3MVPA

The crystal structure of a tetr/acrr transcriptional regulator from streptococcus mutans to 1.85a
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
204
structure length
204
Chain Sequence
KNIRKPKQERSIEKRNKILQVAKDLFSDKTYFNVTTNEIAKKADVSVGTLYAYFASKEDILTALLKRYNDFFLTTIFADINSQDSLDRFKKNPKEWLNVLINQLLAAEDKIFHAQIEMLAYAIPQAKALLEEHNNNLKNLTYKCLLYYSDQAANPSFKTLSLVVFDFISALVDELLYHEHTQEEAHQIKKTGIDSLDLIIKSYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords TetR/AcrR transcriptional regulator
publication title The Crystal Structure of a TetR/AcrR transcriptional regulator from Streptococcus mutans to 1.85A
rcsb
source organism Streptococcus mutans
total genus 84
structure length 204
sequence length 204
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3mvpA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3mvpA02
1TWHJ 3VVZA 2XPWA 1BW5A 1OCPA 1JTXA 4S0HB 2LTPA 3RZDJ 4IEJA 2KDZA 2M9HA 2UXHA 3HE0A 1IDZA 4CYCA 1F43A 2NP3A 5M3MJ 1JKRC 3HM5A 2R0QC 1UI5A 1MBGA 5EF6A 3JR9A 2L7MP 3KNWA 1HCRA 3NXCA 1D5YA 1GVDA 2HOAA 3S1QJ 4M3DA 1GV2A 2RAEA 2Q24A 3Q0VA 4DYQA 1GT0C 2DG8A 1BL0A 1JJ6C 1T56A 5M3FJ 4MIMA 2ID6A 4A3GJ 4I76A 3JRFA 1EF4A 3HTIA 1TWFJ 1TC3C 1BJZA 3MKLA 2HDDA 3LSRA 2OPTA 2XGDA 2VUMJ 2GBYA 3S1NJ 3HTJA 3B6CA 3DEWA 3B6AA 5IYCJ 5FMPA 3FISA 3VIBA 3ZQIA 2V57A 4AYBN 4FTHA 5M5XJ 2UXIA 1H89C 2E1OA 2XSDC 4YZEA 3BR1A 4KWAA 1WH7A 1JUMA 5F08A 5IOZA 1JKQC 4FE4A 4JNNA 3G1MA 2NVQJ 5HODA 1ETXA 5JLWA 4MO7A 3MNLA 2RASA 2QCOA 4MXMA 2LK2A 4XK4A 4C3HJ 3BHQA 3S5RA 2R93J 2QOPA 5F0FA 2ZOZA 1WI3A 5FLMJ 2JN6A 4M3BA 5FKMA 2EZLA 2R5ZA 1HF0A 2UXOA 2B63J 3G7RA 3BR6A 1VNDA 2G3BA 4GFKA 4M6VA 1B72A 2DA1A 3LHQA 4M3EA 3A01A 3KZ9A 1HOMA 4DW6A 1ZR4A 2CUEA 2VI6A 3RZOJ 1UI6A 3DPJA 2VKEA 2WGBA 4ACIA 3BR0A 4XIDA 1WGXA 2HKUA 3FRQA 2YVHA 1Y1VJ 1JJ8C 3GTPJ 3VOXA 1U8BA 1W0TA 4GFLA 1VF9A 3P9TA 2COBA 2VKVA 5IOYA 2Y9YA 2NVTJ 1U78A 5JLXA 3M4OJ 2O7OA 1XS9A 2PZ9A 3WHBA 5CXIA 1ETOA 3GTJJ 3RD3A 1I6HJ 1Q1VA 2EZKA 2OERA 4W97A 1UHSA 2O8KA 1JUSA 1U9OA 3UKGA 3GTLJ 4A69C 3NI7A 1SANA 1WCMJ 2JJ7A 2FQ4A 3AQTA 3JRDA 5HAWA 1T33A 1DU6A 4UDSA 2R92J 3BTJA 2MGQA 4UUSA 2AHQA 5IP9J 1FTZA 4X1EA 1P7IA 1MH4A 5J1RA 2OI8A 4JX6A 2DG7A 5F1JA 2ZCXA 3V6GA 3LOCA 2HI3A 1OJLA 2R7ZJ 2QTQA 3OIOA 2FJ1A 3BJBA 4I6ZA 1MH3A 3G1OA 4AF5A 1FIAA 5D18A 2NOGA 5EGOB 3IV5A 2X6OA 3GTGJ 4CYCB 5FGLA 3NARA 4XRSA 1JTYA 1X2MA 3F1BA 2EZHA 1MBJA 2LY9A 2FBQA 2DA2A 4BBRJ 2HQ5A 2WV1A 2WUIA 1MSEC 2JA8J 1I50J 3S17J 2QKOA 3VPRA 4IHYA 2ME6A 3S2DJ 4JKZA 2DA6A 1PUFB 2DN0A 1FJLA 1IC8A 1OFCX 2L7FP 4C2MJ 3NAUA 3HOXJ 2MW8A 1ZKGA 2JWTA 3BQYA 3L1PA 3JRAA 3O60A 1Y1WJ 2MG4A 4D5FA 4AC6A 1S7EA 4DZPA 1A6IA 4A3EJ 1IUFA 3OSGA 3CCYA 5EGOA 3JRIA 4DYRA 4RBOA 3NRGA 3S1MJ 3HOVJ 3OOUA 1ZQ3P 3HOUJ 3JREA 5CXGA 1RETA 5K7ZA 1PUFA 4BY1J 1SGMA 2DA5A 5EFYA 2LKXA 2E2JJ 3QQAA 2JA6J 4JYKA 1MSFC 1AU7A 2HYTA 1F36A 3PM1A 3HOYJ 2Y2ZA 1YRNB 2Y30A 3JRHA 2L9RA 2UXUA 1JT0A 2NVXJ 5GPAA 1IGNA 3BTLA 1IG7A 1ETVA 2XGCA 5K58A 2PBXA 1LFBA 1RR7A 5E3LA 3A02A 3HOWJ 3HGGA 1JKPC 1IJWC 2R5ZB 2XDNA 2AO9A 3ZOBA 2DTZA 3O8GA 4CGRA 3SFIA 1B72B 1XG1A 3A01B 4NELA 3T6NA 5F04A 3HBLA 1ZR2A 4C3IJ 5J1YA 3I4NJ 4FE7A 1YRNA 2JA5J 1VFCA 2IU5A 1ETKA 1BA5A 3FKIJ 3BNIA 4AUXA 1ETWA 2F07A 2K9NA 2XPVA 1R9TJ 4LOCA 5HSZA 1SFOJ 2LLKA 2LD5A 3IH2A 2D6YA 1LE8B 3VUQA 1I3QJ 2EQRA 2M2EA 1LFUP 3E7LA 2NVYJ 5F0HA 3GTOJ 2ZB9A 3D1NI 3HTHA 1HDDC 3JRCA 3HGYA 5FKLA 1TWAJ 2GUHA 2QWTA 3BQZA 3CDLA 5BNGA 1RESA 4UUSB 1AHDP 1B8IB 2RHAA 4V2FA 3S1RJ 5FHPA 3TW6A 2ZOYA 5C4JJ 2DA3A 3LSJA 2G0EA 4M3FA 4B1RA 1GV5A 4IHVA 4D7NA 3ON2A 4UUTA 3DCFA 3Q0WA 1TWCJ 1FEXA 4DZJA 4HKUA 2DMQA 1LE8A 1CQTA 3BR3A 4ABZA 3C07A 4G12A 4L5EA 4A3MJ 1FTTA 2JK3A 3ZQLA 2XPUA 3RH2A 2DMTA 4NN1A 3CRJA 3BR2A 2TRTA 5FLVA 1B8IA 4M3GA 3B81A 2NS8A 3CWRA 4BXXJ 4A3IJ 5J3LA 4GCTA 2GENA 5IP7J 1IRZA 4GCKA 4QIWN 1H88C 2REKA 1MBEA 1ETQA 3ZQGA 2YVEA 1VI0A 2QF7A 1O4XA 1ZGWA 3HOZJ 2GFNA 2X48A 1Z0XA 3BG5A 1K83J 2W53A 3KKDA 3MVPA 4J19A 2GLOA 3CMYA 5K7FA 2H8RA 2L0KA 1QVTA 1QPIA 1Z77A 5AQCA 1RKWA 4A3KJ 2D5VA 3S15J 2M8GX 3QPSA 4Y52J 3NNRA 2ZCNA 4MFEA 2HOTA 3OSFA 2E2HJ 1JT6A 3IH4A 3VP5A 1QVUA 4JX4A 2K9QA 3E7QA 3AQSA 3F0CA 4D7MA 1APLC 5EYRA 2YUSA 4QTRA 2EH3A 3TEDA 3JRGA 2M0CA 4GFBA 1MNMC 2NS7A 4XRSG 1HLVA 4A3BJ 3FK7A 3NPIA 3JRBA 3W6VA 4PXIA 3LSPA 4IHWA 3H0GJ 3VW0A 2ELKA 4AC0A 3LWJA 3HIMA 3ZQFA 2O9LA 2HXIA 3BTCA 1POGA 4BBSJ 2ID3A 1ITYA 3TW7A 2GM4A 3CJDA 2MSYA 4D5CA 3RQIA 1H8AC 3QKXA 2CU7A 5GP9A 1NK3P 4A3CJ 3GTQJ 3EGQA 2EZIA 4B4CA 3VW2A 3IUVA 3A03A 2WB1N 5K7HA 4MFDA 4FISA 3LSGA 5M5WJ 4EEFG 5D19A 2HYJA 5EG0B 3PASA 3VW1A 1WH5A 5IPAA 1MBKA 2R5YA 1X2NA 3PO3J 2XB5A 1GDTA 4Y7NJ 1UMQA 3H3VK 5DS9A 5C44J 3M3YJ 3GTMJ 1P7JA 3G1LA 3K7AJ 4A3DJ 4JX5A 3HDDA 2XGEA 5GPCA 3PPBA 2QIBA 2O7TA 3ANGA 2PMZN 3VVYA 5DAJA 3Q0UA 4X6AJ 4DYCA 1E3OC 5C3EJ 1NTCA 3BG9A 2DA4A 3HKZN 3I4MJ 2DJNA 4JL3A 4BY7J 2JMWA 3SDGA 3IH3A 4XICA 2NP5A 2K9SA 2YS9A 5EG0A 2CUFA 2L7ZA 3HEFA 3GZIA 3VVXA 3WHCA 2Y0SN 3Q3SA 2XB0X 2K40A 5HBUA 5E3MA 2W48A 2YU9J 4C3JJ 3O8HA 4JP0A 3TP0A 3BTIA 1IDYA 2DA7A 5DTDA 2X9DA 1MBFA 5CW8A 2DMPA 1ZK8A 3BCGA 1U9NA 1ETYA 5J1UA 5C4XJ 5IYDJ 2KT0A 1JGGA 3SJMA 1G2HA 2FX0A 2CQQA 2IEKA 3S14J 2HXOA 4QSHA 1MBHA 5E3NA 3ON4A 3COLA 5F27A 2LFBA 2G7GA 2CQXA 2LR8A 4MLOA 1WPKA 1XC5A 1RPWA 2ECBA 4IHXA 3ZQHA 1DU0A 5FKOA 1BW6A 2LP0A 4A3JJ 1FIPA 2JA7J 1ENHA 3MN2A 1JKOC 1UG2A 9ANTA 2IBDA 2WAQN 1K61A 3JSJA 4RDUA 3HTAA 5IYBJ 3GEUA 3RKQA 1OCTC 2NX4A 2M34A 3GTKJ 3HB9A 3FK6A 5FJ8J 4GCLA 2OF7A 4A3LJ 3S16J 1NK2P 5FKNA 2HOSA 2CRGA 1X58A 5EZGA 5EDNA 1HDPA 5F0CA 2EBIA 3TP3A 4MK6A 4HNVA 4A93J 2DMUA 2DMNA 4NDLA 4L62A 2P81A 2LVSA 5E3OA 5C4YA 5IP6A 1JUPA 3C2BA 4W1UA 2E19A 3BR5A 2TCTA 1AKHB 3EUPA 2IAIA 2H1KA 5EZHA 2N8GA 3G56A 3CQZJ 4FCYA 3PO2J 3QPLA 1TWGJ 5D1RA 1ORKA 2VPRA 2ZCMA 4A3FJ 5M5YJ 2Y9ZA 2FD5A 2ME0A 1W0UA 4ICHA 2I10A 1QRYA 4XRMA 4ME9A 2ECCA 4V2GA 2E2IJ 2XRLA 5FKKA 3VOKA 2G7SA 1ZTRA 3S2HJ 1GUUA 3BRUA 3GBGA 2CJJA 1IV6A 3KKCA 3LJLA 3V78A 2UXPA 3K2AA 3BT9A 3LNQA 1RKTA 3FIWA 5EEAA 1AKHA 2R5YB 1A5JA 4B3AA 3ZQCA 3QBMA 5H9TA 3ANPA 2G7LA 3BG3A 2Y31A 4BKXA
chains in the Genus database with same CATH superfamily
1WKMA 5ERIA 1BW5A 4S0HB 4MHGA 2KDZA 3AL0C 2M9HA 1HSTA 3VOEA 3ZQQA 5M3MJ 2B9SA 3HRUA 1K4SA 2R0QC 3M07A 2WC2A 3IRRA 4DBRA 3D5LA 5D5VB 5EF6A 3G3ZA 1OYIA 1B59A 5HOOA 3GX4X 1GVDA 2HOAA 4IJAA 2RAEA 3K1PA 1GT0C 1J2XA 1W5TA 1BL0A 3S93A 4MIMA 3LWFA 3OYMA 3CLOA 1HXDA 4KDPA 2MFZA 1Z7UA 3OYBA 1TWFJ 2QQ9A 5LFAA 3KX2A 1G59A 2DDAA 1TC3C 1P9QC 2P7CB 2PX9A 4N4NB 3GVAA 2VUMJ 2OPTA 2GBYA 1IN4A 3DEWA 1BOAA 2WA0A 3B6CA 2Z5UA 3FBNB 5B1BH 1ZAOA 1WJDA 3VIBA 3BJOA 1QQIA 1VQPI 5HS8A 3D0SA 1H89C 1MZBA 4RS8A 3MMYB 1J75A 2KDOA 5GAGJ 3BR1A 2X85A 4HAMA 3BWGA 1AOYA 4U0YA 2L02A 1JUMA 3ELKA 2QM3A 5DM6F 3ASNH 3WGHA 4PGHA 1ZHFA 2Y75A 2NVQJ 1ETXA 3QYEA 2L9SA 4LG3A 4ZH4F 4A0YA 1ODDA 2JZYA 3CJTB 4EJWA 3BHQA 2FBHA 2R93J 1WI3A 3SEZA 4EV0A 5FLMJ 1YIOA 5FKMA 2R5ZA 4MTDA 1HF0A 2V6CA 2EIJH 3OIQA 5EEGA 1VNDA 4M6VA 3CUQA 2DA1A 4Y17A 4M3EA 4QPQA 3LHQA 3RZOJ 4JOMA 2WGBA 4XIDA 3U9GA 2YVHA 4ZTFA 3VOXA 4YRVA 1W0TA 1FOXA 1MMDA 4MNUA 5IOYA 2Y9YA 3AAFA 1QNTA 3T0YA 3FM3A 5JLXA 4KT6A 3D5RC 3RTRA 4EGYA 4HG2A 2R7OA 2XAJA 3GCMA 3RD3A 1JE8A 4CZCA 2OQRA 4KIBA 5F1RA 2P0WA 2JJ7A 3H3UA 3KLNA 2FQ3A 5CVUA 5JVGF 2VBWA 1Z6TA 4X1EA 4UY8I 4G9YA 3BC8A 1XN7A 1FMVA 1MH4A 4CSWA 4JX6A 1DGRM 3FBIB 3TMOA 3ABUA 3L2RA 3LOCA 2R7DA 1QZEA 4EM1A 1V55H 1YJNI 3RI4A 2FJ1A 4FT8A 1MH3A 2PJRA 1MMNA 1Q1HA 2DYSH 2QYOA 1U3EM 4XRSA 3KIOA 1JTYA 1X2MA 2RQPA 2DFIA 2EZHA 2LY9A 1WQ2A 2DA2A 3KLOA 2IS1A 3NQOA 2WV1A 1I50J 3PNVA 3WODF 4JKZA 3VPRA 2ME6A 1SD4A 1R00A 2C6YA 1FJLA 2L7FP 2QEXI 2MW8A 3I3LA 2GOXB 2RGVA 5L3BA 1FT9A 1GVJA 2ADUA 3BQYA 1Z1DA 2M7BA 3C1DA 3L1PA 2OCCH 3JRAA 3O60A 3VWBA 4AIDA 4DZPA 1A6IA 1QPMA 1T2KA 3U21A 3BZ6A 2BY1A 3J7ZI 4FX4A 2FU4A 3D5SC 2Q8KA 4QWQA 3NRGA 4A0XA 1ZQ3P 4CYDA 3PUFA 4CICA 3GFLA 3KP2A 4GGGA 1PUFA 1ZLKA 4HDUA 2DA5A 5EFYA 4WXHA 3PIOF 4XLAA 3IKVA 3OR1C 3PQJA 1MNEA 3V7CA 2ICWG 3PM1A 3MEXA 1KU7A 1SFKA 1YRNB 3JRHA 2ZBKA 2UXUA 4RM2A 2IVMA 4IZZA 1IGNA 2W57A 3ZMSA 3K8PC 3T5XA 1YFHA 3BOQA 2PBXA 2M45A 5E3LA 2KRFA 3HOWJ 2YR2A 2VKDA 2PQ8A 1BIAA 2Y69H 3K6GA 5AIQA 1UG0A 2AO9A 3MWMA 1VQ8I 2DTZA 3O8GA 3K4LA 2HVSA 4IO9F 2X51A 1ZR2A 3HBLA 4C3IJ 5A2QK 5DV5A 1ZGAA 3VTIA 1U8RA 2CV2A 2JA5J 1BI2A 1XPXA 4HQEA 3FKIJ 3J7AY 1ETWA 2F07A 3K4BA 2K9NA 2OZUA 3JSPA 2E36A 1K4TA 1SFOJ 2LLKA 1PVEA 2D6YA 1LE8B 1I3QJ 2GIVA 2PN6A 1IW7F 4EATA 5F0HA 4Y4RA 2ZB9A 4DVYP 1YJWI 1YJ9I 4OIPF 3F8CA 2QENA 3LQRA 5BQTA 2HPIA 4UUVA 1RESA 3HSFA 2PJPA 3IC7A 2DT6A 4IRGA 2HTSA 3EYIA 1TWCJ 4Y3OA 4AVPA 1CQTA 3BR3A 1KZHA 4ABZA 4E7JA 2EK5A 1TBXA 1SMTA 3S3MA 4N4OB 4G12A 4L5EA 3TO9A 4RMNA 5IT9K 1ZLJA 3EUKL 2DMTA 2NNYA 1VQMI 2X4HA 3TO7A 1OMIA 3E3VA 5JR3A 3TGNA 1D0XA 1P4WA 5L3CA 1IXRC 2Z33A 3CWRA 4BXXJ 4E4HA 1KGSA 1WFXA 4YELA 1SFXA 1ZG3A 2Q2EA 1YIJI 2EFNA 3ML6A 4A3IJ 3RYRA 2VONA 2FRHA 5IP7J 2V6EA 3CD6I 1WJFA 2K4JA 3REOA 4QIWN 1H88C 1MBEA 2X0LA 2ZJ2A 3CP8A 3CCUI 2ESNA 3OL4A 5LGTA 4A0ZA 3P7NA 1LJ9A 1VQKI 3H3ZA 3BG5A 1K83J 1V3FA 4M9XA 3MVPA 4S05A 3A4CA 4BS9A 2GLOA 4U9NA 4HW0A 3LSMA 1Z77A 4XMYA 5HNHA 4ZJZA 4R79A 3S15J 1J7KA 3PNTA 3TBIA 1MKMA 4PJNA 1W7PD 3NNRA 5JI6A 4IQJA 4P9UA 4Q4ZF 2ZCNA 3MKYB 2HOTA 1OQYA 5K1YA 4OINF 3VP5A 1QVUA 1OYYA 3FXRA 2K9QA 3AQSA 2M5WA 3KYCB 4GYGA 1KYWA 5EYRA 3JRGA 2M0CA 2IRFG 1T6SA 4U0VA 2ZSIB 2NS7A 3O2PE 2FOKA 4RA2A 4A3BJ 3FK7A 3EUHC 3W6VA 1R1UA 3RPUA 3OYHA 1PP7U 3ZRGA 2K5CA 3H0GJ 3UNGC 4A6EA 3VW0A 2ELKA 3DWLE 2L9VA 5E8GA 2HDCA 3LWJA 1I39A 1IXCA 3HIMA 2O9LA 2HXIA 2J5PA 3DLAA 2GM4A 2L01A 3FXOA 4CO8A 1X1AA 1FPQA 2JRTA 5GP9A 3M7GA 4ZDPA 2VOPA 1OYWA 4GCVA 3NWTA 3IUVA 5K7HA 4MFDA 4FISA 3LSGA 2F5DA 2OC6A 1YS7A 2HYJA 2X1DA 5EG0B 1E3HA 2OTJI 3PASA 5IT3A 4XN3A 