4JKZA

Crystal structure of ms6564 from mycobacterium smegmatis
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
179
structure length
179
Chain Sequence
b'SEKSRVAIVEATRALLLERGFDGLSIEAVAAKAGVGKQTIYRWWPSRHALVADVLLEDADKILARMPKTDDVTADLASWAGTLAAALTTRRGHAMLKTLMAASLEHEDTAARLREGFSRPLIESVRDRLRDEDIDADHAQAAADALLGAVVNAVLSEGRSYSRQRAETSARIIVAGLRP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, TetR family
molecule tags Transcription
source organism Mycobacterium smegmatis
publication title Structural basis for interaction between M. smegmatis Ms6564, a TetR family master regulator, and its target DNA.
rcsb
total genus 68
structure length 179
sequence length 179
ec nomenclature
pdb deposition date 2013-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF16859 TetR_C_11 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 4jkzA00
3PM1A 2Y2ZA 2HQ5A 2ID6A 2DG8A 4G12A 3GEUA 2ZCNA 3NXCA 3VW0A 3VUQA 2VPRA 3HIMA 3Q0UA 3P9TA 4W97A 2G7SA 2WV1A 2QOPA 3IH3A 2XPUA 3PPBA 3EGQA 5EFYA 3RD3A 4B3AA 4MO7A 2QTQA 5GPCA 3VPRA 2FBQA 4MXMA 3KKCA 2RHAA 3BR1A 2EH3A 5IPAA 3CWRA 1JUPA 2RAEA 2UXPA 3HGGA 3VP5A 2TRTA 5FMPA 2OERA 1Z0XA 4W1UA 2YVEA 3Q3SA 3COLA 2ZCMA 5IP6A 4CGRA 5K58A 3CJDA 5K7HA 3BR6A 2HXIA 3RH2A 4ABZA 1RKWA 3HE0A 2IAIA 5IOZA 2O7OA 1JT0A 3DEWA 3ANGA 4X1EA 2Y30A 2NP5A 5FKOA 4M3BA 3E7QA 2PBXA 3G7RA 5F0CA 2F07A 2OPTA 3Q0VA 3NNRA 2HYTA 3C07A 5D1RA 2D6YA 4ICHA 5AQCA 2QWTA 2OF7A 3SFIA 4XK4A 5GP9A 2WGBA 4AC6A 1VI0A 3BR0A 3QQAA 3NI7A 3F1BA 5FKMA 4AUXA 4AC0A 3VW2A 3VVZA 5GPAA 4GFKA 3VIBA 2XPWA 1U9NA 3BJBA 4I6ZA 4D5CA 2RASA 3ZQLA 2DG7A 3T6NA 4GFLA 1JTYA 4M3DA 3BHQA 1U9OA 2XGEA 2QCOA 4L62A 5D19A 2FJ1A 2Y31A 3ZQFA 3CRJA 1RPWA 2PZ9A 4AF5A 3EUPA 3QKXA 2ZOYA 5EYRA 2UXHA 2IBDA 4M3EA 3QBMA 2I10A 3ZQHA 3IUVA 3JSJA 3ON2A 5FKKA 3WHCA 4D5FA 5EZHA 2V57A 4JNNA 3FK7A 2DTZA 3MVPA 3O8GA 5J1UA 3LSPA 3HTJA 2XB5A 2ZB9A 3LJLA 3ZQIA 1ZK8A 3TP3A 3QPSA 2XDNA 3CDLA 1QVTA 1Z77A 3C2BA 3ON4A 2GENA 1ORKA 1UI5A 2TCTA 4GCLA 2X6OA 2GBYA 3S5RA 3BTIA 5HBUA 3ZQGA 3CCYA 2QKOA 5K7FA 5CXIA 1RKTA 4V2GA 2W53A 3BRUA 4MK6A 2UXOA 5F27A 2VKEA 3PASA 3BR5A 2REKA 3G56A 3G1OA 1SGMA 2FD5A 3BCGA 1JTXA 3BTJA 3F0CA 3VVYA 1JUMA 4V2FA 5HAWA 2X9DA 2JJ7A 5HSZA 3BNIA 3MNLA 3V78A 2XGCA 2YVHA 3VW1A 2NS7A 3G1LA 5J3LA 2G7LA 3KZ9A 