1JUMA

Crystal structure of the multidrug binding transcriptional repressor qacr bound to the natural drug berberine
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
186
structure length
186
Chain Sequence
NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKKEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords HYPOTHETICAL TRANSCRIPTIONAL REGULATOR IN QACA 5'REGION
publication title Structural mechanisms of QacR induction and multidrug recognition.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 78
structure length 186
sequence length 186
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2001-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1jumA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 1jumA02
4GFBA 1UHSA 2DA7A 4B1RA 1UG2A 5GPCA 2O7OA 5IP6A 2DA2A 3JSJA 2LR8A 2DMQA 2I10A 3GTPJ 5M5WJ 3S1NJ 2WGBA 2X9DA 3A03A 1HCRA 3VP5A 2KDZA 2IBDA 2Y9YA 3BR5A 1B72B 2K9QA 1E3OC 2IEKA 2NOGA 3BR2A 3O60A 1I50J 1PUFB 4JYKA 1OCPA 2NVQJ 5FKKA 4DW6A 1BA5A 2K9NA 3VIBA 3WHCA 3JRGA 1F43A 2JJ7A 1TWFJ 2ECCA 2HQ5A 3TW6A 3LWJA 2LY9A 2XDNA 2XPUA 3V6GA 2R5YA 3LJLA 3A02A 3OSFA 3H0GJ 5M5XJ 1SFOJ 1JTYA 3O8HA 1BL0A 3TEDA 3BRUA 1U78A 1RKTA 2EZLA 1R9TJ 5EGOB 3G1MA 3H3VK 2TCTA 1CQTA 2Q24A 5M3FJ 3HM5A 3V78A 3G56A 3BR3A 2E2HJ 4M3GA 2REKA 2PBXA 2M34A 2MG4A 4RDUA 4IHWA 2PZ9A 2VPRA 3RQIA 3W6VA 1JUMA 3S5RA 3ZQFA 3EUPA 1GV2A 4C3JJ 5M3MJ 2X6OA 4XK4A 2L7MP 3OOUA 2QOPA 1IGNA 2JK3A 1Z0XA 2P81A 3CQZJ 1IG7A 2LP0A 2UXUA 1H88C 2ID6A 2G7GA 3LSRA 4V2GA 4JX4A 4ABZA 3MKLA 1JTXA 2UXIA 5FKNA 1ZKGA 5E3MA 2CQXA 3PO2J 1MBFA 2L7FP 2HI3A 2XB5A 2IAIA 4D5CA 4CYCB 1JUPA 3BR6A 3Q0UA 1MSEC 3GZIA 5IYCJ 5FGLA 3HGGA 3QBMA 1JJ6C 3CRJA 1VI0A 5EG0B 1ZQ3P 2PMZN 1SANA 5GPAA 1ZGWA 3BG5A 3RZDJ 4Y7NJ 2O8KA 1OCTC 1FTZA 2Y0SN 4JP0A 4PXIA 4V2FA 2DTZA 3IH2A 1B72A 1ZR4A 2XPWA 1HDDC 3FISA 2EZKA 4EEFG 5IYDJ 2G0EA 4A3EJ 1PUFA 1QPIA 3FIWA 4C3IJ 1ETQA 1W0UA 3S1QJ 4GFKA 4D7NA 2IU5A 2DA4A 3ZQHA 4Y52J 2DG7A 2OERA 5IOZA 4D5FA 3JREA 3BNIA 3CWRA 2NS8A 1SGMA 3S17J 1XG1A 1ZR2A 3JRBA 3PASA 5HAWA 1VNDA 2RAEA 3BR0A 2ZOZA 5F08A 4FISA 1TWAJ 2B63J 2AHQA 2ZCXA 3HE0A 3HBLA 4X1EA 3QQAA 5EGOA 2ME6A 5C3EJ 1FTTA 2YU9J 5HODA 3RZOJ 3OSGA 2V57A 3VOKA 3B6AA 3BHQA 5IYBJ 2WB1N 4MXMA 3EGQA 3BTLA 3LSPA 3ZQCA 1B8IB 2R0QC 2UXOA 4IHYA 2WV1A 2G7LA 1IJWC 1NK2P 1JKOC 2DMPA 4C3HJ 2ZB9A 1U8BA 3ZQGA 2ZCNA 3HIMA 4S0HB 2MSYA 3KKDA 3ANGA 2X48A 2QF7A 1IUFA 2LVSA 3GTGJ 3GBGA 3I4NJ 5JLWA 4DYRA 4XRSG 2CRGA 5F27A 3HOVJ 3CDLA 2JMWA 1Y1VJ 4CYCA 4I6ZA 1T33A 4J19A 5C4XJ 3LSJA 1EF4A 2K9SA 3VW2A 1NK3P 5IOYA 3BG3A 5EG0A 2VUMJ 1IRZA 4XRSA 2HDDA 3BTIA 3Q0VA 3TP0A 3PO3J 4MK6A 1ITYA 5E3LA 2G3BA 2LTPA 4LOCA 3FRQA 5JLXA 1WH5A 1DU6A 1IDZA 2DA5A 1GDTA 3RD3A 4L62A 4XIDA 4BY7J 3JRFA 4RBOA 3TP3A 1GV5A 2MGQA 2Y2ZA 1BW6A 1APLC 3GTJJ 1OFCX 4BXXJ 5EFYA 5CXIA 2HKUA 1RETA 5EDNA 4A3LJ 4BBSJ 5C44J 5FHPA 2R92J 3UKGA 3HEFA 5EZGA 3QPSA 1RKWA 2K40A 4QSHA 4A93J 5C4JJ 4IHXA 3COLA 3VUQA 2O7TA 2NVYJ 2H1KA 2CQQA 2H8RA 3FKIJ 1OJLA 2JA5J 1B8IA 2EQRA 2L7ZA 1P7IA 2CJJA 3A01B 1IV6A 3GTLJ 4A3KJ 1ZK8A 5J1YA 1JKPC 3HOZJ 4KWAA 3VPRA 5C4YA 1X2MA 3S2HJ 4L5EA 3HTHA 3NNRA 4YZEA 2MW8A 2DN0A 3S14J 4FE7A 1FEXA 2N8GA 3M3YJ 2RHAA 1P7JA 2CUEA 2E19A 2LD5A 4W1UA 5D1RA 4M3FA 2ZCMA 3KNWA 3VW1A 4UUSB 1AU7A 4M6VA 3BJBA 1RR7A 3LHQA 4JX6A 2JWTA 1WI3A 3ANPA 2F07A 3E7LA 1W0TA 2L0KA 4DZJA 1LE8B 4HKUA 3HB9A 1MBEA 1LFUP 2FBQA 2JA8J 4JKZA 2NVTJ 3T6NA 2W48A 2QCOA 4DZPA 3NPIA 1XS9A 1Q1VA 1MNMC 1YRNB 3FK6A 1D5YA 2M0CA 3KKCA 3F0CA 2HXIA 3BR1A 5FKMA 5K7HA 2NX4A 1UI5A 3AQTA 1K61A 1WH7A 4D7MA 4I76A 3QKXA 1AHDP 3ON2A 4GCTA 3VVXA 2GBYA 2DMNA 2DMTA 3DCFA 2ID3A 2XRLA 2JN6A 4A3CJ 2RASA 2E2JJ 2LK2A 1MBHA 2E2IJ 5FMPA 2NS7A 1ENHA 2XB0X 5E3NA 2DA1A 5F1JA 2R7ZJ 1VFCA 4GCLA 1WPKA 3NAUA 3A01A 2VKEA 2NVXJ 3BTJA 4XICA 1K83J 2YVEA 1TWHJ 4B3AA 5J1RA 3AQSA 1G2HA 3GEUA 4FCYA 1MBGA 3LOCA 1X58A 5EZHA 1DU0A 4A3GJ 1WCMJ 2GM4A 5IPAA 5HBUA 2OF7A 2L9RA 1ZTRA 1MSFC 3SFIA 1FIPA 4A3DJ 4G12A 2CUFA 3HOYJ 5D19A 2W53A 3KZ9A 2KT0A 3Q0WA 4AUXA 2R93J 3VOXA 3LSGA 4UUSA 3G1LA 4JX5A 4BKXA 1A6IA 2FQ4A 2OI8A 1RESA 4W97A 2GUHA 3BT9A 3DPJA 1POGA 4CGRA 1LE8A 1IDYA 2GLOA 2EZIA 3RH2A 4A3MJ 2QWTA 5M5YJ 2COBA 2XGCA 1YRNA 2XGEA 5E3OA 2HOTA 3NXCA 3MVPA 5K7FA 2ELKA 3OIOA 1NTCA 2FD5A 3F1BA 3C07A 1LFBA 3HTJA 2M8GX 1U9OA 1F36A 1IC8A 1HOMA 1O4XA 1Y1WJ 2XSDC 4BBRJ 3IUVA 2ME0A 1GVDA 3JRHA 3GTQJ 1AKHB 3BG9A 1XC5A 3O8GA 3BQYA 3I4MJ 4QTRA 3QPLA 1T56A 2G7SA 3P9TA 2GFNA 2EH3A 3S1MJ 3DEWA 2UXHA 3WHBA 2HYTA 2DA6A 1GUUA 1QVUA 4B4CA 3PPBA 3HOXJ 1JT0A 5HSZA 1QVTA 1WGXA 5DTDA 2HYJA 2LLKA 5FLMJ 4HNVA 1MH3A 5CXGA 4AC0A 4FTHA 3ON4A 4A3BJ 3C2BA 4MLOA 3LNQA 3BQZA 1Z77A 3SJMA 5F0CA 4UUTA 2AO9A 2VKVA 1I3QJ 3IV5A 2HOAA 1HDPA 2FJ1A 4IEJA 5CW8A 2R5ZB 9ANTA 1H8AC 1A5JA 4NN1A 1H89C 3HOWJ 1JGGA 4FE4A 3TW7A 3CJDA 1ETVA 2Y31A 3MN2A 5J3LA 4DYCA 2QIBA 3JR9A 4A3JJ 5FKOA 3CMYA 1I6HJ 4NELA 2O9LA 5D18A 2DA3A 1MBKA 2DJNA 3ZOBA 1JKRC 1RPWA 2QKOA 3IH4A 1S7EA 3D1NI 3S16J 2D6YA 5H9TA 3BCGA 3BTCA 1GT0C 4GCKA 4BY1J 2YVHA 1BJZA 1ETWA 2XGDA 2QTQA 3K7AJ 1AKHA 4MIMA 4MFDA 1U9NA 3HGYA 2M9HA 3HOUJ 3NI7A 4UDSA 3K2AA 1ETKA 3ZQIA 4A69C 3M4OJ 2YUSA 5F0FA 2GENA 3S2DJ 5EF6A 1MH4A 3ZQLA 4MFEA 1BW5A 4ACIA 1TWGJ 3CCYA 2DG8A 3HDDA 3VVYA 1FIAA 4M3EA 3IH3A 2EZHA 1ETXA 3Q3SA 1VF9A 5EYRA 4ICHA 3RKQA 5K58A 3E7QA 1JT6A 2FX0A 3GTMJ 1UMQA 3G7RA 2XPVA 4C2MJ 3GTKJ 5K7ZA 4ME9A 4M3BA 3VW0A 1HLVA 2E1OA 5F04A 1X2NA 3B81A 5FKLA 3NRGA 3HKZN 2R5ZA 2NP5A 3S1RJ 5FLVA 5IP7J 1JJ8C 2JA6J 3HTIA 2YS9A 4GFLA 3B6CA 1QRYA 1ETYA 2NP3A 2ECBA 5F0HA 5EEAA 1HF0A 5BNGA 3JRDA 2WUIA 5DAJA 2R5YB 3HTAA 4QIWN 4NDLA 4DYQA 3G1OA 4A3IJ 1FJLA 2D5VA 2HOSA 2EBIA 2ZOYA 2WAQN 5GP9A 3GTOJ 3S15J 2M2EA 5IP9J 1ORKA 3VVZA 1TC3C 4IHVA 3MNLA 2OPTA 2LFBA 1TWCJ 3SDGA 2Y9ZA 4A3FJ 3JRCA 2CU7A 2JA7J 2DMUA 3NARA 4JNNA 1UI6A 2TRTA 1ETOA 2LKXA 2UXPA 4X6AJ 1JUSA 2HXOA 2Y30A 1MBJA 5DS9A 3JRIA 5AQCA 3FK7A 4XRMA 5FJ8J 3PM1A 4AYBN 4AF5A 1JKQC 2VI6A 5J1UA 3L1PA 4M3DA 4AC6A 4MO7A 3JRAA 4JL3A
chains in the Genus database with same CATH superfamily
1SD4A 1OR7A 2YVXA 4G94A 2DOEA 3IWZA 3MEXA 4RB0A 2DA7A 4B1RA 2RQQA 3DBRB 2W24A 3OYGA 3F8CA 3C2GA 2XHKA 5FD6A 5IP6A 5AONA 1Y6IA 2I10A 3J7ZI 3GTPJ 1S7OA 3DBLB 3S32A 1PUEE 1W7PB 2VASA 2X9DA 1N25A 2IPQX 4OMYA 5IT3A 1IRFA 2K9QA 2K27A 2IEKA 4JBAA 4Y33A 1XGMA 4JYKA 3LMMA 3I55I 2NVQJ 1SFKA 4DGWB 1Z21A 4DW6A 3P9CA 2K9NA 3VIBA 3WHCA 4BAYA 2JSCA 2JJ7A 1TWFJ 2HQ5A 3TW6A 3LWJA 2XPUA 4M72A 2CFXA 3J80K 2KJCA 2YSRA 3A02A 4BHBA 3OSFA 3H0GJ 2DT5A 4BXFA 3TEDA 3K6GA 3L09A 2B1EA 1P4XA 3H3UA 2E36A 1TZLA 1CQTA 3U1KA 5FB2A 4NHJA 3V78A 4D9JA 2B0LA 2HNHA 3G56A 1WJEA 4XQFA 2DLLA 1I6XA 1S29A 4FHTA 3ROUA 3FZVA 4PSXA 3RQIA 5J8CA 1JGSA 1FPQA 5LHGA 1T2KA 3S5RA 3NEUA 1YO5C 3GVAA 3AAFA 3ZQFA 5M3MJ 2QOPA 1P2FA 2L7MP 3K70C 2DK8A 2CV0A 1Z0XA 2P81A 3KFWX 4KN7X 2LREA 1A04A 3DFGA 3SHFA 3CD6I 1KQ9A 1Z7LA 2M0MA 1ZKGA 3PO2J 3SXYA 2JRTA 1WRJA 1GXQA 4XORA 3W6JB 2XC7A 3CCJI 1JUPA 3Q0UA 1MSEC 3GZIA 3F3XA 5IYCJ 1U5TB 2J5PA 4LB6B 3GW2A 3QBMA 5A2QK 2GQQA 2IT0A 1VI0A 5EG0B 1ZQ3P 1K78B 2EFPA 1ZGWA 2FSWA 3WTSC 2KIUA 4IVNA 4V2FA 1B72A 1ZR4A 1S6LA 3FISA 3I64A 1UZCA 4EEFG 2LKPA 1MNEA 3LFUA 4FQGA 2STTA 1WI9A 4F7ZA 3CLQA 1KONA 2CQ7A 1FOYA 2EA2A 3ESWB 3ZQHA 2OERA 3BNIA 4ENMA 1QA6A 1D3YA 1ZR2A 5HAWA 3W6KB 2O0YA 5F08A 2AHQA 3WGIA 1I5ZA 2VQLA 3Q9VA 1T6SA 1FTTA 1WSUA 2YU9J 3NRVA 4C30A 3RZOJ 2V57A 3FXRA 4A0YA 3BHQA 3PL8A 3FHNA 1XB4A 1RI7A 2CW8A 2LMDA 3QP5A 1V5FA 4HNTA 3RKXA 2G7LA 1W1WE 1IJWC 2BE5F 2HQRA 1XDSA 2F5VA 1U8BA 3E3VA 4HDUA 3HIMA 3WG7H 3IP4B 3K4CA 4GYGA 2QF7A 1IUFA 3GTGJ 4EJVA 3GBGA 5JLWA 3PIOF 1D0ZA 4ASNA 1ODDA 3EUHA 1KU7A 3FXMA 1T08B 5C4XJ 3LSJA 4EM1A 1X4PA 1P4AA 1X1AA 3VW2A 2IGMA 4PCQA 3COAC 1NK3P 3TKYA 1IRZA 2HDDA 3PQJA 1NH3A 1YX5A 2CV1A 3KYDB 2MD5A 4ZDPA 2XKPA 3CMEI 1Z6TA 1P6RA 3CMAI 1TBXA 3OL3A 3FRQA 1WH5A 1IDZA 2DA5A 5FROA 4L62A 1LVAA 3TDZC 2RNGA 4KN4X 2ZKZA 2MGQA 3NS4A 3KEOA 1APLC 3JAMK 3MKZA 3DPTA 4BQOA 1W4MA 5BPIA 3IWFA 1EH6A 3ZMVA 2PFBA 2X1EA 5EDNA 3S93A 3GXOA 2R92J 3ERMA 1BOAA 2VB6A 1W7PD 2E1NA 4QSHA 3WTYC 2CO5A 3KE2A 2LC2A 2W85A 3WU1B 4IHXA 3COLA 3VUQA 3GZ5A 1HSJA 1X1DA 3LAPA 2UXNA 4M9ZA 2H1KA 2H8RA 2V1UA 4WXHA 2JA5J 1VQ4I 4ZYGA 1IV6A 3GFMA 2IA0A 2IW5A 4E7LA 1XDUA 2VKDA 3W2WA 4I99C 4HF2A 4BJTA 1L3LA 3S2HJ 3NNRA 1R23A 4B44A 1R4MB 2DN0A 3RTRA 2V9KA 1MNDA 4F93B 1IZ1A 2HPIA 2FE3A 4FX4A 4MEYF 2HDWA 2HR3A 3BROA 2NOJB 4LG3A 2GAUA 2O03A 2G7UA 2HS5A 1UG0A 4Q5SF 3S3MA 2ZNZA 2XIGA 1WI3A 5HVQC 2BGCA 5L3GA 1LE8B 4IKFA 2L0KA 1KA8A 1T8IA 5DD8A 1YLFA 2LKSA 2D45A 1MDMA 2K4BA 3H92A 3MKWB 1XS9A 3T0YA 1LKXA 1R5ID 4HBLA 1SMYF 1YOVB 3FK6A 2UXXA 1RC9A 2MH2A 4BEHB 3ULQB 4I76A 4J00A 2RREA 2DMNA 2XRLA 1Z3XA 4EVIA 1WFXA 1EV7A 1WJDA 5FMPA 3F8NA 1K6YA 3L2CA 2XV4S 1NHAA 1WQ2A 1X3UA 1VFCA 1X1PA 3F72A 2GOMA 2NVXJ 4OIQF 1K83J 5D4RA 1TWHJ 4D1QA 2MH9A 2GA2A 5J1RA 2DO7A 1SAXA 2K86A 4G6TB 1X58A 1DU0A 4A3GJ 1WCMJ 3C7JA 4B09A 1VQ7I 2E1MC 2DXIA 1QZYA 4LK0F 5HLIA 5HOOA 3FM3A 1BC8C 4J01A 4NNJA 2KT0A 5E1ZB 2KQRA 4UUSA 2QENA 4CCMA 1BIBA 3CJQB 4BH9A 4LMYA 1TTYA 2MC4A 3GO5A 4BU2A 3ERED 3AL0B 3DTEA 5L3EA 2PMHA 4P9FA 2KFDA 1S5LC 2GLOA 4ZTJA 1QO0D 1XCVA 2ZO4A 4L18B 1J0RA 3NWTA 1ZN2A 3FM5A 5CKTA 2A68F 4RB2C 2COBA 2XGCA 1YRNA 4RA2A 1XPXA 2KDOA 5K1YA 3F1BA 5DEQA 2VJJA 4G9YA 4OIOF 4PJ0C 3PNVA 1D1CA 4BBRJ 2DCEA 2Z5UA 3K70D 4I01A 3JRHA 1YW8A 1XC5A 4PZJA 2XSJC 4AYBA 3BQYA 3V7SA 3I4MJ 4ZC3A 3ZP5A 3CJTB 1Z7UA 2GFNA 3WGHA 2DAOA 3HYIA 4DIQA 4YFKF 2UXHA 4HPQA 1FYKA 4ZYAA 2W4SA 4WX9A 3I0TA 4I7HA 4PGGA 3HPGA 1JT0A 2GIZA 1J5YA 1WGXA 3OOPA 4O6JA 5HDNA 4L9TA 4BACA 1Y56A 3CZ6A 5DM7F 4BQNA 4UV8A 2K9LA 5CXGA 3LQRA 4G7OF 1VTNC 2P8TA 1T98A 4LJZF 5BMZA 1DP7P 3PFYA 3C2BA 3LNQA 5DD4A 2O8XA 3BQZA 5D6FA 2D1HA 1M1EB 2V6EA 4UUTA 2FUG2 