3MVPA

The crystal structure of a tetr/acrr transcriptional regulator from streptococcus mutans to 1.85a
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
204
structure length
204
Chain Sequence
KNIRKPKQERSIEKRNKILQVAKDLFSDKTYFNVTTNEIAKKADVSVGTLYAYFASKEDILTALLKRYNDFFLTTIFADINSQDSLDRFKKNPKEWLNVLINQLLAAEDKIFHAQIEMLAYAIPQAKALLEEHNNNLKNLTYKCLLYYSDQAANPSFKTLSLVVFDFISALVDELLYHEHTQEEAHQIKKTGIDSLDLIIKSYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of a TetR/AcrR transcriptional regulator from Streptococcus mutans to 1.85A
rcsb
source organism Streptococcus mutans
molecule tags Transcription regulator
molecule keywords TetR/AcrR transcriptional regulator
total genus 84
structure length 204
sequence length 204
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3mvpA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3mvpA02
5M5XJ 4CGRA 4RDUA 2VKEA 5IYDJ 5K7FA 3O60A 2DMUA 3BNIA 4KWAA 4GFKA 2H8RA 1BW5A 1VI0A 2VI6A 4IHWA 2DA1A 1E3OC 2ZOZA 4HNVA 3WHBA 3H3VK 5AQCA 3MKLA 2R0QC 2R5YB 1GDTA 4C3HJ 4QIWN 1UMQA 4A3IJ 1AU7A 3BTCA 1IUFA 2UXIA 5CW8A 2DMTA 3LHQA 4FE7A 3S14J 3QPSA 3F0CA 1F36A 5JLXA 4D5FA 4GCTA 1X2MA 2E2IJ 5IP7J 3VPRA 3G1MA 5HBUA 4XRSG 4DYRA 3HKZN 2LY9A 2VPRA 4MFEA 3AQTA 4JX4A 2CUFA 2HXOA 1LE8A 1MSEC 4A3GJ 4FE4A 3VIBA 5IYCJ 3HOVJ 3CWRA 2W48A 2XGCA 1SFOJ 2FD5A 1OFCX 3VVZA 1RESA 2RHAA 1P7IA 2MGQA 3IUVA 5JLWA 1H8AC 1PUFA 3A03A 4PXIA 1GV2A 1OJLA 3HOWJ 3GTJJ 1R9TJ 2JN6A 4BBSJ 5D19A 5D1RA 4MLOA 3EUPA 5EEAA 5HSZA 2NX4A 1JT6A 1OCTC 1ZQ3P 5EF6A 1JGGA 5FLVA 4A3BJ 4GCLA 4HKUA 4FISA 2F07A 3C2BA 2Q24A 1MNMC 1TWAJ 1MBGA 3ZQHA 1DU0A 3BR3A 1ETOA 1IG7A 4Y52J 4JL3A 1X58A 5F27A 2X48A 2TRTA 4M3FA 1G2HA 3ON2A 3CMYA 2QWTA 4V2FA 1TWCJ 3DCFA 3CJDA 3EGQA 2OF7A 3BG3A 3G1OA 3ZQLA 3JRCA 1FIPA 4BY1J 2NVQJ 1RETA 3A01A 2R5YA 2YS9A 3QQAA 2LD5A 1WCMJ 2EQRA 2IAIA 1U9OA 5BNGA 3BR2A 5F1JA 3VOKA 1HCRA 1YRNB 4AF5A 2R5ZB 2GUHA 3DEWA 4QSHA 4W1UA 2WAQN 3Q0WA 2CRGA 2Y9ZA 3I4MJ 1POGA 3BR0A 2ID3A 2HOAA 3C07A 3HB9A 1HOMA 3JRIA 4ACIA 1TWHJ 3BQZA 2JMWA 4G12A 3VW0A 2XSDC 3CCYA 3LSPA 4IHVA 2XPUA 4QTRA 5M3MJ 3JREA 5E3OA 3NARA 3JRGA 1U9NA 3JRDA 2UXPA 5DAJA 3V6GA 1K83J 4Y7NJ 3PO3J 2L7MP 2ZOYA 3OSGA 2D5VA 1ENHA 2DA6A 4J19A 1UI6A 2WUIA 1HLVA 3JRBA 1Y1WJ 3LJLA 2E19A 2LLKA 1MSFC 2DA2A 2XB0X 1JT0A 1JJ8C 2Y0SN 4EEFG 3K7AJ 1BL0A 2NP3A 3LSJA 2NP5A 2ME6A 3BRUA 1I50J 4S0HB 1A5JA 3ZQIA 2OI8A 2DA4A 1SANA 4AYBN 5FKLA 3GTLJ 3AQSA 2RASA 3RZOJ 3FRQA 3ON4A 1RPWA 2QCOA 3TP3A 5EGOB 1ETWA 1FEXA 2GFNA 5FGLA 1ZK8A 2NS8A 3HDDA 2FQ4A 3OOUA 3JR9A 2NVXJ 3SDGA 2VKVA 3KKDA 2EZLA 2W53A 1ZGWA 5IOYA 5EDNA 3I4NJ 1W0UA 1A6IA 4BY7J 4D7NA 2DN0A 5M5YJ 2G3BA 3PASA 2K9SA 2PBXA 1QVUA 4IEJA 1B8IB 3B81A 1F43A 1I3QJ 2N8GA 3O8HA 1ZTRA 4DZJA 1B72B 2M34A 2O9LA 2UXOA 2LVSA 3BT9A 2L7FP 2M0CA 4GFBA 5CXIA 4XICA 1GVDA 4B4CA 1RKWA 3IH2A 3BCGA 1JTYA 3V78A 5M3FJ 1UG2A 4UUSB 3HOYJ 1WH7A 3HE0A 1FIAA 3JRAA 2HKUA 2Y30A 3P9TA 1T56A 3BTJA 2DMPA 1MBFA 3HGGA 3ANGA 4W97A 2GM4A 5F0FA 4X1EA 3LOCA 1AHDP 4A93J 1U78A 1GUUA 5F0CA 2XGDA 5GP9A 4RBOA 2ZCNA 4CYCB 2XPWA 2JJ7A 4M3DA 3HTAA 1JUSA 1ETKA 2G7SA 2YVEA 5DTDA 2EZHA 1MH4A 3HM5A 3VOXA 2OERA 3S1MJ 3S1QJ 2V57A 4M3EA 4JNNA 1JKPC 2R92J 3D1NI 1QPIA 1MBEA 3GTQJ 2H1KA 2R7ZJ 4A3KJ 1DU6A 2B63J 1JTXA 2EZIA 3UKGA 3NAUA 2O7TA 2CQXA 2WB1N 4YZEA 3RD3A 2JK3A 3JRFA 3SJMA 2TCTA 3A01B 3TP0A 5IYBJ 2CUEA 4BXXJ 2QTQA 3VP5A 3SFIA 1XC5A 1MBKA 2MSYA 3HGYA 5K7ZA 3IV5A 1PUFB 2LR8A 2FJ1A 2CJJA 3Q0UA 3K2AA 4A69C 3S2HJ 2FX0A 3PPBA 2Y9YA 2DA5A 4JX5A 3FK7A 1K61A 2E1OA 1Z0XA 5FKNA 3VVXA 2DJNA 3BJBA 5C4JJ 1YRNA 3PO2J 2HXIA 3G7RA 2G7GA 4JX6A 3OSFA 2MG4A 2LKXA 3HOUJ 5EFYA 1H88C 3W6VA 3MNLA 4A3FJ 3M3YJ 4MK6A 1JUMA 3ZOBA 4X6AJ 3Q3SA 2DG7A 2QIBA 3DPJA 3IH3A 3COLA 1T33A 3NNRA 4XRSA 4DYCA 1FTTA 3NI7A 5C4XJ 4MXMA 3IH4A 1I6HJ 2XPVA 2CU7A 3O8GA 2YVHA 2XGEA 3A02A 5FLMJ 1VFCA 1H89C 2RAEA 4XK4A 5EZHA 5E3MA 1XS9A 2Y2ZA 3GZIA 2X9DA 5EG0A 5C3EJ 1WH5A 1ORKA 1HF0A 2JA8J 3BR1A 5CXGA 3HTHA 3B6AA 1LE8B 5C4YA 1QVTA 3LSGA 3S15J 4A3JJ 2VUMJ 3MVPA 2KDZA 1IRZA 4A3MJ 1UHSA 1UI5A 2O8KA 1MBHA 3S5RA 1ETVA 4DYQA 4AC0A 5IP6A 1IV6A 4BKXA 2HYJA 2IBDA 1B72A 2HI3A 5F04A 1AKHB 9ANTA 3JSJA 5F0HA 3BG5A 3MN2A 1IC8A 5EG0B 2EBIA 4ICHA 1ITYA 2HYTA 1Q1VA 2E2JJ 1NK2P 1RR7A 3GTGJ 5C44J 4C3IJ 1JKOC 1NK3P 2JA7J 3OIOA 1FJLA 5H9TA 1HDPA 2LK2A 2XB5A 1JKQC 1IDZA 2HQ5A 2JA6J 3G1LA 4JYKA 2NVTJ 2G0EA 1SGMA 3E7LA 5GPCA 3S2DJ 2CQQA 5FKOA 2HDDA 1BA5A 4NDLA 5K7HA 2GLOA 4I6ZA 1WI3A 5EZGA 5DS9A 2AHQA 1LFUP 4FTHA 4UUSA 4C3JJ 2IU5A 3NPIA 1P7JA 4C2MJ 2M2EA 3ZQCA 1TWGJ 5M5WJ 3LWJA 2K9NA 2ZB9A 1IGNA 2WV1A 3CQZJ 2ID6A 1ZR2A 1APLC 1TC3C 1VF9A 1AKHA 4IHXA 2PZ9A 1HDDC 2QOPA 2ECCA 3HIMA 3BQYA 3RKQA 5FKKA 2GBYA 2GENA 4M6VA 4A3LJ 1MH3A 4NN1A 2LP0A 1GT0C 3KNWA 4FCYA 2L9RA 1X2NA 2PMZN 2ZCMA 2G7LA 5K58A 3GEUA 2R93J 3VW2A 4AC6A 1ZR4A 3HTIA 3BR6A 3GBGA 4DZPA 4V2GA 3S17J 2OPTA 4JP0A 1ETXA 2M8GX 3JRHA 3GTMJ 1VNDA 2XDNA 5FJ8J 2DG8A 4IHYA 4D5CA 3FKIJ 3CRJA 2FBQA 3S1NJ 4XIDA 3RH2A 2NVYJ 3GTPJ 5IP9J 3PM1A 4LOCA 4MFDA 2L0KA 2ME0A 4GFLA 1BJZA 3ANPA 1WGXA 3NXCA 5J1YA 4MIMA 5IPAA 4XRMA 1ZKGA 3FK6A 5FKMA 2X6OA 2EH3A 1MBJA 1S7EA 2MW8A 2D6YA 3BTLA 1ETQA 3TW7A 2ZCXA 2LTPA 2Y31A 4M3BA 3GTOJ 2DTZA 2NS7A 5E3LA 1FTZA 3HEFA 2UXHA 2QF7A 3WHCA 3ZQFA 3RQIA 4ABZA 3HOZJ 3NRGA 3GTKJ 4M3GA 3M4OJ 1QRYA 1IDYA 1JJ6C 5F08A 3BR5A 3BG9A 3L1PA 4GCKA 1JKRC 2ELKA 1RKTA 1ETYA 2R5ZA 5GPAA 1Z77A 1OCPA 4B1RA 5EYRA 3S1RJ 2AO9A 1O4XA 2P81A 3E7QA 2NOGA 4JKZA 5J1RA 3G56A 5HODA 3T6NA 2WGBA 4ME9A 2JA5J 2REKA 4DW6A 1BW6A 1GV5A 4UUTA 1JUPA 1B8IA 2ECBA 1LFBA 1W0TA 4A3DJ 4A3CJ 5IOZA 3FISA 1EF4A 1U8BA 1CQTA 4B3AA 1WPKA 1TWFJ 2I10A 3FIWA 1XG1A 2LFBA 5J3LA 5E3NA 4L5EA 3TEDA 3KZ9A 4MO7A 4NELA 2KT0A 3HBLA 3LNQA 3S16J 3H0GJ 2E2HJ 3F1BA 4BBRJ 3HTJA 4CYCA 4D7MA 3CDLA 2K40A 4I76A 5FMPA 2XRLA 2IEKA 2YUSA 4UDSA 2L7ZA 2M9HA 2O7OA 3B6CA 3TW6A 2UXUA 5D18A 1NTCA 3BTIA 3VVYA 3QPLA 5J1UA 3VUQA 3Q0VA 4AUXA 2DA7A 5EGOA 2YU9J 5HAWA 2K9QA 3VW1A 2DA3A 2HOSA 1IJWC 3KKCA 3QKXA 2COBA 2QKOA 3RZDJ 4A3EJ 1D5YA 2HOTA 3BHQA 2EZKA 2DMNA 5FHPA 3LSRA 4L62A 1Y1VJ 2JWTA 3ZQGA 2DMQA 3QBMA 3HOXJ
chains in the Genus database with same CATH superfamily
4BNCA 4CGRA 2KLOA 5IYDJ 3PFIA 4FX4A 3O60A 5LGNA 2DMUA 3I4PA 4KWAA 2R7DA 4MQ9F 2DA1A 2ZOZA 4BE0A 1Z3XA 2MH2A 2PG4A 3HKZA 3IL2A 1I27A 1YIJI 1BI2A 2R0QC 3N05A 3F72A 5GTHC 2O03A 2V9VA 5L3EA 1V4RA 1AU7A 2MD0A 1EKEA 1FMVA 1IN7A 2KP6A 2UXIA 2Z1DA 1U0JA 2DMTA 4HQEA 1R1UA 3QPSA 2PLYA 1B9NA 1HSTA 1IV8A 4GYGA 2A6HF 1HW2A 4N0BA 2HOEA 5HDKA 2XF7A 4XKCA 1A35A 2H8WA 3G1MA 2XV4S 4XN0A 4U9NA 4HNUA 3WE3A 2LY9A 4LJZF 4MFEA 1U5TA 1YOVB 3AQTA 1AA7A 2CUFA 3FMQA 2HXOA 1LUJB 3JCUC 2KL4A 3K4MA 2BHYA 5LHIA 4HZFA 3ECOA 3SXYA 3G73A 2FD5A 1OFCX 2PFBA 1H8AC 1FBQA 2CGPA 1OJLA 5KCMA 4BBSJ 5D1RA 1IRXA 2E7XA 4P55A 1R58A 5EEAA 3K69A 5FROA 1OCTC 4A3BJ 3FDYA 5FO5A 4GCLA 2FJI1 3LSTA 1MNMC 2DQRA 3P5JA 3P9KA 1LPQA 1DU0A 3B73A 1ETOA 1YO5C 1WFXA 2OCCH 1T38A 3CDHA 2EFPA 1O7LA 2X48A 5J8FA 4OAZA 4HAMA 5DM7F 4KUMA 2OF7A 1FY7A 2ZMEA 3BG3A 2A2FX 3G1OA 3ABTA 1IXSB 1RETA 2DTRA 1K6OA 2R5YA 3TDUC 5JFRA 1WCMJ 4OMYA 4NC8A 1U9OA 2EILH 3KYDB 2CH0A 1PP7U 5LEKA 4KT5C 1HCRA 2R5ZB 2P7CB 5L3DA 1POGA 4IOAF 2OD5A 2Q0OA 2WADA 1J7KA 2KIMA 3WE2A 4EJOA 3C07A 2ZXIA 4OU0A 5A2QZ 3JRIA 3PSFA 1KGSA 3TO7A 1IN4A 2QLZA 3BQZA 1B6AA 1IN5A 3VW0A 2CO5A 1R1TA 1QZYA 3TL4X 2VQLA 5E1XA 3DU6A 5M3MJ 5E3OA 3NARA 2UXPA 3BZKA 4D9JA 2L7MP 2W4SA 4BQAA 3DU5A 3OYLA 4ZDPA 3KYLA 1KYWA 2D5VA 1ENHA 5ILSA 1ERDA 1UI6A 1X1DA 1IAWA 1Y1WJ 1FSHA 2BXYA 2QUFA 1LDJA 2EFNA 2LLKA 3FMRA 2OC6A 5JI6A 2KRHA 1R6RA 2DYRH 4LMYA 2R7RA 1MSFC 4EM2A 5J8CA 1JJ8C 2NP5A 3K7AJ 3LSJA 4A0XA 1LFPA 4U87A 1A5JA 3MFKA 1OR7A 2DA4A 1Y0NA 4RB0A 5FKLA 3WTWC 3GTLJ 4IZZA 2VQCA 2YSRA 5FFXA 2VBXA 2HQNA 3FRQA 2QCOA 1T95A 1QNTA 2V79A 3CUOA 5EGOB 2OZ6A 1FEXA 2V9KA 2NS8A 2GFNA 2DOAA 2QZ8A 5FGLA 5HOOA 3GMEA 3ESWB 3BLYA 2A3SA 2A5YB 3JR9A 2WAEA 3BCAA 1R7JA 1KU2A 1U5TB 2COMA 1TBXA 1HA8A 3AG1H 4IJAA 3T8RA 2I5UA 3K4NA 3K2ZA 3WTXC 1UFMA 2W53A 4HF2A 5EDNA 3I4NJ 4CCOA 1YS7A 1W0UA 4D7NA 1OPCA 2DN0A 5ICEA 2Z33A 2K9SA 1ZGJA 1QVUA 4IEJA 2OAZA 3U2RA 5E20A 3JTHA 2XF5A 1I3QJ 3O8HA 1YW7A 5CJ9A 4AYBA 4DZJA 3J7AY 2M34A 4ZZLA 2O9LA 1RI7A 2A07F 2L7FP 3U9GA 1LEAA 3WODF 1DGWY 2B0LA 4A6DA 1UAAA 1GVDA 2L7KA 4OAYA 2O3FA 3QAHA 3V78A 2E34A 4A2UA 1B9MA 2BGCA 4IRIA 1WH7A 4XNFA 3BTJA 3ANGA 3QRFF 4ZZDA 4W97A 1F1ZA 2P0WA 2KPMA 1U78A 2HU9A 4XSXF 3E0JB 5F0CA 4GDFA 1ZHFA 3T0YA 3OYNA 4RBOA 2ZCNA 4BL0B 2V1NA 3BG6A 3HTAA 4EM0B 4XLPF 3HXLA 5TJJA 3ROUA 2G7SA 2YVEA 2ELHA 2EZHA 3WG7H 2KIUA 1J75A 2OERA 1HW5A 3S1QJ 4BEHA 1UCRA 4M3EA 4N9HA 5JVGF 4JNNA 1MBEA 3WTUC 2H1KA 3LL7A 4PZJA 4JQFA 4AVZA 4D1QA 3UKGA 4IRVA 2WB1N 1L3LA 2F4IA 3I56I 1JGSA 2TCTA 3VOEA 3J81K 4BDZA 4BXXJ 4ITVA 1J9IA 3CO6C 2EIJH 4IRGA 2MSYA 5KVRA 5B1AH 5K7ZA 3IV5A 3KX2A 3KIOA 3F6VA 4BE1A 1P6RA 3V8JA 1ACIA 2GA1A 3K2AA 3S2HJ 4RB3C 2VOOA 1UG0A 1KYZA 1S7OA 5FKNA 4BJTA 3VVXA 2DJNA 3GUDA 3L00A 5KAIC 3BJBA 1O7FA 2F5DA 4UVCA 3L2UA 1VQKI 3HOTA 2WWYA 3OSFA 1S6LA 2LKXA 1W5SA 4PK4A 4BJ6C 5HVQC 1GLNA 5LRSA 3MNLA 4A3FJ 3M3YJ 1G3TA 5HNFA 5FD5A 4MK6A 3VB2A 4HF1A 1X4OA 1T33A 1IO2A 1XTAA 2DT6A 3DKWA 4RAGA 1T39A 3PJRA 4DYCA 5FD6A 3H0DA 1FTTA 5C4XJ 3NI7A 3HRTA 3CJRB 3M9AA 3DF8A 4BHCA 5LLQA 5GAHJ 3IH4A 1R22A 2XPVA 2W82A 2KJCA 3A02A 1FOWA 4M73A 4PGGA 1VFCA 2Y48A 4K2EA 1H89C 5EZHA 5DD4A 2HKOA 2RREA 3VYRB 2RNJA 2M87A 4U9LA 4Q5SF 1LVAA 3CCRI 3IUOA 3OWTA 2ZJPF 1HF0A 5D8KB 1D0YA 3WGGA 3WTZA 4CGZA 3OYDA 4KMUX 1TTYA 2DO7A 2DT7B 5CVIA 3F22A 3GZ6A 2W00A 2VUMJ 2BZTA 4Z6YA 4A3MJ 3FXMA 2BVLA 3VSKA 1IRGA 3S5RA 1ETVA 3HUGA 5IP6A 3CCUI 5IY5H 3O6BB 3V42A 2R7SA 2DYSH 4P96A 2GWRA 2ZBKA 2XAQA 1B59A 3DBRB 3HSRA 3FXLA 1AKHB 1B72A 1OCCH 3JSJA 3MZHA 1IC8A 3MN2A 5HDGA 2EBIA 2GXGA 2VJJA 4G7ZF 4CCMA 