4AF5A

Structure of the c. glutamicum acnr crystal form i
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
174
structure length
173
Chain Sequence
RQEILEGARRCFAEHGYEGATVRRLEEATGKSRGAIFHHFGDKENLFLALAREDAARMAEVVENGLVEVMRGMLEDPERYDWMSVRLEISKQLRTDPVFRAKWIDHQSVLDEAVRVRLSRNVDKGQMRTDVPIEVLHTFLETVLDGFISRLATGASTEGLSEVLDLVEGTVRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords HTH-TYPE TRANSCRIPTIONAL REPRESSOR ACNR COMPND 2
publication title Crystal and Solution Studies Reveal that the Transcriptional Regulator Acnr of Corynebacterium Glutamicum is Regulated by Citrate:Mg2+ Binding to a Non-Canonical Pocket.
pubmed doi rcsb
source organism Corynebacterium glutamicum
total genus 74
structure length 173
sequence length 174
ec nomenclature
pdb deposition date 2012-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 4af5A00
3Q0VA 4GCKA 2HQ5A 2EH3A 3ANGA 2WUIA 5K7ZA 5FKKA 4AF5A 4AUXA 3B6CA 1JTXA 3WHBA 2Y2ZA 3BCGA 3VVZA 2PBXA 5FGLA 3B81A 2REKA 3G1MA 4NN1A 3PASA 2HXIA 3HTIA 2QOPA 2X6OA 2XGDA 3HTHA 3Q0UA 3F1BA 4W1UA 4D5FA 3E7QA 5FKNA 2QCOA 3EUPA 5D1RA 5D18A 3TP0A 5DAJA 2RAEA 4MK6A 4L62A 2W53A 3ZQFA 2ZB9A 3BR6A 5IPAA 4NELA 3BJBA 3S5RA 3CJDA 1QPIA 4M3GA 4M3FA 3KKCA 5J1YA 4GCLA 3BTCA 1BJZA 3O8GA 3VPRA 1RKTA 2PZ9A 3VOKA 5F04A 2IAIA 3G1OA 5EZHA 3EGQA 3VW2A 2ZCNA 2OI8A 2HXOA 1U9NA 2JK3A 2QTQA 3Q0WA 3TP3A 3C07A 1ZKGA 2FJ1A 3IH4A 3LOCA 3NRGA 5CW8A 3IH3A 5AQCA 1RPWA 1JT6A 1QVTA 3KKDA 5F1JA 2GENA 4I6ZA 3SFIA 3BNIA 4AC0A 4JKZA 3G7RA 3Q3SA 3LSPA 5CXIA 3IUVA 3LWJA 2X9DA 2OF7A 3QKXA 4UDSA 3RD3A 5H9TA 2F07A 3VIBA 3GZIA 2HKUA 3VP5A 1Z0XA 2XRLA 4M3DA 3ZQGA 2FBQA 2HYJA 3BR5A 4D7MA 5HSZA 5F0CA 2YVHA 2ID6A 3LJLA 3PM1A 2XB5A 3VOXA 5F08A 2IEKA 2G3BA 3O60A 3SDGA 3AQTA 4ACIA 4AC6A 1RKWA 3KZ9A 3BQYA 5IOZA 1T33A 3GEUA 2O7OA 2QKOA 4KWAA 2UXUA 4B1RA 5EZGA 1A6IA 5IP6A 4GFKA 1UI6A 3QPSA 2FD5A 3COLA 5F27A 3DCFA 3RH2A 4JYKA 1JTYA 2XGEA 3CDLA 1QVUA 3PPBA 3FK6A 3FIWA 3WHCA 2O7TA 2Y31A 3CWRA 3F0CA 3T6NA 2NP3A 3LSRA 3QBMA 3VVXA 3IH2A 2FQ4A 4JL3A 3C2BA 3ZQIA 5GPCA 4D7NA 5J3LA 2DG8A 5C4YA 2UXOA 2NS7A 2DG7A 5K58A 2WV1A 4ICHA 2NS8A 3BR3A 3VUQA 3FK7A 2YVEA 1ORKA 3CRJA 5FKLA 5EFYA 1JUSA 2XPUA 2G7LA 5GPAA 1U9OA 2DTZA 3BT9A 3ON2A 2Q24A 2OPTA 3LSJA 5FMPA 3AQSA 3ZQLA 3ANPA 3NNRA 2VKVA 2G7SA 