2AO9A 2BW3A 5D5UB 2NXNB 2HOAA 1HDPA 4IEJA 3IC7A 2HVQA 1Q1HA 1WJ5A 2LH9A 1ETVA 2Y31A 5J3LA 4DYCA 2L9VA 1H0MA 4XMYA 4Y15A 4A3JJ 1HQCA 3CMYA 2O9LA 5D18A 2E1MB 3H1CA 1JKRC 2QKOA 4AIHA 1ZELA 1K6OA 1S7EA 2AQEA 4PFPA 3D1NI 4BDYA 1Y0NA 4AIDA 3RSNA 1LEAA 2XUBA 3CMMA 1VQ6I 2P4WA 4CCLA 5KHDA 3KZIC 4DNCA 1YQAA 5D8KB 4HF1A 1BJZA 1VQLI 3VDXA 1JHFA 4I0AA 1U9NA 1BI2A 5FLXZ 1SVMA 3M4OJ 4MTDA 3O3KA 3S2WA 3LSKA 3K4KA 2AS5F 3V7CA 1O57A 3S2DJ 1FP2A 1TW2A 2RN7A 2DDAA 5EF6A 1MH4A 2BY0A 1BW5A 4ACIA 1UHWA 4OAYA 5GAHJ 1ZLJA 3F22A 3CCYA 2EK5A 2HQAA 2DG8A 1Z05A 3N97A 3EQLF 2CS3A 5DCMB 1RNLA 1ETXA 3Q3SA 4NC7A 4UB6C 4ICHA 3RKQA 2QBYB 4KISA 4PGHA 4BGDA 3E7QA 4CUGA 4LITA 4G7ZF 5D4SA 1T0FA 1W5TA 2FX0A 3H5AA 2DYRH 1ON1A 2BXZA 4M3BA 3HPHA 5HLHA 1K4SA 2O61A 1SAUA 1X19A 3OYFA 4NQWA 2UWMA 2ZCWA 4YFNF 3NWSA 3ZXSA 2Q2EA 2NP5A 3MZHA 5FLVA 4A12A 1O7FA 2FA5A 3HTIA 4GFLA 1Y39A 1ETYA 2LF8A 2R7RA 4UY8I 2NP3A 2JZYA 5EEAA 3CC4I 4XN3A 1RUNA 1SEUA 2R5YB 3G1OA 5A2QZ 3F8FA 2HOSA 2LYCA 3ZPLA 5GP9A 5L3DA 3GTOJ 2M2EA 3VB2A 1X4OA 3FXQA 4RM3A 5AIPA 2LRDA 5JI6A 3L9FA 2CWEA 4A3FJ 2BVLA 3FXKA 1HA8A 2YU3A 5EEGA 2A6EF 2LKXA 4EM0B 2WWYA 4GCVA 1JUSA 4ZYHA 2Y30A 3JRIA 1F5TA 2OV7A 2H09A 4Y13A 2QZ8A 2W00A 4M6XA 3TO6A 5FJ8J 1FX7A 1LEBA 4JOMA 4Q47A 1JKQC 4UUVA 2OCCH 2UV1A 3DPUA 2XAFA 1LFPA 4MO7A 3TGNA 2FU4A 1ZGAA 1OCOH 1DGWY 1R1VA 2ISZA 4CH7A 2QSHX 4DBRA 4X0GA 5TGTA 2RGVA 2HVRA 3JSJA 5B66C 4KIGA 5M5WJ 1ZG1A 2VKHA 5K5OA 1FOXA 1BBYA 2ZXIA 3BY6A 3TO7A 3TL4X 5E8IA 4I2OA 3OV8A 4MNUA 1E3OC 2KZGA 1V4RA 2B3WA 2DOAA 4JQFA 1I50J 3GFLA 1W5SA 2EIJH 4EJTA 3HL2A 1U3EM 3JRGA 2CSOA 1F43A 3D5RC 5DDGA 5LRSA 1UHMA 4PJNA 3KCCA 1SFOJ 5M5XJ 2IRFG 3ZGKA 3RYPA 4A6EA 3BRUA 3A4CA 2EZLA 2GZWA 3BCAA 5EGOB 3G1MA 3K69A 1J59A 1X3WB 2L3DA 4WF2A 3L7WA 1B6AA 4B48A 3BR3A 1ZREA 3QU6A 4G8XA 3BG7A 2QYOA 2REKA 2DTRA 1XMXA 2PBXA 3MD2A 1PP8F 3SQNA 4CO8A 3CCRI 2WC2A 4K2EA 2R4GA 4IQJA 1FT9A 2LY2A 3E5QA 3HRSA 3G73A 1REPC 3VEPA 1GV2A 4C3JJ 2X6OA 3F23A 1HKSA 3M1CA 1IGNA 2JK3A 3U1DA 3HRTA 2UXUA 3ABMH 1BIAA 3OYKA 1QZZA 3HIFA 3S8PA 1JTXA 2RC4A 5FKNA 2CQXA 2OD5A 1MBFA 2EFWA 2A6HF 4KJZA 3FXUA 4CYCB 3HG9A 2PJRA 2PFVA 1IN5A 5F64A 3HGGA 1SVOA 3G2BA 1JJ6C 4IOAF 3GYHX 1XGNA 1CF7A 5GPAA 1SANA 2KRHA 2DI3A 3PQKA 4A2UA 4BQAA 3RZDJ 2PMUA 2EFOA 2O8KA 4JP0A 2IS6A 3C2HA 2GXAA 3BZKA 2HOEA 2EZKA 1HW5A 1A31A 1NG6A 2DQLA 1PUFA 1TNTA 4C3IJ 1QPIA 2P5VA 1ETQA 3O2PE 1HSTA 1LE8A 4Y52J 2DG7A 1QNTA 3JREA 2ESHA 4KITB 1SGMA 5LEKA 1VQNI 3RPUD 3G3ZA 3JRBA 2Y48A 1D0YA 5LEJA 4DQ2A 2RAEA 1V55H 3BR0A 3EUKL 2EINH 4ZYEA 3QOPA 4WCGA 4X1EA 5C3EJ 3IRRA 4BE0A 2ADUA 2ZBKA 4MTEA 3SYTA 1G3YA 2M30A 3HRUA 3GFJA 3JW4A 3K4LA 3B6AA 4FASD 3AG4H 1G3WA 2ICWG 5IYBJ 5GAEJ 1C0WA 2VXZA 3BZCA 3LSPA 1BM9A 2E71A 1QPMA 2V79A 2WV1A 3AG1H 2ZB9A 5TRDA 4S0HB 2MSYA 2BBYA 4HX4A 3KPHA 4HV5A 1SFUA 2CRGA 1XX5A 5HDKA 1R5HA 3HOVJ 1DPUA 3CDLA 2B7EA 1X1BA 2KLOA 4I6ZA 3D5SC 1YJWI 4ESFA 5L3BA 4YEJA 4P55A 5E1XA 1T95A 4KFCA 4U7DA 2F48A 3W2VA 2DOFA 3TOBA 5F1RA 2DU9A 3Q5FA 4M71A 4LOCA 3OYBA 2W7NA 2MC3A 3FXLA 2VJ4A 3RD3A 1H9GA 3JRFA 2XVCA 5D5XB 1GV5A 2G9WA 2WAEA 3GTJJ 4AWXB 2F5EA 3SZGA 4IRVA 2HKUA 3HUGA 4XR6A 2I5UA 4A3LJ 3F9KA 5FHPA 5ICEA 5BPDA 1MW7A 4UHTA 2EA4A 1GLNA 3CDIA 5FLXK 3EYYA 1QGPA 4F3QA 4KIBA 3DKWA 2NVYJ 3DLAA 3RKWA 4BQQA 4IRGA 3FKIJ 3PSIA 4E70A 1S8NA 1OJLA 3CTAA 1B8IA 2CUJA 1D8JA 2RQPA 2E5ZA 1YS6A 2CMPA 4A3KJ 3HOZJ 4KWAA 3WE3A 2DDBA 1TNSA 3V8LA 2R7SA 3CLOA 2MW8A 4XONA 1LUJB 4LG0A 1LPQA 4XLNF 1MKMA 1P7JA 2Z3YA 3VSKA 3DU6A 4N0BA 4HYEA 2E19A 2LD5A 2JRMA 4P9UA 2ZCMA 4JK1X 2BY2A 2KISA 3GZ6A 4DBQA 1VQ5I 3G71I 3LFKA 3DKYA 4Q48A 2X1CA 2XAHA 4MGRA 4LIUA 3ANPA 3B73A 3ZRGA 1EKEA 2F07A 3E7LA 4DZJA 4HKUA 3HB9A 2EV6A 2FBQA 2NVTJ 3KLNA 1BR1A 4XLPF 5J47A 1XMAA 1IF1A 3E1SA 2XASA 3HSEA 1D5YA 3I59A 4HSTA 2F5FA 3RIRA 3F0CA 3D5LA 2GOXB 3BR1A 4NBQA 3FWEA 5FKMA 2NX4A 4RMNA 2WY8Q 4MEXF 1UI5A 3AQTA 2PJPA 1WH7A 3VYRB 3E6MA 3O6BB 3QKXA 2QVOA 3ON2A 4GCTA 2GBYA 1LDDA 2ID3A 3V8KA 4S05A 4A3CJ 2IGNA 1D8KA 2OZUA 4BS9A 1ZRCA 2QM3A 5JHUA 3NQOA 3H9GA 3MZYA 1YFHA 5B1BH 1ZLKA 5CYVA 4WIBA 2PEXA 4TV7A 1X1CA 4U87A 3K4NA 3M8JA 4IZZA 3A01A 1S7AA 2KZVA 3BTJA 3DF8A 3DWLE 3CCQI 1P9QC 1DPRA 3TBIA 2PN6A 1YE9A 1OQYA 2LBFB 1MBGA 1EH8A 3LOCA 5EZHA 1B1BA 5FRNA 2BZTA 3ABUA 2FOWA 2Z33A 2H6BA 2L9RA 5ERIA 2L4AA 5KVRA 1V5EA 2W25A 2F5CA 1FIPA 2CUFA 5JR3A 3HOYJ 3FF5A 4CCOA 3KZ9A 3LSIA 2R7WA 2YR2A 1J2XA 4IRHA 3BJAA 4BKXA 3OYIA 1A6IA 2QQBA 4ZDLA 1WZ2A 1BI0A 2HPMA 2L7KA 1OCCH 1R36A 1R5GA 2GUHA 3BT9A 1POGA 4DVYP 2VXDA 2ISYA 3WTTC 3RH2A 3EPZA 5CVVA 2QWTA 1FC3A 4RAYA 5M5YJ 2FBIA 1P4WA 2XGEA 1IN6A 5DYMA 3K0LA 3ECHA 5H6QA 5LHIA 4XSZF 5K7FA 1UAAA 3AFHA 3C07A 1LFBA 1OR7C 2M8GX 4QLCU 3R0AA 3QYFA 1IC8A 4LB5A 2VE8A 5HLTA 1HOMA 2D1VA 2XSDC 4EJOA 3ZMZA 2CW0F 3IUVA 4BHCA 2DFEA 2ME0A 1AKHB 4HF0A 4QTRA 4G6QA 2EH3A 3DP7A 4XKCA 1K7AA 2VC0A 2ZC2A 3WU0A 1XTAA 2DA6A 3X2QH 1R6RA 2YPRA 3IKTA 5HSZA 3HOXJ 1CF7B 3CUQA 4HQEA 4BNCA 2ELJA 4E6KG 3DXJF 3IUOA 2F4OB 5FLMJ 4HNVA 2KRFA 4ZDOA 4P96A 2ZMEA 3FMRA 2V1NA 1TQIA 3QAHA 3ON4A 4A3BJ 3AL0C 4MLOA 1Z77A 2G7HA 3ONQA 2EV0A 2VKVA 2LNBA 4RB1A 2O6GE 1HW2A 5FRMA 3J7AO 4ZZDA 5CW8A 2Y69H 2Y75A 4RLFA 5H2FC 3I53A 2R5ZB 9ANTA 2IGOA 4KICA 5B1AH 1H8AC 1A5JA 1JGGA 4FE4A 3TW7A 2DPDA 3HXLA 2QIBA 3JR9A 1FBQA 2K02A 1I6HJ 1IN4A 4NELA 3FBIB 1MBKA 1LNWA 1KU9A 3L2RA 1RPWA 3HRMA 2V9PA 4XOTA 1VQ8I 1LVKA 4BJ6C 1RR8C 2NNNA 2HDCA 3DLLF 1JXSA 3J7AY 2D6YA 2OTLI 1G3TA 2UZKA 4N9HA 4B47A 3BCGA 1SD6A 2MABA 3BTCA 5KNLA 1IO2A 3G6EI 1E17A 4E7ZA 2CQNA 2QTQA 3K7AJ 1J75A 5TJJA 1WJFA 3HGYA 3RPQA 5FFZA 4KA4A 1J9IA 4UDSA 3PSFA 3ZQIA 2RDPA 3WE2A 4UV9A 3WU2C 3P7NA 2GENA 4Y4RA 4PDKA 3KYCB 4BE2A 1TWGJ 3CCSI 1R7JA 4AM3A 3VVYA 1FIAA 1IW7F 2OUMA 2JTVA 1IXRC 2GXGA 4XLHA 2OU2A 2GIVA 3GTMJ 2VOPA 1J09A 2K4JA 3R61A 5K7ZA 3K1PA 3FHZA 4RGSA 1HLVA 1YHQI 1FP1D 1WJAA 2E1OA 1X2NA 1MMSA 2PG4A 3B81A 1WHUA 2W84A 3EDPA 5IT9Z 3H5NA 1JJ8C 3GCMA 2JA6J 3I4PA 1QRYA 2W1OA 2QUFA 2KRCA 2ECBA 4M9XA 5F0HA 5BNGA 5DAJA 1FMVA 1E0EA 4HQMA 4DYQA 1WKMA 4A3IJ 3BCBA 2D5VA 4HA8A 1LQ1A 2ZOYA 2WAQN 2JT1A 4B43A 3E5UA 5IP9J 1TC3C 4M6YA 2GA1A 2ZJPF 2OPTA 2LFBA 3A0BC 3QYBA 1ACIA 1TWCJ 3QODA 2Z1DA 3EUHC 3JRCA 4KT5C 3ABLH 2JA7J 1VQKI 2NRAC 4QWQA 3KX2A 3HTSB 5E17F 2OTJI 5J40A 1UI6A 2GWRA 3BOQA 2WBMA 5AQCA 3OYMA 3G4SI 5J4VA 1OYWA 3FBNB 3FK7A 3LSTA 1DP3A 4O3MA 1GHCA 2QA4I 4HLXA 3GLXA 3KP4A 2YX4A 4LFUA 3IAS2 4H4KC 5K5RA 4B8XA 3GMEA 1RUOA 4AC6A 3DV8A 2MLGA 3JRAA 4JL3A 4DOZA 2OA4A 4GFBA 1UHSA 2EFNA 1UG2A 3OYJA 2P5KA 3BZ6A 4RS8A 2PX9A 3ZR8X 2FBKA 2LR8A 3V42A 2WGBA 2VBZA 4YRVA 1HCRA 2EIKH 2KDZA 4I0BA 4AIKA 2IBDA 3KEQA 2Y9YA 2BEOA 1XCBA 1BN5A 2EV5A 3BR5A 4U0VA 1B72B 2F4IA 4HRIA 1FY7A 4MHGA 3BR2A 4I09A 3O60A 3UNGC 4XOPA 5ILUA 3VTIA 2H8WA 4Q4ZF 2VQGA 2ZSHB 3S3NA 3M8EA 2ECCA 3V6GA 2NNYA 4XRFA 5HLGA 2DT7B 2M4GA 5D5VB 3KP6A 5CLSA 4WWCA 1JTYA 4UNOA 4ENKA 3KP5A 3CCMI 1RKTA 1BI1A 2XRNA 4O5VA 1R9TJ 1KU2A 2LG4A 3TO9A 1ZARA 2TCTA 3L2VA 2C6YA 1O7LA 3HM5A 2HEOA 1E2XA 2QLZA 4LLGF 5BS6A 2QQ8A 3PNTA 2E2HJ 4M3GA 3OR1C 4OMZA 4OOIA 1SFEA 2V26A 4NC8A 2M34A 2OC6A 4IHWA 2PZ9A 3QOEA 4IJAA 3CO6C 1KQ0A 1JUMA 3W6VA 3VYUB 1IUYA 1MGTA 4FETA 4ENNA 4XK4A 2LP0A 4F91B 4HEA2 4RLQA 5TISC 2ID6A 4Z6YA 1H88C 1K79A 3LSRA 2DODA 3V4GA 1GXPA 2G7GA 4NUBA 4JX4A 2V7FA 2UXIA 5E3MA 1D5VA 2W57A 4QPQA 2XB5A 1I3AA 4D5CA 3W2AA 3BR6A 2K3FA 1B9NA 2CG4A 1S3JA 1I1GA 1ONVA 2PMZN 2F2EA 1W7PA 3BG5A 3Q9SA 4Y7NJ 1LB2A 1FTZA 2Y0SN 2MBFA 3QPTA 2RKHA 3IH2A 2XPWA 3ZMSA 2ZXHA 5GADJ 2G0EA 2RV8A 2XKOA 4A3EJ 3MKYB 3FIWA 4KT6A 4GFKA 1W0UA 4OIPF 2IU5A 1AWCA 5IOZA 4D5FA 2H6CA 1ZGJA 4HV6A 2NS8A 1X3ZB 3S17J 5CPRB 3PASA 4XSXF 3MWMA 1VNDA 1A6QA 3K4JA 3MZ8A 3VWBA 5E20A 2FJI1 1FYMA 2ZOZA 3GLLA 4FISA 3PJRA 2B63J 4GO1A 1DGRM 2ZCXA 3HBLA 1UB9A 3K10A 3QQAA 5ILVA 3HE0A 1TP4A 2ME6A 2V4JC 2VT2A 2F4MB 5HODA 1K4TA 2IVMA 3OSGA 2FNAA 4EM2A 3KP3A 4ON0A 3K4BA 2Z9OA 1SMTA 1RZ4A 5LGNA 4IQ4A 2M87A 3BTLA 2UXOA 4MXMA 4A0XA 2FMLA 1FMWA 5ED4A 2ZXWH 1BC7C 1JKOC 4RGXA 1YW9A 2DMPA 4C3HJ 1LJ9A 2JVHA 3ZQGA 4WK8F 4EGYA 3KKDA 3SWHA 3I9V2 2X48A 2LVSA 3T5XA 3I4NJ 2RNJA 4XRSG 4DYRA 3KIOA 3MMYB 5F27A 3CF2A 3DEUA 1Y1VJ 2P7VB 1T33A 2E7XA 1E3HA 1EF4A 4EQQA 2P0WA 4BYYA 1U5TA 4U0YA 2DQRA 5IOYA 2VQCA 5EG0A 2COMA 4XRSA 3BTIA 1K78A 4L0YB 4OWRB 3TP0A 4OINF 3PO3J 4MK6A 3P9KA 1ITYA 2G3BA 2LTPA 2XF5A 2A05A 2HTSA 1U2WA 3IKVA 5JLXA 1DU6A 1GDTA 4C9YA 2VBXA 4WXDA 3VOEA 4XIDA 1MDMB 4BY7J 2P7CB 4RBOA 2STWA 2Y2ZA 1BW6A 1MZBA 2EILH 2A5WA 1R71A 1OFCX 4BXXJ 1HBXG 5EFYA 2UUZA 1U0JA 5J6XA 2Z16A 1RETA 2JA2A 1P92A 1S9HA 2DT6A 2IS4A 2L5QA 4DJAA 3HEFA 5EZGA 3H3ZA 2Q8KA 2KL4A 3T8RA 3OYHA 3IRQA 5E8GA 3EUAA 3BDDA 1MMNA 4GGGA 3AKZA 2O7TA 5BQTA 3IHUA 3QPHA 5GAGJ 2PBIA 5J8FA 3LSHA 4PJMA 3J7YJ 3CCVI 2L7ZA 4EMSA 1QBJA 2FF4A 1P7IA 5L3FA 4ETSA 3GTLJ 2ZJRF 2E35A 1ZK8A 1JKPC 2CH0A 1U6GA 3VPRA 3UR3C 2KIMA 5LRRA 1FZPB 1X2MA 4L5EA 3HTHA 4R79A 1GVJA 5CVIA 4YZEA 1KZHA 3S14J 4U9LA 1FEXA 4L9NA 2IGKA 1FLIA 3H36A 5ICGA 1HXDA 2BYVE 3C18A 2CUEA 2WV0A 5KAFC 4RAFA 5IT9K 5D1RA 4KDPA 2RVCA 4M3FA 5ILSA 3VW1A 4CSWA 4UUSB 4PJJA 2IXSA 2E7WA 4M6VA 2XAGA 3OIQA 3PUFA 4AU7A 3LHQA 3H9QA 2CGPA 2JWTA 3H35A 3P5JA 3ABKH 2QWWA 1W0TA 3DTKA 4NN1A 3J81Z 1MBEA 4JKZA 3T6NA 2W48A 4LD5A 2QCOA 4DZPA 3BJOA 1ZAOA 1YRNB 4YIRX 2L02A 3MCZA 4XLEA 1FBSA 4F55A 5HDGA 4LGWA 1STZA 2HXIA 1K61A 4N9IA 4D7MA 2VBWA 1AHDP 2R7TA 2M7BA 3VVXA 2DMTA 1XSDA 1XN7A 4M73A 2RASA 2JN6A 2MFZA 4UVAA 2LK2A 1MBHA 2VONA 2NS7A 5KCMA 1ENHA 2QQAA 4QPOA 3N05A 2DA1A 5F1JA 1YW7A 3GFIA 4M74A 4GXOA 4GCLA 1WPKA 3NAUA 2VKEA 4XICA 2VJIA 1O3TA 1ZH5A 2BV6A 4OAZA 5J4YA 1Z3YA 3LA3A 1G2HA 2X6XA 3T8TA 3IAM2 1HW1A 2GM4A 5GTIC 5HBUA 2V1XA 4PSWA 3CF5F 3BLYA 2OF7A 1VQMI 3SFIA 4ESJA 2MYSA 3VOXA 2HTJA 5LD2C 1WWXA 2R93J 1G4DA 2BW3B 3L2WA 4JX5A 4IHTA 4E4HA 2FQ4A 1G3SA 