1ZKGA

Crystal structure of transcriptional regulator, tetr family (tm1030) from thermotoga maritima at 2.30 a resolution
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
200
structure length
200
Chain Sequence
b'VLSKRDAILKAAVEVFGKKGYDRATTDEIAEKAGVAKGLIFHYFKNKEELYYQAYMSVTEKLQKEFENFLMKNRNRDIFDFMERWIEKKLEYSASHPEEADFLITLVSVDEGLRKRILLDLEKSQRVFFDFVREKLKDLDLAEDVTEEIALKFLMWFFSGFEEVYLRTYQGKPELLKRDMNTLVEEVKVMLRILKKGMTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords transcriptional regulator, TetR family
publication title Crystal structure of TM1030 from Thermotoga maritima at 2.3 A resolution reveals molecular details of its transcription repressor function.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transcription regulator
total genus 69
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1zkgA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 1zkgA02
1B8IB 1VF9A 2DTZA 5C4XJ 2W48A 3BTLA 3G56A 4ICHA 4V2GA 3VW0A 2XGCA 1ZGWA 1P7JA 3LHQA 3NPIA 2DMPA 5EGOA 3FIWA 2WAQN 4IHXA 4MK6A 3O8GA 4CGRA 5IPAA 3GTGJ 1XC5A 5IP6A 4BBSJ 1RESA 5EG0B 2LFBA 4A69C 2DG7A 4A3LJ 5IYDJ 1RR7A 3HGGA 4KWAA 4C3JJ 4V2FA 3K2AA 4FTHA 1ETYA 4JKZA 1A5JA 4JP0A 2NS8A 5D1RA 1ETXA 5EYRA 5EZGA 4C2MJ 5E3MA 4A3CJ 2CRGA 4FCYA 3GTOJ 3JRAA 1BW6A 1NTCA 2JWTA 3JRHA 5K7FA 2ECCA 5EZHA 2ME0A 2COBA 3ZQGA 2UXPA 2QTQA 3FISA 4GFBA 2V57A 2WGBA 5EGOB 5E3LA 4GCTA 1FEXA 1MSFC 4AYBN 2UXOA 2L7MP 1K83J 3A01A 4A3DJ 3F0CA 5M5WJ 1ZR2A 1POGA 1NK3P 5C44J 2QKOA 2EQRA 5J1YA 3ZQIA 2XSDC 1S7EA 1U78A 2OERA 1ENHA 5GP9A 3LNQA 5FGLA 1SFOJ 1GT0C 2PZ9A 2JN6A 2EZIA 3M3YJ 3S15J 2Y9ZA 3Q0VA 3JRDA 2UXHA 3ON4A 2N8GA 4D7NA 1ETVA 1O4XA 4A3IJ 2VKVA 4L62A 5M3FJ 2FX0A 2K9SA 3IUVA 2LKXA 2NP5A 2HDDA 2DMTA 2VPRA 1MBKA 2XPVA 3GBGA 2ELKA 4JNNA 2AHQA 1MBEA 3Q0WA 2QIBA 1LFUP 5FKLA 3A01B 4A3KJ 2LR8A 1GUUA 1VFCA 3VIBA 1DU0A 2JJ7A 2GLOA 4DZJA 2MW8A 1QVTA 3Q0UA 4RBOA 2XB0X 1ZTRA 5D19A 2R7ZJ 2PMZN 1G2HA 1JTXA 1Z77A 2HOSA 4GFLA 1WH7A 2K40A 3JRGA 4BY7J 5FKMA 3G1LA 1R9TJ 3FRQA 2RAEA 2JK3A 1Y1WJ 4M6VA 1AU7A 3A03A 4M3GA 1JJ8C 2DA5A 2RASA 3S17J 1UG2A 3NXCA 4GCKA 3KKCA 1UI6A 3MKLA 2E2HJ 2YU9J 3W6VA 2IU5A 1YRNA 2JMWA 2OF7A 1ETKA 2R93J 5J1UA 3BTCA 4A3EJ 1JKRC 1IG7A 3BHQA 3BG9A 4J19A 4MIMA 4D5FA 2Q24A 1TWCJ 4XRMA 5EF6A 1X2MA 2L9RA 3Q3SA 3HTIA 4FE4A 5HAWA 4PXIA 4AUXA 4NDLA 1XS9A 2CUEA 3QKXA 3JRFA 2HI3A 2M34A 2ID6A 1HOMA 3S1RJ 5CW8A 1TWHJ 2DG8A 2ME6A 4MFDA 2R5ZA 1TWGJ 3CWRA 1K61A 2L7ZA 3GTJJ 4A3JJ 4XRSG 2X48A 3FK6A 3KZ9A 1RKTA 4EEFG 1YRNB 3RD3A 3CRJA 2FD5A 3JSJA 4HKUA 3KKDA 4B3AA 1H88C 2YVHA 2LY9A 1HF0A 3S1NJ 2QWTA 3BR6A 4B1RA 1MBJA 2FQ4A 2DA1A 5FLVA 2EH3A 3GTMJ 4ME9A 2QF7A 2I10A 4YZEA 4AC0A 3HOVJ 3LSPA 4A93J 3HKZN 1FIAA 5K7HA 4MXMA 3DEWA 2UXIA 2E19A 4X1EA 2R5ZB 3PO3J 4M3FA 2HOAA 4XICA 2GENA 3VVZA 4D5CA 1ETWA 3HOXJ 1IJWC 2M2EA 4A3MJ 2G3BA 4MO7A 2GM4A 1FIPA 1NK2P 5F0CA 2XPUA 3S2DJ 4X6AJ 1XG1A 4ACIA 4HNVA 2X9DA 2TCTA 2H1KA 2ZCXA 2UXUA 3ZQCA 1BA5A 4MFEA 5GPAA 4L5EA 3F1BA 3WHCA 3TEDA 3P9TA 2VUMJ 2XGDA 3L1PA 3SJMA 3IV5A 2PBXA 1MH4A 2M0CA 2ZB9A 2NP3A 3NRGA 1WH5A 3OSFA 5IOZA 3DCFA 1A6IA 3BR2A 3EUPA 3S16J 5IYCJ 2CQXA 1JUMA 2EZKA 2R92J 3S5RA 1GDTA 5J3LA 4A3GJ 1P7IA 1HCRA 2GFNA 1VI0A 3UKGA 2GUHA 2DA3A 1IGNA 4C3IJ 4DYRA 1RETA 5F1JA 1SANA 1AKHA 2LK2A 4JYKA 3EGQA 2R0QC 3HIMA 2NS7A 3VP5A 3JRCA 1FJLA 1OCTC 5K58A 3OIOA 1X58A 3VVYA 1JUPA 2YUSA 2Y31A 4RDUA 2O8KA 3M4OJ 2CQQA 3KNWA 4C3HJ 5IP7J 2K9NA 2CUFA 1MNMC 1I3QJ 3RQIA 2E2IJ 2M8GX 4S0HB 2DA7A 1MSEC 4XK4A 5JLWA 1HDPA 1MH3A 2IAIA 2NOGA 1WCMJ 5F0HA 3PPBA 3JRBA 3HOZJ 3GZIA 4DW6A 1Q1VA 1AKHB 9ANTA 2RHAA 1LE8A 2P81A 3ZOBA 5IP9J 3RZOJ 3VVXA 4NELA 5EEAA 3TW7A 3PO2J 3GTKJ 2XPWA 1WGXA 2ZOYA 2HYTA 3LOCA 4W97A 3RH2A 4IHYA 3C07A 2CU7A 3FK7A 3HM5A 3NNRA 3OOUA 2NVTJ 3H3VK 4A3FJ 3S2HJ 4JL3A 2LLKA 3V78A 2K9QA 3HOWJ 5HODA 5E3NA 2CJJA 2IEKA 2NVQJ 3BCGA 5F0FA 3C2BA 3SDGA 2HKUA 3BRUA 2MGQA 2HXIA 4DYQA 2F07A 2DMNA 3PASA 4IEJA 2DMUA 1RPWA 3QPSA 5F27A 3BR1A 5DAJA 2E2JJ 2OPTA 3G1MA 2L0KA 5EFYA 2G7SA 1LE8B 2KT0A 5C3EJ 5C4JJ 4FISA 3QQAA 3BJBA 3VOXA 3RZDJ 3HTJA 4G12A 1OJLA 2WV1A 3O60A 3HB9A 3O8HA 4DYCA 1GV5A 2Y30A 2FBQA 1UHSA 1JKPC 2E1OA 3CCYA 3HOYJ 3B81A 3E7LA 1JT0A 2YS9A 1IV6A 2MG4A 5FKNA 2JA7J 5BNGA 3GTQJ 2R5YA 1QRYA 4M3BA 3LJLA 3B6CA 1ETQA 1MBGA 1OCPA 3LSJA 4BXXJ 5HSZA 3BTIA 2NVYJ 3LWJA 4M3EA 1F43A 1FTTA 1IUFA 3DPJA 5FHPA 3MNLA 1VNDA 2DA4A 3AQTA 2XGEA 3ZQHA 3BR0A 3BG5A 3H0GJ 2JA6J 3HTAA 4CYCA 5FJ8J 1TWAJ 5EDNA 5CXIA 5H9TA 1I50J 5IYBJ 4I6ZA 2DN0A 4JX4A 1GV2A 3HOUJ 1SGMA 3BT9A 2TRTA 3ZQFA 3ANGA 3ZQLA 2M9HA 1ZK8A 2XB5A 4QSHA 2WB1N 3K7AJ 4GCLA 2R5YB 4UUSA 3FKIJ 5K7ZA 4GFKA 2AO9A 2ZOZA 3CJDA 4XIDA 2L7FP 1DU6A 1H89C 3BQZA 2G7GA 2DMQA 2DA6A 4MLOA 3GTPJ 2ZCNA 1X2NA 4BBRJ 2W53A 2GBYA 2ID3A 3CDLA 4DZPA 5C4YA 3T6NA 1TWFJ 1B72A 1JGGA 3VW1A 2XDNA 5D18A 5J1RA 1PUFA 3QBMA 4W1UA 5FKOA 3VOKA 4CYCB 2LVSA 3QPLA 2JA5J 3IH2A 5FKKA 4QIWN 5DS9A 2VI6A 2G7LA 1JUSA 3GTLJ 2HOTA 1H8AC 1U9NA 4UUTA 1ZQ3P 5FMPA 4B4CA 3AQSA 3HBLA 2KDZA 3E7QA 3VUQA 1AHDP 3TP3A 5HBUA 2IBDA 3BR5A 2QOPA 3SFIA 4UUSB 3RKQA 2HYJA 4JX6A 2EBIA 4BKXA 5E3OA 3MVPA 3HEFA 1LFBA 3PM1A 5M5XJ 2ECBA 3NAUA 2WUIA 2HXOA 4NN1A 2HQ5A 4Y52J 3I4MJ 3B6AA 5DTDA 1APLC 3ANPA 4Y7NJ 3BTJA 1B72B 3GEUA 2XRLA 3WHBA 2EZLA 1PUFB 2LTPA 2O7OA 1U9OA 1U8BA 1E3OC 2Y0SN 1W0UA 1JKOC 1ETOA 4QTRA 5GPCA 3CQZJ 4AF5A 1BL0A 3TW6A 1ORKA 1D5YA 3ON2A 3NARA 3I4NJ 3BR3A 3G1OA 4AC6A 1CQTA 3JRIA 1JJ6C 5F04A 2EZHA 1BJZA 1MBHA 2VKEA 5M3MJ 2O7TA 3D1NI 3BQYA 1IDZA 4A3BJ 1MBFA 1WPKA 1ZKGA 3S1QJ 3HDDA 1OFCX 1WI3A 3V6GA 2OI8A 2QCOA 4M3DA 3JR9A 2REKA 3NI7A 2DA2A 3VW2A 2D6YA 2NVXJ 4IHWA 3IH3A 4ABZA 1JKQC 4XRSA 3S1MJ 1GVDA 5F08A 4BY1J 2YVEA 3TP0A 1FTZA 1T33A 1HLVA 2LD5A 2Y2ZA 1B8IA 2FJ1A 1I6HJ 3HGYA 2G0EA 1ZR4A 2B63J 3OSGA 5FLMJ 2ZCMA 1RKWA 3BNIA 3BG3A 4D7MA 1UI5A 3LSRA 2MSYA 4UDSA 5JLXA 4FE7A 2NX4A 3IH4A 3COLA 1BW5A 5CXGA 5EG0A 2JA8J 3S14J 3HE0A 1JTYA 3LSGA 1F36A 1IDYA 2X6OA 4I76A 1TC3C 3G7RA 5AQCA 1W0TA 4JX5A 1Y1VJ 1ITYA 3VPRA 4LOCA 1EF4A 1QVUA 3JREA 1HDDC 1IC8A 1IRZA 5IOYA 4IHVA 1T56A 1Z0XA 3A02A 3HTHA 2H8RA 1JT6A 2O9LA 5M5YJ 3CMYA 2DJNA 1UMQA 1QPIA 2D5VA 2LP0A 2Y9YA 3MN2A
chains in the Genus database with same CATH superfamily
1B8IB 3PUBA 3E0JB 3NPIA 1UZCA 2BE5F 3FIWA 2EV0A 2WAQN 3T0YA 1XMKA 1BC7C 3V8KA 4CICA 3HIFA 1SD4A 3O8GA 4HDVA 5IPAA 3WTWC 3RDIA 2LKSA 3ZR8X 1U5TA 1XSXA 2PMUA 2Q0OA 3DP7A 2WADA 4CCNA 5B3SH 1MIJA 4V2FA 5DCMB 4FTHA 4R8HA 5J4VA 4JP0A 4XRFA 4UB6C 5EZGA 3I56I 1BW6A 2JWTA 1LJ9A 2Z1DA 3BY6A 5K7FA 2IS6A 2ECCA 4C30A 4U9NA 3AFHA 2ME0A 2HZTA 2R7XA 1ZN2A 2ZKZA 2UXPA 1IZ1A 2A69F 2RVCA 2FNPA 2OCEA 4GCTA 1P4AA 1MSFC 2D2WA 4KITB 4AYBN 2VT3A 2F5CA 4EJOA 2UXOA 1K83J 3F0CA 1QQIA 2DYRH 1TQIA 3G73A 4B3XA 3I58A 4IHSA 2QKOA 3HRTA 1G3WA 5J1YA 3ZQIA 2R7TA 2HDCA 3GZNB 1R00A 5GP9A 4C2UA 2RQQA 2PZ9A 2O3FA 3HRMA 2HKXA 2IPQX 3M3YJ 3S15J 2B3WA 4PZJA 2A5WA 3DEEA 3JRDA 2HVQA 2VODA 1FOWA 4D7NA 1ETVA 1XGMA 3OV8A 4A3IJ 1Z6TA 2B1EA 2VKVA 4RA2A 3K4LA 4L62A 2K9SA 2KQRA 1YYVA 2NP5A 3KP7A 2DMTA 5CVRA 2RQPA 1S8NA 3CDHA 5IT9Z 2X1EA 3FXOA 3P9KA 1MBEA 3Q0WA 2PQ8A 3CF2A 3K10A 4II3A 3CMAI 4KNYA 3OYLA 1YS6A 2TDXA 3I71A 5FKLA 2LR8A 3JAMZ 4ITVA 4MNUA 3A01B 2EK5A 2X1DA 4CZZA 2WAFA 1FYMA 2GLOA 4IZZA 2XB0X 5D6FA 5D4RA 2R7ZJ 3I59B 1G2HA 4RAYA 2HOSA 4GFLA 4OIOF 2EB7A 2ZJRF 2JK3A 4M6VA 1MMAA 3E6BA 5CKTA 2K7LA 5K5QA 1JJ8C 4LLGF 2DA5A 4CUGA 2OTLI 4Q48A 2L9SA 2XV4S 4GCKA 4Q4ZF 1P9QC 4G6DA 2IU5A 3W6VA 3QOEA 4LB6B 1YJ9I 1R1VA 2F5FA 2OAZA 4A6EA 4ESJA 2GXBA 3MEXA 2R93J 1FOYA 3HHGA 1RI7A 2V26A 2WBMA 3BTCA 1YS7A 2P5KA 1IG7A 2OQGA 4NC6A 3K4KA 1T0FA 1TWCJ 2KZVA 4XRMA 1OPCA 1SAUA 3A1YA 5EF6A 2EIJH 2L9RA 3FF5A 1YW7A 5CQGA 5GTHC 4LJZF 4AUXA 2M1BA 1P92A 3W2AA 3JTGA 1XS9A 4BU2A 3QKXA 1BIAA 3DFGA 3GLLA 1UHWA 2M34A 1PUEE 4HA8A 4L5IA 4EATA 1KU7A 3S1RJ 1BI1A 4UVAA 5FROA 3RSNA 1ON1A 3BDDA 4G9YA 5DM6F 1BC8C 4FHTA 5E1WA 1K61A 1T08B 1YX5A 2L7ZA 3GTJJ 4LLNA 3K1MA 4U9LA 3FK6A 3A2KA 1YRNB 3HOTA 3RD3A 4HKUA 1K7AA 2XHKA 4ZTFA 1EH7A 2EWNA 3H3ZA 3S1NJ 1FPQA 1QGPA 4E7ZA 3CD6I 2EH3A 3I5UA 4ME9A 4XOPA 1IN8A 2M7AA 5E8IA 2I10A 3S32A 3DBHB 4YZEA 4AC0A 3IRRA 3U2RA 1MW7A 1FIAA 1K6OA 1Y8QB 1S7AA 2E19A 2R5ZB 1XMAA 2GWRA 1JHHA 2HOAA 2J5OA 3F9KA 2ISYA 5EEHA 1I1SA 1ETWA 2DFHA 1KQ0A 3HOXJ 2G3BA 1BR4A 4UV9A 4MO7A 2GM4A 2VPLA 2H8WA 4CCOA 5GADJ 2ELHA 1MMDA 1XB4A 4HNVA 1VZ0A 4GRIA 3SFZA 2QBYB 1QU3A 3WU2C 2WTEA 4RB0A 1K4SA 3F1BA 3TMOA 3K4BA 3PL8A 1V55H 1VQ7I 2FU4A 3SXYA 2W82A 4XBFA 1MDMB 4ZYGA 2CG4A 2ZO4A 2BHZA 2OBPA 3KP6A 2EINH 4KT6A 4OINF 3BR2A 3SZPA 3HOSA 2YR2A 2MD0A 2CQXA 2WA0A 1QA6A 2JSPA 4A3GJ 1E2XA 3KFWX 1HCRA 2GUHA 3UKGA 5HLIA 4PUSA 1Y0NA 4J01A 5F1JA 2QGUA 5J4YA 1W36D 4ZYDA 2LK2A 1KU3A 4RGRA 3FM3A 3IRQA 4EM2A 3DKXA 2O61A 1IN6A 4WWCA 4IRVA 3VSLA 3CO7C 3DF8A 4A0XA 4CH7A 2L02A 2O0YA 1FJLA 2XC7A 2L3DA 3OIOA 4C2TA 2FE3A 1X1BA 2YUSA 2K9MA 3NQOA 3TDZC 1K4TA 2MC3A 5IP7J 4ENNA 4XLNF 2FBIA 2K9NA 2NAZA 3JSOA 1YFHA 2EFOA 3OYNA 2E2IJ 2DA7A 1MSEC 1A31A 3NRVA 4KT5C 2UXNA 4I98B 1HDPA 1J75A 3BC8A 2L9NA 3WTVC 3CF5F 1WCMJ 1YIOA 2H1LA 3S3NA 3S3OA 3PPBA 4E70A 3GZIA 5LLQA 2B7EA 2F5DA 1ZELA 3LAJA 2KIUA 4JBAA 1O3QA 1H0MA 2ESHA 2ZJ2A 3CUOA 3F8NA 4P96A 3PO2J 2XPWA 1BOBA 2FJI1 1D0YA 2HYTA 3R4KA 4W97A 2VLAA 4Q47A 3J7ZI 3OYEA 1ZGAA 2HWVA 3NNRA 5L3GA 4BDZA 4FASD 3H3VK 2LLKA 3OL4A 2LY2A 4HLXA 2MLKA 3BCGA 3OWTA 2VE9A 4OD4A 5F0FA 3SDGA 5HLTA 3BRUA 4M6YA 3HG9A 2VB6A 3F22A 2P6TA 4WXHA 2DQLA 4CA0A 5HDGA 1ON2A 5KAIC 3QPSA 3AAFA 5F27A 1LVKA 2KDOA 2B0LA 2DPUA 3KP3A 3IL2A 3SQNA 4PFOA 5C4JJ 4FISA 3TGNA 2O03A 2KHMA 3HXLA 4F3QA 3NS4A 2OTJI 2HU9A 2PI0A 2P0WA 1QZYA 1OJLA 2M4KA 1W5CC 2DBBA 2R3SA 4DYCA 3FX3A 2HEOA 1W5SA 2E34A 2E1OA 3CCYA 3FXLA 3TKYA 3HOYJ 3B81A 3C2HA 3GVAA 1JT0A 5FKNA 2EIKH 4XMYA 2JA7J 5FLXK 2R5YA 3OOPA 3DWLE 4MGRA 5FRMA 5FD5A 