1ZKGA

Crystal structure of transcriptional regulator, tetr family (tm1030) from thermotoga maritima at 2.30 a resolution
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
200
structure length
200
Chain Sequence
VLSKRDAILKAAVEVFGKKGYDRATTDEIAEKAGVAKGLIFHYFKNKEELYYQAYMSVTEKLQKEFENFLMKNRNRDIFDFMERWIEKKLEYSASHPEEADFLITLVSVDEGLRKRILLDLEKSQRVFFDFVREKLKDLDLAEDVTEEIALKFLMWFFSGFEEVYLRTYQGKPELLKRDMNTLVEEVKVMLRILKKGMTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords transcriptional regulator, TetR family
publication title Crystal structure of TM1030 from Thermotoga maritima at 2.3 A resolution reveals molecular details of its transcription repressor function.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 69
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1zkgA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 1zkgA02
1ZKGA 3G7RA 3OIOA 5EGOB 4NELA 1RESA 1WI3A 1G2HA 2JK3A 5EDNA 1ORKA 3ZOBA 2JA6J 1K61A 2NX4A 4IHVA 4S0HB 1E3OC 5C44J 2QOPA 2VUMJ 3GTQJ 4EEFG 4DYQA 5JLWA 4KWAA 2GENA 2R5YB 1RKWA 4A3MJ 1CQTA 5BNGA 2NVTJ 4IHWA 4AYBN 3DPJA 1WGXA 3FKIJ 1YRNB 1IG7A 5IP9J 3ZQIA 2MGQA 3BTJA 2DMUA 1K83J 4JX4A 2NVQJ 1Z0XA 2XPUA 1JUMA 2YU9J 2LKXA 1DU0A 3DEWA 3AQSA 3VW2A 3P9TA 2CQXA 1OCPA 4DZPA 3KNWA 2DJNA 2JA8J 2K9SA 4AC0A 3OOUA 2ME0A 3BT9A 4IHYA 2L9RA 2JN6A 2CU7A 4M3BA 4AUXA 2LY9A 1ZR2A 2G7GA 3HTJA 1BW6A 3NXCA 1JKQC 5FHPA 4UUSB 2E1OA 3GEUA 2P81A 2WV1A 1UI5A 3S1QJ 5M5YJ 1B72B 5IYDJ 4DYRA 1HOMA 4NN1A 4GCLA 3BR1A 3VUQA 4A3GJ 2LD5A 3BG5A 5C4XJ 3E7QA 4M3GA 4LOCA 1OCTC 2QF7A 4MIMA 5F1JA 4JP0A 2R0QC 2E2HJ 1ETYA 1TWFJ 3CMYA 2D5VA 3S2DJ 3S1RJ 3K7AJ 1RR7A 3EGQA 4A69C 4A3FJ 3QKXA 3C07A 1ETVA 2COBA 3SFIA 2CQQA 5FKOA 5IP7J 2ID6A 1ENHA 4NDLA 1JKRC 2IAIA 2TRTA 2QKOA 4XRSG 4RBOA 4XICA 1MSFC 4IHXA 3COLA 5EF6A 3F0CA 2DMQA 2HXOA 2DMPA 3O8HA 3HKZN 1TWGJ 1T33A 2MG4A 1Y1VJ 3KKDA 4W1UA 2H8RA 2X6OA 4AF5A 3LSGA 3JRGA 3G1OA 2KT0A 1FIPA 1ZGWA 2EBIA 3ZQCA 4X6AJ 4FE4A 1SGMA 2XGEA 3KZ9A 3HM5A 2MW8A 5C3EJ 3S1NJ 3NAUA 1JTXA 2NVYJ 2Q24A 2L0KA 4MFEA 2QTQA 3LSJA 3VVYA 4G12A 2XGDA 4BBSJ 3FISA 3WHCA 4XRMA 4JKZA 2OPTA 5IYCJ 5K7HA 1JTYA 3RD3A 4V2GA 5CXGA 1MBEA 4M3FA 1U8BA 3QBMA 2YVHA 3G1MA 4BBRJ 4BKXA 4XRSA 1HCRA 3BR5A 5IYBJ 1ZK8A 3M3YJ 4L5EA 4DW6A 2DTZA 4C3HJ 5GPCA 2H1KA 3CWRA 2DA7A 2LR8A 2GUHA 1JT6A 1AHDP 2R93J 1WCMJ 3ON2A 1X2NA 4RDUA 3LNQA 3V6GA 1U78A 1ETQA 3A02A 1H8AC 5E3OA 2UXUA 2M9HA 3HTIA 2GM4A 2REKA 3LSPA 5EFYA 1IRZA 4A93J 1VFCA 3T6NA 4A3IJ 3VP5A 2WAQN 4DYCA 3BRUA 2NS8A 3JRAA 2EZIA 1BA5A 1AU7A 5F0CA 1GT0C 4D7MA 3SDGA 4ICHA 3JRIA 3S15J 3BHQA 2ZCXA 5K58A 2K9NA 3ANPA 5F27A 1APLC 1FJLA 4MK6A 5DS9A 1JUSA 2NOGA 3G1LA 2ZOYA 5F04A 2M0CA 2GBYA 1F36A 3I4MJ 2WGBA 1MH4A 3ZQFA 3HOUJ 2YVEA 1SANA 2TCTA 2X9DA 4UUTA 5IOYA 1Y1WJ 2PZ9A 2EZHA 2ZB9A 3RZOJ 5FKLA 2HDDA 3O60A 1GVDA 4CYCA 3VW0A 2DA4A 4MLOA 3K2AA 4M3EA 3VPRA 2XSDC 2R5ZA 3EUPA 3HTAA 1R9TJ 3A03A 1JUPA 4JX5A 2K40A 5HODA 3S16J 3MNLA 2ZCNA 4FE7A 4B3AA 4W97A 3JRFA 1P7JA 3HOXJ 3BTCA 1ZR4A 1PUFA 3AQTA 3LSRA 3PO2J 1NK3P 1ITYA 1IUFA 3HOVJ 1QVTA 5HBUA 1GUUA 2F07A 1WH7A 2Y0SN 3LOCA 3S17J 3VOKA 4ACIA 3HB9A 3LWJA 1U9OA 3RZDJ 4GFBA 4CYCB 1IDZA 2EQRA 2NVXJ 4BXXJ 1UHSA 9ANTA 2EZLA 2G0EA 2RASA 3S5RA 3Q0WA 3VVZA 1HDPA 2R5ZB 1TWHJ 1A6IA 4HNVA 2G3BA 5HAWA 4AC6A 3HOWJ 3HTHA 3E7LA 3A01A 3BQYA 2WUIA 3GTPJ 3S1MJ 4MXMA 3CDLA 3BR2A 1MBFA 1TWAJ 3BG9A 3BCGA 5K7FA 3KKCA 2ZCMA 2RAEA 3S14J 2HI3A 1TC3C 2IEKA 1POGA 5FKMA 5E3NA 1QPIA 2GLOA 1W0TA 2NP3A 2HYJA 4X1EA 1BL0A 3NPIA 4J19A 2LP0A 2Y30A 1F43A 2XRLA 4ME9A 2DMNA 4CGRA 3IH3A 3UKGA 3A01B 2LK2A 2XGCA 2WB1N 3QQAA 4FISA 5DTDA 2I10A 3Q0UA 5F08A 3JR9A 1B8IA 5J1YA 2HOSA 3NNRA 1GV5A 2M8GX 2PBXA 4YZEA 4BY7J 1BW5A 5M3MJ 1IGNA 5CXIA 2MSYA 2UXIA 2JA5J 2CJJA 4JL3A 1XC5A 2FX0A 3HGYA 5HSZA 1RETA 5GP9A 4B4CA 3TW6A 2W48A 1IV6A 1JGGA 2K9QA 2FD5A 2ECBA 4B1RA 1VNDA 1X2MA 2HKUA 3Q3SA 5FJ8J 3MVPA 1W0UA 2D6YA 2L7MP 2RHAA 3LHQA 2DA2A 2G7LA 2EH3A 2NP5A 3RQIA 1D5YA 2O9LA 1B8IB 3GTLJ 2G7SA 5DAJA 1LE8A 1ZTRA 4A3EJ 2L7ZA 3BG3A 3GTJJ 1NTCA 5J1UA 3BJBA 4M6VA 2R7ZJ 5D19A 3V78A 1A5JA 3BNIA 4GCKA 2FBQA 2QWTA 1LFBA 2DA3A 4L62A 2E2IJ 2Y2ZA 3NARA 2UXOA 2UXPA 3WHBA 5EZHA 3RKQA 1RKTA 2QCOA 2YS9A 4BY1J 2IU5A 1QVUA 4MO7A 5FLMJ 2Y9ZA 1OJLA 1JJ6C 2E19A 2HOAA 1MNMC 1DU6A 5H9TA 1HDDC 5AQCA 2CUFA 1BJZA 1Z77A 2LLKA 3TP3A 2DG7A 1HLVA 2CUEA 1I6HJ 5M5XJ 2DN0A 3JRDA 1MBJA 4A3LJ 3LJLA 5FGLA 4A3DJ 4A3JJ 4M3DA 4UDSA 3JRBA 2PMZN 5K7ZA 1ETWA 1TWCJ 2XPWA 2OI8A 5D18A 1JT0A 2LTPA 1P7IA 2AHQA 2Y9YA 3CJDA 2JMWA 4GFKA 2HQ5A 2XDNA 2DMTA 5GPAA 3F1BA 5C4YA 1RPWA 5FMPA 2LFBA 3ZQGA 3MKLA 4C2MJ 4I6ZA 5EG0A 2UXHA 1YRNA 2HXIA 4MFDA 2KDZA 2YUSA 4C3JJ 3GTGJ 3NRGA 1XS9A 2VKEA 3JREA 4FTHA 3VIBA 3FK6A 1T56A 2HOTA 2E2JJ 1U9NA 1IDYA 1MBHA 1MH3A 3JRHA 3GTOJ 2O7TA 1H89C 3GTKJ 5EYRA 2M2EA 3O8GA 1ETXA 3BR3A 3I4NJ 2OERA 2CRGA 4PXIA 3H0GJ 5FKKA 3D1NI 2XB0X 5M3FJ 2EZKA 1VI0A 5EG0B 4UUSA 3GZIA 3BTLA 1WH5A 5J1RA 1FTTA 2VKVA 2VI6A 5EEAA 1B72A 1PUFB 3VW1A 2FJ1A 4V2FA 3HOZJ 2Y31A 5FKNA 1GDTA 3GTMJ 2ZOZA 3QPSA 1NK2P 2DA6A 2V57A 3Q0VA 5CW8A 2NS7A 2FQ4A 4DZJA 1HF0A 3M4OJ 3RH2A 2O8KA 3OSGA 1H88C 1Q1VA 3IH4A 1JJ8C 2DG8A 3CCYA 3B81A 3MN2A 3ZQLA 3ANGA 3L1PA 3ON4A 3TP0A 5JLXA 2O7OA 3BTIA 5FLVA 3ZQHA 3HOYJ 1JKOC 1LFUP 2DA5A 4D5CA 4GCTA 4XK4A 1UMQA 1I3QJ 3TW7A 3CRJA 3HBLA 4QSHA 4FCYA 1EF4A 3BQZA 5F0HA 3HDDA 5IP6A 1IC8A 4QTRA 3G56A 1XG1A 3QPLA 3IUVA 3CQZJ 1MBGA 1MSEC 2OF7A 4D5FA 1AKHA 1X58A 2JJ7A 3PM1A 3B6AA 3HIMA 2ME6A 2AO9A 5E3LA 3GBGA 2L7FP 1FEXA 3SJMA 3BR0A 4ABZA 3W6VA 4Y52J 1WPKA 5D1RA 1I50J 3VOXA 2VPRA 2LVSA 3PPBA 4I76A 3HEFA 3VVXA 1FTZA 3DCFA 1MBKA 5E3MA 3PASA 1AKHB 1QRYA 2QIBA 2GFNA 5IPAA 3H3VK 4D7NA 5F0FA 3FRQA 4GFLA 2ID3A 1O4XA 2N8GA 4HKUA 3C2BA 3BR6A 1ETKA 1LE8B 2JA7J 1ETOA 3S2HJ 1VF9A 3FK7A 3PO3J 3OSFA 2IBDA 1GV2A 2ELKA 5IOZA 5M5WJ 2XPVA 1UI6A 5EGOA 3NI7A 2B63J 4JNNA 3B6CA 3HGGA 2X48A 3IH2A 3JRCA 4QIWN 4JX6A 3TEDA 3HE0A 1IJWC 1ZQ3P 5J3LA 2W53A 5C4JJ 1S7EA 1FIAA 2HYTA 2M34A 3JSJA 1JKPC 1UG2A 4JYKA 2XB5A 2JWTA 4Y7NJ 2DA1A 4C3IJ 2R5YA 4XIDA 3IV5A 2R92J 4A3CJ 1OFCX 4IEJA 3FIWA 5EZGA 1SFOJ 2ECCA 4A3BJ 4A3KJ
chains in the Genus database with same CATH superfamily
3G7RA 2K3FA 3LSKA 4ANJA 5L3DA 4JOMA 3K8PC 4XM3A 3G3ZA 1IXRC 2JK3A 3S3MA 3WG9A 3ZOBA 1YX3A 3B02A 5EDNA 5D8LB 4AIKA 2A5WA 3I9V2 3S3NA 4YG2F 4R8HA 3CP2A 2VKHA 3I53A 2A69F 3GTQJ 4F93B 1TW2A 4KWAA 2GENA 2R5YB 3FXMA 4O3MA 4BE2A 3KP5A 5BNGA 1EJ9A 1IZ1A 2NS0A 2ADUA 2FNPA 1WI9A 2Y0SA 1LVKA 4OMZA 3I59B 3FWEA 2B9SA 1MDMB 4HF1A 4E7SA 4IHWA 4AYBN 1ERDA 2P8TA 2KFDA 2RC4A 2VJIA 5IP9J 3BTJA 3NEUA 2DMUA 2L9VA 2LBFA 5B1BH 2YU9J 1VQ4I 1DU0A 3HRUA 3VW2A 4A5NA 1Z1DA 3QU3A 4DVYP 2DJNA 3K4KA 4KN4X 3NQOA 1X1CA 3BT9A 3GCMA 3V7RA 5E20A 1ZR2A 2LY9A 2VJ5A 2OTJI 1BW6A 1Z7LA 1KYWA 3EETA 4BQNA 2HQNA 4LLNA 5L3FA 2P81A 4A0XA 3WTVC 1VQNI 1IRFA 2GWRA 2HS5A 1VQLI 3JCUC 2FJI1 3BWGA 1W36D 3VUQA 4RS8A 2HFHA 5C4XJ 3BG5A 1OCTC 4ZYGA 2CO5A 3CCEI 2B0LA 3M07A 1IV8A 1IUYA 1TWFJ 1RNLA 2D1VA 3CMYA 3CP8A 1FSHA 3KX2A 2CMPA 3SZPA 1D1CA 2CYYA 1G8XA 2IJLA 3CJRB 3QKXA 3CCVI 5LRRA 2COBA 2CQNA 4NBQA 3GWZA 3T1BA 2WY7Q 1N77A 3V8KA 5FKOA 5IP7J 3PNTA 2TRTA 4FHTA 2QKOA 4XRSG 4IHXA 3BP8A 4ZTFA 2GAUA 2DMQA 3O8HA 1BIAA 4ASNA 1T33A 3KKDA 3QYFA 2X6OA 4FQGA 1X4PA 3VEPA 4EM1A 2WADA 3RYRA 4XNFA 4RMNA 3ZQCA 4X6AJ 4M6YA 3VFZA 1XDSA 3NAUA 2DYRH 1BIBA 1JTXA 2Q24A 4LJZF 1Y39A 2QTQA 2ISYA 3DTIA 3QP6A 4A0YA 3VVYA 1R7JA 3FM3A 1DPRA 3FISA 4F7ZA 2OPTA 1A6QA 4ETSA 2L01A 2H27A 3RD3A 2L4MA 1MBEA 3BLYA 1U8BA 3QBMA 3KP6A 4BBRJ 2YVHA 1PVEA 2A61A 3BR5A 3M3YJ 4ESBA 3E97A 2J5OA 4DW6A 5LEJA 3WU1B 3KETA 3K4CA 2HKXA 2X1DA 4A12A 1AHDP 1B9NA 3HPHA 5BPDA 4XLAA 1WCMJ 4HSTA 4RDUA 3V6GA 2PEXA 2UXUA 3VDXA 2M9HA 1A36A 1O3TA 2BY0A 1DDNA 5EFYA 3KLOA 5LGTA 3T6NA 3V7SA 4A3IJ 1I39A 1BC7C 1WJFA 2P5VA 5D6EA 4LLLA 5F0CA 2QVOA 1LNWA 5J4YA 5D5XB 3CCRI 3VODA 1JI8A 4P96A 2R7QA 4IQJA 3F8CA 3CC2I 3BHQA 2DDAA 2HZDA 2QEXI 2ZCXA 3L00A 3ZCOA 2A6EF 2XAFA 3KP7A 5F6FA 3L2CA 3K70D 1HBXG 1FJLA 5DS9A 3OWTA 5A2QZ 5JFRA 3G1LA 5K5QA 5F04A 3AL0B 2MBFA 1F36A 3I4MJ 1HC8A 5HVQC 2YVEA 1SANA 3HL2A 3CCMI 2EZHA 3R0AA 2X6WA 4LIVA 3ZPLA 4M73A 1GVDA 1S72I 2K9MA 3BDDA 2EPFA 2BBYA 2CUZA 2CQ7A 5F64A 2KKOA 3EUPA 2XSDC 3CMEI 1MIJA 4IRHA 2K40A 1T08B 4C2UA 2ZCNA 4FE7A 4B3AA 4Q4ZF 3JRFA 1P7JA 1LQ1A 1G59A 1W36C 1S3JA 3GMEA 4JQFA 3CJTB 1M1EB 4V19K 2EV0A 2F5CA 5K1YA 3MMYB 4HOBA 1S8NA 4GGGA 4IZZA 1S7OA 1LJ9A 2Y0SN 1B4AA 3PFIA 4ACIA 3TBIA 1FNNA 3OR2C 3RZDJ 1SFEA 2RASA 2EZLA 3S5RA 1KONA 3NWTA 1HDPA 2R5ZB 4HNVA 1MMGA 2KL4A 3VYTB 1IN7A 3A01A 2MYSA 3WTYC 2GZWA 3BQYA 1E3HA 2FF4A 3KP4A 3GTPJ 3FBIB 3IL2A 1B59A 3S1MJ 4EJWA 3CDLA 3FMQA 3I5UA 2XAUA 2PJRB 3GFIA 2F4IA 5K7FA 3KKCA 2ZCMA 2V7FA 3SEQA 2RAEA 2HDCA 1BI1A 1TC3C 1SMTA 1POGA 2IEKA 1FY7A 1QPIA 2BW3A 3CO7C 4EJTA 1YI2I 4IL6C 2NP3A 2ZMEA 1KGSA 1BL0A 4Q5SF 3NPIA 4IHTA 3K4NA 3KE2A 2FMLA 3AG4H 1F4KA 1FMVA 3UKGA 1JE8A 4UVCA 2E1CA 4GRIA 4IX7A 3V7CA 2E36A 3ABKH 2VOPA 2I10A 2BHYA 3E6MA 3GW2A 5J1YA 5LD2C 3ZMSA 1GV5A 4AD9A 2M1BA 5E8GA 3J7YJ 2VIXA 2W1OA 2PBXA 5TISC 1L0OC 2F5FA 5M3MJ 3CCLI 2HWVA 5CXIA 4JL3A 1XC5A 3GLXA 2O5RA 1Y8RB 1RETA 4B4CA 4AVPA 2ZXIA 3F8MA 4YFNF 4XONA 1ZGJA 4F55A 1W0UA 2RHAA 2DA2A 1YJ9I 4U9LA 4OINF 1JHHA 1MMAA 2P4WA 1UHWA 1YE9A 5FFXA 2EJRA 1LE8A 2FRHA 3H9JA 4A3EJ 5CQEA 3TGNA 2L7ZA 2RNGA 3MEXA 1PP8F 4II3A 5J1UA 3GTJJ 1OR7C 2ELJA 2R7ZJ 3CZ6A 2W84A 2Q0OA 3K4MA 3V78A 3K70C 4EGZA 1LFBA 2CV0A 4DIQA 4II2A 5IY5H 1YW9A 1AOYA 1YW8A 2VONA 1I3AA 1WKMA 2XF7A 3MKYB 4AU7A 3IRRA 2VBYA 4A6DA 1T38A 5TJJA 4E7HA 4ZDOA 3IKTA 1MZBA 5TGTA 1U0JA 3C7JA 3DBRB 4N4OB 3ZP5A 4E7ZA 1NH3A 2C6YA 2E19A 4ZJZA 5H9TA 4IVNA 5AQCA 2P7CB 3TP3A 2CUEA 1JGSA 3TO6A 3DEUA 3I64A 4ITVA 3LJLA 4RM3A 4UDSA 3H36A 4FASD 2VQCA 3QRFF 1W7PB 4C30A 1G3YA 3TL4X 4B43A 2XPWA 2IVMA 