1JUMA

Crystal structure of the multidrug binding transcriptional repressor qacr bound to the natural drug berberine
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
186
structure length
186
Chain Sequence
NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKKEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOTHETICAL TRANSCRIPTIONAL REGULATOR IN QACA 5'REGION
publication title Structural mechanisms of QacR induction and multidrug recognition.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription
total genus 78
structure length 186
sequence length 186
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2001-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1jumA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 1jumA02
2NVTJ 2YVHA 4M3EA 3BR6A 1FTTA 4IEJA 2NOGA 4A69C 1ZR2A 1TWCJ 4YZEA 3G1MA 2E1OA 3NAUA 2ME0A 4BBRJ 1MBHA 2RAEA 3GTJJ 3BQYA 3K7AJ 5D1RA 1YRNB 2EZIA 1NTCA 2Y9YA 5FKOA 3FKIJ 1JTXA 5FHPA 1HDPA 4DYQA 1U78A 4C3IJ 2XDNA 1GV5A 2M2EA 3TW7A 1RR7A 1BL0A 2QTQA 3NPIA 2DMPA 3FK6A 5IPAA 1MBGA 1ZTRA 2L7FP 4ME9A 5IOYA 3Q0UA 1ZR4A 1S7EA 1JKPC 5IYBJ 4HNVA 2E2HJ 2Y30A 3B81A 2JMWA 3IH2A 4B1RA 1ZKGA 3BTJA 4AUXA 1AU7A 1IDZA 2W53A 4ICHA 3S2HJ 2GLOA 5E3LA 2MW8A 2Y2ZA 4DW6A 2CU7A 4GCKA 3GTQJ 3HOWJ 3VVYA 5IYDJ 2G7LA 4IHYA 4HKUA 4PXIA 3MNLA 2HQ5A 3WHCA 3HOXJ 2HOTA 1WGXA 2HYTA 5FMPA 5BNGA 5EEAA 1WPKA 2L7ZA 1SGMA 2PBXA 2FBQA 3ZOBA 1X2MA 3QQAA 3BG5A 4L62A 1RKWA 2WUIA 3KKCA 5DAJA 5C4JJ 2CRGA 1IV6A 2H8RA 5M5WJ 4IHXA 5FKKA 3ZQIA 2LLKA 4DZJA 2VUMJ 1Y1VJ 4MIMA 3LSPA 2LP0A 3HGGA 4A3DJ 1JUPA 2ELKA 1EF4A 3HEFA 3COLA 1LFBA 5D19A 2RASA 2LR8A 4D7NA 3ZQHA 2HI3A 5FGLA 3BR0A 1UMQA 4JX5A 5C4YA 1MSFC 2DA2A 2IAIA 1IDYA 2AO9A 5HODA 3JRCA 4GCTA 3V78A 2DMTA 2LY9A 3JRIA 1ETVA 2QWTA 1IJWC 4RDUA 3GTOJ 1P7JA 1U9OA 1UHSA 3ZQCA 3VW1A 2PMZN 3JRFA 3F0CA 3HBLA 3AQTA 4DZPA 1MBEA 4W97A 3KZ9A 3E7LA 2R0QC 3BR3A 1FTZA 3HOVJ 1FJLA 1B72B 4X6AJ 3D1NI 3BQZA 1F36A 4IHWA 3GBGA 3JRGA 2G7GA 2ID6A 1ETXA 2X9DA 5EZHA 3BHQA 3ON4A 4XRSG 5GPAA 2D6YA 4UUSB 4I76A 2R92J 3O8HA 2HOSA 1JGGA 1AHDP 1MNMC 2B63J 3E7QA 2CUFA 1B72A 2IU5A 2COBA 1QVUA 5GP9A 2EH3A 2JA6J 2ZOYA 3LJLA 1K61A 3RZOJ 2Q24A 3MKLA 3FK7A 4MXMA 1AKHB 4NN1A 2EZLA 2XGDA 1BJZA 1W0UA 2NVXJ 1SANA 4UUSA 2ME6A 1ITYA 3S1NJ 1UI5A 3VOKA 2LK2A 1TC3C 4W1UA 1MH3A 2OERA 5HBUA 4AYBN 1MBFA 2ZB9A 2YS9A 2GM4A 5J1YA 1AKHA 4RBOA 2G3BA 1T56A 3ANPA 3QPSA 3S14J 5EG0B 3HTHA 5CW8A 2R5YB 3S1MJ 1A5JA 2FJ1A 5J1RA 5JLWA 2UXUA 3QBMA 3CJDA 2F07A 3VUQA 1E3OC 1QVTA 3ZQFA 5DS9A 5EYRA 3S1RJ 2UXPA 2W48A 4CYCB 4FCYA 3TP0A 2K9NA 3TW6A 4GFLA 1JT0A 5FLMJ 3PO2J 3BJBA 1BA5A 1WCMJ 2M0CA 5F0CA 5EG0A 2D5VA 2XRLA 4M6VA 1ETQA 2R5YA 2LVSA 3PO3J 3G56A 1TWFJ 4G12A 5C4XJ 4CYCA 1ETOA 2M9HA 4A3IJ 3MN2A 3A01B 1QPIA 3MVPA 5EFYA 3RKQA 1ZGWA 1ZQ3P 3G7RA 2E2JJ 2XB5A 4L5EA 1YRNA 2XPVA 3HB9A 2DA7A 3I4MJ 5EGOB 3LWJA 2NVYJ 2XB0X 4BBSJ 4FE7A 4QSHA 3OOUA 4A3CJ 1VI0A 3M3YJ 1OCPA 3CWRA 4AF5A 3A01A 4FISA 2ZCNA 3H0GJ 3RQIA 2H1KA 4GFBA 4IHVA 4JX4A 2XGCA 3VW0A 5EGOA 3HKZN 1LFUP 2R5ZB 3ZQGA 1DU0A 3BT9A 2WV1A 3G1OA 4JX6A 4KWAA 4AC0A 5M3MJ 2LKXA 1FIAA 1WH5A 3VIBA 1MSEC 3HOUJ 3JR9A 3BG9A 5F0FA 4A3BJ 5FKNA 2I10A 1ZK8A 1MH4A 1JUSA 2R5ZA 5EDNA 3CRJA 2REKA 2OPTA 3IH3A 2L9RA 2VKVA 3S15J 3P9TA 3BR2A 5IP7J 4DYCA 1IG7A 5M5YJ 3JRBA 2Y0SN 3ON2A 2X6OA 4AC6A 3BTIA 1ETKA 2L0KA 2JN6A 3K2AA 2E19A 3CMYA 5FLVA 3S1QJ 1JKOC 3A02A 3HDDA 4BY7J 3CCYA 4UUTA 5F08A 3DCFA 2HKUA 4JP0A 1APLC 2VPRA 2AHQA 3GTGJ 1OJLA 1X2NA 5F27A 2N8GA 3GTMJ 3O60A 3IUVA 3OIOA 1W0TA 1RETA 3JRDA 3RH2A 3HE0A 1T33A 2DA5A 4UDSA 3FRQA 1IUFA 3OSGA 3GTKJ 3BR5A 4A3MJ 3ZQLA 1H89C 2G7SA 2KDZA 3EGQA 1H88C 1TWHJ 3G1LA 2FD5A 3TEDA 2Y9ZA 1IGNA 1FEXA 3LHQA 3SDGA 3F1BA 3VVXA 3QKXA 2GBYA 3OSFA 2R93J 3S5RA 2EZKA 3SJMA 5K7HA 1K83J 2UXHA 1UG2A 1GVDA 1GV2A 3LOCA 3BCGA 4BY1J 1O4XA 3BNIA 3VPRA 4M3FA 2MGQA 1GUUA 2FX0A 1MBJA 2LFBA 2WAQN 4GFKA 5FKMA 3B6AA 2XGEA 3Q3SA 2UXIA 5M5XJ 2JJ7A 3JRHA 1PUFB 2GFNA 1GDTA 1ENHA 5F0HA 1HCRA 1Y1WJ 3CDLA 2O9LA 3JSJA 4JL3A 1I50J 2R7ZJ 3QPLA 3JRAA 5FKLA 5J3LA 2O8KA 2NX4A 2DA1A 2LTPA 5HSZA 1JTYA 3HGYA 4QTRA 2DMNA 4I6ZA 3NARA 2OI8A 2K9SA 1PUFA 3PASA 4C3JJ 2DJNA 5K7ZA 2EZHA 1ETYA 2HYJA 1NK2P 1MBKA 4QIWN 4CGRA 2IEKA 1HLVA 3Q0VA 2HDDA 1JKRC 1TWAJ 3S16J 5K58A 2DA3A 4MFDA 4D5FA 1XC5A 2GUHA 1VFCA 3HTJA 5M3FJ 3LSRA 3I4NJ 3PPBA 3ANGA 2DMUA 3LSGA 3NXCA 1TWGJ 5IP9J 3O8GA 2CUEA 2O7OA 4C2MJ 3DEWA 5IP6A 3HOYJ 3S2DJ 1P7IA 5AQCA 1ORKA 3FISA 2G0EA 2MSYA 2JA8J 3TP3A 5DTDA 1UI6A 1XS9A 3GTPJ 2JWTA 4XICA 1XG1A 3CQZJ 2NS8A 1R9TJ 2DMQA 2EBIA 4A3KJ 1D5YA 3IH4A 2UXOA 1WH7A 2YUSA 3VVZA 3GTLJ 4A93J 4MK6A 2V57A 4D7MA 5C3EJ 5F1JA 2DG7A 3VP5A 3AQSA 3HM5A 4XRSA 2ZCXA 2KT0A 1A6IA 3LSJA 1Q1VA 4Y52J 3T6NA 2CJJA 1Z77A 5F04A 1VF9A 5JLXA 5E3MA 5HAWA 2E2IJ 2HOAA 2M8GX 3GZIA 2TCTA 4C3HJ 1Z0XA 4JNNA 4A3GJ 1I3QJ 4A3EJ 1QRYA 1HOMA 3DPJA 3IV5A 3NI7A 4FTHA 3LNQA 4M3GA 3BTCA 4V2GA 2VI6A 2DN0A 1OFCX 2HXIA 2RHAA 3HIMA 1CQTA 2QKOA 2JK3A 2VKEA 5GPCA 3JREA 4ACIA 3UKGA 1H8AC 3RD3A 1BW6A 3HOZJ 3S17J 1B8IB 4MFEA 4NDLA 4Y7NJ 2PZ9A 2ECCA 4M3DA 2MG4A 3VOXA 3NNRA 2DA6A 3HTAA 1LE8B 2X48A 5D18A 1U9NA 3GEUA 1B8IA 3KNWA 1RESA 1VNDA 1FIPA 4GCLA 3EUPA 1IRZA 3BG3A 2OF7A 1ETWA 4EEFG 3VW2A 2ID3A 2IBDA 1JJ8C 2CQXA 4MO7A 1LE8A 2YVEA 2FQ4A 2NVQJ 2K40A 2HXOA 4MLOA 3SFIA 4A3LJ 5CXGA 3PM1A 3WHBA 3B6CA 4LOCA 4XK4A 2WB1N 1WI3A 4JYKA 5FJ8J 2XSDC 5K7FA 2QOPA 2QF7A 4BKXA 1POGA 1IC8A 5IOZA 4M3BA 2O7TA 3HTIA 2Y31A 1I6HJ 4B3AA 1RPWA 2M34A 4S0HB 3L1PA 4JKZA 4BXXJ 3C2BA 1OCTC 5H9TA 2WGBA 2YU9J 2JA7J 2XPUA 2NP3A 2JA5J 3A03A 5EZGA 2DTZA 3Q0WA 4X1EA 2ECBA 4XIDA 2P81A 3BRUA 5E3NA 2L7MP 3BR1A 5E3OA 1NK3P 4A3FJ 2DA4A 4FE4A 5J1UA 4B4CA 2LD5A 2EQRA 2XPWA 4D5CA 4XRMA 3V6GA 2QIBA 4DYRA 1GT0C 4ABZA 1HDDC 2ZOZA 5IYCJ 1SFOJ 2DG8A 2NP5A 2TRTA 3W6VA 3H3VK 1G2HA 1JT6A 2CQQA 1X58A 3RZDJ 3KKDA 2GENA 4A3JJ 2K9QA 1BW5A 2QCOA 3C07A 3FIWA 1RKTA 1HF0A 9ANTA 4J19A 2NS7A 3M4OJ 1JJ6C 1F43A 1U8BA 4NELA 5EF6A 5C44J 1JUMA 1DU6A 2ZCMA 3NRGA 5CXIA 4V2FA 3BTLA 1JKQC
chains in the Genus database with same CATH superfamily
2W57A 3ABKH 4M3EA 1RC9A 3HSRA 3GWZA 1V4RA 5CPRB 2X4HA 2HKXA 4L18B 4WF2A 1N75A 1S7OA 1Y8QB 3VYUB 2P0WA 4KMUX 3PQJA 3W2VA 4NBQA 1XX5A 1WJ5A 1TZLA 2V4JC 1F4KA 2IJLA 4I09A 3TDUC 5H6RA 3WU2C 3GTJJ 1V54H 3K7AJ 2YSRA 1FNNA 5FKOA 4PFPA 5DUKA 3FXJA 1KQ9A 4IRIA 2XDNA 2EIKH 1GV5A 2FOKA 4PJ0C 1RR7A 1XSXA 4UVCA 3OYIA 3NPIA 2XF7A 3FK6A 1MBGA 3K70C 2ZJQF 2HKOA 1ZR4A 2X6WA 2E1NA 1BR2A 2DT6A 2AS5F 4HNVA 1K4SA 3I59A 1GHCA 1XDUA 4RAZA 2FNAA 1XGMA 5CVUA 3B81A 2JMWA 3IH2A 4HG2A 2B0LA 3CUQC 2CV2A 1ZKGA 2QZ8A 2LMDA 4PGHA 1L0OC 2GLOA 4NUBA 2VBZA 2MW8A 3U1KA 1OR7C 1TT0A 2L4MA 3HL2A 3GTQJ 3VVYA 2NVUB 4IHYA 3T8RA 2F5EA 2R7SA 3L00A 5FFZA 2DAOA 3CF2A 3OOPA 1VQKI 2W4SA 1ZRFA 2DFHA 2B7EA 1YS6A 5H20A 1VTNC 1SGMA 1I5ZA 2PBXA 2QBYA 1UJ8A 2AQFA 1VQ9I 1RKWA 4PFOA 1KU9A 2H94A 3E6MA 2WUIA 5DAJA 3OL3A 3DBRB 1MD0A 2H8RA 5FKKA 1Z21A 3U9GA 2VUMJ 2KZGA 2KRHA 4A3DJ 1X4PA 2MH2A 1UCRA 2O5RA 2X51A 2Z2SB 3W3CA 2V7FA 2VLAA 1KU2A 3C7JA 4JX5A 2DA2A 1IAWA 2XC7A 2M4KA 3CCVI 1KU3A 3ERMA 3IAS2 4GCTA 2V1XA 1D1CA 4OAYA 4E4HA 4RLFA 3V8JA 1ETVA 4KUMA 4BDYA 4NQWB 1BI0A 3NQOA 3ZQCA 3FXLA 1T0FA 2C6YA 3RTRA 3JRFA 2OV7A 3DTIA 2OCCH 5E20A 4DZPA 2VT2A 2RNGA 3E7LA 3KZ9A 3GLXA 5FD5A 3BR3A 3WE2A 4H0EA 1J59A 2HVQA 2D45A 4RS8A 2EB7A 3T0YA 4U0YA 2L4AA 3GBGA 3JRGA 2G7GA 2HR3A 5F64A 2X9DA 5EZHA 4EM1A 4IOCF 2JQ7A 3K4LA 5JR3A 1P6RA 3BJ6A 4UUSB 2PG4A 4I76A 3H9JA 1MNMC 3RYPA 2CUFA 2D2WA 1VQ6I 2EH3A 2ZOYA 3LJLA 3I55I 2DYRH 2OQRA 1K61A 1EV7A 4DBQA 2Q24A 3MKLA 4WK8F 2EZLA 1X4OA 4FETA 1BJZA 1OYYA 2NVXJ 2KQRA 4DVYP 5F6FA 2ME6A 1JI8A 1UI5A 5KAFC 1TC3C 1YE9A 4P55A 3CDHA 1MH3A 1XMAA 2MC4A 4AYBN 1RI7A 3HRTA 2YS9A 1FBSA 1OCCH 4AIKA 1WVRA 4DJAA 1AKHA 2FRHA 1T56A 2JZYA 1R6RA 2DDAA 4YFXF 2V9VA 5JLWA 2GXBA 3SYTA 2ZCWA 3I9V2 1U8RA 1HBXG 3MWMA 4HQEA 1JXSA 3IKTA 5IT3A 3PO2J 3CO7C 4A6DA 5GTIC 1WCMJ 1BA5A 5EG0A 2R5YA 3A1YA 2PJRA 4PSWA 4NB5A 3PO3J 2WAEA 4KFCA 2K85A 4CYCA 4F92B 2M9HA 3ZQ7A 3ZXSA 3MVPA 3H5AA 1PP7U 2XB5A 2MC3A 4V19K 2XPVA 3I4MJ 2RKHA 1YOVB 1ZYRF 4BBSJ 2IGOA 4WX9A 4HNUA 4WIBA 3K6GA 4J00A 2WADA 3K4MA 3LAPA 2WWYA 1OCPA 3CWRA 1EH7A 3RQIA 4PJMA 2IGKA 4GFBA 4IHVA 2FUG2 2R5ZB 3ZQGA 3L2WA 4BGDA 3BT9A 3P7NA 4M74A 1VQ7I 1BI3A 2JA2A 2VJIA 2R7VA 2RNJA 1FOWA 5H6QA 2M5WA 1F5TA 2ISYA 2VBXA 1WH5A 3VIBA 4AIDA 4ZYEA 4CZCA 3PFYA 3OR2C 2V6EA 3CJQB 2A5YB 1MH4A 1TNSA 1JUSA 3CRJA 3IH3A 5L3GA 3OIPA 1Z3XA 3O6BB 2LY1A 1O3SA 1D5VA 1G8XA 2V79A 2X6OA 5ILVA 1ETKA 4O6JA 2JN6A 4E7HA 5LFAA 1JKOC 3OS2A 5D6EA 3HDDA 2BY2A 3CCYA 4HZFA 2RN7A 2Y0MA 5ICFA 2AHQA 3DKWA 1N25A 3IUVA 1SEUA 4HSRA 4UDSA 2LH9A 1AWCA 4IRGA 3BR5A 3GTKJ 3ZQLA 1R7JA 1WJAA 1S3JA 1TWHJ 2CW0F 4MEYF 4UB6C 3SXYA 3C1DA 5ED4A 3SDGA 1IGNA 1FEXA 4I0AA 4XR6A 4DBRA 3S5RA 1K83J 5TGTA 4Z6YA 4N4NB 1ZGAA 2K5CA 3HG9A 2UXHA 1UG2A 3BLYA 3JSPA 2K02A 3KFWX 3BNIA 1S29A 3VODA 2CS3A 2OU2A 2OZ6A 1R22A 3VPRA 1ACIA 1MMDA 1XDSA 3SEZA 4ZTFA 3DKXA 1JHFA 2LFBA 2WA0A 3ZPLA 2Z3YA 4LD5A 3AL0C 3V7CA 1HA8A 1XN7A 3ROUA 3G6EI 3N97A 1FZPB 1GDTA 1FP2A 4CO8A 2EIJH 4M6XA 3CDLA 2O9LA 1WJFA 4BHCA 4GRIA 3JRAA 2O8KA 1TQMA 3E5UA 5J3LA 5L3BA 2HEOA 4UNOA 2IS4A 2VPLA 2R7OA 5HSZA 1JTYA 3F9KA 2DMNA 3KYCB 2OI8A 2K9SA 3PASA 4C3JJ 2DJNA 5K7ZA 3ML6A 2E34A 2EZHA 1ETYA 2HYJA 1ZH5A 1MBKA 5DUIA 2HDDA 1HLVA 4CH7A 3WU1B 1Z9CA 2GQQA 3S16J 1OPCA 4BDZA 2DA3A 5K58A 1O7LA 2ZBKA 4KIBA 2A2FX 2E5NA 2V1DA 4LK0F 2DMUA 3NXCA 1TWGJ 3O8GA 2BZTA 5DYMA 1H0MA 5AQCA 3I58A 4LLNA 1ORKA 2G7UA 4G7HF 2MSYA 3P9KA 2JA8J 1Z67A 2PMUA 3MKYB 2FBHA 5EEHA 4EQQA 1BR1A 3OS1A 3RJPA 2M87A 2NS8A 4C2UA 3EPZA 2EBIA 3TL4X 3F22A 4BQQA 3IH4A 3ECHA 3SHFA 1WH7A 3CCEI 3VTIA 2ELHA 5EEGA 3GTLJ 4MK6A 2GA2A 1PYVA 3FXOA 5F1JA 2GZWA 1B6AA 2RQPA 4Y52J 3LSJA 1Q1VA 5IT9K 