  3L2Q A;  3I3L A;  4RGS A;  3A0H C;  5ILU A;  3K70 D;  1X4O A;  1BJA A;  1IC8 A;  2CW0 F;  4TV7 A;  3VYT B;  2WAQ A;  4HBL A;  3KP6 A;  1R5I D;  2P0W A;  3GTG J;  5D5V B;  3W2A A;  4CCO A;  3Q3S A;  3KYD B;  4FQG A;  2RC4 A;  3MN2 A;  3C2H A;  1R6R A;  4R8H A;  1U2W A;  3CCJ I;  4UB6 C;  2OTJ I;  4AID A;  1BR1 A;  1YYV A;  1HLV A;  4KIT B;  4YZE A;  4EVI A;  3K4L A;  4ESF A;  4XQF A;  2ZME A;  3DBH B;  1YW8 A;  1JXS A;  3RYR A;  4BAC A;  2F07 A;  1R58 A;  3LSK A;  2R7T A;  3CLQ A;  2V9V A;  1QRY A;  4BHB A;  3WE2 A;  5IOY A;  2LY2 A;  1ZLK A;  3P7N A;  2IS2 A;  2UUZ A;  2PMZ N;  2RQP A;  3A0B C;  2Z33 A;  3N4M A;  1YJ9 I;  3HBL A;  3DLA A;  4MTE A;  2VT3 A;  1O57 A;  3F8F A;  1K6Y A;  3BPX A;  2H6C A;  3CC4 I;  1DQU A;  5A2Q Z;  1YRN B;  2F5E A;  4D9J A;  2DOE A;  4JOM A;  3VOD A;  1RNL A;  3JRC A;  2R7Z J;  2KLO A;  3M1C A;  3P9K A;  1XMA A;  3ZR8 X;  1RR7 A;  3ZOB A;  3HTU A;  5H6Q A;  1BC8 C;  3CME I;  2ZB9 A;  3GCM A;  2ZJQ F;  1F9N A;  3SQN A;  1ZAO A;  2DTR A;  2NS7 A;  1W5S A;  4XON A;  5KHD A;  1I3Q J;  2HS5 A;  1ETY A;  3O6B B;  5E1W A;  2IPQ X;  4A6D A;  1Z3Y A;  2QF7 A;  3SYT A;  2DA5 A;  4FHT A;  4PSX A;  3JRG A;  1T95 A;  5D6E A;  5FFZ A;  1BC7 C;  2DFI A;  1E2X A;  1IRG A;  2ECB A;  2YPR A;  4FE4 A;  1ZN2 A;  2R7Q A;  2VL8 A;  4A69 C;  3T8R A;  5HDG A;  2G9W A;  3WG7 H;  2EJR A;  5KNL A;  2JVH A;  3AG3 H;  3JSP A;  3L2C A;  2BBY A;  2M1B A;  5J4V A;  3IAS 2;  1HW1 A;  1L0O C;  2M8E A;  3IL2 A;  3BG5 A;  3G73 A;  2ZBK A;  3VEP A;  1ZTR A;  5K7H A;  3SEZ A;  1ITY A;  3HL2 A;  2EK5 A;  3QWL A;  4BHP A;  2W57 A;  2R7U A;  1RUN A;  1ORK A;  2MC4 A;  4FET A;  3VVZ A;  1J2X A;  4I09 A;  2DW4 A;  3R6S A;  1Y1W J;  2B63 J;  2NVY J;  3BR0 A;  3MD2 A;  4IHS A;  5J1U A;  3HTI A;  1S3J A;  4XN3 A;  3N97 A;  4AC0 A;  1MH3 A;  3GZI A;  1QGP A;  4OAZ A;  3K70 C;  4A93 J;  2MC3 A;  2W48 A;  4HW0 A;  1IDY A;  1SFX A;  3C2B A;  3FK7 A;  5EG0 A;  1FLI A;  1PP8 F;  4RBO A;  4PFO A;  2IGO A;  4C2M A;  5DV5 A;  3OYL A;  1WJA A;  2LK2 A;  5K58 A;  3E97 A;  1O3Q A;  4PK4 A;  3V78 A;  1G3S A;  3L00 A;  2GXA A;  1QPI A;  3BRU A;  1D0Y A;  3FF5 A;  3ASO H;  1B9N A;  4B3X A;  1BOB A;  4AC6 A;  4M73 A;  2YS9 A;  4Q48 A;  4L0Y B;  5JR3 A;  1DPR A;  1QZY A;  1UHS A;  1YJN I;  2XPV A;  4F52 A;  1ZLJ A;  3K0L A;  1YE9 A;  2GAU A;  2CU7 A;  3DU5 A;  1ON1 A;  2Z99 A;  3I59 B;  3M8J A;  1PUE E;  4PSW A;  5M5W J;  2PBX A;  2WGB A;  2LY1 A;  1K78 B;  2UXN A;  5D5W B;  2KIF A;  2ZCM A;  1QBJ A;  4I02 A;  3ERE D;  4HF2 A;  1BR4 A;  2X51 A;  4KIG A;  3A4C A;  4BL0 B;  3BCG A;  4CCN A;  3J81 Z;  2DQR A;  1DP7 P;  1XGS A;  1QA6 A;  2E60 A;  2Q0O A;  2XSD C;  9ANT A;  4U7B A;  4E7J A;  4D0P A;  4EM0 B;  2VC1 A;  4EQQ A;  2YUS A;  2KIM A;  4YIF A;  2P5V A;  4V2G A;  1MDM B;  3EUP A;  3OSF A;  3RQ4 A;  1UJ8 A;  5HSZ A;  4UB8 C;  4BAY A;  2FQ4 A;  1ZQ3 P;  2EV5 A;  4LB5 A;  4X0G A;  4H4K C;  3RDI A;  2DN0 A;  2A69 F;  4AM3 A;  3LFK A;  2DG8 A;  3AKZ A;  3LSI A;  3V8J A;  1GV5 A;  2FNA A;  3KE2 A;  1TQI A;  2WB1 N;  5TIS C;  3M8F A;  2F4O B;  4BUP A;  3JRB A;  4DNC A;  1O3T A;  4XLN F;  3PQJ A;  1O7F A;  1TWF J;  1RRJ A;  2ID6 A;  5L3C