1ZKGA

Crystal structure of transcriptional regulator, tetr family (tm1030) from thermotoga maritima at 2.30 a resolution
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
200
structure length
200
Chain Sequence
VLSKRDAILKAAVEVFGKKGYDRATTDEIAEKAGVAKGLIFHYFKNKEELYYQAYMSVTEKLQKEFENFLMKNRNRDIFDFMERWIEKKLEYSASHPEEADFLITLVSVDEGLRKRILLDLEKSQRVFFDFVREKLKDLDLAEDVTEEIALKFLMWFFSGFEEVYLRTYQGKPELLKRDMNTLVEEVKVMLRILKKGMTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of TM1030 from Thermotoga maritima at 2.3 A resolution reveals molecular details of its transcription repressor function.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transcription regulator
molecule keywords transcriptional regulator, TetR family
total genus 69
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1zkgA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 1zkgA02
4D7NA 3JRHA 1A6IA 2XGEA 3FK7A 4G12A 2CJJA 2EZLA 3O60A 1TWGJ 1H8AC 5J1YA 2AHQA 1U9NA 2VKVA 2I10A 4BXXJ 3VUQA 2RAEA 1EF4A 2N8GA 3TEDA 4UDSA 1DU6A 5FKMA 1JUSA 3BTCA 2W48A 1JTXA 3BR5A 5FGLA 4DYQA 3CWRA 2OPTA 4W97A 3CJDA 2R0QC 3RH2A 3SFIA 2PBXA 5D19A 5J3LA 2XSDC 3HE0A 2XB0X 3JRFA 5C4JJ 3S15J 3QKXA 1ZKGA 2OF7A 1JUMA 2R92J 2HQ5A 4X1EA 5HODA 2HOSA 1QPIA 2E19A 2DA6A 4RBOA 1P7JA 1MH4A 5FKLA 1YRNB 4FISA 3JRDA 3JREA 4FTHA 4ACIA 2GFNA 2JK3A 4GFBA 5M5XJ 1VF9A 3DCFA 3D1NI 2UXIA 3QQAA 2DA4A 5EFYA 1Z77A 3S1RJ 2LLKA 3HTAA 2NVXJ 4IHWA 4PXIA 1JKOC 2IAIA 4AUXA 2R93J 2HOTA 4JX6A 4BY7J 1ZQ3P 3HIMA 5IYBJ 4D7MA 4C3HJ 2TRTA 3GTLJ 3GTQJ 1I3QJ 2JA7J 1RKTA 2JA8J 2QOPA 2YUSA 3HKZN 2KDZA 2LD5A 3HDDA 4XRMA 1TWAJ 1JJ8C 1QVTA 1O4XA 3BR6A 2XDNA 2IEKA 4IHXA 3JRGA 3IV5A 3HOUJ 5C3EJ 3S1MJ 2G3BA 5E3MA 4A3BJ 4V2FA 2PZ9A 1XG1A 2NP3A 3MN2A 4JKZA 4MO7A 2HOAA 2LK2A 2WGBA 2ZOYA 4HKUA 1B8IA 3C2BA 4M6VA 2DN0A 2HXOA 4I76A 1IGNA 5K7ZA 3GTMJ 1G2HA 2W53A 3GZIA 4MIMA 4JYKA 5K7FA 3JSJA 5H9TA 4Y52J 1HDDC 3BR1A 1H89C 4BY1J 1SANA 2MG4A 2XPUA 1VFCA 1AKHA 4KWAA 3BTIA 3HTHA 2JJ7A 4IEJA 2LKXA 4C2MJ 3S2HJ 1MH3A 5FKOA 1MBHA 2EZHA 4QTRA 2ZB9A 3IUVA 1Y1WJ 2GM4A 3M4OJ 4MFDA 3HGYA 4UUSB 1RKWA 3BCGA 3VW2A 3F0CA 3FIWA 2ZCXA 3IH3A 5CXIA 3L1PA 3G7RA 1ETQA 1HF0A 1MBGA 1P7IA 5DS9A 1WH7A 5FJ8J 1FTZA 3RD3A 3TP3A 4MXMA 1JKQC 5EZGA 5IP9J 1K83J 1UG2A 3AQTA 4HNVA 1ETXA 3GEUA 2MGQA 4JNNA 3LHQA 5HSZA 5F08A 1IJWC 2E2JJ 3GTGJ 1B8IB 2VPRA 3BJBA 1BA5A 4A3LJ 2ID6A 5K58A 2M8GX 5J1RA 3IH2A 3AQSA 2X6OA 2Y2ZA 4UUTA 1JT0A 1XC5A 1GV2A 4GFLA 4C3IJ 3ON4A 3V78A 5GPAA 2NVYJ 1T33A 2QWTA 3HTJA 1WPKA 3GTJJ 5F0FA 2FBQA 5IOZA 2Y31A 3OSGA 2FQ4A 1ETOA 2D6YA 4L62A 2DG7A 3TW7A 2DA3A 1PUFB 4W1UA 4ME9A 4V2GA 2R5YB 2MSYA 4XK4A 3B6AA 4A3JJ 2X48A 3H3VK 5EF6A 3BHQA 2WV1A 1E3OC 3MNLA 4L5EA 2ME0A 3LOCA 5IPAA 2LVSA 1IDYA 2IBDA 1GUUA 2R7ZJ 3K7AJ 1U78A 3CRJA 3KKDA 3S1QJ 4A69C 2LY9A 3CQZJ 2XPVA 1UHSA 2K40A 5F0CA 3JRCA 4NN1A 1OCPA 2UXPA 5EG0B 2JN6A 1MSFC 2IU5A 2HYTA 4NELA 2NS8A 3F1BA 5M3MJ 4CYCA 3S1NJ 5HAWA 3HM5A 1W0TA 1R9TJ 3VVZA 2EZKA 4A3FJ 5C4YA 1NK2P 3LSJA 2OERA 3EGQA 1JT6A 1IRZA 5DTDA 3HOXJ 2L0KA 3BRUA 1T56A 3ANPA 4BKXA 2QTQA 1ORKA 4D5CA 1JTYA 2L7MP 3GTKJ 3KZ9A 2E2IJ 2GUHA 4AF5A 1F43A 1AKHB 1FTTA 2DMQA 1U9OA 3ZQGA 3BNIA 5K7HA 3VVYA 3O8GA 2GENA 3NARA 4MFEA 5EDNA 4GFKA 2JWTA 3HBLA 3DPJA 3QPSA 1S7EA 5IOYA 1HOMA 2WAQN 2DA1A 5IP7J 2R5ZA 4X6AJ 4BBRJ 3HB9A 2F07A 3S17J 3VIBA 4JX4A 2EBIA 1RETA 1XS9A 1VI0A 5C44J 4B3AA 5M5WJ 3A02A 4A93J 3OOUA 5CW8A 2HDDA 1MBKA 1UI6A 1OJLA 3Q0UA 4DZJA 4EEFG 2FJ1A 2EH3A 4I6ZA 1LE8A 4S0HB 3BG5A 1MBFA 1UMQA 4M3BA 5J1UA 4DYRA 4XRSA 2Y9YA 3C07A 1WH5A 2M2EA 1X2MA 4ICHA 5EYRA 2ME6A 5D18A 1I6HJ 3HGGA 4A3MJ 3Q3SA 3VPRA 1IC8A 3JRAA 4DW6A 3CCYA 3Q0VA 1LFUP 4A3CJ 5M3FJ 3G1OA 2TCTA 2HYJA 3NXCA 2JA6J 2FX0A 4A3EJ 1CQTA 1DU0A 1QVUA 3A01A 1GDTA 2NP5A 1TWCJ 2XPWA 1HLVA 1X58A 3GTOJ 3BTJA 1PUFA 3B6CA 3P9TA 4YZEA 2HI3A 3M3YJ 3BTLA 2NS7A 2NOGA 3CMYA 3HOZJ 3SJMA 2WB1N 4GCLA 2MW8A 4AC0A 1FIPA 2HKUA 4BBSJ 3IH4A 3EUPA 4FE4A 4C3JJ 3BQZA 3ON2A 2QCOA 2XB5A 3KKCA 9ANTA 2CU7A 1TC3C 3T6NA 3DEWA 1H88C 3B81A 1NTCA 3ZQFA 3UKGA 3ZQLA 2QIBA 1RESA 5E3NA 5F04A 1JJ6C 2Q24A 4AYBN 5GP9A 4MK6A 3E7LA 3NPIA 4B4CA 2COBA 3LSRA 5F1JA 2LR8A 4JX5A 2CQQA 3OSFA 3NRGA 2K9NA 2K9SA 1RPWA 2G7GA 3S2DJ 4RDUA 3VW1A 2Y0SN 1LE8B 2ZCNA 2DMNA 1FJLA 4MLOA 5D1RA 4GCTA 2YS9A 2X9DA 2YVHA 1WCMJ 5EGOA 1SFOJ 5CXGA 3LNQA 3ZQHA 3ANGA 4QIWN 2G0EA 1BW6A 4GCKA 3A01B 1Y1VJ 4A3KJ 1D5YA 5FHPA 2RHAA 1U8BA 2E2HJ 3K2AA 2DA5A 1ETWA 3ZQIA 1POGA 1GV5A 1ZR4A 3S14J 3VVXA 1MBEA 4XIDA 4A3IJ 2B63J 3G1LA 1ETYA 2R5YA 1MBJA 2LFBA 4ABZA 3HOYJ 3RZDJ 1YRNA 2VI6A 2ZCMA 4A3GJ 4CGRA 4JL3A 5EEAA 2L9RA 1GT0C 2CQXA 1ZR2A 4A3DJ 5GPCA 3Q0WA 2OI8A 1F36A 3S16J 4XRSG 2L7ZA 5IYCJ 2DA2A 3NI7A 2YU9J 5C4XJ 3JRIA 2WUIA 1X2NA 4B1RA 2QKOA 1ENHA 2O9LA 2CUFA 3HEFA 1IDZA 4LOCA 5EZHA 2QF7A 4IHYA 2UXHA 4IHVA 2M9HA 3S5RA 3BG3A 4UUSA 1JKRC 1TWHJ 1VNDA 1JGGA 2NVQJ 2Y9ZA 1MSEC 3ZQCA 1HDPA 2DMTA 1SGMA 3NNRA 3CDLA 3JRBA 4J19A 3JR9A 5IYDJ 3E7QA 2XGDA 3FKIJ 4DYCA 3LJLA 2O7OA 2ID3A 2CRGA 3BT9A 1ETVA 3RKQA 1OCTC 3V6GA 5FLVA 3HOWJ 4AC6A 1TWFJ 3LSGA 5AQCA 2FD5A 5EGOB 3PO3J 3PASA 1QRYA 2HXIA 2L7FP 5JLWA 3I4MJ 4D5FA 2M34A 2O8KA 3ZOBA 1WGXA 3I4NJ 2DA7A 3VOXA 2G7SA 1BW5A 2UXUA 2UXOA 1OFCX 3FK6A 2JMWA 2PMZN 5HBUA 4FCYA 2LTPA 1B72A 1JKPC 3NAUA 3W6VA 3HOVJ 3WHCA 2V57A 2H1KA 3FISA 5E3LA 3OIOA 2D5VA 3BR0A 3GBGA 4M3EA 5BNGA 2XRLA 1FIAA 1UI5A 1FEXA 3SDGA 2E1OA 2YVEA 4XICA 2R5ZB 1IV6A 3VW0A 2ELKA 2EZIA 2REKA 3G1MA 1JUPA 2NX4A 3LSPA 2H8RA 5F27A 5IP6A 2G7LA 2Y30A 3BG9A 1Q1VA 2KT0A 5M5YJ 1GVDA 1ZK8A 2ECCA 1BL0A 4DZPA 1W0UA 4QSHA 4M3DA 2DG8A 5FMPA 1ETKA 5DAJA 2DMPA 2GLOA 2JA5J 5EG0A 4FE7A 3VP5A 1A5JA 3BR2A 2O7TA 2ZOZA 4CYCB 2M0CA 5F0HA 3COLA 3MVPA 2DTZA 1ITYA 1ZTRA 1AHDP 1IUFA 1K61A 1LFBA 2RASA 4Y7NJ 2P81A 1ZGWA 1AU7A 1I50J 2DMUA 2AO9A 1B72B 3O8HA 2GBYA 4M3FA 5FLMJ 1IG7A 2VUMJ 3VOKA 2ECBA 4JP0A 2NVTJ 3GTPJ 1Z0XA 1APLC 2DJNA 3RQIA 3MKLA 3PPBA 3H0GJ 2EQRA 3PO2J 3RZOJ 2XGCA 3KNWA 3FRQA 3TW6A 2VKEA 3A03A 5FKNA 3WHBA 1NK3P 2CUEA 3BR3A 3BQYA 3QPLA 5JLXA 3TP0A 3G56A 1BJZA 2K9QA 3QBMA 1RR7A 4M3GA 4NDLA 2LP0A 5FKKA 5E3OA 1HCRA 3HTIA 3LWJA 1MNMC 3PM1A 1WI3A
chains in the Genus database with same CATH superfamily
1A36A 1T38A 1H8AC 1QU3A 5CQEA 1FP1D 2VQGA 4XLAA 1U5TC 2K27A 1EF4A 2N8GA 3DP7A 1I3AA 2V7FA 2M30A 4UDSA 4UNOA 1DU6A 1W5TA 2DDBA 2KRCA 2W48A 5ED4A 1I6XA 1BOBA 4W97A 3QU6A 2VXDA 4G6QA 1V5EA 4HX8A 1HKSA 5LGUA 4YIRX 2XSDC 3K70C 1G3SA 2AXTC 4RAFA 5D19A 2WA0A 3CJNA 1CGPA 3ASNH 3DEUA 2DFEA 4M71A 3QKXA 4MEYF 1ZLKA 1D0ZA 3CDIA 2ZCWA 2IPQX 3CCUI 2HQ5A 4X1EA 1DGRM 4DIQA 1QPIA 2IS1A 1AOYA 4CH7A 5IT9K 4RBOA 4GDFA 4PFPA 2FOKA 3JREA 1K78A 2GFNA 3HPGA 2VT2A 4XQFA 4XOTA 2DA4A 4P55A 5EFYA 4BS9A 4IQJA 2IJLA 3HUGA 3WTUC 1LVAA 3A0HC 2OUMA 2HOTA 3PSIA 3H9GA 3ZCOA 2PMUA 2VJIA 4BY7J 1ZQ3P 4DVYP 1SFEA 4A2UA 4RMNA 5D6FA 1I3QJ 2WC2A 1U2WA 3TBIA 4OU0A 4LB6B 2KDZA 4MQ9F 5ILUA 5DV5A 3OY9A 3BC8A 4KN4X 4NQWB 4II2A 3HTSB 3HXLA 3WODF 3ZMDA 2XDNA 2IEKA 3JRGA 2UUZA 3HOUJ 5C3EJ 4ENNA 3S1MJ 4XNFA 3SZGA 2EA2A 2QSFX 4PJMA 3ROUA 4ENMA 3OIQA 2NNNA 3ZN1A 4HKUA 1KU3A 5IT3A 4M6VA 5L3BA 2DN0A 4RB2C 2XAJA 4MEXF 3GTMJ 4BQOA 2W53A 1W7PD 4PJLA 4A0ZA 4WXDA 2IGKA 2M5WA 1VFCA 4HF0A 4MQVA 1O7FA 3HTHA 2LKXA 4AD9A 4YEJA 1WI9A 3DFGA 2E7XA 1BC7C 1OCRH 3D5RC 1ONVA 4KIBA 4QTRA 3BZCA 2WB1A 2PX9A 4Y3OA 3HGYA 4N4OB 4UUSB 1VQ6I 3VW2A 3F0CA 1G3YA 4O5VA 2ZO4A 3QPHA 2BOLA 4AU7A 3IH3A 5D5WB 3V7SA 2E71A 2W7NA 4OMZA 4I0BA 4A0XA 1OISA 1KONA 4UHTA 3KETA 2GOXB 1FTZA 3OYCA 2JA2A 3RD3A 3TP3A 3I53A 2DU9A 2ZSIB 1K83J 4RAGA 1HXDA 4HNVA 4JNNA 5HS7A 3LHQA 2IA0A 2NRAC 1IJWC 2FNAA 3DQVC 2CQKA 1IF1A 3WTWC 2PLYA 4ITVA 1WWXA 4N4NB 5K58A 2M8GX 2P5KA 2V9VA 4UV8A 3IH2A 3AQSA 1BI3A 1JT0A 1XTAA 2K5CA 4GFLA 4DGWB 1SVMA 4G6DA 1Z21A 1ZN2A 2Q8KA 3IRRA 1O57A 3LFKA 4HAMA 1T33A 2CQ7A 1J0RA 2ICWG 5GPAA 5IOZA 4RGUA 1OCCH 1ETOA 1B4AA 5TISC 2TDXA 4ME9A 2JUCA 5EEHA 2FSWA 4A3JJ 2X48A 3X2QH 2JRMA 1Z3YA 1IXRC 3L2UA 2KLOA 2QVOA 4IX7A 1UB9A 3MNLA 4NNJA 1N78A 1IDYA 3CRJA 1TT5B 3K7AJ 2CSOA 2H94A 5CYVA 2HKOA 3HRMA 2OTLI 2J5PA 3GZ6A 3CQZJ 3H5RA 1LQ1A 2X1EA 2CH0A 2O03A 4EGZA 1HC8A 2UXPA 4GGGA 5EG0B 3N97A 4NELA 1LDDA 4HW0A 2NS8A 3KE2A 4KFCA 3MCZA 3F1BA 1RZ4A 1QPMA 5HAWA 4NC8A 4QPQA 3K4JA 2EZKA 1QNTA 5CQGA 5C4YA 2OZUA 4D0PA 5GTHC 3ECHA 3KZYA 1D0XA 1JT6A 1DP3A 1KQ0A 4Y15A 5DTDA 2F5EA 4BKXA 3FHNA 3VDXA 2L7MP 1PUEE 5HLHA 1OLTA 3ZPLA 3QOPA 1U9OA 2P4WA 2IXSA 2K4BA 3IRQA 3VOEA 3VVYA 2W00A 1KGSA 2QKLB 3PNYA 2EA4A 3EUHC 3NARA 4GFKA 4MNUA 1R49A 1E0EA 3HBLA 5F6FA 3QPSA 3TDZC 2DA1A 2FRHA 2LY1A 5IP7J 2CGPA 3W2AA 2QSGX 1K78B 2F07A 4EMSA 1R1VA 1RETA 5ICCA 2MA3A 3VTIA 4UB8C 4B3AA 5M5WJ 3OYLA 2EFWA 4EEFG 4IRHA 4DZJA 3GX4X 3D5SC 4I6ZA 1LE8A 3J80K 1OCOH 2D1VA 1YQAA 1N77A 3BG5A 4M3BA 1WFXA 5LD2C 4G7OF 5J1UA 6PAXA 2DFHA 4XRSA 2PG4A 2Y9YA 1DPUA 2BHYA 3D5LA 2IRFG 1A35A 3Q3SA 3VPRA 2I8DA 1IC8A 5GAGJ 5CVUA 5BPDA 3Q0VA 1LFUP 4ZH4F 5M3FJ 3G1OA 2G7UA 5FGMA 2F5DA 4EJUA 1WJ5A 3KEYA 3O6BB 4HA8A 3GFLA 4BHBA 2F5VA 4N9HA 3OL3A 5B1AH 4BHPA 1QVUA 1REPC 4RAZA 4A6DA 4YFNF 3BTJA 2LBFA 1BR1A 3M3YJ 2NS7A 1ZARA 2NOGA 3HOZJ 3SJMA 2WB1N 3BWGA 1YITI 4ANJA 2DOEA 2ZBKA 4UXNA 5LRRA 2VJJA 1HW1A 1YJNI 3HTUA 2CU7A 3RDIA 3GMEA 3DEWA 1NTCA 2XAFA 3OS0A 3CCVI 4CGZA 1WSUA 2HYFA 3LAPA 2QIBA 4ZYEA 5F04A 4XSZF 1YIOA 4XKBA 3NPIA 4FX0A 2OC6A 1JGSA 1VQ5I 5KVRA 1Z67A 4JX5A 4JQFA 2HPMA 2JVGA 3KP5A 3KYLA 2MC4A 4PZJA 2ZCNA 4GCTA 2DT7B 2QWWA 3BZKA 3EPZA 3O2PE 1WCMJ 5EGOA 3R6SA 3F21A 3RQ4A 5D5XB 3LNQA 3ANGA 1HW5A 4CDGA 4NBQA 2G0EA 3V7RA 2X4HA 4ZYAA 2A3SA 1VQ4I 3RKXA 3ZRGA 3H0DA 1USSA 5FHPA 2PMHA 1RUNA 2XAHA 2ELJA 1ETWA 3Q9SA 1POGA 3DBLB 2VBWA 3S3NA 1ZR4A 3VVXA 3P9IA 1XGMA 3F23A 3CTAA 3R60A 2KIQA 3L2WA 3GLLA 4ZTJA 3I59A 2STWA 1BM9A 2EFQA 2P0WA 1YRNA 4OIOF 1ZG1A 2E35A 3QP5A 2PI0A 1X19A 2HTJA 2R7OA 