2HYTA

Crystal structure of a tetr-family transcriptional regulator (eca1819) from pectobacterium atrosepticum at 1.64 a resolution
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
193
structure length
193
Chain Sequence
b'RTRAEMEETRATLLATARKVFSERGYADTSMDDLTAQASLTRGALYHHFGDKKGLLAAVVEQIDAEMDERLQAISDTAEDDWEGFRCRCRAYLEMALEPEIQRIVLRDARAVLGGASPDSQRHCVESMQRLIDNLIRQGVVAEADPQALASLIYGSLAEAAFWIAEGEDGNARLAQGVAALELLLRGLLVKPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TetR-family transcriptional regulator
publication title Crystal structure of TetR-family transcriptional regulator (YP_049917.1) from Erwinia Cartovora Atroseptica SCRI1043 at 1.64 A resolution
rcsb
source organism Pectobacterium atrosepticum
molecule tags Transcription
total genus 75
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 2006-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2hytA00
2Y2ZA 5F27A 3P9TA 3QBMA 3HGGA 3NPIA 2XDNA 3QQAA 2HYJA 2I10A 3HTJA 4MXMA 2XGDA 3BCGA 4D5CA 3HTIA 2IBDA 2UXIA 3VOXA 2QCOA 5F0CA 5C4YA 2D6YA 5K58A 2OI8A 3ANPA 5IOYA 1SGMA 3BHQA 3HTHA 2ZCXA 5IP6A 4B1RA 5F1JA 3VVXA 3DCFA 4MK6A 2OPTA 3IUVA 3HIMA 2G3BA 3VW2A 3V6GA 3CCYA 3BT9A 4ICHA 4AUXA 2NS8A 3FIWA 3LOCA 5J1RA 2UXHA 2FQ4A 2HXOA 2REKA 1U9NA 2W53A 4B3AA 3VPRA 5F04A 3ON2A 3O8HA 5CXGA 2XPWA 5K7ZA 3AQSA 3TP3A 5J1YA 1QPIA 1ORKA 4PXIA 4ME9A 2NP3A 2FD5A 2XB5A 2XPVA 3BTCA 3NI7A 3PM1A 3ON4A 3B6AA 2GUHA 3Q0WA 2DG7A 2O7TA 3QPLA 4I76A 4D7MA 3S5RA 5FKMA 2TRTA 2WUIA 4V2GA 4GCLA 3JSJA 2NP5A 3F0CA 4M3EA 2JJ7A 2DG8A 3ZQGA 2GBYA 4ACIA 4NELA 3BTLA 2G0EA 1ZKGA 5D19A 3IH3A 3QPSA 2ZOZA 3MVPA 4KWAA 1Z0XA 3T6NA 3LWJA 2ID3A 3BNIA 4W1UA 3BR5A 3VUQA 2VKEA 2YVEA 3LHQA 3IH2A 3LSRA 1JT0A 3VIBA 5FKNA 2QWTA 3VW1A 2G7LA 3C2BA 3NRGA 3EGQA 2XPUA 2QKOA 5IPAA 2QIBA 4MO7A 1JTYA 3NNRA 4HKUA 5HSZA 4AC6A 4M3BA 1RKTA 5EFYA 2V57A 1Z77A 2XRLA 5IOZA 1JUMA 3BRUA 2WGBA 3QKXA 2HQ5A 2F07A 2ZB9A 3BJBA 3CRJA 5CXIA 3V78A 2HKUA 2PBXA 5FHPA 2YVHA 3CDLA 3BR6A 5D18A 3BR2A 4JYKA 2GFNA 4W97A 2G7SA 2PZ9A 3B6CA 5K7HA 4V2FA 2RASA 1A6IA 5FMPA 3LJLA 3O8GA 5K7FA 4YZEA 3SFIA 2Y30A 3LSPA 3BR3A 4GFKA 2NX4A 3G1MA 3ZQFA 3G56A 5FKLA 3DPJA 3B81A 5F0HA 3SDGA 5FGLA 3MNLA 4I6ZA 5AQCA 4GFLA 3F1BA 4AC0A 2O7OA 3CJDA 2FBQA 4AF5A 1RPWA 3KKCA 1ZK8A 2QTQA 2UXUA 1JUPA 3C07A 