A;  1TWA J;  3OS2 A;  2Q24 A;  1ETO A;  4XLF A;  4IRH A;  2EIN H;  1SEU A;  1U5T C;  2B7E A;  2M0M A;  2RKH A;  1S6L A;  2FXA A;  2EZH A;  4M9X A;  4I99 C;  5A2Q K;  3IUV A;  3FXK A;  4IQJ A;  3SZP A;  2JUC A;  2PMH A;  4HEA 2;  3T5X A;  2VQC A;  1IUF A;  1K4S A;  2JA7 J;  4YII A;  1X1B A;  2WV1 A;  3EDP A;  2RHA A;  2I5U A;  5DYM A;  1KA8 A;  2XF5 A;  3AG2 H;  1RUO A;  2JVG A;  1D5V A;  2B0L A;  3HRU A;  2XUB A;  2NRA C;  4EMS A;  1G3W A;  2COB A;  2FNP A;  4I98 B;  1LE8 B;  2CG4 A;  3ZPL A;  1WI9 A;  3NRV A;  5ED4 A;  1F43 A;  4XRS G;  2O03 A;  1PVE A;  2IU5 A;  5B1A H;  1ZRC A;  2IT0 A;  2BEO A;  4XK4 A;  3LWJ A;  3LFU A;  1IV6 A;  1OCP A;  2V26 A;  5CQG A;  1KYZ A;  2TDX A;  1F4K A;  4ZYD A;  3R0A A;  4BS9 A;  3CP2 A;  3H35 A;  2KMU A;  1Y0U A;  3VOX A;  4WF2 A;  3D5R C;  2K27 A;  2MAB A;  2DG7 A;  1KU3 A;  3VTI A;  4DIQ A;  1LVA A;  5CW8 A;  2O5R A;  3KLO A;  1UEL B;  4LD5 A;  2OV7 A;  3VW2 A;  3KZY A;  4HOB A;  2Z5U A;  2YVE A;  1X4P A;  2VON A;  1QZE A;  2HU9 A;  3DEE A;  1G4D A;  3H36 A;  1TC3 C;  2PEX A;  2IP2 A;  2HEO A;  2HQ5 A;  4CO8 A;  2XAF A;  5TGT A;  1W0T A;  2MG4 A;  3NS4 A;  3LL7 A;  3OYM A;  5E3O A;  3OYF A;  1D8J A;  1TW3 A;  3LQR A;  4FCY A;  2DPU A;  3ZP5 A;  4M6X A;  4CH7 A;  1K7A A;  2EFQ A;  5D5U B;  1Z6T A;  3GFL A;  2ZCN A;  5IY5 H;  3CCV I;  1Y8Q B;  1WJD A;  3FXJ A;  1OCO H;  1PDN C;  1ETV A;  3M8E A;  2DLL A;  3U1D A;  3TOA A;  2Y0S A;  1G59 A;  4KMF A;  4BDY A;  4C2U A;  2XAU A;  3HKZ N;  2M4G A;  4IHV A;  3V7S A;  2DAO A;  2GQQ A;  2AS5 F;  3HOT A;  3NNR A;  1BI2 A;  5K1Y A;  1S8N A;  2PJR B;  4AIH A;  3C3W A;  2WTE A;  3R4K A;  1SMT A;  4BJ6 C;  4B8X A;  2EZK A;  2E1O A;  1LNW A;  1IN8 A;  2EIM H;  2ZSI B;  1PP7 U;  3CWR A;  1P7J A;  4OMZ A;  3KYL A;  3FXR A;  4CYD A;  4HX4 A;  3ON2 A;  2K4J A;  3DBL B;  3J81 K;  4CGR A;  4PFP A;  3E6C C;  2HYG D;  3BP8 A;  2W7N A;  3S16 J;  1ZGJ A;  1MKM A;  2K3P A;  5ILV A;  2M30 A;  2LKS A;  1TL8 A;  3HPG A;  2FU4 A;  3PO3 J;  1JGS A;  3F9K A;  4BJ5 C;  1HOM A;  3RPU A;  3BT9 A;  3A2K A;  1BBY A;  3T1B A;  2X4H A;  1LFU P;  4KMU X;  2OER A;  1OCR H;  1IG7 A;  4NBQ A;  2LH9 A;  5FO5 A;  1XDS A;  2HYJ A;  2JA6 J;  3IUO A;  2F48 A;  1EH6 A;  3GME A;  2QBY A;  5M5X J;  2DT7 B;  1CGP A;  4B4C A;  4DJA A;  1BN5 A;  3QPL A;  4RA2 A;  2PZ9 A;  4FAS D;  5FKK A;  4LLG F;  1Y39 A;  1FBU A;  1IW7 F;  4IRG A;  4LOC A;  4N9H A;  1Q1V A;  2Y69 H;  2DA3 A;  3S32 A;  1TWH J;  3AG1 H;  2G7H A;  5KCM A;  3ZMT A;  4HSR A;  3BPV A;  3BNI A;  4QWQ A;  1U5T B;  2HXI A;  4NQW A;  2QQB A;  4XRF A;  3H9J A;  3ABL H;  4IPA A;  4OIR F;  2RVC A;  4M3G A;  3QOD A;  1HF0 A;  3QOP A;  3RD3 A;  3WHB A;  4DYQ A;  4XKW A;  2XPU A;  5CKT A;  3BQZ A;  2ZSH B;  2TCT A;  1LPQ A;  5EEG A;  1ZH5 A;  2VQL A;  3JRE A;  2IS6 A;  4CYC A;  4CHU A;  3CDL A;  2M87 A;  3IKV A;  4WXH A;  4PXI A;  4KT5 C;  1MW7 A;  5FRO A;  4O5V A;  1IXR C;  4BXX J;  2L9R A;  2FA5 A;  3ANG A;  3A1Y A;  3G56 A;  1OMI A;  4A3C J;  1XN7 A;  1Z6R A;  1TBX A;  4CUG A;  1IN5 A;  2QLZ A;  2IGK A;  1OR7 A;  3W6K B;  1WI3 A;  1B59 A;  5EJC A;  5B66 C;  4L62 A;  3K2A A;  4KIF A;  1XD7 A;  1TTY A;  3G2B A;  