3CCYA

Crystal structure of a tetr-family transcriptional regulator from bordetella parapertussis 12822
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
192
structure length
192
Chain Sequence
YENIRDTIIERAAAMFARQGYSETSIGDIARACECSKSRLYHYFDSKEAVLRDMLTTHVDSLLERCRQVLYGSNEPKTRFLQIVKLFLEIYATSRDRHVVMLTCLDALPEDQRKALIAKQRELIAYVRDALLQLRPDMAANRTLAHVDTMLFFGMINWTYTWYKADGSVSPDALAERTVQLFLDGYLNLLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative TetR-family transcriptional regulator
publication title The crystal structure of a TetR-family transcriptional regulator from Bordetella parapertussis 12822.
rcsb
source organism Bordetella parapertussis 12822
molecule tags Transcription regulator
total genus 65
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17932 TetR_C_24 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3ccyA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3ccyA02
4DYQA 4D7NA 3VOKA 3B6AA 2UXOA 1H88C 2CRGA 5E3NA 4A3LJ 4A3GJ 3AQSA 1NK2P 3JRHA 3QPLA 4RDUA 2R93J 2MW8A 1FTZA 3B6CA 3NI7A 5D19A 2HQ5A 1ETKA 5IP9J 3LSPA 3C07A 5EYRA 1BJZA 2NOGA 2VKEA 4QSHA 2CQXA 2DN0A 3FIWA 2FQ4A 3IH4A 4ABZA 5E3MA 5M5YJ 3HOXJ 1GV2A 4JYKA 3HOWJ 2EZLA 1BA5A 3WHBA 3QPSA 4CYCB 3OSFA 1Z0XA 2QCOA 1E3OC 1RETA 2JA8J 3HKZN 3IV5A 5IPAA 4MIMA 1HDPA 3RZOJ 2UXIA 3RZDJ 3VVZA 2ID3A 1RR7A 3MVPA 4IHXA 3G1LA 3V6GA 4IHWA 3ANGA 3UKGA 4BY1J 5HBUA 1TWHJ 1IJWC 3CMYA 2Y31A 1A5JA 2OERA 1XC5A 2NVYJ 2QOPA 1G2HA 1H8AC 2QWTA 4XICA 5EG0B 2L7ZA 2NS7A 5J1UA 3W6VA 3P9TA 2GM4A 2CUEA 1YRNA 1WCMJ 1ETXA 2DA5A 2E2JJ 5FJ8J 1JKQC 4DZPA 3EUPA 3O8GA 5C4YA 2G7GA 1I3QJ 4D5CA 3TP3A 4D7MA 1MSFC 2COBA 2IBDA 3LSJA 1JKOC 3BJBA 5C3EJ 2EZKA 3PO3J 2XPWA 4IHYA 1P7JA 3CCYA 1LE8A 3VP5A 2LVSA 3BR3A 2YVHA 4NN1A 2Y9YA 4RBOA 1UHSA 4UUSA 3PM1A 3PO2J 1IDZA 5K7FA 1VF9A 1TWCJ 3DEWA 3Q3SA 5EDNA 5JLWA 1UI6A 3H3VK 4FISA 4JX5A 3A02A 1ZR2A 4CGRA 3JSJA 4GCKA 1MH4A 2CU7A 4A93J 4JP0A 3QKXA 4DW6A 1ZKGA 1UG2A 3JRAA 3JR9A 1LE8B 5FLVA 4W1UA 3RD3A 1RPWA 3NAUA 1JTXA 4M3EA 4PXIA 2GUHA 2TCTA 3RKQA 2ZOYA 3F1BA 4G12A 2YU9J 3HGYA 3HOVJ 3S2DJ 4M3GA 1A6IA 5EGOB 1GVDA 2L9RA 2UXPA 2MGQA 3JRCA 2P81A 1BW5A 3BCGA 4W97A 3CQZJ 4JNNA 2QTQA 3D1NI 1ETVA 2R5ZA 1VI0A 1B72B 3BR5A 1PUFB 1ZR4A 1ETOA 4DYCA 4XRSA 1JJ8C 2QIBA 3JREA 4A3MJ 1P7IA 1FIPA 2HXOA 2LFBA 2ECBA 3GTLJ 4GCLA 2VI6A 4AUXA 3FK7A 4MFEA 3Q0UA 4C2MJ 2QKOA 5D1RA 3L1PA 3LJLA 2DJNA 5M3FJ 1OFCX 4YZEA 2V57A 4BKXA 1U9OA 2ELKA 4S0HB 3JRGA 1IRZA 3BQYA 1S7EA 3HDDA 1ETWA 3GBGA 2CQQA 2ME6A 4EEFG 4A3FJ 5HSZA 1LFUP 4UDSA 3SFIA 4CYCA 3BNIA 1T56A 1QVTA 1JUMA 4BY7J 2EH3A 2ZCMA 3COLA 4ICHA 1B8IB 2JMWA 2KT0A 3S16J 3OSGA 2IAIA 4GFBA 2HDDA 3VW1A 3HOZJ 3ON4A 1K83J 5FKLA 2QF7A 1I6HJ 3CRJA 2LR8A 1CQTA 5EZHA 5DS9A 2DMQA 2CUFA 2O7TA 5D18A 1SGMA 4B3AA 4A3JJ 3JRBA 1JTYA 1F43A 2RHAA 3NPIA 5C4XJ 2ZCXA 3BR6A 3K2AA 3LOCA 1POGA 1IC8A 4IHVA 5AQCA 2L0KA 2GBYA 5EG0A 2VKVA 1WPKA 3EGQA 5E3OA 3S14J 3S1QJ 4JX6A 1APLC 3GZIA 4ME9A 3LWJA 1JT6A 5J1YA 5FKMA 3SDGA 2HOSA 1H89C 3V78A 4FCYA 2E2HJ 2L7FP 3S2HJ 2E1OA 3IH3A 5EF6A 2M34A 3LNQA 3ZOBA 3NXCA 1DU6A 2JK3A 2F07A 2M2EA 3SJMA 2ZCNA 1IDYA 2VUMJ 3BRUA 3BR1A 2ECCA 3TW6A 3GTMJ 3BQZA 3BHQA 4ACIA 3M3YJ 3ANPA 3HTAA 1SANA 5F0FA 5C44J 2FJ1A 1HF0A 3JRFA 3CWRA 1GUUA 3ZQFA 5F27A 2RASA 2DA6A 5J1RA 2FBQA 3VUQA 1ENHA 1FTTA 2I10A 3T6NA 5K7HA 3TP0A 5EGOA 4A3KJ 4XIDA 5FHPA 2HOAA 2W53A 3OIOA 4JKZA 3Q0WA 4A3IJ 4FE7A 4HNVA 1VFCA 2W48A 2AHQA 2DMUA 3WHCA 4KWAA 3VIBA 4DYRA 2IEKA 1TWGJ 2WB1N 2XPVA 4B4CA 1WH7A 4QIWN 2LY9A 1B72A 3BG3A 1PUFA 3LHQA 3HTJA 5EZGA 4A69C 4M3BA 1QPIA 5DAJA 5FKKA 3FISA 2IU5A 3HTIA 1X2NA 1X2MA 2OPTA 4GFLA 5IYCJ 1XS9A 3PASA 1HCRA 1IGNA 5K7ZA 1BW6A 2WAQN 4XRSG 1XG1A 2ID6A 3HE0A 3G1OA 3NNRA 2LP0A 4GFKA 2NVXJ 4A3CJ 3GTQJ 1MBEA 2M9HA 3I4NJ 2OI8A 2Q24A 2PBXA 4A3DJ 2DA3A 2XB5A 3BG5A 1X58A 4C3JJ 2KDZA 3GTGJ 1B8IA 4I76A 2NS8A 5IYBJ 2R5YA 4D5FA 3K7AJ 1GT0C 2NP3A 3CDLA 2H8RA 1ORKA 2NVTJ 5FLMJ 1GV5A 3A03A 2JA5J 5CXIA 2JJ7A 5IYDJ 1GDTA 2GFNA 2X9DA 2GLOA 3PPBA 1RESA 4X6AJ 4M3DA 2AO9A 5FMPA 1MBGA 3NARA 1MBHA 2JN6A 4BBSJ 2LLKA 3HBLA 2XGEA 3GEUA 2DG7A 1DU0A 2B63J 3KKCA 1Z77A 3E7LA 4LOCA 9ANTA 2R5YB 3NRGA 5IP7J 2JA7J 3MN2A 2M8GX 2XGCA 2EZHA 3RQIA 4B1RA 1ETYA 5J3LA 1T33A 4MLOA 1U8BA 2NX4A 3BTCA 1OCTC 1RKWA 3VPRA 1HOMA 3QBMA 3DPJA 4A3BJ 2RAEA 3JRIA 2LD5A 3S1NJ 4FTHA 2EBIA 2O9LA 3HOUJ 1Q1VA 3Q0VA 3BG9A 2PZ9A 2E19A 3FK6A 2TRTA 1W0TA 4J19A 2DMPA 1MNMC 4JL3A 2O8KA 4HKUA 4V2FA 4IEJA 3TEDA 1JT0A 4MXMA 2JA6J 2VPRA 3LSRA 3S1MJ 1FIAA 2XDNA 3BTIA 1VNDA 3DCFA 2N8GA 3OOUA 1MBJA 3B81A 3H0GJ 1I50J 2HOTA 5FKNA 1UMQA 3S1RJ 1UI5A 3HIMA 5IOYA 2E2IJ 2HYJA 2DMTA 1ITYA 2DA2A 3JRDA 1U78A 3HM5A 4A3EJ 5H9TA 2UXUA 3FRQA 2DA7A 3F0CA 2R92J 3HGGA 2YUSA 4MK6A 1JGGA 2K9QA 2XB0X 3BT9A 2R0QC 1JUSA 1RKTA 1OCPA 1JJ6C 3BR0A 3BR2A 1JKPC 3RH2A 4M6VA 1K61A 2ZOZA 2OF7A 2XGDA 5F0CA 2REKA 4GCTA 1MSEC 1WH5A 5BNGA 4MFDA 3HTHA 3VW2A 3S15J 5CXGA 1ZK8A 5GPAA 1HLVA 5F08A 2CJJA 5DTDA 3TW7A 1JKRC 3G56A 2DG8A 4JX4A 1D5YA 3HOYJ 1Y1VJ 1U9NA 2K9NA 3MKLA 4MO7A 3GTJJ 1IV6A 2XRLA 3MNLA 4Y7NJ 3G7RA 4QTRA 3QQAA 3IH2A 1W0UA 5FKOA 3GTPJ 4C3IJ 3O60A 1FEXA 1O4XA 5CW8A 4Y52J 4BBRJ 2XPUA 1FJLA 1ETQA 4M3FA 1F36A 1MBKA 4V2GA 1MBFA 3LSGA 3S5RA 5HODA 5IOZA 2DTZA 2Y2ZA 3ZQIA 2G7SA 2LTPA 1YRNB 3GTOJ 5EEAA 4AF5A 4UUTA 2MG4A 2DA4A 2ME0A 3VW0A 5GPCA 1AHDP 3G1MA 1HDDC 1WI3A 2Y0SN 1OJLA 3HEFA 3VVXA 2EQRA 5FGLA 5EFYA 1IG7A 5IP6A 1AKHA 5M5XJ 2HI3A 1BL0A 2NP5A 4NELA 1ZTRA 3C2BA 2G7LA 4XK4A 2K9SA 1R9TJ 1IUFA 2NVQJ 2Y30A 2WUIA 4L62A 5E3LA 4AC0A 2D5VA 2WV1A 2FX0A 2K40A 3BTJA 4X1EA 5GP9A 1TC3C 3I4MJ 5K58A 4AYBN 5F0HA 2HKUA 4UUSB 2WGBA 4NDLA 4FE4A 2R7ZJ 2YVEA 3ZQGA 2H1KA 4BXXJ 2G0EA 2LK2A 2MSYA 3O8HA 2X6OA 3IUVA 3ON2A 2DMNA 4XRMA 3E7QA 1AKHB 2EZIA 3CJDA 1EF4A 5HAWA 3A01A 1Y1WJ 2YS9A 4L5EA 3KNWA 1SFOJ 4I6ZA 3BTLA 2UXHA 1NK3P 1TWAJ 2FD5A 4DZJA 2DA1A 3HB9A 1TWFJ 5M3MJ 5C4JJ 4C3HJ 1ZGWA 1QVUA 2PMZN 2X48A 4AC6A 2G3BA 3S17J 2M0CA 1JUPA 3ZQLA 2HYTA 3ZQCA 3KZ9A 2XSDC 5F04A 3A01B 2GENA 2R5ZB 3GTKJ 3KKDA 3VOXA 2HXIA 3AQTA 3FKIJ 3ZQHA 2LKXA 1QRYA 1AU7A 2O7OA 5M5WJ 3M4OJ 2D6YA 1ZQ3P 1NTCA 5F1JA 2Y9ZA 3VVYA 2L7MP 5JLXA 2ZB9A 2JWTA 1LFBA 1MH3A 1WGXA
chains in the Genus database with same CATH superfamily
3C2HA 4IL6C 3G2BA 3WGHA 1H88C 2CMPA 4LGWA 4CICA 3LWFA 3QAHA 1KZHA 2DOFA 1T38A 1LJ9A 5IP9J 5EYRA 1S9HA 1QGPA 2BV6A 2NOGA 2VKEA 2ZSIB 4IRVA 4II3A 1GV2A 5FB2A 1BA5A 1G3YA 2H94A 2ZXJA 2B0LA 2K4BA 2LBFA 2L01A 1SFKA 1E3OC 3A1YA 2V79A 4PGGA 3I53A 5IPAA 3AG2H 1QZYA 5HOOA 1HDPA 2UXIA 3H0DA 1ZG5A 3VVZA 1TP4A 3MVPA 1BR4A 2ZMEA 4UVBA 1ZN2A 2QQBA 3OYIA 3RPUD 4ENKA 2VLAA 1A5JA 5KNLA 1X3WB 2OERA 3VTIA 2K02A 4KIBA 2VN2A 2V7FA 4UVCA 1H8AC 4XICA 3W6VA 3K4KA 3EUAA 2GM4A 4LLLA 4NQWB 1ETXA 2DA5A 2EB7A 2DTRA 3P9IA 3CO7C 3I64A 3O8GA 2NNNA 4M9SA 2KP6A 2G7GA 4PJ0C 2WY8Q 3E6CC 1MSFC 2COBA 3BJBA 4PFOA 2Q1ZB 3ABLH 3MEXA 5TGTA 2XPWA 4IHYA 1AA7A 1LE8A 2LVSA 4I7HA 2YVHA 4NN1A 2IPQX 5E20A 3CMMA 2KRCA 4Q48A 4GGGA 2CWEA 3PO2J 2VE8A 2XGXA 3K2ZA 3JSOA 2HGCA 1TWCJ 1R5GA 1GLNA 1UI6A 3JSJA 4A93J 2WV0A 2DW4A 3W2VA 4QPOA 1WJBA 1ZLJA 1UG2A 1ZKGA 4I02A 3JR9A 2E1CA 5FLVA 2P5KA 3RD3A 1LUJB 1JTXA 3CCMI 3QPTA 4PXIA 1S5LC 3DEUA 3F1BA 3HGYA 4KITB 3S2DJ 4YFXF 4CXFA 2A69F 2DCEA 5EGOB 1GVDA 2L9RA 2F6CA 3PIOF 2OBPA 1R49A 5B1AH 2BW3A 1VQ7I 5CVVA 3BCGA 4W97A 4XSZF 5JR3A 1JI8A 3HPGA 4IRGA 4CYDA 3L09A 3H5AA 4UHTA 1VI0A 2G7UA 2MBFA 3SQNA 4ASNA 1B72B 3AKZA 1JJ8C 2KZVA 3DKWA 1FIPA 1FYKA 2ECBA 2VQGA 3GTLJ 3DKXA 4AUXA 4LITA 3FK7A 5DD8A 3T1BA 2E5ZA 4IQJA 1YIOA 4GDFA 4WF2A 4G6QA 3JRGA 2RV8A 1R36A 2A61A 3DU5A 5D5XB 3R61A 2ME6A 3QRFF 4KN7X 1HBXG 5HSZA 2MFZA 3BNIA 4JK1X 2D2WA 1P6RA 1B8IB 1FSHA 3S16J 4Y15A 4GFBA 3VW1A 4I09A 4E7LA 1TL8A 2KL4A 1I6HJ 2QF7A 3H3UA 2ISZA 3H35A 3CRJA 2LR8A 3HRMA 4D1QA 3H9GA 2ESNA 3U2RA 3FMSA 5D18A 1P4AA 1TT5B 1VQMI 4A3JJ 4XQFA 1EV7A 4EQQA 4EVIA 1VQKI 1TQIA 2LY1A 3BR6A 2DK5A 4E7JA 4IHVA 5AQCA 2L0KA 3MD2A 1MDMB 4IHTA 1USSA 5EG0A 1UFMA 1Z6RA 1ZHFA 2ZFUA 3RSNA 3M1EA 4ZYDA 1LNWA 1TBXA 1J0RA 4JX6A 2H6BA 1I1SA 1MD0A 2IXSA 3HIFA 3ULQB 1LB2A 1EH6A 1IUYA 5J1YA 1REPC 4RAFA 3LWJA 3SDGA 2R7OA 4LD5A 1XGSA 1H89C 3RIRA 2HEOA 2RGVA 2E1OA 3IH3A 4MQ9F 1SMYF 2QLZA 3CC2I 3ZOBA 5HDNA 1O57A 2JK3A 5GTHC 2FEZA 1MNEA 2M2EA 4RGSA 3RPUA 3CESA 5BOXA 3IUOA 2VUMJ 3BZCA 3ABTA 5HLHA 1R22A 4HX4A 3M1CA 1IN8A 2BHYA 2Z1DA 3BQZA 3DV8A 5BPIA 3BHQA 2BOLA 2OZ6A 5D5VB 3LFKA 3VYTB 2GXBA 3ZMVA 3ANPA 4CUGA 2L5QA 5JVTA 2HYGD 5DM6F 3SXYA 4A12A 4KJZA 2LF8A 1Z9CA 1QPMA 5J1RA 2PEXA 3VUQA 1D3YA 2W7NA 1AWCA 3HOTA 1FOYA 1ODDA 3BPVA 4D0PA 3GXOA 4RB0A 5HDGA 4L9NA 2P7CB 1X1DA 2HOAA 3WTWC 2L4MA 3Q0WA 1TT0A 4A3IJ 4C2UA 2DMUA 3WHCA 1HKSA 1N77A 2VPLA 2F5VA 3FMQA 4L9JA 4H0EA 3UR3C 3O6BB 5AIPA 3J80Z 1TWGJ 5H6RA 3IKTA 4ZYHA 4OU0A 1ZH5A 1WH7A 1ON2A 2KHMA 2LY9A 4OIQF 1PUFA 3J81K 1J59A 4Y17A 1RNLA 4ZDLA 3N97A 1IF1A 2FQ3A 3K8PC 2MABA 2DDBA 1MGTA 2DODA 3FISA 2CUZA 1DP7P 2VOOA 4YIFA 3H9JA 1HW1A 3ML6A 3OS1A 3PASA 5DD4A 3FF5A 4LLNA 1BW6A 4M6XA 4XRSG 1YQAA 2ID6A 2XHKA 3G1OA 1B6AA 2E36A 3ISPA 4EV0A 5F1RA 3I4NJ 2PBXA 4A3DJ 2XB5A 3BG5A 2KIQA 1H0MA 2KDZA 3GTGJ 5DCFA 4I76A 2NS8A 3I55I 2R5YA 1QZEA 2JQ7A 4JOMA 1GT0C 3CDLA 2CFXA 2H8RA 4B44A 1DGRM 1GV5A 3MMYB 5ILVA 5LGUA 2V9VA 1GDTA 4ZZDA 4X6AJ 1D8JA 2AO9A 5ICCA 5K5RA 1ZYRF 3ERMA 2PQ8A 1FYLA 2LKSA 4BBSJ 4YIRX 1Y6IA 1U0JA 2V9KA 2F2EA 5A2QZ 1MW7A 2XGEA 3LSIA 2EFWA 2AQFA 3E7LA 9ANTA 1K4TA 2R7TA 3HKZA 4KIGA 1EH7A 4EM2A 3MN2A 5FFZA 3KZIC 4XKVA 2EFQA 3RQIA 4B1RA 1ETYA 5J3LA 1U8BA 4RA2A 3BC8A 2RNJA 1RKWA 1HOMA 3DPTA 4BE1A 2HFHA 2GXAA 4FTHA 1IXCA 1YS6A 4L0YB 3Q0VA 4YG2F 3HG9A 3CF5F 2PZ9A 1MNMC 2DMPA 5CKTA 2O8KA 4V2FA 2E60A 3WTYC 5GADJ 4MXMA 2VPRA 2WADA 1S72I 3VWBA 1O3TA 3S1MJ 3QODA 3GO5A 4YFKF 5J8CA 2DXIA 2N8GA 4L5JA 1MNDA 4PJNA 4BJ5C 2DT6A 3CUQA 1BI1A 3E6BA 