2RASA 2GUHA 5K7FA 3FRQA 5J1RA 3BR1A 4M3BA 3ZQHA 2XGCA 4JNNA 5F0FA 2IBDA 2QIBA 4D5CA 1SGMA 3NI7A 4HKUA 1ZK8A 3BTJA 3QQAA 5K7HA 1VI0A 4V2GA 3MNLA 2D6YA 5FKMA 2QWTA 5FHPA 3KNWA 3NXCA 4YZEA 3MVPA 2RHAA 2UXIA 4MO7A 3VW1A 2ZCXA 2GFNA 2NX4A 3HGGA 2VPRA 3HGYA 2XPVA 2ZCMA 3VVYA 2FX0A 3O8HA 4X1EA 2HYTA 2G7GA 5D19A 4ME9A 5FKOA 4ABZA 1T56A 1JUMA 2NP5A 2UXPA 3BQZA 3BRUA 2XDNA 5EYRA 4GCTA 1JT0A 3DEWA 4W97A 2ID3A 4I76A 3V6GA 4G12A 2G0EA 5CXGA 5GP9A 4PXIA 5F0HA 3HTJA 5J1UA 3JSJA 1Z77A 2I10A 5HBUA 5IOYA 3HTAA 3G1LA 3BHQA 3BTIA 3P9TA 2WGBA 4DW6A 3ON4A 2VKEA 3DPJA 4GFLA 3HIMA 1UI5A 3VW0A 1JUPA 2V57A 3V78A 3CCYA 2ZOZA 3BTLA 2GBYA 2JJ7A 4B3AA 2ZOYA 2UXHA 2TCTA 3BR0A 4V2FA 3BR2A 4XK4A 2TRTA 2Y30A 3HE0A 2IU5A 4MXMA 2XPWA 3LHQA 3QPLA 3G56A 5HAWA 3NPIA 4CGRA 4M3EA 2OERA 3B6AA
chains in the Genus database with same CATH superfamily
3Q0VA 4GCKA 2B3WA 2HQ5A 2EH3A 3ANGA 2WUIA 5K7ZA 3FHNA 5FKKA 4AF5A 4AUXA 3B6CA 1JTXA 3WHBA 2Y2ZA 3BCGA 3VVZA 2PBXA 3VTIA 5FGLA 3B81A 2REKA 3G1MA 4NN1A 4C2MA 3PASA 2HXIA 3HTIA 2QOPA 2X6OA 2XGDA 3HTHA 3Q0UA 3F1BA 4W1UA 4D5FA 3E7QA 5FKNA 2QCOA 3EUPA 5D1RA 5D18A 3TP0A 5DAJA 2RAEA 4MK6A 4L62A 2W53A 3ZQFA 2ZB9A 3BR6A 5IPAA 4NELA 3BJBA 3S5RA 3CJDA 1QPIA 4M3GA 4U9NA 4M3FA 3KKCA 5J1YA 4GCLA 3BTCA 1BJZA 3O8GA 3VPRA 1RKTA 2PZ9A 3VOKA 5F04A 2IAIA 2R7TA 3G1OA 5EZHA 3EGQA 3VW2A 2ZCNA 2ZY9A 2OI8A 2HXOA 1U9NA 2JK3A 2QTQA 3Q0WA 3TP3A 3C07A 1ZKGA 2FJ1A 3IH4A 3LOCA 3K8PC 3NRGA 5CW8A 3IH3A 5AQCA 1RPWA 1JT6A 1QVTA 3KKDA 5F1JA 4OD5A 2GENA 4I6ZA 3SFIA 3BNIA 2R7XA 4AC0A 4JKZA 3G7RA 3Q3SA 3LSPA 5CXIA 3IUVA 3LWJA 4IRVA 2X9DA 2OF7A 3QKXA 4UDSA 3RD3A 5H9TA 2F07A 3NS4A 2R7QA 3VIBA 3GZIA 2HKUA 3VP5A 1Z0XA 2XRLA 4M3DA 3ZQGA 2FBQA 2HYJA 3BR5A 4D7MA 5HSZA 5F0CA 2YVHA 2ID6A 3LJLA 3PM1A 2XB5A 3VOXA 5F08A 3DU5A 2IEKA 2G3BA 3O60A 3SDGA 4WIBA 3AQTA 4ACIA 4AC6A 1RKWA 3KZ9A 3BQYA 5IOZA 1T33A 3GEUA 2O7OA 2QKOA 4KWAA 2UXUA 4B1RA 5EZGA 1A6IA 5IP6A 4GFKA 4OD4A 1UI6A 3KYLA 3QPSA 2FD5A 3COLA 5F27A 2A2FX 3DCFA 3RH2A 2R7VA 4JYKA 1JTYA 2XGEA 3CDLA 1QVUA 3PPBA 3FK6A 3FIWA 3WHCA 2O7TA 2Y31A 3CWRA 3F0CA 3T6NA 2NP3A 3LSRA 3QBMA 3VVXA 3IH2A 2FQ4A 4JL3A 3C2BA 2R7SA 3ZQIA 5GPCA 4D7NA 5J3LA 2DG8A 5C4YA 2UXOA 2NS7A 2DG7A 5K58A 2WV1A 4ICHA 2NS8A 3BR3A 3FK7A 3VUQA 2YVEA 1ORKA 3CRJA 5FKLA 5EFYA 1JUSA 