4JKZA

Crystal structure of ms6564 from mycobacterium smegmatis
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
179
structure length
179
Chain Sequence
SEKSRVAIVEATRALLLERGFDGLSIEAVAAKAGVGKQTIYRWWPSRHALVADVLLEDADKILARMPKTDDVTADLASWAGTLAAALTTRRGHAMLKTLMAASLEHEDTAARLREGFSRPLIESVRDRLRDEDIDADHAQAAADALLGAVVNAVLSEGRSYSRQRAETSARIIVAGLRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, TetR family
publication title Structural basis for interaction between M. smegmatis Ms6564, a TetR family master regulator, and its target DNA.
rcsb
source organism Mycobacterium smegmatis
molecule tags Transcription
total genus 68
structure length 179
sequence length 179
ec nomenclature
pdb deposition date 2013-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF16859 TetR_C_11 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 4jkzA00
2FQ4A 4X1EA 5F27A 3P9TA 2NS8A 4NELA 4HKUA 3ZQLA 5HSZA 1SGMA 3B6CA 4JNNA 4M3EA 2UXOA 3RH2A 2DG8A 1U9OA 3EUPA 2I10A 3WHBA 2IBDA 2ID6A 5J1YA 1JUMA 1QVTA 5CXIA 2JK3A 3G1OA 2FBQA 4D5FA 2OI8A 2VKEA 3QBMA 2QWTA 5D19A 3BTJA 4GCLA 5EFYA 3LOCA 5FKLA 3G56A 1ZKGA 5J3LA 2X9DA 5DAJA 3CDLA 3ANPA 1Z77A 4JL3A 2RHAA 3BR5A 4GFLA 4DW6A 3QQAA 3BTCA 3LWJA 5K7ZA 2UXHA 2Y31A 3LSJA 1JT6A 2XGDA 3CWRA 4MXMA 2GFNA 4UDSA 4M3BA 3KZ9A 3SDGA 3G1MA 3HGGA 4ME9A 4V2GA 1QPIA 3BT9A 4YZEA 3F1BA 4JYKA 2YVHA 1A6IA 3FK6A 1JUSA 5K58A 2XGEA 3DEWA 3HTHA 2QTQA 5IOYA 3CCYA 3COLA 5FKNA 3BR0A 3HTAA 3HTIA 2XPWA 3HE0A 5GPAA 2PZ9A 1JTXA 2VKVA 3VW0A 1RPWA 1RKWA 2OF7A 2WGBA 3GEUA 2HXIA 3ZQIA 1VI0A 4MO7A 3QPSA 4G12A 5CW8A 4ABZA 3HTJA 4D5CA 5EYRA 3CJDA 2IAIA 3PASA 2XPUA 3HIMA 3LSPA 3VVYA 3AQTA 5HAWA 3LJLA 3DPJA 3VOXA 5F0FA 3BR1A 2O7TA 3G1LA 4D7MA 2Q24A 3BTLA 1QVUA 3ANGA 3V78A 2ZB9A 2XRLA 3BR2A 2DTZA 3KNWA 2IEKA 1JT0A 3BCGA 4ACIA 5AQCA 4GCTA 3VIBA 2PBXA 3V6GA 5IPAA 4JKZA 3BRUA 3NPIA 2NP3A 2XDNA 3MVPA 3EGQA 2WV1A 2ZOZA 3BHQA 3IH2A 4NN1A 1T33A 2HYJA 5FGLA 1ORKA 5FKKA 5CXGA 2ZCMA 3Q0WA 2QIBA 4V2FA 3BR6A 1ZK8A 4M3GA 2Y30A 4KWAA 3C07A 3QPLA 3G7RA 4XK4A 2V57A 3VUQA 1JUPA 3Q0UA 5EZGA 4GFKA 5FKOA 2YVEA 2GBYA 4AC6A 3MNLA 3LHQA 3E7QA 4AC0A 2UXUA 3LSRA 4CGRA 2G7SA 1T56A 5HBUA 2QOPA 4PXIA 2HKUA 3PM1A 3QKXA 2UXPA 1BJZA 4AUXA 2OERA 3KKCA 1Z0XA 3DCFA 3ZQFA 4ICHA 3BNIA 2OPTA 3NNRA 3ON2A 3BR3A 