3MVPA

The crystal structure of a tetr/acrr transcriptional regulator from streptococcus mutans to 1.85a
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
204
structure length
204
Chain Sequence
b'KNIRKPKQERSIEKRNKILQVAKDLFSDKTYFNVTTNEIAKKADVSVGTLYAYFASKEDILTALLKRYNDFFLTTIFADINSQDSLDRFKKNPKEWLNVLINQLLAAEDKIFHAQIEMLAYAIPQAKALLEEHNNNLKNLTYKCLLYYSDQAANPSFKTLSLVVFDFISALVDELLYHEHTQEEAHQIKKTGIDSLDLIIKSYL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TetR/AcrR transcriptional regulator
publication title The Crystal Structure of a TetR/AcrR transcriptional regulator from Streptococcus mutans to 1.85A
rcsb
source organism Streptococcus mutans
molecule tags Transcription regulator
total genus 84
structure length 204
sequence length 204
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3mvpA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3mvpA02
3TW6A 2D5VA 2YVHA 3FRQA 3CMYA 1RKWA 4X6AJ 1RPWA 2K9NA 3HTAA 3QKXA 1T56A 3BTCA 2EQRA 4MFEA 4HNVA 4IHVA 5CXIA 3GTJJ 3NPIA 4FISA 1JKPC 1F36A 1ETKA 2ELKA 2EZIA 2XDNA 3CRJA 5IOZA 2DMPA 1R9TJ 3HOVJ 1FTZA 1ENHA 1JJ8C 1ORKA 5E3OA 3ZQGA 3BG9A 5H9TA 1OCTC 2YS9A 2G3BA 1MH3A 4QIWN 3Q0VA 4PXIA 3OSGA 1ZR4A 4X1EA 2QOPA 4DYQA 3H0GJ 5E3MA 1H89C 4XRMA 3VVYA 1IGNA 5C4YA 1TWHJ 2W53A 3O60A 3MNLA 2GENA 2IAIA 3GTMJ 2HOSA 2IEKA 1UI5A 2KT0A 2G0EA 2JA6J 4JP0A 1MBEA 4YZEA 4A3IJ 3FISA 4C3IJ 3V78A 2O9LA 1RETA 4A3DJ 2WB1N 2NX4A 3BR5A 4GFLA 5EG0B 2CQQA 2LFBA 1O4XA 3LJLA 3PASA 1GV2A 4ICHA 3CQZJ 3MVPA 3KNWA 5EFYA 2OI8A 5E3NA 4QTRA 1SGMA 1P7JA 3JRFA 1HDPA 4KWAA 3CDLA 2UXHA 4D7MA 3VIBA 3B6CA 2DMNA 4NDLA 2DA6A 1GUUA 5M3MJ 2R5ZB 4V2GA 4XIDA 3LSGA 5EGOB 2Y9YA 2LD5A 1IJWC 3P9TA 4BBSJ 4DYRA 1IC8A 1JKOC 2H8RA 1ZK8A 4IHXA 4M3BA 3BR2A 5M5WJ 2DA7A 1TWGJ 1DU6A 1JKQC 2JK3A 2UXIA 2LK2A 2MGQA 3VW1A 1HDDC 5BNGA 3C2BA 2ECBA 5F08A 3JRAA 1B8IA 3F0CA 1YRNB 2W48A 2X6OA 3GTPJ 4I76A 3Q0WA 4A3GJ 5J1YA 2LP0A 3OSFA 3S2DJ 2ECCA 1MH4A 1TWAJ 1ETOA 2XGCA 4A3KJ 2EH3A 4FE4A 2D6YA 4CGRA 1WH5A 3ZQIA 1Y1VJ 2CQXA 3SJMA 3AQTA 5EEAA 3BTIA 2XSDC 1BL0A 3AQSA 2JMWA 3PM1A 4MXMA 1JTXA 2M0CA 3VPRA 3GTLJ 2RHAA 5HBUA 2JJ7A 2Q24A 4GCKA 2XB5A 2FD5A 3G7RA 4FE7A 4B4CA 1U9NA 2ID6A 1G2HA 1WPKA 1TWFJ 5FKMA 3ZQLA 3LHQA 2LR8A 2B63J 4QSHA 2MW8A 3JREA 1GVDA 3IH2A 5FKOA 1TC3C 3B81A 3DEWA 3VUQA 5EYRA 1QVUA 3HOXJ 5F27A 3HDDA 4W97A 4AC6A 2TRTA 3M4OJ 3VW0A 3WHBA 2LY9A 3BCGA 1HLVA 3VOKA 1U8BA 1QVTA 1U78A 4B3AA 3HTJA 2XB0X 3V6GA 1EF4A 3VVXA 3NARA 2DMUA 1LE8A 3BR0A 1H88C 1XC5A 3HGYA 3Q3SA 1JTYA 3E7LA 1IDYA 4M3EA 3QQAA 4D5FA 4A69C 3FIWA 1MSEC 3VW2A 5F0FA 1K61A 2L7ZA 2NS7A 2ZOZA 3TW7A 3DCFA 3S17J 3C07A 5K7FA 4AC0A 4V2FA 2VUMJ 4JKZA 1Y1WJ 3CJDA 2AHQA 3PO2J 2H1KA 2DJNA 5F04A 1OJLA 4GFBA 4DW6A 2E2IJ 3JRIA 2XPUA 4BKXA 3RH2A 5IP7J 2M34A 2GLOA 5IP9J 3HGGA 4AF5A 3FK6A 2NP3A 1FIAA 1UG2A 3CCYA 3NXCA 3ANGA 3FK7A 3G1LA 1GT0C 2QIBA 1ETVA 5AQCA 4JX4A 4AYBN 4XRSG 2GM4A 4W1UA 2JA5J 3WHCA 1WCMJ 5JLWA 1GDTA 2E19A 2LKXA 4XRSA 2HI3A 5DS9A 2IU5A 5K58A 2WV1A 2E2JJ 2N8GA 1ETWA 3SDGA 4GCTA 1UHSA 5FGLA 1B8IB 1IUFA 4UUSA 5DTDA 2EBIA 1JJ6C 2E1OA 4C3JJ 5IPAA 4XICA 1X2NA 4MIMA 3HKZN 2EZHA 1W0UA 3ZOBA 2Y2ZA 2FQ4A 3IH4A 1ZKGA 5FKNA 3HTHA 1ITYA 2LVSA 1SFOJ 4L62A 3BHQA 4UDSA 3RD3A 4LOCA 3BTJA 2VPRA 1UMQA 3ZQHA 4A3CJ 1AKHA 3S1RJ 1NK3P 1JT0A 1I6HJ 1JGGA 2XRLA 4ABZA 3VOXA 2XPWA 1A6IA 3LSJA 3SFIA 5F0HA 5EF6A 1HCRA 4XK4A 3H3VK 5C4JJ 3BQZA 4Y52J 3S5RA 2O8KA 1FTTA 2LLKA 5GP9A 1HF0A 3O8HA 4A3FJ 2G7SA 5F1JA 2VI6A 4UUTA 3TEDA 2XPVA 3BR1A 2R5YA 3PPBA 1H8AC 3OOUA 1ZGWA 5J1UA 2O7OA 1IV6A 5FLVA 1T33A 1VNDA 2NP5A 1XG1A 2RAEA 2ME6A 3BTLA 1RESA 3I4MJ 1WH7A 2P81A 5C4XJ 1MSFC 3KZ9A 3GZIA 4IHWA 1RKTA 3HOUJ 1I50J 2ZOYA 3HBLA 3OIOA 3HTIA 3B6AA 4M3DA 3JRDA 1JKRC 5FMPA 1NTCA 2HQ5A 5C3EJ 1HOMA 4RDUA 1MNMC 4BY1J 2K9SA 2ID3A 2OF7A 4C2MJ 2G7GA 2F07A 2FJ1A 5D18A 2OPTA 3A01A 1ZTRA 3HM5A 3BT9A 1WGXA 3IUVA 1LE8B 2PMZN 4MFDA 2GBYA 3NAUA 5J3LA 3BR3A 5J1RA 1IDZA 2WAQN 2RASA 2WGBA 3ON4A 2DTZA 1W0TA 1F43A 2JN6A 2K9QA 2O7TA 3T6NA 2DMTA 5IYDJ 1Z0XA 2UXUA 3S16J 5DAJA 1B72A 1E3OC 3GTQJ 2MG4A 2NOGA 4JX6A 2DA3A 3IH3A 1ETYA 3Q0UA 3ZQCA 3A02A 2MSYA 4BBRJ 2ZCNA 2VKVA 2FX0A 4FTHA 1X58A 1AHDP 2QTQA 5JLXA 3BG5A 3S1QJ 4JYKA 3I4NJ 2UXPA 2YVEA 4ACIA 3QPSA 3G1MA 4BXXJ 5E3LA 1ZR2A 1PUFA 3E7QA 4DZJA 2ZCMA 3NRGA 3BG3A 3JRGA 1FEXA 4G12A 3ANPA 4MO7A 5HODA 2EZLA 2EZKA 3L1PA 4A93J 4A3JJ 1VFCA 3VVZA 3JRHA 4C3HJ 1BJZA 1MBHA 2K40A 1VF9A 2X9DA 1OFCX 3LNQA 2X48A 3RZDJ 1NK2P 3NNRA 4UUSB 4A3EJ 5FKLA 3QBMA 3G1OA 1ZQ3P 2XGEA 2M2EA 2NVTJ 2ME0A 4CYCA 4D7NA 4I6ZA 2ZB9A 2PZ9A 2M9HA 5FKKA 4J19A 5IP6A 1LFBA 4GCLA 2QCOA 3JSJA 2CRGA 3CWRA 1JUPA 3GBGA 2WUIA 1QRYA 2IBDA 2QF7A 1AKHB 5M5XJ 4FCYA 1IG7A 2AO9A 3HB9A 3HOYJ 2DG7A 3KKDA 2VKEA 3MN2A 3BRUA 4EEFG 1MBGA 4A3LJ 3GTGJ 2CUFA 3W6VA 5IYBJ 4B1RA 2E2HJ 3M3YJ 2REKA 4Y7NJ 3MKLA 4JX5A 4RBOA 3JR9A 1U9OA 2R5YB 1Q1VA 3HIMA 3G56A 5D1RA 2QWTA 1WI3A 5IYCJ 1VI0A 3D1NI 3O8GA 2GUHA 1FIPA 2CU7A 2I10A 5CXGA 5GPAA 2M8GX 5M3FJ 5IOYA 3TP3A 3K2AA 2JWTA 4DYCA 2DA4A 4M3GA 3HE0A 4NELA 4JNNA 1RR7A 1UI6A 2L7FP 3LSPA 1X2MA 1CQTA 3IV5A 1LFUP 3BJBA 1ETXA 2XGDA 3S14J 5D19A 3GTOJ 3A01B 5HAWA 1D5YA 5CW8A 2FBQA 2JA7J 1TWCJ 2L0KA 3PO3J 1I3QJ 1BW6A 5EZHA 2R7ZJ 4GFKA 2R93J 3COLA 1AU7A 3ON2A 3ZQFA 1MBFA 3GEUA 1B72B 2NVXJ 2YU9J 5HSZA 2HXIA 3S15J 3RKQA 3HEFA 1QPIA 2DA2A 1POGA 2HDDA 1MBKA 1S7EA 1A5JA 3VP5A 2DN0A 4JL3A 4L5EA 1GV5A 2L7MP 4IHYA 3QPLA 4ME9A 4NN1A 1JUSA 5GPCA 4MK6A 2KDZA 2YUSA 1PUFB 2UXOA 3F1BA 5EZGA 2HYJA 3BR6A 2HOTA 2TCTA 2NVYJ 3RQIA 3LSRA 3S2HJ 1BA5A 3S1MJ 4DZPA 2V57A 5EDNA 4BY7J 2R92J 3K7AJ 5FLMJ 5EG0A 2DG8A 3HOZJ 3FKIJ 3LOCA 2OERA 2Y9ZA 1FJLA 2HKUA 2NVQJ 5F0CA 3RZOJ 5FHPA 2L9RA 1K83J 1APLC 2GFNA 4M3FA 4CYCB 2CUEA 3KKCA 3TP0A 1JUMA 1JT6A 1MBJA 2CJJA 5C44J 1XS9A 4D5CA 1Z77A 3A03A 4MLOA 2R0QC 3GTKJ 4M6VA 2HOAA 2R5ZA 1SANA 5M5YJ 2NS8A 2QKOA 4AUXA 5EGOA 2ZCXA 3HOWJ 4IEJA 5K7HA 4A3MJ 3JRCA 3EUPA 2Y30A 4S0HB 2COBA 2DMQA 2HYTA 5FJ8J 2JA8J 2G7LA 2PBXA 3EGQA 1P7IA 4A3BJ 2Y0SN 3S1NJ 3NI7A 1DU0A 3DPJA 4HKUA 1ETQA 2DA5A 1IRZA 3JRBA 3BQYA 3UKGA 3BNIA 2Y31A 1OCPA 5K7ZA 1YRNA 3LWJA 2LTPA 2DA1A 9ANTA 1BW5A 2HXOA
chains in the Genus database with same CATH superfamily
3FXKA 3VB2A 5TISC 4M71A 1XSVA 2HTSA 3IRQA 2XF7A 1RPWA 2K9NA 2EQRA 4HNVA 1UHWA 1USSA 3CESA 1YS6A 3PQKA 4FISA 4N9IA 1JKPC 2Y48A 1E0EA 1AOYA 5D5XB 1F36A 1ETKA 1XGOA 3OYKA 5KVRA 2QENA 2DO7A 2UV1A 4LLLA 4KIBA 4KT6A 3CRJA 3GUDA 4XLNF 1FTZA 3WG7H 4DJAA 2HVRA 1FC3A 1HBXG 4N9HA 1VQ5I 3M8JA 3RPUA 2GXBA 1A36A 2BV6A 1E17A 2LNBA 1K78B 3E5XA 3OYIA 4QIWN 3Q0VA 3HRMA 4BJ5C 3N4MA 1IGNA 2EFOA 2Q1ZB 1QPMA 3B73A 1GVJA 2IAIA 3IUOA 5GTHC 2IEKA 5ICCA 4LGWA 2PJRA 1BOAA 2CQNA 3F6VA 3VSKA 4MEXF 1LDDA 4G9YA 2VKHA 4EM2A 5CVUA 4A3IJ 4EJOA 4F55A 5CKTA 1DDNA 2NX4A 1NG7A 3NWSA 2F5FA 2P6TA 2LFBA 2OCCH 4UXNA 1T38A 3PASA 1K6YA 5FLXK 2F5EA 1P6RA 5E3NA 5L3DA 4YFNF 2DLLA 4DQ2A 1HDPA 1IUYA 4Y4RA 1TLHB 2FXAA 2FU4A 4PK4A 4OIRF 3D0SA 1ZRCA 3DTEA 5LRSA 4UHTA 2A2FX 5J47A 2CS3A 4I02A 2Q2EB 3JCUC 2DOFA 1S3JA 3CCJI 1DUXC 4XQFA 4M3BA 2XC7A 1N77A 1TQMA 3BR2A 2WY7Q 4RLQA 3CO6C 2PMHA 3WG9A 3H1CA 3Q9VA 2PEXA 3EYYA 1DU6A 3CC2I 4LIUA 3QP6A 4B48A 1T39A 1LEAA 1ON1A 2E1MC 2ECBA 5F08A 1IRZA 1YRNB 3GTPJ 1L0OC 5H6RA 2EB7A 1PJRA 1WI9A 2HQRA 4ZZLA 4A3KJ 2EH3A 4LITA 1RRJA 3BTIA 2KIMA 4MXMA 1EH7A 4XL9A 1H9TA 3C3WA 2EIMH 3PIPF 3L2RA 3CDHA 3HYIA 1DPRA 2JJ7A 2YX4A 2XB5A 2FD5A 3VFZA 4OD5A 3KEQA 1LFPA 1YJWI 3FDYA 4AIKA 3O3KA 2A05A 2KQRA 3I54A 3ZQLA 3U1KA 4CCMA 3JREA 1FNNA 3IH2A 2A07F 1W1WE 2BOLA 3KIOA 3B81A 3VUQA 1X1AA 2R7DA 1WHUA 3DF8A 1QVUA 1HKSA 2OTLI 4NB5A 1LVKA 4XR6A 4BXUA 5D5VB 3HOSA 3LFUA 2DOAA 3VW0A 3BCBA 2DFIA 2KDOA 2VT3A 4Y15A 1BR2A 4AVPA 1U8BA 1QVTA 1VTNC 1U78A 4NC7A 1XGSA 2KIFA 2VT2A 1QZZA 2IW5A 3HGYA 5BMZA 4O3MA 2K9LA 1SFEA 1JTYA 2L54A 4CCLA 4M3EA 4D5FA 3BROA 3QQAA 1Z7UA 4B8XA 2GQQA 1YIJI 5B1BH 1TZLA 5HNFA 1SC7A 1MSEC 3JAMZ 2NS7A 3PFIA 3TW7A 1OISA 3L00A 4CO8A 3FXMA 1G3WA 3K4BA 5E8GA 2R7SA 2V4JC 2KRFA 2XIGA 5CVJA 2DJNA 4DW6A 2E2IJ 1V3FA 2XPUA 4OAYA 5D4SA 4GYIA 2M34A 3DPUA 2DYSH 5IP9J 5CYVA 4ETSA 4L0YB 3CCYA 3NXCA 2BW3A 3CO7C 4KMUX 1GT0C 3K69A 2B1EA 1SFXA 1ETVA 4JX4A 3DEEA 1LUJB 2DTRA 2JA5J 1Z9CA 4NHJA 1TT0A 2M1BA 5JLWA 2E19A 4PCQA 5J8FA 3F8CA 2LKXA 4XRSA 2KRCA 2E34A 2WV1A 4A2UA 2N8GA 3CLOA 1ETWA 2VBXA 3TBIA 1R36A 5J6XA 4UUSA 5DTDA 2E1OA 2ESNA 2XRNA 1W0UA 4LLGF 3ZOBA 3TL4X 2CUZA 5E79C 5FKNA 4G94A 1B6AA 3Q9SA 1SFOJ 4L62A 4F92B 4RGSA 3ZQHA 3A0HC 1JGGA 1WJ5A 5LGTA 3SFIA 3N97A 2X6WA 3OYFA 4ITVA 2KISA 3VYTB 5C4JJ 4J01A 4Y52J 3RQ4A 2O8KA 1OCCH 1FBUA 4XM3A 3CZ6A 1TW2A 2VI6A 2K02A 4KFCA 3QYFA 2YPRA 3CMAI 1H8AC 2CH0A 1X4OA 4WIBA 2O7OA 4KT5C 2ZJRF 4UV8A 1R00A 3F21A 1IV6A 1XG1A 5FLVA 2VJ4A 4NC6A 4CZCA 4IHSA 4HW0A 3L2QA 4F7ZA 1QZEA 1SD5A 4Q47A 1G4DA 4IHWA 3GZIA 3IRRA 1VQ6I 3KP4A 1J5YA 2ZOYA 3OIOA 2ZSIB 3B6AA 1MDMA 1JKRC 4I98B 4RAFA 3CCMI 2W25A 4RDUA 3T5XA 2X85A 2L3DA 2BVMA 2ACJA 1R58A 2KZGA 3GFMA 4BY1J 4IO9F 3A01A 3OOPA 4RLFA 2G7UA 2KFDA 2V9KA 3L09A 1LE8B 3A4CA 4M9SA 4MFDA 4DGWB 2WV0A 3BR3A 5J1RA 4XKWA 4YFXF 3CCUI 3CTAA 2DDAA 2XUBA 5KAFC 1WQ2A 1Z6TA 2DTZA 1W0TA 2JN6A 1GXQA 3K1MA 3CJRB 1LDJA 3VSLA 5IYDJ 2ZY9A 3T6NA 2BXYA 4U7BA 5DAJA 1B72A 3GTQJ 3ZRGA 5ILVA 2NOGA 2JTVA 2DA3A 3IH3A 3AL0B 4I0BA 4YIFA 3A02A 1ZYRF 4HLYA 4OD4A 4LMYA 1MW7A 3KETA 4ENNA 3ZQ7A 2G7HA 2YR2A 4HV6A 1FP1D 4E7JA 1X19A 3G1MA 2WBMA 2DDBA 2GOMA 3OR2C 3SXYA 4GCVA 1MD0A 2ZCMA 2OA4A 2W84A 1SEUA 3ZMZA 3ANPA 2F2EA 2V6CA 2K3FA 1Y56A 2LY1A 2XKPA 4A3JJ 2VIXA 1BJZA 1MBHA 1K4TA 1OFCX 2NVTJ 1SAUA 4LK0F 2FBKA 3F8FA 2LYCA 3H5NA 4CYCA 2ZB9A 4GCLA 4G6TB 2QCOA 4H4KC 1BJAA 1JUPA 3GBGA 1D8JA 3BZKA 1QRYA 2IBDA 1HKQA 5M5XJ 2AO9A 1CF7A 2LMDA 3MN2A 2R7TA 3BRUA 4LJZF 4EEFG 3HUGB 5HLGA 5D8LB 1WKMA 3G2BA 2OC6A 1IXSB 5IYBJ 4B1RA 3K8PC 4HG2A 