2IU5A 4D7NA 1JUSA 3BR1A 5HBUA 3FK6A 1U9OA 3RH2A 4M3GA 2HXIA 4M3FA 5H9TA 1VI0A 3LSJA 1QVTA 4DW6A 3O60A 5F08A 4L62A 1UI5A 5FKKA 4JL3A 3E7QA 3ANGA 1JT6A 3BQZA 3KZ9A 2JK3A 3FK7A 3VW0A 2ZOYA 3Q3SA 4D5FA 4JKZA 3VVZA 5EZGA 4JNNA 3AQTA 3GZIA 1RKWA 2VPRA 2WV1A 3CWRA 5GP9A 2GENA 2UXOA 2UXPA 2QOPA 2OERA 5J3LA 3Q0UA 4ABZA 5GPCA 2ID6A 2G7GA 2NS7A 2X9DA 2IAIA 3NXCA 2IEKA 2ZCMA 3HE0A 3ZQHA 3G7RA 2XGCA 4NN1A 4CGRA 5EYRA 3HGYA 1BJZA 1UI6A 3PASA 5J1UA 1QVUA 2FJ1A 2DTZA 3RD3A 2XGEA 1JTXA 2TCTA 5F0FA 2OF7A 5FKOA 3VOKA 3PPBA 3KNWA 3G1LA 3EUPA 3DEWA 5HAWA 3TP0A 3BTJA 4GCTA 2Q24A 5D1RA 3WHCA 3Q0VA 4G12A 3KKDA 3WHBA 3VP5A 3VVYA 2HYTA 3G1OA 5GPAA 2Y31A 3BR0A 4M3DA 3ZQLA 1T56A 2X6OA 1T33A 4UDSA 3COLA 4X1EA 5EZHA 4XK4A 3BTIA 3ZQIA 5CW8A 2ZCNA 2RAEA 3FRQA 2RHAA 3GEUA 2FX0A 3BQYA 5DAJA 3HTAA 2VKVA 3IH4A 2EH3A 4GCKA
chains in the Genus database with same CATH superfamily
2Y2ZA 5F27A 3P9TA 3QBMA 3HGGA 3NPIA 2XDNA 3QQAA 2HYJA 2I10A 3HTJA 2R7QA 4MXMA 2XGDA 3BCGA 4D5CA 3HTIA 2IBDA 2UXIA 3VOXA 2QCOA 5F0CA 5C4YA 2D6YA 5K58A 2OI8A 3ANPA 5IOYA 1SGMA 3BHQA 3HTHA 2ZCXA 5IP6A 4B1RA 5F1JA 3VVXA 3DCFA 4MK6A 2OPTA 4C2MA 3IUVA 3HIMA 2R7RA 2G3BA 3VW2A 3V6GA 3CCYA 3BT9A 4ICHA 4AUXA 2NS8A 3FIWA 3LOCA 5J1RA 2UXHA 2FQ4A 2HXOA 2REKA 1U9NA 2W53A 4B3AA 3VPRA 5F04A 3ON2A 3O8HA 5CXGA 2XPWA 5K7ZA 3AQSA 3TP3A 5J1YA 1QPIA 1ORKA 3FHNA 4PXIA 4ME9A 2NP3A 2FD5A 2XB5A 2XPVA 3BTCA 3NI7A 3PM1A 3ON4A 3B6AA 2GUHA 3Q0WA 2DG7A 2ZY9A 5CQGA 2O7TA 3QPLA 4I76A 4D7MA 3S5RA 5FKMA 3VTIA 2TRTA 2WUIA 4IRVA 4V2GA 4GCLA 3JSJA 2NP5A 3F0CA 4M3EA 2JJ7A 2DG8A 3ZQGA 2GBYA 4ACIA 4NELA 3BTLA 2G0EA 1ZKGA 2PFVA 5D19A 3IH3A 3QPSA 2ZOZA 3MVPA 4KWAA 1Z0XA 3T6NA 3LWJA 2ID3A 3BNIA 4W1UA 3BR5A 3VUQA 2VKEA 2YVEA 3LHQA 3IH2A 3LSRA 1JT0A 3VIBA 5FKNA 2QWTA 3VW1A 2FJI1 2G7LA 3C2BA 3NRGA 3EGQA 2XPUA 2R7TA 2QKOA 5IPAA 2QIBA 4MO7A 1JTYA 3NNRA 4HKUA 5HSZA 4AC6A 4M3BA 1RKTA 5EFYA 2V57A 1Z77A 2XRLA 5IOZA 1JUMA 3BRUA 2WGBA 3QKXA 2HQ5A 2F07A 2ZB9A 3BJBA 3CRJA 2R7XA 5CXIA 2HKUA 2PBXA 3V78A 5FHPA 2YVHA 3CDLA 2A2FX 3BR6A 5D18A 3BR2A 4JYKA 2GFNA 4W97A 2G7SA 2PZ9A 3B6CA 5K7HA 4V2FA 2RASA 1A6IA 2YVXA 5FMPA 3LJLA 3O8GA 5K7FA 2B3WA 4YZEA 3SFIA 2Y30A 3LSPA 3BR3A 4GFKA 2NX4A 3G1MA 2R7SA 3ZQFA 3G56A 5FKLA 3DPJA 3B81A 5F0HA 3SDGA 5FGLA 3MNLA 4I6ZA 5AQCA 4GFLA 4U9LA 