1ZKGA

Crystal structure of transcriptional regulator, tetr family (tm1030) from thermotoga maritima at 2.30 a resolution
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
200
structure length
200
Chain Sequence
VLSKRDAILKAAVEVFGKKGYDRATTDEIAEKAGVAKGLIFHYFKNKEELYYQAYMSVTEKLQKEFENFLMKNRNRDIFDFMERWIEKKLEYSASHPEEADFLITLVSVDEGLRKRILLDLEKSQRVFFDFVREKLKDLDLAEDVTEEIALKFLMWFFSGFEEVYLRTYQGKPELLKRDMNTLVEEVKVMLRILKKGMTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of TM1030 from Thermotoga maritima at 2.3 A resolution reveals molecular details of its transcription repressor function.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transcription regulator
molecule keywords transcriptional regulator, TetR family
total genus 69
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1zkgA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 1zkgA02
1G2HA 4IHVA 1NK3P 3CDLA 3BG9A 2QIBA 4ICHA 2L7ZA 3FK7A 2OPTA 4DYRA 1X2MA 4V2GA 5CXIA 2M9HA 3RZDJ 5IYBJ 5EG0B 1ETOA 1GUUA 3Q3SA 1IDZA 3EUPA 5FKMA 4X6AJ 2XPVA 3NPIA 1VF9A 2G3BA 2ECBA 3ON4A 1IJWC 1WH7A 5EF6A 2DA3A 3JRBA 4DYCA 2LKXA 4MIMA 2NS8A 1H8AC 2XSDC 1BL0A 3B6AA 3BR5A 3BCGA 1MSFC 1HF0A 5CW8A 2HQ5A 3BQYA 5K58A 3HOYJ 2RHAA 4FCYA 5J1UA 5CXGA 3QPLA 3JRAA 3LSPA 2OERA 1HDPA 1W0TA 1JJ8C 2V57A 2DMPA 2M34A 2JMWA 5DTDA 3VVXA 3HB9A 1WH5A 3VVYA 3HOUJ 3ON2A 2LTPA 5HSZA 2ME6A 2GM4A 2O7OA 3F1BA 4GFKA 4NELA 3ZQIA 3TP0A 3VW1A 2P81A 1POGA 5C4JJ 2HOAA 4GCKA 2AHQA 2ZB9A 1F36A 2EBIA 3M3YJ 3S17J 4DYQA 3I4MJ 3W6VA 3BG5A 1H89C 1TWHJ 5HODA 1IG7A 1TWGJ 1X58A 3HM5A 1IUFA 1LFBA 3L1PA 3ZQHA 3O8HA 5F0CA 4X1EA 3HOVJ 2E2IJ 1QRYA 2WAQN 2GBYA 1SFOJ 2JA5J 3JREA 2FBQA 3G7RA 2VI6A 5H9TA 1OCTC 3BT9A 2DMTA 3F0CA 5FGLA 1IDYA 1T56A 1U78A 3OOUA 2Y9ZA 3VW0A 1Z77A 1QVTA 3A01A 1FEXA 4MFEA 3LWJA 2YVHA 1ENHA 5HAWA 5F08A 1JKOC 3S16J 5F04A 1ZTRA 1LE8A 2JN6A 2XPWA 4AYBN 1GVDA 2DJNA 2JK3A 5E3NA 3JRDA 5J3LA 4EEFG 5EEAA 4A3FJ 3V78A 1HCRA 2L7FP 3FK6A 1K83J 1JT0A 3S1RJ 3WHCA 3CWRA 5F0FA 4A3EJ 5FLVA 3Q0UA 4IEJA 3G1MA 1GV2A 2DMQA 2EZHA 3HDDA 3S15J 3BG3A 4DZPA 3VUQA 5C44J 4BBSJ 3HOZJ 3JRGA 3ZQGA 3ZQCA 4S0HB 3FIWA 5J1YA 1R9TJ 5IYCJ 2M0CA 2NS7A 2Q24A 4AUXA 4KWAA 1ETYA 2ECCA 2LK2A 3IH3A 4AC0A 1RETA 2DG7A 3HTAA 5GPCA 1IC8A 2DA4A 5EFYA 3AQSA 5D18A 2TRTA 4BKXA 2LD5A 1MBJA 2LY9A 3BTCA 5FJ8J 3KZ9A 2Y31A 1VFCA 3MVPA 4JYKA 4FISA 2ZCXA 1I50J 2E19A 1OCPA 2WV1A 4CYCB 3NNRA 3GTPJ 3GTOJ 1E3OC 2XRLA 3JSJA 5D19A 4CYCA 2VPRA 3DCFA 2QF7A 3JRCA 2R5ZB 1MBEA 2CRGA 2EH3A 3K7AJ 1OFCX 4RBOA 1MNMC 1FIAA 4JP0A 3M4OJ 2E2JJ 3NAUA 3PASA 2WB1N 1APLC 2G0EA 1ETVA 2Y30A 2L9RA 1W0UA 2HKUA 1B8IA 2JA6J 1U8BA 5E3LA 1JJ6C 2H8RA 4GCTA 1MH4A 1UHSA 4AF5A 5GPAA 1FJLA 3NI7A 1CQTA 3S2HJ 3C07A 1B72A 2TCTA 2HXOA 2IAIA 1RKWA 3QPSA 3DPJA 4I76A 3RKQA 3COLA 3JR9A 4A3LJ 2K9NA 3IH4A 1P7IA 3SJMA 1PUFB 4D5CA 2KT0A 2UXPA 3TW6A 4M3EA 5FKOA 3HGGA 1EF4A 2EZKA 3S1MJ 3ANGA 4D7NA 4DW6A 2XB0X 3Q0VA 2B63J 4Y52J 3BQZA 5C3EJ 4MLOA 5FMPA 2JJ7A 2O9LA 4IHXA 3TW7A 1WGXA 3G1OA 3IUVA 2EZLA 1BW5A 5IPAA 3NXCA 4M6VA 3VOXA 2HYJA 1O4XA 3HE0A 2F07A 3UKGA 3EGQA 2JA7J 2NX4A 2FQ4A 5FKKA 4C3HJ 2GENA 2YU9J 4D5FA 5FLMJ 2LFBA 5GP9A 3LHQA 5F0HA 5HBUA 1VI0A 1ZQ3P 4A3MJ 2CQXA 1XG1A 3D1NI 1MBGA 2ME0A 5C4YA 1JGGA 3PO2J 2R5YB 3T6NA 3JRFA 3BR1A 1XS9A 5M5XJ 2MW8A 3BR0A 1X2NA 5IOZA 3QBMA 4C3IJ 5IP6A 4BXXJ 1T33A 1IRZA 1RKTA 5JLWA 2LR8A 2Y0SN 4JX6A 4M3BA 4IHYA 1DU6A 9ANTA 3BNIA 5EG0A 2D6YA 2PMZN 4LOCA 4W97A 4ACIA 2X6OA 2DA6A 1FTTA 5EYRA 1Z0XA 3I4NJ 3ZQFA 1WI3A 2YUSA 3BR3A 2IEKA 2MG4A 2NVXJ 3HOWJ 2W53A 3P9TA 3H0GJ 3LNQA 4ABZA 1MH3A 1RESA 4B4CA 2WGBA 1ZR2A 4A3IJ 3ZQLA 4C3JJ 2NOGA 5M3FJ 3GZIA 3GTMJ 3GTLJ 1LFUP 4GCLA 2COBA 3S1NJ 1RR7A 4UUSB 1FIPA 2XGDA 3NARA 4YZEA 3AQTA 3MKLA 2UXIA 2XPUA 5EZHA 4IHWA 5E3MA 1JUSA 2XB5A 1F43A 2RASA 1IV6A 4A93J 2GFNA 3FKIJ 3A01B 3G56A 3A02A 1JUMA 2X48A 1MSEC 3B81A 2DMUA 1UI6A 3GBGA 3OIOA 3CQZJ 3QQAA 4D7MA 1WCMJ 3KNWA 2HXIA 4V2FA 2ELKA 4BY1J 1H88C 1I6HJ 1IGNA 2L7MP 2HDDA 3LJLA 4PXIA 2K9SA 4B1RA 2FX0A 1QPIA 1BJZA 3KKCA 3IH2A 4BY7J 2VKEA 3VVZA 5D1RA 1U9NA 3GTJJ 2QTQA 1TWFJ 3NRGA 2H1KA 2R92J 2R5YA 3HIMA 2LLKA 2JWTA 2AO9A 3C2BA 4BBRJ 3JRHA 1UMQA 5IP9J 3HTHA 3OSGA 1TWAJ 4A3BJ 2YVEA 3MNLA 2R0QC 2UXHA 4A69C 1NK2P 3BHQA 3V6GA 3GTQJ 1GV5A 2ID3A 4B3AA 1GT0C 2G7SA 4M3FA 4NN1A 3HEFA 1BW6A 5M5WJ 1UG2A 1JKQC 4JX5A 3VIBA 1MBKA 1Y1WJ 1JKRC 3RD3A 5M5YJ 4GFBA 5F27A 1Y1VJ 5EZGA 2K9QA 3S1QJ 3G1LA 3O8GA 3S14J 2R5ZA 5K7HA 5C4XJ 2NP3A 3MN2A 4DZJA 2CJJA 1DU0A 1BA5A 4M3GA 1K61A 3IV5A 5IYDJ 2DA1A 2KDZA 3WHBA 1YRNA 1AHDP 3PPBA 1ETWA 1YRNB 1ETKA 2DMNA 4XK4A 3BR2A 1VNDA 1LE8B 2JA8J 1B72B 3GTGJ 3CJDA 4A3JJ 2IU5A 5FKNA 2L0KA 1XC5A 3ZOBA 1D5YA 4I6ZA 2XGCA 2YS9A 2OI8A 2OF7A 1HLVA 5F1JA 1P7JA 3GTKJ 2QOPA 3VW2A 2ZOZA 4MXMA 3K2AA 4C2MJ 4XRMA 4RDUA 2VUMJ 4L62A 5EGOB 1JT6A 2ZOYA 2EZIA 2E1OA 2IBDA 2DN0A 3RQIA 4XIDA 1ITYA 2K40A 2M2EA 5EGOA 4J19A 3VPRA 3HOXJ 4FTHA 2PZ9A 4XRSG 2UXOA 3TP3A 3E7QA 1MBHA 1ZR4A 1ZKGA 1A5JA 2DG8A 2M8GX 4FE4A 4QIWN 3HTJA 3CRJA 2DTZA 1ZGWA 1UI5A 3H3VK 4UUTA 3Q0WA 2DA2A 1RPWA 3RH2A 2DA5A 3BTJA 5E3OA 2Y9YA 3LSGA 4XICA 4UDSA 2VKVA 3BJBA 3HBLA 3O60A 1QVUA 5K7ZA 2O7TA 2HI3A 1ETQA 5IP7J 4Y7NJ 2RAEA 3PO3J 3GEUA 2QKOA 2WUIA 4A3KJ 4NDLA 2I10A 4A3GJ 4XRSA 3S5RA 4JL3A 3TEDA 2W48A 2LVSA 4GFLA 3LSJA 1S7EA 5EDNA 2LP0A 1A6IA 4HKUA 4L5EA 4FE7A 5M3MJ 3CCYA 2FD5A 2Y2ZA 1B8IB 2HOTA 4A3DJ 4AC6A 1Q1VA 2FJ1A 2O8KA 2ZCNA 4CGRA 2CUFA 2NP5A 5K7FA 3S2DJ 2EQRA 3SFIA 1SGMA 1TWCJ 4QSHA 2QWTA 3HTIA 2HYTA 2ID6A 2QCOA 5BNGA 2XGEA 2MGQA 3B6CA 1ORKA 1U9OA 3PM1A 3ANPA 3VP5A 2G7LA 3A03A 1PUFA 4G12A 5DAJA 1TC3C 1ZK8A 4JX4A 4MO7A 2GUHA 1MBFA 4MFDA 5J1RA 1WPKA 3JRIA 4M3DA 1AKHB 2UXUA 4MK6A 3OSFA 2NVTJ 3BRUA 1AKHA 5IOYA 2G7GA 2E2HJ 2R7ZJ 4A3CJ 2REKA 3FRQA 5FKLA 2GLOA 2CUEA 3HGYA 2R93J 3LSRA 5FHPA 5AQCA 5JLXA 2HOSA 2MSYA 2PBXA 1ETXA 2CQQA 1I3QJ 4HNVA 3KKDA 3SDGA 2DA7A 4JNNA 2XDNA 1SANA 1GDTA 1AU7A 3E7LA 2D5VA 2NVQJ 4JKZA 3VOKA 1HOMA 1HDDC 4QTRA 3HKZN 4ME9A 2N8GA 3RZOJ 4W1UA 1JTYA 1JUPA 3BTIA 1OJLA 3CMYA 1JKPC 1JTXA 3QKXA 2CU7A 2NVYJ 2ZCMA 3BTLA 3BR6A 1FTZA 3LOCA 5DS9A 1NTCA 3FISA 3DEWA 2X9DA 4UUSA
chains in the Genus database with same CATH superfamily
2H6BA 3HSEA 5GADJ 4IHVA 2WY7Q 4KMFA 2FF4A 3O3KA 2VQHA 3ASNH 3BCAA 2DDAA 2OZUA 4HEA2 5KAFC 2XV4S 3X2QH 2A6EF 4V2GA 2M9HA 1H9GA 3GWZA 1ETOA 1SVOA 2XAGA 3D5LA 1GUUA 3J81Z 2BY3A 2L7KA 2QKMB 2XPVA 1VF9A 4ESBA 2G3BA 2KPMA 2ECBA 2DDBA 3ON4A 1OYYA 2JPCA 3VSLA 1R1UA 2DODA 2XHKA 1I6XA 4FHTA 2H8WA 4L0YB 4NC8A 3B6AA 2JQ7A 3BR5A 2WY8Q 3CC7I 5D6FA 2VPLA 3LMMA 2RNGA 2V7FA 1G6NA 1REPC 2YPRA 3BQYA 1XGNA 5J40A 3DFGA 1F4KA 1ACIA 3QPLA 1BOAA 3F72A 1T0FA 1W5TA 1HDPA 3C3WA 3CCVI 4XN3A 3OIQA 4BS9A 3QRFF 2JMWA 4U0VA 3VVXA 1D3YA 3RJPA 3CCQI 2LSOA 4YIIA 2HNHA 2CV1A 3ON2A 2ME6A 2GM4A 4E6KG 3H5NA 2OV7A 3DTEA 2MH2A 2P81A 2RREA 4N4OB 4RA2A 4I09A 2WAEA 3E6BA 2ZB9A 4IXAA 4FX0A 4ZJZA 3H5AA 2OD5A 2RNJA 3ASOH 3ZN0A 3W6VA 4MQ9F 3LL7A 1Z7UA 1TWGJ 1KZHA 3GW2A 2F5DA 1HSTA 2A5YB 3I5UA 1VQNI 4IRVA 1R23A 3GO5A 4Q48A 1V5GA 3BZ6A 5LBQA 5F0CA 2A5WA 4X1EA 3G3ZA 5D4RA 4F55A 3C2HA 2O03A 3S3NA 3SYTA 3FXOA 2K9MA 1IN7A 1A6QA 2JA5J 2BVLA 2R4GA 3IUOA 5FGLA 3F0CA 1IDYA 1U78A 4XN0A 5DV5A 2V9VA 1MD0A 1X1BA 3BJOA 3VW0A 3LWJA 1PP7U 1Y8QB 2L02A 5HAWA 4II2A 5F08A 1A35A 2PFVA 3ESWB 2XPWA 3W2VA 4L9TA 1EKEA 2LBFB 2JK3A 5E3NA 2K3PA 2B7EA 4BHPA 3KP6A 2W85A 2L7FP 2RN7A 3FXKA 3FK6A 3C2GA 4A6EA 3MKYB 3VODA 3BWGA 3WHCA 2DK8A 4A3EJ 2PMUA 5FLVA 5ICGA 2LY1A 4PJJA 1EV7A 3IHUA 4HV5A 3K4NA 1B9NA 4DZPA 3L2RA 5C44J 4BBSJ 3E5UA 4CCNA 2ZJ2A 4XKCA 3CZ6A 3W2WA 3ZQGA 3ZQCA 1Y39A 2NRAC 3FIWA 4RB3C 1KYWA 3PFIA 2W25A 3LSMA 3WG9A 1R9TJ 1OMIA 2EFNA 3AL0B 1S29A 4AM3A 2E35A 1S72I 4KWAA 4HPQA 4LG0B 1VQ7I 5GPCA 4CGZA 5EFYA 1KYZA 3G2BA 5LHGA 3H1CA 4RGSA 5FJ8J 4NHJA 2Y31A 2NYXA 3AG3H 2GXAA 3ZQ7A 4F52A 2A69F 4FISA 2YSRA 1ZRDA 1BIBA 1OCPA 4CYCB 2RQPA 4L0ZB 2R7OA 3PNYA 4AIDA 4UY8I 5D19A 4CYCA 3DCFA 1IUYA 1MBEA 5HVQC 2CRGA 2M3AA 3ZCOA 4KITB 2R7SA 3PFYA 2G0EA 3IRRA 1OLTA 1ETVA 4E4HA 5FFZA 1W0UA 1ZRCA 3CUQC 2JA6J 3NRVA 2E1NA 2KIUA 1SFEA 2EFOA 1W36D 3JAMZ 2HVQA 4AIHA 1DP7P 5BOXA 4HX7A 1LB2A 4PCQA 4EJOA 2IAIA 3GFLA 3ROUA 4BEHB 2H1LA 1WRJA 4U0WA 3WGGA 1A04A 2HZTA 1ONVA 2K9NA 1PUFB 1M1EB 3B73A 5CKTA 5A2QZ 4BHCA 4A6DA 4U7BA 4Z2YA 4Z6YA 5L3FA 1EF4A 2EINH 2ZC2A 3CDHA 3SWHA 1LJ9A 4ZYEA 1KGSA 2VC1A 3R4KA 4D7NA 3OY9A 5BPDA 1MZBA 3EUKL 5AIPA 4PSWA 5DCMB 3Q0VA 2EFQA 1P4AA 4XLNF 2BHZA 5FMPA 2W84A 4IHXA 4HX4A 5E79C 5HLHA 2E60A 2IGOA 3AFHA 4HF0A 3M8JA 1MJAA 1O4XA 5H20A 4IRHA 3VB2A 4NNJA 4WF2A 4A5NA 3JTGA 3UKGA 2JA7J 4UV8A 1FC3A 1ZHFA 2NX4A 4C3HJ 4IOAF 5HS9A 5FO5A 3G73A 2OA4A 3ONQA 2F48A 4BAYA 2UXNA 4D5FA 2LFBA 3LHQA 1GLNA 5F0HA 1LPQA 2NNNA 2VOOA 1VZ0A 3D1NI 2XAFA 3U1KA 2XASA 3K4MA 3KLOA 3U1DA 5M5XJ 1EH8A 3BP8A 3CUQA 3RQ4A 2BW3B 1R5ID 3HPHA 3GCMA 1T33A 3NQOA 1YJNI 3TO6A 2LR8A 4M3BA 3A1YA 4G7ZF 5CVUA 9ANTA 3BNIA 2PMZN 3OYAA 2G7UA 3FHZA 5EYRA 3FXRA 1VTNC 1V5EA 3MD2A 2H94A 1OYWA 1WJ5A 2YUSA 3BR3A 1UJ8A 3R6SA 4ZDLA 1R4NB 2LC2A 5HS8A 2NVXJ 4ON0A 4ABZA 4HDUA 1MH3A 2WGBA 1ZR2A 2OCEA 3LSTA 4PJ0C 4L5JA 1LFUP 3GTLJ 1IN4A 1OCRH 3EETA 3VYTB 1RR7A 2R7FA 3S1NJ 2HTSA 2XGDA 3HRSA 1TTYA 3CLOA 3CUOA 1XMAA 2A3SA 4N4NB 4MTEA 5E1ZB 4TV7A 2VT3A 1J0RA 1TT0A 3LFKA 5EZHA 1JUSA 3FX3A 2BV6A 4XSZF 1XN7A 3ECHA 1SMYF 1R49A 4UV9A 3REOA 1WFXA 1YG2A 2WBMA 1ERDA 2DYRH 2L9VA 1W4MA 4E70A 1UI6A 1YX3A 1FMVA 2HDWA 3FXQA 1WCMJ 4ESFA 1I27A 3L09A 4OIOF 4OIPF 1LDDA 3WU0A 5K1YA 4L9JA 2FX0A 2B1EA 1I1GA 4KIFA 4E7IA 1BJZA 3IH2A 3IC7A 4C2MA 3LA2A 4AWXB 2H1KA 2R92J 3F8BA 1H9TA 2M87A 2LLKA 4XLFA 4DQ2A 5ICEA 2V26A 4A3BJ 2YVEA 1PP8F 4XL9A 2R0QC 2ZKZA 3GF2A 3AG2H 1TNSA 4A69C 4E7KA 3BHQA 2QBYB 2ZXIA 3F8FA 2HPMA 2WWYA 1EH6A 1WWXA 1SAXA 3MAJA 1HKQA 3F3XA 2G7SA 3RYRA 1PVEA 5M5WJ 4OD5A 