3CCYA

Crystal structure of a tetr-family transcriptional regulator from bordetella parapertussis 12822
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
192
structure length
192
Chain Sequence
YENIRDTIIERAAAMFARQGYSETSIGDIARACECSKSRLYHYFDSKEAVLRDMLTTHVDSLLERCRQVLYGSNEPKTRFLQIVKLFLEIYATSRDRHVVMLTCLDALPEDQRKALIAKQRELIAYVRDALLQLRPDMAANRTLAHVDTMLFFGMINWTYTWYKADGSVSPDALAERTVQLFLDGYLNLLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Putative TetR-family transcriptional regulator
publication title The crystal structure of a TetR-family transcriptional regulator from Bordetella parapertussis 12822.
rcsb
source organism Bordetella parapertussis 12822
total genus 65
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17932 TetR_C_24 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3ccyA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3ccyA02
3BG9A 2LR8A 4QIWN 3RZOJ 1X58A 3DEWA 2YS9A 3HOYJ 2QKOA 2XB0X 2EZKA 4ME9A 1VFCA 3GTGJ 4NDLA 2LP0A 1HDDC 3IH3A 4M3DA 2O7TA 3QPSA 4J19A 1U9NA 2YUSA 3RZDJ 4A3CJ 1Q1VA 5IYDJ 3KKCA 4DW6A 3S1MJ 2M2EA 3WHCA 2L0KA 2CQXA 1MBEA 2OPTA 3O8GA 1FTTA 1RKWA 4A3JJ 3WHBA 2IAIA 1AHDP 2NVQJ 3G1MA 3S1RJ 3JREA 3MNLA 4AC6A 3HTHA 2IBDA 2EZLA 1GV5A 2HYTA 4EEFG 1MBJA 3BJBA 3OSGA 4AC0A 3HOWJ 4HKUA 4HNVA 3JRBA 3VIBA 1K83J 2YU9J 1ZR2A 3HTJA 1WPKA 3G1OA 1GUUA 1YRNA 2R0QC 1BL0A 2D6YA 1ITYA 1U9OA 2DJNA 1TWGJ 1TWCJ 4UUSA 1MSEC 2REKA 4DZPA 1ETVA 2NVYJ 3BR0A 1IRZA 3SJMA 2L7ZA 1PUFB 2E19A 3JSJA 3MN2A 5FKMA 2V57A 5EFYA 4V2FA 3F0CA 4DYCA 4CYCA 2VKEA 3BG5A 2K9QA 1F36A 3BQZA 5DTDA 3LHQA 2ME6A 3A01A 2OERA 2R7ZJ 4CGRA 1WH7A 1X2NA 3KKDA 4BXXJ 2K9SA 4JYKA 5JLWA 3RD3A 2YVEA 1LE8B 5EF6A 4A69C 5IOZA 4IHWA 3HOZJ 4A3DJ 3SDGA 2G3BA 2NOGA 2QTQA 1FTZA 1RESA 2M0CA 2Y2ZA 4B4CA 3CJDA 4XRMA 1ZTRA 3HKZN 4GCTA 2JA5J 2HDDA 4GFBA 1WH5A 5EZHA 5M5XJ 1MH4A 3BR2A 2W53A 3K2AA 3VW2A 1FIAA 1R9TJ 4M3GA 3ON4A 3H3VK 3BRUA 1JKQC 3S1QJ 3O8HA 2O7OA 4X6AJ 3B81A 5K58A 1JKOC 5CW8A 3JRGA 2XGDA 2DA6A 3W6VA 3COLA 3EGQA 1APLC 2QF7A 3VVZA 3CMYA 2M34A 1O4XA 3FK6A 2PBXA 5JLXA 3QPLA 1E3OC 3S16J 1Z77A 1W0TA 4IHVA 5D1RA 2WUIA 1NK3P 1PUFA 5F0FA 1HLVA 5HODA 1SANA 3JRIA 3LSPA 3GZIA 4IHXA 3GTMJ 3TP0A 5F04A 4BKXA 2GFNA 2MSYA 1ZK8A 2DTZA 5IYCJ 3GTJJ 1ETXA 1WCMJ 3LSJA 5H9TA 2DMQA 3F1BA 2WGBA 5FKLA 2UXUA 2W48A 1LE8A 4D7NA 3RQIA 1WGXA 5M5WJ 3BHQA 5C4YA 1QVTA 1P7JA 3SFIA 1X2MA 2K9NA 2RASA 4Y7NJ 5M5YJ 3LNQA 3K7AJ 3MVPA 5CXIA 1U78A 5FHPA 2N8GA 5F1JA 3Q0UA 4L5EA 2EQRA 2B63J 4X1EA 4FCYA 3BT9A 2O8KA 5K7HA 5J3LA 1NTCA 2R92J 1IGNA 1POGA 5BNGA 3HM5A 2MGQA 3HGGA 3S14J 2G7LA 5F0CA 3NI7A 2HQ5A 5FMPA 2CJJA 2NP5A 3GBGA 4L62A 3DPJA 2WB1N 4BBSJ 1SGMA 1MBKA 4A3MJ 2DN0A 1ZR4A 4A3FJ 1UMQA 4A3IJ 4RBOA 2ZCMA 2NVXJ 1H88C 2TCTA 2XB5A 3HTAA 1S7EA 2GM4A 2H8RA 3TEDA 5GPAA 1GDTA 4NELA 2GENA 3S15J 1I3QJ 2MW8A 1UHSA 3FRQA 1H89C 4JP0A 2ZCXA 5GPCA 5J1YA 1DU0A 1GVDA 1JGGA 3UKGA 2JK3A 3HTIA 3HBLA 2ID3A 4DYQA 5HSZA 3G56A 4D5FA 4KWAA 5F27A 3ON2A 5IYBJ 3HOVJ 2X48A 1IV6A 3BNIA 1AU7A 1MBGA 2JJ7A 3S17J 2CU7A 2ECCA 5C44J 4XIDA 1ETQA 4I76A 5HAWA 2XGCA 1LFUP 4FTHA 5E3MA 2JA6J 3B6CA 3GTLJ 2G7GA 3PASA 9ANTA 3LSRA 1BW5A 4QSHA 5F08A 1TWFJ 4A3BJ 5C4JJ 3QQAA 3S2HJ 4JX5A 2D5VA 3BG3A 4A3KJ 5IP6A 2R93J 3LWJA 1CQTA 1GT0C 5EG0B 2I10A 2ME0A 2OI8A 3VOKA 5F0HA 3KZ9A 3NPIA 3Q0VA 1UI6A 2XPUA 3HEFA 3BCGA 1ORKA 5E3OA 4GCLA 3ANGA 2LLKA 4GCKA 2LVSA 1XC5A 3I4NJ 2M8GX 4MK6A 5C4XJ 4BY7J 2HOTA 2NVTJ 1HDPA 5EZGA 2KT0A 5M3FJ 4JKZA 1QRYA 1FEXA 2DA4A 2EZIA 2NP3A 3JRHA 2DA3A 3HOXJ 5FKNA 1UG2A 2VKVA 3VP5A 3PO2J 1VNDA 2NS8A 2LFBA 3NXCA 5GP9A 1TC3C 1OCTC 5EDNA 2ZOYA 2O9LA 4RDUA 2M9HA 1A6IA 1XG1A 2ELKA 1AKHB 1F43A 3JRAA 5IPAA 5HBUA 3CWRA 3D1NI 3V78A 1MBHA 3RH2A 2R5ZB 1B8IB 3QBMA 2JWTA 2ZB9A 3GTOJ 4AF5A 5FGLA 4BY1J 1VF9A 2K40A 1IDYA 3S5RA 2CUEA 2LY9A 1RPWA 1JKPC 2F07A 3NRGA 1TWAJ 3VVXA 5EYRA 1BJZA 4FE4A 4XRSG 1BA5A 3ZOBA 5K7ZA 1Y1VJ 4C3IJ 4XICA 5J1UA 2FX0A 3MKLA 2NX4A 4UDSA 2UXHA 4B3AA 3ZQHA 3E7QA 5EG0A 3QKXA 4JNNA 1VI0A 2TRTA 4C3HJ 2H1KA 3JRFA 1IDZA 1RR7A 4M3EA 3GEUA 1ZQ3P 1IUFA 5E3LA 4QTRA 3JR9A 2FBQA 1GV2A 3DCFA 4ICHA 2VUMJ 1ZGWA 1NK2P 1JUMA 3E7LA 1JT0A 2L9RA 5K7FA 1QVUA 3HOUJ 1K61A 1JKRC 1HOMA 3VW0A 5FKOA 1JUSA 1MBFA 3LOCA 2XPVA 1FJLA 3HIMA 3FKIJ 3OIOA 3HDDA 4NN1A 3Q3SA 5D18A 1AKHA 2R5YB 2CUFA 2E2HJ 2XGEA 3ANPA 4FISA 2HXIA 3HB9A 2DA5A 2AO9A 2P81A 1DU6A 3NNRA 4XK4A 2CQQA 3BR5A 2R5ZA 2DMUA 5DS9A 4ABZA 2DMNA 3BTIA 3CCYA 3ZQGA 1B8IA 3IV5A 2Y9YA 1T33A 3PM1A 4GFLA 1BW6A 2L7MP 3IH4A 3O60A 2OF7A 2PZ9A 2Y9ZA 5CXGA 4LOCA 4M6VA 4IEJA 3EUPA 3BR1A 4C3JJ 5EGOB 3A02A 2RHAA 2GBYA 2HXOA 2XRLA 3GTKJ 3NAUA 3VUQA 2EZHA 3C2BA 1OFCX 3TP3A 2QOPA 3CQZJ 3IUVA 2HYJA 3I4MJ 5AQCA 3PPBA 3CDLA 4JL3A 5J1RA 2DA1A 2Y30A 4W97A 3LJLA 1P7IA 2Y31A 1OCPA 1U8BA 3OSFA 4A93J 3GTQJ 5C3EJ 2QCOA 1UI5A 3HE0A 1WI3A 2DG8A 4ACIA 1I50J 2ID6A 2XSDC 3RKQA 1JT6A 2ZOZA 4M3BA 2UXOA 2DMPA 1JTYA 5FJ8J 3BTJA 4D7MA 2XPWA 3A03A 4D5CA 2QWTA 2HOSA 4YZEA 4JX6A 2YVHA 4MFEA 2R5YA 3VW1A 1ZKGA 3B6AA 1A5JA 5D19A 1Y1WJ 3V6GA 4JX4A 2G0EA 1RETA 1MSFC 3FISA 3L1PA 4C2MJ 2FJ1A 3OOUA 1MNMC 2LKXA 1ETWA 3VPRA 3IH2A 3ZQFA 4FE7A 1XS9A 3PO3J 3GTPJ 3M3YJ 3Q0WA 5EGOA 2ZCNA 2VI6A 2UXPA 1JUPA 2FD5A 4V2GA 2JA8J 5FLVA 4XRSA 4A3LJ 5IP7J 3NARA 4G12A 2E2JJ 1FIPA 1JJ8C 1TWHJ 2HOAA 1SFOJ 5FKKA 1HCRA 4Y52J 4IHYA 1G2HA 2JA7J 3VVYA 3H0GJ 3T6NA 1B72B 3AQTA 3BR6A 3TW7A 2GUHA 4I6ZA 2DG7A 2EH3A 2HI3A 2Q24A 2HKUA 2Y0SN 1JJ6C 1T56A 3KNWA 2X6OA 4MLOA 2DMTA 4B1RA 5IP9J 1EF4A 2COBA 1Z0XA 4W1UA 5DAJA 1ETYA 2XDNA 2DA7A 4UUTA 2DA2A 2L7FP 2WV1A 1LFBA 5E3NA 3JRCA 3VOXA 3TW6A 3LSGA 4DZJA 1ENHA 2JN6A 1RKTA 3ZQCA 4M3FA 3ZQIA 3S1NJ 3ZQLA 2VPRA 3JRDA 3BR3A 2GLOA 2LTPA 3M4OJ 4MIMA 1ETKA 1MH3A 2AHQA 4MO7A 2QIBA 3BTCA 1I6HJ 2WAQN 1IG7A 2X9DA 2RAEA 4AUXA 4DYRA 3C07A 3FIWA 2JMWA 2LD5A 2E2IJ 2IU5A 3CRJA 1ETOA 3S2DJ 4A3GJ 2LK2A 4PXIA 4A3EJ 4GFKA 1YRNB 3P9TA 5FLMJ 1QPIA 3BTLA 1HF0A 3G7RA 1H8AC 4UUSB 4MFDA 1B72A 5IOYA 2G7SA 2NS7A 3FK7A 2IEKA 2EBIA 2FQ4A 4S0HB 1OJLA 2UXIA 3HGYA 4CYCB 2MG4A 4BBRJ 2E1OA 2CRGA 2ECBA 1IC8A 1JTXA 1D5YA 3AQSA 4MXMA 2KDZA 5M3MJ 5EEAA 1W0UA 1IJWC 3A01B 2PMZN 3G1LA 4AYBN 3BQYA
chains in the Genus database with same CATH superfamily
4PJLA 4ZDOA 2YS9A 4FX4A 5B1BH 2QQBA 2JSPA 2EZKA 2F6CA 4ME9A 3GTGJ 2LP0A 2PX9A 3MZ8A 3IH3A 1HDDC 3QPSA 3R0AA 3VDXA 3PL8A 4CCLA 3G71I 3TOAA 5LHGA 2EIJH 4OIQF 1Z91A 3O8GA 2L2OA 3LWFA 2NVQJ 2CG4A 4CYDA 3CP8A 4UB6C 2QQ9A 4AC6A 2EZLA 3ELKA 2KIUA 1GV5A 4ZTJA 3KE2A 1U5TC 3LQRA 1N78A 1MBJA 4Y33A 3BJBA 3P9IA 2FBKA 3OSGA 2CWEA 3EQLF 4HKUA 2F4MB 2X1CA 4GRIA 3JRBA 5BPDA 4GO1A 5E1XA 2MABA 2AQFA 1XCBA 2JRTA 2BW3B 2R0QC 1ITYA 2DJNA 1MSEC 3CLQA 4UUSA 4DZPA 3BR0A 1B9MA 4IX7A 4LG0B 1BBYA 3EUHC 1PUFB 4A6DA 2PJRA 3JSJA 3BCBA 2BXZA 5L3DA 1ZG3A 2V57A 5EFYA 3F0CA 1LB2A 2VKEA 3SEZA 3DF8A 3Q9VA 3LL7A 2ME6A 2W1OA 1S3JA 3A01A 2OERA 1ZLKA 3KP3A 2OJED 3MAJA 2BV6A 1HW5A 3ECHA 2EV0A 4IHWA 2ISYA 4A3DJ 3HHGA 1HKTA 1IN7A 2UXXA 4LK0F 3ZMSA 1SMYF 5GAGJ 3WTSC 1Z3XA 1PJRA 3CJDA 1HKQA 2WAFA 3DKYA 3AFHA 3HYIA 3FXLA 1WH5A 1R1UA 1VQ4I 4OAZA 3L2QA 5LGUA 3Q5FA 3LFUA 2QKMB 3DKXA 3E1SA 2PLYA 5K58A 1JKOC 4KT6A 3W6VA 2K02A 2GAUA 5CVJA 5BMZA 1KQ9A 1TLHB 2MC4A 5JLXA 1E3OC 3S16J 1Z77A 4EJWA 2RREA 4BQAA 2R7XA 2WUIA 4OD4A 4IJAA 2LMDA 5D5XB 4ZYAA 1FWZA 3ABMH 3FMSA 3GTMJ 5E8IA 1ZK8A 1LVAA 2W57A 2DTZA 2VIXA 2MD5A 4HX7A 5IYCJ 3BPXA 4AIJA 3ABLH 3CMMA 3LSJA 4B8XA 3HRSA 3F1BA 4XNFA 3S3OA 3VYTB 3F6VA 3OR1C 3VSKA 3J7AO 1P7JA 2L5QA 3BJ6A 4Y7NJ 2UXNA 2RASA 1XSDA 4P96A 3MVPA 5CXIA 1U78A 5AIQA 5IT3A 4HQEA 1TQPA 3S3NA 3BT9A 4BJ6C 4C30A 1NTCA 3FXQA 4YIRX 2R92J 2UWMA 5BNGA 1JXSA 1YIJI 5FMPA 2FOKA 2NP5A 1W5TA 2DYRH 1WKMA 2GXAA 4L18B 1MBKA 1BJAA 2KQRA 1SVOA 2KDOA 2VBYA 1HSTA 5J40A 2KRCA 2ZY9A 2ZCMA 2BE5F 1H88C 2XB5A 1WVRA 3W2WA 2BY0A 1XMXA 3MKZA 1H9TA 1FYLA 2J5OA 4NELA 2F5DA 2EILH 1UHSA 5DEQA 1OR7C 1H89C 4JP0A 4G7OF 5GPCA 2Z3YA 1DU0A 1M1EB 3C1DA 3UKGA 2JK3A 5TISC 4IO9F 3RPUD 2DBBA 4D5FA 3RTRA 3IAS2 3ON2A 2F5VA 3HOVJ 1O3RA 2VXZA 3QYEA 3ZMZA 2X1EA 3CD6I 4XORA 3S17J 1WJAA 2CU7A 2O6GE 1KU7A 3LFKA 1ULYA 1R1VA 1LFUP 4XLHA 2H1LA 4BGDA 4RB2C 1OYYA 5CVIA 1IV8A 1BW5A 5JHUA 3SWHA 1BR4A 4A5MA 2P5VA 2V7FA 3W3CA 5FROA 1TWFJ 2QSFX 1E17A 2Z9OA 1YYVA 1RIOH 2D5VA 4XMYA 5EEHA 4RGRA 2WY7Q 5IP6A 4RB1A 4D9JA 4Y15A 5KK1A 5FFXA 3ZRGA 4HV6A 4OIRF 5F0HA 3S32A 3FZVA 2Z99A 4KNYA 1D0ZA 2QUFA 1UI6A 4N9HA 3BCGA 1E2XA 2ETHA 2LLKA 1MGTA 5J6XA 3M8JA 4MK6A 5C4XJ 1OQYA 4BY7J 3GFMA 1T38A 1IRFA 1MDMB 4MTDA 3L09A 3E5UA 2IW5A 5FKNA 1ERDA 3VP5A 1W7PA 4RAZA 3PO2J 2NS8A 2LFBA 3I53A 4IRHA 5GP9A 4KUMA 1TC3C 1IRXA 1T6SA 5ED4A 2EV5A 4KN7X 5BS6A 3VYUB 2XASA 4KISA 2ZOYA 3MFKA 1EH6A 2O9LA 4HPQA 2LNBA 1AKHB 5TGTA 5D5WB 5HBUA 1YX3A 3A2KA 2ZMEA 5IY5H 1R5HA 2JPBA 1I1SA 3RH2A 4Y4RA 2R5ZB 3KZYA 4HBLA 3C3WA 1P2FA 3IAM2 2K40A 3CUQC 3WTZA 2LY9A 1JKPC 2R7SA 2F07A 1TWAJ 3NRGA 2JSCA 2AQEA 2EA4A 4FE4A 4XRSG 3LSTA 3ZOBA 3K9TA 4RAFA 4BXUA 1Y1VJ 1U3EM 4I0BA 4C3IJ 2QENA 5J1UA 4AIDA 2NX4A 1BOAA 4UDSA 5KCMA 3L00A 4B3AA 5GADJ 5EG0A 3F3XA 2TRTA 1FOKA 3GEUA 4I02A 1N75A 1ZQ3P 3SDBA 3M7GA 3CJNA 4QTRA 3JR9A 3NEUA 3RKXA 3OIPA 4LK1F 2LF7A 1QQIA 3HG9A 4F93B 4FX0A 3TL4X 2BY3A 4BHPA 1TQMA 3PQKA 2E7WA 4N4OB 3HOUJ 4BDZA 2ELJA 2Q0OA 5FKOA 1JUSA 1KU9A 2OCEA 1IN8A 5D18A 2JVHA 2XGEA 2PMHA 4BJ5C 1VQLI 3HB9A 1YJ9I 2F4IA 2KJCA 3KIOA 1R49A 2CQQA 2P4WA 5ILSA 1LKXA 3JAMZ 5LBQA 4ABZA 3BTIA 3HTUA 3CCYA 3O2PE 4NQWB 5DS9A 3IV5A 1F4KA 2Y69H 3PM1A 2L7MP 3O60A 5L3FA 2ZSIB 2OF7A 4HA8A 1RNLA 2Y9ZA 4M6VA 3DLAA 4GCVA 3OYJA 3EUPA 4CXFA 3MWMA 3BR1A 4CGZA 3A02A 1OKRA 2F5FA 2FUG2 1CF7A 2KRFA 3OYAA 2GBYA 1XCVA 3H35A 3PNYA 3VUQA 2L4AA 3TP3A 3ZR8X 4FQGA 2MBFA 3K6GA 4NC8A 4WF2A 5AQCA 3PPBA 5J1RA 3EDPA 2HZDA 2DA1A 1QZEA 3JCUC 2Y30A 5HLHA 4IHTA 3H36A 5K5OA 4IRIA 3CDHA 2ZJ2A 4L5JA 5C3EJ 3FHNA 4IOAF 