2XPUA 2G7LA 5GPAA 1U9OA 2DTZA 3BT9A 3ON2A 2Q24A 2OPTA 3LSJA 5FMPA 3AQSA 3ZQLA 2R7UA 3ANPA 3NNRA 2VKVA 2G7SA 2RASA 2GUHA 5K7FA 3FRQA 5J1RA 3BR1A 4M3BA 3ZQHA 2XGCA 4JNNA 5F0FA 2IBDA 2QIBA 4D5CA 1SGMA 3NI7A 4HKUA 2B1EA 1ZK8A 3BTJA 3QQAA 5K7HA 1VI0A 4V2GA 3MNLA 3DU6A 2D6YA 5FKMA 2QWTA 5FHPA 3KNWA 3NXCA 4YZEA 3MVPA 2RHAA 2UXIA 4MO7A 3VW1A 2ZCXA 2GFNA 2NX4A 3HGGA 2VPRA 3HGYA 2XPVA 2ZCMA 3VVYA 2FX0A 3O8HA 4X1EA 2HYTA 2G7GA 5D19A 4ME9A 5FKOA 4U9LA 4ABZA 1T56A 1JUMA 2NP5A 2UXPA 3BQZA 3BRUA 2XDNA 5EYRA 4GCTA 1JT0A 3DEWA 4W97A 2ID3A 4I76A 3V6GA 4G12A 2G0EA 5CXGA 5GP9A 4PXIA 5F0HA 3HTJA 5J1UA 3JSJA 1Z77A 2I10A 5HBUA 5IOYA 3SWHA 3HTAA 2PFVA 3G1LA 3BHQA 2YVXA 3BTIA 3P9TA 2WGBA 4DW6A 5CQGA 3ON4A 2VKEA 3DPJA 2R7OA 4GFLA 3HIMA 1UI5A 3VW0A 1JUPA 2V57A 3V78A 3CCYA 2ZOZA 3BTLA 2GBYA 2JJ7A 4B3AA 2ZOYA 2UXHA 4DVYP 2R7WA 2TCTA 3BR0A 4V2FA 3BR2A 4XK4A 2TRTA 2FJI1 2Y30A 3HE0A 2IU5A 4MXMA 2XPWA 3LHQA 3QPLA 3G56A 5HAWA 3NPIA 4CGRA 4M3EA 2OERA 2R7RA 3B6AA
chains in the Genus database with same CATH topology
3Q0VA 4GCKA 2HQ5A 2EH3A 3ANGA 2WUIA 5K7ZA 5FKKA 4AF5A 4AUXA 3B6CA 1JTXA 3WHBA 2Y2ZA 3BCGA 3VVZA 2PBXA 5FGLA 3B81A 2REKA 3G1MA 4NN1A 3PASA 2HXIA 3HTIA 2QOPA 2X6OA 2XGDA 3HTHA 3Q0UA 3F1BA 4W1UA 4D5FA 3E7QA 5FKNA 2QCOA 3EUPA 5D1RA 5D18A 3TP0A 5DAJA 2RAEA 4MK6A 4L62A 2W53A 3ZQFA 2ZB9A 3BR6A 5IPAA 4NELA 3BJBA 3S5RA 3CJDA 1QPIA 4M3GA 4M3FA 3KKCA 5J1YA 4GCLA 3BTCA 1BJZA 3O8GA 3VPRA 1RKTA 2PZ9A 3VOKA 5F04A 2IAIA 3G1OA 5EZHA 3EGQA 3VW2A 2ZCNA 2OI8A 2HXOA 1U9NA 2JK3A 2QTQA 3Q0WA 3TP3A 3C07A 1ZKGA 2FJ1A 3IH4A 3LOCA 3NRGA 5CW8A 3IH3A 5AQCA 1RPWA 1JT6A 1QVTA 3KKDA 5F1JA 2GENA 4I6ZA 3SFIA 3BNIA 4AC0A 4JKZA 3G7RA 3Q3SA 3LSPA 5CXIA 3IUVA 3LWJA 2X9DA 2OF7A 3QKXA 4UDSA 3RD3A 5H9TA 2F07A 3VIBA 3GZIA 2HKUA 3VP5A 1Z0XA 2XRLA 4M3DA 3ZQGA 2FBQA 2HYJA 3BR5A 4D7MA 5HSZA 5F0CA 2YVHA 2ID6A 3LJLA 3PM1A 2XB5A 3VOXA 5F08A 2IEKA 2G3BA 3O60A 3SDGA 3AQTA 4ACIA 4AC6A 1RKWA 3KZ9A 3BQYA 5IOZA 1T33A 3GEUA 2O7OA 2QKOA 4KWAA 2UXUA 4B1RA 5EZGA 1A6IA 5IP6A 4GFKA 1UI6A 3QPSA 2FD5A 3COLA 5F27A 3DCFA 3RH2A 4JYKA 1JTYA 2XGEA 3CDLA 1QVUA 3PPBA 3FK6A 3FIWA 3WHCA 2O7TA 2Y31A 3CWRA 3F0CA 3T6NA 2NP3A 3LSRA 3QBMA 3VVXA 3IH2A 2FQ4A 4JL3A 3C2BA 3ZQIA 5GPCA 4D7NA 5J3LA 2DG8A 5C4YA 2UXOA 2NS7A 2DG7A 5K58A 2WV1A 4ICHA 2NS8A 3BR3A 3VUQA 3FK7A 2YVEA 1ORKA 3CRJA 5FKLA 5EFYA 1JUSA 2XPUA 2G7LA 5GPAA 1U9OA 2DTZA 3BT9A 3ON2A 2Q24A 2OPTA 3LSJA 5FMPA 3AQSA 3ZQLA 3ANPA 3NNRA 2VKVA 2G7SA 2RASA 2GUHA 5K7FA 3FRQA 5J1RA 3BR1A 4M3BA 3ZQHA 2XGCA 4JNNA 5F0FA 2IBDA 2QIBA 4D5CA 1SGMA 3NI7A 4HKUA 1ZK8A 3BTJA 3QQAA 5K7HA 1VI0A 4V2GA 3MNLA 2D6YA 5FKMA 2QWTA 5FHPA 3KNWA 3NXCA 4YZEA 3MVPA 2RHAA 2UXIA 4MO7A 3VW1A 2ZCXA 2GFNA 2NX4A 3HGGA 2VPRA 3HGYA 2XPVA 2ZCMA 3VVYA 2FX0A 3O8HA 4X1EA 2HYTA 2G7GA 5D19A 4ME9A 5FKOA 4ABZA 1T56A 1JUMA 2NP5A 2UXPA 3BQZA 3BRUA 2XDNA 5EYRA 4GCTA 1JT0A 3DEWA 4W97A 2ID3A 4I76A 3V6GA 4G12A 2G0EA 5CXGA 5GP9A 4PXIA 5F0HA 3HTJA 5J1UA 3JSJA 1Z77A 2I10A 5HBUA 5IOYA 3HTAA 3G1LA 3BHQA 3BTIA 3P9TA 2WGBA 4DW6A 3ON4A 2VKEA 3DPJA 4GFLA 3HIMA 1UI5A 3VW0A 1JUPA 2V57A 3V78A 3CCYA 2ZOZA 3BTLA 2GBYA 2JJ7A 4B3AA 2ZOYA 2UXHA 2TCTA 3BR0A 4V2FA 3BR2A 4XK4A 2TRTA 2Y30A 3HE0A 2IU5A 4MXMA 2XPWA 3LHQA 3QPLA 3G56A 5HAWA 3NPIA 4CGRA 4M3EA 2OERA 3B6AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q0V A;  4GCK A;  2HQ5 A;  2EH3 A;  3ANG A;  2WUI A;  5K7Z A;  5FKK A;  4AF5 A;  4AUX A;  3B6C A;  1JTX A;  3WHB A;  2Y2Z A;  3BCG A;  3VVZ A;  2PBX A;  5FGL A;  3B81 A;  2REK A;  3G1M A;  4NN1 A;  3PAS A;  2HXI A;  3HTI A;  2QOP A;  2X6O A;  2XGD A;  3HTH A;  3Q0U A;  3F1B A;  4W1U A;  4D5F A;  3E7Q A;  5FKN A;  2QCO A;  3EUP A;  5D1R A;  5D18 A;  3TP0 A;  5DAJ A;  2RAE A;  4MK6 A;  4L62 A;  2W53 A;  3ZQF A;  2ZB9 A;  3BR6 A;  5IPA A;  4NEL A;  3BJB A;  3S5R A;  3CJD A;  1QPI A;  4M3G A;  4M3F A;  3KKC A;  5J1Y A;  4GCL A;  3BTC A;  1BJZ A;  3O8G A;  3VPR A;  1RKT A;  2PZ9 A;  3VOK A;  5F04 A;  2IAI A;  3G1O A;  5EZH A;  3EGQ A;  3VW2 A;  2ZCN A;  2OI8 A;  2HXO A;  1U9N A;  2JK3 A;  2QTQ A;  3Q0W A;  3TP3 A;  3C07 A;  1ZKG A;  2FJ1 A;  3IH4 A;  3LOC A;  3NRG A;  5CW8 A;  3IH3 A;  5AQC A;  1RPW A;  1JT6 A;  1QVT A;  3KKD A;  5F1J A;  2GEN A;  4I6Z A;  3SFI A;  3BNI A;  4AC0 A;  4JKZ A;  3G7R A;  3Q3S A;  3LSP A;  5CXI A;  3IUV A;  3LWJ A;  2X9D A;  2OF7 A;  3QKX A;  4UDS A;  3RD3 A;  5H9T A;  2F07 A;  3VIB A;  3GZI A;  2HKU A;  3VP5 A;  1Z0X A;  2XRL A;  4M3D A;  3ZQG A;  2FBQ A;  2HYJ A;  3BR5 A;  4D7M A;  5HSZ A;  5F0C A;  2YVH A;  2ID6 A;  3LJL A;  3PM1 A;  2XB5 A;  3VOX A;  5F08 A;  2IEK