4AF5A

Structure of the c. glutamicum acnr crystal form i
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
174
structure length
173
Chain Sequence
b'RQEILEGARRCFAEHGYEGATVRRLEEATGKSRGAIFHHFGDKENLFLALAREDAARMAEVVENGLVEVMRGMLEDPERYDWMSVRLEISKQLRTDPVFRAKWIDHQSVLDEAVRVRLSRNVDKGQMRTDVPIEVLHTFLETVLDGFISRLATGASTEGLSEVLDLVEGTVRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-TYPE TRANSCRIPTIONAL REPRESSOR ACNR COMPND 2
publication title Crystal and Solution Studies Reveal that the Transcriptional Regulator Acnr of Corynebacterium Glutamicum is Regulated by Citrate:Mg2+ Binding to a Non-Canonical Pocket.
pubmed doi rcsb
source organism Corynebacterium glutamicum
molecule tags Transcription
total genus 74
structure length 173
sequence length 174
ec nomenclature
pdb deposition date 2012-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 4af5A00
5J1YA 1JT6A 4KWAA 4X1EA 4YZEA 5F0HA 5H9TA 2HQ5A 2X6OA 3AQTA 5FHPA 1Z77A 4ICHA 2QCOA 3LWJA 3ZQHA 2GFNA 4M3FA 4D7NA 3WHBA 5IPAA 3PASA 3F1BA 1RKWA 3E7QA 3HE0A 4GFLA 4M3EA 2HXIA 2PBXA 4JKZA 3BR2A 3BCGA 2Y30A 5FKLA 3CJDA 2HYTA 2XPWA 3IH4A 5J3LA 2XGCA 2ID3A 3HGYA 3SDGA 1QVTA 2O7TA 3G1MA 5F08A 2XPVA 3O8HA 2X9DA 5IOYA 3TP0A 3ON4A 5EFYA 5GP9A 3Q0VA 5D1RA 5J1RA 2TCTA 5GPCA 3FK7A 2HYJA 2QTQA 5D18A 2F07A 2VKEA 1JUMA 4PXIA 3ZQLA 5F27A 2UXIA 2VPRA 2V57A 2NP3A 2DTZA 4V2FA 1ZKGA 4MO7A 2NP5A 3B81A 3NXCA 5D19A 5FMPA 4I76A 4G12A 1U9NA 3LHQA 2ZCMA 3KKCA 3HTJA 3NNRA 4ACIA 3NI7A 3S5RA 4D5CA 3VOXA 2Y31A 4AF5A 3VVXA 3VUQA 3SFIA 1JT0A 3Q0UA 3T6NA 3VIBA 3TP3A 3EGQA 1VI0A 3F0CA 3DEWA 3BTJA 3PM1A 3IUVA 2FBQA 2ZOZA 2NS8A 3VVYA 3BQZA 2G7LA 4B1RA 2FD5A 3QKXA 3HTIA 2RASA 4JL3A 2W53A 2YVEA 2NS7A 4ABZA 3MVPA 3B6CA 5EYRA 3O8GA 4AUXA 2ZB9A 5GPAA 2O7OA 5F0FA 5IP6A 1Z0XA 3BR5A 5F1JA 2FQ4A 3BTCA 2XRLA 3HTHA 3FK6A 4NN1A 3GEUA 2XB5A 5C4YA 3G1LA 4GCKA 3ANGA 3VW0A 2FX0A 3DPJA 1ZK8A 2IEKA 3G7RA 3VPRA 5K7FA 3ZQIA 1T33A 2XDNA 2ZCNA 5F04A 2I10A 2WV1A 3IH3A 1QPIA 5HBUA 5K58A 2G7GA 2IBDA 3KNWA 4D5FA 2WUIA 1ORKA 3HGGA 2OF7A 2G0EA 2HKUA 3B6AA 3GZIA 3CWRA 1U9OA 1BJZA 3DCFA 1A6IA 3KZ9A 3HTAA 3V78A 3VP5A 3BJBA 2WGBA 3O60A 3Q3SA 5HSZA 3C2BA 2XGEA 3BR1A 4XK4A 4AC6A 2IAIA 3BNIA 3HIMA 3QQAA 2YVHA 1JUSA 3NRGA 3BTIA 4JNNA 3WHCA 3C07A 2UXOA 2OI8A 2EH3A 2Q24A 4DW6A 