4AF5A

Structure of the c. glutamicum acnr crystal form i
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
174
structure length
173
Chain Sequence
RQEILEGARRCFAEHGYEGATVRRLEEATGKSRGAIFHHFGDKENLFLALAREDAARMAEVVENGLVEVMRGMLEDPERYDWMSVRLEISKQLRTDPVFRAKWIDHQSVLDEAVRVRLSRNVDKGQMRTDVPIEVLHTFLETVLDGFISRLATGASTEGLSEVLDLVEGTVRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal and Solution Studies Reveal that the Transcriptional Regulator Acnr of Corynebacterium Glutamicum is Regulated by Citrate:Mg2+ Binding to a Non-Canonical Pocket.
pubmed doi rcsb
source organism Corynebacterium glutamicum
molecule tags Transcription
molecule keywords HTH-TYPE TRANSCRIPTIONAL REPRESSOR ACNR COMPND 2
total genus 74
structure length 173
sequence length 174
ec nomenclature
pdb deposition date 2012-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 4af5A00
3ZQIA 2QCOA 1RKWA 3LSJA 4M3GA 3JSJA 2Y2ZA 3CDLA 3IH4A 4B3AA 2FQ4A 2PBXA 2HXOA 3VPRA 3FK6A 2UXPA 2G7LA 2VKEA 1RKTA 3DEWA 2WUIA 3P9TA 3RH2A 1T56A 3QQAA 2GENA 3NRGA 3ZQGA 1U9NA 2G3BA 3EUPA 2OI8A 3HTAA 4YZEA 5EZHA 5FMPA 2OPTA 2XRLA 5H9TA 1Z77A 3S5RA 5F04A 2FD5A 3VOXA 3KKDA 4MXMA 2NP3A 3SFIA 4AC0A 3BR5A 2HYJA 4L62A 4V2FA 5D19A 3QPLA 4W97A 4KWAA 3BR3A 2XGEA 3CJDA 4HKUA 4B1RA 5FKLA 4MO7A 3BCGA 3F1BA 4M3EA 2DTZA 5F0FA 3VP5A 1ZKGA 2QKOA 1JTYA 3FRQA 3ON2A 2ID3A 3LJLA 5FKNA 3C07A 3QBMA 2Y30A 2QTQA 1VI0A 3B6CA 5HSZA 5J1RA 5GPAA 4W1UA 2YVHA 5CW8A 3AQSA 3ZQHA 4AUXA 3HGYA 1QPIA 2OERA 4ME9A 3SDGA 2PZ9A 5J3LA 3B81A 2XPVA 5HBUA 3BTCA 3CRJA 2FX0A 3O8GA 3ON4A 4D7NA 4ABZA 3DCFA 4D5CA 5IP6A 3VW1A 2X6OA 1U9OA 3PASA 4I76A 2HKUA 3GZIA 4GFKA 3LSRA 5J1UA 3T6NA 2NS7A 3BJBA 1UI6A 2FBQA 4UDSA 2WGBA 5K7ZA 2HYTA 3HE0A 1UI5A 4NN1A 3KKCA 5CXGA 2YVEA 2G7SA 5CXIA 2XDNA 3BQZA 2ID6A 1QVUA 2W53A 3BT9A 3O8HA 4ACIA 2NP5A 5GP9A 5IPAA 3WHBA 5HAWA 3BR0A 2IBDA 2IU5A 2UXIA 2TCTA 2HXIA 5AQCA 4NELA 5K58A 3G1LA 3NNRA 2O7TA 2REKA 3C2BA 2ZOYA 2G0EA 3BQYA 2UXHA 1RPWA 2VKVA 3VIBA 5F0HA 2XGDA 2XPWA 3BRUA 1A6IA 2GUHA 2QWTA 5F08A 1QVTA 3HTIA 4GCLA 2XPUA 2JJ7A 3ANPA 3BR1A 3MVPA 2Q24A 2XB5A 3B6AA 4DW6A 3NPIA 2HQ5A 3IH2A 2UXUA 3LWJA 2JK3A 3WHCA 1T33A 3VOKA 2V57A 3DPJA 2ZCXA 3EGQA 4D7MA 2TRTA 5FHPA 3VUQA 2RHAA 4ICHA 4CGRA 5F27A 1SGMA 1JTXA 4D5FA 2GFNA 4M3FA 3BTIA 