2EINH 3P9CA 3S1RJ 3RPQA 1UI5A 1GXPA 2HQAA 3SZGA 4I99C 1XN7A 1Y39A 4HLYA 1UJ8A 1UELB 2UXUA 5AIQA 3L9FA 2R92J 3FXKA 1YITI 1KYWA 1V4RA 2YR2A 1R5ID 1D1BA 1JUSA 3CUOA 5D8KB 3L2UA 3HSRA 2EFPA 2Y75A 3I0TA 3BR0A 3BR2A 1JKPC 2KFDA 1VQ9I 3RH2A 1JHFA 2VBWA 2PLYA 2HQRA 3WTSC 3FHNA 2MH2A 5GPAA 1V3FA 1JKRC 1WKMA 2UUZA 4PK4A 4G6TB 3FXLA 2DLLA 3MQ0A 3JSPA 1XDUA 2EPFA 3QOEA 2M7BA 3GTJJ 5DYMA 4Y7NJ 2J5OA 2M1BA 2DPUA 2CUJA 5J40A 3IH2A 3DTEA 5FKOA 3GTPJ 2EWNA 3E97A 1MJAA 4ZTFA 3F8BA 4Y52J 1R4NB 3ZMUA 2IJLA 1IXSB 3VDXA 2HOEA 4PJMA 4Z2YA 1FJLA 3ZP5A 2IGNA 2DOAA 5HVQC 1ETQA 1F36A 4DNCA 4TV7A 4U87A 5JI6A 5HODA 5CVUA 4IRIA 3ZQIA 4U0YA 3JAMK 3DLLF 3CC4I 4HDUA 3F3XA 1YRNB 4GRIA 5EEAA 4AF5A 2MG4A 2UV1A 5GPCA 1HSTA 4B3XA 1RC9A 1XCBA 2E1MC 2R7VA 1IG7A 5IP6A 5M5XJ 4KMFA 1ZTRA 5FD6A 4OWRB 1IUFA 2NVQJ 3JTHA 3KZYA 2WUIA 5E3LA 4BAYA 4L62A 4X1EA 5K58A 3QPHA 1XX5A 2KJCA 2VQLA 4HV6A 5FO5A 2NYXA 3OIQA 1OISA 3BLYA 3ZQGA 3K4LA 2H1KA 4BXXJ 2BXYA 3OS2A 1A36A 2FSWA 2X6OA 3S3NA 2DFFA 2DMNA 2KZGA 3DKYA 2EZIA 3Q9SA 5HAWA 4IVNA 1PUEE 2Q2EB 2CSOA 2YS9A 1Y1WJ 1SFOJ 3A0BC 1QBJA 2ESHA 2VQHA 3G3ZA 1YI2I 2UXHA 4NBQA 4H4KC 4KT6A 3GVAA 1NHAA 3TO6A 2FD5A 4E7KA 4UUVA 1QO0D 3HSFA 2DA1A 1IRXA 2DQLA 2ZKZA 1ZGWA 1KU7A 3GFIA 2F5DA 2PMHA 1DPUA 2X48A 1MIJA 1DDNA 2G3BA 3U9GA 2XSDC 3R0JA 3AG4H 3FXJA 3WE3A 4ESJA 2R5ZB 2RNGA 2GENA 3KKDA 3F72A 2HXIA 2MC4A 2O7OA 5M5WJ 2D6YA 4HX8A 2Y9ZA 3VVYA 4YIIA 3REOA 5JLXA 2BY2A 3DP7A 1D0YA 2JWTA 1LEAA 1BR1A 1S8NA 1WGXA 4WCGA 4BS9A 1G3TA 2L4AA 1HC8A 4XLFA 3B6AA 2UXOA 2W4SA 3EUHA 3Q5FA 2Z99A 1SC7A 1H9GA 3AQSA 3QPLA 3H3ZA 1EKEA 3E5UA 2HQ5A 2D45A 2XF6A 1FSEA 1ZLKA 3C07A 4KDPA 4QSHA 2YU3A 3KX2A 3IH4A 2IVMA 2LSOA 1TNTA 5D4RA 3QPSA 1EH8A 3ROUA 4CYCB 1R4MB 2F48A 3E6MA 1Z0XA 2XAGA 4RLQA 2XDVA 1RETA 3HL2A 3JW4A 1CF7A 4NQWA 1RUOA 4XLNF 2JVGA 2XIGA 3FXUA 5L3CA 3CLQA 1RR7A 3LFUA 4IHWA 4BY1J 4XL9A 5KAFC 1IJWC 1L0OC 3TDZC 4DIQA 3VSLA 3PFYA 3F8MA 3H5RA 1XC5A 3J80K 1FPQA 2L7ZA 2NS7A 3LA7A 2CUEA 2LRDA 5ICFA 1XMAA 1UAAA 4DZPA 3BY6A 3EUPA 4LIVA 2W85A 2XAUA 1I3QJ 3EYYA 1IXRC 1FBQA 1XGOA 4AVPA 1RZ4A 1OYWA 5CJ9A 3BPXA 3RKYA 1JKOC 2EZKA 3GUDA 2IGOA 1Z7LA 3RQ4A 2VC1A 2VBZA 3OYHA 2Y9YA 4ZYEA 3GWZA 2CV2A 3ZMZA 2A3SA 2EA2A 3LAPA 4A2UA 1UHSA 3I71A 1KU3A 2W25A 4PJJA 3SDBA 3PM1A 4UUSA 3AL0B 5L3DA 1VF9A 2KISA 2VL8A 3VODA 1FWZA 5EDNA 3FBNB 2OAZA 3H3VK 4FISA 4JX5A 2X1DA 3A02A 3FXOA 4PCQA 1W36C 1SFXA 2CU7A 2GWRA 3H9QA 1MMGA 5D4SA 1K78B 3ABKH 1D1CA 1D1AA 2PI0A 2W82A 4BYYA 5DUIA 2ICWG 4BE2A 1IW7F 3RKQA 4AIJA 3HOVJ 1T6SA 4QPQA 1MMNA 4M3GA 3KIOA 2O03A 5E8IA 4RLFA 3NWSA 3FZVA 3JRCA 2E71A 2HWVA 3OOPA 1ZELA 1OYIA 1XMKA 2P4WA 2K4JA 2PFBA 4XONA 3FM3A 2Z9OA 1ZREA 4XSXF 2HZDA 1O3QA 2QTQA 2F5EA 2KLOA 2WY7Q 3D1NI 5EEGA 3F22A 2BXZA 1ETVA 3VFZA 3DF8A 4LFUA 1B9NA 3QP6A 4GO1A 2V1XA 2COMA 2QIBA 3JREA 1BBYA 2V26A 4A3MJ 4DGWB 3H5NA 4WIBA 4B8XA 4I0BA 3L1PA 2DJNA 3OYKA 2R7SA 3CTAA 1T98A 1OFCX 4YZEA 4XRFA 2V57A 5ICEA 2HVQA 5J47A 1IRZA 3CMAI 3BZ6A 1FBUA 4AWXB 4EEFG 4BEHA 1MKMA 4S05A 1XGMA 3SFIA 3TO9A 4UDSA 4BY7J 5LGTA 1MDMA 2EH3A 2MYSA 5ICGA 5JHFA 2A6TA 2ZCMA 4ICHA 2H1LA 2JMWA 2FRHA 2KT0A 3KZZA 1T8IA 4B09A 2A5YB 5GAHJ 3GEZA 1DGWY 5L3BA 3J7AO 1CQTA 1ON1A 5EZHA 5DS9A 1R00A 4KYWA 1M1EB 2DMQA 1BOBA 1FMVA 4B3AA 1IAWA 1MMSA 3AG3H 3JRBA 2PFVA 1F43A 4RB3C 2OQGA 2ZCXA 1I3AA 3K2AA 4BHBA 3K1MA 3LOCA 1POGA 3CCQI 1IC8A 5LD2C 2VKVA 3TBIA 4ZC3A 1J2XA 1VQNI 2P7VB 1APLC 3KP7A 1IV8A 4CGZA 4CO8A 2HR3A 2L7FP 3ASOH 3TKYA 3VYRB 3BJAA 4B43A 4L9TA 3MZHA 1YS7A 2PJRA 5EEHA 1TQMA 3PNYA 2O6GE 3TO7A 2ZJQF 2XAHA 3SJMA 1WJ5A 1STZA 3KEOA 2ECCA 4BE0A 1BI2A 3GTMJ 2M0MA 3WTZA 2ETHA 3M3YJ 5F6FA 3E6DA 4ESBA 1SANA 5F0FA 4Q5SF 1HF0A 2VOPA 3K70D 4L5IA 2K5CA 5F27A 3ZQFA 2RASA 2YSRA 2EV5A 2DA6A 3BG7A 4BUPA 2RQQA 3M07A 2BVMA 1LVAA 2ZBKA 4JBAA 3DTKA 3U1DA 3S32A 1KONA 2Z16A 4XIDA 3T8RA 2W53A 3OIOA 3QU6A 3G4SI 4HNVA 3DU6A 3CJRB 1VFCA 2W48A 4C30A 2AS5F 4ENNA 1YFHA 1FBSA 2CH0A 3I3LA 4EATA 4KWAA 3OYCA 4WXHA 2WB1N 2LMDA 2GAUA 3S2WA 3OYGA 2LY2A 4X0GA 3IRQA 2DYRH 4F52A 1VQLI 4WX9A 4PGHA 1H9TA 2RVCA 4IKFA 3DWLE 3QU3A 1X2NA 1X2MA 1XGNA 2OPTA 1YYVA 1KQ9A 5LHHA 2QSGX 4RM3A 4E7SA 2GZWA 2HZTA 1SVMA 5TJJA 1XS9A 4RAYA 1ZGAA 4HW0A 1B1BA 5HLGA 1HCRA 2QSHX 2VB6A 5KK1A 1J75A 2X85A 3HRUA 3IRRA 3LA2A 3HE0A 3NNRA 1IN4A 4G6DA 4R1HA 5KHDA 2WBMA 2NVXJ 2V1DA 4HQEA 1MBEA 1QZZA 4OIRF 2M9HA 2Q24A 4XN0A 3K9TA 2X1CA 2RQPA 3E5XA 2HDWA 4D5FA 1A04A 2OA4A 5HLTA 3K7AJ 5ILSA 1SD7A 2XV4S 4RAZA 4XR6A 5LBQA 2NP3A 3F23A 1W1WE 3ZPLA 1QQIA 3A03A 2JA5J 2L9VA 4IXAA 2VE9A 5IYDJ 1SD5A 2GLOA 5BPDA 4M3DA 5FMPA 1MBGA 2LC2A 1MBHA 4KN4X 3L2VA 3CF2A 5CVJA 1RRJA 3WG9A 3HJEA 2DG7A 1DU0A 3PSIA 2DFIA 1D0XA 4LOCA 5IP7J 4J01A 4BNCA 1TW2A 2XGCA 3DTIA 2IS2A 4MLOA 3BTCA 1YLFA 3QYFA 1FX7A 1S6LA 4ZDPA 3KPHA 3DPJA 3HRTA 4CH7A 2O61A 3PUFA 4BQOA 2QEXI 3S1NJ 4GYGA 2FBIA 1N25A 1BOAA 2BY3A 3P9KA 2E19A 3I58A 2TRTA 2OUMA 1W0TA 2R4GA 2Z5UA 4L0ZB 4JL3A 1U5TB 2FNPA 4HKUA 3I54A 3TEDA 1JT0A 3LSRA 2ZJPF 3CMEI 3L7WA 4E6KG 1FOXA 2VKDA 2Z2SB 3W2WA 1BIBA 4HX7A 1WZ2A 1F9NA 3H0GJ 4FX4A 2HOTA 1UMQA 3BWGA 3V8KA 1S29A 1BIAA 2H27A 2XF5A 2HYJA 5K5QA 2PN6A 1T95A 3OIPA 3FRQA 4O3MA 4ITVA 5E79C 5GAEJ 4CDGA 2VODA 2K9QA 3BT9A 1IRGA 4OMYA 5K1YA 1OCPA 2HQNA 3GFJA 4AVZA 3L2RA 2VXDA 5BMZA 1ONVA 1B59A 1XSDA 5F0CA 2REKA 3J7YJ 5BNGA 4MFDA 4MEXF 2HTJA 3A4CA 5DV5A 3WTTC 1DUXC 1UB9A 5DTDA 2E1NA 5E1XA 1HKQA 2LBFB 3NS4A 2Y0MA 4RMNA 4BACA 1FLIA 1Y1VJ 1U9NA 2K9NA 3MKLA 3PJRA 2LNBA 2A05A 3MNLA 2XRLA 5D8LB 2VC0A 2WTEA 3HHHA 3O60A 1FEXA 5CW8A 2ZMEB 1W7PB 3ABUA 2PBIA 4BH9A 5IT9K 3HUGA 2FOWA 2VIXA 1MBKA 4V2GA 2K27A 4RGRA 4B47A 5CYVA 1PJRA 1WQ2A 2DK8A 1WI9A 3SYTA 2Y2ZA 3ECHA 2ZSHB 2R7QA 2G7SA 5D6FA 2QGUA 3LSMA 4QWQA 3C2GA 1NH3A 4IZZA 2R7FA 3VYUB 2CQKA 2M87A 3F8NA 3TGNA 4RB1A 3G1MA 2Y0SN 1WI3A 3M9AA 1OJLA 3HEFA 4HOBA 3IL2A 3CP8A 5EFYA 4NELA 2CW8A 3H36A 4LG0B 2G7LA 4XK4A 3DBLB 1R9TJ 3BOQA 3KP5A 3BDDA 2WV1A 2STWA 3BTJA 5J6XA 3KP4A 3OS0A 4AYBN 2R7UA 1XD7A 5F0HA 2M8EA 2EK5A 2BEOA 4KT5C 2MH9A 1SFUA 4FE4A 3W6JB 1W36D 5GAGJ 2G0EA 2MSYA 3GF2A 4IHSA 1RUNA 2H8WA 1FC3A 1V5GA 1ZARA 5J8FA 1O3RA 3T5XA 1EF4A 4YEJA 3CP2A 5FLXZ 4CCKA 5HS8A 2VT2A 1YO5C 3J7ZI 4CSWA 3DEEA 3OL4A 3BCAA 1TWAJ 2G9WA 2OZUA 2X6XA 3SHFA 4BHPA 4Q47A 1U8RA 1EJ9A 2JTVA 5IT3A 1FMWA 3ECOA 3RKWA 3OYAA 4A5NA 2PMZN 5JVGF 4U7BA 4E7IA 1HQCA 1JUPA 3ZQLA 2A68F 1I1GA 3ESWB 3ZQQA 3ZQCA 6PAXA 5F04A 3OWTA 1OCRH 1YW8A 4PUSA 3VOXA 2W00A 3M4OJ 3ZQHA 1AU7A 2AXLA 2R7WA 1IN6A 4WXCA 1UCRA 5B1BH 1RIOH 4IF4A 2F4MB 4N0BA 3K1NA 2GOMA 4EM1A 1LFBA 4PZJA 2D1VA 3EQLF 2DT7B 2E34A 5DM7F 4DYQA 4D7NA 3VOKA 4IOCF 4A3GJ 2HNHA 3KETA 1FNNA 4RDUA 3HXLA 2KIUA 1T2KA 4E7ZA 3LSPA 2DT5A 1BJZA 1N75A 1SD4A 4UV8A 2CQXA 5FGMA 3FIWA 2DBBA 4ABZA 4F7ZA 2BE5F 5M5YJ 3HOXJ 4JYKA 2JA2A 3WHBA 4N4NB 2QBYA 1OR7C 2X1EA 4KMUX 3OSFA 2QCOA 5LLQA 2QUFA 4ZJZA 1ZAOA 3NRVA 3HKZN 3SWHA 3KEYA 5AONA 4NC8A 2ID3A 4IHXA 2ZXIA 2XROA 4AU7A 3ANGA 3UKGA 1V54H 1TWHJ 2CV0A 3CMYA 2Y31A 1P4XA 3KEQA 4LK0F 2QOPA 4O5VA 2QWTA 5HS9A 5EG0B 3NEUA 1LDKB 3P9TA 1YW9A 1WCMJ 2F4OB 2V6EA 5FJ8J 2OCEA 2OTJI 1A6QA 4D5CA 5LRSA 2KRHA 3GZNB 3WE2A 3L2CA 4XBFA 2IBDA 1K78A 3CCRI 3PO3J 2EJRA 1P7JA 3CCYA 3LL7A 3M8FA 4XLHA 2Q0OA 4ESFA 4EMSA 2CGPA 2X4HA 4ZYGA 4CCNA 2V9PA 2I8DA 3R4KA 2CG4A 2OD5A 1ACIA 5K7FA 3D5RC 1BM9A 3GLXA 1ZR2A 1T08B 4CGRA 1Q1HA 3J7AY 1G3SA 1QHGA 4FT8A 4JP0A 4LK1F 3PIPF 1G59A 5L3EA 4I2OA 3QKXA 1B9MA 2BBYA 2L3DA 1MMAA 4W1UA 3NAUA 1W5SA 2WA0A 1FY7A 2TCTA 2XAFA 1ZG1A 2ZOYA 2YU9J 3I59B 1QHHD 5FD5A 3GCMA 3VEPA 4HDVA 1T0FA 3F9KA 2F4IA 4CCOA 3ERED 4M74A 2UXPA 4F3QA 3VB2A 2P81A 3OR1C 3IHUA 4HF2A 2BY1A 3CQZJ 4JNNA 2F5FA 4BU2A 3PUBA 2NS0A 4XOTA 3EETA 2NVUB 3Q9VA 2DJIA 1TZLA 4RM2A 1PUFB 1ZR4A 1Z05A 1ETOA 4DYCA 4XRSA 4A0YA 3TQNA 2RREA 1E3HA 3GYHX 1VQPI 4PJLA 3RJPA 2LFBA 3ZGKA 1E17A 4GCLA 2VI6A 3HTSB 5E8GA 3Q0UA 4CCJA 4C2MJ 4HNUA 4HRIA 2QKOA 3LJLA 1I5ZA 3MKYB 1O7LA 5M3FJ 4E7HA 2QKMB 4BKXA 4UV9A 1U9OA 2KIMA 4UNOA 4C9YA 1F5TA 1UHWA 5EJCA 3IC7A 3HDDA 1ETWA 3DQVC 2RDPA 5HLIA 4BHCA 2CW7A 1SVLA 1LFUP 1ZG3A 3VYSB 1WJAA 1QVTA 1JUMA 4KICA 1TNSA 2WAFA 3M8EA 1RR8C 3DPLC 3OSGA 3OYFA 4HA8A 3V8JA 3HOZJ 3ON4A 5B66C 3KP3A 3MZYA 4ZDOA 2KRFA 2YVXA 1SGMA 1VTNC 1JXSA 2IA0A 4G7ZF 5C4XJ 3AL0C 3QYBA 4K2EA 1U2WA 2GBYA 4XLAA 5LRRA 1WPKA 3PFIA 3S14J 2IP2A 4MTDA 4E70A 4ME9A 2O0YA 4RAGA 3OV8A 1HKTA 3PNTA 3LSHA 1WJCA 1BR2A 2E2HJ 3S2HJ 2W24A 2FMLA 1LDJA 5EF6A 3B02A 3FXMA 3LNQA 3C1DA 4HQMA 3NXCA 3WGIA 3TMOA 4AIHA 3GZ6A 3ONQA 4HNTA 2ZCNA 1IDYA 2IGKA 3BR1A 3TW6A 3CCJI 1ZRDA 3EDPA 4GXOA 4LJZF 3HTAA 3RCOA 1OKRA 2K9MA 2FJ1A 3CUQB 4ZYAA 2LOOA 5C44J 3JRFA 4A0XA 1JE8A 3G6EI 3CWRA 2DYSH 3RTRA 4U0VA 3ZR8X 1I6XA 4S04A 3GW2A 5DUKA 4A0ZA 5LFAA 1T0FC 3LA3A 3TOAA 2K86A 1ENHA 2UXNA 2V1NA 2I10A 4U9LA 2BGCA 3ZQ7A 4NNJA 5K7HA 3TP0A 5EGOA 2KKOA 2L02A 4OIPF 4IQ4A 4OOIA 1WSUA 3D5SC 5E17F 2VASA 3DBHB 1X1CA 3L00A 3KYDB 4HBLA 4JKZA 1P4WA 2AQEA 1SAXA 4IOAF 1YTYA 2AHQA 2P5VA 4M73A 4CHUA 2OQRA 3OYJA 2DU9A 5HS7A 4DYRA 2IEKA 1MJBA 4B4CA 3CCEI 4QIWN 3HPHA 1B72A 3K69A 1FYMA 3HTJA 5EZGA 4A69C 4M3BA 2ZJ2A 2IS4A 4MGRA 2K3FA 4A5MA 4BXFA 3ZMSA 2HVRA 2CS3A 2FXAA 5A2QK 1HW5A 4P96A 2DFHA 4G8XA 1V5EA 2ZO4A 3WTUC 5D6EA 4MHGA 1XSVA 4JQFA 4HZFA 1J5YA 1OLTA 2R7XA 1A35A 2HKXA 2WAQN 4D9JA 1FZPB 1XG1A 2L9SA 2IGMA 3ZN1A 4OMZA 5LEJA 4GFKA 2P6SA 4I0AA 3ZXSA 4B48A 3WU0A 1FOWA 1QA6A 3NWTA 2C6YA 3GTQJ 4A3CJ 3OYMA 5E1ZB 2OI8A 1XPXA 2DA3A 1K6YA 1Y56A 1X58A 2NXNB 3V4GA 2RC4A 1B8IA 2Z33A 2XAJA 2JUGA 3IKVA 3S3MA 1ORKA 2CW0F 2NVTJ 3DLAA 1BC8C 4BDYA 4C2TA 3RI4A 4Y3OA 3B73A 3F21A 2R7RA 2KJBA 1KU2A 5K5OA 2X9DA 1SFEA 3C7JA 4M6YA 2QZ8A 3J81Z 1TW3A 2KQRA 1OYYA 2ZXHA 3O2PE 4YELA 2DFEA 5ERIA 1QU3A 2LLKA 3VSKA 2M3AA 4YFNF 4RGXA 2B63J 3BJOA 1HW2A 2KDOA 1U5TA 1WWXA 3LQRA 4UB8C 4Q4ZF 3H1CA 1PYVA 4RS8A 2XASA 1Z6TA 2DQRA 2R3SA 