3CCYA

Crystal structure of a tetr-family transcriptional regulator from bordetella parapertussis 12822
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
192
structure length
192
Chain Sequence
YENIRDTIIERAAAMFARQGYSETSIGDIARACECSKSRLYHYFDSKEAVLRDMLTTHVDSLLERCRQVLYGSNEPKTRFLQIVKLFLEIYATSRDRHVVMLTCLDALPEDQRKALIAKQRELIAYVRDALLQLRPDMAANRTLAHVDTMLFFGMINWTYTWYKADGSVSPDALAERTVQLFLDGYLNLLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of a TetR-family transcriptional regulator from Bordetella parapertussis 12822.
rcsb
source organism Bordetella parapertussis 12822
molecule tags Transcription regulator
molecule keywords Putative TetR-family transcriptional regulator
total genus 65
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17932 TetR_C_24 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3ccyA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3ccyA02
4BY7J 2Y9YA 4UUSB 5K7ZA 1JKQC 4L5EA 1QPIA 2F07A 4L62A 2HOTA 3EUPA 2FJ1A 3HTAA 4XIDA 2HOSA 1OJLA 3SJMA 3W6VA 3M4OJ 2XDNA 2UXHA 3S1NJ 1F43A 4NDLA 2W53A 1B8IA 2LTPA 3B6AA 5IOZA 3JRFA 3A01B 4DYCA 2OPTA 4DZJA 2YU9J 3DEWA 4MIMA 3C07A 1IJWC 2FD5A 2M9HA 4EEFG 2R5YB 1APLC 3JR9A 1RETA 3A03A 2KT0A 5D19A 1MNMC 4GCLA 3HOUJ 3BJBA 3F1BA 1AKHB 1RR7A 3S2DJ 2LK2A 1FIPA 4MXMA 5E3NA 1PUFA 3NI7A 3L1PA 2NVXJ 3JRGA 3NPIA 3S16J 3BNIA 4A3BJ 4M6VA 3GTKJ 1T56A 5HSZA 3K7AJ 1R9TJ 3IV5A 1SFOJ 2DA3A 3B81A 2Y30A 3HGYA 5FKKA 3TEDA 1P7JA 1QVUA 2GUHA 1GUUA 5EDNA 2YVEA 3GZIA 1W0UA 3VW1A 2WGBA 4M3FA 4FE7A 4GFLA 4DZPA 2TRTA 3BTLA 3LSPA 2O7OA 3BRUA 4FTHA 2IEKA 5FLVA 2GENA 1ZKGA 3BQYA 3CMYA 2G7SA 2QF7A 3E7QA 3PASA 3GTPJ 3KNWA 3IUVA 4A3IJ 3BHQA 3BTIA 2E2JJ 2XPVA 3BQZA 1IUFA 3K2AA 3NAUA 4X6AJ 1TWHJ 4XRSG 3JRCA 5FKOA 1ETOA 3CQZJ 3GTLJ 2JK3A 3ON2A 2OF7A 1UG2A 5IP6A 3V78A 2LY9A 2Q24A 2IBDA 4A3GJ 5EZGA 3MKLA 1MBEA 2ZCMA 1IC8A 4C3HJ 2R93J 3S1QJ 3BTCA 3FKIJ 1UI6A 3RQIA 4Y7NJ 4AF5A 1IDYA 2OERA 1IG7A 3JRHA 4PXIA 5M5XJ 1U78A 3LJLA 2XPWA 3BR6A 2RAEA 4XRMA 2HYTA 2DA7A 1MBKA 2HXOA 2DN0A 1U9OA 2Y9ZA 1FJLA 4FISA 2QTQA 2O8KA 4C3IJ 2RASA 2FX0A 4IHYA 2R0QC 2HKUA 2DG8A 5J3LA 1WI3A 1MH3A 5EZHA 3O8GA 5IOYA 2NP3A 3PO2J 1AU7A 2XGDA 1ZQ3P 3BR3A 4MFDA 4C3JJ 2CRGA 5F0HA 3NARA 3A01A 4AC6A 4MLOA 2FBQA 2E1OA 1SANA 5FKLA 3CDLA 4MO7A 3Q0VA 4XICA 2VI6A 1WCMJ 1Z77A 2ID3A 3T6NA 3HTJA 3LSGA 2CQXA 1LFBA 1K83J 2MW8A 1PUFB 3HDDA 2ZOZA 4Y52J 4NELA 4IHXA 3TW7A 2MG4A 5M5YJ 2TCTA 5FGLA 4UDSA 4ME9A 1TWAJ 4BKXA 2MSYA 5EF6A 3NRGA 2GBYA 2DA4A 3BR2A 3MVPA 1MSFC 1HCRA 5J1UA 2GFNA 2ZCNA 2LVSA 2MGQA 2DA2A 3HB9A 1MBJA 4BBRJ 2OI8A 3Q0WA 5JLXA 4QIWN 2CQQA 1LE8B 3PPBA 1RKTA 2E2HJ 4A69C 3GTMJ 5IP7J 3HOVJ 2L9RA 1I6HJ 2K40A 2LKXA 2DMNA 2CU7A 1ETXA 3GTGJ 2EZIA 3DPJA 2XB0X 2K9SA 2X9DA 3MNLA 4JNNA 2QKOA 2D5VA 4B3AA 1EF4A 2XPUA 2X6OA 2XB5A 4W1UA 1BL0A 1IGNA 4GFBA 1AKHA 2WV1A 1GT0C 5H9TA 1JKOC 2NX4A 1JT0A 5CXGA 4CYCB 3IH4A 1MH4A 3QPLA 2LR8A 2ZCXA 3WHCA 2G0EA 3S2HJ 3VVZA 1Q1VA 2DJNA 2NVTJ 1X2MA 5F0CA 3VOKA 3CJDA 5BNGA 2NOGA 4UUTA 3ZQIA 3JRAA 3E7LA 2E19A 5D1RA 2DTZA 5M3FJ 3ZOBA 2PBXA 1JTXA 4IHWA 2O7TA 3RD3A 2ELKA 2VUMJ 3G56A 2B63J 2R5ZA 2UXPA 1NK3P 1O4XA 3O8HA 2E2IJ 3HIMA 3LWJA 3IH3A 2M34A 4A3KJ 3BCGA 3KKCA 1HDDC 5C4YA 2KDZA 1HDPA 2H1KA 1FTZA 1VF9A 4W97A 5K7HA 3QQAA 4A3FJ 1HLVA 2CUEA 2XRLA 5FJ8J 1QRYA 2YS9A 5C44J 3HOWJ 2EBIA 1POGA 3BR1A 4IEJA 1B72A 2R7ZJ 2DG7A 4DW6A 5IPAA 1JT6A 5DAJA 1FIAA 1OCPA 1ZGWA 5F1JA 3FK6A 2HXIA 2NS7A 1JUPA 3WHBA 5F27A 2DA5A 4ACIA 5M3MJ 5J1YA 3LNQA 1I3QJ 4IHVA 1T33A 5FKNA 3S14J 3FRQA 3BT9A 4CGRA 3HOXJ 2JA7J 3VW2A 1JUSA 2N8GA 2FQ4A 1OCTC 3VUQA 4JKZA 3GTQJ 3LSRA 2EQRA 4B1RA 5AQCA 3KKDA 5IYBJ 1WH7A 2P81A 1H88C 2QCOA 3TP3A 4I6ZA 4A3DJ 3VW0A 3CRJA 1ETKA 4D7MA 2R5ZB 1BJZA 2DA6A 2HI3A 1IV6A 2G7GA 3MN2A 2DMUA 1TWFJ 2Y2ZA 4JX5A 2HOAA 4ICHA 2ME6A 3S17J 3VVXA 1BW5A 2DMTA 3COLA 3HTIA 4D5FA 3PO3J 4QTRA 1DU6A 1Y1WJ 5CW8A 4A3JJ 2R92J 1XG1A 3G1MA 1Z0XA 2CUFA 2Y31A 4D5CA 3M3YJ 2G3BA 2K9NA 4AUXA 1MBHA 4A93J 3LHQA 1ETQA 2HYJA 1TWGJ 5EGOA 3H0GJ 3OSFA 2LFBA 2Y0SN 1GDTA 3RH2A 4V2GA 3JRIA 3VVYA 2HDDA 5DS9A 3VP5A 1UI5A 5HODA 3ON4A 2YUSA 1ZR2A 4C2MJ 4MK6A 1XC5A 3ZQHA 1NTCA 1VI0A 2JMWA 4M3BA 3ZQGA 3SDGA 3BTJA 4JX4A 3I4MJ 5FHPA 2XGCA 3IH2A 1I50J 2K9QA 1ETWA 1G2HA 1MBGA 4HKUA 3JRDA 3SFIA 5EG0A 3V6GA 2H8RA 2DA1A 4GFKA 2DMQA 2WAQN 4AC0A 4DYQA 2UXUA 2O9LA 2I10A 2QIBA 2EZKA 3BR0A 3JREA 2AHQA 3HBLA 4AYBN 1ORKA 1B72B 1RKWA 1ZR4A 2QWTA 3HGGA 4S0HB 1TWCJ 2HQ5A 5CXIA 9ANTA 1W0TA 4A3LJ 2GM4A 1FTTA 3Q0UA 5JLWA 5HAWA 4JYKA 3ZQFA 5C4JJ 2XSDC 3HKZN 2R5YA 2JA6J 4JP0A 2JA5J 1SGMA 1WPKA 2RHAA 5K58A 2EZHA 3QBMA 5IP9J 1ENHA 5E3OA 5EG0B 2NS8A 1JJ8C 4A3MJ 2L7FP 3FIWA 4JX6A 4D7NA 1JKPC 3HOZJ 2D6YA 1B8IB 3ANGA 4YZEA 1IRZA 3G1LA 1VFCA 4RDUA 1FEXA 4JL3A 2DMPA 5FKMA 4BBSJ 1YRNB 1HOMA 3FISA 4A3EJ 2YVHA 3BG5A 2LD5A 2VPRA 3LSJA 2M2EA 5FMPA 4HNVA 3ZQCA 2XGEA 3BG3A 2L0KA 3QPSA 3VPRA 3VIBA 3S1RJ 2JN6A 3LOCA 5J1RA 4NN1A 1XS9A 2L7MP 4M3DA 3I4NJ 2ZOYA 2V57A 2X48A 3S5RA 4B4CA 3GBGA 4FCYA 1WH5A 3PM1A 1RESA 5IYCJ 2ZB9A 3S1MJ 3QKXA 3ZQLA 2NVQJ 5C3EJ 4XK4A 3BR5A 4XRSA 1WGXA 3G1OA 3EGQA 1OFCX 3C2BA 1X2NA 4X1EA 3TW6A 5FLMJ 2AO9A 3GTOJ 1TC3C 3Q3SA 5K7FA 4J19A 4GCKA 2M8GX 2M0CA 1DU0A 3RZOJ 1BW6A 3G7RA 2EH3A 3CWRA 2ECBA 3CCYA 5GPAA 3ANPA 1A6IA 1RPWA 5GPCA 2L7ZA 2W48A 3TP0A 4A3CJ 1GVDA 1QVTA 4GCTA 5GP9A 5EGOB 1K61A 2COBA 3KZ9A 3NXCA 1AHDP 2G7LA 2REKA 5IYDJ 1MBFA 1E3OC 1X58A 4KWAA 1P7IA 1S7EA 1U9NA 1IDZA 1ITYA 4M3GA 4M3EA 1UMQA 2CJJA 1H89C 5C4XJ 3HE0A 4DYRA 3D1NI 3F0CA 4V2FA 3DCFA 3GEUA 2PZ9A 3O60A 1ETVA 2IAIA 3B6CA 4G12A 1VNDA 2EZLA 3JRBA 2LP0A 1UHSA 5EEAA 2VKEA 3A02A 1U8BA 5D18A 1JTYA 4QSHA 2NVYJ 3S15J 2ID6A 4CYCA 1NK2P 4BXXJ 1ETYA 2WB1N 5EFYA 1JJ6C 3UKGA 2UXIA 3VOXA 2WUIA 1ZTRA 2VKVA 3RKQA 5HBUA 3HM5A 4RBOA 5M5WJ 1Y1VJ 1GV2A 3GTJJ 1YRNA 4I76A 1HF0A 1A5JA 5F04A 4FE4A 3HOYJ 4LOCA 3RZDJ 1H8AC 3OOUA 3HEFA 1CQTA 2UXOA 2JWTA 1BA5A 1LE8A 3OSGA 4ABZA 1JUMA 5F08A 1GV5A 2JA8J 1D5YA 1ZK8A 4BY1J 5E3LA 3FK7A 1JKRC 1JGGA 2QOPA 3NNRA 3H3VK 4MFEA 2ECCA 1MSEC 3P9TA 3BG9A 3AQSA 5DTDA 4UUSA 1F36A 2NP5A 1LFUP 3JSJA 2IU5A 5F0FA 2ME0A 3OIOA 5E3MA 2LLKA 2PMZN 5EYRA 2GLOA 3AQTA 3HTHA 2JJ7A
chains in the Genus database with same CATH superfamily
2XASA 2ZSIB 4BEHA 2DK8A 4L5EA 1QPIA 1KU2A 5E1XA 3ABTA 3GUDA 1OR7A 4XIDA 1OJLA 3SJMA 4X0GA 2H6CA 3HSEA 5HS8A 3SDBA 2X1DA 4BGDA 4EATA 1BIBA 2LTPA 3B6AA 5IOZA 4CUGA 3A01B 2YU3A 2OPTA 4PK4A 3ABLH 4MIMA 1IJWC 2HZDA 3CCQI 1PVEA 1O7LA 1OYYA 1MMDA 3GMEA 3ASNH 5D19A 4LG0B 4GCLA 4MNUA 1VQNI 3VOEA 3F1BA 1VQPI 3S2DJ 2PQ8A 3M8EA 4S04A 3E5XA 3IP4B 3K4NA 3QU3A 4DQ2A 2NVXJ 3JRGA 2FOWA 1WJDA 3WG7H 3F8NA 1E3HA 3K7AJ 4LJZF 2HTSA 3WTZA 3IUOA 5FKKA 3JSPA 4IX7A 3KP5A 4HDUA 2H1LA 3QWLA 2E1MB 3BJ6A 3VYTB 2LSOA 3E6MA 4XMYA 2QSFX 1BR2A 3OYBA 3GXOA 3JTGA 4N0BA 4ZTJA 3BOQA 3LSPA 4BXFA 4P9UA 5FLVA 2GENA 3VSLA 2KIUA 3E7QA 1KQ8A 3IUVA 4PSXA 3BHQA 2FNPA 2E2JJ 3BQZA 2A61A 1R49A 3NAUA 4PJJA 4X6AJ 2NNNA 1ZG3A 2ELJA 1ETOA 1SMYF 3C7JA 3CQZJ 3W2VA 3L00A 2Q8KA 2XV4S 4C2TA 2KDOA 1Y56A 5IP6A 3V78A 4ZDPA 4AIKA 4IHTA 4A0ZA 4BQQA 4A3GJ 4MEYF 4XLNF 6PAXA 3F72A 3AG1H 3FKIJ 3G71I 2HPIA 3K0LA 4CCOA 1IG7A 4PXIA 1KONA 1U78A 2W82A 1IXCA 2XPWA 5L3CA 3AG2H 2DA7A 3KP7A 1MBKA 2VLAA 3AG3H 2VBXA 3OYAA 2VJ5A 3MKWB 2A2FX 3ABUA 2O8KA 2H09A 3CDHA 5HLHA 2Z5UA 3HTUA 1MH3A 4O5VA 2P7VB 3I54A 5E18F 3OYDA 3REOA 3WTXC 4JK1X 2MC4A 1B4AA 1LUJB 2PEXA 3J7YJ 2CRGA 2P5KA 1V55H 4CH7A 4A0XA 4EJUA 5CVJA 1QZYA 4MLOA 2FMLA 2CW7A 4RLFA 1G3WA 4BDZA 4ZJZA 2E1OA 1SANA 2JRMA 3QPHA 4MO7A 1DGRM 3HPHA 2XDVA 3CC7I 3ZR8X 5H2FC 1C0WA 4RAYA 1P2FA 4WX9A 5J4VA 2CUJA 4BE2A 1XPXA 2MW8A 3HDDA 1FX7A 2ZOZA 3TW7A 1Z67A 2LH9A 3VYUB 5M5YJ 1IRGA 5FGLA 1S7AA 5TISC 2KRHA 3ZN1A 4IHSA 2O3FA 3NRGA 1QQIA 5IT9K 2GXBA 2GBYA 1ZRDA 4XSXF 4G6TB 2QBYB 5DD4A 5J1UA 2DYSH 2MGQA 3KYDB 3HUGA 2STTA 2OI8A 1IN7A 1W5SA 3Q0WA 2DFIA 3PPBA 1OKRA 5FGMA 1O3SA 1I6HJ 2DMNA 2CU7A 3BZ6A 3IWZA 4B09A 1ETXA 1FNNA 3GTGJ 2C6YA 2X9DA 4JNNA 2D5VA 4L0YB 1EV7A 1REPC 3KEQA 2X6OA 3U1KA 2PMUA 4ZYAA 5DYMA 4GFBA 3BCAA 4Q47A 1GT0C 2A07F 2NX4A 1ZHFA 5CXGA 4S05A 1MH4A 3QPLA 5KNLA 2LR8A 3WHCA 2G0EA 1A04A 1Q1VA 2OQRA 3SFZA 3U1DA 1X2MA 5F0CA 3E5UA 2P5VA 3DTIA 3K70C 3CO6C 3CJDA 1SVOA 2NOGA 3E7LA 3KP3A 5HLGA 2RVCA 2DTZA 2WB1A 3RYPA 4HA8A 2PBXA 1KGSA 4HSTA 1TQPA 4L9VA 2ZSHB 2VUMJ 3BDDA 1MGTA 1UELB 2WAEA 5F1RA 1D8JA 2E2IJ 1LVAA 3IH3A 2L9VA 2ZFWA 4A3KJ 3TO9A 3BCGA 3FX3A 4XN0A 1HDDC 4M9ZA 3KKCA 1DP3A 2H1KA 2K5CA 4W97A 4XORA 1ZGAA 2KHMA 4EJVA 3PJRA 3QQAA 2MC3A 2XRLA 2XAGA 3F21A 2EBIA 1B72A 1OCOH 3BR1A 4IEJA 2R7ZJ 4A0YA 5GAHJ 3BWGA 2Q2EA 3D0SA 1B59A 3BZKA 3HC7A 3ABKH 1ZGWA 2W85A 4EM0B 5F1JA 2QENA 2NS7A 1JUPA 1SFEA 5H6QA 3WHBA 1AWCA 4LLNA 3PL8A 3I59B 2A5WA 5E1WA 3LNQA 1XGSA 1T33A 3E6DA 1MW7A 3BT9A 3HOXJ 3KZZA 3VW2A 4BYYA 4AWXB 4P9FA 3COAC 2CWEA 4JKZA 1FY7A 4U0VA 4B1RA 4NQWB 3IRQA 4BQOA 2XUBA 3PQKA 4ZYDA 2QCOA 3K1MA 3TP3A 3T0YA 1H88C 3EUKL 1KZHA 4L9NA 1YW7A 2CS3A 3RKWA 2LMDA 2R5ZB 2R7XA 4KISA 2DA6A 1IRXA 2O03A 2DT5A 3K1NA 4B43A 3OL4A 4CCMA 2CUZA 2E35A 3H5RA 4ZH4F 3CP2A 4CZCA 1YX5A 4U7DA 1LJ9A 5HDKA 3LSTA 2MH2A 3NQOA 3COLA 2ZJQF 3FM3A 4NNJA 5D8LB 1A36A 4HF0A 4HDVA 2DT6A 1R6RA 4A3JJ 4CA0A 1Z0XA 5EJCA 1ODDA 4M74A 2G3BA 5ERIA 4XSZF 3LHQA 1ETQA 2XGXA 3GZ6A 1O3RA 3S3MA 2HPMA 1WJBA 2Y0SN 4IOAF 3RH2A 3EPZA 2QM3A 2E5NA 1PUEE 5B1AH 4UVAA 3ZXSA 4MK6A 4DNCA 3M1CA 4N9HA 1W36D 1G6NA 1ZG1A 4ASNA 4RB3C 3JAMZ 1I50J 2R3SA 3WTSC 4E6KG 2VJJA 1ZRFA 3R61A 3CUQA 4KYWA 2QUFA 4MQVA 4GDFA 4UB8C 4DYQA 1IN6A 1SVMA 3A4CA 1AOYA 2QIBA 2EZKA 3BR0A 3DEUA 4UHTA 1I27A 3DPLC 1B9NA 2XAFA 4HEA2 4NBQA 1G3TA 3Q0UA 2L4AA 2RNJA 5HAWA 3FDYA 1SGMA 2W25A 2EZHA 2GZWA 5B66C 2ISYA 2UXNA 1SAXA 2NS8A 4XRFA 3M8FA 5J40A 2L7FP 4D7NA 2ICWG 1FBQA 3ABMH 1B8IB 3W2WA 4YZEA 1X1DA 3EQLF 3HXLA 4JL3A 1SD4A 3QPTA 2QQAA 