2XF6A 1QZZA 2IXSA 3NRVA 5HS7A 3R61A 4GCVA 2EINH 1VF9A 3GLLA 5JLXA 2E2IJ 3FZVA 2HOAA 2M8GX 3QYEA 2IGMA 2PI0A 1T2KA 2FBKA 1Y8RB 2LY2A 3HUGB 5FGMA 1MW7A 2QKMB 4A3GJ 1I3QJ 1ONVA 3HHHA 1ERDA 5IT9Z 4FTHA 3E97A 5LGTA 4CYDA 4KDPA 2RHAA 2L5QA 1SMYF 4AU7A 4HNTA 1DP7P 2JK3A 3SFZA 2Z16A 3RD3A 1LDJA 2KZVA 1MJ9A 5E1XA 1V5EA 2PZ9A 2HNHA 2Z1DA 4CCOA 1Z7UA 3CCJI 3L2UA 1A35A 5KK1A 2DA6A 1WI9A 1ZAOA 4KT5C 3ZMSA 1B8IA 1STZA 2VXZA 3HSEA 4GCLA 3EUPA 3ULQB 1E3HA 3BG3A 1ZLJA 3RPQA 1RZ4A 2DYSH 1K6OA 4ZYHA 1USTA 2HGCA 2QKLB 2X6XA 3FHNA 2ZSIB 3TQNA 1SVMA 4MO7A 1LE8A 3IP4B 4NC7A 2VE9A 1KONA 2HXOA 3QODA 4CZZA 4A3LJ 5CXGA 3PM1A 4RB2C 4ETSA 2CV1A 1KGSA 5F1RA 2WB1N 1WI3A 5FJ8J 2XSDC 2QOPA 1Z3YA 1POGA 4JK1X 2JRMA 2HYFA 5J8CA 4M3BA 1I1SA 2JUCA 3AG3H 5DCFA 3DTKA 4HF1A 3BJAA 4JKZA 1YJWI 2STWA 2QQ8A 4H4KC 2QQAA 5L3EA 2IP2A 2XPUA 2YU9J 1OKRA 2DTZA 3ZMVA 3QYBA 4XMYA 1MIJA 2ESHA 4XLCA 4XIDA 4U7DA 2P81A 3BRUA 4F91B 3J7ZI 2DA4A 5J1UA 3R0AA 5K5OA 1SFEA 3CLOA 2IPQX 3BG6A 2D1VA 4D5CA 2R7DA 4FQGA 3OYLA 1Y56A 1D8JA 1M1EB 2E60A 4E7ZA 2QQBA 2STTA 3S32A 5AIQA 4ABZA 2ZOZA 1SAUA 5J4YA 2ETHA 2CW8A 1IRXA 4Y17A 3DLLF 2CQQA 2WC2A 1X58A 5FROA 3RZDJ 2ZJPF 1VQ8I 3KKDA 2OZUA 2YPRA 1R5ID 2K9QA 2V1NA 3BC8A 2QCOA 3F6VA 1QBJA 4CHUA 3KPHA 1BW5A 3DFGA 2R3SA 9ANTA 2KRCA 2EV0A 1U8BA 4P9FA 3KIOA 2GIVA 4M9ZA 1JUMA 3NRGA 2AQEA 3MZ8A 2HQNA 4HX8A 5B66C 1FWZA 1ZARA 2Q2EA 3E5QA 2YVHA 3BR6A 1FTTA 4D1QA 4EJTA 3I5UA 2ZO4A 4A69C 1B59A 1ZR2A 1TWCJ 2M0MA 4HX7A 4N9IA 2Z9OA 2E1OA 3T8TA 4IO9F 2ME0A 4BBRJ 1MBHA 4ESJA 3BQYA 3CCMI 5D1RA 1YRNB 2W25A 3FKIJ 1JTXA 1HDPA 2WY8Q 4C3IJ 3TOBA 5CVRA 5LLQA 3KLOA 5DM7F 1H9TA 3TW7A 2BW3A 2DMPA 5FO5A 3JAMK 5J4VA 4ZDOA 3RCOA 4PCQA 1X19A 1ZTRA 2XF5A 1R4MB 5IOYA 2MLKA 1R71A 4PZJA 5HVQC 1S7EA 4ENNA 5IYBJ 2ZC2A 2MA3A 2BHYA 2L54A 3E6DA 3BTJA 4NHJA 3M07A 1AU7A 2W53A 4YIFA 3JAMZ 5DV5A 5D8KB 5E3LA 3CDIA 2QBYB 2QGUA 2VT3A 2CWEA 1S72I 1H9GA 2KFDA 4XQFA 3HOWJ 5IYDJ 2G7LA 4HKUA 3SWHA 3KX2A 2HQ5A 3K1NA 2DCEA 3S93A 1WGXA 3LMMA 1U2WA 1BIBA 5BNGA 1WPKA 2ADUA 1P4AA 3N05A 4D0PA 4M6YA 1WJDA 3D5LA 3K8PC 3FF5A 3C18A 5C4JJ 2XAFA 5KCMA 3BP8A 5M5WJ 2VE8A 3MD2A 2ZFUA 2LLKA 4DZJA 4MIMA 5LHIA 2LP0A 4Y4RA 1HKSA 5GTHC 3HEFA 3COLA 4PSXA 4WXCA 1UG0A 1R1TA 2EK5A 4EJUA 3ZQHA 5FGLA 3BR0A 1UMQA 2KIUA 2P5KA 1IDYA 3JRCA 1BC8C 3J7AO 3MKWB 1BJAA 2V9PA 3LAJA 1U5TB 3TO9A 2KIQA 3H1CA 2XV4S 3VW1A 4LG3A 3QPHA 2PMZN 5GAGJ 4CCMA 1FYMA 2G9WA 1NG7A 1IRFA 2DOFA 3HBLA 5GAEJ 1LVKA 4BXFA 2ICWG 5D4RA 2VONA 4R1HA 3CZ6A 3HOVJ 1FJLA 1W36C 1V3FA 2E7XA 2JVGA 2JUGA 1A04A 4X6AJ 2UUZA 1F36A 5A2QK 2VQHA 4ESFA 5ICCA 4I01A 3ON4A 1XD7A 4XRSG 2M4GA 2OD5A 1QQIA 4IVNA 2J5PA 2IW5A 1JGGA 3RPUA 1K6YA 5LEKA 3EQLF 4B8XA 2GXGA 2F4OB 5A2QZ 2F5CA 4MXMA 1AKHB 4NN1A 2PQ8A 2XGDA 2M7BA 3WODF 3EUAA 3F8BA 1XGNA 2HTJA 4E7SA 5CJ9A 1MMGA 2DODA 1MKMA 4RGRA 2ZB9A 2A3SA 2YX7A 1YIJI 1PVEA 2GM4A 1I39A 3K9TA 5GADJ 2A05A 1NG6A 4Y3OA 4HA8A 3HTHA 2VQCA 5EG0B 4ZYDA 2R5YB 2E1MC 4LB6B 2FJ1A 4L9NA 4U87A 5DM6F 2PJRB 3CJDA 1MDMA 4IKFA 1E3OC 3QBMA 3VUQA 1SC7A 3ESWB 4CYCB 2OUMA 3HOSA 2RGVA 5HLTA 3EDPA 1WRJA 2M0CA 2D5VA 2XRLA 4M6VA 2XAJA 3IUOA 2ZJ2A 3R60A 2AXLA 1E17A 1LDDA 1S9HA 3QU6A 4A3IJ 3MN2A 4U88A 4CUGA 1YW7A 3D5RC 4HDVA 5L3DA 5CQGA 1ZGWA 1ZQ3P 3S8PA 2E35A 3EYIA 1YRNA 1WJBA 2GAUA 1X1PA 4ZDLA 2ZXHA 2KL4A 1LB2A 3KEQA 2XB0X 2DFFA 3K10A 2EV5A 2K86A 1EH8A 4FE7A 4LIUA 2LBFB 3WG7H 3GZ5A 4RB3C 1MMSA 1QNTA 3QPTA 2WV0A 3A01A 2HWVA 3DBLB 3JTGA 2OBPA 2XGCA 3BZCA 3OS0A 1BIAA 3HKZN 1DQUA 1G4DA 2BXYA 2BVMA 3G1OA 4KWAA 4JOMA 3H3ZA 2BHZA 4M72A 2R7XA 1FIAA 3U21A 3A0HC 2M3AA 5TRDA 4P5OA 2NAZA 1VZ0A 4L9JA 2BXZA 2KJBA 4F55A 4LLGF 2OPTA 1QPMA 4KN4X 3S15J 3ABUA 3P9TA 1F9NA 5LGUA 3BR2A 5IP7J 5L3CA 1YLFA 1TQPA 4UV9A 1IG7A 2Y0SN 3IKVA 1ZGJA 4M9SA 4L5JA 2XDVA 1XSVA 3DTEA 2EV6A 3OYKA 2NNYA 4HDUA 4FT8A 1OQYA 4GYGA 3MEXA 3DP7A 4JP0A 1APLC 5LBQA 4BHPA 3GTGJ 2HPIA 1E2XA 2XRNA 1IN7A 4P1WA 5KAIC 4XOPA 1ZELA 3HE0A 4LIVA 1O3RA 1IXCA 3FM3A 3OSGA 2MABA 3LL7A 1U5TA 2G7SA 4I0BA 3H36A 3VSKA 5BMZA 3VSLA 5B1BH 2KIMA 4RM3A 4ON0A 2ESNA 3IWFA 3DV8A 3BCGA 1HSJA 4BY1J 3QOEA 1O4XA 3OV8A 2ZXJA 4BJ5C 4R79A 4UVAA 3W2WA 2QA4I 2EA2A 1GVJA 4MNUA 3DU6A 4WWCA 2WAQN 1MBJA 2W24A 3M1EA 1R36A 3I54A 1DPRA 1TBXA 3Q3SA 4I7HA 1O57A 3ASNH 3FXRA 1UELB 3JRHA 2GFNA 5H2FC 4XLHA 3PFIA 1ENHA 1HCRA 1Y1WJ 4L0ZB 3JSJA 4JL3A 1J0RA 2R7ZJ 3ONQA 1Y0UA 5FKLA 3GMEA 4AIJA 2DA1A 2D1HA 2ZSHB 3HGYA 3CUQB 4QTRA 2QUFA 3HIFA 1W4MA 4UXNA 3DF8A 3DXJF 3MFKA 3QRFF 3E1SA 3RKXA 4YFNF 3K4KA 3ABLH 1NK2P 1B9NA 3KYDB 4LB5A 3M8FA 1SFKA 1JKRC 2FF4A 1SMTA 3DEEA 2PBIA 3OYDA 3PIPF 3ZGKA 2P6TA 2VKHA 4JQFA 5HOOA 1W5SA 2HZDA 4AD9A 3D5SC 3ANGA 4PK4A 4A0YA 3N4MA 2X1CA 1ODDA 3KP7A 5IP9J 2CUEA 2Y69H 1W1WE 2H8WA 3FISA 2OJED 3FHZA 4S05A 1RR8C 3GTPJ 1LVAA 4IOAF 3OYEA 1XG1A 3CD6I 3CQZJ 4HYEA 1R9TJ 2K3PA 4XKBA 2K4JA 2F6CA 3ZMTA 2EFWA 3SZGA 1PDNC 1OYIA 4KJZA 2VL8A 3VP5A 1LEBA 4XRSA 2LYCA 5B3SH 1A6IA 3T6NA 3GXOA 1P4XA 2FNPA 2QENA 1FYLA 5DEQA 3BJOA 3GCMA 3HXLA 4Z2YA 4A0XA 5HAWA 3GZIA 1UFMA 2LBFA 3BROA 1QHHD 4HAMA 3CCQI 2R7WA 1PUEE 2EIMH 2FU4A 3LFUA 4C3HJ 2RC4A 2R7QA 5JFRA 3RKYA 3HHGA 4A3EJ 1QRYA 3NS4A 2UXXA 4BJ6C 1YQAA 3KE2A 1FLIA 3F8MA 2V1UA 3K4CA 4Q5SF 4OIPF 4V2GA 2VI6A 1OFCX 2HXIA 3SZPA 3FBNB 3HIMA 2QKOA 5J6XA 3JREA 1V5GA 1P4WA 3Q9SA 3ZMUA 1BW6A 1T8IA 3S17J 2XUBA 2FSWA 1B8IB 3L09A 5DDGA 4Y7NJ 2KHMA 3WTXC 1Z6RA 3V4GA 1R5HA 4M3DA 2MG4A 1TW2A 3L2RA 1SAXA 5CQEA 4EM0B 1W7PA 3V8LA 1G3SA 4LITA 3SZTA 2YR2A 5ICGA 4X0GA 3HTAA 1LE8B 5KNLA 3OYHA 1BI2A 3ZP5A 3K0LA 3FXQA 3ZRGA 2NRAC 2HVRA 1OMIA 3KNWA 3E3VA 1ZRDA 2L7KA 1ETWA 2ACJA 2GOMA 3KETA 2ID3A 4FX4A 2Q1ZB 2K40A 3KP4A 4LK1F 3WE3A 3SFIA 4EJVA 3EUHC 3WHBA 1XMKA 4LOCA 4ZYGA 1TLHB 3FDYA 4JYKA 1I1GA 2W7NA 3GW2A 2L01A 1ZG5A 3KZIC 1IN5A 4IQ4A 1D3YA 3JTHA 5FRMA 2IA2A 2O7TA 3VOEA 1JGSA 3J81K 2KDOA 1I6HJ 1DUXC 5JHFA 1YW8A 4S0HB 1MGTA 1T6SA 3H9QA 3C2BA 1OCTC 2EFQA 2JA7J 2DDBA 2OCEA 5HLIA 3OY9A 1HQCA 1WFXA 3AG1H 2B1EA 1LKXA 5E3NA 4BS9A 2L7MP 3BR1A 4KITB 3QAHA 2HPMA 1TNTA 1SVLA 1VQNI 1MMNA 2M1BA 4FE4A 4HLXA 1QZEA 1P9QC 5TISC 3H9GA 1FP1D 1ON1A 2QIBA 2A07F 3H92A 3H0DA 1Y0NA 2PMZA 3E5XA 4G8XA 1HDDC 4HX4A 3AKZA 4PDKA 2TRTA 2ZKZA 3AG2H 4IZZA 3PSFA 1G2HA 1OCOH 1VQ4I 3MQ0A 4A3JJ 2DT5A 2CFXA 5BS6A 1MJBA 2Q2EB 5JVGF 3FIWA 4U9LA 4LG0A 1TQIA 5JI6A 4RM2A 4J19A 1HF0A 1F43A 3F23A 3CUQA 2BV6A 3K1PA 1X3WB 4EV0A 2KMUA 2NXNB 1OR7A 3F3XA 1CF7A 5B1AH 2NVTJ 3I56I 4F7ZA 2IS2A 3MAJA 1BOBA 3S2DJ 3ZR8X 3DLAA 3RPUD 4LFUA 5DD8A 4YZEA 3SDBA 4CCLA 3KP5A 5FD6A 2BW3B 2X1EA 5E1WA 1P92A 1WZ2A 3GEZA 3NAUA 1RUOA 2F5FA 4BACA 4RB0A 4DNCA 4B44A 4XN3A 3ZN1A 4YFKF 3EYYA 1T98A 1FSHA 2EZIA 2K9MA 2Y9YA 1FBQA 4MHGA 4DIQA 3P5JA 5FHPA 4F52A 4PUSA 3I53A 4DYQA 1WSUA 1X1AA 2XVCA 1IV8A 3I0TA 2HOEA 2ZFWA 4IQJA 3P9CA 6PAXA 5IPAA 4PJNA 1A31A 2L7FP 3F8CA 2ZMEC 4Q47A 1YG2A 4AVPA 3GVAA 1FYKA 2GOXB 1WJCA 1JKPC 3OYBA 1LNWA 1R4NB 3DPUA 2IA1A 4KIGA 2LF8A 1R58A 1FT9A 4BYYA 4HLYA 1ZLKA 4B1RA 4AUXA 2OTLI 2BVLA 3FBIB 1EJ9A 1IUYA 2Y2ZA 1EKEA 4DW6A 5D5UB 2CU7A 4HV5A 4GCKA 2ZJRF 4PXIA 2O0YA 1YS7A 4DGWB 4KYWA 2P7CB 5EEAA 2L7ZA 3LQQA 3ZN0A 1WJEA 2PX9A 2FBQA 3ZOBA 3QQAA 3BG5A 3AL0B 4AIHA 4ZJZA 4GDFA 2CRGA 1IV6A 4AVZA 4L5IA 3ERED 5JVTA 4GO1A 1QHGA 1EH6A 5AIPA 2OAZA 3H3UA 3ZQIA 3LSPA 2MLGA 3HGGA 5DD4A 2COMA 2ELKA 1KQ8A 4BQOA 2O3FA 2X1DA 1T38A 1LFBA 5D19A 4L9TA 2LR8A 4D7NA 2CUZA 4XN0A 1RNLA 2ISZA 2H09A 3OYFA 5K5QA 2L9VA 5HODA 2AO9A 3LFKA 2Y75A 3L2CA 1QZYA 3LWFA 2XGXA 3V78A 1Q1HA 3LA7A 1YW9A 3JRIA 2JT1A 3F6OA 2EFPA 2L9SA 3HTUA 5GAHJ 4BQAA 2LRDA 5HS8A 2RDPA 3GFLA 5HDGA 1Z91A 5HNFA 1ZG1A 1RIOH 4UB8C 3F0CA 2JPBA 3AQTA 1K4TA 1MBEA 5FB2A 4HV6A 2BYVE 4QLCU 3OIQA 3TKYA 4KICA 4MQVA 4CSWA 2R0QC 3CC7I 2JVHA 2XAGA 3WTTC 1FTZA 3VYTB 2L3DA 3BQZA 2A69F 1IW7F 1D0XA 1IN6A 2R7UA 3H5NA 3COAC 3FX3A 2R7RA 4HF2A 3BHQA 5GPAA 2D6YA 2IT0A 3JW4A 3V8KA 4OIOF 3O8HA 1D1AA 3S3NA 1S5LC 5EJCA 2V9KA 4EGZA 1B72A 4HRIA 4PGGA 2CQKA 2COBA 2F2EA 1KZHA 3O2PE 2JA6J 4I2OA 2JSPA 2EFNA 3LA2A 3FK7A 1GXPA 1F1ZA 4IRVA 4O3MA 2I5UA 1SANA 2HDWA 2DK8A 3DPLC 1KYZA 3DEUA 2WTEA 1ITYA 2CW7A 3S1NJ 2VB6A 5BPDA 3VOKA 1MDMB 2CUJA 4MTDA 3G71I 5BOXA 4Y15A 1UHWA 1QGPA 2VOOA 3VYRB 1VQMI 3KCCA 1VQOI 2NOJB 2G3BA 1Z6TA 4HOBA 2CFOA 4XNFA 2Z33A 3MZHA 1R00A 3ANPA 3KP6A 3S14J 4A12A 2RV8A 2LKPA 1LQ1A 5CW8A 3S1MJ 1A5JA 3CTAA 2F07A 4ANJA 1MMAA 3CJTB 4FX0A 1QVTA 4OMZA 3ZQFA 2LSOA 1DDNA 1HW1A 5EYRA 3S1RJ 3BPXA 2W48A 4FCYA 3PJRA 5FLXK 3TP0A 2K9NA 1P2FA 3WTSC 1D0YA 4HF0A 2L9NA 3HOTA 3KEYA 1JT0A 3PSIA 5FLMJ 3BJBA 3WTUC 5F0CA 2E7WA 3TO6A 4AYBA 1KA8A 5K5RA 1XPXA 1PP8F 2DXIA 2LVSA 4FASD 4K2EA 3L2VA 1TWFJ 4YG2F 4J01A 4G7ZF 4G12A 5C4XJ 4WXDA 4IHTA 3ABMH 3VYSB 5FLXZ 3A01B 1RUNA 2MD5A 2E2JJ 4EJWA 2P8TA 2Z5UA 3HB9A 2DA7A 1J75A 1MNDA 2NVYJ 4E6KG 5LEJA 5J40A 4QSHA 3IHUA 1JE8A 3OOUA 2LOOA 2EJRA 4A3CJ 1A36A 2DFIA 3M3YJ 2OTJI 4HBLA 4C30A 1YJNI 2LKSA 2ZCNA 3H0GJ 3D0SA 5CLSA 4Y13A 2RQQA 2H1KA 3VW0A 2M8EA 5EGOA 1LFUP 2QVOA 5DCMB 1DU0A 3F8FA 2WV1A 3EUHA 4JX6A 3VDXA 1RRJA 4C9YA 1K79A 1X1CA 5M3MJ 2LKXA 4EJOA 3PQKA 3WTYC 3HTSB 4AM3A 1MSEC 4IL6C 4I02A 3S3OA 4XRFA 3CMMA 5F0FA 4A3BJ 1G3TA 2HTSA 2DU9A 2ZXWH 2K9LA 4KNYA 2DW4A 1IZ1A 2L9RA 3M9AA 2VKVA 4KT6A 4U9NA 2VODA 2LREA 4DYCA 3HPHA 2O61A 4G6DA 2VJ5A 1Y6IA 3GZ6A 3OYCA 4A5NA 5M5YJ 3JRBA 4Q4ZF 2CQ7A 3VB2A 2A5WA 3BTIA 1HW2A 1J2XA 3ECOA 2L0KA 3CMEI 2F48A 2HQRA 3K2AA 1JHHA 2L2OA 3NWSA 3C3WA 2X0LA 5F08A 1UZCA 3DCFA 1B4AA 3K4JA 4MTEA 2VKDA 2VPRA 3JCUC 4M9XA 4YELA 3GTMJ 5F27A 2N8GA 3RI4A 1FOXA 3O60A 3OIOA 4O5VA 3WGGA 3JRDA 1T33A 4PJLA 1ZN2A 1S7AA 3HPGA 4ZC3A 4ENMA 2MBFA 4A3MJ 3J7AY 4ZH4F 2YX4A 2KDZA 3L2QA 4F93B 2DOAA 3EGQA 2P6SA 3G1LA 2Y9ZA 3LHQA 1MJAA 1SFXA 3F1BA 3VVXA 3QKXA 3OSFA 4IRHA 2R93J 1W7PD 1QA6A 2EZKA 2VASA 5K7HA 3SJMA 5HDKA 3CJRB 1N77A 1GV2A 3LOCA 3O3KA 4R8HA 