4JKZA

Crystal structure of ms6564 from mycobacterium smegmatis
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
179
structure length
179
Chain Sequence
SEKSRVAIVEATRALLLERGFDGLSIEAVAAKAGVGKQTIYRWWPSRHALVADVLLEDADKILARMPKTDDVTADLASWAGTLAAALTTRRGHAMLKTLMAASLEHEDTAARLREGFSRPLIESVRDRLRDEDIDADHAQAAADALLGAVVNAVLSEGRSYSRQRAETSARIIVAGLRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for interaction between M. smegmatis Ms6564, a TetR family master regulator, and its target DNA.
rcsb
source organism Mycobacterium smegmatis
molecule tags Transcription
molecule keywords Transcriptional regulator, TetR family
total genus 68
structure length 179
sequence length 179
ec nomenclature
pdb deposition date 2013-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF16859 TetR_C_11 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 4jkzA00
1JUPA 3VIBA 1JUMA 2HYTA 2XGCA 4AC6A 5FKKA 2XRLA 2G7SA 2ZCXA 3BQYA 3V6GA 3LSRA 5F0HA 2DG8A 3FRQA 4W97A 2QKOA 3HTAA 5J1YA 2EH3A 2NS7A 3BJBA 2WV1A 3AQSA 5F04A 4M3GA 4MO7A 2Y2ZA 3DPJA 2YVEA 3QPSA 5HSZA 1U9OA 3NXCA 5F27A 2UXPA 2VKEA 3HE0A 3EUPA 2NS8A 2WGBA 3VW1A 5J1UA 2HQ5A 3FIWA 3VVYA 2IBDA 3LOCA 3CJDA 4AF5A 5AQCA 3VOXA 3IH4A 1U9NA 5HBUA 2JK3A 2PZ9A 2HXOA 5D18A 3KNWA 3CCYA 3BR5A 4GFKA 4JNNA 2UXUA 3ZQGA 3LSPA 5IOYA 1BJZA 1RKTA 3Q3SA 2TCTA 2Y30A 3KZ9A 4M3BA 5EZGA 2G7GA 5CXGA 4D5FA 4GFLA 3LJLA 4GCLA 5J1RA 2PBXA 3LHQA 2GFNA 3BR6A 2IAIA 4V2FA 5FGLA 2QWTA 2XGEA 5FMPA 3BTIA 1Z0XA 3BHQA 4MK6A 4X1EA 2QTQA 3EGQA 4AUXA 5IP6A 1JTYA 5J3LA 3G56A 4ICHA 4L62A 1A6IA 3VOKA 2UXOA 1SGMA 5FKLA 3GEUA 2VKVA 3VP5A 4YZEA 3HTJA 3WHCA 5HAWA 1JT0A 1VI0A 2ZB9A 3G1MA 4D7MA 4M3FA 4ACIA 3NNRA 3IH2A 2FD5A 2D6YA 3IH3A 3B81A 1QPIA 3QKXA 2HYJA 3BT9A 3BRUA 2XB5A 3T6NA 3VUQA 3VVXA 4CGRA 2F07A 5FKNA 5GPCA 1QVTA 5K58A 3BNIA 2RAEA 3Q0UA 1UI5A 3O60A 4NN1A 5K7ZA 1Z77A 4UDSA 4B1RA 2RHAA 3BR1A 5IOZA 4JKZA 3QBMA 3CDLA 5FHPA 4B3AA 3O8HA 2XDNA 5F0FA 5D19A 2G3BA 2ID6A 2I10A 5DAJA 3VVZA 3FK6A 5H9TA 2ZCMA 1ZK8A 3RH2A 4JYKA 1RPWA 4DW6A 3COLA 4ABZA 3CWRA 2IEKA 3LSJA 3O8GA 3B6CA 2JJ7A 3HTIA 4GCKA 2V57A 5F1JA 3WHBA 2DTZA 3BTCA 3VW2A 3G1OA 3P9TA 5GP9A 3V78A 2G0EA 2OI8A 3HIMA 2OPTA 3AQTA 5CXIA 5EYRA 2VPRA 4V2GA 3G1LA 4XK4A 2XGDA 3G7RA 3NPIA 2HXIA 2QOPA 1JT6A 4M3EA 2QIBA 5D1RA 