3LSPA 3BT9A 5F0CA 3BR6A 5EZGA 1T56A 3JSJA 4HKUA 1RKTA 4MXMA 3ZQFA 4M3BA 1JTYA 5CXIA 2G3BA 4L62A 2QWTA 3VW1A 5HAWA 3LOCA 2GUHA 4UDSA 2OPTA 2UXUA 3BR0A 3QPLA 4NELA 2DG8A 2OERA 3VW2A 2ZCXA 3RD3A 3BTLA 2D6YA 2ID6A 2GENA 2QOPA 3LSRA 4JYKA 2REKA 3QPSA 3LJLA 5IOZA 2RHAA 4W97A 2UXHA 5K7HA 1JTXA 3NPIA 1SGMA 4M3GA 5FKMA 2RAEA 2HXOA 2QIBA 4AC0A 2QKOA 3KKDA 2Y2ZA 4ME9A 2PZ9A 3G56A 5CXGA 4B3AA 5CW8A 2JK3A 3COLA 5FKKA 3QBMA 4CGRA 2VKVA 4GFKA 3G1OA 3P9TA 1JUPA 2IU5A 1UI5A 3V6GA 3MNLA 2G7SA 2NX4A 5FGLA 1RPWA 4W1UA 5FKNA 3PPBA 5EZHA 3CCYA 3LSJA 3Q0WA 3VOKA 5AQCA 2XPUA 1UI6A 3CRJA 3BQYA 3FRQA 3EUPA 2XGDA 2ZOYA 3AQSA 2UXPA 4GCTA 3RH2A 5K7ZA 3BRUA 2TRTA 5J1UA 3FIWA 3BR3A 3ZQGA 4D7MA 2FJ1A 3IH2A 5FKOA 4M3DA 2DG7A 2JJ7A 3CDLA 4GCLA 4V2GA 3BHQA 3ON2A 2GBYA 4MK6A 5DAJA 3ANPA 3VVZA 1QVUA 4I6ZA
chains in the Genus database with same CATH superfamily
5J1YA 1JT6A 4KWAA 4X1EA 4YZEA 5F0HA 5H9TA 2HQ5A 2X6OA 3AQTA 5FHPA 1Z77A 4ICHA 2QCOA 3LWJA 3ZQHA 2GFNA 4M3FA 4D7NA 3WHBA 5IPAA 3PASA 2PFVA 3F1BA 1RKWA 3E7QA 3HE0A 4GFLA 4M3EA 2HXIA 2PBXA 4DVYP 4JKZA 3BR2A 3SWHA 3BCGA 2Y30A 5FKLA 3CJDA 2HYTA 2XPWA 3IH4A 5J3LA 2XGCA 2R7XA 2ID3A 3HGYA 3SDGA 1QVTA 2O7TA 3G1MA 5F08A 2XPVA 3K8PC 3O8HA 2X9DA 5IOYA 3TP0A 3ON4A 5EFYA 5GP9A 3Q0VA 5D1RA 5J1RA 2TCTA 2R7RA 5GPCA 3FK7A 2HYJA 2QTQA 5D18A 2F07A 2VKEA 1JUMA 4PXIA 2R7SA 3ZQLA 5F27A 2UXIA 2VPRA 2V57A 2NP3A 2DTZA 4V2FA 1ZKGA 4MO7A 2NP5A 3B81A 3NXCA 5D19A 5FMPA 4I76A 4G12A 1U9NA 3LHQA 2ZCMA 3KKCA 3HTJA 3NNRA 4ACIA 3NI7A 3S5RA 4D5CA 3VOXA 2Y31A 4AF5A 3VVXA 3VUQA 3SFIA 1JT0A 3FHNA 3Q0UA 3T6NA 3VIBA 3TP3A 3EGQA 1VI0A 3F0CA 3DEWA 3BTJA 3PM1A 3IUVA 2FBQA 2ZOZA 4OD4A 2NS8A 3VVYA 3BQZA 2G7LA 4B1RA 2FD5A 3QKXA 3HTIA 2RASA 3DU5A 4JL3A 2W53A 2YVEA 2NS7A 4ABZA 3MVPA 3B6CA 5EYRA 2R7QA 3O8GA 4AUXA 2ZB9A 4C2MA 5GPAA 2O7OA 5F0FA 5IP6A 1Z0XA 3BR5A 5F1JA 2FQ4A 3BTCA 2XRLA 3HTHA 3FK6A 4NN1A 3GEUA 2XB5A 5C4YA 3G1LA 4GCKA 3ANGA 3VW0A 2FX0A 3DPJA 1ZK8A 2IEKA 3G7RA 3VPRA 5K7FA 3ZQIA 1T33A 2XDNA 2ZCNA 5F04A 2R7OA 2R7WA 2I10A 2WV1A 3IH3A 1QPIA 5HBUA 2R7TA 5K58A 2G7GA 2IBDA 3KNWA 4D5FA 2WUIA 1ORKA 3HGGA 2OF7A 2G0EA 2HKUA 3B6AA 3GZIA 3CWRA 1U9OA 1BJZA 3DCFA 1A6IA 2A2FX 3KZ9A 3HTAA 3V78A 2YVXA 3VP5A 4IRVA 2R7VA 3BJBA 2WGBA 3O60A 3Q3SA 4OD5A 5HSZA 3C2BA 2XGEA 2ZY9A 3BR1A 