1ZREA 3U2RA 1T95A 1T08B 4M3FA 2XAQA 2F5VA 2LNBA 2MGQA 1GUUA 2FX0A 2H6CA 2OC6A 1O3TA 3BY6A 1BI1A 2RVCA 5FKMA 3B6AA 2XGEA 2CYYA 4CCKA 2MYSA 1WQ2A 4UVBA 1B9MA 1HXDA 5F0HA 2GWRA 2GA1A 1TW3A 2LC2A 1I50J 5JHUA 3LQRA 2GIZA 2NX4A 2LTPA 3CCSI 4I6ZA 3NARA 5ILUA 2BY1A 2VC1A 1PUFA 4HPQA 3U1DA 4OIRF 4CGRA 3AFHA 4U0WA 2IEKA 3Q0VA 4OWRB 4RAYA 3HYIA 4BUPA 4IXAA 4MFDA 4D5FA 2P7VB 2HYGD 2JSCA 2PN6A 2VN2A 5K1YA 3LSRA 3I4NJ 1OCRH 1U0JA 2HQAA 2KJCA 2O7OA 3ASOH 4XLFA 3DEWA 4XONA 4C2MJ 2FBIA 5IP6A 1ZG3A 3HOYJ 5E18F 2KIFA 3KEOA 3ISPA 3CLQA 2FOWA 2IS1A 3TP3A 2BY3A 5D4SA 2QSGX 5DTDA 2DLLA 1UI6A 2XAUA 2BOLA 1ON2A 2JWTA 3NWTA 4XICA 4NNJA 3OR1C 3K70D 2PMHA 4A3KJ 4Q48A 2X6YA 1D5YA 4EGYA 1O3QA 3OYNA 2O03A 3VVZA 1J7KA 4A93J 1R49A 4RAGA 3CMAI 4BAYA 2DG7A 1D1BA 3MCZA 4LMYA 3AQSA 3HM5A 4IPAA 2DI3A 2QEXI 2ZCXA 1IO2A 1R1UA 2CJJA 3X2QH 1Z77A 4LJZF 1EA3A 2TDXA 5F04A 3GX4X 5E3MA 2W1OA 3M8EA 3TMOA 1QU3A 2A68F 5CKTA 2TCTA 1XB4A 3RDIA 5ERIA 2Q0OA 2QLZA 3BZ6A 2XHKA 4JNNA 1LPQA 4HW0A 3H35A 3IV5A 3NI7A 1OYWA 5FFXA 3EETA 1IN4A 5LRRA 3LNQA 2E1CA 4A2UA 2KP6A 4Y33A 2FE3A 4M3GA 3OWTA 5DCMA 1W7PB 3AAFA 1CQTA 3GFJA 2Q8KA 5GPCA 2CO5A 4IHSA 2B3WA 3OYJA 3UKGA 4ACIA 2QM3A 1H8AC 3WTZA 3ZMDA 2I8DA 4D9JA 3HOZJ 4QPOA 1FC3A 2Z99A 2DT7B 4MFEA 4RMNA 1AA7A 1J5YA 2DO7A 2J5OA 3HC7A 3DKYA 4OOIA 1ULYA 2BEOA 3VOXA 4CCJA 5E8GA 1YITI 3KLNA 4N0BA 1VQPI 1V55H 4XL9A 1IRZA 1GXQA 1CGPA 3A4CA 5HNHA 3S3MA 2VXDA 1TTYA 4C2TA 2KISA 1JJ8C 2CQXA 5IY5H 4KMFA 2YVEA 4V2FA 3HRUA 2L02A 1YJ9I 2OQGA 3B6CA 3J80K 4EATA 2A61A 2E1MB 1FY7A 3HJEA 3BWGA 3V42A 4BKXA 4CCNA 1D0ZA 1LUJB 3OYMA 1FMVA 1KYWA 3HTIA 4B09A 5H9TA 2ZNYA 2JA5J 3A03A 3J80Z 1D8KA 4MQ9F 4XLNF 5HLGA 1WHUA 4X1EA 4BEHA 2JTVA 2XAHA 2DBBA 2ZXIA 2WB1A 1Y39A 5D5WB 1NK3P 1DGRM 4A3FJ 3RYRA 5KVRA 2LD5A 2UZKA 2XPWA 1Z05A 4BL0B 4XRMA 3OYAA 3WG9A 2YU3A 4LG0B 4OIQF 1DP3A 5IYCJ 1SFOJ 2WAFA 4EMSA 3WTVC 1SD7A 2IVMA 1SD6A 2EILH 2NP5A 3WGHA 1K78B 5LGNA 2W85A 3WTWC 1JT6A 4XOTA 3OL4A 1CF7B 3J7YJ 2P5LC 1IRGA 4U7BA 3T5XA 1BC7C 1ZRCA 3M4OJ 4BNCA 1JJ6C 2RREA 2R4GA 1I6XA 3HSFA 3V7RA 4NELA 3M8JA 4ZYAA 4A0ZA 5EF6A 5C44J 2XROA 1DU6A 4RGUA 2PLYA 2QSHX 2W84A 3T1BA 2E36A 2NYXA 4IEJA 2NOGA 3LSKA 3BDDA 4ENJA 1WKMA 1REPC 4BE0A 4IF4A 3L7WA 5CVVA 2PFVA 3G1MA 1YX3A 4I98B 2LG4A 1I27A 2RAEA 1YI2I 4RGSA 1NTCA 2DQRA 4AWXB 4B48A 1U78A 1YIOA 3MKZA 2M2EA 2QYOA 1BL0A 1SD4A 2QTQA 1UHMA 4TV7A 1YX5A 1HKQA 4XBFA 2NS0A 2XKOA 4ME9A 3Q0UA 4F3QA 3TOAA 4PJJA 1ZHFA 2E2HJ 2Y30A 3NEUA 3B02A 4WCGA 1IXRC 3CF5F 1W5CC 2H27A 3LSIA 2R7TA 1IDZA 4ICHA 3SQNA 1LEAA 3F21A 3S2HJ 1LDKB 5FRNA 2IA0A 3C2HA 1TP4A 2ELJA 3K1MA 5LHHA 3H5RA 3GUDA 4ZTJA 3A0BC 4UUVA 3E6BA 2LDUA 3I3LA 3WHCA 3HOXJ 2HOTA 3MNLA 4RAFA 2HYTA 2FMYA 5FMPA 5D5XB 4E7KA 1PJRA 3FMRA 2DPDA 3ABTA 4A6EA 3K2ZA 1E0EA 1X2MA 3MMYB 4JBAA 4XLPF 2QWWA 2H1LA 4ESBA 2O6GE 4L62A 2IS6A 3KKCA 1J09A 3R0JA 3B73A 4IHXA 4G9YA 2FMLA 1Y1VJ 1KQ0A 2X85A 1JUPA 1EF4A 1R5GA 1FOKA 3GO5A 1X1BA 2RASA 4L9VA 1SD5A 1FSEA 4EM2A 2HI3A 1OCZH 3VWBA 5C4YA 3G3ZA 2IAIA 1MSFC 2FEZA 4G7OF 3BG7A 1G3WA 3IRRA 1N78A 3FWEA 5E17F 2DMTA 4BH9A 2LY9A 2QWTA 1IJWC 3HZJA 1G6NA 4RDUA 3GTOJ 1P7JA 2ZNZA 4OU0A 4WXHA 5L3FA 1U9OA 4ITVA 3G73A 1UHSA 3R6SA 3P9IA 2EPFA 1XCBA 3RSNA 2KPMA 3I71A 4W97A 2Y48A 3ZQQA 2FQ3A 3R4KA 3UNGC 1X3UA 1OISA 4OMYA 4NQWA 5J8FA 1U3EM 3J81Z 1B72B 3D1NI 4IHWA 3TDZC 4A5MA 4XKVA 3QP6A 1I3AA 1WWXA 2ID6A 1ETXA 4FHTA 3TO7A 3CO6C 3SEQA 2R92J 1LFPA 4CXFA 2HOSA 3IL2A 3Q5FA 1AHDP 2B63J 3E7QA 5LRSA 2IU5A 3QP5A 5KHDA 2YVXA 1QVUA 3PNYA 5GP9A 3CP2A 4BXUA 1UAAA 4UY8I 3RZOJ 5LHGA 3CCRI 2EWNA 2DFEA 3CP8A 2IGNA 4YRVA 4UUSA 2VJJA 3WGIA 1GLNA 1W0UA 3A2KA 4YIRX 1S8NA 3W2AA 1K78A 2PJPA 2LK2A 1TL8A 3W6JB 2F4IA 2UWMA 1W5TA 2K7LA 4W1UA 2OERA 5HBUA 4E7IA 5LD2C 1MBFA 2DOEA 5J1YA 1TT5B 4RBOA 1HSTA 2F4MB 2P5VA 3QPSA 3GFMA 1VQLI 4OD4A 2UXUA 5J1RA 2CG4A 4XLEA 3PL8A 4ZDPA 3TGNA 5DS9A 1AOYA 2GXAA 4IJAA 1O7FA 2UXPA 3PNVA 2VQGA 3AG4H 3BPVA 4KISA 5J47A 2HFHA 3TW6A 4GFLA 2CMPA 4XM3A 3BZKA 4EVIA 2CQNA 1ETQA 1G3YA 4B47A 3L9FA 2UXNA 2XASA 3G56A 2MFZA 4N4OB 5E8IA 1ETOA 4E70A 4M71A 4M73A 1QPIA 5HS9A 3RKQA 5EFYA 2A6EF 1XCVA 1R1VA 3G7RA 3K4BA 2WBMA 3QYFA 4L5EA 5D6FA 3ZMZA 2VOPA 3PUFA 5EGOB 2CH0A 3LWJA 3QOPA 1DPUA 3F72A 4L0YB 3RKWA 4YIIA 2QSFX 1BR4A 1VI0A 3FKJA 1LJ9A 4AF5A 2HS5A 4FISA 3QWLA 1YYVA 4I99C 1FOYA 4JX4A 3LA3A 2V6CA 1FX7A 3KYLA 2W00A 1MZBA 3DU5A 3FXMA 4AC0A 3I64A 3BOQA 4NC6A 1A6QA 3ELKA 1FBUA 3HOUJ 3JR9A 3BG9A 3CC4I 5FKNA 2I10A 1ZK8A 5BQTA 4B3XA 3E6CC 3RIRA 2R5ZA 5EDNA 2REKA 1Z7LA 5D8LB 3GFIA 4BQNA 1XGOA 4HQMA 4RA2A 3HKZA 2HDCA 3GZNB 3CCUI 4DOZA 3ON2A 2XIGA 4AC6A 4UHTA 4XSZF 3Q9VA 3S2WA 2VQLA 2E19A 3CMYA 4LGWA 5FLVA 3S1QJ 1IN8A 1HC8A 4BU2A 3A02A 4G94A 4BY7J 2AXTC 4UV8A 4UUTA 4BE2A 4N9HA 2HKUA 2CGPA 5CYVA 3FM5A 1OJLA 1X2NA 3KP3A 1G59A 1SFUA 1W0TA 3RH2A 1RETA 3GF2A 2DA5A 3FRQA 1IUFA 2Y0SA 1E3PA 5HDNA 1XGSA 2FA5A 1H89C 1H88C 2BGCA 2FD5A 3TEDA 3W6KB 4ZZDA 2GBYA 2KLOA 4ZZLA 4HEA2 4KA4A 4CGZA 1NHAA 5D5VB 1MNEA 2VJ4A 1GVDA 3G2BA 1FPQA 1USSA 2P4WA 4II2A 2K4BA 2JPCA 1BOAA 4XSXF 2DQLA 2BE5F 4IX7A 4GFKA 1X3ZB 2UXIA 5M5XJ 4G6QA 4XKWA 2JJ7A 1PUFB 1B1BA 4YEJA 4CDGA 2ZMEB 4MEXF 2ZY9A 2LF7A 2K27A 3CC2I 3UR3C 3QPLA 2M30A 3JSOA 3PUBA 4C2MA 1T0FC 2WAQA 3HRSA 3FXKA 2DK5A 4XLAA 4RGXA 4QIWN 3BCAA 4QWQA 5E79C 4MGRA 4OAZA 1HKTA 1TWAJ 1U5TC 1J9IA 1XC5A 2V26A 1VFCA 2XSJC 5M3FJ 2GUHA 2EFOA 3HTJA 1HW5A 2VIXA 4E7JA 3PPBA 2MD0A 3LSGA 3CUOA 3CESA 2K3FA 3FXUA 5ICEA 4S04A 1R23A 1P7IA 2FXAA 4LLLA 2G0EA 5CVIA 2F5DA 3FMQA 4B43A 5E1ZB 1XS9A 1S6LA 4GYIA 2FJI1 2DMQA 2UXOA 1YTYA 3VEPA 2YUSA 3DWLE 3HRMA 3TBIA 3OMYA 1C0WA 2V57A 4D7MA 5C3EJ 1OLTA 2EA4A 2MH9A 2BBYA 2KT0A 3I59B 1BM9A 2HU9A 1SVOA 1XTAA 4GGGA 5CVJA 3I4PA 4BHBA 4E7LA 3OYGA 4II3A 3LSMA 1Z1DA 4QPQA 3DPTA 1BN5A 1Z0XA 1YFHA 2O8XA 1YO5C 3KZZA 2CV0A 4XORA 1HOMA 3DPJA 2XKPA 1XSDA 3FMSA 4RB1A 3BTCA 2DN0A 2CSOA 3K69A 2VKEA 2IRFG 3HUGA 4P96A 2QQ9A 2HZTA 5B5EC 3CCLI 1X1DA 3CJNA 4NDLA 3RQ4A 1VQ5I 2ECCA 3IWZA 3VFZA 3PIOF 2VBWA 2DJIA 3K4NA 3DQVC 1UB9A 2PEXA 3BCBA 3NNRA 2PFBA 4ENKA 2X48A 2M7AA 3LSHA 5D18A 1U9NA 2A6HF 3GEUA 4KN7X 4XKCA 2NNNA 1RESA 2W82A 1VNDA 1FIPA 1IXSB 3DBHB 2OF7A 4BJTA 3F8NA 4EEFG 2JRTA 4NC8A 3VW2A 2IBDA 2E5ZA 1U6GA 3IRQA 2FQ4A 2KKOA 3M1CA 2NVQJ 2DPUA 4MLOA 2OA4A 4XK4A 4OINF 5K7FA 4KIFA 2QF7A 1W36D 3G4SI 1T39A 1IC8A 5IOZA 4BEHB 1BBYA 2KRFA 2Y31A 3WU0A 2DTRA 4B3AA 4HSTA 3ZCOA 1QO0D 1RPWA 2M34A 3E0JB 3L1PA 3LSTA 2H6BA 4BXXJ 5AONA 5BPIA 3KP2A 2WGBA 4CA0A 2NP3A 5EZGA 3C2GA 3MZYA 1KU7A 4DQ2A 3Q0WA 3PNTA 2ECBA 5HLHA 1XMXA 2UV1A 1NH3A 4U0VA 5ILSA 5E3OA 2B9SA 2WY7Q 4B4CA 2EQRA 4OD5A 4RLQA 3V6GA 2BY0A 3IAM2 4DYRA 4CICA 3V7SA 4ASNA 1K7AA 1GT0C 2A6TA 2DG8A 5TJJA 3QU3A 3IC7A 4BE1A 2G7HA 1V5FA 3W6VA 3H3VK 3M7GA 2R7FA 2VC0A 2GENA 2ZMEA 1DGWY 3EUKL 3REOA 3C07A 3KZYA 2VBYA 1RKTA 2NS7A 2E71A 4GXOA 2M45A 1L3LA 4P9UA 3GYHX 1IF1A 2HVSA 2ZCMA 1FMWA 1YHQI 5CXIA 4G6TB 3BTLA 1JKQC
chains in the Genus database with same CATH topology
2NVTJ 2YVHA 4M3EA 3BR6A 1FTTA 4IEJA 2NOGA 4A69C 1ZR2A 1TWCJ 4YZEA 3G1MA 2E1OA 3NAUA 2ME0A 4BBRJ 1MBHA 2RAEA 3GTJJ 3BQYA 3K7AJ 5D1RA 1YRNB 2EZIA 1NTCA 2Y9YA 5FKOA 3FKIJ 1JTXA 5FHPA 1HDPA 4DYQA 1U78A 4C3IJ 2XDNA 1GV5A 2M2EA 3TW7A 1RR7A 1BL0A 2QTQA 3NPIA 2DMPA 3FK6A 5IPAA 1MBGA 1ZTRA 2L7FP 4ME9A 5IOYA 3Q0UA 1ZR4A 1S7EA 1JKPC 5IYBJ 4HNVA 2E2HJ 2Y30A 3B81A 2JMWA 3IH2A 4B1RA 1ZKGA 3BTJA 4AUXA 1AU7A 1IDZA 2W53A 4ICHA 3S2HJ 2GLOA 5E3LA 2MW8A 2Y2ZA 4DW6A 2CU7A 4GCKA 3GTQJ 3HOWJ 3VVYA 5IYDJ 2G7LA 4IHYA 4HKUA 4PXIA 3MNLA 2HQ5A 3WHCA 3HOXJ 2HOTA 1WGXA 2HYTA 5FMPA 5BNGA 5EEAA 1WPKA 2L7ZA 1SGMA 2PBXA 2FBQA 3ZOBA 1X2MA 3QQAA 3BG5A 4L62A 1RKWA 2WUIA 3KKCA 5DAJA 5C4JJ 2CRGA 1IV6A 2H8RA 5M5WJ 4IHXA 5FKKA 3ZQIA 2LLKA 4DZJA 2VUMJ 1Y1VJ 4MIMA 3LSPA 2LP0A 3HGGA 4A3DJ 1JUPA 2ELKA 1EF4A 3HEFA 3COLA 1LFBA 5D19A 2RASA 2LR8A 4D7NA 3ZQHA 2HI3A 5FGLA 3BR0A 1UMQA 4JX5A 5C4YA 1MSFC 2DA2A 2IAIA 1IDYA 2AO9A 5HODA 3JRCA 4GCTA 3V78A 2DMTA 2LY9A 3JRIA 1ETVA 2QWTA 1IJWC 4RDUA 3GTOJ 1P7JA 1U9OA 1UHSA 3ZQCA 3VW1A 2PMZN 3JRFA 3F0CA 3HBLA 3AQTA 4DZPA 1MBEA 4W97A 3KZ9A 3E7LA 2R0QC 3BR3A 1FTZA 3HOVJ 1FJLA 1B72B 4X6AJ 3D1NI 3BQZA 1F36A 4IHWA 3GBGA 3JRGA 2G7GA 2ID6A 1ETXA 2X9DA 5EZHA 3BHQA 3ON4A 4XRSG 5GPAA 2D6YA 4UUSB 4I76A 2R92J 3O8HA 2HOSA 1JGGA 1AHDP 1MNMC 2B63J 3E7QA 2CUFA 1B72A 2IU5A 2COBA 1QVUA 5GP9A 2EH3A 2JA6J 2ZOYA 3LJLA 1K61A 3RZOJ 2Q24A 3MKLA 3FK7A 4MXMA 1AKHB 4NN1A 2EZLA 2XGDA 1BJZA 1W0UA 2NVXJ 1SANA 4UUSA 2ME6A 1ITYA 3S1NJ 1UI5A 3VOKA 2LK2A 1TC3C 4W1UA 1MH3A 2OERA 5HBUA 4AYBN 1MBFA 2ZB9A 2YS9A 2GM4A 5J1YA 1AKHA 4RBOA 2G3BA 1T56A 3ANPA 3QPSA 3S14J 5EG0B 3HTHA 5CW8A 2R5YB 3S1MJ 1A5JA 2FJ1A 5J1RA 5JLWA 2UXUA 3QBMA 3CJDA 2F07A 3VUQA 1E3OC 1QVTA 3ZQFA 5DS9A 5EYRA 3S1RJ 2UXPA 2W48A 4CYCB 4FCYA 3TP0A 2K9NA 3TW6A 4GFLA 1JT0A 5FLMJ 3PO2J 3BJBA 1BA5A 1WCMJ 2M0CA 5F0CA 5EG0A 2D5VA 2XRLA 4M6VA 1ETQA 2R5YA 2LVSA 3PO3J 3G56A 1TWFJ 4G12A 5C4XJ 4CYCA 1ETOA 2M9HA 4A3IJ 3MN2A 3A01B 1QPIA 3MVPA 5EFYA 3RKQA 1ZGWA 1ZQ3P 3G7RA 2E2JJ 2XB5A 4L5EA 1YRNA 2XPVA 3HB9A 2DA7A 3I4MJ 5EGOB 3LWJA 2NVYJ 2XB0X 4BBSJ 4FE7A 4QSHA 3OOUA 4A3CJ 1VI0A 3M3YJ 1OCPA 3CWRA 4AF5A 3A01A 4FISA 2ZCNA 3H0GJ 3RQIA 2H1KA 4GFBA 4IHVA 4JX4A 2XGCA 3VW0A 5EGOA 3HKZN 1LFUP 2R5ZB 3ZQGA 1DU0A 3BT9A 2WV1A 3G1OA 4JX6A 4KWAA 4AC0A 5M3MJ 2LKXA 1FIAA 1WH5A 3VIBA 1MSEC 3HOUJ 3JR9A 3BG9A 5F0FA 4A3BJ 5FKNA 2I10A 1ZK8A 1MH4A 1JUSA 2R5ZA 5EDNA 3CRJA 2REKA 2OPTA 3IH3A 2L9RA 2VKVA 3S15J 3P9TA 3BR2A 5IP7J 4DYCA 1IG7A 5M5YJ 3JRBA 2Y0SN 3ON2A 2X6OA 4AC6A 3BTIA 1ETKA 2L0KA 2JN6A 3K2AA 2E19A 3CMYA 5FLVA 3S1QJ 1JKOC 3A02A 3HDDA 4BY7J 3CCYA 4UUTA 5F08A 3DCFA 2HKUA 4JP0A 1APLC 2VPRA 2AHQA 3GTGJ 1OJLA 1X2NA 5F27A 2N8GA 3GTMJ 3O60A 3IUVA 3OIOA 1W0TA 1RETA 3JRDA 3RH2A 3HE0A 1T33A 2DA5A 4UDSA 3FRQA 1IUFA 