3CCYA

Crystal structure of a tetr-family transcriptional regulator from bordetella parapertussis 12822
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
192
structure length
192
Chain Sequence
b'YENIRDTIIERAAAMFARQGYSETSIGDIARACECSKSRLYHYFDSKEAVLRDMLTTHVDSLLERCRQVLYGSNEPKTRFLQIVKLFLEIYATSRDRHVVMLTCLDALPEDQRKALIAKQRELIAYVRDALLQLRPDMAANRTLAHVDTMLFFGMINWTYTWYKADGSVSPDALAERTVQLFLDGYLNLLSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative TetR-family transcriptional regulator
publication title The crystal structure of a TetR-family transcriptional regulator from Bordetella parapertussis 12822.
rcsb
source organism Bordetella parapertussis 12822
molecule tags Transcription regulator
total genus 65
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17932 TetR_C_24 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3ccyA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3ccyA02
2X9DA 3DEWA 3JRFA 3S5RA 3EGQA 5IPAA 4CGRA 2E19A 3BHQA 1UHSA 3S2HJ 3EUPA 3BG5A 3TP3A 1NK3P 2FBQA 3PPBA 4DZJA 1GV2A 3HEFA 4GCTA 2XPVA 3DCFA 1B8IB 2E1OA 4ACIA 2FQ4A 5F1JA 5IYCJ 1BW5A 1ZQ3P 2JK3A 5E3NA 4X1EA 4UUTA 1MNMC 2E2IJ 4JL3A 3ON2A 2R5YB 2YVEA 3F0CA 3BCGA 5EFYA 1IUFA 1VNDA 3RQIA 3MKLA 2QOPA 1XC5A 2EZKA 1U78A 2Y0SN 5E3MA 1RESA 1Z77A 2DG8A 5EG0B 2ME0A 3ZQGA 4UUSB 4A3EJ 1R9TJ 1B8IA 2L7MP 1MBKA 5J1UA 1YRNB 2DJNA 3BTIA 1HDPA 4FE7A 2VI6A 3HB9A 1U9OA 2GM4A 2MG4A 4C3IJ 3JRBA 3GTJJ 1IJWC 2GLOA 4ICHA 1ETWA 2AO9A 3GTMJ 1IV6A 3VW1A 1TWHJ 2MGQA 3H0GJ 4D5CA 2R5YA 3G1MA 2REKA 2NS8A 5D1RA 1HOMA 4A3KJ 2FX0A 3VOKA 3NAUA 3JRDA 5EEAA 2KDZA 2G7LA 3S17J 2ZCXA 5K7ZA 1IDYA 3BR5A 1POGA 3A02A 1WH7A 3DPJA 2CQXA 3G1LA 4UUSA 3VW0A 1K83J 1YRNA 2I10A 2JA7J 2D6YA 3VUQA 2H8RA 1Y1WJ 3NPIA 2YU9J 3T6NA 3JR9A 1UI5A 4XRMA 5E3OA 5FJ8J 3ZQCA 4A93J 5CW8A 3SFIA 5EF6A 5EGOB 5F08A 5H9TA 1GT0C 2DA4A 2K9QA 3I4MJ 3S15J 4GFLA 4CYCB 1IRZA 3V78A 5JLWA 2ZOZA 4HKUA 3VPRA 2DMTA 2NX4A 1BJZA 2DA6A 3PASA 4I76A 2O7OA 5J1RA 3S1RJ 3TW7A 1OCPA 2LK2A 5GPCA 4FTHA 4EEFG 1H88C 4M3FA 1QPIA 5C4XJ 4IHXA 3CQZJ 4MFDA 2M8GX 1FTTA 2JA5J 5EGOA 5F0HA 1LFBA 4YZEA 4MK6A 4CYCA 1JJ8C 5IP6A 5FKMA 2X48A 2DMUA 3B6AA 1QVTA 4DYCA 2H1KA 3AQSA 5J3LA 2JA6J 4D7MA 5K7FA 1JKRC 3IUVA 3QPSA 4AYBN 2NS7A 3OIOA 2M34A 1HDDC 3KKDA 2NP3A 3LJLA 1BA5A 4A3MJ 3CWRA 2ZOYA 2G7SA 2RASA 3PM1A 2DG7A 1I50J 4MO7A 2L7FP 2GFNA 3FRQA 4A3IJ 2MW8A 1LE8B 5FKKA 4XICA 2CRGA 3TW6A 2Y9ZA 1TWGJ 3VP5A 5CXIA 2MSYA 1ETQA 1MH4A 2IAIA 3QBMA 2VPRA 5HAWA 3MN2A 4B3AA 3G1OA 2QKOA 4A69C 4AC0A 2GBYA 2ZCNA 4BY1J 3JRAA 2COBA 5IOYA 1H89C 2W53A 3NNRA 3AQTA 1AHDP 1IG7A 4M3EA 1EF4A 2R93J 2R7ZJ 3S14J 4JKZA 4W1UA 1D5YA 1GUUA 1RKTA 3HTJA 2K9NA 2NVQJ 5EZGA 3JREA 1NTCA 3W6VA 4MLOA 3P9TA 1JUSA 1TWCJ 1ETXA 2P81A 4NDLA 3KNWA 3LWJA 2XRLA 4Y7NJ 3WHBA 1HCRA 1ORKA 2OERA 3IH2A 3HBLA 4M3GA 4GFKA 3B6CA 1IGNA 2FD5A 3K7AJ 2XGEA 5D18A 1TWFJ 2NOGA 1S7EA 2TRTA 5IP7J 3ZQFA 1X58A 2R5ZB 3JRIA 3H3VK 1FJLA 1K61A 4A3BJ 4IHWA 5AQCA 4AF5A 3O8HA 2IEKA 3ZQLA 4MIMA 5FLMJ 1B72B 4M3BA 3HKZN 3OOUA 2PBXA 4FCYA 4JX5A 1OJLA 2ID6A 1WPKA 3BR0A 2G3BA 2DA5A 4IHVA 5E3LA 4JX4A 1RKWA 1FIAA 2XGDA 2HDDA 5BNGA 1OFCX 4BKXA 5F0CA 1ZR4A 2UXHA 3LHQA 4NN1A 1Y1VJ 5C3EJ 3E7LA 2D5VA 1MSEC 4C3JJ 1UI6A 1B72A 2TCTA 5JLXA 1HLVA 1I3QJ 3HGGA 1UMQA 2EZLA 2LP0A 3LSPA 3O8GA 4BBRJ 2DMPA 5M5XJ 2QIBA 3PO2J 2W48A 4A3FJ 2YUSA 1IC8A 5EG0A 2WV1A 4QSHA 4G12A 1DU0A 1MBFA 5IYBJ 5C44J 2LVSA 1U9NA 3GTQJ 5DS9A 1ITYA 2VKVA 3JRHA 2G7GA 2NVYJ 3WHCA 4W97A 3TEDA 3QQAA 2QCOA 3KKCA 3VVZA 1JTXA 3HOXJ 1VF9A 2O8KA 1ENHA 1JT0A 2CJJA 3MVPA 1FTZA 4MFEA 1OCTC 3L1PA 3GTKJ 2K40A 1H8AC 3FIWA 2JWTA 3I4NJ 4AUXA 4ME9A 3GTOJ 5K58A 4PXIA 1ZGWA 2X6OA 2NVXJ 3LSGA 4DZPA 3F1BA 2XPUA 3A01B 3JRGA 3VW2A 3ZOBA 4HNVA 2JA8J 2DA3A 2DN0A 2E2JJ 2GUHA 3NXCA 1PUFB 1JKOC 4GCLA 3O60A 2DA7A 5HODA 3ZQIA 3RD3A 3VIBA 4S0HB 4JNNA 3UKGA 2DTZA 4JX6A 3S16J 5HBUA 3BJBA 3BT9A 3Q0WA 1GVDA 4B1RA 1XS9A 4GCKA 3ZQHA 3OSGA 1W0TA 2OPTA 3VVXA 2LFBA 1WH5A 1XG1A 3BG3A 1PUFA 2HKUA 2OI8A 4BY7J 1APLC 1MBGA 1W0UA 3HOZJ 3C2BA 1LFUP 1MBEA 1WI3A 5FHPA 2EH3A 1WCMJ 5FKLA 3S1NJ 1FEXA 3HDDA 2QTQA 2HYJA 2AHQA 3BTCA 5C4JJ 2M0CA 2NVTJ 3HE0A 4IEJA 2VUMJ 3RH2A 1LE8A 2Y9YA 2O9LA 1ZTRA 2HXIA 1VI0A 2EZHA 1TC3C 2V57A 1RPWA 3BRUA 3BTJA 2RAEA 2YS9A 4MXMA 5D19A 5EZHA 4RDUA 4D7NA 1WGXA 1JKQC 3HOVJ 1MSFC 2ZCMA 3CJDA 4IHYA 4A3DJ 1I6HJ 3SDGA 3BQZA 3GTGJ 3LNQA 3IV5A 1AU7A 5GPAA 2CUEA 3NRGA 1NK2P 1ETYA 4XIDA 3B81A 1E3OC 2EBIA 4KWAA 3NI7A 1MBHA 5K7HA 4I6ZA 2F07A 2EZIA 3RZDJ 4XRSG 4QIWN 1IDZA 5M5WJ 2B63J 2HOAA 4C3HJ 5FMPA 1GDTA 2R5ZA 2XB5A 5HSZA 3M4OJ 4L62A 1Z0XA 3NARA 4JP0A 4RBOA 4BBSJ 2LR8A 5FKNA 3BG9A 2UXOA 3KZ9A 3CCYA 1SFOJ 2M2EA 4LOCA 1BL0A 2G0EA 2LD5A 2XB0X 4A3JJ 4GFBA 2CUFA 1JJ6C 2R92J 2CQQA 1JUPA 2XDNA 3E7QA 5M3FJ 1T33A 3PO3J 1U8BA 3COLA 5FGLA 1A6IA 1P7IA 2VKEA 3BR2A 3VOXA 3GZIA 1T56A 2WGBA 2WUIA 2UXPA 4V2FA 2UXIA 4AC6A 4XRSA 3K2AA 5DAJA 2OF7A 3Q0UA 5FLVA 4QTRA 1Q1VA 2JJ7A 3HGYA 3QKXA 5EDNA 2GENA 1FIPA 4C2MJ 5DTDA 2HOTA 1F43A 1RR7A 4JYKA 4D5FA 3S1MJ 2UXUA 3HM5A 3QPLA 3C07A 4J19A 1AKHB 1BW6A 3BR1A 2HXOA 3CDLA 5F04A 2ID3A 1A5JA 1X2NA 1P7JA 2Y31A 3FK6A 3ANGA 2ECCA 2YVHA 4NELA 2DMNA 1G2HA 3G56A 2HYTA 4DW6A 2LY9A 2CU7A 1GV5A 4A3LJ 5FKOA 5IYDJ 2IBDA 2NP5A 2HI3A 4XK4A 3ON4A 1ETOA 2DA2A 1MBJA 2XGCA 9ANTA 3GEUA 2LLKA 3VVYA 1AKHA 3CMYA 2JN6A 2WAQN 3GBGA 3OSFA 4FE4A 5M5YJ 3BR3A 3HTAA 4L5EA 3LOCA 2ME6A 1HF0A 1CQTA 4FISA 2JMWA 1ETVA 5C4YA 3A01A 3HTHA 4ABZA 3SJMA 3FKIJ 3V6GA 1SGMA 2LTPA 2L7ZA 2Y2ZA 4Y52J 5F0FA 2WB1N 1VFCA 2O7TA 2ECBA 3JSJA 1ZKGA 1SANA 1UG2A 2ELKA 3TP0A 5J1YA 3D1NI 3GTLJ 3FISA 3LSJA 2Q24A 1QRYA 5EYRA 1JKPC 3RKQA 1RETA 4B4CA 3HOWJ 4A3CJ 3ANPA 3HOYJ 4DYQA 1O4XA 1TWAJ 2K9SA 3A03A 5IOZA 1DU6A 3M3YJ 3Q3SA 2HOSA 3IH4A 3Q0VA 5M3MJ 4M3DA 2HQ5A 1JGGA 2DA1A 3G7RA 1JT6A 2Y30A 3BTLA 2KT0A 3HOUJ 2ZB9A 3LSRA 4X6AJ 2QWTA 1ETKA 3JRCA 5GP9A 2N8GA 3BR6A 2EQRA 2L9RA 2PZ9A 1MH3A 3HTIA 2PMZN 4M6VA 1JUMA 2R0QC 3IH3A 3S1QJ 2RHAA 3BNIA 2M9HA 4BXXJ 4UDSA 3S2DJ 3HIMA 5F27A 1JTYA 5IP9J 1QVUA 3RZOJ 2XPWA 4DYRA 2QF7A 3FK7A 3GTPJ 1F36A 2XSDC 4V2GA 1X2MA 3CRJA 2LKXA 2DMQA 2L0KA 5CXGA 3BQYA 3MNLA 4A3GJ 1ZK8A 2E2HJ 1ZR2A 2IU5A 2FJ1A
chains in the Genus database with same CATH superfamily
3DEUA 3DEWA 3JRFA 2DFIA 2VQLA 2ZMEC 5L3CA 5E20A 2LF8A 3BY6A 3BG5A 3G2BA 3TP3A 2BOLA 1WHUA 3GZ6A 1BR2A 1GV2A 3HEFA 3RPQA 4ASNA 1F5TA 5HDGA 4LG0B 1MJ9A 2RC4A 2A3SA 4Q48A 2ZJQF 4BU2A 4L18B 3V42A 1P9QC 4B44A 1W4MA 1MNMC 4JL3A 3WTYC 2R5YB 3F0CA 2F2EA 4D1QA 3RQIA 2QKMB 1IO2A 4YRVA 4Y15A 5E3MA 2DG8A 2M7BA 1YOVB 1XDSA 1IN6A 4LK0F 4A3EJ 1X1BA 5DYMA 4LG0A 1O7LA 2E71A 1YRNB 2W7NA 3DU6A 3U1KA 2A2FX 2CFXA 1XPXA 1YYVA 2W84A 3M1CA 3ABUA 3LQRA 3GTJJ 2GLOA 1ETWA 5J4YA 2MGQA 2R5YA 3OMYA 3IRRA 3CO6C 4IHSA 3RQ4A 3JRDA 3QU6A 2KDZA 4S04A 1POGA 3W2WA 3A02A 1Z67A 2DPUA 1A31A 2IU5A 4ESBA 3G1LA 1WJEA 2DT6A 2FMYA 3VW0A 4OWRB 2DFFA 1YRNA 3CMAI 4MTDA 2GWRA 4KIGA 3WTXC 2D6YA 1Y1WJ 3FM3A 3T6NA 4BL0B 3ZMZA 3Q9VA 3JR9A 2ZNYA 2LYCA 3ZQCA 2VQCA 2P4WA 1KYWA 2HOEA 2V6CA 4EATA 3IC7A 1GT0C 1FBUA 2B1EA 3S15J 2IS1A 3CJQB 1QU3A 1RI7A 3PNTA 3CJNA 1GXQA 4YELA 3RPUD 2VOPA 2JPBA 4HKUA 2DMTA 3BZ6A 1BJZA 3F3XA 2LK2A 2HQAA 2Q1ZB 2VL8A 4KMUX 4EEFG 2KIMA 5K5QA 4FTHA 4MFDA 1D5VA 1A36A 3LA3A 2M8GX 4CO8A 1QZYA 1T39A 4UNOA 2ZY9A 3JTHA 1ZH5A 2DO7A 1IRXA 1FBSA 1JJ8C 1QZZA 5IP6A 3AQSA 2Z9OA 5K7FA 1JKRC 3MQ0A 1YTYA 3SYTA 3E6DA 2EPFA 1OYWA 2XGXA 4U0YA 5H2FC 5E17F 3KKDA 2NP3A 5AONA 1PDNC 4A3MJ 2VC1A 1J9IA 2ADUA 3PFIA 2K3FA 3PM1A 1I50J 3CLQA 4G6TB 4Z2YA 3RI4A 2MH9A 3V8LA 1OPCA 5FB2A 3WGIA 4A3IJ 2WB1A 4NB5A 1LE8B 1R71A 2BBYA 4M74A 3RIRA 4CDGA 4U7DA 4XKBA 3UNGC 3LSIA 1ZELA 3WGGA 2ESNA 3MN2A 3ASOH 4IL6C 4HEA2 4BDYA 3G1OA 1K79A 2QKOA 4AC0A 3FMRA 1KQ9A 3JRAA 2JUCA 2NRAC 2COBA 4RAGA 2Y75A 3R0AA 4IOAF 1AHDP 2ZCWA 1EF4A 2R7ZJ 5KK1A 1NG7A 4OD4A 2JVGA 3BCBA 4DOZA 4N4OB 1SD7A 3SZTA 1NTCA 2X1DA 2XKOA 4CSWA 1JUSA 3N05A 1YHQI 1WSUA 4PJJA 2QVOA 4NDLA 3LWJA 2XRLA 1TNSA 1ORKA 3IAM2 4GFKA 3B6CA 1STZA 1VQKI 1TWFJ 3BG7A 3U21A 5E1XA 4WK8F 3F8NA 4JOMA 2LKSA 3OYMA 3CMEI 2IA0A 1B9MA 1I5ZA 1SVOA 1KQ0A 2A61A 1K61A 3DKYA 2IGNA 5ICGA 5AQCA 4AF5A 2IEKA 4L9NA 1QZEA 4A6EA 3HKZN 3FMQA 2PBXA 3F6VA 4FCYA 4XLFA 2RV8A 2ZO4A 4C2MA 2MA3A 4DNCA 3BR0A 2G3BA 4YFNF 2DA5A 4HZFA 4BJ6C 1N75A 4EGYA 4HDUA 4E7IA 5BNGA 2LOOA 2LREA 5F0CA 5C3EJ 2BY2A 3DQVC 1WQ2A 4GDFA 4AVPA 4HAMA 2TCTA 1YO5C 1HLVA 5EJCA 4OMZA 2QQ8A 2RQPA 3HSEA 5FGMA 2Y0SA 5M5XJ 1R5HA 3S2WA 2WV1A 2B0LA 2ISZA 1G3WA 3QODA 2Z33A 3DWLE 5C44J 4RMNA 1IXRC 2LVSA 1VQOI 5CJ9A 5AIQA 3SZPA 2LNBA 3ML6A 2EJRA 5HNFA 5HS9A 1TZLA 2W1OA 2NVYJ 3TEDA 3NEUA 3OYDA 2IJLA 4V19K 4CYDA 3KKCA 1T0FA 3HC7A 3U9GA 3BDDA 5EEGA 1H9GA 5LGUA 2O8KA 4KNYA 2LY1A 1Z9CA 1FTZA 3L2VA 3GTKJ 4ENKA 2DXIA 2V7FA 2JWTA 3I4NJ 2LH9A 3E5QA 4X0GA 4LG3A 3CCRI 4IRIA 1ZGWA 3A4CA 3LSGA 1ZARA 4Y4RA 2IW5A 1I39A 4HNVA 2L2OA 2JA8J 1UHWA 4EV0A 1ZREA 3H5NA 2E2JJ 3ASNH 4BE0A 2Q0OA 2LY2A 2HYGD 1LQ1A 1T0FC 1TP4A 2EWNA 3O60A 1Y0UA 3WU0A 4ZH4F 2VJJA 3JW4A 2DTZA 4JX6A 2QLZA 2IT0A 3SEZA 3B02A 3EUHA 2Y48A 3KZIC 3ZQHA 5LEJA 2FJI1 2M0MA 3VVXA 4HF2A 1BR4A 4XKCA 3GCMA 1R4MB 1FZPB 5HNHA 2HKUA 4GXOA 3K4BA 4Y13A 4E7HA 4BY7J 1K6YA 2XV4S 1APLC 3HOZJ 2DU9A 1TT0A 3R0JA 3WTTC 3CP8A 3RDIA 3DKXA 5FHPA 1WCMJ 3BP8A 5CVJA 3EYIA 3EYYA 1UAAA 2HYJA 1OCZH 4LITA 3TDZC 1XCVA 1NHAA 2W85A 3LSMA 3HE0A 2H09A 3DLLF 3EUHC 2EFQA 2O9LA 2BE5F 2HXIA 2RDPA 2CWEA 2XAQA 4I98B 3W2VA 1JE8A 1SEUA 5L3FA 1HW2A 4YG2F 3FXLA 3BTJA 3H9JA 3D0SA 3DXJF 4IRVA 3OY9A 2JT1A 1TQMA 5CLSA 3CJDA 1KQ8A 1S7AA 4M72A 5L3BA 5DM7F 5ICFA 3V7CA 4HDVA 3GTGJ 2A05A 4BNCA 1KU9A 2L4MA 3IV5A 3ZMUA 2DDBA 1AU7A 1TW2A 2KJBA 2BHZA 3NQOA 1ETYA 4XIDA 4XQFA 1V5GA 3S3MA 5FLXK 4BHCA 1H9TA 3B81A 4KUMA 2EBIA 3DBRB 2AXLA 1MBHA 4I6ZA 2EZIA 4QLCU 2WY7Q 1K7AA 4IQ4A 3SDBA 3Q9SA 