4AIHA 2V1XA 2DG8A 4ACIA 4XLCA 2W25A 2XAFA 4M3BA 3RCOA 3G6EI 3O6BB 4RGSA 4D7MA 3HSRA 3SEQA 4CO8A 2HOSA 4NBQA 2X85A 2CUJA 2EJRA 1R5GA 2P6SA 4MFEA 2R5YA 2DFFA 3VW1A 1ZKGA 1BI3A 3KP7A 4UHTA 1Y1WJ 2V9PA 2G0EA 1D0YA 4L0YB 2OAZA 3FISA 3L1PA 3PFYA 3CCMI 4HNUA 2DPUA 2FJ1A 4Q47A 2E36A 4HDUA 2KHMA 1S8NA 3VPRA 4UVBA 1H0MA 1G3TA 1IUYA 3VWBA 4AWXB 2R4GA 2QLZA 2IXSA 4MQ9F 1QBJA 3KP2A 4G6QA 2UXPA 1UG0A 4H4KC 2JA8J 4V2GA 1IN6A 2P7VB 1TL8A 5FLVA 4PGGA 1S29A 3NARA 3B02A 4FHTA 2MYSA 5JFRA 3CJTB 1FIPA 1JJ8C 4Y52J 3WG7H 1G2HA 2BVMA 3MEXA 3T6NA 4MHGA 2DG7A 4PSXA 2HI3A 4ENMA 3N97A 4V19K 2Y0SN 5A2QZ 2JT1A 3ULQB 3JSOA 2IS1A 3RKYA 4B1RA 4DNCA 2KZGA 1ZG1A 3L2WA 1ETYA 4HLYA 3X2QH 1HW1A 5L3CA 4XQFA 2IS2A 3DU6A 2PG4A 5E3NA 2Y0MA 4LB6B 2VJJA 1UFMA 1OLTA 3CCLI 5ICEA 3BWGA 3I56I 3DBLB 2DU9A 4LLLA 3NS4A 3MMYB 2K3PA 3BJOA 2CQNA 2RDPA 5BOXA 3KP5A 4HLXA 3GFJA 2KPMA 2GLOA 3D0SA 1AOYA 3KX2A 1SFKA 3WTUC 2AHQA 4MO7A 5H6QA 1I6HJ 4XOPA 1IG7A 1LEAA 4LIUA 1JHFA 1B9NA 2XAQA 5HLGA 3GUDA 3TGNA 2VBXA 3CRJA 3OL4A 1I1GA 4F92B 5DD4A 4M73A 3LMMA 4PXIA 2P6TA 2P0WA 5FLMJ 2R3SA 3FX3A 4J01A 3DTIA 4PJJA 2NRAC 1VQ5I 4MFDA 3BZ6A 2BXYA 3K4KA 2G7SA 3WTWC 3FK7A 2VT2A 2EBIA 5H20A 2BYVE 5HOOA 2QEXI 4S0HB 4XONA 4F7ZA 2E1OA 1WJDA 5FB2A 1JTXA 5EEAA 1IJWC 2VQHA 2NVUB 5FO5A 3BG9A 2LR8A 2W82A 1T0FA 3DEWA 3DEUA 4CH7A 3HOYJ 1FMWA 1LFPA 2VXDA 2QKOA 4HZFA 2DW4A 4OMZA 3LA2A 4GXOA 1G3YA 2MA3A 4NDLA 5F6FA 4A3CJ 2YUSA 2MLGA 1ZHFA 1J75A 1T08B 2WTEA 3FXRA 2M2EA 3F23A 3WHCA 3IWZA 3OS2A 2L0KA 3KCCA 2CQXA 5CVUA 4A0ZA 2OPTA 1FTTA 3KETA 4IL6C 3WTTC 1AHDP 2R7OA 3G1MA 2Y48A 2JTVA 2JUGA 3JREA 1P92A 4E7SA 3MNLA 2IBDA 2IGKA 5LEKA 1T2KA 4AC0A 3MZHA 1ON1A 3UNGC 1K83J 3HTJA 2EV6A 2ZNZA 4CSWA 5FD5A 1GUUA 1YRNA 1BL0A 4HSRA 1TWGJ 1TWCJ 3H9JA 2OBPA 1IRZA 3SJMA 5LHIA 4Y3OA 3DXJF 2GWRA 3ZMVA 3WGIA 3CESA 4CYCA 2XAGA 2HNHA 2K9QA 1F36A 1Y6IA 5DTDA 1ZREA 2DT6A 2VE9A 3LHQA 2R7ZJ 4CGRA 1WH7A 1WSUA 1W7PD 1QNTA 4NNJA 5HDGA 4BXXJ 1BM9A 5H2FC 4JYKA 2QQAA 3RD3A 2YVEA 2IGNA 1O7FA 1Z7LA 1LE8B 2DOAA 4L0ZB 4BH9A 3TO6A 2W7NA 3SDGA 2M8EA 2G3BA 4OIOF 3GLLA 1DP3A 4A0YA 2A69F 4A12A 3ERMA 2OV7A 2XV4S 4B4CA 1D8KA 3HUGA 4RB0A 4UNOA 2E5ZA 2JA5J 2PI0A 4GFBA 2OTJI 1MH4A 5JHFA 2D2WA 3BZCA 1R9TJ 4M3GA 1JKQC 1SFEA 2EPFA 2F48A 3F21A 3B81A 4P9UA 5CW8A 5BQTA 2CSOA 2DA6A 4LLGF 2W24A 2RKHA 2VOPA 4BHCA 4IRGA 1ZARA 1YQAA 2Q2EB 2QYOA 3TDUC 2ZFUA 1SANA 5LEJA 2GQQA 3JRIA 3GZIA 4IHXA 1BI1A 3DTKA 3I54A 3I0TA 5F04A 2E7XA 3OYGA 2V1UA 1R4MB 4ANJA 1YG2A 2O8XA 1ETXA 2KKOA 1WWXA 1DGWY 1LVKA 2FSWA 4CCJA 5FKLA 2UXUA 4D7NA 5J8FA 1FSEA 3FBNB 5M5WJ 3K4JA 3BHQA 5C4YA 1BR2A 4U9LA 4R8HA 3LNQA 2QA4I 5FHPA 2N8GA 4LG3A 3I59B 1MIJA 2EFQA 1KA8A 1KGSA 4F3QA 4BHBA 5J3LA 4YFNF 3KEYA 3OIQA 2Z1DA 3HM5A 1YJWI 1HA8A 2MGQA 5J47A 3HGGA 3S14J 1G3SA 5F0CA 2G7LA 2HQ5A 3RKWA 2Z16A 4BBSJ 3ZMUA 1SGMA 3HJEA 1BIBA 3OR2C 3HPGA 3QWLA 2IGMA 2JUCA 2DJIA 1UMQA 5JVGF 3QP5A 1MJAA 4RBOA 1EH7A 4BEHB 3DP7A 1S7EA 2GM4A 3OL3A 2RQQA 4CZCA 3BROA 2JVGA 2QZ8A 1GDTA 1Q1HA 4N0BA 2GENA 3S15J 4P1WA 1I3QJ 2MW8A 3CCVI 1A36A 4XLPF 5IT9K 4E7KA 1XD7A 1Y0NA 2OD5A 4S04A 3I64A 5F64A 3RJPA 3DQVC 4RA2A 3KZZA 2CW0F 5IYBJ 2X48A 5FRMA 2DFIA 3BNIA 4ZYEA 1MBGA 3ASNH 1Z7UA 5K5QA 2OQGA 1YS7A 3SFZA 4G9YA 2EFWA 1T98A 3GCMA 2CV1A 1DPRA 3MKWB 1RZ4A 2FJI1 2E71A 5E3MA 3B6CA 3L7WA 3NRVA 2G7GA 2HKOA 4CHUA 3CO7C 1JI8A 4ZYHA 3HTSB 4LFUA 3K70D 4HG2A 2F5EA 2IPQX 3D5RC 2I8DA 3PJRA 4A3KJ 3L2VA 2ZFWA 1GT0C 2I10A 3VOKA 3E6DA 3KFWX 3RIRA 5ERIA 3ZMDA 2NS0A 4EV0A 1BIAA 3Q0VA 3IRQA 5E3OA 1FT9A 2PN6A 3ANGA 4GCKA 2VL8A 3GFIA 1YJNI 1FBUA 4KJZA 4PFPA 3I4NJ 2O61A 2HOTA 2FOWA 2G7UA 5DUIA 1WQ2A 5EZGA 1Z9CA 2P8TA 3H0DA 1Z1DA 2DA4A 4M71A 2NP3A 2PMUA 5CLSA 2VKVA 4HQMA 4RM2A 1UJ8A 1R1TA 3CO6C 1DDNA 1OCTC 3R60A 5EDNA 3FKJA 1XDSA 1K78B 2HPMA 4MNUA 5L3EA 4PK4A 1MW7A 2K27A 4G6TB 3JRAA 4PFOA 3J7YJ 3BJAA 3KYDB 2MLKA 3QBMA 2JWTA 2ZB9A 3OS0A 3FXKA 3E97A 4EMSA 4AF5A 4BY1J 1XGSA 3IKVA 1IDYA 4RAGA 1DPUA 2R7TA 3QPHA 5EYRA 1BA5A 1U0JA 3WTYC 4FETA 4XICA 3EPZA 1J2XA 4I99C 4M9SA 2CUZA 1YITI 3OYFA 1R00A 5K5RA 2KZVA 3KP4A 3TDZC 2PBIA 3ZQHA 4GYGA 3QKXA 4C3HJ 2GOXB 3TBIA 1IDZA 1A6QA 1XGOA 4KT5C 2CS3A 4FT8A 1U5TA 2ICWG 2FBQA 2FBIA 1L0OC 2O0YA 2QKLB 2GZWA 3F6OA 3JSPA 4A0XA 2JQ7A 2HVRA 3GZNB 1NK2P 4E7ZA 1B4AA 1LNWA 1XPXA 4HF1A 2L9RA 1VQ6I 2A5YB 2NXNB 4UV9A 4DGWB 5HVQC 2CO5A 3EUHA 2WV0A 2VASA 1JKRC 3SZGA 3B73A 3BC8A 1KONA 2Z2SB 2H09A 2R7DA 4IRVA 3LOCA 2HR3A 3HZJA 2BY2A 3OMYA 3FKIJ 3Q3SA 3RSNA 3SHFA 2CUFA 2DI3A 2E1CA 1FP1D 4FISA 5JI6A 2DA5A 1DU6A 2DCEA 3BR5A 5GAEJ 4N9IA 1B8IA 3RDIA 1W1WE 5LGTA 1ZELA 4I01A 4NC6A 2HOEA 1BW6A 1DGRM 2CQ7A 3IH4A 3HRMA 4KIGA 1P9QC 3AKZA 3COAC 3PQJA 3VOEA 2CH0A 1S7OA 4FASD 2HXOA 2XRLA 3OYHA 1Y56A 4MEYF 2OTLI 1GXQA 2QWWA 1X1AA 3C2BA 4U0VA 1IO2A 1MMSA 3CDLA 2Z33A 1LJ9A 3GF2A 4W97A 1J59A 3LJLA 1P7IA 2NNNA 1R23A 1WJBA 1U8BA 2YPRA 4A93J 2WA0A 3GTQJ 3HSEA 4EQQA 2A2FX 3R0JA 1MNEA 4MGRA 5LRRA 5DM6F 4RAYA 2ID6A 5BPIA 2XSDC 3RKQA 2VJIA 2XIGA 4ZZLA 4ON0A 5CPRB 3PFIA 4OMYA 1Z6RA 3Q9SA 1V5GA 2M30A 3BTJA 1U2WA 2XPWA 3A03A 5KAFC 4YZEA 4JX6A 3SZPA 4EGYA 1FOWA 3V6GA 2IT0A 2K9LA 1MSFC 3CP2A 4M6XA 2KP6A 2ZNYA 4WXCA 3NWTA 1F9NA 5LLQA 1MNMC 2LKXA 1ETWA 2PJPA 3FF5A 2V79A 1VZ0A 2QVOA 4ZDLA 4EJVA 4FE7A 3PO3J 1D1AA 3GTPJ 4UV8A 5F1RA 4HEA2 4BQNA 3M3YJ 3Q0WA 5EEGA 3EUKL 1S5LC 5EGOA 1S9HA 2VI6A 4Y17A 1W36C 4A3LJ 1SEUA 2FF4A 2DT5A 1ZLJA 3F8BA 2E2JJ 2L01A 2HOAA 2HYFA 1SFOJ 1HCRA 2OA4A 4IPAA 1A35A 1PVEA 3R4KA 5HLTA 3BCAA 1T8IA 4LB5A 3I71A 2TDXA 2CGPA 3AQTA 3OY9A 2IVMA 3BR6A 2EH3A 2HKUA 2OCCH 1T56A 2HPIA 1ONVA 2UUZA 2ZXHA 3BDDA 3N05A 1RI7A 1BC7C 1EF4A 4XM3A 1MNDA 3DLLF 1X4OA 1QHGA 1YW9A 2CFOA 4S05A 3CLOA 1FOYA 1B6AA 4U7BA 3JRCA 3OV8A 2XC7A 1GHCA 1FZPB 5DM7F 3E5XA 1YTYA 2J5PA 3RYPA 1G6NA 1MZBA 4UY8I 2E1NA 2A6EF 1UELB 3QRFF 2V1NA 2X6XA 4DOZA 4XLEA 2QQ8A 1A31A 1ACIA 2P5LC 5DCMB 2LH9A 3LSKA 2RAEA 2DDAA 4CZZA 1PP8F 4LMYA 3CJRB 2F4OB 2JMWA 2LD5A 2IU5A 3WODF 1H9GA 3GZ5A 2AS5F 1ETOA 1K4SA 1F5TA 1R22A 2LK2A 1LQ1A 4EJOA 2DAOA 1XB4A 3NWSA 3K70C 5CYVA 4A3EJ 1PUEE 2V6CA 2VODA 2E34A 2XKOA 3E5QA 3GLXA 2XAUA 4UUSB 1B72A 1XMKA 2A05A 2LY2A 3WE2A 5E1WA 2FQ4A 3HGYA 1TT0A 2MG4A 3G2BA 3GW2A 4U0YA 2ECBA 1D5YA 4MXMA 2KDZA 1I39A 1W0UA 4WIBA 2A61A 2BHYA 3A01B 2PMZN 4AYBN 3J80Z 3BQYA 4YIIA 4ENNA 3GWZA 3TMOA 4YELA 2QBYA 1FSHA 2XB0X 1MMGA 1HXDA 1XMAA 4J19A 3RZDJ 1I3AA 5IYDJ 1YFHA 4DW6A 3SQNA 2M4KA 4LIVA 5AIPA 2DOEA 4PJNA 1OISA 1MBEA 1SAXA 4XBFA 4A3JJ 3WHBA 3G3ZA 5B66C 4A5NA 4UXNA 3DPUA 3A0HC 3M9AA 1ODDA 4EVIA 5TRDA 4C2TA 1BOBA 4NUBA 2VBZA 4UB8C 3CMAI 1D3YA 3HOWJ 4HNVA 3CUQA 3OYCA 5L3GA 2DPDA 3IKTA 3F72A 1ZR2A 2DTRA 3H5NA 3G1OA 4XSZF 1FBQA 1U9OA 2REKA 4CICA 2STWA 3W6KB 4OU0A 2NVYJ 3C7JA 2E19A 2ISZA 2CQKA 2BY1A 5E8GA 4V2FA 3BZKA 1IXSB 4DYCA 3BG5A 3BQZA 2LBFA 2M7BA 2RGVA 2LRDA 3KYLA 2HEOA 4WWCA 4WXHA 1EV7A 1X2NA 4A6EA 5JLWA 1OCZH 2K3FA 2OUMA 3T5XA 1I5ZA 5EF6A 5HNFA 2CMPA 3HOZJ 4BEHA 2EB7A 1FTZA 3ZP5A 2DQLA 3GO5A 1X1PA 2M0CA 2Z5UA 1WJEA 1RR8C 3ZXSA 4WCGA 1T0FC 4XRMA 1ZTRA 1VQ8I 4GCTA 2HDDA 1UHMA 3KZIC 5M5XJ 4EM0B 2IS6A 3K2AA 4KITB 2P5KA 3LSHA 2ZJRF 3ON4A 3H3VK 2DDBA 3WG9A 3O8HA 4HNTA 5D5VB 3CCSI 1SC7A 1X19A 3ABKH 3C2GA 1X3UA 4M9ZA 2XGDA 2VT3A 3CCEI 3DKWA 1APLC 2BEOA 3CMYA 2VOOA 2M34A 2PBXA 1Z67A 2BW3A 2O03A 4P9FA 2HQRA 3QPLA 1U6GA 4NHJA 4G6DA 1V55H 1W0TA 4IHVA 2KIFA 4LG0A 1VQOI 1NK3P 2M1BA 1PUFA 5HODA 2OZUA 3PUFA 4ZDPA 1SD5A 3LSPA 3CMEI 3TP0A 4AD9A 4UUVA 4BKXA 1Y8RB 3OYNA 1YOVB 2MSYA 3KYCB 2H6CA 3SYTA 4JK1X 3GTJJ 2H94A 1WCMJ 5H9TA 2XF6A 3H3ZA 2FQ3A 4B3XA 1OYIA 3RQIA 4Q48A 2KFDA 2PEXA 1YW8A 3CC2I 2K9NA 4G7ZF 4F55A 5M5YJ 1G3WA 5EJCA 1REPC 3M1EA 5F1JA 2D45A 4L5EA 2EQRA 4X1EA 3M8FA 4FCYA 2FNPA 2O8KA 2XVCA 2DQRA 1POGA 3PIPF 3NI7A 1WHUA 1A04A 2VBWA 2BZTA 1YI2I 3WU0A 3GBGA 1WJFA 4WXDA 2WB1N 1K78A 3DPJA 2K7LA 2KMUA 3EYYA 4E7IA 3AG1H 4A3MJ 5CVVA 4E7LA 4M9XA 3KPHA 4A3IJ 2OQRA 3W2VA 3V4GA 1FYMA 2R7VA 4PZJA 2IA0A 1KYWA 5LHHA 3RI4A 3HTAA 2K4BA 2H8RA 3S8PA 4DBRA 4CCMA 3K8PC 2EFOA 3QP6A 3D5LA 3FRQA 1QA6A 1UB9A 3BPVA 3L9FA 3WTXC 5HLIA 2ZCXA 5HNHA 5J1YA 1N77A 1GVDA 2JRMA 1W7PB 1FLIA 3HBLA 3LQQA 4C2UA 2ID3A 3NQOA 4DYQA 5HSZA 1OYWA 4KWAA 4O5VA 4F91B 5A2QK 3KEQA 3E6BA 4ZZDA 1O57A 2V26A 1AU7A 2BGCA 2JJ7A 2MH2A 2RV8A 2XGXA 3AL0B 2OC6A 4ESJA 2ECCA 4M74A 5C44J 4XIDA 3TO9A 4XSXF 4PJMA 2ZMEB 5HDNA 1QZYA 1W5SA 2XGCA 2RC4A 2YX4A 4FTHA 1MMNA 1KQ8A 3PASA 5D8KB 4QSHA 4E70A 5F08A 1SD4A 2MFZA 2A5WA 5C4JJ 1WZ2A 3QQAA 1O3TA 1W4MA 2VKHA 4JX5A 3BG3A 2B3WA 1TP4A 5FD6A 2R93J 1D8JA 5J4YA 2WBMA 1CQTA 4BUPA 5EG0B 1EA3A 2IS4A 3LA7A 2OI8A 5E18F 3H5AA 3NPIA 3ZN1A 3PUBA 2XPUA 3HEFA 3W2AA 1ORKA 3CZ6A 3O3KA 3TQNA 5FLXK 1XSVA 1RC9A 2NVTJ 5DUKA 1QU3A 1FEXA 1YW7A 2EZIA 3JRHA 2M7AA 1UG2A 2HZTA 4CUGA 5FGMA 1VNDA 5D4RA 4ENKA 1KU2A 5B5EC 1IAWA 3NXCA 4IQJA 3HC7A 2UZKA 3BG6A 4HF2A 2A6HF 2V9KA 3IHUA 1VQ7I 3G4SI 2E1MC 2IGOA 5IPAA 3CWRA 3D1NI 2KIMA 1S72I 3QYFA 4DVYP 1BR1A 1MBHA 1PYVA 3GTOJ 3P7NA 3QU3A 3SXYA 1VF9A 5GTHC 4PSWA 4BS9A 3VODA 2WAEA 5K7ZA 4IHSA 3QU6A 4DQ2A 5GAHJ 1CF7B 3U1DA 2MC3A 2UXHA 1OCRH 1XDUA 4JNNA 1W5CC 2NAZA 1AWCA 3JRFA 4XKVA 2VLAA 4M3EA 2PQ8A 3K10A 4HYEA 2MH9A 3I4PA 3CJQB 2Y0SA 3P9CA 3OYIA 5DDGA 2IRFG 1GV2A 4X0GA 2GXBA 4OWRB 4KN4X 4ICHA 2YR2A 2B0LA 2HVQA 2CYYA 1TBXA 4EJUA 1MDMA 3E7LA 4IVNA 1JT0A 5K7FA 1LUJB 1QVUA 3G73A 2XF7A 3VEPA 1K61A 2ZBKA 3ZMTA 1HOMA 3VW0A 1Z3YA 2M87A 2XPVA 1BI2A 1SAUA 3HIMA 1IXCA 4NN1A 1X1CA 2R5YB 1AKHA 1Y8QB 4QPQA 4IZZA 3FXOA 4YFKF 1QPMA 2HXIA 3GEZA 2P81A 2D1VA 4MTEA 4RLQA 1E3HA 2RQPA 2R5ZA 4BE2A 2DMUA 5E17F 1NG7A 1P4WA 1P4AA 4PDKA 2Y9YA 1HW2A 3U1KA 2DXIA 4KICA 4IF4A 1R6RA 4OOIA 2PZ9A 4KMUX 1UHWA 1JE8A 3S93A 4C3JJ 3SZTA 1IW7F 1KU3A 1WJ5A 4KFCA 2FMLA 1XX5A 3K69A 3GTKJ 2KLOA 4ITVA 4AU7A 2FXAA 2QOPA 3CQZJ 4DJAA 1R7JA 5D4SA 3A1YA 1YHQI 2W4SA 5D8LB 