2HYTA

Crystal structure of a tetr-family transcriptional regulator (eca1819) from pectobacterium atrosepticum at 1.64 a resolution
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
193
structure length
193
Chain Sequence
RTRAEMEETRATLLATARKVFSERGYADTSMDDLTAQASLTRGALYHHFGDKKGLLAAVVEQIDAEMDERLQAISDTAEDDWEGFRCRCRAYLEMALEPEIQRIVLRDARAVLGGASPDSQRHCVESMQRLIDNLIRQGVVAEADPQALASLIYGSLAEAAFWIAEGEDGNARLAQGVAALELLLRGLLVKPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords TetR-family transcriptional regulator
publication title Crystal structure of TetR-family transcriptional regulator (YP_049917.1) from Erwinia Cartovora Atroseptica SCRI1043 at 1.64 A resolution
rcsb
source organism Pectobacterium atrosepticum
total genus 75
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 2006-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2hytA00
1ZKGA 4ABZA 3Q0UA 2NP3A 4W97A 3FIWA 2I10A 2NP5A 3VVXA 4YZEA 3VVZA 3GZIA 3CDLA 4M3EA 5D19A 3HTAA 3VVYA 2HYJA 5IOZA 3V78A 2FX0A 5FKLA 3ZQHA 3C07A 1Z0XA 3AQSA 2QOPA 5H9TA 1SGMA 3VP5A 2QWTA 3COLA 2HXOA 3VOKA 2VKVA 3ZQLA 3NI7A 5FHPA 2ZB9A 2RASA 3BNIA 1QVTA 2NX4A 2XGEA 3BRUA 4B1RA 3BT9A 4NN1A 1QPIA 5GPAA 1RPWA 4G12A 3O60A 1UI5A 2YVEA 2G0EA 3V6GA 3BR0A 3IH3A 5K7FA 4MO7A 2HQ5A 2NS7A 2RHAA 3O8GA 2G7LA 3BJBA 2X9DA 3PPBA 3P9TA 3DCFA 4AC0A 4ME9A 4V2FA 3CWRA 3KNWA 3C2BA 2UXHA 2OERA 3BTIA 4MK6A 2WV1A 3EGQA 3GEUA 5FMPA 3EUPA 2HYTA 3TP3A 2QIBA 1JUSA 5C4YA 4M3BA 5D18A 1U9NA 2ZCMA 5CXGA 5HBUA 5F0FA 3JSJA 3O8HA 5K58A 5AQCA 2HXIA 5F08A 2XGDA 2VKEA 5K7HA 3NXCA 1ORKA 3NRGA 3VUQA 1A6IA 1VI0A 4M3FA 2DG7A 4HKUA 3QBMA 2VPRA 3BR3A 3G1OA 3S5RA 3DEWA 5EYRA 4D7NA 3F0CA 1JTXA 3SDGA 2PBXA 5EZHA 2D6YA 3T6NA 2FD5A 5J1UA 3BHQA 3ZQFA 3CCYA 2TCTA 2ZOYA 3QPLA 4V2GA 2Y2ZA 3VW2A 5EFYA 4B3AA 5GP9A 4X1EA 5IP6A 2YVHA 2JJ7A 2XB5A 5HSZA 3LOCA 2FBQA 4GFLA 5K7ZA 3MVPA 5F0CA 3B6CA 4JNNA 4GCTA 3LHQA 3HTJA 1U9OA 2IEKA 2QTQA 2DTZA 2G7GA 2XPUA 1JUMA 2O7TA 3BR6A 5F27A 4GFKA 5D1RA 3ON4A 1T33A 3FRQA 2ZOZA 3HGGA 4M3GA 5HAWA 5FGLA 2OF7A 3IUVA 4CGRA 2FJ1A 4JKZA 4UDSA 3E7QA 1JT0A 2GBYA 4KWAA 1JT6A 5FKOA 3HTHA 5F0HA 5CW8A 3FK6A 4GCLA 3G56A 4L62A 1ZK8A 3HGYA 4I6ZA 5GPCA 2IU5A 5F04A 3IH2A 3LJLA 5IPAA 2DG8A 2Y31A 2X6OA 4XK4A 2UXOA 2Q24A 2XPVA 2ID3A 2G3BA 2XGCA 3ZQIA 