2W25A 3ROUA 5HDNA 1T6SA 3LSHA 2NVYJ 2L4MA 2V6CA 1FTTA 4L9NA 3OS2A 2FUG2 4QWQA 1KQ8A 4U87A 2XF6A 1LFPA 3H5AA 3BG5A 3DV8A 4ETSA 2JA6J 2OZ6A 2AS5F 4CYCA 4LIUA 5DUKA 1TWAJ 1D3YA 1I50J 4PJLA 5JFRA 3ELKA 2DN0A 3KP5A 1GV2A 4JX4A 4PJ0C 4I6ZA 3HOUJ 3CTAA 1BI0A 3BT9A 2PMZA 3ZQLA 1Y8RB 4M9XA 4BXFA 4M6XA 4QPOA 5JHFA 4OU0A 3FKIJ 2Z9OA 1FP2A 3LMMA 2ZOZA 3BP8A 1B9NA 4L5JA 4ZJZA 1H89C 3BQZA 5B1BH 5LRSA 2XKPA 4MLOA 3GTPJ 4ENJA 2BXYA 4YG2F 3CDLA 3OYMA 3GCMA 1TWFJ 2CUZA 4YEJA 4BXUA 2XDNA 4A0YA 3QBMA 4W1UA 3VOKA 4YRVA 2LVSA 5J6XA 3I53A 3GUDA 5FKKA 4QIWN 3KZIC 2Q2EB 2G7LA 1YW8A 4IF4A 1FOKA 3PJRA 1Y0UA 1R6RA 2G7UA 1RRJA 2NYXA 2EA2A 5JI6A 2RGVA 3C2GA 1XDSA 2R7QA 3R6SA 2NRAC 3HPGA 1D1BA 2EBIA 4BKXA 4D9JA 5F1RA 2K3PA 1LFBA 4PSXA 3HTUA 3V8JA 2WUIA 4PJNA 4FETA 1RR8C 1OKRA 3CCRI 4EJWA 3ANPA 3W2VA 4BDYA 1Q1HA 3BTJA 1K78B 1U6GA 2BYVE 3WHBA 3DPUA 2F2EA 2LTPA 1U9OA 2Y0SN 2STWA 1CGPA 1DGWY 4JOMA 4IX7A 1JKOC 4DIQA 2V1UA 4E7KA 1G3YA 4AD9A 1FP1D 3HKZA 4XLCA 1D5YA 2JPBA 3NARA 5A2QZ 1KONA 3JRIA 1JJ6C 5F04A 2EZHA 1BJZA 3N97A 1MBHA 4BGDA 1B59A 4UY8I 4XL9A 2A5YB 3D1NI 3P9CA 1IDZA 3VTIA 2NS0A 1ZKGA 2Z99A 1Z05A 2QSFX 1D8KA 1TQMA 2QQ8A 1OLTA 2OI8A 2QCOA 4M3DA 3JR9A 2REKA 1PDNC 1I27A 3CZ6A 2VBZA 1BOAA 3VYTB 2VQGA 4O3MA 4XRSA 3S1MJ 2OV7A 1HLVA 4L0ZB 2Y2ZA 1RC9A 4A2UA 1FBQA 1XGOA 3GX4X 2LRDA 1W5TA 5CYVA 3J80Z 2ELJA 2B63J 3G4SI 3BNIA 1RKWA 1O3RA 3LAPA 2E1NA 3ECOA 4HOBA 4FE7A 1O7FA 3EPZA 3IH4A 5CXGA 2H09A 3WTZA 5BMZA 3S2WA 1ITYA 2M45A 3CUQC 1EF4A 1F1ZA 3ZRGA 5HOOA 4MEXF 4U88A 1IRZA 1T56A 4XSXF 3E97A 4HW0A 4IRGA 1VQKI 4EJTA 1ERDA 1R22A 2CWEA 1IRXA 3CMYA 2DJNA 2D5VA 1QZZA 3H5NA 3E6DA 2Y9YA 3CP8A 5LBQA 2DTZA 5D5UB 3G56A 3T5XA 2FBHA 4V2GA 2ZXHA 3C7JA 1ZGWA 3K4NA 3OIPA 2CH0A 4PGGA 4IHXA 2VXZA 4MK6A 2K85A 2LF7A 1P4WA 3G2BA 4LG0B 4BBSJ 5EG0B 2LFBA 4A69C 2DG7A 3IWZA 3LFKA 1LPQA 1W1WE 3U1KA 3RIRA 3KEQA 1QBJA 2HQRA 3F8MA 2OQRA 3QYBA 4KWAA 2X85A 3MQ0A 4L9VA 3CCQI 1QPMA 2HR3A 5BPDA 3IKTA 2R7SA 1ETXA 5E3MA 1V5EA 2CRGA 4FCYA 4NHJA 2IA0A 2UXXA 1WVRA 4G7ZF 3DBLB 3HSRA 3GZ5A 3NWSA 4M74A 4XKVA 4MTDA 2QA4I 4M72A 2QTQA 4EVIA 4AIKA 2XF7A 1FEXA 2K86A 5ICFA 1ZH5A 2I5UA 4KN7X 2P5VA 1ZRDA 4ENKA 4WX9A 3DKYA 1J2XA 4P9FA 4EGZA 1U5TB 2F6CA 3F8CA 2XAHA 2EQRA 1SMYF 3GEZA 2GIVA 1Y56A 3A4CA 5CVIA 1UB9A 5KCMA 2XDVA 3LNQA 2HYFA 2EZIA 1Z3YA 2LG4A 5CQEA 4MEYF 4OWRB 2W7NA 2N8GA 4ZC3A 4ENMA 3MAJA 2ZMEA 5M3FJ 1USTA 3QOPA 3IUVA 2VJIA 2VPRA 2XPVA 1GLNA 4ESBA 2ELKA 4JNNA 1HC8A 2AHQA 1ZARA 2M30A 5GAEJ 3WTXC 2PJPA 2ZY9A 4I2OA 3OYJA 3VIBA 1GUUA 1Z67A 1ZG1A 1DU0A 2VOPA 2IVMA 4Q5SF 1MD0A 1ODDA 3OR1C 1Z77A 5B1AH 5GAHJ 4BY7J 2Y48A 3G1LA 3FRQA 2RAEA 2RDPA 2J5PA 4NUBA 3A03A 4ZYAA 5D5WB 2DK5A 3I54A 2RASA 4GGGA 1X3ZB 4NC7A 2HDWA 2E2HJ 2JMWA 2QSHX 2OF7A 2FSWA 2QQBA 3PNVA 2VN2A 2L5QA 1RZ4A 1ETKA 4RB2C 2HQAA 3ZMZA 1F5TA 1HSJA 4HZFA 2ZXWH 3VYUB 4A3EJ 3ULQB 1TP4A 1XX5A 2QZ8A 3BJ6A 1B1BA 5HNFA 1Y6IA 1VQMI 4KMFA 3BHQA 1B4AA 2H27A 3H5RA 2LDUA 6PAXA 3D5LA 3HTIA 5HAWA 1J5YA 4PXIA 2I8DA 4ZTJA 1KZHA 5LHHA 4RS8A 2CUEA 2QEXI 3TOBA 3A0BC 2X0LA 1HOMA 2FMLA 1TBXA 2DLLA 2GXGA 1J0RA 4MFDA 3CJNA 1WJEA 2DOEA 3CC7I 4QPQA 3ABTA 3T1BA 1RKTA 3BCBA 2M3AA 3DU6A 3KYCB 4GYIA 4EEFG 5J47A 1J09A 3CRJA 4UHTA 3F21A 3JSJA 3KKDA 1XGSA 1HF0A 3SEQA 2QWTA 5H2FC 2ZNZA 3OY9A 1ZGJA 2BZTA 4IOAF 3HYIA 4XLEA 5FLVA 4I09A 4N9IA 2V9KA 3M7GA 2COMA 5ILUA 3LQRA 5HS7A 3L2CA 4YIFA 3FXKA 5ERIA 3R0JA 3PUFA 4RGSA 3LSPA 4A93J 4IQ4A 1R71A 5HLGA 4MXMA 2GOMA 4RM2A 4X1EA 4M3FA 5LGNA 3ESWB 1QZEA 1W7PA 1X19A 3V8LA 1WJAA 2M2EA 3C1DA 2M5WA 4N0BA 3FWEA 3R60A 2FBKA 1NK2P 5F0CA 2XGXA 1S6LA 4E7LA 1FX7A 3S2DJ 1XG1A 4X6AJ 2WC2A 3UR3C 2X9DA 1YLFA 4LLLA 2LREA 1BN5A 2JVHA 4WCGA 4MFEA 5GPAA 2UUZA 2DXIA 3TOAA 3WHCA 2IGKA 4DGWB 2DO7A 3WG9A 2PX9A 2XGDA 5LD2C 3WGGA 2CS3A 3FMRA 3L1PA 2UZKA 3B02A 3IV5A 2PEXA 2KIQA 2PBXA 4BHCA 4UUVA 4II2A 3BPVA 3OSFA 3E6MA 5IOZA 1FY7A 1A6IA 3DCFA 1JUMA 1R7JA 2EZKA 2L9VA 3MZYA 2A07F 3AL0C 2CFXA 5IT3A 5IT9K 1R36A 2GFNA 4KDPA 4YFKF 4C3IJ 1JI8A 1TW2A 1SANA 4AVZA 3JAMK 3LA7A 1AKHA 3OIQA 4YFXF 1TZLA 3HIMA 2NS7A 2MC4A 3BZ6A 1SD6A 2M87A 2FRHA 2PJRA 4DNCA 2EIMH 3GFLA 3L09A 5F64A 3VVYA 1JUPA 4PDKA 4BE0A 5D6EA 2JT1A 3M4OJ 4N4OB 2VL8A 4RAFA 3RKWA 4OMZA 1HA8A 2LYCA 1R5HA 4G7HF 3I9V2 1SAXA 2XSJC 3DKWA 3OMYA 5E1XA 4IHTA 3HHHA 2DOAA 3KEYA 2CUJA 4XK4A 5JLWA 1MH3A 2E7WA 2VBWA 2JPCA 2Y75A 2PMHA 3JRBA 4WIBA 1LE8A 5IP9J 3RZOJ 2DOFA 2OUMA 2CV2A 3TW7A 3BPXA 3CUQA 1UFMA 2K5CA 4UXNA 1YX3A 4NC8A 5H6RA 3F3XA 4LITA 3SWHA 2CV1A 1R4NB 3RH2A 4IHYA 3C07A 3JW4A 2K27A 3FXQA 3CC4I 2NVTJ 4A3FJ 3V78A 4ZYHA 1UCRA 3ERMA 4Y17A 5HODA 1BM9A 2GAUA 4IJAA 2NVQJ 4X0GA 2A6HF 2WY7Q 3VSKA 1BBYA 3C2BA 4XORA 3ZN0A 4BEHB 4KUMA 3L2VA 2X6XA 4O6JA 3REOA 2HXIA 1I6XA 3PASA 1OR7A 4BHBA 3Q9VA 4IEJA 2DMUA 3GLXA 1RPWA 1LQ1A 2Z3YA 3BR1A 2E2JJ 2OPTA 3G1MA 2L0KA 5HS9A 2G7SA 1Z91A 2XASA 1S3JA 2KT0A 4S04A 4DQ2A 4UNOA 1FWZA 1A35A 4IQJA 4HRIA 2GA2A 3O8HA 2Y30A 1E3HA 5JVTA 3CMEI 3IHUA 5HDKA 3GYHX 3DLLF 2YS9A 3K8PC 1XD7A 1STZA 2MG4A 1R58A 5BNGA 2K9LA 3IAM2 3N4MA 2NNNA 2M4GA 4GXOA 3B6CA 3OYCA 5HSZA 1JE8A 1HW5A 3LWJA 5L3FA 1F43A 3AKZA 1IUFA 5E79C 3MKZA 2ZC2A 1TLHB 1VNDA 3K4CA 2AQFA 4PFPA 3BR0A 3H0GJ 4BH9A 4ANJA 3HTAA 5FJ8J 3VFZA 3AG3H 5EDNA 1GHCA 1WQ2A 2BY3A 3FM5A 1SGMA 4YIIA 1VQLI 1OCZH 2WB1N 4I7HA 3EDPA 4GCLA 2UV1A 3ZMTA 1IN4A 1U2WA 2RC4A 2VQLA 2R5YB 2R7VA 4G6QA 5K7ZA 1T38A 1N77A 4GFKA 2AO9A 1K79A 4XIDA 2CW0F 1DU6A 1PP8F 2KZGA 5ICGA 2G7GA 2DA6A 1D1AA 3S8PA 2Z33A 3ZXSA 1X2NA 4BBRJ 2D1VA 2KPMA 3AL0B 3HSFA 3T6NA 1VQ9I 1K6YA 3VW1A 3COAC 5J8CA 5J1RA 1VQOI 3GXOA 5H20A 4CYCB 1TT0A 1PP7U 2JA5J 3ASOH 3IH2A 1RUNA 4IRIA 1TNSA 5DS9A 2MYSA 3GTLJ 2HOTA 2LBFA 1ZQ3P 5FMPA 4Y4RA 1X1AA 4B4CA 1SMTA 1WZ2A 3AQSA 2V79A 1MKMA 4JQFA 3V7CA 3E7QA 3VUQA 2H6CA 3TP3A 5HBUA 1IXCA 2IBDA 1R5GA 2X6YA 3QP6A 3KPHA 3RKQA 2FNAA 3OYGA 2R7UA 2QVOA 5K5OA 1RNLA 3PM1A 1G3SA 5M5XJ 5E18F 2ECBA 3NAUA 3I3LA 3TL4X 3RPQA 1CF7A 4NN1A 4Y52J 2KISA 3WG7H 3VB2A 4U0YA 1Z9CA 4Y7NJ 3FXMA 2O7OA 1E3OC 3IC7A 2KIFA 3H3UA 2H6BA 1ETOA 4EJUA 3DTKA 3CQZJ 1WHUA 3F8BA 4HQMA 1VQ8I 4AF5A 2E5ZA 2KL4A 5E1ZB 3ZN1A 3ON2A 3JCUC 4ASNA 1OQYA 3KP2A 4BQQA 3BR3A 2FEZA 3G1OA 1UG0A 2BY0A 3FZVA 2VKEA 4YFNF 5E8GA 1C0WA 2MD5A 4CZCA 4A3BJ 4ZDOA 3WTSC 4OIPF 2A6EF 1G6NA 1TT5B 1FYLA 1YO5C 3Q9SA 2ZMEC 1KU2A 3G6EI 3VW2A 2HTSA 2D6YA 4QLCU 2V9VA 2MFZA 4IHWA 3V7RA 1J7KA 5AIPA 3T8RA 3M8FA 2BBYA 3PSFA 4ABZA 1JKQC 3BWGA 4GDFA 1GVDA 3FMQA 2RREA 3BZKA 2A05A 1G3TA 4BY1J 2IS2A 2LF8A 4RGXA 2BVMA 5EEGA 5FGMA 1I39A 2MA3A 3HGYA 2G0EA 1ZR4A 2R7FA 3OSGA 5FLMJ 3BG3A 4A12A 1UI5A 2V9PA 2XUBA 4U0WA 5DYMA 3K1PA 2M0MA 3COLA 1BW5A 2JA8J 3S14J 1ZYRF 2X6OA 5HVQC 1LDDA 1YW9A 3M8JA 3N05A 2YSRA 1R1TA 3LSMA 1HDDC 1IC8A 4UV8A 4HPQA 4CO8A 5IOYA 4IHVA 1MNDA 3A02A 1WJ5A 3M07A 3MD2A 3J81Z 3I0TA 3CCMI 3HC7A 1QPIA 3BJAA 2PBIA 3W2WA 1VF9A 5C4XJ 4ICHA 2W48A 4HF1A 2XGCA 4E7JA 1A6QA 5EGOA 4UVBA 3S3MA 4E7SA 3D0SA 1IXRC 3HZJA 4OOIA 1OYYA 4OIRF 4CGRA 1V3FA 4U7DA 5IP6A 1FMVA 2F48A 1VQNI 4KN4X 3PIPF 2ZNYA 3RKXA 2PLYA 3C3WA 1S9HA 2X1CA 1DDNA 1OYWA 2BXZA 1MMSA 4C3JJ 1E17A 2XRNA 2MLGA 3LQQA 1BIBA 3PFYA 1A5JA 2NS8A 3TDUC 4I02A 4I01A 2C6YA 1KGSA 2M7BA 1MJAA 4TV7A 4CCMA 2K4JA 3HJEA 2L7KA 2ZBKA 3ZQGA 5DDGA 3FISA 2R7RA 2V57A 2WGBA 4PK4A 3JTHA 4NQWA 1T39A 2G9WA 1XMXA 2HNHA 5KAFC 2GZWA 2XKOA 1POGA 2QM3A 2LKPA 4HBLA 4LB5A 4OAYA 1DP7P 2MH2A 1WJDA 2OERA 2HZDA 1UJ8A 3ABUA 3KP4A 3CLQA 2JN6A 1H9TA 2FA5A 2RNGA 2AXLA 2UXHA 5A2QK 3ON4A 1X3UA 2VJJA 3MKYB 3M1CA 2E36A 2E7XA 4FT8A 4CYDA 3LWFA 5KNLA 2LKXA 3O6BB 2HDDA 1XCBA 2V1XA 1DGRM 3GBGA 4YELA 4AVPA 3CDIA 1W4MA 2X6WA 1P4XA 2BOLA 2EFQA 4HAMA 5TJJA 5KK1A 3CJRB 1WJBA 1DP3A 2QIBA 2KLOA 3K4JA 2VXDA 3CCEI 3NEUA 3PNYA 2JJ7A 4DZJA 2PFBA 3Q0UA 5D19A 4XLPF 2VOOA 1IO2A 4IXAA 4OAZA 2XAFA 1BR2A 3F8FA 1R9TJ 3SZTA 3RYRA 3J7AO 1AU7A 2ZFWA 3J80K 1WJCA 5CJ9A 4XOTA 1PJRA 2BHYA 2R7DA 1EH8A 2ZMEB 2W84A 3NXCA 1ONVA 3MKLA 4EGYA 3HPHA 2YU9J 2CMPA 2PG4A 2WY8Q 3E3VA 4ESFA 1BR1A 4AWXB 5DD4A 2W4SA 2DQRA 1YTYA 3L00A 2DFIA 3HUGA 3ISPA 4IL6C 1JKRC 3BG9A 2VC0A 1R49A 2DT7B 1X2MA 3K0LA 4FE4A 2LH9A 3RQ4A 4HSRA 2HPMA 3K69A 1OCRH 4K2EA 5AONA 3H0DA 3TBIA 2IGNA 3JRFA 2HI3A 1SFUA 2E1MC 2ID6A 1EA3A 2DG8A 2ME6A 5E17F 1TWGJ 2VBXA 1R23A 3CWRA 3RYPA 3UNGC 2KJCA 1YI2I 1BJAA 2IJLA 4XRSG 2QQAA 2X48A 5FB2A 2OZUA 3GZ6A 2K02A 3ML6A 1X1CA 1IRGA 4J00A 1GVJA 2KKOA 5J8FA 3WTYC 2BV6A 3I64A 4HX7A 1MBJA 3LL7A 4B1RA 3WE3A 4GO1A 4C9YA 3BOQA 4DOZA 4IKFA 2DU9A 4NNJA 5DUIA 3EUHC 1E0EA 1OR7C 4HNTA 3HOVJ 1QO0D 1D8JA 3V7SA 1SC7A 1EJ9A 4HLYA 2ADUA 4LFUA 4BQOA 1ZAOA 3VEPA 3OYIA 1V5FA 3PO3J 2QKMB 4XICA 3T8TA 3C18A 2EILH 1N25A 1UELB 1MJBA 1IJWC 1O7LA 4A3MJ 3BG6A 1LUJB 1P2FA 2R7WA 4PGHA 1O3TA 2TCTA 2H1KA 4G94A 2ZCXA 5F6FA 2P7VB 2JRTA 4L5EA 1L3LA 3TEDA 1HKSA 4G8XA 4YIRX 4RB1A 3W6KB 3ZP5A 4OD5A 2L4AA 3ZGKA 1FYKA 1MH4A 2NP3A 2ZB9A 3NRGA 3H92A 3HRSA 3EUPA 3KX2A 1YJNI 5IYCJ 5LEKA 3S16J 2XIGA 2R92J 1GDTA 3CCUI 1W7PB 1VI0A 1IN7A 1DPUA 2DA3A 5DD8A 2HTJA 1IGNA 1RETA 4KMUX 3HSEA 5DV5A 3QP5A 3CCVI 2LNBA 4KFCA 1F9NA 1B6AA 3EGQA 4PJMA 5H6QA 2R0QC 1SEUA 2WAEA 3GO5A 3VP5A 1U0JA 4LK1F 3HL2A 3EETA 2QUFA 3OYHA 1O3SA 1OCTC 5K58A 4BE1A 4XONA 1X58A 3ABMH 4AIHA 5ICCA 5D4SA 4BQNA 2O8KA 3K6GA 1XCVA 2L01A 1OMIA 1WI9A 3SHFA 4C3HJ 3I55I 2BY2A 1DPRA 2W1OA 2CUFA 1MNMC 4O5VA 5TRDA 3KETA 2M8GX 3K1NA 4S0HB 2YX7A 3QPTA 4F52A 2VIXA 2NOGA 4RLQA 3GFJA 4BJ6C 1LVAA 5F0HA 1I3AA 3H1CA 1AKHB 4AM3A 9ANTA 2RHAA 3K70C 1A04A 2GQQA 5LGUA 3VVXA 1IW7F 1SFXA 3CC2I 3BCAA 1YHQI 3GTKJ 4NBQA 1WGXA 4AU7A 3B73A 3LOCA 2KFDA 3SDBA 3WU1B 2PJRB 3ZQQA 1XDUA 2CU7A 3HM5A 3S2HJ 3R0AA 4BJTA 4JL3A 2K9QA 4BHPA 5E3NA 4A5MA 2IEKA 4P1WA 3ZMDA 4E7HA 5J40A 1BI3A 2MGQA 3MCZA 1S5LC 2E71A 1WSUA 4DYQA 4N9HA 4B48A 2OD5A 5DAJA 5LFAA 5ED4A 5EFYA 2GOXB 2JUCA 1LE8B 4M73A 2GXAA 2IW5A 5C3EJ 2O6GE 