3IRQA 1P7IA 4MEYF 2V1NA 1Z91A 1G6NA 2HQ5A 2ZBKA 2OCEA 2KDOA 5HS9A 2XDNA 3ZQ7A 2QQAA 3RJPA 3ZQGA 4I6ZA 3COAC 4OMYA 2ZXWH 3KZYA 3LAPA 3L7WA 2KDZA 2XGXA 1ULYA 1DUXC 3OYHA 2YUSA 1REPC 4XLPF 5BPIA 1KQ0A 3CUOA 2P5LC 1XS9A 2XUBA 4I98B 4CCOA 2HOTA 2E2JJ 2K27A 2YSRA 3F23A 2W4SA 3O8GA 5LHIA 1ETXA 2DOFA 2QENA 3BR3A 2OERA 2KIQA 1ZREA 4RAZA 2W00A 4P1WA 2E1NA 1JHFA 2XB0X 2O8XA 1AA7A 5M3FJ 1VQPI 3HUGB 2EZKA 5EG0B 2CV1A 3BTLA 1WH5A 3DQVC 4XKWA 3H3UA 2MA3A 3UNGC 2DODA 2VKVA 1HSJA 1SFKA 1IN6A 3F8FA 2FJ1A 2B7EA 4C2TA 2Y31A 5FKNA 5B66C 2ZOZA 3QPSA 2MH2A 5L3CA 1R23A 5CYVA 1QU3A 5ILUA 1XSVA 5IT3A 3W6KB 3EYYA 4N9HA 4WX9A 3N05A 2DQLA 2VN2A 3OL4A 5CPRB 3IUOA 3MN2A 3R61A 2NNYA 1QA6A 2DAOA 3TP0A 2L02A 2MH9A 4LITA 3Q9VA 3ZQHA 4CZCA 3SDBA 4D9JA 1R5HA 1X1AA 3B73A 3P5JA 5A2QK 5FFZA 1I27A 1X3UA 4RGRA 5GAHJ 3HBLA 2GXAA 3MKWB 3GXOA 1K4TA 2IGMA 3FHZA 3BQZA 4H4KC 5F0HA 5IP6A 5EEHA 3WODF 1BBYA 4KIGA 1VQ5I 4LMYA 1W5TA 3CQZJ 2PLYA 4L5JA 4D5FA 4U0WA 3H9GA 3PM1A 4LK1F 3HIMA 4NC7A 1CGPA 4IKFA 1RC9A 4ZZLA 4IOAF 1D8KA 2HEOA 4ABZA 3W6VA 1I50J 2IGOA 3VOXA 3TOAA 5AIPA 3PPBA 3HEFA 3VVXA 4A5MA 2DO7A 3OYBA 2Z33A 3NRVA 1U3EM 3BJ6A 3RDIA 4PDKA 5AIQA 3PASA 1QRYA 2W57A 4ENKA 3TMOA 5IPAA 1PDNC 1K4SA 4D7NA 5F0FA 4U7BA 1VQ8I 5HOOA 3FRQA 4LLGF 4RAYA 3SHFA 2IW5A 3EUHA 4DQ2A 3EUAA 1T0FA 2PI0A 3C2BA 5DD4A 1BR4A 3ONQA 2ZC2A 3I0TA 1ETOA 2GIVA 2QKMB 1ZGAA 2IBDA 1GV2A 3T8RA 2ELKA 5M5WJ 2XPVA 4BHBA 2PFBA 1XGMA 4ESJA 1YQAA 3JRCA 1IN8A 1LUJB 3VTIA 2Y75A 4A2UA 5E17F 4PFPA 4XOTA 3HE0A 1ZQ3P 1UFMA 4BYYA 2EB7A 2W53A 3WTXC 3QPHA 3DWLE 2M34A 5CVVA 4OIQF 1UG2A 4Y7NJ 5J8CA 3PUFA 2PMZA 2EFWA 4DBQA 4XIDA 3IV5A 2CW0F 4PFOA 3QYEA 1B6AA 2LMDA 3FIWA 4BU2A 5EZGA 3CDIA 2DLLA 3KIOA 1SFOJ 4YRVA 1ZKGA 1MNDA 5ICCA 3E6CC 2MABA 1WI3A 1IN5A 4KN7X 2ZNZA 5E1WA 3FF5A 4GYIA 2ZXJA 1BOAA 1O3QA 1K61A 1V5FA 2QSHX 4NC8A 5C44J 3ML6A 1LDDA 4G6TB 3K1PA 2VUMJ 2O6GE 3AG3H 3OIQA 4DYQA 5FLXZ 2BV6A 3QODA 1HQCA 2X1EA 5JHUA 4WIBA 4G9YA 4LIUA 2NXNB 1R22A 2V1DA 1ZLKA 4CGZA 2W25A 1IG7A 1ZN2A 3ZQIA 3CCSI 1W4MA 1QZZA 1K83J 4KUMA 2NVQJ 1S5LC 2X0LA 2XPUA 4BDZA 1Y0NA 1U6GA 4L9JA 4PGGA 3AQSA 2M3AA 4U88A 1GXPA 1IW7F 3R0JA 1OCPA 3K10A 5KCMA 2OD5A 2K9SA 4AC0A 2ME0A 1G3SA 2VQHA 5ICEA 2VPLA 4XSZF 4IRVA 2JN6A 4B3XA 2KJBA 4AIJA 2X85A 2E1OA 2HU9A 3HHHA 3M1CA 2PFVA 1Z3YA 1OMIA 2H6CA 3M8EA 5M5YJ 1B72B 3GF2A 2LBFB 5IYDJ 1TZLA 2GQQA 3QOEA 4DYRA 1SD5A 3L2VA 4KJZA 3BR1A 2WB1A 1BC8C 4A3GJ 4A0ZA 1QHHD 4M3GA 3M7GA 1P6RA 3MZYA 5F1JA 2PMUA 2DT6A 2HDWA 1GXQA 5H6QA 3G73A 1TL8A 2E2HJ 2FQ3A 2M0MA 3S2DJ 3K7AJ 1RR7A 3IC7A 3DXJF 4OU0A 4A69C 5FB2A 2DJIA 4MGRA 3ULQB 4EJOA 5KNLA 2FOWA 2IT0A 2PMHA 2LG4A 3LSMA 3VB2A 3HSEA 1YS6A 2IXSA 4RBOA 1ZRDA 3COLA 4LD5A 4U0YA 2J5PA 5E8IA 3F0CA 4UVAA 4XORA 3D0SA 1TWGJ 3OYFA 2MG4A 2FU4A 2ZSHB 3LSGA 4QPQA 3JRGA 1HKTA 2DCEA 5L3BA 3G1OA 4AIDA 5FRMA 3DPTA 4G7OF 2EBIA 3BG7A 1SGMA 2F48A 3HM5A 2MW8A 1IO2A 4O6JA 4MHGA 1R00A 3OYGA 2HZTA 4MFEA 5J6XA 3LSJA 1ZG5A 1WJ5A 1H9TA 2MC4A 2XGDA 3PSIA 4FX4A 4Y13A 1K79A 2ZXHA 3WHCA 4XRMA 1SAUA 1J75A 5IYCJ 4XKBA 3DTEA 3FX3A 3G71I 2KISA 2CSOA 4PUSA 4V2GA 4M3FA 3FMSA 2VODA 3G1MA 1XN7A 1ZK8A 3R60A 4IRGA 3U1DA 4L5EA 2XC7A 1X19A 1ON1A 1XTAA 2WA0A 3P9CA 1FT9A 2MFZA 2WY8Q 3WGGA 4S05A 2A5YB 1ON2A 4ENNA 3LNQA 1ETQA 5E3OA 1D3YA 4B09A 4HRIA 2GM4A 1OLTA 1O3SA 2COMA 4A93J 1VFCA 1XGOA 4ZC3A 2HVRA 3BRUA 2QBYA 2NS8A 1X3ZB 3MZHA 1IXSB 1XX5A 2EZIA 2Y0MA 2XKPA 5ERIA 1I5ZA 5HNHA 1YJNI 1X1DA 3S15J 1U5TA 3FXRA 3CUQB 3HJEA 5GAGJ 2K9NA 3RTRA 5TRDA 2F5DA 1WZ2A 2DOEA 4MK6A 4I2OA 3KYCB 3Q9SA 2ZJ2A 2KIFA 2M0CA 4NHJA 2GBYA 2MLGA 2UZKA 1MH4A 3ZQFA 4EJVA 1Y1WJ 3ESWB 1SVLA 3RZOJ 1WRJA 2HDDA 4B47A 3KYDB 2WBMA 3O60A 3F6OA 4CYCA 3VW0A 1KZHA 3W6JB 1H0MA 4G7ZF 5B1AH 3KEQA 1TNTA 2EILH 3FDYA 3J81Z 1HKSA 2XDVA 1YW7A 1X1BA 2DXIA 1R36A 4LFUA 1PUFA 3HOXJ 2F5VA 3E1SA 4PJNA 3DBLB 2HR3A 5HDKA 1WWXA 4EQQA 1NK3P 1IUFA 3HOVJ 5HBUA 4CDGA 4BE0A 1GUUA 3MWMA 1FBUA 1D0XA 4NQWA 4E7LA 3LOCA 3S17J 3VOKA 4Y33A 5CKTA 3U21A 4BH9A 5JI6A 1U9OA 1Z05A 4QPOA 2G7HA 2VL8A 3LWJA 4GFBA 2RNJA 4YIRX 1FC3A 2EQRA 1VQOI 2W85A 2VOOA 2G0EA 9ANTA 3Q0WA 2Z9OA 1VQKI 2R7SA 1S6LA 5HAWA 4M71A 3HTHA 2EFPA 1QNTA 3E7LA 5D8KB 2M7BA 1G3WA 4QWQA 2WUIA 2DYSH 4ENJA 3MFKA 4I09A 3U2RA 1RUOA 4MTEA 2XV4S 1E3PA 4HV6A 3W3CA 3M8FA 5JR3A 3SYTA 2HI3A 2OQRA 1A31A 2IS4A 5E3NA 2K9LA 2GLOA 1WJBA 1W0TA 3FXLA 4WXCA 4G8XA 2Y30A 4IO9F 1F43A 1WQ2A 2DMNA 2F2EA 3IH3A 4LG3A 3CJNA 1N25A 3A01B 1HW1A 3QQAA 2WB1N 4GXOA 4IF4A 2A68F 4EV0A 5JVGF 3EDPA 4I02A 2DT7B 4CSWA 4R1HA 3JR9A 1ZARA 4XSXF 4N0BA 1FOXA 3M9AA 3CF2A 4YZEA 2R3SA 1BW5A 1L3LA 1IGNA 4U7DA 1TLHB 3S8PA 5LHHA 2CJJA 1DPUA 2KQRA 1G4DA 5HSZA 1Z3XA 1YTYA 3ASNH 5GP9A 1W5CC 4I7HA 3TW6A 4BAYA 4WXHA 1SAXA 1XSXA 1FLIA 4B1RA 4HQMA 2L7MP 1OISA 2G7LA 3RQIA 1D5YA 2E71A 4HX7A 1V54H 3H3ZA 1YYVA 3GTLJ 4FETA 2JUCA 2G7SA 5DAJA 2MD5A 1ZTRA 3TO9A 1UB9A 3A1YA 1MMNA 1TNSA 1A5JA 2KHMA 4HYEA 5H20A 4ZTJA 2K02A 2XHKA 4H0EA 2Z3YA 4HLYA 1D1BA 2Y2ZA 5CVIA 4OAZA 2UXPA 3WHBA 2A07F 2KMUA 1QPMA 5EZHA 1RKTA 1UELB 2QCOA 2YS9A 4BY1J 1QVUA 1GHCA 4MO7A 3DBHB 4LK0F 4OIPF 4UXNA 5LBQA 4AVZA 3BZCA 1FYLA 3WU0A 1MNMC 1DU6A 1HDDC 2LLKA 2DG7A 1I6HJ 2DN0A 5FGLA 4BXUA 5FRNA 1TTYA 4M3DA 4A3DJ 4BS9A 4IHSA 3RKXA 5K7ZA 4XN3A 3EUKL 1ETWA 2Y9YA 4GFKA 1ZHFA 2EFNA 3U9GA 2BXYA 1OYWA 3F1BA 2DMTA 3VYRB 1MDMA 1FOWA 1D8JA 3MKLA 4WF2A 2UXHA 2Z5UA 4UV8A 4HF0A 3GVAA 5H2FC 3H5NA 2RKHA 5CJ9A 3GTGJ 2W82A 4D0PA 2JRTA 3JREA 4HLXA 2OC6A 4FTHA 3VIBA 1U9NA 1WVRA 1IDYA 3FHNA 4FX0A 2HTSA 3OY9A 3GTOJ 2O7TA 1H89C 1J9IA 2M2EA 2STTA 1A04A 2JSPA 4MQ9F 2V6EA 2VKDA 4KIFA 1ZG1A 1HSTA 3HOTA 3AL0C 3WTTC 2VI6A 1VTNC 2K7LA 3WTUC 3HOZJ 3X2QH 1UJ8A 3V8LA 4BHCA 2F4MB 1GDTA 2EWNA 1V5GA 2M7AA 1NK2P 1YX5A 4XLEA 3RIRA 4YELA 1GVJA 5CW8A 3KZIC 1DGWY 3N4MA 1CF7B 1HF0A 1D0YA 1EA3A 1B1BA 1YFHA 2L4AA 2O8KA 4I99C 1H88C 3W2WA 3IH4A 3JW4A 1P4WA 4M9SA 2DG8A 3CCYA 4OAYA 1BI2A 2TDXA 3WTWC 3LA7A 3BTIA 3S93A 2ZCWA 2H09A 4M74A 3D5RC 3JTHA 1UMQA 1W7PD 1A35A 1OKRA 3TW7A 4ZDLA 4DBRA 2I5UA 4FCYA 1EF4A 3OS2A 2R7DA 3BY6A 3I56I 1YHQI 3G56A 3HKZA 1XG1A 2WAFA 2O03A 3QPLA 2L54A 1MSEC 3IP4B 4IRIA 2B3WA 2A3SA 2ZO4A 4KNYA 2VQGA 2WV0A 3QPTA 3J81K 1QO0D 1YIJI 1FMWA 2ME6A 2AO9A 3V4GA 5E3LA 2K86A 1TT0A 3GBGA 2DOAA 2L7FP 1FEXA 4CXFA 3BR0A 2QYOA 4BJ5C 3S3OA 1Y56A 3LAJA 1FTZA 3C2GA 5FO5A 1MBKA 2K4BA 5GTHC 2BZTA 2GFNA 3ECOA 2JVHA 4GFLA 5DV5A 3WGIA 2L2OA 2XRNA 4BEHA 2ID3A 3DKWA 4HKUA 5BQTA 2STWA 2KIUA 1ETKA 2VLAA 2JA7J 4CO8A 1USSA 3OV8A 3FK7A 3PO3J 1KYZA 2D1HA 3KLNA 4LG0B 3CLQA 4BJTA 1Y0UA 1UI6A 5EGOA 4JNNA 2B63J 1LDJA 3B6CA 2WTEA 2X48A 3HGGA 4S04A 3EPZA 4PJJA 3LQQA 4PK4A 3RSNA 4JX6A 3PFYA 3KZZA 3WTZA 5L3EA 1R5GA 3QOPA 3E5QA 1S7EA 1FIAA 3L2QA 1JKPC 1S7AA 4LGWA 2FOKA 4KICA 2VBWA 2XB5A 4DJAA 4C3IJ 2OZ6A 2RV8A 5BMZA 4OIRF 4IEJA 4RB3C 5H6RA 4ZH4F 4RAFA 4A3KJ 1LEAA 2F5EA 3OIOA 4NELA 2L9NA 2ZFWA 1RESA 5KVRA 3HG9A 4KMUX 3OYCA 4HW0A 2LF7A 3GLLA 1ORKA 4ZYEA 5FD6A 2JA6J 3AG2H 1E3OC 2QUFA 1V4RA 3GEZA 4I0AA 1UZCA 4AWXB 5D5UB 1PUEE 2LY2A 4EEFG 5JLWA 4LB5A 3MCZA 3HRMA 4A3MJ 2QA4I 1O7FA 3K4BA 2R7FA 1WFXA 1K78B 5DUIA 1LEBA 3DPJA 4N9IA 1WGXA 1YRNB 4CHUA 4JX4A 1Z0XA 1C0WA 3GFLA 2M30A 2R7UA 4Y4RA 2P7VB 2LKXA 4OD5A 2ESNA 3DEWA 3ROUA 2ZJQF 2CQXA 4G6DA 1R6RA 2Z2SB 2JA8J 3OOUA 4U9NA 1SD4A 2FXAA 3FXQA 1USTA 2OU2A 4RB0A 2L9RA 4M3BA 2CU7A 4AUXA 1D1AA 2G7GA 4P9FA 1LB2A 2YVXA 3NXCA 3L9FA 2DPUA 2JPCA 1JKQC 2XAGA 5DYMA 4UUSB 3OYMA 1R49A 3FXUA 1OR7A 2BXZA 2KRFA 4GDFA 2WV1A 2DK5A 2GXGA 1EH7A 3S1QJ 2M45A 3W2AA 3K9TA 2HPIA 1HOMA 4GCLA 1B9MA 3RPUD 3GO5A 2LD5A 2JRMA 3E7QA 4OIOF 4LOCA 2IGNA 1KA8A 4P55A 3K2ZA 1T98A 3L09A 2R0QC 3IHUA 3DKYA 1ZELA 1KU9A 2ESHA 2ZKZA 3S1RJ 3R4KA 4KT6A 1MD0A 3BZ6A 2Q2EA 3ERED 3C07A 2Y69H 1ETVA 4WXDA 5K5OA 2HKOA 2LYCA 1FPQA 3SFIA 3TO7A 2VXDA 4CCKA 2LNBA 2LF8A 1ENHA 2OV7A 2RVCA 2IAIA 4NDLA 3V42A 2NVUB 4EATA 1YITI 4QLCU 5EF6A 2JT1A 3DEEA 4YFXF 2HXOA 2DMPA 4NUBA 2M87A 3HKZN 3FKJA 1Y1VJ 4WK8F 5DCMA 2H8RA 2QWWA 3WG7H 4HF2A 4AF5A 2NNNA 1FIPA 4GYGA 4HPQA 5DD8A 4FE4A 4J01A 1VQ7I 5C3EJ 1IRGA 1UG0A 2NVYJ 4RLQA 1AWCA 1FP1D 3GX4X 1HW2A 3ZRGA 3RPQA 4JKZA 2V1XA 1F5TA 1IRXA 3DV8A 4EM0B 2BVMA 4HNTA 5K7HA 1UAAA 2X6XA 3FXJA 2FUG2 5IYBJ 2BEOA 4KFCA 2BGCA 2E7WA 3G2BA 4C3HJ 2PBIA 2H1KA 4KDPA 3CWRA 3TDUC 2LR8A 2GUHA 1BI3A 1KU3A 5D4RA 2OUMA 3OYEA 1U78A 2WWYA 2DQRA 2G9WA 3DU6A 2M4KA 4UB8C 3HTIA 2LOOA 2IGKA 2ZNYA 2CG4A 4Q47A 1IRZA 1WJDA 5ICFA 3EYIA 4KIBA 2Y48A 2BHZA 2KZVA 3F8NA 4KMFA 1AU7A 3E6BA 2GIZA 2M8EA 1BA5A 1GT0C 3WU2C 4D7MA 3I58A 4Y3OA 3JRIA 2W24A 1STZA 1MJBA 2PN6A 2NRAC 4IXAA 3PIPF 2VASA 4I01A 4XLCA 3T0YA 3DLAA 1I1SA 5DDGA 3ANPA 2UXXA 5F27A 1APLC 2X6YA 1VQ9I 3BPXA 2D2WA 5HS8A 2ZOYA 3OYDA 1QZYA 2DTRA 4M72A 4BDYA 4BXFA 3SEZA 2TCTA 2P6SA 4UUTA 2PZ9A 2DFEA 2ZB9A 3E5XA 1FBSA 3OOPA 2YU3A 3CTAA 3FBNB 1WJEA 2LH9A 3S2WA 2H6BA 2DA4A 3ZMVA 1K7AA 2L5QA 1FOKA 2VJ4A 3HYIA 4M3EA 1U5TB 3HSFA 1FP2A 3HTAA 3ZQQA 3A03A 1JUPA 5B5EC 3JAMZ 3S16J 4HNUA 3MKZA 1R58A 3AQTA 5LRSA 3FZVA 3LSRA 3PO2J 2L3DA 2VT2A 1QVTA 1FZPB 2ISZA 3PSFA 2F07A 1WH7A 1IF1A 2VC1A 3BOQA 3SZGA 2W7NA 2AS5F 4CYCB 1IDZA 4E7IA 4BXXJ 1BR1A 4HSRA 1TWHJ 1A6IA 2G3BA 3CD6I 4CICA 1J59A 3HZJA 3HOWJ 1TQMA 4XRFA 2ACJA 1LDKB 3CJQB 2P0WA 5IT9Z 3KP3A 4ON0A 1TWAJ 3KP2A 4NQWB 3ZMTA 2OBPA 4RGSA 5FKMA 4UUVA 3TKYA 3CDHA 2HYJA 3C2HA 3DPUA 2E60A 3WE2A 4CGRA 1VQMI 1SEUA 5K5RA 3LSIA 2XGCA 4FISA 1R1TA 1J0RA 3F9KA 3KEOA 3ABLH 3Q0UA 5B3SH 1B8IA 2EIMH 1LFPA 3OR1C 4HV5A 3NNRA 4M9ZA 2V4JC 4HA8A 2M8GX 2F6CA 4BY7J 2OAZA 1IN4A 2O3FA 2JA5J 3W2VA 3TOBA 3MQ0A 1WHUA 2OQGA 1OPCA 3WE3A 2GA1A 5LGUA 2W48A 1OYYA 3BJOA 3LA2A 2H1LA 4B44A 1F9NA 3Q3SA 5FJ8J 3T5XA 1P4AA 3J7AO 4XLFA 2E5NA 3LHQA 2O9LA 4RA2A 3CCUI 5KAIC 2FE3A 3H92A 4YIIA 3SWHA 4L9VA 3JTGA 5HLGA 2IS1A 3BG3A 2XAHA 4E4HA 5LFAA 5LLQA 3BJBA 4M6VA 2BY3A 1OCOH 