1JUSA 3ZQLA 2FX0A 1T33A 3E7QA 3HGGA 3NI7A 3PPBA 3SFIA 2NX4A 3ZQHA 3TP3A 2G7LA 2NP5A 4JL3A 4W1UA 3BTJA 3VW0A 5F08A 3IUVA 5EZHA 2UXIA 3HTHA 2WUIA 3QQAA 3S5RA 2QCOA 4MXMA 3F0CA 2ZCNA 3BCGA 2X9DA 3PASA 4GCTA 4ME9A 3BR2A 3MVPA 3ANPA 4I76A 1T56A 3RD3A 2REKA 2X6OA 2FQ4A 2TRTA 3Q0VA 2Y31A 3KKCA 3BQZA 3C2BA 1ORKA 2OERA 4PXIA 4HKUA 4I6ZA 3QPLA 2ID3A 4KWAA 4D7NA 5FKOA 3HGYA 3F1BA 3BR0A 2GENA 3BR3A 5CW8A 3ZQFA 3ON2A 2IU5A 1RKWA 2W53A 3LWJA 2Q24A 4AC0A 2OF7A 2O7OA 3JSJA 1ZKGA 2XPVA 3VPRA 3CRJA 3ON4A 3C07A 3DEWA 2FBQA 2YVHA 2HKUA 2ZOYA 4M3DA 2XPWA 3NRGA 3Q0WA 2XPUA 5GPAA 3KKDA 3B6AA 1UI6A 2RASA 2FJ1A 3TP0A 4G12A 3ZQIA 5K7HA 2GUHA 3BTLA 5IPAA 2DG7A 3FK7A 5FKMA 2NP3A 5EFYA 1QVUA 3ANGA 4D5CA 5K7FA 2O7TA 3MNLA 5C4YA 3DCFA 3PM1A 5F0CA 3SDGA 2UXHA 4NELA 1JTXA 2GBYA 2ZOZA 3GZIA
chains in the Genus database with same CATH superfamily
4OD4A 1JUPA 3VIBA 1JUMA 2HYTA 2XGCA 4AC6A 5FKKA 2PFVA 2XRLA 2G7SA 2ZCXA 3BQYA 3V6GA 3LSRA 5F0HA 2DG8A 3FRQA 4W97A 2QKOA 3HTAA 5J1YA 4IRVA 2EH3A 2NS7A 3BJBA 2WV1A 3AQSA 5F04A 2A2FX 4M3GA 4MO7A 2Y2ZA 3DPJA 2YVEA 3QPSA 5HSZA 1U9OA 3NXCA 3KYLA 5F27A 2UXPA 2VKEA 3HE0A 3EUPA 2NS8A 3VTIA 2WGBA 3VW1A 5J1UA 2HQ5A 3FIWA 3VVYA 2IBDA 3LOCA 3CJDA 4AF5A 5AQCA 3VOXA 3IH4A 1U9NA 5HBUA 2JK3A 2PZ9A 2HXOA 5D18A 4C2MA 3DU6A 3KNWA 3CCYA 3BR5A 4GFKA 4JNNA 2UXUA 3ZQGA 3LSPA 5IOYA 1BJZA 1RKTA 3Q3SA 2TCTA 2Y30A 3KZ9A 4M3BA 5EZGA 2G7GA 5CXGA 4D5FA 4GFLA 3LJLA 4GCLA 5J1RA 2R7RA 2PBXA 4WIBA 3LHQA 2GFNA 3BR6A 2IAIA 4V2FA 5FGLA 2QWTA 2XGEA 5FMPA 3BTIA 1Z0XA 3BHQA 4MK6A 4X1EA 2QTQA 3EGQA 4AUXA 5IP6A 1JTYA 5J3LA 3G56A 4ICHA 4L62A 1A6IA 3VOKA 2UXOA 1SGMA 2R7VA 5FKLA 3GEUA 2VKVA 3VP5A 4YZEA 3HTJA 4OD5A 3WHCA 2R7UA 5HAWA 2ZY9A 3K8PC 1JT0A 1VI0A 2ZB9A 3G1MA 4D7MA 4M3FA 4ACIA 3NNRA 3IH2A 2FD5A 2D6YA 3IH3A 3B81A 1QPIA 3QKXA 2HYJA 3BT9A 3BRUA 2XB5A 3T6NA 3VUQA 3VVXA 4CGRA 2F07A 5FKNA 5GPCA 1QVTA 5K58A 3BNIA 2R7XA 2RAEA 3Q0UA 1UI5A 3O60A 4NN1A 5K7ZA 1Z77A 4UDSA 4B1RA 2RHAA 2R7QA 3BR1A 5IOZA 4JKZA 3QBMA 3CDLA 5FHPA 4B3AA 3O8HA 2XDNA 5F0FA 5D19A 2G3BA 2ID6A 2I10A 5DAJA 3VVZA 3FK6A 5H9TA 2ZCMA 1ZK8A 3RH2A 4JYKA 1RPWA 4DW6A 3COLA 4ABZA 3CWRA 2IEKA 3LSJA 3O8GA 3B6CA 2JJ7A 2FJI1 3HTIA 4GCKA 2V57A 5F1JA 3WHBA 3FHNA 2DTZA 3BTCA 3VW2A 3G1OA 3P9TA 5GP9A 3V78A 2G0EA 2OI8A 3HIMA 2OPTA 