2A68 F;  4C3J J;  5ICE A;  3KET A;  3KP3 A;  3LAP A;  3OIP A;  1C0W A;  5J40 A;  3MFK A;  1BM9 A;  1UI5 A;  2OU2 A;  4P9U A;  2Q8K A;  1TNT A;  2L3D A;  4DW6 A;  4EAT A;  1FWZ A;  3GBG A;  4IOA F;  2JA2 A;  2W1O A;  3QQA A;  2YX4 A;  1MBF A;  4C2M J;  3KZ9 A;  3U21 A;  3KP7 A;  4KJZ A;  4E7I A;  2R5Z B;  2UXH A;  4GXO A;  1XCB A;  3F6V A;  2DT6 A;  2DFF A;  1Z77 A;  2L2O A;  1FP1 D;  1MBE A;  3CMA I;  4LK0 F;  3J7A Y;  1YX5 A;  3QKX A;  2FOK A;  3QPH A;  3GZ6 A;  1ON2 A;  2WA0 A;  3LSJ A;  4GFK A;  1H0M A;  4CSW A;  1NG7 A;  1BIB A;  2F5V A;  2HGC A;  4JK1 X;  1B8I B;  3P5J A;  1U0J A;  3HB9 A;  3ZXS A;  2EV6 A;  3W2V A;  5FHP A;  3VDX A;  2M8G X;  2OI8 A;  2VUM J;  2L01 A;  2XDV A;  5BMZ A;  1GDT A;  3RPQ A;  2DOD A;  4CA0 A;  2ID3 A;  2LR8 A;  1N77 A;  1YRN A;  3BCB A;  1GUU A;  1WH7 A;  3Q0V A;  4S0H B;  1D0X A;  3CCU I;  1B1B A;  5FRM A;  3OOP A;  2XGD A;  4B3A A;  1LFP A;  3BWG A;  4RAY A;  3SZT A;  3TP0 A;  2GXB A;  1X1P A;  4XRS A;  4YFX F;  5FKL A;  5EFY A;  1J9I A;  3M1E A;  4L9J A;  4ZYE A;  2DK8 A;  2XHK A;  1JGG A;  3ANP A;  1MBJ A;  2CJJ A;  5DEQ A;  3WTU C;  1V55 H;  3QPT A;  2BGC A;  3GTP J;  3Q5F A;  4M72 A;  1LDK B;  4XOT A;  4HG2 A;  3W6J B;  1BOA A;  3K4C A;  4RAG A;  1X1D A;  4DZP A;  1X19 A;  2K5C A;  3KKC A;  1HKQ A;  3KCC A;  2VXD A;  4G6Q A;  4M9S A;  3D1N I;  4ZTJ A;  4U9N A;  2ZKZ A;  1BW6 A;  2DCE A;  2ISY A;  3VYS B;  1MMS A;  4ZC3 A;  1K4T A;  2UV1 A;  1FEX A;  4EJU A;  3VSL A;  2P7V B;  1POG A;  4BBR J;  5J6X A;  4OD4 A;  3K6G A;  5HOD A;  1HKS A;  4WXC A;  5GP9 A;  3HOX J;  1FOX A;  2HPM A;  3PIP F;  1E17 A;  5F04 A;  1JHH A;  4OOI A;  1P4A A;  5DCM B;  3LA3 A;  2VT2 A;  4S04 A;  3K4B A;  4PJL A;  4JX5 A;  2DA1 A;  4KIB A;  3G1O A;  3RQI A;  3HOS A;  2VLA A;  2VBW A;  1WJ5 A;  2KDO A;  3RKW A;  2Z2S B;  3W3C A;  4DGW B;  1EH7 A;  2CS3 A;  3MZ8 A;  2MD5 A;  5JLW A;  2O9L A;  2G7U A;  1G8X A;  4D7N A;  4BEH B;  4XOP A;  1AHD P;  1QPM A;  2HKU A;  3PPB A;  3I56 I;  1ENH A;  2KDZ A;  4BE0 A;  2COM A;  1DGW Y;  2O3F A;  3U2R A;  1UHW A;  4RDU A;  1MSF C;  4XSZ F;  4C30 A;  1SFO J;  2L4A A;  2L54 A;  3DKW A;  3F3X A;  2JPB A;  3KP4 A;  1S9H A;  1U78 A;  4XMY A;  1U9O A;  2MH2 A;  2BHZ A;  2IA2 A;  3M07 A;  5F1R A;  4XID A;  1PYV A;  4M74 A;  2BXY A;  3TQN A;  3FXU A;  4G6T B;  3I59 A;  4JNN A;  3S17 J;  3OYD A;  4AIJ A;  5GTI C;  1LQ1 A;  2FJ1 A;  1K78 A;  3IRR A;  5GAD J;  3LNQ A;  1SD5 A;  1ZHF A;  1MD0 A;  2VI6 A;  3MZH A;  3IWF A;  1I6H J;  1OJL A;  1K6O A;  5GAG J;  3REO A;  5H9T A;  1ZRF A;  3O8H A;  1N78 A;  5LGU A;  2QSH X;  1G3Y A;  2GA2 A;  1BA5 A;  2AXT C;  3ZMV A;  2BXZ A;  2BVM A;  2V9K A;  2AHQ A;  3TDU C;  4I0B A;  3KEY A;  1XG1 A;  3LOC A;  1MDM A;  3FBN B;  4NC8 A;  1BW5 A;  3HSE A;  3MCZ A;  5B5E C;  2E2H J;  4DBR A;  1KON A;  3HTA A;  4V19 K;  2BYV E;  3MVP A;  1I3A A;  1RKT A;  2IGN A;  4RB1 A;  4LIT A;  1R7J A;  3CUQ C;  3K7A J;  1WZ2 A;  1MBK A;  2JUG A;  2OUM A;  3BG6 A;  4HLY A;  1XC5 A;  1AWC A;  2E1M C;  1DGR M;  1LFB A;  1XMX A;  2F6C A;  5BPD A;  4P1W A;  3CC7 I;  2H8W A;  4AF5 A;  4MQ9 F;  4AVP A;  3CF5 F;  3KZI C;  3VB2 A;  1GVJ A;  1Z67 A;  4BE1 