1ZREA 3FHNA 2H6BA 1V5EA 4C9YA 3H3VK 4P9FA 5HDNA 2OQGA 2NNNA 3QP5A 3K7AJ 2PFBA 4PCQA 2HR3A 1LDDA 2V26A 2QIBA 2ZMEB 3ANGA 3J7AO 1S9HA 4E70A 1IUYA 4DYCA 1E3OC 1T8IA 1NTCA 2A6TA 4DBQA 1D5VA 3DV8A 2KQRA 2LY2A 4LIVA 2K9SA 5ICGA 3P9CA 4C2TA 1YHQI 1HC8A 4G8XA 4KN7X 2L7KA 4EM2A 3Q3SA 2VJJA 2YX4A 3OS0A 3BJ6A 2K40A 1VQ6I 2W48A 3B73A 2XROA 2KJBA 5BOXA 3TP0A 2X1CA 2DA7A 4PJ0C 1PP8F 2QLZA 1MBFA 5CW8A 2DMPA 2A5WA 1ZK8A 2ZNYA 3WTSC 1U9NA 5K5OA 2R7RA 1MJAA 5IYDJ 5J1UA 4YFKF 3CC7I 2LNBA 2DPDA 2WB1A 3OS1A 2NYXA 3SJMA 2CQQA 4G6DA 3K4MA 2HKOA 2CS3A 1RNLA 2DT5A 4LITA 2G7GA 2CQXA 2LR8A 3I56I 1E17A 1V54H 1RPWA 2ECBA 1BC7C 3ZQHA 4RAGA 1EH6A 3SZTA 4RGSA 1DU0A 2BYVE 1G3WA 4A3JJ 4OAZA 1P4XA 1Z9CA 2JA7J 1HKSA 1ENHA 2F4OB 3MN2A 2IBDA 1A36A 1I27A 3OYAA 2YU3A 4F93B 5IYBJ 2IS4A 5FB2A 4BE0A 2NX4A 2VB6A 1DPUA 1V5GA 3VYRB 4NUBA 5CQGA 1B9NA 3K70D 2R7QA 4RLQA 2EINH 1MMAA 2RDPA 5FKNA 3I55I 3PSFA 3K10A 1G3SA 2KZVA 5EDNA 3TP3A 4MK6A 2EBIA 2V1DA 3ECOA 4XLEA 4C2UA 2DMNA 4L62A 4KITB 1PYVA 5TJJA 4F55A 1JUPA 3C2BA 2G7HA 1BI0A 3DEUA 3FMQA 3L2CA 4IKFA 1LB2A 4CCOA 4I99C 3G56A 1LDJA 2BY2A 2A69F 4HNTA 1YITI 1ORKA 2AXTC 1AWCA 2ZCMA 4LG0A 5M5YJ 4L9TA 1W0UA 1OCCH 2HQAA 3CMAI 4XRMA 1IV8A 3DXJF 2G7SA 2IA2A 4L9NA 1GUUA 2DO7A 1LPQA 2E71A 1MNDA 2VJ5A 3MCZA 1QU3A 2V79A 5FFZA 2LF7A 3O6BB 2UXPA 2IGOA 2LKPA 5EJCA 1MDMB 3V8JA 3LNQA 3WTUC 1AKHA 2R5YB 2GWRA 3IHUA 1KONA 3DPUA 2E5NA 3I64A 3RPQA 4ZYHA 3HUGA 2Y31A 4BKXA 5LBQA 2E34A 4S04A 1RRJA 4PDKA 1IDZA 3IP4B 4CYCA 1TNSA 2NP3A 3OYIA 5E79C 1YW9A 1UI5A 2DFEA 1MBGA 3S8PA 3JAMK 2PI0A 5D6FA 3ABKH 3FXJA 4A5NA 2L7MP 2ETHA 2XF7A 3KNWA 2G9WA 4Z2YA 1GV2A 2WBMA 3MZ8A 1LVAA 2MC4A 2VBYA 3Q0VA 4DYQA 5GAHJ 1ZARA 5KAFC 4YG2F 1T56A 3AG4H 5KK1A 3M8FA 3HTIA 4I76A 3JRFA 2ZC2A 3W3CA 3K4CA 1U6GA 3LSIA 2D1HA 4I02A 1KU3A 3CCSI 3SWHA 3JSOA 4CCKA 3IRQA 2HDDA 2XGDA 2CQKA 1NG7A 5J6XA 3B6AA 1S29A 5IYCJ 5H2FC 3ONQA 4GXOA 4JBAA 3GFIA 2CQ7A 4L5JA 3DLLF 3DBHB 3WU0A 3KETA 2IPQX 4OMZA 3R61A 4OD4A 2EA2A 3FHZA 3LSHA 4YZEA 4UVBA 3CUQB 1R7JA 4FE4A 4XR6A 1JKQC 6PAXA 5J4YA 2R7FA 3G1MA 2PFVA 4JNNA 2UZKA 2W4SA 2A05A 2W24A 4BL0B 1DPRA 5JLWA 2KRHA 3MNLA 3QPHA 2QKMB 1XCVA 2K3PA 1IXSB 5HNFA 2QCOA 4MXMA 2LK2A 4XK4A 1UFMA 2JA2A 2FMLA 3EUHA 2RNGA 5F0FA 1KU2A 4M9SA 3OIPA 3X2QH 4RB1A 1TP4A 3CP2A 2CUJA 3FXLA 2CSOA 4ASNA 3G7RA 3LAPA 3BR6A 2STWA 2HVRA 4GFKA 1B72A 2FOWA 2VIXA 3A01A 3WU2C 1DUXC 1HOMA 2A2FX 4DW6A 1V4RA 2CUEA 4Y13A 4ACIA 3HL2A 2P8TA 3F8BA 2GA2A 2E60A 4EJVA 5ILVA 3RYPA 1N77A 3KYDB 5FLXK 3OL3A 2QWWA 2COBA 2VKVA 3VYUB 1U78A 4AYBA 1W36D 2GIZA 3C18A 2O7OA 4F52A 1ETOA 3GTJJ 2KZGA 1VQ5I 2PJRB 4NBQA 4L0YB 2O8KA 1U9OA 2K86A 3UKGA 4A69C 5GADJ 1SANA 2JTVA 4ZTJA 2FQ4A 2EJRA 1KYZA 3IUOA 4MEYF 4YIRX 3CLQA 3V42A 4AVZA 1T33A 4YFXF 3JRDA 4UDSA 1B4AA 2LSOA 2MGQA 4UUSA 2AHQA 4HV5A 5IP9J 1TQPA 1YW8A 4DQ2A 5K5QA 1ZN2A 2BBYA 5LD2C 2OI8A 1USTA 1HA8A 1VZ0A 1MW7A 4E7SA 2JQ7A 2ZSHB 1LUJB 2UWMA 1MD0A 3VDXA 2CV0A 4CHUA 2QTQA 4AF5A 5D18A 2Z99A 1VQ9I 2NOGA 3GZNB 4D9JA 2X6OA 4MQ9F 4U9LA 3NARA 2IGNA 3F1BA 1MBJA 3IAM2 2GXAA 4Y33A 3J7YJ 5FLXZ 3S17J 3U1DA 5LHGA 1QZZA 4ENJA 1PUFB 4XSXF 2DLLA 1OFCX 2TDXA 1YI2I 3ASOH 4B3XA 4NHJA 2H09A 4XKWA 3S3NA 1ZKGA 4BQAA 4J01A 4IHTA 3R0JA 2IT0A 3CCQI 3F6VA 1BN5A 3DKYA 4MEXF 3DKXA 1S7EA 4FX0A 3CO6C 2XAUA 3CCYA 5EGOA 3OMYA 2K3FA 3CCEI 5CVIA 5D5XB 5CXGA 2P5KA 3HOVJ 3OOUA 5KHDA 2QQBA 1DP7P 3ZP5A 3SXYA 2E5ZA 3J80K 3EQLF 3FZVA 3W2VA 2HNHA 2H1LA 3ZN0A 2L5QA 2YPRA 2FF4A 2LKXA 2E2JJ 3L09A 3QQAA 3LFKA 3C3WA 2Z2SB 3ZMTA 3F21A 4HX8A 4KFCA 5FD5A 1J59A 4GDFA 2HYTA 4RLFA 3RKYA 4HQMA 1V5FA 2K85A 4BEHA 3DU6A 1RC9A 1JT0A 1FOKA 3IWZA 4G7OF 3I0TA 5GPAA 5DD8A 3BTLA 5LGUA 1IG7A 3K1NA 1FY7A 2ESHA 3OYGA 2PMUA 3K4KA 1XSDA 1RUNA 1IJWC 1LFPA 2A5YB 3ZPLA 1BOBA 1S3JA 4LB6B 4NB5A 3SFIA 4HRIA 3C2GA 5F04A 3KZYA 1K7AA 4PJLA 5DCFA 3ABMH 5D8KB 4EVIA 4WK8F 1VFCA 1ULYA 2FBKA 2WWYA 3BNIA 4AUXA 3DBLB 4E7KA 4LOCA 1TNTA 1S6LA 1TQMA 2WY7Q 2M2EA 3HPHA 4WCGA 2HEOA 1LFUP 1SAXA 3E7LA 2O3FA 2D45A 4CDGA 2CQNA 1D1BA 4PFPA 1SD5A 3HGYA 4OOIA 2QWTA 4KYWA 1ON2A 1UZCA 2LBFA 1AHDP 4V2FA 3P5JA 4NQWA 3TW6A 1U5TA 2ZOYA 2PG4A 4AU7A 1MMSA 1GV5A 4UUTA 2ZXJA 2X1EA 3DCFA 3L7WA 4BJTA 3CCVI 2F5FA 3HHHA 2Q2EB 4KUMA 4DZJA 3A1YA 1O3TA 2B7EA 1MJBA 3FXMA 3JW4A 2HS5A 5B3SH 4B09A 4ANJA 4A3MJ 1FTTA 1Z3XA 2JK3A 4M6YA 3CJQB 2FE3A 2CFOA 2M3AA 3BY6A 3I5UA 3F9KA 4XKBA 2VBXA 3BR2A 2XAQA 2TRTA 1LKXA 1B8IA 3BCBA 2NS8A 2K7LA 3TDUC 3K2ZA 2BW3B 2I5UA 5CVVA 3GXOA 3W2WA 5HS9A 1HBXG 2VQCA 4WXCA 1SVOA 5H6RA 5J3LA 2STTA 1OCZH 2XHKA 2KPMA 2GENA 3GZ5A 4R8HA 2E1CA 5CQEA 3CMMA 4ZYAA 1TW2A 4IVNA 4E7ZA 1G8XA 5LLQA 2KJCA 2YVEA 4LLLA 5JHUA 2ZJPF 1Y56A 2P6TA 3HOZJ 2GFNA 2IGKA 1QGPA 1IN7A 3OWTA 2IGMA 1X3WB 3GO5A 4ZDOA 4J19A 2GXGA 2KMUA 4FHTA 4F92B 1VTNC 1QVTA 4HX4A 2WTEA 5AQCA 1RKWA 3R6SA 5L3EA 1OKRA 1TLHB 2M8GX 4XBFA 5D8LB 2DTRA 2HKXA 3LSTA 1KA8A 5E18F 3OYNA 4YIIA 3DTEA 2E2HJ 2BXYA 1JT6A 4UVCA 4BU2A 4U7BA 4JX4A 3E7QA 3F0CA 5L3DA 2A6HF 3BJAA 2YUSA 2M0MA 3ZMUA 1BI1A 3TEDA 2VPLA 2L9NA 3E97A 2EWNA 2ZXWH 3KCCA 3NPIA 4Z6YA 1L3LA 5JHFA 4UB8C 3AG1H 4XLHA 3VODA 1OR7A 3LSPA 4PXIA 2K9MA 4KNYA 2Z9OA 2G7UA 4CCMA 3QAHA 1FZPB 1POGA 1IN8A 4BBSJ 3TW7A 1HKTA 4NC7A 3CJDA 2MSYA 2RNJA 3RQIA 4AIHA 4I0BA 3QKXA 3CMEI 1A31A 2CU7A 3WTTC 2EZIA 4XLCA 4KMFA 3VW2A 3A03A 2WB1N 3PNYA 1BI3A 1T0FC 4KIGA 2Z1DA 4E7HA 3CJNA 2OJED 3VW1A 5IPAA 4IOCF 1EKEA 2DW4A 3H92A 3ESWB 4ENMA 2XB5A 4Y7NJ 4LGWA 1PDNC 1JGSA 2MABA 2BE5F 2FMYA 2VE9A 4UNOA 2MH2A 5CYVA 4C30A 3VVYA 4AIKA 3Q0UA 2HTJA 4QPOA 5C3EJ 3I59B 3H9JA 2RQQA 1YYVA 1FSEA 3I4MJ 3M8JA 2DBBA 2BHZA 3EETA 3HEFA 3QYBA 3VVXA 3P9KA 3BCAA 3GZIA 4BE1A 3LFUA 3K4NA 2XB0X 3HOSA 1VQOI 5IY5H 4C3JJ 4Q48A 3CCLI 4LFUA 3OV8A 4JP0A 3DF8A 3DPTA 1BIBA 5DTDA 4V19K 1CGPA 4BXFA 1ETYA 4L9VA 2KT0A 2O8XA 1G2HA 2FX0A 3S14J 3ON4A 1Z67A 5F27A 1LDKB 1ZG1A 2LFBA 1TQIA 4OMYA 5A2QZ 2LG4A 5B66C 3KE2A 1IZ1A 1HW2A 3N97A 3R0AA 1JHFA 3ZMDA 5FKOA 1BW6A 2NVUB 1FIPA 1BR4A 3WE2A 2KHMA 1UG2A 3Q5FA 3FWEA 4AD9A 3MQ0A 1DGWY 4ZZDA 4RDUA 2VC0A 1OCTC 1R1VA 2W82A 2AQFA 4FETA 3HKZA 4CGZA 5E1ZB 4PJMA 4RM3A 5FJ8J 2VC1A 3MD2A 1Z3YA 2OF7A 1L0OC 4LG0B 4A3LJ 2BVLA 1NK2P 1X58A 5EZGA 2EA4A 1W5CC 1HDPA 1ONVA 1SD7A 1W1WE 4HNVA 2GQQA 2E1MB 2DMUA 2KKOA 4A93J 3BG7A 4KICA 2LREA 3OS2A 2QBYA 5E3OA 1FLIA 4HSRA 5IP6A 2R7TA 2KL4A 4HDVA 3G73A 4ON0A 5DCMB 4BHBA 1AKHB 3W6KB 2IAIA 1Z7LA 2EIKH 2F5EA 2N8GA 4JK1X 4B44A 4FCYA 3F8FA 5IT9Z 3HUGB 1OCOH 1TWGJ 5D1RA 1HQCA 1BR1A 1O7FA 2B0LA 4A3FJ 5ILUA 2QZ8A 5LRSA 2FD5A 3M1CA 1R5GA 4ME9A 1WVRA 4WXDA 1P4AA 2ECCA 2E2IJ 2XRLA 5H20A 3VB2A 3VOKA 4LMYA 2EV0A 3ZGKA 1HKQA 3GBGA 2V1XA 3BG6A 3ISPA 3LJLA 1YG2A 2WAQA 5L3FA 3K2AA 5CPRB 3BT9A 1ZRDA 2W25A 2B3WA 5H9TA 3QBMA 4M74A 5KAIC 3GLLA 1TWHJ 1IRFA 2V4JC 2XPWA 3VVZA 3FMSA 3JTHA 3RZDJ 4IEJA 4BQQA 4OAYA 3HE0A 1F43A 1JKRC 2VKHA 4AWXB 1FOWA 1K78A 3KZIC 3KP7A 2FBIA 2Y48A 4EQQA 4EM0B 1SMYF 2ZMEC 3JR9A 3WE3A 1A35A 3MAJA 4P96A 2M1BA 5GTIC 4PUSA 4TV7A 3KP6A 2Q24A 3GWZA 3AG3H 2DG8A 1T95A 3HOTA 2ID6A 1SVLA 2MBFA 4RAYA 1LVKA 3ZCOA 3RKWA 4X0GA 4L9JA 4B8XA 2ELHA 3MKLA 4F3QA 5AIPA 5LEJA 3S1NJ 3HTJA 3O3KA 4CCLA 2DAOA 1BM9A 1O3RA 5FMPA 3FISA 4AYBN 2OTLI 1SVMA 4FTHA 5M5XJ 1FYLA 3NEUA 4PSXA 4A12A 2E1OA 2XSDC 2QSHX 3HSEA 4HF1A 3TOAA 3LA3A 2B1EA 3VYSB 2RASA 2MYSA 3I58A 1XB4A 4CH7A 1J9IA 3S5RA 4A6DA 5ICCA 3CJRB 3JCUC 4G94A 2COMA 2JN6A 2OA4A 2UXOA 2ELJA 3E1SA 3OYKA 2Y0MA 4BHCA 4LLNA 1X1BA 1I1SA 1N25A 1XSXA 1TT5B 2OU2A 3H5NA 1H9GA 2ZO4A 3P9IA 3MZYA 4L5IA 3VFZA 2VI6A 3CESA 1UI6A 2VKEA 1X4PA 3BR0A 2HKUA 3FRQA 4RAZA 5HLIA 1JJ8C 1U8BA 1WZ2A 1YOVB 4CCJA 1ZH5A 3P9TA 4GFLA 2XAHA 1T0FA 2ACJA 3ZQ7A 1XMXA 3M4OJ 1E2XA 1YQAA 1R23A 2MH9A 2ZKZA 3LL7A 1XS9A 1XCBA 1RUOA 1I6HJ 1Q1VA 2AXLA 2EZKA 1DDNA 2NXNB 2OERA 3HC7A 4U87A 1JUSA 1S7AA 3FXUA 4KT5C 3ROUA 4YIFA 1WCMJ 2D2WA 2VJ4A 1DU6A 4NC8A 4XLPF 2R92J 4EMSA 2JPBA 3SEQA 2GXBA 1FOYA 1FTZA 3CC2I 2DFFA 3L2WA 4O5VA 4II2A 1X1CA 4Q5SF 4G7ZF 5J1RA 2OBPA 5F1JA 4U7DA 2OZ6A 2DG7A 2ZCXA 1P2FA 2VBZA 2HYFA 1O3QA 1Z6RA 2HI3A 1SAUA 1K6YA 1OJLA 2R7ZJ 2A6EF 2JUGA 3OIOA 3BJBA 3BPXA 3G1OA 1FIAA 1YS6A 5EGOB 3ECHA 1UCRA 5FGLA 2K02A 4HSTA 3IL2A 3ZN1A 2XGXA 2KISA 2FBQA 3TDZC 4ESJA 2HQ5A 2WUIA 1XMAA 3B02A 4IHYA 3S2DJ 2P5LC 5LHHA 2DN0A 1IC8A 4M9ZA 3SYTA 1O57A 4C2MJ 3NAUA 1VQ7I 1N75A 1LNWA 5LHIA 3MKWB 1KU9A 3OYEA 1XGSA 1ERDA 1H0MA 2JWTA 3NRVA 4XRFA 1Y1WJ 5J40A 3FKJA 5CJ9A 4D5FA 1M1EB 2HQNA 4XLFA 1Z21A 1XDSA 1IUFA 2V9PA 3OSGA 4G6TB 2KIQA 5E20A 2CW0F 3DEEA 4DYRA 3MZHA 4HA8A 4M73A 3S1MJ 3JREA 1IN5A 2CO5A 3CF5F 2FNAA 5K7ZA 4P1WA 4BY1J 3PSIA 1FWZA 2VT3A 4FASD 3BLYA 2EV5A 1F36A 2DOEA 3V7SA 3HOYJ 3ABLH 2CG4A 2ZCWA 3CUQC 3PFYA 4XNFA 3AQTA 2L9RA 2ZJRF 2NVXJ 1BR2A 2K27A 2IXSA 3J81K 1C0WA 2KIUA 1FNNA 2BXZA 2VQLA 3NS4A 1LFBA 2VODA 2UXXA 3A02A 3HTUA 4I0AA 3IKTA 3HGGA 4XONA 2P4WA 2XC7A 3KEQA 2QA4I 2R5ZB 3CO7C 4XQFA 2XDNA 3RPUD 2BOLA 2O5RA 1FBUA 2WY8Q 2AS5F 3T6NA 3FXQA 5J1YA 1Y0NA 2DOFA 3BP8A 2P5VA 4FE7A 2R4GA 1U5TB 2LH9A 2HU9A 3T1BA 4ZYEA 2IU5A 3E5XA 3JAMZ 4RB3C 4NC6A 3BZCA 2I8DA 1R9TJ 5FROA 3F22A 2A3SA 2ZNZA 2LD5A 3LA2A 3W2AA 4IOAF 5KCMA 3RCOA 3OOPA 3SZGA 1YW7A 2NVYJ 1F4KA 1WI9A 1HDDC 3JRCA 4ZZLA 3C7JA 2EIMH 5BNGA 4KJZA 1UHWA 3OYCA 5E1WA 1B8IB 4XKVA 5J8CA 1FP1D 3S1RJ 2JT1A 4RGXA 2DA3A 1ZGJA 4M3FA 2XAGA 5DD4A 2HOEA 3Q0WA 1X3ZB 4Q47A 2DMQA 3G71I 1FYMA 1EH7A 3C07A 1EA3A 1PJRA 2MLGA 4XSZF 3COAC 1D1AA 1OPCA 3ZQLA 2XPUA 3RH2A 4HYEA 3WG9A 4BNCA 2DFHA 2BHYA 3RJPA 2WAFA 2XIGA 1SC7A 4J00A 1FBSA 3B81A 1MGTA 2EB7A 2R7WA 1D0YA 4H4KC 3H0DA 4BAYA 3WGIA 2JPCA 2V9KA 5ED4A 3E5QA 4XORA 4WX9A 2HWVA 2CMPA 3QODA 2V7FA 1WHUA 2JRMA 2REKA 3E6BA 2XDVA 3F8NA 1VQNI 5F6FA 1VI0A 1JHHA 3FF5A 4QLCU 3PL8A 2X48A 3LA7A 3VSKA 4EJUA 2W53A 3KKDA 2LOOA 1TTYA 3KP4A 4HEA2 3CMYA 2L0KA 2LY1A 3KYLA 4PJJA 4KIFA 1R49A 3QP6A 5JVTA 1LQ1A 