1JUMA

Crystal structure of the multidrug binding transcriptional repressor qacr bound to the natural drug berberine
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
186
structure length
186
Chain Sequence
NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKKEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural mechanisms of QacR induction and multidrug recognition.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription
molecule keywords HYPOTHETICAL TRANSCRIPTIONAL REGULATOR IN QACA 5'REGION
total genus 78
structure length 186
sequence length 186
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2001-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1jumA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 1jumA02
2CQQA 3BR5A 2DA2A 1ETKA 4AC0A 5E3MA 1ZKGA 2ME6A 2K9SA 1JKRC 3CCYA 2K9QA 1T56A 3S1QJ 4BBRJ 1JTXA 1VI0A 1HOMA 2EZLA 2O7TA 3V6GA 1POGA 2GLOA 1BW6A 4GCTA 4NELA 1JJ8C 3RZOJ 5DS9A 2JA7J 4MFEA 1TC3C 4YZEA 3B6CA 5EG0A 5FGLA 3BR2A 3P9TA 4L5EA 2E2JJ 2M8GX 1HDPA 3CDLA 5C44J 5K7HA 5E3OA 1HF0A 3JRDA 5EF6A 1B72A 2ID6A 2GENA 3IUVA 1ZR2A 1R9TJ 1UG2A 4XRMA 1WPKA 4M3BA 2CU7A 2IEKA 3LSJA 2CUFA 2ZCXA 2RASA 2DA1A 4JX5A 2REKA 5CXIA 2XGEA 3WHCA 4DW6A 4J19A 5JLWA 2IAIA 2COBA 3CWRA 3G56A 5M5XJ 2M0CA 3NI7A 3JRAA 3SDGA 3PASA 3MNLA 3JRFA 1WCMJ 3RD3A 3E7QA 1MBHA 2QWTA 2ECBA 4V2GA 2XDNA 2Y31A 2O9LA 5HODA 3CMYA 4Y52J 2B63J 2JA5J 2OF7A 2HQ5A 1A5JA 2H8RA 4JL3A 4A3GJ 4A3KJ 2YUSA 3KKCA 3BQZA 3JRIA 2UXPA 2Y0SN 3RZDJ 3BNIA 3QBMA 2JA8J 1JTYA 4A3CJ 4M6VA 1VFCA 1I6HJ 3NARA 1FTZA 4X6AJ 3S15J 5FHPA 2MGQA 1JUPA 2HXOA 4A3LJ 1ETOA 3IV5A 2XB5A 3HGYA 2VKVA 4A3DJ 2N8GA 1WI3A 3LSPA 1F43A 3VUQA 3HTHA 2XRLA 3AQTA 4XICA 2MW8A 1Q1VA 3K7AJ 3ANGA 2CJJA 2DA3A 3BG9A 5J3LA 3BTLA 4Y7NJ 5M5WJ 4KWAA 2VUMJ 2AO9A 2YS9A 1QPIA 4I6ZA 3MVPA 5DTDA 2Q24A 2Y2ZA 1BA5A 4LOCA 1JKOC 5K58A 2DN0A 1NK3P 2G3BA 2WV1A 5FKKA 1NTCA 3VOKA 1TWHJ 4UUSB 2PZ9A 3AQSA 1SANA 3D1NI 2X6OA 2XPUA 2OI8A 2VI6A 2LP0A 2AHQA 2JA6J 2R93J 1LE8A 4JYKA 2LR8A 4DYQA 4JKZA 3LOCA 2HXIA 3WHBA 1Y1WJ 2HDDA 1DU6A 1A6IA 2NS8A 1TWGJ 2LY9A 2V57A 2NOGA 2NVXJ 2QF7A 2R7ZJ 2GFNA 5EDNA 5IPAA 3LSRA 1MSEC 3HGGA 5HBUA 2QIBA 5J1YA 4MFDA 4XK4A 1IDYA 3BG5A 1AU7A 3NRGA 1MBGA 2L7ZA 1K83J 1VF9A 1RESA 1GDTA 2UXHA 3COLA 4MLOA 2O8KA 3K2AA 2GBYA 3Q0VA 3SFIA 3S1MJ 4XIDA 3JRBA 1GV2A 2O7OA 4JP0A 1IV6A 3GTGJ 3OSGA 2HOAA 2R0QC 2D5VA 1HLVA 3QPSA 2ZCMA 5IYBJ 2R5YA 3TP3A 3GEUA 1U78A 3JSJA 3UKGA 1GVDA 2MSYA 3PO3J 2ZB9A 5M3MJ 3HIMA 3VW0A 2E19A 5BNGA 1P7IA 2ZCNA 3S1NJ 2OERA 2JN6A 2LD5A 1LE8B 1D5YA 1P7JA 4GCKA 2G7LA 4X1EA 2EBIA 2WGBA 3PM1A 2NX4A 2XB0X 3VP5A 1JGGA 1IGNA 3GZIA 3ZQIA 4DYRA 1QVTA 1JJ6C 1XG1A 2EZKA 2H1KA 2ME0A 3FK6A 2GM4A 2R92J 3CJDA 2DA6A 2R5YB 4ABZA 3EUPA 2EZHA 3HOVJ 3M3YJ 4BXXJ 3HTIA 5D19A 1MH3A 1S7EA 2W48A 4C2MJ 2NVTJ 1ZK8A 5E3NA 2DA7A 3HOWJ 2HI3A 5EZGA 1FJLA 4XRSG 2YVEA 3FIWA 3A03A 3DCFA 4C3HJ 2KT0A 5EFYA 4HKUA 5C4YA 1LFUP 5IP9J 5GP9A 1WH5A 2L7FP 4M3GA 2HYTA 3M4OJ 2UXIA 1FIAA 3FISA 2HOTA 5FJ8J 3HBLA 2UXOA 1TWCJ 2NP5A 3HTJA 4UUTA 1AKHA 1XC5A 3NXCA 1OJLA 1U9NA 1F36A 2VKEA 1I50J 3BCGA 4B4CA 1ZTRA 2EQRA 2DTZA 2RAEA 5F04A 2XGDA 3VVXA 1APLC 4BBSJ 3VOXA 3O8HA 5GPCA 5FKMA 2F07A 2QTQA 3BG3A 3F1BA 4FISA 3LWJA 4UUSA 9ANTA 1ETWA 5DAJA 3Q0WA 1HCRA 3DEWA 1YRNB 4V2FA 4W97A 3BTIA 1IDZA 2LLKA 2LKXA 2E2IJ 3QKXA 1X2MA 3Q0UA 2YU9J 3S17J 3JRHA 2YVHA 3G1MA 4QIWN 2EH3A 3O8GA 4BY7J 3G1LA 5EYRA 5F0CA 4ACIA 1I3QJ 2LVSA 4FE4A 3ZQFA 4QSHA 2NP3A 1MBEA 3I4NJ 1T33A 2PMZN 2DMTA 3RH2A 2WB1N 1G2HA 3GTMJ 1W0TA 1E3OC 4DZPA 1ENHA 4RBOA 3HM5A 3IH2A 5EG0B 5HSZA 1ORKA 1MBFA 2XGCA 3FRQA 3SJMA 5EGOA 4ME9A 2XPVA 3FK7A 3ON2A 2E2HJ 5K7ZA 1FIPA 2EZIA 3GTKJ 4A93J 1X2NA 2X48A 5EEAA 2CQXA 5AQCA 1FTTA 1OCPA 2MG4A 5JLXA 2XSDC 1NK2P 2LFBA 3T6NA 4NN1A 2HYJA 2HOSA 2L0KA 2QCOA 2WAQN 3S2DJ 2QOPA 3PPBA 3TP0A 1OFCX 5CW8A 5FLVA 4AF5A 3FKIJ 3B6AA 3ZQGA 5HAWA 4ICHA 1CQTA 3HOUJ 3VPRA 2DJNA 3W6VA 3HEFA 1MBJA 3ZQLA 2KDZA 1SGMA 3S16J 5FKLA 5F27A 4DZJA 3HE0A 4FE7A 2DMPA 4MK6A 3NAUA 3QPLA 2QKOA 1Z77A 3F0CA 4D7NA 5FMPA 2K40A 2RHAA 3LHQA 2G7GA 4MIMA 1MSFC 4UDSA 3ZQCA 4XRSA 2DA4A 3JR9A 1LFBA 1PUFA 3TEDA 1WGXA 3BR1A 2P81A 1H88C 3KKDA 1B8IB 1EF4A 3JRGA 1QVUA 5IYDJ 1TWAJ 2WUIA 3DPJA 1ETYA 1UI5A 3OSFA 2Y9ZA 2G7SA 3A01A 3ON4A 1ITYA 5F08A 1BW5A 3L1PA 3CQZJ 3S2HJ 3VVZA 5M5YJ 3HTAA 1RPWA 2L9RA 4MXMA 5F0HA 5C3EJ 5EZHA 3JREA 3BR3A 3BTJA 5C4JJ 1U8BA 1TWFJ 3B81A 1UI6A 4A69C 1JUSA 4FCYA 1Z0XA 4IHYA 2Y9YA 4AYBN 1IRZA 4A3MJ 3GTQJ 2GUHA 2DMNA 4M3EA 3LSGA 2ECCA 2ZOYA 1OCTC 3VIBA 4W1UA 1IJWC 3KNWA 3CRJA 5D18A 4G12A 1RKWA 1U9OA 3IH4A 1RETA 4CGRA 3VVYA 5GPAA 2JWTA 4C3JJ 1JT0A 5K7FA 1H8AC 4GCLA 3A02A 3BTCA 2JJ7A 2CRGA 3BHQA 1GUUA 5J1UA 3Q3SA 4IHXA 3S1RJ 2PBXA 4JX6A 4JNNA 2HKUA 3C2BA 3GTLJ 3LNQA 1W0UA 5FLMJ 3GTJJ 2TRTA 3V78A 2LK2A 4AUXA 1IG7A 1MBKA 3I4MJ 2M34A 4RDUA 3PO2J 2X9DA 1GT0C 3LJLA 4GFLA 2DG8A 3O60A 2DMQA 3NNRA 1K61A 4MO7A 2DG7A 3OIOA 1X58A 1B72B 1B8IA 1HDDC 3C07A 3TW6A 2ZOZA 2IBDA 1ETQA 3NPIA 1VNDA 4A3JJ 4A3IJ 4AC6A 3GTPJ 2NVYJ 2NVQJ 1BL0A 5F0FA 2ELKA 2E1OA 2M9HA 4IHVA 3ZOBA 3H3VK 2FX0A 1O4XA 4QTRA 4D5FA 5IYCJ 4C3IJ 1JUMA 3MN2A 1ZGWA 5IOYA 5IP7J 3IH3A 3E7LA 1ZQ3P 2CUEA 2FBQA 3TW7A 3BR0A 5IP6A 1YRNA 3OOUA 4I76A 4FTHA 1Y1VJ 3A01B 3HDDA 1ETVA 2VPRA 5M3FJ 1IC8A 1AKHB 1RR7A 2G0EA 2ID3A 4B1RA 1JKPC 4M3FA 4A3BJ 2OPTA 4EEFG 5H9TA 3HOYJ 4D7MA 4IHWA 4PXIA 2DMUA 3RQIA 2JMWA 4CYCB 4NDLA 2R5ZB 3S14J 1FEXA 4M3DA 4A3EJ 3BQYA 5FKOA 4L62A 3RKQA 3BR6A 1H89C 1GV5A 1PUFB 4JX4A 3JRCA 2FD5A 1MH4A 3S5RA 4A3FJ 1DU0A 2FJ1A 3HOZJ 1ZR4A 3BJBA 3ZQHA 1ETXA 2TCTA 4BY1J 4BKXA 5J1RA 1UMQA 1RKTA 2L7MP 2IU5A 3H0GJ 3MKLA 2LTPA 3HB9A 3BT9A 2JK3A 1JKQC 5FKNA 2I10A 5EGOB 4CYCA 2R5ZA 3HKZN 3G1OA 1IUFA 1SFOJ 4D5CA 5C4XJ 3KZ9A 5E3LA 2UXUA 3VW2A 1QRYA 3ANPA 4HNVA 4GFBA 3HOXJ 1JT6A 1WH7A 2FQ4A 4IEJA 2DA5A 2XPWA 3EGQA 4DYCA 2Y30A 2K9NA 1AHDP 3VW1A 1UHSA 4B3AA 5F1JA 2W53A 4S0HB 5IOZA 1XS9A 2M2EA 4GFKA 3G7RA 3GTOJ 3BRUA 5D1RA 1BJZA 3QQAA 3GBGA 1MNMC 2D6YA 2NS7A 5CXGA
chains in the Genus database with same CATH superfamily
3OYBA 2B0LA 2XF7A 2DA2A 4BHPA 4KUMA 1D0ZA 1W1WE 1VQNI 3BROA 3CCYA 4OIRF 3OYHA 1T56A 2EZLA 2QVOA 1POGA 1IN7A 2IJLA 2CWEA 5JFRA 3IP4B 2CV1A 4BEHA 5DS9A 1HW2A 2P4WA 4MFEA 3TQNA 2WAQA 3SYTA 4XLEA 2VKDA 3HRTA 1T0FA 2CO5A 1FPQA 5J6XA 3KP4A 2E2JJ 1FMVA 2XAFA 4PSXA 2M8GX 4KN4X 1I1GA 1REPC 2A69F 2CG4A 1VQMI 3WE2A 3ASNH 2MABA 2PG4A 3I53A 1I5ZA 2RASA 2QWWA 3GF2A 2DA1A 2VB6A 4LD5A 1BBYA 3WHCA 3BG7A 1G3TA 4J19A 5JLWA 2IAIA 2COBA 2MLGA 2VN2A 3MNLA 2WAFA 1WCMJ 5LEKA 2QWTA 3PIOF 4LB5A 2K4BA 5GADJ 3OYJA 2XDNA 2Y31A 4D0PA 2O9LA 1W5SA 5ILSA 1J0RA 3N4MA 1E2XA 2JA5J 2OF7A 4JL3A 2H8RA 3J81K 3DPUA 4IPAA 3CC4I 4FETA 3BQZA 1X4OA 2Y0SN 5FD6A 3BNIA 3QBMA 1Z21A 3NARA 4G9YA 4ZYAA 2MGQA 1JUPA 2CYYA 4WWCA 4JK1X 3LSPA 2OTLI 1FX7A 2DW4A 3DBRB 3A4CA 4BDZA 4BL0B 1H9GA 2P6TA 3ANGA 4B44A 1LKXA 1RNLA 3CUQB 4U0WA 3ERED 3HPHA 2QSGX 1W36C 1JXSA 4HSTA 4KWAA 1SFEA 2AO9A 4U0YA 1OMIA 2YS9A 3ZXSA 5ICGA 4RS8A 1QPIA 2HNHA 3MVPA 2Q24A 2QZ8A 2Y2ZA 2VC0A 2F4IA 3C7JA 2JRTA 1PYVA 5K58A 1CF7B 2PN6A 4JOMA 2EJRA 4GDFA 1KU7A 3WG9A 5D5WB 2V1XA 1NTCA 4WXHA 3OYEA 3LAJA 3VOKA 4OIPF 2RN7A 2PZ9A 1V5FA 2FBIA 5HLHA 1R4NB 5KNLA 4L18B 4A6DA 3PQJA 3H92A 2UXNA 2JA6J 1U5TA 4U87A 4WX9A 5D5UB 3CC2I 4AU7A 3WHBA 4IHSA 3R60A 3SXYA 3IL2A 2NS8A 1YO5C 3WTYC 4P5OA 1S72I 1ZYRF 1E17A 2R7ZJ 4PGHA 3OIPA 4HG2A 5L3DA 3EQLF 3KE2A 4N9IA 2ZSIB 1QU3A 5HBUA 1LEBA 1OLTA 2ZNZA 2QIBA 3DBLB 4MFDA 5CVRA 1R22A 1RR8C 3MKWB 4XKCA 2EFNA 1VF9A 1RESA 1GXPA 2UXHA 2QSFX 3AL0C 3Q5FA 2V9VA 4XLFA 4L5JA 1ZARA 5JVTA 4CCOA 2JSPA 3QOPA 3OYFA 2FA5A 3DPTA 3QPTA 3TO6A 2R0QC 5IYBJ 4U9LA 2ESNA 3TP3A 2DI3A 3HKZA 1MNEA 4IQ4A 1FBUA 4AM3A 3JSJA 4PK4A 2DBBA 4BDYA 1GVDA 4XOTA 2CUJA 1HA8A 4HX8A 3HG9A 2E19A 1Z7LA 4M6YA 2LD5A 1D5YA 2G7LA 4ESJA 3WTZA 3E5UA 3GZIA 2DYSH 3KP6A 2ZC2A 4A0YA 2EZKA 2ME0A 2GM4A 1HSTA 1G59A 2DA6A 3EUPA 2EZHA 2YPRA 1YYVA 3AG4H 5HS7A 3PIPF 1X19A 2W24A 1S7EA 2BBYA 1X1PA 1RUOA 3H5RA 2JQ7A 2HI3A 3HRMA 3FIWA 4N9HA 2FBKA 4HKUA 4LIUA 3CUOA 5IP9J 5BPIA 3VFZA 4XLPF 1FC3A 1MDMA 2QLZA 3DKWA 2DCEA 1KA8A 5FJ8J 4RB3C 1FLIA 3HBLA 4KMFA 2X6XA 3J7ZI 5A2QZ 2RV8A 4E7HA 1S29A 2IA0A 5IY5H 3ZQ7A 1HSJA 4UUTA 5CKTA 1OJLA 1R1TA 2VJ5A 4XSXF 3GYHX 2VKEA 1SEUA 3HRUA 3BCGA 1ZTRA 2Y0SA 5F04A 1OR7A 2XGDA 4OAZA 5GPCA 5K1YA 1WJCA 3BP8A 2K9LA 3DXJF 3KX2A 1HKSA 2BE5F 1IRGA 5E8IA 3FXJA 2QM3A 1FBQA 4UUSA 3BZ6A 1ETWA 2HU9A 5DAJA 3EUHC 1J2XA 3LA3A 2M30A 3DEWA 4Q47A 1W36D 1HCRA 3KEOA 2LBFB 4W97A 4YG2F 1X3UA 3SQNA 1FP1D 3W2AA 2ZXIA 3EYIA 1IDZA 3W6JB 3SZTA 3QKXA 3K69A 2GWRA 4LIVA 4KIFA 4A2UA 4ENJA 3S17J 4EJUA 1XD7A 4OOIA 4QIWN 5EYRA 5F0CA 2LVSA 3K4MA 1DQUA 5KHDA 2NP3A 3WTSC 1MBEA 4P9FA 2PMZN 4IO9F 2DMTA 2PFVA 4EM1A 1YI2I 3L2VA 2COMA 4XNFA 3SEZA 5CVIA 2KRCA 1ENHA 2FNAA 1S7AA 5EG0B 2LNBA 4Z6YA 4K2EA 3H9GA 5HSZA 5LGNA 4A5NA 3ULQB 2XGCA 3SJMA 5EGOA 3WTUC 3L2CA 2E2HJ 2EZIA 3OR2C 1A35A 4I2OA 3GTKJ 4L0YB 2QSHX 4A93J 4FX0A 4ZC3A 2XAJA 3JSOA 5CLSA 3S93A 2DPUA 2A61A 3OYDA 2MG4A 2XSDC 1U8RA 4Y15A 1T39A 3KYDB 3T6NA 2O5RA 2RQPA 2PFBA 1TNSA 2D1VA 1R6RA 3EPZA 1QA6A 3FKIJ 1B9NA 1Z7UA 4AF5A 2EIJH 4DBRA 4F55A 5E79C 2R7XA 2XAUA 3OYAA 2LDUA 2W7NA 3IUOA 3CJNA 4BQQA 1VQ8I 2WC2A 3ZQLA 2L3DA 1VQPI 5HLIA 3WTVC 4B47A 3HE0A 4BQNA 4FE7A 3NAUA 5LEJA 1UB9A 1MMDA 1Z77A 2K40A 2RHAA 3LHQA 2MFZA 3PNVA 2ZCWA 4UDSA 3ZQCA 2DA4A 5KK1A 2LMDA 1IRFA 2X1EA 2R7TA 1OYIA 3MEXA 3U1KA 2BEOA 5A2QK 2MD0A 2IGNA 4FASD 2PJRA 2M1BA 3V7SA 2G7HA 4BQOA 3JAMZ 2BW3B 2R7VA 2KQRA 3JRGA 1T08B 4FQGA 2CW0F 1LDJA 1WJFA 5IYDJ 4P55A 4D1QA 2V7FA 4ZDOA 3TKYA 4HOBA 3DEEA 4BH9A 2DJIA 5F08A 2IS6A 1TQMA 2HR3A 3H35A 4PCQA 4E7LA 1RI7A 3EETA 2ZJPF 4ZTFA 2B7EA 2OQGA 3F8MA 5JR3A 5L3CA 5C3EJ 5EZHA 1J59A 1K78B 3BR3A 4BGDA 1QPMA 