4A3GJ 4BEHB 3AG2H 2XF6A 2CQXA 3MD2A 3EDPA 3GFIA 2YX4A 2OZ6A 3S16J 4XRSG 2DA2A 3NI7A 2QLZA 3HSRA 3KP3A 4OIPF 1FOWA 3JRIA 2WUIA 4B1RA 3NS4A 3HEFA 1Y56A 2RGVA 3ZXSA 3OIPA 1V3FA 2UXHA 4WCGA 1XSXA 1T08B 3SZPA 5L3FA 3U1DA 4XKWA 2KIFA 3K69A 4XLHA 2KKOA 1BI0A 2MABA 1H0MA 3ZQCA 2K4JA 5FROA 1SGMA 4YFXF 2IVMA 3EETA 3M7GA 3AL0C 2EV0A 2ZFUA 5IYDJ 1W36D 4DYCA 1W36C 2ID3A 3R0AA 4HNUA 5D8LB 5FLVA 4AC6A 1KU2A 3LSIA 4E6KG 3I55I 1QRYA 2L7FP 5H6RA 3VSKA 4EJOA 3IKTA 3LA3A 2O8KA 1R1TA 3RTRA 5EJCA 3ZOBA 3JSOA 2X85A 3FX3A 5E17F 2Q2EA 3V42A 2BXYA 2M1BA 2UXOA 1JHFA 1OFCX 3VFZA 2JPBA 2MD0A 2RN7A 4FCYA 2O5RA 4GYIA 3I4PA 1Z3XA 4EM2A 1C0WA 1HKTA 3LQQA 3PFYA 3HOVJ 2H09A 2V57A 2KHMA 2BV6A 4HV6A 3TO6A 1T0FC 2XRLA 3AG3H 2XVCA 3UNGC 1FEXA 3F8CA 1LB2A 1ZAOA 3DTKA 4HLXA 2M87A 5FLXZ 3HG9A 2DTRA 2O61A 4BAYA 4HQMA 3ERMA 1GHCA 3VW0A 1V4RA 3SHFA 2V79A 2REKA 4EVIA 1B6AA 5E20A 2QZ8A 4C2TA 5J4VA 5LLQA 3BG9A 2KT0A 3CCRI 1ZK8A 2OU2A 2ECCA 1RNLA 5F64A 1VQ8I 4HPQA 4DZPA 2F4MB 5FMPA 5DAJA 3JCUC 2GLOA 2MYSA 1S29A 2A6EF 3EUHA 4CYCB 1R7JA 3COLA 2A5YB 3OYHA 2VJ4A 2A07F 4LGWA 4RB0A 2XV4S 2DMUA 1B72B 2ELHA 2O3FA 3E5QA 4RGXA 2VT3A 5JVGF 3DEEA 3MMYB 4RB3C 4XLEA 1SAXA 2VUMJ 1SVOA 2HGCA 4HEA2 2H27A 2NVTJ 1Y8QB 3OYKA 1APLC 1W7PA 4C2UA 3PPBA 3KCCA 2ZNZA 5FKNA 3Q5FA 2IT0A 1P2FA 2DOAA 3E97A 2EJRA 3SWHA 4NDLA 2P5VA 1HCRA 2IGOA 1MNMC 4E70A 3PM1A 4D7NA 4YELA 3FK7A 1EKEA 5F1RA 5J1YA 3HOTA 4II3A 2VKVA 4R1HA 1UCRA 2BXZA 3I58A 1HSTA 2RAEA 3VUQA 1ZGJA 3H9JA 5K5QA 1HQCA 1RI7A 3E5UA 2DYSH 4XM3A 1LUJB 1JUSA 3SZTA 4QLCU 3MEXA 2Z2SB 1S7AA 2E1MB 1U0JA 3FKJA 2ISZA 3RH2A 2GIVA 2PBXA 2V1XA 4IHSA 4A0YA 1O3QA 2XB0X 3SEZA 3WTYC 3OYFA 2VODA 5HS8A 1BR2A 3FXKA 2ZY9A 2KJBA 2OF7A 4WXHA 2AQFA 4M72A 2BE5F 3F8MA 3FXLA 2A61A 2E19A 4KMFA 2FMLA 2DA6A 4U0WA 1HBXG 1S7OA 5E8GA 5FKLA 1VQKI 4FISA 4G94A 4FTHA 2HVRA 4DBRA 1VF9A 2A5WA 3DCFA 3D1NI 2Z9OA 3L00A 3ONQA 2FQ3A 1Z77A 3S1RJ 3BZ6A 4PXIA 4IHWA 3DKWA 4U88A 1IXCA 2W85A 3OYDA 3F8BA 4YRVA 3ASOH 1YIJI 2BY3A 3VEPA 4YIFA 4ZC3A 1F5TA 3HYIA 2LYCA 2JA7J 3S2WA 3G71I 3HDDA 4KMUX 1QZZA 1MDMB 4HZFA 4XRMA 2GWRA 2CYYA 1JJ8C 1O4XA 3BR6A 3PUBA 5CVJA 3U9GA 2G3BA 2L7KA 3S32A 2R7XA 3PIOF 4JKZA 4Q47A 1XMXA 1B8IA 3C2BA 2ZJ2A 2HWVA 1IGNA 2BBYA 2DOFA 3KFWX 5K7FA 2G7HA 4Y52J 2DODA 1O3TA 4KIFA 3CCEI 1XX5A 1SANA 2MG4A 1Z7LA 1JHHA 2BVLA 4KWAA 1XD7A 1QO0D 4AIHA 1GVJA 5TJJA 2DPUA 3S2HJ 4XLFA 2D1HA 1MBHA 1R5HA 4M6YA 1SFKA 3TDUC 3IUVA 3M4OJ 4AIJA 1XCBA 1DQUA 3BCGA 1N25A 5CVIA 2E1NA 5FFZA 3ABTA 3TO9A 3U1KA 3EYYA 2A6TA 3FIWA 3U21A 2PBIA 4E7IA 4JK1X 1FLIA 1MBGA 5DS9A 1VQ9I 3PSFA 3C7JA 1G59A 2J5OA 2F4OB 1K6OA 4BNCA 3GZNB 2YVXA 4RM3A 4CSWA 1YOVB 1JKQC 3ECOA 5H2FC 1WRJA 2FBKA 4CA0A 4ZZLA 2MGQA 4AIDA 3K10A 3CMMA 3OS2A 2CG4A 2E2JJ 1J75A 2VPRA 3TGNA 1MJBA 2BHZA 2CS3A 4UUTA 4CICA 1GXPA 3K4MA 3RKWA 3ON4A 4BDZA 1WPKA 3BG6A 5J47A 3EYIA 4KITB 1V5GA 2ZMEA 2FQ4A 4P9FA 3OSGA 1CF7A 1EH7A 3F8FA 3WE2A 2PJRB 2D6YA 1PUFB 4L62A 4V2GA 4FQGA 3OYAA 1KA8A 2VE8A 3DBHB 4XK4A 4PGHA 1U3EM 2CFOA 4B48A 1L0OC 2JPCA 1X3UA 3MQ0A 1WJDA 4KDPA 2WV1A 4BXFA 3WGIA 3S8PA 5IPAA 2LVSA 2R7ZJ 4M9XA 2CW0F 3KKDA 1K79A 3HL2A 2W24A 3J80Z 2XASA 2V6EA 2LY9A 3N05A 4XKVA 1E17A 3JRCA 3CCLI 2HS5A 1OCPA 3WTZA 2PN6A 1MSFC 5M3MJ 5JFRA 3S1NJ 1FX7A 2QYOA 1OMIA 2HDWA 1I1GA 2VQHA 1R9TJ 4S05A 1NK2P 1ZELA 2OQRA 3LSJA 4F91B 4J00A 3EGQA 1IRZA 3HOXJ 1ORKA 2M4KA 3QAHA 5J4YA 2KRFA 5DD8A 4GXOA 5B1BH 4I0AA 2NNYA 2PJRA 2GXBA 1P4AA 2FUG2 4ZJZA 1AKHB 2DMQA 1F43A 2GUHA 2CO5A 2XAQA 5FLXK 3OL4A 1P9QC 4UY8I 2L4AA 4LFUA 4Q4ZF 2UZKA 1BN5A 1U5TB 5EDNA 2JWTA 1FNNA 2X6YA 2XDVA 1IRGA 3OS1A 1XB4A 3DPJA 3F8NA 2NS0A 5IOYA 4XOPA 2WAQN 4X6AJ 4BBRJ 2RC4A 2LY2A 2WY7Q 3HB9A 3JAMK 5ERIA 4JX4A 2EBIA 4CZZA 3OOUA 3ISPA 4EJWA 2OJED 2EFNA 2WAFA 5GAHJ 1UMQA 4LIUA 5J40A 2VJ5A 2ZXIA 3C07A 2M2EA 5D18A 5EYRA 2ME6A 4CXFA 2Z3YA 5L3DA 2NVUB 4X0GA 4HOBA 4HV5A 4DW6A 1TQMA 2Y0MA 2O8XA 1ULYA 2CMPA 2DFIA 4PUSA 2FX0A 4PJ0C 3GO5A 4PJJA 4WF2A 3CUQC 3VB2A 3A01A 3PNTA 1IAWA 3H36A 1GDTA 3FBIB 2XPWA 1LJ9A 1X58A 3GTOJ 2ZJPF 2OA4A 3CMAI 2V26A 4YZEA 4B8XA 2VBYA 3BTLA 2LKSA 2H6CA 3QP6A 2W57A 1S3JA 4AC0A 1FIPA 2F2EA 1LKXA 2LBFB 2KL4A 4BBSJ 4FE4A 4I09A 4C3JJ 2M4GA 3UR3C 1JXSA 2XB5A 9ANTA 2R7DA 4BYYA 1BR4A 1X1BA 1E2XA 2Q24A 4HX4A 3T0YA 5IY5H 2KDOA 4I02A 1PP8F 4MK6A 2LREA 3DKYA 4LG0B 2FF4A 2LR8A 3OSFA 1YE9A 1UFMA 3BCBA 2HNHA 1S5LC 4HYEA 3WU0A 4RDUA 2G7GA 1KU9A 2ZFWA 4FT8A 2YPRA 4D9JA 3CJQB 4I01A 1LE8B 2ZXHA 2YS9A 4XMYA 4IKFA 1SFOJ 3ZMVA 3HIFA 3AKZA 2Z99A 2CV2A 3K4CA 2QQBA 4I99C 4OINF 1BW6A 1WQ2A 3DXJF 2E2HJ 2MLGA 2OTJI 2D2WA 3BCAA 4ZYDA 4C30A 3F6VA 2O0YA 3KP7A 1MBEA 3G1LA 1ETYA 3I0TA 3T1BA 1TW2A 2JRTA 4ABZA 2VXZA 4U7DA 1P4XA 4BDYA 2VI6A 2L2OA 1LEBA 2ZCMA 3L2RA 4DQ2A 3MZYA 3I3LA 1BJAA 2OI8A 2BEOA 2L7ZA 3FF5A 5IYCJ 2YU9J 1W5SA 2H6BA 4NC7A 2QKOA 2OV7A 2CUFA 1OCZH 4BJ5C 1IDZA 1LEAA 3MWMA 4Y17A 4IHYA 4EATA 2M9HA 3S5RA 3BG3A 4UUSA 1JKRC 1TWHJ 2DI3A 1VNDA 1O3SA 2P8TA 4F7ZA 3KPHA 1HDPA 2K9MA 4OMYA 2DMTA 2H1LA 3ZQ7A 4WX9A 2GA2A 4MTDA 5H6QA 3LA7A 1KZHA 4OOIA 4I7HA 4ESBA 3E7QA 3FKIJ 3FXUA 3RPUD 3LJLA 2O7OA 2MBFA 4YG2F 3I9V2 3F9KA 2XRNA 3GCMA 1R58A 1TWFJ 5AQCA 2M45A 2FD5A 5EGOB 1Z6RA 1QGPA 2DAOA 1XMAA 4D5FA 3BJOA 4ZZDA 1WGXA 3BPVA 2VN2A 2G7SA 1Z05A 2IA1A 2UXUA 2IP2A 3K70D 1VQNI 2JTVA 2EB7A 5JHFA 4KICA 3FK6A 5E1WA 2PMZN 2VLAA 2STTA 3I64A 2Z1DA 1PJRA 1B72A 3NAUA 2HEOA 4R8HA 2DK8A 4CCKA 5LBQA 5E3LA 4ETSA 3AG4H 3TL4X 3C3WA 2L9VA 4M3EA 2FBIA 2V4JC 5HLTA 2Y69H 2KJCA 4V19K 2R5ZB 1XSDA 2ESNA 1IO2A 3G1MA 4GCVA 3GEZA 4ESFA 2NX4A 1ZG3A 2ESHA 2V1DA 5F27A 5IP6A 1IRFA 4B47A 2Z16A 2OCCH 1XGNA 2G7LA 2VQCA 4L9TA 3VSLA 5E1XA 4AYBA 5DUIA 3CC2I 5AIQA 2A05A 3REOA 1LDJA 1BL0A 1W0UA 1W4MA 4CHUA 3GW2A 4QSHA 3RI4A 1R00A 2DG8A 2BY2A 1MMAA 2Y48A 1NHAA 1UELB 2GOMA 4HLYA 1ETKA 2HDCA 2DMPA 5EG0A 4FE7A 1A5JA 1MZBA 2O7TA 2Y0SA 3PFIA 4IJAA 5LHIA 2OCEA 3OR2C 5HNFA 2B0LA 1ITYA 2XKOA 1ZTRA 1OYWA 5KNLA 1B9NA 1IUFA 2EIKH 1KU7A 4Q5SF 3V7CA 2DQRA 2P81A 3AL0B 1Z7UA 2FXAA 3CCSI 4M3FA 4BE1A 1BI1A 5FLMJ 3GF2A 1IG7A 3VOKA 3HZJA 4I98B 1EH6A 3V8JA 1T8IA 2ECBA 3C2GA 4HSTA 4IF4A 4ENJA 1VZ0A 2L5QA 5E79C 3GTPJ 3LSMA 1EV7A 1R5ID 3RQIA 1KQ9A 4BQAA 3PO2J 2VKEA 1UZCA 1YX3A 3A03A 1MJ9A 1XMKA 2DYRH 2L01A 1OR7C 5LEJA 4NHJA 3RYRA 3E6DA 5JLXA 1ACIA 3G56A 4CO8A 4M3GA 2LP0A 5FKKA 4A12A 3HTIA 3F3XA 3JRHA 4A5MA 2DFFA 2XGEA 1BI2A 1X1PA 3RIRA 1KYZA 3O60A 2QSHX 2LDUA 2EWNA 5ILSA 2P6SA 1MMNA 1YW7A 2AHQA 1Y0UA 1FBUA 1TTYA 1TNTA 4B43A 2IW5A 4UVAA 5FKMA 1DGWY 3ZMZA 3BTCA 2LF7A 3VYUB 1JTXA 3BR5A 3G3ZA 3K1NA 5FGLA 3OWTA 1VTNC 3CWRA 1WKMA 1FT9A 2ZC2A 3MZ8A 1BC8C 1ZRFA 2DLLA 2LKPA 2EPFA 1J5YA 3SFIA 3QYFA 5J3LA 4KN7X 3HE0A 2KISA 3JRFA 2PFVA 3C18A 2GIZA 3C2HA 1JUMA 2R92J 1RUOA 2Q2EB 2HOSA 2XHKA 4U9NA 1TQIA 4IHTA 1P7JA 2FEZA 1MH4A 3OR1C 3JRDA 2CW7A 2C6YA 4ACIA 4XLPF 4U87A 1DP7P 3QQAA 2MD5A 4N9IA 1XGOA 2LLKA 3HTAA 4G9YA 2LNBA 2IAIA 4AUXA 2V9PA 2GQQA 3ZMUA 5HLGA 4KISA 2XKPA 5IYBJ 2GXAA 1A04A 3FXMA 1RKTA 2BY0A 2QOPA 3P9KA 2YUSA 3HKZN 4L5IA 1G3WA 1D0YA 1QVTA 4KA4A 1YLFA 1XN7A 4IXAA 5GAEJ 1U8RA 1HKQA 4IHXA 3CF2A 3CC7I 2QEXI 1TNSA 2VOPA 5KK1A 2HVSA 1HA8A 2ZXWH 4UUVA 2EILH 1X1CA 4K2EA 5E3MA 4A3BJ 3N4MA 2NP3A 4TV7A 2ZKZA 2RQPA 4D1QA 4MO7A 2HOAA 1Z9CA 2PMZA 3ZQQA 2WADA 2ZOYA 4ZDPA 1EJ9A 4RA2A 3GYHX 2P7VB 2HXOA 3VODA 5K7ZA 3MKZA 1G2HA 4CUGA 1R36A 4MIMA 4JYKA 3OYBA 4E7KA 1MMSA 3JSJA 1SFXA 1WJCA 3B73A 1HDDC 1K6YA 3CESA 3K4KA 3WGHA 4B09A 4BY1J 2XPUA 3EQLF 4EQQA 4KJZA 1AKHA 3W2WA 3BTIA 4ZDLA 1TT0A 2JJ7A 3L2VA 4BE2A 3IAS2 2V1NA 3ERED 2DO7A 3H35A 2ZNYA 5FKOA 3TKYA 2FJI1 2EZHA 1D1BA 1BOAA 2ZB9A 1Y1WJ 3IL2A 3K1PA 5CVVA 4DBQA 4MFDA 2DCEA 1RKWA 3FM5A 1F9NA 3NWTA 1JI8A 2ZCXA 1RC9A 4E7JA 2X6XA 1ETQA 3IKVA 1P7IA 2CUJA 5LHGA 4PJNA 4JBAA 5FJ8J 2GAUA 1OYYA 3S3OA 1IZ1A 3J7AO 2F6CA 3M1EA 3H92A 5IP9J 3AQTA 1UG2A 4Z2YA 3GEUA 5F08A 2KIMA 5D5VB 1IN6A 3L2CA 1MMGA 4F52A 3S3MA 3BJBA 2LC2A 2DQLA 2ID6A 5J1RA 4CCNA 2X6OA 2MH9A 2Y2ZA 2HOEA 2MH2A 2IS6A 1XC5A 4WIBA 2KQRA 3V4GA 5ICEA 2NVYJ 4H4KC 2QWTA 1FMVA 3M9AA 4UVBA 4BGDA 1XCVA 5F0FA 1S72I 3CC4I 5BOXA 2Y31A 2DPDA 2DG7A 3TW7A 2DA3A 4W1UA 1VQPI 4HNTA 4WWCA 2MSYA 5DCFA 4XR6A 3B6AA 3OV8A 3H3VK 3VYSB 2JVHA 5EF6A 3BHQA 2Q1ZB 3BLYA 4CCMA 4RS8A 1E3OC 2ME0A 2OBPA 3LL7A 2VQLA 3G73A 1U78A 4HRIA 2FOWA 1T6SA 2OQGA 4F92B 4A69C 1IN4A 4IRGA 2HQRA 1MNEA 2XPVA 4XSXF 5F0CA 2JSCA 1IN8A 3RSNA 2ZXJA 4Z6YA 4RLFA 1WJFA 2ACJA 2IU5A 2F5CA 3FHZA 4UVCA 3HM5A 1V55H 1ZYRF 3VVZA 3JTHA 4E7SA 1Y0NA 3G2BA 2FNPA 4LLNA 2CWEA 2E60A 4HF1A 2OERA 2HTSA 1TL8A 2W1OA 2L0KA 3BRUA 3RJPA 5K1YA 1X1AA 3QU3A 2PEXA 4XL9A 5HDNA 4P5OA 4D5CA 2X0LA 4KT6A 3GTKJ 2R3SA 3KZ9A 1MMDA 3HPHA 2KMUA 3DWLE 3KP4A 3WG9A 3KLNA 1UHWA 3DV8A 3ZQGA 2DW4A 5K7HA 2NYXA 3FMRA 3O8GA 2GENA 4O6JA 1DDNA 1S7EA 1FOYA 1QHGA 4AWXB 4MHGA 2IA2A 5JR3A 1M1EB 3E3VA 1IN5A 1I27A 2YU3A 3ZQLA 3VIBA 1XS9A 1VI0A 3MZHA 1FYMA 1Z91A 1X4PA 3A02A 1Q1HA 1MBKA 1I5ZA 1UI6A 1OJLA 3DLAA 5TRDA 1RIOH 4HDVA 1GLNA 1IV8A 1ON1A 1WH5A 4LLLA 1D8KA 2QENA 3HGGA 3CP8A 2A69F 3I71A 2XSJC 2F48A 3AFHA 4P9UA 2JA6J 2CUZA 4A3EJ 4L0YB 1CQTA 3TMOA 1DU0A 2HU9A 1SVLA 5LHHA 2VE9A 3NWSA 3ZN0A 2NXNB 1XPXA 5J8FA 1Y39A 4C2MA 3C1DA 3L7WA 2B7EA 2K02A 3DPLC 3B6CA 1TZLA 3P9TA 2HI3A 3SEQA 4OD5A 5D6EA 4XN0A 4YIIA 2XROA 4Y13A 4GCLA 3E1SA 2MW8A 2LOOA 1ZRCA 5FRMA 4PCQA 3E6CC 5TGTA 2LF8A 3LQRA 1YJWI 3BQZA 3ON2A 2R7WA 1X1DA 2QCOA 3ABKH 3S93A 3T6NA 1TC3C 3DBRB 1H88C 3CCMI 4F93B 3BJAA 2L3DA 2HPIA 1RESA 2VC1A 3KP6A 5E3NA 1FSEA 2R7QA 5LGTA 4HDUA 1ZG5A 4DJAA 4AYBN 1W1WE 4KNYA 3CJRB 4IO9F 3W2VA 2BGCA 4CZCA 3SYTA 2HVQA 2RREA 5FRNA 2CQQA 1YW8A 2K9NA 2K9SA 3S2DJ 3M8EA 1FSHA 2Y0SN 3IC7A 1FJLA 1XSVA 3KIOA 5AONA 2YVHA 3QYEA 4HG2A 5DDGA 3P5JA 1MDMA 5CXGA 1P4WA 2JT1A 4IRIA 3ZQHA 2E5ZA 2W4SA 5HNHA 1PP7U 4E7HA 2VASA 5DUKA 1ON2A 2FE3A 4AM3A 2RNJA 4BHCA 1RRJA 3D0SA 