4XK4A 4AC6A 2IAIA 3BNIA 3HIMA 3QQAA 2YVHA 1JUSA 3NRGA 3BTIA 4JNNA 3WHCA 3C07A 2UXOA 2OI8A 2EH3A 2Q24A 4DW6A 3KYLA 3LSPA 3BT9A 5F0CA 3BR6A 2R7UA 5EZGA 4WIBA 1T56A 2B1EA 3JSJA 4HKUA 1RKTA 4MXMA 3ZQFA 4M3BA 2FJI1 1JTYA 5CXIA 2G3BA 4L62A 2QWTA 3VW1A 5HAWA 3LOCA 2GUHA 4UDSA 2OPTA 2UXUA 3BR0A 3QPLA 4NELA 2DG8A 2OERA 3VW2A 2ZCXA 3RD3A 3BTLA 2D6YA 2ID6A 2GENA 2QOPA 3LSRA 4JYKA 2REKA 3QPSA 3LJLA 5IOZA 2RHAA 4W97A 2UXHA 5K7HA 1JTXA 3NPIA 1SGMA 4M3GA 5FKMA 2RAEA 2HXOA 2QIBA 4AC0A 2QKOA 3KKDA 2Y2ZA 4ME9A 2PZ9A 3G56A 5CXGA 4B3AA 5CW8A 2JK3A 3COLA 4U9NA 5FKKA 3QBMA 4CGRA 2VKVA 3NS4A 4GFKA 3G1OA 3P9TA 1JUPA 2IU5A 1UI5A 3V6GA 3MNLA 2G7SA 2NX4A 5FGLA 1RPWA 4W1UA 3DU6A 5FKNA 3PPBA 5EZHA 3CCYA 3LSJA 3Q0WA 3VOKA 5AQCA 2XPUA 5CQGA 1UI6A 3CRJA 3BQYA 3FRQA 3EUPA 3VTIA 2XGDA 2ZOYA 3AQSA 2UXPA 4GCTA 3RH2A 5K7ZA 3BRUA 2B3WA 2TRTA 5J1UA 3FIWA 3BR3A 3ZQGA 4D7MA 2FJ1A 3IH2A 5FKOA 4M3DA 4U9LA 2DG7A 2JJ7A 3CDLA 4GCLA 4V2GA 3BHQA 3ON2A 2GBYA 4MK6A 5DAJA 3ANPA 3VVZA 1QVUA 4I6ZA
chains in the Genus database with same CATH topology
5J1YA 1JT6A 4KWAA 4X1EA 4YZEA 5F0HA 5H9TA 2HQ5A 2X6OA 3AQTA 5FHPA 1Z77A 4ICHA 2QCOA 3LWJA 3ZQHA 2GFNA 4M3FA 4D7NA 3WHBA 5IPAA 3PASA 3F1BA 1RKWA 3E7QA 3HE0A 4GFLA 4M3EA 2HXIA 2PBXA 4JKZA 3BR2A 3BCGA 2Y30A 5FKLA 3CJDA 2HYTA 2XPWA 3IH4A 5J3LA 2XGCA 2ID3A 3HGYA 3SDGA 1QVTA 2O7TA 3G1MA 5F08A 2XPVA 3O8HA 2X9DA 5IOYA 3TP0A 3ON4A 5EFYA 5GP9A 3Q0VA 5D1RA 5J1RA 2TCTA 5GPCA 3FK7A 2HYJA 2QTQA 5D18A 2F07A 2VKEA 1JUMA 4PXIA 3ZQLA 5F27A 2UXIA 2VPRA 2V57A 2NP3A 2DTZA 4V2FA 1ZKGA 4MO7A 2NP5A 3B81A 3NXCA 5D19A 5FMPA 4I76A 4G12A 1U9NA 3LHQA 2ZCMA 3KKCA 3HTJA 3NNRA 4ACIA 3NI7A 3S5RA 4D5CA 3VOXA 2Y31A 4AF5A 3VVXA 3VUQA 3SFIA 1JT0A 3Q0UA 3T6NA 3VIBA 3TP3A 3EGQA 1VI0A 3F0CA 3DEWA 3BTJA 3PM1A 3IUVA 2FBQA 2ZOZA 2NS8A 3VVYA 3BQZA 2G7LA 4B1RA 2FD5A 3QKXA 3HTIA 2RASA 4JL3A 2W53A 2YVEA 2NS7A 4ABZA 3MVPA 3B6CA 5EYRA 3O8GA 4AUXA 2ZB9A 5GPAA 2O7OA 5F0FA 5IP6A 1Z0XA 3BR5A 5F1JA 2FQ4A 3BTCA 2XRLA 3HTHA 3FK6A 4NN1A 3GEUA 2XB5A 5C4YA 3G1LA 4GCKA 3ANGA 3VW0A 2FX0A 3DPJA 1ZK8A 2IEKA 3G7RA 3VPRA 5K7FA 3ZQIA 1T33A 2XDNA 2ZCNA 5F04A 2I10A 2WV1A 3IH3A 1QPIA 5HBUA 5K58A 2G7GA 2IBDA 3KNWA 4D5FA 2WUIA 1ORKA 3HGGA 2OF7A 2G0EA 2HKUA 3B6AA 3GZIA 3CWRA 1U9OA 1BJZA 3DCFA 1A6IA 3KZ9A 3HTAA 3V78A 3VP5A 