1BJZA 5D18A 5F08A 2ID3A 5DAJA 5F0HA 2G7GA 3G1MA 3VVXA 3WHBA 5J1YA 1ZKGA 4I76A 3AQTA 3TP0A 2IU5A 1T33A 2HKUA 2GFNA 5FKNA 3GZIA 3BT9A 3KNWA 3V6GA 4JYKA 4GCKA 3HTAA 4JKZA 1JT6A 3LSRA 3BR2A 4KWAA 4JL3A 5EZGA 2WUIA 4NELA 2XPVA 5F0FA 4D7NA 5F04A 2XRLA 3FIWA 2HYJA 3B6CA 2FQ4A 3B81A 4DW6A 2NX4A 2G3BA 3IH2A 5CW8A 3HTHA 3LOCA 5J1RA 3AQSA 3DPJA 3SDGA 3LSJA 5FGLA 4PXIA 2UXIA 3FRQA 2G0EA 5CXGA 4M3GA 2ZOZA 1A6IA 4HKUA 2GUHA 3FK6A 2Q24A 3VOXA 3O8HA 3HGYA 3IH4A 4ME9A 1QPIA 2JK3A 5K7ZA 2OI8A 3BQZA 4NN1A 3QPLA 2ZCXA 3NRGA 2QIBA 2NS8A 2XGDA 3BR3A 3B6AA 2FX0A 3BTCA 3ANPA 4M3FA 1QVUA 5FKLA 3LHQA 4UDSA 4B1RA 3KKDA 4D7MA 1UI6A 3O60A 2IEKA 3LWJA 3Q0WA 4GCTA 3BQYA 2VKVA 3NPIA 5F1JA 5H9TA 1T56A 3BTLA 1JUSA 3DCFA 2O7TA 5IOYA 3VOKA 2UXUA 3HTIA 2HXOA 5FHPA 4ACIA 5C4YA 2NP3A 4YZEA
chains in the Genus database with same CATH superfamily
3PM1A 2Y2ZA 2HQ5A 2ID6A 2DG8A 4G12A 3GEUA 2ZCNA 3NXCA 3VW0A 3VUQA 2VPRA 3HIMA 3Q0UA 3P9TA 4W97A 2G7SA 2WV1A 2QOPA 3IH3A 2XPUA 3PPBA 3EGQA 5EFYA 3RD3A 2R7RA 4B3AA 4MO7A 2QTQA 5GPCA 3VPRA 2FBQA 4MXMA 3KKCA 2RHAA 3BR1A 2EH3A 5IPAA 3CWRA 1JUPA 2RAEA 2UXPA 3HGGA 3VP5A 2TRTA 5FMPA 2OERA 1Z0XA 4W1UA 2YVEA 3Q3SA 3COLA 2ZCMA 5IP6A 4CGRA 5K58A 4OD5A 3CJDA 5K7HA 3BR6A 2HXIA 3RH2A 4ABZA 1RKWA 3HE0A 2IAIA 5IOZA 2O7OA 2R7WA 1JT0A 4U9NA 3DEWA 3ANGA 4X1EA 2Y30A 3DU5A 2NP5A 5FKOA 4M3BA 3E7QA 2PBXA 3G7RA 5F0CA 2F07A 2OPTA 3Q0VA 3NNRA 2HYTA 3C07A 5D1RA 2D6YA 4ICHA 5AQCA 2QWTA 2OF7A 3SFIA 4XK4A 5GP9A 2WGBA 4AC6A 1VI0A 3BR0A 3QQAA 3NI7A 3F1BA 5FKMA 4AUXA 4AC0A 3VW2A 3VVZA 4WIBA 5GPAA 4GFKA 3VIBA 2XPWA 1U9NA 3BJBA 4I6ZA 4D5CA 2RASA 3ZQLA 2DG7A 3T6NA 4GFLA 1JTYA 4M3DA 3BHQA 1U9OA 3VTIA 2XGEA 2QCOA 4L62A 5D19A 2FJ1A 2Y31A 3ZQFA 3CRJA 1RPWA 2PZ9A 4AF5A 4C2MA 3EUPA 3QKXA 2ZOYA 5EYRA 2UXHA 2IBDA 4M3EA 3QBMA 2I10A 3ZQHA 3IUVA 3JSJA 3KYLA 3ON2A 5FKKA 3WHCA 3FHNA 4D5FA 5EZHA 2V57A 4JNNA 3FK7A 2DTZA 3MVPA 3O8GA 2R7SA 5J1UA 3LSPA 3HTJA 2XB5A 2ZB9A 3LJLA 2R7XA 3ZQIA 1ZK8A 3TP3A 3QPSA 2XDNA 3CDLA 1QVTA 1Z77A 3C2BA 3ON4A 2GENA 1ORKA 1UI5A 2TCTA 4GCLA 2X6OA 3SWHA 2GBYA 3S5RA 3BTIA 5HBUA 3ZQGA 3CCYA 2QKOA 5K7FA 5CXIA 1RKTA 2YVXA 4V2GA 2W53A 3BRUA 4MK6A 2UXOA 5F27A 2VKEA 3PASA 3BR5A 2REKA 3G56A 3G1OA 1SGMA 2FD5A 3BCGA 1JTXA 5CQGA 3BTJA 3F0CA 3VVYA 1JUMA 4V2FA 5HAWA 2X9DA 2JJ7A 