2OPTA 3VPRA 2REKA 3HE0A 4I76A 3RD3A 4D5FA 3BCGA 3HTIA 5F1JA 2HKUA 2TRTA 2UXIA 3BTLA 3NPIA 4M3DA 4MXMA 3B81A 2GUHA 2GFNA 2W53A 4ICHA 5DAJA 5FKKA 2NS8A 4D5CA 2XDNA 3ANPA 3VIBA 3RH2A 3VW0A 2PZ9A 3Q0VA 3MNLA 5EZGA 3WHBA 2IBDA 5FKMA 1JUPA 3B6AA 3IH4A 4AC6A 2ID6A 3G7RA 3LWJA 4AF5A 3KKDA 3VW1A 5CXIA 5IOYA 3BQZA 4D7MA 2RAEA 3QQAA 2G7SA 4W1UA 2F07A 3LSRA 2ZCXA 4DW6A 1BJZA 1RKTA 2O7OA 3F1BA 2UXUA 3PASA 1RKWA 2Y30A 3BR1A 1UI6A 3ZQGA 2IAIA 2EH3A 4JL3A 3ANGA 3DPJA 2WGBA 3BTCA 4JYKA 3AQTA 3KKCA 4PXIA 4AUXA 3LSJA 2FQ4A 3HIMA 3KZ9A 3ON2A 3SFIA 5FKNA 3TP0A 3BR2A 2GENA 3G1MA 2ZCNA 3QKXA 2XRLA 2V57A 3BR5A 3CJDA 3LSPA 5J3LA 5J1YA 1JTYA 3VOXA 3G1LA 2UXPA 3BTJA 3PM1A 4ACIA 3NNRA 3Q3SA 4GCKA 3WHCA 1QVUA 3FK7A 5J1RA 2QCOA 2OI8A 2XPWA 1Z77A 2QKOA 3BQYA 2WUIA 2JK3A 1T56A 3Q0WA 4NELA 3QPSA 3CRJA
chains in the Genus database with same CATH superfamily
1ZKGA 4ABZA 3Q0UA 2NP3A 4W97A 3FIWA 2I10A 2NP5A 3VVXA 4YZEA 2B1EA 3GZIA 3VVZA 3CDLA 4M3EA 5D19A 3HTAA 3VVYA 2HYJA 5IOZA 3V78A 2FX0A 5FKLA 3ZQHA 3C07A 1Z0XA 4U9LA 3AQSA 2QOPA 2R7OA 5H9TA 1SGMA 3VTIA 3VP5A 2QWTA 3COLA 2HXOA 3VOKA 2VKVA 3ZQLA 3NI7A 5FHPA 2ZB9A 2RASA 3BNIA 1QVTA 2NX4A 2XGEA 3BRUA 2R7QA 4B1RA 3BT9A 4NN1A 1QPIA 5GPAA 1RPWA 4G12A 3O60A 1UI5A 2YVEA 2G0EA 2YVXA 3V6GA 3BR0A 3IH3A 5K7FA 4MO7A 2HQ5A 2NS7A 2RHAA 3O8GA 2G7LA 3BJBA 2X9DA 3PPBA 3P9TA 3DCFA 4AC0A 4ME9A 4C2MA 4V2FA 3CWRA 3KNWA 3C2BA 2UXHA 2OERA 3BTIA 4MK6A 2WV1A 3EGQA 3GEUA 5FMPA 3EUPA 2HYTA 3TP3A 2QIBA 1JUSA 5C4YA 4M3BA 5D18A 1U9NA 2ZCMA 5CXGA 5HBUA 5F0FA 3JSJA 3O8HA 5K58A 5AQCA 2HXIA 5F08A 2XGDA 4DVYP 2VKEA 5K7HA 3NXCA 1ORKA 3NRGA 3VUQA 1A6IA 1VI0A 3NS4A 4M3FA 2DG7A 4HKUA 3QBMA 2VPRA 3BR3A 3G1OA 3S5RA 3DEWA 5EYRA 4D7NA 3F0CA 1JTXA 3SDGA 2PBXA 5EZHA 2D6YA 3T6NA 2FD5A 5J1UA 3BHQA 3ZQFA 3CCYA 2TCTA 2ZOYA 3QPLA 4V2GA 2Y2ZA 3VW2A 5EFYA 4B3AA 5GP9A 4X1EA 5IP6A 2YVHA 2JJ7A 2XB5A 2R7XA 5HSZA 3LOCA 2FBQA 4GFLA 5K7ZA 3MVPA 5F0CA 3B6CA 4JNNA 4GCTA 3LHQA 3HTJA 1U9OA 2IEKA 2QTQA 2DTZA 2G7GA 2XPUA 1JUMA 2FJI1 2O7TA 3BR6A 5F27A 4GFKA 5D1RA 3ON4A 1T33A 3K8PC 2ZY9A 3FRQA 2ZOZA 3HGGA 2R7TA 4M3GA 5HAWA 5FGLA 2OF7A 3IUVA 4CGRA 2FJ1A 4JKZA 4UDSA 3E7QA 1JT0A 2R7UA 2GBYA 3KYLA 4KWAA 1JT6A 5FKOA 3HTHA 5F0HA 5CW8A 3FK6A 4GCLA 3FHNA 3G56A 4L62A 1ZK8A 3HGYA 4I6ZA 5GPCA 2IU5A 5F04A 3IH2A 