3F1BA 4AC0A 2O7OA 3CJDA 2FBQA 4AF5A 1RPWA 3KKCA 1ZK8A 2QTQA 2UXUA 1JUPA 3C07A 2IU5A 4D7NA 1JUSA 3BR1A 5HBUA 3FK6A 1U9OA 3RH2A 4M3GA 2HXIA 4M3FA 5H9TA 1VI0A 3LSJA 1QVTA 3DU6A 4DW6A 3O60A 5F08A 4L62A 1UI5A 5FKKA 4JL3A 3E7QA 3ANGA 1JT6A 3BQZA 3KZ9A 2JK3A 3FK7A 3VW0A 2ZOYA 3Q3SA 4D5FA 4JKZA 3VVZA 5EZGA 4JNNA 3AQTA 3GZIA 1RKWA 3SWHA 2R7VA 2VPRA 2WV1A 3CWRA 5GP9A 2GENA 3K8PC 4U9NA 2UXOA 2UXPA 2QOPA 2OERA 5J3LA 3Q0UA 4ABZA 5GPCA 2ID6A 4OD5A 2G7GA 4WIBA 2NS7A 2X9DA 2IAIA 3NXCA 2IEKA 2ZCMA 3HE0A 3ZQHA 3G7RA 2XGCA 4NN1A 4CGRA 5EYRA 3KYLA 3HGYA 1BJZA 1UI6A 3PASA 5J1UA 1QVUA 2FJ1A 2R7WA 2DTZA 3RD3A 2R7OA 2XGEA 1JTXA 2TCTA 5F0FA 2OF7A 2R7UA 5FKOA 3VOKA 3PPBA 3KNWA 3G1LA 3EUPA 3DEWA 5HAWA 3TP0A 3BTJA 4GCTA 2Q24A 3NS4A 5D1RA 3WHCA 3Q0VA 4G12A 4DVYP 3KKDA 3WHBA 3VP5A 3VVYA 2HYTA 3DU5A 3G1OA 5GPAA 2Y31A 3BR0A 4M3DA 3ZQLA 1T56A 2X6OA 1T33A 4UDSA 3COLA 4X1EA 5EZHA 4XK4A 3BTIA 3ZQIA 5CW8A 2ZCNA 2RAEA 3FRQA 2RHAA 3GEUA 2B1EA 2FX0A 3BQYA 5DAJA 3HTAA 2VKVA 3IH4A 2EH3A 4OD4A 4GCKA
chains in the Genus database with same CATH topology
2Y2ZA 5F27A 3P9TA 3QBMA 3HGGA 3NPIA 2XDNA 3QQAA 2HYJA 2I10A 3HTJA 4MXMA 2XGDA 3BCGA 4D5CA 3HTIA 2IBDA 2UXIA 3VOXA 2QCOA 5F0CA 5C4YA 2D6YA 5K58A 2OI8A 3ANPA 5IOYA 1SGMA 3BHQA 3HTHA 2ZCXA 5IP6A 4B1RA 5F1JA 3VVXA 3DCFA 4MK6A 2OPTA 3IUVA 3HIMA 2G3BA 3VW2A 3V6GA 3CCYA 3BT9A 4ICHA 4AUXA 2NS8A 3FIWA 3LOCA 5J1RA 2UXHA 2FQ4A 2HXOA 2REKA 1U9NA 2W53A 4B3AA 3VPRA 5F04A 3ON2A 3O8HA 5CXGA 2XPWA 5K7ZA 3AQSA 3TP3A 5J1YA 1QPIA 1ORKA 4PXIA 4ME9A 2NP3A 2FD5A 2XB5A 2XPVA 3BTCA 3NI7A 3PM1A 3ON4A 3B6AA 2GUHA 3Q0WA 2DG7A 2O7TA 3QPLA 4I76A 4D7MA 3S5RA 5FKMA 2TRTA 2WUIA 4V2GA 4GCLA 3JSJA 2NP5A 3F0CA 4M3EA 2JJ7A 2DG8A 3ZQGA 2GBYA 4ACIA 4NELA 3BTLA 2G0EA 1ZKGA 5D19A 3IH3A 3QPSA 2ZOZA 3MVPA 4KWAA 1Z0XA 3T6NA 3LWJA 2ID3A 3BNIA 4W1UA 3BR5A 3VUQA 2VKEA 2YVEA 3LHQA 3IH2A 3LSRA 1JT0A 3VIBA 5FKNA 2QWTA 3VW1A 2G7LA 3C2BA 3NRGA 3EGQA 2XPUA 2QKOA 5IPAA 2QIBA 4MO7A 1JTYA 3NNRA 4HKUA 5HSZA 4AC6A 4M3BA 1RKTA 5EFYA 2V57A 1Z77A 2XRLA 5IOZA 1JUMA 3BRUA 2WGBA 3QKXA 2HQ5A 2F07A 2ZB9A 3BJBA 3CRJA 5CXIA 3V78A 2HKUA 2PBXA 5FHPA 2YVHA 3CDLA 3BR6A 5D18A 3BR2A 4JYKA 2GFNA 4W97A 2G7SA 2PZ9A 3B6CA 5K7HA 4V2FA 2RASA 1A6IA 5FMPA 3LJLA 3O8GA 5K7FA 4YZEA 3SFIA 2Y30A 3LSPA 3BR3A 4GFKA 2NX4A 3G1MA 