5HSZA 3BNIA 3MNLA 3V78A 2XGCA 2YVHA 3VW1A 2NS7A 3G1LA 5J3LA 2G7LA 2R7QA 3KZ9A 1BJZA 5D18A 5F08A 2ID3A 2R7OA 5DAJA 2A2FX 2G7GA 5F0HA 3G1MA 3VVXA 3WHBA 5J1YA 1ZKGA 4I76A 3AQTA 3TP0A 2IU5A 1T33A 2HKUA 2GFNA 5FKNA 3GZIA 3NS4A 3BT9A 2B1EA 3KNWA 3V6GA 4JYKA 4GCKA 3HTAA 4JKZA 1JT6A 3LSRA 3BR2A 4IRVA 4KWAA 4JL3A 5EZGA 2WUIA 4NELA 2XPVA 5F0FA 4D7NA 5F04A 2XRLA 3FIWA 2HYJA 3B6CA 2FQ4A 3B81A 4DW6A 2NX4A 2G3BA 3IH2A 5CW8A 3HTHA 3LOCA 5J1RA 3AQSA 3DPJA 3SDGA 3LSJA 4OD4A 3DU6A 5FGLA 2R7TA 4PXIA 2UXIA 3FRQA 2G0EA 2PFVA 5CXGA 4M3GA 2ZOZA 1A6IA 4HKUA 2FJI1 2GUHA 3FK6A 2Q24A 4DVYP 3VOXA 3O8HA 3HGYA 3IH4A 4ME9A 1QPIA 2JK3A 5K7ZA 2OI8A 3BQZA 4NN1A 3QPLA 2R7UA 2ZCXA 3NRGA 2QIBA 2NS8A 2XGDA 3BR3A 2R7VA 3B6AA 2FX0A 3BTCA 2ZY9A 3ANPA 4M3FA 1QVUA 5FKLA 3LHQA 4UDSA 4B1RA 3KKDA 4D7MA 1UI6A 3O60A 2IEKA 3K8PC 3LWJA 3Q0WA 4GCTA 3BQYA 2VKVA 3NPIA 5F1JA 4U9LA 5H9TA 1T56A 3BTLA 1JUSA 3DCFA 2O7TA 5IOYA 3VOKA 2UXUA 3HTIA 2HXOA 5FHPA 4ACIA 2B3WA 5C4YA 2NP3A 4YZEA
chains in the Genus database with same CATH topology
3PM1A 2Y2ZA 2HQ5A 2ID6A 2DG8A 4G12A 3GEUA 2ZCNA 3NXCA 3VW0A 3VUQA 2VPRA 3HIMA 3Q0UA 3P9TA 4W97A 2G7SA 2WV1A 2QOPA 3IH3A 2XPUA 3PPBA 3EGQA 5EFYA 3RD3A 4B3AA 4MO7A 2QTQA 5GPCA 3VPRA 2FBQA 4MXMA 3KKCA 2RHAA 3BR1A 2EH3A 5IPAA 3CWRA 1JUPA 2RAEA 2UXPA 3HGGA 3VP5A 2TRTA 5FMPA 2OERA 1Z0XA 4W1UA 2YVEA 3Q3SA 3COLA 2ZCMA 5IP6A 4CGRA 5K58A 3CJDA 5K7HA 3BR6A 2HXIA 3RH2A 4ABZA 1RKWA 3HE0A 2IAIA 5IOZA 2O7OA 1JT0A 3DEWA 3ANGA 4X1EA 2Y30A 2NP5A 5FKOA 4M3BA 3E7QA 2PBXA 3G7RA 5F0CA 2F07A 2OPTA 3Q0VA 3NNRA 2HYTA 3C07A 5D1RA 2D6YA 4ICHA 5AQCA 2QWTA 2OF7A 3SFIA 4XK4A 5GP9A 2WGBA 4AC6A 1VI0A 3BR0A 3QQAA 3NI7A 3F1BA 5FKMA 4AUXA 4AC0A 3VW2A 3VVZA 5GPAA 4GFKA 3VIBA 2XPWA 1U9NA 3BJBA 4I6ZA 4D5CA 2RASA 3ZQLA 2DG7A 3T6NA 4GFLA 1JTYA 4M3DA 3BHQA 1U9OA 2XGEA 2QCOA 4L62A 5D19A 2FJ1A 2Y31A 3ZQFA 3CRJA 1RPWA 2PZ9A 4AF5A 3EUPA 3QKXA 2ZOYA 5EYRA 2UXHA 2IBDA 4M3EA 3QBMA 2I10A 3ZQHA 3IUVA 3JSJA 3ON2A 5FKKA 3WHCA 4D5FA 5EZHA 2V57A 4JNNA 3FK7A 2DTZA 3MVPA 3O8GA 5J1UA 3LSPA 3HTJA 2XB5A 2ZB9A 3LJLA 3ZQIA 1ZK8A 3TP3A 3QPSA 2XDNA 3CDLA 1QVTA 1Z77A 3C2BA 3ON4A 2GENA 1ORKA 1UI5A 2TCTA 4GCLA 2X6OA 2GBYA 3S5RA 3BTIA 5HBUA 3ZQGA 3CCYA 2QKOA 5K7FA 5CXIA 1RKTA 4V2GA 2W53A 3BRUA 4MK6A 2UXOA 5F27A 2VKEA 3PASA 3BR5A 