1JUMA

Crystal structure of the multidrug binding transcriptional repressor qacr bound to the natural drug berberine
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
186
structure length
186
Chain Sequence
NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKKEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural mechanisms of QacR induction and multidrug recognition.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription
molecule keywords HYPOTHETICAL TRANSCRIPTIONAL REGULATOR IN QACA 5'REGION
total genus 78
structure length 186
sequence length 186
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2001-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1jumA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 1jumA02
2YVEA 1JTYA 3BTIA 3C2BA 4J19A 1AKHA 1JUPA 3T6NA 2WB1N 1PUFB 1QVUA 1MBJA 1H8AC 3BNIA 3PPBA 2CJJA 1QPIA 3S1NJ 2DJNA 3LSJA 3GTMJ 3GTGJ 2ECBA 4A93J 3ON4A 2XPVA 3OIOA 1Y1VJ 3G7RA 3GTOJ 2IBDA 4NDLA 3MNLA 2DN0A 3BG9A 3ZQIA 4AC0A 5JLWA 5CXGA 2NS8A 5E3NA 5C4XJ 4BKXA 4A3FJ 3SDGA 2QCOA 2ZCNA 5M5WJ 4HKUA 3BR6A 3SFIA 2M34A 3GTJJ 1MSFC 3NNRA 5IP9J 4X6AJ 1MBHA 3IV5A 4A3GJ 3NAUA 3G56A 5JLXA 4XRMA 2QF7A 2WUIA 2H1KA 2H8RA 1TWFJ 2G7GA 1MBGA 2R5ZA 2ZB9A 1XG1A 3TP3A 5HAWA 4XICA 2JA5J 4CYCB 5C44J 3GBGA 3K7AJ 1B8IA 3KKCA 2UXIA 2PBXA 2G7LA 2ELKA 2ZCXA 1JT6A 4A3EJ 1IG7A 4JKZA 5HBUA 4NELA 4DYQA 3JRCA 3F1BA 1T33A 2EZLA 4BBSJ 1POGA 1WCMJ 3NI7A 5IP6A 1GVDA 1OJLA 3Q0UA 5IOZA 5DAJA 1IUFA 4IEJA 4XRSG 3KNWA 3RH2A 2LFBA 2DA1A 3LHQA 4GFKA 3ZOBA 3CQZJ 2AO9A 3LSPA 5F08A 3JSJA 3VW2A 2M2EA 2QTQA 4FTHA 2DA7A 1NTCA 4ABZA 2B63J 2YVHA 2VKEA 1BW5A 5M3MJ 1I6HJ 4ME9A 4DYCA 4D5FA 5K7FA 1XS9A 2RASA 1WGXA 2Y2ZA 5FJ8J 2OI8A 5EG0A 3RD3A 2DMTA 4C3JJ 2EQRA 4A3DJ 2DA5A 1IC8A 3VIBA 5CXIA 3DPJA 1ETWA 5BNGA 2AHQA 2HXIA 4A3CJ 3KKDA 5C4YA 4Y7NJ 1ETYA 1I3QJ 1UG2A 5EFYA 1FJLA 2K9QA 2FX0A 4QTRA 1FIPA 1I50J 1IDYA 1Z0XA 3ZQGA 2HI3A 3VVZA 4MIMA 1EF4A 2F07A 1GUUA 5E3MA 1O4XA 3VW0A 1HF0A 1W0TA 3LNQA 5IYBJ 5M3FJ 2CQQA 2M9HA 1GV5A 3HTAA 2JJ7A 3HGYA 1AU7A 3AQTA 1RESA 1JJ8C 1JKOC 4XK4A 4UUTA 2TRTA 1T56A 3QKXA 2M8GX 3LSRA 1UI5A 2Y0SN 2UXOA 3F0CA 1K61A 4ICHA 1WI3A 2VI6A 3B6AA 3OOUA 3HOVJ 2ID6A 2W48A 5EG0B 4BY7J 2OERA 3O60A 4EEFG 2V57A 3FRQA 3B6CA 3M4OJ 2WGBA 4C2MJ 1BJZA 1HOMA 1ZK8A 3ANGA 3BCGA 4XRSA 2X48A 4M3DA 3UKGA 3VVYA 3ZQCA 4BBRJ 1TC3C 3GZIA 4C3HJ 2XPUA 3IUVA 3E7QA 2JN6A 3LJLA 2XGEA 3HBLA 3HOXJ 1S7EA 2K9SA 3HE0A 2HQ5A 4RDUA 2HYTA 2LTPA 5F0HA 1ENHA 3HB9A 5GPCA 2REKA 1OFCX 4AYBN 1H89C 5D1RA 5F0CA 4Y52J 3NPIA 4B4CA 4JNNA 3CRJA 2LP0A 4M3BA 1F36A 2DMPA 1H88C 2E2HJ 2GBYA 3LSGA 2YUSA 1NK3P 3RZDJ 3W6VA 3BHQA 1MSEC 3JRDA 5FLVA 2JMWA 3NARA 4PXIA 2WV1A 1HDPA 4A3MJ 2IAIA 1HDDC 2Q24A 3ANPA 3JRAA 2P81A 3D1NI 3Q0VA 3CJDA 4A3KJ 1BW6A 4JP0A 2DMNA 2DMUA 3RQIA 3S14J 3HTIA 2O8KA 1B8IB 1JKQC 1ETOA 3BR5A 2ME0A 4B1RA 3BT9A 4UUSA 3S16J 2K9NA 1ZQ3P 2TCTA 3BQZA 3TW6A 1IV6A 3EGQA 1QRYA 3OSFA 2L7FP 1U78A 2EZKA 5K7HA 3MVPA 3IH2A 2I10A 2HKUA 4BY1J 2LD5A 1RKTA 5HODA 2DA3A 3E7LA 2E1OA 3S1RJ 1HLVA 3OSGA 4A3LJ 3AQSA 2EZIA 3GTQJ 4D5CA 1DU0A 2DG7A 2NP5A 5FGLA 4DZPA 1WH5A 2FJ1A 4CYCA 4A3JJ 3HKZN 5K7ZA 2KT0A 2R5YB 3ZQFA 2XB0X 1JTXA 1AKHB 2XDNA 1FIAA 4JX6A 3BR1A 3HM5A 3WHBA 3B81A 5FMPA 5GP9A 2FBQA 2M0CA 4QSHA 2PMZN 2YS9A 3GTPJ 1IGNA 4KWAA 4MXMA 3K2AA 5F1JA 3VOKA 1X2MA 1ETVA 2HDDA 2UXUA 5D18A 5K58A 5HSZA 3I4NJ 2XGDA 4HNVA 3M3YJ 1ZKGA 3QPLA 4AUXA 1U8BA 2FD5A 4ACIA 1JUMA 3S2DJ 1A6IA 2D5VA 4M3GA 4B3AA 2E19A 3VP5A 5GPAA 3Q0WA 1CQTA 1X58A 4S0HB 4GCKA 4AC6A 4MFEA 1IJWC 3FK6A 2DTZA 2MGQA 2HXOA 3BTLA 3TP0A 4W97A 1HCRA 2W53A 1P7JA 4DW6A 5DS9A 2G3BA 3BQYA 4DYRA 5EEAA 3CCYA 1LFUP 1ETQA 2O7OA 3HGGA 2O7TA 2JA6J 2R93J 3QBMA 3JR9A 2L9RA 2HOSA 5IOYA 3RKQA 2K40A 5EF6A 4D7NA 2NVQJ 4MO7A 1MBEA 4LOCA 5IPAA 3FKIJ 1SFOJ 1BL0A 2GUHA 4UDSA 4JL3A 2ZCMA 4M6VA 4M3FA 3DEWA 3PM1A 1FTZA 3NRGA 4JX4A 5IYDJ 2VPRA 1OCPA 1ETXA 1JKPC 5DTDA 3S1QJ 4JX5A 3HEFA 4IHWA 3VW1A 1BA5A 2GFNA 2DA6A 2XSDC 1Y1WJ 3O8HA 3TW7A 2X9DA 2N8GA 1K83J 3HDDA 3S1MJ 4QIWN 2QIBA 3WHCA 3S15J 2ECCA 3ON2A 1F43A 5J1YA 3BR2A 2L0KA 2Y31A 5FKOA 1E3OC 1P7IA 2OPTA 5EZHA 1TWGJ 1LFBA 1XC5A 4A69C 4GCLA 3JRBA 3VUQA 2R5ZB 3JRGA 1ETKA 2MG4A 1UI6A 3A02A 1MBKA 1RETA 2MW8A 2XRLA 5J1RA 5AQCA 2NVYJ 1TWCJ 1LE8A 1VFCA 4RBOA 5EDNA 4GFBA 2G0EA 3PO3J 2MSYA 4XIDA 2JA7J 3LWJA 2CUEA 3BTJA 1WPKA 5E3LA 4C3IJ 2OF7A 2X6OA 2CUFA 2Y30A 3QQAA 3A01A 2UXPA 2NOGA 1GV2A 4L5EA 5EZGA 5FLMJ 3I4MJ 4BXXJ 2E2JJ 2IEKA 5J3LA 2Y9YA 3GTLJ 1QVTA 2YU9J 4V2FA 3QPSA 2WAQN 5EGOA 2ID3A 3CMYA 3VVXA 4V2GA 1TWHJ 3HTHA 1VF9A 3BG3A 1RKWA 1RR7A 3LOCA 1B72B 4I6ZA 3EUPA 2DG8A 2GM4A 1ZR2A 2XGCA 2HYJA 1PUFA 2UXHA 2EZHA 1UHSA 3HOYJ 1JT0A 4A3BJ 1A5JA 1SANA 3FISA 2O9LA 3COLA 3H3VK 3G1LA 5FKNA 5J1UA 2QOPA 1YRNA 5EYRA 4FE7A 3DCFA 5IP7J 1MBFA 3A03A 4FE4A 2HOAA 1JJ6C 3JRFA 5F0FA 3VOXA 1MNMC 4DZJA 3BRUA 2L7MP 2G7SA 2LLKA 2D6YA 2ZOYA 4YZEA 1DU6A 3BG5A 3C07A 5E3OA 4IHXA 1R9TJ 1Z77A 5F27A 1APLC 1GDTA 1IRZA 9ANTA 2ME6A 2NVXJ 1W0UA 3NXCA 2R7ZJ 4MFDA 1U9NA 2EH3A 5F04A 2EBIA 5CW8A 2NS7A 4X1EA 2LK2A 3L1PA 2LKXA 2VKVA 3FIWA 5IYCJ 3A01B 2JWTA 3KZ9A 4D7MA 1ZGWA 5C4JJ 1NK2P 1MH4A 4W1UA 3V6GA 3BJBA 1FEXA 3RZOJ 2CU7A 3BTCA 3HOWJ 5FKMA 1GT0C 2E2IJ 2GLOA 3CWRA 1LE8B 2DA4A 3FK7A 2JK3A 1IDZA 4FCYA 1D5YA 2CRGA 2R5YA 3CDLA 2R92J 1ITYA 3Q3SA 1B72A 3PO2J 5FHPA 3S17J 2IU5A 3MKLA 2KDZA 1JKRC 2RAEA 4A3IJ 3HTJA 3P9TA 3VPRA 2COBA 3O8GA 1ZR4A 3PASA 3GEUA 1ZTRA 1G2HA 5FKLA 2LY9A 3ZQHA 5FKKA 3HOZJ 4UUSB 1MH3A 3S5RA 1X2NA 5C3EJ 1VNDA 2NP3A 5D19A 4FISA 5M5XJ 3SJMA 1SGMA 4JYKA 2R0QC 3BR3A 2XB5A 2DMQA 2RHAA 4NN1A 2ZOZA 5H9TA 3MN2A 1U9OA 4L62A 3H0GJ 2NVTJ 3S2HJ 2QWTA 2VUMJ 4IHVA 1RPWA 3BR0A 4MK6A 3HIMA 4IHYA 3IH4A 2Y9ZA 3HOUJ 2JA8J 3GTKJ 1AHDP 3G1OA 1OCTC 1ORKA 2XPWA 2FQ4A 2DA2A 2HOTA 4M3EA 1UMQA 2GENA 4CGRA 2L7ZA 4I76A 2LVSA 3TEDA 3V78A 1JGGA 1TWAJ 1VI0A 3ZQLA 4GFLA 3IH3A 2LR8A 4G12A 3JRIA 1WH7A 4MLOA 2CQXA 3JREA 3JRHA 2PZ9A 1JUSA 2NX4A 1YRNB 5M5YJ 4AF5A 4GCTA 1FTTA 1Q1VA 3G1MA 5EGOB 2QKOA
chains in the Genus database with same CATH superfamily
1LUJB 3BTIA 2HPIA 3C2BA 3EYYA 2BBYA 1PUFB 5D8KB 1MBJA 3PPBA 3NWSA 4CCNA 4UXNA 5GAGJ 3GTGJ 4A93J 3ON4A 1Y0UA 1T38A 2DFEA 3LSHA 1Y1VJ 4YFNF 3DXJF 5FGMA 2IS6A 4AC0A 1F1ZA 3OMYA 1P6RA 2NS8A 1ZRFA 2RNGA 2LG4A 3L09A 5DCFA 1HSTA 1VQLI 5C4XJ 4BKXA 1BOAA 4A3FJ 2JSCA 1DPUA 3M1CA 4NUBA 4ON0A 3NS4A 2I5UA 3VFZA 3HZJA 2H8WA 4OIRF 1R00A 2M34A 1BM9A 5FD5A 1X3ZB 1YLFA 4X6AJ 2V9VA 1FNNA 3NAUA 1YE9A 1LDDA 2QF7A 4R8HA 3WTUC 2WUIA 2G7GA 2XRNA 4U7DA 2R5ZA 2ZB9A 1XG1A 2E60A 5TISC 2QENA 5HNHA 4KJZA 3DLAA 3HTSB 2XAQA 4JK1X 1V54H 3GW2A 3O3KA 4LB6B 5D4RA 4QPQA 4A3EJ 5CPRB 2J5OA 3K1MA 4JKZA 5HBUA 2ISYA 4ZDLA 4BBSJ 3T8TA 1OQYA 1D0YA 1EA3A 3FF5A 2PJRA 3GFJA 4BACA 3KNWA 3AG2H 2ZXHA 2LFBA 3LHQA 1S5LC 3CQZJ 2AO9A 3JSJA 1SD5A 4PK4A 2BYVE 2P5LC 3VW2A 3GLXA 5LGTA 4FTHA 3FMRA 2A2FX 4B8XA 3BPXA 3O2PE 2M87A 2RV8A 3J7YJ 2B63J 2WAEA 4YELA 2WWYA 4BH9A 4L0ZB 2DOAA 3PIOF 4ME9A 2NVUB 4XKWA 2RASA 1WGXA 2Y2ZA 3F8CA 5FJ8J 1L3LA 2OI8A 3GVAA 5FO5A 1IC8A 1UB9A 2VJ4A 1S3JA 5CXIA 4EM0B 4G94A 1R22A 3ZMZA 1WWXA 5J8FA 3HSRA 2HXIA 4A6DA 3KP3A 4LD5A 3CCEI 2K02A 4E7IA 1DUXC 3LSMA 2R7WA 3RQ4A 2HVSA 1FJLA 1L0OC 1R5ID 2DK8A 1FIPA 1B59A 3ROUA 4LB5A 2ZFUA 2K85A 1XDUA 3VVZA 3WGGA 2VPLA 2FF4A 2XAJA 4II3A 1W5TA 2EFWA 2VB6A 4PSXA 1O4XA 2IT0A 3AL0B 4RB2C 1W0TA 3LNQA 5DD4A 3ZMTA 5M3FJ 2M9HA 3P5JA 3VYTB 2KQRA 2LBFB 3HTAA 5LBQA 2A05A 1JJ8C 2K4BA 3QKXA 3DFGA 4C30A 2VBZA 2TDXA 1UI5A 1OCRH 2BOLA 2Y0SN 1LQ1A 1MKMA 1AWCA 3HL2A 1SMTA 4ICHA 4X0GA 5D6FA 3LFUA 5FLXZ 3HOVJ 4RLFA 5EG0B 3EUAA 3PSFA 2OERA 1I5ZA 1CGPA 3RDIA 4CSWA 4RB0A 3GFLA 3I56I 5CVJA 3SFZA 3KFWX 2MABA 2P7VB 2X48A 2PX9A 3KX2A 4M3DA 3UKGA 1T0FA 1YW7A 3VVYA 2VXZA 3OL3A 2VJIA 3E7QA 2LBFA 4ZYDA 3KPHA 1TT5B 3CUQB 3TO9A 1LKXA 2PLYA 2DODA 5D5UB 5LHHA 2E5ZA 3U1KA 1MJ9A 3IC7A 2AQFA 2KP6A 1N75A 2DW4A 2REKA 3CUQA 3PNYA 1WHUA 1LB2A 3ZP5A 1U5TC 4Q48A 3EUHC 4B4CA 3OS2A 4MTDA 4JNNA 4PJMA 4N4NB 2VKDA 5HLTA 3HTUA 4EJVA 2V1XA 2E2HJ 2GBYA 3LSGA 3CCJI 2XF5A 3HRUA 3JRDA 3L2CA 1R1VA 1ZG5A 3JCUC 4PXIA 2DT7B 4EJWA 1TZLA 1YW8A 2IAIA 3HSEA 3MFKA 3CJDA 4LG0A 3VB2A 2IJLA 4WCGA 3P9CA 2XKOA 3GUDA 3RQIA 1BI3A 1Y6IA 2K27A 3EUKL 2O8KA 1JKQC 3I64A 4MEXF 4GRIA 3IWZA 3BT9A 1VQ9I 4NC6A 3R60A 4KT6A 1U8RA 3EGQA 3OYBA 2L7FP 2Y48A 1STZA 2EZKA 5K7HA 4GYGA 1ZYRF 5LRSA 1LNWA 5HODA 2DA3A 2RNJA 2E1OA 2PQ8A 3JSPA 3S1RJ 1HLVA 4A3LJ 4OIPF 3AQSA 2VJJA 2DG7A 3I55I 2J5PA 5LD2C 3VTIA 2ZJRF 2FJ1A 3K8PC 2R5YB 1OLTA 2XB0X 4UV9A 2HKXA 3Q9SA 4N9IA 3E0JB 1HW1A 2M0CA 1M1EB 3GTPJ 2PMZN 5F1JA 2ELHA 3SDBA 3QYFA 3BC8A 3H3UA 4I02A 2XGDA 4AWXB 4HNVA 1ZRCA 3M3YJ 1ZKGA 3P7NA 4LIUA 4AUXA 3D0SA 1TQMA 3AG4H 4UB6C 4E7SA 2B0LA 2L9VA 3CJQB 1D8JA 2KJCA 4XQFA 4M3GA 3C18A 3Q0WA 2E35A 4PCQA 4GCKA 4MFEA 3K1PA 2DTZA 1XMXA 4HAMA 4I01A 3ZN1A 2HXOA 4AYBA 3U9GA 2VC0A 4RAGA 1SFUA 1SEUA 2FBIA 1XDSA 1R1TA 2IXSA 2O7OA 3HGGA 2KMUA 2OCEA 4IF4A 5ERIA 3QBMA 2RC4A 4U0VA 2V9KA 4HQMA 2EFNA 5HS8A 2GUHA 2VQLA 2R7QA 1BL0A 2M8EA 2WY7Q 2W57A 2CO5A 1LEAA 4M6VA 2OCCH 1X1BA 4AD9A 4HF0A 2XIGA 2JZYA 2W25A 2CSOA 1QNTA 2FJI1 4M6XA 3NRGA 2A68F 2VPRA 4Q4ZF 2Z9OA 1YTYA 1OCPA 1ETXA 4HG2A 3QAHA 1VQ5I 2QQAA 5DTDA 3LSIA 4PFOA 2V4JC 1D3YA 1OR7C 2HTJA 5D6EA 3OYJA 3PUFA 3W6KB 3TW7A 3MQ0A 4HDUA 1WKMA 2MH2A 1K83J 3ZQ7A 3ABUA 1IN4A 3WHCA 2HQNA 2P6SA 3DF8A 1X3UA 5J1YA 1F43A 2Y31A 4ANJA 1E3OC 3KZYA 1QQIA 1VQNI 1LFBA 1X1AA 4A69C 3HKZA 1J09A 3JRBA 2H6CA 2KHMA 2HNHA 1V5EA 2H27A 1OISA 2XRLA 2HYFA 4LITA 3K4LA 4L9TA 4IQJA 5LGUA 5JHUA 1VFCA 4RBOA 2IS4A 2G0EA 3FM5A 4PJNA 4XIDA 4XKVA 2JA7J 2CUEA 2DLLA 2KIQA 3ONQA 1XPXA 2XSJC 2Y30A 1FSEA 2NOGA 2K3FA 3LAPA 5DM7F 1KQ9A 2ESHA 3ZPLA 2A6HF 3FXKA 2W7NA 3L2QA 3BG7A 4HLXA 2RN7A 4M6YA 4DOZA 4PUSA 3VDXA 3WGHA 1KYZA 