2LY1A 2HYTA 1Q1VA 2CW0F 4RLFA 1NK2P 4RMNA 2STTA 3C1DA 5C44J 1JKOC 1FJLA 5H9TA 3QWLA 3E5UA 1QZEA 2WV0A 4XOTA 4CCLA 1IDZA 1U3EM 2JA6J 2EIKH 4UHTA 4JYKA 4G6DA 5GPCA 2CQQA 3GWZA 1S5LC 4XR6A 3LQRA 5GAGJ 5K7HA 1LFUP 1JI8A 4FTHA 3H5RA 1A36A 2V4JC 3HYIA 2M2EA 3ZQCA 5M5WJ 2J5PA 2QKLB 2K9NA 2R4GA 2WV1A 4P5OA 3ZMSA 2CWEA 4LLLA 1VF9A 3LAPA 3I59A 1AKHA 2PZ9A 1HDDC 1W36C 5D8LB 2VJIA 3IRQA 3HIMA 3RKQA 2YVXA 3MAJA 1EH8A 5JVTA 3DKYA 3FM3A 3K6GA 4XONA 2BW3A 3KNWA 3H35A 2P7VB 2WB1A 2HTJA 2L9RA 2BV6A 2HKXA 2L3DA 4NC6A 2WA0A 1RNLA 4ZYAA 2XC7A 4BACA 3GEUA 2M0MA 2XKOA 3HTIA 4DZPA 2IT0A 2OU2A 2RDPA 1MDMB 3JRHA 1W5CC 2BHZA 4M74A 3LWFA 5E1WA 1VNDA 2XDNA 3M1EA 2DU9A 5EEHA 3RH2A 4XIDA 4PJMA 4IO9F 3E6CC 3PM1A 4MFDA 2L0KA 4DOZA 3TO6A 1WQ2A 3RCOA 2HPMA 4FX0A 2R7VA 1TLHB 4GO1A 4WXDA 5J1YA 4MIMA 5IPAA 2O6GE 4U0YA 1MNEA 2ZXJA 3OIQA 2L5QA 1BJAA 3MEXA 3P7NA 1ETQA 4KITB 2ZCXA 2LTPA 3SHFA 4I09A 2DW4A 2DTZA 1FTZA 3EDPA 3HEFA 5BPDA 5D5WB 2HGCA 2CV1A 3F6OA 2PN6A 3RQIA 4KIBA 4PFPA 3QODA 3HOZJ 3NRGA 3KP5A 1SFUA 3M4OJ 3NRVA 1V3FA 3BG9A 3L1PA 4M71A 5EJCA 4YIIA 2ZNZA 3V7SA 4OD5A 3ZMVA 3BCBA 5JHUA 2HZTA 4WX9A 4CCNA 5L3GA 2CMPA 2K9LA 3S1RJ 2LH9A 4AWXB 2AO9A 2LY2A 3RPUD 4HLXA 2FSWA 3QU6A 2M30A 2K02A 1WZ2A 3F23A 2HDWA 2RN7A 4JKZA 3IRRA 2WGBA 4R1HA 1OR7C 1BW6A 4C2TA 2QM3A 5L3FA 1W4MA 2KDOA 3HSFA 2VJ4A 2KKOA 2IS6A 2TDXA 1LFBA 1W0TA 1CF7B 3EYIA 2XROA 4A3CJ 3ZXSA 3PSIA 1EF4A 2HTSA 4AM3A 1CQTA 3F8NA 2JPBA 1VQ6I 4N9IA 2LFBA 3K4JA 4UUVA 4L5EA 2M4GA 4NELA 3S16J 1NHAA 3PUFA 2CS3A 3QPTA 3F1BA 5A2QK 4BBRJ 4IPAA 4F7ZA 1J5YA 4D7MA 2VOPA 3WG9A 1VTNC 2IEKA 1AOYA 4F52A 3DBHB 2M9HA 2E71A 2KMUA 1DUXC 2OQGA 3CF5F 4KN4X 2L9NA 3OYEA 3HL2A 3Q0VA 2VASA 3ABMH 3VYSB 2DA3A 3KKCA 1UJ8A 1O3QA 2ACJA 2COBA 4ZYEA 5TGTA 1Q1HA 3RZDJ 1R00A 1J2XA 2NXNB 1F4KA 2EZKA 3RDIA 2R7UA 3LSRA 1Y1VJ 2XHKA 5LEJA 5M5XJ 1I39A 4XSZF 4RDUA 1PYVA 1P9QC 2JRMA 2VKEA 3ASNH 1SEUA 4KYWA 3REOA 1IN8A 1JHFA 2V1UA 1FPQA 3EPZA 2WTEA 3BJOA 3RKWA 4AD9A 2VI6A 4AIKA 3L7WA 1E3OC 4ANJA 5KK1A 2WBMA 2ZMEC 3WHBA 2NS0A 2GXBA 3MKLA 2R5YB 2RGVA 2AQFA 4QIWN 2QQ9A 4ON0A 2H94A 2WY8Q 1RUNA 2DFHA 3KP2A 2JUCA 3JAMZ 1YX3A 1LVKA 5EEGA 3LHQA 4S05A 3EQLF 1N78A 1F36A 4ESBA 4LFUA 2ZO4A 1Y8RB 2E2IJ 5E1ZB 2ESNA 5DCMA 3VPRA 2CUZA 2F5VA 4PSWA 3CMAI 4BXFA 1DP3A 2VPRA 2IS1A 4I99C 2P4WA 2V6CA 4A3GJ 4FE4A 4MQVA 3IHUA 3VIBA 3PUBA 4BJ5C 3KEYA 2FNAA 2QSFX 3CP8A 4RAZA 1VQNI 2MGQA 3R0AA 3IUVA 3FHNA 2OCEA 2AXTC 4CA0A 4Y15A 1WJAA 4F3QA 1R9TJ 2FBKA 4V19K 1Z67A 3GFMA 4I02A 3ZN0A 1HKSA 2VB6A 1ZG1A 4Y4RA 1OCRH 1YE9A 5HSZA 4BUPA 2PJPA 1JT6A 2E36A 3HZJA 1MJAA 4XBFA 3ZMZA 3SDBA 1TNTA 5FLVA 2DPUA 3H36A 4FISA 2E60A 3ERMA 1MBGA 3BR3A 5IT3A 4Y52J 3ULQB 3GW2A 3M1CA 5F27A 4IXAA 4M3FA 2DT5A 1G2HA 4EJVA 2BY0A 2FXAA 3DCFA 2MBFA 4MNUA 1TQPA 3JRCA 3M8EA 2ZKZA 1BI3A 2VE9A 1HKTA 2NVQJ 3A01A 1WJ5A 3QQAA 1XSDA 4DGWB 3IKVA 2IAIA 1ZN2A 5BNGA 4A6EA 3BR2A 3LMMA 1SAUA 4EJWA 3VOKA 4I01A 1YRNB 2A6EF 1UB9A 3FXOA 4AF5A 2Y9ZA 4G9YA 5D5UB 1B1BA 4U88A 2B7EA 4BH9A 1ZRFA 2AS5F 5D5VB 1HOMA 1IN6A 2F4OB 4UB6C 3I53A 4C2UA 4ACIA 4UVBA 4NC7A 4G12A 4CH7A 4NUBA 4II3A 1KA8A 3LSPA 5BS6A 2F6CA 4L9JA 3V6GA 4Y7NJ 2DDAA 2ZY9A 4PJNA 3DQVC 1ZG3A 3CDIA 5FLXZ 3OSGA 4HQMA 3QP6A 2MLGA 2DA6A 2IA2A 4UY8I 3FKJA 4NQWB 2WUIA 1HLVA 1SD7A 5FRMA 3BPXA 3BJAA 1W7PA 2E19A 1S72I 2DA2A 3ZGKA 3S93A 4G7OF 2VLAA 3TKYA 2EIMH 1D8JA 2LF8A 4EEFG 1Y8QB 4II2A 4KA4A 3FXKA 2ME6A 1TNSA 4HX7A 1H9TA 4XLHA 1X1PA 3M8JA 2K4JA 3G4SI 1I5ZA 4J01A 3K70D 3M7GA 3S3MA 1ETWA 1DDNA 2IA1A 5D6FA 1VQ7I 2UWMA 2FQ4A 3ZRGA 1A31A 2BEOA 2R7OA 4UXNA 4EGZA 3ZQ7A 4BAYA 1Y39A 1Y6IA 3WTSC 4BY7J 2J5OA 1RZ4A 3KZYA 3I59B 3PASA 1SD4A 4FHTA 3B81A 4JOMA 3UR3C 1F43A 1ZTRA 1WVRA 3OOPA 1N75A 2LYCA 4OIOF 2UXOA 5DYMA 1S3JA 1WSUA 1XPXA 2M0CA 2XRNA 2XVCA 2IRFG 2QSHX 1NG6A 2FQ3A 2CFXA 2MH9A 3OS2A 3KZIC 2UXXA 4BYYA 4B4CA 2IA0A 1RKWA 1FMWA 1P4AA 1YW8A 3LA3A 4JK1X 1UG2A 3HE0A 1ZG5A 1RR8C 4D0PA 1MBFA 4MEXF 4B09A 4IF4A 4EJUA 4A93J 1YQAA 3O3KA 3IWZA 2XGDA 2CQNA 5GP9A 2XAGA 3CUQA 2X85A 2A69F 2PX9A 3BROA 5HLIA 2M5WA 4XLNF 4M3DA 3ZMTA 2DJIA 1FBSA 2Z99A 1FX7A 4ENNA 3BP8A 3HM5A 2V57A 1N25A 2LBFB 3GX4X 1JKPC 2HPIA 3D1NI 1OYWA 1QPIA 2ZJ2A 2R7ZJ 2LKSA 4C30A 4A3KJ 3F8FA 2X1DA 2EZIA 3CCLI 1GVJA 3NAUA 4LIVA 2CQXA 4NB5A 2HFHA 5GADJ 2LG4A 3HRUA 4BQNA 2M45A 3A01B 1QZZA 4B43A 3OYHA 2KRCA 2IVMA 1BN5A 3HGYA 3AG2H 2ETHA 4JBAA 2MYSA 2CJJA 3DXJF 2HVRA 1D3YA 2FX0A 2CFOA 4F55A 2LKPA 2FMLA 1K7AA 3PPBA 2E1OA 1CGPA 1YRNA 4HLYA 3ABLH 3G7RA 2G7GA 4PCQA 1T2KA 2PJRB 3H3UA 3QPHA 3FXJA 3ABKH 5DCFA 3J7ZI 3BWGA 3W6VA 2LNBA 5BOXA 1HC8A 4ZYDA 4PDKA 2CQKA 3ML6A 1JUMA 3Q3SA 3COLA 2V6EA 2FEZA 4Y3OA 2PBIA 2JSPA 5DDGA 5ILUA 1I6HJ 1X3UA 3JW4A 4I98B 4FQGA 3JSPA 2CU7A 4XLFA 3E6MA 3CO7C 2XGEA 2HZDA 1D1CA 3O2PE 3KP7A 3ASOH 2UZKA 2P8TA 2Y2ZA 3ZCOA 2X9DA 2GAUA 5EG0A 5C3EJ 1DGRM 2M7BA 3HC7A 3RJPA 3BR1A 2JA8J 2VBZA 1QVTA 1WJFA 4B48A 3MZYA 4E70A 4AIHA 1E0EA 2FE3A 3MVPA 1IRZA 1XMAA 1UI5A 4PJJA 2O8KA 1MBHA 1JE8A 4AC0A 5LHGA 1YYVA 1T98A 2LDUA 4L9NA 4PJ0C 3V7RA 3KP3A 2ISZA 2QVOA 2HI3A 5F04A 5F0HA 1W7PB 3BG5A 3A0BC 3LSMA 2D2WA 5K1YA 5EG0B 4ICHA 2DPDA 1R5ID 2KFDA 1ITYA 2EK5A 1DPRA 3HSEA 2A61A 3HJEA 5B66C 2XAFA 1RR7A 3GTGJ 3SZTA 2K4BA 4KDPA 4AIJA 1VZ0A 2XAUA 3IAS2 1HDPA 2NVUB 1JKQC 3QOPA 1O3SA 3K8PC 2FRHA 5AIQA 2CG4A 3DTEA 4LK0F 1SGMA 4L9VA 1FNNA 1V5EA 1FP2A 2MC4A 1BA5A 3UNGC 3WGIA 2P5LC 4IOCF 5CPRB 1FYLA 2GLOA 4I6ZA 4C3JJ 3EUHA 3NPIA 1OLTA 1HQCA 3CLOA 2JSCA 3J7YJ 3G71I 4BQOA 4CDGA 2ZB9A 3TGNA 2MC3A 2HQAA 5HS7A 2PQ8A 4IHXA 2FMYA 2OA4A 2W85A 1Z9CA 1I1GA 2A5WA 4F92B 1SVOA 1SC7A 4A3LJ 5LGUA 4NN1A 1FP1D 3OYJA 2QEXI 3U1KA 2Z16A 1X1AA 2HNHA 2ZCMA 3Q9SA 4PJLA 2R93J 1ZR4A 1UELB 1SD6A 1XSXA 5CVVA 5AONA 3G3ZA 4OOIA 2M8EA 3SWHA 2F5EA 1J09A 3S1NJ 2NAZA 1MMNA 1STZA 4E7LA 3HTSB 4KT6A 3GTPJ 4HRIA 1OQYA 1ZLJA 3DTKA 5IP9J 2VODA 4LOCA 1TQIA 3Q5FA 2ME0A 3QYEA 1FYMA 3ANPA 3HTUA 4RLQA 4A12A 1WGXA 1SFXA 1R71A 4XRMA 2X6YA 5FKMA 2HEOA 2JTVA 3B02A 1OKRA 2O8XA 3TW7A 1BBYA 3ELKA 4M3BA 2P5KA 2NS7A 4M9XA 3ZR8X 3VWBA 4IHTA 3H5NA 5F6FA 4DBRA 4ABZA 1OCOH 3GTKJ 4M3GA 4WWCA 3TOAA 1IDYA 1JJ6C 3W3CA 4DJAA 3CCVI 3IWFA 1RC9A 3RPQA 5FFZA 4GCKA 4YFKF 3J80K 4KNYA 2R5ZA 1E17A 2QQAA 1OCPA 4B1RA 4HSRA 3N4MA 4OMZA 3SZPA 1Z7UA 3MKWB 4BDYA 3SEQA 4EMSA 3H1CA 5ICGA 3A2KA 1GXQA 1K79A 5J1RA 2QENA 3PIOF 2NRAC 2DODA 3WU2C 4O6JA 2JA5J 3PNVA 2EPFA 1ZARA 3SYTA 4CUGA 1O3RA 2XDVA 3K10A 2KIQA 2VN2A 4CZCA 2IS2A 3R0JA 4LLNA 1MJBA 3RKYA 3K4CA 3LAJA 1U8BA 3H9JA 3PFYA 1TWFJ 3FIWA 2Z5UA 5E3NA 1R5GA 1EJ9A 3TEDA 4GGGA 3LNQA 4YIFA 4R79A 2CQ7A 4ZTJA 1K78A 5TRDA 3V8KA 3CDLA 2WC2A 3AG3H 2K40A 2IGOA 3CCMI 5FMPA 1FSEA 1T8IA 2L7ZA 2O7OA 3TW6A 3F3XA 5J4VA 1NTCA 2KRFA 3QPLA 3VUQA 3F9KA 2O5RA 1EH6A 2DA7A 1RIOH 3VW1A 2ZSIB 2BY3A 2QKOA 3ABUA 1D5YA 3BHQA 3FBIB 5FHPA 2ZC2A 2DBBA 1YS6A 4XKWA 2Y0MA 2JWTA 4ZJZA 2DMQA 3HOXJ 1BC7C 4HDVA 5FLXK 4M6YA 2VT2A 5K7FA 4P1WA 3SEZA 1S8NA 3I3LA 3BNIA 2STWA 4B44A 2OUMA 2H8RA 1VI0A 1XGSA 3AL0C 2L4AA 2MD5A 4NQWA 3OS1A 3OYIA 2LREA 5AQCA 3BJ6A 2K9MA 1GDTA 2YX7A 2RC4A 4RM2A 1HKQA 1ULYA 1UMQA 3MZ8A 1HBXG 4B3XA 4RAFA 5AIPA 4A3IJ 3CC4I 1K78B 3BTCA 1X3ZB 4FE7A 3S14J 4D5FA 4GCTA 3CD6I 5KNLA 5LD2C 3OS0A 5K5RA 3L2RA 4ZH4F 1DQUA 3ONQA 3WU0A 2IS4A 3TMOA 4HF0A 4DYRA 3HKZN 3KYCB 4JX4A 2BBYA 4MTDA 3J81Z 3BC8A 1BIBA 2X4HA 5IYCJ 3CWRA 2W48A 1SFOJ 2O61A 1RESA 2RHAA 2JPCA 1A04A 4PXIA 1PUFA 3V8LA 3HOWJ 4ESFA 1BR1A 1G3WA 2FNPA 1WJEA 4IQ4A 3EUPA 1OCZH 2NX4A 1ZQ3P 3DPLC 5EF6A 3WTYC 3IKTA 2HR3A 3I9V2 4HKUA 3L2QA 2Y69H 3K9TA 3C2BA 4IVNA 2F07A 2Q24A 3K1MA 3ZQHA 1GXPA 4LG0B 4IX7A 4S04A 1KU3A 2VKDA 3E5XA 3DEEA 3SZGA 4ENMA 3P9CA 3X2QH 1X58A 2VPLA 3ON2A 3CMYA 2QWTA 1O57A 3QYBA 1Z7LA 1X1BA 4RS8A 3CJDA 3EGQA 2EFWA 1QU3A 4OD4A 2A6TA 2JUGA 4ESJA 4DQ2A 2EV6A 1U6GA 1D8KA 2XKPA 3I5UA 4I0AA 4E4HA 4L5IA 1MZBA 1TW3A 5F1JA 1QBJA 2HYGD 5CVRA 5CVJA 3DEWA 3Q0WA 2YX4A 3I4MJ 2CRGA 2XAHA 4LLGF 3BR0A 4A5MA 4G6QA 3HB9A 2DFFA 2IGNA 1NH3A 4GCVA 1TWHJ 2XSDC 4IHVA 2XPUA 3AG4H 4ZDLA 4XL9A 3JREA 3LA7A 2A68F 2EV5A 2QGUA 3PO3J 5ILVA 1IXRC 4WCGA 1YJNI 4J19A 2IGKA 4XORA 1I3AA 3AKZA 3JRBA 5L3BA 4OINF 2Y0SA 5B5EC 3GYHX 1R4NB 2ADUA 2FA5A 3CF2A 5H6QA 1X19A 3DKXA 3L2CA 1BL0A 3CP2A 4HYEA 3FX3A 1XDUA 2E35A 1D0XA 3DFGA 1ZH5A 1SVLA 1TT5B 3ZQIA 2OI8A 4BU2A 2K3FA 1X4PA 4HW0A 5E8IA 2YR2A 3AQSA 4F91B 1D1AA 1RPWA 3TP3A 1UHWA 3HDDA 4E7SA 2LRDA 2IXSA 2XGXA 4BQQA 1EA3A 2QBYA 3OOUA 3T8TA 2MFZA 1JXSA 4ZC3A 1T0FA 4YRVA 2VKVA 3KKDA 2EZLA 3WTVC 1MW7A 1PJRA 2E1MC 2L54A 1G6NA 2ZCWA 3S32A 1VQLI 5IOYA 3GFJA 2WAQA 2FOWA 4KJZA 4RGXA 1FYKA 1A6IA 3CJNA 3TO9A 3OYKA 5M5YJ 2PBXA 1B8IB 1Z6TA 1ZELA 3CCQI 3FXQA 3QU3A 2EFOA 2BY2A 2Q1ZB 3BT9A 3D5SC 2DAOA 4GFBA 2F48A 5CXIA 4XICA 3IH2A 2A05A 2VBYA 3BCGA 1JTYA 4E7IA 3L09A 4QWQA 5M3FJ 3V7CA 2C6YA 1FIAA 1TW2A 1BOAA 1T56A 2RKHA 2DMPA 3QP5A 3HGGA 1EH7A 5F0FA 2GM4A 4X1EA 3LOCA 4LIUA 4BXUA 4NHJA 1GUUA 1YJWI 3OYGA 2DCEA 4O3MA 3FBNB 3EUHC 2O0YA 4CYCB 2XPWA 2I8DA 1ZAOA 5BMZA 2JRTA 3RQ4A 3FHZA 3CC7I 2VT3A 3FF5A 2E5NA 5DTDA 3QYFA 5F64A 1MH4A 3VOXA 5E79C 3S1MJ 5LRRA 2R92J 3GTQJ 3FMSA 5CKTA 3ERED 1E3HA 3FZVA 1ZRDA 1DU6A 1IW7F 2B63J 1Z91A 1JTXA 5E17F 2O7TA 1BI0A 4MTEA 2QSGX 3RD3A 1YHQI 2JT1A 1WKMA 3SJMA 1KZHA 2CUEA 4OWRB 3I55I 3KLOA 3DEUA 4HSTA 3CCEI 2XF6A 1XC5A 3S8PA 5D5XB 1MBKA 1BR2A 2LR8A 3G6EI 5DV5A 4HDUA 1ONVA 3Q0UA 4E7JA 1Z3YA 1G3YA 4CZZA 1YI2I 4IQJA 2Y9YA 1K61A 1MMSA 2AQEA 4ASNA 2E1NA 1VQOI 5C4JJ 1Z6RA 2DK8A 5IT9K 4N4OB 2ZNYA 2E1CA 3PL8A 2MG4A 3HOUJ 5EFYA 1H88C 4HV6A 3DWLE 1P2FA 1SD5A 1VQ9I 2CUJA 1KQ0A 4WF2A 1SAXA 3HOSA 4X6AJ 5GTIC 4GRIA 2DG7A 3KFWX 2VE8A 2QIBA 3FXRA 3A1YA 2ZJRF 3N97A 4XRSA 4MXMA 4U0WA 1R1VA 1I1SA 5E18F 1K4TA 2W57A 3VSLA 1BC8C 4PSXA 1TQMA 4RB2C 4XK4A 2KHMA 2X6WA 3VYUB 5CQEA 1FOYA 2HVQA 5IT9Z 2WAFA 3K1PA 1XS9A 2VC0A 4DNCA 1VQPI 1MD0A 3E6BA 