2HYTA

Crystal structure of a tetr-family transcriptional regulator (eca1819) from pectobacterium atrosepticum at 1.64 a resolution
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
193
structure length
193
Chain Sequence
RTRAEMEETRATLLATARKVFSERGYADTSMDDLTAQASLTRGALYHHFGDKKGLLAAVVEQIDAEMDERLQAISDTAEDDWEGFRCRCRAYLEMALEPEIQRIVLRDARAVLGGASPDSQRHCVESMQRLIDNLIRQGVVAEADPQALASLIYGSLAEAAFWIAEGEDGNARLAQGVAALELLLRGLLVKPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of TetR-family transcriptional regulator (YP_049917.1) from Erwinia Cartovora Atroseptica SCRI1043 at 1.64 A resolution
rcsb
source organism Pectobacterium atrosepticum
molecule tags Transcription
molecule keywords TetR-family transcriptional regulator
total genus 75
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 2006-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2hytA00
2QWTA 3ZQFA 1ZK8A 3LHQA 3VVYA 4JYKA 2OERA 5CXGA 3VP5A 4V2FA 4NELA 4AC0A 3RD3A 3QPSA 5J3LA 5F08A 2WV1A 4I76A 2FD5A 4GCTA 3FIWA 2PZ9A 5D19A 1A6IA 2XRLA 2GENA 5FGLA 2TCTA 2WGBA 2G0EA 3LJLA 3G56A 2X9DA 2XPUA 3O8GA 2TRTA 2Q24A 4AUXA 2VPRA 2ZOZA 3IH4A 3ON2A 2Y2ZA 1QVUA 2YVEA 2GUHA 2REKA 3CRJA 2O7TA 2NP3A 3T6NA 2QTQA 4CGRA 5IOZA 5FKMA 4YZEA 3LWJA 2ID3A 3BR5A 4D7MA 3C07A 2Y31A 2XB5A 1JTXA 3ANGA 3C2BA 4GFLA 4NN1A 5HBUA 1QVTA 3HE0A 2O7OA 2RHAA 5F0FA 2JK3A 4V2GA 3G1MA 1JUMA 4ICHA 4UDSA 2HYJA 4B1RA 3ZQGA 3TP0A 2HKUA 3G1LA 3VUQA 3HGGA 2QCOA 2G7GA 1UI6A 2IAIA 2RASA 3VVZA 3NRGA 2UXOA 1JT6A 3BTCA 2XPWA 4AC6A 3LSPA 3SDGA 3VOXA 2UXPA 2VKEA 5H9TA 4GCKA 3PPBA 4GCLA 2GBYA 2FBQA 3BQYA 3QQAA 2JJ7A 3KZ9A 5F04A 2UXUA 2YVHA 2QIBA 5IP6A 4JKZA 4ABZA 2IEKA 4PXIA 3BTLA 2ZB9A 3BQZA 4W97A 5GPAA 3BJBA 1RPWA 3FRQA 3VPRA 3HTAA 3NXCA 4M3FA 2G3BA 3E7QA 4W1UA 3VIBA 5HAWA 1T33A 3P9TA 2IU5A 2OF7A 3B81A 3O8HA 3V78A 3GZIA 2G7SA 3BTJA 2ZOYA 1VI0A 3NPIA 3HTJA 1QPIA 5F0CA 3ZQLA 2DG7A 3F1BA 2DTZA 4M3GA 2HYTA 3DCFA 3G7RA 3TP3A 3WHBA 3ANPA 5J1UA 3QPLA 5AQCA 3LSJA 3KKDA 2XPVA 2IBDA 2GFNA 3Q0UA 3Q3SA 4L62A 3SFIA 5K7FA 3BNIA 2G7LA 5FKKA 3BCGA 5K7HA 4I6ZA 2XGCA 2OI8A 3QKXA 5C4YA 1Z0XA 3BTIA 1ZKGA 2UXHA 2QKOA 3HTIA 5HSZA 3LOCA 4M3DA 5IOYA 4MO7A 2HXOA 5J1RA 3DPJA 3HTHA 2D6YA 1RKWA 3CWRA 1BJZA 2WUIA 1JT0A 5FKLA 2W53A 2ID6A 3Q0VA 5F0HA 2Y30A 5CW8A 5FKNA 5J1YA 