3AQTA 5CXIA 5EYRA 2VPRA 4V2GA 3G1LA 4XK4A 2XGDA 2R7OA 3G7RA 3NPIA 2HXIA 2QOPA 1JT6A 4M3EA 2QIBA 5D1RA 1JUSA 4DVYP 3ZQLA 2FX0A 1T33A 3E7QA 3HGGA 3NI7A 3PPBA 3SFIA 2NX4A 3ZQHA 3TP3A 2G7LA 2NP5A 4JL3A 2B1EA 4W1UA 3BTJA 3VW0A 5F08A 3IUVA 5EZHA 3DU5A 2UXIA 3HTHA 2WUIA 3QQAA 3S5RA 2QCOA 4MXMA 3F0CA 2ZCNA 3BCGA 2X9DA 3PASA 4GCTA 4ME9A 3BR2A 3MVPA 3ANPA 4I76A 1T56A 3RD3A 2REKA 2X6OA 2FQ4A 2TRTA 3Q0VA 2Y31A 3KKCA 3BQZA 3C2BA 1ORKA 2OERA 4PXIA 4HKUA 4I6ZA 3QPLA 2ID3A 4KWAA 4D7NA 5FKOA 3HGYA 3F1BA 3BR0A 2GENA 3BR3A 5CW8A 3ZQFA 3ON2A 2IU5A 1RKWA 2W53A 3LWJA 2R7TA 2Q24A 4AC0A 2OF7A 2O7OA 3JSJA 1ZKGA 2XPVA 4U9LA 3VPRA 3CRJA 3ON4A 3C07A 3DEWA 2FBQA 2YVHA 2HKUA 2ZOYA 4M3DA 2XPWA 3NS4A 3NRGA 3Q0WA 2XPUA 5GPAA 3KKDA 3B6AA 1UI6A 2RASA 2FJ1A 3TP0A 4G12A 3ZQIA 5K7HA 2GUHA 3BTLA 5IPAA 2YVXA 2R7WA 2DG7A 3FK7A 5FKMA 2NP3A 5EFYA 2R7SA 1QVUA 3ANGA 2B3WA 4D5CA 5K7FA 2O7TA 3MNLA 5C4YA 3SWHA 3DCFA 3PM1A 5F0CA 3SDGA 2UXHA 4NELA 1JTXA 4U9NA 2GBYA 2ZOZA 5CQGA 3GZIA
chains in the Genus database with same CATH topology
1JUPA 3VIBA 1JUMA 2HYTA 2XGCA 4AC6A 5FKKA 2XRLA 2G7SA 2ZCXA 3BQYA 3V6GA 3LSRA 5F0HA 2DG8A 3FRQA 4W97A 2QKOA 3HTAA 5J1YA 2EH3A 2NS7A 3BJBA 2WV1A 3AQSA 5F04A 4M3GA 4MO7A 2Y2ZA 3DPJA 2YVEA 3QPSA 5HSZA 1U9OA 3NXCA 5F27A 2UXPA 2VKEA 3HE0A 3EUPA 2NS8A 2WGBA 3VW1A 5J1UA 2HQ5A 3FIWA 3VVYA 2IBDA 3LOCA 3CJDA 4AF5A 5AQCA 3VOXA 3IH4A 1U9NA 5HBUA 2JK3A 2PZ9A 2HXOA 5D18A 3KNWA 3CCYA 3BR5A 4GFKA 4JNNA 2UXUA 3ZQGA 3LSPA 5IOYA 1BJZA 1RKTA 3Q3SA 2TCTA 2Y30A 3KZ9A 4M3BA 5EZGA 2G7GA 5CXGA 4D5FA 4GFLA 3LJLA 4GCLA 5J1RA 2PBXA 3LHQA 2GFNA 3BR6A 2IAIA 4V2FA 5FGLA 2QWTA 2XGEA 5FMPA 3BTIA 1Z0XA 3BHQA 4MK6A 4X1EA 2QTQA 3EGQA 4AUXA 5IP6A 1JTYA 5J3LA 3G56A 4ICHA 4L62A 1A6IA 3VOKA 2UXOA 1SGMA 5FKLA 3GEUA 2VKVA 3VP5A 4YZEA 3HTJA 3WHCA 5HAWA 1JT0A 1VI0A 2ZB9A 3G1MA 4D7MA 4M3FA 4ACIA 3NNRA 3IH2A 2FD5A 2D6YA 3IH3A 3B81A 1QPIA 3QKXA 2HYJA 3BT9A 3BRUA 2XB5A 3T6NA 3VUQA 3VVXA 4CGRA 2F07A 5FKNA 5GPCA 1QVTA 5K58A 3BNIA 2RAEA 3Q0UA 1UI5A 3O60A 4NN1A 5K7ZA 1Z77A 4UDSA 4B1RA 2RHAA 3BR1A 5IOZA 4JKZA 3QBMA 3CDLA 5FHPA 4B3AA 3O8HA 2XDNA 5F0FA 5D19A 2G3BA 2ID6A 2I10A 5DAJA 3VVZA 3FK6A 5H9TA 2ZCMA 1ZK8A 3RH2A 4JYKA 1RPWA 4DW6A 3COLA 4ABZA 3CWRA 2IEKA 3LSJA 3O8GA 3B6CA 2JJ7A 3HTIA 4GCKA 2V57A 5F1JA 3WHBA 2DTZA 