1ZKGA

Crystal structure of transcriptional regulator, tetr family (tm1030) from thermotoga maritima at 2.30 a resolution
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
200
structure length
200
Chain Sequence
VLSKRDAILKAAVEVFGKKGYDRATTDEIAEKAGVAKGLIFHYFKNKEELYYQAYMSVTEKLQKEFENFLMKNRNRDIFDFMERWIEKKLEYSASHPEEADFLITLVSVDEGLRKRILLDLEKSQRVFFDFVREKLKDLDLAEDVTEEIALKFLMWFFSGFEEVYLRTYQGKPELLKRDMNTLVEEVKVMLRILKKGMTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords transcriptional regulator, TetR family
publication title Crystal structure of TM1030 from Thermotoga maritima at 2.3 A resolution reveals molecular details of its transcription repressor function.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transcription regulator
total genus 69
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1zkgA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 1zkgA02
2AO9A 3CCYA 5FKNA 5C4JJ 2NVTJ 2LFBA 3OSGA 2DA6A 1IRZA 2W53A 4DW6A 1TWHJ 2NVYJ 1MH4A 1QVUA 5EFYA 3GZIA 2LD5A 1JKPC 1JKOC 3C07A 5HSZA 5EGOB 3HTHA 2CQQA 4B1RA 2IAIA 2E1OA 4C2MJ 2ME0A 2PBXA 2WGBA 5F0HA 4CYCA 2R5ZB 5FMPA 2PMZN 1RESA 5BNGA 4J19A 2XGCA 3NAUA 1WPKA 3O8HA 1F43A 2WV1A 1W0UA 3MNLA 2NP5A 1LFUP 3S1MJ 3KKDA 3GTJJ 3GTKJ 4IHXA 2ECBA 3G1OA 3CWRA 4QIWN 2XPWA 2R5YB 4A3KJ 5D18A 4GCKA 4JYKA 2LY9A 1PUFB 3GTGJ 3RZOJ 1ETVA 1VI0A 5M5YJ 3JRHA 5J1UA 1F36A 2L9RA 2JMWA 3G1MA 2X9DA 1ETQA 3RZDJ 1B8IB 3S1NJ 1QPIA 4XRMA 2NVQJ 2HXOA 2JA5J 3H3VK 4A3BJ 4D5CA 3IH2A 5GPAA 3RQIA 2R5ZA 2OERA 3BQZA 3A03A 2M0CA 4M3DA 2F07A 1FEXA 3BTCA 4Y52J 3PO3J 3LSRA 4I76A 2E2JJ 1RETA 2V57A 4ME9A 3S2HJ 1EF4A 4W97A 2COBA 4RBOA 2HXIA 3RH2A 5FGLA 1JKRC 4UUTA 5HBUA 2R5YA 5GPCA 3V78A 2QF7A 2LP0A 3BR1A 5H9TA 3S15J 4A3GJ 2M9HA 4QTRA 1JUMA 1RKWA 2KDZA 2TRTA 1TC3C 1B72B 2ZCNA 4D7MA 2LLKA 4MO7A 2XSDC 3A01B 3HE0A 1HLVA 5AQCA 9ANTA 5DTDA 3BR3A 4JX5A 2R7ZJ 5M3FJ 3BNIA 2MGQA 5J3LA 3A02A 1LFBA 4AYBN 3FIWA 4ABZA 2GLOA 5IP7J 1ZGWA 4DYCA 1YRNB 3GEUA 2YVEA 2E19A 3G1LA 3VP5A 3JRDA 3G56A 5EG0B 1MSEC 4NELA 2JJ7A 5EZHA 3HOVJ 2CJJA 4A3CJ 1WH7A 2QCOA 3ZQHA 1BA5A 2FX0A 1B72A 3PO2J 3VVZA 1VF9A 3VW2A 2HKUA 1JTXA 2XB0X 3A01A 5F0FA 4PXIA 4GFLA 5J1RA 3TEDA 4A3FJ 3KKCA 1MBFA 1ZR4A 2DJNA 4A3JJ 1H88C 5FKOA 1GV5A 1U8BA 2DMNA 2O7TA 2H1KA 5C4XJ 2CRGA 5IYDJ 1K83J 1JJ8C 3BJBA 2EBIA 1YRNA 5C44J 2X6OA 4CYCB 3NNRA 1UI5A 3LSGA 3ZQLA 1NK2P 3GTLJ 2ZB9A 1UMQA 1JTYA 3BRUA 4ACIA 3CRJA 2IEKA 3LNQA 5K7HA 5EG0A 4MFEA 1X2NA 3TP3A 2Y9ZA 2M8GX 3QPSA 3DPJA 3IV5A 1H89C 5FLVA 2EZHA 2RASA 1X58A 1P7JA 2HOAA 3LJLA 3NPIA 1GT0C 3SJMA 3WHBA 2MW8A 4A93J 4JKZA 2XPUA 5F0CA 1SGMA 4XRSA 1JUSA 5EEAA 3BG3A 3WHCA 1BL0A 4KWAA 1O4XA 5DAJA 1P7IA 2ECCA 2NVXJ 1FIAA 4M3EA 2X48A 2EZKA 2IBDA 3VVYA 5FHPA 1HCRA 5HAWA 3HEFA 1I3QJ 4GCTA 3QPLA 4A3IJ 3LSPA 3BHQA 4X6AJ 4L62A 2HYJA 4X1EA 3ZQGA 1SFOJ 3C2BA 3BG9A 2REKA 2FJ1A 3E7LA 3GTOJ 2VI6A 1ORKA 5C4YA 1Y1WJ 4IEJA 2WUIA 4D5FA 3FRQA 3HOXJ 5K7ZA 1IJWC 1LE8B 4A3MJ 1TWFJ 5D1RA 3T6NA 4NN1A 3B6AA 2LKXA 2ID6A 5K58A 1GUUA 1ZTRA 1ETYA 1S7EA 3B81A 1T56A 2EZLA 4HKUA 3BR2A 2L7ZA 3D1NI 2I10A 5JLXA 3IH4A 1HOMA 5FLMJ 2LK2A 2K9NA 2P81A 2JA7J 3MVPA 1DU6A 4BY7J 4BKXA 2GFNA 1OFCX 2ZCMA 2NP3A 4D7NA 5K7FA 3COLA 2VPRA 1A5JA 3VW0A 4AC6A 5IOYA 1IDZA 5EDNA 2O7OA 2DN0A 3K2AA 1JJ6C 1VNDA 2YS9A 3HTAA 2ME6A 1BJZA 2Y31A 4A3DJ 3NRGA 4IHWA 2VKVA 4NDLA 1JGGA 2K40A 3NARA 3HTIA 2UXIA 3Q0WA 4JNNA 3MN2A 1ENHA 5F08A 5IOZA 1IC8A 1LE8A 2XGEA 3VW1A 2B63J 2GENA 3HB9A 1R9TJ 4FCYA 2OPTA 2XGDA 3IH3A 4GFBA 3IUVA 2YU9J 4MXMA 1OCPA 2DMQA 2DG8A 3JR9A 2PZ9A 1U9NA 4V2FA 3Q3SA 3SFIA 1JUPA 2LVSA 3VUQA 2R92J 2E2HJ 2QTQA 3JRAA 2JK3A 5IP9J 4JL3A 2QWTA 1Z77A 3Q0UA 2DA2A 3ZQCA 1MH3A 2MG4A 2R0QC 2GUHA 3EUPA 3BTJA 3OIOA 3PASA 3CQZJ 3FK6A 4UUSB 3F1BA 4GFKA 4CGRA 2OF7A 3O8GA 1OJLA 5F04A 3HOZJ 2Q24A 3UKGA 1QVTA 1K61A 1TWAJ 1D5YA 2DTZA 3AQTA 2NOGA 1GVDA 1ZQ3P 1G2HA 1OCTC 3H0GJ 2TCTA 5IP6A 5E3LA 3OOUA 2DA7A 2YVHA 1IDYA 1Q1VA 1ZK8A 3S2DJ 3HTJA 2CQXA 2OI8A 4JX6A 3P9TA 4W1UA 2UXUA 1ZR2A 2GBYA 2DMTA 3BTIA 3S1QJ 3FISA 2ID3A 2NS7A 2DA3A 5FKKA 1IG7A 3FK7A 3K7AJ 3GTMJ 3B6CA 5IPAA 1POGA 2EH3A 1U78A 4XIDA 2HYTA 4M3BA 4UUSA 3CMYA 1WCMJ 1BW6A 2LR8A 5EZGA 1FTZA 1IGNA 2AHQA 1QRYA 1TWCJ 3NXCA 5M3MJ 4S0HB 2XPVA 1MBKA 2DA5A 1ETXA 1Y1VJ 5E3OA 1IUFA 1WGXA 2L7FP 1JKQC 3S1RJ 1AHDP 4C3IJ 3JRGA 3HDDA 1RR7A 2G7GA 3VOKA 4B3AA 3JRIA 1HF0A 4XRSG 3OSFA 2K9QA 1UG2A 3BR5A 3AQSA 1T33A 4EEFG 3JRCA 3S17J 2UXPA 4JX4A 3VVXA 2XB5A 3BCGA 1AKHB 2G3BA 5DS9A 1BW5A 4C3JJ 2QOPA 2G7LA 4DZPA 3Q0VA 1GDTA 2WAQN 4IHYA 4XICA 1ETWA 2FQ4A 3JRFA 3HGYA 2IU5A 5EYRA 2O9LA 2DA4A 2JN6A 5FJ8J 4QSHA 3HOYJ 2JWTA 3BR6A 4JP0A 4AUXA 2LTPA 1CQTA 3HOWJ 5JLWA 2Y0SN 1A6IA 3TW6A 5M5XJ 5E3MA 5CXIA 1IV6A 3HKZN 4ICHA 4IHVA 4MK6A 1NK3P 3W6VA 2W48A 3LHQA 4MLOA 3MKLA 2G7SA 3VIBA 1AKHA 5M5WJ 3RKQA 2M34A 4UDSA 3JRBA 3SDGA 4FTHA 3BT9A 2HI3A 3BQYA 3RD3A 3TW7A 2ELKA 3M4OJ 2CU7A 5FKMA 3ANGA 4M6VA 4BXXJ 1WI3A 3NI7A 1HDPA 3GTQJ 4GCLA 1MBJA 5F27A 1APLC 4BBRJ 3QBMA 1X2MA 3CJDA 2FD5A 1FTTA 2ZOZA 4AF5A 1SANA 3PM1A 3FKIJ 3QQAA 2GM4A 4FISA 2M2EA 2E2IJ 4Y7NJ 5EGOA 3O60A 2HOSA 3ANPA 3BG5A 1RKTA 1U9OA 4DYRA 1TWGJ 4L5EA 3HM5A 5EF6A 3I4NJ 2ZOYA 5HODA 3BR0A 4I6ZA 1VFCA 4A3LJ 3VOXA 1MBEA 1JT0A 5C3EJ 2VKEA 3I4MJ 3DEWA 1H8AC 1ETOA 3S16J 4RDUA 5D19A 1MNMC 1WH5A 2RHAA 3HOUJ 1NTCA 2KT0A 1ZKGA 3BTLA 5IYBJ 3F0CA 3CDLA 3ON4A 1DU0A 2NX4A 2CUFA 1HDDC 2K9SA 1AU7A 1PUFA 3G7RA 1FIPA 2DA1A 2VUMJ 3KZ9A 4M3FA 1MBGA 4B4CA 3ZQIA 2QKOA 3LWJA 4MIMA 1MBHA 5F1JA 2QIBA 5CW8A 1GV2A 1B8IA 5FKLA 4FE7A 2Y30A 2JA6J 2O8KA 3S5RA 3ZOBA 4A3EJ 4AC0A 2CUEA 2UXOA 3JSJA 2HQ5A 3HBLA 3S14J 2DG7A 2D5VA 1XS9A 3M3YJ 2EQRA 4V2GA 2D6YA 1E3OC 1XG1A 1Z0XA 2Y2ZA 4DYQA 2WB1N 4FE4A 3KNWA 2G0EA 1RPWA 2UXHA 2HDDA 3VPRA 2JA8J 1ETKA 4MFDA 3ZQFA 4DZJA 5J1YA 3E7QA 1UHSA 1JT6A 2NS8A 4A69C 4YZEA 3GBGA 5E3NA 3TP0A 5CXGA 4BBSJ 2MSYA 3JREA 3DCFA 2ZCXA 4BY1J 2H8RA 2DMPA 3GTPJ 2XDNA 4M3GA 1ITYA 3ON2A 1FJLA 4C3HJ 2Y9YA 1UI6A 3L1PA 3HGGA 1I50J 2L0KA 2XRLA 1W0TA 3HIMA 3QKXA 2R93J 2DMUA 3EGQA 3V6GA 4XK4A 3LOCA 1I6HJ 2FBQA 3PPBA 3LSJA 5GP9A 2EZIA 1XC5A 2YUSA 2RAEA 5IYCJ 2N8GA 1MSFC 2HOTA 4G12A 4HNVA 2L7MP 4LOCA
chains in the Genus database with same CATH superfamily
3CCYA 2LFBA 3OSGA 1MNEA 5KCMA 1TWHJ 2WTEA 2FUG2 1QVUA 4E7IA 4HF0A 5LEJA 2OD5A 4EJOA 3C07A 1YHQI 5EGOB 2K85A 3CLQA 5K5OA 2QKMB 1T95A 4C2MJ 1QGPA 2JA2A 4Q4ZF 5LHHA 2WGBA 2PMZN 1RESA 3BPXA 1YJWI 3NAUA 3O8HA 3A2KA 4OIRF 4A0ZA 1W0UA 3MNLA 2NP5A 1N77A 5ED4A 1O7FA 2W24A 4IHXA 5GTHC 1PUFB 4LIVA 1G4DA 1ETVA 1B1BA 2Z5UA 2EINH 3JRHA 4RMNA 1LEAA 3K4JA 2L9RA 3G1MA 3I4PA 1NHAA 1OCCH 1XDSA 2J5PA 1ETQA 3U1DA 1B8IB 3EDPA 1QPIA 3S1NJ 2HWVA 2DO7A 2NVQJ 2HXOA 2JA5J 4A3BJ 4D5CA 4KDPA 3P7NA 3IH2A 4IQ4A 2W25A 3REOA 4ANJA 2QSHX 3A03A 2ADUA 2M0CA 4MEYF 1FP2A 2F07A 2YVXA 2DOFA 3SYTA 4Z6YA 3S3OA 2CV0A 2X6XA 2E2JJ 4ME9A 4ASNA 4DJAA 3IWFA 3BG7A 4LGWA 2HXIA 1ACIA 1A31A 3AG4H 3IUOA 3RH2A 5FGLA 2H8WA 2Y75A 3F23A 4ZTFA 1JKRC 2EFPA 3P9KA 4L0YB 2LP0A 2FJI1 4XSZF 5H9TA 2HQAA 3SZTA 3V4GA 2M9HA 2PFBA 1R5ID 3S15J 1VQOI 2XSDC 3HE0A 3A01B 4KT6A 3GF2A 1KU9A 4HBLA 2RN7A 1LFBA 4AYBN 4G9YA 3FIWA 3EYIA 5LRRA 3EUHC 4BS9A 3TO7A 3H0DA 1ZGWA 3RCOA 4P55A 1SD7A 2IRFG 3CMAI 1J9IA 2M7AA 5HS7A 1V54H 2WY7Q 2R4GA 4HNUA 1WWXA 4XORA 3QRFF 4ZJZA 1BR1A 1X1AA 4XL9A 1XCVA 1O3TA 1R1UA 5BMZA 3K70D 2K9LA 4A3CJ 2L4MA 1WH7A 2QCOA 5LFAA 1E2XA 1VTNC 3OYGA 5H2FC 2NNYA 2VN2A 3A01A 2H6BA 3CO7C 4HSTA 3H9QA 3VB2A 4E7KA 2E5ZA 1ZR4A 2K27A 1JI8A 3VYSB 1I6XA 2F4MB 3WTUC 1U8BA 4C2UA 3OYCA 5C4XJ 5IYDJ 1XSXA 1KYWA 1ZGAA 3W6KB 5E79C 4I99C 4IRGA 4N9IA 3GVAA 3PQKA 1UI5A 3QYEA 3NNRA 2J5OA 4U9NA 2ZB9A 3LFUA 3CRJA 1XDUA 5K7HA 2OA4A 2EFOA 3TP3A 2M8GX 1X3WB 1HQCA 4L0ZB 1XX5A 3BP8A 4YEJA 4RM2A 3F8FA 5FLVA 1XTAA 1P7JA 2V1DA 2CFOA 4HLXA 2HOAA 3ZMTA 3J7AO 1KYZA 3NPIA 1GT0C 3SJMA 4WK8F 3WHBA 4O5VA 3ZMUA 4EVIA 4PUSA 5F0CA 1RC9A 3FXOA 5EEAA 2VLAA 4RLQA 1O4XA 5K1YA 3PUFA 2ECCA 2LOOA 2EV0A 2NVXJ 1FIAA 2VONA 2LC2A 3EUAA 2IBDA 1SAXA 5FHPA 3CP8A 4BQQA 1QO0D 2NRAC 4OIQF 3CMEI 4GCTA 3MKWB 3RIRA 4E7JA 1ZLJA 3DPUA 2QEXI 1HKTA 1T38A 2PMHA 2DK8A 3ZCOA 2GOXB 2FJ1A 5GTIC 2X4HA 3G71I 3ZQ7A 1LDJA 3QWLA 2WUIA 4LFUA 3I9V2 5K7ZA 1IJWC 4ZTJA 2A07F 2M1BA 1OR7C 2M8EA 1RIOH 4NB5A 2OAZA 1QPMA 3B6AA 5FD5A 3WGIA 1RI7A 1EKEA 5K58A 1ETYA 1A6QA 2EFQA 1BM9A 4I01A 3VSLA 4EJUA 3TO6A 3D1NI 5FLMJ 2LK2A 3N4MA 1SMTA 4G6DA 4XLEA 2JA7J 3MVPA 1B4AA 1HW2A 2QM3A 2VKDA 2ZCMA 4M6XA 3VW0A 5EDNA 5L3EA 3K2AA 1IRFA 3E97A 1JJ6C 3BCAA 1BJZA 3K4LA 5HDNA 1IXCA 2E35A 2VKVA 2UXIA 4CHUA 3Q0WA 4PJJA 3MN2A 4CGZA 4U88A 3L2QA 4BQAA 2B63J 3HB9A 1YIOA 2FU4A 4BH9A 2KISA 4Q48A 2XGDA 3OIQA 3DBHB 3IH3A 4JOMA 5JFRA 3MQ0A 3IUVA 4GYIA 4L9JA 2GWRA 2WAQA 3OL3A 3RPUA 2BEOA 1Z6TA 3AG2H 2BVLA 3GFLA 1P4AA 2AXTC 5IP9J 1Z77A 2CFXA 4FETA 3S8PA 5D4RA 1MH3A 1AOYA 1FOYA 3OIOA 2KZVA 2IA2A 3D5SC 3IRQA 4UUSB 2KL4A 4GFKA 3EUKL 1WFXA 4IRVA 4CGRA 2ZJ2A 1UZCA 5F04A 1TWAJ 1DGRM 1D5YA 4UVCA 1ZQ3P 3W2WA 1G2HA 4LB5A 3ZN1A 2CSOA 2TCTA 2IA1A 3H9GA 4L9TA 2JUGA 2YVHA 3OYFA 3BJOA 3FM3A 1R1VA 3JAMZ 3HTJA 2E34A 5B1BH 4W1UA 2UXUA 1T08B 1XGOA 2ZXJA 1OYYA 1YO5C 2NS7A 4ZDPA 3RDIA 4PCQA 1FP1D 2RNJA 3LSIA 2VQCA 3MWMA 1S9HA 1BR2A 2C6YA 3GTMJ 1UHWA 2R7UA 2EH3A 3RSNA 3DQVC 2UXNA 3FMQA 3VODA 4XIDA 4M3BA 2ZMEB 1XMXA 3FDYA 4UUSA 2ZXIA 3CMYA 1QA6A 3HRMA 1DUXC 1BW6A 4IHTA 2H94A 5DUKA 2AHQA 1QRYA 1BC7C 4UNOA 3M07A 2DAOA 3KYDB 4HZFA 3IC7A 2XPVA 2YX7A 2DA5A 4NBQA 1IUFA 3UNGC 2V4JC 5DDGA 1VQ4I 2H27A 5HS9A 1JKQC 3DP7A 3S1RJ 2JQ7A 5D6FA 3K1PA 4LLGF 3HSEA 1IW7F 4B3AA 3IL2A 4HV6A 2K9QA 1O3QA 4WXDA 3BJ6A 3S17J 4JX4A 1YX3A 2XB5A 2A61A 1I1SA 4AVZA 1KZHA 4GYGA 3GO5A 3FXKA 1T98A 2IU5A 1SD5A 4H0EA 3CUOA 5FJ8J 4QSHA 2F48A 3BZ6A 2LTPA 3LSHA 5FROA 3F6VA 4DBQA 2YR2A 2ZJPF 4YFKF 1KU3A 3OMYA 1A6IA 1I1GA 3CP2A 3GMEA 3OL4A 