1T08B 3L00A 2CGPA 4HZFA 3OSFA 2ZFWA 5ICEA 4C2MA 5HAWA 4EJOA 2DT7B 1FYKA 3GF2A 4HX7A 1VQLI 5D4SA 4GFBA 4M6XA 1QBJA 3SDBA 3EDPA 4XRSG 2VLAA 3JRBA 3HRSA 2OUMA 3ABTA 2PLYA 3ZR8X 3JTGA 3OYJA 1F5TA 4AC0A 2GOMA 3G6EI 3K70C 1Y0UA 2ZXHA 4LLGF 3I71A 3BTCA 2KIMA 1UELB 2ID3A 1ITYA 2RC4A 2WAEA 3H5AA 3LQQA 3BPVA 4D5CA 4BDZA 5FFXA 5FD6A 1XMKA 2FNPA 4A3CJ 3GTQJ 3S3OA 2CYYA 3W6JB 4II3A 3HZJA 2X6WA 5M5WJ 3VYTB 1FSHA 3DBRB 5LGNA 2E7XA 2EFQA 1WJBA 4HOBA 5J8FA 2MA3A 1OCRH 1MDMA 1JI8A 1T38A 3TL4X 5BPDA 2EFOA 1EJ9A 2IS6A 2R5YA 1O3SA 4AIJA 3AL0B 4IPAA 1GDTA 1UMQA 1EV7A 5C44J 3HTSB 3M3YJ 5TISC 3GTMJ 2M8EA 1P7JA 3G1LA 2E1NA 3SZPA 2RREA 2XGEA 4I09A 3GEZA 5AONA 4XOTA 3PPBA 2O7TA 5LEKA 3J80Z 4X6AJ 1D3YA 2ZY9A 3BG9A 3HKZN 4JL3A 2DJNA 3A0BC 5F64A 5E1XA 5D4RA 1B9MA 4XICA 2NP5A 5B5EC 5DUKA 3PJRA 3WU1B 2VOOA 2CUFA 1EH8A 2L7ZA 2LDUA 5E17F 4ITVA 3HIFA 3WHCA 2HQRA 3NWSA 5E3MA 3O8HA 1LEBA 1Z91A 4E7LA 1E0EA 2XF5A 2NOJB 1WRJA 3F23A 4LB5A 2O6GE 2VJIA 1TW3A 2X9DA 3OYDA 3BCGA 1YO5C 1R5HA 2P7VB 2PBIA 3LAJA 1Y6IA 1JGGA 2IEKA 5E3NA 3DFGA 1HW5A 4N9IA 3COLA 2HZTA 4EGZA 2LC2A 3PQKA 5CVRA 2DJIA 4XM3A 4IXAA 2FSWA 4M72A 2HDWA 3HSRA 3RDIA 2HZDA 4N0BA 2QBYB 5BS6A 1JKOC 2PMZA 2WAQN 3S2WA 1RR8C 1VQ4I 5HLHA 3PUBA 2XKPA 3CF2A 3ZMZA 2M34A 4OIRF 4WIBA 3GTKJ 3FK6A 3R60A 1H9TA 1W7PA 4KISA 4GCLA 3DPLC 5ILSA 1MMGA 3LSKA 3CCJI 1G4DA 3C2HA 4IRVA 2MLKA 3KPHA 3S16J 3CDHA 3TQNA 2W1OA 3EUAA 3M8EA 5LRRA 4MTEA 3V8LA 2Y0SA 1K6OA 2HOSA 4L18B 2IS2A 2XRNA 5HDKA 1I1GA 1B6AA 4MQVA 2HGCA 1MIJA 2Z16A 3SFZA 1QHHD 4RGRA 2LVSA 3ZMVA 1Z05A 1K79A 3QU6A 2E19A 4HF0A 1E3PA 4DNCA 5D5WB 3OYLA 3EUPA 2H1KA 5EZHA 2DPUA 3CQZJ 2IA0A 3PO2J 4PGGA 3QPLA 5CKTA 4I2OA 5GTHC 4PK4A 4ICHA 1P92A 2HYGD 2I10A 1FX7A 3OYFA 4V2GA 2JVGA 2EILH 5FKKA 3GMEA 1FC3A 1K78B 3BRUA 3KKCA 3M9AA 4OU0A 4G6QA 3HPGA 2LMDA 1ACIA 3DU5A 4ZYDA 2WV0A 3V78A 4HLYA 1W36C 1R4MB 1YX3A 1IO2A 1RKTA 5EEAA 4B3AA 3BG3A 2DQRA 1I5ZA 1OCPA 1JTXA 2UXHA 2LTPA 4WWCA 2JSCA 4DJAA 2M4GA 2NAZA 1STZA 2GA1A 3HM5A 4PSWA 2K4BA 1Y8RB 3WG7H 1CF7A 3HG9A 1NG6A 1HSJA 5TGTA 4ZYGA 2PMHA 3E6CC 4BACA 1HCRA 3NXCA 1D5YA 3S1QJ 2NS0A 4M3DA 1XGMA 1U0JA 1O7LA 1R22A 2MC3A 4IX7A 1G3TA 1JJ6C 5M3FJ 1ZRFA 3K0LA 2DODA 4A3GJ 1EF4A 1QO0D 1XDUA 3U2RA 1IRXA 2H94A 2VL8A 3QOPA 1BJZA 3I4PA 1YX5A 3LSRA 1OLTA 2L4AA 4BE2A 3ZQIA 2V57A 1BBYA 4IRHA 2DK8A 2UXIA 2LRDA 4YEJA 4O6JA 4KWAA 2A61A 1WH7A 5F08A 5IOZA 3WTVC 2R7XA 1FMWA 1R5ID 1NHAA 5HODA 3U1KA 4B43A 3T8TA 5FRMA 2L3DA 3QWLA 3GYHX 4MO7A 2KFDA 1JXSA 2H27A 4BXUA 2OD5A 4C3HJ 2Q0OA 3IAS2 2BGCA 2VXZA 2QOPA 2X6XA 5DEQA 4JQFA 1OISA 3BDDA 3HHGA 2ZOZA 3H35A 4M3BA 2EZLA 2R3SA 2UXNA 4ESBA 2M7AA 2VXDA 2B63J 4HNUA 5BMZA 2G3BA 5TRDA 2LF8A 5GAEJ 4U0WA 3KZ9A 3FX3A 1ZR4A 3DTIA 1YTYA 1KQ8A 3DPJA 4XL9A 1WGXA 2QQAA 1G3YA 1WJ5A 3RSNA 1Y1VJ 1XGOA 3GTPJ 2E1MC 4HPQA 3EYYA 1VF9A 2NVTJ 1SFEA 2A07F 1GXQA 3ULQB 4BUPA 2PZ9A 2W00A 3WHBA 5CXIA 2VQGA 2V1UA 2QSFX 2W85A 4W97A 1UHSA 1X1PA 2KRCA 2L54A 5HDGA 4ZDLA 3GTLJ 3NI7A 4OD5A 2RVCA 2XF6A 3K69A 3WTWC 3BTJA 1A6QA 1GLNA 2FA5A 1DQUA 4RGUA 2UUZA 2AQEA 3CDIA 2OCEA 3L2VA 1I6XA 2EFPA 2ZJQF 4AM3A 4CCNA 1P7IA 2OAZA 2M30A 3ERED 4UV8A 3N05A 2V1NA 4LD5A 3V6GA 2DOAA 4B47A 4IRIA 4BJ6C 5DUIA 1F9NA 5L3GA 4XN0A 1XGNA 4I6ZA 5H6QA 2VQHA 4CZZA 3PIPF 3QPTA 3IV5A 4KN4X 1QHGA 4CYCB 1NH3A 3I53A 3GTGJ 3EPZA 4BQOA 3FXKA 4CXFA 2EPFA 4BBRJ 3WGGA 1MSEC 1D0ZA 3Q9SA 2JA8J 5D6EA 2XKOA 2QKOA 2DA6A 1YE9A 3F3XA 2JSPA 2DK5A 2LYCA 4R1HA 3HOXJ 2XAFA 2ZXIA 2DYRH 2BW3A 2CH0A 4RAFA 3SHFA 1Y39A 3Q9VA 3DTKA 4A2UA 2MG4A 4AC6A 1R1TA 3LMMA 2HPMA 4A3EJ 2RV8A 3SQNA 5J47A 4XLNF 3GZ6A 3H9GA 2F4IA 5FO5A 2BZTA 3JRIA 4RBOA 5HBUA 3E0JB 1W4MA 2KP6A 3HOUJ 1REPC 1SD6A 1RETA 1UHMA 1F1ZA 1WJAA 1SGMA 4HV6A 3V4GA 2BY0A 2R7UA 3KP5A 3KEYA 5FRNA 2JA6J 4JYKA 1MSFC 4IHSA 1AU7A 2FJI1 5JFRA 4OIQF 2Y2ZA 1QA6A 2CWEA 4XKCA 3S32A 1SFUA 2Y30A 4I7HA 3CUOA 2XSJC 2QUFA 1J09A 4RB0A 4OIOF 1ETVA 2XGCA 5K58A 2F4MB 1S72I 1RR7A 5K5RA 3I54A 4GRIA 1JKPC 4GYIA 3ZOBA 1T98A 3PFIA 1IAWA 4CGRA 3FMRA 3QU3A 3GW2A 1B72B 1XG1A 3A01B 4NELA 2IA1A 2BVMA 5HS7A 1N78A 1ZG5A 3I4NJ 4LIUA 1YRNA 2BY3A 3RKXA 1X1DA 1ETKA 1BA5A 4D1QA 2FXAA 4HBLA 3CZ6A 1R71A 2XPVA 5HSZA 1LEAA 2DCEA 3ZXSA 3IH2A 1USSA 2CW7A 3VUQA 3R4KA 2EQRA 3HRMA 1X19A 1GHCA 5EEHA 2CV1A 2O61A 3WTYC 3H36A 3GTOJ 3E6MA 4CUGA 2JUCA 3D1NI 3HTHA 4I01A 2ZFUA 5FKLA 1TWAJ 2GUHA 4BH9A 3BQZA 1AA7A 2KLOA 3CDLA 4UUSB 2DQLA 2RHAA 5FHPA 3MFKA 1GXPA 5C4JJ 3LSJA 2G0EA 4P5OA 3FDYA 4B1RA 4IHVA 3ON2A 4D7NA 2WADA 2E7WA 1FEXA 4HKUA 4NNJA 3I59A 1LE8A 1YLFA 1RI7A 4BJ5C 5CLSA 3F8MA 1Y8QB 1UJ8A 4N9HA 5HLTA 4ZC3A 4NN1A 4KMUX 3TKYA 2XASA 3F6OA 3CRJA 4DIQA 5FLVA 3TOBA 4M3GA 2BV6A 2EV6A 4M71A 4UB6C 1S7OA 4YFNF 2K9LA 4P55A 2DI3A 2IW5A 3KEOA 3WTXC 2W84A 4I98B 2JVHA 4GCTA 1IRZA 3K9TA 4GCKA 3E5UA 2QQ8A 2OV7A 5KNLA 1ETQA 3ZQGA 2L2OA 3N4MA 2O0YA 5CVJA 3GFJA 2QF7A 3HRTA 5HVQC 4O3MA 2YSRA 3K4JA 1KQ9A 1D8JA 1U2WA 1O4XA 4BDYA 4LK1F 1ZGWA 1WJEA 1UAAA 2R7SA 4RB2C 1Z0XA 2IP2A 4H0EA 2F48A 2V9VA 3TO6A 1A04A 1RZ4A 2L4MA 3OY9A 4HLXA 4ESFA 2DU9A 5DYMA 5K7FA 2H8RA 1QPIA 2FEZA 1T39A 4A3KJ 2D5VA 2FUG2 3RQ4A 3QPSA 1TZLA 4Y52J 4ENKA 1R4NB 4MFEA 3IH4A 4BEHB 3FM5A 2MD0A 2J5OA 4D7MA 2HVQA 1APLC 2H8WA 2HFHA 1IRGA 1W5SA 4LJZF 2EH3A 4QTRA 3HYIA 4UVAA 2XVCA 1R6RA 1MNMC 1HLVA 4EJTA 1D1CA 4CA0A 4L0ZB 5DCMA 1BC8C 2CW8A 4IHWA 2DXIA 4BYYA 3ZQFA 1DP3A 3AKZA 2NRAC 2VASA 2A68F 1FBQA 1H8AC 3H5RA 3RIRA 1PUEE 3CCRI 3BROA 1U5TC 4B48A 4E6KG 1NK3P 3CC4I 4B4CA 3EGQA 3CTAA 1IF1A 4LK0F 1MJ9A 2PEXA 2UV1A 3DKWA 2X6YA 3WTZA 2YX7A 2QVOA 4BHPA 4EEFG 5D19A 1P6RA 1ZYRF 1WH5A 1MBKA 2QSGX 1X2NA 5D5UB 3VEPA 1QZYA 1J0RA 4F7ZA 3PO3J 1WSUA 4F91B 2LBFB 1J5YA 5DS9A 2VT2A 4XOPA 3T8RA 2W7NA 4A3DJ 3HJEA 4JX5A 4IQ4A 4NQWB 4MGRA 1B1BA 3ERMA 3HDDA 2F2EA 5GPCA 2XV4S 3GFMA 4E7IA 2H6CA 2PMZN 3DP7A 3KP3A 5DAJA 2BEOA 2O03A 3HXLA 2F5CA 1XTAA 2DA4A 5E8IA 4BY7J 2JMWA 3SDGA 3IH3A 4DOZA 1G6NA 2YS9A 5EG0A 3AG2H 1IN6A 2P6SA 2Y0SN 3KZZA 3VSLA 2EFWA 2ISYA 1XSVA 2YU9J 1TL8A 3J81Z 3BTIA 1IDYA 3A2KA 2M4KA 1X4OA 4WF2A 2ZMEA 3M1EA 2QKLB 2RKHA 4KA4A 5C4XJ 4FQGA 3MKZA 2GAUA 1W7PB 4Y15A 2HXOA 3L2QA 3G2BA 4QSHA 1MBHA 3QYFA 2DDBA 1WWXA 5HLGA 1HW1A 4MLOA 1WPKA 2CUZA 1XC5A 5J4VA 2VE8A 4IHXA 1SEUA 2Z3YA 2LP0A 3BZKA 2KIFA 4D0PA 1KQ0A 3GUDA 3F72A 2CFXA 3AFHA 9ANTA 2F6CA 5FGMA 2E35A 2M87A 3CCMI 1K61A 3JSJA 4DGWB 2QGUA 3HTAA 3GEUA 1FP2A 3QOEA 3L2UA 3RKQA 4IF4A 4HF2A 4UV9A 2LKSA 3HB9A 1OR7C 3IWFA 3UR3C 3KFWX 3V8KA 4A5MA 1I3AA 3A0HC 1ZELA 4K2EA 1XX5A 4U88A 2CRGA 1XD7A 3K1MA 5F0CA 3QRFF 1ON1A 1S8NA 3OR2C 4NDLA 4PFOA 5DM7F 3L9FA 5B1AH 4ENNA 2P81A 5DDGA 3G4SI 5C4YA 1RIOH 4W1UA 2MD5A 1D8KA 3BR5A 2TCTA 3I9V2 2R7VA 2YVXA 1WJCA 2D1VA 4BGDA 2VPRA 2Q1ZB 4OWRB 2Y9ZA 2ME0A 3V7RA 2ISZA 1QRYA 5BPIA 3H9QA 1TT0A 2XUBA 5ICFA 2IJLA 2RN7A 4ETSA 1ZTRA 1X3UA 4BQNA 4UHTA 1CF7B 3S2HJ 2CJJA 1IV6A 4G7HF 3H1CA 4PZJA 5KVRA 3GLXA 1R58A 4UXNA 1UB9A 3DQVC 2F5VA 3FIWA 1ZRCA 1BJAA 2VN2A 4IL6C 1A5JA 1S5LC 2GZWA 3ZQCA 1R36A 4GO1A 3ANPA 2G7LA 3E6DA
chains in the Genus database with same CATH topology
1TWHJ 3VVZA 2XPWA 1BW5A 1OCPA 1JTXA 4S0HB 2LTPA 3RZDJ 4IEJA 2KDZA 2M9HA 2UXHA 3HE0A 1IDZA 4CYCA 1F43A 2NP3A 5M3MJ 1JKRC 3HM5A 2R0QC 1UI5A 1MBGA 5EF6A 3JR9A 2L7MP 3KNWA 1HCRA 3NXCA 1D5YA 1GVDA 2HOAA 3S1QJ 4M3DA 1GV2A 2RAEA 2Q24A 3Q0VA 4DYQA 1GT0C 2DG8A 1BL0A 1JJ6C 1T56A 5M3FJ 4MIMA 2ID6A 4A3GJ 4I76A 3JRFA 1EF4A 3HTIA 1TWFJ 1TC3C 1BJZA 3MKLA 2HDDA 3LSRA 2OPTA 2XGDA 2VUMJ 2GBYA 3S1NJ 3HTJA 3B6CA 3DEWA 3B6AA 5IYCJ 5FMPA 3FISA 3VIBA 3ZQIA 2V57A 4AYBN 4FTHA 5M5XJ 2UXIA 1H89C 2E1OA 2XSDC 4YZEA 3BR1A 4KWAA 1WH7A 1JUMA 5F08A 5IOZA 1JKQC 4FE4A 4JNNA 3G1MA 2NVQJ 5HODA 1ETXA 5JLWA 4MO7A 3MNLA 2RASA 2QCOA 4MXMA 2LK2A 4XK4A 4C3HJ 3BHQA 3S5RA 2R93J 2QOPA 5F0FA 2ZOZA 1WI3A 5FLMJ 2JN6A 4M3BA 5FKMA 2EZLA 2R5ZA 1HF0A 2UXOA 2B63J 3G7RA 3BR6A 1VNDA 2G3BA 4GFKA 4M6VA 1B72A 2DA1A 3LHQA 4M3EA 3A01A 3KZ9A 1HOMA 4DW6A 1ZR4A 2CUEA 2VI6A 3RZOJ 1UI6A 3DPJA 2VKEA 2WGBA 4ACIA 3BR0A 4XIDA 1WGXA 2HKUA 3FRQA 2YVHA 1Y1VJ 1JJ8C 3GTPJ 3VOXA 1U8BA 1W0TA 4GFLA 1VF9A 3P9TA 2COBA 2VKVA 5IOYA 2Y9YA 2NVTJ 1U78A 5JLXA 3M4OJ 2O7OA 1XS9A 2PZ9A 3WHBA 5CXIA 1ETOA 3GTJJ 3RD3A 1I6HJ 1Q1VA 2EZKA 2OERA 4W97A 1UHSA 2O8KA 1JUSA 1U9OA 3UKGA 3GTLJ 4A69C 3NI7A 1SANA 1WCMJ 2JJ7A 2FQ4A 3AQTA 3JRDA 5HAWA 1T33A 1DU6A 4UDSA 2R92J 3BTJA 2MGQA 4UUSA 2AHQA 5IP9J 1FTZA 4X1EA 1P7IA 1MH4A 5J1RA 2OI8A 4JX6A 2DG7A 5F1JA 2ZCXA 3V6GA 3LOCA 2HI3A 1OJLA 2R7ZJ 2QTQA 3OIOA 2FJ1A 3BJBA 4I6ZA 1MH3A 3G1OA 4AF5A 1FIAA 5D18A 2NOGA 5EGOB 3IV5A 2X6OA 3GTGJ 4CYCB 5FGLA 3NARA 4XRSA 1JTYA 1X2MA 3F1BA 2EZHA 1MBJA 2LY9A 2FBQA 2DA2A 4BBRJ 2HQ5A 2WV1A 2WUIA 1MSEC 2JA8J 1I50J 3S17J 2QKOA 3VPRA 4IHYA 2ME6A 3S2DJ 4JKZA 2DA6A 1PUFB 2DN0A 1FJLA 1IC8A 1OFCX 2L7FP 4C2MJ 3NAUA 3HOXJ 2MW8A 1ZKGA 2JWTA 3BQYA 3L1PA 3JRAA 3O60A 1Y1WJ 2MG4A 4D5FA 4AC6A 1S7EA 4DZPA 1A6IA 4A3EJ 1IUFA 3OSGA 3CCYA 5EGOA 3JRIA 4DYRA 4RBOA 3NRGA 3S1MJ 3HOVJ 3OOUA 1ZQ3P 3HOUJ 3JREA 5CXGA 1RETA 5K7ZA 1PUFA 4BY1J 1SGMA 2DA5A 5EFYA 2LKXA 2E2JJ 3QQAA 2JA6J 4JYKA 1MSFC 1AU7A 2HYTA 1F36A 3PM1A 3HOYJ 2Y2ZA 1YRNB 2Y30A 3JRHA 2L9RA 2UXUA 1JT0A 2NVXJ 5GPAA 1IGNA 3BTLA 1IG7A 1ETVA 2XGCA 5K58A 2PBXA 1LFBA 1RR7A 5E3LA 3A02A 3HOWJ 3HGGA 1JKPC 1IJWC 2R5ZB 2XDNA 2AO9A 3ZOBA 2DTZA 3O8GA 4CGRA 3SFIA 1B72B 1XG1A 3A01B 4NELA 3T6NA 5F04A 3HBLA 1ZR2A 4C3IJ 5J1YA 3I4NJ 4FE7A 1YRNA 2JA5J 1VFCA 2IU5A 1ETKA 1BA5A 3FKIJ 3BNIA 4AUXA 1ETWA 2F07A 2K9NA 2XPVA 1R9TJ 4LOCA 5HSZA 1SFOJ 2LLKA 2LD5A 3IH2A 2D6YA 1LE8B 3VUQA 1I3QJ 2EQRA 2M2EA 1LFUP 3E7LA 2NVYJ 5F0HA 3GTOJ 2ZB9A 3D1NI 3HTHA 1HDDC 3JRCA 3HGYA 5FKLA 1TWAJ 2GUHA 2QWTA 3BQZA 3CDLA 5BNGA 1RESA 4UUSB 1AHDP 1B8IB 2RHAA 4V2FA 3S1RJ 5FHPA 3TW6A 2ZOYA 5C4JJ 2DA3A 3LSJA 2G0EA 4M3FA 4B1RA 1GV5A 4IHVA 4D7NA 3ON2A 4UUTA 3DCFA 3Q0WA 1TWCJ 1FEXA 4DZJA 4HKUA 