4AF5A

Structure of the c. glutamicum acnr crystal form i
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
174
structure length
173
Chain Sequence
RQEILEGARRCFAEHGYEGATVRRLEEATGKSRGAIFHHFGDKENLFLALAREDAARMAEVVENGLVEVMRGMLEDPERYDWMSVRLEISKQLRTDPVFRAKWIDHQSVLDEAVRVRLSRNVDKGQMRTDVPIEVLHTFLETVLDGFISRLATGASTEGLSEVLDLVEGTVRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-TYPE TRANSCRIPTIONAL REPRESSOR ACNR COMPND 2
publication title Crystal and Solution Studies Reveal that the Transcriptional Regulator Acnr of Corynebacterium Glutamicum is Regulated by Citrate:Mg2+ Binding to a Non-Canonical Pocket.
pubmed doi rcsb
source organism Corynebacterium glutamicum
molecule tags Transcription
total genus 74
structure length 173
sequence length 174
ec nomenclature
pdb deposition date 2012-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 4af5A00
2D6YA 4M3FA 3KNWA 4X1EA 5F0CA 1UI5A 1Z77A 3BR6A 2G7LA 5CW8A 1JT6A 4D5FA 4ABZA 3PASA 2NP5A 3HTAA 2G0EA 5AQCA 3CJDA 3BR2A 3RH2A 3QBMA 2PBXA 2UXPA 5F1JA 3DCFA 4M3GA 5EZHA 4MXMA 3COLA 2IU5A 2DG7A 4V2FA 1JUMA 2ZB9A 5HSZA 1QVUA 5GPCA 3ZQIA 2QKOA 3IUVA 3CDLA 3WHBA 3CWRA 2ID6A 2UXOA 3HGGA 3BR3A 1SGMA 5IOZA 5CXIA 3BTIA 3Q0VA 5GP9A 4B3AA 4JNNA 3Q0UA 5K7FA 1U9NA 2HQ5A 4GFLA 1RPWA 4JYKA 2I10A 2VKVA 4GCLA 3ZQLA 1U9OA 4G12A 2QOPA 2ID3A 3SDGA 4D5CA 3ANPA 3VW1A 2QWTA 3VW0A 3JSJA 2G7SA 3Q3SA 3FK7A 4JL3A 2YVHA 5D1RA 2XPVA 2UXUA 2QCOA 3BR0A 5J1UA 5HAWA 3G56A 4D7MA 3O60A 4UDSA 2QTQA 5HBUA 2FD5A 3BQZA 3VPRA 3VVYA 4KWAA 1ORKA 3PM1A 2FJ1A 3KKCA 2XPWA 4CGRA 1Z0XA 3F0CA 3G1OA 5IP6A 2GUHA 4ICHA 2GBYA 5FKNA 3C2BA 5K7ZA 2ZOYA 3BR1A 2G7GA 2UXHA 1RKTA 2X9DA 2UXIA 2OI8A 5D19A 3BHQA 3ANGA 2OPTA 3NRGA 2RASA 1BJZA 5EFYA 5EZGA 2QIBA 3EUPA 3O8HA 5FMPA 3QQAA 5F04A 1T56A 2HYJA 3BTLA 4I6ZA 4PXIA 4M3EA 5IOYA 3CCYA 1QVTA 5DAJA 2W53A 3F1BA 2O7OA 3Q0WA 2VKEA 3BTJA 2FBQA 2IBDA 3HGYA 3LSJA 4V2GA 3VP5A 3VOKA 5EYRA 2X6OA 2XRLA 3KZ9A 3HIMA 3QPLA 3S5RA 1RKWA 4NN1A 1UI6A 3LJLA 2ZCMA 5K58A 2WV1A 2PZ9A 3HE0A 4JKZA 5J1RA 4AF5A 2XGEA 3VUQA 3T6NA 1JTXA 1JT0A 1QPIA 4M3DA 5J1YA 2NP3A 5FKLA 4D7NA 5IPAA 4W97A 3FIWA 4NELA 2FX0A 2GFNA 2RHAA 2Y30A 3SFIA 3MVPA 2DTZA 3BTCA 3LHQA 3TP3A 5GPAA 3NPIA 3WHCA 2NS7A 3RD3A 5K7HA 4XK4A 3LSPA 3V78A 5J3LA 4M3BA 3O8GA 3G1MA 3VIBA 