3CUQB 3QQAA 3BJBA 3VOXA 1V54H 5B66C 1WWXA 3F6OA 4EJVA 3HTJA 2WV1A 3O60A 3HB9A 1GV5A 3E6CC 5K5RA 5B5EC 1UHSA 1JKPC 1SVOA 4ZDLA 3OR2C 4R1HA 1EV7A 3E7LA 1IV6A 4RAGA 4WXDA 3CCSI 4RGUA 4EV0A 1RUOA 3LJLA 2HVRA 3WE2A 1NG7A 1X4OA 3H9JA 1ETQA 1OCPA 2R7OA 3LSJA 4BXXJ 1YE9A 3KLOA 4FX0A 4EQQA 4A5NA 3QPHA 3BTIA 3WGIA 2FF4A 2ESNA 3NWTA 1FBSA 4M3EA 2P5LC 2AQEA 1BI2A 4HNUA 4E6KG 3DTEA 3RTRA 3ERED 3MNLA 3AQTA 2XGEA 3VWBA 2VQCA 1AOYA 3IAS2 4P55A 3H9QA 2JRMA 5TISC 2NVUB 5CXIA 5H9TA 4HEA2 2VJ5A 3OYDA 4IOCF 1OCCH 3ZQFA 3ANGA 2XB5A 3EUKL 1FSEA 3LSTA 3K7AJ 2IP2A 4QSHA 5CPRB 3LA3A 2BEOA 1KQ9A 3A0HC 3EYYA 1D0ZA 2BVLA 4H0EA 4UUSA 4F7ZA 1FZPB 1Z3XA 1GXPA 3CJDA 5CVJA 2L7FP 2EV6A 5KVRA 2R4GA 2DMQA 3QWLA 4ZDPA 4LIVA 3O3KA 2ZCNA 4BQAA 2W53A 1GXQA 2GBYA 4KIBA 2ID3A 3RKYA 4DZPA 5C4YA 3K2ZA 2LC2A 1B72A 4CCLA 5D18A 1PUFA 2EV5A 4L0YB 2K3FA 2VI6A 1JUSA 1EKEA 2CYYA 1U9NA 3QRFF 3HBLA 1SFKA 1FC3A 2HKOA 2KDZA 4FX4A 1LDJA 2DAOA 1KYZA 1G59A 1HQCA 2VBYA 3EQLF 3SFIA 5CLSA 2HYJA 4JX6A 3HTSB 2XAUA 3QYFA 2IS4A 1U8RA 4B09A 3HEFA 3FMSA 3FHZA 4XR6A 1FT9A 1U3EM 3OS0A 2AXTC 2HXOA 1XSVA 4IVNA 2HQ5A 5DEQA 4A6DA 2K4BA 2H94A 2KMUA 3I4MJ 1OYIA 5DTDA 1APLC 4Y33A 3FBNB 3K9TA 5FD6A 2F4MB 2JZYA 2IT0A 1U8BA 4XQFA 2DPDA 1W0UA 2BW3A 4MTEA 4D0PA 5KHDA 2WAQA 2LBFB 4BACA 4RAZA 5LGTA 2EFNA 3OYAA 1BL0A 4HYEA 4WF2A 3GW2A 4GCVA 5AIQA 3I4NJ 3KZZA 3KCCA 2Y0MA 3QAHA 4U7BA 3E5XA 3VYRB 4AC6A 3L2QA 1CQTA 1PVEA 3KZYA 3M1EA 3ASNH 3U1DA 2G7HA 4IPAA 5M3MJ 2O7TA 4RM3A 3BQYA 1FSHA 4XLFA 1WPKA 2ZJPF 1ZLJA 5CVVA 1CF7B 2LMDA 4LMYA 1PYVA 1OFCX 1WI3A 3DEUA 3EUHA 3ABLH 2ISZA 1XTAA 2DA2A 1G4DA 2L2OA 3V4GA 2FQ3A 2NVXJ 3IH3A 4IRHA 4E4HA 1YQAA 4XKBA 5CVUA 3J7YJ 5F08A 3WTUC 2YVEA 3GWZA 2VC1A 3TP0A 1FTZA 4P9UA 4AYBA 5IY5H 4B8XA 1YOVB 4KISA 1B8IA 2FJ1A 2ZXJA 5ILVA 2JTVA 4B44A 5JVGF 1I6HJ 1MGTA 3PFIA 4BAYA 4RLFA 5JHUA 1YIJI 2DJIA 4FQGA 2OC6A 2XAJA 3IWFA 4KIFA 3BZCA 4XKCA 3TO7A 4UDSA 2JA2A 3DQVC 5D8KB 3CESA 4G6TB 3HE0A 3LSGA 1VQPI 1IDYA 4UB8C 1TC3C 3G7RA 3OS1A 3U21A 3ZCOA 5AQCA 4JX5A 1Y1VJ 2W57A 3WODF 3VPRA 4HF2A 2E5NA 5DCMA 1B9MA 2YPRA 1VQ5I 4B47A 2E1CA 3WTTC 4KA4A 1YJWI 4V19K 1Z0XA 3DPTA 1ZREA 3GFMA 3F72A 2CV0A 1D0XA 1UMQA 2STTA 4D1QA 2VASA 3MN2A 4F93B 2XVCA 3BTLA 3MKWB 1ACIA 3VW0A 3LHQA 1P7JA 2DK8A 1E3PA 2DMPA 2CFOA 4LK0F 3ZMSA 2A3SA 2GIZA 3GTGJ 1XC5A 3SEZA 4KJZA 3ZMVA 1RESA 2Z5UA 1OCOH 4A3LJ 5IYDJ 1IRFA 3G3ZA 3KE2A 1Z7UA 2ZXIA 1RR7A 4F92B 3HGGA 1IAWA 4LG3A 4HX8A 2Z16A 3K2AA 3FXRA 5ILSA 1ETYA 1UAAA 4JKZA 1YG2A 2Q8KA 1F4KA 3AG2H 2F5VA 5D1RA 2OU2A 3FDYA 3ZMUA 5EYRA 4C2MJ 2Z2SB 4A3CJ 3GTOJ 3JRAA 1NTCA 3JRHA 5EZHA 2COBA 1TQPA 2FOKA 2V1DA 2VT2A 2IGMA 4GFBA 3MZHA 3U9GA 1USSA 1Z6RA 5E3LA 2RN7A 5EGOB 2B9SA 1HXDA 2L7MP 3A01A 4A3DJ 2HGCA 4AIDA 5M5WJ 1ZR2A 1P6RA 1NK3P 3RPUA 3I59A 3PNTA 2XSDC 1S7EA 1U78A 4XLAA 1ENHA 4I0BA 1JHFA 4PJJA 5FGLA 5BQTA 1SFOJ 1GT0C 4N4NB 1Z21A 3PSIA 4CXFA 2BGCA 2Y9ZA 3Q0VA 1O4XA 2JUGA 1O57A 1J59A 2W00A 2QQ9A 3VDXA 1IF1A 1MMNA 2FX0A 2EA4A 1W7PD 2DDBA 4A0ZA 1MBKA 1HW1A 3CP2A 5FO5A 3MFKA 4CHUA 2VONA 4NQWB 1X4PA 1LFUP 3GF2A 1KYWA 4A3KJ 1VFCA 4HV6A 5GTIC 2XAGA 3FBIB 4GYGA 2A6TA 2CQKA 4BEHA 2MW8A 1QVTA 4ZZDA 4RBOA 4BE2A 1ZTRA 2O8XA 4EM0B 3ABKH 2PMZN 1JTXA 2HFHA 1WH7A 1OISA 2K40A 3JRGA 2DFFA 5FKMA 2QKLB 2EFWA 2HYGD 1YITI 1Y1WJ 4M3GA 3TO6A 4MHGA 2YX4A 5LHIA 3S17J 1UG2A 2F5EA 4L9TA 3KKCA 1UI6A 4HX4A 1LEAA 5EJCA 2WB1A 1YRNA 2NNYA 2KJBA 4P5OA 4B43A 2V1NA 5E20A 4HDUA 5J1UA 3WGHA 2YU3A 1A36A 4MQVA 1LB2A 4E7IA 5BOXA 1SFEA 1TW3A 4J19A 5K1YA 4MIMA 4D5FA 2Q24A 4M9SA 2KP6A 4XNFA 3ZQ7A 1VTNC 1Y39A 3Q3SA 3KEOA 1XGNA 3J81K 4HV5A 4NDLA 1D5VA 3CJTB 1HBXG 1J9IA 4WXCA 2HS5A 4CCJA 5CW8A 1TWHJ 3LSIA 2IRFG 2R5ZA 3EYIA 4Y13A 4H4KC 1QNTA 4ZYEA 2F4IA 4A3JJ 4PCQA 2ZFUA 3KZ9A 2L54A 4MQ9F 1RIOH 2IS1A 5FFZA 2FD5A 4B3AA 2RV8A 1H88C 2YVHA 2LY9A 2FOWA 2V4JC 3BR6A 2QBYA 3HUGB 2FQ4A 2RKHA 4UVCA 1IN5A 2DA1A 3HRUA 4RMNA 1HSTA 2VKDA 3GTMJ 3SZGA 2QF7A 1LEBA 4XLHA 4BYYA 2NXNB 1LDKB 1R1UA 3P7NA 5FFXA 1MDMA 4DJAA 5LEJA 3HKZN 5K7HA 4XSZF 1T2KA 3DEWA 2UXIA 4NB5A 1SD7A 3H36A 3W6JB 2GENA 3DU5A 3VVZA 4L9JA 4D5CA 1VQ4I 3AG1H 1FIPA 1ZHFA 5FLXZ 5LHGA 2E60A 2XPUA 2M8EA 2XROA 4ACIA 3M9AA 4DVYP 1N75A 3BROA 1VQ6I 2UXUA 3ZQCA 3V42A 3FHNA 1BA5A 3D5RC 1X3WB 4CGZA 3P9TA 2HQNA 2VUMJ 1S72I 2X4HA 5HNHA 3CJQB 1AA7A 1D1CA 3SJMA 3DXJF 1W36C 2M0CA 4U0VA 1WH5A 2DCEA 3ZPLA 2MBFA 4ZZLA 3CCJI 4EMSA 1WKMA 4Z6YA 2QLZA 3S5RA 2KRCA 1KU9A 5J3LA 1P7IA 3VOEA 2ZJQF 2OA4A 3S93A 3DTIA 3PQKA 4XKWA 4DYRA 1MNEA 5HLHA 1S7OA 1MZBA 2CSOA 4XN3A 3TO9A 4JYKA 4R79A 3M8EA 2V7FA 3GFIA 2UWMA 3JRCA 1R4MB 1FLIA 5BS6A 1SVMA 5L3BA 2WWYA 3GMEA 2KRFA 2E35A 3CCLI 1U5TC 2ZSIB 2A2FX 2Y31A 4RDUA 4LD5A 2W85A 3MMYB 2BY1A 2CQQA 1FMWA 3KNWA 2VQHA 2IA2A 2ZCWA 1EH6A 1I3QJ 3RQIA 2PFVA 3ECHA 2QSGX 4C2MA 2KRHA 2IAIA 3X2QH 1HKQA 3L2UA 1REPC 1NG6A 3HOZJ 4DW6A 1Q1VA 2P6SA 1T98A 4Z2YA 3LFUA 2P81A 3ZOBA 2D45A 2EFPA 3KLNA 3VYSB 4L18B 4NELA 5EEAA 3AG4H 3Q5FA 5D5VB 2DW4A 5FRNA 5L3CA 2RNJA 2ZOYA 5L3EA 2ICWG 1M1EB 4XN0A 2VKHA 3J7AY 3FK7A 3OOUA 2FMYA 2QYOA 3K70D 4BNCA 2DT5A 2VJ4A 3HOWJ 2IXSA 2CJJA 2GA1A 1TTYA 2DT6A 3OYBA 1L0OC 2HKUA 3VODA 2NOJB 4BUPA 2W24A 3QU3A 1NH3A 2F07A 2DMNA 1I5ZA 3CO6C 2JVGA 3RPUD 1JXSA 3MWMA 1R5ID 1DQUA 2A68F 2ETHA 3RJPA 2X51A 5LRRA 4CDGA 1ZG3A 3IP4B 3RZDJ 1UHMA 4G12A 3QODA 4M71A 1Z1DA 2DTRA 2JQ7A 2FBQA 4DBQA 2QWWA 3E1SA 1XN7A 1XSDA 5DCFA 3L2RA 3GTQJ 1QRYA 4M3BA 2YVXA 3CMMA 1MBGA 1NHAA 1HKTA 2HOEA 1TNTA 4KYWA 2XAQA 4AIJA 1ZG5A 3D5SC 3SYTA 1N78A 3E5UA 4ZH4F 5JR3A 2Y0SA 3DPJA 2MABA 5FHPA 5L3DA 3CLOA 3H35A 3DLAA 2DA4A 3DPLC 3W3CA 4HQEA 4WK8F 3ZQHA 3OL3A 3BLYA 1ZLKA 2DFEA 3H9GA 3TQNA 4Y3OA 1T0FC 4OIQF 5IYBJ 1JGSA 1G8XA 2Q2EA 4IO9F 4F91B 3L7WA 2TRTA 2M9HA 1ZK8A 3F23A 1V5GA 4M9ZA 2CGPA 5HS8A 1IXSB 1SD5A 4DBRA 4HG2A 3BG7A 1WJFA 2A61A 3G71I 1KA8A 3JSPA 1X1PA 2CQNA 3O2PE 5ICEA 5BPIA 1V4RA 3IUOA 1XPXA 4I99C 2DODA 1K78A 1JGGA 2D1HA 2WV0A 3K4MA 5FKOA 4ON0A 3QPLA 2HPIA 2OJED 1MMGA 2LSOA 2LY1A 1H8AC 4UUTA 2LOOA 2V6EA 4KIGA 4BJ5C 3LSKA 1S29A 4S05A 1ULYA 2IGOA 4BS9A 1AHDP 1FBUA 1FNNA 3BR5A 4BL0B 2DYSH 2DDAA 4UUSB 2QOPA 4CCKA 3PIOF 5E3OA 3MVPA 1LNWA 3BJOA 3MZ8A 5DM7F 2VE8A 3RCOA 4RB3C 1HW2A 3B6AA 4LGWA 1B72B 3GEUA 2XRLA 3FXUA 5GAGJ 2EZLA 1PUFB 2FXAA 2QENA 4CSWA 3P9IA 2Q1ZB 2P8TA 5D5XB 2P7CB 3FKJA 4QTRA 1IV8A 5GPCA 2DI3A 4HSTA 3EUAA 3TW6A 3QYEA 1ORKA 4HF0A 1AWCA 1LKXA 4Y15A 4G7OF 3WU0A 1FOXA 3IKVA 3QU6A 3P5JA 2ACJA 2CQ7A 2JSCA 1TL8A 3OYKA 1MBFA 3KIOA 4I0AA 3PQJA 4KICA 5D8LB 3S1QJ 2OCCH 1DUXC 2EJRA 3FXJA 3HDDA 3LA2A 3V6GA 3F6VA 3E5QA 3NI7A 3L2WA 2E1MB 4F55A 2F4OB 4PSWA 2Y69H 3OYFA 2BW3B 1T33A 3KYDB 2LD5A 3DBRB 2XF5A 2CW8A 3L9FA 1ZRCA 4JK1X 1WRJA 1WFXA 1T8IA 1I1GA 1MJ9A 2EPFA 3ONQA 2CW7A 2O5RA 2ZCMA 1Z7LA 4D7MA 1SVLA 1T95A 4XM3A 2IA1A 2MSYA 3LSRA 3KYLA 1QHGA 5JLXA 2NX4A 2HVSA 4LG0A 2CO5A 5EG0A 4OMYA 1JTYA 1F36A 4I76A 5TGTA 1W0TA 1X1DA 4LOCA 1IUYA 3RI4A 1QHHD 1QVUA 2PN6A 3JREA 2MH9A 2ZSHB 3R61A 2P4WA 2KIMA 3HTHA 3I4PA 1H9GA 2H8RA 1JT6A 2O9LA 5M5YJ 2LP0A 4EM1A 5C44J 1ZRFA
chains in the Genus database with same CATH topology
1B8IB 1VF9A 2DTZA 5C4XJ 2W48A 3BTLA 3G56A 4ICHA 4V2GA 3VW0A 2XGCA 1ZGWA 1P7JA 3LHQA 3NPIA 2DMPA 5EGOA 3FIWA 2WAQN 4IHXA 4MK6A 3O8GA 4CGRA 5IPAA 3GTGJ 1XC5A 5IP6A 4BBSJ 1RESA 5EG0B 2LFBA 4A69C 2DG7A 4A3LJ 5IYDJ 1RR7A 3HGGA 4KWAA 4C3JJ 4V2FA 3K2AA 4FTHA 1ETYA 4JKZA 1A5JA 4JP0A 2NS8A 5D1RA 1ETXA 5EYRA 5EZGA 4C2MJ 5E3MA 4A3CJ 2CRGA 4FCYA 3GTOJ 3JRAA 1BW6A 1NTCA 2JWTA 3JRHA 5K7FA 2ECCA 5EZHA 2ME0A 2COBA 3ZQGA 2UXPA 2QTQA 3FISA 4GFBA 2V57A 2WGBA 5EGOB 5E3LA 4GCTA 1FEXA 1MSFC 4AYBN 2UXOA 2L7MP 1K83J 3A01A 4A3DJ 3F0CA 5M5WJ 1ZR2A 1POGA 1NK3P 5C44J 2QKOA 2EQRA 5J1YA 3ZQIA 2XSDC 1S7EA 1U78A 2OERA 1ENHA 5GP9A 3LNQA 5FGLA 1SFOJ 1GT0C 2PZ9A 2JN6A 2EZIA 3M3YJ 3S15J 2Y9ZA 3Q0VA 3JRDA 2UXHA 3ON4A 2N8GA 4D7NA 1ETVA 1O4XA 4A3IJ 2VKVA 4L62A 5M3FJ 2FX0A 2K9SA 3IUVA 2LKXA 2NP5A 2HDDA 2DMTA 2VPRA 1MBKA 2XPVA 3GBGA 2ELKA 4JNNA 2AHQA 1MBEA 3Q0WA 2QIBA 1LFUP 5FKLA 3A01B 4A3KJ 2LR8A 1GUUA 1VFCA 3VIBA 1DU0A 2JJ7A 2GLOA 4DZJA 2MW8A 1QVTA 3Q0UA 4RBOA 2XB0X 1ZTRA 5D19A 2R7ZJ 2PMZN 1G2HA 1JTXA 1Z77A 2HOSA 4GFLA 1WH7A 2K40A 3JRGA 4BY7J 5FKMA 3G1LA 1R9TJ 3FRQA 2RAEA 2JK3A 1Y1WJ 4M6VA 1AU7A 3A03A 4M3GA 1JJ8C 2DA5A 2RASA 3S17J 1UG2A 3NXCA 4GCKA 3KKCA 1UI6A 3MKLA 2E2HJ 2YU9J 3W6VA 2IU5A 1YRNA 2JMWA 2OF7A 1ETKA 2R93J 5J1UA 3BTCA 4A3EJ 1JKRC 1IG7A 3BHQA 3BG9A 4J19A 4MIMA 4D5FA 2Q24A 1TWCJ 4XRMA 5EF6A 1X2MA 2L9RA 3Q3SA 3HTIA 4FE4A 5HAWA 4PXIA 4AUXA 4NDLA 1XS9A 2CUEA 3QKXA 3JRFA 2HI3A 2M34A 2ID6A 1HOMA 3S1RJ 5CW8A 1TWHJ 2DG8A 2ME6A 4MFDA 2R5ZA 1TWGJ 3CWRA 1K61A 2L7ZA 3GTJJ 4A3JJ 4XRSG 2X48A 3FK6A 3KZ9A 1RKTA 4EEFG 1YRNB 3RD3A 3CRJA 2FD5A 3JSJA 4HKUA 3KKDA 4B3AA 1H88C 2YVHA 2LY9A 1HF0A 3S1NJ 2QWTA 3BR6A 4B1RA 1MBJA 2FQ4A 2DA1A 5FLVA 2EH3A 3GTMJ 4ME9A 2QF7A 2I10A 4YZEA 4AC0A 3HOVJ 3LSPA 4A93J 3HKZN 1FIAA 5K7HA 4MXMA 3DEWA 2UXIA 2E19A 4X1EA 2R5ZB 3PO3J 4M3FA 2HOAA 4XICA 2GENA 3VVZA 4D5CA 1ETWA 3HOXJ 1IJWC 2M2EA 4A3MJ 2G3BA 4MO7A 2GM4A 1FIPA 1NK2P 5F0CA 2XPUA 3S2DJ 4X6AJ 1XG1A 4ACIA 4HNVA 2X9DA 2TCTA 2H1KA 2ZCXA 2UXUA 3ZQCA 1BA5A 4MFEA 5GPAA 4L5EA 3F1BA 3WHCA 3TEDA 3P9TA 2VUMJ 2XGDA 3L1PA 3SJMA 3IV5A 2PBXA 1MH4A 2M0CA 2ZB9A 2NP3A 3NRGA 1WH5A 3OSFA 5IOZA 3DCFA 1A6IA 3BR2A 3EUPA 3S16J 5IYCJ 2CQXA 1JUMA 2EZKA 2R92J 3S5RA 1GDTA 5J3LA 4A3GJ 1P7IA 1HCRA 2GFNA 1VI0A 3UKGA 2GUHA 2DA3A 1IGNA 4C3IJ 4DYRA 1RETA 5F1JA 1SANA 1AKHA 2LK2A 4JYKA 3EGQA 2R0QC 3HIMA 2NS7A 3VP5A 3JRCA 1FJLA 1OCTC 5K58A 3OIOA 1X58A 3VVYA 1JUPA 2YUSA 2Y31A 4RDUA 2O8KA 3M4OJ 2CQQA 3KNWA 4C3HJ 5IP7J 2K9NA 2CUFA 1MNMC 1I3QJ 3RQIA 2E2IJ 2M8GX 4S0HB 2DA7A 1MSEC 4XK4A 5JLWA 1HDPA 1MH3A 2IAIA 2NOGA 1WCMJ 5F0HA 3PPBA 3JRBA 3HOZJ 3GZIA 4DW6A 1Q1VA 1AKHB 9ANTA 2RHAA 1LE8A 2P81A 3ZOBA 5IP9J 3RZOJ 3VVXA 