3GZ5A 3S14J 2W84A 4Y33A 1YI2I 3CUQA 3K1MA 2B63J 5H20A 1MBJA 1I39A 3QRFF 1R4NB 3RZDJ 4RM2A 1BBYA 2Z5UA 4JL3A 2QQAA 1YFHA 4A3DJ 2ETHA 2L4MA 3E5XA 3KYCB 5K5RA 3W6KB 5C4XJ 1SC7A 1X2NA 1ENHA 3CO6C 4OWRB 2O9LA 5FB2A 4LOCA 5EZHA 5AIPA 3L9FA 3CUOA 1YS7A 4M74A 5FD5A 4AIKA 2UXXA 2YSRA 1ZH5A 2NVQJ 3HSEA 2R7SA 3E6BA 3SFZA 3CDLA 4LD5A 1N75A 2RKHA 2WY8Q 2EINH 3SXYA 5GADJ 3OYNA 1SD7A 3BG7A 4J19A 3RCOA 1MJAA 1WJAA 4GRIA 2XGDA 3JR9A 4CYDA 3HJEA 3GXOA 3ZMTA 3TO7A 2V1UA 3JW4A 3H5AA 4GO1A 3BT9A 1ETVA 4PDKA 3RKQA 1OPCA 3CP2A 4U0VA 1OCTC 2CFXA 3Q9VA 4CCJA 3LSGA 5KHDA 3PO3J 1PVEA 5JLWA 3I4MJ 1B9MA 2BYVE 1T98A 2M34A 3DU6A 2DA7A 3H3ZA 3QWLA 1YHQI 4FETA 2EIMH 4LIVA 1BW5A 2ZMEB 1CF7B 5CPRB 2JMWA 3LSKA 2LTPA 3IHUA 3FXQA 5HVQC 3W6VA 3R61A 1JKPC 2M7AA 2ZJRF 1NH3A 2BY1A 3WHCA 3IWZA 3BPXA 1SAUA 5BS6A 2H1KA 1FWZA 3FISA 1G6NA 1Z6TA 1FPQA 4EGYA 3OIOA 2D5VA 3BR0A 5BNGA 1P92A 4IZZA 1FIAA 1W7PB 3SDGA 2E1OA 4RB1A 1QZYA 1IXSB 5K5OA 1MKMA 1PYVA 2HZDA 3OYGA 4XICA 2YVEA 4G7ZF 1IV6A 2RNGA 1XDUA 3ESWB 3MFKA 1LPQA 3A0BC 4UV9A 1PDNC 4M6XA 1MD0A 3V8LA 2AXLA 3H9QA 3ABMH 3WG7H 2VL8A 2XAGA 4M3DA 5J6XA 3OYMA 4XLNF 4MGRA 4ZDOA 3K8PC 1O3RA 1J59A 3E6MA 5HOOA 2KFDA 2EFOA 1OYIA 2M0CA 1X3WB 2VBXA 4G7HF 3OYJA 3K4NA 4HSRA 4QWQA 2KP6A 2DTZA 2DJIA 4OIRF 5E18F 4BUPA 1K61A 3KLOA 3LMMA 2RASA 2BZTA 1AU7A 1I50J 2O6GE 3FDYA 5ICFA 2LRDA 3NEUA 1TQPA 2E36A 3O8HA 2GBYA 1FC3A 3I54A 1UHMA 1F4KA 3CD6I 4JP0A 1DPRA 1ODDA 2V9KA 2MC3A 1Z0XA 4ZYHA 1IN7A 2DJNA 3E0JB 3B02A 3H0GJ 2CV0A 1W5CC 3J7ZI 4NB5A 1U5TA 4XRFA 3PIPF 3QPTA 3WHBA 3QOEA 3BR3A 3BQYA 3QPLA 3K0LA 3VWBA 3TP0A 1BJZA 2JSPA 2K9QA 3QBMA 5E3OA 3A1YA 3LWJA 4P96A 2AQEA 1WI3A 3K4LA 1A6IA 4G12A 2CJJA 2EZLA 4KIGA 5CKTA 5HDGA 1TWGJ 3FBNB 3KZIC 4ZTFA 2WV0A 1H9TA 4IRVA 4A5NA 2YR2A 2QQ9A 1D1CA 3GLXA 2DXIA 1U9NA 2I10A 4BXXJ 3ULQB 3RPUA 3TEDA 2FA5A 5L3CA 1O7LA 5EEGA 3BP8A 4MTEA 3ZR8X 4NQWA 1TP4A 2I5UA 4DYQA 1SMYF 2KPMA 2OPTA 4L5JA 2DT5A 5L3EA 2HQNA 4QPOA 3CJDA 4ZYGA 2R0QC 3F72A 4I2OA 2WAQA 1FMWA 1T39A 4P1WA 2IGMA 2R7VA 4IOCF 1TLHB 5C4JJ 1R71A 3S15J 5B66C 1ZKGA 2HZTA 4JOMA 2OAZA 3O3KA 2B9SA 2QM3A 2R7RA 5HODA 2ZMEC 1MGTA 5KAFC 3GFMA 3F22A 1FP2A 4WK8F 2YX7A 3DF8A 3VYRB 1YRNB 1TW3A 4F55A 2VC0A 1X3ZB 2JK3A 4GFBA 5M5XJ 2A2FX 3OMYA 5LEKA 1P6RA 2K86A 3LAJA 1UAAA 2ZJQF 2UXIA 4LG0A 2FBHA 2R7TA 2NVXJ 2VB6A 1JKOC 4BE0A 2R93J 2VBZA 4JX6A 3HIMA 3ZP5A 4D7MA 4C3HJ 2TRTA 1DUXC 3GTLJ 3GTQJ 1SD5A 4HX7A 2JA8J 3FXOA 2RDPA 2LD5A 2VONA 1TWAJ 1LVKA 3PL8A 2OD5A 1B1BA 3RPQA 3LSHA 4O3MA 5D5UB 3K9TA 2E1MC 3IV5A 3G6EI 1F1ZA 1USTA 3P9CA 2F5FA 1J7KA 1KQ8A 3ELKA 2PZ9A 4V2FA 2IS4A 1XG1A 3COAC 3HHHA 4U9LA 2V6CA 3MN2A 2LK2A 2LMDA 4NUBA 2WGBA 3GWZA 3LWFA 2KIUA 4XBFA 3AG1H 3HOSA 4B44A 4KYWA 3PJRA 4I76A 2Q0OA 3GZIA 5H9TA 1SD4A 2CW8A 3BR1A 1YTYA 4YFKF 1H89C 2K7LA 1ZRDA 1H9GA 3J7AY 1YG2A 3JTGA 2KZVA 3PNVA 4IEJA 1HSJA 4C2MJ 2ZSHB 3BY6A 3HUGB 1MH3A 4DNCA 3L2QA 2GM4A 3CCJI 2DDAA 1YW9A 3P7NA 2E7WA 2A68F 1J9IA 3IAM2 3EUKL 3TOBA 4R79A 5CXIA 3L1PA 3G7RA 5JI6A 1HF0A 4XLCA 3FXRA 1WH7A 4HQEA 4LLGF 4BH9A 3PQKA 1K4TA 2PQ8A 2JQ7A 4MXMA 1SFUA 5EZGA 5J8CA 1ETXA 2RVCA 5HSZA 5CLSA 3OYIA 2QGUA 3DLLF 3GTGJ 2P5LC 5A2QZ 1B8IB 1D3YA 2R7UA 2VOOA 1SMTA 1BA5A 4PSXA 4A3LJ 2M8EA 2HR3A 2XAUA 3IWFA 1Z1DA 4B3XA 2DT6A 4LK0F 1FY7A 1GV2A 2PFBA 3JSPA 2EFPA 3BDDA 1OKRA 3KYDB 4C3IJ 3KEQA 1B59A 3V78A 2UWMA 3HTJA 1D1AA 3JAMZ 3GTJJ 4L0ZB 2FBQA 4AVZA 5HDKA 2EV6A 3K6GA 3DPTA 5LFAA 3RYPA 4BJ6C 2R5YB 3TQNA 1T2KA 1R1UA 3R0JA 1QZEA 4BACA 2G9WA 2K3PA 3H5NA 3J81Z 4E7LA 3AAFA 5LRSA 4L5EA 3LOCA 1E3PA 4KT5C 2IBDA 1GUUA 5E1ZB 3S1QJ 4IOAF 3BJ6A 2HKXA 4Y4RA 3PQJA 1UHSA 2K40A 3BROA 2R4GA 3CDHA 1OR7A 4NN1A 3HRTA 2IS2A 2JN6A 3ZGKA 2HYTA 1TBXA 5FO5A 5FD6A 1XGSA 4CYCA 2XIGA 1W0TA 4ESJA 4A3FJ 1XDSA 2NOJB 2QBYB 2VKHA 2LG4A 4IQ4A 2W82A 5LGNA 1T56A 3ANPA 1YO5C 1G8XA 1R4MB 2QTQA 1WZ2A 1JTYA 4CCOA 5GTIC 3MKYB 1D8JA 2E2IJ 2GA1A 4BU2A 4AF5A 3SDBA 4BJTA 4RLQA 1FTTA 4FX4A 2W25A 5BQTA 1ZHFA 3BNIA 3WU1B 1HW2A 1AA7A 2RQQA 5A2QK 1G3TA 2E1CA 1X4OA 4MFEA 1I1SA 4PFOA 2FMYA 5JVTA 3HC7A 4OD4A 5D8KB 2DBBA 5ICGA 1MW7A 1HOMA 2BW3B 4NC6A 3F6OA 2R5ZA 4EJTA 1U6GA 3LFUA 3J81K 3S17J 5C44J 2D45A 1WHUA 3GVAA 4A93J 5CW8A 3LA2A 2HDDA 3Q0UA 2QA4I 2FJ1A 2EH3A 5KCMA 3CO7C 1QA6A 1WJEA 5BMZA 1MNDA 4S0HB 1MBFA 4OAZA 3H1CA 3NQOA 4DYRA 4ICHA 3V8KA 1X2MA 3QODA 4XKCA 1I6HJ 4A3MJ 5HS9A 3JRAA 3CCYA 2L02A 4A3CJ 1ZLJA 3H3UA 1OQYA 1S9HA 3M8FA 2TCTA 2HYJA 2VKDA 4RGRA 4U0YA 3NXCA 2WAEA 4EM1A 4UB6C 4L9JA 2KZGA 1R6RA 3WU2C 1NG7A 3DKXA 3L09A 2HFHA 3FM3A 2NP5A 1TWCJ 1HLVA 3WTSC 2GZWA 1PUFA 1WJBA 5DD4A 2BVMA 2B3WA 1JE8A 5CVRA 1L3LA 3WTVC 3CMYA 1LDKB 1E3HA 3CUQB 1Y8RB 4M9ZA 4E4HA 1VQLI 4LITA 2PJPA 2QQ8A 2XUBA 2BW3A 5HLIA 2HKUA 3IH4A 3EUPA 3I59B 4OAYA 4C9YA 3ABUA 3KKCA 2LSOA 2H8WA 4FHTA 1IUYA 3B81A 3MAJA 1QBJA 4FASD 3FWEA 3K2ZA 3ZQFA 3UKGA 1V5FA 4BXUA 3DTIA 1UG0A 2HQAA 1JJ6C 2VPLA 3NRVA 5GP9A 4G6TB 4E7ZA 3E7LA 3KZZA 2COBA 4PK4A 4B4CA 3LSRA 2IGNA 1QHHD 4H0EA 1STZA 2RV8A 5F1JA 2XC7A 2UV1A 2XF7A 2M0MA 3CF5F 3NRGA 4ENKA 1RPWA 4WXCA 3SQNA 4G8XA 3VW1A 5DYMA 1QQIA 2P6TA 2DMNA 2COMA 5D4RA 2QBYA 1R23A 3KEOA 4MLOA 5D1RA 2X9DA 4Q48A 4CCLA 4ON0A 4QIWN 1S6LA 3DU5A 4GCKA 3A01B 1Y1VJ 3WE3A 4A3KJ 1D5YA 2RHAA 1U8BA 1FBQA 4J01A 1VQOI 1KYWA 2X1DA 3J7YJ 3K2AA 2DA5A 3FZVA 5DEQA 3ZQIA 4EM0B 4LJZF 1GV5A 3CZ6A 1ZREA 1SD6A 3PUFA 1IW7F 4IPAA 5ILVA 5JHUA 1R5GA 1LFPA 4XIDA 4U7BA 3CJTB 2L54A 4A3IJ 1BIBA 4BEHA 2R5YA 2LFBA 3HOYJ 2A6HF 3CCQI 3IP4B 1Y6IA 4CGRA 5EEAA 2L9RA 3ABLH 1GT0C 1A31A 1ZR2A 3HKZA 5GPCA 2LH9A 3Q0WA 1F36A 3QYBA 4IVNA 5B3SH 3M07A 5BPIA 2XF5A 2GXGA 3DPUA 2QF7A 2M7BA 3A2KA 4IHVA 3W6JB 1T0FA 4HBLA 1YJ9I 1JGGA 5E8IA 2Y9ZA 1K4SA 1MSEC 2EK5A 4LG3A 3MKWB 2Z33A 3BOQA 1V54H 3NNRA 2CQNA 1S8NA 3CLOA 1FOXA 3JRBA 2L9SA 2K9LA 2X51A 4BQQA 4XORA 3FMSA 3TOAA 5DM7F 5DCMB 5L3GA 3K4BA 2CRGA 4L9NA 3I56I 3V6GA 3FXJA 3HOWJ 3PASA 2HXIA 4AVPA 2MFZA 1ERDA 4S04A 2CV1A 1IRXA 4DOZA 4XN3A 3VOXA 3I4NJ 4L9VA 1LNWA 2K85A 3HRSA 1J2XA 3WTXC 4RAYA 1VQMI 2EIJH 2WWYA 2UXNA 3T8TA 5HBUA 2L9NA 3G4SI 1EH8A 2F4IA 3WGGA 3OYEA 2K3FA 1T95A 3DTEA 2EV5A 3VYTB 3T8RA 1D5VA 2B1EA 3GBGA 2P7CB 3HHGA 4EV0A 2Y75A 5B5EC 2X1CA 1UI5A 1NG6A 1YX5A 3IUOA 2WTEA 3ZMSA 3R4KA 1FBSA 4A6EA 3GFJA 2E5NA 4EJVA 1MIJA 2ELKA 2EZIA 2FU4A 2JUGA 3HRUA 2M3AA 1FYKA 2DK5A 1JUPA 3LSPA 2H8RA 3M8JA 4KUMA 3I5UA 3T5XA 4LB5A 1AWCA 1A6QA 2Y30A 4IL6C 5FFXA 1Q1VA 5M5YJ 1FYLA 1GVDA 1YS6A 3EUAA 4F3QA 5DCMA 1FOKA 3RKYA 1UJ8A 2HYGD 3OOPA 4M73A 2JA5J 3WTTC 3VP5A 3W3CA 3M1CA 3BR2A 2QKMB 1WVRA 1SEUA 2ZOZA 5CJ9A 5F0HA 2VIXA 3CMEI 5IT9Z 2NAZA 2R7FA 1RR8C 4L18B 3MVPA 2QUFA 1AHDP 1FZPB 2MLKA 2X6WA 1J09A 2XGXA 4LMYA 3A4CA 1LFBA 4PGGA 4Y7NJ 3KX2A 1ZGWA 5DM6F 2AS5F 2WBMA 2AO9A 4PSWA 1YYVA 3GUDA 1ZGAA 4RGSA 4OIQF 4BL0B 1GXQA 3ML6A 5KAIC 4ASNA 2ADUA 3U2RA 2ISYA 1VQ7I 3MKLA 2EQRA 3RZOJ 2XGCA 3KNWA 3FRQA 3TW6A 4BQNA 1K7AA 1NK3P 2CUEA 4N0BA 3HSFA 3KP2A 2JZYA 4HF2A 2KRHA 4LK1F 1BIAA 3CLQA 1RR7A 5D4SA 2E34A 3LSTA 3FMQA 4M9SA 1EA3A 4XONA 1R22A 4GYGA 1G4DA
chains in the Genus database with same CATH topology
4D7NA 3JRHA 1A6IA 2XGEA 3FK7A 4G12A 2CJJA 2EZLA 3O60A 1TWGJ 1H8AC 5J1YA 2AHQA 1U9NA 2VKVA 2I10A 4BXXJ 3VUQA 2RAEA 1EF4A 2N8GA 3TEDA 4UDSA 1DU6A 5FKMA 1JUSA 3BTCA 2W48A 1JTXA 3BR5A 5FGLA 4DYQA 3CWRA 2OPTA 4W97A 3CJDA 2R0QC 3RH2A 3SFIA 2PBXA 5D19A 5J3LA 2XSDC 3HE0A 2XB0X 3JRFA 5C4JJ 3S15J 3QKXA 1ZKGA 2OF7A 1JUMA 2R92J 2HQ5A 4X1EA 5HODA 2HOSA 1QPIA 2E19A 2DA6A 4RBOA 1P7JA 1MH4A 5FKLA 1YRNB 4FISA 3JRDA 3JREA 4FTHA 4ACIA 2GFNA 2JK3A 4GFBA 5M5XJ 1VF9A 3DCFA 3D1NI 2UXIA 3QQAA 2DA4A 5EFYA 1Z77A 3S1RJ 2LLKA 3HTAA 2NVXJ 4IHWA 4PXIA 1JKOC 2IAIA 4AUXA 2R93J 2HOTA 4JX6A 4BY7J 1ZQ3P 3HIMA 5IYBJ 4D7MA 4C3HJ 2TRTA 3GTLJ 3GTQJ 1I3QJ 2JA7J 1RKTA 2JA8J 2QOPA 2YUSA 3HKZN 2KDZA 2LD5A 3HDDA 4XRMA 1TWAJ 1JJ8C 1QVTA 1O4XA 3BR6A 2XDNA 2IEKA 4IHXA 3JRGA 3IV5A 3HOUJ 5C3EJ 3S1MJ 2G3BA 5E3MA 4A3BJ 4V2FA 2PZ9A 1XG1A 2NP3A 3MN2A 4JKZA 4MO7A 2HOAA 2LK2A 2WGBA 2ZOYA 4HKUA 1B8IA 3C2BA 4M6VA 2DN0A 2HXOA 4I76A 1IGNA 5K7ZA 3GTMJ 1G2HA 2W53A 3GZIA 4MIMA 4JYKA 5K7FA 3JSJA 5H9TA 4Y52J 1HDDC 3BR1A 1H89C 4BY1J 1SANA 2MG4A 2XPUA 1VFCA 1AKHA 4KWAA 3BTIA 3HTHA 2JJ7A 4IEJA 2LKXA 4C2MJ 3S2HJ 1MH3A 5FKOA 1MBHA 2EZHA 4QTRA 2ZB9A 3IUVA 1Y1WJ 2GM4A 3M4OJ 4MFDA 3HGYA 4UUSB 1RKWA 3BCGA 3VW2A 3F0CA 3FIWA 2ZCXA 3IH3A 5CXIA 3L1PA 3G7RA 1ETQA 1HF0A 1MBGA 1P7IA 5DS9A 1WH7A 5FJ8J 1FTZA 3RD3A 3TP3A 4MXMA 1JKQC 5EZGA 5IP9J 1K83J 1UG2A 3AQTA 4HNVA 1ETXA 3GEUA 2MGQA 4JNNA 3LHQA 5HSZA 5F08A 1IJWC 2E2JJ 3GTGJ 1B8IB 2VPRA 3BJBA 1BA5A 4A3LJ 2ID6A 5K58A 2M8GX 5J1RA 3IH2A 3AQSA 2X6OA 2Y2ZA 4UUTA 1JT0A 1XC5A 1GV2A 4GFLA 4C3IJ 3ON4A 3V78A 5GPAA 2NVYJ 1T33A 2QWTA 3HTJA 1WPKA 3GTJJ 5F0FA 2FBQA 5IOZA 2Y31A 3OSGA 2FQ4A 1ETOA 2D6YA 4L62A 2DG7A 3TW7A 2DA3A 1PUFB 4W1UA 4ME9A 4V2GA 2R5YB 2MSYA 4XK4A 3B6AA 4A3JJ 2X48A 3H3VK 5EF6A 3BHQA 2WV1A 1E3OC 3MNLA 4L5EA 2ME0A 3LOCA 5IPAA 2LVSA 1IDYA 2IBDA 1GUUA 2R7ZJ 3K7AJ 1U78A 3CRJA 3KKDA 3S1QJ 4A69C 2LY9A 3CQZJ 2XPVA 1UHSA 2K40A 5F0CA 3JRCA 4NN1A 1OCPA 2UXPA 5EG0B 2JN6A 1MSFC 2IU5A 2HYTA 4NELA 2NS8A 3F1BA 5M3MJ 4CYCA 3S1NJ 5HAWA 3HM5A 1W0TA 1R9TJ 3VVZA 2EZKA 4A3FJ 5C4YA 1NK2P 3LSJA 2OERA 3EGQA 1JT6A 1IRZA 5DTDA 3HOXJ 2L0KA 3BRUA 1T56A 3ANPA 4BKXA 2QTQA 1ORKA 4D5CA 1JTYA 2L7MP 3GTKJ 3KZ9A 2E2IJ 2GUHA 4AF5A 1F43A 1AKHB 1FTTA 2DMQA 1U9OA 3ZQGA 3BNIA 5K7HA 3VVYA 3O8GA 2GENA 3NARA 4MFEA 5EDNA 4GFKA 2JWTA 3HBLA 3DPJA 3QPSA 1S7EA 5IOYA 1HOMA 2WAQN 2DA1A 5IP7J 2R5ZA 4X6AJ 4BBRJ 3HB9A 2F07A 3S17J 3VIBA 4JX4A 2EBIA 1RETA 1XS9A 1VI0A 5C44J 4B3AA 5M5WJ 3A02A 4A93J 3OOUA 5CW8A 2HDDA 1MBKA 1UI6A 1OJLA 3Q0UA 4DZJA 4EEFG 2FJ1A 2EH3A 4I6ZA 1LE8A 4S0HB 3BG5A 1MBFA 1UMQA 4M3BA 5J1UA 4DYRA 4XRSA 2Y9YA 3C07A 1WH5A 2M2EA 1X2MA 4ICHA 5EYRA 2ME6A 5D18A 1I6HJ 3HGGA 4A3MJ 3Q3SA 3VPRA 1IC8A 