3NI7A 3BQYA 2VPRA 5FGLA 2HXIA 3BNIA 1ZKGA 1VI0A 3HTIA 4MK6A 3KKDA 1T33A 1JUPA 2F07A 4I76A 2GENA 5F0FA 2IAIA 3MNLA 2G3BA 3G1LA 4MO7A 4GCKA 1JUSA 3HTHA 2YVEA 4ME9A 2XB5A 4AC6A 2XGCA 3B81A 2Y31A 3ZQHA 5FKMA 3IH4A 3AQSA 3B6AA 3GZIA 1JTYA 3QKXA 4YZEA 2Y2ZA 4AUXA 4AC0A 5FKKA 3NXCA 2DG8A 3BCGA 3ON2A 3LSRA 3V6GA 3IH2A 3G7RA 2TRTA 3DEWA 5FHPA 3P9TA 5F27A 3BR5A 3ZQFA 3ZQGA 1ZK8A 3HTJA 2WGBA 5F0HA 3NNRA 3LWJA 3VVZA 3B6CA 2ZOZA 5C4YA 2FQ4A 3AQTA 2ZCXA 3FRQA 2HYTA 5H9TA 4GCTA 2TCTA 3E7QA 5D18A 2NX4A 3LOCA 2HXOA 3BRUA 4DW6A 2OERA 4ACIA 3VW2A 3FK6A 3DPJA 2RAEA 2HKUA 3QPSA 5F08A 2NS8A 2Q24A 2XGDA 4W1UA 2V57A 4HKUA 4B1RA 2O7TA 2EH3A 1A6IA 2IEKA 5FKOA 3GEUA 3EGQA 2ZCNA 4L62A 3CRJA 3VVXA 2JK3A 3VOXA 3BJBA 3BT9A 2WUIA 3TP0A 3C07A 3PPBA 2REKA 3ON4A 2XDNA 3IH3A 4GFKA 2XPUA 5CXGA 2JJ7A 2OF7A
chains in the Genus database with same CATH superfamily
2D6YA 4M3FA 3KNWA 4X1EA 5F0CA 1UI5A 1Z77A 3BR6A 2G7LA 5CW8A 1JT6A 4D5FA 4ABZA 3PASA 2NP5A 3HTAA 2G0EA 5AQCA 4U9LA 2PFVA 3CJDA 3BR2A 3RH2A 3QBMA 2PBXA 2UXPA 5F1JA 3DCFA 2R7QA 4M3GA 5EZHA 4MXMA 3COLA 2IU5A 2DG7A 4V2FA 1JUMA 2ZB9A 5HSZA 1QVUA 5GPCA 3ZQIA 2QKOA 3IUVA 3CDLA 3WHBA 3CWRA 3NS4A 2R7WA 2ID6A 2UXOA 3HGGA 3BR3A 1SGMA 5IOZA 5CXIA 3BTIA 2R7TA 3Q0VA 2FJI1 5GP9A 4B3AA 4JNNA 3Q0UA 5K7FA 1U9NA 2HQ5A 4GFLA 1RPWA 4JYKA 2I10A 2VKVA 4GCLA 2R7SA 3ZQLA 2R7OA 1U9OA 4G12A 2QOPA 2ID3A 3SDGA 4D5CA 3ANPA 3VW1A 2QWTA 3VW0A 3JSJA 2G7SA 3Q3SA 3FK7A 4JL3A 2YVHA 5D1RA 2XPVA 2UXUA 2QCOA 3BR0A 5J1UA 5HAWA 3G56A 4D7MA 3O60A 4UDSA 2QTQA 5HBUA 2FD5A 3BQZA 2R7UA 3VPRA 3VVYA 4KWAA 1ORKA 3PM1A 2FJ1A 3KKCA 2XPWA 4CGRA 1Z0XA 3F0CA 3G1OA 5IP6A 2GUHA 4ICHA 2GBYA 5FKNA 3C2BA 5K7ZA 2ZOYA 3BR1A 2G7GA 2UXHA 1RKTA 2X9DA 2UXIA 2R7XA 2OI8A 5D19A 3BHQA 3ANGA 3FHNA 2OPTA 4OD5A 3NRGA 2RASA 1BJZA 5EFYA 5EZGA 2QIBA 3EUPA 3O8HA 5FMPA 2R7VA 3QQAA 5F04A 1T56A 2HYJA 3DU5A 3BTLA 4I6ZA 4PXIA 4M3EA 5IOYA 3CCYA 1QVTA 5DAJA 2W53A 3F1BA 2O7OA 3Q0WA 2VKEA 3BTJA 2FBQA 2IBDA 3HGYA 3LSJA 2B1EA 4V2GA 3VP5A 3VOKA 5EYRA 2X6OA 2XRLA 3KZ9A 3HIMA 3QPLA 3S5RA 1RKWA 4NN1A 1UI6A 3LJLA 2ZCMA 5K58A 2WV1A 2PZ9A 3HE0A 4JKZA 5J1RA 4AF5A 2XGEA 3VUQA 3T6NA 1JTXA 3KYLA 1JT0A 4M3DA 1QPIA 5J1YA 2NP3A 5FKLA 4D7NA 4OD4A 5IPAA 4W97A 3FIWA 4NELA 2FX0A 2GFNA 2RHAA 2Y30A 3SFIA 2ZY9A 3MVPA 2DTZA 3BTCA 3LHQA 