5D18A 1RKTA 5K7HA 2WUIA 2GUHA 3CRJA 5FMPA 2QCOA 2X6OA 1UI5A 3SFIA 3FRQA 2IU5A 2D6YA 2FJ1A 5GPCA 3RD3A 4MK6A 2XPVA 2F07A 2G0EA 3ON4A 2TCTA 4I6ZA 5K7FA 5F0CA 2W53A 5F1JA 5C4YA 2Y2ZA 5F08A 4I76A 2VPRA 3O60A 2GENA 3FIWA 5IOZA 3AQSA 5H9TA 2NP5A 4W97A 4M3DA 3B6AA 3B81A 1UI6A 3Q0VA 3VW2A 5FHPA 2G3BA 2TRTA 3GZIA 3FK7A 1U9NA 2UXIA 4D7NA 3VVZA 3S5RA 3TP0A 2NX4A 3VP5A 3BQZA 4W1UA 2RASA 2G7LA 3IH3A 3VPRA 3TP3A 4M3FA 4L62A 2HXOA 3NRGA 3VVXA 3F0CA 5EZHA 3VW1A 2XGCA 3PPBA 5D1RA 2HYTA 2ZCNA 2XB5A 4B3AA 5F0HA 4GCKA 3NXCA 3ZQHA 3ZQGA 2FD5A 2RAEA 2FX0A 3VOKA 2O7OA 5J1UA 2G7GA 1JTYA 2JJ7A 3BQYA 5J1RA 3O8HA 2ZCXA 2QKOA 5FKMA 2DG7A 3BJBA 4B1RA 2HQ5A 5IP6A 3O8GA 2EH3A 2ID3A 2ZOYA 3IUVA 3HGYA 4AF5A 3T6NA 5F04A 3Q3SA 3C2BA 3IH4A 2REKA 3JSJA 3NI7A 2NS7A 3KKDA 5GP9A 3WHCA 3BTIA
chains in the Genus database with same CATH superfamily
2FQ4A 4X1EA 5F27A 3P9TA 2NS8A 4NELA 2R7SA 4HKUA 3ZQLA 5HSZA 1SGMA 3B6CA 4JNNA 4M3EA 2UXOA 3RH2A 2DG8A 1U9OA 3EUPA 2I10A 3WHBA 2IBDA 2ID6A 5J1YA 1JUMA 1QVTA 5CXIA 2JK3A 3DU6A 3G1OA 2FBQA 4D5FA 2OI8A 2VKEA 3QBMA 2QWTA 5D19A 3BTJA 4GCLA 5EFYA 3LOCA 5FKLA 3G56A 1ZKGA 5J3LA 3K8PC 2X9DA 5DAJA 3CDLA 3ANPA 1Z77A 4JL3A 2RHAA 3BR5A 4GFLA 4DW6A 3QQAA 3BTCA 3LWJA 2R7WA 5K7ZA 2UXHA 2Y31A 3LSJA 1JT6A 2XGDA 2B1EA 3CWRA 2R7UA 4MXMA 2GFNA 4UDSA 4M3BA 3KZ9A 3SDGA 3G1MA 3HGGA 4ME9A 4V2GA 1QPIA 4U9NA 3BT9A 4YZEA 3F1BA 4JYKA 2YVHA 1A6IA 3FK6A 1JUSA 5K58A 2XGEA 4WIBA 3DEWA 3FHNA 3HTHA 2FJI1 2QTQA 5IOYA 3CCYA 3COLA 5FKNA 3BR0A 3HTAA 3HTIA 2XPWA 3HE0A 5GPAA 2PZ9A 1JTXA 2VKVA 3VW0A 1RPWA 1RKWA 2OF7A 2WGBA 3GEUA 2HXIA 3ZQIA 1VI0A 4MO7A 3QPSA 4G12A 5CW8A 4ABZA 3HTJA 4D5CA 5EYRA 3CJDA 2IAIA 3PASA 2XPUA 3HIMA 3LSPA 3VVYA 3AQTA 5HAWA 3SWHA 3LJLA 2PFVA 3DPJA 3VOXA 5F0FA 3BR1A 2O7TA 3G1LA 4D7MA 2Q24A 3BTLA 1QVUA 3ANGA 3V78A 2ZB9A 2XRLA 3BR2A 2DTZA 3KNWA 2IEKA 1JT0A 3BCGA 4ACIA 5AQCA 4GCTA 3VIBA 2PBXA 3V6GA 5IPAA 4JKZA 3BRUA 3NPIA 2NP3A 2XDNA 3MVPA 3EGQA 2WV1A 2ZOZA 3BHQA 3IH2A 4NN1A 1T33A 2HYJA 5FGLA 1ORKA 5FKKA 5CXGA 2ZCMA 3Q0WA 2QIBA 4V2FA 3BR6A 1ZK8A 4M3GA 2Y30A 4KWAA 3C07A 3QPLA 3G7RA 4XK4A 2V57A 3VUQA 1JUPA 3Q0UA 5EZGA 4GFKA 5FKOA 2YVEA 2GBYA 4AC6A 3MNLA 3LHQA 3E7QA 4AC0A 2UXUA 2R7TA 3LSRA 4CGRA 2G7SA 1T56A 5HBUA 2QOPA 3VTIA 4PXIA 2HKUA 3PM1A 3QKXA 2UXPA 1BJZA 4AUXA 