3F23A 1R00A 2XAQA 4BS9A 3B81A 1R4MB 4A69C 4MNUA 4R8HA 4IHYA 2Y9YA 4AYBN 3I3LA 3K1PA 1IRZA 5DCFA 2HPIA 3ABTA 5JI6A 2IS4A 3V7RA 4LLNA 5FFZA 3CTAA 3DP7A 1BC8C 4DVYP 2HWVA 5D4RA 1RETA 3IH4A 4ON0A 4IF4A 3ZN0A 1JT0A 2KKOA 2EA4A 3I64A 3U21A 2MD5A 2V6CA 4M73A 5J1UA 3WE3A 3Q3SA 1YITI 3H36A 3S1RJ 2WA0A 1T0FC 3KZYA 2PBXA 4CUGA 4EGZA 2BW3A 3QRFF 3L09A 3HHGA 2V26A 3LNQA 4BE2A 1R23A 1WJ5A 1W0UA 3GTLJ 3GTJJ 3IKTA 4AUXA 1IG7A 3PO2J 4ZYGA 3SDBA 1LDDA 1SFKA 2BY2A 4RAZA 3LWFA 2DMQA 2E1NA 3HUGB 5J4YA 4B43A 1B8IA 3TW6A 1W5TA 1S8NA 3NPIA 1TP4A 3VYTB 2R7WA 2FE3A 3VYUB 2QENA 4RGRA 4AC6A 1U6GA 2P6SA 2R7UA 2P5KA 2NVQJ 1D8KA 1BL0A 5F0FA 5HLTA 5HDNA 3SZGA 3ZOBA 2ACJA 2FX0A 1R7JA 3ZMVA 1RRJA 4AD9A 4KYWA 2PBIA 4NC6A 3MD2A 1JUMA 2LRDA 5IP7J 2PQ8A 2FU4A 1GXQA 4BYYA 1FP2A 3CLQA 1S6LA 1Y1VJ 3A01B 3GZNB 2VPRA 5M3FJ 4EATA 1KQ8A 4D9JA 4ESBA 4M3FA 2ZFUA 3ZCOA 5H9TA 4CCNA 3HOYJ 4L9TA 4IHWA 3PFIA 2QQ8A 3RQIA 5FRNA 4M3DA 4A3EJ 4AYBA 2OZ6A 4L62A 2BYVE 3RKQA 1KGSA 1PUFB 2F4MB 2FD5A 1MH4A 4RLQA 3TO9A 3S5RA 4XKBA 2RKHA 2ZJ2A 3BJBA 4RM3A 1ZLKA 3CF2A 4DGWB 5BPDA 1UJ8A 3M07A 2IU5A 3GFLA 2LF8A 3HB9A 2K7LA 1JKQC 4AIJA 4ENMA 3ML6A 1OCRH 4BUPA 3G1OA 1IUFA 1SFOJ 5E3LA 5DD8A 1B9MA 3PFYA 3HOXJ 1FMWA 1U5TC 1Z1DA 2H1LA 3EGQA 4HF1A 3GVAA 1AHDP 3VW1A 1Z6RA 1UHSA 1N25A 5F1JA 4ZDPA 2A2FX 5EJCA 3AG1H 3OS1A 2BHZA 3G7RA 5DD4A 3TDZC 3BRUA 1BI1A 3QQAA 2PMUA 4AIHA 2DTRA 1ZG1A 3RSNA 2D6YA 2ZY9A 4Y4RA 3BDDA 4G7ZF 2YSRA 1K6YA 2CQQA 4TV7A 3KPHA 4PSWA 1KYZA 1ETKA 3T5XA 1HKQA 4I02A 4Z2YA 4A12A 2ME6A 4M9ZA 5DM6F 3S3OA 2K9QA 1CF7A 1U2WA 1O3RA 4BBRJ 3BZKA 3T1BA 3V6GA 1T95A 2IS1A 3J80Z 3KP3A 5CPRB 4NELA 3RZOJ 2E35A 4PGGA 2JT1A 4WF2A 3HPGA 1BN5A 3RTRA 2QQBA 4UNOA 4MHGA 3RCOA 3DEUA 4YZEA 1TTYA 2H09A 2KIFA 4L5EA 1UZCA 4HNUA 1AWCA 2W00A 4I99C 3U2RA 2MBFA 5EF6A 4XLNF 2ID6A 2UZKA 1B72A 2GENA 2M4KA 1R9TJ 3IUVA 4XN0A 1D3YA 4JX5A 2XGEA 4IKFA 3IAM2 2OV7A 4C2UA 1E3PA 3GMEA 5CJ9A 4EM2A 3HJEA 3G56A 1IV8A 2XUBA 2M0CA 3RDIA 3JRAA 1T6SA 3PASA 3G71I 1VQ4I 2XDVA 1FYKA 3D0SA 3GLXA 1MBHA 2HS5A 1OCOH 2ECBA 5L3GA 4II3A 4Y52J 2M7AA 4M74A 3HTSB 4A3KJ 3FXQA 1BI0A 2UXPA 4RLFA 4KT5C 3I58A 1UAAA 3WTTC 2JA8J 4A3CJ 4M6VA 6PAXA 1I6HJ 1FTZA 4X6AJ 2HXOA 4ENKA 1N75A 4A3DJ 2N8GA 2W82A 1KU9A 2XC7A 1O3QA 2XRLA 3OYKA 4XMYA 1L3LA 3NQOA 5ILUA 2E71A 1RC9A 1T38A 4NQWA 3F8BA 3HZJA 3IC7A 3OY9A 3BPXA 2EB7A 5J3LA 1YTYA 1PVEA 3BTLA 5M5WJ 1FY7A 3JW4A 1X1AA 2CV0A 3K4LA 1KYWA 3GFMA 4ZYEA 3QODA 2EK5A 3PNTA 2AXLA 1NG7A 2XAGA 4NBQA 3FDYA 1C0WA 2QQAA 2BVMA 2DT7B 2JSCA 1ZAOA 1A36A 5DEQA 2DN0A 1EH7A 4NC8A 5FKKA 1SD7A 2QYOA 1TWHJ 3VSLA 1TQPA 3ONQA 3DWLE 4UUSB 3AQSA 1XX5A 2VONA 3IHUA 3JSPA 2XPUA 4HQEA 4G6QA 1Z9CA 2ZMEB 2BY0A 3BG6A 3CJRB 5FO5A 3WTWC 2AHQA 3FXOA 1LE8A 3F6OA 1D0YA 3QU3A 3MAJA 1YS6A 2LR8A 2KIUA 4JKZA 3C1DA 4PJMA 3F8CA 1A6IA 1NG6A 4U7BA 1VQ9I 2X6WA 1UFMA 3JCUC 3HHHA 1R49A 2LC2A 2V57A 4XKWA 2QF7A 1WI9A 2KDOA 2OA4A 4ENNA 3LSRA 3UNGC 3HGGA 5CYVA 4XK4A 1AU7A 3BG5A 3K4CA 2ISYA 2DFEA 1IXRC 2L7ZA 2F5VA 1LVAA 3KFWX 4GYGA 3WGGA 5KVRA 3QWLA 2O8KA 5J47A 3MZYA 3Q0VA 3K6GA 1PP8F 1G3YA 4A6EA 1K7AA 1VQLI 3S1MJ 3JRBA 2O7OA 4JP0A 3F8FA 1WJBA 5E1WA 2HOAA 3CCJI 1P6RA 1HLVA 3QPSA 2ZCMA 4HNTA 2DQLA 1X4PA 2D45A 3GEUA 2EIMH 1U78A 2DU9A 2L9SA 2XVCA 1JHFA 3ABKH 4F92B 4IOAF 1BOBA 3OYCA 4CDGA 4GCKA 3PM1A 3WU1B 1TLHB 1IN8A 1JGGA 4DYRA 1X1DA 4MQ9F 2CH0A 4N0BA 3I0TA 2RC4A 2VXDA 4IRHA 3P9KA 2A07F 3I71A 3FK6A 3S32A 2O8XA 3CJDA 1I39A 1TZLA 4HSRA 4BXXJ 1D1CA 4C9YA 1MH3A 1MIJA 1V4RA 2W48A 3ISPA 1ZK8A 5E3NA 2BZTA 1ZGAA 1Z3YA 5EZGA 4XRSG 1XTAA 2YVEA 1JHHA 3A03A 5EFYA 2KT0A 4M9SA 5K5RA 1QO0D 1MMSA 2E5ZA 2X0LA 5GP9A 1WH5A 2L7FP 5GAEJ 2HYGD 4M3GA 1XCBA 1D5VA 2HYTA 2Q0OA 2UXIA 1OQYA 2HVQA 3FISA 3R0JA 3BZCA 3KEYA 4HQMA 5L3EA 2UXOA 1U3EM 2WBMA 2NP5A 1AKHA 2Z9OA 4LK0F 4AVPA 1HW5A 3RPQA 3KCCA 1F36A 4BJ6C 1I50J 4B4CA 2V1UA 4ZTJA 5HS9A 4BBSJ 2OBPA 3CO6C 2DOFA 4PUSA 2QTQA 1W7PB 5H2FC 5B1AH 2PX9A 2YX4A 3CDIA 3Q0WA 4CA0A 4BQAA 1YRNB 1DGRM 3L2WA 2UWMA 4V2FA 4OMYA 3NS4A 1XGMA 1CGPA 4IZZA 2LLKA 2CSOA 2XKPA 2E2IJ 2RGVA 1X2MA 2YU9J 4OIOF 2Y69H 3B02A 3G1MA 3TGNA 3I9V2 3K4BA 4BY7J 4ACIA 1I3QJ 1YW8A 3C2GA 5BS6A 5E18F 1OYWA 2HKOA 1BJAA 3FMSA 4R79A 3GTMJ 1I1SA 2CFOA 1QBJA 1N77A 2PLYA 1W0TA 1E3OC 3W3CA 4YFXF 4OIQF 2K27A 3T8RA 2Z1DA 4C2TA 3WTXC 3D5LA 3TMOA 1DPRA 3IH2A 4CH7A 3OYMA 2KLOA 4ASNA 4KITB 2XPVA 3FK7A 5K7ZA 1XGNA 3R0AA 2CV2A 3M8JA 1FWZA 5HLGA 3GLLA 1ZREA 4LFUA 3HXLA 3J80K 5BOXA 1P4XA 5EEAA 3BOQA 4XSZF 4G7HF 2HVSA 1OCPA 3DU6A 1YHQI 4HF2A 5JLXA 4LG3A 4NUBA 2L0KA 2WAQN 3S2DJ 3PPBA 5CW8A 5FLVA 2DK5A 1Y0NA 4RGSA 1R71A 3ZQGA 4ICHA 5J8FA 2XV4S 4EVIA 1MBJA 3CJTB 2KDZA 2Y48A 2JRMA 2OUMA 1AA7A 3L2UA 1F1ZA 1U5TB 1XMXA 2QKOA 3F0CA 3S8PA 3AAFA 3FXUA 1GLNA 4MIMA 3HUGA 3HOTA 1XGOA 2VKHA 5L3BA 2EFPA 2W4SA 1PUFA 4HYEA 1B6AA 3FHZA 1FSHA 2VOPA 2M87A 2KFDA 3REOA 2BOLA 3RPUD 4XOPA 3G2BA 1EF4A 3KP7A 4ETSA 2WUIA 3I59A 1TWAJ 3DPJA 1ETYA 3OSFA 2ZXWH 3A01A 3C18A 1BW5A 3CCVI 4UV8A 3VVZA 3BJAA 3B73A 3V8KA 4P96A 4DJAA 4IOCF 1FSEA 1HW1A 4XM3A 3FMRA 2ZNYA 1U8BA 3EUAA 2B9SA 1X1BA 3RKXA 4OD4A 2VQCA 4PJ0C 2FSWA 2EFOA 4PFPA 4A3MJ 1MJ9A 4DIQA 4OWRB 4G94A 4MTDA 2DMNA 3ZMTA 3LSGA 2KL4A 3JTHA 1RUNA 1SVMA 1DUXC 1QZEA 3FM3A 3KNWA 3BJOA 1EKEA 5D18A 1RKWA 5D5VB 3VVYA 1YQAA 5DCMA 4C3JJ 5ICCA 4L9JA 4GCLA 3RI4A 3A02A 3BHQA 1MGTA 1A31A 2EFQA 1UELB 4U7DA 3RJPA 3ECOA 4RGXA 2KIMA 3VB2A 2HKUA 3C2BA 4E70A 1JE8A 1P9QC 1USTA 3WGHA 5FLMJ 1KU3A 2TRTA 3V78A 4DQ2A 2LK2A 2X85A 3E5XA 3I4MJ 2X1DA 2M34A 2M7BA 1FOWA 3TDUC 2OZUA 2IGOA 4PDKA 2DDAA 2GIZA 3O60A 4BNCA 3RYRA 3NNRA 2M4GA 2GZWA 3JAMK 4LJZF 1QHGA 4MO7A 3OIOA 4YRVA 4EQQA 1ZHFA 4CCJA 1P4AA 2IBDA 3MKZA 4L9NA 4RB1A 1ETQA 1W5CC 4A3IJ 2H6CA 1K6OA 4AWXB 2A3SA 4NB5A 1R58A 5E1ZB 1JI8A 2LSOA 1G3SA 2M9HA 2Y0MA 1XCVA 4MTEA 4CSWA 1PDNC 1YFHA 1MMNA 2LKSA 4IHVA 2V1DA 2DXIA 5BQTA 4CCKA 2GA1A 1RZ4A 2A6TA 4C3IJ 1ZGWA 4KDPA 4DBQA 3IH3A 3E7LA 1WSUA 1ZQ3P 3TW7A 3QYBA 4DOZA 5IP6A 3OOUA 2E1MC 5DM7F 3ZMDA 1QHHD 3HDDA 2OCCH 1ETVA 4E7KA 1Y39A 1SC7A 4U88A 2ID3A 1JKPC 4B1RA 4A3BJ 4EEFG 4FX4A 3COAC 2W1OA 2ELHA 2V9KA 3P9CA 2L2OA 2LYCA 1PP7U 2R5ZB 4KISA 3P9IA 3Q9SA 1BIBA 3OYGA 3DV8A 2H94A 1GV5A 4UUVA 4BAYA 3JRCA 3J7AY 3V4GA 3H5AA 2IW5A 3HOZJ 2HQRA 2F5EA 2V4JC 4IX7A 1ZR4A 1ETXA 2TCTA 4XLHA 2WY7Q 5J1RA 3FXMA 2L7MP 1KU2A 1FOXA 3E0JB 2JK3A 5FKNA 5EGOB 4KNYA 2R5ZA 1YS7A 3ECHA 4R1HA 1MZBA 2L01A 2KHMA 3PUFA 4D5CA 2UXUA 1Y0UA 1K4SA 4BJ5C 4HDVA 4GFBA 4YEJA 3V8JA 1DDNA 2EV6A 4E6KG 4FHTA 1JT6A 3F9KA 4ZH4F 4LITA 5HDGA 1Y56A 2K9NA 2FRHA 4XQFA 5IOZA 2M2EA 3H3ZA 1IN5A 2JA2A 1JGSA 3LSTA 5B5EC 1YJWI 2NS7A 5CXGA 3E6CC 2OCEA 5LD2C 2LBFA 4I0BA 3BR5A 4GGGA 4I98B 2IP2A 2P7VB 4XRFA 4PJLA 4UB8C 3OYIA 3S1QJ 4P1WA 1HOMA 2EINH 2O7TA 4XBFA 2IGKA 2EPFA 2GLOA 1GHCA 1YLFA 1XMAA 1BW6A 2WWYA 2L4MA 1JJ8C 3CUQA 2JA7J 3VDXA 3AL0B 1FNNA 4NQWB 5EG0A 5FGLA 3DU5A 3HSRA 2NRAC 3NEUA 2E7XA 1HDPA 5LRSA 5C44J 3MQ0A 5E3OA 1HF0A 2B3WA 3JRDA 2X51A 5K5OA 3GX4X 3CMEI 4HAMA 1UG2A 5DUKA 4XRMA 1G8XA 1WPKA 2WB1A 2ZXHA 2R3SA 3LSJA 2CUFA 2ZCXA 5D6FA 4UB6C 4WK8F 1LUJB 5CXIA 4DW6A 2LOOA 2CQ7A 4O3MA 5KAIC 2DO7A 1X3ZB 5M5XJ 3CF5F 4GYIA 3NI7A 2DOAA 3JRFA 2CQNA 3RD3A 3AG2H 3E7QA 2DLLA 2M0MA 2VJIA 3M9AA 1IXSB 4HBLA 2IXSA 4V2GA 2LREA 3A0BC 4WCGA 2YR2A 3CCQI 3CZ6A 5B1BH 5HODA 3IKVA 4B3XA 4HPQA 5K5QA 4J00A 2JPBA 3OOPA 4HV6A 2L7KA 2OU2A 1FYMA 3P5JA 5TJJA 3JRIA 3OS0A 3ZN1A 2XGXA 5D8KB 2HQNA 4ZYHA 3RZDJ 2G7UA 4RAFA 1VQ6I 3K4JA 2B1EA 4ANJA 3S15J 5FHPA 4I01A 5FB2A 4A3LJ 1ETOA 3HGYA 2VKVA 3DPLC 4F52A 3HTHA 3AQTA 2K3PA 4XICA 2FMYA 2MW8A 2BXYA 5E8GA 4CGZA 3FZVA 1SVLA 2R7DA 3K7AJ 2CJJA 3S2WA 2DA3A 3FHNA 3BG9A 4XONA 4V19K 3ZPLA 2VUMJ 3FMQA 5EEHA 2FOWA 2R7QA 2F5CA 3E6DA 3WU0A 2VODA 1BA5A 4KICA 3SHFA 3SFZA 3MFKA 2FUG2 3G4SI 1JKOC 2WY8Q 3KEQA 2VLAA 3E6BA 1MJAA 1MKMA 1WHUA 4B8XA 2DOEA 5ED4A 1SANA 3D1NI 3ZRGA 2X6OA 3VYSB 3JTGA 1Q1HA 1EA3A 2LP0A 3K1MA 1I3AA 2K4JA 2R93J 2NXNB 2YU3A 4WIBA 3ABLH 2FOKA 1LB2A 4PFOA 4DYQA 1SAXA 4G8XA 2HXIA 3BPVA 4EV0A 2MH2A 1E0EA 4ESFA 2LY9A 2HZDA 2Z33A 3K1NA 4RB2C 4EJOA 3DKXA 1AOYA 5EDNA 1MSEC 2DAOA 3FM5A 3S3NA 4ZJZA 3OL3A 5J1YA 5JHFA 1MBGA 2KJCA 2V79A 4PJJA 1R1UA 3EDPA 5ERIA 1K83J 4AIDA 1GDTA 4OINF 2O6GE 3K2AA 2HFHA 3NRVA 1ACIA 2GBYA 1HBXG 2A6HF 3SFIA 3MZHA 1GV2A 1IV6A 4RB0A 3C2HA 5KAFC 1M1EB 2V9PA 5FRMA 2D5VA 5FGMA 2XSJC 1S7OA 4JQFA 3HC7A 4F3QA 4YELA 1F9NA 3QYFA 2MSYA 2ZKZA 2ZB9A 5M3MJ 3HIMA 2H6BA 2CW7A 2CS3A 3BCAA 4J01A 5BNGA 2C6YA 2ZCNA 2VBZA 2LY1A 2EFWA 3S1NJ 2JN6A 2OERA 2HZTA 1LE8B 1ON1A 4KN7X 1BIAA 4X1EA 2XB0X 1IGNA 3ZMUA 4E7IA 3ZQIA 4XKVA 1VQ7I 4NHJA 3I55I 2YVXA 1QVTA 1JJ6C 2R5YB 2ZBKA 4ABZA 3PSFA 3BC8A 5LLQA 3HOVJ 3M3YJ 2XHKA 3HTIA 5D19A 2F4OB 1LQ1A 3HTUA 3DBHB 4C2MJ 2A68F 4UY8I 4F91B 1FJLA 3DCFA 4C3HJ 4CICA 1LFUP 5C4YA 2HQAA 3PNYA 2DFIA 4BEHB 5TRDA 1SFUA 3E97A 5F6FA 4GO1A 1FZPB 3F3XA 3RYPA 1TNTA 3IRRA 1Y8RB 2HOTA 2EILH 1TWCJ 5F1RA 3HTJA 2R4GA 2KIQA 3NXCA 5D4SA 4YIRX 3LSIA 1U9NA 5HVQC 1QZZA 3PUBA 2EQRA 2DTZA 3SEQA 5GAHJ 2RAEA 4BE0A 3GWZA 4G6TB 5KCMA 3H5NA 4CZZA 1D8JA 1BI2A 2DFFA 3VVXA 1APLC 3VOXA 3DQVC 3ELKA 3TL4X 4Q5SF 2KPMA 5FKMA 2F07A 3F1BA 3CCEI 2M45A 2MA3A 3E1SA 3QYEA 3I56I 1IXCA 9ANTA 4KFCA 2VT2A 4GCVA 2JVGA 3BTIA 1ZG3A 4IQJA 1O57A 3H9QA 1SMYF 2YVHA 2PEXA 2EH3A 3G1LA 1MNDA 2A05A 3IWZA 4LLLA 2Z2SB 2RVCA 4I09A 3ZQFA 3I4NJ 3RH2A 2OQRA 2WB1N 4IRVA 3BLYA 3K4KA 1B1BA 1DP7P 1KQ9A 4WXDA 3I59B 3H0DA 3F72A 3HM5A 3RKWA 1YX5A 2BY1A 1ORKA 1H9TA 1ZELA 4MEYF 4ME9A 1FIPA 3GZ5A 1Z05A 4LMYA 4F7ZA 3G6EI 1YE9A 2VBYA 3KP2A 1MMAA 1MMGA 1OKRA 1Z3XA 2JUGA 2IGMA 1X2NA 4MQVA 2X48A 5AQCA 2CQXA 2L4AA 1YW7A 1XSXA 1FTTA 2CQKA 3KLOA 3M1CA 3VSKA 1FOYA 2LFBA 1NK2P 1WVRA 1YJ9I 2HYJA 4E7JA 2HOSA 2QCOA 2QQ9A 4NN1A 1OR7C 2MLKA 4S05A 4P9UA 3B6AA 3LQQA 5HAWA 3C3WA 4LG0A 3RIRA 3CD6I 3VPRA 2DJNA 