4Y7NJ 3COAC 3PUBA 4O5VA 2W7NA 5IT9K 1U9OA 2M45A 3CP8A 4P5OA 1IN5A 3L7WA 1YOVB 1JHHA 1VQPI 3I5UA 4MGRA 4EQQA 4ZYAA 5GPAA 4L9NA 2KJBA 3ABMH 3OYNA 1Y0NA 3SHFA 4IKFA 2OV7A 1NG6A 2GA1A 1EKEA 2PMUA 4KN7X 3V7SA 2DJIA 3E3VA 4BEHB 4CCOA 3X2QH 1ETXA 2K7LA 5B3SH 5HS8A 5JVGF 5D19A 3J81Z 4U9NA 1LEBA 2AQEA 1KQ0A 4L9JA 5HS7A 3G71I 1TWCJ 2FRHA 3KYLA 3FZVA 4GFKA 3KX2A 3KEYA 3COLA 1FOYA 3GEUA 5DDGA 1ZAOA 4YG2F 3W6JB 2YU9J 1ZARA 4E70A 2QUFA 4JOMA 4UVBA 3EPZA 3RKQA 1O7LA 3W6KB 1K78A 4OIPF 2VB6A 2DA2A 1SMYF 1MBKA 1S7EA 1N75A 5K5RA 1YI2I 4CYDA 3VEPA 3J7AY 3I4PA 2CQKA 3L9FA 5D4RA 1IAWA 4MQ9F 4P1WA 1JUSA 2ZXIA 3KFWX 3C7JA 3KYCB 3DU6A 2E60A 1MJAA 1FY7A 1YW8A 2DW4A 4D1QA 1LNWA 3I56I 5EZGA 3MEXA 3R0JA 5FB2A 3BR6A 1KQ8A 4BY7J 3WE2A 5FRMA 3V4GA 3OL4A 2VC0A 5DD8A 2NVQJ 5F0CA 5A2QZ 4HBLA 4ON0A 3TOAA 2AQFA 4ZTJA 3TOBA 1R4MB 2DBBA 2OCEA 2LSOA 1K79A 4RA2A 4D5CA 5HVQC 3DBRB 4MLOA 1TL8A 4M6VA 5E20A 1UAAA 5M5YJ 5DCFA 2RGVA 4BAYA 3HOWJ 4IEJA 5K7HA 3S3OA 1HSJA 3M9AA 4HNTA 2Q2EA 2CGPA 2HYTA 4ANJA 5FJ8J 2JA8J 4IOCF 3S1NJ 3GO5A 2ZSHB 1ETQA 2VJIA 3ABKH 3BQYA 4WF2A 2F5VA 4EJUA 2K85A 1OCPA 2E5NA 4PFOA 1FMVA 1X1PA 1YRNA 2HXOA 2D5VA 1S29A 4B09A 2QZ8A 3FRQA 3GEZA 1DQUA 3H5RA 1T56A 4G8XA 3OYEA 3GTJJ 2QQAA 3QYBA 1G3YA 3C2HA 1ZLKA 1YQAA 2NRAC 2JPBA 1TT5B 1BOBA 1ZG5A 2XDNA 2STWA 5IOZA 3HTUA 3VODA 2ZCWA 3M8FA 1R9TJ 3HOVJ 3BJ6A 4HYEA 2R7WA 2PFVA 1ORKA 5DYMA 5EEHA 1VQ4I 1MNDA 1USTA 4BQOA 5H9TA 3H36A 4HF1A 1FOKA 1S7OA 1FSHA 1MH3A 1EA3A 2E7XA 5DEQA 1R5ID 4X1EA 4DYQA 1ZR4A 5E3MA 2JRTA 1BIBA 3MNLA 2A5YB 1UI5A 1J7KA 3S32A 3E97A 4YZEA 2VOPA 2HKXA 3FISA 1YIOA 2O9LA 2XASA 1OR7A 1O3RA 4A5MA 2EIJH 4GFLA 2O03A 2XVCA 4NNJA 1GV2A 3K4CA 2JA2A 2LC2A 4QTRA 1RI7A 3OYMA 2CG4A 2FF4A 2KIQA 3BY6A 3O6BB 4L5IA 4PJMA 4BJ6C 2ZJQF 2BEOA 2XAQA 1PP7U 2UXHA 2V9PA 5ICEA 1GUUA 1Z7LA 3LQQA 5M3MJ 5BOXA 4XIDA 5D5UB 1YJ9I 3DKYA 1IJWC 1WJFA 1BR1A 4I2OA 3QPHA 3IC7A 1Y8QB 1XPXA 3AG2H 2H8RA 1XMAA 3ML6A 5LEKA 2COMA 1U0JA 2KP6A 1E3PA 4IRIA 3ZMVA 2E36A 1MNEA 2VONA 3BC8A 1P9QC 2MGQA 3F3XA 1YW7A 4V19K 3ISPA 1J09A 1R23A 3CMMA 3H3UA 4UB8C 4Z6YA 1T0FA 2E1NA 1IV8A 2W48A 2X6OA 5J8CA 1IRFA 2LP0A 3S2DJ 4HQMA 2ECCA 1BI1A 1ETOA 2HKOA 2MD5A 2JSPA 1OCZH 4ZDLA 2KLOA 4WK8F 3V7CA 5IY5H 3K70C 1Y1VJ 2CQXA 2XKOA 1T8IA 2CW7A 4RMNA 2XSDC 1BL0A 2E1CA 2K9MA 4XOPA 2GXAA 3OYCA 1LB2A 4LLNA 2H6CA 2DYRH 3G3ZA 3DU5A 1Q1HA 1U5TC 2I8DA 2VQHA 2IS6A 4D9JA 2XAUA 3G7RA 3DXJF 1OYYA 1XB4A 2F6CA 3ROUA 4PGHA 4ENJA 3KCCA 1WPKA 3RPUD 5FKMA 5TGTA 4E7HA 4E7LA 5J4YA 2GOXB 1S9HA 2LR8A 4QSHA 3FMRA 4HF0A 5FROA 1GVDA 5FKOA 1ZG3A 3ABUA 3HJEA 3TO7A 1E3HA 1DGRM 3EYIA 3HOXJ 3HDDA 2L9NA 2EILH 2ISYA 2HDWA 2TRTA 2ZXJA 2G9WA 5HDNA 4EGYA 3HPHA 4C2TA 4MTEA 2XB0X 1MIJA 1W4MA 2CW8A 3V6GA 3SZTA 3J7ZI 1LE8A 1J9IA 1XC5A 3MKZA 4A5NA 4DVYP 3OMYA 3E7LA 5GAHJ 2FSWA 1SD7A 2QGUA 2L5QA 3EUKL 3VYSB 1K61A 3VW2A 1WJDA 5H20A 3IWFA 3S17J 3C07A 5K7FA 1D1BA 1TNTA 4V2FA 3ASNH 4AC0A 1Y1WJ 3CJDA 5B66C 4KICA 2XF5A 3S8PA 2H1KA 1QA6A 3LQRA 4CICA 2IJLA 3ASOH 4GFBA 5ED4A 3I71A 3JRIA 1JXSA 3RH2A 4AF5A 1KONA 2HYFA 3ANGA 3SZGA 3CCLI 4PFPA 2DPDA 3F72A 3J80Z 1G59A 1D5VA 2P0WA 3M1CA 3GX4X 2GM4A 4W1UA 3WHCA 3MZYA 2O6GE 5KHDA 1R5HA 2JQ7A 1ULYA 2XGXA 2IU5A 5K58A 4WXCA 2VLAA 3OS0A 3SDGA 1XDSA 1B8IB 1JJ6C 2EBIA 1EV7A 5IPAA 4MIMA 3HKZN 2EZHA 3QU3A 1EH8A 3FXLA 4DIQA 1QHHD 2D2WA 4ZC3A 1ZKGA 1L3LA 2D1HA 2PFBA 3SEZA 4LOCA 2VPRA 1UMQA 4A3CJ 1V55H 3FMQA 3ZCOA 1N78A 1NK3P 4ENMA 3G73A 1I6HJ 3E5UA 1HW1A 3VOXA 5HDKA 5EF6A 3H3VK 4Y3OA 2A3SA 2UXXA 3HUGA 3RI4A 2Q8KA 2ZFWA 2V26A 1GXPA 2LLKA 1MJBA 5F64A 1G3SA 2Z3YA 1YJNI 2XPVA 3CF5F 4L0ZB 5B1AH 1KU9A 3OOUA 3VTIA 1BBYA 1ZREA 4G7OF 1BI0A 1VNDA 2E5ZA 2HNHA 2NP5A 3ONQA 4XLEA 3WTYC 2QA4I 1STZA 3OYJA 5GAGJ 3SDBA 1IRGA 4ZH4F 2P81A 1T2KA 4IJAA 5LGUA 4UUVA 2HOEA 5E17F 3HOUJ 1MGTA 2EJRA 3HBLA 5H2FC 3DKWA 4U88A 4M3DA 1NTCA 4BEHA 2HQ5A 4ZYGA 2ZNYA 1YW9A 2OF7A 2HWVA 2F07A 5B5EC 4Q4ZF 2K4BA 2MABA 2RREA 3HM5A 2FE3A 3KZIC 2C6YA 4XLCA 2DT7B 2IGMA 2HR3A 4EJTA 5CVRA 2M8EA 2FBHA 2GBYA 5J3LA 1IN6A 2RASA 3LFKA 2WGBA 3BG6A 2R7OA 2WAFA 3QOPA 2IA1A 2VE9A 2K9QA 1QQIA 1Z0XA 3S16J 2EV0A 2CFOA 4NQWB 2EFNA 2MG4A 4Y33A 2X6YA 3JSPA 1F4KA 4AWXB 2BHYA 1FYMA 1OKRA 2ZXHA 3K4NA 1SMTA 2VKVA 2LKPA 2FX0A 1X58A 3M07A 1X1CA 1TTYA 4KA4A 4BS9A 1AHDP 2QTQA 4QPQA 5JLXA 3MWMA 3BG5A 1OPCA 3IL2A 4JYKA 4PSXA 3I4NJ 5DD4A 4ACIA 1FSEA 3E7QA 1W5CC 1XGNA 4AD9A 3DWLE 3RDIA 2JVHA 3BG3A 5DUKA 4H0EA 3KLOA 3MMYB 2E71A 2EPFA 5L3EA 4CHUA 2VBZA 3VVZA 1MZBA 5DM7F 2DFEA 1XSXA 4BDYA 1MMSA 1LJ9A 3LNQA 4XBFA 3QBMA 4A3EJ 1GLNA 3G1OA 1OCRH 2XGEA 2M2EA 4CDGA 1YITI 3PSIA 3LSMA 2ME0A 2IGNA 1YO5C 4I6ZA 1Z67A 2X1CA 2EWNA 2M9HA 3KP3A 4GDFA 1BI2A 4IQJA 3CUQB 3JSJA 4M73A 4LK1F 2ZJPF 4L9VA 3JAMK 3HOYJ 1FP2A 3C2GA 2VQLA 3SQNA 4LFUA 2B0LA 2VN2A 2XAJA 3F8MA 3GTGJ 2CUFA 3OR1C 4II2A 3MFKA 2MH9A 3ECHA 2E2HJ 3KP2A 2O8XA 2REKA 3K6GA 4D0PA 1ONVA 2R5YB 1Q1VA 3HIMA 5LEJA 2QWTA 1B4AA 3EETA 3V42A 5IYCJ 3D1NI 3O8GA 4KIGA 2H09A 3ZMSA 2CU7A 4ZZDA 4NBQA 1T6SA 1X3UA 2QYOA 4IOAF 3K2AA 1BM9A 4DYCA 3KZYA 4BACA 3AAFA 2IRFG 1X1DA 1IN7A 5GADJ 4JNNA 2BBYA 4RB3C 5CQEA 4HX8A 1Y6IA 3K4LA 4AM3A 3MQ0A 2XGDA 1YE9A 2A61A 4HA8A 2H27A 1S5LC 3HRUA 4F52A 2V1UA 3CJNA 1G6NA 5H6QA 3B02A 2RDPA 2FBQA 1OMIA 2L0KA 4XKCA 1I3QJ 4I7HA 5EZHA 3OYAA 1PUEE 1XD7A 4YELA 2R93J 4CZZA 2M30A 2ZXWH 3E6DA 2Z9OA 1Y8RB 5TJJA 1WJAA 1RNLA 3FBNB 2HXIA 5JI6A 3DKXA 3HEFA 2ZMEB 4XONA 3I53A 2WWYA 2DN0A 4XSXF 2L7MP 4IHYA 3QPLA 1XGMA 3PFYA 1ZH5A 3ESWB 4NN1A 4EM0B 3RSNA 3RKXA 2KDZA 1XTAA 4C9YA 3K1PA 2QM3A 2UXOA 4CA0A 1X4PA 1IXRC 1LDKB 3MD2A 2EIKH 3M8EA 2UXNA 4A0XA 1SFKA 2HOTA 2AXTC 3LSRA 2H94A 1ODDA 1PDNC 3BLYA 3S1MJ 4DZPA 5CVVA 3ZP5A 3K7AJ 5FLMJ 3WGGA 3I59B 2HQNA 3LOCA 5JR3A 3HOZJ 1D1AA 3TQNA 2PBIA 4HQEA 2Y9ZA 3FXRA 1DPUA 1I27A 1K83J 1KA8A 1REPC 2CUEA 3F8NA 3HIFA 1A35A 2CJJA 3HC7A 4KDPA 4ZDOA 4KNYA 1LPQA 1R4NB 3K4MA 2V1XA 4BH9A 2R0QC 4HRIA 2HOAA 2HVSA 1HKTA 2NS8A 2QKOA 4AUXA 4A3MJ 1WWXA 2NYXA 3EUPA 1KU3A 3LSHA 2COBA 3WGHA 4FASD 2OD5A 4FX4A 2PBXA 2M87A 4HDUA 3TDZC 1I39A 2P8TA 3NI7A 5L3BA 1DU0A 2WY8Q 4OINF 4IVNA 5HLIA 3JRBA 2DQLA 4LD5A 4FQGA 2ISZA 3V8JA 4LB6B 4JK1X 1RUNA 3BNIA 2DA1A 9ANTA 1TQPA 3TW6A 2JVGA 2EA2A 3U9GA 3CMYA 1QHGA 4I0AA 1RKWA 4X6AJ 2W57A 2QSHX 2P5LC 3HTAA 3QKXA 5LD2C 4IHVA 5J40A 1KU7A 5CXIA 1FT9A 2DT5A 2QQBA 3QAHA 3PNVA 3IWZA 4C2MA 3TO9A 2P4WA 3GFIA 1S72I 2F5CA 3DLAA 2YSRA 3W2WA 1BIAA 2W4SA 2L7KA 1JJ8C 2HFHA 3W3CA 4IRHA 5E3OA 4QPOA 1D0YA 4CH7A 1MMNA 3NQOA 5LHHA 3IP4B 1D0XA 3AKZA 1OCTC 2MFZA 3RPQA 2G3BA 2F5DA 3OWTA 2XF6A 3OYDA 4PXIA 1EH6A 1QGPA 2XAFA 3I55I 4U0VA 4S04A 1UZCA 3WTUC 1FZPB 3KE2A 1YX3A 2CV0A 1D3YA 2M4GA 2R7RA 1TWHJ 3O60A 4GGGA 2RC4A 3ZPLA 3N05A 4L9TA 2E1MB 5DUIA 5FGMA 2KT0A 2G0EA 3LSTA 4JP0A 1J0RA 4BE0A 2DI3A 3RKWA 4N0BA 5FFXA 2QEXI 2DOEA 3V78A 1U6GA 2WB1N 4P96A 5D5WB 3OYLA 1ZG1A 3BR5A 4XKBA 5EG0B 2CQQA 3DEUA 1KGSA 2P5VA 2FMYA 2LF7A 3F9KA 3FWEA 3BPXA 3H9GA 2LBFB 4BXFA 3LAJA 4ICHA 1FWZA 1A04A 2X1EA 3CQZJ 3MVPA 3KNWA 3CLQA 3F22A 3JRFA 2FMLA 2XAHA 5FD6A 4KWAA 2LH9A 4E7ZA 4D7MA 3VIBA 2NS0A 3PJRA 4NDLA 5KK1A 3JTGA 4V2GA 4DBRA 3LSGA 2Y9YA 4E7KA 3DLLF 3P9TA 4BBSJ 4DYRA 1KQ9A 1JKOC 2OZ6A 2Q0OA 1LQ1A 1ZRDA 4MQVA 5JVTA 1ZK8A 2LREA 4IHXA 4PZJA 1YYVA 2EFWA 4U0YA 2J5PA 1BR4A 1HXDA 2JK3A 2KPMA 1BC8C 5FRNA 2R4GA 4U9LA 2CFXA 5DCMB 1HDDC 3C2BA 1RZ4A 4RAZA 1B8IA 3JRAA 2CO5A 3F0CA 1I6XA 4I76A 3KEOA 4WX9A 5IT3A 2P6SA 5J1YA 2F4IA 3M7GA 3OSFA 1K6OA 2ESHA 4R8HA 4PJJA 1TWAJ 1UHMA 2XGCA 4FE4A 4XLFA 1WZ2A 2STTA 3A0BC 1V5FA 3ELKA 3ZQIA 3ZMDA 3SJMA 3AQTA 5EEAA 3CCQI 2CW0F 2JMWA 3PM1A 1JTXA 2M0CA 5LFAA 2LG4A 3GTLJ 2IS4A 5HOOA 2AS5F 4GCKA 2VQCA 3AG3H 2PMZA 3EUHA 4OAZA 4DOZA 2XV4S 4FE7A 4R1HA 2MYSA 2WAQA 2ID6A 3L2UA 2ZO4A 2L9VA 1P92A 3I64A 1F5TA 3JTHA 2QKMB 1Z91A 2B63J 2MW8A 3GVAA 4E6KG 4OU0A 1W5SA 3WODF 3S3MA 1IF1A 3DEWA 5EYRA 3K9TA 3J7YJ 4G7ZF 1KU2A 4EJVA 3CMEI 1FYLA 4JBAA 3WTWC 1YG2A 1QO0D 1P4XA 4W97A 5AIQA 4A12A 1HLVA 1E2XA 3VOKA 2M3AA 3HTJA 2F4MB 2HVQA 3VVXA 3NARA 4IZZA 1H88C 3WTVC 4XNFA 1Z3XA 2DK8A 3CJQB 4ZJZA 3DPTA 4A69C 4UY8I 2PG4A 1JGSA 2ADUA 3IKTA 4NQWA 2KKOA 3FM3A 2ELHA 2H6BA 4Z2YA 3RYPA 3FF5A 4RGRA 4XORA 5E1ZB 2AHQA 1V5GA 3HXLA 2V6EA 2DODA 2TDXA 5ERIA 3VYUB 1OJLA 5FFZA 3HRTA 4BE1A 4BKXA 2HGCA 5IP7J 2W00A 3HGGA 3FK6A 2BY2A 1FIAA 1UG2A 1VQKI 3FK7A 3G1LA 2QIBA 3PIOF 2VXZA 3T8RA 2DPUA 5AQCA 2L9SA 4XRSG 2L02A 3L2WA 3MKWB 1WCMJ 3H3ZA 5CVIA 5TRDA 2HI3A 5DS9A 2E35A 2QBYB 4K2EA 2Z99A 4C2UA 4KMFA 4GCTA 1UHSA 2X6XA 3UR3C 1XCBA 2KMUA 2VJ5A 4BU2A 3HOTA 1BC7C 1X2NA 2BY3A 1I3AA 2B9SA 2VBWA 2Y2ZA 3IH4A 3HKZA 3JW4A 3LSIA 3AFHA 5CJ9A 1OLTA 1ACIA 3H9JA 3BHQA 3RD3A 3CUQA 1OR7C 1IXCA 4BQQA 2P7VB 3E6BA 2HZDA 1JT0A 2XRLA 4ABZA 1SVMA 2XPWA 1WJCA 2DAOA 4XK4A 4P55A 4XLPF 3S5RA 2HQAA 3MZ8A 3QOEA 3MCZA 1FTTA 1HF0A 1ZLJA 3O8HA 3NWTA 1UELB 3J81K 4A3FJ 5LLQA 1AA7A 2VJJA 4U87A 3WTSC 5D8KB 3TEDA 4KJZA 3BR1A 3VOEA 2R5YA 2VBYA 2OZUA 4HF2A 4HV5A 1T33A 3QWLA 4N4NB 4WCGA 2ME6A 5JHUA 5BPIA 2ZC2A 3BTLA 3I4MJ 1WH7A 2Y75A 2DK5A 3FXJA 2IPQX 5F6FA 2DCEA 4AIDA 2R7FA 1MSFC 5C4XJ 2RQPA 2LKSA 2GIZA 1RKTA 3AG1H 1I50J 1O57A 3HZJA 1DP7P 1N25A 2K5CA 4PUSA 3JRDA 4B3XA 5FMPA 1T0FC 4Y17A 5C3EJ 2DT6A 2K9SA 2ID3A 2G7GA 1R22A 2KRHA 2FJ1A 5D6FA 1MMAA 5D18A 1ZTRA 2WC2A 3BT9A 4HOBA 2L2OA 1ERDA 2PMZN 1LKXA 2MBFA 3NAUA 2WAQN 1VQOI 1XMKA 1F43A 3FXUA 4IXAA 2UXUA 1G8XA 1W7PB 1JE8A 5LHIA 4JX6A 1BW5A 4OOIA 1ETYA 3IKVA 3P5JA 3KP6A 3Q0UA 3U2RA 4F3QA 3BPVA 2ZMEA 3IHUA 2X4HA 3OIPA 3KP5A 1OYWA 3IAS2 5LHGA 3QPSA 1ZN2A 4BXXJ 1ZR2A 2FJI1 3NRGA 4OIQF 1FEXA 1TBXA 1XMXA 4G12A 4II3A 2YVXA 4F93B 3BDDA 2JUCA 3UNGC 5HODA 2EZLA 2EZKA 2HS5A 2OBPA 3L1PA 1Y0UA 3JRHA 4ZYHA 1V54H 2ICWG 2K40A 3I59A 2X9DA 1U2WA 4CCKA 2X48A 3RZDJ 2MA3A 2L01A 5KAIC 2BXZA 1I1GA 2NXNB 2PZ9A 5LBQA 1A6QA 1M1EB 2P5KA 3CC4I 3OYGA 2CRGA 