3G1MA 2ZCNA 3TP0A 3IH3A 4JYKA 4GCKA 3FIWA 2ZB9A 4X1EA 4GCTA 2O7OA 3VVZA 1JT0A 5FKMA 3ZQLA 4JL3A 2DG7A 5DAJA 3CCYA 2RAEA 1JT6A 4JNNA 3Q0VA 5EYRA 1JUSA 2UXOA 3IUVA 3ANGA 4GFLA 5D18A 2VPRA 1ZK8A 3LOCA 2GBYA 3BTJA 5FKKA 3VVYA 3V6GA 4JKZA 3AQTA 3G1OA 3E7QA 3PPBA 2OF7A 3BR6A 4M3BA 4PXIA 5K7HA 3LSPA 5IOZA 4V2GA 3VVXA 4M3DA 3BHQA 4I6ZA 3NXCA 3HGGA 3PM1A 5C4YA 2QOPA 2FJ1A 2Y31A 3LHQA 3F0CA 1ORKA 3VW2A 3VW0A 3HTHA 3QKXA 4AC6A 3Q0WA 1JUMA 5J1YA 3ZQFA 2ZCMA 5GPCA 2DG8A 5FGLA 2X9DA 5EFYA 2NS8A 1Z0XA 3FK7A 2IAIA 3GEUA 4MK6A 2WV1A 2EH3A 3O60A 3Q3SA 5K7FA 5F0CA 1BJZA 5IOYA 3HIMA 5FKOA 3BNIA 3MNLA 4G12A 3KNWA 4XK4A 2IEKA 4AF5A 3V78A 2D6YA 2ZOZA 3QPSA 3G56A 2NX4A 5F1JA 3KZ9A 3TP3A 3BR2A 2RASA 3RD3A 1JUPA 2XGCA 3BTLA 2F07A 5EZGA 2I10A 2QIBA 3NI7A 3HTJA 3G7RA 2G7GA 5D1RA 3COLA 3CWRA 3Q0UA
chains in the Genus database with same CATH superfamily
4OD5A 3ZQIA 2QCOA 1RKWA 3LSJA 4M3GA 3JSJA 2Y2ZA 3CDLA 3IH4A 2ZY9A 4B3AA 2FQ4A 2PBXA 2HXOA 3VPRA 3FK6A 2UXPA 2G7LA 3NS4A 2VKEA 2YVXA 1RKTA 3DEWA 2WUIA 3P9TA 3RH2A 1T56A 3QQAA 2GENA 3NRGA 3ZQGA 1U9NA 2G3BA 3EUPA 2OI8A 3HTAA 4YZEA 5EZHA 2PFVA 5FMPA 2OPTA 2XRLA 5H9TA 1Z77A 3S5RA 5F04A 2FD5A 3VOXA 3KKDA 4MXMA 2NP3A 3SFIA 4AC0A 3BR5A 2HYJA 4L62A 4V2FA 5D19A 3QPLA 4W97A 4KWAA 3BR3A 2XGEA 3CJDA 4HKUA 4B1RA 5FKLA 4MO7A 3BCGA 3F1BA 4IRVA 4M3EA 2DTZA 5F0FA 3VP5A 1ZKGA 2QKOA 4WIBA 1JTYA 3FRQA 3ON2A 2ID3A 3LJLA 5FKNA 3C07A 3QBMA 2Y30A 2QTQA 1VI0A 3B6CA 5HSZA 5J1RA 5GPAA 4W1UA 2YVHA 3DU6A 5CW8A 3AQSA 3ZQHA 4AUXA 3HGYA 2R7RA 1QPIA 2OERA 4ME9A 2R7TA 3SDGA 2R7QA 2PZ9A 5J3LA 3B81A 2XPVA 5HBUA 3BTCA 3CRJA 2FX0A 2B3WA 3DU5A 3O8GA 3ON4A 4D7NA 4ABZA 3DCFA 4D5CA 5IP6A 3VW1A 2X6OA 1U9OA 3PASA 4I76A 2HKUA 3GZIA 4GFKA 3LSRA 2A2FX 5J1UA 3T6NA 2NS7A 3BJBA 1UI6A 2FBQA 4UDSA 2WGBA 5K7ZA 3SWHA 2HYTA 3HE0A 1UI5A 4NN1A 3KKCA 5CXGA 2YVEA 2G7SA 5CXIA 2XDNA 3BQZA 2ID6A 1QVUA 2W53A 3BT9A 3O8HA 4ACIA 2NP5A 5GP9A 5IPAA 3WHBA 5HAWA 3BR0A 2IBDA 4U9LA 2IU5A 2UXIA 2TCTA 2HXIA 5AQCA 5CQGA 4NELA 5K58A 3G1LA 3NNRA 2O7TA 2R7UA 2REKA 3C2BA 4U9NA 2ZOYA 2G0EA 3BQYA 2UXHA 1RPWA 2VKVA 2R7OA 3VIBA 5F0HA 2XGDA 2XPWA 3BRUA 1A6IA 2GUHA 2QWTA 5F08A 1QVTA 3HTIA 4GCLA 2XPUA 2JJ7A 3ANPA 3BR1A 3MVPA 2Q24A 2XB5A 3B6AA 4DW6A 3NPIA 2HQ5A 3IH2A 2R7XA 2UXUA 3LWJA 2JK3A 3WHCA 1T33A 3VOKA 2V57A 