1STZA 3K4CA 4HDVA 4I0AA 3GXOA 4QWQA 4KYWA 2B7EA 2HKXA 5DCMA 2QCOA 3DWLE 3GYHX 2H6BA 3HE0A 1WI3A 3V8KA 3V8LA 1L3LA 1JT6A 2EFNA 2WC2A 2WB1A 1G59A 3J81K 4HF0A 2PFVA 4B43A 2DODA 5FJ8J 4NB5A 4DBQA 4PUSA 3C18A 3B6AA 2K9MA 1A5JA 5D19A 2X4HA 4HV5A 2R7RA 1R58A 4U9NA 1RETA 3ABUA 2F5CA 4C2MJ 1ZRDA 1V5EA 3OOUA 2O5RA 2JPCA 3TOBA 2ZJQF 4NQWA 2E35A 3CCJI 4II3A 5H6RA 3JTHA 3ZQFA 3L2RA 1SFXA 1LDJA 4OIPF 2E5NA 3GZ6A 2L9NA 2ZCNA 3L2CA 3EYIA 4MQVA 1JUPA 3RPQA 5DYMA 1EJ9A 1BN5A 1LEBA 3I58A 5L3BA 2QSHX 2GA2A 4G12A 1TWHJ 4XLFA 5TJJA 4IHYA 1WI9A 2JA7J 3KLNA 3H0GJ 3ERED 4I98B 4RMNA 4R79A 2HVSA 1USSA 3TW7A 1MMAA 3WU2C 2GUHA 2Y75A 3CF2A 1JJ6C 2EIMH 2AXLA 3LSMA 1GVJA 3OYLA 1Z0XA 1FPQA 2BBYA 1FMVA 1N25A 2DA7A 4UUTA 4XN0A 2XDNA 1D5VA 5J4VA 2DA2A 2FBHA 3E6MA 2L7FP 4LD5A 2XAJA 3VOXA 2ZXWH 4JBAA 3TW6A 3E0JB 2QSGX 2K5CA 3ML6A 1ENHA 3P5JA 4RGXA 3QAHA 2W85A 4XLAA 4ZJZA 2ESNA 4BAYA 3LAJA 2LTPA 4GDFA 5LGNA 4B44A 3K1PA 4MIMA 1ETKA 3DBHB 2CW8A 1MH3A 2ZSHB 3OYBA 2ZXJA 2QIBA 4BACA 1R71A 3HRTA 2YVXA 5LFAA 2WAQN 3WGHA 1IXRC 1TQIA 3K0LA 3FXJA 4Z6YA 1V54H 1X3ZB 4RM3A 4BJTA 3N4MA 2BHZA 2E2IJ 2JZYA 4YEJA 1HC8A 4B48A 1R4NB 2LG4A 1K6YA 3E3VA 1SVMA 2YU3A 4XOTA 3S2DJ 4AVZA 4A3GJ 3F9KA 2FU4A 2VKDA 1YRNB 3P9TA 1QPIA 3BTLA 1DP7P 2EWNA 4DIQA 5IOYA 1WRJA 1FBSA 3F8FA 4C9YA 5E79C 3QOEA 2IEKA 2JA2A 3ZCOA 1K4TA 2XROA 4CYCB 4BBRJ 2VJ5A 3F22A 4L5IA 4L9NA 3VSLA 4GYIA 3AL0C 5M3MJ 2EFPA 3OYEA 2VB6A 1RUNA 3REOA 3G1LA 3BLYA 3KEOA 5GTIC 3DV8A 4QIWN 2ZMEC 2XHKA 3RZOJ 1X58A 1CGPA 1VQKI 1KYZA 2IA1A 1X1BA 2A07F 3DU5A 1X4PA 2L02A 1VFCA 2OU2A 1UAAA 1TT5B 4M3DA 4BL0B 2O7TA 1U9NA 1ZRCA 3CC4I 3KKCA 1Q1VA 1YE9A 3CCRI 1S6LA 4XLNF 3S1MJ 3OS1A 2CV2A 2DK5A 3HUGB 4U7DA 2ESHA 2GXGA 1IN4A 4GGGA 1YO5C 4LJZF 5J8CA 1RKWA 1OMIA 3H5RA 2IAIA 3QPTA 2HWVA 4OAYA 3U9GA 1FX7A 3BOQA 3S1RJ 4CDGA 2V1DA 4RLFA 1ZGAA 1SVLA 4G7HF 3HTHA 2HYTA 3PNVA 4EEFG 4IKFA 4KMFA 5CQEA 1FP2A 1Y0UA 3AG2H 1E3PA 2R7FA 2ADUA 1K6OA 5DV5A 3VIBA 3DEEA 2YU9J 1PDNC 1WPKA 4ESBA 3AAFA 2D6YA 4O6JA 5CKTA 3GMEA 2COMA 3VFZA 3VB2A 5KVRA 1ETVA 2KJBA 2L7ZA 3ONQA 1BI0A 2A3SA 2WADA 3MN2A 5FKMA 4Y13A 1C0WA 1QGPA 3FM3A 1HKSA 4P55A 2GIVA 2VC1A 3U21A 5B1AH 3KKDA 3HPHA 2K9SA 1MKMA 1QO0D 2XKPA 4K2EA 2YSRA 1S7AA 5ICFA 4A69C 5IOZA 3IL2A 4JQFA 5KHDA 2ZC2A 2NOGA 3FMRA 2HDWA 4RGUA 5K1YA 2QTQA 3V7SA 1MMDA 2IJLA 1RESA 2E60A 2Y2ZA 1YLFA 1FC3A 2LY1A 3FWEA 2VQCA 3QOPA 2ELHA 1B59A 2Q8KA 5ICCA 3HKZN 2P7CB 1F1ZA 2IP2A 2LYCA 2LKSA 5EZHA 2G7HA 3BR2A 2W53A 3M1CA 4UVCA 3VW2A 1FIAA 4BU2A 4BE1A 1JGSA 1ZG5A 2X6WA 3ZGKA 3BRUA 3S1QJ 2O7OA 4X6AJ 1G4DA 3JTGA 3TKYA 3QYBA 3JRGA 3COLA 3PSIA 2V9VA 3EGQA 1SD6A 3HRUA 3ESWB 2QF7A 1OR7A 3FXMA 3VVZA 3HHHA 1O4XA 3FK6A 1XTAA 2DFHA 5B3SH 3T0YA 2K4JA 4YRVA 4ZYDA 3ZN0A 2VONA 2ZXIA 3FBIB 2M5WA 1DUXC 5D1RA 2KIQA 1T95A 5F0FA 1HLVA 3JW4A 4ZYGA 3BG7A 3T8RA 3QODA 2FE3A 2E1MB 2GFNA 3HOTA 3K2ZA 3K4MA 1UZCA 1KZHA 3F8CA 1PP7U 3HXLA 4O3MA 4Q4ZF 2DLLA 2VQGA 2DMQA 3V8JA 5HS8A 2WGBA 3PSFA 2ACJA 2VPLA 4A2UA 2AXTC 2W48A 1LE8A 1EH8A 2PFBA 5DCFA 3PIOF 4HX4A 1WGXA 4L9VA 3IRRA 1QVTA 1VQMI 3RQ4A 3SFIA 4D1QA 1X2MA 2HQAA 1FYKA 1G8XA 3K7AJ 4HX8A 4C2MA 2VE8A 3Q0UA 2O3FA 4LITA 4ZH4F 2B63J 2PJRB 3MCZA 1SD7A 5K7HA 1SMTA 4CCKA 4HAMA 2R7UA 3IUOA 1IGNA 4IQ4A 1NG6A 5CQGA 4BXFA 2WY8Q 3W6JB 2YX7A 3IWFA 5D5UB 3K4BA 2CJJA 1GLNA 4L62A 4PJ0C 1J5YA 3HIFA 1LPQA 2M3AA 4AIKA 4XN3A 2DN0A 3EUAA 3LAPA 1ZR4A 5E1ZB 4A3FJ 4G94A 2DOFA 4B09A 2F2EA 2GIZA 2NVXJ 4IOCF 2LREA 2ZJPF 2TCTA 3KLOA 4ZTFA 3E6CC 2Q2EA 5ILUA 2WAQA 3FHZA 5GPAA 3TEDA 1USTA 2I5UA 4PCQA 4U88A 2HGCA 4I7HA 4CCNA 1V5FA 2HTSA 2FMYA 3J7ZI 2W00A 1VQ9I 4TV7A 2XF5A 1JGGA 3HTIA 3F8NA 3A0BC 3ASOH 1NH3A 5KNLA 3G56A 1TNTA 1DQUA 5D6FA 5F27A 2DK8A 3WGGA 1Y39A 1IV6A 4F52A 2RVCA 3GFLA 5HDKA 3D5SC 4OINF 1R36A 2WWYA 2EA2A 4H0EA 4RS8A 3DFGA 4WX9A 1P4XA 1ETQA 2X6YA 4EATA 2V4JC 3I59A 4I76A 1E0EA 5HAWA 1AA7A 3DBRB 4E7HA 2JA6J 4HOBA 4XKCA 2QGUA 3GTLJ 1UCRA 1IN5A 3GX4X 3LSRA 1U8RA 1K79A 9ANTA 1JHHA 2LDUA 4E7JA 1ZRFA 1IRGA 2LSOA 1TZLA 3R6SA 2C6YA 4A3BJ 2KL4A 3S2HJ 1Z6TA 3GVAA 3LWJA 3OOPA 3ZPLA 2ME0A 4EGZA 2GA1A 3LA3A 3KZ9A 1EKEA 1OCCH 1U5TB 4YFXF 3MKYB 4GCLA 1TW2A 2LVSA 1J09A 1XC5A 2M8GX 2G9WA 1YS6A 3PNTA 2Q1ZB 1HDPA 2M45A 2KT0A 5M3FJ 1QHHD 4JKZA 4E4HA 1QRYA 2DA3A 4CA0A 3HOXJ 5LRSA 3V7CA 2CFXA 3EETA 1MJBA 4QPOA 3CTAA 1GXPA 2D1HA 1FNNA 2LF8A 1FOXA 1D1BA 2MD0A 4M6YA 1ON2A 3JAMK 4RDUA 2M9HA 1SFUA 1A6IA 1XG1A 4XR6A 2ELKA 1F43A 4BNCA 6PAXA 3P9KA 3WE3A 3V78A 3J80K 4N4NB 1TTYA 4BYYA 1B8IB 4UVAA 2VQLA 2ZCWA 5FGLA 4KIFA 1J9IA 3S5RA 2CUEA 4XKWA 1RPWA 3CC7I 4EJTA 3VVXA 1BJZA 3K1MA 4II2A 3ECOA 2FX0A 3MKLA 4BQQA 3TO7A 4WK8F 3H3UA 2BVLA 3ABTA 2R7QA 4P5OA 1VQPI 3E7QA 1VI0A 3C2HA 2H1KA 1VQNI 1O3QA 1RR7A 1X3WB 2KISA 3OYMA 3F8MA 1IUFA 3K4NA 2NOJB 2A68F 5E3LA 5JR3A 3HKZA 3MZYA 2K86A 2HDCA 2DYSH 1WFXA 3DCFA 2VUMJ 3ROUA 1ZGWA 2L9SA 4XKBA 4ETSA 4J00A 1JUMA 1YIOA 5FFZA 1OPCA 1V3FA 2EINH 1Z21A 4QLCU 2FRHA 5FLXZ 3I55I 3R61A 1HBXG 3T8TA 1MBFA 1XSXA 2RNGA 3AG3H 2FA5A 1FJLA 4L9TA 2VN2A 3OIOA 3HDDA 2L3DA 3WTVC 3HL2A 2DT7B 3MQ0A 3VTIA 2LKPA 3AG4H 4BDYA 4U0WA 2E2HJ 3ANPA 1R5ID 1LDKB 1OCOH 1V4RA 2AO9A 4KA4A 4CCOA 2LOOA 3NNRA 4XK4A 1HQCA 3DTEA 3OWTA 2B9SA 3I3LA 2DMNA 1ZGJA 2XRNA 3ZQGA 1T33A 2DFEA 5KAIC 4BE0A 4GFLA 4LGWA 3ISPA 3V42A 5CXGA 4LOCA 2DO7A 5AONA 4IEJA 5EGOB 4E6KG 2HYGD 2HU9A 5LD2C 1BC8C 4ASNA 2RHAA 2EK5A 2IA2A 4PGHA 3NAUA 5ILVA 2EZHA 4IXAA 1OFCX 3IUVA 3S2WA 4YIFA 2HYJA 1Z05A 4D0PA 3I4MJ 3BY6A 1D0XA 1XGMA 4JL3A 3DPLC 3M07A 4R1HA 3MD2A 5CVRA 2Y31A 4ENJA 1OCPA 4AM3A 4KDPA 1P6RA 3A4CA 5HS9A 3OSFA 1UI5A 3IC7A 2NNYA 1J7KA 4EM2A 1I50J 3KP6A 2PMZA 3I9V2 3K1NA 4AYBA 1YX5A 1X1DA 2ZOZA 3UR3C 1KQ0A 1HSJA 1I6XA 3RPUA 2DMPA 1JTYA 4EM1A 2UXOA 2CV0A 3LSIA 1O3SA 4D5CA 2QWTA 2FEZA 2VC0A 3V7RA 2HFHA 2YVHA 4AVPA 4NC7A 1T39A 1QZZA 4JX4A 2W84A 3IP4B 3J7AY 4B47A 2H8WA 2STTA 3FM5A 2A6TA 1TNSA 3IH2A 3U2RA 5ICGA 1TW3A 5JVTA 1XS9A 4HRIA 1ZH5A 2NYXA 2FNAA 2VJ4A 2XDVA 2FD5A 4HSTA 3CUOA 4XRSA 4L9JA 4ESFA 5IP7J 4YG2F 3FMQA 2XUBA 3CDIA 4JOMA 3CCUI 3CF5F 2L54A 2BOLA 3VYSB 2LC2A 5FKKA 1IF1A 4BQOA 1MD0A 4I2OA 5IT9Z 1ZYRF 3VVYA 2XSJC 1WJCA 4U87A 2L9VA 2UV1A 1B72B 1B1BA 2RNJA 3H9QA 5CJ9A 2H27A 4I6ZA 1VTNC 2ZO4A 5FRNA 4KIBA 2Q24A 4XRFA 4XL9A 4LLNA 3KNWA 1MJ9A 2X6OA 3M8EA 4MLOA 4Q5SF 2DMTA 5DD8A 3T1BA 5IP9J 3L2UA 2COBA 3ZQQA 3CCQI 2ZKZA 4W1UA 5DAJA 1D1CA 2XAHA 2R7WA 1XN7A 1RUOA 2X51A 2WV1A 1LFBA 2HTJA 2K85A 4HW0A 3DPTA 3LSGA 4DZJA 3K4LA 1NHAA 2JN6A 2CW7A 3BP8A 4Z2YA 3WU1B 2QBYB 1RKTA 3ZQCA 4M3FA 3ZQIA 3S1NJ 3J81Z 3ZQLA 2VPRA 5HS7A 3BR3A 3JRDA 3RYRA 3M4OJ 3FDYA 3H9GA 3S3MA 1RRJA 2HS5A 3BTCA 1XGNA 1ZAOA 1I27A 2V6EA 2B1EA 2X9DA 3HSFA 3VYRB 2RN7A 4I09A 4AUXA 4DYRA 3C07A 2L7KA 3FIWA 2EIKH 4G8XA 2L4MA 2QM3A 3CUQB 3HOSA 4MEXF 1FY7A 3OYKA 2KRHA 4GFKA 4RB3C 1ZN2A 1HF0A 3G7RA 1H8AC 2GOMA 3ZQ7A 3I5UA 2OZ6A 2NS7A 4ZC3A 3H1CA 3FXUA 1J0RA 3OYDA 1LDDA 2HQNA 2M4GA 1W36D 1K7AA 1OJLA 4M72A 2UXIA 5D6EA 2CRGA 2X1DA 2M0MA 1IC8A 3AQSA 4OD5A 2LBFB 1IZ1A 3H92A 5E20A 1O7LA 2X0LA
chains in the Genus database with same CATH topology
3BG9A 2LR8A 4QIWN 3RZOJ 1X58A 3DEWA 2YS9A 3HOYJ 2QKOA 2XB0X 2EZKA 4ME9A 1VFCA 3GTGJ 4NDLA 2LP0A 1HDDC 3IH3A 4M3DA 2O7TA 3QPSA 4J19A 1U9NA 2YUSA 3RZDJ 4A3CJ 1Q1VA 5IYDJ 3KKCA 4DW6A 3S1MJ 2M2EA 3WHCA 2L0KA 2CQXA 1MBEA 2OPTA 3O8GA 1FTTA 1RKWA 4A3JJ 3WHBA 2IAIA 1AHDP 2NVQJ 3G1MA 3S1RJ 3JREA 3MNLA 4AC6A 3HTHA 2IBDA 2EZLA 1GV5A 2HYTA 4EEFG 1MBJA 3BJBA 3OSGA 4AC0A 3HOWJ 4HKUA 4HNVA 3JRBA 3VIBA 1K83J 2YU9J 1ZR2A 3HTJA 1WPKA 3G1OA 1GUUA 1YRNA 2R0QC 1BL0A 2D6YA 1ITYA 1U9OA 2DJNA 1TWGJ 1TWCJ 4UUSA 1MSEC 2REKA 4DZPA 1ETVA 2NVYJ 3BR0A 1IRZA 3SJMA 2L7ZA 1PUFB 2E19A 3JSJA 3MN2A 5FKMA 2V57A 5EFYA 4V2FA 3F0CA 4DYCA 4CYCA 2VKEA 3BG5A 2K9QA 1F36A 3BQZA 5DTDA 3LHQA 2ME6A 3A01A 2OERA 2R7ZJ 4CGRA 1WH7A 1X2NA 3KKDA 4BXXJ 2K9SA 4JYKA 5JLWA 3RD3A 2YVEA 1LE8B 5EF6A 4A69C 5IOZA 4IHWA 3HOZJ 4A3DJ 3SDGA 2G3BA 2NOGA 2QTQA 1FTZA 1RESA 2M0CA 2Y2ZA 4B4CA 3CJDA 4XRMA 1ZTRA 3HKZN 4GCTA 2JA5J 2HDDA 4GFBA 1WH5A 5EZHA 5M5XJ 1MH4A 3BR2A 2W53A 3K2AA 3VW2A 1FIAA 1R9TJ 4M3GA 3ON4A 3H3VK 3BRUA 1JKQC 3S1QJ 3O8HA 2O7OA 4X6AJ 3B81A 5K58A 1JKOC 5CW8A 3JRGA 2XGDA 2DA6A 3W6VA 3COLA 3EGQA 1APLC 2QF7A 3VVZA 3CMYA 2M34A 1O4XA 3FK6A 2PBXA 5JLXA 3QPLA 1E3OC 3S16J 1Z77A 1W0TA 4IHVA 5D1RA 2WUIA 1NK3P 1PUFA 5F0FA 1HLVA 5HODA 1SANA 3JRIA 3LSPA 3GZIA 4IHXA 3GTMJ 3TP0A 5F04A 4BKXA 2GFNA 2MSYA 1ZK8A 2DTZA 5IYCJ 3GTJJ 1ETXA 1WCMJ 3LSJA 5H9TA 2DMQA 3F1BA 2WGBA 5FKLA 2UXUA 2W48A 1LE8A 4D7NA 3RQIA 1WGXA 5M5WJ 3BHQA 5C4YA 1QVTA 1P7JA 3SFIA 1X2MA 2K9NA 2RASA 4Y7NJ 5M5YJ 3LNQA 3K7AJ 3MVPA 5CXIA 1U78A 5FHPA 2N8GA 5F1JA 3Q0UA 4L5EA 2EQRA 2B63J 4X1EA 4FCYA 3BT9A 2O8KA 5K7HA 5J3LA 1NTCA 2R92J 1IGNA 1POGA 5BNGA 3HM5A 2MGQA 3HGGA 3S14J 2G7LA 5F0CA 3NI7A 2HQ5A 5FMPA 2CJJA 2NP5A 3GBGA 4L62A 3DPJA 2WB1N 4BBSJ 1SGMA 1MBKA 4A3MJ 2DN0A 1ZR4A 4A3FJ 1UMQA 4A3IJ 4RBOA 2ZCMA 2NVXJ 1H88C 2TCTA 2XB5A 3HTAA 1S7EA 2GM4A 2H8RA 3TEDA 5GPAA 1GDTA 4NELA 2GENA 3S15J 1I3QJ 2MW8A 1UHSA 3FRQA 1H89C 4JP0A 2ZCXA 5GPCA 5J1YA 1DU0A 1GVDA 1JGGA 3UKGA 2JK3A 3HTIA 3HBLA 2ID3A 4DYQA 5HSZA 3G56A 4D5FA 4KWAA 5F27A 3ON2A 5IYBJ 3HOVJ 2X48A 1IV6A 3BNIA 1AU7A 1MBGA 2JJ7A 3S17J 2CU7A 2ECCA 5C44J 4XIDA 1ETQA 4I76A 5HAWA 2XGCA 1LFUP 4FTHA 5E3MA 2JA6J 3B6CA 3GTLJ 2G7GA 3PASA 9ANTA 3LSRA 1BW5A 4QSHA 5F08A 1TWFJ 4A3BJ 5C4JJ 3QQAA 3S2HJ 4JX5A 2D5VA 3BG3A 4A3KJ 5IP6A 2R93J 3LWJA 1CQTA 1GT0C 5EG0B 2I10A 2ME0A 2OI8A 3VOKA 5F0HA 3KZ9A 3NPIA 3Q0VA 1UI6A 2XPUA 3HEFA 3BCGA 1ORKA 5E3OA 4GCLA 3ANGA 2LLKA 4GCKA 2LVSA 1XC5A 3I4NJ 2M8GX 4MK6A 5C4XJ 4BY7J 2HOTA 2NVTJ 1HDPA 5EZGA 2KT0A 5M3FJ 4JKZA 1QRYA 1FEXA 2DA4A 2EZIA 2NP3A 3JRHA 2DA3A 3HOXJ 5FKNA 1UG2A 2VKVA 3VP5A 3PO2J 1VNDA 2NS8A 2LFBA 3NXCA 5GP9A 1TC3C 1OCTC 5EDNA 2ZOYA 2O9LA 4RDUA 2M9HA 1A6IA 