3ZMVA 3OYHA 1U3EM 5M5WJ 2K4JA 4F52A 4F91B 1BIAA 4C3HJ 2XB5A 2LR8A 5JFRA 3K9TA 4UVBA 2BXYA 3CCYA 4P96A 2M2EA 2XAUA 3J7ZI 1BL0A 2ISYA 2LD5A 5E1WA 2MD5A 3HRTA 3I71A 2XDNA 3E7QA 1T33A 1VQ9I 5B1BH 3N97A 3COLA 1A6IA 3BJOA 2VKEA 4AIKA 3VOXA 3F72A 3K0LA 3GZIA 3F8FA 3W6JB 2W25A 1HKTA 1A04A 4V2FA 3LAPA 1J59A 2HVSA 2RQQA 3K2AA 5CVRA 1X3ZB 1PJRA 3QP5A 3K4KA 5DAJA 2OF7A 2XF6A 2XF5A 3Q0UA 4QTRA 5FLVA 2JJ7A 3D5LA 3QKXA 2GENA 4A6DA 1C0WA 3X2QH 2BVMA 4ESJA 3T8TA 4EQQA 2HOTA 4DBQA 1F43A 1RR7A 1D1BA 1SD5A 4YIIA 4O6JA 3N4MA 4JBAA 4ON0A 3OR2C 3E6MA 3B73A 1RNLA 3PUFA 3IRQA 5F04A 1R00A 4AU7A 3BG6A 1LB2A 1X2NA 4L9JA 4KDPA 3FK6A 4NELA 1G2HA 2PFBA 3K6GA 4BACA 2LY9A 4FQGA 2UUZA 2QSFX 4A3LJ 5FKOA 3F6OA 4ETSA 5IYDJ 3CCEI 1MMGA 2HI3A 3ON4A 3VSLA 2XGCA 1SMTA 2Y69H 2DT7B 2QBYB 1V3FA 3GBGA 5M5YJ 1X4OA 4NUBA 4CCMA 2ME6A 1HF0A 3H35A 4L9VA 1XSDA 1CQTA 2MABA 3A01A 1G3YA 2PQ8A 3FX3A 2R7RA 3E6BA 3V6GA 2V1DA 2LTPA 3C18A 2XSJC 4Y52J 4WCGA 3IAS2 3MZHA 1FP1D 2O7TA 2FUG2 2LBFB 2PMHA 1UG2A 1B9NA 3SXYA 3FISA 4BQOA 3LSJA 2J5PA 5JI6A 4UUVA 4EM0B 1RRJA 4XORA 2QBYA 1IRGA 3CCVI 4DIQA 2KISA 4B4CA 1J2XA 1S7OA 5FFZA 5J4VA 1EH8A 3RKYA 4Q47A 1X19A 4DYQA 4RS8A 1O4XA 3EETA 5JHFA 3M3YJ 4LK1F 2WBMA 5M3MJ 2QWWA 3LL7A 2DA1A 1BI3A 2Y30A 2WADA 2MYSA 3DTEA 2LBFA 2ZB9A 3TBIA 4D0PA 3NWTA 2ZJRF 4X6AJ 5GP9A 2ZXHA 1ZGAA 1MKMA 3BR6A 2WY8Q 2J5OA 2R0QC 3KP3A 3MCZA 2DTRA 3JCUC 4E7KA 1G59A 3IWZA 3P7NA 1U5TB 3W2AA 3S2DJ 3HIMA 4G7HF 2Z3YA 2XPWA 5IT3A 4DYRA 2KFDA 4DBRA 5B1AH 3FK7A 1GHCA 3GTPJ 2Y0MA 1F36A 3KPHA 2XSDC 5FLXZ 1OMIA 1U2WA 2LKXA 1ZG5A 5DCMB 3VYTB 1E2XA 4E7SA 4KIBA 2V4JC 3OS1A 2FJ1A 3J7AY 4CGRA 3QOEA 3BHQA 2FMLA 1FYKA 3EUPA 2EINH 4RB1A 4E7JA 2D45A 1NK3P 1VQ5I 3PPBA 4U9LA 2PBIA 4OD5A 2M3AA 3BWGA 2QA4I 1RZ4A 2I8DA 4G7ZF 4ACIA 2WAEA 5D8LB 1VQLI 5CQEA 3QOPA 4L0ZB 3ZRGA 5DCMA 5IYCJ 1R1UA 2D2WA 4I02A 3ON2A 4LD5A 1G3TA 4RGRA 5HVQC 2CS3A 2YSRA 3ECOA 2FXAA 4ZYAA 3CTAA 1U78A 1K4TA 3DBLB 1Z77A 3RKWA 5EG0B 2ME0A 4UUSB 1R9TJ 2DQLA 4KT6A 2E35A 3ZMSA 2RNJA 2OC6A 5J1UA 2E1CA 3C2HA 3HTSB 5JR3A 2OQGA 3BTIA 1HDPA 3DKWA 4WWCA 2XUBA 3GXOA 3WU2C 3TGNA 4OOIA 4P1WA 4ICHA 1EH6A 2AO9A 3GTMJ 3VW1A 4D5CA 1HXDA 1A6QA 2REKA 2NS8A 1V5FA 3KX2A 5J6XA 4A3KJ 2FX0A 1HOMA 3VOKA 2G7LA 3S17J 1WH7A 4ZDPA 4UUSA 1SMYF 1UCRA 3I56I 2VJIA 1PYVA 2DOAA 3IL2A 3CF2A 3PNVA 2H8RA 2KLOA 1ACIA 4N0BA 5B66C 3HOSA 2P7CB 5CW8A 2LC2A 4BE2A 4BXFA 1KZHA 4A93J 1O7FA 4ZTJA 3SFIA 1B4AA 5H9TA 4EJOA 2DA4A 3I4MJ 1G8XA 1IW7F 1S9HA 1IRZA 5LGTA 5JLWA 2VQHA 2ZOZA 5LRRA 1R22A 2DA6A 3FXMA 2KIUA 2HYFA 3AG1H 4UVAA 2EFNA 2PN6A 4M3FA 3P9KA 1KA8A 4RLQA 3WODF 3GYHX 5F0HA 1XGMA 1JI8A 3AG3H 1V5EA 3PSIA 4P9FA 5DEQA 4HX7A 4DYCA 2DMUA 1I27A 4XRFA 4OMYA 5J3LA 2KMUA 4D7MA 1XD7A 2WAQA 4S05A 2EB7A 3DBHB 3PQKA 1BOAA 4UB6C 3KZZA 2CYYA 1BA5A 2IPQX 3CWRA 3L2WA 2ZOYA 4HNUA 1DPUA 3GW2A 3FZVA 2AXTC 1WRJA 3C2GA 3E1SA 4QPQA 3ZMTA 2ZJPF 1Z7UA 5DV5A 1MW7A 2H6CA 4ZTFA 4MEXF 3TW6A 1CGPA 3K10A 2Y9ZA 3VP5A 3H3UA 3K69A 5CXIA 1MH4A 2IAIA 3G3ZA 1OQYA 1QNTA 3H3ZA 4P9UA 3RYRA 4KMFA 1HA8A 1DPRA 1MJBA 2ZSHB 2HFHA 3CP2A 1H89C 2W53A 2CFOA 2M45A 2FOKA 3GVAA 4M3EA 4XLCA 2R93J 3GX4X 3S14J 4OAZA 2ACJA 2VJ5A 4I99C 2IA1A 1RKTA 1S8NA 1W7PB 1OISA 3HTJA 3L7WA 3VWBA 4LFUA 3WTUC 3MWMA 2QYOA 3ABTA 3LSTA 1TWCJ 2KRCA 4I01A 4PJ0C 2PJRB 4ZDOA 3JAMK 2PMZA 3KNWA 1W36C 2XAGA 2K9LA 2MD0A 3WHBA 4A0XA 2OERA 1IUYA 2XAFA 3RPUA 4A0ZA 4UB8C 4J01A 4M9SA 1IGNA 1YJNI 2FD5A 3K7AJ 2XGEA 1S7EA 1Z6RA 3KLNA 1YW8A 3OOPA 3WGHA 4GO1A 3ZQFA 2R5ZB 3JRIA 3QU3A 2OV7A 1FX7A 4PGHA 4PJNA 3VDXA 1W1WE 1W7PA 1YJ9I 1LDJA 3DTKA 4A3BJ 5J8FA 1V54H 4IHWA 2IS4A 4M6XA 3O8HA 4HF0A 2QQBA 2CSOA 3DP7A 1B72B 5HLHA 1WJ5A 2MC3A 4IRHA 1OJLA 1LJ9A 2E1MB 3WE2A 5BPIA 5J40A 2FF4A 2K85A 3UR3C 1FWZA 3QPHA 1MZBA 3HRUA 4IKFA 1YG2A 1FIAA 2XGDA 2GIVA 2Q8KA 3L00A 3S8PA 2HDDA 3P9CA 1OFCX 3K4MA 3LHQA 4NN1A 3AG4H 1Y1VJ 4HG2A 4IZZA 3ABKH 3HPHA 2NNYA 2CG4A 2D5VA 2MBFA 3I0TA 5FRNA 4ZDLA 4FASD 1B72A 3GWZA 5JLXA 2P8TA 1W36D 3HGGA 2EILH 2H6BA 2UV1A 3ZMDA 2HDCA 2GXGA 2QIBA 1P4WA 2YUSA 1IC8A 1Z05A 1IXCA 4E4HA 2E5ZA 4QSHA 1DU0A 4OIQF 3MAJA 1MBFA 3RKXA 3GZ5A 1U9NA 3OYJA 1FOKA 5LEKA 5DS9A 1RC9A 1ITYA 1D1CA 2KZGA 3ZP5A 2G7GA 4W97A 4Y3OA 2R7DA 2JA2A 4IO9F 5BS6A 2BV6A 3C3WA 4PSWA 1O3TA 2W82A 3ELKA 3HOXJ 1VF9A 1ENHA 2K5CA 2HU9A 4I0AA 1RUOA 2VBZA 2X1EA 3H5RA 1J5YA 3L1PA 1D8KA 1F4KA 1OCTC 1B59A 2VOOA 2E1MC 4NC7A 4NHJA 1O3QA 2K9MA 1D0XA 2ELHA 3CCUI 1EJ9A 5K58A 2X1CA 2X6OA 5KCMA 3F1BA 4E7ZA 3JRGA 3J7AO 4RB2C 1W7PD 3MFKA 2V1NA 2VASA 1YLFA 2IP2A 2GUHA 3ONQA 1YW9A 1PUFB 2CGPA 2V9VA 3VYRB 2V79A 5HLIA 4GCLA 4OIRF 2XASA 4RGXA 4A2UA 3ZQIA 1FMVA 1QPMA 4S0HB 4JNNA 2NS0A 2E7XA 1MMNA 3RTRA 5K5OA 2A68F 1IRFA 4KICA 5D5VB 1AWCA 3L9FA 3TKYA 3HHGA 3CESA 4M73A 4PJLA 2LFBA 4CHUA 4C2TA 3HZJA 3U1DA 4EJTA 2FU4A 1PUFA 1XG1A 1Z7LA 3H1CA 4O5VA 1MBGA 2FBKA 1DGWY 4AD9A 1W0UA 2COMA 3C2BA 4AYBA 1LFUP 2HZTA 1WI3A 2LRDA 2QGUA 3VODA 1R6RA 3LSKA 3F23A 4XMYA 2WTEA 3LSHA 2M0CA 2NVTJ 5J8CA 1SAXA 3JAMZ 1LE8A 4BQAA 2KPMA 1L3LA 3QWLA 1FC3A 2EZHA 5LD2C 2V57A 1RPWA 4G6DA 3BRUA 1Z6TA 5CVVA 5LHGA 2HQRA 2DK8A 5EZHA 2HTSA 1BI2A 3FXOA 1JKQC 3HOVJ 2ZCMA 4IHYA 3KEQA 1KGSA 1I6HJ 3I3LA 3O3KA 3LA2A 1QO0D 3LNQA 4HLXA 3CCSI 4BDZA 1VQPI 2HZDA 1H0MA 4D9JA 4H4KC 1UB9A 4C2UA 4PDKA 2CUEA 3HYIA 2RNGA 2X6XA 4R1HA 4E70A 4M9ZA 3K8PC 3GO5A 2JQ7A 4G94A 1ZAOA 4BH9A 1A35A 4PSXA 3QYFA 3MKYB 2OTJI 3SQNA 4KJZA 2DYRH 3OYBA 5K7HA 4EGZA 2C6YA 2TDXA 2F07A 2JSPA 4FETA 2W4SA 1JGSA 3KE2A 4IX7A 1EV7A 2XIGA 1XX5A 4QIWN 2XRNA 2DQRA 2DDAA 4IRGA 1GDTA 5HSZA 3LQQA 3CO7C 3JSPA 1Z0XA 4RBOA 3OV8A 5FKNA 4BEHB 5GAGJ 1BOBA 3H36A 1XSVA 2FNAA 4LOCA 3K4JA 3KZ9A 3ERED 1NH3A 1WKMA 3CMMA 2ELJA 3DTIA 4M6YA 2OA4A 2WWYA 4HLYA 4GFBA 3VFZA 1JUPA 4RB3C 4F55A 4NC8A 4B8XA 1HW1A 1OKRA 2WGBA 4K2EA 1SFUA 2LG4A 4QPOA 4OINF 4AC6A 4XRSA 3OR1C 1ZLKA 4CA0A 1UELB 1T95A 3HGYA 2YU3A 5EDNA 3MMYB 4A5MA 2NAZA 4C2MJ 5B5EC 2ZBKA 3LFUA 1R5GA 2OQRA 3HIFA 4JYKA 4D5FA 4LIUA 2DJIA 2RREA 1Y8QB 2UXUA 3QPLA 2MC4A 4MGRA 5ICEA 4ZZLA 3C07A 3HJEA 4J19A 2W57A 1BW6A 1J7KA 4CCOA 5L3EA 2M30A 1TW3A 3CDLA 3L09A 3NS4A 1ZN2A 1A5JA 1P7JA 3RSNA 2YVHA 2ECCA 1FOWA 2OU2A 2Z16A 5HOOA 3OYKA 5JVGF 1LDKB 4DW6A 3T1BA 3P9IA 4RA2A 3NWSA 2OZUA 4H0EA 2EIKH 4XK4A 2E36A 1WZ2A 1DP3A 2PG4A 3A1YA 3SHFA 4CCJA 3HPGA 4FE4A 2L54A 2R7QA 3HTAA 3LOCA 2RVCA 4FISA 3E97A 4ENJA 4HOBA 3C1DA 3FXKA 1X1AA 5DD8A 1P4AA 1SGMA 2L7ZA 2VN2A 5F0FA 2WB1N 2VBWA 3JSJA 2ELKA 1SANA 3BJ6A 4CCLA 3I4PA 1CF7B 2R7UA 4MQVA 4BJ5C 1VQ4I 2EFOA 2M8EA 5EYRA 1EH7A 1FMWA 4LLGF 1S72I 3ANPA 2UWMA 4EMSA 1FOXA 3HOYJ 3OYEA 4B47A 3M8EA 2K9SA 1WFXA 2OZ6A 2DK5A 1PVEA 3OS2A 2HOSA 4BUPA 3M7GA 1YFHA 4AIJA 2HQ5A 1JGGA 3G7RA 4I2OA 3HOUJ 2VIXA 1HQCA 3LSRA 1Z1DA 2FEZA 5H6RA 2QWTA 1R1VA 2EQRA 2PZ9A 1CF7A 2HTJA 3PIPF 3HTIA 4M6VA 1BIBA 1OR7A 3IH3A 3S1QJ 1Y39A 3BNIA 3I5UA 4PCQA 5CVIA 4MHGA 2GA2A 2QSHX 1E0EA 1JTYA 1QVUA 4RB0A 2EV5A 3TMOA 1TL8A 2PLYA 3K2ZA 3HUGB 3M07A 2L0KA 3LMMA 3BQYA 2DI3A 4A3GJ 2FRHA 2X9DA 4RAFA 4I0BA 1ZRDA 3ZCOA 5LFAA 1ERDA 3EGQA 2VXDA 3S2HJ 3KEYA 2R7SA 1FYLA 1QHGA 2X4HA 4DZJA 4UXNA 4NQWB 1OR7C 2XPVA 2E1OA 2FQ4A 5DM6F 1G3SA 1MJAA 3I59B 4LIVA 4F3QA 3CUOA 2QQAA 1ZQ3P 2JK3A 3PJRA 4X1EA 3Q5FA 2K3PA 4UUTA 1LPQA 4N9IA 2UXNA 2YVEA 3OYFA 3BCGA 2KJCA 2BY1A 1XMAA 2ZXIA 3MKLA 2QOPA 2O5RA 1YX5A 2EZKA 2Y0SN 4ITVA 1RESA 2CQ7A 2L7MP 1MBKA 4PJMA 1TNTA 3OYLA 2UZKA 3CCMI 5EEHA 2PI0A 3I59A 2YX4A 4ANJA 2Z99A 3J80K 3HB9A 2GM4A 4C3IJ 2AQEA 1W5SA 3V8JA 4EJVA 3VTIA 3G1MA 5IT9K 3D5RC 5DUIA 2BVLA 5K7ZA 1IDYA 3CZ6A 3J7YJ 3HOTA 2ZXWH 1Y0NA 2CQXA 1J75A 2Z1DA 3ZN0A 1KU7A 3V7SA 2E5NA 4ESFA 1K4SA 2XAHA 2R7TA 2I10A 3OL4A 1O3SA 2X51A 5TJJA 1D1AA 1SC7A 4BHPA 4XRMA 3CJRB 3ECHA 2A5YB 4LMYA 1DDNA 1P92A 1ZGJA 2VONA 1FP2A 5F08A 4GFLA 1SAUA 4CYCB 4IJAA 2XF7A 2F4OB 3V78A 3SFZA 5D5UB 3VPRA 2NX4A 2XKPA 4I76A 2O7OA 1TLHB 4XM3A 2E34A 2L4AA 1H88C 5GPCA 1QPIA 5C4XJ 3M8JA 3CQZJ 3DLAA 4IHXA 3G6EI 3PUBA 4F7ZA 4WXCA 1FTTA 2YR2A 3CD6I 4HSTA 5JHUA 2AQFA 2DAOA 4MK6A 3OYNA 4CYCA 4AWXB 3KCCA 1K6OA 1QVTA 2JA6J 3OWTA 2DOEA 5L3GA 4U88A 5HLGA 3OIOA 1HDDC 2ZJ2A 4XSZF 4HPQA 3HL2A 5H20A 1LFPA 2JRTA 2PX9A 3FHZA 1UJ8A 1U6GA 2ZNZA 3MD2A 2HEOA 3J81K 4CGZA 2H8WA 1G4DA 2RASA 2GFNA 3FRQA 2BGCA 3KFWX 2V6EA 1SFKA 1E3HA 3ERMA 5FKKA 4XICA 4MTEA 2IA2A 2CRGA 3T8RA 3ABLH 3DEEA 4U7BA 1ONVA 2MSYA 3QBMA 2GOMA 2BHYA 4BXUA 4B3AA 2V1UA 5TISC 4EM1A 4A69C 2GBYA 1BC7C 3K4CA 4BY1J 1LVKA 5IOYA 3FXJA 2DYSH 5LBQA 3AQTA 2BXZA 1IG7A 1W5CC 1TTYA 2BYVE 2K9NA 4XLEA 3VEPA 2NVQJ 2WAFA 2HDWA 4MLOA 3P9TA 5E18F 2F4IA 4NBQA 4PFPA 1ETXA 1I1GA 3K1PA 4GYGA 4Y7NJ 1HCRA 1VQNI 1EA3A 5D6FA 3HBLA 1U5TA 1HKSA 5D18A 3V8KA 2TRTA 2XROA 1X58A 4BGDA 4F92B 5LRSA 3H9GA 4G9YA 1YI2I 2P5VA 4E6KG 3H3VK 5F1RA 1XGOA 4EJUA 3QPTA 2O03A 4XL9A 4Y33A 1RIOH 4F93B 4XBFA 2IXSA 3IKTA 4B48A 3ZQLA 2FE3A 5D4SA 1Y6IA 5D5XB 3O6BB 3OOUA 4PGGA 3L2QA 4L5JA 4AVZA 4YIRX 1ON1A 4JX5A 2EFWA 4B3XA 2ID6A 4M9XA 4KT5C 2GXAA 1LUJB 3T0YA 1QGPA 1MMDA 3FKJA 3KP2A 5E3LA 4II2A 3J80Z 3GEZA 1RKWA 1U5TC 2XHKA 1XB4A 1S29A 5KAIC 2AS5F 1ZR4A 2VBXA 4BKXA 2UXHA 5DDGA 1T98A 2EA4A 3A0BC 3E7LA 3WU1B 3WTZA 5IT9Z 5D8KB 2O3FA 1MSEC 4HX8A 4C3JJ 1UI6A 4A0YA 4RLFA 4HA8A 3LAJA 2Z5UA 1I3QJ 2KHMA 5H6QA 1UMQA 2EZLA 2LP0A 2ZC2A 2KIFA 3O8GA 3GZNB 4BBRJ 1N77A 2DMPA 3PO2J 2W48A 4A3FJ 2P6SA 5CKTA 5EG0A 4U9NA 3OL3A 4G12A 2DBBA 4UV8A 1TT5B 3MKWB 5IYBJ 2DFEA 1OCCH 3GTQJ 3PSFA 2KP6A 2EK5A 2VQGA 3L2UA 2V26A 4CH7A 1XGNA 3WHCA 3QQAA 1J09A 3GLLA 2CV2A 3OIPA 5F64A 2HPIA 4P5OA 3NRVA 2BY3A 1T8IA 4HX4A 3EQLF 4G6QA 4Z6YA 1Z21A 2HQNA 3GFJA 1YX3A 4QWQA 2L9SA 3MVPA 3F9KA 2VE8A 4HQMA 4MFEA 3BZKA 2M87A 2F5VA 5FD5A 1H8AC 3FIWA 4XLPF 5JVTA 3GTOJ 2K7LA 4PXIA 4B09A 3GF2A 2Q2EB 4DZPA 2XPUA 1M1EB 3ZOBA 3ZQ7A 1ZLJA 2DA3A 2RGVA 3PIOF 1KONA 3I53A 2O61A 1WWXA 2DA7A 3RD3A 3KZYA 1LDDA 3EUKL 3J81Z 