2OERA 3KKCA 1Z0XA 3DCFA 3ZQFA 4ICHA 2YVXA 3BNIA 2OPTA 3NNRA 3ON2A 3BR3A 5D18A 1RKTA 5K7HA 2WUIA 2GUHA 3CRJA 5FMPA 2QCOA 2X6OA 2R7OA 3NS4A 4DVYP 1UI5A 3SFIA 3FRQA 2IU5A 2D6YA 2FJ1A 5GPCA 3RD3A 4MK6A 2XPVA 2F07A 2G0EA 3ON4A 2TCTA 4I6ZA 5K7FA 2ZY9A 5F0CA 2W53A 5F1JA 5C4YA 2Y2ZA 5F08A 4I76A 2VPRA 3O60A 2GENA 3FIWA 5IOZA 3AQSA 5H9TA 2NP5A 4W97A 4M3DA 3B6AA 4OD4A 3DU5A 3B81A 1UI6A 3Q0VA 3VW2A 5FHPA 2G3BA 2TRTA 3GZIA 3FK7A 1U9NA 2UXIA 4D7NA 2R7QA 3VVZA 4C2MA 3S5RA 3TP0A 2NX4A 3VP5A 3BQZA 4W1UA 2RASA 2R7XA 2G7LA 3IH3A 3VPRA 3TP3A 4M3FA 4L62A 2HXOA 3NRGA 4U9LA 3VVXA 3F0CA 5EZHA 3VW1A 2XGCA 2R7VA 3PPBA 5D1RA 2HYTA 2ZCNA 2XB5A 4B3AA 2B3WA 5F0HA 4GCKA 3NXCA 3ZQHA 4IRVA 3ZQGA 2FD5A 2RAEA 2FX0A 3VOKA 2O7OA 5J1UA 2G7GA 1JTYA 2JJ7A 3BQYA 5J1RA 3O8HA 2ZCXA 2A2FX 2QKOA 5FKMA 2DG7A 3BJBA 4B1RA 2HQ5A 5IP6A 3O8GA 2EH3A 2ID3A 2ZOYA 3IUVA 3HGYA 4OD5A 4AF5A 3T6NA 5F04A 3Q3SA 2R7RA 3C2BA 3IH4A 2REKA 5CQGA 3JSJA 3NI7A 2NS7A 3KKDA 5GP9A 3KYLA 3WHCA 3BTIA
chains in the Genus database with same CATH topology
2FQ4A 4X1EA 5F27A 3P9TA 2NS8A 4NELA 4HKUA 3ZQLA 5HSZA 1SGMA 3B6CA 4JNNA 4M3EA 2UXOA 3RH2A 2DG8A 1U9OA 3EUPA 2I10A 3WHBA 2IBDA 2ID6A 5J1YA 1JUMA 1QVTA 5CXIA 2JK3A 3G1OA 2FBQA 4D5FA 2OI8A 2VKEA 3QBMA 2QWTA 5D19A 3BTJA 4GCLA 5EFYA 3LOCA 5FKLA 3G56A 1ZKGA 5J3LA 2X9DA 5DAJA 3CDLA 3ANPA 1Z77A 4JL3A 2RHAA 3BR5A 4GFLA 4DW6A 3QQAA 3BTCA 3LWJA 5K7ZA 2UXHA 2Y31A 3LSJA 1JT6A 2XGDA 3CWRA 4MXMA 2GFNA 4UDSA 4M3BA 3KZ9A 3SDGA 3G1MA 3HGGA 4ME9A 4V2GA 1QPIA 3BT9A 4YZEA 3F1BA 4JYKA 2YVHA 1A6IA 3FK6A 1JUSA 5K58A 2XGEA 3DEWA 3HTHA 2QTQA 5IOYA 3CCYA 3COLA 5FKNA 3BR0A 3HTAA 3HTIA 2XPWA 3HE0A 5GPAA 2PZ9A 1JTXA 2VKVA 3VW0A 1RPWA 1RKWA 2OF7A 2WGBA 3GEUA 2HXIA 3ZQIA 1VI0A 4MO7A 3QPSA 4G12A 5CW8A 4ABZA 3HTJA 4D5CA 5EYRA 3CJDA 2IAIA 3PASA 2XPUA 3HIMA 3LSPA 3VVYA 3AQTA 5HAWA 3LJLA 3DPJA 3VOXA 5F0FA 3BR1A 2O7TA 3G1LA 4D7MA 2Q24A 3BTLA 1QVUA 3ANGA 3V78A 2ZB9A 2XRLA 3BR2A 2DTZA 3KNWA 2IEKA 1JT0A 3BCGA 4ACIA 5AQCA 4GCTA 3VIBA 2PBXA 3V6GA 5IPAA 4JKZA 3BRUA 3NPIA 2NP3A 2XDNA 3MVPA 3EGQA 2WV1A 2ZOZA 3BHQA 3IH2A 4NN1A 1T33A 2HYJA 5FGLA 1ORKA 5FKKA 5CXGA 2ZCMA 3Q0WA 2QIBA 4V2FA 3BR6A 1ZK8A 4M3GA 2Y30A 4KWAA 3C07A 3QPLA 3G7RA 4XK4A 2V57A 3VUQA 1JUPA 3Q0UA 5EZGA 4GFKA 5FKOA 2YVEA 2GBYA 4AC6A 3MNLA 3LHQA 3E7QA 