3MVPA

The crystal structure of a tetr/acrr transcriptional regulator from streptococcus mutans to 1.85a
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
204
structure length
204
Chain Sequence
KNIRKPKQERSIEKRNKILQVAKDLFSDKTYFNVTTNEIAKKADVSVGTLYAYFASKEDILTALLKRYNDFFLTTIFADINSQDSLDRFKKNPKEWLNVLINQLLAAEDKIFHAQIEMLAYAIPQAKALLEEHNNNLKNLTYKCLLYYSDQAANPSFKTLSLVVFDFISALVDELLYHEHTQEEAHQIKKTGIDSLDLIIKSYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of a TetR/AcrR transcriptional regulator from Streptococcus mutans to 1.85A
rcsb
source organism Streptococcus mutans
molecule tags Transcription regulator
molecule keywords TetR/AcrR transcriptional regulator
total genus 84
structure length 204
sequence length 204
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3mvpA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3mvpA02
4DYCA 2FQ4A 1W0UA 1TC3C 3VOKA 1RKWA 3PO3J 2DG7A 3GTLJ 2LR8A 3F1BA 3GTQJ 3LJLA 2NS8A 2XGDA 4JYKA 1MBHA 4A93J 4V2GA 3CRJA 3KKCA 5F08A 1LE8B 1LFUP 1ZGWA 1GVDA 2DA5A 3GTOJ 1F43A 1BL0A 3VVZA 2HI3A 2DN0A 4L5EA 2CQQA 5E3LA 1H88C 2HOSA 3EUPA 3KKDA 1GV5A 3JREA 1OCTC 2CQXA 1H8AC 1K83J 3IV5A 2XGEA 2IBDA 4IHYA 5D18A 1NTCA 3H0GJ 1ZR2A 3VUQA 4GCTA 4D5FA 2NP3A 1JJ6C 3RD3A 3HEFA 4FTHA 5JLXA 2NP5A 1MBGA 5D1RA 3HB9A 2CRGA 4XIDA 4A3MJ 1JJ8C 1D5YA 3AQTA 2GBYA 3MVPA 2GUHA 3IH2A 1AHDP 4JX4A 1IC8A 2MSYA 4ICHA 3HBLA 4DW6A 3ZQHA 3LWJA 4ME9A 1QRYA 2N8GA 3B6CA 4QIWN 2ELKA 4ACIA 5HAWA 3NNRA 2ID6A 1JUMA 1LE8A 3LSJA 2M9HA 2B63J 3M4OJ 5JLWA 2G0EA 3GTKJ 2QOPA 1GUUA 1VNDA 2XPVA 2AO9A 3BR3A 2EZLA 1JGGA 4CYCB 1Y1WJ 3VP5A 5H9TA 2E1OA 2V57A 3CDLA 1JKRC 2L7MP 2NOGA 3NXCA 3HDDA 2E2IJ 5M3FJ 1ZQ3P 3ZQLA 2CUEA 1BJZA 2WAQN 1ETWA 4MLOA 5EZGA 2L7ZA 5IYDJ 2H1KA 2CU7A 2W48A 2K9QA 5AQCA 3HTHA 2VKVA 4MFDA 3LOCA 5DAJA 4BKXA 2LTPA 3BTLA 3UKGA 2E2HJ 2VPRA 1MNMC 5GP9A 2LKXA 4LOCA 4IHXA 1WH5A 2JWTA 2Y30A 2JA8J 2O8KA 2GM4A 1B8IB 1U9NA 2HYJA 4HNVA 3B6AA 4C3JJ 5K7ZA 5C4JJ 5D19A 5IYBJ 2FX0A 2AHQA 3BTJA 3C2BA 2VKEA 1HOMA 3DEWA 1PUFA 1ENHA 3GBGA 2GFNA 3BRUA 5DTDA 4A3BJ 1W0TA 9ANTA 3LHQA 4NELA 4AF5A 2ZB9A 2EZKA 3VVXA 5HSZA 2KDZA 1TWFJ 3RH2A 3MKLA 4M3BA 2IU5A 2R5ZB 1X58A 2REKA 2LLKA 3CQZJ 5E3NA 2WGBA 2I10A 1CQTA 1ZKGA 3JRBA 2O7TA 5EEAA 4MIMA 1GDTA 1XC5A 4M3EA 3TW7A 2G7LA 3Q0WA 3WHBA 3FKIJ 3K2AA 5K7FA 1UHSA 2YUSA 5F0FA 4EEFG 1P7IA 5M5XJ 3HKZN 2M8GX 1JT6A 2EZIA 2R5YA 1UMQA 4UDSA 2UXPA 2ZCMA 2QWTA 1HDPA 5EG0A 3IH3A 2G7SA 5EF6A 1A5JA 3VW1A 4A69C 1VFCA 2X9DA 3HE0A 2RASA 3NI7A 4GFLA 2IEKA 2M34A 2KT0A 3JR9A 1XS9A 4A3CJ 1JTYA 3SDGA 5F27A 2YS9A 2XB0X 3Q0UA 2K40A 3BTIA 3SFIA 4XRMA 3BR5A 3GZIA 2G3BA 4Y7NJ 2DTZA 2ZCNA 2QKOA 2L0KA 3BT9A 2QF7A 2MGQA 4M3FA 4JX6A 3S14J 3A01B 2LFBA 3G1MA 1DU0A 4XK4A 2G7GA 3T6NA 3VIBA 2XRLA 1T56A 4IEJA 4DYRA 3ON4A 3JSJA 4YZEA 3NARA 2QIBA 1Y1VJ 4GFBA 2E2JJ 1VF9A 1LFBA 3HGGA 1ETVA 2NS7A 2LD5A 1HLVA 5K7HA 4CYCA 4XRSA 3A01A 2EH3A 1FTTA 5J3LA 1I3QJ 4BBRJ 5J1YA 2XDNA 1Z77A 3E7QA 4W1UA 1P7JA 2K9SA 1I6HJ 4BY7J 2UXOA 5FHPA 3NPIA 1MH4A 2LY9A 1IGNA 4MO7A 2DMPA 4C2MJ 1MBFA 3HIMA 1WGXA 3PPBA 1K61A 4V2FA 3S17J 1FJLA 3HGYA 3JRCA 2FD5A 3CCYA 3VOXA 2MW8A 1OCPA 4D7MA 1MBJA 3BJBA 5M5WJ 3BG9A 2ZCXA 1E3OC 1R9TJ 3A02A 3HOXJ 2Y9ZA 2RHAA 1EF4A 5CXGA 1MSEC 3VW2A 4B3AA 3QQAA 4B1RA 3G7RA 1S7EA 1NK2P 2UXUA 1XG1A 4QTRA 2Y0SN 4A3FJ 2HYTA 5FKMA 1T33A 1ETOA 4JP0A 1ETXA 3BCGA 3TW6A 1U78A 2TRTA 1SFOJ 3QPSA 3ZQCA 3KNWA 3QPLA 2DA1A 1RR7A 1A6IA 4D7NA 1TWGJ 1FIPA 2ID3A 5FKNA 3OSFA 2R7ZJ 3KZ9A 2JA5J 2O9LA 5E3OA 3S1RJ 1G2HA 4D5CA 3BR6A 4AUXA 4FE4A 4X1EA 1IDZA 4G12A 2DA7A 4UUSB 3G1LA 4IHVA 3HOWJ 2QCOA 2XPUA 4M3DA 1IRZA 3QBMA 2VUMJ 1PUFB 2XPWA 2OERA 5CXIA 4RBOA 2Y31A 5EZHA 3G1OA 1RKTA 1IG7A 1B72A 2XSDC 2PMZN 4FE7A 4I76A 1WPKA 4BBSJ 1BW5A 3K7AJ 3BR2A 3Q3SA 4Y52J 2CUFA 3V6GA 4M6VA 3C07A 2O7OA 1HF0A 2L9RA 2LP0A 3GTPJ 3S16J 3E7LA 1ORKA 2PZ9A 1O4XA 3MN2A 4A3KJ 3HTJA 3O60A 3HOYJ 3HM5A 5FKLA 3JRIA 4ABZA 1APLC 4GCKA 4I6ZA 3VVYA 1JKOC 2FJ1A 3W6VA 2UXIA 2NVYJ 5EG0B 2GENA 5GPAA 2YVEA 4DZJA 3AQSA 4UUTA 3CJDA 3S5RA 4JKZA 5F0HA 3S15J 3ZOBA 5IP6A 5EFYA 3FK7A 1NK3P 2DMNA 5GPCA 5DS9A 4JX5A 4NDLA 3O8HA 2PBXA 3FIWA 3RZOJ 2OPTA 3VPRA 1JKQC 4UUSA 2CJJA 5J1UA 4DZPA 1UI5A 3S2DJ 1IUFA 2HXOA 1YRNB 5FLMJ 3P9TA 3SJMA 3RKQA 2X48A 3ANPA 5EDNA 4X6AJ 2LK2A 1AKHA 4PXIA 1QVUA 1RESA 1U9OA 1HCRA 3JRGA 3DCFA 2ZOYA 1ETQA 3PASA 3FISA 3JRAA 2WUIA 1JT0A 5F04A 5K58A 2JA6J 2DA4A 4W97A 2FBQA 2HXIA 1U8BA 1BW6A 5EGOA 2ME6A 3PO2J 3S2HJ 5FGLA 3JRDA 4L62A 2HOAA 1JKPC 3S1MJ 2OI8A 1MBKA 2E19A 1FIAA 1FEXA 5IP7J 3CMYA 2HKUA 4FCYA 1RETA 4FISA 2NX4A 3EGQA 2QTQA 1OJLA 2MG4A 3BR0A 1IJWC 3FRQA 3LSPA 1ZTRA 3D1NI 2EZHA 4BY1J 2D6YA 4NN1A 3DPJA 3S1NJ 2DA3A 2NVXJ 1ZK8A 3LSGA 2EBIA 2L7FP 2Y9YA 4QSHA 2TCTA 3HOZJ 5IOYA 3H3VK 1AKHB 4AC6A 1SANA 2K9NA 3VW0A 3ZQGA 3G56A 2X6OA 5F1JA 3HTIA 5C4XJ 1ETKA 1ITYA 1I50J 2Q24A 4GFKA 1WCMJ 3L1PA 4MXMA 4JL3A 5C44J 1TWCJ 1TWAJ 4XRSG 5IOZA 3HOUJ 3LNQA 3PM1A 4MK6A 4A3LJ 4A3EJ 5HODA 2COBA 3ZQIA 1AU7A 3ZQFA 1MH3A 1Q1VA 1B8IA 2DJNA 3NAUA 5IYCJ 1Z0XA 4B4CA 3TEDA 2ME0A 2D5VA 3M3YJ 5FKOA 3BNIA 1UI6A 2R5YB 4DYQA 3A03A 5IPAA 1GT0C 3BQYA 2NVQJ 3LSRA 5FJ8J 3BG3A 2M2EA 1POGA 3RQIA 5CW8A 3GTGJ 3WHCA 3O8GA 3TP3A 4MFEA 2DMQA 3I4NJ 4A3IJ 1QVTA 2OF7A 3BTCA 2UXHA 3COLA 2H8RA 5C3EJ 2JA7J 2DA6A 4C3IJ 3CWRA 4XICA 1QPIA 5BNGA 2R0QC 2R5ZA 2JK3A 1X2MA 2M0CA 4C3HJ 4IHWA 4KWAA 3TP0A 5EYRA 5M3MJ 2R93J 1IDYA 2VI6A 3BG5A 3BQZA 3MNLA 1FTZA 3ANGA 1JTXA 5HBUA 1ZR4A 5C4YA 2WV1A 3RZDJ 2DG8A 3OOUA 1X2NA 1WH7A 4RDUA 4HKUA 2LVSA 2HQ5A 2ZOZA 2JN6A 1GV2A 3HTAA 2IAIA 3I4MJ 2XGCA 5F0CA 2HDDA 1MSFC 3FK6A 2DMTA 3OSGA 5M5YJ 1B72B 4A3GJ 2HOTA 5EGOB 1MBEA 1ETYA 4S0HB 3NRGA 3QKXA 1RPWA 3HOVJ 4BXXJ 2GLOA 2W53A 2EQRA 1DU6A 3GEUA 5FKKA 3JRHA 4A3JJ 1IV6A 4M3GA 2YU9J 3B81A 1SGMA 1TWHJ 2WB1N 4J19A 3ON2A 1F36A 3OIOA 2P81A 3V78A 4AC0A 1OFCX 1VI0A 4GCLA 2YVHA 1JUPA 3S1QJ 5FMPA 3JRFA 2RAEA 2NVTJ 2JJ7A 1YRNA 2XB5A 3GTMJ 5IP9J 3IUVA 1UG2A 4AYBN 3IH4A 2DA2A 2ECBA 4CGRA 4A3DJ 5E3MA 1H89C 3Q0VA 3F0CA 4JNNA 2R92J 2ECCA 1WI3A 5J1RA 2Y2ZA 2DMUA 1JUSA 3BHQA 1HDDC 3GTJJ 5FLVA 2F07A 2JMWA 1BA5A 3BR1A
chains in the Genus database with same CATH superfamily
4DYCA 3BP8A 3GLLA 2AS5F 3ULQB 3DTEA 4EGYA 2LR8A 3GTQJ 2DODA 1MBHA 3CRJA 4V2GA 3KKCA 5D4RA 1Q1HA 5F08A 1LE8B 2E60A 3ML6A 4UUVA 4ESFA 2CQNA 2DN0A 2HTSA 4MEXF 4L5EA 2CQQA 4N0BA 2QBYA 5LFAA 1UJ8A 3BJ6A 1ZRFA 1VZ0A 2HOSA 1CGPA 3ABKH 3K4NA 3OIPA 4HNUA 3VFZA 4PGHA 4OIPF 2DK5A 3JREA 4HF2A 1R5HA 2A07F 2CQXA 5CVJA 2IS2A 2IBDA 2JZYA 2RQPA 1NTCA 2DOEA 2V1DA 4I02A 2DBBA 3EYIA 4D5FA 1I39A 5JLXA 3CCMI 4CCJA 4AVPA 2O3FA 1W7PD 1D8KA 2CRGA 4GGGA 4XIDA 5BS6A 1JJ8C 1D5YA 1G3TA 4L0ZB 1OISA 3H5RA 5HVQC 3IH2A 2GUHA 2Q1ZB 4F7ZA 1IC8A 2DPDA 1R1VA 3ZMZA 3ZPLA 2KIUA 5H20A 2FBIA 4Y15A 1X4PA 4BJ5C 1IXCA 5B3SH 4IZZA 4RAZA 3ABMH 3VODA 3B6CA 3BZ6A 4ACIA 1GVJA 5HAWA 2UV1A 3LSJA 4NC8A 2X1CA 4BQNA 2P5LC 1VNDA 1BN5A 2QKLB 2A5WA 2FSWA 5B66C 1O3QA 3BR3A 2BW3A 1S6LA 3HXLA 2EB7A 3QP5A 5E1ZB 3ZGKA 1E0EA 1X3UA 2L7MP 3LWFA 4L5JA 4U0VA 1HA8A 3HDDA 2L54A 2YVXA 1UFMA 2M87A 3K1MA 4BYYA 3G73A 1YIJI 3DWLE 1KU2A 3NRVA 4FQGA 3CP2A 1MW7A 3EQLF 3V8LA 3KP7A 2L7ZA 3KLOA 4K2EA 2W48A 4WXHA 3MKYB 4MFDA 4BHBA 3BLYA 3BPVA 4D1QA 1BC8C 2VXZA 4YEJA 3UKGA 4YIFA 4BE0A 2IGMA 2K4BA 2NAZA 2OC6A 3DKYA 1SEUA 1WH5A 1I1SA 1J7KA 2Y30A 3MAJA 5LLQA 2VQCA 5LGTA 4UV9A 1TQIA 3K6GA 4C3JJ 4A0ZA 4LLNA 4HLYA 1EA3A 1WSUA 2PFVA 2AXTC 1ENHA 2H6BA 4A12A 2E7WA 3DBLB 4OD5A 4RM3A 1B4AA 2ZB9A 1W5TA 2WADA 2DFFA 4PFPA 2QVOA 1TWFJ 2X4HA 2ACJA 2Z1DA 4M3BA 2IU5A 2MYSA 3H9QA 2KHMA 2R5ZB 3L7WA 2VBZA 3MKZA 1N75A 4OWRB 1RRJA 1CQTA 1LEAA 1SVLA 3HPHA 3K69A 1XC5A 4M3EA 3VOEA 2G7LA 1KYWA 4FX4A 3FXJA 4ZDLA 4UVCA 2L5QA 4Q4ZF 5K7FA 2Q8KA 5H6RA 5F0FA 3M8EA 2EFPA 1YTYA 2PJRA 3HKZN 4IXAA 1SD5A 3HUGA 1NHAA 2ZCMA 5AIQA 4DJAA 5JHUA 2QWTA 3M1EA 1D1CA 5EF6A 2HR3A 3OV8A 4A69C 1VFCA 2LG4A 2RASA 3NI7A 2VXDA 2IEKA 2M34A 3GX4X 3I64A 5D6FA 5GTIC 2Y69H 3SDGA 1FPQA 1BR2A 1ZLJA 3G6EI 3LA7A 3H36A 2ZXWH 3SQNA 2FRHA 2DT7B 3BR5A 5F6FA 2CUJA 2O0YA 1HXDA 2ZCNA 1MZBA 1VQ6I 1YQAA 2EFNA 2BHYA 2QF7A 3I9V2 3F8FA 1Z21A 2MABA 3E5QA 3OMYA 4F93B 2LFBA 3G1MA 3VIBA 5FLXZ 2XRLA 3L2VA 3IC7A 1QBJA 4YZEA 2W82A 4DGWB 2W84A 1VF9A 1LFBA 4OMZA 1ETVA 2LD5A 5GAEJ 4CYCA 3A01A 2EH3A 3U9GA 1Z77A 3I3LA 2IXSA 4XLCA 3DU5A 4QPOA 4RMNA 4IO9F 1I6HJ 2UXOA 1LDKB 5FB2A 3VSLA 2LY9A 4MO7A 2J5PA 2DMPA 2WWYA 1JE8A 2VOOA 1WGXA 2V6EA 5GTHC 2AQFA 2IW5A 4ASNA 4V2FA 3DP7A 3ESWB 3E3VA 4I0AA 2KMUA 2BXYA 3TDZC 3LFUA 1QU3A 2M3AA 5JR3A 5M5WJ 4B3XA 5JHFA 2EFOA 3J81K 2VJ4A 3I53A 1E3OC 1R9TJ 3CCUI 4PFOA 3HOXJ 3P9CA 3H35A 4WIBA 3VW2A 4B3AA 4UXNA 4J01A 2GOMA 4XLHA 2BVMA 3K4LA 2XROA 2EFQA 2QGUA 3G7RA 3CCLI 1NK2P 2ISYA 3R0JA 1O3RA 1A6QA 4A3FJ 1T33A 1ETOA 4JP0A 3L2UA 2LY1A 3FMRA 1SFOJ 1XMKA 4DVYP 3DKXA 3ZQCA 2DA1A 2VQLA 1ON1A 2E5NA 2OZ6A 4S05A 3OOPA 2FMYA 3IKTA 3S1RJ 5HNHA 2O6GE 4E4HA 2XAQA 1FC3A 1FNNA 2ZXJA 3VTIA 3BCAA 3HOWJ 2QCOA 3L2WA 4I7HA 2O61A 3K9TA 4LIUA 4RB3C 2XPWA 2P7VB 5FFXA 2OCCH 4RBOA 3E0JB 3GYHX 1QZYA 1B72A 2XSDC 2H94A 4ON0A 5KNLA 2DLLA 1WPKA 2VONA 3AG3H 3BR2A 3H3UA 4M74A 3VSKA 4B44A 4Y52J 3HPGA 2M5WA 2PMUA 1HF0A 2L9RA 2WY7Q 1DP7P 3E6DA 3OYFA 4A3KJ 1HW2A 2UZKA 3IRRA 3HM5A 2Y75A 2E5ZA 3OIQA 4DBQA 5FKLA 1KQ9A 3JRIA 4ABZA 1APLC 4GCKA 3L2RA 1R71A 1JKOC 1CF7B 2FJ1A 3W6VA 1SFEA 4YFXF 1IN8A 1W5CC 4DZJA 3CJDA 4JKZA 3ISPA 5F0HA 3S15J 2PEXA 3ZOBA 4G9YA 4RGXA 5EFYA 1NK3P 4U9NA 3O8HA 2PBXA 2R7DA 2ZJQF 2JTVA 3SEQA 4UUSA 3BPXA 3S2DJ 1IUFA 2M0MA 1GXPA 1YRNB 1F1ZA 1AOYA 4IHTA 1G59A 2CQ7A 1MMAA 2JPCA 3RKQA 1V5EA 2X48A 5E8GA 3CF5F 4CYDA 1QVUA 4PXIA 3HZJA 3DCFA 3S2WA 3HSRA 2ZOYA 3FISA 3KX2A 3EPZA 3JRAA 1SC7A 2WUIA 3RPQA 4KMUX 4PGGA 5FROA 2O5RA 1R23A 3F8MA 3PO2J 2YSRA 3SWHA 4L62A 3S1MJ 3OYKA 3GF2A 3ZRGA 3SXYA 2HKUA 1WJFA 