3JRAA 4DW6A 3CCYA 3Q0VA 1LFUP 4A3CJ 5M3FJ 3G1OA 2TCTA 2HYJA 3NXCA 2JA6J 2FX0A 4A3EJ 1CQTA 1DU0A 1QVUA 3A01A 1GDTA 2NP5A 1TWCJ 2XPWA 1HLVA 1X58A 3GTOJ 3BTJA 1PUFA 3B6CA 3P9TA 4YZEA 2HI3A 3M3YJ 3BTLA 2NS7A 2NOGA 3CMYA 3HOZJ 3SJMA 2WB1N 4GCLA 2MW8A 4AC0A 1FIPA 2HKUA 4BBSJ 3IH4A 3EUPA 4FE4A 4C3JJ 3BQZA 3ON2A 2QCOA 2XB5A 3KKCA 9ANTA 2CU7A 1TC3C 3T6NA 3DEWA 1H88C 3B81A 1NTCA 3ZQFA 3UKGA 3ZQLA 2QIBA 1RESA 5E3NA 5F04A 1JJ6C 2Q24A 4AYBN 5GP9A 4MK6A 3E7LA 3NPIA 4B4CA 2COBA 3LSRA 5F1JA 2LR8A 4JX5A 2CQQA 3OSFA 3NRGA 2K9NA 2K9SA 1RPWA 2G7GA 3S2DJ 4RDUA 3VW1A 2Y0SN 1LE8B 2ZCNA 2DMNA 1FJLA 4MLOA 5D1RA 4GCTA 2YS9A 2X9DA 2YVHA 1WCMJ 5EGOA 1SFOJ 5CXGA 3LNQA 3ZQHA 3ANGA 4QIWN 2G0EA 1BW6A 4GCKA 3A01B 1Y1VJ 4A3KJ 1D5YA 5FHPA 2RHAA 1U8BA 2E2HJ 3K2AA 2DA5A 1ETWA 3ZQIA 1POGA 1GV5A 1ZR4A 3S14J 3VVXA 1MBEA 4XIDA 4A3IJ 2B63J 3G1LA 1ETYA 2R5YA 1MBJA 2LFBA 4ABZA 3HOYJ 3RZDJ 1YRNA 2VI6A 2ZCMA 4A3GJ 4CGRA 4JL3A 5EEAA 2L9RA 1GT0C 2CQXA 1ZR2A 4A3DJ 5GPCA 3Q0WA 2OI8A 1F36A 3S16J 4XRSG 2L7ZA 5IYCJ 2DA2A 3NI7A 2YU9J 5C4XJ 3JRIA 2WUIA 1X2NA 4B1RA 2QKOA 1ENHA 2O9LA 2CUFA 3HEFA 1IDZA 4LOCA 5EZHA 2QF7A 4IHYA 2UXHA 4IHVA 2M9HA 3S5RA 3BG3A 4UUSA 1JKRC 1TWHJ 1VNDA 1JGGA 2NVQJ 2Y9ZA 1MSEC 3ZQCA 1HDPA 2DMTA 1SGMA 3NNRA 3CDLA 3JRBA 4J19A 3JR9A 5IYDJ 3E7QA 2XGDA 3FKIJ 4DYCA 3LJLA 2O7OA 2ID3A 2CRGA 3BT9A 1ETVA 3RKQA 1OCTC 3V6GA 5FLVA 3HOWJ 4AC6A 1TWFJ 3LSGA 5AQCA 2FD5A 5EGOB 3PO3J 3PASA 1QRYA 2HXIA 2L7FP 5JLWA 3I4MJ 4D5FA 2M34A 2O8KA 3ZOBA 1WGXA 3I4NJ 2DA7A 3VOXA 2G7SA 1BW5A 2UXUA 2UXOA 1OFCX 3FK6A 2JMWA 2PMZN 5HBUA 4FCYA 2LTPA 1B72A 1JKPC 3NAUA 3W6VA 3HOVJ 3WHCA 2V57A 2H1KA 3FISA 5E3LA 3OIOA 2D5VA 3BR0A 3GBGA 4M3EA 5BNGA 2XRLA 1FIAA 1UI5A 1FEXA 3SDGA 2E1OA 2YVEA 4XICA 2R5ZB 1IV6A 3VW0A 2ELKA 2EZIA 2REKA 3G1MA 1JUPA 2NX4A 3LSPA 2H8RA 5F27A 5IP6A 2G7LA 2Y30A 3BG9A 1Q1VA 2KT0A 5M5YJ 1GVDA 1ZK8A 2ECCA 1BL0A 4DZPA 1W0UA 4QSHA 4M3DA 2DG8A 5FMPA 1ETKA 5DAJA 2DMPA 2GLOA 2JA5J 5EG0A 4FE7A 3VP5A 1A5JA 3BR2A 2O7TA 2ZOZA 4CYCB 2M0CA 5F0HA 3COLA 3MVPA 2DTZA 1ITYA 1ZTRA 1AHDP 1IUFA 1K61A 1LFBA 2RASA 4Y7NJ 2P81A 1ZGWA 1AU7A 1I50J 2DMUA 2AO9A 1B72B 3O8HA 2GBYA 4M3FA 5FLMJ 1IG7A 2VUMJ 3VOKA 2ECBA 4JP0A 2NVTJ 3GTPJ 1Z0XA 1APLC 2DJNA 3RQIA 3MKLA 3PPBA 3H0GJ 2EQRA 3PO2J 3RZOJ 2XGCA 3KNWA 3FRQA 3TW6A 2VKEA 3A03A 5FKNA 3WHBA 1NK3P 2CUEA 3BR3A 3BQYA 3QPLA 5JLXA 3TP0A 3G56A 1BJZA 2K9QA 3QBMA 1RR7A 4M3GA 4NDLA 2LP0A 5FKKA 5E3OA 1HCRA 3HTIA 3LWJA 1MNMC 3PM1A 1WI3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D7N A;  3JRH A;  1A6I A;  2XGE A;  3FK7 A;  4G12 A;  2CJJ A;  2EZL A;  3O60 A;  1TWG J;  1H8A C;  5J1Y A;  2AHQ A;  1U9N A;  2VKV A;  2I10 A;  4BXX J;  3VUQ A;  2RAE A;  1EF4 A;  2N8G A;  3TED A;  4UDS A;  1DU6 A;  5FKM A;  1JUS A;  3BTC A;  2W48 A;  1JTX A;  3BR5 A;  5FGL A;  4DYQ A;  3CWR A;  2OPT A;  4W97 A;  3CJD A;  2R0Q C;  3RH2 A;  3SFI A;  2PBX A;  5D19 A;  5J3L A;  2XSD C;  3HE0 A;  2XB0 X;  3JRF A;  5C4J J;  3S15 J;  3QKX A;  1ZKG A;  2OF7 A;  1JUM A;  2R92 J;  2HQ5 A;  4X1E A;  5HOD A;  2HOS A;  1QPI A;  2E19 A;  2DA6 A;  4RBO A;  1P7J A;  1MH4 A;  5FKL A;  1YRN B;  4FIS A;  3JRD A;  3JRE A;  4FTH A;  4ACI A;  2GFN A;  2JK3 A;  4GFB A;  5M5X J;  1VF9 A;  3DCF A;  3D1N I;  2UXI A;  3QQA A;  2DA4 A;  5EFY A;  1Z77 A;  3S1R J;  2LLK A;  3HTA A;  2NVX J;  4IHW A;  4PXI A;  1JKO C;  2IAI A;  4AUX A;  2R93 J;  2HOT A;  4JX6 A;  4BY7 J;  1ZQ3 P;  3HIM A;  5IYB J;  4D7M A;  4C3H J;  2TRT A;  3GTL J;  3GTQ J;  1I3Q J;  2JA7 J;  1RKT A;  2JA8 J;  2QOP A;  2YUS A;  3HKZ N;  2KDZ A;  2LD5 A;  3HDD A;  4XRM A;  1TWA J;  1JJ8 C;  1QVT A;  1O4X A;  3BR6 A;  2XDN A;  2IEK A;  4IHX A;  3JRG A;  3IV5 A;  3HOU J;  5C3E J;  3S1M J;  2G3B A;  5E3M A;  4A3B J;  4V2F A;  2PZ9 A;  1XG1 A;  2NP3 A;  3MN2 A;  4JKZ A;  4MO7 A;  2HOA A;  2LK2 A;  2WGB A;  2ZOY A;  4HKU A;  1B8I A;  3C2B A;  4M6V A;  2DN0 A;  2HXO A;  4I76 A;  1IGN A;  5K7Z A;  3GTM J;  1G2H A;  2W53 A;  3GZI A;  4MIM A;  4JYK A;  5K7F A;  3JSJ A;  5H9T A;  4Y52 J;  1HDD C;  3BR1 A;  1H89 C;  4BY1 J;  1SAN A;  2MG4 A;  2XPU A;  1VFC A;  1AKH A;  4KWA A;  3BTI A;  3HTH A;  2JJ7 A;  4IEJ A;  2LKX A;  4C2M J;  3S2H J;  1MH3 A;  5FKO A;  1MBH A;  2EZH A;  4QTR A;  2ZB9 A;  3IUV A;  1Y1W J;  2GM4 A;  3M4O J;  4MFD A;  3HGY A;  4UUS B;  1RKW A;  3BCG A;  3VW2 A;  3F0C A;  3FIW A;  2ZCX A;  3IH3 A;  5CXI A;  3L1P A;  3G7R A;  1ETQ A;  1HF0 A;  1MBG A;  1P7I A;  5DS9 A;  1WH7 A;  5FJ8 J;  1FTZ A;  3RD3 A;  3TP3 A;  4MXM A;  1JKQ C;  5EZG A;  5IP9 J;  1K83 J;  1UG2 A;  3AQT A;  4HNV A;  1ETX A;  3GEU A;  2MGQ A;  4JNN A;  3LHQ A;  5HSZ A;  5F08 A;  1IJW C;  2E2J J;  3GTG J;  1B8I B;  2VPR A;  3BJB A;  1BA5 A;  4A3L J;  2ID6 A;  5K58 A;  2M8G X;  5J1R A;  3IH2 A;  3AQS A;  2X6O A;  2Y2Z A;  4UUT A;  1JT0 A;  1XC5 A;  1GV2 A;  4GFL A;  4C3I J;  3ON4 A;  3V78 A;  5GPA A;  2NVY J;  1T33 A;  2QWT A;  3HTJ A;  1WPK A;  3GTJ J;  5F0F A;  2FBQ A;  5IOZ A;  2Y31 A;  3OSG A;  2FQ4 A;  1ETO A;  2D6Y A;  4L62 A;  2DG7 A;  3TW7 A;  2DA3 A;  1PUF B;  4W1U A;  4ME9 A;  4V2G A;  2R5Y B;  2MSY A;  4XK4 A;  3B6A A;  4A3J J;  2X48 A;  3H3V K;  5EF6 A;  3BHQ A;  2WV1 A;  1E3O C;  3MNL A;  4L5E A;  2ME0 A;  3LOC A;  5IPA A;  2LVS A;  1IDY A;  2IBD A;  1GUU A;  2R7Z J;  3K7A J;  1U78 A;  3CRJ A;  3KKD A;  3S1Q J;  4A69 C;  2LY9 A;  3CQZ J;  2XPV A;  1UHS A;  2K40 A;  5F0C A;  3JRC A;  4NN1 A;  1OCP A;  2UXP A;  5EG0 B;  2JN6 A;  1MSF C;  2IU5 A;  2HYT A;  4NEL A;  2NS8 A;  3F1B A;  5M3M J;  4CYC A;  3S1N J;  5HAW A;  3HM5 A;  1W0T A;  1R9T J;  3VVZ A;  2EZK A;  4A3F J;  5C4Y A;  1NK2 P;  3LSJ A;  2OER A;  3EGQ A;  1JT6 A;  1IRZ A;  5DTD A;  3HOX J;  2L0K A;  3BRU A;  1T56 A;  3ANP A;  4BKX A;  2QTQ A;  1ORK A;  4D5C A;  1JTY A;  2L7M P;  3GTK J;  3KZ9 A;  2E2I J;  2GUH A;  4AF5 A;  1F43 A;  1AKH B;  1FTT A;  2DMQ A;  1U9O A;  3ZQG A;  3BNI A;  5K7H A;  3VVY A;  3O8G A;  2GEN A;  3NAR A;  4MFE A;  5EDN A;  4GFK A;  2JWT A;  3HBL A;  3DPJ A;  3QPS A;  1S7E A;  5IOY A;  1HOM A;  2WAQ N;  2DA1 A;  5IP7 J;  2R5Z A;  4X6A J;  4BBR J;  3HB9 A;  2F07 A;  3S17 J;  3VIB A;  4JX4 A;  2EBI A;  1RET A;  1XS9 A;  1VI0 A;  5C44 J;  4B3A A;  5M5W J;  3A02 A;  4A93 J;  3OOU A;  5CW8 A;  2HDD A;  1MBK A;  1UI6 A;  1OJL A;  3Q0U A;  4DZJ A;  4EEF G;  2FJ1 A;  2EH3 A;  4I6Z A;  1LE8 A;  4S0H B;  3BG5 A;  1MBF A;  1UMQ A;  4M3B A;  5J1U A;  4DYR A;  4XRS A;  2Y9Y A;  3C07 A;  1WH5 A;  2M2E A;  1X2M A;  4ICH A;  5EYR A;  2ME6 A;  5D18 A;  1I6H J;  3HGG A;  4A3M J;  3Q3S A;  3VPR A;  1IC8 A;  3JRA A;  4DW6 A;  3CCY A;  3Q0V A;  1LFU P;  4A3C J;  5M3F J;  3G1O A;  2TCT A;  2HYJ A;  3NXC A;  2JA6 J;  2FX0 A;  4A3E J;  1CQT A;  1DU0 A;  1QVU A;  3A01 A;  1GDT A;  2NP5 A;  1TWC J;  2XPW A;  1HLV A;  1X58 A;  3GTO J;  3BTJ A;  1PUF A;  3B6C A;  3P9T A;  4YZE A;  2HI3 A;  3M3Y J;  3BTL A;  2NS7 A;  2NOG A;  3CMY A;  3HOZ J;  3SJM A;  2WB1 N;  4GCL A;  2MW8 A;  4AC0 A;  1FIP A;  2HKU A;  4BBS J;  3IH4 A;  3EUP A;  4FE4 A;  4C3J J;  3BQZ A;  3ON2 A;  2QCO A;  2XB5 A;  3KKC A;  9ANT A;  2CU7 A;  1TC3 C;  3T6N A;  3DEW A;  1H88 C;  3B81 A;  1NTC A;  3ZQF A;  3UKG A;  3ZQL A;  2QIB A;  1RES A;  5E3N A;  5F04 A;  1JJ6 C;  2Q24 A;  4AYB N;  5GP9 A;  4MK6 A;  3E7L A;  3NPI A;  4B4C A;  2COB A;  3LSR A;  5F1J A;  2LR8 A;  4JX5 A;  2CQQ A;  3OSF A;  3NRG A;  2K9N A;  2K9S A;  1RPW A;  2G7G A;  3S2D J;  4RDU A;  3VW1 A;  2Y0S N;  1LE8 B;  2ZCN A;  2DMN A;  1FJL A;  4MLO A;  5D1R A;  4GCT A;  2YS9 A;  2X9D A;  2YVH A;  1WCM J;  5EGO A;  1SFO J;  5CXG A;  3LNQ A;  3ZQH A;  3ANG A;  4QIW N;  2G0E A;  1BW6 A;  4GCK A;  3A01 B;  1Y1V J;  4A3K J;  1D5Y A;  5FHP A;  2RHA A;  1U8B A;  2E2H J;  3K2A A;  2DA5 A;  1ETW A;  3ZQI A;  1POG A;  1GV5 A;  1ZR4 A;  3S14 J;  3VVX A;  1MBE A;  4XID A;  4A3I J;  2B63 J;  3G1L A;  1ETY A;  2R5Y A;  1MBJ A;  2LFB A;  4ABZ A;  3HOY J;  3RZD J;  1YRN A;  2VI6 A;  2ZCM A;  4A3G J;  4CGR A;  4JL3 A;  5EEA A;  2L9R A;  1GT0 C;  2CQX A;  1ZR2 A;  4A3D J;  5GPC A;  3Q0W A;  2OI8 A;  1F36 A;  3S16 J;  4XRS G;  2L7Z A;  5IYC J;  2DA2 A;  3NI7 A;  2YU9 J;  5C4X J;  3JRI A;  2WUI A;  1X2N A;  4B1R A;  2QKO A;  1ENH A;  2O9L A;  2CUF A;  3HEF A;  1IDZ A;  4LOC A;  5EZH A;  2QF7 A;  4IHY A;  2UXH A;  4IHV A;  2M9H A;  3S5R A;  3BG3 A;  4UUS A;  1JKR C;  1TWH J;  1VND A;  1JGG A;  2NVQ J;  2Y9Z A;  1MSE C;  3ZQC A;  1HDP A;  2DMT A;  1SGM A;  3NNR A;  3CDL A;  3JRB A;  4J19 A;  3JR9 A;  5IYD J;  3E7Q A;  2XGD A;  3FKI J;  4DYC A;  3LJL A;  2O7O A;  2ID3 A;  2CRG A;  3BT9 A;  1ETV A;  3RKQ A;  1OCT C;  3V6G A;  5FLV A;  3HOW J;  4AC6 A;  1TWF J;  3LSG A;  5AQC A;  2FD5 A;  5EGO B;  3PO3 J;  3PAS A;  1QRY A;  2HXI A;  2L7F P;  5JLW A;  3I4M J;  4D5F A;  2M34 A;  2O8K A;  3ZOB A;  1WGX A;  3I4N J;  2DA7 A;  3VOX A;  2G7S A;  1BW5 A;  2UXU A;  2UXO A;  1OFC X;  3FK6 A;  2JMW A;  2PMZ N;  5HBU A;  4FCY A;  2LTP A;  1B72 A;  1JKP C;  3NAU A;  3W6V A;  3HOV J;  3WHC A;  2V57 A;  2H1K A;  3FIS A;  5E3L A;  3OIO A;  2D5V A;  3BR0 A;  3GBG A;  4M3E A;  5BNG A;  2XRL A;  1FIA A;  1UI5 A;  1FEX A;  3SDG A;  2E1O A;  2YVE A;  4XIC A;  2R5Z B;  1IV6 A;  3VW0 A;  2ELK A;  2EZI A;  2REK A;  3G1M A;  1JUP A;  2NX4 A;  3LSP A;  2H8R A;  5F27 A;  5IP6 A;  2G7L A;  2Y30 A;  3BG9 A;  1Q1V A;  2KT0 A;  5M5Y J;  1GVD A;  1ZK8 A;  2ECC A;  1BL0 A;  4DZP A;  1W0U A;  4QSH A;  4M3D A;  2DG8 A;  5FMP A;  1ETK A;  5DAJ A;  2DMP A;  2GLO A;  2JA5 J;  5EG0 A;  4FE7 A;  3VP5 A;  1A5J A;  3BR2 A;  2O7T A;  2ZOZ A;  4CYC B;  2M0C A;  5F0H A;  3COL A;  3MVP A;  2DTZ A;  1ITY A;  1ZTR A;  1AHD P;  1IUF A;  1K61 A;  1LFB A;  2RAS A;  4Y7N J;  2P81 A;  1ZGW A;  1AU7 A;  1I50 J;  2DMU A;  2AO9 A;  1B72 B;  3O8H A;  2GBY A;  4M3F A;  5FLM J;  1IG7 A;  2VUM J;  3VOK A;  2ECB A;  4JP0 A;  2NVT J;  3GTP J;  1Z0X A;  1APL C;  2DJN A;  3RQI A;  3MKL A;  3PPB A;  3H0G J;  2EQR A;  3PO2 J;  3RZO J;  2XGC A;  3KNW A;  3FRQ A;  3TW6 A;  2VKE A;  3A03 A;  5FKN A;  3WHB A;  1NK3 P;  2CUE A;  3BR3 A;  3BQY A;  3QPL A;  5JLX A;  3TP0 A;  3G56 A;  1BJZ A;  2K9Q A;  3QBM A;  1RR7 A;  4M3G A;  4NDL A;  2LP0 A;  5FKK A;  5E3O A;  1HCR A;  3HTI A;  3LWJ A;  1MNM C;  3PM1 A;  1WI3 A; 