2DMQA 1LE8A 1CQTA 3BR3A 4ABZA 3C07A 4G12A 4L5EA 4A3MJ 1FTTA 2JK3A 3ZQLA 2XPUA 3RH2A 2DMTA 4NN1A 3CRJA 3BR2A 2TRTA 5FLVA 1B8IA 4M3GA 3B81A 2NS8A 3CWRA 4BXXJ 4A3IJ 5J3LA 4GCTA 2GENA 5IP7J 1IRZA 4GCKA 4QIWN 1H88C 2REKA 1MBEA 1ETQA 3ZQGA 2YVEA 1VI0A 2QF7A 1O4XA 1ZGWA 3HOZJ 2GFNA 2X48A 1Z0XA 3BG5A 1K83J 2W53A 3KKDA 3MVPA 4J19A 2GLOA 3CMYA 5K7FA 2H8RA 2L0KA 1QVTA 1QPIA 1Z77A 5AQCA 1RKWA 4A3KJ 2D5VA 3S15J 2M8GX 3QPSA 4Y52J 3NNRA 2ZCNA 4MFEA 2HOTA 3OSFA 2E2HJ 1JT6A 3IH4A 3VP5A 1QVUA 4JX4A 2K9QA 3E7QA 3AQSA 3F0CA 4D7MA 1APLC 5EYRA 2YUSA 4QTRA 2EH3A 3TEDA 3JRGA 2M0CA 4GFBA 1MNMC 2NS7A 4XRSG 1HLVA 4A3BJ 3FK7A 3NPIA 3JRBA 3W6VA 4PXIA 3LSPA 4IHWA 3H0GJ 3VW0A 2ELKA 4AC0A 3LWJA 3HIMA 3ZQFA 2O9LA 2HXIA 3BTCA 1POGA 4BBSJ 2ID3A 1ITYA 3TW7A 2GM4A 3CJDA 2MSYA 4D5CA 3RQIA 1H8AC 3QKXA 2CU7A 5GP9A 1NK3P 4A3CJ 3GTQJ 3EGQA 2EZIA 4B4CA 3VW2A 3IUVA 3A03A 2WB1N 5K7HA 4MFDA 4FISA 3LSGA 5M5WJ 4EEFG 5D19A 2HYJA 5EG0B 3PASA 3VW1A 1WH5A 5IPAA 1MBKA 2R5YA 1X2NA 3PO3J 2XB5A 1GDTA 4Y7NJ 1UMQA 3H3VK 5DS9A 5C44J 3M3YJ 3GTMJ 1P7JA 3G1LA 3K7AJ 4A3DJ 4JX5A 3HDDA 2XGEA 5GPCA 3PPBA 2QIBA 2O7TA 3ANGA 2PMZN 3VVYA 5DAJA 3Q0UA 4X6AJ 4DYCA 1E3OC 5C3EJ 1NTCA 3BG9A 2DA4A 3HKZN 3I4MJ 2DJNA 4JL3A 4BY7J 2JMWA 3SDGA 3IH3A 4XICA 2NP5A 2K9SA 2YS9A 5EG0A 2CUFA 2L7ZA 3HEFA 3GZIA 3VVXA 3WHCA 2Y0SN 3Q3SA 2XB0X 2K40A 5HBUA 5E3MA 2W48A 2YU9J 4C3JJ 3O8HA 4JP0A 3TP0A 3BTIA 1IDYA 2DA7A 5DTDA 2X9DA 1MBFA 5CW8A 2DMPA 1ZK8A 3BCGA 1U9NA 1ETYA 5J1UA 5C4XJ 5IYDJ 2KT0A 1JGGA 3SJMA 1G2HA 2FX0A 2CQQA 2IEKA 3S14J 2HXOA 4QSHA 1MBHA 5E3NA 3ON4A 3COLA 5F27A 2LFBA 2G7GA 2CQXA 2LR8A 4MLOA 1WPKA 1XC5A 1RPWA 2ECBA 4IHXA 3ZQHA 1DU0A 5FKOA 1BW6A 2LP0A 4A3JJ 1FIPA 2JA7J 1ENHA 3MN2A 1JKOC 1UG2A 9ANTA 2IBDA 2WAQN 1K61A 3JSJA 4RDUA 3HTAA 5IYBJ 3GEUA 3RKQA 1OCTC 2NX4A 2M34A 3GTKJ 3HB9A 3FK6A 5FJ8J 4GCLA 2OF7A 4A3LJ 3S16J 1NK2P 5FKNA 2HOSA 2CRGA 1X58A 5EZGA 5EDNA 1HDPA 5F0CA 2EBIA 3TP3A 4MK6A 4HNVA 4A93J 2DMUA 2DMNA 4NDLA 4L62A 2P81A 2LVSA 5E3OA 5C4YA 5IP6A 1JUPA 3C2BA 4W1UA 2E19A 3BR5A 2TCTA 1AKHB 3EUPA 2IAIA 2H1KA 5EZHA 2N8GA 3G56A 3CQZJ 4FCYA 3PO2J 3QPLA 1TWGJ 5D1RA 1ORKA 2VPRA 2ZCMA 4A3FJ 5M5YJ 2Y9ZA 2FD5A 2ME0A 1W0UA 4ICHA 2I10A 1QRYA 4XRMA 4ME9A 2ECCA 4V2GA 2E2IJ 2XRLA 5FKKA 3VOKA 2G7SA 1ZTRA 3S2HJ 1GUUA 3BRUA 3GBGA 2CJJA 1IV6A 3KKCA 3LJLA 3V78A 2UXPA 3K2AA 3BT9A 3LNQA 1RKTA 3FIWA 5EEAA 1AKHA 2R5YB 1A5JA 4B3AA 3ZQCA 3QBMA 5H9TA 3ANPA 2G7LA 3BG3A 2Y31A 4BKXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TWH J;  3VVZ A;  2XPW A;  1BW5 A;  1OCP A;  1JTX A;  4S0H B;  2LTP A;  3RZD J;  4IEJ A;  2KDZ A;  2M9H A;  2UXH A;  3HE0 A;  1IDZ A;  4CYC A;  1F43 A;  2NP3 A;  5M3M J;  1JKR C;  3HM5 A;  2R0Q C;  1UI5 A;  1MBG A;  5EF6 A;  3JR9 A;  2L7M P;  3KNW A;  1HCR A;  3NXC A;  1D5Y A;  1GVD A;  2HOA A;  3S1Q J;  4M3D A;  1GV2 A;  2RAE A;  2Q24 A;  3Q0V A;  4DYQ A;  1GT0 C;  2DG8 A;  1BL0 A;  1JJ6 C;  1T56 A;  5M3F J;  4MIM A;  2ID6 A;  4A3G J;  4I76 A;  3JRF A;  1EF4 A;  3HTI A;  1TWF J;  1TC3 C;  1BJZ A;  3MKL A;  2HDD A;  3LSR A;  2OPT A;  2XGD A;  2VUM J;  2GBY A;  3S1N J;  3HTJ A;  3B6C A;  3DEW A;  3B6A A;  5IYC J;  5FMP A;  3FIS A;  3VIB A;  3ZQI A;  2V57 A;  4AYB N;  4FTH A;  5M5X J;  2UXI A;  1H89 C;  2E1O A;  2XSD C;  4YZE A;  3BR1 A;  4KWA A;  1WH7 A;  1JUM A;  5F08 A;  5IOZ A;  1JKQ C;  4FE4 A;  4JNN A;  3G1M A;  2NVQ J;  5HOD A;  1ETX A;  5JLW A;  4MO7 A;  3MNL A;  2RAS A;  2QCO A;  4MXM A;  2LK2 A;  4XK4 A;  4C3H J;  3BHQ A;  3S5R A;  2R93 J;  2QOP A;  5F0F A;  2ZOZ A;  1WI3 A;  5FLM J;  2JN6 A;  4M3B A;  5FKM A;  2EZL A;  2R5Z A;  1HF0 A;  2UXO A;  2B63 J;  3G7R A;  3BR6 A;  1VND A;  2G3B A;  4GFK A;  4M6V A;  1B72 A;  2DA1 A;  3LHQ A;  4M3E A;  3A01 A;  3KZ9 A;  1HOM A;  4DW6 A;  1ZR4 A;  2CUE A;  2VI6 A;  3RZO J;  1UI6 A;  3DPJ A;  2VKE A;  2WGB A;  4ACI A;  3BR0 A;  4XID A;  1WGX A;  2HKU A;  3FRQ A;  2YVH A;  1Y1V J;  1JJ8 C;  3GTP J;  3VOX A;  1U8B A;  1W0T A;  4GFL A;  1VF9 A;  3P9T A;  2COB A;  2VKV A;  5IOY A;  2Y9Y A;  2NVT J;  1U78 A;  5JLX A;  3M4O J;  2O7O A;  1XS9 A;  2PZ9 A;  3WHB A;  5CXI A;  1ETO A;  3GTJ J;  3RD3 A;  1I6H J;  1Q1V A;  2EZK A;  2OER A;  4W97 A;  1UHS A;  2O8K A;  1JUS A;  1U9O A;  3UKG A;  3GTL J;  4A69 C;  3NI7 A;  1SAN A;  1WCM J;  2JJ7 A;  2FQ4 A;  3AQT A;  3JRD A;  5HAW A;  1T33 A;  1DU6 A;  4UDS A;  2R92 J;  3BTJ A;  2MGQ A;  4UUS A;  2AHQ A;  5IP9 J;  1FTZ A;  4X1E A;  1P7I A;  1MH4 A;  5J1R A;  2OI8 A;  4JX6 A;  2DG7 A;  5F1J A;  2ZCX A;  3V6G A;  3LOC A;  2HI3 A;  1OJL A;  2R7Z J;  2QTQ A;  3OIO A;  2FJ1 A;  3BJB A;  4I6Z A;  1MH3 A;  3G1O A;  4AF5 A;  1FIA A;  5D18 A;  2NOG A;  5EGO B;  3IV5 A;  2X6O A;  3GTG J;  4CYC B;  5FGL A;  3NAR A;  4XRS A;  1JTY A;  1X2M A;  3F1B A;  2EZH A;  1MBJ A;  2LY9 A;  2FBQ A;  2DA2 A;  4BBR J;  2HQ5 A;  2WV1 A;  2WUI A;  1MSE C;  2JA8 J;  1I50 J;  3S17 J;  2QKO A;  3VPR A;  4IHY A;  2ME6 A;  3S2D J;  4JKZ A;  2DA6 A;  1PUF B;  2DN0 A;  1FJL A;  1IC8 A;  1OFC X;  2L7F P;  4C2M J;  3NAU A;  3HOX J;  2MW8 A;  1ZKG A;  2JWT A;  3BQY A;  3L1P A;  3JRA A;  3O60 A;  1Y1W J;  2MG4 A;  4D5F A;  4AC6 A;  1S7E A;  4DZP A;  1A6I A;  4A3E J;  1IUF A;  3OSG A;  3CCY A;  5EGO A;  3JRI A;  4DYR A;  4RBO A;  3NRG A;  3S1M J;  3HOV J;  3OOU A;  1ZQ3 P;  3HOU J;  3JRE A;  5CXG A;  1RET A;  5K7Z A;  1PUF A;  4BY1 J;  1SGM A;  2DA5 A;  5EFY A;  2LKX A;  2E2J J;  3QQA A;  2JA6 J;  4JYK A;  1MSF C;  1AU7 A;  2HYT A;  1F36 A;  3PM1 A;  3HOY J;  2Y2Z A;  1YRN B;  2Y30 A;  3JRH A;  2L9R A;  2UXU A;  1JT0 A;  2NVX J;  5GPA A;  1IGN A;  3BTL A;  1IG7 A;  1ETV A;  2XGC A;  5K58 A;  2PBX A;  1LFB A;  1RR7 A;  5E3L A;  3A02 A;  3HOW J;  3HGG A;  1JKP C;  1IJW C;  2R5Z B;  2XDN A;  2AO9 A;  3ZOB A;  2DTZ A;  3O8G A;  4CGR A;  3SFI A;  1B72 B;  1XG1 A;  3A01 B;  4NEL A;  3T6N A;  5F04 A;  3HBL A;  1ZR2 A;  4C3I J;  5J1Y A;  3I4N J;  4FE7 A;  1YRN A;  2JA5 J;  1VFC A;  2IU5 A;  1ETK A;  1BA5 A;  3FKI J;  3BNI A;  4AUX A;  1ETW A;  2F07 A;  2K9N A;  2XPV A;  1R9T J;  4LOC A;  5HSZ A;  1SFO J;  2LLK A;  2LD5 A;  3IH2 A;  2D6Y A;  1LE8 B;  3VUQ A;  1I3Q J;  2EQR A;  2M2E A;  1LFU P;  3E7L A;  2NVY J;  5F0H A;  3GTO J;  2ZB9 A;  3D1N I;  3HTH A;  1HDD C;  3JRC A;  3HGY A;  5FKL A;  1TWA J;  2GUH A;  2QWT A;  3BQZ A;  3CDL A;  5BNG A;  1RES A;  4UUS B;  1AHD P;  1B8I B;  2RHA A;  4V2F A;  3S1R J;  5FHP A;  3TW6 A;  2ZOY A;  5C4J J;  2DA3 A;  3LSJ A;  2G0E A;  4M3F A;  4B1R A;  1GV5 A;  4IHV A;  4D7N A;  3ON2 A;  4UUT A;  3DCF A;  3Q0W A;  1TWC J;  1FEX A;  4DZJ A;  4HKU A;  2DMQ A;  1LE8 A;  1CQT A;  3BR3 A;  4ABZ A;  3C07 A;  4G12 A;  4L5E A;  4A3M J;  1FTT A;  2JK3 A;  3ZQL A;  2XPU A;  3RH2 A;  2DMT A;  4NN1 A;  3CRJ A;  3BR2 A;  2TRT A;  5FLV A;  1B8I A;  4M3G A;  3B81 A;  2NS8 A;  3CWR A;  4BXX J;  4A3I J;  5J3L A;  4GCT A;  2GEN A;  5IP7 J;  1IRZ A;  4GCK A;  4QIW N;  1H88 C;  2REK A;  1MBE A;  1ETQ A;  3ZQG A;  2YVE A;  1VI0 A;  2QF7 A;  1O4X A;  1ZGW A;  3HOZ J;  2GFN A;  2X48 A;  1Z0X A;  3BG5 A;  1K83 J;  2W53 A;  3KKD A;  3MVP A;  4J19 A;  2GLO A;  3CMY A;  5K7F A;  2H8R A;  2L0K A;  1QVT A;  1QPI A;  1Z77 A;  5AQC A;  1RKW A;  4A3K J;  2D5V A;  3S15 J;  2M8G X;  3QPS A;  4Y52 J;  3NNR A;  2ZCN A;  4MFE A;  2HOT A;  3OSF A;  2E2H J;  1JT6 A;  3IH4 A;  3VP5 A;  1QVU A;  4JX4 A;  2K9Q A;  3E7Q A;  3AQS A;  3F0C A;  4D7M A;  1APL C;  5EYR A;  2YUS A;  4QTR A;  2EH3 A;  3TED A;  3JRG A;  2M0C A;  4GFB A;  1MNM C;  2NS7 A;  4XRS G;  1HLV A;  4A3B J;  3FK7 A;  3NPI A;  3JRB A;  3W6V A;  4PXI A;  3LSP A;  4IHW A;  3H0G J;  3VW0 A;  2ELK A;  4AC0 A;  3LWJ A;  3HIM A;  3ZQF A;  2O9L A;  2HXI A;  3BTC A;  1POG A;  4BBS J;  2ID3 A;  1ITY A;  3TW7 A;  2GM4 A;  3CJD A;  2MSY A;  4D5C A;  3RQI A;  1H8A C;  3QKX A;  2CU7 A;  5GP9 A;  1NK3 P;  4A3C J;  3GTQ J;  3EGQ A;  2EZI A;  4B4C A;  3VW2 A;  3IUV A;  3A03 A;  2WB1 N;  5K7H A;  4MFD A;  4FIS A;  3LSG A;  5M5W J;  4EEF G;  5D19 A;  2HYJ A;  5EG0 B;  3PAS A;  3VW1 A;  1WH5 A;  5IPA A;  1MBK A;  2R5Y A;  1X2N A;  3PO3 J;  2XB5 A;  1GDT A;  4Y7N J;  1UMQ A;  3H3V K;  5DS9 A;  5C44 J;  3M3Y J;  3GTM J;  1P7J A;  3G1L A;  3K7A J;  4A3D J;  4JX5 A;  3HDD A;  2XGE A;  5GPC A;  3PPB A;  2QIB A;  2O7T A;  3ANG A;  2PMZ N;  3VVY A;  5DAJ A;  3Q0U A;  4X6A J;  4DYC A;  1E3O C;  5C3E J;  1NTC A;  3BG9 A;  2DA4 A;  3HKZ N;  3I4M J;  2DJN A;  4JL3 A;  4BY7 J;  2JMW A;  3SDG A;  3IH3 A;  4XIC A;  2NP5 A;  2K9S A;  2YS9 A;  5EG0 A;  2CUF A;  2L7Z A;  3HEF A;  3GZI A;  3VVX A;  3WHC A;  2Y0S N;  3Q3S A;  2XB0 X;  2K40 A;  5HBU A;  5E3M A;  2W48 A;  2YU9 J;  4C3J J;  3O8H A;  4JP0 A;  3TP0 A;  3BTI A;  1IDY A;  2DA7 A;  5DTD A;  2X9D A;  1MBF A;  5CW8 A;  2DMP A;  1ZK8 A;  3BCG A;  1U9N A;  1ETY A;  5J1U A;  5C4X J;  5IYD J;  2KT0 A;  1JGG A;  3SJM A;  1G2H A;  2FX0 A;  2CQQ A;  2IEK A;  3S14 J;  2HXO A;  4QSH A;  1MBH A;  5E3N A;  3ON4 A;  3COL A;  5F27 A;  2LFB A;  2G7G A;  2CQX A;  2LR8 A;  4MLO A;  1WPK A;  1XC5 A;  1RPW A;  2ECB A;  4IHX A;  3ZQH A;  1DU0 A;  5FKO A;  1BW6 A;  2LP0 A;  4A3J J;  1FIP A;  2JA7 J;  1ENH A;  3MN2 A;  1JKO C;  1UG2 A;  9ANT A;  2IBD A;  2WAQ N;  1K61 A;  3JSJ A;  4RDU A;  3HTA A;  5IYB J;  3GEU A;  3RKQ A;  1OCT C;  2NX4 A;  2M34 A;  3GTK J;  3HB9 A;  3FK6 A;  5FJ8 J;  4GCL A;  2OF7 A;  4A3L J;  3S16 J;  1NK2 P;  5FKN A;  2HOS A;  2CRG A;  1X58 A;  5EZG A;  5EDN A;  1HDP A;  5F0C A;  2EBI A;  3TP3 A;  4MK6 A;  4HNV A;  4A93 J;  2DMU A;  2DMN A;  4NDL A;  4L62 A;  2P81 A;  2LVS A;  5E3O A;  5C4Y A;  5IP6 A;  1JUP A;  3C2B A;  4W1U A;  2E19 A;  3BR5 A;  2TCT A;  1AKH B;  3EUP A;  2IAI A;  2H1K A;  5EZH A;  2N8G A;  3G56 A;  3CQZ J;  4FCY A;  3PO2 J;  3QPL A;  1TWG J;  5D1R A;  1ORK A;  2VPR A;  2ZCM A;  4A3F J;  5M5Y J;  2Y9Z A;  2FD5 A;  2ME0 A;  1W0U A;  4ICH A;  2I10 A;  1QRY A;  4XRM A;  4ME9 A;  2ECC A;  4V2G A;  2E2I J;  2XRL A;  5FKK A;  3VOK A;  2G7S A;  1ZTR A;  3S2H J;  1GUU A;  3BRU A;  3GBG A;  2CJJ A;  1IV6 A;  3KKC A;  3LJL A;  3V78 A;  2UXP A;  3K2A A;  3BT9 A;  3LNQ A;  1RKT A;  3FIW A;  5EEA A;  1AKH A;  2R5Y B;  1A5J A;  4B3A A;  3ZQC A;  3QBM A;  5H9T A;  3ANP A;  2G7L A;  3BG3 A;  2Y31 A;  4BKX A; 