2FEZA 4MQVA 3I3LA 5LEKA 5E18F 3LWFA 4GCKA 4Z6YA 2QWTA 2DA3A 2R7XA 4X0GA 4EMSA 3NARA 3MD2A 1G3TA 2UXOA 2RN7A 1IAWA 2H8WA 3J80Z 1LVAA 3RKQA 4XR6A 1ONVA 4OWRB 3LQRA 2ELHA 1MMSA 3SQNA 2IU5A 5J8FA 2PJPA 2PG4A 3OYNA 2QKLB 3DLLF 2A6TA 4L18B 3C1DA 5J40A 1QHGA 2Y9ZA 4RB2C 4UB6C 1OCRH 2HOAA 1P9QC 2LC2A 5BOXA 1BJZA 1Z77A 2IS2A 1X3WB 3ZMDA 4WCGA 3JRDA 1MBJA 4UVBA 4N4NB 4BQOA 2YPRA 3JRBA 2PMZN 1RIOH 3IWZA 4OD4A 1TWCJ 3DFGA 2OI8A 5D18A 1D5VA 2LTPA 1XPXA 2EV5A 3CJDA 2UWMA 1BJAA 1N78A 3PNYA 4BQAA 3NWSA 4XKVA 5GPAA 4ESFA 2B1EA 3I54A 1RPWA 5C4YA 1R4NB 2CQKA 2UXNA 2LFBA 3TQNA 1SC7A 2VBZA 4BQQA 4C2MJ 3H9QA 2O61A 2HXIA 2Z1DA 5HNFA 2AQFA 2DK8A 2R4GA 4HAMA 1X1PA 1QBJA 1RUNA 3M8JA 4WWCA 2QQ9A 3LFKA 4BNCA 1T56A 1MBHA 3JRHA 3PL8A 1SVOA 2KIMA 2AXTC 3I4NJ 3KPHA 2XROA 5EJCA 4PXIA 3FXKA 4F3QA 2R7VA 3CUQC 3D1NI 5ILSA 2G7UA 1VI0A 2CFOA 2HQAA 3GZIA 4Q48A 5J1RA 3O6BB 2FSWA 1E17A 1FTTA 2VC0A 3WGHA 5EEAA 1B72A 3VW1A 1ODDA 2K85A 4V2FA 2NAZA 2V26A 4OOIA 1MW7A 5FROA 4PGHA 4E70A 2ZJPF 4BACA 2DA6A 2V57A 3CO6C 1DQUA 2NS7A 2FQ4A 3RH2A 2V9VA 3OSGA 2QZ8A 3K69A 1Z7UA 1JJ8C 4L0YB 1EKEA 2WC2A 2BYVE 3OYLA 2IRFG 4G94A 3ANGA 3ON4A 1TT5B 1XGNA 3IAS2 3L2UA 5JLXA 2O7OA 4L9TA 3FM5A 3HOYJ 2BVLA 3GYHX 1LFUP 2KZGA 4LB6B 2VBXA 2DA5A 2WAEA 5AONA 4D5CA 3HTUA 2LSOA 3CRJA 5CVJA 1FWZA 2LDUA 4QSHA 5FLXK 1VZ0A 1BN5A 2BW3B 3P9KA 3HDDA 1IC8A 2ZMEB 3G4SI 3GZ5A 1WJAA 3LSTA 2KPMA 4KA4A 5FGMA 3IUVA 5J4VA 1MBGA 3ZN1A 2OF7A 4K2EA 2LY1A 1AKHA 2IS6A 4E6KG 2CW8A 3CCJI 3JAMK 3SFZA 3O2PE 1MJ9A 1T95A 3B6AA 1E0EA 1E2XA 1S29A 3F72A 1XMAA 4XKCA 1MGTA 3L2RA 3SJMA 4AIHA 2Q8KA 4Y52J 1WPKA 5D1RA 2VPRA 2LVSA 4I76A 2OTLI 2MD0A 3ISPA 4CZZA 3H3VK 2DBBA 2HVQA 2LKSA 4HQEA 3VYSB 2IA2A 2Z16A 4HDUA 2XSJC 5IT9K 1LE8B 3C3WA 3S2HJ 1VF9A 2ZMEC 2ETHA 3H1CA 2WAQA 1YJWI 3K4LA 3DTKA 2F4OB 4Z2YA 3NI7A 2HVSA 1DP7P 2RGVA 2CS3A 2LRDA 3CUQA 4TV7A 2AXLA 1RR8C 3CCQI 3SXYA 4QIWN 3TEDA 1HW5A 3MZ8A 1PP7U 1IJWC 4UY8I 1FSEA 5J3LA 1P4XA 4XLNF 2JQ7A 4IPAA 4BEHB 3JSPA 1MMDA 1I6XA 3GFMA 1FYMA 3DU5A 1XMXA 2JWTA 1OYIA 2DA1A 3F22A 2R5YA 2R92J 1OFCX 2R7TA 3I59A 3OYJA 3H35A 5EGOB 4EJUA 3GZ6A 1PYVA 3D5LA 3V8JA 1SFUA 1G2HA 4CCLA 2NX4A 4C2MA 4IHVA 4S0HB 1QGPA 2QOPA 2HYGD 1TQIA 3I71A 1RKWA 5DM7F 4E7JA 1XCVA 1CQTA 2NVTJ 1XCBA 3D5SC 3P7NA 4MNUA 1WSUA 2MC3A 5CQGA 3BCAA 3FKIJ 2ZJRF 5LHGA 2HPMA 5ED4A 3E0JB 2MGQA 4BL0B 1YG2A 1JUMA 3I55I 3HIFA 2BY1A 3P9TA 2DDBA 2R7OA 4DZPA 5HLHA 4NNJA 4CCMA 5EEGA 3KNWA 3J80K 4IHYA 2P5KA 5E1ZB 3HTJA 3H0DA 1T2KA 2V1UA 3CC7I 5FHPA 2K3PA 3GEUA 1UI5A 2YX7A 2XASA 1IXCA 3OS0A 4HX8A 4NN1A 4NB5A 5E79C 3UR3C 1EH8A 2QF7A 4MIMA 3FXOA 3GFJA 4JP0A 4IOCF 1ETYA 2D5VA 2DPDA 3ERMA 3RYPA 3LL7A 4XL9A 4F91B 1Z21A 3EGQA 3MAJA 1MNEA 3K6GA 4A3FJ 1O57A 1X4OA 3RKYA 3BPVA 4RAGA 5GTIC 1J09A 1KQ9A 2CQQA 3J7AY 2XAQA 2ID6A 3N97A 1JKRC 1UHMA 3M1EA 4XICA 4G7HF 1MSFC 3ZMZA 1P2FA 4XOPA 4W1UA 1ZYRF 3F8BA 2NOJB 3HC7A 3DF8A 5F1RA 2JSCA 2Q2EB 2KT0A 3CMMA 2XF5A 1ZGWA 4KT5C 3KCCA 3OL3A 2XGEA 3KZ9A 2A2FX 3S1NJ 3CMAI 2L0KA 1RZ4A 1XB4A 4G12A 2E7XA 3PNVA 4RGXA 3HPGA 4BBSJ 3NS4A 2O0YA 4RB1A 2RREA 2VJJA 1JTYA 5DCMB 4DNCA 5CXGA 3OYIA 2E35A 2E5ZA 3R6SA 1J7KA 1BR2A 4BKXA 4XRSA 1HCRA 5CVRA 2DTZA 5GPCA 1Z6TA 2DA7A 3F3XA 1JT6A 2RQPA 4CA0A 4O5VA 2R93J 3ON2A 1X2NA 1O7LA 2OJED 3A02A 1H8AC 3REOA 3F6VA 2A6HF 3QU6A 2REKA 1ZRCA 2CWEA 3DP7A 3LSPA 1SFXA 2IPQX 1KQ8A 3VP5A 2WAQN 4XMYA 4DYCA 2XIGA 3JRAA 5HS7A 1FX7A 3SDGA 1Y8QB 2EA4A 2EIJH 2GOXB 4ICHA 2CFXA 3LFUA 1R71A 1HKQA 3HXLA 4ENMA 2E34A 3CC4I 4GCVA 3ZMUA 1H9GA 1JUSA 1RI7A 2NOGA 2QQBA 3A0HC 1XDUA 2QSFX 2KP6A 2WGBA 1SD6A 4D1QA 3HOUJ 2ZY9A 3ECHA 2DT5A 2X9DA 3GUDA 5IOYA 4KISA 2VXZA 5FKLA 2JUGA 3K1MA 3C18A 1EV7A 2K5CA 3HRTA 5ICGA 3HSRA 3BZKA 4MLOA 1NG7A 3K2AA 5JHFA 3VPRA 2R5ZA 2VT3A 1KU2A 3AKZA 4ZYAA 2JPBA 1R9TJ 4JX5A 4RM2A 3MNLA 5HODA 5J47A 3EQLF 2H94A 4YIFA 3IKVA 4W97A 3EUHC 3BTCA 5D4SA 2FBIA 1ZR4A 2BY2A 1ITYA 2DI3A 3QYBA 1T0FC 4HX4A 3SZTA 4RGUA 2QQ8A 2PJRA 1FOYA 4PSXA 4EM2A 3Q5FA 1R1VA 1R1UA 3E5UA 4G6QA 4DGWB 1VQ6I 3HB9A 3WTSC 3HOSA 4HG2A 2GOMA 2XVCA 3A4CA 2BE5F 1CF7A 2NVXJ 1UHSA 2XKOA 4HBLA 3KFWX 3VVZA 5L3GA 4L0ZB 4P5OA 2VE8A 4R79A 4AC6A 3BC8A 4RLFA 2MLKA 4CCJA 4GO1A 2HGCA 2RQQA 4AM3A 2I8DA 4MXMA 1V55H 3QAHA 1KU7A 3BR2A 5D5VB 2AQEA 4F52A 1MBFA 3TDZC 3OYAA 3BG9A 1ZH5A 3BCGA 3S14J 3PUBA 2EA2A 2UUZA 2PQ8A 4EVIA 3HRSA 1YIOA 5E1XA 4EGYA 1YLFA 4X1EA 4J19A 2LP0A 2XRLA 3BROA 4DOZA 4ME9A 2E1MB 2LK2A 4L5IA 1QQIA 2LKPA 1XMKA 3RQ4A 2BOLA 5DTDA 2FBKA 3RI4A 4ZYHA 2CUJA 5CVUA 5F08A 1Q1HA 3LA3A 1R5ID 2CH0A 2HOSA 1Z6RA 2JTVA 4PCQA 1U8RA 2QSGX 1Z9CA 4BUPA 1DP3A 1PJRA 2QLZA 2MSYA 2UXIA 2EFQA 2FX0A 2OCCH 3HGYA 2GA2A 1V3FA 4MTDA 2UV1A 3LSHA 2IP2A 1TBXA 1IV6A 1T8IA 2K9QA 1JGGA 2FD5A 2ECBA 1VNDA 1X2MA 2KJCA 2HKUA 5D6FA 3MVPA 2D6YA 3S32A 3ABUA 3H5RA 2NP5A 2EH3A 3U1KA 4ZDPA 2Z99A 4E7KA 5K58A 3RCOA 1B8IB 5LGNA 1RRJA 2EK5A 5FD5A 4PJ0C 2OZUA 1NTCA 1U2WA 5JVTA 1K6YA 5D19A 5HLIA 2M5WA 3E3VA 4LG0A 2E1MC 4IJAA 4C9YA 3BNIA 2HYFA 1TP4A 2FBQA 4PZJA 3OS1A 1T6SA 2E2IJ 4MEXF 4L62A 5GAEJ 4IQ4A 1TQPA 1FBQA 2HTJA 1W7PA 2RDPA 5DM6F 2HQRA 4XBFA 1W1WE 4HEA2 3QWLA 5FLMJ 3K1NA 2FMYA 2OA4A 3ZGKA 1BI0A 2HOEA 1OJLA 1JJ6C 5DUKA 2K4JA 1QZEA 1R4MB 2CUFA 1HLVA 2FBHA 1GLNA 3PQKA 4U0VA 5M5XJ 4A6EA 4A3LJ 4A3JJ 2FNAA 3LMMA 4YEJA 3ZR8X 1W5SA 2GXBA 2X1CA 3IWFA 2DU9A 1JT0A 3CESA 5CLSA 2AHQA 2V79A 4Y15A 2JMWA 5GADJ 5HDNA 2QBYB 4B8XA 4CCNA 2V6CA 5DEQA 4ZZDA 4JBAA 1S9HA 4B48A 5FMPA 1V5EA 2JVGA 1K78A 4CUGA 3HUGA 2DFIA 3T8TA 5EG0A 1XGSA 1BM9A 1YRNA 2YR2A 3ASOH 4MFDA 4AYBA 3OIPA 4YFKF 1XSDA 3PJRA 1SD7A 2VE9A 4C3JJ 1HA8A 3NRGA 2VKEA 4KYWA 2JA2A 3FK6A 3KEYA 5KK1A 5BS6A 1MH3A 2EIKH 2HNHA 1J2XA 1OCZH 2KRCA 3GTKJ 5EYRA 1ZAOA 1N75A 4CYDA 3BG6A 1TW3A 2CRGA 2X51A 3H0GJ 2KLOA 5FKKA 4BHPA 1UCRA 3G6EI 3ZN0A 2CV2A 4UUSA 1D0ZA 4UHTA 2A05A 2EV6A 3QP5A 1PUFB 3K4JA 3O3KA 4JK1X 2VB6A 3KYLA 3GTMJ 2PX9A 3ABTA 2IA0A 2QM3A 1J5YA 3Q0VA 4M6XA 3H5AA 3DKXA 3GZNB 4DZJA 3HTSB 3M4OJ 4U87A 1MKMA 1U5TC 4XLHA 3OMYA 1Q1VA 3A0BC 1ZG3A 3VSLA 1JXSA 4J00A 4M9XA 3HHGA 3B81A 4ZYDA 3ZQLA 3L1PA 1LPQA 5FLVA 4I0BA 2NYXA 1JKOC 1ACIA 4XN0A 2XF6A 1FYKA 4GCTA 4XK4A 2ICWG 3ELKA 1I3QJ 4F92B 4NC6A 5HLTA 1P92A 5KAFC 2KRHA 3ABMH 2CW7A 3I4PA 2ZSIB 4L9NA 2L7KA 4QTRA 3BJAA 4HDVA 2VQLA 3E6DA 2QGUA 2Q1ZB 1LKXA 6PAXA 3AAFA 3CF5F 3BCBA 4PJLA 2IA1A 3JSOA 1DGRM 1OCCH 4FT8A 2M4GA 1X58A 2JJ7A 2DFHA 1ZRFA 3OYKA 1OQYA 5DCFA 5D5WB 3VOEA 2EINH 4UV9A 2LREA 1Y6IA 1NHAA 4PJMA 2DFFA 3F21A 2EFOA 3PIOF 3DCFA 1MJAA 3VWBA 2ZFUA 3K0LA 3AG1H 5E3MA 1AKHB 2QIBA 4BJ6C 1O3RA 2YX4A 2P6TA 1SMYF 2DW4A 3IAM2 3CLOA 1ZLJA 3VYUB 3RPUA 3J7ZI 1O4XA 2N8GA 2JZYA 3VSKA 1HXDA 3BR6A 4CH7A 3L2WA 2FA5A 4P9UA 4KITB 2R7WA 1EH6A 3OSFA 1I1GA 2V9KA 1YS7A 2X4HA 1K6OA 2D45A 1NG6A 3P9IA 5IOZA 4UNOA 2V9PA 5HDGA 3IH2A 2R7RA 1Z67A 1YO5C 4XQFA 5C4JJ 2L9SA 4PSWA 2HYTA 3A2KA 3JSJA 5KHDA 2CGPA 1F1ZA 2XAJA 1WJCA 4HZFA 4BGDA 5ILVA 4JYKA 1XD7A 3FMRA 1T39A 1SVMA 4A3CJ 1YOVB 3PQJA 3RKWA 3DPLC 3ZXSA 3AFHA 4BE1A 4Y17A 2ECCA 4A3BJ 1BOBA
chains in the Genus database with same CATH topology
1ZKGA 3G7RA 3OIOA 5EGOB 4NELA 1RESA 1WI3A 1G2HA 2JK3A 5EDNA 1ORKA 3ZOBA 2JA6J 1K61A 2NX4A 4IHVA 4S0HB 1E3OC 5C44J 2QOPA 2VUMJ 3GTQJ 4EEFG 4DYQA 5JLWA 4KWAA 2GENA 2R5YB 1RKWA 4A3MJ 1CQTA 5BNGA 2NVTJ 4IHWA 4AYBN 3DPJA 1WGXA 3FKIJ 1YRNB 1IG7A 5IP9J 3ZQIA 2MGQA 3BTJA 2DMUA 1K83J 4JX4A 2NVQJ 1Z0XA 2XPUA 1JUMA 2YU9J 2LKXA 1DU0A 3DEWA 3AQSA 3VW2A 3P9TA 2CQXA 1OCPA 4DZPA 3KNWA 2DJNA 2JA8J 2K9SA 4AC0A 3OOUA 2ME0A 3BT9A 4IHYA 2L9RA 2JN6A 2CU7A 4M3BA 4AUXA 2LY9A 1ZR2A 2G7GA 3HTJA 1BW6A 3NXCA 1JKQC 5FHPA 4UUSB 2E1OA 3GEUA 2P81A 2WV1A 1UI5A 3S1QJ 5M5YJ 1B72B 5IYDJ 4DYRA 1HOMA 4NN1A 4GCLA 3BR1A 3VUQA 4A3GJ 2LD5A 3BG5A 5C4XJ 3E7QA 4M3GA 4LOCA 1OCTC 2QF7A 4MIMA 5F1JA 4JP0A 2R0QC 2E2HJ 1ETYA 1TWFJ 3CMYA 2D5VA 3S2DJ 3S1RJ 3K7AJ 1RR7A 3EGQA 4A69C 4A3FJ 3QKXA 3C07A 1ETVA 2COBA 3SFIA 2CQQA 5FKOA 5IP7J 2ID6A 1ENHA 4NDLA 1JKRC 2IAIA 2TRTA 2QKOA 4XRSG 4RBOA 4XICA 1MSFC 4IHXA 3COLA 5EF6A 3F0CA 2DMQA 2HXOA 2DMPA 3O8HA 3HKZN 1TWGJ 1T33A 2MG4A 1Y1VJ 3KKDA 4W1UA 2H8RA 2X6OA 4AF5A 3LSGA 3JRGA 3G1OA 2KT0A 1FIPA 1ZGWA 2EBIA 3ZQCA 4X6AJ 4FE4A 1SGMA 2XGEA 3KZ9A 3HM5A 2MW8A 5C3EJ 3S1NJ 3NAUA 1JTXA 2NVYJ 2Q24A 2L0KA 4MFEA 2QTQA 3LSJA 3VVYA 4G12A 2XGDA 4BBSJ 3FISA 3WHCA 4XRMA 4JKZA 2OPTA 5IYCJ 5K7HA 1JTYA 3RD3A 4V2GA 5CXGA 1MBEA 4M3FA 1U8BA 3QBMA 2YVHA 3G1MA 4BBRJ 4BKXA 4XRSA 1HCRA 3BR5A 5IYBJ 1ZK8A 3M3YJ 4L5EA 4DW6A 2DTZA 4C3HJ 5GPCA 2H1KA 3CWRA 2DA7A 2LR8A 2GUHA 1JT6A 1AHDP 2R93J 1WCMJ 3ON2A 1X2NA 4RDUA 3LNQA 3V6GA 1U78A 1ETQA 3A02A 1H8AC 5E3OA 2UXUA 2M9HA 3HTIA 2GM4A 2REKA 3LSPA 5EFYA 1IRZA 4A93J 1VFCA 3T6NA 4A3IJ 3VP5A 2WAQN 4DYCA 3BRUA 2NS8A 3JRAA 2EZIA 1BA5A 1AU7A 5F0CA 1GT0C 4D7MA 3SDGA 4ICHA 3JRIA 3S15J 3BHQA 2ZCXA 5K58A 2K9NA 3ANPA 5F27A 1APLC 1FJLA 4MK6A 5DS9A 1JUSA 2NOGA 3G1LA 2ZOYA 5F04A 2M0CA 2GBYA 1F36A 3I4MJ 2WGBA 1MH4A 3ZQFA 3HOUJ 2YVEA 1SANA 2TCTA 2X9DA 4UUTA 5IOYA 1Y1WJ 2PZ9A 2EZHA 2ZB9A 3RZOJ 5FKLA 2HDDA 3O60A 1GVDA 4CYCA 3VW0A 2DA4A 4MLOA 3K2AA 4M3EA 3VPRA 2XSDC 2R5ZA 3EUPA 3HTAA 1R9TJ 3A03A 1JUPA 4JX5A 2K40A 5HODA 3S16J 3MNLA 2ZCNA 4FE7A 4B3AA 4W97A 3JRFA 1P7JA 3HOXJ 3BTCA 1ZR4A 1PUFA 3AQTA 3LSRA 3PO2J 1NK3P 1ITYA 1IUFA 3HOVJ 1QVTA 5HBUA 1GUUA 2F07A 1WH7A 2Y0SN 3LOCA 3S17J 3VOKA 4ACIA 3HB9A 3LWJA 1U9OA 3RZDJ 4GFBA 4CYCB 1IDZA 2EQRA 2NVXJ 4BXXJ 1UHSA 9ANTA 2EZLA 2G0EA 2RASA 3S5RA 3Q0WA 3VVZA 1HDPA 2R5ZB 1TWHJ 1A6IA 4HNVA 2G3BA 5HAWA 4AC6A 3HOWJ 3HTHA 3E7LA 3A01A 3BQYA 2WUIA 3GTPJ 3S1MJ 4MXMA 3CDLA 3BR2A 1MBFA 1TWAJ 3BG9A 3BCGA 5K7FA 3KKCA 2ZCMA 2RAEA 3S14J 2HI3A 1TC3C 2IEKA 1POGA 5FKMA 5E3NA 1QPIA 2GLOA 1W0TA 2NP3A 2HYJA 4X1EA 1BL0A 3NPIA 4J19A 2LP0A 2Y30A 1F43A 2XRLA 4ME9A 2DMNA 4CGRA 3IH3A 3UKGA 3A01B 2LK2A 2XGCA 2WB1N 3QQAA 4FISA 5DTDA 2I10A 3Q0UA 