3DPJA 2ZCXA 3EGQA 4D7MA 2TRTA 5FHPA 3VUQA 2RHAA 4ICHA 4CGRA 5F27A 1SGMA 1JTXA 4D5FA 2GFNA 4M3FA 3BTIA 2R7SA 3G1MA 2ZCNA 3TP0A 3IH3A 4JYKA 4GCKA 3FIWA 2ZB9A 4X1EA 3VTIA 4GCTA 2O7OA 3VVZA 1JT0A 5FKMA 3ZQLA 4JL3A 2DG7A 5DAJA 3CCYA 2RAEA 1JT6A 4JNNA 3Q0VA 3KYLA 5EYRA 1JUSA 2UXOA 3IUVA 3ANGA 4GFLA 5D18A 2VPRA 1ZK8A 3LOCA 2GBYA 2R7VA 3BTJA 5FKKA 3VVYA 3V6GA 4JKZA 3AQTA 3G1OA 3E7QA 3PPBA 2OF7A 3BR6A 4M3BA 4PXIA 5K7HA 3LSPA 4DVYP 5IOZA 4V2GA 3VVXA 4M3DA 3BHQA 4I6ZA 3NXCA 3HGGA 3PM1A 5C4YA 2QOPA 2FJ1A 2Y31A 3LHQA 3F0CA 1ORKA 3VW2A 3VW0A 3HTHA 3QKXA 4AC6A 3Q0WA 1JUMA 5J1YA 3ZQFA 2ZCMA 5GPCA 2DG8A 5FGLA 2X9DA 5EFYA 2NS8A 1Z0XA 3FK7A 2IAIA 3GEUA 4MK6A 2WV1A 3K8PC 2EH3A 3O60A 4OD4A 3Q3SA 5K7FA 5F0CA 1BJZA 5IOYA 3HIMA 5FKOA 3BNIA 2FJI1 4C2MA 3MNLA 4G12A 3KNWA 2B1EA 4XK4A 2IEKA 4AF5A 3V78A 2D6YA 2ZOZA 3QPSA 3G56A 2NX4A 5F1JA 3KZ9A 3TP3A 3BR2A 2RASA 3RD3A 1JUPA 2XGCA 3BTLA 2F07A 5EZGA 2I10A 2QIBA 3NI7A 3HTJA 3G7RA 2G7GA 5D1RA 2R7WA 3COLA 3CWRA 3FHNA 3Q0UA
chains in the Genus database with same CATH topology
3ZQIA 2QCOA 1RKWA 3LSJA 4M3GA 3JSJA 2Y2ZA 3CDLA 3IH4A 4B3AA 2FQ4A 2PBXA 2HXOA 3VPRA 3FK6A 2UXPA 2G7LA 2VKEA 1RKTA 3DEWA 2WUIA 3P9TA 3RH2A 1T56A 3QQAA 2GENA 3NRGA 3ZQGA 1U9NA 2G3BA 3EUPA 2OI8A 3HTAA 4YZEA 5EZHA 5FMPA 2OPTA 2XRLA 5H9TA 1Z77A 3S5RA 5F04A 2FD5A 3VOXA 3KKDA 4MXMA 2NP3A 3SFIA 4AC0A 3BR5A 2HYJA 4L62A 4V2FA 5D19A 3QPLA 4W97A 4KWAA 3BR3A 2XGEA 3CJDA 4HKUA 4B1RA 5FKLA 4MO7A 3BCGA 3F1BA 4M3EA 2DTZA 5F0FA 3VP5A 1ZKGA 2QKOA 1JTYA 3FRQA 3ON2A 2ID3A 3LJLA 5FKNA 3C07A 3QBMA 2Y30A 2QTQA 1VI0A 3B6CA 5HSZA 5J1RA 5GPAA 4W1UA 2YVHA 5CW8A 3AQSA 3ZQHA 4AUXA 3HGYA 1QPIA 2OERA 4ME9A 3SDGA 2PZ9A 5J3LA 3B81A 2XPVA 5HBUA 3BTCA 3CRJA 2FX0A 3O8GA 3ON4A 4D7NA 4ABZA 3DCFA 4D5CA 5IP6A 3VW1A 2X6OA 1U9OA 3PASA 4I76A 2HKUA 3GZIA 4GFKA 3LSRA 5J1UA 3T6NA 2NS7A 3BJBA 1UI6A 2FBQA 4UDSA 2WGBA 5K7ZA 2HYTA 3HE0A 1UI5A 4NN1A 3KKCA 5CXGA 2YVEA 2G7SA 5CXIA 2XDNA 3BQZA 2ID6A 1QVUA 2W53A 3BT9A 3O8HA 4ACIA 2NP5A 5GP9A 5IPAA 3WHBA 5HAWA 3BR0A 2IBDA 2IU5A 2UXIA 2TCTA 2HXIA 5AQCA 4NELA 5K58A 3G1LA 3NNRA 2O7TA 2REKA 3C2BA 2ZOYA 2G0EA 3BQYA 2UXHA 1RPWA 2VKVA 3VIBA 5F0HA 2XGDA 2XPWA 3BRUA 1A6IA 2GUHA 2QWTA 5F08A 1QVTA 3HTIA 4GCLA 2XPUA 2JJ7A 3ANPA 3BR1A 3MVPA 2Q24A 2XB5A 3B6AA 4DW6A 3NPIA 2HQ5A 