A;  3I53 A;  3BG3 A;  5L3D A;  4GCV A;  4ZYA A;  3RTR A;  3WGH A;  4Y3O A;  4YEL A;  3PIO F;  3DPJ A;  4NC6 A;  1MMD A;  2A6T A;  4C9Y A;  3IHU A;  4G6D A;  1YIO A;  3FHN A;  1W5C C;  3E5Q A;  3RCO A;  5IP6 A;  4E7H A;  1YS7 A;  1AA7 A;  3F23 A;  3KLN A;  4N0B A;  5ICG A;  1Y56 A;  2HOA A;  3ONQ A;  5EDN A;  1XDU A;  5DS9 A;  2CH0 A;  1R36 A;  1VQO I;  1VQ4 I;  2FQ3 A;  2FEZ A;  4UUT A;  1IF1 A;  5FKM A;  2ZO4 A;  1LE8 A;  4YFK F;  1QVT A;  2GA1 A;  4M3D A;  1YHQ I;  2HVR A;  1W36 D;  5E79 C;  3N05 A;  3S8P A;  3C2G A;  3HGG A;  3SHF A;  3BLY A;  2WY8 Q;  3HM5 A;  2VOP A;  3PQK A;  1WRJ A;  3PSF A;  5D4R A;  1H88 C;  2PMZ A;  2V6C A;  2W4S A;  1A31 A;  5DUK A;  4D7M A;  1M1E B;  3F8B A;  3AL0 C;  3O60 A;  5HNH A;  4PZJ A;  3WTV C;  3QBM A;  2LFB A;  1XX5 A;  3B6A A;  3LSG A;  2DPD A;  1R22 A;  1R5G A;  4RAF A;  3K1P A;  3BY6 A;  4HST A;  5CJ9 A;  4C2T A;  1UZC A;  1A04 A;  2M34 A;  2X6X A;  3GZN B;  2YR2 A;  3K4N A;  2A61 A;  4RGU A;  4QLC U;  3DPL C;  4Y17 A;  5EEH A;  2OCC H;  1Z91 A;  2LF8 A;  3KPH A;  4Y33 A;  5HNF A;  1KU9 A;  2UWM A;  4OAY A;  3KX2 A;  1X2M A;  2LY9 A;  2GOM A;  3H9Q A;  4RLQ A;  2PI0 A;  1WPK A;  2DBB A;  3H5A A;  2F5F A;  3CO7 C;  1NHA A;  1RPW A;  4XIC A;  2E2I J;  4HNV A;  5JLX A;  1X2N A;  3IC7 A;  4O3M A;  2LBF B;  3FIW A;  3Q9V A;  2NVU B;  3HXL A;  2HPI A;  5HDK A;  5E3N A;  4B44 A;  2EBI A;  3K2Z A;  3PL8 A;  1TQP A;  1MMN A;  3JTG A;  1ZG5 A;  2K40 A;  5HLG A;  2UXP A;  2MH9 A;  4LB6 B;  3QPS A;  3B81 A;  2R3S A;  3A01 B;  2JZY A;  4JYK A;  2FBQ A;  4ENK A;  1SVL A;  2JK3 A;  3DP7 A;  3FHZ A;  2ZFW A;  3P9I A;  4FIS A;  2E2J J;  5H2F C;  4XNF A;  3SDB A;  1FTT A;  3R0J A;  3M3Y J;  4R1H A;  3ON4 A;  3V6G A;  2R7W A;  1E0E A;  2PJR A;  3HJE A;  4PDK A;  1ZRD A;  4K2E A;  5M3F J;  2DT5 A;  4RGX A;  4G7O F;  1Z3X A;  5GPA A;  3HSR A;  5DCF A;  3DV8 A;  1BR2 A;  1YW7 A;  1FP2 A;  3DF8 A;  3SDG A;  1MGT A;  3V42 A;  1YQA A;  2E5N A;  1KU7 A;  1JT6 A;  2LLK A;  4DYC A;  2X9D A;  4UVC A;  4A5M A;  4RB3 C;  1DUX C;  2OAZ A;  1HSJ A;  2BHY A;  2IW5 A;  2Z9O A;  3NI7 A;  2BOL A;  2MLG A;  5E1X A;  4C3H J;  2ZOZ A;  4IJA A;  5K5Q A;  3AAF A;  1I6X A;  1JKQ C;  5CQE A;  3QYF A;  3OYG A;  4MNU A;  2Y0M A;  1GLN A;  3EUK L;  1YG2 A;  3HZJ A;  3K4J A;  5E8G A;  4AVZ A;  3QYE A;  3BR5 A;  2A07 F;  2LKX A;  2ELK A;  1UI6 A;  1RKW A;  4ANJ A;  4N4N B;  3WG9 A;  1FYK A;  4FE7 A;  1XTA A;  2KFD A;  2YU9 J;  3OYB A;  5CXG A;  2WAD A;  3EUA A;  5D6F A;  1W36 C;  3HSF A;  4A3I J;  2Q2E B;  1QQI A;  3CUQ B;  1FSH A;  5J1R A;  5CVI A;  3S3M A;  5FB2 A;  1JJ8 C;  4P96 A;  2F4M B;  4NNJ A;  1RET A;  3DWL E;  2ETH A;  1LB2 A;  2XRL A;  2E1M B;  3CJD A;  2KT0 A;  4G9Y A;  3T6N A;  1X3U A;  3CCY A;  5D4S A;  1VQN I;  2HYT A;  1W0U A;  1TLH B;  2ZOY A;  2DTZ A;  3QAH A;  1J7K A;  5HLI A;  3F21 A;  4UDS A;  3VIB A;  3HRS A;  2EFN A;  1U5T A;  4KN7 X;  2FJI 1;  1O4X A;  3I9V 2;  2M0C A;  5CXI A;  2DU9 A;  4HF0 A;  4IQ4 A;  1WSU A;  2LKP A;  1VTN C;  3VOK A;  1S7O A;  2CGP A;  1YI2 I;  3QU6 A;  3G6E I;  2X1D A;  5DM6 F;  2X0L A;  4A5N A;  3VPR A;  5LHI A;  5IYD J;  1OLT A;  2AQE A;  3HRM A;  2M2E A;  