1XG1A 2ELKA 1AKHB 1F43A 3JRAA 5IPAA 5HBUA 3CWRA 3D1NI 3V78A 1MBHA 3RH2A 2R5ZB 1B8IB 3QBMA 2JWTA 2ZB9A 3GTOJ 4AF5A 5FGLA 4BY1J 1VF9A 2K40A 1IDYA 3S5RA 2CUEA 2LY9A 1RPWA 1JKPC 2F07A 3NRGA 1TWAJ 3VVXA 5EYRA 1BJZA 4FE4A 4XRSG 1BA5A 3ZOBA 5K7ZA 1Y1VJ 4C3IJ 4XICA 5J1UA 2FX0A 3MKLA 2NX4A 4UDSA 2UXHA 4B3AA 3ZQHA 3E7QA 5EG0A 3QKXA 4JNNA 1VI0A 2TRTA 4C3HJ 2H1KA 3JRFA 1IDZA 1RR7A 4M3EA 3GEUA 1ZQ3P 1IUFA 5E3LA 4QTRA 3JR9A 2FBQA 1GV2A 3DCFA 4ICHA 2VUMJ 1ZGWA 1NK2P 1JUMA 3E7LA 1JT0A 2L9RA 5K7FA 1QVUA 3HOUJ 1K61A 1JKRC 1HOMA 3VW0A 5FKOA 1JUSA 1MBFA 3LOCA 2XPVA 1FJLA 3HIMA 3FKIJ 3OIOA 3HDDA 4NN1A 3Q3SA 5D18A 1AKHA 2R5YB 2CUFA 2E2HJ 2XGEA 3ANPA 4FISA 2HXIA 3HB9A 2DA5A 2AO9A 2P81A 1DU6A 3NNRA 4XK4A 2CQQA 3BR5A 2R5ZA 2DMUA 5DS9A 4ABZA 2DMNA 3BTIA 3CCYA 3ZQGA 1B8IA 3IV5A 2Y9YA 1T33A 3PM1A 4GFLA 1BW6A 2L7MP 3IH4A 3O60A 2OF7A 2PZ9A 2Y9ZA 5CXGA 4LOCA 4M6VA 4IEJA 3EUPA 3BR1A 4C3JJ 5EGOB 3A02A 2RHAA 2GBYA 2HXOA 2XRLA 3GTKJ 3NAUA 3VUQA 2EZHA 3C2BA 1OFCX 3TP3A 2QOPA 3CQZJ 3IUVA 2HYJA 3I4MJ 5AQCA 3PPBA 3CDLA 4JL3A 5J1RA 2DA1A 2Y30A 4W97A 3LJLA 1P7IA 2Y31A 1OCPA 1U8BA 3OSFA 4A93J 3GTQJ 5C3EJ 2QCOA 1UI5A 3HE0A 1WI3A 2DG8A 4ACIA 1I50J 2ID6A 2XSDC 3RKQA 1JT6A 2ZOZA 4M3BA 2UXOA 2DMPA 1JTYA 5FJ8J 3BTJA 4D7MA 2XPWA 3A03A 4D5CA 2QWTA 2HOSA 4YZEA 4JX6A 2YVHA 4MFEA 2R5YA 3VW1A 1ZKGA 3B6AA 1A5JA 5D19A 1Y1WJ 3V6GA 4JX4A 2G0EA 1RETA 1MSFC 3FISA 3L1PA 4C2MJ 2FJ1A 3OOUA 1MNMC 2LKXA 1ETWA 3VPRA 3IH2A 3ZQFA 4FE7A 1XS9A 3PO3J 3GTPJ 3M3YJ 3Q0WA 5EGOA 2ZCNA 2VI6A 2UXPA 1JUPA 2FD5A 4V2GA 2JA8J 5FLVA 4XRSA 4A3LJ 5IP7J 3NARA 4G12A 2E2JJ 1FIPA 1JJ8C 1TWHJ 2HOAA 1SFOJ 5FKKA 1HCRA 4Y52J 4IHYA 1G2HA 2JA7J 3VVYA 3H0GJ 3T6NA 1B72B 3AQTA 3BR6A 3TW7A 2GUHA 4I6ZA 2DG7A 2EH3A 2HI3A 2Q24A 2HKUA 2Y0SN 1JJ6C 1T56A 3KNWA 2X6OA 4MLOA 2DMTA 4B1RA 5IP9J 1EF4A 2COBA 1Z0XA 4W1UA 5DAJA 1ETYA 2XDNA 2DA7A 4UUTA 2DA2A 2L7FP 2WV1A 1LFBA 5E3NA 3JRCA 3VOXA 3TW6A 3LSGA 4DZJA 1ENHA 2JN6A 1RKTA 3ZQCA 4M3FA 3ZQIA 3S1NJ 3ZQLA 2VPRA 3JRDA 3BR3A 2GLOA 2LTPA 3M4OJ 4MIMA 1ETKA 1MH3A 2AHQA 4MO7A 2QIBA 3BTCA 1I6HJ 2WAQN 1IG7A 2X9DA 2RAEA 4AUXA 4DYRA 3C07A 3FIWA 2JMWA 2LD5A 2E2IJ 2IU5A 3CRJA 1ETOA 3S2DJ 4A3GJ 2LK2A 4PXIA 4A3EJ 4GFKA 1YRNB 3P9TA 5FLMJ 1QPIA 3BTLA 1HF0A 3G7RA 1H8AC 4UUSB 4MFDA 1B72A 5IOYA 2G7SA 2NS7A 3FK7A 2IEKA 2EBIA 2FQ4A 4S0HB 1OJLA 2UXIA 3HGYA 4CYCB 2MG4A 4BBRJ 2E1OA 2CRGA 2ECBA 1IC8A 1JTXA 1D5YA 3AQSA 4MXMA 2KDZA 5M3MJ 5EEAA 1W0UA 1IJWC 3A01B 2PMZN 3G1LA 4AYBN 3BQYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BG9 A;  2LR8 A;  4QIW N;  3RZO J;  1X58 A;  3DEW A;  2YS9 A;  3HOY J;  2QKO A;  2XB0 X;  2EZK A;  4ME9 A;  1VFC A;  3GTG J;  4NDL A;  2LP0 A;  1HDD C;  3IH3 A;  4M3D A;  2O7T A;  3QPS A;  4J19 A;  1U9N A;  2YUS A;  3RZD J;  4A3C J;  1Q1V A;  5IYD J;  3KKC A;  4DW6 A;  3S1M J;  2M2E A;  3WHC A;  2L0K A;  2CQX A;  1MBE A;  2OPT A;  3O8G A;  1FTT A;  1RKW A;  4A3J J;  3WHB A;  2IAI A;  1AHD P;  2NVQ J;  3G1M A;  3S1R J;  3JRE A;  3MNL A;  4AC6 A;  3HTH A;  2IBD A;  2EZL A;  1GV5 A;  2HYT A;  4EEF G;  1MBJ A;  3BJB A;  3OSG A;  4AC0 A;  3HOW J;  4HKU A;  4HNV A;  3JRB A;  3VIB A;  1K83 J;  2YU9 J;  1ZR2 A;  3HTJ A;  1WPK A;  3G1O A;  1GUU A;  1YRN A;  2R0Q C;  1BL0 A;  2D6Y A;  1ITY A;  1U9O A;  2DJN A;  1TWG J;  1TWC J;  4UUS A;  1MSE C;  2REK A;  4DZP A;  1ETV A;  2NVY J;  3BR0 A;  1IRZ A;  3SJM A;  2L7Z A;  1PUF B;  2E19 A;  3JSJ A;  3MN2 A;  5FKM A;  2V57 A;  5EFY A;  4V2F A;  3F0C A;  4DYC A;  4CYC A;  2VKE A;  3BG5 A;  2K9Q A;  1F36 A;  3BQZ A;  5DTD A;  3LHQ A;  2ME6 A;  3A01 A;  2OER A;  2R7Z J;  4CGR A;  1WH7 A;  1X2N A;  3KKD A;  4BXX J;  2K9S A;  4JYK A;  5JLW A;  3RD3 A;  2YVE A;  1LE8 B;  5EF6 A;  4A69 C;  5IOZ A;  4IHW A;  3HOZ J;  4A3D J;  3SDG A;  2G3B A;  2NOG A;  2QTQ A;  1FTZ A;  1RES A;  2M0C A;  2Y2Z A;  4B4C A;  3CJD A;  4XRM A;  1ZTR A;  3HKZ N;  4GCT A;  2JA5 J;  2HDD A;  4GFB A;  1WH5 A;  5EZH A;  5M5X J;  1MH4 A;  3BR2 A;  2W53 A;  3K2A A;  3VW2 A;  1FIA A;  1R9T J;  4M3G A;  3ON4 A;  3H3V K;  3BRU A;  1JKQ C;  3S1Q J;  3O8H A;  2O7O A;  4X6A J;  3B81 A;  5K58 A;  1JKO C;  5CW8 A;  3JRG A;  2XGD A;  2DA6 A;  3W6V A;  3COL A;  3EGQ A;  1APL C;  2QF7 A;  3VVZ A;  3CMY A;  2M34 A;  1O4X A;  3FK6 A;  2PBX A;  5JLX A;  3QPL A;  1E3O C;  3S16 J;  1Z77 A;  1W0T A;  4IHV A;  5D1R A;  2WUI A;  1NK3 P;  1PUF A;  5F0F A;  1HLV A;  5HOD A;  1SAN A;  3JRI A;  3LSP A;  3GZI A;  4IHX A;  3GTM J;  3TP0 A;  5F04 A;  4BKX A;  2GFN A;  2MSY A;  1ZK8 A;  2DTZ A;  5IYC J;  3GTJ J;  1ETX A;  1WCM J;  3LSJ A;  5H9T A;  2DMQ A;  3F1B A;  2WGB A;  5FKL A;  2UXU A;  2W48 A;  1LE8 A;  4D7N A;  3RQI A;  1WGX A;  5M5W J;  3BHQ A;  5C4Y A;  1QVT A;  1P7J A;  3SFI A;  1X2M A;  2K9N A;  2RAS A;  4Y7N J;  5M5Y J;  3LNQ A;  3K7A J;  3MVP A;  5CXI A;  1U78 A;  5FHP A;  2N8G A;  5F1J A;  3Q0U A;  4L5E A;  2EQR A;  2B63 J;  4X1E A;  4FCY A;  3BT9 A;  2O8K A;  5K7H A;  5J3L A;  1NTC A;  2R92 J;  1IGN A;  1POG A;  5BNG A;  3HM5 A;  2MGQ A;  3HGG A;  3S14 J;  2G7L A;  5F0C A;  3NI7 A;  2HQ5 A;  5FMP A;  2CJJ A;  2NP5 A;  3GBG A;  4L62 A;  3DPJ A;  2WB1 N;  4BBS J;  1SGM A;  1MBK A;  4A3M J;  2DN0 A;  1ZR4 A;  4A3F J;  1UMQ A;  4A3I J;  4RBO A;  2ZCM A;  2NVX J;  1H88 C;  2TCT A;  2XB5 A;  3HTA A;  1S7E A;  2GM4 A;  2H8R A;  3TED A;  5GPA A;  1GDT A;  4NEL A;  2GEN A;  3S15 J;  1I3Q J;  2MW8 A;  1UHS A;  3FRQ A;  1H89 C;  4JP0 A;  2ZCX A;  5GPC A;  5J1Y A;  1DU0 A;  1GVD A;  1JGG A;  3UKG A;  2JK3 A;  3HTI A;  3HBL A;  2ID3 A;  4DYQ A;  5HSZ A;  3G56 A;  4D5F A;  4KWA A;  5F27 A;  3ON2 A;  5IYB J;  3HOV J;  2X48 A;  1IV6 A;  3BNI A;  1AU7 A;  1MBG A;  2JJ7 A;  3S17 J;  2CU7 A;  2ECC A;  5C44 J;  4XID A;  1ETQ A;  4I76 A;  5HAW A;  2XGC A;  1LFU P;  4FTH A;  5E3M A;  2JA6 J;  3B6C A;  3GTL J;  2G7G A;  3PAS A;  9ANT A;  3LSR A;  1BW5 A;  4QSH A;  5F08 A;  1TWF J;  4A3B J;  5C4J J;  3QQA A;  3S2H J;  4JX5 A;  2D5V A;  3BG3 A;  4A3K J;  5IP6 A;  2R93 J;  3LWJ A;  1CQT A;  1GT0 C;  5EG0 B;  2I10 A;  2ME0 A;  2OI8 A;  3VOK A;  5F0H A;  3KZ9 A;  3NPI A;  3Q0V A;  1UI6 A;  2XPU A;  3HEF A;  3BCG A;  1ORK A;  5E3O A;  4GCL A;  3ANG A;  2LLK A;  4GCK A;  2LVS A;  1XC5 A;  3I4N J;  2M8G X;  4MK6 A;  5C4X J;  4BY7 J;  2HOT A;  2NVT J;  1HDP A;  5EZG A;  2KT0 A;  5M3F J;  4JKZ A;  1QRY A;  1FEX A;  2DA4 A;  2EZI A;  2NP3 A;  3JRH A;  2DA3 A;  3HOX J;  5FKN A;  1UG2 A;  2VKV A;  3VP5 A;  3PO2 J;  1VND A;  2NS8 A;  2LFB A;  3NXC A;  5GP9 A;  1TC3 C;  1OCT C;  5EDN A;  2ZOY A;  2O9L A;  4RDU A;  2M9H A;  1A6I A;  1XG1 A;  2ELK A;  1AKH B;  1F43 A;  3JRA A;  5IPA A;  5HBU A;  3CWR A;  3D1N I;  3V78 A;  1MBH A;  3RH2 A;  2R5Z B;  1B8I B;  3QBM A;  2JWT A;  2ZB9 A;  3GTO J;  4AF5 A;  5FGL A;  4BY1 J;  1VF9 A;  2K40 A;  1IDY A;  3S5R A;  2CUE A;  2LY9 A;  1RPW A;  1JKP C;  2F07 A;  3NRG A;  1TWA J;  3VVX A;  5EYR A;  1BJZ A;  4FE4 A;  4XRS G;  1BA5 A;  3ZOB A;  5K7Z A;  1Y1V J;  4C3I J;  4XIC A;  5J1U A;  2FX0 A;  3MKL A;  2NX4 A;  4UDS A;  2UXH A;  4B3A A;  3ZQH A;  3E7Q A;  5EG0 A;  3QKX A;  4JNN A;  1VI0 A;  2TRT A;  4C3H J;  2H1K A;  3JRF A;  1IDZ A;  1RR7 A;  4M3E A;  3GEU A;  1ZQ3 P;  1IUF A;  5E3L A;  4QTR A;  3JR9 A;  2FBQ A;  1GV2 A;  3DCF A;  4ICH A;  2VUM J;  1ZGW A;  1NK2 P;  1JUM A;  3E7L A;  1JT0 A;  2L9R A;  5K7F A;  1QVU A;  3HOU J;  1K61 A;  1JKR C;  1HOM A;  3VW0 A;  5FKO A;  1JUS A;  1MBF A;  3LOC A;  2XPV A;  1FJL A;  3HIM A;  3FKI J;  3OIO A;  3HDD A;  4NN1 A;  3Q3S A;  5D18 A;  1AKH A;  2R5Y B;  2CUF A;  2E2H J;  2XGE A;  3ANP A;  4FIS A;  2HXI A;  3HB9 A;  2DA5 A;  2AO9 A;  2P81 A;  1DU6 A;  3NNR A;  4XK4 A;  2CQQ A;  3BR5 A;  2R5Z A;  2DMU A;  5DS9 A;  4ABZ A;  2DMN A;  3BTI A;  3CCY A;  3ZQG A;  1B8I A;  3IV5 A;  2Y9Y A;  1T33 A;  3PM1 A;  4GFL A;  1BW6 A;  2L7M P;  3IH4 A;  3O60 A;  2OF7 A;  2PZ9 A;  2Y9Z A;  5CXG A;  4LOC A;  4M6V A;  4IEJ A;  3EUP A;  3BR1 A;  4C3J J;  5EGO B;  3A02 A;  2RHA A;  2GBY A;  2HXO A;  2XRL A;  3GTK J;  3NAU A;  3VUQ A;  2EZH A;  3C2B A;  1OFC X;  3TP3 A;  2QOP A;  3CQZ J;  3IUV A;  2HYJ A;  3I4M J;  5AQC A;  3PPB A;  3CDL A;  4JL3 A;  5J1R A;  2DA1 A;  2Y30 A;  4W97 A;  3LJL A;  1P7I A;  2Y31 A;  1OCP A;  1U8B A;  3OSF A;  4A93 J;  3GTQ J;  5C3E J;  2QCO A;  1UI5 A;  3HE0 A;  1WI3 A;  2DG8 A;  4ACI A;  1I50 J;  2ID6 A;  2XSD C;  3RKQ A;  1JT6 A;  2ZOZ A;  4M3B A;  2UXO A;  2DMP A;  1JTY A;  5FJ8 J;  3BTJ A;  4D7M A;  2XPW A;  3A03 A;  4D5C A;  2QWT A;  2HOS A;  4YZE A;  4JX6 A;  2YVH A;  4MFE A;  2R5Y A;  3VW1 A;  1ZKG A;  3B6A A;  1A5J A;  5D19 A;  1Y1W J;  3V6G A;  4JX4 A;  2G0E A;  1RET A;  1MSF C;  3FIS A;  3L1P A;  4C2M J;  2FJ1 A;  3OOU A;  1MNM C;  2LKX A;  1ETW A;  3VPR A;  3IH2 A;  3ZQF A;  4FE7 A;  1XS9 A;  3PO3 J;  3GTP J;  3M3Y J;  3Q0W A;  5EGO A;  2ZCN A;  2VI6 A;  2UXP A;  1JUP A;  2FD5 A;  4V2G A;  2JA8 J;  5FLV A;  4XRS A;  4A3L J;  5IP7 J;  3NAR A;  4G12 A;  2E2J J;  1FIP A;  1JJ8 C;  1TWH J;  2HOA A;  1SFO J;  5FKK A;  1HCR A;  4Y52 J;  4IHY A;  1G2H A;  2JA7 J;  3VVY A;  3H0G J;  3T6N A;  1B72 B;  3AQT A;  3BR6 A;  3TW7 A;  2GUH A;  4I6Z A;  2DG7 A;  2EH3 A;  2HI3 A;  2Q24 A;  2HKU A;  2Y0S N;  1JJ6 C;  1T56 A;  3KNW A;  2X6O A;  4MLO A;  2DMT A;  4B1R A;  5IP9 J;  1EF4 A;  2COB A;  1Z0X A;  4W1U A;  5DAJ A;  1ETY A;  2XDN A;  2DA7 A;  4UUT A;  2DA2 A;  2L7F P;  2WV1 A;  1LFB A;  5E3N A;  3JRC A;  3VOX A;  3TW6 A;  3LSG A;  4DZJ A;  1ENH A;  2JN6 A;  1RKT A;  3ZQC A;  4M3F A;  3ZQI A;  3S1N J;  3ZQL A;  2VPR A;  3JRD A;  3BR3 A;  2GLO A;  2LTP A;  3M4O J;  4MIM A;  1ETK A;  1MH3 A;  2AHQ A;  4MO7 A;  2QIB A;  3BTC A;  1I6H J;  2WAQ N;  1IG7 A;  2X9D A;  2RAE A;  4AUX A;  4DYR A;  3C07 A;  3FIW A;  2JMW A;  2LD5 A;  2E2I J;  2IU5 A;  3CRJ A;  1ETO A;  3S2D J;  4A3G J;  2LK2 A;  4PXI A;  4A3E J;  4GFK A;  1YRN B;  3P9T A;  5FLM J;  1QPI A;  3BTL A;  1HF0 A;  3G7R A;  1H8A C;  4UUS B;  4MFD A;  1B72 A;  5IOY A;  2G7S A;  2NS7 A;  3FK7 A;  2IEK A;  2EBI A;  2FQ4 A;  4S0H B;  1OJL A;  2UXI A;  3HGY A;  4CYC B;  2MG4 A;  4BBR J;  2E1O A;  2CRG A;  2ECB A;  1IC8 A;  1JTX A;  1D5Y A;  3AQS A;  4MXM A;  2KDZ A;  5M3M J;  5EEA A;  1W0U A;  1IJW C;  3A01 B;  2PMZ N;  3G1L A;  4AYB N;  3BQY A; 