2HVSA 2OI8A 6PAXA 4W97A 5LGTA 3K1NA 2FRHA 1PP7U 3ZMUA 3DPJA 3F6VA 2ZFUA 3R60A 4XLAA 1IDYA 2ZNYA 3GZNB 4HX8A 5H6RA 2EZIA 3N4MA 3KETA 2M7AA 4XKBA 3OYAA 1B59A 3CCEI 4A3MJ 2WAQA 2OCEA 4G6DA 4GRIA 2HGCA 3OR2C 4IPAA 5E3OA 2HOTA 3NXCA 1KU3A 2VODA 2WTEA 3MVPA 3R6SA 4S04A 4BEHA 3A1YA 3PUBA 1U9OA 1BJAA 5CQEA 1V54H 1O4XA 2IJLA 4C2MA 5B3SH 2K7LA 1YIOA 1GVDA 1Y8QB 1D1AA 3O8GA 1T56A 2G7SA 1MIJA 5ICCA 3K8PC 3LAJA 1WJCA 4AIJA 3WHBA 2GXBA 1GUUA 5FGMA 2KPMA 4CYDA 1MD0A 2B9SA 4B4CA 4B3XA 2LY1A 2HKXA 2HYFA 2NAZA 1QVTA 1AA7A 3OYEA 4IHSA 4KYWA 3PPBA 5E18F 2LLKA 1ZRFA 4BUPA 4PFOA 1IRGA 2FXAA 3A2KA 4AC0A 2J5OA 4E7IA 3BG6A 3ABTA 4FTHA 2L2OA 4P5OA 5H20A 3SZTA 5CVRA 1FYLA 2XAQA 3GUDA 2V1DA 3PFIA 5F0CA 2Q0OA 4ZZLA 1H9TA 1I3QJ 3ZCOA 3IV5A 1Z1DA 4IF4A 4NQWB 3GX4X 2FJ1A 1V5GA 2Q2EB 2P6SA 5DV5A 1H89C 3K1MA 2X6YA 1SC7A 3M7GA 5FKOA 4XKVA 2DA3A 3U2RA 1HC8A 4RAZA 2DJNA 3PNYA 3CDHA 3IH4A 1FSHA 5L3CA 5B5EC 4II3A 2OBPA 1O3RA 2E60A 1IRXA 3S16J 1YS7A 2F6CA 2Z99A 4U7BA 2M3AA 5CJ9A 4XBFA 4IXAA 2YX7A 2AXTC 3JTGA 1GT0C 1SD7A 2HWVA 4GCKA 2YVHA 2WY7Q 4MQ9F 2E1CA 4MIMA 1XGSA 2QEXI 4XN0A 3E6DA 4MFDA 2M9HA 3NI7A 1UCRA 5EJCA 1ETKA 3HHHA 2R7XA 3LWFA 4HSRA 4CA0A 3BC8A 4MFEA 5AIQA 3HDDA 2WADA 5D8LB 4CZCA 3HTUA 1EA3A 4BL0B 2ZJQF 3DBHB 2PMZA 2DFFA 4BXUA 5K58A 1JT6A 2LOOA 1R1TA 3B02A 3G7RA 2XPVA 4LLNA 4C2MJ 2Y0SA 4OD4A 4ME9A 2O3FA 3KZYA 4U88A 3I54A 2ZSIB 3HKZN 1E3PA 3L00A 1R58A 3S1RJ 3OYCA 3WODF 3KEYA 3AG2H 2WUIA 1N75A 1MJBA 1B9MA 2VBYA 2FQ3A 2LF7A 5DCFA 2CQKA 3SEZA 1ZG5A 3TOAA 1A36A 4PK4A 1FJLA 1YG2A 2AXLA 1Z67A 2FMYA 4HW0A 2EBIA 3S15J 1IV8A 4P1WA 4IHVA 3K2ZA 3C3WA 3FKJA 3EYIA 1UFMA 2H1LA 2HU9A 2QKMB 2Y9ZA 2EPFA 2CU7A 2TRTA 2WAFA 2D2WA 1O3SA 4N4OB 4X6AJ 5ICFA 2UXPA 2HXOA 5DS9A 1BOBA 4FX0A 2VL8A 3SDBA 3WTVC 3BWGA 4XRMA 5JVGF 2OJED 3C1DA 4WXCA 3CCLI 2QQ9A 4C2UA 3L1PA 2K5CA 2ZFWA 2FOKA 3E6BA 4ZH4F 2BVMA 3OY9A 5GTHC 1QHGA 5DCMA 3KP7A 3GWZA 3RPUA 5GPCA 1LDJA 2PJRB 2O7OA 1RIOH 2QBYA 3CESA 1DDNA 3M9AA 2DA2A 2KMUA 2R7OA 4ZTFA 2DMQA 4EV0A 2X85A 2CFOA 3E97A 3S1NJ 3A03A 3VP5A 3J81K 1HKTA 5KAIC 1TT5B 4HZFA 2F5DA 2X51A 1XSVA 2KIFA 4BDZA 4HNUA 1D1BA 4AVPA 2PQ8A 2NOGA 1PUFB 1JI8A 4RGUA 4KMUX 1OCPA 3V8JA 5FKKA 1R00A 1BA5A 2H27A 4RAGA 1VQPI 3OYNA 2OQGA 2VC1A 3HSFA 1TLHB 1YJ9I 2LY9A 2XDNA 1QHHD 2R5YA 3LJLA 5CVUA 4BHPA 2QKLB 1O3QA 3I58A 5E1WA 3O8HA 1BL0A 1D0XA 3JCUC 3P9IA 5HS9A 1U78A 2HFHA 5KK1A 3H3VK 4YG2F 4CDGA 1Z91A 2Q24A 3F8MA 5M3FJ 1XGOA 3F21A 1Z6RA 4U9NA 1PVEA 3RYRA 2VN2A 1FOKA 1PJRA 2MG4A 1Y0UA 1YITI 2KIQA 4RDUA 2VPRA 3WG9A 2M4KA 2A2FX 3M1EA 4CICA 3OYLA 3EUPA 5HS8A 2K9MA 3OOUA 4XLFA 2BHYA 1I1SA 3CQZJ 1IG7A 2IS2A 4GDFA 4IOCF 1G6NA 4V2GA 4F92B 5LLQA 4ABZA 3MKLA 3CP2A 2P5LC 2XAJA 3DU5A 2HQNA 2BHZA 2QSFX 1WVRA 2AQFA 2L7FP 2HI3A 1XSXA 2IAIA 4RGRA 4R8HA 2XF7A 1BR2A 3E0JB 5FGLA 1A35A 1YIJI 3CRJA 4XM3A 1KQ8A 4XLCA 1W36D 2KHMA 5IY5H 3E5XA 1T39A 1AOYA 1IAWA 2VT3A 1S72I 1OCTC 3VFZA 4HX7A 4PXIA 2DTZA 2LDUA 3RI4A 3K4MA 3OS2A 1HDDC 2A07F 5IYDJ 2DPUA 3VYSB 1BR4A 2CV2A 2K3PA 3K9TA 3OMYA 2BY3A 3CJRB 3D0SA 3HZJA 3V7RA 4D7NA 3S1QJ 2DA4A 4YIIA 3CWRA 5FO5A 4CXFA 3DKXA 1XG1A 1OISA 2IP2A 4M9SA 3FXOA 3HUGB 4BJ5C 2ETHA 2L9SA 3IL2A 1TWAJ 3CC7I 3BP8A 5EGOA 4IO9F 5JVTA 1V3FA 2X0LA 2DK5A 3ZN1A 1DQUA 2JPCA 1ZRDA 2EIMH 2ZXJA 3VOKA 4Y17A 5F6FA 2Z2SB 3HJEA 3QYEA 2E34A 4I02A 2WB1N 2VIXA 3F6OA 1ON2A 3ZQCA 1B8IB 3EGQA 2R0QC 4IHYA 4H0EA 2OAZA 5FFXA 2EWNA 1NK2P 4L9VA 1Z9CA 1TT0A 1Y8RB 2ZCNA 1FSEA 2IA1A 3ANGA 3VYTB 3L2QA 1J7KA 1NG7A 3M07A 1U8RA 2DFIA 1TW3A 3QWLA 4LG0B 3GF2A 2JMWA 1R22A 3ZQQA 4CYCA 2BY1A 3L2UA 4J19A 4HLYA 2FEZA 2DFHA 2X6WA 2K9SA 4C2TA 2XF6A 3BG3A 1YJNI 2VUMJ 1QU3A 3ECOA 3KYLA 3Q0VA 3WGGA 4CGZA 2V9VA 3H0DA 1R4NB 4AVZA 5E3LA 2W82A 1G8XA 2FNPA 1HKQA 2JUGA 4D0PA 2VQHA 3TP3A 2LSOA 2BOLA 3ZMDA 2VPLA 3I3LA 2VJ5A 3I59B 3I56I 5CXIA 2OQRA 3FMSA 2R7VA 2EFQA 2ZY9A 4BBSJ 5C44J 3CUQC 3UKGA 3OL4A 1TL8A 3QPSA 2FBHA 3OWTA 1RKWA 2K40A 4A93J 4L9JA 3LA2A 5BOXA 2EJRA 3H9JA 5C4JJ 3BPVA 2ZMEC 2A3SA 3EETA 2CQQA 3BJ6A 3KZZA 4L5JA 2L54A 3R4KA 2HZDA 2EQRA 3VSLA 3LA7A 2CJJA 3A01B 1N77A 2KP6A 2R7FA 3RKYA 1TQPA 1XMKA 5J1YA 4L5IA 1RRJA 5D6EA 2PLYA 5C4YA 4OU0A 2L4MA 5DUKA 4OIRF 5LFAA 2L01A 2PI0A 4FE7A 2A69F 2N8GA 4EATA 3M3YJ 2RHAA 4CHUA 3VODA 3BPXA 2KKOA 4W1UA 2BXYA 4E7HA 3FX3A 1MJ9A 4II2A 3KNWA 1IXSB 4XL9A 1AU7A 5CVJA 3BJBA 1RR7A 4JX6A 1OPCA 4OD5A 1I39A 1YYVA 3CJNA 2VLAA 1LFUP 3U21A 2JA8J 3SEQA 2A6TA 4NC6A 3REOA 3NPIA 1Q1VA 1MNMC 2K85A 3HHGA 3KKCA 1JHHA 2M0CA 2XROA 3TQNA 2ESNA 3HOSA 2JSPA 5K7HA 1OMIA 2V6CA 3OIPA 3OS0A 1MMDA 3J80Z 4YELA 4AD9A 3DCFA 3SFZA 5CQGA 2OZ6A 4IL6C 3TDUC 2E2JJ 2E2IJ 1KGSA 2XB0X 3ASOH 2XDVA 5E3NA 3LQQA 2WA0A 3DTIA 2R7ZJ 2M5WA 4UB8C 5LGUA 2QSGX 4A5NA 4N4NB 1UJ8A 5D5WB 2YVEA 4B3AA 4NB5A 1W5CC 3CUQB 3WTWC 3AQSA 3GEUA 2DBBA 4FCYA 3ELKA 3MFKA 2MA3A 3FXJA 2JPBA 5IPAA 4XNFA 5LHHA 4ANJA 4EJWA 2ZMEB 1MMGA 1ZTRA 1MSFC 5FD5A 4EGZA 4A3DJ 4UXNA 4G12A 1OYIA 2M1BA 1VQ9I 2W53A 5D19A 3Q0WA 4AUXA 1ZYRF 2XGXA 3LSGA 3HKZA 3G1LA 4Z2YA 4XKWA 1IN7A 2E5NA 1RESA 4CCKA 1FOWA 3HSRA 5K5QA 2M45A 1N78A 2H94A 3QU3A 4CGRA 4E7SA 1VZ0A 4UVCA 3E6CC 1SD5A 4FT8A 1DUXC 3WTXC 1JE8A 2VOOA 1UELB 1OCRH 1USSA 2ELKA 2IS1A 4BE1A 1FWZA 3H5RA 3OIOA 1NTCA 2DW4A 1T38A 1KYZA 2FD5A 2R3SA 2Q1ZB 3HTJA 3AG3H 1OCZH 1F36A 1Y1WJ 3ZN0A 1SFXA 4ZJZA 3KLOA 3WTZA 1MMAA 1R49A 3GTQJ 3BG9A 4E7JA 1OLTA 2CYYA 3OS1A 3RCOA 3QPLA 1OYYA 3P9TA 1ZG3A 5JFRA 3S1MJ 4IX7A 3CO7C 1FBUA 4CCNA 3U9GA 3DEWA 2NYXA 5LBQA 2HYTA 1XD7A 3PIPF 1QVUA 3LL7A 3GEZA 4EJUA 3F8BA 5DTDA 4MQVA 2LBFA 2HYJA 2HZTA 3MAJA 2TDXA 1MH3A 2NVUB 3HOTA 2DYSH 1G59A 4I98B 1USTA 1R1UA 3S3OA 1KYWA 5DUIA 1BI3A 3ZMTA 4PJLA 3SJMA 5HNFA 4HG2A 3JTHA 1OKRA 4RB3C 2ACJA 4KUMA 4KNYA 3FDYA 4ENJA 1ULYA 2A61A 3HOWJ 3CJDA 5EEHA 3KP2A 3MN2A 3SZPA 2X4HA 1F1ZA 3JSOA 4F52A 3QP6A 3ZOBA 1YTYA 2CW7A 2R7QA 5HNHA 4R1HA 4ESBA 4E7KA 4V19K 3A0HC 4A5MA 3RJPA 3ML6A 3JAMZ 2JVGA 1LDKB 2QGUA 5H9TA 2JQ7A 3CUOA 4CCJA 2L9NA 4BY1J 4PUSA 4LIVA 1ETWA 2XGDA 1AKHA 2JUCA 2O5RA 3HOUJ 2IA2A 2MD0A 3K2AA 1TQMA 4A69C 1I27A 2YUSA 3FMQA 5F0FA 3QRFF 5HS7A 3ZQLA 2X1DA 1T0FC 4LK1F 2KJBA 3DQVC 2ZJ2A 4M3EA 2VE9A 3IH3A 2CUZA 4U0WA 1ERDA 2EZHA 3WTUC 2MLKA 1VF9A 4KIFA 5EYRA 3JSPA 3M8FA 3ISPA 4A6DA 3RQ4A 1UMQA 1QZEA 5DM6F 3GTKJ 4UVBA 1YI2I 1EH7A 3T1BA 4IRIA 2Y0MA 3LSMA 3VW0A 3HC7A 3TMOA 1L0OC 5F04A 3CP8A 5FKLA 1F9NA 4ZYDA 3NRGA 2EB7A 2XAUA 2R5ZA 5IP7J 2YS9A 3W3CA 1CGPA 3RDIA 1EJ9A 3B6CA 1VQOI 3ZQ7A 3ASNH 5JHFA 3I71A 1HF0A 3JRDA 4L0ZB 3HTAA 4YIFA 2I8DA 4QIWN 4NDLA 4GYIA 4Y3OA 3OYDA 3CC2I 1IN8A 1MJAA 3R0JA 2HYGD 3DPLC 3CCUI 1W36C 1ORKA 4A0ZA 3VVZA 1SVLA 2P6TA 2NS0A 3MNLA 4CZZA 1YX3A 3SDGA 4HDVA 2WB1A 4HAMA 4ITVA 2DJIA 1FNNA 2DMUA 3NARA 4YFXF 4JNNA 2A5YB 1B4AA 1U5TC 1ETOA 3DEEA 1PDNC 5E79C 1F4KA 1ZHFA 1MBJA 1PYVA 2R7UA 3I5UA 1IXCA 1QQIA 2ELHA 2R7DA 3PM1A 4HOBA 4RM2A 4G7HF 4AYBN 4AF5A 4LLLA 2VI6A 2HKOA 5J1UA 3MQ0A 4KMFA 4M3DA 1WJBA 2M8EA
chains in the Genus database with same CATH topology
4GFBA 1UHSA 2DA7A 4B1RA 1UG2A 5GPCA 2O7OA 5IP6A 2DA2A 3JSJA 2LR8A 2DMQA 2I10A 3GTPJ 5M5WJ 3S1NJ 2WGBA 2X9DA 3A03A 1HCRA 3VP5A 2KDZA 2IBDA 2Y9YA 3BR5A 1B72B 2K9QA 1E3OC 2IEKA 2NOGA 3BR2A 3O60A 1I50J 1PUFB 4JYKA 1OCPA 2NVQJ 5FKKA 4DW6A 1BA5A 2K9NA 3VIBA 3WHCA 3JRGA 1F43A 2JJ7A 1TWFJ 2ECCA 2HQ5A 3TW6A 3LWJA 2LY9A 2XDNA 2XPUA 3V6GA 2R5YA 3LJLA 3A02A 3OSFA 3H0GJ 5M5XJ 1SFOJ 1JTYA 3O8HA 1BL0A 3TEDA 3BRUA 1U78A 1RKTA 2EZLA 1R9TJ 5EGOB 3G1MA 3H3VK 2TCTA 1CQTA 2Q24A 5M3FJ 3HM5A 3V78A 3G56A 3BR3A 2E2HJ 4M3GA 2REKA 2PBXA 2M34A 2MG4A 4RDUA 4IHWA 2PZ9A 2VPRA 3RQIA 3W6VA 1JUMA 3S5RA 3ZQFA 3EUPA 1GV2A 4C3JJ 5M3MJ 2X6OA 4XK4A 2L7MP 3OOUA 2QOPA 1IGNA 2JK3A 1Z0XA 2P81A 3CQZJ 1IG7A 2LP0A 2UXUA 1H88C 2ID6A 2G7GA 3LSRA 4V2GA 4JX4A 4ABZA 3MKLA 1JTXA 2UXIA 5FKNA 1ZKGA 5E3MA 2CQXA 3PO2J 1MBFA 2L7FP 2HI3A 2XB5A 2IAIA 4D5CA 4CYCB 1JUPA 3BR6A 3Q0UA 1MSEC 3GZIA 5IYCJ 5FGLA 3HGGA 3QBMA 1JJ6C 3CRJA 1VI0A 5EG0B 1ZQ3P 2PMZN 1SANA 5GPAA 1ZGWA 3BG5A 3RZDJ 4Y7NJ 2O8KA 1OCTC 1FTZA 2Y0SN 4JP0A 4PXIA 4V2FA 2DTZA 3IH2A 1B72A 1ZR4A 2XPWA 1HDDC 3FISA 2EZKA 4EEFG 5IYDJ 2G0EA 4A3EJ 1PUFA 1QPIA 3FIWA 4C3IJ 1ETQA 1W0UA 3S1QJ 4GFKA 4D7NA 2IU5A 2DA4A 3ZQHA 4Y52J 2DG7A 2OERA 5IOZA 4D5FA 3JREA 3BNIA 3CWRA 2NS8A 1SGMA 3S17J 1XG1A 1ZR2A 3JRBA 3PASA 5HAWA 1VNDA 2RAEA 3BR0A 2ZOZA 5F08A 4FISA 1TWAJ 2B63J 2AHQA 2ZCXA 3HE0A 3HBLA 4X1EA 3QQAA 5EGOA 2ME6A 5C3EJ 1FTTA 2YU9J 5HODA 3RZOJ 3OSGA 2V57A 3VOKA 3B6AA 3BHQA 5IYBJ 2WB1N 4MXMA 3EGQA 3BTLA 3LSPA 3ZQCA 1B8IB 2R0QC 2UXOA 4IHYA 2WV1A 2G7LA 1IJWC 1NK2P 1JKOC 2DMPA 4C3HJ 2ZB9A 1U8BA 3ZQGA 2ZCNA 3HIMA 4S0HB 2MSYA 3KKDA 3ANGA 2X48A 2QF7A 1IUFA 2LVSA 3GTGJ 3GBGA 3I4NJ 5JLWA 4DYRA 4XRSG 2CRGA 5F27A 3HOVJ 3CDLA 2JMWA 1Y1VJ 4CYCA 4I6ZA 1T33A 4J19A 5C4XJ 3LSJA 1EF4A 2K9SA 3VW2A 1NK3P 5IOYA 3BG3A 5EG0A 2VUMJ 1IRZA 4XRSA 2HDDA 3BTIA 3Q0VA 3TP0A 3PO3J 4MK6A 1ITYA 5E3LA 2G3BA 2LTPA 4LOCA 3FRQA 5JLXA 1WH5A 1DU6A 1IDZA 2DA5A 1GDTA 3RD3A 4L62A 4XIDA 4BY7J 3JRFA 4RBOA 3TP3A 1GV5A 2MGQA 2Y2ZA 1BW6A 1APLC 3GTJJ 1OFCX 4BXXJ 5EFYA 5CXIA 2HKUA 1RETA 5EDNA 4A3LJ 4BBSJ 5C44J 5FHPA 2R92J 3UKGA 3HEFA 5EZGA 3QPSA 1RKWA 2K40A 4QSHA 4A93J 5C4JJ 4IHXA 3COLA 3VUQA 2O7TA 2NVYJ 2H1KA 2CQQA 2H8RA 3FKIJ 1OJLA 2JA5J 1B8IA 2EQRA 2L7ZA 1P7IA 2CJJA 3A01B 1IV6A 3GTLJ 4A3KJ 1ZK8A 5J1YA 1JKPC 3HOZJ 4KWAA 3VPRA 5C4YA 1X2MA 3S2HJ 4L5EA 3HTHA 3NNRA 4YZEA 2MW8A 2DN0A 3S14J 4FE7A 1FEXA 2N8GA 3M3YJ 2RHAA 1P7JA 2CUEA 2E19A 2LD5A 4W1UA 5D1RA 4M3FA 2ZCMA 3KNWA 3VW1A 4UUSB 1AU7A 4M6VA 3BJBA 1RR7A 3LHQA 4JX6A 2JWTA 1WI3A 3ANPA 2F07A 3E7LA 1W0TA 2L0KA 4DZJA 1LE8B 4HKUA 3HB9A 1MBEA 1LFUP 2FBQA 2JA8J 4JKZA 2NVTJ 3T6NA 2W48A 2QCOA 4DZPA 3NPIA 1XS9A 1Q1VA 1MNMC 1YRNB 3FK6A 1D5YA 2M0CA 3KKCA 3F0CA 2HXIA 3BR1A 5FKMA 5K7HA 2NX4A 1UI5A 3AQTA 1K61A 1WH7A 4D7MA 4I76A 