2HYTA

Crystal structure of a tetr-family transcriptional regulator (eca1819) from pectobacterium atrosepticum at 1.64 a resolution
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
193
structure length
193
Chain Sequence
RTRAEMEETRATLLATARKVFSERGYADTSMDDLTAQASLTRGALYHHFGDKKGLLAAVVEQIDAEMDERLQAISDTAEDDWEGFRCRCRAYLEMALEPEIQRIVLRDARAVLGGASPDSQRHCVESMQRLIDNLIRQGVVAEADPQALASLIYGSLAEAAFWIAEGEDGNARLAQGVAALELLLRGLLVKPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TetR-family transcriptional regulator
publication title Crystal structure of TetR-family transcriptional regulator (YP_049917.1) from Erwinia Cartovora Atroseptica SCRI1043 at 1.64 A resolution
rcsb
source organism Pectobacterium atrosepticum
molecule tags Transcription
total genus 75
structure length 193
sequence length 193
ec nomenclature
pdb deposition date 2006-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2hytA00
1UI5A 5CXIA 2HQ5A 2XGCA 3G1LA 4YZEA 1QPIA 3HTAA 3ZQIA 1JUMA 3ZQHA 4ACIA 2XB5A 3ZQFA 2HYJA 4NELA 4MO7A 1JT6A 2I10A 2O7OA 2XPVA 3BT9A 2UXPA 2HXIA 2FX0A 3O8GA 4GCKA 2REKA 3F1BA 1U9OA 2ZOYA 3KKDA 1Z77A 3DPJA 3BTCA 2FD5A 5F04A 1T56A 4I76A 2FQ4A 5FKLA 3QQAA 3V6GA 2XGDA 2RASA 3ANPA 3SFIA 4CGRA 3FK6A 1QVTA 3BJBA 3VVXA 3FK7A 3HIMA 3HTJA 5FKNA 3VW1A 2OF7A 5F0CA 3VOXA 4ME9A 2G0EA 3SDGA 2QTQA 3Q3SA 2G7GA 5J3LA 2IEKA 3IH3A 3BRUA 3NRGA 3IUVA 5K7FA 2UXIA 4GCLA 3VOKA 5GPAA 3WHCA 2D6YA 3VVZA 2JJ7A 2DG8A 2ZCXA 4I6ZA 3HTHA 3LJLA 3BR3A 2UXHA 5D19A 2QWTA 3BQZA 2QOPA 2XPUA 1UI6A 3IH4A 2VKEA 4GFLA 2ZCNA 3BTLA 5H9TA 1ZK8A 3Q0VA 1Z0XA 2IBDA 3B81A 2OERA 3PASA 5FKOA 2VKVA 5CXGA 2UXUA 3LSJA 3BR5A 3BCGA 3ZQLA 3EUPA 3VPRA 4W97A 3G56A 2O7TA 4PXIA 3GEUA 2GUHA 4AF5A 4D7NA 2OI8A 2PBXA 3COLA 3MNLA 1BJZA 5F1JA 2NP5A 3BNIA 3HGGA 3T6NA 1JUSA 5F08A 3RD3A 2WUIA 2W53A 4HKUA 4V2GA 3DEWA 3KKCA 5CW8A 2V57A 2UXOA 4XK4A 2ZOZA 2RAEA 2JK3A 2XRLA 5FHPA 1QVUA 3CRJA 4L62A 5F0HA 4D5FA 1RPWA 5J1YA 4M3DA 5F27A 5HBUA 1JTYA 3BR0A 3G1OA 1T33A 3NNRA 5HSZA 3AQTA 2HKUA 3BTJA 3ON2A 2X9DA 3MVPA 3PPBA 2OPTA 2NX4A 3G1MA 4JYKA 3HTIA 2NP3A 3NI7A 2TRTA 3WHBA 3BTIA 4MXMA 3B6CA 3CWRA 5FKKA 5FGLA 2FJ1A 4M3GA 4ABZA 2GENA 4AC0A 5C4YA 5K7HA 5K58A 4JL3A 1JUPA 1RKWA 5HAWA 5EFYA 3TP3A 3ANGA 3HGYA 2ZCMA 3VIBA 1JT0A 3BR6A 2YVHA 2YVEA 4ICHA 3IH2A 