4D7NA 4DW6A 3IH2A 5GPCA 2QOPA 4MK6A 1RKTA 5EFYA 2ZCXA 3F0CA 4G12A 2FJ1A 5F27A 1JTYA 3BR3A 3CDLA 2VKVA 5FHPA 2XDNA 4KWAA 5FMPA 2F07A 5GP9A 2XGEA 2FQ4A 2RAEA 3BR0A 1UI5A 4B3AA 3B6CA 5D18A 3FK6A 1ORKA 3MNLA 2V57A 3VW2A 3BHQA 1U9NA 5K58A 3BR1A 4ME9A 3NI7A 2HQ5A 5IPAA 3IH3A 3RH2A 2NP5A 3GEUA 3PASA 2NX4A 3BR2A 3B6AA 3COLA 3VVXA 3BT9A 3HIMA 2ZCNA 2XGDA 3CJDA 5EYRA 4D5FA 5DAJA 3G1OA 2X6OA 2PBXA 3MVPA 3HGYA 4JL3A 2OPTA 2NS8A 4XK4A 2UXIA 2NS7A 3NNRA 4MXMA 2FX0A 4ACIA 3VOKA 3VW1A 3Q0WA 4D5CA 1JUPA 1U9OA 5EZHA 3WHCA 3EGQA 5D1RA 2EH3A 4GFKA 4HKUA 3O60A 5EZGA 3JSJA 3IUVA 3ZQIA 1Z77A 3KKCA 3AQTA 5K7ZA 3KNWA 4M3BA 3AQSA 5F1JA 2DG8A 3FK7A 2I10A 1T56A 3ZQHA 3QBMA 2ZCMA 3VW0A 1SGMA 3CCYA 4X1EA 1JUSA 3LSRA 3ON4A 4JNNA 4AF5A 3PM1A 4M3EA 3S5RA 3BR6A 3EUPA 5CXIA 3DEWA 3V6GA 2HXIA 5FKOA 3BRUA
chains in the Genus database with same CATH superfamily
2QWTA 3ZQFA 1ZK8A 3LHQA 3VVYA 4JYKA 2OERA 5CXGA 3VP5A 4V2FA 4NELA 4AC0A 3RD3A 3QPSA 5J3LA 5F08A 2WV1A 4I76A 2FD5A 4GCTA 3FIWA 2PZ9A 5D19A 1A6IA 2XRLA 2GENA 5FGLA 2TCTA 2WGBA 2G0EA 3LJLA 3G56A 2X9DA 2XPUA 3O8GA 4U9LA 2TRTA 2Q24A 4AUXA 2VPRA 3DU5A 2ZOZA 3IH4A 3ON2A 2Y2ZA 1QVUA 2YVEA 2GUHA 2REKA 3CRJA 2O7TA 2NP3A 3T6NA 2QTQA 4CGRA 5IOZA 5FKMA 4YZEA 3LWJA 2ID3A 3BR5A 4D7MA 3C07A 2Y31A 2R7UA 3VTIA 2XB5A 1JTXA 3ANGA 3C2BA 4GFLA 4NN1A 5HBUA 1QVTA 3HE0A 2O7OA 2RHAA 5F0FA 2JK3A 4V2GA 3G1MA 1JUMA 4ICHA 2R7VA 4UDSA 2HYJA 4B1RA 3K8PC 4IRVA 3ZQGA 2B3WA 3TP0A 2HKUA 3G1LA 3VUQA 3SWHA 3HGGA 2QCOA 2G7GA 1UI6A 2R7SA 2IAIA 2RASA 3VVZA 3NRGA 2UXOA 1JT6A 3BTCA 2XPWA 3FHNA 2B1EA 4AC6A 3LSPA 2R7XA 3SDGA 3VOXA 4C2MA 2UXPA 2VKEA 5H9TA 4GCKA 3PPBA 4GCLA 2GBYA 2FBQA 3BQYA 3QQAA 2JJ7A 3KZ9A 4DVYP 5F04A 2UXUA 2YVHA 2QIBA 4JKZA 5IP6A 4ABZA 2IEKA 4PXIA 3BTLA 2ZB9A 3BQZA 4W97A 5GPAA 3BJBA 1RPWA 3FRQA 3VPRA 3HTAA 3NXCA 2A2FX 4M3FA 2G3BA 3E7QA 4W1UA 4WIBA 3VIBA 5HAWA 2PFVA 1T33A 3P9TA 2FJI1 2YVXA 2IU5A 2OF7A 3B81A 3O8HA 2R7WA 3V78A 3GZIA 2G7SA 3BTJA 2ZOYA 1VI0A 3NPIA 3HTJA 1QPIA 5F0CA 3ZQLA 2DG7A 3F1BA 2DTZA 4M3GA 2HYTA 3DCFA 3G7RA 3NS4A 3TP3A 3WHBA 3ANPA 5J1UA 3QPLA 5AQCA 3LSJA 3KKDA 2XPVA 2IBDA 2GFNA 3Q0UA 3Q3SA 2ZY9A 4L62A 3SFIA 5K7FA 3BNIA 2G7LA 5FKKA 3BCGA 5K7HA 4I6ZA 2XGCA 2OI8A 3QKXA 5C4YA 1Z0XA 3BTIA 1ZKGA 2UXHA 2QKOA 3HTIA 5HSZA 3LOCA 4M3DA 5IOYA 