2BY2A 3CUQC 2O3FA 3LWFA 3BWGA 1TW2A 3CMYA 3JAMZ 1BIAA 1VF9A 3BY6A 1DGRM 1RKWA 2CW7A 4CH7A 4E70A 4UHTA 4BHPA 4KNYA 2WC2A 2Z99A 3FBNB 2DG8A 3EUPA 4Y4RA 2HYJA 1GXPA 3GX4X 1QZZA 3VWBA 2Q1ZB 2EZHA 3LMMA 4C9YA 3HOYJ 2AXTC 1SANA 2O9LA 1R58A 5HS7A 3BJOA 5FKNA 4RGSA 4U7BA 4OMZA 2EV0A 5LRRA 4XM3A 1ZH5A 5LGNA 2MH9A 3IAS2 3CD6I 1YYVA 4FE4A 2OC6A 1P4XA 3JRFA 5F0FA 2KJBA 2XAGA 1ZGAA 3I71A 2L7MP 2G7SA 2LLKA 3ERMA 5KHDA 1DU6A 3BG5A 5E3OA 1AOYA 2M4GA 5FD6A 2O6GE 4KDPA 2L7KA 3IWFA 2P8TA 4ESFA 2HYGD 4KIBA 1TT0A 5CVUA 5D5WB 1XMKA 4ITVA 4CCMA 5ICCA 2NVXJ 3NXCA 2D1VA 1K78B 3QU3A 4TV7A 3H35A 2W85A 1OKRA 3H5NA 2E1NA 2LK2A 3E97A 1UZCA 5IYCJ 3L1PA 3CCUI 1S9HA 4QPOA 4DGWB 4WK8F 4CGZA 3RI4A 3T0YA 1NK2P 2ACJA 1ODDA 4W1UA 4ZYGA 2JQ7A 3TO7A 1FWZA 1IUYA 5GADJ 4DVYP 2GLOA 4HV6A 1XX5A 3KE2A 3F72A 2DA4A 4B48A 3KLOA 1LVAA 2R92J 2E1MB 2L02A 2MC3A 3PQJA 4DQ2A 3PO2J 2PEXA 5K5OA 3S17J 3MKLA 1X1DA 3K10A 2RAEA 3EDPA 4WXDA 3HTJA 2Q2EB 4G6QA 3VPRA 5LLQA 2QQ8A 2G7UA 1T8IA 3H36A 3P9KA 4XN3A 3OYNA 1MW7A 1W5SA 3GEUA 1NH3A 3WU0A 4EVIA 2DOEA 3FKJA 3TO6A 3PFIA 4ZYHA 4WXCA 3ZGKA 3HOZJ 1E0EA 1QHGA 3DTKA 4YRVA 4F91B 2E7WA 1VNDA 5C3EJ 2Z33A 4E7KA 5D19A 3ECOA 3IL2A 2XB5A 3KYDB 4OWRB 1F5TA 2KKOA 4I99C 3FWEA 4MHGA 2NVTJ 3HIMA 2FOKA 1YQAA 3LA2A 3AG3H 4KMFA 3WTSC 3DTIA 1X1PA 1MZBA 2DA2A 3ESWB 2FMLA 2GENA 1YOVB 3ABLH 5BS6A 3TEDA 4AM3A 2ICWG 3V78A 4GYIA 1JGGA 1TWAJ 1VI0A 4GO1A 1J75A 1TQIA 5DDGA 4MLOA 4XR6A 2NAZA 2CQXA 4KT5C 2PZ9A 1JUSA 4XLCA 2X85A 2D45A 4AF5A 4HOBA 1FTTA 3CTAA 3G1MA 5EGOB 2KISA 1VTNC 2K7LA 3CMAI 4QWQA 2HS5A 4P96A 4J19A 1AKHA 4XN0A 2XUBA 4F3QA 1BI0A 1V55H 2WB1N 2CJJA 3S1NJ 3LSJA 3GTMJ 4RB3C 3OIOA 1K4SA 4NC7A 3G7RA 2IBDA 2DDBA 2YX4A 4NDLA 5JLWA 4XBFA 4PGGA 4XKBA 2KPMA 1PVEA 1PUEE 3ISPA 2ZCNA 5M5WJ 2M45A 1QA6A 4IVNA 3RCOA 2RKHA 1WFXA 4CCJA 3MCZA 2NS0A 1HSJA 2CV1A 1MBHA 4UV8A 2L9SA 2EA2A 2XAHA 3FXJA 3KYCB 2ZNYA 5JLXA 5LHIA 2IA2A 1TWFJ 1OPCA 4CYDA 2OV7A 4UVBA 1WRJA 2Y0SA 3GBGA 1FBUA 3ZXSA 3TL4X 2ZSHB 4LFUA 2FUG2 2XAFA 3J7ZI 1JT6A 4E7ZA 3K69A 3SZPA 2E5NA 3LA3A 4DYQA 3JRCA 2M30A 1WJDA 3F1BA 4B09A 2V6EA 3F8MA 3U21A 3QYEA 1GVDA 3Q0UA 2L54A 5IOZA 4EQQA 3V7CA 1XGMA 5L3GA 2BEOA 2ZCWA 4XORA 2DA1A 1OR7A 2K5CA 3E3VA 4I09A 3ZOBA 1U0JA 2Y75A 3G73A 2RDPA 4P5OA 4FX4A 2M2EA 4D1QA 1YX5A 1UCRA 1Z1DA 3G4SI 1DGWY 3SXYA 2DA7A 5IT9K 1YJNI 3Q5FA 2YVHA 1BW5A 2A3SA 2HOEA 3DBLB 3OR2C 5F64A 4Z2YA 4A5MA 4CCLA 4DYCA 3UNGC 3R0JA 3RKWA 5K7FA 2CS3A 1XS9A 3WTXC 3OY9A 4HQEA 4CO8A 4NNJA 1SVLA 5ICFA 1ZG3A 2LC2A 1D1AA 1WJAA 4A3DJ 2V79A 1BC8C 2ZSIB 4RAZA 1XMAA 1W4MA 3MZYA 4F52A 1MMSA 5CVIA 4ZDOA 1FMWA 4BHCA 5BNGA 1EH6A 2MC4A 4RMNA 4I0BA 3PFYA 5C4YA 1Z21A 1I3QJ 5E1XA 3D5LA 1TP4A 1IV8A 1W7PA 2FX0A 5BPIA 4QTRA 2M5WA 4CXFA 4H0EA 2X1DA 1FP1D 1V5GA 2LMDA 2K3PA 4NBQA 3WU2C 2XROA 1IDYA 3ZQGA 4EM2A 2HZTA 3GFIA 2HI3A 2X1CA 5L3DA 2F5CA 3BP8A 1Z6RA 4MIMA 5E8GA 3OIPA 3VODA 4AVPA 2CQQA 2ZBKA 4MQVA 1SD7A 1HKQA 2CW0F 3IUOA 2QEXI 2NNYA 1BN5A 4Y17A 2YX7A 3K6GA 1J9IA 1RESA 3IHUA 1I1GA 1JKOC 1LEBA 1D1CA 1HQCA 2FE3A 5E17F 3ABTA 2C6YA 2KRFA 4IRGA 2E1CA 1HXDA 5BOXA 3R61A 2XVCA 3CP8A 4S05A 2VI6A 3B6AA 1ERDA 1I6XA 4J01A 3GCMA 3OYMA 3FRQA 2W84A 2WGBA 2ZNZA 2Z3YA 3QWLA 2LF8A 1FY7A 2VBWA 1TNTA 3SYTA 3ZQCA 1F9NA 2XPUA 2IRFG 1I3AA 2JN6A 3LJLA 1JHFA 2XGEA 4XOTA 1Z91A 3ELKA 1FYMA 5EEGA 3H5RA 3HE0A 3K4MA 3REOA 3OYFA 1CF7B 2LTPA 2W1OA 3RYRA 2LF7A 2EV5A 3HB9A 1TW3A 2H1LA 4XNFA 5GPCA 4A12A 5HOOA 1H89C 2LY2A 1IN7A 3CZ6A 4Y52J 2RQPA 2IPQX 2STWA 2LP0A 4M3BA 2OTLI 1K78A 1NK3P 3BHQA 3W6VA 3NARA 4ESBA 3SQNA 2JRMA 2Q24A 1T6SA 3D1NI 4LLLA 3DWLE 2QUFA 1GLNA 2EJRA 2R7FA 2RREA 3F3XA 3S3NA 2BHZA 1B8IB 3V8KA 4BJ6C 3FX3A 3BR5A 1KU9A 1JHHA 2ME0A 4B1RA 4IZZA 2DBBA 3BQZA 4N0BA 2DFIA 1IV6A 2YPRA 1T0FC 1OYWA 1OCOH 3NQOA 1S6LA 4RGUA 3MVPA 3IH2A 2I10A 1SMYF 2QBYA 5L3CA 2HKUA 1VQKI 1E3PA 3OS0A 3FZVA 3D5SC 1DU0A 4Y33A 3BROA 2MD5A 4DZPA 1P2FA 3VOEA 3F22A 3HKZN 2OJED 3QODA 1I27A 1FIAA 4O3MA 3BR1A 5K5QA 3WHBA 1SD6A 3RIRA 4PDKA 4ZZLA 3VOKA 3F8FA 3DBRB 4ENKA 2R7TA 4UVCA 5D18A 4A0YA 1QBJA 3I4NJ 3C2GA 2QSFX 3BJAA 4PSWA 5B1AH 3W3CA 2CFOA 1B1BA 1U8BA 2FD5A 2MFZA 4ACIA 1SFKA 1GXQA 3LL7A 3BG6A 1BJAA 2ZO4A 3A1YA 1A6IA 3PNTA 5CVVA 4B3AA 2E19A 3CLQA 1XSXA 1RNLA 1CQTA 3VP5A 4AC6A 4B47A 4M72A 3WTZA 1IJWC 1HBXG 3BTLA 3TP0A 1HCRA 1MMNA 3T1BA 4DYRA 2IGMA 3CCQI 1EH7A 1ACIA 4UVAA 1N25A 1UJ8A 1DQUA 2BY1A 2O61A 2L9RA 4CDGA 2NVQJ 4D7NA 3CCRI 4MO7A 1J5YA 3L00A 3G71I 1H0MA 1MIJA 4OIOF 4JL3A 4L5IA 1VQ6I 3I9V2 4LJZF 3PM1A 4XOPA 1FTZA 2VASA 4D0PA 4JX4A 2ZXIA 2D2WA 1Z9CA 5IYDJ 2BZTA 4LLGF 2W82A 1UG0A 5KNLA 2EINH 1W5CC 4KUMA 1RI7A 2BXZA 3S1QJ 4OINF 2WY8Q 4BQQA 3HEFA 4G7ZF 2GFNA 1Y56A 2DA6A 4Y15A 4YIFA 3O8HA 2A5WA 2X9DA 4M9SA 4C2TA 2QIBA 2FA5A 3CMEI 2O03A 4A0XA 2Q2EA 4BXUA 3BR2A 1MMDA 5KAIC 3SEQA 1P7IA 5EZHA 4MGRA 2WADA 1XC5A 4MNUA 4GCLA 2VLAA 5J4VA 2R5ZB 1O3TA 5B3SH 2MG4A 3K9TA 1EH8A 4HX8A 2EK5A 2MW8A 4P55A 5J1RA 1K7AA 1TWCJ 1BIBA 3U1DA 1WQ2A 1NG7A 2CFXA 1YG2A 3K4JA 5E79C 4GFBA 3LWJA 2MSYA 2NYXA 2OQGA 5E1WA 2QKMB 3E5QA 1Z67A 1WPKA 1X4PA 2X6OA 3S93A 4C3IJ 1SC7A 2DXIA 2ZMEB 2BW3B 3S8PA 3QQAA 4JBAA 3DU5A 1GV2A 1X3WB 3HPHA 4K2EA 5EZGA 5FLMJ 4B43A 5B5EC 2YU3A 2PBIA 4BU2A 1SVOA 4E6KG 2IEKA 2KIFA 5J3LA 3IP4B 4E4HA 5DM6F 3GTLJ 1FSHA 3WTYC 3CCVI 1IAWA 4BQAA 1MNDA 5EGOA 2G9WA 2MLGA 2Z1DA 1IXRC 1YI2I 3PNVA 2JUGA 5TRDA 3LOCA 4AIJA 1UFMA 2R7SA 1PUFA 4MTEA 3BJ6A 5AIQA 1A5JA 3KETA 3RPUA 3COLA 3HPGA 1XSVA 3DQVC 4WIBA 1YRNA 1I1SA 5EYRA 5IP7J 3DCFA 2QGUA 1OMIA 3A03A 2IW5A 2DO7A 2H6BA 4GGGA 3ML6A 4E7LA 3FM3A 4DZJA 3BRUA 1R36A 3X2QH 1T95A 5CJ9A 3AG1H 3QP6A 4IHXA 1R9TJ 5F27A 4A5NA 2F6CA 4DJAA 1S29A 2AQEA 2P4WA 4M74A 4P1WA 2ME6A 3CO7C 9ANTA 1X19A 4KA4A 2V9PA 2R7ZJ 2FNAA 2LYCA 4KIGA 1U9NA 2EH3A 5F04A 2EBIA 2DDAA 1B6AA 5FFZA 4X1EA 1AA7A 2PN6A 4YFXF 1Z3YA 3FIWA 2JPBA 3A01B 1FC3A 3GMEA 2F5DA 3B02A 1EV7A 1YO5C 4HPQA 2EA4A 4D7MA 4IKFA 5C4JJ 1MH4A 1H9GA 3E6CC 3RZOJ 3BTCA 1LE8B 1DP3A 1D1BA 2V7FA 3RSNA 4IL6C 1D5YA 5L3BA 1IN6A 3CDLA 3MKYB 3Q3SA 2R5YA 1XTAA 2Z16A 4BE2A 2IU5A 4A0ZA 2F4IA 3ZQQA 5ILVA 3HXLA 3ZCOA 2PMZA 3O8GA 4OOIA 4WWCA 1P92A 1G2HA 2VODA 2Q0OA 3OYIA 2YSRA 3CC7I 2IS1A 3MAJA 4NQWB 3S5RA 5BPDA 2NP3A 1SGMA 4JYKA 2DOFA 4OAZA 5EEHA 5CKTA 2DMQA 1KGSA 4BL0B 1YJWI 1EJ9A 2ZOZA 4NN1A 5H9TA 2GZWA 3DU6A 5F6FA 3CC4I 1G59A 3H0GJ 5JFRA 2DI3A 3S2HJ 1RUOA 1PJRA 2HTSA 5EJCA 2VUMJ 2JT1A 4IHVA 1RPWA 2Y69H 4MK6A 1JE8A 2Y9ZA 1RRJA 3HOUJ 2JA8J 5H6RA 5J8CA 3L2RA 1OCTC 4HV5A 2BY0A 2XPWA 1ORKA 4HYEA 1NG6A 5D5VB 5DEQA 3LAJA 4M3EA 4BQNA 4QLCU 3NEUA 4CGRA 2X6YA 4XONA 5DCMB 1S8NA 1WJ5A 4BGDA 2OU2A 2LR8A 2GOXB 4G12A 1IXSB 1E2XA 3LA7A 4N9HA 3JRIA 5B1BH 3JREA 2NX4A 1YRNB 1SD4A 4JQFA 3QYBA 2E1MC 1GVJA 1U6GA 3MMYB 1DP7P 3OWTA 2VBXA 1XCVA 2M7AA 1H8AC 3BNIA 2QQBA 5HVQC 2HVQA 4HSRA 2DJNA 1TTYA 4ZTJA 2KLOA 2JVHA 1VQ7I 2JA2A 2ECBA 2WTEA 3BZ6A 2V1DA 3V42A 2XPVA 5JVGF 4O6JA 2UUZA 2KZVA 3GF2A 2DN0A 2ZY9A 4BUPA 5E3NA 2VE8A 3KLNA 3JTHA 2VOPA 3CP2A 5FRNA 3SDGA 4IRIA 3J81Z 2H09A 1SVMA 3BR6A 2ZMEA 4M73A 1FZPB 3IV5A 3G56A 1IF1A 5ILSA 4BDYA 4D9JA 1UHMA 1IO2A 5HNFA 2H1KA 1BBYA 4BAYA 1MBGA 3LQRA 4XLEA 5HAWA 4XICA 3TKYA 4CYCB 3I59B 3CF2A 4RS8A 2EV6A 1V3FA 1IRGA 3K7AJ 3H9GA 2BHYA 2D1HA 1KU3A 2UXIA 2PBXA 1IG7A 3PIPF 2DAOA 4NELA 1ZG1A 1IN8A 1R4NB 1OCCH 1T33A 1ZLKA 3L2VA 2EZLA 1J0RA 1POGA 3M1EA 1WCMJ 3C7JA 5IP6A 1OJLA 3TMOA 5DAJA 3GLLA 1IUFA 4F93B 4GXOA 4UY8I 3V7SA 2IVMA 2KZGA 1WVRA 4GFKA 2WA0A 4FASD 4F92B 1D0XA 2P6TA 2PFBA 3KEYA 1W7PB 1VQPI 5F08A 3RTRA 2GIZA 2QTQA 3HHHA 3LSTA 1NHAA 2R7RA 4OAYA 4ABZA 4KMUX 2VKEA 3VEPA 5M3MJ 1I6HJ 2KIUA 4D5FA 1KYWA 3S3OA 1G3WA 3L2WA 2EQRA 2DA5A 1R49A 1G6NA 4KFCA 1Y39A 1KQ0A 3V8LA 4AVZA 2XAUA 3ZMVA 4O5VA 2AHQA 2M0MA 2DQRA 4Y7NJ 5A2QK 1UG2A 4IPAA 3OOPA 4IHSA 5EFYA 2K9QA 1JI8A 2ZXJA 1I50J 3PUBA 1W1WE 1LDKB 3V4GA 3I58A 2QA4I 1O3QA 1EF4A 3DP7A 3OYEA 3FXLA 1RIOH 1Z6TA 4IOAF 2PMUA 2JJ7A 2UXNA 3RJPA 4ZTFA 3HGYA 4II2A 4IO9F 2EILH 2ZXWH 1TQPA 4XK4A 2LDUA 3M8JA 3KZZA 1CF7A 1T56A 3E5XA 1BR1A 3LSRA 3ULQB 2XF6A 1ULYA 2FBKA 2UXOA 2VN2A 3F0CA 2EIJH 2HDCA 3OOUA 2ID6A 2W48A 1A35A 2K4JA 5B66C 4EEFG 1KA8A 3G6EI 4L5JA 3B6CA 4FHTA 5E18F 3M4OJ 4C2MJ 1BJZA 2BW3A 1ZK8A 2CUJA 4IXAA 1HKSA 2JUCA 3OV8A 3Q9VA 3RPUD 3T8RA 2VBYA 3I53A 5DUKA 4XRSA 1LDJA 2OBPA 4BBRJ 3CF5F 1TC3C 1KU7A 4C3HJ 3IUVA 3K1NA 2PG4A 3OIQA 3E6BA 3TOBA 3HOXJ 1S7EA 1BI2A 2PMHA 2XDVA 2HQ5A 4RDUA 2HYTA 1ENHA 5D4SA 5FB2A 4RLQA 1OFCX 1WJFA 2OZUA 1LVKA 3OR1C 5D5XB 3BZCA 5F0CA 3NPIA 4RB1A 4EGZA 3CRJA 1VQ8I 1F36A 1ZAOA 2DMPA 1H88C 3BLYA 4CICA 2YUSA 4LIVA 2BY3A 2DQLA 3HSFA 1MSEC 1J59A 5FLVA 3RPQA 4BEHB 3F23A 3WE3A 1HDPA 1ONVA 1HDDC 3ANPA 4ZJZA 2P81A 3JRAA 3Q0VA 2DFFA 1A36A 4HZFA 1MMAA 3HIFA 1BW6A 2X1EA 1WSUA 2A5YB 1P4WA 3L2UA 3SZTA 4DBQA 3FHNA 3CCSI 3B73A 3FBIB 4KYWA 1ZQ3P 2TCTA 4DNCA 4L9JA 1YFHA 5J47A 3MKWB 2O8XA 1QRYA 5GTHC 1QO0D 1U78A 4UNOA 3SEZA 1R4MB 4GDFA 1RKTA 3IKTA 3VYUB 1Z7UA 5H20A 3E7LA 3OS1A 4ENNA 3OSGA 4D5CA 3SHFA 4EJUA 2NP5A 2F5FA 3HRMA 1WH5A 5FGLA 4FETA 1KU2A 1XCBA 2KT0A 2UZKA 2DT6A 2W4SA 3FXUA 3ZQFA 1R23A 1JTXA 1AKHB 3A4CA 4JX6A 3MWMA 4WF2A 3CO6C 3B81A 2FBQA 4FT8A 3OYHA 4I2OA 1XD7A 2YS9A 4QSHA 4KWAA 1C0WA 2HQAA 2HDDA 3RYPA 3CJNA 2LKPA 2ZC2A 5HSZA 3BOQA 2E71A 5HLIA 1E3HA 3ABKH 3QPLA 3UR3C 3CC2I 4KISA 4I0AA 1T08B 1JUMA 3S2DJ 4LMYA 3CCLI 4RGXA 5BQTA 3OYDA 4S0HB 3G2BA 3KP4A 5ILUA 3FDYA 2MGQA 2R7UA 4G9YA 3AKZA 3HRTA 4W97A 1REPC 4M9XA 1P7JA 3LSKA 4RM3A 2G3BA 2HPMA 4BS9A 3CCYA 4KITB 1LFUP 1ETQA 2JTVA 3U2RA 3RKXA 4V19K 1RZ4A 1ZRDA 3N05A 3OYGA 2A69F 2NRAC 5IOYA 1OCZH 3RKQA 4PZJA 2K40A 5EF6A 1IXCA 1MBEA 4LOCA 3L9FA 3I4PA 1U2WA 1YIOA 2ZCMA 4KICA 3DEWA 3GWZA 2A61A 1XGOA 3FXOA 1UHWA 3CMMA 3HUGA 3I3LA 1XGSA 3EQLF 1R6RA 5K1YA 2OUMA 2X6WA 3R4KA 3E5UA 3VW1A 3GYHX 2R3SA 3QRFF 4EGYA 3OYKA 3DKXA 1Y1WJ 