3LJLA 5IPAA 3DU5A 2DG8A 2Y31A 2X6OA 4XK4A 2UXOA 2Q24A 2XPVA 2ID3A 2G3BA 2XGCA 3ZQIA 2B3WA 2OPTA 3VPRA 2REKA 3HE0A 4I76A 3RD3A 4D5FA 3BCGA 3HTIA 5F1JA 2HKUA 2TRTA 2UXIA 2R7SA 3BTLA 3NPIA 4M3DA 4MXMA 3B81A 2GUHA 2GFNA 2W53A 4ICHA 5DAJA 5FKKA 2NS8A 2R7VA 4D5CA 2XDNA 3ANPA 3VIBA 3RH2A 3DU6A 3VW0A 2PZ9A 3Q0VA 3MNLA 5EZGA 4OD5A 2IBDA 3WHBA 5FKMA 1JUPA 3B6AA 3IH4A 3SWHA 4AC6A 2ID6A 3G7RA 3LWJA 4IRVA 4AF5A 4OD4A 3KKDA 3VW1A 5CXIA 5IOYA 3BQZA 4D7MA 2RAEA 3QQAA 2PFVA 2G7SA 4W1UA 2F07A 3LSRA 2ZCXA 4DW6A 4U9NA 1BJZA 1RKTA 2O7OA 3F1BA 2UXUA 4WIBA 2R7RA 3PASA 1RKWA 2Y30A 3BR1A 1UI6A 3ZQGA 2IAIA 2EH3A 4JL3A 3ANGA 3DPJA 2WGBA 3BTCA 4JYKA 3AQTA 3KKCA 4PXIA 4AUXA 3LSJA 2FQ4A 3HIMA 3KZ9A 3ON2A 3SFIA 5FKNA 3TP0A 3BR2A 2A2FX 2GENA 3G1MA 2ZCNA 3QKXA 2XRLA 2V57A 3BR5A 3CJDA 3LSPA 5J3LA 5J1YA 1JTYA 3VOXA 2R7WA 3G1LA 2UXPA 3BTJA 3PM1A 4ACIA 3NNRA 3Q3SA 4GCKA 3WHCA 1QVUA 3FK7A 5J1RA 2QCOA 2OI8A 5CQGA 2XPWA 1Z77A 2QKOA 3BQYA 2WUIA 2JK3A 1T56A 3Q0WA 4NELA 3QPSA 3CRJA
chains in the Genus database with same CATH topology
1ZKGA 4ABZA 3Q0UA 2NP3A 4W97A 3FIWA 2I10A 2NP5A 3VVXA 4YZEA 3VVZA 3GZIA 3CDLA 4M3EA 5D19A 3HTAA 3VVYA 2HYJA 5IOZA 3V78A 2FX0A 5FKLA 3ZQHA 3C07A 1Z0XA 3AQSA 2QOPA 5H9TA 1SGMA 3VP5A 2QWTA 3COLA 2HXOA 3VOKA 2VKVA 3ZQLA 3NI7A 5FHPA 2ZB9A 2RASA 3BNIA 1QVTA 2NX4A 2XGEA 3BRUA 4B1RA 3BT9A 4NN1A 1QPIA 5GPAA 1RPWA 4G12A 3O60A 1UI5A 2YVEA 2G0EA 3V6GA 3BR0A 3IH3A 5K7FA 4MO7A 2HQ5A 2NS7A 2RHAA 3O8GA 2G7LA 3BJBA 2X9DA 3PPBA 3P9TA 3DCFA 4AC0A 4ME9A 4V2FA 3CWRA 3KNWA 3C2BA 2UXHA 2OERA 3BTIA 4MK6A 2WV1A 3EGQA 3GEUA 5FMPA 3EUPA 2HYTA 3TP3A 2QIBA 1JUSA 5C4YA 4M3BA 5D18A 1U9NA 2ZCMA 5CXGA 5HBUA 5F0FA 3JSJA 3O8HA 5K58A 5AQCA 2HXIA 5F08A 2XGDA 2VKEA 5K7HA 3NXCA 1ORKA 3NRGA 3VUQA 1A6IA 1VI0A 4M3FA 2DG7A 4HKUA 3QBMA 2VPRA 3BR3A 3G1OA 3S5RA 3DEWA 5EYRA 4D7NA 3F0CA 1JTXA 3SDGA 2PBXA 5EZHA 2D6YA 3T6NA 2FD5A 5J1UA 3BHQA 3ZQFA 3CCYA 2TCTA 2ZOYA 3QPLA 4V2GA 2Y2ZA 3VW2A 5EFYA 4B3AA 5GP9A 4X1EA 5IP6A 2YVHA 2JJ7A 2XB5A 5HSZA 3LOCA 2FBQA 4GFLA 5K7ZA 3MVPA 5F0CA 3B6CA 4JNNA 4GCTA 3LHQA 3HTJA 1U9OA 2IEKA 2QTQA 2DTZA 2G7GA 2XPUA 1JUMA 2O7TA 3BR6A 5F27A 4GFKA 5D1RA 3ON4A 1T33A 3FRQA 2ZOZA 3HGGA 4M3GA 5HAWA 5FGLA 2OF7A 3IUVA 4CGRA 2FJ1A 4JKZA 4UDSA 3E7QA 1JT0A 2GBYA 4KWAA 1JT6A 5FKOA 3HTHA 5F0HA 