3ZQFA 3G56A 5FKLA 3DPJA 3B81A 5F0HA 3SDGA 5FGLA 3MNLA 4I6ZA 5AQCA 4GFLA 3F1BA 4AC0A 2O7OA 3CJDA 2FBQA 4AF5A 1RPWA 3KKCA 1ZK8A 2QTQA 2UXUA 1JUPA 3C07A 2IU5A 4D7NA 1JUSA 3BR1A 5HBUA 3FK6A 1U9OA 3RH2A 4M3GA 2HXIA 4M3FA 5H9TA 1VI0A 3LSJA 1QVTA 4DW6A 3O60A 5F08A 4L62A 1UI5A 5FKKA 4JL3A 3E7QA 3ANGA 1JT6A 3BQZA 3KZ9A 2JK3A 3FK7A 3VW0A 2ZOYA 3Q3SA 4D5FA 4JKZA 3VVZA 5EZGA 4JNNA 3AQTA 3GZIA 1RKWA 2VPRA 2WV1A 3CWRA 5GP9A 2GENA 2UXOA 2UXPA 2QOPA 2OERA 5J3LA 3Q0UA 4ABZA 5GPCA 2ID6A 2G7GA 2NS7A 2X9DA 2IAIA 3NXCA 2IEKA 2ZCMA 3HE0A 3ZQHA 3G7RA 2XGCA 4NN1A 4CGRA 5EYRA 3HGYA 1BJZA 1UI6A 3PASA 5J1UA 1QVUA 2FJ1A 2DTZA 3RD3A 2XGEA 1JTXA 2TCTA 5F0FA 2OF7A 5FKOA 3VOKA 3PPBA 3KNWA 3G1LA 3EUPA 3DEWA 5HAWA 3TP0A 3BTJA 4GCTA 2Q24A 5D1RA 3WHCA 3Q0VA 4G12A 3KKDA 3WHBA 3VP5A 3VVYA 2HYTA 3G1OA 5GPAA 2Y31A 3BR0A 4M3DA 3ZQLA 1T56A 2X6OA 1T33A 4UDSA 3COLA 4X1EA 5EZHA 4XK4A 3BTIA 3ZQIA 5CW8A 2ZCNA 2RAEA 3FRQA 2RHAA 3GEUA 2FX0A 3BQYA 5DAJA 3HTAA 2VKVA 3IH4A 2EH3A 4GCKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y2Z A;  5F27 A;  3P9T A;  3QBM A;  3HGG A;  3NPI A;  2XDN A;  3QQA A;  2HYJ A;  2I10 A;  3HTJ A;  4MXM A;  2XGD A;  3BCG A;  4D5C A;  3HTI A;  2IBD A;  2UXI A;  3VOX A;  2QCO A;  5F0C A;  5C4Y A;  2D6Y A;  5K58 A;  2OI8 A;  3ANP A;  5IOY A;  1SGM A;  3BHQ A;  3HTH A;  2ZCX A;  5IP6 A;  4B1R A;  5F1J A;  3VVX A;  3DCF A;  4MK6 A;  2OPT A;  3IUV A;  3HIM A;  2G3B A;  3VW2 A;  3V6G A;  3CCY A;  3BT9 A;  4ICH A;  4AUX A;  2NS8 A;  3FIW A;  3LOC A;  5J1R A;  2UXH A;  2FQ4 A;  2HXO A;  2REK A;  1U9N A;  2W53 A;  4B3A A;  3VPR A;  5F04 A;  3ON2 A;  3O8H A;  5CXG A;  2XPW A;  5K7Z A;  3AQS A;  3TP3 A;  5J1Y A;  1QPI A;  1ORK A;  4PXI A;  4ME9 A;  2NP3 A;  2FD5 A;  2XB5 A;  2XPV A;  3BTC A;  3NI7 A;  3PM1 A;  3ON4 A;  3B6A A;  2GUH A;  3Q0W A;  2DG7 A;  2O7T A;  3QPL A;  4I76 A;  4D7M A;  3S5R A;  5FKM A;  2TRT A;  2WUI A;  4V2G A;  4GCL A;  3JSJ A;  2NP5 A;  3F0C A;  4M3E A;  2JJ7 A;  2DG8 A;  3ZQG A;  2GBY A;  4ACI A;  4NEL A;  3BTL A;  2G0E A;  1ZKG A;  5D19 A;  3IH3 A;  3QPS A;  2ZOZ A;  3MVP A;  4KWA A;  1Z0X A;  3T6N A;  3LWJ A;  2ID3 A;  3BNI A;  4W1U A;  3BR5 A;  3VUQ A;  2VKE A;  2YVE A;  3LHQ A;  3IH2 A;  3LSR A;  1JT0 A;  3VIB A;  5FKN A;  2QWT A;  3VW1 A;  2G7L A;  