4MEYF 1BI1A 5CXGA 4LB6B 3HTHA 1LE8B 4BE2A 2PMZA 1BIAA 1D1BA 1TP4A 3Q9VA 1UHSA 2GIZA 4Y33A 1W7PD 2R3SA 3KP4A 4OIRF 3KZZA 2HYJA 3SFZA 4BKXA 2QBYB 3K0LA 4KN7X 4AU7A 2VXDA 5L3CA 2YPRA 5J47A 2W7NA 3LA2A 2EA2A 1BM9A 2V1DA 2E2JJ 2GIVA 3HIFA 3ZPLA 3CJQB 4KFCA 1U5TC 1DP7P 1DPUA 4G7HF 2B9SA 4C3IJ 2G9WA 4RGSA 1NK3P 1P4XA 3KCCA 2FOKA 2QYOA 1VQ4I 2XB5A 2EB7A 3FM5A 4Q48A 1S29A 1LKXA 4U0VA 1K6YA 2ISYA 3RPUA 3HRSA 2HDDA 2CV2A 2IGMA 4YELA 3G2BA 4CCKA 4E6KG 2NYXA 1WI3A 5DS9A 2AHQA 2ZJQF 4ZDOA 2GOXB 1MNDA 3HPHA 2IU5A 2RQQA 1P7JA 4M6XA 1SFEA 1V5FA 3PIPF 1Y0UA 3F21A 2ID6A 2Q2EB 2WY7Q 1APLC 4IKFA 1WHUA 1YG2A 1TC3C 2K27A 4CXFA 2ECCA 5FKKA 3OIPA 2GENA 1E2XA 1XB4A 2MLKA 4M6VA 1MH3A 3NQOA 3RI4A 2EFQA 5FRNA 1GHCA 2LP0A 1GT0C 1G4DA 2BE5F 1X2NA 2PMZN 2H09A 5K58A 1Z21A 2QQBA 2B1EA 1SFKA 4OIQF 3RYRA 2VXZA 3BR6A 3GBGA 4V2GA 4LG3A 3S17J 1VQ8I 4JP0A 3FXUA 3RIRA 1ETXA 3BZCA 1P4WA 3GTMJ 1G59A 4LITA 2DG8A 2OTJI 1XGNA 4D5CA 2HVSA 3IP4B 5CQGA 3FKIJ 3FWEA 4XLAA 2VQGA 2VJ5A 2FBQA 3S2WA 3CRJA 1MIJA 3H9QA 2F5CA 4XOPA 2XAJA 4YFXF 3T5XA 1ON1A 1KQ9A 1XMKA 5K5OA 2KZVA 4GFLA 2XASA 1BJZA 1PP8F 4LG0A 4EV0A 5DD8A 2X6OA 4A5NA 1MBJA 1S7EA 4M72A 2MW8A 3GXOA 4E7ZA 2Y31A 2QWWA 4XKVA 3GTOJ 2QA4I 5E3LA 2DXIA 2UXHA 4EM1A 3WHCA 3ZQFA 3F8CA 1N77A 3OY9A 3A0HC 2DOEA 1MDMA 4XKBA 3I71A 3CC2I 4LB5A 3PQKA 2GOMA 1JKRC 2ELKA 2OJED 3F8BA 5J4YA 1WWXA 2L9SA 3K1NA 3LSHA 4P9FA 2W24A 2K85A 2ICWG 1O4XA 3NWTA 1LEBA 3E7QA 3EYYA 4IL6C 1FC3A 2X0LA 5DUKA 4U7DA 3BY6A 2RQPA 3CUQC 4ME9A 3KE2A 1U2WA 4DW6A 3M8FA 3HG9A 1XGMA 2PEXA 2H6BA 1GV5A 4I7HA 4O5VA 4UUTA 1JUPA 4Y13A 3E97A 3T1BA 4A3DJ 3OL3A 5IOZA 2QKMB 2R7WA 3ISPA 5J3LA 3OYMA 3KZ9A 6PAXA 1OISA 3ZMUA 4ZTFA 3MMYB 4IRHA 2BY1A 4FETA 2PMHA 3GZNB 3VFZA 3HTJA 1WJBA 4CYCA 4HBLA 2Z3YA 2DI3A 2M7AA 3PQJA 2HDCA 3HRMA 1W1WE 4I76A 2BOLA 4FASD 2H1LA 2YUSA 2W84A 4ZYGA 4UDSA 4RGRA 5HS8A 1QA6A 4UB8C 1BR4A 1QGPA 1YW9A 2G7UA 2LBFA 4AUXA 5EGOA 5HAWA 4NNJA 2HWVA 3QKXA 1IJWC 1D0ZA 3GF2A 2ZXHA 3LFUA 4KIFA 2AXLA 4A3EJ 1IRFA 3NS4A 3CTAA 3C18A 1X1CA 4L62A 2X51A 1FBUA 4ENJA 3ZQGA 5GAEJ 3VVYA 1H9GA 4XRFA 5F1RA 4A0YA 2V1XA 4GFKA 1QQIA 1BW5A 2Q2EA 4HPQA 4CSWA 2BW3B 2K5CA 2W25A 3DV8A 4HNVA 5ED4A 4IHWA 4XLCA 4UVAA 3GZ5A 4XLEA 3H3VK 3OMYA 2NNYA 3CCJI 4OIPF 2IJLA 1R23A 3GVAA 4C3HJ 2L4MA 3TBIA 4X0GA 5JHFA 3JAMK 3VTIA 1IUFA 1ZGAA 5CW8A 2FU4A 1MKMA 3F0CA 5JLXA 1X2MA 2VONA 2ZMEB 5IP7J 4H4KC 2D1HA 2ESHA 1WRJA 5HBUA 4XRSG 3PNTA 3KPHA 5D4RA 1KU7A 1TL8A 2BVMA 4P9UA 3WTTC 1LE8A 5CLSA 2FUG2 1MSEC 4XMYA 3HOVJ 3I58A 2HS5A 3DP7A 1W36D 2XGCA 2CV0A 2KISA 3VVZA 3D5RC 1P7IA 5JLWA 3A03A 1XMXA 1GV2A 1IUYA 3GTJJ 2JN6A 2HYFA 4HV5A 5D19A 2CW8A 2NNNA 1T08B 4MLOA 5DCMB 1AWCA 4CCJA 4HOBA 2B3WA 3TDZC 1B4AA 4KIGA 1JGGA 4KMFA 1OYIA 2VIXA 4N4NB 2F2EA 2K7LA 1TWAJ 1S9HA 4BS9A 4HEA2 3VDXA 3J7AO 1IG7A 4YFNF 5J40A 4UNOA 3ZN1A 4JL3A 2Z9OA 1QHHD 3RSNA 2TRTA 3A4CA 4GXOA 4V2FA 1TWCJ 4UV8A 3CLQA 5FB2A 2W1OA 3I54A 1K4SA 3I64A 5ERIA 1I6XA 2R7QA 3ZQLA 2DFIA 1FIPA 3C2HA 3VYTB 4U7BA 3OYCA 4BY1J 3E1SA 3RYPA 2YS9A 4QPQA 4DBQA 2LD5A 2EQRA 2KQRA 2E7WA 4Z2YA 2ELJA 4DIQA 3DPUA 4NBQA 2PMUA 3CJTB 3ZMDA 2GUHA 4W1UA 2JVHA 2WAQN 4QSHA 3K4KA 3KEQA 2ID3A 2Y75A 4ETSA 2HOAA 4WXCA 2GZWA 3U21A 4KISA 2DK5A 2V7FA 2KIFA 2XUBA 3H9GA 1ZYRF 1CF7A 1C0WA 2JMWA 5D4SA 3CCYA 1QHGA 4EATA 3R6SA 3E3VA 3F8MA 2P5VA 5CVUA 4QTRA 3JRGA 1U9NA 3JRDA 5DAJA 1K83J 5JR3A 4LGWA 4IHSA 2ZOYA 3LSKA 3LSIA 4UV9A 4YG2F 4CYDA 5FGMA 3HHGA 1WJDA 2F4MB 4Q4ZF 4PFOA 3DBLB 1PDNC 1ZRCA 3LJLA 2DFEA 5HLHA 2XB0X 4R8HA 1JT0A 5KAFC 1USTA 3OYBA 4RM3A 3E5QA 3COAC 1QO0D 2Y0SN 3BRUA 2NP3A 1USSA 5HS9A 1I50J 2NOJB 4S0HB 2MABA 2M3AA 1SANA 4AYBN 4BGDA 3J80Z 2RASA 1Y56A 3RZOJ 3ON4A 5DEQA 1R5HA 1ON2A 4MHGA 2JA2A 3MD2A 1ZK8A 3CESA 2DDBA 3PNYA 2F5FA 2EJRA 1BOBA 2NVXJ 1MJ9A 3SDGA 1XSVA 1MMDA 5H6RA 4BEHB 1YLFA 1T0FC 3D5LA 4XM3A 1ZGWA 3OV8A 1XD7A 2OV7A 2G3BA 3S3NA 3NEUA 3S3OA 2V26A 1MGTA 1R4MB 2N8GA 4L0YB 1B72B 1NG7A 2LVSA 4EGYA 3BPVA 3VODA 3DPTA 1PVEA 1SMYF 2BYVE 3AFHA 2OBPA 3HUGB 5HLGA 3HOYJ 4UUSB 3MCZA 3JRAA 2D45A 2HKUA 2Y30A 3P9TA 3TOBA 4DVYP 2OTLI 2LMDA 1R36A 2LOOA 1UHMA 5ICFA 5K5QA 2R7TA 1XGOA 2KJBA 4MGRA 1AHDP 1LB2A 1J0RA 3MQ0A 5DM6F 1G8XA 1LDDA 2VBWA 5DUIA 4J00A 2YU3A 3HPGA 3K4BA 1HW1A 2FF4A 2H6CA 2JJ7A 4KICA 4L18B 1JUSA 1ETKA 3SQNA 3C7JA 2GA2A 4H0EA 2X6XA 3CZ6A 3E6DA 3OYFA 2XIGA 4YZEA 5B1BH 5H2FC 2JK3A 3JRFA 1O3TA 1ODDA 4G8XA 3TP0A 5IYBJ 4F93B 2K3PA 2QTQA 1IXCA 3OR2C 3VP5A 1VQMI 3SFIA 3D0SA 3KP6A 2OQRA 3ZQQA 3W2VA 4BHPA 1PUFB 2FJ1A 1U8RA 3EUAA 3WGHA 5HDNA 4A69C 2H27A 3BOQA 1L0OC 2DA5A 5H20A 2IP2A 4JX5A 1M1EB 1UZCA 3FK7A 1Z0XA 1FOKA 1D5VA 2RVCA 1SMTA 1MMAA 3L2WA 3PO2J 2HXIA 1EV7A 4B8XA 2P6SA 4JX6A 2UXNA 3H5AA 3LQQA 4HG2A 4M9SA 3MKZA 1VQ5I 1ZLKA 4HX8A 2L9VA 3H92A 3ZOBA 2LC2A 3DPJA 3IH3A 2R7XA 5KHDA 4M9ZA 3NNRA 3K70C 3L9FA 3CCSI 3H3ZA 1YJ9I 1YITI 4B47A 3OR1C 3BG7A 1P92A 3O8GA 3QOEA 4HX4A 2YVHA 2LSOA 3HHHA 4PUSA 5FLMJ 2HQRA 1HXDA 3GFIA 2BXZA 2RAEA 5E3MA 2OZUA 1FT9A 4GYIA 4LD5A 3GZIA 1YIOA 1WH5A 1ORKA 1YTYA 4RAYA 2ZSHB 4G6TB 3B6AA 5C4YA 2VL8A 3BZ6A 3KLNA 3LSGA 1FZPB 1LNWA 4A3JJ 3S15J 2KDZA 1V55H 1IZ1A 3GO5A 3VEPA 4RA2A 5TISC 4EQQA 2ZFWA 4DYQA 1FWZA 5ICCA 1KU9A 1FLIA 1IV6A 3C2GA 3RTRA 3WU1B 4FT8A 3EETA 2IBDA 1XX5A 9ANTA 3W2WA 4L9TA 2M1BA 4HA8A 2VC1A 3NWSA 5HNHA 2JA7J 4PGHA 3OIOA 1J59A 3ZP5A 1HSJA 1TT0A 2L01A 2LK2A 2HQ5A 3G1LA 1X3WB 2NVTJ 2G0EA 3E7LA 3S2DJ 5FKOA 3AL0B 4NDLA 4YEJA 1QPMA 5EZGA 1XN7A 4UUSA 4CICA 4C2MJ 1WJCA 1TWGJ 3LWJA 3OYAA 1XCBA 2KZGA 5CYVA 1IGNA 3CQZJ 4WIBA 2D1VA 2DLLA 1Z1DA 4E7HA 1ZR2A 3GLXA 1MMGA 3V4GA 1LDKB 2EV0A 3EUKL 4L0ZB 2QOPA 4E7KA 4I2OA 3BQYA 2V9PA 2VKHA 3R60A 2GBYA 2K86A 4TV7A 2Q8KA 3M07A 4QLCU 1OMIA 2JZYA 5LBQA 4FCYA 1V54H 4HNTA 2XSJC 2X1EA 3RKXA 1OYYA 2CW7A 2G7LA 2PI0A 2EWNA 3VW2A 2PFVA 4LK1F 2OPTA 1IF1A 2QQ8A 3ECHA 1REPC 2M8GX 2L02A 5FJ8J 1RRJA 4IHYA 3CMMA 3CMEI 2EINH 2FBHA 4XN3A 2NVYJ 2R7FA 3TQNA 1F9NA 2RV8A 4EJTA 2PJRA 5HLTA 2CSOA 3IAM2 2UV1A 4WK8F 4QPOA 3NXCA 1ZREA 1W5TA 1ZKGA 1YX5A 2GQQA 3FK6A 4C9YA 2EH3A 1WI9A 5B3SH 5BPIA 2D6YA 3BTLA 2DOFA 3I0TA 4ZYHA 4AIDA 1F5TA 5LGTA 2QF7A 3C3WA 3JTGA 1XDSA 1E3PA 4WXHA 2JQ7A 2DQLA 4BHBA 3R61A 1QRYA 5F08A 3BR5A 3K4LA 1PUEE 2FBIA 1KQ8A 1XCVA 1RKTA 1ETYA 3BDDA 5LFAA 5GPAA 1Z77A 5EYRA 1FOXA 5BQTA 2P81A 3JSOA 4A0ZA 2NOGA 4Q47A 2JVGA 3KEOA 3U1DA 1H0MA 3DLLF 2CYYA 2ZXWH 4I0BA 3L2VA 3G56A 5HODA 3T6NA 2REKA 4YIRX 1TZLA 1V5GA 3GEZA 3IC7A 4AVPA 3W6JB 3GFLA 1B8IA 2ECBA 2Z2SB 3KETA 3W6KB 4EVIA 1T6SA 2IPQX 4ENKA 3FISA 4L5JA 3DLAA 4CO8A 1A6QA 2UUZA 4B3AA 1WPKA 2I10A 3MKYB 4CHUA 1XG1A 4AC6A 4RB1A 2GXAA 4C2MA 2LF7A 1Z05A 1LJ9A 2L2OA 2KT0A 3HBLA 4MO7A 5LHHA 1LQ1A 1S7AA 2IW5A 3H0GJ 1RUOA 4RGUA 2E2HJ 5D6EA 5E8GA 2P6TA 3CUQB 4XQFA 3OL4A 4Y17A 2XRLA 1YFHA 5D18A 2UXUA 2G7HA 3B6CA 5J6XA 3R4KA 3BTIA 3AAFA 2EA4A 5J1UA 1JHHA 3W2AA 2X1CA 3LFKA 2MA3A 2YU9J 2K9QA 2M4KA 3DTIA 1R49A 2HOSA 1G3SA 3P9IA 3GCMA 1KONA 2VQHA 2ZFUA 3MWMA 2HOTA 4G94A 3GLLA 2DMNA 2E5ZA 2RNGA 1SVMA 2E1MB 3QBMA
chains in the Genus database with same CATH topology
5M5XJ 4CGRA 4RDUA 2VKEA 5IYDJ 5K7FA 3O60A 2DMUA 3BNIA 4KWAA 4GFKA 2H8RA 1BW5A 1VI0A 2VI6A 4IHWA 2DA1A 1E3OC 2ZOZA 4HNVA 3WHBA 3H3VK 5AQCA 3MKLA 2R0QC 2R5YB 1GDTA 4C3HJ 4QIWN 1UMQA 4A3IJ 1AU7A 3BTCA 1IUFA 2UXIA 5CW8A 2DMTA 3LHQA 4FE7A 3S14J 3QPSA 3F0CA 1F36A 5JLXA 4D5FA 4GCTA 1X2MA 2E2IJ 5IP7J 3VPRA 3G1MA 5HBUA 4XRSG 4DYRA 3HKZN 2LY9A 2VPRA 4MFEA 3AQTA 4JX4A 2CUFA 2HXOA 1LE8A 1MSEC 4A3GJ 4FE4A 3VIBA 5IYCJ 3HOVJ 3CWRA 2W48A 2XGCA 1SFOJ 2FD5A 1OFCX 3VVZA 1RESA 2RHAA 1P7IA 2MGQA 3IUVA 5JLWA 1H8AC 1PUFA 3A03A 4PXIA 1GV2A 1OJLA 3HOWJ 3GTJJ 1R9TJ 2JN6A 4BBSJ 5D19A 5D1RA 4MLOA 3EUPA 5EEAA 5HSZA 2NX4A 1JT6A 1OCTC 1ZQ3P 5EF6A 1JGGA 5FLVA 4A3BJ 4GCLA 4HKUA 4FISA 2F07A 3C2BA 2Q24A 1MNMC 1TWAJ 1MBGA 3ZQHA 1DU0A 3BR3A 1ETOA 1IG7A 4Y52J 4JL3A 1X58A 5F27A 2X48A 2TRTA 4M3FA 1G2HA 3ON2A 3CMYA 2QWTA 4V2FA 1TWCJ 3DCFA 3CJDA 3EGQA 2OF7A 3BG3A 3G1OA 3ZQLA 3JRCA 1FIPA 4BY1J 2NVQJ 1RETA 3A01A 2R5YA 2YS9A 3QQAA 2LD5A 1WCMJ 2EQRA 2IAIA 1U9OA 5BNGA 3BR2A 5F1JA 3VOKA 1HCRA 1YRNB 4AF5A 2R5ZB 2GUHA 3DEWA 4QSHA 4W1UA 2WAQN 3Q0WA 2CRGA 2Y9ZA 3I4MJ 1POGA 3BR0A 2ID3A 2HOAA 3C07A 3HB9A 1HOMA 3JRIA 4ACIA 1TWHJ 3BQZA 2JMWA 4G12A 3VW0A 2XSDC 3CCYA 3LSPA 4IHVA 2XPUA 4QTRA 5M3MJ 3JREA 5E3OA 3NARA 3JRGA 1U9NA 3JRDA 2UXPA 5DAJA 3V6GA 1K83J 4Y7NJ 3PO3J 2L7MP 2ZOYA 3OSGA 2D5VA 1ENHA 2DA6A 4J19A 1UI6A 2WUIA 1HLVA 3JRBA 1Y1WJ 3LJLA 2E19A 2LLKA 1MSFC 2DA2A 2XB0X 1JT0A 1JJ8C 2Y0SN 4EEFG 3K7AJ 1BL0A 2NP3A 3LSJA 2NP5A 2ME6A 3BRUA 1I50J 4S0HB 1A5JA 3ZQIA 2OI8A 2DA4A 1SANA 4AYBN 5FKLA 3GTLJ 3AQSA 2RASA 3RZOJ 3FRQA 3ON4A 1RPWA 2QCOA 3TP3A 5EGOB 1ETWA 1FEXA 2GFNA 5FGLA 1ZK8A 2NS8A 3HDDA 2FQ4A 3OOUA 3JR9A 2NVXJ 3SDGA 2VKVA 3KKDA 2EZLA 2W53A 1ZGWA 5IOYA 5EDNA 3I4NJ 1W0UA 1A6IA 4BY7J 4D7NA 2DN0A 5M5YJ 2G3BA 3PASA 2K9SA 2PBXA 1QVUA 4IEJA 1B8IB 3B81A 1F43A 1I3QJ 2N8GA 3O8HA 1ZTRA 4DZJA 1B72B 2M34A 2O9LA 2UXOA 2LVSA 3BT9A 2L7FP 2M0CA 4GFBA 5CXIA 4XICA 1GVDA 4B4CA 1RKWA 3IH2A 3BCGA 1JTYA 3V78A 5M3FJ 1UG2A 4UUSB 3HOYJ 1WH7A 3HE0A 1FIAA 3JRAA 2HKUA 2Y30A 3P9TA 1T56A 3BTJA 2DMPA 1MBFA 3HGGA 3ANGA 4W97A 2GM4A 5F0FA 4X1EA 3LOCA 1AHDP 4A93J 1U78A 1GUUA 5F0CA 2XGDA 5GP9A 4RBOA 2ZCNA 4CYCB 2XPWA 2JJ7A 4M3DA 3HTAA 1JUSA 1ETKA 2G7SA 2YVEA 5DTDA 2EZHA 1MH4A 3HM5A 3VOXA 2OERA 3S1MJ 3S1QJ 2V57A 4M3EA 4JNNA 1JKPC 2R92J 3D1NI 1QPIA 1MBEA 3GTQJ 2H1KA 2R7ZJ 4A3KJ 1DU6A 2B63J 1JTXA 2EZIA 3UKGA 3NAUA 2O7TA 2CQXA 2WB1N 4YZEA 3RD3A 2JK3A 3JRFA 3SJMA 2TCTA 3A01B 3TP0A 5IYBJ 2CUEA 4BXXJ 2QTQA 3VP5A 3SFIA 1XC5A 1MBKA 2MSYA 3HGYA 5K7ZA 3IV5A 1PUFB 2LR8A 2FJ1A 2CJJA 3Q0UA 3K2AA 4A69C 3S2HJ 2FX0A 3PPBA 2Y9YA 2DA5A 4JX5A 3FK7A 1K61A 2E1OA 1Z0XA 5FKNA 3VVXA 2DJNA 3BJBA 5C4JJ 1YRNA 3PO2J 2HXIA 3G7RA 2G7GA 4JX6A 3OSFA 2MG4A 2LKXA 