4HLXA 4ESBA 5L3DA 1SMTA 2K02A 2NX4A 1U5TA 3GFLA 4NC6A 3CCRI 1IJWC 4MTDA 3FRQA 3J7ZI 1U0JA 4NN1A 3IWFA 2E34A 3RTRA 3DPJA 2HZTA 2ZSIB 3S1NJ 1T8IA 1SAXA 4XLEA 4G7OF 4L9VA 2L7FP 1R4MB 4CUGA 1ZYRF 3E6BA 3JSPA 4AC6A 1D0XA 3KCCA 3R4KA 1K6OA 1OLTA 5ILVA 3HTSB 2ZJPF 4FASD 4EJVA 5F1JA 4CSWA 5J47A 3OYGA 1SFUA 2R7XA 3E6CC 5A2QZ 1BIAA 1ETKA 1WWXA 2KQRA 2KJCA 4P1WA 4JL3A 2QZ8A 5C44J 2KISA 3R0AA 1TWCJ 3M1CA 2E1MC 1P9QC 2NNNA 5D4SA 1YW9A 5HLHA 1MH3A 1Q1VA 3NAUA 4XN0A 5IYCJ 2MA3A 2LSOA 4IQ4A 3OS2A 2HGCA 4H4KC 3T8RA 3TEDA 2D5VA 1A04A 3BNIA 1BC7C 3IUOA 1Z6RA 2R5YB 4DYQA 2FXAA 4HRIA 1OYIA 2A6HF 4XRFA 5FJ8J 4CCMA 3BG3A 2M2EA 4WXDA 3TP3A 3CESA 4PK4A 3WU0A 1N77A 2M4GA 3COLA 2H8RA 2X6YA 4M72A 4HZFA 4XLAA 2ZNZA 1R36A 4R79A 1HSJA 4LK0F 2R0QC 2XRNA 2FNPA 3VYRB 5IY5H 3X2QH 3K2ZA 3BQZA 4DIQA 5J6XA 4KA4A 1DQUA 4L9JA 1WI9A 3T1BA 1VQPI 3TKYA 2VC1A 2XGXA 4RB1A 2WBMA 2WV1A 2IA2A 3RZDJ 2DG8A 2IGNA 4RAGA 3BDDA 1YS6A 2F6CA 2PG4A 2QKMB 3S32A 3TOAA 2XC7A 1RUOA 2A6TA 4UB6C 3OR1C 2EINH 2TDXA 2JN6A 5ED4A 2V9KA 4RGSA 4G6DA 3V7CA 1MSFC 2IJLA 2DMTA 2LREA 2BVLA 2P5KA 5DD4A 5J40A 1IO2A 3HUGB 2DDAA 3A0HC 5TJJA 4AVZA 4S0HB 4R1HA 2KRCA 4RS8A 1IZ1A 2IS6A 1OCOH 1MMNA 1U3EM 1BM9A 3ECHA 2DTRA 2GA2A 3PFYA 4HG2A 4KT5C 5CVUA 5HLTA 2Z16A 1Z6TA 3JRHA 5K5QA 5ICEA 2WB1N 2DK8A 2KIQA 2L4AA 1D0YA 1HC8A 2KZVA 3G4SI 2A2FX 1WZ2A 2VJIA 4A0XA 2JJ7A 2QQ8A 2XB5A 1UG2A 4AYBN 4JOMA 4RGRA 4A3DJ 1K79A 2MD5A 1DPUA 1YJ9I 2HU9A 3E5UA 3TO6A 3BHQA 1HDDC 1BBYA 1R4NB 2E36A 3GTJJ 2F07A 4M6XA 3BR1A 1W0UA 4ZC3A 1TQMA 3DLAA 3GTLJ 2OA4A 1UG0A 3F1BA 2OTJI 1P4XA 3CP8A 3LJLA 3T0YA 3T5XA 4A93J 1B59A 1FMVA 2QQAA 2YPRA 4ITVA 1H9GA 4HOBA 1LFUP 1ZGWA 3GTOJ 1BL0A 2HI3A 3QODA 2QA4I 3CLOA 2ETHA 5HNFA 4BNCA 5E3LA 3GFJA 3LQRA 1DGRM 1G3YA 1X1AA 3BC8A 4HYEA 2LC2A 2R7RA 4XQFA 3KKDA 4G7HF 2VKHA 3HC7A 4A6DA 1YX3A 1OCTC 3PJRA 3CCJI 3W6KB 1XGOA 1H8AC 1O3SA 3ZXSA 1ZR2A 4GCTA 1OYYA 5JVTA 4KUMA 3QPHA 4FTHA 2NP5A 3JAMZ 3FBIB 4A3MJ 3MVPA 2C6YA 1W1WE 3I58A 4GRIA 2BY2A 1JGSA 4ICHA 4DW6A 4EJTA 3ZQHA 1QRYA 3PUBA 4JQFA 4F3QA 3CC4I 2N8GA 3FF5A 4N4NB 2EIJH 2CG4A 3WGHA 2V1UA 4QIWN 1WHUA 1DP3A 2M9HA 2K3FA 3K4CA 5ERIA 2B63J 5JLWA 3CO6C 4AIHA 1EKEA 2EZLA 4E7LA 5L3FA 4CYCB 4P9UA 4C2TA 2E1OA 3HRMA 3MZ8A 3CDLA 4LG0B 2ZFWA 3UR3C 1BOAA 1STZA 3NXCA 4I98B 2E2IJ 5M3FJ 5DD8A 2QQ9A 2CUEA 4KITB 3OYBA 2DYSH 1KQ0A 2KKOA 4CA0A 4IOCF 2WAQN 1ETWA 1XGMA 2RNGA 1K7AA 5EZGA 3WG7H 3CC7I 1FWZA 4BJ6C 1FBUA 2Z2SB 2H1KA 4O3MA 5IYDJ 2K9QA 4E7IA 4J00A 2AXLA 3HTHA 2VKVA 2LMDA 2ICWG 1WVRA 3BTLA 2EILH 2A61A 4PUSA 3WE2A 1IRGA 1HBXG 2HQRA 3HSFA 1ONVA 1B8IB 1F4KA 2HYJA 4IX7A 2WB1A 2FX0A 2AHQA 3OS1A 1OPCA 2DFIA 3C2BA 3GUDA 4R8HA 4XL9A 5K5RA 3OYMA 1HOMA 3GBGA 4KICA 2OTLI 5DTDA 1W0TA 3LHQA 2X6WA 2JVHA 4EM2A 2JRTA 3VVXA 1TT5B 3AKZA 1I27A 2Z3YA 1W7PB 5DYMA 2JVGA 4HV5A 4A0YA 5E18F 1X58A 3SZTA 2VN2A 2I10A 1FOKA 1KQ8A 4ZH4F 3GZNB 4RGUA 3GMEA 3WHBA 4L0YB 1IAWA 2CMPA 2VODA 4BHPA 3FKIJ 4ZZDA 4IPAA 3GVAA 3ZN0A 1ZG5A 5CVIA 4EEFG 2DOFA 5M5XJ 2EZIA 4UDSA 1UMQA 2MLGA 3MD2A 3IH3A 2EA4A 4XLNF 1J9IA 4A5NA 3VW1A 3H1CA 3HE0A 2K27A 2OZUA 2VASA 3BG6A 2R7WA 1J09A 3M07A 3R6SA 4MTEA 3P9IA 3Q0UA 2DT5A 3BTIA 3OS0A 2P8TA 4XRMA 1ZG3A 4XNFA 2G3BA 4Y7NJ 2QKOA 3CDHA 1QA6A 3BT9A 2M8EA 2MGQA 4M3FA 4M9SA 2BZTA 4JX6A 4I99C 3RYRA 3TQNA 1OQYA 5LBQA 3S14J 1MMSA 2G7GA 2PBIA 4GYGA 2K86A 4U7DA 3T6NA 3FXMA 3DU6A 5D8LB 1T56A 2BV6A 2BBYA 2P6SA 3V8KA 2DFEA 3BOQA 1P4AA 3MFKA 2RN7A 2E35A 3MZYA 5DM6F 1I3QJ 3J7AO 1OR7A 3RPUD 4BBRJ 5KHDA 3RJPA 2W00A 2XDNA 3E7QA 2BXZA 3KPHA 1P7JA 1ZLKA 3WGIA 4BY7J 2ELJA 4XONA 1MH4A 5TRDA 2DOAA 2GOXB 3NS4A 1KU9A 3KETA 2CQKA 1VQMI 1FOYA 1EV7A 4HSRA 2WC2A 3PPBA 4WK8F 1K61A 4P9FA 4N9IA 3QRFF 2HFHA 3KEOA 3O3KA 3ZQ7A 3CCYA 3F21A 3AAFA 1UCRA 4EVIA 3AG1H 1XGSA 4PCQA 2CV0A 3RI4A 3W2AA 4Q5SF 1R5ID 1ZGJA 3BG9A 1SD4A 4QWQA 2IA0A 3BG7A 5LRRA 1D3YA 2FJI1 1X1PA 1B9MA 1QGPA 1MSEC 3IRQA 3V8JA 3WTWC 3GO5A 1R00A 4QTRA 2HYTA 2Y0SN 3CMMA 3M8FA 1W7PA 5FKMA 4ZZLA 3TW6A 1J5YA 2TRTA 3QPSA 1B1BA 5CQEA 1Y39A 2Y48A 1FMWA 4D7NA 2RDPA 3GEZA 5KVRA 1OYWA 1TWGJ 2CW0F 2L2OA 3BJOA 1FIPA 3V7RA 2B3WA 2ID3A 3OSFA 1E2XA 1YW7A 4WWCA 2E1CA 2VJJA 2JA5J 3BR6A 5D5VB 1U5TC 4FE4A 1QZEA 1REPC 3PQKA 1IDZA 3U21A 1AWCA 4G12A 3SYTA 3CO7C 5D5XB 1T0FA 4IHVA 2V6CA 2XPUA 4ZYGA 2FBKA 4E7ZA 2EV6A 3IP4B 3DFGA 4Y17A 2O03A 1TQPA 3IAM2 4IVNA 3G1OA 5EZHA 1QHGA 1RKTA 1IG7A 4GDFA 1USTA 3IWZA 1KONA 2H09A 2O8XA 4H0EA 4CXFA 3ABLH 3WE3A 4I76A 3F23A 1ZREA 3CCVI 2CV1A 3Q3SA 3CMEI 4OIOF 3JW4A 1XN7A 2B0LA 3LSHA 3K70C 4WXCA 4E7SA 2CH0A 2CYYA 4CZCA 3COAC 3D5SC 2PJRB 3CCQI 2V26A 3GTPJ 3S16J 2X6XA 2DFHA 4HAMA 2G9WA 2PZ9A 5L3CA 3F22A 3O60A 3H5NA 3HOYJ 2L7KA 1P6RA 1R6RA 4BGDA 3SFZA 2QSHX 2DW4A 1S8NA 2ZBKA 4MGRA 4I6ZA 1A31A 1S9HA 2E71A 2UXIA 2NVYJ 4UNOA 2YVEA 3AQSA 3S5RA 3OL4A 3WTTC 4E7HA 5A2QK 1T08B 4N9HA 5IP6A 2LF8A 5LD2C 2JSPA 4JX5A 3KP2A 3NWSA 3FIWA 1TTYA 5LEJA 4U88A 2CJJA 5J1UA 4M6YA 3R61A 4LJZF 4E70A 2K3PA 4XKBA 2MH9A 1D1AA 5DV5A 3P9TA 3M8JA 1Z7UA 4RAFA 1OR7C 5DCMB 3ANPA 4DQ2A 1U9OA 2XF6A 1SVOA 4ETSA 1V4RA 1ETQA 3TO7A 3DLLF 3DEUA 1FBSA 2DA4A 3A2KA 4DOZA 2HXIA 5GAHJ 2LBFA 1PJRA 3LSKA 2IVMA 5FGLA 4XKVA 3RIRA 2HOAA 1JKPC 4Z6YA 4QLCU 1FEXA 2IRFG 3CMYA 4FISA 1OJLA 3DBHB 3U1KA 1U6GA 2WAEA 3A4CA 1ZTRA 3LSPA 2D6YA 3I71A 3DXJF 1ZK8A 1UELB 1M1EB 4FX0A 1JHHA 2LYCA 2Y0SA 2EBIA 4QSHA 1V5FA 1XDSA 3HOZJ 5IOYA 1AKHB 3RQ4A 4YELA 1LDJA 3PNVA 2IS4A 3K4MA 2KRFA 4F92B 5DCFA 2VBXA 2Z5UA 5C4XJ 3HOSA 4BQOA 2CWEA 4IKFA 2Q24A 4CCLA 2KDOA 2W7NA 3L1PA 4OIQF 3KP6A 2PN6A 1QO0D 5HS8A 1T98A 2OAZA 1TWAJ 2NOJB 5J4YA 2UWMA 5F1RA 1QQIA 5IOZA 1X19A 3PM1A 1G6NA 4A3EJ 4A3LJ 2RC4A 1T2KA 2V79A 1UAAA 5BQTA 2LOOA 3CZ6A 4PSXA 2FA5A 4B4CA 5BPIA 3TBIA 4BACA 5KCMA 3M3YJ 2BW3B 3KEQA 1J75A 3GWZA 1OMIA 1E3HA 3K4KA 2JQ7A 3ABTA 1FOXA 3LSRA 1P2FA 4M73A 1S72I 4L9NA 1W5SA 5LHHA 3RQIA 6PAXA 2PMHA 4C30A 4HX8A 4LIVA 5E1WA 4IOAF 5CW8A 2I5UA 2DMQA 4XM3A 3I4NJ 1QVTA 4KIGA 3W3CA 2UXHA 3KYCB 2PLYA 2BY3A 3D5LA 1PP7U 4C3IJ 3CWRA 1XTAA 4RB2C 1IUYA 1RI7A 2JK3A 2M0CA 4KWAA 3TGNA 1Z1DA 5EYRA 2ESHA 5M3MJ 4XN3A 3I59B 3NQOA 2QWWA 5B1AH 4B43A 3N97A 2CSOA 4BQAA 5FRNA 1ZR4A 1XMAA 2ZJRF 1YHQI 1EJ9A 3OOUA 1FSHA 1X2NA 3WTVC 3HL2A 5HDGA 2E7XA 1Z9CA 3IAS2 1TNTA 2LVSA 4P55A 4ESJA 2PI0A 1GV2A 3HTAA 3CLQA 4HA8A 5F0CA 4ZDOA 3O2PE 3FXRA 4XMYA 5KAIC 2HOTA 3D0SA 1U8RA 4Z2YA 1MBEA 1ETYA 3H9GA 2R7VA 1RPWA 4BXXJ 3ZMSA 4E7KA 1DU6A 1I3AA 2W25A 2BE5F 2FNAA 5FKKA 5FO5A 1IV6A 1VQ7I 4M3GA 5B1BH 3ZCOA 3CJRB 4YIIA 3KEYA 3OIOA 3V78A 1SMYF 4GCLA 3H9JA 4EGZA 3G2BA 1JUPA 2HWVA 3MMYB 4OU0A 2P5VA 3S3NA 2BOLA 3LSMA 3L2CA 3G71I 3Q5FA 3IH4A 4CGRA 1WRJA 3FBNB 2FQ3A 5E3MA 1O7FA 1UHWA 3MQ0A 3F0CA 4JNNA 4U9LA 3SZPA 1W4MA 3GFMA 2R92J 1BI2A 2ECCA 2DDBA 2Y2ZA 3K1NA 1ZHFA 2DMUA 5CLSA 1JUSA 2BY1A 2IA1A 2V9VA 3VB2A 2JMWA 1XSVA 4A6EA 2WAFA 1DPRA 3VOKA 1O7LA 1ZAOA 1RKWA 1LKXA 2LH9A 1R22A 2VE8A 4ZJZA 1S7AA 1KYZA 3DPUA 2IS1A 5TISC 2KL4A 2ZC2A 2NS8A 3PL8A 4YFKF 1ULYA 2CW8A 4KIBA 3LAJA 3DPTA 3LFKA 5GADJ 1MJAA 5HLGA 1YS7A 3ZR8X 1F5TA 3VVZA 4F52A 4GO1A 4CCOA 1TT0A 4Y3OA 1UHMA 2FBHA 3KE2A 4IL6C 3RDIA 3EUPA 3DPLC 1GV5A 5KAFC 4LG0A 1K83J 5D18A 2HDWA 2QQBA 2XGEA 4C9YA 5J8CA 3OYLA 1QHHD 3OYEA 1JJ6C 2NP3A 3RD3A 1W36C 2A69F 2OV7A 1K4SA 1ZGAA 3LAPA 1MBGA 1V3FA 1BOBA 5D1RA 5ICGA 1I6XA 1VQ4I 3AQTA 4JK1X 3K70D 3H5AA 2PX9A 1AHDP 2DAOA 1YFHA 2MSYA 4NUBA 4BDYA 3WTZA 3HBLA 1VQ8I 3LWJA 5E20A 1TW2A 3GXOA 3PSFA 3PIOF 4MQ9F 3M7GA 2ID6A 1LE8A 3RKYA 4BHCA 4B8XA 1KZHA 2V7FA 4XOTA 3EUKL 1FY7A 1JGGA 3IL2A 1Y1WJ 2LNBA 4OIRF 2V57A 1CF7A 1JKRC 2JPBA 2XAJA 3U1DA 1QNTA 2MBFA 2YX7A 1BJZA 3RKWA 2DJIA 2FF4A 5H6QA 2JRMA 1VQOI 2V4JC 3ABUA 5TGTA 3LOCA 5IT9Z 2D45A 4CHUA 2E2HJ 2VPRA 1ODDA 1MNMC 1YO5C 4GYIA 3CMAI 4IHXA 2JA8J 2LKPA 1MDMB 3ZMDA 2GM4A 4PJJA 2R7SA 1U9NA 2UUZA 4HNVA 2B7EA 4UV8A 3DTKA 5C4JJ 5IYBJ 5D19A 3BY6A 1PUFA 2GFNA 2JUCA 4IRHA 5EEGA 3FHNA 4A3BJ 4AYBA 4BJTA 9ANTA 2JA2A 4NELA 2KIFA 3BZKA 1IN4A 4AF5A 1YOVB 1MMDA 5HSZA 1FZPB 2RQQA 1LB2A 2REKA 5E3NA 1XCVA 2A5YB 3E97A 3ECOA 4ENJA 1NH3A 1ZKGA 2HPIA 1FYLA 2O7TA 5D6EA 3B73A 1FYKA 3Q0WA 3B02A 3K2AA 3ASNH 4I01A 3SHFA 2YUSA 3KZIC 4OAYA 1P7IA 1BJAA 2XV4S 5CJ9A 2R5YA 1T95A 2XF5A 4XSZF 2UXPA 4B48A 1HDPA 5LHIA 4U0YA 2X9DA 1GXQA 2JSCA 1GHCA 4GFLA 3KP4A 5HS9A 1Y0UA 3JR9A 2KT0A 4BQQA 4A3CJ 3MEXA 4DNCA 1Z3YA 4ZYEA 5F27A 1LVKA 4KYWA 4XKCA 1Y0NA 2XB0X 5CVRA 2K40A 2ZKZA 1LUJB 4TV7A 3SFIA 1C0WA 5D5UB 2EA2A 2QENA 4EATA 2DTZA 3CUOA 2GQQA 3QOPA 5L3BA 1RZ4A 3CF2A 4Y33A 1YITI 1KU7A 2ADUA 3TL4X 3R60A 3A01B 3F8CA 2M4KA 3S3OA 1HKSA 1O57A 1UZCA 4NQWB 3ON4A 1YG2A 1TLHB 2HKXA 4IHSA 2GXAA 3WODF 3NARA 1HKTA 1Y1VJ 5EJCA 3HGGA 5FFZA 2NS7A 5K7HA 3HHGA 2IGOA 4XRSA 5J3LA 1ON2A 2M45A 2XDVA 5J1YA 2CO5A 5HS7A 2NYXA 4W1UA 3ONQA 5FHPA 4MNUA 4ZYDA 2EIMH 3FWEA 1MBFA 3HIMA 1SFXA 4LLGF 3D5RC 2ESNA 3N05A 3S17J 4G94A 3HGYA 3JRCA 1B9NA 5DM7F 2MW8A 4D7MA 2H27A 5EEHA 4OOIA 1QZZA 3RYPA 4BL0B 4EV0A 1X3WB 1P92A 2XAUA 3RCOA 1WJCA 3LL7A 1FLIA 1XMXA 1A35A 5HOOA 1EF4A 2XAHA 5LEKA 1V55H 5FD6A 5J4VA 2VT2A 3OYIA 1X1BA 3K10A 2UXUA 4E7JA 4O6JA 1XG1A 4G6QA 1ETXA 3BCGA 3HSEA 4BE1A 1RR7A 2F5EA 3JSOA 1LEBA 3KP3A 1OCRH 1SD6A 4YRVA 2R7ZJ 3KLNA 2O9LA 5E3OA 4D5CA 1D0ZA 3C3WA 1ZELA 4HX4A 4X1EA 3E6MA 1YJWI 1L3LA 3UNGC 4BH9A 3HYIA 3G1LA 3QAHA 2ZMEB 1RUNA 4M3DA 1IRZA 1LDDA 1ZARA 4U7BA 1PUFB 1Y8QB 2P0WA 3K4BA 1X3ZB 5FRMA 2HZDA 3W2WA 4CZZA 5HDNA 2KPMA 2BEOA 2QSGX 5F64A 1S7OA 2CW7A 4FE7A 4BBSJ 3K7AJ 4N4OB 1G3WA 5GAGJ 3V6GA 2RVCA 3FM5A 2IPQX 4M6VA 3C07A 2R4GA 2GAUA 2DQLA 2VOPA 4G6TB 2K85A 2VQHA 3GZ6A 2ZXHA 3PSIA 5KK1A 4QPQA 3F72A 1ORKA 2H8WA 2XSJC 4NB5A 5E1XA 3S8PA 1MKMA 2L01A 2ZMEA 3PIPF 3OWTA 3A1YA 2ZO4A 3V7SA 3U2RA 3CD6I 2X1DA 4II3A 2GIZA 3VVYA 1J0RA 4EJUA 1LNWA 3ZQQA 1G8XA 3DBRB 3LA2A 5EG0B 1ACIA 2GENA 3BWGA 4UUTA 3CUQA 2Z99A 3FK7A 2D1VA 