1K79A 3FISA 4EM1A 1HOMA 5IY5H 5F6FA 2CYYA 2M2EA 5K5OA 4HNVA 2EV6A 2OV7A 5ICEA 3ZMVA 5J4YA 4OIOF 1BOAA 2JN6A 3EUHA 3LOCA 4N4NB 5J1RA 1J59A 1S6LA 4CSWA 4YIIA 2BOLA 5DV5A 5LRSA 4CGZA 2EIMH 4XN3A 4BDYA 2L7MP 2YX7A 2DW4A 1FT9A 3I4NJ 1IXSB 3H5NA 4XKVA 3MWMA 2X48A 2ZMEC 1MDMB 3LL7A 1RESA 4V19K 2ZB9A 4OMZA 4XNFA 2RQQA 1OCCH 3GFIA 3EGQA 2XAQA 3EUAA 1OFCX 4Y33A 2CMPA 3KZYA 4L5IA 3RPUD 2EFOA 4BACA 4QPQA 5K7FA 4C2UA 3OS0A 4P96A 4XL9A 4ZZLA 3ZP5A 4HPQA 1TL8A 4KIBA 1R71A 3CWRA 4WXDA 1D3YA 3F8MA 3KCCA 2I5UA 2LDUA 3IHUA 2VASA 4A3CJ 3S3NA 1QVTA 1R22A 1WJFA 2H8WA 4IL6C 1YI2I 5GP9A 1R5GA 2COBA 4BE1A 3NXCA 2REKA 1KU3A 4K2EA 4YRVA 4A12A 2UUZA 4ZYHA 4FASD 1FZPB 2CGPA 3HHGA 4M3EA 1H89C 4I2OA 1FLIA 2EV0A 1BIAA 4DYRA 4J00A 3CMAI 2EFWA 4ENMA 1G4DA 3AFHA 3GO5A 4RM3A 5KAIC 4ZC3A 3B6CA 4G12A 4BHBA 2BBYA 3PUBA 3JRBA 4F92B 3AL0C 1TLHB 3OYEA 2G9WA 4I0BA 5BPDA 2V6CA 2BV6A 2NVYJ 2VKDA 1HSJA 3I58A 2PN6A 5D5XB 4R79A 4CYCA 1NK2P 1ETYA 2MH9A 4BXXJ 4IRHA 2VOPA 1JJ6C 4MGRA 3QODA 1ZTRA 3MAJA 5HBUA 1M1EB 4RBOA 3WTYC 1GV2A 4M9SA 4O6JA 4I76A 2R7UA 3L2VA 4R8HA 2DTRA 2ZO4A 2FSWA 2WC2A 3KEYA 2NVUB 1KYZA 3IKTA 1R58A 1BA5A 4C2MA 1LE8A 1FOWA 3FXMA 4ABZA 1FYKA 2P5LC 4CCLA 4B48A 1D5YA 1ZK8A 5E3LA 3A2KA 1EA3A 5LHIA 1JGGA 2XAHA 1LQ1A 2EFPA 3NNRA 1BI2A 2ZMEA 1YIOA 1MSEC 2LKPA 3G6EI 4OOIA 5E17F 3V4GA 4D0PA 3ULQB 3G4SI 1YYVA 3JSJA 2IU5A 2G7UA 3V7RA 4YEJA 3K2ZA 5EYRA 3HTHA 4KDPA 3W2AA 2P6SA 4O3MA 2I8DA 2FBKA 4PGHA 4Q4ZF 3PNTA 5BQTA 4RB1A 2F07A 1USTA 1SFKA 1J75A 3VWBA 3W6VA 2KKOA 4IKFA 4M9XA 2XROA 3SEQA 2V1XA 2IA0A 1HA8A 4BQNA 2VJ4A 2VBWA 3V8KA 2MFZA 1B1BA 2O5RA 4E7SA 2VKHA 5GADJ 4KITB 2YU9J 1B9MA 2JA2A 2ZXIA 3DEWA 3C07A 2OUMA 3CCJI 2QEXI 1Z3YA 3JSOA 4EVIA 3CO7C 1FOKA 1BC7C 4OINF 3QP5A 3GFJA 1MNMC 2VN2A 2DFEA 3LAPA 1AKHB 1RR7A 1FIPA 1Q1HA 3S8PA 5CQGA 4EQQA 3NI7A 4L5JA 1IF1A 3NPIA 3CJRB 4CO8A 4M6VA 5HSZA 1T56A 3OIQA 3TMOA 2G7HA 1SFOJ 1U0JA 4A2UA 1TT0A 3IAM2 2ZCWA 5KAFC 1P7JA 1QVUA 2JVGA 4P1WA 5EDNA 3GZIA 2YVEA 3NS4A 1W0UA 1J0RA 2XF6A 3M1EA 2RV8A 5K1YA 2WGBA 1R4MB 4L18B 3KP2A 4DZPA 2HYFA 3R0AA 3LAJA 1P4XA 3BRUA 1L0OC 2MYSA 2X6WA 1ZKGA 3BQYA 4EJOA 1TTYA 2F5EA 3CMYA 3IC7A 3GTPJ 3H35A 3BTIA 3K4JA 3W6JB 4BQAA 1OCRH 1TWHJ 3LWFA 3PIOF 1YE9A 2JTVA 3JRCA 3P9CA 3TKYA 3GTLJ 2LKSA 4KT5C 4ZDLA 2LY9A 4AIHA 3IKVA 3RTRA 2VBZA 3MKLA 5AONA 1IC8A 2ZCMA 4C3HJ 3I64A 3BJOA 4Y7NJ 1FYMA 2VT2A 4EMSA 2OERA 5FD5A 5M5XJ 2IPQX 5HNFA 4KN4X 2WBMA 4UY8I 3DQVC 4XRMA 2GAUA 2HXOA 1IN5A 2EWNA 3C2GA 3QU6A 1RUNA 3CUOA 2QTQA 4RAGA 4C3IJ 2L54A 2CFXA 4BHPA 1DPRA 2L9SA 2RASA 4XLFA 3ZMSA 2HKUA 2K4BA 2B7EA 5IOYA 3CMEI 2BZTA 2QLZA 5L3DA 3PO2J 4PDKA 1NG6A 2KQRA 3OYMA 1XMKA 4HAMA 3BR3A 4PSWA 1V5FA 1T8IA 3KX2A 3HOTA 3NARA 1UAAA 1DGWY 2QVOA 3TO6A 4AC6A 1HXDA 1JGSA 3N4MA 3K4LA 3CDLA 3KFWX 2YSRA 4XKBA 3Q0VA 4P55A 5CKTA 2VI6A 4XICA 3CZ6A 2KRFA 3T6NA 3J80Z 2QQ8A 1LFBA 1K83J 4RLQA 2VIXA 4IHXA 2BHYA 3VYRB 3AAFA 2TCTA 3TDUC 2PLYA 3CC4I 4IZZA 1TWAJ 2MSYA 5BPIA 3CJQB 4AIDA 2VODA 2H27A 3MVPA 3DP7A 1MSFC 4CCJA 4ENKA 3HTSB 4RGSA 3QYFA 1UG0A 5J6XA 1YG2A 3HB9A 1MBJA 4JOMA 3LA2A 4BBRJ 1H0MA 2NRAC 2P4WA 4OIPF 1ULYA 3F3XA 4Z2YA 3KYCB 4I01A 3G2BA 2E2HJ 4A69C 1HKSA 3GTMJ 5IP7J 4ESBA 1T6SA 5BS6A 2K40A 1W5TA 2M4GA 2F5CA 3W6KB 4HBLA 2EZIA 2FOKA 4OAZA 1EJ9A 2IXSA 2K9SA 1X1AA 4HX7A 2QSHX 1EF4A 1UHWA 2JUCA 2OQGA 1WJAA 2TDXA 2VB6A 3MZ8A 1BL0A 3SZTA 3OOPA 4CYCB 1QHGA 1HW5A 1SAUA 3N05A 1XSXA 5ICGA 3HYIA 2NVTJ 2MLGA 1F4KA 3VOKA 3VEPA 3FXQA 2HZTA 4UUTA 3ZQIA 2EA4A 5D1RA 4YFXF 3CDIA 5M3FJ 3ZOBA 4IOCF 4IHWA 2O7TA 2ADUA 2E36A 3M07A 3RD3A 1ZRCA 3R60A 3GYHX 2R5ZA 2UXPA 2EJRA 1WZ2A 1O4XA 4MHGA 5B3SH 1XDUA 2ETHA 3D5RC 3HIMA 2M34A 2JVHA 4G94A 3SEZA 1PYVA 4YFNF 2KDZA 4BJ5C 4IQ4A 1Y8RB 5K7HA 4CICA 1JHHA 2V7FA 2MLKA 2QA4I 2FXAA 2XRNA 4EM2A 3H3UA 1N77A 4PCQA 1VQ6I 1POGA 1BM9A 1T08B 2LC2A 3IL2A 1ACIA 2HOEA 2DG7A 3K8PC 2MA3A 1X3WB 5IPAA 4Z6YA 4LD5A 1VQMI 1GHCA 1FIAA 2AXLA 4M71A 1B6AA 3ZQQA 1DUXC 1P92A 2R7VA 5F27A 1RIOH 4C30A 2Q2EB 5J1YA 1MMAA 1I3QJ 3QOPA 1XCVA 2NOJB 3S14J 3UR3C 4Y13A 2N8GA 2VQLA 1ZLJA 4PJ0C 1R1TA 2JPBA 1J9IA 1WH7A 2P81A 3R6SA 3O3KA 5FROA 2Y48A 1ETKA 2CFOA 2DLLA 2PJPA 3FHZA 1BJZA 1BR4A 1SVLA 2LREA 1HQCA 1TWFJ 3WGGA 1WKMA 5JHUA 2DBBA 4RGRA 4BJ6C 2HVQA 4ICHA 3S17J 4DOZA 2LG4A 1KU7A 2Z3YA 2DXIA 3PO3J 4IXAA 3BCBA 4PZJA 3KLOA 2XF7A 2HU9A 4RS8A 4G7HF 4PJNA 3PUFA 2R92J 3GCMA 1XG1A 3E97A 3FZVA 2K85A 2Y31A 2JSCA 1G3YA 2R7DA 2B0LA 2K9NA 4Y3OA 4A93J 4G7OF 2L02A 1LVKA 1WHUA 4XKCA 2HYJA 5EGOA 1K78B 3HRUA 1T0FA 1D0ZA 3BP8A 3CF5F 1D1AA 3JRIA 1J5YA 2HDDA 3VP5A 5HODA 1ZN2A 2PX9A 1YJWI 3F8FA 1U3EM 1TW2A 3DU6A 3FXJA 3A1YA 3P7NA 4M3BA 3SDGA 5HOOA 1XMXA 5IT9Z 5FHPA 3DBLB 4XLEA 3U9GA 4PUSA 1NHAA 3MMYB 4HLYA 1YFHA 1ETWA 1XGMA 2BGCA 1G2HA 4PGGA 4FQGA 4HKUA 3JRDA 3RKXA 3SFIA 2RDPA 3NEUA 5CJ9A 2DMQA 3E5QA 2IGMA 4KICA 3ZPLA 1B72B 2HQAA 4BL0B 1RKWA 3MCZA 3HGGA 4S0HB 1TWCJ 2HQ5A 2VE8A 2DFFA 5DUIA 2ZXJA 2OA4A 5ICCA 5E79C 4ETSA 5LBQA 4JYKA 3EYIA 3ZQFA 4M73A 3HKZN 3KE2A 2W1OA 3CCEI 1KQ0A 4II3A 1WPKA 3QBMA 5IP9J 2CV2A 5E3OA 1OYIA 4H0EA 3FBNB 4Y15A 4JX6A 2D6YA 5B1BH 1R1VA 2JQ7A 2QZ8A 3G1LA 3H36A 1WJCA 3Q5FA 3G3ZA 1VQ4I 5LHHA 4YG2F 2K27A 4A3EJ 3BG5A 3HRMA 2LD5A 2RKHA 3OS1A 2FQ3A 3WU1B 3ZQCA 2XGEA 3BG3A 2L0KA 3L2QA 3S1RJ 1FBSA 2RGVA 4RMNA 2K7LA 4M6YA 3RDIA 3Q9VA 2JPCA 3ZN0A 4F52A 2K9LA 1Z91A 2ZOYA 3DTEA 2VQCA 4PJLA 1WH5A 4EJTA 5IYCJ 3QKXA 4DIQA 1ZGJA 3ZQLA 1SFUA 3ROUA 4XK4A 5C3EJ 2YR2A 3CF2A 3OYFA 2DK5A 2EPFA 4KIFA 2E60A 1WGXA 4XRSA 3QOEA 3OR2C 1ON2A 2M3AA 1X2NA 3CLQA 1XMAA 1RI7A 3HIFA 1R5ID 4QWQA 2ESNA 3F23A 3VSKA 3HRTA 2VJIA 4JQFA 2EIKH 5J8CA 4FT8A 2DDAA 2F5VA 3BG6A 3CCYA 4HQEA 3CJTB 3RPQA 1PP8F 2D45A 2UZKA 3TP0A 1GVDA 2R7WA 4LIVA 4BJTA 2Z9OA 3O2PE 1YX3A 1AHDP 3L2UA 3S93A 1D5VA 1X3ZB 1E3OC 4IVNA 4PJMA 2FF4A 1HW2A 4U0YA 1T2KA 1ITYA 4E7LA 4M3GA 5B5EC 1UMQA 5C4XJ 1WWXA 3F0CA 3WE2A 4ESFA 1IO2A 4V2FA 3J81K 1K6YA 3K70D 2RQPA 2VQHA 3OYGA 3DV8A 1UHSA 1WJ5A 3A02A 1WI9A 4QSHA 2ID6A 5LGUA 1Z9CA 1CGPA 1P6RA 2WB1N 3T8RA 2J5OA 5FLXK 1ZELA 5EFYA 3UKGA 1IV8A 4F7ZA 3CJNA 2WUIA 4YIFA 1OISA 3HM5A 2QKMB 3GTJJ 2VONA 3H9QA 1HF0A 2JRTA 5F04A 2BEOA 2R7FA 4LOCA 1H8AC 3OOUA 4KN7X 2X6YA 1TP4A 4DBRA 4ESJA 1IN4A 4B44A 3ZMTA 4WXCA 1UHMA 2OBPA 3GFLA 2WA0A 2PG4A 3RCOA 4YFKF 4GO1A 1JKRC 3CLOA 1HC8A 3MKYB 4CHUA 1CF7B 4NHJA 1N78A 1UFMA 3L7WA 1F36A 3FF5A 4UUSA 2NP5A 3FHNA 5DD8A 1LFUP 1MMNA 2DFHA 5F0FA 2ME0A 4EJWA 5E3MA 4RB2C 1YITI 1BBYA 1VZ0A 2F6CA 1U8RA 4BS9A 2EV5A 4KIGA 1RR8C 2WY7Q 3BPVA 2Y9YA 4BY7J 4LMYA 4UUSB 3ERED 2F5DA 2CQ7A 3HTAA 1YS6A 2HOSA 2IGNA 1A6QA 2DCEA 3I0TA 1RRJA 1ZYRF 3F8CA 3ISPA 3LSKA 3RJPA 1OLTA 3MZHA 2A05A 4NDLA 1B8IA 2IT0A 2D1VA 2HVRA 3CUQC 4II2A 2ZXWH 3IAS2 1QPMA 4DZJA 1Y0UA 1S8NA 5GTIC 3KP6A 4EEFG 2Y69H 4HOBA 1APLC 1TQMA 2XC7A 1I5ZA 2KT0A 4LITA 3TOAA 3HOUJ 3BJBA 4IO9F 2LK2A 5GAGJ 3OR1C 1BI3A 2BXZA 5E3NA 3L1PA 2AXTC 1STZA 2QGUA 3F6VA 3HHHA 3BNIA 2W24A 1MNEA 4HX4A 3GTKJ 4U9NA 4WCGA 3GZNB 4DBQA 1QGPA 3IV5A 3SWHA 2DA3A 4BXUA 4D9JA 2OAZA 2Y30A 3NWSA 3HGYA 3B81A 3TEDA 3CMMA 4WK8F 1GUUA 2CSOA 4ZZDA 1FC3A 2BW3A 5J47A 2IS6A 3VW1A 5EEHA 4L0ZB 4FE7A 1E17A 1LDJA 4MTEA 1XB4A 4FTHA 2W57A 1F1ZA 2L4MA 2R7QA 2G7SA 5AIQA 2PMHA 2QF7A 2Z2SB 1YW9A 4HYEA 3KNWA 3V8LA 2X51A 3OS2A 1PDNC 2XPVA 2X85A 1MJAA 1OMIA 1A31A 3IRRA 2OZ6A 3FMQA 3TDZC 5D4SA 2H6BA 4HF1A 2ZBKA 2E1MC 1MKMA 3ON2A 3HKZA 2OF7A 1UG2A 2PJRA 1W7PD 1T0FC 2DYRH 2Q24A 1MBEA 2LY2A 2R93J 3S1QJ 1WRJA 2PFBA 3IWFA 2KISA 3RQIA 4G9YA 4ANJA 1JXSA 4UXNA 4AF5A 2L3DA 1IDYA 5TGTA 2GA1A 1R5HA 3LJLA 2RAEA 2DN0A 1U9OA 4OD4A 1FJLA 4FISA 3DPTA 2FX0A 4JBAA 2R0QC 2GXGA 5J3LA 1WI3A 2B1EA 1LDKB 2YPRA 5EZHA 3O8GA 4LG0A 1O3QA 1IW7F 2O6GE 2NP3A 3H9GA 2XGDA 1AU7A 3P5JA 2FU4A 2ACJA 1FP2A 1GXPA 2V26A 5F0HA 4IQJA 3A01A 4E7HA 3UNGC 3ZGKA 4RAZA 3E6BA 5K5RA 1A35A 2A3SA 3HUGB 4PFPA 4UVBA 2WAFA 5L3EA 2BY3A 5A2QK 2KIQA 1WCMJ 1Z77A 2ID3A 3HTJA 4CCKA 3LSGA 2DDBA 2LBFA 1XTAA 1ZH5A 4AVPA 1PUFB 2VXDA 4IPAA 3FXLA 3SXYA 4C9YA 4WIBA 3CCMI 4KT6A 4ME9A 1WJEA 2DOAA 3CCVI 1OPCA 4BKXA 5EF6A 4L9JA 1R1UA 1OYWA 3LFKA 1TQIA 3MFKA 3HSRA 1GLNA 1D0XA 4XM3A 2ZCNA 1R7JA 1QNTA 2DA2A 2LVSA 5CVUA 4A6EA 2M0MA 4KFCA 1I1GA 5JLXA 3DF8A 2CQQA 1W5CC 1SEUA 1XN7A 2V79A 3WTVC 2A5YB 2L9RA 4I99C 2LKXA 2EK5A 2OTLI 1Y8QB 3FMSA 2BW3B 1NH3A 2HNHA 5L3GA 4F93B 1YTYA 2R7OA 1YJNI 3QYBA 3MNLA 3DXJF 2GIZA 4XOPA 2KRCA 3H3ZA 2HEOA 4MEXF 2XPUA 1K6OA 4E7KA 5K5QA 1T95A 2FRHA 2XB5A 4W1UA 2WV0A 1S72I 2WV1A 4I0AA 5H9TA 3C3WA 2R7SA 1JT0A 3CUQB 2K9MA 4IF4A 4OD5A 2ZFUA 4WF2A 1F9NA 4N4OB 5FLXZ 1U5TC 4G8XA 3SQNA 2FUG2 2AS5F 1G8XA 2ZNYA 5BNGA 2DJIA 3W3CA 2E19A 3OIPA 4LB5A 3HRSA 2IP2A 4G6QA 4XKWA 2E71A 2NNYA 2STWA 2OCCH 4U9LA 2M8EA 1WSUA 1QBJA 1L3LA 1NK3P 2VBYA 1W7PB 3BY6A 1P4WA 3O8HA 4CCNA 4F55A 3LWJA 1BN5A 5C4YA 1HDPA 2NYXA 3FXOA 1VF9A 2BE5F 4WWCA 3BJAA 4FX0A 3K9TA 1HLVA 4G7ZF 2EFQA 5CQEA 5FJ8J 4EGYA 3HOWJ 3E6CC 4GGGA 2NXNB 4CYDA 3VYSB 5JR3A 1CF7A 2E5ZA 5LGTA 5ED4A 1JT6A 1OCPA 3ZMZA 1JE8A 4Q5SF 2EILH 4ACIA 4UNOA 2XVCA 2WTEA 5M3MJ 3HSFA 5L3FA 2KMUA 5FKNA 3H0DA 1KQ9A 2KIMA 5CLSA 3FRQA 1R36A 3S3OA 2JA7J 2Z99A 2FQ4A 1OCTC 1YS7A 3VUQA 1IUYA 2YX4A 4GYIA 2DQRA 3KKDA 5IYBJ 3RI4A 4G6DA 3QYEA 4NQWA 3OYJA 4AD9A 2F2EA 4A3DJ 3VW0A 3BLYA 4D7MA 2ZKZA 3PFIA 2HI3A 5FB2A 1IV6A 1OR7C 4DGWB 4J01A 2BXYA 3MN2A 1GXQA 2IRFG 2G7GA 2DMUA 4JX5A 2Z1DA 3ASOH 3TOBA 2ESHA 2HOAA 1BC8C 3T1BA 2ME6A 1BW5A 1AA7A 3MKZA 4LK1F 5CVRA 3HTIA 4Q48A 2JZYA 4DVYP 1V3FA 1Y1WJ 4I09A 5JI6A 4MTDA 1EH7A 4KNYA 3G1MA 4D5CA 3MEXA 1MBHA 3L09A 5FO5A 1TWGJ 1LB2A 5GAEJ 1X4OA 3H0GJ 3BROA 3A0HC 3MZYA 2LFBA 4Y4RA 4E4HA 2LBFB 3VVYA 1EKEA 4GXOA 3I55I 4EGZA 1UI5A 2YUSA 5H6RA 4C2MJ 2M30A 1HKTA 1XC5A 2PMZA 5ILUA 1NTCA 4QPOA 2CG4A 2JMWA 2V9PA 3BTJA 2CQNA 3TL4X 2LY1A 3DLLF 4Y17A 2K9QA 1QO0D 4XLAA 1Z1DA 2FBIA 4ITVA 1MBGA 1LPQA 2X0LA 