3HOUJ 5EFYA 1H88C 3W6VA 3MNLA 4A3FJ 3M3YJ 4MK6A 1JUMA 3ZOBA 4X6AJ 3Q3SA 2DG7A 2QIBA 3DPJA 3IH3A 3COLA 1T33A 3NNRA 4XRSA 4DYCA 1FTTA 3NI7A 5C4XJ 4MXMA 3IH4A 1I6HJ 2XPVA 2CU7A 3O8GA 2YVHA 2XGEA 3A02A 5FLMJ 1VFCA 1H89C 2RAEA 4XK4A 5EZHA 5E3MA 1XS9A 2Y2ZA 3GZIA 2X9DA 5EG0A 5C3EJ 1WH5A 1ORKA 1HF0A 2JA8J 3BR1A 5CXGA 3HTHA 3B6AA 1LE8B 5C4YA 1QVTA 3LSGA 3S15J 4A3JJ 2VUMJ 3MVPA 2KDZA 1IRZA 4A3MJ 1UHSA 1UI5A 2O8KA 1MBHA 3S5RA 1ETVA 4DYQA 4AC0A 5IP6A 1IV6A 4BKXA 2HYJA 2IBDA 1B72A 2HI3A 5F04A 1AKHB 9ANTA 3JSJA 5F0HA 3BG5A 3MN2A 1IC8A 5EG0B 2EBIA 4ICHA 1ITYA 2HYTA 1Q1VA 2E2JJ 1NK2P 1RR7A 3GTGJ 5C44J 4C3IJ 1JKOC 1NK3P 2JA7J 3OIOA 1FJLA 5H9TA 1HDPA 2LK2A 2XB5A 1JKQC 1IDZA 2HQ5A 2JA6J 3G1LA 4JYKA 2NVTJ 2G0EA 1SGMA 3E7LA 5GPCA 3S2DJ 2CQQA 5FKOA 2HDDA 1BA5A 4NDLA 5K7HA 2GLOA 4I6ZA 1WI3A 5EZGA 5DS9A 2AHQA 1LFUP 4FTHA 4UUSA 4C3JJ 2IU5A 3NPIA 1P7JA 4C2MJ 2M2EA 3ZQCA 1TWGJ 5M5WJ 3LWJA 2K9NA 2ZB9A 1IGNA 2WV1A 3CQZJ 2ID6A 1ZR2A 1APLC 1TC3C 1VF9A 1AKHA 4IHXA 2PZ9A 1HDDC 2QOPA 2ECCA 3HIMA 3BQYA 3RKQA 5FKKA 2GBYA 2GENA 4M6VA 4A3LJ 1MH3A 4NN1A 2LP0A 1GT0C 3KNWA 4FCYA 2L9RA 1X2NA 2PMZN 2ZCMA 2G7LA 5K58A 3GEUA 2R93J 3VW2A 4AC6A 1ZR4A 3HTIA 3BR6A 3GBGA 4DZPA 4V2GA 3S17J 2OPTA 4JP0A 1ETXA 2M8GX 3JRHA 3GTMJ 1VNDA 2XDNA 5FJ8J 2DG8A 4IHYA 4D5CA 3FKIJ 3CRJA 2FBQA 3S1NJ 4XIDA 3RH2A 2NVYJ 3GTPJ 5IP9J 3PM1A 4LOCA 4MFDA 2L0KA 2ME0A 4GFLA 1BJZA 3ANPA 1WGXA 3NXCA 5J1YA 4MIMA 5IPAA 4XRMA 1ZKGA 3FK6A 5FKMA 2X6OA 2EH3A 1MBJA 1S7EA 2MW8A 2D6YA 3BTLA 1ETQA 3TW7A 2ZCXA 2LTPA 2Y31A 4M3BA 3GTOJ 2DTZA 2NS7A 5E3LA 1FTZA 3HEFA 2UXHA 2QF7A 3WHCA 3ZQFA 3RQIA 4ABZA 3HOZJ 3NRGA 3GTKJ 4M3GA 3M4OJ 1QRYA 1IDYA 1JJ6C 5F08A 3BR5A 3BG9A 3L1PA 4GCKA 1JKRC 2ELKA 1RKTA 1ETYA 2R5ZA 5GPAA 1Z77A 1OCPA 4B1RA 5EYRA 3S1RJ 2AO9A 1O4XA 2P81A 3E7QA 2NOGA 4JKZA 5J1RA 3G56A 5HODA 3T6NA 2WGBA 4ME9A 2JA5J 2REKA 4DW6A 1BW6A 1GV5A 4UUTA 1JUPA 1B8IA 2ECBA 1LFBA 1W0TA 4A3DJ 4A3CJ 5IOZA 3FISA 1EF4A 1U8BA 1CQTA 4B3AA 1WPKA 1TWFJ 2I10A 3FIWA 1XG1A 2LFBA 5J3LA 5E3NA 4L5EA 3TEDA 3KZ9A 4MO7A 4NELA 2KT0A 3HBLA 3LNQA 3S16J 3H0GJ 2E2HJ 3F1BA 4BBRJ 3HTJA 4CYCA 4D7MA 3CDLA 2K40A 4I76A 5FMPA 2XRLA 2IEKA 2YUSA 4UDSA 2L7ZA 2M9HA 2O7OA 3B6CA 3TW6A 2UXUA 5D18A 1NTCA 3BTIA 3VVYA 3QPLA 5J1UA 3VUQA 3Q0VA 4AUXA 2DA7A 5EGOA 2YU9J 5HAWA 2K9QA 3VW1A 2DA3A 2HOSA 1IJWC 3KKCA 3QKXA 2COBA 2QKOA 3RZDJ 4A3EJ 1D5YA 2HOTA 3BHQA 2EZKA 2DMNA 5FHPA 3LSRA 4L62A 1Y1VJ 2JWTA 3ZQGA 2DMQA 3QBMA 3HOXJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M5X J;  4CGR A;  4RDU A;  2VKE A;  5IYD J;  5K7F A;  3O60 A;  2DMU A;  3BNI A;  4KWA A;  4GFK A;  2H8R A;  1BW5 A;  1VI0 A;  2VI6 A;  4IHW A;  2DA1 A;  1E3O C;  2ZOZ A;  4HNV A;  3WHB A;  3H3V K;  5AQC A;  3MKL A;  2R0Q C;  2R5Y B;  1GDT A;  4C3H J;  4QIW N;  1UMQ A;  4A3I J;  1AU7 A;  3BTC A;  1IUF A;  2UXI A;  5CW8 A;  2DMT A;  3LHQ A;  4FE7 A;  3S14 J;  3QPS A;  3F0C A;  1F36 A;  5JLX A;  4D5F A;  4GCT A;  1X2M A;  2E2I J;  5IP7 J;  3VPR A;  3G1M A;  5HBU A;  4XRS G;  4DYR A;  3HKZ N;  2LY9 A;  2VPR A;  4MFE A;  3AQT A;  4JX4 A;  2CUF A;  2HXO A;  1LE8 A;  1MSE C;  4A3G J;  4FE4 A;  3VIB A;  5IYC J;  3HOV J;  3CWR A;  2W48 A;  2XGC A;  1SFO J;  2FD5 A;  1OFC X;  3VVZ A;  1RES A;  2RHA A;  1P7I A;  2MGQ A;  3IUV A;  5JLW A;  1H8A C;  1PUF A;  3A03 A;  4PXI A;  1GV2 A;  1OJL A;  3HOW J;  3GTJ J;  1R9T J;  2JN6 A;  4BBS J;  5D19 A;  5D1R A;  4MLO A;  3EUP A;  5EEA A;  5HSZ A;  2NX4 A;  1JT6 A;  1OCT C;  1ZQ3 P;  5EF6 A;  1JGG A;  5FLV A;  4A3B J;  4GCL A;  4HKU A;  4FIS A;  2F07 A;  3C2B A;  2Q24 A;  1MNM C;  1TWA J;  1MBG A;  3ZQH A;  1DU0 A;  3BR3 A;  1ETO A;  1IG7 A;  4Y52 J;  4JL3 A;  1X58 A;  5F27 A;  2X48 A;  2TRT A;  4M3F A;  1G2H A;  3ON2 A;  3CMY A;  2QWT A;  4V2F A;  1TWC J;  3DCF A;  3CJD A;  3EGQ A;  2OF7 A;  3BG3 A;  3G1O A;  3ZQL A;  3JRC A;  1FIP A;  4BY1 J;  2NVQ J;  1RET A;  3A01 A;  2R5Y A;  2YS9 A;  3QQA A;  2LD5 A;  1WCM J;  2EQR A;  2IAI A;  1U9O A;  5BNG A;  3BR2 A;  5F1J A;  3VOK A;  1HCR A;  1YRN B;  4AF5 A;  2R5Z B;  2GUH A;  3DEW A;  4QSH A;  4W1U A;  2WAQ N;  3Q0W A;  2CRG A;  2Y9Z A;  3I4M J;  1POG A;  3BR0 A;  2ID3 A;  2HOA A;  3C07 A;  3HB9 A;  1HOM A;  3JRI A;  4ACI A;  1TWH J;  3BQZ A;  2JMW A;  4G12 A;  3VW0 A;  2XSD C;  3CCY A;  3LSP A;  4IHV A;  2XPU A;  4QTR A;  5M3M J;  3JRE A;  5E3O A;  3NAR A;  3JRG A;  1U9N A;  3JRD A;  2UXP A;  5DAJ A;  3V6G A;  1K83 J;  4Y7N J;  3PO3 J;  2L7M P;  2ZOY A;  3OSG A;  2D5V A;  1ENH A;  2DA6 A;  4J19 A;  1UI6 A;  2WUI A;  1HLV A;  3JRB A;  1Y1W J;  3LJL A;  2E19 A;  2LLK A;  1MSF C;  2DA2 A;  2XB0 X;  1JT0 A;  1JJ8 C;  2Y0S N;  4EEF G;  3K7A J;  1BL0 A;  2NP3 A;  3LSJ A;  2NP5 A;  2ME6 A;  3BRU A;  1I50 J;  4S0H B;  1A5J A;  3ZQI A;  2OI8 A;  2DA4 A;  1SAN A;  4AYB N;  5FKL A;  3GTL J;  3AQS A;  2RAS A;  3RZO J;  3FRQ A;  3ON4 A;  1RPW A;  2QCO A;  3TP3 A;  5EGO B;  1ETW A;  1FEX A;  2GFN A;  5FGL A;  1ZK8 A;  2NS8 A;  3HDD A;  2FQ4 A;  3OOU A;  3JR9 A;  2NVX J;  3SDG A;  2VKV A;  3KKD A;  2EZL A;  2W53 A;  1ZGW A;  5IOY A;  5EDN A;  3I4N J;  1W0U A;  1A6I A;  4BY7 J;  4D7N A;  2DN0 A;  5M5Y J;  2G3B A;  3PAS A;  2K9S A;  2PBX A;  1QVU A;  4IEJ A;  1B8I B;  3B81 A;  1F43 A;  1I3Q J;  2N8G A;  3O8H A;  1ZTR A;  4DZJ A;  1B72 B;  2M34 A;  2O9L A;  2UXO A;  2LVS A;  3BT9 A;  2L7F P;  2M0C A;  4GFB A;  5CXI A;  4XIC A;  1GVD A;  4B4C A;  1RKW A;  3IH2 A;  3BCG A;  1JTY A;  3V78 A;  5M3F J;  1UG2 A;  4UUS B;  3HOY J;  1WH7 A;  3HE0 A;  1FIA A;  3JRA A;  2HKU A;  2Y30 A;  3P9T A;  1T56 A;  3BTJ A;  2DMP A;  1MBF A;  3HGG A;  3ANG A;  4W97 A;  2GM4 A;  5F0F A;  4X1E A;  3LOC A;  1AHD P;  4A93 J;  1U78 A;  1GUU A;  5F0C A;  2XGD A;  5GP9 A;  4RBO A;  2ZCN A;  4CYC B;  2XPW A;  2JJ7 A;  4M3D A;  3HTA A;  1JUS A;  1ETK A;  2G7S A;  2YVE A;  5DTD A;  2EZH A;  1MH4 A;  3HM5 A;  3VOX A;  2OER A;  3S1M J;  3S1Q J;  2V57 A;  4M3E A;  4JNN A;  1JKP C;  2R92 J;  3D1N I;  1QPI A;  1MBE A;  3GTQ J;  2H1K A;  2R7Z J;  4A3K J;  1DU6 A;  2B63 J;  1JTX A;  2EZI A;  3UKG A;  3NAU A;  2O7T A;  2CQX A;  2WB1 N;  4YZE A;  3RD3 A;  2JK3 A;  3JRF A;  3SJM A;  2TCT A;  3A01 B;  3TP0 A;  5IYB J;  2CUE A;  4BXX J;  2QTQ A;  3VP5 A;  3SFI A;  1XC5 A;  1MBK A;  2MSY A;  3HGY A;  5K7Z A;  3IV5 A;  1PUF B;  2LR8 A;  2FJ1 A;  2CJJ A;  3Q0U A;  3K2A A;  4A69 C;  3S2H J;  2FX0 A;  3PPB A;  2Y9Y A;  2DA5 A;  4JX5 A;  3FK7 A;  1K61 A;  2E1O A;  1Z0X A;  5FKN A;  3VVX A;  2DJN A;  3BJB A;  5C4J J;  1YRN A;  3PO2 J;  2HXI A;  3G7R A;  2G7G A;  4JX6 A;  3OSF A;  2MG4 A;  2LKX A;  3HOU J;  5EFY A;  1H88 C;  3W6V A;  3MNL A;  4A3F J;  3M3Y J;  4MK6 A;  1JUM A;  3ZOB A;  4X6A J;  3Q3S A;  2DG7 A;  2QIB A;  3DPJ A;  3IH3 A;  3COL A;  1T33 A;  3NNR A;  4XRS A;  4DYC A;  1FTT A;  3NI7 A;  5C4X J;  4MXM A;  3IH4 A;  1I6H J;  2XPV A;  2CU7 A;  3O8G A;  2YVH A;  2XGE A;  3A02 A;  5FLM J;  1VFC A;  1H89 C;  2RAE A;  4XK4 A;  5EZH A;  5E3M A;  1XS9 A;  2Y2Z A;  3GZI A;  2X9D A;  5EG0 A;  5C3E J;  1WH5 A;  1ORK A;  1HF0 A;  2JA8 J;  3BR1 A;  5CXG A;  3HTH A;  3B6A A;  1LE8 B;  5C4Y A;  1QVT A;  3LSG A;  3S15 J;  4A3J J;  2VUM J;  3MVP A;  2KDZ A;  1IRZ A;  4A3M J;  1UHS A;  1UI5 A;  2O8K A;  1MBH A;  3S5R A;  1ETV A;  4DYQ A;  4AC0 A;  5IP6 A;  1IV6 A;  4BKX A;  2HYJ A;  2IBD A;  1B72 A;  2HI3 A;  5F04 A;  1AKH B;  9ANT A;  3JSJ A;  5F0H A;  3BG5 A;  3MN2 A;  1IC8 A;  5EG0 B;  2EBI A;  4ICH A;  1ITY A;  2HYT A;  1Q1V A;  2E2J J;  1NK2 P;  1RR7 A;  3GTG J;  5C44 J;  4C3I J;  1JKO C;  1NK3 P;  2JA7 J;  3OIO A;  1FJL A;  5H9T A;  1HDP A;  2LK2 A;  2XB5 A;  1JKQ C;  1IDZ A;  2HQ5 A;  2JA6 J;  3G1L A;  4JYK A;  2NVT J;  2G0E A;  1SGM A;  3E7L A;  5GPC A;  3S2D J;  2CQQ A;  5FKO A;  2HDD A;  1BA5 A;  4NDL A;  5K7H A;  2GLO A;  4I6Z A;  1WI3 A;  5EZG A;  5DS9 A;  2AHQ A;  1LFU P;  4FTH A;  4UUS A;  4C3J J;  2IU5 A;  3NPI A;  1P7J A;  4C2M J;  2M2E A;  3ZQC A;  1TWG J;  5M5W J;  3LWJ A;  2K9N A;  2ZB9 A;  1IGN A;  2WV1 A;  3CQZ J;  2ID6 A;  1ZR2 A;  1APL C;  1TC3 C;  1VF9 A;  1AKH A;  4IHX A;  2PZ9 A;  1HDD C;  2QOP A;  2ECC A;  3HIM A;  3BQY A;  3RKQ A;  5FKK A;  2GBY A;  2GEN A;  4M6V A;  4A3L J;  1MH3 A;  4NN1 A;  2LP0 A;  1GT0 C;  3KNW A;  4FCY A;  2L9R A;  1X2N A;  2PMZ N;  2ZCM A;  2G7L A;  5K58 A;  3GEU A;  2R93 J;  3VW2 A;  4AC6 A;  1ZR4 A;  3HTI A;  3BR6 A;  3GBG A;  4DZP A;  4V2G A;  3S17 J;  2OPT A;  4JP0 A;  1ETX A;  2M8G X;  3JRH A;  3GTM J;  1VND A;  2XDN A;  5FJ8 J;  2DG8 A;  4IHY A;  4D5C A;  3FKI J;  3CRJ A;  2FBQ A;  3S1N J;  4XID A;  3RH2 A;  2NVY J;  3GTP J;  5IP9 J;  3PM1 A;  4LOC A;  4MFD A;  2L0K A;  2ME0 A;  4GFL A;  1BJZ A;  3ANP A;  1WGX A;  3NXC A;  5J1Y A;  4MIM A;  5IPA A;  4XRM A;  1ZKG A;  3FK6 A;  5FKM A;  2X6O A;  2EH3 A;  1MBJ A;  1S7E A;  2MW8 A;  2D6Y A;  3BTL A;  1ETQ A;  3TW7 A;  2ZCX A;  2LTP A;  2Y31 A;  4M3B A;  3GTO J;  2DTZ A;  2NS7 A;  5E3L A;  1FTZ A;  3HEF A;  2UXH A;  2QF7 A;  3WHC A;  3ZQF A;  3RQI A;  4ABZ A;  3HOZ J;  3NRG A;  3GTK J;  4M3G A;  3M4O J;  1QRY A;  1IDY A;  1JJ6 C;  5F08 A;  3BR5 A;  3BG9 A;  3L1P A;  4GCK A;  1JKR C;  2ELK A;  1RKT A;  1ETY A;  2R5Z A;  5GPA A;  1Z77 A;  1OCP A;  4B1R A;  5EYR A;  3S1R J;  2AO9 A;  1O4X A;  2P81 A;  3E7Q A;  2NOG A;  4JKZ A;  5J1R A;  3G56 A;  5HOD A;  3T6N A;  2WGB A;  4ME9 A;  2JA5 J;  2REK A;  4DW6 A;  1BW6 A;  1GV5 A;  4UUT A;  1JUP A;  1B8I A;  2ECB A;  1LFB A;  1W0T A;  4A3D J;  4A3C J;  5IOZ A;  3FIS A;  1EF4 A;  1U8B A;  1CQT A;  4B3A A;  1WPK A;  1TWF J;  2I10 A;  3FIW A;  1XG1 A;  2LFB A;  5J3L A;  5E3N A;  4L5E A;  3TED A;  3KZ9 A;  4MO7 A;  4NEL A;  2KT0 A;  3HBL A;  3LNQ A;  3S16 J;  3H0G J;  2E2H J;  3F1B A;  4BBR J;  3HTJ A;  4CYC A;  4D7M A;  3CDL A;  2K40 A;  4I76 A;  5FMP A;  2XRL A;  2IEK A;  2YUS A;  4UDS A;  2L7Z A;  2M9H A;  2O7O A;  3B6C A;  3TW6 A;  2UXU A;  5D18 A;  1NTC A;  3BTI A;  3VVY A;  3QPL A;  5J1U A;  3VUQ A;  3Q0V A;  4AUX A;  2DA7 A;  5EGO A;  2YU9 J;  5HAW A;  2K9Q A;  3VW1 A;  2DA3 A;  2HOS A;  1IJW C;  3KKC A;  3QKX A;  2COB A;  2QKO A;  3RZD J;  4A3E J;  1D5Y A;  2HOT A;  3BHQ A;  2EZK A;  2DMN A;  5FHP A;  3LSR A;  4L62 A;  1Y1V J;  2JWT A;  3ZQG A;  2DMQ A;  3QBM A;  3HOX J; 
