2IBDA

Crystal structure of probable transcriptional regulatory protein rha5900
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
192
structure length
192
Chain Sequence
b'GKSGRRTELLDIAATLFAERGLRATTVRDIADAAGILSGSLYHHFDSKESMVDEILRGFLDDLFGKYREIVASGLDSRATLEALVTTSYEAIDASHSAVAIYQDEVKHLVANERFTYLSELNTEFRELWMGVLEAGVKDGSFRSDIDVELAFRFLRDTAWVAVRWYRPGGSVTVDTVAKQYLSIVLDGLASP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Possible transcriptional regulator
publication title Crystal structure of Probable transcriptional regulatory protein RHA5900
rcsb
source organism Rhodococcus sp.
molecule tags Structural genomics, unknown function
total genus 72
structure length 192
sequence length 192
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17932 TetR_C_24 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2ibdA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2ibdA02
2ID6A 4KWAA 3VUQA 2FD5A 4C3IJ 2MW8A 1S7EA 2KDZA 2HI3A 2M0CA 2P81A 1XC5A 3CRJA 5HBUA 5EGOA 3QPLA 4LOCA 3JRCA 1RKTA 2Q24A 3HTAA 1MSEC 1ENHA 3JRAA 4GCLA 3E7LA 3GTQJ 2O8KA 4V2FA 4D5CA 3ZOBA 2NP5A 4L5EA 2ZOZA 5BNGA 2FX0A 3BHQA 2DA3A 4AUXA 2O9LA 3BG3A 5FKNA 1YRNB 5GPAA 1JGGA 2XGDA 1IJWC 2NVQJ 4Y52J 2O7OA 2G7LA 5FHPA 5J1YA 3SJMA 1FIPA 1IGNA 4MIMA 3VPRA 1UMQA 5DS9A 1JUPA 1F36A 3BR5A 2OPTA 1Z77A 4DZPA 5K58A 2HQ5A 2JA8J 3TW7A 2WV1A 1H88C 5F04A 3VVYA 3VVZA 1CQTA 1ETKA 2X6OA 3DPJA 1ZGWA 3GTKJ 5E3LA 3DCFA 1DU0A 2MGQA 4DW6A 3PASA 3BJBA 1Q1VA 3OIOA 1ZQ3P 4CYCA 1MBFA 1ZK8A 5C4JJ 2NVYJ 1PUFB 3ZQIA 4C3HJ 5M5YJ 1TWFJ 2L0KA 3QPSA 3KNWA 3A01A 5EYRA 2VI6A 2G0EA 3FK6A 2DG7A 3VW2A 1JKRC 4HKUA 1HLVA 4BKXA 4I6ZA 2ME6A 2GENA 5EEAA 1QVUA 4A69C 5IOYA 1HDDC 1APLC 2EQRA 1IRZA 4DYQA 3LSJA 5GPCA 4FCYA 3HOXJ 2CRGA 2IEKA 3VVXA 3MVPA 1LE8A 5F27A 4GFBA 4A3EJ 5FJ8J 4A3JJ 3ZQHA 2DTZA 1ETVA 2K9NA 4B4CA 2EZHA 3HOZJ 2DN0A 3OSFA 3NPIA 2JWTA 1SANA 1XS9A 3KKDA 2R5ZB 3BTJA 5HODA 2PZ9A 5HSZA 1IC8A 1IUFA 2HOAA 3HOVJ 3I4MJ 2NX4A 3LHQA 4FTHA 5EG0A 5FMPA 3S1QJ 4AF5A 5K7HA 3DEWA 4M3DA 2WUIA 2AO9A 1AKHA 5C4XJ 2JK3A 5JLWA 2QOPA 3HOUJ 2HXIA 4AYBN 2YU9J 4W1UA 5DTDA 1JT0A 5C4YA 4MFDA 2R5YB 1G2HA 3I4NJ 3Q0UA 4BXXJ 3HTJA 3S15J 3UKGA 2NVTJ 2YVEA 1DU6A 4MFEA 4JX5A 1QVTA 4A3IJ 4MK6A 2Y9YA 1ETWA 3BRUA 2WGBA 4G12A 2UXOA 2EH3A 3HKZN 1BW6A 2DA4A 3GEUA 3BR2A 5M5XJ 3PO2J 3CMYA 3ANPA 3ZQFA 2K9SA 3QQAA 1JUSA 2DA5A 3K7AJ 1H8AC 2XGEA 2I10A 5M3MJ 3RH2A 2EZLA 3F0CA 1VI0A 2JN6A 2ME0A 3BR1A 1IDZA 5IP6A 2LLKA 3T6NA 3LJLA 3V78A 1A6IA 5D1RA 1HF0A 2QKOA 1AHDP 4NDLA 1UG2A 4QSHA 3BT9A 4JYKA 4FE7A 3BQYA 4MLOA 4XRMA 3SFIA 1UI6A 2L9RA 2GFNA 2YUSA 1B8IA 3GTLJ 1MH4A 2R93J 3S16J 3JRIA 2E19A 3KZ9A 2VUMJ 3WHBA 3JRFA 3G7RA 2H1KA 5JLXA 3CQZJ 3LSGA 3HE0A 4FE4A 1NK2P 3VOXA 4MO7A 3E7QA 3TEDA 3IH2A 4BY7J 3G56A 1MNMC 2XPWA 4L62A 4DYCA 3CCYA 1I3QJ 5DAJA 1JKOC 4CYCB 3M3YJ 1MSFC 3V6GA 3O8HA 2X48A 1RR7A 5E3NA 4IHWA 2REKA 1FIAA 5F0CA 2QCOA 1MH3A 4A3MJ 3GTGJ 2XDNA 5D18A 2G7SA 3Q0WA 1ETXA 1FJLA 4V2GA 4C2MJ 5F0FA 3VW1A 3OOUA 1JJ8C 3HOYJ 2D5VA 1QRYA 3A01B 4FISA 5IP7J 2CU7A 4X1EA 2DMPA 5IYDJ 1OCTC 1F43A 3RZOJ 2MG4A 3H3VK 3HM5A 2EZKA 1SGMA 1QPIA 2UXPA 3HBLA 3CJDA 4RDUA 3RKQA 1FTZA 1WI3A 3JRBA 3ZQLA 3JR9A 3HB9A 2QF7A 5J1RA 1ZTRA 3AQTA 1YRNA 3OSGA 2UXHA 3BCGA 3C2BA 1LE8B 2GM4A 1GUUA 1WGXA 3MKLA 1ZR2A 3FRQA 1TWGJ 3RZDJ 2XGCA 4D7MA 1RKWA 1K61A 1IG7A 1EF4A 3HEFA 3CWRA 4JKZA 3EUPA 3IH4A 2H8RA 4HNVA 4A3CJ 2X9DA 1ORKA 1Z0XA 2JA6J 9ANTA 1POGA 2CQXA 3S5RA 2WB1N 1X2NA 1WPKA 3TP3A 3BR0A 2CUEA 1GT0C 1H89C 