4NELA 5EEAA 3TW7A 3PO2J 3GTKJ 2XPWA 1WGXA 2ZOYA 2HYTA 3LOCA 4W97A 3RH2A 4IHYA 3C07A 2CU7A 3FK7A 3HM5A 3NNRA 3OOUA 2NVTJ 3H3VK 4A3FJ 3S2HJ 4JL3A 2LLKA 3V78A 2K9QA 3HOWJ 5HODA 5E3NA 2CJJA 2IEKA 2NVQJ 3BCGA 5F0FA 3C2BA 3SDGA 2HKUA 3BRUA 2MGQA 2HXIA 4DYQA 2F07A 2DMNA 3PASA 4IEJA 2DMUA 1RPWA 3QPSA 5F27A 3BR1A 5DAJA 2E2JJ 2OPTA 3G1MA 2L0KA 5EFYA 2G7SA 1LE8B 2KT0A 5C3EJ 5C4JJ 4FISA 3QQAA 3BJBA 3VOXA 3RZDJ 3HTJA 4G12A 1OJLA 2WV1A 3O60A 3HB9A 3O8HA 4DYCA 1GV5A 2Y30A 2FBQA 1UHSA 1JKPC 2E1OA 3CCYA 3HOYJ 3B81A 3E7LA 1JT0A 2YS9A 1IV6A 2MG4A 5FKNA 2JA7J 5BNGA 3GTQJ 2R5YA 1QRYA 4M3BA 3LJLA 3B6CA 1ETQA 1MBGA 1OCPA 3LSJA 4BXXJ 5HSZA 3BTIA 2NVYJ 3LWJA 4M3EA 1F43A 1FTTA 1IUFA 3DPJA 5FHPA 3MNLA 1VNDA 2DA4A 3AQTA 2XGEA 3ZQHA 3BR0A 3BG5A 3H0GJ 2JA6J 3HTAA 4CYCA 5FJ8J 1TWAJ 5EDNA 5CXIA 5H9TA 1I50J 5IYBJ 4I6ZA 2DN0A 4JX4A 1GV2A 3HOUJ 1SGMA 3BT9A 2TRTA 3ZQFA 3ANGA 3ZQLA 2M9HA 1ZK8A 2XB5A 4QSHA 2WB1N 3K7AJ 4GCLA 2R5YB 4UUSA 3FKIJ 5K7ZA 4GFKA 2AO9A 2ZOZA 3CJDA 4XIDA 2L7FP 1DU6A 1H89C 3BQZA 2G7GA 2DMQA 2DA6A 4MLOA 3GTPJ 2ZCNA 1X2NA 4BBRJ 2W53A 2GBYA 2ID3A 3CDLA 4DZPA 5C4YA 3T6NA 1TWFJ 1B72A 1JGGA 3VW1A 2XDNA 5D18A 5J1RA 1PUFA 3QBMA 4W1UA 5FKOA 3VOKA 4CYCB 2LVSA 3QPLA 2JA5J 3IH2A 5FKKA 4QIWN 5DS9A 2VI6A 2G7LA 1JUSA 3GTLJ 2HOTA 1H8AC 1U9NA 4UUTA 1ZQ3P 5FMPA 4B4CA 3AQSA 3HBLA 2KDZA 3E7QA 3VUQA 1AHDP 3TP3A 5HBUA 2IBDA 3BR5A 2QOPA 3SFIA 4UUSB 3RKQA 2HYJA 4JX6A 2EBIA 4BKXA 5E3OA 3MVPA 3HEFA 1LFBA 3PM1A 5M5XJ 2ECBA 3NAUA 2WUIA 2HXOA 4NN1A 2HQ5A 4Y52J 3I4MJ 3B6AA 5DTDA 1APLC 3ANPA 4Y7NJ 3BTJA 1B72B 3GEUA 2XRLA 3WHBA 2EZLA 1PUFB 2LTPA 2O7OA 1U9OA 1U8BA 1E3OC 2Y0SN 1W0UA 1JKOC 1ETOA 4QTRA 5GPCA 3CQZJ 4AF5A 1BL0A 3TW6A 1ORKA 1D5YA 3ON2A 3NARA 3I4NJ 3BR3A 3G1OA 4AC6A 1CQTA 3JRIA 1JJ6C 5F04A 2EZHA 1BJZA 1MBHA 2VKEA 5M3MJ 2O7TA 3D1NI 3BQYA 1IDZA 4A3BJ 1MBFA 1WPKA 1ZKGA 3S1QJ 3HDDA 1OFCX 1WI3A 3V6GA 2OI8A 2QCOA 4M3DA 3JR9A 2REKA 3NI7A 2DA2A 3VW2A 2D6YA 2NVXJ 4IHWA 3IH3A 4ABZA 1JKQC 4XRSA 3S1MJ 1GVDA 5F08A 4BY1J 2YVEA 3TP0A 1FTZA 1T33A 1HLVA 2LD5A 2Y2ZA 1B8IA 2FJ1A 1I6HJ 3HGYA 2G0EA 1ZR4A 2B63J 3OSGA 5FLMJ 2ZCMA 1RKWA 3BNIA 3BG3A 4D7MA 1UI5A 3LSRA 2MSYA 4UDSA 5JLXA 4FE7A 2NX4A 3IH4A 3COLA 1BW5A 5CXGA 5EG0A 2JA8J 3S14J 3HE0A 1JTYA 3LSGA 1F36A 1IDYA 2X6OA 4I76A 1TC3C 3G7RA 5AQCA 1W0TA 4JX5A 1Y1VJ 1ITYA 3VPRA 4LOCA 1EF4A 1QVUA 3JREA 1HDDC 1IC8A 1IRZA 5IOYA 4IHVA 1T56A 1Z0XA 3A02A 3HTHA 2H8RA 1JT6A 2O9LA 5M5YJ 3CMYA 2DJNA 1UMQA 1QPIA 2D5VA 2LP0A 2Y9YA 3MN2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B8I B;  1VF9 A;  2DTZ A;  5C4X J;  2W48 A;  3BTL A;  3G56 A;  4ICH A;  4V2G A;  3VW0 A;  2XGC A;  1ZGW A;  1P7J A;  3LHQ A;  3NPI A;  2DMP A;  5EGO A;  3FIW A;  2WAQ N;  4IHX A;  4MK6 A;  3O8G A;  4CGR A;  5IPA A;  3GTG J;  1XC5 A;  5IP6 A;  4BBS J;  1RES A;  5EG0 B;  2LFB A;  4A69 C;  2DG7 A;  4A3L J;  5IYD J;  1RR7 A;  3HGG A;  4KWA A;  4C3J J;  4V2F A;  3K2A A;  4FTH A;  1ETY A;  4JKZ A;  1A5J A;  4JP0 A;  2NS8 A;  5D1R A;  1ETX A;  5EYR A;  5EZG A;  4C2M J;  5E3M A;  4A3C J;  2CRG A;  4FCY A;  3GTO J;  3JRA A;  1BW6 A;  1NTC A;  2JWT A;  3JRH A;  5K7F A;  2ECC A;  5EZH A;  2ME0 A;  2COB A;  3ZQG A;  2UXP A;  2QTQ A;  3FIS A;  4GFB A;  2V57 A;  2WGB A;  5EGO B;  5E3L A;  4GCT A;  1FEX A;  1MSF C;  4AYB N;  2UXO A;  2L7M P;  1K83 J;  3A01 A;  4A3D J;  3F0C A;  5M5W J;  1ZR2 A;  1POG A;  1NK3 P;  5C44 J;  2QKO A;  2EQR A;  5J1Y A;  3ZQI A;  2XSD C;  1S7E A;  1U78 A;  2OER A;  1ENH A;  5GP9 A;  3LNQ A;  5FGL A;  1SFO J;  1GT0 C;  2PZ9 A;  2JN6 A;  2EZI A;  3M3Y J;  3S15 J;  2Y9Z A;  3Q0V A;  3JRD A;  2UXH A;  3ON4 A;  2N8G A;  4D7N A;  1ETV A;  1O4X A;  4A3I J;  2VKV A;  4L62 A;  5M3F J;  2FX0 A;  2K9S A;  3IUV A;  2LKX A;  2NP5 A;  2HDD A;  2DMT A;  2VPR A;  1MBK A;  2XPV A;  3GBG A;  2ELK A;  4JNN A;  2AHQ A;  1MBE A;  3Q0W A;  2QIB A;  1LFU P;  5FKL A;  3A01 B;  4A3K J;  2LR8 A;  1GUU A;  1VFC A;  3VIB A;  1DU0 A;  2JJ7 A;  2GLO A;  4DZJ A;  2MW8 A;  1QVT A;  3Q0U A;  4RBO A;  2XB0 X;  1ZTR A;  5D19 A;  2R7Z J;  2PMZ N;  1G2H A;  1JTX A;  1Z77 A;  2HOS A;  4GFL A;  1WH7 A;  2K40 A;  3JRG A;  4BY7 J;  5FKM A;  3G1L A;  1R9T J;  3FRQ A;  2RAE A;  2JK3 A;  1Y1W J;  4M6V A;  1AU7 A;  3A03 A;  4M3G A;  1JJ8 C;  2DA5 A;  2RAS A;  3S17 J;  1UG2 A;  3NXC A;  4GCK A;  3KKC A;  1UI6 A;  3MKL A;  2E2H J;  2YU9 J;  3W6V A;  2IU5 A;  1YRN A;  2JMW A;  2OF7 A;  1ETK A;  2R93 J;  5J1U A;  3BTC A;  4A3E J;  1JKR C;  1IG7 A;  3BHQ A;  3BG9 A;  4J19 A;  4MIM A;  4D5F A;  2Q24 A;  1TWC J;  4XRM A;  5EF6 A;  1X2M A;  2L9R A;  3Q3S A;  3HTI A;  4FE4 A;  5HAW A;  4PXI A;  4AUX A;  4NDL A;  1XS9 A;  2CUE A;  3QKX A;  3JRF A;  2HI3 A;  2M34 A;  2ID6 A;  1HOM A;  3S1R J;  5CW8 A;  1TWH J;  2DG8 A;  2ME6 A;  4MFD A;  2R5Z A;  1TWG J;  3CWR A;  1K61 A;  2L7Z A;  3GTJ J;  4A3J J;  4XRS G;  2X48 A;  3FK6 A;  3KZ9 A;  1RKT A;  4EEF G;  1YRN B;  3RD3 A;  3CRJ A;  2FD5 A;  3JSJ A;  4HKU A;  3KKD A;  4B3A A;  1H88 C;  2YVH A;  2LY9 A;  1HF0 A;  3S1N J;  2QWT A;  3BR6 A;  4B1R A;  1MBJ A;  2FQ4 A;  2DA1 A;  5FLV A;  2EH3 A;  3GTM J;  4ME9 A;  2QF7 A;  2I10 A;  4YZE A;  4AC0 A;  3HOV J;  3LSP A;  4A93 J;  3HKZ N;  1FIA A;  5K7H A;  4MXM A;  3DEW A;  2UXI A;  2E19 A;  4X1E A;  2R5Z B;  3PO3 J;  4M3F A;  2HOA A;  4XIC A;  2GEN A;  3VVZ A;  4D5C A;  1ETW A;  3HOX J;  1IJW C;  2M2E A;  4A3M J;  2G3B A;  4MO7 A;  2GM4 A;  1FIP A;  1NK2 P;  5F0C A;  2XPU A;  3S2D J;  4X6A J;  1XG1 A;  4ACI A;  4HNV A;  2X9D A;  2TCT A;  2H1K A;  2ZCX A;  2UXU A;  3ZQC A;  1BA5 A;  4MFE A;  5GPA A;  4L5E A;  3F1B A;  3WHC A;  3TED A;  3P9T A;  2VUM J;  2XGD A;  3L1P A;  3SJM A;  3IV5 A;  2PBX A;  1MH4 A;  2M0C A;  2ZB9 A;  2NP3 A;  3NRG A;  1WH5 A;  3OSF A;  5IOZ A;  3DCF A;  1A6I A;  3BR2 A;  3EUP A;  3S16 J;  5IYC J;  2CQX A;  1JUM A;  2EZK A;  2R92 J;  3S5R A;  1GDT A;  5J3L A;  4A3G J;  1P7I A;  1HCR A;  2GFN A;  1VI0 A;  3UKG A;  2GUH A;  2DA3 A;  1IGN A;  4C3I J;  4DYR A;  1RET A;  5F1J A;  1SAN A;  1AKH A;  2LK2 A;  4JYK A;  3EGQ A;  2R0Q C;  3HIM A;  2NS7 A;  3VP5 A;  3JRC A;  1FJL A;  1OCT C;  5K58 A;  3OIO A;  1X58 A;  3VVY A;  1JUP A;  2YUS A;  2Y31 A;  4RDU A;  2O8K A;  3M4O J;  2CQQ A;  3KNW A;  4C3H J;  5IP7 J;  2K9N A;  2CUF A;  1MNM C;  1I3Q J;  3RQI A;  2E2I J;  2M8G X;  4S0H B;  2DA7 A;  1MSE C;  4XK4 A;  5JLW A;  1HDP A;  1MH3 A;  2IAI A;  2NOG A;  1WCM J;  5F0H A;  3PPB A;  3JRB A;  3HOZ J;  3GZI A;  4DW6 A;  1Q1V A;  1AKH B;  9ANT A;  2RHA A;  1LE8 A;  2P81 A;  3ZOB A;  5IP9 J;  3RZO J;  3VVX A;  4NEL A;  5EEA A;  3TW7 A;  3PO2 J;  3GTK J;  2XPW A;  1WGX A;  2ZOY A;  2HYT A;  3LOC A;  4W97 A;  3RH2 A;  4IHY A;  3C07 A;  2CU7 A;  3FK7 A;  3HM5 A;  3NNR A;  3OOU A;  2NVT J;  3H3V K;  4A3F J;  3S2H J;  4JL3 A;  2LLK A;  3V78 A;  2K9Q A;  3HOW J;  5HOD A;  5E3N A;  2CJJ A;  2IEK A;  2NVQ J;  3BCG A;  5F0F A;  3C2B A;  3SDG A;  2HKU A;  3BRU A;  2MGQ A;  2HXI A;  4DYQ A;  2F07 A;  2DMN A;  3PAS A;  4IEJ A;  2DMU A;  1RPW A;  3QPS A;  5F27 A;  3BR1 A;  5DAJ A;  2E2J J;  2OPT A;  3G1M A;  2L0K A;  5EFY A;  2G7S A;  1LE8 B;  2KT0 A;  5C3E J;  5C4J J;  4FIS A;  3QQA A;  3BJB A;  3VOX A;  3RZD J;  3HTJ A;  4G12 A;  1OJL A;  2WV1 A;  3O60 A;  3HB9 A;  3O8H A;  4DYC A;  1GV5 A;  2Y30 A;  2FBQ A;  1UHS A;  1JKP C;  2E1O A;  3CCY A;  3HOY J;  3B81 A;  3E7L A;  1JT0 A;  2YS9 A;  1IV6 A;  2MG4 A;  5FKN A;  2JA7 J;  5BNG A;  3GTQ J;  2R5Y A;  1QRY A;  4M3B A;  3LJL A;  3B6C A;  1ETQ A;  1MBG A;  1OCP A;  3LSJ A;  4BXX J;  5HSZ A;  3BTI A;  2NVY J;  3LWJ A;  4M3E A;  1F43 A;  1FTT A;  1IUF A;  3DPJ A;  5FHP A;  3MNL A;  1VND A;  2DA4 A;  3AQT A;  2XGE A;  3ZQH A;  3BR0 A;  3BG5 A;  3H0G J;  2JA6 J;  3HTA A;  4CYC A;  5FJ8 J;  1TWA J;  5EDN A;  5CXI A;  5H9T A;  1I50 J;  5IYB J;  4I6Z A;  2DN0 A;  4JX4 A;  1GV2 A;  3HOU J;  1SGM A;  3BT9 A;  2TRT A;  3ZQF A;  3ANG A;  3ZQL A;  2M9H A;  1ZK8 A;  2XB5 A;  4QSH A;  2WB1 N;  3K7A J;  4GCL A;  2R5Y B;  4UUS A;  3FKI J;  5K7Z A;  4GFK A;  2AO9 A;  2ZOZ A;  3CJD A;  4XID A;  2L7F P;  1DU6 A;  1H89 C;  3BQZ A;  2G7G A;  2DMQ A;  2DA6 A;  4MLO A;  3GTP J;  2ZCN A;  1X2N A;  4BBR J;  2W53 A;  2GBY A;  2ID3 A;  3CDL A;  4DZP A;  5C4Y A;  3T6N A;  1TWF J;  1B72 A;  1JGG A;  3VW1 A;  2XDN A;  5D18 A;  5J1R A;  1PUF A;  3QBM A;  4W1U A;  5FKO A;  3VOK A;  4CYC B;  2LVS A;  3QPL A;  2JA5 J;  3IH2 A;  5FKK A;  4QIW N;  5DS9 A;  2VI6 A;  2G7L A;  1JUS A;  3GTL J;  2HOT A;  1H8A C;  1U9N A;  4UUT A;  1ZQ3 P;  5FMP A;  4B4C A;  3AQS A;  3HBL A;  2KDZ A;  3E7Q A;  3VUQ A;  1AHD P;  3TP3 A;  5HBU A;  2IBD A;  3BR5 A;  2QOP A;  3SFI A;  4UUS B;  3RKQ A;  2HYJ A;  4JX6 A;  2EBI A;  4BKX A;  5E3O A;  3MVP A;  3HEF A;  1LFB A;  3PM1 A;  5M5X J;  2ECB A;  3NAU A;  2WUI A;  2HXO A;  4NN1 A;  2HQ5 A;  4Y52 J;  3I4M J;  3B6A A;  5DTD A;  1APL C;  3ANP A;  4Y7N J;  3BTJ A;  1B72 B;  3GEU A;  2XRL A;  3WHB A;  2EZL A;  1PUF B;  2LTP A;  2O7O A;  1U9O A;  1U8B A;  1E3O C;  2Y0S N;  1W0U A;  1JKO C;  1ETO A;  4QTR A;  5GPC A;  3CQZ J;  4AF5 A;  1BL0 A;  3TW6 A;  1ORK A;  1D5Y A;  3ON2 A;  3NAR A;  3I4N J;  3BR3 A;  3G1O A;  4AC6 A;  1CQT A;  3JRI A;  1JJ6 C;  5F04 A;  2EZH A;  1BJZ A;  1MBH A;  2VKE A;  5M3M J;  2O7T A;  3D1N I;  3BQY A;  1IDZ A;  4A3B J;  1MBF A;  1WPK A;  1ZKG A;  3S1Q J;  3HDD A;  1OFC X;  1WI3 A;  3V6G A;  2OI8 A;  2QCO A;  4M3D A;  3JR9 A;  2REK A;  3NI7 A;  2DA2 A;  3VW2 A;  2D6Y A;  2NVX J;  4IHW A;  3IH3 A;  4ABZ A;  1JKQ C;  4XRS A;  3S1M J;  1GVD A;  5F08 A;  4BY1 J;  2YVE A;  3TP0 A;  1FTZ A;  1T33 A;  1HLV A;  2LD5 A;  2Y2Z A;  1B8I A;  2FJ1 A;  1I6H J;  3HGY A;  2G0E A;  1ZR4 A;  2B63 J;  3OSG A;  5FLM J;  2ZCM A;  1RKW A;  3BNI A;  3BG3 A;  4D7M A;  1UI5 A;  3LSR A;  2MSY A;  4UDS A;  5JLX A;  4FE7 A;  2NX4 A;  3IH4 A;  3COL A;  1BW5 A;  5CXG A;  5EG0 A;  2JA8 J;  3S14 J;  3HE0 A;  1JTY A;  3LSG A;  1F36 A;  1IDY A;  2X6O A;  4I76 A;  1TC3 C;  3G7R A;  5AQC A;  1W0T A;  4JX5 A;  1Y1V J;  1ITY A;  3VPR A;  4LOC A;  1EF4 A;  1QVU A;  3JRE A;  1HDD C;  1IC8 A;  1IRZ A;  5IOY A;  4IHV A;  1T56 A;  1Z0X A;  3A02 A;  3HTH A;  2H8R A;  1JT6 A;  2O9L A;  5M5Y J;  3CMY A;  2DJN A;  1UMQ A;  1QPI A;  2D5V A;  2LP0 A;  2Y9Y A;  3MN2 A; 