3TP3A 5GPAA 3NPIA 3WHCA 3K8PC 2NS7A 3RD3A 5K7HA 4XK4A 3LSPA 3V78A 5J3LA 4M3BA 4IRVA 3O8GA 3G1MA 3VIBA 3NI7A 3BQYA 2VPRA 5FGLA 2HXIA 3BNIA 1ZKGA 1VI0A 3HTIA 4MK6A 3KKDA 1T33A 1JUPA 2F07A 4WIBA 4I76A 2GENA 5F0FA 2A2FX 2IAIA 3MNLA 2G3BA 3G1LA 4MO7A 4GCKA 1JUSA 3DU6A 3HTHA 2YVEA 4ME9A 2XB5A 4AC6A 2XGCA 3B81A 2Y31A 3ZQHA 5FKMA 3IH4A 3AQSA 3B6AA 3GZIA 2R7RA 1JTYA 3QKXA 4YZEA 2Y2ZA 4AUXA 4AC0A 5CQGA 5FKKA 3NXCA 2DG8A 3BCGA 3ON2A 3LSRA 3V6GA 3IH2A 3G7RA 2TRTA 3DEWA 5FHPA 3P9TA 5F27A 3BR5A 3SWHA 3ZQFA 3ZQGA 4DVYP 1ZK8A 3HTJA 2WGBA 5F0HA 3NNRA 3LWJA 3VVZA 3B6CA 2ZOZA 5C4YA 2FQ4A 3AQTA 2ZCXA 3FRQA 2HYTA 5H9TA 4GCTA 2TCTA 3E7QA 5D18A 2NX4A 4U9NA 3LOCA 2HXOA 3BRUA 4DW6A 2OERA 4ACIA 3VW2A 3FK6A 3DPJA 2RAEA 2HKUA 4C2MA 3QPSA 5F08A 2NS8A 2Q24A 2XGDA 4W1UA 2V57A 4HKUA 4B1RA 2O7TA 2EH3A 1A6IA 2IEKA 5FKOA 3GEUA 3EGQA 2ZCNA 2YVXA 4L62A 3CRJA 3VVXA 2JK3A 3VOXA 3BJBA 3BT9A 2WUIA 3VTIA 3TP0A 3C07A 2B3WA 3PPBA 2REKA 3ON4A 2XDNA 3IH3A 4GFKA 2XPUA 5CXGA 2JJ7A 2OF7A
chains in the Genus database with same CATH topology
2D6YA 4M3FA 3KNWA 4X1EA 5F0CA 1UI5A 1Z77A 3BR6A 2G7LA 5CW8A 1JT6A 4D5FA 4ABZA 3PASA 2NP5A 3HTAA 2G0EA 5AQCA 3CJDA 3BR2A 3RH2A 3QBMA 2PBXA 2UXPA 5F1JA 3DCFA 4M3GA 5EZHA 4MXMA 3COLA 2IU5A 2DG7A 4V2FA 1JUMA 2ZB9A 5HSZA 1QVUA 5GPCA 3ZQIA 2QKOA 3IUVA 3CDLA 3WHBA 3CWRA 2ID6A 2UXOA 3HGGA 3BR3A 1SGMA 5IOZA 5CXIA 3BTIA 3Q0VA 5GP9A 4B3AA 4JNNA 3Q0UA 5K7FA 1U9NA 2HQ5A 4GFLA 1RPWA 4JYKA 2I10A 2VKVA 4GCLA 3ZQLA 1U9OA 4G12A 2QOPA 2ID3A 3SDGA 4D5CA 3ANPA 3VW1A 2QWTA 3VW0A 3JSJA 2G7SA 3Q3SA 3FK7A 4JL3A 2YVHA 5D1RA 2XPVA 2UXUA 2QCOA 3BR0A 5J1UA 5HAWA 3G56A 4D7MA 3O60A 4UDSA 2QTQA 5HBUA 2FD5A 3BQZA 3VPRA 3VVYA 4KWAA 1ORKA 3PM1A 2FJ1A 3KKCA 2XPWA 4CGRA 1Z0XA 3F0CA 3G1OA 5IP6A 2GUHA 4ICHA 2GBYA 5FKNA 3C2BA 5K7ZA 2ZOYA 3BR1A 2G7GA 2UXHA 1RKTA 2X9DA 2UXIA 2OI8A 5D19A 3BHQA 3ANGA 2OPTA 3NRGA 2RASA 1BJZA 5EFYA 5EZGA 2QIBA 3EUPA 3O8HA 5FMPA 3QQAA 5F04A 1T56A 2HYJA 3BTLA 4I6ZA 4PXIA 4M3EA 5IOYA 3CCYA 1QVTA 5DAJA 2W53A 3F1BA 2O7OA 3Q0WA 2VKEA 3BTJA 2FBQA 2IBDA 3HGYA 3LSJA 4V2GA 3VP5A 3VOKA 5EYRA 2X6OA 2XRLA 3KZ9A 3HIMA 3QPLA 3S5RA 1RKWA 4NN1A 1UI6A 3LJLA 2ZCMA 5K58A 2WV1A 2PZ9A 3HE0A 4JKZA 5J1RA 4AF5A 2XGEA 3VUQA 3T6NA 1JTXA 1JT0A 1QPIA 4M3DA 5J1YA 2NP3A 5FKLA 4D7NA 5IPAA 4W97A 3FIWA 