3IH2A 2UXUA 3LWJA 2JK3A 3WHCA 1T33A 3VOKA 2V57A 3DPJA 2ZCXA 3EGQA 4D7MA 2TRTA 5FHPA 3VUQA 2RHAA 4ICHA 4CGRA 5F27A 1SGMA 1JTXA 4D5FA 2GFNA 4M3FA 3BTIA 3G1MA 2ZCNA 3TP0A 3IH3A 4JYKA 4GCKA 3FIWA 2ZB9A 4X1EA 4GCTA 2O7OA 3VVZA 1JT0A 5FKMA 3ZQLA 4JL3A 2DG7A 5DAJA 3CCYA 2RAEA 1JT6A 4JNNA 3Q0VA 5EYRA 1JUSA 2UXOA 3IUVA 3ANGA 4GFLA 5D18A 2VPRA 1ZK8A 3LOCA 2GBYA 3BTJA 5FKKA 3VVYA 3V6GA 4JKZA 3AQTA 3G1OA 3E7QA 3PPBA 2OF7A 3BR6A 4M3BA 4PXIA 5K7HA 3LSPA 5IOZA 4V2GA 3VVXA 4M3DA 3BHQA 4I6ZA 3NXCA 3HGGA 3PM1A 5C4YA 2QOPA 2FJ1A 2Y31A 3LHQA 3F0CA 1ORKA 3VW2A 3VW0A 3HTHA 3QKXA 4AC6A 3Q0WA 1JUMA 5J1YA 3ZQFA 2ZCMA 5GPCA 2DG8A 5FGLA 2X9DA 5EFYA 2NS8A 1Z0XA 3FK7A 2IAIA 3GEUA 4MK6A 2WV1A 2EH3A 3O60A 3Q3SA 5K7FA 5F0CA 1BJZA 5IOYA 3HIMA 5FKOA 3BNIA 3MNLA 4G12A 3KNWA 4XK4A 2IEKA 4AF5A 3V78A 2D6YA 2ZOZA 3QPSA 3G56A 2NX4A 5F1JA 3KZ9A 3TP3A 3BR2A 2RASA 3RD3A 1JUPA 2XGCA 3BTLA 2F07A 5EZGA 2I10A 2QIBA 3NI7A 3HTJA 3G7RA 2G7GA 5D1RA 3COLA 3CWRA 3Q0UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZQI A;  2QCO A;  1RKW A;  3LSJ A;  4M3G A;  3JSJ A;  2Y2Z A;  3CDL A;  3IH4 A;  4B3A A;  2FQ4 A;  2PBX A;  2HXO A;  3VPR A;  3FK6 A;  2UXP A;  2G7L A;  2VKE A;  1RKT A;  3DEW A;  2WUI A;  3P9T A;  3RH2 A;  1T56 A;  3QQA A;  2GEN A;  3NRG A;  3ZQG A;  1U9N A;  2G3B A;  3EUP A;  2OI8 A;  3HTA A;  4YZE A;  5EZH A;  5FMP A;  2OPT A;  2XRL A;  5H9T A;  1Z77 A;  3S5R A;  5F04 A;  2FD5 A;  3VOX A;  3KKD A;  4MXM A;  2NP3 A;  3SFI A;  4AC0 A;  3BR5 A;  2HYJ A;  4L62 A;  4V2F A;  5D19 A;  3QPL A;  4W97 A;  4KWA A;  3BR3 A;  2XGE A;  3CJD A;  4HKU A;  4B1R A;  5FKL A;  4MO7 A;  3BCG A;  3F1B A;  4M3E A;  2DTZ A;  5F0F A;  3VP5 A;  1ZKG A;  2QKO A;  1JTY A;  3FRQ A;  3ON2 A;  2ID3 A;  3LJL A;  5FKN A;  3C07 A;  3QBM A;  2Y30 A;  2QTQ A;  1VI0 A;  3B6C A;  5HSZ A;  5J1R A;  5GPA A;  4W1U A;  2YVH A;  5CW8 A;  3AQS A;  3ZQH A;  4AUX A;  3HGY A;  1QPI A;  2OER A;  4ME9 A;  3SDG A;  2PZ9 A;  5J3L A;  3B81 A;  2XPV A;  5HBU A;  3BTC A;  3CRJ A;  2FX0 A;  3O8G A;  3ON4 A;  4D7N A;  4ABZ A;  3DCF A;  4D5C A;  5IP6 A;  3VW1 A;  2X6O A;  1U9O A;  3PAS A;  4I76 A;  2HKU A;  3GZI A;  4GFK A;  3LSR A;  5J1U A;  3T6N A;  2NS7 A;  3BJB A;  1UI6 A;  2FBQ A;  4UDS A;  2WGB A;  5K7Z A;  2HYT A;  3HE0 A;  1UI5 