3CCYA

Crystal structure of a tetr-family transcriptional regulator from bordetella parapertussis 12822
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
192
structure length
192
Chain Sequence
YENIRDTIIERAAAMFARQGYSETSIGDIARACECSKSRLYHYFDSKEAVLRDMLTTHVDSLLERCRQVLYGSNEPKTRFLQIVKLFLEIYATSRDRHVVMLTCLDALPEDQRKALIAKQRELIAYVRDALLQLRPDMAANRTLAHVDTMLFFGMINWTYTWYKADGSVSPDALAERTVQLFLDGYLNLLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative TetR-family transcriptional regulator
publication title The crystal structure of a TetR-family transcriptional regulator from Bordetella parapertussis 12822.
rcsb
source organism Bordetella parapertussis 12822
molecule tags Transcription regulator
total genus 65
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17932 TetR_C_24 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3ccyA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3ccyA02
2M2EA 2VI6A 1BL0A 1WH7A 1YRNB 2TRTA 4ME9A 3RH2A 3VW2A 2WUIA 1X2MA 3QKXA 3JRHA 3M4OJ 1G2HA 4FE7A 4MLOA 5IYCJ 2VKVA 2R5ZB 3F0CA 3CQZJ 1QPIA 2YVHA 1B72B 3LHQA 4JNNA 2YU9J 3HB9A 2FX0A 2NP3A 3CCYA 3BQZA 2Y30A 2M8GX 2VKEA 4EEFG 1A5JA 2LKXA 3VOXA 2P81A 2DA1A 5D19A 4AUXA 1MBKA 2EZKA 3DPJA 1I3QJ 2ME0A 3S17J 3JRGA 5EZHA 4BBRJ 3IH2A 3PPBA 3Q0VA 5C3EJ 3QPSA 2G0EA 1RETA 3ON2A 4LOCA 2RAEA 1OFCX 1XC5A 2L7MP 3ON4A 2REKA 2RHAA 3S15J 3ANPA 4A3DJ 3HOWJ 3BG3A 4XK4A 1QRYA 3JR9A 3HOVJ 2NVYJ 2DMPA 4DZJA 2DMNA 1W0TA 3NAUA 4IHYA 3PO2J 3E7LA 3IH4A 5F0HA 3M3YJ 4DYCA 3LSGA 2G7GA 1X58A 2B63J 2TCTA 4DYRA 2ELKA 5FHPA 4QSHA 2QOPA 1ETVA 4A69C 2XSDC 2M0CA 2K9QA 3Q0UA 4ICHA 1CQTA 5FMPA 4AC6A 4IHWA 3PASA 5BNGA 3BR6A 4PXIA 1WPKA 3RZOJ 3BCGA 5E3OA 2AO9A 5AQCA 3GBGA 2JA8J 2OPTA 5JLXA 2E2JJ 5CXIA 2QKOA 3EGQA 2L7FP 1OCTC 3DEWA 4A3KJ 3C2BA 4Y7NJ 2HYTA 3NNRA 5FKLA 2JA7J 4V2GA 1AHDP 3H0GJ 1UHSA 5C4XJ 1IDYA 2UXHA 5EG0A 4NELA 1JUMA 1MBJA 2KT0A 5IP6A 1SANA 3VW1A 3TP0A 3T6NA 1APLC 3LNQA 3BR2A 3BTJA 5FKKA 3JRCA 1BW5A 3HOYJ 2NOGA 3BR1A 2E1OA 2OI8A 1P7IA 3V78A 3HM5A 5J3LA 2G7LA 2IAIA 1GV5A 2CU7A 1FIAA 5J1YA 3VIBA 2XGDA 1Y1VJ 3FIWA 2QWTA 2WGBA 2RASA 1IG7A 5DTDA 1GDTA 2HOSA 2X6OA 3OIOA 1YRNA 4A3GJ 4MFDA 5K7HA 2COBA 4I76A 3S2HJ 5EG0B 4DW6A 1NK2P 5IYDJ 2UXOA 3HOZJ 3CMYA 3BG5A 1JT6A 3TEDA 3NPIA 3NRGA 3VVYA 1QVTA 3IH3A 5E3LA 4UUTA 3LSJA 4RBOA 2AHQA 4HKUA 3VUQA 1MBEA 3CRJA 2ZCXA 4BY7J 1Y1WJ 3HIMA 3TW7A 3BR0A 1OJLA 1U8BA 1T33A 3OSGA 1S7EA 3CWRA 4GCTA 1A6IA 3GTQJ 2DA6A 2IEKA 1U78A 2HYJA 3HTAA 5HBUA 3BTCA 2E19A 2Y31A 3QPLA 5GPAA 4GCLA 1NTCA 3PO3J 4C3JJ 2JK3A 3S2DJ 4M3EA 1HCRA 3K7AJ 1MBFA 4MIMA 5HODA 5FLVA 2GFNA 4YZEA 4C3IJ 3VVZA 4JL3A 5C4YA 5EGOA 1WI3A 1IJWC 2R5YA 1Z0XA 2L7ZA 3IV5A 2GBYA 3A01A 4M3DA 1IRZA 3G7RA 2JWTA 2HOTA 5CW8A 1T56A 1IDZA 3CJDA 1ORKA 1U9OA 3JRBA 2LTPA 3HOUJ 3HE0A 3LWJA 4W97A 4AYBN 3HBLA 2NVQJ 4FISA 4XRSG 3G1MA 2HOAA 2X48A 3W6VA 3ZOBA 2LLKA 2QIBA 1AU7A 1FIPA 2HQ5A 4GFLA 2H8RA 5FLMJ 2YUSA 2XRLA 1NK3P 1RPWA 1PUFA 2F07A 2CJJA 3HDDA 2NS7A 5EGOB 2UXUA 1JJ8C 3I4NJ 4RDUA 2Y9ZA 1IUFA 2CUFA 3O8HA 5J1UA 5E3NA 4A3CJ 2I10A 3MVPA 2R5YB 1B8IA 5HAWA 3A01B 2DN0A 1RR7A 1R9TJ 1I50J 5M3MJ 2LK2A 4W1UA 2R0QC 2UXIA 3SJMA 1X2NA 3RZDJ 9ANTA 4MFEA 1BJZA 3G56A 1JJ6C 1ZGWA 3H3VK 2XPUA 1I6HJ 2JN6A 2Y2ZA 5FKMA 1PUFB 2R92J 1IV6A 3GTGJ 5IP7J 2EH3A 2LP0A 3ZQHA 3BQYA 3D1NI 3EUPA 2EQRA 4AC0A 3VPRA 2XPVA 4D7MA 1TWGJ 4BKXA 1B8IB 1F43A 1H8AC 3DCFA 5EZGA 3FISA 4MO7A 1W0UA 4FTHA 4I6ZA 1ZR2A 1HDDC 2QF7A 2GUHA 1ETQA 1VF9A 3OSFA 2KDZA 2O8KA 2ID6A 3VW0A 2YVEA 3HKZN 1O4XA 2XGCA 5EYRA 2Q24A 4KWAA 1GVDA 2FD5A 5IOZA 1XG1A 2GM4A 3RD3A 3JSJA 4IEJA 3E7QA 4D7NA 4ACIA 5IYBJ 2R7ZJ 1HLVA 2HKUA 3JRAA 1HOMA 3CDLA 5M3FJ 5M5XJ 1Z77A 5M5WJ 4FE4A 5EF6A 1XS9A 1HF0A 1SGMA 3HTIA 2M34A 3B6AA 3QBMA 1HDPA 1JTXA 4B4CA 3ZQGA 2L0KA 4C3HJ 4A3EJ 5D18A 1POGA 3COLA 3BTLA 2DG8A 2EBIA 3KNWA 2HI3A 4QIWN 3JRFA 2ID3A 4IHXA 1JKQC 2HDDA 3AQSA 4NDLA 3BJBA 4L62A 4D5FA 3S14J 3ZQIA 4M6VA 3BNIA 1IGNA 1JKPC 1IC8A 5K58A 2DMUA 2IU5A 2WAQN 3NARA 3GTKJ 1UMQA 4V2FA 5D1RA 2O7TA 4M3FA 3O60A 2R93J 1ETKA 4B1RA 3SDGA 1TC3C 2OF7A 3BG9A 3S16J 4A3LJ 3HGGA 1GV2A 2XDNA 3TW6A 2Y0SN 3WHBA 2ME6A 5FKOA 3HOXJ 3B6CA 1BA5A 5E3MA 2IBDA 2LD5A 5FGLA 4CYCA 5EDNA 2FJ1A 1LFUP 1OCPA 1TWAJ 2UXPA 4G12A 4JYKA 2OERA 4IHVA 2DMQA 3GEUA 5GP9A 3KKCA 3BHQA 2O9LA 5DAJA 3RKQA 4JKZA 5EEAA 3G1OA 1FTTA 2EZHA 1MH4A 2NVXJ 1FJLA 2HXOA 5F27A 2DA4A 2K9SA 2XGEA 1MSFC 1AKHA 2MW8A 3KZ9A 1ZKGA 4FCYA 3O8GA 1ZR4A 4S0HB 1UI6A 5H9TA 2DA5A 5HSZA 2CRGA 2MGQA 5F08A 5C44J 1D5YA 3VVXA 2JA6J 4XRSA 1MSEC 4JX4A 3FRQA 3PM1A 4B3AA 5FJ8J 1VI0A 2NS8A 3GTLJ 4M3BA 4CYCB 1MH3A 5K7FA 3VP5A 2Y9YA 2PBXA 2H1KA 4NN1A 2ZCMA 3S1QJ 1DU0A 1FEXA 3ANGA 2LFBA 5JLWA 3K2AA 4MK6A 2E2HJ 1Q1VA 2CQQA 3JRIA 1QVUA 3Q3SA 1MBGA 2DA3A 5IOYA 3LSPA 1ITYA 2FQ4A 3HEFA 1ETXA 1RKWA 5F0CA 2LVSA 2LY9A 1ETYA 4X1EA 1AKHB 2V57A 3S1MJ 4BXXJ 3ZQCA 3LJLA 4A3FJ 5IP9J 2L9RA 3BR5A 2CUEA 1JT0A 4JX5A 2M9HA 3MNLA 2WB1N 1GUUA 2JMWA 3OOUA 1ENHA 1EF4A 1LE8A 2D5VA 3JRDA 1BW6A 2LR8A 3NI7A 4XIDA 2JA5J 5K7ZA 3KKDA 4D5CA 3S1RJ 2QCOA 1H89C 1ZK8A 1ETOA 2XB0X 3WHCA 1JGGA 3FK6A 4UDSA 4GFBA 1TWFJ 3Q0WA 4CGRA 1WCMJ 3BR3A 1K61A 5F0FA 3GTPJ 2CQXA 1TWHJ 1WH5A 2DTZA 4JX6A 3UKGA 3LOCA 1K83J 2G3BA 2VPRA 2JJ7A 4A93J 3V6GA 2EZIA 2E2IJ 1LE8B 4AF5A 1MBHA 2N8GA 2PZ9A 1RKTA 2MSYA 2GENA 2ZCNA 1UG2A 5GPCA 4QTRA 3FKIJ 4JP0A 1GT0C 1H88C 4MXMA 2YS9A 4DZPA 2DMTA 2O7OA 3GTOJ 1F36A 3A03A 1SFOJ 2EZLA 4L5EA 4UUSA 5IPAA 4X6AJ 3S1NJ 3BRUA 3HGYA 3MKLA 3A02A 3FK7A 3F1BA 2NP5A 3LSRA 1JKRC 2D6YA 2DG7A 2DJNA 4GFKA 4M3GA 3MN2A 2DA7A 3GTMJ 4DYQA 1ZQ3P 2K9NA 4A3IJ 3ZQLA 2WV1A 4Y52J 3GZIA 3GTJJ 5C4JJ 3VOKA 2G7SA 4BY1J 2VUMJ 1ZTRA 3P9TA 2XB5A 2W48A 3ZQFA 2GLOA 2ZOYA 1JKOC 5EFYA 4UUSB 4J19A 3BTIA 1FTZA 5F04A 2X9DA 3L1PA 1ETWA 5DS9A 1MNMC 2MG4A 1TWCJ 3IUVA 2ZOZA 3RQIA 4A3MJ 3B81A 2NVTJ 2K40A 3I4MJ 3TP3A 3HTJA 3AQTA 5FKNA 4XICA 4BBSJ 3SFIA 3JREA 1WGXA 1JUPA 1JUSA 1U9NA 2HXIA 1VNDA 4HNVA 1UI5A 1RESA 3BT9A 2R5ZA 3S5RA 1E3OC 2QTQA 2ZB9A 1B72A 5CXGA 4XRMA 1P7JA 4GCKA 2ECCA 4A3BJ 3NXCA 4ABZA 2FBQA 3C07A 1JTYA 1LFBA 2DA2A 4A3JJ 4C2MJ 5M5YJ 2ECBA 1DU6A 2PMZN 1VFCA 2XPWA 3G1LA 5J1RA 2W53A 2NX4A 3HTHA 5F1JA 3QQAA
chains in the Genus database with same CATH superfamily
2HVSA 3ZMDA 1WH7A 2HGCA 3PQKA 4HW0A 1LJ9A 5GAGJ 3EYIA 1BI3A 3MEXA 1AWCA 1P9QC 1YOVB 4DBRA 2BVLA 4XLPF 1RZ4A 4GGGA 1D8KA 3ZQ7A 3KZIC 1PUEE 2QBYA 2YVXA 4MLOA 2VKVA 3RYRA 3SXYA 4PFPA 5BPDA 1TNTA 1B72B 2V79A 1E0EA 3ESWB 3BQZA 1WRJA 4HEA2 1F4KA 2VKEA 1LPQA 4BU2A 2JQ7A 1FY7A 3J80K 3DBHB 3RKYA 3KYLA 1MBKA 4CCMA 3DPJA 3GXOA 4NUBA 2E1MB 3KFWX 5ICEA 5L3GA 3H5NA 2KRFA 1AOYA 3DBRB 3FMRA 5L3EA 2QEXI 2D2WA 3HJEA 3KP5A 4LOCA 1OFCX 4IKFA 1XB4A 3ON4A 2REKA 2EIJH 3ANPA 3WU1B 3CC2I 3HOWJ 2K02A 4XK4A 1BOBA 2XVCA 5HNHA 3BZKA 3NAUA 2DW4A 4PFOA 4IHYA 3PO2J 1YFHA 3M3YJ 3K1MA 4DYCA 2VQLA 2DAOA 3LSGA 3WTWC 2L02A 2JPCA 3PFYA 2G7GA 1X58A 4ESFA 2IGMA 1IRXA 1TNSA 5E1ZB 4QSHA 1W5SA 4XN3A 1A31A 2FXAA 3WU2C 2M0CA 2K9QA 3Q0UA 4RGSA 5LBQA 5FMPA 1M1EB 4BNCA 2W85A 3RZOJ 3BCGA 4NQWA 1VQLI 5F6FA 2X4HA 5JLXA 2QQ9A 4KN4X 2WADA 3OYNA 1OCTC 1RC9A 2E7WA 3DEWA 1OKRA 4TV7A 5FKLA 3LFUA 3A2KA 4FT8A 1SAXA 3MZYA 2UXHA 4G6DA 5DYMA 1WQ2A 3MKZA 2ZFUA 1D0XA 5IP6A 3VW1A 2E60A 3T6NA 4CYDA 5DM7F 2R7UA 4XLEA 3BR2A 3BTJA 3KP4A 1VQPI 4BAYA 1BW5A 2ETHA 1VQMI 4F3QA 3HOYJ 3HRSA 3NQOA 3BLYA 4U88A 4NQWB 4YFNF 1J9IA 1P7IA 4OIQF 2OV7A 3IAM2 3LQQA 5FD6A 2RQQA 1SEUA 1GV5A 5F64A 1XSDA 2CMPA 3VIBA 4PSXA 3LL7A 1YIOA 1IG7A 1UCRA 3QOPA 5EEGA 2X6OA 1IO2A 1N25A 2JTVA 4L9VA 4N4NB 1FYLA 3HOZJ 3J81K 2P0WA 3BG5A 2KIFA 3E1SA 5E3LA 3FF5A 2BXZA 1FMVA 3LSJA 2R7TA 1UHMA 3K4NA 3Q9SA 4HX7A 2AHQA 4HKUA 3VUQA 1Y1WJ 3HIMA 1Y0UA 3BPXA 4XRFA 2ZO4A 2H94A 5FRNA 3L2CA 4KICA 3V7SA 1BC7C 2EA4A 4U87A 1HKTA 3BTCA 2JK3A 1YW7A 2A6TA 1HCRA 4YZEA 2LF8A 4HF0A 3GUDA 5HODA 5FLVA 4NBQA 1W5TA 3F6VA 2IS2A 1IRGA 1XCBA 2IS1A 4AVZA 1WI3A 4A5NA 2K3FA 1VZ0A 2IGOA 3FXRA 2L7ZA 4LD5A 3ZCOA 2G7HA 4LK1F 5BS6A 3GZNB 2H27A 2P4WA 2EWNA 3G71I 2LTPA 4L5IA 5DEQA 4CUGA 3HE0A 2WAFA 4L5JA 2V4JC 4FISA 2HOAA 3S3OA 3W6VA 2RREA 3BJ6A 3ZOBA 3W2AA 4PJLA 2LLKA 3K4CA 2L5QA 5LGTA 1FIPA 2QIBA 2F5FA 1OR7A 3ZP5A 2H8RA 4UVBA 3M1EA 4MEYF 4QPOA 1MMNA 2F07A 3HDDA 2NS7A 2M45A 4UV9A 1ZN2A 4RDUA 5JVGF 5J1UA 1VQOI 2KDOA 1Y6IA 2ZXWH 4EJUA 4EM1A 1J75A 1SD4A 4CCNA 2PQ8A 2HYGD 2RQPA 1RR7A 4WXCA 1R9TJ 3LSHA 2WTEA 3TMOA 5M3MJ 3HIFA 4LJZF 4BHCA 3QPTA 2R0QC 2DJIA 2GIVA 3ULQB 5HS9A 3TGNA 9ANTA 4MFEA 2PFBA 2M4GA 3AG2H 1TT0A 5J8FA 3ABLH 1I6HJ 2JN6A 5FKMA 1QBJA 1IV6A 3RQ4A 1V5EA 3BQYA 4KUMA 3PNVA 3GYHX 1R23A 3RKXA 4AC0A 1WI9A 2RN7A 1F43A 1TW2A 4ITVA 5EZGA 3ZRGA 3FISA 1V55H 2X1DA 3DBLB 3ABMH 4I6ZA 2WV0A 2XV4S 4AIDA 2BW3A 1D1CA 2RVCA 2OA4A 1FZPB 3KZYA 4UB6C 2OCEA 3OSFA 3KLOA 4RB1A 2R7VA 2Z3YA 3V7CA 5EYRA 1JE8A 3M07A 5GTIC 3CP2A 3ZN0A 3OIQA 2VN2A 4EV0A 4YELA 2D1HA 2LY1A 2AXTC 3IRRA 6PAXA 4WF2A 3WTTC 2W7NA 1R22A 4JQFA 4D7NA 3G2BA 3A0HC 2E7XA 2B7EA 1HLVA 1HBXG 3JRAA 2MLGA 1MJ9A 3CJQB 4XM3A 2IT0A 1KZHA 1Z77A 2J5OA 2STWA 4XONA 3KX2A 3PQJA 1HDPA 1GXQA 2BW3B 5JR3A 4M9SA 3S3NA 4G8XA 1YS6A 3LQRA 4A3EJ 2O6GE 4CZCA 1YYVA 4EJWA 2OZ6A 3JRFA 1ZLKA 1TQIA 2E1CA 4NDLA 1LNWA 1USTA 3CUQA 1NH3A 1R71A 3ZQIA 4AVPA 2O5RA 5JHFA 2IU5A 1HW5A 3NARA 1UMQA 3HXLA 1Z6TA 3G6EI 2ZY9A 2JSCA 2ZCWA 1BI1A 1ETKA 3DXJF 2DODA 3SDGA 1TC3C 2OF7A 1HW1A 3HGGA 2XDNA 2XUBA 3P5JA 2X6WA 3IWZA 2VB6A 3E6BA 3BDDA 4QPQA 2L54A 1G3TA 4NNJA 1EKEA 1I39A 3HOXJ 5BPIA 3L2VA 3HTSB 3DWLE 1BA5A 5E3MA 4LG3A 4M71A 1R5GA 1D1AA 4E7JA 3CUQB 5FGLA 2M5WA 3JAMK 3I53A 4XLHA 2LC2A 4Z6YA 3JW4A 1IN8A 4G12A 2K86A 3HZJA 5CVVA 3GEUA 1E3PA 5GP9A 5HDGA 3BHQA 2O9LA 5DAJA 5EEAA 5L3DA 1SMTA 4C2MA 2MW8A 3V8LA 3KZ9A 1FSEA 1FBSA 3WGIA 1D1BA 4S0HB 2DA5A 2KHMA 2VJ4A 4GXOA 5F08A 4HDVA 2VE8A 2JA6J 4OD4A 4JX4A 4A2UA 2NS8A 2LSOA 