4MO7A 2HXOA 5J1RA 3DPJA 3HTHA 2D6YA 1RKWA 2R7QA 3CWRA 1BJZA 2WUIA 1JT0A 5FKLA 2W53A 2ID6A 3Q0VA 5F0HA 2Y30A 5CW8A 5FKNA 5J1YA 4D7NA 4DW6A 3IH2A 5GPCA 2QOPA 4MK6A 1RKTA 5EFYA 2ZCXA 3F0CA 4G12A 2FJ1A 5F27A 1JTYA 3BR3A 3CDLA 2VKVA 5FHPA 2XDNA 2R7OA 4KWAA 5FMPA 2F07A 5GP9A 2XGEA 2FQ4A 2RAEA 3BR0A 1UI5A 4B3AA 3B6CA 5D18A 3FK6A 4U9NA 1ORKA 3MNLA 2V57A 2R7TA 3VW2A 3BHQA 1U9NA 5K58A 3BR1A 4ME9A 3NI7A 2HQ5A 5IPAA 3IH3A 3RH2A 2NP5A 3GEUA 3PASA 2NX4A 3BR2A 3B6AA 3COLA 3VVXA 4OD4A 3BT9A 3HIMA 2ZCNA 2XGDA 3CJDA 5EYRA 4D5FA 5DAJA 3G1OA 2X6OA 2PBXA 3MVPA 3HGYA 4JL3A 2OPTA 2NS8A 4XK4A 2UXIA 2NS7A 3NNRA 4MXMA 2FX0A 4ACIA 3VOKA 3VW1A 3Q0WA 4D5CA 5CQGA 1JUPA 1U9OA 5EZHA 3WHCA 3EGQA 5D1RA 2EH3A 4GFKA 4HKUA 3O60A 5EZGA 3JSJA 3IUVA 3ZQIA 1Z77A 3KKCA 3AQTA 5K7ZA 3DU6A 3KNWA 4M3BA 3AQSA 5F1JA 2DG8A 3FK7A 4OD5A 2I10A 1T56A 3ZQHA 3QBMA 2ZCMA 3VW0A 1SGMA 3CCYA 4X1EA 1JUSA 3LSRA 3KYLA 2R7RA 3ON4A 4JNNA 4AF5A 3PM1A 4M3EA 3S5RA 3BR6A 3EUPA 5CXIA 3DEWA 3V6GA 2HXIA 5FKOA 3BRUA
chains in the Genus database with same CATH topology
2QWTA 3ZQFA 1ZK8A 3LHQA 3VVYA 4JYKA 2OERA 5CXGA 3VP5A 4V2FA 4NELA 4AC0A 3RD3A 3QPSA 5J3LA 5F08A 2WV1A 4I76A 2FD5A 4GCTA 3FIWA 2PZ9A 5D19A 1A6IA 2XRLA 2GENA 5FGLA 2TCTA 2WGBA 2G0EA 3LJLA 3G56A 2X9DA 2XPUA 3O8GA 2TRTA 2Q24A 4AUXA 2VPRA 2ZOZA 3IH4A 3ON2A 2Y2ZA 1QVUA 2YVEA 2GUHA 2REKA 3CRJA 2O7TA 2NP3A 3T6NA 2QTQA 4CGRA 5IOZA 5FKMA 4YZEA 3LWJA 2ID3A 3BR5A 4D7MA 3C07A 2Y31A 2XB5A 1JTXA 3ANGA 3C2BA 4GFLA 4NN1A 5HBUA 1QVTA 3HE0A 2O7OA 2RHAA 5F0FA 2JK3A 4V2GA 3G1MA 1JUMA 4ICHA 4UDSA 2HYJA 4B1RA 3ZQGA 3TP0A 2HKUA 3G1LA 3VUQA 3HGGA 2QCOA 2G7GA 1UI6A 2IAIA 2RASA 3VVZA 3NRGA 2UXOA 1JT6A 3BTCA 2XPWA 4AC6A 3LSPA 3SDGA 3VOXA 2UXPA 2VKEA 5H9TA 4GCKA 3PPBA 4GCLA 2GBYA 2FBQA 3BQYA 3QQAA 2JJ7A 3KZ9A 5F04A 2UXUA 2YVHA 2QIBA 5IP6A 4JKZA 4ABZA 2IEKA 4PXIA 3BTLA 2ZB9A 3BQZA 4W97A 5GPAA 3BJBA 1RPWA 3FRQA 3VPRA 3HTAA 3NXCA 4M3FA 2G3BA 3E7QA 4W1UA 3VIBA 5HAWA 1T33A 3P9TA 2IU5A 2OF7A 3B81A 3O8HA 3V78A 3GZIA 2G7SA 3BTJA 2ZOYA 1VI0A 3NPIA 3HTJA 1QPIA 5F0CA 3ZQLA 2DG7A 3F1BA 2DTZA 4M3GA 2HYTA 3DCFA 3G7RA 3TP3A 3WHBA 3ANPA 5J1UA 3QPLA 5AQCA 3LSJA 3KKDA 2XPVA 2IBDA 2GFNA 3Q0UA 3Q3SA 4L62A 3SFIA 5K7FA 3BNIA 2G7LA 5FKKA 3BCGA 5K7HA 4I6ZA 2XGCA 2OI8A 3QKXA 5C4YA 1Z0XA 3BTIA 1ZKGA 2UXHA 