A;  4NN1 A;  3KKC A;  5CXG A;  2YVE A;  2G7S A;  5CXI A;  2XDN A;  3BQZ A;  2ID6 A;  1QVU A;  2W53 A;  3BT9 A;  3O8H A;  4ACI A;  2NP5 A;  5GP9 A;  5IPA A;  3WHB A;  5HAW A;  3BR0 A;  2IBD A;  2IU5 A;  2UXI A;  2TCT A;  2HXI A;  5AQC A;  4NEL A;  5K58 A;  3G1L A;  3NNR A;  2O7T A;  2REK A;  3C2B A;  2ZOY A;  2G0E A;  3BQY A;  2UXH A;  1RPW A;  2VKV A;  3VIB A;  5F0H A;  2XGD A;  2XPW A;  3BRU A;  1A6I A;  2GUH A;  2QWT A;  5F08 A;  1QVT A;  3HTI A;  4GCL A;  2XPU A;  2JJ7 A;  3ANP A;  3BR1 A;  3MVP A;  2Q24 A;  2XB5 A;  3B6A A;  4DW6 A;  3NPI A;  2HQ5 A;  3IH2 A;  2UXU A;  3LWJ A;  2JK3 A;  3WHC A;  1T33 A;  3VOK A;  2V57 A;  3DPJ A;  2ZCX A;  3EGQ A;  4D7M A;  2TRT A;  5FHP A;  3VUQ A;  2RHA A;  4ICH A;  4CGR A;  5F27 A;  1SGM A;  1JTX A;  4D5F A;  2GFN A;  4M3F A;  3BTI A;  3G1M A;  2ZCN A;  3TP0 A;  3IH3 A;  4JYK A;  4GCK A;  3FIW A;  2ZB9 A;  4X1E A;  4GCT A;  2O7O A;  3VVZ A;  1JT0 A;  5FKM A;  3ZQL A;  4JL3 A;  2DG7 A;  5DAJ A;  3CCY A;  2RAE A;  1JT6 A;  4JNN A;  3Q0V A;  5EYR A;  1JUS A;  2UXO A;  3IUV A;  3ANG A;  4GFL A;  5D18 A;  2VPR A;  1ZK8 A;  3LOC A;  2GBY A;  3BTJ A;  5FKK A;  3VVY A;  3V6G A;  4JKZ A;  3AQT A;  3G1O A;  3E7Q A;  3PPB A;  2OF7 A;  3BR6 A;  4M3B A;  4PXI A;  5K7H A;  3LSP A;  5IOZ A;  4V2G A;  3VVX A;  4M3D A;  3BHQ A;  4I6Z A;  3NXC A;  3HGG A;  3PM1 A;  5C4Y A;  2QOP A;  2FJ1 A;  2Y31 A;  3LHQ A;  3F0C A;  1ORK A;  3VW2 A;  3VW0 A;  3HTH A;  3QKX A;  4AC6 A;  3Q0W A;  1JUM A;  5J1Y A;  3ZQF A;  2ZCM A;  5GPC A;  2DG8 A;  5FGL A;  2X9D A;  5EFY A;  2NS8 A;  1Z0X A;  3FK7 A;  2IAI A;  3GEU A;  4MK6 A;  2WV1 A;  2EH3 A;  3O60 A;  3Q3S A;  5K7F A;  5F0C A;  1BJZ A;  5IOY A;  3HIM A;  5FKO A;  3BNI A;  3MNL A;  4G12 A;  3KNW A;  4XK4 A;  2IEK A;  4AF5 A;  3V78 A;  2D6Y A;  2ZOZ A;  3QPS A;  3G56 A;  2NX4 A;  5F1J A;  3KZ9 A;  3TP3 A;  3BR2 A;  2RAS A;  3RD3 A;  1JUP A;  2XGC A;  3BTL A;  2F07 A;  5EZG A;  2I10 A;  2QIB A;  3NI7 A;  3HTJ A;  3G7R A;  2G7G A;  5D1R A;  3COL A;  3CWR A;  3Q0U A; 
#chains in the Genus database with same CATH topology