3FXJA 3GF2A 5LLQA 2R7WA 2XIGA 2EILH 3HPGA 5GAHJ 4NC8A 2BBYA 2BY3A 1OR7C 4UHTA 1I1SA 3ANGA 2LFBA 4MK6A 1I1GA 3K2AA 1W36D 2OBPA 2EFPA 3LA7A 2CQQA 3KLNA 2DA3A 1QZZA 4N9HA 1T8IA 1ETYA 1U6GA 4FETA 4BEHA 2R7OA 1IXCA 4OINF 2JSPA 2NRAC 3NEUA 2L9RA 4CCJA 2MD0A 2W00A 2M9HA 4U0VA 4ZDOA 3MNLA 3OYFA 1OYIA 5ILSA 5DCMA 3I64A 2K27A 3K4LA 4IHSA 3SEQA 1I6XA 3JRDA 1BW6A 1X3UA 5L3CA 1U8RA 4XIDA 3KKDA 1XN7A 2WAQA 4D5CA 1F5TA 2QM3A 3M8FA 1JGGA 1ZGJA 3BCAA 1ZK8A 4XOPA 2XB0X 1TL8A 5IT9Z 1TWFJ 1U0JA 1FMWA 3BR3A 3CCQI 3CDHA 1Y8RB 3MZHA 4Q5SF 1WH5A 2DTZA 4LMYA 4BEHB 3OYDA 1VQ9I 5HDKA 1TZLA 1R49A 3QWLA 5D6EA 3LOCA 2IP2A 1YJWI 5LGNA 2VPRA 3SDBA 4A93J 1D0ZA 5DCMB 5GTHC 2PX9A 1ZAOA 4AF5A 2N8GA 2P8TA 4PGHA 3BROA 1RKTA 4BJTA 1KONA 1OCCH 2DMTA 2O7OA 2ZNYA 1F36A 2MFZA 3GTOJ 2FBKA 1N75A 1SFOJ 2P7VB 5IPAA 1Z21A 1BR1A 3BRUA 3EQLF 2M7BA 3FK7A 3F1BA 2KRCA 2TDXA 2LYCA 2M87A 3I5UA 2G9WA 3IL2A 2QQ8A 2O61A 5ERIA 4E6KG 3EUAA 5E1WA 2DA7A 5EJCA 3H3UA 3KP7A 3CCLI 3CCUI 2VOPA 2K9NA 2UV1A 4N0BA 2RNGA 2PLYA 3PNYA 1WJFA 2ADUA 4Y52J 2A68F 4ZTFA 2PMHA 2PFVA 2VUMJ 4KITB 2KJBA 3CUQC 3BJAA 2GLOA 2W48A 2R7FA 3F8NA 2X9DA 1ETWA 5DS9A 4HSTA 1MNMC 2H6BA 3JTGA 4A3MJ 4HV5A 3VFZA 4DOZA 3OIPA 2QA4I 3HTUA 2MABA 2HDCA 2LBFA 3IUOA 3AQTA 4CH7A 5LEKA 3HTJA 3H35A 3JREA 4HV6A 1JUSA 2VKHA 4HNVA 4P9FA 1QGPA 1E3OC 1R5ID 4OAZA 5CXGA 4XRMA 1P7JA 3I9V2 4GCKA 3NXCA 3OYIA 4KFCA 2F48A 1JTYA 2DA2A 2NAZA 4A3JJ 2FA5A 3K10A 3CC4I 1EJ9A 2VL8A 1FOYA 4HZFA 2P5VA 1KU7A 1YTYA 3G1LA 1MKMA 4M73A 5F1JA 3MCZA 3QQAA 2K85A 2VI6A 4U7BA 1BL0A 3BOQA 2CFOA 2TRTA 3ERED 3FXKA 3RH2A 3VW2A 4RLQA 3PIOF 2WUIA 3ECOA 2CV1A 3QKXA 3C2HA 2A3SA 5A2QZ 3AKZA 5D6FA 3E5UA 1YO5C 4HNTA 5IYCJ 2XF5A 3RPQA 3F0CA 1QPIA 2DBBA 3QAHA 3K1NA 3F72A 4Y13A 2YU9J 3LHQA 4M9ZA 4RGUA 1FOKA 1X4OA 1LDJA 1WFXA 5E79C 2F4MB 3LAJA 2M8GX 4UV8A 4EEFG 3OYBA 2FUG2 4S05A 2VQHA 2LKXA 3VOXA 3ELKA 2DA1A 4CHUA 5DUIA 5HVQC 2I8DA 2EPFA 1Z6RA 1FWZA 3AAFA 3CTAA 3LA2A 1I3QJ 1R58A 4L18B 4ZTJA 3S17J 2LKSA 3JRGA 5J4YA 4HF2A 2IGNA 5EZHA 4HG2A 1LDKB 1RETA 3ON2A 1QO0D 1TT5B 1Y8QB 1P2FA 1F9NA 3HOVJ 2DMPA 4DZJA 1SFKA 2DMNA 3IC7A 3H36A 2GAUA 3DLLF 3KEOA 1D5VA 2M7AA 4E7LA 1K6YA 4EJOA 3GO5A 5LEJA 1LDDA 3HSRA 3P9KA 4QLCU 1EA3A 3H9QA 2Z33A 3CCJI 4BJ6C 2TCTA 2WY8Q 4DYRA 2CO5A 2ELKA 2EV0A 4XORA 3PNTA 3WTUC 2DK5A 4WXDA 1IN6A 1BI0A 4ICHA 2WWYA 1TBXA 3L00A 2NVUB 4K2EA 4AC6A 3RPUD 1G59A 2QGUA 5BNGA 1SD5A 2GIZA 1WPKA 2L3DA 5FFZA 4PXIA 5J4VA 2ZMEA 5AQCA 3A0BC 3GBGA 3CZ6A 4XR6A 3KETA 3NRVA 4DIQA 2E2JJ 2E35A 2QKOA 3EGQA 2L7FP 5DV5A 4L9TA 4A3KJ 4CXFA 5DDGA 3I58A 2ZFWA 2PMZA 4CA0A 4JOMA 3NNRA 1AA7A 1XSXA 4XBFA 4HOBA 1UHSA 2DDBA 2Q2EA 3CLQA 3GZ5A 3CESA 4G7ZF 1JUMA 4IOAF 2KIQA 4GCVA 2PMUA 3SEZA 2FEZA 1G3SA 3S32A 2LREA 3BR1A 2ISYA 3R4KA 5E20A 2ZMEB 4BYYA 3V78A 1FOWA 1U5TA 5J3LA 3S8PA 4ESJA 2AQFA 3IP4B 1XDSA 1IN7A 3KEYA 3K70C 4AWXB 4BHBA 2R7RA 1S5LC 1Y1VJ 2XGDA 3FIWA 2QWTA 1S7AA 2HOSA 1XD7A 4MFDA 3IHUA 3ABTA 3SWHA 4XKWA 3S2HJ 2UXOA 4NC7A 5E1XA 4IF4A 3NRGA 1XGOA 1QVTA 5J6XA 4B09A 2M30A 2Y48A 2JRTA 2STTA 2V9PA 1QPMA 1BIBA 3CRJA 2ZCXA 1MMAA 3RDIA 3CO7C 1U5TB 3LWFA 1F1ZA 2K4JA 3TKYA 4Y33A 3OY9A 1UAAA 4GCTA 1A6IA 2F4IA 2B1EA 3HTAA 2L2OA 1IV8A 4GCLA 1NTCA 3DLAA 1DP3A 3PO3J 4C3JJ 4BGDA 4AIHA 3LAPA 2KISA 4JL3A 5C4YA 1G8XA 5EGOA 2VC1A 1IJWC 3HC7A 2DXIA 4OAYA 2ESHA 2XF7A 3IRQA 2IS4A 2JUCA 4XLAA 3IV5A 1G4DA 4HQEA 1IRZA 4OD5A 1P4XA 4UVCA 2JWTA 2CH0A 3T1BA 3QU6A 4QWQA 3CJDA 4IO9F 2A07F 5CVRA 3LWJA 3ISPA 3HBLA 1W4MA 4U7DA 2MC4A 2NVQJ 5FB2A 1JXSA 4LIVA 3L09A 2FOKA 1AU7A 1E3HA 2K9MA 3AG1H 5FLMJ 2XRLA 4M72A 2HS5A 1PUFA 2JVGA 1O3TA 5EGOB 2ZJ2A 2UXUA 2IA0A 2PBIA 3KE2A 1MMSA 3DPUA 3K69A 1B8IA 3FKJA 5HAWA 3ONQA 3SFZA 4YIRX 3FM3A 3IWFA 4D1QA 1I50J 3OS2A 1DGRM 1EV7A 3MKYB 2UXIA 4RAFA 3SJMA 1X2NA 1CGPA 3U2RA 1Y56A 3E97A 1W7PA 1SVOA 1BJZA 3G56A 1ZGWA 5TRDA 2IS6A 1HSTA 4XMYA 4ON0A 1PUFB 1VQ5I 2H1LA 2HQNA 1T39A 1J09A 3PSFA 3D1NI 3F3XA 1UFMA 2A05A 3VPRA 2XPVA 4D7MA 1TWGJ 4Q4ZF 3PSIA 1B8IB 1W0UA 4FTHA 2XKOA 1ZR2A 1VQKI 2NOJB 4KIFA 1C0WA 2MH9A 4XKBA 4XOTA 4BQNA 2ZMEC 3R60A 2BZTA 2GUHA 1WJAA 2G7UA 4MEXF 2DLLA 1ETQA 1VF9A 2E36A 2O8KA 3L2UA 2LY2A 2YVEA 1W7PB 4KWAA 1HC8A 1B6AA 1ZREA 4RAGA 2F4OB 3VYUB 2FD5A 1ONVA 2WC2A 4CCKA 1GLNA 4ACIA 4HQMA 2HPIA 4LITA 5IYBJ 5TJJA 2O3FA 5IT9K 5M3FJ 2EINH 4P5OA 4C9YA 3E6CC 5M5WJ 1HF0A 1SGMA 3PUFA 3JSPA 1ZLJA 1YITI 3VOEA 2HTSA 5FRMA 3O3KA 4B4CA 3S3MA 4IL6C 3DTEA 2L0KA 2QQAA 3ROUA 5D18A 2LDUA 4ZYEA 1U5TC 3LMMA 3HOSA 1ZH5A 3KNWA 2OJED 2HI3A 2LMDA 2L7KA 3DF8A 2ID3A 1LVKA 3ECHA 4E7ZA 3H92A 3BJBA 2DDAA 4L62A 4HLXA 4E7IA 3S14J 3HYIA 2KIMA 1JI8A 2X51A 4BDYA 4IRVA 3FBNB 1IRFA 1W7PD 2CQKA 3X2QH 1O3RA 5K58A 3GTKJ 1LVAA 4V2FA 5D1RA 1WWXA 4M3FA 4U0YA 3O60A 4ZDLA 2HTJA 4XN0A 4BE0A 5KCMA 3GLLA 4U9NA 2FRHA 2HFHA 2X0LA 3H9JA 2VIXA 4WCGA 2L4AA 2Y0SN 4B8XA 3WHBA 1FT9A 2KPMA 4HAMA 1B9NA 1Z05A 4UNOA 2DCEA 3FBIB 2BXYA 2COMA 2DT7B 3ASOH 1UZCA 4M9XA 2LD5A 3V42A 1MMGA 2BY2A 3CO6C 2UXPA 2E1MC 1G3YA 1GVJA 3T8TA 2DPDA 4ENKA 1REPC 1X1CA 5CVUA 3KKCA 4I7HA 1WJCA 1XMAA 3RKQA 4JKZA 2O0YA 1MH4A 2HQAA 2RGVA 1FJLA 1DPUA 3W6JB 2XSJC 5K5RA 4ZYAA 1K7AA 2CQ7A 3O8GA 1ZR4A 3E5XA 5ED4A 2ZC2A 3I71A 4FHTA 2CRGA 1P6RA 5C44J 2R7XA 4MTEA 3WG9A 4XRSA 1FP2A 2HZDA 3FX3A 3HSFA 3PM1A 5FJ8J 5BOXA 5L3BA 3VP5A 1T38A 4LFUA 3W6KB 2PBXA 1LB2A 1DUXC 2H1KA 2FOWA 2P6SA 4HX4A 4HNUA 2JT1A 3MKWB 1NHAA 5B3SH 2KQRA 4OWRB 3JRIA 3Q3SA 2XASA 1IAWA 3OS1A 3M9AA 2FQ4A 2V57A 5A2QK 2CW0F 4BQQA 2QYOA 2PG4A 2FNAA 4WX9A 2FNPA 2CUEA 4OMZA 3J7ZI 1JT0A 4LG0A 2WB1N 1ERDA 1U2WA 1EH8A 2DOEA 5IT3A 2R7SA 2D5VA 5D5UB 4XKVA 1ZRFA 3G73A 2VE9A 2EV6A 3MFKA 1RNLA 5K7ZA 4CZZA 2EB7A 1ETOA 3FK6A 4UDSA 4I99C 3HRTA 2QVOA 1Z9CA 1WKMA 3DP7A 1V4RA 4CICA 2MA3A 3WTXC 3M8EA 1J59A 2CUZA 5LGUA 2G3BA 2R3SA 2XF6A 3DU5A 4LG0B 2JJ7A 3FXOA 1N78A 1E17A 1FP1D 2A2FX 4C2UA 4PJNA 2O8XA 1MBHA 4IQ4A 4ENJA 1G6NA 2E1NA 2X1EA 3HOTA 5IY5H 3SHFA 2GENA 1UG2A 2RNJA 1GT0C 3FKIJ 2ZCNA 1H88C 4MXMA 4BS9A 3ZQQA 1DPRA 1ON2A 5FLXZ 2OAZA 3VODA 5HDNA 2VASA 2IGKA 2F5VA 3DPTA 5ILUA 2GWRA 3ZGKA 1A36A 3HGYA 3S1NJ 3DFGA 3MKLA 1EH7A 4ZYHA 2NP5A 1QZYA 4A0XA 1JKRC 3WODF 2D6YA 3NWTA 2KZVA 2DG7A 3CF5F 1CF7A 4M3GA 2VJ5A 4GFKA 1L0OC 4EGYA 3GTMJ 4WIBA 3K2ZA 2EJRA 4LIUA 4RB3C 3CCSI 1ZQ3P 3ZQLA 3GZIA 4IJAA 4XSZF 4GDFA 5D5WB 5EEHA 2XB5A 3ZQFA 2ZOYA 4PCQA 4J19A 1LKXA 1K78A 5F04A 4AM3A 3F8BA 1UG0A 3LSIA 1TWCJ 4A6DA 1O7LA 5DD8A 2P5LC 3RQIA 3B81A 2K9LA 3I4MJ 1NG6A 1LFPA 3V7RA 5FKNA 4XICA 4BBSJ 3FMQA 3LSTA 2A6EF 2E5ZA 1YLFA 1CF7B 1RESA 2OQRA 4S04A 2R5ZA 1XCVA 2FQ3A 3VEPA 2GA1A 2QTQA 4I0AA 2ECCA 3OL4A 4BQOA 2HZTA 3BP8A 4G94A 1E2XA 2L9VA 4XNFA 2PEXA 4E70A 2XPWA 1S29A 4EMSA 2NX4A 3WE3A 3J7YJ 1K78B 1KQ9A 2M2EA 1YRNB 1D0YA 4ME9A 4J01A 3D5RC 3U9GA 3WGHA 5DCFA 4F93B 1WVRA 3ABUA 1FPQA 1XMXA 3M8JA 5L3FA 1G2HA 4HYEA 4CCOA 1TTYA 2R5ZB 2DOFA 3SZPA 3CQZJ 1VQ8I 3GCMA 3D0SA 4JNNA 3DTKA 2K4BA 3HB9A 2FX0A 2NP3A 3HRUA 3CCYA 3DV8A 3LSKA 1QNTA 3CDIA 4P96A 3C18A 3K6GA 2CWEA 1USSA 5FGMA 1O3SA 2P81A 4UVAA 1J2XA 5D19A 4AUXA 4FASD 5HOOA 2MH2A 2EK5A 4P9UA 3PPBA 2KJCA 1W5CC 3Q0VA 2R7DA 3QPSA 2UUZA 3EUHA 1XC5A 2L7MP 3KP2A 4M6XA 2HWVA 2RHAA 4M74A 3BG3A 2HU9A 1QRYA 4BQAA 1Z3XA 4YFKF 1W0TA 5HLTA 1S9HA 3W2VA 3E7LA 2I5UA 3I0TA 3JSOA 4EJTA 2IA2A 3QU3A 2Q1ZB 4MHGA 2UZKA 4HA8A 2B63J 3KEQA 2IXSA 5H20A 2VONA 3HG9A 3FHNA 1KQ0A 2L01A 2VPLA 2QOPA 4A69C 1RIOH 1CQTA 2FSWA 3K0LA 1RUOA 3O6BB 3GWZA 3PASA 3KIOA 1S72I 4AIKA 2AO9A 4LLLA 1SFUA 5D8KB 1Z91A 3VSKA 4OIOF 3T5XA 2OPTA 3F8MA 2Y69H 5CXIA 2ISZA 3C2BA 4Y7NJ 4BH9A 2NYXA 4M6YA 2K3PA 2JA7J 2QWWA 3A4CA 4IRGA 4V2GA 5C4XJ 1IDYA 2EV5A 4Y15A 1SANA 2MD5A 4N9IA 3CC7I 4RAYA 3TP0A 1OCZH 3W2WA 3JRCA 2A5YB 1YX5A 4O6JA 1YW8A 1O57A 3WE2A 2OUMA 2NOGA 1ZG1A 3WTYC 4IPAA 2E1OA 2IA1A 4YG2F 3UNGC 5LD2C 1SC7A 2G7LA 1W36C 4KJZA 5E17F 2DFEA 4PJJA 2AS5F 1ZGAA 3QP6A 4IVNA 4G6TB 4ZH4F 2BOLA 1FYKA 1HA8A 3DU6A 5DTDA 2RASA 3EETA 3OIOA 4A3GJ 3CP8A 3DKWA 4P1WA 5K7HA 2VBWA 4I76A 3QYEA 4DW6A 1NK2P 2CUJA 2ICWG 2W57A 3BY6A 2VT2A 5KNLA 1LEBA 3TEDA 3WG7H 1Y39A 3IH3A 4UUTA 4RBOA 3BZCA 3VYSB 3PIPF 1V3FA 4YIFA 1QHGA 4DQ2A 2QSHX 3EYYA 1MBEA 1SFEA 4OIPF 3TW7A 2BHZA 1OJLA 1U8BA 2A61A 3OSGA 3OS0A 2VQGA 1S7EA 3CWRA 1P92A 2XAJA 1JHHA 2DA6A 4LB5A 3MZ8A 4F52A 4BE2A 5HBUA 2Q0OA 2Y31A 3QPLA 3C3WA 5GPAA 3RPUA 2F5DA 3MQ0A 4M3EA 3K7AJ 1MBFA 4MIMA 3VVZA 2ZXHA 2OZUA 2DU9A 1LUJB 4RB0A 5KVRA 3E5QA 1Z67A 1OYYA 4ENNA 4CSWA 2R5YA 4BJ5C 2CQNA 2GBYA 2Z99A 4M3DA 1OCRH 1DQUA 4KISA 1STZA 3JRBA 1X1PA 2DFFA 5HS8A 3VWBA 4AYBN 3E0JB 5HS7A 3K4JA 5K5OA 2CV2A 3V8JA 5LHGA 2X48A 3I54A 1IF1A 2L4MA 2JPBA 2HQ5A 2MC3A 4E7SA 4GFLA 5J40A 1WSUA 3JCUC 1XDUA 3DKYA 2YUSA 1IN4A 1R7JA 2XAHA 3L7WA 5CQGA 5LHHA 3I4NJ 4HSRA 3KYDB 3WU0A 1IUFA 2CUFA 3O8HA 4HLYA 2I10A 3MVPA 4RMNA 3PFIA 2R5YB 4MQVA 3CD6I 3T8RA 2QKLB 4A12A 2R4GA 3EUHC 2XAQA 4XLFA 4YRVA 2LK2A 4W1UA 4A5MA 4EATA 2HDWA 1JHFA 3QODA 3GFLA 4CDGA 3D5LA 2KMUA 1W1WE 2HVQA 2OTLI 3H3VK 3TL4X 2QLZA 4G7HF 2Y2ZA 3GTGJ 5IP7J 2LOOA 4PDKA 2EH3A 2LP0A 2FMYA 3FDYA 3EUPA 2NXNB 3L2RA 1FLIA 2EQRA 1DDNA 1YJ9I 1TP4A 4KN7X 5AIQA 2RDPA 4WXHA 1IN5A 4PK4A 1VQ4I 2KDZA 2ID6A 3HKZN 3CMMA 2XGCA 2XAUA 4P55A 3GW2A 2Q24A 4BHPA 1GVDA 3HSEA 1XG1A 2GM4A 1FBQA 3JSJA 2K5CA 4J00A 3C2GA 4DJAA 1BOAA 4KDPA 2R7ZJ 2HKUA 1HOMA 3CDLA 3CMAI 2XGXA 2ZJRF 5M5XJ 4XKCA 1XS9A 5EF6A 2M34A 4HBLA 4IRHA 5JFRA 2XC7A 2VODA 3QBMA 5D8LB 3P9CA 3ZQGA 5J47A 2V1XA 4C3HJ 2CGPA 3K4KA 1POGA 4BDZA 3BTLA 2X1CA 2DG8A 3COLA 1P4AA 3TDZC 3SQNA 2LF7A 1RR8C 5K5QA 1JKQC 4IHXA 3FMSA 2K7LA 4D5FA 2EFOA 2XDVA 3MD2A 4M6VA 1TQMA 3BNIA 3BJOA 4C2TA 5KAIC 5FLXK 1IC8A 2DMUA 1T08B 4B43A 1OLTA 2O7TA 2YX7A 4HX8A 2R93J 4B1RA 3AFHA 2NNNA 1RI7A 4ETSA 4H0EA 1ZRCA 3MWMA 3BG9A 4A3LJ 3OYCA 1R00A 1GV2A 1FOXA 4D0PA 2OCCH 2DQRA 5HNFA 1B9MA 3N4MA 1FYMA 3CCVI 4ZYDA 4RM3A 2CW8A 3W3CA 2VQCA 