2QKOA 3HTIA 5HSZA 3LOCA 4M3DA 5IOYA 4MO7A 2HXOA 5J1RA 3DPJA 3HTHA 2D6YA 1RKWA 3CWRA 1BJZA 2WUIA 1JT0A 5FKLA 2W53A 2ID6A 3Q0VA 5F0HA 2Y30A 5CW8A 5FKNA 5J1YA 4D7NA 4DW6A 3IH2A 5GPCA 2QOPA 4MK6A 1RKTA 5EFYA 2ZCXA 3F0CA 4G12A 2FJ1A 5F27A 1JTYA 3BR3A 3CDLA 2VKVA 5FHPA 2XDNA 4KWAA 5FMPA 2F07A 5GP9A 2XGEA 2FQ4A 2RAEA 3BR0A 1UI5A 4B3AA 3B6CA 5D18A 3FK6A 1ORKA 3MNLA 2V57A 3VW2A 3BHQA 1U9NA 5K58A 3BR1A 4ME9A 3NI7A 2HQ5A 5IPAA 3IH3A 3RH2A 2NP5A 3GEUA 3PASA 2NX4A 3BR2A 3B6AA 3COLA 3VVXA 3BT9A 3HIMA 2ZCNA 2XGDA 3CJDA 5EYRA 4D5FA 5DAJA 3G1OA 2X6OA 2PBXA 3MVPA 3HGYA 4JL3A 2OPTA 2NS8A 4XK4A 2UXIA 2NS7A 3NNRA 4MXMA 2FX0A 4ACIA 3VOKA 3VW1A 3Q0WA 4D5CA 1JUPA 1U9OA 5EZHA 3WHCA 3EGQA 5D1RA 2EH3A 4GFKA 4HKUA 3O60A 5EZGA 3JSJA 3IUVA 3ZQIA 1Z77A 3KKCA 3AQTA 5K7ZA 3KNWA 4M3BA 3AQSA 5F1JA 2DG8A 3FK7A 2I10A 1T56A 3ZQHA 3QBMA 2ZCMA 3VW0A 1SGMA 3CCYA 4X1EA 1JUSA 3LSRA 3ON4A 4JNNA 4AF5A 3PM1A 4M3EA 3S5RA 3BR6A 3EUPA 5CXIA 3DEWA 3V6GA 2HXIA 5FKOA 3BRUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QWT A;  3ZQF A;  1ZK8 A;  3LHQ A;  3VVY A;  4JYK A;  2OER A;  5CXG A;  3VP5 A;  4V2F A;  4NEL A;  4AC0 A;  3RD3 A;  3QPS A;  5J3L A;  5F08 A;  2WV1 A;  4I76 A;  2FD5 A;  4GCT A;  3FIW A;  2PZ9 A;  5D19 A;  1A6I A;  2XRL A;  2GEN A;  5FGL A;  2TCT A;  2WGB A;  2G0E A;  3LJL A;  3G56 A;  2X9D A;  2XPU A;  3O8G A;  2TRT A;  2Q24 A;  4AUX A;  2VPR A;  2ZOZ A;  3IH4 A;  3ON2 A;  2Y2Z A;  1QVU A;  2YVE A;  2GUH A;  2REK A;  3CRJ A;  2O7T A;  2NP3 A;  3T6N A;  2QTQ A;  4CGR A;  5IOZ A;  5FKM A;  4YZE A;  3LWJ A;  2ID3 A;  3BR5 A;  4D7M A;  3C07 A;  2Y31 A;  2XB5 A;  1JTX A;  3ANG A;  3C2B A;  4GFL A;  4NN1 A;  5HBU A;  1QVT A;  3HE0 A;  2O7O A;  2RHA A;  5F0F A;  2JK3 A;  4V2G A;  3G1M A;  1JUM A;  4ICH A;  4UDS A;  2HYJ A;  4B1R A;  3ZQG A;  3TP0 A;  2HKU A;  3G1L A;  3VUQ A;  3HGG A;  2QCO A;  2G7G A;  1UI6 A;  2IAI A;  2RAS A;  3VVZ A;  3NRG A;  2UXO A;  1JT6 A;  3BTC A;  2XPW A;  4AC6 A;  3LSP A;  3SDG A;  3VOX A;  2UXP A;  2VKE A;  5H9T A;  4GCK A;  3PPB A;  4GCL A;  2GBY A;  2FBQ A;  3BQY A;  3QQA A;  2JJ7 A;  3KZ9 A;  5F04 A;  2UXU A;  2YVH A;  2QIB A;  5IP6 A;  4JKZ A;  4ABZ A;  2IEK A;  4PXI A;  3BTL A;  2ZB9 A;  3BQZ A;  4W97 A;  5GPA A;  3BJB A;  1RPW A;  3FRQ A;  3VPR A;  3HTA