 4OD5 A;  3ZQI A;  2QCO A;  1RKW A;  3LSJ A;  4M3G A;  3JSJ A;  2Y2Z A;  3CDL A;  3IH4 A;  2ZY9 A;  4B3A A;  2FQ4 A;  2PBX A;  2HXO A;  3VPR A;  3FK6 A;  2UXP A;  2G7L A;  3NS4 A;  2VKE A;  2YVX A;  1RKT A;  3DEW A;  2WUI A;  3P9T A;  3RH2 A;  1T56 A;  3QQA A;  2GEN A;  3NRG A;  3ZQG A;  1U9N A;  2G3B A;  3EUP A;  2OI8 A;  3HTA A;  4YZE A;  5EZH A;  2PFV A;  5FMP A;  2OPT A;  2XRL A;  5H9T A;  1Z77 A;  3S5R A;  5F04 A;  2FD5 A;  3VOX A;  3KKD A;  4MXM A;  2NP3 A;  3SFI A;  4AC0 A;  3BR5 A;  2HYJ A;  4L62 A;  4V2F A;  5D19 A;  3QPL A;  4W97 A;  4KWA A;  3BR3 A;  2XGE A;  3CJD A;  4HKU A;  4B1R A;  5FKL A;  4MO7 A;  3BCG A;  3F1B A;  4IRV A;  4M3E A;  2DTZ A;  5F0F A;  3VP5 A;  1ZKG A;  2QKO A;  4WIB A;  1JTY A;  3FRQ A;  3ON2 A;  2ID3 A;  3LJL A;  5FKN A;  3C07 A;  3QBM A;  2Y30 A;  2QTQ A;  1VI0 A;  3B6C A;  5HSZ A;  5J1R A;  5GPA A;  4W1U A;  2YVH A;  3DU6 A;  5CW8 A;  3AQS A;  3ZQH A;  4AUX A;  3HGY A;  2R7R A;  1QPI A;  2OER A;  4ME9 A;  2R7T A;  3SDG A;  2R7Q A;  2PZ9 A;  5J3L A;  3B81 A;  2XPV A;  5HBU A;  3BTC A;  3CRJ A;  2FX0 A;  2B3W A;  3DU5 A;  3O8G A;  3ON4 A;  4D7N A;  4ABZ A;  3DCF A;  4D5C A;  5IP6 A;  3VW1 A;  2X6O A;  1U9O A;  3PAS A;  4I76 A;  2HKU A;  3GZI A;  4GFK A;  3LSR A;  2A2F X;  5J1U A;  3T6N A;  2NS7 A;  3BJB A;  1UI6 A;  2FBQ A;  4UDS A;  2WGB A;  5K7Z A;  3SWH A;  2HYT A;  3HE0 A;  1UI5 A;  4NN1 A;  3KKC A;  5CXG A;  2YVE A;  2G7S A;  5CXI A;  2XDN A;  3BQZ A;  2ID6 A;  1QVU A;  2W53 A;  3BT9 A;  3O8H A;  4ACI A;  2NP5 A;  5GP9 A;  5IPA A;  3WHB A;  5HAW A;  3BR0 A;  2IBD A;  4U9L A;  2IU5 A;  2UXI A;  2TCT A;  2HXI A;  5AQC A;  5CQG A;  4NEL A;  5K58 A;  3G1L A;  3NNR A;  2O7T A;  2R7U A;  2REK A;  3C2B A;  4U9N A;  2ZOY A;  2G0E A;  3BQY A;  2UXH A;  1RPW A;  2VKV A;  2R7O A;  3VIB A;  5F0H A;  2XGD A;  2XPW A;  3BRU A;  1A6I A;  2GUH A;  2QWT A;  5F08 A;  1QVT A;  3HTI A;  4GCL A;  2XPU A;  2JJ7 A;  3ANP A;  3BR1 A;  3MVP A;  2Q24 A;  2XB5 A;  3B6A A;  4DW6 A;  3NPI A;  2HQ5 A;  3IH2 A;  2R7X A;  2UXU A;  3LWJ A;  2JK3 A;  3WHC A;  1T33 A;  3VOK A;  2V57 A;  3DPJ A;  2ZCX A;  3EGQ A;  4D7M A;  2TRT A;  5FHP A;  3VUQ A;  2RHA A;  4ICH A;  4CGR A;  5F27 A;  1SGM A;  1JTX A;  4D5F A;  2GFN A;  4M3F A;  3BTI A;  2R7S A;  3G1M A;  2ZCN A;  3TP0 A;  3IH3 A;  4JYK A;  4GCK A;  3FIW A;  2ZB9 A;  4X1E A;  3VTI A;  4GCT A;  2O7O A;  3VVZ A;  1JT0 A;  5FKM A;  3ZQL A;  4JL3 A;  2DG7 A;  5DAJ A;  3CCY A;  2RAE A;  1JT6 A;  4JNN A;  3Q0V A;  3KYL A;  5EYR A;  1JUS A;  2UXO A;  3IUV A;  3ANG A;  4GFL A;  5D18 A;  2VPR A;  1ZK8 A;  3LOC A;  2GBY A;  2R7V A;  3BTJ A;  5FKK A;  3VVY A;  3V6G A;  4JKZ A;  3AQT A;  3G1O A;  3E7Q A;  3PPB A;  2OF7 A;  3BR6 A;  4M3B A;  4PXI A;  5K7H A;  3LSP A;  4DVY P;  5IOZ A;  4V2G A;  3VVX A;  4M3D A;  3BHQ A;  4I6Z A;  3NXC A;  3HGG A;  3PM1 A;  5C4Y A;  2QOP A;  2FJ1 A;  2Y31 A;  3LHQ A;  3F0C A;  1ORK A;  3VW2 A;  3VW0 A;  3HTH A;  3QKX A;  4AC6 A;  3Q0W A;  1JUM A;  5J1Y A;  3ZQF A;  2ZCM A;  5GPC A;  2DG8 A;  5FGL A;  2X9D A;  5EFY A;  2NS8 A;  1Z0X A;  3FK7 A;  2IAI A;  3GEU A;  4MK6 A;  2WV1 A;  3K8P C;  2EH3 A;  3O60 A;  4OD4 A;  3Q3S A;  5K7F A;  5F0C A;  1BJZ A;  5IOY A;  3HIM A;  5FKO A;  3BNI A;  2FJI 1;  4C2M A;  3MNL A;  4G12 A;  3KNW A;  2B1E A;  4XK4 A;  2IEK A;  4AF5 A;  3V78 A;  2D6Y A;  2ZOZ A;  3QPS A;  3G56 A;  2NX4 A;  5F1J A;  3KZ9 A;  3TP3 A;  3BR2 A;  2RAS A;  3RD3 A;  1JUP A;  2XGC A;  3BTL A;  2F07 A;  5EZG A;  2I10 A;  2QIB A;  3NI7 A;  3HTJ A;  3G7R A;  2G7G A;  5D1R A;  2R7W A;  3COL A;  3CWR A;  3FHN A;  3Q0U A; 
#chains in the Genus database with same CATH homology
 3ZQI A;  2QCO A;  1RKW A;  3LSJ A;  4M3G A;  3JSJ A;  2Y2Z A;  3CDL A;  3IH4 A;  4B3A A;  2FQ4 A;  2PBX A;  2HXO A;  3VPR A;  3FK6 A;  2UXP A;  2G7L A;  2VKE A;  1RKT A;  3DEW A;  2WUI A;  3P9T A;  3RH2 A;  1T56 A;  3QQA A;  2GEN A;  3NRG A;  3ZQG A;  1U9N A;  2G3B A;  3EUP A;  2OI8 A;  3HTA A;  4YZE A;  5EZH A;  5FMP A;  2OPT A;  2XRL A;  5H9T A;  1Z77 A;  3S5R A;  5F04 A;  2FD5 A;  3VOX A;  3KKD A;  4MXM A;  2NP3 A;  3SFI A;  4AC0 A;  3BR5 A;  2HYJ A;  4L62 A;  4V2F A;  5D19 A;  3QPL A;  4W97 A;  4KWA A;  3BR3 A;  2XGE A;  3CJD A;  4HKU A;  4B1R A;  5FKL A;  4MO7 A;  3BCG A;  3F1B A;  4M3E A;  2DTZ A;  5F0F A;  3VP5 A;  1ZKG A;  2QKO A;  1JTY A;  3FRQ A;  3ON2 A;  2ID3 A;  3LJL A;  5FKN A;  3C07 A;  3QBM A;  2Y30 A;  2QTQ A;  1VI0 A;  3B6C A;  5HSZ A;  5J1R A;  5GPA A;  4W1U A;  2YVH A;  5CW8 A;  3AQS A;  3ZQH A;  4AUX A;  3HGY A;  1QPI A;  2OER A;  4ME9 A;  3SDG A;  2PZ9 A;  5J3L A;  3B81 A;  2XPV A;  5HBU A;  3BTC A;  3CRJ A;  2FX0 A;  3O8G A;  3ON4 A;  4D7N A;  4ABZ A;  3DCF A;  4D5C A;  5IP6 A;  3VW1 A;  