3V7RA 5IY5H 4U0YA 1ZLJA 1HA8A 2ECCA 1EKEA 2VJ5A 2WV0A 2PJRB 2OD5A 1P9QC 4YEJA 1TWGJ 2DCEA 2KFDA 3JRGA 4XRFA 4HLYA 2KL4A 2ZKZA 1MBKA 1RETA 3MZHA 5AQCA 2IP2A 2NVYJ 1LE8A 2M1BA 5HDNA 5FLXK 3PO3J 2R7OA 3FMSA 3WTTC 1FOYA 3BTJA 3EYIA 5E3LA 3MZ8A 3KEOA 2GOMA 3KEQA 5H6QA 3A01A 2CUZA 1YS7A 3FHZA 5JVTA 1TL8A 3I4MJ 1J2XA 4BXXJ 2E2JJ 4YIRX 4IJAA 2IS2A 3K70D 4UB8C 4N4OB 3GZ5A 2Y9YA 3F9KA 3W2WA 2YU9J 2VXDA 4HA8A 4Y3OA 2EFPA 5AIPA 2ID3A 5F1RA 4V2GA 1FOKA 2JRTA 3VVXA 1W36D 3HTHA 4BYYA 1RR7A 3S3MA 3A0BC 3H9JA 3V8JA 1B9NA 1XN7A 1G3YA 2XGCA 4DBRA 3ABMH 5BMZA 4BE0A 1UHSA 1JT0A 3EPZA 4A3BJ 1O3RA 3DBHB 2M4KA 3F8BA 1Z05A 3K0LA 2CYYA 2HEOA 3M9AA 3F6VA 4WX9A 2A07F 3G1LA 5J1UA 2B7EA 2RGVA 2KRHA 1FT9A 3EETA 4BEHA 4XL9A 2L2OA 2FU4A 1MBFA 4FX0A 2HOAA 3A0HC 4ZC3A 3VOXA 1ON1A 2GA1A 2L5QA 1ZN2A 4AIKA 1G3TA 4YZEA 2P7CB 4ASNA 3C07A 1HKTA 3VSLA 1FOXA 4PJLA 1IRZA 1W0UA 1FOWA 2GIVA 5LEKA 3F21A 4E7HA 2NS7A 3BCBA 1K4TA 3NWTA 2K9MA 4RAFA 2VKVA 4ZH4F 2CV0A 2P0WA 4L0YB 2R7DA 2PJPA 3KZ9A 1ZGWA 3DPTA 3V6GA 1FEXA 3ZMSA 2FSWA 2LKSA 4AIDA 3FK7A 1FLIA 2NXNB 3S32A 1W7PD 2O5RA 2CRGA 1ITYA 4HDVA 2F4MB 2OAZA 2MYSA 1B72A 3ERED 4G7OF 2L3DA 2F5VA 2KDZA 1G8XA 1JKRC 5E20A 3P9TA 2KIMA 2YVXA 1ZR4A 4NQWA 3I54A 3M7GA 3A2KA 1LFPA 3DEUA 3VSKA 4H4KC 3IRQA 3R6SA 4LG0B 2EPFA 3ZR8X 5A2QZ 2A6EF 3CDIA 3ZQHA 2HZDA 5FKKA 5KAFC 4UUSB 1PDNC 2DYRH 5ICGA 4OD5A 1MNEA 2B9SA 3DV8A 2LRDA 4XSXF 3K4KA 1UELB 5M5XJ 2R0QC 1R71A 4BNCA 3BR3A 2EB7A 2RHAA 4GCVA 3SWHA 4OD4A 2I8DA 3MN2A 1U9OA 2FOWA 2CGPA 4L62A 2QWTA 5CQGA 4HX7A 3BR0A 4IHYA 3IH4A 3GTKJ 5DCMA 5HLGA 2PI0A 4IHTA 2CWEA 5J4YA 4ESJA 2GXAA 3T5XA 2YR2A 1J7KA 1UMQA 4I76A 2HGCA 4MQ9F 2FQ3A 4NHJA 3ZQLA 3F8NA 3CCMI 4U87A 4R79A 3H5AA 3KYLA 2VOOA 4S04A 2VC1A 4XLAA 2R7VA 5M5YJ 4GCTA 4M71A 1YJ9I 1FYLA 4EM1A 1LJ9A 1O3SA 2B3WA 2DJIA 1K79A 1O57A 5E8IA 2ZFWA 4HNUA 2YVEA 5HS9A 4CZZA 1JTYA 3IAM2 3AL0C 2ESNA 2FBHA 2NNNA 1JUPA 3T6NA 2CMPA 5JR3A 1Q1HA 1QVUA 5LFAA 1QPIA 3LFKA 2XV4S 3PSIA 4M9ZA 2M3AA 4G8XA 5D8LB 3GTOJ 2WBMA 1Z3XA 5CXGA 3MNLA 2GWRA 2QM3A 3BG9A 1YX3A 3ZQIA 5CQEA 4XSZF 1YHQI 3WODF 4G6TB 3RKYA 5KK1A 4CHUA 2QCOA 1V4RA 1YW9A 4HKUA 3LQQA 4BJTA 3SFIA 2OQRA 4XMYA 4DIQA 4U88A 2GXGA 3GTJJ 1MSFC 4ZDPA 3NNRA 5IP9J 2QBYB 5HDKA 4XLNF 3I59A 1DPRA 4A3GJ 4XRMA 5LEJA 4IOCF 2H8RA 4ZZDA 5HLHA 3BPVA 2CH0A 4EV0A 4E7JA 4JOMA 3TP3A 2DFHA 2JA5J 5C44J 3HHGA 2EIMH 2X6XA 3JW4A 3FXRA 1B8IA 3KKCA 3O6BB 3K4CA 2KDOA 1GHCA 2G7LA 2ELKA 2IA0A 2P5VA 3JAMK 4BE1A 2ZCXA 1B4AA 3CJTB 4XLFA 3F6OA 1BR2A 3AFHA 3KZIC 3NI7A 3WTVC 2UV1A 1D5VA 4HSTA 1YS6A 4OU0A 2R4GA 2VT2A 1A6QA 4IEJA 1S72I 4HF1A 1QU3A 4XRSG 4U9LA 3K4BA 2EWNA 3J7AY 3RH2A 3ZMUA 1XB4A 1IZ1A 1U3EM 1MJBA 4BXFA 3LSPA 4LG3A 1H9TA 3J7AO 4ENJA 1IRFA 4HW0A 4LK1F 1NTCA 1U5TA 3QPHA 5DD8A 1HC8A 4P9UA 2GXBA 2F48A 2QVOA 4ZYEA 5AONA 3H0DA 5EG0A 3RD3A 2DMTA 3ZN0A 4C3JJ 2MBFA 2ADUA 1MD0A 3VIBA 3DLLF 1KONA 3DPJA 1ETWA 3K70C 3WE2A 1B9MA 4RA2A 3JTGA 4A3CJ 2BGCA 3EUHA 4G7HF 3KKDA 1ETYA 1MMGA 1UAAA 2JSPA 4EMSA 2FEZA 1W36C 1ZARA 5DYMA 3R0AA 3W2VA 4RAYA 2BXYA 3HC7A 3BZKA 2UWMA 1Z0XA 4OMYA 2DTRA 2MLKA 3N4MA 2QYOA 1U5TB 3QPTA 1Y0NA 4BHBA 2F07A 4KIFA 1GUUA 4PGHA 5E3MA 3VW0A 1R5HA 2W00A 1HF0A 1FYKA 2K86A 5IYBJ 2IGOA 1GV5A 3MKZA 2Y0MA 3QP5A 2ZJ2A 2Q8KA 1AU7A 4OIQF 3AQTA 2V1UA 3WG9A 3TDUC 4UUTA 2TRTA 3C3WA 3GXOA 2M8GX 2F2EA 4ETSA 4CA0A 1DDNA 2F4OB 2FXAA 3KP2A 4PJ0C 5JHFA 1K61A 1ZREA 1WI3A 3QOPA 3J80Z 1PP8F 4Q5SF 1JXSA 2ISZA 4WXHA 2V26A 4L9VA 4BY7J 3O60A 1YITI 4U0WA 2VONA 2EFQA 2VL8A 2NOJB 3S2WA 1D8KA 2BVMA 4BJ5C 2V57A 4Z6YA 5ICEA 2QSHX 2IGNA 1SFXA 2VKHA 5GAHJ 1HOMA 3ANGA 4C2MA 3I5UA 3BCGA 3QOEA 2L01A 4G6DA 4NC8A 2IA1A 2HVRA 3GZIA 2CQNA 1R5GA 3P9IA 3HBLA 2STTA 3HUGB 1PYVA 2K9SA 2E34A 2V6CA 2LNBA 4IX7A 5F0HA 1TNSA 2UXXA 2ELJA 3ASOH 4AYBN 3WGIA 5D1RA 4PFPA 1T39A 2HKOA 2VE9A 3GEZA 3ASNH 3TOAA 3TBIA 2GAUA 1WI9A 1K6YA 2COMA 3WG7H 5DUIA 3RZDJ 3CDHA 4B44A 2JMWA 2L4AA 5CYVA 1S7OA 4EJOA 1BC7C 2WV1A 4A3MJ 3KIOA 3E6MA 3DPLC 3J80K 5H2FC 2A6TA 4A3KJ 4JP0A 2DMNA 2DMUA 3D5RC 3S14J 3CJRB 3HTIA 1FMVA 4YG2F 4KN4X 1ETOA 1VQOI 3J81K 1IW7F 3M07A 2FMYA 3C2HA 5LHGA 4UUSA 3FXMA 2K9NA 1YIJI 3S16J 1XGNA 4J00A 1KQ8A 4L18B 3TW6A 4HEA2 3KP7A 3OSFA 1N77A 1USTA 3KCCA 2DPUA 4BY1J 2LD5A 2WAQA 4R1HA 4Y13A 1HW2A 3L7WA 3PJRA 5E1ZB 1RUNA 1R7JA 2CQKA 2EZIA 3GTQJ 2WB1A 1VQ4I 3AAFA 3HOTA 2HQRA 4CYCA 4A3JJ 2H94A 5K7ZA 2OTJI 1N78A 4NB5A 2BVLA 5TGTA 3M8FA 3W6JB 2XDNA 4CUGA 3HM5A 5FMPA 5GP9A 4XKCA 4I98B 1IGNA 4MXMA 3K2AA 4Q47A 1X2MA 2GQQA 5CVRA 1ETVA 2UXUA 2K9LA 2IGKA 2QWWA 1K6OA 4F55A 2DPDA 5K58A 1VQMI 3N97A 2BE5F 3G3ZA 4IQ4A 3HG9A 2HDWA 2LSOA 2QZ8A 3MEXA 2D5VA 1RC9A 2E36A 3VYRB 5GPAA 2CQ7A 4YIIA 1X58A 2MD0A 3TDZC 3FK6A 3PL8A 2CV2A 3H92A 3GO5A 2WAFA 1X1CA 2W53A 4XLPF 4DW6A 5DS9A 2M7BA 3BQYA 5EEAA 2XHKA 4ZYAA 2XC7A 5GAEJ 2PFVA 2O7TA 1FPQA 2RVCA 5J6XA 2JA6J 2R93J 3M8EA 4P9FA 3JR9A 2HOSA 2VIXA 1BI1A 3DPUA 6PAXA 2Z2SB 5IPAA 3FKIJ 4FQGA 1SFOJ 4UDSA 2BV6A 2QLZA 4M3FA 3MD2A 4EATA 2X51A 2JVGA 1ON2A 2Z5UA 1JKPC 2OA4A 2V1NA 4JX5A 3IRRA 2LH9A 2VQGA 4IHWA 2HFHA 1QPMA 1BA5A 4XLHA 2XSDC 2VQHA 5IT3A 2E7XA 4MEYF 2N8GA 3HDDA 1ZGJA 3W2AA 4QIWN 3DTEA 1G4DA 3S1MJ 3QU6A 3S15J 2QSGX 5L3FA 3ON2A 4EJTA 2L0KA 1HW5A 5FKOA 3HOSA 3DEEA 4RM2A 2OPTA 2X4HA 1O7FA 5JI6A 3VUQA 4HX4A 3VYSB 1ETKA 1UI6A 3A02A 5FFXA 4HRIA 2CG4A 1QZEA 2L4MA 5KVRA 3E6DA 5L3EA 3NRVA 4AIHA 5GTIC 5EDNA 1A04A 3PQKA 1Y8QB 1G3SA 3K2ZA 2OF7A 4CCKA 2CUFA 4F7ZA 1FBQA 2UXPA 4L5EA 3TQNA 3GFMA 2R7XA 3DKYA 3IKVA 2JPCA 3FXQA 3DKWA 5KCMA 1QVTA 2DT5A 3I0TA 2ZMEC 4V2FA 1BR4A 2CW8A 3QPSA 2WAQN 4A6EA 1FX7A 1BOBA 2VT3A 1TWHJ 3BG3A 2XF7A 2MA3A 1X4OA 5CLSA 1D0ZA 3BCAA 1RR8C 3BDDA 1B72B 4I6ZA 2GM4A 1E17A 1ZR2A 5J40A 4IRHA 1IN5A 2UXHA 1I39A 2LY1A 3C1DA 2ETHA 2XGXA 3GZ6A 3FISA 4HF2A 2XASA 3H3VK 4U9NA 3K4NA 4BDZA 2QOPA 2EIKH 3H9QA 4FE7A 3ZRGA 2QQ9A 1T2KA 5ED4A 1JJ6C 1IRXA 2X0LA 4AU7A 1MNMC 1QGPA 2AS5F 1USSA 4HNTA 2D6YA 2ZOYA 1SAXA 1SAUA 1TBXA 1WZ2A 1APLC 1Z77A 1GDTA 4CZCA 4IRVA 1VZ0A 3CESA 4LK0F 1O7LA 4MFDA 1PP7U 2FRHA 2G7HA 5CW8A 1WJBA 3SZGA 3OYAA 2LKXA 2GA2A 2O0YA 3HRSA 2JWTA 4HBLA 2EFOA 1JGSA 1WJEA 3HJEA 3BJBA 2CU7A 3HOWJ 1TLHB 2DK5A 2ZJQF 5FKMA 1GT0C 2E2IJ 2OZ6A 5K5RA 5FRMA 3CWRA 1ZELA 2JK3A 3H1CA 3HYIA 3KP5A 4RGRA 4YFKF 4FCYA 1IDZA 1XSDA 3E1SA 2HU9A 1KZHA 4B3XA 1LPQA 5FHPA 1ZHFA 2HWVA 2QKLB 2LOOA 4A3IJ 2P5KA 2COBA 1R1UA 3PASA 4C2UA 1MGTA 2L9NA 4L9NA 3ZMDA 2XKPA 1ZTRA 2AXLA 5FKLA 2LY9A 1FP2A 1MH3A 3CUOA 1X2NA 2FNPA 2W24A 4A2UA 4BQOA 2LREA 3KP6A 4FISA 3SJMA 3H3ZA 4I7HA 1S7AA 5DV5A 1Z7LA 3JSOA 4LLNA 2B1EA 2DYSH 1MJAA 3COAC 1A31A 2KRCA 5HDGA 1QZYA 2RQQA 1WJCA 4ENMA 1FBSA 3ECHA 3OYLA 5IT9Z 1P4AA 1AHDP 3G1OA 1F4KA 2VQCA 3WU1B 2ZJPF 1SFEA 1QHHD 2FQ4A 2HOTA 2DU9A 2L7ZA 5TJJA 3WTWC 2LVSA 1Y8RB 4PJJA 3CLOA 5FROA 1T98A 1V5FA 3GZNB 2F5EA 3OL4A 4GFLA 3FMQA 3IH3A 1MDMB 1WH7A 3OYCA 4KN7X 3TGNA 1OYIA 3JRHA 4LGWA 4CCOA 2HR3A 1Q1VA 1MDMA 2QKOA 4UUVA 1OYYA
chains in the Genus database with same CATH topology
2YVEA 1JTYA 3BTIA 3C2BA 4J19A 1AKHA 1JUPA 3T6NA 2WB1N 1PUFB 1QVUA 1MBJA 1H8AC 3BNIA 3PPBA 2CJJA 1QPIA 3S1NJ 2DJNA 3LSJA 3GTMJ 3GTGJ 2ECBA 4A93J 3ON4A 2XPVA 3OIOA 1Y1VJ 3G7RA 3GTOJ 2IBDA 4NDLA 3MNLA 2DN0A 3BG9A 3ZQIA 4AC0A 5JLWA 5CXGA 2NS8A 5E3NA 5C4XJ 4BKXA 4A3FJ 3SDGA 2QCOA 2ZCNA 5M5WJ 4HKUA 3BR6A 3SFIA 2M34A 3GTJJ 1MSFC 3NNRA 5IP9J 4X6AJ 1MBHA 3IV5A 4A3GJ 3NAUA 3G56A 5JLXA 4XRMA 2QF7A 2WUIA 2H1KA 2H8RA 1TWFJ 2G7GA 1MBGA 2R5ZA 2ZB9A 1XG1A 3TP3A 5HAWA 4XICA 2JA5J 4CYCB 5C44J 3GBGA 3K7AJ 1B8IA 3KKCA 2UXIA 2PBXA 2G7LA 2ELKA 2ZCXA 1JT6A 4A3EJ 1IG7A 4JKZA 5HBUA 4NELA 4DYQA 3JRCA 3F1BA 1T33A 2EZLA 4BBSJ 1POGA 1WCMJ 3NI7A 5IP6A 1GVDA 1OJLA 3Q0UA 5IOZA 5DAJA 1IUFA 4IEJA 4XRSG 3KNWA 3RH2A 2LFBA 2DA1A 3LHQA 4GFKA 3ZOBA 3CQZJ 2AO9A 3LSPA 5F08A 3JSJA 3VW2A 2M2EA 2QTQA 4FTHA 2DA7A 1NTCA 4ABZA 2B63J 2YVHA 2VKEA 1BW5A 5M3MJ 1I6HJ 4ME9A 4DYCA 4D5FA 5K7FA 1XS9A 2RASA 1WGXA 2Y2ZA 5FJ8J 2OI8A 5EG0A 3RD3A 2DMTA 4C3JJ 2EQRA 4A3DJ 2DA5A 1IC8A 3VIBA 5CXIA 3DPJA 1ETWA 5BNGA 2AHQA 2HXIA 4A3CJ 3KKDA 5C4YA 4Y7NJ 1ETYA 1I3QJ 1UG2A 5EFYA 1FJLA 2K9QA 2FX0A 4QTRA 1FIPA 1I50J 1IDYA 1Z0XA 3ZQGA 2HI3A 3VVZA 4MIMA 1EF4A 2F07A 1GUUA 5E3MA 1O4XA 3VW0A 1HF0A 1W0TA 3LNQA 5IYBJ 5M3FJ 2CQQA 2M9HA 1GV5A 3HTAA 2JJ7A 3HGYA 1AU7A 3AQTA 1RESA 1JJ8C 1JKOC 4XK4A 4UUTA 2TRTA 1T56A 3QKXA 2M8GX 3LSRA 1UI5A 2Y0SN 2UXOA 3F0CA 1K61A 4ICHA 1WI3A 2VI6A 3B6AA 3OOUA 3HOVJ 2ID6A 2W48A 5EG0B 4BY7J 2OERA 3O60A 4EEFG 2V57A 3FRQA 3B6CA 3M4OJ 2WGBA 4C2MJ 1BJZA 1HOMA 1ZK8A 3ANGA 3BCGA 4XRSA 2X48A 4M3DA 3UKGA 3VVYA 3ZQCA 4BBRJ 1TC3C 3GZIA 4C3HJ 2XPUA 3IUVA 3E7QA 2JN6A 3LJLA 2XGEA 3HBLA 3HOXJ 1S7EA 2K9SA 3HE0A 2HQ5A 4RDUA 2HYTA 2LTPA 5F0HA 1ENHA 3HB9A 5GPCA 2REKA 1OFCX 4AYBN 1H89C 5D1RA 5F0CA 4Y52J 3NPIA 4B4CA 4JNNA 3CRJA 2LP0A 4M3BA 1F36A 2DMPA 1H88C 2E2HJ 2GBYA 3LSGA 2YUSA 1NK3P 3RZDJ 3W6VA 3BHQA 1MSEC 3JRDA 5FLVA 2JMWA 3NARA 4PXIA 2WV1A 1HDPA 4A3MJ 2IAIA 1HDDC 2Q24A 3ANPA 3JRAA 2P81A 3D1NI 3Q0VA 3CJDA 4A3KJ 1BW6A 4JP0A 2DMNA 2DMUA 3RQIA 3S14J 3HTIA 2O8KA 1B8IB 1JKQC 1ETOA 3BR5A 2ME0A 4B1RA 3BT9A 4UUSA 3S16J 2K9NA 1ZQ3P 2TCTA 3BQZA 3TW6A 1IV6A 3EGQA 1QRYA 3OSFA 2L7FP 1U78A 2EZKA 5K7HA 3MVPA 3IH2A 2I10A 2HKUA 4BY1J 2LD5A 1RKTA 5HODA 2DA3A 3E7LA 2E1OA 3S1RJ 1HLVA 3OSGA 4A3LJ 3AQSA 2EZIA 3GTQJ 4D5CA 1DU0A 2DG7A 2NP5A 5FGLA 4DZPA 1WH5A 2FJ1A 4CYCA 4A3JJ 3HKZN 5K7ZA 2KT0A 2R5YB 3ZQFA 2XB0X 1JTXA 1AKHB 2XDNA 1FIAA 4JX6A 3BR1A 3HM5A 3WHBA 3B81A 5FMPA 5GP9A 2FBQA 2M0CA 4QSHA 2PMZN 2YS9A 3GTPJ 1IGNA 4KWAA 4MXMA 3K2AA 5F1JA 3VOKA 1X2MA 1ETVA 2HDDA 2UXUA 5D18A 5K58A 5HSZA 3I4NJ 2XGDA 4HNVA 3M3YJ 1ZKGA 3QPLA 4AUXA 1U8BA 2FD5A 4ACIA 1JUMA 3S2DJ 1A6IA 2D5VA 4M3GA 4B3AA 2E19A 3VP5A 5GPAA 3Q0WA 1CQTA 1X58A 4S0HB 4GCKA 4AC6A 4MFEA 1IJWC 3FK6A 2DTZA 2MGQA 2HXOA 3BTLA 3TP0A 