4AU7A 2KRFA 2VN2A 3V8JA 2LOOA 2H6CA 2VKDA 2B3WA 1DGWY 2LREA 1Y1VJ 5L3DA 1DPUA 3S1QJ 2K9QA 5C4XJ 1X4PA 2NP3A 5AIQA 4GYIA 3MN2A 3P9CA 4E7HA 4WIBA 1BA5A 4M3GA 5E8IA 1W5CC 5ICCA 3GX4X 4CCJA 2DA1A 3I54A 4IF4A 3WHBA 2D45A 1SFUA 2LF7A 2IVMA 3HYIA 1PDNC 1ETKA 2RKHA 1RR8C 1VNDA 1LE8B 3DWLE 3F6VA 3N97A 4ZTJA 4YFNF 2IU5A 2XAUA 1D5YA 2K86A 2XGCA 2OI8A 3K1MA 5B1BH 3GTKJ 2ZOZA 1B6AA 2UV1A 4NUBA 3ZRGA 4G9YA 1JHFA 2PG4A 1HA8A 1I5ZA 2EZIA 2E1OA 2DN0A 2OQGA 4J19A 3CDIA 5DCMA 2F5FA 5DEQA 2CSOA 2IGMA 3HOXJ 4FTHA 3WTUC 2Z33A 4UB8C 2A07F 3E7QA 3MZYA 2M8GX 4FE4A 4Y17A 3DBHB 3RYPA 1SD4A 2DTZA 1LEBA 4BQNA 2PQ8A 2ZJQF 3HTUA 4UUTA 1ZGAA 2DA2A 3Q0WA 2OQRA 3BTJA 4G94A 2Y9YA 2LF8A 2LYCA 4PGHA 3BJBA 1WZ2A 3RDIA 4XOPA 2VONA 4FASD 5K7ZA 4LLLA 5HS7A 4A0XA 1SD5A 4Y7NJ 5IP7J 3JCUC 2HTJA 4E7SA 2QKOA 4YIRX 1HBXG 4NDLA 1EJ9A 2QM3A 2G7HA 4F93B 2F4IA 1YO5C 4A3GJ 3S5RA 4M9ZA 1YE9A 2ZSHB 1U8RA 2GXGA 4GXOA 3UR3C 5L3CA 4M6YA 4IHSA 3CUQB 4HKUA 5M3MJ 3K4CA 3CCYA 2BW3A 2FD5A 1B8IB 2OZ6A 3F6OA 3I71A 4AC6A 5JHUA 4BQOA 4A2UA 2BE5F 2EQRA 3S2DJ 3F8CA 1FSHA 2QWTA 1Z6RA 3L2VA 3K70D 2QUFA 1ZN2A 2O5RA 2X6XA 4IO9F 3HSRA 2W57A 3HUGA 4HSTA 1MIJA 1MJ9A 4DVYP 1ZK8A 3ZP5A 2E34A 2QQAA 2UXUA 4M3DA 3HUGB 2L01A 1Y0UA 5J4VA 3W6JB 1Y56A 5IOYA 4EMSA 2GA2A 3E6DA 2OU2A 5GTIC 4GO1A 2ZMEC 4HF2A 1RI7A 3F21A 2HOSA 3VFZA 1DDNA 1I3QJ 5EEHA 2DFHA 1RUNA 3QU6A 5H2FC 3Q5FA 2XGXA 2HEOA 2XDNA 3RI4A 2VQGA 1AU7A 2NVQJ 4I98B 5JR3A 1HDDC 4C2TA 2FJI1 3FZVA 1IV8A 2N8GA 4CUGA 3IKVA 1QU3A 1JTYA 3K10A 1OJLA 3NEUA 4EJTA 2L9SA 5D4SA 1JKPC 4R79A 2NVYJ 1FOWA 3IWZA 1ZYRF 1FTZA 2KRCA 2ZMEA 3O6BB 5FGMA 2L2OA 3F23A 3CMAI 1O3QA 2X9DA 2PBIA 4UUSA 1VQOI 2YX7A 2L7ZA 2KZGA 2MABA 1OYIA 3T0YA 4PJNA 1SFKA 1T98A 4PZJA 4ZH4F 1X2MA 3DTKA 4IL6C 1ULYA 1PUEE 3FWEA 3Q3SA 4X6AJ 1VQ8I 1VQ6I 1NG7A 2DT5A 3B02A 4UVBA 3CO7C 1FOYA 1IJWC 1WH7A 3FXUA 4BACA 3JRBA 1F1ZA 5CLSA 4DYCA 2V6EA 2ZO4A 3S32A 2CFOA 1SVMA 2FA5A 2J5PA 3KPHA 3R0AA 4AVPA 3S2WA 1IXSB 5CVJA 1HF0A 5CW8A 5D8LB 5K58A 1P9QC 4FCYA 5J1UA 2OC6A 3SZPA 3TDUC 2OERA 1D1BA 1R1TA 2HZDA 4B44A 1JJ8C 2DMPA 3FM3A 2Q2EB 3ISPA 3H3ZA 1U3EM 3QYBA 3I4PA 2QEXI 1I1SA 4IKFA 3DTIA 3HOUJ 2R7QA 1R6RA 2XC7A 4HG2A 4G6TB 4Y3OA 2CWEA 1X4OA 1KQ9A 1B9MA 3TP0A 4AVZA 3VW1A 4IX7A 1OISA 1W1WE 2HOAA 1Z9CA 4GCKA 2EBIA 3M3YJ 3OYFA 1KU7A 2Q1ZB 3BZKA 3BG5A 3GZ5A 4EATA 1TWHJ 1Y8RB 2MH9A 3CJRB 1P4XA 2IS6A 4JK1X 2IXSA 1S6LA 3L2QA 3KP7A 2IA2A 1IUFA 2P6TA 5TRDA 1FMWA 2ZXHA 3DU5A 3ZQHA 5DM7F 3O8HA 2OBPA 3J7AY 2VE8A 3A0BC 3IP4B 1MJBA 4A0YA 1ZELA 3HOVJ 1AOYA 2KJCA 3QWLA 3CJQB 1QGPA 2IA1A 2XROA 2CW8A 2HS5A 3G7RA 3JREA 4H0EA 2FBQA 5H9TA 3QP6A 5B66C 3MFKA 1OCTC 4M9XA 2VASA 5A2QK 4A0ZA 3EYYA 2K5CA 2EB7A 1QVTA 5D8KB 3A01A 1KONA 3VSKA 1ZGJA 2JN6A 3KETA 1GVDA 1O57A 2WV0A 4UVCA 2Y75A 1XD7A 2XIGA 3GYHX 1XB4A 3IL2A 2MC4A 3UNGC 4EGZA 3S1RJ 4XLHA 5F0FA 1HKTA 2Z5UA 2DFEA 3G1MA 1VQKI 3BPXA 2DMQA 2KJBA 1XGOA 2V1XA 2GOXB 2M7AA 2E7XA 4Y33A 5J1YA 4HW0A 1W7PB 2ESNA 1OKRA 2NS7A 2Q24A 4AUXA 3ZXSA 2VOPA 3VOEA 2PMZA 4ITVA 3WTTC 2W7NA 3FF5A 4AC0A 3WTVC 2EWNA 5LHHA 2DA4A 3AQSA 5E1XA 1BN5A 2TRTA 3BTCA 3K4LA 3E6MA 1IXCA 1UFMA 1YQAA 2ZCXA 1I50J 3S3OA 4LG3A 3GTPJ 3GTOJ 1E3OC 4D9JA 3MKZA 3OR1C 4I01A 4Y15A 3JRCA 5GTHC 4CCLA 1BJAA 1E3HA 1MNMC 4WXCA 1FIAA 3GZNB 3D5RC 2B0LA 3NAUA 2WB1N 3PASA 1APLC 4Q5SF 2MC3A 3ZGKA 2Y30A 2X85A 1YW8A 1U8BA 3L00A 2BYVE 4WXDA 2V1NA 1JJ6C 1TLHB 2H8RA 1GHCA 1MH4A 1UHSA 3TOAA 1Z1DA 1BOBA 4JQFA 3W6KB 1ON1A 1TBXA 4IRGA 1FJLA 2AQEA 2TCTA 5HOOA 2DQLA 1HC8A 3QPSA 4Q4ZF 3RKQA 3COLA 3DKXA 5HLTA 3LA7A 1P7IA 1TZLA 1IO2A 1XSXA 4D5CA 1BC7C 1WJBA 3HGGA 1UB9A 4M71A 1J9IA 3V7SA 2K3FA 2DPUA 2EZKA 4DW6A 2XAQA 4CO8A 4BYYA 4NBQA 5FRNA 2B63J 2YR2A 1FOXA 3BQZA 5C3EJ 2M5WA 4MLOA 3E6CC 1ZARA 4BNCA 4D0PA 2FE3A 5IT9K 4CCMA 4IQJA 4AIJA 2EZLA 4WXHA 1J75A 5IPAA 1BC8C 3DKWA 3VOXA 4S05A 4LG0A 4ZZLA 2P7CB 3H5RA 3PNVA 2FQ4A 2GENA 1XSVA 2FMYA 3I59A 4A5MA 5KHDA 2YU9J 5FLMJ 1G59A 4ESJA 3CJNA 5E17F 5D5XB 1VI0A 1ZQ3P 2V9PA 3ZQQA 1K4TA 4BGDA 4MGRA 4LB6B 2VODA 1MBGA 2BXZA 1JGGA 4E7ZA 1LFPA 2R5YB 3T6NA 3BR1A 2DAOA 2IGNA 4HRIA 3KZYA 5E8GA 2MW8A 1WJFA 1X2NA 2CV0A 4HA8A 2RQQA 2ZNYA 4C3IJ 5IP6A 1QPMA 4M9SA 3DEEA 3W3CA 1IRZA 2DCEA 5JLWA 1R5HA 2Y0SN 1P6RA 2EJRA 2FMLA 2IT0A 2KLOA 1FYKA 5EG0A 3GMEA 3OL4A 4C9YA 2X6OA 1J7KA 2DA6A 2FUG2 1WSUA 1YTYA 2HYGD 3I4NJ 2QA4I 4CA0A 3ULQB 3ZQFA 1ZG3A 1P2FA 2IEKA 3K4BA 4O6JA 2RVCA 4XRFA 2JA2A 4OAYA 4BEHA 3H0GJ 1QZEA 4B4CA 1RESA 1K78B 2DT6A 4KT5C 4A3IJ 2KIMA 4C3JJ 5M3FJ 1KA8A 1I39A 2W00A 4B09A 2ZY9A 2A6TA 1FIPA 3AL0C 1I3AA 3AAFA 3KYCB 3AQTA 3MKLA 1RRJA 1DPRA 3FXMA 5B5EC 3BCBA 2MD5A 3RIRA 1V3FA 2XB5A 2Z99A 2ZJPF 1F43A 2RASA 2ZSIB 4L9VA 5DYMA 1U6GA 3A01B 4LK0F 3G56A 1JUMA 3U21A 4BU2A 2A2FX 2X48A 3SFZA 3ZMZA 2FQ3A 2BEOA 3CCUI 4L9NA 2R7RA 1EA3A 1HQCA 3U9GA 4D7MA 2PEXA 3FDYA 1V54H 2RV8A 4FX4A 1I6HJ 2LDUA 5EEGA 2L7MP 5D6EA 2HDDA 4B1RA 3N05A 4BE0A 3OS2A 3CO6C 2K85A 3GLLA 4UNOA 1YS6A 4KT6A 2VKEA 4M74A 3RSNA 1U9NA 3PQJA 1TQPA 2J5OA 2VKHA 2VXZA 2OJED 5E1WA 4EJVA 4CCOA 1YFHA 2AO9A 1X3UA 2HWVA 3OSGA 1TWAJ 2PI0A 1YIJI 3OS1A 3CCJI 2K4JA 3VEPA 2E1MC 1STZA 2KL4A 1UHMA 1N75A 3OOPA 3GTQJ 2GIVA 3M07A 2EA2A 2ID3A 1XDSA 4GRIA 1LKXA 3SZGA 1JKQC 3VIBA 3H9GA 1Y1WJ 2UZKA 1JKRC 3CC2I 2L3DA 2VJ4A 3S14J 2E36A 5K7HA 2Z3YA 4LITA 1DU0A 2PN6A 1TL8A 4HV6A 1K61A 3IV5A 5FRMA 3WGHA 4I7HA 2CQ7A 2KDZA 4PJLA 2EFWA 3J7YJ 1YRNA 4XMYA 4XLEA 4XLAA 1ETWA 1YRNB 2VB6A 2YU3A 3OYDA 2LBFA 3CF5F 1T38A 1QNTA 4PUSA 1XC5A 3ABTA 2OF7A 1BI1A 5F1JA 4E7JA 3K1PA 4MXMA 4XRMA 2VUMJ 2E7WA 2JUGA 2EFPA 4QPQA 5E18F 5EGOB 1JT6A 1R00A 3RQIA 4XIDA 5GAHJ 2M2EA 5EGOA 2P5LC 2KDOA 2L9NA 5DCFA 3OYIA 3LFUA 4XRSG 1R58A 4OINF 1A5JA 2DG8A 1L3LA 2EV0A 2DJIA 2V9KA 1WJAA 3FM5A 4PSXA 4QIWN 3CRJA 1ZGWA 3M7GA 1UI5A 1T6SA 1TW2A 5FD5A 5KNLA 3DPLC 4B48A 2XKOA 1USTA 4C2UA 1NG6A 1OCOH 1RPWA 2DA5A 2XSJC 1MMSA 5K5QA 1OCCH 2CH0A 3KFWX 1IRGA 2OCCH 4RB2C 3H0DA 3CCEI 3PUBA 3O60A 4BE1A 2CQKA 2HI3A 3BZCA 1ZLKA 1YYVA 3OWTA 1QHGA 1FX7A 1XPXA 4XRSA 1XCVA 2HFHA 1YLFA 2KRHA 4PFOA 2HOTA 2C6YA 2DQRA 4A3DJ 4RLFA 3QOPA 1ON2A 2QGUA 5D5WB 4J01A 3CCRI 3TDZC 3BDDA 4Q47A 2HOEA 1D1AA 3KP4A 2ZBKA 4MEXF 2ID6A 2QCOA 2R7XA 2NXNB 1E2XA 3COAC 2MGQA 3LSIA 2OUMA 1PUFA 2VT2A 4G12A 2ISYA 3PIOF 1TC3C 4JX4A 1U5TA 5J1RA 1WPKA 1AKHB 4WK8F 1Z3YA 3OSFA 3BRUA 3HJEA 1AKHA 1BI0A 2X1EA 3LQQA 2REKA 3K1NA 2CUEA 3MZHA 5FHPA 3P9KA 4HNUA 4ZYDA 1VQPI 5AQCA 2MSYA 5DDGA 2PBXA 3A0HC 1Z3XA 2CQNA 2WTEA 2O6GE 3DPTA 1BI3A 4IQ4A 3SDGA 4UXNA 1GDTA 1Z7LA 3EDPA 4JKZA 1T95A 1H0MA 4OIQF 2Z1DA 2QVOA 3WU1B 2D1HA 1MDMA 3HKZN 4ME9A 3DF8A 4LMYA 1JUPA 1TNTA 4DBRA 1HSJA 3CMYA 2X6YA 1JTXA 1SD7A 2ZCMA 1UELB 3F8MA 5D5VB 1E17A 1NTCA 1G2HA 1NK3P 3CDLA 3BG9A 2I5UA 1F5TA 4AIKA 4ICHA 3H35A 2X4HA 3FK7A 4ZYAA 1KU9A 2NAZA 5AONA 2KISA 4YFXF 3FBNB 1R22A 4KUMA 3RZDJ 5IYBJ 4WCGA 4HBLA 4MTDA 4KMUX 3HXLA 1D0YA 5ILSA 2IS4A 1IDZA 5FKMA 2O8XA 2NVUB 3NPIA 2RDPA 2FOKA 3ZMVA 2QWWA 3DBRB 5EF6A 3H3UA 3EUHC 4BDZA 4P55A 2LKXA 2NS8A 3FBIB 3T1BA 3IKTA 1BL0A 2LNBA 3H9JA 1QA6A 1MSFC 4UHTA 2HQ5A 4NC6A 3Q9VA 5CXGA 3WG7H 2HVRA 1BR1A 1J2XA 2F4MB 3LSPA 1YW7A 1W0TA 1K79A 3ML6A 1SEUA 4ETSA 2M34A 4P96A 4CH7A 2BHYA 2Y69H 1WH5A 1IN8A 4J00A 3Q9SA 5CYVA 3VVYA 4BHBA 4XNFA 2LTPA 4RGXA 3F1BA 4NELA 3N4MA 3JAMK 1POGA 4BJ6C 1S7AA 2DO7A 3JW4A 3T8TA 3BG6A 3K2ZA 4DYQA 3I4MJ 4B47A 4CICA 3G6EI 5CVIA 1H89C 1S7OA 4NC7A 1HW1A 3NWTA 5HODA 1IG7A 4MNUA 3OYCA 3M1CA 4Y4RA 3QODA 3BJAA 3OV8A 2VE9A 2F2EA 2M45A 3CLQA 4DJAA 2EA4A 2E2IJ 3F9KA 2ZMEB 3V7RA 3H9QA 1G3YA 2A61A 2JT1A 2VQLA 1IXRC 4ZZDA 3IWFA 4MEYF 2XUBA 3WU2C 3C18A 3OOUA 4K2EA 2Y9ZA 1Z77A 1X3ZB 2YVHA 4ASNA 1ENHA 3E5QA 5HNHA 1KU3A 4C30A 3S16J 1UG0A 5F04A 4KIBA 3JSOA 1OCZH 1JE8A 3HZJA 3I64A 1O3SA 3JRDA 5J3LA 4EEFG 2LY2A 4A3FJ 5K5RA 3V78A 4YEJA 1X1CA 5H6RA 2K02A 1HCRA 2WADA 3CCMI 1K83J 2KZVA 3FMRA 5JVTA 2QQ8A 1JT0A 4OAZA 1OQYA 5J6XA 4RM2A 2FU4A 2GA1A 3ECOA 4OIRF 1FBSA 4IEJA 1GV2A 2EZHA 1TQMA 1ZRFA 2WB1A 3BROA 2GQQA 1O7FA 1SFXA 3WTWC 2BXYA 3DEUA 2A6HF 1LDKB 2M0CA 4I0AA 1R4MB 2ECCA 2DG7A 1RETA 3HTAA 1W36C 5D18A 4BKXA 2LD5A 1MBJA 2V4JC 3KZ9A 2CO5A 3P7NA 4HQMA 3WGIA 1Z6TA 3TBIA 3MVPA 2CUJA 2E19A 4YG2F 2WV1A 4IZZA 1TT5B 1E0EA 3NNRA 1U5TB 1NHAA 2VPRA 2QF7A 2R5ZB 2DK5A 1X3WB 3DQVC 2LH9A 4RBOA 5B3SH 3M4OJ 4JP0A 2VQCA 2PX9A 4IJAA 2VJ5A 4I0BA 4OOIA 3LQRA 3SXYA 1BBYA 3OYHA 3V8KA 4JBAA 3GZ6A 2CFXA 2HKUA 2W24A 1QZZA 3ZR8X 5GPAA 2A05A 3RTRA 4QLCU 4PJMA 3NI7A 4U7DA 1CQTA 3S2HJ 3C07A 3VDXA 1O7LA 5HDNA 4BQAA 4I76A 1MDMB 1DQUA 1GXQA 3SEQA 5J47A 3HSFA 3OYLA 4ENNA 2QKLB 2KT0A 2ACJA 3LSKA 3MEXA 5FKOA 1FWZA 2XVCA 4LD5A 3TMOA 4WX9A 3S1MJ 4KISA 3ANGA 3ERED 2XB0X 3KEOA 4I2OA 2Z9OA 1VQ9I 2O9LA 4QPOA 3BLYA 3TW7A 4U9NA 1WGXA 2Y0SA 3AG4H 3KYDB 4G7OF 1BM9A 1BW5A 3IUVA 1KQ0A 3NXCA 1W7PA 2GAUA 5HNFA 3AKZA 1PJRA 2FBHA 2HYJA 4N9IA 1ZG5A 3HE0A 1T0FC 4DNCA 4LGWA 3EGQA 2QSFX 4NB5A 5CQEA 1C0WA 5HLGA 1FNNA 1FLIA 3PSIA 5BS6A 2QZ8A 3A2KA 2VBZA 2E71A 5GP9A 1IF1A 5FLXK 1WQ2A 1ZLJA 1RIOH 4A3MJ 1XG1A 4XORA 2M7BA 5C4YA 3PO2J 1Z05A 1G3WA 1IAWA 3E1SA 1IRFA 3JRFA 3CCLI 1XS9A 3KE2A 4O3MA 3RKYA 5IOZA 4IVNA 2JRTA 5F1RA 4II3A 2P8TA 1FP1D 3L2UA 1XTAA 1VQLI 4GDFA 2DW4A 4JX6A 1DU6A 1ZH5A 5FROA 2D6YA 2BY1A 4LOCA 4W97A 4ACIA 1DGRM 2R3SA 1FTTA 4CYDA 3QPTA 2STTA 3TL4X 3ERMA 2MG4A 3EPZA 2W53A 1BR2A 2AXTC 3GLXA 1VQMI 3P9TA 3LNQA 3VYRB 1DP3A 5LRRA 2E5NA 2UWMA 2ZJRF 3ZQLA 3GZIA 2QQ9A 3GTMJ 2STWA 1LQ1A 4GCLA 4F92B 4UUSB 1Z67A 4YIFA 4B43A 1QHHD 2FEZA 2L4AA 2XPUA 5F6FA 3WE3A 2MYSA 4YELA 2VBXA 3OYEA 1SC7A 5LHIA 3OL3A 4A93J 4U88A 3FKIJ 4ENMA 1ODDA 2IRFG 5KK1A 4P9FA 3DLAA 2Y0MA 1MSEC 2K7LA 3B81A 4RGUA 2DMUA 4HLYA 3OIOA 2HU9A 1ZG1A 3CESA 3KNWA 2DU9A 2HXIA 4V2FA 2ELKA 4XR6A 4E7LA 2R7WA 3KX2A 2FBKA 1IGNA 2F5CA 2VL8A 2D2WA 4PK4A 3NS4A 1QPIA 4L5IA 4EGYA 3F22A 3BPVA 3QU3A 5DM6F 5HDKA 5D1RA 