3NAU A;  3DQV C;  3B02 A;  4FTH A;  2RAS A;  4JX6 A;  1JTY A;  4KDP A;  5LEK A;  1ZEL A;  2IJL A;  2VPR A;  1FX7 A;  2FBH A;  1FZP B;  2DMT A;  2OF7 A;  2VC0 A;  2WB1 A;  3BC8 A;  2OZ6 A;  4L9V A;  4A2U A;  4A3K J;  5J47 A;  1J09 A;  3A02 A;  2EA2 A;  3HOW J;  2F5D A;  3WGI A;  1VFC A;  2PBI A;  2FF4 A;  4LMY A;  4MFE A;  3WHC A;  4HA8 A;  4OMY A;  2QM3 A;  1VQK I;  4IHX A;  1JUP A;  4HDV A;  1HC8 A;  3AL0 B;  2XB5 A;  4KA4 A;  1E3H A;  4E7Z A;  1UMQ A;  3FXO A;  2K9S A;  3ZN0 A;  2P6S A;  2DDB A;  1MNE A;  3HYI A;  3C18 A;  3FM3 A;  2DMP A;  1XGM A;  4I7H A;  1W1W E;  2G7S A;  2VPL A;  1X58 A;  2XRN A;  2M7A A;  4UVA A;  5C4J J;  2QIB A;  2E19 A;  2WC2 A;  4BU2 A;  5TJJ A;  4EGZ A;  3WGG A;  2G3B A;  5FMP A;  3OL4 A;  1P2F A;  3I55 I;  2NYX A;  3QP5 A;  3JCU C;  3DPT A;  1F1Z A;  4JX4 A;  3KP5 A;  1XSD A;  2R5Z A;  1VQ5 I;  1XCV A;  3LQQ A;  4ZDP A;  4MQV A;  4L5E A;  3G4S I;  5DUI A;  3QRF F;  1IN6 A;  2A6H F;  4LIV A;  2UXX A;  4II2 A;  1R1U A;  2A3S A;  4ESB A;  2DA4 A;  4ME9 A;  2LG4 A;  1BI3 A;  2IS1 A;  1YW9 A;  1EKE A;  1A6I A;  1B8I A;  2CV2 A;  5J1Y A;  3E0J B;  2XIG A;  3ECO A;  3Q0W A;  4AWX B;  1GT0 C;  1MJB A;  3AG4 H;  1S5L C;  4Q47 A;  3WTY C;  1FBS A;  2MYS A;  2VIX A;  2IEK A;  2F2E A;  2L9N A;  4MIM A;  4LLN A;  1K61 A;  1OYW A;  4GCL A;  3DBR B;  2GZW A;  4L5J A;  1R49 A;  1MMA A;  3CO6 C;  4OIQ F;  1BL0 A;  1S7E A;  3RI4 A;  1QNT A;  4RB2 C;  3MAJ A;  2ZC2 A;  2LVS A;  4PCQ A;  5B3S H;  1T8I A;  3AQT A;  2KIU A;  3D5L A;  1HCR A;  3K69 A;  3LA2 A;  2X1E A;  3K8P C;  3HPH A;  2BY1 A;  4NEL A;  3BRO A;  4BDZ A;  2D1V A;  3GTQ J;  2I10 A;  1HA8 A;  4HX7 A;  3HTS B;  4XLE A;  1XPX A;  3EET A;  1R1V A;  1W7P D;  2JRM A;  2XAH A;  1WVR A;  1KZH A;  1SGM A;  2Y30 A;  3SEQ A;  4XLA A;  2OQG A;  3V7C A;  1P4W A;  2NOG A;  3OSG A;  4F91 B;  1B4A A;  4ENN A;  4A3M J;  4E7S A;  1LDD A;  3DEW A;  2JT1 A;  3CQZ J;  1ZK8 A;  2ELJ A;  3HKZ A;  5FGM A;  2BY2 A;  3PJR A;  4U0V A;  1T98 A;  2V7F A;  5EF6 A;  5BPI A;  3NPI A;  4CCK A;  3G3Z A;  4WXD A;  1SVM A;  4P9F A;  5DCM A;  2W53 A;  2M5W A;  4I76 A;  2QKO A;  4EJT A;  3CUO A;  4WK8 F;  4LGW A;  1R1T A;  1SD7 A;  1ZR4 A;  3KEO A;  2XVC A;  3GUD A;  5LHG A;  4CXF A;  2WUI A;  1VF9 A;  4EM2 A;  5H20 A;  2VE9 A;  1ZGW A;  1R71 A;  3M9A A;  1G3T A;  4BEH A;  4UXN A;  2QKM B;  1ZG1 A;  4A3G J;  5GAE J;  2EFP A;  3G71 I;  2DA2 A;  3NWT A;  2OD5 A;  4ZH4 F;  3BR1 A;  3ZQL A;  1IXC A;  3H9G A;  1ZAR A;  1L3L A;  4Y52 J;  1OYI A;  2X6W A;  2NX4 A;  2CFX A;  2CWE A;  4ZJZ A;  2NVT J;  1T39 A;  1HXD A;  2PQ8 A;  1HBX G;  1ACI A;  3AFH A;  1VI0 A;  4FT8 A;  3H3Z A;  4E7L A;  3OR2 C;  2HDC A;  4Y4R A;  4OIP F;  3FKJ A;  5DD4 A;  2VB6 A;  2YX7 A;  4BBS J;  3TO7 A;  5FLV A;  1TW2 A;  4F7Z A;  5IP9 J;  2BZT A;  3OYA A;  3CCL I;  4YRV A;  3SFZ A;  2F4I A;  2X85 A;  2CW7 A;  4YIR X;  2NP3 A;  1I1G A;  2HTS A;  5K5O A;  2KRH A;  2JMW A;  1BI1 A;  1YIT I;  5IOZ A;  1P7I A;  1P4X A;  5F0F A;  3JAM Z;  2HQR A;  2BY3 A;  1NTC A;  5ICC A;  1KGS A;  2I8D A;  4E6K G;  5L3G A;  2O6G E;  2K02 A;  2L7F P;  4BQN A;  3F1B A;  4GCK A;  2KRC A;  4CIC A;  3S15 J;  4WIB A;  1ZYR F;  