2HYTA

Crystal structure of a tetr-family transcriptional regulator (eca1819) from pectobacterium atrosepticum at 1.64 a resolution
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
193
structure length
193
Chain Sequence
RTRAEMEETRATLLATARKVFSERGYADTSMDDLTAQASLTRGALYHHFGDKKGLLAAVVEQIDAEMDERLQAISDTAEDDWEGFRCRCRAYLEMALEPEIQRIVLRDARAVLGGASPDSQRHCVESMQRLIDNLIRQGVVAEADPQALASLIYGSLAEAAFWIAEGEDGNARLAQGVAALELLLRGLLVKPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TetR-family transcriptional regulator
publication title Crystal structure of TetR-family transcriptional regulator (YP_049917.1) from Erwinia Cartovora Atroseptica SCRI1043 at 1.64 A resolution
rcsb
source organism Pectobacterium atrosepticum
molecule tags Transcription
total genus 75
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 2006-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2hytA00
1ZK8A 4M3FA 5K7HA 5FKNA 2OF7A 2OI8A 3ZQLA 1ORKA 2GFNA 3BHQA 5HBUA 3PASA 2UXUA 3BT9A 3BTCA 2I10A 2Y30A 2ZCNA 2HXIA 2O7OA 4M3DA 1ZKGA 3LSJA 5J1RA 3Q3SA 5EFYA 5H9TA 3VUQA 3DPJA 3G56A 1Z0XA 1T56A 5D1RA 2XRLA 2XGCA 3C07A 5HSZA 3HGGA 3ON2A 2X9DA 4GCLA 2ZOZA 2HXOA 3NI7A 3LSRA 3DCFA 3LJLA 3LOCA 5EZGA 2DTZA 2DG7A 1VI0A 3F0CA 3QBMA 2Y2ZA 3SFIA 3V6GA 5AQCA 1BJZA 3O8GA 3BQYA 3RD3A 3EGQA 2XB5A 3BR6A 1RPWA 2NX4A 4AC0A 3ZQGA 3CRJA 1JTXA 2FJ1A 3SDGA 4XK4A 5GPCA 2G7SA 3C2BA 3VIBA 5FHPA 4D7NA 1JTYA 2REKA 5F1JA 3HE0A 4JNNA 5GP9A 4W97A 2PBXA 3F1BA 3Q0UA 4NN1A 3QQAA 3CWRA 4D5FA 2G3BA 4GCKA 4V2GA 3JSJA 1SGMA 3BCGA 1QVTA 5F08A 3B6CA 4MK6A 3FIWA 2GBYA 2IEKA 5J1YA 5DAJA 3COLA 2ZOYA 4D7MA 2NP3A 2D6YA 3NXCA 3AQTA 3G1LA 5CW8A 2YVEA 3ANGA 4M3GA 3ANPA 4AC6A 4JYKA 4V2FA 3PM1A 3BTIA 2FQ4A 3CJDA 3BTJA 5EYRA 2QWTA 2F07A 4AUXA 1QPIA 2RAEA 4G12A 5EZHA 2QOPA 3BJBA 2WGBA 2HKUA 3MVPA 3BRUA 2OERA 2HYTA 1U9NA 5CXGA 2VKVA 2JK3A 3BR1A 2IAIA 3G1MA 2WUIA 4JKZA 2VKEA 3IH3A 2RASA 4ICHA 3IH2A 5GPAA 3P9TA 5F0FA 3HTAA 3NRGA 3BR0A 4NELA 3PPBA 5D19A 4YZEA 4I76A 2FX0A 2ZCMA 3KKDA 2YVHA 4PXIA 5IP6A 2HYJA 4GFKA 1JT0A 3LSPA 3MNLA 5C4YA 4L62A 2UXOA 4JL3A 4GFLA 2UXIA 3FRQA 3G1OA 1UI5A 2XPVA 2IU5A 3WHBA 2NS7A 2ZCXA 2JJ7A 2TRTA 3O60A 4D5CA 3T6NA 3E7QA 3VPRA 2HQ5A 4ACIA 3Q0WA 3KZ9A 4M3EA 2Q24A 1JT6A 3B81A 3DEWA 3AQSA 5FMPA 3BR5A 2ID3A 3NPIA 1Z77A 3IUVA 3Q0VA 4GCTA 5IPAA 4I6ZA 5FKOA 3VOXA 3LHQA 3HIMA 3IH4A 3BR2A 3KKCA 2XGEA 1A6IA 5F0CA 2V57A 3BR3A 2ZB9A 1RKTA 2GUHA 1QVUA 2QKOA 1U9OA 3O8HA 3S5RA 2ID6A 2IBDA 3RH2A 5K7ZA 3VW2A 3ZQHA 1UI6A 3G7RA 5FKKA 5HAWA 2QIBA 2W53A 3VVXA 4ABZA 4AF5A 4UDSA 3WHCA 3VW0A 2G7GA 3QPLA 3VP5A 3VVZA 3HTHA 5K7FA 5K58A 1JUMA 2QTQA 3HTJA 5FGLA 1JUPA 3ON4A 1T33A 3BTLA 3TP3A 2GENA 3BNIA 2O7TA 3V78A 3B6AA 5F0HA 2NS8A 4MXMA 5J1UA 4M3BA 4X1EA 2XDNA 2FBQA 3VVYA 3CDLA 3HTIA 3NNRA 2XGDA 3BQZA 3TP0A 5FKLA 1RKWA 2DG8A 4W1UA 5IOZA 3FK6A 3CCYA 2XPUA 3QKXA 5F27A 3ZQIA 3GEUA 2FD5A 2NP5A 2Y31A 4B3AA 2TCTA 1JUSA 2QCOA 5IOYA 2RHAA 4B1RA 2G7LA 3KNWA 5D18A 3QPSA 5FKMA 3ZQFA 5F04A 2PZ9A 2XPWA 3HGYA 2X6OA 5J3LA 4DW6A 3FK7A 4HKUA 2EH3A 2OPTA 2WV1A 3EUPA 3LWJA 2UXPA 3VW1A 4KWAA 2G0EA 4CGRA 2VPRA 4ME9A 3VOKA 3GZIA 5CXIA 4MO7A 2UXHA
chains in the Genus database with same CATH superfamily
1ZK8A 4M3FA 5K7HA 5FKNA 2OF7A 2OI8A 3ZQLA 1ORKA 2GFNA 2R7SA 3BHQA 5HBUA 3PASA 2A2FX 2UXUA 3BT9A 3NS4A 3BTCA 2I10A 2Y30A 2ZCNA 2HXIA 2O7OA 4M3DA 1ZKGA 3LSJA 5J1RA 3Q3SA 5EFYA 5H9TA 3VUQA 3DPJA 3G56A 1Z0XA 2R7UA 1T56A 5D1RA 2XRLA 2XGCA 3C07A 5HSZA 3SWHA 3HGGA 3ON2A 2X9DA 4GCLA 2ZOZA 2HXOA 3NI7A 4U9NA 3LSRA 3DCFA 3LJLA 3LOCA 5EZGA 2B3WA 2DTZA 2DG7A 3FHNA 1VI0A 3F0CA 3QBMA 2Y2ZA 3SFIA 5AQCA 3V6GA 1BJZA 2R7WA 3O8GA 3BQYA 3RD3A 3EGQA 2XB5A 3BR6A 1RPWA 2R7RA 3K8PC 2NX4A 4AC0A 3DU5A 3ZQGA 3CRJA 1JTXA 2FJ1A 3SDGA 4XK4A 5GPCA 2G7SA 3C2BA 3VIBA 5FHPA 4D7NA 1JTYA 2REKA 5F1JA 3HE0A 4JNNA 5GP9A 4W97A 2PBXA 3F1BA 3Q0UA 4NN1A 3QQAA 3CWRA 4D5FA 2G3BA 4GCKA 4V2GA 3JSJA 2PFVA 1SGMA 3BCGA 1QVTA 5F08A 3B6CA 4MK6A 3FIWA 2GBYA 2IEKA 5J1YA 5DAJA 3COLA 2ZOYA 4D7MA 2NP3A 2D6YA 3NXCA 3AQTA 3G1LA 5CW8A 2YVEA 3ANGA 4M3GA 3ANPA 4AC6A 2FJI1 4JYKA 4V2FA 3PM1A 3BTIA 2FQ4A 3CJDA 3BTJA 5EYRA 2QWTA 2F07A 4AUXA 1QPIA 2RAEA 4G12A 5EZHA 2QOPA 3BJBA 2WGBA 2HKUA 3MVPA 3BRUA 2OERA 2HYTA 1U9NA 5CXGA 2VKVA 2JK3A 3BR1A 2IAIA 3G1MA 2R7OA 2WUIA 4JKZA 2VKEA 3IH3A 2RASA 4ICHA 2R7QA 3IH2A 5GPAA 2R7TA 3P9TA 5F0FA 3HTAA 3NRGA 3BR0A 4NELA 3PPBA 5D19A 4YZEA 4I76A 2FX0A 2R7XA 2ZCMA 3KKDA 2YVHA 4PXIA 5IP6A 2HYJA 4GFKA 1JT0A 3LSPA 3MNLA 5C4YA 4L62A 2UXOA 4JL3A 4GFLA 2UXIA 3FRQA 3G1OA 1UI5A 2XPVA 2IU5A 3WHBA 2NS7A 2ZCXA 2JJ7A 2TRTA 3O60A 4D5CA 3T6NA 3E7QA 3VPRA 2HQ5A 