4AC0A 2UXUA 3LSRA 4CGRA 2G7SA 1T56A 5HBUA 2QOPA 4PXIA 2HKUA 3PM1A 3QKXA 2UXPA 1BJZA 4AUXA 2OERA 3KKCA 1Z0XA 3DCFA 3ZQFA 4ICHA 3BNIA 2OPTA 3NNRA 3ON2A 3BR3A 5D18A 1RKTA 5K7HA 2WUIA 2GUHA 3CRJA 5FMPA 2QCOA 2X6OA 1UI5A 3SFIA 3FRQA 2IU5A 2D6YA 2FJ1A 5GPCA 3RD3A 4MK6A 2XPVA 2F07A 2G0EA 3ON4A 2TCTA 4I6ZA 5K7FA 5F0CA 2W53A 5F1JA 5C4YA 2Y2ZA 5F08A 4I76A 2VPRA 3O60A 2GENA 3FIWA 5IOZA 3AQSA 5H9TA 2NP5A 4W97A 4M3DA 3B6AA 3B81A 1UI6A 3Q0VA 3VW2A 5FHPA 2G3BA 2TRTA 3GZIA 3FK7A 1U9NA 2UXIA 4D7NA 3VVZA 3S5RA 3TP0A 2NX4A 3VP5A 3BQZA 4W1UA 2RASA 2G7LA 3IH3A 3VPRA 3TP3A 4M3FA 4L62A 2HXOA 3NRGA 3VVXA 3F0CA 5EZHA 3VW1A 2XGCA 3PPBA 5D1RA 2HYTA 2ZCNA 2XB5A 4B3AA 5F0HA 4GCKA 3NXCA 3ZQHA 3ZQGA 2FD5A 2RAEA 2FX0A 3VOKA 2O7OA 5J1UA 2G7GA 1JTYA 2JJ7A 3BQYA 5J1RA 3O8HA 2ZCXA 2QKOA 5FKMA 2DG7A 3BJBA 4B1RA 2HQ5A 5IP6A 3O8GA 2EH3A 2ID3A 2ZOYA 3IUVA 3HGYA 4AF5A 3T6NA 5F04A 3Q3SA 3C2BA 3IH4A 2REKA 3JSJA 3NI7A 2NS7A 3KKDA 5GP9A 3WHCA 3BTIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FQ4 A;  4X1E A;  5F27 A;  3P9T A;  2NS8 A;  4NEL A;  4HKU A;  3ZQL A;  5HSZ A;  1SGM A;  3B6C A;  4JNN A;  4M3E A;  2UXO A;  3RH2 A;  2DG8 A;  1U9O A;  3EUP A;  2I10 A;  3WHB A;  2IBD A;  2ID6 A;  5J1Y A;  1JUM A;  1QVT A;  5CXI A;  2JK3 A;  3G1O A;  2FBQ A;  4D5F A;  2OI8 A;  2VKE A;  3QBM A;  2QWT A;  5D19 A;  3BTJ A;  4GCL A;  5EFY A;  3LOC A;  5FKL A;  3G56 A;  1ZKG A;  5J3L A;  2X9D A;  5DAJ A;  3CDL A;  3ANP A;  1Z77 A;  4JL3 A;  2RHA A;  3BR5 A;  4GFL A;  4DW6 A;  3QQA A;  3BTC A;  3LWJ A;  5K7Z A;  2UXH A;  2Y31 A;  3LSJ A;  1JT6 A;  2XGD A;  3CWR A;  4MXM A;  2GFN A;  4UDS A;  4M3B A;  3KZ9 A;  3SDG A;  3G1M A;  3HGG A;  4ME9 A;  4V2G A;  1QPI A;  3BT9 A;  4YZE A;  3F1B A;  4JYK A;  2YVH A;  1A6I A;  3FK6 A;  1JUS A;  5K58 A;  2XGE A;  3DEW A;  3HTH A;  2QTQ A;  5IOY A;  3CCY A;  3COL A;  5FKN A;  3BR0 A;  3HTA A;  3HTI A;  2XPW A;  3HE0 A;  5GPA A;  2PZ9 A;  1JTX A;  2VKV A;  3VW0 A;  1RPW A;  1RKW A;  2OF7 A;  2WGB A;  3GEU A;  2HXI A;  3ZQI A;  1VI0 A;  4MO7 A;  3QPS A;  4G12 A;  5CW8 A;  4ABZ A;  3HTJ A;  4D5C A;  5EYR A;  3CJD A;  2IAI A;  3PAS A;  2XPU A;  3HIM A;  3LSP A;  3VVY A;  3AQT A;  5HAW A;  3LJL A;  3DPJ A;  3VOX A;  5F0F A;  3BR1 A;  2O7T A;  3G1L A;  4D7M A;  2Q24 