#chains in the Genus database with same CATH topology
 1WKM A;  5ERI A;  1BW5 A;  4S0H B;  4MHG A;  2KDZ A;  3AL0 C;  2M9H A;  1HST A;  3VOE A;  3ZQQ A;  5M3M J;  2B9S A;  3HRU A;  1K4S A;  2R0Q C;  3M07 A;  2WC2 A;  3IRR A;  4DBR A;  3D5L A;  5D5V B;  5EF6 A;  3G3Z A;  1OYI A;  1B59 A;  5HOO A;  3GX4 X;  1GVD A;  2HOA A;  4IJA A;  2RAE A;  3K1P A;  1GT0 C;  1J2X A;  1W5T A;  1BL0 A;  3S93 A;  4MIM A;  3LWF A;  3OYM A;  3CLO A;  1HXD A;  4KDP A;  2MFZ A;  1Z7U A;  3OYB A;  1TWF J;  2QQ9 A;  5LFA A;  3KX2 A;  1G59 A;  2DDA A;  1TC3 C;  1P9Q C;  2P7C B;  2PX9 A;  4N4N B;  3GVA A;  2VUM J;  2OPT A;  2GBY A;  1IN4 A;  3DEW A;  1BOA A;  2WA0 A;  3B6C A;  2Z5U A;  3FBN B;  5B1B H;  1ZAO A;  1WJD A;  3VIB A;  3BJO A;  1QQI A;  1VQP I;  5HS8 A;  3D0S A;  1H89 C;  1MZB A;  4RS8 A;  3MMY B;  1J75 A;  2KDO A;  5GAG J;  3BR1 A;  2X85 A;  4HAM A;  3BWG A;  1AOY A;  4U0Y A;  2L02 A;  1JUM A;  3ELK A;  2QM3 A;  5DM6 F;  3ASN H;  3WGH A;  4PGH A;  1ZHF A;  2Y75 A;  2NVQ J;  1ETX A;  3QYE A;  2L9S A;  4LG3 A;  4ZH4 F;  4A0Y A;  1ODD A;  2JZY A;  3CJT B;  4EJW A;  3BHQ A;  2FBH A;  2R93 J;  1WI3 A;  3SEZ A;  4EV0 A;  5FLM J;  1YIO A;  5FKM A;  2R5Z A;  4MTD A;  1HF0 A;  2V6C A;  2EIJ H;  3OIQ A;  5EEG A;  1VND A;  4M6V A;  3CUQ A;  2DA1 A;  4Y17 A;  4M3E A;  4QPQ A;  3LHQ A;  3RZO J;  4JOM A;  2WGB A;  4XID A;  3U9G A;  2YVH A;  4ZTF A;  3VOX A;  4YRV A;  1W0T A;  1FOX A;  1MMD A;  4MNU A;  5IOY A;  2Y9Y A;  3AAF A;  1QNT A;  3T0Y A;  3FM3 A;  5JLX A;  4KT6 A;  3D5R C;  3RTR A;  4EGY A;  4HG2 A;  2R7O A;  2XAJ A;  3GCM A;  3RD3 A;  1JE8 A;  4CZC A;  2OQR A;  4KIB A;  5F1R A;  2P0W A;  2JJ7 A;  3H3U A;  3KLN A;  2FQ3 A;  5CVU A;  5JVG F;  2VBW A;  1Z6T A;  4X1E A;  4UY8 I;  4G9Y A;  3BC8 A;  1XN7 A;  1FMV A;  1MH4 A;  4CSW A;  4JX6 A;  1DGR M;  3FBI B;  3TMO A;  3ABU A;  3L2R A;  3LOC A;  2R7D A;  1QZE A;  4EM1 A;  1V55 H;  1YJN I;  3RI4 A;  2FJ1 A;  4FT8 A;  1MH3 A;  2PJR A;  1MMN A;  1Q1H A;  2DYS H;  2QYO A;  1U3E M;  4XRS A;  3KIO A;  1JTY A;  1X2M A;  2RQP A;  2DFI A;  2EZH A;  2LY9 A;  1WQ2 A;  2DA2 A;  3KLO A;  2IS1 A;  3NQO A;  2WV1 A;  1I50 J;  3PNV A;  3WOD F;  4JKZ A;  3VPR A;  2ME6 A;  1SD4 A;  1R00 A;  2C6Y A;  1FJL A;  2L7F P;  2QEX I;  2MW8 A;  3I3L A;  2GOX B;  2RGV A;  5L3B A;  1FT9 A;  1GVJ A;  2ADU A;  3BQY A;  1Z1D A;  2M7B A;  3C1D A;  3L1P A;  2OCC H;  3JRA A;  3O60 A;  3VWB A;  4AID A;  4DZP A;  1A6I A;  1QPM A;  1T2K A;  3U21 A;  3BZ6 A;  2BY1 A;  3J7Z I;  4FX4 A;  2FU4 A;  3D5S C;  2Q8K A;  4QWQ A;  3NRG A;  4A0X A;  1ZQ3 P;  4CYD A;  3PUF A;  4CIC A;  3GFL A;  3KP2 A;  4GGG A;  1PUF A;  1ZLK A;  4HDU A;  2DA5 A;  5EFY A;  4WXH A;  3PIO F;  4XLA A;  3IKV A;  3OR1 C;  3PQJ A;  1MNE A;  3V7C A;  2ICW G;  3PM1 A;  3MEX A;  1KU7 A;  1SFK A;  1YRN B;  3JRH A;  2ZBK A;  2UXU A;  4RM2 A;  2IVM A;  4IZZ A;  1IGN A;  2W57 A;  3ZMS A;  3K8P C;  3T5X A;  1YFH A;  3BOQ A;  2PBX A;  2M45 A;  5E3L A;  2KRF A;  3HOW J;  2YR2 A;  2VKD A;  2PQ8 A;  1BIA A;  2Y69 H;  3K6G A;  5AIQ A;  1UG0 A;  2AO9 A;  3MWM A;  1VQ8 I;  2DTZ A;  3O8G A;  3K4L A;  2HVS A;  4IO9 F;  2X51 A;  1ZR2 A;  3HBL A;  4C3I J;  5A2Q K;  5DV5 A;  1ZGA A;  3VTI A;  1U8R A;  2CV2 A;  2JA5 J;  1BI2 A;  1XPX A;  4HQE A;  3FKI J;  3J7A Y;  1ETW A;  2F07 A;  3K4B A;  2K9N A;  2OZU A;  3JSP A;  2E36 A;  1K4T A;  1SFO J;  2LLK A;  1PVE A;  2D6Y A;  1LE8 B;  1I3Q J;  2GIV A;  2PN6 A;  1IW7 F;  4EAT A;  5F0H A;  4Y4R A;  2ZB9 A;  4DVY P;  1YJW I;  1YJ9 I;  4OIP F;  3F8C A;  2QEN A;  3LQR A;  5BQT A;  2HPI A;  4UUV A;  1RES A;  3HSF A;  2PJP A;  3IC7 A;  2DT6 A;  4IRG A;  2HTS A;  3EYI A;  1TWC J;  4Y3O A;  4AVP A;  1CQT A;  3BR3 A;  1KZH A;  4ABZ A;  4E7J A;  2EK5 A;  1TBX A;  1SMT A;  3S3M A;  4N4O B;  4G12 A;  4L5E A;  3TO9 A;  4RMN A;  5IT9 K;  1ZLJ A;  3EUK L;  2DMT A;  2NNY A;  1VQM I;  2X4H A;  3TO7 A;  1OMI A;  3E3V A;  5JR3 A;  3TGN A;  1D0X A;  1P4W A;  5L3C A;  1IXR C;  2Z33 A;  3CWR A;  4BXX J;  4E4H A;  1KGS A;  1WFX A;  4YEL A;  1SFX A;  1ZG3 A;  2Q2E A;  1YIJ I;  2EFN A;  3ML6 A;  4A3I J;  3RYR A;  2VON A;  2FRH A;  5IP7 J;  2V6E A;  3CD6 I;  1WJF A;  2K4J A;  3REO A;  4QIW N;  1H88 C;  1MBE A;  2X0L A;  2ZJ2 A;  3CP8 A;  3CCU I;  2ESN A;  3OL4 A;  5LGT A;  4A0Z A;  3P7N A;  1LJ9 A;  1VQK I;  3H3Z A;  3BG5 A;  1K83 J;  1V3F A;  4M9X A;  3MVP A;  4S05 A;  3A4C A;  4BS9 A;  2GLO A;  4U9N A;  4HW0 A;  3LSM A;  1Z77 A;  4XMY A;  5HNH A;  4ZJZ A;  4R79 A;  3S15 J;  1J7K A;  3PNT A;  3TBI A;  1MKM A;  4PJN A;  1W7P D;  3NNR A;  5JI6 A;  4IQJ A;  4P9U A;  4Q4Z F;  2ZCN A;  3MKY B;  2HOT A;  1OQY A;  5K1Y A;  4OIN F;  3VP5 A;  1QVU A;  1OYY A;  3FXR A;  2K9Q A;  3AQS A;  2M5W A;  3KYC B;  4GYG A;  1KYW A;  5EYR A;  3JRG A;  2M0C A;  2IRF G;  1T6S A;  4U0V A;  2ZSI B;  2NS7 A;  3O2P E;  2FOK A;  4RA2 A;  4A3B J;  3FK7 A;  3EUH C;  3W6V A;  1R1U A;  3RPU A;  3OYH A;  1PP7 U;  3ZRG A;  2K5C A;  3H0G J;  3UNG C;  4A6E A;  3VW0 A;  2ELK A;  3DWL E;  2L9V A;  5E8G A;  2HDC A;  3LWJ A;  1I39 A;  1IXC A;  3HIM A;  2O9L A;  2HXI A;  2J5P A;  3DLA A;  2GM4 A;  2L01 A;  3FXO A;  4CO8 A;  1X1A A;  1FPQ A;  2JRT A;  5GP9 A;  3M7G A;  4ZDP A;  2VOP A;  1OYW A;  4GCV A;  3NWT A;  3IUV A;  5K7H A;  4MFD A;  4FIS A;  3LSG A;  2F5D A;  2OC6 A;  1YS7 A;  2HYJ A;  2X1D A;  5EG0 B;  1E3H A;  2OTJ I;  3PAS A;  5IT3 A;  4XN3 A;  1ZRE A;  3FHN A;  2H6B A;  1V5E A;  4C9Y A;  3H3V K;  4P9F A;  5HDN A;  2OQG A;  2NNN A;  3QP5 A;  3K7A J;  2PFB A;  4PCQ A;  2HR3 A;  1LDD A;  2V26 A;  2QIB A;  2ZME B;  3ANG A;  3J7A O;  1S9H A;  4E70 A;  1IUY A;  4DYC A;  1E3O C;  1T8I A;  1NTC A;  2A6T A;  4DBQ A;  1D5V A;  3DV8 A;  2KQR A;  2LY2 A;  4LIV A;  2K9S A;  5ICG A;  3P9C A;  4C2T A;  1YHQ I;  1HC8 A;  4G8X A;  4KN7 X;  2L7K A;  4EM2 A;  3Q3S A;  2VJJ A;  2YX4 A;  3OS0 A;  3BJ6 A;  2K40 A;  1VQ6 I;  2W48 A;  3B73 A;  2XRO A;  2KJB A;  5BOX A;  3TP0 A;  2X1C A;  2DA7 A;  4PJ0 C;  1PP8 F;  2QLZ A;  1MBF A;  5CW8 A;  2DMP A;  2A5W A;  1ZK8 A;  2ZNY A;  3WTS C;  1U9N A;  5K5O A;  2R7R A;  1MJA A;  5IYD J;  5J1U A;  4YFK F;  3CC7 I;  2LNB A;  2DPD A;  2WB1 A;  3OS1 A;  2NYX A;  3SJM A;  2CQQ A;  4G6D A;  3K4M A;  2HKO A;  2CS3 A;  1RNL A;  2DT5 A;  4LIT A;  2G7G A;  2CQX A;  2LR8 A;  3I56 I;  1E17 A;  1V54 H;  1RPW A;  2ECB A;  1BC7 C;  3ZQH A;  4RAG A;  1EH6 A;  3SZT A;  4RGS A;  1DU0 A;  2BYV E;  1G3W A;  4A3J J;  4OAZ A;  1P4X A;  1Z9C A;  2JA7 J;  1HKS A;  1ENH A;  2F4O B;  3MN2 A;  2IBD A;  1A36 A;  1I27 A;  3OYA A;  2YU3 A;  4F93 B;  5IYB J;  2IS4 A;  5FB2 A;  4BE0 A;  2NX4 A;  2VB6 A;  1DPU A;  1V5G A;  3VYR B;  4NUB A;  5CQG A;  1B9N A;  3K70 D;  2R7Q A;  4RLQ A;  2EIN H;  1MMA A;  2RDP A;  5FKN A;  3I55 I;  3PSF A;  3K10 A;  1G3S A;  2KZV A;  5EDN A;  3TP3 A;  4MK6 A;  2EBI A;  2V1D A;  3ECO A;  4XLE A;  4C2U A;  2DMN A;  4L62 A;  4KIT B;  1PYV A;  5TJJ A;  4F55 A;  1JUP A;  3C2B A;  2G7H A;  1BI0 A;  3DEU A;  3FMQ A;  3L2C A;  4IKF A;  1LB2 A;  4CCO A;  4I99 C;  3G56 A;  1LDJ A;  2BY2 A;  2A69 F;  4HNT A;  1YIT I;  1ORK A;  2AXT C;  1AWC A;  2ZCM A;  4LG0 A;  5M5Y J;  4L9T A;  1W0U A;  1OCC H;  2HQA A;  3CMA I;  4XRM A;  1IV8 A;  3DXJ F;  2G7S A;  2IA2 A;  4L9N A;  1GUU A;  2DO7 A;  1LPQ A;  2E71 A;  1MND A;  2VJ5 A;  3MCZ A;  1QU3 A;  2V79 A;  5FFZ A;  2LF7 A;  3O6B B;  2UXP A;  2IGO A;  2LKP A;  5EJC A;  1MDM B;  3V8J A;  3LNQ A;  3WTU C;  1AKH A;  2R5Y B;  2GWR A;  3IHU A;  1KON A;  3DPU A;  2E5N A;  3I64 A;  3RPQ A;  4ZYH A;  3HUG A;  2Y31 A;  4BKX A;  5LBQ A;  2E34 A;  4S04 A;  1RRJ A;  4PDK A;  1IDZ A;  3IP4 B;  4CYC A;  1TNS A;  2NP3 A;  3OYI A;  5E79 C;  1YW9 A;  1UI5 A;  2DFE A;  1MBG A;  3S8P A;  3JAM K;  2PI0 A;  5D6F A;  3ABK H;  3FXJ A;  4A5N A;  2L7M P;  2ETH A;  2XF7 A;  3KNW A;  2G9W A;  4Z2Y A;  1GV2 A;  2WBM A;  3MZ8 A;  1LVA A;  2MC4 A;  2VBY A;  3Q0V A;  4DYQ A;  5GAH J;  1ZAR A;  5KAF C;  4YG2 F;  1T56 A;  3AG4 H;  5KK1 A;  3M8F A;  3HTI A;  4I76 A;  3JRF A;  2ZC2 A;  3W3C A;  3K4C A;  1U6G A;  3LSI A;  2D1H A;  4I02 A;  1KU3 A;  3CCS I;  3SWH A;  3JSO A;  4CCK A;  3IRQ A;  2HDD A;  2XGD A;  2CQK A;  1NG7 A;  5J6X A;  3B6A A;  1S29 A;  5IYC J;  5H2F C;  3ONQ A;  4GXO A;  4JBA A;  3GFI A;  2CQ7 A;  4L5J A;  3DLL F;  3DBH B;  3WU0 A;  3KET A;  2IPQ X;  4OMZ A;  3R61 A;  4OD4 A;  2EA2 A;  3FHZ A;  3LSH A;  4YZE A;  4UVB A;  3CUQ B;  1R7J A;  4FE4 A;  4XR6 A;  1JKQ C;  6PAX A;  5J4Y A;  2R7F A;  3G1M A;  2PFV A;  4JNN A;  2UZK A;  2W4S A;  2A05 A;  2W24 A;  4BL0 B;  1DPR A;  5JLW A;  2KRH A;  3MNL A;  3QPH A;  2QKM B;  1XCV A;  2K3P A;  1IXS B;  5HNF A;  2QCO A;  4MXM A;  2LK2 A;  4XK4 A;  1UFM A;  2JA2 A;  2FML A;  3EUH A;  2RNG A;  5F0F A;  1KU2 A;  4M9S A;  3OIP A;  3X2Q H;  4RB1 A;  1TP4 A;  3CP2 A;  2CUJ A;  3FXL A;  2CSO A;  4ASN A;  3G7R A;  3LAP A;  3BR6 A;  2STW A;  2HVR A;  4GFK A;  1B72 A;  2FOW A;  2VIX A;  3A01 A;  3WU2 C;  1DUX C;  1HOM A;  2A2F X;  4DW6 A;  1V4R A;  2CUE A;  4Y13 A;  4ACI A;  3HL2 A;  2P8T A;  3F8B A;  2GA2 A;  2E60 A;  4EJV