4ACIA 3Q0WA 3KZ9A 4WIBA 4M3EA 2Q24A 2YVXA 1JT6A 3B81A 3DEWA 3AQSA 5FMPA 3BR5A 2ID3A 3NPIA 1Z77A 3IUVA 3Q0VA 4GCTA 5IPAA 4I6ZA 5FKOA 3VOXA 3LHQA 3HIMA 3IH4A 3BR2A 3KKCA 4DVYP 2XGEA 1A6IA 5F0CA 2V57A 3BR3A 2ZB9A 1RKTA 2GUHA 1QVUA 2QKOA 1U9OA 3O8HA 3S5RA 2ID6A 2IBDA 3RH2A 5K7ZA 3VW2A 3DU6A 3ZQHA 3KYLA 1UI6A 3G7RA 5FKKA 5HAWA 2QIBA 2W53A 3VVXA 4ABZA 4AF5A 4U9LA 4UDSA 3WHCA 3VW0A 2G7GA 3QPLA 3VP5A 4IRVA 3VVZA 3HTHA 5K7FA 5K58A 1JUMA 2QTQA 3HTJA 5FGLA 1JUPA 3ON4A 1T33A 3BTLA 3TP3A 2GENA 3BNIA 2O7TA 3V78A 3B6AA 5F0HA 2NS8A 4MXMA 5J1UA 4M3BA 5CQGA 4X1EA 2XDNA 2FBQA 3VVYA 3CDLA 3HTIA 3NNRA 2XGDA 3BQZA 4OD5A 3TP0A 5FKLA 1RKWA 2DG8A 4W1UA 5IOZA 3FK6A 3CCYA 2XPUA 3QKXA 5F27A 3ZQIA 3GEUA 2FD5A 2NP5A 2Y31A 4B3AA 2TCTA 1JUSA 2QCOA 2R7VA 5IOYA 2RHAA 2B1EA 2ZY9A 4C2MA 4B1RA 2G7LA 3KNWA 5D18A 3QPSA 5FKMA 3ZQFA 5F04A 2PZ9A 2XPWA 3HGYA 2X6OA 5J3LA 4DW6A 3FK7A 4HKUA 2EH3A 2OPTA 2WV1A 3EUPA 3LWJA 2UXPA 4OD4A 3VW1A 4KWAA 2G0EA 4CGRA 2VPRA 4ME9A 3VOKA 3VTIA 3GZIA 5CXIA 4MO7A 2UXHA
chains in the Genus database with same CATH topology
1ZK8A 4M3FA 5K7HA 5FKNA 2OF7A 2OI8A 3ZQLA 1ORKA 2GFNA 3BHQA 5HBUA 3PASA 2UXUA 3BT9A 3BTCA 2I10A 2Y30A 2ZCNA 2HXIA 2O7OA 4M3DA 1ZKGA 3LSJA 5J1RA 3Q3SA 5EFYA 5H9TA 3VUQA 3DPJA 3G56A 1Z0XA 1T56A 5D1RA 2XRLA 2XGCA 3C07A 5HSZA 3HGGA 3ON2A 2X9DA 4GCLA 2ZOZA 2HXOA 3NI7A 3LSRA 3DCFA 3LJLA 3LOCA 5EZGA 2DTZA 2DG7A 1VI0A 3F0CA 3QBMA 2Y2ZA 3SFIA 3V6GA 5AQCA 1BJZA 3O8GA 3BQYA 3RD3A 3EGQA 2XB5A 3BR6A 1RPWA 2NX4A 4AC0A 3ZQGA 3CRJA 1JTXA 2FJ1A 3SDGA 4XK4A 5GPCA 2G7SA 3C2BA 3VIBA 5FHPA 4D7NA 1JTYA 2REKA 5F1JA 3HE0A 4JNNA 5GP9A 4W97A 2PBXA 3F1BA 3Q0UA 4NN1A 3QQAA 3CWRA 4D5FA 2G3BA 4GCKA 4V2GA 3JSJA 1SGMA 3BCGA 1QVTA 5F08A 3B6CA 4MK6A 3FIWA 2GBYA 2IEKA 5J1YA 5DAJA 3COLA 2ZOYA 4D7MA 2NP3A 2D6YA 3NXCA 3AQTA 3G1LA 5CW8A 2YVEA 3ANGA 4M3GA 3ANPA 4AC6A 4JYKA 4V2FA 3PM1A 3BTIA 2FQ4A 3CJDA 3BTJA 5EYRA 2QWTA 2F07A 4AUXA 1QPIA 2RAEA 4G12A 5EZHA 2QOPA 3BJBA 2WGBA 2HKUA 3MVPA 3BRUA 2OERA 2HYTA 1U9NA 5CXGA 2VKVA 2JK3A 3BR1A 2IAIA 3G1MA 2WUIA 4JKZA 2VKEA 3IH3A 2RASA 4ICHA 3IH2A 5GPAA 3P9TA 5F0FA 3HTAA 3NRGA 3BR0A 4NELA 3PPBA 5D19A 4YZEA 4I76A 2FX0A 2ZCMA 3KKDA 2YVHA 4PXIA 5IP6A 2HYJA 4GFKA 1JT0A 3LSPA 3MNLA 5C4YA 4L62A 2UXOA 4JL3A 4GFLA 2UXIA 3FRQA 3G1OA 1UI5A 2XPVA 2IU5A 3WHBA 