A;  3BTL A;  1QVU A;  3ANG A;  3V78 A;  2ZB9 A;  2XRL A;  3BR2 A;  2DTZ A;  3KNW A;  2IEK A;  1JT0 A;  3BCG A;  4ACI A;  5AQC A;  4GCT A;  3VIB A;  2PBX A;  3V6G A;  5IPA A;  4JKZ A;  3BRU A;  3NPI A;  2NP3 A;  2XDN A;  3MVP A;  3EGQ A;  2WV1 A;  2ZOZ A;  3BHQ A;  3IH2 A;  4NN1 A;  1T33 A;  2HYJ A;  5FGL A;  1ORK A;  5FKK A;  5CXG A;  2ZCM A;  3Q0W A;  2QIB A;  4V2F A;  3BR6 A;  1ZK8 A;  4M3G A;  2Y30 A;  4KWA A;  3C07 A;  3QPL A;  3G7R A;  4XK4 A;  2V57 A;  3VUQ A;  1JUP A;  3Q0U A;  5EZG A;  4GFK A;  5FKO A;  2YVE A;  2GBY A;  4AC6 A;  3MNL A;  3LHQ A;  3E7Q A;  4AC0 A;  2UXU A;  3LSR A;  4CGR A;  2G7S A;  1T56 A;  5HBU A;  2QOP A;  4PXI A;  2HKU A;  3PM1 A;  3QKX A;  2UXP A;  1BJZ A;  4AUX A;  2OER A;  3KKC A;  1Z0X A;  3DCF A;  3ZQF A;  4ICH A;  3BNI A;  2OPT A;  3NNR A;  3ON2 A;  3BR3 A;  5D18 A;  1RKT A;  5K7H A;  2WUI A;  2GUH A;  3CRJ A;  5FMP A;  2QCO A;  2X6O A;  1UI5 A;  3SFI A;  3FRQ A;  2IU5 A;  2D6Y A;  2FJ1 A;  5GPC A;  3RD3 A;  4MK6 A;  2XPV A;  2F07 A;  2G0E A;  3ON4 A;  2TCT A;  4I6Z A;  5K7F A;  5F0C A;  2W53 A;  5F1J A;  5C4Y A;  2Y2Z A;  5F08 A;  4I76 A;  2VPR A;  3O60 A;  2GEN A;  3FIW A;  5IOZ A;  3AQS A;  5H9T A;  2NP5 A;  4W97 A;  4M3D A;  3B6A A;  3B81 A;  1UI6 A;  3Q0V A;  3VW2 A;  5FHP A;  2G3B A;  2TRT A;  3GZI A;  3FK7 A;  1U9N A;  2UXI A;  4D7N A;  3VVZ A;  3S5R A;  3TP0 A;  2NX4 A;  3VP5 A;  3BQZ A;  4W1U A;  2RAS A;  2G7L A;  3IH3 A;  3VPR A;  3TP3 A;  4M3F A;  4L62 A;  2HXO A;  3NRG A;  3VVX A;  3F0C A;  5EZH A;  3VW1 A;  2XGC A;  3PPB A;  5D1R A;  2HYT A;  2ZCN A;  2XB5 A;  4B3A A;  5F0H A;  4GCK A;  3NXC A;  3ZQH A;  3ZQG A;  2FD5 A;  2RAE A;  2FX0 A;  3VOK A;  2O7O A;  5J1U A;  2G7G A;  1JTY A;  2JJ7 A;  3BQY A;  5J1R A;  3O8H A;  2ZCX A;  2QKO A;  5FKM A;  2DG7 A;  3BJB A;  4B1R A;  2HQ5 A;  5IP6 A;  3O8G A;  2EH3 A;  2ID3 A;  2ZOY A;  3IUV A;  3HGY A;  4AF5 A;  3T6N A;  5F04 A;  3Q3S A;  3C2B A;  3IH4 A;  2REK A;  3JSJ A;  3NI7 A;  2NS7 A;  3KKD A;  5GP9 A;  3WHC A;  3BTI A; 
#chains in the Genus database with same CATH topology