3QKXA 1AHDP 3ON2A 4GCTA 3VVXA 2GBYA 2DMNA 2DMTA 3DCFA 2ID3A 2XRLA 2JN6A 4A3CJ 2RASA 2E2JJ 2LK2A 1MBHA 2E2IJ 5FMPA 2NS7A 1ENHA 2XB0X 5E3NA 2DA1A 5F1JA 2R7ZJ 1VFCA 4GCLA 1WPKA 3NAUA 3A01A 2VKEA 2NVXJ 3BTJA 4XICA 1K83J 2YVEA 1TWHJ 4B3AA 5J1RA 3AQSA 1G2HA 3GEUA 4FCYA 1MBGA 3LOCA 1X58A 5EZHA 1DU0A 4A3GJ 1WCMJ 2GM4A 5IPAA 5HBUA 2OF7A 2L9RA 1ZTRA 1MSFC 3SFIA 1FIPA 4A3DJ 4G12A 2CUFA 3HOYJ 5D19A 2W53A 3KZ9A 2KT0A 3Q0WA 4AUXA 2R93J 3VOXA 3LSGA 4UUSA 3G1LA 4JX5A 4BKXA 1A6IA 2FQ4A 2OI8A 1RESA 4W97A 2GUHA 3BT9A 3DPJA 1POGA 4CGRA 1LE8A 1IDYA 2GLOA 2EZIA 3RH2A 4A3MJ 2QWTA 5M5YJ 2COBA 2XGCA 1YRNA 2XGEA 5E3OA 2HOTA 3NXCA 3MVPA 5K7FA 2ELKA 3OIOA 1NTCA 2FD5A 3F1BA 3C07A 1LFBA 3HTJA 2M8GX 1U9OA 1F36A 1IC8A 1HOMA 1O4XA 1Y1WJ 2XSDC 4BBRJ 3IUVA 2ME0A 1GVDA 3JRHA 3GTQJ 1AKHB 3BG9A 1XC5A 3O8GA 3BQYA 3I4MJ 4QTRA 3QPLA 1T56A 2G7SA 3P9TA 2GFNA 2EH3A 3S1MJ 3DEWA 2UXHA 3WHBA 2HYTA 2DA6A 1GUUA 1QVUA 4B4CA 3PPBA 3HOXJ 1JT0A 5HSZA 1QVTA 1WGXA 5DTDA 2HYJA 2LLKA 5FLMJ 4HNVA 1MH3A 5CXGA 4AC0A 4FTHA 3ON4A 4A3BJ 3C2BA 4MLOA 3LNQA 3BQZA 1Z77A 3SJMA 5F0CA 4UUTA 2AO9A 2VKVA 1I3QJ 3IV5A 2HOAA 1HDPA 2FJ1A 4IEJA 5CW8A 2R5ZB 9ANTA 1H8AC 1A5JA 4NN1A 1H89C 3HOWJ 1JGGA 4FE4A 3TW7A 3CJDA 1ETVA 2Y31A 3MN2A 5J3LA 4DYCA 2QIBA 3JR9A 4A3JJ 5FKOA 3CMYA 1I6HJ 4NELA 2O9LA 5D18A 2DA3A 1MBKA 2DJNA 3ZOBA 1JKRC 1RPWA 2QKOA 3IH4A 1S7EA 3D1NI 3S16J 2D6YA 5H9TA 3BCGA 3BTCA 1GT0C 4GCKA 4BY1J 2YVHA 1BJZA 1ETWA 2XGDA 2QTQA 3K7AJ 1AKHA 4MIMA 4MFDA 1U9NA 3HGYA 2M9HA 3HOUJ 3NI7A 4UDSA 3K2AA 1ETKA 3ZQIA 4A69C 3M4OJ 2YUSA 5F0FA 2GENA 3S2DJ 5EF6A 1MH4A 3ZQLA 4MFEA 1BW5A 4ACIA 1TWGJ 3CCYA 2DG8A 3HDDA 3VVYA 1FIAA 4M3EA 3IH3A 2EZHA 1ETXA 3Q3SA 1VF9A 5EYRA 4ICHA 3RKQA 5K58A 3E7QA 1JT6A 2FX0A 3GTMJ 1UMQA 3G7RA 2XPVA 4C2MJ 3GTKJ 5K7ZA 4ME9A 4M3BA 3VW0A 1HLVA 2E1OA 5F04A 1X2NA 3B81A 5FKLA 3NRGA 3HKZN 2R5ZA 2NP5A 3S1RJ 5FLVA 5IP7J 1JJ8C 2JA6J 3HTIA 2YS9A 4GFLA 3B6CA 1QRYA 1ETYA 2NP3A 2ECBA 5F0HA 5EEAA 1HF0A 5BNGA 3JRDA 2WUIA 5DAJA 2R5YB 3HTAA 4QIWN 4NDLA 4DYQA 3G1OA 4A3IJ 1FJLA 2D5VA 2HOSA 2EBIA 2ZOYA 2WAQN 5GP9A 3GTOJ 3S15J 2M2EA 5IP9J 1ORKA 3VVZA 1TC3C 4IHVA 3MNLA 2OPTA 2LFBA 1TWCJ 3SDGA 2Y9ZA 4A3FJ 3JRCA 2CU7A 2JA7J 2DMUA 3NARA 4JNNA 1UI6A 2TRTA 1ETOA 2LKXA 2UXPA 4X6AJ 1JUSA 2HXOA 2Y30A 1MBJA 5DS9A 3JRIA 5AQCA 3FK7A 4XRMA 5FJ8J 3PM1A 4AYBN 4AF5A 1JKQC 2VI6A 5J1UA 3L1PA 4M3DA 4AC6A 4MO7A 3JRAA 4JL3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GFB A;  1UHS A;  2DA7 A;  4B1R A;  1UG2 A;  5GPC A;  2O7O A;  5IP6 A;  2DA2 A;  3JSJ A;  2LR8 A;  2DMQ A;  2I10 A;  3GTP J;  5M5W J;  3S1N J;  2WGB A;  2X9D A;  3A03 A;  1HCR A;  3VP5 A;  2KDZ A;  2IBD A;  2Y9Y A;  3BR5 A;  1B72 B;  2K9Q A;  1E3O C;  2IEK A;  2NOG A;  3BR2 A;  3O60 A;  1I50 J;  1PUF B;  4JYK A;  1OCP A;  2NVQ J;  5FKK A;  4DW6 A;  1BA5 A;  2K9N A;  3VIB A;  3WHC A;  3JRG A;  1F43 A;  2JJ7 A;  1TWF J;  2ECC A;  2HQ5 A;  3TW6 A;  3LWJ A;  2LY9 A;  2XDN A;  2XPU A;  3V6G A;  2R5Y A;  3LJL A;  3A02 A;  3OSF A;  3H0G J;  5M5X J;  1SFO J;  1JTY A;  3O8H A;  1BL0 A;  3TED A;  3BRU A;  1U78 A;  1RKT A;  2EZL A;  1R9T J;  5EGO B;  3G1M A;  3H3V K;  2TCT A;  1CQT A;  2Q24 A;  5M3F J;  3HM5 A;  3V78 A;  3G56 A;  3BR3 A;  2E2H J;  4M3G A;  2REK A;  2PBX A;  2M34 A;  2MG4 A;  4RDU A;  4IHW A;  2PZ9 A;  2VPR A;  3RQI A;  3W6V A;  1JUM A;  3S5R A;  3ZQF A;  3EUP A;  1GV2 A;  4C3J J;  5M3M J;  2X6O A;  4XK4 A;  2L7M P;  3OOU A;  2QOP A;  1IGN A;  2JK3 A;  1Z0X A;  2P81 A;  3CQZ J;  1IG7 A;  2LP0 A;  2UXU A;  1H88 C;  2ID6 A;  2G7G A;  3LSR A;  4V2G A;  4JX4 A;  4ABZ A;  3MKL A;  1JTX A;  2UXI A;  5FKN A;  1ZKG A;  5E3M A;  2CQX A;  3PO2 J;  1MBF A;  2L7F P;  2HI3 A;  2XB5 A;  2IAI A;  4D5C A;  4CYC B;  1JUP A;  3BR6 A;  3Q0U A;  1MSE C;  3GZI A;  5IYC J;  5FGL A;  3HGG A;  3QBM A;  1JJ6 C;  3CRJ A;  1VI0 A;  5EG0 B;  1ZQ3 P;  2PMZ N;  1SAN A;  5GPA A;  1ZGW A;  3BG5 A;  3RZD J;  4Y7N J;  2O8K A;  1OCT C;  1FTZ A;  2Y0S N;  4JP0 A;  4PXI A;  4V2F A;  2DTZ A;  3IH2 A;  1B72 A;  1ZR4 A;  2XPW A;  1HDD C;  3FIS A;  2EZK A;  4EEF G;  5IYD J;  2G0E A;  4A3E J;  1PUF A;  1QPI A;  3FIW A;  4C3I J;  1ETQ A;  1W0U A;  3S1Q J;  4GFK A;  4D7N A;  2IU5 A;  2DA4 A;  3ZQH A;  4Y52 J;  2DG7 A;  2OER A;  5IOZ A;  4D5F A;  3JRE A;  3BNI A;  3CWR A;  2NS8 A;  1SGM A;  3S17 J;  1XG1 A;  1ZR2 A;  3JRB A;  3PAS A;  5HAW A;  1VND A;  2RAE A;  3BR0 A;  2ZOZ A;  5F08 A;  4FIS A;  1TWA J;  2B63 J;  2AHQ A;  2ZCX A;  3HE0 A;  3HBL A;  4X1E A;  3QQA A;  5EGO A;  2ME6 A;  5C3E J;  1FTT A;  2YU9 J;  5HOD A;  3RZO J;  3OSG A;  2V57 A;  3VOK A;  3B6A A;  3BHQ A;  5IYB J;  2WB1 N;  4MXM A;  3EGQ A;  3BTL A;  3LSP A;  3ZQC A;  1B8I B;  2R0Q C;  2UXO A;  4IHY A;  2WV1 A;  2G7L A;  1IJW C;  1NK2 P;  1JKO C;  2DMP A;  4C3H J;  2ZB9 A;  1U8B A;  3ZQG A;  2ZCN A;  3HIM A;  4S0H B;  2MSY A;  3KKD A;  3ANG A;  2X48 A;  2QF7 A;  1IUF A;  2LVS A;  3GTG J;  3GBG A;  3I4N J;  5JLW A;  4DYR A;  4XRS G;  2CRG A;  5F27 A;  3HOV J;  3CDL A;  2JMW A;  1Y1V J;  4CYC A;  4I6Z A;  1T33 A;  4J19 A;  5C4X J;  3LSJ A;  1EF4 A;  2K9S A;  3VW2 A;  1NK3 P;  5IOY A;  3BG3 A;  5EG0 A;  2VUM J;  1IRZ A;  4XRS A;  2HDD A;  3BTI A;  3Q0V A;  3TP0 A;  3PO3 J;  4MK6 A;  1ITY A;  5E3L A;  2G3B A;  2LTP A;  4LOC A;  3FRQ A;  5JLX A;  1WH5 A;  1DU6 A;  1IDZ A;  2DA5 A;  1GDT A;  3RD3 A;  4L62 A;  4XID A;  4BY7 J;  3JRF A;  4RBO A;  3TP3 A;  1GV5 A;  2MGQ A;  2Y2Z A;  1BW6 A;  1APL C;  3GTJ J;  1OFC X;  4BXX J;  5EFY A;  5CXI A;  2HKU A;  1RET A;  5EDN A;  4A3L J;  4BBS J;  5C44 J;  5FHP A;  2R92 J;  3UKG A;  3HEF A;  5EZG A;  3QPS A;  1RKW A;  2K40 A;  4QSH A;  4A93 J;  5C4J J;  4IHX A;  3COL A;  3VUQ A;  2O7T A;  2NVY J;  2H1K A;  2CQQ A;  2H8R A;  3FKI J;  1OJL A;  2JA5 J;  1B8I A;  2EQR A;  2L7Z A;  1P7I A;  2CJJ A;  3A01 B;  1IV6 A;  3GTL J;  4A3K J;  1ZK8 A;  5J1Y A;  1JKP C;  3HOZ J;  4KWA A;  3VPR A;  5C4Y A;  1X2M A;  3S2H J;  4L5E A;  3HTH A;  3NNR A;  4YZE A;  2MW8 A;  2DN0 A;  3S14 J;  4FE7 A;  1FEX A;  2N8G A;  3M3Y J;  2RHA A;  1P7J A;  2CUE A;  2E19 A;  2LD5 A;  4W1U A;  5D1R A;  4M3F A;  2ZCM A;  3KNW A;  3VW1 A;  4UUS B;  1AU7 A;  4M6V A;  3BJB A;  1RR7 A;  3LHQ A;  4JX6 A;  2JWT A;  1WI3 A;  3ANP A;  2F07 A;  3E7L A;  1W0T A;  2L0K A;  4DZJ A;  1LE8 B;  4HKU A;  3HB9 A;  1MBE A;  1LFU P;  2FBQ A;  2JA8 J;  4JKZ A;  2NVT J;  3T6N A;  2W48 A;  2QCO A;  4DZP A;  3NPI A;  1XS9 A;  1Q1V A;  1MNM C;  1YRN B;  3FK6 A;  1D5Y A;  2M0C A;  3KKC A;  3F0C A;  2HXI A;  3BR1 A;  5FKM A;  5K7H A;  2NX4 A;  1UI5 A;  3AQT A;  1K61 A;  1WH7 A;  4D7M A;  4I76 A;  3QKX A;  1AHD P;  3ON2 A;  4GCT A;  3VVX A;  2GBY A;  2DMN A;  2DMT A;  3DCF A;  2ID3 A;  2XRL A;  2JN6 A;  4A3C J;  2RAS A;  2E2J J;  2LK2 A;  1MBH A;  2E2I J;  5FMP A;  2NS7 A;  1ENH A;  2XB0 X;  5E3N A;  2DA1 A;  5F1J A;  2R7Z J;  1VFC A;  4GCL A;  1WPK A;  3NAU A;  3A01 A;  2VKE A;  2NVX J;  3BTJ A;  4XIC A;  1K83 J;  2YVE A;  1TWH J;  4B3A A;  5J1R A;  3AQS A;  1G2H A;  3GEU A;  4FCY A;  1MBG A;  3LOC A;  1X58 A;  5EZH A;  1DU0 A;  4A3G J;  1WCM J;  2GM4 A;  5IPA A;  5HBU A;  2OF7 A;  2L9R A;  1ZTR A;  1MSF C;  3SFI A;  1FIP A;  4A3D J;  4G12 A;  2CUF A;  3HOY J;  5D19 A;  2W53 A;  3KZ9 A;  2KT0 A;  3Q0W A;  4AUX A;  2R93 J;  3VOX A;  3LSG A;  4UUS A;  3G1L A;  4JX5 A;  4BKX A;  1A6I A;  2FQ4 A;  2OI8 A;  1RES A;  4W97 A;  2GUH A;  3BT9 A;  3DPJ A;  1POG A;  4CGR A;  1LE8 A;  1IDY A;  2GLO A;  2EZI A;  3RH2 A;  4A3M J;  2QWT A;  5M5Y J;  2COB A;  2XGC A;  1YRN A;  2XGE A;  5E3O A;  2HOT A;  3NXC A;  3MVP A;  5K7F A;  2ELK A;  3OIO A;  1NTC A;  2FD5 A;  3F1B A;  3C07 A;  1LFB A;  3HTJ A;  2M8G X;  1U9O A;  1F36 A;  1IC8 A;  1HOM A;  1O4X A;  1Y1W J;  2XSD C;  4BBR J;  3IUV A;  2ME0 A;  1GVD A;  3JRH A;  3GTQ J;  1AKH B;  3BG9 A;  1XC5 A;  3O8G A;  3BQY A;  3I4M J;  4QTR A;  3QPL A;  1T56 A;  2G7S A;  3P9T A;  2GFN A;  2EH3 A;  3S1M J;  3DEW A;  2UXH A;  3WHB A;  2HYT A;  2DA6 A;  1GUU A;  1QVU A;  4B4C A;  3PPB A;  3HOX J;  1JT0 A;  5HSZ A;  1QVT A;  1WGX A;  5DTD A;  2HYJ A;  2LLK A;  5FLM J;  4HNV A;  1MH3 A;  5CXG A;  4AC0 A;  4FTH A;  3ON4 A;  4A3B J;  3C2B A;  4MLO A;  3LNQ A;  3BQZ A;  1Z77 A;  3SJM A;  5F0C A;  4UUT A;  2AO9 A;  2VKV A;  1I3Q J;  3IV5 A;  2HOA A;  1HDP A;  2FJ1 A;  4IEJ A;  5CW8 A;  2R5Z B;  9ANT A;  1H8A C;  1A5J A;  4NN1 A;  1H89 C;  3HOW J;  1JGG A;  4FE4 A;  3TW7 A;  3CJD A;  1ETV A;  2Y31 A;  3MN2 A;  5J3L A;  4DYC A;  2QIB A;  3JR9 A;  4A3J J;  5FKO A;  3CMY A;  1I6H J;  4NEL A;  2O9L A;  5D18 A;  2DA3 A;  1MBK A;  2DJN A;  3ZOB A;  1JKR C;  1RPW A;  2QKO A;  3IH4 A;  1S7E A;  3D1N I;  3S16 J;  2D6Y A;  5H9T A;  3BCG A;  3BTC A;  1GT0 C;  4GCK A;  4BY1 J;  2YVH A;  1BJZ A;  1ETW A;  2XGD A;  2QTQ A;  3K7A J;  1AKH A;  4MIM A;  4MFD A;  1U9N A;  3HGY A;  2M9H A;  3HOU J;  3NI7 A;  4UDS A;  3K2A A;  1ETK A;  3ZQI A;  4A69 C;  3M4O J;  2YUS A;  5F0F A;  2GEN A;  3S2D J;  5EF6 A;  1MH4 A;  3ZQL A;  4MFE A;  1BW5 A;  4ACI A;  1TWG J;  3CCY A;  2DG8 A;  3HDD A;  3VVY A;  1FIA A;  4M3E A;  3IH3 A;  2EZH A;  1ETX A;  3Q3S A;  1VF9 A;  5EYR A;  4ICH A;  3RKQ A;  5K58 A;  3E7Q A;  1JT6 A;  2FX0 A;  3GTM J;  1UMQ A;  3G7R A;  2XPV A;  4C2M J;  3GTK J;  5K7Z A;  4ME9 A;  4M3B A;  3VW0 A;  1HLV A;  2E1O A;  5F04 A;  1X2N A;  3B81 A;  5FKL A;  3NRG A;  3HKZ N;  2R5Z A;  2NP5 A;  3S1R J;  5FLV A;  5IP7 J;  1JJ8 C;  2JA6 J;  3HTI A;  2YS9 A;  4GFL A;  3B6C A;  1QRY A;  1ETY A;  2NP3 A;  2ECB A;  5F0H A;  5EEA A;  1HF0 A;  5BNG A;  3JRD A;  2WUI A;  5DAJ A;  2R5Y B;  3HTA A;  4QIW N;  4NDL A;  4DYQ A;  3G1O A;  4A3I J;  1FJL A;  2D5V A;  2HOS A;  2EBI A;  2ZOY A;  2WAQ N;  5GP9 A;  3GTO J;  3S15 J;  2M2E A;  5IP9 J;  1ORK A;  3VVZ A;  1TC3 C;  4IHV A;  3MNL A;  2OPT A;  2LFB A;  1TWC J;  3SDG A;  2Y9Z A;  4A3F J;  3JRC A;  2CU7 A;  2JA7 J;  2DMU A;  3NAR A;  4JNN A;  1UI6 A;  2TRT A;  1ETO A;  2LKX A;  2UXP A;  4X6A J;  1JUS A;  2HXO A;  2Y30 A;  1MBJ A;  5DS9 A;  3JRI A;  5AQC A;  3FK7 A;  4XRM A;  5FJ8 J;  3PM1 A;  4AYB N;  4AF5 A;  1JKQ C;  2VI6 A;  5J1U A;  3L1P A;  4M3D A;  4AC6 A;  4MO7 A;  3JRA A;  4JL3 A; 