1BC8C 3S16J 3IKVA 4NNJA 2R7WA 3BJBA 3BT9A 1HSTA 3Q0WA 4XLHA 4B1RA 3ESWB 3GFMA 4WX9A 3F8MA 4GCKA 3OSGA 2Q2EA 1U8RA 2A69F 2QENA 2OBPA 4L0YB 3KIOA 2CW0F 2EIJH 2VT3A 2VJ4A 1WH5A 4EM2A 2VLAA 3WE3A 2X85A 1R36A 3CCLI 2CV1A 1MBEA 1D3YA 3GMEA 2EH3A 3I55I 5L3DA 1KYZA 5FKLA 4CZCA 3S1NJ 3W3CA 1Z3XA 3H5AA 2QTQA 2F48A 2PFVA 1LEAA 3KP4A 4JQFA 5LHIA 3BTCA 5C4JJ 2VUMJ 1ZTRA 3RYPA 3AFHA 1GLNA 1Y56A 1WJDA 2RAEA 4RDUA 3CC7I 4BHBA 4D7NA 2F6CA 1YIJI 3FBNB 6PAXA 1OCOH 4A3DJ 1YIOA 3SDGA 4WXHA 2JSCA 1SVMA 2OCCH 1VQ8I 2ZFUA 2KDOA 1NK2P 3ZPLA 4KISA 1FYMA 1ON2A 2PJRA 4KN4X 1E3OC 4XLNF 3NI7A 4ZYHA 5K1YA 1U0JA 2D1VA 2EFPA 2HNHA 3AG2H 4B43A 1TBXA 2ZKZA 4XRSG 2GAUA 2B63J 2E1NA 2V9PA 3OYIA 3CUQB 2GA1A 3KP5A 2R5ZA 5FMPA 3COAC 1ODDA 4U0VA 2CUZA 5KHDA 1ZG1A 3KYDB 3DF8A 4CICA 4JP0A 2V9KA 1VQMI 2VODA 3R4KA 1X3WB 3BG9A 2UXOA 1SFOJ 3ZR8X 3K1MA 2HVQA 2XB0X 2A6TA 4A3JJ 2JZYA 1SVLA 2R92J 2CUFA 3HKZA 5E8IA 1JJ6C 2CQQA 4A12A 1HSJA 5M3FJ 1WVRA 2WA0A 3BR2A 3HTUA 3HG9A 4BAYA 2WV0A 3TOBA 3H9QA 5J47A 2WUIA 3CUQA 5FRMA 3LWFA 3FDYA 3GLXA 3BC8A 1AA7A 5HS8A 2GQQA 1XGSA 4RAYA 3TO7A 2CW7A 2EA2A 3HXLA 2K86A 1TQIA 4HSRA 5DTDA 3CC4I 2FQ3A 1UZCA 2O8XA 4KYWA 2CQKA 2QM3A 3K70C 2L3DA 3FWEA 1AKHB 1FSEA 4Y17A 1MMSA 3WG7H 2ID3A 3VB2A 1MD0A 3CUQC 2Y31A 5D6EA 1YJWI 3ANGA 2LDUA 1R1TA 2DMNA 3G56A 3E6CC 2HYTA 4FHTA 1GV5A 1REPC 4LJZF 2IBDA 3TQNA 1ETOA 3CF5F 1RUNA 3GEUA 2LLKA 5HLTA 1I1SA 5GTIC 4L9TA 5HS7A 1AKHA 3KP7A 1WJAA 3CMYA 3I54A 2WAQN 1N78A 4O3MA 4L5EA 5E79C 2M4GA 2JMWA 1ETVA 5C4YA 2L02A 2MH2A 2WC2A 2XVCA 3HTHA 4ABZA 2HS5A 3FKIJ 2KRFA 2R7XA 2Y2ZA 1LEBA 4KFCA 4Q5SF 1VFCA 5D5WB 3KETA 2R3SA 1ZKGA 5J1YA 3TP0A 5GTHC 3GTLJ 2M1BA 3K70D 1JKPC 3BROA 3RKQA 1OYIA 1USTA 1RETA 2DCEA 1XSXA 4XOPA 3HOWJ 4A3CJ 3KP6A 3A03A 4GYIA 1DU6A 1HW5A 1I3AA 3FM5A 3IH4A 3Q0VA 1HBXG 2G9WA 4M3DA 3RCOA 2NOJB 1JT6A 2OJED 3BCAA 2KT0A 5CQGA 3JRCA 4CUGA 5TGTA 2N8GA 2LMDA 3BPXA 2VXZA 2PMZN 1SD6A 2A07F 3ULQB 4DVYP 2HVRA 1Y8RB 5CPRB 4BXXJ 4UDSA 1HC8A 2MFZA 2PMUA 1PP7U 3RZOJ 3R6SA 1FPQA 3WTVC 5LLQA 3M9AA 2QF7A 2P5KA 4I09A 4V2GA 3CRJA 3FMSA 2DMQA 4GGGA 3OYAA 4BE1A 4HV5A 1VTNC 5BQTA 1ZK8A 3PNYA 2V1XA 3PL8A 4XKVA 3S5RA 5DCFA 2VB6A 5IPAA 2E19A 1DGRM 2FOWA 1UHSA 4BYYA 2FBQA 2NYXA 4E7LA 3DU5A 3F21A 4GCTA 3DCFA 1B8IB 3MZYA 3K4LA 4M71A 1V55H 3ABMH 1P2FA 1UHMA 4J00A 3FHNA 3MKZA 5F1JA 5DUKA 1OYYA 4PFOA 1BW5A 5FFXA 3TO9A 5E3NA 4EJWA 2QUFA 1FT9A 2XDVA 2E2IJ 2KRHA 2D1HA 2HR3A 1YW7A 4YIFA 5EFYA 1IUFA 1VNDA 2VPLA 1XC5A 1FSHA 2HWVA 1IF1A 5FO5A 4FX4A 2IGOA 3ZQGA 3RJPA 2HKOA 1P4XA 2HGCA 1B8IA 1MGTA 4HV6A 3EDPA 2L01A 2XC7A 2DJNA 2YPRA 4KN7X 4FE7A 4BEHA 2VI6A 5ERIA 1U9OA 1D0ZA 1ZG3A 2MG4A 3QYEA 3JRBA 1IJWC 4JK1X 1FLIA 2H1LA 1IV6A 1TWHJ 1FBQA 2H94A 2OCEA 3H0GJ 4PK4A 5D1RA 4N9HA 3ZXSA 2QKLB 3NAUA 5EEAA 2ZCXA 2RKHA 4ZJZA 3BR5A 1MDMB 2GXBA 3DPJA 4YFXF 3OYCA 2DOFA 3CDIA 1J0RA 5KNLA 1K83J 2OTLI 2VKDA 4BQNA 5AIPA 2JA7J 3QP6A 5ILSA 3VUQA 4YFKF 3NPIA 2DODA 3M8FA 2YU9J 3K4NA 1UI5A 4OIOF 5E3OA 3TO6A 5FJ8J 3IHUA 4XSXF 4ENMA 1T2KA 2MLKA 5EF6A 3C7JA 2LSOA 5EGOB 2MLGA 5KAFC 3G73A 2K9QA 3S32A 1MDMA 1IAWA 2IGKA 5ILVA 4XKWA 4LLNA 1R23A 1BI1A 1R49A 1MIJA 2BW3B 4XLAA 3PASA 1I6XA 5J1RA 3S1RJ 2UXXA 5A2QK 3TW7A 1OCPA 1JXSA 3HRSA 3R61A 4IOCF 4RM3A 2P7VB 3SEQA 1X3UA 1HKQA 2ESHA 2JA5J 1XCBA 4N4NB 5EGOA 2O0YA 1LFBA 5HDKA 1MMAA 4YZEA 3E0JB 3G4SI 2BY0A 5FKMA 2X48A 2H1KA 3B6AA 2VBYA 3KYLA 2QQ9A 2STTA 3IUVA 3QPSA 1B6AA 4AYBN 4GCVA 2NS7A 2M34A 1N25A 2BW3A 3U2RA 3A2KA 1DUXC 3OIQA 3LJLA 4IQJA 2G7SA 2DG7A 2KKOA 1LNWA 4MO7A 2L7FP 4BS9A 4XONA 4HRIA 2MW8A 4UVCA 4LB5A 2IRFG 2IS2A 2NNNA 2CUJA 1TWGJ 2KL4A 1R7JA 1ETQA 4C9YA 2VPRA 5HAWA 3CDHA 3E5XA 4CCKA 5HDNA 3V7RA 2B3WA 4YEJA 3CCJI 5BPDA 2LF7A 3TDUC 3JSOA 2L5QA 2ZCNA 4AM3A 2KZVA 3NNRA 3ISPA 1IN8A 1T08B 2X0LA 1S3JA 1OLTA 4JKZA 4W1UA 1D5YA 1GUUA 1MNEA 2F5DA 4ZYEA 5EZGA 4R8HA 4TV7A 3JREA 3W6VA 1S6LA 3H92A 2P81A 2OD5A 3FF5A 4FT8A 3IH2A 1E3PA 2K27A 4M3GA 3AAFA 2NVUB 2HPMA 5GADJ 2FA5A 1P6RA 4HNTA 2NOGA 4DQ2A 2VE9A 5IP7J 5F6FA 2JPCA 1Z91A 3WTSC 1FJLA 3BOQA 1AOYA 3HUGA 3W6KB 1K78B 4OIPF 5FROA 3QYBA 1Z3YA 2F5EA 3ZQQA 3CCQI 4MIMA 5FLMJ 2R7FA 4M3BA 3VSKA 4L5IA 1FNNA 2A5WA 2P0WA 1WJFA 1F9NA 3IWFA 1IV8A 3G71I 4IHTA 3L2RA 1JHFA 1WPKA 2IGMA 4DGWB 4IVNA 4NQWA 3VOEA 4KA4A 4IHVA 4JX4A 4PUSA 3S93A 2DW4A 5FD6A 3EPZA 2E7WA 3E5UA 4MNUA 2CQNA 1K78A 1DP7P 2M4KA 1WI9A 3KYCB 1BM9A 2DPDA 1WJBA 2VT2A 3IP4B 3SZGA 3LSPA 2F4MB 2W00A 4CZZA 1UFMA 4AIDA 1QBJA 3I64A 1YS6A 4RAZA 3HRMA 1QA6A 1D8JA 1X4PA 4PZJA 1G6NA 2VKVA 3JRHA 1IXSB 2A6EF 3GFLA 1ZRCA 2R7OA 3H0DA 2QCOA 5KVRA 4XR6A 4WIBA 4ENNA 3SWHA 3VVZA 1SFEA 3DPUA 3VYUB 1JTXA 5CVUA 1PUEE 4XNFA 4HBLA 1JT0A 2CJJA 2STWA 1OCRH 4C30A 1JHHA 2CH0A 3PFYA 5A2QZ 1YITI 1ZYRF 2K40A 2EV6A 2E60A 4AUXA 4ME9A 3I9V2 3V4GA 3MZ8A 5IY5H 2NVXJ 3VW2A 3A01B 2DN0A 2CV0A 2PJPA 1X1PA 3NXCA 3OS0A 2M5WA 1V4RA 3K1NA 1JKOC 1EKEA 2ETHA 3T5XA 1R4NB 4RM2A 5HODA 3VIBA 1YQAA 3ZGKA 3UKGA 1PP8F 1SFXA 1WJCA 4KITB 1X1DA 5HBUA 3ROUA 3EUAA 4Q4ZF 3O2PE 1RR8C 1GVDA 4G7OF 5BOXA 1XS9A 2H27A 2XAJA 3F8BA 4AIHA 4RGSA 5GAHJ 2OPTA 1W0TA 3AL0B 3E3VA 5ILUA 3HSRA 2JRMA 3BG3A 2OUMA 2OI8A 2FBIA 3VYSB 3OYGA 4IXAA 3REOA 2QEXI 3GUDA 2ZFWA 4OU0A 1FEXA 3HDDA 5K5RA 2P6TA 1S5LC 4U87A 1QHHD 2AHQA 4RGUA 5LHHA 1NG6A 2CO5A 2F5FA 2QZ8A 4IEJA 1MNDA 3RH2A 2Y9YA 1XMKA 2FSWA 2IVMA 1LVAA 1VI0A 1TC3C 5E8GA 4BQQA 1QQIA 2HKXA 3D5SC 2YS9A 4MXMA 5D19A 3QAHA 1WGXA 2CW8A 1MSFC 3HHHA 1ULYA 2IS6A 2P5LC 2YX7A 3BQZA 5D4RA 3FXRA 5GPAA 3LA7A 4II3A 2FNPA 3R60A 1YS7A 2BZTA 4HW0A 3LFKA 1IN7A 3NRGA 2GOXB 2BEOA 4LLLA 2DFHA 3AL0C 4NC6A 1DQUA 4CXFA 4IF4A 4P55A 4KWAA 2EIMH 3KEOA 3BLYA 1E17A 3RZDJ 1IDZA 3P5JA 4MEYF 4LB6B 2HOAA 3S3NA 4XN3A 3M4OJ 1O57A 3ZN1A 3FXQA 3NARA 3HSFA 4BBSJ 3CLOA 3DFGA 1D0YA 4HYEA 2R4GA 1IN4A 2FBHA 4UV9A 2G0EA 1FOYA 3KLOA 4ZZDA 4UHTA 1T6SA 2L9VA 4MQ9F 2X6YA 2JUGA 2KIQA 4U0WA 4ZYDA 3PO3J 1U8BA 5ICCA 5FGLA 1P7IA 1XMXA 5BMZA 4IPAA 1XN7A 3TL4X 3WG9A 1T56A 2K4BA 1O3RA 1VQ7I 1R5ID 1BBYA 5LGNA 2UXPA 2UXIA 3QRFF 2YVXA 3WTWC 3F8CA 1W5TA 5GAEJ 2ZSIB 1USSA 3M1EA 2R7VA 2GIZA 3TOAA 2G7HA 1Q1VA 1BI0A 1FIPA 2ZXJA 1X1CA 3FXUA 3CJTB 3DPTA 2VC0A 1L0OC 3BZCA 1Q1HA 2O6GE 1SD4A 3S1MJ 2Z2SB 3S3OA 2VKHA 5ED4A 3HM5A 4EVIA 2DLLA 1IZ1A 4G8XA 4XOTA 3BR1A 4HQEA 4WF2A 1GVJA 2HXOA 4ZYGA 3F22A 2A6HF 1KU3A 2CMPA 5B3SH 3CC2I 1B1BA 1VQ6I 2CU7A 2B7EA 4I7HA 2NP5A 2ICWG 3I58A 1F1ZA 4UY8I 2DA2A 1MBJA 9ANTA 2QSGX 2DT5A 2GZWA 3BJAA 3VVYA 2JVHA 2LKPA 2JN6A 2L9NA 3OSFA 1IN5A 2RN7A 3BR3A 1GXPA 3MEXA 2X6WA 1VZ0A 3JTGA 3SJMA 5TRDA 4A5NA 2KQRA 1YE9A 2ZMEB 3FBIB 2ECBA 1UG0A 3D1NI 4HF1A 2PEXA 1BJAA 2Q24A 1QRYA 4R79A 1XDUA 1BN5A 4WXDA 1BR1A 4L62A 4BJTA 4OAYA 1KU2A 4KIFA 2B9SA 1TWAJ 5IOZA 2L7KA 2OAZA 3Q3SA 3AKZA 2F5CA 4XN0A 1ZHFA 4GRIA 2JTVA 2NXNB 4FX0A 3BTLA 2ZMEA 5E1ZB 2W24A 1ETKA 3GFIA 2L9RA 4ZC3A 3BPVA 3PQJA 1MH3A 1JUMA 4DJAA 2I5UA 2RHAA 2M9HA 5CYVA 3L2CA 3A0HC 5F27A 4CCNA 5IP9J 1T38A 1FY7A 1R58A 1XTAA 2EV0A 3DV8A 4LGWA 2K02A 5DD4A 1X2MA 2G7UA 3IUOA 1TQPA 1LKXA 1ZRFA 5CXGA 3MNLA 2M7AA 2E2HJ 1ZR2A 3DPLC
chains in the Genus database with same CATH topology
2X9DA 3DEWA 3JRFA 3S5RA 3EGQA 5IPAA 4CGRA 2E19A 3BHQA 1UHSA 3S2HJ 3EUPA 3BG5A 3TP3A 1NK3P 2FBQA 3PPBA 4DZJA 1GV2A 3HEFA 4GCTA 2XPVA 3DCFA 1B8IB 2E1OA 4ACIA 2FQ4A 5F1JA 5IYCJ 1BW5A 1ZQ3P 2JK3A 5E3NA 4X1EA 4UUTA 1MNMC 2E2IJ 4JL3A 3ON2A 2R5YB 2YVEA 3F0CA 3BCGA 5EFYA 1IUFA 1VNDA 3RQIA 3MKLA 2QOPA 1XC5A 2EZKA 1U78A 2Y0SN 5E3MA 1RESA 1Z77A 2DG8A 5EG0B 2ME0A 3ZQGA 4UUSB 4A3EJ 1R9TJ 1B8IA 2L7MP 1MBKA 5J1UA 1YRNB 2DJNA 3BTIA 1HDPA 4FE7A 2VI6A 3HB9A 1U9OA 2GM4A 2MG4A 4C3IJ 3JRBA 3GTJJ 1IJWC 2GLOA 4ICHA 1ETWA 2AO9A 3GTMJ 1IV6A 3VW1A 1TWHJ 2MGQA 3H0GJ 4D5CA 2R5YA 3G1MA 2REKA 2NS8A 5D1RA 1HOMA 4A3KJ 2FX0A 3VOKA 3NAUA 3JRDA 5EEAA 2KDZA 2G7LA 3S17J 2ZCXA 5K7ZA 1IDYA 3BR5A 1POGA 3A02A 1WH7A 3DPJA 2CQXA 3G1LA 4UUSA 3VW0A 1K83J 1YRNA 2I10A 2JA7J 2D6YA 3VUQA 2H8RA 1Y1WJ 3NPIA 2YU9J 3T6NA 3JR9A 1UI5A 4XRMA 5E3OA 5FJ8J 3ZQCA 4A93J 5CW8A 3SFIA 5EF6A 5EGOB 5F08A 5H9TA 1GT0C 2DA4A 2K9QA 3I4MJ 3S15J 4GFLA 4CYCB 1IRZA 3V78A 5JLWA 2ZOZA 4HKUA 3VPRA 2DMTA 2NX4A 1BJZA 2DA6A 3PASA 4I76A 2O7OA 5J1RA 3S1RJ 3TW7A 1OCPA 2LK2A 5GPCA 4FTHA 4EEFG 1H88C 4M3FA 1QPIA 5C4XJ 4IHXA 3CQZJ 4MFDA 2M8GX 1FTTA 2JA5J 5EGOA 5F0HA 1LFBA 4YZEA 4MK6A 4CYCA 1JJ8C 5IP6A 5FKMA 2X48A 2DMUA 3B6AA 1QVTA 4DYCA 2H1KA 3AQSA 5J3LA 2JA6J 4D7MA 5K7FA 1JKRC 3IUVA 3QPSA 4AYBN 2NS7A 3OIOA 2M34A 1HDDC 3KKDA 2NP3A 3LJLA 1BA5A 4A3MJ 3CWRA 2ZOYA 2G7SA 2RASA 3PM1A 2DG7A 1I50J 4MO7A 2L7FP 2GFNA 3FRQA 4A3IJ 2MW8A 1LE8B 5FKKA 4XICA 2CRGA 3TW6A 2Y9ZA 1TWGJ 3VP5A 5CXIA 2MSYA 1ETQA 1MH4A 2IAIA 3QBMA 2VPRA 5HAWA 3MN2A 4B3AA 3G1OA 2QKOA 4A69C 4AC0A 2GBYA 2ZCNA 4BY1J 3JRAA 2COBA 5IOYA 1H89C 2W53A 3NNRA 3AQTA 1AHDP 1IG7A 4M3EA 1EF4A 2R93J 2R7ZJ 3S14J 4JKZA 4W1UA 1D5YA 1GUUA 1RKTA 3HTJA 2K9NA 2NVQJ 5EZGA 3JREA 1NTCA 3W6VA 4MLOA 3P9TA 1JUSA 1TWCJ 1ETXA 2P81A 4NDLA 3KNWA 3LWJA 2XRLA 4Y7NJ 3WHBA 1HCRA 1ORKA 2OERA 3IH2A 3HBLA 4M3GA 4GFKA 3B6CA 1IGNA 2FD5A 3K7AJ 2XGEA 5D18A 1TWFJ 2NOGA 1S7EA 2TRTA 5IP7J 3ZQFA 1X58A 2R5ZB 3JRIA 3H3VK 1FJLA 1K61A 4A3BJ 4IHWA 5AQCA 4AF5A 3O8HA 2IEKA 3ZQLA 4MIMA 5FLMJ 1B72B 4M3BA 3HKZN 3OOUA 2PBXA 4FCYA 4JX5A 1OJLA 2ID6A 1WPKA 3BR0A 2G3BA 2DA5A 4IHVA 5E3LA 4JX4A 1RKWA 1FIAA 2XGDA 2HDDA 5BNGA 1OFCX 4BKXA 5F0CA 1ZR4A 2UXHA 3LHQA 4NN1A 1Y1VJ 5C3EJ 3E7LA 2D5VA 1MSEC 4C3JJ 1UI6A 1B72A 2TCTA 5JLXA 1HLVA 1I3QJ 3HGGA 1UMQA 2EZLA 2LP0A 3LSPA 3O8GA 4BBRJ 2DMPA 5M5XJ 2QIBA 3PO2J 2W48A 4A3FJ 2YUSA 1IC8A 5EG0A 2WV1A 4QSHA 4G12A 1DU0A 1MBFA 5IYBJ 5C44J 2LVSA 1U9NA 3GTQJ 5DS9A 1ITYA 2VKVA 3JRHA 2G7GA 2NVYJ 3WHCA 4W97A 3TEDA 3QQAA 2QCOA 3KKCA 3VVZA 1JTXA 3HOXJ 1VF9A 2O8KA 1ENHA 1JT0A 2CJJA 3MVPA 1FTZA 4MFEA 1OCTC 3L1PA 3GTKJ 2K40A 1H8AC 3FIWA 2JWTA 3I4NJ 4AUXA 4ME9A 3GTOJ 