4NELA 2FX0A 2GFNA 2RHAA 2Y30A 3SFIA 3MVPA 2DTZA 3BTCA 3LHQA 3TP3A 5GPAA 3NPIA 3WHCA 2NS7A 3RD3A 5K7HA 4XK4A 3LSPA 3V78A 5J3LA 4M3BA 3O8GA 3G1MA 3VIBA 3NI7A 3BQYA 2VPRA 5FGLA 2HXIA 3BNIA 1ZKGA 1VI0A 3HTIA 4MK6A 3KKDA 1T33A 1JUPA 2F07A 4I76A 2GENA 5F0FA 2IAIA 3MNLA 2G3BA 3G1LA 4MO7A 4GCKA 1JUSA 3HTHA 2YVEA 4ME9A 2XB5A 4AC6A 2XGCA 3B81A 2Y31A 3ZQHA 5FKMA 3IH4A 3AQSA 3B6AA 3GZIA 1JTYA 3QKXA 4YZEA 2Y2ZA 4AUXA 4AC0A 5FKKA 3NXCA 2DG8A 3BCGA 3ON2A 3LSRA 3V6GA 3IH2A 3G7RA 2TRTA 3DEWA 5FHPA 3P9TA 5F27A 3BR5A 3ZQFA 3ZQGA 1ZK8A 3HTJA 2WGBA 5F0HA 3NNRA 3LWJA 3VVZA 3B6CA 2ZOZA 5C4YA 2FQ4A 3AQTA 2ZCXA 3FRQA 2HYTA 5H9TA 4GCTA 2TCTA 3E7QA 5D18A 2NX4A 3LOCA 2HXOA 3BRUA 4DW6A 2OERA 4ACIA 3VW2A 3FK6A 3DPJA 2RAEA 2HKUA 3QPSA 5F08A 2NS8A 2Q24A 2XGDA 4W1UA 2V57A 4HKUA 4B1RA 2O7TA 2EH3A 1A6IA 2IEKA 5FKOA 3GEUA 3EGQA 2ZCNA 4L62A 3CRJA 3VVXA 2JK3A 3VOXA 3BJBA 3BT9A 2WUIA 3TP0A 3C07A 3PPBA 2REKA 3ON4A 2XDNA 3IH3A 4GFKA 2XPUA 5CXGA 2JJ7A 2OF7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D6Y A;  4M3F A;  3KNW A;  4X1E A;  5F0C A;  1UI5 A;  1Z77 A;  3BR6 A;  2G7L A;  5CW8 A;  1JT6 A;  4D5F A;  4ABZ A;  3PAS A;  2NP5 A;  3HTA A;  2G0E A;  5AQC A;  3CJD A;  3BR2 A;  3RH2 A;  3QBM A;  2PBX A;  2UXP A;  5F1J A;  3DCF A;  4M3G A;  5EZH A;  4MXM A;  3COL A;  2IU5 A;  2DG7 A;  4V2F A;  1JUM A;  2ZB9 A;  5HSZ A;  1QVU A;  5GPC A;  3ZQI A;  2QKO A;  3IUV A;  3CDL A;  3WHB A;  3CWR A;  2ID6 A;  2UXO A;  3HGG A;  3BR3 A;  1SGM A;  5IOZ A;  5CXI A;  3BTI A;  3Q0V A;  5GP9 A;  4B3A A;  4JNN A;  3Q0U A;  5K7F A;  1U9N A;  2HQ5 A;  4GFL A;  1RPW A;  4JYK A;  2I10 A;  2VKV A;  4GCL A;  3ZQL A;  1U9O A;  4G12 A;  2QOP A;  2ID3 A;  3SDG A;  4D5C A;  3ANP A;  3VW1 A;  2QWT A;  3VW0 A;  3JSJ A;  2G7S A;  3Q3S A;  3FK7 A;  4JL3 A;  2YVH A;  5D1R A;  2XPV A;  2UXU A;  2QCO A;  3BR0 A;  5J1U A;  5HAW A;  3G56 A;  4D7M A;  3O60 A;  4UDS A;  2QTQ A;  5HBU A;  2FD5 A;  3BQZ A;  3VPR A;  3VVY A;  4KWA A;  1ORK A;  3PM1 A;  2FJ1 A;  3KKC A;  2XPW A;  4CGR A;  1Z0X A;  3F0C A;  3G1O A;  5IP6 A;  2GUH A;  4ICH A;  2GBY A;  5FKN A;  3C2B A;  5K7Z A;  2ZOY A;  3BR1 A;  2G7G A;  2UXH A;  1RKT A;  2X9D A;  2UXI A;  2OI8 A;  5D19 A;  3BHQ A;  3ANG A;  2OPT A;  3NRG A;  2RAS A;  1BJZ A;  5EFY A;  5EZG