#chains in the Genus database with same CATH topology
 1SD4 A;  1OR7 A;  2YVX A;  4G94 A;  2DOE A;  3IWZ A;  3MEX A;  4RB0 A;  2DA7 A;  4B1R A;  2RQQ A;  3DBR B;  2W24 A;  3OYG A;  3F8C A;  3C2G A;  2XHK A;  5FD6 A;  5IP6 A;  5AON A;  1Y6I A;  2I10 A;  3J7Z I;  3GTP J;  1S7O A;  3DBL B;  3S32 A;  1PUE E;  1W7P B;  2VAS A;  2X9D A;  1N25 A;  2IPQ X;  4OMY A;  5IT3 A;  1IRF A;  2K9Q A;  2K27 A;  2IEK A;  4JBA A;  4Y33 A;  1XGM A;  4JYK A;  3LMM A;  3I55 I;  2NVQ J;  1SFK A;  4DGW B;  1Z21 A;  4DW6 A;  3P9C A;  2K9N A;  3VIB A;  3WHC A;  4BAY A;  2JSC A;  2JJ7 A;  1TWF J;  2HQ5 A;  3TW6 A;  3LWJ A;  2XPU A;  4M72 A;  2CFX A;  3J80 K;  2KJC A;  2YSR A;  3A02 A;  4BHB A;  3OSF A;  3H0G J;  2DT5 A;  4BXF A;  3TED A;  3K6G A;  3L09 A;  2B1E A;  1P4X A;  3H3U A;  2E36 A;  1TZL A;  1CQT A;  3U1K A;  5FB2 A;  4NHJ A;  3V78 A;  4D9J A;  2B0L A;  2HNH A;  3G56 A;  1WJE A;  4XQF A;  2DLL A;  1I6X A;  1S29 A;  4FHT A;  3ROU A;  3FZV A;  4PSX A;  3RQI A;  5J8C A;  1JGS A;  1FPQ A;  5LHG A;  1T2K A;  3S5R A;  3NEU A;  1YO5 C;  3GVA A;  3AAF A;  3ZQF A;  5M3M J;  2QOP A;  1P2F A;  2L7M P;  3K70 C;  2DK8 A;  2CV0 A;  1Z0X A;  2P81 A;  3KFW X;  4KN7 X;  2LRE A;  1A04 A;  3DFG A;  3SHF A;  3CD6 I;  1KQ9 A;  1Z7L A;  2M0M A;  1ZKG A;  3PO2 J;  3SXY A;  2JRT A;  1WRJ A;  1GXQ A;  4XOR A;  3W6J B;  2XC7 A;  3CCJ I;  1JUP A;  3Q0U A;  1MSE C;  3GZI A;  3F3X A;  5IYC J;  1U5T B;  2J5P A;  4LB6 B;  3GW2 A;  3QBM A;  5A2Q K;  2GQQ A;  2IT0 A;  1VI0 A;  5EG0 B;  1ZQ3 P;  1K78 B;  2EFP A;  1ZGW A;  2FSW A;  3WTS C;  2KIU A;  4IVN A;  4V2F A;  1B72 A;  1ZR4 A;  1S6L A;  3FIS A;  3I64 A;  1UZC A;  4EEF G;  2LKP A;  1MNE A;  3LFU A;  4FQG A;  2STT A;  1WI9 A;  4F7Z A;  3CLQ A;  1KON A;  2CQ7 A;  1FOY A;  2EA2 A;  3ESW B;  3ZQH A;  2OER A;  3BNI A;  4ENM A;  1QA6 A;  1D3Y A;  1ZR2 A;  5HAW A;  3W6K B;  2O0Y A;  5F08 A;  2AHQ A;  3WGI A;  1I5Z A;  2VQL A;  3Q9V A;  1T6S A;  1FTT A;  1WSU A;  2YU9 J;  3NRV A;  4C30 A;  3RZO J;  2V57 A;  3FXR A;  4A0Y A;  3BHQ A;  3PL8 A;  3FHN A;  1XB4 A;  1RI7 A;  2CW8 A;  2LMD A;  3QP5 A;  1V5F A;  4HNT A;  3RKX A;  2G7L A;  1W1W E;  1IJW C;  2BE5 F;  2HQR A;  1XDS A;  2F5V A;  1U8B A;  3E3V A;  4HDU A;  3HIM A;  3WG7 H;  3IP4 B;  3K4C A;  4GYG A;  2QF7 A;  1IUF A;  3GTG J;  4EJV A;  3GBG A;  5JLW A;  3PIO F;  1D0Z A;  4ASN A;  1ODD A;  3EUH A;  1KU7 A;  3FXM A;  1T08 B;  5C4X J;  3LSJ A;  4EM1 A;  1X4P A;  1P4A A;  1X1A A;  3VW2 A;  2IGM A;  4PCQ A;  3COA C;  1NK3 P;  3TKY A;  1IRZ A;  2HDD A;  3PQJ A;  1NH3 A;  1YX5 A;  2CV1 A;  3KYD B;  2MD5 A;  4ZDP A;  2XKP A;  3CME I;  1Z6T A;  1P6R A;  3CMA I;  1TBX A;  3OL3 A;  3FRQ A;  1WH5 A;  1IDZ A;  2DA5 A;  5FRO A;  4L62 A;  1LVA A;  3TDZ C;  2RNG A;  4KN4 X;  2ZKZ A;  2MGQ A;  3NS4 A;  3KEO A;  1APL C;  3JAM K;  3MKZ A;  3DPT A;  4BQO A;  1W4M A;  5BPI A;  3IWF A;  1EH6 A;  3ZMV A;  2PFB A;  2X1E A;  5EDN A;  3S93 A;  3GXO A;  2R92 J;  3ERM A;  1BOA A;  2VB6 A;  1W7P D;  2E1N A;  4QSH A;  3WTY C;  2CO5 A;  3KE2 A;  2LC2 A;  2W85 A;  3WU1 B;  4IHX A;  3COL A;  3VUQ A;  3GZ5 A;  1HSJ A;  1X1D A;  3LAP A;  2UXN A;  4M9Z A;  2H1K A;  2H8R A;  2V1U A;  4WXH A;  2JA5 J;  1VQ4 I;  4ZYG A;  1IV6 A;  3GFM A;  2IA0 A;  2IW5 A;  4E7L A;  1XDU A;  2VKD A;  3W2W A;  4I99 C;  4HF2 A;  4BJT A;  1L3L A;  3S2H J;  3NNR A;  1R23 A;  4B44 A;  1R4M B;  2DN0 A;  3RTR A;  2V9K A;  1MND A;  4F93 B;  1IZ1 A;  2HPI A;  2FE3 A;  4FX4 A;  4MEY F;  2HDW A;  2HR3 A;  3BRO A;  2NOJ B;  4LG3 A;  2GAU A;  2O03 A;  2G7U A;  2HS5 A;  1UG0 A;  4Q5S F;  3S3M A;  2ZNZ A;  2XIG A;  1WI3 A;  5HVQ C;  2BGC A;  5L3G A;  1LE8 B;  4IKF A;  2L0K A;  1KA8 A;  1T8I A;  5DD8 A;  1YLF A;  2LKS A;  2D45 A;  1MDM A;  2K4B A;  3H92 A;  3MKW B;  1XS9 A;  3T0Y A;  1LKX A;  1R5I D;  4HBL A;  1SMY F;  1YOV B;  3FK6 A;  2UXX A;  1RC9 A;  2MH2 A;  4BEH B;  3ULQ B;  4I76 A;  4J00 A;  2RRE A;  2DMN A;  2XRL A;  1Z3X A;  4EVI A;  1WFX A;  1EV7 A;  1WJD A;  5FMP A;  3F8N A;  1K6Y A;  3L2C A;  2XV4 S;  1NHA A;  1WQ2 A;  1X3U A;  1VFC A;  1X1P A;  3F72 A;  2GOM A;  2NVX J;  4OIQ F;  1K83 J;  5D4R A;  1TWH J;  4D1Q A;  2MH9 A;  2GA2 A;  5J1R A;  2DO7 A;  1SAX A;  2K86 A;  4G6T B;  1X58 A;  1DU0 A;  4A3G J;  1WCM J;  3C7J A;  4B09 A;  1VQ7 I;  2E1M C;  2DXI A;  1QZY A;  4LK0 F;  5HLI A;  5HOO A;  3FM3 A;  1BC8 C;  4J01 A;  4NNJ A;  2KT0 A;  5E1Z B;  2KQR A;  4UUS A;  2QEN A;  4CCM A;  1BIB A;  3CJQ B;  4BH9 A;  4LMY A;  1TTY A;  2MC4 A;  3GO5 A;  4BU2 A;  3ERE D;  3AL0 B;  3DTE A;  5L3E A;  2PMH A;  4P9F A;  2KFD A;  1S5L C;  2GLO A;  4ZTJ A;  1QO0 D;  1XCV A;  2ZO4 A;  4L18 B;  1J0R A;  3NWT A;  1ZN2 A;  3FM5 A;  5CKT A;  2A68 F;  4RB2 C;  2COB A;  2XGC A;  1YRN A;  4RA2 A;  1XPX A;  2KDO A;  5K1Y A;  3F1B A;  5DEQ A;  2VJJ A;  4G9Y A;  4OIO F;  4PJ0 C;  3PNV A;  1D1C A;  4BBR J;  2DCE A;  2Z5U A;  3K70 D;  4I01 A;  3JRH A;  1YW8 A;  1XC5 A;  4PZJ A;  2XSJ C;  4AYB A;  3BQY A;  3V7S A;  3I4M J;  4ZC3 A;  3ZP5 A;  3CJT B;  1Z7U A;  2GFN A;  3WGH A;  2DAO A;  3HYI A;  4DIQ A;  4YFK F;  2UXH A;  4HPQ A;  1FYK A;  4ZYA A;  2W4S A;  4WX9 A;  3I0T A;  4I7H A;  4PGG A;  3HPG A;  1JT0 A;  2GIZ A;  1J5Y A;  1WGX A;  3OOP A;  4O6J A;  5HDN A;  4L9T A;  4BAC A;  1Y56 A;  3CZ6 A;  5DM7 F;  4BQN A;  4UV8 A;  2K9L A;  5CXG A;  3LQR A;  4G7O F;  1VTN C;  2P8T A;  1T98 A;  4LJZ F;  5BMZ A;  1DP7 P;  3PFY A;  3C2B A;  3LNQ A;  5DD4 A;  2O8X A;  3BQZ A;  5D6F A;  2D1H A;  1M1E B;  2V6E A;  4UUT A;  2FUG 2;  2AO9 A;  2BW3 A;  5D5U B;  2NXN B;  2HOA A;  1HDP A;  4IEJ A;  3IC7 A;  2HVQ A;  1Q1H A;  1WJ5 A;  2LH9 A;  1ETV A;  2Y31 A;  5J3L A;  4DYC A;  2L9V A;  1H0M A;  4XMY A;  4Y15 A;  4A3J J;  1HQC A;  3CMY A;  2O9L A;  5D18 A;  2E1M B;  3H1C A;  1JKR C;  2QKO A;  4AIH A;  1ZEL A;  1K6O A;  1S7E A;  2AQE A;  4PFP A;  3D1N I;  4BDY A;  1Y0N A;  4AID A;  3RSN A;  1LEA A;  2XUB A;  3CMM A;  1VQ6 I;  2P4W A;  4CCL A;  5KHD A;  3KZI C;  4DNC A;  1YQA A;  5D8K B;  4HF1 A;  1BJZ A;  1VQL I;  3VDX A;  1JHF A;  4I0A A;  1U9N A;  1BI2 A;  5FLX Z;  1SVM A;  3M4O J;  4MTD A;  3O3K A;  3S2W A;  3LSK A;  3K4K A;  2AS5 F;  3V7C A;  1O57 A;  3S2D J;  1FP2 A;  1TW2 A;  2RN7 A;  2DDA A;  5EF6 A;  1MH4 A;  2BY0 A;  1BW5 A;  4ACI A;  1UHW A;  4OAY A;  5GAH J;  1ZLJ A;  3F22 A;  3CCY A;  2EK5 A;  2HQA A;  2DG8 A;  1Z05 A;  3N97 A;  3EQL F;  2CS3 A;  5DCM B;  1RNL A;  1ETX A;  3Q3S A;  4NC7 A;  4UB6 C;  4ICH A;  3RKQ A;  2QBY B;  4KIS A;  4PGH A;  4BGD A;  3E7Q A;  4CUG A;  4LIT A;  4G7Z F;  5D4S A;  1T0F A;  1W5T A;  2FX0 A;  3H5A A;  2DYR H;  1ON1 A;  2BXZ A;  4M3B A;  3HPH A;  5HLH A;  1K4S A;  2O61 A;  1SAU A;  1X19 A;  3OYF A;  4NQW A;  2UWM A;  2ZCW A;  4YFN F;  3NWS A;  3ZXS A;  2Q2E A;  2NP5 A;  3MZH A;  5FLV A;  4A12 A;  1O7F A;  2FA5 A;  3HTI A;  4GFL A;  1Y39 A;  1ETY A;  2LF8 A;  2R7R A;  4UY8 I;  2NP3 A;  2JZY A;  5EEA A;  3CC4 I;  4XN3 A;  1RUN A;  1SEU A;  2R5Y B;  3G1O A;  5A2Q Z;  3F8F A;  2HOS A;  2LYC A;  3ZPL A;  5GP9 A;  5L3D A;  3GTO J;  2M2E A;  3VB2 A;  1X4O A;  3FXQ A;  4RM3 A;  5AIP A;  2LRD A;  5JI6 A;  3L9F A;  2CWE A;  4A3F J;  2BVL A;  3FXK A;  1HA8 A;  2YU3 A;  5EEG A;  2A6E F;  2LKX A;  4EM0 B;  2WWY A;  4GCV A;  1JUS A;  4ZYH A;  2Y30 A;  3JRI A;  1F5T A;  2OV7 A;  2H09 A;  4Y13 A;  2QZ8 A;  2W00 A;  4M6X A;  3TO6 A;  5FJ8 J;  1FX7 A;  1LEB A;  4JOM A;  4Q47 A;  1JKQ C;  4UUV A;  2OCC H;  2UV1 A;  3DPU A;  2XAF A;  1LFP A;  4MO7 A;  3TGN A;  2FU4 A;  1ZGA A;  1OCO H;  1DGW Y;  1R1V A;  2ISZ A;  4CH7 A;  2QSH X;  4DBR A;  4X0G A;  5TGT A;  2RGV A;  2HVR A;  3JSJ A;  5B66 C;  4KIG A;  5M5W J;  1ZG1 A;  2VKH A;  5K5O A;  1FOX A;  1BBY A;  2ZXI A;  3BY6 A;  3TO7 A;  3TL4 X;  5E8I A;  4I2O A;  3OV8 A;  4MNU A;  1E3O C;  2KZG A;  1V4R A;  2B3W A;  2DOA A;  4JQF A;  1I50 J;  3GFL A;  1W5S A;  2EIJ H;  4EJT A;  3HL2 A;  1U3E M;  3JRG A;  2CSO A;  1F43 A;  3D5R C;  5DDG A;  5LRS A;  1UHM A;  4PJN A;  3KCC A;  1SFO J;  5M5X J;  2IRF G;  3ZGK A;  3RYP A;  4A6E A;  3BRU A;  3A4C A;  2EZL A;  2GZW A;  3BCA A;  5EGO B;  3G1M A;  3K69 A;  1J59 A;  1X3W B;  2L3D A;  4WF2 A;  3L7W A;  1B6A A;  4B48 A;  3BR3 A;  1ZRE A;  3QU6 A;  4G8X A;  3BG7 A;  2QYO A;  2REK A;  2DTR A;  1XMX A;  2PBX A;  3MD2 A;  1PP8 F;  3SQN A;  4CO8 A;  3CCR I;  2WC2 A;  4K2E A;  2R4G A;  4IQJ A;  1FT9 A;  2LY2 A;  3E5Q A;  3HRS A;  3G73 A;  1REP C;  3VEP A;  1GV2 A;  4C3J J;  2X6O A;  3F23 A;  1HKS A;  3M1C A;  1IGN A;  2JK3 A;  3U1D A;  3HRT A;  2UXU A;  3ABM H;  1BIA A;  3OYK A;  1QZZ A;  3HIF A;  3S8P A;  1JTX A;  2RC4 A;  5FKN A;  2CQX A;  2OD5 A;  1MBF A;  2EFW A;  2A6H F;  4KJZ A;  3FXU A;  4CYC B;  3HG9 A;  2PJR A;  2PFV A;  1IN5 A;  5F64 A;  3HGG A;  1SVO A;  3G2B A;  1JJ6 C;  4IOA F;  3GYH X;  1XGN A;  1CF7 A;  5GPA A;  1SAN A;  2KRH A;  2DI3 A;  3PQK A;  4A2U A;  4BQA A;  3RZD J;  2PMU A;  2EFO A;  2O8K A;  4JP0 A;  2IS6 A;  3C2H A;  2GXA A;  3BZK A;  2HOE A;  2EZK A;  1HW5 A;  1A31 A;  1NG6 A;  2DQL A;  1PUF A;  1TNT A;  4C3I J;  1QPI A;  2P5V A;  1ETQ A;  3O2P E;  1HST A;  1LE8 A;  4Y52 