3SHFA 5H6QA 4EVIA 3NRGA 2M8EA 2E5ZA 2XDVA 4HZFA 3D5SC 4N9HA 4F91B 2R5YA 3M1EA 3JRHA 1UMQA 2BBYA 3HRMA 3BC8A 1X1PA 2JTVA 4BQQA 4LB5A 3BOQA 3MNLA 2HQNA 2UXHA 4LIUA 2FBIA 5ILUA 4LLNA 1NK2P 4P1WA 3J80K 3LAJA 1D5VA 3V6GA 3E97A 2LKPA 1FYMA 4G6DA 5JFRA 3DLLF 2DYSH 2EV5A 1MKMA 5LLQA 4NN1A 3HEFA 3HOSA 3M9AA 1UG2A 4RAYA 3ZMUA 4JX5A 3ZPLA 2RGVA 3RD3A 1X1AA 5LRSA 5M5YJ 1YJWI 2O61A 5F27A 4BXFA 1K78A 2BGCA 3FMQA 1VQ4I 3G4SI 2NS0A 5LD2C 3PQKA 3J7ZI 2R5ZA 2MFZA 3ABKH 2CJJA 2HYFA 3OR2C 2R7UA 2CYYA 2EPFA 3DP7A 3RCOA 1R36A 5LEKA 1FP2A 3CMEI 2WC2A 3U2RA 1FPQA 2D1VA 2PJRA 1AHDP 3PPBA 2V6CA 3W2AA 3BR2A 2JA8J 3HRTA 3QYFA 3CJDA 4A3JJ 3KYLA 5FKNA 2L0KA 3CTAA 5JVGF 2E1CA 3ZOBA 1E3PA 2HKOA 4XQFA 2YS9A 2OAZA 2LG4A 4EM1A 4F7ZA 4C2MJ 2QLZA 2H27A 6PAXA 3MQ0A 2IJLA 4B8XA 2ZOYA 1WJDA 1QZYA 2VBYA 2K40A 1VQ5I 3EQLF 3TGNA 3KCCA 2ESHA 4B3XA 2PZ9A 2UXOA 1KU2A 3TP3A 1MBHA 1N25A 1ZKGA 1ZR4A 3HRUA 4BH9A 1U2WA 3IAM2 3HTJA 5BQTA 2RC4A 2DI3A 4HAMA 3H3VK 3HPGA 3GUDA 3AG1H 1B59A 2IW5A 3RH2A 3O2PE 3IAS2 5E3OA 2ADUA 4XICA 5CVVA 2VKVA 4P5OA 4UDSA 1D8JA 3K4JA 3HIFA 2VLAA 2DPDA 1FY7A 1SD6A 2MLGA 2Z16A 2RAEA 3ZMDA 3PO3J 3GEUA 1LVAA 5LGTA 1XX5A 4A3KJ 2ISZA 3EUHA 3PUFA 3TEDA 4FETA 2W48A 4GFLA 3CJTB 1S7EA 5BPIA 3RPUD 4L5EA 1R5GA 1YOVB 4BDYA 3K0LA 2E1MB 2MD0A 1Q1VA 2FJ1A 4XKWA 4CGRA 2CUFA 4OMZA 2NP5A 5K7FA 1SGMA 4KN7X 1TWCJ 4QSHA 3HTIA 3V4GA 2HYTA 3LWFA 4DGWB 2DFIA 4XBFA 3B6CA 1ORKA 1U9OA 3PM1A 2KMUA 4OWRB 4BJTA 4EJUA 3VP5A 3HKZA 4PGGA 2IS2A 1P4WA 2BY0A 3QOEA 2PMHA 4U0YA 2GWRA 4MO7A 2GUHA 2KIQA 2K27A 2QSHX 1MBFA 1Z91A 4MFDA 3JRIA 2W1OA 2DBBA 5IY5H 1OPCA 2E2HJ 1YS7A 1G4DA 4A3CJ 3FRQA 4EJWA 5FB2A 3HGYA 2HQRA 2XF6A 5JLXA 2X51A 3JSPA 3E0JB 5L3BA 1MMGA 3EYIA 1ETXA 1UAAA 4X0GA 3KKDA 3H36A 2PLYA 2XF5A 4RMNA 4JNNA 1DUXC 4M73A 1SANA 1Z21A 4PDKA 2QENA 2AQFA 1N78A 1HOMA 3VOKA 4NQWA 4QTRA 2FXAA 3RZOJ 4W1UA 3PJRA 2H09A 4KN4X 3I59B 2FNPA 4CZCA 2IGKA 4RGRA 3QKXA 2CU7A 4G6QA 3RKWA 5GAGJ 2CV2A 2XRNA 3RPQA 5CPRB 2F5EA 4HF1A 1YITI 2UXXA 3FISA 3PL8A 3TOBA 3DEWA 2HPIA 3I3LA 3OIPA 4LJZF 3HL2A 2QIBA 3J81K 2JSCA 2OPTA 2AXLA 3KEYA 1Y6IA 2CG4A 3BJ6A 2KFDA 3JTHA 1S9HA 4DYRA 5CXIA 2DXIA 2MA3A 1Q1HA 5EG0B 2PJPA 2IP2A 4G7HF 3EUPA 1USSA 3GFJA 1JHHA 4D1QA 1XMKA 3HTSB 1T08B 3ABMH 2DA3A 1O3TA 2KHMA 4MIMA 4ENJA 3OYKA 1H8AC 2XSDC 2JSPA 4M72A 3BCGA 3FKJA 5DD8A 3V42A 2ELHA 3HOYJ 2RHAA 5ILVA 3JRAA 2O0YA 1IN5A 1X1DA 5TJJA 3GVAA 2HKXA 3J7AO 2V57A 1BI2A 4ZTFA 5DTDA 2ELJA 5D5UB 4MHGA 3HB9A 3CF2A 2GOMA 1WVRA 1XDUA 2EK5A 5HSZA 2O7OA 4GFKA 2PJRB 4UUVA 2QQBA 4RS8A 2L4MA 3ZQIA 1NH3A 1FSEA 5C4JJ 2QBYA 2TDXA 2AHQA 1F36A 3S17J 4CDGA 3SEZA 4P9UA 4IPAA 1JXSA 2HVSA 2FNAA 2VJJA 1YW9A 2L5QA 1WJCA 3L2CA 1X58A 1SVLA 1YJ9I 3CP8A 3HM5A 4R8HA 1QQIA 1LFBA 1MNDA 3OYJA 3L1PA 2CMPA 4XM3A 3T5XA 3EUAA 1F9NA 1K7AA 2KP6A 3S8PA 4RB1A 1QRYA 2WAQN 2EILH 2GBYA 1LUJB 1SFOJ 2VI6A 3BT9A 2DMTA 5BMZA 1T56A 4HQEA 1L0OC 4S04A 1FEXA 4MFEA 2ZCWA 1IN6A 2FOWA 1JKOC 3DU6A 1ZTRA 1LE8A 4AYBN 2DJNA 1S8NA 4KIGA 5IT9Z 3I56I 3M8EA 2I8DA 3FXJA 5EEAA 4V19K 3OYNA 2K4BA 3KZZA 3K69A 4RAZA 1IZ1A 2JPBA 1SMTA 3DKYA 3CWRA 1HW5A 4GCVA 4MQVA 3Q0UA 1J59A 1QO0D 4FQGA 1B1BA 1WJEA 1G3TA 4OU0A 3HDDA 3S15J 3BG3A 3VUQA 1XSDA 3HOZJ 3JRGA 5HLIA 1HKSA 4S0HB 2Q8KA 1T8IA 1AA7A 5IYCJ 3WTXC 2R7TA 5DUIA 1ETYA 2LK2A 3IH3A 4CSWA 2AS5F 2OTJI 1IC8A 2BVMA 3GXOA 1EH7A 2LY9A 4L18B 4OMYA 1VFCA 2P5VA 4EQQA 1WI9A 3PSFA 4JYKA 2M0MA 1YI2I 1LNWA 4M6XA 5TISC 4HOBA 1V55H 2XRLA 5ICFA 3JSJA 2COMA 1T39A 1FZPB 2UUZA 2O3FA 4EM0B 1HW2A 3G71I 2EH3A 3K7AJ 1OFCX 4KJZA 1Y0NA 5EJCA 4F3QA 2E2JJ 2JVGA 2DT7B 2M1BA 5L3EA 3P5JA 2L9RA 1R7JA 1UCRA 3HHGA 4G8XA 1B8IA 5E3LA 1G3SA 4GCTA 2JVHA 3SZTA 2IPQX 2EIMH 4AF5A 2BZTA 1T2KA 1B72A 1W5SA 2HXOA 2HR3A 2VJIA 1RKWA 3CC4I 1RNLA 4NQWB 2X0LA 2GZWA 3DPJA 3OYGA 3JR9A 2VIXA 4A3LJ 2HDCA 3IH4A 3VYUB 3SJMA 2ZFUA 4IOCF 2K9LA 1OR7A 1J5YA 2ETHA 1FBUA 2UXPA 3TW6A 4M3EA 1YX5A 3OYBA 1K6OA 1LVKA 2NOJB 4FT8A 1RZ4A 2BY2A 3M8FA 2EIKH 2M4KA 4GYGA 3K6GA 3TO7A 3R0JA 1AWCA 4Y52J 4KYWA 3QAHA 2JJ7A 3FXLA 4EV0A 5J4YA 3G1OA 3WTSC 3HOTA 2M30A 4M6VA 3I55I 2GIZA 3I0TA 4HSRA 4DBQA 2F07A 4RB0A 1LEAA 3K8PC 1IW7F 3VTIA 1QBJA 4HNTA 1A31A 1A36A 5FKKA 3KIOA 2X1DA 2MLKA 1YHQI 2CW7A 1BIAA 3GFIA 5KVRA 5HBUA 2ZXWH 3KZIC 1TQIA 2CQXA 3KP3A 2QYOA 3DBLB 2ME0A 3VYSB 3ZMTA 3MKWB 3OMYA 3A4CA 1J09A 5IT3A 1U0JA 5FFXA 2XAJA 3BR0A 2JZYA 2F4OB 1D1CA 3QBMA 4BXXJ 3FMSA 1RKTA 1MGTA 4IHYA 1XCBA 4XSXF 2X1CA 2XKPA 2GXBA 3FHNA 1Z0XA 2R7DA 5L3GA 2HGCA 5HDGA 1X19A 3KP5A 1WI3A 5CQGA 3IRQA 2ICWG 3BY6A 3LSHA 4CXFA 3HOWJ 3F8NA 1WHUA 2P5KA 4U87A 5JHFA 1ZREA 2NOGA 4DOZA 3R61A 5J8FA 4EM2A 2COBA 4XONA 1XGSA 3QPHA 2EIJH 4YZEA 3NARA 4HLXA 2IS1A 2YVXA 1V4RA 2KIFA 2Q2EA 1YIOA 2VBWA 2UXIA 3I53A 3PIPF 5E3MA 4IHWA 5CJ9A 1R71A 2CUZA 1IV6A 2GFNA 4HYEA 1ZAOA 3K70C 3A02A 4ZC3A 3C7JA 3HG9A 3LA3A 1UZCA 1FYLA 3MCZA 1WKMA 2L54A 3L9FA 3GBGA 1SAUA 4I02A 4I99C 2WA0A 3CQZJ 3TKYA 3QQAA 3OYMA 1MW7A 3KEQA 4BY1J 4LLGF 2R7VA 4BXUA 1H88C 2P0WA 1P92A 1W7PD 3LJLA 4PXIA 2K9SA 2EV6A 1RUOA 1G8XA 3KKCA 4BY7J 2A68F 2F5VA 3VVZA 3GTJJ 4UVAA 2QTQA 1TWFJ 3V8LA 4KICA 1S3JA 3HIMA 1CF7B 2JWTA 4BBRJ 3C2BA 4OD4A 1GXPA 3MWMA 5IP9J 3HTHA 2KKOA 1CF7A 4R1HA 5FD6A 3H92A 4ENKA 1K4SA 1FT9A 3D0SA 3CMMA 1FOKA 4YFKF 3HC7A 3RPUA 1GV5A 2F6CA 1GT0C 4B3AA 4QWQA 3KP2A 4M3FA 4RAGA 1BW6A 5KAIC 2KQRA 1MMAA 1MBKA 4UB6C 4XKBA 5JI6A 4GFBA 2X6WA 5F64A 3L7WA 5EZGA 3G1LA 3O8GA 1RC9A 3DPUA 2V1DA 4RLQA 4DZJA 2P6SA 4IHTA 4CZZA 2B9SA 5IYDJ 3BG7A 5DUKA 2LKSA 4XLCA 3C1DA 4XKVA 2BOLA 3ZMSA 4ZYGA 1TP4A 2DMNA 4PFPA 3GEZA 4XK4A 1UHWA 1CGPA 3ELKA 3ZN1A 1B72B 3ABUA 3P9IA 2XF7A 5LGUA 3WTYC 3GTGJ 2M4GA 1PYVA 4DIQA 4RM3A 4XLPF 1FBQA 4HX8A 1TW3A 4I6ZA 5E20A 3KLNA 2IA0A 1HLVA 1P7JA 2QOPA 3L2WA 3VW2A 4KDPA 3K2AA 3SDBA 1V5FA 4RDUA 4L62A 5CVRA 1ITYA 2IBDA 3VPRA 2WAFA 3J80Z 3WTZA 4U9LA 3DV8A 3K9TA 1O3RA 4LFUA 2CW0F 3K4KA 2Z2SB 4JOMA 3CD6I 1XGMA 1S5LC 2P7VB 2DOAA 5LFAA 3R60A 3WE2A 3LSGA 3SQNA 2DLLA 2V79A 3HBLA 2DOEA 5K5OA 1QVUA 2G9WA 2LRDA 2NNYA 1N77A 2O7TA 3CP2A 1ETQA 3I58A 1D8KA 5LGNA 2P4WA 4BJ5C 4BUPA 1XMXA 2Y48A 2WUIA 3E5XA 1D0ZA 2FRHA 1R1VA 1GVJA 2I10A 2Q0OA 2ZXJA 3VWBA 4JL3A 5FLXZ 1JI8A 2HQAA 2LVSA 2DTRA 2W4SA 4O5VA 3LSJA 5EDNA 3S3MA 1JGSA 4RAFA 2LP0A 1A6IA 4GGGA 1IRXA 3I9V2 4FE7A 2Y2ZA 3TO9A 4ZDOA 3RKXA 2VC0A 2OTLI 2O8KA 2ZCNA 4CHUA 3SFIA 4BL0B 1KQ8A 3LAPA 3TQNA 1MMDA 1LDJA 5BNGA 1BR4A 1OR7C 2XGEA 4LK1F 5TGTA 3ANPA 2G7LA 1HXDA 3A03A 3DXJF 3PNTA 4H4KC 2ZFWA 3MZ8A 5DAJA 4CCKA 4ZYHA 2DFFA 3V7CA 4MK6A 1K6YA 3E3VA 5ERIA 2NVTJ 2XAHA 3HHHA 2FSWA 2W82A 2G7GA 2WAQA 2CS3A 2R7ZJ 5FKLA 4Y13A 2QSGX 2GLOA 4KFCA 3QYEA 3ABLH 3LSRA 2R93J 2ZNZA 4AD9A 2V1UA 2CQQA 2PFBA 4KA4A 4HDVA 4A12A 2LMDA 4KNYA 4HNVA 3WODF 2JRMA 2DA7A 4ZDPA 2YX4A 3CCSI 1D0XA 3E7LA 4WWCA 2D5VA 4AYBA 5J8CA 3OS0A 5KCMA 4YRVA 3T8RA 3S93A 2JUCA 4XOTA 4IRIA 4LIVA 5DD4A 3BTIA 4ANJA 2MBFA 5GAEJ 1U5TC 2CGPA 5LEJA 5B1AH 3BTLA 2VXDA 3QP5A 3BR6A 4BE2A 1MMNA 3LOCA 5ED4A 2DOFA 5DS9A 3NWSA 1B4AA 3GFMA 4N0BA 1MNEA 3MMYB
chains in the Genus database with same CATH topology
1G2HA 4IHVA 1NK3P 3CDLA 3BG9A 2QIBA 4ICHA 2L7ZA 3FK7A 2OPTA 4DYRA 1X2MA 4V2GA 5CXIA 2M9HA 3RZDJ 5IYBJ 5EG0B 1ETOA 1GUUA 3Q3SA 1IDZA 3EUPA 5FKMA 4X6AJ 2XPVA 3NPIA 1VF9A 2G3BA 2ECBA 3ON4A 1IJWC 1WH7A 5EF6A 2DA3A 3JRBA 4DYCA 2LKXA 4MIMA 2NS8A 1H8AC 2XSDC 1BL0A 3B6AA 3BR5A 3BCGA 1MSFC 1HF0A 5CW8A 2HQ5A 3BQYA 5K58A 3HOYJ 2RHAA 4FCYA 5J1UA 5CXGA 3QPLA 3JRAA 3LSPA 2OERA 1HDPA 1W0TA 1JJ8C 2V57A 2DMPA 2M34A 2JMWA 5DTDA 3VVXA 3HB9A 1WH5A 3VVYA 3HOUJ 3ON2A 2LTPA 5HSZA 2ME6A 2GM4A 2O7OA 3F1BA 4GFKA 4NELA 3ZQIA 3TP0A 3VW1A 2P81A 1POGA 5C4JJ 2HOAA 4GCKA 2AHQA 2ZB9A 1F36A 2EBIA 3M3YJ 3S17J 4DYQA 3I4MJ 3W6VA 3BG5A 1H89C 1TWHJ 5HODA 1IG7A 1TWGJ 1X58A 3HM5A 1IUFA 1LFBA 3L1PA 3ZQHA 3O8HA 5F0CA 4X1EA 3HOVJ 2E2IJ 1QRYA 2WAQN 2GBYA 1SFOJ 2JA5J 3JREA 2FBQA 3G7RA 2VI6A 5H9TA 1OCTC 3BT9A 2DMTA 3F0CA 5FGLA 1IDYA 1T56A 1U78A 3OOUA 2Y9ZA 3VW0A 1Z77A 1QVTA 3A01A 1FEXA 4MFEA 3LWJA 2YVHA 1ENHA 5HAWA 5F08A 1JKOC 3S16J 5F04A 1ZTRA 1LE8A 2JN6A 2XPWA 4AYBN 1GVDA 2DJNA 2JK3A 5E3NA 3JRDA 5J3LA 4EEFG 5EEAA 4A3FJ 3V78A 1HCRA 2L7FP 3FK6A 1K83J 1JT0A 3S1RJ 3WHCA 3CWRA 5F0FA 4A3EJ 5FLVA 3Q0UA 4IEJA 3G1MA 1GV2A 2DMQA 2EZHA 3HDDA 3S15J 3BG3A 4DZPA 3VUQA 5C44J 4BBSJ 3HOZJ 3JRGA 3ZQGA 3ZQCA 4S0HB 3FIWA 5J1YA 1R9TJ 5IYCJ 2M0CA 2NS7A 2Q24A 4AUXA 4KWAA 1ETYA 2ECCA 2LK2A 3IH3A 4AC0A 1RETA 2DG7A 3HTAA 5GPCA 1IC8A 2DA4A 5EFYA 3AQSA 5D18A 2TRTA 4BKXA 2LD5A 1MBJA 2LY9A 3BTCA 5FJ8J 3KZ9A 2Y31A 1VFCA 3MVPA 4JYKA 4FISA 2ZCXA 1I50J 2E19A 1OCPA 2WV1A 4CYCB 3NNRA 3GTPJ 3GTOJ 1E3OC 2XRLA 3JSJA 5D19A 4CYCA 2VPRA 3DCFA 2QF7A 3JRCA 2R5ZB 1MBEA 2CRGA 2EH3A 3K7AJ 1OFCX 4RBOA 1MNMC 1FIAA 4JP0A 3M4OJ 2E2JJ 3NAUA 3PASA 2WB1N 1APLC 2G0EA 1ETVA 2Y30A 2L9RA 1W0UA 2HKUA 1B8IA 2JA6J 1U8BA 5E3LA 1JJ6C 2H8RA 4GCTA 1MH4A 1UHSA 4AF5A 5GPAA 1FJLA 3NI7A 1CQTA 3S2HJ 3C07A 1B72A 2TCTA 2HXOA 2IAIA 1RKWA 3QPSA 3DPJA 4I76A 3RKQA 3COLA 3JR9A 4A3LJ 2K9NA 3IH4A 1P7IA 3SJMA 1PUFB 4D5CA 2KT0A 2UXPA 3TW6A 4M3EA 5FKOA 3HGGA 1EF4A 2EZKA 3S1MJ 3ANGA 4D7NA 4DW6A 2XB0X 3Q0VA 2B63J 4Y52J 3BQZA 5C3EJ 4MLOA 5FMPA 2JJ7A 2O9LA 4IHXA 3TW7A 1WGXA 3G1OA 3IUVA 2EZLA 1BW5A 5IPAA 3NXCA 4M6VA 3VOXA 2HYJA 1O4XA 3HE0A 2F07A 3UKGA 3EGQA 2JA7J 2NX4A 2FQ4A 5FKKA 4C3HJ 2GENA 2YU9J 4D5FA 5FLMJ 2LFBA 5GP9A 3LHQA 5F0HA 5HBUA 1VI0A 1ZQ3P 4A3MJ 2CQXA 1XG1A 3D1NI 1MBGA 2ME0A 5C4YA 1JGGA 3PO2J 2R5YB 3T6NA 3JRFA 3BR1A 1XS9A 5M5XJ 2MW8A 3BR0A 1X2NA 5IOZA 3QBMA 4C3IJ 5IP6A 4BXXJ 1T33A 1IRZA 1RKTA 5JLWA 2LR8A 2Y0SN 4JX6A 4M3BA 4IHYA 1DU6A 9ANTA 3BNIA 5EG0A 2D6YA 2PMZN 4LOCA 4W97A 4ACIA 2X6OA 2DA6A 1FTTA 5EYRA 1Z0XA 3I4NJ 3ZQFA 1WI3A 2YUSA 3BR3A 2IEKA 2MG4A 2NVXJ 3HOWJ 2W53A 3P9TA 3H0GJ 3LNQA 4ABZA 1MH3A 1RESA 4B4CA 2WGBA 1ZR2A 4A3IJ 3ZQLA 4C3JJ 2NOGA 