3BTCA 3VW2A 3G1OA 3P9TA 5GP9A 3V78A 2G0EA 2OI8A 3HIMA 2OPTA 3AQTA 5CXIA 5EYRA 2VPRA 4V2GA 3G1LA 4XK4A 2XGDA 3G7RA 3NPIA 2HXIA 2QOPA 1JT6A 4M3EA 2QIBA 5D1RA 1JUSA 3ZQLA 2FX0A 1T33A 3E7QA 3HGGA 3NI7A 3PPBA 3SFIA 2NX4A 3ZQHA 3TP3A 2G7LA 2NP5A 4JL3A 4W1UA 3BTJA 3VW0A 5F08A 3IUVA 5EZHA 2UXIA 3HTHA 2WUIA 3QQAA 3S5RA 2QCOA 4MXMA 3F0CA 2ZCNA 3BCGA 2X9DA 3PASA 4GCTA 4ME9A 3BR2A 3MVPA 3ANPA 4I76A 1T56A 3RD3A 2REKA 2X6OA 2FQ4A 2TRTA 3Q0VA 2Y31A 3KKCA 3BQZA 3C2BA 1ORKA 2OERA 4PXIA 4HKUA 4I6ZA 3QPLA 2ID3A 4KWAA 4D7NA 5FKOA 3HGYA 3F1BA 3BR0A 2GENA 3BR3A 5CW8A 3ZQFA 3ON2A 2IU5A 1RKWA 2W53A 3LWJA 2Q24A 4AC0A 2OF7A 2O7OA 3JSJA 1ZKGA 2XPVA 3VPRA 3CRJA 3ON4A 3C07A 3DEWA 2FBQA 2YVHA 2HKUA 2ZOYA 4M3DA 2XPWA 3NRGA 3Q0WA 2XPUA 5GPAA 3KKDA 3B6AA 1UI6A 2RASA 2FJ1A 3TP0A 4G12A 3ZQIA 5K7HA 2GUHA 3BTLA 5IPAA 2DG7A 3FK7A 5FKMA 2NP3A 5EFYA 1QVUA 3ANGA 4D5CA 5K7FA 2O7TA 3MNLA 5C4YA 3DCFA 3PM1A 5F0CA 3SDGA 2UXHA 4NELA 1JTXA 2GBYA 2ZOZA 3GZIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JUP A;  3VIB A;  1JUM A;  2HYT A;  2XGC A;  4AC6 A;  5FKK A;  2XRL A;  2G7S A;  2ZCX A;  3BQY A;  3V6G A;  3LSR A;  5F0H A;  2DG8 A;  3FRQ A;  4W97 A;  2QKO A;  3HTA A;  5J1Y A;  2EH3 A;  2NS7 A;  3BJB A;  2WV1 A;  3AQS A;  5F04 A;  4M3G A;  4MO7 A;  2Y2Z A;  3DPJ A;  2YVE A;  3QPS A;  5HSZ A;  1U9O A;  3NXC A;  5F27 A;  2UXP A;  2VKE A;  3HE0 A;  3EUP A;  2NS8 A;  2WGB A;  3VW1 A;  5J1U A;  2HQ5 A;  3FIW A;  3VVY A;  2IBD A;  3LOC A;  3CJD A;  4AF5 A;  5AQC A;  3VOX A;  3IH4 A;  1U9N A;  5HBU A;  2JK3 A;  2PZ9 A;  2HXO A;  5D18 A;  3KNW A;  3CCY A;  3BR5 A;  4GFK A;  4JNN A;  2UXU A;  3ZQG A;  3LSP A;  5IOY A;  1BJZ A;  1RKT A;  3Q3S A;  2TCT A;  2Y30 A;  3KZ9 A;  4M3B A;  5EZG A;  2G7G A;  5CXG A;  4D5F A;  4GFL A;  3LJL A;  4GCL A;  5J1R A;  2PBX A;  3LHQ A;  2GFN A;  3BR6 A;  2IAI A;  4V2F A;  5FGL A;  2QWT A;  2XGE A;  5FMP A;  3BTI A;  1Z0X A;  3BHQ A;  4MK6 A;  4X1E A;  2QTQ A;  3EGQ A;  4AUX A;  5IP6 A;  1JTY A;  5J3L A;  3G56 A;  4ICH A;  4L62 A;  1A6I A;  3VOK A;  2UXO A;  1SGM A;  5FKL A;  3GEU A;  2VKV A;  3VP5 A;  4YZE A;  3HTJ A;  3WHC A;  5HAW A;  1JT0 A;  1VI0 A;  2ZB9 A;  3G1M A;  4D7M A;  4M3F A;  4ACI A;  3NNR A;  3IH2 A;  2FD5 A;  2D6Y A;  3IH3 A;  3B81 A;  1QPI A;  