A;  3NXC A;  4M3F A;  2G3B A;  3E7Q A;  4W1U A;  3VIB A;  5HAW A;  1T33 A;  3P9T A;  2IU5 A;  2OF7 A;  3B81 A;  3O8H A;  3V78 A;  3GZI A;  2G7S A;  3BTJ A;  2ZOY A;  1VI0 A;  3NPI A;  3HTJ A;  1QPI A;  5F0C A;  3ZQL A;  2DG7 A;  3F1B A;  2DTZ A;  4M3G A;  2HYT A;  3DCF A;  3G7R A;  3TP3 A;  3WHB A;  3ANP A;  5J1U A;  3QPL A;  5AQC A;  3LSJ A;  3KKD A;  2XPV A;  2IBD A;  2GFN A;  3Q0U A;  3Q3S A;  4L62 A;  3SFI A;  5K7F A;  3BNI A;  2G7L A;  5FKK A;  3BCG A;  5K7H A;  4I6Z A;  2XGC A;  2OI8 A;  3QKX A;  5C4Y A;  1Z0X A;  3BTI A;  1ZKG A;  2UXH A;  2QKO A;  3HTI A;  5HSZ A;  3LOC A;  4M3D A;  5IOY A;  4MO7 A;  2HXO A;  5J1R A;  3DPJ A;  3HTH A;  2D6Y A;  1RKW A;  3CWR A;  1BJZ A;  2WUI A;  1JT0 A;  5FKL A;  2W53 A;  2ID6 A;  3Q0V A;  5F0H A;  2Y30 A;  5CW8 A;  5FKN A;  5J1Y A;  4D7N A;  4DW6 A;  3IH2 A;  5GPC A;  2QOP A;  4MK6 A;  1RKT A;  5EFY A;  2ZCX A;  3F0C A;  4G12 A;  2FJ1 A;  5F27 A;  1JTY A;  3BR3 A;  3CDL A;  2VKV A;  5FHP A;  2XDN A;  4KWA A;  5FMP A;  2F07 A;  5GP9 A;  2XGE A;  2FQ4 A;  2RAE A;  3BR0 A;  1UI5 A;  4B3A A;  3B6C A;  5D18 A;  3FK6 A;  1ORK A;  3MNL A;  2V57 A;  3VW2 A;  3BHQ A;  1U9N A;  5K58 A;  3BR1 A;  4ME9 A;  3NI7 A;  2HQ5 A;  5IPA A;  3IH3 A;  3RH2 A;  2NP5 A;  3GEU A;  3PAS A;  2NX4 A;  3BR2 A;  3B6A A;  3COL A;  3VVX A;  3BT9 A;  3HIM A;  2ZCN A;  2XGD A;  3CJD A;  5EYR A;  4D5F A;  5DAJ A;  3G1O A;  2X6O A;  2PBX A;  3MVP A;  3HGY A;  4JL3 A;  2OPT A;  2NS8 A;  4XK4 A;  2UXI A;  2NS7 A;  3NNR A;  4MXM A;  2FX0 A;  4ACI A;  3VOK A;  3VW1 A;  3Q0W A;  4D5C A;  1JUP A;  1U9O A;  5EZH A;  3WHC A;  3EGQ A;  5D1R A;  2EH3 A;  4GFK A;  4HKU A;  3O60 A;  5EZG A;  3JSJ A;  3IUV A;  3ZQI A;  1Z77 A;  3KKC A;  3AQT A;  5K7Z A;  3KNW A;  4M3B A;  3AQS A;  5F1J A;  2DG8 A;  3FK7 A;  2I10 A;  1T56 A;  3ZQH A;  3QBM A;  2ZCM A;  3VW0 A;  1SGM A;  3CCY A;  4X1E A;  1JUS A;  3LSR A;  3ON4 A;  4JNN A;  4AF5 A;  3PM1 A;  4M3E A;  3S5R A;  3BR6 A;  3EUP A;  5CXI A;  3DEW A;  3V6G A;  2HXI A;  5FKO A;  3BRU A; 
#chains in the Genus database with same CATH topology
 2QWT A;  3ZQF A;  1ZK8 A;  3LHQ A;  3VVY A;  4JYK A;  2OER A;  5CXG A;  3VP5 A;  4V2F A;  4NEL A;  4AC0 A;  3RD3 A;  3QPS A;  5J3L A;  5F08 A;  2WV1 A;  4I76 A;  2FD5 A;  4GCT A;  3FIW A;  2PZ9 A;  5D19 A;  1A6I A;  2XRL A;  2GEN A;  5FGL A;  2TCT A;  2WGB A;  2G0E A;  3LJL A;  3G56 A;  2X9D A;  2XPU A;  3O8G A;  4U9L A;  2TRT A;  2Q24 A;  4AUX A;  2VPR A;  3DU5 A;  2ZOZ A;  3IH4 A;  3ON2 A;  2Y2Z A;  1QVU A;  2YVE A;  2GUH A;  2REK A;  3CRJ A;  2O7T A;  2NP3 A;  3T6N A;  2QTQ A;  4CGR A;  5IOZ A;  5FKM A;  4YZE A;  3LWJ A;  2ID3 A;  3BR5 A;  4D7M A;  3C07 A;  2Y31 A;  2R7U A;  3VTI A;  2XB5 A;  1JTX A;  3ANG A;  3C2B A;  4GFL A;  4NN1 A;  5HBU A;  1QVT A;  3HE0 A;  2O7O A;  2RHA A;  5F0F A;  2JK3 A;  4V2G A;  3G1M A;  1JUM A;  4ICH A;  2R7V A;  4UDS A;  2HYJ A;  4B1R A;  3K8P C;  4IRV A;  3ZQG A;  2B3W A;  3TP0 A;  2HKU A;  3G1L A;  3VUQ A;  3SWH A;  3HGG A;  2QCO A;  2G7G A;  1UI6 A;  2R7S A;  2IAI A;  2RAS A;  3VVZ A;  3NRG A;  2UXO A;  1JT6 A;  3BTC A;  2XPW A;  3FHN A;  2B1E A;  4AC6 A;  3LSP A;  2R7X A;  3SDG A;  3VOX A;  4C2M A;  2UXP A;  2VKE A;  5H9T A;  4GCK A;  3PPB A;  4GCL A;  2GBY A;  2FBQ A;  3BQY A;  3QQA A;  2JJ7 A;  3KZ9 A;  4DVY P;  5F04 A;  2UXU A;  2YVH A;  2QIB A;  4JKZ A;  5IP6 A;  4ABZ A;  2IEK A;  4PXI A;  3BTL A;  2ZB9 A;  3BQZ A;  4W97 A;  5GPA A;  3BJB A;  1RPW A;  3FRQ A;  3VPR A;  3HTA A;  3NXC A;  2A2F X;  4M3F A;  2G3B A;  3E7Q A;  4W1U A;  4WIB A;  3VIB A;  5HAW A;  2PFV A;  1T33 A;  3P9T A;  2FJI 1;  2YVX A;  2IU5 A;  2OF7 A;  3B81 A;  3O8H A;  2R7W A;  3V78 A;  3GZI A;  2G7S A;  3BTJ A;  2ZOY A;  1VI0 A;  3NPI A;  3HTJ A;  1QPI A;  5F0C A;  3ZQL A;  2DG7 A;  3F1B A;  2DTZ A;  4M3G A;  2HYT A;  3DCF A;  3G7R A;  3NS4 A;  3TP3 A;  3WHB A;  3ANP A;  5J1U A;  3QPL A;  5AQC A;  3LSJ A;  3KKD A;  2XPV A;  2IBD A;  2GFN A;  3Q0U A;  3Q3S A;  2ZY9 A;  4L62 A;  3SFI A;  5K7F A;  3BNI A;  2G7L A;  5FKK A;  3BCG A;  5K7H A;  4I6Z A;  2XGC A;  2OI8 A;  3QKX A;  5C4Y A;  1Z0X A;  3BTI A;  1ZKG A;  2UXH A;  2QKO A;  3HTI A;  5HSZ A;  3LOC A;  4M3D A;  5IOY A;  4MO7 A;  2HXO A;  5J1R A;  3DPJ A;  3HTH A;  2D6Y A;  1RKW A;  2R7Q A;  3CWR A;  1BJZ A;  2WUI A;  1JT0 A;  5FKL A;  2W53 A;  2ID6 A;  3Q0V A;  5F0H A;  2Y30 A;  5CW8 A;  5FKN A;  5J1Y A;  4D7N A;  4DW6 A;  3IH2 A;  5GPC A;  2QOP A;  4MK6 A;  1RKT A;  5EFY A;  2ZCX A;  3F0C A;  4G12 A;  2FJ1 A;  5F27 A;  1JTY A;  3BR3 A;  3CDL A;  2VKV