3BJBA 2WGBA 3O60A 3Q3SA 5HSZA 3C2BA 2XGEA 3BR1A 4XK4A 4AC6A 2IAIA 3BNIA 3HIMA 3QQAA 2YVHA 1JUSA 3NRGA 3BTIA 4JNNA 3WHCA 3C07A 2UXOA 2OI8A 2EH3A 2Q24A 4DW6A 3LSPA 3BT9A 5F0CA 3BR6A 5EZGA 1T56A 3JSJA 4HKUA 1RKTA 4MXMA 3ZQFA 4M3BA 1JTYA 5CXIA 2G3BA 4L62A 2QWTA 3VW1A 5HAWA 3LOCA 2GUHA 4UDSA 2OPTA 2UXUA 3BR0A 3QPLA 4NELA 2DG8A 2OERA 3VW2A 2ZCXA 3RD3A 3BTLA 2D6YA 2ID6A 2GENA 2QOPA 3LSRA 4JYKA 2REKA 3QPSA 3LJLA 5IOZA 2RHAA 4W97A 2UXHA 5K7HA 1JTXA 3NPIA 1SGMA 4M3GA 5FKMA 2RAEA 2HXOA 2QIBA 4AC0A 2QKOA 3KKDA 2Y2ZA 4ME9A 2PZ9A 3G56A 5CXGA 4B3AA 5CW8A 2JK3A 3COLA 5FKKA 3QBMA 4CGRA 2VKVA 4GFKA 3G1OA 3P9TA 1JUPA 2IU5A 1UI5A 3V6GA 3MNLA 2G7SA 2NX4A 5FGLA 1RPWA 4W1UA 5FKNA 3PPBA 5EZHA 3CCYA 3LSJA 3Q0WA 3VOKA 5AQCA 2XPUA 1UI6A 3CRJA 3BQYA 3FRQA 3EUPA 2XGDA 2ZOYA 3AQSA 2UXPA 4GCTA 3RH2A 5K7ZA 3BRUA 2TRTA 5J1UA 3FIWA 3BR3A 3ZQGA 4D7MA 2FJ1A 3IH2A 5FKOA 4M3DA 2DG7A 2JJ7A 3CDLA 4GCLA 4V2GA 3BHQA 3ON2A 2GBYA 4MK6A 5DAJA 3ANPA 3VVZA 1QVUA 4I6ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J1Y A;  1JT6 A;  4KWA A;  4X1E A;  4YZE A;  5F0H A;  5H9T A;  2HQ5 A;  2X6O A;  3AQT A;  5FHP A;  1Z77 A;  4ICH A;  2QCO A;  3LWJ A;  3ZQH A;  2GFN A;  4M3F A;  4D7N A;  3WHB A;  5IPA A;  3PAS A;  3F1B A;  1RKW A;  3E7Q A;  3HE0 A;  4GFL A;  4M3E A;  2HXI A;  2PBX A;  4JKZ A;  3BR2 A;  3BCG A;  2Y30 A;  5FKL A;  3CJD A;  2HYT A;  2XPW A;  3IH4 A;  5J3L A;  2XGC A;  2ID3 A;  3HGY A;  3SDG A;  1QVT A;  2O7T A;  3G1M A;  5F08 A;  2XPV A;  3O8H A;  2X9D A;  5IOY A;  3TP0 A;  3ON4 A;  5EFY A;  5GP9 A;  3Q0V A;  5D1R A;  5J1R A;  2TCT A;  5GPC A;  3FK7 A;  2HYJ A;  2QTQ A;  5D18 A;  2F07 A;  2VKE A;  1JUM A;  4PXI A;  3ZQL A;  5F27 A;  2UXI A;  2VPR A;  2V57 A;  2NP3 A;  2DTZ A;  4V2F A;  1ZKG A;  4MO7 A;  2NP5 A;  3B81 A;  3NXC A;  5D19 A;  5FMP A;  4I76 A;  4G12 A;  1U9N A;  3LHQ A;  2ZCM A;  3KKC A;  3HTJ A;  3NNR A;  4ACI A;  3NI7 A;  3S5R A;  4D5C A;  3VOX A;  2Y31 A;  4AF5 A;  3VVX A;  3VUQ A;  3SFI A;  1JT0 A;  3Q0U A;  3T6N A;  3VIB A;  3TP3 A;  3EGQ A;  1VI0 A;  3F0C A;  3DEW A;  3BTJ A;  3PM1 A;  3IUV A;  2FBQ A;  2ZOZ A;  2NS8 A;  3VVY A;  3BQZ A;  2G7L A;  4B1R A;  2FD5 A;  3QKX A;  3HTI A;  2RAS A;  4JL3 A;  2W53 A;  2YVE A;  2NS7 A;  4ABZ A;  3MVP A;  3B6C A;  5EYR A;  3O8G