3QKX A;  2HYJ A;  3BT9 A;  3BRU A;  2XB5 A;  3T6N A;  3VUQ A;  3VVX A;  4CGR A;  2F07 A;  5FKN A;  5GPC A;  1QVT A;  5K58 A;  3BNI A;  2RAE A;  3Q0U A;  1UI5 A;  3O60 A;  4NN1 A;  5K7Z A;  1Z77 A;  4UDS A;  4B1R A;  2RHA A;  3BR1 A;  5IOZ A;  4JKZ A;  3QBM A;  3CDL A;  5FHP A;  4B3A A;  3O8H A;  2XDN A;  5F0F A;  5D19 A;  2G3B A;  2ID6 A;  2I10 A;  5DAJ A;  3VVZ A;  3FK6 A;  5H9T A;  2ZCM A;  1ZK8 A;  3RH2 A;  4JYK A;  1RPW A;  4DW6 A;  3COL A;  4ABZ A;  3CWR A;  2IEK A;  3LSJ A;  3O8G A;  3B6C A;  2JJ7 A;  3HTI A;  4GCK A;  2V57 A;  5F1J A;  3WHB A;  2DTZ A;  3BTC A;  3VW2 A;  3G1O A;  3P9T A;  5GP9 A;  3V78 A;  2G0E A;  2OI8 A;  3HIM A;  2OPT A;  3AQT A;  5CXI A;  5EYR A;  2VPR A;  4V2G A;  3G1L A;  4XK4 A;  2XGD A;  3G7R A;  3NPI A;  2HXI A;  2QOP A;  1JT6 A;  4M3E A;  2QIB A;  5D1R A;  1JUS A;  3ZQL A;  2FX0 A;  1T33 A;  3E7Q A;  3HGG A;  3NI7 A;  3PPB A;  3SFI A;  2NX4 A;  3ZQH A;  3TP3 A;  2G7L A;  2NP5 A;  4JL3 A;  4W1U A;  3BTJ A;  3VW0 A;  5F08 A;  3IUV A;  5EZH A;  2UXI A;  3HTH A;  2WUI A;  3QQA A;  3S5R A;  2QCO A;  4MXM A;  3F0C A;  2ZCN A;  3BCG A;  2X9D A;  3PAS A;  4GCT A;  4ME9 A;  3BR2 A;  3MVP A;  3ANP A;  4I76 A;  1T56 A;  3RD3 A;  2REK A;  2X6O A;  2FQ4 A;  2TRT A;  3Q0V A;  2Y31 A;  3KKC A;  3BQZ A;  3C2B A;  1ORK A;  2OER A;  4PXI A;  4HKU A;  4I6Z A;  3QPL A;  2ID3 A;  4KWA A;  4D7N A;  5FKO A;  3HGY A;  3F1B A;  3BR0 A;  2GEN A;  3BR3 A;  5CW8 A;  3ZQF A;  3ON2 A;  2IU5 A;  1RKW A;  2W53 A;  3LWJ A;  2Q24 A;  4AC0 A;  2OF7 A;  2O7O A;  3JSJ A;  1ZKG A;  2XPV A;  3VPR A;  3CRJ A;  3ON4 A;  3C07 A;  3DEW A;  2FBQ A;  2YVH A;  2HKU A;  2ZOY A;  4M3D A;  2XPW A;  3NRG A;  3Q0W A;  2XPU A;  5GPA A;  3KKD A;  3B6A A;  1UI6 A;  2RAS A;  2FJ1 A;  3TP0 A;  4G12 A;  3ZQI A;  5K7H A;  2GUH A;  3BTL A;  5IPA A;  2DG7 A;  3FK7 A;  5FKM A;  2NP3 A;  5EFY A;  1QVU A;  3ANG A;  4D5C A;  5K7F A;  2O7T A;  3MNL A;  5C4Y A;  3DCF A;  3PM1 A;  5F0C A;  3SDG A;  2UXH A;  4NEL A;  1JTX A;  2GBY A;  2ZOZ A;  3GZI A; 
#chains in the Genus database with same CATH topology