5FKOA 4ANJA 5FD5A 3B6CA 3R0AA 1O3QA 5CQEA 3BC8A 3QRFF 2FJ1A 1LFUP 2VXDA 3MMYB 4EM0B 4JYKA 4BXUA 1XGNA 2CFXA 2E71A 3LSMA 2WA0A 1X4PA 1DGWY 2EZHA 2NVXJ 1H0MA 4KT6A 4BUPA 2W1OA 4ZDPA 2HXOA 5F27A 2K9SA 2YU3A 3L9FA 2XGEA 5JHUA 2XROA 1ZKGA 1BN5A 3P9IA 3ZMVA 1J7KA 3H3ZA 1T2KA 1R4NB 2C6YA 5E18F 4D9JA 1UI6A 2MGQA 5HSZA 1D5YA 1N77A 1Y0NA 5E8GA 4KIGA 2JVHA 3H9GA 1VI0A 2D45A 4OMYA 4M3BA 5K7FA 3GEZA 1KYZA 4WK8F 2W84A 3S1QJ 1SMYF 1SVLA 2A5WA 1DU0A 2E2HJ 3EUKL 1Q1VA 3OYGA 2M8EA 1QA6A 1MBGA 1OYWA 3GFJA 5IOYA 3LSPA 1ITYA 1B59A 1ZELA 1MDMA 3CJTB 3HEFA 1ETXA 1RKWA 2NS0A 4X1EA 5F0CA 2Q8KA 4E7KA 2VT3A 4BXXJ 3F21A 1P4WA 3LJLA 4B3XA 5IP9J 1KU3A 1GUUA 2JMWA 2QBYB 3OOUA 4XL9A 1ENHA 3TO7A 4ENMA 1EF4A 3HPHA 1LE8A 2JUGA 1MNEA 4I0BA 4DVYP 4GO1A 4PUSA 2ZXIA 2LR8A 2CYYA 1XX5A 4Q47A 2ELHA 2OQGA 1YE9A 2DO7A 3OYLA 3KYCB 3TOBA 2FJI1 2RC4A 2H6CA 1MMDA 3S1RJ 1H89C 2MBFA 4XLNF 3PL8A 3TBIA 1VTNC 4CGRA 1BI2A 3VDXA 4KT5C 1K61A 1MDMB 3T0YA 3GFMA 4DBQA 2W82A 2HKOA 4HPQA 3UKGA 4IQJA 5J8CA 2KKOA 2CG4A 5H6QA 2Y0SA 4GYIA 3SZGA 4IX7A 3C7JA 1A35A 4DNCA 4II3A 1LE8B 1B4AA 1WJDA 4G7OF 4IOCF 2MSYA 3OWTA 5H6RA 2EFNA 1ON1A 2UWMA 5D5VB 3DEUA 2CSOA 4RGRA 3A03A 2E5NA 1HKQA 3FM5A 4R79A 2EZLA 4UUSA 1VQNI 4X6AJ 3Q5FA 1MW7A 4L9JA 1WJEA 3K9TA 5DD4A 1I27A 1SFXA 3EDPA 3L2WA 4MQ9F 1QZEA 2IRFG 3H5AA 2XKPA 3KP6A 3MN2A 4A0ZA 1XGSA 2V7FA 2P7CB 2JA2A 4DYQA 4A3IJ 2WBMA 1K4TA 1BR2A 4I2OA 3GTJJ 5C4JJ 2AQEA 2G7SA 4BY1J 1ZTRA 3P9TA 3HHGA 3F22A 3L2QA 2V1DA 2DOAA 4FX4A 2ZJPF 3IKVA 5EFYA 4UUSB 3BTIA 3QP5A 2MG4A 3E3VA 3IUVA 3CCMI 4PSWA 3BG7A 2FMLA 2K40A 4NB5A 4I02A 3TP3A 3ZMTA 4IRIA 2HNHA 2IJLA 5CVIA 1JUPA 1WGXA 2HXIA 2KL4A 2V9VA 1VNDA 1UI5A 2QUFA 3S5RA 1PP7U 2H8WA 2VKDA 1TQPA 2WB1A 2ZB9A 4A3BJ 5CPRB 4ABZA 1Z1DA 3UR3C 4WWCA 1LFBA 1R36A 1UELB 1RUNA 3RCOA 1DU6A 2KFDA 1VFCA 2QZ8A 5J1RA 2W53A 1YW9A 4I98B 3HTHA 3CJNA 5ICFA 4ZZDA 4PZJA 2VJIA 5TGTA 4LGWA 1KYWA 2KLOA 1T0FA 1XPXA 1X2MA 1HW2A 3V4GA 3JRHA 4MNUA 3M4OJ 5FO5A 4FE7A 1WJBA 2EIMH 4A6EA 1MNDA 2X85A 3G3ZA 2YPRA 2YVHA 5LHIA 2P5KA 1X1BA 3ZXSA 2Y30A 1A5JA 2GQQA 1K4SA 3COAC 3BG6A 3CF2A 4RA2A 1YJNI 2BV6A 2EZKA 4AD9A 4AU7A 2GXAA 4GYGA 3RIRA 4CCLA 4I01A 2ME0A 1YX3A 3GX4X 2KZGA 1HKSA 1X1AA 3OL3A 4AIJA 3AG4H 3TDUC 4BBRJ 3IH2A 2HVRA 5C3EJ 4O5VA 3OYHA 1MZBA 2G0EA 2W4SA 3E6MA 5JI6A 2RAEA 2PI0A 2BE5F 3AL0B 2O03A 3V8KA 3S15J 4A3DJ 3ABKH 1BJAA 3JR9A 2NVYJ 3OR2C 3R6SA 3OR1C 4CGZA 2OU2A 3IH4A 3ZR8X 5F0HA 3BPVA 1XGMA 4HF1A 3WTVC 5B5EC 1J0RA 2F2EA 2FE3A 3S93A 4Y3OA 2QSGX 2Y0MA 5FHPA 2KRHA 1BIAA 2YR2A 5FROA 2HKXA 1VQ6I 1D3YA 1ETVA 2XSDC 2F5EA 4CO8A 2IVMA 2EIKH 2WY7Q 3VB2A 3J7AO 1ZG3A 1U3EM 4IHWA 1IXRC 3BR6A 4JK1X 1PP8F 5E3OA 2Z5UA 2JA8J 3R0JA 2DT5A 3IKTA 4L0YB 1OMIA 2QSFX 2BY0A 1KQ8A 1BC8C 2HYTA 5HLHA 1I3AA 2BVMA 1BM9A 1X1DA 1KU9A 1AHDP 3KZZA 2OC6A 3H0GJ 4OU0A 4NELA 4ESBA 5EG0A 3PJRA 1MBJA 2KT0A 2PN6A 3WGGA 2ACJA 1APLC 3LNQA 5FKKA 3H1CA 4FX0A 5DM6F 1QU3A 1B1BA 1R1TA 3RYPA 5LRSA 2OI8A 2JRMA 3HM5A 3SZTA 2IAIA 3REOA 2DK8A 3IAS2 2VC0A 2CU7A 2MLKA 1FIAA 3GMEA 5KK1A 3FWEA 5B1BH 5K1YA 5J1YA 3ZPLA 1R4MB 4L9NA 2Z1DA 2ZSIB 3BWGA 2IPQX 2DT6A 3FZVA 5CVJA 4BACA 1YHQI 2PJRA 2WGBA 2RKHA 3SYTA 1DP7P 4R1HA 4EQQA 1GDTA 2FBHA 3FXMA 3KPHA 1YRNA 2COBA 5IYDJ 5EG0B 1K6OA 2M3AA 1QHHD 4YEJA 3CMYA 3NPIA 1JT6A 4Y4RA 2FU4A 3VVYA 1UB9A 1ACIA 1KU2A 2VOOA 2ZJQF 5ICCA 4OOIA 3QOEA 3QYBA 4II2A 2V9KA 5TISC 2VXZA 3B73A 3PUBA 3ZMSA 4BY7J 3CCEI 3BR0A 5B1AH 1GHCA 1T33A 1SAUA 1ZARA 1OPCA 1I5ZA 3WTZA 2PJRB 3GTQJ 2LH9A 2IEKA 1U78A 2HYJA 3BZ6A 3J80Z 3OYAA 2E19A 3OYMA 3VSLA 3JTHA 4R8HA 3MAJA 4KMFA 3S2DJ 2JZYA 2DQLA 3K1PA 2GFNA 4C3IJ 4KMUX 2OTJI 2M0MA 2QKMB 2LRDA 3EPZA 2LNBA 4PJMA 4UB8C 3CJRB 3U21A 1T0FC 3FXQA 1Z0XA 2DFHA 3A01A 4I09A 3G7RA 2HOTA 5CW8A 2BY1A 1T56A 1IDZA 1ORKA 2QENA 3AG3H 1U9OA 3HOUJ 3AL0C 1HQCA 4W97A 2Y75A 3OV8A 4BXFA 4XRSG 2XAFA 1GXPA 3DEEA 3G1MA 1A6QA 2YSRA 2GXGA 3C1DA 3TQNA 4LLNA 5B66C 1O7FA 3ERMA 1Z7UA 4F55A 1NK3P 4IHTA 1RPWA 3NWSA 5KAFC 1QQIA 2CJJA 4FQGA 1JJ8C 4U9LA 2NNYA 2Y9ZA 5E3NA 4A3CJ 2X6YA 2GXBA 3F8FA 2FBIA 2UXNA 2W24A 5GADJ 1V5GA 3A01B 5ILVA 4UUVA 2DN0A 5FFXA 2A69F 4RAZA 1SD7A 4YFXF 2LKPA 1IUYA 1TW3A 5BQTA 4RGXA 1V54H 4HRIA 3NS4A 3I55I 3FXUA 5GAEJ 3RZDJ 2DYSH 3DPLC 2H09A 3LFKA 2XAGA 3HHHA 1JJ6C 1R1UA 2MYSA 3G4SI 1FNNA 1BR4A 2XPUA 2KP6A 1SD6A 2R92J 4E7HA 4C30A 3ZQHA 3CCRI 1FX7A 3A1YA 2GA2A 2R7QA 3RTRA 4BKXA 1H8AC 3F23A 3DCFA 1R1VA 2BHYA 2PJPA 4MO7A 5LRRA 1PVEA 1SVMA 2EA2A 1HDDC 4L0ZB 1D8JA 1G3WA 2QF7A 4UXNA 4E4HA 3QYFA 2V6EA 2ZBKA 3CUOA 3GVAA 2F6CA 2HOEA 2CW7A 4YIIA 1Z7LA 5ICGA 3VW0A 1O4XA 2EFWA 1JGSA 1XTAA 4U0WA 1WJ5A 5IOZA 2RV8A 4HDUA 1X3WB 3RD3A 2VBZA 4IEJA 3E7QA 3J81Z 2Z2SB 1UJ8A 1PJRA 5JVTA 1FBUA 2WAEA 4EVIA 4FE4A 3HTIA 1MJAA 2V26A 4IZZA 4ZYGA 3GFIA 3B6AA 1JTXA 4KA4A 2GOMA 2XRNA 4F91B 1X19A 2DI3A 2EBIA 4AYBA 3BCBA 2L9NA 2GOXB 4QIWN 3AQSA 5KHDA 2HDDA 3RSNA 2YX4A 4EGZA 5HLGA 2B3WA 4BL0B 2L9SA 1IGNA 1JKPC 1UHWA 3N97A 1ZHFA 2WAQN 1X3ZB 1Z3YA 1Q1HA 1VQ7I 1YI2I 1T98A 4LB6B 4N4OB 1J5YA 2ESNA 1PYVA 1OISA 1ZYRF 3ZN1A 3RI4A 2HEOA 3S16J 2VLAA 3Q9VA 5AONA 1YQAA 2ZNZA 3TW6A 1S6LA 2DFIA 1XMKA 2QQBA 2HPMA 3WTSC 3DTIA 1MGTA 3FHZA 2ME6A 2VJJA 2V1NA 2IBDA 2CV0A 2EFQA 2DTRA 5LFAA 3B02A 3OMYA 5EDNA 4CYCA 3VYRB 1OCPA 1TWAJ 3F6OA 2OERA 4IHVA 4RS8A 2DMQA 4A0YA 3P7NA 2BGCA 1IZ1A 1IW7F 3TO6A 1H9TA 1FTTA 3G1OA 1HXDA 3GLXA 4B44A 4KYWA 2DA4A 3OYEA 1MSFC 1AKHA 4FCYA 3U1DA 5CYVA 5E8IA 5H9TA 2LBFB 2ZSHB 2BYVE 1YG2A 3VVXA 3QPHA 4Q48A 1MSEC 3FRQA 3RKWA 3HKZA 4B3AA 2B9SA 1XSVA 5H2FC 3N05A 3GTLJ 4X0GA 1ZRDA 1V5FA 3I4PA 1MH3A 4H4KC 4LK0F 2Y9YA 4CYCB 3OYKA 4NHJA 4NN1A 2B0LA 2ZCMA 1FEXA 3H5RA 4G6QA 2HYFA 5JLWA 3CLOA 3I56I 3K70D 5D4RA 1QVUA 2HR3A 4Y17A 1ZG5A 3DKXA 3D5SC 2ZKZA 1S8NA 4DGWB 1WHUA 1R5HA 4PJ0C 1AKHB 2LVSA 2LY9A 5D4SA 4Z2YA 3S1MJ 4RB2C 3ZQCA 3CMEI 4A3FJ 1KGSA 2V6CA 3ASNH 3BR5A 4ZJZA 4JX5A 3HRMA 4KNYA 4XSXF 3KP3A 4O3MA 1MD0A 5D5XB 2W25A 4B47A 1ODDA 4PGGA 3ML6A 4BE1A 2Z16A 3NI7A 2J5PA 3HUGA 2JA5J 1BBYA 4B48A 1MIJA 1IXSB 4UY8I 2VBYA 2QCOA 2IW5A 3WHCA 1NG7A 5BMZA 2LG4A 4GFBA 3VTIA 3Q0WA 1WCMJ 3GTPJ 5F0FA 2CQXA 1WZ2A 1TWHJ 2VBXA 4JX6A 5CKTA 3FXLA 1S3JA 2D1VA 4GRIA 1K83J 2KIUA 3F8CA 3I3LA 3K8PC 3OYJA 4ZZLA 1T6SA 1KA8A 4ASNA 3V6GA 2EZIA 2E2IJ 2XHKA 3K4MA 2BEOA 1A04A 1S7OA 2OD5A 3ZMZA 2PZ9A 2DPUA 2V1UA 1MJBA 5F1RA 4QTRA 5GPCA 3HL2A 3HUGB 4JP0A 3E6DA 2YS9A 4DZPA 1FC3A 4L5EA 1L3LA 4LLGF 4EM2A 1T95A 3A02A 2M4KA 2A6HF 2ZXJA 3U1KA 3LSRA 3VYTB 2DJNA 3LA3A 5AIPA 1ULYA 1H9GA 4EJVA 3J7AY 4V19K 1RRJA 1YS7A 3KCCA 4OIRF 3F9KA 1K79A 4RM2A 2WV1A 3I59A 2UXXA 4MGRA 3RJPA 5CJ9A 3GZ6A 1LEAA 3VOKA 4ZC3A 3JAMZ 3OOPA 1YIJI 3M7GA 3TO9A 2F5CA 5HLIA 1JKOC 1FTZA 3L1PA 2CS3A 1OCOH 2ZOZA 3K4BA 1EH6A 2P6TA 2FF4A 2NVTJ 5DUKA 2Q2EB 1TLHB 2GZWA 4XLCA 3SFIA 2X6XA 2HQRA 5CLSA 4F7ZA 1HSJA 1U9NA 1PDNC 1FSHA 2AXLA 2M1BA 3TOAA 3BT9A 4JBAA 4F92B 3M1CA 2DYRH 3O2PE 2E34A 1B72A 1OQYA 4IXAA 4NC6A 3S2WA 3I59B 2FBQA 3DQVC 3C07A 3R61A 3ZMUA 4C2MJ 5M5YJ 4RLFA 2ECBA 3H0DA 2ELJA 4KIBA 2PMZN 4XQFA 4MTDA 1LQ1A 4G9YA 2Z9OA 1R6RA
chains in the Genus database with same CATH topology
2M2EA 2VI6A 1BL0A 1WH7A 1YRNB 2TRTA 4ME9A 3RH2A 3VW2A 2WUIA 1X2MA 3QKXA 3JRHA 3M4OJ 1G2HA 4FE7A 4MLOA 5IYCJ 2VKVA 2R5ZB 3F0CA 3CQZJ 1QPIA 2YVHA 1B72B 3LHQA 4JNNA 2YU9J 3HB9A 2FX0A 2NP3A 3CCYA 3BQZA 2Y30A 2M8GX 2VKEA 4EEFG 1A5JA 2LKXA 3VOXA 2P81A 2DA1A 5D19A 4AUXA 1MBKA 2EZKA 3DPJA 1I3QJ 2ME0A 3S17J 3JRGA 5EZHA 4BBRJ 3IH2A 3PPBA 3Q0VA 5C3EJ 3QPSA 2G0EA 1RETA 3ON2A 4LOCA 2RAEA 1OFCX 1XC5A 2L7MP 3ON4A 2REKA 2RHAA 3S15J 3ANPA 4A3DJ 3HOWJ 3BG3A 4XK4A 1QRYA 3JR9A 3HOVJ 2NVYJ 2DMPA 4DZJA 2DMNA 1W0TA 3NAUA 4IHYA 3PO2J 3E7LA 3IH4A 5F0HA 3M3YJ 4DYCA 3LSGA 2G7GA 1X58A 2B63J 2TCTA 4DYRA 2ELKA 5FHPA 4QSHA 2QOPA 1ETVA 4A69C 2XSDC 2M0CA 2K9QA 3Q0UA 4ICHA 1CQTA 5FMPA 4AC6A 4IHWA 3PASA 5BNGA 3BR6A 4PXIA 1WPKA 3RZOJ 3BCGA 5E3OA 2AO9A 5AQCA 3GBGA 2JA8J 2OPTA 5JLXA 2E2JJ 5CXIA 2QKOA 3EGQA 2L7FP 1OCTC 3DEWA 4A3KJ 3C2BA 4Y7NJ 2HYTA 3NNRA 5FKLA 2JA7J 4V2GA 1AHDP 3H0GJ 1UHSA 5C4XJ 1IDYA 2UXHA 5EG0A 4NELA 1JUMA 1MBJA 2KT0A 5IP6A 1SANA 3VW1A 3TP0A 3T6NA 1APLC 3LNQA 3BR2A 3BTJA 5FKKA 3JRCA 1BW5A 3HOYJ 2NOGA 3BR1A 2E1OA 2OI8A 1P7IA 3V78A 3HM5A 5J3LA 2G7LA 2IAIA 1GV5A 2CU7A 1FIAA 5J1YA 3VIBA 2XGDA 1Y1VJ 3FIWA 2QWTA 2WGBA 2RASA 1IG7A 5DTDA 1GDTA 2HOSA 2X6OA 3OIOA 1YRNA 4A3GJ 4MFDA 5K7HA 2COBA 4I76A 3S2HJ 5EG0B 4DW6A 1NK2P 5IYDJ 2UXOA 3HOZJ 3CMYA 3BG5A 1JT6A 3TEDA 3NPIA 3NRGA 3VVYA 1QVTA 3IH3A 5E3LA 4UUTA 3LSJA 4RBOA 2AHQA 4HKUA 3VUQA 1MBEA 3CRJA 2ZCXA 4BY7J 1Y1WJ 3HIMA 3TW7A 3BR0A 1OJLA 1U8BA 1T33A 3OSGA 1S7EA 3CWRA 4GCTA 1A6IA 3GTQJ 2DA6A 2IEKA 1U78A 2HYJA 3HTAA 5HBUA 3BTCA 2E19A 2Y31A 3QPLA 5GPAA 4GCLA 1NTCA 3PO3J 4C3JJ 2JK3A 3S2DJ 4M3EA 1HCRA 3K7AJ 1MBFA 4MIMA 5HODA 5FLVA 2GFNA 4YZEA 4C3IJ 3VVZA 4JL3A 5C4YA 5EGOA 1WI3A 1IJWC 2R5YA 1Z0XA 2L7ZA 3IV5A 2GBYA 3A01A 4M3DA 1IRZA 3G7RA 2JWTA 2HOTA 5CW8A 1T56A 1IDZA 3CJDA 1ORKA 1U9OA 3JRBA 2LTPA 3HOUJ 3HE0A 3LWJA 4W97A 4AYBN 3HBLA 2NVQJ 4FISA 4XRSG 3G1MA 2HOAA 2X48A 3W6VA 3ZOBA 2LLKA 2QIBA 1AU7A 1FIPA 2HQ5A 4GFLA 2H8RA 5FLMJ 2YUSA 2XRLA 1NK3P 1RPWA 1PUFA 2F07A 2CJJA 3HDDA 2NS7A 5EGOB 2UXUA 1JJ8C 3I4NJ 4RDUA 2Y9ZA 1IUFA 2CUFA 3O8HA 5J1UA 5E3NA 4A3CJ 2I10A 3MVPA 2R5YB 1B8IA 5HAWA 3A01B 2DN0A 1RR7A 1R9TJ 1I50J 5M3MJ 2LK2A 4W1UA 2R0QC 2UXIA 3SJMA 1X2NA 3RZDJ 9ANTA 4MFEA 1BJZA 3G56A 1JJ6C 1ZGWA 3H3VK 2XPUA 1I6HJ 2JN6A 2Y2ZA 5FKMA 1PUFB 2R92J 1IV6A 3GTGJ 5IP7J 2EH3A 2LP0A 3ZQHA 3BQYA 3D1NI 3EUPA 2EQRA 4AC0A 3VPRA 2XPVA 4D7MA 1TWGJ 4BKXA 1B8IB 1F43A 1H8AC 3DCFA 5EZGA 3FISA 4MO7A 1W0UA 4FTHA 4I6ZA 1ZR2A 1HDDC 2QF7A 2GUHA 1ETQA 1VF9A 3OSFA 2KDZA 2O8KA 2ID6A 3VW0A 2YVEA 3HKZN 1O4XA 2XGCA 5EYRA 2Q24A 4KWAA 1GVDA 2FD5A 5IOZA 1XG1A 2GM4A 3RD3A 3JSJA 4IEJA 3E7QA 4D7NA 4ACIA 5IYBJ 2R7ZJ 1HLVA 2HKUA 