2F07A 5FMPA 3O60A 5EYRA 3TP0A 3CDLA 5IOZA 3FRQA 4DW6A 2G3BA 5IPAA 3DCFA 2HYTA 1ZKGA 4GCTA 3B6AA 4M3EA 4V2FA 2GFNA 2WV1A 3LHQA 5F0FA 3E7QA 5D1RA 2HXOA 3LSRA 2FBQA 3LOCA 2RHAA 4G12A 4NN1A 3VW0A 3C2BA 3JSJA 2G7SA 4JNNA 2QIBA 2NS7A 3KNWA 5D18A 1VI0A 4KWAA 2Y30A 3VP5A 5AQCA 2NS8A 1ORKA 5J1RA 3QPLA 5GP9A 2QKOA 4AUXA 3RH2A 3QPSA 4X1EA 3BQYA 5IP6A 5GPCA 3BHQA 3CCYA 3BR1A 2ID6A 3S5RA 3G7RA 3HE0A 2GBYA 2Q24A 3KZ9A 3QBMA 2IU5A 4UDSA 3PM1A 3ZQGA 4M3FA 2Y2ZA 3BR2A 3O8HA 5FKMA 3LSPA 2DG7A 2X6OA 3VVYA 4W1UA 2DTZA 3NXCA 5DAJA 2EH3A 2ID3A 3VUQA 4MK6A 4D7MA 1SGMA 2QCOA 2TCTA 4GFKA 5EZGA 2VPRA 3Q0UA 2G7LA 5EZHA 2XPWA 3VW2A 3AQSA 2ZB9A 3EGQA 2PZ9A 4AC6A 3Q0WA 4M3BA 2Y31A 2IAIA 3QKXA 4B3AA 2XGEA 3F0CA 3NPIA 3V78A 5IOYA 1A6IA 4D5CA 2XDNA 3C07A 3CJDA 3LWJA 3FIWA 1JTXA 4B1RA 4JKZA 2WGBA 3P9TA 5J1UA 5K7ZA 3GZIA 1U9NA 3ON4A 1RKTA
chains in the Genus database with same CATH superfamily
1UI5A 5CXIA 2HQ5A 2XGCA 3G1LA 4YZEA 1QPIA 2PFVA 3HTAA 3ZQIA 1JUMA 3ZQHA 2ZY9A 2XB5A 4ACIA 3ZQFA 3KYLA 2HYJA 4NELA 2R7XA 4MO7A 1JT6A 2I10A 4WIBA 2O7OA 2XPVA 3BT9A 2UXPA 2R7UA 2HXIA 2FX0A 2R7SA 3O8GA 4GCKA 2REKA 2B1EA 3F1BA 1U9OA 2ZOYA 3KKDA 1Z77A 2A2FX 3DPJA 3BTCA 2FD5A 5F04A 3NS4A 1T56A 4I76A 2FQ4A 5FKLA 3QQAA 3V6GA 2XGDA 2RASA 3SWHA 3ANPA 3VTIA 3SFIA 4CGRA 3FK6A 1QVTA 3BJBA 3VVXA 3FK7A 3HIMA 3HTJA 5FKNA 3VW1A 2OF7A 5F0CA 2R7TA 3VOXA 4ME9A 2G0EA 3SDGA 2QTQA 3Q3SA 2G7GA 5J3LA 2IEKA 3IH3A 4OD5A 3DU6A 3BRUA 3NRGA 3IUVA 5K7FA 2UXIA 4GCLA 3VOKA 5GPAA 3WHCA 2D6YA 3VVZA 2JJ7A 2DG8A 2ZCXA 4I6ZA 3HTHA 3LJLA 3BR3A 2UXHA 5D19A 2QWTA 3BQZA 2QOPA 2XPUA 4U9LA 1UI6A 3IH4A 2VKEA 4GFLA 2ZCNA 3BTLA 5H9TA 1ZK8A 3Q0VA 3DU5A 1Z0XA 2IBDA 3B81A 2OERA 3PASA 5FKOA 2VKVA 5CXGA 2UXUA 3LSJA 3BR5A 3BCGA 3ZQLA 3EUPA 3VPRA 4W97A 3G56A 2O7TA 4PXIA 3GEUA 2GUHA 4AF5A 4D7NA 2OI8A 2PBXA 3COLA 3MNLA 1BJZA 5F1JA 2NP5A 3BNIA 3HGGA 3T6NA 1JUSA 5F08A 3RD3A 2WUIA 2W53A 4HKUA 4V2GA 3DEWA 3KKCA 4OD4A 5CW8A 2V57A 2UXOA 4XK4A 2ZOZA 2RAEA 2JK3A 2XRLA 5FHPA 1QVUA 3CRJA 4L62A 5F0HA 4D5FA 1RPWA 5J1YA 4M3DA 5F27A 5HBUA 1JTYA 3BR0A 3G1OA 1T33A 3NNRA 5HSZA 3AQTA 2HKUA 3BTJA 3ON2A 2X9DA 3MVPA 3PPBA 2OPTA 2NX4A 3G1MA 4JYKA 3HTIA 2NP3A 3NI7A 2TRTA 3WHBA 3BTIA 4MXMA 3B6CA 3CWRA 5FKKA 5FGLA 2FJ1A 4M3GA 4ABZA 2GENA 4AC0A 5C4YA 5K7HA 5K58A 4JL3A 1JUPA 