#chains in the Genus database with same CATH topology
 4BNC A;  4CGR A;  2KLO A;  5IYD J;  3PFI A;  4FX4 A;  3O60 A;  5LGN A;  2DMU A;  3I4P A;  4KWA A;  2R7D A;  4MQ9 F;  2DA1 A;  2ZOZ A;  4BE0 A;  1Z3X A;  2MH2 A;  2PG4 A;  3HKZ A;  3IL2 A;  1I27 A;  1YIJ I;  1BI2 A;  2R0Q C;  3N05 A;  3F72 A;  5GTH C;  2O03 A;  2V9V A;  5L3E A;  1V4R A;  1AU7 A;  2MD0 A;  1EKE A;  1FMV A;  1IN7 A;  2KP6 A;  2UXI A;  2Z1D A;  1U0J A;  2DMT A;  4HQE A;  1R1U A;  3QPS A;  2PLY A;  1B9N A;  1HST A;  1IV8 A;  4GYG A;  2A6H F;  1HW2 A;  4N0B A;  2HOE A;  5HDK A;  2XF7 A;  4XKC A;  1A35 A;  2H8W A;  3G1M A;  2XV4 S;  4XN0 A;  4U9N A;  4HNU A;  3WE3 A;  2LY9 A;  4LJZ F;  4MFE A;  1U5T A;  1YOV B;  3AQT A;  1AA7 A;  2CUF A;  3FMQ A;  2HXO A;  1LUJ B;  3JCU C;  2KL4 A;  3K4M A;  2BHY A;  5LHI A;  4HZF A;  3ECO A;  3SXY A;  3G73 A;  2FD5 A;  1OFC X;  2PFB A;  1H8A C;  1FBQ A;  2CGP A;  1OJL A;  5KCM A;  4BBS J;  5D1R A;  1IRX A;  2E7X A;  4P55 A;  1R58 A;  5EEA A;  3K69 A;  5FRO A;  1OCT C;  4A3B J;  3FDY A;  5FO5 A;  4GCL A;  2FJI 1;  3LST A;  1MNM C;  2DQR A;  3P5J A;  3P9K A;  1LPQ A;  1DU0 A;  3B73 A;  1ETO A;  1YO5 C;  1WFX A;  2OCC H;  1T38 A;  3CDH A;  2EFP A;  1O7L A;  2X48 A;  5J8F A;  4OAZ A;  4HAM A;  5DM7 F;  4KUM A;  2OF7 A;  1FY7 A;  2ZME A;  3BG3 A;  2A2F X;  3G1O A;  3ABT A;  1IXS B;  1RET A;  2DTR A;  1K6O A;  2R5Y A;  3TDU C;  5JFR A;  1WCM J;  4OMY A;  4NC8 A;  1U9O A;  2EIL H;  3KYD B;  2CH0 A;  1PP7 U;  5LEK A;  4KT5 C;  1HCR A;  2R5Z B;  2P7C B;  5L3D A;  1POG A;  4IOA F;  2OD5 A;  2Q0O A;  2WAD A;  1J7K A;  2KIM A;  3WE2 A;  4EJO A;  3C07 A;  2ZXI A;  4OU0 A;  5A2Q Z;  3JRI A;  3PSF A;  1KGS A;  3TO7 A;  1IN4 A;  2QLZ A;  3BQZ A;  1B6A A;  1IN5 A;  3VW0 A;  2CO5 A;  1R1T A;  1QZY A;  3TL4 X;  2VQL A;  5E1X A;  3DU6 A;  5M3M J;  5E3O A;  3NAR A;  2UXP A;  3BZK A;  4D9J A;  2L7M P;  2W4S A;  4BQA A;  3DU5 A;  3OYL A;  4ZDP A;  3KYL A;  1KYW A;  2D5V A;  1ENH A;  5ILS A;  1ERD A;  1UI6 A;  1X1D A;  1IAW A;  1Y1W J;  1FSH A;  2BXY A;  2QUF A;  1LDJ A;  2EFN A;  2LLK A;  3FMR A;  2OC6 A;  5JI6 A;  2KRH A;  1R6R A;  2DYR H;  4LMY A;  2R7R A;  1MSF C;  4EM2 A;  5J8C A;  1JJ8 C;  2NP5 A;  3K7A J;  3LSJ A;  4A0X A;  1LFP A;  4U87 A;  1A5J A;  3MFK A;  1OR7 A;  2DA4 A;  1Y0N A;  4RB0 A;  5FKL A;  3WTW C;  3GTL J;  4IZZ A;  2VQC A;  2YSR A;  5FFX A;  2VBX A;  2HQN A;  3FRQ A;  2QCO A;  1T95 A;  1QNT A;  2V79 A;  3CUO A;  5EGO B;  2OZ6 A;  1FEX A;  2V9K A;  2NS8 A;  2GFN A;  2DOA A;  2QZ8 A;  5FGL A;  5HOO A;  3GME A;  3ESW B;  3BLY A;  2A3S A;  2A5Y B;  3JR9 A;  2WAE A;  3BCA A;  1R7J A;  1KU2 A;  1U5T B;  2COM A;  1TBX A;  1HA8 A;  3AG1 H;  4IJA A;  3T8R A;  2I5U A;  3K4N A;  3K2Z A;  3WTX C;  1UFM A;  2W53 A;  4HF2 A;  5EDN A;  3I4N J;  4CCO A;  1YS7 A;  1W0U A;  4D7N A;  1OPC A;  2DN0 A;  5ICE A;  2Z33 A;  2K9S A;  1ZGJ A;  1QVU A;  4IEJ A;  2OAZ A;  3U2R A;  5E20 A;  3JTH A;  2XF5 A;  1I3Q J;  3O8H A;  1YW7 A;  5CJ9 A;  4AYB A;  4DZJ A;  3J7A Y;  2M34 A;  4ZZL A;  2O9L A;  1RI7 A;  2A07 F;  2L7F P;  3U9G A;  1LEA A;  3WOD F;  1DGW Y;  2B0L A;  4A6D A;  1UAA A;  1GVD A;  2L7K A;  4OAY A;  2O3F A;  3QAH A;  3V78 A;  2E34 A;  4A2U A;  1B9M A;  2BGC A;  4IRI A;  1WH7 A;  4XNF A;  3BTJ A;  3ANG A;  3QRF F;  4ZZD A;  4W97 A;  1F1Z A;  2P0W A;  2KPM A;  1U78 A;  2HU9 A;  4XSX F;  3E0J B;  5F0C A;  4GDF A;  1ZHF A;  3T0Y A;  3OYN A;  4RBO A;  2ZCN A;  4BL0 B;  2V1N A;  3BG6 A;  3HTA A;  4EM0 B;  4XLP F;  3HXL A;  5TJJ A;  3ROU A;  2G7S A;  2YVE A;  2ELH A;  2EZH A;  3WG7 H;  2KIU A;  1J75 A;  2OER A;  1HW5 A;  3S1Q J;  4BEH A;  1UCR A;  4M3E A;  4N9H A;  5JVG F;  4JNN A;  1MBE A;  3WTU C;  2H1K A;  3LL7 A;  4PZJ A;  4JQF A;  4AVZ A;  4D1Q A;  3UKG A;  4IRV A;  2WB1 N;  1L3L A;  2F4I A;  3I56 I;  1JGS A;  2TCT A;  3VOE A;  3J81 K;  4BDZ A;  4BXX J;  4ITV A;  1J9I A;  3CO6 C;  2EIJ H;  4IRG A;  2MSY A;  5KVR A;  5B1A H;  5K7Z A;  3IV5 A;  3KX2 A;  3KIO A;  3F6V A;  4BE1 A;  1P6R A;  3V8J A;  1ACI A;  2GA1 A;  3K2A A;  3S2H J;  4RB3 C;  2VOO A;  1UG0 A;  1KYZ A;  1S7O A;  5FKN A;  4BJT A;  3VVX A;  2DJN A;  3GUD A;  3L00 A;  5KAI C;  3BJB A;  1O7F A;  2F5D A;  4UVC A;  3L2U A;  1VQK I;  3HOT A;  2WWY A;  3OSF A;  1S6L A;  2LKX A;  1W5S A;  4PK4 A;  4BJ6 C;  5HVQ C;  1GLN A;  5LRS A;  3MNL A;  4A3F J;  3M3Y J;  1G3T A;  5HNF A;  5FD5 A;  4MK6 A;  3VB2 A;  4HF1 A;  1X4O A;  1T33 A;  1IO2 A;  1XTA A;  2DT6 A;  3DKW A;  4RAG A;  1T39 A;  3PJR A;  4DYC A;  5FD6 A;  3H0D A;  1FTT A;  5C4X J;  3NI7 A;  3HRT A;  3CJR B;  3M9A A;  3DF8 A;  4BHC A;  5LLQ A;  5GAH J;  3IH4 A;  1R22 A;  2XPV A;  2W82 A;  2KJC A;  3A02 A;  1FOW A;  4M73 A;  4PGG A;  1VFC A;  2Y48 A;  4K2E A;  1H89 C;  5EZH A;  5DD4 A;  2HKO A;  2RRE A;  3VYR B;  2RNJ A;  2M87 A;  4U9L A;  4Q5S F;  1LVA A;  3CCR I;  3IUO A;  3OWT A;  2ZJP F;  1HF0 A;  5D8K B;  1D0Y A;  3WGG A;  3WTZ A;  4CGZ A;  3OYD A;  4KMU X;  1TTY A;  2DO7 A;  2DT7 B;  5CVI A;  3F22 A;  3GZ6 A;  2W00 A;  2VUM J;  2BZT A;  4Z6Y A;  4A3M J;  3FXM A;  2BVL A;  3VSK A;  1IRG A;  3S5R A;  1ETV A;  3HUG A;  5IP6 A;  3CCU I;  5IY5 H;  3O6B B;  3V42 A;  2R7S A;  2DYS H;  4P96 A;  2GWR A;  2ZBK A;  2XAQ A;  1B59 A;  3DBR B;  3HSR A;  3FXL A;  1AKH B;  1B72 A;  1OCC H;  3JSJ A;  3MZH A;  1IC8 A;  3MN2 A;  5HDG A;  2EBI A;  2GXG A;  2VJJ A;  4G7Z F;  4CCM A;  2LY1 A;  2HYT A;  1Q1V A;  2CW0 F;  4RLF A;  1NK2 P;  4RMN A;  2STT A;  3C1D A;  5C44 J;  1JKO C;  1FJL A;  5H9T A;  3QWL A;  3E5U A;  1QZE A;  2WV0 A;  4XOT A;  4CCL A;  1IDZ A;  1U3E M;  2JA6 J;  2EIK H;  4UHT A;  4JYK A;  4G6D A;  5GPC A;  2CQQ A;  3GWZ A;  1S5L C;  4XR6 A;  3LQR A;  5GAG J;  5K7H A;  1LFU P;  1JI8 A;  4FTH A;  3H5R A;  1A36 A;  2V4J C;  3HYI A;  2M2E A;  3ZQC A;  5M5W J;  2J5P A;  2QKL B;  2K9N A;  2R4G A;  2WV1 A;  4P5O A;  3ZMS A;  2CWE A;  4LLL A;  1VF9 A;  3LAP A;  3I59 A;  1AKH A;  2PZ9 A;  1HDD C;  1W36 C;  5D8L B;  2VJI A;  3IRQ A;  3HIM A;  3RKQ A;  2YVX A;  3MAJ A;  1EH8 A;  5JVT A;  3DKY A;  3FM3 A;  3K6G A;  4XON A;  2BW3 A;  3KNW A;  3H35 A;  2P7V B;  2WB1 A;  2HTJ A;  2L9R A;  2BV6 A;  2HKX A;  2L3D A;  4NC6 A;  2WA0 A;  1RNL A;  4ZYA A;  2XC7 A;  4BAC A;  3GEU A;  2M0M A;  2XKO A;  3HTI A;  4DZP A;  2IT0 A;  2OU2 A;  2RDP A;  1MDM B;  3JRH A;  1W5C C;  2BHZ A;  4M74 A;  3LWF A;  5E1W A;  1VND A;  2XDN A;  3M1E A;  2DU9 A;  5EEH A;  3RH2 A;  4XID A;  4PJM A;  4IO9 F;  3E6C C;  3PM1 A;  4MFD A;  2L0K A;  4DOZ A;  3TO6 A;  1WQ2 A;  3RCO A;  2HPM A;  4FX0 A;  2R7V A;  1TLH B;  4GO1 A;  4WXD A;  5J1Y A;  4MIM A;  5IPA A;  2O6G E;  4U0Y A;  1MNE A;  2ZXJ A;  3OIQ A;  2L5Q A;  1BJA A;  3MEX A;  3P7N A;  1ETQ A;  4KIT B;  2ZCX A;  2LTP A;  3SHF A;  4I09 A;  2DW4 A;  2DTZ A;  1FTZ A;  3EDP A;  3HEF A;  5BPD A;  5D5W B;  2HGC A;  2CV1 A;  3F6O A;  2PN6 A;  3RQI A;  4KIB A;  4PFP A;  3QOD A;  3HOZ J;  3NRG A;  3KP5 A;  1SFU A;  3M4O J;  3NRV A;  1V3F A;  3BG9 A;  3L1P A;  4M71 A;  5EJC A;  4YII A;  2ZNZ A;  3V7S A;  4OD5 A;  3ZMV A;  3BCB A;  5JHU A;  2HZT A;  4WX9 A;  4CCN A;  5L3G A;  2CMP A;  2K9L A;  3S1R J;  2LH9 A;  4AWX B;  2AO9 A;  2LY2 A;  3RPU D;  4HLX A;  2FSW A;  3QU6 A;  2M30 A;  2K02 A;  1WZ2 A;  3F23 A;  2HDW A;  2RN7 A;  4JKZ A;  3IRR A;  2WGB A;  4R1H A;  1OR7 C;  1BW6 A;  4C2T A;  2QM3 A;  5L3F A;  1W4M A;  2KDO A;  3HSF A;  2VJ4 A;  2KKO A;  2IS6 A;  2TDX A;  1LFB A;  1W0T A;  1CF7 B;  3EYI A;  2XRO A;  4A3C J;  3ZXS A;  3PSI A;  1EF4 A;  2HTS A;  4AM3 A;  1CQT A;  3F8N A;  2JPB A;  1VQ6 I;  4N9I A;  2LFB A;  3K4J A;  4UUV A;  4L5E A;  2M4G A;  4NEL A;  3S16 J;  1NHA A;  3PUF A;  2CS3 A;  3QPT A;  3F1B A;  5A2Q K;  4BBR J;  4IPA A;  4F7Z A;  1J5Y A;  4D7M A;  2VOP A;  3WG9 A;  1VTN C;  2IEK A;  1AOY A;  4F52 A;  3DBH B;  2M9H A;  2E71 A;  2KMU A;  1DUX C;  2OQG A;  3CF5 F;  4KN4 X;  2L9N A;  3OYE A;  3HL2 A;  3Q0V A;  2VAS A;  3ABM H;  3VYS B;  2DA3 A;  3KKC A;  1UJ8 A;  1O3Q A;  2ACJ A;  2COB A;  4ZYE A;  5TGT A;  1Q1H A;  3RZD J;  1R00 A;  1J2X A;  2NXN B;  1F4K A;  2EZK A;  3RDI A;  2R7U A;  3LSR A;  1Y1V J;  2XHK A;  5LEJ A;  5M5X J;  1I39 A;  4XSZ F;  4RDU A;  1PYV A;  1P9Q C;  2JRM A;  2VKE A;  3ASN H;  1SEU A;  4KYW A;  3REO A;  1IN8 A;  1JHF A;  2V1U A;  1FPQ A;  3EPZ A;  2WTE A;  3BJO A;  3RKW A;  4AD9 A;  2VI6 A;  4AIK A;  3L7W A;  1E3O C;  4ANJ A;  5KK1 A;  2WBM A;  2ZME C;  3WHB A;  2NS0 A;  2GXB A;  3MKL A;  2R5Y B;  2RGV A;  2AQF A;  4QIW N;  2QQ9 A;  4ON0 A;  2H94 A;  2WY8 Q;  1RUN A;  2DFH A;  3KP2 A;  2JUC A;  3JAM Z;  1YX3 A;  1LVK A;  5EEG A;  3LHQ A;  4S05 A;  3EQL F;  1N78 A;  1F36 A;  4ESB A;  4LFU A;  2ZO4 A;  1Y8R B;  2E2I J;  5E1Z B;  2ESN A;  5DCM A;  3VPR A;  2CUZ A;  2F5V A;  4PSW A;  3CMA I;  4BXF A;  1DP3 A;  2VPR A;  2IS1 A;  4I99 C;  2P4W A;  2V6C A;  4A3G J;  4FE4 A;  4MQV A;  3IHU A;  3VIB A;  3PUB A;  4BJ5 C;  3KEY A;  2FNA A;  2QSF X;  3CP8 A;  4RAZ A;  1VQN I;  2MGQ A;  3R0A A;  3IUV A;  3FHN A;  2OCE A;  2AXT C;  4CA0 A;  4Y15 A;  1WJA A;  4F3Q A;  1R9T J;  2FBK A;  4V19 