1IV6A 3K4KA 3I58A 3HTSB 4E6KG 3LHQA 1E0EA 3OY9A 5J8CA 5CVUA 1DPUA 2G7SA 4ESBA 2STTA 3ZPLA 2FA5A 1VQPI 3F8BA 2CUJA 3SDGA 2Z3YA 3RD3A 5JHFA 3M4OJ 3BWGA 1O3SA 4FT8A 4UV8A 3ANGA 3V7SA 1U8RA 1S72I 2WV0A 1TW2A 4EQQA 3H3ZA 3HUGB 5FD6A 4OMYA 1X2MA 3H36A 1BN5A 1FTTA 4RGXA 1SANA 3KP4A 3FKIJ 2NOJB 3ONQA 3PM1A 1L0OC 3QQAA 2M2EA 4RM3A 4XRFA 4Y7NJ 1N78A 1U9OA 4DYRA 3BZCA 1TWGJ 4L5EA 3HM5A 3KETA 1EH8A 2CGPA 5HODA 4A3LJ 1R58A 3VOXA 5E20A 2LDUA 2VKEA 4G6TB 4YIFA 5C3EJ 1H8AC 1F5TA 4RDUA 2IS2A 5DD4A 2VQLA 2D1VA 1MNMC 1UELB 2KT0A 1FSEA 3KEYA 2D1HA 1USTA 1DU0A 4IHSA 2XASA 1MMAA 3G7RA 1BOBA 1PP8F 1FIPA 2KKOA 4HX8A 1LKXA 4MHGA 4BEHB 4M3FA 3ZRGA 1IF1A 4B4CA 3HUGA 2QKOA 3LWJA 2XKOA 1MBHA 4A0XA 2BW3B 2B7EA 4AIJA 2ESNA 2A05A 2JA6J 5IT9Z 1EH7A 2F5CA 4AC0A 1B59A 1QU3A 5D8KB 4A12A 3T0YA 1FT9A 3FM5A 3HBLA 3FXMA 2VQHA 4XNFA 3DWLE 2DG7A 2D5VA 2RV8A 1YIJI 1XS9A 2ETHA 3LWFA 1ZELA 1XGSA 1ZHFA 2X6YA 3O6BB 3M3YJ 4V2GA 2K5CA 3S2WA 2D6YA 2YU3A 3FXRA 2OBPA 3CCMI 4ZH4F 4DYQA 3OYDA 1QHHD 2BE5F 1RPWA 4AD9A 2Y48A 4CCJA 2Q2EA 4CO8A 3PQJA 4IXAA 4RGRA 4R79A 4II3A 1Y0UA 4BEHA 3E7QA 1S7OA 2BW3A 2F5EA 3GBGA 1LDKB 1LUJB 1YW9A 4EGZA 3HRUA 5AIQA 3DLAA 4RAGA 5LBQA 1RRJA 1FYLA 4UXNA 3JREA 2A2FX 2Z33A 2GXGA 5DEQA 3G3ZA 4RB2C 3WTZA 2O03A 2HNHA 4NC7A 4C3HJ 1OQYA 2K4BA 1R00A 2O5RA 3L1PA 1ON2A 3M1CA 2R7WA 2GIVA 5D5UB 3CCVI 2LF8A 4LD5A 4UB6C 1BI3A 1FNNA 4B44A 1HA8A 3V6GA 3LOCA 1UAAA 1I6HJ 4ITVA 5D5VB 3CCUI 2YUSA 3V7CA 1ZRDA 2MH2A 2HOTA 2L7MP 2MLKA 4WWCA 5IY5H 3GLXA 2OV7A 2TDXA 5C4JJ 2NVTJ 1ZG5A 4DW6A 3S3NA 3MAJA 2A6EF 4ZYEA 1Z67A 1WJCA 2H1LA 2PN6A 3AFHA 3PFYA 4RB3C 2LD5A 1JKPC 1JKOC 1XCBA 2IS1A 2MH9A 3BPVA 2CQQA 1UHMA 4B1RA 3R0AA 3CCLI 2ME0A 2RREA 5F0HA 3DBRB 2W82A 5FMPA 2BXYA 1DP7P 3H5NA 4LLNA 5A2QZ 3G2BA 1BJAA 4QWQA 5BNGA 4J19A 1F43A 3F8CA 4EM0B 1IRXA 4PJMA 3OS2A 3ERMA 3S1MJ 4U9LA 2IGNA 2LSOA 3RPQA 5KHDA 5D18A 4JYKA 1X4OA 5M5YJ 4DQ2A 2ZMEC 3VDXA 3WGHA 1YG2A 4IOAF 5H6RA 2MC4A 3WTYC 3RZDJ 5HOOA 3ABMH 5J4VA 3BQZA 4EJTA 1LVKA 3HOSA 5B3SH 2Q1ZB 3PO3J 4KJZA 2PFVA 2VXDA 1IXSB 1RETA 2V9VA 2V57A 2VBZA 4N4OB 4W97A 3OOPA 1XMAA 1JHFA 2IP2A 3M8JA 3F22A 4UUTA 3V78A 1W1WE 3S3MA 3R60A 3BR1A 4U0YA 3I59B 3JW4A 2NNNA 2STWA 4QTRA 5DUIA 3HL2A 3HRTA 2V1NA 3L2RA 2TRTA 3V42A 1G3WA 1B72B 2EILH 2ZCNA 4MO7A 4GCVA 3TMOA 3V8JA 1SVLA 2CW7A 4AU7A 2R7VA 5AQCA 2R3SA 4IOCF 3K4CA 5L3BA 2VBXA 5M3FJ 2XIGA 1J7KA 5J3LA 2VE8A 2IVMA 2KJCA 3J7YJ 4D1QA 3TBIA 2GLOA 3CC4I 2KQRA 1OCRH 2XAJA 3ASNH 2DXIA 3CESA 4AIKA 2VC1A 2YVEA 1WJFA 3DU5A 3RKXA 3JRDA 1LQ1A 3R4KA 3CC7I 1MSEC 4KMFA 4XOPA 1CF7B 4TV7A 3I59A 5EEHA 1MJAA 2CG4A 2R7RA 3ZQHA 3JAMK 1BA5A 4RB0A 1STZA 5L3CA 1B72A 2V1UA 3C2HA 2HKUA 4HDVA 5J1RA 3KKCA 1MBFA 5CKTA 3BZKA 4A3JJ 2Q0OA 2QGUA 3NRVA 5J6XA 3K9TA 1JJ8C 2PJRB 1B9MA 3V7RA 3PL8A 1UMQA 3M8FA 1UG0A 2NYXA 3GZNB 3SEZA 1Z3XA 3RKYA 4OD4A 1X2NA 2Y9ZA 3G6EI 1GXPA 1CF7A 2QZ8A 3Q9SA 4ZZDA 2L01A 3QP6A 2EZHA 2RASA 2OJED 5H20A 2Z99A 1Y6IA 2ZFUA 4CDGA 1X19A 3LJLA 4XLHA 1VQLI 3WG9A 3PIPF 2DFHA 3DPLC 4PGHA 4KMUX 4JKZA 2KMUA 4XLCA 3T1BA 2QSFX 3BG3A 1UB9A 3I54A 2JVGA 5DD8A 4NC6A 3AG1H 3GEZA 4RA2A 5EEGA 3KLNA 2QENA 5J47A 4BE2A 3K6GA 4NQWB 1Z05A 1R22A 1R23A 2PJRA 5HAWA 2A68F 3HEFA 5DM7F 5DCMA 2P5KA 2M0MA 1X1PA 3BHQA 4X6AJ 4EM2A 1TBXA 3ZQGA 1P4WA 3PNTA 4KIBA 4X0GA 3IP4B 3BG9A 2H6CA 3F9KA 1K4TA 1MNDA 3GTOJ 4B43A 2V6EA 2MFZA 1Y1WJ 4IEJA 4BHCA 2H09A 3GFJA 4D5FA 3HOXJ 3G73A 1K4SA 5D1RA 2HPIA 1TL8A 2ZBKA 1RR8C 2X0LA 2ZFWA 4A5NA 4Q5SF 1ZTRA 4ZDOA 1S7EA 2IGOA 2EZLA 4HKUA 4NQWA 5JLXA 1HOMA 1W7PD 2P81A 2DODA 1AWCA 1ZG3A 2JTVA 1OFCX 3L7WA 3COLA 3U21A 4KISA 1VNDA 3HTAA 2QQ8A 2ZJRF 4IHWA 4M6YA 1IAWA 4NDLA 1JGGA 2K40A 3J7AY 4JNNA 3OS0A 1ENHA 3E6BA 5F08A 5IOZA 4CICA 3VW1A 3A4CA 2CV1A 2P5LC 1GLNA 2P7CB 1OYWA 4XLFA 4GFBA 4XKCA 1D0XA 1F1ZA 2DMQA 2DG8A 3K0LA 3KIOA 4V2FA 5B66C 1X1DA 1Z21A 4I7HA 2R92J 3CC2I 5L3DA 3EPZA 2VKHA 5FGMA 3JRAA 4ENMA 2QWTA 2OU2A 3Q0UA 2DA2A 3ZQCA 2KFDA 4M72A 2GUHA 1MMSA 3VOEA 2RC4A 4B3XA 2R7FA 3OYMA 3JCUC 3LA2A 3PASA 3DEEA 2FMYA 2MD0A 1VQKI 3O8GA 4AIHA 2A5WA 2CQKA 1T6SA 1B6AA 2QLZA 3NWTA 2HS5A 1K61A 5IT9K 2DTZA 2VC0A 3AQTA 1EA3A 3KX2A 4BXFA 6PAXA 1IN8A 1OCZH 3FWEA 2MYSA 2AXLA 5IP6A 3OOUA 2DA7A 1BI1A 1IDYA 3OR1C 3I56I 3N97A 2V9PA 2CQXA 2OI8A 1V4RA 5LEKA 3BTIA 3BJAA 1X3ZB 1IG7A 2EIMH 3TKYA 3HHGA 2DDBA 3HPGA 2EV5A 3BDDA 4C2MA 3QOPA 4XMYA 1WCMJ 2LR8A 3CCQI 2HTSA 1FTZA 3C18A 1MMDA 4LG3A 1I3AA 4D9JA 3MZYA 2HOEA 1HSTA 1YLFA 1SFKA 1U6GA 1ZGJA 3A1YA 1QZEA 3FZVA 4XR6A 1W4MA 4RAYA 2KRCA 3V8LA 1OCOH 5M3MJ 4P1WA 1MBKA 2Z2SB 4Y33A 4QPQA 3VSKA 5E3OA 1K7AA 4BU2A 2L7FP 3LMMA 3QAHA 2QUFA 5J40A 2W1OA 4RS8A 4F7ZA 2HYGD 3FBNB 1KQ9A 4O6JA 2QQ9A 3JRGA 1RR7A 1SD6A 5D6EA 3JRIA 1HF0A 3LQRA 3BR5A 3SWHA 3JRCA 3MKYB 3VVXA 4EJVA 1A35A 1LEBA 1D0ZA 1BW5A 2P5VA 4XBFA 5E1ZB 3H3UA 2G7LA 4DZPA 4DBRA 2KPMA 2E1CA 4IHYA 4XICA 2FQ4A 2DA4A 2JN6A 2EV6A 2JWTA 2WB1A 3BR6A 2LF7A 3NS4A 4I98B 5EJCA 1ZG1A 3ZQQA 1V5EA 2V1XA 2KRHA 3VWBA 3BCBA 2Y0SN 5L3GA 5A2QK 3TW6A 3E0JB 3HKZN 1G8XA 4ICHA 4IHVA 1AA7A 3TOBA 1CGPA 4MLOA 3MKLA 1FBQA 2X85A 2DLLA 3JSOA 3VIBA 1I39A 5ICCA 4U87A 2ZO4A 3CCSI 3R0JA 3JRBA 4FTHA 3BT9A 3F8MA 2FSWA 5E1XA 3J81Z 4U7BA 4M6VA 4C30A 1J09A 5E17F 2UZKA 2VJJA 4KUMA 4BBRJ 3WTWC 3BROA 1E3HA 2FD5A 4UY8I 4L9VA 1BBYA 3BG5A 1QZZA 4EM1A 5EF6A 2ZOYA 3FMRA 2JPBA 1YI2I 2FE3A 3AKZA 1ETOA 3J80Z 1KQ0A 5AONA 2CH0A 5FRNA 2QBYA 2RHAA 2HU9A 4ZZLA 3I55I 1ZKGA 2HZTA 3CDLA 2HKOA 5K5QA 2BY3A 1HDDC 5CVJA 4BXUA 1BIBA 2PMZA 2DOEA 3W3CA 2DA1A 2VUMJ 4A0YA 1FC3A 4GXOA 1ODDA 1GHCA 3HXLA 4HF1A 1NG7A 2QIBA 5CW8A 3CDHA 4Q47A 2PLYA 1R36A 2KP6A 1SD4A 3W6JB 5FKLA 3C3WA 4JK1X 5LD2C 2O8KA 4A3EJ 3PIOF 5H6QA 2CO5A 4G7OF 2WWYA 4LITA 4G8XA 4MNUA 1TLHB 4WX9A 5JVTA 3R61A 2KIMA 1T39A 1G59A 4AM3A 1J2XA 1Z0XA 5K5RA 1G3TA 2FXAA 2Y2ZA 3K69A 1XSDA 1DDNA 3KNWA 3QPTA 1YTYA 2F4IA 4WCGA 2UXHA 3GZ5A 3U2RA 4HG2A 5JHUA 3LQQA 4BHPA 3BY6A 5J1YA 2FOWA 3K1NA 3QP5A 2X1DA 3CJTB 5HLTA 4IRIA 5E3NA 3TP0A 2CYYA 2ZNZA 3KYLA 2ZY9A 2VOPA 4F92B 5FLXZ 2MSYA 2OQGA 3CDIA 4G6QA 3ZGKA 1S5LC 4BY1J 3LSTA 4M9XA 5FO5A 2H8RA 3DTEA 3WODF 5LHIA 4M3GA 3ON2A 4DIQA 4E7ZA 4PZJA 2ISZA 1UI6A 1BC8C 2BYVE 3HGGA 1I50J 4RAFA 3DLLF 1TT5B 2XRLA 1IXRC 3QKXA 3O3KA 1FOKA 2R93J 4XN0A 3EGQA 2DQLA 2EA4A 3LSJA 1OLTA 4N9HA 4AYBA 2RAEA 4A2UA 2N8GA 2IPQX 5IYCJ 1V55H 5TGTA 2HTJA 1MSFC 4HNVA 5E1WA 1F9NA 1MMGA 3NEUA 3GFMA 3CCRI 4QLCU 2W53A 2KDOA 2YPRA 1D8JA 4AWXB 1MH4A 2MA3A 1SVOA 3GZIA 4I02A 4BHBA 5HS8A 1G6NA 5LLQA 4ZYGA 1KGSA 4H4KC 4LK0F 3HTHA 3HRSA 2D45A 2E1OA 2KIUA 1N25A 3DXJF 2F5DA 4HSRA 4CYCA 3L2VA 3PNYA 3G4SI 2R5ZB 2L5QA 4MTDA 2XAHA 1EH6A 1WPKA 4B48A 2IA0A 3ZMVA 2IGKA 1ZYRF 1MD0A 3KKDA 3OYJA 3GTJJ 5JR3A 3I71A 3CWRA 3HC7A 2XPWA 4QIWN 2R5YB 4A3KJ 2O61A 4GCKA 3IWZA 3GTGJ 4Y3OA 4B8XA 1VI0A 4G7ZF 2KRFA 5J1UA 3RKWA 1F36A 4XLPF 1YOVB 2FEZA 2FBKA 4M73A 3MEXA 3DFGA 5ICGA 4FX4A 4NHJA 2X9DA 2VPLA 1REPC 2HVSA 2XKPA 3OYIA 4XRMA 5ICFA 4S05A 1K6OA 2BY2A 3PUBA 4BNCA 3K4BA 4GGGA 3PSIA 2L4AA 3FXLA 5GPAA 4D0PA 3RQIA 2R5ZA 2LBFA 2OERA 2A5YB 4M3DA 1PUEE 1FEXA 2KLOA 3M1EA 3BTCA 3BLYA 3KE2A 3H9JA 4I76A 3AL0B 1ERDA 2RKHA 4EGYA 1EF4A 1WJDA 4RBOA 1U5TB 3DV8A 5CPRB 4GO1A 2R5YA 3MZ8A 1NH3A 2Q2EB 1HSJA 2LY2A 3Q5FA 2F5VA 1JUMA 2KDZA 3COAC 3I53A 4KYWA 3H1CA 2ACJA 4AIDA 1HLVA 3KP6A 4B09A 1I5ZA 9ANTA 1ON1A 2VXZA 3BR3A 5DTDA 4JX5A 4MQ9F 2R7ZJ 3CCJI 2R7XA 1W5CC 4HNTA 2UWMA 2PEXA 2MGQA 1R5GA 2MD5A 4BJ5C 3GFIA 4BDYA 2XF7A 4DNCA 3HJEA 4XN3A 2HDCA 5IP7J 2I8DA 4DYCA 1YRNB 2HFHA 2E19A 1L3LA 1U5TA 2PJPA 5KVRA 3G56A 3KP7A 4NELA 2EA2A 2JJ7A 4BJ6C 4I0BA 2R7SA 5ERIA 2CJJA 3U1KA 1SAUA 2VB6A 2ZNYA 4OAZA 3PO2J 3VVZA 4ETSA 2W57A 3ISPA 3AG3H 1JTXA 2M7BA 2XB0X 1XMKA 3CUQB 5F0FA 3MKZA 5ILSA 1LPQA 4DGWB 4GFLA 4PXIA 2COMA 4XQFA 1WZ2A 4A3FJ 1MJBA 2DJNA 3A0BC 1GV5A 4FX0A 4LLLA 1ZRCA 2DMNA 2O7TA 3PNVA 4IF4A 4IO9F 2H1KA 1HW5A 5IT3A 3K1MA 4OIOF 3ZR8X 1YRNA 1TT0A 3ZQLA 1NK2P 3GTLJ 2IEKA 1WJAA 4G94A 2GA1A 4MTEA 2XRNA 2ZJQF 5FRMA 3C1DA 3QPSA 3DPJA 3IV5A 5JVGF 2G7HA 5J8FA 3GZ6A 4BACA 2EFWA 1H89C 5BS6A 3M9AA 1X58A 2W7NA 3DTIA 2VL8A 1T2KA 4S04A 2FRHA 3ZMDA 4CH7A 4OINF 2E7WA 3CUQA 4YFNF 4A93J 1D1CA 3PJRA 3OYHA 5TISC 1JUSA 1SGMA 3CMMA 3WHCA 4OIPF 4KWAA 1P7IA 4KN7X 1IRGA 3OS1A 3HPHA 4M3EA 1DGWY 5HNFA 2NVUB 2X48A 1FYMA 3VVYA 4UV9A 3OYAA 3E5XA 3DKWA 4F3QA 3CO6C 4PDKA 2O6GE 2R7TA 5FFZA 3QPLA 4HX4A 3F8NA 2DT7B 2HYJA 4X1EA 5B1AH 1FBSA 2E5NA 1LDDA 1SFOJ 5J4YA 5FFXA 2V7FA 3LA7A 2REKA 4PFOA 4OMZA 2VI6A 4M71A 1ORKA 2HPMA 2A69F 1TWFJ 1U0JA 2Z16A 4NN1A 4XKVA 3DBLB 3E6DA 3H35A 2EIKH 2HR3A 1HXDA 1WRJA 2IW5A 3TDUC 1T56A 2VBWA 4UB8C 3BR2A 2K7LA 2L7ZA 4YIRX 4L18B 3IH4A 3GW2A 3OR2C 2GZWA 3GCMA 2K9NA 1FX7A 2VJ4A 1BOAA 3EQLF 1DU6A 4LIUA 3OYBA 1J5YA 4D7NA 5K7FA 1A5JA 3TOAA 1SFXA 5F6FA 5IOYA 4AC6A 3J81K 2FOKA 1J75A 2YS9A 2DDAA 3RYRA 2BHYA 2XAGA 5CVRA 2Y31A 4A3DJ 4BAYA 1LJ9A 2L3DA 2F6CA 2WY8Q 3HTIA 2GOMA 4FHTA 4M9ZA 4XLAA 1IC8A 2O3FA 2XGEA 3EUHA 4M74A 3HG9A 1ONVA 2OPTA 3Q9VA 1O3RA 1LVAA 3OYKA 3KYCB 2LKPA 3J80K 1HC8A 2QWWA 4MXMA 3X2QH 3RJPA 3CJQB 2PZ9A 1U9NA 3SFIA 3Q3SA 5TRDA 1V3FA 1YYVA 3RI4A 1YS7A 2M5WA 2QYOA 4JL3A 1Y8RB 2DTRA 4L5IA 1S8NA 3P9CA 4HYEA 2MG4A 2R0QC 2ZKZA 1PJRA 3OYEA 3ZMSA 3GYHX 1FMVA 1ZH5A 2FBHA 2JZYA 4IL6C 3F1BA 2V9KA 5HDGA 3GUDA 2LH9A 3HOZJ 3WU0A 4ENJA 3SFZA 5DV5A 2Q24A 3UKGA 4HQMA 1OKRA 4XSXF 2G7UA 2X51A 2NOGA 3LAJA 3KZZA 1UFMA 2OTLI 2P4WA 1FYKA 2M45A 2K86A 2MBFA 1Q1VA 1ZK8A 3S2DJ 3P9TA 3TO9A 3F21A 3ELKA 1ZR2A 1IN7A 4EV0A 2F4OB 2GBYA 5KAFC 3E6CC 3FISA 2DPUA 2ID3A 5DCFA 1WVRA 5ILVA 1IN5A 1X1CA 2Y69H 1HKSA 4IKFA 2MLGA 1TP4A 2KJBA 5JI6A 1R5HA 5DCMB 2HYTA 3FKJA 4ON0A 4F55A 2B0LA 4EATA 5L3FA 5EZGA 3L2WA 3AL0C 1IGNA 4HW0A 5FLXK 4NNJA 2ZSIB 2XSJC 1TWCJ 2RDPA 1Z6RA 1RUOA 3WTSC 1U5TC 4O3MA 2D2WA 1R7JA 1ETXA 1Y1VJ 1P4XA 4I2OA 1LFPA 1SFEA 1AHDP 3HDDA 1K79A 