J;  2DG7 A;  1QNT A;  3JRE A;  2ESH A;  4KIT B;  1SGM A;  5LEK A;  1VQN I;  3RPU D;  3G3Z A;  3JRB A;  2Y48 A;  1D0Y A;  5LEJ A;  4DQ2 A;  2RAE A;  1V55 H;  3BR0 A;  3EUK L;  2EIN H;  4ZYE A;  3QOP A;  4WCG A;  4X1E A;  5C3E J;  3IRR A;  4BE0 A;  2ADU A;  2ZBK A;  4MTE A;  3SYT A;  1G3Y A;  2M30 A;  3HRU A;  3GFJ A;  3JW4 A;  3K4L A;  3B6A A;  4FAS D;  3AG4 H;  1G3W A;  2ICW G;  5IYB J;  5GAE J;  1C0W A;  2VXZ A;  3BZC A;  3LSP A;  1BM9 A;  2E71 A;  1QPM A;  2V79 A;  2WV1 A;  3AG1 H;  2ZB9 A;  5TRD A;  4S0H B;  2MSY A;  2BBY A;  4HX4 A;  3KPH A;  4HV5 A;  1SFU A;  2CRG A;  1XX5 A;  5HDK A;  1R5H A;  3HOV J;  1DPU A;  3CDL A;  2B7E A;  1X1B A;  2KLO A;  4I6Z A;  3D5S C;  1YJW I;  4ESF A;  5L3B A;  4YEJ A;  4P55 A;  5E1X A;  1T95 A;  4KFC A;  4U7D A;  2F48 A;  3W2V A;  2DOF A;  3TOB A;  5F1R A;  2DU9 A;  3Q5F A;  4M71 A;  4LOC A;  3OYB A;  2W7N A;  2MC3 A;  3FXL A;  2VJ4 A;  3RD3 A;  1H9G A;  3JRF A;  2XVC A;  5D5X B;  1GV5 A;  2G9W A;  2WAE A;  3GTJ J;  4AWX B;  2F5E A;  3SZG A;  4IRV A;  2HKU A;  3HUG A;  4XR6 A;  2I5U A;  4A3L J;  3F9K A;  5FHP A;  5ICE A;  5BPD A;  1MW7 A;  4UHT A;  2EA4 A;  1GLN A;  3CDI A;  5FLX K;  3EYY A;  1QGP A;  4F3Q A;  4KIB A;  3DKW A;  2NVY J;  3DLA A;  3RKW A;  4BQQ A;  4IRG A;  3FKI J;  3PSI A;  4E70 A;  1S8N A;  1OJL A;  3CTA A;  1B8I A;  2CUJ A;  1D8J A;  2RQP A;  2E5Z A;  1YS6 A;  2CMP A;  4A3K J;  3HOZ J;  4KWA A;  3WE3 A;  2DDB A;  1TNS A;  3V8L A;  2R7S A;  3CLO A;  2MW8 A;  4XON A;  1LUJ B;  4LG0 A;  1LPQ A;  4XLN F;  1MKM A;  1P7J A;  2Z3Y A;  3VSK A;  3DU6 A;  4N0B A;  4HYE A;  2E19 A;  2LD5 A;  2JRM A;  4P9U A;  2ZCM A;  4JK1 X;  2BY2 A;  2KIS A;  3GZ6 A;  4DBQ A;  1VQ5 I;  3G71 I;  3LFK A;  3DKY A;  4Q48 A;  2X1C A;  2XAH A;  4MGR A;  4LIU A;  3ANP A;  3B73 A;  3ZRG A;  1EKE A;  2F07 A;  3E7L A;  4DZJ A;  4HKU A;  3HB9 A;  2EV6 A;  2FBQ A;  2NVT J;  3KLN A;  1BR1 A;  4XLP F;  5J47 A;  1XMA A;  1IF1 A;  3E1S A;  2XAS A;  3HSE A;  1D5Y A;  3I59 A;  4HST A;  2F5F A;  3RIR A;  3F0C A;  3D5L A;  2GOX B;  3BR1 A;  4NBQ A;  3FWE A;  5FKM A;  2NX4 A;  4RMN A;  2WY8 Q;  4MEX F;  1UI5 A;  3AQT A;  2PJP A;  1WH7 A;  3VYR B;  3E6M A;  3O6B B;  3QKX A;  2QVO A;  3ON2 A;  4GCT A;  2GBY A;  1LDD A;  2ID3 A;  3V8K A;  4S05 A;  4A3C J;  2IGN A;  1D8K A;  2OZU A;  4BS9 A;  1ZRC A;  2QM3 A;  5JHU A;  3NQO A;  3H9G A;  3MZY A;  1YFH A;  5B1B H;  1ZLK A;  5CYV A;  4WIB A;  2PEX A;  4TV7 A;  1X1C A;  4U87 A;  3K4N A;  3M8J A;  4IZZ A;  3A01 A;  1S7A A;  2KZV A;  3BTJ A;  3DF8 A;  3DWL E;  3CCQ I;  1P9Q C;  1DPR A;  3TBI A;  2PN6 A;  1YE9 A;  1OQY A;  2LBF B;  1MBG A;  1EH8 A;  3LOC A;  5EZH A;  1B1B A;  5FRN A;  2BZT A;  3ABU A;  2FOW A;  2Z33 A;  2H6B A;  2L9R A;  5ERI A;  2L4A A;  5KVR A;  1V5E A;  2W25 A;  2F5C A;  1FIP A;  2CUF A;  5JR3 A;  3HOY J;  3FF5 A;  4CCO A;  3KZ9 A;  3LSI A;  2R7W A;  2YR2 A;  1J2X A;  4IRH A;  3BJA A;  4BKX A;  3OYI A;  1A6I A;  2QQB A;  4ZDL A;  1WZ2 A;  1BI0 A;  2HPM A;  2L7K A;  1OCC H;  1R36 A;  1R5G A;  2GUH A;  3BT9 A;  1POG A;  4DVY P;  2VXD A;  2ISY A;  3WTT C;  3RH2 A;  3EPZ A;  5CVV A;  2QWT A;  1FC3 A;  4RAY A;  5M5Y J;  2FBI A;  1P4W A;  2XGE A;  1IN6 A;  5DYM A;  3K0L A;  3ECH A;  5H6Q A;  5LHI A;  4XSZ F;  5K7F A;  1UAA A;  3AFH A;  3C07 A;  1LFB A;  1OR7 C;  2M8G X;  4QLC U;  3R0A A;  3QYF A;  1IC8 A;  4LB5 A;  2VE8 A;  5HLT A;  1HOM A;  2D1V A;  2XSD C;  4EJO A;  3ZMZ A;  2CW0 F;  3IUV A;  4BHC A;  2DFE A;  2ME0 A;  1AKH B;  4HF0 A;  4QTR A;  4G6Q A;  2EH3 A;  3DP7 A;  4XKC A;  1K7A A;  2VC0 A;  2ZC2 A;  3WU0 A;  1XTA A;  2DA6 A;  3X2Q H;  1R6R A;  2YPR A;  3IKT A;  5HSZ A;  3HOX J;  1CF7 B;  3CUQ A;  4HQE A;  4BNC A;  2ELJ A;  4E6K G;  3DXJ F;  3IUO A;  2F4O B;  5FLM J;  4HNV A;  2KRF A;  4ZDO A;  4P96 A;  2ZME A;  3FMR A;  2V1N A;  1TQI A;  3QAH A;  3ON4 A;  4A3B J;  3AL0 C;  4MLO A;  1Z77 A;  2G7H A;  3ONQ A;  2EV0 A;  2VKV A;  2LNB A;  4RB1 A;  2O6G E;  1HW2 A;  5FRM A;  3J7A O;  4ZZD A;  5CW8 A;  2Y69 H;  2Y75 A;  4RLF A;  5H2F C;  3I53 A;  2R5Z B;  9ANT A;  2IGO A;  4KIC A;  5B1A H;  1H8A C;  1A5J A;  1JGG A;  4FE4 A;  3TW7 A;  2DPD A;  3HXL A;  2QIB A;  3JR9 A;  1FBQ A;  2K02 A;  1I6H J;  1IN4 A;  4NEL A;  3FBI B;  1MBK A;  1LNW A;  1KU9 A;  3L2R A;  1RPW A;  3HRM A;  2V9P A;  4XOT A;  1VQ8 I;  1LVK A;  4BJ6 C;  1RR8 C;  2NNN A;  2HDC A;  3DLL F;  1JXS A;  3J7A Y;  2D6Y A;  2OTL I;  1G3T A;  2UZK A;  4N9H A;  4B47 A;  3BCG A;  1SD6 A;  2MAB A;  3BTC A;  5KNL A;  1IO2 A;  3G6E I;  1E17 A;  4E7Z A;  2CQN A;  2QTQ A;  3K7A J;  1J75 A;  5TJJ A;  1WJF A;  3HGY A;  3RPQ A;  5FFZ A;  4KA4 A;  1J9I A;  4UDS A;  3PSF A;  3ZQI A;  2RDP A;  3WE2 A;  4UV9 A;  3WU2 C;  3P7N A;  2GEN A;  4Y4R A;  4PDK A;  3KYC B;  4BE2 A;  1TWG J;  3CCS I;  1R7J A;  4AM3 A;  3VVY A;  1FIA A;  1IW7 F;  2OUM A;  2JTV A;  1IXR C;  2GXG A;  4XLH A;  2OU2 A;  2GIV A;  3GTM J;  2VOP A;  1J09 A;  2K4J A;  3R61 A;  5K7Z A;  3K1P A;  3FHZ A;  4RGS A;  1HLV A;  1YHQ I;  1FP1 D;  1WJA A;  2E1O A;  1X2N A;  1MMS A;  2PG4 A;  3B81 A;  1WHU A;  2W84 A;  3EDP A;  5IT9 Z;  3H5N A;  1JJ8 C;  3GCM A;  2JA6 J;  3I4P A;  1QRY A;  2W1O A;  2QUF A;  2KRC A;  2ECB A;  4M9X A;  5F0H A;  5BNG A;  5DAJ A;  1FMV A;  1E0E A;  4HQM A;  4DYQ A;  1WKM A;  4A3I J;  3BCB A;  2D5V A;  4HA8 A;  1LQ1 A;  2ZOY A;  2WAQ N;  2JT1 A;  4B43 A;  3E5U A;  5IP9 J;  1TC3 C;  4M6Y A;  2GA1 A;  2ZJP F;  2OPT A;  2LFB A;  3A0B C;  3QYB A;  1ACI A;  1TWC J;  3QOD A;  2Z1D A;  3EUH C;  3JRC A;  4KT5 C;  3ABL H;  2JA7 J;  1VQK I;  2NRA C;  4QWQ A;  3KX2 A;  3HTS B;  5E17 F;  2OTJ I;  5J40 A;  1UI6 A;  2GWR A;  3BOQ A;  2WBM A;  5AQC A;  3OYM A;  3G4S I;  5J4V A;  1OYW A;  3FBN B;  3FK7 A;  3LST A;  1DP3 A;  4O3M A;  1GHC A;  2QA4 I;  4HLX A;  3GLX A;  3KP4 A;  2YX4 A;  4LFU A;  3IAS 2;  4H4K C;  5K5R A;  4B8X A;  3GME A;  1RUO A;  4AC6 A;  3DV8 A;  2MLG A;  3JRA A;  4JL3 A;  4DOZ A;  2OA4 A;  4GFB A;  1UHS A;  2EFN A;  1UG2 A;  3OYJ A;  2P5K A;  3BZ6 A;  4RS8 A;  2PX9 A;  3ZR8 X;  2FBK A;  2LR8 A;  3V42 A;  2WGB A;  2VBZ A;  4YRV A;  1HCR A;  2EIK H;  2KDZ A;  4I0B A;  4AIK A;  2IBD A;  3KEQ A;  2Y9Y A;  2BEO A;  1XCB A;  1BN5 A;  2EV5 A;  3BR5 A;  4U0V A;  1B72 B;  2F4I A;  4HRI A;  1FY7 A;  4MHG A;  3BR2 A;  4I09 A;  3O60 A;  3UNG C;  4XOP A;  5ILU A;  3VTI A;  2H8W A;  4Q4Z F;  2VQG A;  2ZSH B;  3S3N A;  3M8E A;  2ECC A;  3V6G A;  2NNY A;  4XRF A;  5HLG A;  2DT7 B;  2M4G A;  5D5V B;  3KP6 A;  5CLS A;  4WWC A;  1JTY A;  4UNO A;  4ENK A;  3KP5 A;  3CCM I;  1RKT A;  1BI1 A;  2XRN A;  4O5V A;  1R9T J;  1KU2 A;  2LG4 A;  3TO9 A;  1ZAR A;  2TCT A;  3L2V A;  2C6Y A;  1O7L A;  3HM5 A;  2HEO A;  1E2X A;  2QLZ A;  4LLG F;  5BS6 A;  2QQ8 A;  3PNT A;  2E2H J;  4M3G A;  3OR1 C;  4OMZ A;  4OOI A;  1SFE A;  2V26 A;  4NC8 A;  2M34 A;  2OC6 A;  4IHW A;  2PZ9 A;  3QOE A;  4IJA A;  3CO6 C;  1KQ0 A;  1JUM A;  3W6V A;  3VYU B;  1IUY A;  1MGT A;  4FET A;  4ENN A;  4XK4 A;  2LP0 A;  4F91 B;  4HEA 2;  4RLQ A;  5TIS C;  2ID6 A;  4Z6Y A;  1H88 C;  1K79 A;  3LSR A;  2DOD A;  3V4G A;  1GXP A;  2G7G A;  4NUB A;  4JX4 A;  2V7F A;  2UXI A;  5E3M A;  1D5V A;  2W57 A;  4QPQ A;  2XB5 A;  1I3A A;  4D5C A;  3W2A A;  3BR6 A;  2K3F A;  1B9N A;  2CG4 A;  1S3J A;  1I1G A;  1ONV A;  2PMZ N;  2F2E A;  1W7P A;  3BG5 A;  3Q9S A;  4Y7N J;  1LB2 A;  1FTZ A;  2Y0S N;  2MBF A;  3QPT A;  2RKH A;  3IH2 A;  2XPW A;  3ZMS A;  2ZXH A;  5GAD J;  2G0E A;  2RV8 A;  2XKO A;  4A3E J;  3MKY B;  3FIW A;  4KT6 A;  4GFK A;  1W0U A;  4OIP F;  2IU5 A;  1AWC A;  5IOZ A;  4D5F A;  2H6C A;  1ZGJ A;  4HV6 A;  2NS8 A;  1X3Z B;  3S17 J;  5CPR B;  3PAS A;  4XSX F;  3MWM A;  1VND A;  1A6Q A;  3K4J A;  3MZ8 A;  3VWB A;  5E20 A;  2FJI 1;  1FYM A;  2ZOZ A;  3GLL A;  4FIS A;  3PJR A;  2B63 J;  4GO1 A;  1DGR M;  2ZCX A;  3HBL A;  1UB9 A;  3K10 A;  3QQA A;  5ILV A;  3HE0 A;  1TP4 A;  2ME6 A;  2V4J C;  2VT2 A;  2F4M B;  5HOD A;  1K4T A;  2IVM A;  3OSG A;  2FNA A;  4EM2 A;  3KP3 A;  4ON0 A;  3K4B A;  2Z9O A;  1SMT A;  1RZ4 A;  5LGN A;  4IQ4 A;  2M87 A;  3BTL A;  2UXO A;  4MXM A;  4A0X A;  2FML A;  1FMW A;  5ED4 A;  2ZXW H;  1BC7 C;  1JKO C;  4RGX A;  1YW9 A;  2DMP A;  4C3H J;  1LJ9 A;  2JVH A;  3ZQG A;  4WK8 F;  4EGY A;  3KKD A;  3SWH A;  3I9V 2;  2X48 A;  2LVS A;  3T5X A;  3I4N J;  2RNJ A;  4XRS G;  4DYR A;  3KIO A;  3MMY B;  5F27 A;  3CF2 A;  3DEU A;  1Y1V J;  2P7V B;  1T33 A;  2E7X A;  1E3H A;  1EF4 A;  4EQQ A;  2P0W A;  4BYY A;  1U5T A;  4U0Y A;  2DQR A;  5IOY A;  2VQC A;  5EG0 A;  2COM A;  4XRS A;  3BTI A;  1K78 A;  4L0Y B;  4OWR B;  3TP0 A;  4OIN F;  3PO3 J;  4MK6 A;  3P9K A;  1ITY A;  2G3B A;  2LTP A;  2XF5 A;  2A05 A;  2HTS A;  1U2W A;  3IKV A;  5JLX A;  1DU6 A;  1GDT A;  4C9Y A;  2VBX A;  4WXD A;  3VOE A;  4XID A;  1MDM B;  4BY7 J;  2P7C B;  4RBO A;  2STW A;  2Y2Z A;  1BW6 A;  1MZB A;  2EIL H;  2A5W A;  1R71 A;  1OFC X;  4BXX J;  1HBX G;  5EFY A;  2UUZ A;  1U0J A;  5J6X A;  2Z16 A;  1RET A;  2JA2 A;  1P92 A;  1S9H A;  2DT6 A;  2IS4 A;  2L5Q A;  4DJA A;  3HEF A;  5EZG A;  3H3Z A;  2Q8K A;  2KL4 A;  3T8R A;  3OYH A;  3IRQ A;  5E8G A;  3EUA A;  3BDD A;  1MMN A;  4GGG A;  3AKZ A;  2O7T A;  5BQT A;  3IHU A;  3QPH A;  5GAG J;  2PBI A;  5J8F A;  3LSH A;  4PJM A;  3J7Y J;  3CCV I;  2L7Z A;  4EMS A;  1QBJ A;  2FF4 A;  1P7I A;  5L3F A;  4ETS A;  3GTL J;  2ZJR F;  2E35 A;  1ZK8 A;  1JKP C;  2CH0 A;  1U6G A;  3VPR A;  3UR3 C;  2KIM A;  5LRR A;  1FZP B;  1X2M A;  4L5E A;  3HTH A;  4R79 A;  1GVJ A;  5CVI A;  4YZE A;  1KZH A;  3S14 J;  4U9L A;  1FEX A;  4L9N A;  2IGK A;  1FLI A;  3H36 A;  5ICG A;  