K;  1Z67 A;  3GFM A;  4I02 A;  3ZN0 A;  1HKS A;  2VB6 A;  1ZG1 A;  4Y4R A;  1OCR H;  1YE9 A;  5HSZ A;  4BUP A;  2PJP A;  1JT6 A;  2E36 A;  3HZJ A;  1MJA A;  4XBF A;  3ZMZ A;  3SDB A;  1TNT A;  5FLV A;  2DPU A;  3H36 A;  4FIS A;  2E60 A;  3ERM A;  1MBG A;  3BR3 A;  5IT3 A;  4Y52 J;  3ULQ B;  3GW2 A;  3M1C A;  5F27 A;  4IXA A;  4M3F A;  2DT5 A;  1G2H A;  4EJV A;  2BY0 A;  2FXA A;  3DCF A;  2MBF A;  4MNU A;  1TQP A;  3JRC A;  3M8E A;  2ZKZ A;  1BI3 A;  2VE9 A;  1HKT A;  2NVQ J;  3A01 A;  1WJ5 A;  3QQA A;  1XSD A;  4DGW B;  3IKV A;  2IAI A;  1ZN2 A;  5BNG A;  4A6E A;  3BR2 A;  3LMM A;  1SAU A;  4EJW A;  3VOK A;  4I01 A;  1YRN B;  2A6E F;  1UB9 A;  3FXO A;  4AF5 A;  2Y9Z A;  4G9Y A;  5D5U B;  1B1B A;  4U88 A;  2B7E A;  4BH9 A;  1ZRF A;  2AS5 F;  5D5V B;  1HOM A;  1IN6 A;  2F4O B;  4UB6 C;  3I53 A;  4C2U A;  4ACI A;  4UVB A;  4NC7 A;  4G12 A;  4CH7 A;  4NUB A;  4II3 A;  1KA8 A;  3LSP A;  5BS6 A;  2F6C A;  4L9J A;  3V6G A;  4Y7N J;  2DDA A;  2ZY9 A;  4PJN A;  3DQV C;  1ZG3 A;  3CDI A;  5FLX Z;  3OSG A;  4HQM A;  3QP6 A;  2MLG A;  2DA6 A;  2IA2 A;  4UY8 I;  3FKJ A;  4NQW B;  2WUI A;  1HLV A;  1SD7 A;  5FRM A;  3BPX A;  3BJA A;  1W7P A;  2E19 A;  1S72 I;  2DA2 A;  3ZGK A;  3S93 A;  4G7O F;  2VLA A;  3TKY A;  2EIM H;  1D8J A;  2LF8 A;  4EEF G;  1Y8Q B;  4II2 A;  4KA4 A;  3FXK A;  2ME6 A;  1TNS A;  4HX7 A;  1H9T A;  4XLH A;  1X1P A;  3M8J A;  2K4J A;  3G4S I;  1I5Z A;  4J01 A;  3K70 D;  3M7G A;  3S3M A;  1ETW A;  1DDN A;  2IA1 A;  5D6F A;  1VQ7 I;  2UWM A;  2FQ4 A;  3ZRG A;  1A31 A;  2BEO A;  2R7O A;  4UXN A;  4EGZ A;  3ZQ7 A;  4BAY A;  1Y39 A;  1Y6I A;  3WTS C;  4BY7 J;  2J5O A;  1RZ4 A;  3KZY A;  3I59 B;  3PAS A;  1SD4 A;  4FHT A;  3B81 A;  4JOM A;  3UR3 C;  1F43 A;  1ZTR A;  1WVR A;  3OOP A;  1N75 A;  2LYC A;  4OIO F;  2UXO A;  5DYM A;  1S3J A;  1WSU A;  1XPX A;  2M0C A;  2XRN A;  2XVC A;  2IRF G;  2QSH X;  1NG6 A;  2FQ3 A;  2CFX A;  2MH9 A;  3OS2 A;  3KZI C;  2UXX A;  4BYY A;  4B4C A;  2IA0 A;  1RKW A;  1FMW A;  1P4A A;  1YW8 A;  3LA3 A;  4JK1 X;  1UG2 A;  3HE0 A;  1ZG5 A;  1RR8 C;  4D0P A;  1MBF A;  4MEX F;  4B09 A;  4IF4 A;  4EJU A;  4A93 J;  1YQA A;  3O3K A;  3IWZ A;  2XGD A;  2CQN A;  5GP9 A;  2XAG A;  3CUQ A;  2X85 A;  2A69 F;  2PX9 A;  3BRO A;  5HLI A;  2M5W A;  4XLN F;  4M3D A;  3ZMT A;  2DJI A;  1FBS A;  2Z99 A;  1FX7 A;  4ENN A;  3BP8 A;  3HM5 A;  2V57 A;  1N25 A;  2LBF B;  3GX4 X;  1JKP C;  2HPI A;  3D1N I;  1OYW A;  1QPI A;  2ZJ2 A;  2R7Z J;  2LKS A;  4C30 A;  4A3K J;  3F8F A;  2X1D A;  2EZI A;  3CCL I;  1GVJ A;  3NAU A;  4LIV A;  2CQX A;  4NB5 A;  2HFH A;  5GAD J;  2LG4 A;  3HRU A;  4BQN A;  2M45 A;  3A01 B;  1QZZ A;  4B43 A;  3OYH A;  2KRC A;  2IVM A;  1BN5 A;  3HGY A;  3AG2 H;  2ETH A;  4JBA A;  2MYS A;  2CJJ A;  3DXJ F;  2HVR A;  1D3Y A;  2FX0 A;  2CFO A;  4F55 A;  2LKP A;  2FML A;  1K7A A;  3PPB A;  2E1O A;  1CGP A;  1YRN A;  4HLY A;  3ABL H;  3G7R A;  2G7G A;  4PCQ A;  1T2K A;  2PJR B;  3H3U A;  3QPH A;  3FXJ A;  3ABK H;  5DCF A;  3J7Z I;  3BWG A;  3W6V A;  2LNB A;  5BOX A;  1HC8 A;  4ZYD A;  4PDK A;  2CQK A;  3ML6 A;  1JUM A;  3Q3S A;  3COL A;  2V6E A;  2FEZ A;  4Y3O A;  2PBI A;  2JSP A;  5DDG A;  5ILU A;  1I6H J;  1X3U A;  3JW4 A;  4I98 B;  4FQG A;  3JSP A;  2CU7 A;  4XLF A;  3E6M A;  3CO7 C;  2XGE A;  2HZD A;  1D1C A;  3O2P E;  3KP7 A;  3ASO H;  2UZK A;  2P8T A;  2Y2Z A;  3ZCO A;  2X9D A;  2GAU A;  5EG0 A;  5C3E J;  1DGR M;  2M7B A;  3HC7 A;  3RJP A;  3BR1 A;  2JA8 J;  2VBZ A;  1QVT A;  1WJF A;  4B48 A;  3MZY A;  4E70 A;  4AIH A;  1E0E A;  2FE3 A;  3MVP A;  1IRZ A;  1XMA A;  1UI5 A;  4PJJ A;  2O8K A;  1MBH A;  1JE8 A;  4AC0 A;  5LHG A;  1YYV A;  1T98 A;  2LDU A;  4L9N A;  4PJ0 C;  3V7R A;  3KP3 A;  2ISZ A;  2QVO A;  2HI3 A;  5F04 A;  5F0H A;  1W7P B;  3BG5 A;  3A0B C;  3LSM A;  2D2W A;  5K1Y A;  5EG0 B;  4ICH A;  2DPD A;  1R5I D;  2KFD A;  1ITY A;  2EK5 A;  1DPR A;  3HSE A;  2A61 A;  3HJE A;  5B66 C;  2XAF A;  1RR7 A;  3GTG J;  3SZT A;  2K4B A;  4KDP A;  4AIJ A;  1VZ0 A;  2XAU A;  3IAS 2;  1HDP A;  2NVU B;  1JKQ C;  3QOP A;  1O3S A;  3K8P C;  2FRH A;  5AIQ A;  2CG4 A;  3DTE A;  4LK0 F;  1SGM A;  4L9V A;  1FNN A;  1V5E A;  1FP2 A;  2MC4 A;  1BA5 A;  3UNG C;  3WGI A;  2P5L C;  4IOC F;  5CPR B;  1FYL A;  2GLO A;  4I6Z A;  4C3J J;  3EUH A;  3NPI A;  1OLT A;  1HQC A;  3CLO A;  2JSC A;  3J7Y J;  3G71 I;  4BQO A;  4CDG A;  2ZB9 A;  3TGN A;  2MC3 A;  2HQA A;  5HS7 A;  2PQ8 A;  4IHX A;  2FMY A;  2OA4 A;  2W85 A;  1Z9C A;  1I1G A;  2A5W A;  4F92 B;  1SVO A;  1SC7 A;  4A3L J;  5LGU A;  4NN1 A;  1FP1 D;  3OYJ A;  2QEX I;  3U1K A;  2Z16 A;  1X1A A;  2HNH A;  2ZCM A;  3Q9S A;  4PJL A;  2R93 J;  1ZR4 A;  1UEL B;  1SD6 A;  1XSX A;  5CVV A;  5AON A;  3G3Z A;  4OOI A;  2M8E A;  3SWH A;  2F5E A;  1J09 A;  3S1N J;  2NAZ A;  1MMN A;  1STZ A;  4E7L A;  3HTS B;  4KT6 A;  3GTP J;  4HRI A;  1OQY A;  1ZLJ A;  3DTK A;  5IP9 J;  2VOD A;  4LOC A;  1TQI A;  3Q5F A;  2ME0 A;  3QYE A;  1FYM A;  3ANP A;  3HTU A;  4RLQ A;  4A12 A;  1WGX A;  1SFX A;  1R71 A;  4XRM A;  2X6Y A;  5FKM A;  2HEO A;  2JTV A;  3B02 A;  1OKR A;  2O8X A;  3TW7 A;  1BBY A;  3ELK A;  4M3B A;  2P5K A;  2NS7 A;  4M9X A;  3ZR8 X;  3VWB A;  4IHT A;  3H5N A;  5F6F A;  4DBR A;  4ABZ A;  1OCO H;  3GTK J;  4M3G A;  4WWC A;  3TOA A;  1IDY A;  1JJ6 C;  3W3C A;  4DJA A;  3CCV I;  3IWF A;  1RC9 A;  3RPQ A;  5FFZ A;  4GCK A;  4YFK F;  3J80 K;  4KNY A;  2R5Z A;  1E17 A;  2QQA A;  1OCP A;  4B1R A;  4HSR A;  3N4M A;  4OMZ A;  3SZP A;  1Z7U A;  3MKW B;  4BDY A;  3SEQ A;  4EMS A;  3H1C A;  5ICG A;  3A2K A;  1GXQ A;  1K79 A;  5J1R A;  2QEN A;  3PIO F;  2NRA C;  2DOD A;  3WU2 C;  4O6J A;  2JA5 J;  3PNV A;  2EPF A;  1ZAR A;  3SYT A;  4CUG A;  1O3R A;  2XDV A;  3K10 A;  2KIQ A;  2VN2 A;  4CZC A;  2IS2 A;  3R0J A;  4LLN A;  1MJB A;  3RKY A;  3K4C A;  3LAJ A;  1U8B A;  3H9J A;  3PFY A;  1TWF J;  3FIW A;  2Z5U A;  5E3N A;  1R5G A;  1EJ9 A;  3TED A;  4GGG A;  3LNQ A;  4YIF A;  4R79 A;  2CQ7 A;  4ZTJ A;  1K78 A;  5TRD A;  3V8K A;  3CDL A;  2WC2 A;  3AG3 H;  2K40 A;  2IGO A;  3CCM I;  5FMP A;  1FSE A;  1T8I A;  2L7Z A;  2O7O A;  3TW6 A;  3F3X A;  5J4V A;  1NTC A;  2KRF A;  3QPL A;  3VUQ A;  3F9K A;  2O5R A;  1EH6 A;  2DA7 A;  1RIO H;  3VW1 A;  2ZSI B;  2BY3 A;  2QKO A;  3ABU A;  1D5Y A;  3BHQ A;  3FBI B;  5FHP A;  2ZC2 A;  2DBB A;  1YS6 A;  4XKW A;  2Y0M A;  2JWT A;  4ZJZ A;  2DMQ A;  3HOX J;  1BC7 C;  4HDV A;  5FLX K;  4M6Y A;  2VT2 A;  5K7F A;  4P1W A;  3SEZ A;  1S8N A;  3I3L A;  3BNI A;  2STW A;  4B44 A;  2OUM A;  2H8R A;  1VI0 A;  1XGS A;  3AL0 C;  2L4A A;  2MD5 A;  4NQW A;  3OS1 A;  3OYI A;  2LRE A;  5AQC A;  3BJ6 A;  2K9M A;  1GDT A;  2YX7 A;  2RC4 A;  4RM2 A;  1HKQ A;  1ULY A;  1UMQ A;  3MZ8 A;  1HBX G;  4B3X A;  4RAF A;  5AIP A;  4A3I J;  3CC4 I;  1K78 B;  3BTC A;  1X3Z B;  4FE7 A;  3S14 J;  4D5F A;  4GCT A;  3CD6 I;  5KNL A;  5LD2 C;  3OS0 A;  5K5R A;  3L2R A;  4ZH4 F;  1DQU A;  3ONQ A;  3WU0 A;  2IS4 A;  3TMO A;  4HF0 A;  4DYR A;  3HKZ N;  3KYC B;  4JX4 A;  2BBY A;  4MTD A;  3J81 Z;  3BC8 A;  1BIB A;  2X4H A;  5IYC J;  3CWR A;  2W48 A;  1SFO J;  2O61 A;  1RES A;  2RHA A;  2JPC A;  1A04 A;  4PXI A;  1PUF A;  3V8L A;  3HOW J;  4ESF A;  1BR1 A;  1G3W A;  2FNP A;  1WJE A;  4IQ4 A;  3EUP A;  1OCZ H;  2NX4 A;  1ZQ3 P;  3DPL C;  5EF6 A;  3WTY C;  3IKT A;  2HR3 A;  3I9V 2;  4HKU A;  3L2Q A;  2Y69 H;  3K9T A;  3C2B A;  4IVN A;  2F07 A;  2Q24 A;  3K1M A;  3ZQH A;  1GXP A;  4LG0 B;  4IX7 A;  4S04 A;  1KU3 A;  2VKD A;  3E5X A;  3DEE A;  3SZG A;  4ENM A;  3P9C A;  3X2Q H;  1X58 A;  2VPL A;  3ON2 A;  3CMY A;  2QWT A;  1O57 A;  3QYB A;  1Z7L A;  1X1B A;  4RS8 A;  3CJD A;  3EGQ A;  2EFW A;  1QU3 A;  4OD4 A;  2A6T A;  2JUG A;  4ESJ A;  4DQ2 A;  2EV6 A;  1U6G A;  1D8K A;  2XKP A;  3I5U A;  4I0A A;  4E4H A;  4L5I A;  1MZB A;  1TW3 A;  5F1J A;  1QBJ A;  2HYG D;  5CVR A;  5CVJ A;  3DEW A;  3Q0W A;  2YX4 A;  3I4M J;  2CRG A;  2XAH A;  4LLG F;  3BR0 A;  4A5M A;  4G6Q A;  3HB9 A;  2DFF A;  2IGN A;  1NH3 A;  4GCV A;  1TWH J;  2XSD C;  4IHV A;  2XPU A;  3AG4 H;  4ZDL A;  4XL9 A;  3JRE A;  3LA7 A;  2A68 F;  2EV5 A;  2QGU A;  3PO3 J;  5ILV A;  1IXR C;  4WCG A;  1YJN I;  4J19 A;  2IGK A;  4XOR A;  1I3A A;  3AKZ A;  3JRB A;  5L3B A;  4OIN F;  2Y0S A;  5B5E C;  3GYH X;  1R4N B;  2ADU A;  2FA5 A;  3CF2 A;  5H6Q A;  1X19 A;  3DKX A;  3L2C A;  1BL0 A;  3CP2 A;  4HYE A;  3FX3 A;  1XDU A;  2E35 A;  1D0X A;  3DFG A;  1ZH5 A;  1SVL A;  1TT5 B;  3ZQI A;  2OI8 A;  4BU2 A;  2K3F A;  1X4P A;  4HW0 A;  5E8I A;  2YR2 A;  3AQS A;  4F91 B;  1D1A A;  1RPW A;  3TP3 A;  1UHW A;  3HDD A;  4E7S A;  2LRD A;  2IXS A;  2XGX A;  4BQQ A;  1EA3 A;  2QBY A;  3OOU A;  3T8T A;  2MFZ A;  1JXS A;  4ZC3 A;  1T0F A;  4YRV A;  2VKV A;  3KKD A;  2EZL A;  3WTV C;  1MW7 A;  1PJR A;  2E1M C;  2L54 A;  1G6N A;  2ZCW A;  3S32 A;  1VQL I;  5IOY A;  3GFJ A;  2WAQ A;  2FOW A;  4KJZ A;  4RGX A;  1FYK A;  1A6I A;  3CJN A;  3TO9 A;  3OYK A;  5M5Y J;  2PBX A;  1B8I B;  1Z6T A;  1ZEL A;  3CCQ I;  3FXQ A;  3QU3 A;  2EFO A;  2BY2 A;  2Q1Z B;  3BT9 A;  3D5S C;  2DAO A;  4GFB A;  2F48 A;  5CXI A;  4XIC A;  3IH2 A;  2A05 A;  2VBY A;  3BCG A;  1JTY A;  4E7I A;  3L09 A;  4QWQ A;  5M3F J;  3V7C A;  2C6Y A;  1FIA A;  1TW2 A;  1BOA A;  1T56 A;  2RKH A;  2DMP A;  3QP5 A;  3HGG A;  1EH7 A;  5F0F A;  2GM4 A;  4X1E A;  3LOC A;  4LIU A;  4BXU A;  4NHJ A;  1GUU A;  1YJW I;  3OYG A;  2DCE A;  4O3M A;  3FBN B;  3EUH C;  2O0Y A;  4CYC B;  2XPW A;  2I8D A;  1ZAO A;  5BMZ A;  2JRT A;  3RQ4 A;  3FHZ A;  3CC7 I;  2VT3 A;  3FF5 A;  2E5N A;  5DTD A;  3QYF A;  5F64 A;  1MH4 A;  3VOX A;  5E79 