A;  2QIB A;  3EUP A;  3O8H A;  5FMP A;  3QQA A;  5F04 A;  1T56 A;  2HYJ A;  3BTL A;  4I6Z A;  4PXI A;  4M3E A;  5IOY A;  3CCY A;  1QVT A;  5DAJ A;  2W53 A;  3F1B A;  2O7O A;  3Q0W A;  2VKE A;  3BTJ A;  2FBQ A;  2IBD A;  3HGY A;  3LSJ A;  4V2G A;  3VP5 A;  3VOK A;  5EYR A;  2X6O A;  2XRL A;  3KZ9 A;  3HIM A;  3QPL A;  3S5R A;  1RKW A;  4NN1 A;  1UI6 A;  3LJL A;  2ZCM A;  5K58 A;  2WV1 A;  2PZ9 A;  3HE0 A;  4JKZ A;  5J1R A;  4AF5 A;  2XGE A;  3VUQ A;  3T6N A;  1JTX A;  1JT0 A;  1QPI A;  4M3D A;  5J1Y A;  2NP3 A;  5FKL A;  4D7N A;  5IPA A;  4W97 A;  3FIW A;  4NEL A;  2FX0 A;  2GFN A;  2RHA A;  2Y30 A;  3SFI A;  3MVP A;  2DTZ A;  3BTC A;  3LHQ A;  3TP3 A;  5GPA A;  3NPI A;  3WHC A;  2NS7 A;  3RD3 A;  5K7H A;  4XK4 A;  3LSP A;  3V78 A;  5J3L A;  4M3B A;  3O8G A;  3G1M A;  3VIB A;  3NI7 A;  3BQY A;  2VPR A;  5FGL A;  2HXI A;  3BNI A;  1ZKG A;  1VI0 A;  3HTI A;  4MK6 A;  3KKD A;  1T33 A;  1JUP A;  2F07 A;  4I76 A;  2GEN A;  5F0F A;  2IAI A;  3MNL A;  2G3B A;  3G1L A;  4MO7 A;  4GCK A;  1JUS A;  3HTH A;  2YVE A;  4ME9 A;  2XB5 A;  4AC6 A;  2XGC A;  3B81 A;  2Y31 A;  3ZQH A;  5FKM A;  3IH4 A;  3AQS A;  3B6A A;  3GZI A;  1JTY A;  3QKX A;  4YZE A;  2Y2Z A;  4AUX A;  4AC0 A;  5FKK A;  3NXC A;  2DG8 A;  3BCG A;  3ON2 A;  3LSR A;  3V6G A;  3IH2 A;  3G7R A;  2TRT A;  3DEW A;  5FHP A;  3P9T A;  5F27 A;  3BR5 A;  3ZQF A;  3ZQG A;  1ZK8 A;  3HTJ A;  2WGB A;  5F0H A;  3NNR A;  3LWJ A;  3VVZ A;  3B6C A;  2ZOZ A;  5C4Y A;  2FQ4 A;  3AQT A;  2ZCX A;  3FRQ A;  2HYT A;  5H9T A;  4GCT A;  2TCT A;  3E7Q A;  5D18 A;  2NX4 A;  3LOC A;  2HXO A;  3BRU A;  4DW6 A;  2OER A;  4ACI A;  3VW2 A;  3FK6 A;  3DPJ A;  2RAE A;  2HKU A;  3QPS A;  5F08 A;  2NS8 A;  2Q24 A;  2XGD A;  4W1U A;  2V57 A;  4HKU A;  4B1R A;  2O7T A;  2EH3 A;  1A6I A;  2IEK A;  5FKO A;  3GEU A;  3EGQ A;  2ZCN A;  4L62 A;  3CRJ A;  3VVX A;  2JK3 A;  3VOX A;  3BJB A;  3BT9 A;  2WUI A;  3TP0 A;  3C07 A;  3PPB A;  2REK A;  3ON4 A;  2XDN A;  3IH3 A;  4GFK A;  2XPU A;  5CXG A;  2JJ7 A;  2OF7 A; 
#chains in the Genus database with same CATH topology