A;  4AUX A;  2ZB9 A;  5GPA A;  2O7O A;  5F0F A;  5IP6 A;  1Z0X A;  3BR5 A;  5F1J A;  2FQ4 A;  3BTC A;  2XRL A;  3HTH A;  3FK6 A;  4NN1 A;  3GEU A;  2XB5 A;  5C4Y A;  3G1L A;  4GCK A;  3ANG A;  3VW0 A;  2FX0 A;  3DPJ A;  1ZK8 A;  2IEK A;  3G7R A;  3VPR A;  5K7F A;  3ZQI A;  1T33 A;  2XDN A;  2ZCN A;  5F04 A;  2I10 A;  2WV1 A;  3IH3 A;  1QPI A;  5HBU A;  5K58 A;  2G7G A;  2IBD A;  3KNW A;  4D5F A;  2WUI A;  1ORK A;  3HGG A;  2OF7 A;  2G0E A;  2HKU A;  3B6A A;  3GZI A;  3CWR A;  1U9O A;  1BJZ A;  3DCF A;  1A6I A;  3KZ9 A;  3HTA A;  3V78 A;  3VP5 A;  3BJB A;  2WGB A;  3O60 A;  3Q3S A;  5HSZ A;  3C2B A;  2XGE A;  3BR1 A;  4XK4 A;  4AC6 A;  2IAI A;  3BNI A;  3HIM A;  3QQA A;  2YVH A;  1JUS A;  3NRG A;  3BTI A;  4JNN A;  3WHC A;  3C07 A;  2UXO A;  2OI8 A;  2EH3 A;  2Q24 A;  4DW6 A;  3LSP A;  3BT9 A;  5F0C A;  3BR6 A;  5EZG A;  1T56 A;  3JSJ A;  4HKU A;  1RKT A;  4MXM A;  3ZQF A;  4M3B A;  1JTY A;  5CXI A;  2G3B A;  4L62 A;  2QWT A;  3VW1 A;  5HAW A;  3LOC A;  2GUH A;  4UDS A;  2OPT A;  2UXU A;  3BR0 A;  3QPL A;  4NEL A;  2DG8 A;  2OER A;  3VW2 A;  2ZCX A;  3RD3 A;  3BTL A;  2D6Y A;  2ID6 A;  2GEN A;  2QOP A;  3LSR A;  4JYK A;  2REK A;  3QPS A;  3LJL A;  5IOZ A;  2RHA A;  4W97 A;  2UXH A;  5K7H A;  1JTX A;  3NPI A;  1SGM A;  4M3G A;  5FKM A;  2RAE A;  2HXO A;  2QIB A;  4AC0 A;  2QKO A;  3KKD A;  2Y2Z A;  4ME9 A;  2PZ9 A;  3G56 A;  5CXG A;  4B3A A;  5CW8 A;  2JK3 A;  3COL A;  5FKK A;  3QBM A;  4CGR A;  2VKV A;  4GFK A;  3G1O A;  3P9T A;  1JUP A;  2IU5 A;  1UI5 A;  3V6G A;  3MNL A;  2G7S A;  2NX4 A;  5FGL A;  1RPW A;  4W1U A;  5FKN A;  3PPB A;  5EZH A;  3CCY A;  3LSJ A;  3Q0W A;  3VOK A;  5AQC A;  2XPU A;  1UI6 A;  3CRJ A;  3BQY A;  3FRQ A;  3EUP A;  2XGD A;  2ZOY A;  3AQS A;  2UXP A;  4GCT A;  3RH2 A;  5K7Z A;  3BRU A;  2TRT A;  5J1U A;  3FIW A;  3BR3 A;  3ZQG A;  4D7M A;  2FJ1 A;  3IH2 A;  5FKO A;  4M3D A;  2DG7 A;  2JJ7 A;  3CDL A;  4GCL A;  4V2G A;  3BHQ A;  3ON2 A;  2GBY A;  4MK6 A;  5DAJ A;  3ANP A;  3VVZ A;  1QVU A;  4I6Z A; 
#chains in the Genus database with same CATH topology