2NS7A 2ZCXA 2JJ7A 2TRTA 3O60A 4D5CA 3T6NA 3E7QA 3VPRA 2HQ5A 4ACIA 3Q0WA 3KZ9A 4M3EA 2Q24A 1JT6A 3B81A 3DEWA 3AQSA 5FMPA 3BR5A 2ID3A 3NPIA 1Z77A 3IUVA 3Q0VA 4GCTA 5IPAA 4I6ZA 5FKOA 3VOXA 3LHQA 3HIMA 3IH4A 3BR2A 3KKCA 2XGEA 1A6IA 5F0CA 2V57A 3BR3A 2ZB9A 1RKTA 2GUHA 1QVUA 2QKOA 1U9OA 3O8HA 3S5RA 2ID6A 2IBDA 3RH2A 5K7ZA 3VW2A 3ZQHA 1UI6A 3G7RA 5FKKA 5HAWA 2QIBA 2W53A 3VVXA 4ABZA 4AF5A 4UDSA 3WHCA 3VW0A 2G7GA 3QPLA 3VP5A 3VVZA 3HTHA 5K7FA 5K58A 1JUMA 2QTQA 3HTJA 5FGLA 1JUPA 3ON4A 1T33A 3BTLA 3TP3A 2GENA 3BNIA 2O7TA 3V78A 3B6AA 5F0HA 2NS8A 4MXMA 5J1UA 4M3BA 4X1EA 2XDNA 2FBQA 3VVYA 3CDLA 3HTIA 3NNRA 2XGDA 3BQZA 3TP0A 5FKLA 1RKWA 2DG8A 4W1UA 5IOZA 3FK6A 3CCYA 2XPUA 3QKXA 5F27A 3ZQIA 3GEUA 2FD5A 2NP5A 2Y31A 4B3AA 2TCTA 1JUSA 2QCOA 5IOYA 2RHAA 4B1RA 2G7LA 3KNWA 5D18A 3QPSA 5FKMA 3ZQFA 5F04A 2PZ9A 2XPWA 3HGYA 2X6OA 5J3LA 4DW6A 3FK7A 4HKUA 2EH3A 2OPTA 2WV1A 3EUPA 3LWJA 2UXPA 3VW1A 4KWAA 2G0EA 4CGRA 2VPRA 4ME9A 3VOKA 3GZIA 5CXIA 4MO7A 2UXHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZK8 A;  4M3F A;  5K7H A;  5FKN A;  2OF7 A;  2OI8 A;  3ZQL A;  1ORK A;  2GFN A;  3BHQ A;  5HBU A;  3PAS A;  2UXU A;  3BT9 A;  3BTC A;  2I10 A;  2Y30 A;  2ZCN A;  2HXI A;  2O7O A;  4M3D A;  1ZKG A;  3LSJ A;  5J1R A;  3Q3S A;  5EFY A;  5H9T A;  3VUQ A;  3DPJ A;  3G56 A;  1Z0X A;  1T56 A;  5D1R A;  2XRL A;  2XGC A;  3C07 A;  5HSZ A;  3HGG A;  3ON2 A;  2X9D A;  4GCL A;  2ZOZ A;  2HXO A;  3NI7 A;  3LSR A;  3DCF A;  3LJL A;  3LOC A;  5EZG A;  2DTZ A;  2DG7 A;  1VI0 A;  3F0C A;  3QBM A;  2Y2Z A;  3SFI A;  3V6G A;  5AQC A;  1BJZ A;  3O8G A;  3BQY A;  3RD3 A;  3EGQ A;  2XB5 A;  3BR6 A;  1RPW A;  2NX4 A;  4AC0 A;  3ZQG A;  3CRJ A;  1JTX A;  2FJ1 A;  3SDG A;  4XK4 A;  5GPC A;  2G7S A;  3C2B A;  3VIB A;  5FHP A;  4D7N A;  1JTY A;  2REK A;  5F1J A;  3HE0 A;  4JNN A;  5GP9 A;  4W97 A;  2PBX A;  3F1B A;  3Q0U A;  4NN1 A;  3QQA A;  3CWR A;  4D5F A;  2G3B A;  4GCK A;  4V2G A;  3JSJ A;  1SGM A;  3BCG A;  1QVT A;  5F08 A;  3B6C A;  4MK6 A;  3FIW A;  2GBY A;  2IEK A;  5J1Y A;  5DAJ A;  3COL A;  2ZOY A;  4D7M A;  2NP3 A;  2D6Y A;  3NXC A;  3AQT A;  3G1L A;  5CW8 A;  2YVE A;  3ANG A;  4M3G A;  3ANP A;  4AC6 A;  4JYK A;  4V2F A;  3PM1 A;  3BTI A;  2FQ4 A;  3CJD A;  3BTJ A;  5EYR A;  2QWT A;  2F07 