2G7GA 3ML6A 4PFPA 1ZLKA 4R8HA 3OV8A 1BI0A 1OR7A 3DU6A 5E18F 3BCGA 1AKHB 2G3BA 3VFZA 2EFNA 3SXYA 1TQIA 2QOPA 4C3JJ 2DCEA 1GDTA 2WAQN 1ZRFA 4HDUA 2PX9A 4EMSA 3JRFA 4E7HA 3ZN0A 2W85A 2AS5F 2ZC2A 3N05A 3QU3A 1ULYA 1I27A 5CVVA 3F72A 4NC8A 2LREA 3HOWJ 2BY0A 5GAEJ 2EK5A 2WADA 3DPTA 5E3MA 2FMLA 4HV5A 1MJ9A 3K4NA 3KEQA 4GRIA 1Z7UA 3GLLA 3WG7H 4KITB 2LKSA 2XUBA 3W6VA 4V19K 2P6SA 3IRRA 3CUQC 4N4NB 2QSGX 2QA4I 2GA2A 2GQQA 2VJ5A 3MCZA 4IRHA 5D5XB 3CF5F 2OQRA 1AKHA 2M34A 4ENNA 3W2VA 2HVRA 2M4KA 4UDSA 1WSUA 3BQYA 1FZPB 1W5SA 3TW7A 2ELKA 3HSFA 2OZUA 5FKMA 2MABA 4BXXJ 1WI3A 3KP5A 4E7LA 3NI7A 4RAZA 2IGMA 4GCLA 1MBJA 5F27A 3QBMA 1HKQA 4F91B 3B73A 1MMNA 4FISA 2E2IJ 4Y17A 5EGOA 1MDMB 2HOSA 3ANPA 4CYDA 1RKTA 2LNBA 3O60A 5LGTA 4ZYHA 3L00A 3VEPA 1VQ8I 3BR0A 4KN4X 4XKWA 3FXUA 2NS0A 3DEWA 5GADJ 1U3EM 3S16J 1TW3A 3WTVC 4CCOA 4Y4RA 4QPOA 5E8IA 3KP3A 3NQOA 1WH5A 2CWEA 4CCMA 3HOUJ 1NTCA 2E60A 5ICEA 2IJLA 2G9WA 3BTLA 3L9FA 1O57A 3ABUA 2CUFA 1PDNC 1XGMA 2K9SA 1AU7A 1PUFA 2HVQA 4KIGA 2BV6A 1PP7U 3D5RC 3P5JA 1YW8A 3ZQIA 2DQRA 1ZAOA 4MIMA 4F93B 1GV2A 1B8IA 2XAUA 3FXQA 1VQ6I 3FF5A 1MDMA 2XHKA 4FE7A 2BGCA 4HX7A 5KAIC 1SVMA 1P6RA 1JHHA 3SDBA 1USSA 2CUEA 2L54A 1Z3YA 1M1EB 4IVNA 2HQ5A 2K9MA 4U7DA 4IJAA 2UXOA 3JSJA 1N75A 5HDKA 2E1NA 4RGUA 4HPQA 1X1BA 2HDWA 4YRVA 3KFWX 4BQNA 1XG1A 4IPAA 2XAFA 2L9SA 4FE4A 4HEA2 5D8LB 4XONA 1RNLA 1Y56A 3KCCA 4J00A 2K3FA 1YJNI 2JA8J 1IZ1A 4DZJA 2DOAA 4E4HA 2PBIA 1WJ5A 3WU2C 1JT6A 2NS8A 3CTAA 3EETA 1J59A 4YZEA 1TNTA 4MGRA 5B5EC 3CD6I 4BE1A 3MMYB 1YJ9I 1Z91A 2DK5A 3DCFA 2ZCXA 1MW7A 1MGTA 2IT0A 1P2FA 4DOZA 3RQ4A 1QQIA 3GTPJ 1D1BA 3SEQA 2PG4A 2DYRH 2A3SA 2Y9YA 1D3YA 2CW8A 1QNTA 2O8XA 5D4SA 2BY1A 2QQBA 1NG6A 1OMIA 4YFXF 2L0KA 2F5FA 3D0SA 2LY1A 4XM3A 5CQEA 3V8KA 4U0VA 4JQFA 4BGDA 4R1HA 4XK4A 2CW0F 3K70C 2FBQA 5LGUA 2EZIA 5BPDA 2L9VA 1YITI 4LOCA 4YELA 4L5JA 4KNYA 2AO9A 5FKNA 4Y13A 1J0RA 1W36D 2DA6A 1IRZA 2KIQA 1IO2A 4AVPA 2NVYJ 5FB2A 5EFYA 1EV7A 1MKMA 1RZ4A 4K2EA 2OTJI 4P9UA 4UVBA 1S3JA 3BG6A 1Q1HA 5HSZA 4OWRB 3TL4X 3AAFA 2IAIA 2M4GA 4PJLA 4CCKA 2PBXA 1FOXA 3RYPA 2ZSHB 3WU1B 3TDZC 4PK4A 1KU7A 1BR4A 2XGCA 5KNLA 2XDVA 2WV1A 2QBYB 2L2OA 1DPRA 4CZCA 4ENKA 1Y8QB 2VT3A 1LFUP 3GTKJ 2ECBA 3G1OA 1W36C 2LYCA 2LY9A 3L2CA 3IAM2 2DPDA 3RZOJ 1SMYF 1ZN2A 3B02A 2JRTA 2WAFA 4FASD 3L2UA 3A0HC 2OZ6A 2JMWA 3D5LA 1ZARA 1OPCA 5GAHJ 2ELHA 3OYNA 1O7LA 3KZIC 2FF4A 1ZREA 2DBBA 3CZ6A 3H3VK 1LNWA 3K4MA 3ABLH 2B3WA 2JUCA 4XOTA 4PJNA 4IZZA 3ZP5A 1JXSA 4DVYP 2B9SA 4Y52J 4LMYA 4ESJA 4PSWA 3HTUA 3LSRA 1FPQA 2VBYA 3S2HJ 2VJIA 4HOBA 2M3AA 2COBA 2GXBA 3CF2A 3OIPA 1X3UA 5HBUA 1K78B 2LMDA 5GPCA 2QF7A 4OAYA 2BBYA 4N0BA 3ERED 1Y0NA 4A3GJ 1OYIA 1A36A 1RKWA 2HYFA 3WTTC 1TC3C 5BPIA 4D7MA 2LLKA 2VIXA 4ZDLA 4BQOA 4RB1A 3BNIA 2CV2A 2JVHA 3IKTA 1YFHA 3A02A 4ABZA 4CXFA 3VYUB 1W5TA 3ABTA 3FHNA 4E70A 3ABKH 3GEUA 3I64A 1QHGA 3G1LA 3VP5A 2Y0MA 3C2GA 5EG0B 1K78A 4ZYDA 1YW7A 5EZHA 1P9QC 3HOVJ 3ASOH 5BOXA 3H5AA 2BOLA 1EJ9A 2DI3A 2FX0A 1YQAA 1R4MB 1WJEA 1X4PA 3LFKA 4G7HF 1WJBA 1VF9A 4C2TA 3VW2A 2DT5A 3VTIA 3BOQA 2HQRA 3P9IA 3WE2A 1WI9A 1KA8A 3E5UA 3K2ZA 4B47A 1GVJA 3TEDA 3R6SA 4UVAA 1GXQA 3W2AA 3DF8A 4J01A 1TQMA 1H88C 5CLSA 5FKOA 2QKLB 2DW4A 2CRGA 3KLOA 2E36A 1K83J 3ESWB 3BJBA 2EBIA 4JBAA 5C44J 2X6OA 2ICWG 4CYCB 1XD7A 3LSGA 5HLIA 1JTYA 3BRUA 4ACIA 3SQNA 3LNQA 5EG0A 4MFEA 2KZGA 2Q8KA 2DU9A 4YIIA 3OWTA 1UJ8A 3ECHA 1VQ5I 3RTRA 2VE9A 1HBXG 3TQNA 2P8TA 3VYTB 4FQGA 2MW8A 4MEXF 2XPUA 4XRSA 3KZYA 5LGNA 1BL0A 2E1MB 1DP3A 3UR3C 5DAJA 1WHUA 2EWNA 1YE9A 2EB7A 2X1CA 3NWSA 2EZKA 2XC7A 4L9NA 4F52A 3SZGA 1HCRA 2BZTA 2Z9OA 4C9YA 1I3QJ 2LBFB 4WXCA 1XB4A 2ZMEA 4A3IJ 2P0WA 3LSPA 1S29A 1VZ0A 4Z2YA 2Z1DA 1RUNA 4L62A 1VQ7I 3C2BA 1K6YA 1D0YA 3E7LA 5C4YA 1MZBA 3FRQA 2FNAA 1LE8B 4A3MJ 3CLOA 3HSRA 4ZYAA 3T6NA 1XGNA 1G3SA 3DKXA 2LKXA 2ID6A 4OD5A 1GUUA 2E71A 2M30A 3B81A 4GDFA 1QZYA 2R7DA 1R71A 2I10A 3IHUA 4LK1F 3ULQB 4CZZA 5DYMA 1WKMA 2K3PA 4BY7J 4BKXA 2GFNA 3E6MA 2VASA 2NP3A 4HQEA 2VPRA 4XKBA 4WIBA 4HLYA 1IDZA 1TQPA 2O7OA 2DN0A 5LRSA 5LHGA 2ME6A 2ISYA 2UXXA 3K8PC 4A6DA 3NRGA 5HLHA 3NARA 1QBJA 2A6TA 4YG2F 3I5UA 1VQNI 2AQFA 1OISA 2PQ8A 2P6TA 1LE8A 2XROA 4NUBA 3RPUD 3H92A 3T5XA 2WAEA 2XF6A 2GENA 5ILUA 1IN4A 1R9TJ 4FCYA 3GX4X 1S6LA 3F6OA 5GAGJ 5F1RA 2X1EA 2YU9J 1T0FA 3FBIB 2JRMA 5CQGA 1OCPA 3HOTA 1P92A 2L9NA 3JR9A 1JE8A 2GAUA 1JUPA 2LVSA 2DYSH 3VUQA 2E2HJ 1Z9CA 5HVQC 2QTQA 1XN7A 2JK3A 2DFFA 2CS3A 2VQGA 2WC2A 3KPHA 1S7AA 2Y0SA 1KU2A 2KHMA 3EUPA 3BTJA 3HKZA 1FSHA 2LG4A 1R4NB 2A6HF 4HRIA 3CQZJ 3FK6A 2F2EA 2QVOA 2OF7A 1OJLA 3K10A 1QVTA 3DKYA 1GVDA 1OCTC 3H0GJ 3DTKA 4OOIA 1FMWA 5E3LA 3LSKA 3T8RA 2FNPA 1FY7A 4JX6A 4WXHA 2ZXHA 3C7JA 2NAZA 1U2WA 2YSRA 2DMTA 2EPFA 3U9GA 3S1QJ 1D8KA 1TNSA 3DEUA 5FKKA 2DA3A 1MIJA 3M7GA 5DM6F 1FLIA 1XSVA 3FK7A 1JGSA 3K7AJ 5AIPA 4CA0A 2VOOA 2IXSA 3B6CA 5IPAA 1POGA 1U78A 3S32A 1SFUA 2BVMA 2JSPA 3F3XA 2JT1A 3E1SA 3VYRB 3ZMZA 3QYBA 3NXCA 1HW1A 2XF5A 2L02A 4CSWA 1A04A 4S0HB 5F64A 3E3VA 4ZC3A 3QU6A 4RLFA 3FX3A 1WGXA 1T8IA 3L09A 2VODA 4KICA 4I0AA 4C3IJ 2XGXA 2KIFA 4OU0A 4A6EA 3VOKA 2JPCA 4E7SA 1FOWA 3I3LA 4XRSG 4A5MA 3OSFA 1UG2A 3AQSA 2OCCH 1UCRA 1T33A 2HKXA 1V5GA 4EEFG 4BJTA 2UXPA 3CJNA 3LA3A 4BYYA 3TGNA 1PVEA 3S93A 3FXJA 5DS9A 3H5RA 1IN6A 3I0TA 2LRDA 2BXZA 4BUPA 3Q0VA 3QPHA 1G3YA 3KEOA 1W7PB 3J7ZI 2GXAA 2IS6A 1ETWA 2HEOA 5CXGA 3HGYA 1V5FA 5EYRA 1XPXA 2O9LA 3T8TA 1H9GA 3HOYJ 1F4KA 3PSFA 1FWZA 4JP0A 4AUXA 3MD2A 4KA4A 5TJJA 1CQTA 1E17A 4CUGA 3SZPA 4UHTA 2XVCA 5JLWA 2W00A 1SEUA 1PYVA 3PFIA 4PGGA 4MQVA 5HLGA 5M5XJ 1KQ8A 5CXIA 2PMUA 2RGVA 2L7KA 2WBMA 2OUMA 1NK3P 2W48A 3FMSA 4MK6A 2W4SA 4II2A 4KT5C 1IUYA 2AQEA 1KONA 3JTHA 1R1TA 4KFCA 2YX4A 4P9FA 3GXOA 5M5WJ 3RKQA 2RQQA 3SHFA 3QODA 2UV1A 2HI3A 2HZDA 1W7PA 4ESFA 2CU7A 2CQNA 2MC3A 2E7XA 1HDPA 1DQUA 1VQ9I 3GTQJ 3ECOA 2GIZA 1APLC 3CJDA 2O0YA 2ZOZA 4AF5A 4HAMA 2XV4S 2GM4A 1VQMI 3JSPA 1R6RA 2K4JA 3I4NJ 3LSMA 5D5WB 2ESHA 4I6ZA 2W84A 3QOEA 4WF2A 1MBEA 1VFCA 1JT0A 3I4MJ 2M87A 4BL0B 1D1AA 5D19A 2E1MC 2UUZA 3GWZA 3E5QA 5HNHA 2FBIA 1H9TA 4M9SA 5IYBJ 3F0CA 4P5OA 3ON4A 5BQTA 2NX4A 3LL7A 2DFEA 3OYLA 1Z1DA 1BIAA 1TZLA 3KZ9A 4UUVA 1MBGA 2ZCWA 2HGCA 1YS6A 2HQNA 5F1JA 3FHZA 4KIFA 3ROUA 2BHZA 4RGSA 2Y30A 3MZHA 2QQAA 3S5RA 3ZOBA 4IX7A 3LAPA 1LB2A 3QYFA 1BI2A 3EYYA 3HZJA 3HIFA 1R49A 3MFKA 3S14J 5CVIA 1Z7LA 2WA0A 2OC6A 4I09A 4XLNF 4BDZA 1H0MA 4U0WA 2EQRA 1T0FC 3IKVA 1E3OC 3IAS2 3O2PE 2WB1N 1TTYA 2VT2A 2G0EA 4P96A 2CUZA 4LB6B 2FQ3A 1C0WA 2HDDA 3VPRA 2R7OA 3CCEI 4LG0B 1ETKA 4MFDA 3ZQFA 2B1EA 1FBUA 4HA8A 1UHSA 3M8EA 2I5UA 4A69C 4CCLA 1Y39A 1E3PA 4BBSJ 1WQ2A 2X6WA 5CYVA 4EJWA 2V6CA 4CCNA 2ELJA 1SC7A 1IV8A 5CJ9A 2DMPA 2V26A 1B9NA 1YX5A 3WE3A 2IS4A 1ITYA 2XDNA 3HYIA 3BC8A 1FJLA 4LJZF 4BE0A 4HF2A 2DJIA 2RNGA 2RVCA 2V79A 3HHHA 3ZXSA 2NXNB 2OCEA 4PSXA 1W0TA 3HIMA 2EIJH 2DMUA 2JSCA 3KP2A 3CJRB 2ZXWH 4IQJA 2PI0A 3PPBA 2CMPA 2K02A 2R7QA 2XAQA 2P7VB 5E8GA 5GP9A 1XC5A 5KK1A 4LG0A 2CQ7A 3WGGA 2EJRA 4Y15A 3WTXC 2DFIA 1D5VA 4G12A 3JTGA 4PJ0C 2DT6A 2RQPA
chains in the Genus database with same CATH topology
2AO9A 3CCYA 5FKNA 5C4JJ 2NVTJ 2LFBA 3OSGA 2DA6A 1IRZA 2W53A 4DW6A 1TWHJ 2NVYJ 1MH4A 1QVUA 5EFYA 3GZIA 2LD5A 1JKPC 1JKOC 3C07A 5HSZA 5EGOB 3HTHA 2CQQA 4B1RA 2IAIA 2E1OA 4C2MJ 2ME0A 2PBXA 2WGBA 5F0HA 4CYCA 2R5ZB 5FMPA 2PMZN 1RESA 5BNGA 4J19A 2XGCA 3NAUA 1WPKA 3O8HA 1F43A 2WV1A 1W0UA 3MNLA 2NP5A 1LFUP 3S1MJ 3KKDA 3GTJJ 3GTKJ 4IHXA 2ECBA 3G1OA 3CWRA 4QIWN 2XPWA 2R5YB 4A3KJ 5D18A 4GCKA 4JYKA 2LY9A 1PUFB 3GTGJ 3RZOJ 1ETVA 1VI0A 5M5YJ 3JRHA 5J1UA 1F36A 2L9RA 2JMWA 3G1MA 2X9DA 1ETQA 3RZDJ 1B8IB 3S1NJ 1QPIA 4XRMA 2NVQJ 2HXOA 2JA5J 3H3VK 4A3BJ 4D5CA 3IH2A 5GPAA 3RQIA 2R5ZA 2OERA 3BQZA 3A03A 2M0CA 4M3DA 2F07A 1FEXA 3BTCA 4Y52J 3PO3J 3LSRA 4I76A 2E2JJ 1RETA 2V57A 4ME9A 3S2HJ 1EF4A 4W97A 2COBA 4RBOA 2HXIA 3RH2A 5FGLA 1JKRC 4UUTA 5HBUA 2R5YA 5GPCA 3V78A 2QF7A 2LP0A 3BR1A 5H9TA 3S15J 4A3GJ 2M9HA 4QTRA 1JUMA 1RKWA 2KDZA 2TRTA 1TC3C 1B72B 2ZCNA 4D7MA 2LLKA 4MO7A 2XSDC 3A01B 3HE0A 1HLVA 5AQCA 9ANTA 5DTDA 3BR3A 4JX5A 2R7ZJ 5M3FJ 3BNIA 2MGQA 5J3LA 3A02A 1LFBA 4AYBN 3FIWA 4ABZA 2GLOA 5IP7J 1ZGWA 4DYCA 1YRNB 3GEUA 2YVEA 2E19A 3G1LA 3VP5A 3JRDA 3G56A 5EG0B 1MSEC 4NELA 2JJ7A 5EZHA 3HOVJ 2CJJA 4A3CJ 1WH7A 2QCOA 3ZQHA 1BA5A 2FX0A 1B72A 3PO2J 3VVZA 1VF9A 3VW2A 2HKUA 1JTXA 2XB0X 3A01A 5F0FA 4PXIA 4GFLA 5J1RA 3TEDA 4A3FJ 3KKCA 1MBFA 1ZR4A 2DJNA 4A3JJ 1H88C 5FKOA 1GV5A 1U8BA 2DMNA 2O7TA 2H1KA 5C4XJ 2CRGA 5IYDJ 1K83J 1JJ8C 3BJBA 2EBIA 1YRNA 5C44J 2X6OA 4CYCB 3NNRA 1UI5A 3LSGA 3ZQLA 1NK2P 3GTLJ 2ZB9A 1UMQA 1JTYA 3BRUA 4ACIA 3CRJA 2IEKA 3LNQA 5K7HA 5EG0A 4MFEA 1X2NA 3TP3A 2Y9ZA 2M8GX 3QPSA 3DPJA 3IV5A 1H89C 5FLVA 2EZHA 2RASA 1X58A 1P7JA 2HOAA 3LJLA 3NPIA 1GT0C 3SJMA 3WHBA 2MW8A 4A93J 4JKZA 2XPUA 5F0CA 1SGMA 4XRSA 1JUSA 5EEAA 3BG3A 3WHCA 1BL0A 4KWAA 1O4XA 5DAJA 1P7IA 2ECCA 2NVXJ 1FIAA 4M3EA 2X48A 2EZKA 2IBDA 3VVYA 5FHPA 1HCRA 5HAWA 3HEFA 1I3QJ 4GCTA 3QPLA 4A3IJ 3LSPA 3BHQA 4X6AJ 4L62A 2HYJA 4X1EA 3ZQGA 1SFOJ 3C2BA 3BG9A 2REKA 2FJ1A 3E7LA 3GTOJ 2VI6A 1ORKA 5C4YA 1Y1WJ 4IEJA 2WUIA 4D5FA 3FRQA 3HOXJ 5K7ZA 1IJWC 1LE8B 4A3MJ 1TWFJ 5D1RA 3T6NA 4NN1A 3B6AA 2LKXA 2ID6A 5K58A 1GUUA 1ZTRA 1ETYA 1S7EA 3B81A 1T56A 2EZLA 4HKUA 3BR2A 2L7ZA 3D1NI 2I10A 5JLXA 3IH4A 1HOMA 5FLMJ 2LK2A 2K9NA 2P81A 2JA7J 3MVPA 1DU6A 4BY7J 4BKXA 2GFNA 1OFCX 2ZCMA 2NP3A 4D7NA 5K7FA 3COLA 2VPRA 1A5JA 3VW0A 4AC6A 5IOYA 1IDZA 5EDNA 2O7OA 2DN0A 3K2AA 1JJ6C 1VNDA 2YS9A 3HTAA 2ME6A 1BJZA 2Y31A 4A3DJ 3NRGA 4IHWA 2VKVA 4NDLA 1JGGA 2K40A 3NARA 3HTIA 2UXIA 3Q0WA 4JNNA 3MN2A 1ENHA 5F08A 5IOZA 1IC8A 1LE8A 2XGEA 3VW1A 2B63J 2GENA 3HB9A 1R9TJ 4FCYA 2OPTA 2XGDA 3IH3A 4GFBA 3IUVA 2YU9J 4MXMA 1OCPA 2DMQA 2DG8A 3JR9A 2PZ9A 1U9NA 4V2FA 3Q3SA 3SFIA 1JUPA 2LVSA 3VUQA 2R92J 2E2HJ 2QTQA 3JRAA 2JK3A 5IP9J 