4W97A 1HCRA 2W53A 1P7JA 4DW6A 5DS9A 2G3BA 3BQYA 4DYRA 5EEAA 3CCYA 1LFUP 1ETQA 2O7OA 3HGGA 2O7TA 2JA6J 2R93J 3QBMA 3JR9A 2L9RA 2HOSA 5IOYA 3RKQA 2K40A 5EF6A 4D7NA 2NVQJ 4MO7A 1MBEA 4LOCA 5IPAA 3FKIJ 1SFOJ 1BL0A 2GUHA 4UDSA 4JL3A 2ZCMA 4M6VA 4M3FA 3DEWA 3PM1A 1FTZA 3NRGA 4JX4A 5IYDJ 2VPRA 1OCPA 1ETXA 1JKPC 5DTDA 3S1QJ 4JX5A 3HEFA 4IHWA 3VW1A 1BA5A 2GFNA 2DA6A 2XSDC 1Y1WJ 3O8HA 3TW7A 2X9DA 2N8GA 1K83J 3HDDA 3S1MJ 4QIWN 2QIBA 3WHCA 3S15J 2ECCA 3ON2A 1F43A 5J1YA 3BR2A 2L0KA 2Y31A 5FKOA 1E3OC 1P7IA 2OPTA 5EZHA 1TWGJ 1LFBA 1XC5A 4A69C 4GCLA 3JRBA 3VUQA 2R5ZB 3JRGA 1ETKA 2MG4A 1UI6A 3A02A 1MBKA 1RETA 2MW8A 2XRLA 5J1RA 5AQCA 2NVYJ 1TWCJ 1LE8A 1VFCA 4RBOA 5EDNA 4GFBA 2G0EA 3PO3J 2MSYA 4XIDA 2JA7J 3LWJA 2CUEA 3BTJA 1WPKA 5E3LA 4C3IJ 2OF7A 2X6OA 2CUFA 2Y30A 3QQAA 3A01A 2UXPA 2NOGA 1GV2A 4L5EA 5EZGA 5FLMJ 3I4MJ 4BXXJ 2E2JJ 2IEKA 5J3LA 2Y9YA 3GTLJ 1QVTA 2YU9J 4V2FA 3QPSA 2WAQN 5EGOA 2ID3A 3CMYA 3VVXA 4V2GA 1TWHJ 3HTHA 1VF9A 3BG3A 1RKWA 1RR7A 3LOCA 1B72B 4I6ZA 3EUPA 2DG8A 2GM4A 1ZR2A 2XGCA 2HYJA 1PUFA 2UXHA 2EZHA 1UHSA 3HOYJ 1JT0A 4A3BJ 1A5JA 1SANA 3FISA 2O9LA 3COLA 3H3VK 3G1LA 5FKNA 5J1UA 2QOPA 1YRNA 5EYRA 4FE7A 3DCFA 5IP7J 1MBFA 3A03A 4FE4A 2HOAA 1JJ6C 3JRFA 5F0FA 3VOXA 1MNMC 4DZJA 3BRUA 2L7MP 2G7SA 2LLKA 2D6YA 2ZOYA 4YZEA 1DU6A 3BG5A 3C07A 5E3OA 4IHXA 1R9TJ 1Z77A 5F27A 1APLC 1GDTA 1IRZA 9ANTA 2ME6A 2NVXJ 1W0UA 3NXCA 2R7ZJ 4MFDA 1U9NA 2EH3A 5F04A 2EBIA 5CW8A 2NS7A 4X1EA 2LK2A 3L1PA 2LKXA 2VKVA 3FIWA 5IYCJ 3A01B 2JWTA 3KZ9A 4D7MA 1ZGWA 5C4JJ 1NK2P 1MH4A 4W1UA 3V6GA 3BJBA 1FEXA 3RZOJ 2CU7A 3BTCA 3HOWJ 5FKMA 1GT0C 2E2IJ 2GLOA 3CWRA 1LE8B 2DA4A 3FK7A 2JK3A 1IDZA 4FCYA 1D5YA 2CRGA 2R5YA 3CDLA 2R92J 1ITYA 3Q3SA 1B72A 3PO2J 5FHPA 3S17J 2IU5A 3MKLA 2KDZA 1JKRC 2RAEA 4A3IJ 3HTJA 3P9TA 3VPRA 2COBA 3O8GA 1ZR4A 3PASA 3GEUA 1ZTRA 1G2HA 5FKLA 2LY9A 3ZQHA 5FKKA 3HOZJ 4UUSB 1MH3A 3S5RA 1X2NA 5C3EJ 1VNDA 2NP3A 5D19A 4FISA 5M5XJ 3SJMA 1SGMA 4JYKA 2R0QC 3BR3A 2XB5A 2DMQA 2RHAA 4NN1A 2ZOZA 5H9TA 3MN2A 1U9OA 4L62A 3H0GJ 2NVTJ 3S2HJ 2QWTA 2VUMJ 4IHVA 1RPWA 3BR0A 4MK6A 3HIMA 4IHYA 3IH4A 2Y9ZA 3HOUJ 2JA8J 3GTKJ 1AHDP 3G1OA 1OCTC 1ORKA 2XPWA 2FQ4A 2DA2A 2HOTA 4M3EA 1UMQA 2GENA 4CGRA 2L7ZA 4I76A 2LVSA 3TEDA 3V78A 1JGGA 1TWAJ 1VI0A 3ZQLA 4GFLA 3IH3A 2LR8A 4G12A 3JRIA 1WH7A 4MLOA 2CQXA 3JREA 3JRHA 2PZ9A 1JUSA 2NX4A 1YRNB 5M5YJ 4AF5A 4GCTA 1FTTA 1Q1VA 3G1MA 5EGOB 2QKOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YVE A;  1JTY A;  3BTI A;  3C2B A;  4J19 A;  1AKH A;  1JUP A;  3T6N A;  2WB1 N;  1PUF B;  1QVU A;  1MBJ A;  1H8A C;  3BNI A;  3PPB A;  2CJJ A;  1QPI A;  3S1N J;  2DJN A;  3LSJ A;  3GTM J;  3GTG J;  2ECB A;  4A93 J;  3ON4 A;  2XPV A;  3OIO A;  1Y1V J;  3G7R A;  3GTO J;  2IBD A;  4NDL A;  3MNL A;  2DN0 A;  3BG9 A;  3ZQI A;  4AC0 A;  5JLW A;  5CXG A;  2NS8 A;  5E3N A;  5C4X J;  4BKX A;  4A3F J;  3SDG A;  2QCO A;  2ZCN A;  5M5W J;  4HKU A;  3BR6 A;  3SFI A;  2M34 A;  3GTJ J;  1MSF C;  3NNR A;  5IP9 J;  4X6A J;  1MBH A;  3IV5 A;  4A3G J;  3NAU A;  3G56 A;  5JLX A;  4XRM A;  2QF7 A;  2WUI A;  2H1K A;  2H8R A;  1TWF J;  2G7G A;  1MBG A;  2R5Z A;  2ZB9 A;  1XG1 A;  3TP3 A;  5HAW A;  4XIC A;  2JA5 J;  4CYC B;  5C44 J;  3GBG A;  3K7A J;  1B8I A;  3KKC A;  2UXI A;  2PBX A;  2G7L A;  2ELK A;  2ZCX A;  1JT6 A;  4A3E J;  1IG7 A;  4JKZ A;  5HBU A;  4NEL A;  4DYQ A;  3JRC A;  3F1B A;  1T33 A;  2EZL A;  4BBS J;  1POG A;  1WCM J;  3NI7 A;  5IP6 A;  1GVD A;  1OJL A;  3Q0U A;  5IOZ A;  5DAJ A;  1IUF A;  4IEJ A;  4XRS G;  3KNW A;  3RH2 A;  2LFB A;  2DA1 A;  3LHQ A;  4GFK A;  3ZOB A;  3CQZ J;  2AO9 A;  3LSP A;  5F08 A;  3JSJ A;  3VW2 A;  2M2E A;  2QTQ A;  4FTH A;  2DA7 A;  1NTC A;  4ABZ A;  2B63 J;  2YVH A;  2VKE A;  1BW5 A;  5M3M J;  1I6H J;  4ME9 A;  4DYC A;  4D5F A;  5K7F A;  1XS9 A;  2RAS A;  1WGX A;  2Y2Z A;  5FJ8 J;  2OI8 A;  5EG0 A;  3RD3 A;  2DMT A;  4C3J J;  2EQR A;  4A3D J;  2DA5 A;  1IC8 A;  3VIB A;  5CXI A;  3DPJ A;  1ETW A;  5BNG A;  2AHQ A;  2HXI A;  4A3C J;  3KKD A;  5C4Y A;  4Y7N J;  1ETY A;  1I3Q J;  1UG2 A;  5EFY A;  1FJL A;  2K9Q A;  2FX0 A;  4QTR A;  1FIP A;  1I50 J;  1IDY A;  1Z0X A;  3ZQG A;  2HI3 A;  3VVZ A;  4MIM A;  1EF4 A;  2F07 A;  1GUU A;  5E3M A;  1O4X A;  3VW0 A;  1HF0 A;  1W0T A;  3LNQ A;  5IYB J;  5M3F J;  2CQQ A;  2M9H A;  1GV5 A;  3HTA A;  2JJ7 A;  3HGY A;  1AU7 A;  3AQT A;  1RES A;  1JJ8 C;  1JKO C;  4XK4 A;  4UUT A;  2TRT A;  1T56 A;  3QKX A;  2M8G X;  3LSR A;  1UI5 A;  2Y0S N;  2UXO A;  3F0C A;  1K61 A;  4ICH A;  1WI3 A;  2VI6 A;  3B6A A;  3OOU A;  3HOV J;  2ID6 A;  2W48 A;  5EG0 B;  4BY7 J;  2OER A;  3O60 A;  4EEF G;  2V57 A;  3FRQ A;  3B6C A;  3M4O J;  2WGB A;  4C2M J;  1BJZ A;  1HOM A;  1ZK8 A;  3ANG A;  3BCG A;  4XRS A;  2X48 A;  4M3D A;  3UKG A;  3VVY A;  3ZQC A;  4BBR J;  1TC3 C;  3GZI A;  4C3H J;  2XPU A;  3IUV A;  3E7Q A;  2JN6 A;  3LJL A;  2XGE A;  3HBL A;  3HOX J;  1S7E A;  2K9S A;  3HE0 A;  2HQ5 A;  4RDU A;  2HYT A;  2LTP A;  5F0H A;  1ENH A;  3HB9 A;  5GPC A;  2REK A;  1OFC X;  4AYB N;  1H89 C;  5D1R A;  5F0C A;  4Y52 J;  3NPI A;  4B4C A;  4JNN A;  3CRJ A;  2LP0 A;  4M3B A;  1F36 A;  2DMP A;  1H88 C;  2E2H J;  2GBY A;  3LSG A;  2YUS A;  1NK3 P;  3RZD J;  3W6V A;  3BHQ A;  1MSE C;  3JRD A;  5FLV A;  2JMW A;  3NAR A;  4PXI A;  2WV1 A;  1HDP A;  4A3M J;  2IAI A;  1HDD C;  2Q24 A;  3ANP A;  3JRA A;  2P81 A;  3D1N I;  3Q0V A;  3CJD A;  4A3K J;  1BW6 A;  4JP0 A;  2DMN A;  2DMU A;  3RQI A;  3S14 J;  3HTI A;  2O8K A;  1B8I B;  1JKQ C;  1ETO A;  3BR5 A;  2ME0 A;  4B1R A;  3BT9 A;  4UUS A;  3S16 J;  2K9N A;  1ZQ3 P;  2TCT A;  3BQZ A;  3TW6 A;  1IV6 A;  3EGQ A;  1QRY A;  3OSF A;  2L7F P;  1U78 A;  2EZK A;  5K7H A;  3MVP A;  3IH2 A;  2I10 A;  2HKU A;  4BY1 J;  2LD5 A;  1RKT A;  5HOD A;  2DA3 A;  3E7L A;  2E1O A;  3S1R J;  1HLV A;  3OSG A;  4A3L J;  3AQS A;  2EZI A;  3GTQ J;  4D5C A;  1DU0 A;  2DG7 A;  2NP5 A;  5FGL A;  4DZP A;  1WH5 A;  2FJ1 A;  4CYC A;  4A3J J;  3HKZ N;  5K7Z A;  2KT0 A;  2R5Y B;  3ZQF A;  2XB0 X;  1JTX A;  1AKH B;  2XDN A;  1FIA A;  4JX6 A;  3BR1 A;  3HM5 A;  3WHB A;  3B81 A;  5FMP A;  5GP9 A;  2FBQ A;  2M0C A;  4QSH A;  2PMZ N;  2YS9 A;  3GTP J;  1IGN A;  4KWA A;  4MXM A;  3K2A A;  5F1J A;  3VOK A;  1X2M A;  1ETV A;  2HDD A;  2UXU A;  5D18 A;  5K58 A;  5HSZ A;  3I4N J;  2XGD A;  4HNV A;  3M3Y J;  1ZKG A;  3QPL A;  4AUX A;  1U8B A;  2FD5 A;  4ACI A;  1JUM A;  3S2D J;  1A6I A;  2D5V A;  4M3G A;  4B3A A;  2E19 A;  3VP5 A;  5GPA A;  3Q0W A;  1CQT A;  1X58 A;  4S0H B;  4GCK A;  4AC6 A;  4MFE A;  1IJW C;  3FK6 A;  2DTZ A;  2MGQ A;  2HXO A;  3BTL A;  3TP0 A;  4W97 A;  1HCR A;  2W53 A;  1P7J A;  4DW6 A;  5DS9 A;  2G3B A;  3BQY A;  4DYR A;  5EEA A;  3CCY A;  1LFU P;  1ETQ A;  2O7O A;  3HGG A;  2O7T A;  2JA6 J;  2R93 J;  3QBM A;  3JR9 A;  2L9R A;  2HOS A;  5IOY A;  3RKQ A;  2K40 A;  5EF6 A;  4D7N A;  2NVQ J;  4MO7 A;  1MBE A;  4LOC A;  5IPA A;  3FKI J;  1SFO J;  1BL0 A;  2GUH A;  4UDS A;  4JL3 A;  2ZCM A;  4M6V A;  4M3F A;  3DEW A;  3PM1 A;  1FTZ A;  3NRG A;  4JX4 A;  5IYD J;  2VPR A;  1OCP A;  1ETX A;  1JKP C;  5DTD A;  3S1Q J;  4JX5 A;  3HEF A;  4IHW A;  3VW1 A;  1BA5 A;  2GFN A;  2DA6 A;  2XSD C;  1Y1W J;  3O8H A;  3TW7 A;  2X9D A;  2N8G A;  1K83 J;  3HDD A;  3S1M J;  4QIW N;  2QIB A;  3WHC A;  3S15 J;  2ECC A;  3ON2 A;  1F43 A;  5J1Y A;  3BR2 A;  2L0K A;  2Y31 A;  5FKO A;  1E3O C;  1P7I A;  2OPT A;  5EZH A;  1TWG J;  1LFB A;  1XC5 A;  4A69 C;  4GCL A;  3JRB A;  3VUQ A;  2R5Z B;  3JRG A;  1ETK A;  2MG4 A;  1UI6 A;  3A02 A;  1MBK A;  1RET A;  2MW8 A;  2XRL A;  5J1R A;  5AQC A;  2NVY J;  1TWC J;  1LE8 A;  1VFC A;  4RBO A;  5EDN A;  4GFB A;  2G0E A;  3PO3 J;  2MSY A;  4XID A;  2JA7 J;  3LWJ A;  2CUE A;  3BTJ A;  1WPK A;  5E3L A;  4C3I J;  2OF7 A;  2X6O A;  2CUF A;  2Y30 A;  3QQA A;  3A01 A;  2UXP A;  2NOG A;  1GV2 A;  4L5E A;  5EZG A;  5FLM J;  3I4M J;  4BXX J;  2E2J J;  2IEK A;  5J3L A;  2Y9Y A;  3GTL J;  1QVT A;  2YU9 J;  4V2F A;  3QPS A;  2WAQ N;  5EGO A;  2ID3 A;  3CMY A;  3VVX A;  4V2G A;  1TWH J;  3HTH A;  1VF9 A;  3BG3 A;  1RKW A;  1RR7 A;  3LOC A;  1B72 B;  4I6Z A;  3EUP A;  2DG8 A;  2GM4 A;  1ZR2 A;  2XGC A;  2HYJ A;  1PUF A;  2UXH A;  2EZH A;  1UHS A;  3HOY J;  1JT0 A;  4A3B J;  1A5J A;  1SAN A;  3FIS A;  2O9L A;  3COL A;  3H3V K;  3G1L A;  5FKN A;  5J1U A;  2QOP A;  1YRN A;  5EYR A;  4FE7 A;  3DCF A;  5IP7 J;  1MBF A;  3A03 A;  4FE4 A;  2HOA A;  1JJ6 C;  3JRF A;  5F0F A;  3VOX A;  1MNM C;  4DZJ A;  3BRU A;  2L7M P;  2G7S A;  2LLK A;  2D6Y A;  2ZOY A;  4YZE A;  1DU6 A;  3BG5 A;  3C07 A;  5E3O A;  4IHX A;  1R9T J;  1Z77 A;  5F27 A;  1APL C;  1GDT A;  1IRZ A;  9ANT A;  2ME6 A;  2NVX J;  1W0U A;  3NXC A;  2R7Z J;  4MFD A;  1U9N A;  2EH3 A;  5F04 A;  2EBI A;  5CW8 A;  2NS7 A;  4X1E A;  2LK2 A;  3L1P A;  2LKX A;  2VKV A;  3FIW A;  5IYC J;  3A01 B;  2JWT A;  3KZ9 A;  4D7M A;  1ZGW A;  5C4J J;  1NK2 P;  1MH4 A;  4W1U A;  3V6G A;  3BJB A;  1FEX A;  3RZO J;  2CU7 A;  3BTC A;  3HOW J;  5FKM A;  1GT0 C;  2E2I J;  2GLO A;  3CWR A;  1LE8 B;  2DA4 A;  3FK7 A;  2JK3 A;  1IDZ A;  4FCY A;  1D5Y A;  2CRG A;  2R5Y A;  3CDL A;  2R92 J;  1ITY A;  3Q3S A;  1B72 A;  3PO2 J;  5FHP A;  3S17 J;  2IU5 A;  3MKL A;  2KDZ A;  1JKR C;  2RAE A;  4A3I J;  3HTJ A;  3P9T A;  3VPR A;  2COB A;  3O8G A;  1ZR4 A;  3PAS A;  3GEU A;  1ZTR A;  1G2H A;  5FKL A;  2LY9 A;  3ZQH A;  5FKK A;  3HOZ J;  4UUS B;  1MH3 A;  3S5R A;  1X2N A;  5C3E J;  1VND A;  2NP3 A;  5D19 A;  4FIS A;  5M5X J;  3SJM A;  1SGM A;  4JYK A;  2R0Q C;  3BR3 A;  2XB5 A;  2DMQ A;  2RHA A;  4NN1 A;  2ZOZ A;  5H9T A;  3MN2 A;  1U9O A;  4L62 A;  3H0G J;  2NVT J;  3S2H J;  2QWT A;  2VUM J;  4IHV A;  1RPW A;  3BR0 A;  4MK6 A;  3HIM A;  4IHY A;  3IH4 A;  2Y9Z A;  3HOU J;  2JA8 J;  3GTK J;  1AHD P;  3G1O A;  1OCT C;  1ORK A;  2XPW A;  2FQ4 A;  2DA2 A;  2HOT A;  4M3E A;  1UMQ A;  2GEN A;  4CGR A;  2L7Z A;  4I76 A;  2LVS A;  3TED A;  3V78 A;  1JGG A;  1TWA J;  1VI0 A;  3ZQL A;  4GFL A;  3IH3 A;  2LR8 A;  4G12 A;  3JRI A;  1WH7 A;  4MLO A;  2CQX A;  3JRE A;  3JRH A;  2PZ9 A;  1JUS A;  2NX4 A;  1YRN B;  5M5Y J;  4AF5 A;  4GCT A;  1FTT A;  1Q1V A;  3G1M A;  5EGO B;  2QKO A; 