5K58A 4PXIA 1ZGWA 2X6OA 2NVXJ 3LSGA 4DZPA 3F1BA 2XPUA 3A01B 3JRGA 3VW2A 3ZOBA 4HNVA 2JA8J 2DA3A 2DN0A 2E2JJ 2GUHA 3NXCA 1PUFB 1JKOC 4GCLA 3O60A 2DA7A 5HODA 3ZQIA 3RD3A 3VIBA 4S0HB 4JNNA 3UKGA 2DTZA 4JX6A 3S16J 5HBUA 3BJBA 3BT9A 3Q0WA 1GVDA 4B1RA 1XS9A 4GCKA 3ZQHA 3OSGA 1W0TA 2OPTA 3VVXA 2LFBA 1WH5A 1XG1A 3BG3A 1PUFA 2HKUA 2OI8A 4BY7J 1APLC 1MBGA 1W0UA 3HOZJ 3C2BA 1LFUP 1MBEA 1WI3A 5FHPA 2EH3A 1WCMJ 5FKLA 3S1NJ 1FEXA 3HDDA 2QTQA 2HYJA 2AHQA 3BTCA 5C4JJ 2M0CA 2NVTJ 3HE0A 4IEJA 2VUMJ 3RH2A 1LE8A 2Y9YA 2O9LA 1ZTRA 2HXIA 1VI0A 2EZHA 1TC3C 2V57A 1RPWA 3BRUA 3BTJA 2RAEA 2YS9A 4MXMA 5D19A 5EZHA 4RDUA 4D7NA 1WGXA 1JKQC 3HOVJ 1MSFC 2ZCMA 3CJDA 4IHYA 4A3DJ 1I6HJ 3SDGA 3BQZA 3GTGJ 3LNQA 3IV5A 1AU7A 5GPAA 2CUEA 3NRGA 1NK2P 1ETYA 4XIDA 3B81A 1E3OC 2EBIA 4KWAA 3NI7A 1MBHA 5K7HA 4I6ZA 2F07A 2EZIA 3RZDJ 4XRSG 4QIWN 1IDZA 5M5WJ 2B63J 2HOAA 4C3HJ 5FMPA 1GDTA 2R5ZA 2XB5A 5HSZA 3M4OJ 4L62A 1Z0XA 3NARA 4JP0A 4RBOA 4BBSJ 2LR8A 5FKNA 3BG9A 2UXOA 3KZ9A 3CCYA 1SFOJ 2M2EA 4LOCA 1BL0A 2G0EA 2LD5A 2XB0X 4A3JJ 4GFBA 2CUFA 1JJ6C 2R92J 2CQQA 1JUPA 2XDNA 3E7QA 5M3FJ 1T33A 3PO3J 1U8BA 3COLA 5FGLA 1A6IA 1P7IA 2VKEA 3BR2A 3VOXA 3GZIA 1T56A 2WGBA 2WUIA 2UXPA 4V2FA 2UXIA 4AC6A 4XRSA 3K2AA 5DAJA 2OF7A 3Q0UA 5FLVA 4QTRA 1Q1VA 2JJ7A 3HGYA 3QKXA 5EDNA 2GENA 1FIPA 4C2MJ 5DTDA 2HOTA 1F43A 1RR7A 4JYKA 4D5FA 3S1MJ 2UXUA 3HM5A 3QPLA 3C07A 4J19A 1AKHB 1BW6A 3BR1A 2HXOA 3CDLA 5F04A 2ID3A 1A5JA 1X2NA 1P7JA 2Y31A 3FK6A 3ANGA 2ECCA 2YVHA 4NELA 2DMNA 1G2HA 3G56A 2HYTA 4DW6A 2LY9A 2CU7A 1GV5A 4A3LJ 5FKOA 5IYDJ 2IBDA 2NP5A 2HI3A 4XK4A 3ON4A 1ETOA 2DA2A 1MBJA 2XGCA 9ANTA 3GEUA 2LLKA 3VVYA 1AKHA 3CMYA 2JN6A 2WAQN 3GBGA 3OSFA 4FE4A 5M5YJ 3BR3A 3HTAA 4L5EA 3LOCA 2ME6A 1HF0A 1CQTA 4FISA 2JMWA 1ETVA 5C4YA 3A01A 3HTHA 4ABZA 3SJMA 3FKIJ 3V6GA 1SGMA 2LTPA 2L7ZA 2Y2ZA 4Y52J 5F0FA 2WB1N 1VFCA 2O7TA 2ECBA 3JSJA 1ZKGA 1SANA 1UG2A 2ELKA 3TP0A 5J1YA 3D1NI 3GTLJ 3FISA 3LSJA 2Q24A 1QRYA 5EYRA 1JKPC 3RKQA 1RETA 4B4CA 3HOWJ 4A3CJ 3ANPA 3HOYJ 4DYQA 1O4XA 1TWAJ 2K9SA 3A03A 5IOZA 1DU6A 3M3YJ 3Q3SA 2HOSA 3IH4A 3Q0VA 5M3MJ 4M3DA 2HQ5A 1JGGA 2DA1A 3G7RA 1JT6A 2Y30A 3BTLA 2KT0A 3HOUJ 2ZB9A 3LSRA 4X6AJ 2QWTA 1ETKA 3JRCA 5GP9A 2N8GA 3BR6A 2EQRA 2L9RA 2PZ9A 1MH3A 3HTIA 2PMZN 4M6VA 1JUMA 2R0QC 3IH3A 3S1QJ 2RHAA 3BNIA 2M9HA 4BXXJ 4UDSA 3S2DJ 3HIMA 5F27A 1JTYA 5IP9J 1QVUA 3RZOJ 2XPWA 4DYRA 2QF7A 3FK7A 3GTPJ 1F36A 2XSDC 4V2GA 1X2MA 3CRJA 2LKXA 2DMQA 2L0KA 5CXGA 3BQYA 3MNLA 4A3GJ 1ZK8A 2E2HJ 1ZR2A 2IU5A 2FJ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X9D A;  3DEW A;  3JRF A;  3S5R A;  3EGQ A;  5IPA A;  4CGR A;  2E19 A;  3BHQ A;  1UHS A;  3S2H J;  3EUP A;  3BG5 A;  3TP3 A;  1NK3 P;  2FBQ A;  3PPB A;  4DZJ A;  1GV2 A;  3HEF A;  4GCT A;  2XPV A;  3DCF A;  1B8I B;  2E1O A;  4ACI A;  2FQ4 A;  5F1J A;  5IYC J;  1BW5 A;  1ZQ3 P;  2JK3 A;  5E3N A;  4X1E A;  4UUT A;  1MNM C;  2E2I J;  4JL3 A;  3ON2 A;  2R5Y B;  2YVE A;  3F0C A;  3BCG A;  5EFY A;  1IUF A;  1VND A;  3RQI A;  3MKL A;  2QOP A;  1XC5 A;  2EZK A;  1U78 A;  2Y0S N;  5E3M A;  1RES A;  1Z77 A;  2DG8 A;  5EG0 B;  2ME0 A;  3ZQG A;  4UUS B;  4A3E J;  1R9T J;  1B8I A;  2L7M P;  1MBK A;  5J1U A;  1YRN B;  2DJN A;  3BTI A;  1HDP A;  4FE7 A;  2VI6 A;  3HB9 A;  1U9O A;  2GM4 A;  2MG4 A;  4C3I J;  3JRB A;  3GTJ J;  1IJW C;  2GLO A;  4ICH A;  1ETW A;  2AO9 A;  3GTM J;  1IV6 A;  3VW1 A;  1TWH J;  2MGQ A;  3H0G J;  4D5C A;  2R5Y A;  3G1M A;  2REK A;  2NS8 A;  5D1R A;  1HOM A;  4A3K J;  2FX0 A;  3VOK A;  3NAU A;  3JRD A;  5EEA A;  2KDZ A;  2G7L A;  3S17 J;  2ZCX A;  5K7Z A;  1IDY A;  3BR5 A;  1POG A;  3A02 A;  1WH7 A;  3DPJ A;  2CQX A;  3G1L A;  4UUS A;  3VW0 A;  1K83 J;  1YRN A;  2I10 A;  2JA7 J;  2D6Y A;  3VUQ A;  2H8R A;  1Y1W J;  3NPI A;  2YU9 J;  3T6N A;  3JR9 A;  1UI5 A;  4XRM A;  5E3O A;  5FJ8 J;  3ZQC A;  4A93 J;  5CW8 A;  3SFI A;  5EF6 A;  5EGO B;  5F08 A;  5H9T A;  1GT0 C;  2DA4 A;  2K9Q A;  3I4M J;  3S15 J;  4GFL A;  4CYC B;  1IRZ A;  3V78 A;  5JLW A;  2ZOZ A;  4HKU A;  3VPR A;  2DMT A;  2NX4 A;  1BJZ A;  2DA6 A;  3PAS A;  4I76 A;  2O7O A;  5J1R A;  3S1R J;  3TW7 A;  1OCP A;  2LK2 A;  5GPC A;  4FTH A;  4EEF G;  1H88 C;  4M3F A;  1QPI A;  5C4X J;  4IHX A;  3CQZ J;  4MFD A;  2M8G X;  1FTT A;  2JA5 J;  5EGO A;  5F0H A;  1LFB A;  4YZE A;  4MK6 A;  4CYC A;  1JJ8 C;  5IP6 A;  5FKM A;  2X48 A;  2DMU A;  3B6A A;  1QVT A;  4DYC A;  2H1K A;  3AQS A;  5J3L A;  2JA6 J;  4D7M A;  5K7F A;  1JKR C;  3IUV A;  3QPS A;  4AYB N;  2NS7 A;  3OIO A;  2M34 A;  1HDD C;  3KKD A;  2NP3 A;  3LJL A;  1BA5 A;  4A3M J;  3CWR A;  2ZOY A;  2G7S A;  2RAS A;  3PM1 A;  2DG7 A;  1I50 J;  4MO7 A;  2L7F P;  2GFN A;  3FRQ A;  4A3I J;  2MW8 A;  1LE8 B;  5FKK A;  4XIC A;  2CRG A;  3TW6 A;  2Y9Z A;  1TWG J;  3VP5 A;  5CXI A;  2MSY A;  1ETQ A;  1MH4 A;  2IAI A;  3QBM A;  2VPR A;  5HAW A;  3MN2 A;  4B3A A;  3G1O A;  2QKO A;  4A69 C;  4AC0 A;  2GBY A;  2ZCN A;  4BY1 J;  3JRA A;  2COB A;  5IOY A;  1H89 C;  2W53 A;  3NNR A;  3AQT A;  1AHD P;  1IG7 A;  4M3E A;  1EF4 A;  2R93 J;  2R7Z J;  3S14 J;  4JKZ A;  4W1U A;  1D5Y A;  1GUU A;  1RKT A;  3HTJ A;  2K9N A;  2NVQ J;  5EZG A;  3JRE A;  1NTC A;  3W6V A;  4MLO A;  3P9T A;  1JUS A;  1TWC J;  1ETX A;  2P81 A;  4NDL A;  3KNW A;  3LWJ A;  2XRL A;  4Y7N J;  3WHB A;  1HCR A;  1ORK A;  2OER A;  3IH2 A;  3HBL A;  4M3G A;  4GFK A;  3B6C A;  1IGN A;  2FD5 A;  3K7A J;  2XGE A;  5D18 A;  1TWF J;  2NOG A;  1S7E A;  2TRT A;  5IP7 J;  3ZQF A;  1X58 A;  2R5Z B;  3JRI A;  3H3V K;  1FJL A;  1K61 A;  4A3B J;  4IHW A;  5AQC A;  4AF5 A;  3O8H A;  2IEK A;  3ZQL A;  4MIM A;  5FLM J;  1B72 B;  4M3B A;  3HKZ N;  3OOU A;  2PBX A;  4FCY A;  4JX5 A;  1OJL A;  2ID6 A;  1WPK A;  3BR0 A;  2G3B A;  2DA5 A;  4IHV A;  5E3L A;  4JX4 A;  1RKW A;  1FIA A;  2XGD A;  2HDD A;  5BNG A;  1OFC X;  4BKX A;  5F0C A;  1ZR4 A;  2UXH A;  3LHQ A;  4NN1 A;  1Y1V J;  5C3E J;  3E7L A;  2D5V A;  1MSE C;  4C3J J;  1UI6 A;  1B72 A;  2TCT A;  5JLX A;  1HLV A;  1I3Q J;  3HGG A;  1UMQ A;  2EZL A;  2LP0 A;  3LSP A;  3O8G A;  4BBR J;  2DMP A;  5M5X J;  2QIB A;  3PO2 J;  2W48 A;  4A3F J;  2YUS A;  1IC8 A;  5EG0 A;  2WV1 A;  4QSH A;  4G12 A;  1DU0 A;  1MBF A;  5IYB J;  5C44 J;  2LVS A;  1U9N A;  3GTQ J;  5DS9 A;  1ITY A;  2VKV A;  3JRH A;  2G7G A;  2NVY J;  3WHC A;  4W97 A;  3TED A;  3QQA A;  2QCO A;  3KKC A;  3VVZ A;  1JTX A;  3HOX J;  1VF9 A;  2O8K A;  1ENH A;  1JT0 A;  2CJJ A;  3MVP A;  1FTZ A;  4MFE A;  1OCT C;  3L1P A;  3GTK J;  2K40 A;  1H8A C;  3FIW A;  2JWT A;  3I4N J;  4AUX A;  4ME9 A;  3GTO J;  5K58 A;  4PXI A;  1ZGW A;  2X6O A;  2NVX J;  3LSG A;  4DZP A;  3F1B A;  2XPU A;  3A01 B;  3JRG A;  3VW2 A;  3ZOB A;  4HNV A;  2JA8 J;  2DA3 A;  2DN0 A;  2E2J J;  2GUH A;  3NXC A;  1PUF B;  1JKO C;  4GCL A;  3O60 A;  2DA7 A;  5HOD A;  3ZQI A;  3RD3 A;  3VIB A;  4S0H B;  4JNN A;  3UKG A;  2DTZ A;  4JX6 A;  3S16 J;  5HBU A;  3BJB A;  3BT9 A;  3Q0W A;  1GVD A;  4B1R A;  1XS9 A;  4GCK A;  3ZQH A;  3OSG A;  1W0T A;  2OPT A;  3VVX A;  2LFB A;  1WH5 A;  1XG1 A;  3BG3 A;  1PUF A;  2HKU A;  2OI8 A;  4BY7 J;  1APL C;  1MBG A;  1W0U A;  3HOZ J;  3C2B A;  1LFU P;  1MBE A;  1WI3 A;  5FHP A;  2EH3 A;  1WCM J;  5FKL A;  3S1N J;  1FEX A;  3HDD A;  2QTQ A;  2HYJ A;  2AHQ A;  3BTC A;  5C4J J;  2M0C A;  2NVT J;  3HE0 A;  4IEJ A;  2VUM J;  3RH2 A;  1LE8 A;  2Y9Y A;  2O9L A;  1ZTR A;  2HXI A;  1VI0 A;  2EZH A;  1TC3 C;  2V57 A;  1RPW A;  3BRU A;  3BTJ A;  2RAE A;  2YS9 A;  4MXM A;  5D19 A;  5EZH A;  4RDU A;  4D7N A;  1WGX A;  1JKQ C;  3HOV J;  1MSF C;  2ZCM A;  3CJD A;  4IHY A;  4A3D J;  1I6H J;  3SDG A;  3BQZ A;  3GTG J;  3LNQ A;  3IV5 A;  1AU7 A;  5GPA A;  2CUE A;  3NRG A;  1NK2 P;  1ETY A;  4XID A;  3B81 A;  1E3O C;  2EBI A;  4KWA A;  3NI7 A;  1MBH A;  5K7H A;  4I6Z A;  2F07 A;  2EZI A;  3RZD J;  4XRS G;  4QIW N;  1IDZ A;  5M5W J;  2B63 J;  2HOA A;  4C3H J;  5FMP A;  1GDT A;  2R5Z A;  2XB5 A;  5HSZ A;  3M4O J;  4L62 A;  1Z0X A;  3NAR A;  4JP0 A;  4RBO A;  4BBS J;  2LR8 A;  5FKN A;  3BG9 A;  2UXO A;  3KZ9 A;  3CCY A;  1SFO J;  2M2E A;  4LOC A;  1BL0 A;  2G0E A;  2LD5 A;  2XB0 X;  4A3J J;  4GFB A;  2CUF A;  1JJ6 C;  2R92 J;  2CQQ A;  1JUP A;  2XDN A;  3E7Q A;  5M3F J;  1T33 A;  3PO3 J;  1U8B A;  3COL A;  5FGL A;  1A6I A;  1P7I A;  2VKE A;  3BR2 A;  3VOX A;  3GZI A;  1T56 A;  2WGB A;  2WUI A;  2UXP A;  4V2F A;  2UXI A;  4AC6 A;  4XRS A;  3K2A A;  5DAJ A;  2OF7 A;  3Q0U A;  5FLV A;  4QTR A;  1Q1V A;  2JJ7 A;  3HGY A;  3QKX A;  5EDN A;  2GEN A;  1FIP A;  4C2M J;  5DTD A;  2HOT A;  1F43 A;  1RR7 A;  4JYK A;  4D5F A;  3S1M J;  2UXU A;  3HM5 A;  3QPL A;  3C07 A;  4J19 A;  1AKH B;  1BW6 A;  3BR1 A;  2HXO A;  3CDL A;  5F04 A;  2ID3 A;  1A5J A;  1X2N A;  1P7J A;  2Y31 A;  3FK6 A;  3ANG A;  2ECC A;  2YVH A;  4NEL A;  2DMN A;  1G2H A;  3G56 A;  2HYT A;  4DW6 A;  2LY9 A;  2CU7 A;  1GV5 A;  4A3L J;  5FKO A;  5IYD J;  2IBD A;  2NP5 A;  2HI3 A;  4XK4 A;  3ON4 A;  1ETO A;  2DA2 A;  1MBJ A;  2XGC A;  9ANT A;  3GEU A;  2LLK A;  3VVY A;  1AKH A;  3CMY A;  2JN6 A;  2WAQ N;  3GBG A;  3OSF A;  4FE4 A;  5M5Y J;  3BR3 A;  3HTA A;  4L5E A;  3LOC A;  2ME6 A;  1HF0 A;  1CQT A;  4FIS A;  2JMW A;  1ETV A;  5C4Y A;  3A01 A;  3HTH A;  4ABZ A;  3SJM A;  3FKI J;  3V6G A;  1SGM A;  2LTP A;  2L7Z A;  2Y2Z A;  4Y52 J;  5F0F A;  2WB1 N;  1VFC A;  2O7T A;  2ECB A;  3JSJ A;  1ZKG A;  1SAN A;  1UG2 A;  2ELK A;  3TP0 A;  5J1Y A;  3D1N I;  3GTL J;  3FIS A;  3LSJ A;  2Q24 A;  1QRY A;  5EYR A;  1JKP C;  3RKQ A;  1RET A;  4B4C A;  3HOW J;  4A3C J;  3ANP A;  3HOY J;  4DYQ A;  1O4X A;  1TWA J;  2K9S A;  3A03 A;  5IOZ A;  1DU6 A;  3M3Y J;  3Q3S A;  2HOS A;  3IH4 A;  3Q0V A;  5M3M J;  4M3D A;  2HQ5 A;  1JGG A;  2DA1 A;  3G7R A;  1JT6 A;  2Y30 A;  3BTL A;  2KT0 A;  3HOU J;  2ZB9 A;  3LSR A;  4X6A J;  2QWT A;  1ETK A;  3JRC A;  5GP9 A;  2N8G A;  3BR6 A;  2EQR A;  2L9R A;  2PZ9 A;  1MH3 A;  3HTI A;  2PMZ N;  4M6V A;  1JUM A;  2R0Q C;  3IH3 A;  3S1Q J;  2RHA A;  3BNI A;  2M9H A;  4BXX J;  4UDS A;  3S2D J;  3HIM A;  5F27 A;  1JTY A;  5IP9 J;  1QVU A;  3RZO J;  2XPW A;  4DYR A;  2QF7 A;  3FK7 A;  3GTP J;  1F36 A;  2XSD C;  4V2G A;  1X2M A;  3CRJ A;  2LKX A;  2DMQ A;  2L0K A;  5CXG A;  3BQY A;  3MNL A;  4A3G J;  1ZK8 A;  2E2H J;  1ZR2 A;  2IU5 A;  2FJ1 A; 