4IJAA 2NX4A 1OCTC 3VPRA 3K1PA 3N05A 1P2FA 3QBMA 3MKWB 1E3PA 5HDKA 4MEYF 2B3WA 4MTEA 4A3BJ 2RAEA 4BJ6C 2LD5A 2EBIA 2W84A 2O9LA 1Q1VA 3HTUA 4XN3A 3W3CA 3TL4X 3FMRA 4QLCU 4E4HA 3BZKA 3MKZA 3L2WA 2OJED 3FM5A 1P9QC 3U1KA 4IEJA 2PJPA 3ZN0A 5DCMB 4DOZA 2JA6J 2QA4I 2L9NA 1VQ4I 1JGSA 1FIAA 2X51A 1VQOI 1VQ5I 2O5RA 4CZZA 2XDNA 3BTIA 4BQQA 5JHUA 1LVKA 1VNDA 2X6YA 3OOUA 2ZNZA 2FU4A 1MBJA 4CCLA 3B81A 4M9ZA 2F5CA 2ISYA 2QQ8A 4HG2A 3HRSA 3CC7I 2H09A 2IA1A 5FKNA 4L18B 3HIMA 5IOYA 2E2IJ 4FHTA 2A5WA 2DMTA 1ITYA 3GMEA 3JRDA 1U78A 3HM5A 5H9TA 3F8FA 1LDDA 2DA7A 3F0CA 3HGGA 2YUSA 1E0EA 2Z3YA 2XSJC 3V8LA 2XB0X 1P92A 4N9IA 3K0LA 3R0AA 4A6DA 4ON0A 4XLPF 2QWWA 4KFCA 1VQ8I 1WJFA 4XM3A 1JJ6C 1W7PA 2MLKA 2ZOZA 4BGDA 2Y48A 3ZCOA 1SEUA 1SMTA 2HPMA 3OL3A 2WB1A 1MSEC 3HTHA 2DOEA 5CXGA 1HLVA 4CA0A 4G7OF 1XSXA 2CJJA 5F08A 3TW7A 4BXUA 3OYDA 1WRJA 1D5YA 2GA2A 2DG8A 3GFLA 2EV6A 2FBHA 3FWEA 2STTA 2ZC2A 2W1OA 4MO7A 1CF7B 2QYOA 2B9SA 3EYIA 3E0JB 3QQAA 1WFXA 3C3WA 4P1WA 1OQYA 5FFXA 2ZXWH 1DPRA 3D0SA 3PSFA 2VJ5A 4M72A 4KIFA 4U7DA 1DQUA 1L3LA 4BBRJ 2IS6A 2XPUA 4P9FA 2KIFA 4LG0A 2OTLI 4XKBA 1D8KA 4M3FA 3ELKA 1MBFA 4XLCA 2E7WA 3T8TA 5IOZA 2DTZA 5LHGA 2LREA 2LTPA 2QQ9A 4AIDA 2UZKA 4UUTA 2DA4A 3N4MA 3LAJA 3VW0A 1AHDP 2JT1A 1S7AA 2EQRA 2HS5A 2UXXA 1SVOA 1PP7U 1R1UA 1BL0A 4U9NA 1K7AA 3FDYA 3CCVI 2K9SA 2OC6A 1GVJA 1I39A 2Y30A 5CVRA 3OYEA 3E3VA 4AC0A 2K85A 1TC3C 3I5UA 5GP9A 3DBRB 5KCMA 2HKUA 4UUSB 1U5TC 4ANJA 1VQ6I 1OCCH 1EA3A 1TQPA 2E35A 1K6OA 3O3KA 2R7ZJ 3G73A 1YE9A 3O8HA 2TDXA 3FBIB 3IUVA 2Q8KA 4FASD 4IO9F 1AKHB 5J4YA 5FRMA 4RGUA 1MZBA 2L2OA 2D1HA 2M45A 4MQVA 3K4CA 2EIJH 2VBXA 4EJVA 4DQ2A 4EM0B 3JAMZ 3BP8A 1NK3P 4WK8F 3QWLA 3QOPA 2XC7A 4DZJA 3MFKA 3BJ6A 2O3FA 3HB9A 5C4JJ 4DJAA 4AC6A 1R58A 2ADUA 2M0CA 3P7NA 4IPAA 3WG7H 3OYLA 1ULYA 3KZ9A 1R1VA 3A01B 1S7OA 1V55H 1R5HA 3AQTA 2LKXA 1QRYA 2BVLA 2GIZA 1TTYA 4M9XA 1J7KA 3FX3A 1PVEA 1V5FA 3V42A 5F1JA 2K9LA 5D5UB 1O7FA 2QKLB 2L7MP 1OPCA 3V7RA 1IN5A 1PDNC 3PNVA 1PP8F 3LQQA 5LHIA 2CRGA 2ZMEC 5E3NA 4A3LJ 4HF0A 2LH9A 4M71A 1NK2P 3JRHA 1FTZA 1IO2A 2R93J 2MW8A 3NI7A 3B6CA 5D19A 1ETKA 4LG3A 3OY9A 1YIJI 1LKXA 3DXJF 1XMXA 2DN0A 2FQ4A 3SZTA 4BJTA 5E3MA 4HAMA 3HOWJ 3DPUA 2EZLA 4BEHB 1N78A 2ELJA 4HYEA 3DFGA 1YOVB 3HC7A 3SFZA 1NG6A 4PSXA 2JA8J 3UNGC 3IV5A 1FP2A 3FKJA 3S93A 4MIMA 3RZOJ 3ASNH 3MZ8A 4FETA 3RZDJ 2L54A 4HLXA 4Y33A 4HV5A 3G1LA 4UY8I 3V6GA 2HU9A 5HBUA 1ZRCA 4RB2C 2JVHA 4N4OB 3K4MA 2FMYA 2QENA 3EPZA 2MC3A 1Y8RB 2NVYJ 1MJ9A 4BQAA 1G2HA 2CO5A 3S3OA 3KP2A 5J1UA 1F4KA 4YRVA 3CJTB 1YRNA 2M5WA 1W5TA 3SEZA 1OR7A 2E2JJ 5J4VA 3PQJA 1JKQC 5FRNA 1X4PA 5C4YA 2Y0SA 3ABMH 1GHCA 3TP3A 4LB6B 4D7MA 2E5NA 4A6EA 3LSJA 5H2FC 2VQCA 3CD6I 5C3EJ 1YX3A 3VP5A 2G7HA 3BR3A 2PJRB 3JCUC 2V1UA 4RBOA 4AYBA 3I59A 2WAEA 1IDZA 3DEWA 3Q3SA 3CCLI 1KGSA 3HSEA 5JLWA 2ACJA 3VOEA 1R6RA 2FNAA 4GCKA 1MH4A 4LIUA 1MMDA 5H20A 4DW6A 3JRAA 4ENJA 2RKHA 1LFPA 1LE8B 2KMUA 4WXDA 1RPWA 2Q2EA 4M3EA 3L2QA 2LDUA 2GUHA 1R23A 2K7LA 4G12A 3W6KB 2JSPA 3OYNA 1A6IA 2XVCA 4GCVA 1Y0NA 1CGPA 2MGQA 2O8XA 2QSFX 3OMYA 4U88A 4N9HA 1BW5A 2PMZA 1G4DA 5KVRA 4EGYA 1YX5A 3ZRGA 1XDSA 4P55A 4C2MA 1Z3YA 2GQQA 3WU2C 3V7CA 2R5ZA 2H6CA 1HA8A 3T0YA 4BL0B 4L9VA 2IW5A 3BR5A 3OYBA 2CQ7A 2CYYA 2V4JC 2JZYA 1P7IA 2HXOA 3PL8A 1ZGJA 3BCBA 4MFEA 2NAZA 1X1AA 4NUBA 2BW3B 4OD5A 5D1RA 2GA1A 2HTSA 5BS6A 1W5CC 2RN7A 2EA4A 4IRHA 4II2A 1HSJA 2ELKA 2WC2A 4S0HB 1A31A 3BQYA 1S7EA 3GBGA 2FOKA 2CQQA 3F6VA 2YPRA 3QP5A 4A3FJ 2KPMA 5HNHA 1U6GA 2V6CA 4CYCA 4P5OA 1T56A 4ETSA 3COLA 3C18A 4Y13A 2IAIA 2HDDA 5CQGA 1QNTA 1K83J 5FKLA 2XAQA 3FHZA 4KISA 3KCCA 4HSRA 2LF7A 2FF4A 3R60A 2CUFA 1ERDA 3BROA 2O7TA 1JTYA 2RHAA 2CQNA 3NPIA 1BI0A 1YW7A 4O6JA 3I56I 2JPCA 2NOJB 2JRTA 2ZY9A 1R1TA 2NNYA 4EGZA 4LMYA 5L3GA 4XLEA 3KYCB 2K3PA 3EGQA 4F93B 5E3OA 2NRAC 4I01A 3S1QJ 3GZIA 5GTIC 1U3EM 3ZMTA 2YX7A 1JT6A 3KLNA 5FKMA 4OAZA 3CCSI 2DDAA 1Z91A 3AG1H 3K6GA 2HOSA 4FCYA 3V78A 1BI3A 3LSKA 4PDKA 4KNYA 3OR2C 3IWZA 2M34A 1KQ0A 3K70C 4G94A 1UHMA 1DU6A 5TISC 3GFMA 2F07A 1W4MA 2X0LA 3K10A 2A6EF 1JHHA 5CVIA 2VKHA 2A2FX 3BRUA 1BJAA 3D5LA 3F8CA 2GOXB 4BQNA 4ACIA 3K4JA 3CLOA 4HSTA 2GIVA 1OMIA 1GUUA 5TRDA 4P9UA 2FBQA 1Z1DA 1Z21A 1FTTA 1Y8QB 1KYZA 1SAUA 2BYVE 3T6NA 1BN5A 3WTVC 4A3KJ 1WHUA 5LEKA 3A2KA 4F55A 4ZZLA 5FHPA 4I98B 4Z6YA 2GXGA 1IN7A 3BG6A 4FE7A 1ZRFA 4IX7A 5B5EC 2JRMA 4UVAA 3JTGA 4G7HF 4G9YA 2HVSA 2Y69H 3VIBA 3RDIA 3CDIA 2EFOA 2XPVA 1LQ1A 5LGNA 3E5QA 2QM3A 2DAOA 3BG3A 3M7GA 3LHQA 2CFOA 1XCVA 4HEA2 4CCMA 3COAC 2B1EA 1QPIA 4WWCA 5DAJA 2PG4A 5FKKA 1Z67A 5FROA 3GX4X 4F92B 1AOYA 2FUG2 4XKWA 2IU5A 2VXZA 4OIOF 2BY0A 3HTIA 3KP6A 4GFLA 5IYCJ 3AFHA 4ZH4F 2BZTA 2ZCWA 1K79A 2CV1A 5CPRB 3HUGB 2MD0A 3CJNA 1GXQA 3KFWX 2YX4A 4PSWA 3U21A 5K7ZA 1IGNA 4OD4A 2HYFA 4KA4A 2JSCA 3IAS2 3PQKA 5DEQA 1USTA 1OCOH 2LP0A 4OAYA 2ZFWA 1R71A 3I9V2 2DPDA 1KA8A 1X4OA 3QYEA 2W57A 3KLOA 1D0ZA 4C3JJ 2XKPA 5IYBJ 4EJUA 4U0WA 2IS1A 5FLMJ 1D5VA 5CXIA 2ELHA 2JJ7A 2GFNA 2MLGA 3PPBA 1RESA 1T39A 2XRNA 4ENMA 3NARA 4XOPA 2JN6A 2FE3A 2J5PA 3MCZA 1NG7A 4LLGF 2A07F 3HBLA 2PMUA 3GEUA 4BDZA 5DDGA 4EJTA 4Y4RA 3KKCA 1Z77A 2R5YB 3NRGA 2JA7J 3V7SA 3WGGA 2M8GX 5F64A 2M4KA 5DCMA 2EZHA 3RYPA 3I4PA 5ED4A 3EUKL 3RYRA 2DO7A 1T33A 3CUQC 4XNFA 2E1MB 1I27A 2HPIA 3GLLA 3X2QH 5L3FA 2IT0A 2X6WA 1O3SA 1OCZH 4OINF 3JRIA 4XKCA 2VJIA 3HOUJ 4FQGA 2HKOA 1Z3XA 3BG9A 3FK6A 2EV0A 3FXQA 4J19A 1KU9A 2M7AA 2VJJA 3K4NA 4EJOA 5IY5H 1IZ1A 3CJQB 4HPQA 2OV7A 2L7KA 3DCFA 1HXDA 3WTXC 1E2XA 2ZJRF 4NC6A 3R6SA 3G71I 4DVYP 1I50J 3M8JA 1YJWI 3E1SA 1BC7C 5JFRA 3CDHA 2LG4A 1WJEA 2DA2A 3LMMA 1J9IA 4A3EJ 1YJNI 3CZ6A 4DBQA 2IA2A 1VZ0A 1W7PD 5E18F 2A6HF 3CCUI 4MK6A 1X19A 1JGGA 4V19K 4UXNA 2R0QC 4F91B 2FJI1 1RKTA 1TLHB 1YHQI 4M6VA 1K61A 4AIKA 2OF7A 4CZCA 2XGDA 2FA5A 1X3UA 4KUMA 3SEQA 2XUBA 4EJWA 4GCTA 1WH5A 1YJ9I 1R7JA 3VW2A 3LSTA 4AD9A 2XF7A 3S15J 5FGLA 1ZK8A 3G56A 4MNUA 5H6QA 2QBYB 4R79A 4JX4A 1X1PA 3HOYJ 2WWYA 4DBRA 2EFNA 1IV6A 1SD6A 4FX0A 3G7RA 4QTRA 3FXRA 3RKXA 1G3WA 1W0UA 4C3IJ 2AXTC 4J00A 1O4XA 3CO6C 1K4SA 1FOKA 1KQ8A 4R8HA 3AAFA 3W2AA 1S3JA 1UZCA 1G8XA 3IP4B 2WAQA 3IWFA 1FP1D 1C0WA 3LSGA 4NHJA 5FLXK 3S5RA 1XB4A 4HF1A 2FBKA 3F6OA 5CLSA 5ILUA 3GTOJ 3TDUC 4LB5A 3ZMDA 2VT3A 3MAJA 2ME0A 2VONA 1WJDA 1YG2A 5D5WB 1HDDC 2MD5A 3H92A 2EIMH 3KE2A 5E1WA 3VVXA 4AM3A 5CQEA 1AKHA 3HZJA 2HI3A 2NP5A 5KAIC 1XTAA 3C2BA 1X1BA 1F1ZA 1RI7A 4XMYA 2P6TA 3HHGA 3TOBA 2D5VA 2FX0A 2K40A 5BQTA 3I4MJ 2DI3A 2M30A 2OU2A 3S8PA 1X3ZB 5B3SH 2WGBA 4NDLA 1LPQA 1UG0A 2QVOA 2YVEA 3SZPA 2VBYA 2LK2A 3ON2A 5IT9Z 3WODF 3HOSA 4XRMA 3E7QA 3CJDA 1B4AA 4GYIA 2B7EA 2PX9A 1Z7UA 5HNFA 3A0HC 2P8TA 2OCCH 2JUCA 1WVRA 3A01A 4L5EA 2P5LC 2QQAA 3IAM2 3KNWA 4I6ZA 2EILH 3BTLA 1LEBA 2LYCA 4NB5A 3K4BA 1IRFA 3GZ5A 1DP3A 3EUHC 3P5JA 2R7DA 2IRFG 2ZNYA 1TWFJ 5M3MJ 1J09A 4C3HJ 3MWMA 1G6NA 3NQOA 1QVUA 2BHZA 2I5UA 2HDCA 2EIKH 4XORA 2P0WA 2VJ4A 2LKPA 3KYLA 3S17J 4NC7A 3WU1B 2HYTA 1FT9A 1Y0UA 3GTKJ 4PFPA 4ZTJA 2MA3A 3FKIJ 2UWMA 3HYIA 2JPBA 2M4GA 1ZQ3P 1NTCA 2XKOA 2E7XA 2ZB9A 4UB6C 1MH3A
chains in the Genus database with same CATH topology
4DYQA 4D7NA 3VOKA 3B6AA 2UXOA 1H88C 2CRGA 5E3NA 4A3LJ 4A3GJ 3AQSA 1NK2P 3JRHA 3QPLA 4RDUA 2R93J 2MW8A 1FTZA 3B6CA 3NI7A 5D19A 2HQ5A 1ETKA 5IP9J 3LSPA 3C07A 5EYRA 1BJZA 2NOGA 2VKEA 4QSHA 2CQXA 2DN0A 3FIWA 2FQ4A 3IH4A 4ABZA 5E3MA 5M5YJ 3HOXJ 1GV2A 4JYKA 3HOWJ 2EZLA 1BA5A 3WHBA 3QPSA 4CYCB 3OSFA 1Z0XA 2QCOA 1E3OC 1RETA 2JA8J 3HKZN 3IV5A 5IPAA 4MIMA 1HDPA 3RZOJ 2UXIA 3RZDJ 3VVZA 2ID3A 1RR7A 3MVPA 4IHXA 3G1LA 3V6GA 4IHWA 3ANGA 3UKGA 4BY1J 5HBUA 1TWHJ 1IJWC 3CMYA 2Y31A 1A5JA 2OERA 1XC5A 2NVYJ 2QOPA 1G2HA 1H8AC 2QWTA 4XICA 5EG0B 2L7ZA 2NS7A 5J1UA 3W6VA 3P9TA 2GM4A 2CUEA 1YRNA 1WCMJ 1ETXA 2DA5A 2E2JJ 5FJ8J 1JKQC 4DZPA 3EUPA 3O8GA 5C4YA 2G7GA 1I3QJ 4D5CA 3TP3A 4D7MA 1MSFC 2COBA 2IBDA 3LSJA 1JKOC 3BJBA 5C3EJ 2EZKA 3PO3J 2XPWA 4IHYA 1P7JA 3CCYA 1LE8A 3VP5A 2LVSA 3BR3A 2YVHA 4NN1A 2Y9YA 4RBOA 1UHSA 4UUSA 3PM1A 3PO2J 1IDZA 5K7FA 1VF9A 1TWCJ 3DEWA 3Q3SA 5EDNA 5JLWA 1UI6A 3H3VK 4FISA 4JX5A 3A02A 1ZR2A 4CGRA 3JSJA 4GCKA 1MH4A 2CU7A 4A93J 4JP0A 3QKXA 4DW6A 1ZKGA 1UG2A 3JRAA 3JR9A 1LE8B 5FLVA 4W1UA 3RD3A 1RPWA 3NAUA 1JTXA 4M3EA 4PXIA 2GUHA 2TCTA 3RKQA 2ZOYA 3F1BA 4G12A 2YU9J 3HGYA 3HOVJ 3S2DJ 4M3GA 1A6IA 5EGOB 1GVDA 2L9RA 2UXPA 2MGQA 3JRCA 2P81A 1BW5A 3BCGA 4W97A 3CQZJ 4JNNA 2QTQA 3D1NI 1ETVA 2R5ZA 1VI0A 1B72B 3BR5A 1PUFB 1ZR4A 1ETOA 4DYCA 4XRSA 1JJ8C 2QIBA 3JREA 4A3MJ 1P7IA 1FIPA 2HXOA 2LFBA 2ECBA 3GTLJ 4GCLA 2VI6A 4AUXA 3FK7A 4MFEA 3Q0UA 4C2MJ 2QKOA 5D1RA 3L1PA 3LJLA 2DJNA 5M3FJ 1OFCX 4YZEA 2V57A 4BKXA 1U9OA 2ELKA 4S0HB 3JRGA 1IRZA 3BQYA 1S7EA 3HDDA 1ETWA 3GBGA 2CQQA 2ME6A 4EEFG 4A3FJ 5HSZA 1LFUP 4UDSA 3SFIA 4CYCA 3BNIA 1T56A 1QVTA 1JUMA 4BY7J 2EH3A 2ZCMA 3COLA 4ICHA 1B8IB 2JMWA 2KT0A 3S16J 3OSGA 2IAIA 4GFBA 2HDDA 3VW1A 3HOZJ 3ON4A 1K83J 5FKLA 2QF7A 1I6HJ 3CRJA 2LR8A 1CQTA 5EZHA 5DS9A 2DMQA 2CUFA 2O7TA 5D18A 1SGMA 4B3AA 4A3JJ 3JRBA 1JTYA 1F43A 2RHAA 3NPIA 5C4XJ 2ZCXA 3BR6A 3K2AA 3LOCA 1POGA 1IC8A 4IHVA 5AQCA 2L0KA 2GBYA 5EG0A 2VKVA 1WPKA 3EGQA 5E3OA 3S14J 3S1QJ 4JX6A 1APLC 3GZIA 4ME9A 3LWJA 1JT6A 5J1YA 5FKMA 3SDGA 2HOSA 1H89C 3V78A 4FCYA 2E2HJ 2L7FP 3S2HJ 2E1OA 3IH3A 5EF6A 2M34A 3LNQA 3ZOBA 3NXCA 1DU6A 2JK3A 2F07A 2M2EA 3SJMA 2ZCNA 1IDYA 2VUMJ 3BRUA 3BR1A 2ECCA 3TW6A 3GTMJ 3BQZA 3BHQA 4ACIA 3M3YJ 3ANPA 3HTAA 1SANA 5F0FA 5C44J 2FJ1A 1HF0A 3JRFA 3CWRA 1GUUA 3ZQFA 5F27A 2RASA 2DA6A 5J1RA 2FBQA 3VUQA 1ENHA 1FTTA 2I10A 3T6NA 5K7HA 3TP0A 5EGOA 4A3KJ 4XIDA 5FHPA 2HOAA 2W53A 3OIOA 4JKZA 3Q0WA 4A3IJ 4FE7A 4HNVA 1VFCA 2W48A 2AHQA 2DMUA 3WHCA 4KWAA 3VIBA 4DYRA 2IEKA 1TWGJ 2WB1N 2XPVA 4B4CA 1WH7A 4QIWN 2LY9A 1B72A 3BG3A 1PUFA 3LHQA 3HTJA 5EZGA 4A69C 4M3BA 1QPIA 5DAJA 5FKKA 3FISA 2IU5A 3HTIA 1X2NA 1X2MA 2OPTA 4GFLA 5IYCJ 1XS9A 