#chains in the Genus database with same CATH topology
 1LUJ B;  3BTI A;  2HPI A;  3C2B A;  3EYY A;  2BBY A;  1PUF B;  5D8K B;  1MBJ A;  3PPB A;  3NWS A;  4CCN A;  4UXN A;  5GAG J;  3GTG J;  4A93 J;  3ON4 A;  1Y0U A;  1T38 A;  2DFE A;  3LSH A;  1Y1V J;  4YFN F;  3DXJ F;  5FGM A;  2IS6 A;  4AC0 A;  1F1Z A;  3OMY A;  1P6R A;  2NS8 A;  1ZRF A;  2RNG A;  2LG4 A;  3L09 A;  5DCF A;  1HST A;  1VQL I;  5C4X J;  4BKX A;  1BOA A;  4A3F J;  2JSC A;  1DPU A;  3M1C A;  4NUB A;  4ON0 A;  3NS4 A;  2I5U A;  3VFZ A;  3HZJ A;  2H8W A;  4OIR F;  1R00 A;  2M34 A;  1BM9 A;  5FD5 A;  1X3Z B;  1YLF A;  4X6A J;  2V9V A;  1FNN A;  3NAU A;  1YE9 A;  1LDD A;  2QF7 A;  4R8H A;  3WTU C;  2WUI A;  2G7G A;  2XRN A;  4U7D A;  2R5Z A;  2ZB9 A;  1XG1 A;  2E60 A;  5TIS C;  2QEN A;  5HNH A;  4KJZ A;  3DLA A;  3HTS B;  2XAQ A;  4JK1 X;  1V54 H;  3GW2 A;  3O3K A;  4LB6 B;  5D4R A;  4QPQ A;  4A3E J;  5CPR B;  2J5O A;  3K1M A;  4JKZ A;  5HBU A;  2ISY A;  4ZDL A;  4BBS J;  3T8T A;  1OQY A;  1D0Y A;  1EA3 A;  3FF5 A;  2PJR A;  3GFJ A;  4BAC A;  3KNW A;  3AG2 H;  2ZXH A;  2LFB A;  3LHQ A;  1S5L C;  3CQZ J;  2AO9 A;  3JSJ A;  1SD5 A;  4PK4 A;  2BYV E;  2P5L C;  3VW2 A;  3GLX A;  5LGT A;  4FTH A;  3FMR A;  2A2F X;  4B8X A;  3BPX A;  3O2P E;  2M87 A;  2RV8 A;  3J7Y J;  2B63 J;  2WAE A;  4YEL A;  2WWY A;  4BH9 A;  4L0Z B;  2DOA A;  3PIO F;  4ME9 A;  2NVU B;  4XKW A;  2RAS A;  1WGX A;  2Y2Z A;  3F8C A;  5FJ8 J;  1L3L A;  2OI8 A;  3GVA A;  5FO5 A;  1IC8 A;  1UB9 A;  2VJ4 A;  1S3J A;  5CXI A;  4EM0 B;  4G94 A;  1R22 A;  3ZMZ A;  1WWX A;  5J8F A;  3HSR A;  2HXI A;  4A6D A;  3KP3 A;  4LD5 A;  3CCE I;  2K02 A;  4E7I A;  1DUX C;  3LSM A;  2R7W A;  3RQ4 A;  2HVS A;  1FJL A;  1L0O C;  1R5I D;  2DK8 A;  1FIP A;  1B59 A;  3ROU A;  4LB5 A;  2ZFU A;  2K85 A;  1XDU A;  3VVZ A;  3WGG A;  2VPL A;  2FF4 A;  2XAJ A;  4II3 A;  1W5T A;  2EFW A;  2VB6 A;  4PSX A;  1O4X A;  2IT0 A;  3AL0 B;  4RB2 C;  1W0T A;  3LNQ A;  5DD4 A;  3ZMT A;  5M3F J;  2M9H A;  3P5J A;  3VYT B;  2KQR A;  2LBF B;  3HTA A;  5LBQ A;  2A05 A;  1JJ8 C;  2K4B A;  3QKX A;  3DFG A;  4C30 A;  2VBZ A;  2TDX A;  1UI5 A;  1OCR H;  2BOL A;  2Y0S N;  1LQ1 A;  1MKM A;  1AWC A;  3HL2 A;  1SMT A;  4ICH A;  4X0G A;  5D6F A;  3LFU A;  5FLX Z;  3HOV J;  4RLF A;  5EG0 B;  3EUA A;  3PSF A;  2OER A;  1I5Z A;  1CGP A;  3RDI A;  4CSW A;  4RB0 A;  3GFL A;  3I56 I;  5CVJ A;  3SFZ A;  3KFW X;  2MAB A;  2P7V B;  2X48 A;  2PX9 A;  3KX2 A;  4M3D A;  3UKG A;  1T0F A;  1YW7 A;  3VVY A;  2VXZ A;  3OL3 A;  2VJI A;  3E7Q A;  2LBF A;  4ZYD A;  3KPH A;  1TT5 B;  3CUQ B;  3TO9 A;  1LKX A;  2PLY A;  2DOD A;  5D5U B;  5LHH A;  2E5Z A;  3U1K A;  1MJ9 A;  3IC7 A;  2AQF A;  2KP6 A;  1N75 A;  2DW4 A;  2REK A;  3CUQ A;  3PNY A;  1WHU A;  1LB2 A;  3ZP5 A;  1U5T C;  4Q48 A;  3EUH C;  4B4C A;  3OS2 A;  4MTD A;  4JNN A;  4PJM A;  4N4N B;  2VKD A;  5HLT A;  3HTU A;  4EJV A;  2V1X A;  2E2H J;  2GBY A;  3LSG A;  3CCJ I;  2XF5 A;  3HRU A;  3JRD A;  3L2C A;  1R1V A;  1ZG5 A;  3JCU C;  4PXI A;  2DT7 B;  4EJW A;  1TZL A;  1YW8 A;  2IAI A;  3HSE A;  3MFK A;  3CJD A;  4LG0 A;  3VB2 A;  2IJL A;  4WCG A;  3P9C A;  2XKO A;  3GUD A;  3RQI A;  1BI3 A;  1Y6I A;  2K27 A;  3EUK L;  2O8K A;  1JKQ C;  3I64 A;  4MEX F;  4GRI A;  3IWZ A;  3BT9 A;  1VQ9 I;  4NC6 A;  3R60 A;  4KT6 A;  1U8R A;  3EGQ A;  3OYB A;  2L7F P;  2Y48 A;  1STZ A;  2EZK A;  5K7H A;  4GYG A;  1ZYR F;  5LRS A;  1LNW A;  5HOD A;  2DA3 A;  2RNJ A;  2E1O A;  2PQ8 A;  3JSP A;  3S1R J;  1HLV A;  4A3L J;  4OIP F;  3AQS A;  2VJJ A;  2DG7 A;  3I55 I;  2J5P A;  5LD2 C;  3VTI A;  2ZJR F;  2FJ1 A;  3K8P C;  2R5Y B;  1OLT A;  2XB0 X;  4UV9 A;  2HKX A;  3Q9S A;  4N9I A;  3E0J B;  1HW1 A;  2M0C A;  1M1E B;  3GTP J;  2PMZ N;  5F1J A;  2ELH A;  3SDB A;  3QYF A;  3BC8 A;  3H3U A;  4I02 A;  2XGD A;  4AWX B;  4HNV A;  1ZRC A;  3M3Y J;  1ZKG A;  3P7N A;  4LIU A;  4AUX A;  3D0S A;  1TQM A;  3AG4 H;  4UB6 C;  4E7S A;  2B0L A;  2L9V A;  3CJQ B;  1D8J A;  2KJC A;  4XQF A;  4M3G A;  3C18 A;  3Q0W A;  2E35 A;  4PCQ A;  4GCK A;  4MFE A;  3K1P A;  2DTZ A;  1XMX A;  4HAM A;  4I01 A;  3ZN1 A;  2HXO A;  4AYB A;  3U9G A;  2VC0 A;  4RAG A;  1SFU A;  1SEU A;  2FBI A;  1XDS A;  1R1T A;  2IXS A;  2O7O A;  3HGG A;  2KMU A;  2OCE A;  4IF4 A;  5ERI A;  3QBM A;  2RC4 A;  4U0V A;  2V9K A;  4HQM A;  2EFN A;  5HS8 A;  2GUH A;  2VQL A;  2R7Q A;  1BL0 A;  2M8E A;  2WY7 Q;  2W57 A;  2CO5 A;  1LEA A;  4M6V A;  2OCC H;  1X1B A;  4AD9 A;  4HF0 A;  2XIG A;  2JZY A;  2W25 A;  2CSO A;  1QNT A;  2FJI 1;  4M6X A;  3NRG A;  2A68 F;  2VPR A;  4Q4Z F;  2Z9O A;  1YTY A;  1OCP A;  1ETX A;  4HG2 A;  3QAH A;  1VQ5 I;  2QQA A;  5DTD A;  3LSI A;  4PFO A;  2V4J C;  1D3Y A;  1OR7 C;  2HTJ A;  5D6E A;  3OYJ A;  3PUF A;  3W6K B;  3TW7 A;  3MQ0 A;  4HDU A;  1WKM A;  2MH2 A;  1K83 J;  3ZQ7 A;  3ABU A;  1IN4 A;  3WHC A;  2HQN A;  2P6S A;  3DF8 A;  1X3U A;  5J1Y A;  1F43 A;  2Y31 A;  4ANJ A;  1E3O C;  3KZY A;  1QQI A;  1VQN I;  1LFB A;  1X1A A;  4A69 C;  3HKZ A;  1J09 A;  3JRB A;  2H6C A;  2KHM A;  2HNH A;  1V5E A;  2H27 A;  1OIS A;  2XRL A;  2HYF A;  4LIT A;  3K4L A;  4L9T A;  4IQJ A;  5LGU A;  5JHU A;  1VFC A;  4RBO A;  2IS4 A;  2G0E A;  3FM5 A;  4PJN A;  4XID A;  4XKV A;  2JA7 J;  2CUE A;  2DLL A;  2KIQ A;  3ONQ A;  1XPX A;  2XSJ C;  2Y30 A;  1FSE A;  2NOG A;  2K3F A;  3LAP A;  5DM7 F;  1KQ9 A;  2ESH A;  3ZPL A;  2A6H F;  3FXK A;  2W7N A;  3L2Q A;  3BG7 A;  4HLX A;  2RN7 A;  4M6Y A;  4DOZ A;  4PUS A;  3VDX A;  3WGH A;  1KYZ A;  2BY2 A;  3CUQ C;  2O3F A;  3LWF A;  3BWG A;  1TW2 A;  3CMY A;  3JAM Z;  1BIA A;  1VF9 A;  3BY6 A;  1DGR M;  1RKW A;  2CW7 A;  4CH7 A;  4E70 A;  4UHT A;  4BHP A;  4KNY A;  2WC2 A;  2Z99 A;  3FBN B;  2DG8 A;  3EUP A;  4Y4R A;  2HYJ A;  1GXP A;  3GX4 X;  1QZZ A;  3VWB A;  2Q1Z B;  2EZH A;  3LMM A;  4C9Y A;  3HOY J;  2AXT C;  1SAN A;  2O9L A;  1R58 A;  5HS7 A;  3BJO A;  5FKN A;  4RGS A;  4U7B A;  4OMZ A;  2EV0 A;  5LRR A;  4XM3 A;  1ZH5 A;  5LGN A;  2MH9 A;  3IAS 2;  3CD6 I;  1YYV A;  4FE4 A;  2OC6 A;  1P4X A;  3JRF A;  5F0F A;  2KJB A;  2XAG A;  1ZGA A;  3I71 A;  2L7M P;  2G7S A;  2LLK A;  3ERM A;  5KHD A;  1DU6 A;  3BG5 A;  5E3O A;  1AOY A;  2M4G A;  5FD6 A;  2O6G E;  4KDP A;  2L7K A;  3IWF A;  2P8T A;  4ESF A;  2HYG D;  4KIB A;  1TT0 A;  5CVU A;  5D5W B;  1XMK A;  4ITV A;  4CCM A;  5ICC A;  2NVX J;  3NXC A;  2D1V A;  1K78 B;  3QU3 A;  4TV7 A;  3H35 A;  2W85 A;  1OKR A;  3H5N A;  2E1N A;  2LK2 A;  3E97 A;  1UZC A;  5IYC J;  3L1P A;  3CCU I;  1S9H A;  4QPO A;  4DGW B;  4WK8 F;  4CGZ A;  3RI4 A;  3T0Y A;  1NK2 P;  2ACJ A;  1ODD A;  4W1U A;  4ZYG A;  2JQ7 A;  3TO7 A;  1FWZ A;  1IUY A;  5GAD J;  4DVY P;  2GLO A;  4HV6 A;  1XX5 A;  3KE2 A;  3F72 A;  2DA4 A;  4B48 A;  3KLO A;  1LVA A;  2R92 J;  2E1M B;  2L02 A;  2MC3 A;  3PQJ A;  4DQ2 A;  3PO2 J;  2PEX A;  5K5O A;  3S17 J;  3MKL A;  1X1D A;  3K10 A;  2RAE A;  3EDP A;  4WXD A;  3HTJ A;  2Q2E B;  4G6Q A;  3VPR A;  5LLQ A;  2QQ8 A;  2G7U A;  1T8I A;  3H36 A;  3P9K A;  4XN3 A;  3OYN A;  1MW7 A;  1W5S A;  3GEU A;  1NH3 A;  3WU0 A;  4EVI A;  2DOE A;  3FKJ A;  3TO6 A;  3PFI A;  4ZYH A;  4WXC A;  3ZGK A;  3HOZ J;  1E0E A;  1QHG A;  3DTK A;  4YRV A;  4F91 B;  2E7W A;  1VND A;  5C3E J;  2Z33 A;  4E7K A;  5D19 A;  3ECO A;  3IL2 A;  2XB5 A;  3KYD B;  4OWR B;  1F5T A;  2KKO A;  4I99 C;  3FWE A;  4MHG A;  2NVT J;  3HIM A;  2FOK A;  1YQA A;  3LA2 A;  3AG3 H;  4KMF A;  3WTS C;  3DTI A;  1X1P A;  1MZB A;  2DA2 A;  3ESW B;  2FML A;  2GEN A;  1YOV B;  3ABL H;  5BS6 A;  3TED A;  4AM3 A;  2ICW G;  3V78 A;  4GYI A;  1JGG A;  1TWA J;  1VI0 A;  4GO1 A;  1J75 A;  1TQI A;  5DDG A;  4MLO A;  4XR6 A;  2NAZ A;  2CQX A;  4KT5 C;  2PZ9 A;  1JUS A;  4XLC A;  2X85 A;  2D45 A;  4AF5 A;  4HOB A;  1FTT A;  3CTA A;  3G1M A;  5EGO B;  2KIS A;  1VTN C;  2K7L A;  3CMA I;  4QWQ A;  2HS5 A;  4P96 A;  4J19 A;  1AKH A;  4XN0 A;  2XUB A;  4F3Q A;  1BI0 A;  1V55 H;  2WB1 N;  2CJJ A;  3S1N J;  3LSJ A;  3GTM J;  4RB3 C;  3OIO A;  1K4S A;  4NC7 A;  3G7R A;  2IBD A;  2DDB A;  2YX4 A;  4NDL A;  5JLW A;  4XBF A;  4PGG A;  4XKB A;  2KPM A;  1PVE A;  1PUE E;  3ISP A;  2ZCN A;  5M5W J;  2M45 A;  1QA6 A;  4IVN A;  3RCO A;  2RKH A;  1WFX A;  4CCJ A;  3MCZ A;  2NS0 A;  1HSJ A;  2CV1 A;  1MBH A;  4UV8 A;  2L9S A;  2EA2 A;  2XAH A;  3FXJ A;  3KYC B;  2ZNY A;  5JLX A;  5LHI A;  2IA2 A;  1TWF J;  1OPC A;  4CYD A;  2OV7 A;  4UVB A;  1WRJ A;  2Y0S A;  3GBG A;  1FBU A;  3ZXS A;  3TL4 X;  2ZSH B;  4LFU A;  2FUG 2;  2XAF A;  3J7Z I;  1JT6 A;  4E7Z A;  3K69 A;  3SZP A;  2E5N A;  3LA3 A;  4DYQ A;  3JRC A;  2M30 A;  1WJD A;  3F1B A;  4B09 A;  2V6E A;  3F8M A;  3U21 A;  3QYE A;  1GVD A;  3Q0U A;  2L54 A;  5IOZ A;  4EQQ A;  3V7C A;  1XGM A;  5L3G A;  2BEO A;  2ZCW A;  4XOR A;  2DA1 A;  1OR7 A;  2K5C A;  3E3V A;  4I09 A;  3ZOB A;  1U0J A;  2Y75 A;  3G73 A;  2RDP A;  4P5O A;  4FX4 A;  2M2E A;  4D1Q A;  1YX5 A;  1UCR A;  1Z1D A;  3G4S I;  1DGW Y;  3SXY A;  2DA7 A;  5IT9 K;  1YJN I;  3Q5F A;  2YVH A;  1BW5 A;  2A3S A;  2HOE A;  3DBL B;  3OR2 C;  5F64 A;  4Z2Y A;  4A5M A;  4CCL A;  4DYC A;  3UNG C;  