5EEGA 3W6VA 3HEFA 2VOOA 1SGMA 3GCMA 3DTEA 4YIIA 4BU2A 5H6QA 1G3WA 2DMPA 4MK6A 2VBWA 1D1BA 1YOVB 5CVJA 1P92A 2FBHA 4D7NA 3CCSI 5FMPA 1ZGJA 2EIKH 3W2VA 2G7GA 1MSFC 1T98A 1LEAA 4XRSA 2V6EA 1N78A 3RKYA 1VQKI 4Q4ZF 1BC7C 1LFBA 2ADUA 4HF0A 3TEDA 2CGPA 2DYRH 2P81A 3X2QH 4WXCA 3ZP5A 4UVCA 2ICWG 1B8IB 1DPUA 5E1XA 2VT3A 1QVUA 2HDWA 3D5RC 2F48A 1UI5A 2L02A 1H0MA 2H27A 2G7SA 3ON4A 3F22A 1ITYA 3L1PA 2G9WA 5D5XB 3HTAA 3GW2A 1RPWA 2KZVA 2QKMB 3CMAI 4H0EA 2L9RA 2FQ3A 2GA2A 1O7FA 3F6VA 3K8PC 2VIXA 4BJTA 4BXUA 1FOKA 4NNJA 3K70C 2VL8A 5HNFA 4HA8A 5AIQA 5FLXZ 4X0GA 1RIOH 1TWFJ 4A5MA 2P7CB 3OMYA 3HOSA 5TISC 2JVHA 4FCYA 1Z0XA 2BVLA 3HSFA 1UCRA 2HTSA 2HOEA 3ABUA 3VWBA 3KLNA 2ECCA 2ZOYA 1OCTC 1QQIA 3OL4A 2E1CA 2GXBA 3QU6A 5JHUA 2M8EA 3OS2A 2GOXB 1BR1A 3GUDA 4HLYA 2VE8A 2PI0A 5DDGA 2GQQA 4HZFA 1H8AC 5E17F 2JJ7A 2CRGA 2ZXJA 1GUUA 2FEZA 3CO7C 4PJNA 1FT9A 4JX6A 2K3FA 4JNNA 4RGUA 4AIKA 5IT9K 1KONA 4CCLA 2IT0A 3HRSA 1J75A 2Z99A 1WFXA 3TOBA 1MBKA 1OISA 1ONVA 1TW3A 2MYSA 2NNNA 2QKLB 1J09A 3LJLA 2ISZA 2DG8A 2WTEA 2Z5UA 4M71A 3QAHA 3QP6A 3J7AO 3W2WA 3E3VA 2A6EF 1B72B 3IWFA 4UHTA 2RQQA 3C07A 4KMUX 2ZOZA 2XAHA 1YIOA 5LGTA 2DPDA 1B4AA 3KETA 1VNDA 1LDKB 2VBXA 4A3JJ 2F5FA 1WJAA 1Z67A 2NVYJ 3GTPJ 3J7YJ 3UR3C 4GXOA 2ELKA 2E1OA 2QEXI 2KZGA 3VTIA 1VZ0A 3H3VK 4FT8A 1O4XA 3LSMA 4A0XA 3ZMZA 3FXKA 3K4NA 3MN2A 3TOAA 3GFIA 1EV7A 5CVVA 2FBQA 4CHUA 2RNJA 3M8EA 2DT5A 4PZJA 2BHYA 3WG7H 1TQIA 2EWNA 1Y8QB 4YFKF 1AKHB 2NYXA 2PMHA 1RR7A 5LHIA 3CMMA 3MWMA 4C2MA 2CUZA 3I5UA 3TO7A 2DMUA 5L3FA 2JMWA 4CYCB 4M6XA 3VODA 3S14J 1FEXA 4PXIA 2Z16A 3BQYA 5FKOA 1O3TA 5LFAA 1IF1A 3LFUA 2K5CA 5BMZA 3L7WA 4IXAA 1S5LC 2A5YB 2D2WA 2E34A 2Q8KA 4A3FJ 1DU0A 2ZJQF 2FMLA 2DODA 3ZQHA 4BY1J 4BKXA 1TBXA 1UMQA 2Y75A 3OWTA 3CCMI 4HRIA 3H0GJ 3MKLA 1SFXA 2LTPA 2GXGA 3BT9A 2I10A 2WV0A 2L9VA 4CYCA 1X1CA 2ZO4A 2YX7A 2EV5A 3HKZN 4E7ZA 1SD5A 5C4XJ 3KZ9A 4HEA2 3VW2A 3ZR8X 1QRYA 3ANPA 4HNVA 4B09A 1WH7A 3AG3H 2X6YA 4Y17A 3LSKA 2XPWA 5J8CA 1W7PA 3N97A 2Y30A 3DTKA 5HNHA 1UG0A 1XSVA 2Q1ZB 4S0HB 2E60A 3FXLA 3DLAA 2LKPA 1QGPA 3GTOJ 2RNGA 1BJZA 3GBGA 1MNMC 2HPMA 2UV1A 1OYYA 4NC7A 4RM2A 2VE9A 1SAUA 2AXTC 1P2FA 2R7FA 4AC0A 2X4HA 5E3MA 1ZKGA 1JKRC 2K9SA 2XRNA 3CC7I 2M5WA 2NAZA 3GFJA 3K70D 3R4KA 1PUEE 3IAS2 1JTXA 1VI0A 1EJ9A 4CYDA 2VXZA 3OIQA 1ZG5A 4O6JA 4GCTA 2DT6A 3CP8A 5GTHC 2QBYB 4IRGA 1TC3C 2W85A 1Y6IA 3CESA 4QWQA 3LFKA 1I6XA 2CW8A 2D1HA 3B6CA 2E5NA 1SD6A 3BR2A 3OR1C 1A04A 4CZCA 1V54H 4EJTA 3P9TA 2KRHA 1G4DA 3CDLA 2HKXA 5K7HA 4OAYA 2XASA 1ZR2A 3EUKL 5F64A 4M3BA 2MH9A 1LPQA 2CU7A 2IEKA 4DNCA 1X3WB 2K9MA 4XLAA 2REKA 4S04A 2VQGA 3DLLF 3CWRA 2NOJB 1G6NA 4XL9A 3SDGA 4B48A 4JBAA 4KT6A 4Y13A 2AQEA 1SMTA 3L2RA 2AS5F 4BXFA 3FBIB 1L0OC 2KJBA 2KP6A 1YJNI 2HEOA 3CMYA 4EGYA 2Q2EB 2B63J 2HQ5A 4QLCU 4LK1F 1A5JA 4EM0B 2HYFA 5JVGF 4A3GJ 2YUSA 2O61A 4Y3OA 3KKCA 5B66C 2H8WA 3M1EA 2QUFA 1JTYA 1VFCA 1EH6A 1MD0A 3KZZA 3M8FA 2XF5A 3IV5A 2XB5A 3M7GA 3VUQA 1BI3A 1WI3A 1F43A 1O7LA 2IRFG 5IT9Z 3F8NA 4L0ZB 3G73A 1Q1VA 3LSHA 3VOEA 3FKJA 1IN4A 3MKYB 3CDHA 2O0YA 2LF7A 3BCBA 5J40A 3LAPA 4Y7NJ 3GZ6A 5DCMB 5H6RA 3K2ZA 4N4NB 4I6ZA 3O6BB 2L9NA 5DTDA 1J9IA 3LQRA 2OAZA 2W57A 2KRFA 2LG4A 5ILVA 3SWHA 3VEPA 4LOCA 1R5HA 4UVAA 2ZSHB 1ZRDA 4L5IA 2PJRB 2DK8A 1NK3P 2G3BA 2WV1A 4RAGA 2KMUA 2FNPA 1DP3A 4XLCA 1KQ0A 1HQCA 3CCUI 4E7SA 2P5VA 1IAWA 4F93B 2OI8A 2VI6A 4UVBA 5LBQA 1ZH5A 5AONA 3AFHA 4JYKA 1XDUA 2RDPA 2ZMEC 2VQLA 3KIOA 3LOCA 2HDDA 1Y1WJ 4RAYA 1DU6A 4OD5A 1TWGJ 3A0HC 1SVOA 1IZ1A 3MZ8A 4HV5A 3H1CA 3ESWB 2NOGA 4HX7A 2NVXJ 2MC3A 1YIJI 1STZA 2GFNA 1V3FA 5IPAA 4HDUA 3FBNB 5CVUA 3OYNA 1IDYA 3NRGA 2FXAA 2WADA 3ZMSA 2CFXA 2K02A 2PMZA 4BE1A 3COLA 4MLOA 2NS0A 3ABMH 3FWEA 4EMSA 2K85A 4UXNA 2R7SA 2Z3YA 1S3JA 1R5ID 4MGRA 1ULYA 4XIDA 5FD5A 3GTGJ 3TBIA 3OSGA 1T2KA 2J5PA 3N05A 4CCMA 1XSDA 2O3FA 1BR4A 1ZRCA 2R5YA 2EV0A 2O03A 4M9XA 3UKGA 3CLOA 3PO3J 2QBYA 4BHBA 3VW0A 1P7IA 1P7JA 2ELJA 3K10A 3V8LA 1K4TA 1IUYA 2EBIA 3VYRB 2WGBA 2NX4A 3VP5A 1XPXA 4MEXF 4YIFA 3D5SC 2ZJRF 1E3HA 2OC6A 4BACA 1ON2A 1XG1A 2NVUB 2H1KA 1WJDA 3BJ6A 3A1YA 3T8TA 2R92J 2TDXA 3KZIC 3PSIA 1PJRA 1O3SA 1HKTA 1OPCA 1OCZH 4L9VA 2NVTJ 3GXOA 1W4MA 2VC1A 2DA7A 1HXDA 3WGIA 3HOWJ 2JTVA 3DKYA 3CUQC 3LMMA 4QPQA 4U0VA 3Q9VA 1ZLJA 3U9GA 1Z91A 1LFPA 3M4OJ 1FIAA 4UV9A 5LHGA 1FBSA 4O5VA 5D6EA 1TW2A 3GEZA 1U0JA 1XC5A 2BXZA 4YFNF 1R5GA 2BGCA 3WODF 4QPOA 3LL7A 5IT3A 2NNYA 2GAUA 5DV5A 4ZZDA 3WU2C 1R1VA 2QGUA 3K0LA 2FF4A 4ZYDA 1FYLA 2IS2A 3LA2A 3HL2A 1B59A 3NWSA 3O8HA 4RMNA 3BG3A 5FLXK 3CP2A 1IN6A 3CCRI 4BHCA 4FISA 5FFXA 3LWJA 3V7CA 3S3MA 2VQHA 1I27A 1WRJA 3PJRA 3J81Z 3LA7A 2LKXA 2STTA 1IO2A 3Q0UA 4E4HA 1YW9A 3PQKA 3JRHA 3O8GA 3L2QA 2QA4I 4FE4A 2DFHA 4QSHA 4ZDLA 1V5EA 1T33A 5HOOA 3OYLA 1EH8A 5ICEA 1WZ2A 1D1AA 3RQ4A 1G2HA 2UUZA 5B3SH 1WKMA 4DZPA 4LB6B 2VASA 1XB4A 3E5QA 4RBOA 1SD4A 3R6SA 1MBFA 3FRQA 1J7KA 3ON2A 2ZFWA 2V1NA 1P4WA 1T8IA 4KIBA 3P7NA 2GIVA 2F6CA 4HX4A 1VQ5I 2LH9A 3BWGA 3AKZA 2EA2A 4IJAA 2IPQX 4XN3A 1ERDA 2IVMA 2QOPA 3A2KA 2HTJA 3TP0A 1OFCX 2GXAA 1WQ2A 3KYCB 4HLXA 3KP5A 2VJJA 3T0YA 2FJI1 1CQTA 3CJQB 3HOUJ 2DQRA 3FXRA 1XMKA 2E1MB 3S16J 5FKLA 3IRQA 3HYIA 5F27A 4DZJA 2ZMEA 3SZPA 2GOMA 5FROA 3QPLA 3PL8A 4LLGF 1NH3A 2UXXA 2STWA 2OJED 2X1CA 3JR9A 1F5TA 3K9TA 1BR2A 1W7PD 4XORA 5LGUA 1GVJA 1WGXA 3BR1A 3E6MA 4IHTA 1H88C 4CO8A 3KKDA 1TT0A 3DFGA 3L00A 4IVNA 2K86A 1LVKA 4I7HA 4XR6A 2Y9ZA 1OCCH 2JUCA 3CQZJ 3S2HJ 5M5YJ 4I0AA 4MXMA 4CXFA 5F0HA 3JREA 2F2EA 5C4JJ 3BTJA 3EUHA 4A0ZA 2W25A 2PJPA 1UI6A 5LHHA 1JUSA 2MC4A 1D0XA 3EYYA 1WWXA 2R7OA 4HW0A 5HDKA 3GTQJ 2GUHA 5HS8A 2VPLA 4M3EA 2L5QA 3VIBA 1WJEA 3O3KA 2M3AA 3RPUA 1IJWC 2JPCA 5ICFA 2P0WA 3CRJA 4G12A 1U9OA 4CGRA 1K79A 1K78A 5CQEA 4EJVA 5GPAA 2JWTA 3I54A 4H4KC 5K7FA 3BTCA 1S9HA 3GO5A 2J5OA 4GRIA 4RA2A 4C30A 4U9NA 3O2PE 2HDCA 2E7WA 4KJZA 5TGTA 4IHXA 2R7RA 3MCZA 4IRIA 2E36A 3BY6A 1BOAA 1XGSA 3ZGKA 3HIFA 2IA2A 5DYMA 3FX3A 4RDUA 2X9DA 1DGWY 1GT0C 4N4OB 4GFLA 4G6DA 5D8LB 2XKOA 1LNWA 1K61A 2DG7A 1X58A 3CCLI 1VTNC 3R61A 3U1DA 2DDBA 3ROUA 1HDDC 2F5DA 4Q48A 1HC8A 1MDMB 1ZN2A 1A6QA 3W6KB 4II2A 3KYLA 4OMZA 5LRRA 3ASOH 2XIGA 3ZQQA 3DF8A 4M72A 1KZHA 1NHAA 1USSA 2L54A 2I5UA 5CQGA 4AVZA 4QTRA 4OU0A 4D5FA 5DUIA 5IYCJ 4KA4A 1LJ9A 3QP5A 2JZYA 2XROA 2BY3A 1VQOI 5IOYA 1ZRFA 4ITVA 2CUEA 2AQFA 3QOEA 3BR0A 3H9JA 2ESHA 1YRNA 5AIPA 2P5LC 2OTJI 1Z6TA 3MMYB 4I76A 4FTHA 1IC8A 2G0EA 1IW7F 1XN7A 2I8DA 2OPTA 4KIGA 1UHWA 4EJWA 4D7MA 4LGWA 1QNTA 3ERMA 4NDLA 1MJBA 2VJ4A 5J4VA 3BR6A 1H89C 1TT5B 4JX4A 1V5GA 2FJ1A 3HSEA 3DTIA 1TL8A 2LY2A 1RKTA 2XF6A 4Y33A 1YX3A 2ETHA 2P8TA 5H20A 4IL6C 1QZYA 1ODDA 2HGCA 3FF5A 3L9FA 1V55H 3OV8A 3F21A 3NWTA 5GAGJ 2A5WA 2IA1A 2OD5A 3G3ZA 2WAEA 5GTIC 1MW7A 2RREA 2CMPA 1R36A 4IEJA 3H3UA 2FQ4A 2W84A 2DA5A 2KISA 2BV6A 1F4KA 1UHMA 4DYCA 1BM9A 4ZZLA 2Q2EA 5E20A 4B3AA 2W53A 3I4PA 1XS9A 4GFKA 3V42A 1XDSA 3QPHA 5D1RA 4LG0B 4G7OF 2HVRA 1IRXA 1YG2A 4W1UA 1J5YA
chains in the Genus database with same CATH topology
2CQQA 3BR5A 2DA2A 1ETKA 4AC0A 5E3MA 1ZKGA 2ME6A 2K9SA 1JKRC 3CCYA 2K9QA 1T56A 3S1QJ 4BBRJ 1JTXA 1VI0A 1HOMA 2EZLA 2O7TA 3V6GA 1POGA 2GLOA 1BW6A 4GCTA 4NELA 1JJ8C 3RZOJ 5DS9A 2JA7J 4MFEA 1TC3C 4YZEA 3B6CA 5EG0A 5FGLA 3BR2A 3P9TA 4L5EA 2E2JJ 2M8GX 1HDPA 3CDLA 5C44J 5K7HA 5E3OA 1HF0A 3JRDA 5EF6A 1B72A 2ID6A 2GENA 3IUVA 1ZR2A 1R9TJ 1UG2A 4XRMA 1WPKA 4M3BA 2CU7A 2IEKA 3LSJA 2CUFA 2ZCXA 2RASA 2DA1A 4JX5A 2REKA 5CXIA 2XGEA 3WHCA 4DW6A 4J19A 5JLWA 2IAIA 2COBA 3CWRA 3G56A 5M5XJ 2M0CA 3NI7A 3JRAA 3SDGA 3PASA 3MNLA 3JRFA 1WCMJ 3RD3A 3E7QA 1MBHA 2QWTA 2ECBA 4V2GA 2XDNA 2Y31A 2O9LA 5HODA 3CMYA 4Y52J 2B63J 2JA5J 2OF7A 2HQ5A 1A5JA 2H8RA 4JL3A 4A3GJ 4A3KJ 2YUSA 3KKCA 3BQZA 3JRIA 2UXPA 2Y0SN 3RZDJ 3BNIA 3QBMA 2JA8J 1JTYA 4A3CJ 4M6VA 1VFCA 1I6HJ 3NARA 1FTZA 4X6AJ 3S15J 5FHPA 2MGQA 1JUPA 2HXOA 4A3LJ 1ETOA 3IV5A 2XB5A 3HGYA 2VKVA 4A3DJ 2N8GA 1WI3A 3LSPA 1F43A 3VUQA 3HTHA 2XRLA 3AQTA 4XICA 2MW8A 1Q1VA 3K7AJ 3ANGA 2CJJA 2DA3A 3BG9A 5J3LA 3BTLA 4Y7NJ 5M5WJ 4KWAA 2VUMJ 2AO9A 2YS9A 1QPIA 4I6ZA 3MVPA 5DTDA 2Q24A 2Y2ZA 1BA5A 4LOCA 1JKOC 5K58A 2DN0A 1NK3P 2G3BA 2WV1A 5FKKA 1NTCA 3VOKA 1TWHJ 4UUSB 2PZ9A 3AQSA 1SANA 3D1NI 2X6OA 2XPUA 2OI8A 2VI6A 2LP0A 2AHQA 2JA6J 2R93J 1LE8A 4JYKA 2LR8A 4DYQA 4JKZA 3LOCA 2HXIA 3WHBA 1Y1WJ 2HDDA 1DU6A 1A6IA 2NS8A 1TWGJ 2LY9A 2V57A 2NOGA 2NVXJ 2QF7A 2R7ZJ 2GFNA 5EDNA 5IPAA 3LSRA 1MSEC 3HGGA 5HBUA 2QIBA 5J1YA 4MFDA 4XK4A 1IDYA 3BG5A 1AU7A 3NRGA 1MBGA 2L7ZA 1K83J 1VF9A 1RESA 1GDTA 2UXHA 3COLA 4MLOA 2O8KA 3K2AA 2GBYA 3Q0VA 3SFIA 3S1MJ 4XIDA 3JRBA 1GV2A 2O7OA 4JP0A 1IV6A 3GTGJ 3OSGA 2HOAA 2R0QC 2D5VA 1HLVA 3QPSA 2ZCMA 5IYBJ 2R5YA 3TP3A 3GEUA 1U78A 3JSJA 3UKGA 1GVDA 2MSYA 3PO3J 2ZB9A 5M3MJ 3HIMA 3VW0A 2E19A 5BNGA 1P7IA 2ZCNA 3S1NJ 2OERA 2JN6A 2LD5A 1LE8B 1D5YA 1P7JA 4GCKA 2G7LA 4X1EA 2EBIA 2WGBA 3PM1A 2NX4A 2XB0X 3VP5A 1JGGA 1IGNA 3GZIA 3ZQIA 4DYRA 1QVTA 1JJ6C 1XG1A 2EZKA 2H1KA 2ME0A 3FK6A 2GM4A 2R92J 3CJDA 2DA6A 2R5YB 4ABZA 3EUPA 2EZHA 3HOVJ 3M3YJ 4BXXJ 3HTIA 5D19A 1MH3A 1S7EA 2W48A 4C2MJ 2NVTJ 1ZK8A 5E3NA 2DA7A 3HOWJ 2HI3A 5EZGA 1FJLA 4XRSG 2YVEA 3FIWA 3A03A 3DCFA 4C3HJ 2KT0A 5EFYA 4HKUA 5C4YA 1LFUP 5IP9J 5GP9A 1WH5A 2L7FP 4M3GA 2HYTA 3M4OJ 2UXIA 1FIAA 3FISA 2HOTA 5FJ8J 3HBLA 2UXOA 1TWCJ 2NP5A 3HTJA 4UUTA 1AKHA 1XC5A 3NXCA 1OJLA 1U9NA 1F36A 2VKEA 1I50J 3BCGA 4B4CA 1ZTRA 2EQRA 2DTZA 2RAEA 5F04A 2XGDA 3VVXA 1APLC 4BBSJ 3VOXA 3O8HA 5GPCA 5FKMA 2F07A 2QTQA 3BG3A 3F1BA 4FISA 3LWJA 4UUSA 9ANTA 1ETWA 5DAJA 3Q0WA 1HCRA 3DEWA 1YRNB 4V2FA 4W97A 3BTIA 1IDZA 2LLKA 2LKXA 2E2IJ 3QKXA 1X2MA 3Q0UA 2YU9J 3S17J 3JRHA 2YVHA 3G1MA 4QIWN 2EH3A 3O8GA 4BY7J 3G1LA 5EYRA 5F0CA 4ACIA 1I3QJ 2LVSA 4FE4A 3ZQFA 4QSHA 2NP3A 1MBEA 3I4NJ 1T33A 2PMZN 2DMTA 3RH2A 2WB1N 1G2HA 3GTMJ 1W0TA 1E3OC 4DZPA 1ENHA 4RBOA 3HM5A 3IH2A 5EG0B 