 4OD4 A;  1JUP A;  3VIB A;  1JUM A;  2HYT A;  2XGC A;  4AC6 A;  5FKK A;  2PFV A;  2XRL A;  2G7S A;  2ZCX A;  3BQY A;  3V6G A;  3LSR A;  5F0H A;  2DG8 A;  3FRQ A;  4W97 A;  2QKO A;  3HTA A;  5J1Y A;  4IRV A;  2EH3 A;  2NS7 A;  3BJB A;  2WV1 A;  3AQS A;  5F04 A;  2A2F X;  4M3G A;  4MO7 A;  2Y2Z A;  3DPJ A;  2YVE A;  3QPS A;  5HSZ A;  1U9O A;  3NXC A;  3KYL A;  5F27 A;  2UXP A;  2VKE A;  3HE0 A;  3EUP A;  2NS8 A;  3VTI A;  2WGB A;  3VW1 A;  5J1U A;  2HQ5 A;  3FIW A;  3VVY A;  2IBD A;  3LOC A;  3CJD A;  4AF5 A;  5AQC A;  3VOX A;  3IH4 A;  1U9N A;  5HBU A;  2JK3 A;  2PZ9 A;  2HXO A;  5D18 A;  4C2M A;  3DU6 A;  3KNW A;  3CCY A;  3BR5 A;  4GFK A;  4JNN A;  2UXU A;  3ZQG A;  3LSP A;  5IOY A;  1BJZ A;  1RKT A;  3Q3S A;  2TCT A;  2Y30 A;  3KZ9 A;  4M3B A;  5EZG A;  2G7G A;  5CXG A;  4D5F A;  4GFL A;  3LJL A;  4GCL A;  5J1R A;  2R7R A;  2PBX A;  4WIB A;  3LHQ A;  2GFN A;  3BR6 A;  2IAI A;  4V2F A;  5FGL A;  2QWT A;  2XGE A;  5FMP A;  3BTI A;  1Z0X A;  3BHQ A;  4MK6 A;  4X1E A;  2QTQ A;  3EGQ A;  4AUX A;  5IP6 A;  1JTY A;  5J3L A;  3G56 A;  4ICH A;  4L62 A;  1A6I A;  3VOK A;  2UXO A;  1SGM A;  2R7V A;  5FKL A;  3GEU A;  2VKV A;  3VP5 A;  4YZE A;  3HTJ A;  4OD5 A;  3WHC A;  2R7U A;  5HAW A;  2ZY9 A;  3K8P C;  1JT0 A;  1VI0 A;  2ZB9 A;  3G1M A;  4D7M A;  4M3F A;  4ACI A;  3NNR A;  3IH2 A;  2FD5 A;  2D6Y A;  3IH3 A;  3B81 A;  1QPI A;  3QKX A;  2HYJ A;  3BT9 A;  3BRU A;  2XB5 A;  3T6N A;  3VUQ A;  3VVX A;  4CGR A;  2F07 A;  5FKN A;  5GPC A;  1QVT A;  5K58 A;  3BNI A;  2R7X A;  2RAE A;  3Q0U A;  1UI5 A;  3O60 A;  4NN1 A;  5K7Z A;  1Z77 A;  4UDS A;  4B1R A;  2RHA A;  2R7Q A;  3BR1 A;  5IOZ A;  4JKZ A;  3QBM A;  3CDL A;  5FHP A;  4B3A A;  3O8H A;  2XDN A;  5F0F A;  5D19 A;  2G3B A;  2ID6 A;  2I10 A;  5DAJ A;  3VVZ A;  3FK6 A;  5H9T A;  2ZCM A;  1ZK8 A;  3RH2 A;  4JYK A;  1RPW A;  4DW6 A;  3COL A;  4ABZ A;  3CWR A;  2IEK A;  3LSJ A;  3O8G A;  3B6C A;  2JJ7 A;  2FJI 1;  3HTI A;  4GCK A;  2V57 A;  5F1J A;  3WHB A;  3FHN A;  2DTZ A;  3BTC A;  3VW2 A;  3G1O A;  3P9T A;  5GP9 A;  3V78 A;  2G0E A;  2OI8 A;  3HIM A;  2OPT A;  3AQT A;  5CXI A;  5EYR A;  2VPR A;  4V2G A;  3G1L A;  4XK4 A;  2XGD A;  2R7O A;  3G7R A;  3NPI A;  2HXI A;  2QOP A;  1JT6 A;  4M3E A;  2QIB A;  5D1R A;  1JUS A;  4DVY P;  3ZQL A;  2FX0 A;  1T33 A;  3E7Q A;  3HGG A;  3NI7 A;  3PPB A;  3SFI A;  2NX4 A;  3ZQH A;  3TP3 A;  2G7L A;  2NP5 A;  4JL3 A;  2B1E A;  4W1U A;  3BTJ A;  