 2D6Y A;  4M3F A;  3KNW A;  4X1E A;  5F0C A;  1UI5 A;  1Z77 A;  3BR6 A;  2G7L A;  5CW8 A;  1JT6 A;  4D5F A;  4ABZ A;  3PAS A;  2NP5 A;  3HTA A;  2G0E A;  5AQC A;  4U9L A;  2PFV A;  3CJD A;  3BR2 A;  3RH2 A;  3QBM A;  2PBX A;  2UXP A;  5F1J A;  3DCF A;  2R7Q A;  4M3G A;  5EZH A;  4MXM A;  3COL A;  2IU5 A;  2DG7 A;  4V2F A;  1JUM A;  2ZB9 A;  5HSZ A;  1QVU A;  5GPC A;  3ZQI A;  2QKO A;  3IUV A;  3CDL A;  3WHB A;  3CWR A;  3NS4 A;  2R7W A;  2ID6 A;  2UXO A;  3HGG A;  3BR3 A;  1SGM A;  5IOZ A;  5CXI A;  3BTI A;  2R7T A;  3Q0V A;  2FJI 1;  5GP9 A;  4B3A A;  4JNN A;  3Q0U A;  5K7F A;  1U9N A;  2HQ5 A;  4GFL A;  1RPW A;  4JYK A;  2I10 A;  2VKV A;  4GCL A;  2R7S A;  3ZQL A;  2R7O A;  1U9O A;  4G12 A;  2QOP A;  2ID3 A;  3SDG A;  4D5C A;  3ANP A;  3VW1 A;  2QWT A;  3VW0 A;  3JSJ A;  2G7S A;  3Q3S A;  3FK7 A;  4JL3 A;  2YVH A;  5D1R A;  2XPV A;  2UXU A;  2QCO A;  3BR0 A;  5J1U A;  5HAW A;  3G56 A;  4D7M A;  3O60 A;  4UDS A;  2QTQ A;  5HBU A;  2FD5 A;  3BQZ A;  2R7U A;  3VPR A;  3VVY A;  4KWA A;  1ORK A;  3PM1 A;  2FJ1 A;  3KKC A;  2XPW A;  4CGR A;  1Z0X A;  3F0C A;  3G1O A;  5IP6 A;  2GUH A;  4ICH A;  2GBY A;  5FKN A;  3C2B A;  5K7Z A;  2ZOY A;  3BR1 A;  2G7G A;  2UXH A;  1RKT A;  2X9D A;  2UXI A;  2R7X A;  2OI8 A;  5D19 A;  3BHQ A;  3ANG A;  3FHN A;  2OPT A;  4OD5 A;  3NRG A;  2RAS A;  1BJZ A;  5EFY A;  5EZG A;  2QIB A;  3EUP A;  3O8H A;  5FMP A;  2R7V A;  3QQA A;  5F04 A;  1T56 A;  2HYJ A;  3DU5 A;  3BTL A;  4I6Z A;  4PXI A;  4M3E A;  5IOY A;  3CCY A;  1QVT A;  5DAJ A;  2W53 A;  3F1B A;  2O7O A;  3Q0W A;  2VKE A;  3BTJ A;  2FBQ A;  2IBD A;  3HGY A;  3LSJ A;  2B1E A;  4V2G A;  3VP5 A;  3VOK A;  5EYR A;  2X6O A;  2XRL A;  3KZ9 A;  3HIM A;  3QPL A;  3S5R A;  1RKW A;  4NN1 A;  1UI6 A;  3LJL A;  2ZCM A;  5K58 A;  2WV1 A;  2PZ9 A;  3HE0 A;  4JKZ A;  5J1R A;  4AF5 A;  2XGE A;  3VUQ A;  3T6N A;  1JTX A;  3KYL A;  1JT0 A;  4M3D A;  1QPI A;  5J1Y A;  2NP3 A;  5FKL A;  4D7N A;  4OD4 A;  5IPA A;  4W97 A;  3FIW A;  4NEL A;  2FX0 A;  2GFN A;  2RHA A;  2Y30 A;  3SFI A;  2ZY9 A;  3MVP A;  2DTZ A;  3BTC A;  3LHQ A;  3TP3 A;  5GPA A;  3NPI A;  3WHC A;  3K8P C;  2NS7 A;  3RD3 A;  5K7H A;  4XK4 A;  3LSP A;  3V78 A;  5J3L A;  4M3B A;  4IRV A;  3O8G A;  3G1M A;  3VIB A;  3NI7 A;  3BQY A;  2VPR A;  5FGL A;  2HXI A;  3BNI A;  1ZKG A;  1VI0 A;  3HTI A;  4MK6 A;  3KKD A;  1T33 A;  1JUP A;  2F07 A;  4WIB A;  4I76 A;  2GEN A;  5F0F A;  2A2F X;  2IAI