1RKWA 5HAWA 5EFYA 3TP3A 3ANGA 3HGYA 2ZCMA 3VIBA 1JT0A 3BR6A 2YVHA 4U9NA 2YVEA 2R7QA 4ICHA 3IH2A 2F07A 5FMPA 3O60A 5EYRA 3TP0A 3CDLA 5IOZA 3FRQA 4DW6A 2G3BA 5IPAA 3DCFA 2HYTA 1ZKGA 4GCTA 3B6AA 4M3EA 4V2FA 2GFNA 2WV1A 3LHQA 5F0FA 3E7QA 5D1RA 2HXOA 3LSRA 2FBQA 3LOCA 2RHAA 4G12A 4NN1A 3VW0A 3C2BA 3JSJA 2G7SA 4JNNA 2QIBA 2NS7A 3KNWA 3K8PC 5D18A 1VI0A 4KWAA 2Y30A 2R7RA 3VP5A 2R7WA 5AQCA 4DVYP 2NS8A 1ORKA 5J1RA 3QPLA 3FHNA 5GP9A 2QKOA 4AUXA 3RH2A 3QPSA 4X1EA 3BQYA 5IP6A 5GPCA 3BHQA 3CCYA 3BR1A 2R7VA 2ID6A 3S5RA 3G7RA 3HE0A 4C2MA 2GBYA 2Q24A 3KZ9A 5CQGA 3QBMA 2IU5A 4UDSA 3PM1A 3ZQGA 4M3FA 2Y2ZA 3BR2A 3O8HA 5FKMA 3LSPA 2DG7A 4IRVA 2X6OA 3VVYA 4W1UA 2DTZA 3NXCA 5DAJA 2EH3A 2ID3A 3VUQA 4MK6A 4D7MA 1SGMA 2QCOA 2TCTA 4GFKA 5EZGA 2VPRA 2FJI1 3Q0UA 2G7LA 5EZHA 2XPWA 3VW2A 3AQSA 2ZB9A 2R7OA 3EGQA 2B3WA 2PZ9A 4AC6A 3Q0WA 4M3BA 2YVXA 2Y31A 2IAIA 3QKXA 4B3AA 2XGEA 3F0CA 3NPIA 3V78A 5IOYA 1A6IA 4D5CA 2XDNA 3C07A 3CJDA 3LWJA 3FIWA 1JTXA 4B1RA 4JKZA 2WGBA 3P9TA 5J1UA 5K7ZA 3GZIA 1U9NA 3ON4A 1RKTA
chains in the Genus database with same CATH topology
1UI5A 5CXIA 2HQ5A 2XGCA 3G1LA 4YZEA 1QPIA 3HTAA 3ZQIA 1JUMA 3ZQHA 4ACIA 2XB5A 3ZQFA 2HYJA 4NELA 4MO7A 1JT6A 2I10A 2O7OA 2XPVA 3BT9A 2UXPA 2HXIA 2FX0A 3O8GA 4GCKA 2REKA 3F1BA 1U9OA 2ZOYA 3KKDA 1Z77A 3DPJA 3BTCA 2FD5A 5F04A 1T56A 4I76A 2FQ4A 5FKLA 3QQAA 3V6GA 2XGDA 2RASA 3ANPA 3SFIA 4CGRA 3FK6A 1QVTA 3BJBA 3VVXA 3FK7A 3HIMA 3HTJA 5FKNA 3VW1A 2OF7A 5F0CA 3VOXA 4ME9A 2G0EA 3SDGA 2QTQA 3Q3SA 2G7GA 5J3LA 2IEKA 3IH3A 3BRUA 3NRGA 3IUVA 5K7FA 2UXIA 4GCLA 3VOKA 5GPAA 3WHCA 2D6YA 3VVZA 2JJ7A 2DG8A 2ZCXA 4I6ZA 3HTHA 3LJLA 3BR3A 2UXHA 5D19A 2QWTA 3BQZA 2QOPA 2XPUA 1UI6A 3IH4A 2VKEA 4GFLA 2ZCNA 3BTLA 5H9TA 1ZK8A 3Q0VA 1Z0XA 2IBDA 3B81A 2OERA 3PASA 5FKOA 2VKVA 5CXGA 2UXUA 3LSJA 3BR5A 3BCGA 3ZQLA 3EUPA 3VPRA 4W97A 3G56A 2O7TA 4PXIA 3GEUA 2GUHA 4AF5A 4D7NA 2OI8A 2PBXA 3COLA 3MNLA 1BJZA 5F1JA 2NP5A 3BNIA 3HGGA 3T6NA 1JUSA 5F08A 3RD3A 2WUIA 2W53A 4HKUA 4V2GA 3DEWA 3KKCA 5CW8A 2V57A 2UXOA 4XK4A 2ZOZA 2RAEA 2JK3A 2XRLA 5FHPA 1QVUA 3CRJA 4L62A 5F0HA 4D5FA 1RPWA 5J1YA 4M3DA 5F27A 5HBUA 1JTYA 3BR0A 3G1OA 1T33A 3NNRA 5HSZA 3AQTA 2HKUA 3BTJA 3ON2A 2X9DA 3MVPA 3PPBA 2OPTA 2NX4A 3G1MA 4JYKA 3HTIA 2NP3A 3NI7A 2TRTA 3WHBA 3BTIA 4MXMA 3B6CA 3CWRA 5FKKA 5FGLA 