3PASA 1HCRA 1IGNA 5K7ZA 1BW6A 2WAQN 4XRSG 1XG1A 2ID6A 3HE0A 3G1OA 3NNRA 2LP0A 4GFKA 2NVXJ 4A3CJ 3GTQJ 1MBEA 2M9HA 3I4NJ 2OI8A 2Q24A 2PBXA 4A3DJ 2DA3A 2XB5A 3BG5A 1X58A 4C3JJ 2KDZA 3GTGJ 1B8IA 4I76A 2NS8A 5IYBJ 2R5YA 4D5FA 3K7AJ 1GT0C 2NP3A 3CDLA 2H8RA 1ORKA 2NVTJ 5FLMJ 1GV5A 3A03A 2JA5J 5CXIA 2JJ7A 5IYDJ 1GDTA 2GFNA 2X9DA 2GLOA 3PPBA 1RESA 4X6AJ 4M3DA 2AO9A 5FMPA 1MBGA 3NARA 1MBHA 2JN6A 4BBSJ 2LLKA 3HBLA 2XGEA 3GEUA 2DG7A 1DU0A 2B63J 3KKCA 1Z77A 3E7LA 4LOCA 9ANTA 2R5YB 3NRGA 5IP7J 2JA7J 3MN2A 2M8GX 2XGCA 2EZHA 3RQIA 4B1RA 1ETYA 5J3LA 1T33A 4MLOA 1U8BA 2NX4A 3BTCA 1OCTC 1RKWA 3VPRA 1HOMA 3QBMA 3DPJA 4A3BJ 2RAEA 3JRIA 2LD5A 3S1NJ 4FTHA 2EBIA 2O9LA 3HOUJ 1Q1VA 3Q0VA 3BG9A 2PZ9A 2E19A 3FK6A 2TRTA 1W0TA 4J19A 2DMPA 1MNMC 4JL3A 2O8KA 4HKUA 4V2FA 4IEJA 3TEDA 1JT0A 4MXMA 2JA6J 2VPRA 3LSRA 3S1MJ 1FIAA 2XDNA 3BTIA 1VNDA 3DCFA 2N8GA 3OOUA 1MBJA 3B81A 3H0GJ 1I50J 2HOTA 5FKNA 1UMQA 3S1RJ 1UI5A 3HIMA 5IOYA 2E2IJ 2HYJA 2DMTA 1ITYA 2DA2A 3JRDA 1U78A 3HM5A 4A3EJ 5H9TA 2UXUA 3FRQA 2DA7A 3F0CA 2R92J 3HGGA 2YUSA 4MK6A 1JGGA 2K9QA 2XB0X 3BT9A 2R0QC 1JUSA 1RKTA 1OCPA 1JJ6C 3BR0A 3BR2A 1JKPC 3RH2A 4M6VA 1K61A 2ZOZA 2OF7A 2XGDA 5F0CA 2REKA 4GCTA 1MSEC 1WH5A 5BNGA 4MFDA 3HTHA 3VW2A 3S15J 5CXGA 1ZK8A 5GPAA 1HLVA 5F08A 2CJJA 5DTDA 3TW7A 1JKRC 3G56A 2DG8A 4JX4A 1D5YA 3HOYJ 1Y1VJ 1U9NA 2K9NA 3MKLA 4MO7A 3GTJJ 1IV6A 2XRLA 3MNLA 4Y7NJ 3G7RA 4QTRA 3QQAA 3IH2A 1W0UA 5FKOA 3GTPJ 4C3IJ 3O60A 1FEXA 1O4XA 5CW8A 4Y52J 4BBRJ 2XPUA 1FJLA 1ETQA 4M3FA 1F36A 1MBKA 4V2GA 1MBFA 3LSGA 3S5RA 5HODA 5IOZA 2DTZA 2Y2ZA 3ZQIA 2G7SA 2LTPA 1YRNB 3GTOJ 5EEAA 4AF5A 4UUTA 2MG4A 2DA4A 2ME0A 3VW0A 5GPCA 1AHDP 3G1MA 1HDDC 1WI3A 2Y0SN 1OJLA 3HEFA 3VVXA 2EQRA 5FGLA 5EFYA 1IG7A 5IP6A 1AKHA 5M5XJ 2HI3A 1BL0A 2NP5A 4NELA 1ZTRA 3C2BA 2G7LA 4XK4A 2K9SA 1R9TJ 1IUFA 2NVQJ 2Y30A 2WUIA 4L62A 5E3LA 4AC0A 2D5VA 2WV1A 2FX0A 2K40A 3BTJA 4X1EA 5GP9A 1TC3C 3I4MJ 5K58A 4AYBN 5F0HA 2HKUA 4UUSB 2WGBA 4NDLA 4FE4A 2R7ZJ 2YVEA 3ZQGA 2H1KA 4BXXJ 2G0EA 2LK2A 2MSYA 3O8HA 2X6OA 3IUVA 3ON2A 2DMNA 4XRMA 3E7QA 1AKHB 2EZIA 3CJDA 1EF4A 5HAWA 3A01A 1Y1WJ 2YS9A 4L5EA 3KNWA 1SFOJ 4I6ZA 3BTLA 2UXHA 1NK3P 1TWAJ 2FD5A 4DZJA 2DA1A 3HB9A 1TWFJ 5M3MJ 5C4JJ 4C3HJ 1ZGWA 1QVUA 2PMZN 2X48A 4AC6A 2G3BA 3S17J 2M0CA 1JUPA 3ZQLA 2HYTA 3ZQCA 3KZ9A 2XSDC 5F04A 3A01B 2GENA 2R5ZB 3GTKJ 3KKDA 3VOXA 2HXIA 3AQTA 3FKIJ 3ZQHA 2LKXA 1QRYA 1AU7A 2O7OA 5M5WJ 3M4OJ 2D6YA 1ZQ3P 1NTCA 5F1JA 2Y9ZA 3VVYA 2L7MP 5JLXA 2ZB9A 2JWTA 1LFBA 1MH3A 1WGXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DYQ A;  4D7N A;  3VOK A;  3B6A A;  2UXO A;  1H88 C;  2CRG A;  5E3N A;  4A3L J;  4A3G J;  3AQS A;  1NK2 P;  3JRH A;  3QPL A;  4RDU A;  2R93 J;  2MW8 A;  1FTZ A;  3B6C A;  3NI7 A;  5D19 A;  2HQ5 A;  1ETK A;  5IP9 J;  3LSP A;  3C07 A;  5EYR A;  1BJZ A;  2NOG A;  2VKE A;  4QSH A;  2CQX A;  2DN0 A;  3FIW A;  2FQ4 A;  3IH4 A;  4ABZ A;  5E3M A;  5M5Y J;  3HOX J;  1GV2 A;  4JYK A;  3HOW J;  2EZL A;  1BA5 A;  3WHB A;  3QPS A;  4CYC B;  3OSF A;  1Z0X A;  2QCO A;  1E3O C;  1RET A;  2JA8 J;  3HKZ N;  3IV5 A;  5IPA A;  4MIM A;  1HDP A;  3RZO J;  2UXI A;  3RZD J;  3VVZ A;  2ID3 A;  1RR7 A;  3MVP A;  4IHX A;  3G1L A;  3V6G A;  4IHW A;  3ANG A;  3UKG A;  4BY1 J;  5HBU A;  1TWH J;  1IJW C;  3CMY A;  2Y31 A;  1A5J A;  2OER A;  1XC5 A;  2NVY J;  2QOP A;  1G2H A;  1H8A C;  2QWT A;  4XIC A;  5EG0 B;  2L7Z A;  2NS7 A;  5J1U A;  3W6V A;  3P9T A;  2GM4 A;  2CUE A;  1YRN A;  1WCM J;  1ETX A;  2DA5 A;  2E2J J;  5FJ8 J;  1JKQ C;  4DZP A;  3EUP A;  3O8G A;  5C4Y A;  2G7G A;  1I3Q J;  4D5C A;  3TP3 A;  4D7M A;  1MSF C;  2COB A;  2IBD A;  3LSJ A;  1JKO C;  3BJB A;  5C3E J;  2EZK A;  3PO3 J;  2XPW A;  4IHY A;  1P7J A;  3CCY A;  1LE8 A;  3VP5 A;  2LVS A;  3BR3 A;  2YVH A;  4NN1 A;  2Y9Y A;  4RBO A;  1UHS A;  4UUS A;  3PM1 A;  3PO2 J;  1IDZ A;  5K7F A;  1VF9 A;  1TWC J;  3DEW A;  3Q3S A;  5EDN A;  5JLW A;  1UI6 A;  3H3V K;  4FIS A;  4JX5 A;  3A02 A;  1ZR2 A;  4CGR A;  3JSJ A;  4GCK A;  1MH4 A;  2CU7 A;  4A93 J;  4JP0 A;  3QKX A;  4DW6 A;  1ZKG A;  1UG2 A;  3JRA A;  3JR9 A;  1LE8 B;  5FLV A;  4W1U A;  3RD3 A;  1RPW A;  3NAU A;  1JTX A;  4M3E A;  4PXI A;  2GUH A;  2TCT A;  3RKQ A;  2ZOY A;  3F1B A;  4G12 A;  2YU9 J;  3HGY A;  3HOV J;  3S2D J;  4M3G A;  1A6I A;  5EGO B;  1GVD A;  2L9R A;  2UXP A;  2MGQ A;  3JRC A;  2P81 A;  1BW5 A;  3BCG A;  4W97 A;  3CQZ J;  4JNN A;  2QTQ A;  3D1N I;  1ETV A;  2R5Z A;  1VI0 A;  1B72 B;  3BR5 A;  1PUF B;  1ZR4 A;  1ETO A;  4DYC A;  4XRS A;  1JJ8 C;  2QIB A;  3JRE A;  4A3M J;  1P7I A;  1FIP A;  2HXO A;  2LFB A;  2ECB A;  3GTL J;  4GCL A;  2VI6 A;  4AUX A;  3FK7 A;  4MFE A;  3Q0U A;  4C2M J;  2QKO A;  5D1R A;  3L1P A;  3LJL A;  2DJN A;  5M3F J;  1OFC X;  4YZE A;  2V57 A;  4BKX A;  1U9O A;  2ELK A;  4S0H B;  3JRG A;  1IRZ A;  3BQY A;  1S7E A;  3HDD A;  1ETW A;  3GBG A;  2CQQ A;  2ME6 A;  4EEF G;  4A3F J;  5HSZ A;  1LFU P;  4UDS A;  3SFI A;  4CYC A;  3BNI A;  1T56 A;  1QVT A;  1JUM A;  4BY7 J;  2EH3 A;  2ZCM A;  3COL A;  4ICH A;  1B8I B;  2JMW A;  2KT0 A;  3S16 J;  3OSG A;  2IAI A;  4GFB A;  2HDD A;  3VW1 A;  3HOZ J;  3ON4 A;  1K83 J;  5FKL A;  2QF7 A;  1I6H J;  3CRJ A;  2LR8 A;  1CQT A;  5EZH A;  5DS9 A;  2DMQ A;  2CUF A;  2O7T A;  5D18 A;  1SGM A;  4B3A A;  4A3J J;  3JRB A;  1JTY A;  1F43 A;  2RHA A;  3NPI A;  5C4X J;  2ZCX A;  3BR6 A;  3K2A A;  3LOC A;  1POG A;  1IC8 A;  4IHV A;  5AQC A;  2L0K A;  2GBY A;  5EG0 A;  2VKV A;  1WPK A;  3EGQ A;  5E3O A;  3S14 J;  3S1Q J;  4JX6 A;  1APL C;  3GZI A;  4ME9 A;  3LWJ A;  1JT6 A;  5J1Y A;  5FKM A;  3SDG A;  2HOS A;  1H89 C;  3V78 A;  4FCY A;  2E2H J;  2L7F P;  3S2H J;  2E1O A;  3IH3 A;  5EF6 A;  2M34 A;  3LNQ A;  3ZOB A;  3NXC A;  1DU6 A;  2JK3 A;  2F07 A;  2M2E A;  3SJM A;  2ZCN A;  1IDY A;  2VUM J;  3BRU A;  3BR1 A;  2ECC A;  3TW6 A;  3GTM J;  3BQZ A;  3BHQ A;  4ACI A;  3M3Y J;  3ANP A;  3HTA A;  1SAN A;  5F0F A;  5C44 J;  2FJ1 A;  1HF0 A;  3JRF A;  3CWR A;  1GUU A;  3ZQF A;  5F27 A;  2RAS A;  2DA6 A;  5J1R A;  2FBQ A;  3VUQ A;  1ENH A;  1FTT A;  2I10 A;  3T6N A;  5K7H A;  3TP0 A;  5EGO A;  4A3K J;  4XID A;  5FHP A;  2HOA A;  2W53 A;  3OIO A;  4JKZ A;  3Q0W A;  4A3I J;  4FE7 A;  4HNV A;  1VFC A;  2W48 A;  2AHQ A;  2DMU A;  3WHC A;  4KWA A;  3VIB A;  4DYR A;  2IEK A;  1TWG J;  2WB1 N;  2XPV A;  4B4C A;  1WH7 A;  4QIW N;  2LY9 A;  1B72 A;  3BG3 A;  1PUF A;  3LHQ A;  3HTJ A;  5EZG A;  4A69 C;  4M3B A;  1QPI A;  5DAJ A;  5FKK A;  3FIS A;  2IU5 A;  3HTI A;  1X2N A;  1X2M A;  2OPT A;  4GFL A;  5IYC J;  1XS9 A;  3PAS A;  1HCR A;  1IGN A;  5K7Z A;  1BW6 A;  2WAQ N;  4XRS G;  1XG1 A;  2ID6 A;  3HE0 A;  3G1O A;  3NNR A;  2LP0 A;  4GFK A;  2NVX J;  4A3C J;  3GTQ J;  1MBE A;  2M9H A;  3I4N J;  2OI8 A;  2Q24 A;  2PBX A;  4A3D J;  2DA3 A;  2XB5 A;  3BG5 A;  1X58 A;  4C3J J;  2KDZ A;  3GTG J;  1B8I A;  4I76 A;  2NS8 A;  5IYB J;  2R5Y A;  4D5F A;  3K7A J;  1GT0 C;  2NP3 A;  3CDL A;  2H8R A;  1ORK A;  2NVT J;  5FLM J;  1GV5 A;  3A03 A;  2JA5 J;  5CXI A;  2JJ7 A;  5IYD J;  1GDT A;  2GFN A;  2X9D A;  2GLO A;  3PPB A;  1RES A;  4X6A J;  4M3D A;  2AO9 A;  5FMP A;  1MBG A;  3NAR A;  1MBH A;  2JN6 A;  4BBS J;  2LLK A;  3HBL A;  2XGE A;  3GEU A;  2DG7 A;  1DU0 A;  2B63 J;  3KKC A;  1Z77 A;  3E7L A;  4LOC A;  9ANT A;  2R5Y B;  3NRG A;  5IP7 J;  2JA7 J;  3MN2 A;  2M8G X;  2XGC A;  2EZH A;  3RQI A;  4B1R A;  1ETY A;  5J3L A;  1T33 A;  4MLO A;  1U8B A;  2NX4 A;  3BTC A;  1OCT C;  1RKW A;  3VPR A;  1HOM A;  3QBM A;  3DPJ A;  4A3B J;  2RAE A;  3JRI A;  2LD5 A;  3S1N J;  4FTH A;  2EBI A;  2O9L A;  3HOU J;  1Q1V A;  3Q0V A;  3BG9 A;  2PZ9 A;  2E19 A;  3FK6 A;  2TRT A;  1W0T A;  4J19 A;  2DMP A;  1MNM C;  4JL3 A;  2O8K A;  4HKU A;  4V2F A;  4IEJ A;  3TED A;  1JT0 A;  4MXM A;  2JA6 J;  2VPR A;  3LSR A;  3S1M J;  1FIA A;  2XDN A;  3BTI A;  1VND A;  3DCF A;  2N8G A;  3OOU A;  1MBJ A;  3B81 A;  3H0G J;  1I50 J;  2HOT A;  5FKN A;  1UMQ A;  3S1R J;  1UI5 A;  3HIM A;  5IOY A;  2E2I J;  2HYJ A;  2DMT A;  1ITY A;  2DA2 A;  3JRD A;  1U78 A;  3HM5 A;  4A3E J;  5H9T A;  2UXU A;  3FRQ A;  2DA7 A;  3F0C A;  2R92 J;  3HGG A;  2YUS A;  4MK6 A;  1JGG A;  2K9Q A;  2XB0 X;  3BT9 A;  2R0Q C;  1JUS A;  1RKT A;  1OCP A;  1JJ6 C;  3BR0 A;  3BR2 A;  1JKP C;  3RH2 A;  4M6V A;  1K61 A;  2ZOZ A;  2OF7 A;  2XGD A;  5F0C A;  2REK A;  4GCT A;  1MSE C;  1WH5 A;  5BNG A;  4MFD A;  3HTH A;  3VW2 A;  3S15 J;  5CXG A;  1ZK8 A;  5GPA A;  1HLV A;  5F08 A;  2CJJ A;  5DTD A;  3TW7 A;  1JKR C;  3G56 A;  2DG8 A;  4JX4 A;  1D5Y A;  3HOY J;  1Y1V J;  1U9N A;  2K9N A;  3MKL A;  4MO7 A;  3GTJ J;  1IV6 A;  2XRL A;  3MNL A;  4Y7N J;  3G7R A;  4QTR A;  3QQA A;  3IH2 A;  1W0U A;  5FKO A;  3GTP J;  4C3I J;  3O60 A;  1FEX A;  1O4X A;  5CW8 A;  4Y52 J;  4BBR J;  2XPU A;  1FJL A;  1ETQ A;  4M3F A;  1F36 A;  1MBK A;  4V2G A;  1MBF A;  3LSG A;  3S5R A;  5HOD A;  5IOZ A;  2DTZ A;  2Y2Z A;  3ZQI A;  2G7S A;  2LTP A;  1YRN B;  3GTO J;  5EEA A;  4AF5 A;  4UUT A;  2MG4 A;  2DA4 A;  2ME0 A;  3VW0 A;  5GPC A;  1AHD P;  3G1M A;  1HDD C;  1WI3 A;  2Y0S N;  1OJL A;  3HEF A;  3VVX A;  2EQR A;  5FGL A;  5EFY A;  1IG7 A;  5IP6 A;  1AKH A;  5M5X J;  2HI3 A;  1BL0 A;  2NP5 A;  4NEL A;  1ZTR A;  3C2B A;  2G7L A;  4XK4 A;  2K9S A;  1R9T J;  1IUF A;  2NVQ J;  2Y30 A;  2WUI A;  4L62 A;  5E3L A;  4AC0 A;  2D5V A;  2WV1 A;  2FX0 A;  2K40 A;  3BTJ A;  4X1E A;  5GP9 A;  1TC3 C;  3I4M J;  5K58 A;  4AYB N;  5F0H A;  2HKU A;  4UUS B;  2WGB A;  4NDL A;  4FE4 A;  2R7Z J;  2YVE A;  3ZQG A;  2H1K A;  4BXX J;  2G0E A;  2LK2 A;  2MSY A;  3O8H A;  2X6O A;  3IUV A;  3ON2 A;  2DMN A;  4XRM A;  3E7Q A;  1AKH B;  2EZI A;  3CJD A;  1EF4 A;  5HAW A;  3A01 A;  1Y1W J;  2YS9 A;  4L5E A;  3KNW A;  1SFO J;  4I6Z A;  3BTL A;  2UXH A;  1NK3 P;  1TWA J;  2FD5 A;  4DZJ A;  2DA1 A;  3HB9 A;  1TWF J;  5M3M J;  5C4J J;  4C3H J;  1ZGW A;  1QVU A;  2PMZ N;  2X48 A;  4AC6 A;  2G3B A;  3S17 J;  2M0C A;  1JUP A;  3ZQL A;  2HYT A;  3ZQC A;  3KZ9 A;  2XSD C;  5F04 A;  3A01 B;  2GEN A;  2R5Z B;  3GTK J;  3KKD A;  3VOX A;  2HXI A;  3AQT A;  3FKI J;  3ZQH A;  2LKX A;  1QRY A;  1AU7 A;  2O7O A;  5M5W J;  3M4O J;  2D6Y A;  1ZQ3 P;  1NTC A;  5F1J A;  2Y9Z A;  3VVY A;  2L7M P;  5JLX A;  2ZB9 A;  2JWT A;  1LFB A;  1MH3 A;  1WGX A; 