5F08A 3JR9A 1B8IA 5J1YA 2HOSA 3NNRA 1GV5A 2M8GX 2PBXA 4YZEA 4BY7J 1BW5A 5M3MJ 1IGNA 5CXIA 2MSYA 2UXIA 2JA5J 2CJJA 4JL3A 1XC5A 2FX0A 3HGYA 5HSZA 1RETA 5GP9A 4B4CA 3TW6A 2W48A 1IV6A 1JGGA 2K9QA 2FD5A 2ECBA 4B1RA 1VNDA 1X2MA 2HKUA 3Q3SA 5FJ8J 3MVPA 1W0UA 2D6YA 2L7MP 2RHAA 3LHQA 2DA2A 2G7LA 2EH3A 2NP5A 3RQIA 1D5YA 2O9LA 1B8IB 3GTLJ 2G7SA 5DAJA 1LE8A 1ZTRA 4A3EJ 2L7ZA 3BG3A 3GTJJ 1NTCA 5J1UA 3BJBA 4M6VA 2R7ZJ 5D19A 3V78A 1A5JA 3BNIA 4GCKA 2FBQA 2QWTA 1LFBA 2DA3A 4L62A 2E2IJ 2Y2ZA 3NARA 2UXOA 2UXPA 3WHBA 5EZHA 3RKQA 1RKTA 2QCOA 2YS9A 4BY1J 2IU5A 1QVUA 4MO7A 5FLMJ 2Y9ZA 1OJLA 1JJ6C 2E19A 2HOAA 1MNMC 1DU6A 5H9TA 1HDDC 5AQCA 2CUFA 1BJZA 1Z77A 2LLKA 3TP3A 2DG7A 1HLVA 2CUEA 1I6HJ 5M5XJ 2DN0A 3JRDA 1MBJA 4A3LJ 3LJLA 5FGLA 4A3DJ 4A3JJ 4M3DA 4UDSA 3JRBA 2PMZN 5K7ZA 1ETWA 1TWCJ 2XPWA 2OI8A 5D18A 1JT0A 2LTPA 1P7IA 2AHQA 2Y9YA 3CJDA 2JMWA 4GFKA 2HQ5A 2XDNA 2DMTA 5GPAA 3F1BA 5C4YA 1RPWA 5FMPA 2LFBA 3ZQGA 3MKLA 4C2MJ 4I6ZA 5EG0A 2UXHA 1YRNA 2HXIA 4MFDA 2KDZA 2YUSA 4C3JJ 3GTGJ 3NRGA 1XS9A 2VKEA 3JREA 4FTHA 3VIBA 3FK6A 1T56A 2HOTA 2E2JJ 1U9NA 1IDYA 1MBHA 1MH3A 3JRHA 3GTOJ 2O7TA 1H89C 3GTKJ 5EYRA 2M2EA 3O8GA 1ETXA 3BR3A 3I4NJ 2OERA 2CRGA 4PXIA 3H0GJ 5FKKA 3D1NI 2XB0X 5M3FJ 2EZKA 1VI0A 5EG0B 4UUSA 3GZIA 3BTLA 1WH5A 5J1RA 1FTTA 2VKVA 2VI6A 5EEAA 1B72A 1PUFB 3VW1A 2FJ1A 4V2FA 3HOZJ 2Y31A 5FKNA 1GDTA 3GTMJ 2ZOZA 3QPSA 1NK2P 2DA6A 2V57A 3Q0VA 5CW8A 2NS7A 2FQ4A 4DZJA 1HF0A 3M4OJ 3RH2A 2O8KA 3OSGA 1H88C 1Q1VA 3IH4A 1JJ8C 2DG8A 3CCYA 3B81A 3MN2A 3ZQLA 3ANGA 3L1PA 3ON4A 3TP0A 5JLXA 2O7OA 3BTIA 5FLVA 3ZQHA 3HOYJ 1JKOC 1LFUP 2DA5A 4D5CA 4GCTA 4XK4A 1UMQA 1I3QJ 3TW7A 3CRJA 3HBLA 4QSHA 4FCYA 1EF4A 3BQZA 5F0HA 3HDDA 5IP6A 1IC8A 4QTRA 3G56A 1XG1A 3QPLA 3IUVA 3CQZJ 1MBGA 1MSEC 2OF7A 4D5FA 1AKHA 1X58A 2JJ7A 3PM1A 3B6AA 3HIMA 2ME6A 2AO9A 5E3LA 3GBGA 2L7FP 1FEXA 3SJMA 3BR0A 4ABZA 3W6VA 4Y52J 1WPKA 5D1RA 1I50J 3VOXA 2VPRA 2LVSA 3PPBA 4I76A 3HEFA 3VVXA 1FTZA 3DCFA 1MBKA 5E3MA 3PASA 1AKHB 1QRYA 2QIBA 2GFNA 5IPAA 3H3VK 4D7NA 5F0FA 3FRQA 4GFLA 2ID3A 1O4XA 2N8GA 4HKUA 3C2BA 3BR6A 1ETKA 1LE8B 2JA7J 1ETOA 3S2HJ 1VF9A 3FK7A 3PO3J 3OSFA 2IBDA 1GV2A 2ELKA 5IOZA 5M5WJ 2XPVA 1UI6A 5EGOA 3NI7A 2B63J 4JNNA 3B6CA 3HGGA 2X48A 3IH2A 3JRCA 4QIWN 4JX6A 3TEDA 3HE0A 1IJWC 1ZQ3P 5J3LA 2W53A 5C4JJ 1S7EA 1FIAA 2HYTA 2M34A 3JSJA 1JKPC 1UG2A 4JYKA 2XB5A 2JWTA 4Y7NJ 2DA1A 4C3IJ 2R5YA 4XIDA 3IV5A 2R92J 4A3CJ 1OFCX 4IEJA 3FIWA 5EZGA 1SFOJ 2ECCA 4A3BJ 4A3KJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZKG A;  3G7R A;  3OIO A;  5EGO B;  4NEL A;  1RES A;  1WI3 A;  1G2H A;  2JK3 A;  5EDN A;  1ORK A;  3ZOB A;  2JA6 J;  1K61 A;  2NX4 A;  4IHV A;  4S0H B;  1E3O C;  5C44 J;  2QOP A;  2VUM J;  3GTQ J;  4EEF G;  4DYQ A;  5JLW A;  4KWA A;  2GEN A;  2R5Y B;  1RKW A;  4A3M J;  1CQT A;  5BNG A;  2NVT J;  4IHW A;  4AYB N;  3DPJ A;  1WGX A;  3FKI J;  1YRN B;  1IG7 A;  5IP9 J;  3ZQI A;  2MGQ A;  3BTJ A;  2DMU A;  1K83 J;  4JX4 A;  2NVQ J;  1Z0X A;  2XPU A;  1JUM A;  2YU9 J;  2LKX A;  1DU0 A;  3DEW A;  3AQS A;  3VW2 A;  3P9T A;  2CQX A;  1OCP A;  4DZP A;  3KNW A;  2DJN A;  2JA8 J;  2K9S A;  4AC0 A;  3OOU A;  2ME0 A;  3BT9 A;  4IHY A;  2L9R A;  2JN6 A;  2CU7 A;  4M3B A;  4AUX A;  2LY9 A;  1ZR2 A;  2G7G A;  3HTJ A;  1BW6 A;  3NXC A;  1JKQ C;  5FHP A;  4UUS B;  2E1O A;  3GEU A;  2P81 A;  2WV1 A;  1UI5 A;  3S1Q J;  5M5Y J;  1B72 B;  5IYD J;  4DYR A;  1HOM A;  4NN1 A;  4GCL A;  3BR1 A;  3VUQ A;  4A3G J;  2LD5 A;  3BG5 A;  5C4X J;  3E7Q A;  4M3G A;  4LOC A;  1OCT C;  2QF7 A;  4MIM A;  5F1J A;  4JP0 A;  2R0Q C;  2E2H J;  1ETY A;  1TWF J;  3CMY A;  2D5V A;  3S2D J;  3S1R J;  3K7A J;  1RR7 A;  3EGQ A;  4A69 C;  4A3F J;  3QKX A;  3C07 A;  1ETV A;  2COB A;  3SFI A;  2CQQ A;  5FKO A;  5IP7 J;  2ID6 A;  1ENH A;  4NDL A;  1JKR C;  2IAI A;  2TRT A;  2QKO A;  4XRS G;  4RBO A;  4XIC A;  1MSF C;  4IHX A;  3COL A;  5EF6 A;  3F0C A;  2DMQ A;  2HXO A;  2DMP A;  3O8H A;  3HKZ N;  1TWG J;  1T33 A;  2MG4 A;  1Y1V J;  3KKD A;  4W1U A;  2H8R A;  2X6O A;  4AF5 A;  3LSG A;  3JRG A;  3G1O A;  2KT0 A;  1FIP A;  1ZGW A;  2EBI A;  3ZQC A;  4X6A J;  4FE4 A;  1SGM A;  2XGE A;  3KZ9 A;  3HM5 A;  2MW8 A;  5C3E J;  3S1N J;  3NAU A;  1JTX A;  2NVY J;  2Q24 A;  2L0K A;  4MFE A;  2QTQ A;  3LSJ A;  3VVY A;  4G12 A;  2XGD A;  4BBS J;  3FIS A;  3WHC A;  4XRM A;  4JKZ A;  2OPT A;  5IYC J;  5K7H A;  1JTY A;  3RD3 A;  4V2G A;  5CXG A;  1MBE A;  4M3F A;  1U8B A;  3QBM A;  2YVH A;  3G1M A;  4BBR J;  4BKX A;  4XRS A;  1HCR A;  3BR5 A;  5IYB J;  1ZK8 A;  3M3Y J;  4L5E A;  4DW6 A;  2DTZ A;  4C3H J;  5GPC A;  2H1K A;  3CWR A;  2DA7 A;  2LR8 A;  2GUH A;  1JT6 A;  1AHD P;  2R93 J;  1WCM J;  3ON2 A;  1X2N A;  4RDU A;  3LNQ A;  3V6G A;  1U78 A;  1ETQ A;  3A02 A;  1H8A C;  5E3O A;  2UXU A;  2M9H A;  3HTI A;  2GM4 A;  2REK A;  3LSP A;  5EFY A;  1IRZ A;  4A93 J;  1VFC A;  3T6N A;  4A3I J;  3VP5 A;  2WAQ N;  4DYC A;  3BRU A;  2NS8 A;  3JRA A;  2EZI A;  1BA5 A;  1AU7 A;  5F0C A;  1GT0 C;  4D7M A;  3SDG A;  4ICH A;  3JRI A;  3S15 J;  3BHQ A;  2ZCX A;  5K58 A;  2K9N A;  3ANP A;  5F27 A;  1APL C;  1FJL A;  4MK6 A;  5DS9 A;  1JUS A;  2NOG A;  3G1L A;  2ZOY A;  5F04 A;  2M0C A;  2GBY A;  1F36 A;  3I4M J;  2WGB A;  1MH4 A;  3ZQF A;  3HOU J;  2YVE A;  1SAN A;  2TCT A;  2X9D A;  4UUT A;  5IOY A;  1Y1W J;  2PZ9 A;  2EZH A;  2ZB9 A;  3RZO J;  5FKL A;  2HDD A;  3O60 A;  1GVD A;  4CYC A;  3VW0 A;  2DA4 A;  4MLO A;  3K2A A;  4M3E A;  3VPR A;  2XSD C;  2R5Z A;  3EUP A;  3HTA A;  1R9T J;  3A03 A;  1JUP A;  4JX5 A;  2K40 A;  5HOD A;  3S16 J;  3MNL A;  2ZCN A;  4FE7 A;  4B3A A;  4W97 A;  3JRF A;  1P7J A;  3HOX J;  3BTC A;  1ZR4 A;  1PUF A;  3AQT A;  3LSR A;  3PO2 J;  1NK3 P;  1ITY A;  1IUF A;  3HOV J;  1QVT A;  5HBU A;  1GUU A;  2F07 A;  1WH7 A;  2Y0S N;  3LOC A;  3S17 J;  3VOK A;  4ACI A;  3HB9 A;  3LWJ A;  1U9O A;  3RZD J;  4GFB A;  4CYC B;  1IDZ A;  2EQR A;  2NVX J;  4BXX J;  1UHS A;  9ANT A;  2EZL A;  2G0E A;  2RAS A;  3S5R A;  3Q0W A;  3VVZ A;  1HDP A;  2R5Z B;  1TWH J;  1A6I A;  4HNV A;  2G3B A;  5HAW A;  4AC6 A;  3HOW J;  3HTH A;  3E7L A;  3A01 A;  3BQY A;  2WUI A;  3GTP J;  3S1M J;  4MXM A;  3CDL A;  3BR2 A;  1MBF A;  1TWA J;  3BG9 A;  3BCG A;  5K7F A;  3KKC A;  2ZCM A;  2RAE A;  3S14 J;  2HI3 A;  1TC3 C;  2IEK A;  1POG A;  5FKM A;  5E3N A;  1QPI A;  2GLO A;  1W0T A;  2NP3 A;  2HYJ A;  4X1E A;  1BL0 A;  3NPI A;  4J19 A;  2LP0 A;  2Y30 A;  1F43 A;  2XRL A;  4ME9 A;  2DMN A;  4CGR A;  3IH3 A;  3UKG A;  3A01 B;  2LK2 A;  2XGC A;  2WB1 N;  3QQA A;  4FIS A;  5DTD A;  2I10 A;  3Q0U A;  5F08 A;  3JR9 A;  1B8I A;  5J1Y A;  2HOS A;  3NNR A;  1GV5 A;  2M8G X;  2PBX A;  4YZE A;  4BY7 J;  1BW5 A;  5M3M J;  1IGN A;  5CXI A;  2MSY A;  2UXI A;  2JA5 J;  2CJJ A;  4JL3 A;  1XC5 A;  2FX0 A;  3HGY A;  5HSZ A;  1RET A;  5GP9 A;  4B4C A;  3TW6 A;  2W48 A;  1IV6 A;  1JGG A;  2K9Q A;  2FD5 A;  2ECB A;  4B1R A;  1VND A;  1X2M A;  2HKU A;  3Q3S A;  5FJ8 J;  3MVP A;  1W0U A;  2D6Y A;  2L7M P;  2RHA A;  3LHQ A;  2DA2 A;  2G7L A;  2EH3 A;  2NP5 A;  3RQI A;  1D5Y A;  2O9L A;  1B8I B;  3GTL J;  2G7S A;  5DAJ A;  1LE8 A;  1ZTR A;  4A3E J;  2L7Z A;  3BG3 A;  3GTJ J;  1NTC A;  5J1U A;  3BJB A;  4M6V A;  2R7Z J;  5D19 A;  3V78 A;  1A5J A;  3BNI A;  4GCK A;  2FBQ A;  2QWT A;  1LFB A;  2DA3 A;  4L62 A;  2E2I J;  2Y2Z A;  3NAR A;  2UXO A;  2UXP A;  3WHB A;  5EZH A;  3RKQ A;  1RKT A;  2QCO A;  2YS9 A;  4BY1 J;  2IU5 A;  1QVU A;  4MO7 A;  5FLM J;  2Y9Z A;  1OJL A;  1JJ6 C;  2E19 A;  2HOA A;  1MNM C;  1DU6 A;  5H9T A;  1HDD C;  5AQC A;  2CUF A;  1BJZ A;  1Z77 A;  2LLK A;  3TP3 A;  2DG7 A;  1HLV A;  2CUE A;  1I6H J;  5M5X J;  2DN0 A;  3JRD A;  1MBJ A;  4A3L J;  3LJL A;  5FGL A;  4A3D J;  4A3J J;  4M3D A;  4UDS A;  3JRB A;  2PMZ N;  5K7Z A;  1ETW A;  1TWC J;  2XPW A;  2OI8 A;  5D18 A;  1JT0 A;  2LTP A;  1P7I A;  2AHQ A;  2Y9Y A;  3CJD A;  2JMW A;  4GFK A;  2HQ5 A;  2XDN A;  2DMT A;  5GPA A;  3F1B A;  5C4Y A;  1RPW A;  5FMP A;  2LFB A;  3ZQG A;  3MKL A;  4C2M J;  4I6Z A;  5EG0 A;  2UXH A;  1YRN A;  2HXI A;  4MFD A;  2KDZ A;  2YUS A;  4C3J J;  3GTG J;  3NRG A;  1XS9 A;  2VKE A;  3JRE A;  4FTH A;  3VIB A;  3FK6 A;  1T56 A;  2HOT A;  2E2J J;  1U9N A;  1IDY A;  1MBH A;  1MH3 A;  3JRH A;  3GTO J;  2O7T A;  1H89 C;  3GTK J;  5EYR A;  2M2E A;  3O8G A;  1ETX A;  3BR3 A;  3I4N J;  2OER A;  2CRG A;  4PXI A;  3H0G J;  5FKK A;  3D1N I;  2XB0 X;  5M3F J;  2EZK A;  1VI0 A;  5EG0 B;  4UUS A;  3GZI A;  3BTL A;  1WH5 A;  5J1R A;  1FTT A;  2VKV A;  2VI6 A;  5EEA A;  1B72 A;  1PUF B;  3VW1 A;  2FJ1 A;  4V2F A;  3HOZ J;  2Y31 A;  5FKN A;  1GDT A;  3GTM J;  2ZOZ A;  3QPS A;  1NK2 P;  2DA6 A;  2V57 A;  3Q0V A;  5CW8 A;  2NS7 A;  2FQ4 A;  4DZJ A;  1HF0 A;  3M4O J;  3RH2 A;  2O8K A;  3OSG A;  1H88 C;  1Q1V A;  3IH4 A;  1JJ8 C;  2DG8 A;  3CCY A;  3B81 A;  3MN2 A;  3ZQL A;  3ANG A;  3L1P A;  3ON4 A;  3TP0 A;  5JLX A;  2O7O A;  3BTI A;  5FLV A;  3ZQH A;  3HOY J;  1JKO C;  1LFU P;  2DA5 A;  4D5C A;  4GCT A;  4XK4 A;  1UMQ A;  1I3Q J;  3TW7 A;  3CRJ A;  3HBL A;  4QSH A;  4FCY A;  1EF4 A;  3BQZ A;  5F0H A;  3HDD A;  5IP6 A;  1IC8 A;  4QTR A;  3G56 A;  1XG1 A;  3QPL A;  3IUV A;  3CQZ J;  1MBG A;  1MSE C;  2OF7 A;  4D5F A;  1AKH A;  1X58 A;  2JJ7 A;  3PM1 A;  3B6A A;  3HIM A;  2ME6 A;  2AO9 A;  5E3L A;  3GBG A;  2L7F P;  1FEX A;  3SJM A;  3BR0 A;  4ABZ A;  3W6V A;  4Y52 J;  1WPK A;  5D1R A;  1I50 J;  3VOX A;  2VPR A;  2LVS A;  3PPB A;  4I76 A;  3HEF A;  3VVX A;  1FTZ A;  3DCF A;  1MBK A;  5E3M A;  3PAS A;  1AKH B;  1QRY A;  2QIB A;  2GFN A;  5IPA A;  3H3V K;  4D7N A;  5F0F A;  3FRQ A;  4GFL A;  2ID3 A;  1O4X A;  2N8G A;  4HKU A;  3C2B A;  3BR6 A;  1ETK A;  1LE8 B;  2JA7 J;  1ETO A;  3S2H J;  1VF9 A;  3FK7 A;  3PO3 J;  3OSF A;  2IBD A;  1GV2 A;  2ELK A;  5IOZ A;  5M5W J;  2XPV A;  1UI6 A;  5EGO A;  3NI7 A;  2B63 J;  4JNN A;  3B6C A;  3HGG A;  2X48 A;  3IH2 A;  3JRC A;  4QIW N;  4JX6 A;  3TED A;  3HE0 A;  1IJW C;  1ZQ3 P;  5J3L A;  2W53 A;  5C4J J;  1S7E A;  1FIA A;  2HYT A;  2M34 A;  3JSJ A;  1JKP C;  1UG2 A;  4JYK A;  2XB5 A;  2JWT A;  4Y7N J;  2DA1 A;  4C3I J;  2R5Y A;  4XID A;  3IV5 A;  2R92 J;  4A3C J;  1OFC X;  4IEJ A;  3FIW A;  5EZG A;  1SFO J;  2ECC A;  4A3B J;  4A3K J; 