1X2MA 2W48A 3GZIA 2LK2A 1HCRA 2Y9ZA 3JREA 5CW8A 4XK4A 1ETQA 4X6AJ 1U8BA 5IYCJ 1AKHB 2E1OA 5CXIA 3NNRA 4ABZA 3MNLA 2RAEA 5FKMA 5M3FJ 2L7ZA 2M9HA 2DA6A 3HGYA 3GTJJ 1B72B 4M6VA 1U9NA 2YS9A 3RQIA 4ICHA 2TRTA 5FLMJ 2Y30A 3FKIJ 3FISA 4A3DJ 3P9TA 5EZGA 2DMNA 5EDNA 2R7ZJ 3PO3J 3S2HJ 2IU5A 3HGGA 4EEFG 4A3KJ 2OF7A 2FBQA 3S14J 1JKPC 5K7FA 2LVSA 2ECBA 2XPVA 3C07A 3M4OJ 3VOKA 1FEXA 1BW5A 1GVDA 1JUMA 4DZJA 1GDTA 2OI8A 2QIBA 2CJJA 3B6CA 1R9TJ 3JSJA 5HAWA 2LKXA 5EZHA 4GCTA 2HXOA 2M34A 2NVXJ 3S17J 2RASA 1LFUP 1MBHA 1OFCX 3BG5A 4RBOA 4XRSG 1U78A 3HTIA 2ELKA 3O8GA 4ACIA 5EGOB 4A3FJ 2JMWA 4JX6A 4JX4A 3S1RJ 1HOMA 1MBJA 1JTXA 1HDPA 5FKLA 2QWTA 4C3JJ 2DG8A 2ZCMA 5J1UA 5J3LA 1B8IB 1T33A 1TWCJ 1E3OC 1X58A 1Y1VJ 2EBIA 3PPBA 5M5WJ 4S0HB 2VKEA 4A93J 4JNNA 2LD5A 2HOTA 3NXCA 2AHQA 3A02A 3JRDA 5EFYA 2XPUA 1WCMJ 1SFOJ 2DJNA 3IH3A 2HYTA 1W0TA 2IBDA 3S1NJ 4D5FA 2GUHA 5IYBJ 2W53A 3KKCA 2HOSA 3NARA 2JJ7A 1RESA 4QTRA 4UUTA 1ETOA 2DA1A 2LR8A 3PM1A 4A3BJ 4UUSA 3BR3A 2MSYA 3HIMA 5E3OA 3B6AA 2VKVA 4IHXA 1NTCA 2LTPA 2YVHA 1P7JA 2B63J 1I6HJ 4M3FA 5C3EJ 3LOCA 2HDDA 1ZR4A 2G7GA 2DMQA 5AQCA 4JP0A 4M3GA 4A3LJ 3G1OA 1D5YA 3ZQGA 3JRHA 2GBYA 2DA2A 3GTPJ 1P7IA 2G3BA 2DMUA 2F07A 4M3BA 3BTIA 3VIBA 2CUFA 2V57A 4UDSA 1FTTA 4W97A 4IHVA 3BTLA 4GFLA 1LFBA 2E2HJ 3D1NI 1BL0A 5EF6A 1UI5A 3G1LA 4JL3A 1U9OA 5H9TA 2D6YA 3IUVA 1Y1WJ 1AU7A 3LWJA 5F0HA 4CGRA 3JRGA 3GTMJ 1UHSA 1GV2A 2LFBA 4DYRA 2GLOA 1WH5A 2NP3A 1TWHJ 4IHYA 2Y0SN 4XIDA 5CXGA 1VNDA 2HKUA 2QTQA 2ZCXA 3NAUA 2O7TA 3QBMA 3AQSA 2ID3A 2NS8A 2XRLA 3BTCA 2N8GA 5GP9A 3Q0VA 2M2EA 2LP0A 5C44J 3S1MJ 3CDLA 1JJ6C 3RD3A 1VF9A 3S2DJ 3VW0A 4BBSJ 3F1BA 3TP0A 1W0UA 3W6VA 3VP5A 3BNIA 5F08A 1VFCA 3Q3SA 1T56A 4XICA 3MN2A 3TW6A 2PMZN 1RETA 2NOGA 1TC3C 5EG0B 3LSRA 2Y31A 2PBXA 2CQQA 3COLA 2XSDC 2LY9A 3SDGA 2EZIA 1O4XA 4BY1J 5IP9J 1A5JA 4Y7NJ 5FGLA 3QKXA 3A03A 2L7FP 3BQZA 5FKOA 3GBGA 1PUFA 2OERA 2UXUA 2ECCA 1MBGA 2ZOYA 3ANGA 4B1RA 5D19A 1JT6A 4GFKA 5E3MA 1MBEA 3IV5A 5FLVA 3NI7A 1JTYA 4BBRJ 4NN1A 1IDYA 3O60A 1ZKGA 2VPRA 1RPWA 2TCTA 1K83J 3FIWA 2E2JJ 5IOZA 3NRGA 3HTHA 4M3EA 2ZB9A 4AC6A 3L1PA 2R0QC 2R92J 1XG1A 3LSPA 5F1JA 4D7NA 4ME9A 3ON2A 5FKKA 4YZEA 1MBKA 2DMTA 1TWAJ 4QIWN 3GTOJ 3FK7A 2COBA 1GV5A 2JA5J 2IAIA 1OJLA 1IV6A 2HYJA 4A3GJ 2FQ4A 2R5ZA 2ZCNA 1ITYA 3WHCA 4IEJA 1BJZA 1B72A 3BG9A 4NELA 2XB0X 3LNQA 2XB5A 2M8GX 5IPAA 3ZQCA 4PXIA 1I50J 4UUSB 2NS7A 2K9QA 2L7MP 4XRSA 3EGQA 2UXIA 1OCPA 2RHAA 3K2AA 1BA5A 2KT0A 4J19A 3G1MA 1WH7A 4B3AA 2FJ1A 2WAQN 3BR6A 2JA7J 2DA7A 5K7ZA 3B81A 1ETYA 2E2IJ 3ON4A 3H0GJ 4GCKA 4MXMA 4I76A 2R5YA 2Y2ZA 2K40A 4AC0A 3HOWJ 3HDDA 1JKQC 1NK3P
chains in the Genus database with same CATH superfamily
5A2QK 3DEEA 3M07A 4KWAA 3VUQA 2FD5A 4LJZF 4AIHA 4ZTJA 1LPQA 4KFCA 2P81A 1OPCA 1B4AA 5HBUA 4ZDLA 3KP5A 4XKCA 1MZBA 1KQ0A 3ISPA 4OIOF 3FXJA 1U5TC 4CZZA 2FU4A 1V4RA 3JRAA 2KDOA 3FMQA 5J47A 4WWCA 3TGNA 2X1CA 3OYKA 1LDKB 4D5CA 2CMPA 2VIXA 3ZOBA 4L5EA 2VQHA 3E6DA 4M6XA 2BXYA 1ZLJA 2LH9A 2I8DA 4ZDOA 1JGGA 1S9HA 3AFHA 5D6FA 2ZMEB 3SJMA 1FIPA 3WE2A 1P4XA 5CQGA 4UNOA 1W4MA 2KHMA 1I39A 1UCRA 4NQWB 4WXCA 5K58A 2HQ5A 4LG0B 2JA8J 4GXOA 5F04A 2MH9A 1KZHA 3E1SA 2ZCWA 3OYJA 3VVYA 3HRTA 4UVAA 3VVZA 1KU2A 3VODA 1ZGWA 2CFXA 4DW6A 4HLYA 2A2FX 3U9GA 3BJBA 3CC4I 4BEHB 2QKMB 2VXZA 2R7QA 1IXRC 1MBFA 1YOVB 4BAYA 5C4JJ 3PQJA 3L9FA 2XDVA 5CVIA 2IW5A 5M5YJ 1XSDA 3ABMH 1TWFJ 2L0KA 4HV5A 3LA3A 5DCMA 2DYRH 5EYRA 1K6YA 2DG7A 3K4KA 1JKRC 3S3OA 3LFKA 4V19K 1FP2A 2XAHA 1QVUA 1VQ6I 1APLC 2QA4I 1WVRA 