3JRAA 1HOMA 3CDLA 5M3FJ 5M5XJ 1Z77A 5M5WJ 4FE4A 5EF6A 1XS9A 1HF0A 1SGMA 3HTIA 2M34A 3B6AA 3QBMA 1HDPA 1JTXA 4B4CA 3ZQGA 2L0KA 4C3HJ 4A3EJ 5D18A 1POGA 3COLA 3BTLA 2DG8A 2EBIA 3KNWA 2HI3A 4QIWN 3JRFA 2ID3A 4IHXA 1JKQC 2HDDA 3AQSA 4NDLA 3BJBA 4L62A 4D5FA 3S14J 3ZQIA 4M6VA 3BNIA 1IGNA 1JKPC 1IC8A 5K58A 2DMUA 2IU5A 2WAQN 3NARA 3GTKJ 1UMQA 4V2FA 5D1RA 2O7TA 4M3FA 3O60A 2R93J 1ETKA 4B1RA 3SDGA 1TC3C 2OF7A 3BG9A 3S16J 4A3LJ 3HGGA 1GV2A 2XDNA 3TW6A 2Y0SN 3WHBA 2ME6A 5FKOA 3HOXJ 3B6CA 1BA5A 5E3MA 2IBDA 2LD5A 5FGLA 4CYCA 5EDNA 2FJ1A 1LFUP 1OCPA 1TWAJ 2UXPA 4G12A 4JYKA 2OERA 4IHVA 2DMQA 3GEUA 5GP9A 3KKCA 3BHQA 2O9LA 5DAJA 3RKQA 4JKZA 5EEAA 3G1OA 1FTTA 2EZHA 1MH4A 2NVXJ 1FJLA 2HXOA 5F27A 2DA4A 2K9SA 2XGEA 1MSFC 1AKHA 2MW8A 3KZ9A 1ZKGA 4FCYA 3O8GA 1ZR4A 4S0HB 1UI6A 5H9TA 2DA5A 5HSZA 2CRGA 2MGQA 5F08A 5C44J 1D5YA 3VVXA 2JA6J 4XRSA 1MSEC 4JX4A 3FRQA 3PM1A 4B3AA 5FJ8J 1VI0A 2NS8A 3GTLJ 4M3BA 4CYCB 1MH3A 5K7FA 3VP5A 2Y9YA 2PBXA 2H1KA 4NN1A 2ZCMA 3S1QJ 1DU0A 1FEXA 3ANGA 2LFBA 5JLWA 3K2AA 4MK6A 2E2HJ 1Q1VA 2CQQA 3JRIA 1QVUA 3Q3SA 1MBGA 2DA3A 5IOYA 3LSPA 1ITYA 2FQ4A 3HEFA 1ETXA 1RKWA 5F0CA 2LVSA 2LY9A 1ETYA 4X1EA 1AKHB 2V57A 3S1MJ 4BXXJ 3ZQCA 3LJLA 4A3FJ 5IP9J 2L9RA 3BR5A 2CUEA 1JT0A 4JX5A 2M9HA 3MNLA 2WB1N 1GUUA 2JMWA 3OOUA 1ENHA 1EF4A 1LE8A 2D5VA 3JRDA 1BW6A 2LR8A 3NI7A 4XIDA 2JA5J 5K7ZA 3KKDA 4D5CA 3S1RJ 2QCOA 1H89C 1ZK8A 1ETOA 2XB0X 3WHCA 1JGGA 3FK6A 4UDSA 4GFBA 1TWFJ 3Q0WA 4CGRA 1WCMJ 3BR3A 1K61A 5F0FA 3GTPJ 2CQXA 1TWHJ 1WH5A 2DTZA 4JX6A 3UKGA 3LOCA 1K83J 2G3BA 2VPRA 2JJ7A 4A93J 3V6GA 2EZIA 2E2IJ 1LE8B 4AF5A 1MBHA 2N8GA 2PZ9A 1RKTA 2MSYA 2GENA 2ZCNA 1UG2A 5GPCA 4QTRA 3FKIJ 4JP0A 1GT0C 1H88C 4MXMA 2YS9A 4DZPA 2DMTA 2O7OA 3GTOJ 1F36A 3A03A 1SFOJ 2EZLA 4L5EA 4UUSA 5IPAA 4X6AJ 3S1NJ 3BRUA 3HGYA 3MKLA 3A02A 3FK7A 3F1BA 2NP5A 3LSRA 1JKRC 2D6YA 2DG7A 2DJNA 4GFKA 4M3GA 3MN2A 2DA7A 3GTMJ 4DYQA 1ZQ3P 2K9NA 4A3IJ 3ZQLA 2WV1A 4Y52J 3GZIA 3GTJJ 5C4JJ 3VOKA 2G7SA 4BY1J 2VUMJ 1ZTRA 3P9TA 2XB5A 2W48A 3ZQFA 2GLOA 2ZOYA 1JKOC 5EFYA 4UUSB 4J19A 3BTIA 1FTZA 5F04A 2X9DA 3L1PA 1ETWA 5DS9A 1MNMC 2MG4A 1TWCJ 3IUVA 2ZOZA 3RQIA 4A3MJ 3B81A 2NVTJ 2K40A 3I4MJ 3TP3A 3HTJA 3AQTA 5FKNA 4XICA 4BBSJ 3SFIA 3JREA 1WGXA 1JUPA 1JUSA 1U9NA 2HXIA 1VNDA 4HNVA 1UI5A 1RESA 3BT9A 2R5ZA 3S5RA 1E3OC 2QTQA 2ZB9A 1B72A 5CXGA 4XRMA 1P7JA 4GCKA 2ECCA 4A3BJ 3NXCA 4ABZA 2FBQA 3C07A 1JTYA 1LFBA 2DA2A 4A3JJ 4C2MJ 5M5YJ 2ECBA 1DU6A 2PMZN 1VFCA 2XPWA 3G1LA 5J1RA 2W53A 2NX4A 3HTHA 5F1JA 3QQAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M2E A;  2VI6 A;  1BL0 A;  1WH7 A;  1YRN B;  2TRT A;  4ME9 A;  3RH2 A;  3VW2 A;  2WUI A;  1X2M A;  3QKX A;  3JRH A;  3M4O J;  1G2H A;  4FE7 A;  4MLO A;  5IYC J;  2VKV A;  2R5Z B;  3F0C A;  3CQZ J;  1QPI A;  2YVH A;  1B72 B;  3LHQ A;  4JNN A;  2YU9 J;  3HB9 A;  2FX0 A;  2NP3 A;  3CCY A;  3BQZ A;  2Y30 A;  2M8G X;  2VKE A;  4EEF G;  1A5J A;  2LKX A;  3VOX A;  2P81 A;  2DA1 A;  5D19 A;  4AUX A;  1MBK A;  2EZK A;  3DPJ A;  1I3Q J;  2ME0 A;  3S17 J;  3JRG A;  5EZH A;  4BBR J;  3IH2 A;  3PPB A;  3Q0V A;  5C3E J;  3QPS A;  2G0E A;  1RET A;  3ON2 A;  4LOC A;  2RAE A;  1OFC X;  1XC5 A;  2L7M P;  3ON4 A;  2REK A;  2RHA A;  3S15 J;  3ANP A;  4A3D J;  3HOW J;  3BG3 A;  4XK4 A;  1QRY A;  3JR9 A;  3HOV J;  2NVY J;  2DMP A;  4DZJ A;  2DMN A;  1W0T A;  3NAU A;  4IHY A;  3PO2 J;  3E7L A;  3IH4 A;  5F0H A;  3M3Y J;  4DYC A;  3LSG A;  2G7G A;  1X58 A;  2B63 J;  2TCT A;  4DYR A;  2ELK A;  5FHP A;  4QSH A;  2QOP A;  1ETV A;  4A69 C;  2XSD C;  2M0C A;  2K9Q A;  3Q0U A;  4ICH A;  1CQT A;  5FMP A;  4AC6 A;  4IHW A;  3PAS A;  5BNG A;  3BR6 A;  4PXI A;  1WPK A;  3RZO J;  3BCG A;  5E3O A;  2AO9 A;  5AQC A;  3GBG A;  2JA8 J;  2OPT A;  5JLX A;  2E2J J;  5CXI A;  2QKO A;  3EGQ A;  2L7F P;  1OCT C;  3DEW A;  4A3K J;  3C2B A;  4Y7N J;  2HYT A;  3NNR A;  5FKL A;  2JA7 J;  4V2G A;  1AHD P;  3H0G J;  1UHS A;  5C4X J;  1IDY A;  2UXH A;  5EG0 A;  4NEL A;  1JUM A;  1MBJ A;  2KT0 A;  5IP6 A;  1SAN A;  3VW1 A;  3TP0 A;  3T6N A;  1APL C;  3LNQ A;  3BR2 A;  3BTJ A;  5FKK A;  3JRC A;  1BW5 A;  3HOY J;  2NOG A;  3BR1 A;  2E1O A;  2OI8 A;  1P7I A;  3V78 A;  3HM5 A;  5J3L A;  2G7L A;  2IAI A;  1GV5 A;  2CU7 A;  1FIA A;  5J1Y A;  3VIB A;  2XGD A;  1Y1V J;  3FIW A;  2QWT A;  2WGB A;  2RAS A;  1IG7 A;  5DTD A;  1GDT A;  2HOS A;  2X6O A;  3OIO A;  1YRN A;  4A3G J;  4MFD A;  5K7H A;  2COB A;  4I76 A;  3S2H J;  5EG0 B;  4DW6 A;  1NK2 P;  5IYD J;  2UXO A;  3HOZ J;  3CMY A;  3BG5 A;  1JT6 A;  3TED A;  3NPI A;  3NRG A;  3VVY A;  1QVT A;  3IH3 A;  5E3L A;  4UUT A;  3LSJ A;  4RBO A;  2AHQ A;  4HKU A;  3VUQ A;  1MBE A;  3CRJ A;  2ZCX A;  4BY7 J;  1Y1W J;  3HIM A;  3TW7 A;  3BR0 A;  1OJL A;  1U8B A;  1T33 A;  3OSG A;  1S7E A;  3CWR A;  4GCT A;  1A6I A;  3GTQ J;  2DA6 A;  2IEK A;  1U78 A;  2HYJ A;  3HTA A;  5HBU A;  3BTC A;  2E19 A;  2Y31 A;  3QPL A;  5GPA A;  4GCL A;  1NTC A;  3PO3 J;  4C3J J;  2JK3 A;  3S2D J;  4M3E A;  1HCR A;  3K7A J;  1MBF A;  4MIM A;  5HOD A;  5FLV A;  2GFN A;  4YZE A;  4C3I J;  3VVZ A;  4JL3 A;  5C4Y A;  5EGO A;  1WI3 A;  1IJW C;  2R5Y A;  1Z0X A;  2L7Z A;  3IV5 A;  2GBY A;  3A01 A;  4M3D A;  1IRZ A;  3G7R A;  2JWT A;  2HOT A;  5CW8 A;  1T56 A;  1IDZ A;  3CJD A;  1ORK A;  1U9O A;  3JRB A;  2LTP A;  3HOU J;  3HE0 A;  3LWJ A;  4W97 A;  4AYB N;  3HBL A;  2NVQ J;  4FIS A;  4XRS G;  3G1M A;  2HOA A;  2X48 A;  3W6V A;  3ZOB A;  2LLK A;  2QIB A;  1AU7 A;  1FIP A;  2HQ5 A;  4GFL A;  2H8R A;  5FLM J;  2YUS A;  2XRL A;  1NK3 P;  1RPW A;  1PUF A;  2F07 A;  2CJJ A;  3HDD A;  2NS7 A;  5EGO B;  2UXU A;  1JJ8 C;  3I4N J;  4RDU A;  2Y9Z A;  1IUF A;  2CUF A;  3O8H A;  5J1U A;  5E3N A;  4A3C J;  2I10 A;  3MVP A;  2R5Y B;  1B8I A;  5HAW A;  3A01 B;  2DN0 A;  1RR7 A;  1R9T J;  1I50 J;  5M3M J;  2LK2 A;  4W1U A;  2R0Q C;  2UXI A;  3SJM A;  1X2N A;  3RZD J;  9ANT A;  4MFE A;  1BJZ A;  3G56 A;  1JJ6 C;  1ZGW A;  3H3V K;  2XPU A;  1I6H J;  2JN6 A;  2Y2Z A;  5FKM A;  1PUF B;  2R92 J;  1IV6 A;  3GTG J;  5IP7 J;  2EH3 A;  2LP0 A;  3ZQH A;  3BQY A;  3D1N I;  3EUP A;  2EQR A;  4AC0 A;  3VPR A;  2XPV A;  4D7M A;  1TWG J;  4BKX A;  1B8I B;  1F43 A;  1H8A C;  3DCF A;  5EZG A;  3FIS A;  4MO7 A;  1W0U A;  4FTH A;  4I6Z A;  1ZR2 A;  1HDD C;  2QF7 A;  2GUH A;  1ETQ A;  1VF9 A;  3OSF A;  2KDZ A;  2O8K A;  2ID6 A;  3VW0 A;  2YVE A;  3HKZ N;  1O4X A;  2XGC A;  5EYR A;  2Q24 A;  4KWA A;  1GVD A;  2FD5 A;  5IOZ A;  1XG1 A;  2GM4 A;  3RD3 A;  3JSJ A;  4IEJ A;  3E7Q A;  4D7N A;  4ACI A;  5IYB J;  2R7Z J;  1HLV A;  2HKU A;  3JRA A;  1HOM A;  3CDL A;  5M3F J;  5M5X J;  1Z77 A;  5M5W J;  4FE4 A;  5EF6 A;  1XS9 A;  1HF0 A;  1SGM A;  3HTI A;  2M34 A;  3B6A A;  3QBM A;  1HDP A;  1JTX A;  4B4C A;  3ZQG A;  2L0K A;  4C3H J;  4A3E J;  5D18 A;  1POG A;  3COL A;  3BTL A;  2DG8 A;  2EBI A;  3KNW A;  2HI3 A;  4QIW N;  3JRF A;  2ID3 A;  4IHX A;  1JKQ C;  2HDD A;  3AQS A;  4NDL A;  3BJB A;  4L62 A;  4D5F A;  3S14 J;  3ZQI A;  4M6V A;  3BNI A;  1IGN A;  1JKP C;  1IC8 A;  5K58 A;  2DMU A;  2IU5 A;  2WAQ N;  3NAR A;  3GTK J;  1UMQ A;  4V2F A;  5D1R A;  2O7T A;  4M3F A;  3O60 A;  2R93 J;  1ETK A;  4B1R A;  3SDG A;  1TC3 C;  2OF7 A;  3BG9 A;  3S16 J;  4A3L J;  3HGG A;  1GV2 A;  2XDN A;  3TW6 A;  2Y0S N;  3WHB A;  2ME6 A;  5FKO A;  3HOX J;  3B6C A;  1BA5 A;  5E3M A;  2IBD A;  2LD5 A;  5FGL A;  4CYC A;  5EDN A;  2FJ1 A;  1LFU P;  1OCP A;  1TWA J;  2UXP A;  4G12 A;  4JYK A;  2OER A;  4IHV A;  2DMQ A;  3GEU A;  5GP9 A;  3KKC A;  3BHQ A;  2O9L A;  5DAJ A;  3RKQ A;  4JKZ A;  5EEA A;  3G1O A;  1FTT A;  2EZH A;  1MH4 A;  2NVX J;  1FJL A;  2HXO A;  5F27 A;  2DA4 A;  2K9S A;  2XGE A;  1MSF C;  1AKH A;  2MW8 A;  3KZ9 A;  1ZKG A;  4FCY A;  3O8G A;  1ZR4 A;  4S0H B;  1UI6 A;  5H9T A;  2DA5 A;  5HSZ A;  2CRG A;  2MGQ A;  5F08 A;  5C44 J;  1D5Y A;  3VVX A;  2JA6 J;  4XRS A;  1MSE C;  4JX4 A;  3FRQ A;  3PM1 A;  4B3A A;  5FJ8 J;  1VI0 A;  2NS8 A;  3GTL J;  4M3B A;  4CYC B;  1MH3 A;  5K7F A;  3VP5 A;  2Y9Y A;  2PBX A;  2H1K A;  4NN1 A;  2ZCM A;  3S1Q J;  1DU0 A;  1FEX A;  3ANG A;  2LFB A;  5JLW A;  3K2A A;  4MK6 A;  2E2H J;  1Q1V A;  2CQQ A;  3JRI A;  1QVU A;  3Q3S A;  1MBG A;  2DA3 A;  5IOY A;  3LSP A;  1ITY A;  2FQ4 A;  3HEF A;  1ETX A;  1RKW A;  5F0C A;  2LVS A;  2LY9 A;  1ETY A;  4X1E A;  1AKH B;  2V57 A;  3S1M J;  4BXX J;  3ZQC A;  3LJL A;  4A3F J;  5IP9 J;  2L9R A;  3BR5 A;  2CUE A;  1JT0 A;  4JX5 A;  2M9H A;  3MNL A;  2WB1 N;  1GUU A;  2JMW A;  3OOU A;  1ENH A;  1EF4 A;  1LE8 A;  2D5V A;  3JRD A;  1BW6 A;  2LR8 A;  3NI7 A;  4XID A;  2JA5 J;  5K7Z A;  3KKD A;  4D5C A;  3S1R J;  2QCO A;  1H89 C;  1ZK8 A;  1ETO A;  2XB0 X;  3WHC A;  1JGG A;  3FK6 A;  4UDS A;  4GFB A;  1TWF J;  3Q0W A;  4CGR A;  1WCM J;  3BR3 A;  1K61 A;  5F0F A;  3GTP J;  2CQX A;  1TWH J;  1WH5 A;  2DTZ A;  4JX6 A;  3UKG A;  3LOC A;  1K83 J;  2G3B A;  2VPR A;  2JJ7 A;  4A93 J;  3V6G A;  2EZI A;  2E2I J;  1LE8 B;  4AF5 A;  1MBH A;  2N8G A;  2PZ9 A;  1RKT A;  2MSY A;  2GEN A;  2ZCN A;  1UG2 A;  5GPC A;  4QTR A;  3FKI J;  4JP0 A;  1GT0 C;  1H88 C;  4MXM A;  2YS9 A;  4DZP A;  2DMT A;  2O7O A;  3GTO J;  1F36 A;  3A03 A;  1SFO J;  2EZL A;  4L5E A;  4UUS A;  5IPA A;  4X6A J;  3S1N J;  3BRU A;  3HGY A;  3MKL A;  3A02 A;  3FK7 A;  3F1B A;  2NP5 A;  3LSR A;  1JKR C;  2D6Y A;  2DG7 A;  2DJN A;  4GFK A;  4M3G A;  3MN2 A;  2DA7 A;  3GTM J;  4DYQ A;  1ZQ3 P;  2K9N A;  4A3I J;  3ZQL A;  2WV1 A;  4Y52 J;  3GZI A;  3GTJ J;  5C4J J;  3VOK A;  2G7S A;  4BY1 J;  2VUM J;  1ZTR A;  3P9T A;  2XB5 A;  2W48 A;  3ZQF A;  2GLO A;  2ZOY A;  1JKO C;  5EFY A;  4UUS B;  4J19 A;  3BTI A;  1FTZ A;  5F04 A;  2X9D A;  3L1P A;  1ETW A;  5DS9 A;  1MNM C;  2MG4 A;  1TWC J;  3IUV A;  2ZOZ A;  3RQI A;  4A3M J;  3B81 A;  2NVT J;  2K40 A;  3I4M J;  3TP3 A;  3HTJ A;  3AQT A;  5FKN A;  4XIC A;  4BBS J;  3SFI A;  3JRE A;  1WGX A;  1JUP A;  1JUS A;  1U9N A;  2HXI A;  1VND A;  4HNV A;  1UI5 A;  1RES A;  3BT9 A;  2R5Z A;  3S5R A;  1E3O C;  2QTQ A;  2ZB9 A;  1B72 A;  5CXG A;  4XRM A;  1P7J A;  4GCK A;  2ECC A;  4A3B J;  3NXC A;  4ABZ A;  2FBQ A;  3C07 A;  1JTY A;  1LFB A;  2DA2 A;  4A3J J;  4C2M J;  5M5Y J;  2ECB A;  1DU6 A;  2PMZ N;  1VFC A;  2XPW A;  3G1L A;  5J1R A;  2W53 A;  2NX4 A;  3HTH A;  5F1J A;  3QQA A; 