#chains in the Genus database with same CATH topology
 3C2H A;  4IL6 C;  3G2B A;  3WGH A;  1H88 C;  2CMP A;  4LGW A;  4CIC A;  3LWF A;  3QAH A;  1KZH A;  2DOF A;  1T38 A;  1LJ9 A;  5IP9 J;  5EYR A;  1S9H A;  1QGP A;  2BV6 A;  2NOG A;  2VKE A;  2ZSI B;  4IRV A;  4II3 A;  1GV2 A;  5FB2 A;  1BA5 A;  1G3Y A;  2H94 A;  2ZXJ A;  2B0L A;  2K4B A;  2LBF A;  2L01 A;  1SFK A;  1E3O C;  3A1Y A;  2V79 A;  4PGG A;  3I53 A;  5IPA A;  3AG2 H;  1QZY A;  5HOO A;  1HDP A;  2UXI A;  3H0D A;  1ZG5 A;  3VVZ A;  1TP4 A;  3MVP A;  1BR4 A;  2ZME A;  4UVB A;  1ZN2 A;  2QQB A;  3OYI A;  3RPU D;  4ENK A;  2VLA A;  1A5J A;  5KNL A;  1X3W B;  2OER A;  3VTI A;  2K02 A;  4KIB A;  2VN2 A;  2V7F A;  4UVC A;  1H8A C;  4XIC A;  3W6V A;  3K4K A;  3EUA A;  2GM4 A;  4LLL A;  4NQW B;  1ETX A;  2DA5 A;  2EB7 A;  2DTR A;  3P9I A;  3CO7 C;  3I64 A;  3O8G A;  2NNN A;  4M9S A;  2KP6 A;  2G7G A;  4PJ0 C;  2WY8 Q;  3E6C C;  1MSF C;  2COB A;  3BJB A;  4PFO A;  2Q1Z B;  3ABL H;  3MEX A;  5TGT A;  2XPW A;  4IHY A;  1AA7 A;  1LE8 A;  2LVS A;  4I7H A;  2YVH A;  4NN1 A;  2IPQ X;  5E20 A;  3CMM A;  2KRC A;  4Q48 A;  4GGG A;  2CWE A;  3PO2 J;  2VE8 A;  2XGX A;  3K2Z A;  3JSO A;  2HGC A;  1TWC J;  1R5G A;  1GLN A;  1UI6 A;  3JSJ A;  4A93 J;  2WV0 A;  2DW4 A;  3W2V A;  4QPO A;  1WJB A;  1ZLJ A;  1UG2 A;  1ZKG A;  4I02 A;  3JR9 A;  2E1C A;  5FLV A;  2P5K A;  3RD3 A;  1LUJ B;  1JTX A;  3CCM I;  3QPT A;  4PXI A;  1S5L C;  3DEU A;  3F1B A;  3HGY A;  4KIT B;  3S2D J;  4YFX F;  4CXF A;  2A69 F;  2DCE A;  5EGO B;  1GVD A;  2L9R A;  2F6C A;  3PIO F;  2OBP A;  1R49 A;  5B1A H;  2BW3 A;  1VQ7 I;  5CVV A;  3BCG A;  4W97 A;  4XSZ F;  5JR3 A;  1JI8 A;  3HPG A;  4IRG A;  4CYD A;  3L09 A;  3H5A A;  4UHT A;  1VI0 A;  2G7U A;  2MBF A;  3SQN A;  4ASN A;  1B72 B;  3AKZ A;  1JJ8 C;  2KZV A;  3DKW A;  1FIP A;  1FYK A;  2ECB A;  2VQG A;  3GTL J;  3DKX A;  4AUX A;  4LIT A;  3FK7 A;  5DD8 A;  3T1B A;  2E5Z A;  4IQJ A;  1YIO A;  4GDF A;  4WF2 A;  4G6Q A;  3JRG A;  2RV8 A;  1R36 A;  2A61 A;  3DU5 A;  5D5X B;  3R61 A;  2ME6 A;  3QRF F;  4KN7 X;  1HBX G;  5HSZ A;  2MFZ A;  3BNI A;  4JK1 X;  2D2W A;  1P6R A;  1B8I B;  1FSH A;  3S16 J;  4Y15 A;  4GFB A;  3VW1 A;  4I09 A;  4E7L A;  1TL8 A;  2KL4 A;  1I6H J;  2QF7 A;  3H3U A;  2ISZ A;  3H35 A;  3CRJ A;  2LR8 A;  3HRM A;  4D1Q A;  3H9G A;  2ESN A;  3U2R A;  3FMS A;  5D18 A;  1P4A A;  1TT5 B;  1VQM I;  4A3J J;  4XQF A;  1EV7 A;  4EQQ A;  4EVI A;  1VQK I;  1TQI A;  2LY1 A;  3BR6 A;  2DK5 A;  4E7J A;  4IHV A;  5AQC A;  2L0K A;  3MD2 A;  1MDM B;  4IHT A;  1USS A;  5EG0 A;  1UFM A;  1Z6R A;  1ZHF A;  2ZFU A;  3RSN A;  3M1E A;  4ZYD A;  1LNW A;  1TBX A;  1J0R A;  4JX6 A;  2H6B A;  1I1S A;  1MD0 A;  2IXS A;  3HIF A;  3ULQ B;  1LB2 A;  1EH6 A;  1IUY A;  5J1Y A;  1REP C;  4RAF A;  3LWJ A;  3SDG A;  2R7O A;  4LD5 A;  1XGS A;  1H89 C;  3RIR A;  2HEO A;  2RGV A;  2E1O A;  3IH3 A;  4MQ9 F;  1SMY F;  2QLZ A;  3CC2 I;  3ZOB A;  5HDN A;  1O57 A;  2JK3 A;  5GTH C;  2FEZ A;  1MNE A;  2M2E A;  4RGS A;  3RPU A;  3CES A;  5BOX A;  3IUO A;  2VUM J;  3BZC A;  3ABT A;  5HLH A;  1R22 A;  4HX4 A;  3M1C A;  1IN8 A;  2BHY A;  2Z1D A;  3BQZ A;  3DV8 A;  5BPI A;  3BHQ A;  2BOL A;  2OZ6 A;  5D5V B;  3LFK A;  3VYT B;  2GXB A;  3ZMV A;  3ANP A;  4CUG A;  2L5Q A;  5JVT A;  2HYG D;  5DM6 F;  3SXY A;  4A12 A;  4KJZ A;  2LF8 A;  1Z9C A;  1QPM A;  5J1R A;  2PEX A;  3VUQ A;  1D3Y A;  2W7N A;  1AWC A;  3HOT A;  1FOY A;  1ODD A;  3BPV A;  4D0P A;  3GXO A;  4RB0 A;  5HDG A;  4L9N A;  2P7C B;  1X1D A;  2HOA A;  3WTW C;  2L4M A;  3Q0W A;  1TT0 A;  4A3I J;  4C2U A;  2DMU A;  3WHC A;  1HKS A;  1N77 A;  2VPL A;  2F5V A;  3FMQ A;  4L9J A;  4H0E A;  3UR3 C;  3O6B B;  5AIP A;  3J80 Z;  1TWG J;  5H6R A;  3IKT A;  4ZYH A;  4OU0 A;  1ZH5 A;  1WH7 A;  1ON2 A;  2KHM A;  2LY9 A;  4OIQ F;  1PUF A;  3J81 K;  1J59 A;  4Y17 A;  1RNL A;  4ZDL A;  3N97 A;  1IF1 A;  2FQ3 A;  3K8P C;  2MAB A;  2DDB A;  1MGT A;  2DOD A;  3FIS A;  2CUZ A;  1DP7 P;  2VOO A;  4YIF A;  3H9J A;  1HW1 A;  3ML6 A;  3OS1 A;  3PAS A;  5DD4 A;  3FF5 A;  4LLN A;  1BW6 A;  4M6X A;  4XRS G;  1YQA A;  2ID6 A;  2XHK A;  3G1O A;  1B6A A;  2E36 A;  3ISP A;  4EV0 A;  5F1R A;  3I4N J;  2PBX A;  4A3D J;  2XB5 A;  3BG5 A;  2KIQ A;  1H0M A;  2KDZ A;  3GTG J;  5DCF A;  4I76 A;  2NS8 A;  3I55 I;  2R5Y A;  1QZE A;  2JQ7 A;  4JOM A;  1GT0 C;  3CDL A;  2CFX A;  2H8R A;  4B44 A;  1DGR M;  1GV5 A;  3MMY B;  5ILV A;  5LGU A;  2V9V A;  1GDT A;  4ZZD A;  4X6A J;  1D8J A;  2AO9 A;  5ICC A;  5K5R A;  1ZYR F;  3ERM A;  2PQ8 A;  1FYL A;  2LKS A;  4BBS J;  4YIR X;  1Y6I A;  1U0J A;  2V9K A;  2F2E A;  5A2Q Z;  1MW7 A;  2XGE A;  3LSI A;  2EFW A;  2AQF A;  3E7L A;  9ANT A;  1K4T A;  2R7T A;  3HKZ A;  4KIG A;  1EH7 A;  4EM2 A;  3MN2 A;  5FFZ A;  3KZI C;  4XKV A;  2EFQ A;  3RQI A;  4B1R A;  1ETY A;  5J3L A;  1U8B A;  4RA2 A;  3BC8 A;  2RNJ A;  1RKW A;  1HOM A;  3DPT A;  4BE1 A;  2HFH A;  2GXA A;  4FTH A;  1IXC A;  1YS6 A;  4L0Y B;  3Q0V A;  4YG2 F;  3HG9 A;  3CF5 F;  2PZ9 A;  1MNM C;  2DMP A;  5CKT A;  2O8K A;  4V2F A;  2E60 A;  3WTY C;  5GAD J;  4MXM A;  2VPR A;  2WAD A;  1S72 I;  3VWB A;  1O3T A;  3S1M J;  3QOD A;  3GO5 A;  4YFK F;  5J8C A;  2DXI A;  2N8G A;  4L5J A;  1MND A;  4PJN A;  4BJ5 C;  2DT6 A;  3CUQ A;  1BI1 A;  3E6B A;  2EIN H;  3P9C A;  3S1R J;  3RPQ A;  1UI5 A;  1GXP A;  2HQA A;  3SZG A;  4I99 C;  1XN7 A;  1Y39 A;  4HLY A;  1UJ8 A;  1UEL B;  2UXU A;  5AIQ A;  3L9F A;  2R92 J;  3FXK A;  1YIT I;  1KYW A;  1V4R A;  2YR2 A;  1R5I D;  1D1B A;  1JUS A;  3CUO A;  5D8K B;  3L2U A;  3HSR A;  2EFP A;  2Y75 A;  3I0T A;  3BR0 A;  3BR2 A;  1JKP C;  2KFD A;  1VQ9 I;  3RH2 A;  1JHF A;  2VBW A;  2PLY A;  2HQR A;  3WTS C;  3FHN A;  2MH2 A;  5GPA A;  1V3F A;  1JKR C;  1WKM A;  2UUZ A;  4PK4 A;  4G6T B;  3FXL A;  2DLL A;  3MQ0 A;  3JSP A;  1XDU A;  2EPF A;  3QOE A;  2M7B A;  3GTJ J;  5DYM A;  4Y7N J;  2J5O A;  2M1B A;  2DPU A;  2CUJ A;  5J40 A;  3IH2 A;  3DTE A;  5FKO A;  3GTP J;  2EWN A;  3E97 A;  1MJA A;  4ZTF A;  3F8B A;  4Y52 J;  1R4N B;  3ZMU A;  2IJL A;  1IXS B;  3VDX A;  2HOE A;  4PJM A;  4Z2Y A;  1FJL A;  3ZP5 A;  2IGN A;  2DOA A;  5HVQ C;  1ETQ A;  1F36 A;  4DNC A;  4TV7 A;  4U87 A;  5JI6 A;  5HOD A;  5CVU A;  4IRI A;  3ZQI A;  4U0Y A;  3JAM K;  3DLL F;  3CC4 I;  4HDU A;  3F3X A;  1YRN B;  4GRI A;  5EEA A;  4AF5 A;  2MG4 A;  2UV1 A;  5GPC A;  1HST A;  4B3X A;  1RC9 A;  1XCB A;  2E1M C;  2R7V A;  1IG7 A;  5IP6 A;  5M5X J;  4KMF A;  1ZTR A;  5FD6 A;  4OWR B;  1IUF A;  2NVQ J;  3JTH A;  3KZY A;  2WUI A;  5E3L A;  4BAY A;  4L62 A;  4X1E A;  5K58 A;  3QPH A;  1XX5 A;  2KJC A;  2VQL A;  4HV6 A;  5FO5 A;  2NYX A;  3OIQ A;  1OIS A;  3BLY A;  3ZQG A;  3K4L A;  2H1K A;  4BXX J;  2BXY A;  3OS2 A;  1A36 A;  2FSW A;  2X6O A;  3S3N A;  2DFF A;  2DMN A;  2KZG A;  3DKY A;  2EZI A;  3Q9S A;  5HAW A;  4IVN A;  1PUE E;  2Q2E B;  2CSO A;  2YS9 A;  1Y1W J;  1SFO J;  3A0B C;  1QBJ A;  2ESH A;  2VQH A;  3G3Z A;  1YI2 I;  2UXH A;  4NBQ A;  4H4K C;  4KT6 A;  3GVA A;  1NHA A;  3TO6 A;  2FD5 A;  4E7K A;  4UUV A;  1QO0 D;  3HSF A;  2DA1 A;  1IRX A;  2DQL A;  2ZKZ A;  1ZGW A;  1KU7 A;  3GFI A;  2F5D A;  2PMH A;  1DPU A;  2X48 A;  1MIJ A;  1DDN A;  2G3B A;  3U9G A;  2XSD C;  3R0J A;  3AG4 H;  3FXJ A;  3WE3 A;  4ESJ A;  2R5Z B;  2RNG A;  2GEN A;  3KKD A;  3F72 A;  2HXI A;  2MC4 A;  2O7O A;  5M5W J;  2D6Y A;  4HX8 A;  2Y9Z A;  3VVY A;  4YII A;  3REO A;  5JLX A;  2BY2 A;  3DP7 A;  1D0Y A;  2JWT A;  1LEA A;  1BR1 A;  1S8N A;  1WGX A;  4WCG A;  4BS9 A;  1G3T A;  2L4A A;  1HC8 A;  4XLF A;  3B6A A;  2UXO A;  2W4S A;  3EUH A;  3Q5F A;  2Z99 A;  1SC7 A;  1H9G A;  3AQS A;  3QPL A;  3H3Z A;  1EKE A;  3E5U A;  2HQ5 A;  2D45 A;  2XF6 A;  1FSE A;  1ZLK A;  3C07 A;  4KDP A;  4QSH A;  2YU3 A;  3KX2 A;  3IH4 A;  2IVM A;  2LSO A;  1TNT A;  5D4R A;  3QPS A;  1EH8 A;  3ROU A;  4CYC B;  1R4M B;  2F48 A;  3E6M A;  1Z0X A;  2XAG A;  4RLQ A;  2XDV A;  1RET A;  3HL2 A;  3JW4 A;  1CF7 A;  4NQW A;  1RUO A;  4XLN F;  2JVG A;  2XIG A;  3FXU A;  5L3C A;  3CLQ A;  1RR7 A;  3LFU A;  4IHW A;  4BY1 J;  4XL9 A;  5KAF C;  1IJW C;  1L0O C;  3TDZ C;  4DIQ A;  3VSL A;  3PFY A;  3F8M A;  3H5R A;  1XC5 A;  3J80 K;  1FPQ A;  2L7Z A;  2NS7 A;  3LA7 A;  2CUE A;  2LRD A;  5ICF A;  1XMA A;  1UAA A;  4DZP A;  3BY6 A;  3EUP A;  4LIV A;  2W85 A;  2XAU A;  1I3Q J;  3EYY A;  1IXR C;  1FBQ A;  1XGO A;  4AVP A;  1RZ4 A;  1OYW A;  5CJ9 A;  3BPX A;  3RKY A;  1JKO C;  2EZK A;  3GUD A;  2IGO A;  1Z7L A;  3RQ4 A;  2VC1 A;  2VBZ A;  3OYH A;  2Y9Y A;  4ZYE A;  3GWZ A;  2CV2 A;  3ZMZ A;  2A3S A;  2EA2 A;  3LAP A;  4A2U A;  1UHS A;  3I71 A;  1KU3 A;  2W25 A;  4PJJ A;  3SDB A;  3PM1 A;  4UUS A;  3AL0 B;  5L3D A;  1VF9 A;  2KIS A;  2VL8 A;  3VOD A;  1FWZ A;  5EDN A;  3FBN B;  2OAZ A;  3H3V K;  4FIS A;  4JX5 A;  2X1D A;  3A02 A;  3FXO A;  4PCQ A;  1W36 C;  1SFX A;  2CU7 A;  2GWR A;  3H9Q A;  1MMG A;  5D4S A;  1K78 B;  3ABK H;  1D1C A;  1D1A A;  2PI0 A;  2W82 A;  4BYY A;  5DUI A;  2ICW G;  4BE2 A;  1IW7 F;  3RKQ A;  4AIJ A;  