#chains in the Genus database with same CATH topology
 1A36 A;  1T38 A;  1H8A C;  1QU3 A;  5CQE A;  1FP1 D;  2VQG A;  4XLA A;  1U5T C;  2K27 A;  1EF4 A;  2N8G A;  3DP7 A;  1I3A A;  2V7F A;  2M30 A;  4UDS A;  4UNO A;  1DU6 A;  1W5T A;  2DDB A;  2KRC A;  2W48 A;  5ED4 A;  1I6X A;  1BOB A;  4W97 A;  3QU6 A;  2VXD A;  4G6Q A;  1V5E A;  4HX8 A;  1HKS A;  5LGU A;  4YIR X;  2XSD C;  3K70 C;  1G3S A;  2AXT C;  4RAF A;  5D19 A;  2WA0 A;  3CJN A;  1CGP A;  3ASN H;  3DEU A;  2DFE A;  4M71 A;  3QKX A;  4MEY F;  1ZLK A;  1D0Z A;  3CDI A;  2ZCW A;  2IPQ X;  3CCU I;  2HQ5 A;  4X1E A;  1DGR M;  4DIQ A;  1QPI A;  2IS1 A;  1AOY A;  4CH7 A;  5IT9 K;  4RBO A;  4GDF A;  4PFP A;  2FOK A;  3JRE A;  1K78 A;  2GFN A;  3HPG A;  2VT2 A;  4XQF A;  4XOT A;  2DA4 A;  4P55 A;  5EFY A;  4BS9 A;  4IQJ A;  2IJL A;  3HUG A;  3WTU C;  1LVA A;  3A0H C;  2OUM A;  2HOT A;  3PSI A;  3H9G A;  3ZCO A;  2PMU A;  2VJI A;  4BY7 J;  1ZQ3 P;  4DVY P;  1SFE A;  4A2U A;  4RMN A;  5D6F A;  1I3Q J;  2WC2 A;  1U2W A;  3TBI A;  4OU0 A;  4LB6 B;  2KDZ A;  4MQ9 F;  5ILU A;  5DV5 A;  3OY9 A;  3BC8 A;  4KN4 X;  4NQW B;  4II2 A;  3HTS B;  3HXL A;  3WOD F;  3ZMD A;  2XDN A;  2IEK A;  3JRG A;  2UUZ A;  3HOU J;  5C3E J;  4ENN A;  3S1M J;  4XNF A;  3SZG A;  2EA2 A;  2QSF X;  4PJM A;  3ROU A;  4ENM A;  3OIQ A;  2NNN A;  3ZN1 A;  4HKU A;  1KU3 A;  5IT3 A;  4M6V A;  5L3B A;  2DN0 A;  4RB2 C;  2XAJ A;  4MEX F;  3GTM J;  4BQO A;  2W53 A;  1W7P D;  4PJL A;  4A0Z A;  4WXD A;  2IGK A;  2M5W A;  1VFC A;  4HF0 A;  4MQV A;  1O7F A;  3HTH A;  2LKX A;  4AD9 A;  4YEJ A;  1WI9 A;  3DFG A;  2E7X A;  1BC7 C;  1OCR H;  3D5R C;  1ONV A;  4KIB A;  4QTR A;  3BZC A;  2WB1 A;  2PX9 A;  4Y3O A;  3HGY A;  4N4O B;  4UUS B;  1VQ6 I;  3VW2 A;  3F0C A;  1G3Y A;  4O5V A;  2ZO4 A;  3QPH A;  2BOL A;  4AU7 A;  3IH3 A;  5D5W B;  3V7S A;  2E71 A;  2W7N A;  4OMZ A;  4I0B A;  4A0X A;  1OIS A;  1KON A;  4UHT A;  3KET A;  2GOX B;  1FTZ A;  3OYC A;  2JA2 A;  3RD3 A;  3TP3 A;  3I53 A;  2DU9 A;  2ZSI B;  1K83 J;  4RAG A;  1HXD A;  4HNV A;  4JNN A;  5HS7 A;  3LHQ A;  2IA0 A;  2NRA C;  1IJW C;  2FNA A;  3DQV C;  2CQK A;  1IF1 A;  3WTW C;  2PLY A;  4ITV A;  1WWX A;  4N4N B;  5K58 A;  2M8G X;  2P5K A;  2V9V A;  4UV8 A;  3IH2 A;  3AQS A;  1BI3 A;  1JT0 A;  1XTA A;  2K5C A;  4GFL A;  4DGW B;  1SVM A;  4G6D A;  1Z21 A;  1ZN2 A;  2Q8K A;  3IRR A;  1O57 A;  3LFK A;  4HAM A;  1T33 A;  2CQ7 A;  1J0R A;  2ICW G;  5GPA A;  5IOZ A;  4RGU A;  1OCC H;  1ETO A;  1B4A A;  5TIS C;  2TDX A;  4ME9 A;  2JUC A;  5EEH A;  2FSW A;  4A3J J;  2X48 A;  3X2Q H;  2JRM A;  1Z3Y A;  1IXR C;  3L2U A;  2KLO A;  2QVO A;  4IX7 A;  1UB9 A;  3MNL A;  4NNJ A;  1N78 A;  1IDY A;  3CRJ A;  1TT5 B;  3K7A J;  2CSO A;  2H94 A;  5CYV A;  2HKO A;  3HRM A;  2OTL I;  2J5P A;  3GZ6 A;  3CQZ J;  3H5R A;  1LQ1 A;  2X1E A;  2CH0 A;  2O03 A;  4EGZ A;  1HC8 A;  2UXP A;  4GGG A;  5EG0 B;  3N97 A;  4NEL A;  1LDD A;  4HW0 A;  2NS8 A;  3KE2 A;  4KFC A;  3MCZ A;  3F1B A;  1RZ4 A;  1QPM A;  5HAW A;  4NC8 A;  4QPQ A;  3K4J A;  2EZK A;  1QNT A;  5CQG A;  5C4Y A;  2OZU A;  4D0P A;  5GTH C;  3ECH A;  3KZY A;  1D0X A;  1JT6 A;  1DP3 A;  1KQ0 A;  4Y15 A;  5DTD A;  2F5E A;  4BKX A;  3FHN A;  3VDX A;  2L7M P;  1PUE E;  5HLH A;  1OLT A;  3ZPL A;  3QOP A;  1U9O A;  2P4W A;  2IXS A;  2K4B A;  3IRQ A;  3VOE A;  3VVY A;  2W00 A;  1KGS A;  2QKL B;  3PNY A;  2EA4 A;  3EUH C;  3NAR A;  4GFK A;  4MNU A;  1R49 A;  1E0E A;  3HBL A;  5F6F A;  3QPS A;  3TDZ C;  2DA1 A;  2FRH A;  2LY1 A;  5IP7 J;  2CGP A;  3W2A A;  2QSG X;  1K78 B;  2F07 A;  4EMS A;  1R1V A;  1RET A;  5ICC A;  2MA3 A;  3VTI A;  4UB8 C;  4B3A A;  5M5W J;  3OYL A;  2EFW A;  4EEF G;  4IRH A;  4DZJ A;  3GX4 X;  3D5S C;  4I6Z A;  1LE8 A;  3J80 K;  1OCO H;  2D1V A;  1YQA A;  1N77 A;  3BG5 A;  4M3B A;  1WFX A;  5LD2 C;  4G7O F;  5J1U A;  6PAX A;  2DFH A;  4XRS A;  2PG4 A;  2Y9Y A;  1DPU A;  2BHY A;  3D5L A;  2IRF G;  1A35 A;  3Q3S A;  3VPR A;  2I8D A;  1IC8 A;  5GAG J;  5CVU A;  5BPD A;  3Q0V A;  1LFU P;  4ZH4 F;  5M3F J;  3G1O A;  2G7U A;  5FGM A;  2F5D A;  4EJU A;  1WJ5 A;  3KEY A;  3O6B B;  4HA8 A;  3GFL A;  4BHB A;  2F5V A;  4N9H A;  3OL3 A;  5B1A H;  4BHP A;  1QVU A;  1REP C;  4RAZ A;  4A6D A;  4YFN F;  3BTJ A;  2LBF A;  1BR1 A;  3M3Y J;  2NS7 A;  1ZAR A;  2NOG A;  3HOZ J;  3SJM A;  2WB1 N;  3BWG A;  1YIT I;  4ANJ A;  2DOE A;  2ZBK A;  4UXN A;  5LRR A;  2VJJ A;  1HW1 A;  1YJN I;  3HTU A;  2CU7 A;  3RDI A;  3GME A;  3DEW A;  1NTC A;  2XAF A;  3OS0 A;  3CCV I;  4CGZ A;  1WSU A;  2HYF A;  3LAP A;  2QIB A;  4ZYE A;  5F04 A;  4XSZ F;  1YIO A;  4XKB A;  3NPI A;  4FX0 A;  2OC6 A;  1JGS A;  1VQ5 I;  5KVR A;  1Z67 A;  4JX5 A;  4JQF A;  2HPM A;  2JVG A;  3KP5 A;  3KYL A;  2MC4 A;  4PZJ A;  2ZCN A;  4GCT A;  2DT7 B;  2QWW A;  3BZK A;  3EPZ A;  3O2P E;  1WCM J;  5EGO A;  3R6S A;  3F21 A;  3RQ4 A;  5D5X B;  3LNQ A;  3ANG A;  1HW5 A;  4CDG A;  4NBQ A;  2G0E A;  3V7R A;  2X4H A;  4ZYA A;  2A3S A;  1VQ4 I;  3RKX A;  3ZRG A;  3H0D A;  1USS A;  5FHP A;  2PMH A;  1RUN A;  2XAH A;  2ELJ A;  1ETW A;  3Q9S A;  1POG A;  3DBL B;  2VBW A;  3S3N A;  1ZR4 A;  3VVX A;  3P9I A;  1XGM A;  3F23 A;  3CTA A;  3R60 A;  2KIQ A;  3L2W A;  3GLL A;  4ZTJ A;  3I59 A;  2STW A;  1BM9 A;  2EFQ A;  2P0W A;  1YRN A;  4OIO F;  1ZG1 A;  2E35 A;  3QP5 A;  2PI0 A;  1X19 A;  2HTJ A;  2R7O A;  4A3G J;  4BEH B;  3AG2 H;  2XF6 A;  2CQX A;  3MD2 A;  3EDP A;  3GFI A;  2YX4 A;  2OZ6 A;  3S16 J;  4XRS G;  2DA2 A;  3NI7 A;  2QLZ A;  3HSR A;  3KP3 A;  4OIP F;  1FOW A;  3JRI A;  2WUI A;  4B1R A;  3NS4 A;  3HEF A;  1Y56 A;  2RGV A;  3ZXS A;  3OIP A;  1V3F A;  2UXH A;  4WCG A;  1XSX A;  1T08 B;  3SZP A;  5L3F A;  3U1D A;  4XKW A;  2KIF A;  3K69 A;  4XLH A;  2KKO A;  1BI0 A;  2MAB A;  1H0M A;  3ZQC A;  2K4J A;  5FRO A;  1SGM A;  4YFX F;  2IVM A;  3EET A;  3M7G A;  3AL0 C;  2EV0 A;  2ZFU A;  5IYD J;  1W36 D;  4DYC A;  1W36 C;  2ID3 A;  3R0A A;  4HNU A;  5D8L B;  5FLV A;  4AC6 A;  1KU2 A;  3LSI A;  4E6K G;  3I55 I;  1QRY A;  2L7F P;  5H6R A;  3VSK A;  4EJO A;  3IKT A;  3LA3 A;  2O8K A;  1R1T A;  3RTR A;  5EJC A;  3ZOB A;  3JSO A;  2X85 A;  3FX3 A;  5E17 F;  2Q2E A;  3V42 A;  2BXY A;  2M1B A;  2UXO A;  1JHF A;  1OFC X;  3VFZ A;  2JPB A;  2MD0 A;  2RN7 A;  4FCY A;  2O5R A;  4GYI A;  3I4P A;  1Z3X A;  4EM2 A;  1C0W A;  1HKT A;  3LQQ A;  3PFY A;  3HOV J;  2H09 A;  2V57 A;  2KHM A;  2BV6 A;  4HV6 A;  3TO6 A;  1T0F C;  2XRL A;  3AG3 H;  2XVC A;  3UNG C;  1FEX A;  3F8C A;  1LB2 A;  1ZAO A;  3DTK A;  4HLX A;  2M87 A;  5FLX Z;  3HG9 A;  2DTR A;  2O61 A;  4BAY A;  4HQM A;  3ERM A;  1GHC A;  3VW0 A;  1V4R A;  3SHF A;  2V79 A;  2REK A;  4EVI A;  1B6A A;  5E20 A;  2QZ8 A;  4C2T A;  5J4V A;  5LLQ A;  3BG9 A;  2KT0 A;  3CCR I;  1ZK8 A;  2OU2 A;  2ECC A;  1RNL A;  5F64 A;  1VQ8 I;  4HPQ A;  4DZP A;  2F4M B;  5FMP A;  5DAJ A;  3JCU C;  2GLO A;  2MYS A;  1S29 A;  2A6E F;  3EUH A;  4CYC B;  1R7J A;  3COL A;  2A5Y B;  3OYH A;  2VJ4 A;  2A07 F;  4LGW A;  4RB0 A;  2XV4 S;  2DMU A;  1B72 B;  2ELH A;  2O3F A;  3E5Q A;  4RGX A;  2VT3 A;  5JVG F;  3DEE A;  3MMY B;  4RB3 C;  4XLE A;  1SAX A;  2VUM J;  1SVO A;  2HGC A;  4HEA 2;  2H27 A;  2NVT J;  1Y8Q B;  3OYK A;  1APL C;  1W7P A;  4C2U A;  3PPB A;  3KCC A;  2ZNZ A;  5FKN A;  3Q5F A;  2IT0 A;  1P2F A;  2DOA A;  3E97 A;  2EJR A;  3SWH A;  4NDL A;  2P5V A;  1HCR A;  2IGO A;  1MNM C;  4E70 A;  3PM1 A;  4D7N A;  4YEL A;  3FK7 A;  1EKE A;  5F1R A;  5J1Y A;  3HOT A;  4II3 A;  2VKV A;  4R1H A;  1UCR A;  2BXZ A;  3I58 A;  1HST A;  2RAE A;  3VUQ A;  1ZGJ A;  3H9J A;  5K5Q A;  1HQC A;  1RI7 A;  3E5U A;  2DYS H;  4XM3 A;  1LUJ B;  1JUS A;  3SZT A;  4QLC U;  3MEX A;  2Z2S B;  1S7A A;  2E1M B;  1U0J A;  3FKJ A;  2ISZ A;  3RH2 A;  2GIV A;  2PBX A;  2V1X A;  4IHS A;  4A0Y A;  1O3Q A;  2XB0 X;  3SEZ A;  3WTY C;  3OYF A;  2VOD A;  5HS8 A;  1BR2 A;  3FXK A;  2ZY9 A;  2KJB A;  2OF7 A;  4WXH A;  2AQF A;  4M72 A;  2BE5 F;  3F8M A;  3FXL A;  2A61 A;  2E19 A;  4KMF A;  2FML A;  2DA6 A;  4U0W A;  1HBX G;  1S7O A;  5E8G A;  5FKL A;  1VQK I;  4FIS A;  4G94 A;  4FTH A;  2HVR A;  4DBR A;  1VF9 A;  2A5W A;  3DCF A;  3D1N I;  2Z9O A;  3L00 A;  3ONQ A;  2FQ3 A;  1Z77 A;  3S1R J;  3BZ6 A;  4PXI A;  4IHW A;  3DKW A;  4U88 A;  1IXC A;  2W85 A;  3OYD A;  3F8B A;  4YRV A;  3ASO H;  1YIJ I;  2BY3 A;  3VEP A;  4YIF A;  4ZC3 A;  1F5T A;  3HYI A;  2LYC A;  2JA7 J;  3S2W A;  3G71 I;  3HDD A;  4KMU X;  1QZZ A;  1MDM B;  4HZF A;  4XRM A;  2GWR A;  2CYY A;  1JJ8 C;  1O4X A;  3BR6 A;  3PUB A;  5CVJ A;  3U9G A;  2G3B A;  2L7K A;  3S32 A;  2R7X A;  3PIO F;  4JKZ A;  4Q47 A;  1XMX A;  1B8I A;  3C2B A;  2ZJ2 A;  2HWV A;  1IGN A;  2BBY A;  2DOF A;  3KFW X;  5K7F A;  2G7H A;  4Y52 J;  2DOD A;  1O3T A;  4KIF A;  3CCE I;  1XX5 A;  1SAN A;  2MG4 A;  1Z7L A;  1JHH A;  2BVL A;  4KWA A;  1XD7 A;  1QO0 D;  4AIH A;  1GVJ A;  5TJJ A;  2DPU A;  3S2H J;  4XLF A;  2D1H A;  1MBH A;  1R5H A;  4M6Y A;  1SFK A;  3TDU C;  3IUV A;  3M4O J;  4AIJ A;  1XCB A;  1DQU A;  3BCG A;  1N25 A;  5CVI A;  2E1N A;  5FFZ A;  3ABT