4JL3A 2QWTA 1Z77A 3Q0UA 2DA2A 3ZQCA 1MH3A 2MG4A 2R0QC 2GUHA 3EUPA 3BTJA 3OIOA 3PASA 3CQZJ 3FK6A 4UUSB 3F1BA 4GFKA 4CGRA 2OF7A 3O8GA 1OJLA 5F04A 3HOZJ 2Q24A 3UKGA 1QVTA 1K61A 1TWAJ 1D5YA 2DTZA 3AQTA 2NOGA 1GVDA 1ZQ3P 1G2HA 1OCTC 3H0GJ 2TCTA 5IP6A 5E3LA 3OOUA 2DA7A 2YVHA 1IDYA 1Q1VA 1ZK8A 3S2DJ 3HTJA 2CQXA 2OI8A 4JX6A 3P9TA 4W1UA 2UXUA 1ZR2A 2GBYA 2DMTA 3BTIA 3S1QJ 3FISA 2ID3A 2NS7A 2DA3A 5FKKA 1IG7A 3FK7A 3K7AJ 3GTMJ 3B6CA 5IPAA 1POGA 2EH3A 1U78A 4XIDA 2HYTA 4M3BA 4UUSA 3CMYA 1WCMJ 1BW6A 2LR8A 5EZGA 1FTZA 1IGNA 2AHQA 1QRYA 1TWCJ 3NXCA 5M3MJ 4S0HB 2XPVA 1MBKA 2DA5A 1ETXA 1Y1VJ 5E3OA 1IUFA 1WGXA 2L7FP 1JKQC 3S1RJ 1AHDP 4C3IJ 3JRGA 3HDDA 1RR7A 2G7GA 3VOKA 4B3AA 3JRIA 1HF0A 4XRSG 3OSFA 2K9QA 1UG2A 3BR5A 3AQSA 1T33A 4EEFG 3JRCA 3S17J 2UXPA 4JX4A 3VVXA 2XB5A 3BCGA 1AKHB 2G3BA 5DS9A 1BW5A 4C3JJ 2QOPA 2G7LA 4DZPA 3Q0VA 1GDTA 2WAQN 4IHYA 4XICA 1ETWA 2FQ4A 3JRFA 3HGYA 2IU5A 5EYRA 2O9LA 2DA4A 2JN6A 5FJ8J 4QSHA 3HOYJ 2JWTA 3BR6A 4JP0A 4AUXA 2LTPA 1CQTA 3HOWJ 5JLWA 2Y0SN 1A6IA 3TW6A 5M5XJ 5E3MA 5CXIA 1IV6A 3HKZN 4ICHA 4IHVA 4MK6A 1NK3P 3W6VA 2W48A 3LHQA 4MLOA 3MKLA 2G7SA 3VIBA 1AKHA 5M5WJ 3RKQA 2M34A 4UDSA 3JRBA 3SDGA 4FTHA 3BT9A 2HI3A 3BQYA 3RD3A 3TW7A 2ELKA 3M4OJ 2CU7A 5FKMA 3ANGA 4M6VA 4BXXJ 1WI3A 3NI7A 1HDPA 3GTQJ 4GCLA 1MBJA 5F27A 1APLC 4BBRJ 3QBMA 1X2MA 3CJDA 2FD5A 1FTTA 2ZOZA 4AF5A 1SANA 3PM1A 3FKIJ 3QQAA 2GM4A 4FISA 2M2EA 2E2IJ 4Y7NJ 5EGOA 3O60A 2HOSA 3ANPA 3BG5A 1RKTA 1U9OA 4DYRA 1TWGJ 4L5EA 3HM5A 5EF6A 3I4NJ 2ZOYA 5HODA 3BR0A 4I6ZA 1VFCA 4A3LJ 3VOXA 1MBEA 1JT0A 5C3EJ 2VKEA 3I4MJ 3DEWA 1H8AC 1ETOA 3S16J 4RDUA 5D19A 1MNMC 1WH5A 2RHAA 3HOUJ 1NTCA 2KT0A 1ZKGA 3BTLA 5IYBJ 3F0CA 3CDLA 3ON4A 1DU0A 2NX4A 2CUFA 1HDDC 2K9SA 1AU7A 1PUFA 3G7RA 1FIPA 2DA1A 2VUMJ 3KZ9A 4M3FA 1MBGA 4B4CA 3ZQIA 2QKOA 3LWJA 4MIMA 1MBHA 5F1JA 2QIBA 5CW8A 1GV2A 1B8IA 5FKLA 4FE7A 2Y30A 2JA6J 2O8KA 3S5RA 3ZOBA 4A3EJ 4AC0A 2CUEA 2UXOA 3JSJA 2HQ5A 3HBLA 3S14J 2DG7A 2D5VA 1XS9A 3M3YJ 2EQRA 4V2GA 2D6YA 1E3OC 1XG1A 1Z0XA 2Y2ZA 4DYQA 2WB1N 4FE4A 3KNWA 2G0EA 1RPWA 2UXHA 2HDDA 3VPRA 2JA8J 1ETKA 4MFDA 3ZQFA 4DZJA 5J1YA 3E7QA 1UHSA 1JT6A 2NS8A 4A69C 4YZEA 3GBGA 5E3NA 3TP0A 5CXGA 4BBSJ 2MSYA 3JREA 3DCFA 2ZCXA 4BY1J 2H8RA 2DMPA 3GTPJ 2XDNA 4M3GA 1ITYA 3ON2A 1FJLA 4C3HJ 2Y9YA 1UI6A 3L1PA 3HGGA 1I50J 2L0KA 2XRLA 1W0TA 3HIMA 3QKXA 2R93J 2DMUA 3EGQA 3V6GA 4XK4A 3LOCA 1I6HJ 2FBQA 3PPBA 3LSJA 5GP9A 2EZIA 1XC5A 2YUSA 2RAEA 5IYCJ 2N8GA 1MSFC 2HOTA 4G12A 4HNVA 2L7MP 4LOCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AO9 A;  3CCY A;  5FKN A;  5C4J J;  2NVT J;  2LFB A;  3OSG A;  2DA6 A;  1IRZ A;  2W53 A;  4DW6 A;  1TWH J;  2NVY J;  1MH4 A;  1QVU A;  5EFY A;  3GZI A;  2LD5 A;  1JKP C;  1JKO C;  3C07 A;  5HSZ A;  5EGO B;  3HTH A;  2CQQ A;  4B1R A;  2IAI A;  2E1O A;  4C2M J;  2ME0 A;  2PBX A;  2WGB A;  5F0H A;  4CYC A;  2R5Z B;  5FMP A;  2PMZ N;  1RES A;  5BNG A;  4J19 A;  2XGC A;  3NAU A;  1WPK A;  3O8H A;  1F43 A;  2WV1 A;  1W0U A;  3MNL A;  2NP5 A;  1LFU P;  3S1M J;  3KKD A;  3GTJ J;  3GTK J;  4IHX A;  2ECB A;  3G1O A;  3CWR A;  4QIW N;  2XPW A;  2R5Y B;  4A3K J;  5D18 A;  4GCK A;  4JYK A;  2LY9 A;  1PUF B;  3GTG J;  3RZO J;  1ETV A;  1VI0 A;  5M5Y J;  3JRH A;  5J1U A;  1F36 A;  2L9R A;  2JMW A;  3G1M A;  2X9D A;  1ETQ A;  3RZD J;  1B8I B;  3S1N J;  1QPI A;  4XRM A;  2NVQ J;  2HXO A;  2JA5 J;  3H3V K;  4A3B J;  4D5C A;  3IH2 A;  5GPA A;  3RQI A;  2R5Z A;  2OER A;  3BQZ A;  3A03 A;  2M0C A;  4M3D A;  2F07 A;  1FEX A;  3BTC A;  4Y52 J;  3PO3 J;  3LSR A;  4I76 A;  2E2J J;  1RET A;  2V57 A;  4ME9 A;  3S2H J;  1EF4 A;  4W97 A;  2COB A;  4RBO A;  2HXI A;  3RH2 A;  5FGL A;  1JKR C;  4UUT A;  5HBU A;  2R5Y A;  5GPC A;  3V78 A;  2QF7 A;  2LP0 A;  3BR1 A;  5H9T A;  3S15 J;  4A3G J;  2M9H A;  4QTR A;  1JUM A;  1RKW A;  2KDZ A;  2TRT A;  1TC3 C;  1B72 B;  2ZCN A;  4D7M A;  2LLK A;  4MO7 A;  2XSD C;  3A01 B;  3HE0 A;  1HLV A;  5AQC A;  9ANT A;  5DTD A;  3BR3 A;  4JX5 A;  2R7Z J;  5M3F J;  3BNI A;  2MGQ A;  5J3L A;  3A02 A;  1LFB A;  4AYB N;  3FIW A;  4ABZ A;  2GLO A;  5IP7 J;  1ZGW A;  4DYC A;  1YRN B;  3GEU A;  2YVE A;  2E19 A;  3G1L A;  3VP5 A;  3JRD A;  3G56 A;  5EG0 B;  1MSE C;  4NEL A;  2JJ7 A;  5EZH A;  3HOV J;  2CJJ A;  4A3C J;  1WH7 A;  2QCO A;  3ZQH A;  1BA5 A;  2FX0 A;  1B72 A;  3PO2 J;  3VVZ A;  1VF9 A;  3VW2 A;  2HKU A;  1JTX A;  2XB0 X;  3A01 A;  5F0F A;  4PXI A;  4GFL A;  5J1R A;  3TED A;  4A3F J;  3KKC A;  1MBF A;  1ZR4 A;  2DJN A;  4A3J J;  1H88 C;  5FKO A;  1GV5 A;  1U8B A;  2DMN A;  2O7T A;  2H1K A;  5C4X J;  2CRG A;  5IYD J;  1K83 J;  1JJ8 C;  3BJB A;  2EBI A;  1YRN A;  5C44 J;  2X6O A;  4CYC B;  3NNR A;  1UI5 A;  3LSG A;  3ZQL A;  1NK2 P;  3GTL J;  2ZB9 A;  1UMQ A;  1JTY A;  3BRU A;  4ACI A;  3CRJ A;  2IEK A;  3LNQ A;  5K7H A;  5EG0 A;  4MFE A;  1X2N A;  3TP3 A;  2Y9Z A;  2M8G X;  3QPS A;  3DPJ A;  3IV5 A;  1H89 C;  5FLV A;  2EZH A;  2RAS A;  1X58 A;  1P7J A;  2HOA A;  3LJL A;  3NPI A;  1GT0 C;  3SJM A;  3WHB A;  2MW8 A;  4A93 J;  4JKZ A;  2XPU A;  5F0C A;  1SGM A;  4XRS A;  1JUS A;  5EEA A;  3BG3 A;  3WHC A;  1BL0 A;  4KWA A;  1O4X A;  5DAJ A;  1P7I A;  2ECC A;  2NVX J;  1FIA A;  4M3E A;  2X48 A;  2EZK A;  2IBD A;  3VVY A;  5FHP A;  1HCR A;  5HAW A;  3HEF A;  1I3Q J;  4GCT A;  3QPL A;  4A3I J;  3LSP A;  3BHQ A;  4X6A J;  4L62 A;  2HYJ A;  4X1E A;  3ZQG A;  1SFO J;  3C2B A;  3BG9 A;  2REK A;  2FJ1 A;  3E7L A;  3GTO J;  2VI6 A;  1ORK A;  5C4Y A;  1Y1W J;  4IEJ A;  2WUI A;  4D5F A;  3FRQ A;  3HOX J;  5K7Z A;  1IJW C;  1LE8 B;  4A3M J;  1TWF J;  5D1R A;  3T6N A;  4NN1 A;  3B6A A;  2LKX A;  2ID6 A;  5K58 A;  1GUU A;  1ZTR A;  1ETY A;  1S7E A;  3B81 A;  1T56 A;  2EZL A;  4HKU A;  3BR2 A;  2L7Z A;  3D1N I;  2I10 A;  5JLX A;  3IH4 A;  1HOM A;  5FLM J;  2LK2 A;  2K9N A;  2P81 A;  2JA7 J;  3MVP A;  1DU6 A;  4BY7 J;  4BKX A;  2GFN A;  1OFC X;  2ZCM A;  2NP3 A;  4D7N A;  5K7F A;  3COL A;  2VPR A;  1A5J A;  3VW0 A;  4AC6 A;  5IOY A;  1IDZ A;  5EDN A;  2O7O A;  2DN0 A;  3K2A A;  1JJ6 C;  1VND A;  2YS9 A;  3HTA A;  2ME6 A;  1BJZ A;  2Y31 A;  4A3D J;  3NRG A;  4IHW A;  2VKV A;  4NDL A;  1JGG A;  2K40 A;  3NAR A;  3HTI A;  2UXI A;  3Q0W A;  4JNN A;  3MN2 A;  1ENH A;  5F08 A;  5IOZ A;  1IC8 A;  1LE8 A;  2XGE A;  3VW1 A;  2B63 J;  2GEN A;  3HB9 A;  1R9T J;  4FCY A;  2OPT A;  2XGD A;  3IH3 A;  4GFB A;  3IUV A;  2YU9 J;  4MXM A;  1OCP A;  2DMQ A;  2DG8 A;  3JR9 A;  2PZ9 A;  1U9N A;  4V2F A;  3Q3S A;  3SFI A;  1JUP A;  2LVS A;  3VUQ A;  2R92 J;  2E2H J;  2QTQ A;  3JRA A;  2JK3 A;  5IP9 J;  4JL3 A;  2QWT A;  1Z77 A;  3Q0U A;  2DA2 A;  3ZQC A;  1MH3 A;  2MG4 A;  2R0Q C;  2GUH A;  3EUP A;  3BTJ A;  3OIO A;  3PAS A;  3CQZ J;  3FK6 A;  4UUS B;  3F1B A;  4GFK A;  4CGR A;  2OF7 A;  3O8G A;  1OJL A;  5F04 A;  3HOZ J;  2Q24 A;  3UKG A;  1QVT A;  1K61 A;  1TWA J;  1D5Y A;  2DTZ A;  3AQT A;  2NOG A;  1GVD A;  1ZQ3 P;  1G2H A;  1OCT C;  3H0G J;  2TCT A;  5IP6 A;  5E3L A;  3OOU A;  2DA7 A;  2YVH A;  1IDY A;  1Q1V A;  1ZK8 A;  3S2D J;  3HTJ A;  2CQX A;  2OI8 A;  4JX6 A;  3P9T A;  4W1U A;  2UXU A;  1ZR2 A;  2GBY A;  2DMT A;  3BTI A;  3S1Q J;  3FIS A;  2ID3 A;  2NS7 A;  2DA3 A;  5FKK A;  1IG7 A;  3FK7 A;  3K7A J;  3GTM J;  3B6C A;  5IPA A;  1POG A;  2EH3 A;  1U78 A;  4XID A;  2HYT A;  4M3B A;  4UUS A;  3CMY A;  1WCM J;  1BW6 A;  2LR8 A;  5EZG A;  1FTZ A;  1IGN A;  2AHQ A;  1QRY A;  1TWC J;  3NXC A;  5M3M J;  4S0H B;  2XPV A;  1MBK A;  2DA5 A;  1ETX A;  1Y1V J;  5E3O A;  1IUF A;  1WGX A;  2L7F P;  1JKQ C;  3S1R J;  1AHD P;  4C3I J;  3JRG A;  3HDD A;  1RR7 A;  2G7G A;  3VOK A;  4B3A A;  3JRI A;  1HF0 A;  4XRS G;  3OSF A;  2K9Q A;  1UG2 A;  3BR5 A;  3AQS A;  1T33 A;  4EEF G;  3JRC A;  3S17 J;  2UXP A;  4JX4 A;  3VVX A;  2XB5 A;  3BCG A;  1AKH B;  2G3B A;  5DS9 A;  1BW5 A;  4C3J J;  2QOP A;  2G7L A;  4DZP A;  3Q0V A;  1GDT A;  2WAQ N;  4IHY A;  4XIC A;  1ETW A;  2FQ4 A;  3JRF A;  3HGY A;  2IU5 A;  5EYR A;  2O9L A;  2DA4 A;  2JN6 A;  5FJ8 J;  4QSH A;  3HOY J;  2JWT A;  3BR6 A;  4JP0 A;  4AUX A;  2LTP A;  1CQT A;  3HOW J;  5JLW A;  2Y0S N;  1A6I A;  3TW6 A;  5M5X J;  5E3M A;  5CXI A;  1IV6 A;  3HKZ N;  4ICH A;  4IHV A;  4MK6 A;  1NK3 P;  3W6V A;  2W48 A;  3LHQ A;  4MLO A;  3MKL A;  2G7S A;  3VIB A;  1AKH A;  5M5W J;  3RKQ A;  2M34 A;  4UDS A;  3JRB A;  3SDG A;  4FTH A;  3BT9 A;  2HI3 A;  3BQY A;  3RD3 A;  3TW7 A;  2ELK A;  3M4O J;  2CU7 A;  5FKM A;  3ANG A;  4M6V A;  4BXX J;  1WI3 A;  3NI7 A;  1HDP A;  3GTQ J;  4GCL A;  1MBJ A;  5F27 A;  1APL C;  4BBR J;  3QBM A;  1X2M A;  3CJD A;  2FD5 A;  1FTT A;  2ZOZ A;  4AF5 A;  1SAN A;  3PM1 A;  3FKI J;  3QQA A;  2GM4 A;  4FIS A;  2M2E A;  2E2I J;  4Y7N J;  5EGO A;  3O60 A;  2HOS A;  3ANP A;  3BG5 A;  1RKT A;  1U9O A;  4DYR A;  1TWG J;  4L5E A;  3HM5 A;  5EF6 A;  3I4N J;  2ZOY A;  5HOD A;  3BR0 A;  4I6Z A;  1VFC A;  4A3L J;  3VOX A;  1MBE A;  1JT0 A;  5C3E J;  2VKE A;  3I4M J;  3DEW A;  1H8A C;  1ETO A;  3S16 J;  4RDU A;  5D19 A;  1MNM C;  1WH5 A;  2RHA A;  3HOU J;  1NTC A;  2KT0 A;  1ZKG A;  3BTL A;  5IYB J;  3F0C A;  3CDL A;  3ON4 A;  1DU0 A;  2NX4 A;  2CUF A;  1HDD C;  2K9S A;  1AU7 A;  1PUF A;  3G7R A;  1FIP A;  2DA1 A;  2VUM J;  3KZ9 A;  4M3F A;  1MBG A;  4B4C A;  3ZQI A;  2QKO A;  3LWJ A;  4MIM A;  1MBH A;  5F1J A;  2QIB A;  5CW8 A;  1GV2 A;  1B8I A;  5FKL A;  4FE7 A;  2Y30 A;  2JA6 J;  2O8K A;  3S5R A;  3ZOB A;  4A3E J;  4AC0 A;  2CUE A;  2UXO A;  3JSJ A;  2HQ5 A;  3HBL A;  3S14 J;  2DG7 A;  2D5V A;  1XS9 A;  3M3Y J;  2EQR A;  4V2G A;  2D6Y A;  1E3O C;  1XG1 A;  1Z0X A;  2Y2Z A;  4DYQ A;  2WB1 N;  4FE4 A;  3KNW A;  2G0E A;  1RPW A;  2UXH A;  2HDD A;  3VPR A;  2JA8 J;  1ETK A;  4MFD A;  3ZQF A;  4DZJ A;  5J1Y A;  3E7Q A;  1UHS A;  1JT6 A;  2NS8 A;  4A69 C;  4YZE A;  3GBG A;  5E3N A;  3TP0 A;  5CXG A;  4BBS J;  2MSY A;  3JRE A;  3DCF A;  2ZCX A;  4BY1 J;  2H8R A;  2DMP A;  3GTP J;  2XDN A;  4M3G A;  1ITY A;  3ON2 A;  1FJL A;  4C3H J;  2Y9Y A;  1UI6 A;  3L1P A;  3HGG A;  1I50 J;  2L0K A;  2XRL A;  1W0T A;  3HIM A;  3QKX A;  2R93 J;  2DMU A;  3EGQ A;  3V6G A;  4XK4 A;  3LOC A;  1I6H J;  2FBQ A;  3PPB A;  3LSJ A;  5GP9 A;  2EZI A;  1XC5 A;  2YUS A;  2RAE A;  5IYC J;  2N8G A;  1MSF C;  2HOT A;  4G12 A;  4HNV A;  2L7M P;  4LOC A; 