2MD5A 1T98A 3DTKA 2DA1A 3RYRA 4KMFA 4LLLA 4LLGF 4HW0A 1V4RA 1N75A 2WAQN 2UXUA 4IRVA 5DDGA 2K3FA 3JREA 1K78A 2AHQA 3HBLA 4LK0F 4AYBN 1TBXA 5EEGA 1XSVA 4PFOA 3ZQ7A 2P6TA 5CXIA 2GIVA 2GM4A 1FTTA 2V9VA 3JW4A 5JLWA 1T38A 3K6GA 3KPHA 3FM5A 5C4JJ 3ELKA 1XD7A 4LG3A 2KZGA 2RN7A 4JP0A 1SD7A 1X1PA 2JA5J 2JA6J 2RHAA 2WY8Q 5FRMA 4FX4A 1XGNA 4A3MJ 4OWRB 4ENJA 3BZCA 3DWLE 3FIWA 3M7GA 3GVAA 2PJRB 3ANGA 2V1NA 3CCRI 5HS9A 4CDGA 3J7ZI 1VFCA 1FEXA 1T39A 2DODA 1U6GA 2OTJI 1ZG5A 1HBXG 4RGUA 2YVHA 5ILSA 2VPRA 3RKYA 5JHFA 3GEZA 3LSJA 3HPGA 5FMPA 3F9KA 3VPRA 3VIBA 2BHZA 3GFMA 1VTNC 4NC6A 2V6EA 1XS9A 1I39A 1I6XA 5HLIA 3C2HA 3ZMUA 3CCLI 4M3DA 5D5UB 2K86A 1FSHA 2P8TA 1IN8A 5LFAA 2IS1A 3S5RA 3GBGA 1MNDA 3PM1A 3S1MJ 1DQUA 1GVJA 4U87A 2NVQJ 2VXZA 1FPQA 3PFYA 3BR5A 1J09A 2HQRA 2J5PA 4E7JA 3C2BA 3TW6A 1PJRA 3BPXA 3TBIA 2FNAA 4J19A 4NC7A 2M8GX 2M0CA 3MD2A 4RAFA 4I02A 1EH8A 2F4IA 3G7RA 2ECBA 4HV5A 3KYLA 2B9SA 3ANPA 1A6IA 1RPWA 5GPCA 5H20A 3AL0B 3ML6A 5CVIA 1PP7U 1R23A 4XQFA 3KZIC 3OYLA 4GCTA 5EGOB 1K61A 5HDNA 3KZ9A 1D1CA 5IYDJ 1BI1A 5DCMA 1X58A 4KWAA 1P7IA 1S7EA 1U9NA 1IDZA 2KP6A 3V7CA 3HE0A 3I53A 2CJJA 2HR3A 3ECOA 4BU2A 2Y75A 3D1NI 5HLTA 3DCFA 2PZ9A 4KJZA 1ETVA 2BVMA 1XSDA 1FYLA 2QBYA 2DI3A 2LP0A 4ZDOA 3OYNA 2VKEA 4XR6A 1U8BA 1JTYA 2F48A 5JVGF 2M4KA 2XKPA 2A6EF 4ZYGA 3T8TA 3CCSI 3VOXA 2IW5A 3AG4H 1VQ8I 2UWMA 3J81Z 2A6TA 1LDDA 2GOMA 3RKQA 4FETA 3GW2A 3VB2A 4FE4A 3P9KA 3TO7A 3HZJA 3C18A 4A5NA 3RZDJ 2K02A 3HEFA 2Z33A 1BI0A 4H4KC 4U88A 3F22A 2UXOA 1JI8A 5DM6F 3OSGA 2VOOA 3NWTA 3J7AO 2IA1A 2DO7A 4BY1J 2FMYA 3L2CA 1FBUA 3E3VA 2QOPA 1TNSA 4L9TA 1QZZA 1UJ8A 2LYCA 4MFEA 3B73A 3H3VK 2F4MB 1DPUA 3P9TA 3BG9A 4XBFA 1E0EA 1YJ9I 4RB0A 4B3XA 5D4RA 4A5MA 3WGHA 3I3LA 4A6DA 2M1BA 3OIOA 2GOXB 2X6XA 2AQFA 1NG7A 2XAUA 5CVVA 5K7ZA 1JKQC 2O8XA 4L62A 2HOTA 3EUPA 2FJ1A 1MJ9A 3CTAA 3PSIA 1OQYA 1QZEA 1ZLKA 4B47A 2OC6A 1YOVB 3CP8A 3M4OJ 3RIRA 5L3BA 5E8IA 3WU2C 1YHQI 3M9AA 2XDNA 2UXHA 3S1NJ 1F43A 2F5FA 2Q1ZB 1XDSA 1MIJA 4IRGA 4BAYA 5GTHC 2W53A 1J2XA 3QP6A 2Y0MA 4ENNA 1Z7LA 2JT1A 1IAWA 3JRFA 1TNTA 2E1NA 3S2WA 4DYCA 1X19A 4N9IA 2L9NA 2ZC2A 3GWZA 4HV6A 2FD5A 2M9HA 2E1CA 2WAQA 5KCMA 2R5YB 5D6FA 3JR9A 1RETA 3A03A 3G73A 2VC0A 1MZBA 1FMVA 2DT7B 2PI0A 4MXMA 2M7BA 1UB9A 1PUFA 1P4AA 2FBHA 3S16J 1UCRA 1LEAA 4A3BJ 2NAZA 1R9TJ 3NRVA 2X1EA 3H5AA 4XONA 2V1DA 1X1BA 3OYKA 2GUHA 2XIGA 1HW1A 3EUHC 2IS4A 4M3FA 3PSFA 2DU9A 4GFLA 3A0BC 4AVZA 5KK1A 2TRTA 3BTLA 3K10A 3H92A 2O7OA 3DKYA 2IEKA 1LEBA 4XLCA 3X2QH 1X4PA 2O61A 4I98B 3PASA 4A3IJ 2L7KA 3DEEA 2OU2A 1IUFA 3K2AA 1RUOA 2ZXHA 2P7CB 4XRSG 2X1CA 5FKOA 2RREA 3FXKA 1I3AA 2FEZA 2JK3A 5D6EA 2IBDA 1FOYA 5EZGA 5ILVA 1FMWA 2LRDA 1W4MA 2CV0A 3BTCA 1BJAA 1O57A 1LFPA 1UI6A 3KP4A 2HDCA 2KPMA 4U0WA 4E7IA 4BEHB 1VQLI 3JRHA 3I71A 4BE0A 3BR6A 2HYTA 4IJAA 1R4NB 2NS0A 2LOOA 2Y9ZA 3RPUA 2H94A 5JFRA 5DM7F 1MJBA 2KFDA 4D1QA 4OMYA 4IHYA 2DG8A 4MQ9F 2X4HA 3RQ4A 5BMZA 1USSA 1HSTA 1R00A 4P5OA 3H1CA 1ZQ3P 2D2WA 5HDGA 3S32A 1MMGA 3GZ5A 3FMRA 4MFDA 4C3JJ 3JCUC 3U21A 3ZCOA 3QRFF 2EFNA 2FBQA 3K4CA 4NUBA 3VFZA 4CZZA 1X1CA 2M87A 5JVTA 2Y0SA 4WXHA 5FKLA 2HFHA 4E70A 3FXRA 1YO5C 2EA2A 2EINH 3D5LA 2BY1A 4HLXA 2W00A 2JSPA 5D8KB 3T5XA 1H9TA 2V1UA 3DKWA 3R0JA 2CQXA 1MMSA 3WTUC 3WTWC 4Y52J 4NELA 4RGXA 4HNUA 2MG4A 1TZLA 1RC9A 4EV0A 2A68F 4UDSA 3JTHA 4B8XA 2IA2A 2XHKA 2DA4A 3BR2A 2ZY9A 1HCRA 2GFNA 2ZJRF 1ZREA 5ICFA 4ZTFA 3V7SA 4QIWN 1LE8B 1RKTA 3M8JA 2Q0OA 3E0JB 3HOVJ 3I9V2 2Z16A 3EYYA 1SMTA 2HVSA 2XSJC 1QHHD 4ZYEA 3DPJA 5HVQC 1J7KA 2XB0X 3PNVA 3BG7A 3TQNA 2R4GA 4F3QA 3H9JA 2QKOA 2VQGA 5D5WB 4B3AA 4UV8A 1KA8A 3QAHA 3DFGA 3P9IA 3TGNA 1V5EA 3FWEA 1WVRA 1W36C 2R7TA 2E34A 3WU0A 5KHDA 3F6OA 5E20A 1IGNA 2VT3A 2L2OA 3SZGA 1AKHA 3N97A 2CQKA 1JKOC 3SHFA 3DBRB 2GXAA 3IH4A 1VQKI 2MD0A 3CD6I 2ZCXA 3K69A 4KA4A 2CV1A 1V54H 1S5LC 3S2HJ 2JUGA 3VVZA 1SC7A 2DJNA 3LQRA 1QA6A 3WODF 1OCZH 1Z7UA 3JRAA 3ESWB 4FHTA 2DPUA 1WQ2A 1WFXA 3K4KA 3V8JA 1JTXA 4AM3A 3ERMA 2DQLA 2FA5A 2ELKA 3ZMDA 4NB5A 2XAJA 2BY0A 2MABA 4BUPA 5HNHA 3HL2A 2B63J 1EH6A 3GX4X 3G56A 1Y6IA 4GYGA 3LA7A 3L2WA 2OCEA 2KLOA 1Z05A 1Y39A 2R7RA 5DCFA 1FTZA 2WADA 2IVMA 4A3FJ 3O6BB 1D0YA 2CUEA 2IGKA 5C44J 1QRYA 2YS9A 3VDXA 4DW6A 1ON1A 2ZMEB 1VQ9I 5DAJA 3OV8A 1O7FA 4U7BA 2M45A 2IJLA 3FK6A 3CESA 2HXIA 3I59A 2DA5A 1E3PA 2KJBA 1MDMA 5LRRA 1D8KA 4UB6C 4BH9A 4IHVA 1JHFA 3ONQA 1S29A 1ZARA 4BNCA 1VQOI 4CGRA 1JUSA 3LSMA 2QWWA 4HF2A 3F8BA 2VL8A 4KUMA 3LSRA 2EQRA 2QYOA 3GTQJ 5AQCA 1S9HA 4XOTA 1YLFA 5IT3A 1IRFA 2K4JA 5E1ZB 1TW3A 5A2QZ 4M72A 4I6ZA 2QQBA 4HNTA 3CRJA 2O0YA 1IXRC 3HOSA 2E7WA 2HGCA 1ZAOA 3OY9A 1K7AA 3I4PA 3LQQA 5FFXA 1V5GA 2Y2ZA 3CC2I 2W4SA 3FBIB 2GA2A 3DKXA 3E1SA 3WG9A 3VODA 3I56I 3VVXA 4AU7A 2DMTA 3MQ0A 4D5FA 2ZNZA 4QTRA 5D5VB 4GRIA 2LF7A 1DU6A 4QLCU 5CW8A 2XF5A 4BHCA 4E7ZA 3LMMA 2CW0F 1G59A 3LSIA 2CUFA 4AYBA 2ZJ2A 2CO5A 3M3YJ 3Q9SA 3HJEA 4AUXA 2DOEA 3FKJA 1U5TB 1ERDA 4KMUX 3OSFA 1BOBA 2HWVA 1GDTA 4HZFA 1KU9A 4V2GA 1VQ5I 2IS2A 1FP1D 1TT5B 5DS9A 2HKXA 3ON4A 5TJJA 1SD5A 1X3UA 1SFXA 1ZR2A 2BVLA 3HG9A 3L2RA 3ZQHA 1QU3A 1VI0A 3I5UA 3ZQGA 3KEOA 4JX4A 3EETA 3I4MJ 2XGCA 3IH2A 2W84A 2EB7A 2AQEA 4LIUA 3ZRGA 4OIRF 3KETA 2KZVA 5EG0A 1F5TA 1N25A 1SD6A 2QKLB 2OD5A 3WTTC 3OYCA 2H8RA 4XLHA 4GFKA 3V6GA 1KYWA 4AC0A 5LD2C 1RZ4A 2O9LA 2I10A 2KIFA 1ORKA 2RC4A 5TRDA 1ZR4A 2FJI1 2QWTA 2L01A 4ON0A 3PQJA 4HG2A 9ANTA 3DLAA 4RM2A 1W0TA 4A3LJ 3KIOA 5FFZA 3DPUA 4DJAA 2E7XA 4UV9A 3WE3A 2XSDC 2R5YA 2LNBA 5J8FA 1Z6TA 1D1BA 3OL3A 5FRNA 5K58A 1ENHA 5LEKA 5CYVA 4LB6B 5EG0B 2LF8A 1JJ8C 1FOXA 2W7NA 2BYVE 2FE3A 4OIQF 3OWTA 1JKPC 3HOZJ 1S3JA 1I1SA 5AIPA 1Z21A 5DCMB 1S7OA 3OMYA 1IRZA 2EIJH 1UZCA 4RDUA 2VC1A 2DMPA 5FKMA 2YVXA 1FSEA 4BBSJ 1XGOA 1K4TA 1K4SA 1YRNB 2UXXA 2M7AA 3U2RA 1DP7P 3QPSA 4GCVA 3LFUA 2P0WA 2UV1A 3KLNA 3L9FA 3PNYA 3FXUA 1W1WE 4F91B 1G3SA 1ONVA 3J80K 4NN1A 4YELA 3B02A 4IRIA 2A6HF 4LGWA 1U5TA 4HRIA 2HKOA 1HKQA 3JAMK 3OYHA 2V57A 4B4CA 4FCYA 3LSHA 2A69F 2OJED 3GF2A 3K4BA 1MD0A 1Z6RA 2ELHA 3G1OA 2BY2A 5LHGA 2V4JC 2M5WA 4X1EA 5FLMJ 1DDNA 2AO9A 3GTOJ 1TC3C 3Q3SA 4OAYA 2HS5A 1U2WA 2B3WA 4GCKA 1DU0A 3RZOJ 2D1HA 4UVCA 1BW6A 2EH3A 5FD6A 2K3PA 2DAOA 5GPAA 2QQ9A 1YIJI 1XCBA 2L7ZA 2W48A 3PIPF 3EDPA 5KVRA 3RSNA 2HDWA 2PBIA 4RA2A 3SYTA 1VQ7I 2G7LA 1W7PA 3BC8A 2QSGX 2COMA 1MBFA 3K1PA 2VE9A 2MBFA 3GLLA 2F4OB 4YIRX 3AKZA 2OZUA 1XX5A 2CW8A 3GEUA 3O60A 1O3TA 2IAIA 2DOFA 2GWRA 2L5QA 4R1HA 1VNDA 2EZLA 5EEAA 1RNLA 4I7HA 3CCUI 2PFVA 3ECHA 5D18A 3OYIA 1BR1A 3D5SC 3S15J 4CXFA 2ZJPF 1FWZA 1LKXA 1E2XA 5F64A 2KJCA 2RNGA 5E8GA 2UXIA 4UUVA 2VKVA 2V9KA 4HX8A 3DU5A 5HS7A 3J7AY 4LFUA 1Y1VJ 2HQNA 5M5WJ 4TV7A 1YRNA 2IGOA 1A5JA 4NC8A 5BOXA 3LA3A 3HOYJ 2WWYA 5DUKA 5LGNA 1CQTA 2HYGD 2JWTA 1H9GA 3K4MA 3V42A 1IZ1A 1JUMA 4XLPF 5F08A 4HSRA 3SZPA 1GV5A 2JA8J 1LNWA 1Y0NA 1YW8A 4M6XA 2KL4A 3DBHB 4HQMA 3FK7A 2HTJA 3WGIA 1P9QC 2CH0A 3C1DA 2DPDA 4AIJA 1YQAA 2ECCA 2VPLA 1Z3XA 2ISZA 3AQSA 2GQQA 5DTDA 2XKOA 5LEJA 5CPRB 3GLXA 4OU0A 2LLKA 2PMZN 3R4KA 5LLQA 2GLOA 3AQTA 5DEQA 3VTIA 2JJ7A
chains in the Genus database with same CATH topology
4BY7J 2Y9YA 4UUSB 5K7ZA 1JKQC 4L5EA 1QPIA 2F07A 4L62A 2HOTA 3EUPA 2FJ1A 3HTAA 4XIDA 2HOSA 1OJLA 3SJMA 3W6VA 3M4OJ 2XDNA 2UXHA 3S1NJ 1F43A 4NDLA 2W53A 1B8IA 2LTPA 3B6AA 5IOZA 3JRFA 3A01B 4DYCA 2OPTA 4DZJA 2YU9J 3DEWA 4MIMA 3C07A 1IJWC 2FD5A 2M9HA 4EEFG 2R5YB 1APLC 3JR9A 1RETA 3A03A 2KT0A 5D19A 1MNMC 4GCLA 3HOUJ 3BJBA 3F1BA 1AKHB 1RR7A 3S2DJ 2LK2A 1FIPA 4MXMA 5E3NA 1PUFA 3NI7A 3L1PA 2NVXJ 3JRGA 3NPIA 3S16J 3BNIA 4A3BJ 4M6VA 3GTKJ 1T56A 5HSZA 3K7AJ 1R9TJ 3IV5A 1SFOJ 2DA3A 3B81A 2Y30A 3HGYA 5FKKA 3TEDA 1P7JA 1QVUA 2GUHA 1GUUA 5EDNA 2YVEA 3GZIA 1W0UA 3VW1A 2WGBA 4M3FA 4FE7A 4GFLA 4DZPA 2TRTA 3BTLA 3LSPA 2O7OA 3BRUA 4FTHA 2IEKA 5FLVA 2GENA 1ZKGA 3BQYA 3CMYA 2G7SA 2QF7A 3E7QA 3PASA 3GTPJ 3KNWA 3IUVA 4A3IJ 3BHQA 3BTIA 2E2JJ 2XPVA 3BQZA 1IUFA 3K2AA 3NAUA 4X6AJ 1TWHJ 4XRSG 3JRCA 5FKOA 1ETOA 3CQZJ 3GTLJ 2JK3A 3ON2A 2OF7A 1UG2A 5IP6A 3V78A 2LY9A 2Q24A 2IBDA 4A3GJ 5EZGA 3MKLA 1MBEA 2ZCMA 1IC8A 4C3HJ 2R93J 3S1QJ 3BTCA 3FKIJ 1UI6A 3RQIA 4Y7NJ 4AF5A 1IDYA 2OERA 1IG7A 3JRHA 4PXIA 5M5XJ 1U78A 3LJLA 2XPWA 3BR6A 2RAEA 4XRMA 2HYTA 2DA7A 1MBKA 2HXOA 2DN0A 1U9OA 2Y9ZA 1FJLA 4FISA 2QTQA 2O8KA 4C3IJ 2RASA 2FX0A 4IHYA 2R0QC 2HKUA 2DG8A 5J3LA 1WI3A 1MH3A 5EZHA 3O8GA 5IOYA 2NP3A 3PO2J 1AU7A 2XGDA 1ZQ3P 3BR3A 4MFDA 4C3JJ 2CRGA 5F0HA 3NARA 3A01A 4AC6A 4MLOA 2FBQA 2E1OA 1SANA 5FKLA 3CDLA 4MO7A 3Q0VA 4XICA 2VI6A 1WCMJ 1Z77A 2ID3A 3T6NA 3HTJA 3LSGA 2CQXA 1LFBA 1K83J 2MW8A 1PUFB 3HDDA 2ZOZA 4Y52J 4NELA 4IHXA 3TW7A 2MG4A 5M5YJ 2TCTA 5FGLA 4UDSA 4ME9A 1TWAJ 4BKXA 2MSYA 5EF6A 3NRGA 2GBYA 2DA4A 3BR2A 3MVPA 1MSFC 1HCRA 5J1UA 2GFNA 2ZCNA 2LVSA 2MGQA 2DA2A 3HB9A 1MBJA 4BBRJ 2OI8A 3Q0WA 5JLXA 4QIWN 2CQQA 1LE8B 3PPBA 1RKTA 2E2HJ 4A69C 3GTMJ 5IP7J 3HOVJ 2L9RA 1I6HJ 2K40A 2LKXA 2DMNA 2CU7A 1ETXA 3GTGJ 2EZIA 3DPJA 2XB0X 2K9SA 2X9DA 3MNLA 4JNNA 2QKOA 2D5VA 4B3AA 1EF4A 2XPUA 2X6OA 2XB5A 4W1UA 1BL0A 1IGNA 4GFBA 1AKHA 2WV1A 1GT0C 5H9TA 1JKOC 2NX4A 1JT0A 5CXGA 4CYCB 3IH4A 1MH4A 3QPLA 2LR8A 2ZCXA 3WHCA 2G0EA 3S2HJ 3VVZA 1Q1VA 2DJNA 2NVTJ 1X2MA 5F0CA 3VOKA 3CJDA 5BNGA 2NOGA 4UUTA 3ZQIA 3JRAA 3E7LA 2E19A 5D1RA 2DTZA 5M3FJ 3ZOBA 2PBXA 1JTXA 4IHWA 2O7TA 3RD3A 2ELKA 2VUMJ 3G56A 2B63J 2R5ZA 2UXPA 1NK3P 1O4XA 3O8HA 2E2IJ 3HIMA 3LWJA 3IH3A 2M34A 4A3KJ 3BCGA 3KKCA 1HDDC 5C4YA 2KDZA 1HDPA 2H1KA 1FTZA 1VF9A 4W97A 5K7HA 3QQAA 4A3FJ 1HLVA 2CUEA 2XRLA 5FJ8J 1QRYA 2YS9A 5C44J 3HOWJ 2EBIA 1POGA 3BR1A 4IEJA 1B72A 2R7ZJ 2DG7A 4DW6A 5IPAA 1JT6A 5DAJA 1FIAA 1OCPA 1ZGWA 5F1JA 3FK6A 2HXIA 2NS7A 1JUPA 3WHBA 5F27A 2DA5A 4ACIA 5M3MJ 5J1YA 3LNQA 1I3QJ 4IHVA 1T33A 5FKNA 3S14J 3FRQA 3BT9A 4CGRA 3HOXJ 2JA7J 3VW2A 1JUSA 2N8GA 2FQ4A 1OCTC 3VUQA 4JKZA 3GTQJ 3LSRA 2EQRA 4B1RA 5AQCA 3KKDA 5IYBJ 