3VW0 A;  5F08 A;  3IUV A;  5EZH A;  3DU5 A;  2UXI A;  3HTH A;  2WUI A;  3QQA A;  3S5R A;  2QCO A;  4MXM A;  3F0C A;  2ZCN A;  3BCG A;  2X9D A;  3PAS A;  4GCT A;  4ME9 A;  3BR2 A;  3MVP A;  3ANP A;  4I76 A;  1T56 A;  3RD3 A;  2REK A;  2X6O A;  2FQ4 A;  2TRT A;  3Q0V A;  2Y31 A;  3KKC A;  3BQZ A;  3C2B A;  1ORK A;  2OER A;  4PXI A;  4HKU A;  4I6Z A;  3QPL A;  2ID3 A;  4KWA A;  4D7N A;  5FKO A;  3HGY A;  3F1B A;  3BR0 A;  2GEN A;  3BR3 A;  5CW8 A;  3ZQF A;  3ON2 A;  2IU5 A;  1RKW A;  2W53 A;  3LWJ A;  2R7T A;  2Q24 A;  4AC0 A;  2OF7 A;  2O7O A;  3JSJ A;  1ZKG A;  2XPV A;  4U9L A;  3VPR A;  3CRJ A;  3ON4 A;  3C07 A;  3DEW A;  2FBQ A;  2YVH A;  2HKU A;  2ZOY A;  4M3D A;  2XPW A;  3NS4 A;  3NRG A;  3Q0W A;  2XPU A;  5GPA A;  3KKD A;  3B6A A;  1UI6 A;  2RAS A;  2FJ1 A;  3TP0 A;  4G12 A;  3ZQI A;  5K7H A;  2GUH A;  3BTL A;  5IPA A;  2YVX A;  2R7W A;  2DG7 A;  3FK7 A;  5FKM A;  2NP3 A;  5EFY A;  2R7S A;  1QVU A;  3ANG A;  2B3W A;  4D5C A;  5K7F A;  2O7T A;  3MNL A;  5C4Y A;  3SWH A;  3DCF A;  3PM1 A;  5F0C A;  3SDG A;  2UXH A;  4NEL A;  1JTX A;  4U9N A;  2GBY A;  2ZOZ A;  5CQG A;  3GZI A; 
#chains in the Genus database with same CATH homology
 1JUP A;  3VIB A;  1JUM A;  2HYT A;  2XGC A;  4AC6 A;  5FKK A;  2XRL A;  2G7S A;  2ZCX A;  3BQY A;  3V6G A;  3LSR A;  5F0H A;  2DG8 A;  3FRQ A;  4W97 A;  2QKO A;  3HTA A;  5J1Y A;  2EH3 A;  2NS7 A;  3BJB A;  2WV1 A;  3AQS A;  5F04 A;  4M3G A;  4MO7 A;  2Y2Z A;  3DPJ A;  2YVE A;  3QPS A;  5HSZ A;  1U9O A;  3NXC A;  5F27 A;  2UXP A;  2VKE A;  3HE0 A;  3EUP A;  2NS8 A;  2WGB A;  3VW1 A;  5J1U A;  2HQ5 A;  3FIW A;  3VVY A;  2IBD A;  3LOC A;  3CJD A;  4AF5 A;  5AQC A;  3VOX A;  3IH4 A;  1U9N A;  5HBU A;  2JK3 A;  2PZ9 A;  2HXO A;  5D18 A;  3KNW A;  3CCY A;  3BR5 A;  4GFK A;  4JNN A;  2UXU A;  3ZQG A;  3LSP A;  5IOY A;  1BJZ A;  1RKT A;  3Q3S A;  2TCT A;  2Y30 A;  3KZ9 A;  4M3B A;  5EZG A;  2G7G A;  5CXG A;  4D5F A;  4GFL A;  3LJL A;  4GCL A;  5J1R A;  2PBX A;  3LHQ A;  2GFN A;  3BR6 A;  2IAI A;  4V2F A;  5FGL A;  2QWT A;  2XGE A;  5FMP A;  3BTI A;  1Z0X A;  3BHQ A;  4MK6 A;  4X1E A;  2QTQ A;  3EGQ A;  4AUX A;  5IP6 A;  1JTY A;  5J3L A;  3G56 A;  4ICH A;  4L62 A;  1A6I A;  3VOK A;  2UXO A;  1SGM A;  5FKL A;  3GEU A;  