#chains in the Genus database with same CATH topology
 3G7R A;  2K3F A;  3LSK A;  4ANJ A;  5L3D A;  4JOM A;  3K8P C;  4XM3 A;  3G3Z A;  1IXR C;  2JK3 A;  3S3M A;  3WG9 A;  3ZOB A;  1YX3 A;  3B02 A;  5EDN A;  5D8L B;  4AIK A;  2A5W A;  3I9V 2;  3S3N A;  4YG2 F;  4R8H A;  3CP2 A;  2VKH A;  3I53 A;  2A69 F;  3GTQ J;  4F93 B;  1TW2 A;  4KWA A;  2GEN A;  2R5Y B;  3FXM A;  4O3M A;  4BE2 A;  3KP5 A;  5BNG A;  1EJ9 A;  1IZ1 A;  2NS0 A;  2ADU A;  2FNP A;  1WI9 A;  2Y0S A;  1LVK A;  4OMZ A;  3I59 B;  3FWE A;  2B9S A;  1MDM B;  4HF1 A;  4E7S A;  4IHW A;  4AYB N;  1ERD A;  2P8T A;  2KFD A;  2RC4 A;  2VJI A;  5IP9 J;  3BTJ A;  3NEU A;  2DMU A;  2L9V A;  2LBF A;  5B1B H;  2YU9 J;  1VQ4 I;  1DU0 A;  3HRU A;  3VW2 A;  4A5N A;  1Z1D A;  3QU3 A;  4DVY P;  2DJN A;  3K4K A;  4KN4 X;  3NQO A;  1X1C A;  3BT9 A;  3GCM A;  3V7R A;  5E20 A;  1ZR2 A;  2LY9 A;  2VJ5 A;  2OTJ I;  1BW6 A;  1Z7L A;  1KYW A;  3EET A;  4BQN A;  2HQN A;  4LLN A;  5L3F A;  2P81 A;  4A0X A;  3WTV C;  1VQN I;  1IRF A;  2GWR A;  2HS5 A;  1VQL I;  3JCU C;  2FJI 1;  3BWG A;  1W36 D;  3VUQ A;  4RS8 A;  2HFH A;  5C4X J;  3BG5 A;  1OCT C;  4ZYG A;  2CO5 A;  3CCE I;  2B0L A;  3M07 A;  1IV8 A;  1IUY A;  1TWF J;  1RNL A;  2D1V A;  3CMY A;  3CP8 A;  1FSH A;  3KX2 A;  2CMP A;  3SZP A;  1D1C A;  2CYY A;  1G8X A;  2IJL A;  3CJR B;  3QKX A;  3CCV I;  5LRR A;  2COB A;  2CQN A;  4NBQ A;  3GWZ A;  3T1B A;  2WY7 Q;  1N77 A;  3V8K A;  5FKO A;  5IP7 J;  3PNT A;  2TRT A;  4FHT A;  2QKO A;  4XRS G;  4IHX A;  3BP8 A;  4ZTF A;  2GAU A;  2DMQ A;  3O8H A;  1BIA A;  4ASN A;  1T33 A;  3KKD A;  3QYF A;  2X6O A;  4FQG A;  1X4P A;  3VEP A;  4EM1 A;  2WAD A;  3RYR A;  4XNF A;  4RMN A;  3ZQC A;  4X6A J;  4M6Y A;  3VFZ A;  1XDS A;  3NAU A;  2DYR H;  1BIB A;  1JTX A;  2Q24 A;  4LJZ F;  1Y39 A;  2QTQ A;  2ISY A;  3DTI A;  3QP6 A;  4A0Y A;  3VVY A;  1R7J A;  3FM3 A;  1DPR A;  3FIS A;  4F7Z A;  2OPT A;  1A6Q A;  4ETS A;  2L01 A;  2H27 A;  3RD3 A;  2L4M A;  1MBE A;  3BLY A;  1U8B A;  3QBM A;  3KP6 A;  4BBR J;  2YVH A;  1PVE A;  2A61 A;  3BR5 A;  3M3Y J;  4ESB A;  3E97 A;  2J5O A;  4DW6 A;  5LEJ A;  3WU1 B;  3KET A;  3K4C A;  2HKX A;  2X1D A;  4A12 A;  1AHD P;  1B9N A;  3HPH A;  5BPD A;  4XLA A;  1WCM J;  4HST A;  4RDU A;  3V6G A;  2PEX A;  2UXU A;  3VDX A;  2M9H A;  1A36 A;  1O3T A;  2BY0 A;  1DDN A;  5EFY A;  3KLO A;  5LGT A;  3T6N A;  3V7S A;  4A3I J;  1I39 A;  1BC7 C;  1WJF A;  2P5V A;  5D6E A;  4LLL A;  5F0C A;  2QVO A;  1LNW A;  5J4Y A;  5D5X B;  3CCR I;  3VOD A;  1JI8 A;  4P96 A;  2R7Q A;  4IQJ A;  3F8C A;  3CC2 I;  3BHQ A;  2DDA A;  2HZD A;  2QEX I;  2ZCX A;  3L00 A;  3ZCO A;  2A6E F;  2XAF A;  3KP7 A;  5F6F A;  3L2C A;  3K70 D;  1HBX G;  1FJL A;  5DS9 A;  3OWT A;  5A2Q Z;  5JFR A;  3G1L A;  5K5Q A;  5F04 A;  3AL0 B;  2MBF A;  1F36 A;  3I4M J;  1HC8 A;  5HVQ C;  2YVE A;  1SAN A;  3HL2 A;  3CCM I;  2EZH A;  3R0A A;  2X6W A;  4LIV A;  3ZPL A;  4M73 A;  1GVD A;  1S72 I;  2K9M A;  3BDD A;  2EPF A;  2BBY A;  2CUZ A;  2CQ7 A;  5F64 A;  2KKO A;  3EUP A;  2XSD C;  3CME I;  1MIJ A;  4IRH A;  2K40 A;  1T08 B;  4C2U A;  2ZCN A;  4FE7 A;  4B3A A;  4Q4Z F;  3JRF A;  1P7J A;  1LQ1 A;  1G59 A;  1W36 C;  1S3J A;  3GME A;  4JQF A;  3CJT B;  1M1E B;  4V19 K;  2EV0 A;  2F5C A;  5K1Y A;  3MMY B;  4HOB A;  1S8N A;  4GGG A;  4IZZ A;  1S7O A;  1LJ9 A;  2Y0S N;  1B4A A;  3PFI A;  4ACI A;  3TBI A;  1FNN A;  3OR2 C;  3RZD J;  1SFE A;  2RAS A;  2EZL A;  3S5R A;  1KON A;  3NWT A;  1HDP A;  2R5Z B;  4HNV A;  1MMG A;  2KL4 A;  3VYT B;  1IN7 A;  3A01 A;  2MYS A;  3WTY C;  2GZW A;  3BQY A;  1E3H A;  2FF4 A;  3KP4 A;  3GTP J;  3FBI B;  3IL2 A;  1B59 A;  3S1M J;  4EJW A;  3CDL A;  3FMQ A;  3I5U A;  2XAU A;  2PJR B;  3GFI A;  2F4I A;  5K7F A;  3KKC A;  2ZCM A;  2V7F A;  3SEQ A;  2RAE A;  2HDC A;  1BI1 A;  1TC3 C;  1SMT A;  1POG A;  2IEK A;  1FY7 A;  1QPI A;  2BW3 A;  3CO7 C;  4EJT A;  1YI2 I;  4IL6 C;  2NP3 A;  2ZME A;  1KGS A;  1BL0 A;  4Q5S F;  3NPI A;  4IHT A;  3K4N A;  3KE2 A;  2FML A;  3AG4 H;  1F4K A;  1FMV A;  3UKG A;  1JE8 A;  4UVC A;  2E1C A;  4GRI A;  4IX7 A;  3V7C A;  2E36 A;  3ABK H;  2VOP A;  2I10 A;  2BHY A;  3E6M A;  3GW2 A;  5J1Y A;  5LD2 C;  3ZMS A;  1GV5 A;  4AD9 A;  2M1B A;  5E8G A;  3J7Y J;  2VIX A;  2W1O A;  2PBX A;  5TIS C;  1L0O C;  2F5F A;  5M3M J;  3CCL I;  2HWV A;  5CXI A;  4JL3 A;  1XC5 A;  3GLX A;  2O5R A;  1Y8R B;  1RET A;  4B4C A;  4AVP A;  2ZXI A;  3F8M A;  4YFN F;  4XON A;  1ZGJ A;  4F55 A;  1W0U A;  2RHA A;  2DA2 A;  1YJ9 I;  4U9L A;  4OIN F;  1JHH A;  1MMA A;  2P4W A;  1UHW A;  1YE9 A;  5FFX A;  2EJR A;  1LE8 A;  2FRH A;  3H9J A;  4A3E J;  5CQE A;  3TGN A;  2L7Z A;  2RNG A;  3MEX A;  1PP8 F;  4II3 A;  5J1U A;  3GTJ J;  1OR7 C;  2ELJ A;  2R7Z J;  3CZ6 A;  2W84 A;  2Q0O A;  3K4M A;  3V78 A;  3K70 C;  4EGZ A;  1LFB A;  2CV0 A;  4DIQ A;  4II2 A;  5IY5 H;  1YW9 A;  1AOY A;  1YW8 A;  2VON A;  1I3A A;  1WKM A;  2XF7 A;  3MKY B;  4AU7 A;  3IRR A;  2VBY A;  4A6D A;  1T38 A;  5TJJ A;  4E7H A;  4ZDO A;  3IKT A;  1MZB A;  5TGT A;  1U0J A;  3C7J A;  3DBR B;  4N4O B;  3ZP5 A;  4E7Z A;  1NH3 A;  2C6Y A;  2E19 A;  4ZJZ A;  5H9T A;  4IVN A;  5AQC A;  2P7C B;  3TP3 A;  2CUE A;  1JGS A;  3TO6 A;  3DEU A;  3I64 A;  4ITV A;  3LJL A;  4RM3 A;  4UDS A;  3H36 A;  4FAS D;  2VQC A;  3QRF F;  1W7P B;  4C30 A;  1G3Y A;  3TL4 X;  4B43 A;  2XPW A;  2IVM A;  3IRQ A;  1P7I A;  4MEY F;  2V1N A;  1Z91 A;  1G6N A;  2HQ5 A;  2ZBK A;  2OCE A;  2KDO A;  5HS9 A;  2XDN A;  3ZQ7 A;  2QQA A;  3RJP A;  3ZQG A;  4I6Z A;  3COA C;  4OMY A;  2ZXW H;  3KZY A;  3LAP A;  3L7W A;  2KDZ A;  2XGX A;  1ULY A;  1DUX C;  3OYH A;  2YUS A;  1REP C;  4XLP F;  5BPI A;  1KQ0 A;  3CUO A;  2P5L C;  1XS9 A;  2XUB A;  4I98 B;  4CCO A;  2HOT A;  2E2J J;  2K27 A;  2YSR A;  3F23 A;  2W4S A;  3O8G A;  5LHI A;  1ETX A;  2DOF A;  2QEN A;  3BR3 A;  2OER A;  2KIQ A;  1ZRE A;  4RAZ A;  2W00 A;  4P1W A;  2E1N A;  1JHF A;  2XB0 X;  2O8X A;  1AA7 A;  5M3F J;  1VQP I;  3HUG B;  2EZK A;  5EG0 B;  2CV1 A;  3BTL A;  1WH5 A;  3DQV C;  4XKW A;  3H3U A;  2MA3 A;  3UNG C;  2DOD A;  2VKV A;  1HSJ A;  1SFK A;  1IN6 A;  3F8F A;  2FJ1 A;  2B7E A;  4C2T A;  2Y31 A;  5FKN A;  5B66 C;  2ZOZ A;  3QPS A;  2MH2 A;  5L3C A;  1R23 A;  5CYV A;  1QU3 A;  5ILU A;  1XSV A;  5IT3 A;  3W6K B;  3EYY A;  4N9H A;  4WX9 A;  3N05 A;  2DQL A;  2VN2 A;  3OL4 A;  5CPR B;  3IUO A;  3MN2 A;  3R61 A;  2NNY A;  1QA6 A;  2DAO A;  3TP0 A;  2L02 A;  2MH9 A;  4LIT A;  3Q9V A;  3ZQH A;  4CZC A;  3SDB A;  4D9J A;  1R5H A;  1X1A A;  3B73 A;  3P5J A;  5A2Q K;  5FFZ A;  1I27 A;  1X3U A;  4RGR A;  5GAH J;  3HBL A;  2GXA A;  3MKW B;  3GXO A;  1K4T A;  2IGM A;  3FHZ A;  3BQZ A;  4H4K C;  5F0H A;  5IP6 A;  5EEH A;  3WOD F;  1BBY A;  4KIG A;  1VQ5 I;  4LMY A;  1W5T A;  3CQZ J;  2PLY A;  4L5J A;  4D5F A;  4U0W A;  3H9G A;  3PM1 A;  4LK1 F;  3HIM A;  4NC7 A;  1CGP A;  4IKF A;  1RC9 A;  4ZZL A;  4IOA F;  1D8K A;  2HEO A;  4ABZ A;  3W6V A;  1I50 J;  2IGO A;  3VOX A;  3TOA A;  5AIP A;  3PPB A;  3HEF A;  3VVX A;  4A5M A;  2DO7 A;  3OYB A;  2Z33 A;  3NRV A;  1U3E M;  3BJ6 A;  3RDI A;  4PDK A;  5AIQ A;  3PAS A;  1QRY A;  2W57 A;  4ENK A;  3TMO A;  5IPA A;  1PDN C;  1K4S A;  4D7N A;  5F0F A;  4U7B A;  1VQ8 I;  5HOO A;  3FRQ A;  4LLG F;  4RAY A;  3SHF A;  2IW5 A;  3EUH A;  4DQ2 A;  3EUA A;  1T0F A;  2PI0 A;  3C2B A;  5DD4 A;  1BR4 A;  3ONQ A;  2ZC2 A;  3I0T A;  1ETO A;  2GIV A;  2QKM B;  1ZGA A;  2IBD A;  1GV2 A;  3T8R A;  2ELK A;  5M5W J;  2XPV A;  4BHB A;  2PFB A;  1XGM A;  4ESJ A;  1YQA A;  3JRC A;  1IN8 A;  1LUJ B;  3VTI A;  2Y75 A;  4A2U A;  5E17 F;  4PFP A;  4XOT A;  3HE0 A;  1ZQ3 P;  1UFM A;  4BYY A;  2EB7 A;  2W53 A;  3WTX C;  3QPH A;  3DWL E;  2M34 A;  5CVV A;  4OIQ F;  1UG2 A;  4Y7N J;  5J8C A;  3PUF A;  2PMZ A;  2EFW A;  4DBQ A;  4XID A;  3IV5 A;  2CW0 F;  4PFO A;  3QYE A;  1B6A A;  2LMD A;  3FIW A;  4BU2 A;  5EZG A;  3CDI A;  2DLL A;  3KIO A;  1SFO J;  4YRV A;  1ZKG A;  1MND A;  5ICC A;  3E6C C;  2MAB A;  1WI3 A;  1IN5 A;  4KN7 X;  2ZNZ A;  5E1W A;  3FF5 A;  4GYI A;  2ZXJ A;  1BOA A;  1O3Q A;  1K61 A;  1V5F A;  2QSH X;  4NC8 A;  5C44 J;  3ML6 A;  1LDD A;  4G6T B;  3K1P A;  2VUM J;  2O6G E;  3AG3 H;  3OIQ A;  4DYQ A;  5FLX Z;  2BV6 A;  3QOD A;  1HQC A;  2X1E A;  5JHU A;  4WIB A;  4G9Y A;  4LIU A;  2NXN B;  1R22 A;  2V1D A;  1ZLK A;  4CGZ A;  2W25 A;  1IG7 A;  1ZN2 A;  3ZQI A;  3CCS I;  1W4M A;  1QZZ A;  1K83 J;  4KUM A;  2NVQ J;  1S5L C;  2X0L A;  2XPU A;  4BDZ A;  1Y0N A;  1U6G A;  4L9J A;  4PGG A;  3AQS A;  2M3A A;  4U88 A;  1GXP A;  1IW7 F;  3R0J A;  1OCP A;  3K10 A;  5KCM A;  2OD5 A;  2K9S A;  4AC0 A;  2ME0 A;  1G3S A;  2VQH A;  5ICE A;  2VPL A;  4XSZ F;  4IRV A;  2JN6 A;  4B3X A;  2KJB A;  4AIJ A;  2X85 A;  2E1O A;  2HU9 A;  3HHH A;  3M1C A;  2PFV A;  1Z3Y A;  1OMI A;  2H6C A;  3M8E A;  5M5Y J;  1B72 B;  3GF2 A;  2LBF B;  5IYD J;  1TZL A;  2GQQ A;  3QOE A;  4DYR A;  1SD5 A;  3L2V A;  4KJZ A;  3BR1 A;  2WB1 A;  1BC8 C;  4A3G J;  4A0Z A;  1QHH D;  4M3G A;  3M7G A;  1P6R A;  3MZY A;  5F1J A;  2PMU A;  