2REKA 3G56A 3G1OA 1SGMA 2FD5A 3BCGA 1JTXA 3BTJA 3F0CA 3VVYA 1JUMA 4V2FA 5HAWA 2X9DA 2JJ7A 5HSZA 3BNIA 3MNLA 3V78A 2XGCA 2YVHA 3VW1A 2NS7A 3G1LA 5J3LA 2G7LA 3KZ9A 1BJZA 5D18A 5F08A 2ID3A 5DAJA 5F0HA 2G7GA 3G1MA 3VVXA 3WHBA 5J1YA 1ZKGA 4I76A 3AQTA 3TP0A 2IU5A 1T33A 2HKUA 2GFNA 5FKNA 3GZIA 3BT9A 3KNWA 3V6GA 4JYKA 4GCKA 3HTAA 4JKZA 1JT6A 3LSRA 3BR2A 4KWAA 4JL3A 5EZGA 2WUIA 4NELA 2XPVA 5F0FA 4D7NA 5F04A 2XRLA 3FIWA 2HYJA 3B6CA 2FQ4A 3B81A 4DW6A 2NX4A 2G3BA 3IH2A 5CW8A 3HTHA 3LOCA 5J1RA 3AQSA 3DPJA 3SDGA 3LSJA 5FGLA 4PXIA 2UXIA 3FRQA 2G0EA 5CXGA 4M3GA 2ZOZA 1A6IA 4HKUA 2GUHA 3FK6A 2Q24A 3VOXA 3O8HA 3HGYA 3IH4A 4ME9A 1QPIA 2JK3A 5K7ZA 2OI8A 3BQZA 4NN1A 3QPLA 2ZCXA 3NRGA 2QIBA 2NS8A 2XGDA 3BR3A 3B6AA 2FX0A 3BTCA 3ANPA 4M3FA 1QVUA 5FKLA 3LHQA 4UDSA 4B1RA 3KKDA 4D7MA 1UI6A 3O60A 2IEKA 3LWJA 3Q0WA 4GCTA 3BQYA 2VKVA 3NPIA 5F1JA 5H9TA 1T56A 3BTLA 1JUSA 3DCFA 2O7TA 5IOYA 3VOKA 2UXUA 3HTIA 2HXOA 5FHPA 4ACIA 5C4YA 2NP3A 4YZEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PM1 A;  2Y2Z A;  2HQ5 A;  2ID6 A;  2DG8 A;  4G12 A;  3GEU A;  2ZCN A;  3NXC A;  3VW0 A;  3VUQ A;  2VPR A;  3HIM A;  3Q0U A;  3P9T A;  4W97 A;  2G7S A;  2WV1 A;  2QOP A;  3IH3 A;  2XPU A;  3PPB A;  3EGQ A;  5EFY A;  3RD3 A;  4B3A A;  4MO7 A;  2QTQ A;  5GPC A;  3VPR A;  2FBQ A;  4MXM A;  3KKC A;  2RHA A;  3BR1 A;  2EH3 A;  5IPA A;  3CWR A;  1JUP A;  2RAE A;  2UXP A;  3HGG A;  3VP5 A;  2TRT A;  5FMP A;  2OER A;  1Z0X A;  4W1U A;  2YVE A;  3Q3S A;  3COL A;  2ZCM A;  5IP6 A;  4CGR A;  5K58 A;  3CJD A;  5K7H A;  3BR6 A;  2HXI A;  3RH2 A;  4ABZ A;  1RKW A;  3HE0 A;  2IAI A;  5IOZ A;  2O7O A;  1JT0 A;  3DEW A;  3ANG A;  4X1E A;  2Y30 A;  2NP5 A;  5FKO A;  4M3B A;  3E7Q A;  2PBX A;  3G7R A;  5F0C A;  2F07 A;  2OPT A;  3Q0V A;  3NNR A;  2HYT A;  3C07 A;  5D1R A;  2D6Y A;  4ICH A;  5AQC A;  2QWT A;  2OF7 A;  3SFI A;  4XK4 A;  5GP9 A;  2WGB A;  4AC6 A;  1VI0 A;  3BR0 A;  3QQA A;  3NI7 A;  3F1B A;  5FKM A;  4AUX A;  4AC0 A;  3VW2 A;  3VVZ A;  5GPA A;  4GFK A;  3VIB A;  2XPW A;  1U9N A;  3BJB A;  4I6Z A;  4D5C A;  2RAS A;  3ZQL A;  2DG7 A;  3T6N A;  4GFL A;  1JTY A;  4M3D A;  3BHQ A;  1U9O A;  2XGE A;  2QCO A;  4L62 A;  5D19 A;  2FJ1 A;  2Y31 A;  3ZQF A;  3CRJ A;  1RPW A;  2PZ9 A;  4AF5 A;  3EUP A;  3QKX