#chains in the Genus database with same CATH topology
 4PJL A;  4ZDO A;  2YS9 A;  4FX4 A;  5B1B H;  2QQB A;  2JSP A;  2EZK A;  2F6C A;  4ME9 A;  3GTG J;  2LP0 A;  2PX9 A;  3MZ8 A;  3IH3 A;  1HDD C;  3QPS A;  3R0A A;  3VDX A;  3PL8 A;  4CCL A;  3G71 I;  3TOA A;  5LHG A;  2EIJ H;  4OIQ F;  1Z91 A;  3O8G A;  2L2O A;  3LWF A;  2NVQ J;  2CG4 A;  4CYD A;  3CP8 A;  4UB6 C;  2QQ9 A;  4AC6 A;  2EZL A;  3ELK A;  2KIU A;  1GV5 A;  4ZTJ A;  3KE2 A;  1U5T C;  3LQR A;  1N78 A;  1MBJ A;  4Y33 A;  3BJB A;  3P9I A;  2FBK A;  3OSG A;  2CWE A;  3EQL F;  4HKU A;  2F4M B;  2X1C A;  4GRI A;  3JRB A;  5BPD A;  4GO1 A;  5E1X A;  2MAB A;  2AQF A;  1XCB A;  2JRT A;  2BW3 B;  2R0Q C;  1ITY A;  2DJN A;  1MSE C;  3CLQ A;  4UUS A;  4DZP A;  3BR0 A;  1B9M A;  4IX7 A;  4LG0 B;  1BBY A;  3EUH C;  1PUF B;  4A6D A;  2PJR A;  3JSJ A;  3BCB A;  2BXZ A;  5L3D A;  1ZG3 A;  2V57 A;  5EFY A;  3F0C A;  1LB2 A;  2VKE A;  3SEZ A;  3DF8 A;  3Q9V A;  3LL7 A;  2ME6 A;  2W1O A;  1S3J A;  3A01 A;  2OER A;  1ZLK A;  3KP3 A;  2OJE D;  3MAJ A;  2BV6 A;  1HW5 A;  3ECH A;  2EV0 A;  4IHW A;  2ISY A;  4A3D J;  3HHG A;  1HKT A;  1IN7 A;  2UXX A;  4LK0 F;  3ZMS A;  1SMY F;  5GAG J;  3WTS C;  1Z3X A;  1PJR A;  3CJD A;  1HKQ A;  2WAF A;  3DKY A;  3AFH A;  3HYI A;  3FXL A;  1WH5 A;  1R1U A;  1VQ4 I;  4OAZ A;  3L2Q A;  5LGU A;  3Q5F A;  3LFU A;  2QKM B;  3DKX A;  3E1S A;  2PLY A;  5K58 A;  1JKO C;  4KT6 A;  3W6V A;  2K02 A;  2GAU A;  5CVJ A;  5BMZ A;  1KQ9 A;  1TLH B;  2MC4 A;  5JLX A;  1E3O C;  3S16 J;  1Z77 A;  4EJW A;  2RRE A;  4BQA A;  2R7X A;  2WUI A;  4OD4 A;  4IJA A;  2LMD A;  5D5X B;  4ZYA A;  1FWZ A;  3ABM H;  3FMS A;  3GTM J;  5E8I A;  1ZK8 A;  1LVA A;  2W57 A;  2DTZ A;  2VIX A;  2MD5 A;  4HX7 A;  5IYC J;  3BPX A;  4AIJ A;  3ABL H;  3CMM A;  3LSJ A;  4B8X A;  3HRS A;  3F1B A;  4XNF A;  3S3O A;  3VYT B;  3F6V A;  3OR1 C;  3VSK A;  3J7A O;  1P7J A;  2L5Q A;  3BJ6 A;  4Y7N J;  2UXN A;  2RAS A;  1XSD A;  4P96 A;  3MVP A;  5CXI A;  1U78 A;  5AIQ A;  5IT3 A;  4HQE A;  1TQP A;  3S3N A;  3BT9 A;  4BJ6 C;  4C30 A;  1NTC A;  3FXQ A;  4YIR X;  2R92 J;  2UWM A;  5BNG A;  1JXS A;  1YIJ I;  5FMP A;  2FOK A;  2NP5 A;  1W5T A;  2DYR H;  1WKM A;  2GXA A;  4L18 B;  1MBK A;  1BJA A;  2KQR A;  1SVO A;  2KDO A;  2VBY A;  1HST A;  5J40 A;  2KRC A;  2ZY9 A;  2ZCM A;  2BE5 F;  1H88 C;  2XB5 A;  1WVR A;  3W2W A;  2BY0 A;  1XMX A;  3MKZ A;  1H9T A;  1FYL A;  2J5O A;  4NEL A;  2F5D A;  2EIL H;  1UHS A;  5DEQ A;  1OR7 C;  1H89 C;  4JP0 A;  4G7O F;  5GPC A;  2Z3Y A;  1DU0 A;  1M1E B;  3C1D A;  3UKG A;  2JK3 A;  5TIS C;  4IO9 F;  3RPU D;  2DBB A;  4D5F A;  3RTR A;  3IAS 2;  3ON2 A;  2F5V A;  3HOV J;  1O3R A;  2VXZ A;  3QYE A;  3ZMZ A;  2X1E A;  3CD6 I;  4XOR A;  3S17 J;  1WJA A;  2CU7 A;  2O6G E;  1KU7 A;  3LFK A;  1ULY A;  1R1V A;  1LFU P;  4XLH A;  2H1L A;  4BGD A;  4RB2 C;  1OYY A;  5CVI A;  1IV8 A;  1BW5 A;  5JHU A;  3SWH A;  1BR4 A;  4A5M A;  2P5V A;  2V7F A;  3W3C A;  5FRO A;  1TWF J;  2QSF X;  1E17 A;  2Z9O A;  1YYV A;  1RIO H;  2D5V A;  4XMY A;  5EEH A;  4RGR A;  2WY7 Q;  5IP6 A;  4RB1 A;  4D9J A;  4Y15 A;  5KK1 A;  5FFX A;  3ZRG A;  4HV6 A;  4OIR F;  5F0H A;  3S32 A;  3FZV A;  2Z99 A;  4KNY A;  1D0Z A;  2QUF A;  1UI6 A;  4N9H A;  3BCG A;  1E2X A;  2ETH A;  2LLK A;  1MGT A;  5J6X A;  3M8J A;  4MK6 A;  5C4X J;  1OQY A;  4BY7 J;  3GFM A;  1T38 A;  1IRF A;  1MDM B;  4MTD A;  3L09 A;  3E5U A;  2IW5 A;  5FKN A;  1ERD A;  3VP5 A;  1W7P A;  4RAZ A;  3PO2 J;  2NS8 A;  2LFB A;  3I53 A;  4IRH A;  5GP9 A;  4KUM A;  1TC3 C;  1IRX A;  1T6S A;  5ED4 A;  2EV5 A;  4KN7 X;  5BS6 A;  3VYU B;  2XAS A;  4KIS A;  2ZOY A;  3MFK A;  1EH6 A;  2O9L A;  4HPQ A;  2LNB A;  1AKH B;  5TGT A;  5D5W B;  5HBU A;  1YX3 A;  3A2K A;  2ZME A;  5IY5 H;  1R5H A;  2JPB A;  1I1S A;  3RH2 A;  4Y4R A;  2R5Z B;  3KZY A;  4HBL A;  3C3W A;  1P2F A;  3IAM 2;  2K40 A;  3CUQ C;  3WTZ A;  2LY9 A;  1JKP C;  2R7S A;  2F07 A;  1TWA J;  3NRG A;  2JSC A;  2AQE A;  2EA4 A;  4FE4 A;  4XRS G;  3LST A;  3ZOB A;  3K9T A;  4RAF A;  4BXU A;  1Y1V J;  1U3E M;  4I0B A;  4C3I J;  2QEN A;  5J1U A;  4AID A;  2NX4 A;  1BOA A;  4UDS A;  5KCM A;  3L00 A;  4B3A A;  5GAD J;  5EG0 A;  3F3X A;  2TRT A;  1FOK A;  3GEU A;  4I02 A;  1N75 A;  1ZQ3 P;  3SDB A;  3M7G A;  3CJN A;  4QTR A;  3JR9 A;  3NEU A;  3RKX A;  3OIP A;  4LK1 F;  2LF7 A;  1QQI A;  3HG9 A;  4F93 B;  4FX0 A;  3TL4 X;  2BY3 A;  4BHP A;  1TQM A;  3PQK A;  2E7W A;  4N4O B;  3HOU J;  4BDZ A;  2ELJ A;  2Q0O A;  5FKO A;  1JUS A;  1KU9 A;  2OCE A;  1IN8 A;  5D18 A;  2JVH A;  2XGE A;  2PMH A;  4BJ5 C;  1VQL I;  3HB9 A;  1YJ9 I;  2F4I A;  2KJC A;  3KIO A;  1R49 A;  2CQQ A;  2P4W A;  5ILS A;  1LKX A;  3JAM Z;  5LBQ A;  4ABZ A;  3BTI A;  3HTU A;  3CCY A;  3O2P E;  4NQW B;  5DS9 A;  3IV5 A;  1F4K A;  2Y69 H;  3PM1 A;  2L7M P;  3O60 A;  5L3F A;  2ZSI B;  2OF7 A;  4HA8 A;  1RNL A;  2Y9Z A;  4M6V A;  3DLA A;  4GCV A;  3OYJ A;  3EUP A;  4CXF A;  3MWM A;  3BR1 A;  4CGZ A;  3A02 A;  1OKR A;  2F5F A;  2FUG 2;  1CF7 A;  2KRF A;  3OYA A;  2GBY A;  1XCV A;  3H35 A;  3PNY A;  3VUQ A;  2L4A A;  3TP3 A;  3ZR8 X;  4FQG A;  2MBF A;  3K6G A;  4NC8 A;  4WF2 A;  5AQC A;  3PPB A;  5J1R A;  3EDP A;  2HZD A;  2DA1 A;  1QZE A;  3JCU C;  2Y30 A;  5HLH A;  4IHT A;  3H36 A;  5K5O A;  4IRI A;  3CDH A;  2ZJ2 A;  4L5J A;  5C3E J;  3FHN A;  4IOA F;  4AIH A;  2V1X A;  2DG8 A;  4ACI A;  4XLC A;  2W25 A;  2XAF A;  4M3B A;  3RCO A;  3G6E I;  3O6B B;  4RGS A;  4D7M A;  3HSR A;  3SEQ A;  4CO8 A;  2HOS A;  4NBQ A;  2X85 A;  2CUJ A;  2EJR A;  1R5G A;  2P6S A;  4MFE A;  2R5Y A;  2DFF A;  3VW1 A;  1ZKG A;  1BI3 A;  3KP7 A;  4UHT A;  1Y1W J;  2V9P A;  2G0E A;  1D0Y A;  4L0Y B;  2OAZ A;  3FIS A;  3L1P A;  3PFY A;  3CCM I;  4HNU A;  2DPU A;  2FJ1 A;  4Q47 A;  2E36 A;  4HDU A;  2KHM A;  1S8N A;  3VPR A;  4UVB A;  1H0M A;  1G3T A;  1IUY A;  3VWB A;  4AWX B;  2R4G A;  2QLZ A;  2IXS A;  4MQ9 F;  1QBJ A;  3KP2 A;  4G6Q A;  2UXP A;  1UG0 A;  4H4K C;  2JA8 J;  4V2G A;  1IN6 A;  2P7V B;  1TL8 A;  5FLV A;  4PGG A;  1S29 A;  3NAR A;  3B02 A;  4FHT A;  2MYS A;  5JFR A;  3CJT B;  1FIP A;  1JJ8 C;  4Y52 J;  3WG7 H;  1G2H A;  2BVM A;  3MEX A;  3T6N A;  4MHG A;  2DG7 A;  4PSX A;  2HI3 A;  4ENM A;  3N97 A;  4V19 K;  2Y0S N;  5A2Q Z;  2JT1 A;  3ULQ B;  3JSO A;  2IS1 A;  3RKY A;  4B1R A;  4DNC A;  2KZG A;  1ZG1 A;  3L2W A;  1ETY A;  4HLY A;  3X2Q H;  1HW1 A;  5L3C A;  4XQF A;  2IS2 A;  3DU6 A;  2PG4 A;  5E3N A;  2Y0M A;  4LB6 B;  2VJJ A;  1UFM A;  1OLT A;  3CCL I;  5ICE A;  3BWG A;  3I56 I;  3DBL B;  2DU9 A;  4LLL A;  3NS4 A;  3MMY B;  2K3P A;  3BJO A;  2CQN A;  2RDP A;  5BOX A;  3KP5 A;  4HLX A;  3GFJ A;  2KPM A;  2GLO A;  3D0S A;  1AOY A;  3KX2 A;  1SFK A;  3WTU C;  2AHQ A;  4MO7 A;  5H6Q A;  1I6H J;  4XOP A;  1IG7 A;  1LEA A;  4LIU A;  1JHF A;  1B9N A;  2XAQ A;  5HLG A;  3GUD A;  3TGN A;  2VBX A;  3CRJ A;  3OL4 A;  1I1G A;  4F92 B;  5DD4 A;  4M73 A;  3LMM A;  4PXI A;  2P6T A;  2P0W A;  5FLM J;  2R3S A;  3FX3 A;  4J01 A;  3DTI A;  4PJJ A;  2NRA C;  1VQ5 I;  4MFD A;  3BZ6 A;  2BXY A;  3K4K A;  2G7S A;  3WTW C;  3FK7 A;  2VT2 A;  2EBI A;  5H20 A;  2BYV E;  5HOO A;  2QEX I;  4S0H B;  4XON A;  4F7Z A;  2E1O A;  1WJD A;  5FB2 A;  1JTX A;  5EEA A;  1IJW C;  2VQH A;  2NVU B;  5FO5 A;  3BG9 A;  2LR8 A;  2W82 A;  1T0F A;  3DEW A;  3DEU A;  4CH7 A;  3HOY J;  1FMW A;  1LFP A;  2VXD A;  2QKO A;  4HZF A;  2DW4 A;  4OMZ A;  3LA2 A;  4GXO A;  1G3Y A;  2MA3 A;  4NDL A;  5F6F A;  4A3C J;  2YUS A;  2MLG A;  1ZHF A;  1J75 A;  1T08 B;  2WTE A;  3FXR A;  2M2E A;  3F23 A;  3WHC A;  3IWZ A;  3OS2 A;  2L0K A;  3KCC A;  2CQX A;  5CVU A;  4A0Z A;  2OPT A;  1FTT A;  3KET A;  4IL6 C;  3WTT C;  1AHD P;  2R7O A;  3G1M A;  2Y48 A;  2JTV A;  2JUG A;  3JRE A;  1P92 A;  4E7S A;  3MNL A;  2IBD A;  2IGK A;  5LEK A;  1T2K A;  4AC0 A;  3MZH A;  1ON1 A;  3UNG C;  1K83 J;  3HTJ A;  2EV6 A;  2ZNZ A;  4CSW A;  5FD5 A;  1GUU A;  1YRN A;  1BL0 A;  4HSR A;  1TWG J;  1TWC J;  3H9J A;  2OBP A;  1IRZ A;  3SJM A;  5LHI A;  4Y3O A;  3DXJ F;  2GWR A;  3ZMV A;  3WGI A;  3CES A;  4CYC A;  2XAG A;  2HNH A;  2K9Q A;  1F36 A;  1Y6I A;  5DTD A;  1ZRE A;  2DT6 A;  2VE9 A;  3LHQ A;  2R7Z J;  4CGR A;  1WH7 A;  1WSU A;  1W7P D;  1QNT A;  4NNJ A;  5HDG A;  4BXX J;  1BM9 A;  5H2F C;  4JYK A;  2QQA A;  3RD3 A;  2YVE A;  2IGN A;  1O7F A;  1Z7L A;  1LE8 B;  2DOA A;  4L0Z B;  4BH9 A;  3TO6 A;  2W7N A;  3SDG A;  2M8E A;  2G3B A;  4OIO F;  3GLL A;  1DP3 A;  4A0Y A;  2A69 F;  4A12 A;  3ERM A;  2OV7 A;  2XV4 S;  4B4C A;  1D8K A;  3HUG A;  4RB0 A;  4UNO A;  2E5Z A;  2JA5 J;  2PI0 A;  4GFB A;  2OTJ I;  1MH4 A;  5JHF A;  2D2W A;  3BZC A;  1R9T J;  4M3G A;  1JKQ C;  1SFE A;  2EPF A;  2F48 A;  3F21 A;  3B81 A;  4P9U A;  5CW8 A;  5BQT A;  2CSO A;  2DA6 A;  4LLG F;  2W24 A;  2RKH A;  2VOP A;  4BHC A;  4IRG A;  1ZAR A;  1YQA A;  2Q2E B;  2QYO A;  3TDU C;  2ZFU A;  1SAN A;  5LEJ A;  2GQQ A;  3JRI A;  3GZI A;  4IHX A;  1BI1 A;  3DTK A;  3I54 A;  3I0T A;  5F04 A;  2E7X A;  3OYG A;  2V1U A;  1R4M B;  4ANJ A;  1YG2 A;  2O8X