3C2B A;  3NRG A;  3EGQ A;  2XPU A;  2QKO A;  5IPA A;  2QIB A;  4MO7 A;  1JTY A;  3NNR A;  4HKU A;  5HSZ A;  4AC6 A;  4M3B A;  1RKT A;  5EFY A;  2V57 A;  1Z77 A;  2XRL A;  5IOZ A;  1JUM A;  3BRU A;  2WGB A;  3QKX A;  2HQ5 A;  2F07 A;  2ZB9 A;  3BJB A;  3CRJ A;  5CXI A;  3V78 A;  2HKU A;  2PBX A;  5FHP A;  2YVH A;  3CDL A;  3BR6 A;  5D18 A;  3BR2 A;  4JYK A;  2GFN A;  4W97 A;  2G7S A;  2PZ9 A;  3B6C A;  5K7H A;  4V2F A;  2RAS A;  1A6I A;  5FMP A;  3LJL A;  3O8G A;  5K7F A;  4YZE A;  3SFI A;  2Y30 A;  3LSP A;  3BR3 A;  4GFK A;  2NX4 A;  3G1M A;  3ZQF A;  3G56 A;  5FKL A;  3DPJ A;  3B81 A;  5F0H A;  3SDG A;  5FGL A;  3MNL A;  4I6Z A;  5AQC A;  4GFL A;  3F1B A;  4AC0 A;  2O7O A;  3CJD A;  2FBQ A;  4AF5 A;  1RPW A;  3KKC A;  1ZK8 A;  2QTQ A;  2UXU A;  1JUP A;  3C07 A;  2IU5 A;  4D7N A;  1JUS A;  3BR1 A;  5HBU A;  3FK6 A;  1U9O A;  3RH2 A;  4M3G A;  2HXI A;  4M3F A;  5H9T A;  1VI0 A;  3LSJ A;  1QVT A;  4DW6 A;  3O60 A;  5F08 A;  4L62 A;  1UI5 A;  5FKK A;  4JL3 A;  3E7Q A;  3ANG A;  1JT6 A;  3BQZ A;  3KZ9 A;  2JK3 A;  3FK7 A;  3VW0 A;  2ZOY A;  3Q3S A;  4D5F A;  4JKZ A;  3VVZ A;  5EZG A;  4JNN A;  3AQT A;  3GZI A;  1RKW A;  2VPR A;  2WV1 A;  3CWR A;  5GP9 A;  2GEN A;  2UXO A;  2UXP A;  2QOP A;  2OER A;  5J3L A;  3Q0U A;  4ABZ A;  5GPC A;  2ID6 A;  2G7G A;  2NS7 A;  2X9D A;  2IAI A;  3NXC A;  2IEK A;  2ZCM A;  3HE0 A;  3ZQH A;  3G7R A;  2XGC A;  4NN1 A;  4CGR A;  5EYR A;  3HGY A;  1BJZ A;  1UI6 A;  3PAS A;  5J1U A;  1QVU A;  2FJ1 A;  2DTZ A;  3RD3 A;  2XGE A;  1JTX A;  2TCT A;  5F0F A;  2OF7 A;  5FKO A;  3VOK A;  3PPB A;  3KNW A;  3G1L A;  3EUP A;  3DEW A;  5HAW A;  3TP0 A;  3BTJ A;  4GCT A;  2Q24 A;  5D1R A;  3WHC A;  3Q0V A;  4G12 A;  3KKD A;  3WHB A;  3VP5 A;  3VVY A;  2HYT A;  3G1O A;  5GPA A;  2Y31 A;  3BR0 A;  4M3D A;  3ZQL A;  1T56 A;  2X6O A;  1T33 A;  4UDS A;  3COL A;  4X1E A;  5EZH A;  4XK4 A;  3BTI A;  3ZQI A;  5CW8 A;  2ZCN A;  2RAE A;  3FRQ A;  2RHA A;  3GEU A;  2FX0 A;  3BQY A;  5DAJ A;  3HTA A;  2VKV A;  3IH4 A;  2EH3 A;  4GCK A; 
#chains in the Genus database with same CATH topology