5HSZA 1ORKA 1MBFA 2XGCA 3FRQA 3SJMA 5EGOA 4ME9A 2XPVA 3FK7A 3ON2A 2E2HJ 5K7ZA 1FIPA 2EZIA 3GTKJ 4A93J 1X2NA 2X48A 5EEAA 2CQXA 5AQCA 1FTTA 1OCPA 2MG4A 5JLXA 2XSDC 1NK2P 2LFBA 3T6NA 4NN1A 2HYJA 2HOSA 2L0KA 2QCOA 2WAQN 3S2DJ 2QOPA 3PPBA 3TP0A 1OFCX 5CW8A 5FLVA 4AF5A 3FKIJ 3B6AA 3ZQGA 5HAWA 4ICHA 1CQTA 3HOUJ 3VPRA 2DJNA 3W6VA 3HEFA 1MBJA 3ZQLA 2KDZA 1SGMA 3S16J 5FKLA 5F27A 4DZJA 3HE0A 4FE7A 2DMPA 4MK6A 3NAUA 3QPLA 2QKOA 1Z77A 3F0CA 4D7NA 5FMPA 2K40A 2RHAA 3LHQA 2G7GA 4MIMA 1MSFC 4UDSA 3ZQCA 4XRSA 2DA4A 3JR9A 1LFBA 1PUFA 3TEDA 1WGXA 3BR1A 2P81A 1H88C 3KKDA 1B8IB 1EF4A 3JRGA 1QVUA 5IYDJ 1TWAJ 2WUIA 3DPJA 1ETYA 1UI5A 3OSFA 2Y9ZA 2G7SA 3A01A 3ON4A 1ITYA 5F08A 1BW5A 3L1PA 3CQZJ 3S2HJ 3VVZA 5M5YJ 3HTAA 1RPWA 2L9RA 4MXMA 5F0HA 5C3EJ 5EZHA 3JREA 3BR3A 3BTJA 5C4JJ 1U8BA 1TWFJ 3B81A 1UI6A 4A69C 1JUSA 4FCYA 1Z0XA 4IHYA 2Y9YA 4AYBN 1IRZA 4A3MJ 3GTQJ 2GUHA 2DMNA 4M3EA 3LSGA 2ECCA 2ZOYA 1OCTC 3VIBA 4W1UA 1IJWC 3KNWA 3CRJA 5D18A 4G12A 1RKWA 1U9OA 3IH4A 1RETA 4CGRA 3VVYA 5GPAA 2JWTA 4C3JJ 1JT0A 5K7FA 1H8AC 4GCLA 3A02A 3BTCA 2JJ7A 2CRGA 3BHQA 1GUUA 5J1UA 3Q3SA 4IHXA 3S1RJ 2PBXA 4JX6A 4JNNA 2HKUA 3C2BA 3GTLJ 3LNQA 1W0UA 5FLMJ 3GTJJ 2TRTA 3V78A 2LK2A 4AUXA 1IG7A 1MBKA 3I4MJ 2M34A 4RDUA 3PO2J 2X9DA 1GT0C 3LJLA 4GFLA 2DG8A 3O60A 2DMQA 3NNRA 1K61A 4MO7A 2DG7A 3OIOA 1X58A 1B72B 1B8IA 1HDDC 3C07A 3TW6A 2ZOZA 2IBDA 1ETQA 3NPIA 1VNDA 4A3JJ 4A3IJ 4AC6A 3GTPJ 2NVYJ 2NVQJ 1BL0A 5F0FA 2ELKA 2E1OA 2M9HA 4IHVA 3ZOBA 3H3VK 2FX0A 1O4XA 4QTRA 4D5FA 5IYCJ 4C3IJ 1JUMA 3MN2A 1ZGWA 5IOYA 5IP7J 3IH3A 3E7LA 1ZQ3P 2CUEA 2FBQA 3TW7A 3BR0A 5IP6A 1YRNA 3OOUA 4I76A 4FTHA 1Y1VJ 3A01B 3HDDA 1ETVA 2VPRA 5M3FJ 1IC8A 1AKHB 1RR7A 2G0EA 2ID3A 4B1RA 1JKPC 4M3FA 4A3BJ 2OPTA 4EEFG 5H9TA 3HOYJ 4D7MA 4IHWA 4PXIA 2DMUA 3RQIA 2JMWA 4CYCB 4NDLA 2R5ZB 3S14J 1FEXA 4M3DA 4A3EJ 3BQYA 5FKOA 4L62A 3RKQA 3BR6A 1H89C 1GV5A 1PUFB 4JX4A 3JRCA 2FD5A 1MH4A 3S5RA 4A3FJ 1DU0A 2FJ1A 3HOZJ 1ZR4A 3BJBA 3ZQHA 1ETXA 2TCTA 4BY1J 4BKXA 5J1RA 1UMQA 1RKTA 2L7MP 2IU5A 3H0GJ 3MKLA 2LTPA 3HB9A 3BT9A 2JK3A 1JKQC 5FKNA 2I10A 5EGOB 4CYCA 2R5ZA 3HKZN 3G1OA 1IUFA 1SFOJ 4D5CA 5C4XJ 3KZ9A 5E3LA 2UXUA 3VW2A 1QRYA 3ANPA 4HNVA 4GFBA 3HOXJ 1JT6A 1WH7A 2FQ4A 4IEJA 2DA5A 2XPWA 3EGQA 4DYCA 2Y30A 2K9NA 1AHDP 3VW1A 1UHSA 4B3AA 5F1JA 2W53A 4S0HB 5IOZA 1XS9A 2M2EA 4GFKA 3G7RA 3GTOJ 3BRUA 5D1RA 1BJZA 3QQAA 3GBGA 1MNMC 2D6YA 2NS7A 5CXGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CQQ A;  3BR5 A;  2DA2 A;  1ETK A;  4AC0 A;  5E3M A;  1ZKG A;  2ME6 A;  2K9S A;  1JKR C;  3CCY A;  2K9Q A;  1T56 A;  3S1Q J;  4BBR J;  1JTX A;  1VI0 A;  1HOM A;  2EZL A;  2O7T A;  3V6G A;  1POG A;  2GLO A;  1BW6 A;  4GCT A;  4NEL A;  1JJ8 C;  3RZO J;  5DS9 A;  2JA7 J;  4MFE A;  1TC3 C;  4YZE A;  3B6C A;  5EG0 A;  5FGL A;  3BR2 A;  3P9T A;  4L5E A;  2E2J J;  2M8G X;  1HDP A;  3CDL A;  5C44 J;  5K7H A;  5E3O A;  1HF0 A;  3JRD A;  5EF6 A;  1B72 A;  2ID6 A;  2GEN A;  3IUV A;  1ZR2 A;  1R9T J;  1UG2 A;  4XRM A;  1WPK A;  4M3B A;  2CU7 A;  2IEK A;  3LSJ A;  2CUF A;  2ZCX A;  2RAS A;  2DA1 A;  4JX5 A;  2REK A;  5CXI A;  2XGE A;  3WHC A;  4DW6 A;  4J19 A;  5JLW A;  2IAI A;  2COB A;  3CWR A;  3G56 A;  5M5X J;  2M0C A;  3NI7 A;  3JRA A;  3SDG A;  3PAS A;  3MNL A;  3JRF A;  1WCM J;  3RD3 A;  3E7Q A;  1MBH A;  2QWT A;  2ECB A;  4V2G A;  2XDN A;  2Y31 A;  2O9L A;  5HOD A;  3CMY A;  4Y52 J;  2B63 J;  2JA5 J;  2OF7 A;  2HQ5 A;  1A5J A;  2H8R A;  4JL3 A;  4A3G J;  4A3K J;  2YUS A;  3KKC A;  3BQZ A;  3JRI A;  2UXP A;  2Y0S N;  3RZD J;  3BNI A;  3QBM A;  2JA8 J;  1JTY A;  4A3C J;  4M6V A;  1VFC A;  1I6H J;  3NAR A;  1FTZ A;  4X6A J;  3S15 J;  5FHP A;  2MGQ A;  1JUP A;  2HXO A;  4A3L J;  1ETO A;  3IV5 A;  2XB5 A;  3HGY A;  2VKV A;  4A3D J;  2N8G A;  1WI3 A;  3LSP A;  1F43 A;  3VUQ A;  3HTH A;  2XRL A;  3AQT A;  4XIC A;  2MW8 A;  1Q1V A;  3K7A J;  3ANG A;  2CJJ A;  2DA3 A;  3BG9 A;  5J3L A;  3BTL A;  4Y7N J;  5M5W J;  4KWA A;  2VUM J;  2AO9 A;  2YS9 A;  1QPI A;  4I6Z A;  3MVP A;  5DTD A;  2Q24 A;  2Y2Z A;  1BA5 A;  4LOC A;  1JKO C;  5K58 A;  2DN0 A;  1NK3 P;  2G3B A;  2WV1 A;  5FKK A;  1NTC A;  3VOK A;  1TWH J;  4UUS B;  2PZ9 A;  3AQS A;  1SAN A;  3D1N I;  2X6O A;  2XPU A;  2OI8 A;  2VI6 A;  2LP0 A;  2AHQ A;  2JA6 J;  2R93 J;  1LE8 A;  4JYK A;  2LR8 A;  4DYQ A;  4JKZ A;  3LOC A;  2HXI A;  3WHB A;  1Y1W J;  2HDD A;  1DU6 A;  1A6I A;  2NS8 A;  1TWG J;  2LY9 A;  2V57 A;  2NOG A;  2NVX J;  2QF7 A;  2R7Z J;  2GFN A;  5EDN A;  5IPA A;  3LSR A;  1MSE C;  3HGG A;  5HBU A;  2QIB A;  5J1Y A;  4MFD A;  4XK4 A;  1IDY A;  3BG5 A;  1AU7 A;  3NRG A;  1MBG A;  2L7Z A;  1K83 J;  1VF9 A;  1RES A;  1GDT A;  2UXH A;  3COL A;  4MLO A;  2O8K A;  3K2A A;  2GBY A;  3Q0V A;  3SFI A;  3S1M J;  4XID A;  3JRB A;  1GV2 A;  2O7O A;  4JP0 A;  1IV6 A;  3GTG J;  3OSG A;  2HOA A;  2R0Q C;  2D5V A;  1HLV A;  3QPS A;  2ZCM A;  5IYB J;  2R5Y A;  3TP3 A;  3GEU A;  1U78 A;  3JSJ A;  3UKG A;  1GVD A;  2MSY A;  3PO3 J;  2ZB9 A;  5M3M J;  3HIM A;  3VW0 A;  2E19 A;  5BNG A;  1P7I A;  2ZCN A;  3S1N J;  2OER A;  2JN6 A;  2LD5 A;  1LE8 B;  1D5Y A;  1P7J A;  4GCK A;  2G7L A;  4X1E A;  2EBI A;  2WGB A;  3PM1 A;  2NX4 A;  2XB0 X;  3VP5 A;  1JGG A;  1IGN A;  3GZI A;  3ZQI A;  4DYR A;  1QVT A;  1JJ6 C;  1XG1 A;  2EZK A;  2H1K A;  2ME0 A;  3FK6 A;  2GM4 A;  2R92 J;  3CJD A;  2DA6 A;  2R5Y B;  4ABZ A;  3EUP A;  2EZH A;  3HOV J;  3M3Y J;  4BXX J;  3HTI A;  5D19 A;  1MH3 A;  1S7E A;  2W48 A;  4C2M J;  2NVT J;  1ZK8 A;  5E3N A;  2DA7 A;  3HOW J;  2HI3 A;  5EZG A;  1FJL A;  4XRS G;  2YVE A;  3FIW A;  3A03 A;  3DCF A;  4C3H J;  2KT0 A;  5EFY A;  4HKU A;  5C4Y A;  1LFU P;  5IP9 J;  5GP9 A;  1WH5 A;  2L7F P;  4M3G A;  2HYT A;  3M4O J;  2UXI A;  1FIA A;  3FIS A;  2HOT A;  5FJ8 J;  3HBL A;  2UXO A;  1TWC J;  2NP5 A;  3HTJ A;  4UUT A;  1AKH A;  1XC5 A;  3NXC A;  1OJL A;  1U9N A;  1F36 A;  2VKE A;  1I50 J;  3BCG A;  4B4C A;  1ZTR A;  2EQR A;  2DTZ A;  2RAE A;  5F04 A;  2XGD A;  3VVX A;  1APL C;  4BBS J;  3VOX A;  3O8H A;  5GPC A;  5FKM A;  2F07 A;  2QTQ A;  3BG3 A;  3F1B A;  4FIS A;  3LWJ A;  4UUS A;  9ANT A;  1ETW A;  5DAJ A;  3Q0W A;  1HCR A;  3DEW A;  1YRN B;  4V2F A;  4W97 A;  3BTI A;  1IDZ A;  2LLK A;  2LKX A;  2E2I J;  3QKX A;  1X2M A;  3Q0U A;  2YU9 J;  3S17 J;  3JRH A;  2YVH A;  3G1M A;  4QIW N;  2EH3 A;  3O8G A;  4BY7 J;  3G1L A;  5EYR A;  5F0C A;  4ACI A;  1I3Q J;  2LVS A;  4FE4 A;  3ZQF A;  4QSH A;  2NP3 A;  1MBE A;  3I4N J;  1T33 A;  2PMZ N;  2DMT A;  3RH2 A;  2WB1 N;  1G2H A;  3GTM J;  1W0T A;  1E3O C;  4DZP A;  1ENH A;  4RBO A;  3HM5 A;  3IH2 A;  5EG0 B;  5HSZ A;  1ORK A;  1MBF A;  2XGC A;  3FRQ A;  3SJM A;  5EGO A;  4ME9 A;  2XPV A;  3FK7 A;  3ON2 A;  2E2H J;  5K7Z A;  1FIP A;  2EZI A;  3GTK J;  4A93 J;  1X2N A;  2X48 A;  5EEA A;  2CQX A;  5AQC A;  1FTT A;  1OCP A;  2MG4 A;  5JLX A;  2XSD C;  1NK2 P;  2LFB A;  3T6N A;  4NN1 A;  2HYJ A;  2HOS A;  2L0K A;  2QCO A;  2WAQ N;  3S2D J;  2QOP A;  3PPB A;  3TP0 A;  1OFC X;  5CW8 A;  5FLV A;  4AF5 A;  3FKI J;  3B6A A;  3ZQG A;  5HAW A;  4ICH A;  1CQT A;  3HOU J;  3VPR A;  2DJN A;  3W6V A;  3HEF A;  1MBJ A;  3ZQL A;  2KDZ A;  1SGM A;  3S16 J;  5FKL A;  5F27 A;  4DZJ A;  3HE0 A;  4FE7 A;  2DMP A;  4MK6 A;  3NAU A;  3QPL A;  2QKO A;  1Z77 A;  3F0C A;  4D7N A;  5FMP A;  2K40 A;  2RHA A;  3LHQ A;  2G7G A;  4MIM A;  1MSF C;  4UDS A;  3ZQC A;  4XRS A;  2DA4 A;  3JR9 A;  1LFB A;  1PUF A;  3TED A;  1WGX A;  3BR1 A;  2P81 A;  1H88 C;  3KKD A;  1B8I B;  1EF4 A;  3JRG A;  1QVU A;  5IYD J;  1TWA J;  2WUI A;  3DPJ A;  1ETY A;  1UI5 A;  3OSF A;  2Y9Z A;  2G7S A;  3A01 A;  3ON4 A;  1ITY A;  5F08 A;  1BW5 A;  3L1P A;  3CQZ J;  3S2H J;  3VVZ A;  5M5Y J;  3HTA A;  1RPW A;  2L9R A;  4MXM A;  5F0H A;  5C3E J;  5EZH A;  3JRE A;  3BR3 A;  3BTJ A;  5C4J J;  1U8B A;  1TWF J;  3B81 A;  1UI6 A;  4A69 C;  1JUS A;  4FCY A;  1Z0X A;  4IHY A;  2Y9Y A;  4AYB N;  1IRZ A;  4A3M J;  3GTQ J;  2GUH A;  2DMN A;  4M3E A;  3LSG A;  2ECC A;  2ZOY A;  1OCT C;  3VIB A;  4W1U A;  1IJW C;  3KNW A;  3CRJ A;  5D18 A;  4G12 A;  1RKW A;  1U9O A;  3IH4 A;  1RET A;  4CGR A;  3VVY A;  5GPA A;  2JWT A;  4C3J J;  1JT0 A;  5K7F A;  1H8A C;  4GCL A;  3A02 A;  3BTC A;  2JJ7 A;  2CRG A;  3BHQ A;  1GUU A;  5J1U A;  3Q3S A;  4IHX A;  3S1R J;  2PBX A;  4JX6 A;  4JNN A;  2HKU A;  3C2B A;  3GTL J;  3LNQ A;  1W0U A;  5FLM J;  3GTJ J;  2TRT A;  3V78 A;  2LK2 A;  4AUX A;  1IG7 A;  1MBK A;  3I4M J;  2M34 A;  4RDU A;  3PO2 J;  2X9D A;  1GT0 C;  3LJL A;  4GFL A;  2DG8 A;  3O60 A;  2DMQ A;  3NNR A;  1K61 A;  4MO7 A;  2DG7 A;  3OIO A;  1X58 A;  1B72 B;  1B8I A;  1HDD C;  3C07 A;  3TW6 A;  2ZOZ A;  2IBD A;  1ETQ A;  3NPI A;  1VND A;  4A3J J;  4A3I J;  4AC6 A;  3GTP J;  2NVY J;  2NVQ J;  1BL0 A;  5F0F A;  2ELK A;  2E1O A;  2M9H A;  4IHV A;  3ZOB A;  3H3V K;  2FX0 A;  1O4X A;  4QTR A;  4D5F A;  5IYC J;  4C3I J;  1JUM A;  3MN2 A;  1ZGW A;  5IOY A;  5IP7 J;  3IH3 A;  3E7L A;  1ZQ3 P;  2CUE A;  2FBQ A;  3TW7 A;  3BR0 A;  5IP6 A;  1YRN A;  3OOU A;  4I76 A;  4FTH A;  1Y1V J;  3A01 B;  3HDD A;  1ETV A;  2VPR A;  5M3F J;  1IC8 A;  1AKH B;  1RR7 A;  2G0E A;  2ID3 A;  4B1R A;  1JKP C;  4M3F A;  4A3B J;  2OPT A;  4EEF G;  5H9T A;  3HOY J;  4D7M A;  4IHW A;  4PXI A;  2DMU A;  3RQI A;  2JMW A;  4CYC B;  4NDL A;  2R5Z B;  3S14 J;  1FEX A;  4M3D A;  4A3E J;  3BQY A;  5FKO A;  4L62 A;  3RKQ A;  3BR6 A;  1H89 C;  1GV5 A;  1PUF B;  4JX4 A;  3JRC A;  2FD5 A;  1MH4 A;  3S5R A;  4A3F J;  1DU0 A;  2FJ1 A;  3HOZ J;  1ZR4 A;  3BJB A;  3ZQH A;  1ETX A;  2TCT A;  4BY1 J;  4BKX A;  5J1R A;  1UMQ A;  1RKT A;  2L7M P;  2IU5 A;  3H0G J;  3MKL A;  2LTP A;  3HB9 A;  3BT9 A;  2JK3 A;  1JKQ C;  5FKN A;  2I10 A;  5EGO B;  4CYC A;  2R5Z A;  3HKZ N;  3G1O A;  1IUF A;  1SFO J;  4D5C A;  5C4X J;  3KZ9 A;  5E3L A;  2UXU A;  3VW2 A;  1QRY A;  3ANP A;  4HNV A;  4GFB A;  3HOX J;  1JT6 A;  1WH7 A;  2FQ4 A;  4IEJ A;  2DA5 A;  2XPW A;  3EGQ A;  4DYC A;  2Y30 A;  2K9N A;  1AHD P;  3VW1 A;  1UHS A;  4B3A A;  5F1J A;  2W53 A;  4S0H B;  5IOZ A;  1XS9 A;  2M2E A;  4GFK A;  3G7R A;  3GTO J;  3BRU A;  5D1R A;  1BJZ A;  3QQA A;  3GBG A;  1MNM C;  2D6Y A;  2NS7 A;  5CXG A; 
#chains in the Genus database with same CATH topology
 3OYB A;  2B0L A;  2XF7 A;  2DA2 A;  4BHP A;  4KUM A;  1D0Z A;  1W1W E;  1VQN I;  3BRO A;  3CCY A;  4OIR F;  3OYH A;  1T56 A;  2EZL A;  2QVO A;  1POG A;  1IN7 A;  2IJL A;  2CWE A;  5JFR A;  3IP4 B;  2CV1 A;  4BEH A;  5DS9 A;  1HW2 A;  2P4W A;  4MFE A;  3TQN A;  2WAQ A;  3SYT A;  4XLE A;  2VKD A;  3HRT A;  1T0F A;  2CO5 A;  1FPQ A;  5J6X A;  3KP4 A;  2E2J J;  1FMV A;  2XAF A;  4PSX A;  2M8G X;  4KN4 X;  1I1G A;  1REP C;  2A69 F;  2CG4 A;  1VQM I;  3WE2 A;  3ASN H;  2MAB A;  2PG4 A;  3I53 A;  1I5Z A;  2RAS A;  2QWW A;  3GF2 A;  2DA1 A;  2VB6 A;  4LD5 A;  1BBY A;  3WHC A;  3BG7 A;  1G3T A;  4J19 A;  5JLW A;  2IAI A;  2COB A;  2MLG A;  2VN2 A;  3MNL A;  2WAF A;  1WCM J;  5LEK A;  2QWT A;  3PIO F;  4LB5 A;  2K4B A;  5GAD J;  3OYJ A;  2XDN A;  2Y31 A;  4D0P A;  2O9L A;  1W5S A;  5ILS A;  1J0R A;  3N4M A;  1E2X A;  2JA5 J;  2OF7 A;  4JL3 A;  2H8R A;  3J81 K;  3DPU A;  4IPA A;  3CC4 I;  4FET A;  3BQZ A;  1X4O A;  2Y0S N;  5FD6 A;  3BNI A;  3QBM A;  1Z21 A;  3NAR A;  4G9Y A;  4ZYA A;  2MGQ A;  1JUP A;  2CYY A;  4WWC A;  4JK1 X;  3LSP A;  2OTL I;  1FX7 A;  2DW4 A;  3DBR B;  3A4C A;  4BDZ A;  4BL0 B;  1H9G A;  2P6T A;  3ANG A;  4B44 A;  1LKX A;  1RNL A;  3CUQ B;  4U0W A;  3ERE D;  3HPH A;  2QSG X;  1W36 C;  1JXS A;  4HST A;  4KWA A;  1SFE A;  2AO9 A;  4U0Y A;  1OMI A;  2YS9 A;  3ZXS A;  5ICG A;  4RS8 A;  1QPI A;  2HNH A;  3MVP A;  2Q24 A;  2QZ8 A;  2Y2Z A;  2VC0 A;  2F4I A;  3C7J A;  2JRT A;  1PYV A;  5K58 A;  1CF7 B;  2PN6 A;  4JOM A;  2EJR A;  4GDF A;  1KU7 A;  3WG9 A;  5D5W B;  2V1X A;  1NTC A;  4WXH A;  3OYE A;  3LAJ A;  3VOK A;  4OIP F;  2RN7 A;  2PZ9 A;  1V5F A;  2FBI A;  5HLH A;  1R4N B;  5KNL A;  4L18 B;  4A6D A;  3PQJ A;  3H92 A;  2UXN A;  2JA6 J;  1U5T A;  4U87 A;  4WX9 A;  5D5U B;  3CC2 I;  4AU7 A;  3WHB A;  4IHS A;  3R60 A;  3SXY A;  3IL2 A;  2NS8 A;  1YO5 C;  3WTY C;  4P5O A;  1S72 I;  1ZYR F;  1E17 A;  2R7Z J;  4PGH A;  3OIP A;  4HG2 A;  5L3D A;  3EQL F;  3KE2 A;  4N9I A;  2ZSI B;  1QU3 A;  5HBU A;  1LEB A;  1OLT A;  2ZNZ A;  2QIB A;  3DBL B;  4MFD A;  5CVR A;  1R22 A;  1RR8 C;  3MKW B;  4XKC A;  2EFN A;  1VF9 A;  1RES A;  1GXP A;  2UXH A;  2QSF X;  3AL0 C;  3Q5F A;  2V9V A;  4XLF A;  4L5J A;  1ZAR A;  5JVT A;  4CCO A;  2JSP A;  3QOP A;  3OYF A;  2FA5 A;  3DPT A;  3QPT A;  3TO6 A;  2R0Q C;  5IYB J;  4U9L A;  2ESN A;  3TP3 A;  2DI3 A;  3HKZ A;  1MNE A;  4IQ4 A;  1FBU A;  4AM3 A;  3JSJ A;  4PK4 A;  2DBB A;  4BDY A;  1GVD A;  4XOT A;  2CUJ A;  1HA8 A;  4HX8 A;  3HG9 A;  2E19 A;  1Z7L A;  4M6Y A;  2LD5 A;  1D5Y A;  2G7L A;  4ESJ A;  3WTZ A;  3E5U A;  3GZI A;  2DYS H;  3KP6 A;  2ZC2 A;  4A0Y A;  2EZK A;  2ME0 A;  2GM4 A;  1HST A;  1G59 A;  2DA6 A;  3EUP A;  2EZH A;  2YPR A;  1YYV A;  3AG4 H;  5HS7 A;  3PIP F;  1X19 A;  2W24 A;  1S7E A;  2BBY A;  1X1P A;  1RUO A;  3H5R A;  2JQ7 A;  2HI3 A;  3HRM A;  3FIW A;  4N9H A;  2FBK A;  4HKU A;  4LIU A;  3CUO A;  5IP9 J;  5BPI A;  3VFZ A;  4XLP F;  1FC3 A;  1MDM A;  2QLZ A;  3DKW A;  2DCE A;  1KA8 A;  5FJ8 J;  4RB3 C;  1FLI A;  3HBL A;  4KMF A;  2X6X A;  3J7Z I;  5A2Q Z;  2RV8 A;  4E7H A;  1S29 A;  2IA0 A;  5IY5 H;  3ZQ7 A;  1HSJ A;  4UUT A;  5CKT A;  1OJL A;  1R1T A;  2VJ5 A;  4XSX F;  3GYH X;  2VKE A;  1SEU A;  3HRU A;  3BCG A;  1ZTR A;  2Y0S A;  5F04 A;  1OR7 A;  2XGD A;  4OAZ A;  5GPC A;  5K1Y A;  1WJC A;  3BP8 A;  2K9L A;  3DXJ F;  3KX2 A;  1HKS A;  2BE5 F;  1IRG A;  5E8I A;  3FXJ A;  2QM3 A;  1FBQ A;  4UUS A;  3BZ6 A;  1ETW A;  2HU9 A;  5DAJ A;  3EUH C;  1J2X A;  3LA3 A;  2M30 A;  3DEW A;  4Q47 A;  1W36 D;  1HCR A;  3KEO A;  2LBF B;  4W97 A;  4YG2 F;  1X3U A;  3SQN A;  1FP1 D;  3W2A A;  2ZXI A;  3EYI A;  1IDZ A;  3W6J B;  3SZT A;  3QKX A;  3K69 A;  2GWR A;  4LIV A;  4KIF A;  4A2U A;  4ENJ A;  3S17 J;  4EJU A;  1XD7 A;  4OOI A;  4QIW N;  5EYR A;  5F0C A;  2LVS A;  3K4M A;  1DQU A;  5KHD A;  2NP3 A;  3WTS C;  1MBE A;  4P9F A;  2PMZ N;  4IO9 F;  2DMT A;  2PFV A;  4EM1 A;  1YI2 I;  3L2V A;  2COM A;  4XNF A;  3SEZ A;  5CVI A;  2KRC A;  1ENH A;  2FNA A;  1S7A A;  5EG0 B;  2LNB A;  4Z6Y A;  4K2E A;  3H9G A;  5HSZ A;  5LGN A;  4A5N A;  3ULQ B;  2XGC A;  3SJM A;  5EGO A;  3WTU C;  3L2C A;  2E2H J;  2EZI A;  3OR2 C;  1A35 A;  4I2O A;  3GTK J;  4L0Y B;  2QSH X;  4A93 J;  4FX0 A;  4ZC3 A;  2XAJ A;  3JSO A;  5CLS A;  3S93 A;  2DPU A;  2A61 A;  3OYD A;  2MG4 A;  2XSD C;  1U8R A;  4Y15 A;  1T39 A;  3KYD B;  3T6N A;  2O5R A;  2RQP A;  2PFB A;  1TNS A;  2D1V A;  1R6R A;  3EPZ A;  1QA6 A;  3FKI J;  1B9N A;  1Z7U A;  4AF5 A;  2EIJ H;  4DBR A;  4F55 A;  5E79 C;  2R7X A;  2XAU A;  3OYA A;  2LDU A;  2W7N A;  3IUO A;  3CJN A;  4BQQ A;  1VQ8 I;  2WC2 A;  3ZQL A;  2L3D A;  1VQP I;  5HLI A;  3WTV C;  4B47 A;  3HE0 A;  4BQN A;  4FE7 A;  3NAU A;  5LEJ A;  1UB9 A;  1MMD A;  1Z77 A;  2K40 A;  2RHA A;  3LHQ A;  2MFZ A;  3PNV A;  2ZCW A;  4UDS A;  3ZQC A;  2DA4 A;  5KK1 A;  2LMD A;  1IRF A;  2X1E A;  2R7T A;  1OYI A;  3MEX A;  3U1K A;  2BEO A;  5A2Q K;  2MD0 A;  2IGN A;  4FAS D;  2PJR A;  2M1B A;  3V7S A;  2G7H A;  4BQO A;  3JAM Z;  2BW3 B;  2R7V A;  2KQR A;  3JRG A;  1T08 B;  4FQG A;  2CW0 F;  1LDJ A;  1WJF A;  5IYD J;  4P55 A;  4D1Q A;  2V7F A;  4ZDO A;  3TKY A;  4HOB A;  3DEE A;  4BH9 A;  2DJI A;  5F08 A;  2IS6 A;  1TQM A;  2HR3 A;  3H35 A;  4PCQ A;  4E7L A;  1RI7 A;  3EET A;  2ZJP F;  4ZTF A;  2B7E A;  2OQG A;  3F8M A;  5JR3 A;  5L3C A;  5C3E J;  5EZH A;  1J59 A;  1K78 B;  3BR3 A;  4BGD A;  1QPM A;  3F23 A;  1R00 A;  2XAQ A;  4BS9 A;  3B81 A;  1R4M B;  4A69 C;  4MNU A;  4R8H A;  4IHY A;  2Y9Y A;  4AYB N;  3I3L A;  3K1P A;  1IRZ A;  5DCF A;  2HPI A;  3ABT A;  5JI6 A;  2IS4 A;  3V7R A;  4LLN A;  5FFZ A;  3CTA A;  3DP7 A;  1BC8 C;  4DVY P;  2HWV A;  5D4R A;  1RET A;  3IH4 A;  4ON0 A;  4IF4 A;  3ZN0 A;  1JT0 A;  2KKO A;  2EA4 A;  3I64 A;  3U21 A;  2MD5 A;  2V6C A;  4M73 A;  5J1U A;  3WE3 A;  3Q3S A;  1YIT I;  3H36 A;  3S1R J;  2WA0 A;  1T0F C;  3KZY A;  2PBX A;  4CUG A;  4EGZ A;  2BW3 A;  3QRF F;  3L09 A;  3HHG A;  2V26 A;  3LNQ A;  4BE2 A;  1R23 A;  1WJ5 A;  1W0U A;  3GTL J;  3GTJ J;  3IKT A;  4AUX A;  1IG7 A;  3PO2 J;  4ZYG A;  3SDB A;  1LDD A;  1SFK A;  2BY2 A;  4RAZ A;  3LWF A;  2DMQ A;  2E1N A;  3HUG B;  5J4Y A;  4B43 A;  1B8I A;  3TW6 A;  1W5T A;  1S8N A;  3NPI A;  1TP4 A;  3VYT B;  2R7W A;  2FE3 A;  3VYU B;  2QEN A;  4RGR A;  4AC6 A;  1U6G A;  2P6S A;  2R7U A;  2P5K A;  2NVQ J;  1D8K A;  1BL0 A;  5F0F A;  5HLT A;  5HDN A;  3SZG A;  3ZOB A;  2ACJ A;  2FX0 A;  1R7J A;  3ZMV A;  1RRJ A;  4AD9 A;  4KYW A;  2PBI A;  4NC6 A;  3MD2 A;  1JUM A;  2LRD A;  5IP7 J;  2PQ8 A;  2FU4 A;  1GXQ A;  4BYY A;  1FP2 A;  3CLQ A;  1S6L A;  1Y1V J;  3A01 B;  3GZN B;  2VPR A;  5M3F J;  4EAT A;  1KQ8 A;  4D9J A;  4ESB A;  4M3F A;  2ZFU A;  3ZCO A;  5H9T A;  4CCN A;  3HOY J;  4L9T A;  4IHW A;  3PFI A;  2QQ8 A;  3RQI A;  5FRN A;  4M3D A;  4A3E J;  4AYB A;  2OZ6 A;  4L62 A;  2BYV E;  3RKQ A;  1KGS A;  1PUF B;  2F4M B;  2FD5 A;  1MH4 A;  4RLQ A;  3TO9 A;  3S5R A;  4XKB A;  2RKH A;  2ZJ2 A;  3BJB A;  4RM3 A;  1ZLK A;  3CF2 A;  4DGW B;  5BPD A;  1UJ8 A;  3M07 A;  2IU5 A;  3GFL A;  2LF8 A;  3HB9 A;  2K7L A;  1JKQ C;  4AIJ A;  4ENM A;  3ML6 A;  1OCR H;  4BUP A;  3G1O A;  1IUF A;  1SFO J;  5E3L A;  5DD8 A;  1B9M A;  3PFY A;  3HOX J;  1FMW A;  1U5T C;  1Z1D A;  2H1L A;  3EGQ A;  4HF1 A;  3GVA A;  1AHD P;  3VW1 A;  1Z6R A;  1UHS A;  1N25 A;  5F1J A;  4ZDP A;  2A2F X;  5EJC A;  3AG1 H;  3OS1 A;  2BHZ A;  3G7R A;  5DD4 A;  3TDZ C;  3BRU A;  1BI1 A;  3QQA A;  2PMU A;  4AIH A;  2DTR A;  1ZG1 A;  3RSN A;  2D6Y A;  2ZY9 A;  4Y4R A;  3BDD A;  4G7Z F;  2YSR A;  1K6Y A;  2CQQ A;  4TV7 A;  3KPH A;  4PSW A;  1KYZ A;  1ETK A;  3T5X A;  1HKQ A;  4I02 A;  4Z2Y A;  4A12 A;  2ME6 A;  4M9Z A;  5DM6 F;  3S3O A;  2K9Q A;  1CF7 A;  1U2W A;  1O3R A;  4BBR J;  3BZK A;  3T1B A;  3V6G A;  1T95 A;  2IS1 A;  3J80 Z;  3KP3 A;  5CPR B;  4NEL A;  3RZO J;  2E35 A;  4PGG A;  2JT1 A;  4WF2 A;  3HPG A;  1BN5 A;  3RTR A;  2QQB A;  4UNO A;  4MHG A;  3RCO A;  3DEU A;  4YZE A;  1TTY A;  2H09 A;  2KIF A;  4L5E A;  1UZC A;  4HNU A;  1AWC A;  2W00 A;  4I99 C;  3U2R A;  2MBF A;  5EF6 A;  4XLN F;  2ID6 A;  2UZK A;  1B72 A;  2GEN A;  2M4K A;  1R9T J;  3IUV A;  4XN0 A;  1D3Y A;  4JX5 A;  2XGE A;  4IKF A;  3IAM 2;  2OV7 A;  4C2U A;  1E3P A;  3GME A;  5CJ9 A;  4EM2 A;  3HJE A;  3G56 A;  1IV8 A;  2XUB A;  2M0C A;  3RDI A;  3JRA A;  1T6S A;  3PAS A;  3G71 I;  1VQ4 I;  2XDV A;  1FYK A;  3D0S A;  3GLX A;  1MBH A;  2HS5 A;  1OCO H;  2ECB A;  5L3G A;  4II3 A;  4Y52 J;  2M7A A;  4M74 A;  3HTS B;  4A3K J;  3FXQ A;  1BI0 A;  2UXP A;  4RLF A;  4KT5 C;  3I58 A;  1UAA A;  3WTT C;  2JA8 J;  4A3C J;  4M6V A;  6PAX A;  1I6H J;  1FTZ A;  4X6A J;  2HXO A;  4ENK A;  1N75 A;  4A3D J;  2N8G A;  2W82 A;  1KU9 A;  2XC7 A;  1O3Q A;  2XRL A;  3OYK A;  4XMY A;  1L3L A;  3NQO A;  5ILU A;  2E71 A;  1RC9 A;  1T38 A;  4NQW A;  3F8B A;  3HZJ A;  3IC7 A;  3OY9 A;  3BPX A;  2EB7 A;  5J3L A;  1YTY A;  1PVE A;  3BTL A;  5M5W J;  1FY7 A;  3JW4 A;  1X1A A;  2CV0 A;  3K4L A;  