4F91B 2F4OB 3C7JA 5GPCA 2B1EA 1VQ9I 4EJWA 1QPMA 1K6YA 2J5OA 1JKQC 1TZLA 3I54A 1UI5A 1RNLA 2HVQA 3WTSC 3ZMVA 2ZMEC 1X1DA 4EM0B 3ROUA 1RC9A 3C2HA 4NQWA 3BZCA 3SJMA 3MKWB 4G7ZF 3BCBA 1FP2A 1RESA 1I1GA 1HCRA 3JRGA 2K9LA 4PJMA 2GZWA 1WJBA 1PDNC 2FOKA 1JT0A 1HKQA 5F04A 2HVRA 3K8PC 4XORA 2WY8Q 1XSDA 5K58A 5K1YA 2ME6A 3WTUC 3S2HJ 1BR1A 3KZYA 2OI8A 1MBKA 3LSIA 2XKPA 5IP7J 1JI8A 2HEOA 1G3SA 2R7QA 2NVUB 1RETA 3P5JA 2QTQA 3D1NI 2EZHA 4YG2F 2UXNA 3L2QA 2HPMA 2ZXIA 1KU3A 1Z91A 3LSGA 3W6JB 1X1CA 2Y9YA 2EK5A 4IQJA 2TCTA 1MNEA 2HDCA 2M7BA 3VYSB 1SANA 2K9NA 4NHJA 1ZRDA 3ZQGA 1V5GA 2E1MB 2X6OA 1WJEA 4BXFA 4XBFA 1PP8F 4GFKA 2XAGA 2VBYA 1WCMJ 2L9SA 1PVEA 1A36A 3CC2I 4XRSG 4IF4A 3ZMUA 3TOBA 3KIOA 2KRHA 3LNQA 4MK6A 3EETA 2OCEA 4IRVA 2COBA 1VQNI 3ZQFA 5FLXK 2MH2A 4CO8A 3QWLA 2DJNA 4XLPF 4LK1F 4PJ0C 4B47A 3WGGA 3VWBA 1ZN2A 1Z67A 3JCUC 5E79C 1H0MA 3A03A 5IPAA 3OYNA 2VBWA 3BQYA 1R5GA 3ZN1A 1Z7LA 4YIRX 4NC7A 3GW2A 4NBQA 2GXGA 3GTGJ 3WHCA 3I5UA 3CJTB 4FT8A 4MFEA 2AQEA 2E1NA 3DV8A 2CS3A 4A3IJ 2F5FA 2BYVE 4WF2A 3OR2C 4O5VA 2JA7J 2DA6A 3FXOA 5BNGA 4S04A 2R5ZA 4U0WA 2R7FA 3CUQC 2VI6A 3PNYA 3KP5A 3ANGA 4XSXF 2FU4A 3I56I 1IN7A 5HBUA 2BGCA 4ZDPA 1XCBA 1GLNA 2A68F 1WKMA 4HF1A 2EV0A 4D9JA 4RDUA 2F4MB 2Z33A 4HKUA 2LDUA 2HQ5A 5DDGA 1PYVA 2ZOZA 2V9PA 2IAIA 2F5VA 2XVCA 2EWNA 1WJAA 2HDDA 3FK6A 3OSGA 5M5YJ 2BHZA 4AIJA 1B72B 4A3GJ 3HKZA 5IT3A 5EGOB 5FGMA 2B9SA 3QKXA 1XD7A 1P4WA 4D0PA 2UXXA 4LGWA 2EQRA 3PQJA 3GEUA 2VLAA 4PJNA 2EPFA 1IRXA 1MD0A 4HW0A 2YU9J 3B81A 4J19A 2KZGA 5ILUA 3F8BA 1F36A 4HF0A 2P81A 4L9TA 1VI0A 1OKRA 3JAMK 4UVAA 1K4TA 2YVHA 2Q2EB 2W24A 2NVTJ 1LJ9A 1DGWY 3FHZA 3GTMJ 3F6VA 4AM3A 4ZTFA 3WU1B 4P96A 2P7CB 4IRIA 3DKWA 2VT3A 3QU6A 4CICA 3EUHC 4XOPA 4RA2A 5HLIA 5D5WB 1YYVA 1MGTA 5JFRA 1BA5A 1T38A 2FQ4A 1TC3C 1XX5A 3LSTA 4G8XA 1LFPA 3Q9SA 1SVMA 3PO3J 1IV8A 3KYLA 2DG7A 3V4GA 2MD0A 2XGDA 2XUBA 1F9NA 3QYEA 4JYKA 2Y0MA 3PNTA 1J59A 3FDYA 2V1XA 1MJ9A 2VPLA 3DEEA 1GVDA 2DA5A 2W85A 1F43A 4LB6B 1XDUA 1ZRCA 4MEYF 1YW8A 3HRSA 2CFOA 4LITA 1H88C 3JTHA 3DQVC 2W1OA 2WTEA 2ZY9A 5ICCA 3OYAA 1L0OC 2FOWA 3C2GA 3IV5A 3VUQA 4IHYA 3H0GJ 2G7UA 2F4IA 4PDKA 1HW5A 3HEFA 1BI1A 4CCNA 4AU7A 4EQQA 2ISZA 4CH7A 2OQGA 3HB9A 4V19K 1N78A 2LY2A 2CV2A 2GBYA 3DTIA 2HVSA 2FMLA 4JX4A 4YFNF 2FUG2 3M9AA 4M9ZA 1PUEE 4ME9A 3HG9A 4Q48A 2HOEA 4UVBA 2M7AA 1WJDA 2H1LA 2R7OA 4RB0A 2ELKA 4KJZA 4KMFA 2ELHA 3NNRA 1JUMA 4MQVA 3ASOH 4LLLA 3M4OJ 3GTKJ 2G0EA 2QOPA 1GUUA 3MWMA 4F55A 3CCEI 2XPVA 2AO9A 4L5IA 2HNHA 3VP5A 5H9TA 2HQNA 2K4JA 2NOGA 1ZQ3P 4OD4A 4FETA 3ZQLA 1JHFA 2OU2A 5LGUA 4KNYA 3J81Z 3HJEA 3CJQB 4LFUA 1O3TA 4MLOA 3ERED 4HBLA 4PZJA 2VL8A 3Q9VA 2OD5A 1HSTA 5DUIA 2CU7A 5AQCA 3TDUC 1OCCH 4WCGA 5DAJA 1XGNA 4BKXA 2LTPA 1SAUA 4ZYAA 4BEHA 4M71A 5GP9A 4BDZA 4LOCA 2LKXA 2JWTA 3QYBA 2QM3A 1FBQA 2DYRH 4P5OA 3TO9A 1W36D 5CQGA 1MDMA 2O8KA 1VQLI 1WJ5A 3B6AA 5K7ZA 2QSFX 3EUAA 4FHTA 5J8FA 3BROA 3BTJA 2VKEA 3DEWA 3E5XA 3BRUA 2NXNB 1X4OA 1T6SA 3K0LA 2RGVA 5ILSA 2P4WA 2EFWA 1HQCA 3ERMA 2DO7A 2HYFA 3EDPA 3I0TA 3FMQA 4I09A 3F6OA 2EZKA 1J2XA 4BUPA 2K9MA 3CUQB 2ZJ2A 4Y13A 2KDZA 3MKLA 3RH2A 2EJRA 4Q47A 2WGBA 2LLKA 3CQZJ 1TL8A 1IXSB 2HTJA 2IP2A 3JRBA 3REOA 4MIMA 4NNJA 5EEAA 2L9VA 1GDTA 2K5CA 3TW7A 5CPRB 3ZMTA 3SZGA 4U87A 3CJNA 3FM3A 4WX9A 1UHSA 1K78A 2L9NA 1XPXA 3GCMA 3FXKA 2VB6A 2M8GX 5AIPA 1JT6A 2VC0A 2W4SA 2YX4A 5EG0A 2RREA 4JBAA 1LQ1A 2G7SA 1A5JA 1Z05A 1JXSA 1BI0A 1XS9A 1R7JA 2G7HA 3LMMA 1JTYA 5D8KB 2YS9A 3FXUA 3HIFA 2HYGD 3L9FA 3IHUA 2XAFA 3GZIA 4C2MA 4UY8I 1FSEA 3HOTA 2L0KA 4HX7A 2R3SA 3AL0C 3HRUA 1FOWA 3GZ5A 3WG9A 1DU0A 4XK4A 3JTGA 1R58A 3EUHA 3BJAA 2IT0A 4IEJA 3VYUB 4DYRA 5LGNA 1B6AA 4C2UA 3JSJA 2QIBA 4GFBA 2E2JJ 3QP6A 1HLVA 1WQ2A 3C18A 1MNDA 2GWRA 1FTTA 3LA3A 4HQMA 2V1NA 3PUFA 3OYJA 4AIDA 2K9SA 1K78B 3S93A 2WAQA 3QOEA 3FKJA 2F5DA 4KN4X 3NPIA 5B5EC 1IGNA 1TBXA 4C2MJ 2L4MA 1R1UA 2R7TA 4PJLA 3CDIA 3RSNA 4IRGA 3HTUA 1FJLA 5DUKA 4UHTA 2FD5A 4IJAA 2CGPA 2ZSHB 1I5ZA 4Y4RA 3VOXA 2X0LA 1OCPA 2I8DA 2MFZA 1MBJA 2GA1A 2A3SA 3BJBA 2DT6A 1Y8RB 2ZCXA 4II2A 3PFIA 1FYMA 3QYFA 1HW1A 5H2FC 3MCZA 3A02A 2PFBA 2Y9ZA 2RHAA 2VIXA 5DCMA 5CXGA 4EJOA 3QQAA 1R49A 4OMYA 1YIOA 4B1RA 2D1HA 3H92A 1S7EA 3AL0B 1USSA 1IN5A 3K1PA 1Y56A 2MLKA 1U78A 3KNWA 3QPLA 4ENNA 2A05A 4XLFA 1A6IA 1BI3A 4XR6A 2DCEA 2L02A 5FKNA 4HDUA 3KZ9A 3AFHA 1VQKI 1G2HA 1FT9A 4AUXA 3E1SA 5CVVA 3WTYC 2NS0A 2P6TA 2DA7A 2F5CA 3KYDB 4UUSB 3QBMA 5CKTA 1IW7F 4CDGA 2LRDA 1KGSA 4HEA2 2VUMJ 2HS5A 3WU2C 4HPQA 3HRTA 2OERA 1SFKA 2OJED 5CXIA 1SD7A 2Y31A 1U5TB 1YX5A 1XB4A 2PQ8A 4LG3A 4ANJA 2PMZN 2EIKH 3CTAA 1RR8C 1BW5A 3G3ZA 1OCZH 1TNSA 1IN6A 2COMA 2HQAA 2LF7A 5E17F 2DU9A 3SDBA 1D1BA 5JI6A 1ZG1A 2CUFA 4I2OA 3NWTA 4E6KG 2O7OA 2JUGA 2LP0A 3OYDA 3E7LA 4UB8C 1O4XA 3MN2A 3L09A 3HTJA 4X0GA 4DBRA 1TP4A 2RV8A 4HV6A 4CGZA 2QYOA 4LD5A 3VDXA 5BMZA 1N25A 1DDNA 4GXOA 3QPTA 4ENMA 3OL3A 4OAZA 4EMSA 3H3ZA 3C1DA 5GPAA 2ZNYA 3VYTB 4I0BA 2QEXI 3W2VA 2NNYA 4GCVA 1BIBA 4KFCA 2DMNA 2F2EA 5DS9A 4NDLA 1XSXA 3KZZA 2KIMA 3RZOJ 5AONA 2OPTA 3VPRA 5E8IA 1Y6IA 4XKWA 4AWXB 4DZPA 2HXOA 4LB5A 1VQ5I 5FLMJ 2Q2EA 3AG2H 3S3MA 3AG4H 1MIJA 1DUXC 5EDNA 2EV5A 4X6AJ 2RNJA 2LK2A 3VEPA 1AKHA 4ZYHA 3J7YJ 3FXLA 4A2UA 3P7NA 3PASA 2MC4A 3GFIA 3F9KA 2HKOA 2STWA 5IT9K 2QUFA 3A0BC 2JA6J 2FBQA 4W97A 3N4MA 1V54H 1R1TA 1U8BA 1T39A 1BW6A 1AA7A 5L3GA 5EGOA 4KDPA 2M30A 3JRDA 4RLFA 5L3EA 4PSWA 2E19A 1FIAA 1IRFA 1NG7A 4KN7X 4FCYA 3OYHA 2DXIA 2DI3A 3EGQA 2MG4A 3BR0A 5ICFA 2X51A 2Z9OA 2OUMA 4BY1J 3K4JA 4KIFA 2DA3A 2NVXJ 2RKHA 2X85A 3HHHA 1YE9A 3T8TA 3H3VK 3KFWX 1NG6A 1E17A 1E3PA 2OBPA 2M1BA 3VW0A 5K5OA 2A6EF 1MJBA 3OY9A 2D2WA 3G56A 3HTIA 2W57A 2MC3A 3ELKA 2PMZA 4OINF 2LBFB 1ITYA 1I50J 4MXMA 1EH7A 2YU3A 1LVAA 3L00A 2ZCWA 4EM1A 1YJNI 2XF7A 3HOUJ 2WA0A 3LQQA 3IKVA 1Z3XA 3O6BB 3CCSI 4BS9A 3I4PA 5HODA 3ZQIA 2FE3A 1AU7A 2PJPA 1B8IA 1Z0XA 3OYCA 2DQRA 3NEUA 1S3JA 2STTA 1T0FC 2KJBA 2XASA 3H0DA 2ME0A 4BEHB 3V42A 3FMSA 5FKOA 1TW3A 2LKSA 4L18B 1UI6A 3GLXA 1LPQA 1GT0C 2NVQJ 2VKDA 2GIVA 2OQRA 1POGA 1YLFA 4RLQA 1YI2I 2ZFUA 3O8GA 1ERDA 4AD9A 4BXUA 2OF7A 3BTCA 4HQEA 1WFXA 2R7UA 2VQGA 4A5MA 5C3EJ 2KP6A 2VJ5A 1H9TA 5HDKA 4XICA 1QPIA 2QBYB 5BPDA 1X2MA 4IHWA 4C3HJ 2GXBA 3TP0A 3I55I 3J80K 2CUZA 2KFDA 2R93J 1IDYA 3BG5A 3P9KA 1FP1D 3MNLA 1FTZA 3TMOA 1D5VA 2QLZA 1JTXA 2FEZA 2XIGA 3FZVA 2BY0A 5LHGA 1G4DA 5C4YA 1EH6A 2JT1A 5JVGF 1WH7A 4HSTA 1MMGA 2WV0A 5BOXA 4RM2A 3I4MJ 1KA8A 2XGCA 1S29A 1EH8A 5LRSA 3MZHA 3J80Z 1D8JA 5FD5A 4HNTA 3NRGA 2XHKA 3F8NA 3HOVJ 2YR2A 2KLOA 2GLOA 2W53A 2X1EA 3FXQA 3EYYA 3RKXA 4B09A 2CFXA 2K7LA 4RAYA 4BAYA 4CCKA 4A3JJ 2F48A 4ENKA 2DPUA 1SGMA 1TWHJ 4BU2A 3DF8A 2L3DA 3ON2A 1U2WA 3F3XA 4AC0A 1BR4A 1OFCX 5DEQA 2NRAC 1S5LC 4LMYA 3S1QJ 5FMPA 4M9XA 3JRFA 2RAEA 2XKOA 1YRNA 4KISA 5IP9J 3FX3A 5CYVA 3IUVA 2Q0OA 2H6CA 2VE9A 2DA2A 4AIKA 2ECBA 4KT6A 1FX7A 1H89C 3Q0VA 3J7AY 3ZP5A 1VTNC 4ZTJA 1IF1A 1WI3A 5J1RA 3I59A 1UB9A 1IXRC 3QU3A 4MHGA 3RPUA 3SEZA 3WTXC 4BE2A 1ZH5A 1RIOH 2IGKA 4HDVA 5FLVA
chains in the Genus database with same CATH topology
4DYCA 2FQ4A 1W0UA 1TC3C 3VOKA 1RKWA 3PO3J 2DG7A 3GTLJ 2LR8A 3F1BA 3GTQJ 3LJLA 2NS8A 2XGDA 4JYKA 1MBHA 4A93J 4V2GA 3CRJA 3KKCA 5F08A 1LE8B 1LFUP 1ZGWA 1GVDA 2DA5A 3GTOJ 1F43A 1BL0A 3VVZA 2HI3A 2DN0A 4L5EA 2CQQA 5E3LA 1H88C 2HOSA 3EUPA 3KKDA 1GV5A 3JREA 1OCTC 2CQXA 1H8AC 1K83J 3IV5A 2XGEA 2IBDA 4IHYA 5D18A 1NTCA 3H0GJ 1ZR2A 3VUQA 4GCTA 4D5FA 2NP3A 1JJ6C 3RD3A 3HEFA 4FTHA 5JLXA 2NP5A 1MBGA 5D1RA 3HB9A 2CRGA 4XIDA 4A3MJ 1JJ8C 1D5YA 3AQTA 2GBYA 3MVPA 2GUHA 3IH2A 1AHDP 4JX4A 1IC8A 2MSYA 4ICHA 3HBLA 4DW6A 3ZQHA 3LWJA 4ME9A 1QRYA 2N8GA 3B6CA 4QIWN 2ELKA 4ACIA 5HAWA 3NNRA 2ID6A 1JUMA 1LE8A 3LSJA 2M9HA 2B63J 3M4OJ 5JLWA 2G0EA 3GTKJ 2QOPA 1GUUA 1VNDA 2XPVA 2AO9A 3BR3A 2EZLA 1JGGA 4CYCB 1Y1WJ 3VP5A 5H9TA 2E1OA 2V57A 3CDLA 1JKRC 2L7MP 2NOGA 3NXCA 3HDDA 2E2IJ 5M3FJ 1ZQ3P 3ZQLA 2CUEA 1BJZA 2WAQN 1ETWA 4MLOA 5EZGA 2L7ZA 5IYDJ 2H1KA 2CU7A 2W48A 2K9QA 5AQCA 3HTHA 2VKVA 4MFDA 3LOCA 5DAJA 4BKXA 2LTPA 3BTLA 3UKGA 2E2HJ 2VPRA 1MNMC 5GP9A 2LKXA 4LOCA 4IHXA 1WH5A 2JWTA 2Y30A 2JA8J 2O8KA 2GM4A 1B8IB 1U9NA 2HYJA 4HNVA 3B6AA 4C3JJ 5K7ZA 5C4JJ 5D19A 5IYBJ 2FX0A 2AHQA 3BTJA 3C2BA 2VKEA 1HOMA 3DEWA 1PUFA 1ENHA 3GBGA 2GFNA 3BRUA 5DTDA 4A3BJ 1W0TA 9ANTA 3LHQA 4NELA 4AF5A 2ZB9A 2EZKA 3VVXA 5HSZA 2KDZA 1TWFJ 3RH2A 3MKLA 4M3BA 2IU5A 2R5ZB 1X58A 2REKA 2LLKA 3CQZJ 5E3NA 2WGBA 2I10A 1CQTA 1ZKGA 3JRBA 2O7TA 5EEAA 4MIMA 1GDTA 1XC5A 4M3EA 3TW7A 2G7LA 3Q0WA 3WHBA 3FKIJ 3K2AA 5K7FA 1UHSA 2YUSA 5F0FA 4EEFG 1P7IA 5M5XJ 3HKZN 2M8GX 1JT6A 2EZIA 2R5YA 1UMQA 4UDSA 2UXPA 2ZCMA 2QWTA 1HDPA 5EG0A 3IH3A 2G7SA 5EF6A 1A5JA 3VW1A 4A69C 1VFCA 2X9DA 3HE0A 2RASA 3NI7A 4GFLA 2IEKA 2M34A 2KT0A 3JR9A 1XS9A 4A3CJ 1JTYA 3SDGA 5F27A 2YS9A 2XB0X 3Q0UA 2K40A 3BTIA 3SFIA 4XRMA 3BR5A 3GZIA 2G3BA 4Y7NJ 2DTZA 2ZCNA 2QKOA 2L0KA 3BT9A 2QF7A 2MGQA 4M3FA 4JX6A 3S14J 3A01B 2LFBA 3G1MA 1DU0A 4XK4A 2G7GA 3T6NA 3VIBA 2XRLA 1T56A 4IEJA 4DYRA 3ON4A 3JSJA 4YZEA 3NARA 2QIBA 1Y1VJ 4GFBA 2E2JJ 1VF9A 1LFBA 3HGGA 1ETVA 2NS7A 2LD5A 1HLVA 5K7HA 4CYCA 4XRSA 3A01A 2EH3A 1FTTA 5J3LA 1I3QJ 4BBRJ 5J1YA 2XDNA 1Z77A 3E7QA 4W1UA 1P7JA 2K9SA 1I6HJ 4BY7J 2UXOA 5FHPA 3NPIA 1MH4A 2LY9A 1IGNA 4MO7A 2DMPA 4C2MJ 1MBFA 3HIMA 1WGXA 3PPBA 1K61A 4V2FA 3S17J 1FJLA 3HGYA 3JRCA 2FD5A 3CCYA 3VOXA 2MW8A 1OCPA 4D7MA 1MBJA 3BJBA 5M5WJ 3BG9A 2ZCXA 1E3OC 1R9TJ 3A02A 3HOXJ 2Y9ZA 2RHAA 1EF4A 5CXGA 1MSEC 3VW2A 4B3AA 3QQAA 4B1RA 3G7RA 1S7EA 1NK2P 2UXUA 1XG1A 4QTRA 2Y0SN 4A3FJ 2HYTA 5FKMA 1T33A 1ETOA 4JP0A 1ETXA 3BCGA 3TW6A 1U78A 2TRTA 1SFOJ 3QPSA 3ZQCA 3KNWA 3QPLA 2DA1A 1RR7A 1A6IA 4D7NA 1TWGJ 1FIPA 2ID3A 5FKNA 3OSFA 2R7ZJ 3KZ9A 2JA5J 2O9LA 5E3OA 3S1RJ 1G2HA 4D5CA 3BR6A 4AUXA 4FE4A 4X1EA 1IDZA 4G12A 2DA7A 4UUSB 3G1LA 4IHVA 3HOWJ 2QCOA 2XPUA 4M3DA 1IRZA 3QBMA 