A;  5ILV A;  3RYP A;  1N77 A;  3KYD B;  5FLX K;  3OL3 A;  2QWW A;  2COB A;  2VKV A;  3VYU B;  1U78 A;  4AYB A;  1W36 D;  2GIZ A;  3C18 A;  2O7O A;  4F52 A;  1ETO A;  3GTJ J;  2KZG A;  1VQ5 I;  2PJR B;  4NBQ A;  4L0Y B;  2O8K A;  1U9O A;  2K86 A;  3UKG A;  4A69 C;  5GAD J;  1SAN A;  2JTV A;  4ZTJ A;  2FQ4 A;  2EJR A;  1KYZ A;  3IUO A;  4MEY F;  4YIR X;  3CLQ A;  3V42 A;  4AVZ A;  1T33 A;  4YFX F;  3JRD A;  4UDS A;  1B4A A;  2LSO A;  2MGQ A;  4UUS A;  2AHQ A;  4HV5 A;  5IP9 J;  1TQP A;  1YW8 A;  4DQ2 A;  5K5Q A;  1ZN2 A;  2BBY A;  5LD2 C;  2OI8 A;  1UST A;  1HA8 A;  1VZ0 A;  1MW7 A;  4E7S A;  2JQ7 A;  2ZSH B;  1LUJ B;  2UWM A;  1MD0 A;  3VDX A;  2CV0 A;  4CHU A;  2QTQ A;  4AF5 A;  5D18 A;  2Z99 A;  1VQ9 I;  2NOG A;  3GZN B;  4D9J A;  2X6O A;  4MQ9 F;  4U9L A;  3NAR A;  2IGN A;  3F1B A;  1MBJ A;  3IAM 2;  2GXA A;  4Y33 A;  3J7Y J;  5FLX Z;  3S17 J;  3U1D A;  5LHG A;  1QZZ A;  4ENJ A;  1PUF B;  4XSX F;  2DLL A;  1OFC X;  2TDX A;  1YI2 I;  3ASO H;  4B3X A;  4NHJ A;  2H09 A;  4XKW A;  3S3N A;  1ZKG A;  4BQA A;  4J01 A;  4IHT A;  3R0J A;  2IT0 A;  3CCQ I;  3F6V A;  1BN5 A;  3DKY A;  4MEX F;  3DKX A;  1S7E A;  4FX0 A;  3CO6 C;  2XAU A;  3CCY A;  5EGO A;  3OMY A;  2K3F A;  3CCE I;  5CVI A;  5D5X B;  5CXG A;  2P5K A;  3HOV J;  3OOU A;  5KHD A;  2QQB A;  1DP7 P;  3ZP5 A;  3SXY A;  2E5Z A;  3J80 K;  3EQL F;  3FZV A;  3W2V A;  2HNH A;  2H1L A;  3ZN0 A;  2L5Q A;  2YPR A;  2FF4 A;  2LKX A;  2E2J J;  3L09 A;  3QQA A;  3LFK A;  3C3W A;  2Z2S B;  3ZMT A;  3F21 A;  4HX8 A;  4KFC A;  5FD5 A;  1J59 A;  4GDF A;  2HYT A;  4RLF A;  3RKY A;  4HQM A;  1V5F A;  2K85 A;  4BEH A;  3DU6 A;  1RC9 A;  1JT0 A;  1FOK A;  3IWZ A;  4G7O F;  3I0T A;  5GPA A;  5DD8 A;  3BTL A;  5LGU A;  1IG7 A;  3K1N A;  1FY7 A;  2ESH A;  3OYG A;  2PMU A;  3K4K A;  1XSD A;  1RUN A;  1IJW C;  1LFP A;  2A5Y B;  3ZPL A;  1BOB A;  1S3J A;  4LB6 B;  4NB5 A;  3SFI A;  4HRI A;  3C2G A;  5F04 A;  3KZY A;  1K7A A;  4PJL A;  5DCF A;  3ABM H;  5D8K B;  4EVI A;  4WK8 F;  1VFC A;  1ULY A;  2FBK A;  2WWY A;  3BNI A;  4AUX A;  3DBL B;  4E7K A;  4LOC A;  1TNT A;  1S6L A;  1TQM A;  2WY7 Q;  2M2E A;  3HPH A;  4WCG A;  2HEO A;  1LFU P;  1SAX A;  3E7L A;  2O3F A;  2D45 A;  4CDG A;  2CQN A;  1D1B A;  4PFP A;  1SD5 A;  3HGY A;  4OOI A;  2QWT A;  4KYW A;  1ON2 A;  1UZC A;  2LBF A;  1AHD P;  4V2F A;  3P5J A;  4NQW A;  3TW6 A;  1U5T A;  2ZOY A;  2PG4 A;  4AU7 A;  1MMS A;  1GV5 A;  4UUT A;  2ZXJ A;  2X1E A;  3DCF A;  3L7W A;  4BJT A;  3CCV I;  2F5F A;  3HHH A;  2Q2E B;  4KUM A;  4DZJ A;  3A1Y A;  1O3T A;  2B7E A;  1MJB A;  3FXM A;  3JW4 A;  2HS5 A;  5B3S H;  4B09 A;  4ANJ A;  4A3M J;  1FTT A;  1Z3X A;  2JK3 A;  4M6Y A;  3CJQ B;  2FE3 A;  2CFO A;  2M3A A;  3BY6 A;  3I5U A;  3F9K A;  4XKB A;  2VBX A;  3BR2 A;  2XAQ A;  2TRT A;  1LKX A;  1B8I A;  3BCB A;  2NS8 A;  2K7L A;  3TDU C;  3K2Z A;  2BW3 B;  2I5U A;  5CVV A;  3GXO A;  3W2W A;  5HS9 A;  1HBX G;  2VQC A;  4WXC A;  1SVO A;  5H6R A;  5J3L A;  2STT A;  1OCZ H;  2XHK A;  2KPM A;  2GEN A;  3GZ5 A;  4R8H A;  2E1C A;  5CQE A;  3CMM A;  4ZYA A;  1TW2 A;  4IVN A;  4E7Z A;  1G8X A;  5LLQ A;  2KJC A;  2YVE A;  4LLL A;  5JHU A;  2ZJP F;  1Y56 A;  2P6T A;  3HOZ J;  2GFN A;  2IGK A;  1QGP A;  1IN7 A;  3OWT A;  2IGM A;  1X3W B;  3GO5 A;  4ZDO A;  4J19 A;  2GXG A;  2KMU A;  4FHT A;  4F92 B;  1VTN C;  1QVT A;  4HX4 A;  2WTE A;  5AQC A;  1RKW A;  3R6S A;  5L3E A;  1OKR A;  1TLH B;  2M8G X;  4XBF A;  5D8L B;  2DTR A;  2HKX A;  3LST A;  1KA8 A;  5E18 F;  3OYN A;  4YII A;  3DTE A;  2E2H J;  2BXY A;  1JT6 A;  4UVC A;  4BU2 A;  4U7B A;  4JX4 A;  3E7Q A;  3F0C A;  5L3D A;  2A6H F;  3BJA A;  2YUS A;  2M0M A;  3ZMU A;  1BI1 A;  3TED A;  2VPL A;  2L9N A;  3E97 A;  2EWN A;  2ZXW H;  3KCC A;  3NPI A;  4Z6Y A;  1L3L A;  5JHF A;  4UB8 C;  3AG1 H;  4XLH A;  3VOD A;  1OR7 A;  3LSP A;  4PXI A;  2K9M A;  4KNY A;  2Z9O A;  2G7U A;  4CCM A;  3QAH A;  1FZP B;  1POG A;  1IN8 A;  4BBS J;  3TW7 A;  1HKT A;  4NC7 A;  3CJD A;  2MSY A;  2RNJ A;  3RQI A;  4AIH A;  4I0B A;  3QKX A;  3CME I;  1A31 A;  2CU7 A;  3WTT C;  2EZI A;  4XLC A;  4KMF A;  3VW2 A;  3A03 A;  2WB1 N;  3PNY A;  1BI3 A;  1T0F C;  4KIG A;  2Z1D A;  4E7H A;  3CJN A;  2OJE D;  3VW1 A;  5IPA A;  4IOC F;  1EKE A;  2DW4 A;  3H92 A;  3ESW B;  4ENM A;  2XB5 A;  4Y7N J;  4LGW A;  1PDN C;  1JGS A;  2MAB A;  2BE5 F;  2FMY A;  2VE9 A;  4UNO A;  2MH2 A;  5CYV A;  4C30 A;  3VVY A;  4AIK A;  3Q0U A;  2HTJ A;  4QPO A;  5C3E J;  3I59 B;  3H9J A;  2RQQ A;  1YYV A;  1FSE A;  3I4M J;  3M8J A;  2DBB A;  2BHZ A;  3EET A;  3HEF A;  3QYB A;  3VVX A;  3P9K A;  3BCA A;  3GZI A;  4BE1 A;  3LFU A;  3K4N A;  2XB0 X;  3HOS A;  1VQO I;  5IY5 H;  4C3J J;  4Q48 A;  3CCL I;  4LFU A;  3OV8 A;  4JP0 A;  3DF8 A;  3DPT A;  1BIB A;  5DTD A;  4V19 K;  1CGP A;  4BXF A;  1ETY A;  4L9V A;  2KT0 A;  2O8X A;  1G2H A;  2FX0 A;  3S14 J;  3ON4 A;  1Z67 A;  5F27 A;  1LDK B;  1ZG1 A;  2LFB A;  1TQI A;  4OMY A;  5A2Q Z;  2LG4 A;  5B66 C;  3KE2 A;  1IZ1 A;  1HW2 A;  3N97 A;  3R0A A;  1JHF A;  3ZMD A;  5FKO A;  1BW6 A;  2NVU B;  1FIP A;  1BR4 A;  3WE2 A;  2KHM A;  1UG2 A;  3Q5F A;  3FWE A;  4AD9 A;  3MQ0 A;  1DGW Y;  4ZZD A;  4RDU A;  2VC0 A;  1OCT C;  1R1V A;  2W82 A;  2AQF A;  4FET A;  3HKZ A;  4CGZ A;  5E1Z B;  4PJM A;  4RM3 A;  5FJ8 J;  2VC1 A;  3MD2 A;  1Z3Y A;  2OF7 A;  1L0O C;  4LG0 B;  4A3L J;  2BVL A;  1NK2 P;  1X58 A;  5EZG A;  2EA4 A;  1W5C C;  1HDP A;  1ONV A;  1SD7 A;  1W1W E;  4HNV A;  2GQQ A;  2E1M B;  2DMU A;  2KKO A;  4A93 J;  3BG7 A;  4KIC A;  2LRE A;  3OS2 A;  2QBY A;  5E3O A;  1FLI A;  4HSR A;  5IP6 A;  2R7T A;  2KL4 A;  4HDV A;  3G73 A;  4ON0 A;  5DCM B;  4BHB A;  1AKH B;  3W6K B;  2IAI A;  1Z7L A;  2EIK H;  2F5E A;  2N8G A;  4JK1 X;  4B44 A;  4FCY A;  3F8F A;  5IT9 Z;  3HUG B;  1OCO H;  1TWG J;  5D1R A;  1HQC A;  1BR1 A;  1O7F A;  2B0L A;  4A3F J;  5ILU A;  2QZ8 A;  5LRS A;  2FD5 A;  3M1C A;  1R5G A;  4ME9 A;  1WVR A;  4WXD A;  1P4A A;  2ECC A;  2E2I J;  2XRL A;  5H20 A;  3VB2 A;  3VOK A;  4LMY A;  2EV0 A;  3ZGK A;  1HKQ A;  3GBG A;  2V1X A;  3BG6 A;  3ISP A;  3LJL A;  1YG2 A;  2WAQ A;  5L3F A;  3K2A A;  5CPR B;  3BT9 A;  1ZRD A;  2W25 A;  2B3W A;  5H9T A;  3QBM A;  4M74 A;  5KAI C;  3GLL A;  1TWH J;  1IRF A;  2V4J C;  2XPW A;  3VVZ A;  3FMS A;  3JTH A;  3RZD J;  4IEJ A;  4BQQ A;  4OAY A;  3HE0 A;  1F43 A;  1JKR C;  2VKH A;  4AWX B;  1FOW A;  1K78 A;  3KZI C;  3KP7 A;  2FBI A;  2Y48 A;  4EQQ A;  4EM0 B;  1SMY F;  2ZME C;  3JR9 A;  3WE3 A;  1A35 A;  3MAJ A;  4P96 A;  2M1B A;  5GTI C;  4PUS A;  4TV7 A;  3KP6 A;  2Q24 A;  3GWZ A;  3AG3 H;  2DG8 A;  1T95 A;  3HOT A;  2ID6 A;  1SVL A;  2MBF A;  4RAY A;  1LVK A;  3ZCO A;  3RKW A;  4X0G A;  4L9J A;  4B8X A;  2ELH A;  3MKL A;  4F3Q A;  5AIP A;  5LEJ A;  3S1N J;  3HTJ A;  3O3K A;  4CCL A;  2DAO A;  1BM9 A;  1O3R A;  5FMP A;  3FIS A;  4AYB N;  2OTL I;  1SVM A;  4FTH A;  5M5X J;  1FYL A;  3NEU A;  4PSX A;  4A12 A;  2E1O A;  2XSD C;  2QSH X;  3HSE A;  4HF1 A;  3TOA A;  3LA3 A;  2B1E A;  3VYS B;  2RAS A;  2MYS A;  3I58 A;  1XB4 A;  4CH7 A;  1J9I A;  3S5R A;  4A6D A;  5ICC A;  3CJR B;  3JCU C;  4G94 A;  2COM A;  2JN6 A;  2OA4 A;  2UXO A;  2ELJ A;  3E1S A;  3OYK A;  2Y0M A;  4BHC A;  4LLN A;  1X1B A;  1I1S A;  1N25 A;  1XSX A;  1TT5 B;  2OU2 A;  3H5N A;  1H9G A;  2ZO4 A;  3P9I A;  3MZY A;  4L5I A;  3VFZ A;  2VI6 A;  3CES A;  1UI6 A;  2VKE A;  1X4P A;  3BR0 A;  2HKU A;  3FRQ A;  4RAZ A;  5HLI A;  1JJ8 C;  1U8B A;  1WZ2 A;  1YOV B;  4CCJ A;  1ZH5 A;  3P9T A;  4GFL A;  2XAH A;  1T0F A;  2ACJ A;  3ZQ7 A;  1XMX A;  3M4O J;  1E2X A;  1YQA A;  1R23 A;  2MH9 A;  2ZKZ A;  3LL7 A;  1XS9 A;  1XCB A;  1RUO A;  1I6H J;  1Q1V A;  2AXL A;  2EZK A;  1DDN A;  2NXN B;  2OER A;  3HC7 A;  4U87 A;  1JUS A;  1S7A A;  3FXU A;  4KT5 C;  3ROU A;  4YIF A;  1WCM J;  2D2W A;  2VJ4 A;  1DU6 A;  4NC8 A;  4XLP F;  2R92 J;  4EMS A;  2JPB A;  3SEQ A;  2GXB A;  1FOY A;  1FTZ A;  3CC2 I;  2DFF A;  3L2W A;  4O5V A;  4II2 A;  1X1C A;  4Q5S F;  4G7Z F;  5J1R A;  2OBP A;  5F1J A;  4U7D A;  2OZ6 A;  2DG7 A;  2ZCX A;  1P2F A;  2VBZ A;  2HYF A;  1O3Q A;  1Z6R A;  2HI3 A;  1SAU A;  1K6Y A;  1OJL A;  2R7Z J;  2A6E F;  2JUG A;  3OIO A;  3BJB A;  3BPX A;  3G1O A;  1FIA A;  1YS6 A;  5EGO B;  3ECH A;  1UCR A;  5FGL A;  2K02 A;  4HST A;  3IL2 A;  3ZN1 A;  2XGX A;  2KIS A;  2FBQ A;  3TDZ C;  4ESJ A;  2HQ5 A;  2WUI A;  1XMA A;  3B02 A;  4IHY A;  3S2D J;  2P5L C;  5LHH A;  2DN0 A;  1IC8 A;  4M9Z A;  3SYT A;  1O57 A;  4C2M J;  3NAU A;  1VQ7 I;  1N75 A;  1LNW A;  5LHI A;  3MKW B;  1KU9 A;  3OYE A;  1XGS A;  1ERD A;  1H0M A;  2JWT A;  3NRV A;  4XRF A;  1Y1W J;  5J40 A;  3FKJ A;  5CJ9 A;  4D5F A;  1M1E B;  2HQN A;  4XLF A;  1Z21 A;  1XDS A;  1IUF A;  2V9P A;  3OSG A;  4G6T B;  2KIQ A;  5E20 A;  2CW0 F;  3DEE A;  4DYR A;  3MZH A;  4HA8 A;  4M73 A;  3S1M J;  3JRE A;  1IN5 A;  2CO5 A;  3CF5 F;  2FNA A;  5K7Z A;  4P1W A;  4BY1 J;  3PSI A;  1FWZ A;  2VT3 A;  4FAS D;  3BLY A;  2EV5 A;  1F36 A;  2DOE A;  3V7S A;  3HOY J;  3ABL H;  2CG4 A;  2ZCW A;  3CUQ C;  3PFY A;  4XNF A;  3AQT A;  2L9R A;  2ZJR F;  2NVX J;  1BR2 A;  2K27 A;  2IXS A;  3J81 K;  1C0W A;  2KIU A;  1FNN A;  2BXZ A;  2VQL A;  3NS4 A;  1LFB A;  2VOD A;  2UXX A;  3A02 A;  3HTU A;  4I0A A;  3IKT A;  3HGG A;  4XON A;  2P4W A;  2XC7 A;  3KEQ A;  2QA4 I;  2R5Z B;  3CO7 C;  4XQF A;  2XDN A;  3RPU D;  2BOL A;  2O5R A;  1FBU A;  2WY8 Q;  2AS5 F;  3T6N A;  3FXQ A;  5J1Y A;  1Y0N A;  2DOF A;  3BP8 A;  2P5V A;  4FE7 A;  2R4G A;  1U5T B;  2LH9 A;  2HU9 A;  3T1B A;  4ZYE A;  2IU5 A;  3E5X A;  3JAM Z;  4RB3 C;  4NC6 A;  3BZC A;  2I8D