2FJ1A 4M3GA 4ABZA 2GENA 4AC0A 5C4YA 5K7HA 5K58A 4JL3A 1JUPA 1RKWA 5HAWA 5EFYA 3TP3A 3ANGA 3HGYA 2ZCMA 3VIBA 1JT0A 3BR6A 2YVHA 2YVEA 4ICHA 3IH2A 2F07A 5FMPA 3O60A 5EYRA 3TP0A 3CDLA 5IOZA 3FRQA 4DW6A 2G3BA 5IPAA 3DCFA 2HYTA 1ZKGA 4GCTA 3B6AA 4M3EA 4V2FA 2GFNA 2WV1A 3LHQA 5F0FA 3E7QA 5D1RA 2HXOA 3LSRA 2FBQA 3LOCA 2RHAA 4G12A 4NN1A 3VW0A 3C2BA 3JSJA 2G7SA 4JNNA 2QIBA 2NS7A 3KNWA 5D18A 1VI0A 4KWAA 2Y30A 3VP5A 5AQCA 2NS8A 1ORKA 5J1RA 3QPLA 5GP9A 2QKOA 4AUXA 3RH2A 3QPSA 4X1EA 3BQYA 5IP6A 5GPCA 3BHQA 3CCYA 3BR1A 2ID6A 3S5RA 3G7RA 3HE0A 2GBYA 2Q24A 3KZ9A 3QBMA 2IU5A 4UDSA 3PM1A 3ZQGA 4M3FA 2Y2ZA 3BR2A 3O8HA 5FKMA 3LSPA 2DG7A 2X6OA 3VVYA 4W1UA 2DTZA 3NXCA 5DAJA 2EH3A 2ID3A 3VUQA 4MK6A 4D7MA 1SGMA 2QCOA 2TCTA 4GFKA 5EZGA 2VPRA 3Q0UA 2G7LA 5EZHA 2XPWA 3VW2A 3AQSA 2ZB9A 3EGQA 2PZ9A 4AC6A 3Q0WA 4M3BA 2Y31A 2IAIA 3QKXA 4B3AA 2XGEA 3F0CA 3NPIA 3V78A 5IOYA 1A6IA 4D5CA 2XDNA 3C07A 3CJDA 3LWJA 3FIWA 1JTXA 4B1RA 4JKZA 2WGBA 3P9TA 5J1UA 5K7ZA 3GZIA 1U9NA 3ON4A 1RKTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UI5 A;  5CXI A;  2HQ5 A;  2XGC A;  3G1L A;  4YZE A;  1QPI A;  3HTA A;  3ZQI A;  1JUM A;  3ZQH A;  4ACI A;  2XB5 A;  3ZQF A;  2HYJ A;  4NEL A;  4MO7 A;  1JT6 A;  2I10 A;  2O7O A;  2XPV A;  3BT9 A;  2UXP A;  2HXI A;  2FX0 A;  3O8G A;  4GCK A;  2REK A;  3F1B A;  1U9O A;  2ZOY A;  3KKD A;  1Z77 A;  3DPJ A;  3BTC A;  2FD5 A;  5F04 A;  1T56 A;  4I76 A;  2FQ4 A;  5FKL A;  3QQA A;  3V6G A;  2XGD A;  2RAS A;  3ANP A;  3SFI A;  4CGR A;  3FK6 A;  1QVT A;  3BJB A;  3VVX A;  3FK7 A;  3HIM A;  3HTJ A;  5FKN A;  3VW1 A;  2OF7 A;  5F0C A;  3VOX A;  4ME9 A;  2G0E A;  3SDG A;  2QTQ A;  3Q3S A;  2G7G A;  5J3L A;  2IEK A;  3IH3 A;  3BRU A;  3NRG A;  3IUV A;  5K7F A;  2UXI A;  4GCL A;  3VOK A;  5GPA A;  3WHC A;  2D6Y A;  3VVZ A;  2JJ7 A;  2DG8 A;  2ZCX A;  4I6Z A;  3HTH A;  3LJL A;  3BR3 A;  2UXH A;  5D19 A;  2QWT A;  3BQZ A;  2QOP A;  2XPU A;  1UI6 A;  3IH4 A;  2VKE A;  4GFL A;  2ZCN A;  3BTL A;  5H9T A;  1ZK8 A;  3Q0V A;  1Z0X A;  2IBD A;  3B81 A;  2OER A;  3PAS A;  5FKO A;  2VKV A;  5CXG A;  2UXU A;  3LSJ A;  3BR5 A;  3BCG A;  3ZQL A;  3EUP A;  3VPR A;  4W97 A;  3G56 A;  2O7T A;  4PXI A;  3GEU A;  2GUH A;  4AF5 A;  4D7N A;  2OI8 A;  2PBX A;  3COL A;  3MNL A;  1BJZ A;  5F1J A;  