2DT6 A;  2HDW A;  1GXQ A;  5H6Q A;  3G73 A;  1TL8 A;  2E2H J;  2FQ3 A;  2M0M A;  3S2D J;  3K7A J;  1RR7 A;  3IC7 A;  3DXJ F;  4OU0 A;  4A69 C;  5FB2 A;  2DJI A;  4MGR A;  3ULQ B;  4EJO A;  5KNL A;  2FOW A;  2IT0 A;  2PMH A;  2LG4 A;  3LSM A;  3VB2 A;  3HSE A;  1YS6 A;  2IXS A;  4RBO A;  1ZRD A;  3COL A;  4LD5 A;  4U0Y A;  2J5P A;  5E8I A;  3F0C A;  4UVA A;  4XOR A;  3D0S A;  1TWG J;  3OYF A;  2MG4 A;  2FU4 A;  2ZSH B;  3LSG A;  4QPQ A;  3JRG A;  1HKT A;  2DCE A;  5L3B A;  3G1O A;  4AID A;  5FRM A;  3DPT A;  4G7O F;  2EBI A;  3BG7 A;  1SGM A;  2F48 A;  3HM5 A;  2MW8 A;  1IO2 A;  4O6J A;  4MHG A;  1R00 A;  3OYG A;  2HZT A;  4MFE A;  5J6X A;  3LSJ A;  1ZG5 A;  1WJ5 A;  1H9T A;  2MC4 A;  2XGD A;  3PSI A;  4FX4 A;  4Y13 A;  1K79 A;  2ZXH A;  3WHC A;  4XRM A;  1SAU A;  1J75 A;  5IYC J;  4XKB A;  3DTE A;  3FX3 A;  3G71 I;  2KIS A;  2CSO A;  4PUS A;  4V2G A;  4M3F A;  3FMS A;  2VOD A;  3G1M A;  1XN7 A;  1ZK8 A;  3R60 A;  4IRG A;  3U1D A;  4L5E A;  2XC7 A;  1X19 A;  1ON1 A;  1XTA A;  2WA0 A;  3P9C A;  1FT9 A;  2MFZ A;  2WY8 Q;  3WGG A;  4S05 A;  2A5Y B;  1ON2 A;  4ENN A;  3LNQ A;  1ETQ A;  5E3O A;  1D3Y A;  4B09 A;  4HRI A;  2GM4 A;  1OLT A;  1O3S A;  2COM A;  4A93 J;  1VFC A;  1XGO A;  4ZC3 A;  2HVR A;  3BRU A;  2QBY A;  2NS8 A;  1X3Z B;  3MZH A;  1IXS B;  1XX5 A;  2EZI A;  2Y0M A;  2XKP A;  5ERI A;  1I5Z A;  5HNH A;  1YJN I;  1X1D A;  3S15 J;  1U5T A;  3FXR A;  3CUQ B;  3HJE A;  5GAG J;  2K9N A;  3RTR A;  5TRD A;  2F5D A;  1WZ2 A;  2DOE A;  4MK6 A;  4I2O A;  3KYC B;  3Q9S A;  2ZJ2 A;  2KIF A;  2M0C A;  4NHJ A;  2GBY A;  2MLG A;  2UZK A;  1MH4 A;  3ZQF A;  4EJV A;  1Y1W J;  3ESW B;  1SVL A;  3RZO J;  1WRJ A;  2HDD A;  4B47 A;  3KYD B;  2WBM A;  3O60 A;  3F6O A;  4CYC A;  3VW0 A;  1KZH A;  3W6J B;  1H0M A;  4G7Z F;  5B1A H;  3KEQ A;  1TNT A;  2EIL H;  3FDY A;  3J81 Z;  1HKS A;  2XDV A;  1YW7 A;  1X1B A;  2DXI A;  1R36 A;  4LFU A;  1PUF A;  3HOX J;  2F5V A;  3E1S A;  4PJN A;  3DBL B;  2HR3 A;  5HDK A;  1WWX A;  4EQQ A;  1NK3 P;  1IUF A;  3HOV J;  5HBU A;  4CDG A;  4BE0 A;  1GUU A;  3MWM A;  1FBU A;  1D0X A;  4NQW A;  4E7L A;  3LOC A;  3S17 J;  3VOK A;  4Y33 A;  5CKT A;  3U21 A;  4BH9 A;  5JI6 A;  1U9O A;  1Z05 A;  4QPO A;  2G7H A;  2VL8 A;  3LWJ A;  4GFB A;  2RNJ A;  4YIR X;  1FC3 A;  2EQR A;  1VQO I;  2W85 A;  2VOO A;  2G0E A;  9ANT A;  3Q0W A;  2Z9O A;  1VQK I;  2R7S A;  1S6L A;  5HAW A;  4M71 A;  3HTH A;  2EFP A;  1QNT A;  3E7L A;  5D8K B;  2M7B A;  1G3W A;  4QWQ A;  2WUI A;  2DYS H;  4ENJ A;  3MFK A;  4I09 A;  3U2R A;  1RUO A;  4MTE A;  2XV4 S;  1E3P A;  4HV6 A;  3W3C A;  3M8F A;  5JR3 A;  3SYT A;  2HI3 A;  2OQR A;  1A31 A;  2IS4 A;  5E3N A;  2K9L A;  2GLO A;  1WJB A;  1W0T A;  3FXL A;  4WXC A;  4G8X A;  2Y30 A;  4IO9 F;  1F43 A;  1WQ2 A;  2DMN A;  2F2E A;  3IH3 A;  4LG3 A;  3CJN A;  1N25 A;  3A01 B;  1HW1 A;  3QQA A;  2WB1 N;  4GXO A;  4IF4 A;  2A68 F;  4EV0 A;  5JVG F;  3EDP A;  4I02 A;  2DT7 B;  4CSW A;  4R1H A;  3JR9 A;  1ZAR A;  4XSX F;  4N0B A;  1FOX A;  3M9A A;  3CF2 A;  4YZE A;  2R3S A;  1BW5 A;  1L3L A;  1IGN A;  4U7D A;  1TLH B;  3S8P A;  5LHH A;  2CJJ A;  1DPU A;  2KQR A;  1G4D A;  5HSZ A;  1Z3X A;  1YTY A;  3ASN H;  5GP9 A;  1W5C C;  4I7H A;  3TW6 A;  4BAY A;  4WXH A;  1SAX A;  1XSX A;  1FLI A;  4B1R A;  4HQM A;  2L7M P;  1OIS A;  2G7L A;  3RQI A;  1D5Y A;  2E71 A;  4HX7 A;  1V54 H;  3H3Z A;  1YYV A;  3GTL J;  4FET A;  2JUC A;  2G7S A;  5DAJ A;  2MD5 A;  1ZTR A;  3TO9 A;  1UB9 A;  3A1Y A;  1MMN A;  1TNS A;  1A5J A;  2KHM A;  4HYE A;  5H20 A;  4ZTJ A;  2K02 A;  2XHK A;  4H0E A;  2Z3Y A;  4HLY A;  1D1B A;  2Y2Z A;  5CVI A;  4OAZ A;  2UXP A;  3WHB A;  2A07 F;  2KMU A;  1QPM A;  5EZH A;  1RKT A;  1UEL B;  2QCO A;  2YS9 A;  4BY1 J;  1QVU A;  1GHC A;  4MO7 A;  3DBH B;  4LK0 F;  4OIP F;  4UXN A;  5LBQ A;  4AVZ A;  3BZC A;  1FYL A;  3WU0 A;  1MNM C;  1DU6 A;  1HDD C;  2LLK A;  2DG7 A;  1I6H J;  2DN0 A;  5FGL A;  4BXU A;  5FRN A;  1TTY A;  4M3D A;  4A3D J;  4BS9 A;  4IHS A;  3RKX A;  5K7Z A;  4XN3 A;  3EUK L;  1ETW A;  2Y9Y A;  4GFK A;  1ZHF A;  2EFN A;  3U9G A;  2BXY A;  1OYW A;  3F1B A;  2DMT A;  3VYR B;  1MDM A;  1FOW A;  1D8J A;  3MKL A;  4WF2 A;  2UXH A;  2Z5U A;  4UV8 A;  4HF0 A;  3GVA A;  5H2F C;  3H5N A;  2RKH A;  5CJ9 A;  3GTG J;  2W82 A;  4D0P A;  2JRT A;  3JRE A;  4HLX A;  2OC6 A;  4FTH A;  3VIB A;  1U9N A;  1WVR A;  1IDY A;  3FHN A;  4FX0 A;  2HTS A;  3OY9 A;  3GTO J;  2O7T A;  1H89 C;  1J9I A;  2M2E A;  2STT A;  1A04 A;  2JSP A;  4MQ9 F;  2V6E A;  2VKD A;  4KIF A;  1ZG1 A;  1HST A;  3HOT A;  3AL0 C;  3WTT C;  2VI6 A;  1VTN C;  2K7L A;  3WTU C;  3HOZ J;  3X2Q H;  1UJ8 A;  3V8L A;  4BHC A;  2F4M B;  1GDT A;  2EWN A;  1V5G A;  2M7A A;  1NK2 P;  1YX5 A;  4XLE A;  3RIR A;  4YEL A;  1GVJ A;  5CW8 A;  3KZI C;  1DGW Y;  3N4M A;  1CF7 B;  1HF0 A;  1D0Y A;  1EA3 A;  1B1B A;  1YFH A;  2L4A A;  2O8K A;  4I99 C;  1H88 C;  3W2W A;  3IH4 A;  3JW4 A;  1P4W A;  4M9S A;  2DG8 A;  3CCY A;  4OAY A;  1BI2 A;  2TDX A;  3WTW C;  3LA7 A;  3BTI A;  3S93 A;  2ZCW A;  2H09 A;  4M74 A;  3D5R C;  3JTH A;  1UMQ A;  1W7P D;  1A35 A;  1OKR A;  3TW7 A;  4ZDL A;  4DBR A;  2I5U A;  4FCY A;  1EF4 A;  3OS2 A;  2R7D A;  3BY6 A;  3I56 I;  1YHQ I;  3G56 A;  3HKZ A;  1XG1 A;  2WAF A;  2O03 A;  3QPL A;  2L54 A;  1MSE C;  3IP4 B;  4IRI A;  2B3W A;  2A3S A;  2ZO4 A;  4KNY A;  2VQG A;  2WV0 A;  3QPT A;  3J81 K;  1QO0 D;  1YIJ I;  1FMW A;  2ME6 A;  2AO9 A;  3V4G A;  5E3L A;  2K86 A;  1TT0 A;  3GBG A;  2DOA A;  2L7F P;  1FEX A;  4CXF A;  3BR0 A;  2QYO A;  4BJ5 C;  3S3O A;  1Y56 A;  3LAJ A;  1FTZ A;  3C2G A;  5FO5 A;  1MBK A;  2K4B A;  5GTH C;  2BZT A;  2GFN A;  3ECO A;  2JVH A;  4GFL A;  5DV5 A;  3WGI A;  2L2O A;  2XRN A;  4BEH A;  2ID3 A;  3DKW A;  4HKU A;  5BQT A;  2STW A;  2KIU A;  1ETK A;  2VLA A;  2JA7 J;  4CO8 A;  1USS A;  3OV8 A;  3FK7 A;  3PO3 J;  1KYZ A;  2D1H A;  3KLN A;  4LG0 B;  3CLQ A;  4BJT A;  1Y0U A;  1UI6 A;  5EGO A;  4JNN A;  2B63 J;  1LDJ A;  3B6C A;  2WTE A;  2X48 A;  3HGG A;  4S04 A;  3EPZ A;  4PJJ A;  3LQQ A;  4PK4 A;  3RSN A;  4JX6 A;  3PFY A;  3KZZ A;  3WTZ A;  5L3E A;  1R5G A;  3QOP A;  3E5Q A;  1S7E A;  1FIA A;  3L2Q A;  1JKP C;  1S7A A;  4LGW A;  2FOK A;  4KIC A;  2VBW A;  2XB5 A;  4DJA A;  4C3I J;  2OZ6 A;  2RV8 A;  5BMZ A;  4OIR F;  4IEJ A;  4RB3 C;  5H6R A;  4ZH4 F;  4RAF A;  4A3K J;  1LEA A;  2F5E A;  3OIO A;  4NEL A;  2L9N A;  2ZFW A;  1RES A;  5KVR A;  3HG9 A;  4KMU X;  3OYC A;  4HW0 A;  2LF7 A;  3GLL A;  1ORK A;  4ZYE A;  5FD6 A;  2JA6 J;  3AG2 H;  1E3O C;  2QUF A;  1V4R A;  3GEZ A;  4I0A A;  1UZC A;  4AWX B;  5D5U B;  1PUE E;  2LY2 A;  4EEF G;  5JLW A;  4LB5 A;  3MCZ A;  3HRM A;  4A3M J;  2QA4 I;  1O7F A;  3K4B A;  2R7F A;  1WFX A;  1K78 B;  5DUI A;  1LEB A;  3DPJ A;  4N9I A;  1WGX A;  1YRN B;  4CHU A;  4JX4 A;  1Z0X A;  1C0W A;  3GFL A;  2M30 A;  2R7U A;  4Y4R A;  2P7V B;  2LKX A;  4OD5 A;  2ESN A;  3DEW A;  3ROU A;  2ZJQ F;  2CQX A;  4G6D A;  1R6R A;  2Z2S B;  2JA8 J;  3OOU A;  4U9N A;  1SD4 A;  2FXA A;  3FXQ A;  1UST A;  2OU2 A;  4RB0 A;  2L9R A;  4M3B A;  2CU7 A;  4AUX A;  1D1A A;  2G7G A;  4P9F A;  1LB2 A;  2YVX A;  3NXC A;  3L9F A;  2DPU A;  2JPC A;  1JKQ C;  2XAG A;  5DYM A;  4UUS B;  3OYM A;  1R49 A;  3FXU A;  1OR7 A;  2BXZ A;  2KRF A;  4GDF A;  2WV1 A;  2DK5 A;  2GXG A;  1EH7 A;  3S1Q J;  2M45 A;  3W2A A;  3K9T A;  2HPI A;  1HOM A;  4GCL A;  1B9M A;  3RPU D;  3GO5 A;  2LD5 A;  2JRM A;  3E7Q A;  4OIO F;  4LOC A;  2IGN A;  1KA8 A;  4P55 A;  3K2Z A;  1T98 A;  3L09 A;  2R0Q C;  3IHU A;  3DKY A;  1ZEL A;  1KU9 A;  2ESH A;  2ZKZ A;  3S1R J;  3R4K A;  4KT6 A;  1MD0 A;  3BZ6 A;  2Q2E A;  3ERE D;  3C07 A;  2Y69 H;  1ETV A;  4WXD A;  5K5O A;  2HKO A;  2LYC A;  1FPQ A;  3SFI A;  3TO7 A;  2VXD A;  4CCK A;  2LNB A;  2LF8 A;  1ENH A;  2OV7 A;  2RVC A;  2IAI A;  4NDL A;  3V42 A;  2NVU B;  4EAT A;  1YIT I;  4QLC U;  5EF6 A;  2JT1 A;  3DEE A;  4YFX F;  2HXO A;  2DMP A;  4NUB A;  2M87 A;  3HKZ N;  3FKJ A;  1Y1V J;  4WK8 F;  5DCM A;  2H8R A;  2QWW A;  3WG7 H;  4HF2 A;  4AF5 A;  2NNN A;  1FIP A;  4GYG A;  4HPQ A;  5DD8 A;  4FE4 A;  4J01 A;  1VQ7 I;  5C3E J;  1IRG A;  1UG0 A;  2NVY J;  4RLQ A;  1AWC A;  1FP1 D;  3GX4 X;  1HW2 A;  3ZRG A;  3RPQ A;  4JKZ A;  2V1X A;  1F5T A;  1IRX A;  3DV8 A;  4EM0 B;  2BVM A;  4HNT A;  5K7H A;  1UAA A;  2X6X A;  3FXJ A;  2FUG 2;  5IYB J;  2BEO A;  4KFC A;  2BGC A;  2E7W A;  3G2B A;  4C3H J;  2PBI A;  2H1K A;  4KDP A;  3CWR A;  3TDU C;  2LR8 A;  2GUH A;  1BI3 A;  1KU3 A;  5D4R A;  2OUM A;  3OYE A;  1U78 A;  2WWY A;  2DQR A;  2G9W A;  3DU6 A;  2M4K A;  4UB8 C;  3HTI A;  2LOO A;  2IGK A;  2ZNY A;  2CG4 A;  4Q47 A;  1IRZ A;  1WJD A;  5ICF A;  3EYI A;  4KIB A;  2Y48 A;  2BHZ A;  2KZV A;  3F8N A;  4KMF A;  1AU7 A;  3E6B A;  2GIZ A;  2M8E A;  1BA5 A;  1GT0 C;  3WU2 C;  4D7M A;  3I58 A;  4Y3O A;  3JRI A;  2W24 A;  1STZ A;  1MJB A;  2PN6 A;  2NRA C;  4IXA A;  3PIP F;  2VAS A;  4I01 A;  4XLC A;  3T0Y A;  3DLA A;  1I1S A;  5DDG A;  3ANP A;  2UXX A;  5F27 A;  1APL C;  2X6Y A;  1VQ9 I;  3BPX A;  2D2W A;  5HS8 A;  2ZOY A;  3OYD A;  1QZY A;  2DTR A;  4M72 A;  4BDY A;  4BXF A;  3SEZ A;  2TCT A;  2P6S A;  4UUT A;  2PZ9 A;  2DFE A;  2ZB9 A;  3E5X A;  1FBS A;  3OOP A;  2YU3 A;  3CTA A;  3FBN B;  1WJE A;  2LH9 A;  3S2W A;  2H6B A;  2DA4 A;  3ZMV A;  1K7A A;  2L5Q A;  1FOK A;  2VJ4 A;  3HYI A;  4M3E A;  1U5T B;  3HSF A;  1FP2 A;  3HTA A;  3ZQQ A;  3A03 A;  1JUP A;  5B5E C;  3JAM Z;  3S16 J;  4HNU A;  3MKZ A;  1R58 A;  3AQT A;  5LRS A;  3FZV A;  3LSR A;  3PO2 J;  2L3D A;  2VT2 A;  1QVT A;  1FZP B;  2ISZ A;  3PSF A;  2F07 A;  1WH7 