5M3FJ 3GZIA 3GTMJ 3GTLJ 1LFUP 4GCLA 2COBA 3S1NJ 1RR7A 4UUSB 1FIPA 2XGDA 3NARA 4YZEA 3AQTA 3MKLA 2UXIA 2XPUA 5EZHA 4IHWA 5E3MA 1JUSA 2XB5A 1F43A 2RASA 1IV6A 4A93J 2GFNA 3FKIJ 3A01B 3G56A 3A02A 1JUMA 2X48A 1MSEC 3B81A 2DMUA 1UI6A 3GBGA 3OIOA 3CQZJ 3QQAA 4D7MA 1WCMJ 3KNWA 2HXIA 4V2FA 2ELKA 4BY1J 1H88C 1I6HJ 1IGNA 2L7MP 2HDDA 3LJLA 4PXIA 2K9SA 4B1RA 2FX0A 1QPIA 1BJZA 3KKCA 3IH2A 4BY7J 2VKEA 3VVZA 5D1RA 1U9NA 3GTJJ 2QTQA 1TWFJ 3NRGA 2H1KA 2R92J 2R5YA 3HIMA 2LLKA 2JWTA 2AO9A 3C2BA 4BBRJ 3JRHA 1UMQA 5IP9J 3HTHA 3OSGA 1TWAJ 4A3BJ 2YVEA 3MNLA 2R0QC 2UXHA 4A69C 1NK2P 3BHQA 3V6GA 3GTQJ 1GV5A 2ID3A 4B3AA 1GT0C 2G7SA 4M3FA 4NN1A 3HEFA 1BW6A 5M5WJ 1UG2A 1JKQC 4JX5A 3VIBA 1MBKA 1Y1WJ 1JKRC 3RD3A 5M5YJ 4GFBA 5F27A 1Y1VJ 5EZGA 2K9QA 3S1QJ 3G1LA 3O8GA 3S14J 2R5ZA 5K7HA 5C4XJ 2NP3A 3MN2A 4DZJA 2CJJA 1DU0A 1BA5A 4M3GA 1K61A 3IV5A 5IYDJ 2DA1A 2KDZA 3WHBA 1YRNA 1AHDP 3PPBA 1ETWA 1YRNB 1ETKA 2DMNA 4XK4A 3BR2A 1VNDA 1LE8B 2JA8J 1B72B 3GTGJ 3CJDA 4A3JJ 2IU5A 5FKNA 2L0KA 1XC5A 3ZOBA 1D5YA 4I6ZA 2XGCA 2YS9A 2OI8A 2OF7A 1HLVA 5F1JA 1P7JA 3GTKJ 2QOPA 3VW2A 2ZOZA 4MXMA 3K2AA 4C2MJ 4XRMA 4RDUA 2VUMJ 4L62A 5EGOB 1JT6A 2ZOYA 2EZIA 2E1OA 2IBDA 2DN0A 3RQIA 4XIDA 1ITYA 2K40A 2M2EA 5EGOA 4J19A 3VPRA 3HOXJ 4FTHA 2PZ9A 4XRSG 2UXOA 3TP3A 3E7QA 1MBHA 1ZR4A 1ZKGA 1A5JA 2DG8A 2M8GX 4FE4A 4QIWN 3HTJA 3CRJA 2DTZA 1ZGWA 1UI5A 3H3VK 4UUTA 3Q0WA 2DA2A 1RPWA 3RH2A 2DA5A 3BTJA 5E3OA 2Y9YA 3LSGA 4XICA 4UDSA 2VKVA 3BJBA 3HBLA 3O60A 1QVUA 5K7ZA 2O7TA 2HI3A 1ETQA 5IP7J 4Y7NJ 2RAEA 3PO3J 3GEUA 2QKOA 2WUIA 4A3KJ 4NDLA 2I10A 4A3GJ 4XRSA 3S5RA 4JL3A 3TEDA 2W48A 2LVSA 4GFLA 3LSJA 1S7EA 5EDNA 2LP0A 1A6IA 4HKUA 4L5EA 4FE7A 5M3MJ 3CCYA 2FD5A 2Y2ZA 1B8IB 2HOTA 4A3DJ 4AC6A 1Q1VA 2FJ1A 2O8KA 2ZCNA 4CGRA 2CUFA 2NP5A 5K7FA 3S2DJ 2EQRA 3SFIA 1SGMA 1TWCJ 4QSHA 2QWTA 3HTIA 2HYTA 2ID6A 2QCOA 5BNGA 2XGEA 2MGQA 3B6CA 1ORKA 1U9OA 3PM1A 3ANPA 3VP5A 2G7LA 3A03A 1PUFA 4G12A 5DAJA 1TC3C 1ZK8A 4JX4A 4MO7A 2GUHA 1MBFA 4MFDA 5J1RA 1WPKA 3JRIA 4M3DA 1AKHB 2UXUA 4MK6A 3OSFA 2NVTJ 3BRUA 1AKHA 5IOYA 2G7GA 2E2HJ 2R7ZJ 4A3CJ 2REKA 3FRQA 5FKLA 2GLOA 2CUEA 3HGYA 2R93J 3LSRA 5FHPA 5AQCA 5JLXA 2HOSA 2MSYA 2PBXA 1ETXA 2CQQA 1I3QJ 4HNVA 3KKDA 3SDGA 2DA7A 4JNNA 2XDNA 1SANA 1GDTA 1AU7A 3E7LA 2D5VA 2NVQJ 4JKZA 3VOKA 1HOMA 1HDDC 4QTRA 3HKZN 4ME9A 2N8GA 3RZOJ 4W1UA 1JTYA 1JUPA 3BTIA 1OJLA 3CMYA 1JKPC 1JTXA 3QKXA 2CU7A 2NVYJ 2ZCMA 3BTLA 3BR6A 1FTZA 3LOCA 5DS9A 1NTCA 3FISA 3DEWA 2X9DA 4UUSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G2H A;  4IHV A;  1NK3 P;  3CDL A;  3BG9 A;  2QIB A;  4ICH A;  2L7Z A;  3FK7 A;  2OPT A;  4DYR A;  1X2M A;  4V2G A;  5CXI A;  2M9H A;  3RZD J;  5IYB J;  5EG0 B;  1ETO A;  1GUU A;  3Q3S A;  1IDZ A;  3EUP A;  5FKM A;  4X6A J;  2XPV A;  3NPI A;  1VF9 A;  2G3B A;  2ECB A;  3ON4 A;  1IJW C;  1WH7 A;  5EF6 A;  2DA3 A;  3JRB A;  4DYC A;  2LKX A;  4MIM A;  2NS8 A;  1H8A C;  2XSD C;  1BL0 A;  3B6A A;  3BR5 A;  3BCG A;  1MSF C;  1HF0 A;  5CW8 A;  2HQ5 A;  3BQY A;  5K58 A;  3HOY J;  2RHA A;  4FCY A;  5J1U A;  5CXG A;  3QPL A;  3JRA A;  3LSP A;  2OER A;  1HDP A;  1W0T A;  1JJ8 C;  2V57 A;  2DMP A;  2M34 A;  2JMW A;  5DTD A;  3VVX A;  3HB9 A;  1WH5 A;  3VVY A;  3HOU J;  3ON2 A;  2LTP A;  5HSZ A;  2ME6 A;  2GM4 A;  2O7O A;  3F1B A;  4GFK A;  4NEL A;  3ZQI A;  3TP0 A;  3VW1 A;  2P81 A;  1POG A;  5C4J J;  2HOA A;  4GCK A;  2AHQ A;  2ZB9 A;  1F36 A;  2EBI A;  3M3Y J;  3S17 J;  4DYQ A;  3I4M J;  3W6V A;  3BG5 A;  1H89 C;  1TWH J;  5HOD A;  1IG7 A;  1TWG J;  1X58 A;  3HM5 A;  1IUF A;  1LFB A;  3L1P A;  3ZQH A;  3O8H A;  5F0C A;  4X1E A;  3HOV J;  2E2I J;  1QRY A;  2WAQ N;  2GBY A;  1SFO J;  2JA5 J;  3JRE A;  2FBQ A;  3G7R A;  2VI6 A;  5H9T A;  1OCT C;  3BT9 A;  2DMT A;  3F0C A;  5FGL A;  1IDY A;  1T56 A;  1U78 A;  3OOU A;  2Y9Z A;  3VW0 A;  1Z77 A;  1QVT A;  3A01 A;  1FEX A;  4MFE A;  3LWJ A;  2YVH A;  1ENH A;  5HAW A;  5F08 A;  1JKO C;  3S16 J;  5F04 A;  1ZTR A;  1LE8 A;  2JN6 A;  2XPW A;  4AYB N;  1GVD A;  2DJN A;  2JK3 A;  5E3N A;  3JRD A;  5J3L A;  4EEF G;  5EEA A;  4A3F J;  3V78 A;  1HCR A;  2L7F P;  3FK6 A;  1K83 J;  1JT0 A;  3S1R J;  3WHC A;  3CWR A;  5F0F A;  4A3E J;  5FLV A;  3Q0U A;  4IEJ A;  3G1M A;  1GV2 A;  2DMQ A;  2EZH A;  3HDD A;  3S15 J;  3BG3 A;  4DZP A;  3VUQ A;  5C44 J;  4BBS J;  3HOZ J;  3JRG A;  3ZQG A;  3ZQC A;  4S0H B;  3FIW A;  5J1Y A;  1R9T J;  5IYC J;  2M0C A;  2NS7 A;  2Q24 A;  4AUX A;  4KWA A;  1ETY A;  2ECC A;  2LK2 A;  3IH3 A;  4AC0 A;  1RET A;  2DG7 A;  3HTA A;  5GPC A;  1IC8 A;  2DA4 A;  5EFY A;  3AQS A;  5D18 A;  2TRT A;  4BKX A;  2LD5 A;  1MBJ A;  2LY9 A;  3BTC A;  5FJ8 J;  3KZ9 A;  2Y31 A;  1VFC A;  3MVP A;  4JYK A;  4FIS A;  2ZCX A;  1I50 J;  2E19 A;  1OCP A;  2WV1 A;  4CYC B;  3NNR A;  3GTP J;  3GTO J;  1E3O C;  2XRL A;  3JSJ A;  5D19 A;  4CYC A;  2VPR A;  3DCF A;  2QF7 A;  3JRC A;  2R5Z B;  1MBE A;  2CRG A;  2EH3 A;  3K7A J;  1OFC X;  4RBO A;  1MNM C;  1FIA A;  4JP0 A;  3M4O J;  2E2J J;  3NAU A;  3PAS A;  2WB1 N;  1APL C;  2G0E A;  1ETV A;  2Y30 A;  2L9R A;  1W0U A;  2HKU A;  1B8I A;  2JA6 J;  1U8B A;  5E3L A;  1JJ6 C;  2H8R A;  4GCT A;  1MH4 A;  1UHS A;  4AF5 A;  5GPA A;  1FJL A;  3NI7 A;  1CQT A;  3S2H J;  3C07 A;  1B72 A;  2TCT A;  2HXO A;  2IAI A;  1RKW A;  3QPS A;  3DPJ A;  4I76 A;  3RKQ A;  3COL A;  3JR9 A;  4A3L J;  2K9N A;  3IH4 A;  1P7I A;  3SJM A;  1PUF B;  4D5C A;  2KT0 A;  2UXP A;  3TW6 A;  4M3E A;  5FKO A;  3HGG A;  1EF4 A;  2EZK A;  3S1M J;  3ANG A;  4D7N A;  4DW6 A;  2XB0 X;  3Q0V A;  2B63 J;  4Y52 J;  3BQZ A;  5C3E J;  4MLO A;  5FMP A;  2JJ7 A;  2O9L A;  4IHX A;  3TW7 A;  1WGX A;  3G1O A;  3IUV A;  2EZL A;  1BW5 A;  5IPA A;  3NXC A;  4M6V A;  3VOX A;  2HYJ A;  1O4X A;  3HE0 A;  2F07 A;  3UKG A;  3EGQ A;  2JA7 J;  2NX4 A;  2FQ4 A;  5FKK A;  4C3H J;  2GEN A;  2YU9 J;  4D5F A;  5FLM J;  2LFB A;  5GP9 A;  3LHQ A;  5F0H A;  5HBU A;  1VI0 A;  1ZQ3 P;  4A3M J;  2CQX A;  1XG1 A;  3D1N I;  1MBG A;  2ME0 A;  5C4Y A;  1JGG A;  3PO2 J;  2R5Y B;  3T6N A;  3JRF A;  3BR1 A;  1XS9 A;  5M5X J;  2MW8 A;  3BR0 A;  1X2N A;  5IOZ A;  3QBM A;  4C3I J;  5IP6 A;  4BXX J;  1T33 A;  1IRZ A;  1RKT A;  5JLW A;  2LR8 A;  2Y0S N;  4JX6 A;  4M3B A;  4IHY A;  1DU6 A;  9ANT A;  3BNI A;  5EG0 A;  2D6Y A;  2PMZ N;  4LOC A;  4W97 A;  4ACI A;  2X6O A;  2DA6 A;  1FTT A;  5EYR A;  1Z0X A;  3I4N J;  3ZQF A;  1WI3 A;  2YUS A;  3BR3 A;  2IEK A;  2MG4 A;  2NVX J;  3HOW J;  2W53 A;  3P9T A;  3H0G J;  3LNQ A;  4ABZ A;  1MH3 A;  1RES A;  4B4C A;  2WGB A;  1ZR2 A;  4A3I J;  3ZQL A;  4C3J J;  2NOG A;  5M3F J;  3GZI A;  3GTM J;  3GTL J;  1LFU P;  4GCL A;  2COB A;  3S1N J;  1RR7 A;  4UUS B;  1FIP A;  2XGD A;  3NAR A;  4YZE A;  3AQT A;  3MKL A;  2UXI A;  2XPU A;  5EZH A;  4IHW A;  5E3M A;  1JUS A;  2XB5 A;  1F43 A;  2RAS A;  1IV6 A;  4A93 J;  2GFN A;  3FKI J;  3A01 B;  3G56 A;  3A02 A;  1JUM A;  2X48 A;  1MSE C;  3B81 A;  2DMU A;  1UI6 A;  3GBG A;  3OIO A;  3CQZ J;  3QQA A;  4D7M A;  1WCM J;  3KNW A;  2HXI A;  4V2F A;  2ELK A;  4BY1 J;  1H88 C;  1I6H J;  1IGN A;  2L7M P;  2HDD A;  3LJL A;  4PXI A;  2K9S A;  4B1R A;  2FX0 A;  1QPI A;  1BJZ A;  3KKC A;  3IH2 A;  4BY7 J;  2VKE A;  3VVZ A;  5D1R A;  1U9N A;  3GTJ J;  2QTQ A;  1TWF J;  3NRG A;  2H1K A;  2R92 J;  2R5Y A;  3HIM A;  2LLK A;  2JWT A;  2AO9 A;  3C2B A;  4BBR J;  3JRH A;  1UMQ A;  5IP9 J;  3HTH A;  3OSG A;  1TWA J;  4A3B J;  2YVE A;  3MNL A;  2R0Q C;  2UXH A;  4A69 C;  1NK2 P;  3BHQ A;  3V6G A;  3GTQ J;  1GV5 A;  2ID3 A;  4B3A A;  1GT0 C;  2G7S A;  4M3F A;  4NN1 A;  3HEF A;  1BW6 A;  5M5W J;  1UG2 A;  1JKQ C;  4JX5 A;  3VIB A;  1MBK A;  1Y1W J;  1JKR C;  3RD3 A;  5M5Y J;  4GFB A;  5F27 A;  1Y1V J;  5EZG A;  2K9Q A;  3S1Q J;  3G1L A;  3O8G A;  3S14 J;  2R5Z A;  5K7H A;  5C4X J;  2NP3 A;  3MN2 A;  4DZJ A;  2CJJ A;  1DU0 A;  1BA5 A;  4M3G A;  1K61 A;  3IV5 A;  5IYD J;  2DA1 A;  2KDZ A;  3WHB A;  1YRN A;  1AHD P;  3PPB A;  1ETW A;  1YRN B;  1ETK A;  2DMN A;  4XK4 A;  3BR2 A;  1VND A;  1LE8 B;  2JA8 J;  1B72 B;  3GTG J;  3CJD A;  4A3J J;  2IU5 A;  5FKN A;  2L0K A;  1XC5 A;  3ZOB A;  1D5Y A;  4I6Z A;  2XGC A;  2YS9 A;  2OI8 A;  2OF7 A;  1HLV A;  5F1J A;  1P7J A;  3GTK J;  2QOP A;  3VW2 A;  2ZOZ A;  4MXM A;  3K2A A;  4C2M J;  4XRM A;  4RDU A;  2VUM J;  4L62 A;  5EGO B;  1JT6 A;  2ZOY A;  2EZI A;  2E1O A;  2IBD A;  2DN0 A;  3RQI A;  4XID A;  1ITY A;  2K40 A;  2M2E A;  5EGO A;  4J19 A;  3VPR A;  3HOX J;  4FTH A;  2PZ9 A;  4XRS G;  2UXO A;  3TP3 A;  3E7Q A;  1MBH A;  1ZR4 A;  1ZKG A;  1A5J A;  2DG8 A;  2M8G X;  4FE4 A;  4QIW N;  3HTJ A;  3CRJ A;  2DTZ A;  1ZGW A;  1UI5 A;  3H3V K;  4UUT A;  3Q0W A;  2DA2 A;  1RPW A;  3RH2 A;  2DA5 A;  3BTJ A;  5E3O A;  2Y9Y A;  3LSG A;  4XIC A;  4UDS A;  2VKV A;  3BJB A;  3HBL A;  3O60 A;  1QVU A;  5K7Z A;  2O7T A;  2HI3 A;  1ETQ A;  5IP7 J;  4Y7N J;  2RAE A;  3PO3 J;  3GEU A;  2QKO A;  2WUI A;  4A3K J;  4NDL A;  2I10 A;  4A3G J;  4XRS A;  3S5R A;  4JL3 A;  3TED A;  2W48 A;  2LVS A;  4GFL A;  3LSJ A;  1S7E A;  5EDN A;  2LP0 A;  1A6I A;  4HKU A;  4L5E A;  4FE7 A;  5M3M J;  3CCY A;  2FD5 A;  2Y2Z A;  1B8I B;  2HOT A;  4A3D J;  4AC6 A;  1Q1V A;  2FJ1 A;  2O8K A;  2ZCN A;  4CGR A;  2CUF A;  2NP5 A;  5K7F A;  3S2D J;  2EQR A;  3SFI A;  1SGM A;  1TWC J;  4QSH A;  2QWT A;  3HTI A;  2HYT A;  2ID6 A;  2QCO A;  5BNG A;  2XGE A;  2MGQ A;  3B6C A;  1ORK A;  1U9O A;  3PM1 A;  3ANP A;  3VP5 A;  2G7L A;  3A03 A;  1PUF A;  4G12 A;  5DAJ A;  1TC3 C;  1ZK8 A;  4JX4 A;  4MO7 A;  2GUH A;  1MBF A;  4MFD A;  5J1R A;  1WPK A;  3JRI A;  4M3D A;  1AKH B;  2UXU A;  4MK6 A;  3OSF A;  2NVT J;  3BRU A;  1AKH A;  5IOY A;  2G7G A;  2E2H J;  2R7Z J;  4A3C J;  2REK A;  3FRQ A;  5FKL A;  2GLO A;  2CUE A;  3HGY A;  2R93 J;  3LSR A;  5FHP A;  5AQC A;  5JLX A;  2HOS A;  2MSY A;  2PBX A;  1ETX A;  2CQQ A;  1I3Q J;  4HNV A;  3KKD A;  3SDG A;  2DA7 A;  4JNN A;  2XDN A;  1SAN A;  1GDT A;  1AU7 A;  3E7L A;  2D5V A;  2NVQ J;  4JKZ A;  3VOK A;  1HOM A;  1HDD C;  4QTR A;  3HKZ N;  4ME9 A;  2N8G A;  3RZO J;  4W1U A;  1JTY A;  1JUP A;  3BTI A;  1OJL A;  3CMY A;  1JKP C;  1JTX A;  3QKX A;  2CU7 A;  2NVY J;  2ZCM A;  3BTL A;  3BR6 A;  1FTZ A;  3LOC A;  5DS9 A;  1NTC A;  3FIS A;  3DEW A;  2X9D A;  4UUS A; 