2NP5 A;  3BNI A;  3HGG A;  3T6N A;  1JUS A;  5F08 A;  3RD3 A;  2WUI A;  2W53 A;  4HKU A;  4V2G A;  3DEW A;  3KKC A;  5CW8 A;  2V57 A;  2UXO A;  4XK4 A;  2ZOZ A;  2RAE A;  2JK3 A;  2XRL A;  5FHP A;  1QVU A;  3CRJ A;  4L62 A;  5F0H A;  4D5F A;  1RPW A;  5J1Y A;  4M3D A;  5F27 A;  5HBU A;  1JTY A;  3BR0 A;  3G1O A;  1T33 A;  3NNR A;  5HSZ A;  3AQT A;  2HKU A;  3BTJ A;  3ON2 A;  2X9D A;  3MVP A;  3PPB A;  2OPT A;  2NX4 A;  3G1M A;  4JYK A;  3HTI A;  2NP3 A;  3NI7 A;  2TRT A;  3WHB A;  3BTI A;  4MXM A;  3B6C A;  3CWR A;  5FKK A;  5FGL A;  2FJ1 A;  4M3G A;  4ABZ A;  2GEN A;  4AC0 A;  5C4Y A;  5K7H A;  5K58 A;  4JL3 A;  1JUP A;  1RKW A;  5HAW A;  5EFY A;  3TP3 A;  3ANG A;  3HGY A;  2ZCM A;  3VIB A;  1JT0 A;  3BR6 A;  2YVH A;  2YVE A;  4ICH A;  3IH2 A;  2F07 A;  5FMP A;  3O60 A;  5EYR A;  3TP0 A;  3CDL A;  5IOZ A;  3FRQ A;  4DW6 A;  2G3B A;  5IPA A;  3DCF A;  2HYT A;  1ZKG A;  4GCT A;  3B6A A;  4M3E A;  4V2F A;  2GFN A;  2WV1 A;  3LHQ A;  5F0F A;  3E7Q A;  5D1R A;  2HXO A;  3LSR A;  2FBQ A;  3LOC A;  2RHA A;  4G12 A;  4NN1 A;  3VW0 A;  3C2B A;  3JSJ A;  2G7S A;  4JNN A;  2QIB A;  2NS7 A;  3KNW A;  5D18 A;  1VI0 A;  4KWA A;  2Y30 A;  3VP5 A;  5AQC A;  2NS8 A;  1ORK A;  5J1R A;  3QPL A;  5GP9 A;  2QKO A;  4AUX A;  3RH2 A;  3QPS A;  4X1E A;  3BQY A;  5IP6 A;  5GPC A;  3BHQ A;  3CCY A;  3BR1 A;  2ID6 A;  3S5R A;  3G7R A;  3HE0 A;  2GBY A;  2Q24 A;  3KZ9 A;  3QBM A;  2IU5 A;  4UDS A;  3PM1 A;  3ZQG A;  4M3F A;  2Y2Z A;  3BR2 A;  3O8H A;  5FKM A;  3LSP A;  2DG7 A;  2X6O A;  3VVY A;  4W1U A;  2DTZ A;  3NXC A;  5DAJ A;  2EH3 A;  2ID3 A;  3VUQ A;  4MK6 A;  4D7M A;  1SGM A;  2QCO A;  2TCT A;  4GFK A;  5EZG A;  2VPR A;  3Q0U A;  2G7L A;  5EZH A;  2XPW A;  3VW2 A;  3AQS A;  2ZB9 A;  3EGQ A;  2PZ9 A;  4AC6 A;  3Q0W A;  4M3B A;  2Y31 A;  2IAI A;  3QKX A;  4B3A A;  2XGE A;  3F0C A;  3NPI A;  3V78 A;  5IOY A;  1A6I A;  4D5C A;  2XDN A;  3C07 A;  3CJD A;  3LWJ A;  3FIW A;  1JTX A;  4B1R A;  4JKZ A;  2WGB A;  3P9T A;  5J1U A;  5K7Z A;  3GZI A;  1U9N A;  3ON4 A;  1RKT A; 
#chains in the Genus database with same CATH topology