A;  1IF1 A;  2VC1 A;  3BOQ A;  3SZG A;  2W7N A;  2AS5 F;  4CYC B;  1IDZ A;  4E7I A;  4BXX J;  1BR1 A;  4HSR A;  1TWH J;  1A6I A;  2G3B A;  3CD6 I;  4CIC A;  1J59 A;  3HZJ A;  3HOW J;  1TQM A;  4XRF A;  2ACJ A;  1LDK B;  3CJQ B;  2P0W A;  5IT9 Z;  3KP3 A;  4ON0 A;  1TWA J;  3KP2 A;  4NQW B;  3ZMT A;  2OBP A;  4RGS A;  5FKM A;  4UUV A;  3TKY A;  3CDH A;  2HYJ A;  3C2H A;  3DPU A;  2E60 A;  3WE2 A;  4CGR A;  1VQM I;  1SEU A;  5K5R A;  3LSI A;  2XGC A;  4FIS A;  1R1T A;  1J0R A;  3F9K A;  3KEO A;  3ABL H;  3Q0U A;  5B3S H;  1B8I A;  2EIM H;  1LFP A;  3OR1 C;  4HV5 A;  3NNR A;  4M9Z A;  2V4J C;  4HA8 A;  2M8G X;  2F6C A;  4BY7 J;  2OAZ A;  1IN4 A;  2O3F A;  2JA5 J;  3W2V A;  3TOB A;  3MQ0 A;  1WHU A;  2OQG A;  1OPC A;  3WE3 A;  2GA1 A;  5LGU A;  2W48 A;  1OYY A;  3BJO A;  3LA2 A;  2H1L A;  4B44 A;  1F9N A;  3Q3S A;  5FJ8 J;  3T5X A;  1P4A A;  3J7A O;  4XLF A;  2E5N A;  3LHQ A;  2O9L A;  4RA2 A;  3CCU I;  5KAI C;  2FE3 A;  3H92 A;  4YII A;  3SWH A;  4L9V A;  3JTG A;  5HLG A;  2IS1 A;  3BG3 A;  2XAH A;  4E4H A;  5LFA A;  5LLQ A;  3BJB A;  4M6V A;  2BY3 A;  1OCO H;  2FEZ A;  4MQV A;  3I3L A;  5LEK A;  5E18 F;  3LWF A;  4GCK A;  4Z6Y A;  2QWT A;  2DA3 A;  2R7X A;  4X0G A;  4EMS A;  3NAR A;  3MD2 A;  1G3T A;  2UXO A;  2RN7 A;  1IAW A;  2H8W A;  3J80 Z;  1LVA A;  3RKQ A;  4XR6 A;  1ONV A;  4OWR B;  3LQR A;  2ELH A;  1MMS A;  3SQN A;  2IU5 A;  5J8F A;  2PJP A;  2PG4 A;  3OYN A;  2QKL B;  3DLL F;  2A6T A;  4L18 B;  3C1D A;  5J40 A;  1QHG A;  2Y9Z A;  4RB2 C;  4UB6 C;  1OCR H;  2HOA A;  1P9Q C;  2LC2 A;  5BOX A;  1BJZ A;  1Z77 A;  2IS2 A;  1X3W B;  3ZMD A;  4WCG A;  3JRD A;  1MBJ A;  4UVB A;  4N4N B;  4BQO A;  2YPR A;  3JRB A;  2PMZ N;  1RIO H;  3IWZ A;  4OD4 A;  1TWC J;  3DFG A;  2OI8 A;  5D18 A;  1D5V A;  2LTP A;  1XPX A;  2EV5 A;  3CJD A;  2UWM A;  1BJA A;  1N78 A;  3PNY A;  4BQA A;  3NWS A;  4XKV A;  5GPA A;  4ESF A;  2B1E A;  3I54 A;  1RPW A;  5C4Y A;  1R4N B;  2CQK A;  2UXN A;  2LFB A;  3TQN A;  1SC7 A;  2VBZ A;  4BQQ A;  4C2M J;  3H9Q A;  2O61 A;  2HXI A;  2Z1D A;  5HNF A;  2AQF A;  2DK8 A;  2R4G A;  4HAM A;  1X1P A;  1QBJ A;  1RUN A;  3M8J A;  4WWC A;  2QQ9 A;  3LFK A;  4BNC A;  1T56 A;  1MBH A;  3JRH A;  3PL8 A;  1SVO A;  2KIM A;  2AXT C;  3I4N J;  3KPH A;  2XRO A;  5EJC A;  4PXI A;  3FXK A;  4F3Q A;  2R7V A;  3CUQ C;  3D1N I;  5ILS A;  2G7U A;  1VI0 A;  2CFO A;  2HQA A;  3GZI A;  4Q48 A;  5J1R A;  3O6B B;  2FSW A;  1E17 A;  1FTT A;  2VC0 A;  3WGH A;  5EEA A;  1B72 A;  3VW1 A;  1ODD A;  2K85 A;  4V2F A;  2NAZ A;  2V26 A;  4OOI A;  1MW7 A;  5FRO A;  4PGH A;  4E70 A;  2ZJP F;  4BAC A;  2DA6 A;  2V57 A;  3CO6 C;  1DQU A;  2NS7 A;  2FQ4 A;  3RH2 A;  2V9V A;  3OSG A;  2QZ8 A;  3K69 A;  1Z7U A;  1JJ8 C;  4L0Y B;  1EKE A;  2WC2 A;  2BYV E;  3OYL A;  2IRF G;  4G94 A;  3ANG A;  3ON4 A;  1TT5 B;  1XGN A;  3IAS 2;  3L2U A;  5JLX A;  2O7O A;  4L9T A;  3FM5 A;  3HOY J;  2BVL A;  3GYH X;  1LFU P;  2KZG A;  4LB6 B;  2VBX A;  2DA5 A;  2WAE A;  5AON A;  4D5C A;  3HTU A;  2LSO A;  3CRJ A;  5CVJ A;  1FWZ A;  2LDU A;  4QSH A;  5FLX K;  1VZ0 A;  1BN5 A;  2BW3 B;  3P9K A;  3HDD A;  1IC8 A;  2ZME B;  3G4S I;  3GZ5 A;  1WJA A;  3LST A;  2KPM A;  4KA4 A;  5FGM A;  3IUV A;  5J4V A;  1MBG A;  3ZN1 A;  2OF7 A;  4K2E A;  2LY1 A;  1AKH A;  2IS6 A;  4E6K G;  2CW8 A;  3CCJ I;  3JAM K;  3SFZ A;  3O2P E;  1MJ9 A;  1T95 A;  3B6A A;  1E0E A;  1E2X A;  1S29 A;  3F72 A;  1XMA A;  4XKC A;  1MGT A;  3L2R A;  3SJM A;  4AIH A;  2Q8K A;  4Y52 J;  1WPK A;  5D1R A;  2VPR A;  2LVS A;  4I76 A;  2OTL I;  2MD0 A;  3ISP A;  4CZZ A;  3H3V K;  2DBB A;  2HVQ A;  2LKS A;  4HQE A;  3VYS B;  2IA2 A;  2Z16 A;  4HDU A;  2XSJ C;  5IT9 K;  1LE8 B;  3C3W A;  3S2H J;  1VF9 A;  2ZME C;  2ETH A;  3H1C A;  2WAQ A;  1YJW I;  3K4L A;  3DTK A;  2F4O B;  4Z2Y A;  3NI7 A;  2HVS A;  1DP7 P;  2RGV A;  2CS3 A;  2LRD A;  3CUQ A;  4TV7 A;  2AXL A;  1RR8 C;  3CCQ I;  3SXY A;  4QIW N;  3TED A;  1HW5 A;  3MZ8 A;  1PP7 U;  1IJW C;  4UY8 I;  1FSE A;  5J3L A;  1P4X A;  4XLN F;  2JQ7 A;  4IPA A;  4BEH B;  3JSP A;  1MMD A;  1I6X A;  3GFM A;  1FYM A;  3DU5 A;  1XMX A;  2JWT A;  1OYI A;  2DA1 A;  3F22 A;  2R5Y A;  2R92 J;  1OFC X;  2R7T A;  3I59 A;  3OYJ A;  3H35 A;  5EGO B;  4EJU A;  3GZ6 A;  1PYV A;  3D5L A;  3V8J A;  1SFU A;  1G2H A;  4CCL A;  2NX4 A;  4C2M A;  4IHV A;  4S0H B;  1QGP A;  2QOP A;  2HYG D;  1TQI A;  3I71 A;  1RKW A;  5DM7 F;  4E7J A;  1XCV A;  1CQT A;  2NVT J;  1XCB A;  3D5S C;  3P7N A;  4MNU A;  1WSU A;  2MC3 A;  5CQG A;  3BCA A;  3FKI J;  2ZJR F;  5LHG A;  2HPM A;  5ED4 A;  3E0J B;  2MGQ A;  4BL0 B;  1YG2 A;  1JUM A;  3I55 I;  3HIF A;  2BY1 A;  3P9T A;  2DDB A;  2R7O A;  4DZP A;  5HLH A;  4NNJ A;  4CCM A;  5EEG A;  3KNW A;  3J80 K;  4IHY A;  2P5K A;  5E1Z B;  3HTJ A;  3H0D A;  1T2K A;  2V1U A;  3CC7 I;  5FHP A;  2K3P A;  3GEU A;  1UI5 A;  2YX7 A;  2XAS A;  1IXC A;  3OS0 A;  4HX8 A;  4NN1 A;  4NB5 A;  5E79 C;  3UR3 C;  1EH8 A;  2QF7 A;  4MIM A;  3FXO A;  3GFJ A;  4JP0 A;  4IOC F;  1ETY A;  2D5V A;  2DPD A;  3ERM A;  3RYP A;  3LL7 A;  4XL9 A;  4F91 B;  1Z21 A;  3EGQ A;  3MAJ A;  1MNE A;  3K6G A;  4A3F J;  1O57 A;  1X4O A;  3RKY A;  3BPV A;  4RAG A;  5GTI C;  1J09 A;  1KQ9 A;  2CQQ A;  3J7A Y;  2XAQ A;  2ID6 A;  3N97 A;  1JKR C;  1UHM A;  3M1E A;  4XIC A;  4G7H F;  1MSF C;  3ZMZ A;  1P2F A;  4XOP A;  4W1U A;  1ZYR F;  3F8B A;  2NOJ B;  3HC7 A;  3DF8 A;  5F1R A;  2JSC A;  2Q2E B;  2KT0 A;  3CMM A;  2XF5 A;  1ZGW A;  4KT5 C;  3KCC A;  3OL3 A;  2XGE A;  3KZ9 A;  2A2F X;  3S1N J;  3CMA I;  2L0K A;  1RZ4 A;  1XB4 A;  4G12 A;  2E7X A;  3PNV A;  4RGX A;  3HPG A;  4BBS J;  3NS4 A;  2O0Y A;  4RB1 A;  2RRE A;  2VJJ A;  1JTY A;  5DCM B;  4DNC A;  5CXG A;  3OYI A;  2E35 A;  2E5Z A;  3R6S A;  1J7K A;  1BR2 A;  4BKX A;  4XRS A;  1HCR A;  5CVR A;  2DTZ A;  5GPC A;  1Z6T A;  2DA7 A;  3F3X A;  1JT6 A;  2RQP A;  4CA0 A;  4O5V A;  2R93 J;  3ON2 A;  1X2N A;  1O7L A;  2OJE D;  3A02 A;  1H8A C;  3REO A;  3F6V A;  2A6H F;  3QU6 A;  2REK A;  1ZRC A;  2CWE A;  3DP7 A;  3LSP A;  1SFX A;  2IPQ X;  1KQ8 A;  3VP5 A;  2WAQ N;  4XMY A;  4DYC A;  2XIG A;  3JRA A;  5HS7 A;  1FX7 A;  3SDG A;  1Y8Q B;  2EA4 A;  2EIJ H;  2GOX B;  4ICH A;  2CFX A;  3LFU A;  1R71 A;  1HKQ A;  3HXL A;  4ENM A;  2E34 A;  3CC4 I;  4GCV A;  3ZMU A;  1H9G A;  1JUS A;  1RI7 A;  2NOG A;  2QQB A;  3A0H C;  1XDU A;  2QSF X;  2KP6 A;  2WGB A;  1SD6 A;  4D1Q A;  3HOU J;  2ZY9 A;  3ECH A;  2DT5 A;  2X9D A;  3GUD A;  5IOY A;  4KIS A;  2VXZ A;  5FKL A;  2JUG A;  3K1M A;  3C18 A;  1EV7 A;  2K5C A;  3HRT A;  5ICG A;  3HSR A;  3BZK A;  4MLO A;  1NG7 A;  3K2A A;  5JHF A;  3VPR A;  2R5Z A;  2VT3 A;  1KU2 A;  3AKZ A;  4ZYA A;  2JPB A;  1R9T J;  4JX5 A;  4RM2 A;  3MNL A;  5HOD A;  5J47 A;  3EQL F;  2H94 A;  4YIF A;  3IKV A;  4W97 A;  3EUH C;  3BTC A;  5D4S A;  2FBI A;  1ZR4 A;  2BY2 A;  1ITY A;  2DI3 A;  3QYB A;  1T0F C;  4HX4 A;  3SZT A;  4RGU A;  2QQ8 A;  2PJR A;  1FOY A;  4PSX A;  4EM2 A;  3Q5F A;  1R1V A;  1R1U A;  3E5U A;  4G6Q A;  4DGW B;  1VQ6 I;  3HB9 A;  3WTS C;  3HOS A;  4HG2 A;  2GOM A;  2XVC A;  3A4C A;  2BE5 F;  1CF7 A;  2NVX J;  1UHS A;  2XKO A;  4HBL A;  3KFW X;  3VVZ A;  5L3G A;  4L0Z B;  4P5O A;  2VE8 A;  4R79 A;  4AC6 A;  3BC8 A;  4RLF A;  2MLK A;  4CCJ A;  4GO1 A;  2HGC A;  2RQQ A;  4AM3 A;  2I8D A;  4MXM A;  1V55 H;  3QAH A;  1KU7 A;  3BR2 A;  5D5V B;  2AQE A;  4F52 A;  1MBF A;  3TDZ C;  3OYA A;  3BG9 A;  1ZH5 A;  3BCG A;  3S14 J;  3PUB A;  2EA2 A;  2UUZ A;  2PQ8 A;  4EVI A;  3HRS A;  1YIO A;  5E1X A;  4EGY A;  1YLF A;  4X1E A;  4J19 A;  2LP0 A;  2XRL A;  3BRO A;  4DOZ A;  4ME9 A;  2E1M B;  2LK2 A;  4L5I A;  1QQI A;  2LKP A;  1XMK A;  3RQ4 A;  2BOL A;  5DTD A;  2FBK A;  3RI4 A;  4ZYH A;  2CUJ A;  5CVU A;  5F08 A;  1Q1H A;  3LA3 A;  1R5I D;  2CH0 A;  2HOS A;  1Z6R A;  2JTV A;  4PCQ A;  1U8R A;  2QSG X;  1Z9C A;  4BUP A;  1DP3 A;  1PJR A;  2QLZ A;  2MSY A;  2UXI A;  2EFQ A;  2FX0 A;  2OCC H;  3HGY A;  2GA2 A;  1V3F A;  4MTD A;  2UV1 A;  3LSH A;  2IP2 A;  1TBX A;  1IV6 A;  1T8I A;  2K9Q A;  1JGG A;  2FD5 A;  2ECB A;  1VND A;  1X2M A;  2KJC A;  2HKU A;  5D6F A;  3MVP A;  2D6Y A;  3S32 A;  3ABU A;  3H5R A;  2NP5 A;  2EH3 A;  3U1K A;  4ZDP A;  2Z99 A;  4E7K A;  5K58 A;  3RCO A;  1B8I B;  5LGN A;  1RRJ A;  2EK5 A;  5FD5 A;  4PJ0 C;  2OZU A;  1NTC A;  1U2W A;  5JVT A;  1K6Y A;  5D19 A;  5HLI A;  2M5W A;  3E3V A;  4LG0 A;  2E1M C;  4IJA A;  4C9Y A;  3BNI A;  2HYF A;  1TP4 A;  2FBQ A;  4PZJ A;  3OS1 A;  1T6S A;  2E2I J;  4MEX F;  4L62 A;  5GAE J;  4IQ4 A;  1TQP A;  1FBQ A;  2HTJ A;  1W7P A;  2RDP A;  5DM6 F;  2HQR A;  4XBF A;  1W1W E;  4HEA 2;  3QWL A;  5FLM J;  3K1N A;  2FMY A;  2OA4 A;  3ZGK A;  1BI0 A;  2HOE A;  1OJL A;  1JJ6 C;  5DUK A;  2K4J A;  1QZE A;  1R4M B;  2CUF A;  1HLV A;  2FBH A;  1GLN A;  3PQK A;  4U0V A;  5M5X J;  4A6E A;  4A3L J;  4A3J J;  2FNA A;  3LMM A;  4YEJ A;  3ZR8 X;  1W5S A;  2GXB A;  2X1C A;  3IWF A;  2DU9 A;  1JT0 A;  3CES A;  5CLS A;  2AHQ A;  2V79 A;  4Y15 A;  2JMW A;  5GAD J;  5HDN A;  2QBY B;  4B8X A;  4CCN A;  2V6C A;  5DEQ A;  4ZZD A;  4JBA A;  1S9H A;  4B48 A;  5FMP A;  1V5E A;  2JVG A;  1K78 A;  4CUG A;  3HUG A;  2DFI A;  3T8T A;  5EG0 A;  1XGS A;  1BM9 A;  1YRN A;  2YR2 A;  3ASO H;  4MFD A;  4AYB A;  3OIP A;  4YFK F;  1XSD A;  3PJR A;  1SD7 A;  2VE9 A;  4C3J J;  1HA8 A;  3NRG A;  2VKE A;  4KYW A;  2JA2 A;  3FK6 A;  3KEY A;  5KK1 A;  5BS6 A;  1MH3 A;  2EIK H;  2HNH A;  1J2X A;  1OCZ H;  2KRC A;  3GTK J;  5EYR A;  1ZAO A;  1N75 A;  4CYD A;  3BG6 A;  1TW3 A;  2CRG A;  2X51 A;  3H0G J;  2KLO A;  5FKK A;  4BHP A;  1UCR A;  3G6E