A;  1ETX A;  2KKO A;  1WWX A;  1DGW Y;  1LVK A;  2FSW A;  4CCJ A;  5FKL A;  2UXU A;  4D7N A;  5J8F A;  1FSE A;  3FBN B;  5M5W J;  3K4J A;  3BHQ A;  5C4Y A;  1BR2 A;  4U9L A;  4R8H A;  3LNQ A;  2QA4 I;  5FHP A;  2N8G A;  4LG3 A;  3I59 B;  1MIJ A;  2EFQ A;  1KA8 A;  1KGS A;  4F3Q A;  4BHB A;  5J3L A;  4YFN F;  3KEY A;  3OIQ A;  2Z1D A;  3HM5 A;  1YJW I;  1HA8 A;  2MGQ A;  5J47 A;  3HGG A;  3S14 J;  1G3S A;  5F0C A;  2G7L A;  2HQ5 A;  3RKW A;  2Z16 A;  4BBS J;  3ZMU A;  1SGM A;  3HJE A;  1BIB A;  3OR2 C;  3HPG A;  3QWL A;  2IGM A;  2JUC A;  2DJI A;  1UMQ A;  5JVG F;  3QP5 A;  1MJA A;  4RBO A;  1EH7 A;  4BEH B;  3DP7 A;  1S7E A;  2GM4 A;  3OL3 A;  2RQQ A;  4CZC A;  3BRO A;  2JVG A;  2QZ8 A;  1GDT A;  1Q1H A;  4N0B A;  2GEN A;  3S15 J;  4P1W A;  1I3Q J;  2MW8 A;  3CCV I;  1A36 A;  4XLP F;  5IT9 K;  4E7K A;  1XD7 A;  1Y0N A;  2OD5 A;  4S04 A;  3I64 A;  5F64 A;  3RJP A;  3DQV C;  4RA2 A;  3KZZ A;  2CW0 F;  5IYB J;  2X48 A;  5FRM A;  2DFI A;  3BNI A;  4ZYE A;  1MBG A;  3ASN H;  1Z7U A;  5K5Q A;  2OQG A;  1YS7 A;  3SFZ A;  4G9Y A;  2EFW A;  1T98 A;  3GCM A;  2CV1 A;  1DPR A;  3MKW B;  1RZ4 A;  2FJI 1;  2E71 A;  5E3M A;  3B6C A;  3L7W A;  3NRV A;  2G7G A;  2HKO A;  4CHU A;  3CO7 C;  1JI8 A;  4ZYH A;  3HTS B;  4LFU A;  3K70 D;  4HG2 A;  2F5E A;  2IPQ X;  3D5R C;  2I8D A;  3PJR A;  4A3K J;  3L2V A;  2ZFW A;  1GT0 C;  2I10 A;  3VOK A;  3E6D A;  3KFW X;  3RIR A;  5ERI A;  3ZMD A;  2NS0 A;  4EV0 A;  1BIA A;  3Q0V A;  3IRQ A;  5E3O A;  1FT9 A;  2PN6 A;  3ANG A;  4GCK A;  2VL8 A;  3GFI A;  1YJN I;  1FBU A;  4KJZ A;  4PFP A;  3I4N J;  2O61 A;  2HOT A;  2FOW A;  2G7U A;  5DUI A;  1WQ2 A;  5EZG A;  1Z9C A;  2P8T A;  3H0D A;  1Z1D A;  2DA4 A;  4M71 A;  2NP3 A;  2PMU A;  5CLS A;  2VKV A;  4HQM A;  4RM2 A;  1UJ8 A;  1R1T A;  3CO6 C;  1DDN A;  1OCT C;  3R60 A;  5EDN A;  3FKJ A;  1XDS A;  1K78 B;  2HPM A;  4MNU A;  5L3E A;  4PK4 A;  1MW7 A;  2K27 A;  4G6T B;  3JRA A;  4PFO A;  3J7Y J;  3BJA A;  3KYD B;  2MLK A;  3QBM A;  2JWT A;  2ZB9 A;  3OS0 A;  3FXK A;  3E97 A;  4EMS A;  4AF5 A;  4BY1 J;  1XGS A;  3IKV A;  1IDY A;  4RAG A;  1DPU A;  2R7T A;  3QPH A;  5EYR A;  1BA5 A;  1U0J A;  3WTY C;  4FET A;  4XIC A;  3EPZ A;  1J2X A;  4I99 C;  4M9S A;  2CUZ A;  1YIT I;  3OYF A;  1R00 A;  5K5R A;  2KZV A;  3KP4 A;  3TDZ C;  2PBI A;  3ZQH A;  4GYG A;  3QKX A;  4C3H J;  2GOX B;  3TBI A;  1IDZ A;  1A6Q A;  1XGO A;  4KT5 C;  2CS3 A;  4FT8 A;  1U5T A;  2ICW G;  2FBQ A;  2FBI A;  1L0O C;  2O0Y A;  2QKL B;  2GZW A;  3F6O A;  3JSP A;  4A0X A;  2JQ7 A;  2HVR A;  3GZN B;  1NK2 P;  4E7Z A;  1B4A A;  1LNW A;  1XPX A;  4HF1 A;  2L9R A;  1VQ6 I;  2A5Y B;  2NXN B;  4UV9 A;  4DGW B;  5HVQ C;  2CO5 A;  3EUH A;  2WV0 A;  2VAS A;  1JKR C;  3SZG A;  3B73 A;  3BC8 A;  1KON A;  2Z2S B;  2H09 A;  2R7D A;  4IRV A;  3LOC A;  2HR3 A;  3HZJ A;  2BY2 A;  3OMY A;  3FKI J;  3Q3S A;  3RSN A;  3SHF A;  2CUF A;  2DI3 A;  2E1C A;  1FP1 D;  4FIS A;  5JI6 A;  2DA5 A;  1DU6 A;  2DCE A;  3BR5 A;  5GAE J;  4N9I A;  1B8I A;  3RDI A;  1W1W E;  5LGT A;  1ZEL A;  4I01 A;  4NC6 A;  2HOE A;  1BW6 A;  1DGR M;  2CQ7 A;  3IH4 A;  3HRM A;  4KIG A;  1P9Q C;  3AKZ A;  3COA C;  3PQJ A;  3VOE A;  2CH0 A;  1S7O A;  4FAS D;  2HXO A;  2XRL A;  3OYH A;  1Y56 A;  4MEY F;  2OTL I;  1GXQ A;  2QWW A;  1X1A A;  3C2B A;  4U0V A;  1IO2 A;  1MMS A;  3CDL A;  2Z33 A;  1LJ9 A;  3GF2 A;  4W97 A;  1J59 A;  3LJL A;  1P7I A;  2NNN A;  1R23 A;  1WJB A;  1U8B A;  2YPR A;  4A93 J;  2WA0 A;  3GTQ J;  3HSE A;  4EQQ A;  2A2F X;  3R0J A;  1MNE A;  4MGR A;  5LRR A;  5DM6 F;  4RAY A;  2ID6 A;  5BPI A;  2XSD C;  3RKQ A;  2VJI A;  2XIG A;  4ZZL A;  4ON0 A;  5CPR B;  3PFI A;  4OMY A;  1Z6R A;  3Q9S A;  1V5G A;  2M30 A;  3BTJ A;  1U2W A;  2XPW A;  3A03 A;  5KAF C;  4YZE A;  4JX6 A;  3SZP A;  4EGY A;  1FOW A;  3V6G A;  2IT0 A;  2K9L A;  1MSF C;  3CP2 A;  4M6X A;  2KP6 A;  2ZNY A;  4WXC A;  3NWT A;  1F9N A;  5LLQ A;  1MNM C;  2LKX A;  1ETW A;  2PJP A;  3FF5 A;  2V79 A;  1VZ0 A;  2QVO A;  4ZDL A;  4EJV A;  4FE7 A;  3PO3 J;  1D1A A;  3GTP J;  4UV8 A;  5F1R A;  4HEA 2;  4BQN A;  3M3Y J;  3Q0W A;  5EEG A;  3EUK L;  1S5L C;  5EGO A;  1S9H A;  2VI6 A;  4Y17 A;  1W36 C;  4A3L J;  1SEU A;  2FF4 A;  2DT5 A;  1ZLJ A;  3F8B A;  2E2J J;  2L01 A;  2HOA A;  2HYF A;  1SFO J;  1HCR A;  2OA4 A;  4IPA A;  1A35 A;  1PVE A;  3R4K A;  5HLT A;  3BCA A;  1T8I A;  4LB5 A;  3I71 A;  2TDX A;  2CGP A;  3AQT A;  3OY9 A;  2IVM A;  3BR6 A;  2EH3 A;  2HKU A;  2OCC H;  1T56 A;  2HPI A;  1ONV A;  2UUZ A;  2ZXH A;  3BDD A;  3N05 A;  1RI7 A;  1BC7 C;  1EF4 A;  4XM3 A;  1MND A;  3DLL F;  1X4O A;  1QHG A;  1YW9 A;  2CFO A;  4S05 A;  3CLO A;  1FOY A;  1B6A A;  4U7B A;  3JRC A;  3OV8 A;  2XC7 A;  1GHC A;  1FZP B;  5DM7 F;  3E5X A;  1YTY A;  2J5P A;  3RYP A;  1G6N A;  1MZB A;  4UY8 I;  2E1N A;  2A6E F;  1UEL B;  3QRF F;  2V1N A;  2X6X A;  4DOZ A;  4XLE A;  2QQ8 A;  1A31 A;  1ACI A;  2P5L C;  5DCM B;  2LH9 A;  3LSK A;  2RAE A;  2DDA A;  4CZZ A;  1PP8 F;  4LMY A;  3CJR B;  2F4O B;  2JMW A;  2LD5 A;  2IU5 A;  3WOD F;  1H9G A;  3GZ5 A;  2AS5 F;  1ETO A;  1K4S A;  1F5T A;  1R22 A;  2LK2 A;  1LQ1 A;  4EJO A;  2DAO A;  1XB4 A;  3NWS A;  3K70 C;  5CYV A;  4A3E J;  1PUE E;  2V6C A;  2VOD A;  2E34 A;  2XKO A;  3E5Q A;  3GLX A;  2XAU A;  4UUS B;  1B72 A;  1XMK A;  2A05 A;  2LY2 A;  3WE2 A;  5E1W A;  2FQ4 A;  3HGY A;  1TT0 A;  2MG4 A;  3G2B A;  3GW2 A;  4U0Y A;  2ECB A;  1D5Y A;  4MXM A;  2KDZ A;  1I39 A;  1W0U A;  4WIB A;  2A61 A;  2BHY A;  3A01 B;  2PMZ N;  4AYB N;  3J80 Z;  3BQY A;  4YII A;  4ENN A;  3GWZ A;  3TMO A;  4YEL A;  2QBY A;  1FSH A;  2XB0 X;  1MMG A;  1HXD A;  1XMA A;  4J19 A;  3RZD J;  1I3A A;  5IYD J;  1YFH A;  4DW6 A;  3SQN A;  2M4K A;  4LIV A;  5AIP A;  2DOE A;  4PJN A;  1OIS A;  1MBE A;  1SAX A;  4XBF A;  4A3J J;  3WHB A;  3G3Z A;  5B66 C;  4A5N A;  4UXN A;  3DPU A;  3A0H C;  3M9A A;  1ODD A;  4EVI A;  5TRD A;  4C2T A;  1BOB A;  4NUB A;  2VBZ A;  4UB8 C;  3CMA I;  1D3Y A;  3HOW J;  4HNV A;  3CUQ A;  3OYC A;  5L3G A;  2DPD A;  3IKT A;  3F72 A;  1ZR2 A;  2DTR A;  3H5N A;  3G1O A;  4XSZ F;  1FBQ A;  1U9O A;  2REK A;  4CIC A;  2STW A;  3W6K B;  4OU0 A;  2NVY J;  3C7J A;  2E19 A;  2ISZ A;  2CQK A;  2BY1 A;  5E8G A;  4V2F A;  3BZK A;  1IXS B;  4DYC A;  3BG5 A;  3BQZ A;  2LBF A;  2M7B A;  2RGV A;  2LRD A;  3KYL A;  2HEO A;  4WWC A;  4WXH A;  1EV7 A;  1X2N A;  4A6E A;  5JLW A;  1OCZ H;  2K3F A;  2OUM A;  3T5X A;  1I5Z A;  5EF6 A;  5HNF A;  2CMP A;  3HOZ J;  4BEH A;  2EB7 A;  1FTZ A;  3ZP5 A;  2DQL A;  3GO5 A;  1X1P A;  2M0C A;  2Z5U A;  1WJE A;  1RR8 C;  3ZXS A;  4WCG A;  1T0F C;  4XRM A;  1ZTR A;  1VQ8 I;  4GCT A;  2HDD A;  1UHM A;  3KZI C;  5M5X J;  4EM0 B;  2IS6 A;  3K2A A;  4KIT B;  2P5K A;  3LSH A;  2ZJR F;  3ON4 A;  3H3V K;  2DDB A;  3WG9 A;  3O8H A;  4HNT A;  5D5V B;  3CCS I;  1SC7 A;  1X19 A;  3ABK H;  3C2G A;  1X3U A;  4M9Z A;  2XGD A;  2VT3 A;  3CCE I;  3DKW A;  1APL C;  2BEO A;  3CMY A;  2VOO A;  2M34 A;  2PBX A;  1Z67 A;  2BW3 A;  2O03 A;  4P9F A;  2HQR A;  3QPL A;  1U6G A;  4NHJ A;  4G6D A;  1V55 H;  1W0T A;  4IHV A;  2KIF A;  4LG0 A;  1VQO I;  1NK3 P;  2M1B A;  1PUF A;  5HOD A;  2OZU A;  3PUF A;  4ZDP A;  1SD5 A;  3LSP A;  3CME I;  3TP0 A;  4AD9 A;  4UUV A;  4BKX A;  1Y8R B;  3OYN A;  1YOV B;  2MSY A;  3KYC B;  2H6C A;  3SYT A;  4JK1 X;  3GTJ J;  2H94 A;  1WCM J;  5H9T A;  2XF6 A;  3H3Z A;  2FQ3 A;  4B3X A;  1OYI A;  3RQI A;  4Q48 A;  2KFD A;  2PEX A;  1YW8 A;  3CC2 I;  2K9N A;  4G7Z F;  4F55 A;  5M5Y J;  1G3W A;  5EJC A;  1REP C;  3M1E A;  5F1J A;  2D45 A;  4L5E A;  2EQR A;  4X1E A;  3M8F A;  4FCY A;  2FNP A;  2O8K A;  2XVC A;  2DQR A;  1POG A;  3PIP F;  3NI7 A;  1WHU A;  1A04 A;  2VBW A;  2BZT A;  1YI2 I;  3WU0 A;  3GBG A;  1WJF A;  4WXD A;  2WB1 N;  1K78 A;  3DPJ A;  2K7L A;  2KMU A;  3EYY A;  4E7I A;  3AG1 H;  4A3M J;  5CVV A;  4E7L A;  4M9X A;  3KPH A;  4A3I J;  2OQR A;  3W2V A;  3V4G A;  1FYM A;  2R7V A;  4PZJ A;  2IA0 A;  1KYW A;  5LHH A;  3RI4 A;  3HTA A;  2K4B A;  2H8R A;  3S8P A;  4DBR A;  4CCM A;  3K8P C;  2EFO A;  3QP6 A;  3D5L A;  3FRQ A;  1QA6 A;  1UB9 A;  3BPV A;  3L9F A;  3WTX C;  5HLI A;  2ZCX A;  5HNH A;  5J1Y A;  1N77 A;  1GVD A;  2JRM A;  1W7P B;  1FLI A;  3HBL A;  3LQQ A;  4C2U A;  2ID3 A;  3NQO A;  4DYQ A;  5HSZ A;  1OYW A;  4KWA A;  4O5V A;  4F91 B;  5A2Q K;  3KEQ A;  3E6B A;  4ZZD A;  1O57 A;  2V26 A;  1AU7 A;  2BGC A;  2JJ7 A;  2MH2 A;  2RV8 A;  2XGX A;  3AL0 B;  2OC6 A;  4ESJ A;  2ECC A;  4M74 A;  5C44 J;  4XID A;  3TO9 A;  4XSX F;  4PJM A;  2ZME B;  5HDN A;  1QZY A;  1W5S A;  2XGC A;  2RC4 A;  2YX4 A;  4FTH A;  1MMN A;  1KQ8 A;  3PAS A;  5D8K B;  4QSH A;  4E70 A;  5F08 A;  1SD4 A;  2MFZ A;  2A5W A;  5C4J J;  1WZ2 A;  3QQA A;  1O3T A;  1W4M A;  2VKH A;  4JX5 A;  3BG3 A;  2B3W A;  1TP4 A;  5FD6 A;  2R93 J;  1D8J A;  5J4Y A;  2WBM A;  1CQT A;  4BUP A;  5EG0 B;  1EA3 A;  2IS4 A;  3LA7 A;  2OI8 A;  5E18 F;  3H5A A;  3NPI A;  3ZN1 A;  3PUB A;  2XPU A;  3HEF A;  3W2A A;  1ORK A;  3CZ6 A;  3O3K A;  3TQN A;  5FLX K;  1XSV A;  1RC9 A;  2NVT J;  5DUK A;  1QU3 A;  1FEX A;  1YW7 A;  2EZI A;  3JRH A;  2M7A A;  1UG2 A;  2HZT A;  4CUG A;  5FGM A;  1VND A;  5D4R A;  4ENK A;  1KU2 A;  5B5E C;  1IAW A;  3NXC A;  4IQJ A;  3HC7 A;  2UZK A;  3BG6 A;  4HF2 A;  2A6H F;  2V9K A;  3IHU A;  1VQ7 I;  3G4S I;  2E1M C;  2IGO A;  5IPA A;  3CWR A;  3D1N I;  2KIM A;  1S72 I;  3QYF A;  4DVY P;  1BR1 A;  1MBH A;  1PYV A;  3GTO J;  3P7N A;  3QU3 A;  3SXY A;  1VF9 A;  5GTH C;  4PSW A;  4BS9 A;  3VOD A;  2WAE A;  5K7Z A;  4IHS A;  3QU6 A;  4DQ2 A;  5GAH J;  1CF7 B;  3U1D A;  2MC3 A;  