 1UI5 A;  5CXI A;  2HQ5 A;  2XGC A;  3G1L A;  4YZE A;  1QPI A;  2PFV A;  3HTA A;  3ZQI A;  1JUM A;  3ZQH A;  2ZY9 A;  2XB5 A;  4ACI A;  3ZQF A;  3KYL A;  2HYJ A;  4NEL A;  2R7X A;  4MO7 A;  1JT6 A;  2I10 A;  4WIB A;  2O7O A;  2XPV A;  3BT9 A;  2UXP A;  2R7U A;  2HXI A;  2FX0 A;  2R7S A;  3O8G A;  4GCK A;  2REK A;  2B1E A;  3F1B A;  1U9O A;  2ZOY A;  3KKD A;  1Z77 A;  2A2F X;  3DPJ A;  3BTC A;  2FD5 A;  5F04 A;  3NS4 A;  1T56 A;  4I76 A;  2FQ4 A;  5FKL A;  3QQA A;  3V6G A;  2XGD A;  2RAS A;  3SWH A;  3ANP A;  3VTI A;  3SFI A;  4CGR A;  3FK6 A;  1QVT A;  3BJB A;  3VVX A;  3FK7 A;  3HIM A;  3HTJ A;  5FKN A;  3VW1 A;  2OF7 A;  5F0C A;  2R7T A;  3VOX A;  4ME9 A;  2G0E A;  3SDG A;  2QTQ A;  3Q3S A;  2G7G A;  5J3L A;  2IEK A;  3IH3 A;  4OD5 A;  3DU6 A;  3BRU A;  3NRG A;  3IUV A;  5K7F A;  2UXI A;  4GCL A;  3VOK A;  5GPA A;  3WHC A;  2D6Y A;  3VVZ A;  2JJ7 A;  2DG8 A;  2ZCX A;  4I6Z A;  3HTH A;  3LJL A;  3BR3 A;  2UXH A;  5D19 A;  2QWT A;  3BQZ A;  2QOP A;  2XPU A;  4U9L A;  1UI6 A;  3IH4 A;  2VKE A;  4GFL A;  2ZCN A;  3BTL A;  5H9T A;  1ZK8 A;  3Q0V A;  3DU5 A;  1Z0X A;  2IBD A;  3B81 A;  2OER A;  3PAS A;  5FKO A;  2VKV A;  5CXG A;  2UXU A;  3LSJ A;  3BR5 A;  3BCG A;  3ZQL A;  3EUP A;  3VPR A;  4W97 A;  3G56 A;  2O7T A;  4PXI A;  3GEU A;  2GUH A;  4AF5 A;  4D7N A;  2OI8 A;  2PBX A;  3COL A;  3MNL A;  1BJZ A;  5F1J A;  2NP5 A;  3BNI A;  3HGG A;  3T6N A;  1JUS A;  5F08 A;  3RD3 A;  2WUI A;  2W53 A;  4HKU A;  4V2G A;  3DEW A;  3KKC A;  4OD4 A;  5CW8 A;  2V57 A;  2UXO A;  4XK4 A;  2ZOZ A;  2RAE A;  2JK3 A;  2XRL A;  5FHP A;  1QVU A;  3CRJ A;  4L62 A;  5F0H A;  4D5F A;  1RPW A;  5J1Y A;  4M3D A;  5F27 A;  5HBU A;  1JTY A;  3BR0 A;  3G1O A;  1T33 A;  3NNR A;  5HSZ A;  3AQT A;  2HKU A;  3BTJ A;  3ON2 A;  2X9D A;  3MVP A;  3PPB A;  2OPT A;  2NX4 A;  3G1M A;  4JYK A;  3HTI A;  2NP3 A;  3NI7 A;  2TRT A;  3WHB A;  3BTI A;  4MXM A;  3B6C A;  3CWR A;  5FKK A;  5FGL A;  2FJ1 A;  4M3G A;  4ABZ A;  2GEN A;  4AC0 A;  5C4Y A;  5K7H A;  5K58 A;  4JL3 A;  1JUP A;  1RKW A;  5HAW A;  5EFY A;  3TP3 A;  3ANG A;  3HGY A;  2ZCM A;  3VIB A;  1JT0 A;  3BR6 A;  2YVH A;  4U9N A;  2YVE A;  2R7Q A;  4ICH A;  3IH2 A;  2F07 A;  5FMP A;  3O60 A;  5EYR A;  3TP0 A;  3CDL A;  5IOZ A;  3FRQ A;  4DW6 A;  2G3B A;  5IPA A;  3DCF A;  2HYT A;  1ZKG A;  4GCT A;  3B6A A;  4M3E A;  4V2F A;  2GFN A;  2WV1 A;  3LHQ A;  5F0F A;  3E7Q A;  5D1R A;  2HXO A;  3LSR