#chains in the Genus database with same CATH topology
 3CCY A;  2LFB A;  3OSG A;  1MNE A;  5KCM A;  1TWH J;  2WTE A;  2FUG 2;  1QVU A;  4E7I A;  4HF0 A;  5LEJ A;  2OD5 A;  4EJO A;  3C07 A;  1YHQ I;  5EGO B;  2K85 A;  3CLQ A;  5K5O A;  2QKM B;  1T95 A;  4C2M J;  1QGP A;  2JA2 A;  4Q4Z F;  5LHH A;  2WGB A;  2PMZ N;  1RES A;  3BPX A;  1YJW I;  3NAU A;  3O8H A;  3A2K A;  4OIR F;  4A0Z A;  1W0U A;  3MNL A;  2NP5 A;  1N77 A;  5ED4 A;  1O7F A;  2W24 A;  4IHX A;  5GTH C;  1PUF B;  4LIV A;  1G4D A;  1ETV A;  1B1B A;  2Z5U A;  2EIN H;  3JRH A;  4RMN A;  1LEA A;  3K4J A;  2L9R A;  3G1M A;  3I4P A;  1NHA A;  1OCC H;  1XDS A;  2J5P A;  1ETQ A;  3U1D A;  1B8I B;  3EDP A;  1QPI A;  3S1N J;  2HWV A;  2DO7 A;  2NVQ J;  2HXO A;  2JA5 J;  4A3B J;  4D5C A;  4KDP A;  3P7N A;  3IH2 A;  4IQ4 A;  2W25 A;  3REO A;  4ANJ A;  2QSH X;  3A03 A;  2ADU A;  2M0C A;  4MEY F;  1FP2 A;  2F07 A;  2YVX A;  2DOF A;  3SYT A;  4Z6Y A;  3S3O A;  2CV0 A;  2X6X A;  2E2J J;  4ME9 A;  4ASN A;  4DJA A;  3IWF A;  3BG7 A;  4LGW A;  2HXI A;  1ACI A;  1A31 A;  3AG4 H;  3IUO A;  3RH2 A;  5FGL A;  2H8W A;  2Y75 A;  3F23 A;  4ZTF A;  1JKR C;  2EFP A;  3P9K A;  4L0Y B;  2LP0 A;  2FJI 1;  4XSZ F;  5H9T A;  2HQA A;  3SZT A;  3V4G A;  2M9H A;  2PFB A;  1R5I D;  3S15 J;  1VQO I;  2XSD C;  3HE0 A;  3A01 B;  4KT6 A;  3GF2 A;  1KU9 A;  4HBL A;  2RN7 A;  1LFB A;  4AYB N;  4G9Y A;  3FIW A;  3EYI A;  5LRR A;  3EUH C;  4BS9 A;  3TO7 A;  3H0D A;  1ZGW A;  3RCO A;  4P55 A;  1SD7 A;  2IRF G;  3CMA I;  1J9I A;  2M7A A;  5HS7 A;  1V54 H;  2WY7 Q;  2R4G A;  4HNU A;  1WWX A;  4XOR A;  3QRF F;  4ZJZ A;  1BR1 A;  1X1A A;  4XL9 A;  1XCV A;  1O3T A;  1R1U A;  5BMZ A;  3K70 D;  2K9L A;  4A3C J;  2L4M A;  1WH7 A;  2QCO A;  5LFA A;  1E2X A;  1VTN C;  3OYG A;  5H2F C;  2NNY A;  2VN2 A;  3A01 A;  2H6B A;  3CO7 C;  4HST A;  3H9Q A;  3VB2 A;  4E7K A;  2E5Z A;  1ZR4 A;  2K27 A;  1JI8 A;  3VYS B;  1I6X A;  2F4M B;  3WTU C;  1U8B A;  4C2U A;  3OYC A;  5C4X J;  5IYD J;  1XSX A;  1KYW A;  1ZGA A;  3W6K B;  5E79 C;  4I99 C;  4IRG A;  4N9I A;  3GVA A;  3PQK A;  1UI5 A;  3QYE A;  3NNR A;  2J5O A;  4U9N A;  2ZB9 A;  3LFU A;  3CRJ A;  1XDU A;  5K7H A;  2OA4 A;  2EFO A;  3TP3 A;  2M8G X;  1X3W B;  1HQC A;  4L0Z B;  1XX5 A;  3BP8 A;  4YEJ A;  4RM2 A;  3F8F A;  5FLV A;  1XTA A;  1P7J A;  2V1D A;  2CFO A;  4HLX A;  2HOA A;  3ZMT A;  3J7A O;  1KYZ A;  3NPI A;  1GT0 C;  3SJM A;  4WK8 F;  3WHB A;  4O5V A;  3ZMU A;  4EVI A;  4PUS A;  5F0C A;  1RC9 A;  3FXO A;  5EEA A;  2VLA A;  4RLQ A;  1O4X A;  5K1Y A;  3PUF A;  2ECC A;  2LOO A;  2EV0 A;  2NVX J;  1FIA A;  2VON A;  2LC2 A;  3EUA A;  2IBD A;  1SAX A;  5FHP A;  3CP8 A;  4BQQ A;  1QO0 D;  2NRA C;  4OIQ F;  3CME I;  4GCT A;  3MKW B;  3RIR A;  4E7J A;  1ZLJ A;  3DPU A;  2QEX I;  1HKT A;  1T38 A;  2PMH A;  2DK8 A;  3ZCO A;  2GOX B;  2FJ1 A;  5GTI C;  2X4H A;  3G71 I;  3ZQ7 A;  1LDJ A;  3QWL A;  2WUI A;  4LFU A;  3I9V 2;  5K7Z A;  1IJW C;  4ZTJ A;  2A07 F;  2M1B A;  1OR7 C;  2M8E A;  1RIO H;  4NB5 A;  2OAZ A;  1QPM A;  3B6A A;  5FD5 A;  3WGI A;  1RI7 A;  1EKE A;  5K58 A;  1ETY A;  1A6Q A;  2EFQ A;  1BM9 A;  4I01 A;  3VSL A;  4EJU A;  3TO6 A;  3D1N I;  5FLM J;  2LK2 A;  3N4M A;  1SMT A;  4G6D A;  4XLE A;  2JA7 J;  3MVP A;  1B4A A;  1HW2 A;  2QM3 A;  2VKD A;  2ZCM A;  4M6X A;  3VW0 A;  5EDN A;  5L3E A;  3K2A A;  1IRF A;  3E97 A;  1JJ6 C;  3BCA A;  1BJZ A;  3K4L A;  5HDN A;  1IXC A;  2E35 A;  2VKV A;  2UXI A;  4CHU A;  3Q0W A;  4PJJ A;  3MN2 A;  4CGZ A;  4U88 A;  3L2Q A;  4BQA A;  2B63 J;  3HB9 A;  1YIO A;  2FU4 A;  4BH9 A;  2KIS A;  4Q48 A;  2XGD A;  3OIQ A;  3DBH B;  3IH3 A;  4JOM A;  5JFR A;  3MQ0 A;  3IUV A;  4GYI A;  4L9J A;  2GWR A;  2WAQ A;  3OL3 A;  3RPU A;  2BEO A;  1Z6T A;  3AG2 H;  2BVL A;  3GFL A;  1P4A A;  2AXT C;  5IP9 J;  1Z77 A;  2CFX A;  4FET A;  3S8P A;  5D4R A;  1MH3 A;  1AOY A;  1FOY A;  3OIO A;  2KZV A;  2IA2 A;  3D5S C;  3IRQ A;  4UUS B;  2KL4 A;  4GFK A;  3EUK L;  1WFX A;  4IRV A;  4CGR A;  2ZJ2 A;  1UZC A;  5F04 A;  1TWA J;  1DGR M;  1D5Y A;  4UVC A;  1ZQ3 P;  3W2W A;  1G2H A;  4LB5 A;  3ZN1 A;  2CSO A;  2TCT A;  2IA1 A;  3H9G A;  4L9T A;  2JUG A;  2YVH A;  3OYF A;  3BJO A;  3FM3 A;  1R1V A;  3JAM Z;  3HTJ A;  2E34 A;  5B1B H;  4W1U A;  2UXU A;  1T08 B;  1XGO A;  2ZXJ A;  1OYY A;  1YO5 C;  2NS7 A;  4ZDP A;  3RDI A;  4PCQ A;  1FP1 D;  2RNJ A;  3LSI A;  2VQC A;  3MWM A;  1S9H A;  1BR2 A;  2C6Y A;  3GTM J;  1UHW A;  2R7U A;  2EH3 A;  3RSN A;  3DQV C;  2UXN A;  3FMQ A;  3VOD A;  4XID A;  4M3B A;  2ZME B;  1XMX A;  3FDY A;  4UUS A;  2ZXI A;  3CMY A;  1QA6 A;  3HRM A;  1DUX C;  1BW6 A;  4IHT A;  2H94 A;  5DUK A;  2AHQ A;  1QRY A;  1BC7 C;  4UNO A;  3M07 A;  2DAO A;  3KYD B;  4HZF A;  3IC7 A;  2XPV A;  2YX7 A;  2DA5 A;  4NBQ A;  1IUF A;  3UNG C;  2V4J C;  5DDG A;  1VQ4 I;  2H27 A;  5HS9 A;  1JKQ C;  3DP7 A;  3S1R J;  2JQ7 A;  5D6F A;  3K1P A;  4LLG F;  3HSE A;  1IW7 F;  4B3A A;  3IL2 A;  4HV6 A;  2K9Q A;  1O3Q A;  4WXD A;  3BJ6 A;  3S17 J;  4JX4 A;  1YX3 A;  2XB5 A;  2A61 A;  1I1S A;  4AVZ A;  1KZH A;  4GYG A;  3GO5 A;  3FXK A;  1T98 A;  2IU5 A;  1SD5 A;  4H0E A;  3CUO A;  5FJ8 J;  4QSH A;  2F48 A;  3BZ6 A;  2LTP A;  3LSH A;  5FRO A;  3F6V A;  4DBQ A;  2YR2 A;  2ZJP F;  4YFK F;  1KU3 A;  3OMY A;  1A6I A;  1I1G A;  3CP2 A;  3GME A;  3OL4 A;  1IV6 A;  3K4K A;  3I58 A;  3HTS B;  4E6K G;  3LHQ A;  1E0E A;  3OY9 A;  5J8C A;  5CVU A;  1DPU A;  2G7S A;  4ESB A;  2STT A;  3ZPL A;  2FA5 A;  1VQP I;  3F8B A;  2CUJ A;  3SDG A;  2Z3Y A;  3RD3 A;  5JHF A;  3M4O J;  3BWG A;  1O3S A;  4FT8 A;  4UV8 A;  3ANG A;  3V7S A;  1U8R A;  1S72 I;  2WV0 A;  1TW2 A;  4EQQ A;  3H3Z A;  3HUG B;  5FD6 A;  4OMY A;  1X2M A;  3H36 A;  1BN5 A;  1FTT A;  4RGX A;  1SAN A;  3KP4 A;  3FKI J;  2NOJ B;  3ONQ A;  3PM1 A;  1L0O C;  3QQA A;  2M2E A;  4RM3 A;  4XRF A;  4Y7N J;  1N78 A;  1U9O A;  4DYR A;  3BZC A;  1TWG J;  4L5E A;  3HM5 A;  3KET A;  1EH8 A;  2CGP A;  5HOD A;  4A3L J;  1R58 A;  3VOX A;  5E20 A;  2LDU A;  2VKE A;  4G6T B;  4YIF A;  5C3E J;  1H8A C;  1F5T A;  4RDU A;  2IS2 A;  5DD4 A;  2VQL A;  2D1V A;  1MNM C;  1UEL B;  2KT0 A;  1FSE A;  3KEY A;  2D1H A;  1UST A;  1DU0 A;  4IHS A;  2XAS A;  1MMA A;  3G7R A;  1BOB A;  1PP8 F;  1FIP A;  2KKO A;  4HX8 A;  1LKX A;  4MHG A;  4BEH B;  4M3F A;  3ZRG A;  1IF1 A;  4B4C A;  3HUG A;  2QKO A;  3LWJ A;  2XKO A;  1MBH A;  4A0X A;  2BW3 B;  2B7E A;  4AIJ A;  2ESN A;  2A05 A;  2JA6 J;  5IT9 Z;  1EH7 A;  2F5C A;  4AC0 A;  1B59 A;  1QU3 A;  5D8K B;  4A12 A;  3T0Y A;  1FT9 A;  3FM5 A;  3HBL A;  3FXM A;  2VQH A;  4XNF A;  3DWL E;  2DG7 A;  2D5V A;  2RV8 A;  1YIJ I;  1XS9 A;  2ETH A;  3LWF A;  1ZEL A;  1XGS A;  1ZHF A;  2X6Y A;  3O6B B;  3M3Y J;  4V2G A;  2K5C A;  3S2W A;  2D6Y A;  2YU3 A;  3FXR A;  2OBP A;  3CCM I;  4ZH4 F;  4DYQ A;  3OYD A;  1QHH D;  2BE5 F;  1RPW A;  4AD9 A;  2Y48 A;  4CCJ A;  2Q2E A;  4CO8 A;  3PQJ A;  4IXA A;  4RGR A;  4R79 A;  4II3 A;  1Y0U A;  4BEH A;  3E7Q A;  1S7O A;  2BW3 A;  2F5E A;  3GBG A;  1LDK B;  1LUJ B;  1YW9 A;  4EGZ A;  3HRU A;  5AIQ A;  3DLA A;  4RAG A;  5LBQ A;  1RRJ A;  1FYL A;  4UXN A;  3JRE A;  2A2F X;  2Z33 A;  2GXG A;  5DEQ A;  3G3Z A;  4RB2 C;  3WTZ A;  2O03 A;  2HNH A;  4NC7 A;  4C3H J;  1OQY A;  2K4B A;  1R00 A;  2O5R A;  3L1P A;  1ON2 A;  3M1C A;  2R7W A;  2GIV A;  5D5U B;  3CCV I;  2LF8 A;  4LD5 A;  4UB6 C;  1BI3 A;  1FNN A;  4B44 A;  1HA8 A;  3V6G A;  3LOC A;  1UAA A;  1I6H J;  4ITV A;  5D5V B;  3CCU I;  2YUS A;  3V7C A;  1ZRD A;  2MH2 A;  2HOT A;  2L7M P;  2MLK A;  4WWC A;  5IY5 H;  3GLX A;  2OV7 A;  2TDX A;  5C4J J;  2NVT J;  1ZG5 A;  4DW6 A;  3S3N A;  3MAJ A;  2A6E F;  4ZYE A;  1Z67 A;  1WJC A;  2H1L A;  2PN6 A;  3AFH A;  3PFY A;  4RB3 C;  2LD5 A;  1JKP C;  1JKO C;  1XCB A;  2IS1 A;  2MH9 A;  3BPV A;  2CQQ A;  1UHM A;  4B1R A;  3R0A A;  3CCL I;  2ME0 A;  2RRE A;  5F0H A;  3DBR B;  2W82 A;  5FMP A;  2BXY A;  1DP7 P;  3H5N A;  4LLN A;  5A2Q Z;  3G2B A;  1BJA A;  4QWQ A;  5BNG A;  4J19 A;  1F43 A;  3F8C A;  4EM0 B;  1IRX A;  4PJM A;  3OS2 A;  3ERM A;  3S1M J;  4U9L A;  2IGN A;  2LSO A;  3RPQ A;  5KHD A;  5D18 A;  4JYK A;  1X4O A;  5M5Y J;  4DQ2 A;  2ZME C;  3VDX A;  3WGH A;  1YG2 A;  4IOA F;  5H6R A;  2MC4 A;  3WTY C;  3RZD J;  5HOO A;  3ABM H;  5J4V A;  3BQZ A;  4EJT A;  1LVK A;  3HOS A;  5B3S H;  2Q1Z B;  3PO3 J;  4KJZ A;  2PFV A;  2VXD A;  1IXS B;  1RET A;  2V9V A;  2V57 A;  2VBZ A;  4N4O B;  4W97 A;  3OOP A;  1XMA A;  1JHF A;  2IP2 A;  3M8J A;  3F22 A;  4UUT A;  3V78 A;  1W1W E;  3S3M A;  3R60 A;  3BR1 A;  4U0Y A;  3I59 B;  3JW4 A;  2NNN A;  2STW A;  4QTR A;  5DUI A;  3HL2 A;  3HRT A;  2V1N A;  3L2R A;  2TRT A;  3V42 A;  1G3W A;  1B72 B;  2EIL H;  2ZCN A;  4MO7 A;  4GCV A;  3TMO A;  3V8J A;  1SVL A;  2CW7 A;  4AU7 A;  2R7V A;  5AQC A;  2R3S A;  4IOC F;  3K4C A;  5L3B A;  2VBX A;  5M3F J;  2XIG A;  1J7K A;  5J3L A;  2VE8 A;  2IVM A;  2KJC A;  3J7Y J;  4D1Q A;  3TBI A;  2GLO A;  3CC4 I;  2KQR A;  1OCR H;  2XAJ A;  3ASN H;  2DXI A;  3CES A;  4AIK A;  2VC1 A;  2YVE A;  1WJF