A;  2G3B A;  3O60 A;  3SDG A;  3AQT A;  4ACI A;  4AC6 A;  1RKW A;  3KZ9 A;  3BQY A;  5IOZ A;  1T33 A;  3GEU A;  2O7O A;  2QKO A;  4KWA A;  2UXU A;  4B1R A;  5EZG A;  1A6I A;  5IP6 A;  4GFK A;  1UI6 A;  3QPS A;  2FD5 A;  3COL A;  5F27 A;  3DCF A;  3RH2 A;  4JYK A;  1JTY A;  2XGE A;  3CDL A;  1QVU A;  3PPB A;  3FK6 A;  3FIW A;  3WHC A;  2O7T A;  2Y31 A;  3CWR A;  3F0C A;  3T6N A;  2NP3 A;  3LSR A;  3QBM A;  3VVX A;  3IH2 A;  2FQ4 A;  4JL3 A;  3C2B A;  3ZQI A;  5GPC A;  4D7N A;  5J3L A;  2DG8 A;  5C4Y A;  2UXO A;  2NS7 A;  2DG7 A;  5K58 A;  2WV1 A;  4ICH A;  2NS8 A;  3BR3 A;  3VUQ A;  3FK7 A;  2YVE A;  1ORK A;  3CRJ A;  5FKL A;  5EFY A;  1JUS A;  2XPU A;  2G7L A;  5GPA A;  1U9O A;  2DTZ A;  3BT9 A;  3ON2 A;  2Q24 A;  2OPT A;  3LSJ A;  5FMP A;  3AQS A;  3ZQL A;  3ANP A;  3NNR A;  2VKV A;  2G7S A;  2RAS A;  2GUH A;  5K7F A;  3FRQ A;  5J1R A;  3BR1 A;  4M3B A;  3ZQH A;  2XGC A;  4JNN A;  5F0F A;  2IBD A;  2QIB A;  4D5C A;  1SGM A;  3NI7 A;  4HKU A;  1ZK8 A;  3BTJ A;  3QQA A;  5K7H A;  1VI0 A;  4V2G A;  3MNL A;  2D6Y A;  5FKM A;  2QWT A;  5FHP A;  3KNW A;  3NXC A;  4YZE A;  3MVP A;  2RHA A;  2UXI A;  4MO7 A;  3VW1 A;  2ZCX A;  2GFN A;  2NX4 A;  3HGG A;  2VPR A;  3HGY A;  2XPV A;  2ZCM A;  3VVY A;  2FX0 A;  3O8H A;  4X1E A;  2HYT A;  2G7G A;  5D19 A;  4ME9 A;  5FKO A;  4ABZ A;  1T56 A;  1JUM A;  2NP5 A;  2UXP A;  3BQZ A;  3BRU A;  2XDN A;  5EYR A;  4GCT A;  1JT0 A;  3DEW A;  4W97 A;  2ID3 A;  4I76 A;  3V6G A;  4G12 A;  2G0E A;  5CXG A;  5GP9 A;  4PXI A;  5F0H A;  3HTJ A;  5J1U A;  3JSJ A;  1Z77 A;  2I10 A;  5HBU A;  5IOY A;  3HTA A;  3G1L A;  3BHQ A;  3BTI A;  3P9T A;  2WGB A;  4DW6 A;  3ON4 A;  2VKE A;  3DPJ A;  4GFL A;  3HIM A;  1UI5 A;  3VW0 A;  1JUP A;  2V57 A;  3V78 A;  3CCY A;  2ZOZ A;  3BTL A;  2GBY A;  2JJ7 A;  4B3A A;  2ZOY A;  2UXH A;  2TCT A;  3BR0 A;  4V2F A;  3BR2 A;  4XK4 A;  2TRT A;  2Y30 A;  3HE0 A;  2IU5 A;  4MXM A;  2XPW A;  3LHQ A;  3QPL A;  3G56 A;  5HAW A;  3NPI A;  4CGR A;  4M3E A;  2OER A;  3B6A A; 
#chains in the Genus database with same CATH topology