#chains in the Genus database with same CATH topology
 2H6B A;  3HSE A;  5GAD J;  4IHV A;  2WY7 Q;  4KMF A;  2FF4 A;  3O3K A;  2VQH A;  3ASN H;  3BCA A;  2DDA A;  2OZU A;  4HEA 2;  5KAF C;  2XV4 S;  3X2Q H;  2A6E F;  4V2G A;  2M9H A;  1H9G A;  3GWZ A;  1ETO A;  1SVO A;  2XAG A;  3D5L A;  1GUU A;  3J81 Z;  2BY3 A;  2L7K A;  2QKM B;  2XPV A;  1VF9 A;  4ESB A;  2G3B A;  2KPM A;  2ECB A;  2DDB A;  3ON4 A;  1OYY A;  2JPC A;  3VSL A;  1R1U A;  2DOD A;  2XHK A;  1I6X A;  4FHT A;  2H8W A;  4L0Y B;  4NC8 A;  3B6A A;  2JQ7 A;  3BR5 A;  2WY8 Q;  3CC7 I;  5D6F A;  2VPL A;  3LMM A;  2RNG A;  2V7F A;  1G6N A;  1REP C;  2YPR A;  3BQY A;  1XGN A;  5J40 A;  3DFG A;  1F4K A;  1ACI A;  3QPL A;  1BOA A;  3F72 A;  1T0F A;  1W5T A;  1HDP A;  3C3W A;  3CCV I;  4XN3 A;  3OIQ A;  4BS9 A;  3QRF F;  2JMW A;  4U0V A;  3VVX A;  1D3Y A;  3RJP A;  3CCQ I;  2LSO A;  4YII A;  2HNH A;  2CV1 A;  3ON2 A;  2ME6 A;  2GM4 A;  4E6K G;  3H5N A;  2OV7 A;  3DTE A;  2MH2 A;  2P81 A;  2RRE A;  4N4O B;  4RA2 A;  4I09 A;  2WAE A;  3E6B A;  2ZB9 A;  4IXA A;  4FX0 A;  4ZJZ A;  3H5A A;  2OD5 A;  2RNJ A;  3ASO H;  3ZN0 A;  3W6V A;  4MQ9 F;  3LL7 A;  1Z7U A;  1TWG J;  1KZH A;  3GW2 A;  2F5D A;  1HST A;  2A5Y B;  3I5U A;  1VQN I;  4IRV A;  1R23 A;  3GO5 A;  4Q48 A;  1V5G A;  3BZ6 A;  5LBQ A;  5F0C A;  2A5W A;  4X1E A;  3G3Z A;  5D4R A;  4F55 A;  3C2H A;  2O03 A;  3S3N A;  3SYT A;  3FXO A;  2K9M A;  1IN7 A;  1A6Q A;  2JA5 J;  2BVL A;  2R4G A;  3IUO A;  5FGL A;  3F0C A;  1IDY A;  1U78 A;  4XN0 A;  5DV5 A;  2V9V A;  1MD0 A;  1X1B A;  3BJO A;  3VW0 A;  3LWJ A;  1PP7 U;  1Y8Q B;  2L02 A;  5HAW A;  4II2 A;  5F08 A;  1A35 A;  2PFV A;  3ESW B;  2XPW A;  3W2V A;  4L9T A;  1EKE A;  2LBF B;  2JK3 A;  5E3N A;  2K3P A;  2B7E A;  4BHP A;  3KP6 A;  2W85 A;  2L7F P;  2RN7 A;  3FXK A;  3FK6 A;  3C2G A;  4A6E A;  3MKY B;  3VOD A;  3BWG A;  3WHC A;  2DK8 A;  4A3E J;  2PMU A;  5FLV A;  5ICG A;  2LY1 A;  4PJJ A;  1EV7 A;  3IHU A;  4HV5 A;  3K4N A;  1B9N A;  4DZP A;  3L2R A;  5C44 J;  4BBS J;  3E5U A;  4CCN A;  2ZJ2 A;  4XKC A;  3CZ6 A;  3W2W A;  3ZQG A;  3ZQC A;  1Y39 A;  2NRA C;  3FIW A;  4RB3 C;  1KYW A;  3PFI A;  2W25 A;  3LSM A;  3WG9 A;  1R9T J;  1OMI A;  2EFN A;  3AL0 B;  1S29 A;  4AM3 A;  2E35 A;  1S72 I;  4KWA A;  4HPQ A;  4LG0 B;  1VQ7 I;  5GPC A;  4CGZ A;  5EFY A;  1KYZ A;  3G2B A;  5LHG A;  3H1C A;  4RGS A;  5FJ8 J;  4NHJ A;  2Y31 A;  2NYX A;  3AG3 H;  2GXA A;  3ZQ7 A;  4F52 A;  2A69 F;  4FIS A;  2YSR A;  1ZRD A;  1BIB A;  1OCP A;  4CYC B;  2RQP A;  4L0Z B;  2R7O A;  3PNY A;  4AID A;  4UY8 I;  5D19 A;  4CYC A;  3DCF A;  1IUY A;  1MBE A;  5HVQ C;  2CRG A;  2M3A A;  3ZCO A;  4KIT B;  2R7S A;  3PFY A;  2G0E A;  3IRR A;  1OLT A;  1ETV A;  4E4H A;  5FFZ A;  1W0U A;  1ZRC A;  3CUQ C;  2JA6 J;  3NRV A;  2E1N A;  2KIU A;  1SFE A;  2EFO A;  1W36 D;  3JAM Z;  2HVQ A;  4AIH A;  1DP7 P;  5BOX A;  4HX7 A;  1LB2 A;  4PCQ A;  4EJO A;  2IAI A;  3GFL A;  3ROU A;  4BEH B;  2H1L A;  1WRJ A;  4U0W A;  3WGG A;  1A04 A;  2HZT A;  1ONV A;  2K9N A;  1PUF B;  1M1E B;  3B73 A;  5CKT A;  5A2Q Z;  4BHC A;  4A6D A;  4U7B A;  4Z2Y A;  4Z6Y A;  5L3F A;  1EF4 A;  2EIN H;  2ZC2 A;  3CDH A;  3SWH A;  1LJ9 A;  4ZYE A;  1KGS A;  2VC1 A;  3R4K A;  4D7N A;  3OY9 A;  5BPD A;  1MZB A;  3EUK L;  5AIP A;  4PSW A;  5DCM B;  3Q0V A;  2EFQ A;  1P4A A;  4XLN F;  2BHZ A;  5FMP A;  2W84 A;  4IHX A;  4HX4 A;  5E79 C;  5HLH A;  2E60 A;  2IGO A;  3AFH A;  4HF0 A;  3M8J A;  1MJA A;  1O4X A;  5H20 A;  4IRH A;  3VB2 A;  4NNJ A;  4WF2 A;  4A5N A;  3JTG A;  3UKG A;  2JA7 J;  4UV8 A;  1FC3 A;  1ZHF A;  2NX4 A;  4C3H J;  4IOA F;  5HS9 A;  5FO5 A;  3G73 A;  2OA4 A;  3ONQ A;  2F48 A;  4BAY A;  2UXN A;  4D5F A;  2LFB A;  3LHQ A;  1GLN A;  5F0H A;  1LPQ A;  2NNN A;  2VOO A;  1VZ0 A;  3D1N I;  2XAF A;  3U1K A;  2XAS A;  3K4M A;  3KLO A;  3U1D A;  5M5X J;  1EH8 A;  3BP8 A;  3CUQ A;  3RQ4 A;  2BW3 B;  1R5I D;  3HPH A;  3GCM A;  1T33 A;  3NQO A;  1YJN I;  3TO6 A;  2LR8 A;  4M3B A;  3A1Y A;  4G7Z F;  5CVU A;  9ANT A;  3BNI A;  2PMZ N;  3OYA A;  2G7U A;  3FHZ A;  5EYR A;  3FXR A;  1VTN C;  1V5E A;  3MD2 A;  2H94 A;  1OYW A;  1WJ5 A;  2YUS A;  3BR3 A;  1UJ8 A;  3R6S A;  4ZDL A;  1R4N B;  2LC2 A;  5HS8 A;  2NVX J;  4ON0 A;  4ABZ A;  4HDU A;  1MH3 A;  2WGB A;  1ZR2 A;  2OCE A;  3LST A;  4PJ0 C;  4L5J A;  1LFU P;  3GTL J;  1IN4 A;  1OCR H;  3EET A;  3VYT B;  1RR7 A;  2R7F A;  3S1N J;  2HTS A;  2XGD A;  3HRS A;  1TTY A;  3CLO A;  3CUO A;  1XMA A;  2A3S A;  4N4N B;  4MTE A;  5E1Z B;  4TV7 A;  2VT3 A;  1J0R A;  1TT0 A;  3LFK A;  5EZH A;  1JUS A;  3FX3 A;  2BV6 A;  4XSZ F;  1XN7 A;  3ECH A;  1SMY F;  1R49 A;  4UV9 A;  3REO A;  1WFX A;  1YG2 A;  2WBM A;  1ERD A;  2DYR H;  2L9V A;  1W4M A;  4E70 A;  1UI6 A;  1YX3 A;  1FMV A;  2HDW A;  3FXQ A;  1WCM J;  4ESF A;  1I27 A;  3L09 A;  4OIO F;  4OIP F;  1LDD A;  3WU0 A;  5K1Y A;  4L9J A;  2FX0 A;  2B1E A;  1I1G A;  4KIF A;  4E7I A;  1BJZ A;  3IH2 A;  3IC7 A;  4C2M A;  3LA2 A;  4AWX B;  2H1K A;  2R92 J;  3F8B A;  1H9T A;  2M87 A;  2LLK A;  4XLF A;  4DQ2 A;  5ICE A;  2V26 A;  4A3B J;  2YVE A;  1PP8 F;  4XL9 A;  2R0Q C;  2ZKZ A;  3GF2 A;  3AG2 H;  1TNS A;  4A69 C;  4E7K A;  3BHQ A;  2QBY B;  2ZXI A;  3F8F A;  2HPM A;  2WWY A;  1EH6 A;  1WWX A;  1SAX A;  3MAJ A;  1HKQ A;  3F3X A;  2G7S A;  3RYR A;  1PVE A;  5M5W J;  4OD5 A;  4AU7 A;  2KRF A;  2VN2 A;  3V8J A;  2LOO A;  2H6C A;  2VKD A;  2B3W A;  1DGW Y;  2LRE A;  1Y1V J;  5L3D A;  1DPU A;  3S1Q J;  2K9Q A;  5C4X J;  1X4P A;  2NP3 A;  5AIQ A;  4GYI A;  3MN2 A;  3P9C A;  4E7H A;  4WIB A;  1BA5 A;  4M3G A;  5E8I A;  1W5C C;  5ICC A;  3GX4 X;  4CCJ A;  2DA1 A;  3I54 A;  4IF4 A;  3WHB A;  2D45 A;  1SFU A;  2LF7 A;  2IVM A;  3HYI A;  1PDN C;  1ETK A;  2RKH A;  1RR8 C;  1VND A;  1LE8 B;  3DWL E;  3F6V A;  3N97 A;  4ZTJ A;  4YFN F;  2IU5 A;  2XAU A;  1D5Y A;  2K86 A;  2XGC A;  2OI8 A;  3K1M A;  5B1B H;  3GTK J;  2ZOZ A;  1B6A A;  2UV1 A;  4NUB A;  3ZRG A;  4G9Y A;  1JHF A;  2PG4 A;  1HA8 A;  1I5Z A;  2EZI A;  2E1O A;  2DN0 A;  2OQG A;  4J19 A;  3CDI A;  5DCM A;  2F5F A;  5DEQ A;  2CSO A;  2IGM A;  3HOX J;  4FTH A;  3WTU C;  2Z33 A;  4UB8 C;  2A07 F;  3E7Q A;  3MZY A;  2M8G X;  4FE4 A;  4Y17 A;  3DBH B;  3RYP A;  1SD4 A;  2DTZ A;  1LEB A;  4BQN A;  2PQ8 A;  2ZJQ F;  3HTU A;  4UUT A;  1ZGA A;  2DA2 A;  3Q0W A;  2OQR A;  3BTJ A;  4G94 A;  2Y9Y A;  2LF8 A;  2LYC A;  4PGH A;  3BJB A;  1WZ2 A;  3RDI A;  4XOP A;  2VON A;  4FAS D;  5K7Z A;  4LLL A;  5HS7 A;  4A0X A;  1SD5 A;  4Y7N J;  5IP7 J;  3JCU C;  2HTJ A;  4E7S A;  2QKO A;  4YIR X;  1HBX G;  4NDL A;  1EJ9 A;  2QM3 A;  2G7H A;  4F93 B;  2F4I A;  1YO5 C;  4A3G J;  3S5R A;  4M9Z A;  1YE9 A;  2ZSH B;  1U8R A;  2GXG A;  4GXO A;  3UR3 C;  5L3C A;  4M6Y A;  4IHS A;  3CUQ B;  4HKU A;  5M3M J;  3K4C A;  3CCY A;  2BW3 A;  2FD5 A;  1B8I B;  2OZ6 A;  3F6O A;  3I71 A;  4AC6 A;  5JHU A;  4BQO A;  4A2U A;  2BE5 F;  2EQR A;  3S2D J;  3F8C A;  1FSH A;  2QWT A;  1Z6R A;  3L2V A;  3K70 D;  2QUF A;  1ZN2 A;  2O5R A;  2X6X A;  4IO9 F;  3HSR A;  2W57 A;  3HUG A;  4HST A;  1MIJ A;  1MJ9 A;  4DVY P;  1ZK8 A;  3ZP5 A;  2E34 A;  2QQA A;  2UXU A;  4M3D A;  3HUG B;  2L01 A;  1Y0U A;  5J4V A;  3W6J B;  1Y56 A;  5IOY A;  4EMS A;  2GA2 A;  3E6D A;  2OU2 A;  5GTI C;  4GO1 A;  2ZME C;  4HF2 A;  1RI7 A;  3F21 A;  2HOS A;  3VFZ A;  1DDN A;  1I3Q J;  5EEH A;  2DFH A;  1RUN A;  3QU6 A;  5H2F C;  3Q5F A;  2XGX A;  2HEO A;  2XDN A;  3RI4 A;  2VQG A;  1AU7 A;  2NVQ J;  4I98 B;  5JR3 A;  1HDD C;  4C2T A;  2FJI 1;  3FZV A;  1IV8 A;  2N8G A;  4CUG A;  3IKV A;  1QU3 A;  1JTY A;  3K10 A;  1OJL A;  3NEU A;  4EJT A;  2L9S A;  5D4S A;  1JKP C;  4R79 A;  2NVY J;  1FOW A;  3IWZ A;  1ZYR F;  1FTZ A;  2KRC A;  2ZME A;  3O6B B;  5FGM A;  2L2O A;  3F23 A;  3CMA I;  1O3Q A;  2X9D A;  2PBI A;  4UUS A;  1VQO I;  2YX7 A;  2L7Z A;  2KZG A;  2MAB A;  1OYI A;  3T0Y A;  4PJN A;  1SFK A;  1T98 A;  4PZJ A;  4ZH4 F;  1X2M A;  3DTK A;  4IL6 C;  1ULY A;  1PUE E;  3FWE A;  3Q3S A;  4X6A J;  1VQ8 I;  1VQ6 I;  1NG7 A;  2DT5 A;  3B02 A;  4UVB A;  3CO7 C;  1FOY A;  1IJW C;  1WH7 A;  3FXU A;  4BAC A;  3JRB A;  1F1Z A;  5CLS A;  4DYC A;  2V6E A;  2ZO4 A;  3S32 A;  2CFO A;  1SVM A;  2FA5 A;  2J5P A;  3KPH A;  3R0A A;  4AVP A;  3S2W A;  1IXS B;  5CVJ A;  1HF0 A;  5CW8 A;  5D8L B;  5K58 A;  1P9Q C;  4FCY A;  5J1U A;  2OC6 A;  3SZP A;  3TDU C;  2OER A;  1D1B A;  1R1T A;  2HZD A;  4B44 A;  1JJ8 C;  2DMP A;  3FM3 A;  2Q2E B;  3ISP A;  3H3Z A;  1U3E M;  3QYB A;  3I4P A;  2QEX I;  1I1S A;  4IKF A;  3DTI A;  3HOU J;  2R7Q A;  1R6R A;  2XC7 A;  4HG2 A;  4G6T B;  4Y3O A;  2CWE A;  1X4O A;  1KQ9 A;  1B9M A;  3TP0 A;  4AVZ A;  3VW1 A;  4IX7 A;  1OIS A;  1W1W E;  2HOA A;  1Z9C A;  4GCK A;  2EBI A;  3M3Y J;  3OYF A;  1KU7 A;  2Q1Z B;  3BZK A;  3BG5 A;  3GZ5 A;  4EAT A;  1TWH J;  1Y8R B;  2MH9 A;  3CJR B;  1P4X A;  2IS6 A;  4JK1 X;  2IXS A;  1S6L A;  3L2Q A;  3KP7 A;  2IA2 A;  1IUF A;  2P6T A;  5TRD A;  1FMW A;  2ZXH A;  3DU5 A;  3ZQH A;  5DM7 F;  3O8H A;  2OBP A;  3J7A Y;  2VE8 A;  3A0B