3OSGA 3GTKJ 3BR5A 4A3MJ 3ZQLA 1H89C 2G7SA 2KDZA 3EGQA 1H88C 1TWHJ 3G1LA 2FD5A 3TEDA 2Y9ZA 1IGNA 1FEXA 3LHQA 3SDGA 3F1BA 3VVXA 3QKXA 2GBYA 3OSFA 2R93J 3S5RA 2EZKA 3SJMA 5K7HA 1K83J 2UXHA 1UG2A 1GVDA 1GV2A 3LOCA 3BCGA 4BY1J 1O4XA 3BNIA 3VPRA 4M3FA 2MGQA 1GUUA 2FX0A 1MBJA 2LFBA 2WAQN 4GFKA 5FKMA 3B6AA 2XGEA 3Q3SA 2UXIA 5M5XJ 2JJ7A 3JRHA 1PUFB 2GFNA 1GDTA 1ENHA 5F0HA 1HCRA 1Y1WJ 3CDLA 2O9LA 3JSJA 4JL3A 1I50J 2R7ZJ 3QPLA 3JRAA 5FKLA 5J3LA 2O8KA 2NX4A 2DA1A 2LTPA 5HSZA 1JTYA 3HGYA 4QTRA 2DMNA 4I6ZA 3NARA 2OI8A 2K9SA 1PUFA 3PASA 4C3JJ 2DJNA 5K7ZA 2EZHA 1ETYA 2HYJA 1NK2P 1MBKA 4QIWN 4CGRA 2IEKA 1HLVA 3Q0VA 2HDDA 1JKRC 1TWAJ 3S16J 5K58A 2DA3A 4MFDA 4D5FA 1XC5A 2GUHA 1VFCA 3HTJA 5M3FJ 3LSRA 3I4NJ 3PPBA 3ANGA 2DMUA 3LSGA 3NXCA 1TWGJ 5IP9J 3O8GA 2CUEA 2O7OA 4C2MJ 3DEWA 5IP6A 3HOYJ 3S2DJ 1P7IA 5AQCA 1ORKA 3FISA 2G0EA 2MSYA 2JA8J 3TP3A 5DTDA 1UI6A 1XS9A 3GTPJ 2JWTA 4XICA 1XG1A 3CQZJ 2NS8A 1R9TJ 2DMQA 2EBIA 4A3KJ 1D5YA 3IH4A 2UXOA 1WH7A 2YUSA 3VVZA 3GTLJ 4A93J 4MK6A 2V57A 4D7MA 5C3EJ 5F1JA 2DG7A 3VP5A 3AQSA 3HM5A 4XRSA 2ZCXA 2KT0A 1A6IA 3LSJA 1Q1VA 4Y52J 3T6NA 2CJJA 1Z77A 5F04A 1VF9A 5JLXA 5E3MA 5HAWA 2E2IJ 2HOAA 2M8GX 3GZIA 2TCTA 4C3HJ 1Z0XA 4JNNA 4A3GJ 1I3QJ 4A3EJ 1QRYA 1HOMA 3DPJA 3IV5A 3NI7A 4FTHA 3LNQA 4M3GA 3BTCA 4V2GA 2VI6A 2DN0A 1OFCX 2HXIA 2RHAA 3HIMA 1CQTA 2QKOA 2JK3A 2VKEA 5GPCA 3JREA 4ACIA 3UKGA 1H8AC 3RD3A 1BW6A 3HOZJ 3S17J 1B8IB 4MFEA 4NDLA 4Y7NJ 2PZ9A 2ECCA 4M3DA 2MG4A 3VOXA 3NNRA 2DA6A 3HTAA 1LE8B 2X48A 5D18A 1U9NA 3GEUA 1B8IA 3KNWA 1RESA 1VNDA 1FIPA 4GCLA 3EUPA 1IRZA 3BG3A 2OF7A 1ETWA 4EEFG 3VW2A 2ID3A 2IBDA 1JJ8C 2CQXA 4MO7A 1LE8A 2YVEA 2FQ4A 2NVQJ 2K40A 2HXOA 4MLOA 3SFIA 4A3LJ 5CXGA 3PM1A 3WHBA 3B6CA 4LOCA 4XK4A 2WB1N 1WI3A 4JYKA 5FJ8J 2XSDC 5K7FA 2QOPA 2QF7A 4BKXA 1POGA 1IC8A 5IOZA 4M3BA 2O7TA 3HTIA 2Y31A 1I6HJ 4B3AA 1RPWA 2M34A 4S0HB 3L1PA 4JKZA 4BXXJ 3C2BA 1OCTC 5H9TA 2WGBA 2YU9J 2JA7J 2XPUA 2NP3A 2JA5J 3A03A 5EZGA 2DTZA 3Q0WA 4X1EA 2ECBA 4XIDA 2P81A 3BRUA 5E3NA 2L7MP 3BR1A 5E3OA 1NK3P 4A3FJ 2DA4A 4FE4A 5J1UA 4B4CA 2LD5A 2EQRA 2XPWA 4D5CA 4XRMA 3V6GA 2QIBA 4DYRA 1GT0C 4ABZA 1HDDC 2ZOZA 5IYCJ 1SFOJ 2DG8A 2NP5A 2TRTA 3W6VA 3H3VK 1G2HA 1JT6A 2CQQA 1X58A 3RZDJ 3KKDA 2GENA 4A3JJ 2K9QA 1BW5A 2QCOA 3C07A 3FIWA 1RKTA 1HF0A 9ANTA 4J19A 2NS7A 3M4OJ 1JJ6C 1F43A 1U8BA 4NELA 5EF6A 5C44J 1JUMA 1DU6A 2ZCMA 3NRGA 5CXIA 4V2FA 3BTLA 1JKQC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NVT J;  2YVH A;  4M3E A;  3BR6 A;  1FTT A;  4IEJ A;  2NOG A;  4A69 C;  1ZR2 A;  1TWC J;  4YZE A;  3G1M A;  2E1O A;  3NAU A;  2ME0 A;  4BBR J;  1MBH A;  2RAE A;  3GTJ J;  3BQY A;  3K7A J;  5D1R A;  1YRN B;  2EZI A;  1NTC A;  2Y9Y A;  5FKO A;  3FKI J;  1JTX A;  5FHP A;  1HDP A;  4DYQ A;  1U78 A;  4C3I J;  2XDN A;  1GV5 A;  2M2E A;  3TW7 A;  1RR7 A;  1BL0 A;  2QTQ A;  3NPI A;  2DMP A;  3FK6 A;  5IPA A;  1MBG A;  1ZTR A;  2L7F P;  4ME9 A;  5IOY A;  3Q0U A;  1ZR4 A;  1S7E A;  1JKP C;  5IYB J;  4HNV A;  2E2H J;  2Y30 A;  3B81 A;  2JMW A;  3IH2 A;  4B1R A;  1ZKG A;  3BTJ A;  4AUX A;  1AU7 A;  1IDZ A;  2W53 A;  4ICH A;  3S2H J;  2GLO A;  5E3L A;  2MW8 A;  2Y2Z A;  4DW6 A;  2CU7 A;  4GCK A;  3GTQ J;  3HOW J;  3VVY A;  5IYD J;  2G7L A;  4IHY A;  4HKU A;  4PXI A;  3MNL A;  2HQ5 A;  3WHC A;  3HOX J;  2HOT A;  1WGX A;  2HYT A;  5FMP A;  5BNG A;  5EEA A;  1WPK A;  2L7Z A;  1SGM A;  2PBX A;  2FBQ A;  3ZOB A;  1X2M A;  3QQA A;  3BG5 A;  4L62 A;  1RKW A;  2WUI A;  3KKC A;  5DAJ A;  5C4J J;  2CRG A;  1IV6 A;  2H8R A;  5M5W J;  4IHX A;  5FKK A;  3ZQI A;  2LLK A;  4DZJ A;  2VUM J;  1Y1V J;  4MIM A;  3LSP A;  2LP0 A;  3HGG A;  4A3D J;  1JUP A;  2ELK A;  1EF4 A;  3HEF A;  3COL A;  1LFB A;  5D19 A;  2RAS A;  2LR8 A;  4D7N A;  3ZQH A;  2HI3 A;  5FGL A;  3BR0 A;  1UMQ A;  4JX5 A;  5C4Y A;  1MSF C;  2DA2 A;  2IAI A;  1IDY A;  2AO9 A;  5HOD A;  3JRC A;  4GCT A;  3V78 A;  2DMT A;  2LY9 A;  3JRI A;  1ETV A;  2QWT A;  1IJW C;  4RDU A;  3GTO J;  1P7J A;  1U9O A;  1UHS A;  3ZQC A;  3VW1 A;  2PMZ N;  3JRF A;  3F0C A;  3HBL A;  3AQT A;  4DZP A;  1MBE A;  4W97 A;  3KZ9 A;  3E7L A;  2R0Q C;  3BR3 A;  1FTZ A;  3HOV J;  1FJL A;  1B72 B;  4X6A J;  3D1N I;  3BQZ A;  1F36 A;  4IHW A;  3GBG A;  3JRG A;  2G7G A;  2ID6 A;  1ETX A;  2X9D A;  5EZH A;  3BHQ A;  3ON4 A;  4XRS G;  5GPA A;  2D6Y A;  4UUS B;  4I76 A;  2R92 J;  3O8H A;  2HOS A;  1JGG A;  1AHD P;  1MNM C;  2B63 J;  3E7Q A;  2CUF A;  1B72 A;  2IU5 A;  2COB A;  1QVU A;  5GP9 A;  2EH3 A;  2JA6 J;  2ZOY A;  3LJL A;  1K61 A;  3RZO J;  2Q24 A;  3MKL A;  3FK7 A;  4MXM A;  1AKH B;  4NN1 A;  2EZL A;  2XGD A;  1BJZ A;  1W0U A;  2NVX J;  1SAN A;  4UUS A;  2ME6 A;  1ITY A;  3S1N J;  1UI5 A;  3VOK A;  2LK2 A;  1TC3 C;  4W1U A;  1MH3 A;  2OER A;  5HBU A;  4AYB N;  1MBF A;  2ZB9 A;  2YS9 A;  2GM4 A;  5J1Y A;  1AKH A;  4RBO A;  2G3B A;  1T56 A;  3ANP A;  3QPS A;  3S14 J;  5EG0 B;  3HTH A;  5CW8 A;  2R5Y B;  3S1M J;  1A5J A;  2FJ1 A;  5J1R A;  5JLW A;  2UXU A;  3QBM A;  3CJD A;  2F07 A;  3VUQ A;  1E3O C;  1QVT A;  3ZQF A;  5DS9 A;  5EYR A;  3S1R J;  2UXP A;  2W48 A;  4CYC B;  4FCY A;  3TP0 A;  2K9N A;  3TW6 A;  4GFL A;  1JT0 A;  5FLM J;  3PO2 J;  3BJB A;  1BA5 A;  1WCM J;  2M0C A;  5F0C A;  5EG0 A;  2D5V A;  2XRL A;  4M6V A;  1ETQ A;  2R5Y A;  2LVS A;  3PO3 J;  3G56 A;  1TWF J;  4G12 A;  5C4X J;  4CYC A;  1ETO A;  2M9H A;  4A3I J;  3MN2 A;  3A01 B;  1QPI A;  3MVP A;  5EFY A;  3RKQ A;  1ZGW A;  1ZQ3 P;  3G7R A;  2E2J J;  2XB5 A;  4L5E A;  1YRN A;  2XPV A;  3HB9 A;  2DA7 A;  3I4M J;  5EGO B;  3LWJ A;  2NVY J;  2XB0 X;  4BBS J;  4FE7 A;  4QSH A;  3OOU A;  4A3C J;  1VI0 A;  3M3Y J;  1OCP A;  3CWR A;  4AF5 A;  3A01 A;  4FIS A;  2ZCN A;  3H0G J;  3RQI A;  2H1K A;  4GFB A;  4IHV A;  4JX4 A;  2XGC A;  3VW0 A;  5EGO A;  3HKZ N;  1LFU P;  2R5Z B;  3ZQG A;  1DU0 A;  3BT9 A;  2WV1 A;  3G1O A;  4JX6 A;  4KWA A;  4AC0 A;  5M3M J;  2LKX A;  1FIA A;  1WH5 A;  3VIB A;  1MSE C;  3HOU J;  3JR9 A;  3BG9 A;  5F0F A;  4A3B J;  5FKN A;  2I10 A;  1ZK8 A;  1MH4 A;  1JUS A;  2R5Z A;  5EDN A;  3CRJ A;  2REK A;  2OPT A;  3IH3 A;  2L9R A;  2VKV A;  3S15 J;  3P9T A;  3BR2 A;  5IP7 J;  4DYC A;  1IG7 A;  5M5Y J;  3JRB A;  2Y0S N;  3ON2 A;  2X6O A;  4AC6 A;  3BTI A;  1ETK A;  2L0K A;  2JN6 A;  3K2A A;  2E19 A;  3CMY A;  5FLV A;  3S1Q J;  1JKO C;  3A02 A;  3HDD A;  4BY7 J;  3CCY A;  4UUT A;  5F08 A;  3DCF A;  2HKU A;  4JP0 A;  1APL C;  2VPR A;  2AHQ A;  3GTG J;  1OJL A;  1X2N A;  5F27 A;  2N8G A;  3GTM J;  3O60 A;  3IUV A;  3OIO A;  1W0T A;  1RET A;  3JRD A;  3RH2 A;  3HE0 A;  1T33 A;  2DA5 A;  4UDS A;  3FRQ A;  1IUF A;  3OSG A;  3GTK J;  3BR5 A;  4A3M J;  3ZQL A;  1H89 C;  2G7S A;  2KDZ A;  3EGQ A;  1H88 C;  1TWH J;  3G1L A;  2FD5 A;  3TED A;  2Y9Z A;  1IGN A;  1FEX A;  3LHQ A;  3SDG A;  3F1B A;  3VVX A;  3QKX A;  2GBY A;  3OSF A;  2R93 J;  3S5R A;  2EZK A;  3SJM A;  5K7H A;  1K83 J;  2UXH A;  1UG2 A;  1GVD A;  1GV2 A;  3LOC A;  3BCG A;  4BY1 J;  1O4X A;  3BNI A;  3VPR A;  4M3F A;  2MGQ A;  1GUU A;  2FX0 A;  1MBJ A;  2LFB A;  2WAQ N;  4GFK A;  5FKM A;  3B6A A;  2XGE A;  3Q3S A;  2UXI A;  5M5X J;  2JJ7 A;  3JRH A;  1PUF B;  2GFN A;  1GDT A;  1ENH A;  5F0H A;  1HCR A;  1Y1W J;  3CDL A;  2O9L A;  3JSJ A;  4JL3 A;  1I50 J;  2R7Z J;  3QPL A;  3JRA A;  5FKL A;  5J3L A;  2O8K A;  2NX4 A;  2DA1 A;  2LTP A;  5HSZ A;  1JTY A;  3HGY A;  4QTR A;  2DMN A;  4I6Z A;  3NAR A;  2OI8 A;  2K9S A;  1PUF A;  3PAS A;  4C3J J;  2DJN A;  5K7Z A;  2EZH A;  1ETY A;  2HYJ A;  1NK2 P;  1MBK A;  4QIW N;  4CGR A;  2IEK A;  1HLV A;  3Q0V A;  2HDD A;  1JKR C;  1TWA J;  3S16 J;  5K58 A;  2DA3 A;  4MFD A;  4D5F A;  1XC5 A;  2GUH A;  1VFC A;  3HTJ A;  5M3F J;  3LSR A;  3I4N J;  3PPB A;  3ANG A;  2DMU A;  3LSG A;  3NXC A;  1TWG J;  5IP9 J;  3O8G A;  2CUE A;  2O7O A;  4C2M J;  3DEW A;  5IP6 A;  3HOY J;  3S2D J;  1P7I A;  5AQC A;  1ORK A;  3FIS A;  2G0E A;  2MSY A;  2JA8 J;  3TP3 A;  5DTD A;  1UI6 A;  1XS9 A;  3GTP J;  2JWT A;  4XIC A;  1XG1 A;  3CQZ J;  2NS8 A;  1R9T J;  2DMQ A;  2EBI A;  4A3K J;  1D5Y A;  3IH4 A;  2UXO A;  1WH7 A;  2YUS A;  3VVZ A;  3GTL J;  4A93 J;  4MK6 A;  2V57 A;  4D7M A;  5C3E J;  5F1J A;  2DG7 A;  3VP5 A;  3AQS A;  3HM5 A;  4XRS A;  2ZCX A;  2KT0 A;  1A6I A;  3LSJ A;  1Q1V A;  4Y52 J;  3T6N A;  2CJJ A;  1Z77 A;  5F04 A;  1VF9 A;  5JLX A;  5E3M A;  5HAW A;  2E2I J;  2HOA A;  2M8G X;  3GZI A;  2TCT A;  4C3H J;  1Z0X A;  4JNN A;  4A3G J;  1I3Q J;  4A3E J;  1QRY A;  1HOM A;  3DPJ A;  3IV5 A;  3NI7 A;  4FTH A;  3LNQ A;  4M3G A;  3BTC A;  4V2G A;  2VI6 A;  2DN0 A;  1OFC X;  2HXI A;  2RHA A;  3HIM A;  1CQT A;  2QKO A;  2JK3 A;  2VKE A;  5GPC A;  3JRE A;  4ACI A;  3UKG A;  1H8A C;  3RD3 A;  1BW6 A;  3HOZ J;  3S17 J;  1B8I B;  4MFE A;  4NDL A;  4Y7N J;  2PZ9 A;  2ECC A;  4M3D A;  2MG4 A;  3VOX A;  3NNR A;  2DA6 A;  3HTA A;  1LE8 B;  2X48 A;  5D18 A;  1U9N A;  3GEU A;  1B8I A;  3KNW A;  1RES A;  1VND A;  1FIP A;  4GCL A;  3EUP A;  1IRZ A;  3BG3 A;  2OF7 A;  1ETW A;  4EEF G;  3VW2 A;  2ID3 A;  2IBD A;  1JJ8 C;  2CQX A;  4MO7 A;  1LE8 A;  2YVE A;  2FQ4 A;  2NVQ J;  2K40 A;  2HXO A;  4MLO A;  3SFI A;  4A3L J;  5CXG A;  3PM1 A;  3WHB A;  3B6C A;  4LOC A;  4XK4 A;  2WB1 N;  1WI3 A;  4JYK A;  5FJ8 J;  2XSD C;  5K7F A;  2QOP A;  2QF7 A;  4BKX A;  1POG A;  1IC8 A;  5IOZ A;  4M3B A;  2O7T A;  3HTI A;  2Y31 A;  1I6H J;  4B3A A;  1RPW A;  2M34 A;  4S0H B;  3L1P A;  4JKZ A;  4BXX J;  3C2B A;  1OCT C;  5H9T A;  2WGB A;  2YU9 J;  2JA7 J;  2XPU A;  2NP3 A;  2JA5 J;  3A03 A;  5EZG A;  2DTZ A;  3Q0W A;  4X1E A;  2ECB A;  4XID A;  2P81 A;  3BRU A;  5E3N A;  2L7M P;  3BR1 A;  5E3O A;  1NK3 P;  4A3F J;  2DA4 A;  4FE4 A;  5J1U A;  4B4C A;  2LD5 A;  2EQR A;  2XPW A;  4D5C A;  4XRM A;  3V6G A;  2QIB A;  4DYR A;  1GT0 C;  4ABZ A;  1HDD C;  2ZOZ A;  5IYC J;  1SFO J;  2DG8 A;  2NP5 A;  2TRT A;  3W6V A;  3H3V K;  1G2H A;  1JT6 A;  2CQQ A;  1X58 A;  3RZD J;  3KKD A;  2GEN A;  4A3J J;  2K9Q A;  1BW5 A;  2QCO A;  3C07 A;  3FIW A;  1RKT A;  1HF0 A;  9ANT A;  4J19 A;  2NS7 A;  3M4O J;  1JJ6 C;  1F43 A;  1U8B A;  4NEL A;  5EF6 A;  5C44 J;  1JUM A;  1DU6 A;  2ZCM A;  3NRG A;  5CXI A;  4V2F A;  3BTL A;  1JKQ C; 