2UXH A;  1OCR H;  1XDU A;  4JNN A;  1W5C C;  2NAZ A;  1AWC A;  3JRF A;  4XKV A;  2VLA A;  4M3E A;  2PQ8 A;  3K10 A;  4HYE A;  2MH9 A;  3I4P A;  3CJQ B;  2Y0S A;  3P9C A;  3OYI A;  5DDG A;  2IRF G;  1GV2 A;  4X0G A;  2GXB A;  4OWR B;  4KN4 X;  4ICH A;  2YR2 A;  2B0L A;  2HVQ A;  2CYY A;  1TBX A;  4EJU A;  1MDM A;  3E7L A;  4IVN A;  1JT0 A;  5K7F A;  1LUJ B;  1QVU A;  3G73 A;  2XF7 A;  3VEP A;  1K61 A;  2ZBK A;  3ZMT A;  1HOM A;  3VW0 A;  1Z3Y A;  2M87 A;  2XPV A;  1BI2 A;  1SAU A;  3HIM A;  1IXC A;  4NN1 A;  1X1C A;  2R5Y B;  1AKH A;  1Y8Q B;  4QPQ A;  4IZZ A;  3FXO A;  4YFK F;  1QPM A;  2HXI A;  3GEZ A;  2P81 A;  2D1V A;  4MTE A;  4RLQ A;  1E3H A;  2RQP A;  2R5Z A;  4BE2 A;  2DMU A;  5E17 F;  1NG7 A;  1P4W A;  1P4A A;  4PDK A;  2Y9Y A;  1HW2 A;  3U1K A;  2DXI A;  4KIC A;  4IF4 A;  1R6R A;  4OOI A;  2PZ9 A;  4KMU X;  1UHW A;  1JE8 A;  3S93 A;  4C3J J;  3SZT A;  1IW7 F;  1KU3 A;  1WJ5 A;  4KFC A;  2FML A;  1XX5 A;  3K69 A;  3GTK J;  2KLO A;  4ITV A;  4AU7 A;  2FXA A;  2QOP A;  3CQZ J;  4DJA A;  1R7J A;  5D4S A;  3A1Y A;  1YHQ I;  2W4S A;  5D8L B;  1STZ A;  3K4C A;  4HDV A;  4I0A A;  3GXO A;  4QWQ A;  4KYW A;  2B7E A;  2HKX A;  5DCM A;  2QCO A;  3DWL E;  3GYH X;  2H6B A;  3HE0 A;  1WI3 A;  3V8K A;  3V8L A;  1L3L A;  1JT6 A;  2EFN A;  2WC2 A;  2WB1 A;  1G59 A;  3J81 K;  4HF0 A;  2PFV A;  4B43 A;  2DOD A;  5FJ8 J;  4NB5 A;  4DBQ A;  4PUS A;  3C18 A;  3B6A A;  2K9M A;  1A5J A;  5D19 A;  2X4H A;  4HV5 A;  2R7R A;  1R58 A;  4U9N A;  1RET A;  3ABU A;  2F5C A;  4C2M J;  1ZRD A;  1V5E A;  3OOU A;  2O5R A;  2JPC A;  3TOB A;  2ZJQ F;  4NQW A;  2E35 A;  3CCJ I;  4II3 A;  5H6R A;  3JTH A;  3ZQF A;  3L2R A;  1SFX A;  1LDJ A;  4OIP F;  2E5N A;  3GZ6 A;  2L9N A;  2ZCN A;  3L2C A;  3EYI A;  4MQV A;  1JUP A;  3RPQ A;  5DYM A;  1EJ9 A;  1BN5 A;  1LEB A;  3I58 A;  5L3B A;  2QSH X;  2GA2 A;  4G12 A;  1TWH J;  4XLF A;  5TJJ A;  4IHY A;  1WI9 A;  2JA7 J;  3KLN A;  3H0G J;  3ERE D;  4I98 B;  4RMN A;  4R79 A;  2HVS A;  1USS A;  3TW7 A;  1MMA A;  3WU2 C;  2GUH A;  2Y75 A;  3CF2 A;  1JJ6 C;  2EIM H;  2AXL A;  3LSM A;  1GVJ A;  3OYL A;  1Z0X A;  1FPQ A;  2BBY A;  1FMV A;  1N25 A;  2DA7 A;  4UUT A;  4XN0 A;  2XDN A;  1D5V A;  5J4V A;  2DA2 A;  2FBH A;  3E6M A;  2L7F P;  4LD5 A;  2XAJ A;  3VOX A;  2ZXW H;  4JBA A;  3TW6 A;  3E0J B;  2QSG X;  2K5C A;  3ML6 A;  1ENH A;  3P5J A;  4RGX A;  3QAH A;  2W85 A;  4XLA A;  4ZJZ A;  2ESN A;  4BAY A;  3LAJ A;  2LTP A;  4GDF A;  5LGN A;  4B44 A;  3K1P A;  4MIM A;  1ETK A;  3DBH B;  2CW8 A;  1MH3 A;  2ZSH B;  3OYB A;  2ZXJ A;  2QIB A;  4BAC A;  1R71 A;  3HRT A;  2YVX A;  5LFA A;  2WAQ N;  3WGH A;  1IXR C;  1TQI A;  3K0L A;  3FXJ A;  4Z6Y A;  1V54 H;  1X3Z B;  4RM3 A;  4BJT A;  3N4M A;  2BHZ A;  2E2I J;  2JZY A;  4YEJ A;  1HC8 A;  4B48 A;  1R4N B;  2LG4 A;  1K6Y A;  3E3V A;  1SVM A;  2YU3 A;  4XOT A;  3S2D J;  4AVZ A;  4A3G J;  3F9K A;  2FU4 A;  2VKD A;  1YRN B;  3P9T A;  1QPI A;  3BTL A;  1DP7 P;  2EWN A;  4DIQ A;  5IOY A;  1WRJ A;  1FBS A;  3F8F A;  4C9Y A;  5E79 C;  3QOE A;  2IEK A;  2JA2 A;  3ZCO A;  1K4T A;  2XRO A;  4CYC B;  4BBR J;  2VJ5 A;  3F22 A;  4L5I A;  4L9N A;  3VSL A;  4GYI A;  3AL0 C;  5M3M J;  2EFP A;  3OYE A;  2VB6 A;  1RUN A;  3REO A;  3G1L A;  3BLY A;  3KEO A;  5GTI C;  3DV8 A;  4QIW N;  2ZME C;  2XHK A;  3RZO J;  1X58 A;  1CGP A;  1VQK I;  1KYZ A;  2IA1 A;  1X1B A;  2A07 F;  3DU5 A;  1X4P A;  2L02 A;  1VFC A;  2OU2 A;  1UAA A;  1TT5 B;  4M3D A;  4BL0 B;  2O7T A;  1U9N A;  1ZRC A;  3CC4 I;  3KKC A;  1Q1V A;  1YE9 A;  3CCR I;  1S6L A;  4XLN F;  3S1M J;  3OS1 A;  2CV2 A;  2DK5 A;  3HUG B;  4U7D A;  2ESH A;  2GXG A;  1IN4 A;  4GGG A;  1YO5 C;  4LJZ F;  5J8C A;  1RKW A;  1OMI A;  3H5R A;  2IAI A;  3QPT A;  2HWV A;  4OAY A;  3U9G A;  1FX7 A;  3BOQ A;  3S1R J;  4CDG A;  2V1D A;  4RLF A;  1ZGA A;  1SVL A;  4G7H F;  3HTH A;  2HYT A;  3PNV A;  4EEF G;  4IKF A;  4KMF A;  5CQE A;  1FP2 A;  1Y0U A;  3AG2 H;  1E3P A;  2R7F A;  2ADU A;  1K6O A;  5DV5 A;  3VIB A;  3DEE A;  2YU9 J;  1PDN C;  1WPK A;  4ESB A;  3AAF A;  2D6Y A;  4O6J A;  5CKT A;  3GME A;  2COM A;  3VFZ A;  3VB2 A;  5KVR A;  1ETV A;  2KJB A;  2L7Z A;  3ONQ A;  1BI0 A;  2A3S A;  2WAD A;  3MN2 A;  5FKM A;  4Y13 A;  1C0W A;  1QGP A;  3FM3 A;  1HKS A;  4P55 A;  2GIV A;  2VC1 A;  3U21 A;  5B1A H;  3KKD A;  3HPH A;  2K9S A;  1MKM A;  1QO0 D;  2XKP A;  4K2E A;  2YSR A;  1S7A A;  5ICF A;  4A69 C;  5IOZ A;  3IL2 A;  4JQF A;  5KHD A;  2ZC2 A;  2NOG A;  3FMR A;  2HDW A;  4RGU A;  5K1Y A;  2QTQ A;  3V7S A;  1MMD A;  2IJL A;  1RES A;  2E60 A;  2Y2Z A;  1YLF A;  1FC3 A;  2LY1 A;  3FWE A;  2VQC A;  3QOP A;  2ELH A;  1B59 A;  2Q8K A;  5ICC A;  3HKZ N;  2P7C B;  1F1Z A;  2IP2 A;  2LYC A;  2LKS A;  5EZH A;  2G7H A;  3BR2 A;  2W53 A;  3M1C A;  4UVC A;  3VW2 A;  1FIA A;  4BU2 A;  4BE1 A;  1JGS A;  1ZG5 A;  2X6W A;  3ZGK A;  3BRU A;  3S1Q J;  2O7O A;  4X6A J;  1G4D A;  3JTG A;  3TKY A;  3QYB A;  3JRG A;  3COL A;  3PSI A;  2V9V A;  3EGQ A;  1SD6 A;  3HRU A;  3ESW B;  2QF7 A;  1OR7 A;  3FXM A;  3VVZ A;  3HHH A;  1O4X A;  3FK6 A;  1XTA A;  2DFH A;  5B3S H;  3T0Y A;  2K4J A;  4YRV A;  4ZYD A;  3ZN0 A;  2VON A;  2ZXI A;  3FBI B;  2M5W A;  1DUX C;  5D1R A;  2KIQ A;  1T95 A;  5F0F A;  1HLV A;  3JW4 A;  4ZYG A;  3BG7 A;  3T8R A;  3QOD A;  2FE3 A;  2E1M B;  2GFN A;  3HOT A;  3K2Z A;  3K4M A;  1UZC A;  1KZH A;  3F8C A;  1PP7 U;  3HXL A;  4O3M A;  4Q4Z F;  2DLL A;  2VQG A;  2DMQ A;  3V8J A;  5HS8 A;  2WGB A;  3PSF A;  2ACJ A;  2VPL A;  4A2U A;  2AXT C;  2W48 A;  1LE8 A;  1EH8 A;  2PFB A;  5DCF A;  3PIO F;  4HX4 A;  1WGX A;  4L9V A;  3IRR A;  1QVT A;  1VQM I;  3RQ4 A;  3SFI A;  4D1Q A;  1X2M A;  2HQA A;  1FYK A;  1G8X A;  3K7A J;  4HX8 A;  4C2M A;  2VE8 A;  3Q0U A;  2O3F A;  4LIT A;  4ZH4 F;  2B63 J;  2PJR B;  3MCZ A;  1SD7 A;  5K7H A;  1SMT A;  4CCK A;  4HAM A;  2R7U A;  3IUO A;  1IGN A;  4IQ4 A;  1NG6 A;  5CQG A;  4BXF A;  2WY8 Q;  3W6J B;  2YX7 A;  3IWF A;  5D5U B;  3K4B A;  2CJJ A;  1GLN A;  4L62 A;  4PJ0 C;  1J5Y A;  3HIF A;  1LPQ A;  2M3A A;  4AIK A;  4XN3 A;  2DN0 A;  3EUA A;  3LAP A;  1ZR4 A;  5E1Z B;  4A3F J;  4G94 A;  2DOF A;  4B09 A;  2F2E A;  2GIZ A;  2NVX J;  4IOC F;  2LRE A;  2ZJP F;  2TCT A;  3KLO A;  4ZTF A;  3E6C C;  2Q2E A;  5ILU A;  2WAQ A;  3FHZ A;  5GPA A;  3TED A;  1UST A;  2I5U A;  4PCQ A;  4U88 A;  2HGC A;  4I7H A;  4CCN A;  1V5F A;  2HTS A;  2FMY A;  3J7Z I;  2W00 A;  1VQ9 I;  4TV7 A;  2XF5 A;  1JGG A;  3HTI A;  3F8N A;  3A0B C;  3ASO H;  1NH3 A;  5KNL A;  3G56 A;  1TNT A;  1DQU A;  5D6F A;  5F27 A;  2DK8 A;  3WGG A;  1Y39 A;  1IV6 A;  4F52 A;  2RVC A;  3GFL A;  5HDK A;  3D5S C;  4OIN F;  1R36 A;  2WWY A;  2EA2 A;  4H0E A;  4RS8 A;  3DFG A;  4WX9 A;  1P4X A;  1ETQ A;  2X6Y A;  4EAT A;  2V4J C;  3I59 A;  4I76 A;  1E0E A;  5HAW A;  1AA7 A;  3DBR B;  4E7H A;  2JA6 J;  4HOB A;  4XKC A;  2QGU A;  3GTL J;  1UCR A;  1IN5 A;  3GX4 X;  3LSR A;  1U8R A;  1K79 A;  9ANT A;  1JHH A;  2LDU A;  4E7J A;  1ZRF A;  1IRG A;  2LSO A;  1TZL A;  3R6S A;  2C6Y A;  4A3B J;  2KL4 A;  3S2H J;  1Z6T A;  3GVA A;  3LWJ A;  3OOP A;  3ZPL A;  2ME0 A;  4EGZ A;  2GA1 A;  3LA3 A;  3KZ9 A;  1EKE A;  1OCC H;  1U5T B;  4YFX F;  3MKY B;  4GCL A;  1TW2 A;  2LVS A;  1J09 A;  1XC5 A;  2M8G X;  2G9W A;  1YS6 A;  3PNT A;  2Q1Z B;  1HDP A;  2M45 A;  2KT0 A;  5M3F J;  1QHH D;  4JKZ A;  4E4H A;  1QRY A;  2DA3 A;  4CA0 A;  3HOX J;  5LRS A;  3V7C A;  2CFX A;  3EET A;  1MJB A;  4QPO A;  3CTA A;  1GXP A;  2D1H A;  1FNN A;  2LF8 A;  1FOX A;  1D1B A;  2MD0 A;  4M6Y A;  1ON2 A;  3JAM K;  4RDU A;  2M9H A;  1SFU A;  1A6I A;  1XG1 A;  4XR6 A;  2ELK A;  1F43 A;  4BNC A;  6PAX A;  3P9K A;  3WE3 A;  3V78 A;  3J80 K;  4N4N B;  1TTY A;  4BYY A;  1B8I B;  4UVA A;  2VQL A;  2ZCW A;  5FGL A;  4KIF A;  1J9I A;  3S5R A;  2CUE A;  4XKW A;  1RPW A;  3CC7 I;  4EJT A;  3VVX A;  1BJZ A;  3K1M A;  4II2 A;  3ECO A;  2FX0 A;  3MKL A;  4BQQ A;  3TO7 A;  4WK8 F;  3H3U A;  2BVL A;  3ABT A;  2R7Q A;  4P5O A;  1VQP I;  3E7Q A;  1VI0 A;  3C2H A;  2H1K A;  1VQN I;  1O3Q A;  1RR7 A;  1X3W B;  2KIS A;  3OYM A;  3F8M A;  1IUF A;  3K4N A;  2NOJ B;  2A68 F;  5E3L A;  5JR3 A;  3HKZ A;  3MZY A;  2K86 A;  2HDC A;  2DYS H;  1WFX A;  3DCF A;  2VUM J;  3ROU A;  1ZGW A;  2L9S A;  4XKB A;  4ETS A;  4J00 A;  1JUM A;  1YIO A;  5FFZ A;  1OPC A;  1V3F A;  2EIN H;  1Z21 A;  4QLC U;  2FRH A;  5FLX Z;  3I55 I;  3R61 A;  1HBX G;  3T8T A;  1MBF A;  1XSX A;  2RNG A;  3AG3 H;  2FA5 A;  1FJL A;  4L9T A;  2VN2 A;  3OIO A;  3HDD A;  2L3D A;  3WTV C;  3HL2 A;  2DT7 B;  3MQ0 A;  3VTI A;  2LKP A;  3AG4 H;  4BDY A;  4U0W A;  2E2H J;  3ANP A;  1R5I D;  1LDK B;  1OCO H;  1V4R A;  2AO9 A;  4KA4 A;  4CCO A;  2LOO A;  3NNR A;  4XK4 A;  1HQC A;  3DTE A;  3OWT A;  2B9S A;  3I3L A;  2DMN A;  1ZGJ A;  2XRN A;  3ZQG A;  1T33 A;  2DFE A;  5KAI C;  4BE0 A;  4GFL A;  4LGW A;  3ISP A;  3V42 A;  5CXG A;  4LOC A;  2DO7 A;  5AON A;  4IEJ A;  5EGO B;  4E6K G;  2HYG D;  2HU9 A;  5LD2 C;  1BC8 C;  4ASN A;  2RHA A;  2EK5 A;  2IA2 A;  4PGH A;  3NAU A;  5ILV A;  2EZH A;  4IXA A;  1OFC X;  3IUV A;  3S2W A;  4YIF A;  2HYJ A;  1Z05 A;  4D0P A;  3I4M J;  3BY6 A;  1D0X A;  1XGM A;  4JL3 A;  3DPL C;  3M07 A;  4R1H A;  3MD2 A;  5CVR A;  2Y31 A;  4ENJ A;  1OCP A;  4AM3 A;  4KDP A;  1P6R A;  3A4C A;  5HS9 A;  3OSF A;  1UI5 A;  3IC7 A;  2NNY A;  1J7K A;  4EM2 A;  1I50 J;  3KP6 A;  2PMZ A;  3I9V 2;  3K1N A;  4AYB A;  1YX5 A;  1X1D A;  2ZOZ A;  3UR3 C;  1KQ0 A;  1HSJ A;  1I6X A;  3RPU A;  2DMP A;  1JTY A;  4EM1 A;  2UXO A;  2CV0 A;  3LSI A;  1O3S A;  4D5C A;  2QWT A;  2FEZ A;  2VC0 A;  3V7R A;  2HFH A;  2YVH