C;  3IP4 B;  1MJB A;  4A0Y A;  1ZEL A;  3HOV J;  1AOY A;  2KJC A;  3QWL A;  3CJQ B;  1QGP A;  2IA1 A;  2XRO A;  2CW8 A;  2HS5 A;  3G7R A;  3JRE A;  4H0E A;  2FBQ A;  5H9T A;  3QP6 A;  5B66 C;  3MFK A;  1OCT C;  4M9X A;  2VAS A;  5A2Q K;  4A0Z A;  3EYY A;  2K5C A;  2EB7 A;  1QVT A;  5D8K B;  3A01 A;  1KON A;  3VSK A;  1ZGJ A;  2JN6 A;  3KET A;  1GVD A;  1O57 A;  2WV0 A;  4UVC A;  2Y75 A;  1XD7 A;  2XIG A;  3GYH X;  1XB4 A;  3IL2 A;  2MC4 A;  3UNG C;  4EGZ A;  3S1R J;  4XLH A;  5F0F A;  1HKT A;  2Z5U A;  2DFE A;  3G1M A;  1VQK I;  3BPX A;  2DMQ A;  2KJB A;  1XGO A;  2V1X A;  2GOX B;  2M7A A;  2E7X A;  4Y33 A;  5J1Y A;  4HW0 A;  1W7P B;  2ESN A;  1OKR A;  2NS7 A;  2Q24 A;  4AUX A;  3ZXS A;  2VOP A;  3VOE A;  2PMZ A;  4ITV A;  3WTT C;  2W7N A;  3FF5 A;  4AC0 A;  3WTV C;  2EWN A;  5LHH A;  2DA4 A;  3AQS A;  5E1X A;  1BN5 A;  2TRT A;  3BTC A;  3K4L A;  3E6M A;  1IXC A;  1UFM A;  1YQA A;  2ZCX A;  1I50 J;  3S3O A;  4LG3 A;  3GTP J;  3GTO J;  1E3O C;  4D9J A;  3MKZ A;  3OR1 C;  4I01 A;  4Y15 A;  3JRC A;  5GTH C;  4CCL A;  1BJA A;  1E3H A;  1MNM C;  4WXC A;  1FIA A;  3GZN B;  3D5R C;  2B0L A;  3NAU A;  2WB1 N;  3PAS A;  1APL C;  4Q5S F;  2MC3 A;  3ZGK A;  2Y30 A;  2X85 A;  1YW8 A;  1U8B A;  3L00 A;  2BYV E;  4WXD A;  2V1N A;  1JJ6 C;  1TLH B;  2H8R A;  1GHC A;  1MH4 A;  1UHS A;  3TOA A;  1Z1D A;  1BOB A;  4JQF A;  3W6K B;  1ON1 A;  1TBX A;  4IRG A;  1FJL A;  2AQE A;  2TCT A;  5HOO A;  2DQL A;  1HC8 A;  3QPS A;  4Q4Z F;  3RKQ A;  3COL A;  3DKX A;  5HLT A;  3LA7 A;  1P7I A;  1TZL A;  1IO2 A;  1XSX A;  4D5C A;  1BC7 C;  1WJB A;  3HGG A;  1UB9 A;  4M71 A;  1J9I A;  3V7S A;  2K3F A;  2DPU A;  2EZK A;  4DW6 A;  2XAQ A;  4CO8 A;  4BYY A;  4NBQ A;  5FRN A;  2B63 J;  2YR2 A;  1FOX A;  3BQZ A;  5C3E J;  2M5W A;  4MLO A;  3E6C C;  1ZAR A;  4BNC A;  4D0P A;  2FE3 A;  5IT9 K;  4CCM A;  4IQJ A;  4AIJ A;  2EZL A;  4WXH A;  1J75 A;  5IPA A;  1BC8 C;  3DKW A;  3VOX A;  4S05 A;  4LG0 A;  4ZZL A;  2P7C B;  3H5R A;  3PNV A;  2FQ4 A;  2GEN A;  1XSV A;  2FMY A;  3I59 A;  4A5M A;  5KHD A;  2YU9 J;  5FLM J;  1G59 A;  4ESJ A;  3CJN A;  5E17 F;  5D5X B;  1VI0 A;  1ZQ3 P;  2V9P A;  3ZQQ A;  1K4T A;  4BGD A;  4MGR A;  4LB6 B;  2VOD A;  1MBG A;  2BXZ A;  1JGG A;  4E7Z A;  1LFP A;  2R5Y B;  3T6N A;  3BR1 A;  2DAO A;  2IGN A;  4HRI A;  3KZY A;  5E8G A;  2MW8 A;  1WJF A;  1X2N A;  2CV0 A;  4HA8 A;  2RQQ A;  2ZNY A;  4C3I J;  5IP6 A;  1QPM A;  4M9S A;  3DEE A;  3W3C A;  1IRZ A;  2DCE A;  5JLW A;  1R5H A;  2Y0S N;  1P6R A;  2EJR A;  2FML A;  2IT0 A;  2KLO A;  1FYK A;  5EG0 A;  3GME A;  3OL4 A;  4C9Y A;  2X6O A;  1J7K A;  2DA6 A;  2FUG 2;  1WSU A;  1YTY A;  2HYG D;  3I4N J;  2QA4 I;  4CA0 A;  3ULQ B;  3ZQF A;  1ZG3 A;  1P2F A;  2IEK A;  3K4B A;  4O6J A;  2RVC A;  4XRF A;  2JA2 A;  4OAY A;  4BEH A;  3H0G J;  1QZE A;  4B4C A;  1RES A;  1K78 B;  2DT6 A;  4KT5 C;  4A3I J;  2KIM A;  4C3J J;  5M3F J;  1KA8 A;  1I39 A;  2W00 A;  4B09 A;  2ZY9 A;  2A6T A;  1FIP A;  3AL0 C;  1I3A A;  3AAF A;  3KYC B;  3AQT A;  3MKL A;  1RRJ A;  1DPR A;  3FXM A;  5B5E C;  3BCB A;  2MD5 A;  3RIR A;  1V3F A;  2XB5 A;  2Z99 A;  2ZJP F;  1F43 A;  2RAS A;  2ZSI B;  4L9V A;  5DYM A;  1U6G A;  3A01 B;  4LK0 F;  3G56 A;  1JUM A;  3U21 A;  4BU2 A;  2A2F X;  2X48 A;  3SFZ A;  3ZMZ A;  2FQ3 A;  2BEO A;  3CCU I;  4L9N A;  2R7R A;  1EA3 A;  1HQC A;  3U9G A;  4D7M A;  2PEX A;  3FDY A;  1V54 H;  2RV8 A;  4FX4 A;  1I6H J;  2LDU A;  5EEG A;  2L7M P;  5D6E A;  2HDD A;  4B1R A;  3N05 A;  4BE0 A;  3OS2 A;  3CO6 C;  2K85 A;  3GLL A;  4UNO A;  1YS6 A;  4KT6 A;  2VKE A;  4M74 A;  3RSN A;  1U9N A;  3PQJ A;  1TQP A;  2J5O A;  2VKH A;  2VXZ A;  2OJE D;  5E1W A;  4EJV A;  4CCO A;  1YFH A;  2AO9 A;  1X3U A;  2HWV A;  3OSG A;  1TWA J;  2PI0 A;  1YIJ I;  3OS1 A;  3CCJ I;  2K4J A;  3VEP A;  2E1M C;  1STZ A;  2KL4 A;  1UHM A;  1N75 A;  3OOP A;  3GTQ J;  2GIV A;  3M07 A;  2EA2 A;  2ID3 A;  1XDS A;  4GRI A;  1LKX A;  3SZG A;  1JKQ C;  3VIB A;  3H9G A;  1Y1W J;  2UZK A;  1JKR C;  3CC2 I;  2L3D A;  2VJ4 A;  3S14 J;  2E36 A;  5K7H A;  2Z3Y A;  4LIT A;  1DU0 A;  2PN6 A;  1TL8 A;  4HV6 A;  1K61 A;  3IV5 A;  5FRM A;  3WGH A;  4I7H A;  2CQ7 A;  2KDZ A;  4PJL A;  2EFW A;  3J7Y J;  1YRN A;  4XMY A;  4XLE A;  4XLA A;  1ETW A;  1YRN B;  2VB6 A;  2YU3 A;  3OYD A;  2LBF A;  3CF5 F;  1T38 A;  1QNT A;  4PUS A;  1XC5 A;  3ABT A;  2OF7 A;  1BI1 A;  5F1J A;  4E7J A;  3K1P A;  4MXM A;  4XRM A;  2VUM J;  2E7W A;  2JUG A;  2EFP A;  4QPQ A;  5E18 F;  5EGO B;  1JT6 A;  1R00 A;  3RQI A;  4XID A;  5GAH J;  2M2E A;  5EGO A;  2P5L C;  2KDO A;  2L9N A;  5DCF A;  3OYI A;  3LFU A;  4XRS G;  1R58 A;  4OIN F;  1A5J A;  2DG8 A;  1L3L A;  2EV0 A;  2DJI A;  2V9K A;  1WJA A;  3FM5 A;  4PSX A;  4QIW N;  3CRJ A;  1ZGW A;  3M7G A;  1UI5 A;  1T6S A;  1TW2 A;  5FD5 A;  5KNL A;  3DPL C;  4B48 A;  2XKO A;  1UST A;  4C2U A;  1NG6 A;  1OCO H;  1RPW A;  2DA5 A;  2XSJ C;  1MMS A;  5K5Q A;  1OCC H;  2CH0 A;  3KFW X;  1IRG A;  2OCC H;  4RB2 C;  3H0D A;  3CCE I;  3PUB A;  3O60 A;  4BE1 A;  2CQK A;  2HI3 A;  3BZC A;  1ZLK A;  1YYV A;  3OWT A;  1QHG A;  1FX7 A;  1XPX A;  4XRS A;  1XCV A;  2HFH A;  1YLF A;  2KRH A;  4PFO A;  2HOT A;  2C6Y A;  2DQR A;  4A3D J;  4RLF A;  3QOP A;  1ON2 A;  2QGU A;  5D5W B;  4J01 A;  3CCR I;  3TDZ C;  3BDD A;  4Q47 A;  2HOE A;  1D1A A;  3KP4 A;  2ZBK A;  4MEX F;  2ID6 A;  2QCO A;  2R7X A;  2NXN B;  1E2X A;  3COA C;  2MGQ A;  3LSI A;  2OUM A;  1PUF A;  2VT2 A;  4G12 A;  2ISY A;  3PIO F;  1TC3 C;  4JX4 A;  1U5T A;  5J1R A;  1WPK A;  1AKH B;  4WK8 F;  1Z3Y A;  3OSF A;  3BRU A;  3HJE A;  1AKH A;  1BI0 A;  2X1E A;  3LQQ A;  2REK A;  3K1N A;  2CUE A;  3MZH A;  5FHP A;  3P9K A;  4HNU A;  4ZYD A;  1VQP I;  5AQC A;  2MSY A;  5DDG A;  2PBX A;  3A0H C;  1Z3X A;  2CQN A;  2WTE A;  2O6G E;  3DPT A;  1BI3 A;  4IQ4 A;  3SDG A;  4UXN A;  1GDT A;  1Z7L A;  3EDP A;  4JKZ A;  1T95 A;  1H0M A;  4OIQ F;  2Z1D A;  2QVO A;  3WU1 B;  2D1H A;  1MDM A;  3HKZ N;  4ME9 A;  3DF8 A;  4LMY A;  1JUP A;  1TNT A;  4DBR A;  1HSJ A;  3CMY A;  2X6Y A;  1JTX A;  1SD7 A;  2ZCM A;  1UEL B;  3F8M A;  5D5V B;  1E17 A;  1NTC A;  1G2H A;  1NK3 P;  3CDL A;  3BG9 A;  2I5U A;  1F5T A;  4AIK A;  4ICH A;  3H35 A;  2X4H A;  3FK7 A;  4ZYA A;  1KU9 A;  2NAZ A;  5AON A;  2KIS A;  4YFX F;  3FBN B;  1R22 A;  4KUM A;  3RZD J;  5IYB J;  4WCG A;  4HBL A;  4MTD A;  4KMU X;  3HXL A;  1D0Y A;  5ILS A;  2IS4 A;  1IDZ A;  5FKM A;  2O8X A;  2NVU B;  3NPI A;  2RDP A;  2FOK A;  3ZMV A;  2QWW A;  3DBR B;  5EF6 A;  3H3U A;  3EUH C;  4BDZ A;  4P55 A;  2LKX A;  2NS8 A;  3FBI B;  3T1B A;  3IKT A;  1BL0 A;  2LNB A;  3H9J A;  1QA6 A;  1MSF C;  4UHT A;  2HQ5 A;  4NC6 A;  3Q9V A;  5CXG A;  3WG7 H;  2HVR A;  1BR1 A;  1J2X A;  2F4M B;  3LSP A;  1YW7 A;  1W0T A;  1K79 A;  3ML6 A;  1SEU A;  4ETS A;  2M34 A;  4P96 A;  4CH7 A;  2BHY A;  2Y69 H;  1WH5 A;  1IN8 A;  4J00 A;  3Q9S A;  5CYV A;  3VVY A;  4BHB A;  4XNF A;  2LTP A;  4RGX A;  3F1B A;  4NEL A;  3N4M A;  3JAM K;  1POG A;  4BJ6 C;  1S7A A;  2DO7 A;  3JW4 A;  3T8T A;  3BG6 A;  3K2Z A;  4DYQ A;  3I4M J;  4B47 A;  4CIC A;  3G6E I;  5CVI A;  1H89 C;  1S7O A;  4NC7 A;  1HW1 A;  3NWT A;  5HOD A;  1IG7 A;  4MNU A;  3OYC A;  3M1C A;  4Y4R A;  3QOD A;  3BJA A;  3OV8 A;  2VE9 A;  2F2E A;  2M45 A;  3CLQ A;  4DJA A;  2EA4 A;  2E2I J;  3F9K A;  2ZME B;  3V7R A;  3H9Q A;  1G3Y A;  2A61 A;  2JT1 A;  2VQL A;  1IXR C;  4ZZD A;  3IWF A;  4MEY F;  2XUB A;  3WU2 C;  3C18 A;  3OOU A;  4K2E A;  2Y9Z A;  1Z77 A;  1X3Z B;  2YVH A;  4ASN A;  1ENH A;  3E5Q A;  5HNH A;  1KU3 A;  4C30 A;  3S16 J;  1UG0 A;  5F04 A;  4KIB A;  3JSO A;  1OCZ H;  1JE8 A;  3HZJ A;  3I64 A;  1O3S A;  3JRD A;  5J3L A;  4EEF G;  2LY2 A;  4A3F J;  5K5R A;  3V78 A;  4YEJ A;  1X1C A;  5H6R A;  2K02 A;  1HCR A;  2WAD A;  3CCM I;  1K83 J;  2KZV A;  3FMR A;  5JVT A;  2QQ8 A;  1JT0 A;  4OAZ A;  1OQY A;  5J6X A;  4RM2 A;  2FU4 A;  2GA1 A;  3ECO A;  4OIR F;  1FBS A;  4IEJ A;  1GV2 A;  2EZH A;  1TQM A;  1ZRF A;  2WB1 A;  3BRO A;  2GQQ A;  1O7F A;  1SFX A;  3WTW C;  2BXY A;  3DEU A;  2A6H F;  1LDK B;  2M0C A;  4I0A A;  1R4M B;  2ECC A;  2DG7 A;  1RET A;  3HTA A;  1W36 C;  5D18 A;  4BKX A;  2LD5 A;  1MBJ A;  2V4J C;  3KZ9 A;  2CO5 A;  3P7N A;  4HQM A;  3WGI A;  1Z6T A;  3TBI A;  3MVP A;  2CUJ A;  2E19 A;  4YG2 F;  2WV1 A;  4IZZ A;  1TT5 B;  1E0E A;  3NNR A;  1U5T B;  1NHA A;  2VPR A;  2QF7 A;  2R5Z B;  2DK5 A;  1X3W B;  3DQV C;  2LH9 A;  4RBO A;  5B3S H;  3M4O J;  4JP0 A;  2VQC A;  2PX9 A;  4IJA A;  2VJ5 A;  4I0B A;  4OOI A;  3LQR A;  3SXY A;  1BBY A;  3OYH A;  3V8K A;  4JBA A;  3GZ6 A;  2CFX A;  2HKU A;  2W24 A;  1QZZ A;  3ZR8 X;  5GPA A;  2A05 A;  3RTR A;  4QLC U;  4PJM A;  3NI7 A;  4U7D A;  1CQT A;  3S2H J;  3C07 A;  3VDX A;  1O7L A;  5HDN A;  4BQA A;  4I76 A;  1MDM B;  1DQU A;  1GXQ A;  3SEQ A;  5J47 A;  3HSF A;  3OYL A;  4ENN A;  2QKL B;  2KT0 A;  2ACJ A;  3LSK A;  3MEX A;  5FKO A;  1FWZ A;  2XVC A;  4LD5 A;  3TMO A;  4WX9 A;  3S1M J;  4KIS A;  3ANG A;  3ERE D;  2XB0 X;  3KEO A;  4I2O A;  2Z9O A;  1VQ9 I;  2O9L A;  4QPO A;  3BLY A;  3TW7 A;  4U9N A;  1WGX A;  2Y0S A;  3AG4 H;  3KYD B;  4G7O F;  1BM9 A;  1BW5 A;  3IUV A;  1KQ0 A;  3NXC A;  1W7P A;  2GAU A;  5HNF A;  3AKZ A;  1PJR A;  2FBH A;  2HYJ A;  4N9I A;  1ZG5 A;  3HE0 A;  1T0F C;  4DNC A;  4LGW A;  3EGQ A;  2QSF X;  4NB5 A;  5CQE A;  1C0W A;  5HLG A;  1FNN A;  1FLI A;  3PSI A;  5BS6 A;  2QZ8 A;  3A2K A;  2VBZ A;  2E71 A;  5GP9 A;  1IF1 A;  5FLX K;  1WQ2 A;  1ZLJ A;  1RIO H;  4A3M J;  1XG1 A;  4XOR A;  2M7B A;  5C4Y A;  3PO2 J;  1Z05 A;  1G3W A;  1IAW A;  3E1S A;  1IRF A;  3JRF A;  