2VUMJ 1PUFB 2XPWA 2OERA 5CXIA 4RBOA 2Y31A 5EZHA 3G1OA 1RKTA 1IG7A 1B72A 2XSDC 2PMZN 4FE7A 4I76A 1WPKA 4BBSJ 1BW5A 3K7AJ 3BR2A 3Q3SA 4Y52J 2CUFA 3V6GA 4M6VA 3C07A 2O7OA 1HF0A 2L9RA 2LP0A 3GTPJ 3S16J 3E7LA 1ORKA 2PZ9A 1O4XA 3MN2A 4A3KJ 3HTJA 3O60A 3HOYJ 3HM5A 5FKLA 3JRIA 4ABZA 1APLC 4GCKA 4I6ZA 3VVYA 1JKOC 2FJ1A 3W6VA 2UXIA 2NVYJ 5EG0B 2GENA 5GPAA 2YVEA 4DZJA 3AQSA 4UUTA 3CJDA 3S5RA 4JKZA 5F0HA 3S15J 3ZOBA 5IP6A 5EFYA 3FK7A 1NK3P 2DMNA 5GPCA 5DS9A 4JX5A 4NDLA 3O8HA 2PBXA 3FIWA 3RZOJ 2OPTA 3VPRA 1JKQC 4UUSA 2CJJA 5J1UA 4DZPA 1UI5A 3S2DJ 1IUFA 2HXOA 1YRNB 5FLMJ 3P9TA 3SJMA 3RKQA 2X48A 3ANPA 5EDNA 4X6AJ 2LK2A 1AKHA 4PXIA 1QVUA 1RESA 1U9OA 1HCRA 3JRGA 3DCFA 2ZOYA 1ETQA 3PASA 3FISA 3JRAA 2WUIA 1JT0A 5F04A 5K58A 2JA6J 2DA4A 4W97A 2FBQA 2HXIA 1U8BA 1BW6A 5EGOA 2ME6A 3PO2J 3S2HJ 5FGLA 3JRDA 4L62A 2HOAA 1JKPC 3S1MJ 2OI8A 1MBKA 2E19A 1FIAA 1FEXA 5IP7J 3CMYA 2HKUA 4FCYA 1RETA 4FISA 2NX4A 3EGQA 2QTQA 1OJLA 2MG4A 3BR0A 1IJWC 3FRQA 3LSPA 1ZTRA 3D1NI 2EZHA 4BY1J 2D6YA 4NN1A 3DPJA 3S1NJ 2DA3A 2NVXJ 1ZK8A 3LSGA 2EBIA 2L7FP 2Y9YA 4QSHA 2TCTA 3HOZJ 5IOYA 3H3VK 1AKHB 4AC6A 1SANA 2K9NA 3VW0A 3ZQGA 3G56A 2X6OA 5F1JA 3HTIA 5C4XJ 1ETKA 1ITYA 1I50J 2Q24A 4GFKA 1WCMJ 3L1PA 4MXMA 4JL3A 5C44J 1TWCJ 1TWAJ 4XRSG 5IOZA 3HOUJ 3LNQA 3PM1A 4MK6A 4A3LJ 4A3EJ 5HODA 2COBA 3ZQIA 1AU7A 3ZQFA 1MH3A 1Q1VA 1B8IA 2DJNA 3NAUA 5IYCJ 1Z0XA 4B4CA 3TEDA 2ME0A 2D5VA 3M3YJ 5FKOA 3BNIA 1UI6A 2R5YB 4DYQA 3A03A 5IPAA 1GT0C 3BQYA 2NVQJ 3LSRA 5FJ8J 3BG3A 2M2EA 1POGA 3RQIA 5CW8A 3GTGJ 3WHCA 3O8GA 3TP3A 4MFEA 2DMQA 3I4NJ 4A3IJ 1QVTA 2OF7A 3BTCA 2UXHA 3COLA 2H8RA 5C3EJ 2JA7J 2DA6A 4C3IJ 3CWRA 4XICA 1QPIA 5BNGA 2R0QC 2R5ZA 2JK3A 1X2MA 2M0CA 4C3HJ 4IHWA 4KWAA 3TP0A 5EYRA 5M3MJ 2R93J 1IDYA 2VI6A 3BG5A 3BQZA 3MNLA 1FTZA 3ANGA 1JTXA 5HBUA 1ZR4A 5C4YA 2WV1A 3RZDJ 2DG8A 3OOUA 1X2NA 1WH7A 4RDUA 4HKUA 2LVSA 2HQ5A 2ZOZA 2JN6A 1GV2A 3HTAA 2IAIA 3I4MJ 2XGCA 5F0CA 2HDDA 1MSFC 3FK6A 2DMTA 3OSGA 5M5YJ 1B72B 4A3GJ 2HOTA 5EGOB 1MBEA 1ETYA 4S0HB 3NRGA 3QKXA 1RPWA 3HOVJ 4BXXJ 2GLOA 2W53A 2EQRA 1DU6A 3GEUA 5FKKA 3JRHA 4A3JJ 1IV6A 4M3GA 2YU9J 3B81A 1SGMA 1TWHJ 2WB1N 4J19A 3ON2A 1F36A 3OIOA 2P81A 3V78A 4AC0A 1OFCX 1VI0A 4GCLA 2YVHA 1JUPA 3S1QJ 5FMPA 3JRFA 2RAEA 2NVTJ 2JJ7A 1YRNA 2XB5A 3GTMJ 5IP9J 3IUVA 1UG2A 4AYBN 3IH4A 2DA2A 2ECBA 4CGRA 4A3DJ 5E3MA 1H89C 3Q0VA 3F0CA 4JNNA 2R92J 2ECCA 1WI3A 5J1RA 2Y2ZA 2DMUA 1JUSA 3BHQA 1HDDC 3GTJJ 5FLVA 2F07A 2JMWA 1BA5A 3BR1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DYC A;  2FQ4 A;  1W0U A;  1TC3 C;  3VOK A;  1RKW A;  3PO3 J;  2DG7 A;  3GTL J;  2LR8 A;  3F1B A;  3GTQ J;  3LJL A;  2NS8 A;  2XGD A;  4JYK A;  1MBH A;  4A93 J;  4V2G A;  3CRJ A;  3KKC A;  5F08 A;  1LE8 B;  1LFU P;  1ZGW A;  1GVD A;  2DA5 A;  3GTO J;  1F43 A;  1BL0 A;  3VVZ A;  2HI3 A;  2DN0 A;  4L5E A;  2CQQ A;  5E3L A;  1H88 C;  2HOS A;  3EUP A;  3KKD A;  1GV5 A;  3JRE A;  1OCT C;  2CQX A;  1H8A C;  1K83 J;  3IV5 A;  2XGE A;  2IBD A;  4IHY A;  5D18 A;  1NTC A;  3H0G J;  1ZR2 A;  3VUQ A;  4GCT A;  4D5F A;  2NP3 A;  1JJ6 C;  3RD3 A;  3HEF A;  4FTH A;  5JLX A;  2NP5 A;  1MBG A;  5D1R A;  3HB9 A;  2CRG A;  4XID A;  4A3M J;  1JJ8 C;  1D5Y A;  3AQT A;  2GBY A;  3MVP A;  2GUH A;  3IH2 A;  1AHD P;  4JX4 A;  1IC8 A;  2MSY A;  4ICH A;  3HBL A;  4DW6 A;  3ZQH A;  3LWJ A;  4ME9 A;  1QRY A;  2N8G A;  3B6C A;  4QIW N;  2ELK A;  4ACI A;  5HAW A;  3NNR A;  2ID6 A;  1JUM A;  1LE8 A;  3LSJ A;  2M9H A;  2B63 J;  3M4O J;  5JLW A;  2G0E A;  3GTK J;  2QOP A;  1GUU A;  1VND A;  2XPV A;  2AO9 A;  3BR3 A;  2EZL A;  1JGG A;  4CYC B;  1Y1W J;  3VP5 A;  5H9T A;  2E1O A;  2V57 A;  3CDL A;  1JKR C;  2L7M P;  2NOG A;  3NXC A;  3HDD A;  2E2I J;  5M3F J;  1ZQ3 P;  3ZQL A;  2CUE A;  1BJZ A;  2WAQ N;  1ETW A;  4MLO A;  5EZG A;  2L7Z A;  5IYD J;  2H1K A;  2CU7 A;  2W48 A;  2K9Q A;  5AQC A;  3HTH A;  2VKV A;  4MFD A;  3LOC A;  5DAJ A;  4BKX A;  2LTP A;  3BTL A;  3UKG A;  2E2H J;  2VPR A;  1MNM C;  5GP9 A;  2LKX A;  4LOC A;  4IHX A;  1WH5 A;  2JWT A;  2Y30 A;  2JA8 J;  2O8K A;  2GM4 A;  1B8I B;  1U9N A;  2HYJ A;  4HNV A;  3B6A A;  4C3J J;  5K7Z A;  5C4J J;  5D19 A;  5IYB J;  2FX0 A;  2AHQ A;  3BTJ A;  3C2B A;  2VKE A;  1HOM A;  3DEW A;  1PUF A;  1ENH A;  3GBG A;  2GFN A;  3BRU A;  5DTD A;  4A3B J;  1W0T A;  9ANT A;  3LHQ A;  4NEL A;  4AF5 A;  2ZB9 A;  2EZK A;  3VVX A;  5HSZ A;  2KDZ A;  1TWF J;  3RH2 A;  3MKL A;  4M3B A;  2IU5 A;  2R5Z B;  1X58 A;  2REK A;  2LLK A;  3CQZ J;  5E3N A;  2WGB A;  2I10 A;  1CQT A;  1ZKG A;  3JRB A;  2O7T A;  5EEA A;  4MIM A;  1GDT A;  1XC5 A;  4M3E A;  3TW7 A;  2G7L A;  3Q0W A;  3WHB A;  3FKI J;  3K2A A;  5K7F A;  1UHS A;  2YUS A;  5F0F A;  4EEF G;  1P7I A;  5M5X J;  3HKZ N;  2M8G X;  1JT6 A;  2EZI A;  2R5Y A;  1UMQ A;  4UDS A;  2UXP A;  2ZCM A;  2QWT A;  1HDP A;  5EG0 A;  3IH3 A;  2G7S A;  5EF6 A;  1A5J A;  3VW1 A;  4A69 C;  1VFC A;  2X9D A;  3HE0 A;  2RAS A;  3NI7 A;  4GFL A;  2IEK A;  2M34 A;  2KT0 A;  3JR9 A;  1XS9 A;  4A3C J;  1JTY A;  3SDG A;  5F27 A;  2YS9 A;  2XB0 X;  3Q0U A;  2K40 A;  3BTI A;  3SFI A;  4XRM A;  3BR5 A;  3GZI A;  2G3B A;  4Y7N J;  2DTZ A;  2ZCN A;  2QKO A;  2L0K A;  3BT9 A;  2QF7 A;  2MGQ A;  4M3F A;  4JX6 A;  3S14 J;  3A01 B;  2LFB A;  3G1M A;  1DU0 A;  4XK4 A;  2G7G A;  3T6N A;  3VIB A;  2XRL A;  1T56 A;  4IEJ A;  4DYR A;  3ON4 A;  3JSJ A;  4YZE A;  3NAR A;  2QIB A;  1Y1V J;  4GFB A;  2E2J J;  1VF9 A;  1LFB A;  3HGG A;  1ETV A;  2NS7 A;  2LD5 A;  1HLV A;  5K7H A;  4CYC A;  4XRS A;  3A01 A;  2EH3 A;  1FTT A;  5J3L A;  1I3Q J;  4BBR J;  5J1Y A;  2XDN A;  1Z77 A;  3E7Q A;  4W1U A;  1P7J A;  2K9S A;  1I6H J;  4BY7 J;  2UXO A;  5FHP A;  3NPI A;  1MH4 A;  2LY9 A;  1IGN A;  4MO7 A;  2DMP A;  4C2M J;  1MBF A;  3HIM A;  1WGX A;  3PPB A;  1K61 A;  4V2F A;  3S17 J;  1FJL A;  3HGY A;  3JRC A;  2FD5 A;  3CCY A;  3VOX A;  2MW8 A;  1OCP A;  4D7M A;  1MBJ A;  3BJB A;  5M5W J;  3BG9 A;  2ZCX A;  1E3O C;  1R9T J;  3A02 A;  3HOX J;  2Y9Z A;  2RHA A;  1EF4 A;  5CXG A;  1MSE C;  3VW2 A;  4B3A A;  3QQA A;  4B1R A;  3G7R A;  1S7E A;  1NK2 P;  2UXU A;  1XG1 A;  4QTR A;  2Y0S N;  4A3F J;  2HYT A;  5FKM A;  1T33 A;  1ETO A;  4JP0 A;  1ETX A;  3BCG A;  3TW6 A;  1U78 A;  2TRT A;  1SFO J;  3QPS A;  3ZQC A;  3KNW A;  3QPL A;  2DA1 A;  1RR7 A;  1A6I A;  4D7N A;  1TWG J;  1FIP A;  2ID3 A;  5FKN A;  3OSF A;  2R7Z J;  3KZ9 A;  2JA5 J;  2O9L A;  5E3O A;  3S1R J;  1G2H A;  4D5C A;  3BR6 A;  4AUX A;  4FE4 A;  4X1E A;  1IDZ A;  4G12 A;  2DA7 A;  4UUS B;  3G1L A;  4IHV A;  3HOW J;  2QCO A;  2XPU A;  4M3D A;  1IRZ A;  3QBM A;  2VUM J;  1PUF B;  2XPW A;  2OER A;  5CXI A;  4RBO A;  2Y31 A;  5EZH A;  3G1O A;  1RKT A;  1IG7 A;  1B72 A;  2XSD C;  2PMZ N;  4FE7 A;  4I76 A;  1WPK A;  4BBS J;  1BW5 A;  3K7A J;  3BR2 A;  3Q3S A;  4Y52 J;  2CUF A;  3V6G A;  4M6V A;  3C07 A;  2O7O A;  1HF0 A;  2L9R A;  2LP0 A;  3GTP J;  3S16 J;  3E7L A;  1ORK A;  2PZ9 A;  1O4X A;  3MN2 A;  4A3K J;  3HTJ A;  3O60 A;  3HOY J;  3HM5 A;  5FKL A;  3JRI A;  4ABZ A;  1APL C;  4GCK A;  4I6Z A;  3VVY A;  1JKO C;  2FJ1 A;  3W6V A;  2UXI A;  2NVY J;  5EG0 B;  2GEN A;  5GPA A;  2YVE A;  4DZJ A;  3AQS A;  4UUT A;  3CJD A;  3S5R A;  4JKZ A;  5F0H A;  3S15 J;  3ZOB A;  5IP6 A;  5EFY A;  3FK7 A;  1NK3 P;  2DMN A;  5GPC A;  5DS9 A;  4JX5 A;  4NDL A;  3O8H A;  2PBX A;  3FIW A;  3RZO J;  2OPT A;  3VPR A;  1JKQ C;  4UUS A;  2CJJ A;  5J1U A;  4DZP A;  1UI5 A;  3S2D J;  1IUF A;  2HXO A;  1YRN B;  5FLM J;  3P9T A;  3SJM A;  3RKQ A;  2X48 A;  3ANP A;  5EDN A;  4X6A J;  2LK2 A;  1AKH A;  4PXI A;  1QVU A;  1RES A;  1U9O A;  1HCR A;  3JRG A;  3DCF A;  2ZOY A;  1ETQ A;  3PAS A;  3FIS A;  3JRA A;  2WUI A;  1JT0 A;  5F04 A;  5K58 A;  2JA6 J;  2DA4 A;  4W97 A;  2FBQ A;  2HXI A;  1U8B A;  1BW6 A;  5EGO A;  2ME6 A;  3PO2 J;  3S2H J;  5FGL A;  3JRD A;  4L62 A;  2HOA A;  1JKP C;  3S1M J;  2OI8 A;  1MBK A;  2E19 A;  1FIA A;  1FEX A;  5IP7 J;  3CMY A;  2HKU A;  4FCY A;  1RET A;  4FIS A;  2NX4 A;  3EGQ A;  2QTQ A;  1OJL A;  2MG4 A;  3BR0 A;  1IJW C;  3FRQ A;  3LSP A;  1ZTR A;  3D1N I;  2EZH A;  4BY1 J;  2D6Y A;  4NN1 A;  3DPJ A;  3S1N J;  2DA3 A;  2NVX J;  1ZK8 A;  3LSG A;  2EBI A;  2L7F P;  2Y9Y A;  4QSH A;  2TCT A;  3HOZ J;  5IOY A;  3H3V K;  1AKH B;  4AC6 A;  1SAN A;  2K9N A;  3VW0 A;  3ZQG A;  3G56 A;  2X6O A;  5F1J A;  3HTI A;  5C4X J;  1ETK A;  1ITY A;  1I50 J;  2Q24 A;  4GFK A;  1WCM J;  3L1P A;  4MXM A;  4JL3 A;  5C44 J;  1TWC J;  1TWA J;  4XRS G;  5IOZ A;  3HOU J;  3LNQ A;  3PM1 A;  4MK6 A;  4A3L J;  4A3E J;  5HOD A;  2COB A;  3ZQI A;  1AU7 A;  3ZQF A;  1MH3 A;  1Q1V A;  1B8I A;  2DJN A;  3NAU A;  5IYC J;  1Z0X A;  4B4C A;  3TED A;  2ME0 A;  2D5V A;  3M3Y J;  5FKO A;  3BNI A;  1UI6 A;  2R5Y B;  4DYQ A;  3A03 A;  5IPA A;  1GT0 C;  3BQY A;  2NVQ J;  3LSR A;  5FJ8 J;  3BG3 A;  2M2E A;  1POG A;  3RQI A;  5CW8 A;  3GTG J;  3WHC A;  3O8G A;  3TP3 A;  4MFE A;  2DMQ A;  3I4N J;  4A3I J;  1QVT A;  2OF7 A;  3BTC A;  2UXH A;  3COL A;  2H8R A;  5C3E J;  2JA7 J;  2DA6 A;  4C3I J;  3CWR A;  4XIC A;  1QPI A;  5BNG A;  2R0Q C;  2R5Z A;  2JK3 A;  1X2M A;  2M0C A;  4C3H J;  4IHW A;  4KWA A;  3TP0 A;  5EYR A;  5M3M J;  2R93 J;  1IDY A;  2VI6 A;  3BG5 A;  3BQZ A;  3MNL A;  1FTZ A;  3ANG A;  1JTX A;  5HBU A;  1ZR4 A;  5C4Y A;  2WV1 A;  3RZD J;  2DG8 A;  3OOU A;  1X2N A;  1WH7 A;  4RDU A;  4HKU A;  2LVS A;  2HQ5 A;  2ZOZ A;  2JN6 A;  1GV2 A;  3HTA A;  2IAI A;  3I4M J;  2XGC A;  5F0C A;  2HDD A;  1MSF C;  3FK6 A;  2DMT A;  3OSG A;  5M5Y J;  1B72 B;  4A3G J;  2HOT A;  5EGO B;  1MBE A;  1ETY A;  4S0H B;  3NRG A;  3QKX A;  1RPW A;  3HOV J;  4BXX J;  2GLO A;  2W53 A;  2EQR A;  1DU6 A;  3GEU A;  5FKK A;  3JRH A;  4A3J J;  1IV6 A;  4M3G A;  2YU9 J;  3B81 A;  1SGM A;  1TWH J;  2WB1 N;  4J19 A;  3ON2 A;  1F36 A;  3OIO A;  2P81 A;  3V78 A;  4AC0 A;  1OFC X;  1VI0 A;  4GCL A;  2YVH A;  1JUP A;  3S1Q J;  5FMP A;  3JRF A;  2RAE A;  2NVT J;  2JJ7 A;  1YRN A;  2XB5 A;  3GTM J;  5IP9 J;  3IUV A;  1UG2 A;  4AYB N;  3IH4 A;  2DA2 A;  2ECB A;  4CGR A;  4A3D J;  5E3M A;  1H89 C;  3Q0V A;  3F0C A;  4JNN A;  2R92 J;  2ECC A;  1WI3 A;  5J1R A;  2Y2Z A;  2DMU A;  1JUS A;  3BHQ A;  1HDD C;  3GTJ J;  5FLV A;  2F07 A;  2JMW A;  1BA5 A;  3BR1 A; 