1XSXA 4DYQA 1Y0UA 1LUJB 5HDGA 3T0YA 1I3AA 3H5AA 4FCYA 1LDJA 3VVXA 2VBYA 3TDUC 2L5QA 1LE8A 3O3KA 4L0ZB 5FJ8J 3EUHC 2DTZA 3CZ6A 4RAFA 5GAHJ 2Z16A 4XLNF 4PJJA 1SVLA 2KLOA 5H20A 3V7RA 3KKDA 4JQFA 3ERMA 2R7DA 2EIMH 1MW7A 2V9KA 5HODA 3AL0B 3KYCB 5HSZA 3GZNB 3QODA 1IC8A 1IUFA 2XUBA 1VQKI 3HOVJ 3I4MJ 3LHQA 4OWRB 5LEJA 2HYGD 2VASA 3IKVA 2E1MB 2XASA 2K3PA 2JK3A 4AYBN 2E1CA 4KISA 3DKXA 4W1UA 4XRFA 5DTDA 3RIRA 2BYVE 1NG7A 2R5YB 3DV8A 3E5QA 1G2HA 3WG9A 3HTJA 5JHUA 2M7BA 3S15J 3COAC 3ZMVA 5HS8A 1D0XA 3QU3A 1DP7P 1DU6A 2OCCH 3C7JA 4HSTA 3CJTB 1XTAA 4G12A 1RZ4A 2FEZA 2IA2A 1I1SA 5E17F 2DA4A 1FBQA 3BR2A 2VLAA 1O3SA 3PO2J 1UFMA 3PNTA 1B6AA 3QQAA 4PDKA 1JUSA 5B5EC 3HOSA 4MEXF 2EZLA 4KNYA 4IVNA 2CWEA 3H35A 4OAYA 1Z91A 3I71A 1AWCA 4R79A 1C0WA 3J7YJ 2KL4A 4NDLA 1G4DA 3K4CA 2D1VA 1IF1A 2W4SA 4XRMA 3HHGA 3SFIA 2X1DA 2GFNA 1DGWY 4C2MA 1MH4A 5CVVA 3S16J 1WJBA 3P7NA 2WV0A 3PIOF 3JRFA 4IOAF 5JLXA 3JTHA 2KMUA 3TOBA 5BMZA 4FE4A 1MDMB 1NK2P 2FOKA 4EQQA 3VWBA 5B3SH 3OYMA 3VOXA 1N25A 1ZHFA 2ELJA 3I3LA 4NNJA 5F64A 5GADJ 3UR3C 2F5EA 4DYCA 1I3QJ 3MZ8A 5DAJA 2HNHA 1XCVA 1MMSA 4N0BA 1MSFC 3O8HA 1RR7A 4FETA 1J7KA 2L9NA 4I01A 4LIUA 3GFJA 4EJVA 5F0CA 2AQFA 3IP4B 3PUBA 2G7SA 5ED4A 1ETXA 4OINF 3OS0A 3K4JA 1FJLA 4C2MJ 3D0SA 3VW1A 1SMTA 2O8XA 3OOUA 3TO9A 1JJ8C 1REPC 1MJBA 2GIZA 5DCMB 5IYDJ 2VB6A 3HM5A 2BEOA 2EZKA 3IC7A 4XBFA 1XSVA 4XR6A 3N05A 2FBKA 4RDUA 2YX4A 1FTZA 2G9WA 3ZQLA 1YIJI 2HFHA 2BBYA 2O03A 3MKYB 2DLLA 1YRNA 2QKLB 1TW2A 1LE8B 3CESA 4F3QA 3CCRI 1TWGJ 1K61A 4ZYAA 1IG7A 3RTRA 2KIUA 4QPOA 5EEHA 4IRIA 4ENJA 2GQQA 2Q2EB 2H8RA 4PFPA 4A3CJ 1HA8A 2X9DA 1Z0XA 2JA6J 2J5PA 5ILSA 3S5RA 5FFXA 2WB1N 1YS7A 1V55H 3OYAA 4LB6B 2CUEA 1GT0C 4O5VA 2Y9ZA 3HIFA 1Z7LA 2EFOA 2CH0A 3JREA 4XK4A 4Y4RA 1ETQA 4HBLA 4PJ0C 2OC6A 2XKOA 2VJJA 5AONA 3MNLA 3V8JA 2HZDA 1S3JA 5FKMA 4E6KG 3CC7I 3HGYA 1RR8C 2YR2A 2FE3A 2OCEA 2YS9A 3RQIA 5FLMJ 2Y30A 3FISA 1CF7A 2YSRA 4CICA 2R7ZJ 4IRVA 2OF7A 1UAAA 3LFUA 2P6TA 5K7FA 2KZVA 3FXOA 3C07A 1R4MB 4LD5A 4IPAA 2LC2A 3M4OJ 3VOKA 1T38A 5LRRA 2GXAA 3BZCA 2FRHA 2VJIA 4QPQA 1I1GA 3HZJA 5EZHA 4GCTA 2EA4A 2MLGA 1B1BA 5CVJA 2MD5A 3EYIA 1FYLA 4P96A 4ACIA 2DU9A 2QQAA 2EV5A 3K9TA 4JX6A 1HOMA 3JAMK 2ADUA 2QWTA 2DG8A 5KAFC 1D8KA 2IRFG 4XL9A 4RB1A 4YFXF 3V4GA 2VBZA 4RA2A 2DQLA 3MZHA 1R36A 1U8RA 5JVGF 3W3CA 2VE9A 3IRRA 5M5WJ 4JNNA 3NXCA 4I98B 3K1PA 4D0PA 3KEYA 4BDYA 3PFYA 4B47A 2E71A 2MBFA 4Z2YA 2QLZA 4C30A 1R58A 3WTZA 3KYLA 1OLTA 2IBDA 4L18B 3S1NJ 3Q5FA 5J6XA 3E97A 3NARA 4NHJA 1IN5A 4A3BJ 1QHHD 2QQ9A 5HDKA 2EFPA 5GTIC 3R60A 3T8TA 4G6QA 4M3FA 3OYHA 4IX7A 2HDDA 1J9IA 5FLXK 1G3TA 2P7CB 4CHUA 2XAJA 1BC8C 4M3GA 3ROUA 3G1OA 1QZEA 3F8NA 1W5CC 4M3BA 1IV8A 1H0MA 2CUFA 3FX3A 1Y8RB 4KT5C 6PAXA 2HQAA 4W97A 2E1NA 3BTLA 4II2A 2PJRB 3NEUA 1BL0A 3G1LA 5D4RA 4JL3A 1U9OA 3I64A 4IQJA 2OA4A 4I09A 1ZRDA 4HZFA 5F0HA 3GTMJ 2LFBA 2GLOA 1UG0A 2NP3A 5CXGA 4D9JA 2PFVA 3K1NA 2JVGA 3PNVA 3CP2A 2VBWA 2ZXHA 1VTNC 2LREA 3WODF 1KQ9A 3FKJA 2XRLA 3BTCA 5F1RA 3I58A 1JJ6C 4I7HA 2VL8A 2VBXA 4JBAA 1SFKA 3F1BA 4HG2A 3BNIA 2BY1A 3U1DA 3Q3SA 1VFCA 2LF8A 3KEOA 3F72A 1J59A 3HTSB 2W57A 2R7OA 2W82A 1S5LC 4FHTA 1BI0A 4NC8A 3GFIA 3MN2A 1J0RA 3X2QH 4O3MA 1TC3C 1CF7B 2FXAA 1I6XA 4XLCA 2Y31A 2CQQA 4MHGA 3QOPA 3IHUA 1GLNA 3ML6A 4OIRF 5L3CA 1A5JA 2VT2A 5FGLA 1WHUA 1YHQI 2XAFA 3JAMZ 2E7XA 2UXUA 3BQZA 4ZYGA 3HTUA 3BZ6A 4I0BA 4BS9A 1R1VA 2A5WA 2IS1A 3WGIA 4BQAA 3ABUA 2ZOYA 3ANGA 5FLVA 1R1TA 1WJFA 2VQLA 3BDDA 3RPQA 1JTYA 2BVMA 4NN1A 4UY8I 4U7BA 3ECHA 2VODA 