5CW8A 3FK6A 4GCLA 3G56A 4L62A 1ZK8A 3HGYA 4I6ZA 5GPCA 2IU5A 5F04A 3IH2A 3LJLA 5IPAA 2DG8A 2Y31A 2X6OA 4XK4A 2UXOA 2Q24A 2XPVA 2ID3A 2G3BA 2XGCA 3ZQIA 2OPTA 3VPRA 2REKA 3HE0A 4I76A 3RD3A 4D5FA 3BCGA 3HTIA 5F1JA 2HKUA 2TRTA 2UXIA 3BTLA 3NPIA 4M3DA 4MXMA 3B81A 2GUHA 2GFNA 2W53A 4ICHA 5DAJA 5FKKA 2NS8A 4D5CA 2XDNA 3ANPA 3VIBA 3RH2A 3VW0A 2PZ9A 3Q0VA 3MNLA 5EZGA 3WHBA 2IBDA 5FKMA 1JUPA 3B6AA 3IH4A 4AC6A 2ID6A 3G7RA 3LWJA 4AF5A 3KKDA 3VW1A 5CXIA 5IOYA 3BQZA 4D7MA 2RAEA 3QQAA 2G7SA 4W1UA 2F07A 3LSRA 2ZCXA 4DW6A 1BJZA 1RKTA 2O7OA 3F1BA 2UXUA 3PASA 1RKWA 2Y30A 3BR1A 1UI6A 3ZQGA 2IAIA 2EH3A 4JL3A 3ANGA 3DPJA 2WGBA 3BTCA 4JYKA 3AQTA 3KKCA 4PXIA 4AUXA 3LSJA 2FQ4A 3HIMA 3KZ9A 3ON2A 3SFIA 5FKNA 3TP0A 3BR2A 2GENA 3G1MA 2ZCNA 3QKXA 2XRLA 2V57A 3BR5A 3CJDA 3LSPA 5J3LA 5J1YA 1JTYA 3VOXA 3G1LA 2UXPA 3BTJA 3PM1A 4ACIA 3NNRA 3Q3SA 4GCKA 3WHCA 1QVUA 3FK7A 5J1RA 2QCOA 2OI8A 2XPWA 1Z77A 2QKOA 3BQYA 2WUIA 2JK3A 1T56A 3Q0WA 4NELA 3QPSA 3CRJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZKG A;  4ABZ A;  3Q0U A;  2NP3 A;  4W97 A;  3FIW A;  2I10 A;  2NP5 A;  3VVX A;  4YZE A;  3VVZ A;  3GZI A;  3CDL A;  4M3E A;  5D19 A;  3HTA A;  3VVY A;  2HYJ A;  5IOZ A;  3V78 A;  2FX0 A;  5FKL A;  3ZQH A;  3C07 A;  1Z0X A;  3AQS A;  2QOP A;  5H9T A;  1SGM A;  3VP5 A;  2QWT A;  3COL A;  2HXO A;  3VOK A;  2VKV A;  3ZQL A;  3NI7 A;  5FHP A;  2ZB9 A;  2RAS A;  3BNI A;  1QVT A;  2NX4 A;  2XGE A;  3BRU A;  4B1R A;  3BT9 A;  4NN1 A;  1QPI A;  5GPA A;  1RPW A;  4G12 A;  3O60 A;  1UI5 A;  2YVE A;  2G0E A;  3V6G A;  3BR0 A;  3IH3 A;  5K7F A;  4MO7 A;  2HQ5 A;  2NS7 A;  2RHA A;  3O8G A;  2G7L A;  3BJB A;  2X9D A;  3PPB A;  3P9T A;  3DCF A;  4AC0 A;  4ME9 A;  4V2F A;  3CWR A;  3KNW A;  3C2B A;  2UXH A;  2OER A;  3BTI A;  4MK6 A;  2WV1 A;  3EGQ A;  3GEU A;  5FMP A;  3EUP A;  2HYT A;  3TP3 A;  2QIB A;  1JUS A;  5C4Y A;  4M3B A;  5D18 A;  1U9N A;  2ZCM A;  5CXG A;  5HBU A;  5F0F A;  3JSJ A;  3O8H A;  5K58 A;  5AQC A;  2HXI A;  5F08 A;  2XGD A;  2VKE A;  5K7H A;  3NXC A;  1ORK A;  3NRG A;  3VUQ A;  1A6I A;  1VI0 A;  4M3F A;  2DG7 A;  4HKU A;  3QBM A;  2VPR A;  3BR3 A;  3G1O A;  3S5R A;  3DEW A;  5EYR A;  4D7N A;  3F0C A;  1JTX A;  3SDG A;  2PBX A;  5EZH A;  2D6Y A;  3T6N A;  2FD5 A;  5J1U A;  3BHQ A;  3ZQF A;  3CCY A;  2TCT A;  2ZOY A;  3QPL A;  4V2G A;  2Y2Z A;  3VW2 A;  5EFY A;  4B3A A;  5GP9 A;  4X1E A;  5IP6 A;  2YVH A;  2JJ7 A;  2XB5 A;  5HSZ A;  3LOC A;  2FBQ A;  4GFL A;  5K7Z A;  3MVP A;  5F0C A;  3B6C A;  4JNN A;  4GCT A;  3LHQ A;  3HTJ A;  1U9O A;  2IEK A;  2QTQ A;  2DTZ A;  2G7G A;  2XPU A;  1JUM A;  2O7T A;  3BR6 A;  5F27 A;  4GFK A;  5D1R A;  3ON4 A;  1T33 A;  3FRQ A;  2ZOZ A;  3HGG A;  4M3G A;  5HAW A;  5FGL A;  2OF7 A;  3IUV A;  4CGR A;  2FJ1 A;  4JKZ A;  4UDS A;  3E7Q A;  1JT0 A;  2GBY A;  4KWA A;  1JT6 A;  5FKO A;  3HTH A;  5F0H A;  5CW8 A;  3FK6 A;  4GCL A;  3G56 A;  4L62 A;  1ZK8 A;  3HGY A;  4I6Z A;  5GPC A;  2IU5 A;  5F04 A;  3IH2 A;  3LJL A;  5IPA A;  2DG8 A;  2Y31 A;  2X6O A;  4XK4 A;  2UXO A;  2Q24 A;  2XPV A;  2ID3 A;  2G3B A;  2XGC A;  3ZQI A;  2OPT A;  3VPR A;  2REK A;  3HE0 A;  4I76 A;  3RD3 A;  4D5F A;  3BCG A;  3HTI A;  5F1J A;  2HKU A;  2TRT A;  2UXI A;  3BTL A;  3NPI A;  4M3D A;  4MXM A;  3B81 A;  2GUH A;  2GFN A;  2W53 A;  4ICH A;  5DAJ A;  5FKK A;  2NS8 A;  4D5C A;  2XDN A;  3ANP A;  3VIB A;  3RH2 A;  3VW0 A;  2PZ9 A;  3Q0V A;  3MNL A;  5EZG A;  3WHB A;  2IBD A;  5FKM A;  1JUP A;  3B6A A;  3IH4 A;  4AC6 A;  2ID6 A;  3G7R A;  3LWJ A;  4AF5 A;  3KKD A;  3VW1 A;  5CXI A;  5IOY A;  3BQZ A;  4D7M A;  2RAE A;  3QQA A;  2G7S A;  4W1U A;  2F07 A;  3LSR A;  2ZCX A;  4DW6 A;  1BJZ A;  1RKT A;  2O7O A;  3F1B A;  2UXU A;  3PAS A;  1RKW A;  2Y30 A;  3BR1 A;  1UI6 A;  3ZQG A;  2IAI A;  2EH3 A;  4JL3 A;  3ANG A;  3DPJ A;  2WGB A;  3BTC A;  4JYK A;  3AQT A;  3KKC A;  4PXI A;  4AUX A;  3LSJ A;  2FQ4 A;  3HIM A;  3KZ9 A;  3ON2 A;  3SFI A;  5FKN A;  3TP0 A;  3BR2 A;  2GEN A;  3G1M A;  2ZCN A;  3QKX A;  2XRL A;  2V57 A;  3BR5 A;  3CJD A;  3LSP A;  5J3L A;  5J1Y A;  1JTY A;  3VOX A;  3G1L A;  2UXP A;  3BTJ A;  3PM1 A;  4ACI A;  3NNR A;  3Q3S A;  4GCK A;  3WHC A;  1QVU A;  3FK7 A;  5J1R A;  2QCO A;  2OI8 A;  2XPW A;  1Z77 A;  2QKO A;  3BQY A;  2WUI A;  2JK3 A;  1T56 A;  3Q0W A;  4NEL A;  3QPS A;  3CRJ A; 
#chains in the Genus database with same CATH topology