 5J1Y A;  1JT6 A;  4KWA A;  4X1E A;  4YZE A;  5F0H A;  5H9T A;  2HQ5 A;  2X6O A;  3AQT A;  5FHP A;  1Z77 A;  4ICH A;  2QCO A;  3LWJ A;  3ZQH A;  2GFN A;  4M3F A;  4D7N A;  3WHB A;  5IPA A;  3PAS A;  2PFV A;  3F1B A;  1RKW A;  3E7Q A;  3HE0 A;  4GFL A;  4M3E A;  2HXI A;  2PBX A;  4DVY P;  4JKZ A;  3BR2 A;  3SWH A;  3BCG A;  2Y30 A;  5FKL A;  3CJD A;  2HYT A;  2XPW A;  3IH4 A;  5J3L A;  2XGC A;  2R7X A;  2ID3 A;  3HGY A;  3SDG A;  1QVT A;  2O7T A;  3G1M A;  5F08 A;  2XPV A;  3K8P C;  3O8H A;  2X9D A;  5IOY A;  3TP0 A;  3ON4 A;  5EFY A;  5GP9 A;  3Q0V A;  5D1R A;  5J1R A;  2TCT A;  2R7R A;  5GPC A;  3FK7 A;  2HYJ A;  2QTQ A;  5D18 A;  2F07 A;  2VKE A;  1JUM A;  4PXI A;  2R7S A;  3ZQL A;  5F27 A;  2UXI A;  2VPR A;  2V57 A;  2NP3 A;  2DTZ A;  4V2F A;  1ZKG A;  4MO7 A;  2NP5 A;  3B81 A;  3NXC A;  5D19 A;  5FMP A;  4I76 A;  4G12 A;  1U9N A;  3LHQ A;  2ZCM A;  3KKC A;  3HTJ A;  3NNR A;  4ACI A;  3NI7 A;  3S5R A;  4D5C A;  3VOX A;  2Y31 A;  4AF5 A;  3VVX A;  3VUQ A;  3SFI A;  1JT0 A;  3FHN A;  3Q0U A;  3T6N A;  3VIB A;  3TP3 A;  3EGQ A;  1VI0 A;  3F0C A;  3DEW A;  3BTJ A;  3PM1 A;  3IUV A;  2FBQ A;  2ZOZ A;  4OD4 A;  2NS8 A;  3VVY A;  3BQZ A;  2G7L A;  4B1R A;  2FD5 A;  3QKX A;  3HTI A;  2RAS A;  3DU5 A;  4JL3 A;  2W53 A;  2YVE A;  2NS7 A;  4ABZ A;  3MVP A;  3B6C A;  5EYR A;  2R7Q A;  3O8G A;  4AUX A;  2ZB9 A;  4C2M A;  5GPA A;  2O7O A;  5F0F A;  5IP6 A;  1Z0X A;  3BR5 A;  5F1J A;  2FQ4 A;  3BTC A;  2XRL A;  3HTH A;  3FK6 A;  4NN1 A;  3GEU A;  2XB5 A;  5C4Y A;  3G1L A;  4GCK A;  3ANG A;  3VW0 A;  2FX0 A;  3DPJ A;  1ZK8 A;  2IEK A;  3G7R A;  3VPR A;  5K7F A;  3ZQI A;  1T33 A;  2XDN A;  2ZCN A;  5F04 A;  2R7O A;  2R7W A;  2I10 A;  2WV1 A;  3IH3 A;  1QPI A;  5HBU A;  2R7T A;  5K58 A;  2G7G A;  2IBD A;  3KNW A;  4D5F A;  2WUI A;  1ORK A;  3HGG A;  2OF7 A;  2G0E A;  2HKU A;  3B6A A;  3GZI A;  3CWR A;  1U9O A;  1BJZ A;  3DCF A;  1A6I A;  2A2F X;  3KZ9 A;  3HTA A;  3V78 A;  2YVX A;  3VP5 A;  4IRV A;  2R7V A;  3BJB A;  2WGB A;  3O60 A;  3Q3S A;  4OD5 A;  5HSZ A;  3C2B A;  2XGE A;  2ZY9 A;  3BR1 A;  4XK4 A;  4AC6 A;  2IAI A;  3BNI A;  3HIM A;  3QQA A;  2YVH A;  1JUS A;  3NRG A;  3BTI A;  4JNN A;  3WHC A;  3C07 A;  2UXO A;  2OI8 A;  2EH3 A;  2Q24 A;  4DW6 A;  3KYL A;  3LSP A;  3BT9 A;  5F0C A;  3BR6 A;  2R7U A;  5EZG A;  4WIB A;  1T56 A;  2B1E A;  3JSJ A;  4HKU A;  1RKT A;  4MXM A;  3ZQF A;  4M3B A;  2FJI 1;  1JTY A;  5CXI A;  2G3B