A;  4AUX A;  1QPI A;  2RAE A;  4G12 A;  5EZH A;  2QOP A;  3BJB A;  2WGB A;  2HKU A;  3MVP A;  3BRU A;  2OER A;  2HYT A;  1U9N A;  5CXG A;  2VKV A;  2JK3 A;  3BR1 A;  2IAI A;  3G1M A;  2WUI A;  4JKZ A;  2VKE A;  3IH3 A;  2RAS A;  4ICH A;  3IH2 A;  5GPA A;  3P9T A;  5F0F A;  3HTA A;  3NRG A;  3BR0 A;  4NEL A;  3PPB A;  5D19 A;  4YZE A;  4I76 A;  2FX0 A;  2ZCM A;  3KKD A;  2YVH A;  4PXI A;  5IP6 A;  2HYJ A;  4GFK A;  1JT0 A;  3LSP A;  3MNL A;  5C4Y A;  4L62 A;  2UXO A;  4JL3 A;  4GFL A;  2UXI A;  3FRQ A;  3G1O A;  1UI5 A;  2XPV A;  2IU5 A;  3WHB A;  2NS7 A;  2ZCX A;  2JJ7 A;  2TRT A;  3O60 A;  4D5C A;  3T6N A;  3E7Q A;  3VPR A;  2HQ5 A;  4ACI A;  3Q0W A;  3KZ9 A;  4M3E A;  2Q24 A;  1JT6 A;  3B81 A;  3DEW A;  3AQS A;  5FMP A;  3BR5 A;  2ID3 A;  3NPI A;  1Z77 A;  3IUV A;  3Q0V A;  4GCT A;  5IPA A;  4I6Z A;  5FKO A;  3VOX A;  3LHQ A;  3HIM A;  3IH4 A;  3BR2 A;  3KKC A;  2XGE A;  1A6I A;  5F0C A;  2V57 A;  3BR3 A;  2ZB9 A;  1RKT A;  2GUH A;  1QVU A;  2QKO A;  1U9O A;  3O8H A;  3S5R A;  2ID6 A;  2IBD A;  3RH2 A;  5K7Z A;  3VW2 A;  3ZQH A;  1UI6 A;  3G7R A;  5FKK A;  5HAW A;  2QIB A;  2W53 A;  3VVX A;  4ABZ A;  4AF5 A;  4UDS A;  3WHC A;  3VW0 A;  2G7G A;  3QPL A;  3VP5 A;  3VVZ A;  3HTH A;  5K7F A;  5K58 A;  1JUM A;  2QTQ A;  3HTJ A;  5FGL A;  1JUP A;  3ON4 A;  1T33 A;  3BTL A;  3TP3 A;  2GEN A;  3BNI A;  2O7T A;  3V78 A;  3B6A A;  5F0H A;  2NS8 A;  4MXM A;  5J1U A;  4M3B A;  4X1E A;  2XDN A;  2FBQ A;  3VVY A;  3CDL A;  3HTI A;  3NNR A;  2XGD A;  3BQZ A;  3TP0 A;  5FKL A;  1RKW A;  2DG8 A;  4W1U A;  5IOZ A;  3FK6 A;  3CCY A;  2XPU A;  3QKX A;  5F27 A;  3ZQI A;  3GEU A;  2FD5 A;  2NP5 A;  2Y31 A;  4B3A A;  2TCT A;  1JUS A;  2QCO A;  5IOY A;  2RHA A;  4B1R A;  2G7L A;  3KNW A;  5D18 A;  3QPS A;  5FKM A;  3ZQF A;  5F04 A;  2PZ9 A;  2XPW A;  3HGY A;  2X6O A;  5J3L A;  4DW6 A;  3FK7 A;  4HKU A;  2EH3 A;  2OPT A;  2WV1 A;  3EUP A;  3LWJ A;  2UXP A;  3VW1 A;  4KWA A;  2G0E A;  4CGR A;  2VPR A;  4ME9 A;  3VOK A;  3GZI A;  5CXI A;  4MO7 A;  2UXH A; 
#chains in the Genus database with same CATH topology