1WH7A 2P81A 1H88C 2QCOA 3TP3A 4I6ZA 4A3DJ 3VW0A 3CRJA 1ETKA 4D7MA 2R5ZB 1BJZA 2DA6A 2HI3A 1IV6A 2G7GA 3MN2A 2DMUA 1TWFJ 2Y2ZA 4JX5A 2HOAA 4ICHA 2ME6A 3S17J 3VVXA 1BW5A 2DMTA 3COLA 3HTIA 4D5FA 3PO3J 4QTRA 1DU6A 1Y1WJ 5CW8A 4A3JJ 2R92J 1XG1A 3G1MA 1Z0XA 2CUFA 2Y31A 4D5CA 3M3YJ 2G3BA 2K9NA 4AUXA 1MBHA 4A93J 3LHQA 1ETQA 2HYJA 1TWGJ 5EGOA 3H0GJ 3OSFA 2LFBA 2Y0SN 1GDTA 3RH2A 4V2GA 3JRIA 3VVYA 2HDDA 5DS9A 3VP5A 1UI5A 5HODA 3ON4A 2YUSA 1ZR2A 4C2MJ 4MK6A 1XC5A 3ZQHA 1NTCA 1VI0A 2JMWA 4M3BA 3ZQGA 3SDGA 3BTJA 4JX4A 3I4MJ 5FHPA 2XGCA 3IH2A 1I50J 2K9QA 1ETWA 1G2HA 1MBGA 4HKUA 3JRDA 3SFIA 5EG0A 3V6GA 2H8RA 2DA1A 4GFKA 2DMQA 2WAQN 4AC0A 4DYQA 2UXUA 2O9LA 2I10A 2QIBA 2EZKA 3BR0A 3JREA 2AHQA 3HBLA 4AYBN 1ORKA 1B72B 1RKWA 1ZR4A 2QWTA 3HGGA 4S0HB 1TWCJ 2HQ5A 5CXIA 9ANTA 1W0TA 4A3LJ 2GM4A 1FTTA 3Q0UA 5JLWA 5HAWA 4JYKA 3ZQFA 5C4JJ 2XSDC 3HKZN 2R5YA 2JA6J 4JP0A 2JA5J 1SGMA 1WPKA 2RHAA 5K58A 2EZHA 3QBMA 5IP9J 1ENHA 5E3OA 5EG0B 2NS8A 1JJ8C 4A3MJ 2L7FP 3FIWA 4JX6A 4D7NA 1JKPC 3HOZJ 2D6YA 1B8IB 3ANGA 4YZEA 1IRZA 3G1LA 1VFCA 4RDUA 1FEXA 4JL3A 2DMPA 5FKMA 4BBSJ 1YRNB 1HOMA 3FISA 4A3EJ 2YVHA 3BG5A 2LD5A 2VPRA 3LSJA 2M2EA 5FMPA 4HNVA 3ZQCA 2XGEA 3BG3A 2L0KA 3QPSA 3VPRA 3VIBA 3S1RJ 2JN6A 3LOCA 5J1RA 4NN1A 1XS9A 2L7MP 4M3DA 3I4NJ 2ZOYA 2V57A 2X48A 3S5RA 4B4CA 3GBGA 4FCYA 1WH5A 3PM1A 1RESA 5IYCJ 2ZB9A 3S1MJ 3QKXA 3ZQLA 2NVQJ 5C3EJ 4XK4A 3BR5A 4XRSA 1WGXA 3G1OA 3EGQA 1OFCX 3C2BA 1X2NA 4X1EA 3TW6A 5FLMJ 2AO9A 3GTOJ 1TC3C 3Q3SA 5K7FA 4J19A 4GCKA 2M8GX 2M0CA 1DU0A 3RZOJ 1BW6A 3G7RA 2EH3A 3CWRA 2ECBA 3CCYA 5GPAA 3ANPA 1A6IA 1RPWA 5GPCA 2L7ZA 2W48A 3TP0A 4A3CJ 1GVDA 1QVTA 4GCTA 5GP9A 5EGOB 1K61A 2COBA 3KZ9A 3NXCA 1AHDP 2G7LA 2REKA 5IYDJ 1MBFA 1E3OC 1X58A 4KWAA 1P7IA 1S7EA 1U9NA 1IDZA 1ITYA 4M3GA 4M3EA 1UMQA 2CJJA 1H89C 5C4XJ 3HE0A 4DYRA 3D1NI 3F0CA 4V2FA 3DCFA 3GEUA 2PZ9A 3O60A 1ETVA 2IAIA 3B6CA 4G12A 1VNDA 2EZLA 3JRBA 2LP0A 1UHSA 5EEAA 2VKEA 3A02A 1U8BA 5D18A 1JTYA 4QSHA 2NVYJ 3S15J 2ID6A 4CYCA 1NK2P 4BXXJ 1ETYA 2WB1N 5EFYA 1JJ6C 3UKGA 2UXIA 3VOXA 2WUIA 1ZTRA 2VKVA 3RKQA 5HBUA 3HM5A 4RBOA 5M5WJ 1Y1VJ 1GV2A 3GTJJ 1YRNA 4I76A 1HF0A 1A5JA 5F04A 4FE4A 3HOYJ 4LOCA 3RZDJ 1H8AC 3OOUA 3HEFA 1CQTA 2UXOA 2JWTA 1BA5A 1LE8A 3OSGA 4ABZA 1JUMA 5F08A 1GV5A 2JA8J 1D5YA 1ZK8A 4BY1J 5E3LA 3FK7A 1JKRC 1JGGA 2QOPA 3NNRA 3H3VK 4MFEA 2ECCA 1MSEC 3P9TA 3BG9A 3AQSA 5DTDA 4UUSA 1F36A 2NP5A 1LFUP 3JSJA 2IU5A 5F0FA 2ME0A 3OIOA 5E3MA 2LLKA 2PMZN 5EYRA 2GLOA 3AQTA 3HTHA 2JJ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BY7 J;  2Y9Y A;  4UUS B;  5K7Z A;  1JKQ C;  4L5E A;  1QPI A;  2F07 A;  4L62 A;  2HOT A;  3EUP A;  2FJ1 A;  3HTA A;  4XID A;  2HOS A;  1OJL A;  3SJM A;  3W6V A;  3M4O J;  2XDN A;  2UXH A;  3S1N J;  1F43 A;  4NDL A;  2W53 A;  1B8I A;  2LTP A;  3B6A A;  5IOZ A;  3JRF A;  3A01 B;  4DYC A;  2OPT A;  4DZJ A;  2YU9 J;  3DEW A;  4MIM A;  3C07 A;  1IJW C;  2FD5 A;  2M9H A;  4EEF G;  2R5Y B;  1APL C;  3JR9 A;  1RET A;  3A03 A;  2KT0 A;  5D19 A;  1MNM C;  4GCL A;  3HOU J;  3BJB A;  3F1B A;  1AKH B;  1RR7 A;  3S2D J;  2LK2 A;  1FIP A;  4MXM A;  5E3N A;  1PUF A;  3NI7 A;  3L1P A;  2NVX J;  3JRG A;  3NPI A;  3S16 J;  3BNI A;  4A3B J;  4M6V A;  3GTK J;  1T56 A;  5HSZ A;  3K7A J;  1R9T J;  3IV5 A;  1SFO J;  2DA3 A;  3B81 A;  2Y30 A;  3HGY A;  5FKK A;  3TED A;  1P7J A;  1QVU A;  2GUH A;  1GUU A;  5EDN A;  2YVE A;  3GZI A;  1W0U A;  3VW1 A;  2WGB A;  4M3F A;  4FE7 A;  4GFL A;  4DZP A;  2TRT A;  3BTL A;  3LSP A;  2O7O A;  3BRU A;  4FTH A;  2IEK A;  5FLV A;  2GEN A;  1ZKG A;  3BQY A;  3CMY A;  2G7S A;  2QF7 A;  3E7Q A;  3PAS A;  3GTP J;  3KNW A;  3IUV A;  4A3I J;  3BHQ A;  3BTI A;  2E2J J;  2XPV A;  3BQZ A;  1IUF A;  3K2A A;  3NAU A;  4X6A J;  1TWH J;  4XRS G;  3JRC A;  5FKO A;  1ETO A;  3CQZ J;  3GTL J;  2JK3 A;  3ON2 A;  2OF7 A;  1UG2 A;  5IP6 A;  3V78 A;  2LY9 A;  2Q24 A;  2IBD A;  4A3G J;  5EZG A;  3MKL A;  1MBE A;  2ZCM A;  1IC8 A;  4C3H J;  2R93 J;  3S1Q J;  3BTC A;  3FKI J;  1UI6 A;  3RQI A;  4Y7N J;  4AF5 A;  1IDY A;  2OER A;  1IG7 A;  3JRH A;  4PXI A;  5M5X J;  1U78 A;  3LJL A;  2XPW A;  3BR6 A;  2RAE A;  4XRM A;  2HYT A;  2DA7 A;  1MBK A;  2HXO A;  2DN0 A;  1U9O A;  2Y9Z A;  1FJL A;  4FIS A;  2QTQ A;  2O8K A;  4C3I J;  2RAS A;  2FX0 A;  4IHY A;  2R0Q C;  2HKU A;  2DG8 A;  5J3L A;  1WI3 A;  1MH3 A;  5EZH A;  3O8G A;  5IOY A;  2NP3 A;  3PO2 J;  1AU7 A;  2XGD A;  1ZQ3 P;  3BR3 A;  4MFD A;  4C3J J;  2CRG A;  5F0H A;  3NAR A;  3A01 A;  4AC6 A;  4MLO A;  2FBQ A;  2E1O A;  1SAN A;  5FKL A;  3CDL A;  4MO7 A;  3Q0V A;  4XIC A;  2VI6 A;  1WCM J;  1Z77 A;  2ID3 A;  3T6N A;  3HTJ A;  3LSG A;  2CQX A;  1LFB A;  1K83 J;  2MW8 A;  1PUF B;  3HDD A;  2ZOZ A;  4Y52 J;  4NEL A;  4IHX A;  3TW7 A;  2MG4 A;  5M5Y J;  2TCT A;  5FGL A;  4UDS A;  4ME9 A;  1TWA J;  4BKX A;  2MSY A;  5EF6 A;  3NRG A;  2GBY A;  2DA4 A;  3BR2 A;  3MVP A;  1MSF C;  1HCR A;  5J1U A;  2GFN A;  2ZCN A;  2LVS A;  2MGQ A;  2DA2 A;  3HB9 A;  1MBJ A;  4BBR J;  2OI8 A;  3Q0W A;  5JLX A;  4QIW N;  2CQQ A;  1LE8 B;  3PPB A;  1RKT A;  2E2H J;  4A69 C;  3GTM J;  5IP7 J;  3HOV J;  2L9R A;  1I6H J;  2K40 A;  2LKX A;  2DMN A;  2CU7 A;  1ETX A;  3GTG J;  2EZI A;  3DPJ A;  2XB0 X;  2K9S A;  2X9D A;  3MNL A;  4JNN A;  2QKO A;  2D5V A;  4B3A A;  1EF4 A;  2XPU A;  2X6O A;  2XB5 A;  4W1U A;  1BL0 A;  1IGN A;  4GFB A;  1AKH A;  2WV1 A;  1GT0 C;  5H9T A;  1JKO C;  2NX4 A;  1JT0 A;  5CXG A;  4CYC B;  3IH4 A;  1MH4 A;  3QPL A;  2LR8 A;  2ZCX A;  3WHC A;  2G0E A;  3S2H J;  3VVZ A;  1Q1V A;  2DJN A;  2NVT J;  1X2M A;  5F0C A;  3VOK A;  3CJD A;  5BNG A;  2NOG A;  4UUT A;  3ZQI A;  3JRA A;  3E7L A;  2E19 A;  5D1R A;  2DTZ A;  5M3F J;  3ZOB A;  2PBX A;  1JTX A;  4IHW A;  2O7T A;  3RD3 A;  2ELK A;  2VUM J;  3G56 A;  2B63 J;  2R5Z A;  2UXP A;  1NK3 P;  1O4X A;  3O8H A;  2E2I J;  3HIM A;  3LWJ A;  3IH3 A;  2M34 A;  4A3K J;  3BCG A;  3KKC A;  1HDD C;  5C4Y A;  2KDZ A;  1HDP A;  2H1K A;  1FTZ A;  1VF9 A;  4W97 A;  5K7H A;  3QQA A;  4A3F J;  1HLV A;  2CUE A;  2XRL A;  5FJ8 J;  1QRY A;  2YS9 A;  5C44 J;  3HOW J;  2EBI A;  1POG A;  3BR1 A;  4IEJ A;  1B72 A;  2R7Z J;  2DG7 A;  4DW6 A;  5IPA A;  1JT6 A;  5DAJ A;  1FIA A;  1OCP A;  1ZGW A;  5F1J A;  3FK6 A;  2HXI A;  2NS7 A;  1JUP A;  3WHB A;  5F27 A;  2DA5 A;  4ACI A;  5M3M J;  5J1Y A;  3LNQ A;  1I3Q J;  4IHV A;  1T33 A;  5FKN A;  3S14 J;  3FRQ A;  3BT9 A;  4CGR A;  3HOX J;  2JA7 J;  3VW2 A;  1JUS A;  2N8G A;  2FQ4 A;  1OCT C;  3VUQ A;  4JKZ A;  3GTQ J;  3LSR A;  2EQR A;  4B1R A;  5AQC A;  3KKD A;  5IYB J;  1WH7 A;  2P81 A;  1H88 C;  2QCO A;  3TP3 A;  4I6Z A;  4A3D J;  3VW0 A;  3CRJ A;  1ETK A;  4D7M A;  2R5Z B;  1BJZ A;  2DA6 A;  2HI3 A;  1IV6 A;  2G7G A;  3MN2 A;  2DMU A;  1TWF J;  2Y2Z A;  4JX5 A;  2HOA A;  4ICH A;  2ME6 A;  3S17 J;  3VVX A;  1BW5 A;  2DMT A;  3COL A;  3HTI A;  4D5F A;  3PO3 J;  4QTR A;  1DU6 A;  1Y1W J;  5CW8 A;  4A3J J;  2R92 J;  1XG1 A;  3G1M A;  1Z0X A;  2CUF A;  2Y31 A;  4D5C A;  3M3Y J;  2G3B A;  2K9N A;  4AUX A;  1MBH A;  4A93 J;  3LHQ A;  1ETQ A;  2HYJ A;  1TWG J;  5EGO A;  3H0G J;  3OSF A;  2LFB A;  2Y0S N;  1GDT A;  3RH2 A;  4V2G A;  3JRI A;  3VVY A;  2HDD A;  5DS9 A;  3VP5 A;  1UI5 A;  5HOD A;  3ON4 A;  2YUS A;  1ZR2 A;  4C2M J;  4MK6 A;  1XC5 A;  3ZQH A;  1NTC A;  1VI0 A;  2JMW A;  4M3B A;  3ZQG A;  3SDG A;  3BTJ A;  4JX4 A;  3I4M J;  5FHP A;  2XGC A;  3IH2 A;  1I50 J;  2K9Q A;  1ETW A;  1G2H A;  1MBG A;  4HKU A;  3JRD A;  3SFI A;  5EG0 A;  3V6G A;  2H8R A;  2DA1 A;  4GFK A;  2DMQ A;  2WAQ N;  4AC0 A;  4DYQ A;  2UXU A;  2O9L A;  2I10 A;  2QIB A;  2EZK A;  3BR0 A;  3JRE A;  2AHQ A;  3HBL A;  4AYB N;  1ORK A;  1B72 B;  1RKW A;  1ZR4 A;  2QWT A;  3HGG A;  4S0H B;  1TWC J;  2HQ5 A;  5CXI A;  9ANT A;  1W0T A;  4A3L J;  2GM4 A;  1FTT A;  3Q0U A;  5JLW A;  5HAW A;  4JYK A;  3ZQF A;  5C4J J;  2XSD C;  3HKZ N;  2R5Y A;  2JA6 J;  4JP0 A;  2JA5 J;  1SGM A;  1WPK A;  2RHA A;  5K58 A;  2EZH A;  3QBM A;  5IP9 J;  1ENH A;  5E3O A;  5EG0 B;  2NS8 A;  1JJ8 C;  4A3M J;  2L7F P;  3FIW A;  4JX6 A;  4D7N A;  1JKP C;  3HOZ J;  2D6Y A;  1B8I B;  3ANG A;  4YZE A;  1IRZ A;  3G1L A;  1VFC A;  4RDU A;  1FEX A;  4JL3 A;  2DMP A;  5FKM A;  4BBS J;  1YRN B;  1HOM A;  3FIS A;  4A3E J;  2YVH A;  3BG5 A;  2LD5 A;  2VPR A;  3LSJ A;  2M2E A;  5FMP A;  4HNV A;  3ZQC A;  2XGE A;  3BG3 A;  2L0K A;  3QPS A;  3VPR A;  3VIB A;  3S1R J;  2JN6 A;  3LOC A;  5J1R A;  4NN1 A;  1XS9 A;  2L7M P;  4M3D A;  3I4N J;  2ZOY A;  2V57 A;  2X48 A;  3S5R A;  4B4C A;  3GBG A;  4FCY A;  1WH5 A;  3PM1 A;  1RES A;  5IYC J;  2ZB9 A;  3S1M J;  3QKX A;  3ZQL A;  2NVQ J;  5C3E J;  4XK4 A;  3BR5 A;  4XRS A;  1WGX A;  3G1O A;  3EGQ A;  1OFC X;  3C2B A;  1X2N A;  4X1E A;  3TW6 A;  5FLM J;  2AO9 A;  3GTO J;  1TC3 C;  3Q3S A;  5K7F A;  4J19 A;  4GCK A;  2M8G X;  2M0C A;  1DU0 A;  3RZO J;  1BW6 A;  3G7R A;  2EH3 A;  3CWR A;  2ECB A;  3CCY A;  5GPA A;  3ANP A;  1A6I A;  1RPW A;  5GPC A;  2L7Z A;  2W48 A;  3TP0 A;  4A3C J;  1GVD A;  1QVT A;  4GCT A;  5GP9 A;  5EGO B;  1K61 A;  2COB A;  3KZ9 A;  3NXC A;  1AHD P;  2G7L A;  2REK A;  5IYD J;  1MBF A;  1E3O C;  1X58 A;  4KWA A;  1P7I A;  1S7E A;  1U9N A;  1IDZ A;  1ITY A;  4M3G A;  4M3E A;  1UMQ A;  2CJJ A;  1H89 C;  5C4X J;  3HE0 A;  4DYR A;  3D1N I;  3F0C A;  4V2F A;  3DCF A;  3GEU A;  2PZ9 A;  3O60 A;  1ETV A;  2IAI A;  3B6C A;  4G12 A;  1VND A;  2EZL A;  3JRB A;  2LP0 A;  1UHS A;  5EEA A;  2VKE A;  3A02 A;  1U8B A;  5D18 A;  1JTY A;  4QSH A;  2NVY J;  3S15 J;  2ID6 A;  4CYC A;  1NK2 P;  4BXX J;  1ETY A;  2WB1 N;  5EFY A;  1JJ6 C;  3UKG A;  2UXI A;  3VOX A;  2WUI A;  1ZTR A;  2VKV A;  3RKQ A;  5HBU A;  3HM5 A;  4RBO A;  5M5W J;  1Y1V J;  1GV2 A;  3GTJ J;  1YRN A;  4I76 A;  1HF0 A;  1A5J A;  5F04 A;  4FE4 A;  3HOY J;  4LOC A;  3RZD J;  1H8A C;  3OOU A;  3HEF A;  1CQT A;  2UXO A;  2JWT A;  1BA5 A;  1LE8 A;  3OSG A;  4ABZ A;  1JUM A;  5F08 A;  1GV5 A;  2JA8 J;  1D5Y A;  1ZK8 A;  4BY1 J;  5E3L A;  3FK7 A;  1JKR C;  1JGG A;  2QOP A;  3NNR A;  3H3V K;  4MFE A;  2ECC A;  1MSE C;  3P9T A;  3BG9 A;  3AQS A;  5DTD A;  4UUS A;  1F36 A;  2NP5 A;  1LFU P;  3JSJ A;  2IU5 A;  5F0F A;  2ME0 A;  3OIO A;  5E3M A;  2LLK A;  2PMZ N;  5EYR A;  2GLO A;  3AQT A;  3HTH A;  2JJ7 A; 