1HKTA 1Z67A 2YPRA 2VPRA 1K83J 1OR7C 3C3WA 3DWLE 3KCCA 4S04A 1R4NB 4M3EA 1O7FA 4L0YB 5LHIA 4AC6A 3L1PA 1Z6TA 4C9YA 3CMAI 4ME9A 1WSUA 1MBKA 2QBYB 3GTOJ 2HDWA 2W84A 2COBA 1XMAA 2ZFWA 3R6SA 1OJLA 3PQKA 4A3GJ 1YTYA 2FQ4A 5FLXZ 5KAIC 2Z5UA 3FXQA 3BG9A 3SZGA 3GMEA 4Y15A 3K8PC 1YJNI 4KT6A 2XB5A 3ZQCA 4XOPA 5DCFA 2K9LA 1QQIA 4UB6C 4XRSA 1P6RA 3L2WA 3E6CC 1IUYA 2HDCA 2CFOA 2KT0A 3BJOA 2E34A 4B3AA 2WAQN 2YU3A 3HSFA 2R7VA 2LKPA 2Y2ZA 1LNWA 1HQCA 1Y8QB 3F6OA 3D5SC 3HHHA 4IRHA 4U0YA 4C3IJ 2MW8A 1BOAA 2M0CA 3IWFA 1D1CA 3CRJA 5EGOA 4LOCA 2ZXIA 1RKTA 4KN7X 2RNJA 1ENHA 4E7ZA 4GCLA 1USSA 1FOYA 2D1HA 1XN7A 4V2FA 5E8IA 4UVBA 2QM3A 1X1BA 1V54H 3OOPA 2FX0A 3VYSB 3BHQA 3J80K 4AUXA 1Z21A 2M30A 2O9LA 2B3WA 5FKNA 4HA8A 1O3TA 1YW7A 1W7PB 3CMEI 2G7LA 5JVTA 5FHPA 5J1YA 5D5UB 3VPRA 1UMQA 5DS9A 1JUPA 3ZMSA 2LG4A 3HKZA 1ZGJA 2K3FA 4WXHA 2VOOA 3K0LA 5K5QA 1XMXA 2WV1A 4G9YA 1H88C 3V8KA 1EJ9A 3LL7A 2B1EA 1CQTA 1ETKA 3OYEA 1J75A 3REOA 4Q47A 3GTKJ 5CYVA 5E3LA 3OYLA 2Y69H 3ELKA 4KJZA 1Q1HA 2E7WA 4KIGA 1J2XA 5HS9A 3JW4A 2VXDA 1ON1A 1A31A 4HW0A 5JFRA 5HNFA 1ZQ3P 4L9TA 2BGCA 4CYCA 1D8JA 1ONVA 2FNPA 2LKSA 4LLGF 4UUVA 1LEBA 1E0EA 3IAM2 5TISC 1ZK8A 2E60A 3GVAA 2X4HA 3K4BA 1MMNA 2M4GA 5LHHA 1GVJA 2NVYJ 1LVAA 4KMFA 3VB2A 3IAS2 3KNWA 3A01A 2HEOA 2VC1A 2M4KA 2F5VA 4PUSA 2G0EA 3QOEA 1HLVA 1SVOA 3NWTA 3DU5A 5LGUA 4BKXA 4I6ZA 2GENA 5HNHA 2CW7A 2DOAA 5IOYA 1IRZA 2VC0A 4FASD 2W1OA 3MWMA 1Z6RA 2NOJB 1K4SA 4Q48A 4B09A 4CA0A 3MVPA 3MD2A 1SAUA 3OV8A 4GFBA 3I9V2 2CO5A 4IHTA 4E70A 2K9NA 3ZP5A 3HOZJ 3OSFA 2LSOA 2NRAC 2JWTA 2A61A 3LA2A 2H8WA 1X1CA 5K1YA 4BE2A 4AM3A 4XKVA 1D3YA 2HWVA 1YI2I 2NX4A 3EUHA 3I5UA 4XLFA 1F1ZA 4KYWA 2AXTC 3N97A 1TW3A 3VYUB 3HG9A 4DBRA 5JLWA 3HOUJ 2QOPA 1BI3A 1VQNI 5AIPA 3DP7A 2CGPA 1PP8F 2QYOA 3CCUI 1SAXA 5DYMA 3I4NJ 3Q0UA 3AKZA 3SFZA 3DQVC 2HTSA 2VOPA 3OWTA 5EJCA 2YVEA 2J5OA 3BLYA 3J80Z 3ZN0A 4BDZA 4MK6A 2ZKZA 5LRSA 3PSIA 4Q4ZF 2HKXA 4EMSA 2XHKA 1BW6A 4LG3A 1ERDA 3GEUA 1A36A 3CMYA 2EPFA 3K4MA 1WFXA 2DA5A 3P9IA 1H8AC 2I10A 3TO7A 3RH2A 3F0CA 1VI0A 2ME0A 3KETA 4B48A 4J01A 3I59A 1S72I 2DYSH 3T6NA 1HXDA 3S2WA 1FOWA 1U5TB 3QYEA 3GYHX 1W36D 1YW8A 1UG2A 4PZJA 4JYKA 3G3ZA 2IGKA 3V8LA 3KP7A 4PJLA 4I2OA 1ZH5A 2DFFA 1ZG1A 3M8EA 1B8IA 2RKHA 1VZ0A 1YG2A 2KQRA 3KZ9A 2VUMJ 3CF2A 1YW9A 1BC7C 3HYIA 3LSGA 3DLAA 4RAZA 3HE0A 3L2VA 3BG6A 4KUMA 2GAUA 3CUQA 1MNMC 3G56A 3J7ZI 2VJ5A 1L0OC 4G8XA 4HV6A 1USTA 1YLFA 3LMMA 4CYCB 4X0GA 1S29A 3R0AA 1X1AA 5E3NA 4GDFA 4MNUA 1TZLA 3GTGJ 4EJUA 4V2GA 1QGPA 1FOXA 1K6OA 1K78B 1QRYA 3A01B 4M9ZA 2M0MA 4HOBA 1Z9CA 2X1EA 1OCTC 2EIJH 1Z05A 3RZOJ 3H3VK 2L54A 3OYDA 1LVKA 4A0ZA 2UXPA 4IF4A 2OJED 2KIQA 1WI3A 3EDPA 2BXZA 1LEAA 2RNGA 5J1RA 2JUCA 3KPHA 3ZRGA 2L2OA 5LGNA 1WWXA 1NHAA 4XLEA 3L09A 2FF4A 2GM4A 2EIKH 1GUUA 2KISA 4E7JA 3RZDJ 2XAGA 1TQIA 5J40A 3LQQA 4YG2F 5LD2C 3EUPA 3VYTB 5B1AH 4HNVA 5B66C 5GAEJ 5DV5A 3E3VA 3GLLA 3F23A 1ORKA 9ANTA 3U2RA 3ERED 1POGA 2CQXA 3CF5F 4OD5A 1WPKA 3BOQA 3DLLF 2V6EA 1HW1A 3GCMA 2W48A 3M1CA 3S8PA 5LEKA 1HCRA 1F9NA 1SD4A 1FSEA 4AD9A 3FHZA 2Z9OA 3HC7A 1BIAA 2KIFA 1FLIA 2LY1A 4M72A 4ENKA 1W5SA 5M3FJ 3DTKA 3DTIA 2UUZA 2L9VA 3GTJJ 5D5WB 3G71I 4M6VA 5BPDA 2DAOA 2DCEA 5EZGA 1AA7A 3TKYA 2DMNA 3H9GA 3HOTA 4M6YA 2VPLA 3HGGA 2X85A 4HRIA 2FBQA 1MNDA 5L3BA 2LVSA 2KRCA 2ECBA 2CUZA 1YFHA 4CUGA 2EK5A 3WE3A 1P9QC 1LFPA 1Z3YA 4KICA 1S8NA 4CYDA 2X6XA 1GDTA 2ZSIB 2FA5A 5HAWA 1S7AA 4LGWA 4EM0B 2ZJRF 1G59A 4L9NA 2MLKA 5DM7F 3I56I 2M87A 1LFUP 1JE8A 3BG5A 2RASA 2XSJC 4XN3A 4XRSG 