3HOV J;  1T6S A;  4QPQ A;  1MMN A;  4M3G A;  3KIO A;  2O03 A;  5E8I A;  4RLF A;  3NWS A;  3FZV A;  3JRC A;  2E71 A;  2HWV A;  3OOP A;  1ZEL A;  1OYI A;  1XMK A;  2P4W A;  2K4J A;  2PFB A;  4XON A;  3FM3 A;  2Z9O A;  1ZRE A;  4XSX F;  2HZD A;  1O3Q A;  2QTQ A;  2F5E A;  2KLO A;  2WY7 Q;  3D1N I;  5EEG A;  3F22 A;  2BXZ A;  1ETV A;  3VFZ A;  3DF8 A;  4LFU A;  1B9N A;  3QP6 A;  4GO1 A;  2V1X A;  2COM A;  2QIB A;  3JRE A;  1BBY A;  2V26 A;  4A3M J;  4DGW B;  3H5N A;  4WIB A;  4B8X A;  4I0B A;  3L1P A;  2DJN A;  3OYK A;  2R7S A;  3CTA A;  1T98 A;  1OFC X;  4YZE A;  4XRF A;  2V57 A;  5ICE A;  2HVQ A;  5J47 A;  1IRZ A;  3CMA I;  3BZ6 A;  1FBU A;  4AWX B;  4EEF G;  4BEH A;  1MKM A;  4S05 A;  1XGM A;  3SFI A;  3TO9 A;  4UDS A;  4BY7 J;  5LGT A;  1MDM A;  2EH3 A;  2MYS A;  5ICG A;  5JHF A;  2A6T A;  2ZCM A;  4ICH A;  2H1L A;  2JMW A;  2FRH A;  2KT0 A;  3KZZ A;  1T8I A;  4B09 A;  2A5Y B;  5GAH J;  3GEZ A;  1DGW Y;  5L3B A;  3J7A O;  1CQT A;  1ON1 A;  5EZH A;  5DS9 A;  1R00 A;  4KYW A;  1M1E B;  2DMQ A;  1BOB A;  1FMV A;  4B3A A;  1IAW A;  1MMS A;  3AG3 H;  3JRB A;  2PFV A;  1F43 A;  4RB3 C;  2OQG A;  2ZCX A;  1I3A A;  3K2A A;  4BHB A;  3K1M A;  3LOC A;  1POG A;  3CCQ I;  1IC8 A;  5LD2 C;  2VKV A;  3TBI A;  4ZC3 A;  1J2X A;  1VQN I;  2P7V B;  1APL C;  3KP7 A;  1IV8 A;  4CGZ A;  4CO8 A;  2HR3 A;  2L7F P;  3ASO H;  3TKY A;  3VYR B;  3BJA A;  4B43 A;  4L9T A;  3MZH A;  1YS7 A;  2PJR A;  5EEH A;  1TQM A;  3PNY A;  2O6G E;  3TO7 A;  2ZJQ F;  2XAH A;  3SJM A;  1WJ5 A;  1STZ A;  3KEO A;  2ECC A;  4BE0 A;  1BI2 A;  3GTM J;  2M0M A;  3WTZ A;  2ETH A;  3M3Y J;  5F6F A;  3E6D A;  4ESB A;  1SAN A;  5F0F A;  4Q5S F;  1HF0 A;  2VOP A;  3K70 D;  4L5I A;  2K5C A;  5F27 A;  3ZQF A;  2RAS A;  2YSR A;  2EV5 A;  2DA6 A;  3BG7 A;  4BUP A;  2RQQ A;  3M07 A;  2BVM A;  1LVA A;  2ZBK A;  4JBA A;  3DTK A;  3U1D A;  3S32 A;  1KON A;  2Z16 A;  4XID A;  3T8R A;  2W53 A;  3OIO A;  3QU6 A;  3G4S I;  4HNV A;  3DU6 A;  3CJR B;  1VFC A;  2W48 A;  4C30 A;  2AS5 F;  4ENN A;  1YFH A;  1FBS A;  2CH0 A;  3I3L A;  4EAT A;  4KWA A;  3OYC A;  4WXH A;  2WB1 N;  2LMD A;  2GAU A;  3S2W A;  3OYG A;  2LY2 A;  4X0G A;  3IRQ A;  2DYR H;  4F52 A;  1VQL I;  4WX9 A;  4PGH A;  1H9T A;  2RVC A;  4IKF A;  3DWL E;  3QU3 A;  1X2N A;  1X2M A;  1XGN A;  2OPT A;  1YYV A;  1KQ9 A;  5LHH A;  2QSG X;  4RM3 A;  4E7S A;  2GZW A;  2HZT A;  1SVM A;  5TJJ A;  1XS9 A;  4RAY A;  1ZGA A;  4HW0 A;  1B1B A;  5HLG A;  1HCR A;  2QSH X;  2VB6 A;  5KK1 A;  1J75 A;  2X85 A;  3HRU A;  3IRR A;  3LA2 A;  3HE0 A;  3NNR A;  1IN4 A;  4G6D A;  4R1H A;  5KHD A;  2WBM A;  2NVX J;  2V1D A;  4HQE A;  1MBE A;  1QZZ A;  4OIR F;  2M9H A;  2Q24 A;  4XN0 A;  3K9T A;  2X1C A;  2RQP A;  3E5X A;  2HDW A;  4D5F A;  1A04 A;  2OA4 A;  5HLT A;  3K7A J;  5ILS A;  1SD7 A;  2XV4 S;  4RAZ A;  4XR6 A;  5LBQ A;  2NP3 A;  3F23 A;  1W1W E;  3ZPL A;  1QQI A;  3A03 A;  2JA5 J;  2L9V A;  4IXA A;  2VE9 A;  5IYD J;  1SD5 A;  2GLO A;  5BPD A;  4M3D A;  5FMP A;  1MBG A;  2LC2 A;  1MBH A;  4KN4 X;  3L2V A;  3CF2 A;  5CVJ A;  1RRJ A;  3WG9 A;  3HJE A;  2DG7 A;  1DU0 A;  3PSI A;  2DFI A;  1D0X A;  4LOC A;  5IP7 J;  4J01 A;  4BNC A;  1TW2 A;  2XGC A;  3DTI A;  2IS2 A;  4MLO A;  3BTC A;  1YLF A;  3QYF A;  1FX7 A;  1S6L A;  4ZDP A;  3KPH A;  3DPJ A;  3HRT A;  4CH7 A;  2O61 A;  3PUF A;  4BQO A;  2QEX I;  3S1N J;  4GYG A;  2FBI A;  1N25 A;  1BOA A;  2BY3 A;  3P9K A;  2E19 A;  3I58 A;  2TRT A;  2OUM A;  1W0T A;  2R4G A;  2Z5U A;  4L0Z B;  4JL3 A;  1U5T B;  2FNP A;  4HKU A;  3I54 A;  3TED A;  1JT0 A;  3LSR A;  2ZJP F;  3CME I;  3L7W A;  4E6K G;  1FOX A;  2VKD A;  2Z2S B;  3W2W A;  1BIB A;  4HX7 A;  1WZ2 A;  1F9N A;  3H0G J;  4FX4 A;  2HOT A;  1UMQ A;  3BWG A;  3V8K A;  1S29 A;  1BIA A;  2H27 A;  2XF5 A;  2HYJ A;  5K5Q A;  2PN6 A;  1T95 A;  3OIP A;  3FRQ A;  4O3M A;  4ITV A;  5E79 C;  5GAE J;  4CDG A;  2VOD A;  2K9Q A;  3BT9 A;  1IRG A;  4OMY A;  5K1Y A;  1OCP A;  2HQN A;  3GFJ A;  4AVZ A;  3L2R A;  2VXD A;  5BMZ A;  1ONV A;  1B59 A;  1XSD A;  5F0C A;  2REK A;  3J7Y J;  5BNG A;  4MFD A;  4MEX F;  2HTJ A;  3A4C A;  5DV5 A;  3WTT C;  1DUX C;  1UB9 A;  5DTD A;  2E1N A;  5E1X A;  1HKQ A;  2LBF B;  3NS4 A;  2Y0M A;  4RMN A;  4BAC A;  1FLI A;  1Y1V J;  1U9N A;  2K9N A;  3MKL A;  3PJR A;  2LNB A;  2A05 A;  3MNL A;  2XRL A;  5D8L B;  2VC0 A;  2WTE A;  3HHH A;  3O60 A;  1FEX A;  5CW8 A;  2ZME B;  1W7P B;  3ABU A;  2PBI A;  4BH9 A;  5IT9 K;  3HUG A;  2FOW A;  2VIX A;  1MBK A;  4V2G A;  2K27 A;  4RGR A;  4B47 A;  5CYV A;  1PJR A;  1WQ2 A;  2DK8 A;  1WI9 A;  3SYT A;  2Y2Z A;  3ECH A;  2ZSH B;  2R7Q A;  2G7S A;  5D6F A;  2QGU A;  3LSM A;  4QWQ A;  3C2G A;  1NH3 A;  4IZZ A;  2R7F A;  3VYU B;  2CQK A;  2M87 A;  3F8N A;  3TGN A;  4RB1 A;  3G1M A;  2Y0S N;  1WI3 A;  3M9A A;  1OJL A;  3HEF A;  4HOB A;  3IL2 A;  3CP8 A;  5EFY A;  4NEL A;  2CW8 A;  3H36 A;  4LG0 B;  2G7L A;  4XK4 A;  3DBL B;  1R9T J;  3BOQ A;  3KP5 A;  3BDD A;  2WV1 A;  2STW A;  3BTJ A;  5J6X A;  3KP4 A;  3OS0 A;  4AYB N;  2R7U A;  1XD7 A;  5F0H A;  2M8E A;  2EK5 A;  2BEO A;  4KT5 C;  2MH9 A;  1SFU A;  4FE4 A;  3W6J B;  1W36 D;  5GAG J;  2G0E A;  2MSY A;  3GF2 A;  4IHS A;  1RUN A;  2H8W A;  1FC3 A;  1V5G A;  1ZAR A;  5J8F A;  1O3R A;  3T5X A;  1EF4 A;  4YEJ A;  3CP2 A;  5FLX Z;  4CCK A;  5HS8 A;  2VT2 A;  1YO5 C;  3J7Z I;  4CSW A;  3DEE A;  3OL4 A;  3BCA A;  1TWA J;  2G9W A;  2OZU A;  2X6X A;  3SHF A;  4BHP A;  4Q47 A;  1U8R A;  1EJ9 A;  2JTV A;  5IT3 A;  1FMW A;  3ECO A;  3RKW A;  3OYA A;  4A5N A;  2PMZ N;  5JVG F;  4U7B A;  4E7I A;  1HQC A;  1JUP A;  3ZQL A;  2A68 F;  1I1G A;  3ESW B;  3ZQQ A;  3ZQC A;  6PAX A;  5F04 A;  3OWT A;  1OCR H;  1YW8 A;  4PUS A;  3VOX A;  2W00 A;  3M4O J;  3ZQH A;  1AU7 A;  2AXL A;  2R7W A;  1IN6 A;  4WXC A;  1UCR A;  5B1B H;  1RIO H;  4IF4 A;  2F4M B;  4N0B A;  3K1N A;  2GOM A;  4EM1 A;  1LFB A;  4PZJ A;  2D1V A;  3EQL F;  2DT7 B;  2E34 A;  5DM7 F;  4DYQ A;  4D7N A;  3VOK A;  4IOC F;  4A3G J;  2HNH A;  3KET A;  1FNN A;  4RDU A;  3HXL A;  2KIU A;  1T2K A;  4E7Z A;  3LSP A;  2DT5 A;  1BJZ A;  1N75 A;  1SD4 A;  4UV8 A;  2CQX A;  5FGM A;  3FIW A;  2DBB A;  4ABZ A;  4F7Z A;  2BE5 F;  5M5Y J;  3HOX J;  4JYK A;  2JA2 A;  3WHB A;  4N4N B;  2QBY A;  1OR7 C;  2X1E A;  4KMU X;  3OSF A;  2QCO A;  5LLQ A;  2QUF A;  4ZJZ A;  1ZAO A;  3NRV A;  3HKZ N;  3SWH A;  3KEY A;  5AON A;  4NC8 A;  2ID3 A;  4IHX A;  2ZXI A;  2XRO A;  4AU7 A;  3ANG A;  3UKG A;  1V54 H;  1TWH J;  2CV0 A;  3CMY A;  2Y31 A;  1P4X A;  3KEQ A;  4LK0 F;  2QOP A;  4O5V A;  2QWT A;  5HS9 A;  5EG0 B;  3NEU A;  1LDK B;  3P9T A;  1YW9 A;  1WCM J;  2F4O B;  2V6E A;  5FJ8 J;  2OCE A;  2OTJ I;  1A6Q A;  4D5C A;  5LRS A;  2KRH A;  3GZN B;  3WE2 A;  3L2C A;  4XBF A;  2IBD A;  1K78 A;  3CCR I;  3PO3 J;  2EJR A;  1P7J A;  3CCY A;  3LL7 A;  3M8F A;  4XLH A;  2Q0O A;  4ESF A;  4EMS A;  2CGP A;  2X4H A;  4ZYG A;  4CCN A;  2V9P A;  2I8D A;  3R4K A;  2CG4 A;  2OD5 A;  1ACI A;  5K7F A;  3D5R C;  1BM9 A;  3GLX A;  1ZR2 A;  1T08 B;  4CGR A;  1Q1H A;  3J7A Y;  1G3S A;  1QHG A;  4FT8 A;  4JP0 A;  4LK1 F;  3PIP F;  1G59 A;  5L3E A;  4I2O A;  3QKX A;  1B9M A;  2BBY A;  2L3D A;  1MMA A;  4W1U A;  3NAU A;  1W5S A;  2WA0 A;  1FY7 A;  2TCT A;  2XAF A;  1ZG1 A;  2ZOY A;  2YU9 J;  3I59 B;  1QHH D;  5FD5 A;  3GCM A;  3VEP A;  4HDV A;  1T0F A;  3F9K A;  2F4I A;  4CCO A;  3ERE D;  4M74 A;  2UXP A;  4F3Q A;  3VB2 A;  2P81 A;  3OR1 C;  3IHU A;  4HF2 A;  2BY1 A;  3CQZ J;  4JNN A;  2F5F A;  4BU2 A;  3PUB A;  2NS0 A;  4XOT A;  3EET A;  2NVU B;  3Q9V A;  2DJI A;  1TZL A;  4RM2 A;  1PUF B;  1ZR4 A;  1Z05 A;  1ETO A;  4DYC A;  4XRS A;  4A0Y A;  3TQN A;  2RRE A;  1E3H A;  3GYH X;  1VQP I;  4PJL A;  3RJP A;  2LFB A;  3ZGK A;  1E17 A;  4GCL A;  2VI6 A;  3HTS B;  5E8G A;  3Q0U A;  4CCJ A;  4C2M J;  4HNU A;  4HRI A;  2QKO A;  3LJL A;  1I5Z A;  3MKY B;  1O7L A;  5M3F J;  4E7H A;  2QKM B;  4BKX A;  4UV9 A;  1U9O A;  2KIM A;  4UNO A;  4C9Y A;  1F5T A;  1UHW A;  5EJC A;  3IC7 A;  3HDD A;  1ETW A;  3DQV C;  2RDP A;  5HLI A;  4BHC A;  2CW7 A;  1SVL A;  1LFU P;  1ZG3 A;  3VYS B;  1WJA A;  1QVT A;  1JUM A;  4KIC A;  1TNS A;  2WAF A;  3M8E A;  1RR8 C;  3DPL C;  3OSG A;  3OYF A;  4HA8 A;  3V8J A;  3HOZ J;  3ON4 A;  5B66 C;  3KP3 A;  3MZY A;  4ZDO A;  2KRF A;  2YVX A;  1SGM A;  1VTN C;  1JXS A;  2IA0 A;  4G7Z F;  5C4X J;  3AL0 C;  3QYB A;  4K2E A;  1U2W A;  2GBY A;  4XLA A;  5LRR A;  1WPK A;  3PFI A;  3S14 J;  2IP2 A;  4MTD A;  4E70 A;  4ME9 A;  2O0Y A;  4RAG A;  3OV8 A;  1HKT A;  3PNT A;  3LSH A;  1WJC A;  1BR2 A;  2E2H J;  3S2H J;  2W24 A;  2FML A;  1LDJ A;  5EF6 A;  3B02 A;  3FXM A;  3LNQ A;  3C1D A;  4HQM A;  3NXC A;  3WGI A;  3TMO A;  4AIH A;  3GZ6 A;  3ONQ A;  4HNT A;  2ZCN A;  1IDY A;  2IGK A;  3BR1 A;  3TW6 A;  3CCJ I;  1ZRD A;  3EDP A;  4GXO A;  4LJZ F;  3HTA A;  3RCO A;  1OKR A;  2K9M A;  2FJ1 A;  3CUQ B;  4ZYA A;  2LOO A;  5C44 J;  3JRF A;  4A0X A;  1JE8 A;  3G6E I;  3CWR A;  2DYS H;  3RTR A;  4U0V A;  3ZR8 X;  1I6X A;  4S04 A;  3GW2 A;  5DUK A;  4A0Z A;  5LFA A;  1T0F C;  3LA3 A;  3TOA A;  2K86 A;  1ENH A;  2UXN A;  2V1N A;  2I10 A;  4U9L A;  2BGC A;  3ZQ7 A;  4NNJ A;  5K7H A;  3TP0 A;  5EGO A;  2KKO A;  2L02 A;  4OIP F;  4IQ4 A;  4OOI A;  1WSU A;  3D5S C;  5E17 F;  2VAS A;  3DBH B;  1X1C A;  3L00 A;  3KYD B;  4HBL A;  4JKZ A;  1P4W A;  2AQE A;  1SAX A;  4IOA F;  1YTY A;  2AHQ A;  2P5V A;  4M73 A;  4CHU A;  2OQR A;  3OYJ A;  2DU9 A;  5HS7 A;  4DYR A;  2IEK A;  1MJB A;  4B4C A;  3CCE I;  4QIW N;  3HPH A;  1B72 A;  3K69 A;  1FYM A;  3HTJ A;  5EZG A;  4A69 C;  4M3B A;  2ZJ2 A;  2IS4 A;  