 1ZK8 A;  4M3F A;  5K7H A;  5FKN A;  2OF7 A;  2OI8 A;  3ZQL A;  1ORK A;  2GFN A;  2R7S A;  3BHQ A;  5HBU A;  3PAS A;  2A2F X;  2UXU A;  3BT9 A;  3NS4 A;  3BTC A;  2I10 A;  2Y30 A;  2ZCN A;  2HXI A;  2O7O A;  4M3D A;  1ZKG A;  3LSJ A;  5J1R A;  3Q3S A;  5EFY A;  5H9T A;  3VUQ A;  3DPJ A;  3G56 A;  1Z0X A;  2R7U A;  1T56 A;  5D1R A;  2XRL A;  2XGC A;  3C07 A;  5HSZ A;  3SWH A;  3HGG A;  3ON2 A;  2X9D A;  4GCL A;  2ZOZ A;  2HXO A;  3NI7 A;  4U9N A;  3LSR A;  3DCF A;  3LJL A;  3LOC A;  5EZG A;  2B3W A;  2DTZ A;  2DG7 A;  3FHN A;  1VI0 A;  3F0C A;  3QBM A;  2Y2Z A;  3SFI A;  5AQC A;  3V6G A;  1BJZ A;  2R7W A;  3O8G A;  3BQY A;  3RD3 A;  3EGQ A;  2XB5 A;  3BR6 A;  1RPW A;  2R7R A;  3K8P C;  2NX4 A;  4AC0 A;  3DU5 A;  3ZQG A;  3CRJ A;  1JTX A;  2FJ1 A;  3SDG A;  4XK4 A;  5GPC A;  2G7S A;  3C2B A;  3VIB A;  5FHP A;  4D7N A;  1JTY A;  2REK A;  5F1J A;  3HE0 A;  4JNN A;  5GP9 A;  4W97 A;  2PBX A;  3F1B A;  3Q0U A;  4NN1 A;  3QQA A;  3CWR A;  4D5F A;  2G3B A;  4GCK A;  4V2G A;  3JSJ A;  2PFV A;  1SGM A;  3BCG A;  1QVT A;  5F08 A;  3B6C A;  4MK6 A;  3FIW A;  2GBY A;  2IEK A;  5J1Y A;  5DAJ A;  3COL A;  2ZOY A;  4D7M A;  2NP3 A;  2D6Y A;  3NXC A;  3AQT A;  3G1L A;  5CW8 A;  2YVE A;  3ANG A;  4M3G A;  3ANP A;  4AC6 A;  2FJI 1;  4JYK A;  4V2F A;  3PM1 A;  3BTI A;  2FQ4 A;  3CJD A;  3BTJ A;  5EYR A;  2QWT A;  2F07 A;  4AUX A;  1QPI A;  2RAE A;  4G12 A;  5EZH A;  2QOP A;  3BJB A;  2WGB A;  2HKU A;  3MVP A;  3BRU A;  2OER A;  2HYT A;  1U9N A;  5CXG A;  2VKV A;  2JK3 A;  3BR1 A;  2IAI A;  3G1M A;  2R7O A;  2WUI A;  4JKZ A;  2VKE A;  3IH3 A;  2RAS A;  4ICH A;  2R7Q A;  3IH2 A;  5GPA A;  2R7T A;  3P9T A;  5F0F A;  3HTA A;  3NRG A;  3BR0 A;  4NEL A;  3PPB A;  5D19 A;  4YZE A;  4I76 A;  2FX0 A;  2R7X A;  2ZCM A;  3KKD A;  2YVH A;  4PXI A;  5IP6 A;  2HYJ A;  4GFK A;  1JT0 A;  3LSP A;  3MNL A;  5C4Y A;  4L62 A;  2UXO A;  4JL3 A;  4GFL A;  2UXI A;  3FRQ A;  3G1O A;  1UI5 A;  2XPV A;  2IU5 A;  3WHB A;  2NS7 A;  2ZCX A;  2JJ7 A;  2TRT A;  3O60 A;  4D5C A;  3T6N A;  3E7Q A;  3VPR A;  2HQ5 A;  4ACI A;  3Q0W A;  3KZ9 A;  4WIB A;  4M3E A;  2Q24 A;  2YVX A;  1JT6 A;  3B81 A;  3DEW A;  3AQS A;  5FMP A;  3BR5 A;  2ID3 A;  3NPI A;  1Z77 A;  3IUV A;  3Q0V A;  4GCT A;  5IPA A;  4I6Z A;  5FKO A;  3VOX A;  3LHQ A;  3HIM A;  3IH4 A;  3BR2 A;  3KKC A;  4DVY P;  2XGE A;  1A6I A;  5F0C A;  2V57 A;  3BR3 A;  2ZB9 A;  1RKT A;  2GUH A;  1QVU A;  2QKO A;  