4EV0A 1R71A 1Z3YA 1HW2A 2B7EA 3K1NA 1AKHB 1IG7A 3F8BA 4FCYA 2EFQA 3REOA 3HB9A 3RIRA 2W82A 3KKDA 2VKEA 4Q48A 3BOQA 1FOXA 3RKYA 4A3LJ 2K4JA 3T0YA 3AL0C 3LSKA 3W6VA 3C18A 2V7FA 4LIVA 2JPCA 1TW3A 2WAEA 3HSEA 3D5LA 3CCSI 3OV8A 3PNTA 2M7BA 3SEQA 2V79A 4FX0A 3J80K 2P7CB 3W2VA 3KYDB 1UB9A 3MAJA 1UCRA 4XLHA 4M3GA 1S8NA 4L5JA 3RJPA 3ZGKA 5K5OA 4RS8A 3DFGA 1NH3A 3KP7A 4LB5A 1RR7A 1MKMA 2HPIA 4XKVA 1QU3A 1D8KA 3LSPA 1R1UA 2RVCA 3IV5A 1XCVA 2QSFX 4ENKA 4HLXA 1QNTA 1WFXA 3E0JB 5FLXZ 1D5YA 3KZZA 5CW8A 1B59A 1ZRFA 2OU2A 4GO1A 1BW6A 2R7ZJ 3IAM2 4IPAA 1QZYA 1AU7A 4YIRX 2F48A 1MBFA 4GXOA 4G7HF 1SD4A 2D1VA 3E5QA 5JHFA 2RQQA 2NVXJ 5HSZA 4HX4A 4XSZF 3S15J 3TKYA 2M0MA 4ZTFA 2FNPA 2A68F 1QPIA 1T08B 4PJNA 2HDDA 3E6CC 1A5JA 3V7RA 3VP5A 4JL3A 4L5EA 2VKDA 2L4MA 3ULQB 4U0WA 2NNNA 4ZYDA 4UNOA 2Y69H 5GPCA 4MK6A 5KNLA 5ICFA 2VE8A 2YX7A 3WTTC 1A31A 4CCJA 1PUFB 5F1RA 3SFZA 5GAEJ 2HYJA 2O3FA 3P7NA 3H92A 2TCTA 3RQIA 3S2HJ 2GWRA 3ZMUA 1BA5A 4AIHA 4BHPA 4GRIA 2R92J 1OYIA 5EG0A 2DG8A 2RN7A 3BZCA 2LBFA 2HKUA 2ETHA 3PSFA 1O3TA 5FHPA 3RZOJ 2L9RA 3H0DA 1APLC 1V5EA 2OTJI 3OYHA 2M7AA 3KKCA 1MBJA 2IS1A 5C44J 2HZTA 3K4JA 4LG3A 3QU6A 4I09A 2GAUA 1Z77A 3A03A 3F6OA 3GTKJ 1SANA 4MNUA 4P9UA 2XROA 3D5RC 4PJLA 5J4VA 3JRCA 2HDCA 1SFUA 3DQVC 1I1SA 5HLHA 1UG0A 3EGQA 5AIPA 1OCOH 1F9NA 1C0WA 3K4KA 1K7AA 1WSUA 3DPJA 4HKUA 2DA5A 2KZVA 2R7QA 1B1BA 2QQ9A 3ZN0A 1JI8A 2FUG2 2XSJC 1PVEA 5DCMA 4A6EA 4EATA 4EMSA 3UKGA 2IS2A 3EQLF 5K7ZA 4LG0B 3LWJA 1R1TA 1B9MA 2LRDA 4BL0B 3K0LA 3I3LA 4U7DA 2YVHA 1BN5A 1MMGA 2EK5A 2A6TA 2I5UA 3G4SI 4AVZA 1R7JA 3BTCA 4MFEA 2IA2A 3PL8A 4XLAA 3NPIA 1RR8C 4EJWA 2KL4A 5KCMA 2ELKA 4BJTA 1R49A 2EZIA 1O7FA 2LF8A 2IT0A 2DMPA 3DTKA 4WXDA 1ENHA 4PJ0C 2E7WA 4UV9A 4M74A 2LDUA 2PLYA 3OS2A 2PQ8A 4BYYA 3ZQGA 3BG9A 1KZHA 3JSOA 3PNYA 3HSFA 1Z6RA 2YS9A 3O2PE 2VXDA 5E1WA 2OAZA 4BHCA 4XN0A 3OSGA 2EFPA 2QOPA 2MLKA 3H0GJ 1H89C 4XRMA 3VVYA 4QWQA 4RAYA 3F23A 5C4YA 5E8IA 2W53A 2GENA 2MLGA 3GTMJ 2HOSA 1NHAA 3CCVI 5E1XA 2JA6J 4UVCA 1S6LA 3U21A 1MBEA 4AYBA 5L3CA 5DM6F 2RNGA 4FETA 4IL6C 2DXIA 2EV5A 4C3IJ 3R60A 1RETA 3M1EA 2BVLA 4F91B 4A3DJ 4HSTA 3ZR8X 2D45A 1AWCA 1P4AA 2WB1A 3CDIA 1O4XA 3BP8A 1CGPA 3LJLA 3OY9A 4B43A 4AIJA 3WE3A 2EA4A 4CXFA 1U3EM 3CC7I 1U5TB 2OI8A 5EFYA 3HSRA 5L3GA 1P7JA 1YFHA 1FMWA 2IP2A 2YU3A 2NOJB 2FOKA 3CDLA 1X1BA 2ZNZA 3B6CA 2DMNA 2DA6A 4MEYF 2R5ZB 4M6XA 5EGOB 2LD5A 4YEJA 3H5AA 4TV7A 1IC8A 1UJ8A 1J75A 1FBQA 1H0MA 4L18B 3SWHA 4ASNA 2PN6A 5M5WJ 2DA7A 1TWGJ 1JKQC 2UXIA 1MJ9A 2LK2A 1UFMA 2OUMA 2QKLB 4I01A 4S05A 3VW1A 2EINH 2QBYA 1IRXA 3TGNA 3Q5FA 5BNGA 4UVAA 2WADA 4AU7A 4BQNA 4RM2A 1YLFA 3Q0WA 1Y39A 4A3GJ 2VPLA 4KUMA 3VWBA 1MH4A 4M6YA 4OMYA 2D6YA 4CGRA 4M9XA 1WH5A 4WXHA 4NUBA 2UZKA 1X3ZB 3AQSA 4R79A 3MKYB 1FPQA 3VPRA 3FM5A 3KLNA 1KYWA 3FHZA 2RHAA 2L4AA 3PUFA 3GYHX 5HNHA 1YHQI 5HBUA 2Q24A 5D6EA 4OIOF 1X3WB 4XMYA 4KN4X 5EEGA 3H35A 4B4CA 3C1DA 1B9NA 2ZJ2A 3FMSA 1KYZA 1W7PD 1U9NA 1RIOH 2FEZA 3S2WA 2X51A 3DTIA 1U8RA 1G2HA 4ZDPA 1TWFJ 3T1BA 1FOWA 3DV8A 3MZHA 3LHQA 3CD6I 5ICGA 2VASA 3SYTA 3ZN1A 2CV2A 4IRGA 4XRFA 3G6EI 3CCEI 1TC3C 3LWFA 2CSOA 2AXLA 2JZYA 1BI3A 1S7AA 5BQTA 5F27A 2JSCA 3RCOA 5ILSA 3ERED 3QRFF 4RAGA 4AC6A 3M4OJ 4QLCU 2HYGD 3WHBA 2LY9A 2B3WA 3BCGA 2DFHA 4CCNA 2IXSA 5E18F 2PI0A 2Z2SB 3U1DA 2PJRB 3ECOA 4B3AA 4HSRA 5CLSA 3P9CA 5ILUA 2CYYA 1EF4A 1K4SA 2DMUA 1Z05A 1TQIA 3BR0A 4HPQA 2ZBKA 2DFFA 2V9VA 3FX3A 2CQ7A 3Q3SA 2W24A 1SVOA 4IX7A 1IDYA 2OJED 2Y0MA 3R0AA 3FIWA 3CUOA 3LA7A 5F0FA 1W7PA 2A6EF 4CSWA 2L7ZA 2ZOZA 3DCFA 2IVMA 4PDKA 3GF2A 2VUMJ 2H1LA 4JKZA 3WTZA 3K2ZA 3PO2J 5F04A 2CV1A 3R6SA 2KHMA 1R1VA 2GZWA 4A0ZA 3W2AA 1O3QA 2GLOA 4XN3A 2BE5F 2F4OB 2XHKA 2DQRA 5K1YA 1FX7A 3WGIA 3OS1A 5IT9Z 3BJOA 2NP3A 3WU0A 3ABTA 3ZXSA 4GYGA 4AYBN 4EM1A 1WVRA 1J59A 2IGOA 2VQGA 2EV6A 3HHHA 2MH2A 1GDTA 4MHGA 1FBSA 3V8KA 2E2JJ 3GZNB 2CWEA 4BGDA 3HL2A 3S93A 5FGLA 1IO2A 1G3TA 1IUFA 1WRJA 2VODA 1TP4A 4IF4A 4C3JJ 2LOOA 4XICA 1R5GA 2BY0A 1HA8A 2K3PA 4PSWA 2Z1DA 2FQ4A 2W85A 1IN4A 5HLTA 1EJ9A 1SD6A 3HTHA 2XDVA 1ITYA 2LVSA 3LA2A 1VQ9I 4UDSA 4E7SA 1VQMI 3BTJA 4RB1A 5DV5A 1AKHA 2HEOA 3S1RJ 1LVAA 3FHNA 2LY2A 1A6IA 3LSJA 5F0HA 1HCRA 1VQNI 5GTIC 1SVLA 1P4WA 4KIFA 5FO5A 3BQZA 4IRVA 2A69F 3NRVA 4EGZA 2BZTA 5GP9A 4IQ4A 2G7SA 3GMEA 5F1JA 3QP5A 4CUGA 4UUTA 3CP2A 4UB6C 1YX5A 4CGZA 3PPBA 2BGCA 5BS6A 3EUAA 1ZGWA 5J1UA 2IA0A 3P9KA 2RAEA 4KITB 2ZKZA 2K86A 5HDGA 1RESA 1YTYA 1D0ZA 3WU1B 2VC1A 2M4KA 3FKJA 3KZ9A 2QWWA 2ELJA 5K5QA 2HPMA 2R7XA 2A6HF 3ERMA 4HDVA 3HTIA 3E1SA 1ZGAA 3T8TA 1WJBA 1HOMA 1MNMC 4YIIA 2FOWA 4C2MJ 5A2QK 1QBJA 4BQAA 2OPTA 2WA0A 3DP7A 4M72A 3BZ6A 3HHGA 3R61A 1PP8F 1WGXA 3IUVA 4OMZA 4HX7A 4BNCA 1IDZA 4HAMA 2X1DA 3ON4A 2O7TA 3GFLA 2DMTA 2MD0A 4J00A 3TDUC 3ZMTA 1E3OC 1MMDA 3GFJA 2JRMA 3EUHC 2IGKA 3ZQCA 2MC4A 1ZHFA 2MSYA 4BBRJ 4HZFA 2V1DA 2KJCA 3LL7A 2CUJA 2VL8A 3GWZA 3TO6A 2ZCNA 2KIUA 1JHFA 3FXQA 4FTHA 3QODA 2VOOA 2FNAA 4YRVA 3S1QJ 4OWRB 5JFRA 2UXPA 2YVEA 2BW3B 3WTXC 2GA2A 2XAGA 1D1CA 5E3LA 1PUFA 4DZJA 3CJTB 3JRGA 1ON2A 3I58A 4RB2C 4MO7A 4BDZA 3NEUA 2Y0SA 4B44A 2ZFUA 4A93J 1VFCA 5L3FA 4M9ZA 4C3HJ 2NAZA 1VF9A 3OIQA 1NK2P 3NNRA 2Z16A 4UUSB 5FKLA 4I99C 3OYBA 1ZQ3P 2UWMA 1F1ZA 4ESFA 4D7NA 2BHZA 2O5RA 3QYEA 3BCAA 5FKKA 5IP6A 4J19A 1LFBA 4X0GA 4IHTA 3HG9A 3LMMA 2RKHA 3WU2C 3CWRA 1HSTA 3A2KA 2M5WA 2RNJA 3BWGA 3GLXA 2QF7A 3GZ5A 2WUIA 2DG7A 4E7IA 2J5OA 1P2FA 2RV8A 4G6QA 4ESJA 2QVOA 2UUZA 1DGWY 1Z1DA 1MBGA 1YS7A 3J7AO 2QLZA 3HRSA 3GXOA 2Z5UA 3M3YJ 4BHBA 4JQFA 3MKLA 4JX5A 3RYRA 4RBOA 3JR9A 3BJAA 3A1YA 5HS9A 2FQ3A 2K27A 4NC8A 3TMOA 2GXGA 4ESBA 3CCRI 1FYKA 4BUPA 3G56A 1RC9A 5D1RA 2R7VA 1WI3A 1VI0A 1DP3A 4LG0A 2O61A 2GUHA 1FIPA 2I10A 4Q5SF 5CXGA 1VQ7I 4FT8A 2M8GX 4B47A 4E4HA 5M3FJ 5IOYA 3TP3A 3LAPA 1W36D 2QQ8A 1VQ8I 2JWTA 2DA4A 5LGNA 3HE0A 4NELA 3FBIB 2NNYA 5CQGA 3S3NA 2QSGX 3V8LA 3KPHA 3VDXA 4P9FA 1UI6A 2OQGA 2L7FP 5AONA 4DBQA 1MDMB 1X2MA 1CQTA 4XOTA 2O0YA 3SZPA 1LFUP 3BJBA 1ZGJA 2H8WA 3S14J 1V4RA 1SGMA 3GTOJ 3OL3A 3A01B 1H9GA 2FBIA 2WTEA 5HAWA 3P9IA 2V1NA 3K70D 2PJPA 1VQLI 1XX5A 4RB0A 2JA7J 3VYRB 1HQCA 4FHTA 3PO3J 1GHCA 3I0TA 2OQRA 2A5WA 1XDUA 3CUQC 3GCMA 3LA3A 5LRRA 3GZ6A 3ON2A 2MC3A 3ZQFA 2GIVA 2DU9A 3CF2A 5FD5A 1B72B 4RGXA 4KISA 3BG7A 2PX9A 1RUOA 5EJCA 2JT1A 4HNUA 2Z33A 1WJEA 1POGA 1R6RA 1FLIA 4WWCA 3HTSB 2BY1A 3RTRA 4Y13A 1GV5A 3HPGA 1XSDA 2CMPA 4ME9A 1IN8A 3AG4H 1PYVA 5BPDA 2R7UA 4KYWA 2YUSA 6PAXA 1IW7F 3ZQQA 3F1BA 1ZELA 4C30A 4YFKF 2HTJA 2NVYJ 1W36C 4PGGA 4EVIA 1W5TA 1T95A 1T98A 1XN7A 3DBHB 4ZYEA 2V57A 5EDNA 4DNCA 2OERA 2HU9A 3L2CA 3FKIJ 4RM3A 4A0YA 1VZ0A 1SAXA 1FJLA 3I9V2 2JUGA 3K10A 1U5TA 3PQJA 2GFNA 3DBLB 4M3FA 4CYCB 4BE2A 3R4KA 3DPLC 1JUMA 1JT6A 3TP0A 1XS9A 4O6JA 4A6DA 2R5ZA 1Z21A 5EGOA 1I5ZA 1J2XA 3E6MA 2FA5A 3QPTA 1CF7B 2ZCXA 3D5SC 4G6DA 2BYVE 2W1OA 3L2VA 2Y30A 4S0HB 3H9QA 1HW5A 2DMQA 1IZ1A 4HEA2 5CPRB 4N4OB 1HC8A 2G7LA 4RGUA 1TNSA 2ZMEC 1P7IA 3EDPA 4A3BJ 2Y0SN 2R3SA 2NVUB 1OQYA 3FXOA 3GLLA 2X0LA 3ABLH 3GW2A 2Y31A 1O3SA 2LTPA 3NS4A 4MTDA
chains in the Genus database with same CATH topology
3TW6A 2D5VA 2YVHA 3FRQA 3CMYA 1RKWA 4X6AJ 1RPWA 2K9NA 3HTAA 3QKXA 1T56A 3BTCA 2EQRA 4MFEA 4HNVA 4IHVA 5CXIA 3GTJJ 3NPIA 4FISA 1JKPC 1F36A 1ETKA 2ELKA 2EZIA 2XDNA 3CRJA 5IOZA 2DMPA 1R9TJ 3HOVJ 1FTZA 1ENHA 1JJ8C 1ORKA 5E3OA 3ZQGA 3BG9A 5H9TA 1OCTC 2YS9A 2G3BA 1MH3A 4QIWN 3Q0VA 4PXIA 3OSGA 1ZR4A 4X1EA 2QOPA 4DYQA 3H0GJ 5E3MA 1H89C 4XRMA 3VVYA 1IGNA 5C4YA 1TWHJ 2W53A 3O60A 3MNLA 2GENA 2IAIA 3GTMJ 2HOSA 2IEKA 1UI5A 2KT0A 2G0EA 2JA6J 4JP0A 1MBEA 4YZEA 4A3IJ 3FISA 4C3IJ 3V78A 2O9LA 1RETA 4A3DJ 2WB1N 2NX4A 3BR5A 4GFLA 5EG0B 2CQQA 2LFBA 1O4XA 3LJLA 3PASA 1GV2A 4ICHA 3CQZJ 3MVPA 3KNWA 5EFYA 2OI8A 5E3NA 4QTRA 1SGMA 1P7JA 3JRFA 1HDPA 4KWAA 3CDLA 2UXHA 4D7MA 3VIBA 3B6CA 2DMNA 4NDLA 2DA6A 1GUUA 5M3MJ 2R5ZB 4V2GA 4XIDA 3LSGA 5EGOB 2Y9YA 2LD5A 1IJWC 3P9TA 4BBSJ 4DYRA 1IC8A 1JKOC 2H8RA 1ZK8A 4IHXA 4M3BA 3BR2A 5M5WJ 2DA7A 1TWGJ 1DU6A 1JKQC 2JK3A 2UXIA 2LK2A 2MGQA 3VW1A 1HDDC 5BNGA 3C2BA 2ECBA 5F08A 3JRAA 1B8IA 3F0CA 1YRNB 2W48A 2X6OA 3GTPJ 4I76A 3Q0WA 4A3GJ 5J1YA 2LP0A 3OSFA 3S2DJ 2ECCA 1MH4A 1TWAJ 1ETOA 2XGCA 4A3KJ 2EH3A 4FE4A 2D6YA 4CGRA 1WH5A 3ZQIA 1Y1VJ 2CQXA 3SJMA 3AQTA 5EEAA 3BTIA 2XSDC 1BL0A 3AQSA 2JMWA 3PM1A 4MXMA 1JTXA 2M0CA 3VPRA 3GTLJ 2RHAA 5HBUA 2JJ7A 2Q24A 4GCKA 2XB5A 2FD5A 3G7RA 4FE7A 4B4CA 1U9NA 2ID6A 1G2HA 1WPKA 1TWFJ 5FKMA 3ZQLA 3LHQA 2LR8A 2B63J 4QSHA 2MW8A 3JREA 1GVDA 3IH2A 5FKOA 1TC3C 3B81A 3DEWA 3VUQA 5EYRA 1QVUA 3HOXJ 5F27A 3HDDA 4W97A 4AC6A 2TRTA 3M4OJ 3VW0A 3WHBA 2LY9A 3BCGA 1HLVA 3VOKA 1U8BA 1QVTA 1U78A 4B3AA 3HTJA 2XB0X 3V6GA 1EF4A 3VVXA 3NARA 2DMUA 1LE8A 3BR0A 1H88C 1XC5A 3HGYA 3Q3SA 1JTYA 3E7LA 1IDYA 4M3EA 3QQAA 4D5FA 4A69C 3FIWA 1MSEC 3VW2A 5F0FA 1K61A 2L7ZA 2NS7A 2ZOZA 3TW7A 3DCFA 3S17J 3C07A 5K7FA 4AC0A 4V2FA 2VUMJ 4JKZA 1Y1WJ 3CJDA 2AHQA 3PO2J 2H1KA 2DJNA 5F04A 1OJLA 4GFBA 4DW6A 2E2IJ 3JRIA 2XPUA 4BKXA 3RH2A 5IP7J 2M34A 2GLOA 5IP9J 3HGGA 4AF5A 3FK6A 2NP3A 1FIAA 1UG2A 3CCYA 3NXCA 3ANGA 3FK7A 3G1LA 1GT0C 2QIBA 1ETVA 5AQCA 4JX4A 4AYBN 4XRSG 2GM4A 4W1UA 2JA5J 3WHCA 1WCMJ 5JLWA 1GDTA 2E19A 2LKXA 4XRSA 2HI3A 5DS9A 2IU5A 5K58A 2WV1A 2E2JJ 2N8GA 1ETWA 3SDGA 4GCTA 1UHSA 5FGLA 1B8IB 1IUFA 4UUSA 5DTDA 2EBIA 1JJ6C 2E1OA 4C3JJ 5IPAA 4XICA 1X2NA 4MIMA 3HKZN 2EZHA 1W0UA 3ZOBA 2Y2ZA 2FQ4A 3IH4A 1ZKGA 5FKNA 3HTHA 1ITYA 2LVSA 1SFOJ 4L62A 3BHQA 4UDSA 3RD3A 4LOCA 3BTJA 2VPRA 1UMQA 3ZQHA 4A3CJ 1AKHA 3S1RJ 1NK3P 1JT0A 1I6HJ 1JGGA 2XRLA 4ABZA 3VOXA 2XPWA 1A6IA 3LSJA 3SFIA 5F0HA 5EF6A 1HCRA 4XK4A 3H3VK 5C4JJ 3BQZA 4Y52J 3S5RA 2O8KA 1FTTA 2LLKA 5GP9A 1HF0A 3O8HA 4A3FJ 2G7SA 5F1JA 2VI6A 4UUTA 3TEDA 2XPVA 3BR1A 2R5YA 3PPBA 1H8AC 3OOUA 1ZGWA 5J1UA 2O7OA 1IV6A 5FLVA 1T33A 1VNDA 2NP5A 1XG1A 2RAEA 2ME6A 3BTLA 1RESA 3I4MJ 1WH7A 2P81A 5C4XJ 1MSFC 3KZ9A 3GZIA 4IHWA 1RKTA 3HOUJ 1I50J 2ZOYA 3HBLA 3OIOA 3HTIA 3B6AA 4M3DA 3JRDA 1JKRC 5FMPA 1NTCA 2HQ5A 5C3EJ 1HOMA 4RDUA 1MNMC 4BY1J 2K9SA 2ID3A 2OF7A 4C2MJ 2G7GA 2F07A 2FJ1A 5D18A 2OPTA 3A01A 1ZTRA 3HM5A 3BT9A 1WGXA 3IUVA 1LE8B 2PMZN 4MFDA 2GBYA 3NAUA 5J3LA 3BR3A 5J1RA 1IDZA 2WAQN 2RASA 2WGBA 3ON4A 2DTZA 1W0TA 1F43A 2JN6A 2K9QA 2O7TA 3T6NA 2DMTA 5IYDJ 1Z0XA 2UXUA 3S16J 5DAJA 1B72A 1E3OC 3GTQJ 2MG4A 2NOGA 4JX6A 2DA3A 3IH3A 1ETYA 3Q0UA 3ZQCA 3A02A 2MSYA 4BBRJ 2ZCNA 2VKVA 2FX0A 4FTHA 1X58A 1AHDP 2QTQA 5JLXA 3BG5A 3S1QJ 4JYKA 3I4NJ 2UXPA 2YVEA 4ACIA 3QPSA 3G1MA 4BXXJ 5E3LA 1ZR2A 1PUFA 3E7QA 4DZJA 2ZCMA 3NRGA 3BG3A 3JRGA 1FEXA 4G12A 3ANPA 4MO7A 5HODA 2EZLA 2EZKA 3L1PA 4A93J 4A3JJ 1VFCA 3VVZA 3JRHA 4C3HJ 1BJZA 1MBHA 2K40A 1VF9A 2X9DA 1OFCX 3LNQA 2X48A 3RZDJ 1NK2P 3NNRA 4UUSB 4A3EJ 5FKLA 3QBMA 3G1OA 1ZQ3P 2XGEA 2M2EA 2NVTJ 2ME0A 4CYCA 4D7NA 4I6ZA 2ZB9A 2PZ9A 2M9HA 5FKKA 4J19A 5IP6A 1LFBA 4GCLA 2QCOA 3JSJA 2CRGA 3CWRA 1JUPA 3GBGA 2WUIA 1QRYA 2IBDA 2QF7A 1AKHB 5M5XJ 4FCYA 1IG7A 2AO9A 3HB9A 3HOYJ 2DG7A 3KKDA 2VKEA 3MN2A 3BRUA 4EEFG 1MBGA 4A3LJ 3GTGJ 2CUFA 3W6VA 5IYBJ 4B1RA 2E2HJ 3M3YJ 2REKA 4Y7NJ 3MKLA 4JX5A 4RBOA 3JR9A 1U9OA 2R5YB 1Q1VA 3HIMA 3G56A 5D1RA 2QWTA 1WI3A 5IYCJ 1VI0A 3D1NI 3O8GA 2GUHA 1FIPA 2CU7A 2I10A 5CXGA 5GPAA 2M8GX 5M3FJ 5IOYA 3TP3A 3K2AA 2JWTA 4DYCA 2DA4A 4M3GA 3HE0A 4NELA 4JNNA 1RR7A 1UI6A 2L7FP 3LSPA 1X2MA 1CQTA 3IV5A 1LFUP 3BJBA 1ETXA 2XGDA 3S14J 5D19A 3GTOJ 3A01B 5HAWA 1D5YA 5CW8A 2FBQA 2JA7J 1TWCJ 2L0KA 3PO3J 1I3QJ 1BW6A 5EZHA 2R7ZJ 4GFKA 2R93J 3COLA 1AU7A 3ON2A 3ZQFA 1MBFA 3GEUA 1B72B 2NVXJ 2YU9J 5HSZA 2HXIA 3S15J 3RKQA 3HEFA 1QPIA 2DA2A 1POGA 2HDDA 1MBKA 1S7EA 1A5JA 3VP5A 2DN0A 4JL3A 4L5EA 1GV5A 2L7MP 4IHYA 3QPLA 4ME9A 4NN1A 1JUSA 5GPCA 4MK6A 2KDZA 2YUSA 1PUFB 2UXOA 3F1BA 5EZGA 2HYJA 3BR6A 2HOTA 2TCTA 2NVYJ 3RQIA 3LSRA 3S2HJ 1BA5A 3S1MJ 4DZPA 2V57A 5EDNA 4BY7J 2R92J 3K7AJ 5FLMJ 5EG0A 2DG8A 3HOZJ 3FKIJ 3LOCA 2OERA 2Y9ZA 1FJLA 2HKUA 2NVQJ 5F0CA 3RZOJ 5FHPA 2L9RA 1K83J 1APLC 2GFNA 4M3FA 4CYCB 2CUEA 3KKCA 3TP0A 1JUMA 1JT6A 1MBJA 2CJJA 5C44J 1XS9A 4D5CA 1Z77A 3A03A 4MLOA 2R0QC 3GTKJ 4M6VA 2HOAA 2R5ZA 1SANA 5M5YJ 2NS8A 2QKOA 4AUXA 5EGOA 2ZCXA 3HOWJ 4IEJA 5K7HA 4A3MJ 3JRCA 3EUPA 2Y30A 4S0HB 2COBA 2DMQA 2HYTA 5FJ8J 2JA8J 2G7LA 2PBXA 3EGQA 1P7IA 4A3BJ 2Y0SN 3S1NJ 3NI7A 1DU0A 3DPJA 4HKUA 1ETQA 2DA5A 1IRZA 3JRBA 3BQYA 3UKGA 3BNIA 2Y31A 1OCPA 5K7ZA 1YRNA 3LWJA 2LTPA 2DA1A 9ANTA 1BW5A 2HXOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TW6 A;  2D5V A;  2YVH A;  3FRQ A;  3CMY A;  1RKW A;  4X6A J;  1RPW A;  2K9N A;  3HTA A;  3QKX A;  1T56 A;  3BTC A;  2EQR A;  4MFE A;  4HNV A;  4IHV A;  5CXI A;  3GTJ J;  3NPI A;  4FIS A;  1JKP C;  1F36 A;  1ETK A;  2ELK A;  2EZI A;  2XDN A;  3CRJ A;  5IOZ A;  2DMP A;  1R9T J;  3HOV J;  1FTZ A;  1ENH A;  1JJ8 C;  1ORK A;  5E3O A;  3ZQG A;  3BG9 A;  5H9T A;  1OCT C;  2YS9 A;  2G3B A;  1MH3 A;  4QIW N;  3Q0V A;  4PXI A;  3OSG A;  1ZR4 A;  4X1E A;  2QOP A;  4DYQ A;  3H0G J;  5E3M A;  1H89 C;  4XRM A;  3VVY A;  1IGN A;  5C4Y A;  1TWH J;  2W53 A;  3O60 A;  3MNL A;  2GEN A;  2IAI A;  3GTM J;  2HOS A;  2IEK A;  1UI5 A;  2KT0 A;  2G0E A;  2JA6 J;  4JP0 A;  1MBE A;  4YZE A;  4A3I J;  3FIS A;  4C3I J;  3V78 A;  2O9L A;  1RET A;  4A3D J;  2WB1 N;  2NX4 A;  3BR5 A;  4GFL A;  5EG0 B;  2CQQ A;  2LFB A;  1O4X A;  3LJL A;  3PAS A;  1GV2 A;  4ICH A;  3CQZ J;  3MVP A;  3KNW A;  5EFY A;  2OI8 A;  5E3N A;  4QTR A;  1SGM A;  1P7J A;  3JRF A;  1HDP A;  4KWA A;  3CDL A;  2UXH A;  4D7M A;  3VIB A;  3B6C A;  2DMN A;  4NDL A;  2DA6 A;  1GUU A;  5M3M J;  2R5Z B;  4V2G A;  4XID A;  3LSG A;  5EGO B;  2Y9Y A;  2LD5 A;  1IJW C;  3P9T A;  4BBS J;  4DYR A;  1IC8 A;  1JKO C;  2H8R A;  1ZK8 A;  4IHX A;  4M3B A;  3BR2 A;  5M5W J;  2DA7 A;  1TWG J;  1DU6 A;  1JKQ C;  2JK3 A;  2UXI A;  2LK2 A;  2MGQ A;  3VW1 A;  1HDD C;  5BNG A;  3C2B A;  2ECB A;  5F08 A;  3JRA A;  1B8I A;  3F0C A;  1YRN B;  2W48 A;  2X6O A;  3GTP J;  4I76 A;  3Q0W A;  4A3G J;  5J1Y A;  2LP0 A;  3OSF A;  3S2D J;  2ECC A;  1MH4 A;  1TWA J;  1ETO A;  2XGC A;  4A3K J;  2EH3 A;  4FE4 A;  2D6Y A;  4CGR A;  1WH5 A;  3ZQI A;  1Y1V J;  2CQX A;  3SJM A;  3AQT A;  5EEA A;  3BTI A;  2XSD C;  1BL0 A;  3AQS A;  2JMW A;  3PM1 A;  4MXM A;  1JTX A;  2M0C A;  3VPR A;  3GTL J;  2RHA A;  5HBU A;  2JJ7 A;  2Q24 A;  4GCK A;  2XB5 A;  2FD5 A;  3G7R A;  4FE7 A;  4B4C A;  1U9N A;  2ID6 A;  1G2H A;  1WPK A;  1TWF J;  5FKM A;  3ZQL A;  3LHQ A;  2LR8 A;  2B63 J;  4QSH A;  2MW8 A;  3JRE A;  1GVD A;  3IH2 A;  5FKO A;  1TC3 C;  3B81 A;  3DEW A;  3VUQ A;  5EYR A;  1QVU A;  3HOX J;  5F27 A;  3HDD A;  4W97 A;  4AC6 A;  2TRT A;  3M4O J;  3VW0 A;  3WHB A;  2LY9 A;  3BCG A;  1HLV A;  3VOK A;  1U8B A;  1QVT A;  1U78 A;  4B3A A;  3HTJ A;  2XB0 X;  3V6G A;  1EF4 A;  3VVX A;  3NAR A;  2DMU A;  1LE8 A;  3BR0 A;  1H88 C;  1XC5 A;  3HGY A;  3Q3S A;  1JTY A;  3E7L A;  1IDY A;  4M3E A;  3QQA A;  4D5F A;  4A69 C;  3FIW A;  1MSE C;  3VW2 A;  5F0F A;  1K61 A;  2L7Z A;  2NS7 A;  2ZOZ A;  3TW7 A;  3DCF A;  3S17 J;  3C07 A;  5K7F A;  4AC0 A;  4V2F A;  2VUM J;  4JKZ A;  1Y1W J;  3CJD A;  2AHQ A;  3PO2 J;  2H1K A;  2DJN A;  5F04 A;  1OJL A;  4GFB A;  4DW6 A;  2E2I J;  3JRI A;  2XPU A;  4BKX A;  3RH2 A;  5IP7 J;  2M34 A;  2GLO A;  5IP9 J;  3HGG A;  4AF5 A;  3FK6 A;  2NP3 A;  1FIA A;  1UG2 A;  3CCY A;  3NXC A;  3ANG A;  3FK7 A;  3G1L A;  1GT0 C;  2QIB A;  1ETV A;  5AQC A;  4JX4 A;  4AYB N;  4XRS G;  2GM4 A;  4W1U A;  2JA5 J;  3WHC A;  1WCM J;  5JLW A;  1GDT A;  2E19 A;  2LKX A;  4XRS A;  2HI3 A;  5DS9 A;  2IU5 A;  5K58 A;  2WV1 A;  2E2J J;  2N8G A;  1ETW A;  3SDG A;  4GCT A;  1UHS A;  5FGL A;  1B8I B;  1IUF A;  4UUS A;  5DTD A;  2EBI A;  1JJ6 C;  2E1O A;  4C3J J;  5IPA A;  4XIC A;  1X2N A;  4MIM A;  3HKZ N;  2EZH A;  1W0U A;  3ZOB A;  2Y2Z A;  2FQ4 A;  3IH4 A;  1ZKG A;  5FKN A;  3HTH A;  1ITY A;  2LVS A;  1SFO J;  4L62 A;  3BHQ A;  4UDS A;  3RD3 A;  4LOC A;  3BTJ A;  2VPR A;  1UMQ A;  3ZQH A;  4A3C J;  1AKH A;  3S1R J;  1NK3 P;  1JT0 A;  1I6H J;  1JGG A;  2XRL A;  4ABZ A;  3VOX A;  2XPW A;  1A6I A;  3LSJ A;  3SFI A;  5F0H A;  5EF6 A;  1HCR A;  4XK4 A;  3H3V K;  5C4J J;  3BQZ A;  4Y52 J;  3S5R A;  2O8K A;  1FTT A;  2LLK A;  5GP9 A;  1HF0 A;  3O8H A;  4A3F J;  2G7S A;  5F1J A;  2VI6 A;  4UUT A;  3TED A;  2XPV A;  3BR1 A;  2R5Y A;  3PPB A;  1H8A C;  3OOU A;  1ZGW A;  5J1U A;  2O7O A;  1IV6 A;  5FLV A;  1T33 A;  1VND A;  2NP5 A;  1XG1 A;  2RAE A;  2ME6 A;  3BTL A;  1RES A;  3I4M J;  1WH7 A;  2P81 A;  5C4X J;  1MSF C;  3KZ9 A;  3GZI A;  4IHW A;  1RKT A;  3HOU J;  1I50 J;  2ZOY A;  3HBL A;  3OIO A;  3HTI A;  3B6A A;  4M3D A;  3JRD A;  1JKR C;  5FMP A;  1NTC A;  2HQ5 A;  5C3E J;  1HOM A;  4RDU A;  1MNM C;  4BY1 J;  2K9S A;  2ID3 A;  2OF7 A;  4C2M J;  2G7G A;  2F07 A;  2FJ1 A;  5D18 A;  2OPT A;  3A01 A;  1ZTR A;  3HM5 A;  3BT9 A;  1WGX A;  3IUV A;  1LE8 B;  2PMZ N;  4MFD A;  2GBY A;  3NAU A;  5J3L A;  3BR3 A;  5J1R A;  1IDZ A;  2WAQ N;  2RAS A;  2WGB A;  3ON4 A;  2DTZ A;  1W0T A;  1F43 A;  2JN6 A;  2K9Q A;  2O7T A;  3T6N A;  2DMT A;  5IYD J;  1Z0X A;  2UXU A;  3S16 J;  5DAJ A;  1B72 A;  1E3O C;  3GTQ J;  2MG4 A;  2NOG A;  4JX6 A;  2DA3 A;  3IH3 A;  1ETY A;  3Q0U A;  3ZQC A;  3A02 A;  2MSY A;  4BBR J;  2ZCN A;  2VKV A;  2FX0 A;  4FTH A;  1X58 A;  1AHD P;  2QTQ A;  5JLX A;  3BG5 A;  3S1Q J;  4JYK A;  3I4N J;  2UXP A;  2YVE A;  4ACI A;  3QPS A;  3G1M A;  4BXX J;  5E3L A;  1ZR2 A;  1PUF A;  3E7Q A;  4DZJ A;  2ZCM A;  3NRG A;  3BG3 A;  3JRG A;  1FEX A;  4G12 A;  3ANP A;  4MO7 A;  5HOD A;  2EZL A;  2EZK A;  3L1P A;  4A93 J;  4A3J J;  1VFC A;  3VVZ A;  3JRH A;  4C3H J;  1BJZ A;  1MBH A;  2K40 A;  1VF9 A;  2X9D A;  1OFC X;  3LNQ A;  2X48 A;  3RZD J;  1NK2 P;  3NNR A;  4UUS B;  4A3E J;  5FKL A;  3QBM A;  3G1O A;  1ZQ3 P;  2XGE A;  2M2E A;  2NVT J;  2ME0 A;  4CYC A;  4D7N A;  4I6Z A;  2ZB9 A;  2PZ9 A;  2M9H A;  5FKK A;  4J19 A;  5IP6 A;  1LFB A;  4GCL A;  2QCO A;  3JSJ A;  2CRG A;  3CWR A;  1JUP A;  3GBG A;  2WUI A;  1QRY A;  2IBD A;  2QF7 A;  1AKH B;  5M5X J;  4FCY A;  1IG7 A;  2AO9 A;  3HB9 A;  3HOY J;  2DG7 A;  3KKD A;  2VKE A;  3MN2 A;  3BRU A;  4EEF G;  1MBG A;  4A3L J;  3GTG J;  2CUF A;  3W6V A;  5IYB J;  4B1R A;  2E2H J;  3M3Y J;  2REK A;  4Y7N J;  3MKL A;  4JX5 A;  4RBO A;  3JR9 A;  1U9O A;  2R5Y B;  1Q1V A;  3HIM A;  3G56 A;  5D1R A;  2QWT A;  1WI3 A;  5IYC J;  1VI0 A;  3D1N I;  3O8G A;  2GUH A;  1FIP A;  2CU7 A;  2I10 A;  5CXG A;  5GPA A;  2M8G X;  5M3F J;  5IOY A;  3TP3 A;  3K2A A;  2JWT A;  4DYC A;  2DA4 A;  4M3G A;  3HE0 A;  4NEL A;  4JNN A;  1RR7 A;  1UI6 A;  2L7F P;  3LSP A;  1X2M A;  1CQT A;  3IV5 A;  1LFU P;  3BJB A;  1ETX A;  2XGD A;  3S14 J;  5D19 A;  3GTO J;  3A01 B;  5HAW A;  1D5Y A;  5CW8 A;  2FBQ A;  2JA7 J;  1TWC J;  2L0K A;  3PO3 J;  1I3Q J;  1BW6 A;  5EZH A;  2R7Z J;  4GFK A;  2R93 J;  3COL A;  1AU7 A;  3ON2 A;  3ZQF A;  1MBF A;  3GEU A;  1B72 B;  2NVX J;  2YU9 J;  5HSZ A;  2HXI A;  3S15 J;  3RKQ A;  3HEF A;  1QPI A;  2DA2 A;  1POG A;  2HDD A;  1MBK A;  1S7E A;  1A5J A;  3VP5 A;  2DN0 A;  4JL3 A;  4L5E A;  1GV5 A;  2L7M P;  4IHY A;  3QPL A;  4ME9 A;  4NN1 A;  1JUS A;  5GPC A;  4MK6 A;  2KDZ A;  2YUS A;  1PUF B;  2UXO A;  3F1B A;  5EZG A;  2HYJ A;  3BR6 A;  2HOT A;  2TCT A;  2NVY J;  3RQI A;  3LSR A;  3S2H J;  1BA5 A;  3S1M J;  4DZP A;  2V57 A;  5EDN A;  4BY7 J;  2R92 J;  3K7A J;  5FLM J;  5EG0 A;  2DG8 A;  3HOZ J;  3FKI J;  3LOC A;  2OER A;  2Y9Z A;  1FJL A;  2HKU A;  2NVQ J;  5F0C A;  3RZO J;  5FHP A;  2L9R A;  1K83 J;  1APL C;  2GFN A;  4M3F A;  4CYC B;  2CUE A;  3KKC A;  3TP0 A;  1JUM A;  1JT6 A;  1MBJ A;  2CJJ A;  5C44 J;  1XS9 A;  4D5C A;  1Z77 A;  3A03 A;  4MLO A;  2R0Q C;  3GTK J;  4M6V A;  2HOA A;  2R5Z A;  1SAN A;  5M5Y J;  2NS8 A;  2QKO A;  4AUX A;  5EGO A;  2ZCX A;  3HOW J;  4IEJ A;  5K7H A;  4A3M J;  3JRC A;  3EUP A;  2Y30 A;  4S0H B;  2COB A;  2DMQ A;  2HYT A;  5FJ8 J;  2JA8 J;  2G7L A;  2PBX A;  3EGQ A;  1P7I A;  4A3B J;  2Y0S N;  3S1N J;  3NI7 A;  1DU0 A;  3DPJ A;  4HKU A;  1ETQ A;  2DA5 A;  1IRZ A;  3JRB A;  3BQY A;  3UKG A;  3BNI A;  2Y31 A;  1OCP A;  5K7Z A;  1YRN A;  3LWJ A;  2LTP A;  2DA1 A;  9ANT A;  1BW5 A;  2HXO A; 