3CCL I;  1XS9 A;  3KE2 A;  4O3M A;  3RKY A;  5IOZ A;  4IVN A;  2JRT A;  5F1R A;  4II3 A;  2P8T A;  1FP1 D;  3L2U A;  1XTA A;  1VQL I;  4GDF A;  2DW4 A;  4JX6 A;  1DU6 A;  1ZH5 A;  5FRO A;  2D6Y A;  2BY1 A;  4LOC A;  4W97 A;  4ACI A;  1DGR M;  2R3S A;  1FTT A;  4CYD A;  3QPT A;  2STT A;  3TL4 X;  3ERM A;  2MG4 A;  3EPZ A;  2W53 A;  1BR2 A;  2AXT C;  3GLX A;  1VQM I;  3P9T A;  3LNQ A;  3VYR B;  1DP3 A;  5LRR A;  2E5N A;  2UWM A;  2ZJR F;  3ZQL A;  3GZI A;  2QQ9 A;  3GTM J;  2STW A;  1LQ1 A;  4GCL A;  4F92 B;  4UUS B;  1Z67 A;  4YIF A;  4B43 A;  1QHH D;  2FEZ A;  2L4A A;  2XPU A;  5F6F A;  3WE3 A;  2MYS A;  4YEL A;  2VBX A;  3OYE A;  1SC7 A;  5LHI A;  3OL3 A;  4A93 J;  4U88 A;  3FKI J;  4ENM A;  1ODD A;  2IRF G;  5KK1 A;  4P9F A;  3DLA A;  2Y0M A;  1MSE C;  2K7L A;  3B81 A;  4RGU A;  2DMU A;  4HLY A;  3OIO A;  2HU9 A;  1ZG1 A;  3CES A;  3KNW A;  2DU9 A;  2HXI A;  4V2F A;  2ELK A;  4XR6 A;  4E7L A;  2R7W A;  3KX2 A;  2FBK A;  1IGN A;  2F5C A;  2VL8 A;  2D2W A;  4PK4 A;  3NS4 A;  1QPI A;  4L5I A;  4EGY A;  3F22 A;  3BPV A;  3QU3 A;  5DM6 F;  5HDK A;  5D1R A;  3SHF A;  5H6Q A;  4EVI A;  3NRG A;  2M8E A;  2E5Z A;  2XDV A;  4HZF A;  3D5S C;  4N9H A;  4F91 B;  2R5Y A;  3M1E A;  3JRH A;  1UMQ A;  2BBY A;  3HRM A;  3BC8 A;  1X1P A;  2JTV A;  4BQQ A;  4LB5 A;  3BOQ A;  3MNL A;  2HQN A;  2UXH A;  4LIU A;  2FBI A;  5ILU A;  4LLN A;  1NK2 P;  4P1W A;  3J80 K;  3LAJ A;  1D5V A;  3V6G A;  3E97 A;  2LKP A;  1FYM A;  4G6D A;  5JFR A;  3DLL F;  2DYS H;  2EV5 A;  1MKM A;  5LLQ A;  4NN1 A;  3HEF A;  3HOS A;  3M9A A;  1UG2 A;  4RAY A;  3ZMU A;  4JX5 A;  3ZPL A;  2RGV A;  3RD3 A;  1X1A A;  5LRS A;  5M5Y J;  1YJW I;  2O61 A;  5F27 A;  4BXF A;  1K78 A;  2BGC A;  3FMQ A;  1VQ4 I;  3G4S I;  2NS0 A;  5LD2 C;  3PQK A;  3J7Z I;  2R5Z A;  2MFZ A;  3ABK H;  2CJJ A;  2HYF A;  3OR2 C;  2R7U A;  2CYY A;  2EPF A;  3DP7 A;  3RCO A;  1R36 A;  5LEK A;  1FP2 A;  3CME I;  2WC2 A;  3U2R A;  1FPQ A;  2D1V A;  2PJR A;  1AHD P;  3PPB A;  2V6C A;  3W2A A;  3BR2 A;  2JA8 J;  3HRT A;  3QYF A;  3CJD A;  4A3J J;  3KYL A;  5FKN A;  2L0K A;  3CTA A;  5JVG F;  2E1C A;  3ZOB A;  1E3P A;  2HKO A;  4XQF A;  2YS9 A;  2OAZ A;  2LG4 A;  4EM1 A;  4F7Z A;  4C2M J;  2QLZ A;  2H27 A;  6PAX A;  3MQ0 A;  2IJL A;  4B8X A;  2ZOY A;  1WJD A;  1QZY A;  2VBY A;  2K40 A;  1VQ5 I;  3EQL F;  3TGN A;  3KCC A;  2ESH A;  4B3X A;  2PZ9 A;  2UXO A;  1KU2 A;  3TP3 A;  1MBH A;  1N25 A;  1ZKG A;  1ZR4 A;  3HRU A;  4BH9 A;  1U2W A;  3IAM 2;  3HTJ A;  5BQT A;  2RC4 A;  2DI3 A;  4HAM A;  3H3V K;  3HPG A;  3GUD A;  3AG1 H;  1B59 A;  2IW5 A;  3RH2 A;  3O2P E;  3IAS 2;  5E3O A;  2ADU A;  4XIC A;  5CVV A;  2VKV A;  4P5O A;  4UDS A;  1D8J A;  3K4J A;  3HIF A;  2VLA A;  2DPD A;  1FY7 A;  1SD6 A;  2MLG A;  2Z16 A;  2RAE A;  3ZMD A;  3PO3 J;  3GEU A;  1LVA A;  5LGT A;  1XX5 A;  4A3K J;  2ISZ A;  3EUH A;  3PUF A;  3TED A;  4FET A;  2W48 A;  4GFL A;  3CJT B;  1S7E A;  5BPI A;  3RPU D;  4L5E A;  1R5G A;  1YOV B;  4BDY A;  3K0L A;  2E1M B;  2MD0 A;  1Q1V A;  2FJ1 A;  4XKW A;  4CGR A;  2CUF A;  4OMZ A;  2NP5 A;  5K7F A;  1SGM A;  4KN7 X;  1TWC J;  4QSH A;  3HTI A;  3V4G A;  2HYT A;  3LWF A;  4DGW B;  2DFI A;  4XBF A;  3B6C A;  1ORK A;  1U9O A;  3PM1 A;  2KMU A;  4OWR B;  4BJT A;  4EJU A;  3VP5 A;  3HKZ A;  4PGG A;  2IS2 A;  1P4W A;  2BY0 A;  3QOE A;  2PMH A;  4U0Y A;  2GWR A;  4MO7 A;  2GUH A;  2KIQ A;  2K27 A;  2QSH X;  1MBF A;  1Z91 A;  4MFD A;  3JRI A;  2W1O A;  2DBB A;  5IY5 H;  1OPC A;  2E2H J;  1YS7 A;  1G4D A;  4A3C J;  3FRQ A;  4EJW A;  5FB2 A;  3HGY A;  2HQR A;  2XF6 A;  5JLX A;  2X51 A;  3JSP A;  3E0J B;  5L3B A;  1MMG A;  3EYI A;  1ETX A;  1UAA A;  4X0G A;  3KKD A;  3H36 A;  2PLY A;  2XF5 A;  4RMN A;  4JNN A;  1DUX C;  4M73 A;  1SAN A;  1Z21 A;  4PDK A;  2QEN A;  2AQF A;  1N78 A;  1HOM A;  3VOK A;  4NQW A;  4QTR A;  2FXA A;  3RZO J;  4W1U A;  3PJR A;  2H09 A;  4KN4 X;  3I59 B;  2FNP A;  4CZC A;  2IGK A;  4RGR A;  3QKX A;  2CU7 A;  4G6Q A;  3RKW A;  5GAG J;  2CV2 A;  2XRN A;  3RPQ A;  5CPR B;  2F5E A;  4HF1 A;  1YIT I;  2UXX A;  3FIS A;  3PL8 A;  3TOB A;  3DEW A;  2HPI A;  3I3L A;  3OIP A;  4LJZ F;  3HL2 A;  2QIB A;  3J81 K;  2JSC A;  2OPT A;  2AXL A;  3KEY A;  1Y6I A;  2CG4 A;  3BJ6 A;  2KFD A;  3JTH A;  1S9H A;  4DYR A;  5CXI A;  2DXI A;  2MA3 A;  1Q1H A;  5EG0 B;  2PJP A;  2IP2 A;  4G7H F;  3EUP A;  1USS A;  3GFJ A;  1JHH A;  4D1Q A;  1XMK A;  3HTS B;  1T08 B;  3ABM H;  2DA3 A;  1O3T A;  2KHM A;  4MIM A;  4ENJ A;  3OYK A;  1H8A C;  2XSD C;  2JSP A;  4M72 A;  3BCG A;  3FKJ A;  5DD8 A;  3V42 A;  2ELH A;  3HOY J;  2RHA A;  5ILV A;  3JRA A;  2O0Y A;  1IN5 A;  1X1D A;  5TJJ A;  3GVA A;  2HKX A;  3J7A O;  2V57 A;  1BI2 A;  4ZTF A;  5DTD A;  2ELJ A;  5D5U B;  4MHG A;  3HB9 A;  3CF2 A;  2GOM A;  1WVR A;  1XDU A;  2EK5 A;  5HSZ A;  2O7O A;  4GFK A;  2PJR B;  4UUV A;  2QQB A;  4RS8 A;  2L4M A;  3ZQI A;  1NH3 A;  1FSE A;  5C4J J;  2QBY A;  2TDX A;  2AHQ A;  1F36 A;  3S17 J;  4CDG A;  3SEZ A;  4P9U A;  4IPA A;  1JXS A;  2HVS A;  2FNA A;  2VJJ A;  1YW9 A;  2L5Q A;  1WJC A;  3L2C A;  1X58 A;  1SVL A;  1YJ9 I;  3CP8 A;  3HM5 A;  4R8H A;  1QQI A;  1LFB A;  1MND A;  3OYJ A;  3L1P A;  2CMP A;  4XM3 A;  3T5X A;  3EUA A;  1F9N A;  1K7A A;  2KP6 A;  3S8P A;  4RB1 A;  1QRY A;  2WAQ N;  2EIL H;  2GBY A;  1LUJ B;  1SFO J;  2VI6 A;  3BT9 A;  2DMT A;  5BMZ A;  1T56 A;  4HQE A;  1L0O C;  4S04 A;  1FEX A;  4MFE A;  2ZCW A;  1IN6 A;  2FOW A;  1JKO C;  3DU6 A;  1ZTR A;  1LE8 A;  4AYB N;  2DJN A;  1S8N A;  4KIG A;  5IT9 Z;  3I56 I;  3M8E A;  2I8D A;  3FXJ A;  5EEA A;  4V19 K;  3OYN A;  2K4B A;  3KZZ A;  3K69 A;  4RAZ A;  1IZ1 A;  2JPB A;  1SMT A;  3DKY A;  3CWR A;  1HW5 A;  4GCV A;  4MQV A;  3Q0U A;  1J59 A;  1QO0 D;  4FQG A;  1B1B A;  1WJE A;  1G3T A;  4OU0 A;  3HDD A;  3S15 J;  3BG3 A;  3VUQ A;  1XSD A;  3HOZ J;  3JRG A;  5HLI A;  1HKS A;  4S0H B;  2Q8K A;  1T8I A;  1AA7 A;  5IYC J;  3WTX C;  2R7T A;  5DUI A;  1ETY A;  2LK2 A;  3IH3 A;  4CSW A;  2AS5 F;  2OTJ I;  1IC8 A;  2BVM A;  3GXO A;  1EH7 A;  2LY9 A;  4L18 B;  4OMY A;  1VFC A;  2P5V A;  4EQQ A;  1WI9 A;  3PSF A;  4JYK A;  2M0M A;  1YI2 I;  1LNW A;  4M6X A;  5TIS C;  4HOB A;  1V55 H;  2XRL A;  5ICF A;  3JSJ A;  2COM A;  1T39 A;  1FZP B;  2UUZ A;  2O3F A;  4EM0 B;  1HW2 A;  3G71 I;  2EH3 A;  3K7A J;  1OFC X;  4KJZ A;  1Y0N A;  5EJC A;  4F3Q A;  2E2J J;  2JVG A;  2DT7 B;  2M1B A;  5L3E A;  3P5J A;  2L9R A;  1R7J A;  1UCR A;  3HHG A;  4G8X A;  1B8I A;  5E3L A;  1G3S A;  4GCT A;  2JVH A;  3SZT A;  2IPQ X;  2EIM H;  4AF5 A;  2BZT A;  1T2K A;  1B72 A;  1W5S A;  2HXO A;  2HR3 A;  2VJI A;  1RKW A;  3CC4 I;  1RNL A;  4NQW B;  2X0L A;  2GZW A;  3DPJ A;  3OYG A;  3JR9 A;  2VIX A;  4A3L J;  2HDC A;  3IH4 A;  3VYU B;  3SJM A;  2ZFU A;  4IOC F;  2K9L A;  1OR7 A;  1J5Y A;  2ETH A;  1FBU A;  2UXP A;  3TW6 A;  4M3E A;  1YX5 A;  3OYB A;  1K6O A;  1LVK A;  2NOJ B;  4FT8 A;  1RZ4 A;  2BY2 A;  3M8F A;  2EIK H;  2M4K A;  4GYG A;  3K6G A;  3TO7 A;  3R0J A;  1AWC A;  4Y52 J;  4KYW A;  3QAH A;  2JJ7 A;  3FXL A;  4EV0 A;  5J4Y A;  3G1O A;  3WTS C;  3HOT A;  2M30 A;  4M6V A;  3I55 I;  2GIZ A;  3I0T A;  4HSR A;  4DBQ A;  2F07 A;  4RB0 A;  1LEA A;  3K8P C;  1IW7 F;  3VTI A;  1QBJ A;  4HNT A;  1A31 A;  1A36 A;  5FKK A;  3KIO A;  2X1D A;  2MLK A;  1YHQ I;  2CW7 A;  1BIA A;  3GFI A;  5KVR A;  5HBU A;  2ZXW H;  3KZI C;  1TQI A;  2CQX A;  3KP3 A;  2QYO A;  3DBL B;  2ME0 A;  3VYS B;  3ZMT A;  3MKW B;  3OMY A;  3A4C A;  1J09 A;  5IT3 A;  1U0J A;  5FFX A;  2XAJ A;  3BR0 A;  2JZY A;  2F4O B;  1D1C A;  3QBM A;  4BXX J;  3FMS A;  1RKT A;  1MGT A;  4IHY A;  1XCB A;  4XSX F;  2X1C A;  2XKP A;  2GXB A;  3FHN A;  1Z0X A;  2R7D A;  5L3G A;  2HGC A;  5HDG A;  1X19 A;  3KP5 A;  1WI3 A;  5CQG A;  3IRQ A;  2ICW G;  3BY6 A;  3LSH A;  4CXF A;  3HOW J;  3F8N A;  1WHU A;  2P5K A;  4U87 A;  5JHF A;  1ZRE A;  2NOG A;  4DOZ A;  3R61 A;  5J8F A;  4EM2 A;  2COB A;  4XON A;  1XGS A;  3QPH A;  2EIJ H;  4YZE A;  3NAR A;  4HLX A;  2IS1 A;  2YVX A;  1V4R A;  2KIF A;  2Q2E A;  1YIO A;  2VBW A;  2UXI A;  3I53 A;  3PIP F;  5E3M A;  4IHW A;  5CJ9 A;  1R71 A;  2CUZ A;  1IV6 A;  2GFN A;  4HYE A;  1ZAO A;  3K70 C;  3A02 A;  4ZC3 A;  3C7J A;  3HG9 A;  3LA3 A;  1UZC A;  1FYL A;  3MCZ A;  1WKM A;  2L54 A;  3L9F A;  3GBG A;  1SAU A;  4I02 A;  4I99 C;  2WA0 A;  3CQZ J;  3TKY A;  3QQA A;  3OYM A;  1MW7 A;  3KEQ A;  4BY1 J;  4LLG F;  2R7V A;  4BXU A;  1H88 C;  2P0W A;  1P92 A;  1W7P D;  3LJL A;  4PXI A;  2K9S A;  2EV6 A;  1RUO A;  1G8X A;  3KKC A;  4BY7 J;  2A68 F;  2F5V A;  3VVZ A;  3GTJ J;  4UVA A;  2QTQ A;  1TWF J;  3V8L A;  4KIC A;  1S3J A;  3HIM A;  1CF7 B;  2JWT A;  4BBR J;  3C2B A;  4OD4 A;  1GXP A;  3MWM A;  5IP9 J;  3HTH A;  2KKO A;  1CF7 A;  4R1H A;  5FD6 A;  3H92 A;  4ENK A;  1K4S A;  1FT9 A;  3D0S A;  3CMM A;  1FOK A;  4YFK F;  3HC7 A;  3RPU A;  1GV5 A;  2F6C A;  1GT0 C;  4B3A A;  4QWQ A;  3KP2 A;  4M3F A;  4RAG A;  1BW6 A;  5KAI C;  2KQR A;  1MMA A;  1MBK A;  4UB6 C;  4XKB A;  5JI6 A;  4GFB A;  2X6W A;  5F64 A;  3L7W A;  5EZG A;  3G1L A;  3O8G A;  1RC9 A;  3DPU A;  2V1D A;  4RLQ A;  4DZJ A;  2P6S A;  4IHT A;  4CZZ A;  2B9S A;  5IYD J;  3BG7 A;  5DUK A;  2LKS A;  4XLC A;  3C1D A;  4XKV A;  2BOL A;  3ZMS A;  4ZYG A;  1TP4 A;  2DMN A;  4PFP A;  3GEZ A;  4XK4 A;  1UHW A;  1CGP A;  3ELK A;  3ZN1 A;  1B72 B;  3ABU A;  3P9I A;  2XF7 A;  5LGU A;  3WTY C;  3GTG J;  2M4G A;  1PYV A;  4DIQ A;  4RM3 A;  4XLP F;  1FBQ A;  4HX8 A;  1TW3 A;  4I6Z A;  5E20 A;  3KLN A;  2IA0 A;  1HLV A;  1P7J A;  2QOP A;  3L2W A;  3VW2 A;  4KDP A;  3K2A A;  3SDB A;  1V5F A;  4RDU