#chains in the Genus database with same CATH topology
 3DEU A;  3DEW A;  3JRF A;  2DFI A;  2VQL A;  2ZME C;  5L3C A;  5E20 A;  2LF8 A;  3BY6 A;  3BG5 A;  3G2B A;  3TP3 A;  2BOL A;  1WHU A;  3GZ6 A;  1BR2 A;  1GV2 A;  3HEF A;  3RPQ A;  4ASN A;  1F5T A;  5HDG A;  4LG0 B;  1MJ9 A;  2RC4 A;  2A3S A;  4Q48 A;  2ZJQ F;  4BU2 A;  4L18 B;  3V42 A;  1P9Q C;  4B44 A;  1W4M A;  1MNM C;  4JL3 A;  3WTY C;  2R5Y B;  3F0C A;  2F2E A;  4D1Q A;  3RQI A;  2QKM B;  1IO2 A;  4YRV A;  4Y15 A;  5E3M A;  2DG8 A;  2M7B A;  1YOV B;  1XDS A;  1IN6 A;  4LK0 F;  4A3E J;  1X1B A;  5DYM A;  4LG0 A;  1O7L A;  2E71 A;  1YRN B;  2W7N A;  3DU6 A;  3U1K A;  2A2F X;  2CFX A;  1XPX A;  1YYV A;  2W84 A;  3M1C A;  3ABU A;  3LQR A;  3GTJ J;  2GLO A;  1ETW A;  5J4Y A;  2MGQ A;  2R5Y A;  3OMY A;  3IRR A;  3CO6 C;  4IHS A;  3RQ4 A;  3JRD A;  3QU6 A;  2KDZ A;  4S04 A;  1POG A;  3W2W A;  3A02 A;  1Z67 A;  2DPU A;  1A31 A;  2IU5 A;  4ESB A;  3G1L A;  1WJE A;  2DT6 A;  2FMY A;  3VW0 A;  4OWR B;  2DFF A;  1YRN A;  3CMA I;  4MTD A;  2GWR A;  4KIG A;  3WTX C;  2D6Y A;  1Y1W J;  3FM3 A;  3T6N A;  4BL0 B;  3ZMZ A;  3Q9V A;  3JR9 A;  2ZNY A;  2LYC A;  3ZQC A;  2VQC A;  2P4W A;  1KYW A;  2HOE A;  2V6C A;  4EAT A;  3IC7 A;  1GT0 C;  1FBU A;  2B1E A;  3S15 J;  2IS1 A;  3CJQ B;  1QU3 A;  1RI7 A;  3PNT A;  3CJN A;  1GXQ A;  4YEL A;  3RPU D;  2VOP A;  2JPB A;  4HKU A;  2DMT A;  3BZ6 A;  1BJZ A;  3F3X A;  2LK2 A;  2HQA A;  2Q1Z B;  2VL8 A;  4KMU X;  4EEF G;  2KIM A;  5K5Q A;  4FTH A;  4MFD A;  1D5V A;  1A36 A;  3LA3 A;  2M8G X;  4CO8 A;  1QZY A;  1T39 A;  4UNO A;  2ZY9 A;  3JTH A;  1ZH5 A;  2DO7 A;  1IRX A;  1FBS A;  1JJ8 C;  1QZZ A;  5IP6 A;  3AQS A;  2Z9O A;  5K7F A;  1JKR C;  3MQ0 A;  1YTY A;  3SYT A;  3E6D A;  2EPF A;  1OYW A;  2XGX A;  4U0Y A;  5H2F C;  5E17 F;  3KKD A;  2NP3 A;  5AON A;  1PDN C;  4A3M J;  2VC1 A;  1J9I A;  2ADU A;  3PFI A;  2K3F A;  3PM1 A;  1I50 J;  3CLQ A;  4G6T B;  4Z2Y A;  3RI4 A;  2MH9 A;  3V8L A;  1OPC A;  5FB2 A;  3WGI A;  4A3I J;  2WB1 A;  4NB5 A;  1LE8 B;  1R71 A;  2BBY A;  4M74 A;  3RIR A;  4CDG A;  4U7D A;  4XKB A;  3UNG C;  3LSI A;  1ZEL A;  3WGG A;  2ESN A;  3MN2 A;  3ASO H;  4IL6 C;  4HEA 2;  4BDY A;  3G1O A;  1K79 A;  2QKO A;  4AC0 A;  3FMR A;  1KQ9 A;  3JRA A;  2JUC A;  2NRA C;  2COB A;  4RAG A;  2Y75 A;  3R0A A;  4IOA F;  1AHD P;  2ZCW A;  1EF4 A;  2R7Z J;  5KK1 A;  1NG7 A;  4OD4 A;  2JVG A;  3BCB A;  4DOZ A;  4N4O B;  1SD7 A;  3SZT A;  1NTC A;  2X1D A;  2XKO A;  4CSW A;  1JUS A;  3N05 A;  1YHQ I;  1WSU A;  4PJJ A;  2QVO A;  4NDL A;  3LWJ A;  2XRL A;  1TNS A;  1ORK A;  3IAM 2;  4GFK A;  3B6C A;  1STZ A;  1VQK I;  1TWF J;  3BG7 A;  3U21 A;  5E1X A;  4WK8 F;  3F8N A;  4JOM A;  2LKS A;  3OYM A;  3CME I;  2IA0 A;  1B9M A;  1I5Z A;  1SVO A;  1KQ0 A;  2A61 A;  1K61 A;  3DKY A;  2IGN A;  5ICG A;  5AQC A;  4AF5 A;  2IEK A;  4L9N A;  1QZE A;  4A6E A;  3HKZ N;  3FMQ A;  2PBX A;  3F6V A;  4FCY A;  4XLF A;  2RV8 A;  2ZO4 A;  4C2M A;  2MA3 A;  4DNC A;  3BR0 A;  2G3B A;  4YFN F;  2DA5 A;  4HZF A;  4BJ6 C;  1N75 A;  4EGY A;  4HDU A;  4E7I A;  5BNG A;  2LOO A;  2LRE A;  5F0C A;  5C3E J;  2BY2 A;  3DQV C;  1WQ2 A;  4GDF A;  4AVP A;  4HAM A;  2TCT A;  1YO5 C;  1HLV A;  5EJC A;  4OMZ A;  2QQ8 A;  2RQP A;  3HSE A;  5FGM A;  2Y0S A;  5M5X J;  1R5H A;  3S2W A;  2WV1 A;  2B0L A;  2ISZ A;  1G3W A;  3QOD A;  2Z33 A;  3DWL E;  5C44 J;  4RMN A;  1IXR C;  2LVS A;  1VQO I;  5CJ9 A;  5AIQ A;  3SZP A;  2LNB A;  3ML6 A;  2EJR A;  5HNF A;  5HS9 A;  1TZL A;  2W1O A;  2NVY J;  3TED A;  3NEU A;  3OYD A;  2IJL A;  4V19 K;  4CYD A;  3KKC A;  1T0F A;  3HC7 A;  3U9G A;  3BDD A;  5EEG A;  1H9G A;  5LGU A;  2O8K A;  4KNY A;  2LY1 A;  1Z9C A;  1FTZ A;  3L2V A;  3GTK J;  4ENK A;  2DXI A;  2V7F A;  2JWT A;  3I4N J;  2LH9 A;  3E5Q A;  4X0G A;  4LG3 A;  3CCR I;  4IRI A;  1ZGW A;  3A4C A;  3LSG A;  1ZAR A;  4Y4R A;  2IW5 A;  1I39 A;  4HNV A;  2L2O A;  2JA8 J;  1UHW A;  4EV0 A;  1ZRE A;  3H5N A;  2E2J J;  3ASN H;  4BE0 A;  2Q0O A;  2LY2 A;  2HYG D;  1LQ1 A;  1T0F C;  1TP4 A;  2EWN A;  3O60 A;  1Y0U A;  3WU0 A;  4ZH4 F;  2VJJ A;  3JW4 A;  2DTZ A;  4JX6 A;  2QLZ A;  2IT0 A;  3SEZ A;  3B02 A;  3EUH A;  2Y48 A;  3KZI C;  3ZQH A;  5LEJ A;  2FJI 1;  2M0M A;  3VVX A;  4HF2 A;  1BR4 A;  4XKC A;  3GCM A;  1R4M B;  1FZP B;  5HNH A;  2HKU A;  4GXO A;  3K4B A;  4Y13 A;  4E7H A;  4BY7 J;  1K6Y A;  2XV4 S;  1APL C;  3HOZ J;  2DU9 A;  1TT0 A;  3R0J A;  3WTT C;  3CP8 A;  3RDI A;  3DKX A;  5FHP A;  1WCM J;  3BP8 A;  5CVJ A;  3EYI A;  3EYY A;  1UAA A;  2HYJ A;  1OCZ H;  4LIT A;  3TDZ C;  1XCV A;  1NHA A;  2W85 A;  3LSM A;  3HE0 A;  2H09 A;  3DLL F;  3EUH C;  2EFQ A;  2O9L A;  2BE5 F;  2HXI A;  2RDP A;  2CWE A;  2XAQ A;  4I98 B;  3W2V A;  1JE8 A;  1SEU A;  5L3F A;  1HW2 A;  4YG2 F;  3FXL A;  3BTJ A;  3H9J A;  3D0S A;  3DXJ F;  4IRV A;  3OY9 A;  2JT1 A;  1TQM A;  5CLS A;  3CJD A;  1KQ8 A;  1S7A A;  4M72 A;  5L3B A;  5DM7 F;  5ICF A;  3V7C A;  4HDV A;  3GTG J;  2A05 A;  4BNC A;  1KU9 A;  2L4M A;  3IV5 A;  3ZMU A;  2DDB A;  1AU7 A;  1TW2 A;  2KJB A;  2BHZ A;  3NQO A;  1ETY A;  4XID A;  4XQF A;  1V5G A;  3S3M A;  5FLX K;  4BHC A;  1H9T A;  3B81 A;  4KUM A;  2EBI A;  3DBR B;  2AXL A;  1MBH A;  4I6Z A;  2EZI A;  4QLC U;  2WY7 Q;  1K7A A;  4IQ4 A;  3SDB A;  3Q9S A;  3ZMV A;  3OYH A;  1U3E M;  5M5W J;  2K4J A;  4F52 A;  4F91 B;  1BIA A;  4C3H J;  2XB5 A;  2LR8 A;  5JFR A;  3K9T A;  4UVB A;  2BXY A;  3CCY A;  4P96 A;  2M2E A;  2XAU A;  3J7Z I;  1BL0 A;  2ISY A;  2LD5 A;  5E1W A;  2MD5 A;  3HRT A;  3I71 A;  2XDN A;  3E7Q A;  1T33 A;  1VQ9 I;  5B1B H;  3N97 A;  3COL A;  1A6I A;  3BJO A;  2VKE A;  4AIK A;  3VOX A;  3F72 A;  3K0L A;  3GZI A;  3F8F A;  3W6J B;  2W25 A;  1HKT A;  1A04 A;  4V2F A;  3LAP A;  1J59 A;  2HVS A;  2RQQ A;  3K2A A;  5CVR A;  1X3Z B;  1PJR A;  3QP5 A;  3K4K A;  5DAJ A;  2OF7 A;  2XF6 A;  2XF5 A;  3Q0U A;  4QTR A;  5FLV A;  2JJ7 A;  3D5L A;  3QKX A;  2GEN A;  4A6D A;  1C0W A;  3X2Q H;  2BVM A;  4ESJ A;  3T8T A;  4EQQ A;  2HOT A;  4DBQ A;  1F43 A;  1RR7 A;  1D1B A;  1SD5 A;  4YII A;  4O6J A;  3N4M A;  4JBA A;  4ON0 A;  3OR2 C;  3E6M A;  3B73 A;  1RNL A;  3PUF A;  3IRQ A;  5F04 A;  1R00 A;  4AU7 A;  3BG6 A;  1LB2 A;  1X2N A;  4L9J A;  4KDP A;  3FK6 A;  4NEL A;  1G2H A;  2PFB A;  3K6G A;  4BAC A;  2LY9 A;  4FQG A;  2UUZ A;  2QSF X;  4A3L J;  5FKO A;  3F6O A;  4ETS A;  5IYD J;  3CCE I;  1MMG A;  2HI3 A;  3ON4 A;  3VSL A;  2XGC A;  1SMT A;  2Y69 H;  2DT7 B;  2QBY B;  1V3F A;  3GBG A;  5M5Y J;  1X4O A;  4NUB A;  4CCM A;  2ME6 A;  1HF0 A;  3H35 A;  4L9V A;  1XSD A;  1CQT A;  2MAB A;  3A01 A;  1G3Y A;  2PQ8 A;  3FX3 A;  2R7R A;  3E6B A;  3V6G A;  2V1D A;  2LTP A;  3C18 A;  2XSJ C;  4Y52 J;  4WCG A;  3IAS 2;  3MZH A;  1FP1 D;  2O7T A;  2FUG 2;  2LBF B;  2PMH A;  1UG2 A;  1B9N A;  3SXY A;  3FIS A;  4BQO A;  3LSJ A;  2J5P A;  5JI6 A;  4UUV A;  4EM0 B;  1RRJ A;  4XOR A;  2QBY A;  1IRG A;  3CCV I;  4DIQ A;  2KIS A;  4B4C A;  1J2X A;  1S7O A;  5FFZ A;  5J4V A;  1EH8 A;  3RKY A;  4Q47 A;  1X19 A;  4DYQ A;  4RS8 A;  1O4X A;  3EET A;  5JHF A;  3M3Y J;  4LK1 F;  2WBM A;  5M3M J;  2QWW A;  3LL7 A;  2DA1 A;  1BI3 A;  2Y30 A;  2WAD A;  2MYS A;  3DTE A;  2LBF A;  2ZB9 A;  3TBI A;  4D0P A;  3NWT A;  2ZJR F;  4X6A J;  5GP9 A;  2ZXH A;  1ZGA A;  1MKM A;  3BR6 A;  2WY8 Q;  2J5O A;  2R0Q C;  3KP3 A;  3MCZ A;  2DTR A;  3JCU C;  4E7K A;  1G59 A;  3IWZ A;  3P7N A;  1U5T B;  3W2A A;  3S2D J;  3HIM A;  4G7H F;  2Z3Y A;  2XPW A;  5IT3 A;  4DYR A;  2KFD A;  4DBR A;  5B1A H;  3FK7 A;  1GHC A;  3GTP J;  2Y0M A;  1F36 A;  3KPH A;  2XSD C;  5FLX Z;  1OMI A;  1U2W A;  2LKX A;  1ZG5 A;  5DCM B;  3VYT B;  1E2X A;  4E7S A;  4KIB A;  2V4J C;  3OS1 A;  2FJ1 A;  3J7A Y;  4CGR A;  3QOE A;  3BHQ A;  2FML A;  1FYK A;  3EUP A;  2EIN H;  4RB1 A;  4E7J A;  2D45 A;  1NK3 P;  1VQ5 I;  3PPB A;  4U9L A;  2PBI A;  4OD5 A;  2M3A A;  3BWG A;  2QA4 I;  1RZ4 A;  2I8D A;  4G7Z F;  4ACI A;  2WAE A;  5D8L B;  1VQL I;  5CQE A;  3QOP A;  4L0Z B;  3ZRG A;  5DCM A;  5IYC J;  1R1U A;  2D2W A;  4I02 A;  3ON2 A;  4LD5 A;  1G3T A;  4RGR A;  5HVQ C;  2CS3 A;  2YSR A;  3ECO A;  2FXA A;  4ZYA A;  3CTA A;  1U78 A;  1K4T A;  3DBL B;  1Z77 A;  3RKW A;  5EG0 B;  2ME0 A;  4UUS B;  1R9T J;  2DQL A;  4KT6 A;  2E35 A;  3ZMS A;  2RNJ A;  2OC6 A;  5J1U A;  2E1C A;  3C2H A;  3HTS B;  5JR3 A;  2OQG A;  3BTI A;  1HDP A;  3DKW A;  4WWC A;  2XUB A;  3GXO A;  3WU2 C;  3TGN A;  4OOI A;  4P1W A;  4ICH A;  1EH6 A;  2AO9 A;  3GTM J;  3VW1 A;  4D5C A;  1HXD A;  1A6Q A;  2REK A;  2NS8 A;  1V5F A;  3KX2 A;  5J6X A;  4A3K J;  2FX0 A;  1HOM A;  3VOK A;  2G7L A;  3S17 J;  1WH7 A;  4ZDP A;  4UUS A;  1SMY F;  1UCR A;  3I56 I;  2VJI A;  1PYV A;  2DOA A;  3IL2 A;  3CF2 A;  3PNV A;  2H8R A;  2KLO A;  1ACI A;  4N0B A;  5B66 C;  3HOS A;  2P7C B;  5CW8 A;  2LC2 A;  4BE2 A;  4BXF A;  1KZH A;  4A93 J;  1O7F A;  4ZTJ A;  3SFI A;  1B4A A;  5H9T A;  4EJO A;  2DA4 A;  3I4M J;  1G8X A;  1IW7 F;  1S9H A;  1IRZ A;  5LGT A;  5JLW A;  2VQH A;  2ZOZ A;  5LRR A;  1R22 