A;  1R9T J;  5FRO A;  3F22 A;  2A3S A;  2ZNZ A;  2LD5 A;  3LA2 A;  3W2A A;  4IOA F;  5KCM A;  3RCO A;  3OOP A;  3SZG A;  1YW7 A;  2NVY J;  1F4K A;  1WI9 A;  1HDD C;  3JRC A;  4ZZL A;  3C7J A;  2EIM H;  5BNG A;  4KJZ A;  1UHW A;  3OYC A;  5E1W A;  1B8I B;  4XKV A;  5J8C A;  1FP1 D;  3S1R J;  2JT1 A;  4RGX A;  2DA3 A;  1ZGJ A;  4M3F A;  2XAG A;  5DD4 A;  2HOE A;  3Q0W A;  1X3Z B;  4Q47 A;  2DMQ A;  3G71 I;  1FYM A;  1EH7 A;  3C07 A;  1EA3 A;  1PJR A;  2MLG A;  4XSZ F;  3COA C;  1D1A A;  1OPC A;  3ZQL A;  2XPU A;  3RH2 A;  4HYE A;  3WG9 A;  4BNC A;  2DFH A;  2BHY A;  3RJP A;  2WAF A;  2XIG A;  1SC7 A;  4J00 A;  1FBS A;  3B81 A;  1MGT A;  2EB7 A;  2R7W A;  1D0Y A;  4H4K C;  3H0D A;  4BAY A;  3WGI A;  2JPC A;  2V9K A;  5ED4 A;  3E5Q A;  4XOR A;  4WX9 A;  2HWV A;  2CMP A;  3QOD A;  2V7F A;  1WHU A;  2JRM A;  2REK A;  3E6B A;  2XDV A;  3F8N A;  1VQN I;  5F6F A;  1VI0 A;  1JHH A;  3FF5 A;  4QLC U;  3PL8 A;  2X48 A;  3LA7 A;  3VSK A;  4EJU A;  2W53 A;  3KKD A;  2LOO A;  1TTY A;  3KP4 A;  4HEA 2;  3CMY A;  2L0K A;  2LY1 A;  3KYL A;  4PJJ A;  4KIF A;  1R49 A;  3QP6 A;  5JVT A;  1LQ1 A;  1T08 B;  3L00 A;  2CGP A;  4HZF A;  3OSF A;  2ZFW A;  5ICE A;  4C2M A;  5HAW A;  4EJO A;  2DT7 B;  1FYK A;  3GF2 A;  4HX7 A;  1VQL I;  5D4S A;  4GFB A;  4M6X A;  1QBJ A;  3SDB A;  3EDP A;  4XRS G;  2VLA A;  3JRB A;  3HRS A;  2OUM A;  3ABT A;  2PLY A;  3ZR8 X;  3JTG A;  3OYJ A;  1F5T A;  4AC0 A;  2GOM A;  3G6E I;  3K70 C;  1Y0U A;  2ZXH A;  4LLG F;  3I71 A;  3BTC A;  2KIM A;  1UEL B;  2ID3 A;  1ITY A;  2RC4 A;  2WAE A;  3H5A A;  3LQQ A;  3BPV A;  4D5C A;  4BDZ A;  5FFX A;  5FD6 A;  1XMK A;  2FNP A;  4A3C J;  3GTQ J;  3S3O A;  2CYY A;  3W6J B;  4II3 A;  3HZJ A;  2X6W A;  5M5W J;  3VYT B;  1FSH A;  3DBR B;  5LGN A;  2E7X A;  2EFQ A;  1WJB A;  4HOB A;  5J8F A;  2MA3 A;  1OCR H;  1MDM A;  1JI8 A;  1T38 A;  3TL4 X;  5BPD A;  2EFO A;  1EJ9 A;  2IS6 A;  2R5Y A;  1O3S A;  4AIJ A;  3AL0 B;  4IPA A;  1GDT A;  1UMQ A;  1EV7 A;  5C44 J;  3HTS B;  3M3Y J;  5TIS C;  3GTM J;  2M8E A;  1P7J A;  3G1L A;  2E1N A;  3SZP A;  2RRE A;  2XGE A;  4I09 A;  3GEZ A;  5AON A;  4XOT A;  3PPB A;  2O7T A;  5LEK A;  3J80 Z;  4X6A J;  1D3Y A;  2ZY9 A;  3BG9 A;  3HKZ N;  4JL3 A;  2DJN A;  3A0B C;  5F64 A;  5E1X A;  5D4R A;  1B9M A;  4XIC A;  2NP5 A;  5B5E C;  5DUK A;  3PJR A;  3WU1 B;  2VOO A;  2CUF A;  1EH8 A;  2L7Z A;  2LDU A;  5E17 F;  4ITV A;  3HIF A;  3WHC A;  2HQR A;  3NWS A;  5E3M A;  3O8H A;  1LEB A;  1Z91 A;  4E7L A;  1E0E A;  2XF5 A;  2NOJ B;  1WRJ A;  3F23 A;  4LB5 A;  2O6G E;  2VJI A;  1TW3 A;  2X9D A;  3OYD A;  3BCG A;  1YO5 C;  1R5H A;  2P7V B;  2PBI A;  3LAJ A;  1Y6I A;  1JGG A;  2IEK A;  5E3N A;  3DFG A;  1HW5 A;  4N9I A;  3COL A;  2HZT A;  4EGZ A;  2LC2 A;  3PQK A;  5CVR A;  2DJI A;  4XM3 A;  4IXA A;  2FSW A;  4M72 A;  2HDW A;  3HSR A;  3RDI A;  2HZD A;  4N0B A;  2QBY B;  5BS6 A;  1JKO C;  2PMZ A;  2WAQ N;  3S2W A;  1RR8 C;  1VQ4 I;  5HLH A;  3PUB A;  2XKP A;  3CF2 A;  3ZMZ A;  2M34 A;  4OIR F;  4WIB A;  3GTK J;  3FK6 A;  3R60 A;  1H9T A;  1W7P A;  4KIS A;  4GCL A;  3DPL C;  5ILS A;  1MMG A;  3LSK A;  3CCJ I;  1G4D A;  3C2H A;  4IRV A;  2MLK A;  3KPH A;  3S16 J;  3CDH A;  3TQN A;  2W1O A;  3EUA A;  3M8E A;  5LRR A;  4MTE A;  3V8L A;  2Y0S A;  1K6O A;  2HOS A;  4L18 B;  2IS2 A;  2XRN A;  5HDK A;  1I1G A;  1B6A A;  4MQV A;  2HGC A;  1MIJ A;  2Z16 A;  3SFZ A;  1QHH D;  4RGR A;  2LVS A;  3ZMV A;  1Z05 A;  1K79 A;  3QU6 A;  2E19 A;  4HF0 A;  1E3P A;  4DNC A;  5D5W B;  3OYL A;  3EUP A;  2H1K A;  5EZH A;  2DPU A;  3CQZ J;  2IA0 A;  3PO2 J;  4PGG A;  3QPL A;  5CKT A;  4I2O A;  5GTH C;  4PK4 A;  4ICH A;  1P92 A;  2HYG D;  2I10 A;  1FX7 A;  3OYF A;  4V2G A;  2JVG A;  2EIL H;  5FKK A;  3GME A;  1FC3 A;  1K78 B;  3BRU A;  3KKC A;  3M9A A;  4OU0 A;  4G6Q A;  3HPG A;  2LMD A;  1ACI A;  3DU5 A;  4ZYD A;  2WV0 A;  3V78 A;  4HLY A;  1W36 C;  1R4M B;  1YX3 A;  1IO2 A;  1RKT A;  5EEA A;  4B3A A;  3BG3 A;  2DQR A;  1I5Z A;  1OCP A;  1JTX A;  2UXH A;  2LTP A;  4WWC A;  2JSC A;  4DJA A;  2M4G A;  2NAZ A;  1STZ A;  2GA1 A;  3HM5 A;  4PSW A;  2K4B A;  1Y8R B;  3WG7 H;  1CF7 A;  3HG9 A;  1NG6 A;  1HSJ A;  5TGT A;  4ZYG A;  2PMH A;  3E6C C;  4BAC A;  1HCR A;  3NXC A;  1D5Y A;  3S1Q J;  2NS0 A;  4M3D A;  1XGM A;  1U0J A;  1O7L A;  1R22 A;  2MC3 A;  4IX7 A;  1G3T A;  1JJ6 C;  5M3F J;  1ZRF A;  3K0L A;  2DOD A;  4A3G J;  1EF4 A;  1QO0 D;  1XDU A;  3U2R A;  1IRX A;  2H94 A;  2VL8 A;  3QOP A;  1BJZ A;  3I4P A;  1YX5 A;  3LSR A;  1OLT A;  2L4A A;  4BE2 A;  3ZQI A;  2V57 A;  1BBY A;  4IRH A;  2DK8 A;  2UXI A;  2LRD A;  4YEJ A;  4O6J A;  4KWA A;  2A61 A;  1WH7 A;  5F08 A;  5IOZ A;  3WTV C;  2R7X A;  1FMW A;  1R5I D;  1NHA A;  5HOD A;  3U1K A;  4B43 A;  3T8T A;  5FRM A;  2L3D A;  3QWL A;  3GYH X;  4MO7 A;  2KFD A;  1JXS A;  2H27 A;  4BXU A;  2OD5 A;  4C3H J;  2Q0O A;  3IAS 2;  2BGC A;  2VXZ A;  2QOP A;  2X6X A;  5DEQ A;  4JQF A;  1OIS A;  3BDD A;  3HHG A;  2ZOZ A;  3H35 A;  4M3B A;  2EZL A;  2R3S A;  2UXN A;  4ESB A;  2M7A A;  2VXD A;  2B63 J;  4HNU A;  5BMZ A;  2G3B A;  5TRD A;  2LF8 A;  5GAE J;  4U0W A;  3KZ9 A;  3FX3 A;  1ZR4 A;  3DTI A;  1YTY A;  1KQ8 A;  3DPJ A;  4XL9 A;  1WGX A;  2QQA A;  1G3Y A;  1WJ5 A;  3RSN A;  1Y1V J;  1XGO A;  3GTP J;  2E1M C;  4HPQ A;  3EYY A;  1VF9 A;  2NVT J;  1SFE A;  2A07 F;  1GXQ A;  3ULQ B;  4BUP A;  2PZ9 A;  2W00 A;  3WHB A;  5CXI A;  2VQG A;  2V1U A;  2QSF X;  2W85 A;  4W97 A;  1UHS A;  1X1P A;  2KRC A;  2L54 A;  5HDG A;  4ZDL A;  3GTL J;  3NI7 A;  4OD5 A;  2RVC A;  2XF6 A;  3K69 A;  3WTW C;  3BTJ A;  1A6Q A;  1GLN A;  2FA5 A;  1DQU A;  4RGU A;  2UUZ A;  2AQE A;  3CDI A;  2OCE A;  3L2V A;  1I6X A;  2EFP A;  2ZJQ F;  4AM3 A;  4CCN A;  1P7I A;  2OAZ A;  2M30 A;  3ERE D;  4UV8 A;  3N05 A;  2V1N A;  4LD5 A;  3V6G A;  2DOA A;  4B47 A;  4IRI A;  4BJ6 C;  5DUI A;  1F9N A;  5L3G A;  4XN0 A;  1XGN A;  4I6Z A;  5H6Q A;  2VQH A;  4CZZ A;  3PIP F;  3QPT A;  3IV5 A;  4KN4 X;  1QHG A;  4CYC B;  1NH3 A;  3I53 A;  3GTG J;  3EPZ A;  4BQO A;  3FXK A;  4CXF A;  2EPF A;  4BBR J;  3WGG A;  1MSE C;  1D0Z A;  3Q9S A;  2JA8 J;  5D6E A;  2XKO A;  2QKO A;  2DA6 A;  1YE9 A;  3F3X A;  2JSP A;  2DK5 A;  2LYC A;  4R1H A;  3HOX J;  2XAF A;  2ZXI A;  2DYR H;  2BW3 A;  2CH0 A;  4RAF A;  3SHF A;  1Y39 A;  3Q9V A;  3DTK A;  4A2U A;  2MG4 A;  4AC6 A;  1R1T A;  3LMM A;  2HPM A;  4A3E J;  2RV8 A;  3SQN A;  5J47 A;  4XLN F;  3GZ6 A;  3H9G A;  2F4I A;  5FO5 A;  2BZT A;  3JRI A;  4RBO A;  5HBU A;  3E0J B;  1W4M A;  2KP6 A;  3HOU J;  1REP C;  1SD6 A;  1RET A;  1UHM A;  1F1Z A;  1WJA A;  1SGM A;  4HV6 A;  3V4G A;  2BY0 A;  2R7U A;  3KP5 A;  3KEY A;  5FRN A;  2JA6 J;  4JYK A;  1MSF C;  4IHS A;  1AU7 A;  2FJI 1;  5JFR A;  4OIQ F;  2Y2Z A;  1QA6 A;  2CWE A;  4XKC A;  3S32 A;  1SFU A;  2Y30 A;  4I7H A;  3CUO A;  2XSJ C;  2QUF A;  1J09 A;  4RB0 A;  4OIO F;  1ETV A;  2XGC A;  5K58 A;  2F4M B;  1S72 I;  1RR7 A;  5K5R A;  3I54 A;  4GRI A;  1JKP C;  4GYI A;  3ZOB A;  1T98 A;  3PFI A;  1IAW A;  4CGR A;  3FMR A;  3QU3 A;  3GW2 A;  1B72 B;  1XG1 A;  3A01 B;  4NEL A;  2IA1 A;  2BVM A;  5HS7 A;  1N78 A;  1ZG5 A;  3I4N J;  4LIU A;  1YRN A;  2BY3 A;  3RKX A;  1X1D A;  1ETK A;  1BA5 A;  4D1Q A;  2FXA A;  4HBL A;  3CZ6 A;  1R71 A;  2XPV A;  5HSZ A;  1LEA A;  2DCE A;  3ZXS A;  3IH2 A;  1USS A;  2CW7 A;  3VUQ A;  3R4K A;  2EQR A;  3HRM A;  1X19 A;  1GHC A;  5EEH A;  2CV1 A;  2O61 A;  3WTY C;  3H36 A;  3GTO J;  3E6M A;  4CUG A;  2JUC A;  3D1N I;  3HTH A;  4I01 A;  2ZFU A;  5FKL A;  1TWA J;  2GUH A;  4BH9 A;  3BQZ A;  1AA7 A;  2KLO A;  3CDL A;  4UUS B;  2DQL A;  2RHA A;  5FHP A;  3MFK A;  1GXP A;  5C4J J;  3LSJ A;  2G0E A;  4P5O A;  3FDY A;  4B1R A;  4IHV A;  3ON2 A;  4D7N A;  2WAD A;  2E7W A;  1FEX A;  4HKU A;  4NNJ A;  3I59 A;  1LE8 A;  1YLF A;  1RI7 A;  4BJ5 C;  5CLS A;  3F8M A;  1Y8Q B;  1UJ8 A;  4N9H A;  5HLT A;  4ZC3 A;  4NN1 A;  4KMU X;  3TKY A;  2XAS A;  3F6O A;  3CRJ A;  4DIQ A;  5FLV A;  3TOB A;  4M3G A;  2BV6 A;  2EV6 A;  4M71 A;  4UB6 C;  1S7O A;  4YFN F;  2K9L A;  4P55 A;  2DI3 A;  2IW5 A;  3KEO A;  3WTX C;  2W84 A;  4I98 B;  2JVH A;  4GCT A;  1IRZ A;  3K9T A;  4GCK A;  3E5U A;  2QQ8 A;  2OV7 A;  5KNL A;  1ETQ A;  3ZQG A;  2L2O A;  3N4M A;  2O0Y A;  5CVJ A;  3GFJ A;  2QF7 A;  3HRT A;  5HVQ C;  4O3M A;  2YSR A;  3K4J A;  1KQ9 A;  1D8J A;  1U2W A;  1O4X A;  4BDY A;  4LK1 F;  1ZGW A;  1WJE A;  1UAA A;  2R7S A;  4RB2 C;  1Z0X A;  2IP2 A;  4H0E A;  2F48 A;  2V9V A;  3TO6 A;  1A04 A;  1RZ4 A;  2L4M A;  3OY9 A;  4HLX A;  4ESF A;  2DU9 A;  5DYM A;  5K7F A;  2H8R A;  1QPI A;  2FEZ A;  1T39 A;  4A3K J;  2D5V A;  2FUG 2;  3RQ4 A;  3QPS A;  1TZL A;  4Y52 J;  4ENK A;  1R4N B;  4MFE A;  3IH4 A;  4BEH B;  3FM5 A;  2MD0 A;  2J5O A;  4D7M A;  2HVQ A;  1APL C;  2H8W A;  2HFH A;  1IRG A;  1W5S A;  4LJZ F;  2EH3 A;  4QTR A;  3HYI A;  4UVA A;  2XVC A;  1R6R A;  1MNM C;  1HLV A;  4EJT A;  1D1C A;  4CA0 A;  4L0Z B;  5DCM A;  1BC8 C;  2CW8 A;  4IHW A;  2DXI A;  4BYY A;  3ZQF A;  1DP3 A;  3AKZ A;  2NRA C;  2VAS A;  2A68 F;  1FBQ A;  1H8A C;  3H5R A;  3RIR A;  1PUE E;  3CCR I;  3BRO A;  1U5T C;  4B48 A;  4E6K G;  1NK3 P;  3CC4 I;  4B4C A;  3EGQ A;  3CTA A;  1IF1 A;  4LK0 F;  1MJ9 A;  2PEX A;  2UV1 A;  3DKW A;  2X6Y A;  3WTZ A;  2YX7 A;  2QVO A;  4BHP A;  4EEF G;  5D19 A;  1P6R A;  1ZYR F;  1WH5 A;  1MBK A;  2QSG X;  1X2N A;  5D5U B;  3VEP A;  1QZY A;  1J0R A;  4F7Z A;  3PO3 J;  1WSU A;  4F91 B;  2LBF B;  1J5Y A;  5DS9 A;  2VT2 A;  4XOP A;  3T8R A;  2W7N A;  4A3D J;  3HJE A;  4JX5 A;  4IQ4 A;  4NQW B;  4MGR A;  1B1B A;  3ERM A;  3HDD A;  2F2E