A;  4L62 A;  5CVR A;  1ITY A;  2IBD A;  3VPR A;  2WAF A;  3J80 Z;  3WTZ A;  4U9L A;  3DV8 A;  3K9T A;  1O3R A;  4LFU A;  2CW0 F;  3K4K A;  2Z2S B;  4JOM A;  3CD6 I;  1XGM A;  1S5L C;  2P7V B;  2DOA A;  5LFA A;  3R60 A;  3WE2 A;  3LSG A;  3SQN A;  2DLL A;  2V79 A;  3HBL A;  2DOE A;  5K5O A;  1QVU A;  2G9W A;  2LRD A;  2NNY A;  1N77 A;  2O7T A;  3CP2 A;  1ETQ A;  3I58 A;  1D8K A;  5LGN A;  2P4W A;  4BJ5 C;  4BUP A;  1XMX A;  2Y48 A;  2WUI A;  3E5X A;  1D0Z A;  2FRH A;  1R1V A;  1GVJ A;  2I10 A;  2Q0O A;  2ZXJ A;  3VWB A;  4JL3 A;  5FLX Z;  1JI8 A;  2HQA A;  2LVS A;  2DTR A;  2W4S A;  4O5V A;  3LSJ A;  5EDN A;  3S3M A;  1JGS A;  4RAF A;  2LP0 A;  1A6I A;  4GGG A;  1IRX A;  3I9V 2;  4FE7 A;  2Y2Z A;  3TO9 A;  4ZDO A;  3RKX A;  2VC0 A;  2OTL I;  2O8K A;  2ZCN A;  4CHU A;  3SFI A;  4BL0 B;  1KQ8 A;  3LAP A;  3TQN A;  1MMD A;  1LDJ A;  5BNG A;  1BR4 A;  1OR7 C;  2XGE A;  4LK1 F;  5TGT A;  3ANP A;  2G7L A;  1HXD A;  3A03 A;  3DXJ F;  3PNT A;  4H4K C;  2ZFW A;  3MZ8 A;  5DAJ A;  4CCK A;  4ZYH A;  2DFF A;  3V7C A;  4MK6 A;  1K6Y A;  3E3V A;  5ERI A;  2NVT J;  2XAH A;  3HHH A;  2FSW A;  2W82 A;  2G7G A;  2WAQ A;  2CS3 A;  2R7Z J;  5FKL A;  4Y13 A;  2QSG X;  2GLO A;  4KFC A;  3QYE A;  3ABL H;  3LSR A;  2R93 J;  2ZNZ A;  4AD9 A;  2V1U A;  2CQQ A;  2PFB A;  4KA4 A;  4HDV A;  4A12 A;  2LMD A;  4KNY A;  4HNV A;  3WOD F;  2JRM A;  2DA7 A;  4ZDP A;  2YX4 A;  3CCS I;  1D0X A;  3E7L A;  4WWC A;  2D5V A;  4AYB A;  5J8C A;  3OS0 A;  5KCM A;  4YRV A;  3T8R A;  3S93 A;  2JUC A;  4XOT A;  4IRI A;  4LIV A;  5DD4 A;  3BTI A;  4ANJ A;  2MBF A;  5GAE J;  1U5T C;  2CGP A;  5LEJ A;  5B1A H;  3BTL A;  2VXD A;  3QP5 A;  3BR6 A;  4BE2 A;  1MMN A;  3LOC A;  5ED4 A;  2DOF A;  5DS9 A;  3NWS A;  1B4A A;  3GFM A;  4N0B A;  1MNE A;  3MMY B; 
#chains in the Genus database with same CATH homology
 1G2H A;  4IHV A;  1NK3 P;  3CDL A;  3BG9 A;  2QIB A;  4ICH A;  2L7Z A;  3FK7 A;  2OPT A;  4DYR A;  1X2M A;  4V2G A;  5CXI A;  2M9H A;  3RZD J;  5IYB J;  5EG0 B;  1ETO A;  1GUU A;  3Q3S A;  1IDZ A;  3EUP A;  5FKM A;  4X6A J;  2XPV A;  3NPI A;  1VF9 A;  2G3B A;  2ECB A;  3ON4 A;  1IJW C;  1WH7 A;  5EF6 A;  2DA3 A;  3JRB A;  4DYC A;  2LKX A;  4MIM A;  2NS8 A;  1H8A C;  2XSD C;  1BL0 A;  3B6A A;  3BR5 A;  3BCG A;  1MSF C;  1HF0 A;  5CW8 A;  2HQ5 A;  3BQY A;  5K58 A;  3HOY J;  2RHA A;  4FCY A;  5J1U A;  5CXG A;  3QPL A;  3JRA A;  3LSP A;  2OER A;  1HDP A;  1W0T A;  1JJ8 C;  2V57 A;  2DMP A;  2M34 A;  2JMW A;  5DTD A;  3VVX A;  3HB9 A;  1WH5 A;  3VVY A;  3HOU J;  3ON2 A;  2LTP A;  5HSZ A;  2ME6 A;  2GM4 A;  2O7O A;  3F1B A;  4GFK A;  4NEL A;  3ZQI A;  3TP0 A;  3VW1 A;  2P81 A;  1POG A;  5C4J J;  2HOA A;  4GCK A;  2AHQ A;  2ZB9 A;  1F36 A;  2EBI A;  3M3Y J;  3S17 J;  4DYQ A;  3I4M J;  3W6V A;  3BG5 A;  1H89 C;  1TWH J;  5HOD A;  1IG7 A;  1TWG J;  1X58 A;  3HM5 A;  1IUF A;  1LFB A;  3L1P A;  3ZQH A;  3O8H A;  5F0C A;  4X1E A;  3HOV J;  2E2I J;  1QRY A;  2WAQ N;  2GBY A;  1SFO J;  2JA5 J;  3JRE A;  2FBQ A;  3G7R A;  2VI6 A;  5H9T A;  1OCT C;  3BT9 A;  2DMT A;  3F0C A;  5FGL A;  1IDY A;  1T56 A;  1U78 A;  3OOU A;  2Y9Z A;  3VW0 A;  1Z77 A;  1QVT A;  3A01 A;  1FEX A;  4MFE A;  3LWJ A;  2YVH A;  1ENH A;  5HAW A;  5F08 A;  1JKO C;  3S16 J;  5F04 A;  1ZTR A;  1LE8 A;  2JN6 A;  2XPW A;  4AYB N;  1GVD A;  2DJN A;  2JK3 A;  5E3N A;  3JRD A;  5J3L A;  4EEF G;  5EEA A;  4A3F J;  3V78 A;  1HCR A;  2L7F P;  3FK6 A;  1K83 J;  1JT0 A;  3S1R J;  3WHC A;  3CWR A;  5F0F A;  4A3E J;  5FLV A;  3Q0U A;  4IEJ A;  3G1M A;  1GV2 A;  2DMQ A;  2EZH A;  3HDD A;  3S15 J;  3BG3 A;  4DZP A;  3VUQ A;  5C44 J;  4BBS J;  3HOZ J;  3JRG A;  3ZQG A;  3ZQC A;  4S0H B;  3FIW A;  5J1Y A;  1R9T J;  5IYC J;  2M0C A;  2NS7 A;  2Q24 A;  4AUX A;  4KWA A;  1ETY A;  2ECC A;  2LK2 A;  3IH3 A;  4AC0 A;  1RET A;  2DG7 A;  3HTA A;  5GPC A;  1IC8 A;  2DA4 A;  5EFY A;  3AQS A;  5D18 A;  2TRT A;  4BKX A;  2LD5 A;  1MBJ A;  2LY9 A;  3BTC A;  5FJ8 J;  3KZ9 A;  2Y31 A;  1VFC A;  3MVP A;  4JYK A;  4FIS A;  2ZCX A;  1I50 J;  2E19 A;  1OCP A;  2WV1 A;  4CYC B;  3NNR A;  3GTP J;  3GTO J;  1E3O C;  2XRL A;  3JSJ A;  5D19 A;  4CYC A;  2VPR A;  3DCF A;  2QF7 A;  3JRC A;  2R5Z B;  1MBE A;  2CRG A;  2EH3 A;  3K7A J;  1OFC X;  4RBO A;  1MNM C;  1FIA A;  4JP0 A;  3M4O J;  2E2J J;  3NAU A;  3PAS A;  2WB1 N;  1APL C;  2G0E A;  1ETV A;  2Y30 A;  2L9R A;  1W0U A;  2HKU A;  1B8I A;  2JA6 J;  1U8B A;  5E3L A;  1JJ6 C;  2H8R A;  4GCT A;  1MH4 A;  1UHS A;  4AF5 A;  5GPA A;  1FJL A;  3NI7 A;  1CQT A;  3S2H J;  3C07 A;  1B72 A;  2TCT A;  2HXO A;  2IAI A;  1RKW A;  3QPS A;  3DPJ A;  4I76 A;  3RKQ A;  3COL A;  3JR9 A;  4A3L J;  2K9N A;  3IH4 A;  1P7I A;  3SJM A;  1PUF B;  4D5C A;  2KT0 A;  2UXP A;  3TW6 A;  4M3E A;  5FKO A;  3HGG A;  1EF4 A;  2EZK A;  3S1M J;  3ANG A;  4D7N A;  4DW6 A;  2XB0 X;  3Q0V A;  2B63 J;  4Y52 J;  3BQZ A;  5C3E J;  4MLO A;  5FMP A;  2JJ7 A;  2O9L A;  4IHX A;  3TW7 A;  1WGX A;  3G1O A;  3IUV A;  2EZL A;  1BW5 A;  5IPA A;  3NXC A;  4M6V A;  3VOX A;  2HYJ A;  1O4X A;  3HE0 A;  2F07 A;  3UKG A;  3EGQ A;  2JA7 J;  2NX4 A;  2FQ4 A;  5FKK A;  4C3H J;  2GEN A;  2YU9 J;  4D5F A;  5FLM J;  2LFB A;  5GP9 A;  3LHQ A;  5F0H A;  5HBU A;  1VI0 A;  1ZQ3 P;  4A3M J;  2CQX A;  1XG1 A;  3D1N I;  1MBG A;  2ME0 A;  5C4Y A;  1JGG A;  3PO2 J;  2R5Y B;  3T6N A;  3JRF A;  3BR1 A;  1XS9 A;  5M5X J;  2MW8 A;  3BR0 A;  1X2N A;  5IOZ A;  3QBM A;  4C3I J;  5IP6 A;  4BXX J;  1T33 A;  1IRZ A;  1RKT A;  5JLW A;  2LR8 A;  2Y0S N;  4JX6 A;  4M3B A;  4IHY A;  1DU6 A;  9ANT A;  3BNI A;  5EG0 A;  2D6Y A;  2PMZ N;  4LOC A;  4W97 A;  4ACI A;  2X6O A;  2DA6 A;  1FTT A;  5EYR A;  1Z0X A;  3I4N J;  3ZQF A;  1WI3 A;  2YUS A;  3BR3 A;  2IEK A;  2MG4 A;  2NVX J;  3HOW J;  2W53 A;  3P9T A;  3H0G J;  3LNQ A;  4ABZ A;  1MH3 A;  1RES A;  4B4C A;  2WGB A;  1ZR2 A;  4A3I J;  3ZQL A;  4C3J J;  2NOG A;  5M3F J;  3GZI A;  3GTM J;  3GTL J;  1LFU P;  4GCL A;  2COB A;  3S1N J;  1RR7 A;  4UUS B;  1FIP A;  2XGD A;  3NAR A;  4YZE A;  3AQT A;  3MKL A;  2UXI A;  2XPU A;  5EZH A;  4IHW A;  5E3M A;  1JUS A;  2XB5 A;  1F43 A;  2RAS A;  1IV6 A;  4A93 J;  2GFN A;  3FKI J;  3A01 B;  3G56 A;  3A02 A;  1JUM A;  2X48 A;  1MSE C;  3B81 A;  2DMU A;  1UI6 A;  3GBG A;  3OIO A;  3CQZ J;  3QQA A;  4D7M A;  1WCM J;  3KNW A;  2HXI A;  4V2F A;  2ELK A;  4BY1 J;  1H88 C;  1I6H J;  1IGN A;  2L7M P;  2HDD A;  3LJL A;  4PXI A;  2K9S A;  4B1R A;  2FX0 A;  1QPI A;  1BJZ A;  3KKC A;  3IH2 A;  4BY7 J;  2VKE A;  3VVZ A;  5D1R A;  1U9N A;  3GTJ J;  2QTQ A;  1TWF J;  3NRG A;  2H1K A;  2R92 J;  2R5Y A;  3HIM A;  2LLK A;  2JWT A;  2AO9 A;  3C2B A;  4BBR J;  3JRH A;  1UMQ A;  5IP9 J;  3HTH A;  3OSG A;  1TWA J;  4A3B J;  2YVE A;  3MNL A;  2R0Q C;  2UXH A;  4A69 C;  1NK2 P;  3BHQ A;  3V6G A;  3GTQ J;  1GV5 A;  2ID3 A;  4B3A A;  1GT0 C;  2G7S A;  4M3F A;  4NN1 A;  3HEF A;  1BW6 A;  5M5W J;  1UG2 A;  1JKQ C;  4JX5 A;  3VIB A;  1MBK A;  1Y1W J;  1JKR C;  3RD3 A;  5M5Y J;  4GFB A;  5F27 A;  1Y1V J;  5EZG A;  2K9Q A;  3S1Q J;  3G1L A;  3O8G A;  3S14 J;  2R5Z A;  5K7H A;  5C4X J;  2NP3 A;  3MN2 A;  4DZJ A;  2CJJ A;  1DU0 A;  1BA5 A;  4M3G A;  1K61 A;  3IV5 A;  5IYD J;  2DA1 A;  2KDZ A;  3WHB A;  1YRN A;  1AHD P;  3PPB A;  1ETW A;  1YRN B;  1ETK A;  2DMN A;  4XK4 A;  3BR2 A;  1VND A;  1LE8 B;  2JA8 J;  1B72 B;  3GTG J;  3CJD A;  4A3J J;  2IU5 A;  5FKN A;  2L0K A;  1XC5 A;  3ZOB A;  1D5Y A;  4I6Z A;  2XGC A;  2YS9 A;  2OI8 A;  2OF7 A;  1HLV A;  5F1J A;  1P7J A;  3GTK J;  2QOP A;  3VW2 A;  2ZOZ A;  4MXM A;  3K2A A;  4C2M J;  4XRM A;  4RDU A;  2VUM J;  4L62 A;  5EGO B;  1JT6 A;  2ZOY A;  2EZI A;  2E1O A;  2IBD A;  2DN0 A;  3RQI A;  4XID A;  1ITY A;  2K40 A;  2M2E A;  5EGO A;  4J19 A;  3VPR A;  3HOX J;  4FTH A;  2PZ9 A;  4XRS G;  2UXO A;  3TP3 A;  3E7Q A;  1MBH A;  1ZR4 A;  1ZKG A;  1A5J A;  2DG8 A;  2M8G X;  4FE4 A;  4QIW N;  3HTJ A;  3CRJ A;  2DTZ A;  1ZGW A;  1UI5 A;  3H3V K;  4UUT A;  3Q0W A;  2DA2 A;  1RPW A;  3RH2 A;  2DA5 A;  3BTJ A;  5E3O A;  2Y9Y A;  3LSG A;  4XIC A;  4UDS A;  2VKV A;  3BJB A;  3HBL A;  3O60 A;  1QVU A;  5K7Z A;  2O7T A;  2HI3 A;  1ETQ A;  5IP7 J;  4Y7N J;  2RAE A;  3PO3 J;  3GEU A;  2QKO A;  2WUI A;  4A3K J;  4NDL A;  2I10 A;  4A3G J;  4XRS A;  3S5R A;  4JL3 A;  3TED A;  2W48 A;  2LVS A;  4GFL A;  3LSJ A;  1S7E A;  5EDN A;  2LP0 A;  1A6I A;  4HKU A;  4L5E A;  4FE7 A;  5M3M J;  3CCY A;  2FD5 A;  2Y2Z A;  1B8I B;  2HOT A;  4A3D J;  4AC6 A;  1Q1V A;  2FJ1 A;  2O8K A;  2ZCN A;  4CGR A;  2CUF A;  2NP5 A;  5K7F A;  3S2D J;  2EQR A;  3SFI A;  1SGM A;  1TWC J;  4QSH A;  2QWT A;  3HTI A;  2HYT A;  2ID6 A;  2QCO A;  5BNG A;  2XGE A;  2MGQ A;  3B6C A;  1ORK A;  1U9O A;  3PM1 A;  3ANP A;  3VP5 A;  2G7L A;  3A03 A;  1PUF A;  4G12 A;  5DAJ A;  1TC3 C;  1ZK8 A;  4JX4 A;  4MO7 A;  2GUH A;  1MBF A;  4MFD A;  5J1R A;  1WPK A;  3JRI A;  4M3D A;  1AKH B;  2UXU A;  4MK6 A;  3OSF A;  2NVT J;  3BRU A;  1AKH A;  5IOY A;  2G7G A;  2E2H J;  2R7Z J;  4A3C J;  2REK A;  3FRQ A;  5FKL A;  2GLO A;  2CUE A;  3HGY A;  2R93 J;  3LSR A;  5FHP A;  5AQC A;  5JLX A;  2HOS A;  2MSY A;  2PBX A;  1ETX A;  2CQQ A;  1I3Q J;  4HNV A;  3KKD A;  3SDG A;  2DA7 A;  4JNN A;  2XDN A;  1SAN A;  1GDT A;  1AU7 A;  3E7L A;  2D5V A;  2NVQ J;  4JKZ A;  3VOK A;  1HOM A;  1HDD C;  4QTR A;  3HKZ N;  4ME9 A;  2N8G A;  3RZO J;  4W1U A;  1JTY A;  1JUP A;  3BTI A;  1OJL A;  3CMY A;  1JKP C;  1JTX A;  3QKX A;  2CU7 A;  2NVY J;  2ZCM A;  3BTL A;  3BR6 A;  1FTZ A;  3LOC A;  5DS9 A;  1NTC A;  3FIS A;  3DEW A;  2X9D A;  4UUS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...