#chains in the Genus database with same CATH topology
 1B8I B;  3PUB A;  3E0J B;  3NPI A;  1UZC A;  2BE5 F;  3FIW A;  2EV0 A;  2WAQ N;  3T0Y A;  1XMK A;  1BC7 C;  3V8K A;  4CIC A;  3HIF A;  1SD4 A;  3O8G A;  4HDV A;  5IPA A;  3WTW C;  3RDI A;  2LKS A;  3ZR8 X;  1U5T A;  1XSX A;  2PMU A;  2Q0O A;  3DP7 A;  2WAD A;  4CCN A;  5B3S H;  1MIJ A;  4V2F A;  5DCM B;  4FTH A;  4R8H A;  5J4V A;  4JP0 A;  4XRF A;  4UB6 C;  5EZG A;  3I56 I;  1BW6 A;  2JWT A;  1LJ9 A;  2Z1D A;  3BY6 A;  5K7F A;  2IS6 A;  2ECC A;  4C30 A;  4U9N A;  3AFH A;  2ME0 A;  2HZT A;  2R7X A;  1ZN2 A;  2ZKZ A;  2UXP A;  1IZ1 A;  2A69 F;  2RVC A;  2FNP A;  2OCE A;  4GCT A;  1P4A A;  1MSF C;  2D2W A;  4KIT B;  4AYB N;  2VT3 A;  2F5C A;  4EJO A;  2UXO A;  1K83 J;  3F0C A;  1QQI A;  2DYR H;  1TQI A;  3G73 A;  4B3X A;  3I58 A;  4IHS A;  2QKO A;  3HRT A;  1G3W A;  5J1Y A;  3ZQI A;  2R7T A;  2HDC A;  3GZN B;  1R00 A;  5GP9 A;  4C2U A;  2RQQ A;  2PZ9 A;  2O3F A;  3HRM A;  2HKX A;  2IPQ X;  3M3Y J;  3S15 J;  2B3W A;  4PZJ A;  2A5W A;  3DEE A;  3JRD A;  2HVQ A;  2VOD A;  1FOW A;  4D7N A;  1ETV A;  1XGM A;  3OV8 A;  4A3I J;  1Z6T A;  2B1E A;  2VKV A;  4RA2 A;  3K4L A;  4L62 A;  2K9S A;  2KQR A;  1YYV A;  2NP5 A;  3KP7 A;  2DMT A;  5CVR A;  2RQP A;  1S8N A;  3CDH A;  5IT9 Z;  2X1E A;  3FXO A;  3P9K A;  1MBE A;  3Q0W A;  2PQ8 A;  3CF2 A;  3K10 A;  4II3 A;  3CMA I;  4KNY A;  3OYL A;  1YS6 A;  2TDX A;  3I71 A;  5FKL A;  2LR8 A;  3JAM Z;  4ITV A;  4MNU A;  3A01 B;  2EK5 A;  2X1D A;  4CZZ A;  2WAF A;  1FYM A;  2GLO A;  4IZZ A;  2XB0 X;  5D6F A;  5D4R A;  2R7Z J;  3I59 B;  1G2H A;  4RAY A;  2HOS A;  4GFL A;  4OIO F;  2EB7 A;  2ZJR F;  2JK3 A;  4M6V A;  1MMA A;  3E6B A;  5CKT A;  2K7L A;  5K5Q A;  1JJ8 C;  4LLG F;  2DA5 A;  4CUG A;  2OTL I;  4Q48 A;  2L9S A;  2XV4 S;  4GCK A;  4Q4Z F;  1P9Q C;  4G6D A;  2IU5 A;  3W6V A;  3QOE A;  4LB6 B;  1YJ9 I;  1R1V A;  2F5F A;  2OAZ A;  4A6E A;  4ESJ A;  2GXB A;  3MEX A;  2R93 J;  1FOY A;  3HHG A;  1RI7 A;  2V26 A;  2WBM A;  3BTC A;  1YS7 A;  2P5K A;  1IG7 A;  2OQG A;  4NC6 A;  3K4K A;  1T0F A;  1TWC J;  2KZV A;  4XRM A;  1OPC A;  1SAU A;  3A1Y A;  5EF6 A;  2EIJ H;  2L9R A;  3FF5 A;  1YW7 A;  5CQG A;  5GTH C;  4LJZ F;  4AUX A;  2M1B A;  1P92 A;  3W2A A;  3JTG A;  1XS9 A;  4BU2 A;  3QKX A;  1BIA A;  3DFG A;  3GLL A;  1UHW A;  2M34 A;  1PUE E;  4HA8 A;  4L5I A;  4EAT A;  1KU7 A;  3S1R J;  1BI1 A;  4UVA A;  5FRO A;  3RSN A;  1ON1 A;  3BDD A;  4G9Y A;  5DM6 F;  1BC8 C;  4FHT A;  5E1W A;  1K61 A;  1T08 B;  1YX5 A;  2L7Z A;  3GTJ J;  4LLN A;  3K1M A;  4U9L A;  3FK6 A;  3A2K A;  1YRN B;  3HOT A;  3RD3 A;  4HKU A;  1K7A A;  2XHK A;  4ZTF A;  1EH7 A;  2EWN A;  3H3Z A;  3S1N J;  1FPQ A;  1QGP A;  4E7Z A;  3CD6 I;  2EH3 A;  3I5U A;  4ME9 A;  4XOP A;  1IN8 A;  2M7A A;  5E8I A;  2I10 A;  3S32 A;  3DBH B;  4YZE A;  4AC0 A;  3IRR A;  3U2R A;  1MW7 A;  1FIA A;  1K6O A;  1Y8Q B;  1S7A A;  2E19 A;  2R5Z B;  1XMA A;  2GWR A;  1JHH A;  2HOA A;  2J5O A;  3F9K A;  2ISY A;  5EEH A;  1I1S A;  1ETW A;  2DFH A;  1KQ0 A;  3HOX J;  2G3B A;  1BR4 A;  4UV9 A;  4MO7 A;  2GM4 A;  2VPL A;  2H8W A;  4CCO A;  5GAD J;  2ELH A;  1MMD A;  1XB4 A;  4HNV A;  1VZ0 A;  4GRI A;  3SFZ A;  2QBY B;  1QU3 A;  3WU2 C;  2WTE A;  4RB0 A;  1K4S A;  3F1B A;  3TMO A;  3K4B A;  3PL8 A;  1V55 H;  1VQ7 I;  2FU4 A;  3SXY A;  2W82 A;  4XBF A;  1MDM B;  4ZYG A;  2CG4 A;  2ZO4 A;  2BHZ A;  2OBP A;  3KP6 A;  2EIN H;  4KT6 A;  4OIN F;  3BR2 A;  3SZP A;  3HOS A;  2YR2 A;  2MD0 A;  2CQX A;  2WA0 A;  1QA6 A;  2JSP A;  4A3G J;  1E2X A;  3KFW X;  1HCR A;  2GUH A;  3UKG A;  5HLI A;  4PUS A;  1Y0N A;  4J01 A;  5F1J A;  2QGU A;  5J4Y A;  1W36 D;  4ZYD A;  2LK2 A;  1KU3 A;  4RGR A;  3FM3 A;  3IRQ A;  4EM2 A;  3DKX A;  2O61 A;  1IN6 A;  4WWC A;  4IRV A;  3VSL A;  3CO7 C;  3DF8 A;  4A0X A;  4CH7 A;  2L02 A;  2O0Y A;  1FJL A;  2XC7 A;  2L3D A;  3OIO A;  4C2T A;  2FE3 A;  1X1B A;  2YUS A;  2K9M A;  3NQO A;  3TDZ C;  1K4T A;  2MC3 A;  5IP7 J;  4ENN A;  4XLN F;  2FBI A;  2K9N A;  2NAZ A;  3JSO A;  1YFH A;  2EFO A;  3OYN A;  2E2I J;  2DA7 A;  1MSE C;  1A31 A;  3NRV A;  4KT5 C;  2UXN A;  4I98 B;  1HDP A;  1J75 A;  3BC8 A;  2L9N A;  3WTV C;  3CF5 F;  1WCM J;  1YIO A;  2H1L A;  3S3N A;  3S3O A;  3PPB A;  4E70 A;  3GZI A;  5LLQ A;  2B7E A;  2F5D A;  1ZEL A;  3LAJ A;  2KIU A;  4JBA A;  1O3Q A;  1H0M A;  2ESH A;  2ZJ2 A;  3CUO A;  3F8N A;  4P96 A;  3PO2 J;  2XPW A;  1BOB A;  2FJI 1;  1D0Y A;  2HYT A;  3R4K A;  4W97 A;  2VLA A;  4Q47 A;  3J7Z I;  3OYE A;  1ZGA A;  2HWV A;  3NNR A;  5L3G A;  4BDZ A;  4FAS D;  3H3V K;  2LLK A;  3OL4 A;  2LY2 A;  4HLX A;  2MLK A;  3BCG A;  3OWT A;  2VE9 A;  4OD4 A;  5F0F A;  3SDG A;  5HLT A;  3BRU A;  4M6Y A;  3HG9 A;  2VB6 A;  3F22 A;  2P6T A;  4WXH A;  2DQL A;  4CA0 A;  5HDG A;  1ON2 A;  5KAI C;  3QPS A;  3AAF A;  5F27 A;  1LVK A;  2KDO A;  2B0L A;  2DPU A;  3KP3 A;  3IL2 A;  3SQN A;  4PFO A;  5C4J J;  4FIS A;  3TGN A;  2O03 A;  2KHM A;  3HXL A;  4F3Q A;  3NS4 A;  2OTJ I;  2HU9 A;  2PI0 A;  2P0W A;  1QZY A;  1OJL A;  2M4K A;  1W5C C;  2DBB A;  2R3S A;  4DYC A;  3FX3 A;  2HEO A;  1W5S A;  2E34 A;  2E1O A;  3CCY A;  3FXL A;  3TKY A;  3HOY J;  3B81 A;  3C2H A;  3GVA A;  1JT0 A;  5FKN A;  2EIK H;  4XMY A;  2JA7 J;  5FLX K;  2R5Y A;  3OOP A;  3DWL E;  4MGR A;  5FRM A;  5FD5 A;  2W25 A;  3ROU A;  5HDN A;  1T6S A;  3LSH A;  2NVY J;  2L4M A;  2V6C A;  1FTT A;  4L9N A;  3OS2 A;  2FUG 2;  4QWQ A;  1KQ8 A;  4U87 A;  2XF6 A;  1LFP A;  3H5A A;  3BG5 A;  3DV8 A;  4ETS A;  2JA6 J;  2OZ6 A;  2AS5 F;  4CYC A;  4LIU A;  5DUK A;  1TWA J;  1D3Y A;  1I50 J;  4PJL A;  5JFR A;  3ELK A;  2DN0 A;  3KP5 A;  1GV2 A;  4JX4 A;  4PJ0 C;  4I6Z A;  3HOU J;  3CTA A;  1BI0 A;  3BT9 A;  2PMZ A;  3ZQL A;  1Y8R B;  4M9X A;  4BXF A;  4M6X A;  4QPO A;  5JHF A;  4OU0 A;  3FKI J;  2Z9O A;  1FP2 A;  3LMM A;  2ZOZ A;  3BP8 A;  1B9N A;  4L5J A;  4ZJZ A;  1H89 C;  3BQZ A;  5B1B H;  5LRS A;  2XKP A;  4MLO A;  3GTP J;  4ENJ A;  2BXY A;  4YG2 F;  3CDL A;  3OYM A;  3GCM A;  1TWF J;  2CUZ A;  4YEJ A;  4BXU A;  2XDN A;  4A0Y A;  3QBM A;  4W1U A;  3VOK A;  4YRV A;  2LVS A;  5J6X A;  3I53 A;  3GUD A;  5FKK A;  4QIW N;  3KZI C;  2Q2E B;  2G7L A;  1YW8 A;  4IF4 A;  1FOK A;  3PJR A;  1Y0U A;  1R6R A;  2G7U A;  1RRJ A;  2NYX A;  2EA2 A;  5JI6 A;  2RGV A;  3C2G A;  1XDS A;  2R7Q A;  3R6S A;  2NRA C;  3HPG A;  1D1B A;  2EBI A;  4BKX A;  4D9J A;  5F1R A;  2K3P A;  1LFB A;  4PSX A;  3HTU A;  3V8J A;  2WUI A;  4PJN A;  4FET A;  1RR8 C;  1OKR A;  3CCR I;  4EJW A;  3ANP A;  3W2V A;  4BDY A;  1Q1H A;  3BTJ A;  1K78 B;  1U6G A;  2BYV E;  3WHB A;  3DPU A;  2F2E A;  2LTP A;  1U9O A;  2Y0S N;  2STW A;  1CGP A;  1DGW Y;  4JOM A;  4IX7 A;  1JKO C;  4DIQ A;  2V1U A;  4E7K A;  1G3Y A;  4AD9 A;  1FP1 D;  3HKZ A;  4XLC A;  1D5Y A;  2JPB A;  3NAR A;  5A2Q Z;  1KON A;  3JRI A;  1JJ6 C;  5F04 A;  2EZH A;  1BJZ A;  3N97 A;  1MBH A;  4BGD A;  1B59 A;  4UY8 I;  4XL9 A;  2A5Y B;  3D1N I;  3P9C A;  1IDZ A;  3VTI A;  2NS0 A;  1ZKG A;  2Z99 A;  1Z05 A;  2QSF X;  1D8K A;  1TQM A;  2QQ8 A;  1OLT A;  2OI8 A;  2QCO A;  4M3D A;  3JR9 A;  2REK A;  1PDN C;  1I27 A;  3CZ6 A;  2VBZ A;  1BOA A;  3VYT B;  2VQG A;  4O3M A;  4XRS A;  3S1M J;  2OV7 A;  1HLV A;  4L0Z B;  2Y2Z A;  1RC9 A;  4A2U A;  1FBQ A;  1XGO A;  3GX4 X;  2LRD A;  1W5T A;  5CYV A;  3J80 Z;  2ELJ A;  2B63 J;  3G4S I;  3BNI A;  1RKW A;  1O3R A;  3LAP A;  2E1N A;  3ECO A;  4HOB A;  4FE7 A;  1O7F A;  3EPZ A;  3IH4 A;  5CXG A;  2H09 A;  3WTZ A;  5BMZ A;  3S2W A;  1ITY A;  2M45 A;  3CUQ C;  1EF4 A;  1F1Z A;  3ZRG A;  5HOO A;  4MEX F;  4U88 A;  1IRZ A;  1T56 A;  4XSX F;  3E97 A;  4HW0 A;  4IRG A;  1VQK I;  4EJT A;  1ERD A;  1R22 A;  2CWE A;  1IRX A;  3CMY A;  2DJN A;  2D5V A;  1QZZ A;  3H5N A;  3E6D A;  2Y9Y A;  3CP8 A;  5LBQ A;  2DTZ A;  5D5U B;  3G56 A;  3T5X A;  2FBH A;  4V2G A;  2ZXH A;  3C7J A;  1ZGW A;  3K4N A;  3OIP A;  2CH0 A;  4PGG A;  4IHX A;  2VXZ A;  4MK6 A;  2K85 A;  2LF7 A;  1P4W A;  3G2B A;  4LG0 B;  4BBS J;  5EG0 B;  2LFB A;  4A69 C;  2DG7 A;  3IWZ A;  3LFK A;  1LPQ A;  1W1W E;  3U1K A;  3RIR A;  3KEQ A;  1QBJ A;  2HQR A;  3F8M A;  2OQR A;  3QYB A;  4KWA A;  2X85 A;  3MQ0 A;  4L9V A;  3CCQ I;  1QPM A;  2HR3 A;  5BPD A;  3IKT A;  2R7S A;  1ETX A;  5E3M A;  1V5E A;  2CRG A;  4FCY A;  4NHJ A;  2IA0 A;  2UXX A;  1WVR A;  4G7Z F;  3DBL B;  3HSR A;  3GZ5 A;  3NWS A;  4M74 A;  4XKV A;  4MTD A;  2QA4 I;  4M72 A;  2QTQ A;  4EVI A;  4AIK A;  2XF7 A;  1FEX A;  2K86 A;  5ICF A;  1ZH5 A;  2I5U A;  4KN7 X;  2P5V A;  1ZRD A;  4ENK A;  4WX9 A;  3DKY A;  1J2X A;  4P9F A;  4EGZ A;  1U5T B;  2F6C A;  3F8C A;  2XAH A;  2EQR A;  1SMY F;  3GEZ A;  2GIV A;  1Y56 A;  3A4C A;  5CVI A;  1UB9 A;  5KCM A;  2XDV A;  3LNQ A;  2HYF A;  2EZI A;  1Z3Y A;  2LG4 A;  5CQE A;  4MEY F;  4OWR B;  2W7N A;  2N8G A;  4ZC3 A;  4ENM A;  3MAJ A;  2ZME A;  5M3F J;  1UST A;  3QOP A;  3IUV A;  2VJI A;  2VPR A;  2XPV A;  1GLN A;  4ESB A;  2ELK A;  4JNN A;  1HC8 A;  2AHQ A;  1ZAR A;  2M30 A;  5GAE J;  3WTX C;  2PJP A;  2ZY9 