2X6O A;  1U9O A;  3PAS A;  4I76 A;  2HKU A;  3GZI A;  4GFK A;  3LSR A;  5J1U A;  3T6N A;  2NS7 A;  3BJB A;  1UI6 A;  2FBQ A;  4UDS A;  2WGB A;  5K7Z A;  2HYT A;  3HE0 A;  1UI5 A;  4NN1 A;  3KKC A;  5CXG A;  2YVE A;  2G7S A;  5CXI A;  2XDN A;  3BQZ A;  2ID6 A;  1QVU A;  2W53 A;  3BT9 A;  3O8H A;  4ACI A;  2NP5 A;  5GP9 A;  5IPA A;  3WHB A;  5HAW A;  3BR0 A;  2IBD A;  2IU5 A;  2UXI A;  2TCT A;  2HXI A;  5AQC A;  4NEL A;  5K58 A;  3G1L A;  3NNR A;  2O7T A;  2REK A;  3C2B A;  2ZOY A;  2G0E A;  3BQY A;  2UXH A;  1RPW A;  2VKV A;  3VIB A;  5F0H A;  2XGD A;  2XPW A;  3BRU A;  1A6I A;  2GUH A;  2QWT A;  5F08 A;  1QVT A;  3HTI A;  4GCL A;  2XPU A;  2JJ7 A;  3ANP A;  3BR1 A;  3MVP A;  2Q24 A;  2XB5 A;  3B6A A;  4DW6 A;  3NPI A;  2HQ5 A;  3IH2 A;  2UXU A;  3LWJ A;  2JK3 A;  3WHC A;  1T33 A;  3VOK A;  2V57 A;  3DPJ A;  2ZCX A;  3EGQ A;  4D7M A;  2TRT A;  5FHP A;  3VUQ A;  2RHA A;  4ICH A;  4CGR A;  5F27 A;  1SGM A;  1JTX A;  4D5F A;  2GFN A;  4M3F A;  3BTI A;  3G1M A;  2ZCN A;  3TP0 A;  3IH3 A;  4JYK A;  4GCK A;  3FIW A;  2ZB9 A;  4X1E A;  4GCT A;  2O7O A;  3VVZ A;  1JT0 A;  5FKM A;  3ZQL A;  4JL3 A;  2DG7 A;  5DAJ A;  3CCY A;  2RAE A;  1JT6 A;  4JNN A;  3Q0V A;  5EYR A;  1JUS A;  2UXO A;  3IUV A;  3ANG A;  4GFL A;  5D18 A;  2VPR A;  1ZK8 A;  3LOC A;  2GBY A;  3BTJ A;  5FKK A;  3VVY A;  3V6G A;  4JKZ A;  3AQT A;  3G1O A;  3E7Q A;  3PPB A;  2OF7 A;  3BR6 A;  4M3B A;  4PXI A;  5K7H A;  3LSP A;  5IOZ A;  4V2G A;  3VVX A;  4M3D A;  3BHQ A;  4I6Z A;  3NXC A;  3HGG A;  3PM1 A;  5C4Y A;  2QOP A;  2FJ1 A;  2Y31 A;  3LHQ A;  3F0C A;  1ORK A;  3VW2 A;  3VW0 A;  3HTH A;  3QKX A;  4AC6 A;  3Q0W A;  1JUM A;  5J1Y A;  3ZQF A;  2ZCM A;  5GPC A;  2DG8 A;  5FGL A;  2X9D A;  5EFY A;  2NS8 A;  1Z0X A;  3FK7 A;  2IAI A;  3GEU A;  4MK6 A;  2WV1 A;  2EH3 A;  3O60 A;  3Q3S A;  5K7F A;  5F0C A;  1BJZ A;  5IOY A;  3HIM A;  5FKO A;  3BNI A;  3MNL A;  4G12 A;  3KNW A;  4XK4 A;  2IEK A;  4AF5 A;  3V78 A;  2D6Y A;  2ZOZ A;  3QPS A;  3G56 A;  2NX4 A;  5F1J A;  3KZ9 A;  3TP3 A;  3BR2 A;  2RAS A;  3RD3 A;  1JUP A;  2XGC A;  3BTL A;  2F07 A;  5EZG A;  2I10 A;  2QIB A;  3NI7 A;  3HTJ A;  3G7R A;  2G7G A;  5D1R A;  3COL A;  3CWR A;  3Q0U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...