 2Y2Z A;  5F27 A;  3P9T A;  3QBM A;  3HGG A;  3NPI A;  2XDN A;  3QQA A;  2HYJ A;  2I10 A;  3HTJ A;  2R7Q A;  4MXM A;  2XGD A;  3BCG A;  4D5C A;  3HTI A;  2IBD A;  2UXI A;  3VOX A;  2QCO A;  5F0C A;  5C4Y A;  2D6Y A;  5K58 A;  2OI8 A;  3ANP A;  5IOY A;  1SGM A;  3BHQ A;  3HTH A;  2ZCX A;  5IP6 A;  4B1R A;  5F1J A;  3VVX A;  3DCF A;  4MK6 A;  2OPT A;  4C2M A;  3IUV A;  3HIM A;  2R7R A;  2G3B A;  3VW2 A;  3V6G A;  3CCY A;  3BT9 A;  4ICH A;  4AUX A;  2NS8 A;  3FIW A;  3LOC A;  5J1R A;  2UXH A;  2FQ4 A;  2HXO A;  2REK A;  1U9N A;  2W53 A;  4B3A A;  3VPR A;  5F04 A;  3ON2 A;  3O8H A;  5CXG A;  2XPW A;  5K7Z A;  3AQS A;  3TP3 A;  5J1Y A;  1QPI A;  1ORK A;  3FHN A;  4PXI A;  4ME9 A;  2NP3 A;  2FD5 A;  2XB5 A;  2XPV A;  3BTC A;  3NI7 A;  3PM1 A;  3ON4 A;  3B6A A;  2GUH A;  3Q0W A;  2DG7 A;  2ZY9 A;  5CQG A;  2O7T A;  3QPL A;  4I76 A;  4D7M A;  3S5R A;  5FKM A;  3VTI A;  2TRT A;  2WUI A;  4IRV A;  4V2G A;  4GCL A;  3JSJ A;  2NP5 A;  3F0C A;  4M3E A;  2JJ7 A;  2DG8 A;  3ZQG A;  2GBY A;  4ACI A;  4NEL A;  3BTL A;  2G0E A;  1ZKG A;  2PFV A;  5D19 A;  3IH3 A;  3QPS A;  2ZOZ A;  3MVP A;  4KWA A;  1Z0X A;  3T6N A;  3LWJ A;  2ID3 A;  3BNI A;  4W1U A;  3BR5 A;  3VUQ A;  2VKE A;  2YVE A;  3LHQ A;  3IH2 A;  3LSR A;  1JT0 A;  3VIB A;  5FKN A;  2QWT A;  3VW1 A;  2FJI 1;  2G7L A;  3C2B A;  3NRG A;  3EGQ A;  2XPU A;  2R7T A;  2QKO A;  5IPA A;  2QIB A;  4MO7 A;  1JTY A;  3NNR A;  4HKU A;  5HSZ A;  4AC6 A;  4M3B A;  1RKT A;  5EFY A;  2V57 A;  1Z77 A;  2XRL A;  5IOZ A;  1JUM A;  3BRU A;  2WGB A;  3QKX A;  2HQ5 A;  2F07 A;  2ZB9 A;  3BJB A;  3CRJ A;  2R7X A;  5CXI A;  2HKU A;  2PBX A;  3V78 A;  5FHP A;  2YVH A;  3CDL A;  2A2F X;  3BR6 A;  5D18 A;  3BR2 A;  4JYK A;  2GFN A;  4W97 A;  2G7S A;  2PZ9 A;  3B6C A;  5K7H A;  4V2F A;  2RAS A;  1A6I A;  2YVX A;  5FMP A;  3LJL A;  3O8G A;  5K7F A;  2B3W A;  4YZE A;  3SFI A;  2Y30 A;  3LSP A;  3BR3 A;  4GFK A;  2NX4 A;  3G1M A;  2R7S A;  3ZQF A;  3G56 A;  5FKL A;  3DPJ A;  3B81 A;  5F0H A;  3SDG A;  5FGL A;  3MNL A;  4I6Z A;  5AQC A;  4GFL A;  4U9L A;  3F1B A;  4AC0 A;  2O7O A;  3CJD A;  2FBQ A;  4AF5 A;  1RPW A;  3KKC A;  1ZK8 A;  2QTQ A;  2UXU A;  1JUP A;  3C07 A;  2IU5 A;  4D7N A;  1JUS A;  3BR1 A;  5HBU A;  3FK6 A;  1U9O A;  3RH2 A;  4M3G A;  2HXI A;  4M3F A;  5H9T A;  1VI0 A;  3LSJ A;  1QVT A;  3DU6 A;  4DW6 A;  3O60 A;  5F08 A;  4L62 A;  1UI5 A;  5FKK A;  4JL3 A;  3E7Q A;  3ANG A;  1JT6 A;  