4MGR A;  2K3F A;  4A5M A;  4BXF A;  3ZMS A;  2HVR A;  2CS3 A;  2FXA A;  5A2Q K;  1HW5 A;  4P96 A;  2DFH A;  4G8X A;  1V5E A;  2ZO4 A;  3WTU C;  5D6E A;  4MHG A;  1XSV A;  4JQF A;  4HZF A;  1J5Y A;  1OLT A;  2R7X A;  1A35 A;  2HKX A;  2WAQ N;  4D9J A;  1FZP B;  1XG1 A;  2L9S A;  2IGM A;  3ZN1 A;  4OMZ A;  5LEJ A;  4GFK A;  2P6S A;  4I0A A;  3ZXS A;  4B48 A;  3WU0 A;  1FOW A;  1QA6 A;  3NWT A;  2C6Y A;  3GTQ J;  4A3C J;  3OYM A;  5E1Z B;  2OI8 A;  1XPX A;  2DA3 A;  1K6Y A;  1Y56 A;  1X58 A;  2NXN B;  3V4G A;  2RC4 A;  1B8I A;  2Z33 A;  2XAJ A;  2JUG A;  3IKV A;  3S3M A;  1ORK A;  2CW0 F;  2NVT J;  3DLA A;  1BC8 C;  4BDY A;  4C2T A;  3RI4 A;  4Y3O A;  3B73 A;  3F21 A;  2R7R A;  2KJB A;  1KU2 A;  5K5O A;  2X9D A;  1SFE A;  3C7J A;  4M6Y A;  2QZ8 A;  3J81 Z;  1TW3 A;  2KQR A;  1OYY A;  2ZXH A;  3O2P E;  4YEL A;  2DFE A;  5ERI A;  1QU3 A;  2LLK A;  3VSK A;  2M3A A;  4YFN F;  4RGX A;  2B63 J;  3BJO A;  1HW2 A;  2KDO A;  1U5T A;  1WWX A;  3LQR A;  4UB8 C;  4Q4Z F;  3H1C A;  1PYV A;  4RS8 A;  2XAS A;  1Z6T A;  2DQR A;  2R3S A;  4IJA A;  2NX4 A;  1OCT C;  3VPR A;  3K1P A;  3N05 A;  1P2F A;  3QBM A;  3MKW B;  1E3P A;  5HDK A;  4MEY F;  2B3W A;  4MTE A;  4A3B J;  2RAE A;  4BJ6 C;  2LD5 A;  2EBI A;  2W84 A;  2O9L A;  1Q1V A;  3HTU A;  4XN3 A;  3W3C A;  3TL4 X;  3FMR A;  4QLC U;  4E4H A;  3BZK A;  3MKZ A;  3L2W A;  2OJE D;  3FM5 A;  1P9Q C;  3U1K A;  4IEJ A;  2PJP A;  3ZN0 A;  5DCM B;  4DOZ A;  2JA6 J;  2QA4 I;  2L9N A;  1VQ4 I;  1JGS A;  1FIA A;  2X51 A;  1VQO I;  1VQ5 I;  2O5R A;  4CZZ A;  2XDN A;  3BTI A;  4BQQ A;  5JHU A;  1LVK A;  1VND A;  2X6Y A;  3OOU A;  2ZNZ A;  2FU4 A;  1MBJ A;  4CCL A;  3B81 A;  4M9Z A;  2F5C A;  2ISY A;  2QQ8 A;  4HG2 A;  3HRS A;  3CC7 I;  2H09 A;  2IA1 A;  5FKN A;  4L18 B;  3HIM A;  5IOY A;  2E2I J;  4FHT A;  2A5W A;  2DMT A;  1ITY A;  3GME A;  3JRD A;  1U78 A;  3HM5 A;  5H9T A;  3F8F A;  1LDD A;  2DA7 A;  3F0C A;  3HGG A;  2YUS A;  1E0E A;  2Z3Y A;  2XSJ C;  3V8L A;  2XB0 X;  1P92 A;  4N9I A;  3K0L A;  3R0A A;  4A6D A;  4ON0 A;  4XLP F;  2QWW A;  4KFC A;  1VQ8 I;  1WJF A;  4XM3 A;  1JJ6 C;  1W7P A;  2MLK A;  2ZOZ A;  4BGD A;  2Y48 A;  3ZCO A;  1SEU A;  1SMT A;  2HPM A;  3OL3 A;  2WB1 A;  1MSE C;  3HTH A;  2DOE A;  5CXG A;  1HLV A;  4CA0 A;  4G7O F;  1XSX A;  2CJJ A;  5F08 A;  3TW7 A;  4BXU A;  3OYD A;  1WRJ A;  1D5Y A;  2GA2 A;  2DG8 A;  3GFL A;  2EV6 A;  2FBH A;  3FWE A;  2STT A;  2ZC2 A;  2W1O A;  4MO7 A;  1CF7 B;  2QYO A;  2B9S A;  3EYI A;  3E0J B;  3QQA A;  1WFX A;  3C3W A;  4P1W A;  1OQY A;  5FFX A;  2ZXW H;  1DPR A;  3D0S A;  3PSF A;  2VJ5 A;  4M72 A;  4KIF A;  4U7D A;  1DQU A;  1L3L A;  4BBR J;  2IS6 A;  2XPU A;  4P9F A;  2KIF A;  4LG0 A;  2OTL I;  4XKB A;  1D8K A;  4M3F A;  3ELK A;  1MBF A;  4XLC A;  2E7W A;  3T8T A;  5IOZ A;  2DTZ A;  5LHG A;  2LRE A;  2LTP A;  2QQ9 A;  4AID A;  2UZK A;  4UUT A;  2DA4 A;  3N4M A;  3LAJ A;  3VW0 A;  1AHD P;  2JT1 A;  1S7A A;  2EQR A;  2HS5 A;  2UXX A;  1SVO A;  1PP7 U;  1R1U A;  1BL0 A;  4U9N A;  1K7A A;  3FDY A;  3CCV I;  2K9S A;  2OC6 A;  1GVJ A;  1I39 A;  2Y30 A;  5CVR A;  3OYE A;  3E3V A;  4AC0 A;  2K85 A;  1TC3 C;  3I5U A;  5GP9 A;  3DBR B;  5KCM A;  2HKU A;  4UUS B;  1U5T C;  4ANJ A;  1VQ6 I;  1OCC H;  1EA3 A;  1TQP A;  2E35 A;  1K6O A;  3O3K A;  2R7Z J;  3G73 A;  1YE9 A;  3O8H A;  2TDX A;  3FBI B;  3IUV A;  2Q8K A;  4FAS D;  4IO9 F;  1AKH B;  5J4Y A;  5FRM A;  4RGU A;  1MZB A;  2L2O A;  2D1H A;  2M45 A;  4MQV A;  3K4C A;  2EIJ H;  2VBX A;  4EJV A;  4DQ2 A;  4EM0 B;  3JAM Z;  3BP8 A;  1NK3 P;  4WK8 F;  3QWL A;  3QOP A;  2XC7 A;  4DZJ A;  3MFK A;  3BJ6 A;  2O3F A;  3HB9 A;  5C4J J;  4DJA A;  4AC6 A;  1R58 A;  2ADU A;  2M0C A;  3P7N A;  4IPA A;  3WG7 H;  3OYL A;  1ULY A;  3KZ9 A;  1R1V A;  3A01 B;  1S7O A;  1V55 H;  1R5H A;  3AQT A;  2LKX A;  1QRY A;  2BVL A;  2GIZ A;  1TTY A;  4M9X A;  1J7K A;  3FX3 A;  1PVE A;  1V5F A;  3V42 A;  5F1J A;  2K9L A;  5D5U B;  1O7F A;  2QKL B;  2L7M P;  1OPC A;  3V7R A;  1IN5 A;  1PDN C;  3PNV A;  1PP8 F;  3LQQ A;  5LHI A;  2CRG A;  2ZME C;  5E3N A;  4A3L J;  4HF0 A;  2LH9 A;  4M71 A;  1NK2 P;  3JRH A;  1FTZ A;  1IO2 A;  2R93 J;  2MW8 A;  3NI7 A;  3B6C A;  5D19 A;  1ETK A;  4LG3 A;  3OY9 A;  1YIJ I;  1LKX A;  3DXJ F;  1XMX A;  2DN0 A;  2FQ4 A;  3SZT A;  4BJT A;  5E3M A;  4HAM A;  3HOW J;  3DPU A;  2EZL A;  4BEH B;  1N78 A;  2ELJ A;  4HYE A;  3DFG A;  1YOV B;  3HC7 A;  3SFZ A;  1NG6 A;  4PSX A;  2JA8 J;  3UNG C;  3IV5 A;  1FP2 A;  3FKJ A;  3S93 A;  4MIM A;  3RZO J;  3ASN H;  3MZ8 A;  4FET A;  3RZD J;  2L54 A;  4HLX A;  4Y33 A;  4HV5 A;  3G1L A;  4UY8 I;  3V6G A;  2HU9 A;  5HBU A;  1ZRC A;  4RB2 C;  2JVH A;  4N4O B;  3K4M A;  2FMY A;  2QEN A;  3EPZ A;  2MC3 A;  1Y8R B;  2NVY J;  1MJ9 A;  4BQA A;  1G2H A;  2CO5 A;  3S3O A;  3KP2 A;  5J1U A;  1F4K A;  4YRV A;  3CJT B;  1YRN A;  2M5W A;  1W5T A;  3SEZ A;  1OR7 A;  2E2J J;  5J4V A;  3PQJ A;  1JKQ C;  5FRN A;  1X4P A;  5C4Y A;  2Y0S A;  3ABM H;  1GHC A;  3TP3 A;  4LB6 B;  4D7M A;  2E5N A;  4A6E A;  3LSJ A;  5H2F C;  2VQC A;  3CD6 I;  5C3E J;  1YX3 A;  3VP5 A;  2G7H A;  3BR3 A;  2PJR B;  3JCU C;  2V1U A;  4RBO A;  4AYB A;  3I59 A;  2WAE A;  1IDZ A;  3DEW A;  3Q3S A;  3CCL I;  1KGS A;  3HSE A;  5JLW A;  2ACJ A;  3VOE A;  1R6R A;  2FNA A;  4GCK A;  1MH4 A;  4LIU A;  1MMD A;  5H20 A;  4DW6 A;  3JRA A;  4ENJ A;  2RKH A;  1LFP A;  1LE8 B;  2KMU A;  4WXD A;  1RPW A;  2Q2E A;  4M3E A;  3L2Q A;  2LDU A;  2GUH A;  1R23 A;  2K7L A;  4G12 A;  3W6K B;  2JSP A;  3OYN A;  1A6I A;  2XVC A;  4GCV A;  1Y0N A;  1CGP A;  2MGQ A;  2O8X A;  2QSF X;  3OMY A;  4U88 A;  4N9H A;  1BW5 A;  2PMZ A;  1G4D A;  5KVR A;  4EGY A;  1YX5 A;  3ZRG A;  1XDS A;  4P55 A;  4C2M A;  1Z3Y A;  2GQQ A;  3WU2 C;  3V7C A;  2R5Z A;  2H6C A;  1HA8 A;  3T0Y A;  4BL0 B;  4L9V A;  2IW5 A;  3BR5 A;  3OYB A;  2CQ7 A;  2CYY A;  2V4J C;  2JZY A;  1P7I A;  2HXO A;  3PL8 A;  1ZGJ A;  3BCB A;  4MFE A;  2NAZ A;  1X1A A;  4NUB A;  2BW3 B;  4OD5 A;  5D1R A;  2GA1 A;  2HTS A;  5BS6 A;  1W5C C;  2RN7 A;  2EA4 A;  4IRH A;  4II2 A;  1HSJ A;  2ELK A;  2WC2 A;  4S0H B;  1A31 A;  3BQY A;  1S7E A;  3GBG A;  2FOK A;  2CQQ A;  3F6V A;  2YPR A;  3QP5 A;  4A3F J;  2KPM A;  5HNH A;  1U6G A;  2V6C A;  4CYC A;  4P5O A;  1T56 A;  4ETS A;  3COL A;  3C18 A;  4Y13 A;  2IAI A;  2HDD A;  5CQG A;  1QNT A;  1K83 J;  5FKL A;  2XAQ A;  3FHZ A;  4KIS A;  3KCC A;  4HSR A;  2LF7 A;  2FF4 A;  3R60 A;  2CUF A;  1ERD A;  3BRO A;  2O7T A;  1JTY A;  2RHA A;  2CQN A;  3NPI A;  1BI0 A;  1YW7 A;  4O6J A;  3I56 I;  2JPC A;  2NOJ B;  2JRT A;  2ZY9 A;  1R1T A;  2NNY A;  4EGZ A;  4LMY A;  5L3G A;  4XLE A;  3KYC B;  2K3P A;  3EGQ A;  4F93 B;  5E3O A;  2NRA C;  4I01 A;  3S1Q J;  3GZI A;  5GTI C;  1U3E M;  3ZMT A;  2YX7 A;  1JT6 A;  3KLN A;  5FKM A;  4OAZ A;  3CCS I;  2DDA A;  1Z91 A;  3AG1 H;  3K6G A;  2HOS A;  4FCY A;  3V78 A;  1BI3 A;  3LSK A;  4PDK A;  4KNY A;  3OR2 C;  3IWZ A;  2M34 A;  1KQ0 A;  3K70 C;  4G94 A;  1UHM A;  1DU6 A;  5TIS C;  3GFM A;  2F07 A;  1W4M A;  2X0L A;  3K10 A;  2A6E F;  1JHH A;  5CVI A;  2VKH A;  2A2F X;  3BRU A;  1BJA A;  3D5L A;  3F8C A;  2GOX B;  4BQN A;  4ACI A;  3K4J A;  3CLO A;  4HST A;  2GIV A;  1OMI A;  1GUU A;  5TRD A;  4P9U A;  2FBQ A;  1Z1D A;  1Z21 A;  1FTT A;  1Y8Q B;  1KYZ A;  1SAU A;  2BYV E;  3T6N A;  1BN5 A;  3WTV C;  4A3K J;  1WHU A;  5LEK A;  3A2K A;  4F55 A;  4ZZL A;  5FHP A;  4I98 B;  4Z6Y A;  2GXG A;  1IN7 A;  3BG6 A;  4FE7 A;  1ZRF A;  4IX7 A;  5B5E C;  2JRM A;  4UVA A;  3JTG A;  4G7H F;  4G9Y A;  2HVS A;  2Y69 H;  3VIB A;  3RDI A;  3CDI A;  2EFO A;  2XPV A;  1LQ1 A;  5LGN A;  3E5Q A;  2QM3 A;  2DAO A;  3BG3 A;  3M7G A;  3LHQ A;  2CFO A;  1XCV A;  4HEA 2;  4CCM A;  3COA C;  2B1E A;  1QPI A;  4WWC A;  5DAJ A;  2PG4 A;  5FKK A;  1Z67 A;  5FRO A;  3GX4 X;  4F92 B;  1AOY A;  2FUG 2;  4XKW A;  2IU5 A;  2VXZ A;  4OIO F;  2BY0 A;  3HTI A;  3KP6 A;  4GFL A;  5IYC J;  3AFH A;  4ZH4 F;  2BZT A;  2ZCW A;  1K79 A;  2CV1 A;  5CPR B;  3HUG B;  2MD0 A;  3CJN A;  1GXQ A;  3KFW X;  2YX4 A;  4PSW A;  3U21 A;  5K7Z A;  1IGN A;  4OD4 A;  2HYF A;  4KA4 A;  2JSC A;  3IAS 2;  3PQK A;  5DEQ A;  1UST A;  1OCO H;  2LP0 A;  4OAY A;  2ZFW A;  1R71 A;  3I9V 2;  2DPD A;  1KA8 A;  1X4O A;  3QYE A;  2W57 A;  3KLO A;  1D0Z A;  4C3J J;  2XKP A;  5IYB J;  4EJU A;  4U0W A;  2IS1 A;  5FLM J;  1D5V A;  5CXI A;  2ELH A;  2JJ7 A;  2GFN A;  2MLG A;  3PPB A;  1RES A;  1T39 A;  2XRN A;  4ENM A;  3NAR A;  4XOP A;  2JN6 A;  2FE3 A;  2J5P A;  3MCZ A;  1NG7 A;  4LLG F;  2A07 F;  3HBL A;  2PMU A;  3GEU A;  4BDZ A;  5DDG A;  4EJT A;  4Y4R A;  3KKC A;  1Z77 A;  2R5Y B;  3NRG A;  2JA7 J;  3V7S A;  3WGG A;  2M8G X;  5F64 A;  2M4K A;  5DCM A;  2EZH A;  3RYP A;  3I4P A;  5ED4 A;  3EUK L;  3RYR A;  2DO7 A;  1T33 A;  3CUQ C;  4XNF A;  2E1M B;  1I27 A;  2HPI A;  3GLL A;  3X2Q H;  5L3F A;  2IT0 A;  2X6W A;  1O3S A;  1OCZ H;  4OIN F;  3JRI A;  4XKC A;  2VJI A;  3HOU J;  4FQG A;  2HKO A;  1Z3X A;  3BG9 A;  3FK6 A;  2EV0 A;  3FXQ A;  4J19 A;  1KU9 A;  2M7A A;  2VJJ A;  3K4N A;  4EJO A;  5IY5 H;  1IZ1 A;  3CJQ B;  4HPQ A;  2OV7 A;  2L7K A;  3DCF A;  1HXD A;  3WTX C;  1E2X A;  2ZJR F;  4NC6 A;  3R6S A;  3G71 I;  4DVY P;  1I50 J;  3M8J A;  1YJW I;  3E1S A;  1BC7 C;  5JFR A;  3CDH A;  2LG4 A;  1WJE A;  2DA2 A;  3LMM A;  1J9I A;  4A3E J;  1YJN I;  3CZ6 A;  4DBQ A;  2IA2 A;  1VZ0 A;  1W7P D;  5E18 F;  2A6H F;  3CCU I;  4MK6 A;  1X19 A;  1JGG A;  4V19 K;  4UXN A;  2R0Q C;  4F91 B;  2FJI 1;  1RKT A;  1TLH B;  1YHQ I;  4M6V A;  1K61 A;  4AIK A;  2OF7 A;  4CZC A;  2XGD A;  2FA5 A;  1X3U A;  4KUM A;  3SEQ A;  2XUB A;  