A;  5FHP A;  2XDN A;  2R7O A;  4KWA A;  5FMP A;  2F07 A;  5GP9 A;  2XGE A;  2FQ4 A;  2RAE A;  3BR0 A;  1UI5 A;  4B3A A;  3B6C A;  5D18 A;  3FK6 A;  4U9N A;  1ORK A;  3MNL A;  2V57 A;  2R7T A;  3VW2 A;  3BHQ A;  1U9N A;  5K58 A;  3BR1 A;  4ME9 A;  3NI7 A;  2HQ5 A;  5IPA A;  3IH3 A;  3RH2 A;  2NP5 A;  3GEU A;  3PAS A;  2NX4 A;  3BR2 A;  3B6A A;  3COL A;  3VVX A;  4OD4 A;  3BT9 A;  3HIM A;  2ZCN A;  2XGD A;  3CJD A;  5EYR A;  4D5F A;  5DAJ A;  3G1O A;  2X6O A;  2PBX A;  3MVP A;  3HGY A;  4JL3 A;  2OPT A;  2NS8 A;  4XK4 A;  2UXI A;  2NS7 A;  3NNR A;  4MXM A;  2FX0 A;  4ACI A;  3VOK A;  3VW1 A;  3Q0W A;  4D5C A;  5CQG A;  1JUP A;  1U9O A;  5EZH A;  3WHC A;  3EGQ A;  5D1R A;  2EH3 A;  4GFK A;  4HKU A;  3O60 A;  5EZG A;  3JSJ A;  3IUV A;  3ZQI A;  1Z77 A;  3KKC A;  3AQT A;  5K7Z A;  3DU6 A;  3KNW A;  4M3B A;  3AQS A;  5F1J A;  2DG8 A;  3FK7 A;  4OD5 A;  2I10 A;  1T56 A;  3ZQH A;  3QBM A;  2ZCM A;  3VW0 A;  1SGM A;  3CCY A;  4X1E A;  1JUS A;  3LSR A;  3KYL A;  2R7R A;  3ON4 A;  4JNN A;  4AF5 A;  3PM1 A;  4M3E A;  3S5R A;  3BR6 A;  3EUP A;  5CXI A;  3DEW A;  3V6G A;  2HXI A;  5FKO A;  3BRU A; 
#chains in the Genus database with same CATH homology
 2QWT A;  3ZQF A;  1ZK8 A;  3LHQ A;  3VVY A;  4JYK A;  2OER A;  5CXG A;  3VP5 A;  4V2F A;  4NEL A;  4AC0 A;  3RD3 A;  3QPS A;  5J3L A;  5F08 A;  2WV1 A;  4I76 A;  2FD5 A;  4GCT A;  3FIW A;  2PZ9 A;  5D19 A;  1A6I A;  2XRL A;  2GEN A;  5FGL A;  2TCT A;  2WGB A;  2G0E A;  3LJL A;  3G56 A;  2X9D A;  2XPU A;  3O8G A;  2TRT A;  2Q24 A;  4AUX A;  2VPR A;  2ZOZ A;  3IH4 A;  3ON2 A;  2Y2Z A;  1QVU A;  2YVE A;  2GUH A;  2REK A;  3CRJ A;  2O7T A;  2NP3 A;  3T6N A;  2QTQ A;  4CGR A;  5IOZ A;  5FKM A;  4YZE A;  3LWJ A;  2ID3 A;  3BR5 A;  4D7M A;  3C07 A;  2Y31 A;  2XB5 A;  1JTX A;  3ANG A;  3C2B A;  4GFL A;  4NN1 A;  5HBU A;  1QVT A;  3HE0 A;  2O7O A;  2RHA A;  5F0F A;  2JK3 A;  4V2G A;  3G1M A;  1JUM A;  4ICH A;  4UDS A;  2HYJ A;  4B1R A;  3ZQG A;  3TP0 A;  2HKU A;  3G1L A;  3VUQ A;  3HGG A;  2QCO A;  2G7G A;  1UI6 A;  2IAI A;  2RAS A;  3VVZ A;  3NRG A;  2UXO A;  1JT6 A;  3BTC A;  2XPW A;  4AC6 A;  3LSP A;  3SDG A;  3VOX A;  2UXP A;  2VKE A;  5H9T A;  4GCK A;  3PPB A;  4GCL A;  2GBY A;  2FBQ A;  3BQY A;  3QQA A;  2JJ7 A;  