3BQZ A;  3KZ9 A;  2JK3 A;  3FK7 A;  3VW0 A;  2ZOY A;  3Q3S A;  4D5F A;  4JKZ A;  3VVZ A;  5EZG A;  4JNN A;  3AQT A;  3GZI A;  1RKW A;  3SWH A;  2R7V A;  2VPR A;  2WV1 A;  3CWR A;  5GP9 A;  2GEN A;  3K8P C;  4U9N A;  2UXO A;  2UXP A;  2QOP A;  2OER A;  5J3L A;  3Q0U A;  4ABZ A;  5GPC A;  2ID6 A;  4OD5 A;  2G7G A;  4WIB A;  2NS7 A;  2X9D A;  2IAI A;  3NXC A;  2IEK A;  2ZCM A;  3HE0 A;  3ZQH A;  3G7R A;  2XGC A;  4NN1 A;  4CGR A;  5EYR A;  3KYL A;  3HGY A;  1BJZ A;  1UI6 A;  3PAS A;  5J1U A;  1QVU A;  2FJ1 A;  2R7W A;  2DTZ A;  3RD3 A;  2R7O A;  2XGE A;  1JTX A;  2TCT A;  5F0F A;  2OF7 A;  2R7U A;  5FKO A;  3VOK A;  3PPB A;  3KNW A;  3G1L A;  3EUP A;  3DEW A;  5HAW A;  3TP0 A;  3BTJ A;  4GCT A;  2Q24 A;  3NS4 A;  5D1R A;  3WHC A;  3Q0V A;  4G12 A;  4DVY P;  3KKD A;  3WHB A;  3VP5 A;  3VVY A;  2HYT A;  3DU5 A;  3G1O A;  5GPA A;  2Y31 A;  3BR0 A;  4M3D A;  3ZQL A;  1T56 A;  2X6O A;  1T33 A;  4UDS A;  3COL A;  4X1E A;  5EZH A;  4XK4 A;  3BTI A;  3ZQI A;  5CW8 A;  2ZCN A;  2RAE A;  3FRQ A;  2RHA A;  3GEU A;  2B1E A;  2FX0 A;  3BQY A;  5DAJ A;  3HTA A;  2VKV A;  3IH4 A;  2EH3 A;  4OD4 A;  4GCK A; 
#chains in the Genus database with same CATH homology
 2Y2Z A;  5F27 A;  3P9T A;  3QBM A;  3HGG A;  3NPI A;  2XDN A;  3QQA A;  2HYJ A;  2I10 A;  3HTJ A;  4MXM A;  2XGD A;  3BCG A;  4D5C A;  3HTI A;  2IBD A;  2UXI A;  3VOX A;  2QCO A;  5F0C A;  5C4Y A;  2D6Y A;  5K58 A;  2OI8 A;  3ANP A;  5IOY A;  1SGM A;  3BHQ A;  3HTH A;  2ZCX A;  5IP6 A;  4B1R A;  5F1J A;  3VVX A;  3DCF A;  4MK6 A;  2OPT A;  3IUV A;  3HIM A;  2G3B A;  3VW2 A;  3V6G A;  3CCY A;  3BT9 A;  4ICH A;  4AUX A;  2NS8 A;  3FIW A;  3LOC A;  5J1R A;  2UXH A;  2FQ4 A;  2HXO A;  2REK A;  1U9N A;  2W53 A;  4B3A A;  3VPR A;  5F04 A;  3ON2 A;  3O8H A;  5CXG A;  2XPW A;  5K7Z A;  3AQS A;  3TP3 A;  5J1Y A;  1QPI A;  1ORK A;  4PXI A;  4ME9 A;  2NP3 A;  2FD5 A;  2XB5 A;  2XPV A;  3BTC A;  3NI7 A;  3PM1 A;  3ON4 A;  3B6A A;  2GUH A;  3Q0W A;  2DG7 A;  2O7T A;  3QPL A;  4I76 A;  4D7M A;  3S5R A;  5FKM A;  2TRT A;  2WUI A;  4V2G A;  4GCL A;  3JSJ A;  2NP5 A;  3F0C A;  4M3E A;  2JJ7 A;  2DG8 A;  3ZQG A;  2GBY A;  4ACI A;  4NEL A;  3BTL A;  2G0E A;  1ZKG A;  5D19 A;  3IH3 A;  3QPS A;  2ZOZ A;  3MVP A;  4KWA A;  1Z0X