A;  3DU5 A;  3RKX A;  3JRD A;  1LQ1 A;  3R4K A;  3CC7 I;  1MSE C;  4KMF A;  4XOP A;  1CF7 B;  4TV7 A;  3I59 A;  5EEH A;  1MJA A;  2CG4 A;  2R7R A;  3ZQH A;  3JAM K;  1BA5 A;  4RB0 A;  1STZ A;  5L3C A;  1B72 A;  2V1U A;  3C2H A;  2HKU A;  4HDV A;  5J1R A;  3KKC A;  1MBF A;  5CKT A;  3BZK A;  4A3J J;  2Q0O A;  2QGU A;  3NRV A;  5J6X A;  3K9T A;  1JJ8 C;  2PJR B;  1B9M A;  3V7R A;  3PL8 A;  1UMQ A;  3M8F A;  1UG0 A;  2NYX A;  3GZN B;  3SEZ A;  1Z3X A;  3RKY A;  4OD4 A;  1X2N A;  2Y9Z A;  3G6E I;  1GXP A;  1CF7 A;  2QZ8 A;  3Q9S A;  4ZZD A;  2L01 A;  3QP6 A;  2EZH A;  2RAS A;  2OJE D;  5H20 A;  2Z99 A;  1Y6I A;  2ZFU A;  4CDG A;  1X19 A;  3LJL A;  4XLH A;  1VQL I;  3WG9 A;  3PIP F;  2DFH A;  3DPL C;  4PGH A;  4KMU X;  4JKZ A;  2KMU A;  4XLC A;  3T1B A;  2QSF X;  3BG3 A;  1UB9 A;  3I54 A;  2JVG A;  5DD8 A;  4NC6 A;  3AG1 H;  3GEZ A;  4RA2 A;  5EEG A;  3KLN A;  2QEN A;  5J47 A;  4BE2 A;  3K6G A;  4NQW B;  1Z05 A;  1R22 A;  1R23 A;  2PJR A;  5HAW A;  2A68 F;  3HEF A;  5DM7 F;  5DCM A;  2P5K A;  2M0M A;  1X1P A;  3BHQ A;  4X6A J;  4EM2 A;  1TBX A;  3ZQG A;  1P4W A;  3PNT A;  4KIB A;  4X0G A;  3IP4 B;  3BG9 A;  2H6C A;  3F9K A;  1K4T A;  1MND A;  3GTO J;  4B43 A;  2V6E A;  2MFZ A;  1Y1W J;  4IEJ A;  4BHC A;  2H09 A;  3GFJ A;  4D5F A;  3HOX J;  3G73 A;  1K4S A;  5D1R A;  2HPI A;  1TL8 A;  2ZBK A;  1RR8 C;  2X0L A;  2ZFW A;  4A5N A;  4Q5S F;  1ZTR A;  4ZDO A;  1S7E A;  2IGO A;  2EZL A;  4HKU A;  4NQW A;  5JLX A;  1HOM A;  1W7P D;  2P81 A;  2DOD A;  1AWC A;  1ZG3 A;  2JTV A;  1OFC X;  3L7W A;  3COL A;  3U21 A;  4KIS A;  1VND A;  3HTA A;  2QQ8 A;  2ZJR F;  4IHW A;  4M6Y A;  1IAW A;  4NDL A;  1JGG A;  2K40 A;  3J7A Y;  4JNN A;  3OS0 A;  1ENH A;  3E6B A;  5F08 A;  5IOZ A;  4CIC A;  3VW1 A;  3A4C A;  2CV1 A;  2P5L C;  1GLN A;  2P7C B;  1OYW A;  4XLF A;  4GFB A;  4XKC A;  1D0X A;  1F1Z A;  2DMQ A;  2DG8 A;  3K0L A;  3KIO A;  4V2F A;  5B66 C;  1X1D A;  1Z21 A;  4I7H A;  2R92 J;  3CC2 I;  5L3D A;  3EPZ A;  2VKH A;  5FGM A;  3JRA A;  4ENM A;  2QWT A;  2OU2 A;  3Q0U A;  2DA2 A;  3ZQC A;  2KFD A;  4M72 A;  2GUH A;  1MMS A;  3VOE A;  2RC4 A;  4B3X A;  2R7F A;  3OYM A;  3JCU C;  3LA2 A;  3PAS A;  3DEE A;  2FMY A;  2MD0 A;  1VQK I;  3O8G A;  4AIH A;  2A5W A;  2CQK A;  1T6S A;  1B6A A;  2QLZ A;  3NWT A;  2HS5 A;  1K61 A;  5IT9 K;  2DTZ A;  2VC0 A;  3AQT A;  1EA3 A;  3KX2 A;  4BXF A;  6PAX A;  1IN8 A;  1OCZ H;  3FWE A;  2MYS A;  2AXL A;  5IP6 A;  3OOU A;  2DA7 A;  1BI1 A;  1IDY A;  3OR1 C;  3I56 I;  3N97 A;  2V9P A;  2CQX A;  2OI8 A;  1V4R A;  5LEK A;  3BTI A;  3BJA A;  1X3Z B;  1IG7 A;  2EIM H;  3TKY A;  3HHG A;  2DDB A;  3HPG A;  2EV5 A;  3BDD A;  4C2M A;  3QOP A;  4XMY A;  1WCM J;  2LR8 A;  3CCQ I;  2HTS A;  1FTZ A;  3C18 A;  1MMD A;  4LG3 A;  1I3A A;  4D9J A;  3MZY A;  2HOE A;  1HST A;  1YLF A;  1SFK A;  1U6G A;  1ZGJ A;  3A1Y A;  1QZE A;  3FZV A;  4XR6 A;  1W4M A;  4RAY A;  2KRC A;  3V8L A;  1OCO H;  5M3M J;  4P1W A;  1MBK A;  2Z2S B;  4Y33 A;  4QPQ A;  3VSK A;  5E3O A;  1K7A A;  4BU2 A;  2L7F P;  3LMM A;  3QAH A;  2QUF A;  5J40 A;  2W1O A;  4RS8 A;  4F7Z A;  2HYG D;  3FBN B;  1KQ9 A;  4O6J A;  2QQ9 A;  3JRG A;  1RR7 A;  1SD6 A;  5D6E A;  3JRI A;  1HF0 A;  3LQR A;  3BR5 A;  3SWH A;  3JRC A;  3MKY B;  3VVX A;  4EJV A;  1A35 A;  1LEB A;  1D0Z A;  1BW5 A;  2P5V A;  4XBF A;  5E1Z B;  3H3U A;  2G7L A;  4DZP A;  4DBR A;  2KPM A;  2E1C A;  4IHY A;  4XIC A;  2FQ4 A;  2DA4 A;  2JN6 A;  2EV6 A;  2JWT A;  2WB1 A;  3BR6 A;  2LF7 A;  3NS4 A;  4I98 B;  5EJC A;  1ZG1 A;  3ZQQ A;  1V5E A;  2V1X A;  2KRH A;  3VWB A;  3BCB A;  2Y0S N;  5L3G A;  5A2Q K;  3TW6 A;  3E0J B;  3HKZ N;  1G8X A;  4ICH A;  4IHV A;  1AA7 A;  3TOB A;  1CGP A;  4MLO A;  3MKL A;  1FBQ A;  2X85 A;  2DLL A;  3JSO A;  3VIB A;  1I39 A;  5ICC A;  4U87 A;  2ZO4 A;  3CCS I;  3R0J A;  3JRB A;  4FTH A;  3BT9 A;  3F8M A;  2FSW A;  5E1X A;  3J81 Z;  4U7B A;  4M6V A;  4C30 A;  1J09 A;  5E17 F;  2UZK A;  2VJJ A;  4KUM A;  4BBR J;  3WTW C;  3BRO A;  1E3H A;  2FD5 A;  4UY8 I;  4L9V A;  1BBY A;  3BG5 A;  1QZZ A;  4EM1 A;  5EF6 A;  2ZOY A;  3FMR A;  2JPB A;  1YI2 I;  2FE3 A;  3AKZ A;  1ETO A;  3J80 Z;  1KQ0 A;  5AON A;  2CH0 A;  5FRN A;  2QBY A;  2RHA A;  2HU9 A;  4ZZL A;  3I55 I;  1ZKG A;  2HZT A;  3CDL A;  2HKO A;  5K5Q A;  2BY3 A;  1HDD C;  5CVJ A;  4BXU A;  1BIB A;  2PMZ A;  2DOE A;  3W3C A;  2DA1 A;  2VUM J;  4A0Y A;  1FC3 A;  4GXO A;  1ODD A;  1GHC A;  3HXL A;  4HF1 A;  1NG7 A;  2QIB A;  5CW8 A;  3CDH A;  4Q47 A;  2PLY A;  1R36 A;  2KP6 A;  1SD4 A;  3W6J B;  5FKL A;  3C3W A;  4JK1 X;  5LD2 C;  2O8K A;  4A3E J;  3PIO F;  5H6Q A;  2CO5 A;  4G7O F;  2WWY A;  4LIT A;  4G8X A;  4MNU A;  1TLH B;  4WX9 A;  5JVT A;  3R61 A;  2KIM A;  1T39 A;  1G59 A;  4AM3 A;  1J2X A;  1Z0X A;  5K5R A;  1G3T A;  2FXA A;  2Y2Z A;  3K69 A;  1XSD A;  1DDN A;  3KNW A;  3QPT A;  1YTY A;  2F4I A;  4WCG A;  2UXH A;  3GZ5 A;  3U2R A;  4HG2 A;  5JHU A;  3LQQ A;  4BHP A;  3BY6 A;  5J1Y A;  2FOW A;  3K1N A;  3QP5 A;  2X1D A;  3CJT B;  5HLT A;  4IRI A;  5E3N A;  3TP0 A;  2CYY A;  2ZNZ A;  3KYL A;  2ZY9 A;  2VOP A;  4F92 B;  5FLX Z;  2MSY A;  2OQG A;  3CDI A;  4G6Q A;  3ZGK A;  1S5L C;  4BY1 J;  3LST A;  4M9X A;  5FO5 A;  2H8R A;  3DTE A;  3WOD F;  5LHI A;  4M3G A;  3ON2 A;  4DIQ A;  4E7Z A;  4PZJ A;  2ISZ A;  1UI6 A;  1BC8 C;  2BYV E;  3HGG A;  1I50 J;  4RAF A;  3DLL F;  1TT5 B;  2XRL A;  1IXR C;  3QKX A;  3O3K A;  1FOK A;  2R93 J;  4XN0 A;  3EGQ A;  2DQL A;  2EA4 A;  3LSJ A;  1OLT A;  4N9H A;  4AYB A;  2RAE A;  4A2U A;  2N8G A;  2IPQ X;  5IYC J;  1V55 H;  5TGT A;  2HTJ A;  1MSF C;  4HNV A;  5E1W A;  1F9N A;  1MMG A;  3NEU A;  3GFM A;  3CCR I;  4QLC U;  2W53 A;  2KDO A;  2YPR A;  1D8J A;  4AWX B;  1MH4 A;  2MA3 A;  1SVO A;  3GZI A;  4I02 A;  4BHB A;  5HS8 A;  1G6N A;  5LLQ A;  4ZYG A;  1KGS A;  4H4K C;  4LK0 F;  3HTH A;  3HRS A;  2D45 A;  2E1O A;  2KIU A;  1N25 A;  3DXJ F;  2F5D A;  4HSR A;  4CYC A;  3L2V A;  3PNY A;  3G4S I;  2R5Z B;  2L5Q A;  4MTD A;  2XAH A;  1EH6 A;  1WPK A;  4B48 A;  2IA0 A;  3ZMV A;  2IGK A;  1ZYR F;  1MD0 A;  3KKD A;  3OYJ A;  3GTJ J;  5JR3 A;  3I71 A;  3CWR A;  3HC7 A;  2XPW A;  4QIW N;  2R5Y B;  4A3K J;  2O61 A;  4GCK A;  3IWZ A;  3GTG J;  4Y3O A;  4B8X A;  1VI0 A;  4G7Z F;  2KRF A;  5J1U A;  3RKW A;  1F36 A;  4XLP F;  1YOV B;  2FEZ A;  2FBK A;  4M73 A;  3MEX A;  3DFG A;  5ICG A;  4FX4 A;  4NHJ A;  2X9D A;  2VPL A;  1REP C;  2HVS A;  2XKP A;  3OYI A;  4XRM A;  5ICF A;  4S05 A;  1K6O A;  2BY2 A;  3PUB A;  4BNC A;  3K4B A;  4GGG A;  3PSI A;  2L4A A;  3FXL A;  5GPA A;  4D0P A;  3RQI A;  2R5Z A;  2LBF A;  2OER A;  2A5Y B;  4M3D A;  1PUE E;  1FEX A;  2KLO A;  3M1E A;  3BTC A;  3BLY A;  3KE2 A;  3H9J A;  4I76 A;  3AL0 B;  1ERD A;  2RKH A;  4EGY A;  1EF4 A;  1WJD A;  4RBO A;  1U5T B;  3DV8 A;  5CPR B;  4GO1 A;  2R5Y A;  3MZ8 A;  1NH3 A;  2Q2E B;  1HSJ A;  2LY2 A;  3Q5F A;  2F5V A;  1JUM A;  2KDZ A;  3COA C;  3I53 A;  4KYW A;  3H1C A;  2ACJ A;  4AID A;  1HLV A;  3KP6 A;  4B09 A;  1I5Z A;  9ANT A;  1ON1 A;  2VXZ A;  3BR3 A;  5DTD A;  4JX5 A;  4MQ9 F;  2R7Z J;  3CCJ I;  2R7X A;  1W5C C;  4HNT A;  2UWM A;  2PEX A;  2MGQ A;  1R5G A;  2MD5 A;  4BJ5 C;  3GFI A;  4BDY A;  2XF7 A;  4DNC A;  3HJE A;  4XN3 A;  2HDC A;  5IP7 J;  2I8D A;  4DYC A;  1YRN B;  2HFH A;  2E19 A;  1L3L A;  1U5T A;  2PJP A;  5KVR A;  3G56 A;  3KP7 A;  4NEL A;  2EA2 A;  2JJ7 A;  4BJ6 C;  4I0B A;  2R7S A;  5ERI A;  2CJJ A;  3U1K A;  1SAU A;  2VB6 A;  2ZNY A;  4OAZ A;  3PO2 J;  3VVZ A;  4ETS A;  2W57 A;  3ISP A;  3AG3 H;  1JTX A;  2M7B A;  2XB0 X;  1XMK A;  3CUQ B;  5F0F A;  3MKZ A;  5ILS A;  1LPQ A;  4DGW B;  4GFL A;  4PXI A;  2COM A;  4XQF A;  1WZ2 A;  4A3F J;  1MJB A;  2DJN A;  3A0B C;  1GV5 A;  4FX0 A;  4LLL A;  1ZRC A;  2DMN A;  2O7T A;  3PNV A;  4IF4 A;  4IO9 F;  2H1K A;  1HW5 A;  5IT3 A;  3K1M A;  4OIO F;  3ZR8 X;  1YRN A;  1TT0 A;  3ZQL A;  1NK2 P;  3GTL J;  2IEK A;  1WJA A;  4G94 A;  2GA1 A;  4MTE A;  2XRN A;  2ZJQ F;  5FRM A;  3C1D A;  3QPS A;  3DPJ A;  3IV5 A;  5JVG F;  2G7H A;  5J8F A;  3GZ6 A;  4BAC A;  2EFW A;  1H89 C;  5BS6 A;  3M9A A;  1X58 A;  2W7N A;  3DTI A;  2VL8 A;  1T2K A;  4S04 A;  2FRH A;  3ZMD A;  4CH7 A;  4OIN F;  2E7W A;  3CUQ A;  4YFN F;  4A93 J;  1D1C A;  3PJR A;  3OYH A;  5TIS C;  1JUS A;  1SGM A;  3CMM A;  3WHC A;  4OIP F;  4KWA A;  1P7I A;  4KN7 X;  1IRG A;  3OS1 A;  3HPH A;  4M3E A;  1DGW Y;  5HNF A;  2NVU B;  2X48 A;  1FYM A;  3VVY A;  4UV9 A;  3OYA A;  3E5X A;  3DKW A;  4F3Q A;  3CO6 C;  4PDK A;  2O6G E;  2R7T A;  5FFZ A;  3QPL A;  4HX4 A;  3F8N A;  2DT7 B;  2HYJ A;  4X1E A;  5B1A H;  1FBS A;  2E5N A;  1LDD A;  1SFO J;  5J4Y A;  5FFX A;  2V7F A;  3LA7 A;  2REK A;  4PFO A;  4OMZ A;  2VI6 A;  4M71 A;  1ORK A;  2HPM A;  2A69 F;  1TWF J;  1U0J A;  2Z16 A;  4NN1 A;  4XKV A;  3DBL B;  3E6D A;  3H35 A;  2EIK H;  2HR3 A;  1HXD A;  1WRJ A;  2IW5 A;  3TDU C;  1T56 A;  2VBW A;  4UB8 C;  3BR2 A;  2K7L A;  2L7Z A;  4YIR X;  4L18 B;  3IH4 A;  3GW2 A;  3OR2 C;  2GZW A;  3GCM A;  2K9N A;  1FX7 A;  2VJ4 A;  1BOA A;  3EQL F;  1DU6 A;  4LIU A;  3OYB A;  1J5Y A;  4D7N A;  5K7F A;  1A5J A;  3TOA A;  1SFX A;  5F6F A;  5IOY A;  4AC6 A;  3J81 K;  2FOK A;  1J75 A;  2YS9 A;  2DDA A;  3RYR A;  2BHY A;  2XAG A;  5CVR A;  2Y31 A;  4A3D J;  4BAY A;  1LJ9 A;  2L3D A;  2F6C A;  2WY8 Q;  3HTI A;  2GOM A;  4FHT A;  4M9Z A;  4XLA A;  1IC8 A;  2O3F A;  2XGE A;  3EUH A;  4M74 A;  3HG9 A;  1ONV A;  2OPT A;  3Q9V A;  1O3R A;  1LVA A;  3OYK A;  3KYC B;  2LKP A;  3J80 K;  1HC8 A;  2QWW A;  4MXM A;  3X2Q H;  3RJP A;  3CJQ B;  2PZ9 A;  1U9N A;  3SFI A;  3Q3S A;  5TRD A;  1V3F