A;  4I2O A;  3OYJ A;  3VIB A;  1GUU A;  1Z67 A;  1ZG1 A;  1DU0 A;  2VOP A;  2IVM A;  4Q5S F;  1MD0 A;  1ODD A;  3OR1 C;  1Z77 A;  5B1A H;  5GAH J;  4BY7 J;  2Y48 A;  3G1L A;  3FRQ A;  2RAE A;  2RDP A;  2J5P A;  4NUB A;  3A03 A;  4ZYA A;  5D5W B;  2DK5 A;  3I54 A;  2RAS A;  4GGG A;  1X3Z B;  4NC7 A;  2HDW A;  2E2H J;  2JMW A;  2QSH X;  2OF7 A;  2FSW A;  2QQB A;  3PNV A;  2VN2 A;  2L5Q A;  1RZ4 A;  1ETK A;  4RB2 C;  2HQA A;  3ZMZ A;  1F5T A;  1HSJ A;  4HZF A;  2ZXW H;  3VYU B;  4A3E J;  3ULQ B;  1TP4 A;  1XX5 A;  2QZ8 A;  3BJ6 A;  1B1B A;  5HNF A;  1Y6I A;  1VQM I;  4KMF A;  3BHQ A;  1B4A A;  2H27 A;  3H5R A;  2LDU A;  6PAX A;  3D5L A;  3HTI A;  5HAW A;  1J5Y A;  4PXI A;  2I8D A;  4ZTJ A;  1KZH A;  5LHH A;  4RS8 A;  2CUE A;  2QEX I;  3TOB A;  3A0B C;  2X0L A;  1HOM A;  2FML A;  1TBX A;  2DLL A;  2GXG A;  1J0R A;  4MFD A;  3CJN A;  1WJE A;  2DOE A;  3CC7 I;  4QPQ A;  3ABT A;  3T1B A;  1RKT A;  3BCB A;  2M3A A;  3DU6 A;  3KYC B;  4GYI A;  4EEF G;  5J47 A;  1J09 A;  3CRJ A;  4UHT A;  3F21 A;  3JSJ A;  3KKD A;  1XGS A;  1HF0 A;  3SEQ A;  2QWT A;  5H2F C;  2ZNZ A;  3OY9 A;  1ZGJ A;  2BZT A;  4IOA F;  3HYI A;  4XLE A;  5FLV A;  4I09 A;  4N9I A;  2V9K A;  3M7G A;  2COM A;  5ILU A;  3LQR A;  5HS7 A;  3L2C A;  4YIF A;  3FXK A;  5ERI A;  3R0J A;  3PUF A;  4RGS A;  3LSP A;  4A93 J;  4IQ4 A;  1R71 A;  5HLG A;  4MXM A;  2GOM A;  4RM2 A;  4X1E A;  4M3F A;  5LGN A;  3ESW B;  1QZE A;  1W7P A;  1X19 A;  3V8L A;  1WJA A;  2M2E A;  3C1D A;  2M5W A;  4N0B A;  3FWE A;  3R60 A;  2FBK A;  1NK2 P;  5F0C A;  2XGX A;  1S6L A;  4E7L A;  1FX7 A;  3S2D J;  1XG1 A;  4X6A J;  2WC2 A;  3UR3 C;  2X9D A;  1YLF A;  4LLL A;  2LRE A;  1BN5 A;  2JVH A;  4WCG A;  4MFE A;  5GPA A;  2UUZ A;  2DXI A;  3TOA A;  3WHC A;  2IGK A;  4DGW B;  2DO7 A;  3WG9 A;  2PX9 A;  2XGD A;  5LD2 C;  3WGG A;  2CS3 A;  3FMR A;  3L1P A;  2UZK A;  3B02 A;  3IV5 A;  2PEX A;  2KIQ A;  2PBX A;  4BHC A;  4UUV A;  4II2 A;  3BPV A;  3OSF A;  3E6M A;  5IOZ A;  1FY7 A;  1A6I A;  3DCF A;  1JUM A;  1R7J A;  2EZK A;  2L9V A;  3MZY A;  2A07 F;  3AL0 C;  2CFX A;  5IT3 A;  5IT9 K;  1R36 A;  2GFN A;  4KDP A;  4YFK F;  4C3I J;  1JI8 A;  1TW2 A;  1SAN A;  4AVZ A;  3JAM K;  3LA7 A;  1AKH A;  3OIQ A;  4YFX F;  1TZL A;  3HIM A;  2NS7 A;  2MC4 A;  3BZ6 A;  1SD6 A;  2M87 A;  2FRH A;  2PJR A;  4DNC A;  2EIM H;  3GFL A;  3L09 A;  5F64 A;  3VVY A;  1JUP A;  4PDK A;  4BE0 A;  5D6E A;  2JT1 A;  3M4O J;  4N4O B;  2VL8 A;  4RAF A;  3RKW A;  4OMZ A;  1HA8 A;  2LYC A;  1R5H A;  4G7H F;  3I9V 2;  1SAX A;  2XSJ C;  3DKW A;  3OMY A;  5E1X A;  4IHT A;  3HHH A;  2DOA A;  3KEY A;  2CUJ A;  4XK4 A;  5JLW A;  1MH3 A;  2E7W A;  2VBW A;  2JPC A;  2Y75 A;  2PMH A;  3JRB A;  4WIB A;  1LE8 A;  5IP9 J;  3RZO J;  2DOF A;  2OUM A;  2CV2 A;  3TW7 A;  3BPX A;  3CUQ A;  1UFM A;  2K5C A;  4UXN A;  1YX3 A;  4NC8 A;  5H6R A;  3F3X A;  4LIT A;  3SWH A;  2CV1 A;  1R4N B;  3RH2 A;  4IHY A;  3C07 A;  3JW4 A;  2K27 A;  3FXQ A;  3CC4 I;  2NVT J;  4A3F J;  3V78 A;  4ZYH A;  1UCR A;  3ERM A;  4Y17 A;  5HOD A;  1BM9 A;  2GAU A;  4IJA A;  2NVQ J;  4X0G A;  2A6H F;  2WY7 Q;  3VSK A;  1BBY A;  3C2B A;  4XOR A;  3ZN0 A;  4BEH B;  4KUM A;  3L2V A;  2X6X A;  4O6J A;  3REO A;  2HXI A;  1I6X A;  3PAS A;  1OR7 A;  4BHB A;  3Q9V A;  4IEJ A;  2DMU A;  3GLX A;  1RPW A;  1LQ1 A;  2Z3Y A;  3BR1 A;  2E2J J;  2OPT A;  3G1M A;  2L0K A;  5HS9 A;  2G7S A;  1Z91 A;  2XAS A;  1S3J A;  2KT0 A;  4S04 A;  4DQ2 A;  4UNO A;  1FWZ A;  1A35 A;  4IQJ A;  4HRI A;  2GA2 A;  3O8H A;  2Y30 A;  1E3H A;  5JVT A;  3CME I;  3IHU A;  5HDK A;  3GYH X;  3DLL F;  2YS9 A;  3K8P C;  1XD7 A;  1STZ A;  2MG4 A;  1R58 A;  5BNG A;  2K9L A;  3IAM 2;  3N4M A;  2NNN A;  2M4G A;  4GXO A;  3B6C A;  3OYC A;  5HSZ A;  1JE8 A;  1HW5 A;  3LWJ A;  5L3F A;  1F43 A;  3AKZ A;  1IUF A;  5E79 C;  3MKZ A;  2ZC2 A;  1TLH B;  1VND A;  3K4C A;  2AQF A;  4PFP A;  3BR0 A;  3H0G J;  4BH9 A;  4ANJ A;  3HTA A;  5FJ8 J;  3VFZ A;  3AG3 H;  5EDN A;  1GHC A;  1WQ2 A;  2BY3 A;  3FM5 A;  1SGM A;  4YII A;  1VQL I;  1OCZ H;  2WB1 N;  4I7H A;  3EDP A;  4GCL A;  2UV1 A;  3ZMT A;  1IN4 A;  1U2W A;  2RC4 A;  2VQL A;  2R5Y B;  2R7V A;  4G6Q A;  5K7Z A;  1T38 A;  1N77 A;  4GFK A;  2AO9 A;  1K79 A;  4XID A;  2CW0 F;  1DU6 A;  1PP8 F;  2KZG A;  5ICG A;  2G7G A;  2DA6 A;  1D1A A;  3S8P A;  2Z33 A;  3ZXS A;  1X2N A;  4BBR J;  2D1V A;  2KPM A;  3AL0 B;  3HSF A;  3T6N A;  1VQ9 I;  1K6Y A;  3VW1 A;  3COA C;  5J8C A;  5J1R A;  1VQO I;  3GXO A;  5H20 A;  4CYC B;  1TT0 A;  1PP7 U;  2JA5 J;  3ASO H;  3IH2 A;  1RUN A;  4IRI A;  1TNS A;  5DS9 A;  2MYS A;  3GTL J;  2HOT A;  2LBF A;  1ZQ3 P;  5FMP A;  4Y4R A;  1X1A A;  4B4C A;  1SMT A;  1WZ2 A;  3AQS A;  2V79 A;  1MKM A;  4JQF A;  3V7C A;  3E7Q A;  3VUQ A;  2H6C A;  3TP3 A;  5HBU A;  1IXC A;  2IBD A;  1R5G A;  2X6Y A;  3QP6 A;  3KPH A;  3RKQ A;  2FNA A;  3OYG A;  2R7U A;  2QVO A;  5K5O A;  1RNL A;  3PM1 A;  1G3S A;  5M5X J;  5E18 F;  2ECB A;  3NAU A;  3I3L A;  3TL4 X;  3RPQ A;  1CF7 A;  4NN1 A;  4Y52 J;  2KIS A;  3WG7 H;  3VB2 A;  4U0Y A;  1Z9C A;  4Y7N J;  3FXM A;  2O7O A;  1E3O C;  3IC7 A;  2KIF A;  3H3U A;  2H6B A;  1ETO A;  4EJU A;  3DTK A;  3CQZ J;  1WHU A;  3F8B A;  4HQM A;  1VQ8 I;  4AF5 A;  2E5Z A;  2KL4 A;  5E1Z B;  3ZN1 A;  3ON2 A;  3JCU C;  4ASN A;  1OQY A;  3KP2 A;  4BQQ A;  3BR3 A;  2FEZ A;  3G1O A;  1UG0 A;  2BY0 A;  3FZV A;  2VKE A;  4YFN F;  5E8G A;  1C0W A;  2MD5 A;  4CZC A;  4A3B J;  4ZDO A;  3WTS C;  4OIP F;  2A6E F;  1G6N A;  1TT5 B;  1FYL A;  1YO5 C;  3Q9S A;  2ZME C;  1KU2 A;  3G6E I;  3VW2 A;  2HTS A;  2D6Y A;  4QLC U;  2V9V A;  2MFZ A;  4IHW A;  3V7R A;  1J7K A;  5AIP A;  3T8R A;  3M8F A;  2BBY A;  3PSF A;  4ABZ A;  1JKQ C;  3BWG A;  4GDF A;  1GVD A;  3FMQ A;  2RRE A;  3BZK A;  2A05 A;  1G3T A;  4BY1 J;  2IS2 A;  2LF8 A;  4RGX A;  2BVM A;  5EEG A;  5FGM A;  1I39 A;  2MA3 A;  3HGY A;  2G0E A;  1ZR4 A;  2R7F A;  3OSG A;  5FLM J;  3BG3 A;  4A12 A;  1UI5 A;  2V9P A;  2XUB A;  4U0W A;  5DYM A;  3K1P A;  2M0M A;  3COL A;  1BW5 A;  2JA8 J;  3S14 J;  1ZYR F;  2X6O A;  5HVQ C;  1LDD A;  1YW9 A;  3M8J A;  3N05 A;  2YSR A;  1R1T A;  3LSM A;  1HDD C;  1IC8 A;  4UV8 A;  4HPQ A;  4CO8 A;  5IOY A;  4IHV A;  1MND A;  3A02 A;  1WJ5 A;  3M07 A;  3MD2 A;  3J81 Z;  3I0T A;  3CCM I;  3HC7 A;  1QPI A;  3BJA A;  2PBI A;  3W2W A;  1VF9 A;  5C4X J;  4ICH A;  2W48 A;  4HF1 A;  2XGC A;  4E7J A;  1A6Q A;  5EGO A;  4UVB A;  3S3M A;  4E7S A;  3D0S A;  1IXR C;  3HZJ A;  4OOI A;  1OYY A;  4OIR F;  4CGR A;  1V3F A;  4U7D A;  5IP6 A;  1FMV A;  2F48 A;  1VQN I;  4KN4 X;  3PIP F;  2ZNY A;  3RKX A;  2PLY A;  3C3W A;  1S9H A;  2X1C A;  1DDN A;  1OYW A;  2BXZ A;  1MMS A;  4C3J J;  1E17 A;  2XRN A;  2MLG A;  3LQQ A;  1BIB A;  3PFY A;  1A5J A;  2NS8 A;  3TDU C;  4I02 A;  4I01 A;  2C6Y A;  1KGS A;  2M7B A;  1MJA A;  4TV7 A;  4CCM A;  2K4J A;  3HJE A;  2L7K A;  2ZBK A;  3ZQG A;  5DDG A;  3FIS A;  2R7R A;  2V57 A;  2WGB A;  4PK4 A;  3JTH A;  4NQW A;  1T39 A;  2G9W A;  1XMX A;  2HNH A;  5KAF C;  2GZW A;  2XKO A;  1POG A;  2QM3 A;  2LKP A;  4HBL A;  4LB5 A;  4OAY A;  1DP7 P;  2MH2 A;  1WJD A;  2OER A;  2HZD A;  1UJ8 A;  3ABU A;  3KP4 A;  3CLQ A;  2JN6 A;  1H9T A;  2FA5 A;  2RNG A;  2AXL A;  2UXH A;  5A2Q K;  3ON4 A;  1X3U A;  2VJJ A;  3MKY B;  3M1C A;  2E36 A;  2E7X A;  4FT8 A;  4CYD A;  3LWF A;  5KNL A;  2LKX A;  3O6B B;  2HDD A;  1XCB A;  2V1X A;  1DGR M;  3GBG A;  4YEL A;  4AVP A;  3CDI A;  1W4M A;  2X6W A;  1P4X A;  2BOL A;  2EFQ A;  4HAM A;  5TJJ A;  5KK1 A;  3CJR B;  1WJB A;  1DP3 A;  2QIB A;  2KLO A;  3K4J A;  2VXD A;  3CCE I;  3NEU A;  3PNY A;  2JJ7 A;  4DZJ A;  2PFB A;  3Q0U A;  5D19 A;  4XLP F;  2VOO A;  1IO2 A;  4IXA A;  4OAZ A;  2XAF A;  1BR2 A;  3F8F A;  1R9T J;  3SZT A;  3RYR A;  3J7A O;  1AU7 A;  2ZFW A;  3J80 K;  1WJC A;  5CJ9 A;  4XOT A;  1PJR A;  2BHY A;  2R7D A;  1EH8 A;  2ZME B;  2W84 A;  3NXC A;  1ONV A;  3MKL A;  4EGY A;  3HPH A;  2YU9 J;  2CMP A;  2PG4 A;  2WY8 Q;  3E3V A;  4ESF A;  1BR1 A;  4AWX B;  5DD4 A;  2W4S A;  2DQR A;  1YTY A;  3L00 A;  2DFI A;  3HUG A;  3ISP A;  4IL6 C;  1JKR C;  3BG9 A;  2VC0 A;  1R49 A;  2DT7 B;  1X2M A;  3K0L A;  4FE4 A;  2LH9 A;  3RQ4 A;  4HSR A;  2HPM A;  3K69 A;  1OCR H;  4K2E A;  5AON A;  3H0D A;  3TBI A;  2IGN A;  3JRF A;  2HI3 A;  1SFU A;  2E1M C;  2ID6 A;  1EA3 A;  2DG8 A;  2ME6 A;  5E17 F;  1TWG J;  2VBX A;  1R23 A;  3CWR A;  3RYP A;  3UNG C;  2KJC A;  1YI2 I;  1BJA A;  2IJL A;  4XRS G;  2QQA A;  2X48 A;  5FB2 A;  2OZU A;  3GZ6 A;  2K02 A;  3ML6 A;  1X1C A;  1IRG A;  4J00 A;  1GVJ A;  2KKO A;  5J8F A;  3WTY C;  2BV6 A;  3I64 A;  4HX7 A;  1MBJ A;  3LL7 A;  4B1R A;  3WE3 A;  4GO1 A;  4C9Y A;  3BOQ A;  4DOZ A;  4IKF A;  2DU9 A;  4NNJ A;  5DUI A;  3EUH C;  1E0E A;  1OR7 C;  4HNT A;  3HOV J;  1QO0 D;  1D8J A;  3V7S A;  1SC7 A;  1EJ9 A;  4HLY A;  2ADU A;  4LFU A;  4BQO A;  1ZAO A;  3VEP A;  3OYI A;  1V5F A;  3PO3 J;  2QKM B;  4XIC A;  3T8T A;  3C18 A;  2EIL H;  1N25 A;  1UEL B;  1MJB A;  1IJW C;  1O7L A;  4A3M J;  3BG6 A;  1LUJ B;  1P2F A;  2R7W A;  4PGH A;  1O3T A;  2TCT A;  2H1K A;  4G94 A;  2ZCX A;  5F6F A;  2P7V B;  2JRT A;  4L5E A;  1L3L A;  3TED A;  1HKS A;  4G8X A;  4YIR X;  4RB1 A;  3W6K B;  3ZP5 A;  4OD5 A;  2L4A A;  3ZGK A;  1FYK A;  1MH4 A;  2NP3 A;  2ZB9 A;  3NRG A;  3H92 A;  3HRS A;  3EUP A;  3KX2 A;  1YJN I;  5IYC J;  5LEK A;  3S16 J;  2XIG A;  2R92 J;  1GDT A;  3CCU I;  1W7P B;  1VI0 A;  1IN7 A;  1DPU A;  2DA3 A;  5DD8 A;  2HTJ A;  1IGN A;  1RET A;  4KMU X;  3HSE A;  5DV5 A;  3QP5 A;  3CCV I;  2LNB A;  4KFC A;  1F9N A;  1B6A A;  3EGQ A;  4PJM A;  5H6Q A;  