1U78A 2Z1DA 4LK0F 3HTIA 3HRMA 3H9JA 1FMVA 3TQNA 4Z6YA 5DD8A 3S1RJ 1JHHA 1HKSA 5F6FA 1MBJA 1HDPA 2CV2A 3ZN1A 2ZCMA 1R1UA 1KYZA 4KIBA 4P9UA 5LGTA 3HPHA 3LWFA 1B8IB 2QSGX 2A69F 1E3OC 2PG4A 3RCOA 1P4AA 3KZYA 3PPBA 1YS6A 1D1BA 2AS5F 2VKEA 1UB9A 4EVIA 3C2GA 3M9AA 2FUG2 2AHQA 4BHBA 3I54A 2LD5A 1NH3A 3JRDA 3HSRA 3RKXA 1IN6A 2PX9A 3CCSI 2DJNA 3MKZA 4R8HA 3H3UA 2LY2A 2X6YA 1W0TA 3CUQC 4L5IA 3A4CA 3HSEA 4P5OA 4C2TA 5IYBJ 2W53A 3F8CA 1B9NA 3PJRA 2M7AA 2DA1A 3HIMA 3BR3A 5E3OA 2A68F 2VKVA 4CO8A 4LK1F 2YVHA 3FHNA 1P7JA 5C3EJ 2K27A 2DMQA 3QPTA 3P5JA 2DFEA 3F9KA 4ASNA 4YIRX 3F8BA 1TNSA 4RGRA 1HC8A 1MGTA 3ZQGA 4B3XA 1RNLA 3GTPJ 1SFUA 3BTIA 2MABA 3FXLA 1FTTA 2R7UA 3RQ4A 2QUFA 5FROA 2OQRA 1RUOA 1LFBA 3V42A 1S6LA 3D1NI 5EF6A 1FYMA 3K69A 5KHDA 1QZYA 1R23A 3NRVA 4GGGA 2CS3A 4AIJA 1P4WA 1AU7A 3BY6A 5D5VB 3JRGA 3N4MA 4CGRA 1GV2A 4MGRA 4DYRA 4M71A 3L2QA 2Y0SN 1RUNA 4EGZA 1BR4A 2QTQA 2ZCXA 1RRJA 3PUFA 1QZZA 2NS8A 3GZ5A 1JXSA 1Y56A 2V26A 2N8GA 2O3FA 3CTAA 2M2EA 5C44J 2NNYA 3RD3A 3CDLA 4U9NA 3JSPA 1VF9A 2TDXA 1W5TA 1WQ2A 3TP0A 4NC7A 3LAJA 5F08A 5KK1A 2P0WA 4XICA 2BVLA 1VQ4I 2LMDA 2PMZN 4PK4A 3ZMUA 1MJAA 2NOGA 2X6WA 2QVOA 4R1HA 1A04A 5D5XB 2PBXA 2CUJA 2XSDC 2OQGA 5HLIA 4N4NB 1AOYA 1T39A 2LY9A 1R5ID 2EZIA 3HPGA 4M9XA 3ONQA 1O4XA 1T98A 2F5DA 1WJEA 1FBSA 3CJQB 1MBGA 3NWSA 1MJ9A 3H0DA 2QQ8A 1JT6A 4GFKA 5E3MA 2VKHA 1KYWA 4A12A 4DOZA 1O57A 3NI7A 4RLQA 3PFIA 1JI8A 2G7UA 3ZPLA 2BW3A 2L02A 2ZBKA 1TQMA 2ISZA 3CO6C 2H27A 5TJJA 5ICFA 2NVUB 3FIWA 1XGSA 5IOZA 3NRGA 1OCOH 2PEXA 3HTHA 2ZB9A 2LBFA 4GYGA 3ZMTA 4ZJZA 3QWLA 3FM3A 2FNAA 4O6JA 3VEPA 1XG1A 4IZZA 2JPCA 4XM3A 3LSPA 2I5UA 2Q8KA 4RB0A 2OBPA 5F1JA 1HBXG 3F8FA 3LSTA 4BE1A 5FKKA 2R7TA 5FB2A 1D0ZA 2HYFA 1TWAJ 4OIQF 1KU7A 1OR7A 3VYRB 2IAIA 5KCMA 3SDBA 3QRFF 2R5ZA 4RAGA 1ITYA 2ZCNA 2DW4A 2O5RA 2UV1A 2QGUA 4DNCA 2R7WA 1B72A 4L9JA 4G7OF 4NELA 2X51A 3B02A 3SQNA 2K85A 2M8GX 4PXIA 2DFHA 2K02A 2RREA 4CGZA 1BOBA 3AG4H 3ASNH 2UXIA 2RHAA 4HEA2 2DT5A 5ICEA 4Q5SF 3OR2C 2FJ1A 3BR6A 2EV6A 2DA7A 1ETYA 2IGMA 2RQQA 2KIMA 4MXMA 4I76A 2ZXJA 4AC0A 3HDDA 3VOEA 2MH2A 2IXSA 1PJRA 2VQGA 1UELB 4YRVA 2HI3A 2BHZA 3CCJI 3T8RA 4WK8F 3A0BC 2R7FA 3QPLA 4XORA 3KP4A 3JRCA 2Q24A 3HTAA 2R7SA 2DK8A 2FBIA 5FFZA 2O8KA 2MC4A 2Z3YA 3EUAA 4AYBA 1E3HA 2K4BA 5HLHA 2JRMA 2ZOZA 2HQNA 2IS4A 2GOXB 1R6RA 2BOLA 2XKPA 3FXRA 2NYXA 1W36C 2BV6A 4UVCA 2OAZA 1YRNB 2K7LA 4WCGA 3ZCOA 2XGDA 3H9QA 1FBUA 2E36A 3H3ZA 4M9SA 1F36A 2V9PA 2P8TA 2OPTA 4E7IA 3L7WA 4UV9A 4S05A 1TT0A 5DM6F 4XKWA 2V9VA 1G3WA 2EJRA 1TQPA 2DODA 5J4VA 4A6EA 3RYPA 5D8KB 1DU0A 1WKMA 2MGQA 3PASA 1WJ5A 3RSNA 1Q1VA 3OIOA 4L5JA 2AXLA 2EFNA 2F5CA 2KRHA 3I53A 2DJIA 2DPDA 3EUKL 4C3HJ 1YX3A 1LQ1A 3EETA 3G73A 4JOMA 1XX5A 4XSZF 1XGOA 2VI6A 3FK6A 3VW2A 3S93A 4HKUA 2B0LA 1BIBA 2BW3B 2ME6A 4PGGA 5EEAA 4IOCF 4A69C 3BCBA 1MMDA 1A6QA 3LSJA 5GPCA 3MQ0A 3PL8A 2R7RA 2CRGA 2CQKA 4ZZLA 1R00A 4MQVA 2MFZA 1TBXA 2LBFB 5CKTA 2EB7A 2V4JC 5F27A 1LDDA 4MEYF 3ZQHA 1OYYA 1ETVA 2COMA 2KFDA 3LAPA 5K5OA 4OD4A 4B4CA 2EZHA 3QU6A 4BQNA 3NPIA 1O7LA 1H9TA 1XS9A 1SANA 2R5ZB 2BHYA 2PZ9A 5HS7A 4PJNA 4IO9F 4MTEA 3E6MA 3G2BA 4UV8A 1FNNA 4HX7A 3OYFA 3DPTA 2HGCA 4BNCA 5EG0A 2VJ4A 3FXUA 2STWA 2Y0SA 4AF5A 5K7HA 1TL8A 2CW8A 5CPRB 4M3DA 4BJTA 2OD5A 3IUOA 1AKHA 1OISA 3GO5A 2WUIA 3Q9SA 4ITVA 2YX7A 2O0YA 3BPVA 2HXIA 2YU9J 1Z1DA 4GYIA 3RKWA 2FJI1 5C4YA 3M1EA 1HSTA 4MFDA 1B9MA 2W7NA 4BQOA 1ACIA 1VQ5I 4IJAA 2NNNA 4XQFA 4HDVA 5TGTA 3K1MA 2BY0A 2NVTJ 2WB1A 5DUKA 1KQ8A 2PMZA 3TBIA 4BYYA 1DUXC 