A;  2DA6 A;  3FXM A;  2KIU A;  2HYF A;  3AG1 H;  4UVA A;  2EFN A;  2PN6 A;  4M3F A;  3P9K A;  1KA8 A;  4RLQ A;  3WOD F;  3GYH X;  5F0H A;  1XGM A;  1JI8 A;  3AG3 H;  1V5E A;  3PSI A;  4P9F A;  5DEQ A;  4HX7 A;  4DYC A;  2DMU A;  1I27 A;  4XRF A;  4OMY A;  5J3L A;  2KMU A;  4D7M A;  1XD7 A;  2WAQ A;  4S05 A;  2EB7 A;  3DBH B;  3PQK A;  1BOA A;  4UB6 C;  3KZZ A;  2CYY A;  1BA5 A;  2IPQ X;  3CWR A;  3L2W A;  2ZOY A;  4HNU A;  1DPU A;  3GW2 A;  3FZV A;  2AXT C;  1WRJ A;  3C2G A;  3E1S A;  4QPQ A;  3ZMT A;  2ZJP F;  1Z7U A;  5DV5 A;  1MW7 A;  2H6C A;  4ZTF A;  4MEX F;  3TW6 A;  1CGP A;  3K10 A;  2Y9Z A;  3VP5 A;  3H3U A;  3K69 A;  5CXI A;  1MH4 A;  2IAI A;  3G3Z A;  1OQY A;  1QNT A;  3H3Z A;  4P9U A;  3RYR A;  4KMF A;  1HA8 A;  1DPR A;  1MJB A;  2ZSH B;  2HFH A;  3CP2 A;  1H89 C;  2W53 A;  2CFO A;  2M45 A;  2FOK A;  3GVA A;  4M3E A;  4XLC A;  2R93 J;  3GX4 X;  3S14 J;  4OAZ A;  2ACJ A;  2VJ5 A;  4I99 C;  2IA1 A;  1RKT A;  1S8N A;  1W7P B;  1OIS A;  3HTJ A;  3L7W A;  3VWB A;  4LFU A;  3WTU C;  3MWM A;  2QYO A;  3ABT A;  3LST A;  1TWC J;  2KRC A;  4I01 A;  4PJ0 C;  2PJR B;  4ZDO A;  3JAM K;  2PMZ A;  3KNW A;  1W36 C;  2XAG A;  2K9L A;  2MD0 A;  3WHB A;  4A0X A;  2OER A;  1IUY A;  2XAF A;  3RPU A;  4A0Z A;  4UB8 C;  4J01 A;  4M9S A;  1IGN A;  1YJN I;  2FD5 A;  3K7A J;  2XGE A;  1S7E A;  1Z6R A;  3KLN A;  1YW8 A;  3OOP A;  3WGH A;  4GO1 A;  3ZQF A;  2R5Z B;  3JRI A;  3QU3 A;  2OV7 A;  1FX7 A;  4PGH A;  4PJN A;  3VDX A;  1W1W E;  1W7P A;  1YJ9 I;  1LDJ A;  3DTK A;  4A3B J;  5J8F A;  1V54 H;  4IHW A;  2IS4 A;  4M6X A;  3O8H A;  4HF0 A;  2QQB A;  2CSO A;  3DP7 A;  1B72 B;  5HLH A;  1WJ5 A;  2MC3 A;  4IRH A;  1OJL A;  1LJ9 A;  2E1M B;  3WE2 A;  5BPI A;  5J40 A;  2FF4 A;  2K85 A;  3UR3 C;  1FWZ A;  3QPH A;  1MZB A;  3HRU A;  4IKF A;  1YG2 A;  1FIA A;  2XGD A;  2GIV A;  2Q8K A;  3L00 A;  3S8P A;  2HDD A;  3P9C A;  1OFC X;  3K4M A;  3LHQ A;  4NN1 A;  3AG4 H;  1Y1V J;  4HG2 A;  4IZZ A;  3ABK H;  3HPH A;  2NNY A;  2CG4 A;  2D5V A;  2MBF A;  3I0T A;  5FRN A;  4ZDL A;  4FAS D;  1B72 A;  3GWZ A;  5JLX A;  2P8T A;  1W36 D;  3HGG A;  2EIL H;  2H6B A;  2UV1 A;  3ZMD A;  2HDC A;  2GXG A;  2QIB A;  1P4W A;  2YUS A;  1IC8 A;  1Z05 A;  1IXC A;  4E4H A;  2E5Z A;  4QSH A;  1DU0 A;  4OIQ F;  3MAJ A;  1MBF A;  3RKX A;  3GZ5 A;  1U9N A;  3OYJ A;  1FOK A;  5LEK A;  5DS9 A;  1RC9 A;  1ITY A;  1D1C A;  2KZG A;  3ZP5 A;  2G7G A;  4W97 A;  4Y3O A;  2R7D A;  2JA2 A;  4IO9 F;  5BS6 A;  2BV6 A;  3C3W A;  4PSW A;  1O3T A;  2W82 A;  3ELK A;  3HOX J;  1VF9 A;  1ENH A;  2K5C A;  2HU9 A;  4I0A A;  1RUO A;  2VBZ A;  2X1E A;  3H5R A;  1J5Y A;  3L1P A;  1D8K A;  1F4K A;  1OCT C;  1B59 A;  2VOO A;  2E1M C;  4NC7 A;  4NHJ A;  1O3Q A;  2K9M A;  1D0X A;  2ELH A;  3CCU I;  1EJ9 A;  5K58 A;  2X1C A;  2X6O A;  5KCM A;  3F1B A;  4E7Z A;  3JRG A;  3J7A O;  4RB2 C;  1W7P D;  3MFK A;  2V1N A;  2VAS A;  1YLF A;  2IP2 A;  2GUH A;  3ONQ A;  1YW9 A;  1PUF B;  2CGP A;  2V9V A;  3VYR B;  2V79 A;  5HLI A;  4GCL A;  4OIR F;  2XAS A;  4RGX A;  4A2U A;  3ZQI A;  1FMV A;  1QPM A;  4S0H B;  4JNN A;  2NS0 A;  2E7X A;  1MMN A;  3RTR A;  5K5O A;  2A68 F;  1IRF A;  4KIC A;  5D5V B;  1AWC A;  3L9F A;  3TKY A;  3HHG A;  3CES A;  4M73 A;  4PJL A;  2LFB A;  4CHU A;  4C2T A;  3HZJ A;  3U1D A;  4EJT A;  2FU4 A;  1PUF A;  1XG1 A;  1Z7L A;  3H1C A;  4O5V A;  1MBG A;  2FBK A;  1DGW Y;  4AD9 A;  1W0U A;  2COM A;  3C2B A;  4AYB A;  1LFU P;  2HZT A;  1WI3 A;  2LRD A;  2QGU A;  3VOD A;  1R6R A;  3LSK A;  3F23 A;  4XMY A;  2WTE A;  3LSH A;  2M0C A;  2NVT J;  5J8C A;  1SAX A;  3JAM Z;  1LE8 A;  4BQA A;  2KPM A;  1L3L A;  3QWL A;  1FC3 A;  2EZH A;  5LD2 C;  2V57 A;  1RPW A;  4G6D A;  3BRU A;  1Z6T A;  5CVV A;  5LHG A;  2HQR A;  2DK8 A;  5EZH A;  2HTS A;  1BI2 A;  3FXO A;  1JKQ C;  3HOV J;  2ZCM A;  4IHY A;  3KEQ A;  1KGS A;  1I6H J;  3I3L A;  3O3K A;  3LA2 A;  1QO0 D;  3LNQ A;  4HLX A;  3CCS I;  4BDZ A;  1VQP I;  2HZD A;  1H0M A;  4D9J A;  4H4K C;  1UB9 A;  4C2U A;  4PDK A;  2CUE A;  3HYI A;  2RNG A;  2X6X A;  4R1H A;  4E70 A;  4M9Z A;  3K8P C;  3GO5 A;  2JQ7 A;  4G94 A;  1ZAO A;  4BH9 A;  1A35 A;  4PSX A;  3QYF A;  3MKY B;  2OTJ I;  3SQN A;  4KJZ A;  2DYR H;  3OYB A;  5K7H A;  4EGZ A;  2C6Y A;  2TDX A;  2F07 A;  2JSP A;  4FET A;  2W4S A;  1JGS A;  3KE2 A;  4IX7 A;  1EV7 A;  2XIG A;  1XX5 A;  4QIW N;  2XRN A;  2DQR A;  2DDA A;  4IRG A;  1GDT A;  5HSZ A;  3LQQ A;  3CO7 C;  3JSP A;  1Z0X A;  4RBO A;  3OV8 A;  5FKN A;  4BEH B;  5GAG J;  1BOB A;  3H36 A;  1XSV A;  2FNA A;  4LOC A;  3K4J A;  3KZ9 A;  3ERE D;  1NH3 A;  1WKM A;  3CMM A;  2ELJ A;  3DTI A;  4M6Y A;  2OA4 A;  2WWY A;  4HLY A;  4GFB A;  3VFZ A;  1JUP A;  4RB3 C;  4F55 A;  4NC8 A;  4B8X A;  1HW1 A;  1OKR A;  2WGB A;  4K2E A;  1SFU A;  2LG4 A;  4QPO A;  4OIN F;  4AC6 A;  4XRS A;  3OR1 C;  1ZLK A;  4CA0 A;  1UEL B;  1T95 A;  3HGY A;  2YU3 A;  5EDN A;  3MMY B;  4A5M A;  2NAZ A;  4C2M J;  5B5E C;  2ZBK A;  3LFU A;  1R5G A;  2OQR A;  3HIF A;  4JYK A;  4D5F A;  4LIU A;  2DJI A;  2RRE A;  1Y8Q B;  2UXU A;  3QPL A;  2MC4 A;  4MGR A;  5ICE A;  4ZZL A;  3C07 A;  3HJE A;  4J19 A;  2W57 A;  1BW6 A;  1J7K A;  4CCO A;  5L3E A;  2M30 A;  1TW3 A;  3CDL A;  3L09 A;  3NS4 A;  1ZN2 A;  1A5J A;  1P7J A;  3RSN A;  2YVH A;  2ECC A;  1FOW A;  2OU2 A;  2Z16 A;  5HOO A;  3OYK A;  5JVG F;  1LDK B;  4DW6 A;  3T1B A;  3P9I A;  4RA2 A;  3NWS A;  2OZU A;  4H0E A;  2EIK H;  4XK4 A;  2E36 A;  1WZ2 A;  1DP3 A;  2PG4 A;  3A1Y A;  3SHF A;  4CCJ A;  3HPG A;  4FE4 A;  2L54 A;  2R7Q A;  3HTA A;  3LOC A;  2RVC A;  4FIS A;  3E97 A;  4ENJ A;  4HOB A;  3C1D A;  3FXK A;  1X1A A;  5DD8 A;  1P4A A;  1SGM A;  2L7Z A;  2VN2 A;  5F0F A;  2WB1 N;  2VBW A;  3JSJ A;  2ELK A;  1SAN A;  3BJ6 A;  4CCL A;  3I4P A;  1CF7 B;  2R7U A;  4MQV A;  4BJ5 C;  1VQ4 I;  2EFO A;  2M8E A;  5EYR A;  1EH7 A;  1FMW A;  4LLG F;  1S72 I;  3ANP A;  2UWM A;  4EMS A;  1FOX A;  3HOY J;  3OYE A;  4B47 A;  3M8E A;  2K9S A;  1WFX A;  2OZ6 A;  2DK5 A;  1PVE A;  3OS2 A;  2HOS A;  4BUP A;  3M7G A;  1YFH A;  4AIJ A;  2HQ5 A;  1JGG A;  3G7R A;  4I2O A;  3HOU J;  2VIX A;  1HQC A;  3LSR A;  1Z1D A;  2FEZ A;  5H6R A;  2QWT A;  1R1V A;  2EQR A;  2PZ9 A;  1CF7 A;  2HTJ A;  3PIP F;  3HTI A;  4M6V A;  1BIB A;  1OR7 A;  3IH3 A;  3S1Q J;  1Y39 A;  3BNI A;  3I5U A;  4PCQ A;  5CVI A;  4MHG A;  2GA2 A;  2QSH X;  1E0E A;  1JTY A;  1QVU A;  4RB0 A;  2EV5 A;  3TMO A;  1TL8 A;  2PLY A;  3K2Z A;  3HUG B;  3M07 A;  2L0K A;  3LMM A;  3BQY A;  2DI3 A;  4A3G J;  2FRH A;  2X9D A;  4RAF A;  4I0B A;  1ZRD A;  3ZCO A;  5LFA A;  1ERD A;  3EGQ A;  2VXD A;  3S2H J;  3KEY A;  2R7S A;  1FYL A;  1QHG A;  2X4H A;  4DZJ A;  4UXN A;  4NQW B;  1OR7 C;  2XPV A;  2E1O A;  2FQ4 A;  5DM6 F;  1G3S A;  1MJA A;  3I59 B;  4LIV A;  4F3Q A;  3CUO A;  2QQA A;  1ZQ3 P;  2JK3 A;  3PJR A;  4X1E A;  3Q5F A;  2K3P A;  4UUT A;  1LPQ A;  4N9I A;  2UXN A;  2YVE A;  3OYF A;  3BCG A;  2KJC A;  2BY1 A;  1XMA A;  2ZXI A;  3MKL A;  2QOP A;  2O5R A;  1YX5 A;  2EZK A;  2Y0S N;  4ITV A;  1RES A;  2CQ7 A;  2L7M P;  1MBK A;  4PJM A;  1TNT A;  3OYL A;  2UZK A;  3CCM I;  5EEH A;  2PI0 A;  3I59 A;  2YX4 A;  4ANJ A;  2Z99 A;  3J80 K;  3HB9 A;  2GM4 A;  4C3I J;  2AQE A;  1W5S A;  3V8J A;  4EJV A;  3VTI A;  3G1M A;  5IT9 K;  3D5R C;  5DUI A;  2BVL A;  5K7Z A;  1IDY A;  3CZ6 A;  3J7Y J;  3HOT A;  2ZXW H;  1Y0N A;  2CQX A;  1J75 A;  2Z1D A;  3ZN0 A;  1KU7 A;  3V7S A;  2E5N A;  4ESF A;  1K4S A;  2XAH A;  2R7T A;  2I10 A;  3OL4 A;  1O3S A;  2X51 A;  5TJJ A;  1D1A A;  1SC7 A;  4BHP A;  4XRM A;  3CJR B;  3ECH A;  2A5Y B;  4LMY A;  1DDN A;  1P92 A;  1ZGJ A;  2VON A;  1FP2 A;  5F08 A;  4GFL A;  1SAU A;  4CYC B;  4IJA A;  2XF7 A;  2F4O B;  3V78 A;  3SFZ A;  5D5U B;  3VPR A;  2NX4 A;  2XKP A;  4I76 A;  2O7O A;  1TLH B;  4XM3 A;  2E34 A;  2L4A A;  1H88 C;  5GPC A;  1QPI A;  5C4X J;  3M8J A;  3CQZ J;  3DLA A;  4IHX A;  3G6E I;  3PUB A;  4F7Z A;  4WXC A;  1FTT A;  2YR2 A;  3CD6 I;  4HST A;  5JHU A;  2AQF A;  2DAO A;  4MK6 A;  3OYN A;  4CYC A;  4AWX B;  3KCC A;  1K6O A;  1QVT A;  2JA6 J;  3OWT A;  2DOE A;  5L3G A;  4U88 A;  5HLG A;  3OIO A;  1HDD C;  2ZJ2 A;  4XSZ F;  4HPQ A;  3HL2 A;  5H20 A;  1LFP A;  2JRT A;  2PX9 A;  3FHZ A;  1UJ8 A;  1U6G A;  2ZNZ A;  3MD2 A;  2HEO A;  3J81 K;  4CGZ A;  2H8W A;  1G4D A;  2RAS A;  2GFN A;  3FRQ A;  2BGC A;  3KFW X;  2V6E A;  1SFK A;  1E3H A;  3ERM A;  5FKK A;  4XIC A;  4MTE A;  2IA2 A;  2CRG A;  3T8R A;  3ABL H;  3DEE A;  4U7B A;  1ONV A;  2MSY A;  3QBM A;  2GOM A;  2BHY A;  4BXU A;  4B3A A;  2V1U A;  5TIS C;  4EM1 A;  4A69 C;  2GBY A;  1BC7 C;  3K4C A;  4BY1 J;  1LVK A;  5IOY A;  3FXJ A;  2DYS H;  5LBQ A;  3AQT A;  2BXZ A;  1IG7 A;  1W5C C;  1TTY A;  2BYV E;  2K9N A;  4XLE A;  3VEP A;  2NVQ J;  2WAF A;  2HDW A;  4MLO A;  3P9T A;  5E18 F;  2F4I A;  4NBQ A;  4PFP A;  1ETX A;  1I1G A;  3K1P A;  4GYG A;  4Y7N J;  1HCR A;  1VQN I;  1EA3 A;  5D6F A;  3HBL A;  1U5T A;  1HKS A;  5D18 A;  3V8K A;  2TRT A;  2XRO A;  1X58 A;  4BGD A;  4F92 B;  5LRS A;  3H9G A;  4G9Y A;  1YI2 I;  2P5V A;  4E6K G;  3H3V K;  5F1R A;  1XGO A;  4EJU A;  3QPT A;  2O03 A;  4XL9 A;  4Y33 A;  1RIO H;  4F93 B;  4XBF A;  2IXS A;  3IKT A;  4B48 A;  3ZQL A;  2FE3 A;  5D4S A;  1Y6I A;  5D5X B;  3O6B B;  3OOU A;  4PGG A;  3L2Q A;  4L5J A;  4AVZ A;  4YIR X;  1ON1 A;  4JX5 A;  2EFW A;  4B3X A;  2ID6 A;  4M9X A;  4KT5 C;  2GXA A;  1LUJ B;  3T0Y A;  1QGP A;  1MMD A;  3FKJ A;  3KP2 A;  5E3L A;  4II2 A;  3J80 Z;  3GEZ A;  1RKW A;  1U5T C;  2XHK A;  1XB4 A;  1S29 A;  5KAI C;  2AS5 F;  1ZR4 A;  2VBX A;  4BKX A;  2UXH A;  5DDG A;  1T98 A;  2EA4 