#chains in the Genus database with same CATH topology
 2XAS A;  2ZSI B;  4BEH A;  2DK8 A;  4L5E A;  1QPI A;  1KU2 A;  5E1X A;  3ABT A;  3GUD A;  1OR7 A;  4XID A;  1OJL A;  3SJM A;  4X0G A;  2H6C A;  3HSE A;  5HS8 A;  3SDB A;  2X1D A;  4BGD A;  4EAT A;  1BIB A;  2LTP A;  3B6A A;  5IOZ A;  4CUG A;  3A01 B;  2YU3 A;  2OPT A;  4PK4 A;  3ABL H;  4MIM A;  1IJW C;  2HZD A;  3CCQ I;  1PVE A;  1O7L A;  1OYY A;  1MMD A;  3GME A;  3ASN H;  5D19 A;  4LG0 B;  4GCL A;  4MNU A;  1VQN I;  3VOE A;  3F1B A;  1VQP I;  3S2D J;  2PQ8 A;  3M8E A;  4S04 A;  3E5X A;  3IP4 B;  3K4N A;  3QU3 A;  4DQ2 A;  2NVX J;  3JRG A;  2FOW A;  1WJD A;  3WG7 H;  3F8N A;  1E3H A;  3K7A J;  4LJZ F;  2HTS A;  3WTZ A;  3IUO A;  5FKK A;  3JSP A;  4IX7 A;  3KP5 A;  4HDU A;  2H1L A;  3QWL A;  2E1M B;  3BJ6 A;  3VYT B;  2LSO A;  3E6M A;  4XMY A;  2QSF X;  1BR2 A;  3OYB A;  3GXO A;  3JTG A;  4N0B A;  4ZTJ A;  3BOQ A;  3LSP A;  4BXF A;  4P9U A;  5FLV A;  2GEN A;  3VSL A;  2KIU A;  3E7Q A;  1KQ8 A;  3IUV A;  4PSX A;  3BHQ A;  2FNP A;  2E2J J;  3BQZ A;  2A61 A;  1R49 A;  3NAU A;  4PJJ A;  4X6A J;  2NNN A;  1ZG3 A;  2ELJ A;  1ETO A;  1SMY F;  3C7J A;  3CQZ J;  3W2V A;  3L00 A;  2Q8K A;  2XV4 S;  4C2T A;  2KDO A;  1Y56 A;  5IP6 A;  3V78 A;  4ZDP A;  4AIK A;  4IHT A;  4A0Z A;  4BQQ A;  4A3G J;  4MEY F;  4XLN F;  6PAX A;  3F72 A;  3AG1 H;  3FKI J;  3G71 I;  2HPI A;  3K0L A;  4CCO A;  1IG7 A;  4PXI A;  1KON A;  1U78 A;  2W82 A;  1IXC A;  2XPW A;  5L3C A;  3AG2 H;  2DA7 A;  3KP7 A;  1MBK A;  2VLA A;  3AG3 H;  2VBX A;  3OYA A;  2VJ5 A;  3MKW B;  2A2F X;  3ABU A;  2O8K A;  2H09 A;  3CDH A;  5HLH A;  2Z5U A;  3HTU A;  1MH3 A;  4O5V A;  2P7V B;  3I54 A;  5E18 F;  3OYD A;  3REO A;  3WTX C;  4JK1 X;  2MC4 A;  1B4A A;  1LUJ B;  2PEX A;  3J7Y J;  2CRG A;  2P5K A;  1V55 H;  4CH7 A;  4A0X A;  4EJU A;  5CVJ A;  1QZY A;  4MLO A;  2FML A;  2CW7 A;  4RLF A;  1G3W A;  4BDZ A;  4ZJZ A;  2E1O A;  1SAN A;  2JRM A;  3QPH A;  4MO7 A;  1DGR M;  3HPH A;  2XDV A;  3CC7 I;  3ZR8 X;  5H2F C;  1C0W A;  4RAY A;  1P2F A;  4WX9 A;  5J4V A;  2CUJ A;  4BE2 A;  1XPX A;  2MW8 A;  3HDD A;  1FX7 A;  2ZOZ A;  3TW7 A;  1Z67 A;  2LH9 A;  3VYU B;  5M5Y J;  1IRG A;  5FGL A;  1S7A A;  5TIS C;  2KRH A;  3ZN1 A;  4IHS A;  2O3F A;  3NRG A;  1QQI A;  5IT9 K;  2GXB A;  2GBY A;  1ZRD A;  4XSX F;  4G6T B;  2QBY B;  5DD4 A;  5J1U A;  2DYS H;  2MGQ A;  3KYD B;  3HUG A;  2STT A;  2OI8 A;  1IN7 A;  1W5S A;  3Q0W A;  2DFI A;  3PPB A;  1OKR A;  5FGM A;  1O3S A;  1I6H J;  2DMN A;  2CU7 A;  3BZ6 A;  3IWZ A;  4B09 A;  1ETX A;  1FNN A;  3GTG J;  2C6Y A;  2X9D A;  4JNN A;  2D5V A;  4L0Y B;  1EV7 A;  1REP C;  3KEQ A;  2X6O A;  3U1K A;  2PMU A;  4ZYA A;  5DYM A;  4GFB A;  3BCA A;  4Q47 A;  1GT0 C;  2A07 F;  2NX4 A;  1ZHF A;  5CXG A;  4S05 A;  1MH4 A;  3QPL A;  5KNL A;  2LR8 A;  3WHC A;  2G0E A;  1A04 A;  1Q1V A;  2OQR A;  3SFZ A;  3U1D A;  1X2M A;  5F0C A;  3E5U A;  2P5V A;  3DTI A;  3K70 C;  3CO6 C;  3CJD A;  1SVO A;  2NOG A;  3E7L A;  3KP3 A;  5HLG A;  2RVC A;  2DTZ A;  2WB1 A;  3RYP A;  4HA8 A;  2PBX A;  1KGS A;  4HST A;  1TQP A;  4L9V A;  2ZSH B;  2VUM J;  3BDD A;  1MGT A;  1UEL B;  2WAE A;  5F1R A;  1D8J A;  2E2I J;  1LVA A;  3IH3 A;  2L9V A;  2ZFW A;  4A3K J;  3TO9 A;  3BCG A;  3FX3 A;  4XN0 A;  1HDD C;  4M9Z A;  3KKC A;  1DP3 A;  2H1K A;  2K5C A;  4W97 A;  4XOR A;  1ZGA A;  2KHM A;  4EJV A;  3PJR A;  3QQA A;  2MC3 A;  2XRL A;  2XAG A;  3F21 A;  2EBI A;  1B72 A;  1OCO H;  3BR1 A;  4IEJ A;  2R7Z J;  4A0Y A;  5GAH J;  3BWG A;  2Q2E A;  3D0S A;  1B59 A;  3BZK A;  3HC7 A;  3ABK H;  1ZGW A;  2W85 A;  4EM0 B;  5F1J A;  2QEN A;  2NS7 A;  1JUP A;  1SFE A;  5H6Q A;  3WHB A;  1AWC A;  4LLN A;  3PL8 A;  3I59 B;  2A5W A;  5E1W A;  3LNQ A;  1XGS A;  1T33 A;  3E6D A;  1MW7 A;  3BT9 A;  3HOX J;  3KZZ A;  3VW2 A;  4BYY A;  4AWX B;  4P9F A;  3COA C;  2CWE A;  4JKZ A;  1FY7 A;  4U0V A;  4B1R A;  4NQW B;  3IRQ A;  4BQO A;  2XUB A;  3PQK A;  4ZYD A;  2QCO A;  3K1M A;  3TP3 A;  3T0Y A;  1H88 C;  3EUK L;  1KZH A;  4L9N A;  1YW7 A;  2CS3 A;  3RKW A;  2LMD A;  2R5Z B;  2R7X A;  4KIS A;  2DA6 A;  1IRX A;  2O03 A;  2DT5 A;  3K1N A;  4B43 A;  3OL4 A;  4CCM A;  2CUZ A;  2E35 A;  3H5R A;  4ZH4 F;  3CP2 A;  4CZC A;  1YX5 A;  4U7D A;  1LJ9 A;  5HDK A;  3LST A;  2MH2 A;  3NQO A;  3COL A;  2ZJQ F;  3FM3 A;  4NNJ A;  5D8L B;  1A36 A;  4HF0 A;  4HDV A;  2DT6 A;  1R6R A;  4A3J J;  4CA0 A;  1Z0X A;  5EJC A;  1ODD A;  4M74 A;  2G3B A;  5ERI A;  4XSZ F;  3LHQ A;  1ETQ A;  2XGX A;  3GZ6 A;  1O3R A;  3S3M A;  2HPM A;  1WJB A;  2Y0S N;  4IOA F;  3RH2 A;  3EPZ A;  2QM3 A;  2E5N A;  1PUE E;  5B1A H;  4UVA A;  3ZXS A;  4MK6 A;  4DNC A;  3M1C A;  4N9H A;  1W36 D;  1G6N A;  1ZG1 A;  4ASN A;  4RB3 C;  3JAM Z;  1I50 J;  2R3S A;  3WTS C;  4E6K G;  2VJJ A;  1ZRF A;  3R61 A;  3CUQ A;  4KYW A;  2QUF A;  4MQV A;  4GDF A;  4UB8 C;  4DYQ A;  1IN6 A;  1SVM A;  3A4C A;  1AOY A;  2QIB A;  2EZK A;  3BR0 A;  3DEU A;  4UHT A;  1I27 A;  3DPL C;  1B9N A;  2XAF A;  4HEA 2;  4NBQ A;  1G3T A;  3Q0U A;  2L4A A;  2RNJ A;  5HAW A;  3FDY A;  1SGM A;  2W25 A;  2EZH A;  2GZW A;  5B66 C;  2ISY A;  2UXN A;  1SAX A;  2NS8 A;  4XRF A;  3M8F A;  5J40 A;  2L7F P;  4D7N A;  2ICW G;  1FBQ A;  3ABM H;  1B8I B;  3W2W A;  4YZE A;  1X1D A;  3EQL F;  3HXL A;  4JL3 A;  1SD4 A;  3QPT A;  2QQA A;  1K79 A;  3FIS A;  4EM1 A;  1HOM A;  5IY5 H;  5F6F A;  2CYY A;  2M2E A;  5K5O A;  4HNV A;  2EV6 A;  2OV7 A;  5ICE A;  3ZMV A;  5J4Y A;  4OIO F;  1BOA A;  2JN6 A;  3EUH A;  3LOC A;  4N4N B;  5J1R A;  1J59 A;  1S6L A;  4CSW A;  4YII A;  2BOL A;  5DV5 A;  5LRS A;  4CGZ A;  2EIM H;  4XN3 A;  4BDY A;  2L7M P;  2YX7 A;  2DW4 A;  1FT9 A;  3I4N J;  1IXS B;  3H5N A;  4XKV A;  3MWM A;  2X48 A;  2ZME C;  1MDM B;  3LL7 A;  1RES A;  4V19 K;  2ZB9 A;  4OMZ A;  4XNF A;  2RQQ A;  1OCC H;  3GFI A;  3EGQ A;  2XAQ A;  3EUA A;  1OFC X;  4Y33 A;  2CMP A;  3KZY A;  4L5I A;  3RPU D;  2EFO A;  4BAC A;  4QPQ A;  5K7F A;  4C2U A;  3OS0 A;  4P96 A;  4XL9 A;  4ZZL A;  3ZP5 A;  4HPQ A;  1TL8 A;  4KIB A;  1R71 A;  3CWR A;  4WXD A;  1D3Y A;  3F8M A;  3KCC A;  2I5U A;  2LDU A;  3IHU A;  2VAS A;  4A3C J;  3S3N A;  1QVT A;  1R22 A;  1WJF A;  2H8W A;  4IL6 C;  1YI2 I;  5GP9 A;  1R5G A;  2COB A;  4BE1 A;  3NXC A;  2REK A;  1KU3 A;  4K2E A;  4YRV A;  4A12 A;  2UUZ A;  4ZYH A;  4FAS D;  1FZP B;  2CGP A;  3HHG A;  4M3E A;  1H89 C;  4I2O A;  1FLI A;  2EV0 A;  1BIA A;  4DYR A;  4J00 A;  3CMA I;  2EFW A;  4ENM A;  1G4D A;  3AFH A;  3GO5 A;  4RM3 A;  5KAI C;  4ZC3 A;  3B6C A;  4G12 A;  4BHB A;  2BBY A;  3PUB A;  3JRB A;  4F92 B;  3AL0 C;  1TLH B;  3OYE A;  2G9W A;  4I0B A;  5BPD A;  2V6C A;  2BV6 A;  2NVY J;  2VKD A;  1HSJ A;  3I58 A;  2PN6 A;  5D5X B;  4R79 A;  4CYC A;  1NK2 P;  1ETY A;  2MH9 A;  4BXX J;  4IRH A;  2VOP A;  1JJ6 C;  4MGR A;  3QOD A;  1ZTR A;  3MAJ A;  5HBU A;  1M1E B;  4RBO A;  3WTY C;  1GV2 A;  4M9S A;  4O6J A;  4I76 A;  2R7U A;  3L2V A;  4R8H A;  2DTR A;  2ZO4 A;  2FSW A;  2WC2 A;  3KEY A;  2NVU B;  1KYZ A;  3IKT A;  1R58 A;  1BA5 A;  4C2M A;  1LE8 A;  1FOW A;  3FXM A;  4ABZ A;  1FYK A;  2P5L C;  4CCL A;  4B48 A;  1D5Y A;  1ZK8 A;  5E3L A;  3A2K A;  1EA3 A;  5LHI A;  1JGG A;  2XAH A;  1LQ1 A;  2EFP A;  3NNR A;  1BI2 A;  2ZME A;  1YIO A;  1MSE C;  2LKP A;  3G6E I;  4OOI A;  5E17 F;  3V4G A;  4D0P A;  3ULQ B;  3G4S I;  1YYV A;  3JSJ A;  2IU5 A;  2G7U A;  3V7R A;  4YEJ A;  3K2Z A;  5EYR A;  3HTH A;  4KDP A;  3W2A A;  2P6S A;  4O3M A;  2I8D A;  2FBK A;  4PGH A;  4Q4Z F;  3PNT A;  5BQT A;  4RB1 A;  2F07 A;  1UST A;  1SFK A;  1J75 A;  3VWB A;  3W6V A;  2KKO A;  4IKF A;  4M9X A;  2XRO A;  3SEQ A;  2V1X A;  2IA0 A;  1HA8 A;  4BQN A;  2VJ4 A;  2VBW A;  3V8K A;  2MFZ A;  1B1B A;  2O5R A;  4E7S A;  2VKH A;  5GAD J;  4KIT B;  2YU9 J;  1B9M A;  2JA2 A;  2ZXI A;  3DEW A;  3C07 A;  2OUM A;  3CCJ I;  2QEX I;  1Z3Y A;  3JSO A;  4EVI A;  3CO7 C;  1FOK A;  1BC7 C;  4OIN F;  3QP5 A;  3GFJ A;  1MNM C;  2VN2 A;  2DFE A;  3LAP A;  1AKH B;  1RR7 A;  1FIP A;  1Q1H A;  3S8P A;  5CQG A;  4EQQ A;  3NI7 A;  4L5J A;  1IF1 A;  3NPI A;  3CJR B;  4CO8 A;  4M6V A;  5HSZ A;  1T56 A;  3OIQ A;  3TMO A;  2G7H A;  1SFO J;  1U0J A;  4A2U A;  1TT0 A;  3IAM 2;  2ZCW A;  5KAF C;  1P7J A;  1QVU A;  2JVG A;  4P1W A;  5EDN A;  3GZI A;  2YVE A;  3NS4 A;  1W0U A;  1J0R A;  2XF6 A;  3M1E A;  2RV8 A;  5K1Y A;  2WGB A;  1R4M B;  4L18 B;  3KP2 A;  4DZP A;  2HYF A;  3R0A A;  3LAJ A;  1P4X A;  3BRU A;  1L0O C;  2MYS A;  2X6W A;  1ZKG A;  3BQY A;  4EJO A;  1TTY A;  2F5E A;  3CMY A;  3IC7 A;  3GTP J;  3H35 A;  3BTI A;  3K4J A;  3W6J B;  4BQA A;  1OCR H;  1TWH J;  3LWF A;  3PIO F;  1YE9 A;  2JTV A;  3JRC A;  3P9C A;  3TKY A;  3GTL J;  2LKS A;  4KT5 C;  4ZDL A;  2LY9 A;  4AIH A;  3IKV A;  3RTR A;  2VBZ A;  3MKL A;  5AON A;  1IC8 A;  2ZCM A;  4C3H J;  3I64 A;  3BJO A;  4Y7N J;  1FYM A;  2VT2 A;  4EMS A;  2OER A;  5FD5 A;  5M5X J;  2IPQ X;  5HNF A;  4KN4 X;  2WBM A;  4UY8 I;  3DQV C;  4XRM A;  2GAU A;  2HXO A;  1IN5 A;  2EWN A;  3C2G A;  3QU6 A;  1RUN A;  3CUO A;  2QTQ A;  4RAG A;  4C3I J;  2L54 A;  2CFX A;  4BHP A;  1DPR A;  2L9S A;  2RAS A;  4XLF A;  3ZMS A;  2HKU A;  2K4B A;  2B7E A;  5IOY A;  3CME I;  2BZT A;  2QLZ A;  5L3D A;  3PO2 J;  4PDK A;  1NG6 A;  2KQR A;  3OYM A;  1XMK A;  4HAM A;  3BR3 A;  4PSW A;  1V5F A;  1T8I A;  3KX2 A;  3HOT A;  3NAR A;  1UAA A;  1DGW Y;  2QVO A;  3TO6 A;  4AC6 A;  1HXD A;  1JGS A;  3N4M A;  3K4L A;  3CDL A;  3KFW X;  2YSR A;  4XKB A;  3Q0V A;  4P55 A;  5CKT A;  2VI6 A;  4XIC A;  3CZ6 A;  2KRF A;  3T6N A;  3J80 Z;  2QQ8 A;  1LFB A;  1K83 J;  4RLQ A;  2VIX A;  4IHX A;  2BHY A;  3VYR B;  3AAF A;  2TCT A;  3TDU C;  2PLY A;  3CC4 I;  4IZZ A;  1TWA J;  2MSY A;  5BPI A;  3CJQ B;  4AID A;  2VOD A;  2H27 A;  3MVP A;  3DP7 A;  1MSF C;  4CCJ A;  4ENK A;  3HTS B;  4RGS A;  3QYF A;  1UG0 A;  5J6X A;  1YG2 A;  3HB9 A;  1MBJ A;  4JOM A;  3LA2 A;  4BBR J;  1H0M A;  2NRA C;  2P4W A;  4OIP F;  1ULY A;  3F3X A;  4Z2Y A;  3KYC B;  4I01 A;  3G2B A;  2E2H J;  4A69 C;  1HKS A;  3GTM J;  5IP7 J;  4ESB A;  1T6S A;  5BS6 A;  2K40 A;  1W5T A;  2M4G A;  2F5C A;  3W6K B;  4HBL A;  2EZI A;  2FOK A;  4OAZ A;  1EJ9 A;  2IXS A;  2K9S A;  1X1A A;  4HX7 A;  2QSH X;  1EF4 A;  1UHW A;  2JUC A;  2OQG A;  1WJA A;  2TDX A;  2VB6 A;  3MZ8 A;  1BL0 A;  3SZT A;  3OOP A;  4CYC B;  1QHG A;  1HW5 A;  1SAU A;  3N05 A;  1XSX A;  5ICG A;  3HYI A;  2NVT J;  2MLG A;  1F4K A;  3VOK A;  3VEP A;  3FXQ A;  2HZT A;  4UUT A;  3ZQI A;  2EA4 A;  5D1R A;  4YFX F;  3CDI A;  5M3F J;  3ZOB A;  4IOC F;  4IHW A;  2O7T A;  2ADU A;  2E36 A;  3M07 A;  3RD3 A;  1ZRC A;  3R60 A;  3GYH X;  2R5Z A;  2UXP A;  2EJR A;  1WZ2 A;  1O4X A;  4MHG A;  5B3S H;  1XDU A;  2ETH A;  3D5R C;  3HIM A;  2M34 A;  2JVH A;  4G94 A;  3SEZ A;  1PYV A;  4YFN F;  2KDZ A;  4BJ5 C;  4IQ4 A;  1Y8R B;  5K7H A;  4CIC A;  1JHH A;  2V7F A;  2MLK A;  2QA4 I;  2FXA A;  2XRN A;  4EM2 A;  3H3U A;  1N77 A;  4PCQ A;  1VQ6 I;  1POG A;  1BM9 A;  1T08 B;  2LC2 A;  3IL2 A;  1ACI A;  2HOE A;  2DG7 A;  3K8P C;  2MA3 A;  1X3W B;  5IPA A;  4Z6Y A;  4LD5 A;  1VQM I;  1GHC A;  1FIA A;  2AXL A;  4M71 A;  1B6A A;  3ZQQ A;  1DUX C;  1P92 A;  2R7V A;  5F27 A;  1RIO H;  4C30 A;  2Q2E B;  5J1Y A;  1MMA A;  1I3Q J;  3QOP A;  1XCV A;  2NOJ B;  3S14 J;  3UR3 C;  4Y13 A;  2N8G A;  2VQL A;  1ZLJ A;  4PJ0 C;  1R1T A;  2JPB A;  1J9I A;  1WH7 A;  2P81 A;  3R6S A;  3O3K A;  5FRO A;  2Y48 A;  1ETK A;  2CFO A;  2DLL A;  2PJP A;  3FHZ A;  1BJZ A;  1BR4 A;  1SVL A;  2LRE A;  1HQC A;  1TWF J;  3WGG A;  1WKM A;  5JHU A;  2DBB A;  4RGR A;  4BJ6 C;  2HVQ A;  4ICH A;  3S17 J;  4DOZ A;  2LG4 A;  1KU7 A;  2Z3Y A;  2DXI A;  3PO3 J;  4IXA A;  3BCB A;  4PZJ A;  3KLO A;  2XF7 A;  2HU9 A;  4RS8 A;  4G7H F;  4PJN A;  3PUF A;  2R92 J;  3GCM A;  1XG1 A;  3E97 A;  3FZV A;  2K85 A;  2Y31 A;  2JSC A;  1G3Y A;  2R7D A;  2B0L A;  2K9N A;  4Y3O A;  4A93 J;  4G7O F;  2L02 A;  1LVK A;  1WHU A;  4XKC A;  2HYJ A;  5EGO A;  1K78 B;  3HRU A;  1T0F A;  1D0Z A;  3BP8 A;  3CF5 F;  1D1A A;  3JRI A;  1J5Y A;  2HDD A;  3VP5 A;  5HOD A;  1ZN2 A;  2PX9 A;  1YJW I;  3F8F A;  1U3E M;  1TW2 A;  3DU6 A;  3FXJ A;  3A1Y A;  3P7N A;  4M3B A;  3SDG A;  5HOO A;  1XMX A;  5IT9 Z;  5FHP A;  3DBL B;  4XLE A;  3U9G A;  4PUS A;  1NHA A;  3MMY B;  4HLY A;  1YFH A;  1ETW A;  1XGM A;  2BGC A;  1G2H A;  4PGG A;  4FQG A;  4HKU A;  3JRD A;  3RKX A;  3SFI A;  2RDP A;  3NEU A;  5CJ9 A;  2DMQ A;  3E5Q A;  2IGM A;  4KIC A;  3ZPL A;  1B72 B;  2HQA A;  4BL0 B;  1RKW A;  3MCZ A;  3HGG A;  4S0H B;  1TWC J;  2HQ5 A;  2VE8 A;  2DFF A;  5DUI A;  2ZXJ A;  2OA4 A;  5ICC A;  5E79 C;  4ETS A;  5LBQ A;  4JYK A;  3EYI A;  3ZQF A;  4M73 A;  3HKZ N;  3KE2 A;  2W1O A;  3CCE I;  1KQ0 A;  4II3 A;  1WPK A;  3QBM A;  5IP9 J;  2CV2 A;  5E3O A;  1OYI A;  4H0E A;  3FBN B;  4Y15 A;  4JX6 A;  2D6Y A;  5B1B H;  1R1V A;  2JQ7 A;  2QZ8 A;  3G1L A;  3H36 A;  1WJC A;  3Q5F A;  3G3Z A;  1VQ4 I;  5LHH A;  4YG2 F;  2K27 A;  4A3E J;  3BG5 A;  3HRM A;  2LD5 A;  2RKH A;  3OS1 A;  2FQ3 A;  3WU1 B;  3ZQC A;  2XGE A;  3BG3 A;  2L0K A;  3L2Q A;  3S1R J;  1FBS A;  2RGV A;  4RMN A;  2K7L A;  4M6Y A;  3RDI A;  3Q9V A;  2JPC A;  3ZN0 A;  4F52 A;  2K9L A;  1Z91 A;  2ZOY A;  3DTE A;  2VQC A;  4PJL A;  1WH5 A;  4EJT A;  5IYC J;  3QKX A;  4DIQ A;  1ZGJ A;  3ZQL A;  1SFU A;  3ROU A;  4XK4 A;  5C3E J;  2YR2 A;  3CF2 A;  3OYF A;  2DK5 A;  2EPF A;  4KIF A;  2E60 A;  1WGX A;  4XRS A;  3QOE A;  3OR2 C;  1ON2 A;  2M3A A;  1X2N A;  3CLQ A;  1XMA A;  1RI7 A;  3HIF A;  1R5I D;  4QWQ A;  2ESN A;  3F23 A;  3VSK A;  3HRT A;  2VJI A;  4JQF A;  2EIK H;  5J8C A;  4FT8 A;  2DDA A;  2F5V A;  3BG6 A;  3CCY A;  4HQE A;  3CJT B;  3RPQ A;  1PP8 F;  2D45 A;  2UZK A;  3TP0 A;  1GVD A;  2R7W A;  4LIV A;  4BJT A;  2Z9O A;  3O2P E;  1YX3 A;  1AHD P;  3L2U A;  3S93 A;  1D5V A;  1X3Z B;  1E3O C;  4IVN A;  4PJM A;  2FF4 A;  1HW2 A;  4U0Y A;  1T2K A;  1ITY A;  4E7L A;  4M3G A;  5B5E C;  1UMQ A;  5C4X J;  1WWX A;  3F0C A;  3WE2 A;  4ESF A;  1IO2 A;  4V2F A;  3J81 K;  1K6Y A;  3K70 D;  2RQP A;  2VQH A;  3OYG A;  3DV8 A;  1UHS A;  1WJ5 A;  3A02 A;  1WI9 A;  4QSH A;  2ID6 A;  5LGU A;  1Z9C A;  1CGP A;  1P6R A;  2WB1 N;  3T8R A;  2J5O A;  5FLX K;  1ZEL A;  5EFY A;  3UKG A;  1IV8 A;  4F7Z A;  3CJN A;  2WUI A;  4YIF A;  1OIS A;  3HM5 A;  2QKM B;  3GTJ J;  2VON A;  3H9Q A;  1HF0 A;  2JRT A;  5F04 A;  2BEO A;  2R7F A;  4LOC A;  1H8A C;  3OOU A;  4KN7 X;  2X6Y A;  1TP4 A;  4DBR A;  4ESJ A;  1IN4 A;  4B44 A;  3ZMT A;  4WXC A;  1UHM A;  2OBP A;  3GFL A;  2WA0 A;  2PG4 A;  3RCO A;  4YFK F;  4GO1 A;  1JKR C;  3CLO A;  1HC8 A;  3MKY B;  4CHU A;  1CF7 B;  4NHJ A;  1N78 A;  1UFM A;  3L7W A;  1F36 A;  3FF5 A;  4UUS A;  2NP5 A;  3FHN A;  5DD8 A;  1LFU P;  1MMN A;  2DFH A;  5F0F A;  2ME0 A;  4EJW A;  5E3M A;  4RB2 C;  1YIT I;  1BBY A;  1VZ0 A;  2F6C A;  1U8R A;  4BS9 A;  2EV5 A;  4KIG A;  1RR8 C;  2WY7 Q;  3BPV A;  2Y9Y A;  4BY7 J;  4LMY A;  4UUS B;  3ERE D;  2F5D A;  2CQ7 A;  3HTA A;  1YS6 A;  2HOS A;  2IGN A;  1A6Q A;  2DCE A;  3I0T A;  1RRJ A;  1ZYR F;  3F8C A;  3ISP A;  3LSK A;  3RJP A;  1OLT A;  3MZH A;  2A05 A;  4NDL A;  1B8I A;  2IT0 A;  2D1V A;  2HVR A;  3CUQ C;  4II2 A;  2ZXW H;  3IAS 2;  1QPM A;  4DZJ A;  1Y0U A;  1S8N A;  5GTI C;  3KP6 A;  4EEF G;  2Y69 H;  4HOB A;  1APL C;  1TQM A;  2XC7 A;  1I5Z A;  2KT0 A;  4LIT A;  3TOA A;  3HOU J;  3BJB A;  4IO9 F;  2LK2 A;  5GAG J;  3OR1 C;  1BI3 A;  2BXZ A;  5E3N A;  3L1P A;  2AXT C;  1STZ A;  2QGU A;  3F6V A;  3HHH A;  3BNI A;  2W24 A;  1MNE A;  4HX4 A;  3GTK J;  4U9N A;  4WCG A;  3GZN B;  4DBQ A;  1QGP A;  3IV5 A;  3SWH A;  2DA3 A;  4BXU A;  4D9J A;  2OAZ A;  2Y30 A;  3NWS A;  3HGY A;  3B81 A;  3TED A;  3CMM A;  4WK8 F;  1GUU A;  2CSO A;  4ZZD A;  1FC3 A;  2BW3 A;  5J47 A;  2IS6 A;  3VW1 A;  5EEH A;  4L0Z B;  4FE7 A;  1E17 A;  1LDJ A;  4MTE A;  1XB4 A;  4FTH A;  2W57 A;  1F1Z A;  2L4M A;  2R7Q A;  2G7S A;  5AIQ A;  2PMH A;  2QF7 A;  2Z2S B;  1YW9 A;  4HYE A;  3KNW A;  3V8L A;  2X51 A;  3OS2 A;  1PDN C;  2XPV A;  2X85 A;  1MJA A;  1OMI A;  1A31 A;  3IRR A;  2OZ6 A;  3FMQ A;  3TDZ C;  5D4S A;  2H6B A;  4HF1 A;  2ZBK A;  2E1M C;  1MKM A;  3ON2 A;  3HKZ A;  2OF7 A;  1UG2 A;  2PJR A;  1W7P D;  1T0F C;  2DYR H;  2Q24 A;  1MBE A;  2LY2 A;  2R93 J;  3S1Q J;  1WRJ A;  2PFB A;  3IWF A;  2KIS A;  3RQI A;  4G9Y A;  4ANJ A;  1JXS A;  4UXN A;  4AF5 A;  2L3D A;  1IDY A;  5TGT A;  2GA1 A;  1R5H A;  3LJL A;  2RAE A;  2DN0 A;  1U9O A;  4OD4 A;  1FJL A;  4FIS A;  3DPT A;  2FX0 A;  4JBA A;  2R0Q C;  2GXG A;  5J3L A;  1WI3 A;  2B1E A;  1LDK B;  2YPR A;  5EZH A;  3O8G A;  4LG0 A;  1O3Q A;  1IW7 F;  2O6G E;  2NP3 A;  3H9G A;  2XGD A;  1AU7 A;  3P5J A;  2FU4 A;  2ACJ A;  1FP2 A;  1GXP A;  2V26 A;  5F0H A;  4IQJ A;  3A01 A;  4E7H A;  3UNG C;  3ZGK A;  4RAZ A;  3E6B A;  5K5R A;  1A35 A;  2A3S A;  3HUG B;  4PFP A;  4UVB A;  2WAF A;  5L3E A;  2BY3 A;  5A2Q K;  2KIQ A;  1WCM J;  1Z77 A;  2ID3 A;  3HTJ A;  4CCK A;  3LSG A;  2DDB A;  2LBF A;  1XTA A;  1ZH5 A;  4AVP A;  1PUF B;  2VXD A;  4IPA A;  3FXL A;  3SXY A;  4C9Y A;  4WIB A;  3CCM I;  4KT6 A;  4ME9 A;  1WJE A;  2DOA A;  3CCV I;  1OPC A;  4BKX A;  5EF6 A;  4L9J A;  1R1U A;  1OYW A;  3LFK A;  1TQI A;  3MFK A;  3HSR A;  1GLN A;  1D0X A;  4XM3 A;  2ZCN A;  1R7J A;  1QNT A;  2DA2 A;  2LVS A;  5CVU A;  4A6E A;  2M0M A;  4KFC A;  1I1G A;  5JLX A;  3DF8 A;  2CQQ A;  1W5C C;  1SEU A;  1XN7 A;  2V79 A;  3WTV C;  2A5Y B;  2L9R A;  4I99 C;  2LKX A;  2EK5 A;  2OTL I;  1Y8Q B;  3FMS A;  2BW3 B;  1NH3 A;  2HNH A;  5L3G A;  4F93 B;  1YTY A;  2R7O A;  1YJN I;  3QYB A;  3MNL A;  3DXJ F;  2GIZ A;  4XOP A;  2KRC A;  3H3Z A;  2HEO A;  4MEX F;  2XPU A;  1K6O A;  4E7K A;  5K5Q A;  1T95 A;  2FRH A;  2XB5 A;  4W1U A;  2WV0 A;  1S72 I;  2WV1 A;  4I0A A;  5H9T A;  3C3W A;  2R7S A;  1JT0 A;  3CUQ B;  2K9M A;  4IF4 A;  4OD5 A;  2ZFU A;  4WF2 A;  1F9N A;  4N4O B;  5FLX Z;  1U5T C;  4G8X A;  3SQN A;  2FUG 2;  2AS5 F;  1G8X A;  2ZNY A;  5BNG A;  2DJI A;  3W3C A;  2E19 A;  3OIP A;  4LB5 A;  3HRS A;  2IP2 A;  4G6Q A;  4XKW A;  2E71 A;  2NNY A;  2STW A;  2OCC H;  4U9L A;  2M8E A;  1WSU A;  1QBJ A;  1L3L A;  1NK3 P;  2VBY A;  1W7P B;  3BY6 A;  1P4W A;  3O8H A;  4CCN A;  4F55 A;  3LWJ A;  1BN5 A;  5C4Y A;  1HDP A;  2NYX A;  3FXO A;  1VF9 A;  2BE5 F;  4WWC A;  3BJA A;  4FX0 A;  3K9T A;  1HLV A;  4G7Z F;  2EFQ A;  5CQE A;  5FJ8 J;  4EGY A;  3HOW J;  3E6C C;  4GGG A;  2NXN B;  4CYD A;  3VYS B;  5JR3 A;  1CF7 A;  2E5Z A;  5LGT A;  5ED4 A;  1JT6 A;  1OCP A;  3ZMZ A;  1JE8 A;  4Q5S F;  2EIL H;  4ACI A;  4UNO A;  2XVC A;  2WTE A;  5M3M J;  3HSF A;  5L3F A;  2KMU A;  5FKN A;  3H0D A;  1KQ9 A;  2KIM A;  5CLS A;  3FRQ A;  1R36 A;  3S3O A;  2JA7 J;  2Z99 A;  2FQ4 A;  1OCT C;  1YS7 A;  3VUQ A;  1IUY A;  2YX4 A;  4GYI A;  2DQR A;  3KKD A;  5IYB J;  3RI4 A;  4G6D A;  3QYE A;  4NQW A;  3OYJ A;  4AD9 A;  2F2E A;  4A3D J;  3VW0 A;  3BLY A;  4D7M A;  2ZKZ A;  3PFI A;  2HI3 A;  5FB2 A;  1IV6 A;  1OR7 C;  4DGW B;  4J01 A;  2BXY A;  3MN2 A;  1GXQ A;  2IRF G;  2G7G A;  2DMU A;  4JX5 A;  2Z1D A;  3ASO H;  3TOB A;  2ESH A;  2HOA A;  1BC8 C;  3T1B A;  2ME6 A;  1BW5 A;  1AA7 A;  3MKZ A;  4LK1 F;  5CVR A;  3HTI A;  4Q48 A;  2JZY A;  4DVY P;  1V3F A;  1Y1W J;  4I09 A;  5JI6 A;  4MTD A;  1EH7 A;  4KNY A;  3G1M A;  4D5C A;  3MEX A;  1MBH A;  3L09 A;  5FO5 A;  1TWG J;  1LB2 A;  5GAE J;  1X4O A;  3H0G J;  3BRO A;  3A0H C;  3MZY A;  2LFB A;  4Y4R A;  4E4H A;  2LBF B;  3VVY A;  1EKE A;  4GXO A;  3I55 I;  4EGZ A;  1UI5 A;  2YUS A;  5H6R A;  4C2M J;  2M30 A;  1HKT A;  1XC5 A;  2PMZ A;  5ILU A;  1NTC A;  4QPO A;  2CG4 A;  2JMW A;  2V9P A;  3BTJ A;  2CQN A;  3TL4 X;  2LY1 A;  3DLL F;  4Y17 A;  2K9Q A;  1QO0 D;  4XLA A;  1Z1D A;  2FBI A;  4ITV A;  1MBG A;  1LPQ A;  2X0L A;  2MD5 A;  1T98 A;  3DTK A;  2DA1 A;  3RYR A;  4KMF A;  4LLL A;  4LLG F;  4HW0 A;  1V4R A;  1N75 A;  2WAQ N;  2UXU A;  4IRV A;  5DDG A;  2K3F A;  3JRE A;  1K78 A;  2AHQ A;  3HBL A;  4LK0 F;  4AYB N;  1TBX A;  5EEG A;  1XSV A;  4PFO A;  3ZQ7 A;  2P6T A;  5CXI A;  2GIV A;  2GM4 A;  1FTT A;  2V9V A;  3JW4 A;  5JLW A;  1T38 A;  3K6G A;  3KPH A;  3FM5 A;  5C4J J;  3ELK A;  1XD7 A;  4LG3 A;  2KZG A;  2RN7 A;  4JP0 A;  1SD7 A;  1X1P A;  2JA5 J;  2JA6 J;  2RHA A;  2WY8 Q;  5FRM A;  4FX4 A;  1XGN A;  4A3M J;  4OWR B;  4ENJ A;  3BZC A;  3DWL E;  3FIW A;  3M7G A;  3GVA A;  2PJR B;  3ANG A;  2V1N A;  3CCR I;  5HS9 A;  4CDG A;  3J7Z I;  1VFC A;  1FEX A;  1T39 A;  2DOD A;  1U6G A;  2OTJ I;  1ZG5 A;  1HBX G;  4RGU A;  2YVH A;  5ILS A;  2VPR A;  3RKY A;  5JHF A;  3GEZ A;  3LSJ A;  3HPG A;  5FMP A;  3F9K A;  3VPR A;  3VIB A;  2BHZ A;  3GFM A;  1VTN C;  4NC6 A;  2V6E A;  1XS9 A;  1I39 A;  1I6X A;  5HLI A;  3C2H A;  3ZMU A;  3CCL I;  4M3D A;  5D5U B;  2K86 A;  1FSH A;  2P8T A;  1IN8 A;  5LFA A;  2IS1 A;  3S5R A;  3GBG A;  1MND A;  3PM1 A;  3S1M J;  1DQU A;  1GVJ A;  4U87 A;  2NVQ J;  2VXZ A;  1FPQ A;  3PFY A;  3BR5 A;  1J09 A;  2HQR A;  2J5P A;  4E7J A;  3C2B A;  3TW6 A;  1PJR A;  3BPX A;  3TBI A;  2FNA A;  4J19 A;  4NC7 A;  2M8G X;  2M0C A;  3MD2 A;  4RAF A;  4I02 A;  1EH8 A;  2F4I A;  3G7R A;  2ECB A;  4HV5 A;  3KYL A;  2B9S A;  3ANP A;  1A6I A;  1RPW A;  5GPC A;  5H20 A;  3AL0 B;  3ML6 A;  5CVI A;  1PP7 U;  1R23 A;  4XQF A;  3KZI C;  3OYL A;  4GCT A;  5EGO B;  1K61 A;  5HDN A;  3KZ9 A;  1D1C A;  5IYD J;  1BI1 A;  5DCM A;  1X58 A;  4KWA A;  1P7I A;  1S7E A;  1U9N A;  1IDZ A;  2KP6 A;  3V7C A;  3HE0 A;  3I53 A;  2CJJ A;  2HR3 A;  3ECO A;  4BU2 A;  2Y75 A;  3D1N I;  5HLT A;  3DCF A;  2PZ9 A;  4KJZ A;  1ETV A;  2BVM A;  1XSD A;  1FYL A;  2QBY A;  2DI3 A;  2LP0 A;  4ZDO A;  3OYN A;  2VKE A;  4XR6 A;  1U8B A;  1JTY A;  2F48 A;  5JVG F;  2M4K A;  2XKP A;  2A6E F;  4ZYG A;  3T8T A;  3CCS I;  3VOX A;  2IW5 A;  3AG4 H;  1VQ8 I;  2UWM A;  3J81 Z;  2A6T A;  1LDD A;  2GOM A;  3RKQ A;  4FET A;  3GW2 A;  3VB2 A;  4FE4 A;  3P9K A;  3TO7 A;  3HZJ A;  3C18 A;  4A5N A;  3RZD J;  2K02 A;  3HEF A;  2Z33 A;  1BI0 A;  4H4K C;  4U88 A;  3F22 A;  2UXO A;  1JI8 A;  5DM6 F;  3OSG A;  2VOO A;  3NWT A;  3J7A O;  2IA1 A;  2DO7 A;  4BY1 J;  2FMY A;  3L2C A;  1FBU A;  3E3V A;  2QOP A;  1TNS A;  4L9T A;  1QZZ A;  1UJ8 A;  2LYC A;  4MFE A;  3B73 A;  3H3V K;  2F4M B;  1DPU A;  3P9T A;  3BG9 A;  4XBF A;  1E0E A;  1YJ9 I;  4RB0 A;  4B3X A;  5D4R A;  4A5M A;  3WGH A;  3I3L A;  4A6D A;  2M1B A;  3OIO A;  2GOX B;  2X6X A;  2AQF A;  1NG7 A;  2XAU A;  5CVV A;  5K7Z A;  1JKQ C;  2O8X A;  4L62 A;  2HOT A;  3EUP A;  2FJ1 A;  1MJ9 A;  3CTA A;  3PSI A;  1OQY A;  1QZE A;  1ZLK A;  4B47 A;  2OC6 A;  1YOV B;  3CP8 A;  3M4O J;  3RIR A;  5L3B A;  5E8I A;  3WU2 C;  1YHQ I;  3M9A A;  2XDN A;  2UXH A;  3S1N J;  1F43 A;  2F5F A;  2Q1Z B;  1XDS A;  1MIJ A;  4IRG A;  4BAY A;  5GTH C;  2W53 A;  1J2X A;  3QP6 A;  2Y0M A;  4ENN A;  1Z7L A;  2JT1 A;  1IAW A;  3JRF A;  1TNT A;  2E1N A;  3S2W A;  4DYC A;  1X19 A;  4N9I A;  2L9N A;  2ZC2 A;  3GWZ A;  4HV6 A;  2FD5 A;  2M9H A;  2E1C A;  2WAQ A;  5KCM A;  2R5Y B;  5D6F A;  3JR9 A;  1RET A;  3A03 A;  3G73 A;  2VC0 A;  1MZB A;  1FMV A;  2DT7 B;  2PI0 A;  4MXM A;  2M7B A;  1UB9 A;  1PUF A;  1P4A A;  2FBH A;  3S16 J;  1UCR A;  1LEA A;  4A3B J;  2NAZ A;  1R9T J;  3NRV A;  2X1E A;  3H5A A;  4XON A;  2V1D A;  1X1B A;  3OYK A;  2GUH A;  2XIG A;  1HW1 A;  3EUH C;  2IS4 A;  4M3F A;  3PSF A;  2DU9 A;  4GFL A;  3A0B C;  4AVZ A;  5KK1 A;  2TRT A;  3BTL A;  3K10 A;  3H92 A;  2O7O A;  3DKY A;  2IEK A;  1LEB A;  4XLC A;  3X2Q H;  1X4P A;  2O61 A;  4I98 B;  3PAS A;  4A3I J;  2L7K A;  3DEE A;  2OU2 A;  1IUF A;  3K2A A;  1RUO A;  2ZXH A;  2P7C B;  4XRS G;  2X1C A;  5FKO A;  2RRE A;  3FXK A;  1I3A A;  2FEZ A;  2JK3 A;  5D6E A;  2IBD A;  1FOY A;  5EZG A;  5ILV A;  1FMW A;  2LRD A;  1W4M A;  2CV0 A;  3BTC A;  1BJA A;  1O57 A;  1LFP A;  1UI6 A;  3KP4 A;  2HDC A;  2KPM A;  4U0W A;  4E7I A;  4BEH B;  1VQL I;  3JRH A;  3I71 A;  4BE0 A;  3BR6 A;  2HYT A;  4IJA A;  1R4N B;  2NS0 A;  2LOO A;  2Y9Z A;  3RPU A;  2H94 A;  5JFR A;  5DM7 F;  1MJB A;  2KFD A;  4D1Q A;  4OMY A;  4IHY A;  2DG8 A;  4MQ9 F;  2X4H A;  3RQ4 A;  5BMZ A;  1USS A;  1HST A;  1R00 A;  4P5O A;  3H1C A;  1ZQ3 P;  2D2W A;  5HDG A;  3S32 A;  1MMG A;  3GZ5 A;  3FMR A;  4MFD A;  4C3J J;  3JCU C;  3U21 A;  3ZCO A;  3QRF F;  2EFN A;  2FBQ A;  3K4C A;  4NUB A;  3VFZ A;  4CZZ A;  1X1C A;  2M87 A;  5JVT A;  2Y0S A;  4WXH A;  5FKL A;  2HFH A;  4E70 A;  3FXR A;  1YO5 C;  2EA2 A;  2EIN H;  3D5L A;  2BY1 A;  4HLX A;  2W00 A;  2JSP A;  5D8K B;  3T5X A;  1H9T A;  2V1U A;  3DKW A;  3R0J A;  2CQX A;  1MMS A;  3WTU C;  3WTW C;  4Y52 J;  4NEL A;  4RGX A;  4HNU A;  2MG4 A;  1TZL A;  1RC9 A;  4EV0 A;  2A68 F;  4UDS A;  3JTH A;  4B8X A;  2IA2 A;  2XHK A;  2DA4 A;  3BR2 A;  2ZY9 A;  1HCR A;  2GFN A;  2ZJR F;  1ZRE A;  5ICF A;  4ZTF A;  3V7S A;  4QIW N;  1LE8 B;  1RKT A;  3M8J A;  2Q0O A;  3E0J B;  3HOV J;  3I9V 2;  2Z16 A;  3EYY A;  1SMT A;  2HVS A;  2XSJ C;  1QHH D;  4ZYE A;  3DPJ A;  5HVQ C;  1J7K A;  2XB0 X;  3PNV A;  3BG7 A;  3TQN A;  2R4G A;  4F3Q A;  3H9J A;  2QKO A;  2VQG A;  5D5W B;  4B3A A;  4UV8 A;  1KA8 A;  3QAH A;  3DFG A;  3P9I A;  3TGN A;  1V5E A;  3FWE A;  1WVR A;  1W36 C;  2R7T A;  2E34 A;  3WU0 A;  5KHD A;  3F6O A;  5E20 A;  1IGN A;  2VT3 A;  2L2O A;  3SZG A;  1AKH A;  3N97 A;  2CQK A;  1JKO C;  3SHF A;  3DBR B;  2GXA A;  3IH4 A;  1VQK I;  2MD0 A;  3CD6 I;  2ZCX A;  3K69 A;  4KA4 A;  2CV1 A;  1V54 H;  1S5L C;  3S2H J;  2JUG A;  3VVZ A;  1SC7 A;  2DJN A;  3LQR A;  1QA6 A;  3WOD F;  1OCZ H;  1Z7U A;  3JRA A;  3ESW B;  4FHT A;  2DPU A;  1WQ2 A;  1WFX A;  3K4K A;  3V8J A;  1JTX A;  4AM3 A;  3ERM A;  2DQL A;  2FA5 A;  2ELK A;  3ZMD A;  4NB5 A;  2XAJ A;  2BY0 A;  2MAB A;  4BUP A;  5HNH A;  3HL2 A;  2B63 J;  1EH6 A;  3GX4 X;  3G56 A;  1Y6I A;  4GYG A;  3LA7 A;  3L2W A;  2OCE A;  2KLO A;  1Z05 A;  1Y39 A;  2R7R A;  5DCF A;  1FTZ A;  2WAD A;  2IVM A;  4A3F J;  3O6B B;  1D0Y A;  2CUE A;  2IGK A;  5C44 J;  1QRY A;  2YS9 A;  3VDX A;  4DW6 A;  1ON1 A;  2ZME B;  1VQ9 I;  5DAJ A;  3OV8 A;  1O7F A;  4U7B A;  2M45 A;  2IJL A;  3FK6 A;  3CES A;  2HXI A;  3I59 A;  2DA5 A;  1E3P A;  2KJB A;  1MDM A;  5LRR A;  1D8K A;  4UB6 C;  4BH9 A;  4IHV A;  1JHF A;  3ONQ A;  1S29 A;  1ZAR A;  4BNC A;  1VQO I;  4CGR A;  1JUS A;  3LSM A;  2QWW A;  4HF2 A;  3F8B A;  2VL8 A;  4KUM A;  3LSR A;  2EQR A;  2QYO A;  3GTQ J;  5AQC A;  1S9H A;  4XOT A;  1YLF A;  5IT3 A;  1IRF A;  2K4J A;  5E1Z B;  1TW3 A;  5A2Q Z;  4M72 A;  4I6Z A;  2QQB A;  4HNT A;  3CRJ A;  2O0Y A;  1IXR C;  3HOS A;  2E7W A;  2HGC A;  1ZAO A;  3OY9 A;  1K7A A;  3I4P A;  3LQQ A;  5FFX A;  1V5G A;  2Y2Z A;  3CC2 I;  2W4S A;  3FBI B;  2GA2 A;  3DKX A;  3E1S A;  3WG9 A;  3VOD A;  3I56 I;  3VVX A;  4AU7 A;  2DMT A;  3MQ0 A;  4D5F A;  2ZNZ A;  4QTR A;  5D5V B;  4GRI A;  2LF7 A;  1DU6 A;  4QLC U;  5CW8 A;  2XF5 A;  4BHC A;  4E7Z A;  3LMM A;  2CW0 F;  1G59 A;  3LSI A;  2CUF A;  4AYB A;  2ZJ2 A;  2CO5 A;  3M3Y J;  3Q9S A;  3HJE A;  4AUX A;  2DOE A;  3FKJ A;  1U5T B;  1ERD A;  4KMU X;  3OSF A;  1BOB A;  2HWV A;  1GDT A;  4HZF A;  1KU9 A;  4V2G A;  1VQ5 I;  2IS2 A;  1FP1 D;  1TT5 B;  5DS9 A;  2HKX A;  3ON4 A;  5TJJ A;  1SD5 A;  1X3U A;  1SFX A;  1ZR2 A;  2BVL A;  3HG9 A;  3L2R A;  3ZQH A;  1QU3 A;  1VI0 A;  3I5U A;  3ZQG A;  3KEO A;  4JX4 A;  3EET A;  3I4M J;  2XGC A;  3IH2 A;  2W84 A;  2EB7 A;  2AQE A;  4LIU A;  3ZRG A;  4OIR F;  3KET A;  2KZV A;  5EG0 A;  1F5T A;  1N25 A;  1SD6 A;  2QKL B;  2OD5 A;  3WTT C;  3OYC A;  2H8R A;  4XLH A;  4GFK A;  3V6G A;  1KYW A;  4AC0 A;  5LD2 C;  1RZ4 A;  2O9L A;  2I10 A;  2KIF A;  1ORK A;  2RC4 A;  5TRD A;  1ZR4 A;  2FJI 1;  2QWT A;  2L01 A;  4ON0 A;  3PQJ A;  4HG2 A;  9ANT A;  3DLA A;  4RM2 A;  1W0T A;  4A3L J;  3KIO A;  5FFZ A;  3DPU A;  4DJA A;  2E7X A;  4UV9 A;  3WE3 A;  2XSD C;  2R5Y A;  2LNB A;  5J8F A;  1Z6T A;  1D1B A;  3OL3 A;  5FRN A;  5K58 A;  1ENH A;  5LEK A;  5CYV A;  4LB6 B;  5EG0 B;  2LF8 A;  1JJ8 C;  1FOX A;  2W7N A;  2BYV E;  2FE3 A;  4OIQ F;  3OWT A;  1JKP C;  3HOZ J;  1S3J A;  1I1S A;  5AIP A;  1Z21 A;  5DCM B;  1S7O A;  3OMY A;  1IRZ A;  2EIJ H;  1UZC A;  4RDU A;  2VC1 A;  2DMP A;  5FKM A;  2YVX A;  1FSE A;  4BBS J;  1XGO A;  1K4T A;  1K4S A;  1YRN B;  2UXX A;  2M7A A;  3U2R A;  1DP7 P;  3QPS A;  4GCV A;  3LFU A;  2P0W A;  2UV1 A;  