A;  2ZOY A;  5EYR A;  2UXH A;  2IBD A;  4M3E A;  3QBM A;  2I10 A;  3ZQH A;  3IUV A;  3JSJ A;  3ON2 A;  5FKK A;  3WHC A;  4D5F A;  5EZH A;  2V57 A;  4JNN A;  3FK7 A;  2DTZ A;  3MVP A;  3O8G A;  5J1U A;  3LSP A;  3HTJ A;  2XB5 A;  2ZB9 A;  3LJL A;  3ZQI A;  1ZK8 A;  3TP3 A;  3QPS A;  2XDN A;  3CDL A;  1QVT A;  1Z77 A;  3C2B A;  3ON4 A;  2GEN A;  1ORK A;  1UI5 A;  2TCT A;  4GCL A;  2X6O A;  2GBY A;  3S5R A;  3BTI A;  5HBU A;  3ZQG A;  3CCY A;  2QKO A;  5K7F A;  5CXI A;  1RKT A;  4V2G A;  2W53 A;  3BRU A;  4MK6 A;  2UXO A;  5F27 A;  2VKE A;  3PAS A;  3BR5 A;  2REK A;  3G56 A;  3G1O A;  1SGM A;  2FD5 A;  3BCG A;  1JTX A;  3BTJ A;  3F0C A;  3VVY A;  1JUM A;  4V2F A;  5HAW A;  2X9D A;  2JJ7 A;  5HSZ A;  3BNI A;  3MNL A;  3V78 A;  2XGC A;  2YVH A;  3VW1 A;  2NS7 A;  3G1L A;  5J3L A;  2G7L A;  3KZ9 A;  1BJZ A;  5D18 A;  5F08 A;  2ID3 A;  5DAJ A;  5F0H A;  2G7G A;  3G1M A;  3VVX A;  3WHB A;  5J1Y A;  1ZKG A;  4I76 A;  3AQT A;  3TP0 A;  2IU5 A;  1T33 A;  2HKU A;  2GFN A;  5FKN A;  3GZI A;  3BT9 A;  3KNW A;  3V6G A;  4JYK A;  4GCK A;  3HTA A;  4JKZ A;  1JT6 A;  3LSR A;  3BR2 A;  4KWA A;  4JL3 A;  5EZG A;  2WUI A;  4NEL A;  2XPV A;  5F0F A;  4D7N A;  5F04 A;  2XRL A;  3FIW A;  2HYJ A;  3B6C A;  2FQ4 A;  3B81 A;  4DW6 A;  2NX4 A;  2G3B A;  3IH2 A;  5CW8 A;  3HTH A;  3LOC A;  5J1R A;  3AQS A;  3DPJ A;  3SDG A;  3LSJ A;  5FGL A;  4PXI A;  2UXI A;  3FRQ A;  2G0E A;  5CXG A;  4M3G A;  2ZOZ A;  1A6I A;  4HKU A;  2GUH A;  3FK6 A;  2Q24 A;  3VOX A;  3O8H A;  3HGY A;  3IH4 A;  4ME9 A;  1QPI A;  2JK3 A;  5K7Z A;  2OI8 A;  3BQZ A;  4NN1 A;  3QPL A;  2ZCX A;  3NRG A;  2QIB A;  2NS8 A;  2XGD A;  3BR3 A;  3B6A A;  2FX0 A;  3BTC A;  3ANP A;  4M3F A;  1QVU A;  5FKL A;  3LHQ A;  4UDS A;  4B1R A;  3KKD A;  4D7M A;  1UI6 A;  3O60 A;  2IEK A;  3LWJ A;  3Q0W A;  4GCT A;  3BQY A;  2VKV A;  3NPI A;  5F1J A;  5H9T A;  1T56 A;  3BTL A;  1JUS A;  3DCF A;  2O7T A;  5IOY A;  3VOK A;  2UXU A;  3HTI A;  2HXO A;  5FHP A;  4ACI A;  5C4Y A;  2NP3 A;  4YZE A; 
#chains in the Genus database with same CATH topology