C;  3S1M J;  5LRR A;  2R92 J;  3GTQ J;  3FMS A;  5CKT A;  3ERE D;  1E3H A;  3FZV A;  1ZRD A;  1DU6 A;  1IW7 F;  2B63 J;  1Z91 A;  1JTX A;  5E17 F;  2O7T A;  1BI0 A;  4MTE A;  2QSG X;  3RD3 A;  1YHQ I;  2JT1 A;  1WKM A;  3SJM A;  1KZH A;  2CUE A;  4OWR B;  3I55 I;  3KLO A;  3DEU A;  4HST A;  3CCE I;  2XF6 A;  1XC5 A;  3S8P A;  5D5X B;  1MBK A;  1BR2 A;  2LR8 A;  3G6E I;  5DV5 A;  4HDU A;  1ONV A;  3Q0U A;  4E7J A;  1Z3Y A;  1G3Y A;  4CZZ A;  1YI2 I;  4IQJ A;  2Y9Y A;  1K61 A;  1MMS A;  2AQE A;  4ASN A;  2E1N A;  1VQO I;  5C4J J;  1Z6R A;  2DK8 A;  5IT9 K;  4N4O B;  2ZNY A;  2E1C A;  3PL8 A;  2MG4 A;  3HOU J;  5EFY A;  1H88 C;  4HV6 A;  3DWL E;  1P2F A;  1SD5 A;  1VQ9 I;  2CUJ A;  1KQ0 A;  4WF2 A;  1SAX A;  3HOS A;  4X6A J;  5GTI C;  4GRI A;  2DG7 A;  3KFW X;  2VE8 A;  2QIB A;  3FXR A;  3A1Y A;  2ZJR F;  3N97 A;  4XRS A;  4MXM A;  4U0W A;  1R1V A;  1I1S A;  5E18 F;  1K4T A;  2W57 A;  3VSL A;  1BC8 C;  4PSX A;  1TQM A;  4RB2 C;  4XK4 A;  2KHM A;  2X6W A;  3VYU B;  5CQE A;  1FOY A;  2HVQ A;  5IT9 Z;  2WAF A;  3K1P A;  1XS9 A;  2VC0 A;  4DNC A;  1VQP I;  1MD0 A;  3E6B A;  4MEY F;  1BI1 A;  5CXG A;  4LB6 B;  3HTH A;  1LE8 B;  4BE2 A;  2PMZ A;  1BIA A;  1D1B A;  1TP4 A;  3Q9V A;  1UHS A;  2GIZ A;  4Y33 A;  1W7P D;  2R3S A;  3KP4 A;  4OIR F;  3KZZ A;  2HYJ A;  3SFZ A;  4BKX A;  2QBY B;  3K0L A;  4KN7 X;  4AU7 A;  2VXD A;  5L3C A;  2YPR A;  5J47 A;  2W7N A;  3LA2 A;  2EA2 A;  1BM9 A;  2V1D A;  2E2J J;  2GIV A;  3HIF A;  3ZPL A;  3CJQ B;  4KFC A;  1U5T C;  1DP7 P;  1DPU A;  4G7H F;  2B9S A;  4C3I J;  2G9W A;  4RGS A;  1NK3 P;  1P4X A;  3KCC A;  2FOK A;  2QYO A;  1VQ4 I;  2XB5 A;  2EB7 A;  3FM5 A;  4Q48 A;  1S29 A;  1LKX A;  4U0V A;  1K6Y A;  2ISY A;  3RPU A;  3HRS A;  2HDD A;  2CV2 A;  2IGM A;  4YEL A;  3G2B A;  4CCK A;  4E6K G;  2NYX A;  1WI3 A;  5DS9 A;  2AHQ A;  2ZJQ F;  4ZDO A;  2GOX B;  1MND A;  3HPH A;  2IU5 A;  2RQQ A;  1P7J A;  4M6X A;  1SFE A;  1V5F A;  3PIP F;  1Y0U A;  3F21 A;  2ID6 A;  2Q2E B;  2WY7 Q;  1APL C;  4IKF A;  1WHU A;  1YG2 A;  1TC3 C;  2K27 A;  4CXF A;  2ECC A;  5FKK A;  3OIP A;  2GEN A;  1E2X A;  1XB4 A;  2MLK A;  4M6V A;  1MH3 A;  3NQO A;  3RI4 A;  2EFQ A;  5FRN A;  1GHC A;  2LP0 A;  1GT0 C;  1G4D A;  2BE5 F;  1X2N A;  2PMZ N;  2H09 A;  5K58 A;  1Z21 A;  2QQB A;  2B1E A;  1SFK A;  4OIQ F;  3RYR A;  2VXZ A;  3BR6 A;  3GBG A;  4V2G A;  4LG3 A;  3S17 J;  1VQ8 I;  4JP0 A;  3FXU A;  3RIR A;  1ETX A;  3BZC A;  1P4W A;  3GTM J;  1G59 A;  4LIT A;  2DG8 A;  2OTJ I;  1XGN A;  4D5C A;  2HVS A;  3IP4 B;  5CQG A;  3FKI J;  3FWE A;  4XLA A;  2VQG A;  2VJ5 A;  2FBQ A;  3S2W A;  3CRJ A;  1MIJ A;  3H9Q A;  2F5C A;  4XOP A;  2XAJ A;  4YFX F;  3T5X A;  1ON1 A;  1KQ9 A;  1XMK A;  5K5O A;  2KZV A;  4GFL A;  2XAS A;  1BJZ A;  1PP8 F;  4LG0 A;  4EV0 A;  5DD8 A;  2X6O A;  4A5N A;  1MBJ A;  1S7E A;  4M72 A;  2MW8 A;  3GXO A;  4E7Z A;  2Y31 A;  2QWW A;  4XKV A;  3GTO J;  2QA4 I;  5E3L A;  2DXI A;  2UXH A;  4EM1 A;  3WHC A;  3ZQF A;  3F8C A;  1N77 A;  3OY9 A;  3A0H C;  2DOE A;  1MDM A;  4XKB A;  3I71 A;  3CC2 I;  4LB5 A;  3PQK A;  2GOM A;  1JKR C;  2ELK A;  2OJE D;  3F8B A;  5J4Y A;  1WWX A;  2L9S A;  3K1N A;  3LSH A;  4P9F A;  2W24 A;  2K85 A;  2ICW G;  1O4X A;  3NWT A;  1LEB A;  3E7Q A;  3EYY A;  4IL6 C;  1FC3 A;  2X0L A;  5DUK A;  4U7D A;  3BY6 A;  2RQP A;  3CUQ C;  4ME9 A;  3KE2 A;  1U2W A;  4DW6 A;  3M8F A;  3HG9 A;  1XGM A;  2PEX A;  2H6B A;  1GV5 A;  4I7H A;  4O5V A;  4UUT A;  1JUP A;  4Y13 A;  3E97 A;  3T1B A;  4A3D J;  3OL3 A;  5IOZ A;  2QKM B;  2R7W A;  3ISP A;  5J3L A;  3OYM A;  3KZ9 A;  6PAX A;  1OIS A;  3ZMU A;  4ZTF A;  3MMY B;  4IRH A;  2BY1 A;  4FET A;  2PMH A;  3GZN B;  3VFZ A;  3HTJ A;  1WJB A;  4CYC A;  4HBL A;  2Z3Y A;  2DI3 A;  2M7A A;  3PQJ A;  2HDC A;  3HRM A;  1W1W E;  4I76 A;  2BOL A;  4FAS D;  2H1L A;  2YUS A;  2W84 A;  4ZYG A;  4UDS A;  4RGR A;  5HS8 A;  1QA6 A;  4UB8 C;  1BR4 A;  1QGP A;  1YW9 A;  2G7U A;  2LBF A;  4AUX A;  5EGO A;  5HAW A;  4NNJ A;  2HWV A;  3QKX A;  1IJW C;  1D0Z A;  3GF2 A;  2ZXH A;  3LFU A;  4KIF A;  2AXL A;  4A3E J;  1IRF A;  3NS4 A;  3CTA A;  3C18 A;  1X1C A;  4L62 A;  2X51 A;  1FBU A;  4ENJ A;  3ZQG A;  5GAE J;  3VVY A;  1H9G A;  4XRF A;  5F1R A;  4A0Y A;  2V1X A;  4GFK A;  1QQI A;  1BW5 A;  2Q2E A;  4HPQ A;  4CSW A;  2BW3 B;  2K5C A;  2W25 A;  3DV8 A;  4HNV A;  5ED4 A;  4IHW A;  4XLC A;  4UVA A;  3GZ5 A;  4XLE A;  3H3V K;  3OMY A;  2NNY A;  3CCJ I;  4OIP F;  2IJL A;  1R23 A;  3GVA A;  4C3H J;  2L4M A;  3TBI A;  4X0G A;  5JHF A;  3JAM K;  3VTI A;  1IUF A;  1ZGA A;  5CW8 A;  2FU4 A;  1MKM A;  3F0C A;  5JLX A;  1X2M A;  2VON A;  2ZME B;  5IP7 J;  4H4K C;  2D1H A;  2ESH A;  1WRJ A;  5HBU A;  4XRS G;  3PNT A;  3KPH A;  5D4R A;  1KU7 A;  1TL8 A;  2BVM A;  4P9U A;  3WTT C;  1LE8 A;  5CLS A;  2FUG 2;  1MSE C;  4XMY A;  3HOV J;  3I58 A;  2HS5 A;  3DP7 A;  1W36 D;  2XGC A;  2CV0 A;  2KIS A;  3VVZ A;  3D5R C;  1P7I A;  5JLW A;  3A03 A;  1XMX A;  1GV2 A;  1IUY A;  3GTJ J;  2JN6 A;  2HYF A;  4HV5 A;  5D19 A;  2CW8 A;  2NNN A;  1T08 B;  4MLO A;  5DCM B;  1AWC A;  4CCJ A;  4HOB A;  2B3W A;  3TDZ C;  1B4A A;  4KIG A;  1JGG A;  4KMF A;  1OYI A;  2VIX A;  4N4N B;  2F2E A;  2K7L A;  1TWA J;  1S9H A;  4BS9 A;  4HEA 2;  3VDX A;  3J7A O;  1IG7 A;  4YFN F;  5J40 A;  4UNO A;  3ZN1 A;  4JL3 A;  2Z9O A;  1QHH D;  3RSN A;  2TRT A;  3A4C A;  4GXO A;  4V2F A;  1TWC J;  4UV8 A;  3CLQ A;  5FB2 A;  2W1O A;  3I54 A;  1K4S A;  3I64 A;  5ERI A;  1I6X A;  2R7Q A;  3ZQL A;  2DFI A;  1FIP A;  3C2H A;  3VYT B;  4U7B A;  3OYC A;  4BY1 J;  3E1S A;  3RYP A;  2YS9 A;  4QPQ A;  4DBQ A;  2LD5 A;  2EQR A;  2KQR A;  2E7W A;  4Z2Y A;  2ELJ A;  4DIQ A;  3DPU A;  4NBQ A;  2PMU A;  3CJT B;  3ZMD A;  2GUH A;  4W1U A;  2JVH A;  2WAQ N;  4QSH A;  3K4K A;  3KEQ A;  2ID3 A;  2Y75 A;  4ETS A;  2HOA A;  4WXC A;  2GZW A;  3U21 A;  4KIS A;  2DK5 A;  2V7F A;  2KIF A;  2XUB A;  3H9G A;  1ZYR F;  1CF7 A;  1C0W A;  2JMW A;  5D4S A;  3CCY A;  1QHG A;  4EAT A;  3R6S A;  3E3V A;  3F8M A;  2P5V A;  5CVU A;  4QTR A;  3JRG A;  1U9N A;  3JRD A;  5DAJ A;  1K83 J;  5JR3 A;  4LGW A;  4IHS A;  2ZOY A;  3LSK A;  3LSI A;  4UV9 A;  4YG2 F;  4CYD A;  5FGM A;  3HHG A;  1WJD A;  2F4M B;  4Q4Z F;  4PFO A;  3DBL B;  1PDN C;  1ZRC A;  3LJL A;  2DFE A;  5HLH A;  2XB0 X;  4R8H A;  1JT0 A;  5KAF C;  1UST A;  3OYB A;  4RM3 A;  3E5Q A;  3COA C;  1QO0 D;  2Y0S N;  3BRU A;  2NP3 A;  1USS A;  5HS9 A;  1I50 J;  2NOJ B;  4S0H B;  2MAB A;  2M3A A;  1SAN A;  4AYB N;  4BGD A;  3J80 Z;  2RAS A;  1Y56 A;  3RZO J;  3ON4 A;  5DEQ A;  1R5H A;  1ON2 A;  4MHG A;  2JA2 A;  3MD2 A;  1ZK8 A;  3CES A;  2DDB A;  3PNY A;  2F5F A;  2EJR A;  1BOB A;  2NVX J;  1MJ9 A;  3SDG A;  1XSV A;  1MMD A;  5H6R A;  4BEH B;  1YLF A;  1T0F C;  3D5L A;  4XM3 A;  1ZGW A;  3OV8 A;  1XD7 A;  2OV7 A;  2G3B A;  3S3N A;  3NEU A;  3S3O A;  2V26 A;  1MGT A;  1R4M B;  2N8G A;  4L0Y B;  1B72 B;  1NG7 A;  2LVS A;  4EGY A;  3BPV A;  3VOD A;  3DPT A;  1PVE A;  1SMY F;  2BYV E;  3AFH A;  2OBP A;  3HUG B;  5HLG A;  3HOY J;  4UUS B;  3MCZ A;  3JRA A;  2D45 A;  2HKU A;  2Y30 A;  3P9T A;  3TOB A;  4DVY P;  2OTL I;  2LMD A;  1R36 A;  2LOO A;  1UHM A;  5ICF A;  5K5Q A;  2R7T A;  1XGO A;  2KJB A;  4MGR A;  1AHD P;  1LB2 A;  1J0R A;  3MQ0 A;  5DM6 F;  1G8X A;  1LDD A;  2VBW A;  5DUI A;  4J00 A;  2YU3 A;  3HPG A;  3K4B A;  1HW1 A;  2FF4 A;  2H6C A;  2JJ7 A;  4KIC A;  4L18 B;  1JUS A;  1ETK A;  3SQN A;  3C7J A;  2GA2 A;  4H0E A;  2X6X A;  3CZ6 A;  3E6D A;  3OYF A;  2XIG A;  4YZE A;  5B1B H;  5H2F C;  2JK3 A;  3JRF A;  1O3T A;  1ODD A;  4G8X A;  3TP0 A;  5IYB J;  4F93 B;  2K3P A;  2QTQ A;  1IXC A;  3OR2 C;  3VP5 A;  1VQM I;  3SFI A;  3D0S A;  3KP6 A;  2OQR A;  3ZQQ A;  3W2V A;  4BHP A;  1PUF B;  2FJ1 A;  1U8R A;  3EUA A;  3WGH A;  5HDN A;  4A69 C;  2H27 A;  3BOQ A;  1L0O C;  2DA5 A;  5H20 A;  2IP2 A;  4JX5 A;  1M1E B;  1UZC A;  3FK7 A;  1Z0X A;  1FOK A;  1D5V A;  2RVC A;  1SMT A;  1MMA A;  3L2W A;  3PO2 J;  2HXI A;  1EV7 A;  4B8X A;  2P6S A;  4JX6 A;  2UXN A;  3H5A A;  3LQQ A;  4HG2 A;  4M9S A;  3MKZ A;  1VQ5 I;  1ZLK A;  4HX8 A;  2L9V A;  3H92 A;  3ZOB A;  2LC2 A;  3DPJ A;  3IH3 A;  2R7X A;  5KHD A;  4M9Z A;  3NNR A;  3K70 C;  3L9F A;  3CCS I;  3H3Z A;  1YJ9 I;  1YIT I;  4B47 A;  3OR1 C;  3BG7 A;  1P92 A;  3O8G A;  3QOE A;  4HX4 A;  2YVH A;  2LSO A;  3HHH A;  4PUS A;  5FLM J;  2HQR A;  1HXD A;  3GFI A;  2BXZ A;  2RAE A;  5E3M A;  2OZU A;  1FT9 A;  4GYI A;  4LD5 A;  3GZI A;  1YIO A;  1WH5 A;  1ORK A;  1YTY A;  4RAY A;  2ZSH B;  4G6T B;  3B6A A;  5C4Y A;  2VL8 A;  3BZ6 A;  3KLN A;  3LSG A;  1FZP B;  1LNW A;  4A3J J;  3S15 J;  2KDZ A;  1V55 H;  1IZ1 A;  3GO5 A;  3VEP A;  4RA2 A;  5TIS C;  4EQQ A;  2ZFW A;  4DYQ A;  1FWZ A;  5ICC A;  1KU9 A;  1FLI A;  1IV6 A;  3C2G A;  3RTR A;  3WU1 B;  4FT8 A;  3EET A;  2IBD A;  1XX5 A;  9ANT A;  3W2W A;  4L9T A;  2M1B A;  4HA8 A;  2VC1 A;  3NWS A;  5HNH A;  2JA7 J;  4PGH A;  3OIO A;  1J59 A;  3ZP5 A;  1HSJ A;  1TT0 A;  2L01 A;  2LK2 A;  2HQ5 A;  3G1L A;  1X3W B;  2NVT J;  2G0E A;  3E7L A;  3S2D J;  5FKO A;  3AL0 B;  4NDL A;  4YEJ A;  1QPM A;  5EZG A;  1XN7 A;  4UUS A;  4CIC A;  4C2M J;  1WJC A;  1TWG J;  3LWJ A;  3OYA A;  1XCB A;  2KZG A;  5CYV A;  1IGN A;  3CQZ J;  4WIB A;  2D1V A;  2DLL A;  1Z1D A;  4E7H A;  1ZR2 A;  3GLX A;  1MMG A;  3V4G A;  1LDK B;  2EV0 A;  3EUK L;  4L0Z B;  2QOP A;  4E7K A;  4I2O A;  3BQY A;  2V9P A;  2VKH A;  3R60 A;  2GBY A;  2K86 A;  4TV7 A;  2Q8K A;  3M07 A;  4QLC U;  1OMI A;  2JZY A;  5LBQ A;  4FCY A;  1V54 H;  4HNT A;  2XSJ C;  2X1E A;  3RKX A;  1OYY A;  2CW7 A;  2G7L A;  