3KLN A;  3L9F A;  3PNY A;  3FXU A;  1W1W E;  4F91 B;  1G3S A;  1ONV A;  3J80 K;  4NN1 A;  4YEL A;  3B02 A;  4IRI A;  2A6H F;  4LGW A;  1U5T A;  4HRI A;  2HKO A;  1HKQ A;  3JAM K;  3OYH A;  2V57 A;  4B4C A;  4FCY A;  3LSH A;  2A69 F;  2OJE D;  3GF2 A;  3K4B A;  1MD0 A;  1Z6R A;  2ELH A;  3G1O A;  2BY2 A;  5LHG A;  2V4J C;  2M5W A;  4X1E A;  5FLM J;  1DDN A;  2AO9 A;  3GTO J;  1TC3 C;  3Q3S A;  4OAY A;  2HS5 A;  1U2W A;  2B3W A;  4GCK A;  1DU0 A;  3RZO J;  2D1H A;  4UVC A;  1BW6 A;  2EH3 A;  5FD6 A;  2K3P A;  2DAO A;  5GPA A;  2QQ9 A;  1YIJ I;  1XCB A;  2L7Z A;  2W48 A;  3PIP F;  3EDP A;  5KVR A;  3RSN A;  2HDW A;  2PBI A;  4RA2 A;  3SYT A;  1VQ7 I;  2G7L A;  1W7P A;  3BC8 A;  2QSG X;  2COM A;  1MBF A;  3K1P A;  2VE9 A;  2MBF A;  3GLL A;  2F4O B;  4YIR X;  3AKZ A;  2OZU A;  1XX5 A;  2CW8 A;  3GEU A;  3O60 A;  1O3T A;  2IAI A;  2DOF A;  2GWR A;  2L5Q A;  4R1H A;  1VND A;  2EZL A;  5EEA A;  1RNL A;  4I7H A;  3CCU I;  2PFV A;  3ECH A;  5D18 A;  3OYI A;  1BR1 A;  3D5S C;  3S15 J;  4CXF A;  2ZJP F;  1FWZ A;  1LKX A;  1E2X A;  5F64 A;  2KJC A;  2RNG A;  5E8G A;  2UXI A;  4UUV A;  2VKV A;  2V9K A;  4HX8 A;  3DU5 A;  5HS7 A;  3J7A Y;  4LFU A;  1Y1V J;  2HQN A;  5M5W J;  4TV7 A;  1YRN A;  2IGO A;  1A5J A;  4NC8 A;  5BOX A;  3LA3 A;  3HOY J;  2WWY A;  5DUK A;  5LGN A;  1CQT A;  2HYG D;  2JWT A;  1H9G A;  3K4M A;  3V42 A;  1IZ1 A;  1JUM A;  4XLP F;  5F08 A;  4HSR A;  3SZP A;  1GV5 A;  2JA8 J;  1LNW A;  1Y0N A;  1YW8 A;  4M6X A;  2KL4 A;  3DBH B;  4HQM A;  3FK7 A;  2HTJ A;  3WGI A;  1P9Q C;  2CH0 A;  3C1D A;  2DPD A;  4AIJ A;  1YQA A;  2ECC A;  2VPL A;  1Z3X A;  2ISZ A;  3AQS A;  2GQQ A;  5DTD A;  2XKO A;  5LEJ A;  5CPR B;  3GLX A;  4OU0 A;  2LLK A;  2PMZ N;  3R4K A;  5LLQ A;  2GLO A;  3AQT A;  5DEQ A;  3VTI A;  2JJ7 A; 
#chains in the Genus database with same CATH homology
 4BY7 J;  2Y9Y A;  4UUS B;  5K7Z A;  1JKQ C;  4L5E A;  1QPI A;  2F07 A;  4L62 A;  2HOT A;  3EUP A;  2FJ1 A;  3HTA A;  4XID A;  2HOS A;  1OJL A;  3SJM A;  3W6V A;  3M4O J;  2XDN A;  2UXH A;  3S1N J;  1F43 A;  4NDL A;  2W53 A;  1B8I A;  2LTP A;  3B6A A;  5IOZ A;  3JRF A;  3A01 B;  4DYC A;  2OPT A;  4DZJ A;  2YU9 J;  3DEW A;  4MIM A;  3C07 A;  1IJW C;  2FD5 A;  2M9H A;  4EEF G;  2R5Y B;  1APL C;  3JR9 A;  1RET A;  3A03 A;  2KT0 A;  5D19 A;  1MNM C;  4GCL A;  3HOU J;  3BJB A;  3F1B A;  1AKH B;  1RR7 A;  3S2D J;  2LK2 A;  1FIP A;  4MXM A;  5E3N A;  1PUF A;  3NI7 A;  3L1P A;  2NVX J;  3JRG A;  3NPI A;  3S16 J;  3BNI A;  4A3B J;  4M6V A;  3GTK J;  1T56 A;  5HSZ A;  3K7A J;  1R9T J;  3IV5 A;  1SFO J;  2DA3 A;  3B81 A;  2Y30 A;  3HGY A;  5FKK A;  3TED A;  1P7J A;  1QVU A;  2GUH A;  1GUU A;  5EDN A;  2YVE A;  3GZI A;  1W0U A;  3VW1 A;  2WGB A;  4M3F A;  4FE7 A;  4GFL A;  4DZP A;  2TRT A;  3BTL A;  3LSP A;  2O7O A;  3BRU A;  4FTH A;  2IEK A;  5FLV A;  2GEN A;  1ZKG A;  3BQY A;  3CMY A;  2G7S A;  2QF7 A;  3E7Q A;  3PAS A;  3GTP J;  3KNW A;  3IUV A;  4A3I J;  3BHQ A;  3BTI A;  2E2J J;  2XPV A;  3BQZ A;  1IUF A;  3K2A A;  3NAU A;  4X6A J;  1TWH J;  4XRS G;  3JRC A;  5FKO A;  1ETO A;  3CQZ J;  3GTL J;  2JK3 A;  3ON2 A;  2OF7 A;  1UG2 A;  5IP6 A;  3V78 A;  2LY9 A;  2Q24 A;  2IBD A;  4A3G J;  5EZG A;  3MKL A;  1MBE A;  2ZCM A;  1IC8 A;  4C3H J;  2R93 J;  3S1Q J;  3BTC A;  3FKI J;  1UI6 A;  3RQI A;  4Y7N J;  4AF5 A;  1IDY A;  2OER A;  1IG7 A;  3JRH A;  4PXI A;  5M5X J;  1U78 A;  3LJL A;  2XPW A;  3BR6 A;  2RAE A;  4XRM A;  2HYT A;  2DA7 A;  1MBK A;  2HXO A;  2DN0 A;  1U9O A;  2Y9Z A;  1FJL A;  4FIS A;  2QTQ A;  2O8K A;  4C3I J;  2RAS A;  2FX0 A;  4IHY A;  2R0Q C;  2HKU A;  2DG8 A;  5J3L A;  1WI3 A;  1MH3 A;  5EZH A;  3O8G A;  5IOY A;  2NP3 A;  3PO2 J;  1AU7 A;  2XGD A;  1ZQ3 P;  3BR3 A;  4MFD A;  4C3J J;  2CRG A;  5F0H A;  3NAR A;  3A01 A;  4AC6 A;  4MLO A;  2FBQ A;  2E1O A;  1SAN A;  5FKL A;  3CDL A;  4MO7 A;  3Q0V A;  4XIC A;  2VI6 A;  1WCM J;  1Z77 A;  2ID3 A;  3T6N A;  3HTJ A;  3LSG A;  2CQX A;  1LFB A;  1K83 J;  2MW8 A;  1PUF B;  3HDD A;  2ZOZ A;  4Y52 J;  4NEL A;  4IHX A;  3TW7 A;  2MG4 A;  5M5Y J;  2TCT A;  5FGL A;  4UDS A;  4ME9 A;  1TWA J;  4BKX A;  2MSY A;  5EF6 A;  3NRG A;  2GBY A;  2DA4 A;  3BR2 A;  3MVP A;  1MSF C;  1HCR A;  5J1U A;  2GFN A;  2ZCN A;  2LVS A;  2MGQ A;  2DA2 A;  3HB9 A;  1MBJ A;  4BBR J;  2OI8 A;  3Q0W A;  5JLX A;  4QIW N;  2CQQ A;  1LE8 B;  3PPB A;  1RKT A;  2E2H J;  4A69 C;  3GTM J;  5IP7 J;  3HOV J;  2L9R A;  1I6H J;  2K40 A;  2LKX A;  2DMN A;  2CU7 A;  1ETX A;  3GTG J;  2EZI A;  3DPJ A;  2XB0 X;  2K9S A;  2X9D A;  3MNL A;  4JNN A;  2QKO A;  2D5V A;  4B3A A;  1EF4 A;  2XPU A;  2X6O A;  2XB5 A;  4W1U A;  1BL0 A;  1IGN A;  4GFB A;  1AKH A;  2WV1 A;  1GT0 C;  5H9T A;  1JKO C;  2NX4 A;  1JT0 A;  5CXG A;  4CYC B;  3IH4 A;  1MH4 A;  3QPL A;  2LR8 A;  2ZCX A;  3WHC A;  2G0E A;  3S2H J;  3VVZ A;  1Q1V A;  2DJN A;  2NVT J;  1X2M A;  5F0C A;  3VOK A;  3CJD A;  5BNG A;  2NOG A;  4UUT A;  3ZQI A;  3JRA A;  3E7L A;  2E19 A;  5D1R A;  2DTZ A;  5M3F J;  3ZOB A;  2PBX A;  1JTX A;  4IHW A;  2O7T A;  3RD3 A;  2ELK A;  2VUM J;  3G56 A;  2B63 J;  2R5Z A;  2UXP A;  1NK3 P;  1O4X A;  3O8H A;  2E2I J;  3HIM A;  3LWJ A;  3IH3 A;  2M34 A;  4A3K J;  3BCG A;  3KKC A;  1HDD C;  5C4Y A;  2KDZ A;  1HDP A;  2H1K A;  1FTZ A;  1VF9 A;  4W97 A;  5K7H A;  3QQA A;  4A3F J;  1HLV A;  2CUE A;  2XRL A;  5FJ8 J;  1QRY A;  2YS9 A;  5C44 J;  3HOW J;  2EBI A;  1POG A;  3BR1 A;  4IEJ A;  1B72 A;  2R7Z J;  2DG7 A;  4DW6 A;  5IPA A;  1JT6 A;  5DAJ A;  1FIA A;  1OCP A;  1ZGW A;  5F1J A;  3FK6 A;  2HXI A;  2NS7 A;  1JUP A;  3WHB A;  5F27 A;  2DA5 A;  4ACI A;  5M3M J;  5J1Y A;  3LNQ A;  1I3Q J;  4IHV A;  1T33 A;  5FKN A;  3S14 J;  3FRQ A;  3BT9 A;  4CGR A;  3HOX J;  2JA7 J;  3VW2 A;  1JUS A;  2N8G A;  2FQ4 A;  1OCT C;  3VUQ A;  4JKZ A;  3GTQ J;  3LSR A;  2EQR A;  4B1R A;  5AQC A;  3KKD A;  5IYB J;  1WH7 A;  2P81 A;  1H88 C;  2QCO A;  3TP3 A;  4I6Z A;  4A3D J;  3VW0 A;  3CRJ A;  1ETK A;  4D7M A;  2R5Z B;  1BJZ A;  2DA6 A;  2HI3 A;  1IV6 A;  2G7G A;  3MN2 A;  2DMU A;  1TWF J;  2Y2Z A;  4JX5 A;  2HOA A;  4ICH A;  2ME6 A;  3S17 J;  3VVX A;  1BW5 A;  2DMT A;  3COL A;  3HTI A;  4D5F A;  3PO3 J;  4QTR A;  1DU6 A;  1Y1W J;  5CW8 A;  4A3J J;  2R92 J;  1XG1 A;  3G1M A;  1Z0X A;  2CUF A;  2Y31 A;  4D5C A;  3M3Y J;  2G3B A;  2K9N A;  4AUX A;  1MBH A;  4A93 J;  3LHQ A;  1ETQ A;  2HYJ A;  1TWG J;  5EGO A;  3H0G J;  3OSF A;  2LFB A;  2Y0S N;  1GDT A;  3RH2 A;  4V2G A;  3JRI A;  3VVY A;  2HDD A;  5DS9 A;  3VP5 A;  1UI5 A;  5HOD A;  3ON4 A;  2YUS A;  1ZR2 A;  4C2M J;  4MK6 A;  1XC5 A;  3ZQH A;  1NTC A;  1VI0 A;  2JMW A;  4M3B A;  3ZQG A;  3SDG A;  3BTJ A;  4JX4 A;  3I4M J;  5FHP A;  2XGC A;  3IH2 A;  1I50 J;  2K9Q A;  1ETW A;  1G2H A;  1MBG A;  4HKU A;  3JRD A;  3SFI A;  5EG0 A;  3V6G A;  2H8R A;  2DA1 A;  4GFK A;  2DMQ A;  2WAQ N;  4AC0 A;  4DYQ A;  2UXU A;  2O9L A;  2I10 A;  2QIB A;  2EZK A;  3BR0 A;  3JRE A;  2AHQ A;  3HBL A;  4AYB N;  1ORK A;  1B72 B;  1RKW A;  1ZR4 A;  2QWT A;  3HGG A;  4S0H B;  1TWC J;  2HQ5 A;  5CXI A;  9ANT A;  1W0T A;  4A3L J;  2GM4 A;  1FTT A;  3Q0U A;  5JLW A;  5HAW A;  4JYK A;  3ZQF A;  5C4J J;  2XSD C;  3HKZ N;  2R5Y A;  2JA6 J;  4JP0 A;  2JA5 J;  1SGM A;  1WPK A;  2RHA A;  5K58 A;  2EZH A;  3QBM A;  5IP9 J;  1ENH A;  5E3O A;  5EG0 B;  2NS8 A;  1JJ8 C;  4A3M J;  2L7F P;  3FIW A;  4JX6 A;  4D7N A;  1JKP C;  3HOZ J;  2D6Y A;  1B8I B;  3ANG A;  4YZE A;  1IRZ A;  3G1L A;  1VFC A;  4RDU A;  1FEX A;  4JL3 A;  2DMP A;  5FKM A;  4BBS J;  1YRN B;  1HOM A;  3FIS A;  4A3E J;  2YVH A;  3BG5 A;  2LD5 A;  2VPR A;  3LSJ A;  2M2E A;  5FMP A;  4HNV A;  3ZQC A;  2XGE A;  3BG3 A;  2L0K A;  3QPS A;  3VPR A;  3VIB A;  3S1R J;  2JN6 A;  3LOC A;  5J1R A;  4NN1 A;  1XS9 A;  2L7M P;  4M3D A;  3I4N J;  2ZOY A;  2V57 A;  2X48 A;  3S5R A;  4B4C A;  3GBG A;  4FCY A;  1WH5 A;  3PM1 A;  1RES A;  5IYC J;  2ZB9 A;  3S1M J;  3QKX A;  3ZQL A;  2NVQ J;  5C3E J;  4XK4 A;  3BR5 A;  4XRS A;  1WGX A;  3G1O A;  3EGQ A;  1OFC X;  3C2B A;  1X2N A;  4X1E A;  3TW6 A;  5FLM J;  2AO9 A;  3GTO J;  1TC3 C;  3Q3S A;  5K7F A;  4J19 A;  4GCK A;  2M8G X;  2M0C A;  1DU0 A;  3RZO J;  1BW6 A;  3G7R A;  2EH3 A;  3CWR A;  2ECB A;  3CCY A;  5GPA A;  3ANP A;  1A6I A;  1RPW A;  5GPC A;  2L7Z A;  2W48 A;  3TP0 A;  4A3C J;  1GVD A;  1QVT A;  4GCT A;  5GP9 A;  5EGO B;  1K61 A;  2COB A;  3KZ9 A;  3NXC A;  1AHD P;  2G7L A;  2REK A;  5IYD J;  1MBF A;  1E3O C;  1X58 A;  4KWA A;  1P7I A;  1S7E A;  1U9N A;  1IDZ A;  1ITY A;  4M3G A;  4M3E A;  1UMQ A;  2CJJ A;  1H89 C;  5C4X J;  3HE0 A;  4DYR A;  3D1N I;  3F0C A;  4V2F A;  3DCF A;  3GEU A;  2PZ9 A;  3O60 A;  1ETV A;  2IAI A;  3B6C A;  4G12 A;  1VND A;  2EZL A;  3JRB A;  2LP0 A;  1UHS A;  5EEA A;  2VKE A;  3A02 A;  1U8B A;  5D18 A;  1JTY A;  4QSH A;  2NVY J;  3S15 J;  2ID6 A;  4CYC A;  1NK2 P;  4BXX J;  1ETY A;  2WB1 N;  5EFY A;  1JJ6 C;  3UKG A;  2UXI A;  3VOX A;  2WUI A;  1ZTR A;  2VKV A;  3RKQ A;  5HBU A;  3HM5 A;  4RBO A;  5M5W J;  1Y1V J;  1GV2 A;  3GTJ J;  1YRN A;  4I76 A;  1HF0 A;  1A5J A;  5F04 A;  4FE4 A;  3HOY J;  4LOC A;  3RZD J;  1H8A C;  3OOU A;  3HEF A;  1CQT A;  2UXO A;  2JWT A;  1BA5 A;  1LE8 A;  3OSG A;  4ABZ A;  1JUM A;  5F08 A;  1GV5 A;  2JA8 J;  1D5Y A;  1ZK8 A;  4BY1 J;  5E3L A;  3FK7 A;  1JKR C;  1JGG A;  2QOP A;  3NNR A;  3H3V K;  4MFE A;  2ECC A;  1MSE C;  3P9T A;  3BG9 A;  3AQS A;  5DTD A;  4UUS A;  1F36 A;  2NP5 A;  1LFU P;  3JSJ A;  2IU5 A;  5F0F A;  2ME0 A;  3OIO A;  5E3M A;  2LLK A;  2PMZ N;  5EYR A;  2GLO A;  3AQT A;  3HTH A;  2JJ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...