A;  4L62 A;  2QWT A;  3VW1 A;  5HAW A;  3LOC A;  2GUH A;  4UDS A;  2OPT A;  2UXU A;  3BR0 A;  3QPL A;  4NEL A;  2DG8 A;  2OER A;  3VW2 A;  2ZCX A;  3RD3 A;  3BTL A;  2D6Y A;  2ID6 A;  2GEN A;  2QOP A;  3LSR A;  4JYK A;  2REK A;  3QPS A;  3LJL A;  5IOZ A;  2RHA A;  4W97 A;  2UXH A;  5K7H A;  1JTX A;  3NPI A;  1SGM A;  4M3G A;  5FKM A;  2RAE A;  2HXO A;  2QIB A;  4AC0 A;  2QKO A;  3KKD A;  2Y2Z A;  4ME9 A;  2PZ9 A;  3G56 A;  5CXG A;  4B3A A;  5CW8 A;  2JK3 A;  3COL A;  4U9N A;  5FKK A;  3QBM A;  4CGR A;  2VKV A;  3NS4 A;  4GFK A;  3G1O A;  3P9T A;  1JUP A;  2IU5 A;  1UI5 A;  3V6G A;  3MNL A;  2G7S A;  2NX4 A;  5FGL A;  1RPW A;  4W1U A;  3DU6 A;  5FKN A;  3PPB A;  5EZH A;  3CCY A;  3LSJ A;  3Q0W A;  3VOK A;  5AQC A;  2XPU A;  5CQG A;  1UI6 A;  3CRJ A;  3BQY A;  3FRQ A;  3EUP A;  3VTI A;  2XGD A;  2ZOY A;  3AQS A;  2UXP A;  4GCT A;  3RH2 A;  5K7Z A;  3BRU A;  2B3W A;  2TRT A;  5J1U A;  3FIW A;  3BR3 A;  3ZQG A;  4D7M A;  2FJ1 A;  3IH2 A;  5FKO A;  4M3D A;  4U9L A;  2DG7 A;  2JJ7 A;  3CDL A;  4GCL A;  4V2G A;  3BHQ A;  3ON2 A;  2GBY A;  4MK6 A;  5DAJ A;  3ANP A;  3VVZ A;  1QVU A;  4I6Z A; 
#chains in the Genus database with same CATH homology
 5J1Y A;  1JT6 A;  4KWA A;  4X1E A;  4YZE A;  5F0H A;  5H9T A;  2HQ5 A;  2X6O A;  3AQT A;  5FHP A;  1Z77 A;  4ICH A;  2QCO A;  3LWJ A;  3ZQH A;  2GFN A;  4M3F A;  4D7N A;  3WHB A;  5IPA A;  3PAS A;  3F1B A;  1RKW A;  3E7Q A;  3HE0 A;  4GFL A;  4M3E A;  2HXI A;  2PBX A;  4JKZ A;  3BR2 A;  3BCG A;  2Y30 A;  5FKL A;  3CJD A;  2HYT A;  2XPW A;  3IH4 A;  5J3L A;  2XGC A;  2ID3 A;  3HGY A;  3SDG A;  1QVT A;  2O7T A;  3G1M A;  5F08 A;  2XPV A;  3O8H A;  2X9D A;  5IOY A;  3TP0 A;  3ON4 A;  5EFY A;  5GP9 A;  3Q0V A;  5D1R A;  5J1R A;  2TCT A;  5GPC A;  3FK7 A;  2HYJ A;  2QTQ A;  5D18 A;  2F07 A;  2VKE A;  1JUM A;  4PXI A;  3ZQL A;  5F27 A;  2UXI A;  2VPR A;  2V57 A;  2NP3 A;  2DTZ A;  4V2F A;  1ZKG A;  4MO7 A;  2NP5 A;  3B81 A;  3NXC A;  5D19 A;  5FMP A;  4I76 A;  4G12 A;  1U9N A;  3LHQ A;  2ZCM A;  3KKC A;  3HTJ A;  3NNR A;  4ACI A;  3NI7 A;  3S5R A;  4D5C A;  3VOX A;  2Y31 A;  4AF5 A;  3VVX A;  3VUQ A;  3SFI A;  1JT0 A;  3Q0U A;  3T6N A;  3VIB A;  3TP3 A;  3EGQ A;  1VI0 A;  3F0C A;  3DEW A;  3BTJ A;  3PM1 A;  3IUV A;  