A;  1YYV A;  3RI4 A;  1YS7 A;  2M5W A;  2QYO A;  4JL3 A;  1Y8R B;  2DTR A;  4L5I A;  1S8N A;  3P9C A;  4HYE A;  2MG4 A;  2R0Q C;  2ZKZ A;  1PJR A;  3OYE A;  3ZMS A;  3GYH X;  1FMV A;  1ZH5 A;  2FBH A;  2JZY A;  4IL6 C;  3F1B A;  2V9K A;  5HDG A;  3GUD A;  2LH9 A;  3HOZ J;  3WU0 A;  4ENJ A;  3SFZ A;  5DV5 A;  2Q24 A;  3UKG A;  4HQM A;  1OKR A;  4XSX F;  2G7U A;  2X51 A;  2NOG A;  3LAJ A;  3KZZ A;  1UFM A;  2OTL I;  2P4W A;  1FYK A;  2M45 A;  2K86 A;  2MBF A;  1Q1V A;  1ZK8 A;  3S2D J;  3P9T A;  3TO9 A;  3F21 A;  3ELK A;  1ZR2 A;  1IN7 A;  4EV0 A;  2F4O B;  2GBY A;  5KAF C;  3E6C C;  3FIS A;  2DPU A;  2ID3 A;  5DCF A;  1WVR A;  5ILV A;  1IN5 A;  1X1C A;  2Y69 H;  1HKS A;  4IKF A;  2MLG A;  1TP4 A;  2KJB A;  5JI6 A;  1R5H A;  5DCM B;  2HYT A;  3FKJ A;  4ON0 A;  4F55 A;  2B0L A;  4EAT A;  5L3F A;  5EZG A;  3L2W A;  3AL0 C;  1IGN A;  4HW0 A;  5FLX K;  4NNJ A;  2ZSI B;  2XSJ C;  1TWC J;  2RDP A;  1Z6R A;  1RUO A;  3WTS C;  1U5T C;  4O3M A;  2D2W A;  1R7J A;  1ETX A;  1Y1V J;  1P4X A;  4I2O A;  1LFP A;  1SFE A;  1AHD P;  3HDD A;  1K79 A;  2G7G A;  3ML6 A;  4PFP A;  1ZLK A;  4R8H A;  3OV8 A;  1BI0 A;  1OR7 A;  3DU6 A;  5E18 F;  3BCG A;  1AKH B;  2G3B A;  3VFZ A;  2EFN A;  3SXY A;  1TQI A;  2QOP A;  4C3J J;  2DCE A;  1GDT A;  2WAQ N;  1ZRF A;  4HDU A;  2PX9 A;  4EMS A;  3JRF A;  4E7H A;  3ZN0 A;  2W85 A;  2AS5 F;  2ZC2 A;  3N05 A;  3QU3 A;  1ULY A;  1I27 A;  5CVV A;  3F72 A;  4NC8 A;  2LRE A;  3HOW J;  2BY0 A;  5GAE J;  2EK5 A;  2WAD A;  3DPT A;  5E3M A;  2FML A;  4HV5 A;  1MJ9 A;  3K4N A;  3KEQ A;  4GRI A;  1Z7U A;  3GLL A;  3WG7 H;  4KIT B;  2LKS A;  2XUB A;  3W6V A;  4V19 K;  2P6S A;  3IRR A;  3CUQ C;  4N4N B;  2QSG X;  2QA4 I;  2GA2 A;  2GQQ A;  2VJ5 A;  3MCZ A;  4IRH A;  5D5X B;  3CF5 F;  2OQR A;  1AKH A;  2M34 A;  4ENN A;  3W2V A;  2HVR A;  2M4K A;  4UDS A;  1WSU A;  3BQY A;  1FZP B;  1W5S A;  3TW7 A;  2ELK A;  3HSF A;  2OZU A;  5FKM A;  2MAB A;  4BXX J;  1WI3 A;  3KP5 A;  4E7L A;  3NI7 A;  4RAZ A;  2IGM A;  4GCL A;  1MBJ A;  5F27 A;  3QBM A;  1HKQ A;  4F91 B;  3B73 A;  1MMN A;  4FIS A;  2E2I J;  4Y17 A;  5EGO A;  1MDM B;  2HOS A;  3ANP A;  4CYD A;  1RKT A;  2LNB A;  3O60 A;  5LGT A;  4ZYH A;  3L00 A;  3VEP A;  1VQ8 I;  3BR0 A;  4KN4 X;  4XKW A;  3FXU A;  2NS0 A;  3DEW A;  5GAD J;  1U3E M;  3S16 J;  1TW3 A;  3WTV C;  4CCO A;  4Y4R A;  4QPO A;  5E8I A;  3KP3 A;  3NQO A;  1WH5 A;  2CWE A;  4CCM A;  3HOU J;  1NTC A;  2E60 A;  5ICE A;  2IJL A;  2G9W A;  3BTL A;  3L9F A;  1O57 A;  3ABU A;  2CUF A;  1PDN C;  1XGM A;  2K9S A;  1AU7 A;  1PUF A;  2HVQ A;  4KIG A;  2BV6 A;  1PP7 U;  3D5R C;  3P5J A;  1YW8 A;  3ZQI A;  2DQR A;  1ZAO A;  4MIM A;  4F93 B;  1GV2 A;  1B8I A;  2XAU A;  3FXQ A;  1VQ6 I;  3FF5 A;  1MDM A;  2XHK A;  4FE7 A;  2BGC A;  4HX7 A;  5KAI C;  1SVM A;  1P6R A;  1JHH A;  3SDB A;  1USS A;  2CUE A;  2L54 A;  1Z3Y A;  1M1E B;  4IVN A;  2HQ5 A;  2K9M A;  4U7D A;  4IJA A;  2UXO A;  3JSJ A;  1N75 A;  5HDK A;  2E1N A;  4RGU A;  4HPQ A;  1X1B A;  2HDW A;  4YRV A;  3KFW X;  4BQN A;  1XG1 A;  4IPA A;  2XAF A;  2L9S A;  4FE4 A;  4HEA 2;  5D8L B;  4XON A;  1RNL A;  1Y56 A;  3KCC A;  4J00 A;  2K3F A;  1YJN I;  2JA8 J;  1IZ1 A;  4DZJ A;  2DOA A;  4E4H A;  2PBI A;  1WJ5 A;  3WU2 C;  1JT6 A;  2NS8 A;  3CTA A;  3EET A;  1J59 A;  4YZE A;  1TNT A;  4MGR A;  5B5E C;  3CD6 I;  4BE1 A;  3MMY B;  1YJ9 I;  1Z91 A;  2DK5 A;  3DCF A;  2ZCX A;  1MW7 A;  1MGT A;  2IT0 A;  1P2F A;  4DOZ A;  3RQ4 A;  1QQI A;  3GTP J;  1D1B A;  3SEQ A;  2PG4 A;  2DYR H;  2A3S A;  2Y9Y A;  1D3Y A;  2CW8 A;  1QNT A;  2O8X A;  5D4S A;  2BY1 A;  2QQB A;  1NG6 A;  1OMI A;  4YFX F;  2L0K A;  2F5F A;  3D0S A;  2LY1 A;  4XM3 A;  5CQE A;  3V8K A;  4U0V A;  4JQF A;  4BGD A;  4R1H A;  4XK4 A;  2CW0 F;  3K70 C;  2FBQ A;  5LGU A;  2EZI A;  5BPD A;  2L9V A;  1YIT I;  4LOC A;  4YEL A;  4L5J A;  4KNY A;  2AO9 A;  5FKN A;  4Y13 A;  1J0R A;  1W36 D;  2DA6 A;  1IRZ A;  2KIQ A;  1IO2 A;  4AVP A;  2NVY J;  5FB2 A;  5EFY A;  1EV7 A;  1MKM A;  1RZ4 A;  4K2E A;  2OTJ I;  4P9U A;  4UVB A;  1S3J A;  3BG6 A;  1Q1H A;  5HSZ A;  4OWR B;  3TL4 X;  3AAF A;  2IAI A;  2M4G A;  4PJL A;  4CCK A;  2PBX A;  1FOX A;  3RYP A;  2ZSH B;  3WU1 B;  3TDZ C;  4PK4 A;  1KU7 A;  1BR4 A;  2XGC A;  5KNL A;  2XDV A;  2WV1 A;  2QBY B;  2L2O A;  1DPR A;  4CZC A;  4ENK A;  1Y8Q B;  2VT3 A;  1LFU P;  3GTK J;  2ECB A;  3G1O A;  1W36 C;  2LYC A;  2LY9 A;  3L2C A;  3IAM 2;  2DPD A;  3RZO J;  1SMY F;  1ZN2 A;  3B02 A;  2JRT A;  2WAF A;  4FAS D;  3L2U A;  3A0H C;  2OZ6 A;  2JMW A;  3D5L A;  1ZAR A;  1OPC A;  5GAH J;  2ELH A;  3OYN A;  1O7L A;  3KZI C;  2FF4 A;  1ZRE A;  2DBB A;  3CZ6 A;  3H3V K;  1LNW A;  3K4M A;  3ABL H;  2B3W A;  2JUC A;  4XOT A;  4PJN A;  4IZZ A;  3ZP5 A;  1JXS A;  4DVY P;  2B9S A;  4Y52 J;  4LMY A;  4ESJ A;  4PSW A;  3HTU A;  3LSR A;  1FPQ A;  2VBY A;  3S2H J;  2VJI A;  4HOB A;  2M3A A;  2COB A;  2GXB A;  3CF2 A;  3OIP A;  1X3U A;  5HBU A;  1K78 B;  2LMD A;  5GPC A;  2QF7 A;  4OAY A;  2BBY A;  4N0B A;  3ERE D;  1Y0N A;  4A3G J;  1OYI A;  1A36 A;  1RKW A;  2HYF A;  3WTT C;  1TC3 C;  5BPI A;  4D7M A;  2LLK A;  2VIX A;  4ZDL A;  4BQO A;  4RB1 A;  3BNI A;  2CV2 A;  2JVH A;  3IKT A;  1YFH A;  3A02 A;  4ABZ A;  4CXF A;  3VYU B;  1W5T A;  3ABT A;  3FHN A;  4E70 A;  3ABK H;  3GEU A;  3I64 A;  1QHG A;  3G1L A;  3VP5 A;  2Y0M A;  3C2G A;  5EG0 B;  1K78 A;  4ZYD A;  1YW7 A;  5EZH A;  1P9Q C;  3HOV J;  3ASO H;  5BOX A;  3H5A A;  2BOL A;  1EJ9 A;  2DI3 A;  2FX0 A;  1YQA A;  1R4M B;  1WJE A;  1X4P A;  3LFK A;  4G7H F;  1WJB A;  1VF9 A;  4C2T A;  3VW2 A;  2DT5 A;  3VTI A;  3BOQ A;  2HQR A;  3P9I A;  3WE2 A;  1WI9 A;  1KA8 A;  3E5U A;  3K2Z A;  4B47 A;  1GVJ A;  3TED A;  3R6S A;  4UVA A;  1GXQ A;  3W2A A;  3DF8 A;  4J01 A;  1TQM A;  1H88 C;  5CLS A;  5FKO A;  2QKL B;  2DW4 A;  2CRG A;  3KLO A;  2E36 A;  1K83 J;  3ESW B;  3BJB A;  2EBI A;  4JBA A;  5C44 J;  2X6O A;  2ICW G;  4CYC B;  1XD7 A;  3LSG A;  5HLI A;  1JTY A;  3BRU A;  4ACI A;  3SQN A;  3LNQ A;  5EG0 A;  4MFE A;  2KZG A;  2Q8K A;  2DU9 A;  4YII A;  3OWT A;  1UJ8 A;  3ECH A;  1VQ5 I;  3RTR A;  2VE9 A;  1HBX G;  3TQN A;  2P8T A;  3VYT B;  4FQG A;  2MW8 A;  4MEX F;  2XPU A;  4XRS A;  3KZY A;  5LGN A;  1BL0 A;  2E1M B;  1DP3 A;  3UR3 C;  5DAJ A;  1WHU A;  2EWN A;  1YE9 A;  2EB7 A;  2X1C A;  3NWS A;  2EZK A;  2XC7 A;  4L9N A;  4F52 A;  3SZG A;  1HCR A;  2BZT A;  2Z9O A;  4C9Y A;  1I3Q J;  2LBF B;  4WXC A;  1XB4 A;  2ZME A;  4A3I J;  2P0W A;  3LSP A;  1S29 A;  1VZ0 A;  4Z2Y A;  2Z1D A;  1RUN A;  4L62 A;  1VQ7 I;  3C2B A;  1K6Y A;  1D0Y A;  3E7L A;  5C4Y A;  1MZB A;  3FRQ A;  2FNA A;  1LE8 B;  4A3M J;  3CLO A;  3HSR A;  4ZYA A;  3T6N A;  1XGN A;  1G3S A;  3DKX A;  2LKX A;  2ID6 A;  4OD5 A;  1GUU A;  2E71 A;  2M30 A;  3B81 A;  4GDF A;  1QZY A;  2R7D A;  1R71 A;  2I10 A;  3IHU A;  4LK1 F;  3ULQ B;  4CZZ A;  5DYM A;  1WKM A;  2K3P A;  4BY7 J;  4BKX A;  2GFN A;  3E6M A;  2VAS A;  2NP3 A;  4HQE A;  2VPR A;  4XKB A;  4WIB A;  4HLY A;  1IDZ A;  1TQP A;  2O7O A;  2DN0 A;  5LRS A;  5LHG A;  2ME6 A;  2ISY A;  2UXX A;  3K8P C;  4A6D A;  3NRG A;  5HLH A;  3NAR A;  1QBJ A;  2A6T A;  4YG2 F;  3I5U A;  1VQN I;  2AQF A;  1OIS A;  2PQ8 A;  2P6T A;  1LE8 A;  2XRO A;  4NUB A;  3RPU D;  3H92 A;  3T5X A;  2WAE A;  2XF6 A;  2GEN A;  5ILU A;  1IN4 A;  1R9T J;  4FCY A;  3GX4 X;  1S6L A;  3F6O A;  5GAG J;  5F1R A;  2X1E A;  2YU9 J;  1T0F A;  3FBI B;  2JRM A;  5CQG A;  1OCP A;  3HOT A;  1P92 A;  2L9N A;  3JR9 A;  1JE8 A;  2GAU A;  1JUP A;  2LVS A;  2DYS H;  3VUQ A;  2E2H J;  1Z9C A;  5HVQ C;  2QTQ A;  1XN7 A;  2JK3 A;  2DFF A;  2CS3 A;  2VQG A;  2WC2 A;  3KPH A;  1S7A A;  2Y0S A;  1KU2 A;  2KHM A;  3EUP A;  3BTJ A;  3HKZ A;  1FSH A;  2LG4 A;  1R4N B;  2A6H F;  4HRI A;  3CQZ J;  3FK6 A;  2F2E A;  2QVO A;  2OF7 A;  1OJL A;  3K10 A;  1QVT A;  3DKY A;  1GVD A;  1OCT C;  3H0G J;  3DTK A;  4OOI A;  1FMW A;  5E3L A;  3LSK A;  3T8R A;  2FNP A;  1FY7 A;  4JX6 A;  4WXH A;  2ZXH A;  3C7J A;  2NAZ A;  1U2W A;  2YSR A;  2DMT A;  2EPF A;  3U9G A;  3S1Q J;  1D8K A;  1TNS A;  3DEU A;  5FKK A;  2DA3 A;  1MIJ A;  3M7G A;  5DM6 F;  1FLI A;  1XSV A;  3FK7 A;  1JGS A;  3K7A J;  5AIP A;  4CA0 A;  2VOO A;  2IXS A;  3B6C A;  5IPA A;  1POG A;  1U78 A;  3S32 A;  1SFU A;  2BVM A;  2JSP A;  3F3X A;  2JT1 A;  3E1S A;  3VYR B;  3ZMZ A;  3QYB A;  3NXC A;  1HW1 A;  2XF5 A;  2L02 A;  4CSW A;  1A04 A;  4S0H B;  5F64 A;  3E3V A;  4ZC3 A;  3QU6 A;  4RLF A;  3FX3 A;  1WGX A;  1T8I A;  3L09 A;  2VOD A;  4KIC A;  4I0A A;  4C3I J;  2XGX A;  2KIF A;  4OU0 A;  4A6E A;  3VOK A;  2JPC A;  4E7S A;  1FOW A;  3I3L A;  4XRS G;  4A5M A;  3OSF A;  1UG2 A;  3AQS A;  2OCC H;  1UCR A;  1T33 A;  2HKX A;  1V5G A;  4EEF G;  4BJT A;  2UXP A;  3CJN A;  3LA3 A;  4BYY A;  3TGN A;  1PVE A;  3S93 A;  3FXJ A;  5DS9 A;  3H5R A;  1IN6 A;  3I0T A;  2LRD A;  2BXZ A;  4BUP A;  3Q0V A;  3QPH A;  1G3Y A;  3KEO A;  1W7P B;  3J7Z I;  2GXA A;  2IS6 A;  1ETW A;  2HEO A;  5CXG A;  3HGY A;  1V5F A;  5EYR A;  1XPX A;  2O9L A;  3T8T A;  1H9G A;  3HOY J;  1F4K A;  3PSF A;  1FWZ A;  4JP0 A;  4AUX A;  3MD2 A;  4KA4 A;  5TJJ A;  1CQT A;  1E17 A;  4CUG A;  3SZP A;  4UHT A;  2XVC A;  5JLW A;  2W00 A;  1SEU A;  1PYV A;  3PFI A;  4PGG A;  4MQV A;  5HLG A;  5M5X J;  1KQ8 A;  5CXI A;  2PMU A;  2RGV A;  2L7K A;  2WBM A;  2OUM A;  1NK3 P;  2W48 A;  3FMS A;  4MK6 A;  2W4S A;  4II2 A;  4KT5 C;  1IUY A;  2AQE A;  1KON A;  3JTH A;  1R1T A;  4KFC A;  2YX4 A;  4P9F A;  3GXO A;  5M5W J;  3RKQ A;  2RQQ A;  3SHF A;  3QOD A;  2UV1 A;  2HI3 A;  2HZD A;  1W7P A;  4ESF A;  2CU7 A;  2CQN A;  2MC3 A;  