5DDGA 2UXOA 3R0JA 2KZGA 1OKRA 2DPUA 3KP3A 3BPXA 3CLQA 5M5XJ 4A6DA 2K9SA 3PNYA 3OR1C 4HX4A 2P4WA 4CZCA 3MFKA 3CC2I 5D4SA 3BR1A 3VFZA 1FSHA 4G6DA 1EA3A 1IDZA 2DBBA 2XF7A 3JCUC 3LJLA 3V78A 3M8JA 4FT8A 4P55A 1STZA 1XGNA 4UXNA 4BUPA 4QSHA 3BT9A 2QSFX 4MLOA 5J8FA 1QA6A 4EJTA 3K10A 1UI6A 2L9RA 2ZXWH 3ABKH 2ACJA 2YUSA 3OYIA 3GTLJ 2R93J 5E1ZB 3E5UA 3WTTC 3JRIA 4AWXB 3U21A 4A5NA 2E19A 4FQGA 2IP2A 1XB4A 4H0EA 2GZWA 2RV8A 2V1UA 4YFKF 5ILUA 3G7RA 3CQZJ 1IRXA 2K4JA 3EQLF 3BJAA 4MO7A 3DPLC 4RGUA 1KU3A 3J7AO 2CV1A 4BY7J 1DP3A 3E7QA 4I02A 2XPWA 2A6EF 2IA0A 2KKOA 3L00A 3CCLI 1Z3XA 2IT0A 1JKOC 4Y3OA 4CCJA 3I55I 3M3YJ 3V6GA 3A1YA 4DBQA 4RM2A 1TT5B 3PIPF 1MMGA 5D18A 2QCOA 3FMRA 1BN5A 5F0FA 2CQNA 3HJEA 2JPBA 1H9GA 5IP7J 4CH7A 1U0JA 2CU7A 4X1EA 2DMPA 3LQRA 2GXGA 1ZN2A 4BACA 3SWHA 1KU9A 1QPIA 3HBLA 1WJDA 3CJDA 4HYEA 1U6GA 4ZH4F 3RKQA 3JRBA 1UZCA 4II3A 2QF7A 4TV7A 3RYRA 2DQRA 3DBRB 3AG1H 5E18F 1ZTRA 2UXHA 3C2BA 3QPHA 1OQYA 4EJOA 2GOMA 1ZR2A 2ZMEA 2V1XA 3FRQA 4M73A 2EILH 1EF4A 4JKZA 4OU0A 3C18A 1PUEE 1SD7A 4NQWA 3K2ZA 3WTVC 1OYWA 1IZ1A 3WG7H 1EH8A 1H89C 4U88A 3F22A 4OIPF 2F2EA 4WIBA 1QBJA 2XRNA 4M74A 3WTXC 2KJBA 1ZRCA 5H6RA 1R49A 2XVCA 1U8BA 1M1EB 3ECOA 3FMSA 1AKHB 2E1OA 4BEHA 1N77A 3NNRA 4LITA 2CSOA 3F8MA 4NB5A 4RLFA 3UNGC 4EGYA 3SEQA 2L7ZA 3ABLH 2DA6A 4IL6C 3KP2A 1U9NA 5CVRA 4EV0A 2TRTA 3IKTA 4ICHA 3CCEI 2Z2SB 3P9TA 1WJCA 2Q0OA 4FX4A 2HPIA 4A3DJ 5EDNA 3PO3J 2EV0A 4ETSA 4EEFG 2IU5A 1PP7U 1XDUA 4BU2A 3IWZA 5L3FA 1FZPB 2KP6A 2XPVA 2OV7A 3DEUA 1IN4A 1T08B 1RC9A 5IY5H 1FEXA 1BW5A 3C1DA 4HSRA 2QIBA 4QLCU 2LOOA 1PYVA 3HL2A 3CCMI 4RS8A 1R9TJ 2LKXA 3WTYC 4LLLA 2F48A 2ZSHB 2D2WA 5DD4A 2MC3A 1OFCX 4RBOA 1IXCA 2JTVA 2PN6A 3HRSA 2ELKA 2K86A 2Q1ZB 3AG2H 3KZIC 4XLPF 4F91B 3O8GA 3FZVA 1QHGA 5EGOB 2F4OB 2GWRA 2HVQA 4A3FJ 2CW0F 1JTXA 3CJRB 2EA2A 4C3JJ 3W2WA 2DOFA 1XGMA 5CLSA 4OMYA 4F55A 2IVMA 1NG6A 2ISYA 1T33A 1TWCJ 4QWQA 3TMOA 1FY7A 2M3AA 4GO1A 4S0HB 2HVRA 4A93J 2P7VB 2HOTA 2HR3A 3A02A 2WADA 2XPUA 2ZJQF 1V3FA 3RPUD 3C2HA 2HYTA 2QEXI 3DTEA 2Z99A 3KKCA 2HOSA 2ESHA 1LJ9A 2DT6A 3KZZA 4QTRA 3HRUA 4C2UA 5ERIA 4UUTA 1ETOA 2LR8A 4Y13A 2MSYA 5LFAA 4IRGA 2BE5F 2GA2A 4LMYA 3M8FA 1NTCA 1Y6IA 4WF2A 3OYBA 2B63J 2RQPA 3H92A 5HVQC 5KVRA 1SFXA 2DTRA 4LB5A 2G7GA 4E7SA 5JI6A 2ZC2A 2K5CA 4JP0A 4YEJA 5FO5A 1D5YA 3FM5A 5FRNA 2GBYA 2F07A 5CJ9A 2Z33A 3VIBA 4U0WA 1IN8A 2DDAA 4UDSA 1N78A 4Y17A 4PCQA 2RC4A 4HF2A 1BBYA 2EFWA 1FP1D 1G8XA 2V79A 4IHVA 1U3EM 2V1NA 1ZG3A 2A3SA 2XF6A 2GA1A 4BGDA 2F4MB 2E2HJ 4DQ2A 1FC3A 1TTYA 3CO7C 5H9TA 3W2AA 3EPZA 2ZMEC 4OMZA 4YIIA 3ZQQA 3KYDB 5L3EA 2WAQA 3LWJA 3GXOA 1UHSA 1WH5A 1OCZH 1MD0A 2RDPA 2XGXA 3CP8A 3E5XA 1P2FA 4H4KC 4P1WA 4ZTFA 2LYCA 2HKUA 3NAUA 1YO5C 3MCZA 2O7TA 3QBMA 1MDMA 3AQSA 1QO0D 2ID3A 3NQOA 2FMYA 3MAJA 4XONA 5BPIA 4ZZDA 2WBMA 3S1MJ 5GP9A 3Q0VA 2LP0A 3W2VA 1YQAA 3CJNA 2L7KA 3L2CA 3H5RA 2DI3A 3W6VA 4HF1A 2FSWA 1GXQA 4B8XA 1T56A 3CLOA 5AIQA 5DEQA 1DPRA 1RETA 3K4NA 4PFOA 3GF2A 4G94A 2QQBA 4G6TB 5IT9Z 2EFQA 1XMKA 1F5TA 2RGVA 3GX4X 3SDGA 4Y7NJ 4GCVA 3QKXA 2GIVA 2ZJPF 1EH6A 2ZJ2A 1PUFA 2AQEA 2OERA 3KIOA 4UB8C 2ECCA 1Y0NA 4E7KA 3RI4A 4DGWB 2JUGA 1FYKA 5D19A 1SVMA 2A6HF 2BY3A 1MBEA 3ZQ7A 2FMLA 4RGXA 2HS5A 1ZYRF 1VQMI 4AIKA 3O60A 3VSKA 2LF7A 4MQ9F 5CQEA 3V7SA 2XAUA 5E8GA 2Q2EA 1ZKGA 2UXNA 2TCTA 4ESFA 1FWZA 2E2JJ 3OMYA 2VKDA 3DF8A 2UXXA 3EYYA 2OZ6A 3AL0C 2R92J 1SMYF 3BZKA 4U0VA 1ZRFA 3I59B 3OIPA 4CCNA 4D7NA 4LLNA 5A2QZ 4YZEA 2ZNYA 2DMTA 4QIWN 1VQPI 2KPMA 3FK7A 1GV5A 2EWNA 2E1MC 