2VKV A;  3VP5 A;  4YZE A;  3HTJ A;  3WHC A;  5HAW A;  1JT0 A;  1VI0 A;  2ZB9 A;  3G1M A;  4D7M A;  4M3F A;  4ACI A;  3NNR A;  3IH2 A;  2FD5 A;  2D6Y A;  3IH3 A;  3B81 A;  1QPI A;  3QKX A;  2HYJ A;  3BT9 A;  3BRU A;  2XB5 A;  3T6N A;  3VUQ A;  3VVX A;  4CGR A;  2F07 A;  5FKN A;  5GPC A;  1QVT A;  5K58 A;  3BNI A;  2RAE A;  3Q0U A;  1UI5 A;  3O60 A;  4NN1 A;  5K7Z A;  1Z77 A;  4UDS A;  4B1R A;  2RHA A;  3BR1 A;  5IOZ A;  4JKZ A;  3QBM A;  3CDL A;  5FHP A;  4B3A A;  3O8H A;  2XDN A;  5F0F A;  5D19 A;  2G3B A;  2ID6 A;  2I10 A;  5DAJ A;  3VVZ A;  3FK6 A;  5H9T A;  2ZCM A;  1ZK8 A;  3RH2 A;  4JYK A;  1RPW A;  4DW6 A;  3COL A;  4ABZ A;  3CWR A;  2IEK A;  3LSJ A;  3O8G A;  3B6C A;  2JJ7 A;  3HTI A;  4GCK A;  2V57 A;  5F1J A;  3WHB A;  2DTZ A;  3BTC A;  3VW2 A;  3G1O A;  3P9T A;  5GP9 A;  3V78 A;  2G0E A;  2OI8 A;  3HIM A;  2OPT A;  3AQT A;  5CXI A;  5EYR A;  2VPR A;  4V2G A;  3G1L A;  4XK4 A;  2XGD A;  3G7R A;  3NPI A;  2HXI A;  2QOP A;  1JT6 A;  4M3E A;  2QIB A;  5D1R A;  1JUS A;  3ZQL A;  2FX0 A;  1T33 A;  3E7Q A;  3HGG A;  3NI7 A;  3PPB A;  3SFI A;  2NX4 A;  3ZQH A;  3TP3 A;  2G7L A;  2NP5 A;  4JL3 A;  4W1U A;  3BTJ A;  3VW0 A;  5F08 A;  3IUV A;  5EZH A;  2UXI A;  3HTH A;  2WUI A;  3QQA A;  3S5R A;  2QCO A;  4MXM A;  3F0C A;  2ZCN A;  3BCG A;  2X9D A;  3PAS A;  4GCT A;  4ME9 A;  3BR2 A;  3MVP A;  3ANP A;  4I76 A;  1T56 A;  3RD3 A;  2REK A;  2X6O A;  2FQ4 A;  2TRT A;  3Q0V A;  2Y31 A;  3KKC A;  3BQZ A;  3C2B A;  1ORK A;  2OER A;  4PXI A;  4HKU A;  4I6Z A;  3QPL A;  2ID3 A;  4KWA A;  4D7N A;  5FKO A;  3HGY A;  3F1B A;  3BR0 A;  2GEN A;  3BR3 A;  5CW8 A;  3ZQF A;  3ON2 A;  2IU5 A;  1RKW A;  2W53 A;  3LWJ A;  2Q24 A;  4AC0 A;  2OF7 A;  2O7O A;  3JSJ A;  1ZKG A;  2XPV A;  3VPR A;  3CRJ A;  3ON4 A;  3C07 A;  3DEW A;  2FBQ A;  2YVH A;  2HKU A;  2ZOY A;  4M3D A;  2XPW A;  3NRG A;  3Q0W A;  2XPU A;  5GPA A;  3KKD A;  3B6A A;  1UI6 A;  2RAS A;  2FJ1 A;  3TP0 A;  4G12 A;  3ZQI A;  5K7H A;  2GUH A;  3BTL A;  5IPA A;  2DG7 A;  3FK7 A;  5FKM A;  2NP3 A;  5EFY A;  1QVU A;  3ANG A;  4D5C A;  5K7F A;  2O7T A;  3MNL A;  5C4Y A;  3DCF A;  3PM1 A;  5F0C A;  3SDG A;  2UXH A;  4NEL A;  1JTX A;  2GBY A;  2ZOZ A;  3GZI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...