 3Q0V A;  4GCK A;  2B3W A;  2HQ5 A;  2EH3 A;  3ANG A;  2WUI A;  5K7Z A;  3FHN A;  5FKK A;  4AF5 A;  4AUX A;  3B6C A;  1JTX A;  3WHB A;  2Y2Z A;  3BCG A;  3VVZ A;  2PBX A;  3VTI A;  5FGL A;  3B81 A;  2REK A;  3G1M A;  4NN1 A;  4C2M A;  3PAS A;  2HXI A;  3HTI A;  2QOP A;  2X6O A;  2XGD A;  3HTH A;  3Q0U A;  3F1B A;  4W1U A;  4D5F A;  3E7Q A;  5FKN A;  2QCO A;  3EUP A;  5D1R A;  5D18 A;  3TP0 A;  5DAJ A;  2RAE A;  4MK6 A;  4L62 A;  2W53 A;  3ZQF A;  2ZB9 A;  3BR6 A;  5IPA A;  4NEL A;  3BJB A;  3S5R A;  3CJD A;  1QPI A;  4M3G A;  4U9N A;  4M3F A;  3KKC A;  5J1Y A;  4GCL A;  3BTC A;  1BJZ A;  3O8G A;  3VPR A;  1RKT A;  2PZ9 A;  3VOK A;  5F04 A;  2IAI A;  2R7T A;  3G1O A;  5EZH A;  3EGQ A;  3VW2 A;  2ZCN A;  2ZY9 A;  2OI8 A;  2HXO A;  1U9N A;  2JK3 A;  2QTQ A;  3Q0W A;  3TP3 A;  3C07 A;  1ZKG A;  2FJ1 A;  3IH4 A;  3LOC A;  3K8P C;  3NRG A;  5CW8 A;  3IH3 A;  5AQC A;  1RPW A;  1JT6 A;  1QVT A;  3KKD A;  5F1J A;  4OD5 A;  2GEN A;  4I6Z A;  3SFI A;  3BNI A;  2R7X A;  4AC0 A;  4JKZ A;  3G7R A;  3Q3S A;  3LSP A;  5CXI A;  3IUV A;  3LWJ A;  4IRV A;  2X9D A;  2OF7 A;  3QKX A;  4UDS A;  3RD3 A;  5H9T A;  2F07 A;  3NS4 A;  2R7Q A;  3VIB A;  3GZI A;  2HKU A;  3VP5 A;  1Z0X A;  2XRL A;  4M3D A;  3ZQG A;  2FBQ A;  2HYJ A;  3BR5 A;  4D7M A;  5HSZ A;  5F0C A;  2YVH A;  2ID6 A;  3LJL A;  3PM1 A;  2XB5 A;  3VOX A;  5F08 A;  3DU5 A;  2IEK A;  2G3B A;  3O60 A;  3SDG A;  4WIB A;  3AQT A;  4ACI A;  4AC6 A;  1RKW A;  3KZ9 A;  3BQY A;  5IOZ A;  1T33 A;  3GEU A;  2O7O A;  2QKO A;  4KWA A;  2UXU A;  4B1R A;  5EZG A;  1A6I A;  5IP6 A;  4GFK A;  4OD4 A;  1UI6 A;  3KYL A;  3QPS A;  2FD5 A;  3COL A;  5F27 A;  2A2F X;  3DCF A;  3RH2 A;  2R7V A;  4JYK A;  1JTY A;  2XGE A;  3CDL A;  1QVU A;  3PPB A;  3FK6 A;  3FIW A;  3WHC A;  2O7T A;  2Y31 A;  3CWR A;  3F0C A;  3T6N A;  2NP3 A;  3LSR A;  3QBM A;  3VVX A;  3IH2 A;  2FQ4 A;  4JL3 A;  3C2B A;  2R7S A;  3ZQI A;  5GPC A;  4D7N A;  5J3L A;  2DG8 A;  5C4Y A;  2UXO A;  2NS7 A;  2DG7 A;  5K58 A;  2WV1 A;  4ICH A;  2NS8 A;  3BR3 A;  3FK7 A;  3VUQ A;  2YVE A;  1ORK A;  3CRJ A;  5FKL A;  5EFY A;  1JUS A;  2XPU A;  2G7L A;  5GPA A;  1U9O A;  2DTZ A;  3BT9 A;  3ON2 A;  2Q24 A;  2OPT A;  3LSJ A;  5FMP A;  3AQS A;  3ZQL A;  2R7U A;  3ANP A;  3NNR A;  2VKV A;  2G7S A;  2RAS A;  2GUH A;  5K7F A;  3FRQ A;  5J1R A;  3BR1 A;  4M3B A;  3ZQH A;  2XGC A;  4JNN A;  5F0F A;  2IBD A;  2QIB A;  4D5C A;  1SGM A;  3NI7 A;  4HKU A;  