3KZ9 A;  5F04 A;  2UXU A;  2YVH A;  2QIB A;  5IP6 A;  4JKZ A;  4ABZ A;  2IEK A;  4PXI A;  3BTL A;  2ZB9 A;  3BQZ A;  4W97 A;  5GPA A;  3BJB A;  1RPW A;  3FRQ A;  3VPR A;  3HTA A;  3NXC A;  4M3F A;  2G3B A;  3E7Q A;  4W1U A;  3VIB A;  5HAW A;  1T33 A;  3P9T A;  2IU5 A;  2OF7 A;  3B81 A;  3O8H A;  3V78 A;  3GZI A;  2G7S A;  3BTJ A;  2ZOY A;  1VI0 A;  3NPI A;  3HTJ A;  1QPI A;  5F0C A;  3ZQL A;  2DG7 A;  3F1B A;  2DTZ A;  4M3G A;  2HYT A;  3DCF A;  3G7R A;  3TP3 A;  3WHB A;  3ANP A;  5J1U A;  3QPL A;  5AQC A;  3LSJ A;  3KKD A;  2XPV A;  2IBD A;  2GFN A;  3Q0U A;  3Q3S A;  4L62 A;  3SFI A;  5K7F A;  3BNI A;  2G7L A;  5FKK A;  3BCG A;  5K7H A;  4I6Z A;  2XGC A;  2OI8 A;  3QKX A;  5C4Y A;  1Z0X A;  3BTI A;  1ZKG A;  2UXH A;  2QKO A;  3HTI A;  5HSZ A;  3LOC A;  4M3D A;  5IOY A;  4MO7 A;  2HXO A;  5J1R A;  3DPJ A;  3HTH A;  2D6Y A;  1RKW A;  3CWR A;  1BJZ A;  2WUI A;  1JT0 A;  5FKL A;  2W53 A;  2ID6 A;  3Q0V A;  5F0H A;  2Y30 A;  5CW8 A;  5FKN A;  5J1Y A;  4D7N A;  4DW6 A;  3IH2 A;  5GPC A;  2QOP A;  4MK6 A;  1RKT A;  5EFY A;  2ZCX A;  3F0C A;  4G12 A;  2FJ1 A;  5F27 A;  1JTY A;  3BR3 A;  3CDL A;  2VKV A;  5FHP A;  2XDN A;  4KWA A;  5FMP A;  2F07 A;  5GP9 A;  2XGE A;  2FQ4 A;  2RAE A;  3BR0 A;  1UI5 A;  4B3A A;  3B6C A;  5D18 A;  3FK6 A;  1ORK A;  3MNL A;  2V57 A;  3VW2 A;  3BHQ A;  1U9N A;  5K58 A;  3BR1 A;  4ME9 A;  3NI7 A;  2HQ5 A;  5IPA A;  3IH3 A;  3RH2 A;  2NP5 A;  3GEU A;  3PAS A;  2NX4 A;  3BR2 A;  3B6A A;  3COL A;  3VVX A;  3BT9 A;  3HIM A;  2ZCN A;  2XGD A;  3CJD A;  5EYR A;  4D5F A;  5DAJ A;  3G1O A;  2X6O A;  2PBX A;  3MVP A;  3HGY A;  4JL3 A;  2OPT A;  2NS8 A;  4XK4 A;  2UXI A;  2NS7 A;  3NNR A;  4MXM A;  2FX0 A;  4ACI A;  3VOK A;  3VW1 A;  3Q0W A;  4D5C A;  1JUP A;  1U9O A;  5EZH A;  3WHC A;  3EGQ A;  5D1R A;  2EH3 A;  4GFK A;  4HKU A;  3O60 A;  5EZG A;  3JSJ A;  3IUV A;  3ZQI A;  1Z77 A;  3KKC A;  3AQT A;  5K7Z A;  3KNW A;  4M3B A;  3AQS A;  5F1J A;  2DG8 A;  3FK7 A;  2I10 A;  1T56 A;  3ZQH A;  3QBM A;  2ZCM A;  3VW0 A;  1SGM A;  3CCY A;  4X1E A;  1JUS A;  3LSR A;  3ON4 A;  4JNN A;  4AF5 A;  3PM1 A;  4M3E A;  3S5R A;  3BR6 A;  3EUP A;  5CXI A;  3DEW A;  3V6G A;  2HXI A;  5FKO A;  3BRU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...