1U9O A;  3O8H A;  3S5R A;  2ID6 A;  2IBD A;  3RH2 A;  5K7Z A;  3VW2 A;  3DU6 A;  3ZQH A;  3KYL A;  1UI6 A;  3G7R A;  5FKK A;  5HAW A;  2QIB A;  2W53 A;  3VVX A;  4ABZ A;  4AF5 A;  4U9L A;  4UDS A;  3WHC A;  3VW0 A;  2G7G A;  3QPL A;  3VP5 A;  4IRV A;  3VVZ A;  3HTH A;  5K7F A;  5K58 A;  1JUM A;  2QTQ A;  3HTJ A;  5FGL A;  1JUP A;  3ON4 A;  1T33 A;  3BTL A;  3TP3 A;  2GEN A;  3BNI A;  2O7T A;  3V78 A;  3B6A A;  5F0H A;  2NS8 A;  4MXM A;  5J1U A;  4M3B A;  5CQG A;  4X1E A;  2XDN A;  2FBQ A;  3VVY A;  3CDL A;  3HTI A;  3NNR A;  2XGD A;  3BQZ A;  4OD5 A;  3TP0 A;  5FKL A;  1RKW A;  2DG8 A;  4W1U A;  5IOZ A;  3FK6 A;  3CCY A;  2XPU A;  3QKX A;  5F27 A;  3ZQI A;  3GEU A;  2FD5 A;  2NP5 A;  2Y31 A;  4B3A A;  2TCT A;  1JUS A;  2QCO A;  2R7V A;  5IOY A;  2RHA A;  2B1E A;  2ZY9 A;  4C2M A;  4B1R A;  2G7L A;  3KNW A;  5D18 A;  3QPS A;  5FKM A;  3ZQF A;  5F04 A;  2PZ9 A;  2XPW A;  3HGY A;  2X6O A;  5J3L A;  4DW6 A;  3FK7 A;  4HKU A;  2EH3 A;  2OPT A;  2WV1 A;  3EUP A;  3LWJ A;  2UXP A;  4OD4 A;  3VW1 A;  4KWA A;  2G0E A;  4CGR A;  2VPR A;  4ME9 A;  3VOK A;  3VTI A;  3GZI A;  5CXI A;  4MO7 A;  2UXH A; 
#chains in the Genus database with same CATH homology
 1ZK8 A;  4M3F A;  5K7H A;  5FKN A;  2OF7 A;  2OI8 A;  3ZQL A;  1ORK A;  2GFN A;  3BHQ A;  5HBU A;  3PAS A;  2UXU A;  3BT9 A;  3BTC A;  2I10 A;  2Y30 A;  2ZCN A;  2HXI A;  2O7O A;  4M3D A;  1ZKG A;  3LSJ A;  5J1R A;  3Q3S A;  5EFY A;  5H9T A;  3VUQ A;  3DPJ A;  3G56 A;  1Z0X A;  1T56 A;  5D1R A;  2XRL A;  2XGC A;  3C07 A;  5HSZ A;  3HGG A;  3ON2 A;  2X9D A;  4GCL A;  2ZOZ A;  2HXO A;  3NI7 A;  3LSR A;  3DCF A;  3LJL A;  3LOC A;  5EZG A;  2DTZ A;  2DG7 A;  1VI0 A;  3F0C A;  3QBM A;  2Y2Z A;  3SFI A;  3V6G A;  5AQC A;  1BJZ A;  3O8G A;  3BQY A;  3RD3 A;  3EGQ A;  2XB5 A;  3BR6 A;  1RPW A;  2NX4 A;  4AC0 A;  3ZQG A;  3CRJ A;  1JTX A;  2FJ1 A;  3SDG A;  4XK4 A;  5GPC A;  2G7S A;  3C2B A;  3VIB A;  5FHP A;  4D7N A;  1JTY A;  2REK A;  5F1J A;  3HE0 A;  4JNN A;  5GP9 A;  4W97 A;  2PBX A;  3F1B A;  3Q0U A;  4NN1 A;  3QQA A;  3CWR A;  4D5F A;  2G3B A;  4GCK A;  4V2G A;  3JSJ A;  1SGM A;  3BCG A;  1QVT A;  5F08 A;  3B6C A;  4MK6 A;  3FIW A;  2GBY A;  2IEK A;  5J1Y A;  5DAJ A;  3COL A;  2ZOY A;  4D7M A;  2NP3 A;  2D6Y A;  