A;  3A0B C;  3E7L A;  3WU1 B;  3WTZ A;  5IT9 Z;  5D8K B;  2O3F A;  1MSE C;  4HX8 A;  4C3J J;  1UI6 A;  4A0Y A;  4RLF A;  4HA8 A;  3LAJ A;  2Z5U A;  1I3Q J;  2KHM A;  5H6Q A;  1UMQ A;  2EZL A;  2LP0 A;  2ZC2 A;  2KIF A;  3O8G A;  3GZN B;  4BBR J;  1N77 A;  2DMP A;  3PO2 J;  2W48 A;  4A3F J;  2P6S A;  5CKT A;  5EG0 A;  4U9N A;  3OL3 A;  4G12 A;  2DBB A;  4UV8 A;  1TT5 B;  3MKW B;  5IYB J;  2DFE A;  1OCC H;  3GTQ J;  3PSF A;  2KP6 A;  2EK5 A;  2VQG A;  3L2U A;  2V26 A;  4CH7 A;  1XGN A;  3WHC A;  3QQA A;  1J09 A;  3GLL A;  2CV2 A;  3OIP A;  5F64 A;  2HPI A;  4P5O A;  3NRV A;  2BY3 A;  1T8I A;  4HX4 A;  3EQL F;  4G6Q A;  4Z6Y A;  1Z21 A;  2HQN A;  3GFJ A;  1YX3 A;  4QWQ A;  2L9S A;  3MVP A;  3F9K A;  2VE8 A;  4HQM A;  4MFE A;  3BZK A;  2M87 A;  2F5V A;  5FD5 A;  1H8A C;  3FIW A;  4XLP F;  5JVT A;  3GTO J;  2K7L A;  4PXI A;  4B09 A;  3GF2 A;  2Q2E B;  4DZP A;  2XPU A;  1M1E B;  3ZOB A;  3ZQ7 A;  1ZLJ A;  2DA3 A;  2RGV A;  3PIO F;  1KON A;  3I53 A;  2O61 A;  1WWX A;  2DA7 A;  3RD3 A;  3KZY A;  1LDD A;  3EUK L;  3J81 Z;  1BC8 C;  3S16 J;  3IKV A;  4NNJ A;  2R7W A;  3BJB A;  3BT9 A;  1HST A;  3Q0W A;  4XLH A;  4B1R A;  3ESW B;  3GFM A;  4WX9 A;  3F8M A;  4GCK A;  3OSG A;  2Q2E A;  1U8R A;  2A69 F;  2QEN A;  2OBP A;  4L0Y B;  3KIO A;  2CW0 F;  2EIJ H;  2VT3 A;  2VJ4 A;  1WH5 A;  4EM2 A;  2VLA A;  3WE3 A;  2X85 A;  1R36 A;  3CCL I;  2CV1 A;  1MBE A;  1D3Y A;  3GME A;  2EH3 A;  3I55 I;  5L3D A;  1KYZ A;  5FKL A;  4CZC A;  3S1N J;  3W3C A;  1Z3X A;  3H5A A;  2QTQ A;  2F48 A;  2PFV A;  1LEA A;  3KP4 A;  4JQF A;  5LHI A;  3BTC A;  5C4J J;  2VUM J;  1ZTR A;  3RYP A;  3AFH A;  1GLN A;  1Y56 A;  1WJD A;  2RAE A;  4RDU A;  3CC7 I;  4BHB A;  4D7N A;  2F6C A;  1YIJ I;  3FBN B;  6PAX A;  1OCO H;  4A3D J;  1YIO A;  3SDG A;  4WXH A;  2JSC A;  1SVM A;  2OCC H;  1VQ8 I;  2ZFU A;  2KDO A;  1NK2 P;  3ZPL A;  4KIS A;  1FYM A;  1ON2 A;  2PJR A;  4KN4 X;  1E3O C;  4XLN F;  3NI7 A;  4ZYH A;  5K1Y A;  1U0J A;  2D1V A;  2EFP A;  2HNH A;  3AG2 H;  4B43 A;  1TBX A;  2ZKZ A;  4XRS G;  2GAU A;  2B63 J;  2E1N A;  2V9P A;  3OYI A;  3CUQ B;  2GA1 A;  3KP5 A;  2R5Z A;  5FMP A;  3COA C;  1ODD A;  4U0V A;  2CUZ A;  5KHD A;  1ZG1 A;  3KYD B;  3DF8 A;  4CIC A;  4JP0 A;  2V9K A;  1VQM I;  2VOD A;  3R4K A;  1X3W B;  3BG9 A;  2UXO A;  1SFO J;  3ZR8 X;  3K1M A;  2HVQ A;  2XB0 X;  2A6T A;  4A3J J;  2JZY A;  1SVL A;  2R92 J;  2CUF A;  3HKZ A;  5E8I A;  1JJ6 C;  2CQQ A;  4A12 A;  1HSJ A;  5M3F J;  1WVR A;  2WA0 A;  3BR2 A;  3HTU A;  3HG9 A;  4BAY A;  2WV0 A;  3TOB A;  3H9Q A;  5J47 A;  2WUI A;  3CUQ A;  5FRM A;  3LWF A;  3FDY A;  3GLX A;  3BC8 A;  1AA7 A;  5HS8 A;  2GQQ A;  1XGS A;  4RAY A;  3TO7 A;  2CW7 A;  2EA2 A;  3HXL A;  2K86 A;  1TQI A;  4HSR A;  5DTD A;  3CC4 I;  2FQ3 A;  1UZC A;  2O8X A;  4KYW A;  2CQK A;  2QM3 A;  3K70 C;  2L3D A;  3FWE A;  1AKH B;  1FSE A;  4Y17 A;  1MMS A;  3WG7 H;  2ID3 A;  3VB2 A;  1MD0 A;  3CUQ C;  2Y31 A;  5D6E A;  1YJW I;  3ANG A;  2LDU A;  1R1T A;  2DMN A;  3G56 A;  3E6C C;  2HYT A;  4FHT A;  1GV5 A;  1REP C;  4LJZ F;  2IBD A;  3TQN A;  1ETO A;  3CF5 F;  1RUN A;  3GEU A;  2LLK A;  5HLT A;  1I1S A;  5GTI C;  4L9T A;  5HS7 A;  1AKH A;  3KP7 A;  1WJA A;  3CMY A;  3I54 A;  2WAQ N;  1N78 A;  4O3M A;  4L5E A;  5E79 C;  2M4G A;  2JMW A;  1ETV A;  5C4Y A;  2L02 A;  2MH2 A;  2WC2 A;  2XVC A;  3HTH A;  4ABZ A;  2HS5 A;  3FKI J;  2KRF A;  2R7X A;  2Y2Z A;  1LEB A;  4KFC A;  4Q5S F;  1VFC A;  5D5W B;  3KET A;  2R3S A;  1ZKG A;  5J1Y A;  3TP0 A;  5GTH C;  3GTL J;  2M1B A;  3K70 D;  1JKP C;  3BRO A;  3RKQ A;  1OYI A;  1UST A;  1RET A;  2DCE A;  1XSX A;  4XOP A;  3HOW J;  4A3C J;  3KP6 A;  3A03 A;  4GYI A;  1DU6 A;  1HW5 A;  1I3A A;  3FM5 A;  3IH4 A;  3Q0V A;  1HBX G;  2G9W A;  4M3D A;  3RCO A;  2NOJ B;  1JT6 A;  2OJE D;  3BCA A;  2KT0 A;  5CQG A;  3JRC A;  4CUG A;  5TGT A;  2N8G A;  2LMD A;  3BPX A;  2VXZ A;  2PMZ N;  1SD6 A;  2A07 F;  3ULQ B;  4DVY P;  2HVR A;  1Y8R B;  5CPR B;  4BXX J;  4UDS A;  1HC8 A;  2MFZ A;  2PMU A;  1PP7 U;  3RZO J;  3R6S A;  1FPQ A;  3WTV C;  5LLQ A;  3M9A A;  2QF7 A;  2P5K A;  4I09 A;  4V2G A;  3CRJ A;  3FMS A;  2DMQ A;  4GGG A;  3OYA A;  4BE1 A;  4HV5 A;  1VTN C;  5BQT A;  1ZK8 A;  3PNY A;  2V1X A;  3PL8 A;  4XKV A;  3S5R A;  5DCF A;  2VB6 A;  5IPA A;  2E19 A;  1DGR M;  2FOW A;  1UHS A;  4BYY A;  2FBQ A;  2NYX A;  4E7L A;  3DU5 A;  3F21 A;  4GCT A;  3DCF A;  1B8I B;  3MZY A;  3K4L A;  4M71 A;  1V55 H;  3ABM H;  1P2F A;  1UHM A;  4J00 A;  3FHN A;  3MKZ A;  5F1J A;  5DUK A;  1OYY A;  4PFO A;  1BW5 A;  5FFX A;  3TO9 A;  5E3N A;  4EJW A;  2QUF A;  1FT9 A;  2XDV A;  2E2I J;  2KRH A;  2D1H A;  2HR3 A;  1YW7 A;  4YIF A;  5EFY A;  1IUF A;  1VND A;  2VPL A;  1XC5 A;  1FSH A;  2HWV A;  1IF1 A;  5FO5 A;  4FX4 A;  2IGO A;  3ZQG A;  3RJP A;  2HKO A;  1P4X A;  2HGC A;  1B8I A;  1MGT A;  4HV6 A;  3EDP A;  2L01 A;  2XC7 A;  2DJN A;  2YPR A;  4KN7 X;  4FE7 A;  4BEH A;  2VI6 A;  5ERI A;  1U9O A;  1D0Z A;  1ZG3 A;  2MG4 A;  3QYE A;  3JRB A;  1IJW C;  4JK1 X;  1FLI A;  2H1L A;  1IV6 A;  1TWH J;  1FBQ A;  2H94 A;  2OCE A;  3H0G J;  4PK4 A;  5D1R A;  4N9H A;  3ZXS A;  2QKL B;  3NAU A;  5EEA A;  2ZCX A;  2RKH A;  4ZJZ A;  3BR5 A;  1MDM B;  2GXB A;  3DPJ A;  4YFX F;  3OYC A;  2DOF A;  3CDI A;  1J0R A;  5KNL A;  1K83 J;  2OTL I;  2VKD A;  4BQN A;  5AIP A;  2JA7 J;  3QP6 A;  5ILS A;  3VUQ A;  4YFK F;  3NPI A;  2DOD A;  3M8F A;  2YU9 J;  3K4N A;  1UI5 A;  4OIO F;  5E3O A;  3TO6 A;  5FJ8 J;  3IHU A;  4XSX F;  4ENM A;  1T2K A;  2MLK A;  5EF6 A;  3C7J A;  2LSO A;  5EGO B;  2MLG A;  5KAF C;  3G73 A;  2K9Q A;  3S32 A;  1MDM A;  1IAW A;  2IGK A;  5ILV A;  4XKW A;  4LLN A;  1R23 A;  1BI1 A;  1R49 A;  1MIJ A;  2BW3 B;  4XLA A;  3PAS A;  1I6X A;  5J1R A;  3S1R J;  2UXX A;  5A2Q K;  3TW7 A;  1OCP A;  1JXS A;  3HRS A;  3R61 A;  4IOC F;  4RM3 A;  2P7V B;  3SEQ A;  1X3U A;  1HKQ A;  2ESH A;  2JA5 J;  1XCB A;  4N4N B;  5EGO A;  2O0Y A;  1LFB A;  5HDK A;  1MMA A;  4YZE A;  3E0J B;  3G4S I;  2BY0 A;  5FKM A;  2X48 A;  2H1K A;  3B6A A;  2VBY A;  3KYL A;  2QQ9 A;  2STT A;  3IUV A;  3QPS A;  1B6A A;  4AYB N;  4GCV A;  2NS7 A;  2M34 A;  1N25 A;  2BW3 A;  3U2R A;  3A2K A;  1DUX C;  3OIQ A;  3LJL A;  4IQJ A;  2G7S A;  2DG7 A;  2KKO A;  1LNW A;  4MO7 A;  2L7F P;  4BS9 A;  4XON A;  4HRI A;  2MW8 A;  4UVC A;  4LB5 A;  2IRF G;  2IS2 A;  2NNN A;  2CUJ A;  1TWG J;  2KL4 A;  1R7J A;  1ETQ A;  4C9Y A;  2VPR A;  5HAW A;  3CDH A;  3E5X A;  4CCK A;  5HDN A;  3V7R A;  2B3W A;  4YEJ A;  3CCJ I;  5BPD A;  2LF7 A;  3TDU C;  3JSO A;  2L5Q A;  2ZCN A;  4AM3 A;  2KZV A;  3NNR A;  3ISP A;  1IN8 A;  1T08 B;  2X0L A;  1S3J A;  1OLT A;  4JKZ A;  4W1U A;  1D5Y A;  1GUU A;  1MNE A;  2F5D A;  4ZYE A;  5EZG A;  4R8H A;  4TV7 A;  3JRE A;  3W6V A;  1S6L A;  3H92 A;  2P81 A;  2OD5 A;  3FF5 A;  4FT8 A;  3IH2 A;  1E3P A;  2K27 A;  4M3G A;  3AAF A;  2NVU B;  2HPM A;  5GAD J;  2FA5 A;  1P6R A;  4HNT A;  2NOG A;  4DQ2 A;  2VE9 A;  5IP7 J;  5F6F A;  2JPC A;  1Z91 A;  3WTS C;  1FJL A;  3BOQ A;  1AOY A;  3HUG A;  3W6K B;  1K78 B;  4OIP F;  5FRO A;  3QYB A;  1Z3Y A;  2F5E A;  3ZQQ A;  3CCQ I;  4MIM A;  5FLM J;  2R7F A;  4M3B A;  3VSK A;  4L5I A;  1FNN A;  2A5W A;  2P0W A;  1WJF A;  1F9N A;  3IWF A;  1IV8 A;  3G71 I;  4IHT A;  3L2R A;  1JHF A;  1WPK A;  2IGM A;  4DGW B;  4IVN A;  4NQW A;  3VOE A;  4KA4 A;  4IHV A;  4JX4 A;  4PUS A;  3S93 A;  2DW4 A;  5FD6 A;  3EPZ A;  2E7W A;  3E5U A;  4MNU A;  2CQN A;  1K78 A;  1DP7 P;  2M4K A;  1WI9 A;  3KYC B;  1BM9 A;  2DPD A;  1WJB A;  2VT2 A;  3IP4 B;  3SZG A;  3LSP A;  2F4M B;  2W00 A;  4CZZ A;  1UFM A;  4AID A;  1QBJ A;  3I64 A;  1YS6 A;  4RAZ A;  3HRM A;  1QA6 A;  1D8J A;  1X4P A;  4PZJ A;  1G6N A;  2VKV A;  3JRH A;  1IXS B;  2A6E F;  3GFL A;  1ZRC A;  2R7O A;  3H0D A;  2QCO A;  5KVR A;  4XR6 A;  4WIB A;  4ENN A;  3SWH A;  3VVZ A;  1SFE A;  3DPU A;  3VYU B;  1JTX A;  5CVU A;  1PUE E;  4XNF A;  4HBL A;  1JT0 A;  2CJJ A;  2STW A;  1OCR H;  4C30 A;  1JHH A;  2CH0 A;  3PFY A;  5A2Q Z;  1YIT I;  1ZYR F;  2K40 A;  2EV6 A;  2E60 A;  4AUX A;  4ME9 A;  3I9V 2;  3V4G A;  3MZ8 A;  5IY5 H;  2NVX J;  3VW2 A;  3A01 B;  2DN0 A;  2CV0 A;  2PJP A;  1X1P A;  3NXC A;  3OS0 A;  2M5W A;  1V4R A;  3K1N A;  1JKO C;  1EKE A;  2ETH A;  3T5X A;  1R4N B;  4RM2 A;  5HOD A;  3VIB A;  1YQA A;  3ZGK A;  3UKG A;  1PP8 F;  1SFX A;  1WJC A;  4KIT B;  1X1D A;  5HBU A;  3ROU A;  3EUA A;  4Q4Z F;  3O2P E;  1RR8 C;  1GVD A;  4G7O F;  5BOX A;  1XS9 A;  2H27 A;  2XAJ A;  3F8B A;  4AIH A;  4RGS A;  5GAH J;  2OPT A;  1W0T A;  3AL0 B;  3E3V A;  5ILU A;  3HSR A;  2JRM A;  3BG3 A;  2OUM A;  2OI8 A;  2FBI A;  3VYS B;  3OYG A;  4IXA A;  3REO A;  2QEX I;  3GUD A;  2ZFW A;  4OU0 A;  1FEX A;  3HDD A;  5K5R A;  2P6T A;  1S5L C;  4U87 A;  1QHH D;  2AHQ A;  4RGU A;  5LHH A;  1NG6 A;  2CO5 A;  2F5F A;  2QZ8 A;  4IEJ A;  1MND A;  3RH2 A;  2Y9Y A;  1XMK A;  2FSW A;  2IVM A;  1LVA A;  1VI0 A;  1TC3 C;  5E8G A;  4BQQ A;  1QQI A;  2HKX A;  3D5S C;  2YS9 A;  4MXM A;  5D19 A;  3QAH A;  1WGX A;  2CW8 A;  1MSF C;  3HHH A;  1ULY A;  2IS6 A;  2P5L C;  2YX7 A;  3BQZ A;  5D4R A;  3FXR A;  5GPA A;  3LA7 A;  4II3 A;  2FNP A;  3R60 A;  1YS7 A;  2BZT A;  4HW0 A;  3LFK A;  1IN7 A;  3NRG A;  2GOX B;  2BEO A;  4LLL A;  2DFH A;  3AL0 C;  4NC6 A;  1DQU A;  4CXF A;  4IF4 A;  4P55 A;  4KWA A;  2EIM H;  3KEO A;  3BLY A;  1E17 A;  3RZD J;  1IDZ A;  3P5J A;  4MEY F;  4LB6 B;  2HOA A;  3S3N A;  4XN3 A;  3M4O J;  1O57 A;  3ZN1 A;  3FXQ A;  3NAR A;  3HSF A;  4BBS J;  3CLO A;  3DFG A;  1D0Y A;  4HYE A;  2R4G A;  1IN4 A;  2FBH A;  4UV9 A;  2G0E A;  1FOY A;  3KLO