 1ZKG A;  4ABZ A;  3Q0U A;  2NP3 A;  4W97 A;  3FIW A;  2I10 A;  2NP5 A;  3VVX A;  4YZE A;  2B1E A;  3GZI A;  3VVZ A;  3CDL A;  4M3E A;  5D19 A;  3HTA A;  3VVY A;  2HYJ A;  5IOZ A;  3V78 A;  2FX0 A;  5FKL A;  3ZQH A;  3C07 A;  1Z0X A;  4U9L A;  3AQS A;  2QOP A;  2R7O A;  5H9T A;  1SGM A;  3VTI A;  3VP5 A;  2QWT A;  3COL A;  2HXO A;  3VOK A;  2VKV A;  3ZQL A;  3NI7 A;  5FHP A;  2ZB9 A;  2RAS A;  3BNI A;  1QVT A;  2NX4 A;  2XGE A;  3BRU A;  2R7Q A;  4B1R A;  3BT9 A;  4NN1 A;  1QPI A;  5GPA A;  1RPW A;  4G12 A;  3O60 A;  1UI5 A;  2YVE A;  2G0E A;  2YVX A;  3V6G A;  3BR0 A;  3IH3 A;  5K7F A;  4MO7 A;  2HQ5 A;  2NS7 A;  2RHA A;  3O8G A;  2G7L A;  3BJB A;  2X9D A;  3PPB A;  3P9T A;  3DCF A;  4AC0 A;  4ME9 A;  4C2M A;  4V2F A;  3CWR A;  3KNW A;  3C2B A;  2UXH A;  2OER A;  3BTI A;  4MK6 A;  2WV1 A;  3EGQ A;  3GEU A;  5FMP A;  3EUP A;  2HYT A;  3TP3 A;  2QIB A;  1JUS A;  5C4Y A;  4M3B A;  5D18 A;  1U9N A;  2ZCM A;  5CXG A;  5HBU A;  5F0F A;  3JSJ A;  3O8H A;  5K58 A;  5AQC A;  2HXI A;  5F08 A;  2XGD A;  4DVY P;  2VKE A;  5K7H A;  3NXC A;  1ORK A;  3NRG A;  3VUQ A;  1A6I A;  1VI0 A;  3NS4 A;  4M3F A;  2DG7 A;  4HKU A;  3QBM A;  2VPR A;  3BR3 A;  3G1O A;  3S5R A;  3DEW A;  5EYR A;  4D7N A;  3F0C A;  1JTX A;  3SDG A;  2PBX A;  5EZH A;  2D6Y A;  3T6N A;  2FD5 A;  5J1U A;  3BHQ A;  3ZQF A;  3CCY A;  2TCT A;  2ZOY A;  3QPL A;  4V2G A;  2Y2Z A;  3VW2 A;  5EFY A;  4B3A A;  5GP9 A;  4X1E A;  5IP6 A;  2YVH A;  2JJ7 A;  2XB5 A;  2R7X A;  5HSZ A;  3LOC A;  2FBQ A;  4GFL A;  5K7Z A;  3MVP A;  5F0C A;  3B6C A;  4JNN A;  4GCT A;  3LHQ A;  3HTJ A;  1U9O A;  2IEK A;  2QTQ A;  2DTZ A;  2G7G A;  2XPU A;  1JUM A;  2FJI 1;  2O7T A;  3BR6 A;  5F27 A;  4GFK A;  5D1R A;  3ON4 A;  1T33 A;  3K8P C;  2ZY9 A;  3FRQ A;  2ZOZ A;  3HGG A;  2R7T A;  4M3G A;  5HAW A;  5FGL A;  2OF7 A;  3IUV A;  4CGR A;  2FJ1 A;  4JKZ A;  4UDS A;  3E7Q A;  1JT0 A;  2R7U A;  2GBY A;  3KYL A;  4KWA A;  1JT6 A;  5FKO A;  3HTH A;  5F0H A;  5CW8 A;  3FK6 A;  4GCL A;  3FHN A;  3G56 A;  4L62 A;  1ZK8 A;  3HGY A;  4I6Z A;  5GPC A;  2IU5 A;  5F04 A;  3IH2 A;  3LJL A;  5IPA A;  3DU5 A;  2DG8 A;  2Y31 A;  2X6O A;  4XK4 A;  2UXO A;  2Q24 A;  2XPV A;  2ID3 A;  2G3B A;  2XGC A;  3ZQI A;  2B3W A;  2OPT A;  3VPR A;  2REK A;  3HE0 A;  4I76 A;  3RD3 A;  4D5F A;  3BCG A;  3HTI A;  5F1J A;  2HKU A;  2TRT A;  2UXI A;  2R7S A;  3BTL A;  3NPI A;  4M3D A;  4MXM A;  3B81 A;  2GUH A;  2GFN A;  2W53 