1IO2 A;  3GTK J;  1ZRE A;  4G94 A;  4GCT A;  1ODD A;  1K79 A;  2NAZ A;  2GM4 A;  3CCM I;  3NEU A;  2GOX B;  4IL6 C;  1FYM A;  3ESW B;  4G12 A;  5JHF A;  1S72 I;  2XGE A;  3SZG A;  1P6R A;  5HDN A;  1T0F C;  1HW2 A;  3ZGK A;  2DO7 A;  3JW4 A;  2ISZ A;  3OR1 C;  1F36 A;  3K1N A;  2D2W A;  2JWT A;  2PFV A;  1S29 A;  1FYL A;  3MNL A;  4ZYH A;  4JQF A;  1Q1H A;  3Q9S A;  4HPQ A;  4CZC A;  1FIP A;  3BJ6 A;  3JSJ A;  2ECC A;  2VXZ A;  3LSM A;  4GFB A;  5AIQ A;  2ADU A;  3V8K A;  3CMY A;  4S05 A;  5FKO A;  5KAF C;  2QSG X;  1UG0 A;  4KIS A;  3ZRG A;  2EA4 A;  3BTL A;  2GBY A;  3EUH C;  1BJZ A;  3ZCO A;  2KP6 A;  1UFM A;  1Z05 A;  3WTS C;  4ZDO A;  2LYC A;  4HNT A;  4QIW N;  2HOS A;  3CF2 A;  5DD8 A;  2QWW A;  4F93 B;  5LLQ A;  4U0W A;  4KWA A;  3RIR A;  1AU7 A;  4UHT A;  4KNY A;  1VZ0 A;  4CCL A;  3WU0 A;  3ZQC A;  2QA4 I;  2XKP A;  2RAE A;  5TRD A;  2V57 A;  4IRI A;  5E3L A;  4W1U A;  3VFZ A;  3E5X A;  5HVQ C;  1RI7 A;  5FD5 A;  5LD2 C;  2ICW G;  5HLH A;  3DXJ F;  3BG9 A;  2FBK A;  1U6G A;  3GFI A;  2R5Y B;  3GTJ J;  2HNH A;  5J8F A;  1ETQ A;  1IZ1 A;  1IRF A;  1EV7 A;  2HFH A;  1IRX A;  2OPT A;  4A0Z A;  2OJE D;  4QTR A;  1R4M B;  2ME0 A;  3CZ6 A;  2REK A;  4HNU A;  1SC7 A;  4BH9 A;  4M6Y A;  2FSW A;  4HV5 A;  4JP0 A;  4L9T A;  1OR7 C;  2L4M A;  5LBQ A;  3DU6 A;  4RM2 A;  5ERI A;  3OS1 A;  3HTH A;  2HZT A;  4BJT A;  2XAS A;  2A05 A;  2OC6 A;  1FY7 A;  3COA C;  3ECH A;  3S14 J;  2YU3 A;  1I39 A;  2CO5 A;  2ZCW A;  3D0S A;  5JHU A;  3FX3 A;  4M6V A;  4CGZ A;  3OYC A;  1JKR C;  2A5W A;  2LBF A;  1ZR2 A;  1D0Z A;  4GYI A;  1CQT A;  4DQ2 A;  3B6C A;  2HKO A;  3TW7 A;  2VJ5 A;  2PG4 A;  4IF4 A;  2E1N A;  3HOV J;  1DDN A;  4ZZL A;  3PSI A;  1MBG A;  3I5U A;  2HKX A;  1WCM J;  3PFI A; 
#chains in the Genus database with same CATH homology
 5C4X J;  5EZH A;  3HGG A;  3A01 A;  3HM5 A;  2DN0 A;  1WGX A;  3S1R J;  2DG8 A;  2MSY A;  1H88 C;  1GV5 A;  2DA6 A;  1GV2 A;  2M9H A;  2WB1 N;  4D7M A;  3JRB A;  3O60 A;  1MBH A;  1TWF J;  2LFB A;  3B6A A;  3QBM A;  2ID6 A;  5EYR A;  1XS9 A;  3FKI J;  1TWA J;  3VVY A;  3LSG A;  1Y1V J;  1IRZ A;  4QSH A;  4MK6 A;  3SJM A;  2Q24 A;  1ETO A;  2H8R A;  4IHY A;  3LSP A;  1RES A;  3VUQ A;  2M34 A;  2EZH A;  4M3E A;  5IPA A;  1HDP A;  3IUV A;  1JKP C;  5HAW A;  1MSE C;  2NVX J;  3ZQI A;  1X2M A;  5D19 A;  5K7Z A;  1IUF A;  3G1M A;  2LY9 A;  2JA7 J;  2WV1 A;  1T56 A;  1OCT C;  1WPK A;  5M5Y J;  2RHA A;  2CRG A;  1RPW A;  4XIC A;  3UKG A;  3G1L A;  2E2I J;  4HNV A;  1U8B A;  5JLX A;  1X2N A;  3S1Q J;  3FIW A;  2GLO A;  2COB A;  5E3N A;  3COL A;  2EBI A;  2Y9Y A;  1LE8 B;  2K40 A;  2UXP A;  1F43 A;  3B81 A;  3QPS A;  4XRS G;  2IU5 A;  1WCM J;  3A01 B;  4JYK A;  2FBQ A;  2JJ7 A;  2JK3 A;  4XK4 A;  3LWJ A;  1IV6 A;  3S2H J;  1OCP A;  1TWC J;  4FIS A;  2E2J J;  3GTO J;  1EF4 A;  4HKU A;  4A3L J;  4D5F A;  1FTT A;  1SAN A;  3M3Y J;  3V6G A;  3ON4 A;  4ACI A;  1IDZ A;  3VOX A;  3BR3 A;  1NK2 P;  4D5C A;  5IYC J;  2NS8 A;  2DG7 A;  5M3F J;  4UUS A;  5CW8 A;  5GPA A;  2EZL A;  3IH2 A;  4ABZ A;  3VW2 A;  3E7Q A;  3L1P A;  3SDG A;  3VP5 A;  2YVE A;  1JT6 A;  2LLK A;  4DYC A;  5F1J A;  2X9D A;  3RZD