2PI0 A;  2EWN A;  3VW2 A;  2PFV A;  4LK1 F;  2OPT A;  1IF1 A;  2QQ8 A;  3ECH A;  1REP C;  2M8G X;  2L02 A;  5FJ8 J;  1RRJ A;  4IHY A;  3CMM A;  3CME I;  2EIN H;  2FBH A;  4XN3 A;  2NVY J;  2R7F A;  3TQN A;  1F9N A;  2RV8 A;  4EJT A;  2PJR A;  5HLT A;  2CSO A;  3IAM 2;  2UV1 A;  4WK8 F;  4QPO A;  3NXC A;  1ZRE A;  1W5T A;  1ZKG A;  1YX5 A;  2GQQ A;  3FK6 A;  4C9Y A;  2EH3 A;  1WI9 A;  5B3S H;  5BPI A;  2D6Y A;  3BTL A;  2DOF A;  3I0T A;  4ZYH A;  4AID A;  1F5T A;  5LGT A;  2QF7 A;  3C3W A;  3JTG A;  1XDS A;  1E3P A;  4WXH A;  2JQ7 A;  2DQL A;  4BHB A;  3R61 A;  1QRY A;  5F08 A;  3BR5 A;  3K4L A;  1PUE E;  2FBI A;  1KQ8 A;  1XCV A;  1RKT A;  1ETY A;  3BDD A;  5LFA A;  5GPA A;  1Z77 A;  5EYR A;  1FOX A;  5BQT A;  2P81 A;  3JSO A;  4A0Z A;  2NOG A;  4Q47 A;  2JVG A;  3KEO A;  3U1D A;  1H0M A;  3DLL F;  2CYY A;  2ZXW H;  4I0B A;  3L2V A;  3G56 A;  5HOD A;  3T6N A;  2REK A;  4YIR X;  1TZL A;  1V5G A;  3GEZ A;  3IC7 A;  4AVP A;  3W6J B;  3GFL A;  1B8I A;  2ECB A;  2Z2S B;  3KET A;  3W6K B;  4EVI A;  1T6S A;  2IPQ X;  4ENK A;  3FIS A;  4L5J A;  3DLA A;  4CO8 A;  1A6Q A;  2UUZ A;  4B3A A;  1WPK A;  2I10 A;  3MKY B;  4CHU A;  1XG1 A;  4AC6 A;  4RB1 A;  2GXA A;  4C2M A;  2LF7 A;  1Z05 A;  1LJ9 A;  2L2O A;  2KT0 A;  3HBL A;  4MO7 A;  5LHH A;  1LQ1 A;  1S7A A;  2IW5 A;  3H0G J;  1RUO A;  4RGU A;  2E2H J;  5D6E A;  5E8G A;  2P6T A;  3CUQ B;  4XQF A;  3OL4 A;  4Y17 A;  2XRL A;  1YFH A;  5D18 A;  2UXU A;  2G7H A;  3B6C A;  5J6X A;  3R4K A;  3BTI A;  3AAF A;  2EA4 A;  5J1U A;  1JHH A;  3W2A A;  2X1C A;  3LFK A;  2MA3 A;  2YU9 J;  2K9Q A;  2M4K A;  3DTI A;  1R49 A;  2HOS A;  1G3S A;  3P9I A;  3GCM A;  1KON A;  2VQH A;  2ZFU A;  3MWM A;  2HOT A;  4G94 A;  3GLL A;  2DMN A;  2E5Z A;  2RNG A;  1SVM A;  2E1M B;  3QBM A; 
#chains in the Genus database with same CATH homology
 5M5X J;  4CGR A;  4RDU A;  2VKE A;  5IYD J;  5K7F A;  3O60 A;  2DMU A;  3BNI A;  4KWA A;  4GFK A;  2H8R A;  1BW5 A;  1VI0 A;  2VI6 A;  4IHW A;  2DA1 A;  1E3O C;  2ZOZ A;  4HNV A;  3WHB A;  3H3V K;  5AQC A;  3MKL A;  2R0Q C;  2R5Y B;  1GDT A;  4C3H J;  4QIW N;  1UMQ A;  4A3I J;  1AU7 A;  3BTC A;  1IUF A;  2UXI A;  5CW8 A;  2DMT A;  3LHQ A;  4FE7 A;  3S14 J;  3QPS A;  3F0C A;  1F36 A;  5JLX A;  4D5F A;  4GCT A;  1X2M A;  2E2I J;  5IP7 J;  3VPR A;  3G1M A;  5HBU A;  4XRS G;  4DYR A;  3HKZ N;  2LY9 A;  2VPR A;  4MFE A;  3AQT A;  4JX4 A;  2CUF A;  2HXO A;  1LE8 A;  1MSE C;  4A3G J;  4FE4 A;  3VIB A;  5IYC J;  3HOV J;  3CWR A;  2W48 A;  2XGC A;  1SFO J;  2FD5 A;  1OFC X;  3VVZ A;  1RES A;  2RHA A;  1P7I A;  2MGQ A;  3IUV A;  5JLW A;  1H8A C;  1PUF A;  3A03 A;  4PXI A;  1GV2 A;  1OJL A;  3HOW J;  3GTJ J;  1R9T J;  2JN6 A;  4BBS J;  5D19 A;  5D1R A;  4MLO A;  3EUP A;  5EEA A;  5HSZ A;  2NX4 A;  1JT6 A;  1OCT C;  1ZQ3 P;  5EF6 A;  1JGG A;  5FLV A;  4A3B J;  4GCL A;  4HKU A;  4FIS A;  2F07 A;  3C2B A;  2Q24 A;  1MNM C;  1TWA J;  1MBG A;  3ZQH A;  1DU0 A;  3BR3 A;  1ETO A;  1IG7 A;  4Y52 J;  4JL3 A;  1X58 A;  5F27 A;  2X48 A;  2TRT A;  4M3F A;  1G2H A;  3ON2 A;  3CMY A;  2QWT A;  4V2F A;  1TWC J;  3DCF A;  3CJD A;  3EGQ A;  2OF7 A;  3BG3 A;  3G1O A;  3ZQL A;  3JRC A;  1FIP A;  4BY1 J;  2NVQ J;  1RET A;  3A01 A;  2R5Y A;  2YS9 A;  3QQA A;  2LD5 A;  1WCM J;  2EQR A;  2IAI A;  1U9O A;  5BNG A;  3BR2 A;  5F1J A;  3VOK A;  1HCR A;  1YRN B;  4AF5 A;  2R5Z B;  2GUH A;  3DEW A;  4QSH A;  4W1U A;  2WAQ N;  3Q0W A;  2CRG A;  2Y9Z A;  3I4M J;  1POG A;  3BR0 A;  2ID3 A;  2HOA A;  3C07 A;  3HB9 A;  1HOM A;  3JRI A;  4ACI A;  1TWH J;  3BQZ A;  2JMW A;  4G12 A;  3VW0 A;  2XSD C;  3CCY A;  3LSP A;  4IHV A;  2XPU A;  4QTR A;  5M3M J;  3JRE A;  5E3O A;  3NAR A;  3JRG A;  1U9N A;  3JRD A;  2UXP A;  5DAJ A;  3V6G A;  1K83 J;  4Y7N J;  3PO3 J;  2L7M P;  2ZOY A;  3OSG A;  2D5V A;  1ENH A;  2DA6 A;  4J19 A;  1UI6 A;  2WUI A;  1HLV A;  3JRB A;  1Y1W J;  3LJL A;  2E19 A;  2LLK A;  1MSF C;  2DA2 A;  2XB0 X;  1JT0 A;  1JJ8 C;  2Y0S N;  4EEF G;  3K7A J;  1BL0 A;  2NP3 A;  3LSJ A;  2NP5 A;  2ME6 A;  3BRU A;  1I50 J;  4S0H B;  1A5J A;  3ZQI A;  2OI8 A;  2DA4 A;  1SAN A;  4AYB N;  5FKL A;  3GTL J;  3AQS A;  2RAS A;  3RZO J;  3FRQ A;  3ON4 A;  1RPW A;  2QCO A;  3TP3 A;  5EGO B;  1ETW A;  1FEX A;  2GFN A;  5FGL A;  1ZK8 A;  2NS8 A;  3HDD A;  2FQ4 A;  3OOU A;  3JR9 A;  2NVX J;  3SDG A;  2VKV A;  3KKD A;  2EZL A;  2W53 A;  1ZGW A;  5IOY A;  5EDN A;  3I4N J;  1W0U A;  1A6I A;  4BY7 J;  4D7N A;  2DN0 A;  5M5Y J;  2G3B A;  3PAS A;  2K9S A;  2PBX A;  1QVU A;  4IEJ A;  1B8I B;  3B81 A;  1F43 A;  1I3Q J;  2N8G A;  3O8H A;  1ZTR A;  4DZJ A;  1B72 B;  2M34 A;  2O9L A;  2UXO A;  2LVS A;  3BT9 A;  2L7F P;  2M0C A;  4GFB A;  5CXI A;  4XIC A;  1GVD A;  4B4C A;  1RKW A;  3IH2 A;  3BCG A;  1JTY A;  3V78 A;  5M3F J;  1UG2 A;  4UUS B;  3HOY J;  1WH7 A;  3HE0 A;  1FIA A;  3JRA A;  2HKU A;  2Y30 A;  3P9T A;  1T56 A;  3BTJ A;  2DMP A;  1MBF A;  3HGG A;  3ANG A;  4W97 A;  2GM4 A;  5F0F A;  4X1E A;  3LOC A;  1AHD P;  4A93 J;  1U78 A;  1GUU A;  5F0C A;  2XGD A;  5GP9 A;  4RBO A;  2ZCN A;  4CYC B;  2XPW A;  2JJ7 A;  4M3D A;  3HTA A;  1JUS A;  1ETK A;  2G7S A;  2YVE A;  5DTD A;  2EZH A;  1MH4 A;  3HM5 A;  3VOX A;  2OER A;  3S1M J;  3S1Q J;  2V57 A;  4M3E A;  4JNN A;  1JKP C;  2R92 J;  3D1N I;  1QPI A;  1MBE A;  3GTQ J;  2H1K A;  2R7Z J;  4A3K J;  1DU6 A;  2B63 J;  1JTX A;  2EZI A;  3UKG A;  3NAU A;  2O7T A;  2CQX A;  2WB1 N;  4YZE A;  3RD3 A;  2JK3 A;  3JRF A;  3SJM A;  2TCT A;  3A01 B;  3TP0 A;  5IYB J;  2CUE A;  4BXX J;  2QTQ A;  3VP5 A;  3SFI A;  1XC5 A;  1MBK A;  2MSY A;  3HGY A;  5K7Z A;  3IV5 A;  1PUF B;  2LR8 A;  2FJ1 A;  2CJJ A;  3Q0U A;  3K2A A;  4A69 C;  3S2H J;  2FX0 A;  3PPB A;  2Y9Y A;  2DA5 A;  4JX5 A;  3FK7 A;  1K61 A;  2E1O A;  1Z0X A;  5FKN A;  3VVX A;  2DJN A;  3BJB A;  5C4J J;  1YRN A;  3PO2 J;  2HXI A;  3G7R A;  2G7G A;  4JX6 A;  3OSF A;  2MG4 A;  2LKX A;  3HOU J;  5EFY A;  1H88 C;  3W6V A;  3MNL A;  4A3F J;  3M3Y J;  4MK6 A;  1JUM A;  3ZOB A;  4X6A J;  3Q3S A;  2DG7 A;  2QIB A;  3DPJ A;  3IH3 A;  3COL A;  1T33 A;  3NNR A;  4XRS A;  4DYC A;  1FTT A;  3NI7 A;  5C4X J;  4MXM A;  3IH4 A;  1I6H J;  2XPV A;  2CU7 A;  3O8G A;  2YVH A;  2XGE A;  3A02 A;  5FLM J;  1VFC A;  1H89 C;  2RAE A;  4XK4 A;  5EZH A;  5E3M A;  1XS9 A;  2Y2Z A;  3GZI A;  2X9D A;  5EG0 A;  5C3E J;  1WH5 A;  1ORK A;  1HF0 A;  2JA8 J;  3BR1 A;  5CXG A;  3HTH A;  3B6A A;  1LE8 B;  5C4Y A;  1QVT A;  3LSG A;  3S15 J;  4A3J J;  2VUM J;  3MVP A;  2KDZ A;  1IRZ A;  4A3M J;  1UHS A;  1UI5 A;  2O8K A;  1MBH A;  3S5R A;  1ETV A;  4DYQ A;  4AC0 A;  5IP6 A;  1IV6 A;  4BKX A;  2HYJ A;  2IBD A;  1B72 A;  2HI3 A;  5F04 A;  1AKH B;  9ANT A;  3JSJ A;  5F0H A;  3BG5 A;  3MN2 A;  1IC8 A;  5EG0 B;  2EBI A;  4ICH A;  1ITY A;  2HYT A;  1Q1V A;  2E2J J;  1NK2 P;  1RR7 A;  3GTG J;  5C44 J;  4C3I J;  1JKO C;  1NK3 P;  2JA7 J;  3OIO A;  1FJL A;  5H9T A;  1HDP A;  2LK2 A;  2XB5 A;  1JKQ C;  1IDZ A;  2HQ5 A;  2JA6 J;  3G1L A;  4JYK A;  2NVT J;  2G0E A;  1SGM A;  3E7L A;  5GPC A;  3S2D J;  2CQQ A;  5FKO A;  2HDD A;  1BA5 A;  4NDL A;  5K7H A;  2GLO A;  4I6Z A;  1WI3 A;  5EZG A;  5DS9 A;  2AHQ A;  1LFU P;  4FTH A;  4UUS A;  4C3J J;  2IU5 A;  3NPI A;  1P7J A;  4C2M J;  2M2E A;  3ZQC A;  1TWG J;  5M5W J;  3LWJ A;  2K9N A;  2ZB9 A;  1IGN A;  2WV1 A;  3CQZ J;  2ID6 A;  1ZR2 A;  1APL C;  1TC3 C;  1VF9 A;  1AKH A;  4IHX A;  2PZ9 A;  1HDD C;  2QOP A;  2ECC A;  3HIM A;  3BQY A;  3RKQ A;  5FKK A;  2GBY A;  2GEN A;  4M6V A;  4A3L J;  1MH3 A;  4NN1 A;  2LP0 A;  1GT0 C;  3KNW A;  4FCY A;  2L9R A;  1X2N A;  2PMZ N;  2ZCM A;  2G7L A;  5K58 A;  3GEU A;  2R93 J;  3VW2 A;  4AC6 A;  1ZR4 A;  3HTI A;  3BR6 A;  3GBG A;  4DZP A;  4V2G A;  3S17 J;  2OPT A;  4JP0 A;  1ETX A;  2M8G X;  3JRH A;  3GTM J;  1VND A;  2XDN A;  5FJ8 J;  2DG8 A;  4IHY A;  4D5C A;  3FKI J;  3CRJ A;  2FBQ A;  3S1N J;  4XID A;  3RH2 A;  2NVY J;  3GTP J;  5IP9 J;  3PM1 A;  4LOC A;  4MFD A;  2L0K A;  2ME0 A;  4GFL A;  1BJZ A;  3ANP A;  1WGX A;  3NXC A;  5J1Y A;  4MIM A;  5IPA A;  4XRM A;  1ZKG A;  3FK6 A;  5FKM A;  2X6O A;  2EH3 A;  1MBJ A;  1S7E A;  2MW8 A;  2D6Y A;  3BTL A;  1ETQ A;  3TW7 A;  2ZCX A;  2LTP A;  2Y31 A;  4M3B A;  3GTO J;  2DTZ A;  2NS7 A;  5E3L A;  1FTZ A;  3HEF A;  2UXH A;  2QF7 A;  3WHC A;  3ZQF A;  3RQI A;  4ABZ A;  3HOZ J;  3NRG A;  3GTK J;  4M3G A;  3M4O J;  1QRY A;  1IDY A;  1JJ6 C;  5F08 A;  3BR5 A;  3BG9 A;  3L1P A;  4GCK A;  1JKR C;  2ELK A;  1RKT A;  1ETY A;  2R5Z A;  5GPA A;  1Z77 A;  1OCP A;  4B1R A;  5EYR A;  3S1R J;  2AO9 A;  1O4X A;  2P81 A;  3E7Q A;  2NOG A;  4JKZ A;  5J1R A;  3G56 A;  5HOD A;  3T6N A;  2WGB A;  4ME9 A;  2JA5 J;  2REK A;  4DW6 A;  1BW6 A;  1GV5 A;  4UUT A;  1JUP A;  1B8I A;  2ECB A;  1LFB A;  1W0T A;  4A3D J;  4A3C J;  5IOZ A;  3FIS A;  1EF4 A;  1U8B A;  1CQT A;  4B3A A;  1WPK A;  1TWF J;  2I10 A;  3FIW A;  1XG1 A;  2LFB A;  5J3L A;  5E3N A;  4L5E A;  3TED A;  3KZ9 A;  4MO7 A;  4NEL A;  2KT0 A;  3HBL A;  3LNQ A;  3S16 J;  3H0G J;  2E2H J;  3F1B A;  4BBR J;  3HTJ A;  4CYC A;  4D7M A;  3CDL A;  2K40 A;  4I76 A;  5FMP A;  2XRL A;  2IEK A;  2YUS A;  4UDS A;  2L7Z A;  2M9H A;  2O7O A;  3B6C A;  3TW6 A;  2UXU A;  5D18 A;  1NTC A;  3BTI A;  3VVY A;  3QPL A;  5J1U A;  3VUQ A;  3Q0V A;  4AUX A;  2DA7 A;  5EGO A;  2YU9 J;  5HAW A;  2K9Q A;  3VW1 A;  2DA3 A;  2HOS A;  1IJW C;  3KKC A;  3QKX A;  2COB A;  2QKO A;  3RZD J;  4A3E J;  1D5Y A;  2HOT A;  3BHQ A;  2EZK A;  2DMN A;  5FHP A;  3LSR A;  4L62 A;  1Y1V J;  2JWT A;  3ZQG A;  2DMQ A;  3QBM A;  3HOX J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...