#chains in the Genus database with same CATH topology
 2W57 A;  3ABK H;  4M3E A;  1RC9 A;  3HSR A;  3GWZ A;  1V4R A;  5CPR B;  2X4H A;  2HKX A;  4L18 B;  4WF2 A;  1N75 A;  1S7O A;  1Y8Q B;  3VYU B;  2P0W A;  4KMU X;  3PQJ A;  3W2V A;  4NBQ A;  1XX5 A;  1WJ5 A;  1TZL A;  2V4J C;  1F4K A;  2IJL A;  4I09 A;  3TDU C;  5H6R A;  3WU2 C;  3GTJ J;  1V54 H;  3K7A J;  2YSR A;  1FNN A;  5FKO A;  4PFP A;  5DUK A;  3FXJ A;  1KQ9 A;  4IRI A;  2XDN A;  2EIK H;  1GV5 A;  2FOK A;  4PJ0 C;  1RR7 A;  1XSX A;  4UVC A;  3OYI A;  3NPI A;  2XF7 A;  3FK6 A;  1MBG A;  3K70 C;  2ZJQ F;  2HKO A;  1ZR4 A;  2X6W A;  2E1N A;  1BR2 A;  2DT6 A;  2AS5 F;  4HNV A;  1K4S A;  3I59 A;  1GHC A;  1XDU A;  4RAZ A;  2FNA A;  1XGM A;  5CVU A;  3B81 A;  2JMW A;  3IH2 A;  4HG2 A;  2B0L A;  3CUQ C;  2CV2 A;  1ZKG A;  2QZ8 A;  2LMD A;  4PGH A;  1L0O C;  2GLO A;  4NUB A;  2VBZ A;  2MW8 A;  3U1K A;  1OR7 C;  1TT0 A;  2L4M A;  3HL2 A;  3GTQ J;  3VVY A;  2NVU B;  4IHY A;  3T8R A;  2F5E A;  2R7S A;  3L00 A;  5FFZ A;  2DAO A;  3CF2 A;  3OOP A;  1VQK I;  2W4S A;  1ZRF A;  2DFH A;  2B7E A;  1YS6 A;  5H20 A;  1VTN C;  1SGM A;  1I5Z A;  2PBX A;  2QBY A;  1UJ8 A;  2AQF A;  1VQ9 I;  1RKW A;  4PFO A;  1KU9 A;  2H94 A;  3E6M A;  2WUI A;  5DAJ A;  3OL3 A;  3DBR B;  1MD0 A;  2H8R A;  5FKK A;  1Z21 A;  3U9G A;  2VUM J;  2KZG A;  2KRH A;  4A3D J;  1X4P A;  2MH2 A;  1UCR A;  2O5R A;  2X51 A;  2Z2S B;  3W3C A;  2V7F A;  2VLA A;  1KU2 A;  3C7J A;  4JX5 A;  2DA2 A;  1IAW A;  2XC7 A;  2M4K A;  3CCV I;  1KU3 A;  3ERM A;  3IAS 2;  4GCT A;  2V1X A;  1D1C A;  4OAY A;  4E4H A;  4RLF A;  3V8J A;  1ETV A;  4KUM A;  4BDY A;  4NQW B;  1BI0 A;  3NQO A;  3ZQC A;  3FXL A;  1T0F A;  2C6Y A;  3RTR A;  3JRF A;  2OV7 A;  3DTI A;  2OCC H;  5E20 A;  4DZP A;  2VT2 A;  2RNG A;  3E7L A;  3KZ9 A;  3GLX A;  5FD5 A;  3BR3 A;  3WE2 A;  4H0E A;  1J59 A;  2HVQ A;  2D45 A;  4RS8 A;  2EB7 A;  3T0Y A;  4U0Y A;  2L4A A;  3GBG A;  3JRG A;  2G7G A;  2HR3 A;  5F64 A;  2X9D A;  5EZH A;  4EM1 A;  4IOC F;  2JQ7 A;  3K4L A;  5JR3 A;  1P6R A;  3BJ6 A;  4UUS B;  2PG4 A;  4I76 A;  3H9J A;  1MNM C;  3RYP A;  2CUF A;  2D2W A;  1VQ6 I;  2EH3 A;  2ZOY A;  3LJL A;  3I55 I;  2DYR H;  2OQR A;  1K61 A;  1EV7 A;  4DBQ A;  2Q24 A;  3MKL A;  4WK8 F;  2EZL A;  1X4O A;  4FET A;  1BJZ A;  1OYY A;  2NVX J;  2KQR A;  4DVY P;  5F6F A;  2ME6 A;  1JI8 A;  1UI5 A;  5KAF C;  1TC3 C;  1YE9 A;  4P55 A;  3CDH A;  1MH3 A;  1XMA A;  2MC4 A;  4AYB N;  1RI7 A;  3HRT A;  2YS9 A;  1FBS A;  1OCC H;  4AIK A;  1WVR A;  4DJA A;  1AKH A;  2FRH A;  1T56 A;  2JZY A;  1R6R A;  2DDA A;  4YFX F;  2V9V A;  5JLW A;  2GXB A;  3SYT A;  2ZCW A;  3I9V 2;  1U8R A;  1HBX G;  3MWM A;  4HQE A;  1JXS A;  3IKT A;  5IT3 A;  3PO2 J;  3CO7 C;  4A6D A;  5GTI C;  1WCM J;  1BA5 A;  5EG0 A;  2R5Y A;  3A1Y A;  2PJR A;  4PSW A;  4NB5 A;  3PO3 J;  2WAE A;  4KFC A;  2K85 A;  4CYC A;  4F92 B;  2M9H A;  3ZQ7 A;  3ZXS A;  3MVP A;  3H5A A;  1PP7 U;  2XB5 A;  2MC3 A;  4V19 K;  2XPV A;  3I4M J;  2RKH A;  1YOV B;  1ZYR F;  4BBS J;  2IGO A;  4WX9 A;  4HNU A;  4WIB A;  3K6G A;  4J00 A;  2WAD A;  3K4M A;  3LAP A;  2WWY A;  1OCP A;  3CWR A;  1EH7 A;  3RQI A;  4PJM A;  2IGK A;  4GFB A;  4IHV A;  2FUG 2;  2R5Z B;  3ZQG A;  3L2W A;  4BGD A;  3BT9 A;  3P7N A;  4M74 A;  1VQ7 I;  1BI3 A;  2JA2 A;  2VJI A;  2R7V A;  2RNJ A;  1FOW A;  5H6Q A;  2M5W A;  1F5T A;  2ISY A;  2VBX A;  1WH5 A;  3VIB A;  4AID A;  4ZYE A;  4CZC A;  3PFY A;  3OR2 C;  2V6E A;  3CJQ B;  2A5Y B;  1MH4 A;  1TNS A;  1JUS A;  3CRJ A;  3IH3 A;  5L3G A;  3OIP A;  1Z3X A;  3O6B B;  2LY1 A;  1O3S A;  1D5V A;  1G8X A;  2V79 A;  2X6O A;  5ILV A;  1ETK A;  4O6J A;  2JN6 A;  4E7H A;  5LFA A;  1JKO C;  3OS2 A;  5D6E A;  3HDD A;  2BY2 A;  3CCY A;  4HZF A;  2RN7 A;  2Y0M A;  5ICF A;  2AHQ A;  3DKW A;  1N25 A;  3IUV A;  1SEU A;  4HSR A;  4UDS A;  2LH9 A;  1AWC A;  4IRG A;  3BR5 A;  3GTK J;  3ZQL A;  1R7J A;  1WJA A;  1S3J A;  1TWH J;  2CW0 F;  4MEY F;  4UB6 C;  3SXY A;  3C1D A;  5ED4 A;  3SDG A;  1IGN A;  1FEX A;  4I0A A;  4XR6 A;  4DBR A;  3S5R A;  1K83 J;  5TGT A;  4Z6Y A;  4N4N B;  1ZGA A;  2K5C A;  3HG9 A;  2UXH A;  1UG2 A;  3BLY A;  3JSP A;  2K02 A;  3KFW X;  3BNI A;  1S29 A;  3VOD A;  2CS3 A;  2OU2 A;  2OZ6 A;  1R22 A;  3VPR A;  1ACI A;  1MMD A;  1XDS A;  3SEZ A;  4ZTF A;  3DKX A;  1JHF A;  2LFB A;  2WA0 A;  3ZPL A;  2Z3Y A;  4LD5 A;  3AL0 C;  3V7C A;  1HA8 A;  1XN7 A;  3ROU A;  3G6E I;  3N97 A;  1FZP B;  1GDT A;  1FP2 A;  4CO8 A;  2EIJ H;  4M6X A;  3CDL A;  2O9L A;  1WJF A;  4BHC A;  4GRI A;  3JRA A;  2O8K A;  1TQM A;  3E5U A;  5J3L A;  5L3B A;  2HEO A;  4UNO A;  2IS4 A;  2VPL A;  2R7O A;  5HSZ A;  1JTY A;  3F9K A;  2DMN A;  3KYC B;  2OI8 A;  2K9S A;  3PAS A;  4C3J J;  2DJN A;  5K7Z A;  3ML6 A;  2E34 A;  2EZH A;  1ETY A;  2HYJ A;  1ZH5 A;  1MBK A;  5DUI A;  2HDD A;  1HLV A;  4CH7 A;  3WU1 B;  1Z9C A;  2GQQ A;  3S16 J;  1OPC A;  4BDZ A;  2DA3 A;  5K58 A;  1O7L A;  2ZBK A;  4KIB A;  2A2F X;  2E5N A;  2V1D A;  4LK0 F;  2DMU A;  3NXC A;  1TWG J;  3O8G A;  2BZT A;  5DYM A;  1H0M A;  5AQC A;  3I58 A;  4LLN A;  1ORK A;  2G7U A;  4G7H F;  2MSY A;  3P9K A;  2JA8 J;  1Z67 A;  2PMU A;  3MKY B;  2FBH A;  5EEH A;  4EQQ A;  1BR1 A;  3OS1 A;  3RJP A;  2M87 A;  2NS8 A;  4C2U A;  3EPZ A;  2EBI A;  3TL4 X;  3F22 A;  4BQQ A;  3IH4 A;  3ECH A;  3SHF A;  1WH7 A;  3CCE I;  3VTI A;  2ELH A;  5EEG A;  3GTL J;  4MK6 A;  2GA2 A;  1PYV A;  3FXO A;  5F1J A;  2GZW A;  1B6A A;  2RQP A;  4Y52 J;  3LSJ A;  1Q1V A;  5IT9 K;  2XF6 A;  1QZZ A;  2IXS A;  3NRV A;  5HS7 A;  3R61 A;  4GCV A;  2EIN H;  1VF9 A;  3GLL A;  5JLX A;  2E2I J;  3FZV A;  2HOA A;  2M8G X;  3QYE A;  2IGM A;  2PI0 A;  1T2K A;  2FBK A;  1Y8R B;  2LY2 A;  3HUG B;  5FGM A;  1MW7 A;  2QKM B;  4A3G J;  1I3Q J;  1ONV A;  3HHH A;  1ERD A;  5IT9 Z;  4FTH A;  3E97 A;  5LGT A;  4CYD A;  4KDP A;  2RHA A;  2L5Q A;  1SMY F;  4AU7 A;  4HNT A;  1DP7 P;  2JK3 A;  3SFZ A;  2Z16 A;  3RD3 A;  1LDJ A;  2KZV A;  1MJ9 A;  5E1X A;  1V5E A;  2PZ9 A;  2HNH A;  2Z1D A;  4CCO A;  1Z7U A;  3CCJ I;  3L2U A;  1A35 A;  5KK1 A;  2DA6 A;  1WI9 A;  1ZAO A;  4KT5 C;  3ZMS A;  1B8I A;  1STZ A;  2VXZ A;  3HSE A;  4GCL A;  3EUP A;  3ULQ B;  1E3H A;  3BG3 A;  1ZLJ A;  3RPQ A;  1RZ4 A;  2DYS H;  1K6O A;  4ZYH A;  1UST A;  2HGC A;  2QKL B;  2X6X A;  3FHN A;  2ZSI B;  3TQN A;  1SVM A;  4MO7 A;  1LE8 A;  3IP4 B;  4NC7 A;  2VE9 A;  1KON A;  2HXO A;  3QOD A;  4CZZ A;  4A3L J;  5CXG A;  3PM1 A;  4RB2 C;  4ETS A;  2CV1 A;  1KGS A;  5F1R A;  2WB1 N;  1WI3 A;  5FJ8 J;  2XSD C;  2QOP A;  1Z3Y A;  1POG A;  4JK1 X;  2JRM A;  2HYF A;  5J8C A;  4M3B A;  1I1S A;  2JUC A;  3AG3 H;  5DCF A;  3DTK A;  4HF1 A;  3BJA A;  4JKZ A;  1YJW I;  2STW A;  2QQ8 A;  4H4K C;  2QQA A;  5L3E A;  2IP2 A;  2XPU A;  2YU9 J;  1OKR A;  2DTZ A;  3ZMV A;  3QYB A;  4XMY A;  1MIJ A;  2ESH A;  4XLC A;  4XID A;  4U7D A;  2P81 A;  3BRU A;  4F91 B;  3J7Z I;  2DA4 A;  5J1U A;  3R0A A;  5K5O A;  1SFE A;  3CLO A;  2IPQ X;  3BG6 A;  2D1V A;  4D5C A;  2R7D A;  4FQG A;  3OYL A;  1Y56 A;  1D8J A;  1M1E B;  2E60 A;  4E7Z A;  2QQB A;  2STT A;  3S32 A;  5AIQ A;  4ABZ A;  2ZOZ A;  1SAU A;  5J4Y A;  2ETH A;  2CW8 A;  1IRX A;  4Y17 A;  3DLL F;  2CQQ A;  2WC2 A;  1X58 A;  5FRO A;  3RZD J;  2ZJP F;  1VQ8 I;  3KKD A;  2OZU A;  2YPR A;  1R5I D;  2K9Q A;  2V1N A;  3BC8 A;  2QCO A;  3F6V A;  1QBJ A;  4CHU A;  3KPH A;  1BW5 A;  3DFG A;  2R3S A;  9ANT A;  2KRC A;  2EV0 A;  1U8B A;  4P9F A;  3KIO A;  2GIV A;  4M9Z A;  1JUM A;  3NRG A;  2AQE A;  3MZ8 A;  2HQN A;  4HX8 A;  5B66 C;  1FWZ A;  1ZAR A;  2Q2E A;  3E5Q A;  2YVH A;  3BR6 A;  1FTT A;  4D1Q A;  4EJT A;  3I5U A;  2ZO4 A;  4A69 C;  1B59 A;  1ZR2 A;  1TWC J;  2M0M A;  4HX7 A;  4N9I A;  2Z9O A;  2E1O A;  3T8T A;  4IO9 F;  2ME0 A;  4BBR J;  1MBH A;  4ESJ A;  3BQY A;  3CCM I;  5D1R A;  1YRN B;  2W25 A;  3FKI J;  1JTX A;  1HDP A;  2WY8 Q;  4C3I J;  3TOB A;  5CVR A;  5LLQ A;  3KLO A;  5DM7 F;  1H9T A;  3TW7 A;  2BW3 A;  2DMP A;  5FO5 A;  3JAM K;  5J4V A;  4ZDO A;  3RCO A;  4PCQ A;  1X19 A;  1ZTR A;  2XF5 A;  1R4M B;  5IOY A;  2MLK A;  1R71 A;  4PZJ A;  5HVQ C;  1S7E A;  4ENN A;  5IYB J;  2ZC2 A;  2MA3 A;  2BHY A;  2L54 A;  3E6D A;  3BTJ A;  4NHJ A;  3M07 A;  1AU7 A;  2W53 A;  4YIF A;  3JAM Z;  5DV5 A;  5D8K B;  5E3L A;  3CDI A;  2QBY B;  2QGU A;  2VT3 A;  2CWE A;  1S72 I;  1H9G A;  2KFD A;  4XQF A;  3HOW J;  5IYD J;  2G7L A;  4HKU A;  3SWH A;  3KX2 A;  2HQ5 A;  3K1N A;  2DCE A;  3S93 A;  1WGX A;  3LMM A;  1U2W A;  1BIB A;  5BNG A;  1WPK A;  2ADU A;  1P4A A;  3N05 A;  4D0P A;  4M6Y A;  1WJD A;  3D5L A;  3K8P C;  3FF5 A;  3C18 A;  5C4J J;  2XAF A;  5KCM A;  3BP8 A;  5M5W J;  2VE8 A;  3MD2 A;  2ZFU A;  2LLK A;  4DZJ A;  4MIM A;  5LHI A;  2LP0 A;  4Y4R A;  1HKS A;  5GTH C;  3HEF A;  3COL A;  4PSX A;  4WXC A;  1UG0 A;  1R1T A;  2EK5 A;  4EJU A;  3ZQH A;  5FGL A;  3BR0 A;  1UMQ A;  2KIU A;  2P5K A;  1IDY A;  3JRC A;  1BC8 C;  3J7A O;  3MKW B;  1BJA A;  2V9P A;  3LAJ A;  1U5T B;  3TO9 A;  2KIQ A;  3H1C A;  2XV4 S;  3VW1 A;  4LG3 A;  3QPH A;  2PMZ N;  5GAG J;  4CCM A;  1FYM A;  2G9W A;  