J;  2DMQ A;  1TC3 C;  2G7L A;  1JUM A;  2HQ5 A;  2JN6 A;  2K9N A;  1W0T A;  1MH4 A;  2MG4 A;  3NI7 A;  1DU6 A;  4C3H J;  2ZOZ A;  2FX0 A;  4NDL A;  1JKQ C;  4MFD A;  5HBU A;  5E3O A;  2LD5 A;  4ICH A;  2XDN A;  1G2H A;  4FCY A;  3OOU A;  4MXM A;  3BR5 A;  1K83 J;  2LKX A;  2ELK A;  1UI6 A;  1RKW A;  4BY7 J;  5FJ8 J;  1JTX A;  2VKE A;  1DU0 A;  2ZCN A;  4FE7 A;  2D5V A;  2R92 J;  2YU9 J;  5CXG A;  3HOY J;  4A3I J;  1ETV A;  2O7O A;  2EH3 A;  5EGO A;  1JUS A;  1B72 A;  5J1R A;  3HKZ N;  1JJ8 C;  4JKZ A;  1MNM C;  4IHV A;  1RET A;  2Y31 A;  3BTJ A;  2HDD A;  3RZO J;  3HE0 A;  3NNR A;  2XRL A;  3CJD A;  2D6Y A;  2KT0 A;  4AYB N;  4DZJ A;  3CCY A;  3HGY A;  4UUS B;  2HOT A;  3T6N A;  2EZK A;  2HYT A;  1W0U A;  2X48 A;  2E1O A;  3BTC A;  2ZOY A;  2DTZ A;  4UDS A;  3VIB A;  4AUX A;  5M3M J;  3HOZ J;  2R0Q C;  2H1K A;  1O4X A;  3CWR A;  2M0C A;  1P7J A;  4W97 A;  3JRD A;  5CXI A;  3ON2 A;  3FK6 A;  2CQQ A;  3VOK A;  4CGR A;  1ZQ3 P;  2WAQ N;  3HIM A;  2HXO A;  3S16 J;  2GUH A;  3VPR A;  5DAJ A;  5IYD J;  3F0C A;  1WH5 A;  2QTQ A;  2XPW A;  3I4M J;  2M2E A;  3NAU A;  3JR9 A;  1IJW C;  3PO3 J;  2UXO A;  4FTH A;  2RAS A;  3A03 A;  4JX6 A;  2QOP A;  3TED A;  1JTY A;  2DJN A;  3E7L A;  1HOM A;  3M4O J;  2VPR A;  3BT9 A;  3RH2 A;  2XGC A;  2OER A;  2DMT A;  1LFU P;  2OF7 A;  1IG7 A;  3ZQH A;  4A3K J;  3A02 A;  3HOW J;  2HYJ A;  4A3F J;  1VFC A;  2HI3 A;  2JA6 J;  4J19 A;  4MFE A;  3WHC A;  5M5X J;  5EGO B;  4B4C A;  5EEA A;  3GTL J;  3QPL A;  1JUP A;  3IH4 A;  3Q0U A;  2CUE A;  2PZ9 A;  5FKK A;  2L7Z A;  1ETK A;  2XB5 A;  2G7G A;  1D5Y A;  2L7M P;  3S1M J;  2UXU A;  1UMQ A;  4LOC A;  2K9S A;  5E3M A;  1Q1V A;  3BTI A;  2DA3 A;  1JKO C;  2DMP A;  1TWH J;  2G7S A;  1X58 A;  1A5J A;  3BNI A;  3FIS A;  5C4J J;  2QIB A;  2E19 A;  2HXI A;  1JJ6 C;  1U9N A;  2JA5 J;  2G3B A;  3TW6 A;  5FMP A;  1ZKG A;  2EZI A;  4M3G A;  2ZCX A;  4JX4 A;  3HDD A;  1HF0 A;  2R5Z A;  2R93 J;  3RD3 A;  3WHB A;  4DYQ A;  1FJL A;  2XPU A;  4EEF G;  4L5E A;  1FTZ A;  3BQZ A;  1PUF A;  3HEF A;  5F0H A;  3ZQF A;  5DTD A;  4ME9 A;  1ETW A;  2DA4 A;  2TCT A;  4X6A J;  1GVD A;  3VVX A;  3JRF A;  3JRE A;  2O8K A;  1R9T J;  4CYC A;  3CDL A;  2MGQ A;  4PXI A;  1B8I A;  1A6I A;  5J1Y A;  4BXX J;  2L9R A;  3Q0W A;  3G7R A;  1GT0 C;  3H3V K;  3ANG A;  4DYR A;  2NP5 A;  3G56 A;  2IEK A;  4MIM A;  4A3C J;  3LJL A;  1H8A C;  1IGN A;  1K61 A;  1UG2 A;  4GCL A;  2G0E A;  4C3I J;  1WI3 A;  1BL0 A;  1S7E A;  4L62 A;  3K2A A;  2LVS A;  2ME6 A;  3AQT A;  4C3J J;  1HCR A;  5C44 J;  2FD5 A;  3GEU A;  1UI5 A;  2P81 A;  3NAR A;  4NEL A;  3P9T A;  3H0G J;  4DW6 A;  3GTQ J;  3FRQ A;  3GBG A;  2I10 A;  3QQA A;  1MBF A;  4C2M J;  3KZ9 A;  1H89 C;  2R5Z B;  3KNW A;  2UXH A;  5C3E J;  4MO7 A;  4IEJ A;  4A3D J;  1SGM A;  3VW1 A;  1Z77 A;  1MBE A;  2Y30 A;  4Y7N J;  1PUF B;  1E3O C;  3QKX A;  1QVU A;  2NOG A;  3OSG A;  3BR6 A;  2QWT A;  5GPC A;  3LSJ A;  4A3M J;  1AKH A;  4GFK A;  4CYC B;  3DEW A;  3CQZ J;  2K9Q A;  1B8I B;  3NRG A;  1ZK8 A;  2TRT A;  4A3E J;  3HB9 A;  2GFN A;  5C4Y A;  5FHP A;  2EQR A;  2M8G X;  2OI8 A;  2CUF A;  5EF6 A;  1OFC X;  2VUM J;  1GDT A;  3PAS A;  