2B1E A;  1ZK8 A;  3BTJ A;  3QQA A;  5K7H A;  1VI0 A;  4V2G A;  3MNL A;  3DU6 A;  2D6Y A;  5FKM A;  2QWT A;  5FHP A;  3KNW A;  3NXC A;  4YZE A;  3MVP A;  2RHA A;  2UXI A;  4MO7 A;  3VW1 A;  2ZCX A;  2GFN A;  2NX4 A;  3HGG A;  2VPR A;  3HGY A;  2XPV A;  2ZCM A;  3VVY A;  2FX0 A;  3O8H A;  4X1E A;  2HYT A;  2G7G A;  5D19 A;  4ME9 A;  5FKO A;  4U9L A;  4ABZ A;  1T56 A;  1JUM A;  2NP5 A;  2UXP A;  3BQZ A;  3BRU A;  2XDN A;  5EYR A;  4GCT A;  1JT0 A;  3DEW A;  4W97 A;  2ID3 A;  4I76 A;  3V6G A;  4G12 A;  2G0E A;  5CXG A;  5GP9 A;  4PXI A;  5F0H A;  3HTJ A;  5J1U A;  3JSJ A;  1Z77 A;  2I10 A;  5HBU A;  5IOY A;  3SWH A;  3HTA A;  2PFV A;  3G1L A;  3BHQ A;  2YVX A;  3BTI A;  3P9T A;  2WGB A;  4DW6 A;  5CQG A;  3ON4 A;  2VKE A;  3DPJ A;  2R7O A;  4GFL A;  3HIM A;  1UI5 A;  3VW0 A;  1JUP A;  2V57 A;  3V78 A;  3CCY A;  2ZOZ A;  3BTL A;  2GBY A;  2JJ7 A;  4B3A A;  2ZOY A;  2UXH A;  4DVY P;  2R7W A;  2TCT A;  3BR0 A;  4V2F A;  3BR2 A;  4XK4 A;  2TRT A;  2FJI 1;  2Y30 A;  3HE0 A;  2IU5 A;  4MXM A;  2XPW A;  3LHQ A;  3QPL A;  3G56 A;  5HAW A;  3NPI A;  4CGR A;  4M3E A;  2OER A;  2R7R A;  3B6A A; 
#chains in the Genus database with same CATH homology
 3Q0V A;  4GCK A;  2HQ5 A;  2EH3 A;  3ANG A;  2WUI A;  5K7Z A;  5FKK A;  4AF5 A;  4AUX A;  3B6C A;  1JTX A;  3WHB A;  2Y2Z A;  3BCG A;  3VVZ A;  2PBX A;  5FGL A;  3B81 A;  2REK A;  3G1M A;  4NN1 A;  3PAS A;  2HXI A;  3HTI A;  2QOP A;  2X6O A;  2XGD A;  3HTH A;  3Q0U A;  3F1B A;  4W1U A;  4D5F A;  3E7Q A;  5FKN A;  2QCO A;  3EUP A;  5D1R A;  5D18 A;  3TP0 A;  5DAJ A;  2RAE A;  4MK6 A;  4L62 A;  2W53 A;  3ZQF A;  2ZB9 A;  3BR6 A;  5IPA A;  4NEL A;  3BJB A;  3S5R A;  3CJD A;  1QPI A;  4M3G A;  4M3F A;  3KKC A;  5J1Y A;  4GCL A;  3BTC A;  1BJZ A;  3O8G A;  3VPR A;  1RKT A;  2PZ9 A;  3VOK A;  5F04 A;  2IAI A;  3G1O A;  5EZH A;  3EGQ A;  3VW2 A;  2ZCN A;  2OI8 A;  2HXO A;  1U9N A;  2JK3 A;  2QTQ A;  3Q0W A;  3TP3 A;  3C07 A;  1ZKG A;  2FJ1 A;  3IH4 A;  3LOC A;  3NRG A;  5CW8 A;  3IH3 A;  5AQC A;  1RPW A;  1JT6 A;  1QVT A;  3KKD A;  5F1J A;  2GEN A;  4I6Z A;  3SFI A;  3BNI A;  4AC0 A;  4JKZ A;  3G7R A;  3Q3S A;  3LSP A;  5CXI A;  3IUV A;  3LWJ A;  2X9D A;  2OF7 A;  3QKX A;  4UDS A;  3RD3 A;  5H9T A;  2F07 A;  3VIB A;  3GZI