 2FQ4 A;  4X1E A;  5F27 A;  3P9T A;  2NS8 A;  4NEL A;  2R7S A;  4HKU A;  3ZQL A;  5HSZ A;  1SGM A;  3B6C A;  4JNN A;  4M3E A;  2UXO A;  3RH2 A;  2DG8 A;  1U9O A;  3EUP A;  2I10 A;  3WHB A;  2IBD A;  2ID6 A;  5J1Y A;  1JUM A;  1QVT A;  5CXI A;  2JK3 A;  3DU6 A;  3G1O A;  2FBQ A;  4D5F A;  2OI8 A;  2VKE A;  3QBM A;  2QWT A;  5D19 A;  3BTJ A;  4GCL A;  5EFY A;  3LOC A;  5FKL A;  3G56 A;  1ZKG A;  5J3L A;  3K8P C;  2X9D A;  5DAJ A;  3CDL A;  3ANP A;  1Z77 A;  4JL3 A;  2RHA A;  3BR5 A;  4GFL A;  4DW6 A;  3QQA A;  3BTC A;  3LWJ A;  2R7W A;  5K7Z A;  2UXH A;  2Y31 A;  3LSJ A;  1JT6 A;  2XGD A;  2B1E A;  3CWR A;  2R7U A;  4MXM A;  2GFN A;  4UDS A;  4M3B A;  3KZ9 A;  3SDG A;  3G1M A;  3HGG A;  4ME9 A;  4V2G A;  1QPI A;  4U9N A;  3BT9 A;  4YZE A;  3F1B A;  4JYK A;  2YVH A;  1A6I A;  3FK6 A;  1JUS A;  5K58 A;  2XGE A;  4WIB A;  3DEW A;  3FHN A;  3HTH A;  2FJI 1;  2QTQ A;  5IOY A;  3CCY A;  3COL A;  5FKN A;  3BR0 A;  3HTA A;  3HTI A;  2XPW A;  3HE0 A;  5GPA A;  2PZ9 A;  1JTX A;  2VKV A;  3VW0 A;  1RPW A;  1RKW A;  2OF7 A;  2WGB A;  3GEU A;  2HXI A;  3ZQI A;  1VI0 A;  4MO7 A;  3QPS A;  4G12 A;  5CW8 A;  4ABZ A;  3HTJ A;  4D5C A;  5EYR A;  3CJD A;  2IAI A;  3PAS A;  2XPU A;  3HIM A;  3LSP A;  3VVY A;  3AQT A;  5HAW A;  3SWH A;  3LJL A;  2PFV A;  3DPJ A;  3VOX A;  5F0F A;  3BR1 A;  2O7T A;  3G1L A;  4D7M A;  2Q24 A;  3BTL A;  1QVU A;  3ANG A;  3V78 A;  2ZB9 A;  2XRL A;  3BR2 A;  2DTZ A;  3KNW A;  2IEK A;  1JT0 A;  3BCG A;  4ACI A;  5AQC A;  4GCT A;  3VIB A;  2PBX A;  3V6G A;  5IPA A;  4JKZ A;  3BRU A;  3NPI A;  2NP3 A;  2XDN A;  3MVP A;  3EGQ A;  2WV1 A;  2ZOZ A;  3BHQ A;  3IH2 A;  4NN1 A;  1T33 A;  2HYJ A;  5FGL A;  1ORK A;  5FKK A;  5CXG A;  2ZCM A;  3Q0W A;  2QIB A;  4V2F A;  3BR6 A;  1ZK8 A;  4M3G A;  2Y30 A;  4KWA A;  3C07 A;  3QPL A;  3G7R A;  4XK4 A;  2V57 A;  3VUQ A;  1JUP A;  3Q0U A;  5EZG A;  4GFK A;  5FKO A;  2YVE A;  2GBY A;  4AC6 A;  3MNL A;  3LHQ A;  3E7Q A;  4AC0 A;  2UXU A;  2R7T A;  3LSR A;  4CGR A;  2G7S A;  1T56 A;  5HBU A;  2QOP A;  3VTI A;  4PXI A;  2HKU A;  3PM1 A;  3QKX A;  2UXP A;  1BJZ A;  4AUX A;  2OER A;  3KKC A;  1Z0X A;  3DCF A;  3ZQF A;  4ICH A;  2YVX A;  3BNI A;  2OPT A;  3NNR A;  3ON2 A;  3BR3 A;  5D18 A;  1RKT A;  5K7H A;  2WUI A;  2GUH A;  3CRJ A;  5FMP A;  2QCO A;  2X6O A;  2R7O A;  3NS4 A;  4DVY P;  1UI5 A;  3SFI A;  3FRQ A;  2IU5 A;  2D6Y A;  2FJ1 A;  5GPC A;  3RD3 A;  4MK6 A;  2XPV A;  2F07 A;  