#chains in the Genus database with same CATH topology
 2HVS A;  3ZMD A;  1WH7 A;  2HGC A;  3PQK A;  4HW0 A;  1LJ9 A;  5GAG J;  3EYI A;  1BI3 A;  3MEX A;  1AWC A;  1P9Q C;  1YOV B;  4DBR A;  2BVL A;  4XLP F;  1RZ4 A;  4GGG A;  1D8K A;  3ZQ7 A;  3KZI C;  1PUE E;  2QBY A;  2YVX A;  4MLO A;  2VKV A;  3RYR A;  3SXY A;  4PFP A;  5BPD A;  1TNT A;  1B72 B;  2V79 A;  1E0E A;  3ESW B;  3BQZ A;  1WRJ A;  4HEA 2;  1F4K A;  2VKE A;  1LPQ A;  4BU2 A;  2JQ7 A;  1FY7 A;  3J80 K;  3DBH B;  3RKY A;  3KYL A;  1MBK A;  4CCM A;  3DPJ A;  3GXO A;  4NUB A;  2E1M B;  3KFW X;  5ICE A;  5L3G A;  3H5N A;  2KRF A;  1AOY A;  3DBR B;  3FMR A;  5L3E A;  2QEX I;  2D2W A;  3HJE A;  3KP5 A;  4LOC A;  1OFC X;  4IKF A;  1XB4 A;  3ON4 A;  2REK A;  2EIJ H;  3ANP A;  3WU1 B;  3CC2 I;  3HOW J;  2K02 A;  4XK4 A;  1BOB A;  2XVC A;  5HNH A;  3BZK A;  3NAU A;  2DW4 A;  4PFO A;  4IHY A;  3PO2 J;  1YFH A;  3M3Y J;  3K1M A;  4DYC A;  2VQL A;  2DAO A;  3LSG A;  3WTW C;  2L02 A;  2JPC A;  3PFY A;  2G7G A;  1X58 A;  4ESF A;  2IGM A;  1IRX A;  1TNS A;  5E1Z B;  4QSH A;  1W5S A;  4XN3 A;  1A31 A;  2FXA A;  3WU2 C;  2M0C A;  2K9Q A;  3Q0U A;  4RGS A;  5LBQ A;  5FMP A;  1M1E B;  4BNC A;  2W85 A;  3RZO J;  3BCG A;  4NQW A;  1VQL I;  5F6F A;  2X4H A;  5JLX A;  2QQ9 A;  4KN4 X;  2WAD A;  3OYN A;  1OCT C;  1RC9 A;  2E7W A;  3DEW A;  1OKR A;  4TV7 A;  5FKL A;  3LFU A;  3A2K A;  4FT8 A;  1SAX A;  3MZY A;  2UXH A;  4G6D A;  5DYM A;  1WQ2 A;  3MKZ A;  2ZFU A;  1D0X A;  5IP6 A;  3VW1 A;  2E60 A;  3T6N A;  4CYD A;  5DM7 F;  2R7U A;  4XLE A;  3BR2 A;  3BTJ A;  3KP4 A;  1VQP I;  4BAY A;  1BW5 A;  2ETH A;  1VQM I;  4F3Q A;  3HOY J;  3HRS A;  3NQO A;  3BLY A;  4U88 A;  4NQW B;  4YFN F;  1J9I A;  1P7I A;  4OIQ F;  2OV7 A;  3IAM 2;  3LQQ A;  5FD6 A;  2RQQ A;  1SEU A;  1GV5 A;  5F64 A;  1XSD A;  2CMP A;  3VIB A;  4PSX A;  3LL7 A;  1YIO A;  1IG7 A;  1UCR A;  3QOP A;  5EEG A;  2X6O A;  1IO2 A;  1N25 A;  2JTV A;  4L9V A;  4N4N B;  1FYL A;  3HOZ J;  3J81 K;  2P0W A;  3BG5 A;  2KIF A;  3E1S A;  5E3L A;  3FF5 A;  2BXZ A;  1FMV A;  3LSJ A;  2R7T A;  1UHM A;  3K4N A;  3Q9S A;  4HX7 A;  2AHQ A;  4HKU A;  3VUQ A;  1Y1W J;  3HIM A;  1Y0U A;  3BPX A;  4XRF A;  2ZO4 A;  2H94 A;  5FRN A;  3L2C A;  4KIC A;  3V7S A;  1BC7 C;  2EA4 A;  4U87 A;  1HKT A;  3BTC A;  2JK3 A;  1YW7 A;  2A6T A;  1HCR A;  4YZE A;  2LF8 A;  4HF0 A;  3GUD A;  5HOD A;  5FLV A;  4NBQ A;  1W5T A;  3F6V A;  2IS2 A;  1IRG A;  1XCB A;  2IS1 A;  4AVZ A;  1WI3 A;  4A5N A;  2K3F A;  1VZ0 A;  2IGO A;  3FXR A;  2L7Z A;  4LD5 A;  3ZCO A;  2G7H A;  4LK1 F;  5BS6 A;  3GZN B;  2H27 A;  2P4W A;  2EWN A;  3G71 I;  2LTP A;  4L5I A;  5DEQ A;  4CUG A;  3HE0 A;  2WAF A;  4L5J A;  2V4J C;  4FIS A;  2HOA A;  3S3O A;  3W6V A;  2RRE A;  3BJ6 A;  3ZOB A;  3W2A A;  4PJL A;  2LLK A;  3K4C A;  2L5Q A;  5LGT A;  1FIP A;  2QIB A;  2F5F A;  1OR7 A;  3ZP5 A;  2H8R A;  4UVB A;  3M1E A;  4MEY F;  4QPO A;  1MMN A;  2F07 A;  3HDD A;  2NS7 A;  2M45 A;  4UV9 A;  1ZN2 A;  4RDU A;  5JVG F;  5J1U A;  1VQO I;  2KDO A;  1Y6I A;  2ZXW H;  4EJU A;  4EM1 A;  1J75 A;  1SD4 A;  4CCN A;  2PQ8 A;  2HYG D;  2RQP A;  1RR7 A;  4WXC A;  1R9T J;  3LSH A;  2WTE A;  3TMO A;  5M3M J;  3HIF A;  4LJZ F;  4BHC A;  3QPT A;  2R0Q C;  2DJI A;  2GIV A;  3ULQ B;  5HS9 A;  3TGN A;  9ANT A;  4MFE A;  2PFB A;  2M4G A;  3AG2 H;  1TT0 A;  5J8F A;  3ABL H;  1I6H J;  2JN6 A;  5FKM A;  1QBJ A;  1IV6 A;  3RQ4 A;  1V5E A;  3BQY A;  4KUM A;  3PNV A;  3GYH X;  1R23 A;  3RKX A;  4AC0 A;  1WI9 A;  2RN7 A;  1F43 A;  1TW2 A;  4ITV A;  5EZG A;  3ZRG A;  3FIS A;  1V55 H;  2X1D A;  3DBL B;  3ABM H;  4I6Z A;  2WV0 A;  2XV4 S;  4AID A;  2BW3 A;  1D1C A;  2RVC A;  2OA4 A;  1FZP B;  3KZY A;  4UB6 C;  2OCE A;  3OSF A;  3KLO A;  4RB1 A;  2R7V A;  2Z3Y A;  3V7C A;  5EYR A;  1JE8 A;  3M07 A;  5GTI C;  3CP2 A;  3ZN0 A;  3OIQ A;  2VN2 A;  4EV0 A;  4YEL A;  2D1H A;  2LY1 A;  2AXT C;  3IRR A;  6PAX A;  4WF2 A;  3WTT C;  2W7N A;  1R22 A;  4JQF A;  4D7N A;  3G2B A;  3A0H C;  2E7X A;  2B7E A;  1HLV A;  1HBX G;  3JRA A;  2MLG A;  1MJ9 A;  3CJQ B;  4XM3 A;  2IT0 A;  1KZH A;  1Z77 A;  2J5O A;  2STW A;  4XON A;  3KX2 A;  3PQJ A;  1HDP A;  1GXQ A;  2BW3 B;  5JR3 A;  4M9S A;  3S3N A;  4G8X A;  1YS6 A;  3LQR A;  4A3E J;  2O6G E;  4CZC A;  1YYV A;  4EJW A;  2OZ6 A;  3JRF A;  1ZLK A;  1TQI A;  2E1C A;  4NDL A;  1LNW A;  1UST A;  3CUQ A;  1NH3 A;  1R71 A;  3ZQI A;  4AVP A;  2O5R A;  5JHF A;  2IU5 A;  1HW5 A;  3NAR A;  1UMQ A;  3HXL A;  1Z6T A;  3G6E I;  2ZY9 A;  2JSC A;  2ZCW A;  1BI1 A;  1ETK A;  3DXJ F;  2DOD A;  3SDG A;  1TC3 C;  2OF7 A;  1HW1 A;  3HGG A;  2XDN A;  2XUB A;  3P5J A;  2X6W A;  3IWZ A;  2VB6 A;  3E6B A;  3BDD A;  4QPQ A;  2L54 A;  1G3T A;  4NNJ A;  1EKE A;  1I39 A;  3HOX J;  5BPI A;  3L2V A;  3HTS B;  3DWL E;  1BA5 A;  5E3M A;  4LG3 A;  4M71 A;  1R5G A;  1D1A A;  4E7J A;  3CUQ B;  5FGL A;  2M5W A;  3JAM K;  3I53 A;  4XLH A;  2LC2 A;  4Z6Y A;  3JW4 A;  1IN8 A;  4G12 A;  2K86 A;  3HZJ A;  5CVV A;  3GEU A;  1E3P A;  5GP9 A;  5HDG A;  3BHQ A;  2O9L A;  5DAJ A;  5EEA A;  5L3D A;  1SMT A;  4C2M A;  2MW8 A;  3V8L A;  3KZ9 A;  1FSE A;  1FBS A;  3WGI A;  1D1B A;  4S0H B;  2DA5 A;  2KHM A;  2VJ4 A;  4GXO A;  5F08 A;  4HDV A;  2VE8 A;  2JA6 J;  4OD4 A;  4JX4 A;  4A2U A;  2NS8 A;  2LSO A;  3FXJ A;  3GF2 A;  5LLQ A;  2R7W A;  2XIG A;  2EIL H;  3HPG A;  5GAH J;  4NC8 A;  2BBY A;  2BY3 A;  1OR7 C;  4UHT A;  1I1S A;  3ANG A;  2LFB A;  4MK6 A;  1I1G A;  3K2A A;  1W36 D;  2OBP A;  2EFP A;  3LA7 A;  2CQQ A;  3KLN A;  2DA3 A;  1QZZ A;  4N9H A;  1T8I A;  1ETY A;  1U6G A;  4FET A;  4BEH A;  2R7O A;  1IXC A;  4OIN F;  2JSP A;  2NRA C;  3NEU A;  2L9R A;  4CCJ A;  2MD0 A;  2W00 A;  2M9H A;  4U0V A;  4ZDO A;  3MNL A;  3OYF A;  1OYI A;  5ILS A;  5DCM A;  3I64 A;  2K27 A;  3K4L A;  4IHS A;  3SEQ A;  1I6X A;  3JRD A;  1BW6 A;  1X3U A;  5L3C A;  1U8R A;  4XID A;  3KKD A;  1XN7 A;  2WAQ A;  4D5C A;  1F5T A;  2QM3 A;  3M8F A;  1JGG A;  1ZGJ A;  3BCA A;  1ZK8 A;  4XOP A;  2XB0 X;  1TL8 A;  5IT9 Z;  1TWF J;  1U0J A;  1FMW A;  3BR3 A;  3CCQ I;  3CDH A;  1Y8R B;  3MZH A;  4Q5S F;  1WH5 A;  2DTZ A;  4LMY A;  4BEH B;  3OYD A;  1VQ9 I;  5HDK A;  1TZL A;  1R49 A;  3QWL A;  5D6E A;  3LOC A;  2IP2 A;  1YJW I;  5LGN A;  2VPR A;  3SDB A;  4A93 J;  1D0Z A;  5DCM B;  5GTH C;  2PX9 A;  1ZAO A;  4AF5 A;  2N8G A;  2P8T A;  4PGH A;  3BRO A;  1RKT A;  4BJT A;  1KON A;  1OCC H;  2DMT A;  2O7O A;  2ZNY A;  1F36 A;  2MFZ A;  3GTO J;  2FBK A;  1N75 A;  1SFO J;  2P7V B;  5IPA A;  1Z21 A;  1BR1 A;  3BRU A;  3EQL F;  2M7B A;  3FK7 A;  3F1B A;  2KRC A;  2TDX A;  2LYC A;  2M87 A;  3I5U A;  2G9W A;  3IL2 A;  2QQ8 A;  2O61 A;  5ERI A;  4E6K G;  3EUA A;  5E1W A;  2DA7 A;  5EJC A;  3H3U A;  3KP7 A;  3CCL I;  3CCU I;  2VOP A;  2K9N A;  2UV1 A;  4N0B A;  2RNG A;  2PLY A;  3PNY A;  1WJF A;  2ADU A;  4Y52 J;  2A68 F;  4ZTF A;  2PMH A;  2PFV A;  2VUM J;  4KIT B;  2KJB A;  3CUQ C;  3BJA A;  2GLO A;  2W48 A;  2R7F A;  3F8N A;  2X9D A;  1ETW A;  5DS9 A;  4HST A;  1MNM C;  2H6B A;  3JTG A;  4A3M J;  4HV5 A;  3VFZ A;  4DOZ A;  3OIP A;  2QA4 I;  3HTU A;  2MAB A;  2HDC A;  2LBF A;  3IUO A;  3AQT A;  4CH7 A;  5LEK A;  3HTJ A;  3H35 A;  3JRE A;  4HV6 A;  1JUS A;  2VKH A;  4HNV A;  4P9F A;  1QGP A;  1E3O C;  1R5I D;  4OAZ A;  5CXG A;  4XRM A;  1P7J A;  3I9V 2;  4GCK A;  3NXC A;  3OYI A;  4KFC A;  2F48 A;  1JTY A;  2DA2 A;  2NAZ A;  4A3J J;  2FA5 A;  3K10 A;  3CC4 I;  1EJ9 A;  2VL8 A;  1FOY A;  4HZF A;  2P5V A;  1KU7 A;  1YTY A;  3G1L A;  1MKM A;  4M73 A;  5F1J A;  3MCZ A;  3QQA A;  2K85 A;  2VI6 A;  4U7B A;  1BL0 A;  3BOQ A;  2CFO A;  2TRT A;  3ERE D;  3FXK A;  3RH2 A;  3VW2 A;  4RLQ A;  3PIO F;  2WUI A;  3ECO A;  2CV1 A;  3QKX A;  3C2H A;  2A3S A;  5A2Q Z;  3AKZ A;  5D6F A;  3E5U A;  1YO5 C;  4HNT A;  5IYC J;  2XF5 A;  3RPQ A;  3F0C A;  1QPI A;  2DBB A;  3QAH A;  3K1N A;  3F72 A;  4Y13 A;  2YU9 J;  3LHQ A;  4M9Z A;  4RGU A;  1FOK A;  1X4O A;  1LDJ A;  1WFX A;  5E79 C;  2F4M B;  3LAJ A;  2M8G X;  4UV8 A;  4EEF G;  3OYB A;  2FUG 2;  4S05 A;  2VQH A;  2LKX A;  3VOX A;  3ELK A;  2DA1 A;  4CHU A;  5DUI A;  5HVQ C;  2I8D A;  2EPF A;  1Z6R A;  1FWZ A;  3AAF A;  3CTA A;  3LA2 A;  1I3Q J;  1R58 A;  4L18 B;  4ZTJ A;  3S17 J;  2LKS A;  3JRG A;  5J4Y A;  4HF2 A;  2IGN A;  5EZH A;  4HG2 A;  1LDK B;  1RET A;  3ON2 A;  1QO0 D;  1TT5 B;  1Y8Q B;  1P2F A;  1F9N A;  3HOV J;  2DMP A;  4DZJ A;  1SFK A;  2DMN A;  3IC7 A;  3H36 A;  2GAU A;  3DLL F;  3KEO A;  1D5V A;  2M7A A;  4E7L A;  1K6Y A;  4EJO A;  3GO5 A;  5LEJ A;  1LDD A;  3HSR A;  3P9K A;  4QLC U;  1EA3 A;  3H9Q A;  2Z33 A;  3CCJ I;  4BJ6 C;  2TCT A;  2WY8 Q;  4DYR A;  2CO5 A;  2ELK A;  2EV0 A;  4XOR A;  3PNT A;  3WTU C;  2DK5 A;  4WXD A;  1IN6 A;  1BI0 A;  4ICH A;  2WWY A;  1TBX A;  3L00 A;  2NVU B;  4K2E A;  4AC6 A;  3RPU D;  1G59 A;  2QGU A;  5BNG A;  1SD5 A;  2GIZ A;  1WPK A;  2L3D A;  5FFZ A;  4PXI A;  5J4V A;  2ZME A;  5AQC A;  3A0B C;  3GBG A;  3CZ6 A;  4XR6 A;  3KET A;  3NRV A;  4DIQ A;  2E2J J;  2E35 A;  2QKO A;  