2E7X A;  1HDP A;  1DQU A;  1VQ9 I;  3GTQ J;  3ECO A;  2GIZ A;  1APL C;  3CJD A;  2O0Y A;  2ZOZ A;  4AF5 A;  4HAM A;  2XV4 S;  2GM4 A;  1VQM I;  3JSP A;  1R6R A;  2K4J A;  3I4N J;  3LSM A;  5D5W B;  2ESH A;  4I6Z A;  2W84 A;  3QOE A;  4WF2 A;  1MBE A;  1VFC A;  1JT0 A;  3I4M J;  2M87 A;  4BL0 B;  1D1A A;  5D19 A;  2E1M C;  2UUZ A;  3GWZ A;  3E5Q A;  5HNH A;  2FBI A;  1H9T A;  4M9S A;  5IYB J;  3F0C A;  4P5O A;  3ON4 A;  5BQT A;  2NX4 A;  3LL7 A;  2DFE A;  3OYL A;  1Z1D A;  1BIA A;  1TZL A;  3KZ9 A;  4UUV A;  1MBG A;  2ZCW A;  2HGC A;  1YS6 A;  2HQN A;  5F1J A;  3FHZ A;  4KIF A;  3ROU A;  2BHZ A;  4RGS A;  2Y30 A;  3MZH A;  2QQA A;  3S5R A;  3ZOB A;  4IX7 A;  3LAP A;  1LB2 A;  3QYF A;  1BI2 A;  3EYY A;  3HZJ A;  3HIF A;  1R49 A;  3MFK A;  3S14 J;  5CVI A;  1Z7L A;  2WA0 A;  2OC6 A;  4I09 A;  4XLN F;  4BDZ A;  1H0M A;  4U0W A;  2EQR A;  1T0F C;  3IKV A;  1E3O C;  3IAS 2;  3O2P E;  2WB1 N;  1TTY A;  2VT2 A;  2G0E A;  4P96 A;  2CUZ A;  4LB6 B;  2FQ3 A;  1C0W A;  2HDD A;  3VPR A;  2R7O A;  3CCE I;  4LG0 B;  1ETK A;  4MFD A;  3ZQF A;  2B1E A;  1FBU A;  4HA8 A;  1UHS A;  3M8E A;  2I5U A;  4A69 C;  4CCL A;  1Y39 A;  1E3P A;  4BBS J;  1WQ2 A;  2X6W A;  5CYV A;  4EJW A;  2V6C A;  4CCN A;  2ELJ A;  1SC7 A;  1IV8 A;  5CJ9 A;  2DMP A;  2V26 A;  1B9N A;  1YX5 A;  3WE3 A;  2IS4 A;  1ITY A;  2XDN A;  3HYI A;  3BC8 A;  1FJL A;  4LJZ F;  4BE0 A;  4HF2 A;  2DJI A;  2RNG A;  2RVC A;  2V79 A;  3HHH A;  3ZXS A;  2NXN B;  2OCE A;  4PSX A;  1W0T A;  3HIM A;  2EIJ H;  2DMU A;  2JSC A;  3KP2 A;  3CJR B;  2ZXW H;  4IQJ A;  2PI0 A;  3PPB A;  2CMP A;  2K02 A;  2R7Q A;  2XAQ A;  2P7V B;  5E8G A;  5GP9 A;  1XC5 A;  5KK1 A;  4LG0 A;  2CQ7 A;  3WGG A;  2EJR A;  4Y15 A;  3WTX C;  2DFI A;  1D5V A;  4G12 A;  3JTG A;  4PJ0 C;  2DT6 A;  2RQP A; 
#chains in the Genus database with same CATH homology
 2AO9 A;  3CCY A;  5FKN A;  5C4J J;  2NVT J;  2LFB A;  3OSG A;  2DA6 A;  1IRZ A;  2W53 A;  4DW6 A;  1TWH J;  2NVY J;  1MH4 A;  1QVU A;  5EFY A;  3GZI A;  2LD5 A;  1JKP C;  1JKO C;  3C07 A;  5HSZ A;  5EGO B;  3HTH A;  2CQQ A;  4B1R A;  2IAI A;  2E1O A;  4C2M J;  2ME0 A;  2PBX A;  2WGB A;  5F0H A;  4CYC A;  2R5Z B;  5FMP A;  2PMZ N;  1RES A;  5BNG A;  4J19 A;  2XGC A;  3NAU A;  1WPK A;  3O8H A;  1F43 A;  2WV1 A;  1W0U A;  3MNL A;  2NP5 A;  1LFU P;  3S1M J;  3KKD A;  3GTJ J;  3GTK J;  4IHX A;  2ECB A;  3G1O A;  3CWR A;  4QIW N;  2XPW A;  2R5Y B;  4A3K J;  5D18 A;  4GCK A;  4JYK A;  2LY9 A;  1PUF B;  3GTG J;  3RZO J;  1ETV A;  1VI0 A;  5M5Y J;  3JRH A;  5J1U A;  1F36 A;  2L9R A;  2JMW A;  3G1M A;  2X9D A;  1ETQ A;  3RZD J;  1B8I B;  3S1N J;  1QPI A;  4XRM A;  2NVQ J;  2HXO A;  2JA5 J;  3H3V K;  4A3B J;  4D5C A;  3IH2 A;  5GPA A;  3RQI A;  2R5Z A;  2OER A;  3BQZ A;  3A03 A;  2M0C A;  4M3D A;  2F07 A;  1FEX A;  3BTC A;  4Y52 J;  3PO3 J;  3LSR A;  4I76 A;  2E2J J;  1RET A;  2V57 A;  4ME9 A;  3S2H J;  1EF4 A;  4W97 A;  2COB A;  4RBO A;  2HXI A;  3RH2 A;  5FGL A;  1JKR C;  4UUT A;  5HBU A;  2R5Y A;  5GPC A;  3V78 A;  2QF7 A;  2LP0 A;  3BR1 A;  5H9T A;  3S15 J;  4A3G J;  2M9H A;  4QTR A;  1JUM A;  1RKW A;  2KDZ A;  2TRT A;  1TC3 C;  1B72 B;  2ZCN A;  4D7M A;  2LLK A;  4MO7 A;  2XSD C;  3A01 B;  3HE0 A;  1HLV A;  5AQC A;  9ANT A;  5DTD A;  3BR3 A;  4JX5 A;  2R7Z J;  5M3F J;  3BNI A;  2MGQ A;  5J3L A;  3A02 A;  1LFB A;  4AYB N;  3FIW A;  4ABZ A;  2GLO A;  5IP7 J;  1ZGW A;  4DYC A;  1YRN B;  3GEU A;  2YVE A;  2E19 A;  3G1L A;  3VP5 A;  3JRD A;  3G56 A;  5EG0 B;  1MSE C;  4NEL A;  2JJ7 A;  5EZH A;  3HOV J;  2CJJ A;  4A3C J;  1WH7 A;  2QCO A;  3ZQH A;  1BA5 A;  2FX0 A;  1B72 A;  3PO2 J;  3VVZ A;  1VF9 A;  3VW2 A;  2HKU A;  1JTX A;  2XB0 X;  3A01 A;  5F0F A;  4PXI A;  4GFL A;  5J1R A;  3TED A;  4A3F J;  3KKC A;  1MBF A;  1ZR4 A;  2DJN A;  4A3J J;  1H88 C;  5FKO A;  1GV5 A;  1U8B A;  2DMN A;  2O7T A;  2H1K A;  5C4X J;  2CRG A;  5IYD J;  1K83 J;  1JJ8 C;  3BJB A;  2EBI A;  1YRN A;  5C44 J;  2X6O A;  4CYC B;  3NNR A;  1UI5 A;  3LSG A;  3ZQL A;  1NK2 P;  3GTL J;  2ZB9 A;  1UMQ A;  1JTY A;  3BRU A;  4ACI A;  3CRJ A;  2IEK A;  3LNQ A;  5K7H A;  5EG0 A;  4MFE A;  1X2N A;  3TP3 A;  2Y9Z A;  2M8G X;  3QPS A;  3DPJ A;  3IV5 A;  1H89 C;  5FLV A;  2EZH A;  2RAS A;  1X58 A;  1P7J A;  2HOA A;  3LJL A;  3NPI A;  1GT0 C;  3SJM A;  3WHB A;  2MW8 A;  4A93 J;  4JKZ A;  2XPU A;  5F0C A;  1SGM A;  4XRS A;  1JUS A;  5EEA A;  3BG3 A;  3WHC A;  1BL0 A;  4KWA A;  1O4X A;  5DAJ A;  1P7I A;  2ECC A;  2NVX J;  1FIA A;  4M3E A;  2X48 A;  2EZK A;  2IBD A;  3VVY A;  5FHP A;  1HCR A;  5HAW A;  3HEF A;  1I3Q J;  4GCT A;  3QPL A;  4A3I J;  3LSP A;  3BHQ A;  4X6A J;  4L62 A;  2HYJ A;  4X1E A;  3ZQG A;  1SFO J;  3C2B A;  3BG9 A;  2REK A;  2FJ1 A;  3E7L A;  3GTO J;  2VI6 A;  1ORK A;  5C4Y A;  1Y1W J;  4IEJ A;  2WUI A;  4D5F A;  3FRQ A;  3HOX J;  5K7Z A;  1IJW C;  1LE8 B;  4A3M J;  1TWF J;  5D1R A;  3T6N A;  4NN1 A;  3B6A A;  2LKX A;  2ID6 A;  5K58 A;  1GUU A;  1ZTR A;  1ETY A;  1S7E A;  3B81 A;  1T56 A;  2EZL A;  4HKU A;  3BR2 A;  2L7Z A;  3D1N I;  2I10 A;  5JLX A;  3IH4 A;  1HOM A;  5FLM J;  2LK2 A;  2K9N A;  2P81 A;  2JA7 J;  3MVP A;  1DU6 A;  4BY7 J;  4BKX A;  2GFN A;  1OFC X;  2ZCM A;  2NP3 A;  4D7N A;  5K7F A;  3COL A;  2VPR A;  1A5J A;  3VW0 A;  4AC6 A;  5IOY A;  1IDZ A;  5EDN A;  2O7O A;  2DN0 A;  3K2A A;  1JJ6 C;  1VND A;  2YS9 A;  3HTA A;  2ME6 A;  1BJZ A;  2Y31 A;  4A3D J;  3NRG A;  4IHW A;  2VKV A;  4NDL A;  1JGG A;  2K40 A;  3NAR A;  3HTI A;  2UXI A;  3Q0W A;  4JNN A;  3MN2 A;  1ENH A;  5F08 A;  5IOZ A;  1IC8 A;  1LE8 A;  2XGE A;  3VW1 A;  2B63 J;  2GEN A;  3HB9 A;  1R9T J;  4FCY A;  2OPT A;  2XGD A;  3IH3 A;  4GFB A;  3IUV A;  2YU9 J;  4MXM A;  1OCP A;  2DMQ A;  2DG8 A;  3JR9 A;  2PZ9 A;  1U9N A;  4V2F A;  3Q3S A;  3SFI A;  1JUP A;  2LVS A;  3VUQ A;  2R92 J;  2E2H J;  2QTQ A;  3JRA A;  2JK3 A;  5IP9 J;  4JL3 A;  2QWT A;  1Z77 A;  3Q0U A;  2DA2 A;  3ZQC A;  1MH3 A;  2MG4 A;  2R0Q C;  2GUH A;  3EUP A;  3BTJ A;  3OIO A;  3PAS A;  3CQZ J;  3FK6 A;  4UUS B;  3F1B A;  4GFK A;  4CGR A;  2OF7 A;  3O8G A;  1OJL A;  5F04 A;  3HOZ J;  2Q24 A;  3UKG A;  1QVT A;  1K61 A;  1TWA J;  1D5Y A;  2DTZ A;  3AQT A;  2NOG A;  1GVD A;  1ZQ3 P;  1G2H A;  1OCT C;  3H0G J;  2TCT A;  5IP6 A;  5E3L A;  3OOU A;  2DA7 A;  2YVH A;  1IDY A;  1Q1V A;  1ZK8 A;  3S2D J;  3HTJ A;  2CQX A;  2OI8 A;  4JX6 A;  3P9T A;  4W1U A;  2UXU A;  1ZR2 A;  2GBY A;  2DMT A;  3BTI A;  3S1Q J;  3FIS A;  2ID3 A;  2NS7 A;  2DA3 A;  5FKK A;  1IG7 A;  3FK7 A;  3K7A J;  3GTM J;  3B6C A;  5IPA A;  1POG A;  2EH3 A;  1U78 A;  4XID A;  2HYT A;  4M3B A;  4UUS A;  3CMY A;  1WCM J;  1BW6 A;  2LR8 A;  5EZG A;  1FTZ A;  1IGN A;  2AHQ A;  1QRY A;  1TWC J;  3NXC A;  5M3M J;  4S0H B;  2XPV A;  1MBK A;  2DA5 A;  1ETX A;  1Y1V J;  5E3O A;  1IUF A;  1WGX A;  2L7F P;  1JKQ C;  3S1R J;  1AHD P;  4C3I J;  3JRG A;  3HDD A;  1RR7 A;  2G7G A;  3VOK A;  4B3A A;  3JRI A;  1HF0 A;  4XRS G;  3OSF A;  2K9Q A;  1UG2 A;  3BR5 A;  3AQS A;  1T33 A;  4EEF G;  3JRC A;  3S17 J;  2UXP A;  4JX4 A;  3VVX A;  2XB5 A;  3BCG A;  1AKH B;  2G3B A;  5DS9 A;  1BW5 A;  4C3J J;  2QOP A;  2G7L A;  4DZP A;  3Q0V A;  1GDT A;  2WAQ N;  4IHY A;  4XIC A;  1ETW A;  2FQ4 A;  3JRF A;  3HGY A;  2IU5 A;  5EYR A;  2O9L A;  2DA4 A;  2JN6 A;  5FJ8 J;  4QSH A;  3HOY J;  2JWT A;  3BR6 A;  4JP0 A;  4AUX A;  2LTP A;  1CQT A;  3HOW J;  5JLW A;  2Y0S N;  1A6I A;  3TW6 A;  5M5X J;  5E3M A;  5CXI A;  1IV6 A;  3HKZ N;  4ICH A;  4IHV A;  4MK6 A;  1NK3 P;  3W6V A;  2W48 A;  3LHQ A;  4MLO A;  3MKL A;  2G7S A;  3VIB A;  1AKH A;  5M5W J;  3RKQ A;  2M34 A;  4UDS A;  3JRB A;  3SDG A;  4FTH A;  3BT9 A;  2HI3 A;  3BQY A;  3RD3 A;  3TW7 A;  2ELK A;  3M4O J;  2CU7 A;  5FKM A;  3ANG A;  4M6V A;  4BXX J;  1WI3 A;  3NI7 A;  1HDP A;  3GTQ J;  4GCL A;  1MBJ A;  5F27 A;  1APL C;  4BBR J;  3QBM A;  1X2M A;  3CJD A;  2FD5 A;  1FTT A;  2ZOZ A;  4AF5 A;  1SAN A;  3PM1 A;  3FKI J;  3QQA A;  2GM4 A;  4FIS A;  2M2E A;  2E2I J;  4Y7N J;  5EGO A;  3O60 A;  2HOS A;  3ANP A;  3BG5 A;  1RKT A;  1U9O A;  4DYR A;  1TWG J;  4L5E A;  3HM5 A;  5EF6 A;  3I4N J;  2ZOY A;  5HOD A;  3BR0 A;  4I6Z A;  1VFC A;  4A3L J;  3VOX A;  1MBE A;  1JT0 A;  5C3E J;  2VKE A;  3I4M J;  3DEW A;  1H8A C;  1ETO A;  3S16 J;  4RDU A;  5D19 A;  1MNM C;  1WH5 A;  2RHA A;  3HOU J;  1NTC A;  2KT0 A;  1ZKG A;  3BTL A;  5IYB J;  3F0C A;  3CDL A;  3ON4 A;  1DU0 A;  2NX4 A;  2CUF A;  1HDD C;  2K9S A;  1AU7 A;  1PUF A;  3G7R A;  1FIP A;  2DA1 A;  2VUM J;  3KZ9 A;  4M3F A;  1MBG A;  4B4C A;  3ZQI A;  2QKO A;  3LWJ A;  4MIM A;  1MBH A;  5F1J A;  2QIB A;  5CW8 A;  1GV2 A;  1B8I A;  5FKL A;  4FE7 A;  2Y30 A;  2JA6 J;  2O8K A;  3S5R A;  3ZOB A;  4A3E J;  4AC0 A;  2CUE A;  2UXO A;  3JSJ A;  2HQ5 A;  3HBL A;  3S14 J;  2DG7 A;  2D5V A;  1XS9 A;  3M3Y J;  2EQR A;  4V2G A;  2D6Y A;  1E3O C;  1XG1 A;  1Z0X A;  2Y2Z A;  4DYQ A;  2WB1 N;  4FE4 A;  3KNW A;  2G0E A;  1RPW A;  2UXH A;  2HDD A;  3VPR A;  2JA8 J;  1ETK A;  4MFD A;  3ZQF A;  4DZJ A;  5J1Y A;  3E7Q A;  1UHS A;  1JT6 A;  2NS8 A;  4A69 C;  4YZE A;  3GBG A;  5E3N A;  3TP0 A;  5CXG A;  4BBS J;  2MSY A;  3JRE A;  3DCF A;  2ZCX A;  4BY1 J;  2H8R A;  2DMP A;  3GTP J;  2XDN A;  4M3G A;  1ITY A;  3ON2 A;  1FJL A;  4C3H J;  2Y9Y A;  1UI6 A;  3L1P A;  3HGG A;  1I50 J;  2L0K A;  2XRL A;  1W0T A;  3HIM A;  3QKX A;  2R93 J;  2DMU A;  3EGQ A;  3V6G A;  4XK4 A;  3LOC A;  1I6H J;  2FBQ A;  3PPB A;  3LSJ A;  5GP9 A;  2EZI A;  1XC5 A;  2YUS A;  2RAE A;  5IYC J;  2N8G A;  1MSF C;  2HOT A;  4G12 A;  4HNV A;  2L7M P;  4LOC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...