3R0J A;  3RKW A;  5K7F A;  2CS3 A;  1XS9 A;  3WTX C;  3OY9 A;  4HQE A;  4CO8 A;  4NNJ A;  1SVL A;  5ICF A;  1ZG3 A;  2LC2 A;  1D1A A;  1WJA A;  4A3D J;  2V79 A;  1BC8 C;  2ZSI B;  4RAZ A;  1XMA A;  1W4M A;  3MZY A;  4F52 A;  1MMS A;  5CVI A;  4ZDO A;  1FMW A;  4BHC A;  5BNG A;  1EH6 A;  2MC4 A;  4RMN A;  4I0B A;  3PFY A;  5C4Y A;  1Z21 A;  1I3Q J;  5E1X A;  3D5L A;  1TP4 A;  1IV8 A;  1W7P A;  2FX0 A;  5BPI A;  4QTR A;  2M5W A;  4CXF A;  4H0E A;  2X1D A;  1FP1 D;  1V5G A;  2LMD A;  2K3P A;  4NBQ A;  3WU2 C;  2XRO A;  1IDY A;  3ZQG A;  4EM2 A;  2HZT A;  3GFI A;  2HI3 A;  2X1C A;  5L3D A;  2F5C A;  3BP8 A;  1Z6R A;  4MIM A;  5E8G A;  3OIP A;  3VOD A;  4AVP A;  2CQQ A;  2ZBK A;  4MQV A;  1SD7 A;  1HKQ A;  2CW0 F;  3IUO A;  2QEX I;  2NNY A;  1BN5 A;  4Y17 A;  2YX7 A;  3K6G A;  1J9I A;  1RES A;  3IHU A;  1I1G A;  1JKO C;  1LEB A;  1D1C A;  1HQC A;  2FE3 A;  5E17 F;  3ABT A;  2C6Y A;  2KRF A;  4IRG A;  2E1C A;  1HXD A;  5BOX A;  3R61 A;  2XVC A;  3CP8 A;  4S05 A;  2VI6 A;  3B6A A;  1ERD A;  1I6X A;  4J01 A;  3GCM A;  3OYM A;  3FRQ A;  2W84 A;  2WGB A;  2ZNZ A;  2Z3Y A;  3QWL A;  2LF8 A;  1FY7 A;  2VBW A;  1TNT A;  3SYT A;  3ZQC A;  1F9N A;  2XPU A;  2IRF G;  1I3A A;  2JN6 A;  3LJL A;  1JHF A;  2XGE A;  4XOT A;  1Z91 A;  3ELK A;  1FYM A;  5EEG A;  3H5R A;  3HE0 A;  3K4M A;  3REO A;  3OYF A;  1CF7 B;  2LTP A;  2W1O A;  3RYR A;  2LF7 A;  2EV5 A;  3HB9 A;  1TW3 A;  2H1L A;  4XNF A;  5GPC A;  4A12 A;  5HOO A;  1H89 C;  2LY2 A;  1IN7 A;  3CZ6 A;  4Y52 J;  2RQP A;  2IPQ X;  2STW A;  2LP0 A;  4M3B A;  2OTL I;  1K78 A;  1NK3 P;  3BHQ A;  3W6V A;  3NAR A;  4ESB A;  3SQN A;  2JRM A;  2Q24 A;  1T6S A;  3D1N I;  4LLL A;  3DWL E;  2QUF A;  1GLN A;  2EJR A;  2R7F A;  2RRE A;  3F3X A;  3S3N A;  2BHZ A;  1B8I B;  3V8K A;  4BJ6 C;  3FX3 A;  3BR5 A;  1KU9 A;  1JHH A;  2ME0 A;  4B1R A;  4IZZ A;  2DBB A;  3BQZ A;  4N0B A;  2DFI A;  1IV6 A;  2YPR A;  1T0F C;  1OYW A;  1OCO H;  3NQO A;  1S6L A;  4RGU A;  3MVP A;  3IH2 A;  2I10 A;  1SMY F;  2QBY A;  5L3C A;  2HKU A;  1VQK I;  1E3P A;  3OS0 A;  3FZV A;  3D5S C;  1DU0 A;  4Y33 A;  3BRO A;  2MD5 A;  4DZP A;  1P2F A;  3VOE A;  3F22 A;  3HKZ N;  2OJE D;  3QOD A;  1I27 A;  1FIA A;  4O3M A;  3BR1 A;  5K5Q A;  3WHB A;  1SD6 A;  3RIR A;  4PDK A;  4ZZL A;  3VOK A;  3F8F A;  3DBR B;  4ENK A;  2R7T A;  4UVC A;  5D18 A;  4A0Y A;  1QBJ A;  3I4N J;  3C2G A;  2QSF X;  3BJA A;  4PSW A;  5B1A H;  3W3C A;  2CFO A;  1B1B A;  1U8B A;  2FD5 A;  2MFZ A;  4ACI A;  1SFK A;  1GXQ A;  3LL7 A;  3BG6 A;  1BJA A;  2ZO4 A;  3A1Y A;  1A6I A;  3PNT A;  5CVV A;  4B3A A;  2E19 A;  3CLQ A;  1XSX A;  1RNL A;  1CQT A;  3VP5 A;  4AC6 A;  4B47 A;  4M72 A;  3WTZ A;  1IJW C;  1HBX G;  3BTL A;  3TP0 A;  1HCR A;  1MMN A;  3T1B A;  4DYR A;  2IGM A;  3CCQ I;  1EH7 A;  1ACI A;  4UVA A;  1N25 A;  1UJ8 A;  1DQU A;  2BY1 A;  2O61 A;  2L9R A;  4CDG A;  2NVQ J;  4D7N A;  3CCR I;  4MO7 A;  1J5Y A;  3L00 A;  3G71 I;  1H0M A;  1MIJ A;  4OIO F;  4JL3 A;  4L5I A;  1VQ6 I;  3I9V 2;  4LJZ F;  3PM1 A;  4XOP A;  1FTZ A;  2VAS A;  4D0P A;  4JX4 A;  2ZXI A;  2D2W A;  1Z9C A;  5IYD J;  2BZT A;  4LLG F;  2W82 A;  1UG0 A;  5KNL A;  2EIN H;  1W5C C;  4KUM A;  1RI7 A;  2BXZ A;  3S1Q J;  4OIN F;  2WY8 Q;  4BQQ A;  3HEF A;  4G7Z F;  2GFN A;  1Y56 A;  2DA6 A;  4Y15 A;  4YIF A;  3O8H A;  2A5W A;  2X9D A;  4M9S A;  4C2T A;  2QIB A;  2FA5 A;  3CME I;  2O03 A;  4A0X A;  2Q2E A;  4BXU A;  3BR2 A;  1MMD A;  5KAI C;  3SEQ A;  1P7I A;  5EZH A;  4MGR A;  2WAD A;  1XC5 A;  4MNU A;  4GCL A;  2VLA A;  5J4V A;  2R5Z B;  1O3T A;  5B3S H;  2MG4 A;  3K9T A;  1EH8 A;  4HX8 A;  2EK5 A;  2MW8 A;  4P55 A;  5J1R A;  1K7A A;  1TWC J;  1BIB A;  3U1D A;  1WQ2 A;  1NG7 A;  2CFX A;  1YG2 A;  3K4J A;  5E79 C;  4GFB A;  3LWJ A;  2MSY A;  2NYX A;  2OQG A;  5E1W A;  2QKM B;  3E5Q A;  1Z67 A;  1WPK A;  1X4P A;  2X6O A;  3S93 A;  4C3I J;  1SC7 A;  2DXI A;  2ZME B;  2BW3 B;  3S8P A;  3QQA A;  4JBA A;  3DU5 A;  1GV2 A;  1X3W B;  3HPH A;  4K2E A;  5EZG A;  5FLM J;  4B43 A;  5B5E C;  2YU3 A;  2PBI A;  4BU2 A;  1SVO A;  4E6K G;  2IEK A;  2KIF A;  5J3L A;  3IP4 B;  4E4H A;  5DM6 F;  3GTL J;  1FSH A;  3WTY C;  3CCV I;  1IAW A;  4BQA A;  1MND A;  5EGO A;  2G9W A;  2MLG A;  2Z1D A;  1IXR C;  1YI2 I;  3PNV A;  2JUG A;  5TRD A;  3LOC A;  4AIJ A;  1UFM A;  2R7S A;  1PUF A;  4MTE A;  3BJ6 A;  5AIQ A;  1A5J A;  3KET A;  3RPU A;  3COL A;  3HPG A;  1XSV A;  3DQV C;  4WIB A;  1YRN A;  1I1S A;  5EYR A;  5IP7 J;  3DCF A;  2QGU A;  1OMI A;  3A03 A;  2IW5 A;  2DO7 A;  2H6B A;  4GGG A;  3ML6 A;  4E7L A;  3FM3 A;  4DZJ A;  3BRU A;  1R36 A;  3X2Q H;  1T95 A;  5CJ9 A;  3AG1 H;  3QP6 A;  4IHX A;  1R9T J;  5F27 A;  4A5N A;  2F6C A;  4DJA A;  1S29 A;  2AQE A;  2P4W A;  4M74 A;  4P1W A;  2ME6 A;  3CO7 C;  9ANT A;  1X19 A;  4KA4 A;  2V9P A;  2R7Z J;  2FNA A;  2LYC A;  4KIG A;  1U9N A;  2EH3 A;  5F04 A;  2EBI A;  2DDA A;  1B6A A;  5FFZ A;  4X1E A;  1AA7 A;  2PN6 A;  4YFX F;  1Z3Y A;  3FIW A;  2JPB A;  3A01 B;  1FC3 A;  3GME A;  2F5D A;  3B02 A;  1EV7 A;  1YO5 C;  4HPQ A;  2EA4 A;  4D7M A;  4IKF A;  5C4J J;  1MH4 A;  1H9G A;  3E6C C;  3RZO J;  3BTC A;  1LE8 B;  1DP3 A;  1D1B A;  2V7F A;  3RSN A;  4IL6 C;  1D5Y A;  5L3B A;  1IN6 A;  3CDL A;  3MKY B;  3Q3S A;  2R5Y A;  1XTA A;  2Z16 A;  4BE2 A;  2IU5 A;  4A0Z A;  2F4I A;  3ZQQ A;  5ILV A;  3HXL A;  3ZCO A;  2PMZ A;  3O8G A;  4OOI A;  4WWC A;  1P92 A;  1G2H A;  2VOD A;  2Q0O A;  3OYI A;  2YSR A;  3CC7 I;  2IS1 A;  3MAJ A;  4NQW B;  3S5R A;  5BPD A;  2NP3 A;  1SGM A;  4JYK A;  2DOF A;  4OAZ A;  5EEH A;  5CKT A;  2DMQ A;  1KGS A;  4BL0 B;  1YJW I;  1EJ9 A;  2ZOZ A;  4NN1 A;  5H9T A;  2GZW A;  3DU6 A;  5F6F A;  3CC4 I;  1G59 A;  3H0G J;  5JFR A;  2DI3 A;  3S2H J;  1RUO A;  1PJR A;  2HTS A;  5EJC A;  2VUM J;  2JT1 A;  4IHV A;  1RPW A;  2Y69 H;  4MK6 A;  1JE8 A;  2Y9Z A;  1RRJ A;  3HOU J;  2JA8 J;  5H6R A;  5J8C A;  3L2R A;  1OCT C;  4HV5 A;  2BY0 A;  2XPW A;  1ORK A;  4HYE A;  1NG6 A;  5D5V B;  5DEQ A;  3LAJ A;  4M3E A;  4BQN A;  4QLC U;  3NEU A;  4CGR A;  2X6Y A;  4XON A;  5DCM B;  1S8N A;  1WJ5 A;  4BGD A;  2OU2 A;  2LR8 A;  2GOX B;  4G12 A;  1IXS B;  1E2X A;  3LA7 A;  4N9H A;  3JRI A;  5B1B H;  3JRE A;  2NX4 A;  1YRN B;  1SD4 A;  4JQF A;  3QYB A;  2E1M C;  1GVJ A;  1U6G A;  3MMY B;  1DP7 P;  3OWT A;  2VBX A;  1XCV A;  2M7A A;  1H8A C;  3BNI A;  2QQB A;  5HVQ C;  2HVQ A;  4HSR A;  2DJN A;  1TTY A;  4ZTJ A;  2KLO A;  2JVH A;  1VQ7 I;  2JA2 A;  2ECB A;  2WTE A;  3BZ6 A;  2V1D A;  3V42 A;  2XPV A;  5JVG F;  4O6J A;  2UUZ A;  2KZV A;  3GF2 A;  2DN0 A;  2ZY9 A;  4BUP A;  5E3N A;  2VE8 A;  3KLN A;  3JTH A;  2VOP A;  3CP2 A;  5FRN A;  3SDG A;  4IRI A;  3J81 Z;  2H09 A;  1SVM A;  3BR6 A;  2ZME A;  4M73 A;  1FZP B;  3IV5 A;  3G56 A;  1IF1 A;  5ILS A;  4BDY A;  4D9J A;  1UHM A;  1IO2 A;  5HNF A;  2H1K A;  1BBY A;  4BAY A;  1MBG A;  3LQR A;  4XLE A;  5HAW A;  4XIC A;  3TKY A;  4CYC B;  3I59 B;  3CF2 A;  4RS8 A;  2EV6 A;  1V3F A;  1IRG A;  3K7A J;  3H9G A;  2BHY A;  2D1H A;  1KU3 A;  2UXI A;  2PBX A;  1IG7 A;  3PIP F;  2DAO A;  4NEL A;  1ZG1 A;  1IN8 A;  1R4N B;  1OCC H;  1T33 A;  1ZLK A;  3L2V A;  2EZL A;  1J0R A;  1POG A;  3M1E A;  1WCM J;  3C7J A;  5IP6 A;  1OJL A;  3TMO A;  5DAJ A;  3GLL A;  1IUF A;  4F93 B;  4GXO A;  4UY8 I;  3V7S A;  2IVM A;  2KZG A;  1WVR A;  4GFK A;  2WA0 A;  4FAS D;  4F92 B;  1D0X A;  2P6T A;  2PFB A;  3KEY A;  1W7P B;  1VQP I;  5F08 A;  3RTR A;  2GIZ A;  2QTQ A;  3HHH A;  3LST A;  1NHA A;  2R7R A;  4OAY A;  4ABZ A;  4KMU X;  2VKE A;  3VEP A;  5M3M J;  1I6H J;  2KIU A;  4D5F A;  1KYW A;  3S3O A;  1G3W A;  3L2W A;  2EQR A;  2DA5 A;  1R49 A;  1G6N A;  4KFC A;  1Y39 A;  1KQ0 A;  3V8L A;  4AVZ A;  2XAU A;  3ZMV A;  4O5V A;  2AHQ A;  2M0M A;  2DQR A;  4Y7N J;  5A2Q K;  1UG2 A;  4IPA A;  3OOP A;  4IHS A;  5EFY A;  2K9Q A;  1JI8 A;  2ZXJ A;  1I50 J;  3PUB A;  1W1W E;  1LDK B;  3V4G A;  3I58 A;  2QA4 I;  1O3Q A;  1EF4 A;  3DP7 A;  3OYE A;  3FXL A;  1RIO H;  1Z6T A;  4IOA F;  2PMU A;  2JJ7 A;  2UXN A;  3RJP A;  4ZTF A;  3HGY A;  4II2 A;  4IO9 F;  2EIL H;  2ZXW H;  1TQP A;  4XK4 A;  2LDU A;  3M8J A;  3KZZ A;  1CF7 A;  1T56 A;  3E5X A;  1BR1 A;  3LSR A;  3ULQ B;  2XF6 A;  1ULY A;  2FBK A;  2UXO A;  2VN2 A;  3F0C A;  2EIJ H;  2HDC A;  3OOU A;  2ID6 A;  2W48 A;  1A35 A;  2K4J A;  5B66 C;  4EEF G;  1KA8 A;  3G6E I;  4L5J A;  3B6C A;  4FHT A;  5E18 F;  3M4O J;  4C2M J;  1BJZ A;  2BW3 A;  1ZK8 A;  2CUJ A;  4IXA A;  1HKS A;  2JUC A;  3OV8 A;  3Q9V A;  3RPU D;  3T8R A;  2VBY A;  3I53 A;  5DUK A;  4XRS A;  1LDJ A;  2OBP A;  4BBR J;  3CF5 F;  1TC3 C;  1KU7 A;  4C3H J;  3IUV A;  3K1N A;  2PG4 A;  3OIQ A;  3E6B A;  3TOB A;  3HOX J;  1S7E A;  1BI2 A;  2PMH A;  2XDV A;  2HQ5 A;  4RDU A;  2HYT A;  1ENH A;  5D4S A;  5FB2 A;  4RLQ A;  1OFC X;  1WJF A;  2OZU A;  1LVK A;  3OR1 C;  5D5X B;  3BZC A;  5F0C A;  3NPI A;  4RB1 A;  4EGZ A;  3CRJ A;  1VQ8 I;  1F36 A;  1ZAO A;  2DMP A;  1H88 C;  3BLY A;  4CIC A;  2YUS A;  4LIV A;  2BY3 A;  2DQL A;  3HSF A;  1MSE C;  1J59 A;  5FLV A;  3RPQ A;  4BEH B;  3F23 A;  3WE3 A;  1HDP A;  1ONV A;  1HDD C;  3ANP A;  4ZJZ A;  2P81 A;  3JRA A;  3Q0V A;  2DFF A;  1A36 A;  4HZF A;  1MMA A;  3HIF A;  1BW6 A;  2X1E A;  1WSU A;  2A5Y B;  1P4W A;  3L2U A;  3SZT A;  4DBQ A;  3FHN A;  3CCS I;  3B73 A;  3FBI B;  4KYW A;  1ZQ3 P;  2TCT A;  4DNC A;  4L9J A;  1YFH A;  5J47 A;  3MKW B;  2O8X A;  1QRY A;  5GTH C;  1QO0 D;  1U78 A;  4UNO A;  3SEZ A;  1R4M B;  4GDF A;  1RKT A;  3IKT A;  3VYU B;  1Z7U A;  5H20 A;  3E7L A;  3OS1 A;  4ENN A;  3OSG A;  4D5C A;  3SHF A;  4EJU A;  2NP5 A;  