3EGQ A;  2L7F P;  5DV5 A;  4L9T A;  4A3K J;  4CXF A;  5DDG A;  3I58 A;  2ZFW A;  2PMZ A;  4CA0 A;  4JOM A;  3NNR A;  1AA7 A;  1XSX A;  4XBF A;  4HOB A;  1UHS A;  2DDB A;  2Q2E A;  3CLQ A;  3GZ5 A;  3CES A;  4G7Z F;  1JUM A;  4IOA F;  2KIQ A;  4GCV A;  2PMU A;  3SEZ A;  2FEZ A;  1G3S A;  3S32 A;  2LRE A;  3BR1 A;  2ISY A;  3R4K A;  5E20 A;  2ZME B;  4BYY A;  3V78 A;  1FOW A;  1U5T A;  5J3L A;  3S8P A;  4ESJ A;  2AQF A;  3IP4 B;  1XDS A;  1IN7 A;  3KEY A;  3K70 C;  4AWX B;  4BHB A;  2R7R A;  1S5L C;  1Y1V J;  2XGD A;  3FIW A;  2QWT A;  1S7A A;  2HOS A;  1XD7 A;  4MFD A;  3IHU A;  3ABT A;  3SWH A;  4XKW A;  3S2H J;  2UXO A;  4NC7 A;  5E1X A;  4IF4 A;  3NRG A;  1XGO A;  1QVT A;  5J6X A;  4B09 A;  2M30 A;  2Y48 A;  2JRT A;  2STT A;  2V9P A;  1QPM A;  1BIB A;  3CRJ A;  2ZCX A;  1MMA A;  3RDI A;  3CO7 C;  1U5T B;  3LWF A;  1F1Z A;  2K4J A;  3TKY A;  4Y33 A;  3OY9 A;  1UAA A;  4GCT A;  1A6I A;  2F4I A;  2B1E A;  3HTA A;  2L2O A;  1IV8 A;  4GCL A;  1NTC A;  3DLA A;  1DP3 A;  3PO3 J;  4C3J J;  4BGD A;  4AIH A;  3LAP A;  2KIS A;  4JL3 A;  5C4Y A;  1G8X A;  5EGO A;  2VC1 A;  1IJW C;  3HC7 A;  2DXI A;  4OAY A;  2ESH A;  2XF7 A;  3IRQ A;  2IS4 A;  2JUC A;  4XLA A;  3IV5 A;  1G4D A;  4HQE A;  1IRZ A;  4OD5 A;  1P4X A;  4UVC A;  2JWT A;  2CH0 A;  3T1B A;  3QU6 A;  4QWQ A;  3CJD A;  4IO9 F;  2A07 F;  5CVR A;  3LWJ A;  3ISP A;  3HBL A;  1W4M A;  4U7D A;  2MC4 A;  2NVQ J;  5FB2 A;  1JXS A;  4LIV A;  3L09 A;  2FOK A;  1AU7 A;  1E3H A;  2K9M A;  3AG1 H;  5FLM J;  2XRL A;  4M72 A;  2HS5 A;  1PUF A;  2JVG A;  1O3T A;  5EGO B;  2ZJ2 A;  2UXU A;  2IA0 A;  2PBI A;  3KE2 A;  1MMS A;  3DPU A;  3K69 A;  1B8I A;  3FKJ A;  5HAW A;  3ONQ A;  3SFZ A;  4YIR X;  3FM3 A;  3IWF A;  4D1Q A;  1I50 J;  3OS2 A;  1DGR M;  1EV7 A;  3MKY B;  2UXI A;  4RAF A;  3SJM A;  1X2N A;  1CGP A;  3U2R A;  1Y56 A;  3E97 A;  1W7P A;  1SVO A;  1BJZ A;  3G56 A;  1ZGW A;  5TRD A;  2IS6 A;  1HST A;  4XMY A;  4ON0 A;  1PUF B;  1VQ5 I;  2H1L A;  2HQN A;  1T39 A;  1J09 A;  3PSF A;  3D1N I;  3F3X A;  1UFM A;  2A05 A;  3VPR A;  2XPV A;  4D7M A;  1TWG J;  4Q4Z F;  3PSI A;  1B8I B;  1W0U A;  4FTH A;  2XKO A;  1ZR2 A;  1VQK I;  2NOJ B;  4KIF A;  1C0W A;  2MH9 A;  4XKB A;  4XOT A;  4BQN A;  2ZME C;  3R60 A;  2BZT A;  2GUH A;  1WJA A;  2G7U A;  4MEX F;  2DLL A;  1ETQ A;  1VF9 A;  2E36 A;  2O8K A;  3L2U A;  2LY2 A;  2YVE A;  1W7P B;  4KWA A;  1HC8 A;  1B6A A;  1ZRE A;  4RAG A;  2F4O B;  3VYU B;  2FD5 A;  1ONV A;  2WC2 A;  4CCK A;  1GLN A;  4ACI A;  4HQM A;  2HPI A;  4LIT A;  5IYB J;  5TJJ A;  2O3F A;  5IT9 K;  5M3F J;  2EIN H;  4P5O A;  4C9Y A;  3E6C C;  5M5W J;  1HF0 A;  1SGM A;  3PUF A;  3JSP A;  1ZLJ A;  1YIT I;  3VOE A;  2HTS A;  5FRM A;  3O3K A;  4B4C A;  3S3M A;  4IL6 C;  3DTE A;  2L0K A;  2QQA A;  3ROU A;  5D18 A;  2LDU A;  4ZYE A;  1U5T C;  3LMM A;  3HOS A;  1ZH5 A;  3KNW A;  2OJE D;  2HI3 A;  2LMD A;  2L7K A;  3DF8 A;  2ID3 A;  1LVK A;  3ECH A;  4E7Z A;  3H92 A;  3BJB A;  2DDA A;  4L62 A;  4HLX A;  4E7I A;  3S14 J;  3HYI A;  2KIM A;  1JI8 A;  2X51 A;  4BDY A;  4IRV A;  3FBN B;  1IRF A;  1W7P D;  2CQK A;  3X2Q H;  1O3R A;  5K58 A;  3GTK J;  1LVA A;  4V2F A;  5D1R A;  1WWX A;  4M3F A;  4U0Y A;  3O60 A;  4ZDL A;  2HTJ A;  4XN0 A;  4BE0 A;  5KCM A;  3GLL A;  4U9N A;  2FRH A;  2HFH A;  2X0L A;  3H9J A;  2VIX A;  4WCG A;  2L4A A;  2Y0S N;  4B8X A;  3WHB A;  1FT9 A;  2KPM A;  4HAM A;  1B9N A;  1Z05 A;  4UNO A;  2DCE A;  3FBI B;  2BXY A;  2COM A;  2DT7 B;  3ASO H;  1UZC A;  4M9X A;  2LD5 A;  3V42 A;  1MMG A;  2BY2 A;  3CO6 C;  2UXP A;  2E1M C;  1G3Y A;  1GVJ A;  3T8T A;  2DPD A;  4ENK A;  1REP C;  1X1C A;  5CVU A;  3KKC A;  4I7H A;  1WJC A;  1XMA A;  3RKQ A;  4JKZ A;  2O0Y A;  1MH4 A;  2HQA A;  2RGV A;  1FJL A;  1DPU A;  3W6J B;  2XSJ C;  5K5R A;  4ZYA A;  1K7A A;  2CQ7 A;  3O8G A;  1ZR4 A;  3E5X A;  5ED4 A;  2ZC2 A;  3I71 A;  4FHT A;  2CRG A;  1P6R A;  5C44 J;  2R7X A;  4MTE A;  3WG9 A;  4XRS A;  1FP2 A;  2HZD A;  3FX3 A;  3HSF A;  3PM1 A;  5FJ8 J;  5BOX A;  5L3B A;  3VP5 A;  1T38 A;  4LFU A;  3W6K B;  2PBX A;  1LB2 A;  1DUX C;  2H1K A;  2FOW A;  2P6S A;  4HX4 A;  4HNU A;  2JT1 A;  3MKW B;  1NHA A;  5B3S H;  2KQR A;  4OWR B;  3JRI A;  3Q3S A;  2XAS A;  1IAW A;  3OS1 A;  3M9A A;  2FQ4 A;  2V57 A;  5A2Q K;  2CW0 F;  4BQQ A;  2QYO A;  2PG4 A;  2FNA A;  4WX9 A;  2FNP A;  2CUE A;  4OMZ A;  3J7Z I;  1JT0 A;  4LG0 A;  2WB1 N;  1ERD A;  1U2W A;  1EH8 A;  2DOE A;  5IT3 A;  2R7S A;  2D5V A;  5D5U B;  4XKV A;  1ZRF A;  3G73 A;  2VE9 A;  2EV6 A;  3MFK A;  1RNL A;  5K7Z A;  4CZZ A;  2EB7 A;  1ETO A;  3FK6 A;  4UDS A;  4I99 C;  3HRT A;  2QVO A;  1Z9C A;  1WKM A;  3DP7 A;  1V4R A;  4CIC A;  2MA3 A;  3WTX C;  3M8E A;  1J59 A;  2CUZ A;  5LGU A;  2G3B A;  2R3S A;  2XF6 A;  3DU5 A;  4LG0 B;  2JJ7 A;  3FXO A;  1N78 A;  1E17 A;  1FP1 D;  2A2F X;  4C2U A;  4PJN A;  2O8X A;  1MBH A;  4IQ4 A;  4ENJ A;  1G6N A;  2E1N A;  2X1E A;  3HOT A;  5IY5 H;  3SHF A;  2GEN A;  1UG2 A;  2RNJ A;  1GT0 C;  3FKI J;  2ZCN A;  1H88 C;  4MXM A;  4BS9 A;  3ZQQ A;  1DPR A;  1ON2 A;  5FLX Z;  2OAZ A;  3VOD A;  5HDN A;  2VAS A;  2IGK A;  2F5V A;  3DPT A;  5ILU A;  2GWR A;  3ZGK A;  1A36 A;  3HGY A;  3S1N J;  3DFG A;  3MKL A;  1EH7 A;  4ZYH A;  2NP5 A;  1QZY A;  4A0X A;  1JKR C;  3WOD F;  2D6Y A;  3NWT A;  2KZV A;  2DG7 A;  3CF5 F;  1CF7 A;  4M3G A;  2VJ5 A;  4GFK A;  1L0O C;  4EGY A;  3GTM J;  4WIB A;  3K2Z A;  2EJR A;  4LIU A;  4RB3 C;  3CCS I;  1ZQ3 P;  3ZQL A;  3GZI A;  4IJA A;  4XSZ F;  4GDF A;  5D5W B;  5EEH A;  2XB5 A;  3ZQF A;  2ZOY A;  4PCQ A;  4J19 A;  1LKX A;  1K78 A;  5F04 A;  4AM3 A;  3F8B A;  1UG0 A;  3LSI A;  1TWC J;  4A6D A;  1O7L A;  5DD8 A;  2P5L C;  3RQI A;  3B81 A;  2K9L A;  3I4M J;  1NG6 A;  1LFP A;  3V7R A;  5FKN A;  4XIC A;  4BBS J;  3FMQ A;  3LST A;  2A6E F;  2E5Z A;  1YLF A;  1CF7 B;  1RES A;  2OQR A;  4S04 A;  2R5Z A;  1XCV A;  2FQ3 A;  3VEP A;  2GA1 A;  2QTQ A;  4I0A A;  2ECC A;  3OL4 A;  4BQO A;  2HZT A;  3BP8 A;  4G94 A;  1E2X A;  2L9V A;  4XNF A;  2PEX A;  4E70 A;  2XPW A;  1S29 A;  4EMS A;  2NX4 A;  3WE3 A;  3J7Y J;  1K78 B;  1KQ9 A;  2M2E A;  1YRN B;  1D0Y A;  4ME9 A;  4J01 A;  3D5R C;  3U9G A;  3WGH A;  5DCF A;  4F93 B;  1WVR A;  3ABU A;  1FPQ A;  1XMX A;  3M8J A;  5L3F A;  1G2H A;  4HYE A;  4CCO A;  1TTY A;  2R5Z B;  2DOF A;  3SZP A;  3CQZ J;  1VQ8 I;  3GCM A;  3D0S A;  4JNN A;  3DTK A;  2K4B A;  3HB9 A;  2FX0 A;  2NP3 A;  3HRU A;  3CCY A;  3DV8 A;  3LSK A;  1QNT A;  3CDI A;  4P96 A;  3C18 A;  3K6G A;  2CWE A;  1USS A;  5FGM A;  1O3S A;  2P81 A;  4UVA A;  1J2X A;  5D19 A;  4AUX A;  4FAS D;  5HOO A;  2MH2 A;  2EK5 A;  4P9U A;  3PPB A;  2KJC A;  1W5C C;  3Q0V A;  2R7D A;  3QPS A;  2UUZ A;  3EUH A;  1XC5 A;  2L7M P;  3KP2 A;  4M6X A;  2HWV A;  2RHA A;  4M74 A;  3BG3 A;  2HU9 A;  1QRY A;  4BQA A;  1Z3X A;  4YFK F;  1W0T A;  5HLT A;  1S9H A;  3W2V A;  3E7L A;  2I5U A;  3I0T A;  3JSO A;  4EJT A;  2IA2 A;  3QU3 A;  2Q1Z B;  4MHG A;  2UZK A;  4HA8 A;  2B63 J;  3KEQ A;  2IXS A;  5H20 A;  2VON A;  3HG9 A;  3FHN A;  1KQ0 A;  2L01 A;  2VPL A;  2QOP A;  4A69 C;  1RIO H;  1CQT A;  2FSW A;  3K0L A;  1RUO A;  3O6B B;  3GWZ A;  3PAS A;  3KIO A;  1S72 I;  4AIK A;  2AO9 A;  4LLL A;  1SFU A;  5D8K B;  1Z91 A;  3VSK A;  4OIO F;  3T5X A;  2OPT A;  3F8M A;  2Y69 H;  5CXI A;  2ISZ A;  3C2B A;  4Y7N J;  4BH9 A;  2NYX A;  4M6Y A;  2K3P A;  2JA7 J;  2QWW A;  3A4C A;  4IRG A;  4V2G A;  5C4X J;  1IDY A;  2EV5 A;  4Y15 A;  1SAN A;  2MD5 A;  4N9I A;  3CC7 I;  4RAY A;  3TP0 A;  1OCZ H;  3W2W A;  3JRC A;  2A5Y B;  1YX5 A;  4O6J A;  1YW8 A;  1O57 A;  3WE2 A;  2OUM A;  2NOG A;  1ZG1 A;  3WTY C;  4IPA A;  2E1O A;  2IA1 A;  4YG2 F;  3UNG C;  5LD2 C;  1SC7 A;  2G7L A;  1W36 C;  4KJZ A;  5E17 F;  2DFE A;  4PJJ A;  2AS5 F;  1ZGA A;  3QP6 A;  4IVN A;  4G6T B;  4ZH4 F;  2BOL A;  1FYK A;  1HA8 A;  3DU6 A;  5DTD A;  2RAS A;  3EET A;  3OIO A;  4A3G J;  3CP8 A;  3DKW A;  4P1W A;  5K7H A;  2VBW A;  4I76 A;  3QYE A;  4DW6 A;  1NK2 P;  2CUJ A;  2ICW G;  2W57 A;  3BY6 A;  2VT2 A;  5KNL A;  1LEB A;  3TED A;  3WG7 H;  1Y39 A;  3IH3 A;  4UUT A;  4RBO A;  3BZC A;  3VYS B;  3PIP F;  1V3F A;  4YIF A;  1QHG A;  4DQ2 A;  2QSH X;  3EYY A;  1MBE A;  1SFE A;  4OIP F;  3TW7 A;  2BHZ A;  1OJL A;  1U8B A;  2A61 A;  3OSG A;  3OS0 A;  2VQG A;  1S7E A;  3CWR A;  1P92 A;  2XAJ A;  1JHH A;  2DA6 A;  4LB5 A;  3MZ8 A;  4F52 A;  4BE2 A;  5HBU A;  2Q0O A;  2Y31 A;  3QPL A;  3C3W A;  5GPA A;  3RPU A;  2F5D A;  3MQ0 A;  4M3E A;  3K7A J;  1MBF A;  4MIM A;  3VVZ A;  2ZXH A;  2OZU A;  2DU9 A;  1LUJ B;  4RB0 A;  5KVR A;  3E5Q A;  1Z67 A;  1OYY A;  4ENN A;  4CSW A;  2R5Y A;  4BJ5 C;  2CQN A;  2GBY A;  2Z99 A;  4M3D A;  1OCR H;  1DQU A;  4KIS A;  1STZ A;  3JRB A;  1X1P A;  2DFF A;  5HS8 A;  3VWB A;  4AYB N;  3E0J B;  5HS7 A;  3K4J A;  5K5O A;  2CV2 A;  3V8J A;  5LHG A;  2X48 A;  3I54 A;  1IF1 A;  2L4M A;  2JPB A;  2HQ5 A;  2MC3 A;  4E7S A;  4GFL A;  5J40 A;  1WSU A;  3JCU C;  1XDU A;  3DKY A;  2YUS A;  1IN4 A;  1R7J A;  2XAH A;  3L7W A;  5CQG A;  5LHH A;  3I4N J;  4HSR A;  3KYD B;  3WU0 A;  1IUF A;  2CUF A;  3O8H A;  4HLY A;  2I10 A;  3MVP A;  4RMN A;  3PFI A;  2R5Y B;  4MQV A;  3CD6 I;  3T8R A;  2QKL B;  4A12 A;  2R4G A;  3EUH C;  2XAQ A;  4XLF A;  4YRV A;  2LK2 A;  4W1U A;  4A5M A;  4EAT A;  2HDW A;  1JHF A;  3QOD A;  3GFL A;  4CDG A;  3D5L A;  2KMU A;  1W1W E;  2HVQ A;  2OTL I;  3H3V K;  3TL4 X;  2QLZ A;  4G7H F;  2Y2Z A;  3GTG J;  5IP7 J;  2LOO A;  4PDK A;  2EH3 A;  2LP0 A;  2FMY A;  3FDY A;  3EUP A;  2NXN B;  3L2R A;  1FLI A;  2EQR A;  1DDN A;  1YJ9 I;  1TP4 A;  4KN7 X;  5AIQ A;  2RDP A;  