I;  3ZN0 A;  2CV2 A;  4UUS A;  1D0Z A;  4UHT A;  2A05 A;  2EV6 A;  3QP5 A;  1PUF B;  3K4J A;  3O3K A;  4JK1 X;  2VB6 A;  3KYL A;  3GTM J;  2PX9 A;  3ABT A;  2IA0 A;  2QM3 A;  1J5Y A;  3Q0V A;  4M6X A;  3H5A A;  3DKX A;  3GZN B;  4DZJ A;  3HTS B;  3M4O J;  4U87 A;  1MKM A;  1U5T C;  4XLH A;  3OMY A;  1Q1V A;  3A0B C;  1ZG3 A;  3VSL A;  1JXS A;  4J00 A;  4M9X A;  3HHG A;  3B81 A;  4ZYD A;  3ZQL A;  3L1P A;  1LPQ A;  5FLV A;  4I0B A;  2NYX A;  1JKO C;  1ACI A;  4XN0 A;  2XF6 A;  1FYK A;  4GCT A;  4XK4 A;  2ICW G;  3ELK A;  1I3Q J;  4F92 B;  4NC6 A;  5HLT A;  1P92 A;  5KAF C;  2KRH A;  3ABM H;  2CW7 A;  3I4P A;  2ZSI B;  4L9N A;  2L7K A;  4QTR A;  3BJA A;  4HDV A;  2VQL A;  3E6D A;  2QGU A;  2Q1Z B;  1LKX A;  6PAX A;  3AAF A;  3CF5 F;  3BCB A;  4PJL A;  2IA1 A;  3JSO A;  1DGR M;  1OCC H;  4FT8 A;  2M4G A;  1X58 A;  2JJ7 A;  2DFH A;  1ZRF A;  3OYK A;  1OQY A;  5DCF A;  5D5W B;  3VOE A;  2EIN H;  4UV9 A;  2LRE A;  1Y6I A;  1NHA A;  4PJM A;  2DFF A;  3F21 A;  2EFO A;  3PIO F;  3DCF A;  1MJA A;  3VWB A;  2ZFU A;  3K0L A;  3AG1 H;  5E3M A;  1AKH B;  2QIB A;  4BJ6 C;  1O3R A;  2YX4 A;  2P6T A;  1SMY F;  2DW4 A;  3IAM 2;  3CLO A;  1ZLJ A;  3VYU B;  3RPU A;  3J7Z I;  1O4X A;  2N8G A;  2JZY A;  3VSK A;  1HXD A;  3BR6 A;  4CH7 A;  3L2W A;  2FA5 A;  4P9U A;  4KIT B;  2R7W A;  1EH6 A;  3OSF A;  1I1G A;  2V9K A;  1YS7 A;  2X4H A;  1K6O A;  2D45 A;  1NG6 A;  3P9I A;  5IOZ A;  4UNO A;  2V9P A;  5HDG A;  3IH2 A;  2R7R A;  1Z67 A;  1YO5 C;  4XQF A;  5C4J J;  2L9S A;  4PSW A;  2HYT A;  3A2K A;  3JSJ A;  5KHD A;  2CGP A;  1F1Z A;  2XAJ A;  1WJC A;  4HZF A;  4BGD A;  5ILV A;  4JYK A;  1XD7 A;  3FMR A;  1T39 A;  1SVM A;  4A3C J;  1YOV B;  3PQJ A;  3RKW A;  3DPL C;  3ZXS A;  3AFH A;  4BE1 A;  4Y17 A;  2ECC A;  4A3B J;  1BOB A; 
#chains in the Genus database with same CATH homology
 1ZKG A;  3G7R A;  3OIO A;  5EGO B;  4NEL A;  1RES A;  1WI3 A;  1G2H A;  2JK3 A;  5EDN A;  1ORK A;  3ZOB A;  2JA6 J;  1K61 A;  2NX4 A;  4IHV A;  4S0H B;  1E3O C;  5C44 J;  2QOP A;  2VUM J;  3GTQ J;  4EEF G;  4DYQ A;  5JLW A;  4KWA A;  2GEN A;  2R5Y B;  1RKW A;  4A3M J;  1CQT A;  5BNG A;  2NVT J;  4IHW A;  4AYB N;  3DPJ A;  1WGX A;  3FKI J;  1YRN B;  1IG7 A;  5IP9 J;  3ZQI A;  2MGQ A;  3BTJ A;  2DMU A;  1K83 J;  4JX4 A;  2NVQ J;  1Z0X A;  2XPU A;  1JUM A;  2YU9 J;  2LKX A;  1DU0 A;  3DEW A;  3AQS A;  3VW2 A;  3P9T A;  2CQX A;  1OCP A;  4DZP A;  3KNW A;  2DJN A;  2JA8 J;  2K9S A;  4AC0 A;  3OOU A;  2ME0 A;  3BT9 A;  4IHY A;  2L9R A;  2JN6 A;  2CU7 A;  4M3B A;  4AUX A;  2LY9 A;  1ZR2 A;  2G7G A;  3HTJ A;  1BW6 A;  3NXC A;  1JKQ C;  5FHP A;  4UUS B;  2E1O A;  3GEU A;  2P81 A;  2WV1 A;  1UI5 A;  3S1Q J;  5M5Y J;  1B72 B;  5IYD J;  4DYR A;  1HOM A;  4NN1 A;  4GCL A;  3BR1 A;  3VUQ A;  4A3G J;  2LD5 A;  3BG5 A;  5C4X J;  3E7Q A;  4M3G A;  4LOC A;  1OCT C;  2QF7 A;  4MIM A;  5F1J A;  4JP0 A;  2R0Q C;  2E2H J;  1ETY A;  1TWF J;  3CMY A;  2D5V A;  3S2D J;  3S1R J;  3K7A J;  1RR7 A;  3EGQ A;  4A69 C;  4A3F J;  3QKX A;  3C07 A;  1ETV A;  2COB A;  3SFI A;  2CQQ A;  5FKO A;  5IP7 J;  2ID6 A;  1ENH A;  4NDL A;  1JKR C;  2IAI A;  2TRT A;  2QKO A;  4XRS G;  4RBO A;  4XIC A;  1MSF C;  4IHX A;  3COL A;  5EF6 A;  3F0C A;  2DMQ A;  2HXO A;  2DMP A;  3O8H A;  3HKZ N;  1TWG J;  1T33 A;  2MG4 A;  1Y1V J;  3KKD A;  4W1U A;  2H8R A;  2X6O A;  4AF5 A;  3LSG A;  3JRG A;  3G1O A;  2KT0 A;  1FIP A;  1ZGW A;  2EBI A;  3ZQC A;  4X6A J;  4FE4 A;  1SGM A;  2XGE A;  3KZ9 A;  3HM5 A;  2MW8 A;  5C3E J;  3S1N J;  3NAU A;  1JTX A;  2NVY J;  2Q24 A;  2L0K A;  4MFE A;  2QTQ A;  3LSJ A;  3VVY A;  4G12 A;  2XGD A;  4BBS J;  3FIS A;  3WHC A;  4XRM A;  4JKZ A;  2OPT A;  5IYC J;  5K7H A;  1JTY A;  3RD3 A;  4V2G A;  5CXG A;  1MBE A;  4M3F A;  1U8B A;  3QBM A;  2YVH A;  3G1M A;  4BBR J;  4BKX A;  4XRS A;  1HCR A;  3BR5 A;  5IYB J;  1ZK8 A;  3M3Y J;  4L5E A;  4DW6 A;  2DTZ A;  4C3H J;  5GPC A;  2H1K A;  3CWR A;  2DA7 A;  2LR8 A;  2GUH A;  1JT6 A;  1AHD P;  2R93 J;  1WCM J;  3ON2 A;  1X2N A;  4RDU A;  3LNQ A;  3V6G A;  1U78 A;  1ETQ A;  3A02 A;  1H8A C;  5E3O A;  2UXU A;  2M9H A;  3HTI A;  2GM4 A;  2REK A;  3LSP A;  5EFY A;  1IRZ A;  4A93 J;  1VFC A;  3T6N A;  4A3I J;  3VP5 A;  2WAQ N;  4DYC A;  3BRU A;  2NS8 A;  3JRA A;  2EZI A;  1BA5 A;  1AU7 A;  5F0C A;  1GT0 C;  4D7M A;  3SDG A;  4ICH A;  3JRI A;  3S15 J;  3BHQ A;  2ZCX A;  5K58 A;  2K9N A;  3ANP A;  5F27 A;  1APL C;  1FJL A;  4MK6 A;  5DS9 A;  1JUS A;  2NOG A;  3G1L A;  2ZOY A;  5F04 A;  2M0C A;  2GBY A;  1F36 A;  3I4M J;  2WGB A;  1MH4 A;  3ZQF A;  3HOU J;  2YVE A;  1SAN A;  2TCT A;  2X9D A;  4UUT A;  5IOY A;  1Y1W J;  2PZ9 A;  2EZH A;  2ZB9 A;  3RZO J;  5FKL A;  2HDD A;  3O60 A;  1GVD A;  4CYC A;  3VW0 A;  2DA4 A;  4MLO A;  3K2A A;  4M3E A;  3VPR A;  2XSD C;  2R5Z A;  3EUP A;  3HTA A;  1R9T J;  3A03 A;  1JUP A;  4JX5 A;  2K40 A;  5HOD A;  3S16 J;  3MNL A;  2ZCN A;  4FE7 A;  4B3A A;  4W97 A;  3JRF A;  1P7J A;  3HOX J;  3BTC A;  1ZR4 A;  1PUF A;  3AQT A;  3LSR A;  3PO2 J;  1NK3 P;  1ITY A;  1IUF A;  3HOV J;  1QVT A;  5HBU A;  1GUU A;  2F07 A;  1WH7 A;  2Y0S N;  3LOC A;  3S17 J;  3VOK A;  4ACI A;  3HB9 A;  3LWJ A;  1U9O A;  3RZD J;  4GFB A;  4CYC B;  1IDZ A;  2EQR A;  2NVX J;  4BXX J;  1UHS A;  9ANT A;  2EZL A;  2G0E A;  2RAS A;  3S5R A;  3Q0W A;  3VVZ A;  1HDP A;  2R5Z B;  1TWH J;  1A6I A;  4HNV A;  2G3B A;  5HAW A;  4AC6 A;  3HOW J;  3HTH A;  3E7L A;  3A01 A;  3BQY A;  2WUI A;  3GTP J;  3S1M J;  4MXM A;  3CDL A;  3BR2 A;  1MBF A;  1TWA J;  3BG9 A;  3BCG A;  5K7F A;  3KKC A;  2ZCM A;  2RAE A;  3S14 J;  2HI3 A;  1TC3 C;  2IEK A;  1POG A;  5FKM A;  5E3N A;  1QPI A;  2GLO A;  1W0T A;  2NP3 A;  2HYJ A;  4X1E A;  1BL0 A;  3NPI A;  4J19 A;  2LP0 A;  2Y30 A;  1F43 A;  2XRL A;  4ME9 A;  2DMN A;  4CGR A;  3IH3 A;  3UKG A;  3A01 B;  2LK2 A;  2XGC A;  2WB1 N;  3QQA A;  4FIS A;  5DTD A;  2I10 A;  3Q0U A;  5F08 A;  3JR9 A;  1B8I A;  5J1Y A;  2HOS A;  3NNR A;  1GV5 A;  2M8G X;  2PBX A;  4YZE A;  4BY7 J;  1BW5 A;  5M3M J;  1IGN A;  5CXI A;  2MSY A;  2UXI A;  2JA5 J;  2CJJ A;  4JL3 A;  1XC5 A;  2FX0 A;  3HGY A;  5HSZ A;  1RET A;  5GP9 A;  4B4C A;  3TW6 A;  2W48 A;  1IV6 A;  1JGG A;  2K9Q A;  2FD5 A;  2ECB A;  4B1R A;  1VND A;  1X2M A;  2HKU A;  3Q3S A;  5FJ8 J;  3MVP A;  1W0U A;  2D6Y A;  2L7M P;  2RHA A;  3LHQ A;  2DA2 A;  2G7L A;  2EH3 A;  2NP5 A;  3RQI A;  1D5Y A;  2O9L A;  1B8I B;  3GTL J;  2G7S A;  5DAJ A;  1LE8 A;  1ZTR A;  4A3E J;  2L7Z A;  3BG3 A;  3GTJ J;  1NTC A;  5J1U A;  3BJB A;  4M6V A;  2R7Z J;  5D19 A;  3V78 A;  1A5J A;  3BNI A;  4GCK A;  2FBQ A;  2QWT A;  1LFB A;  2DA3 A;  4L62 A;  2E2I J;  2Y2Z A;  3NAR A;  2UXO A;  2UXP A;  3WHB A;  5EZH A;  3RKQ A;  1RKT A;  2QCO A;  2YS9 A;  4BY1 J;  2IU5 A;  1QVU A;  4MO7 A;  5FLM J;  2Y9Z A;  1OJL A;  1JJ6 C;  2E19 A;  2HOA A;  1MNM C;  1DU6 A;  5H9T A;  1HDD C;  5AQC A;  2CUF A;  1BJZ A;  1Z77 A;  2LLK A;  3TP3 A;  2DG7 A;  1HLV A;  2CUE A;  1I6H J;  5M5X J;  2DN0 A;  3JRD A;  1MBJ A;  4A3L J;  3LJL A;  5FGL A;  4A3D J;  4A3J J;  4M3D A;  4UDS A;  3JRB A;  2PMZ N;  5K7Z A;  1ETW A;  1TWC J;  2XPW A;  2OI8 A;  5D18 A;  1JT0 A;  2LTP A;  1P7I A;  2AHQ A;  2Y9Y A;  3CJD A;  2JMW A;  4GFK A;  2HQ5 A;  2XDN A;  2DMT A;  5GPA A;  3F1B A;  5C4Y A;  1RPW A;  5FMP A;  2LFB A;  3ZQG A;  3MKL A;  4C2M J;  4I6Z A;  5EG0 A;  2UXH A;  1YRN A;  2HXI A;  4MFD A;  2KDZ A;  2YUS A;  4C3J J;  3GTG J;  3NRG A;  1XS9 A;  2VKE A;  3JRE A;  4FTH A;  3VIB A;  3FK6 A;  1T56 A;  2HOT A;  2E2J J;  1U9N A;  1IDY A;  1MBH A;  1MH3 A;  3JRH A;  3GTO J;  2O7T A;  1H89 C;  3GTK J;  5EYR A;  2M2E A;  3O8G A;  1ETX A;  3BR3 A;  3I4N J;  2OER A;  2CRG A;  4PXI A;  3H0G J;  5FKK A;  3D1N I;  2XB0 X;  5M3F J;  2EZK A;  1VI0 A;  5EG0 B;  4UUS A;  3GZI A;  3BTL A;  1WH5 A;  5J1R A;  1FTT A;  2VKV A;  2VI6 A;  5EEA A;  1B72 A;  1PUF B;  3VW1 A;  2FJ1 A;  4V2F A;  3HOZ J;  2Y31 A;  5FKN A;  1GDT A;  3GTM J;  2ZOZ A;  3QPS A;  1NK2 P;  2DA6 A;  2V57 A;  3Q0V A;  5CW8 A;  2NS7 A;  2FQ4 A;  4DZJ A;  1HF0 A;  3M4O J;  3RH2 A;  2O8K A;  3OSG A;  1H88 C;  1Q1V A;  3IH4 A;  1JJ8 C;  2DG8 A;  3CCY A;  3B81 A;  3MN2 A;  3ZQL A;  3ANG A;  3L1P A;  3ON4 A;  3TP0 A;  5JLX A;  2O7O A;  3BTI A;  5FLV A;  3ZQH A;  3HOY J;  1JKO C;  1LFU P;  2DA5 A;  4D5C A;  4GCT A;  4XK4 A;  1UMQ A;  1I3Q J;  3TW7 A;  3CRJ A;  3HBL A;  4QSH A;  4FCY A;  1EF4 A;  3BQZ A;  5F0H A;  3HDD A;  5IP6 A;  1IC8 A;  4QTR A;  3G56 A;  1XG1 A;  3QPL A;  3IUV A;  3CQZ J;  1MBG A;  1MSE C;  2OF7 A;  4D5F A;  1AKH A;  1X58 A;  2JJ7 A;  3PM1 A;  3B6A A;  3HIM A;  2ME6 A;  2AO9 A;  5E3L A;  3GBG A;  2L7F P;  1FEX A;  3SJM A;  3BR0 A;  4ABZ A;  3W6V A;  4Y52 J;  1WPK A;  5D1R A;  1I50 J;  3VOX A;  2VPR A;  2LVS A;  3PPB A;  4I76 A;  3HEF A;  3VVX A;  1FTZ A;  3DCF A;  1MBK A;  5E3M A;  3PAS A;  1AKH B;  1QRY A;  2QIB A;  2GFN A;  5IPA A;  3H3V K;  4D7N A;  5F0F A;  3FRQ A;  4GFL A;  2ID3 A;  1O4X A;  2N8G A;  4HKU A;  3C2B A;  3BR6 A;  1ETK A;  1LE8 B;  2JA7 J;  1ETO A;  3S2H J;  1VF9 A;  3FK7 A;  3PO3 J;  3OSF A;  2IBD A;  1GV2 A;  2ELK A;  5IOZ A;  5M5W J;  2XPV A;  1UI6 A;  5EGO A;  3NI7 A;  2B63 J;  4JNN A;  3B6C A;  3HGG A;  2X48 A;  3IH2 A;  3JRC A;  4QIW N;  4JX6 A;  3TED A;  3HE0 A;  1IJW C;  1ZQ3 P;  5J3L A;  2W53 A;  5C4J J;  1S7E A;  1FIA A;  2HYT A;  2M34 A;  3JSJ A;  1JKP C;  1UG2 A;  4JYK A;  2XB5 A;  2JWT A;  4Y7N J;  2DA1 A;  4C3I J;  2R5Y A;  4XID A;  3IV5 A;  2R92 J;  4A3C J;  1OFC X;  4IEJ A;  3FIW A;  5EZG A;  1SFO J;  2ECC A;  4A3B J;  4A3K J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...