A;  2HKU A;  3VP5 A;  1Z0X A;  2XRL A;  4M3D A;  3ZQG A;  2FBQ A;  2HYJ A;  3BR5 A;  4D7M A;  5HSZ A;  5F0C A;  2YVH A;  2ID6 A;  3LJL A;  3PM1 A;  2XB5 A;  3VOX A;  5F08 A;  2IEK A;  2G3B A;  3O60 A;  3SDG A;  3AQT A;  4ACI A;  4AC6 A;  1RKW A;  3KZ9 A;  3BQY A;  5IOZ A;  1T33 A;  3GEU A;  2O7O A;  2QKO A;  4KWA A;  2UXU A;  4B1R A;  5EZG A;  1A6I A;  5IP6 A;  4GFK A;  1UI6 A;  3QPS A;  2FD5 A;  3COL A;  5F27 A;  3DCF A;  3RH2 A;  4JYK A;  1JTY A;  2XGE A;  3CDL A;  1QVU A;  3PPB A;  3FK6 A;  3FIW A;  3WHC A;  2O7T A;  2Y31 A;  3CWR A;  3F0C A;  3T6N A;  2NP3 A;  3LSR A;  3QBM A;  3VVX A;  3IH2 A;  2FQ4 A;  4JL3 A;  3C2B A;  3ZQI A;  5GPC A;  4D7N A;  5J3L A;  2DG8 A;  5C4Y A;  2UXO A;  2NS7 A;  2DG7 A;  5K58 A;  2WV1 A;  4ICH A;  2NS8 A;  3BR3 A;  3VUQ A;  3FK7 A;  2YVE A;  1ORK A;  3CRJ A;  5FKL A;  5EFY A;  1JUS A;  2XPU A;  2G7L A;  5GPA A;  1U9O A;  2DTZ A;  3BT9 A;  3ON2 A;  2Q24 A;  2OPT A;  3LSJ A;  5FMP A;  3AQS A;  3ZQL A;  3ANP A;  3NNR A;  2VKV A;  2G7S A;  2RAS A;  2GUH A;  5K7F A;  3FRQ A;  5J1R A;  3BR1 A;  4M3B A;  3ZQH A;  2XGC A;  4JNN A;  5F0F A;  2IBD A;  2QIB A;  4D5C A;  1SGM A;  3NI7 A;  4HKU A;  1ZK8 A;  3BTJ A;  3QQA A;  5K7H A;  1VI0 A;  4V2G A;  3MNL A;  2D6Y A;  5FKM A;  2QWT A;  5FHP A;  3KNW A;  3NXC A;  4YZE A;  3MVP A;  2RHA A;  2UXI A;  4MO7 A;  3VW1 A;  2ZCX A;  2GFN A;  2NX4 A;  3HGG A;  2VPR A;  3HGY A;  2XPV A;  2ZCM A;  3VVY A;  2FX0 A;  3O8H A;  4X1E A;  2HYT A;  2G7G A;  5D19 A;  4ME9 A;  5FKO A;  4ABZ A;  1T56 A;  1JUM A;  2NP5 A;  2UXP A;  3BQZ A;  3BRU A;  2XDN A;  5EYR A;  4GCT A;  1JT0 A;  3DEW A;  4W97 A;  2ID3 A;  4I76 A;  3V6G A;  4G12 A;  2G0E A;  5CXG A;  5GP9 A;  4PXI A;  5F0H A;  3HTJ A;  5J1U A;  3JSJ A;  1Z77 A;  2I10 A;  5HBU A;  5IOY A;  3HTA A;  3G1L A;  3BHQ A;  3BTI A;  3P9T A;  2WGB A;  4DW6 A;  3ON4 A;  2VKE A;  3DPJ A;  4GFL A;  3HIM A;  1UI5 A;  3VW0 A;  1JUP A;  2V57 A;  3V78 A;  3CCY A;  2ZOZ A;  3BTL A;  2GBY A;  2JJ7 A;  4B3A A;  2ZOY A;  2UXH A;  2TCT A;  3BR0 A;  4V2F A;  3BR2 A;  4XK4 A;  2TRT A;  2Y30 A;  3HE0 A;  2IU5 A;  4MXM A;  2XPW A;  3LHQ A;  3QPL A;  3G56 A;  5HAW A;  3NPI A;  4CGR A;  4M3E A;  2OER A;  3B6A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...