1NG7 A;  1IRF A;  2DOF A;  3HBL A;  5GAE J;  1LVK A;  4BXF A;  2ICW G;  5D4R A;  2VON A;  4R1H A;  3CZ6 A;  3HOV J;  1FJL A;  1W36 C;  1V3F A;  2E7X A;  2JVG A;  2JUG A;  1A04 A;  4X6A J;  2UUZ A;  1F36 A;  5A2Q K;  2VQH A;  4ESF A;  5ICC A;  4I01 A;  3ON4 A;  1XD7 A;  4XRS G;  2M4G A;  2OD5 A;  1QQI A;  4IVN A;  2J5P A;  2IW5 A;  1JGG A;  3RPU A;  1K6Y A;  5LEK A;  3EQL F;  4B8X A;  2GXG A;  2F4O B;  5A2Q Z;  2F5C A;  4MXM A;  1AKH B;  4NN1 A;  2PQ8 A;  2XGD A;  2M7B A;  3WOD F;  3EUA A;  3F8B A;  1XGN A;  2HTJ A;  4E7S A;  5CJ9 A;  1MMG A;  2DOD A;  1MKM A;  4RGR A;  2ZB9 A;  2A3S A;  2YX7 A;  1YIJ I;  1PVE A;  2GM4 A;  1I39 A;  3K9T A;  5GAD J;  2A05 A;  1NG6 A;  4Y3O A;  4HA8 A;  3HTH A;  2VQC A;  5EG0 B;  4ZYD A;  2R5Y B;  2E1M C;  4LB6 B;  2FJ1 A;  4L9N A;  4U87 A;  5DM6 F;  2PJR B;  3CJD A;  1MDM A;  4IKF A;  1E3O C;  3QBM A;  3VUQ A;  1SC7 A;  3ESW B;  4CYC B;  2OUM A;  3HOS A;  2RGV A;  5HLT A;  3EDP A;  1WRJ A;  2M0C A;  2D5V A;  2XRL A;  4M6V A;  2XAJ A;  3IUO A;  2ZJ2 A;  3R60 A;  2AXL A;  1E17 A;  1LDD A;  1S9H A;  3QU6 A;  4A3I J;  3MN2 A;  4U88 A;  4CUG A;  1YW7 A;  3D5R C;  4HDV A;  5L3D A;  5CQG A;  1ZGW A;  1ZQ3 P;  3S8P A;  2E35 A;  3EYI A;  1YRN A;  1WJB A;  2GAU A;  1X1P A;  4ZDL A;  2ZXH A;  2KL4 A;  1LB2 A;  3KEQ A;  2XB0 X;  2DFF A;  3K10 A;  2EV5 A;  2K86 A;  1EH8 A;  4FE7 A;  4LIU A;  2LBF B;  3WG7 H;  3GZ5 A;  4RB3 C;  1MMS A;  1QNT A;  3QPT A;  2WV0 A;  3A01 A;  2HWV A;  3DBL B;  3JTG A;  2OBP A;  2XGC A;  3BZC A;  3OS0 A;  1BIA A;  3HKZ N;  1DQU A;  1G4D A;  2BXY A;  2BVM A;  3G1O A;  4KWA A;  4JOM A;  3H3Z A;  2BHZ A;  4M72 A;  2R7X A;  1FIA A;  3U21 A;  3A0H C;  2M3A A;  5TRD A;  4P5O A;  2NAZ A;  1VZ0 A;  4L9J A;  2BXZ A;  2KJB A;  4F55 A;  4LLG F;  2OPT A;  1QPM A;  4KN4 X;  3S15 J;  3ABU A;  3P9T A;  1F9N A;  5LGU A;  3BR2 A;  5IP7 J;  5L3C A;  1YLF A;  1TQP A;  4UV9 A;  1IG7 A;  2Y0S N;  3IKV A;  1ZGJ A;  4M9S A;  4L5J A;  2XDV A;  1XSV A;  3DTE A;  2EV6 A;  3OYK A;  2NNY A;  4HDU A;  4FT8 A;  1OQY A;  4GYG A;  3MEX A;  3DP7 A;  4JP0 A;  1APL C;  5LBQ A;  4BHP A;  3GTG J;  2HPI A;  1E2X A;  2XRN A;  1IN7 A;  4P1W A;  5KAI C;  4XOP A;  1ZEL A;  3HE0 A;  4LIV A;  1O3R A;  1IXC A;  3FM3 A;  3OSG A;  2MAB A;  3LL7 A;  1U5T A;  2G7S A;  4I0B A;  3H36 A;  3VSK A;  5BMZ A;  3VSL A;  5B1B H;  2KIM A;  4RM3 A;  4ON0 A;  2ESN A;  3IWF A;  3DV8 A;  3BCG A;  1HSJ A;  4BY1 J;  3QOE A;  1O4X A;  3OV8 A;  2ZXJ A;  4BJ5 C;  4R79 A;  4UVA A;  3W2W A;  2QA4 I;  2EA2 A;  1GVJ A;  4MNU A;  3DU6 A;  4WWC A;  2WAQ N;  1MBJ A;  2W24 A;  3M1E A;  1R36 A;  3I54 A;  1DPR A;  1TBX A;  3Q3S A;  4I7H A;  1O57 A;  3ASN H;  3FXR A;  1UEL B;  3JRH A;  2GFN A;  5H2F C;  4XLH A;  3PFI A;  1ENH A;  1HCR A;  1Y1W J;  4L0Z B;  3JSJ A;  4JL3 A;  1J0R A;  2R7Z J;  3ONQ A;  1Y0U A;  5FKL A;  3GME A;  4AIJ A;  2DA1 A;  2D1H A;  2ZSH B;  3HGY A;  3CUQ B;  4QTR A;  2QUF A;  3HIF A;  1W4M A;  4UXN A;  3DF8 A;  3DXJ F;  3MFK A;  3QRF F;  3E1S A;  3RKX A;  4YFN F;  3K4K A;  3ABL H;  1NK2 P;  1B9N A;  3KYD B;  4LB5 A;  3M8F A;  1SFK A;  1JKR C;  2FF4 A;  1SMT A;  3DEE A;  2PBI A;  3OYD A;  3PIP F;  3ZGK A;  2P6T A;  2VKH A;  4JQF A;  5HOO A;  1W5S A;  2HZD A;  4AD9 A;  3D5S C;  3ANG A;  4PK4 A;  4A0Y A;  3N4M A;  2X1C A;  1ODD A;  3KP7 A;  5IP9 J;  2CUE A;  2Y69 H;  1W1W E;  2H8W A;  3FIS A;  2OJE D;  3FHZ A;  4S05 A;  1RR8 C;  3GTP J;  1LVA A;  4IOA F;  3OYE A;  1XG1 A;  3CD6 I;  3CQZ J;  4HYE A;  1R9T J;  2K3P A;  4XKB A;  2K4J A;  2F6C A;  3ZMT A;  2EFW A;  3SZG A;  1PDN C;  1OYI A;  4KJZ A;  2VL8 A;  3VP5 A;  1LEB A;  4XRS A;  2LYC A;  5B3S H;  1A6I A;  3T6N A;  3GXO A;  1P4X A;  2FNP A;  2QEN A;  1FYL A;  5DEQ A;  3BJO A;  3GCM A;  3HXL A;  4Z2Y A;  4A0X A;  5HAW A;  3GZI A;  1UFM A;  2LBF A;  3BRO A;  1QHH D;  4HAM A;  3CCQ I;  2R7W A;  1PUE E;  2EIM H;  2FU4 A;  3LFU A;  4C3H J;  2RC4 A;  2R7Q A;  5JFR A;  3RKY A;  3HHG A;  4A3E J;  1QRY A;  3NS4 A;  2UXX A;  4BJ6 C;  1YQA A;  3KE2 A;  1FLI A;  3F8M A;  2V1U A;  3K4C A;  4Q5S F;  4OIP F;  4V2G A;  2VI6 A;  1OFC X;  2HXI A;  3SZP A;  3FBN B;  3HIM A;  2QKO A;  5J6X A;  3JRE A;  1V5G A;  1P4W A;  3Q9S A;  3ZMU A;  1BW6 A;  1T8I A;  3S17 J;  2XUB A;  2FSW A;  1B8I B;  3L09 A;  5DDG A;  4Y7N J;  2KHM A;  3WTX C;  1Z6R A;  3V4G A;  1R5H A;  4M3D A;  2MG4 A;  1TW2 A;  3L2R A;  1SAX A;  5CQE A;  4EM0 B;  1W7P A;  3V8L A;  1G3S A;  4LIT A;  3SZT A;  2YR2 A;  5ICG A;  4X0G A;  3HTA A;  1LE8 B;  5KNL A;  3OYH A;  1BI2 A;  3ZP5 A;  3K0L A;  3FXQ A;  3ZRG A;  2NRA C;  2HVR A;  1OMI A;  3KNW A;  3E3V A;  1ZRD A;  2L7K A;  1ETW A;  2ACJ A;  2GOM A;  3KET A;  2ID3 A;  4FX4 A;  2Q1Z B;  2K40 A;  3KP4 A;  4LK1 F;  3WE3 A;  3SFI A;  4EJV A;  3EUH C;  3WHB A;  1XMK A;  4LOC A;  4ZYG A;  1TLH B;  3FDY A;  4JYK A;  1I1G A;  2W7N A;  3GW2 A;  2L01 A;  1ZG5 A;  3KZI C;  1IN5 A;  4IQ4 A;  1D3Y A;  3JTH A;  5FRM A;  2IA2 A;  2O7T A;  3VOE A;  1JGS A;  3J81 K;  2KDO A;  1I6H J;  1DUX C;  5JHF A;  1YW8 A;  4S0H B;  1MGT A;  1T6S A;  3H9Q A;  3C2B A;  1OCT C;  2EFQ A;  2JA7 J;  2DDB A;  2OCE A;  5HLI A;  3OY9 A;  1HQC A;  1WFX A;  3AG1 H;  2B1E A;  1LKX A;  5E3N A;  4BS9 A;  2L7M P;  3BR1 A;  4KIT B;  3QAH A;  2HPM A;  1TNT A;  1SVL A;  1VQN I;  1MMN A;  2M1B A;  4FE4 A;  4HLX A;  1QZE A;  1P9Q C;  5TIS C;  3H9G A;  1FP1 D;  1ON1 A;  2QIB A;  2A07 F;  3H92 A;  3H0D A;  1Y0N A;  2PMZ A;  3E5X A;  4G8X A;  1HDD C;  4HX4 A;  3AKZ A;  4PDK A;  2TRT A;  2ZKZ A;  3AG2 H;  4IZZ A;  3PSF A;  1G2H A;  1OCO H;  1VQ4 I;  3MQ0 A;  4A3J J;  2DT5 A;  2CFX A;  5BS6 A;  1MJB A;  2Q2E B;  5JVG F;  3FIW A;  4U9L A;  4LG0 A;  1TQI A;  5JI6 A;  4RM2 A;  4J19 A;  1HF0 A;  1F43 A;  3F23 A;  3CUQ A;  2BV6 A;  3K1P A;  1X3W B;  4EV0 A;  2KMU A;  2NXN B;  1OR7 A;  3F3X A;  1CF7 A;  5B1A H;  2NVT J;  3I56 I;  4F7Z A;  2IS2 A;  3MAJ A;  1BOB A;  3S2D J;  3ZR8 X;  3DLA A;  3RPU D;  4LFU A;  5DD8 A;  4YZE A;  3SDB A;  4CCL A;  3KP5 A;  5FD6 A;  2BW3 B;  2X1E A;  5E1W A;  1P92 A;  1WZ2 A;  3GEZ A;  3NAU A;  1RUO A;  2F5F A;  4BAC A;  4RB0 A;  4DNC A;  4B44 A;  4XN3 A;  3ZN1 A;  4YFK F;  3EYY A;  1T98 A;  1FSH A;  2EZI A;  2K9M A;  2Y9Y A;  1FBQ A;  4MHG A;  4DIQ A;  3P5J A;  5FHP A;  4F52 A;  4PUS A;  3I53 A;  4DYQ A;  1WSU A;  1X1A A;  2XVC A;  1IV8 A;  3I0T A;  2HOE A;  2ZFW A;  4IQJ A;  3P9C A;  6PAX A;  5IPA A;  4PJN A;  1A31 A;  2L7F P;  3F8C A;  2ZME C;  4Q47 A;  1YG2 A;  4AVP A;  3GVA A;  1FYK A;  2GOX B;  1WJC A;  1JKP C;  3OYB A;  1LNW A;  1R4N B;  3DPU A;  2IA1 A;  4KIG A;  2LF8 A;  1R58 A;  1FT9 A;  4BYY A;  4HLY A;  1ZLK A;  4B1R A;  4AUX A;  2OTL I;  2BVL A;  3FBI B;  1EJ9 A;  1IUY A;  2Y2Z A;  1EKE A;  4DW6 A;  5D5U B;  2CU7 A;  4HV5 A;  4GCK A;  2ZJR F;  4PXI A;  2O0Y A;  1YS7 A;  4DGW B;  4KYW A;  2P7C B;  5EEA A;  2L7Z A;  3LQQ A;  3ZN0 A;  1WJE A;  2PX9 A;  2FBQ A;  3ZOB A;  3QQA A;  3BG5 A;  3AL0 B;  4AIH A;  4ZJZ A;  4GDF A;  2CRG A;  1IV6 A;  4AVZ A;  4L5I A;  3ERE D;  5JVT A;  4GO1 A;  1QHG A;  1EH6 A;  5AIP A;  2OAZ A;  3H3U A;  3ZQI A;  3LSP A;  2MLG A;  3HGG A;  5DD4 A;  2COM A;  2ELK A;  1KQ8 A;  4BQO A;  2O3F A;  2X1D A;  1T38 A;  1LFB A;  5D19 A;  4L9T A;  2LR8 A;  4D7N A;  2CUZ A;  4XN0 A;  1RNL A;  2ISZ A;  2H09 A;  3OYF A;  5K5Q A;  2L9V A;  5HOD A;  2AO9 A;  3LFK A;  2Y75 A;  3L2C A;  1QZY A;  3LWF A;  2XGX A;  3V78 A;  1Q1H A;  3LA7 A;  1YW9 A;  3JRI A;  2JT1 A;  3F6O A;  2EFP A;  2L9S A;  3HTU A;  5GAH J;  4BQA A;  2LRD A;  5HS8 A;  2RDP A;  3GFL A;  5HDG A;  1Z91 A;  5HNF A;  1ZG1 A;  1RIO H;  4UB8 C;  3F0C A;  2JPB A;  3AQT A;  1K4T A;  1MBE A;  5FB2 A;  4HV6 A;  2BYV E;  4QLC U;  3OIQ A;  3TKY A;  4KIC A;  4MQV A;  4CSW A;  2R0Q C;  3CC7 I;  2JVH A;  2XAG A;  3WTT C;  1FTZ A;  3VYT B;  2L3D A;  3BQZ A;  2A69 F;  1IW7 F;  1D0X A;  1IN6 A;  2R7U A;  3H5N A;  3COA C;  3FX3 A;  2R7R A;  4HF2 A;  3BHQ A;  5GPA A;  2D6Y A;  2IT0 A;  3JW4 A;  3V8K A;  4OIO F;  3O8H A;  1D1A A;  3S3N A;  1S5L C;  5EJC A;  2V9K A;  4EGZ A;  1B72 A;  4HRI A;  4PGG A;  2CQK A;  2COB A;  2F2E A;  1KZH A;  3O2P E;  2JA6 J;  4I2O A;  2JSP A;  2EFN A;  3LA2 A;  3FK7 A;  1GXP A;  1F1Z A;  4IRV A;  4O3M A;  2I5U A;  1SAN A;  2HDW A;  2DK8 A;  3DPL C;  1KYZ A;  3DEU A;  2WTE A;  1ITY A;  2CW7 A;  3S1N J;  2VB6 A;  5BPD A;  3VOK A;  1MDM B;  2CUJ A;  4MTD A;  3G71 I;  5BOX A;  4Y15 A;  1UHW A;  1QGP A;  2VOO A;  3VYR B;  1VQM I;  3KCC A;  1VQO I;  2NOJ B;  2G3B A;  1Z6T A;  4HOB A;  2CFO A;  4XNF A;  2Z33 A;  3MZH A;  1R00 A;  3ANP A;  3KP6 A;  3S14 J;  4A12 A;  2RV8 A;  2LKP A;  1LQ1 A;  5CW8 A;  3S1M J;  1A5J A;  3CTA A;  2F07 A;  4ANJ A;  1MMA A;  3CJT B;  4FX0 A;  1QVT A;  4OMZ A;  3ZQF A;  2LSO A;  1DDN A;  1HW1 A;  5EYR A;  3S1R J;  3BPX A;  2W48 A;  4FCY A;  3PJR A;  5FLX K;  3TP0 A;  2K9N A;  1P2F A;  3WTS C;  1D0Y A;  4HF0 A;  2L9N A;  3HOT A;  3KEY A;  1JT0 A;  3PSI A;  5FLM J;  3BJB A;  3WTU C;  5F0C A;  2E7W A;  3TO6 A;  4AYB A;  1KA8 A;  5K5R A;  1XPX A;  1PP8 F;  2DXI A;  2LVS A;  4FAS D;  4K2E A;  3L2V A;  1TWF J;  4YG2 F;  4J01 A;  4G7Z F;  4G12 A;  5C4X J;  4WXD A;  4IHT A;  3ABM H;  3VYS B;  5FLX Z;  3A01 B;  1RUN A;  2MD5 A;  2E2J J;  4EJW A;  2P8T A;  2Z5U A;  3HB9 A;  2DA7 A;  1J75 A;  1MND A;  2NVY J;  4E6K G;  5LEJ A;  5J40 A;  4QSH A;  3IHU A;  1JE8 A;  3OOU A;  2LOO A;  2EJR A;  4A3C J;  1A36 A;  2DFI A;  3M3Y J;  2OTJ I;  4HBL A;  4C30 A;  1YJN I;  2LKS A;  2ZCN A;  3H0G J;  3D0S A;  5CLS A;  4Y13 A;  2RQQ A;  2H1K A;  3VW0 A;  2M8E A;  5EGO A;  1LFU P;  2QVO A;  5DCM B;  1DU0 A;  3F8F A;  2WV1 A;  