2FBQ A;  2ZOZ A;  2NS8 A;  3VVY A;  3BQZ A;  2G7L A;  4B1R A;  2FD5 A;  3QKX A;  3HTI A;  2RAS A;  4JL3 A;  2W53 A;  2YVE A;  2NS7 A;  4ABZ A;  3MVP A;  3B6C A;  5EYR A;  3O8G A;  4AUX A;  2ZB9 A;  5GPA A;  2O7O A;  5F0F A;  5IP6 A;  1Z0X A;  3BR5 A;  5F1J A;  2FQ4 A;  3BTC A;  2XRL A;  3HTH A;  3FK6 A;  4NN1 A;  3GEU A;  2XB5 A;  5C4Y A;  3G1L A;  4GCK A;  3ANG A;  3VW0 A;  2FX0 A;  3DPJ A;  1ZK8 A;  2IEK A;  3G7R A;  3VPR A;  5K7F A;  3ZQI A;  1T33 A;  2XDN A;  2ZCN A;  5F04 A;  2I10 A;  2WV1 A;  3IH3 A;  1QPI A;  5HBU A;  5K58 A;  2G7G A;  2IBD A;  3KNW A;  4D5F A;  2WUI A;  1ORK A;  3HGG A;  2OF7 A;  2G0E A;  2HKU A;  3B6A A;  3GZI A;  3CWR A;  1U9O A;  1BJZ A;  3DCF A;  1A6I A;  3KZ9 A;  3HTA A;  3V78 A;  3VP5 A;  3BJB A;  2WGB A;  3O60 A;  3Q3S A;  5HSZ A;  3C2B A;  2XGE A;  3BR1 A;  4XK4 A;  4AC6 A;  2IAI A;  3BNI A;  3HIM A;  3QQA A;  2YVH A;  1JUS A;  3NRG A;  3BTI A;  4JNN A;  3WHC A;  3C07 A;  2UXO A;  2OI8 A;  2EH3 A;  2Q24 A;  4DW6 A;  3LSP A;  3BT9 A;  5F0C A;  3BR6 A;  5EZG A;  1T56 A;  3JSJ A;  4HKU A;  1RKT A;  4MXM A;  3ZQF A;  4M3B A;  1JTY A;  5CXI A;  2G3B A;  4L62 A;  2QWT A;  3VW1 A;  5HAW A;  3LOC A;  2GUH A;  4UDS A;  2OPT A;  2UXU A;  3BR0 A;  3QPL A;  4NEL A;  2DG8 A;  2OER A;  3VW2 A;  2ZCX A;  3RD3 A;  3BTL A;  2D6Y A;  2ID6 A;  2GEN A;  2QOP A;  3LSR A;  4JYK A;  2REK A;  3QPS A;  3LJL A;  5IOZ A;  2RHA A;  4W97 A;  2UXH A;  5K7H A;  1JTX A;  3NPI A;  1SGM A;  4M3G A;  5FKM A;  2RAE A;  2HXO A;  2QIB A;  4AC0 A;  2QKO A;  3KKD A;  2Y2Z A;  4ME9 A;  2PZ9 A;  3G56 A;  5CXG A;  4B3A A;  5CW8 A;  2JK3 A;  3COL A;  5FKK A;  3QBM A;  4CGR A;  2VKV A;  4GFK A;  3G1O A;  3P9T A;  1JUP A;  2IU5 A;  1UI5 A;  3V6G A;  3MNL A;  2G7S A;  2NX4 A;  5FGL A;  1RPW A;  4W1U A;  5FKN A;  3PPB A;  5EZH A;  3CCY A;  3LSJ A;  3Q0W A;  3VOK A;  5AQC A;  2XPU A;  1UI6 A;  3CRJ A;  3BQY A;  3FRQ A;  3EUP A;  2XGD A;  2ZOY A;  3AQS A;  2UXP A;  4GCT A;  3RH2 A;  5K7Z A;  3BRU A;  2TRT A;  5J1U A;  3FIW A;  3BR3 A;  3ZQG A;  4D7M A;  2FJ1 A;  3IH2 A;  5FKO A;  4M3D A;  2DG7 A;  2JJ7 A;  3CDL A;  4GCL A;  4V2G A;  3BHQ A;  3ON2 A;  2GBY A;  4MK6 A;  5DAJ A;  3ANP A;  3VVZ A;  1QVU A;  4I6Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...