#chains in the Genus database with same CATH topology
 3FXK A;  3VB2 A;  5TIS C;  4M71 A;  1XSV A;  2HTS A;  3IRQ A;  2XF7 A;  1RPW A;  2K9N A;  2EQR A;  4HNV A;  1UHW A;  1USS A;  3CES A;  1YS6 A;  3PQK A;  4FIS A;  4N9I A;  1JKP C;  2Y48 A;  1E0E A;  1AOY A;  5D5X B;  1F36 A;  1ETK A;  1XGO A;  3OYK A;  5KVR A;  2QEN A;  2DO7 A;  2UV1 A;  4LLL A;  4KIB A;  4KT6 A;  3CRJ A;  3GUD A;  4XLN F;  1FTZ A;  3WG7 H;  4DJA A;  2HVR A;  1FC3 A;  1HBX G;  4N9H A;  1VQ5 I;  3M8J A;  3RPU A;  2GXB A;  1A36 A;  2BV6 A;  1E17 A;  2LNB A;  1K78 B;  3E5X A;  3OYI A;  4QIW N;  3Q0V A;  3HRM A;  4BJ5 C;  3N4M A;  1IGN A;  2EFO A;  2Q1Z B;  1QPM A;  3B73 A;  1GVJ A;  2IAI A;  3IUO A;  5GTH C;  2IEK A;  5ICC A;  4LGW A;  2PJR A;  1BOA A;  2CQN A;  3F6V A;  3VSK A;  4MEX F;  1LDD A;  4G9Y A;  2VKH A;  4EM2 A;  5CVU A;  4A3I J;  4EJO A;  4F55 A;  5CKT A;  1DDN A;  2NX4 A;  1NG7 A;  3NWS A;  2F5F A;  2P6T A;  2LFB A;  2OCC H;  4UXN A;  1T38 A;  3PAS A;  1K6Y A;  5FLX K;  2F5E A;  1P6R A;  5E3N A;  5L3D A;  4YFN F;  2DLL A;  4DQ2 A;  1HDP A;  1IUY A;  4Y4R A;  1TLH B;  2FXA A;  2FU4 A;  4PK4 A;  4OIR F;  3D0S A;  1ZRC A;  3DTE A;  5LRS A;  4UHT A;  2A2F X;  5J47 A;  2CS3 A;  4I02 A;  2Q2E B;  3JCU C;  2DOF A;  1S3J A;  3CCJ I;  1DUX C;  4XQF A;  4M3B A;  2XC7 A;  1N77 A;  1TQM A;  3BR2 A;  2WY7 Q;  4RLQ A;  3CO6 C;  2PMH A;  3WG9 A;  3H1C A;  3Q9V A;  2PEX A;  3EYY A;  1DU6 A;  3CC2 I;  4LIU A;  3QP6 A;  4B48 A;  1T39 A;  1LEA A;  1ON1 A;  2E1M C;  2ECB A;  5F08 A;  1IRZ A;  1YRN B;  3GTP J;  1L0O C;  5H6R A;  2EB7 A;  1PJR A;  1WI9 A;  2HQR A;  4ZZL A;  4A3K J;  2EH3 A;  4LIT A;  1RRJ A;  3BTI A;  2KIM A;  4MXM A;  1EH7 A;  4XL9 A;  1H9T A;  3C3W A;  2EIM H;  3PIP F;  3L2R A;  3CDH A;  3HYI A;  1DPR A;  2JJ7 A;  2YX4 A;  2XB5 A;  2FD5 A;  3VFZ A;  4OD5 A;  3KEQ A;  1LFP A;  1YJW I;  3FDY A;  4AIK A;  3O3K A;  2A05 A;  2KQR A;  3I54 A;  3ZQL A;  3U1K A;  4CCM A;  3JRE A;  1FNN A;  3IH2 A;  2A07 F;  1W1W E;  2BOL A;  3KIO A;  3B81 A;  3VUQ A;  1X1A A;  2R7D A;  1WHU A;  3DF8 A;  1QVU A;  1HKS A;  2OTL I;  4NB5 A;  1LVK A;  4XR6 A;  4BXU A;  5D5V B;  3HOS A;  3LFU A;  2DOA A;  3VW0 A;  3BCB A;  2DFI A;  2KDO A;  2VT3 A;  4Y15 A;  1BR2 A;  4AVP A;  1U8B A;  1QVT A;  1VTN C;  1U78 A;  4NC7 A;  1XGS A;  2KIF A;  2VT2 A;  1QZZ A;  2IW5 A;  3HGY A;  5BMZ A;  4O3M A;  2K9L A;  1SFE A;  1JTY A;  2L54 A;  4CCL A;  4M3E A;  4D5F A;  3BRO A;  3QQA A;  1Z7U A;  4B8X A;  2GQQ A;  1YIJ I;  5B1B H;  1TZL A;  5HNF A;  1SC7 A;  1MSE C;  3JAM Z;  2NS7 A;  3PFI A;  3TW7 A;  1OIS A;  3L00 A;  4CO8 A;  3FXM A;  1G3W A;  3K4B A;  5E8G A;  2R7S A;  2V4J C;  2KRF A;  2XIG A;  5CVJ A;  2DJN A;  4DW6 A;  2E2I J;  1V3F A;  2XPU A;  4OAY A;  5D4S A;  4GYI A;  2M34 A;  3DPU A;  2DYS H;  5IP9 J;  5CYV A;  4ETS A;  4L0Y B;  3CCY A;  3NXC A;  2BW3 A;  3CO7 C;  4KMU X;  1GT0 C;  3K69 A;  2B1E A;  1SFX A;  1ETV A;  4JX4 A;  3DEE A;  1LUJ B;  2DTR A;  2JA5 J;  1Z9C A;  4NHJ A;  1TT0 A;  2M1B A;  5JLW A;  2E19 A;  4PCQ A;  5J8F A;  3F8C A;  2LKX A;  4XRS A;  2KRC A;  2E34 A;  2WV1 A;  4A2U A;  2N8G A;  3CLO A;  1ETW A;  2VBX A;  3TBI A;  1R36 A;  5J6X A;  4UUS A;  5DTD A;  2E1O A;  2ESN A;  2XRN A;  1W0U A;  4LLG F;  3ZOB A;  3TL4 X;  2CUZ A;  5E79 C;  5FKN A;  4G94 A;  1B6A A;  3Q9S A;  1SFO J;  4L62 A;  4F92 B;  4RGS A;  3ZQH A;  3A0H C;  1JGG A;  1WJ5 A;  5LGT A;  3SFI A;  3N97 A;  2X6W A;  3OYF A;  4ITV A;  2KIS A;  3VYT B;  5C4J J;  4J01 A;  4Y52 J;  3RQ4 A;  2O8K A;  1OCC H;  1FBU A;  4XM3 A;  3CZ6 A;  1TW2 A;  2VI6 A;  2K02 A;  4KFC A;  3QYF A;  2YPR A;  3CMA I;  1H8A C;  2CH0 A;  1X4O A;  4WIB A;  2O7O A;  4KT5 C;  2ZJR F;  4UV8 A;  1R00 A;  3F21 A;  1IV6 A;  1XG1 A;  5FLV A;  2VJ4 A;  4NC6 A;  4CZC A;  4IHS A;  4HW0 A;  3L2Q A;  4F7Z A;  1QZE A;  1SD5 A;  4Q47 A;  1G4D A;  4IHW A;  3GZI A;  3IRR A;  1VQ6 I;  3KP4 A;  1J5Y A;  2ZOY A;  3OIO A;  2ZSI B;  3B6A A;  1MDM A;  1JKR C;  4I98 B;  4RAF A;  3CCM I;  2W25 A;  4RDU A;  3T5X A;  2X85 A;  2L3D A;  2BVM A;  2ACJ A;  1R58 A;  2KZG A;  3GFM A;  4BY1 J;  4IO9 F;  3A01 A;  3OOP A;  4RLF A;  2G7U A;  2KFD A;  2V9K A;  3L09 A;  1LE8 B;  3A4C A;  4M9S A;  4MFD A;  4DGW B;  2WV0 A;  3BR3 A;  5J1R A;  4XKW A;  4YFX F;  3CCU I;  3CTA A;  2DDA A;  2XUB A;  5KAF C;  1WQ2 A;  1Z6T A;  2DTZ A;  1W0T A;  2JN6 A;  1GXQ A;  3K1M A;  3CJR B;  1LDJ A;  3VSL A;  5IYD J;  2ZY9 A;  3T6N A;  2BXY A;  4U7B A;  5DAJ A;  1B72 A;  3GTQ J;  3ZRG A;  5ILV A;  2NOG A;  2JTV A;  2DA3 A;  3IH3 A;  3AL0 B;  4I0B A;  4YIF A;  3A02 A;  1ZYR F;  4HLY A;  4OD4 A;  4LMY A;  1MW7 A;  3KET A;  4ENN A;  3ZQ7 A;  2G7H A;  2YR2 A;  4HV6 A;  1FP1 D;  4E7J A;  1X19 A;  3G1M A;  2WBM A;  2DDB A;  2GOM A;  3OR2 C;  3SXY A;  4GCV A;  1MD0 A;  2ZCM A;  2OA4 A;  2W84 A;  1SEU A;  3ZMZ A;  3ANP A;  2F2E A;  2V6C A;  2K3F A;  1Y56 A;  2LY1 A;  2XKP A;  4A3J J;  2VIX A;  1BJZ A;  1MBH A;  1K4T A;  1OFC X;  2NVT J;  1SAU A;  4LK0 F;  2FBK A;  3F8F A;  2LYC A;  3H5N A;  4CYC A;  2ZB9 A;  4GCL A;  4G6T B;  2QCO A;  4H4K C;  1BJA A;  1JUP A;  3GBG A;  1D8J A;  3BZK A;  1QRY A;  2IBD A;  1HKQ A;  5M5X J;  2AO9 A;  1CF7 A;  2LMD A;  3MN2 A;  2R7T A;  3BRU A;  4LJZ F;  4EEF G;  3HUG B;  5HLG A;  5D8L B;  1WKM A;  3G2B A;  2OC6 A;  1IXS B;  5IYB J;  4B1R A;  3K8P C;  4HG2 A;  4Y7N J;  3COA C;  3PUB A;  4O5V A;  2W7N A;  5IT9 K;  1U9O A;  2M45 A;  3CP8 A;  4P5O A;  1IN5 A;  3L7W A;  1YOV B;  1JHH A;  1VQP I;  3I5U A;  4MGR A;  4EQQ A;  4ZYA A;  5GPA A;  4L9N A;  2KJB A;  3ABM H;  3OYN A;  1Y0N A;  3SHF A;  4IKF A;  2OV7 A;  1NG6 A;  2GA1 A;  1EKE A;  2PMU A;  4KN7 X;  3V7S A;  2DJI A;  3E3V A;  4BEH B;  4CCO A;  3X2Q H;  1ETX A;  2K7L A;  5B3S H;  5HS8 A;  5JVG F;  5D19 A;  3J81 Z;  4U9N A;  1LEB A;  2AQE A;  1KQ0 A;  4L9J A;  5HS7 A;  3G71 I;  1TWC J;  2FRH A;  3KYL A;  3FZV A;  4GFK A;  3KX2 A;  3KEY A;  3COL A;  1FOY A;  3GEU A;  5DDG A;  1ZAO A;  4YG2 F;  3W6J B;  2YU9 J;  1ZAR A;  4E70 A;  2QUF A;  4JOM A;  4UVB A;  3EPZ A;  3RKQ A;  1O7L A;  3W6K B;  1K78 A;  4OIP F;  2VB6 A;  2DA2 A;  1SMY F;  1MBK A;  1S7E A;  1N75 A;  5K5R A;  1YI2 I;  4CYD A;  3VEP A;  3J7A Y;  3I4P A;  2CQK A;  3L9F A;  5D4R A;  1IAW A;  4MQ9 F;  4P1W A;  1JUS A;  2ZXI A;  3KFW X;  3C7J A;  3KYC B;  3DU6 A;  2E60 A;  1MJA A;  1FY7 A;  1YW8 A;  2DW4 A;  4D1Q A;  1LNW A;  3I56 I;  5EZG A;  3MEX A;  3R0J A;  5FB2 A;  3BR6 A;  1KQ8 A;  4BY7 J;  3WE2 A;  5FRM A;  3V4G A;  3OL4 A;  2VC0 A;  5DD8 A;  2NVQ J;  5F0C A;  5A2Q Z;  4HBL A;  4ON0 A;  3TOA A;  2AQF A;  4ZTJ A;  3TOB A;  1R4M B;  2DBB A;  2OCE A;  2LSO A;  1K79 A;  4RA2 A;  4D5C A;  5HVQ C;  3DBR B;  4MLO A;  1TL8 A;  4M6V A;  5E20 A;  1UAA A;  5M5Y J;  5DCF A;  2RGV A;  4BAY A;  3HOW J;  4IEJ A;  5K7H A;  3S3O A;  1HSJ A;  3M9A A;  4HNT A;  2Q2E A;  2CGP A;  2HYT A;  4ANJ A;  5FJ8 J;  2JA8 J;  4IOC F;  3S1N J;  3GO5 A;  2ZSH B;  1ETQ A;  2VJI A;  3ABK H;  3BQY A;  4WF2 A;  2F5V A;  4EJU A;  2K85 A;  1OCP A;  2E5N A;  4PFO A;  1FMV A;  1X1P A;  1YRN A;  2HXO A;  2D5V A;  1S29 A;  4B09 A;  2QZ8 A;  3FRQ A;  3GEZ A;  1DQU A;  3H5R A;  1T56 A;  4G8X A;  3OYE A;  3GTJ J;  2QQA A;  3QYB A;  1G3Y A;  3C2H A;  1ZLK A;  1YQA A;  2NRA C;  2JPB A;  1TT5 B;  1BOB A;  1ZG5 A;  2XDN A;  2STW A;  5IOZ A;  3HTU A;  3VOD A;  2ZCW A;  3M8F A;  1R9T J;  3HOV J;  3BJ6 A;  4HYE A;  2R7W A;  2PFV A;  1ORK A;  5DYM A;  5EEH A;  1VQ4 I;  1MND A;  1UST A;  4BQO A;  5H9T A;  3H36 A;  4HF1 A;  1FOK A;  1S7O A;  1FSH A;  1MH3 A;  1EA3 A;  2E7X A;  5DEQ A;  1R5I D;  4X1E A;  4DYQ A;  1ZR4 A;  5E3M A;  2JRT A;  1BIB A;  3MNL A;  2A5Y B;  1UI5 A;  1J7K A;  3S32 A;  3E97 A;  4YZE A;  2VOP A;  2HKX A;  3FIS A;  1YIO A;  2O9L A;  2XAS A;  1OR7 A;  1O3R A;  4A5M A;  2EIJ H;  4GFL A;  2O03 A;  2XVC A;  4NNJ A;  1GV2 A;  3K4C A;  2JA2 A;  2LC2 A;  4QTR A;  1RI7 A;  3OYM A;  2CG4 A;  2FF4 A;  2KIQ A;  3BY6 A;  3O6B B;  4L5I A;  4PJM A;  4BJ6 C;  2ZJQ F;  2BEO A;  2XAQ A;  1PP7 U;  2UXH A;  2V9P A;  5ICE A;  1GUU A;  1Z7L A;  3LQQ A;  5M3M J;  5BOX A;  4XID A;  5D5U B;  1YJ9 I;  3DKY A;  1IJW C;  1WJF A;  1BR1 A;  4I2O A;  3QPH A;  3IC7 A;  1Y8Q B;  1XPX A;  3AG2 H;  2H8R A;  1XMA A;  3ML6 A;  5LEK A;  2COM A;  1U0J A;  2KP6 A;  1E3P A;  4IRI A;  3ZMV A;  2E36 A;  1MNE A;  2VON A;  3BC8 A;  1P9Q C;  2MGQ A;  3F3X A;  1YW7 A;  4V19 K;  3ISP A;  1J09 A;  1R23 A;  3CMM A;  3H3U A;  4UB8 C;  4Z6Y A;  1T0F A;  2E1N A;  1IV8 A;  2W48 A;  2X6O A;  5J8C A;  1IRF A;  2LP0 A;  3S2D J;  4HQM A;  2ECC A;  1BI1 A;  1ETO A;  2HKO A;  2MD5 A;  2JSP A;  1OCZ H;  4ZDL A;  2KLO A;  4WK8 F;  3V7C A;  5IY5 H;  3K70 C;  1Y1V J;  2CQX A;  2XKO A;  1T8I A;  2CW7 A;  4RMN A;  2XSD C;  1BL0 A;  2E1C A;  2K9M A;  4XOP A;  2GXA A;  3OYC A;  1LB2 A;  4LLN A;  2H6C A;  2DYR H;  3G3Z A;  3DU5 A;  1Q1H A;  1U5T C;  2I8D A;  2VQH A;  2IS6 A;  4D9J A;  2XAU A;  3G7R A;  3DXJ F;  1OYY A;  1XB4 A;  2F6C A;  3ROU A;  4PGH A;  4ENJ A;  3KCC A;  1WPK A;  3RPU D;  5FKM A;  5TGT A;  4E7H A;  