#chains in the Genus database with same CATH topology
 4DYC A;  3BP8 A;  3GLL A;  2AS5 F;  3ULQ B;  3DTE A;  4EGY A;  2LR8 A;  3GTQ J;  2DOD A;  1MBH A;  3CRJ A;  4V2G A;  3KKC A;  5D4R A;  1Q1H A;  5F08 A;  1LE8 B;  2E60 A;  3ML6 A;  4UUV A;  4ESF A;  2CQN A;  2DN0 A;  2HTS A;  4MEX F;  4L5E A;  2CQQ A;  4N0B A;  2QBY A;  5LFA A;  1UJ8 A;  3BJ6 A;  1ZRF A;  1VZ0 A;  2HOS A;  1CGP A;  3ABK H;  3K4N A;  3OIP A;  4HNU A;  3VFZ A;  4PGH A;  4OIP F;  2DK5 A;  3JRE A;  4HF2 A;  1R5H A;  2A07 F;  2CQX A;  5CVJ A;  2IS2 A;  2IBD A;  2JZY A;  2RQP A;  1NTC A;  2DOE A;  2V1D A;  4I02 A;  2DBB A;  3EYI A;  4D5F A;  1I39 A;  5JLX A;  3CCM I;  4CCJ A;  4AVP A;  2O3F A;  1W7P D;  1D8K A;  2CRG A;  4GGG A;  4XID A;  5BS6 A;  1JJ8 C;  1D5Y A;  1G3T A;  4L0Z B;  1OIS A;  3H5R A;  5HVQ C;  3IH2 A;  2GUH A;  2Q1Z B;  4F7Z A;  1IC8 A;  2DPD A;  1R1V A;  3ZMZ A;  3ZPL A;  2KIU A;  5H20 A;  2FBI A;  4Y15 A;  1X4P A;  4BJ5 C;  1IXC A;  5B3S H;  4IZZ A;  4RAZ A;  3ABM H;  3VOD A;  3B6C A;  3BZ6 A;  4ACI A;  1GVJ A;  5HAW A;  2UV1 A;  3LSJ A;  4NC8 A;  2X1C A;  4BQN A;  2P5L C;  1VND A;  1BN5 A;  2QKL B;  2A5W A;  2FSW A;  5B66 C;  1O3Q A;  3BR3 A;  2BW3 A;  1S6L A;  3HXL A;  2EB7 A;  3QP5 A;  5E1Z B;  3ZGK A;  1E0E A;  1X3U A;  2L7M P;  3LWF A;  4L5J A;  4U0V A;  1HA8 A;  3HDD A;  2L54 A;  2YVX A;  1UFM A;  2M87 A;  3K1M A;  4BYY A;  3G73 A;  1YIJ I;  3DWL E;  1KU2 A;  3NRV A;  4FQG A;  3CP2 A;  1MW7 A;  3EQL F;  3V8L A;  3KP7 A;  2L7Z A;  3KLO A;  4K2E A;  2W48 A;  4WXH A;  3MKY B;  4MFD A;  4BHB A;  3BLY A;  3BPV A;  4D1Q A;  1BC8 C;  2VXZ A;  4YEJ A;  3UKG A;  4YIF A;  4BE0 A;  2IGM A;  2K4B A;  2NAZ A;  2OC6 A;  3DKY A;  1SEU A;  1WH5 A;  1I1S A;  1J7K A;  2Y30 A;  3MAJ A;  5LLQ A;  2VQC A;  5LGT A;  4UV9 A;  1TQI A;  3K6G A;  4C3J J;  4A0Z A;  4LLN A;  4HLY A;  1EA3 A;  1WSU A;  2PFV A;  2AXT C;  1ENH A;  2H6B A;  4A12 A;  2E7W A;  3DBL B;  4OD5 A;  4RM3 A;  1B4A A;  2ZB9 A;  1W5T A;  2WAD A;  2DFF A;  4PFP A;  2QVO A;  1TWF J;  2X4H A;  2ACJ A;  2Z1D A;  4M3B A;  2IU5 A;  2MYS A;  3H9Q A;  2KHM A;  2R5Z B;  3L7W A;  2VBZ A;  3MKZ A;  1N75 A;  4OWR B;  1RRJ A;  1CQT A;  1LEA A;  1SVL A;  3HPH A;  3K69 A;  1XC5 A;  4M3E A;  3VOE A;  2G7L A;  1KYW A;  4FX4 A;  3FXJ A;  4ZDL A;  4UVC A;  2L5Q A;  4Q4Z F;  5K7F A;  2Q8K A;  5H6R A;  5F0F A;  3M8E A;  2EFP A;  1YTY A;  2PJR A;  3HKZ N;  4IXA A;  1SD5 A;  3HUG A;  1NHA A;  2ZCM A;  5AIQ A;  4DJA A;  5JHU A;  2QWT A;  3M1E A;  1D1C A;  5EF6 A;  2HR3 A;  3OV8 A;  4A69 C;  1VFC A;  2LG4 A;  2RAS A;  3NI7 A;  2VXD A;  2IEK A;  2M34 A;  3GX4 X;  3I64 A;  5D6F A;  5GTI C;  2Y69 H;  3SDG A;  1FPQ A;  1BR2 A;  1ZLJ A;  3G6E I;  3LA7 A;  3H36 A;  2ZXW H;  3SQN A;  2FRH A;  2DT7 B;  3BR5 A;  5F6F A;  2CUJ A;  2O0Y A;  1HXD A;  2ZCN A;  1MZB A;  1VQ6 I;  1YQA A;  2EFN A;  2BHY A;  2QF7 A;  3I9V 2;  3F8F A;  1Z21 A;  2MAB A;  3E5Q A;  3OMY A;  4F93 B;  2LFB A;  3G1M A;  3VIB A;  5FLX Z;  2XRL A;  3L2V A;  3IC7 A;  1QBJ A;  4YZE A;  2W82 A;  4DGW B;  2W84 A;  1VF9 A;  1LFB A;  4OMZ A;  1ETV A;  2LD5 A;  5GAE J;  4CYC A;  3A01 A;  2EH3 A;  3U9G A;  1Z77 A;  3I3L A;  2IXS A;  4XLC A;  3DU5 A;  4QPO A;  4RMN A;  4IO9 F;  1I6H J;  2UXO A;  1LDK B;  5FB2 A;  3VSL A;  2LY9 A;  4MO7 A;  2J5P A;  2DMP A;  2WWY A;  1JE8 A;  2VOO A;  1WGX A;  2V6E A;  5GTH C;  2AQF A;  2IW5 A;  4ASN A;  4V2F A;  3DP7 A;  3ESW B;  3E3V A;  4I0A A;  2KMU A;  2BXY A;  3TDZ C;  3LFU A;  1QU3 A;  2M3A A;  5JR3 A;  5M5W J;  4B3X A;  5JHF A;  2EFO A;  3J81 K;  2VJ4 A;  3I53 A;  1E3O C;  1R9T J;  3CCU I;  4PFO A;  3HOX J;  3P9C A;  3H35 A;  4WIB A;  3VW2 A;  4B3A A;  4UXN A;  4J01 A;  2GOM A;  4XLH A;  2BVM A;  3K4L A;  2XRO A;  2EFQ A;  2QGU A;  3G7R A;  3CCL I;  1NK2 P;  2ISY A;  3R0J A;  1O3R A;  1A6Q A;  4A3F J;  1T33 A;  1ETO A;  4JP0 A;  3L2U A;  2LY1 A;  3FMR A;  1SFO J;  1XMK A;  4DVY P;  3DKX A;  3ZQC A;  2DA1 A;  2VQL A;  1ON1 A;  2E5N A;  2OZ6 A;  4S05 A;  3OOP A;  2FMY A;  3IKT A;  3S1R J;  5HNH A;  2O6G E;  4E4H A;  2XAQ A;  1FC3 A;  1FNN A;  2ZXJ A;  3VTI A;  3BCA A;  3HOW J;  2QCO A;  3L2W A;  4I7H A;  2O61 A;  3K9T A;  4LIU A;  4RB3 C;  2XPW A;  2P7V B;  5FFX A;  2OCC H;  4RBO A;  3E0J B;  3GYH X;  1QZY A;  1B72 A;  2XSD C;  2H94 A;  4ON0 A;  5KNL A;  2DLL A;  1WPK A;  2VON A;  3AG3 H;  3BR2 A;  3H3U A;  4M74 A;  3VSK A;  4B44 A;  4Y52 J;  3HPG A;  2M5W A;  2PMU A;  1HF0 A;  2L9R A;  2WY7 Q;  1DP7 P;  3E6D A;  3OYF A;  4A3K J;  1HW2 A;  2UZK A;  3IRR A;  3HM5 A;  2Y75 A;  2E5Z A;  3OIQ A;  4DBQ A;  5FKL A;  1KQ9 A;  3JRI A;  4ABZ A;  1APL C;  4GCK A;  3L2R A;  1R71 A;  1JKO C;  1CF7 B;  2FJ1 A;  3W6V A;  1SFE A;  4YFX F;  1IN8 A;  1W5C C;  4DZJ A;  3CJD A;  4JKZ A;  3ISP A;  5F0H A;  3S15 J;  2PEX A;  3ZOB A;  4G9Y A;  4RGX A;  5EFY A;  1NK3 P;  4U9N A;  3O8H A;  2PBX A;  2R7D A;  2ZJQ F;  2JTV A;  3SEQ A;  4UUS A;  3BPX A;  3S2D J;  1IUF A;  2M0M A;  1GXP A;  1YRN B;  1F1Z A;  1AOY A;  4IHT A;  1G59 A;  2CQ7 A;  1MMA A;  2JPC A;  3RKQ A;  1V5E A;  2X48 A;  5E8G A;  3CF5 F;  4CYD A;  1QVU A;  4PXI A;  3HZJ A;  3DCF A;  3S2W A;  3HSR A;  2ZOY A;  3FIS A;  3KX2 A;  3EPZ A;  3JRA A;  1SC7 A;  2WUI A;  3RPQ A;  4KMU X;  4PGG A;  5FRO A;  2O5R A;  1R23 A;  3F8M A;  3PO2 J;  2YSR A;  3SWH A;  4L62 A;  3S1M J;  3OYK A;  3GF2 A;  3ZRG A;  3SXY A;  2HKU A;  1WJF A;  4HLX A;  4ESB A;  5L3D A;  1SMT A;  2K02 A;  2NX4 A;  1U5T A;  3GFL A;  4NC6 A;  3CCR I;  1IJW C;  4MTD A;  3FRQ A;  3J7Z I;  1U0J A;  4NN1 A;  3IWF A;  2E34 A;  3RTR A;  3DPJ A;  2HZT A;  2ZSI B;  3S1N J;  1T8I A;  1SAX A;  4XLE A;  4G7O F;  4L9V A;  2L7F P;  1R4M B;  4CUG A;  1ZYR F;  3E6B A;  3JSP A;  4AC6 A;  1D0X A;  3KCC A;  3R4K A;  1K6O A;  1OLT A;  5ILV A;  3HTS B;  2ZJP F;  4FAS D;  4EJV A;  5F1J A;  4CSW A;  5J47 A;  3OYG A;  1SFU A;  2R7X A;  3E6C C;  5A2Q Z;  1BIA A;  1ETK A;  1WWX A;  2KQR A;  2KJC A;  4P1W A;  4JL3 A;  2QZ8 A;  5C44 J;  2KIS A;  3R0A A;  1TWC J;  3M1C A;  2E1M C;  1P9Q C;  2NNN A;  5D4S A;  1YW9 A;  5HLH A;  1MH3 A;  1Q1V A;  3NAU A;  4XN0 A;  5IYC J;  2MA3 A;  2LSO A;  4IQ4 A;  3OS2 A;  2HGC A;  4H4K C;  3T8R A;  3TED A;  2D5V A;  1A04 A;  3BNI A;  1BC7 C;  3IUO A;  1Z6R A;  2R5Y B;  4DYQ A;  2FXA A;  4HRI A;  1OYI A;  2A6H F;  4XRF A;  5FJ8 J;  4CCM A;  3BG3 A;  2M2E A;  4WXD A;  3TP3 A;  3CES A;  4PK4 A;  3WU0 A;  1N77 A;  2M4G A;  3COL A;  2H8R A;  2X6Y A;  4M72 A;  4HZF A;  4XLA A;  2ZNZ A;  1R36 A;  4R79 A;  1HSJ A;  4LK0 F;  2R0Q C;  2XRN A;  2FNP A;  3VYR B;  5IY5 H;  3X2Q H;  3K2Z A;  3BQZ A;  4DIQ A;  5J6X A;  4KA4 A;  1DQU A;  4L9J A;  1WI9 A;  3T1B A;  1VQP I;  3TKY A;  2VC1 A;  2XGX A;  4RB1 A;  2WBM A;  2WV1 A;  2IA2 A;  3RZD J;  2DG8 A;  2IGN A;  4RAG A;  3BDD A;  1YS6 A;  2F6C A;  2PG4 A;  2QKM B;  3S32 A;  3TOA A;  2XC7 A;  1RUO A;  2A6T A;  4UB6 C;  3OR1 C;  2EIN H;  2TDX A;  2JN6 A;  5ED4 A;  2V9K A;  4RGS A;  4G6D A;  3V7C A;  1MSF C;  2IJL A;  2DMT A;  2LRE A;  2BVL A;  2P5K A;  5DD4 A;  5J40 A;  1IO2 A;  3HUG B;  2DDA A;  3A0H C;  5TJJ A;  4AVZ A;  4S0H B;  4R1H A;  2KRC A;  4RS8 A;  1IZ1 A;  2IS6 A;  1OCO H;  1MMN A;  1U3E M;  1BM9 A;  3ECH A;  2DTR A;  2GA2 A;  3PFY A;  4HG2 A;  4KT5 C;  5CVU A;  5HLT A;  2Z16 A;  1Z6T A;  3JRH A;  5K5Q A;  5ICE A;  2WB1 N;  2DK8 A;  2KIQ A;  2L4A A;  1D0Y A;  1HC8 A;  2KZV A;  3G4S I;  2A2F X;  1WZ2 A;  2VJI A;  4A0X A;  2JJ7 A;  2QQ8 A;  2XB5 A;  1UG2 A;  4AYB N;  4JOM A;  4RGR A;  4A3D J;  1K79 A;  2MD5 A;  1DPU A;  1YJ9 I;  2HU9 A;  3E5U A;  3TO6 A;  3BHQ A;  1HDD C;  1BBY A;  1R4N B;  2E36 A;  3GTJ J;  2F07 A;  4M6X A;  3BR1 A;  1W0U A;  4ZC3 A;  1TQM A;  3DLA A;  3GTL J;  2OA4 A;  1UG0 A;  3F1B A;  2OTJ I;  1P4X A;  3CP8 A;  3LJL A;  3T0Y A;  3T5X A;  4A93 J;  1B59 A;  1FMV A;  2QQA A;  2YPR A;  4ITV A;  1H9G A;  4HOB A;  1LFU P;  1ZGW A;  3GTO J;  1BL0 A;  2HI3 A;  3QOD A;  2QA4 I;  3CLO A;  2ETH A;  5HNF A;  4BNC A;  5E3L A;  3GFJ A;  3LQR A;  1DGR M;  1G3Y A;  1X1A A;  3BC8 A;  4HYE A;  2LC2 A;  2R7R A;  4XQF A;  3KKD A;  4G7H F;  2VKH A;  3HC7 A;  4A6D A;  1YX3 A;  1OCT C;  3PJR A;  3CCJ I;  3W6K B;  1XGO A;  1H8A C;  1O3S A;  3ZXS A;  1ZR2 A;  4GCT A;  1OYY A;  5JVT A;  4KUM A;  3QPH A;  4FTH A;  2NP5 A;  3JAM Z;  3FBI B;  4A3M J;  3MVP A;  2C6Y A;  1W1W E;  3I58 A;  4GRI A;  2BY2 A;  1JGS A;  4ICH A;  4DW6 A;  4EJT A;  3ZQH A;  1QRY A;  3PUB A;  4JQF A;  4F3Q A;  3CC4 I;  2N8G A;  3FF5 A;  4N4N B;  2EIJ H;  2CG4 A;  3WGH A;  2V1U A;  4QIW N;  1WHU A;  1DP3 A;  2M9H A;  2K3F A;  3K4C A;  5ERI A;  2B63 J;  5JLW A;  3CO6 C;  4AIH A;  1EKE A;  2EZL A;  4E7L A;  5L3F A;  4CYC B;  4P9U A;  4C2T A;  2E1O A;  3HRM A;  3MZ8 A;  3CDL A;  4LG0 B;  2ZFW A;  3UR3 C;  1BOA A;  1STZ A;  3NXC A;  4I98 B;  2E2I J;  5M3F J;  5DD8 A;  2QQ9 A;  2CUE A;  4KIT B;  3OYB A;  2DYS H;  1KQ0 A;  2KKO A;  4CA0 A;  4IOC F;  2WAQ N;  1ETW A;  1XGM A;  2RNG A;  1K7A A;  5EZG A;  3WG7 H;  3CC7 I;  1FWZ A;  4BJ6 C;  1FBU A;  2Z2S B;  2H1K A;  4O3M A;  5IYD J;  2K9Q A;  4E7I A;  4J00 