2F5F A;  3HRM A;  1WH5 A;  5FGL A;  4FET A;  1KU2 A;  1XCB A;  2KT0 A;  2UZK A;  2DT6 A;  2W4S A;  3FXU A;  3ZQF A;  1R23 A;  1JTX A;  1AKH B;  3A4C A;  4JX6 A;  3MWM A;  4WF2 A;  3CO6 C;  3B81 A;  2FBQ A;  4FT8 A;  3OYH A;  4I2O A;  1XD7 A;  2YS9 A;  4QSH A;  4KWA A;  1C0W A;  2HQA A;  2HDD A;  3RYP A;  3CJN A;  2LKP A;  2ZC2 A;  5HSZ A;  3BOQ A;  2E71 A;  5HLI A;  1E3H A;  3ABK H;  3QPL A;  3UR3 C;  3CC2 I;  4KIS A;  4I0A A;  1T08 B;  1JUM A;  3S2D J;  4LMY A;  3CCL I;  4RGX A;  5BQT A;  3OYD A;  4S0H B;  3G2B A;  3KP4 A;  5ILU A;  3FDY A;  2MGQ A;  2R7U A;  4G9Y A;  3AKZ A;  3HRT A;  4W97 A;  1REP C;  4M9X A;  1P7J A;  3LSK A;  4RM3 A;  2G3B A;  2HPM A;  4BS9 A;  3CCY A;  4KIT B;  1LFU P;  1ETQ A;  2JTV A;  3U2R A;  3RKX A;  4V19 K;  1RZ4 A;  1ZRD A;  3N05 A;  3OYG A;  2A69 F;  2NRA C;  5IOY A;  1OCZ H;  3RKQ A;  4PZJ A;  2K40 A;  5EF6 A;  1IXC A;  1MBE A;  4LOC A;  3L9F A;  3I4P A;  1U2W A;  1YIO A;  2ZCM A;  4KIC A;  3DEW A;  3GWZ A;  2A61 A;  1XGO A;  3FXO A;  1UHW A;  3CMM A;  3HUG A;  3I3L A;  1XGS A;  3EQL F;  1R6R A;  5K1Y A;  2OUM A;  2X6W A;  3R4K A;  3E5U A;  3VW1 A;  3GYH X;  2R3S A;  3QRF F;  4EGY A;  3OYK A;  3DKX A;  1Y1W J;  3V7R A;  5IY5 H;  4U0Y A;  1ZLJ A;  1HA8 A;  2ECC A;  1EKE A;  2VJ5 A;  2WV0 A;  2PJR B;  2OD5 A;  1P9Q C;  4YEJ A;  1TWG J;  2DCE A;  2KFD A;  3JRG A;  4XRF A;  4HLY A;  2KL4 A;  2ZKZ A;  1MBK A;  1RET A;  3MZH A;  5AQC A;  2IP2 A;  2NVY J;  1LE8 A;  2M1B A;  5HDN A;  5FLX K;  3PO3 J;  2R7O A;  3FMS A;  3WTT C;  1FOY A;  3BTJ A;  3EYI A;  5E3L A;  3MZ8 A;  3KEO A;  2GOM A;  3KEQ A;  5H6Q A;  3A01 A;  2CUZ A;  1YS7 A;  3FHZ A;  5JVT A;  1TL8 A;  3I4M J;  1J2X A;  4BXX J;  2E2J J;  4YIR X;  4IJA A;  2IS2 A;  3K70 D;  4UB8 C;  4N4O B;  3GZ5 A;  2Y9Y A;  3F9K A;  3W2W A;  2YU9 J;  2VXD A;  4HA8 A;  4Y3O A;  2EFP A;  5AIP A;  2ID3 A;  5F1R A;  4V2G A;  1FOK A;  2JRT A;  3VVX A;  1W36 D;  3HTH A;  4BYY A;  1RR7 A;  3S3M A;  3A0B C;  3H9J A;  3V8J A;  1B9N A;  1XN7 A;  1G3Y A;  2XGC A;  4DBR A;  3ABM H;  5BMZ A;  4BE0 A;  1UHS A;  1JT0 A;  3EPZ A;  4A3B J;  1O3R A;  3DBH B;  2M4K A;  3F8B A;  1Z05 A;  3K0L A;  2CYY A;  2HEO A;  3M9A A;  3F6V A;  4WX9 A;  2A07 F;  3G1L A;  5J1U A;  2B7E A;  2RGV A;  2KRH A;  1FT9 A;  3EET A;  4BEH A;  4XL9 A;  2L2O A;  2FU4 A;  1MBF A;  4FX0 A;  2HOA A;  3A0H C;  4ZC3 A;  3VOX A;  1ON1 A;  2GA1 A;  2L5Q A;  1ZN2 A;  4AIK A;  1G3T A;  4YZE A;  2P7C B;  4ASN A;  3C07 A;  1HKT A;  3VSL A;  1FOX A;  4PJL A;  1IRZ A;  1W0U A;  1FOW A;  2GIV A;  5LEK A;  3F21 A;  4E7H A;  2NS7 A;  3BCB A;  1K4T A;  3NWT A;  2K9M A;  4RAF A;  2VKV A;  4ZH4 F;  2CV0 A;  2P0W A;  4L0Y B;  2R7D A;  2PJP A;  3KZ9 A;  1ZGW A;  3DPT A;  3V6G A;  1FEX A;  3ZMS A;  2FSW A;  2LKS A;  4AID A;  3FK7 A;  1FLI A;  2NXN B;  3S32 A;  1W7P D;  2O5R A;  2CRG A;  1ITY A;  4HDV A;  2F4M B;  2OAZ A;  2MYS A;  1B72 A;  3ERE D;  4G7O F;  2L3D A;  2F5V A;  2KDZ A;  1G8X A;  1JKR C;  5E20 A;  3P9T A;  2KIM A;  2YVX A;  1ZR4 A;  4NQW A;  3I54 A;  3M7G A;  3A2K A;  1LFP A;  3DEU A;  3VSK A;  4H4K C;  3IRQ A;  3R6S A;  4LG0 B;  2EPF A;  3ZR8 X;  5A2Q Z;  2A6E F;  3CDI A;  3ZQH A;  2HZD A;  5FKK A;  5KAF C;  4UUS B;  1PDN C;  2DYR H;  5ICG A;  4OD5 A;  1MNE A;  2B9S A;  3DV8 A;  2LRD A;  4XSX F;  3K4K A;  1UEL B;  5M5X J;  2R0Q C;  1R71 A;  4BNC A;  3BR3 A;  2EB7 A;  2RHA A;  4GCV A;  3SWH A;  4OD4 A;  2I8D A;  3MN2 A;  1U9O A;  2FOW A;  2CGP A;  4L62 A;  2QWT A;  5CQG A;  4HX7 A;  3BR0 A;  4IHY A;  3IH4 A;  3GTK J;  5DCM A;  5HLG A;  2PI0 A;  4IHT A;  2CWE A;  5J4Y A;  4ESJ A;  2GXA A;  3T5X A;  2YR2 A;  1J7K A;  1UMQ A;  4I76 A;  2HGC A;  4MQ9 F;  2FQ3 A;  4NHJ A;  3ZQL A;  3F8N A;  3CCM I;  4U87 A;  4R79 A;  3H5A A;  3KYL A;  2VOO A;  4S04 A;  2VC1 A;  4XLA A;  2R7V A;  5M5Y J;  4GCT A;  4M71 A;  1YJ9 I;  1FYL A;  4EM1 A;  1LJ9 A;  1O3S A;  2B3W A;  2DJI A;  1K79 A;  1O57 A;  5E8I A;  2ZFW A;  4HNU A;  2YVE A;  5HS9 A;  4CZZ A;  1JTY A;  3IAM 2;  3AL0 C;  2ESN A;  2FBH A;  2NNN A;  1JUP A;  3T6N A;  2CMP A;  5JR3 A;  1Q1H A;  1QVU A;  5LFA A;  1QPI A;  3LFK A;  2XV4 S;  3PSI A;  4M9Z A;  2M3A A;  4G8X A;  5D8L B;  3GTO J;  2WBM A;  1Z3X A;  5CXG A;  3MNL A;  2GWR A;  2QM3 A;  3BG9 A;  1YX3 A;  3ZQI A;  5CQE A;  4XSZ F;  1YHQ I;  3WOD F;  4G6T B;  3RKY A;  5KK1 A;  4CHU A;  2QCO A;  1V4R A;  1YW9 A;  4HKU A;  3LQQ A;  4BJT A;  3SFI A;  2OQR A;  4XMY A;  4DIQ A;  4U88 A;  2GXG A;  3GTJ J;  1MSF C;  4ZDP A;  3NNR A;  5IP9 J;  2QBY B;  5HDK A;  4XLN F;  3I59 A;  1DPR A;  4A3G J;  4XRM A;  5LEJ A;  4IOC F;  2H8R A;  4ZZD A;  5HLH A;  3BPV A;  2CH0 A;  4EV0 A;  4E7J A;  4JOM A;  3TP3 A;  2DFH A;  2JA5 J;  5C44 J;  3HHG A;  2EIM H;  2X6X A;  3JW4 A;  3FXR A;  1B8I A;  3KKC A;  3O6B B;  3K4C A;  2KDO A;  1GHC A;  2G7L A;  2ELK A;  2IA0 A;  2P5V A;  3JAM K;  4BE1 A;  2ZCX A;  1B4A A;  3CJT B;  4XLF A;  3F6O A;  1BR2 A;  3AFH A;  3KZI C;  3NI7 A;  3WTV C;  2UV1 A;  1D5V A;  4HST A;  1YS6 A;  4OU0 A;  2R4G A;  2VT2 A;  1A6Q A;  4IEJ A;  1S72 I;  4HF1 A;  1QU3 A;  4XRS G;  4U9L A;  3K4B A;  2EWN A;  3J7A Y;  3RH2 A;  3ZMU A;  1XB4 A;  1IZ1 A;  1U3E M;  1MJB A;  4BXF A;  3LSP A;  4LG3 A;  1H9T A;  3J7A O;  4ENJ A;  1IRF A;  4HW0 A;  4LK1 F;  1NTC A;  1U5T A;  3QPH A;  5DD8 A;  1HC8 A;  4P9U A;  2GXB A;  2F48 A;  2QVO A;  4ZYE A;  5AON A;  3H0D A;  5EG0 A;  3RD3 A;  2DMT A;  3ZN0 A;  4C3J J;  2MBF A;  2ADU A;  1MD0 A;  3VIB A;  3DLL F;  1KON A;  3DPJ A;  1ETW A;  3K70 C;  3WE2 A;  1B9M A;  4RA2 A;  3JTG A;  4A3C J;  2BGC A;  3EUH A;  4G7H F;  3KKD A;  1ETY A;  1MMG A;  1UAA A;  2JSP A;  4EMS A;  2FEZ A;  1W36 C;  1ZAR A;  5DYM A;  3R0A A;  3W2V A;  4RAY A;  2BXY A;  3HC7 A;  3BZK A;  2UWM A;  1Z0X A;  4OMY A;  2DTR A;  2MLK A;  3N4M A;  2QYO A;  1U5T B;  3QPT A;  1Y0N A;  4BHB A;  2F07 A;  4KIF A;  1GUU A;  4PGH A;  5E3M A;  3VW0 A;  1R5H A;  2W00 A;  1HF0 A;  1FYK A;  2K86 A;  5IYB J;  2IGO A;  1GV5 A;  3MKZ A;  2Y0M A;  3QP5 A;  2ZJ2 A;  2Q8K A;  1AU7 A;  4OIQ F;  3AQT A;  2V1U A;  3WG9 A;  3TDU C;  4UUT A;  2TRT A;  3C3W A;  3GXO A;  2M8G X;  2F2E A;  4ETS A;  4CA0 A;  1DDN A;  2F4O B;  2FXA A;  3KP2 A;  4PJ0 C;  5JHF A;  1K61 A;  1ZRE A;  1WI3 A;  3QOP A;  3J80 Z;  1PP8 F;  4Q5S F;  1JXS A;  2ISZ A;  4WXH A;  2V26 A;  4L9V A;  4BY7 J;  3O60 A;  1YIT I;  4U0W A;  2VON A;  2EFQ A;  2VL8 A;  2NOJ B;  3S2W A;  1D8K A;  2BVM A;  4BJ5 C;  2V57 A;  4Z6Y A;  5ICE A;  2QSH X;  2IGN A;  1SFX A;  2VKH A;  5GAH J;  1HOM A;  3ANG A;  4C2M A;  3I5U A;  3BCG A;  3QOE A;  2L01 A;  4G6D A;  4NC8 A;  2IA1 A;  2HVR A;  3GZI A;  2CQN A;  1R5G A;  3P9I A;  3HBL A;  2STT A;  3HUG B;  1PYV A;  2K9S A;  2E34 A;  2V6C A;  2LNB A;  4IX7 A;  5F0H A;  1TNS A;  2UXX A;  2ELJ A;  3ASO H;  4AYB N;  3WGI A;  5D1R A;  4PFP A;  1T39 A;  2HKO A;  2VE9 A;  3GEZ A;  3ASN H;  3TOA A;  3TBI A;  2GAU A;  1WI9 A;  1K6Y A;  2COM A;  3WG7 H;  5DUI A;  3RZD J;  3CDH A;  4B44 A;  2JMW A;  2L4A A;  5CYV A;  1S7O A;  4EJO A;  1BC7 C;  2WV1 A;  4A3M J;  3KIO A;  3E6M A;  3DPL C;  3J80 K;  5H2F C;  2A6T A;  4A3K J;  4JP0 A;  2DMN A;  2DMU A;  3D5R C;  3S14 J;  3CJR B;  3HTI A;  1FMV A;  4YG2 F;  4KN4 X;  1ETO A;  1VQO I;  3J81 K;  1IW7 F;  3M07 A;  2FMY A;  3C2H A;  5LHG A;  4UUS A;  3FXM A;  2K9N A;  1YIJ I;  3S16 J;  1XGN A;  4J00 A;  1KQ8 A;  4L18 B;  3TW6 A;  4HEA 2;  3KP7 A;  3OSF A;  1N77 A;  1UST A;  3KCC A;  2DPU A;  4BY1 J;  2LD5 A;  2WAQ A;  4R1H A;  4Y13 A;  1HW2 A;  3L7W A;  3PJR A;  5E1Z B;  1RUN A;  1R7J A;  2CQK A;  2EZI A;  3GTQ J;  2WB1 A;  1VQ4 I;  3AAF A;  3HOT A;  2HQR A;  4CYC A;  4A3J J;  2H94 A;  5K7Z A;  2OTJ I;  1N78 A;  4NB5 A;  2BVL A;  5TGT A;  3M8F A;  3W6J B;  2XDN A;  4CUG A;  3HM5 A;  5FMP A;  5GP9 A;  4XKC A;  4I98 B;  1IGN A;  4MXM A;  3K2A A;  4Q47 A;  1X2M A;  2GQQ A;  5CVR A;  1ETV A;  2UXU A;  2K9L A;  2IGK A;  2QWW A;  1K6O A;  4F55 A;  2DPD A;  5K58 A;  1VQM I;  3N97 A;  2BE5 F;  3G3Z A;  4IQ4 A;  3HG9 A;  2HDW A;  2LSO A;  2QZ8 A;  3MEX A;  2D5V A;  1RC9 A;  2E36 A;  3VYR B;  5GPA A;  2CQ7 A;  4YII A;  1X58 A;  2MD0 A;  3TDZ C;  3FK6 A;  3PL8 A;  2CV2 A;  3H92 A;  3GO5 A;  2WAF A;  1X1C A;  2W53 A;  4XLP F;  4DW6 A;  5DS9 A;  2M7B A;  3BQY A;  5EEA A;  2XHK A;  4ZYA A;  2XC7 A;  5GAE J;  2PFV A;  2O7T A;  1FPQ A;  2RVC A;  5J6X A;  2JA6 J;  2R93 J;  3M8E A;  4P9F A;  3JR9 A;  2HOS A;  2VIX A;  1BI1 A;  3DPU A;  6PAX A;  2Z2S B;  5IPA A;  3FKI J;  4FQG A;  1SFO J;  4UDS A;  2BV6 A;  2QLZ A;  4M3F A;  3MD2 A;  4EAT A;  2X51 A;  2JVG A;  1ON2 A;  2Z5U A;  1JKP C;  2OA4 A;  2V1N A;  4JX5 A;  3IRR A;  2LH9 A;  2VQG A;  4IHW A;  2HFH A;  1QPM A;  1BA5 A;  4XLH A;  2XSD C;  2VQH A;  5IT3 A;  2E7X A;  4MEY F;  2N8G A;  3HDD A;  1ZGJ A;  3W2A A;  4QIW N;  3DTE A;  1G4D A;  3S1M J;  3QU6 A;  3S15 J;  2QSG X;  5L3F A;  3ON2 A;  4EJT A;  2L0K A;  1HW5 A;  5FKO A;  3HOS A;  3DEE A;  4RM2 A;  2OPT A;  2X4H A;  1O7F A;  5JI6 A;  3VUQ A;  4HX4 A;  3VYS B;  1ETK A;  1UI6 A;  3A02 A;  5FFX A;  4HRI A;  2CG4 A;  1QZE A;  2L4M A;  5KVR A;  3E6D A;  5L3E A;  3NRV A;  4AIH A;  5GTI C;  5EDN A;  1A04 A;  3PQK A;  1Y8Q B;  1G3S A;  3K2Z A;  2OF7 A;  4CCK A;  2CUF A;  4F7Z A;  1FBQ A;  2UXP A;  4L5E A;  3TQN A;  3GFM A;  2R7X A;  3DKY A;  3IKV A;  2JPC A;  3FXQ A;  3DKW A;  5KCM A;  1QVT A;  2DT5 A;  3I0T A;  2ZME C;  4V2F A;  1BR4 A;  2CW8 A;  3QPS A;  2WAQ N;  4A6E A;  1FX7 A;  1BOB A;  2VT3 A;  1TWH J;  3BG3 A;  2XF7 A;  2MA3 A;  1X4O A;  5CLS A;  1D0Z A;  3BCA A;  1RR8 C;  3BDD A;  1B72 B;  4I6Z A;  2GM4 A;  1E17 A;  1ZR2 A;  5J40 A;  