A;  3MNL A;  2G3B A;  3G1L A;  4MO7 A;  4GCK A;  1JUS A;  3DU6 A;  3HTH A;  2YVE A;  4ME9 A;  2XB5 A;  4AC6 A;  2XGC A;  3B81 A;  2Y31 A;  3ZQH A;  5FKM A;  3IH4 A;  3AQS A;  3B6A A;  3GZI A;  2R7R A;  1JTY A;  3QKX A;  4YZE A;  2Y2Z A;  4AUX A;  4AC0 A;  5CQG A;  5FKK A;  3NXC A;  2DG8 A;  3BCG A;  3ON2 A;  3LSR A;  3V6G A;  3IH2 A;  3G7R A;  2TRT A;  3DEW A;  5FHP A;  3P9T A;  5F27 A;  3BR5 A;  3SWH A;  3ZQF A;  3ZQG A;  4DVY P;  1ZK8 A;  3HTJ A;  2WGB A;  5F0H A;  3NNR A;  3LWJ A;  3VVZ A;  3B6C A;  2ZOZ A;  5C4Y A;  2FQ4 A;  3AQT A;  2ZCX A;  3FRQ A;  2HYT A;  5H9T A;  4GCT A;  2TCT A;  3E7Q A;  5D18 A;  2NX4 A;  4U9N A;  3LOC A;  2HXO A;  3BRU A;  4DW6 A;  2OER A;  4ACI A;  3VW2 A;  3FK6 A;  3DPJ A;  2RAE A;  2HKU A;  4C2M A;  3QPS A;  5F08 A;  2NS8 A;  2Q24 A;  2XGD A;  4W1U A;  2V57 A;  4HKU A;  4B1R A;  2O7T A;  2EH3 A;  1A6I A;  2IEK A;  5FKO A;  3GEU A;  3EGQ A;  2ZCN A;  2YVX A;  4L62 A;  3CRJ A;  3VVX A;  2JK3 A;  3VOX A;  3BJB A;  3BT9 A;  2WUI A;  3VTI A;  3TP0 A;  3C07 A;  2B3W A;  3PPB A;  2REK A;  3ON4 A;  2XDN A;  3IH3 A;  4GFK A;  2XPU A;  5CXG A;  2JJ7 A;  2OF7 A; 
#chains in the Genus database with same CATH homology
 2D6Y A;  4M3F A;  3KNW A;  4X1E A;  5F0C A;  1UI5 A;  1Z77 A;  3BR6 A;  2G7L A;  5CW8 A;  1JT6 A;  4D5F A;  4ABZ A;  3PAS A;  2NP5 A;  3HTA A;  2G0E A;  5AQC A;  3CJD A;  3BR2 A;  3RH2 A;  3QBM A;  2PBX A;  2UXP A;  5F1J A;  3DCF A;  4M3G A;  5EZH A;  4MXM A;  3COL A;  2IU5 A;  2DG7 A;  4V2F A;  1JUM A;  2ZB9 A;  5HSZ A;  1QVU A;  5GPC A;  3ZQI A;  2QKO A;  3IUV A;  3CDL A;  3WHB A;  3CWR A;  2ID6 A;  2UXO A;  3HGG A;  3BR3 A;  1SGM A;  5IOZ A;  5CXI A;  3BTI A;  3Q0V A;  5GP9 A;  4B3A A;  4JNN A;  3Q0U A;  5K7F A;  1U9N A;  2HQ5 A;  4GFL A;  1RPW A;  4JYK A;  2I10 A;  2VKV A;  4GCL A;  3ZQL A;  1U9O A;  4G12 A;  2QOP A;  2ID3 A;  3SDG A;  4D5C A;  3ANP A;  3VW1 A;  2QWT A;  3VW0 A;  3JSJ A;  2G7S A;  3Q3S A;  3FK7 A;  4JL3 A;  2YVH A;  5D1R A;  2XPV A;  2UXU A;  2QCO A;  3BR0 A;  5J1U A;  5HAW A;  3G56 A;  4D7M A;  3O60 A;  4UDS A;  2QTQ A;  5HBU A;  2FD5 A;  3BQZ A;  3VPR A;  3VVY A;  4KWA A;  1ORK A;  3PM1 A;  2FJ1 A;  3KKC A;  2XPW A;  4CGR A;  1Z0X A;  3F0C A;  3G1O A;  5IP6 A;  2GUH A;  4ICH A;  2GBY A;  