 3PM1 A;  2Y2Z A;  2HQ5 A;  2ID6 A;  2DG8 A;  4G12 A;  3GEU A;  2ZCN A;  3NXC A;  3VW0 A;  3VUQ A;  2VPR A;  3HIM A;  3Q0U A;  3P9T A;  4W97 A;  2G7S A;  2WV1 A;  2QOP A;  3IH3 A;  2XPU A;  3PPB A;  3EGQ A;  5EFY A;  3RD3 A;  2R7R A;  4B3A A;  4MO7 A;  2QTQ A;  5GPC A;  3VPR A;  2FBQ A;  4MXM A;  3KKC A;  2RHA A;  3BR1 A;  2EH3 A;  5IPA A;  3CWR A;  1JUP A;  2RAE A;  2UXP A;  3HGG A;  3VP5 A;  2TRT A;  5FMP A;  2OER A;  1Z0X A;  4W1U A;  2YVE A;  3Q3S A;  3COL A;  2ZCM A;  5IP6 A;  4CGR A;  5K58 A;  4OD5 A;  3CJD A;  5K7H A;  3BR6 A;  2HXI A;  3RH2 A;  4ABZ A;  1RKW A;  3HE0 A;  2IAI A;  5IOZ A;  2O7O A;  2R7W A;  1JT0 A;  4U9N A;  3DEW A;  3ANG A;  4X1E A;  2Y30 A;  3DU5 A;  2NP5 A;  5FKO A;  4M3B A;  3E7Q A;  2PBX A;  3G7R A;  5F0C A;  2F07 A;  2OPT A;  3Q0V A;  3NNR A;  2HYT A;  3C07 A;  5D1R A;  2D6Y A;  4ICH A;  5AQC A;  2QWT A;  2OF7 A;  3SFI A;  4XK4 A;  5GP9 A;  2WGB A;  4AC6 A;  1VI0 A;  3BR0 A;  3QQA A;  3NI7 A;  3F1B A;  5FKM A;  4AUX A;  4AC0 A;  3VW2 A;  3VVZ A;  4WIB A;  5GPA A;  4GFK A;  3VIB A;  2XPW A;  1U9N A;  3BJB A;  4I6Z A;  4D5C A;  2RAS A;  3ZQL A;  2DG7 A;  3T6N A;  4GFL A;  1JTY A;  4M3D A;  3BHQ A;  1U9O A;  3VTI A;  2XGE A;  2QCO A;  4L62 A;  5D19 A;  2FJ1 A;  2Y31 A;  3ZQF A;  3CRJ A;  1RPW A;  2PZ9 A;  4AF5 A;  4C2M A;  3EUP A;  3QKX A;  2ZOY A;  5EYR A;  2UXH A;  2IBD A;  4M3E A;  3QBM A;  2I10 A;  3ZQH A;  3IUV A;  3JSJ A;  3KYL A;  3ON2 A;  5FKK A;  3WHC A;  3FHN A;  4D5F A;  5EZH A;  2V57 A;  4JNN A;  3FK7 A;  2DTZ A;  3MVP A;  3O8G A;  2R7S A;  5J1U A;  3LSP A;  3HTJ A;  2XB5 A;  2ZB9 A;  3LJL A;  2R7X A;  3ZQI A;  1ZK8 A;  3TP3 A;  3QPS A;  2XDN A;  3CDL A;  1QVT A;  1Z77 A;  3C2B A;  3ON4 A;  2GEN A;  1ORK A;  1UI5 A;  2TCT A;  4GCL A;  2X6O A;  3SWH A;  2GBY A;  3S5R A;  3BTI A;  5HBU A;  3ZQG A;  3CCY A;  2QKO A;  5K7F A;  5CXI A;  1RKT A;  2YVX A;  4V2G A;  2W53 A;  3BRU A;  4MK6 A;  2UXO A;  5F27 A;  2VKE A;  3PAS A;  3BR5 A;  2REK A;  3G56 A;  3G1O A;  1SGM A;  2FD5 A;  3BCG A;  1JTX A;  5CQG A;  3BTJ A;  3F0C A;  3VVY A;  1JUM A;  4V2F A;  5HAW A;  2X9D A;  2JJ7 A;  5HSZ A;  3BNI A;  3MNL A;  3V78 A;  2XGC A;  2YVH A;  3VW1 A;  2NS7 A;  3G1L A;  5J3L A;  2G7L A;  2R7Q A;  3KZ9 A;  1BJZ A;  5D18 A;  5F08 A;  2ID3 A;  2R7O A;  5DAJ A;  2A2F X;  2G7G A;  5F0H A;  3G1M A;  3VVX A;  3WHB A;  5J1Y A;  1ZKG A;  4I76 A;  3AQT A;  3TP0 A;  2IU5 A;  1T33 A;  2HKU A;  2GFN A;  5FKN A;  