2R0Q C;  1SEU A;  2WAE A;  3GO5 A;  3VP5 A;  1U0J A;  4LK1 F;  3HL2 A;  3EET A;  2QUF A;  3OYH A;  1O3S A;  1OCT C;  5K58 A;  4BE1 A;  4XON A;  1X58 A;  3ABM H;  4AIH A;  5ICC A;  5D4S A;  4BQN A;  2O8K A;  3K6G A;  1XCV A;  2L01 A;  1OMI A;  1WI9 A;  3SHF A;  4C3H J;  3I55 I;  2BY2 A;  1DPR A;  2W1O A;  2CUF A;  1MNM C;  4O5V A;  5TRD A;  3KET A;  2M8G X;  3K1N A;  4S0H B;  2YX7 A;  3QPT A;  4F52 A;  2VIX A;  2NOG A;  4RLQ A;  3GFJ A;  4BJ6 C;  1LVA A;  5F0H A;  1I3A A;  3H1C A;  1AKH B;  4AM3 A;  9ANT A;  2RHA A;  3K70 C;  1A04 A;  2GQQ A;  5LGU A;  3VVX A;  1IW7 F;  1SFX A;  3CC2 I;  3BCA A;  1YHQ I;  3GTK J;  4NBQ A;  1WGX A;  4AU7 A;  3B73 A;  3LOC A;  2KFD A;  3SDB A;  3WU1 B;  2PJR B;  3ZQQ A;  1XDU A;  2CU7 A;  3HM5 A;  3S2H J;  3R0A A;  4BJT A;  4JL3 A;  2K9Q A;  4BHP A;  5E3N A;  4A5M A;  2IEK A;  4P1W A;  3ZMD A;  4E7H A;  5J40 A;  1BI3 A;  2MGQ A;  3MCZ A;  1S5L C;  2E71 A;  1WSU A;  4DYQ A;  4N9H A;  4B48 A;  2OD5 A;  5DAJ A;  5LFA A;  5ED4 A;  5EFY A;  2GOX B;  2JUC A;  1LE8 B;  4M73 A;  2GXA A;  2IW5 A;  5C3E J;  2O6G E;  3CUQ B;  3QQA A;  3BJB A;  3VOX A;  1V54 H;  5B66 C;  1WWX A;  3F6O A;  4EJV A;  3HTJ A;  2WV1 A;  3O60 A;  3HB9 A;  1GV5 A;  3E6C C;  5K5R A;  5B5E C;  1UHS A;  1JKP C;  1SVO A;  4ZDL A;  3OR2 C;  4R1H A;  1EV7 A;  3E7L A;  1IV6 A;  4RAG A;  4WXD A;  3CCS I;  4RGU A;  4EV0 A;  1RUO A;  3LJL A;  2HVR A;  3WE2 A;  1NG7 A;  1X4O A;  3H9J A;  1ETQ A;  1OCP A;  2R7O A;  3LSJ A;  4BXX J;  1YE9 A;  3KLO A;  4FX0 A;  4EQQ A;  4A5N A;  3QPH A;  3BTI A;  3WGI A;  2FF4 A;  2ESN A;  3NWT A;  1FBS A;  4M3E A;  2P5L C;  2AQE A;  1BI2 A;  4HNU A;  4E6K G;  3DTE A;  3RTR A;  3ERE D;  3MNL A;  3AQT A;  2XGE A;  3VWB A;  2VQC A;  1AOY A;  3IAS 2;  4P55 A;  3H9Q A;  2JRM A;  5TIS C;  2NVU B;  5CXI A;  5H9T A;  4HEA 2;  2VJ5 A;  3OYD A;  4IOC F;  1OCC H;  3ZQF A;  3ANG A;  2XB5 A;  3EUK L;  1FSE A;  3LST A;  3K7A J;  2IP2 A;  4QSH A;  5CPR B;  3LA3 A;  2BEO A;  1KQ9 A;  3A0H C;  3EYY A;  1D0Z A;  2BVL A;  4H0E A;  4UUS A;  4F7Z A;  1FZP B;  1Z3X A;  1GXP A;  3CJD A;  5CVJ A;  2L7F P;  2EV6 A;  5KVR A;  2R4G A;  2DMQ A;  3QWL A;  4ZDP A;  4LIV A;  3O3K A;  2ZCN A;  4BQA A;  2W53 A;  1GXQ A;  2GBY A;  4KIB A;  2ID3 A;  3RKY A;  4DZP A;  5C4Y A;  3K2Z A;  2LC2 A;  1B72 A;  4CCL A;  5D18 A;  1PUF A;  2EV5 A;  4L0Y B;  2K3F A;  2VI6 A;  1JUS A;  1EKE A;  2CYY A;  1U9N A;  3QRF F;  3HBL A;  1SFK A;  1FC3 A;  2HKO A;  2KDZ A;  4FX4 A;  1LDJ A;  2DAO A;  1KYZ A;  1G59 A;  1HQC A;  2VBY A;  3EQL F;  3SFI A;  5CLS A;  2HYJ A;  4JX6 A;  3HTS B;  2XAU A;  3QYF A;  2IS4 A;  1U8R A;  4B09 A;  3HEF A;  3FMS A;  3FHZ A;  4XR6 A;  1FT9 A;  1U3E M;  3OS0 A;  2AXT C;  2HXO A;  1XSV A;  4IVN A;  2HQ5 A;  5DEQ A;  4A6D A;  2K4B A;  2H94 A;  2KMU A;  3I4M J;  1OYI A;  5DTD A;  1APL C;  4Y33 A;  3FBN B;  3K9T A;  5FD6 A;  2F4M B;  2JZY A;  2IT0 A;  1U8B A;  4XQF A;  2DPD A;  1W0U A;  2BW3 A;  4MTE A;  4D0P A;  5KHD A;  2WAQ A;  2LBF B;  4BAC A;  4RAZ A;  5LGT A;  2EFN A;  3OYA A;  1BL0 A;  4HYE A;  4WF2 A;  3GW2 A;  4GCV A;  5AIQ A;  3I4N J;  3KZZ A;  3KCC A;  2Y0M A;  3QAH A;  4U7B A;  3E5X A;  3VYR B;  4AC6 A;  3L2Q A;  1CQT A;  1PVE A;  3KZY A;  3M1E A;  3ASN H;  3U1D A;  2G7H A;  4IPA A;  5M3M J;  2O7T A;  4RM3 A;  3BQY A;  1FSH A;  4XLF A;  1WPK A;  2ZJP F;  1ZLJ A;  5CVV A;  1CF7 B;  2LMD A;  4LMY A;  1PYV A;  1OFC X;  1WI3 A;  3DEU A;  3EUH A;  3ABL H;  2ISZ A;  1XTA A;  2DA2 A;  1G4D A;  2L2O A;  3V4G A;  2FQ3 A;  2NVX J;  3IH3 A;  4IRH A;  4E4H A;  1YQA A;  4XKB A;  5CVU A;  3J7Y J;  5F08 A;  3WTU C;  2YVE A;  3GWZ A;  2VC1 A;  3TP0 A;  1FTZ A;  4P9U A;  4AYB A;  5IY5 H;  4B8X A;  1YOV B;  4KIS A;  1B8I A;  2FJ1 A;  2ZXJ A;  5ILV A;  2JTV A;  4B44 A;  5JVG F;  1I6H J;  1MGT A;  3PFI A;  4BAY A;  4RLF A;  5JHU A;  1YIJ I;  2DJI A;  4FQG A;  2OC6 A;  2XAJ A;  3IWF A;  4KIF A;  3BZC A;  4XKC A;  3TO7 A;  4UDS A;  2JA2 A;  3DQV C;  5D8K B;  3CES A;  4G6T B;  3HE0 A;  3LSG A;  1VQP I;  1IDY A;  4UB8 C;  1TC3 C;  3G7R A;  3OS1 A;  3U21 A;  3ZCO A;  5AQC A;  4JX5 A;  1Y1V J;  2W57 A;  3WOD F;  3VPR A;  4HF2 A;  2E5N A;  5DCM A;  1B9M A;  2YPR A;  1VQ5 I;  4B47 A;  2E1C A;  3WTT C;  4KA4 A;  1YJW I;  4V19 K;  1Z0X A;  3DPT A;  1ZRE A;  3GFM A;  3F72 A;  2CV0 A;  1D0X A;  1UMQ A;  2STT A;  4D1Q A;  2VAS A;  3MN2 A;  4F93 B;  2XVC A;  3BTL A;  3MKW B;  1ACI A;  3VW0 A;  3LHQ A;  1P7J A;  2DK8 A;  1E3P A;  2DMP A;  2CFO A;  4LK0 F;  3ZMS A;  2A3S A;  2GIZ A;  3GTG J;  1XC5 A;  3SEZ A;  4KJZ A;  3ZMV A;  1RES A;  2Z5U A;  1OCO H;  4A3L J;  5IYD J;  1IRF A;  3G3Z A;  3KE2 A;  1Z7U A;  2ZXI A;  1RR7 A;  4F92 B;  3HGG A;  1IAW A;  4LG3 A;  4HX8 A;  2Z16 A;  3K2A A;  3FXR A;  5ILS A;  1ETY A;  1UAA A;  4JKZ A;  1YG2 A;  2Q8K A;  1F4K A;  3AG2 H;  2F5V A;  5D1R A;  2OU2 A;  3FDY A;  3ZMU A;  5EYR A;  4C2M J;  2Z2S B;  4A3C J;  3GTO J;  3JRA A;  1NTC A;  3JRH A;  5EZH A;  2COB A;  1TQP A;  2FOK A;  2V1D A;  2VT2 A;  2IGM A;  4GFB A;  3MZH A;  3U9G A;  1USS A;  1Z6R A;  5E3L A;  2RN7 A;  5EGO B;  2B9S A;  1HXD A;  2L7M P;  3A01 A;  4A3D J;  2HGC A;  4AID A;  5M5W J;  1ZR2 A;  1P6R A;  1NK3 P;  3RPU A;  3I59 A;  3PNT A;  2XSD C;  1S7E A;  1U78 A;  4XLA A;  1ENH A;  4I0B A;  1JHF A;  4PJJ A;  5FGL A;  5BQT A;  1SFO J;  1GT0 C;  4N4N B;  1Z21 A;  3PSI A;  4CXF A;  2BGC A;  2Y9Z A;  3Q0V A;  1O4X A;  2JUG A;  1O57 A;  1J59 A;  2W00 A;  2QQ9 A;  3VDX A;  1IF1 A;  1MMN A;  2FX0 A;  2EA4 A;  1W7P D;  2DDB A;  4A0Z A;  1MBK A;  1HW1 A;  3CP2 A;  5FO5 A;  3MFK A;  4CHU A;  2VON A;  4NQW B;  1X4P A;  1LFU P;  3GF2 A;  1KYW A;  4A3K J;  1VFC A;  4HV6 A;  5GTI C;  2XAG A;  3FBI B;  4GYG A;  2A6T A;  2CQK A;  4BEH A;  2MW8 A;  1QVT A;  4ZZD A;  4RBO A;  4BE2 A;  1ZTR A;  2O8X A;  4EM0 B;  3ABK H;  2PMZ N;  1JTX A;  2HFH A;  1WH7 A;  1OIS A;  2K40 A;  3JRG A;  2DFF A;  5FKM A;  2QKL B;  2EFW A;  2HYG D;  1YIT I;  1Y1W J;  4M3G A;  3TO6 A;  4MHG A;  2YX4 A;  5LHI A;  3S17 J;  1UG2 A;  2F5E A;  4L9T A;  3KKC A;  1UI6 A;  4HX4 A;  1LEA A;  5EJC A;  2WB1 A;  1YRN A;  2NNY A;  2KJB A;  4P5O A;  4B43 A;  2V1N A;  5E20 A;  4HDU A;  5J1U A;  3WGH A;  2YU3 A;  1A36 A;  4MQV A;  1LB2 A;  4E7I A;  5BOX A;  1SFE A;  1TW3 A;  4J19 A;  5K1Y A;  4MIM A;  4D5F A;  2Q24 A;  4M9S A;  2KP6 A;  4XNF A;  3ZQ7 A;  1VTN C;  1Y39 A;  3Q3S A;  3KEO A;  1XGN A;  3J81 K;  4HV5 A;  4NDL A;  1D5V A;  3CJT B;  1HBX G;  1J9I A;  4WXC A;  2HS5 A;  4CCJ A;  5CW8 A;  1TWH J;  3LSI A;  2IRF G;  2R5Z A;  3EYI A;  4Y13 A;  4H4K C;  1QNT A;  4ZYE A;  2F4I A;  4A3J J;  4PCQ A;  2ZFU A;  3KZ9 A;  2L54 A;  4MQ9 F;  1RIO H;  2IS1 A;  5FFZ A;  2FD5 A;  4B3A A;  2RV8 A;  1H88 C;  2YVH A;  2LY9 A;  2FOW A;  2V4J C;  3BR6 A;  2QBY A;  3HUG B;  2FQ4 A;  2RKH A;  4UVC A;  1IN5 A;  2DA1 A;  3HRU A;  4RMN A;  1HST A;  2VKD A;  3GTM J;  3SZG A;  2QF7 A;  1LEB A;  4XLH A;  4BYY A;  2NXN B;  1LDK B;  1R1U A;  3P7N A;  5FFX A;  1MDM A;  4DJA A;  5LEJ A;  3HKZ N;  5K7H A;  4XSZ F;  1T2K A;  3DEW A;  2UXI A;  4NB5 A;  1SD7 A;  3H36 A;  3W6J B;  2GEN A;  3DU5 A;  3VVZ A;  4L9J A;  4D5C A;  1VQ4 I;  3AG1 H;  1FIP A;  1ZHF A;  5FLX Z;  5LHG A;  2E60 A;  2XPU A;  2M8E A;  2XRO A;  4ACI A;  3M9A A;  4DVY P;  1N75 A;  3BRO A;  1VQ6 I;  2UXU A;  3ZQC A;  3V42 A;  3FHN A;  1BA5 A;  3D5R C;  1X3W B;  4CGZ A;  3P9T A;  2HQN A;  2VUM J;  1S72 I;  2X4H A;  5HNH A;  3CJQ B;  1AA7 A;  1D1C A;  3SJM A;  3DXJ F;  1W36 C;  2M0C A;  4U0V A;  1WH5 A;  2DCE A;  3ZPL A;  2MBF A;  4ZZL A;  3CCJ I;  4EMS A;  1WKM A;  4Z6Y A;  2QLZ A;  3S5R A;  2KRC A;  1KU9 A;  5J3L A;  1P7I A;  3VOE A;  2ZJQ F;  2OA4 A;  3S93 A;  3DTI A;  3PQK A;  4XKW A;  4DYR A;  1MNE A;  5HLH A;  1S7O A;  1MZB A;  2CSO A;  4XN3 A;  3TO9 A;  4JYK A;  4R79 A;  3M8E A;  2V7F A;  3GFI A;  2UWM A;  3JRC A;  1R4M B;  1FLI A;  5BS6 A;  1SVM A;  5L3B A;  2WWY A;  3GME A;  2KRF A;  2E35 A;  3CCL I;  1U5T C;  2ZSI B;  2A2F X;  2Y31 A;  4RDU A;  4LD5 A;  2W85 A;  3MMY B;  2BY1 A;  2CQQ A;  1FMW A;  3KNW A;  2VQH A;  2IA2 A;  2ZCW A;  1EH6 A;  1I3Q J;  3RQI A;  2PFV A;  3ECH A;  2QSG X;  4C2M A;  2KRH A;  2IAI A;  3X2Q H;  1HKQ A;  3L2U A;  1REP C;  1NG6 A;  3HOZ J;  4DW6 A;  1Q1V A;  2P6S A;  1T98 A;  4Z2Y A;  3LFU A;  2P81 A;  3ZOB A;  2D45 A;  2EFP A;  3KLN A;  3VYS B;  4L18 B;  4NEL A;  5EEA A;  3AG4 H;  3Q5F A;  5D5V B;  2DW4 A;  5FRN A;  5L3C A;  2RNJ A;  2ZOY A;  5L3E A;  2ICW G;  1M1E B;  4XN0 A;  2VKH A;  3J7A Y;  3FK7 A;  3OOU A;  2FMY A;  2QYO A;  3K70 D;  4BNC A;  2DT5 A;  2VJ4 A;  3HOW J;  2IXS A;  2CJJ A;  2GA1 A;  1TTY A;  2DT6 A;  3OYB A;  1L0O C;  2HKU A;  3VOD A;  2NOJ B;  4BUP A;  2W24 A;  3QU3 A;  1NH3 A;  2F07 A;  2DMN A;  1I5Z A;  3CO6 C;  2JVG A;  3RPU D;  1JXS A;  3MWM A;  1R5I D;  1DQU A;  2A68 F;  2ETH A;  3RJP A;  2X51 A;  5LRR A;  4CDG A;  1ZG3 A;  3IP4 B;  3RZD J;  1UHM A;  4G12 A;  3QOD A;  4M71 A;  1Z1D A;  2DTR A;  2JQ7 A;  2FBQ A;  4DBQ A;  2QWW A;  3E1S A;  1XN7 A;  1XSD A;  5DCF A;  3L2R A;  3GTQ J;  1QRY A;  4M3B A;  2YVX A;  3CMM A;  1MBG A;  1NHA A;  1HKT A;  2HOE A;  1TNT A;  4KYW A;  2XAQ A;  4AIJ A;  1ZG5 A;  3D5S C;  3SYT A;  1N78 A;  3E5U A;  4ZH4 F;  5JR3 A;  2Y0S A;  3DPJ A;  2MAB A;  5FHP A;  5L3D A;  3CLO A;  3H35 A;  3DLA A;  2DA4 A;  3DPL C;  3W3C A;  4HQE A;  4WK8 F;  3ZQH A;  3OL3 A;  3BLY A;  1ZLK A;  2DFE A;  3H9G A;  3TQN A;  4Y3O A;  1T0F C;  4OIQ F;  5IYB J;  1JGS A;  1G8X A;  2Q2E A;  4IO9 F;  4F91 B;  3L7W A;  2TRT A;  2M9H A;  1ZK8 A;  3F23 A;  1V5G A;  4M9Z A;  2CGP A;  5HS8 A;  1IXS B;  1SD5 A;  4DBR A;  4HG2 A;  3BG7 A;  