3EUH A;  4JX6 A;  3VDX A;  1RRJ A;  4C9Y A;  1K79 A;  1X1C A;  5M3M J;  2LKX A;  4EJO A;  3PQK A;  3WTY C;  3HTS B;  4AM3 A;  1MSE C;  4IL6 C;  4I02 A;  3S3O A;  4XRF A;  3CMM A;  5F0F A;  4A3B J;  1G3T A;  2HTS A;  2DU9 A;  2ZXW H;  2K9L A;  4KNY A;  2DW4 A;  1IZ1 A;  2L9R A;  3M9A A;  2VKV A;  4KT6 A;  4U9N A;  2VOD A;  2LRE A;  4DYC A;  3HPH A;  2O61 A;  4G6D A;  2VJ5 A;  1Y6I A;  3GZ6 A;  3OYC A;  4A5N A;  5M5Y J;  3JRB A;  4Q4Z F;  2CQ7 A;  3VB2 A;  2A5W A;  3BTI A;  1HW2 A;  1J2X A;  3ECO A;  2L0K A;  3CME I;  2F48 A;  2HQR A;  3K2A A;  1JHH A;  2L2O A;  3NWS A;  3C3W A;  2X0L A;  5F08 A;  1UZC A;  3DCF A;  1B4A A;  3K4J A;  4MTE A;  2VKD A;  2VPR A;  3JCU C;  4M9X A;  4YEL A;  3GTM J;  5F27 A;  2N8G A;  3RI4 A;  1FOX A;  3O60 A;  3OIO A;  4O5V A;  3WGG A;  3JRD A;  1T33 A;  4PJL A;  1ZN2 A;  1S7A A;  3HPG A;  4ZC3 A;  4ENM A;  2MBF A;  4A3M J;  3J7A Y;  4ZH4 F;  2YX4 A;  2KDZ A;  3L2Q A;  4F93 B;  2DOA A;  3EGQ A;  2P6S A;  3G1L A;  2Y9Z A;  3LHQ A;  1MJA A;  1SFX A;  3F1B A;  3VVX A;  3QKX A;  3OSF A;  4IRH A;  2R93 J;  1W7P D;  1QA6 A;  2EZK A;  2VAS A;  5K7H A;  3SJM A;  5HDK A;  3CJR B;  1N77 A;  1GV2 A;  3LOC A;  3O3K A;  4R8H A;  1ZRE A;  3U2R A;  1T95 A;  1T08 B;  4M3F A;  2XAQ A;  2F5V A;  2LNB A;  2MGQ A;  1GUU A;  2FX0 A;  2H6C A;  2OC6 A;  1O3T A;  3BY6 A;  1BI1 A;  2RVC A;  5FKM A;  3B6A A;  2XGE A;  2CYY A;  4CCK A;  2MYS A;  1WQ2 A;  4UVB A;  1B9M A;  1HXD A;  5F0H A;  2GWR A;  2GA1 A;  1TW3 A;  2LC2 A;  1I50 J;  5JHU A;  3LQR A;  2GIZ A;  2NX4 A;  2LTP A;  3CCS I;  4I6Z A;  3NAR A;  5ILU A;  2BY1 A;  2VC1 A;  1PUF A;  4HPQ A;  3U1D A;  4OIR F;  4CGR A;  3AFH A;  4U0W A;  2IEK A;  3Q0V A;  4OWR B;  4RAY A;  3HYI A;  4BUP A;  4IXA A;  4MFD A;  4D5F A;  2P7V B;  2HYG D;  2JSC A;  2PN6 A;  2VN2 A;  5K1Y A;  3LSR A;  3I4N J;  1OCR H;  1U0J A;  2HQA A;  2KJC A;  2O7O A;  3ASO H;  4XLF A;  3DEW A;  4XON A;  4C2M J;  2FBI A;  5IP6 A;  1ZG3 A;  3HOY J;  5E18 F;  2KIF A;  3KEO A;  3ISP A;  3CLQ A;  2FOW A;  2IS1 A;  3TP3 A;  2BY3 A;  5D4S A;  2QSG X;  5DTD A;  2DLL A;  1UI6 A;  2XAU A;  2BOL A;  1ON2 A;  2JWT A;  3NWT A;  4XIC A;  4NNJ A;  3OR1 C;  3K70 D;  2PMH A;  4A3K J;  4Q48 A;  2X6Y A;  1D5Y A;  4EGY A;  1O3Q A;  3OYN A;  2O03 A;  3VVZ A;  1J7K A;  4A93 J;  1R49 A;  4RAG A;  3CMA I;  4BAY A;  2DG7 A;  1D1B A;  3MCZ A;  4LMY A;  3AQS A;  3HM5 A;  4IPA A;  2DI3 A;  2QEX I;  2ZCX A;  1IO2 A;  1R1U A;  2CJJ A;  3X2Q H;  1Z77 A;  4LJZ F;  1EA3 A;  2TDX A;  5F04 A;  3GX4 X;  5E3M A;  2W1O A;  3M8E A;  3TMO A;  1QU3 A;  2A68 F;  5CKT A;  2TCT A;  1XB4 A;  3RDI A;  5ERI A;  2Q0O A;  2QLZ A;  3BZ6 A;  2XHK A;  4JNN A;  1LPQ A;  4HW0 A;  3H35 A;  3IV5 A;  3NI7 A;  1OYW A;  5FFX A;  3EET A;  1IN4 A;  5LRR A;  3LNQ A;  2E1C A;  4A2U A;  2KP6 A;  4Y33 A;  2FE3 A;  4M3G A;  3OWT A;  5DCM A;  1W7P B;  3AAF A;  1CQT A;  3GFJ A;  2Q8K A;  5GPC A;  2CO5 A;  4IHS A;  2B3W A;  3OYJ A;  3UKG A;  4ACI A;  2QM3 A;  1H8A C;  3WTZ A;  3ZMD A;  2I8D A;  4D9J A;  3HOZ J;  4QPO A;  1FC3 A;  2Z99 A;  2DT7 B;  4MFE A;  4RMN A;  1AA7 A;  1J5Y A;  2DO7 A;  2J5O A;  3HC7 A;  3DKY A;  4OOI A;  1ULY A;  2BEO A;  3VOX A;  4CCJ A;  5E8G A;  1YIT I;  3KLN A;  4N0B A;  1VQP I;  1V55 H;  4XL9 A;  1IRZ A;  1GXQ A;  1CGP A;  3A4C A;  5HNH A;  3S3M A;  2VXD A;  1TTY A;  4C2T A;  2KIS A;  1JJ8 C;  2CQX A;  5IY5 H;  4KMF A;  2YVE A;  4V2F A;  3HRU A;  2L02 A;  1YJ9 I;  2OQG A;  3B6C A;  3J80 K;  4EAT A;  2A61 A;  2E1M B;  1FY7 A;  3HJE A;  3BWG A;  3V42 A;  4BKX A;  4CCN A;  1D0Z A;  1LUJ B;  3OYM A;  1FMV A;  1KYW A;  3HTI A;  4B09 A;  5H9T A;  2ZNY A;  2JA5 J;  3A03 A;  3J80 Z;  1D8K A;  4MQ9 F;  4XLN F;  5HLG A;  1WHU A;  4X1E A;  4BEH A;  2JTV A;  2XAH A;  2DBB A;  2ZXI A;  2WB1 A;  1Y39 A;  5D5W B;  1NK3 P;  1DGR M;  4A3F J;  3RYR A;  5KVR A;  2LD5 A;  2UZK A;  2XPW A;  1Z05 A;  4BL0 B;  4XRM A;  3OYA A;  3WG9 A;  2YU3 A;  4LG0 B;  4OIQ F;  1DP3 A;  5IYC J;  1SFO J;  2WAF A;  4EMS A;  3WTV C;  1SD7 A;  2IVM A;  1SD6 A;  2EIL H;  2NP5 A;  3WGH A;  1K78 B;  5LGN A;  2W85 A;  3WTW C;  1JT6 A;  4XOT A;  3OL4 A;  1CF7 B;  3J7Y J;  2P5L C;  1IRG A;  4U7B A;  3T5X A;  1BC7 C;  1ZRC A;  3M4O J;  4BNC A;  1JJ6 C;  2RRE A;  2R4G A;  1I6X A;  3HSF A;  3V7R A;  4NEL A;  3M8J A;  4ZYA A;  4A0Z A;  5EF6 A;  5C44 J;  2XRO A;  1DU6 A;  4RGU A;  2PLY A;  2QSH X;  2W84 A;  3T1B A;  2E36 A;  2NYX A;  4IEJ A;  2NOG A;  3LSK A;  3BDD A;  4ENJ A;  1WKM A;  1REP C;  4BE0 A;  4IF4 A;  3L7W A;  5CVV A;  2PFV A;  3G1M A;  1YX3 A;  4I98 B;  2LG4 A;  1I27 A;  2RAE A;  1YI2 I;  4RGS A;  1NTC A;  2DQR A;  4AWX B;  4B48 A;  1U78 A;  1YIO A;  3MKZ A;  2M2E A;  2QYO A;  1BL0 A;  1SD4 A;  2QTQ A;  1UHM A;  4TV7 A;  1YX5 A;  1HKQ A;  4XBF A;  2NS0 A;  2XKO A;  4ME9 A;  3Q0U A;  4F3Q A;  3TOA A;  4PJJ A;  1ZHF A;  2E2H J;  2Y30 A;  3NEU A;  3B02 A;  4WCG A;  1IXR C;  3CF5 F;  1W5C C;  2H27 A;  3LSI A;  2R7T A;  1IDZ A;  4ICH A;  3SQN A;  1LEA A;  3F21 A;  3S2H J;  1LDK B;  5FRN A;  2IA0 A;  3C2H A;  1TP4 A;  2ELJ A;  3K1M A;  5LHH A;  3H5R A;  3GUD A;  4ZTJ A;  3A0B C;  4UUV A;  3E6B A;  2LDU A;  3I3L A;  3WHC A;  3HOX J;  2HOT A;  3MNL A;  4RAF A;  2HYT A;  2FMY A;  5FMP A;  5D5X B;  4E7K A;  1PJR A;  3FMR A;  2DPD A;  3ABT A;  4A6E A;  3K2Z A;  1E0E A;  1X2M A;  3MMY B;  4JBA A;  4XLP F;  2QWW A;  2H1L A;  4ESB A;  2O6G E;  4L62 A;  2IS6 A;  3KKC A;  1J09 A;  3R0J A;  3B73 A;  4IHX A;  4G9Y A;  2FML A;  1Y1V J;  1KQ0 A;  2X85 A;  1JUP A;  1EF4 A;  1R5G A;  1FOK A;  3GO5 A;  1X1B A;  2RAS A;  4L9V A;  1SD5 A;  1FSE A;  4EM2 A;  2HI3 A;  1OCZ H;  3VWB A;  5C4Y A;  3G3Z A;  2IAI A;  1MSF C;  2FEZ A;  4G7O F;  3BG7 A;  1G3W A;  3IRR A;  1N78 A;  3FWE A;  5E17 F;  2DMT A;  4BH9 A;  2LY9 A;  2QWT A;  1IJW C;  3HZJ A;  1G6N A;  4RDU A;  3GTO J;  1P7J A;  2ZNZ A;  4OU0 A;  4WXH A;  5L3F A;  1U9O A;  4ITV A;  3G73 A;  1UHS A;  3R6S A;  3P9I A;  2EPF A;  1XCB A;  3RSN A;  2KPM A;  3I71 A;  4W97 A;  2Y48 A;  3ZQQ A;  2FQ3 A;  3R4K A;  3UNG C;  1X3U A;  1OIS A;  4OMY A;  4NQW A;  5J8F A;  1U3E M;  3J81 Z;  1B72 B;  3D1N I;  4IHW A;  3TDZ C;  4A5M A;  4XKV A;  3QP6 A;  1I3A A;  1WWX A;  2ID6 A;  1ETX A;  4FHT A;  3TO7 A;  3CO6 C;  3SEQ A;  2R92 J;  1LFP A;  4CXF A;  2HOS A;  3IL2 A;  3Q5F A;  1AHD P;  2B63 J;  3E7Q A;  5LRS A;  2IU5 A;  3QP5 A;  5KHD A;  2YVX A;  1QVU A;  3PNY A;  5GP9 A;  3CP2 A;  4BXU A;  1UAA A;  4UY8 I;  3RZO J;  5LHG A;  3CCR I;  2EWN A;  2DFE A;  3CP8 A;  2IGN A;  4YRV A;  4UUS A;  2VJJ A;  3WGI A;  1GLN A;  1W0U A;  3A2K A;  4YIR X;  1S8N A;  3W2A A;  1K78 A;  2PJP A;  2LK2 A;  1TL8 A;  3W6J B;  2F4I A;  2UWM A;  1W5T A;  2K7L A;  4W1U A;  2OER A;  5HBU A;  4E7I A;  5LD2 C;  1MBF A;  2DOE A;  5J1Y A;  1TT5 B;  4RBO A;  1HST A;  2F4M B;  2P5V A;  3QPS A;  3GFM A;  1VQL I;  4OD4 A;  2UXU A;  5J1R A;  2CG4 A;  4XLE A;  3PL8 A;  4ZDP A;  3TGN A;  5DS9 A;  1AOY A;  2GXA A;  4IJA A;  1O7F A;  2UXP A;  3PNV A;  2VQG A;  3AG4 H;  3BPV A;  4KIS A;  5J47 A;  2HFH A;  3TW6 A;  4GFL A;  2CMP A;  4XM3 A;  3BZK A;  4EVI A;  2CQN A;  1ETQ A;  1G3Y A;  4B47 A;  3L9F A;  2UXN A;  2XAS A;  3G56 A;  2MFZ A;  4N4O B;  5E8I A;  1ETO A;  4E70 A;  4M71 A;  4M73 A;  1QPI A;  5HS9 A;  3RKQ A;  5EFY A;  2A6E F;  1XCV A;  1R1V A;  3G7R A;  3K4B A;  2WBM A;  3QYF A;  4L5E A;  5D6F A;  3ZMZ A;  2VOP A;  3PUF A;  5EGO B;  2CH0 A;  3LWJ A;  3QOP A;  1DPU A;  3F72 A;  4L0Y B;  3RKW A;  4YII A;  2QSF X;  1BR4 A;  1VI0 A;  3FKJ A;  1LJ9 A;  4AF5 A;  2HS5 A;  4FIS A;  3QWL A;  1YYV A;  4I99 C;  1FOY A;  4JX4 A;  3LA3 A;  2V6C A;  1FX7 A;  3KYL A;  2W00 A;  1MZB A;  3DU5 A;  3FXM A;  4AC0 A;  3I64 A;  3BOQ A;  4NC6 A;  1A6Q A;  3ELK A;  1FBU A;  3HOU J;  3JR9 A;  3BG9 A;  3CC4 I;  5FKN A;  2I10 A;  1ZK8 A;  5BQT A;  4B3X A;  3E6C C;  3RIR A;  2R5Z A;  5EDN A;  2REK A;  1Z7L A;  5D8L B;  3GFI A;  4BQN A;  1XGO A;  4HQM A;  4RA2 A;  3HKZ A;  2HDC A;  3GZN B;  3CCU I;  4DOZ A;  3ON2 A;  2XIG A;  4AC6 A;  4UHT A;  4XSZ F;  3Q9V A;  3S2W A;  2VQL A;  2E19 A;  3CMY A;  4LGW A;  5FLV A;  3S1Q J;  1IN8 A;  1HC8 A;  4BU2 A;  3A02 A;  4G94 A;  4BY7 J;  2AXT C;  4UV8 A;  4UUT A;  4BE2 A;  4N9H A;  2HKU A;  2CGP A;  5CYV A;  3FM5 A;  1OJL A;  1X2N A;  3KP3 A;  1G59 A;  1SFU A;  1W0T A;  3RH2 A;  1RET A;  3GF2 A;  2DA5 A;  3FRQ A;  1IUF A;  2Y0S A;  1E3P A;  5HDN A;  1XGS A;  2FA5 A;  1H89 C;  1H88 C;  2BGC A;  2FD5 A;  3TED A;  3W6K B;  4ZZD A;  2GBY A;  2KLO A;  4ZZL A;  4HEA 2;  4KA4 A;  4CGZ A;  1NHA A;  5D5V B;  1MNE A;  2VJ4 A;  1GVD A;  3G2B A;  1FPQ A;  1USS A;  2P4W A;  4II2 A;  2K4B A;  2JPC A;  1BOA A;  4XSX F;  2DQL A;  2BE5 F;  4IX7 A;  4GFK A;  1X3Z B;  2UXI A;  5M5X J;  4G6Q A;  4XKW A;  2JJ7 A;  1PUF B;  1B1B A;  4YEJ A;  4CDG A;  2ZME B;  4MEX F;  2ZY9 A;  2LF7 A;  2K27 A;  3CC2 I;  3UR3 C;  3QPL A;  2M30 A;  3JSO A;  3PUB A;  4C2M A;  1T0F C;  2WAQ A;  3HRS A;  3FXK A;  2DK5 A;  4XLA A;  4RGX A;  4QIW N;  3BCA A;  4QWQ A;  5E79 C;  4MGR A;  4OAZ A;  1HKT A;  1TWA J;  1U5T C;  1J9I A;  1XC5 A;  2V26 A;  1VFC A;  2XSJ C;  5M3F J;  2GUH A;  2EFO A;  3HTJ A;  1HW5 A;  2VIX A;  4E7J A;  3PPB A;  2MD0 A;  3LSG A;  3CUO A;  3CES A;  2K3F A;  3FXU A;  5ICE A;  4S04 A;  1R23 A;  1P7I A;  2FXA A;  4LLL A;  2G0E A;  5CVI A;  2F5D A;  3FMQ A;  4B43 A;  5E1Z B;  1XS9 A;  1S6L A;  4GYI A;  2FJI 1;  2DMQ A;  2UXO A;  1YTY A;  3VEP A;  2YUS A;  3DWL E;  3HRM A;  3TBI A;  3OMY A;  1C0W A;  2V57 A;  4D7M A;  5C3E J;  1OLT A;  2EA4 A;  2MH9 A;  2BBY A;  2KT0 A;  3I59 B;  1BM9 A;  2HU9 A;  1SVO A;  1XTA A;  