A;  3TO9 A;  3U1K A;  3EYY A;  2A6T A;  3FIW A;  3U21 A;  2PBI A;  4E7I A;  4JK1 X;  1FLI A;  1MBG A;  5DS9 A;  1VQ9 I;  3PSF A;  3C7J A;  1G59 A;  2J5O A;  2F4O B;  1K6O A;  4BNC A;  3GZN B;  2YVX A;  4RM3 A;  4CSW A;  1YOV B;  1JKQ C;  3ECO A;  5H2F C;  1WRJ A;  2FBK A;  4CA0 A;  4ZZL A;  2MGQ A;  4AID A;  3K10 A;  3CMM A;  3OS2 A;  2CG4 A;  2E2J J;  1J75 A;  2VPR A;  3TGN A;  1MJB A;  2BHZ A;  2CS3 A;  4UUT A;  4CIC A;  1GXP A;  3K4M A;  3RKW A;  3ON4 A;  4BDZ A;  1WPK A;  3BG6 A;  5J47 A;  3EYI A;  4KIT B;  1V5G A;  2ZME A;  2FQ4 A;  4P9F A;  3OSG A;  1CF7 A;  1EH7 A;  3F8F A;  3WE2 A;  2PJR B;  2D6Y A;  1PUF B;  4L62 A;  4V2G A;  4FQG A;  3OYA A;  1KA8 A;  2VE8 A;  3DBH B;  4XK4 A;  4PGH A;  1U3E M;  2CFO A;  4B48 A;  1L0O C;  2JPC A;  1X3U A;  3MQ0 A;  1WJD A;  4KDP A;  2WV1 A;  4BXF A;  3WGI A;  3S8P A;  5IPA A;  2LVS A;  2R7Z J;  4M9X A;  2CW0 F;  3KKD A;  1K79 A;  3HL2 A;  2W24 A;  3J80 Z;  2XAS A;  2V6E A;  2LY9 A;  3N05 A;  4XKV A;  1E17 A;  3JRC A;  3CCL I;  2HS5 A;  1OCP A;  3WTZ A;  2PN6 A;  1MSF C;  5M3M J;  5JFR A;  3S1N J;  1FX7 A;  2QYO A;  1OMI A;  2HDW A;  1I1G A;  2VQH A;  1R9T J;  4S05 A;  1NK2 P;  1ZEL A;  2OQR A;  3LSJ A;  4F91 B;  4J00 A;  3EGQ A;  1IRZ A;  3HOX J;  1ORK A;  2M4K A;  3QAH A;  5J4Y A;  2KRF A;  5DD8 A;  4GXO A;  5B1B H;  4I0A A;  2NNY A;  2PJR A;  2GXB A;  1P4A A;  2FUG 2;  4ZJZ A;  1AKH B;  2DMQ A;  1F43 A;  2GUH A;  2CO5 A;  2XAQ A;  5FLX K;  3OL4 A;  1P9Q C;  4UY8 I;  2L4A A;  4LFU A;  4Q4Z F;  2UZK A;  1BN5 A;  1U5T B;  5EDN A;  2JWT A;  1FNN A;  2X6Y A;  2XDV A;  1IRG A;  3OS1 A;  1XB4 A;  3DPJ A;  3F8N A;  2NS0 A;  5IOY A;  4XOP A;  2WAQ N;  4X6A J;  4BBR J;  2RC4 A;  2LY2 A;  2WY7 Q;  3HB9 A;  3JAM K;  5ERI A;  4JX4 A;  2EBI A;  4CZZ A;  3OOU A;  3ISP A;  4EJW A;  2OJE D;  2EFN A;  2WAF A;  5GAH J;  1UMQ A;  4LIU A;  5J40 A;  2VJ5 A;  2ZXI A;  3C07 A;  2M2E A;  5D18 A;  5EYR A;  2ME6 A;  4CXF A;  2Z3Y A;  5L3D A;  2NVU B;  4X0G A;  4HOB A;  4HV5 A;  4DW6 A;  1TQM A;  2Y0M A;  2O8X A;  1ULY A;  2CMP A;  2DFI A;  4PUS A;  2FX0 A;  4PJ0 C;  3GO5 A;  4PJJ A;  4WF2 A;  3CUQ C;  3VB2 A;  3A01 A;  3PNT A;  1IAW A;  3H36 A;  1GDT A;  3FBI B;  2XPW A;  1LJ9 A;  1X58 A;  3GTO J;  2ZJP F;  2OA4 A;  3CMA I;  2V26 A;  4YZE A;  4B8X A;  2VBY A;  3BTL A;  2LKS A;  2H6C A;  3QP6 A;  2W57 A;  1S3J A;  4AC0 A;  1FIP A;  2F2E A;  1LKX A;  2LBF B;  2KL4 A;  4BBS J;  4FE4 A;  4I09 A;  4C3J J;  2M4G A;  3UR3 C;  1JXS A;  2XB5 A;  9ANT A;  2R7D A;  4BYY A;  1BR4 A;  1X1B A;  1E2X A;  2Q24 A;  4HX4 A;  3T0Y A;  5IY5 H;  2KDO A;  4I02 A;  1PP8 F;  4MK6 A;  2LRE A;  3DKY A;  4LG0 B;  2FF4 A;  2LR8 A;  3OSF A;  1YE9 A;  1UFM A;  3BCB A;  2HNH A;  1S5L C;  4HYE A;  3WU0 A;  4RDU A;  2G7G A;  1KU9 A;  2ZFW A;  4FT8 A;  2YPR A;  4D9J A;  3CJQ B;  4I01 A;  1LE8 B;  2ZXH A;  2YS9 A;  4XMY A;  4IKF A;  1SFO J;  3ZMV A;  3HIF A;  3AKZ A;  2Z99 A;  2CV2 A;  3K4C A;  2QQB A;  4I99 C;  4OIN F;  1BW6 A;  1WQ2 A;  3DXJ F;  2E2H J;  2MLG A;  2OTJ I;  2D2W A;  3BCA A;  4ZYD A;  4C30 A;  3F6V A;  2O0Y A;  3KP7 A;  1MBE A;  3G1L A;  1ETY A;  3I0T A;  3T1B A;  1TW2 A;  2JRT A;  4ABZ A;  2VXZ A;  4U7D A;  1P4X A;  4BDY A;  2VI6 A;  2L2O A;  1LEB A;  2ZCM A;  3L2R A;  4DQ2 A;  3MZY A;  3I3L A;  1BJA A;  2OI8 A;  2BEO A;  2L7Z A;  3FF5 A;  5IYC J;  2YU9 J;  1W5S A;  2H6B A;  4NC7 A;  2QKO A;  2OV7 A;  2CUF A;  1OCZ H;  4BJ5 C;  1IDZ A;  1LEA A;  3MWM A;  4Y17 A;  4IHY A;  4EAT A;  2M9H A;  3S5R A;  3BG3 A;  4UUS A;  1JKR C;  1TWH J;  2DI3 A;  1VND A;  1O3S A;  2P8T A;  4F7Z A;  3KPH A;  1HDP A;  2K9M A;  4OMY A;  2DMT A;  2H1L A;  3ZQ7 A;  4WX9 A;  2GA2 A;  4MTD A;  5H6Q A;  3LA7 A;  1KZH A;  4OOI A;  4I7H A;  4ESB A;  3E7Q A;  3FKI J;  3FXU A;  3RPU D;  3LJL A;  2O7O A;  2MBF A;  4YG2 F;  3I9V 2;  3F9K A;  2XRN A;  3GCM A;  1R58 A;  1TWF J;  5AQC A;  2M45 A;  2FD5 A;  5EGO B;  1Z6R A;  1QGP A;  2DAO A;  1XMA A;  4D5F A;  3BJO A;  4ZZD A;  1WGX A;  3BPV A;  2VN2 A;  2G7S A;  1Z05 A;  2IA1 A;  2UXU A;  2IP2 A;  3K70 D;  1VQN I;  2JTV A;  2EB7 A;  5JHF A;  4KIC A;  3FK6 A;  5E1W A;  2PMZ N;  2VLA A;  2STT A;  3I64 A;  2Z1D A;  1PJR A;  1B72 A;  3NAU A;  2HEO A;  4R8H A;  2DK8 A;  4CCK A;  5LBQ A;  5E3L A;  4ETS A;  3AG4 H;  3TL4 X;  3C3W A;  2L9V A;  4M3E A;  2FBI A;  2V4J C;  5HLT A;  2Y69 H;  2KJC A;  4V19 K;  2R5Z B;  1XSD A;  2ESN A;  1IO2 A;  3G1M A;  4GCV A;  3GEZ A;  4ESF A;  2NX4 A;  1ZG3 A;  2ESH A;  2V1D A;  5F27 A;  5IP6 A;  1IRF A;  4B47 A;  2Z16 A;  2OCC H;  1XGN A;  2G7L A;  2VQC A;  4L9T A;  3VSL A;  5E1X A;  4AYB A;  5DUI A;  3CC2 I;  5AIQ A;  2A05 A;  3REO A;  1LDJ A;  1BL0 A;  1W0U A;  1W4M A;  4CHU A;  3GW2 A;  4QSH A;  3RI4 A;  1R00 A;  2DG8 A;  2BY2 A;  1MMA A;  2Y48 A;  1NHA A;  1UEL B;  2GOM A;  4HLY A;  1ETK A;  2HDC A;  2DMP A;  5EG0 A;  4FE7 A;  1A5J A;  1MZB A;  2O7T A;  2Y0S A;  3PFI A;  4IJA A;  5LHI A;  2OCE A;  3OR2 C;  5HNF A;  2B0L A;  1ITY A;  2XKO A;  1ZTR A;  1OYW A;  5KNL A;  1B9N A;  1IUF A;  2EIK H;  1KU7 A;  4Q5S F;  3V7C A;  2DQR A;  2P81 A;  3AL0 B;  1Z7U A;  2FXA A;  3CCS I;  4M3F A;  4BE1 A;  1BI1 A;  5FLM J;  3GF2 A;  1IG7 A;  3VOK A;  3HZJ A;  4I98 B;  1EH6 A;  3V8J A;  1T8I A;  2ECB A;  3C2G A;  4HST A;  4IF4 A;  4ENJ A;  1VZ0 A;  2L5Q A;  5E79 C;  3GTP J;  3LSM A;  1EV7 A;  1R5I D;  3RQI A;  1KQ9 A;  4BQA A;  3PO2 J;  2VKE A;  1UZC A;  1YX3 A;  3A03 A;  1MJ9 A;  1XMK A;  2DYR H;  2L01 A;  1OR7 C;  5LEJ A;  4NHJ A;  3RYR A;  3E6D A;  5JLX A;  1ACI A;  3G56 A;  4CO8 A;  4M3G A;  2LP0 A;  5FKK A;  4A12 A;  3HTI A;  3F3X A;  3JRH A;  4A5M A;  2DFF A;  2XGE A;  1BI2 A;  1X1P A;  3RIR A;  1KYZ A;  3O60 A;  2QSH X;  2LDU A;  2EWN A;  5ILS A;  2P6S A;  1MMN A;  1YW7 A;  2AHQ A;  1Y0U A;  1FBU A;  1TTY A;  1TNT A;  4B43 A;  2IW5 A;  4UVA A;  5FKM A;  1DGW Y;  3ZMZ A;  3BTC A;  2LF7 A;  3VYU B;  1JTX A;  3BR5 A;  3G3Z A;  3K1N A;  5FGL A;  3OWT A;  1VTN C;  3CWR A;  1WKM A;  1FT9 A;  2ZC2 A;  3MZ8 A;  1BC8 C;  1ZRF A;  2DLL A;  2LKP A;  2EPF A;  1J5Y A;  3SFI A;  3QYF A;  5J3L A;  4KN7 X;  3HE0 A;  2KIS A;  3JRF A;  2PFV A;  3C18 A;  2GIZ A;  3C2H A;  1JUM A;  2R92 J;  1RUO A;  2Q2E B;  2HOS A;  2XHK A;  4U9N A;  1TQI A;  4IHT A;  1P7J A;  2FEZ A;  1MH4 A;  3OR1 C;  3JRD A;  2CW7 A;  2C6Y A;  4ACI A;  4XLP F;  4U87 A;  1DP7 P;  3QQA A;  2MD5 A;  4N9I A;  1XGO A;  2LLK A;  3HTA A;  4G9Y A;  2LNB A;  2IAI A;  4AUX A;  2V9P A;  2GQQ A;  3ZMU A;  5HLG A;  4KIS A;  2XKP A;  5IYB J;  2GXA A;  1A04 A;  3FXM A;  1RKT A;  2BY0 A;  2QOP A;  3P9K A;  2YUS A;  3HKZ N;  4L5I A;  1G3W A;  1D0Y A;  1QVT A;  4KA4 A;  1YLF A;  1XN7 A;  4IXA A;  5GAE J;  1U8R A;  1HKQ A;  4IHX A;  3CF2 A;  3CC7 I;  2QEX I;  1TNS A;  2VOP A;  5KK1 A;  2HVS A;  1HA8 A;  2ZXW H;  4UUV A;  2EIL H;  1X1C A;  4K2E A;  5E3M A;  4A3B J;  3N4M A;  2NP3 A;  4TV7 A;  2ZKZ A;  2RQP A;  4D1Q A;  4MO7 A;  2HOA A;  1Z9C A;  2PMZ A;  3ZQQ A;  2WAD A;  2ZOY A;  4ZDP A;  1EJ9 A;  4RA2 A;  3GYH X;  2P7V B;  2HXO A;  3VOD A;  5K7Z A;  3MKZ A;  1G2H A;  4CUG A;  1R36 A;  4MIM A;  4JYK A;  3OYB A;  4E7K A;  1MMS A;  3JSJ A;  1SFX A;  1WJC A;  3B73 A;  1HDD C;  1K6Y A;  3CES A;  3K4K A;  3WGH A;  4B09 A;  4BY1 J;  2XPU A;  3EQL F;  4EQQ A;  4KJZ A;  1AKH A;  3W2W A;  3BTI A;  4ZDL A;  1TT0 A;  2JJ7 A;  3L2V A;  4BE2 A;  3IAS 2;  2V1N A;  3ERE D;  2DO7 A;  3H35 A;  2ZNY A;  5FKO A;  3TKY A;  2FJI 1;  2EZH A;  1D1B A;  1BOA A;  2ZB9 A;  1Y1W J;  3IL2 A;  3K1P A;  5CVV A;  4DBQ A;  4MFD A;  2DCE A;  1RKW A;  3FM5 A;  1F9N A;  3NWT A;  1JI8 A;  2ZCX A;  1RC9 A;  4E7J A;  2X6X A;  1ETQ A;  3IKV A;  1P7I A;  2CUJ A;  5LHG A;  4PJN A;  4JBA A;  5FJ8 J;  2GAU A;  1OYY A;  3S3O A;  1IZ1 A;  3J7A O;  2F6C A;  3M1E A;  3H92 A;  5IP9 J;  3AQT A;  1UG2 A;  4Z2Y A;  3GEU A;  5F08 A;  2KIM A;  5D5V B;  1IN6 A;  3L2C A;  1MMG A;  4F52 A;  3S3M A;  3BJB A;  2LC2 A;  2DQL A;  2ID6 A;  5J1R A;  4CCN A;  2X6O A;  2MH9 A;  2Y2Z A;  2HOE A;  2MH2 A;  2IS6 A;  1XC5 A;  4WIB A;  2KQR A;  3V4G A;  5ICE A;  2NVY J;  4H4K C;  2QWT A;  1FMV A;  3M9A A;  4UVB A;  4BGD A;  1XCV A;  5F0F A;  1S72 I;  3CC4 I;  5BOX A;  2Y31 A;  2DPD A;  2DG7 A;  3TW7 A;  2DA3 A;  4W1U A;  1VQP I;  4HNT A;  4WWC A;  2MSY A;  5DCF A;  4XR6 A;  3B6A A;  3OV8 A;  3H3V K;  3VYS B;  2JVH A;  5EF6 A;  3BHQ A;  2Q1Z B;  3BLY A;  4CCM A;  4RS8 A;  1E3O C;  2ME0 A;  2OBP A;  3LL7 A;  2VQL A;  3G73 A;  1U78 A;  4HRI A;  2FOW A;  1T6S A;  2OQG A;  4F92 B;  4A69 C;  1IN4 A;  4IRG A;  2HQR A;  1MNE A;  2XPV A;  4XSX F;  5F0C A;  2JSC A;  1IN8 A;  3RSN A;  2ZXJ A;  4Z6Y A;  4RLF A;  1WJF A;  2ACJ A;  2IU5 A;  2F5C A;  3FHZ A;  4UVC A;  3HM5 A;  1V55 H;  1ZYR F;  3VVZ A;  3JTH A;  4E7S A;  1Y0N A;  3G2B A;  2FNP A;  4LLN A;  2CWE A;  2E60 A;  4HF1 A;  2OER A;  2HTS A;  1TL8 A;  2W1O A;  2L0K A;  3BRU A;  3RJP A;  5K1Y A;  1X1A A;  3QU3 A;  2PEX A;  4XL9 A;  5HDN A;  4P5O A;  4D5C A;  2X0L A;  4KT6 A;  3GTK J;  2R3S A;  3KZ9 A;  1MMD A;  3HPH A;  2KMU A;  3DWL E;  3KP4 A;  3WG9 A;  3KLN A;  1UHW A;  3DV8 A;  3ZQG A;  2DW4 A;  5K7H A;  2NYX A;  3FMR A;  3O8G A;  2GEN A;  4O6J A;  1DDN A;  1S7E A;  1FOY A;  1QHG A;  4AWX B;  4MHG A;  2IA2 A;  5JR3 A;  1M1E B;  3E3V A;  1IN5 A;  1I27 A;  2YU3 A;  3ZQL A;  3VIB A;  1XS9 A;  1VI0 A;  3MZH A;  1FYM A;  1Z91 A;  1X4P A;  3A02 A;  1Q1H A;  1MBK A;  1I5Z A;  1UI6 A;  1OJL A;  3DLA A;  5TRD A;  1RIO H;  4HDV A;  1GLN A;  1IV8 A;  1ON1 A;  1WH5 A;  4LLL A;  1D8K A;  2QEN A;  3HGG A;  3CP8 A;  2A69 F;  3I71 A;  2XSJ C;  2F48 A;  3AFH A;  4P9U A;  2JA6 J;  2CUZ A;  4A3E J;  