3JRA A;  3NPI A;  2ID3 A;  2LR8 A;  3RKQ A;  1YRN A;  3BHQ A;  2W53 A;  3OIO A;  4I76 A;  2QKO A;  5EZG A;  1GUU A;  1WH7 A;  3Q0V A;  2LP0 A;  4S0H B;  3GTM J;  4A3B J;  3AQS A;  2O7T A;  1I50 J;  2XGD A;  4B3A A;  3JRH A;  4M3B A;  3TP0 A;  4XRS A;  1ZR4 A;  1IC8 A;  1Z0X A;  5FKL A;  5EFY A;  2WUI A;  3S1N J;  3ANP A;  1JGG A;  1VF9 A;  5J3L A;  1MBJ A;  3GTG J;  2CJJ A;  1ZGW A;  3Q3S A;  2DA7 A;  3LHQ A;  3MN2 A;  3GTP J;  1NK3 P;  3HOU J;  4BKX A;  3EGQ A;  1T33 A;  4A3G J;  4DZP A;  1HLV A;  4YZE A;  3KKC A;  3VW0 A;  2DA2 A;  1VND A;  5FKN A;  1JT0 A;  3D1N I;  3BR1 A;  1BW6 A;  3ZQL A;  1TWG J;  4I6Z A;  2F07 A;  5F08 A;  4Y52 J;  1FEX A;  3IV5 A;  1AKH B;  1B72 B;  4BY1 J;  1QRY A;  2NX4 A;  1POG A;  3SFI A;  5IOY A;  4BBR J;  5HOD A;  2NVT J;  5GP9 A;  2DMN A;  5IYB J;  3HOX J;  2PMZ N;  3W6V A;  1VI0 A;  3CRJ A;  3HBL A;  5F04 A;  3NXC A;  1YRN B;  1HDD C;  4BBS J;  4JX5 A;  5FLV A;  5IP9 J;  2DA1 A;  3JRC A;  2R7Z J;  3G1O A;  3C07 A;  3RQI A;  1RR7 A;  3ZOB A;  2NP3 A;  2X6O A;  2ZB9 A;  4GFL A;  3LSR A;  1ETX A;  2NS7 A;  2JMW A;  5IOZ A;  1P7I A;  1I3Q J;  4XRM A;  5F0F A;  2YVH A;  5F0C A;  5JLW A;  1ETY A;  1NTC A;  5D18 A;  2O9L A;  3KKD A;  4D7N A;  5IP7 J;  2L7F P;  3F1B A;  1AHD P;  2HKU A;  4GCK A;  3PPB A;  2Y9Z A;  3S15 J;  2QF7 A;  3S5R A;  1ENH A;  2KDZ A;  2DA5 A;  3JRG A;  1APL C;  3GTK J;  4GCT A;  2ECB A;  4JL3 A;  4FE4 A;  4A69 C;  5FGL A;  4RDU A;  2R5Y A;  2GM4 A;  1MSF C;  1SFO J;  4G12 A;  2LTP A;  4X1E A;  2XGE A;  1U78 A;  5AQC A;  3BG5 A;  1U9O A;  1F36 A;  1ZTR A;  5K7H A;  1ITY A;  2JWT A;  4XID A;  3PM1 A;  4JNN A;  4M3F A;  3MNL A;  3S17 J;  3BJB A;  4A3J J;  1FIP A;  3JSJ A;  2FJ1 A;  2ECC A;  4B1R A;  2JA8 J;  3LNQ A;  4GFB A;  1ORK A;  2VI6 A;  1I6H J;  3CMY A;  3VVZ A;  1OJL A;  5FKO A;  3PO2 J;  1Y1W J;  4MLO A;  3BR2 A;  2B63 J;  2NVY J;  3BR0 A;  5H9T A;  5J1U A;  3HTI A;  4AC0 A;  1MH3 A;  3O8H A;  3GZI A;  3BTL A;  2GBY A;  3DCF A;  2N8G A;  3ZQG A;  1BJZ A;  4A93 J;  1BA5 A;  2W48 A;  1IDY A;  3FK7 A;  3C2B A;  5EG0 A;  2VKV A;  4RBO A;  2HOS A;  4QIW N;  2AHQ A;  2IAI A;  4KWA A;  1AU7 A;  1XG1 A;  5D1R A;  4V2F A;  2LK2 A;  3ZQC A;  2E2H J;  3JRI A;  5F27 A;  1BW5 A;  2GEN A;  5K58 A;  2RAE A;  2V57 A;  3V78 A;  3HTA A;  2QCO A;  5E3L A;  1QPI A;  3MVP A;  1RKT A;  4W1U A;  3TP3 A;  3BRU A;  2NVQ J;  2L0K A;  4AC6 A;  3BG9 A;  2YS9 A;  3K7A J;  2R5Y B;  3GTJ J;  1MBK A;  1ETQ A;  5K7F A;  1XC5 A;  2OPT A;  1UHS A;  5FLM J;  1LFB A;  2XPV A;  2ME0 A;  4QTR A;  2REK A;  2Y0S N;  4AF5 A;  2AO9 A;  2CU7 A;  2MW8 A;  2PBX A;  2IBD A;  2XB0 X;  5M5W J;  3MKL A;  1FIA A;  4JP0 A;  2WGB A;  2CQX A;  3BG3 A;  2ZCM A;  3I4N J;  3HTH A;  3IH3 A;  3BCG A;  5BNG A;  3DPJ A;  4NN1 A;  3S14 J;  2Y2Z A;  5IP6 A;  2XSD C;  9ANT A;  3HTJ A;  4M6V A;  2HOA A;  5EG0 B;  3BQY A;  2YUS A;  2DMU A;  1JKR C;  5EDN A;  1ZR2 A;  1CQT A;  5DS9 A;  3B6C A;  4V2G A;  3TW7 A;  4UUT A;  3EUP A;  5FKM A;  3OSF A;  1LE8 A;  5HSZ A;  3HOV J;  1QVT A;  3O8G A;  4IHW A;  4M3D A;  3S2D J;  1MBG A;  2FQ4 A;  4IHX A;  2UXI A;  3LOC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...