A;  4ICH A;  5DAJ A;  5FKK A;  2NS8 A;  2R7V A;  4D5C A;  2XDN A;  3ANP A;  3VIB A;  3RH2 A;  3DU6 A;  3VW0 A;  2PZ9 A;  3Q0V A;  3MNL A;  5EZG A;  4OD5 A;  2IBD A;  3WHB A;  5FKM A;  1JUP A;  3B6A A;  3IH4 A;  3SWH A;  4AC6 A;  2ID6 A;  3G7R A;  3LWJ A;  4IRV A;  4AF5 A;  4OD4 A;  3KKD A;  3VW1 A;  5CXI A;  5IOY A;  3BQZ A;  4D7M A;  2RAE A;  3QQA A;  2PFV A;  2G7S A;  4W1U A;  2F07 A;  3LSR A;  2ZCX A;  4DW6 A;  4U9N A;  1BJZ A;  1RKT A;  2O7O A;  3F1B A;  2UXU A;  4WIB A;  2R7R A;  3PAS A;  1RKW A;  2Y30 A;  3BR1 A;  1UI6 A;  3ZQG A;  2IAI A;  2EH3 A;  4JL3 A;  3ANG A;  3DPJ A;  2WGB A;  3BTC A;  4JYK A;  3AQT A;  3KKC A;  4PXI A;  4AUX A;  3LSJ A;  2FQ4 A;  3HIM A;  3KZ9 A;  3ON2 A;  3SFI A;  5FKN A;  3TP0 A;  3BR2 A;  2A2F X;  2GEN A;  3G1M A;  2ZCN A;  3QKX A;  2XRL A;  2V57 A;  3BR5 A;  3CJD A;  3LSP A;  5J3L A;  5J1Y A;  1JTY A;  3VOX A;  2R7W A;  3G1L A;  2UXP A;  3BTJ A;  3PM1 A;  4ACI A;  3NNR A;  3Q3S A;  4GCK A;  3WHC A;  1QVU A;  3FK7 A;  5J1R A;  2QCO A;  2OI8 A;  5CQG A;  2XPW A;  1Z77 A;  2QKO A;  3BQY A;  2WUI A;  2JK3 A;  1T56 A;  3Q0W A;  4NEL A;  3QPS A;  3CRJ A; 
#chains in the Genus database with same CATH homology
 1ZKG A;  4ABZ A;  3Q0U A;  2NP3 A;  4W97 A;  3FIW A;  2I10 A;  2NP5 A;  3VVX A;  4YZE A;  3VVZ A;  3GZI A;  3CDL A;  4M3E A;  5D19 A;  3HTA A;  3VVY A;  2HYJ A;  5IOZ A;  3V78 A;  2FX0 A;  5FKL A;  3ZQH A;  3C07 A;  1Z0X A;  3AQS A;  2QOP A;  5H9T A;  1SGM A;  3VP5 A;  2QWT A;  3COL A;  2HXO A;  3VOK A;  2VKV A;  3ZQL A;  3NI7 A;  5FHP A;  2ZB9 A;  2RAS A;  3BNI A;  1QVT A;  2NX4 A;  2XGE A;  3BRU A;  4B1R A;  3BT9 A;  4NN1 A;  1QPI A;  5GPA A;  1RPW A;  4G12 A;  3O60 A;  1UI5 A;  2YVE A;  2G0E A;  3V6G A;  3BR0 A;  3IH3 A;  5K7F A;  4MO7 A;  2HQ5 A;  2NS7 A;  2RHA A;  3O8G A;  2G7L A;  3BJB A;  2X9D A;  3PPB A;  3P9T A;  3DCF A;  4AC0 A;  4ME9 A;  4V2F A;  3CWR A;  3KNW A;  3C2B A;  2UXH A;  2OER A;  3BTI A;  4MK6 A;  2WV1 A;  3EGQ A;  3GEU A;  5FMP A;  3EUP A;  2HYT A;  3TP3 A;  2QIB A;  1JUS A;  5C4Y A;  4M3B A;  5D18 A;  1U9N A;  2ZCM A;  5CXG A;  5HBU A;  5F0F A;  3JSJ A;  3O8H A;  5K58 A;  5AQC A;  2HXI A;  5F08 A;  2XGD A;  2VKE A;  5K7H A;  3NXC A;  1ORK A;  3NRG A;  3VUQ A;  1A6I A;  1VI0 A;  4M3F A;  