4E7L A;  5J4Y A;  2GOX B;  1S9H A;  2LR8 A;  4QSH A;  3FMR A;  4HF0 A;  5FRO A;  1GVD A;  5FKO A;  1ZG3 A;  3ABU A;  3HJE A;  3TO7 A;  1E3H A;  1DGR M;  3EYI A;  3HOX J;  3HDD A;  2L9N A;  2EIL H;  2ISY A;  2HDW A;  2TRT A;  2ZXJ A;  2G9W A;  5HDN A;  4EGY A;  3HPH A;  4C2T A;  4MTE A;  2XB0 X;  1MIJ A;  1W4M A;  2CW8 A;  3V6G A;  3SZT A;  3J7Z I;  1LE8 A;  1J9I A;  1XC5 A;  3MKZ A;  4A5N A;  4DVY P;  3OMY A;  3E7L A;  5GAH J;  2FSW A;  1SD7 A;  2QGU A;  2L5Q A;  3EUK L;  3VYS B;  1K61 A;  3VW2 A;  1WJD A;  5H20 A;  3IWF A;  3S17 J;  3C07 A;  5K7F A;  1D1B A;  1TNT A;  4V2F A;  3ASN H;  4AC0 A;  1Y1W J;  3CJD A;  5B66 C;  4KIC A;  2XF5 A;  3S8P A;  2H1K A;  1QA6 A;  3LQR A;  4CIC A;  2IJL A;  3ASO H;  4GFB A;  5ED4 A;  3I71 A;  3JRI A;  1JXS A;  3RH2 A;  4AF5 A;  1KON A;  2HYF A;  3ANG A;  3SZG A;  3CCL I;  4PFP A;  2DPD A;  3F72 A;  3J80 Z;  1G59 A;  1D5V A;  2P0W A;  3M1C A;  3GX4 X;  2GM4 A;  4W1U A;  3WHC A;  3MZY A;  2O6G E;  5KHD A;  1R5H A;  2JQ7 A;  1ULY A;  2XGX A;  2IU5 A;  5K58 A;  4WXC A;  2VLA A;  3OS0 A;  3SDG A;  1XDS A;  1B8I B;  1JJ6 C;  2EBI A;  1EV7 A;  5IPA A;  4MIM A;  3HKZ N;  2EZH A;  3QU3 A;  1EH8 A;  3FXL A;  4DIQ A;  1QHH D;  2D2W A;  4ZC3 A;  1ZKG A;  1L3L A;  2D1H A;  2PFB A;  3SEZ A;  4LOC A;  2VPR A;  1UMQ A;  4A3C J;  1V55 H;  3FMQ A;  3ZCO A;  1N78 A;  1NK3 P;  4ENM A;  3G73 A;  1I6H J;  3E5U A;  1HW1 A;  3VOX A;  5HDK A;  5EF6 A;  3H3V K;  4Y3O A;  2A3S A;  2UXX A;  3HUG A;  3RI4 A;  2Q8K A;  2ZFW A;  2V26 A;  1GXP A;  2LLK A;  1MJB A;  5F64 A;  1G3S A;  2Z3Y A;  1YJN I;  2XPV A;  3CF5 F;  4L0Z B;  5B1A H;  1KU9 A;  3OOU A;  3VTI A;  1BBY A;  1ZRE A;  4G7O F;  1BI0 A;  1VND A;  2E5Z A;  2HNH A;  2NP5 A;  3ONQ A;  4XLE A;  3WTY C;  2QA4 I;  1STZ A;  3OYJ A;  5GAG J;  3SDB A;  1IRG A;  4ZH4 F;  2P81 A;  1T2K A;  4IJA A;  5LGU A;  4UUV A;  2HOE A;  5E17 F;  3HOU J;  1MGT A;  2EJR A;  3HBL A;  5H2F C;  3DKW A;  4U88 A;  4M3D A;  1NTC A;  4BEH A;  2HQ5 A;  4ZYG A;  2ZNY A;  1YW9 A;  2OF7 A;  2HWV A;  2F07 A;  5B5E C;  4Q4Z F;  2K4B A;  2MAB A;  2RRE A;  3HM5 A;  2FE3 A;  3KZI C;  2C6Y A;  4XLC A;  2DT7 B;  2IGM A;  2HR3 A;  4EJT A;  5CVR A;  2M8E A;  2FBH A;  2GBY A;  5J3L A;  1IN6 A;  2RAS A;  3LFK A;  2WGB A;  3BG6 A;  2R7O A;  2WAF A;  3QOP A;  2IA1 A;  2VE9 A;  2K9Q A;  1QQI A;  1Z0X A;  3S16 J;  2EV0 A;  2CFO A;  4NQW B;  2EFN A;  2MG4 A;  4Y33 A;  2X6Y A;  3JSP A;  1F4K A;  4AWX B;  2BHY A;  1FYM A;  1OKR A;  2ZXH A;  3K4N A;  1SMT A;  2VKV A;  2LKP A;  2FX0 A;  1X58 A;  3M07 A;  1X1C A;  1TTY A;  4KA4 A;  4BS9 A;  1AHD P;  2QTQ A;  4QPQ A;  5JLX A;  3MWM A;  3BG5 A;  1OPC A;  3IL2 A;  4JYK A;  4PSX A;  3I4N J;  5DD4 A;  4ACI A;  1FSE A;  3E7Q A;  1W5C C;  1XGN A;  4AD9 A;  3DWL E;  3RDI A;  2JVH A;  3BG3 A;  5DUK A;  4H0E A;  3KLO A;  3MMY B;  2E71 A;  2EPF A;  5L3E A;  4CHU A;  2VBZ A;  3VVZ A;  1MZB A;  5DM7 F;  2DFE A;  1XSX A;  4BDY A;  1MMS A;  1LJ9 A;  3LNQ A;  4XBF A;  3QBM A;  4A3E J;  1GLN A;  3G1O A;  1OCR H;  2XGE A;  2M2E A;  4CDG A;  1YIT I;  3PSI A;  3LSM A;  2ME0 A;  2IGN A;  1YO5 C;  4I6Z A;  1Z67 A;  2X1C A;  2EWN A;  2M9H A;  3KP3 A;  4GDF A;  1BI2 A;  4IQJ A;  3CUQ B;  3JSJ A;  4M73 A;  4LK1 F;  2ZJP F;  4L9V A;  3JAM K;  3HOY J;  1FP2 A;  3C2G A;  2VQL A;  3SQN A;  4LFU A;  2B0L A;  2VN2 A;  2XAJ A;  3F8M A;  3GTG J;  2CUF A;  3OR1 C;  4II2 A;  3MFK A;  2MH9 A;  3ECH A;  2E2H J;  3KP2 A;  2O8X A;  2REK A;  3K6G A;  4D0P A;  1ONV A;  2R5Y B;  1Q1V A;  3HIM A;  5LEJ A;  2QWT A;  1B4A A;  3EET A;  3V42 A;  5IYC J;  3D1N I;  3O8G A;  4KIG A;  2H09 A;  3ZMS A;  2CU7 A;  4ZZD A;  4NBQ A;  1T6S A;  1X3U A;  2QYO A;  4IOA F;  3K2A A;  1BM9 A;  4DYC A;  3KZY A;  4BAC A;  3AAF A;  2IRF G;  1X1D A;  1IN7 A;  5GAD J;  4JNN A;  2BBY A;  4RB3 C;  5CQE A;  4HX8 A;  1Y6I A;  3K4L A;  4AM3 A;  3MQ0 A;  2XGD A;  1YE9 A;  2A61 A;  4HA8 A;  2H27 A;  1S5L C;  3HRU A;  4F52 A;  2V1U A;  3CJN A;  1G6N A;  5H6Q A;  3B02 A;  2RDP A;  2FBQ A;  1OMI A;  2L0K A;  4XKC A;  1I3Q J;  4I7H A;  5EZH A;  3OYA A;  1PUE E;  1XD7 A;  4YEL A;  2R93 J;  4CZZ A;  2M30 A;  2ZXW H;  3E6D A;  2Z9O A;  1Y8R B;  5TJJ A;  1WJA A;  1RNL A;  3FBN B;  2HXI A;  5JI6 A;  3DKX A;  3HEF A;  2ZME B;  4XON A;  3I53 A;  2WWY A;  2DN0 A;  4XSX F;  2L7M P;  4IHY A;  3QPL A;  1XGM A;  3PFY A;  1ZH5 A;  3ESW B;  4NN1 A;  4EM0 B;  3RSN A;  3RKX A;  2KDZ A;  1XTA A;  4C9Y A;  3K1P A;  2QM3 A;  2UXO A;  4CA0 A;  1X4P A;  1IXR C;  1LDK B;  3MD2 A;  2EIK H;  3M8E A;  2UXN A;  4A0X A;  1SFK A;  2HOT A;  2AXT C;  3LSR A;  2H94 A;  1ODD A;  1PDN C;  3BLY A;  3S1M J;  4DZP A;  5CVV A;  3ZP5 A;  3K7A J;  5FLM J;  3WGG A;  3I59 B;  2HQN A;  3LOC A;  5JR3 A;  3HOZ J;  1D1A A;  3TQN A;  2PBI A;  4HQE A;  2Y9Z A;  3FXR A;  1DPU A;  1I27 A;  1K83 J;  1KA8 A;  1REP C;  2CUE A;  3F8N A;  3HIF A;  1A35 A;  2CJJ A;  3HC7 A;  4KDP A;  4ZDO A;  4KNY A;  1LPQ A;  1R4N B;  3K4M A;  2V1X A;  4BH9 A;  2R0Q C;  4HRI A;  2HOA A;  2HVS A;  1HKT A;  2NS8 A;  2QKO A;  4AUX A;  4A3M J;  1WWX A;  2NYX A;  3EUP A;  1KU3 A;  3LSH A;  2COB A;  3WGH A;  4FAS D;  2OD5 A;  4FX4 A;  2PBX A;  2M87 A;  4HDU A;  3TDZ C;  1I39 A;  2P8T A;  3NI7 A;  5L3B A;  1DU0 A;  2WY8 Q;  4OIN F;  4IVN A;  5HLI A;  3JRB A;  2DQL A;  4LD5 A;  4FQG A;  2ISZ A;  3V8J A;  4LB6 B;  4JK1 X;  1RUN A;  3BNI A;  2DA1 A;  9ANT A;  1TQP A;  3TW6 A;  2JVG A;  2EA2 A;  3U9G A;  3CMY A;  1QHG A;  4I0A A;  1RKW A;  4X6A J;  2W57 A;  2QSH X;  2P5L C;  3HTA A;  3QKX A;  5LD2 C;  4IHV A;  5J40 A;  1KU7 A;  5CXI A;  1FT9 A;  2DT5 A;  2QQB A;  3QAH A;  3PNV A;  3IWZ A;  4C2M A;  3TO9 A;  2P4W A;  3GFI A;  1S72 I;  2F5C A;  3DLA A;  2YSR A;  3W2W A;  1BIA A;  2W4S A;  2L7K A;  1JJ8 C;  2HFH A;  3W3C A;  4IRH A;  5E3O A;  4QPO A;  1D0Y A;  4CH7 A;  1MMN A;  3NQO A;  5LHH A;  3IP4 B;  1D0X A;  3AKZ A;  1OCT C;  2MFZ A;  3RPQ A;  2G3B A;  2F5D A;  3OWT A;  2XF6 A;  3OYD A;  4PXI A;  1EH6 A;  1QGP A;  2XAF A;  3I55 I;  4U0V A;  4S04 A;  1UZC A;  3WTU C;  1FZP B;  3KE2 A;  1YX3 A;  2CV0 A;  1D3Y A;  2M4G A;  2R7R A;  1TWH J;  3O60 A;  4GGG A;  2RC4 A;  3ZPL A;  3N05 A;  4L9T A;  2E1M B;  5DUI A;  5FGM A;  2KT0 A;  2G0E A;  3LST A;  4JP0 A;  1J0R A;  4BE0 A;  2DI3 A;  3RKW A;  4N0B A;  5FFX A;  2QEX I;  2DOE A;  3V78 A;  1U6G A;  2WB1 N;  4P96 A;  5D5W B;  3OYL A;  1ZG1 A;  3BR5 A;  4XKB A;  5EG0 B;  2CQQ A;  3DEU A;  1KGS A;  2P5V A;  2FMY A;  2LF7 A;  3F9K A;  3FWE A;  3BPX A;  3H9G A;  2LBF B;  4BXF A;  3LAJ A;  4ICH A;  1FWZ A;  1A04 A;  2X1E A;  3CQZ J;  3MVP A;  3KNW A;  3CLQ A;  3F22 A;  3JRF A;  2FML A;  2XAH A;  5FD6 A;  4KWA A;  2LH9 A;  4E7Z A;  4D7M A;  3VIB A;  2NS0 A;  3PJR A;  4NDL A;  5KK1 A;  3JTG A;  4V2G A;  4DBR A;  3LSG A;  2Y9Y A;  4E7K A;  3DLL F;  3P9T A;  4BBS J;  4DYR A;  1KQ9 A;  1JKO C;  2OZ6 A;  2Q0O A;  1LQ1 A;  1ZRD A;  4MQV A;  5JVT A;  1ZK8 A;  2LRE A;  4IHX A;  4PZJ A;  1YYV A;  2EFW A;  4U0Y A;  2J5P A;  1BR4 A;  1HXD A;  2JK3 A;  2KPM A;  1BC8 C;  5FRN A;  2R4G A;  4U9L A;  2CFX A;  5DCM B;  1HDD C;  3C2B A;  1RZ4 A;  4RAZ A;  1B8I A;  3JRA A;  2CO5 A;  3F0C A;  1I6X A;  4I76 A;  3KEO A;  4WX9 A;  5IT3 A;  2P6S A;  5J1Y A;  2F4I A;  3M7G A;  3OSF A;  1K6O A;  2ESH A;  4R8H A;  4PJJ A;  1TWA J;  1UHM A;  2XGC A;  4FE4 A;  4XLF A;  1WZ2 A;  2STT A;  3A0B C;  1V5F A;  3ELK A;  3ZQI A;  3ZMD A;  3SJM A;  3AQT A;  5EEA A;  3CCQ I;  2CW0 F;  2JMW A;  3PM1 A;  1JTX A;  2M0C A;  5LFA A;  2LG4 A;  3GTL J;  2IS4 A;  5HOO A;  2AS5 F;  4GCK A;  2VQC A;  3AG3 H;  2PMZ A;  3EUH A;  4OAZ A;  4DOZ A;  2XV4 S;  4FE7 A;  4R1H A;  2MYS A;  2WAQ A;  2ID6 A;  3L2U A;  2ZO4 A;  2L9V A;  1P92 A;  3I64 A;  1F5T A;  3JTH A;  2QKM B;  1Z91 A;  2B63 J;  2MW8 A;  3GVA A;  4E6K G;  4OU0 A;  1W5S A;  3WOD F;  3S3M A;  1IF1 A;  3DEW A;  5EYR A;  3K9T A;  3J7Y J;  4G7Z F;  1KU2 A;  4EJV A;  3CME I;  1FYL A;  4JBA A;  3WTW C;  1YG2 A;  1QO0 D;  1P4X A;  4W97 A;  5AIQ A;  4A12 A;  1HLV A;  1E2X A;  3VOK A;  2M3A A;  3HTJ A;  2F4M B;  2HVQ A;  3VVX A;  3NAR A;  4IZZ A;  1H88 C;  3WTV C;  4XNF A;  1Z3X A;  2DK8 A;  3CJQ B;  4ZJZ A;  3DPT A;  4A69 C;  4UY8 I;  2PG4 A;  1JGS A;  2ADU A;  3IKT A;  4NQW A;  2KKO A;  3FM3 A;  2ELH A;  2H6B A;  4Z2Y A;  3RYP A;  3FF5 A;  4RGR A;  4XOR A;  5E1Z B;  2AHQ A;  1V5G A;  3HXL A;  2V6E A;  2DOD A;  2TDX A;  5ERI A;  3VYU B;  1OJL A;  5FFZ A;  3HRT A;  4BE1 A;  4BKX A;  2HGC A;  5IP7 J;  2W00 A;  3HGG A;  3FK6 A;  2BY2 A;  1FIA A;  1UG2 A;  1VQK I;  3FK7 A;  3G1L A;  2QIB A;  3PIO F;  2VXZ A;  3T8R A;  2DPU A;  5AQC A;  2L9S A;  4XRS G;  2L02 A;  3L2W A;  3MKW B;  1WCM J;  3H3Z A;  5CVI A;  5TRD A;  2HI3 A;  5DS9 A;  2E35 A;  2QBY B;  4K2E A;  2Z99 A;  4C2U A;  4KMF A;  4GCT A;  1UHS A;  2X6X A;  3UR3 C;  1XCB A;  2KMU A;  2VJ5 A;  4BU2 A;  3HOT A;  1BC7 C;  1X2N A;  2BY3 A;  1I3A A;  2B9S A;  2VBW A;  2Y2Z A;  3IH4 A;  3HKZ A;  3JW4 A;  3LSI A;  3AFH A;  5CJ9 A;  1OLT A;  1ACI A;  3H9J A;  3BHQ A;  3RD3 A;  3CUQ A;  1OR7 C;  1IXC A;  4BQQ A;  2P7V B;  3E6B A;  2HZD A;  1JT0 A;  2XRL A;  4ABZ A;  1SVM A;  2XPW A;  1WJC A;  2DAO A;  4XK4 A;  4P55 A;  4XLP F;  3S5R A;  2HQA A;  3MZ8 A;  3QOE A;  3MCZ A;  1FTT A;  1HF0 A;  1ZLJ A;  3O8H A;  3NWT A;  1UEL B;  3J81 K;  4A3F J;  5LLQ A;  1AA7 A;  2VJJ A;  4U87 A;  3WTS C;  5D8K B;  3TED A;  4KJZ A;  3BR1 A;  3VOE A;  2R5Y A;  2VBY A;  2OZU A;  4HF2 A;  4HV5 A;  1T33 A;  3QWL A;  4N4N B;  4WCG A;  2ME6 A;  5JHU A;  5BPI A;  2ZC2 A;  3BTL A;  3I4M J;  1WH7 A;  2Y75 A;  2DK5 A;  3FXJ A;  2IPQ X;  5F6F A;  2DCE A;  4AID A;  2R7F A;  1MSF