5FKN A;  3C2B A;  5K7Z A;  2ZOY A;  3BR1 A;  2G7G A;  2UXH A;  1RKT A;  2X9D A;  2UXI A;  2OI8 A;  5D19 A;  3BHQ A;  3ANG A;  2OPT A;  3NRG A;  2RAS A;  1BJZ A;  5EFY A;  5EZG A;  2QIB A;  3EUP A;  3O8H A;  5FMP A;  3QQA A;  5F04 A;  1T56 A;  2HYJ A;  3BTL A;  4I6Z A;  4PXI A;  4M3E A;  5IOY A;  3CCY A;  1QVT A;  5DAJ A;  2W53 A;  3F1B A;  2O7O A;  3Q0W A;  2VKE A;  3BTJ A;  2FBQ A;  2IBD A;  3HGY A;  3LSJ A;  4V2G A;  3VP5 A;  3VOK A;  5EYR A;  2X6O A;  2XRL A;  3KZ9 A;  3HIM A;  3QPL A;  3S5R A;  1RKW A;  4NN1 A;  1UI6 A;  3LJL A;  2ZCM A;  5K58 A;  2WV1 A;  2PZ9 A;  3HE0 A;  4JKZ A;  5J1R A;  4AF5 A;  2XGE A;  3VUQ A;  3T6N A;  1JTX A;  1JT0 A;  1QPI A;  4M3D A;  5J1Y A;  2NP3 A;  5FKL A;  4D7N A;  5IPA A;  4W97 A;  3FIW A;  4NEL A;  2FX0 A;  2GFN A;  2RHA A;  2Y30 A;  3SFI A;  3MVP A;  2DTZ A;  3BTC A;  3LHQ A;  3TP3 A;  5GPA A;  3NPI A;  3WHC A;  2NS7 A;  3RD3 A;  5K7H A;  4XK4 A;  3LSP A;  3V78 A;  5J3L A;  4M3B A;  3O8G A;  3G1M A;  3VIB A;  3NI7 A;  3BQY A;  2VPR A;  5FGL A;  2HXI A;  3BNI A;  1ZKG A;  1VI0 A;  3HTI A;  4MK6 A;  3KKD A;  1T33 A;  1JUP A;  2F07 A;  4I76 A;  2GEN A;  5F0F A;  2IAI A;  3MNL A;  2G3B A;  3G1L A;  4MO7 A;  4GCK A;  1JUS A;  3HTH A;  2YVE A;  4ME9 A;  2XB5 A;  4AC6 A;  2XGC A;  3B81 A;  2Y31 A;  3ZQH A;  5FKM A;  3IH4 A;  3AQS A;  3B6A A;  3GZI A;  1JTY A;  3QKX A;  4YZE A;  2Y2Z A;  4AUX A;  4AC0 A;  5FKK A;  3NXC A;  2DG8 A;  3BCG A;  3ON2 A;  3LSR A;  3V6G A;  3IH2 A;  3G7R A;  2TRT A;  3DEW A;  5FHP A;  3P9T A;  5F27 A;  3BR5 A;  3ZQF A;  3ZQG A;  1ZK8 A;  3HTJ A;  2WGB A;  5F0H A;  3NNR A;  3LWJ A;  3VVZ A;  3B6C A;  2ZOZ A;  5C4Y A;  2FQ4 A;  3AQT A;  2ZCX A;  3FRQ A;  2HYT A;  5H9T A;  4GCT A;  2TCT A;  3E7Q A;  5D18 A;  2NX4 A;  3LOC A;  2HXO A;  3BRU A;  4DW6 A;  2OER A;  4ACI A;  3VW2 A;  3FK6 A;  3DPJ A;  2RAE A;  2HKU A;  3QPS A;  5F08 A;  2NS8 A;  2Q24 A;  2XGD A;  4W1U A;  2V57 A;  4HKU A;  4B1R A;  2O7T A;  2EH3 A;  1A6I A;  2IEK A;  5FKO A;  3GEU A;  3EGQ A;  2ZCN A;  4L62 A;  3CRJ A;  3VVX A;  2JK3 A;  3VOX A;  3BJB A;  3BT9 A;  2WUI A;  3TP0 A;  3C07 A;  3PPB A;  2REK A;  3ON4 A;  2XDN A;  3IH3 A;  4GFK A;  2XPU A;  5CXG A;  2JJ7 A;  2OF7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...