1KYW A;  3GFM A;  4ZYE A;  3QOD A;  2EK5 A;  3PNT A;  2AXL A;  1NG7 A;  2XAG A;  4NBQ A;  3FDY A;  1C0W A;  2QQA A;  2BVM A;  2DT7 B;  2JSC A;  1ZAO A;  1A36 A;  5DEQ A;  2DN0 A;  1EH7 A;  4NC8 A;  5FKK A;  1SD7 A;  2QYO A;  1TWH J;  3VSL A;  1TQP A;  3ONQ A;  3DWL E;  4UUS B;  3AQS A;  1XX5 A;  2VON A;  3IHU A;  3JSP A;  2XPU A;  4HQE A;  4G6Q A;  1Z9C A;  2ZME B;  2BY0 A;  3BG6 A;  3CJR B;  5FO5 A;  3WTW C;  2AHQ A;  3FXO A;  1LE8 A;  3F6O A;  1D0Y A;  3QU3 A;  3MAJ A;  1YS6 A;  2LR8 A;  2KIU A;  4JKZ A;  3C1D A;  4PJM A;  3F8C A;  1A6I A;  1NG6 A;  4U7B A;  1VQ9 I;  2X6W A;  1UFM A;  3JCU C;  3HHH A;  1R49 A;  2LC2 A;  2V57 A;  4XKW A;  2QF7 A;  1WI9 A;  2KDO A;  2OA4 A;  4ENN A;  3LSR A;  3UNG C;  3HGG A;  5CYV A;  4XK4 A;  1AU7 A;  3BG5 A;  3K4C A;  2ISY A;  2DFE A;  1IXR C;  2L7Z A;  2F5V A;  1LVA A;  3KFW X;  4GYG A;  3WGG A;  5KVR A;  3QWL A;  2O8K A;  5J47 A;  3MZY A;  3Q0V A;  3K6G A;  1PP8 F;  1G3Y A;  4A6E A;  1K7A A;  1VQL I;  3S1M J;  3JRB A;  2O7O A;  4JP0 A;  3F8F A;  1WJB A;  5E1W A;  2HOA A;  3CCJ I;  1P6R A;  1HLV A;  3QPS A;  2ZCM A;  4HNT A;  2DQL A;  1X4P A;  2D45 A;  3GEU A;  2EIM H;  1U78 A;  2DU9 A;  2L9S A;  2XVC A;  1JHF A;  3ABK H;  4F92 B;  4IOA F;  1BOB A;  3OYC A;  4CDG A;  4GCK A;  3PM1 A;  3WU1 B;  1TLH B;  1IN8 A;  1JGG A;  4DYR A;  1X1D A;  4MQ9 F;  2CH0 A;  4N0B A;  3I0T A;  2RC4 A;  2VXD A;  4IRH A;  3P9K A;  2A07 F;  3I71 A;  3FK6 A;  3S32 A;  2O8X A;  3CJD A;  1I39 A;  1TZL A;  4HSR A;  4BXX J;  1D1C A;  4C9Y A;  1MH3 A;  1MIJ A;  1V4R A;  2W48 A;  3ISP A;  1ZK8 A;  5E3N A;  2BZT A;  1ZGA A;  1Z3Y A;  5EZG A;  4XRS G;  1XTA A;  2YVE A;  1JHH A;  3A03 A;  5EFY A;  2KT0 A;  4M9S A;  5K5R A;  1QO0 D;  1MMS A;  2E5Z A;  2X0L A;  5GP9 A;  1WH5 A;  2L7F P;  5GAE J;  2HYG D;  4M3G A;  1XCB A;  1D5V A;  2HYT A;  2Q0O A;  2UXI A;  1OQY A;  2HVQ A;  3FIS A;  3R0J A;  3BZC A;  3KEY A;  4HQM A;  5L3E A;  2UXO A;  1U3E M;  2WBM A;  2NP5 A;  1AKH A;  2Z9O A;  4LK0 F;  4AVP A;  1HW5 A;  3RPQ A;  3KCC A;  1F36 A;  4BJ6 C;  1I50 J;  4B4C A;  2V1U A;  4ZTJ A;  5HS9 A;  4BBS J;  2OBP A;  3CO6 C;  2DOF A;  4PUS A;  2QTQ A;  1W7P B;  5H2F C;  5B1A H;  2PX9 A;  2YX4 A;  3CDI A;  3Q0W A;  4CA0 A;  4BQA A;  1YRN B;  1DGR M;  3L2W A;  2UWM A;  4V2F A;  4OMY A;  3NS4 A;  1XGM A;  1CGP A;  4IZZ A;  2LLK A;  2CSO A;  2XKP A;  2E2I J;  2RGV A;  1X2M A;  2YU9 J;  4OIO F;  2Y69 H;  3B02 A;  3G1M A;  3TGN A;  3I9V 2;  3K4B A;  4BY7 J;  4ACI A;  1I3Q J;  1YW8 A;  3C2G A;  5BS6 A;  5E18 F;  1OYW A;  2HKO A;  1BJA A;  3FMS A;  4R79 A;  3GTM J;  1I1S A;  2CFO A;  1QBJ A;  1N77 A;  2PLY A;  1W0T A;  1E3O C;  3W3C A;  4YFX F;  4OIQ F;  2K27 A;  3T8R A;  2Z1D A;  4C2T A;  3WTX C;  3D5L A;  3TMO A;  1DPR A;  3IH2 A;  4CH7 A;  3OYM A;  2KLO A;  4ASN A;  4KIT B;  2XPV A;  3FK7 A;  5K7Z A;  1XGN A;  3R0A A;  2CV2 A;  3M8J A;  1FWZ A;  5HLG A;  3GLL A;  1ZRE A;  4LFU A;  3HXL A;  3J80 K;  5BOX A;  1P4X A;  5EEA A;  3BOQ A;  4XSZ F;  4G7H F;  2HVS A;  1OCP A;  3DU6 A;  1YHQ I;  4HF2 A;  5JLX A;  4LG3 A;  4NUB A;  2L0K A;  2WAQ N;  3S2D J;  3PPB A;  5CW8 A;  5FLV A;  2DK5 A;  1Y0N A;  4RGS A;  1R71 A;  3ZQG A;  4ICH A;  5J8F A;  2XV4 S;  4EVI A;  1MBJ A;  3CJT B;  2KDZ A;  2Y48 A;  2JRM A;  2OUM A;  1AA7 A;  3L2U A;  1F1Z A;  1U5T B;  1XMX A;  2QKO A;  3F0C A;  3S8P A;  3AAF A;  3FXU A;  1GLN A;  4MIM A;  3HUG A;  3HOT A;  1XGO A;  2VKH A;  5L3B A;  2EFP A;  2W4S A;  1PUF A;  4HYE A;  1B6A A;  3FHZ A;  1FSH A;  2VOP A;  2M87 A;  2KFD A;  3REO A;  2BOL A;  3RPU D;  4XOP A;  3G2B A;  1EF4 A;  3KP7 A;  4ETS A;  2WUI A;  3I59 A;  1TWA J;  3DPJ A;  1ETY A;  3OSF A;  2ZXW H;  3A01 A;  3C18 A;  1BW5 A;  3CCV I;  4UV8 A;  3VVZ A;  3BJA A;  3B73 A;  3V8K A;  4P96 A;  4DJA A;  4IOC F;  1FSE A;  1HW1 A;  4XM3 A;  3FMR A;  2ZNY A;  1U8B A;  3EUA A;  2B9S A;  1X1B A;  3RKX A;  4OD4 A;  2VQC A;  4PJ0 C;  2FSW A;  2EFO A;  4PFP A;  4A3M J;  1MJ9 A;  4DIQ A;  4OWR B;  4G94 A;  4MTD A;  2DMN A;  3ZMT A;  3LSG A;  2KL4 A;  3JTH A;  1RUN A;  1SVM A;  1DUX C;  1QZE A;  3FM3 A;  3KNW A;  3BJO A;  1EKE A;  5D18 A;  1RKW A;  5D5V B;  3VVY A;  1YQA A;  5DCM A;  4C3J J;  5ICC A;  4L9J A;  4GCL A;  3RI4 A;  3A02 A;  3BHQ A;  1MGT A;  1A31 A;  2EFQ A;  1UEL B;  4U7D A;  3RJP A;  3ECO A;  4RGX A;  2KIM A;  3VB2 A;  2HKU A;  3C2B A;  4E70 A;  1JE8 A;  1P9Q C;  1UST A;  3WGH A;  5FLM J;  1KU3 A;  2TRT A;  3V78 A;  4DQ2 A;  2LK2 A;  2X85 A;  3E5X A;  3I4M J;  2X1D A;  2M34 A;  2M7B A;  1FOW A;  3TDU C;  2OZU A;  2IGO A;  4PDK A;  2DDA A;  2GIZ A;  3O60 A;  4BNC A;  3RYR A;  3NNR A;  2M4G A;  2GZW A;  3JAM K;  4LJZ F;  1QHG A;  4MO7 A;  3OIO A;  4YRV A;  4EQQ A;  1ZHF A;  4CCJ A;  1P4A A;  2IBD A;  3MKZ A;  4L9N A;  4RB1 A;  1ETQ A;  1W5C C;  4A3I J;  2H6C A;  1K6O A;  4AWX B;  2A3S A;  4NB5 A;  1R58 A;  5E1Z B;  1JI8 A;  2LSO A;  1G3S A;  2M9H A;  2Y0M A;  1XCV A;  4MTE A;  4CSW A;  1PDN C;  1YFH A;  1MMN A;  2LKS A;  4IHV A;  2V1D A;  2DXI A;  5BQT A;  4CCK A;  2GA1 A;  1RZ4 A;  2A6T A;  4C3I J;  1ZGW A;  4KDP A;  4DBQ A;  3IH3 A;  3E7L A;  1WSU A;  1ZQ3 P;  3TW7 A;  3QYB A;  4DOZ A;  5IP6 A;  3OOU A;  2E1M C;  5DM7 F;  3ZMD A;  1QHH D;  3HDD A;  2OCC H;  1ETV A;  4E7K A;  1Y39 A;  1SC7 A;  4U88 A;  2ID3 A;  1JKP C;  4B1R A;  4A3B J;  4EEF G;  4FX4 A;  3COA C;  2W1O A;  2ELH A;  2V9K A;  3P9C A;  2L2O A;  2LYC A;  1PP7 U;  2R5Z B;  4KIS A;  3P9I A;  3Q9S A;  1BIB A;  3OYG A;  3DV8 A;  2H94 A;  1GV5 A;  4UUV A;  4BAY A;  3JRC A;  3J7A Y;  3V4G A;  3H5A A;  2IW5 A;  3HOZ J;  2HQR A;  2F5E A;  2V4J C;  4IX7 A;  1ZR4 A;  1ETX A;  2TCT A;  4XLH A;  2WY7 Q;  5J1R A;  3FXM A;  2L7M P;  1KU2 A;  1FOX A;  3E0J B;  2JK3 A;  5FKN A;  5EGO B;  4KNY A;  2R5Z A;  1YS7 A;  3ECH A;  4R1H A;  1MZB A;  2L01 A;  2KHM A;  3PUF A;  4D5C A;  2UXU A;  1Y0U A;  1K4S A;  4BJ5 C;  4HDV A;  4GFB A;  4YEJ A;  3V8J A;  1DDN A;  2EV6 A;  4E6K G;  4FHT A;  1JT6 A;  3F9K A;  4ZH4 F;  4LIT A;  5HDG A;  1Y56 A;  2K9N A;  2FRH A;  4XQF A;  5IOZ A;  2M2E A;  3H3Z A;  1IN5 A;  2JA2 A;  1JGS A;  3LST A;  5B5E C;  1YJW I;  2NS7 A;  5CXG A;  3E6C C;  2OCE A;  5LD2 C;  2LBF A;  4I0B A;  3BR5 A;  4GGG A;  4I98 B;  2IP2 A;  2P7V B;  4XRF A;  4PJL A;  4UB8 C;  3OYI A;  3S1Q J;  4P1W A;  1HOM A;  2EIN H;  2O7T A;  4XBF A;  2IGK A;  2EPF A;  2GLO A;  1GHC A;  1YLF A;  1XMA A;  1BW6 A;  2WWY A;  2L4M A;  1JJ8 C;  3CUQ A;  2JA7 J;  3VDX A;  3AL0 B;  1FNN A;  4NQW B;  5EG0 A;  5FGL A;  3DU5 A;  3HSR A;  2NRA C;  3NEU A;  2E7X A;  1HDP A;  5LRS A;  5C44 J;  3MQ0 A;  5E3O A;  1HF0 A;  2B3W A;  3JRD A;  2X51 A;  5K5O A;  3GX4 X;  3CME I;  4HAM A;  1UG2 A;  5DUK A;  4XRM A;  1G8X A;  1WPK A;  2WB1 A;  2ZXH A;  2R3S A;  3LSJ A;  2CUF A;  2ZCX A;  5D6F A;  4UB6 C;  4WK8 F;  1LUJ B;  5CXI A;  4DW6 A;  2LOO A;  2CQ7 A;  4O3M A;  5KAI C;  2DO7 A;  1X3Z B;  5M5X J;  3CF5 F;  4GYI A;  3NI7 A;  2DOA A;  3JRF A;  2CQN A;  3RD3 A;  3AG2 H;  3E7Q A;  2DLL A;  2M0M A;  2VJI A;  3M9A A;  1IXS B;  4HBL A;  2IXS A;  4V2G A;  2LRE A;  3A0B C;  4WCG A;  2YR2 A;  3CCQ I;  3CZ6 A;  5B1B H;  5HOD A;  3IKV A;  4B3X A;  4HPQ A;  5K5Q A;  4J00 A;  2JPB A;  3OOP A;  4HV6 A;  2L7K A;  2OU2 A;  1FYM A;  3P5J A;  5TJJ A;  3JRI A;  3OS0 A;  3ZN1 A;  2XGX A;  5D8K B;  2HQN A;  4ZYH A;  3RZD J;  2G7U A;  4RAF A;  1VQ6 I;  3K4J A;  2B1E A;  4ANJ A;  3S15 J;  5FHP A;  4I01 A;  5FB2 A;  4A3L J;  1ETO A;  3HGY A;  2VKV A;  3DPL C;  4F52 A;  3HTH A;  3AQT A;  2K3P A;  4XIC A;  2FMY A;  2MW8 A;  2BXY A;  5E8G A;  4CGZ A;  3FZV A;  1SVL A;  2R7D A;  3K7A J;  2CJJ A;  3S2W A;  2DA3 A;  3FHN A;  3BG9 A;  4XON A;  4V19 K;  3ZPL A;  2VUM J;  3FMQ A;  5EEH A;  2FOW A;  2R7Q A;  2F5C A;  3E6D A;  3WU0 A;  2VOD A;  1BA5 A;  4KIC A;  3SHF A;  3SFZ A;  3MFK A;  2FUG 2;  3G4S I;  1JKO C;  2WY8 Q;  3KEQ A;  2VLA A;  3E6B A;  1MJA A;  1MKM A;  1WHU A;  4B8X A;  2DOE A;  5ED4 A;  1SAN A;  3D1N I;  3ZRG A;  2X6O A;  3VYS B;  3JTG A;  1Q1H A;  1EA3 A;  2LP0 A;  3K1M A;  1I3A A;  2K4J A;  2R93 J;  2NXN B;  2YU3 A;  4WIB A;  3ABL H;  2FOK A;  1LB2 A;  4PFO A;  4DYQ A;  1SAX A;  4G8X A;  2HXI A;  3BPV A;  4EV0 A;  2MH2 A;  1E0E A;  4ESF A;  2LY9 A;  2HZD A;  2Z33 A;  3K1N A;  4RB2 C;  4EJO A;  3DKX A;  1AOY A;  5EDN A;  1MSE C;  2DAO A;  3FM5 A;  3S3N A;  4ZJZ A;  3OL3 A;  5J1Y A;  5JHF A;  1MBG A;  2KJC A;  2V79 A;  4PJJ A;  1R1U A;  3EDP A;  5ERI A;  1K83 J;  4AID A;  1GDT A;  4OIN F;  2O6G E;  3K2A A;  2HFH A;  3NRV A;  1ACI A;  2GBY A;  1HBX G;  2A6H F;  3SFI A;  3MZH A;  1GV2 A;  1IV6 A;  4RB0 A;  3C2H A;  5KAF C;  1M1E B;  2V9P A;  5FRM A;  2D5V A;  5FGM A;  2XSJ C;  1S7O A;  4JQF A;  3HC7 A;  4F3Q A;  4YEL A;  1F9N A;  3QYF A;  2MSY A;  2ZKZ A;  2ZB9 A;  5M3M J;  3HIM A;  2H6B A;  2CW7 A;  2CS3 A;  3BCA A;  4J01 A;  5BNG A;  2C6Y A;  2ZCN A;  2VBZ A;  2LY1 A;  2EFW A;  3S1N J;  2JN6 A;  2OER A;  2HZT A;  1LE8 B;  1ON1 A;  4KN7 X;  1BIA A;  4X1E A;  2XB0 X;  1IGN A;  3ZMU A;  4E7I A;  3ZQI A;  4XKV A;  1VQ7 I;  4NHJ A;  3I55 I;  2YVX A;  1QVT A;  1JJ6 C;  2R5Y B;  2ZBK A;  4ABZ A;  3PSF A;  3BC8 A;  5LLQ A;  3HOV J;  3M3Y J;  2XHK A;  3HTI A;  5D19 A;  2F4O B;  1LQ1 A;  3HTU A;  3DBH B;  4C2M J;  2A68 F;  4UY8 I;  4F91 B;  1FJL A;  3DCF A;  4C3H J;  4CIC A;  1LFU P;  5C4Y A;  2HQA A;  3PNY A;  2DFI A;  4BEH B;  5TRD A;  1SFU A;  3E97 A;  5F6F A;  4GO1 A;  1FZP B;  3F3X A;  3RYP A;  1TNT A;  3IRR A;  1Y8R B;  2HOT A;  2EIL H;  1TWC J;  5F1R A;  3HTJ A;  2R4G A;  2KIQ A;  3NXC A;  5D4S A;  4YIR X;  3LSI A;  1U9N A;  5HVQ C;  1QZZ A;  3PUB A;  2EQR A;  