4WXH A;  1IN5 A;  4PK4 A;  1VQ4 I;  2KDZ A;  2ID6 A;  3HKZ N;  3CMM A;  2XGC A;  2XAU A;  4P55 A;  3GW2 A;  2Q24 A;  4BHP A;  1GVD A;  3HSE A;  1XG1 A;  2GM4 A;  1FBQ A;  3JSJ A;  2K5C A;  4J00 A;  3C2G A;  4DJA A;  1BOA A;  4KDP A;  2R7Z J;  2HKU A;  1HOM A;  3CDL A;  3CMA I;  2XGX A;  2ZJR F;  5M5X J;  4XKC A;  1XS9 A;  5EF6 A;  2M34 A;  4HBL A;  4IRH A;  5JFR A;  2XC7 A;  2VOD A;  3QBM A;  5D8L B;  3P9C A;  3ZQG A;  5J47 A;  2V1X A;  4C3H J;  2CGP A;  3K4K A;  1POG A;  4BDZ A;  3BTL A;  2X1C A;  2DG8 A;  3COL A;  1P4A A;  3TDZ C;  3SQN A;  2LF7 A;  1RR8 C;  5K5Q A;  1JKQ C;  4IHX A;  3FMS A;  2K7L A;  4D5F A;  2EFO A;  2XDV A;  3MD2 A;  4M6V A;  1TQM A;  3BNI A;  3BJO A;  4C2T A;  5KAI C;  5FLX K;  1IC8 A;  2DMU A;  1T08 B;  4B43 A;  1OLT A;  2O7T A;  2YX7 A;  4HX8 A;  2R93 J;  4B1R A;  3AFH A;  2NNN A;  1RI7 A;  4ETS A;  4H0E A;  1ZRC A;  3MWM A;  3BG9 A;  4A3L J;  3OYC A;  1R00 A;  1GV2 A;  1FOX A;  4D0P A;  2OCC H;  2DQR A;  5HNF A;  1B9M A;  3N4M A;  1FYM A;  3CCV I;  4ZYD A;  4RM3 A;  2CW8 A;  3W3C A;  2VQC A;  5FKO A;  4ANJ A;  5FD5 A;  3B6C A;  3R0A A;  1O3Q A;  5CQE A;  3BC8 A;  3QRF F;  2FJ1 A;  1LFU P;  2VXD A;  3MMY B;  4EM0 B;  4JYK A;  4BXU A;  1XGN A;  2CFX A;  2E71 A;  3LSM A;  2WA0 A;  1X4P A;  1DGW Y;  2EZH A;  2NVX J;  1H0M A;  4KT6 A;  4BUP A;  2W1O A;  4ZDP A;  2HXO A;  5F27 A;  2K9S A;  2YU3 A;  3L9F A;  2XGE A;  5JHU A;  2XRO A;  1ZKG A;  1BN5 A;  3P9I A;  3ZMV A;  1J7K A;  3H3Z A;  1T2K A;  1R4N B;  2C6Y A;  5E18 F;  4D9J A;  1UI6 A;  2MGQ A;  5HSZ A;  1D5Y A;  1N77 A;  1Y0N A;  5E8G A;  4KIG A;  2JVH A;  3H9G A;  1VI0 A;  2D45 A;  4OMY A;  4M3B A;  5K7F A;  3GEZ A;  1KYZ A;  4WK8 F;  2W84 A;  3S1Q J;  1SMY F;  1SVL A;  2A5W A;  1DU0 A;  2E2H J;  3EUK L;  1Q1V A;  3OYG A;  2M8E A;  1QA6 A;  1MBG A;  1OYW A;  3GFJ A;  5IOY A;  3LSP A;  1ITY A;  1B59 A;  1ZEL A;  1MDM A;  3CJT B;  3HEF A;  1ETX A;  1RKW A;  2NS0 A;  4X1E A;  5F0C A;  2Q8K A;  4E7K A;  2VT3 A;  4BXX J;  3F21 A;  1P4W A;  3LJL A;  4B3X A;  5IP9 J;  1KU3 A;  1GUU A;  2JMW A;  2QBY B;  3OOU A;  4XL9 A;  1ENH A;  3TO7 A;  4ENM A;  1EF4 A;  3HPH A;  1LE8 A;  2JUG A;  1MNE A;  4I0B A;  4DVY P;  4GO1 A;  4PUS A;  2ZXI A;  2LR8 A;  2CYY A;  1XX5 A;  4Q47 A;  2ELH A;  2OQG A;  1YE9 A;  2DO7 A;  3OYL A;  3KYC B;  3TOB A;  2FJI 1;  2RC4 A;  2H6C A;  1MMD A;  3S1R J;  1H89 C;  2MBF A;  4XLN F;  3PL8 A;  3TBI A;  1VTN C;  4CGR A;  1BI2 A;  3VDX A;  4KT5 C;  1K61 A;  1MDM B;  3T0Y A;  3GFM A;  4DBQ A;  2W82 A;  2HKO A;  4HPQ A;  3UKG A;  4IQJ A;  5J8C A;  2KKO A;  2CG4 A;  5H6Q A;  2Y0S A;  4GYI A;  3SZG A;  4IX7 A;  3C7J A;  1A35 A;  4DNC A;  4II3 A;  1LE8 B;  1B4A A;  1WJD A;  4G7O F;  4IOC F;  2MSY A;  3OWT A;  5H6R A;  2EFN A;  1ON1 A;  2UWM A;  5D5V B;  3DEU A;  2CSO A;  4RGR A;  3A03 A;  2E5N A;  1HKQ A;  3FM5 A;  4R79 A;  2EZL A;  4UUS A;  1VQN I;  4X6A J;  3Q5F A;  1MW7 A;  4L9J A;  1WJE A;  3K9T A;  5DD4 A;  1I27 A;  1SFX A;  3EDP A;  3L2W A;  4MQ9 F;  1QZE A;  2IRF G;  3H5A A;  2XKP A;  3KP6 A;  3MN2 A;  4A0Z A;  1XGS A;  2V7F A;  2P7C B;  2JA2 A;  4DYQ A;  4A3I J;  2WBM A;  1K4T A;  1BR2 A;  4I2O A;  3GTJ J;  5C4J J;  2AQE A;  2G7S A;  4BY1 J;  1ZTR A;  3P9T A;  3HHG A;  3F22 A;  3L2Q A;  2V1D A;  2DOA A;  4FX4 A;  2ZJP F;  3IKV A;  5EFY A;  4UUS B;  3BTI A;  3QP5 A;  2MG4 A;  3E3V A;  3IUV A;  3CCM I;  4PSW A;  3BG7 A;  2FML A;  2K40 A;  4NB5 A;  4I02 A;  3TP3 A;  3ZMT A;  4IRI A;  2HNH A;  2IJL A;  5CVI A;  1JUP A;  1WGX A;  2HXI A;  2KL4 A;  2V9V A;  1VND A;  1UI5 A;  2QUF A;  3S5R A;  1PP7 U;  2H8W A;  2VKD A;  1TQP A;  2WB1 A;  2ZB9 A;  4A3B J;  5CPR B;  4ABZ A;  1Z1D A;  3UR3 C;  4WWC A;  1LFB A;  1R36 A;  1UEL B;  1RUN A;  3RCO A;  1DU6 A;  2KFD A;  1VFC A;  2QZ8 A;  5J1R A;  2W53 A;  1YW9 A;  4I98 B;  3HTH A;  3CJN A;  5ICF A;  4ZZD A;  4PZJ A;  2VJI A;  5TGT A;  4LGW A;  1KYW A;  2KLO A;  1T0F A;  1XPX A;  1X2M A;  1HW2 A;  3V4G A;  3JRH A;  4MNU A;  3M4O J;  5FO5 A;  4FE7 A;  1WJB A;  2EIM H;  4A6E A;  1MND A;  2X85 A;  3G3Z A;  2YPR A;  2YVH A;  5LHI A;  2P5K A;  1X1B A;  3ZXS A;  2Y30 A;  1A5J A;  2GQQ A;  1K4S A;  3COA C;  3BG6 A;  3CF2 A;  4RA2 A;  1YJN I;  2BV6 A;  2EZK A;  4AD9 A;  4AU7 A;  2GXA A;  4GYG A;  3RIR A;  4CCL A;  4I01 A;  2ME0 A;  1YX3 A;  3GX4 X;  2KZG A;  1HKS A;  1X1A A;  3OL3 A;  4AIJ A;  3AG4 H;  3TDU C;  4BBR J;  3IH2 A;  2HVR A;  5C3E J;  4O5V A;  3OYH A;  1MZB A;  2G0E A;  2W4S A;  3E6M A;  5JI6 A;  2RAE A;  2PI0 A;  2BE5 F;  3AL0 B;  2O03 A;  3V8K A;  3S15 J;  4A3D J;  3ABK H;  1BJA A;  3JR9 A;  2NVY J;  3OR2 C;  3R6S A;  3OR1 C;  4CGZ A;  2OU2 A;  3IH4 A;  3ZR8 X;  5F0H A;  3BPV A;  1XGM A;  4HF1 A;  3WTV C;  5B5E C;  1J0R A;  2F2E A;  2FE3 A;  3S93 A;  4Y3O A;  2QSG X;  2Y0M A;  5FHP A;  2KRH A;  1BIA A;  2YR2 A;  5FRO A;  2HKX A;  1VQ6 I;  1D3Y A;  1ETV A;  2XSD C;  2F5E A;  4CO8 A;  2IVM A;  2EIK H;  2WY7 Q;  3VB2 A;  3J7A O;  1ZG3 A;  1U3E M;  4IHW A;  1IXR C;  3BR6 A;  4JK1 X;  1PP8 F;  5E3O A;  2Z5U A;  2JA8 J;  3R0J A;  2DT5 A;  3IKT A;  4L0Y B;  1OMI A;  2QSF X;  2BY0 A;  1KQ8 A;  1BC8 C;  2HYT A;  5HLH A;  1I3A A;  2BVM A;  1BM9 A;  1X1D A;  1KU9 A;  1AHD P;  3KZZ A;  2OC6 A;  3H0G J;  4OU0 A;  4NEL A;  4ESB A;  5EG0 A;  3PJR A;  1MBJ A;  2KT0 A;  2PN6 A;  3WGG A;  2ACJ A;  1APL C;  3LNQ A;  5FKK A;  3H1C A;  4FX0 A;  5DM6 F;  1QU3 A;  1B1B A;  1R1T A;  3RYP A;  5LRS A;  2OI8 A;  2JRM A;  3HM5 A;  3SZT A;  2IAI A;  3REO A;  2DK8 A;  3IAS 2;  2VC0 A;  2CU7 A;  2MLK A;  1FIA A;  3GME A;  5KK1 A;  3FWE A;  5B1B H;  5K1Y A;  5J1Y A;  3ZPL A;  1R4M B;  4L9N A;  2Z1D A;  2ZSI B;  3BWG A;  2IPQ X;  2DT6 A;  3FZV A;  5CVJ A;  4BAC A;  1YHQ I;  2PJR A;  2WGB A;  2RKH A;  3SYT A;  1DP7 P;  4R1H A;  4EQQ A;  1GDT A;  2FBH A;  3FXM A;  3KPH A;  1YRN A;  2COB A;  5IYD J;  5EG0 B;  1K6O A;  2M3A A;  1QHH D;  4YEJ A;  3CMY A;  3NPI A;  1JT6 A;  4Y4R A;  2FU4 A;  3VVY A;  1UB9 A;  1ACI A;  1KU2 A;  2VOO A;  2ZJQ F;  5ICC A;  4OOI A;  3QOE A;  3QYB A;  4II2 A;  2V9K A;  5TIS C;  2VXZ A;  3B73 A;  3PUB A;  3ZMS A;  4BY7 J;  3CCE I;  3BR0 A;  5B1A H;  1GHC A;  1T33 A;  1SAU A;  1ZAR A;  1OPC A;  1I5Z A;  3WTZ A;  2PJR B;  3GTQ J;  2LH9 A;  2IEK A;  1U78 A;  2HYJ A;  3BZ6 A;  3J80 Z;  3OYA A;  2E19 A;  3OYM A;  3VSL A;  3JTH A;  4R8H A;  3MAJ A;  4KMF A;  3S2D J;  2JZY A;  2DQL A;  3K1P A;  2GFN A;  4C3I J;  4KMU X;  2OTJ I;  2M0M A;  2QKM B;  2LRD A;  3EPZ A;  2LNB A;  4PJM A;  4UB8 C;  3CJR B;  3U21 A;  1T0F C;  3FXQ A;  1Z0X A;  2DFH A;  3A01 A;  4I09 A;  3G7R A;  2HOT A;  5CW8 A;  2BY1 A;  1T56 A;  1IDZ A;  1ORK A;  2QEN A;  3AG3 H;  1U9O A;  3HOU J;  3AL0 C;  1HQC A;  4W97 A;  2Y75 A;  3OV8 A;  4BXF A;  4XRS G;  2XAF A;  1GXP A;  3DEE A;  3G1M A;  1A6Q A;  2YSR A;  2GXG A;  3C1D A;  3TQN A;  4LLN A;  5B66 C;  1O7F A;  3ERM A;  1Z7U A;  4F55 A;  1NK3 P;  4IHT A;  1RPW A;  3NWS A;  5KAF C;  1QQI A;  2CJJ A;  4FQG A;  1JJ8 C;  4U9L A;  2NNY A;  2Y9Z A;  5E3N A;  4A3C J;  2X6Y A;  2GXB A;  3F8F A;  2FBI A;  2UXN A;  2W24 A;  5GAD J;  1V5G A;  3A01 B;  5ILV A;  4UUV A;  2DN0 A;  5FFX A;  2A69 F;  4RAZ A;  1SD7 A;  4YFX F;  2LKP A;  1IUY A;  1TW3 A;  5BQT A;  4RGX A;  1V54 H;  4HRI A;  3NS4 A;  3I55 I;  3FXU A;  5GAE J;  3RZD J;  2DYS H;  3DPL C;  2H09 A;  3LFK A;  2XAG A;  3HHH A;  1JJ6 C;  1R1U A;  2MYS A;  3G4S I;  1FNN A;  1BR4 A;  2XPU A;  2KP6 A;  1SD6 A;  2R92 J;  4E7H A;  4C30 A;  3ZQH A;  3CCR I;  1FX7 A;  3A1Y A;  2GA2 A;  2R7Q A;  3RTR A;  4BKX A;  1H8A C;  3F23 A;  3DCF A;  1R1V A;  2BHY A;  2PJP A;  4MO7 A;  5LRR A;  1PVE A;  1SVM A;  2EA2 A;  1HDD C;  4L0Z B;  1D8J A;  1G3W A;  2QF7 A;  4UXN A;  4E4H A;  3QYF A;  2V6E A;  2ZBK A;  3CUO A;  3GVA A;  2F6C A;  2HOE A;  2CW7 A;  4YII A;  1Z7L A;  5ICG A;  3VW0 A;  1O4X A;  2EFW A;  1JGS A;  1XTA A;  4U0W A;  1WJ5 A;  5IOZ A;  2RV8 A;  4HDU A;  1X3W B;  3RD3 A;  2VBZ A;  4IEJ A;  3E7Q A;  3J81 Z;  2Z2S B;  1UJ8 A;  1PJR A;  5JVT A;  1FBU A;  2WAE A;  4EVI A;  4FE4 A;  3HTI A;  1MJA A;  2V26 A;  4IZZ A;  4ZYG A;  3GFI A;  3B6A A;  1JTX A;  4KA4 A;  2GOM A;  2XRN A;  4F91 B;  1X19 A;  2DI3 A;  2EBI A;  4AYB A;  3BCB A;  2L9N A;  2GOX B;  4QIW N;  3AQS A;  5KHD A;  2HDD A;  3RSN A;  2YX4 A;  4EGZ A;  5HLG A;  2B3W A;  4BL0 B;  2L9S A;  1IGN A;  1JKP C;  1UHW A;  3N97 A;  1ZHF A;  2WAQ N;  1X3Z B;  1Z3Y A;  1Q1H A;  1VQ7 I;  1YI2 I;  1T98 A;  4LB6 B;  4N4O B;  1J5Y A;  2ESN A;  1PYV A;  1OIS A;  1ZYR F;  3ZN1 A;  3RI4 A;  2HEO A;  3S16 J;  2VLA A;  3Q9V A;  5AON A;  1YQA A;  2ZNZ A;  3TW6 A;  1S6L A;  2DFI A;  1XMK A;  2QQB A;  2HPM A;  3WTS C;  3DTI A;  1MGT A;  3FHZ A;  2ME6 A;  2VJJ A;  2V1N A;  2IBD A;  2CV0 A;  2EFQ A;  2DTR A;  5LFA A;  3B02 A;  3OMY A;  5EDN A;  4CYC A;  3VYR B;  1OCP A;  1TWA J;  3F6O A;  2OER A;  4IHV A;  4RS8 A;  2DMQ A;  4A0Y A;  3P7N A;  2BGC A;  1IZ1 A;  1IW7 F;  3TO6 A;  1H9T A;  1FTT A;  3G1O A;  1HXD A;  3GLX A;  4B44 A;  4KYW A;  2DA4 A;  3OYE A;  1MSF C;  1AKH A;  4FCY A;  3U1D A;  5CYV A;  5E8I A;  5H9T A;  2LBF B;  2ZSH B;  2BYV E;  1YG2 A;  3VVX A;  3QPH A;  4Q48 A;  1MSE C;  3FRQ A;  3RKW A;  3HKZ A;  4B3A A;  2B9S A;  1XSV A;  5H2F C;  3N05 A;  3GTL J;  4X0G A;  1ZRD A;  1V5F A;  3I4P A;  1MH3 A;  4H4K C;  4LK0 F;  2Y9Y A;  4CYC B;  3OYK A;  4NHJ A;  4NN1 A;  2B0L A;  2ZCM A;  1FEX A;  3H5R A;  4G6Q A;  2HYF A;  5JLW A;  3CLO A;  3I56 I;  3K70 D;  5D4R A;  1QVU A;  2HR3 A;  4Y17 A;  1ZG5 A;  3DKX A;  3D5S C;  2ZKZ A;  1S8N A;  4DGW B;  1WHU A;  1R5H A;  4PJ0 C;  1AKH B;  2LVS A;  2LY9 A;  5D4S A;  4Z2Y A;  3S1M J;  4RB2 C;  