1HXD A;  2BYV E;  3C18 A;  2CUE A;  2WV0 A;  5KAF C;  4RAF A;  5IT9 K;  5D1R A;  4KDP A;  2RVC A;  4M3F A;  5ILS A;  3VW1 A;  4CSW A;  4UUS B;  4PJJ A;  2IXS A;  2E7W A;  4M6V A;  2XAG A;  3OIQ A;  3PUF A;  4AU7 A;  3LHQ A;  3H9Q A;  2CGP A;  2JWT A;  3H35 A;  3P5J A;  3ABK H;  2QWW A;  1W0T A;  3DTK A;  4NN1 A;  3J81 Z;  1MBE A;  4JKZ A;  3T6N A;  2W48 A;  4LD5 A;  2QCO A;  4DZP A;  3BJO A;  1ZAO A;  1YRN B;  4YIR X;  2L02 A;  3MCZ A;  4XLE A;  1FBS A;  4F55 A;  5HDG A;  4LGW A;  1STZ A;  2HXI A;  1K61 A;  4N9I A;  4D7M A;  2VBW A;  1AHD P;  2R7T A;  2M7B A;  3VVX A;  2DMT A;  1XSD A;  1XN7 A;  4M73 A;  2RAS A;  2JN6 A;  2MFZ A;  4UVA A;  2LK2 A;  1MBH A;  2VON A;  2NS7 A;  5KCM A;  1ENH A;  2QQA A;  4QPO A;  3N05 A;  2DA1 A;  5F1J A;  1YW7 A;  3GFI A;  4M74 A;  4GXO A;  4GCL A;  1WPK A;  3NAU A;  2VKE A;  4XIC A;  2VJI A;  1O3T A;  1ZH5 A;  2BV6 A;  4OAZ A;  5J4Y A;  1Z3Y A;  3LA3 A;  1G2H A;  2X6X A;  3T8T A;  3IAM 2;  1HW1 A;  2GM4 A;  5GTI C;  5HBU A;  2V1X A;  4PSW A;  3CF5 F;  3BLY A;  2OF7 A;  1VQM I;  3SFI A;  4ESJ A;  2MYS A;  3VOX A;  2HTJ A;  5LD2 C;  1WWX A;  2R93 J;  1G4D A;  2BW3 B;  3L2W A;  4JX5 A;  4IHT A;  4E4H A;  2FQ4 A;  1G3S A;  2HVS A;  2OI8 A;  6PAX A;  4W97 A;  5LGT A;  3K1N A;  2FRH A;  1PP7 U;  3ZMU A;  3DPJ A;  3F6V A;  2ZFU A;  3R60 A;  4XLA A;  1IDY A;  2ZNY A;  3GZN B;  4HX8 A;  5H6R A;  2EZI A;  3N4M A;  3KET A;  2M7A A;  4XKB A;  3OYA A;  1B59 A;  3CCE I;  4A3M J;  2WAQ A;  2OCE A;  4G6D A;  4GRI A;  2HGC A;  3OR2 C;  4IPA A;  5E3O A;  2HOT A;  3NXC A;  1KU3 A;  2VOD A;  2WTE A;  3MVP A;  3R6S A;  4S04 A;  4BEH A;  3A1Y A;  3PUB A;  1U9O A;  1BJA A;  5CQE A;  1V54 H;  1O4X A;  2IJL A;  4C2M A;  5B3S H;  2K7L A;  1YIO A;  1GVD A;  1Y8Q B;  1D1A A;  3O8G A;  1T56 A;  2G7S A;  1MIJ A;  5ICC A;  3K8P C;  3LAJ A;  1WJC A;  4AIJ A;  3WHB A;  2GXB A;  1GUU A;  5FGM A;  2KPM A;  4CYD A;  1MD0 A;  2B9S A;  4B4C A;  4B3X A;  2LY1 A;  2HKX A;  2HYF A;  2NAZ A;  1QVT A;  1AA7 A;  3OYE A;  4IHS A;  4KYW A;  3PPB A;  5E18 F;  2LLK A;  1ZRF A;  4BUP A;  4PFO A;  1IRG A;  2FXA A;  3A2K A;  4AC0 A;  2J5O A;  4E7I A;  3BG6 A;  3ABT A;  4FTH A;  2L2O A;  4P5O A;  5H20 A;  3SZT A;  5CVR A;  1FYL A;  2XAQ A;  3GUD A;  2V1D A;  3PFI A;  5F0C A;  2Q0O A;  4ZZL A;  1H9T A;  1I3Q J;  3ZCO A;  3IV5 A;  1Z1D A;  4IF4 A;  4NQW B;  3GX4 X;  2FJ1 A;  1V5G A;  2Q2E B;  2P6S A;  5DV5 A;  1H89 C;  3K1M A;  2X6Y A;  1SC7 A;  3M7G A;  5FKO A;  4XKV A;  2DA3 A;  3U2R A;  1HC8 A;  4RAZ A;  2DJN A;  3PNY A;  3CDH A;  3IH4 A;  1FSH A;  5L3C A;  5B5E C;  4II3 A;  2OBP A;  1O3R A;  2E60 A;  1IRX A;  3S16 J;  1YS7 A;  2F6C A;  2Z99 A;  4U7B A;  2M3A A;  5CJ9 A;  4XBF A;  4IXA A;  2YX7 A;  2AXT C;  3JTG A;  1GT0 C;  1SD7 A;  2HWV A;  4GCK A;  2YVH A;  2WY7 Q;  4MQ9 F;  2E1C A;  4MIM A;  1XGS A;  2QEX I;  4XN0 A;  3E6D A;  4MFD A;  2M9H A;  3NI7 A;  1UCR A;  5EJC A;  1ETK A;  3HHH A;  2R7X A;  3LWF A;  4HSR A;  4CA0 A;  3BC8 A;  4MFE A;  5AIQ A;  3HDD A;  2WAD A;  5D8L B;  4CZC A;  3HTU A;  1EA3 A;  4BL0 B;  2ZJQ F;  3DBH B;  2PMZ A;  2DFF A;  4BXU A;  5K58 A;  1JT6 A;  2LOO A;  1R1T A;  3B02 A;  3G7R A;  2XPV A;  4LLN A;  4C2M J;  2Y0S A;  4OD4 A;  4ME9 A;  2O3F A;  3KZY A;  4U88 A;  3I54 A;  2ZSI B;  3HKZ N;  1E3P A;  3L00 A;  1R58 A;  3S1R J;  3OYC A;  3WOD F;  3KEY A;  3AG2 H;  2WUI A;  1N75 A;  1MJB A;  1B9M A;  2VBY A;  2FQ3 A;  2LF7 A;  5DCF A;  2CQK A;  3SEZ A;  1ZG5 A;  3TOA A;  1A36 A;  4PK4 A;  1FJL A;  1YG2 A;  2AXL A;  1Z67 A;  2FMY A;  4HW0 A;  2EBI A;  3S15 J;  1IV8 A;  4P1W A;  4IHV A;  3K2Z A;  3C3W A;  3FKJ A;  3EYI A;  1UFM A;  2H1L A;  2HU9 A;  2QKM B;  2Y9Z A;  2EPF A;  2CU7 A;  2TRT A;  2WAF A;  2D2W A;  1O3S A;  4N4O B;  4X6A J;  5ICF A;  2UXP A;  2HXO A;  5DS9 A;  1BOB A;  4FX0 A;  2VL8 A;  3SDB A;  3WTV C;  3BWG A;  4XRM A;  5JVG F;  2OJE D;  3C1D A;  4WXC A;  3CCL I;  2QQ9 A;  4C2U A;  3L1P A;  2K5C A;  2ZFW A;  2FOK A;  3E6B A;  4ZH4 F;  2BVM A;  3OY9 A;  5GTH C;  1QHG A;  5DCM A;  3KP7 A;  3GWZ A;  3RPU A;  5GPC A;  1LDJ A;  2PJR B;  2O7O A;  1RIO H;  2QBY A;  3CES A;  1DDN A;  3M9A A;  2DA2 A;  2KMU A;  2R7O A;  4ZTF A;  2DMQ A;  4EV0 A;  2X85 A;  2CFO A;  3E97 A;  3S1N J;  3A03 A;  3VP5 A;  3J81 K;  1HKT A;  5KAI C;  1TT5 B;  4HZF A;  2F5D A;  2X51 A;  1XSV A;  2KIF A;  4BDZ A;  4HNU A;  1D1B A;  4AVP A;  2PQ8 A;  2NOG A;  1PUF B;  1JI8 A;  4RGU A;  4KMU X;  1OCP A;  3V8J A;  5FKK A;  1R00 A;  1BA5 A;  2H27 A;  4RAG A;  1VQP I;  3OYN A;  2OQG A;  2VC1 A;  3HSF A;  1TLH B;  1YJ9 I;  2LY9 A;  2XDN A;  1QHH D;  2R5Y A;  3LJL A;  5CVU A;  4BHP A;  2QKL B;  1O3Q A;  3I58 A;  5E1W A;  3O8H A;  1BL0 A;  1D0X A;  3JCU C;  3P9I A;  5HS9 A;  1U78 A;  2HFH A;  5KK1 A;  3H3V K;  4YG2 F;  4CDG A;  1Z91 A;  2Q24 A;  3F8M A;  5M3F J;  1XGO A;  3F21 A;  1Z6R A;  4U9N A;  1PVE A;  3RYR A;  2VN2 A;  1FOK A;  1PJR A;  2MG4 A;  1Y0U A;  1YIT I;  2KIQ A;  4RDU A;  2VPR A;  3WG9 A;  2M4K A;  2A2F X;  3M1E A;  4CIC A;  3OYL A;  3EUP A;  5HS8 A;  2K9M A;  3OOU A;  4XLF A;  2BHY A;  1I1S A;  3CQZ J;  1IG7 A;  2IS2 A;  4GDF A;  4IOC F;  1G6N A;  4V2G A;  4F92 B;  5LLQ A;  4ABZ A;  3MKL A;  3CP2 A;  2P5L C;  2XAJ A;  3DU5 A;  2HQN A;  2BHZ A;  2QSF X;  1WVR A;  2AQF A;  2L7F P;  2HI3 A;  1XSX A;  2IAI A;  4RGR A;  4R8H A;  2XF7 A;  1BR2 A;  3E0J B;  5FGL A;  1A35 A;  1YIJ I;  3CRJ A;  4XM3 A;  1KQ8 A;  4XLC A;  1W36 D;  2KHM A;  5IY5 H;  3E5X A;  1T39 A;  1AOY A;  1IAW A;  2VT3 A;  1S72 I;  1OCT C;  3VFZ A;  4HX7 A;  4PXI A;  2DTZ A;  2LDU A;  3RI4 A;  3K4M A;  3OS2 A;  1HDD C;  2A07 F;  5IYD J;  2DPU A;  3VYS B;  1BR4 A;  2CV2 A;  2K3P A;  3K9T A;  3OMY A;  2BY3 A;  3CJR B;  3D0S A;  3HZJ A;  3V7R A;  4D7N A;  3S1Q J;  2DA4 A;  4YII A;  3CWR A;  5FO5 A;  4CXF A;  3DKX A;  1XG1 A;  1OIS A;  2IP2 A;  4M9S A;  3FXO A;  3HUG B;  4BJ5 C;  2ETH A;  2L9S A;  3IL2 A;  1TWA J;  3CC7 I;  3BP8 A;  5EGO A;  4IO9 F;  5JVT A;  1V3F A;  2X0L A;  2DK5 A;  3ZN1 A;  1DQU A;  2JPC A;  1ZRD A;  2EIM H;  2ZXJ A;  3VOK A;  4Y17 A;  5F6F A;  2Z2S B;  3HJE A;  3QYE A;  2E34 A;  4I02 A;  2WB1 N;  2VIX A;  3F6O A;  1ON2 A;  3ZQC A;  1B8I B;  3EGQ A;  2R0Q C;  4IHY A;  4H0E A;  2OAZ A;  5FFX A;  2EWN A;  1NK2 P;  4L9V A;  1Z9C A;  1TT0 A;  1Y8R B;  2ZCN A;  1FSE A;  2IA1 A;  3ANG A;  3VYT B;  3L2Q A;  1J7K A;  1NG7 A;  3M07 A;  1U8R A;  2DFI A;  1TW3 A;  3QWL A;  4LG0 B;  3GF2 A;  2JMW A;  1R22 A;  3ZQQ A;  4CYC A;  2BY1 A;  3L2U A;  4J19 A;  4HLY A;  2FEZ A;  2DFH A;  2X6W A;  2K9S A;  4C2T A;  2XF6 A;  3BG3 A;  1YJN I;  2VUM J;  1QU3 A;  3ECO A;  3KYL A;  3Q0V A;  3WGG A;  4CGZ A;  2V9V A;  3H0D A;  1R4N B;  4AVZ A;  5E3L A;  2W82 A;  1G8X A;  2FNP A;  1HKQ A;  2JUG A;  4D0P A;  2VQH A;  3TP3 A;  2LSO A;  2BOL A;  3ZMD A;  2VPL A;  3I3L A;  2VJ5 A;  3I59 B;  3I56 I;  5CXI A;  2OQR A;  3FMS A;  2R7V A;  2EFQ A;  2ZY9 A;  4BBS J;  5C44 J;  3CUQ C;  3UKG A;  3OL4 A;  1TL8 A;  3QPS A;  2FBH A;  3OWT A;  1RKW A;  2K40 A;  4A93 J;  4L9J A;  3LA2 A;  5BOX A;  2EJR A;  3H9J A;  5C4J J;  3BPV A;  2ZME C;  2A3S A;  3EET A;  2CQQ A;  3BJ6 A;  3KZZ A;  4L5J A;  2L54 A;  3R4K A;  2HZD A;  2EQR A;  3VSL A;  3LA7 A;  2CJJ A;  3A01 B;  1N77 A;  2KP6 A;  2R7F A;  3RKY A;  1TQP A;  1XMK A;  5J1Y A;  4L5I A;  1RRJ A;  5D6E A;  2PLY A;  5C4Y A;  4OU0 A;  2L4M A;  5DUK A;  4OIR F;  5LFA A;  2L01 A;  2PI0 A;  4FE7 A;  2A69 F;  2N8G A;  4EAT A;  3M3Y J;  2RHA A;  4CHU A;  3VOD A;  3BPX A;  2KKO A;  4W1U A;  2BXY A;  4E7H A;  3FX3 A;  1MJ9 A;  4II2 A;  3KNW A;  1IXS B;  4XL9 A;  1AU7 A;  5CVJ A;  3BJB A;  1RR7 A;  4JX6 A;  1OPC A;  4OD5 A;  1I39 A;  1YYV A;  3CJN A;  2VLA A;  1LFU P;  3U21 A;  2JA8 J;  3SEQ A;  2A6T A;  4NC6 A;  3REO A;  3NPI A;  1Q1V A;  1MNM C;  2K85 A;  3HHG A;  3KKC A;  1JHH A;  2M0C A;  2XRO A;  3TQN A;  2ESN A;  3HOS A;  2JSP A;  5K7H A;  1OMI A;  2V6C A;  3OIP A;  3OS0 A;  1MMD A;  3J80 Z;  4YEL A;  4AD9 A;  3DCF A;  3SFZ A;  5CQG A;  2OZ6 A;  4IL6 C;  3TDU C;  2E2J J;  2E2I J;  1KGS A;  2XB0 X;  3ASO H;  2XDV A;  5E3N A;  3LQQ A;  2WA0 A;  3DTI A;  2R7Z J;  2M5W A;  4UB8 C;  5LGU A;  2QSG X;  4A5N A;  4N4N B;  1UJ8 A;  5D5W B;  2YVE A;  4B3A A;  4NB5 A;  1W5C C;  3CUQ B;  3WTW C;  3AQS A;  3GEU A;  2DBB A;  4FCY A;  3ELK A;  3MFK A;  2MA3 A;  3FXJ A;  2JPB A;  5IPA A;  4XNF A;  5LHH A;  4ANJ A;  4EJW A;  2ZME B;  1MMG A;  1ZTR A;  1MSF C;  5FD5 A;  4EGZ A;  4A3D J;  4UXN A;  4G12 A;  1OYI A;  2M1B A;  1VQ9 I;  2W53 A;  5D19 A;  3Q0W A;  4AUX A;  1ZYR F;  2XGX A;  3LSG A;  3HKZ A;  3G1L A;  4Z2Y A;  4XKW A;  1IN7 A;  2E5N A;  1RES A;  4CCK A;  1FOW A;  3HSR A;  5K5Q A;  2M45 A;  1N78 A;  2H94 A;  3QU3 A;  4CGR A;  4E7S A;  1VZ0 A;  4UVC A;  3E6C C;  1SD5 A;  4FT8 A;  1DUX C;  3WTX C;  1JE8 A;  2VOO A;  1UEL B;  1OCR H;  1USS A;  2ELK A;  2IS1 A;  4BE1 A;  1FWZ A;  3H5R A;  3OIO A;  1NTC A;  2DW4 A;  1T38 A;  1KYZ A;  2FD5 A;  2R3S A;  2Q1Z B;  3HTJ A;  3AG3 H;  1OCZ H;  1F36 A;  1Y1W J;  3ZN0 A;  1SFX A;  4ZJZ A;  3KLO A;  3WTZ A;  1MMA A;  1R49 A;  3GTQ J;  3BG9 A;  4E7J A;  1OLT A;  2CYY A;  3OS1 A;  3RCO A;  3QPL A;  1OYY A;  3P9T A;  1ZG3 A;  5JFR A;  3S1M J;  4IX7 A;  3CO7 C;  1FBU A;  4CCN A;  3U9G A;  3DEW A;  2NYX A;  5LBQ A;  2HYT A;  1XD7 A;  3PIP F;  1QVU A;  3LL7 A;  3GEZ A;  4EJU A;  3F8B A;  5DTD A;  4MQV A;  2LBF A;  2HYJ A;  2HZT A;  3MAJ A;  2TDX A;  1MH3 A;  2NVU B;  3HOT A;  2DYS H;  1G59 A;  4I98 B;  1UST A;  1R1U A;  3S3O A;  1KYW A;  5DUI A;  1BI3 A;  3ZMT A;  4PJL A;  3SJM A;  5HNF A;  4HG2 A;  3JTH A;  1OKR A;  4RB3 C;  