A;  2AXL A;  3HTH A;  2VKV A;  2LMD A;  2ICW G;  1WVR A;  3BTL A;  2EIL H;  2A61 A;  4PUS A;  3WE2 A;  1IRG A;  1HBX G;  2HQR A;  3HSF A;  1ONV A;  1B8I B;  1F4K A;  2HYJ A;  4IX7 A;  2WB1 A;  2FX0 A;  2AHQ A;  3OS1 A;  1OPC A;  2DFI A;  3C2B A;  3GUD A;  4R8H A;  4XL9 A;  5K5R A;  3OYM A;  1HOM A;  3GBG A;  4KIC A;  2OTL I;  5DTD A;  1W0T A;  3LHQ A;  2X6W A;  2JVH A;  4EM2 A;  2JRT A;  3VVX A;  1TT5 B;  3AKZ A;  1I27 A;  2Z3Y A;  1W7P B;  5DYM A;  2JVG A;  4HV5 A;  4A0Y A;  5E18 F;  1X58 A;  3SZT A;  2VN2 A;  2I10 A;  1FOK A;  1KQ8 A;  4ZH4 F;  3GZN B;  4RGU A;  3GME A;  3WHB A;  4L0Y B;  1IAW A;  2CMP A;  2VOD A;  4BHP A;  3FKI J;  4ZZD A;  4IPA A;  3GVA A;  3ZN0 A;  1ZG5 A;  5CVI A;  4EEF G;  2DOF A;  5M5X J;  2EZI A;  4UDS A;  1UMQ A;  2MLG A;  3MD2 A;  3IH3 A;  2EA4 A;  4XLN F;  1J9I A;  4A5N A;  3VW1 A;  3H1C A;  3HE0 A;  2K27 A;  2OZU A;  2VAS A;  3BG6 A;  2R7W A;  1J09 A;  3M07 A;  3R6S A;  4MTE A;  3P9I A;  3Q0U A;  2DT5 A;  3BTI A;  3OS0 A;  2P8T A;  4XRM A;  1ZG3 A;  4XNF A;  2G3B A;  4Y7N J;  2QKO A;  3CDH A;  1QA6 A;  3BT9 A;  2M8E A;  2MGQ A;  4M3F A;  4M9S A;  2BZT A;  4JX6 A;  4I99 C;  3RYR A;  3TQN A;  1OQY A;  5LBQ A;  3S14 J;  1MMS A;  2G7G A;  2PBI A;  4GYG A;  2K86 A;  4U7D A;  3T6N A;  3FXM A;  3DU6 A;  5D8L B;  1T56 A;  2BV6 A;  2BBY A;  2P6S A;  3V8K A;  2DFE A;  3BOQ A;  1P4A A;  3MFK A;  2RN7 A;  2E35 A;  3MZY A;  5DM6 F;  1I3Q J;  3J7A O;  1OR7 A;  3RPU D;  4BBR J;  5KHD A;  3RJP A;  2W00 A;  2XDN A;  3E7Q A;  2BXZ A;  3KPH A;  1P7J A;  1ZLK A;  3WGI A;  4BY7 J;  2ELJ A;  4XON A;  1MH4 A;  5TRD A;  2DOA A;  2GOX B;  3NS4 A;  1KU9 A;  3KET A;  2CQK A;  1VQM I;  1FOY A;  1EV7 A;  4HSR A;  2WC2 A;  3PPB A;  4WK8 F;  1K61 A;  4P9F A;  4N9I A;  3QRF F;  2HFH A;  3KEO A;  3O3K A;  3ZQ7 A;  3CCY A;  3F21 A;  3AAF A;  1UCR A;  4EVI A;  3AG1 H;  1XGS A;  4PCQ A;  2CV0 A;  3RI4 A;  3W2A A;  4Q5S F;  1R5I D;  1ZGJ A;  3BG9 A;  1SD4 A;  4QWQ A;  2IA0 A;  3BG7 A;  5LRR A;  1D3Y A;  2FJI 1;  1X1P A;  1B9M A;  1QGP A;  1MSE C;  3IRQ A;  3V8J A;  3WTW C;  3GO5 A;  1R00 A;  4QTR A;  2HYT A;  2Y0S N;  3CMM A;  3M8F A;  1W7P A;  5FKM A;  4ZZL A;  3TW6 A;  1J5Y A;  2TRT A;  3QPS A;  1B1B A;  5CQE A;  1Y39 A;  2Y48 A;  1FMW A;  4D7N A;  2RDP A;  3GEZ A;  5KVR A;  1OYW A;  1TWG J;  2CW0 F;  2L2O A;  3BJO A;  1FIP A;  3V7R A;  2B3W A;  2ID3 A;  3OSF A;  1E2X A;  1YW7 A;  4WWC A;  2E1C A;  2VJJ A;  2JA5 J;  3BR6 A;  5D5V B;  1U5T C;  4FE4 A;  1QZE A;  1REP C;  3PQK A;  1IDZ A;  3U21 A;  1AWC A;  4G12 A;  3SYT A;  3CO7 C;  5D5X B;  1T0F A;  4IHV A;  2V6C A;  2XPU A;  4ZYG A;  2FBK A;  4E7Z A;  2EV6 A;  3IP4 B;  3DFG A;  4Y17 A;  2O03 A;  1TQP A;  3IAM 2;  4IVN A;  3G1O A;  5EZH A;  1QHG A;  1RKT A;  1IG7 A;  4GDF A;  1UST A;  3IWZ A;  1KON A;  2H09 A;  2O8X A;  4H0E A;  4CXF A;  3ABL H;  3WE3 A;  4I76 A;  3F23 A;  1ZRE A;  3CCV I;  2CV1 A;  3Q3S A;  3CME I;  4OIO F;  3JW4 A;  1XN7 A;  2B0L A;  3LSH A;  3K70 C;  4WXC A;  4E7S A;  2CH0 A;  2CYY A;  4CZC A;  3COA C;  3D5S C;  2PJR B;  3CCQ I;  2V26 A;  3GTP J;  3S16 J;  2X6X A;  2DFH A;  4HAM A;  2G9W A;  2PZ9 A;  5L3C A;  3F22 A;  3O60 A;  3H5N A;  3HOY J;  2L7K A;  1P6R A;  1R6R A;  4BGD A;  3SFZ A;  2QSH X;  2DW4 A;  1S8N A;  2ZBK A;  4MGR A;  4I6Z A;  1A31 A;  1S9H A;  2E71 A;  2UXI A;  2NVY J;  4UNO A;  2YVE A;  3AQS A;  3S5R A;  3OL4 A;  3WTT C;  4E7H A;  5A2Q K;  1T08 B;  4N9H A;  5IP6 A;  2LF8 A;  5LD2 C;  2JSP A;  4JX5 A;  3KP2 A;  3NWS A;  3FIW A;  1TTY A;  5LEJ A;  4U88 A;  2CJJ A;  5J1U A;  4M6Y A;  3R61 A;  4LJZ F;  4E70 A;  2K3P A;  4XKB A;  2MH9 A;  1D1A A;  5DV5 A;  3P9T A;  3M8J A;  1Z7U A;  4RAF A;  1OR7 C;  5DCM B;  3ANP A;  4DQ2 A;  1U9O A;  2XF6 A;  1SVO A;  4ETS A;  1V4R A;  1ETQ A;  3TO7 A;  3DLL F;  3DEU A;  1FBS A;  2DA4 A;  3A2K A;  4DOZ A;  2HXI A;  5GAH J;  2LBF A;  1PJR A;  3LSK A;  2IVM A;  5FGL A;  4XKV A;  3RIR A;  2HOA A;  1JKP C;  4Z6Y A;  4QLC U;  1FEX A;  2IRF G;  3CMY A;  4FIS A;  1OJL A;  3DBH B;  3U1K A;  1U6G A;  2WAE A;  3A4C A;  1ZTR A;  3LSP A;  2D6Y A;  3I71 A;  3DXJ F;  1ZK8 A;  1UEL B;  1M1E B;  4FX0 A;  1JHH A;  2LYC A;  2Y0S A;  2EBI A;  4QSH A;  1V5F A;  1XDS A;  3HOZ J;  5IOY A;  1AKH B;  3RQ4 A;  4YEL A;  1LDJ A;  3PNV A;  2IS4 A;  3K4M A;  2KRF A;  4F92 B;  5DCF A;  2VBX A;  2Z5U A;  5C4X J;  3HOS A;  4BQO A;  2CWE A;  4IKF A;  2Q24 A;  4CCL A;  2KDO A;  2W7N A;  3L1P A;  4OIQ F;  3KP6 A;  2PN6 A;  1QO0 D;  5HS8 A;  1T98 A;  2OAZ A;  1TWA J;  2NOJ B;  5J4Y A;  2UWM A;  5F1R A;  1QQI A;  5IOZ A;  1X19 A;  3PM1 A;  1G6N A;  4A3E J;  4A3L J;  2RC4 A;  1T2K A;  2V79 A;  1UAA A;  5BQT A;  2LOO A;  3CZ6 A;  4PSX A;  2FA5 A;  4B4C A;  5BPI A;  3TBI A;  4BAC A;  5KCM A;  3M3Y J;  2BW3 B;  3KEQ A;  1J75 A;  3GWZ A;  1OMI A;  1E3H A;  3K4K A;  2JQ7 A;  3ABT A;  1FOX A;  3LSR A;  1P2F A;  4M73 A;  1S72 I;  4L9N A;  1W5S A;  5LHH A;  3RQI A;  6PAX A;  2PMH A;  4C30 A;  4HX8 A;  4LIV A;  5E1W A;  4IOA F;  5CW8 A;  2I5U A;  2DMQ A;  4XM3 A;  3I4N J;  1QVT A;  4KIG A;  3W3C A;  2UXH A;  3KYC B;  2PLY A;  2BY3 A;  3D5L A;  1PP7 U;  4C3I J;  3CWR A;  1XTA A;  4RB2 C;  1IUY A;  1RI7 A;  2JK3 A;  2M0C A;  4KWA A;  3TGN A;  1Z1D A;  5EYR A;  2ESH A;  5M3M J;  4XN3 A;  3I59 B;  3NQO A;  2QWW A;  5B1A H;  4B43 A;  3N97 A;  2CSO A;  4BQA A;  5FRN A;  1ZR4 A;  1XMA A;  2ZJR F;  1YHQ I;  1EJ9 A;  3OOU A;  1FSH A;  1X2N A;  3WTV C;  3HL2 A;  5HDG A;  2E7X A;  1Z9C A;  3IAS 2;  1TNT A;  2LVS A;  4P55 A;  4ESJ A;  2PI0 A;  1GV2 A;  3HTA A;  3CLQ A;  4HA8 A;  5F0C A;  4ZDO A;  3O2P E;  3FXR A;  4XMY A;  5KAI C;  2HOT A;  3D0S A;  1U8R A;  4Z2Y A;  1MBE A;  1ETY A;  3H9G A;  2R7V A;  1RPW A;  4BXX J;  3ZMS A;  4E7K A;  1DU6 A;  1I3A A;  2W25 A;  2BE5 F;  2FNA A;  5FKK A;  5FO5 A;  1IV6 A;  1VQ7 I;  4M3G A;  5B1B H;  3ZCO A;  3CJR B;  4YII A;  3KEY A;  3OIO A;  3V78 A;  1SMY F;  4GCL A;  3H9J A;  4EGZ A;  3G2B A;  1JUP A;  2HWV A;  3MMY B;  4OU0 A;  2P5V A;  3S3N A;  2BOL A;  3LSM A;  3L2C A;  3G71 I;  3Q5F A;  3IH4 A;  4CGR A;  1WRJ A;  3FBN B;  2FQ3 A;  5E3M A;  1O7F A;  1UHW A;  3MQ0 A;  3F0C A;  4JNN A;  4U9L A;  3SZP A;  1W4M A;  3GFM A;  2R92 J;  1BI2 A;  2ECC A;  2DDB A;  2Y2Z A;  3K1N A;  1ZHF A;  2DMU A;  5CLS A;  1JUS A;  2BY1 A;  2IA1 A;  2V9V A;  3VB2 A;  2JMW A;  1XSV A;  4A6E A;  2WAF A;  1DPR A;  3VOK A;  1O7L A;  1ZAO A;  1RKW A;  1LKX A;  2LH9 A;  1R22 A;  2VE8 A;  4ZJZ A;  1S7A A;  1KYZ A;  3DPU A;  2IS1 A;  5TIS C;  2KL4 A;  2ZC2 A;  2NS8 A;  3PL8 A;  4YFK F;  1ULY A;  2CW8 A;  4KIB A;  3LAJ A;  3DPT A;  3LFK A;  5GAD J;  1MJA A;  5HLG A;  1YS7 A;  3ZR8 X;  1F5T A;  3VVZ A;  4F52 A;  4GO1 A;  4CCO A;  1TT0 A;  4Y3O A;  1UHM A;  2FBH A;  3KE2 A;  4IL6 C;  3RDI A;  3EUP A;  3DPL C;  1GV5 A;  5KAF C;  4LG0 A;  1K83 J;  5D18 A;  2HDW A;  2QQB A;  2XGE A;  4C9Y A;  5J8C A;  3OYL A;  1QHH D;  3OYE A;  1JJ6 C;  2NP3 A;  3RD3 A;  1W36 C;  2A69 F;  2OV7 A;  1K4S A;  1ZGA A;  3LAP A;  1MBG A;  1V3F A;  1BOB A;  5D1R A;  5ICG A;  1I6X A;  1VQ4 I;  3AQT A;  4JK1 X;  3K70 D;  3H5A A;  2PX9 A;  1AHD P;  2DAO A;  1YFH A;  2MSY A;  4NUB A;  4BDY A;  3WTZ A;  3HBL A;  1VQ8 I;  3LWJ A;  5E20 A;  1TW2 A;  3GXO A;  3PSF A;  3PIO F;  4MQ9 F;  3M7G A;  2ID6 A;  1LE8 A;  3RKY A;  4BHC A;  4B8X A;  1KZH A;  2V7F A;  4XOT A;  3EUK L;  1FY7 A;  1JGG A;  3IL2 A;  1Y1W J;  2LNB A;  4OIR F;  2V57 A;  1CF7 A;  1JKR C;  2JPB A;  2XAJ A;  3U1D A;  1QNT A;  2MBF A;  2YX7 A;  1BJZ A;  3RKW A;  2DJI A;  2FF4 A;  5H6Q A;  2JRM A;  1VQO I;  2V4J C;  3ABU A;  5TGT A;  3LOC A;  5IT9 Z;  2D45 A;  4CHU A;  2E2H J;  2VPR A;  1ODD A;  1MNM C;  1YO5 C;  4GYI A;  3CMA I;  4IHX A;  2JA8 J;  2LKP A;  1MDM B;  3ZMD A;  2GM4 A;  4PJJ A;  2R7S A;  1U9N A;  2UUZ A;  4HNV A;  2B7E A;  4UV8 A;  3DTK A;  5C4J J;  5IYB J;  5D19 A;  3BY6 A;  1PUF A;  2GFN A;  2JUC A;  4IRH A;  5EEG A;  3FHN A;  4A3B J;  4AYB A;  4BJT A;  9ANT A;  2JA2 A;  4NEL A;  2KIF A;  3BZK A;  1IN4 A;  4AF5 A;  1YOV B;  1MMD A;  5HSZ A;  1FZP B;  2RQQ A;  1LB2 A;  2REK A;  5E3N A;  1XCV A;  2A5Y B;  3E97 A;  3ECO A;  4ENJ A;  1NH3 A;  1ZKG A;  2HPI A;  1FYL A;  2O7T A;  5D6E A;  3B73 A;  1FYK A;  3Q0W A;  3B02 A;  3K2A A;  3ASN H;  4I01 A;  3SHF A;  2YUS A;  3KZI C;  4OAY A;  1P7I A;  1BJA A;  2XV4 S;  5CJ9 A;  2R5Y A;  1T95 A;  2XF5 A;  4XSZ F;  2UXP A;  4B48 A;  1HDP A;  5LHI A;  4U0Y A;  2X9D A;  1GXQ A;  2JSC A;  1GHC A;  4GFL A;  3KP4 A;  5HS9 A;  1Y0U A;  3JR9 A;  2KT0 A;  4BQQ A;  4A3C J;  3MEX A;  4DNC A;  1Z3Y A;  4ZYE A;  5F27 A;  1LVK A;  4KYW A;  4XKC A;  1Y0N A;  2XB0 X;  5CVR A;  2K40 A;  2ZKZ A;  1LUJ B;  4TV7 A;  3SFI A;  1C0W A;  5D5U B;  2EA2 A;  2QEN A;  4EAT A;  2DTZ A;  3CUO A;  2GQQ A;  3QOP A;  5L3B A;  1RZ4 A;  3CF2 A;  4Y33 A;  1YIT I;  1KU7 A;  2ADU A;  3TL4 X;  3R60 A;  3A01 B;  3F8C A;  2M4K A;  3S3O A;  1HKS A;  1O57 A;  1UZC A;  4NQW B;  3ON4 A;  1YG2 A;  1TLH B;  2HKX A;  4IHS A;  2GXA A;  3WOD F;  3NAR A;  1HKT A;  1Y1V J;  5EJC A;  3HGG A;  5FFZ A;  2NS7 A;  5K7H A;  3HHG A;  2IGO A;  4XRS A;  5J3L A;  1ON2 A;  2M45 A;  2XDV A;  5J1Y A;  2CO5 A;  5HS7 A;  2NYX A;  4W1U A;  3ONQ A;  5FHP A;  4MNU A;  4ZYD A;  2EIM H;  3FWE A;  1MBF A;  3HIM A;  1SFX A;  4LLG F;  3D5R C;  2ESN A;  3N05 A;  3S17 J;  4G94 A;  3HGY A;  3JRC A;  1B9N A;  5DM7 F;  2MW8 A;  4D7M A;  2H27 A;  5EEH A;  4OOI A;  1QZZ A;  3RYP A;  4BL0 B;  4EV0 A;  1X3W B;  1P92 A;  2XAU A;  3RCO A;  1WJC A;  3LL7 A;  1FLI A;  1XMX A;  1A35 A;  5HOO A;  1EF4 A;  2XAH A;  5LEK A;  1V55 H;  5FD6 A;  5J4V A;  2VT2 A;  3OYI A;  1X1B