2G0E A;  3ON4 A;  2TCT A;  4I6Z A;  5K7F A;  2ZY9 A;  5F0C A;  2W53 A;  5F1J A;  5C4Y A;  2Y2Z A;  5F08 A;  4I76 A;  2VPR A;  3O60 A;  2GEN A;  3FIW A;  5IOZ A;  3AQS A;  5H9T A;  2NP5 A;  4W97 A;  4M3D A;  3B6A A;  4OD4 A;  3DU5 A;  3B81 A;  1UI6 A;  3Q0V A;  3VW2 A;  5FHP A;  2G3B A;  2TRT A;  3GZI A;  3FK7 A;  1U9N A;  2UXI A;  4D7N A;  2R7Q A;  3VVZ A;  4C2M A;  3S5R A;  3TP0 A;  2NX4 A;  3VP5 A;  3BQZ A;  4W1U A;  2RAS A;  2R7X A;  2G7L A;  3IH3 A;  3VPR A;  3TP3 A;  4M3F A;  4L62 A;  2HXO A;  3NRG A;  4U9L A;  3VVX A;  3F0C A;  5EZH A;  3VW1 A;  2XGC A;  2R7V A;  3PPB A;  5D1R A;  2HYT A;  2ZCN A;  2XB5 A;  4B3A A;  2B3W A;  5F0H A;  4GCK A;  3NXC A;  3ZQH A;  4IRV A;  3ZQG A;  2FD5 A;  2RAE A;  2FX0 A;  3VOK A;  2O7O A;  5J1U A;  2G7G A;  1JTY A;  2JJ7 A;  3BQY A;  5J1R A;  3O8H A;  2ZCX A;  2A2F X;  2QKO A;  5FKM A;  2DG7 A;  3BJB A;  4B1R A;  2HQ5 A;  5IP6 A;  3O8G A;  2EH3 A;  2ID3 A;  2ZOY A;  3IUV A;  3HGY A;  4OD5 A;  4AF5 A;  3T6N A;  5F04 A;  3Q3S A;  2R7R A;  3C2B A;  3IH4 A;  2REK A;  5CQG A;  3JSJ A;  3NI7 A;  2NS7 A;  3KKD A;  5GP9 A;  3KYL A;  3WHC A;  3BTI A; 
#chains in the Genus database with same CATH homology
 2FQ4 A;  4X1E A;  5F27 A;  3P9T A;  2NS8 A;  4NEL A;  4HKU A;  3ZQL A;  5HSZ A;  1SGM A;  3B6C A;  4JNN A;  4M3E A;  2UXO A;  3RH2 A;  2DG8 A;  1U9O A;  3EUP A;  2I10 A;  3WHB A;  2IBD A;  2ID6 A;  5J1Y A;  1JUM A;  1QVT A;  5CXI A;  2JK3 A;  3G1O A;  2FBQ A;  4D5F A;  2OI8 A;  2VKE A;  3QBM A;  2QWT A;  5D19 A;  3BTJ A;  4GCL A;  5EFY A;  3LOC A;  5FKL A;  3G56 A;  1ZKG A;  5J3L A;  2X9D A;  5DAJ A;  3CDL A;  3ANP A;  1Z77 A;  4JL3 A;  2RHA A;  3BR5 A;  4GFL A;  4DW6 A;  3QQA A;  3BTC A;  3LWJ A;  5K7Z A;  2UXH A;  2Y31 A;  3LSJ A;  1JT6 A;  2XGD A;  3CWR A;  4MXM A;  2GFN A;  4UDS A;  4M3B A;  3KZ9 A;  3SDG A;  3G1M A;  3HGG A;  4ME9 A;  4V2G A;  1QPI A;  3BT9 A;  4YZE A;  3F1B A;  4JYK A;  2YVH A;  1A6I A;  3FK6 A;  1JUS A;  5K58 A;  2XGE A;  3DEW A;  3HTH A;  2QTQ A;  5IOY A;  3CCY A;  3COL A;  5FKN A;  3BR0 A;  3HTA A;  3HTI A;  2XPW A;  3HE0 A;  5GPA A;  2PZ9 A;  1JTX A;  2VKV A;  3VW0 A;  1RPW A;  1RKW A;  2OF7 A;  2WGB A;  3GEU A;  2HXI A;  3ZQI A;  1VI0 A;  4MO7 A;  3QPS A;  4G12 A;  5CW8 A;  4ABZ A;  3HTJ A;  4D5C A;  5EYR A;  3CJD A;  2IAI A;  3PAS A;  2XPU A;  3HIM A;  3LSP A;  3VVY A;  3AQT A;  5HAW A;  3LJL A;  3DPJ A;  3VOX A;  5F0F A;  3BR1 A;  2O7T A;  3G1L A;  4D7M A;  2Q24 A;  3BTL A;  1QVU A;  3ANG A;  3V78 A;  2ZB9 A;  2XRL A;  3BR2 A;  2DTZ A;  3KNW A;  2IEK A;  1JT0 A;  3BCG A;  4ACI A;  5AQC A;  4GCT A;  3VIB A;  2PBX A;  3V6G A;  5IPA A;  4JKZ A;  3BRU A;  3NPI A;  2NP3 A;  2XDN A;  3MVP A;  3EGQ A;  2WV1 A;  2ZOZ A;  3BHQ A;  3IH2 A;  4NN1 A;  1T33 A;  2HYJ A;  5FGL A;  1ORK A;  5FKK A;  5CXG A;  2ZCM A;  3Q0W A;  2QIB A;  4V2F A;  3BR6 A;  1ZK8 A;  4M3G A;  2Y30 A;  4KWA A;  3C07 A;  3QPL A;  3G7R A;  4XK4 A;  2V57 A;  3VUQ A;  1JUP A;  3Q0U A;  5EZG A;  4GFK A;  5FKO A;  2YVE A;  2GBY A;  4AC6 A;  3MNL A;  3LHQ A;  3E7Q A;  4AC0 A;  2UXU A;  3LSR A;  4CGR A;  2G7S A;  1T56 A;  5HBU A;  2QOP A;  4PXI A;  2HKU A;  3PM1 A;  3QKX A;  2UXP A;  1BJZ A;  4AUX A;  2OER A;  3KKC A;  1Z0X A;  3DCF A;  3ZQF A;  4ICH A;  3BNI A;  2OPT A;  3NNR A;  3ON2 A;  3BR3 A;  5D18 A;  1RKT A;  5K7H A;  2WUI A;  2GUH A;  3CRJ A;  5FMP A;  2QCO A;  2X6O A;  1UI5 A;  3SFI A;  3FRQ A;  2IU5 A;  2D6Y A;  2FJ1 A;  5GPC A;  3RD3 A;  4MK6 A;  2XPV A;  2F07 A;  2G0E A;  3ON4 A;  2TCT A;  4I6Z A;  5K7F A;  5F0C A;  2W53 A;  5F1J A;  5C4Y A;  2Y2Z A;  5F08 A;  4I76 A;  2VPR A;  3O60 A;  2GEN A;  3FIW A;  5IOZ A;  3AQS A;  5H9T A;  2NP5 A;  4W97 A;  4M3D A;  3B6A A;  3B81 A;  1UI6 A;  3Q0V A;  3VW2 A;  5FHP A;  2G3B A;  2TRT A;  3GZI A;  3FK7 A;  1U9N A;  2UXI A;  4D7N A;  3VVZ A;  3S5R A;  3TP0 A;  2NX4 A;  3VP5 A;  3BQZ A;  4W1U A;  2RAS A;  2G7L A;  3IH3 A;  3VPR A;  3TP3 A;  4M3F A;  4L62 A;  2HXO A;  3NRG A;  3VVX A;  3F0C A;  5EZH A;  3VW1 A;  2XGC A;  3PPB A;  5D1R A;  2HYT A;  2ZCN A;  2XB5 A;  4B3A A;  5F0H A;  4GCK A;  3NXC A;  3ZQH A;  3ZQG A;  2FD5 A;  2RAE A;  2FX0 A;  3VOK A;  2O7O A;  5J1U A;  2G7G A;  1JTY A;  2JJ7 A;  3BQY A;  5J1R A;  3O8H A;  2ZCX A;  2QKO A;  5FKM A;  2DG7 A;  3BJB A;  4B1R A;  2HQ5 A;  5IP6 A;  3O8G A;  2EH3 A;  2ID3 A;  2ZOY A;  3IUV A;  3HGY A;  4AF5 A;  3T6N A;  5F04 A;  3Q3S A;  3C2B A;  3IH4 A;  2REK A;  3JSJ A;  3NI7 A;  2NS7 A;  3KKD A;  5GP9 A;  3WHC A;  3BTI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...