2DTZ A;  3SEQ A;  5GAH J;  2RAE A;  4BE0 A;  3GWZ A;  4G6T B;  5KCM A;  3H5N A;  4CZZ A;  1D8J A;  1BI2 A;  2DFF A;  3VVX A;  1APL C;  3VOX A;  3DQV C;  3ELK A;  3TL4 X;  4Q5S F;  2KPM A;  5FKM A;  2F07 A;  3F1B A;  3CCE I;  2M45 A;  2MA3 A;  3E1S A;  3QYE A;  3I56 I;  1IXC A;  9ANT A;  4KFC A;  2VT2 A;  4GCV A;  2JVG A;  3BTI A;  1ZG3 A;  4IQJ A;  1O57 A;  3H9Q A;  1SMY F;  2YVH A;  2PEX A;  2EH3 A;  3G1L A;  1MND A;  2A05 A;  3IWZ A;  4LLL A;  2Z2S B;  2RVC A;  4I09 A;  3ZQF A;  3I4N J;  3RH2 A;  2OQR A;  2WB1 N;  4IRV A;  3BLY A;  3K4K A;  1B1B A;  1DP7 P;  1KQ9 A;  4WXD A;  3I59 B;  3H0D A;  3F72 A;  3HM5 A;  3RKW A;  1YX5 A;  2BY1 A;  1ORK A;  1H9T A;  1ZEL A;  4MEY F;  4ME9 A;  1FIP A;  3GZ5 A;  1Z05 A;  4LMY A;  4F7Z A;  3G6E I;  1YE9 A;  2VBY A;  3KP2 A;  1MMA A;  1MMG A;  1OKR A;  1Z3X A;  2JUG A;  2IGM A;  1X2N A;  4MQV A;  2X48 A;  5AQC A;  2CQX A;  2L4A A;  1YW7 A;  1XSX A;  1FTT A;  2CQK A;  3KLO A;  3M1C A;  3VSK A;  1FOY A;  2LFB A;  1NK2 P;  1WVR A;  1YJ9 I;  2HYJ A;  4E7J A;  2HOS A;  2QCO A;  2QQ9 A;  4NN1 A;  1OR7 C;  2MLK A;  4S05 A;  4P9U A;  3B6A A;  3LQQ A;  5HAW A;  3C3W A;  4LG0 A;  3RIR A;  3CD6 I;  3VPR A;  2DJN A;  5EEG A;  3W6V A;  3HEF A;  2VOO A;  1SGM A;  3GCM A;  3DTE A;  4YII A;  4BU2 A;  5H6Q A;  1G3W A;  2DMP A;  4MK6 A;  2VBW A;  1D1B A;  1YOV B;  5CVJ A;  1P92 A;  2FBH A;  4D7N A;  3CCS I;  5FMP A;  1ZGJ A;  2EIK H;  3W2V A;  2G7G A;  1MSF C;  1T98 A;  1LEA A;  4XRS A;  2V6E A;  1N78 A;  3RKY A;  1VQK I;  4Q4Z F;  1BC7 C;  1LFB A;  2ADU A;  4HF0 A;  3TED A;  2CGP A;  2DYR H;  2P81 A;  3X2Q H;  4WXC A;  3ZP5 A;  4UVC A;  2ICW G;  1B8I B;  1DPU A;  5E1X A;  2VT3 A;  1QVU A;  2HDW A;  3D5R C;  2F48 A;  1UI5 A;  2L02 A;  1H0M A;  2H27 A;  2G7S A;  3ON4 A;  3F22 A;  1ITY A;  3L1P A;  2G9W A;  5D5X B;  3HTA A;  3GW2 A;  1RPW A;  2KZV A;  2QKM B;  3CMA I;  4H0E A;  2L9R A;  2FQ3 A;  2GA2 A;  1O7F A;  3F6V A;  3K8P C;  2VIX A;  4BJT A;  4BXU A;  1FOK A;  4NNJ A;  3K70 C;  2VL8 A;  5HNF A;  4HA8 A;  5AIQ A;  5FLX Z;  4X0G A;  1RIO H;  1TWF J;  4A5M A;  2P7C B;  3OMY A;  3HOS A;  5TIS C;  2JVH A;  4FCY A;  1Z0X A;  2BVL A;  3HSF A;  1UCR A;  2HTS A;  2HOE A;  3ABU A;  3VWB A;  3KLN A;  2ECC A;  2ZOY A;  1OCT C;  1QQI A;  3OL4 A;  2E1C A;  2GXB A;  3QU6 A;  5JHU A;  2M8E A;  3OS2 A;  2GOX B;  1BR1 A;  3GUD A;  4HLY A;  2VE8 A;  2PI0 A;  5DDG A;  2GQQ A;  4HZF A;  1H8A C;  5E17 F;  2JJ7 A;  2CRG A;  2ZXJ A;  1GUU A;  2FEZ A;  3CO7 C;  4PJN A;  1FT9 A;  4JX6 A;  2K3F A;  4JNN A;  4RGU A;  4AIK A;  5IT9 K;  1KON A;  4CCL A;  2IT0 A;  3HRS A;  1J75 A;  2Z99 A;  1WFX A;  3TOB A;  1MBK A;  1OIS A;  1ONV A;  1TW3 A;  2MYS A;  2NNN A;  2QKL B;  1J09 A;  3LJL A;  2ISZ A;  2DG8 A;  2WTE A;  2Z5U A;  4M71 A;  3QAH A;  3QP6 A;  3J7A O;  3W2W A;  3E3V A;  2A6E F;  1B72 B;  3IWF A;  4UHT A;  2RQQ A;  3C07 A;  4KMU X;  2ZOZ A;  2XAH A;  1YIO A;  5LGT A;  2DPD A;  1B4A A;  3KET A;  1VND A;  1LDK B;  2VBX A;  4A3J J;  2F5F A;  1WJA A;  1Z67 A;  2NVY J;  3GTP J;  3J7Y J;  3UR3 C;  4GXO A;  2ELK A;  2E1O A;  2QEX I;  2KZG A;  3VTI A;  1VZ0 A;  3H3V K;  4FT8 A;  1O4X A;  3LSM A;  4A0X A;  3ZMZ A;  3FXK A;  3K4N A;  3MN2 A;  3TOA A;  3GFI A;  1EV7 A;  5CVV A;  2FBQ A;  4CHU A;  2RNJ A;  3M8E A;  2DT5 A;  4PZJ A;  2BHY A;  3WG7 H;  1TQI A;  2EWN A;  1Y8Q B;  4YFK F;  1AKH B;  2NYX A;  2PMH A;  1RR7 A;  5LHI A;  3CMM A;  3MWM A;  4C2M A;  2CUZ A;  3I5U A;  3TO7 A;  2DMU A;  5L3F A;  2JMW A;  4CYC B;  4M6X A;  3VOD A;  3S14 J;  1FEX A;  4PXI A;  2Z16 A;  3BQY A;  5FKO A;  1O3T A;  5LFA A;  1IF1 A;  3LFU A;  2K5C A;  5BMZ A;  3L7W A;  4IXA A;  1S5L C;  2A5Y B;  2D2W A;  2E34 A;  2Q8K A;  4A3F J;  1DU0 A;  2ZJQ F;  2FML A;  2DOD A;  3ZQH A;  4BY1 J;  4BKX A;  1TBX A;  1UMQ A;  2Y75 A;  3OWT A;  3CCM I;  4HRI A;  3H0G J;  3MKL A;  1SFX A;  2LTP A;  2GXG A;  3BT9 A;  2I10 A;  2WV0 A;  2L9V A;  4CYC A;  1X1C A;  2ZO4 A;  2YX7 A;  2EV5 A;  3HKZ N;  4E7Z A;  1SD5 A;  5C4X J;  3KZ9 A;  4HEA 2;  3VW2 A;  3ZR8 X;  1QRY A;  3ANP A;  4HNV A;  4B09 A;  1WH7 A;  3AG3 H;  2X6Y A;  4Y17 A;  3LSK A;  2XPW A;  5J8C A;  1W7P A;  3N97 A;  2Y30 A;  3DTK A;  5HNH A;  1UG0 A;  1XSV A;  2Q1Z B;  4S0H B;  2E60 A;  3FXL A;  3DLA A;  2LKP A;  1QGP A;  3GTO J;  2RNG A;  1BJZ A;  3GBG A;  1MNM C;  2HPM A;  2UV1 A;  1OYY A;  4NC7 A;  4RM2 A;  2VE9 A;  1SAU A;  2AXT C;  1P2F A;  2R7F A;  4AC0 A;  2X4H A;  5E3M A;  1ZKG A;  1JKR C;  2K9S A;  2XRN A;  3CC7 I;  2M5W A;  2NAZ A;  3GFJ A;  3K70 D;  3R4K A;  1PUE E;  3IAS 2;  1JTX A;  1VI0 A;  1EJ9 A;  4CYD A;  2VXZ A;  3OIQ A;  1ZG5 A;  4O6J A;  4GCT A;  2DT6 A;  3CP8 A;  5GTH C;  2QBY B;  4IRG A;  1TC3 C;  2W85 A;  1Y6I A;  3CES A;  4QWQ A;  3LFK A;  1I6X A;  2CW8 A;  2D1H A;  3B6C A;  2E5N A;  1SD6 A;  3BR2 A;  3OR1 C;  1A04 A;  4CZC A;  1V54 H;  4EJT A;  3P9T A;  2KRH A;  1G4D A;  3CDL A;  2HKX A;  5K7H A;  4OAY A;  2XAS A;  1ZR2 A;  3EUK L;  5F64 A;  4M3B A;  2MH9 A;  1LPQ A;  2CU7 A;  2IEK A;  4DNC A;  1X3W B;  2K9M A;  4XLA A;  2REK A;  4S04 A;  2VQG A;  3DLL F;  3CWR A;  2NOJ B;  1G6N A;  4XL9 A;  3SDG A;  4B48 A;  4JBA A;  4KT6 A;  4Y13 A;  2AQE A;  1SMT A;  3L2R A;  2AS5 F;  4BXF A;  3FBI B;  1L0O C;  2KJB A;  2KP6 A;  1YJN I;  2HEO A;  3CMY A;  4EGY A;  2Q2E B;  2B63 J;  2HQ5 A;  4QLC U;  4LK1 F;  1A5J A;  4EM0 B;  2HYF A;  5JVG F;  4A3G J;  2YUS A;  2O61 A;  4Y3O A;  3KKC A;  5B66 C;  2H8W A;  3M1E A;  2QUF A;  1JTY A;  1VFC A;  1EH6 A;  1MD0 A;  3KZZ A;  3M8F A;  2XF5 A;  3IV5 A;  2XB5 A;  3M7G A;  3VUQ A;  1BI3 A;  1WI3 A;  1F43 A;  1O7L A;  2IRF G;  5IT9 Z;  3F8N A;  4L0Z B;  3G73 A;  1Q1V A;  3LSH A;  3VOE A;  3FKJ A;  1IN4 A;  3MKY B;  3CDH A;  2O0Y A;  2LF7 A;  3BCB A;  5J40 A;  3LAP A;  4Y7N J;  3GZ6 A;  5DCM B;  5H6R A;  3K2Z A;  4N4N B;  4I6Z A;  3O6B B;  2L9N A;  5DTD A;  1J9I A;  3LQR A;  2OAZ A;  2W57 A;  2KRF A;  2LG4 A;  5ILV A;  3SWH A;  3VEP A;  4LOC A;  1R5H A;  4UVA A;  2ZSH B;  1ZRD A;  4L5I A;  2PJR B;  2DK8 A;  1NK3 P;  2G3B A;  2WV1 A;  4RAG A;  2KMU A;  2FNP A;  1DP3 A;  4XLC A;  1KQ0 A;  1HQC A;  3CCU I;  4E7S A;  2P5V A;  1IAW A;  4F93 B;  2OI8 A;  2VI6 A;  4UVB A;  5LBQ A;  1ZH5 A;  5AON A;  3AFH A;  4JYK A;  1XDU A;  2RDP A;  2ZME C;  2VQL A;  3KIO A;  3LOC A;  2HDD A;  1Y1W J;  4RAY A;  1DU6 A;  4OD5 A;  1TWG J;  3A0H C;  1SVO A;  1IZ1 A;  3MZ8 A;  4HV5 A;  3H1C A;  3ESW B;  2NOG A;  4HX7 A;  2NVX J;  2MC3 A;  1YIJ I;  1STZ A;  2GFN A;  1V3F A;  5IPA A;  4HDU A;  3FBN B;  5CVU A;  3OYN A;  1IDY A;  3NRG A;  2FXA A;  2WAD A;  3ZMS A;  2CFX A;  2K02 A;  2PMZ A;  4BE1 A;  3COL A;  4MLO A;  2NS0 A;  3ABM H;  3FWE A;  4EMS A;  2K85 A;  4UXN A;  2R7S A;  2Z3Y A;  1S3J A;  1R5I D;  4MGR A;  1ULY A;  4XID A;  5FD5 A;  3GTG J;  3TBI A;  3OSG A;  1T2K A;  2J5P A;  3N05 A;  4CCM A;  1XSD A;  2O3F A;  1BR4 A;  1ZRC A;  2R5Y A;  2EV0 A;  2O03 A;  4M9X A;  3UKG A;  3CLO A;  3PO3 J;  2QBY A;  4BHB A;  3VW0 A;  1P7I A;  1P7J A;  2ELJ A;  3K10 A;  3V8L A;  1K4T A;  1IUY A;  2EBI A;  3VYR B;  2WGB A;  2NX4 A;  3VP5 A;  1XPX A;  4MEX F;  4YIF A;  3D5S C;  2ZJR F;  1E3H A;  2OC6 A;  4BAC A;  1ON2 A;  1XG1 A;  2NVU B;  2H1K A;  1WJD A;  3BJ6 A;  3A1Y A;  3T8T A;  2R92 J;  2TDX A;  3KZI C;  3PSI A;  1PJR A;  1O3S A;  1HKT A;  1OPC A;  1OCZ H;  4L9V A;  2NVT J;  3GXO A;  1W4M A;  2VC1 A;  2DA7 A;  1HXD A;  3WGI A;  3HOW J;  2JTV A;  3DKY A;  3CUQ C;  3LMM A;  4QPQ A;  4U0V A;  3Q9V A;  1ZLJ A;  3U9G A;  1Z91 A;  1LFP A;  3M4O J;  1FIA A;  4UV9 A;  5LHG A;  1FBS A;  4O5V A;  5D6E A;  1TW2 A;  3GEZ A;  1U0J A;  1XC5 A;  2BXZ A;  4YFN F;  1R5G A;  2BGC A;  3WOD F;  4QPO A;  3LL7 A;  5IT3 A;  2NNY A;  2GAU A;  5DV5 A;  4ZZD A;  3WU2 C;  1R1V A;  2QGU A;  3K0L A;  2FF4 A;  4ZYD A;  1FYL A;  2IS2 A;  3LA2 A;  3HL2 A;  1B59 A;  3NWS A;  3O8H A;  4RMN A;  3BG3 A;  5FLX K;  3CP2 A;  1IN6 A;  3CCR I;  4BHC A;  4FIS A;  5FFX A;  3LWJ A;  3V7C A;  3S3M A;  2VQH A;  1I27 A;  1WRJ A;  3PJR A;  3J81 Z;  3LA7 A;  2LKX A;  2STT A;  1IO2 A;  3Q0U A;  4E4H A;  1YW9 A;  3PQK A;  3JRH A;  3O8G A;  3L2Q A;  2QA4 I;  4FE4 A;  2DFH A;  4QSH A;  4ZDL A;  1V5E A;  1T33 A;  5HOO A;  3OYL A;  1EH8 A;  5ICE A;  1WZ2 A;  1D1A A;  3RQ4 A;  1G2H A;  2UUZ A;  5B3S H;  1WKM A;  4DZP A;  4LB6 B;  2VAS A;  1XB4 A;  3E5Q A;  4RBO A;  1SD4 A;  3R6S A;  1MBF A;  3FRQ A;  1J7K A;  3ON2 A;  2ZFW A;  2V1N A;  1P4W A;  1T8I A;  4KIB A;  3P7N A;  2GIV A;  2F6C A;  4HX4 A;  1VQ5 I;  2LH9 A;  3BWG A;  3AKZ A;  2EA2 A;  4IJA A;  2IPQ X;  4XN3 A;  1ERD A;  2IVM A;  2QOP A;  3A2K A;  2HTJ A;  3TP0 A;  1OFC X;  2GXA A;  1WQ2 A;  3KYC B;  4HLX A;  3KP5 A;  2VJJ A;  3T0Y A;  2FJI 1;  1CQT A;  3CJQ B;  3HOU J;  2DQR A;  3FXR A;  1XMK A;  2E1M B;  3S16 J;  5FKL A;  3IRQ A;  3HYI A;  5F27 A;  4DZJ A;  2ZME A;  3SZP A;  2GOM A;  5FRO A;  3QPL A;  3PL8 A;  4LLG F;  1NH3 A;  2UXX A;  2STW A;  2OJE D;  2X1C A;  3JR9 A;  1F5T A;  3K9T A;  1BR2 A;  1W7P D;  4XOR A;  5LGU A;  1GVJ A;  1WGX A;  3BR1 A;  3E6M A;  4IHT A;  1H88 C;  4CO8 A;  3KKD A;  1TT0 A;  3DFG A;  3L00 A;  4IVN A;  2K86 A;  1LVK A;  4I7H A;  4XR6 A;  2Y9Z A;  1OCC H;  2JUC A;  3CQZ J;  3S2H J;  5M5Y J;  4I0A A;  4MXM A;  4CXF A;  5F0H A;  3JRE A;  2F2E A;  5C4J J;  3BTJ A;  3EUH A;  4A0Z A;  2W25 A;  2PJP A;  1UI6 A;  5LHH A;  1JUS A;  2MC4 A;  1D0X A;  3EYY A;  1WWX A;  2R7O A;  4HW0 A;  5HDK A;  3GTQ J;  2GUH A;  5HS8 A;  2VPL A;  4M3E A;  2L5Q A;  3VIB A;  1WJE A;  3O3K A;  2M3A A;  3RPU A;  1IJW C;  2JPC A;  5ICF A;  2P0W A;  3CRJ A;  4G12 A;  1U9O A;  4CGR A;  1K79 A;  