A;  3T6N A;  3LWJ A;  2ID3 A;  3BNI A;  4W1U A;  3BR5 A;  3VUQ A;  2VKE A;  2YVE A;  3LHQ A;  3IH2 A;  3LSR A;  1JT0 A;  3VIB A;  5FKN A;  2QWT A;  3VW1 A;  2G7L A;  3C2B A;  3NRG A;  3EGQ A;  2XPU A;  2QKO A;  5IPA A;  2QIB A;  4MO7 A;  1JTY A;  3NNR A;  4HKU A;  5HSZ A;  4AC6 A;  4M3B A;  1RKT A;  5EFY A;  2V57 A;  1Z77 A;  2XRL A;  5IOZ A;  1JUM A;  3BRU A;  2WGB A;  3QKX A;  2HQ5 A;  2F07 A;  2ZB9 A;  3BJB A;  3CRJ A;  5CXI A;  3V78 A;  2HKU A;  2PBX A;  5FHP A;  2YVH A;  3CDL A;  3BR6 A;  5D18 A;  3BR2 A;  4JYK A;  2GFN A;  4W97 A;  2G7S A;  2PZ9 A;  3B6C A;  5K7H A;  4V2F A;  2RAS A;  1A6I A;  5FMP A;  3LJL A;  3O8G A;  5K7F A;  4YZE A;  3SFI A;  2Y30 A;  3LSP A;  3BR3 A;  4GFK A;  2NX4 A;  3G1M A;  3ZQF A;  3G56 A;  5FKL A;  3DPJ A;  3B81 A;  5F0H A;  3SDG A;  5FGL A;  3MNL A;  4I6Z A;  5AQC A;  4GFL A;  3F1B A;  4AC0 A;  2O7O A;  3CJD A;  2FBQ A;  4AF5 A;  1RPW A;  3KKC A;  1ZK8 A;  2QTQ A;  2UXU A;  1JUP A;  3C07 A;  2IU5 A;  4D7N A;  1JUS A;  3BR1 A;  5HBU A;  3FK6 A;  1U9O A;  3RH2 A;  4M3G A;  2HXI A;  4M3F A;  5H9T A;  1VI0 A;  3LSJ A;  1QVT A;  4DW6 A;  3O60 A;  5F08 A;  4L62 A;  1UI5 A;  5FKK A;  4JL3 A;  3E7Q A;  3ANG A;  1JT6 A;  3BQZ A;  3KZ9 A;  2JK3 A;  3FK7 A;  3VW0 A;  2ZOY A;  3Q3S A;  4D5F A;  4JKZ A;  3VVZ A;  5EZG A;  4JNN A;  3AQT A;  3GZI A;  1RKW A;  2VPR A;  2WV1 A;  3CWR A;  5GP9 A;  2GEN A;  2UXO A;  2UXP A;  2QOP A;  2OER A;  5J3L A;  3Q0U A;  4ABZ A;  5GPC A;  2ID6 A;  2G7G A;  2NS7 A;  2X9D A;  2IAI A;  3NXC A;  2IEK A;  2ZCM A;  3HE0 A;  3ZQH A;  3G7R A;  2XGC A;  4NN1 A;  4CGR A;  5EYR A;  3HGY A;  1BJZ A;  1UI6 A;  3PAS A;  5J1U A;  1QVU A;  2FJ1 A;  2DTZ A;  3RD3 A;  2XGE A;  1JTX A;  2TCT A;  5F0F A;  2OF7 A;  5FKO A;  3VOK A;  3PPB A;  3KNW A;  3G1L A;  3EUP A;  3DEW A;  5HAW A;  3TP0 A;  3BTJ A;  4GCT A;  2Q24 A;  5D1R A;  3WHC A;  3Q0V A;  4G12 A;  3KKD A;  3WHB A;  3VP5 A;  3VVY A;  2HYT A;  3G1O A;  5GPA A;  2Y31 A;  3BR0 A;  4M3D A;  3ZQL A;  1T56 A;  2X6O A;  1T33 A;  4UDS A;  3COL A;  4X1E A;  5EZH A;  4XK4 A;  3BTI A;  3ZQI A;  5CW8 A;  2ZCN A;  2RAE A;  3FRQ A;  2RHA A;  3GEU A;  2FX0 A;  3BQY A;  5DAJ A;  3HTA A;  2VKV A;  3IH4 A;  2EH3 A;  4GCK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...