1IV6A 5FGMA 1MIJA 2YVXA 5BOXA 4IEJA 1YITI 1BI1A 4ZYDA 2RN7A 2XB0X 3U1KA 2ELHA 1I5ZA 1VQ7I 3FXKA 2P5VA 4ZYHA 3GW2A 3K4LA 1I50J 3TL4X 4XLHA 2NS7A 3WTSC 1O3RA 2K9QA 2M5WA 1BR2A 1KA8A 2PBIA 3EGQA 3WU2C 1OCPA 2PI0A 2GXBA 4I99C 4IKFA 1FMWA 3CUQB 3G1MA 5FRMA 1WH7A 4KITB 2CV0A 5K7ZA 3B81A 2E2IJ 3L2RA 4YFNF 3ON4A 4OAZA 4GCKA 1Z7UA 4RMNA 1R71A 2JRTA 4CCKA 2LNBA 3SZPA 3K70D 3WGHA 2JZYA 1V5FA 1X3UA 2ID6A 3F21A 1ZAOA 1GXPA 3CCQI 5B1BH 1S7EA 2KDZA 2F4IA 3HXLA 3DU6A 3O2PE 1XC5A 2V7FA 1D0YA 4KN4X 1MSEC 2JA2A 1OYIA 1T6SA 1SFEA 3E7LA 3GTQJ 1W7PD 1WRJA 5HLGA 2UZKA 2NP5A 3ULQB 5BNGA 2DA3A 2NXNB 4HF0A 2H6CA 1X4PA 4AVZA 4P9FA 2PLYA 3BG3A 2OTJI 3QAHA 4XN0A 5GPAA 2WAFA 1IJWC 2NVQJ 4LIVA 2O7OA 4Y52J 1ZARA 3FDYA 3DFGA 3H36A 1IGNA 4MIMA 2JT1A 2BY2A 4BJ6C 3BR5A 4XKBA 1R5GA 1Z77A 4DVYP 3SYTA 3TOAA 4DZPA 1ZG5A 5FD5A 4XSXF 4K2EA 4U87A 3TW7A 1CGPA 4NBQA 5H2FC 2G7HA 4XNFA 3OYNA 3RPUA 2X6OA 5TRDA 1V5EA 3DPJA 5LHGA 1KONA 3DCFA 3BWGA 3WTUC 5GAGJ 1I27A 1DPUA 3Q9VA 1X4OA 1IW7F 1ZELA 2M1BA 1OCRH 2ZO4A 3LA7A 3OS2A 1SD5A 2WWYA 1PUFB 3GFMA 1IRFA 4GRIA 3ZQIA 3KLNA 4NUBA 1OCCH 3QPSA 3GWZA 2EINH 4HPQA 2PJRA 5CVUA 2QENA 1E3PA 1DGRM 1VQ8I 3W6JB 3HUGA 1UHMA 3OYCA 1EV7A 5GTHC 1HDDC 1X3WB 2EQRA 2CG4A 4HNTA 3HOXJ 2X0LA 1WJAA 2Y48A 2IEKA 3B73A 3GZ6A 1ODDA 4N4OB 4XLAA 1T8IA 1G6NA 4A3EJ 4BXFA 1FPQA 2RVCA 4A3JJ 2STTA 2VT3A 2DN0A 2XAQA 4A5MA 4MTDA 5H6QA 3BTJA 4DJAA 2K9MA 1RI7A 2IGNA 2WAEA 2CQ7A 2HOAA 4EATA 3WTWC 4UHTA 2IS6A 4FTHA 4KDPA 5FMPA 3OYGA 3S1QJ 3BC8A 3DEWA 3ASOH 2AO9A 3G4SI 4ZDPA 5C4XJ 3CCVI 4BJ5C 3ZGKA 3SEZA 4OOIA 1JT0A 4HQEA 4BXXJ 2HKOA 3GUDA 3UKGA 4WXDA 1EH7A 4F92B 1SEUA 2VN2A 1E17A 3FBNB 3V7CA 3D5LA 3W6KB 4EM2A 4MFEA 4HX8A 4PGHA 4JX5A 1QVTA 4A3IJ 2WTEA 2Y9YA 1ETWA 3BRUA 2WGBA 2EH3A 2IJLA 3HKZN 3WU0A 2O61A 3ANPA 1FT9A 3ZQFA 4L9VA 2XF5A 3LSHA 4D1QA 3K7AJ 1Y39A 2XGEA 4LFUA 1F4KA 4RGSA 5M3MJ 2DDBA 2JN6A 2NAZA 5IP6A 4RB3C 2LLKA 3ZXSA 1BM9A 1A6IA 5D1RA 5L3DA 1HF0A 1VQLI 2QKOA 1AHDP 2QBYA 2M8EA 1UHWA 4FE7A 2OUMA 4IQ4A 4F52A 3BQYA 3AG3H 3KLOA 2VE8A 4RM3A 1ZLKA 2W85A 4E7HA 3F6VA 4HNUA 3WHBA 4E4HA 1ZGAA 3VTIA 1NK3P 2H1KA 1V5GA 2HQRA 2L4MA 3TEDA 3F3XA 3IH2A 4Y33A 1HW2A 4L62A 1EKEA 3CCYA 3CMMA 3ZMDA 3BROA 1G3SA 1K4TA 5IT3A 2X48A 4IHWA 3FXMA 2REKA 2MA3A 3GEZA 1FIAA 2JSCA 4A3MJ 1MH3A 2XDNA 5KNLA 3Q0WA 4F7ZA 3HOYJ 3FF5A 1L3LA 2D5VA 3GFLA 4CCOA 3CDHA 4FISA 3M7GA 4CCLA 2IS2A 1F43A 2MG4A 3BJ6A 3BG7A 3O6BB 3R61A 1SGMA 4BHCA 3HUGB 1D1AA 2JQ7A 2R3SA 4EM1A 3JR9A 3HB9A 1HSJA 4YELA 3WGGA 1O3QA 3A2KA 1IRGA 1YE9A 3S32A 3H1CA 2XC7A 2VQCA 3MKWB 3AQTA 3OSGA 3BCGA 2ESNA 1W7PA 2FQ3A 3BCAA 1WGXA 3MKLA 2E5NA 1UJ8A 2XGCA 4D7MA 1RKWA 2PJPA 1PVEA 1T0FA 2PQ8A 3HEFA 3CWRA 3IH4A 2O6GE 3OY9A 2H09A 3GLXA 5D6EA 1PDNC 1X2NA 3IL2A 3TP3A 3BR0A 4B43A 5BS6A 1X2MA 3GZIA 1ON2A 2LK2A 2M45A 2V6CA 2MD0A 3AAFA 3FWEA 3ESWB 4KA4A 5CW8A 3KE2A 1SD6A 2LRDA 2UWMA 4X6AJ 5IYCJ 2FBHA 3QP6A 5CXIA 1YJWI 4ESBA 4ABZA 4EJWA 4ENMA 2H94A 2RAEA 1TNTA 3I0TA 5E1XA 5JHFA 4PSXA 3DKYA 2M9HA 1R7JA 3T1BA 1B72B 2D45A 3SZTA 5L3GA 3P9KA 2OU2A 3FKIJ 5E79C 4U7DA 3LSIA 1P92A 1FX7A 1YJ9I 3S2HJ 4A3KJ 3ZMZA 2DFIA 3S14J 1JKPC 4BQQA 1JHFA 3G6EI 1D5VA 2IPQX 4BXUA 4ZYEA 1GVDA 1JUMA 4DZJA 2OI8A 3J81K 2HZTA 5ICCA 2CJJA 3B6CA 3E0JB 3JSJA 4HAMA 3QP5A 2HXOA 2KJCA 2M34A 2NVXJ 1TP4A 3S17J 1MBHA 5ILVA 2DO7A 5JR3A 1MKMA 3K6GA 3ZR8X 3T5XA 1LKXA 1J09A 3QYFA 1KGSA 2E35A 1IN7A 3D5RC 2L9SA 2JMWA 4JX4A 2IA1A 4E7LA 1J5YA 5LBQA 5FKLA 1XPXA 1BR1A 4IXAA 2P6SA 3R4KA 5J1UA 2IGOA 5BQTA 2CYYA 5J3LA 4NC6A 