A;  5GPC A;  2XV4 S;  3GFM A;  4E7I A;  2H6C A;  2PMZ N;  3DP7 A;  3KP3 A;  5DAJ A;  2BEO A;  2O03 A;  3HXL A;  2F5C A;  1XTA A;  2DA4 A;  5E8I A;  4BY7 J;  2JMW A;  3SDG A;  3IH3 A;  4DOZ A;  1G6N A;  2YS9 A;  5EG0 A;  3AG2 H;  1IN6 A;  2P6S A;  2Y0S N;  3KZZ A;  3VSL A;  2EFW A;  2ISY A;  1XSV A;  2YU9 J;  1TL8 A;  3J81 Z;  3BTI A;  1IDY A;  3A2K A;  2M4K A;  1X4O A;  4WF2 A;  2ZME A;  3M1E A;  2QKL B;  2RKH A;  4KA4 A;  5C4X J;  4FQG A;  3MKZ A;  2GAU A;  1W7P B;  4Y15 A;  2HXO A;  3L2Q A;  3G2B A;  4QSH A;  1MBH A;  3QYF A;  2DDB A;  1WWX A;  5HLG A;  1HW1 A;  4MLO A;  1WPK A;  2CUZ A;  1XC5 A;  5J4V A;  2VE8 A;  4IHX A;  1SEU A;  2Z3Y A;  2LP0 A;  3BZK A;  2KIF A;  4D0P A;  1KQ0 A;  3GUD A;  3F72 A;  2CFX A;  3AFH A;  9ANT A;  2F6C A;  5FGM A;  2E35 A;  2M87 A;  3CCM I;  1K61 A;  3JSJ A;  4DGW B;  2QGU A;  3HTA A;  3GEU A;  1FP2 A;  3QOE A;  3L2U A;  3RKQ A;  4IF4 A;  4HF2 A;  4UV9 A;  2LKS A;  3HB9 A;  1OR7 C;  3IWF A;  3UR3 C;  3KFW X;  3V8K A;  4A5M A;  1I3A A;  3A0H C;  1ZEL A;  4K2E A;  1XX5 A;  4U88 A;  2CRG A;  1XD7 A;  3K1M A;  5F0C A;  3QRF F;  1ON1 A;  1S8N A;  3OR2 C;  4NDL A;  4PFO A;  5DM7 F;  3L9F A;  5B1A H;  4ENN A;  2P81 A;  5DDG A;  3G4S I;  5C4Y A;  1RIO H;  4W1U A;  2MD5 A;  1D8K A;  3BR5 A;  2TCT A;  3I9V 2;  2R7V A;  2YVX A;  1WJC A;  2D1V A;  4BGD A;  2VPR A;  2Q1Z B;  4OWR B;  2Y9Z A;  2ME0 A;  3V7R A;  2ISZ A;  1QRY A;  5BPI A;  3H9Q A;  1TT0 A;  2XUB A;  5ICF A;  2IJL A;  2RN7 A;  4ETS A;  1ZTR A;  1X3U A;  4BQN A;  4UHT A;  1CF7 B;  3S2H J;  2CJJ A;  1IV6 A;  4G7H F;  3H1C A;  4PZJ A;  5KVR A;  3GLX A;  1R58 A;  4UXN A;  1UB9 A;  3DQV C;  2F5V A;  3FIW A;  1ZRC A;  1BJA A;  2VN2 A;  4IL6 C;  1A5J A;  1S5L C;  2GZW A;  3ZQC A;  1R36 A;  4GO1 A;  3ANP A;  2G7L A;  3E6D A; 
#chains in the Genus database with same CATH homology
 1TWH J;  3VVZ A;  2XPW A;  1BW5 A;  1OCP A;  1JTX A;  4S0H B;  2LTP A;  3RZD J;  4IEJ A;  2KDZ A;  2M9H A;  2UXH A;  3HE0 A;  1IDZ A;  4CYC A;  1F43 A;  2NP3 A;  5M3M J;  1JKR C;  3HM5 A;  2R0Q C;  1UI5 A;  1MBG A;  5EF6 A;  3JR9 A;  2L7M P;  3KNW A;  1HCR A;  3NXC A;  1D5Y A;  1GVD A;  2HOA A;  3S1Q J;  4M3D A;  1GV2 A;  2RAE A;  2Q24 A;  3Q0V A;  4DYQ A;  1GT0 C;  2DG8 A;  1BL0 A;  1JJ6 C;  1T56 A;  5M3F J;  4MIM A;  2ID6 A;  4A3G J;  4I76 A;  3JRF A;  1EF4 A;  3HTI A;  1TWF J;  1TC3 C;  1BJZ A;  3MKL A;  2HDD A;  3LSR A;  2OPT A;  2XGD A;  2VUM J;  2GBY A;  3S1N J;  3HTJ A;  3B6C A;  3DEW A;  3B6A A;  5IYC J;  5FMP A;  3FIS A;  3VIB A;  3ZQI A;  2V57 A;  4AYB N;  4FTH A;  5M5X J;  2UXI A;  1H89 C;  2E1O A;  2XSD C;  4YZE A;  3BR1 A;  4KWA A;  1WH7 A;  1JUM A;  5F08 A;  5IOZ A;  1JKQ C;  4FE4 A;  4JNN A;  3G1M A;  2NVQ J;  5HOD A;  1ETX A;  5JLW A;  4MO7 A;  3MNL A;  2RAS A;  2QCO A;  4MXM A;  2LK2 A;  4XK4 A;  4C3H J;  3BHQ A;  3S5R A;  2R93 J;  2QOP A;  5F0F A;  2ZOZ A;  1WI3 A;  5FLM J;  2JN6 A;  4M3B A;  5FKM A;  2EZL A;  2R5Z A;  1HF0 A;  2UXO A;  2B63 J;  3G7R A;  3BR6 A;  1VND A;  2G3B A;  4GFK A;  4M6V A;  1B72 A;  2DA1 A;  3LHQ A;  4M3E A;  3A01 A;  3KZ9 A;  1HOM A;  4DW6 A;  1ZR4 A;  2CUE A;  2VI6 A;  3RZO J;  1UI6 A;  3DPJ A;  2VKE A;  2WGB A;  4ACI A;  3BR0 A;  4XID A;  1WGX A;  2HKU A;  3FRQ A;  2YVH A;  1Y1V J;  1JJ8 C;  3GTP J;  3VOX A;  1U8B A;  1W0T A;  4GFL A;  1VF9 A;  3P9T A;  2COB A;  2VKV A;  5IOY A;  2Y9Y A;  2NVT J;  1U78 A;  5JLX A;  3M4O J;  2O7O A;  1XS9 A;  2PZ9 A;  3WHB A;  5CXI A;  1ETO A;  3GTJ J;  3RD3 A;  1I6H J;  1Q1V A;  2EZK A;  2OER A;  4W97 A;  1UHS A;  2O8K A;  1JUS A;  1U9O A;  3UKG A;  3GTL J;  4A69 C;  3NI7 A;  1SAN A;  1WCM J;  2JJ7 A;  2FQ4 A;  3AQT A;  3JRD A;  5HAW A;  1T33 A;  1DU6 A;  4UDS A;  2R92 J;  3BTJ A;  2MGQ A;  4UUS A;  2AHQ A;  5IP9 J;  1FTZ A;  4X1E A;  1P7I A;  1MH4 A;  5J1R A;  2OI8 A;  4JX6 A;  2DG7 A;  5F1J A;  2ZCX A;  3V6G A;  3LOC A;  2HI3 A;  1OJL A;  2R7Z J;  2QTQ A;  3OIO A;  2FJ1 A;  3BJB A;  4I6Z A;  1MH3 A;  3G1O A;  4AF5 A;  1FIA A;  5D18 A;  2NOG A;  5EGO B;  3IV5 A;  2X6O A;  3GTG J;  4CYC B;  5FGL A;  3NAR A;  4XRS A;  1JTY A;  1X2M A;  3F1B A;  2EZH A;  1MBJ A;  2LY9 A;  2FBQ A;  2DA2 A;  4BBR J;  2HQ5 A;  2WV1 A;  2WUI A;  1MSE C;  2JA8 J;  1I50 J;  3S17 J;  2QKO A;  3VPR A;  4IHY A;  2ME6 A;  3S2D J;  4JKZ A;  2DA6 A;  1PUF B;  2DN0 A;  1FJL A;  1IC8 A;  1OFC X;  2L7F P;  4C2M J;  3NAU A;  3HOX J;  2MW8 A;  1ZKG A;  2JWT A;  3BQY A;  3L1P A;  3JRA A;  3O60 A;  1Y1W J;  2MG4 A;  4D5F A;  4AC6 A;  1S7E A;  4DZP A;  1A6I A;  4A3E J;  1IUF A;  3OSG A;  3CCY A;  5EGO A;  3JRI A;  4DYR A;  4RBO A;  3NRG A;  3S1M J;  3HOV J;  3OOU A;  1ZQ3 P;  3HOU J;  3JRE A;  5CXG A;  1RET A;  5K7Z A;  1PUF A;  4BY1 J;  1SGM A;  2DA5 A;  5EFY A;  2LKX A;  2E2J J;  3QQA A;  2JA6 J;  4JYK A;  1MSF C;  1AU7 A;  2HYT A;  1F36 A;  3PM1 A;  3HOY J;  2Y2Z A;  1YRN B;  2Y30 A;  3JRH A;  2L9R A;  2UXU A;  1JT0 A;  2NVX J;  5GPA A;  1IGN A;  3BTL A;  1IG7 A;  1ETV A;  2XGC A;  5K58 A;  2PBX A;  1LFB A;  1RR7 A;  5E3L A;  3A02 A;  3HOW J;  3HGG A;  1JKP C;  1IJW C;  2R5Z B;  2XDN A;  2AO9 A;  3ZOB A;  2DTZ A;  3O8G A;  4CGR A;  3SFI A;  1B72 B;  1XG1 A;  3A01 B;  4NEL A;  3T6N A;  5F04 A;  3HBL A;  1ZR2 A;  4C3I J;  5J1Y A;  3I4N J;  4FE7 A;  1YRN A;  2JA5 J;  1VFC A;  2IU5 A;  1ETK A;  1BA5 A;  3FKI J;  3BNI A;  4AUX A;  1ETW A;  2F07 A;  2K9N A;  2XPV A;  1R9T J;  4LOC A;  5HSZ A;  1SFO J;  2LLK A;  2LD5 A;  3IH2 A;  2D6Y A;  1LE8 B;  3VUQ A;  1I3Q J;  2EQR A;  2M2E A;  1LFU P;  3E7L A;  2NVY J;  5F0H A;  3GTO J;  2ZB9 A;  3D1N I;  3HTH A;  1HDD C;  3JRC A;  3HGY A;  5FKL A;  1TWA J;  2GUH A;  2QWT A;  3BQZ A;  3CDL A;  5BNG A;  1RES A;  4UUS B;  1AHD P;  1B8I B;  2RHA A;  4V2F A;  3S1R J;  5FHP A;  3TW6 A;  2ZOY A;  5C4J J;  2DA3 A;  3LSJ A;  2G0E A;  4M3F A;  4B1R A;  1GV5 A;  4IHV A;  4D7N A;  3ON2 A;  4UUT A;  3DCF A;  3Q0W A;  1TWC J;  1FEX A;  4DZJ A;  4HKU A;  2DMQ A;  1LE8 A;  1CQT A;  3BR3 A;  4ABZ A;  3C07 A;  4G12 A;  4L5E A;  4A3M J;  1FTT A;  2JK3 A;  3ZQL A;  2XPU A;  3RH2 A;  2DMT A;  4NN1 A;  3CRJ A;  3BR2 A;  2TRT A;  5FLV A;  1B8I A;  4M3G A;  3B81 A;  2NS8 A;  3CWR A;  4BXX J;  4A3I J;  5J3L A;  4GCT A;  2GEN A;  5IP7 J;  1IRZ A;  4GCK A;  4QIW N;  1H88 C;  2REK A;  1MBE A;  1ETQ A;  3ZQG A;  2YVE A;  1VI0 A;  2QF7 A;  1O4X A;  1ZGW A;  3HOZ J;  2GFN A;  2X48 A;  1Z0X A;  3BG5 A;  1K83 J;  2W53 A;  3KKD A;  3MVP A;  4J19 A;  2GLO A;  3CMY A;  5K7F A;  2H8R A;  2L0K A;  1QVT A;  1QPI A;  1Z77 A;  5AQC A;  1RKW A;  4A3K J;  2D5V A;  3S15 J;  2M8G X;  3QPS A;  4Y52 J;  3NNR A;  2ZCN A;  4MFE A;  2HOT A;  3OSF A;  2E2H J;  1JT6 A;  3IH4 A;  3VP5 A;  1QVU A;  4JX4 A;  2K9Q A;  3E7Q A;  3AQS A;  3F0C A;  4D7M A;  1APL C;  5EYR A;  2YUS A;  4QTR A;  2EH3 A;  3TED A;  3JRG A;  2M0C A;  4GFB A;  1MNM C;  2NS7 A;  4XRS G;  1HLV A;  4A3B J;  3FK7 A;  3NPI A;  3JRB A;  3W6V A;  4PXI A;  3LSP A;  4IHW A;  3H0G J;  3VW0 A;  2ELK A;  4AC0 A;  3LWJ A;  3HIM A;  3ZQF A;  2O9L A;  2HXI A;  3BTC A;  1POG A;  4BBS J;  2ID3 A;  1ITY A;  3TW7 A;  2GM4 A;  3CJD A;  2MSY A;  4D5C A;  3RQI A;  1H8A C;  3QKX A;  2CU7 A;  5GP9 A;  1NK3 P;  4A3C J;  3GTQ J;  3EGQ A;  2EZI A;  4B4C A;  3VW2 A;  3IUV A;  3A03 A;  2WB1 N;  5K7H A;  4MFD A;  4FIS A;  3LSG A;  5M5W J;  4EEF G;  5D19 A;  2HYJ A;  5EG0 B;  3PAS A;  3VW1 A;  1WH5 A;  5IPA A;  1MBK A;  2R5Y A;  1X2N A;  3PO3 J;  2XB5 A;  1GDT A;  4Y7N J;  1UMQ A;  3H3V K;  5DS9 A;  5C44 J;  3M3Y J;  3GTM J;  1P7J A;  3G1L A;  3K7A J;  4A3D J;  4JX5 A;  3HDD A;  2XGE A;  5GPC A;  3PPB A;  2QIB A;  2O7T A;  3ANG A;  2PMZ N;  3VVY A;  5DAJ A;  3Q0U A;  4X6A J;  4DYC A;  1E3O C;  5C3E J;  1NTC A;  3BG9 A;  2DA4 A;  3HKZ N;  3I4M J;  2DJN A;  4JL3 A;  4BY7 J;  2JMW A;  3SDG A;  3IH3 A;  4XIC A;  2NP5 A;  2K9S A;  2YS9 A;  5EG0 A;  2CUF A;  2L7Z A;  3HEF A;  3GZI A;  3VVX A;  3WHC A;  2Y0S N;  3Q3S A;  2XB0 X;  2K40 A;  5HBU A;  5E3M A;  2W48 A;  2YU9 J;  4C3J J;  3O8H A;  4JP0 A;  3TP0 A;  3BTI A;  1IDY A;  2DA7 A;  5DTD A;  2X9D A;  1MBF A;  5CW8 A;  2DMP A;  1ZK8 A;  3BCG A;  1U9N A;  1ETY A;  5J1U A;  5C4X J;  5IYD J;  2KT0 A;  1JGG A;  3SJM A;  1G2H A;  2FX0 A;  2CQQ A;  2IEK A;  3S14 J;  2HXO A;  4QSH A;  1MBH A;  5E3N A;  3ON4 A;  3COL A;  5F27 A;  2LFB A;  2G7G A;  2CQX A;  2LR8 A;  4MLO A;  1WPK A;  1XC5 A;  1RPW A;  2ECB A;  4IHX A;  3ZQH A;  1DU0 A;  5FKO A;  1BW6 A;  2LP0 A;  4A3J J;  1FIP A;  2JA7 J;  1ENH A;  3MN2 A;  1JKO C;  1UG2 A;  9ANT A;  2IBD A;  2WAQ N;  1K61 A;  3JSJ A;  4RDU A;  3HTA A;  5IYB J;  3GEU A;  3RKQ A;  1OCT C;  2NX4 A;  2M34 A;  3GTK J;  3HB9 A;  3FK6 A;  5FJ8 J;  4GCL A;  2OF7 A;  4A3L J;  3S16 J;  1NK2 P;  5FKN A;  2HOS A;  2CRG A;  1X58 A;  5EZG A;  5EDN A;  1HDP A;  5F0C A;  2EBI A;  3TP3 A;  4MK6 A;  4HNV A;  4A93 J;  2DMU A;  2DMN A;  4NDL A;  4L62 A;  2P81 A;  2LVS A;  5E3O A;  5C4Y A;  5IP6 A;  1JUP A;  3C2B A;  4W1U A;  2E19 A;  3BR5 A;  2TCT A;  1AKH B;  3EUP A;  2IAI A;  2H1K A;  5EZH A;  2N8G A;  3G56 A;  3CQZ J;  4FCY A;  3PO2 J;  3QPL A;  1TWG J;  5D1R A;  1ORK A;  2VPR A;  2ZCM A;  4A3F J;  5M5Y J;  2Y9Z A;  2FD5 A;  2ME0 A;  1W0U A;  4ICH A;  2I10 A;  1QRY A;  4XRM A;  4ME9 A;  2ECC A;  4V2G A;  2E2I J;  2XRL A;  5FKK A;  3VOK A;  2G7S A;  1ZTR A;  3S2H J;  1GUU A;  3BRU A;  3GBG A;  2CJJ A;  1IV6 A;  3KKC A;  3LJL A;  3V78 A;  2UXP A;  3K2A A;  3BT9 A;  3LNQ A;  1RKT A;  3FIW A;  5EEA A;  1AKH A;  2R5Y B;  1A5J A;  4B3A A;  3ZQC A;  3QBM A;  5H9T A;  3ANP A;  2G7L A;  3BG3 A;  2Y31 A;  4BKX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...