A;  4AVP A;  4NC7 A;  1T39 A;  1QZZ A;  4JX4 A;  2W84 A;  3IP4 B;  3J7A Y;  4B47 A;  2H8W A;  2STT A;  3FM5 A;  2A6T A;  1TNS A;  3IH2 A;  3U2R A;  5ICG A;  1TW3 A;  5JVT A;  1XS9 A;  4HRI A;  1ZH5 A;  2NYX A;  2FNA A;  2VJ4 A;  2XDV A;  2FD5 A;  4HST A;  3CUO A;  4XRS A;  4L9J A;  4ESF A;  5IP7 J;  4YG2 F;  3FMQ A;  2XUB A;  3CDI A;  4JOM A;  3CCU I;  3CF5 F;  2L54 A;  2BOL A;  3VYS B;  2LC2 A;  5FKK A;  1IF1 A;  4BQO A;  1MD0 A;  4I2O A;  5IT9 Z;  1ZYR F;  3VVY A;  2XSJ C;  1WJC A;  4U87 A;  2L9V A;  2UV1 A;  1B72 B;  1B1B A;  2RNJ A;  3H9Q A;  5CJ9 A;  2H27 A;  4I6Z A;  1VTN C;  2ZO4 A;  5FRN A;  4KIB A;  2Q24 A;  4XRF A;  4XL9 A;  4LLN A;  3KNW A;  1MJ9 A;  2X6O A;  3M8E A;  4MLO A;  4Q5S F;  2DMT A;  5DD8 A;  3T1B A;  5IP9 J;  3L2U A;  2COB A;  3ZQQ A;  3CCQ I;  2ZKZ A;  4W1U A;  5DAJ A;  1D1C A;  2XAH A;  2R7W A;  1XN7 A;  1RUO A;  2X51 A;  2WV1 A;  1LFB A;  2HTJ A;  2K85 A;  4HW0 A;  3DPT A;  3LSG A;  4DZJ A;  3K4L A;  1NHA A;  2JN6 A;  2CW7 A;  3BP8 A;  4Z2Y A;  3WU1 B;  2QBY B;  1RKT A;  3ZQC A;  4M3F A;  3ZQI A;  3S1N J;  3J81 Z;  3ZQL A;  2VPR A;  5HS7 A;  3BR3 A;  3JRD A;  3RYR A;  3M4O J;  3FDY A;  3H9G A;  3S3M A;  1RRJ A;  2HS5 A;  3BTC A;  1XGN A;  1ZAO A;  1I27 A;  2V6E A;  2B1E A;  2X9D A;  3HSF A;  3VYR B;  2RN7 A;  4I09 A;  4AUX A;  4DYR A;  3C07 A;  2L7K A;  3FIW A;  2EIK H;  4G8X A;  2L4M A;  2QM3 A;  3CUQ B;  3HOS A;  4MEX F;  1FY7 A;  3OYK A;  2KRH A;  4GFK A;  4RB3 C;  1ZN2 A;  1HF0 A;  3G7R A;  1H8A C;  2GOM A;  3ZQ7 A;  3I5U A;  2OZ6 A;  2NS7 A;  4ZC3 A;  3H1C A;  3FXU A;  1J0R A;  3OYD A;  1LDD A;  2HQN A;  2M4G A;  1W36 D;  1K7A A;  1OJL A;  4M72 A;  2UXI A;  5D6E A;  2CRG A;  2X1D A;  2M0M A;  1IC8 A;  3AQS A;  4OD5 A;  2LBF B;  1IZ1 A;  3H92 A;  5E20 A;  1O7L A;  2X0L A; 
#chains in the Genus database with same CATH homology
 3BG9 A;  2LR8 A;  4QIW N;  3RZO J;  1X58 A;  3DEW A;  2YS9 A;  3HOY J;  2QKO A;  2XB0 X;  2EZK A;  4ME9 A;  1VFC A;  3GTG J;  4NDL A;  2LP0 A;  1HDD C;  3IH3 A;  4M3D A;  2O7T A;  3QPS A;  4J19 A;  1U9N A;  2YUS A;  3RZD J;  4A3C J;  1Q1V A;  5IYD J;  3KKC A;  4DW6 A;  3S1M J;  2M2E A;  3WHC A;  2L0K A;  2CQX A;  1MBE A;  2OPT A;  3O8G A;  1FTT A;  1RKW A;  4A3J J;  3WHB A;  2IAI A;  1AHD P;  2NVQ J;  3G1M A;  3S1R J;  3JRE A;  3MNL A;  4AC6 A;  3HTH A;  2IBD A;  2EZL A;  1GV5 A;  2HYT A;  4EEF G;  1MBJ A;  3BJB A;  3OSG A;  4AC0 A;  3HOW J;  4HKU A;  4HNV A;  3JRB A;  3VIB A;  1K83 J;  2YU9 J;  1ZR2 A;  3HTJ A;  1WPK A;  3G1O A;  1GUU A;  1YRN A;  2R0Q C;  1BL0 A;  2D6Y A;  1ITY A;  1U9O A;  2DJN A;  1TWG J;  1TWC J;  4UUS A;  1MSE C;  2REK A;  4DZP A;  1ETV A;  2NVY J;  3BR0 A;  1IRZ A;  3SJM A;  2L7Z A;  1PUF B;  2E19 A;  3JSJ A;  3MN2 A;  5FKM A;  2V57 A;  5EFY A;  4V2F A;  3F0C A;  4DYC A;  4CYC A;  2VKE A;  3BG5 A;  2K9Q A;  1F36 A;  3BQZ A;  5DTD A;  3LHQ A;  2ME6 A;  3A01 A;  2OER A;  2R7Z J;  4CGR A;  1WH7 A;  1X2N A;  3KKD A;  4BXX J;  2K9S A;  4JYK A;  5JLW A;  3RD3 A;  2YVE A;  1LE8 B;  5EF6 A;  4A69 C;  5IOZ A;  4IHW A;  3HOZ J;  4A3D J;  3SDG A;  2G3B A;  2NOG A;  2QTQ A;  1FTZ A;  1RES A;  2M0C A;  2Y2Z A;  4B4C A;  3CJD A;  4XRM A;  1ZTR A;  3HKZ N;  4GCT A;  2JA5 J;  2HDD A;  4GFB A;  1WH5 A;  5EZH A;  5M5X J;  1MH4 A;  3BR2 A;  2W53 A;  3K2A A;  3VW2 A;  1FIA A;  1R9T J;  4M3G A;  3ON4 A;  3H3V K;  3BRU A;  1JKQ C;  3S1Q J;  3O8H A;  2O7O A;  4X6A J;  3B81 A;  5K58 A;  1JKO C;  5CW8 A;  3JRG A;  2XGD A;  2DA6 A;  3W6V A;  3COL A;  3EGQ A;  1APL C;  2QF7 A;  3VVZ A;  3CMY A;  2M34 A;  1O4X A;  3FK6 A;  2PBX A;  5JLX A;  3QPL A;  1E3O C;  3S16 J;  1Z77 A;  1W0T A;  4IHV A;  5D1R A;  2WUI A;  1NK3 P;  1PUF A;  5F0F A;  1HLV A;  5HOD A;  1SAN A;  3JRI A;  3LSP A;  3GZI A;  4IHX A;  3GTM J;  3TP0 A;  5F04 A;  4BKX A;  2GFN A;  2MSY A;  1ZK8 A;  2DTZ A;  5IYC J;  3GTJ J;  1ETX A;  1WCM J;  3LSJ A;  5H9T A;  2DMQ A;  3F1B A;  2WGB A;  5FKL A;  2UXU A;  2W48 A;  1LE8 A;  4D7N A;  3RQI A;  1WGX A;  5M5W J;  3BHQ A;  5C4Y A;  1QVT A;  1P7J A;  3SFI A;  1X2M A;  2K9N A;  2RAS A;  4Y7N J;  5M5Y J;  3LNQ A;  3K7A J;  3MVP A;  5CXI A;  1U78 A;  5FHP A;  2N8G A;  5F1J A;  3Q0U A;  4L5E A;  2EQR A;  2B63 J;  4X1E A;  4FCY A;  3BT9 A;  2O8K A;  5K7H A;  5J3L A;  1NTC A;  2R92 J;  1IGN A;  1POG A;  5BNG A;  3HM5 A;  2MGQ A;  3HGG A;  3S14 J;  2G7L A;  5F0C A;  3NI7 A;  2HQ5 A;  5FMP A;  2CJJ A;  2NP5 A;  3GBG A;  4L62 A;  3DPJ A;  2WB1 N;  4BBS J;  1SGM A;  1MBK A;  4A3M J;  2DN0 A;  1ZR4 A;  4A3F J;  1UMQ A;  4A3I J;  4RBO A;  2ZCM A;  2NVX J;  1H88 C;  2TCT A;  2XB5 A;  3HTA A;  1S7E A;  2GM4 A;  2H8R A;  3TED A;  5GPA A;  1GDT A;  4NEL A;  2GEN A;  3S15 J;  1I3Q J;  2MW8 A;  1UHS A;  3FRQ A;  1H89 C;  4JP0 A;  2ZCX A;  5GPC A;  5J1Y A;  1DU0 A;  1GVD A;  1JGG A;  3UKG A;  2JK3 A;  3HTI A;  3HBL A;  2ID3 A;  4DYQ A;  5HSZ A;  3G56 A;  4D5F A;  4KWA A;  5F27 A;  3ON2 A;  5IYB J;  3HOV J;  2X48 A;  1IV6 A;  3BNI A;  1AU7 A;  1MBG A;  2JJ7 A;  3S17 J;  2CU7 A;  2ECC A;  5C44 J;  4XID A;  1ETQ A;  4I76 A;  5HAW A;  2XGC A;  1LFU P;  4FTH A;  5E3M A;  2JA6 J;  3B6C A;  3GTL J;  2G7G A;  3PAS A;  9ANT A;  3LSR A;  1BW5 A;  4QSH A;  5F08 A;  1TWF J;  4A3B J;  5C4J J;  3QQA A;  3S2H J;  4JX5 A;  2D5V A;  3BG3 A;  4A3K J;  5IP6 A;  2R93 J;  3LWJ A;  1CQT A;  1GT0 C;  5EG0 B;  2I10 A;  2ME0 A;  2OI8 A;  3VOK A;  5F0H A;  3KZ9 A;  3NPI A;  3Q0V A;  1UI6 A;  2XPU A;  3HEF A;  3BCG A;  1ORK A;  5E3O A;  4GCL A;  3ANG A;  2LLK A;  4GCK A;  2LVS A;  1XC5 A;  3I4N J;  2M8G X;  4MK6 A;  5C4X J;  4BY7 J;  2HOT A;  2NVT J;  1HDP A;  5EZG A;  2KT0 A;  5M3F J;  4JKZ A;  1QRY A;  1FEX A;  2DA4 A;  2EZI A;  2NP3 A;  3JRH A;  2DA3 A;  3HOX J;  5FKN A;  1UG2 A;  2VKV A;  3VP5 A;  3PO2 J;  1VND A;  2NS8 A;  2LFB A;  3NXC A;  5GP9 A;  1TC3 C;  1OCT C;  5EDN A;  2ZOY A;  2O9L A;  4RDU A;  2M9H A;  1A6I A;  1XG1 A;  2ELK A;  1AKH B;  1F43 A;  3JRA A;  5IPA A;  5HBU A;  3CWR A;  3D1N I;  3V78 A;  1MBH A;  3RH2 A;  2R5Z B;  1B8I B;  3QBM A;  2JWT A;  2ZB9 A;  3GTO J;  4AF5 A;  5FGL A;  4BY1 J;  1VF9 A;  2K40 A;  1IDY A;  3S5R A;  2CUE A;  2LY9 A;  1RPW A;  1JKP C;  2F07 A;  3NRG A;  1TWA J;  3VVX A;  5EYR A;  1BJZ A;  4FE4 A;  4XRS G;  1BA5 A;  3ZOB A;  5K7Z A;  1Y1V J;  4C3I J;  4XIC A;  5J1U A;  2FX0 A;  3MKL A;  2NX4 A;  4UDS A;  2UXH A;  4B3A A;  3ZQH A;  3E7Q A;  5EG0 A;  3QKX A;  4JNN A;  1VI0 A;  2TRT A;  4C3H J;  2H1K A;  3JRF A;  1IDZ A;  1RR7 A;  4M3E A;  3GEU A;  1ZQ3 P;  1IUF A;  5E3L A;  4QTR A;  3JR9 A;  2FBQ A;  1GV2 A;  3DCF A;  4ICH A;  2VUM J;  1ZGW A;  1NK2 P;  1JUM A;  3E7L A;  1JT0 A;  2L9R A;  5K7F A;  1QVU A;  3HOU J;  1K61 A;  1JKR C;  1HOM A;  3VW0 A;  5FKO A;  1JUS A;  1MBF A;  3LOC A;  2XPV A;  1FJL A;  3HIM A;  3FKI J;  3OIO A;  3HDD A;  4NN1 A;  3Q3S A;  5D18 A;  1AKH A;  2R5Y B;  2CUF A;  2E2H J;  2XGE A;  3ANP A;  4FIS A;  2HXI A;  3HB9 A;  2DA5 A;  2AO9 A;  2P81 A;  1DU6 A;  3NNR A;  4XK4 A;  2CQQ A;  3BR5 A;  2R5Z A;  2DMU A;  5DS9 A;  4ABZ A;  2DMN A;  3BTI A;  3CCY A;  3ZQG A;  1B8I A;  3IV5 A;  2Y9Y A;  1T33 A;  3PM1 A;  4GFL A;  1BW6 A;  2L7M P;  3IH4 A;  3O60 A;  2OF7 A;  2PZ9 A;  2Y9Z A;  5CXG A;  4LOC A;  4M6V A;  4IEJ A;  3EUP A;  3BR1 A;  4C3J J;  5EGO B;  3A02 A;  2RHA A;  2GBY A;  2HXO A;  2XRL A;  3GTK J;  3NAU A;  3VUQ A;  2EZH A;  3C2B A;  1OFC X;  3TP3 A;  2QOP A;  3CQZ J;  3IUV A;  2HYJ A;  3I4M J;  5AQC A;  3PPB A;  3CDL A;  4JL3 A;  5J1R A;  2DA1 A;  2Y30 A;  4W97 A;  3LJL A;  1P7I A;  2Y31 A;  1OCP A;  1U8B A;  3OSF A;  4A93 J;  3GTQ J;  5C3E J;  2QCO A;  1UI5 A;  3HE0 A;  1WI3 A;  2DG8 A;  4ACI A;  1I50 J;  2ID6 A;  2XSD C;  3RKQ A;  1JT6 A;  2ZOZ A;  4M3B A;  2UXO A;  2DMP A;  1JTY A;  5FJ8 J;  3BTJ A;  4D7M A;  2XPW A;  3A03 A;  4D5C A;  2QWT A;  2HOS A;  4YZE A;  4JX6 A;  2YVH A;  4MFE A;  2R5Y A;  3VW1 A;  1ZKG A;  3B6A A;  1A5J A;  5D19 A;  1Y1W J;  3V6G A;  4JX4 A;  2G0E A;  1RET A;  1MSF C;  3FIS A;  3L1P A;  4C2M J;  2FJ1 A;  3OOU A;  1MNM C;  2LKX A;  1ETW A;  3VPR A;  3IH2 A;  3ZQF A;  4FE7 A;  1XS9 A;  3PO3 J;  3GTP J;  3M3Y J;  3Q0W A;  5EGO A;  2ZCN A;  2VI6 A;  2UXP A;  1JUP A;  2FD5 A;  4V2G A;  2JA8 J;  5FLV A;  4XRS A;  4A3L J;  5IP7 J;  3NAR A;  4G12 A;  2E2J J;  1FIP A;  1JJ8 C;  1TWH J;  2HOA A;  1SFO J;  5FKK A;  1HCR A;  4Y52 J;  4IHY A;  1G2H A;  2JA7 J;  3VVY A;  3H0G J;  3T6N A;  1B72 B;  3AQT A;  3BR6 A;  3TW7 A;  2GUH A;  4I6Z A;  2DG7 A;  2EH3 A;  2HI3 A;  2Q24 A;  2HKU A;  2Y0S N;  1JJ6 C;  1T56 A;  3KNW A;  2X6O A;  4MLO A;  2DMT A;  4B1R A;  5IP9 J;  1EF4 A;  2COB A;  1Z0X A;  4W1U A;  5DAJ A;  1ETY A;  2XDN A;  2DA7 A;  4UUT A;  2DA2 A;  2L7F P;  2WV1 A;  1LFB A;  5E3N A;  3JRC A;  3VOX A;  3TW6 A;  3LSG A;  4DZJ A;  1ENH A;  2JN6 A;  1RKT A;  3ZQC A;  4M3F A;  3ZQI A;  3S1N J;  3ZQL A;  2VPR A;  3JRD A;  3BR3 A;  2GLO A;  2LTP A;  3M4O J;  4MIM A;  1ETK A;  1MH3 A;  2AHQ A;  4MO7 A;  2QIB A;  3BTC A;  1I6H J;  2WAQ N;  1IG7 A;  2X9D A;  2RAE A;  4AUX A;  4DYR A;  3C07 A;  3FIW A;  2JMW A;  2LD5 A;  2E2I J;  2IU5 A;  3CRJ A;  1ETO A;  3S2D J;  4A3G J;  2LK2 A;  4PXI A;  4A3E J;  4GFK A;  1YRN B;  3P9T A;  5FLM J;  1QPI A;  3BTL A;  1HF0 A;  3G7R A;  1H8A C;  4UUS B;  4MFD A;  1B72 A;  5IOY A;  2G7S A;  2NS7 A;  3FK7 A;  2IEK A;  2EBI A;  2FQ4 A;  4S0H B;  1OJL A;  2UXI A;  3HGY A;  4CYC B;  2MG4 A;  4BBR J;  2E1O A;  2CRG A;  2ECB A;  1IC8 A;  1JTX A;  1D5Y A;  3AQS A;  4MXM A;  2KDZ A;  5M3M J;  5EEA A;  1W0U A;  1IJW C;  3A01 B;  2PMZ N;  3G1L A;  4AYB N;  3BQY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...