3GZI A;  3NS4 A;  3BT9 A;  2B1E A;  3KNW A;  3V6G A;  4JYK A;  4GCK A;  3HTA A;  4JKZ A;  1JT6 A;  3LSR A;  3BR2 A;  4IRV A;  4KWA A;  4JL3 A;  5EZG A;  2WUI A;  4NEL A;  2XPV A;  5F0F A;  4D7N A;  5F04 A;  2XRL A;  3FIW A;  2HYJ A;  3B6C A;  2FQ4 A;  3B81 A;  4DW6 A;  2NX4 A;  2G3B A;  3IH2 A;  5CW8 A;  3HTH A;  3LOC A;  5J1R A;  3AQS A;  3DPJ A;  3SDG A;  3LSJ A;  4OD4 A;  3DU6 A;  5FGL A;  2R7T A;  4PXI A;  2UXI A;  3FRQ A;  2G0E A;  2PFV A;  5CXG A;  4M3G A;  2ZOZ A;  1A6I A;  4HKU A;  2FJI 1;  2GUH A;  3FK6 A;  2Q24 A;  4DVY P;  3VOX A;  3O8H A;  3HGY A;  3IH4 A;  4ME9 A;  1QPI A;  2JK3 A;  5K7Z A;  2OI8 A;  3BQZ A;  4NN1 A;  3QPL A;  2R7U A;  2ZCX A;  3NRG A;  2QIB A;  2NS8 A;  2XGD A;  3BR3 A;  2R7V A;  3B6A A;  2FX0 A;  3BTC A;  2ZY9 A;  3ANP A;  4M3F A;  1QVU A;  5FKL A;  3LHQ A;  4UDS A;  4B1R A;  3KKD A;  4D7M A;  1UI6 A;  3O60 A;  2IEK A;  3K8P C;  3LWJ A;  3Q0W A;  4GCT A;  3BQY A;  2VKV A;  3NPI A;  5F1J A;  4U9L A;  5H9T A;  1T56 A;  3BTL A;  1JUS A;  3DCF A;  2O7T A;  5IOY A;  3VOK A;  2UXU A;  3HTI A;  2HXO A;  5FHP A;  4ACI A;  2B3W A;  5C4Y A;  2NP3 A;  4YZE A; 
#chains in the Genus database with same CATH homology
 3PM1 A;  2Y2Z A;  2HQ5 A;  2ID6 A;  2DG8 A;  4G12 A;  3GEU A;  2ZCN A;  3NXC A;  3VW0 A;  3VUQ A;  2VPR A;  3HIM A;  3Q0U A;  3P9T A;  4W97 A;  2G7S A;  2WV1 A;  2QOP A;  3IH3 A;  2XPU A;  3PPB A;  3EGQ A;  5EFY A;  3RD3 A;  4B3A A;  4MO7 A;  2QTQ A;  5GPC A;  3VPR A;  2FBQ A;  4MXM A;  3KKC A;  2RHA A;  3BR1 A;  2EH3 A;  5IPA A;  3CWR A;  1JUP A;  2RAE A;  2UXP A;  3HGG A;  3VP5 A;  2TRT A;  5FMP A;  2OER A;  1Z0X A;  4W1U A;  2YVE A;  3Q3S A;  3COL A;  2ZCM A;  5IP6 A;  4CGR A;  5K58 A;  3CJD A;  5K7H A;  3BR6 A;  2HXI A;  3RH2 A;  4ABZ A;  1RKW A;  3HE0 A;  2IAI A;  5IOZ A;  2O7O A;  1JT0 A;  3DEW A;  3ANG A;  4X1E A;  2Y30 A;  2NP5 A;  5FKO A;  4M3B A;  3E7Q A;  2PBX A;  3G7R A;  5F0C A;  2F07 A;  2OPT A;  3Q0V A;  3NNR A;  2HYT A;  3C07 A;  5D1R A;  2D6Y A;  4ICH A;  5AQC A;  2QWT A;  2OF7 A;  3SFI A;  4XK4 A;  5GP9 A;  2WGB A;  4AC6 A;  1VI0 A;  3BR0 A;  3QQA A;  3NI7 A;  3F1B A;  5FKM A;  4AUX A;  4AC0 A;  3VW2 A;  3VVZ A;  5GPA A;  4GFK A;  3VIB A;  2XPW A;  1U9N A;  3BJB A;  4I6Z A;  4D5C A;  2RAS A;  3ZQL