C;  5C4X J;  2RQP A;  2LKS A;  2GIZ A;  1RKT A;  3AG1 H;  1I50 J;  1O57 A;  3HZJ A;  1DP7 P;  1N25 A;  2K5C A;  4PUS A;  3JRD A;  4B3X A;  5FMP A;  1T0F C;  4Y17 A;  5C3E J;  2DT6 A;  2K9S A;  2ID3 A;  2G7G A;  1R22 A;  2KRH A;  2FJ1 A;  5D6F A;  1MMA A;  5D18 A;  1ZTR A;  2WC2 A;  3BT9 A;  4HOB A;  2L2O A;  1ERD A;  2PMZ N;  1LKX A;  2MBF A;  3NAU A;  2WAQ N;  1VQO I;  1XMK A;  1F43 A;  3FXU A;  4IXA A;  2UXU A;  1G8X A;  1W7P B;  1JE8 A;  5LHI A;  4JX6 A;  1BW5 A;  4OOI A;  1ETY A;  3IKV A;  3P5J A;  3KP6 A;  3Q0U A;  3U2R A;  4F3Q A;  3BPV A;  2ZME A;  3IHU A;  2X4H A;  3OIP A;  3KP5 A;  1OYW A;  3IAS 2;  5LHG A;  3QPS A;  1ZN2 A;  4BXX J;  1ZR2 A;  2FJI 1;  3NRG A;  4OIQ F;  1FEX A;  1TBX A;  1XMX A;  4G12 A;  4II3 A;  2YVX A;  4F93 B;  3BDD A;  2JUC A;  3UNG C;  5HOD A;  2EZL A;  2EZK A;  2HS5 A;  2OBP A;  3L1P A;  1Y0U A;  3JRH A;  4ZYH A;  1V54 H;  2ICW G;  2K40 A;  3I59 A;  2X9D A;  1U2W A;  4CCK A;  2X48 A;  3RZD J;  2MA3 A;  2L01 A;  5KAI C;  2BXZ A;  1I1G A;  2NXN B;  2PZ9 A;  5LBQ A;  1A6Q A;  1M1E B;  2P5K A;  3CC4 I;  3OYG A;  2CRG A;  4EV0 A;  1R71 A;  1Z3Y A;  1HW2 A;  2B7E A;  3K1N A;  1AKH B;  1IG7 A;  3F8B A;  4FCY A;  2EFQ A;  3REO A;  3HB9 A;  3RIR A;  2W82 A;  3KKD A;  2VKE A;  4Q48 A;  3BOQ A;  1FOX A;  3RKY A;  4A3L J;  2K4J A;  3T0Y A;  3AL0 C;  3LSK A;  3W6V A;  3C18 A;  2V7F A;  4LIV A;  2JPC A;  1TW3 A;  2WAE A;  3HSE A;  3D5L A;  3CCS I;  3OV8 A;  3PNT A;  2M7B A;  3SEQ A;  2V79 A;  4FX0 A;  3J80 K;  2P7C B;  3W2V A;  3KYD B;  1UB9 A;  3MAJ A;  1UCR A;  4XLH A;  4M3G A;  1S8N A;  4L5J A;  3RJP A;  3ZGK A;  5K5O A;  4RS8 A;  3DFG A;  1NH3 A;  3KP7 A;  4LB5 A;  1RR7 A;  1MKM A;  2HPI A;  4XKV A;  1QU3 A;  1D8K A;  3LSP A;  1R1U A;  2RVC A;  3IV5 A;  1XCV A;  2QSF X;  4ENK A;  4HLX A;  1QNT A;  1WFX A;  3E0J B;  5FLX Z;  1D5Y A;  3KZZ A;  5CW8 A;  1B59 A;  1ZRF A;  2OU2 A;  4GO1 A;  1BW6 A;  2R7Z J;  3IAM 2;  4IPA A;  1QZY A;  1AU7 A;  4YIR X;  2F48 A;  1MBF A;  4GXO A;  4G7H F;  1SD4 A;  2D1V A;  3E5Q A;  5JHF A;  2RQQ A;  2NVX J;  5HSZ A;  4HX4 A;  4XSZ F;  3S15 J;  3TKY A;  2M0M A;  4ZTF A;  2FNP A;  2A68 F;  1QPI A;  1T08 B;  4PJN A;  2HDD A;  3E6C C;  1A5J A;  3V7R A;  3VP5 A;  4JL3 A;  4L5E A;  2VKD A;  2L4M A;  3ULQ B;  4U0W A;  2NNN A;  4ZYD A;  4UNO A;  2Y69 H;  5GPC A;  4MK6 A;  5KNL A;  5ICF A;  2VE8 A;  2YX7 A;  3WTT C;  1A31 A;  4CCJ A;  1PUF B;  5F1R A;  3SFZ A;  5GAE J;  2HYJ A;  2O3F A;  3P7N A;  3H92 A;  2TCT A;  3RQI A;  3S2H J;  2GWR A;  3ZMU A;  1BA5 A;  4AIH A;  4BHP A;  4GRI A;  2R92 J;  1OYI A;  5EG0 A;  2DG8 A;  2RN7 A;  3BZC A;  2LBF A;  2HKU A;  2ETH A;  3PSF A;  1O3T A;  5FHP A;  3RZO J;  2L9R A;  3H0D A;  1APL C;  1V5E A;  2OTJ I;  3OYH A;  2M7A A;  3KKC A;  1MBJ A;  2IS1 A;  5C44 J;  2HZT A;  3K4J A;  4LG3 A;  3QU6 A;  4I09 A;  2GAU A;  1Z77 A;  3A03 A;  3F6O A;  3GTK J;  1SAN A;  4MNU A;  4P9U A;  2XRO A;  3D5R C;  4PJL A;  5J4V A;  3JRC A;  2HDC A;  1SFU A;  3DQV C;  1I1S A;  5HLH A;  1UG0 A;  3EGQ A;  5AIP A;  1OCO H;  1F9N A;  1C0W A;  3K4K A;  1K7A A;  1WSU A;  3DPJ A;  4HKU A;  2DA5 A;  2KZV A;  2R7Q A;  1B1B A;  2QQ9 A;  3ZN0 A;  1JI8 A;  2FUG 2;  2XSJ C;  1PVE A;  5DCM A;  4A6E A;  4EAT A;  4EMS A;  3UKG A;  2IS2 A;  3EQL F;  5K7Z A;  4LG0 B;  3LWJ A;  1R1T A;  1B9M A;  2LRD A;  4BL0 B;  3K0L A;  3I3L A;  4U7D A;  2YVH A;  1BN5 A;  1MMG A;  2EK5 A;  2A6T A;  2I5U A;  3G4S I;  4AVZ A;  1R7J A;  3BTC A;  4MFE A;  2IA2 A;  3PL8 A;  4XLA A;  3NPI A;  1RR8 C;  4EJW A;  2KL4 A;  5KCM A;  2ELK A;  4BJT A;  1R49 A;  2EZI A;  1O7F A;  2LF8 A;  2IT0 A;  2DMP A;  3DTK A;  4WXD A;  1ENH A;  4PJ0 C;  2E7W A;  4UV9 A;  4M74 A;  2LDU A;  2PLY A;  3OS2 A;  2PQ8 A;  4BYY A;  3ZQG A;  3BG9 A;  1KZH A;  3JSO A;  3PNY A;  3HSF A;  1Z6R A;  2YS9 A;  3O2P E;  2VXD A;  5E1W A;  2OAZ A;  4BHC A;  4XN0 A;  3OSG A;  2EFP A;  2QOP A;  2MLK A;  3H0G J;  1H89 C;  4XRM A;  3VVY A;  4QWQ A;  4RAY A;  3F23 A;  5C4Y A;  5E8I A;  2W53 A;  2GEN A;  2MLG A;  3GTM J;  2HOS A;  1NHA A;  3CCV I;  5E1X A;  2JA6 J;  4UVC A;  1S6L A;  3U21 A;  1MBE A;  4AYB A;  5L3C A;  5DM6 F;  2RNG A;  4FET A;  4IL6 C;  2DXI A;  2EV5 A;  4C3I J;  3R60 A;  1RET A;  3M1E A;  2BVL A;  4F91 B;  4A3D J;  4HST A;  3ZR8 X;  2D45 A;  1AWC A;  1P4A A;  2WB1 A;  3CDI A;  1O4X A;  3BP8 A;  1CGP A;  3LJL A;  3OY9 A;  4B43 A;  4AIJ A;  3WE3 A;  2EA4 A;  4CXF A;  1U3E M;  3CC7 I;  1U5T B;  2OI8 A;  5EFY A;  3HSR A;  5L3G A;  1P7J A;  1YFH A;  1FMW A;  2IP2 A;  2YU3 A;  2NOJ B;  2FOK A;  3CDL A;  1X1B A;  2ZNZ A;  3B6C A;  2DMN A;  2DA6 A;  4MEY F;  2R5Z B;  4M6X A;  5EGO B;  2LD5 A;  4YEJ A;  3H5A A;  4TV7 A;  1IC8 A;  1UJ8 A;  1J75 A;  1FBQ A;  1H0M A;  4L18 B;  3SWH A;  4ASN A;  2PN6 A;  5M5W J;  2DA7 A;  1TWG J;  1JKQ C;  2UXI A;  1MJ9 A;  2LK2 A;  1UFM A;  2OUM A;  2QKL B;  4I01 A;  4S05 A;  3VW1 A;  2EIN H;  2QBY A;  1IRX A;  3TGN A;  3Q5F A;  5BNG A;  4UVA A;  2WAD A;  4AU7 A;  4BQN A;  4RM2 A;  1YLF A;  3Q0W A;  1Y39 A;  4A3G J;  2VPL A;  4KUM A;  3VWB A;  1MH4 A;  4M6Y A;  4OMY A;  2D6Y A;  4CGR A;  4M9X A;  1WH5 A;  4WXH A;  4NUB A;  2UZK A;  1X3Z B;  3AQS A;  4R79 A;  3MKY B;  1FPQ A;  3VPR A;  3FM5 A;  3KLN A;  1KYW A;  3FHZ A;  2RHA A;  2L4A A;  3PUF A;  3GYH X;  5HNH A;  1YHQ I;  5HBU A;  2Q24 A;  5D6E A;  4OIO F;  1X3W B;  4XMY A;  4KN4 X;  5EEG A;  3H35 A;  4B4C A;  3C1D A;  1B9N A;  2ZJ2 A;  3FMS A;  1KYZ A;  1W7P D;  1U9N A;  1RIO H;  2FEZ A;  3S2W A;  2X51 A;  3DTI A;  1U8R A;  1G2H A;  4ZDP A;  1TWF J;  3T1B A;  1FOW A;  3DV8 A;  3MZH A;  3LHQ A;  3CD6 I;  5ICG A;  2VAS A;  3SYT A;  3ZN1 A;  2CV2 A;  4IRG A;  4XRF A;  3G6E I;  3CCE I;  1TC3 C;  3LWF A;  2CSO A;  2AXL A;  2JZY A;  1BI3 A;  1S7A A;  5BQT A;  5F27 A;  2JSC A;  3RCO A;  5ILS A;  3ERE D;  3QRF F;  4RAG A;  4AC6 A;  3M4O J;  4QLC U;  2HYG D;  3WHB A;  2LY9 A;  2B3W A;  3BCG A;  2DFH A;  4CCN A;  2IXS A;  5E18 F;  2PI0 A;  2Z2S B;  3U1D A;  2PJR B;  3ECO A;  4B3A A;  4HSR A;  5CLS A;  3P9C A;  5ILU A;  2CYY A;  1EF4 A;  1K4S A;  2DMU A;  1Z05 A;  1TQI A;  3BR0 A;  4HPQ A;  2ZBK A;  2DFF A;  2V9V A;  3FX3 A;  2CQ7 A;  3Q3S A;  2W24 A;  1SVO A;  4IX7 A;  1IDY A;  2OJE D;  2Y0M A;  3R0A A;  3FIW A;  3CUO A;  3LA7 A;  5F0F A;  1W7P A;  2A6E F;  4CSW A;  2L7Z A;  2ZOZ A;  3DCF A;  2IVM A;  4PDK A;  3GF2 A;  2VUM J;  2H1L A;  4JKZ A;  3WTZ A;  3K2Z A;  3PO2 J;  5F04 A;  2CV1 A;  3R6S A;  2KHM A;  1R1V A;  2GZW A;  4A0Z A;  3W2A A;  1O3Q A;  2GLO A;  4XN3 A;  2BE5 F;  2F4O B;  2XHK A;  2DQR A;  5K1Y A;  1FX7 A;  3WGI A;  3OS1 A;  5IT9 Z;  3BJO A;  2NP3 A;  3WU0 A;  3ABT A;  3ZXS A;  4GYG A;  4AYB N;  4EM1 A;  1WVR A;  1J59 A;  2IGO A;  2VQG A;  2EV6 A;  3HHH A;  2MH2 A;  1GDT A;  4MHG A;  1FBS A;  3V8K A;  2E2J J;  3GZN B;  2CWE A;  4BGD A;  3HL2 A;  3S93 A;  5FGL A;  1IO2 A;  1G3T A;  1IUF A;  1WRJ A;  2VOD A;  1TP4 A;  4IF4 A;  4C3J J;  2LOO A;  4XIC A;  1R5G A;  2BY0 A;  1HA8 A;  2K3P A;  4PSW A;  2Z1D A;  2FQ4 A;  2W85 A;  1IN4 A;  5HLT A;  1EJ9 A;  1SD6 A;  3HTH A;  2XDV A;  1ITY A;  2LVS A;  3LA2 A;  1VQ9 I;  4UDS A;  4E7S A;  1VQM I;  3BTJ A;  4RB1 A;  5DV5 A;  1AKH A;  2HEO A;  3S1R J;  1LVA A;  3FHN A;  2LY2 A;  1A6I A;  3LSJ A;  5F0H A;  1HCR A;  1VQN I;  5GTI C;  1SVL A;  1P4W A;  4KIF A;  5FO5 A;  3BQZ A;  4IRV A;  2A69 F;  3NRV A;  4EGZ A;  2BZT A;  5GP9 A;  4IQ4 A;  2G7S A;  3GME A;  5F1J A;  3QP5 A;  4CUG A;  4UUT A;  3CP2 A;  4UB6 C;  1YX5 A;  4CGZ A;  3PPB A;  2BGC A;  5BS6 A;  3EUA A;  1ZGW A;  5J1U A;  2IA0 A;  3P9K A;  2RAE A;  4KIT B;  2ZKZ A;  2K86 A;  5HDG A;  1RES A;  1YTY A;  1D0Z A;  3WU1 B;  2VC1 A;  2M4K A;  3FKJ A;  3KZ9 A;  2QWW A;  2ELJ A;  5K5Q A;  2HPM A;  2R7X A;  2A6H F;  3ERM A;  4HDV A;  3HTI A;  3E1S A;  1ZGA A;  3T8T A;  1WJB A;  1HOM A;  1MNM C;  4YII A;  2FOW A;  4C2M J;  5A2Q K;  1QBJ A;  4BQA A;  2OPT A;  2WA0 A;  3DP7 A;  4M72 A;  3BZ6 A;  3HHG A;  3R61 A;  1PP8 F;  1WGX A;  3IUV A;  4OMZ A;  4HX7 A;  4BNC A;  1IDZ A;  4HAM A;  2X1D A;  3ON4 A;  2O7T A;  3GFL A;  2DMT A;  2MD0 A;  4J00 A;  3TDU C;  3ZMT A;  1E3O C;  1MMD A;  3GFJ A;  2JRM A;  3EUH C;  2IGK A;  3ZQC A;  2MC4 A;  1ZHF A;  2MSY A;  4BBR J;  4HZF A;  2V1D A;  2KJC A;  3LL7 A;  2CUJ A;  2VL8 A;  3GWZ A;  3TO6 A;  2ZCN A;  2KIU A;  1JHF A;  3FXQ A;  4FTH A;  3QOD A;  2VOO A;  2FNA A;  4YRV A;  3S1Q J;  4OWR B;  5JFR A;  2UXP A;  2YVE A;  2BW3 B;  3WTX C;  2GA2 A;  2XAG A;  1D1C A;  5E3L A;  1PUF A;  4DZJ A;  3CJT B;  3JRG A;  1ON2 A;  3I58 A;  4RB2 C;  4MO7 A;  4BDZ A;  3NEU A;  2Y0S A;  4B44 A;  2ZFU A;  4A93 J;  1VFC A;  5L3F A;  4M9Z A;  4C3H J;  2NAZ A;  1VF9 A;  3OIQ A;  1NK2 P;  3NNR A;  2Z16 A;  4UUS B;  5FKL A;  4I99 C;  3OYB A;  1ZQ3 P;  2UWM A;  1F1Z A;  4ESF A;  4D7N A;  2BHZ A;  2O5R A;  3QYE A;  3BCA A;  5FKK A;  5IP6 A;  4J19 A;  1LFB A;  4X0G A;  4IHT A;  3HG9 A;  3LMM A;  2RKH A;  3WU2 C;  3CWR A;  1HST A;  3A2K A;  2M5W A;  2RNJ A;  3BWG A;  3GLX A;  2QF7 A;  3GZ5 A;  2WUI A;  2DG7 A;  4E7I A;  2J5O A;  1P2F A;  2RV8 A;  4G6Q A;  4ESJ A;  2QVO A;  2UUZ A;  1DGW Y;  1Z1D A;  1MBG A;  1YS7 A;  3J7A O;  2QLZ A;  3HRS A;  3GXO A;  2Z5U A;  3M3Y J;  4BHB A;  4JQF A;  3MKL A;  4JX5 A;  3RYR A;  4RBO A;  3JR9 A;  3BJA A;  3A1Y A;  5HS9 A;  2FQ3 A;  2K27 A;  4NC8 A;  3TMO A;  2GXG A;  4ESB A;  3CCR I;  1FYK A;  4BUP A;  3G56 A;  1RC9 A;  5D1R A;  2R7V A;  1WI3 A;  1VI0 A;  1DP3 A;  4LG0 A;  2O61 A;  2GUH A;  1FIP A;  2I10 A;  4Q5S F;  5CXG A;  1VQ7 I;  4FT8 A;  2M8G X;  4B47 A;  4E4H A;  5M3F J;  5IOY A;  3TP3 A;  3LAP A;  1W36 D;  2QQ8 A;  1VQ8 I;  