A;  2FBQ A;  3LOC A;  2RHA A;  4G12 A;  4NN1 A;  3VW0 A;  3C2B A;  3JSJ A;  2G7S A;  4JNN A;  2QIB A;  2NS7 A;  3KNW A;  3K8P C;  5D18 A;  1VI0 A;  4KWA A;  2Y30 A;  2R7R A;  3VP5 A;  2R7W A;  5AQC A;  4DVY P;  2NS8 A;  1ORK A;  5J1R A;  3QPL A;  3FHN A;  5GP9 A;  2QKO A;  4AUX A;  3RH2 A;  3QPS A;  4X1E A;  3BQY A;  5IP6 A;  5GPC A;  3BHQ A;  3CCY A;  3BR1 A;  2R7V A;  2ID6 A;  3S5R A;  3G7R A;  3HE0 A;  4C2M A;  2GBY A;  2Q24 A;  3KZ9 A;  5CQG A;  3QBM A;  2IU5 A;  4UDS A;  3PM1 A;  3ZQG A;  4M3F A;  2Y2Z A;  3BR2 A;  3O8H A;  5FKM A;  3LSP A;  2DG7 A;  4IRV A;  2X6O A;  3VVY A;  4W1U A;  2DTZ A;  3NXC A;  5DAJ A;  2EH3 A;  2ID3 A;  3VUQ A;  4MK6 A;  4D7M A;  1SGM A;  2QCO A;  2TCT A;  4GFK A;  5EZG A;  2VPR A;  2FJI 1;  3Q0U A;  2G7L A;  5EZH A;  2XPW A;  3VW2 A;  3AQS A;  2ZB9 A;  2R7O A;  3EGQ A;  2B3W A;  2PZ9 A;  4AC6 A;  3Q0W A;  4M3B A;  2YVX A;  2Y31 A;  2IAI A;  3QKX A;  4B3A A;  2XGE A;  3F0C A;  3NPI A;  3V78 A;  5IOY A;  1A6I A;  4D5C A;  2XDN A;  3C07 A;  3CJD A;  3LWJ A;  3FIW A;  1JTX A;  4B1R A;  4JKZ A;  2WGB A;  3P9T A;  5J1U A;  5K7Z A;  3GZI A;  1U9N A;  3ON4 A;  1RKT A; 
#chains in the Genus database with same CATH homology
 1UI5 A;  5CXI A;  2HQ5 A;  2XGC A;  3G1L A;  4YZE A;  1QPI A;  3HTA A;  3ZQI A;  1JUM A;  3ZQH A;  4ACI A;  2XB5 A;  3ZQF A;  2HYJ A;  4NEL A;  4MO7 A;  1JT6 A;  2I10 A;  2O7O A;  2XPV A;  3BT9 A;  2UXP A;  2HXI A;  2FX0 A;  3O8G A;  4GCK A;  2REK A;  3F1B A;  1U9O A;  2ZOY A;  3KKD A;  1Z77 A;  3DPJ A;  3BTC A;  2FD5 A;  5F04 A;  1T56 A;  4I76 A;  2FQ4 A;  5FKL A;  3QQA A;  3V6G A;  2XGD A;  2RAS A;  3ANP A;  3SFI A;  4CGR A;  3FK6 A;  1QVT A;  3BJB A;  3VVX A;  3FK7 A;  3HIM A;  3HTJ A;  5FKN A;  3VW1 A;  2OF7 A;  5F0C A;  3VOX A;  4ME9 A;  2G0E A;  3SDG A;  2QTQ A;  3Q3S A;  2G7G A;  5J3L A;  2IEK A;  3IH3 A;  3BRU A;  3NRG A;  3IUV A;  5K7F A;  2UXI A;  4GCL A;  3VOK A;  5GPA A;  3WHC A;  2D6Y A;  3VVZ A;  2JJ7 A;  2DG8 A;  2ZCX A;  4I6Z A;  3HTH A;  3LJL A;  3BR3 A;  2UXH A;  5D19 A;  2QWT A;  3BQZ A;  2QOP A;  2XPU A;  1UI6 A;  3IH4 A;  2VKE A;  4GFL A;  2ZCN A;  3BTL A;  5H9T A;  1ZK8 A;  3Q0V A;  1Z0X A;  2IBD A;  3B81 A;  2OER A;  3PAS A;  5FKO A;  2VKV A;  5CXG A;  2UXU A;  3LSJ A;  3BR5 A;  3BCG