1WJF A;  2A61 A;  3G71 I;  1KA8 A;  3JSP A;  1X1P A;  2CQN A;  3O2P E;  5ICE A;  5BPI A;  1V4R A;  3IUO A;  1XPX A;  4I99 C;  2DOD A;  1K78 A;  1JGG A;  2D1H A;  2WV0 A;  3K4M A;  5FKO A;  4ON0 A;  3QPL A;  2HPI A;  2OJE D;  1MMG A;  2LSO A;  2LY1 A;  1H8A C;  4UUT A;  2LOO A;  2V6E A;  4KIG A;  4BJ5 C;  3LSK A;  1S29 A;  4S05 A;  1ULY A;  2IGO A;  4BS9 A;  1AHD P;  1FBU A;  1FNN A;  3BR5 A;  4BL0 B;  2DYS H;  2DDA A;  4UUS B;  2QOP A;  4CCK A;  3PIO F;  5E3O A;  3MVP A;  1LNW A;  3BJO A;  3MZ8 A;  5DM7 F;  2VE8 A;  3RCO A;  4RB3 C;  1HW2 A;  3B6A A;  4LGW A;  1B72 B;  3GEU A;  2XRL A;  3FXU A;  5GAG J;  2EZL A;  1PUF B;  2FXA A;  2QEN A;  4CSW A;  3P9I A;  2Q1Z B;  2P8T A;  5D5X B;  2P7C B;  3FKJ A;  4QTR A;  1IV8 A;  5GPC A;  2DI3 A;  4HST A;  3EUA A;  3TW6 A;  3QYE A;  1ORK A;  4HF0 A;  1AWC A;  1LKX A;  4Y15 A;  4G7O F;  3WU0 A;  1FOX A;  3IKV A;  3QU6 A;  3P5J A;  2ACJ A;  2CQ7 A;  2JSC A;  1TL8 A;  3OYK A;  1MBF A;  3KIO A;  4I0A A;  3PQJ A;  4KIC A;  5D8L B;  3S1Q J;  2OCC H;  1DUX C;  2EJR A;  3FXJ A;  3HDD A;  3LA2 A;  3V6G A;  3F6V A;  3E5Q A;  3NI7 A;  3L2W A;  2E1M B;  4F55 A;  2F4O B;  4PSW A;  2Y69 H;  3OYF A;  2BW3 B;  1T33 A;  3KYD B;  2LD5 A;  3DBR B;  2XF5 A;  2CW8 A;  3L9F A;  1ZRC A;  4JK1 X;  1WRJ A;  1WFX A;  1T8I A;  1I1G A;  1MJ9 A;  2EPF A;  3ONQ A;  2CW7 A;  2O5R A;  2ZCM A;  1Z7L A;  4D7M A;  1SVL A;  1T95 A;  4XM3 A;  2IA1 A;  2MSY A;  3LSR A;  3KYL A;  1QHG A;  5JLX A;  2NX4 A;  2HVS A;  4LG0 A;  2CO5 A;  5EG0 A;  4OMY A;  1JTY A;  1F36 A;  4I76 A;  5TGT A;  1W0T A;  1X1D A;  4LOC A;  1IUY A;  3RI4 A;  1QHH D;  1QVU A;  2PN6 A;  3JRE A;  2MH9 A;  2ZSH B;  3R61 A;  2P4W A;  2KIM A;  3HTH A;  3I4P A;  1H9G A;  2H8R A;  1JT6 A;  2O9L A;  5M5Y J;  2LP0 A;  4EM1 A;  5C44 J;  1ZRF A; 
#chains in the Genus database with same CATH homology
 1B8I B;  1VF9 A;  2DTZ A;  5C4X J;  2W48 A;  3BTL A;  3G56 A;  4ICH A;  4V2G A;  3VW0 A;  2XGC A;  1ZGW A;  1P7J A;  3LHQ A;  3NPI A;  2DMP A;  5EGO A;  3FIW A;  2WAQ N;  4IHX A;  4MK6 A;  3O8G A;  4CGR A;  5IPA A;  3GTG J;  1XC5 A;  5IP6 A;  4BBS J;  1RES A;  5EG0 B;  2LFB A;  4A69 C;  2DG7 A;  4A3L J;  5IYD J;  1RR7 A;  3HGG A;  4KWA A;  4C3J J;  4V2F A;  3K2A A;  4FTH A;  1ETY A;  4JKZ A;  1A5J A;  4JP0 A;  2NS8 A;  5D1R A;  1ETX A;  5EYR A;  5EZG A;  4C2M J;  5E3M A;  4A3C J;  2CRG A;  4FCY A;  3GTO J;  3JRA A;  1BW6 A;  1NTC A;  2JWT A;  3JRH A;  5K7F A;  2ECC A;  5EZH A;  2ME0 A;  2COB A;  3ZQG A;  2UXP A;  2QTQ A;  3FIS A;  4GFB A;  2V57 A;  2WGB A;  5EGO B;  5E3L A;  4GCT A;  1FEX A;  1MSF C;  4AYB N;  2UXO A;  2L7M P;  1K83 J;  3A01 A;  4A3D J;  3F0C A;  5M5W J;  1ZR2 A;  1POG A;  1NK3 P;  5C44 J;  2QKO A;  2EQR A;  5J1Y A;  3ZQI A;  2XSD C;  1S7E A;  1U78 A;  2OER A;  1ENH A;  5GP9 A;  3LNQ A;  5FGL A;  1SFO J;  1GT0 C;  2PZ9 A;  2JN6 A;  2EZI A;  3M3Y J;  3S15 J;  2Y9Z A;  3Q0V A;  3JRD A;  2UXH A;  3ON4 A;  2N8G A;  4D7N A;  1ETV A;  1O4X A;  4A3I J;  2VKV A;  4L62 A;  5M3F J;  2FX0 A;  2K9S A;  3IUV A;  2LKX A;  2NP5 A;  2HDD A;  2DMT A;  2VPR A;  1MBK A;  2XPV A;  3GBG A;  2ELK A;  4JNN A;  2AHQ A;  1MBE A;  3Q0W A;  2QIB A;  1LFU P;  5FKL A;  3A01 B;  4A3K J;  2LR8 A;  1GUU A;  1VFC A;  3VIB A;  1DU0 A;  2JJ7 A;  2GLO A;  4DZJ A;  2MW8 A;  1QVT A;  3Q0U A;  4RBO A;  2XB0 X;  1ZTR A;  5D19 A;  2R7Z J;  2PMZ N;  1G2H A;  1JTX A;  1Z77 A;  2HOS A;  4GFL A;  1WH7 A;  2K40 A;  3JRG A;  4BY7 J;  5FKM A;  3G1L A;  1R9T J;  3FRQ A;  2RAE A;  2JK3 A;  1Y1W J;  4M6V A;  1AU7 A;  3A03 A;  4M3G A;  1JJ8 C;  2DA5 A;  2RAS A;  3S17 J;  1UG2 A;  3NXC A;  4GCK A;  3KKC A;  1UI6 A;  3MKL A;  2E2H J;  2YU9 J;  3W6V A;  2IU5 A;  1YRN A;  2JMW A;  2OF7 A;  1ETK A;  2R93 J;  5J1U A;  3BTC A;  4A3E J;  1JKR C;  1IG7 A;  3BHQ A;  3BG9 A;  4J19 A;  4MIM A;  4D5F A;  2Q24 A;  1TWC J;  4XRM A;  5EF6 A;  1X2M A;  2L9R A;  3Q3S A;  3HTI A;  4FE4 A;  5HAW A;  4PXI A;  4AUX A;  4NDL A;  1XS9 A;  2CUE A;  3QKX A;  3JRF A;  2HI3 A;  2M34 A;  2ID6 A;  1HOM A;  3S1R J;  5CW8 A;  1TWH J;  2DG8 A;  2ME6 A;  4MFD A;  2R5Z A;  1TWG J;  3CWR A;  1K61 A;  2L7Z A;  3GTJ J;  4A3J J;  4XRS G;  2X48 A;  3FK6 A;  3KZ9 A;  1RKT A;  4EEF G;  1YRN B;  3RD3 A;  3CRJ A;  2FD5 A;  3JSJ A;  4HKU A;  3KKD A;  4B3A A;  1H88 C;  2YVH A;  2LY9 A;  1HF0 A;  3S1N J;  2QWT A;  3BR6 A;  4B1R A;  1MBJ A;  2FQ4 A;  2DA1 A;  5FLV A;  2EH3 A;  3GTM J;  4ME9 A;  2QF7 A;  2I10 A;  4YZE A;  4AC0 A;  3HOV J;  3LSP A;  4A93 J;  3HKZ N;  1FIA A;  5K7H A;  4MXM A;  3DEW A;  2UXI A;  2E19 A;  4X1E A;  2R5Z B;  3PO3 J;  4M3F A;  2HOA A;  4XIC A;  2GEN A;  3VVZ A;  4D5C A;  1ETW A;  3HOX J;  1IJW C;  2M2E A;  4A3M J;  2G3B A;  4MO7 A;  2GM4 A;  1FIP A;  1NK2 P;  5F0C A;  2XPU A;  3S2D J;  4X6A J;  1XG1 A;  4ACI A;  4HNV A;  2X9D A;  2TCT A;  2H1K A;  2ZCX A;  2UXU A;  3ZQC A;  1BA5 A;  4MFE A;  5GPA A;  4L5E A;  3F1B A;  3WHC A;  3TED A;  3P9T A;  2VUM J;  2XGD A;  3L1P A;  3SJM A;  3IV5 A;  2PBX A;  1MH4 A;  2M0C A;  2ZB9 A;  2NP3 A;  3NRG A;  1WH5 A;  3OSF A;  5IOZ A;  3DCF A;  1A6I A;  3BR2 A;  3EUP A;  3S16 J;  5IYC J;  2CQX A;  1JUM A;  2EZK A;  2R92 J;  3S5R A;  1GDT A;  5J3L A;  4A3G J;  1P7I A;  1HCR A;  2GFN A;  1VI0 A;  3UKG A;  2GUH A;  2DA3 A;  1IGN A;  4C3I J;  4DYR A;  1RET A;  5F1J A;  1SAN A;  1AKH A;  2LK2 A;  4JYK A;  3EGQ A;  2R0Q C;  3HIM A;  2NS7 A;  3VP5 A;  3JRC A;  1FJL A;  1OCT C;  5K58 A;  3OIO A;  1X58 A;  3VVY A;  1JUP A;  2YUS A;  2Y31 A;  4RDU A;  2O8K A;  3M4O J;  2CQQ A;  3KNW A;  4C3H J;  5IP7 J;  2K9N A;  2CUF A;  1MNM C;  1I3Q J;  3RQI A;  2E2I J;  2M8G X;  4S0H B;  2DA7 A;  1MSE C;  4XK4 A;  5JLW A;  1HDP A;  1MH3 A;  2IAI A;  2NOG A;  1WCM J;  5F0H A;  3PPB A;  3JRB A;  3HOZ J;  3GZI A;  4DW6 A;  1Q1V A;  1AKH B;  9ANT A;  2RHA A;  1LE8 A;  2P81 A;  3ZOB A;  5IP9 J;  3RZO J;  3VVX A;  4NEL A;  5EEA A;  3TW7 A;  3PO2 J;  3GTK J;  2XPW A;  1WGX A;  2ZOY A;  2HYT A;  3LOC A;  4W97 A;  3RH2 A;  4IHY A;  3C07 A;  2CU7 A;  3FK7 A;  3HM5 A;  3NNR A;  3OOU A;  2NVT J;  3H3V K;  4A3F J;  3S2H J;  4JL3 A;  2LLK A;  3V78 A;  2K9Q A;  3HOW J;  5HOD A;  5E3N A;  2CJJ A;  2IEK A;  2NVQ J;  3BCG A;  5F0F A;  3C2B A;  3SDG A;  2HKU A;  3BRU A;  2MGQ A;  2HXI A;  4DYQ A;  2F07 A;  2DMN A;  3PAS A;  4IEJ A;  2DMU A;  1RPW A;  3QPS A;  5F27 A;  3BR1 A;  5DAJ A;  2E2J J;  2OPT A;  3G1M A;  2L0K A;  5EFY A;  2G7S A;  1LE8 B;  2KT0 A;  5C3E J;  5C4J J;  4FIS A;  3QQA A;  3BJB A;  3VOX A;  3RZD J;  3HTJ A;  4G12 A;  1OJL A;  2WV1 A;  3O60 A;  3HB9 A;  3O8H A;  4DYC A;  1GV5 A;  2Y30 A;  2FBQ A;  1UHS A;  1JKP C;  2E1O A;  3CCY A;  3HOY J;  3B81 A;  3E7L A;  1JT0 A;  2YS9 A;  1IV6 A;  2MG4 A;  5FKN A;  2JA7 J;  5BNG A;  3GTQ J;  2R5Y A;  1QRY A;  4M3B A;  3LJL A;  3B6C A;  1ETQ A;  1MBG A;  1OCP A;  3LSJ A;  4BXX J;  5HSZ A;  3BTI A;  2NVY J;  3LWJ A;  4M3E A;  1F43 A;  1FTT A;  1IUF A;  3DPJ A;  5FHP A;  3MNL A;  1VND A;  2DA4 A;  3AQT A;  2XGE A;  3ZQH A;  3BR0 A;  3BG5 A;  3H0G J;  2JA6 J;  3HTA A;  4CYC A;  5FJ8 J;  1TWA J;  5EDN A;  5CXI A;  5H9T A;  1I50 J;  5IYB J;  4I6Z A;  2DN0 A;  4JX4 A;  1GV2 A;  3HOU J;  1SGM A;  3BT9 A;  2TRT A;  3ZQF A;  3ANG A;  3ZQL A;  2M9H A;  1ZK8 A;  2XB5 A;  4QSH A;  2WB1 N;  3K7A J;  4GCL A;  2R5Y B;  4UUS A;  3FKI J;  5K7Z A;  4GFK A;  2AO9 A;  2ZOZ A;  3CJD A;  4XID A;  2L7F P;  1DU6 A;  1H89 C;  3BQZ A;  2G7G A;  2DMQ A;  2DA6 A;  4MLO A;  3GTP J;  2ZCN A;  1X2N A;  4BBR J;  2W53 A;  2GBY A;  2ID3 A;  3CDL A;  4DZP A;  5C4Y A;  3T6N A;  1TWF J;  1B72 A;  1JGG A;  3VW1 A;  2XDN A;  5D18 A;  5J1R A;  1PUF A;  3QBM A;  4W1U A;  5FKO A;  3VOK A;  4CYC B;  2LVS A;  3QPL A;  2JA5 J;  3IH2 A;  5FKK A;  4QIW N;  5DS9 A;  2VI6 A;  2G7L A;  1JUS A;  3GTL J;  2HOT A;  1H8A C;  1U9N A;  4UUT A;  1ZQ3 P;  5FMP A;  4B4C A;  3AQS A;  3HBL A;  2KDZ A;  3E7Q A;  3VUQ A;  1AHD P;  3TP3 A;  5HBU A;  2IBD A;  3BR5 A;  2QOP A;  3SFI A;  4UUS B;  3RKQ A;  2HYJ A;  4JX6 A;  2EBI A;  4BKX A;  5E3O A;  3MVP A;  3HEF A;  1LFB A;  3PM1 A;  5M5X J;  2ECB A;  3NAU A;  2WUI A;  2HXO A;  4NN1 A;  2HQ5 A;  4Y52 J;  3I4M J;  3B6A A;  5DTD A;  1APL C;  3ANP A;  4Y7N J;  3BTJ A;  1B72 B;  3GEU A;  2XRL A;  3WHB A;  2EZL A;  1PUF B;  2LTP A;  2O7O A;  1U9O A;  1U8B A;  1E3O C;  2Y0S N;  1W0U A;  1JKO C;  1ETO A;  4QTR A;  5GPC A;  3CQZ J;  4AF5 A;  1BL0 A;  3TW6 A;  1ORK A;  1D5Y A;  3ON2 A;  3NAR A;  3I4N J;  3BR3 A;  3G1O A;  4AC6 A;  1CQT A;  3JRI A;  1JJ6 C;  5F04 A;  2EZH A;  1BJZ A;  1MBH A;  2VKE A;  5M3M J;  2O7T A;  3D1N I;  3BQY A;  1IDZ A;  4A3B J;  1MBF A;  1WPK A;  1ZKG A;  3S1Q J;  3HDD A;  1OFC X;  1WI3 A;  3V6G A;  2OI8 A;  2QCO A;  4M3D A;  3JR9 A;  2REK A;  3NI7 A;  2DA2 A;  3VW2 A;  2D6Y A;  2NVX J;  4IHW A;  3IH3 A;  4ABZ A;  1JKQ C;  4XRS A;  3S1M J;  1GVD A;  5F08 A;  4BY1 J;  2YVE A;  3TP0 A;  1FTZ A;  1T33 A;  1HLV A;  2LD5 A;  2Y2Z A;  1B8I A;  2FJ1 A;  1I6H J;  3HGY A;  2G0E A;  1ZR4 A;  2B63 J;  3OSG A;  5FLM J;  2ZCM A;  1RKW A;  3BNI A;  3BG3 A;  4D7M A;  1UI5 A;  3LSR A;  2MSY A;  4UDS A;  5JLX A;  4FE7 A;  2NX4 A;  3IH4 A;  3COL A;  1BW5 A;  5CXG A;  5EG0 A;  2JA8 J;  3S14 J;  3HE0 A;  1JTY A;  3LSG A;  1F36 A;  1IDY A;  2X6O A;  4I76 A;  1TC3 C;  3G7R A;  5AQC A;  1W0T A;  4JX5 A;  1Y1V J;  1ITY A;  3VPR A;  4LOC A;  1EF4 A;  1QVU A;  3JRE A;  1HDD C;  1IC8 A;  1IRZ A;  5IOY A;  4IHV A;  1T56 A;  1Z0X A;  3A02 A;  3HTH A;  2H8R A;  1JT6 A;  2O9L A;  5M5Y J;  3CMY A;  2DJN A;  1UMQ A;  1QPI A;  2D5V A;  2LP0 A;  2Y9Y A;  3MN2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...