4EJW A;  4GCT A;  1WH5 A;  1YJ9 I;  1R7J A;  3VW2 A;  3LST A;  4AD9 A;  2XF7 A;  3S15 J;  5FGL A;  1ZK8 A;  3G56 A;  4MNU A;  5H6Q A;  2QBY B;  4R79 A;  4JX4 A;  1X1P A;  3HOY J;  2WWY A;  4DBR A;  2EFN A;  1IV6 A;  1SD6 A;  4FX0 A;  3G7R A;  4QTR A;  3FXR A;  3RKX A;  1G3W A;  1W0U A;  4C3I J;  2AXT C;  4J00 A;  1O4X A;  3CO6 C;  1K4S A;  1FOK A;  1KQ8 A;  4R8H A;  3AAF A;  3W2A A;  1S3J A;  1UZC A;  1G8X A;  3IP4 B;  2WAQ A;  3IWF A;  1FP1 D;  1C0W A;  3LSG A;  4NHJ A;  5FLX K;  3S5R A;  1XB4 A;  4HF1 A;  2FBK A;  3F6O A;  5CLS A;  5ILU A;  3GTO J;  3TDU C;  4LB5 A;  3ZMD A;  2VT3 A;  3MAJ A;  2ME0 A;  2VON A;  1WJD A;  1YG2 A;  5D5W B;  1HDD C;  2MD5 A;  3H92 A;  2EIM H;  3KE2 A;  5E1W A;  3VVX A;  4AM3 A;  5CQE A;  1AKH A;  3HZJ A;  2HI3 A;  2NP5 A;  5KAI C;  1XTA A;  3C2B A;  1X1B A;  1F1Z A;  1RI7 A;  4XMY A;  2P6T A;  3HHG A;  3TOB A;  2D5V A;  2FX0 A;  2K40 A;  5BQT A;  3I4M J;  2DI3 A;  2M30 A;  2OU2 A;  3S8P A;  1X3Z B;  5B3S H;  2WGB A;  4NDL A;  1LPQ A;  1UG0 A;  2QVO A;  2YVE A;  3SZP A;  2VBY A;  2LK2 A;  3ON2 A;  5IT9 Z;  3WOD F;  3HOS A;  4XRM A;  3E7Q A;  3CJD A;  1B4A A;  4GYI A;  2B7E A;  2PX9 A;  1Z7U A;  5HNF A;  3A0H C;  2P8T A;  2OCC H;  2JUC A;  1WVR A;  3A01 A;  4L5E A;  2P5L C;  2QQA A;  3IAM 2;  3KNW A;  4I6Z A;  2EIL H;  3BTL A;  1LEB A;  2LYC A;  4NB5 A;  3K4B A;  1IRF A;  3GZ5 A;  1DP3 A;  3EUH C;  3P5J A;  2R7D A;  2IRF G;  2ZNY A;  1TWF J;  5M3M J;  1J09 A;  4C3H J;  3MWM A;  1G6N A;  3NQO A;  1QVU A;  2BHZ A;  2I5U A;  2HDC A;  2EIK H;  4XOR A;  2P0W A;  2VJ4 A;  2LKP A;  3KYL A;  3S17 J;  4NC7 A;  3WU1 B;  2HYT A;  1FT9 A;  1Y0U A;  3GTK J;  4PFP A;  4ZTJ A;  2MA3 A;  3FKI J;  2UWM A;  3HYI A;  2JPB A;  2M4G A;  1ZQ3 P;  1NTC A;  2XKO A;  2E7X A;  2ZB9 A;  4UB6 C;  1MH3 A; 
#chains in the Genus database with same CATH homology
 4DYQ A;  4D7N A;  3VOK A;  3B6A A;  2UXO A;  1H88 C;  2CRG A;  5E3N A;  4A3L J;  4A3G J;  3AQS A;  1NK2 P;  3JRH A;  3QPL A;  4RDU A;  2R93 J;  2MW8 A;  1FTZ A;  3B6C A;  3NI7 A;  5D19 A;  2HQ5 A;  1ETK A;  5IP9 J;  3LSP A;  3C07 A;  5EYR A;  1BJZ A;  2NOG A;  2VKE A;  4QSH A;  2CQX A;  2DN0 A;  3FIW A;  2FQ4 A;  3IH4 A;  4ABZ A;  5E3M A;  5M5Y J;  3HOX J;  1GV2 A;  4JYK A;  3HOW J;  2EZL A;  1BA5 A;  3WHB A;  3QPS A;  4CYC B;  3OSF A;  1Z0X A;  2QCO A;  1E3O C;  1RET A;  2JA8 J;  3HKZ N;  3IV5 A;  5IPA A;  4MIM A;  1HDP A;  3RZO J;  2UXI A;  3RZD J;  3VVZ A;  2ID3 A;  1RR7 A;  3MVP A;  4IHX A;  3G1L A;  3V6G A;  4IHW A;  3ANG A;  3UKG A;  4BY1 J;  5HBU A;  1TWH J;  1IJW C;  3CMY A;  2Y31 A;  1A5J A;  2OER A;  1XC5 A;  2NVY J;  2QOP A;  1G2H A;  1H8A C;  2QWT A;  4XIC A;  5EG0 B;  2L7Z A;  2NS7 A;  5J1U A;  3W6V A;  3P9T A;  2GM4 A;  2CUE A;  1YRN A;  1WCM J;  1ETX A;  2DA5 A;  2E2J J;  5FJ8 J;  1JKQ C;  4DZP A;  3EUP A;  3O8G A;  5C4Y A;  2G7G A;  1I3Q J;  4D5C A;  3TP3 A;  4D7M A;  1MSF C;  2COB A;  2IBD A;  3LSJ A;  1JKO C;  3BJB A;  5C3E J;  2EZK A;  3PO3 J;  2XPW A;  4IHY A;  1P7J A;  3CCY A;  1LE8 A;  3VP5 A;  2LVS A;  3BR3 A;  2YVH A;  4NN1 A;  2Y9Y A;  4RBO A;  1UHS A;  4UUS A;  3PM1 A;  3PO2 J;  1IDZ A;  5K7F A;  1VF9 A;  1TWC J;  3DEW A;  3Q3S A;  5EDN A;  5JLW A;  1UI6 A;  3H3V K;  4FIS A;  4JX5 A;  3A02 A;  1ZR2 A;  4CGR A;  3JSJ A;  4GCK A;  1MH4 A;  2CU7 A;  4A93 J;  4JP0 A;  3QKX A;  4DW6 A;  1ZKG A;  1UG2 A;  3JRA A;  3JR9 A;  1LE8 B;  5FLV A;  4W1U A;  3RD3 A;  1RPW A;  3NAU A;  1JTX A;  4M3E A;  4PXI A;  2GUH A;  2TCT A;  3RKQ A;  2ZOY A;  3F1B A;  4G12 A;  2YU9 J;  3HGY A;  3HOV J;  3S2D J;  4M3G A;  1A6I A;  5EGO B;  1GVD A;  2L9R A;  2UXP A;  2MGQ A;  3JRC A;  2P81 A;  1BW5 A;  3BCG A;  4W97 A;  3CQZ J;  4JNN A;  2QTQ A;  3D1N I;  1ETV A;  2R5Z A;  1VI0 A;  1B72 B;  3BR5 A;  1PUF B;  1ZR4 A;  1ETO A;  4DYC A;  4XRS A;  1JJ8 C;  2QIB A;  3JRE A;  4A3M J;  1P7I A;  1FIP A;  2HXO A;  2LFB A;  2ECB A;  3GTL J;  4GCL A;  2VI6 A;  4AUX A;  3FK7 A;  4MFE A;  3Q0U A;  4C2M J;  2QKO A;  5D1R A;  3L1P A;  3LJL A;  2DJN A;  5M3F J;  1OFC X;  4YZE A;  2V57 A;  4BKX A;  1U9O A;  2ELK A;  4S0H B;  3JRG A;  1IRZ A;  3BQY A;  1S7E A;  3HDD A;  1ETW A;  3GBG A;  2CQQ A;  2ME6 A;  4EEF G;  4A3F J;  5HSZ A;  1LFU P;  4UDS A;  3SFI A;  4CYC A;  3BNI A;  1T56 A;  1QVT A;  1JUM A;  4BY7 J;  2EH3 A;  2ZCM A;  3COL A;  4ICH A;  1B8I B;  2JMW A;  2KT0 A;  3S16 J;  3OSG A;  2IAI A;  4GFB A;  2HDD A;  3VW1 A;  3HOZ J;  3ON4 A;  1K83 J;  5FKL A;  2QF7 A;  1I6H J;  3CRJ A;  2LR8 A;  1CQT A;  5EZH A;  5DS9 A;  2DMQ A;  2CUF A;  2O7T A;  5D18 A;  1SGM A;  4B3A A;  4A3J J;  3JRB A;  1JTY A;  1F43 A;  2RHA A;  3NPI A;  5C4X J;  2ZCX A;  3BR6 A;  3K2A A;  3LOC A;  1POG A;  1IC8 A;  4IHV A;  5AQC A;  2L0K A;  2GBY A;  5EG0 A;  2VKV A;  1WPK A;  3EGQ A;  5E3O A;  3S14 J;  3S1Q J;  4JX6 A;  1APL C;  3GZI A;  4ME9 A;  3LWJ A;  1JT6 A;  5J1Y A;  5FKM A;  3SDG A;  2HOS A;  1H89 C;  3V78 A;  4FCY A;  2E2H J;  2L7F P;  3S2H J;  2E1O A;  3IH3 A;  5EF6 A;  2M34 A;  3LNQ A;  3ZOB A;  3NXC A;  1DU6 A;  2JK3 A;  2F07 A;  2M2E A;  3SJM A;  2ZCN A;  1IDY A;  2VUM J;  3BRU A;  3BR1 A;  2ECC A;  3TW6 A;  3GTM J;  3BQZ A;  3BHQ A;  4ACI A;  3M3Y J;  3ANP A;  3HTA A;  1SAN A;  5F0F A;  5C44 J;  2FJ1 A;  1HF0 A;  3JRF A;  3CWR A;  1GUU A;  3ZQF A;  5F27 A;  2RAS A;  2DA6 A;  5J1R A;  2FBQ A;  3VUQ A;  1ENH A;  1FTT A;  2I10 A;  3T6N A;  5K7H A;  3TP0 A;  5EGO A;  4A3K J;  4XID A;  5FHP A;  2HOA A;  2W53 A;  3OIO A;  4JKZ A;  3Q0W A;  4A3I J;  4FE7 A;  4HNV A;  1VFC A;  2W48 A;  2AHQ A;  2DMU A;  3WHC A;  4KWA A;  3VIB A;  4DYR A;  2IEK A;  1TWG J;  2WB1 N;  2XPV A;  4B4C A;  1WH7 A;  4QIW N;  2LY9 A;  1B72 A;  3BG3 A;  1PUF A;  3LHQ A;  3HTJ A;  5EZG A;  4A69 C;  4M3B A;  1QPI A;  5DAJ A;  5FKK A;  3FIS A;  2IU5 A;  3HTI A;  1X2N A;  1X2M A;  2OPT A;  4GFL A;  5IYC J;  1XS9 A;  3PAS A;  1HCR A;  1IGN A;  5K7Z A;  1BW6 A;  2WAQ N;  4XRS G;  1XG1 A;  2ID6 A;  3HE0 A;  3G1O A;  3NNR A;  2LP0 A;  4GFK A;  2NVX J;  4A3C J;  3GTQ J;  1MBE A;  2M9H A;  3I4N J;  2OI8 A;  2Q24 A;  2PBX A;  4A3D J;  2DA3 A;  2XB5 A;  3BG5 A;  1X58 A;  4C3J J;  2KDZ A;  3GTG J;  1B8I A;  4I76 A;  2NS8 A;  5IYB J;  2R5Y A;  4D5F A;  3K7A J;  1GT0 C;  2NP3 A;  3CDL A;  2H8R A;  1ORK A;  2NVT J;  5FLM J;  1GV5 A;  3A03 A;  2JA5 J;  5CXI A;  2JJ7 A;  5IYD J;  1GDT A;  2GFN A;  2X9D A;  2GLO A;  3PPB A;  1RES A;  4X6A J;  4M3D A;  2AO9 A;  5FMP A;  1MBG A;  3NAR A;  1MBH A;  2JN6 A;  4BBS J;  2LLK A;  3HBL A;  2XGE A;  3GEU A;  2DG7 A;  1DU0 A;  2B63 J;  3KKC A;  1Z77 A;  3E7L A;  4LOC A;  9ANT A;  2R5Y B;  3NRG A;  5IP7 J;  2JA7 J;  3MN2 A;  2M8G X;  2XGC A;  2EZH A;  3RQI A;  4B1R A;  1ETY A;  5J3L A;  1T33 A;  4MLO A;  1U8B A;  2NX4 A;  3BTC A;  1OCT C;  1RKW A;  3VPR A;  1HOM A;  3QBM A;  3DPJ A;  4A3B J;  2RAE A;  3JRI A;  2LD5 A;  3S1N J;  4FTH A;  2EBI A;  2O9L A;  3HOU J;  1Q1V A;  3Q0V A;  3BG9 A;  2PZ9 A;  2E19 A;  3FK6 A;  2TRT A;  1W0T A;  4J19 A;  2DMP A;  1MNM C;  4JL3 A;  2O8K A;  4HKU A;  4V2F A;  4IEJ A;  3TED A;  1JT0 A;  4MXM A;  2JA6 J;  2VPR A;  3LSR A;  3S1M J;  1FIA A;  2XDN A;  3BTI A;  1VND A;  3DCF A;  2N8G A;  3OOU A;  1MBJ A;  3B81 A;  3H0G J;  1I50 J;  2HOT A;  5FKN A;  1UMQ A;  3S1R J;  1UI5 A;  3HIM A;  5IOY A;  2E2I J;  2HYJ A;  2DMT A;  1ITY A;  2DA2 A;  3JRD A;  1U78 A;  3HM5 A;  4A3E J;  5H9T A;  2UXU A;  3FRQ A;  2DA7 A;  3F0C A;  2R92 J;  3HGG A;  2YUS A;  4MK6 A;  1JGG A;  2K9Q A;  2XB0 X;  3BT9 A;  2R0Q C;  1JUS A;  1RKT A;  1OCP A;  1JJ6 C;  3BR0 A;  3BR2 A;  1JKP C;  3RH2 A;  4M6V A;  1K61 A;  2ZOZ A;  2OF7 A;  2XGD A;  5F0C A;  2REK A;  4GCT A;  1MSE C;  1WH5 A;  5BNG A;  4MFD A;  3HTH A;  3VW2 A;  3S15 J;  5CXG A;  1ZK8 A;  5GPA A;  1HLV A;  5F08 A;  2CJJ A;  5DTD A;  3TW7 A;  1JKR C;  3G56 A;  2DG8 A;  4JX4 A;  1D5Y A;  3HOY J;  1Y1V J;  1U9N A;  2K9N A;  3MKL A;  4MO7 A;  3GTJ J;  1IV6 A;  2XRL A;  3MNL A;  4Y7N J;  3G7R A;  4QTR A;  3QQA A;  3IH2 A;  1W0U A;  5FKO A;  3GTP J;  4C3I J;  3O60 A;  1FEX A;  1O4X A;  5CW8 A;  4Y52 J;  4BBR J;  2XPU A;  1FJL A;  1ETQ A;  4M3F A;  1F36 A;  1MBK A;  4V2G A;  1MBF A;  3LSG A;  3S5R A;  5HOD A;  5IOZ A;  2DTZ A;  2Y2Z A;  3ZQI A;  2G7S A;  2LTP A;  1YRN B;  3GTO J;  5EEA A;  4AF5 A;  4UUT A;  2MG4 A;  2DA4 A;  2ME0 A;  3VW0 A;  5GPC A;  1AHD P;  3G1M A;  1HDD C;  1WI3 A;  2Y0S N;  1OJL A;  3HEF A;  3VVX A;  2EQR A;  5FGL A;  5EFY A;  1IG7 A;  5IP6 A;  1AKH A;  5M5X J;  2HI3 A;  1BL0 A;  2NP5 A;  4NEL A;  1ZTR A;  3C2B A;  2G7L A;  4XK4 A;  2K9S A;  1R9T J;  1IUF A;  2NVQ J;  2Y30 A;  2WUI A;  4L62 A;  5E3L A;  4AC0 A;  2D5V A;  2WV1 A;  2FX0 A;  2K40 A;  3BTJ A;  4X1E A;  5GP9 A;  1TC3 C;  3I4M J;  5K58 A;  4AYB N;  5F0H A;  2HKU A;  4UUS B;  2WGB A;  4NDL A;  4FE4 A;  2R7Z J;  2YVE A;  3ZQG A;  2H1K A;  4BXX J;  2G0E A;  2LK2 A;  2MSY A;  3O8H A;  2X6O A;  3IUV A;  3ON2 A;  2DMN A;  4XRM A;  3E7Q A;  1AKH B;  2EZI A;  3CJD A;  1EF4 A;  5HAW A;  3A01 A;  1Y1W J;  2YS9 A;  4L5E A;  3KNW A;  1SFO J;  4I6Z A;  3BTL A;  2UXH A;  1NK3 P;  1TWA J;  2FD5 A;  4DZJ A;  2DA1 A;  3HB9 A;  1TWF J;  5M3M J;  5C4J J;  4C3H J;  1ZGW A;  1QVU A;  2PMZ N;  2X48 A;  4AC6 A;  2G3B A;  3S17 J;  2M0C A;  1JUP A;  3ZQL A;  2HYT A;  3ZQC A;  3KZ9 A;  2XSD C;  5F04 A;  3A01 B;  2GEN A;  2R5Z B;  3GTK J;  3KKD A;  3VOX A;  2HXI A;  3AQT A;  3FKI J;  3ZQH A;  2LKX A;  1QRY A;  1AU7 A;  2O7O A;  5M5W J;  3M4O J;  2D6Y A;  1ZQ3 P;  1NTC A;  5F1J A;  2Y9Z A;  3VVY A;  2L7M P;  5JLX A;  2ZB9 A;  2JWT A;  1LFB A;  1MH3 A;  1WGX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...