2JWT A;  2DA4 A;  5LGN A;  3HE0 A;  4NEL A;  3FBI B;  2NNY A;  5CQG A;  3S3N A;  2QSG X;  3V8L A;  3KPH A;  3VDX A;  4P9F A;  1UI6 A;  2OQG A;  2L7F P;  5AON A;  4DBQ A;  1MDM B;  1X2M A;  1CQT A;  4XOT A;  2O0Y A;  3SZP A;  1LFU P;  3BJB A;  1ZGJ A;  2H8W A;  3S14 J;  1V4R A;  1SGM A;  3GTO J;  3OL3 A;  3A01 B;  1H9G A;  2FBI A;  2WTE A;  5HAW A;  3P9I A;  2V1N A;  3K70 D;  2PJP A;  1VQL I;  1XX5 A;  4RB0 A;  2JA7 J;  3VYR B;  1HQC A;  4FHT A;  3PO3 J;  1GHC A;  3I0T A;  2OQR A;  2A5W A;  1XDU A;  3CUQ C;  3GCM A;  3LA3 A;  5LRR A;  3GZ6 A;  3ON2 A;  2MC3 A;  3ZQF A;  2GIV A;  2DU9 A;  3CF2 A;  5FD5 A;  1B72 B;  4RGX A;  4KIS A;  3BG7 A;  2PX9 A;  1RUO A;  5EJC A;  2JT1 A;  4HNU A;  2Z33 A;  1WJE A;  1POG A;  1R6R A;  1FLI A;  4WWC A;  3HTS B;  2BY1 A;  3RTR A;  4Y13 A;  1GV5 A;  3HPG A;  1XSD A;  2CMP A;  4ME9 A;  1IN8 A;  3AG4 H;  1PYV A;  5BPD A;  2R7U A;  4KYW A;  2YUS A;  6PAX A;  1IW7 F;  3ZQQ A;  3F1B A;  1ZEL A;  4C30 A;  4YFK F;  2HTJ A;  2NVY J;  1W36 C;  4PGG A;  4EVI A;  1W5T A;  1T95 A;  1T98 A;  1XN7 A;  3DBH B;  4ZYE A;  2V57 A;  5EDN A;  4DNC A;  2OER A;  2HU9 A;  3L2C A;  3FKI J;  4RM3 A;  4A0Y A;  1VZ0 A;  1SAX A;  1FJL A;  3I9V 2;  2JUG A;  3K10 A;  1U5T A;  3PQJ A;  2GFN A;  3DBL B;  4M3F A;  4CYC B;  4BE2 A;  3R4K A;  3DPL C;  1JUM A;  1JT6 A;  3TP0 A;  1XS9 A;  4O6J A;  4A6D A;  2R5Z A;  1Z21 A;  5EGO A;  1I5Z A;  1J2X A;  3E6M A;  2FA5 A;  3QPT A;  1CF7 B;  2ZCX A;  3D5S C;  4G6D A;  2BYV E;  2W1O A;  3L2V A;  2Y30 A;  4S0H B;  3H9Q A;  1HW5 A;  2DMQ A;  1IZ1 A;  4HEA 2;  5CPR B;  4N4O B;  1HC8 A;  2G7L A;  4RGU A;  1TNS A;  2ZME C;  1P7I A;  3EDP A;  4A3B J;  2Y0S N;  2R3S A;  2NVU B;  1OQY A;  3FXO A;  3GLL A;  2X0L A;  3ABL H;  3GW2 A;  2Y31 A;  1O3S A;  2LTP A;  3NS4 A;  4MTD A; 
#chains in the Genus database with same CATH homology
 3TW6 A;  2D5V A;  2YVH A;  3FRQ A;  3CMY A;  1RKW A;  4X6A J;  1RPW A;  2K9N A;  3HTA A;  3QKX A;  1T56 A;  3BTC A;  2EQR A;  4MFE A;  4HNV A;  4IHV A;  5CXI A;  3GTJ J;  3NPI A;  4FIS A;  1JKP C;  1F36 A;  1ETK A;  2ELK A;  2EZI A;  2XDN A;  3CRJ A;  5IOZ A;  2DMP A;  1R9T J;  3HOV J;  1FTZ A;  1ENH A;  1JJ8 C;  1ORK A;  5E3O A;  3ZQG A;  3BG9 A;  5H9T A;  1OCT C;  2YS9 A;  2G3B A;  1MH3 A;  4QIW N;  3Q0V A;  4PXI A;  3OSG A;  1ZR4 A;  4X1E A;  2QOP A;  4DYQ A;  3H0G J;  5E3M A;  1H89 C;  4XRM A;  3VVY A;  1IGN A;  5C4Y A;  1TWH J;  2W53 A;  3O60 A;  3MNL A;  2GEN A;  2IAI A;  3GTM J;  2HOS A;  2IEK A;  1UI5 A;  2KT0 A;  2G0E A;  2JA6 J;  4JP0 A;  1MBE A;  4YZE A;  4A3I J;  3FIS A;  4C3I J;  3V78 A;  2O9L A;  1RET A;  4A3D J;  2WB1 N;  2NX4 A;  3BR5 A;  4GFL A;  5EG0 B;  2CQQ A;  2LFB A;  1O4X A;  3LJL A;  3PAS A;  1GV2 A;  4ICH A;  3CQZ J;  3MVP A;  3KNW A;  5EFY A;  2OI8 A;  5E3N A;  4QTR A;  1SGM A;  1P7J A;  3JRF A;  1HDP A;  4KWA A;  3CDL A;  2UXH A;  4D7M A;  3VIB A;  3B6C A;  2DMN A;  4NDL A;  2DA6 A;  1GUU A;  5M3M J;  2R5Z B;  4V2G A;  4XID A;  3LSG A;  5EGO B;  2Y9Y A;  2LD5 A;  1IJW C;  3P9T A;  4BBS J;  4DYR A;  1IC8 A;  1JKO C;  2H8R A;  1ZK8 A;  4IHX A;  4M3B A;  3BR2 A;  5M5W J;  2DA7 A;  1TWG J;  1DU6 A;  1JKQ C;  2JK3 A;  2UXI A;  2LK2 A;  2MGQ A;  3VW1 A;  1HDD C;  5BNG A;  3C2B A;  2ECB A;  5F08 A;  3JRA A;  1B8I A;  3F0C A;  1YRN B;  2W48 A;  2X6O A;  3GTP J;  4I76 A;  3Q0W A;  4A3G J;  5J1Y A;  2LP0 A;  3OSF A;  3S2D J;  2ECC A;  1MH4 A;  1TWA J;  1ETO A;  2XGC A;  4A3K J;  2EH3 A;  4FE4 A;  2D6Y A;  4CGR A;  1WH5 A;  3ZQI A;  1Y1V J;  2CQX A;  3SJM A;  3AQT A;  5EEA A;  3BTI A;  2XSD C;  1BL0 A;  3AQS A;  2JMW A;  3PM1 A;  4MXM A;  1JTX A;  2M0C A;  3VPR A;  3GTL J;  2RHA A;  5HBU A;  2JJ7 A;  2Q24 A;  4GCK A;  2XB5 A;  2FD5 A;  3G7R A;  4FE7 A;  4B4C A;  1U9N A;  2ID6 A;  1G2H A;  1WPK A;  1TWF J;  5FKM A;  3ZQL A;  3LHQ A;  2LR8 A;  2B63 J;  4QSH A;  2MW8 A;  3JRE A;  1GVD A;  3IH2 A;  5FKO A;  1TC3 C;  3B81 A;  3DEW A;  3VUQ A;  5EYR A;  1QVU A;  3HOX J;  5F27 A;  3HDD A;  4W97 A;  4AC6 A;  2TRT A;  3M4O J;  3VW0 A;  3WHB A;  2LY9 A;  3BCG A;  1HLV A;  3VOK A;  1U8B A;  1QVT A;  1U78 A;  4B3A A;  3HTJ A;  2XB0 X;  3V6G A;  1EF4 A;  3VVX A;  3NAR A;  2DMU A;  1LE8 A;  3BR0 A;  1H88 C;  1XC5 A;  3HGY A;  3Q3S A;  1JTY A;  3E7L A;  1IDY A;  4M3E A;  3QQA A;  4D5F A;  4A69 C;  3FIW A;  1MSE C;  3VW2 A;  5F0F A;  1K61 A;  2L7Z A;  2NS7 A;  2ZOZ A;  3TW7 A;  3DCF A;  3S17 J;  3C07 A;  5K7F A;  4AC0 A;  4V2F A;  2VUM J;  4JKZ A;  1Y1W J;  3CJD A;  2AHQ A;  3PO2 J;  2H1K A;  2DJN A;  5F04 A;  1OJL A;  4GFB A;  4DW6 A;  2E2I J;  3JRI A;  2XPU A;  4BKX A;  3RH2 A;  5IP7 J;  2M34 A;  2GLO A;  5IP9 J;  3HGG A;  4AF5 A;  3FK6 A;  2NP3 A;  1FIA A;  1UG2 A;  3CCY A;  3NXC A;  3ANG A;  3FK7 A;  3G1L A;  1GT0 C;  2QIB A;  1ETV A;  5AQC A;  4JX4 A;  4AYB N;  4XRS G;  2GM4 A;  4W1U A;  2JA5 J;  3WHC A;  1WCM J;  5JLW A;  1GDT A;  2E19 A;  2LKX A;  4XRS A;  2HI3 A;  5DS9 A;  2IU5 A;  5K58 A;  2WV1 A;  2E2J J;  2N8G A;  1ETW A;  3SDG A;  4GCT A;  1UHS A;  5FGL A;  1B8I B;  1IUF A;  4UUS A;  5DTD A;  2EBI A;  1JJ6 C;  2E1O A;  4C3J J;  5IPA A;  4XIC A;  1X2N A;  4MIM A;  3HKZ N;  2EZH A;  1W0U A;  3ZOB A;  2Y2Z A;  2FQ4 A;  3IH4 A;  1ZKG A;  5FKN A;  3HTH A;  1ITY A;  2LVS A;  1SFO J;  4L62 A;  3BHQ A;  4UDS A;  3RD3 A;  4LOC A;  3BTJ A;  2VPR A;  1UMQ A;  3ZQH A;  4A3C J;  1AKH A;  3S1R J;  1NK3 P;  1JT0 A;  1I6H J;  1JGG A;  2XRL A;  4ABZ A;  3VOX A;  2XPW A;  1A6I A;  3LSJ A;  3SFI A;  5F0H A;  5EF6 A;  1HCR A;  4XK4 A;  3H3V K;  5C4J J;  3BQZ A;  4Y52 J;  3S5R A;  2O8K A;  1FTT A;  2LLK A;  5GP9 A;  1HF0 A;  3O8H A;  4A3F J;  2G7S A;  5F1J A;  2VI6 A;  4UUT A;  3TED A;  2XPV A;  3BR1 A;  2R5Y A;  3PPB A;  1H8A C;  3OOU A;  1ZGW A;  5J1U A;  2O7O A;  1IV6 A;  5FLV A;  1T33 A;  1VND A;  2NP5 A;  1XG1 A;  2RAE A;  2ME6 A;  3BTL A;  1RES A;  3I4M J;  1WH7 A;  2P81 A;  5C4X J;  1MSF C;  3KZ9 A;  3GZI A;  4IHW A;  1RKT A;  3HOU J;  1I50 J;  2ZOY A;  3HBL A;  3OIO A;  3HTI A;  3B6A A;  4M3D A;  3JRD A;  1JKR C;  5FMP A;  1NTC A;  2HQ5 A;  5C3E J;  1HOM A;  4RDU A;  1MNM C;  4BY1 J;  2K9S A;  2ID3 A;  2OF7 A;  4C2M J;  2G7G A;  2F07 A;  2FJ1 A;  5D18 A;  2OPT A;  3A01 A;  1ZTR A;  3HM5 A;  3BT9 A;  1WGX A;  3IUV A;  1LE8 B;  2PMZ N;  4MFD A;  2GBY A;  3NAU A;  5J3L A;  3BR3 A;  5J1R A;  1IDZ A;  2WAQ N;  2RAS A;  2WGB A;  3ON4 A;  2DTZ A;  1W0T A;  1F43 A;  2JN6 A;  2K9Q A;  2O7T A;  3T6N A;  2DMT A;  5IYD J;  1Z0X A;  2UXU A;  3S16 J;  5DAJ A;  1B72 A;  1E3O C;  3GTQ J;  2MG4 A;  2NOG A;  4JX6 A;  2DA3 A;  3IH3 A;  1ETY A;  3Q0U A;  3ZQC A;  3A02 A;  2MSY A;  4BBR J;  2ZCN A;  2VKV A;  2FX0 A;  4FTH A;  1X58 A;  1AHD P;  2QTQ A;  5JLX A;  3BG5 A;  3S1Q J;  4JYK A;  3I4N J;  2UXP A;  2YVE A;  4ACI A;  3QPS A;  3G1M A;  4BXX J;  5E3L A;  1ZR2 A;  1PUF A;  3E7Q A;  4DZJ A;  2ZCM A;  3NRG A;  3BG3 A;  3JRG A;  1FEX A;  4G12 A;  3ANP A;  4MO7 A;  5HOD A;  2EZL A;  2EZK A;  3L1P A;  4A93 J;  4A3J J;  1VFC A;  3VVZ A;  3JRH A;  4C3H J;  1BJZ A;  1MBH A;  2K40 A;  1VF9 A;  2X9D A;  1OFC X;  3LNQ A;  2X48 A;  3RZD J;  1NK2 P;  3NNR A;  4UUS B;  4A3E J;  5FKL A;  3QBM A;  3G1O A;  1ZQ3 P;  2XGE A;  2M2E A;  2NVT J;  2ME0 A;  4CYC A;  4D7N A;  4I6Z A;  2ZB9 A;  2PZ9 A;  2M9H A;  5FKK A;  4J19 A;  5IP6 A;  1LFB A;  4GCL A;  2QCO A;  3JSJ A;  2CRG A;  3CWR A;  1JUP A;  3GBG A;  2WUI A;  1QRY A;  2IBD A;  2QF7 A;  1AKH B;  5M5X J;  4FCY A;  1IG7 A;  2AO9 A;  3HB9 A;  3HOY J;  2DG7 A;  3KKD A;  2VKE A;  3MN2 A;  3BRU A;  4EEF G;  1MBG A;  4A3L J;  3GTG J;  2CUF A;  3W6V A;  5IYB J;  4B1R A;  2E2H J;  3M3Y J;  2REK A;  4Y7N J;  3MKL A;  4JX5 A;  4RBO A;  3JR9 A;  1U9O A;  2R5Y B;  1Q1V A;  3HIM A;  3G56 A;  5D1R A;  2QWT A;  1WI3 A;  5IYC J;  1VI0 A;  3D1N I;  3O8G A;  2GUH A;  1FIP A;  2CU7 A;  2I10 A;  5CXG A;  5GPA A;  2M8G X;  5M3F J;  5IOY A;  3TP3 A;  3K2A A;  2JWT A;  4DYC A;  2DA4 A;  4M3G A;  3HE0 A;  4NEL A;  4JNN A;  1RR7 A;  1UI6 A;  2L7F P;  3LSP A;  1X2M A;  1CQT A;  3IV5 A;  1LFU P;  3BJB A;  1ETX A;  2XGD A;  3S14 J;  5D19 A;  3GTO J;  3A01 B;  5HAW A;  1D5Y A;  5CW8 A;  2FBQ A;  2JA7 J;  1TWC J;  2L0K A;  3PO3 J;  1I3Q J;  1BW6 A;  5EZH A;  2R7Z J;  4GFK A;  2R93 J;  3COL A;  1AU7 A;  3ON2 A;  3ZQF A;  1MBF A;  3GEU A;  1B72 B;  2NVX J;  2YU9 J;  5HSZ A;  2HXI A;  3S15 J;  3RKQ A;  3HEF A;  1QPI A;  2DA2 A;  1POG A;  2HDD A;  1MBK A;  1S7E A;  1A5J A;  3VP5 A;  2DN0 A;  4JL3 A;  4L5E A;  1GV5 A;  2L7M P;  4IHY A;  3QPL A;  4ME9 A;  4NN1 A;  1JUS A;  5GPC A;  4MK6 A;  2KDZ A;  2YUS A;  1PUF B;  2UXO A;  3F1B A;  5EZG A;  2HYJ A;  3BR6 A;  2HOT A;  2TCT A;  2NVY J;  3RQI A;  3LSR A;  3S2H J;  1BA5 A;  3S1M J;  4DZP A;  2V57 A;  5EDN A;  4BY7 J;  2R92 J;  3K7A J;  5FLM J;  5EG0 A;  2DG8 A;  3HOZ J;  3FKI J;  3LOC A;  2OER A;  2Y9Z A;  1FJL A;  2HKU A;  2NVQ J;  5F0C A;  3RZO J;  5FHP A;  2L9R A;  1K83 J;  1APL C;  2GFN A;  4M3F A;  4CYC B;  2CUE A;  3KKC A;  3TP0 A;  1JUM A;  1JT6 A;  1MBJ A;  2CJJ A;  5C44 J;  1XS9 A;  4D5C A;  1Z77 A;  3A03 A;  4MLO A;  2R0Q C;  3GTK J;  4M6V A;  2HOA A;  2R5Z A;  1SAN A;  5M5Y J;  2NS8 A;  2QKO A;  4AUX A;  5EGO A;  2ZCX A;  3HOW J;  4IEJ A;  5K7H A;  4A3M J;  3JRC A;  3EUP A;  2Y30 A;  4S0H B;  2COB A;  2DMQ A;  2HYT A;  5FJ8 J;  2JA8 J;  2G7L A;  2PBX A;  3EGQ A;  1P7I A;  4A3B J;  2Y0S N;  3S1N J;  3NI7 A;  1DU0 A;  3DPJ A;  4HKU A;  1ETQ A;  2DA5 A;  1IRZ A;  3JRB A;  3BQY A;  3UKG A;  3BNI A;  2Y31 A;  1OCP A;  5K7Z A;  1YRN A;  3LWJ A;  2LTP A;  2DA1 A;  9ANT A;  1BW5 A;  2HXO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...