3NXC A;  3AQT A;  3G1L A;  5CW8 A;  2YVE A;  3ANG A;  4M3G A;  3ANP A;  4AC6 A;  4JYK A;  4V2F A;  3PM1 A;  3BTI A;  2FQ4 A;  3CJD A;  3BTJ A;  5EYR A;  2QWT A;  2F07 A;  4AUX A;  1QPI A;  2RAE A;  4G12 A;  5EZH A;  2QOP A;  3BJB A;  2WGB A;  2HKU A;  3MVP A;  3BRU A;  2OER A;  2HYT A;  1U9N A;  5CXG A;  2VKV A;  2JK3 A;  3BR1 A;  2IAI A;  3G1M A;  2WUI A;  4JKZ A;  2VKE A;  3IH3 A;  2RAS A;  4ICH A;  3IH2 A;  5GPA A;  3P9T A;  5F0F A;  3HTA A;  3NRG A;  3BR0 A;  4NEL A;  3PPB A;  5D19 A;  4YZE A;  4I76 A;  2FX0 A;  2ZCM A;  3KKD A;  2YVH A;  4PXI A;  5IP6 A;  2HYJ A;  4GFK A;  1JT0 A;  3LSP A;  3MNL A;  5C4Y A;  4L62 A;  2UXO A;  4JL3 A;  4GFL A;  2UXI A;  3FRQ A;  3G1O A;  1UI5 A;  2XPV A;  2IU5 A;  3WHB A;  2NS7 A;  2ZCX A;  2JJ7 A;  2TRT A;  3O60 A;  4D5C A;  3T6N A;  3E7Q A;  3VPR A;  2HQ5 A;  4ACI A;  3Q0W A;  3KZ9 A;  4M3E A;  2Q24 A;  1JT6 A;  3B81 A;  3DEW A;  3AQS A;  5FMP A;  3BR5 A;  2ID3 A;  3NPI A;  1Z77 A;  3IUV A;  3Q0V A;  4GCT A;  5IPA A;  4I6Z A;  5FKO A;  3VOX A;  3LHQ A;  3HIM A;  3IH4 A;  3BR2 A;  3KKC A;  2XGE A;  1A6I A;  5F0C A;  2V57 A;  3BR3 A;  2ZB9 A;  1RKT A;  2GUH A;  1QVU A;  2QKO A;  1U9O A;  3O8H A;  3S5R A;  2ID6 A;  2IBD A;  3RH2 A;  5K7Z A;  3VW2 A;  3ZQH A;  1UI6 A;  3G7R A;  5FKK A;  5HAW A;  2QIB A;  2W53 A;  3VVX A;  4ABZ A;  4AF5 A;  4UDS A;  3WHC A;  3VW0 A;  2G7G A;  3QPL A;  3VP5 A;  3VVZ A;  3HTH A;  5K7F A;  5K58 A;  1JUM A;  2QTQ A;  3HTJ A;  5FGL A;  1JUP A;  3ON4 A;  1T33 A;  3BTL A;  3TP3 A;  2GEN A;  3BNI A;  2O7T A;  3V78 A;  3B6A A;  5F0H A;  2NS8 A;  4MXM A;  5J1U A;  4M3B A;  4X1E A;  2XDN A;  2FBQ A;  3VVY A;  3CDL A;  3HTI A;  3NNR A;  2XGD A;  3BQZ A;  3TP0 A;  5FKL A;  1RKW A;  2DG8 A;  4W1U A;  5IOZ A;  3FK6 A;  3CCY A;  2XPU A;  3QKX A;  5F27 A;  3ZQI A;  3GEU A;  2FD5 A;  2NP5 A;  2Y31 A;  4B3A A;  2TCT A;  1JUS A;  2QCO A;  5IOY A;  2RHA A;  4B1R A;  2G7L A;  3KNW A;  5D18 A;  3QPS A;  5FKM A;  3ZQF A;  5F04 A;  2PZ9 A;  2XPW A;  3HGY A;  2X6O A;  5J3L A;  4DW6 A;  3FK7 A;  4HKU A;  2EH3 A;  2OPT A;  2WV1 A;  3EUP A;  3LWJ A;  2UXP A;  3VW1 A;  4KWA A;  2G0E A;  4CGR A;  2VPR A;  4ME9 A;  3VOK A;  3GZI A;  5CXI A;  4MO7 A;  2UXH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...