A;  3ZQL A;  3EUP A;  3VPR A;  4W97 A;  3G56 A;  2O7T A;  4PXI A;  3GEU A;  2GUH A;  4AF5 A;  4D7N A;  2OI8 A;  2PBX A;  3COL A;  3MNL A;  1BJZ A;  5F1J A;  2NP5 A;  3BNI A;  3HGG A;  3T6N A;  1JUS A;  5F08 A;  3RD3 A;  2WUI A;  2W53 A;  4HKU A;  4V2G A;  3DEW A;  3KKC A;  5CW8 A;  2V57 A;  2UXO A;  4XK4 A;  2ZOZ A;  2RAE A;  2JK3 A;  2XRL A;  5FHP A;  1QVU A;  3CRJ A;  4L62 A;  5F0H A;  4D5F A;  1RPW A;  5J1Y A;  4M3D A;  5F27 A;  5HBU A;  1JTY A;  3BR0 A;  3G1O A;  1T33 A;  3NNR A;  5HSZ A;  3AQT A;  2HKU A;  3BTJ A;  3ON2 A;  2X9D A;  3MVP A;  3PPB A;  2OPT A;  2NX4 A;  3G1M A;  4JYK A;  3HTI A;  2NP3 A;  3NI7 A;  2TRT A;  3WHB A;  3BTI A;  4MXM A;  3B6C A;  3CWR A;  5FKK A;  5FGL A;  2FJ1 A;  4M3G A;  4ABZ A;  2GEN A;  4AC0 A;  5C4Y A;  5K7H A;  5K58 A;  4JL3 A;  1JUP A;  1RKW A;  5HAW A;  5EFY A;  3TP3 A;  3ANG A;  3HGY A;  2ZCM A;  3VIB A;  1JT0 A;  3BR6 A;  2YVH A;  2YVE A;  4ICH A;  3IH2 A;  2F07 A;  5FMP A;  3O60 A;  5EYR A;  3TP0 A;  3CDL A;  5IOZ A;  3FRQ A;  4DW6 A;  2G3B A;  5IPA A;  3DCF A;  2HYT A;  1ZKG A;  4GCT A;  3B6A A;  4M3E A;  4V2F A;  2GFN A;  2WV1 A;  3LHQ A;  5F0F A;  3E7Q A;  5D1R A;  2HXO A;  3LSR A;  2FBQ A;  3LOC A;  2RHA A;  4G12 A;  4NN1 A;  3VW0 A;  3C2B A;  3JSJ A;  2G7S A;  4JNN A;  2QIB A;  2NS7 A;  3KNW A;  5D18 A;  1VI0 A;  4KWA A;  2Y30 A;  3VP5 A;  5AQC A;  2NS8 A;  1ORK A;  5J1R A;  3QPL A;  5GP9 A;  2QKO A;  4AUX A;  3RH2 A;  3QPS A;  4X1E A;  3BQY A;  5IP6 A;  5GPC A;  3BHQ A;  3CCY A;  3BR1 A;  2ID6 A;  3S5R A;  3G7R A;  3HE0 A;  2GBY A;  2Q24 A;  3KZ9 A;  3QBM A;  2IU5 A;  4UDS A;  3PM1 A;  3ZQG A;  4M3F A;  2Y2Z A;  3BR2 A;  3O8H A;  5FKM A;  3LSP A;  2DG7 A;  2X6O A;  3VVY A;  4W1U A;  2DTZ A;  3NXC A;  5DAJ A;  2EH3 A;  2ID3 A;  3VUQ A;  4MK6 A;  4D7M A;  1SGM A;  2QCO A;  2TCT A;  4GFK A;  5EZG A;  2VPR A;  3Q0U A;  2G7L A;  5EZH A;  2XPW A;  3VW2 A;  3AQS A;  2ZB9 A;  3EGQ A;  2PZ9 A;  4AC6 A;  3Q0W A;  4M3B A;  2Y31 A;  2IAI A;  3QKX A;  4B3A A;  2XGE A;  3F0C A;  3NPI A;  3V78 A;  5IOY A;  1A6I A;  4D5C A;  2XDN A;  3C07 A;  3CJD A;  3LWJ A;  3FIW A;  1JTX A;  4B1R A;  4JKZ A;  2WGB A;  3P9T A;  5J1U A;  5K7Z A;  3GZI A;  1U9N A;  3ON4 A;  1RKT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...