A;  4ZZD A;  4UHT A;  1T6S A;  2L9V A;  4MQ9 F;  2X6Y A;  2JUG A;  2KIQ A;  4U0W A;  4ZYD A;  3PO3 J;  1U8B A;  5ICC A;  5FGL A;  1P7I A;  1XMX A;  5BMZ A;  4IPA A;  1XN7 A;  3TL4 X;  3WG9 A;  1T56 A;  2K4B A;  1O3R A;  1VQ7 I;  1R5I D;  1BBY A;  5LGN A;  2UXP A;  2UXI A;  3QRF F;  2YVX A;  3WTW C;  3F8C A;  1W5T A;  5GAE J;  2ZSI B;  1USS A;  3M1E A;  2R7V A;  2GIZ A;  3TOA A;  2G7H A;  1Q1V A;  1BI0 A;  1FIP A;  2ZXJ A;  1X1C A;  3FXU A;  3CJT B;  3DPT A;  2VC0 A;  1L0O C;  3BZC A;  1Q1H A;  2O6G E;  1SD4 A;  3S1M J;  2Z2S B;  3S3O A;  2VKH A;  5ED4 A;  3HM5 A;  4EVI A;  2DLL A;  1IZ1 A;  4G8X A;  4XOT A;  3BR1 A;  4HQE A;  4WF2 A;  1GVJ A;  2HXO A;  4ZYG A;  3F22 A;  2A6H F;  1KU3 A;  2CMP A;  5B3S H;  3CC2 I;  1B1B A;  1VQ6 I;  2CU7 A;  2B7E A;  4I7H A;  2NP5 A;  2ICW G;  3I58 A;  1F1Z A;  4UY8 I;  2DA2 A;  1MBJ A;  9ANT A;  2QSG X;  2DT5 A;  2GZW A;  3BJA A;  3VVY A;  2JVH A;  2LKP A;  2JN6 A;  2L9N A;  3OSF A;  1IN5 A;  2RN7 A;  3BR3 A;  1GXP A;  3MEX A;  2X6W A;  1VZ0 A;  3JTG A;  3SJM A;  5TRD A;  4A5N A;  2KQR A;  1YE9 A;  2ZME B;  3FBI B;  2ECB A;  1UG0 A;  3D1N I;  4HF1 A;  2PEX A;  1BJA A;  2Q24 A;  1QRY A;  4R79 A;  1XDU A;  1BN5 A;  4WXD A;  1BR1 A;  4L62 A;  4BJT A;  4OAY A;  1KU2 A;  4KIF A;  2B9S A;  1TWA J;  5IOZ A;  2L7K A;  2OAZ A;  3Q3S A;  3AKZ A;  2F5C A;  4XN0 A;  1ZHF A;  4GRI A;  2JTV A;  2NXN B;  4FX0 A;  3BTL A;  2ZME A;  5E1Z B;  2W24 A;  1ETK A;  3GFI A;  2L9R A;  4ZC3 A;  3BPV A;  3PQJ A;  1MH3 A;  1JUM A;  4DJA A;  2I5U A;  2RHA A;  2M9H A;  5CYV A;  3L2C A;  3A0H C;  5F27 A;  4CCN A;  5IP9 J;  1T38 A;  1FY7 A;  1R58 A;  1XTA A;  2EV0 A;  3DV8 A;  4LGW A;  2K02 A;  5DD4 A;  1X2M A;  2G7U A;  3IUO A;  1TQP A;  1LKX A;  1ZRF A;  5CXG A;  3MNL A;  2M7A A;  2E2H J;  1ZR2 A;  3DPL C; 
#chains in the Genus database with same CATH homology
 2X9D A;  3DEW A;  3JRF A;  3S5R A;  3EGQ A;  5IPA A;  4CGR A;  2E19 A;  3BHQ A;  1UHS A;  3S2H J;  3EUP A;  3BG5 A;  3TP3 A;  1NK3 P;  2FBQ A;  3PPB A;  4DZJ A;  1GV2 A;  3HEF A;  4GCT A;  2XPV A;  3DCF A;  1B8I B;  2E1O A;  4ACI A;  2FQ4 A;  5F1J A;  5IYC J;  1BW5 A;  1ZQ3 P;  2JK3 A;  5E3N A;  4X1E A;  4UUT A;  1MNM C;  2E2I J;  4JL3 A;  3ON2 A;  2R5Y B;  2YVE A;  3F0C A;  3BCG A;  5EFY A;  1IUF A;  1VND A;  3RQI A;  3MKL A;  2QOP A;  1XC5 A;  2EZK A;  1U78 A;  2Y0S N;  5E3M A;  1RES A;  1Z77 A;  2DG8 A;  5EG0 B;  2ME0 A;  3ZQG A;  4UUS B;  4A3E J;  1R9T J;  1B8I A;  2L7M P;  1MBK A;  5J1U A;  1YRN B;  2DJN A;  3BTI A;  1HDP A;  4FE7 A;  2VI6 A;  3HB9 A;  1U9O A;  2GM4 A;  2MG4 A;  4C3I J;  3JRB A;  3GTJ J;  1IJW C;  2GLO A;  4ICH A;  1ETW A;  2AO9 A;  3GTM J;  1IV6 A;  3VW1 A;  1TWH J;  2MGQ A;  3H0G J;  4D5C A;  2R5Y A;  3G1M A;  2REK A;  2NS8 A;  5D1R A;  1HOM A;  4A3K J;  2FX0 A;  3VOK A;  3NAU A;  3JRD A;  5EEA A;  2KDZ A;  2G7L A;  3S17 J;  2ZCX A;  5K7Z A;  1IDY A;  3BR5 A;  1POG A;  3A02 A;  1WH7 A;  3DPJ A;  2CQX A;  3G1L A;  4UUS A;  3VW0 A;  1K83 J;  1YRN A;  2I10 A;  2JA7 J;  2D6Y A;  3VUQ A;  2H8R A;  1Y1W J;  3NPI A;  2YU9 J;  3T6N A;  3JR9 A;  1UI5 A;  4XRM A;  5E3O A;  5FJ8 J;  3ZQC A;  4A93 J;  5CW8 A;  3SFI A;  5EF6 A;  5EGO B;  5F08 A;  5H9T A;  1GT0 C;  2DA4 A;  2K9Q A;  3I4M J;  3S15 J;  4GFL A;  4CYC B;  1IRZ A;  3V78 A;  5JLW A;  2ZOZ A;  4HKU A;  3VPR A;  2DMT A;  2NX4 A;  1BJZ A;  2DA6 A;  3PAS A;  4I76 A;  2O7O A;  5J1R A;  3S1R J;  3TW7 A;  1OCP A;  2LK2 A;  5GPC A;  4FTH A;  4EEF G;  1H88 C;  4M3F A;  1QPI A;  5C4X J;  4IHX A;  3CQZ J;  4MFD A;  2M8G X;  1FTT A;  2JA5 J;  5EGO A;  5F0H A;  1LFB A;  4YZE A;  4MK6 A;  4CYC A;  1JJ8 C;  5IP6 A;  5FKM A;  2X48 A;  2DMU A;  3B6A A;  1QVT A;  4DYC A;  2H1K A;  3AQS A;  5J3L A;  2JA6 J;  4D7M A;  5K7F A;  1JKR C;  3IUV A;  3QPS A;  4AYB N;  2NS7 A;  3OIO A;  2M34 A;  1HDD C;  3KKD A;  2NP3 A;  3LJL A;  1BA5 A;  4A3M J;  3CWR A;  2ZOY A;  2G7S A;  2RAS A;  3PM1 A;  2DG7 A;  1I50 J;  4MO7 A;  2L7F P;  2GFN A;  3FRQ A;  4A3I J;  2MW8 A;  1LE8 B;  5FKK A;  4XIC A;  2CRG A;  3TW6 A;  2Y9Z A;  1TWG J;  3VP5 A;  5CXI A;  2MSY A;  1ETQ A;  1MH4 A;  2IAI A;  3QBM A;  2VPR A;  5HAW A;  3MN2 A;  4B3A A;  3G1O A;  2QKO A;  4A69 C;  4AC0 A;  2GBY A;  2ZCN A;  4BY1 J;  3JRA A;  2COB A;  5IOY A;  1H89 C;  2W53 A;  3NNR A;  3AQT A;  1AHD P;  1IG7 A;  4M3E A;  1EF4 A;  2R93 J;  2R7Z J;  3S14 J;  4JKZ A;  4W1U A;  1D5Y A;  1GUU A;  1RKT A;  3HTJ A;  2K9N A;  2NVQ J;  5EZG A;  3JRE A;  1NTC A;  3W6V A;  4MLO A;  3P9T A;  1JUS A;  1TWC J;  1ETX A;  2P81 A;  4NDL A;  3KNW A;  3LWJ A;  2XRL A;  4Y7N J;  3WHB A;  1HCR A;  1ORK A;  2OER A;  3IH2 A;  3HBL A;  4M3G A;  4GFK A;  3B6C A;  1IGN A;  2FD5 A;  3K7A J;  2XGE A;  5D18 A;  1TWF J;  2NOG A;  1S7E A;  2TRT A;  5IP7 J;  3ZQF A;  1X58 A;  2R5Z B;  3JRI A;  3H3V K;  1FJL A;  1K61 A;  4A3B J;  4IHW A;  5AQC A;  4AF5 A;  3O8H A;  2IEK A;  3ZQL A;  4MIM A;  5FLM J;  1B72 B;  4M3B A;  3HKZ N;  3OOU A;  2PBX A;  4FCY A;  4JX5 A;  1OJL A;  2ID6 A;  1WPK A;  3BR0 A;  2G3B A;  2DA5 A;  4IHV A;  5E3L A;  4JX4 A;  1RKW A;  1FIA A;  2XGD A;  2HDD A;  5BNG A;  1OFC X;  4BKX A;  5F0C A;  1ZR4 A;  2UXH A;  3LHQ A;  4NN1 A;  1Y1V J;  5C3E J;  3E7L A;  2D5V A;  1MSE C;  4C3J J;  1UI6 A;  1B72 A;  2TCT A;  5JLX A;  1HLV A;  1I3Q J;  3HGG A;  1UMQ A;  2EZL A;  2LP0 A;  3LSP A;  3O8G A;  4BBR J;  2DMP A;  5M5X J;  2QIB A;  3PO2 J;  2W48 A;  4A3F J;  2YUS A;  1IC8 A;  5EG0 A;  2WV1 A;  4QSH A;  4G12 A;  1DU0 A;  1MBF A;  5IYB J;  5C44 J;  2LVS A;  1U9N A;  3GTQ J;  5DS9 A;  1ITY A;  2VKV A;  3JRH A;  2G7G A;  2NVY J;  3WHC A;  4W97 A;  3TED A;  3QQA A;  2QCO A;  3KKC A;  3VVZ A;  1JTX A;  3HOX J;  1VF9 A;  2O8K A;  1ENH A;  1JT0 A;  2CJJ A;  3MVP A;  1FTZ A;  4MFE A;  1OCT C;  3L1P A;  3GTK J;  2K40 A;  1H8A C;  3FIW A;  2JWT A;  3I4N J;  4AUX A;  4ME9 A;  3GTO J;  5K58 A;  4PXI A;  1ZGW A;  2X6O A;  2NVX J;  3LSG A;  4DZP A;  3F1B A;  2XPU A;  3A01 B;  3JRG A;  3VW2 A;  3ZOB A;  4HNV A;  2JA8 J;  2DA3 A;  2DN0 A;  2E2J J;  2GUH A;  3NXC A;  1PUF B;  1JKO C;  4GCL A;  3O60 A;  2DA7 A;  5HOD A;  3ZQI A;  3RD3 A;  3VIB A;  4S0H B;  4JNN A;  3UKG A;  2DTZ A;  4JX6 A;  3S16 J;  5HBU A;  3BJB A;  3BT9 A;  3Q0W A;  1GVD A;  4B1R A;  1XS9 A;  4GCK A;  3ZQH A;  3OSG A;  1W0T A;  2OPT A;  3VVX A;  2LFB A;  1WH5 A;  1XG1 A;  3BG3 A;  1PUF A;  2HKU A;  2OI8 A;  4BY7 J;  1APL C;  1MBG A;  1W0U A;  3HOZ J;  3C2B A;  1LFU P;  1MBE A;  1WI3 A;  5FHP A;  2EH3 A;  1WCM J;  5FKL A;  3S1N J;  1FEX A;  3HDD A;  2QTQ A;  2HYJ A;  2AHQ A;  3BTC A;  5C4J J;  2M0C A;  2NVT J;  3HE0 A;  4IEJ A;  2VUM J;  3RH2 A;  1LE8 A;  2Y9Y A;  2O9L A;  1ZTR A;  2HXI A;  1VI0 A;  2EZH A;  1TC3 C;  2V57 A;  1RPW A;  3BRU A;  3BTJ A;  2RAE A;  2YS9 A;  4MXM A;  5D19 A;  5EZH A;  4RDU A;  4D7N A;  1WGX A;  1JKQ C;  3HOV J;  1MSF C;  2ZCM A;  3CJD A;  4IHY A;  4A3D J;  1I6H J;  3SDG A;  3BQZ A;  3GTG J;  3LNQ A;  3IV5 A;  1AU7 A;  5GPA A;  2CUE A;  3NRG A;  1NK2 P;  1ETY A;  4XID A;  3B81 A;  1E3O C;  2EBI A;  4KWA A;  3NI7 A;  1MBH A;  5K7H A;  4I6Z A;  2F07 A;  2EZI A;  3RZD J;  4XRS G;  4QIW N;  1IDZ A;  5M5W J;  2B63 J;  2HOA A;  4C3H J;  5FMP A;  1GDT A;  2R5Z A;  2XB5 A;  5HSZ A;  3M4O J;  4L62 A;  1Z0X A;  3NAR A;  4JP0 A;  4RBO A;  4BBS J;  2LR8 A;  5FKN A;  3BG9 A;  2UXO A;  3KZ9 A;  3CCY A;  1SFO J;  2M2E A;  4LOC A;  1BL0 A;  2G0E A;  2LD5 A;  2XB0 X;  4A3J J;  4GFB A;  2CUF A;  1JJ6 C;  2R92 J;  2CQQ A;  1JUP A;  2XDN A;  3E7Q A;  5M3F J;  1T33 A;  3PO3 J;  1U8B A;  3COL A;  5FGL A;  1A6I A;  1P7I A;  2VKE A;  3BR2 A;  3VOX A;  3GZI A;  1T56 A;  2WGB A;  2WUI A;  2UXP A;  4V2F A;  2UXI A;  4AC6 A;  4XRS A;  3K2A A;  5DAJ A;  2OF7 A;  3Q0U A;  5FLV A;  4QTR A;  1Q1V A;  2JJ7 A;  3HGY A;  3QKX A;  5EDN A;  2GEN A;  1FIP A;  4C2M J;  5DTD A;  2HOT A;  1F43 A;  1RR7 A;  4JYK A;  4D5F A;  3S1M J;  2UXU A;  3HM5 A;  3QPL A;  3C07 A;  4J19 A;  1AKH B;  1BW6 A;  3BR1 A;  2HXO A;  3CDL A;  5F04 A;  2ID3 A;  1A5J A;  1X2N A;  1P7J A;  2Y31 A;  3FK6 A;  3ANG A;  2ECC A;  2YVH A;  4NEL A;  2DMN A;  1G2H A;  3G56 A;  2HYT A;  4DW6 A;  2LY9 A;  2CU7 A;  1GV5 A;  4A3L J;  5FKO A;  5IYD J;  2IBD A;  2NP5 A;  2HI3 A;  4XK4 A;  3ON4 A;  1ETO A;  2DA2 A;  1MBJ A;  2XGC A;  9ANT A;  3GEU A;  2LLK A;  3VVY A;  1AKH A;  3CMY A;  2JN6 A;  2WAQ N;  3GBG A;  3OSF A;  4FE4 A;  5M5Y J;  3BR3 A;  3HTA A;  4L5E A;  3LOC A;  2ME6 A;  1HF0 A;  1CQT A;  4FIS A;  2JMW A;  1ETV A;  5C4Y A;  3A01 A;  3HTH A;  4ABZ A;  3SJM A;  3FKI J;  3V6G A;  1SGM A;  2LTP A;  2L7Z A;  2Y2Z A;  4Y52 J;  5F0F A;  2WB1 N;  1VFC A;  2O7T A;  2ECB A;  3JSJ A;  1ZKG A;  1SAN A;  1UG2 A;  2ELK A;  3TP0 A;  5J1Y A;  3D1N I;  3GTL J;  3FIS A;  3LSJ A;  2Q24 A;  1QRY A;  5EYR A;  1JKP C;  3RKQ A;  1RET A;  4B4C A;  3HOW J;  4A3C J;  3ANP A;  3HOY J;  4DYQ A;  1O4X A;  1TWA J;  2K9S A;  3A03 A;  5IOZ A;  1DU6 A;  3M3Y J;  3Q3S A;  2HOS A;  3IH4 A;  3Q0V A;  5M3M J;  4M3D A;  2HQ5 A;  1JGG A;  2DA1 A;  3G7R A;  1JT6 A;  2Y30 A;  3BTL A;  2KT0 A;  3HOU J;  2ZB9 A;  3LSR A;  4X6A J;  2QWT A;  1ETK A;  3JRC A;  5GP9 A;  2N8G A;  3BR6 A;  2EQR A;  2L9R A;  2PZ9 A;  1MH3 A;  3HTI A;  2PMZ N;  4M6V A;  1JUM A;  2R0Q C;  3IH3 A;  3S1Q J;  2RHA A;  3BNI A;  2M9H A;  4BXX J;  4UDS A;  3S2D J;  3HIM A;  5F27 A;  1JTY A;  5IP9 J;  1QVU A;  3RZO J;  2XPW A;  4DYR A;  2QF7 A;  3FK7 A;  3GTP J;  1F36 A;  2XSD C;  4V2G A;  1X2M A;  3CRJ A;  2LKX A;  2DMQ A;  2L0K A;  5CXG A;  3BQY A;  3MNL A;  4A3G J;  1ZK8 A;  2E2H J;  1ZR2 A;  2IU5 A;  2FJ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...