4GGG A;  5CVJ A;  3I4P A;  4BHB A;  4E7L A;  3OYG A;  4II3 A;  3LSM A;  1Z1D A;  4QPQ A;  3DPT A;  1BN5 A;  1Z0X A;  1YFH A;  2O8X A;  1YO5 C;  3KZZ A;  2CV0 A;  4XOR A;  1HOM A;  3DPJ A;  2XKP A;  1XSD A;  3FMS A;  4RB1 A;  3BTC A;  2DN0 A;  2CSO A;  3K69 A;  2VKE A;  2IRF G;  3HUG A;  4P96 A;  2QQ9 A;  2HZT A;  5B5E C;  3CCL I;  1X1D A;  3CJN A;  4NDL A;  3RQ4 A;  1VQ5 I;  2ECC A;  3IWZ A;  3VFZ A;  3PIO F;  2VBW A;  2DJI A;  3K4N A;  3DQV C;  1UB9 A;  2PEX A;  3BCB A;  3NNR A;  2PFB A;  4ENK A;  2X48 A;  2M7A A;  3LSH A;  5D18 A;  1U9N A;  2A6H F;  3GEU A;  4KN7 X;  4XKC A;  2NNN A;  1RES A;  2W82 A;  1VND A;  1FIP A;  1IXS B;  3DBH B;  2OF7 A;  4BJT A;  3F8N A;  4EEF G;  2JRT A;  4NC8 A;  3VW2 A;  2IBD A;  2E5Z A;  1U6G A;  3IRQ A;  2FQ4 A;  2KKO A;  3M1C A;  2NVQ J;  2DPU A;  4MLO A;  2OA4 A;  4XK4 A;  4OIN F;  5K7F A;  4KIF A;  2QF7 A;  1W36 D;  3G4S I;  1T39 A;  1IC8 A;  5IOZ A;  4BEH B;  1BBY A;  2KRF A;  2Y31 A;  3WU0 A;  2DTR A;  4B3A A;  4HST A;  3ZCO A;  1QO0 D;  1RPW A;  2M34 A;  3E0J B;  3L1P A;  3LST A;  2H6B A;  4BXX J;  5AON A;  5BPI A;  3KP2 A;  2WGB A;  4CA0 A;  2NP3 A;  5EZG A;  3C2G A;  3MZY A;  1KU7 A;  4DQ2 A;  3Q0W A;  3PNT A;  2ECB A;  5HLH A;  1XMX A;  2UV1 A;  1NH3 A;  4U0V A;  5ILS A;  5E3O A;  2B9S A;  2WY7 Q;  4B4C A;  2EQR A;  4OD5 A;  4RLQ A;  3V6G A;  2BY0 A;  3IAM 2;  4DYR A;  4CIC A;  3V7S A;  4ASN A;  1K7A A;  1GT0 C;  2A6T A;  2DG8 A;  5TJJ A;  3QU3 A;  3IC7 A;  4BE1 A;  2G7H A;  1V5F A;  3W6V A;  3H3V K;  3M7G A;  2R7F A;  2VC0 A;  2GEN A;  2ZME A;  1DGW Y;  3EUK L;  3REO A;  3C07 A;  3KZY A;  2VBY A;  1RKT A;  2NS7 A;  2E71 A;  4GXO A;  2M45 A;  1L3L A;  4P9U A;  3GYH X;  1IF1 A;  2HVS A;  2ZCM A;  1FMW A;  1YHQ I;  5CXI A;  4G6T B;  3BTL A;  1JKQ C; 
#chains in the Genus database with same CATH homology
 2NVT J;  2YVH A;  4M3E A;  3BR6 A;  1FTT A;  4IEJ A;  2NOG A;  4A69 C;  1ZR2 A;  1TWC J;  4YZE A;  3G1M A;  2E1O A;  3NAU A;  2ME0 A;  4BBR J;  1MBH A;  2RAE A;  3GTJ J;  3BQY A;  3K7A J;  5D1R A;  1YRN B;  2EZI A;  1NTC A;  2Y9Y A;  5FKO A;  3FKI J;  1JTX A;  5FHP A;  1HDP A;  4DYQ A;  1U78 A;  4C3I J;  2XDN A;  1GV5 A;  2M2E A;  3TW7 A;  1RR7 A;  1BL0 A;  2QTQ A;  3NPI A;  2DMP A;  3FK6 A;  5IPA A;  1MBG A;  1ZTR A;  2L7F P;  4ME9 A;  5IOY A;  3Q0U A;  1ZR4 A;  1S7E A;  1JKP C;  5IYB J;  4HNV A;  2E2H J;  2Y30 A;  3B81 A;  2JMW A;  3IH2 A;  4B1R A;  1ZKG A;  3BTJ A;  4AUX A;  1AU7 A;  1IDZ A;  2W53 A;  4ICH A;  3S2H J;  2GLO A;  5E3L A;  2MW8 A;  2Y2Z A;  4DW6 A;  2CU7 A;  4GCK A;  3GTQ J;  3HOW J;  3VVY A;  5IYD J;  2G7L A;  4IHY A;  4HKU A;  4PXI A;  3MNL A;  2HQ5 A;  3WHC A;  3HOX J;  2HOT A;  1WGX A;  2HYT A;  5FMP A;  5BNG A;  5EEA A;  1WPK A;  2L7Z A;  1SGM A;  2PBX A;  2FBQ A;  3ZOB A;  1X2M A;  3QQA A;  3BG5 A;  4L62 A;  1RKW A;  2WUI A;  3KKC A;  5DAJ A;  5C4J J;  2CRG A;  1IV6 A;  2H8R A;  5M5W J;  4IHX A;  5FKK A;  3ZQI A;  2LLK A;  4DZJ A;  2VUM J;  1Y1V J;  4MIM A;  3LSP A;  2LP0 A;  3HGG A;  4A3D J;  1JUP A;  2ELK A;  1EF4 A;  3HEF A;  3COL A;  1LFB A;  5D19 A;  2RAS A;  2LR8 A;  4D7N A;  3ZQH A;  2HI3 A;  5FGL A;  3BR0 A;  1UMQ A;  4JX5 A;  5C4Y A;  1MSF C;  2DA2 A;  2IAI A;  1IDY A;  2AO9 A;  5HOD A;  3JRC A;  4GCT A;  3V78 A;  2DMT A;  2LY9 A;  3JRI A;  1ETV A;  2QWT A;  1IJW C;  4RDU A;  3GTO J;  1P7J A;  1U9O A;  1UHS A;  3ZQC A;  3VW1 A;  2PMZ N;  3JRF A;  3F0C A;  3HBL A;  3AQT A;  4DZP A;  1MBE A;  4W97 A;  3KZ9 A;  3E7L A;  2R0Q C;  3BR3 A;  1FTZ A;  3HOV J;  1FJL A;  1B72 B;  4X6A J;  3D1N I;  3BQZ A;  1F36 A;  4IHW A;  3GBG A;  3JRG A;  2G7G A;  2ID6 A;  1ETX A;  2X9D A;  5EZH A;  3BHQ A;  3ON4 A;  4XRS G;  5GPA A;  2D6Y A;  4UUS B;  4I76 A;  2R92 J;  3O8H A;  2HOS A;  1JGG A;  1AHD P;  1MNM C;  2B63 J;  3E7Q A;  2CUF A;  1B72 A;  2IU5 A;  2COB A;  1QVU A;  5GP9 A;  2EH3 A;  2JA6 J;  2ZOY A;  3LJL A;  1K61 A;  3RZO J;  2Q24 A;  3MKL A;  3FK7 A;  4MXM A;  1AKH B;  4NN1 A;  2EZL A;  2XGD A;  1BJZ A;  1W0U A;  2NVX J;  1SAN A;  4UUS A;  2ME6 A;  1ITY A;  3S1N J;  1UI5 A;  3VOK A;  2LK2 A;  1TC3 C;  4W1U A;  1MH3 A;  2OER A;  5HBU A;  4AYB N;  1MBF A;  2ZB9 A;  2YS9 A;  2GM4 A;  5J1Y A;  1AKH A;  4RBO A;  2G3B A;  1T56 A;  3ANP A;  3QPS A;  3S14 J;  5EG0 B;  3HTH A;  5CW8 A;  2R5Y B;  3S1M J;  1A5J A;  2FJ1 A;  5J1R A;  5JLW A;  2UXU A;  3QBM A;  3CJD A;  2F07 A;  3VUQ A;  1E3O C;  1QVT A;  3ZQF A;  5DS9 A;  5EYR A;  3S1R J;  2UXP A;  2W48 A;  4CYC B;  4FCY A;  3TP0 A;  2K9N A;  3TW6 A;  4GFL A;  1JT0 A;  5FLM J;  3PO2 J;  3BJB A;  1BA5 A;  1WCM J;  2M0C A;  5F0C A;  5EG0 A;  2D5V A;  2XRL A;  4M6V A;  1ETQ A;  2R5Y A;  2LVS A;  3PO3 J;  3G56 A;  1TWF J;  4G12 A;  5C4X J;  4CYC A;  1ETO A;  2M9H A;  4A3I J;  3MN2 A;  3A01 B;  1QPI A;  3MVP A;  5EFY A;  3RKQ A;  1ZGW A;  1ZQ3 P;  3G7R A;  2E2J J;  2XB5 A;  4L5E A;  1YRN A;  2XPV A;  3HB9 A;  2DA7 A;  3I4M J;  5EGO B;  3LWJ A;  2NVY J;  2XB0 X;  4BBS J;  4FE7 A;  4QSH A;  3OOU A;  4A3C J;  1VI0 A;  3M3Y J;  1OCP A;  3CWR A;  4AF5 A;  3A01 A;  4FIS A;  2ZCN A;  3H0G J;  3RQI A;  2H1K A;  4GFB A;  4IHV A;  4JX4 A;  2XGC A;  3VW0 A;  5EGO A;  3HKZ N;  1LFU P;  2R5Z B;  3ZQG A;  1DU0 A;  3BT9 A;  2WV1 A;  3G1O A;  4JX6 A;  4KWA A;  4AC0 A;  5M3M J;  2LKX A;  1FIA A;  1WH5 A;  3VIB A;  1MSE C;  3HOU J;  3JR9 A;  3BG9 A;  5F0F A;  4A3B J;  5FKN A;  2I10 A;  1ZK8 A;  1MH4 A;  1JUS A;  2R5Z A;  5EDN A;  3CRJ A;  2REK A;  2OPT A;  3IH3 A;  2L9R A;  2VKV A;  3S15 J;  3P9T A;  3BR2 A;  5IP7 J;  4DYC A;  1IG7 A;  5M5Y J;  3JRB A;  2Y0S N;  3ON2 A;  2X6O A;  4AC6 A;  3BTI A;  1ETK A;  2L0K A;  2JN6 A;  3K2A A;  2E19 A;  3CMY A;  5FLV A;  3S1Q J;  1JKO C;  3A02 A;  3HDD A;  4BY7 J;  3CCY A;  4UUT A;  5F08 A;  3DCF A;  2HKU A;  4JP0 A;  1APL C;  2VPR A;  2AHQ A;  3GTG J;  1OJL A;  1X2N A;  5F27 A;  2N8G A;  3GTM J;  3O60 A;  3IUV A;  3OIO A;  1W0T A;  1RET A;  3JRD A;  3RH2 A;  3HE0 A;  1T33 A;  2DA5 A;  4UDS A;  3FRQ A;  1IUF A;  3OSG A;  3GTK J;  3BR5 A;  4A3M J;  3ZQL A;  1H89 C;  2G7S A;  2KDZ A;  3EGQ A;  1H88 C;  1TWH J;  3G1L A;  2FD5 A;  3TED A;  2Y9Z A;  1IGN A;  1FEX A;  3LHQ A;  3SDG A;  3F1B A;  3VVX A;  3QKX A;  2GBY A;  3OSF A;  2R93 J;  3S5R A;  2EZK A;  3SJM A;  5K7H A;  1K83 J;  2UXH A;  1UG2 A;  1GVD A;  1GV2 A;  3LOC A;  3BCG A;  4BY1 J;  1O4X A;  3BNI A;  3VPR A;  4M3F A;  2MGQ A;  1GUU A;  2FX0 A;  1MBJ A;  2LFB A;  2WAQ N;  4GFK A;  5FKM A;  3B6A A;  2XGE A;  3Q3S A;  2UXI A;  5M5X J;  2JJ7 A;  3JRH A;  1PUF B;  2GFN A;  1GDT A;  1ENH A;  5F0H A;  1HCR A;  1Y1W J;  3CDL A;  2O9L A;  3JSJ A;  4JL3 A;  1I50 J;  2R7Z J;  3QPL A;  3JRA A;  5FKL A;  5J3L A;  2O8K A;  2NX4 A;  2DA1 A;  2LTP A;  5HSZ A;  1JTY A;  3HGY A;  4QTR A;  2DMN A;  4I6Z A;  3NAR A;  2OI8 A;  2K9S A;  1PUF A;  3PAS A;  4C3J J;  2DJN A;  5K7Z A;  2EZH A;  1ETY A;  2HYJ A;  1NK2 P;  1MBK A;  4QIW N;  4CGR A;  2IEK A;  1HLV A;  3Q0V A;  2HDD A;  1JKR C;  1TWA J;  3S16 J;  5K58 A;  2DA3 A;  4MFD A;  4D5F A;  1XC5 A;  2GUH A;  1VFC A;  3HTJ A;  5M3F J;  3LSR A;  3I4N J;  3PPB A;  3ANG A;  2DMU A;  3LSG A;  3NXC A;  1TWG J;  5IP9 J;  3O8G A;  2CUE A;  2O7O A;  4C2M J;  3DEW A;  5IP6 A;  3HOY J;  3S2D J;  1P7I A;  5AQC A;  1ORK A;  3FIS A;  2G0E A;  2MSY A;  2JA8 J;  3TP3 A;  5DTD A;  1UI6 A;  1XS9 A;  3GTP J;  2JWT A;  4XIC A;  1XG1 A;  3CQZ J;  2NS8 A;  1R9T J;  2DMQ A;  2EBI A;  4A3K J;  1D5Y A;  3IH4 A;  2UXO A;  1WH7 A;  2YUS A;  3VVZ A;  3GTL J;  4A93 J;  4MK6 A;  2V57 A;  4D7M A;  5C3E J;  5F1J A;  2DG7 A;  3VP5 A;  3AQS A;  3HM5 A;  4XRS A;  2ZCX A;  2KT0 A;  1A6I A;  3LSJ A;  1Q1V A;  4Y52 J;  3T6N A;  2CJJ A;  1Z77 A;  5F04 A;  1VF9 A;  5JLX A;  5E3M A;  5HAW A;  2E2I J;  2HOA A;  2M8G X;  3GZI A;  2TCT A;  4C3H J;  1Z0X A;  4JNN A;  4A3G J;  1I3Q J;  4A3E J;  1QRY A;  1HOM A;  3DPJ A;  3IV5 A;  3NI7 A;  4FTH A;  3LNQ A;  4M3G A;  3BTC A;  4V2G A;  2VI6 A;  2DN0 A;  1OFC X;  2HXI A;  2RHA A;  3HIM A;  1CQT A;  2QKO A;  2JK3 A;  2VKE A;  5GPC A;  3JRE A;  4ACI A;  3UKG A;  1H8A C;  3RD3 A;  1BW6 A;  3HOZ J;  3S17 J;  1B8I B;  4MFE A;  4NDL A;  4Y7N J;  2PZ9 A;  2ECC A;  4M3D A;  2MG4 A;  3VOX A;  3NNR A;  2DA6 A;  3HTA A;  1LE8 B;  2X48 A;  5D18 A;  1U9N A;  3GEU A;  1B8I A;  3KNW A;  1RES A;  1VND A;  1FIP A;  4GCL A;  3EUP A;  1IRZ A;  3BG3 A;  2OF7 A;  1ETW A;  4EEF G;  3VW2 A;  2ID3 A;  2IBD A;  1JJ8 C;  2CQX A;  4MO7 A;  1LE8 A;  2YVE A;  2FQ4 A;  2NVQ J;  2K40 A;  2HXO A;  4MLO A;  3SFI A;  4A3L J;  5CXG A;  3PM1 A;  3WHB A;  3B6C A;  4LOC A;  4XK4 A;  2WB1 N;  1WI3 A;  4JYK A;  5FJ8 J;  2XSD C;  5K7F A;  2QOP A;  2QF7 A;  4BKX A;  1POG A;  1IC8 A;  5IOZ A;  4M3B A;  2O7T A;  3HTI A;  2Y31 A;  1I6H J;  4B3A A;  1RPW A;  2M34 A;  4S0H B;  3L1P A;  4JKZ A;  4BXX J;  3C2B A;  1OCT C;  5H9T A;  2WGB A;  2YU9 J;  2JA7 J;  2XPU A;  2NP3 A;  2JA5 J;  3A03 A;  5EZG A;  2DTZ A;  3Q0W A;  4X1E A;  2ECB A;  4XID A;  2P81 A;  3BRU A;  5E3N A;  2L7M P;  3BR1 A;  5E3O A;  1NK3 P;  4A3F J;  2DA4 A;  4FE4 A;  5J1U A;  4B4C A;  2LD5 A;  2EQR A;  2XPW A;  4D5C A;  4XRM A;  3V6G A;  2QIB A;  4DYR A;  1GT0 C;  4ABZ A;  1HDD C;  2ZOZ A;  5IYC J;  1SFO J;  2DG8 A;  2NP5 A;  2TRT A;  3W6V A;  3H3V K;  1G2H A;  1JT6 A;  2CQQ A;  1X58 A;  3RZD J;  3KKD A;  2GEN A;  4A3J J;  2K9Q A;  1BW5 A;  2QCO A;  3C07 A;  3FIW A;  1RKT A;  1HF0 A;  9ANT A;  4J19 A;  2NS7 A;  3M4O J;  1JJ6 C;  1F43 A;  1U8B A;  4NEL A;  5EF6 A;  5C44 J;  1JUM A;  1DU6 A;  2ZCM A;  3NRG A;  5CXI A;  4V2F A;  3BTL A;  1JKQ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...