2ACJ A;  4KUM A;  4KNY A;  3FDY A;  4ENJ A;  1ULY A;  2A61 A;  3HOW J;  3CJD A;  5EEH A;  3KP2 A;  3MN2 A;  3SZP A;  2X4H A;  1F1Z A;  3JSO A;  4F52 A;  3QP6 A;  3ZOB A;  1YTY A;  2CW7 A;  2R7Q A;  5HNH A;  4R1H A;  4ESB A;  4E7K A;  4V19 K;  3A0H C;  4A5M A;  3RJP A;  3ML6 A;  3JAM Z;  2JVG A;  1LDK B;  2QGU A;  5H9T A;  2JQ7 A;  3CUO A;  4CCJ A;  2L9N A;  4BY1 J;  4PUS A;  4LIV A;  1ETW A;  2XGD A;  1AKH A;  2JUC A;  2O5R A;  3HOU J;  2IA2 A;  2MD0 A;  3K2A A;  1TQM A;  4A69 C;  1I27 A;  2YUS A;  3FMQ A;  5F0F A;  3QRF F;  5HS7 A;  3ZQL A;  2X1D A;  1T0F C;  4LK1 F;  2KJB A;  3DQV C;  2ZJ2 A;  4M3E A;  2VE9 A;  3IH3 A;  2CUZ A;  4U0W A;  1ERD A;  2EZH A;  3WTU C;  2MLK A;  1VF9 A;  4KIF A;  5EYR A;  3JSP A;  3M8F A;  3ISP A;  4A6D A;  3RQ4 A;  1UMQ A;  1QZE A;  5DM6 F;  3GTK J;  4UVB A;  1YI2 I;  1EH7 A;  3T1B A;  4IRI A;  2Y0M A;  3LSM A;  3VW0 A;  3HC7 A;  3TMO A;  1L0O C;  5F04 A;  3CP8 A;  5FKL A;  1F9N A;  4ZYD A;  3NRG A;  2EB7 A;  2XAU A;  2R5Z A;  5IP7 J;  2YS9 A;  3W3C A;  1CGP A;  3RDI A;  1EJ9 A;  3B6C A;  1VQO I;  3ZQ7 A;  3ASN H;  5JHF A;  3I71 A;  1HF0 A;  3JRD A;  4L0Z B;  3HTA A;  4YIF A;  2I8D A;  4QIW N;  4NDL A;  4GYI A;  4Y3O A;  3OYD A;  3CC2 I;  1IN8 A;  1MJA A;  3R0J A;  2HYG D;  3DPL C;  3CCU I;  1W36 C;  1ORK A;  4A0Z A;  3VVZ A;  1SVL A;  2P6T A;  2NS0 A;  3MNL A;  4CZZ A;  1YX3 A;  3SDG A;  4HDV A;  2WB1 A;  4HAM A;  4ITV A;  2DJI A;  1FNN A;  2DMU A;  3NAR A;  4YFX F;  4JNN A;  2A5Y B;  1B4A A;  1U5T C;  1ETO A;  3DEE A;  1PDN C;  5E79 C;  1F4K A;  1ZHF A;  1MBJ A;  1PYV A;  2R7U A;  3I5U A;  1IXC A;  1QQI A;  2ELH A;  2R7D A;  3PM1 A;  4HOB A;  4RM2 A;  4G7H F;  4AYB N;  4AF5 A;  4LLL A;  2VI6 A;  2HKO A;  5J1U A;  3MQ0 A;  4KMF A;  4M3D A;  1WJB A;  2M8E A; 
#chains in the Genus database with same CATH homology
 4GFB A;  1UHS A;  2DA7 A;  4B1R A;  1UG2 A;  5GPC A;  2O7O A;  5IP6 A;  2DA2 A;  3JSJ A;  2LR8 A;  2DMQ A;  2I10 A;  3GTP J;  5M5W J;  3S1N J;  2WGB A;  2X9D A;  3A03 A;  1HCR A;  3VP5 A;  2KDZ A;  2IBD A;  2Y9Y A;  3BR5 A;  1B72 B;  2K9Q A;  1E3O C;  2IEK A;  2NOG A;  3BR2 A;  3O60 A;  1I50 J;  1PUF B;  4JYK A;  1OCP A;  2NVQ J;  5FKK A;  4DW6 A;  1BA5 A;  2K9N A;  3VIB A;  3WHC A;  3JRG A;  1F43 A;  2JJ7 A;  1TWF J;  2ECC A;  2HQ5 A;  3TW6 A;  3LWJ A;  2LY9 A;  2XDN A;  2XPU A;  3V6G A;  2R5Y A;  3LJL A;  3A02 A;  3OSF A;  3H0G J;  5M5X J;  1SFO J;  1JTY A;  3O8H A;  1BL0 A;  3TED A;  3BRU A;  1U78 A;  1RKT A;  2EZL A;  1R9T J;  5EGO B;  3G1M A;  3H3V K;  2TCT A;  1CQT A;  2Q24 A;  5M3F J;  3HM5 A;  3V78 A;  3G56 A;  3BR3 A;  2E2H J;  4M3G A;  2REK A;  2PBX A;  2M34 A;  2MG4 A;  4RDU A;  4IHW A;  2PZ9 A;  2VPR A;  3RQI A;  3W6V A;  1JUM A;  3S5R A;  3ZQF A;  3EUP A;  1GV2 A;  4C3J J;  5M3M J;  2X6O A;  4XK4 A;  2L7M P;  3OOU A;  2QOP A;  1IGN A;  2JK3 A;  1Z0X A;  2P81 A;  3CQZ J;  1IG7 A;  2LP0 A;  2UXU A;  1H88 C;  2ID6 A;  2G7G A;  3LSR A;  4V2G A;  4JX4 A;  4ABZ A;  3MKL A;  1JTX A;  2UXI A;  5FKN A;  1ZKG A;  5E3M A;  2CQX A;  3PO2 J;  1MBF A;  2L7F P;  2HI3 A;  2XB5 A;  2IAI A;  4D5C A;  4CYC B;  1JUP A;  3BR6 A;  3Q0U A;  1MSE C;  3GZI A;  5IYC J;  5FGL A;  3HGG A;  3QBM A;  1JJ6 C;  3CRJ A;  1VI0 A;  5EG0 B;  1ZQ3 P;  2PMZ N;  1SAN A;  5GPA A;  1ZGW A;  3BG5 A;  3RZD J;  4Y7N J;  2O8K A;  1OCT C;  1FTZ A;  2Y0S N;  4JP0 A;  4PXI A;  4V2F A;  2DTZ A;  3IH2 A;  1B72 A;  1ZR4 A;  2XPW A;  1HDD C;  3FIS A;  2EZK A;  4EEF G;  5IYD J;  2G0E A;  4A3E J;  1PUF A;  1QPI A;  3FIW A;  4C3I J;  1ETQ A;  1W0U A;  3S1Q J;  4GFK A;  4D7N A;  2IU5 A;  2DA4 A;  3ZQH A;  4Y52 J;  2DG7 A;  2OER A;  5IOZ A;  4D5F A;  3JRE A;  3BNI A;  3CWR A;  2NS8 A;  1SGM A;  3S17 J;  1XG1 A;  1ZR2 A;  3JRB A;  3PAS A;  5HAW A;  1VND A;  2RAE A;  3BR0 A;  2ZOZ A;  5F08 A;  4FIS A;  1TWA J;  2B63 J;  2AHQ A;  2ZCX A;  3HE0 A;  3HBL A;  4X1E A;  3QQA A;  5EGO A;  2ME6 A;  5C3E J;  1FTT A;  2YU9 J;  5HOD A;  3RZO J;  3OSG A;  2V57 A;  3VOK A;  3B6A A;  3BHQ A;  5IYB J;  2WB1 N;  4MXM A;  3EGQ A;  3BTL A;  3LSP A;  3ZQC A;  1B8I B;  2R0Q C;  2UXO A;  4IHY A;  2WV1 A;  2G7L A;  1IJW C;  1NK2 P;  1JKO C;  2DMP A;  4C3H J;  2ZB9 A;  1U8B A;  3ZQG A;  2ZCN A;  3HIM A;  4S0H B;  2MSY A;  3KKD A;  3ANG A;  2X48 A;  2QF7 A;  1IUF A;  2LVS A;  3GTG J;  3GBG A;  3I4N J;  5JLW A;  4DYR A;  4XRS G;  2CRG A;  5F27 A;  3HOV J;  3CDL A;  2JMW A;  1Y1V J;  4CYC A;  4I6Z A;  1T33 A;  4J19 A;  5C4X J;  3LSJ A;  1EF4 A;  2K9S A;  3VW2 A;  1NK3 P;  5IOY A;  3BG3 A;  5EG0 A;  2VUM J;  1IRZ A;  4XRS A;  2HDD A;  3BTI A;  3Q0V A;  3TP0 A;  3PO3 J;  4MK6 A;  1ITY A;  5E3L A;  2G3B A;  2LTP A;  4LOC A;  3FRQ A;  5JLX A;  1WH5 A;  1DU6 A;  1IDZ A;  2DA5 A;  1GDT A;  3RD3 A;  4L62 A;  4XID A;  4BY7 J;  3JRF A;  4RBO A;  3TP3 A;  1GV5 A;  2MGQ A;  2Y2Z A;  1BW6 A;  1APL C;  3GTJ J;  1OFC X;  4BXX J;  5EFY A;  5CXI A;  2HKU A;  1RET A;  5EDN A;  4A3L J;  4BBS J;  5C44 J;  5FHP A;  2R92 J;  3UKG A;  3HEF A;  5EZG A;  3QPS A;  1RKW A;  2K40 A;  4QSH A;  4A93 J;  5C4J J;  4IHX A;  3COL A;  3VUQ A;  2O7T A;  2NVY J;  2H1K A;  2CQQ A;  2H8R A;  3FKI J;  1OJL A;  2JA5 J;  1B8I A;  2EQR A;  2L7Z A;  1P7I A;  2CJJ A;  3A01 B;  1IV6 A;  3GTL J;  4A3K J;  1ZK8 A;  5J1Y A;  1JKP C;  3HOZ J;  4KWA A;  3VPR A;  5C4Y A;  1X2M A;  3S2H J;  4L5E A;  3HTH A;  3NNR A;  4YZE A;  2MW8 A;  2DN0 A;  3S14 J;  4FE7 A;  1FEX A;  2N8G A;  3M3Y J;  2RHA A;  1P7J A;  2CUE A;  2E19 A;  2LD5 A;  4W1U A;  5D1R A;  4M3F A;  2ZCM A;  3KNW A;  3VW1 A;  4UUS B;  1AU7 A;  4M6V A;  3BJB A;  1RR7 A;  3LHQ A;  4JX6 A;  2JWT A;  1WI3 A;  3ANP A;  2F07 A;  3E7L A;  1W0T A;  2L0K A;  4DZJ A;  1LE8 B;  4HKU A;  3HB9 A;  1MBE A;  1LFU P;  2FBQ A;  2JA8 J;  4JKZ A;  2NVT J;  3T6N A;  2W48 A;  2QCO A;  4DZP A;  3NPI A;  1XS9 A;  1Q1V A;  1MNM C;  1YRN B;  3FK6 A;  1D5Y A;  2M0C A;  3KKC A;  3F0C A;  2HXI A;  3BR1 A;  5FKM A;  5K7H A;  2NX4 A;  1UI5 A;  3AQT A;  1K61 A;  1WH7 A;  4D7M A;  4I76 A;  3QKX A;  1AHD P;  3ON2 A;  4GCT A;  3VVX A;  2GBY A;  2DMN A;  2DMT A;  3DCF A;  2ID3 A;  2XRL A;  2JN6 A;  4A3C J;  2RAS A;  2E2J J;  2LK2 A;  1MBH A;  2E2I J;  5FMP A;  2NS7 A;  1ENH A;  2XB0 X;  5E3N A;  2DA1 A;  5F1J A;  2R7Z J;  1VFC A;  4GCL A;  1WPK A;  3NAU A;  3A01 A;  2VKE A;  2NVX J;  3BTJ A;  4XIC A;  1K83 J;  2YVE A;  1TWH J;  4B3A A;  5J1R A;  3AQS A;  1G2H A;  3GEU A;  4FCY A;  1MBG A;  3LOC A;  1X58 A;  5EZH A;  1DU0 A;  4A3G J;  1WCM J;  2GM4 A;  5IPA A;  5HBU A;  2OF7 A;  2L9R A;  1ZTR A;  1MSF C;  3SFI A;  1FIP A;  4A3D J;  4G12 A;  2CUF A;  3HOY J;  5D19 A;  2W53 A;  3KZ9 A;  2KT0 A;  3Q0W A;  4AUX A;  2R93 J;  3VOX A;  3LSG A;  4UUS A;  3G1L A;  4JX5 A;  4BKX A;  1A6I A;  2FQ4 A;  2OI8 A;  1RES A;  4W97 A;  2GUH A;  3BT9 A;  3DPJ A;  1POG A;  4CGR A;  1LE8 A;  1IDY A;  2GLO A;  2EZI A;  3RH2 A;  4A3M J;  2QWT A;  5M5Y J;  2COB A;  2XGC A;  1YRN A;  2XGE A;  5E3O A;  2HOT A;  3NXC A;  3MVP A;  5K7F A;  2ELK A;  3OIO A;  1NTC A;  2FD5 A;  3F1B A;  3C07 A;  1LFB A;  3HTJ A;  2M8G X;  1U9O A;  1F36 A;  1IC8 A;  1HOM A;  1O4X A;  1Y1W J;  2XSD C;  4BBR J;  3IUV A;  2ME0 A;  1GVD A;  3JRH A;  3GTQ J;  1AKH B;  3BG9 A;  1XC5 A;  3O8G A;  3BQY A;  3I4M J;  4QTR A;  3QPL A;  1T56 A;  2G7S A;  3P9T A;  2GFN A;  2EH3 A;  3S1M J;  3DEW A;  2UXH A;  3WHB A;  2HYT A;  2DA6 A;  1GUU A;  1QVU A;  4B4C A;  3PPB A;  3HOX J;  1JT0 A;  5HSZ A;  1QVT A;  1WGX A;  5DTD A;  2HYJ A;  2LLK A;  5FLM J;  4HNV A;  1MH3 A;  5CXG A;  4AC0 A;  4FTH A;  3ON4 A;  4A3B J;  3C2B A;  4MLO A;  3LNQ A;  3BQZ A;  1Z77 A;  3SJM A;  5F0C A;  4UUT A;  2AO9 A;  2VKV A;  1I3Q J;  3IV5 A;  2HOA A;  1HDP A;  2FJ1 A;  4IEJ A;  5CW8 A;  2R5Z B;  9ANT A;  1H8A C;  1A5J A;  4NN1 A;  1H89 C;  3HOW J;  1JGG A;  4FE4 A;  3TW7 A;  3CJD A;  1ETV A;  2Y31 A;  3MN2 A;  5J3L A;  4DYC A;  2QIB A;  3JR9 A;  4A3J J;  5FKO A;  3CMY A;  1I6H J;  4NEL A;  2O9L A;  5D18 A;  2DA3 A;  1MBK A;  2DJN A;  3ZOB A;  1JKR C;  1RPW A;  2QKO A;  3IH4 A;  1S7E A;  3D1N I;  3S16 J;  2D6Y A;  5H9T A;  3BCG A;  3BTC A;  1GT0 C;  4GCK A;  4BY1 J;  2YVH A;  1BJZ A;  1ETW A;  2XGD A;  2QTQ A;  3K7A J;  1AKH A;  4MIM A;  4MFD A;  1U9N A;  3HGY A;  2M9H A;  3HOU J;  3NI7 A;  4UDS A;  3K2A A;  1ETK A;  3ZQI A;  4A69 C;  3M4O J;  2YUS A;  5F0F A;  2GEN A;  3S2D J;  5EF6 A;  1MH4 A;  3ZQL A;  4MFE A;  1BW5 A;  4ACI A;  1TWG J;  3CCY A;  2DG8 A;  3HDD A;  3VVY A;  1FIA A;  4M3E A;  3IH3 A;  2EZH A;  1ETX A;  3Q3S A;  1VF9 A;  5EYR A;  4ICH A;  3RKQ A;  5K58 A;  3E7Q A;  1JT6 A;  2FX0 A;  3GTM J;  1UMQ A;  3G7R A;  2XPV A;  4C2M J;  3GTK J;  5K7Z A;  4ME9 A;  4M3B A;  3VW0 A;  1HLV A;  2E1O A;  5F04 A;  1X2N A;  3B81 A;  5FKL A;  3NRG A;  3HKZ N;  2R5Z A;  2NP5 A;  3S1R J;  5FLV A;  5IP7 J;  1JJ8 C;  2JA6 J;  3HTI A;  2YS9 A;  4GFL A;  3B6C A;  1QRY A;  1ETY A;  2NP3 A;  2ECB A;  5F0H A;  5EEA A;  1HF0 A;  5BNG A;  3JRD A;  2WUI A;  5DAJ A;  2R5Y B;  3HTA A;  4QIW N;  4NDL A;  4DYQ A;  3G1O A;  4A3I J;  1FJL A;  2D5V A;  2HOS A;  2EBI A;  2ZOY A;  2WAQ N;  5GP9 A;  3GTO J;  3S15 J;  2M2E A;  5IP9 J;  1ORK A;  3VVZ A;  1TC3 C;  4IHV A;  3MNL A;  2OPT A;  2LFB A;  1TWC J;  3SDG A;  2Y9Z A;  4A3F J;  3JRC A;  2CU7 A;  2JA7 J;  2DMU A;  3NAR A;  4JNN A;  1UI6 A;  2TRT A;  1ETO A;  2LKX A;  2UXP A;  4X6A J;  1JUS A;  2HXO A;  2Y30 A;  1MBJ A;  5DS9 A;  3JRI A;  5AQC A;  3FK7 A;  4XRM A;  5FJ8 J;  3PM1 A;  4AYB N;  4AF5 A;  1JKQ C;  2VI6 A;  5J1U A;  3L1P A;  4M3D A;  4AC6 A;  4MO7 A;  3JRA A;  4JL3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...