A;  3K10 A;  2UXU A;  4E7J A;  4O6J A;  1XG1 A;  4G6Q A;  1ETX A;  3BCG A;  3HSE A;  4BE1 A;  1RR7 A;  2F5E A;  3JSO A;  1LEB A;  3KP3 A;  1OCR H;  1SD6 A;  4YRV A;  2R7Z J;  3KLN A;  2O9L A;  5E3O A;  4D5C A;  1D0Z A;  3C3W A;  1ZEL A;  4HX4 A;  4X1E A;  3E6M A;  1YJW I;  1L3L A;  3UNG C;  4BH9 A;  3HYI A;  3G1L A;  3QAH A;  2ZME B;  1RUN A;  4M3D A;  1IRZ A;  1LDD A;  1ZAR A;  4U7B A;  1PUF B;  1Y8Q B;  2P0W A;  3K4B A;  1X3Z B;  5FRM A;  2HZD A;  3W2W A;  4CZZ A;  5HDN A;  2KPM A;  2BEO A;  2QSG X;  5F64 A;  1S7O A;  2CW7 A;  4FE7 A;  4BBS J;  3K7A J;  4N4O B;  1G3W A;  5GAG J;  3V6G A;  2RVC A;  3FM5 A;  2IPQ X;  4M6V A;  3C07 A;  2R4G A;  2GAU A;  2DQL A;  2VOP A;  4G6T B;  2K85 A;  2VQH A;  3GZ6 A;  2ZXH A;  3PSI A;  5KK1 A;  4QPQ A;  3F72 A;  1ORK A;  2H8W A;  2XSJ C;  4NB5 A;  5E1X A;  3S8P A;  1MKM A;  2L01 A;  2ZME A;  3PIP F;  3OWT A;  3A1Y A;  2ZO4 A;  3V7S A;  3U2R A;  3CD6 I;  2X1D A;  4II3 A;  2GIZ A;  3VVY A;  1J0R A;  4EJU A;  1LNW A;  3ZQQ A;  1G8X A;  3DBR B;  3LA2 A;  5EG0 B;  1ACI A;  2GEN A;  3BWG A;  4UUT A;  3CUQ A;  2Z99 A;  3FK7 A;  2D1V A;  4F91 B;  2F4O B;  3C7J A;  5GPC A;  2B1E A;  1VQ9 I;  4EJW A;  1QPM A;  1K6Y A;  2J5O A;  1JKQ C;  1TZL A;  3I54 A;  1UI5 A;  1RNL A;  2HVQ A;  3WTS C;  3ZMV A;  2ZME C;  1X1D A;  4EM0 B;  3ROU A;  1RC9 A;  3C2H A;  4NQW A;  3BZC A;  3SJM A;  3MKW B;  4G7Z F;  3BCB A;  1FP2 A;  1RES A;  1I1G A;  1HCR A;  3JRG A;  2K9L A;  4PJM A;  2GZW A;  1WJB A;  1PDN C;  2FOK A;  1JT0 A;  1HKQ A;  5F04 A;  2HVR A;  3K8P C;  4XOR A;  2WY8 Q;  1XSD A;  5K58 A;  5K1Y A;  2ME6 A;  3WTU C;  3S2H J;  1BR1 A;  3KZY A;  2OI8 A;  1MBK A;  3LSI A;  2XKP A;  5IP7 J;  1JI8 A;  2HEO A;  1G3S A;  2R7Q A;  2NVU B;  1RET A;  3P5J A;  2QTQ A;  3D1N I;  2EZH A;  4YG2 F;  2UXN A;  3L2Q A;  2HPM A;  2ZXI A;  1KU3 A;  1Z91 A;  3LSG A;  3W6J B;  1X1C A;  2Y9Y A;  2EK5 A;  4IQJ A;  2TCT A;  1MNE A;  2HDC A;  2M7B A;  3VYS B;  1SAN A;  2K9N A;  4NHJ A;  1ZRD A;  3ZQG A;  1V5G A;  2E1M B;  2X6O A;  1WJE A;  4BXF A;  4XBF A;  1PP8 F;  4GFK A;  2XAG A;  2VBY A;  1WCM J;  2L9S A;  1PVE A;  1A36 A;  3CC2 I;  4XRS G;  4IF4 A;  3ZMU A;  3TOB A;  3KIO A;  2KRH A;  3LNQ A;  4MK6 A;  3EET A;  2OCE A;  4IRV A;  2COB A;  1VQN I;  3ZQF A;  5FLX K;  2MH2 A;  4CO8 A;  3QWL A;  2DJN A;  4XLP F;  4LK1 F;  4PJ0 C;  4B47 A;  3WGG A;  3VWB A;  1ZN2 A;  1Z67 A;  3JCU C;  5E79 C;  1H0M A;  3A03 A;  5IPA A;  3OYN A;  2VBW A;  3BQY A;  1R5G A;  3ZN1 A;  1Z7L A;  4YIR X;  4NC7 A;  3GW2 A;  4NBQ A;  2GXG A;  3GTG J;  3WHC A;  3I5U A;  3CJT B;  4FT8 A;  4MFE A;  2AQE A;  2E1N A;  3DV8 A;  2CS3 A;  4A3I J;  2F5F A;  2BYV E;  4WF2 A;  3OR2 C;  4O5V A;  2JA7 J;  2DA6 A;  3FXO A;  5BNG A;  4S04 A;  2R5Z A;  4U0W A;  2R7F A;  3CUQ C;  2VI6 A;  3PNY A;  3KP5 A;  3ANG A;  4XSX F;  2FU4 A;  3I56 I;  1IN7 A;  5HBU A;  2BGC A;  4ZDP A;  1XCB A;  1GLN A;  2A68 F;  1WKM A;  4HF1 A;  2EV0 A;  4D9J A;  4RDU A;  2F4M B;  2Z33 A;  4HKU A;  2LDU A;  2HQ5 A;  5DDG A;  1PYV A;  2ZOZ A;  2V9P A;  2IAI A;  2F5V A;  2XVC A;  2EWN A;  1WJA A;  2HDD A;  3FK6 A;  3OSG A;  5M5Y J;  2BHZ A;  4AIJ A;  1B72 B;  4A3G J;  3HKZ A;  5IT3 A;  5EGO B;  5FGM A;  2B9S A;  3QKX A;  1XD7 A;  1P4W A;  4D0P A;  2UXX A;  4LGW A;  2EQR A;  3PQJ A;  3GEU A;  2VLA A;  4PJN A;  2EPF A;  1IRX A;  1MD0 A;  4HW0 A;  2YU9 J;  3B81 A;  4J19 A;  2KZG A;  5ILU A;  3F8B A;  1F36 A;  4HF0 A;  2P81 A;  4L9T A;  1VI0 A;  1OKR A;  3JAM K;  4UVA A;  1K4T A;  2YVH A;  2Q2E B;  2W24 A;  2NVT J;  1LJ9 A;  1DGW Y;  3FHZ A;  3GTM J;  3F6V A;  4AM3 A;  4ZTF A;  3WU1 B;  4P96 A;  2P7C B;  4IRI A;  3DKW A;  2VT3 A;  3QU6 A;  4CIC A;  3EUH C;  4XOP A;  4RA2 A;  5HLI A;  5D5W B;  1YYV A;  1MGT A;  5JFR A;  1BA5 A;  1T38 A;  2FQ4 A;  1TC3 C;  1XX5 A;  3LST A;  4G8X A;  1LFP A;  3Q9S A;  1SVM A;  3PO3 J;  1IV8 A;  3KYL A;  2DG7 A;  3V4G A;  2MD0 A;  2XGD A;  2XUB A;  1F9N A;  3QYE A;  4JYK A;  2Y0M A;  3PNT A;  1J59 A;  3FDY A;  2V1X A;  1MJ9 A;  2VPL A;  3DEE A;  1GVD A;  2DA5 A;  2W85 A;  1F43 A;  4LB6 B;  1XDU A;  1ZRC A;  4MEY F;  1YW8 A;  3HRS A;  2CFO A;  4LIT A;  1H88 C;  3JTH A;  3DQV C;  2W1O A;  2WTE A;  2ZY9 A;  5ICC A;  3OYA A;  1L0O C;  2FOW A;  3C2G A;  3IV5 A;  3VUQ A;  4IHY A;  3H0G J;  2G7U A;  2F4I A;  4PDK A;  1HW5 A;  3HEF A;  1BI1 A;  4CCN A;  4AU7 A;  4EQQ A;  2ISZ A;  4CH7 A;  2OQG A;  3HB9 A;  4V19 K;  1N78 A;  2LY2 A;  2CV2 A;  2GBY A;  3DTI A;  2HVS A;  2FML A;  4JX4 A;  4YFN F;  2FUG 2;  3M9A A;  4M9Z A;  1PUE E;  4ME9 A;  3HG9 A;  4Q48 A;  2HOE A;  4UVB A;  2M7A A;  1WJD A;  2H1L A;  2R7O A;  4RB0 A;  2ELK A;  4KJZ A;  4KMF A;  2ELH A;  3NNR A;  1JUM A;  4MQV A;  3ASO H;  4LLL A;  3M4O J;  3GTK J;  2G0E A;  2QOP A;  1GUU A;  3MWM A;  4F55 A;  3CCE I;  2XPV A;  2AO9 A;  4L5I A;  2HNH A;  3VP5 A;  5H9T A;  2HQN A;  2K4J A;  2NOG A;  1ZQ3 P;  4OD4 A;  4FET A;  3ZQL A;  1JHF A;  2OU2 A;  5LGU A;  4KNY A;  3J81 Z;  3HJE A;  3CJQ B;  4LFU A;  1O3T A;  4MLO A;  3ERE D;  4HBL A;  4PZJ A;  2VL8 A;  3Q9V A;  2OD5 A;  1HST A;  5DUI A;  2CU7 A;  5AQC A;  3TDU C;  1OCC H;  4WCG A;  5DAJ A;  1XGN A;  4BKX A;  2LTP A;  1SAU A;  4ZYA A;  4BEH A;  4M71 A;  5GP9 A;  4BDZ A;  4LOC A;  2LKX A;  2JWT A;  3QYB A;  2QM3 A;  1FBQ A;  2DYR H;  4P5O A;  3TO9 A;  1W36 D;  5CQG A;  1MDM A;  2O8K A;  1VQL I;  1WJ5 A;  3B6A A;  5K7Z A;  2QSF X;  3EUA A;  4FHT A;  5J8F A;  3BRO A;  3BTJ A;  2VKE A;  3DEW A;  3E5X A;  3BRU A;  2NXN B;  1X4O A;  1T6S A;  3K0L A;  2RGV A;  5ILS A;  2P4W A;  2EFW A;  1HQC A;  3ERM A;  2DO7 A;  2HYF A;  3EDP A;  3I0T A;  3FMQ A;  4I09 A;  3F6O A;  2EZK A;  1J2X A;  4BUP A;  2K9M A;  3CUQ B;  2ZJ2 A;  4Y13 A;  2KDZ A;  3MKL A;  3RH2 A;  2EJR A;  4Q47 A;  2WGB A;  2LLK A;  3CQZ J;  1TL8 A;  1IXS B;  2HTJ A;  2IP2 A;  3JRB A;  3REO A;  4MIM A;  4NNJ A;  5EEA A;  2L9V A;  1GDT A;  2K5C A;  3TW7 A;  5CPR B;  3ZMT A;  3SZG A;  4U87 A;  3CJN A;  3FM3 A;  4WX9 A;  1UHS A;  1K78 A;  2L9N A;  1XPX A;  3GCM A;  3FXK A;  2VB6 A;  2M8G X;  5AIP A;  1JT6 A;  2VC0 A;  2W4S A;  2YX4 A;  5EG0 A;  2RRE A;  4JBA A;  1LQ1 A;  2G7S A;  1A5J A;  1Z05 A;  1JXS A;  1BI0 A;  1XS9 A;  1R7J A;  2G7H A;  3LMM A;  1JTY A;  5D8K B;  2YS9 A;  3FXU A;  3HIF A;  2HYG D;  3L9F A;  3IHU A;  2XAF A;  3GZI A;  4C2M A;  4UY8 I;  1FSE A;  3HOT A;  2L0K A;  4HX7 A;  2R3S A;  3AL0 C;  3HRU A;  1FOW A;  3GZ5 A;  3WG9 A;  1DU0 A;  4XK4 A;  3JTG A;  1R58 A;  3EUH A;  3BJA A;  2IT0 A;  4IEJ A;  3VYU B;  4DYR A;  5LGN A;  1B6A A;  4C2U A;  3JSJ A;  2QIB A;  4GFB A;  2E2J J;  3QP6 A;  1HLV A;  1WQ2 A;  3C18 A;  1MND A;  2GWR A;  1FTT A;  3LA3 A;  4HQM A;  2V1N A;  3PUF A;  3OYJ A;  4AID A;  2K9S A;  1K78 B;  3S93 A;  2WAQ A;  3QOE A;  3FKJ A;  2F5D A;  4KN4 X;  3NPI A;  5B5E C;  1IGN A;  1TBX A;  4C2M J;  2L4M A;  1R1U A;  2R7T A;  4PJL A;  3CDI A;  3RSN A;  4IRG A;  3HTU A;  1FJL A;  5DUK A;  4UHT A;  2FD5 A;  4IJA A;  2CGP A;  2ZSH B;  1I5Z A;  4Y4R A;  3VOX A;  2X0L A;  1OCP A;  2I8D A;  2MFZ A;  1MBJ A;  2GA1 A;  2A3S A;  3BJB A;  2DT6 A;  1Y8R B;  2ZCX A;  4II2 A;  3PFI A;  1FYM A;  3QYF A;  1HW1 A;  5H2F C;  3MCZ A;  3A02 A;  2PFB A;  2Y9Z A;  2RHA A;  2VIX A;  5DCM A;  5CXG A;  4EJO A;  3QQA A;  1R49 A;  4OMY A;  1YIO A;  4B1R A;  2D1H A;  3H92 A;  1S7E A;  3AL0 B;  1USS A;  1IN5 A;  3K1P A;  1Y56 A;  2MLK A;  1U78 A;  3KNW A;  3QPL A;  4ENN A;  2A05 A;  4XLF A;  1A6I A;  1BI3 A;  4XR6 A;  2DCE A;  2L02 A;  5FKN A;  4HDU A;  3KZ9 A;  3AFH A;  1VQK I;  1G2H A;  1FT9 A;  4AUX A;  3E1S A;  5CVV A;  3WTY C;  2NS0 A;  2P6T A;  2DA7 A;  2F5C A;  3KYD B;  4UUS B;  3QBM A;  5CKT A;  1IW7 F;  4CDG A;  2LRD A;  1KGS A;  4HEA 2;  2VUM J;  2HS5 A;  3WU2 C;  4HPQ A;  3HRT A;  2OER A;  1SFK A;  2OJE D;  5CXI A;  1SD7 A;  2Y31 A;  1U5T B;  1YX5 A;  1XB4 A;  2PQ8 A;  4LG3 A;  4ANJ A;  2PMZ N;  2EIK H;  3CTA A;  1RR8 C;  1BW5 A;  3G3Z A;  1OCZ H;  1TNS A;  1IN6 A;  2COM A;  2HQA A;  2LF7 A;  5E17 F;  2DU9 A;  3SDB A;  1D1B A;  5JI6 A;  1ZG1 A;  2CUF A;  4I2O A;  3NWT A;  4E6K G;  2O7O A;  2JUG A;  2LP0 A;  3OYD A;  3E7L A;  4UB8 C;  1O4X A;  3MN2 A;  3L09 A;  3HTJ A;  4X0G A;  4DBR A;  1TP4 A;  2RV8 A;  4HV6 A;  4CGZ A;  2QYO A;  4LD5 A;  3VDX A;  5BMZ A;  1N25 A;  1DDN A;  4GXO A;  3QPT A;  4ENM A;  3OL3 A;  4OAZ A;  4EMS A;  3H3Z A;  3C1D A;  5GPA A;  2ZNY A;  3VYT B;  4I0B A;  2QEX I;  3W2V A;  2NNY A;  4GCV A;  1BIB A;  4KFC A;  2DMN A;  2F2E A;  5DS9 A;  4NDL A;  1XSX A;  3KZZ A;  2KIM A;  3RZO J;  5AON A;  2OPT A;  3VPR A;  5E8I A;  1Y6I A;  4XKW A;  4AWX B;  4DZP A;  2HXO A;  4LB5 A;  1VQ5 I;  5FLM J;  2Q2E A;  3AG2 H;  3S3M A;  3AG4 H;  1MIJ A;  1DUX C;  5EDN A;  2EV5 A;  4X6A J;  2RNJ A;  2LK2 A;  3VEP A;  1AKH A;  4ZYH A;  3J7Y J;  3FXL A;  4A2U A;  3P7N A;  3PAS A;  2MC4 A;  3GFI A;  3F9K A;  2HKO A;  2STW A;  5IT9 K;  2QUF A;  3A0B C;  2JA6 J;  2FBQ A;  4W97 A;  3N4M A;  1V54 H;  1R1T A;  1U8B A;  1T39 A;  1BW6 A;  1AA7 A;  5L3G A;  5EGO A;  4KDP A;  2M30 A;  3JRD A;  4RLF A;  5L3E A;  4PSW A;  2E19 A;  1FIA A;  1IRF A;  1NG7 A;  4KN7 X;  4FCY A;  3OYH A;  2DXI A;  2DI3 A;  3EGQ A;  2MG4 A;  3BR0 A;  5ICF A;  2X51 A;  2Z9O A;  2OUM A;  4BY1 J;  3K4J A;  4KIF A;  2DA3 A;  2NVX J;  2RKH A;  2X85 A;  3HHH A;  1YE9 A;  3T8T A;  3H3V K;  3KFW X;  1NG6 A;  1E17 A;  1E3P A;  2OBP A;  2M1B A;  3VW0 A;  5K5O A;  2A6E F;  1MJB A;  3OY9 A;  2D2W A;  3G56 A;  3HTI A;  2W57 A;  2MC3 A;  3ELK A;  2PMZ A;  4OIN F;  2LBF B;  1ITY A;  1I50 J;  4MXM A;  1EH7 A;  2YU3 A;  1LVA A;  3L00 A;  2ZCW A;  4EM1 A;  1YJN I;  2XF7 A;  3HOU