4IRH A;  1IN5 A;  2UXH A;  1I39 A;  2LY1 A;  3C1D A;  2ETH A;  2XGX A;  3GZ6 A;  3FIS A;  4HF2 A;  2XAS A;  3H3V K;  4U9N A;  3K4N A;  4BDZ A;  2QOP A;  2EIK H;  3H9Q A;  4FE7 A;  3ZRG A;  2QQ9 A;  1T2K A;  5ED4 A;  1JJ6 C;  1IRX A;  2X0L A;  4AU7 A;  1MNM C;  1QGP A;  2AS5 F;  1USS A;  4HNT A;  2D6Y A;  2ZOY A;  1SAX A;  1SAU A;  1TBX A;  1WZ2 A;  1APL C;  1Z77 A;  1GDT A;  4CZC A;  4IRV A;  1VZ0 A;  3CES A;  4LK0 F;  1O7L A;  4MFD A;  1PP7 U;  2FRH A;  2G7H A;  5CW8 A;  1WJB A;  3SZG A;  3OYA A;  2LKX A;  2GA2 A;  2O0Y A;  3HRS A;  2JWT A;  4HBL A;  2EFO A;  1JGS A;  1WJE A;  3HJE A;  3BJB A;  2CU7 A;  3HOW J;  1TLH B;  2DK5 A;  2ZJQ F;  5FKM A;  1GT0 C;  2E2I J;  2OZ6 A;  5K5R A;  5FRM A;  3CWR A;  1ZEL A;  2JK3 A;  3H1C A;  3HYI A;  3KP5 A;  4RGR A;  4YFK F;  4FCY A;  1IDZ A;  1XSD A;  3E1S A;  2HU9 A;  1KZH A;  4B3X A;  1LPQ A;  5FHP A;  1ZHF A;  2HWV A;  2QKL B;  2LOO A;  4A3I J;  2P5K A;  2COB A;  1R1U A;  3PAS A;  4C2U A;  1MGT A;  2L9N A;  4L9N A;  3ZMD A;  2XKP A;  1ZTR A;  2AXL A;  5FKL A;  2LY9 A;  1FP2 A;  1MH3 A;  3CUO A;  1X2N A;  2FNP A;  2W24 A;  4A2U A;  4BQO A;  2LRE A;  3KP6 A;  4FIS A;  3SJM A;  3H3Z A;  4I7H A;  1S7A A;  5DV5 A;  1Z7L A;  3JSO A;  4LLN A;  2B1E A;  2DYS H;  1MJA A;  3COA C;  1A31 A;  2KRC A;  5HDG A;  1QZY A;  2RQQ A;  1WJC A;  4ENM A;  1FBS A;  3ECH A;  3OYL A;  5IT9 Z;  1P4A A;  1AHD P;  3G1O A;  1F4K A;  2VQC A;  3WU1 B;  2ZJP F;  1SFE A;  1QHH D;  2FQ4 A;  2HOT A;  2DU9 A;  2L7Z A;  5TJJ A;  3WTW C;  2LVS A;  1Y8R B;  4PJJ A;  3CLO A;  5FRO A;  1T98 A;  1V5F A;  3GZN B;  2F5E A;  3OL4 A;  4GFL A;  3FMQ A;  3IH3 A;  1MDM B;  1WH7 A;  3OYC A;  4KN7 X;  3TGN A;  1OYI A;  3JRH A;  4LGW A;  4CCO A;  2HR3 A;  1Q1V A;  1MDM A;  2QKO A;  4UUV A;  1OYY A; 
#chains in the Genus database with same CATH homology
 2YVE A;  1JTY A;  3BTI A;  3C2B A;  4J19 A;  1AKH A;  1JUP A;  3T6N A;  2WB1 N;  1PUF B;  1QVU A;  1MBJ A;  1H8A C;  3BNI A;  3PPB A;  2CJJ A;  1QPI A;  3S1N J;  2DJN A;  3LSJ A;  3GTM J;  3GTG J;  2ECB A;  4A93 J;  3ON4 A;  2XPV A;  3OIO A;  1Y1V J;  3G7R A;  3GTO J;  2IBD A;  4NDL A;  3MNL A;  2DN0 A;  3BG9 A;  3ZQI A;  4AC0 A;  5JLW A;  5CXG A;  2NS8 A;  5E3N A;  5C4X J;  4BKX A;  4A3F J;  3SDG A;  2QCO A;  2ZCN A;  5M5W J;  4HKU A;  3BR6 A;  3SFI A;  2M34 A;  3GTJ J;  1MSF C;  3NNR A;  5IP9 J;  4X6A J;  1MBH A;  3IV5 A;  4A3G J;  3NAU A;  3G56 A;  5JLX A;  4XRM A;  2QF7 A;  2WUI A;  2H1K A;  2H8R A;  1TWF J;  2G7G A;  1MBG A;  2R5Z A;  2ZB9 A;  1XG1 A;  3TP3 A;  5HAW A;  4XIC A;  2JA5 J;  4CYC B;  5C44 J;  3GBG A;  3K7A J;  1B8I A;  3KKC A;  2UXI A;  2PBX A;  2G7L A;  2ELK A;  2ZCX A;  1JT6 A;  4A3E J;  1IG7 A;  4JKZ A;  5HBU A;  4NEL A;  4DYQ A;  3JRC A;  3F1B A;  1T33 A;  2EZL A;  4BBS J;  1POG A;  1WCM J;  3NI7 A;  5IP6 A;  1GVD A;  1OJL A;  3Q0U A;  5IOZ A;  5DAJ A;  1IUF A;  4IEJ A;  4XRS G;  3KNW A;  3RH2 A;  2LFB A;  2DA1 A;  3LHQ A;  4GFK A;  3ZOB A;  3CQZ J;  2AO9 A;  3LSP A;  5F08 A;  3JSJ A;  3VW2 A;  2M2E A;  2QTQ A;  4FTH A;  2DA7 A;  1NTC A;  4ABZ A;  2B63 J;  2YVH A;  2VKE A;  1BW5 A;  5M3M J;  1I6H J;  4ME9 A;  4DYC A;  4D5F A;  5K7F A;  1XS9 A;  2RAS A;  1WGX A;  2Y2Z A;  5FJ8 J;  2OI8 A;  5EG0 A;  3RD3 A;  2DMT A;  4C3J J;  2EQR A;  4A3D J;  2DA5 A;  1IC8 A;  3VIB A;  5CXI A;  3DPJ A;  1ETW A;  5BNG A;  2AHQ A;  2HXI A;  4A3C J;  3KKD A;  5C4Y A;  4Y7N J;  1ETY A;  1I3Q J;  1UG2 A;  5EFY A;  1FJL A;  2K9Q A;  2FX0 A;  4QTR A;  1FIP A;  1I50 J;  1IDY A;  1Z0X A;  3ZQG A;  2HI3 A;  3VVZ A;  4MIM A;  1EF4 A;  2F07 A;  1GUU A;  5E3M A;  1O4X A;  3VW0 A;  1HF0 A;  1W0T A;  3LNQ A;  5IYB J;  5M3F J;  2CQQ A;  2M9H A;  1GV5 A;  3HTA A;  2JJ7 A;  3HGY A;  1AU7 A;  3AQT A;  1RES A;  1JJ8 C;  1JKO C;  4XK4 A;  4UUT A;  2TRT A;  1T56 A;  3QKX A;  2M8G X;  3LSR A;  1UI5 A;  2Y0S N;  2UXO A;  3F0C A;  1K61 A;  4ICH A;  1WI3 A;  2VI6 A;  3B6A A;  3OOU A;  3HOV J;  2ID6 A;  2W48 A;  5EG0 B;  4BY7 J;  2OER A;  3O60 A;  4EEF G;  2V57 A;  3FRQ A;  3B6C A;  3M4O J;  2WGB A;  4C2M J;  1BJZ A;  1HOM A;  1ZK8 A;  3ANG A;  3BCG A;  4XRS A;  2X48 A;  4M3D A;  3UKG A;  3VVY A;  3ZQC A;  4BBR J;  1TC3 C;  3GZI A;  4C3H J;  2XPU A;  3IUV A;  3E7Q A;  2JN6 A;  3LJL A;  2XGE A;  3HBL A;  3HOX J;  1S7E A;  2K9S A;  3HE0 A;  2HQ5 A;  4RDU A;  2HYT A;  2LTP A;  5F0H A;  1ENH A;  3HB9 A;  5GPC A;  2REK A;  1OFC X;  4AYB N;  1H89 C;  5D1R A;  5F0C A;  4Y52 J;  3NPI A;  4B4C A;  4JNN A;  3CRJ A;  2LP0 A;  4M3B A;  1F36 A;  2DMP A;  1H88 C;  2E2H J;  2GBY A;  3LSG A;  2YUS A;  1NK3 P;  3RZD J;  3W6V A;  3BHQ A;  1MSE C;  3JRD A;  5FLV A;  2JMW A;  3NAR A;  4PXI A;  2WV1 A;  1HDP A;  4A3M J;  2IAI A;  1HDD C;  2Q24 A;  3ANP A;  3JRA A;  2P81 A;  3D1N I;  3Q0V A;  3CJD A;  4A3K J;  1BW6 A;  4JP0 A;  2DMN A;  2DMU A;  3RQI A;  3S14 J;  3HTI A;  2O8K A;  1B8I B;  1JKQ C;  1ETO A;  3BR5 A;  2ME0 A;  4B1R A;  3BT9 A;  4UUS A;  3S16 J;  2K9N A;  1ZQ3 P;  2TCT A;  3BQZ A;  3TW6 A;  1IV6 A;  3EGQ A;  1QRY A;  3OSF A;  2L7F P;  1U78 A;  2EZK A;  5K7H A;  3MVP A;  3IH2 A;  2I10 A;  2HKU A;  4BY1 J;  2LD5 A;  1RKT A;  5HOD A;  2DA3 A;  3E7L A;  2E1O A;  3S1R J;  1HLV A;  3OSG A;  4A3L J;  3AQS A;  2EZI A;  3GTQ J;  4D5C A;  1DU0 A;  2DG7 A;  2NP5 A;  5FGL A;  4DZP A;  1WH5 A;  2FJ1 A;  4CYC A;  4A3J J;  3HKZ N;  5K7Z A;  2KT0 A;  2R5Y B;  3ZQF A;  2XB0 X;  1JTX A;  1AKH B;  2XDN A;  1FIA A;  4JX6 A;  3BR1 A;  3HM5 A;  3WHB A;  3B81 A;  5FMP A;  5GP9 A;  2FBQ A;  2M0C A;  4QSH A;  2PMZ N;  2YS9 A;  3GTP J;  1IGN A;  4KWA A;  4MXM A;  3K2A A;  5F1J A;  3VOK A;  1X2M A;  1ETV A;  2HDD A;  2UXU A;  5D18 A;  5K58 A;  5HSZ A;  3I4N J;  2XGD A;  4HNV A;  3M3Y J;  1ZKG A;  3QPL A;  4AUX A;  1U8B A;  2FD5 A;  4ACI A;  1JUM A;  3S2D J;  1A6I A;  2D5V A;  4M3G A;  4B3A A;  2E19 A;  3VP5 A;  5GPA A;  3Q0W A;  1CQT A;  1X58 A;  4S0H B;  4GCK A;  4AC6 A;  4MFE A;  1IJW C;  3FK6 A;  2DTZ A;  2MGQ A;  2HXO A;  3BTL A;  3TP0 A;  4W97 A;  1HCR A;  2W53 A;  1P7J A;  4DW6 A;  5DS9 A;  2G3B A;  3BQY A;  4DYR A;  5EEA A;  3CCY A;  1LFU P;  1ETQ A;  2O7O A;  3HGG A;  2O7T A;  2JA6 J;  2R93 J;  3QBM A;  3JR9 A;  2L9R A;  2HOS A;  5IOY A;  3RKQ A;  2K40 A;  5EF6 A;  4D7N A;  2NVQ J;  4MO7 A;  1MBE A;  4LOC A;  5IPA A;  3FKI J;  1SFO J;  1BL0 A;  2GUH A;  4UDS A;  4JL3 A;  2ZCM A;  4M6V A;  4M3F A;  3DEW A;  3PM1 A;  1FTZ A;  3NRG A;  4JX4 A;  5IYD J;  2VPR A;  1OCP A;  1ETX A;  1JKP C;  5DTD A;  3S1Q J;  4JX5 A;  3HEF A;  4IHW A;  3VW1 A;  1BA5 A;  2GFN A;  2DA6 A;  2XSD C;  1Y1W J;  3O8H A;  3TW7 A;  2X9D A;  2N8G A;  1K83 J;  3HDD A;  3S1M J;  4QIW N;  2QIB A;  3WHC A;  3S15 J;  2ECC A;  3ON2 A;  1F43 A;  5J1Y A;  3BR2 A;  2L0K A;  2Y31 A;  5FKO A;  1E3O C;  1P7I A;  2OPT A;  5EZH A;  1TWG J;  1LFB A;  1XC5 A;  4A69 C;  4GCL A;  3JRB A;  3VUQ A;  2R5Z B;  3JRG A;  1ETK A;  2MG4 A;  1UI6 A;  3A02 A;  1MBK A;  1RET A;  2MW8 A;  2XRL A;  5J1R A;  5AQC A;  2NVY J;  1TWC J;  1LE8 A;  1VFC A;  4RBO A;  5EDN A;  4GFB A;  2G0E A;  3PO3 J;  2MSY A;  4XID A;  2JA7 J;  3LWJ A;  2CUE A;  3BTJ A;  1WPK A;  5E3L A;  4C3I J;  2OF7 A;  2X6O A;  2CUF A;  2Y30 A;  3QQA A;  3A01 A;  2UXP A;  2NOG A;  1GV2 A;  4L5E A;  5EZG A;  5FLM J;  3I4M J;  4BXX J;  2E2J J;  2IEK A;  5J3L A;  2Y9Y A;  3GTL J;  1QVT A;  2YU9 J;  4V2F A;  3QPS A;  2WAQ N;  5EGO A;  2ID3 A;  3CMY A;  3VVX A;  4V2G A;  1TWH J;  3HTH A;  1VF9 A;  3BG3 A;  1RKW A;  1RR7 A;  3LOC A;  1B72 B;  4I6Z A;  3EUP A;  2DG8 A;  2GM4 A;  1ZR2 A;  2XGC A;  2HYJ A;  1PUF A;  2UXH A;  2EZH A;  1UHS A;  3HOY J;  1JT0 A;  4A3B J;  1A5J A;  1SAN A;  3FIS A;  2O9L A;  3COL A;  3H3V K;  3G1L A;  5FKN A;  5J1U A;  2QOP A;  1YRN A;  5EYR A;  4FE7 A;  3DCF A;  5IP7 J;  1MBF A;  3A03 A;  4FE4 A;  2HOA A;  1JJ6 C;  3JRF A;  5F0F A;  3VOX A;  1MNM C;  4DZJ A;  3BRU A;  2L7M P;  2G7S A;  2LLK A;  2D6Y A;  2ZOY A;  4YZE A;  1DU6 A;  3BG5 A;  3C07 A;  5E3O A;  4IHX A;  1R9T J;  1Z77 A;  5F27 A;  1APL C;  1GDT A;  1IRZ A;  9ANT A;  2ME6 A;  2NVX J;  1W0U A;  3NXC A;  2R7Z J;  4MFD A;  1U9N A;  2EH3 A;  5F04 A;  2EBI A;  5CW8 A;  2NS7 A;  4X1E A;  2LK2 A;  3L1P A;  2LKX A;  2VKV A;  3FIW A;  5IYC J;  3A01 B;  2JWT A;  3KZ9 A;  4D7M A;  1ZGW A;  5C4J J;  1NK2 P;  1MH4 A;  4W1U A;  3V6G A;  3BJB A;  1FEX A;  3RZO J;  2CU7 A;  3BTC A;  3HOW J;  5FKM A;  1GT0 C;  2E2I J;  2GLO A;  3CWR A;  1LE8 B;  2DA4 A;  3FK7 A;  2JK3 A;  1IDZ A;  4FCY A;  1D5Y A;  2CRG A;  2R5Y A;  3CDL A;  2R92 J;  1ITY A;  3Q3S A;  1B72 A;  3PO2 J;  5FHP A;  3S17 J;  2IU5 A;  3MKL A;  2KDZ A;  1JKR C;  2RAE A;  4A3I J;  3HTJ A;  3P9T A;  3VPR A;  2COB A;  3O8G A;  1ZR4 A;  3PAS A;  3GEU A;  1ZTR A;  1G2H A;  5FKL A;  2LY9 A;  3ZQH A;  5FKK A;  3HOZ J;  4UUS B;  1MH3 A;  3S5R A;  1X2N A;  5C3E J;  1VND A;  2NP3 A;  5D19 A;  4FIS A;  5M5X J;  3SJM A;  1SGM A;  4JYK A;  2R0Q C;  3BR3 A;  2XB5 A;  2DMQ A;  2RHA A;  4NN1 A;  2ZOZ A;  5H9T A;  3MN2 A;  1U9O A;  4L62 A;  3H0G J;  2NVT J;  3S2H J;  2QWT A;  2VUM J;  4IHV A;  1RPW A;  3BR0 A;  4MK6 A;  3HIM A;  4IHY A;  3IH4 A;  2Y9Z A;  3HOU J;  2JA8 J;  3GTK J;  1AHD P;  3G1O A;  1OCT C;  1ORK A;  2XPW A;  2FQ4 A;  2DA2 A;  2HOT A;  4M3E A;  1UMQ A;  2GEN A;  4CGR A;  2L7Z A;  4I76 A;  2LVS A;  3TED A;  3V78 A;  1JGG A;  1TWA J;  1VI0 A;  3ZQL A;  4GFL A;  3IH3 A;  2LR8 A;  4G12 A;  3JRI A;  1WH7 A;  4MLO A;  2CQX A;  3JRE A;  3JRH A;  2PZ9 A;  1JUS A;  2NX4 A;  1YRN B;  5M5Y J;  4AF5 A;  4GCT A;  1FTT A;  1Q1V A;  3G1M A;  5EGO B;  2QKO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...