4L0Y B;  1CQT A;  3TMO A;  1DU0 A;  2HU9 A;  1SVL A;  5LHH A;  2VE9 A;  3NWS A;  3ZN0 A;  2NXN B;  1XPX A;  5J8F A;  1Y39 A;  4C2M A;  3C1D A;  3L7W A;  2B7E A;  2K02 A;  3DPL C;  3B6C A;  1TZL A;  3P9T A;  2HI3 A;  3SEQ A;  4OD5 A;  5D6E A;  4XN0 A;  4YII A;  2XRO A;  4Y13 A;  4GCL A;  3E1S A;  2MW8 A;  2LOO A;  1ZRC A;  5FRM A;  4PCQ A;  3E6C C;  5TGT A;  2LF8 A;  3LQR A;  1YJW I;  3BQZ A;  3ON2 A;  2R7W A;  1X1D A;  2QCO A;  3ABK H;  3S93 A;  3T6N A;  1TC3 C;  3DBR B;  1H88 C;  3CCM I;  4F93 B;  3BJA A;  2L3D A;  2HPI A;  1RES A;  2VC1 A;  3KP6 A;  5E3N A;  1FSE A;  2R7Q A;  5LGT A;  4HDU A;  1ZG5 A;  4DJA A;  4AYB N;  1W1W E;  4KNY A;  3CJR B;  4IO9 F;  3W2V A;  2BGC A;  4CZC A;  3SYT A;  2HVQ A;  2RRE A;  5FRN A;  2CQQ A;  1YW8 A;  2K9N A;  2K9S A;  3S2D J;  3M8E A;  1FSH A;  2Y0S N;  3IC7 A;  1FJL A;  1XSV A;  3KIO A;  5AON A;  2YVH A;  3QYE A;  4HG2 A;  5DDG A;  3P5J A;  1MDM A;  5CXG A;  1P4W A;  2JT1 A;  4IRI A;  3ZQH A;  2E5Z A;  2W4S A;  5HNH A;  1PP7 U;  4E7H A;  2VAS A;  5DUK A;  1ON2 A;  2FE3 A;  4AM3 A;  2RNJ A;  4BHC A;  1RRJ A;  3D0S A;  3GZ5 A;  3S14 J;  2W84 A;  4Y33 A;  1YI2 I;  3CUQ A;  3K1M A;  2B63 J;  5H20 A;  1MBJ A;  1I39 A;  3QRF F;  1R4N B;  3RZD J;  4RM2 A;  1BBY A;  2Z5U A;  4JL3 A;  2QQA A;  1YFH A;  4A3D J;  2ETH A;  2L4M A;  3E5X A;  3KYC B;  5K5R A;  3W6K B;  5C4X J;  1SC7 A;  1X2N A;  1ENH A;  3CO6 C;  4OWR B;  2O9L A;  5FB2 A;  4LOC A;  5EZH A;  5AIP A;  3L9F A;  3CUO A;  1YS7 A;  4M74 A;  5FD5 A;  4AIK A;  2UXX A;  2YSR A;  1ZH5 A;  2NVQ J;  3HSE A;  2R7S A;  3E6B A;  3SFZ A;  3CDL A;  4LD5 A;  1N75 A;  2RKH A;  2WY8 Q;  2EIN H;  3SXY A;  5GAD J;  3OYN A;  1SD7 A;  3BG7 A;  4J19 A;  3RCO A;  1MJA A;  1WJA A;  4GRI A;  2XGD A;  3JR9 A;  4CYD A;  3HJE A;  3GXO A;  3ZMT A;  3TO7 A;  2V1U A;  3JW4 A;  3H5A A;  4GO1 A;  3BT9 A;  1ETV A;  4PDK A;  3RKQ A;  1OPC A;  3CP2 A;  4U0V A;  1OCT C;  2CFX A;  3Q9V A;  4CCJ A;  3LSG A;  5KHD A;  3PO3 J;  1PVE A;  5JLW A;  3I4M J;  1B9M A;  2BYV E;  1T98 A;  2M34 A;  3DU6 A;  2DA7 A;  3H3Z A;  3QWL A;  1YHQ I;  4FET A;  2EIM H;  4LIV A;  1BW5 A;  2ZME B;  1CF7 B;  5CPR B;  2JMW A;  3LSK A;  2LTP A;  3IHU A;  3FXQ A;  5HVQ C;  3W6V A;  3R61 A;  1JKP C;  2M7A A;  2ZJR F;  1NH3 A;  2BY1 A;  3WHC A;  3IWZ A;  3BPX A;  1SAU A;  5BS6 A;  2H1K A;  1FWZ A;  3FIS A;  1G6N A;  1Z6T A;  1FPQ A;  4EGY A;  3OIO A;  2D5V A;  3BR0 A;  5BNG A;  1P92 A;  4IZZ A;  1FIA A;  1W7P B;  3SDG A;  2E1O A;  4RB1 A;  1QZY A;  1IXS B;  5K5O A;  1MKM A;  1PYV A;  2HZD A;  3OYG A;  4XIC A;  2YVE A;  4G7Z F;  1IV6 A;  2RNG A;  1XDU A;  3ESW B;  3MFK A;  1LPQ A;  3A0B C;  4UV9 A;  1PDN C;  4M6X A;  1MD0 A;  3V8L A;  2AXL A;  3H9Q A;  3ABM H;  3WG7 H;  2VL8 A;  2XAG A;  4M3D A;  5J6X A;  3OYM A;  4XLN F;  4MGR A;  4ZDO A;  3K8P C;  1O3R A;  1J59 A;  3E6M A;  5HOO A;  2KFD A;  2EFO A;  1OYI A;  2M0C A;  1X3W B;  2VBX A;  4G7H F;  3OYJ A;  3K4N A;  4HSR A;  4QWQ A;  2KP6 A;  2DTZ A;  2DJI A;  4OIR F;  5E18 F;  4BUP A;  1K61 A;  3KLO A;  3LMM A;  2RAS A;  2BZT A;  1AU7 A;  1I50 J;  2O6G E;  3FDY A;  5ICF A;  2LRD A;  3NEU A;  1TQP A;  2E36 A;  3O8H A;  2GBY A;  1FC3 A;  3I54 A;  1UHM A;  1F4K A;  3CD6 I;  4JP0 A;  1DPR A;  1ODD A;  2V9K A;  2MC3 A;  1Z0X A;  4ZYH A;  1IN7 A;  2DJN A;  3E0J B;  3B02 A;  3H0G J;  2CV0 A;  1W5C C;  3J7Z I;  4NB5 A;  1U5T A;  4XRF A;  3PIP F;  3QPT A;  3WHB A;  3QOE A;  3BR3 A;  3BQY A;  3QPL A;  3K0L A;  3VWB A;  3TP0 A;  1BJZ A;  2JSP A;  2K9Q A;  3QBM A;  5E3O A;  3A1Y A;  3LWJ A;  4P96 A;  2AQE A;  1WI3 A;  3K4L A;  1A6I A;  4G12 A;  2CJJ A;  2EZL A;  4KIG A;  5CKT A;  5HDG A;  1TWG J;  3FBN B;  3KZI C;  4ZTF A;  2WV0 A;  1H9T A;  4IRV A;  4A5N A;  2YR2 A;  2QQ9 A;  1D1C A;  3GLX A;  2DXI A;  1U9N A;  2I10 A;  4BXX J;  3ULQ B;  3RPU A;  3TED A;  2FA5 A;  5L3C A;  1O7L A;  5EEG A;  3BP8 A;  4MTE A;  3ZR8 X;  4NQW A;  1TP4 A;  2I5U A;  4DYQ A;  1SMY F;  2KPM A;  2OPT A;  4L5J A;  2DT5 A;  5L3E A;  2HQN A;  4QPO A;  3CJD A;  4ZYG A;  2R0Q C;  3F72 A;  4I2O A;  2WAQ A;  1FMW A;  1T39 A;  4P1W A;  2IGM A;  2R7V A;  4IOC F;  1TLH B;  5C4J J;  1R71 A;  3S15 J;  5B66 C;  1ZKG A;  2HZT A;  4JOM A;  2OAZ A;  3O3K A;  2B9S A;  2QM3 A;  2R7R A;  5HOD A;  2ZME C;  1MGT A;  5KAF C;  3GFM A;  3F22 A;  1FP2 A;  4WK8 F;  2YX7 A;  3DF8 A;  3VYR B;  1YRN B;  1TW3 A;  4F55 A;  2VC0 A;  1X3Z B;  2JK3 A;  4GFB A;  5M5X J;  2A2F X;  3OMY A;  5LEK A;  1P6R A;  2K86 A;  3LAJ A;  1UAA A;  2ZJQ F;  2UXI A;  4LG0 A;  2FBH A;  2R7T A;  2NVX J;  2VB6 A;  1JKO C;  4BE0 A;  2R93 J;  2VBZ A;  4JX6 A;  3HIM A;  3ZP5 A;  4D7M A;  4C3H J;  2TRT A;  1DUX C;  3GTL J;  3GTQ J;  1SD5 A;  4HX7 A;  2JA8 J;  3FXO A;  2RDP A;  2LD5 A;  2VON A;  1TWA J;  1LVK A;  3PL8 A;  2OD5 A;  1B1B A;  3RPQ A;  3LSH A;  4O3M A;  5D5U B;  3K9T A;  2E1M C;  3IV5 A;  3G6E I;  1F1Z A;  1UST A;  3P9C A;  2F5F A;  1J7K A;  1KQ8 A;  3ELK A;  2PZ9 A;  4V2F A;  2IS4 A;  1XG1 A;  3COA C;  3HHH A;  4U9L A;  2V6C A;  3MN2 A;  2LK2 A;  2LMD A;  4NUB A;  2WGB A;  3GWZ A;  3LWF A;  2KIU A;  4XBF A;  3AG1 H;  3HOS A;  4B44 A;  4KYW A;  3PJR A;  4I76 A;  2Q0O A;  3GZI A;  5H9T A;  1SD4 A;  2CW8 A;  3BR1 A;  1YTY A;  4YFK F;  1H89 C;  2K7L A;  1ZRD A;  1H9G A;  3J7A Y;  1YG2 A;  3JTG A;  2KZV A;  3PNV A;  4IEJ A;  1HSJ A;  4C2M J;  2ZSH B;  3BY6 A;  3HUG B;  1MH3 A;  4DNC A;  3L2Q A;  2GM4 A;  3CCJ I;  2DDA A;  1YW9 A;  3P7N A;  2E7W A;  2A68 F;  1J9I A;  3IAM 2;  3EUK L;  3TOB A;  4R79 A;  5CXI A;  3L1P A;  3G7R A;  5JI6 A;  1HF0 A;  4XLC A;  3FXR A;  1WH7 A;  4HQE A;  4LLG F;  4BH9 A;  3PQK A;  1K4T A;  2PQ8 A;  2JQ7 A;  4MXM A;  1SFU A;  5EZG A;  5J8C A;  1ETX A;  2RVC A;  5HSZ A;  5CLS A;  3OYI A;  2QGU A;  3DLL F;  3GTG J;  2P5L C;  5A2Q Z;  1B8I B;  1D3Y A;  2R7U A;  2VOO A;  1SMT A;  1BA5 A;  4PSX A;  4A3L J;  2M8E A;  2HR3 A;  2XAU A;  3IWF A;  1Z1D A;  4B3X A;  2DT6 A;  4LK0 F;  1FY7 A;  1GV2 A;  2PFB A;  3JSP A;  2EFP A;  3BDD A;  1OKR A;  3KYD B;  4C3I J;  3KEQ A;  1B59 A;  3V78 A;  2UWM A;  3HTJ A;  1D1A A;  3JAM Z;  3GTJ J;  4L0Z B;  2FBQ A;  4AVZ A;  5HDK A;  2EV6 A;  3K6G A;  3DPT A;  5LFA A;  3RYP A;  4BJ6 C;  2R5Y B;  3TQN A;  1T2K A;  1R1U A;  3R0J A;  1QZE A;  4BAC A;  2G9W A;  2K3P A;  3H5N A;  3J81 Z;  4E7L A;  3AAF A;  5LRS A;  4L5E A;  3LOC A;  1E3P A;  4KT5 C;  2IBD A;  1GUU A;  5E1Z B;  3S1Q J;  4IOA F;  3BJ6 A;  2HKX A;  4Y4R A;  3PQJ A;  1UHS A;  2K40 A;  3BRO A;  2R4G A;  3CDH A;  1OR7 A;  4NN1 A;  3HRT A;  2IS2 A;  2JN6 A;  3ZGK A;  2HYT A;  1TBX A;  5FO5 A;  5FD6 A;  1XGS A;  4CYC A;  2XIG A;  1W0T A;  4ESJ A;  4A3F J;  1XDS A;  2NOJ B;  2QBY B;  2VKH A;  2LG4 A;  4IQ4 A;  2W82 A;  5LGN A;  1T56 A;  3ANP A;  1YO5 C;  1G8X A;  1R4M B;  2QTQ A;  1WZ2 A;  1JTY A;  4CCO A;  5GTI C;  3MKY B;  1D8J A;  2E2I J;  2GA1 A;  4BU2 A;  4AF5 A;  3SDB A;  4BJT A;  4RLQ A;  1FTT A;  4FX4 A;  2W25 A;  5BQT A;  1ZHF A;  3BNI A;  3WU1 B;  1HW2 A;  1AA7 A;  2RQQ A;  5A2Q K;  1G3T A;  2E1C A;  1X4O A;  4MFE A;  1I1S A;  4PFO A;  2FMY A;  5JVT A;  3HC7 A;  4OD4 A;  5D8K B;  2DBB A;  5ICG A;  1MW7 A;  1HOM A;  2BW3 B;  4NC6 A;  3F6O A;  2R5Z A;  4EJT A;  1U6G A;  3LFU A;  3J81 K;  3S17 J;  5C44 J;  2D45 A;  1WHU A;  3GVA A;  4A93 J;  5CW8 A;  3LA2 A;  2HDD A;  3Q0U A;  2QA4 I;  2FJ1 A;  2EH3 A;  5KCM A;  3CO7 C;  1QA6 A;  1WJE A;  5BMZ A;  1MND A;  4S0H B;  1MBF A;  4OAZ A;  3H1C A;  3NQO A;  4DYR A;  4ICH A;  3V8K A;  1X2M A;  3QOD A;  4XKC A;  1I6H J;  4A3M J;  5HS9 A;  3JRA A;  3CCY A;  2L02 A;  4A3C J;  1ZLJ A;  3H3U A;  1OQY A;  1S9H A;  3M8F A;  2TCT A;  2HYJ A;  2VKD A;  4RGR A;  4U0Y A;  3NXC A;  2WAE A;  4EM1 A;  4UB6 C;  4L9J A;  2KZG A;  1R6R A;  3WU2 C;  1NG7 A;  3DKX A;  3L09 A;  2HFH A;  3FM3 A;  2NP5 A;  1TWC J;  1HLV A;  3WTS C;  2GZW A;  1PUF A;  1WJB A;  5DD4 A;  2BVM A;  2B3W A;  1JE8 A;  5CVR A;  1L3L A;  3WTV C;  3CMY A;  1LDK B;  1E3H A;  3CUQ B;  1Y8R B;  4M9Z A;  4E4H A;  1VQL I;  4LIT A;  2PJP A;  2QQ8 A;  2XUB A;  2BW3 A;  5HLI A;  2HKU A;  3IH4 A;  3EUP A;  3I59 B;  4OAY A;  4C9Y A;  3ABU A;  3KKC A;  2LSO A;  2H8W A;  4FHT A;  1IUY A;  3B81 A;  3MAJ A;  1QBJ A;  4FAS D;  3FWE A;  3K2Z A;  3ZQF A;  3UKG A;  1V5F A;  4BXU A;  3DTI A;  1UG0 A;  2HQA A;  1JJ6 C;  2VPL A;  3NRV A;  5GP9 A;  4G6T B;  4E7Z A;  3E7L A;  3KZZ A;  2COB A;  4PK4 A;  4B4C A;  3LSR A;  2IGN A;  1QHH D;  4H0E A;  1STZ A;  2RV8 A;  5F1J A;  2XC7 A;  2UV1 A;  2XF7 A;  2M0M A;  3CF5 F;  3NRG A;  4ENK A;  1RPW A;  4WXC A;  3SQN A;  4G8X A;  3VW1 A;  5DYM A;  1QQI A;  2P6T A;  2DMN A;  2COM A;  5D4R A;  2QBY A;  1R23 A;  3KEO A;  4MLO A;  5D1R A;  2X9D A;  4Q48 A;  4CCL A;  4ON0 A;  4QIW N;  1S6L A;  3DU5 A;  4GCK A;  3A01 B;  1Y1V J;  3WE3 A;  4A3K J;  1D5Y A;  2RHA A;  1U8B A;  1FBQ A;  4J01 A;  1VQO I;  1KYW A;  2X1D A;  3J7Y J;  3K2A A;  2DA5 A;  3FZV A;  5DEQ A;  3ZQI A;  4EM0 B;  4LJZ F;  1GV5 A;  3CZ6 A;  1ZRE A;  1SD6 A;  3PUF A;  1IW7 F;  4IPA A;  5ILV A;  5JHU A;  1R5G A;  1LFP A;  4XID A;  4U7B A;  3CJT B;  2L54 A;  4A3I J;  1BIB A;  4BEH A;  2R5Y A;  2LFB A;  3HOY J;  2A6H F;  3CCQ I;  3IP4 B;  1Y6I A;  4CGR A;  5EEA A;  2L9R A;  3ABL H;  1GT0 C;  1A31 A;  1ZR2 A;  3HKZ A;  5GPC A;  2LH9 A;  3Q0W A;  1F36 A;  3QYB A;  4IVN A;  5B3S H;  3M07 A;  5BPI A;  2XF5 A;  2GXG A;  3DPU A;  2QF7 A;  2M7B A;  3A2K A;  4IHV A;  3W6J B;  1T0F A;  4HBL A;  1YJ9 I;  1JGG A;  5E8I A;  2Y9Z A;  1K4S A;  1MSE C;  2EK5 A;  4LG3 A;  3MKW B;  2Z33 A;  3BOQ A;  1V54 H;  3NNR A;  2CQN A;  1S8N A;  3CLO A;  1FOX A;  3JRB A;  2L9S A;  2K9L A;  2X51 