A;  2DG7 A;  3T6N A;  4GFL A;  1JTY A;  4M3D A;  3BHQ A;  1U9O A;  2XGE A;  2QCO A;  4L62 A;  5D19 A;  2FJ1 A;  2Y31 A;  3ZQF A;  3CRJ A;  1RPW A;  2PZ9 A;  4AF5 A;  3EUP A;  3QKX A;  2ZOY A;  5EYR A;  2UXH A;  2IBD A;  4M3E A;  3QBM A;  2I10 A;  3ZQH A;  3IUV A;  3JSJ A;  3ON2 A;  5FKK A;  3WHC A;  4D5F A;  5EZH A;  2V57 A;  4JNN A;  3FK7 A;  2DTZ A;  3MVP A;  3O8G A;  5J1U A;  3LSP A;  3HTJ A;  2XB5 A;  2ZB9 A;  3LJL A;  3ZQI A;  1ZK8 A;  3TP3 A;  3QPS A;  2XDN A;  3CDL A;  1QVT A;  1Z77 A;  3C2B A;  3ON4 A;  2GEN A;  1ORK A;  1UI5 A;  2TCT A;  4GCL A;  2X6O A;  2GBY A;  3S5R A;  3BTI A;  5HBU A;  3ZQG A;  3CCY A;  2QKO A;  5K7F A;  5CXI A;  1RKT A;  4V2G A;  2W53 A;  3BRU A;  4MK6 A;  2UXO A;  5F27 A;  2VKE A;  3PAS A;  3BR5 A;  2REK A;  3G56 A;  3G1O A;  1SGM A;  2FD5 A;  3BCG A;  1JTX A;  3BTJ A;  3F0C A;  3VVY A;  1JUM A;  4V2F A;  5HAW A;  2X9D A;  2JJ7 A;  5HSZ A;  3BNI A;  3MNL A;  3V78 A;  2XGC A;  2YVH A;  3VW1 A;  2NS7 A;  3G1L A;  5J3L A;  2G7L A;  3KZ9 A;  1BJZ A;  5D18 A;  5F08 A;  2ID3 A;  5DAJ A;  5F0H A;  2G7G A;  3G1M A;  3VVX A;  3WHB A;  5J1Y A;  1ZKG A;  4I76 A;  3AQT A;  3TP0 A;  2IU5 A;  1T33 A;  2HKU A;  2GFN A;  5FKN A;  3GZI A;  3BT9 A;  3KNW A;  3V6G A;  4JYK A;  4GCK A;  3HTA A;  4JKZ A;  1JT6 A;  3LSR A;  3BR2 A;  4KWA A;  4JL3 A;  5EZG A;  2WUI A;  4NEL A;  2XPV A;  5F0F A;  4D7N A;  5F04 A;  2XRL A;  3FIW A;  2HYJ A;  3B6C A;  2FQ4 A;  3B81 A;  4DW6 A;  2NX4 A;  2G3B A;  3IH2 A;  5CW8 A;  3HTH A;  3LOC A;  5J1R A;  3AQS A;  3DPJ A;  3SDG A;  3LSJ A;  5FGL A;  4PXI A;  2UXI A;  3FRQ A;  2G0E A;  5CXG A;  4M3G A;  2ZOZ A;  1A6I A;  4HKU A;  2GUH A;  3FK6 A;  2Q24 A;  3VOX A;  3O8H A;  3HGY A;  3IH4 A;  4ME9 A;  1QPI A;  2JK3 A;  5K7Z A;  2OI8 A;  3BQZ A;  4NN1 A;  3QPL A;  2ZCX A;  3NRG A;  2QIB A;  2NS8 A;  2XGD A;  3BR3 A;  3B6A A;  2FX0 A;  3BTC A;  3ANP A;  4M3F A;  1QVU A;  5FKL A;  3LHQ A;  4UDS A;  4B1R A;  3KKD A;  4D7M A;  1UI6 A;  3O60 A;  2IEK A;  3LWJ A;  3Q0W A;  4GCT A;  3BQY A;  2VKV A;  3NPI A;  5F1J A;  5H9T A;  1T56 A;  3BTL A;  1JUS A;  3DCF A;  2O7T A;  5IOY A;  3VOK A;  2UXU A;  3HTI A;  2HXO A;  5FHP A;  4ACI A;  5C4Y A;  2NP3 A;  4YZE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...