J;  2WA0 A;  3LQQ A;  3IKV A;  1Z3X A;  3O6B B;  3CCS I;  4BS9 A;  3I4P A;  5HOD A;  3ZQI A;  2FE3 A;  1AU7 A;  2PJP A;  1B8I A;  1Z0X A;  3OYC A;  2DQR A;  3NEU A;  1S3J A;  2STT A;  1T0F C;  2KJB A;  2XAS A;  3H0D A;  2ME0 A;  4BEH B;  3V42 A;  3FMS A;  5FKO A;  1TW3 A;  2LKS A;  4L18 B;  1UI6 A;  3GLX A;  1LPQ A;  1GT0 C;  2NVQ J;  2VKD A;  2GIV A;  2OQR A;  1POG A;  1YLF A;  4RLQ A;  1YI2 I;  2ZFU A;  3O8G A;  1ERD A;  4AD9 A;  4BXU A;  2OF7 A;  3BTC A;  4HQE A;  1WFX A;  2R7U A;  2VQG A;  4A5M A;  5C3E J;  2KP6 A;  2VJ5 A;  1H9T A;  5HDK A;  4XIC A;  1QPI A;  2QBY B;  5BPD A;  1X2M A;  4IHW A;  4C3H J;  2GXB A;  3TP0 A;  3I55 I;  3J80 K;  2CUZ A;  2KFD A;  2R93 J;  1IDY A;  3BG5 A;  3P9K A;  1FP1 D;  3MNL A;  1FTZ A;  3TMO A;  1D5V A;  2QLZ A;  1JTX A;  2FEZ A;  2XIG A;  3FZV A;  2BY0 A;  5LHG A;  1G4D A;  5C4Y A;  1EH6 A;  2JT1 A;  5JVG F;  1WH7 A;  4HST A;  1MMG A;  2WV0 A;  5BOX A;  4RM2 A;  3I4M J;  1KA8 A;  2XGC A;  1S29 A;  1EH8 A;  5LRS A;  3MZH A;  3J80 Z;  1D8J A;  5FD5 A;  4HNT A;  3NRG A;  2XHK A;  3F8N A;  3HOV J;  2YR2 A;  2KLO A;  2GLO A;  2W53 A;  2X1E A;  3FXQ A;  3EYY A;  3RKX A;  4B09 A;  2CFX A;  2K7L A;  4RAY A;  4BAY A;  4CCK A;  4A3J J;  2F48 A;  4ENK A;  2DPU A;  1SGM A;  1TWH J;  4BU2 A;  3DF8 A;  2L3D A;  3ON2 A;  1U2W A;  3F3X A;  4AC0 A;  1BR4 A;  1OFC X;  5DEQ A;  2NRA C;  1S5L C;  4LMY A;  3S1Q J;  5FMP A;  4M9X A;  3JRF A;  2RAE A;  2XKO A;  1YRN A;  4KIS A;  5IP9 J;  3FX3 A;  5CYV A;  3IUV A;  2Q0O A;  2H6C A;  2VE9 A;  2DA2 A;  4AIK A;  2ECB A;  4KT6 A;  1FX7 A;  1H89 C;  3Q0V A;  3J7A Y;  3ZP5 A;  1VTN C;  4ZTJ A;  1IF1 A;  1WI3 A;  5J1R A;  3I59 A;  1UB9 A;  1IXR C;  3QU3 A;  4MHG A;  3RPU A;  3SEZ A;  3WTX C;  4BE2 A;  1ZH5 A;  1RIO H;  2IGK A;  4HDV A;  5FLV A; 
#chains in the Genus database with same CATH homology
 4DYC A;  2FQ4 A;  1W0U A;  1TC3 C;  3VOK A;  1RKW A;  3PO3 J;  2DG7 A;  3GTL J;  2LR8 A;  3F1B A;  3GTQ J;  3LJL A;  2NS8 A;  2XGD A;  4JYK A;  1MBH A;  4A93 J;  4V2G A;  3CRJ A;  3KKC A;  5F08 A;  1LE8 B;  1LFU P;  1ZGW A;  1GVD A;  2DA5 A;  3GTO J;  1F43 A;  1BL0 A;  3VVZ A;  2HI3 A;  2DN0 A;  4L5E A;  2CQQ A;  5E3L A;  1H88 C;  2HOS A;  3EUP A;  3KKD A;  1GV5 A;  3JRE A;  1OCT C;  2CQX A;  1H8A C;  1K83 J;  3IV5 A;  2XGE A;  2IBD A;  4IHY A;  5D18 A;  1NTC A;  3H0G J;  1ZR2 A;  3VUQ A;  4GCT A;  4D5F A;  2NP3 A;  1JJ6 C;  3RD3 A;  3HEF A;  4FTH A;  5JLX A;  2NP5 A;  1MBG A;  5D1R A;  3HB9 A;  2CRG A;  4XID A;  4A3M J;  1JJ8 C;  1D5Y A;  3AQT A;  2GBY A;  3MVP A;  2GUH A;  3IH2 A;  1AHD P;  4JX4 A;  1IC8 A;  2MSY A;  4ICH A;  3HBL A;  4DW6 A;  3ZQH A;  3LWJ A;  4ME9 A;  1QRY A;  2N8G A;  3B6C A;  4QIW N;  2ELK A;  4ACI A;  5HAW A;  3NNR A;  2ID6 A;  1JUM A;  1LE8 A;  3LSJ A;  2M9H A;  2B63 J;  3M4O J;  5JLW A;  2G0E A;  3GTK J;  2QOP A;  1GUU A;  1VND A;  2XPV A;  2AO9 A;  3BR3 A;  2EZL A;  1JGG A;  4CYC B;  1Y1W J;  3VP5 A;  5H9T A;  2E1O A;  2V57 A;  3CDL A;  1JKR C;  2L7M P;  2NOG A;  3NXC A;  3HDD A;  2E2I J;  5M3F J;  1ZQ3 P;  3ZQL A;  2CUE A;  1BJZ A;  2WAQ N;  1ETW A;  4MLO A;  5EZG A;  2L7Z A;  5IYD J;  2H1K A;  2CU7 A;  2W48 A;  2K9Q A;  5AQC A;  3HTH A;  2VKV A;  4MFD A;  3LOC A;  5DAJ A;  4BKX A;  2LTP A;  3BTL A;  3UKG A;  2E2H J;  2VPR A;  1MNM C;  5GP9 A;  2LKX A;  4LOC A;  4IHX A;  1WH5 A;  2JWT A;  2Y30 A;  2JA8 J;  2O8K A;  2GM4 A;  1B8I B;  1U9N A;  2HYJ A;  4HNV A;  3B6A A;  4C3J J;  5K7Z A;  5C4J J;  5D19 A;  5IYB J;  2FX0 A;  2AHQ A;  3BTJ A;  3C2B A;  2VKE A;  1HOM A;  3DEW A;  1PUF A;  1ENH A;  3GBG A;  2GFN A;  3BRU A;  5DTD A;  4A3B J;  1W0T A;  9ANT A;  3LHQ A;  4NEL A;  4AF5 A;  2ZB9 A;  2EZK A;  3VVX A;  5HSZ A;  2KDZ A;  1TWF J;  3RH2 A;  3MKL A;  4M3B A;  2IU5 A;  2R5Z B;  1X58 A;  2REK A;  2LLK A;  3CQZ J;  5E3N A;  2WGB A;  2I10 A;  1CQT A;  1ZKG A;  3JRB A;  2O7T A;  5EEA A;  4MIM A;  1GDT A;  1XC5 A;  4M3E A;  3TW7 A;  2G7L A;  3Q0W A;  3WHB A;  3FKI J;  3K2A A;  5K7F A;  1UHS A;  2YUS A;  5F0F A;  4EEF G;  1P7I A;  5M5X J;  3HKZ N;  2M8G X;  1JT6 A;  2EZI A;  2R5Y A;  1UMQ A;  4UDS A;  2UXP A;  2ZCM A;  2QWT A;  1HDP A;  5EG0 A;  3IH3 A;  2G7S A;  5EF6 A;  1A5J A;  3VW1 A;  4A69 C;  1VFC A;  2X9D A;  3HE0 A;  2RAS A;  3NI7 A;  4GFL A;  2IEK A;  2M34 A;  2KT0 A;  3JR9 A;  1XS9 A;  4A3C J;  1JTY A;  3SDG A;  5F27 A;  2YS9 A;  2XB0 X;  3Q0U A;  2K40 A;  3BTI A;  3SFI A;  4XRM A;  3BR5 A;  3GZI A;  2G3B A;  4Y7N J;  2DTZ A;  2ZCN A;  2QKO A;  2L0K A;  3BT9 A;  2QF7 A;  2MGQ A;  4M3F A;  4JX6 A;  3S14 J;  3A01 B;  2LFB A;  3G1M A;  1DU0 A;  4XK4 A;  2G7G A;  3T6N A;  3VIB A;  2XRL A;  1T56 A;  4IEJ A;  4DYR A;  3ON4 A;  3JSJ A;  4YZE A;  3NAR A;  2QIB A;  1Y1V J;  4GFB A;  2E2J J;  1VF9 A;  1LFB A;  3HGG A;  1ETV A;  2NS7 A;  2LD5 A;  1HLV A;  5K7H A;  4CYC A;  4XRS A;  3A01 A;  2EH3 A;  1FTT A;  5J3L A;  1I3Q J;  4BBR J;  5J1Y A;  2XDN A;  1Z77 A;  3E7Q A;  4W1U A;  1P7J A;  2K9S A;  1I6H J;  4BY7 J;  2UXO A;  5FHP A;  3NPI A;  1MH4 A;  2LY9 A;  1IGN A;  4MO7 A;  2DMP A;  4C2M J;  1MBF A;  3HIM A;  1WGX A;  3PPB A;  1K61 A;  4V2F A;  3S17 J;  1FJL A;  3HGY A;  3JRC A;  2FD5 A;  3CCY A;  3VOX A;  2MW8 A;  1OCP A;  4D7M A;  1MBJ A;  3BJB A;  5M5W J;  3BG9 A;  2ZCX A;  1E3O C;  1R9T J;  3A02 A;  3HOX J;  2Y9Z A;  2RHA A;  1EF4 A;  5CXG A;  1MSE C;  3VW2 A;  4B3A A;  3QQA A;  4B1R A;  3G7R A;  1S7E A;  1NK2 P;  2UXU A;  1XG1 A;  4QTR A;  2Y0S N;  4A3F J;  2HYT A;  5FKM A;  1T33 A;  1ETO A;  4JP0 A;  1ETX A;  3BCG A;  3TW6 A;  1U78 A;  2TRT A;  1SFO J;  3QPS A;  3ZQC A;  3KNW A;  3QPL A;  2DA1 A;  1RR7 A;  1A6I A;  4D7N A;  1TWG J;  1FIP A;  2ID3 A;  5FKN A;  3OSF A;  2R7Z J;  3KZ9 A;  2JA5 J;  2O9L A;  5E3O A;  3S1R J;  1G2H A;  4D5C A;  3BR6 A;  4AUX A;  4FE4 A;  4X1E A;  1IDZ A;  4G12 A;  2DA7 A;  4UUS B;  3G1L A;  4IHV A;  3HOW J;  2QCO A;  2XPU A;  4M3D A;  1IRZ A;  3QBM A;  2VUM J;  1PUF B;  2XPW A;  2OER A;  5CXI A;  4RBO A;  2Y31 A;  5EZH A;  3G1O A;  1RKT A;  1IG7 A;  1B72 A;  2XSD C;  2PMZ N;  4FE7 A;  4I76 A;  1WPK A;  4BBS J;  1BW5 A;  3K7A J;  3BR2 A;  3Q3S A;  4Y52 J;  2CUF A;  3V6G A;  4M6V A;  3C07 A;  2O7O A;  1HF0 A;  2L9R A;  2LP0 A;  3GTP J;  3S16 J;  3E7L A;  1ORK A;  2PZ9 A;  1O4X A;  3MN2 A;  4A3K J;  3HTJ A;  3O60 A;  3HOY J;  3HM5 A;  5FKL A;  3JRI A;  4ABZ A;  1APL C;  4GCK A;  4I6Z A;  3VVY A;  1JKO C;  2FJ1 A;  3W6V A;  2UXI A;  2NVY J;  5EG0 B;  2GEN A;  5GPA A;  2YVE A;  4DZJ A;  3AQS A;  4UUT A;  3CJD A;  3S5R A;  4JKZ A;  5F0H A;  3S15 J;  3ZOB A;  5IP6 A;  5EFY A;  3FK7 A;  1NK3 P;  2DMN A;  5GPC A;  5DS9 A;  4JX5 A;  4NDL A;  3O8H A;  2PBX A;  3FIW A;  3RZO J;  2OPT A;  3VPR A;  1JKQ C;  4UUS A;  2CJJ A;  5J1U A;  4DZP A;  1UI5 A;  3S2D J;  1IUF A;  2HXO A;  1YRN B;  5FLM J;  3P9T A;  3SJM A;  3RKQ A;  2X48 A;  3ANP A;  5EDN A;  4X6A J;  2LK2 A;  1AKH A;  4PXI A;  1QVU A;  1RES A;  1U9O A;  1HCR A;  3JRG A;  3DCF A;  2ZOY A;  1ETQ A;  3PAS A;  3FIS A;  3JRA A;  2WUI A;  1JT0 A;  5F04 A;  5K58 A;  2JA6 J;  2DA4 A;  4W97 A;  2FBQ A;  2HXI A;  1U8B A;  1BW6 A;  5EGO A;  2ME6 A;  3PO2 J;  3S2H J;  5FGL A;  3JRD A;  4L62 A;  2HOA A;  1JKP C;  3S1M J;  2OI8 A;  1MBK A;  2E19 A;  1FIA A;  1FEX A;  5IP7 J;  3CMY A;  2HKU A;  4FCY A;  1RET A;  4FIS A;  2NX4 A;  3EGQ A;  2QTQ A;  1OJL A;  2MG4 A;  3BR0 A;  1IJW C;  3FRQ A;  3LSP A;  1ZTR A;  3D1N I;  2EZH A;  4BY1 J;  2D6Y A;  4NN1 A;  3DPJ A;  3S1N J;  2DA3 A;  2NVX J;  1ZK8 A;  3LSG A;  2EBI A;  2L7F P;  2Y9Y A;  4QSH A;  2TCT A;  3HOZ J;  5IOY A;  3H3V K;  1AKH B;  4AC6 A;  1SAN A;  2K9N A;  3VW0 A;  3ZQG A;  3G56 A;  2X6O A;  5F1J A;  3HTI A;  5C4X J;  1ETK A;  1ITY A;  1I50 J;  2Q24 A;  4GFK A;  1WCM J;  3L1P A;  4MXM A;  4JL3 A;  5C44 J;  1TWC J;  1TWA J;  4XRS G;  5IOZ A;  3HOU J;  3LNQ A;  3PM1 A;  4MK6 A;  4A3L J;  4A3E J;  5HOD A;  2COB A;  3ZQI A;  1AU7 A;  3ZQF A;  1MH3 A;  1Q1V A;  1B8I A;  2DJN A;  3NAU A;  5IYC J;  1Z0X A;  4B4C A;  3TED A;  2ME0 A;  2D5V A;  3M3Y J;  5FKO A;  3BNI A;  1UI6 A;  2R5Y B;  4DYQ A;  3A03 A;  5IPA A;  1GT0 C;  3BQY A;  2NVQ J;  3LSR A;  5FJ8 J;  3BG3 A;  2M2E A;  1POG A;  3RQI A;  5CW8 A;  3GTG J;  3WHC A;  3O8G A;  3TP3 A;  4MFE A;  2DMQ A;  3I4N J;  4A3I J;  1QVT A;  2OF7 A;  3BTC A;  2UXH A;  3COL A;  2H8R A;  5C3E J;  2JA7 J;  2DA6 A;  4C3I J;  3CWR A;  4XIC A;  1QPI A;  5BNG A;  2R0Q C;  2R5Z A;  2JK3 A;  1X2M A;  2M0C A;  4C3H J;  4IHW A;  4KWA A;  3TP0 A;  5EYR A;  5M3M J;  2R93 J;  1IDY A;  2VI6 A;  3BG5 A;  3BQZ A;  3MNL A;  1FTZ A;  3ANG A;  1JTX A;  5HBU A;  1ZR4 A;  5C4Y A;  2WV1 A;  3RZD J;  2DG8 A;  3OOU A;  1X2N A;  1WH7 A;  4RDU A;  4HKU A;  2LVS A;  2HQ5 A;  2ZOZ A;  2JN6 A;  1GV2 A;  3HTA A;  2IAI A;  3I4M J;  2XGC A;  5F0C A;  2HDD A;  1MSF C;  3FK6 A;  2DMT A;  3OSG A;  5M5Y J;  1B72 B;  4A3G J;  2HOT A;  5EGO B;  1MBE A;  1ETY A;  4S0H B;  3NRG A;  3QKX A;  1RPW A;  3HOV J;  4BXX J;  2GLO A;  2W53 A;  2EQR A;  1DU6 A;  3GEU A;  5FKK A;  3JRH A;  4A3J J;  1IV6 A;  4M3G A;  2YU9 J;  3B81 A;  1SGM A;  1TWH J;  2WB1 N;  4J19 A;  3ON2 A;  1F36 A;  3OIO A;  2P81 A;  3V78 A;  4AC0 A;  1OFC X;  1VI0 A;  4GCL A;  2YVH A;  1JUP A;  3S1Q J;  5FMP A;  3JRF A;  2RAE A;  2NVT J;  2JJ7 A;  1YRN A;  2XB5 A;  3GTM J;  5IP9 J;  3IUV A;  1UG2 A;  4AYB N;  3IH4 A;  2DA2 A;  2ECB A;  4CGR A;  4A3D J;  5E3M A;  1H89 C;  3Q0V A;  3F0C A;  4JNN A;  2R92 J;  2ECC A;  1WI3 A;  5J1R A;  2Y2Z A;  2DMU A;  1JUS A;  3BHQ A;  1HDD C;  3GTJ J;  5FLV A;  2F07 A;  2JMW A;  1BA5 A;  3BR1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...