3ZQC A;  3CME I;  4A3F J;  1KGS A;  2V6C A;  3ASN H;  3BR5 A;  4ZJZ A;  4JX5 A;  3HRM A;  4KNY A;  4XSX F;  3KP3 A;  4O3M A;  1MD0 A;  5D5X B;  2W25 A;  4B47 A;  1ODD A;  4PGG A;  3ML6 A;  4BE1 A;  2Z16 A;  3NI7 A;  2J5P A;  3HUG A;  2JA5 J;  1BBY A;  4B48 A;  1MIJ A;  1IXS B;  4UY8 I;  2VBY A;  2QCO A;  2IW5 A;  3WHC A;  1NG7 A;  5BMZ A;  2LG4 A;  4GFB A;  3VTI A;  3Q0W A;  1WCM J;  3GTP J;  5F0F A;  2CQX A;  1WZ2 A;  1TWH J;  2VBX A;  4JX6 A;  5CKT A;  3FXL A;  1S3J A;  2D1V A;  4GRI A;  1K83 J;  2KIU A;  3F8C A;  3I3L A;  3K8P C;  3OYJ A;  4ZZL A;  1T6S A;  1KA8 A;  4ASN A;  3V6G A;  2EZI A;  2E2I J;  2XHK A;  3K4M A;  2BEO A;  1A04 A;  1S7O A;  2OD5 A;  3ZMZ A;  2PZ9 A;  2DPU A;  2V1U A;  1MJB A;  5F1R A;  4QTR A;  5GPC A;  3HL2 A;  3HUG B;  4JP0 A;  3E6D A;  2YS9 A;  4DZP A;  1FC3 A;  4L5E A;  1L3L A;  4LLG F;  4EM2 A;  1T95 A;  3A02 A;  2M4K A;  2A6H F;  2ZXJ A;  3U1K A;  3LSR A;  3VYT B;  2DJN A;  3LA3 A;  5AIP A;  1ULY A;  1H9G A;  4EJV A;  3J7A Y;  4V19 K;  1RRJ A;  1YS7 A;  3KCC A;  4OIR F;  3F9K A;  1K79 A;  4RM2 A;  2WV1 A;  3I59 A;  2UXX A;  4MGR A;  3RJP A;  5CJ9 A;  3GZ6 A;  1LEA A;  3VOK A;  4ZC3 A;  3JAM Z;  3OOP A;  1YIJ I;  3M7G A;  3TO9 A;  2F5C A;  5HLI A;  1JKO C;  1FTZ A;  3L1P A;  2CS3 A;  1OCO H;  2ZOZ A;  3K4B A;  1EH6 A;  2P6T A;  2FF4 A;  2NVT J;  5DUK A;  2Q2E B;  1TLH B;  2GZW A;  4XLC A;  3SFI A;  2X6X A;  2HQR A;  5CLS A;  4F7Z A;  1HSJ A;  1U9N A;  1PDN C;  1FSH A;  2AXL A;  2M1B A;  3TOA A;  3BT9 A;  4JBA A;  4F92 B;  3M1C A;  2DYR H;  3O2P E;  2E34 A;  1B72 A;  1OQY A;  4IXA A;  4NC6 A;  3S2W A;  3I59 B;  2FBQ A;  3DQV C;  3C07 A;  3R61 A;  3ZMU A;  4C2M J;  5M5Y J;  4RLF A;  2ECB A;  3H0D A;  2ELJ A;  4KIB A;  2PMZ N;  4XQF A;  4MTD A;  1LQ1 A;  4G9Y A;  2Z9O A;  1R6R A; 
#chains in the Genus database with same CATH homology
 2M2E A;  2VI6 A;  1BL0 A;  1WH7 A;  1YRN B;  2TRT A;  4ME9 A;  3RH2 A;  3VW2 A;  2WUI A;  1X2M A;  3QKX A;  3JRH A;  3M4O J;  1G2H A;  4FE7 A;  4MLO A;  5IYC J;  2VKV A;  2R5Z B;  3F0C A;  3CQZ J;  1QPI A;  2YVH A;  1B72 B;  3LHQ A;  4JNN A;  2YU9 J;  3HB9 A;  2FX0 A;  2NP3 A;  3CCY A;  3BQZ A;  2Y30 A;  2M8G X;  2VKE A;  4EEF G;  1A5J A;  2LKX A;  3VOX A;  2P81 A;  2DA1 A;  5D19 A;  4AUX A;  1MBK A;  2EZK A;  3DPJ A;  1I3Q J;  2ME0 A;  3S17 J;  3JRG A;  5EZH A;  4BBR J;  3IH2 A;  3PPB A;  3Q0V A;  5C3E J;  3QPS A;  2G0E A;  1RET A;  3ON2 A;  4LOC A;  2RAE A;  1OFC X;  1XC5 A;  2L7M P;  3ON4 A;  2REK A;  2RHA A;  3S15 J;  3ANP A;  4A3D J;  3HOW J;  3BG3 A;  4XK4 A;  1QRY A;  3JR9 A;  3HOV J;  2NVY J;  2DMP A;  4DZJ A;  2DMN A;  1W0T A;  3NAU A;  4IHY A;  3PO2 J;  3E7L A;  3IH4 A;  5F0H A;  3M3Y J;  4DYC A;  3LSG A;  2G7G A;  1X58 A;  2B63 J;  2TCT A;  4DYR A;  2ELK A;  5FHP A;  4QSH A;  2QOP A;  1ETV A;  4A69 C;  2XSD C;  2M0C A;  2K9Q A;  3Q0U A;  4ICH A;  1CQT A;  5FMP A;  4AC6 A;  4IHW A;  3PAS A;  5BNG A;  3BR6 A;  4PXI A;  1WPK A;  3RZO J;  3BCG A;  5E3O A;  2AO9 A;  5AQC A;  3GBG A;  2JA8 J;  2OPT A;  5JLX A;  2E2J J;  5CXI A;  2QKO A;  3EGQ A;  2L7F P;  1OCT C;  3DEW A;  4A3K J;  3C2B A;  4Y7N J;  2HYT A;  3NNR A;  5FKL A;  2JA7 J;  4V2G A;  1AHD P;  3H0G J;  1UHS A;  5C4X J;  1IDY A;  2UXH A;  5EG0 A;  4NEL A;  1JUM A;  1MBJ A;  2KT0 A;  5IP6 A;  1SAN A;  3VW1 A;  3TP0 A;  3T6N A;  1APL C;  3LNQ A;  3BR2 A;  3BTJ A;  5FKK A;  3JRC A;  1BW5 A;  3HOY J;  2NOG A;  3BR1 A;  2E1O A;  2OI8 A;  1P7I A;  3V78 A;  3HM5 A;  5J3L A;  2G7L A;  2IAI A;  1GV5 A;  2CU7 A;  1FIA A;  5J1Y A;  3VIB A;  2XGD A;  1Y1V J;  3FIW A;  2QWT A;  2WGB A;  2RAS A;  1IG7 A;  5DTD A;  1GDT A;  2HOS A;  2X6O A;  3OIO A;  1YRN A;  4A3G J;  4MFD A;  5K7H A;  2COB A;  4I76 A;  3S2H J;  5EG0 B;  4DW6 A;  1NK2 P;  5IYD J;  2UXO A;  3HOZ J;  3CMY A;  3BG5 A;  1JT6 A;  3TED A;  3NPI A;  3NRG A;  3VVY A;  1QVT A;  3IH3 A;  5E3L A;  4UUT A;  3LSJ A;  4RBO A;  2AHQ A;  4HKU A;  3VUQ A;  1MBE A;  3CRJ A;  2ZCX A;  4BY7 J;  1Y1W J;  3HIM A;  3TW7 A;  3BR0 A;  1OJL A;  1U8B A;  1T33 A;  3OSG A;  1S7E A;  3CWR A;  4GCT A;  1A6I A;  3GTQ J;  2DA6 A;  2IEK A;  1U78 A;  2HYJ A;  3HTA A;  5HBU A;  3BTC A;  2E19 A;  2Y31 A;  3QPL A;  5GPA A;  4GCL A;  1NTC A;  3PO3 J;  4C3J J;  2JK3 A;  3S2D J;  4M3E A;  1HCR A;  3K7A J;  1MBF A;  4MIM A;  5HOD A;  5FLV A;  2GFN A;  4YZE A;  4C3I J;  3VVZ A;  4JL3 A;  5C4Y A;  5EGO A;  1WI3 A;  1IJW C;  2R5Y A;  1Z0X A;  2L7Z A;  3IV5 A;  2GBY A;  3A01 A;  4M3D A;  1IRZ A;  3G7R A;  2JWT A;  2HOT A;  5CW8 A;  1T56 A;  1IDZ A;  3CJD A;  1ORK A;  1U9O A;  3JRB A;  2LTP A;  3HOU J;  3HE0 A;  3LWJ A;  4W97 A;  4AYB N;  3HBL A;  2NVQ J;  4FIS A;  4XRS G;  3G1M A;  2HOA A;  2X48 A;  3W6V A;  3ZOB A;  2LLK A;  2QIB A;  1AU7 A;  1FIP A;  2HQ5 A;  4GFL A;  2H8R A;  5FLM J;  2YUS A;  2XRL A;  1NK3 P;  1RPW A;  1PUF A;  2F07 A;  2CJJ A;  3HDD A;  2NS7 A;  5EGO B;  2UXU A;  1JJ8 C;  3I4N J;  4RDU A;  2Y9Z A;  1IUF A;  2CUF A;  3O8H A;  5J1U A;  5E3N A;  4A3C J;  2I10 A;  3MVP A;  2R5Y B;  1B8I A;  5HAW A;  3A01 B;  2DN0 A;  1RR7 A;  1R9T J;  1I50 J;  5M3M J;  2LK2 A;  4W1U A;  2R0Q C;  2UXI A;  3SJM A;  1X2N A;  3RZD J;  9ANT A;  4MFE A;  1BJZ A;  3G56 A;  1JJ6 C;  1ZGW A;  3H3V K;  2XPU A;  1I6H J;  2JN6 A;  2Y2Z A;  5FKM A;  1PUF B;  2R92 J;  1IV6 A;  3GTG J;  5IP7 J;  2EH3 A;  2LP0 A;  3ZQH A;  3BQY A;  3D1N I;  3EUP A;  2EQR A;  4AC0 A;  3VPR A;  2XPV A;  4D7M A;  1TWG J;  4BKX A;  1B8I B;  1F43 A;  1H8A C;  3DCF A;  5EZG A;  3FIS A;  4MO7 A;  1W0U A;  4FTH A;  4I6Z A;  1ZR2 A;  1HDD C;  2QF7 A;  2GUH A;  1ETQ A;  1VF9 A;  3OSF A;  2KDZ A;  2O8K A;  2ID6 A;  3VW0 A;  2YVE A;  3HKZ N;  1O4X A;  2XGC A;  5EYR A;  2Q24 A;  4KWA A;  1GVD A;  2FD5 A;  5IOZ A;  1XG1 A;  2GM4 A;  3RD3 A;  3JSJ A;  4IEJ A;  3E7Q A;  4D7N A;  4ACI A;  5IYB J;  2R7Z J;  1HLV A;  2HKU A;  3JRA A;  1HOM A;  3CDL A;  5M3F J;  5M5X J;  1Z77 A;  5M5W J;  4FE4 A;  5EF6 A;  1XS9 A;  1HF0 A;  1SGM A;  3HTI A;  2M34 A;  3B6A A;  3QBM A;  1HDP A;  1JTX A;  4B4C A;  3ZQG A;  2L0K A;  4C3H J;  4A3E J;  5D18 A;  1POG A;  3COL A;  3BTL A;  2DG8 A;  2EBI A;  3KNW A;  2HI3 A;  4QIW N;  3JRF A;  2ID3 A;  4IHX A;  1JKQ C;  2HDD A;  3AQS A;  4NDL A;  3BJB A;  4L62 A;  4D5F A;  3S14 J;  3ZQI A;  4M6V A;  3BNI A;  1IGN A;  1JKP C;  1IC8 A;  5K58 A;  2DMU A;  2IU5 A;  2WAQ N;  3NAR A;  3GTK J;  1UMQ A;  4V2F A;  5D1R A;  2O7T A;  4M3F A;  3O60 A;  2R93 J;  1ETK A;  4B1R A;  3SDG A;  1TC3 C;  2OF7 A;  3BG9 A;  3S16 J;  4A3L J;  3HGG A;  1GV2 A;  2XDN A;  3TW6 A;  2Y0S N;  3WHB A;  2ME6 A;  5FKO A;  3HOX J;  3B6C A;  1BA5 A;  5E3M A;  2IBD A;  2LD5 A;  5FGL A;  4CYC A;  5EDN A;  2FJ1 A;  1LFU P;  1OCP A;  1TWA J;  2UXP A;  4G12 A;  4JYK A;  2OER A;  4IHV A;  2DMQ A;  3GEU A;  5GP9 A;  3KKC A;  3BHQ A;  2O9L A;  5DAJ A;  3RKQ A;  4JKZ A;  5EEA A;  3G1O A;  1FTT A;  2EZH A;  1MH4 A;  2NVX J;  1FJL A;  2HXO A;  5F27 A;  2DA4 A;  2K9S A;  2XGE A;  1MSF C;  1AKH A;  2MW8 A;  3KZ9 A;  1ZKG A;  4FCY A;  3O8G A;  1ZR4 A;  4S0H B;  1UI6 A;  5H9T A;  2DA5 A;  5HSZ A;  2CRG A;  2MGQ A;  5F08 A;  5C44 J;  1D5Y A;  3VVX A;  2JA6 J;  4XRS A;  1MSE C;  4JX4 A;  3FRQ A;  3PM1 A;  4B3A A;  5FJ8 J;  1VI0 A;  2NS8 A;  3GTL J;  4M3B A;  4CYC B;  1MH3 A;  5K7F A;  3VP5 A;  2Y9Y A;  2PBX A;  2H1K A;  4NN1 A;  2ZCM A;  3S1Q J;  1DU0 A;  1FEX A;  3ANG A;  2LFB A;  5JLW A;  3K2A A;  4MK6 A;  2E2H J;  1Q1V A;  2CQQ A;  3JRI A;  1QVU A;  3Q3S A;  1MBG A;  2DA3 A;  5IOY A;  3LSP A;  1ITY A;  2FQ4 A;  3HEF A;  1ETX A;  1RKW A;  5F0C A;  2LVS A;  2LY9 A;  1ETY A;  4X1E A;  1AKH B;  2V57 A;  3S1M J;  4BXX J;  3ZQC A;  3LJL A;  4A3F J;  5IP9 J;  2L9R A;  3BR5 A;  2CUE A;  1JT0 A;  4JX5 A;  2M9H A;  3MNL A;  2WB1 N;  1GUU A;  2JMW A;  3OOU A;  1ENH A;  1EF4 A;  1LE8 A;  2D5V A;  3JRD A;  1BW6 A;  2LR8 A;  3NI7 A;  4XID A;  2JA5 J;  5K7Z A;  3KKD A;  4D5C A;  3S1R J;  2QCO A;  1H89 C;  1ZK8 A;  1ETO A;  2XB0 X;  3WHC A;  1JGG A;  3FK6 A;  4UDS A;  4GFB A;  1TWF J;  3Q0W A;  4CGR A;  1WCM J;  3BR3 A;  1K61 A;  5F0F A;  3GTP J;  2CQX A;  1TWH J;  1WH5 A;  2DTZ A;  4JX6 A;  3UKG A;  3LOC A;  1K83 J;  2G3B A;  2VPR A;  2JJ7 A;  4A93 J;  3V6G A;  2EZI A;  2E2I J;  1LE8 B;  4AF5 A;  1MBH A;  2N8G A;  2PZ9 A;  1RKT A;  2MSY A;  2GEN A;  2ZCN A;  1UG2 A;  5GPC A;  4QTR A;  3FKI J;  4JP0 A;  1GT0 C;  1H88 C;  4MXM A;  2YS9 A;  4DZP A;  2DMT A;  2O7O A;  3GTO J;  1F36 A;  3A03 A;  1SFO J;  2EZL A;  4L5E A;  4UUS A;  5IPA A;  4X6A J;  3S1N J;  3BRU A;  3HGY A;  3MKL A;  3A02 A;  3FK7 A;  3F1B A;  2NP5 A;  3LSR A;  1JKR C;  2D6Y A;  2DG7 A;  2DJN A;  4GFK A;  4M3G A;  3MN2 A;  2DA7 A;  3GTM J;  4DYQ A;  1ZQ3 P;  2K9N A;  4A3I J;  3ZQL A;  2WV1 A;  4Y52 J;  3GZI A;  3GTJ J;  5C4J J;  3VOK A;  2G7S A;  4BY1 J;  2VUM J;  1ZTR A;  3P9T A;  2XB5 A;  2W48 A;  3ZQF A;  2GLO A;  2ZOY A;  1JKO C;  5EFY A;  4UUS B;  4J19 A;  3BTI A;  1FTZ A;  5F04 A;  2X9D A;  3L1P A;  1ETW A;  5DS9 A;  1MNM C;  2MG4 A;  1TWC J;  3IUV A;  2ZOZ A;  3RQI A;  4A3M J;  3B81 A;  2NVT J;  2K40 A;  3I4M J;  3TP3 A;  3HTJ A;  3AQT A;  5FKN A;  4XIC A;  4BBS J;  3SFI A;  3JRE A;  1WGX A;  1JUP A;  1JUS A;  1U9N A;  2HXI A;  1VND A;  4HNV A;  1UI5 A;  1RES A;  3BT9 A;  2R5Z A;  3S5R A;  1E3O C;  2QTQ A;  2ZB9 A;  1B72 A;  5CXG A;  4XRM A;  1P7J A;  4GCK A;  2ECC A;  4A3B J;  3NXC A;  4ABZ A;  2FBQ A;  3C07 A;  1JTY A;  1LFB A;  2DA2 A;  4A3J J;  4C2M J;  5M5Y J;  2ECB A;  1DU6 A;  2PMZ N;  1VFC A;  2XPW A;  3G1L A;  5J1R A;  2W53 A;  2NX4 A;  3HTH A;  5F1J A;  3QQA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...