2DG7 A;  4HKU A;  3QBM A;  2VPR A;  3BR3 A;  3G1O A;  3S5R A;  3DEW A;  5EYR A;  4D7N A;  3F0C A;  1JTX A;  3SDG A;  2PBX A;  5EZH A;  2D6Y A;  3T6N A;  2FD5 A;  5J1U A;  3BHQ A;  3ZQF A;  3CCY A;  2TCT A;  2ZOY A;  3QPL A;  4V2G A;  2Y2Z A;  3VW2 A;  5EFY A;  4B3A A;  5GP9 A;  4X1E A;  5IP6 A;  2YVH A;  2JJ7 A;  2XB5 A;  5HSZ A;  3LOC A;  2FBQ A;  4GFL A;  5K7Z A;  3MVP A;  5F0C A;  3B6C A;  4JNN A;  4GCT A;  3LHQ A;  3HTJ A;  1U9O A;  2IEK A;  2QTQ A;  2DTZ A;  2G7G A;  2XPU A;  1JUM A;  2O7T A;  3BR6 A;  5F27 A;  4GFK A;  5D1R A;  3ON4 A;  1T33 A;  3FRQ A;  2ZOZ A;  3HGG A;  4M3G A;  5HAW A;  5FGL A;  2OF7 A;  3IUV A;  4CGR A;  2FJ1 A;  4JKZ A;  4UDS A;  3E7Q A;  1JT0 A;  2GBY A;  4KWA A;  1JT6 A;  5FKO A;  3HTH A;  5F0H A;  5CW8 A;  3FK6 A;  4GCL A;  3G56 A;  4L62 A;  1ZK8 A;  3HGY A;  4I6Z A;  5GPC A;  2IU5 A;  5F04 A;  3IH2 A;  3LJL A;  5IPA A;  2DG8 A;  2Y31 A;  2X6O A;  4XK4 A;  2UXO A;  2Q24 A;  2XPV A;  2ID3 A;  2G3B A;  2XGC A;  3ZQI A;  2OPT A;  3VPR A;  2REK A;  3HE0 A;  4I76 A;  3RD3 A;  4D5F A;  3BCG A;  3HTI A;  5F1J A;  2HKU A;  2TRT A;  2UXI A;  3BTL A;  3NPI A;  4M3D A;  4MXM A;  3B81 A;  2GUH A;  2GFN A;  2W53 A;  4ICH A;  5DAJ A;  5FKK A;  2NS8 A;  4D5C A;  2XDN A;  3ANP A;  3VIB A;  3RH2 A;  3VW0 A;  2PZ9 A;  3Q0V A;  3MNL A;  5EZG A;  3WHB A;  2IBD A;  5FKM A;  1JUP A;  3B6A A;  3IH4 A;  4AC6 A;  2ID6 A;  3G7R A;  3LWJ A;  4AF5 A;  3KKD A;  3VW1 A;  5CXI A;  5IOY A;  3BQZ A;  4D7M A;  2RAE A;  3QQA A;  2G7S A;  4W1U A;  2F07 A;  3LSR A;  2ZCX A;  4DW6 A;  1BJZ A;  1RKT A;  2O7O A;  3F1B A;  2UXU A;  3PAS A;  1RKW A;  2Y30 A;  3BR1 A;  1UI6 A;  3ZQG A;  2IAI A;  2EH3 A;  4JL3 A;  3ANG A;  3DPJ A;  2WGB A;  3BTC A;  4JYK A;  3AQT A;  3KKC A;  4PXI A;  4AUX A;  3LSJ A;  2FQ4 A;  3HIM A;  3KZ9 A;  3ON2 A;  3SFI A;  5FKN A;  3TP0 A;  3BR2 A;  2GEN A;  3G1M A;  2ZCN A;  3QKX A;  2XRL A;  2V57 A;  3BR5 A;  3CJD A;  3LSP A;  5J3L A;  5J1Y A;  1JTY A;  3VOX A;  3G1L A;  2UXP A;  3BTJ A;  3PM1 A;  4ACI A;  3NNR A;  3Q3S A;  4GCK A;  3WHC A;  1QVU A;  3FK7 A;  5J1R A;  2QCO A;  2OI8 A;  2XPW A;  1Z77 A;  2QKO A;  3BQY A;  2WUI A;  2JK3 A;  1T56 A;  3Q0W A;  4NEL A;  3QPS A;  3CRJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...