A;  4BQQ A;  4XOR A;  3FMS A;  3TOA A;  5DM7 F;  5DCM B;  5L3G A;  3K4B A;  2CRG A;  4L9N A;  3I56 I;  3V6G A;  3FXJ A;  3HOW J;  3PAS A;  2HXI A;  4AVP A;  2MFZ A;  1ERD A;  4S04 A;  2CV1 A;  1IRX A;  4DOZ A;  4XN3 A;  3VOX A;  3I4N J;  4L9V A;  1LNW A;  2K85 A;  3HRS A;  1J2X A;  3WTX C;  4RAY A;  1VQM I;  2EIJ H;  2WWY A;  2UXN A;  3T8T A;  5HBU A;  2L9N A;  3G4S I;  1EH8 A;  2F4I A;  3WGG A;  3OYE A;  2K3F A;  1T95 A;  3DTE A;  2EV5 A;  3VYT B;  3T8R A;  1D5V A;  2B1E A;  3GBG A;  2P7C B;  3HHG A;  4EV0 A;  2Y75 A;  5B5E C;  2X1C A;  1UI5 A;  1NG6 A;  1YX5 A;  3IUO A;  2WTE A;  3ZMS A;  3R4K A;  1FBS A;  4A6E A;  3GFJ A;  2E5N A;  4EJV A;  1MIJ A;  2ELK A;  2EZI A;  2FU4 A;  2JUG A;  3HRU A;  2M3A A;  1FYK A;  2DK5 A;  1JUP A;  3LSP A;  2H8R A;  3M8J A;  4KUM A;  3I5U A;  3T5X A;  4LB5 A;  1AWC A;  1A6Q A;  2Y30 A;  4IL6 C;  5FFX A;  1Q1V A;  5M5Y J;  1FYL A;  1GVD A;  1YS6 A;  3EUA A;  4F3Q A;  5DCM A;  1FOK A;  3RKY A;  1UJ8 A;  2HYG D;  3OOP A;  4M73 A;  2JA5 J;  3WTT C;  3VP5 A;  3W3C A;  3M1C A;  3BR2 A;  2QKM B;  1WVR A;  1SEU A;  2ZOZ A;  5CJ9 A;  5F0H A;  2VIX A;  3CME I;  5IT9 Z;  2NAZ A;  2R7F A;  1RR8 C;  4L18 B;  3MVP A;  2QUF A;  1AHD P;  1FZP B;  2MLK A;  2X6W A;  1J09 A;  2XGX A;  4LMY A;  3A4C A;  1LFB A;  4PGG A;  4Y7N J;  3KX2 A;  1ZGW A;  5DM6 F;  2AS5 F;  2WBM A;  2AO9 A;  4PSW A;  1YYV A;  3GUD A;  1ZGA A;  4RGS A;  4OIQ F;  4BL0 B;  1GXQ A;  3ML6 A;  5KAI C;  4ASN A;  2ADU A;  3U2R A;  2ISY A;  1VQ7 I;  3MKL A;  2EQR A;  3RZO J;  2XGC A;  3KNW A;  3FRQ A;  3TW6 A;  4BQN A;  1K7A A;  1NK3 P;  2CUE A;  4N0B A;  3HSF A;  3KP2 A;  2JZY A;  4HF2 A;  2KRH A;  4LK1 F;  1BIA A;  3CLQ A;  1RR7 A;  5D4S A;  2E34 A;  3LST A;  3FMQ A;  4M9S A;  1EA3 A;  4XON A;  1R22 A;  4GYG A;  1G4D A; 
#chains in the Genus database with same CATH homology
 4D7N A;  3JRH A;  1A6I A;  2XGE A;  3FK7 A;  4G12 A;  2CJJ A;  2EZL A;  3O60 A;  1TWG J;  1H8A C;  5J1Y A;  2AHQ A;  1U9N A;  2VKV A;  2I10 A;  4BXX J;  3VUQ A;  2RAE A;  1EF4 A;  2N8G A;  3TED A;  4UDS A;  1DU6 A;  5FKM A;  1JUS A;  3BTC A;  2W48 A;  1JTX A;  3BR5 A;  5FGL A;  4DYQ A;  3CWR A;  2OPT A;  4W97 A;  3CJD A;  2R0Q C;  3RH2 A;  3SFI A;  2PBX A;  5D19 A;  5J3L A;  2XSD C;  3HE0 A;  2XB0 X;  3JRF A;  5C4J J;  3S15 J;  3QKX A;  1ZKG A;  2OF7 A;  1JUM A;  2R92 J;  2HQ5 A;  4X1E A;  5HOD A;  2HOS A;  1QPI A;  2E19 A;  2DA6 A;  4RBO A;  1P7J A;  1MH4 A;  5FKL A;  1YRN B;  4FIS A;  3JRD A;  3JRE A;  4FTH A;  4ACI A;  2GFN A;  2JK3 A;  4GFB A;  5M5X J;  1VF9 A;  3DCF A;  3D1N I;  2UXI A;  3QQA A;  2DA4 A;  5EFY A;  1Z77 A;  3S1R J;  2LLK A;  3HTA A;  2NVX J;  4IHW A;  4PXI A;  1JKO C;  2IAI A;  4AUX A;  2R93 J;  2HOT A;  4JX6 A;  4BY7 J;  1ZQ3 P;  3HIM A;  5IYB J;  4D7M A;  4C3H J;  2TRT A;  3GTL J;  3GTQ J;  1I3Q J;  2JA7 J;  1RKT A;  2JA8 J;  2QOP A;  2YUS A;  3HKZ N;  2KDZ A;  2LD5 A;  3HDD A;  4XRM A;  1TWA J;  1JJ8 C;  1QVT A;  1O4X A;  3BR6 A;  2XDN A;  2IEK A;  4IHX A;  3JRG A;  3IV5 A;  3HOU J;  5C3E J;  3S1M J;  2G3B A;  5E3M A;  4A3B J;  4V2F A;  2PZ9 A;  1XG1 A;  2NP3 A;  3MN2 A;  4JKZ A;  4MO7 A;  2HOA A;  2LK2 A;  2WGB A;  2ZOY A;  4HKU A;  1B8I A;  3C2B A;  4M6V A;  2DN0 A;  2HXO A;  4I76 A;  1IGN A;  5K7Z A;  3GTM J;  1G2H A;  2W53 A;  3GZI A;  4MIM A;  4JYK A;  5K7F A;  3JSJ A;  5H9T A;  4Y52 J;  1HDD C;  3BR1 A;  1H89 C;  4BY1 J;  1SAN A;  2MG4 A;  2XPU A;  1VFC A;  1AKH A;  4KWA A;  3BTI A;  3HTH A;  2JJ7 A;  4IEJ A;  2LKX A;  4C2M J;  3S2H J;  1MH3 A;  5FKO A;  1MBH A;  2EZH A;  4QTR A;  2ZB9 A;  3IUV A;  1Y1W J;  2GM4 A;  3M4O J;  4MFD A;  3HGY A;  4UUS B;  1RKW A;  3BCG A;  3VW2 A;  3F0C A;  3FIW A;  2ZCX A;  3IH3 A;  5CXI A;  3L1P A;  3G7R A;  1ETQ A;  1HF0 A;  1MBG A;  1P7I A;  5DS9 A;  1WH7 A;  5FJ8 J;  1FTZ A;  3RD3 A;  3TP3 A;  4MXM A;  1JKQ C;  5EZG A;  5IP9 J;  1K83 J;  1UG2 A;  3AQT A;  4HNV A;  1ETX A;  3GEU A;  2MGQ A;  4JNN A;  3LHQ A;  5HSZ A;  5F08 A;  1IJW C;  2E2J J;  3GTG J;  1B8I B;  2VPR A;  3BJB A;  1BA5 A;  4A3L J;  2ID6 A;  5K58 A;  2M8G X;  5J1R A;  3IH2 A;  3AQS A;  2X6O A;  2Y2Z A;  4UUT A;  1JT0 A;  1XC5 A;  1GV2 A;  4GFL A;  4C3I J;  3ON4 A;  3V78 A;  5GPA A;  2NVY J;  1T33 A;  2QWT A;  3HTJ A;  1WPK A;  3GTJ J;  5F0F A;  2FBQ A;  5IOZ A;  2Y31 A;  3OSG A;  2FQ4 A;  1ETO A;  2D6Y A;  4L62 A;  2DG7 A;  3TW7 A;  2DA3 A;  1PUF B;  4W1U A;  4ME9 A;  4V2G A;  2R5Y B;  2MSY A;  4XK4 A;  3B6A A;  4A3J J;  2X48 A;  3H3V K;  5EF6 A;  3BHQ A;  2WV1 A;  1E3O C;  3MNL A;  4L5E A;  2ME0 A;  3LOC A;  5IPA A;  2LVS A;  1IDY A;  2IBD A;  1GUU A;  2R7Z J;  3K7A J;  1U78 A;  3CRJ A;  3KKD A;  3S1Q J;  4A69 C;  2LY9 A;  3CQZ J;  2XPV A;  1UHS A;  2K40 A;  5F0C A;  3JRC A;  4NN1 A;  1OCP A;  2UXP A;  5EG0 B;  2JN6 A;  1MSF C;  2IU5 A;  2HYT A;  4NEL A;  2NS8 A;  3F1B A;  5M3M J;  4CYC A;  3S1N J;  5HAW A;  3HM5 A;  1W0T A;  1R9T J;  3VVZ A;  2EZK A;  4A3F J;  5C4Y A;  1NK2 P;  3LSJ A;  2OER A;  3EGQ A;  1JT6 A;  1IRZ A;  5DTD A;  3HOX J;  2L0K A;  3BRU A;  1T56 A;  3ANP A;  4BKX A;  2QTQ A;  1ORK A;  4D5C A;  1JTY A;  2L7M P;  3GTK J;  3KZ9 A;  2E2I J;  2GUH A;  4AF5 A;  1F43 A;  1AKH B;  1FTT A;  2DMQ A;  1U9O A;  3ZQG A;  3BNI A;  5K7H A;  3VVY A;  3O8G A;  2GEN A;  3NAR A;  4MFE A;  5EDN A;  4GFK A;  2JWT A;  3HBL A;  3DPJ A;  3QPS A;  1S7E A;  5IOY A;  1HOM A;  2WAQ N;  2DA1 A;  5IP7 J;  2R5Z A;  4X6A J;  4BBR J;  3HB9 A;  2F07 A;  3S17 J;  3VIB A;  4JX4 A;  2EBI A;  1RET A;  1XS9 A;  1VI0 A;  5C44 J;  4B3A A;  5M5W J;  3A02 A;  4A93 J;  3OOU A;  5CW8 A;  2HDD A;  1MBK A;  1UI6 A;  1OJL A;  3Q0U A;  4DZJ A;  4EEF G;  2FJ1 A;  2EH3 A;  4I6Z A;  1LE8 A;  4S0H B;  3BG5 A;  1MBF A;  1UMQ A;  4M3B A;  5J1U A;  4DYR A;  4XRS A;  2Y9Y A;  3C07 A;  1WH5 A;  2M2E A;  1X2M A;  4ICH A;  5EYR A;  2ME6 A;  5D18 A;  1I6H J;  3HGG A;  4A3M J;  3Q3S A;  3VPR A;  1IC8 A;  3JRA A;  4DW6 A;  3CCY A;  3Q0V A;  1LFU P;  4A3C J;  5M3F J;  3G1O A;  2TCT A;  2HYJ A;  3NXC A;  2JA6 J;  2FX0 A;  4A3E J;  1CQT A;  1DU0 A;  1QVU A;  3A01 A;  1GDT A;  2NP5 A;  1TWC J;  2XPW A;  1HLV A;  1X58 A;  3GTO J;  3BTJ A;  1PUF A;  3B6C A;  3P9T A;  4YZE A;  2HI3 A;  3M3Y J;  3BTL A;  2NS7 A;  2NOG A;  3CMY A;  3HOZ J;  3SJM A;  2WB1 N;  4GCL A;  2MW8 A;  4AC0 A;  1FIP A;  2HKU A;  4BBS J;  3IH4 A;  3EUP A;  4FE4 A;  4C3J J;  3BQZ A;  3ON2 A;  2QCO A;  2XB5 A;  3KKC A;  9ANT A;  2CU7 A;  1TC3 C;  3T6N A;  3DEW A;  1H88 C;  3B81 A;  1NTC A;  3ZQF A;  3UKG A;  3ZQL A;  2QIB A;  1RES A;  5E3N A;  5F04 A;  1JJ6 C;  2Q24 A;  4AYB N;  5GP9 A;  4MK6 A;  3E7L A;  3NPI A;  4B4C A;  2COB A;  3LSR A;  5F1J A;  2LR8 A;  4JX5 A;  2CQQ A;  3OSF A;  3NRG A;  2K9N A;  2K9S A;  1RPW A;  2G7G A;  3S2D J;  4RDU A;  3VW1 A;  2Y0S N;  1LE8 B;  2ZCN A;  2DMN A;  1FJL A;  4MLO A;  5D1R A;  4GCT A;  2YS9 A;  2X9D A;  2YVH A;  1WCM J;  5EGO A;  1SFO J;  5CXG A;  3LNQ A;  3ZQH A;  3ANG A;  4QIW N;  2G0E A;  1BW6 A;  4GCK A;  3A01 B;  1Y1V J;  4A3K J;  1D5Y A;  5FHP A;  2RHA A;  1U8B A;  2E2H J;  3K2A A;  2DA5 A;  1ETW A;  3ZQI A;  1POG A;  1GV5 A;  1ZR4 A;  3S14 J;  3VVX A;  1MBE A;  4XID A;  4A3I J;  2B63 J;  3G1L A;  1ETY A;  2R5Y A;  1MBJ A;  2LFB A;  4ABZ A;  3HOY J;  3RZD J;  1YRN A;  2VI6 A;  2ZCM A;  4A3G J;  4CGR A;  4JL3 A;  5EEA A;  2L9R A;  1GT0 C;  2CQX A;  1ZR2 A;  4A3D J;  5GPC A;  3Q0W A;  2OI8 A;  1F36 A;  3S16 J;  4XRS G;  2L7Z A;  5IYC J;  2DA2 A;  3NI7 A;  2YU9 J;  5C4X J;  3JRI A;  2WUI A;  1X2N A;  4B1R A;  2QKO A;  1ENH A;  2O9L A;  2CUF A;  3HEF A;  1IDZ A;  4LOC A;  5EZH A;  2QF7 A;  4IHY A;  2UXH A;  4IHV A;  2M9H A;  3S5R A;  3BG3 A;  4UUS A;  1JKR C;  1TWH J;  1VND A;  1JGG A;  2NVQ J;  2Y9Z A;  1MSE C;  3ZQC A;  1HDP A;  2DMT A;  1SGM A;  3NNR A;  3CDL A;  3JRB A;  4J19 A;  3JR9 A;  5IYD J;  3E7Q A;  2XGD A;  3FKI J;  4DYC A;  3LJL A;  2O7O A;  2ID3 A;  2CRG A;  3BT9 A;  1ETV A;  3RKQ A;  1OCT C;  3V6G A;  5FLV A;  3HOW J;  4AC6 A;  1TWF J;  3LSG A;  5AQC A;  2FD5 A;  5EGO B;  3PO3 J;  3PAS A;  1QRY A;  2HXI A;  2L7F P;  5JLW A;  3I4M J;  4D5F A;  2M34 A;  2O8K A;  3ZOB A;  1WGX A;  3I4N J;  2DA7 A;  3VOX A;  2G7S A;  1BW5 A;  2UXU A;  2UXO A;  1OFC X;  3FK6 A;  2JMW A;  2PMZ N;  5HBU A;  4FCY A;  2LTP A;  1B72 A;  1JKP C;  3NAU A;  3W6V A;  3HOV J;  3WHC A;  2V57 A;  2H1K A;  3FIS A;  5E3L A;  3OIO A;  2D5V A;  3BR0 A;  3GBG A;  4M3E A;  5BNG A;  2XRL A;  1FIA A;  1UI5 A;  1FEX A;  3SDG A;  2E1O A;  2YVE A;  4XIC A;  2R5Z B;  1IV6 A;  3VW0 A;  2ELK A;  2EZI A;  2REK A;  3G1M A;  1JUP A;  2NX4 A;  3LSP A;  2H8R A;  5F27 A;  5IP6 A;  2G7L A;  2Y30 A;  3BG9 A;  1Q1V A;  2KT0 A;  5M5Y J;  1GVD A;  1ZK8 A;  2ECC A;  1BL0 A;  4DZP A;  1W0U A;  4QSH A;  4M3D A;  2DG8 A;  5FMP A;  1ETK A;  5DAJ A;  2DMP A;  2GLO A;  2JA5 J;  5EG0 A;  4FE7 A;  3VP5 A;  1A5J A;  3BR2 A;  2O7T A;  2ZOZ A;  4CYC B;  2M0C A;  5F0H A;  3COL A;  3MVP A;  2DTZ A;  1ITY A;  1ZTR A;  1AHD P;  1IUF A;  1K61 A;  1LFB A;  2RAS A;  4Y7N J;  2P81 A;  1ZGW A;  1AU7 A;  1I50 J;  2DMU A;  2AO9 A;  1B72 B;  3O8H A;  2GBY A;  4M3F A;  5FLM J;  1IG7 A;  2VUM J;  3VOK A;  2ECB A;  4JP0 A;  2NVT J;  3GTP J;  1Z0X A;  1APL C;  2DJN A;  3RQI A;  3MKL A;  3PPB A;  3H0G J;  2EQR A;  3PO2 J;  3RZO J;  2XGC A;  3KNW A;  3FRQ A;  3TW6 A;  2VKE A;  3A03 A;  5FKN A;  3WHB A;  1NK3 P;  2CUE A;  3BR3 A;  3BQY A;  3QPL A;  5JLX A;  3TP0 A;  3G56 A;  1BJZ A;  2K9Q A;  3QBM A;  1RR7 A;  4M3G A;  4NDL A;  2LP0 A;  5FKK A;  5E3O A;  1HCR A;  3HTI A;  3LWJ A;  1MNM C;  3PM1 A;  1WI3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...