1K78 A;  5CQE A;  4EJV A;  5GPA A;  2JWT A;  3I54 A;  4H4K C;  5K7F A;  3BTC A;  1S9H A;  3GO5 A;  2J5O A;  4GRI A;  4RA2 A;  4C30 A;  4U9N A;  3O2P E;  2HDC A;  2E7W A;  4KJZ A;  5TGT A;  4IHX A;  2R7R A;  3MCZ A;  4IRI A;  2E36 A;  3BY6 A;  1BOA A;  1XGS A;  3ZGK A;  3HIF A;  2IA2 A;  5DYM A;  3FX3 A;  4RDU A;  2X9D A;  1DGW Y;  1GT0 C;  4N4O B;  4GFL A;  4G6D A;  5D8L B;  2XKO A;  1LNW A;  1K61 A;  2DG7 A;  1X58 A;  3CCL I;  1VTN C;  3R61 A;  3U1D A;  2DDB A;  3ROU A;  1HDD C;  2F5D A;  4Q48 A;  1HC8 A;  1MDM B;  1ZN2 A;  1A6Q A;  3W6K B;  4II2 A;  3KYL A;  4OMZ A;  5LRR A;  3ASO H;  2XIG A;  3ZQQ A;  3DF8 A;  4M72 A;  1KZH A;  1NHA A;  1USS A;  2L54 A;  2I5U A;  5CQG A;  4AVZ A;  4QTR A;  4OU0 A;  4D5F A;  5DUI A;  5IYC J;  4KA4 A;  1LJ9 A;  3QP5 A;  2JZY A;  2XRO A;  2BY3 A;  1VQO I;  5IOY A;  1ZRF A;  4ITV A;  2CUE A;  2AQF A;  3QOE A;  3BR0 A;  3H9J A;  2ESH A;  1YRN A;  5AIP A;  2P5L C;  2OTJ I;  1Z6T A;  3MMY B;  4I76 A;  4FTH A;  1IC8 A;  2G0E A;  1IW7 F;  1XN7 A;  2I8D A;  2OPT A;  4KIG A;  1UHW A;  4EJW A;  4D7M A;  4LGW A;  1QNT A;  3ERM A;  4NDL A;  1MJB A;  2VJ4 A;  5J4V A;  3BR6 A;  1H89 C;  1TT5 B;  4JX4 A;  1V5G A;  2FJ1 A;  3HSE A;  3DTI A;  1TL8 A;  2LY2 A;  1RKT A;  2XF6 A;  4Y33 A;  1YX3 A;  2ETH A;  2P8T A;  5H20 A;  4IL6 C;  1QZY A;  1ODD A;  2HGC A;  3FF5 A;  3L9F A;  1V55 H;  3OV8 A;  3F21 A;  3NWT A;  5GAG J;  2A5W A;  2IA1 A;  2OD5 A;  3G3Z A;  2WAE A;  5GTI C;  1MW7 A;  2RRE A;  2CMP A;  1R36 A;  4IEJ A;  3H3U A;  2FQ4 A;  2W84 A;  2DA5 A;  2KIS A;  2BV6 A;  1F4K A;  1UHM A;  4DYC A;  1BM9 A;  4ZZL A;  2Q2E A;  5E20 A;  4B3A A;  2W53 A;  3I4P A;  1XS9 A;  4GFK A;  3V42 A;  1XDS A;  3QPH A;  5D1R A;  4LG0 B;  4G7O F;  2HVR A;  1IRX A;  1YG2 A;  4W1U A;  1J5Y A; 
#chains in the Genus database with same CATH homology
 2CQQ A;  3BR5 A;  2DA2 A;  1ETK A;  4AC0 A;  5E3M A;  1ZKG A;  2ME6 A;  2K9S A;  1JKR C;  3CCY A;  2K9Q A;  1T56 A;  3S1Q J;  4BBR J;  1JTX A;  1VI0 A;  1HOM A;  2EZL A;  2O7T A;  3V6G A;  1POG A;  2GLO A;  1BW6 A;  4GCT A;  4NEL A;  1JJ8 C;  3RZO J;  5DS9 A;  2JA7 J;  4MFE A;  1TC3 C;  4YZE A;  3B6C A;  5EG0 A;  5FGL A;  3BR2 A;  3P9T A;  4L5E A;  2E2J J;  2M8G X;  1HDP A;  3CDL A;  5C44 J;  5K7H A;  5E3O A;  1HF0 A;  3JRD A;  5EF6 A;  1B72 A;  2ID6 A;  2GEN A;  3IUV A;  1ZR2 A;  1R9T J;  1UG2 A;  4XRM A;  1WPK A;  4M3B A;  2CU7 A;  2IEK A;  3LSJ A;  2CUF A;  2ZCX A;  2RAS A;  2DA1 A;  4JX5 A;  2REK A;  5CXI A;  2XGE A;  3WHC A;  4DW6 A;  4J19 A;  5JLW A;  2IAI A;  2COB A;  3CWR A;  3G56 A;  5M5X J;  2M0C A;  3NI7 A;  3JRA A;  3SDG A;  3PAS A;  3MNL A;  3JRF A;  1WCM J;  3RD3 A;  3E7Q A;  1MBH A;  2QWT A;  2ECB A;  4V2G A;  2XDN A;  2Y31 A;  2O9L A;  5HOD A;  3CMY A;  4Y52 J;  2B63 J;  2JA5 J;  2OF7 A;  2HQ5 A;  1A5J A;  2H8R A;  4JL3 A;  4A3G J;  4A3K J;  2YUS A;  3KKC A;  3BQZ A;  3JRI A;  2UXP A;  2Y0S N;  3RZD J;  3BNI A;  3QBM A;  2JA8 J;  1JTY A;  4A3C J;  4M6V A;  1VFC A;  1I6H J;  3NAR A;  1FTZ A;  4X6A J;  3S15 J;  5FHP A;  2MGQ A;  1JUP A;  2HXO A;  4A3L J;  1ETO A;  3IV5 A;  2XB5 A;  3HGY A;  2VKV A;  4A3D J;  2N8G A;  1WI3 A;  3LSP A;  1F43 A;  3VUQ A;  3HTH A;  2XRL A;  3AQT A;  4XIC A;  2MW8 A;  1Q1V A;  3K7A J;  3ANG A;  2CJJ A;  2DA3 A;  3BG9 A;  5J3L A;  3BTL A;  4Y7N J;  5M5W J;  4KWA A;  2VUM J;  2AO9 A;  2YS9 A;  1QPI A;  4I6Z A;  3MVP A;  5DTD A;  2Q24 A;  2Y2Z A;  1BA5 A;  4LOC A;  1JKO C;  5K58 A;  2DN0 A;  1NK3 P;  2G3B A;  2WV1 A;  5FKK A;  1NTC A;  3VOK A;  1TWH J;  4UUS B;  2PZ9 A;  3AQS A;  1SAN A;  3D1N I;  2X6O A;  2XPU A;  2OI8 A;  2VI6 A;  2LP0 A;  2AHQ A;  2JA6 J;  2R93 J;  1LE8 A;  4JYK A;  2LR8 A;  4DYQ A;  4JKZ A;  3LOC A;  2HXI A;  3WHB A;  1Y1W J;  2HDD A;  1DU6 A;  1A6I A;  2NS8 A;  1TWG J;  2LY9 A;  2V57 A;  2NOG A;  2NVX J;  2QF7 A;  2R7Z J;  2GFN A;  5EDN A;  5IPA A;  3LSR A;  1MSE C;  3HGG A;  5HBU A;  2QIB A;  5J1Y A;  4MFD A;  4XK4 A;  1IDY A;  3BG5 A;  1AU7 A;  3NRG A;  1MBG A;  2L7Z A;  1K83 J;  1VF9 A;  1RES A;  1GDT A;  2UXH A;  3COL A;  4MLO A;  2O8K A;  3K2A A;  2GBY A;  3Q0V A;  3SFI A;  3S1M J;  4XID A;  3JRB A;  1GV2 A;  2O7O A;  4JP0 A;  1IV6 A;  3GTG J;  3OSG A;  2HOA A;  2R0Q C;  2D5V A;  1HLV A;  3QPS A;  2ZCM A;  5IYB J;  2R5Y A;  3TP3 A;  3GEU A;  1U78 A;  3JSJ A;  3UKG A;  1GVD A;  2MSY A;  3PO3 J;  2ZB9 A;  5M3M J;  3HIM A;  3VW0 A;  2E19 A;  5BNG A;  1P7I A;  2ZCN A;  3S1N J;  2OER A;  2JN6 A;  2LD5 A;  1LE8 B;  1D5Y A;  1P7J A;  4GCK A;  2G7L A;  4X1E A;  2EBI A;  2WGB A;  3PM1 A;  2NX4 A;  2XB0 X;  3VP5 A;  1JGG A;  1IGN A;  3GZI A;  3ZQI A;  4DYR A;  1QVT A;  1JJ6 C;  1XG1 A;  2EZK A;  2H1K A;  2ME0 A;  3FK6 A;  2GM4 A;  2R92 J;  3CJD A;  2DA6 A;  2R5Y B;  4ABZ A;  3EUP A;  2EZH A;  3HOV J;  3M3Y J;  4BXX J;  3HTI A;  5D19 A;  1MH3 A;  1S7E A;  2W48 A;  4C2M J;  2NVT J;  1ZK8 A;  5E3N A;  2DA7 A;  3HOW J;  2HI3 A;  5EZG A;  1FJL A;  4XRS G;  2YVE A;  3FIW A;  3A03 A;  3DCF A;  4C3H J;  2KT0 A;  5EFY A;  4HKU A;  5C4Y A;  1LFU P;  5IP9 J;  5GP9 A;  1WH5 A;  2L7F P;  4M3G A;  2HYT A;  3M4O J;  2UXI A;  1FIA A;  3FIS A;  2HOT A;  5FJ8 J;  3HBL A;  2UXO A;  1TWC J;  2NP5 A;  3HTJ A;  4UUT A;  1AKH A;  1XC5 A;  3NXC A;  1OJL A;  1U9N A;  1F36 A;  2VKE A;  1I50 J;  3BCG A;  4B4C A;  1ZTR A;  2EQR A;  2DTZ A;  2RAE A;  5F04 A;  2XGD A;  3VVX A;  1APL C;  4BBS J;  3VOX A;  3O8H A;  5GPC A;  5FKM A;  2F07 A;  2QTQ A;  3BG3 A;  3F1B A;  4FIS A;  3LWJ A;  4UUS A;  9ANT A;  1ETW A;  5DAJ A;  3Q0W A;  1HCR A;  3DEW A;  1YRN B;  4V2F A;  4W97 A;  3BTI A;  1IDZ A;  2LLK A;  2LKX A;  2E2I J;  3QKX A;  1X2M A;  3Q0U A;  2YU9 J;  3S17 J;  3JRH A;  2YVH A;  3G1M A;  4QIW N;  2EH3 A;  3O8G A;  4BY7 J;  3G1L A;  5EYR A;  5F0C A;  4ACI A;  1I3Q J;  2LVS A;  4FE4 A;  3ZQF A;  4QSH A;  2NP3 A;  1MBE A;  3I4N J;  1T33 A;  2PMZ N;  2DMT A;  3RH2 A;  2WB1 N;  1G2H A;  3GTM J;  1W0T A;  1E3O C;  4DZP A;  1ENH A;  4RBO A;  3HM5 A;  3IH2 A;  5EG0 B;  5HSZ A;  1ORK A;  1MBF A;  2XGC A;  3FRQ A;  3SJM A;  5EGO A;  4ME9 A;  2XPV A;  3FK7 A;  3ON2 A;  2E2H J;  5K7Z A;  1FIP A;  2EZI A;  3GTK J;  4A93 J;  1X2N A;  2X48 A;  5EEA A;  2CQX A;  5AQC A;  1FTT A;  1OCP A;  2MG4 A;  5JLX A;  2XSD C;  1NK2 P;  2LFB A;  3T6N A;  4NN1 A;  2HYJ A;  2HOS A;  2L0K A;  2QCO A;  2WAQ N;  3S2D J;  2QOP A;  3PPB A;  3TP0 A;  1OFC X;  5CW8 A;  5FLV A;  4AF5 A;  3FKI J;  3B6A A;  3ZQG A;  5HAW A;  4ICH A;  1CQT A;  3HOU J;  3VPR A;  2DJN A;  3W6V A;  3HEF A;  1MBJ A;  3ZQL A;  2KDZ A;  1SGM A;  3S16 J;  5FKL A;  5F27 A;  4DZJ A;  3HE0 A;  4FE7 A;  2DMP A;  4MK6 A;  3NAU A;  3QPL A;  2QKO A;  1Z77 A;  3F0C A;  4D7N A;  5FMP A;  2K40 A;  2RHA A;  3LHQ A;  2G7G A;  4MIM A;  1MSF C;  4UDS A;  3ZQC A;  4XRS A;  2DA4 A;  3JR9 A;  1LFB A;  1PUF A;  3TED A;  1WGX A;  3BR1 A;  2P81 A;  1H88 C;  3KKD A;  1B8I B;  1EF4 A;  3JRG A;  1QVU A;  5IYD J;  1TWA J;  2WUI A;  3DPJ A;  1ETY A;  1UI5 A;  3OSF A;  2Y9Z A;  2G7S A;  3A01 A;  3ON4 A;  1ITY A;  5F08 A;  1BW5 A;  3L1P A;  3CQZ J;  3S2H J;  3VVZ A;  5M5Y J;  3HTA A;  1RPW A;  2L9R A;  4MXM A;  5F0H A;  5C3E J;  5EZH A;  3JRE A;  3BR3 A;  3BTJ A;  5C4J J;  1U8B A;  1TWF J;  3B81 A;  1UI6 A;  4A69 C;  1JUS A;  4FCY A;  1Z0X A;  4IHY A;  2Y9Y A;  4AYB N;  1IRZ A;  4A3M J;  3GTQ J;  2GUH A;  2DMN A;  4M3E A;  3LSG A;  2ECC A;  2ZOY A;  1OCT C;  3VIB A;  4W1U A;  1IJW C;  3KNW A;  3CRJ A;  5D18 A;  4G12 A;  1RKW A;  1U9O A;  3IH4 A;  1RET A;  4CGR A;  3VVY A;  5GPA A;  2JWT A;  4C3J J;  1JT0 A;  5K7F A;  1H8A C;  4GCL A;  3A02 A;  3BTC A;  2JJ7 A;  2CRG A;  3BHQ A;  1GUU A;  5J1U A;  3Q3S A;  4IHX A;  3S1R J;  2PBX A;  4JX6 A;  4JNN A;  2HKU A;  3C2B A;  3GTL J;  3LNQ A;  1W0U A;  5FLM J;  3GTJ J;  2TRT A;  3V78 A;  2LK2 A;  4AUX A;  1IG7 A;  1MBK A;  3I4M J;  2M34 A;  4RDU A;  3PO2 J;  2X9D A;  1GT0 C;  3LJL A;  4GFL A;  2DG8 A;  3O60 A;  2DMQ A;  3NNR A;  1K61 A;  4MO7 A;  2DG7 A;  3OIO A;  1X58 A;  1B72 B;  1B8I A;  1HDD C;  3C07 A;  3TW6 A;  2ZOZ A;  2IBD A;  1ETQ A;  3NPI A;  1VND A;  4A3J J;  4A3I J;  4AC6 A;  3GTP J;  2NVY J;  2NVQ J;  1BL0 A;  5F0F A;  2ELK A;  2E1O A;  2M9H A;  4IHV A;  3ZOB A;  3H3V K;  2FX0 A;  1O4X A;  4QTR A;  4D5F A;  5IYC J;  4C3I J;  1JUM A;  3MN2 A;  1ZGW A;  5IOY A;  5IP7 J;  3IH3 A;  3E7L A;  1ZQ3 P;  2CUE A;  2FBQ A;  3TW7 A;  3BR0 A;  5IP6 A;  1YRN A;  3OOU A;  4I76 A;  4FTH A;  1Y1V J;  3A01 B;  3HDD A;  1ETV A;  2VPR A;  5M3F J;  1IC8 A;  1AKH B;  1RR7 A;  2G0E A;  2ID3 A;  4B1R A;  1JKP C;  4M3F A;  4A3B J;  2OPT A;  4EEF G;  5H9T A;  3HOY J;  4D7M A;  4IHW A;  4PXI A;  2DMU A;  3RQI A;  2JMW A;  4CYC B;  4NDL A;  2R5Z B;  3S14 J;  1FEX A;  4M3D A;  4A3E J;  3BQY A;  5FKO A;  4L62 A;  3RKQ A;  3BR6 A;  1H89 C;  1GV5 A;  1PUF B;  4JX4 A;  3JRC A;  2FD5 A;  1MH4 A;  3S5R A;  4A3F J;  1DU0 A;  2FJ1 A;  3HOZ J;  1ZR4 A;  3BJB A;  3ZQH A;  1ETX A;  2TCT A;  4BY1 J;  4BKX A;  5J1R A;  1UMQ A;  1RKT A;  2L7M P;  2IU5 A;  3H0G J;  3MKL A;  2LTP A;  3HB9 A;  3BT9 A;  2JK3 A;  1JKQ C;  5FKN A;  2I10 A;  5EGO B;  4CYC A;  2R5Z A;  3HKZ N;  3G1O A;  1IUF A;  1SFO J;  4D5C A;  5C4X J;  3KZ9 A;  5E3L A;  2UXU A;  3VW2 A;  1QRY A;  3ANP A;  4HNV A;  4GFB A;  3HOX J;  1JT6 A;  1WH7 A;  2FQ4 A;  4IEJ A;  2DA5 A;  2XPW A;  3EGQ A;  4DYC A;  2Y30 A;  2K9N A;  1AHD P;  3VW1 A;  1UHS A;  4B3A A;  5F1J A;  2W53 A;  4S0H B;  5IOZ A;  1XS9 A;  2M2E A;  4GFK A;  3G7R A;  3GTO J;  3BRU A;  5D1R A;  1BJZ A;  3QQA A;  3GBG A;  1MNM C;  2D6Y A;  2NS7 A;  5CXG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...