3KFWX 3A0HC 1X58A 1Y1VJ 2EBIA 1MNEA 4DIQA 3I4PA 4A2UA 1SC7A 1BI2A 1BJAA 5EFYA 3TDZC 1WCMJ 1SFOJ 2OTLI 2Y75A 1B59A 1QPMA 4ON0A 3IH3A 1W1WE 1FOKA 5J4YA 4D5FA 1JGSA 2GUHA 3DKWA 3KEQA 3KX2A 2HOEA 2JJ7A 1G3YA 1RESA 3JSOA 1IO2A 2H6BA 3PM1A 4UUSA 2W00A 4HQMA 3B6AA 4AIDA 4IHXA 2LTPA 4BE0A 1HW5A 1I6HJ 3CDIA 3LOCA 4N9IA 1IAWA 3L2UA 1WZ2A 1ZR4A 2ZNZA 4AU7A 5AQCA 2DOEA 3DBHB 2B9SA 4A3LJ 1HKQA 3P9CA 2F6CA 3JRHA 2DA2A 3K70C 1P7IA 2G3BA 2DMUA 2V57A 4KMUX 1K7AA 4IHSA 3MZYA 3SHFA 2WY7Q 4GFLA 1U5TA 2QWWA 1X19A 4ZC3A 3JTGA 3IRQA 1UI5A 2PMHA 2OZUA 4WX9A 2D6YA 4CCMA 1DQUA 3IUVA 2KRFA 2HTJA 1Y1WJ 4XMYA 3OS1A 3DPUA 1T0FC 2L4AA 1QNTA 4FX0A 2LDUA 4CSWA 4G7HF 1TWHJ 4IHYA 4XIDA 3OIQA 1ZREA 1VNDA 2QZ8A 3S3MA 3CUOA 1XDSA 1R5HA 4PJMA 3DBLB 2XIGA 2WY8Q 1VQOI 2R7XA 2WA0A 5EEGA 4A0XA 4ANJA 3KP6A 5HLTA 5LLQA 3S2DJ 3VW0A 2VONA 1R22A 2ZFUA 2ETHA 1W0UA 4BBSJ 2P5KA 3VP5A 3RDIA 2XROA 4G7ZF 2A5YB 4LG0A 4I0AA 3SXYA 1MMAA 1ULYA 1T2KA 2HVSA 1IXSB 3TW6A 4HLXA 5K5RA 3J81Z 3WU1B 4AVPA 2Y0MA 3PSFA 3RKYA 1K78A 1X1PA 5EG0B 3LSRA 2HPMA 2FOWA 4HDUA 3COLA 1LB2A 2XV4S 3FBIB 3OL4A 2DXIA 4B44A 3DXJF 2ZY9A 3BP8A 4F93B 1VQ9I 5IP9J 4BL0B 4BY1J 2A05A 2ICWG 5HDNA 1X1DA 2H1LA 1XD7A 3A03A 2L7FP 3MMYB 5FKOA 3GBGA 3VSLA 2F5FA 2WC2A 3LSMA 1A35A 2V1DA 2B7EA 4B1RA 1YYVA 4CXFA 1U2WA 3IV5A 2C6YA 5DUIA 1K79A 4BBRJ 1GHCA 1IDYA 3LSKA 4BHPA 5E20A 2PMUA 1RIOH 1YX5A 4RAYA 3CD6I 1RPWA 4J00A 2W24A 4CDGA 1DDNA 2HU9A 1YIOA 5IT9K 2E5ZA 2R0QC 1E2XA 4N9HA 4YIFA 1TLHB 2DK5A 5HOOA 3J7AY 1S7OA 3ON2A 1OMIA 4PSWA 2R4GA 1T95A 4ESJA 2JA5J 2DT7B 2HYJA 4ENNA 2L01A 2QSHX 3WHCA 3VDXA 1BJZA 3RJPA 3S3NA 2L3DA 5ICGA 1WI9A 1X3ZB 2MYSA 2PFBA 5IPAA 5J8CA 3LNQA 5FD6A 4UUSB 5D8LB 2NS0A 1XCBA 2L7MP 2JVHA 3QYBA 4RB2C 1N75A 2W25A 3ABTA 3E6BA 4KIFA 3OL3A 5E1WA 3K2AA 2P5LC 1BA5A 4A0YA 4J19A 3MEXA 1QU3A 2A6TA 2JA7J 2BZTA 3H0GJ 4JK1X 2R5YA 2A07F 2K40A 4XOTA 3HOWJ 3H5NA 4BH9A 3NS4A 1JKQC 2JSPA 4U9LA 3TO6A
chains in the Genus database with same CATH topology
2ID6A 4KWAA 3VUQA 2FD5A 4C3IJ 2MW8A 1S7EA 2KDZA 2HI3A 2M0CA 2P81A 1XC5A 3CRJA 5HBUA 5EGOA 3QPLA 4LOCA 3JRCA 1RKTA 2Q24A 3HTAA 1MSEC 1ENHA 3JRAA 4GCLA 3E7LA 3GTQJ 2O8KA 4V2FA 4D5CA 3ZOBA 2NP5A 4L5EA 2ZOZA 5BNGA 2FX0A 3BHQA 2DA3A 4AUXA 2O9LA 3BG3A 5FKNA 1YRNB 5GPAA 1JGGA 2XGDA 1IJWC 2NVQJ 4Y52J 2O7OA 2G7LA 5FHPA 5J1YA 3SJMA 1FIPA 1IGNA 4MIMA 3VPRA 1UMQA 5DS9A 1JUPA 1F36A 3BR5A 2OPTA 1Z77A 4DZPA 5K58A 2HQ5A 2JA8J 3TW7A 2WV1A 1H88C 5F04A 3VVYA 3VVZA 1CQTA 1ETKA 2X6OA 3DPJA 1ZGWA 3GTKJ 5E3LA 3DCFA 1DU0A 2MGQA 4DW6A 3PASA 3BJBA 1Q1VA 3OIOA 1ZQ3P 4CYCA 1MBFA 1ZK8A 5C4JJ 2NVYJ 1PUFB 3ZQIA 4C3HJ 5M5YJ 1TWFJ 2L0KA 3QPSA 3KNWA 3A01A 5EYRA 2VI6A 2G0EA 3FK6A 2DG7A 3VW2A 1JKRC 4HKUA 1HLVA 4BKXA 4I6ZA 2ME6A 2GENA 5EEAA 1QVUA 4A69C 5IOYA 1HDDC 1APLC 2EQRA 1IRZA 4DYQA 3LSJA 5GPCA 4FCYA 3HOXJ 2CRGA 2IEKA 3VVXA 3MVPA 1LE8A 5F27A 4GFBA 4A3EJ 5FJ8J 4A3JJ 3ZQHA 2DTZA 1ETVA 2K9NA 4B4CA 2EZHA 3HOZJ 2DN0A 3OSFA 3NPIA 2JWTA 1SANA 1XS9A 3KKDA 2R5ZB 3BTJA 5HODA 2PZ9A 5HSZA 1IC8A 1IUFA 2HOAA 3HOVJ 3I4MJ 2NX4A 3LHQA 4FTHA 5EG0A 5FMPA 3S1QJ 4AF5A 5K7HA 3DEWA 4M3DA 2WUIA 2AO9A 1AKHA 5C4XJ 2JK3A 5JLWA 2QOPA 3HOUJ 2HXIA 4AYBN 2YU9J 4W1UA 5DTDA 1JT0A 5C4YA 4MFDA 2R5YB 1G2HA 3I4NJ 3Q0UA 4BXXJ 3HTJA 3S15J 3UKGA 2NVTJ 2YVEA 1DU6A 4MFEA 4JX5A 1QVTA 4A3IJ 4MK6A 2Y9YA 1ETWA 3BRUA 2WGBA 4G12A 2UXOA 2EH3A 3HKZN 1BW6A 2DA4A 3GEUA 3BR2A 5M5XJ 3PO2J 3CMYA 3ANPA 3ZQFA 2K9SA 3QQAA 1JUSA 2DA5A 3K7AJ 1H8AC 2XGEA 2I10A 5M3MJ 3RH2A 2EZLA 3F0CA 1VI0A 2JN6A 2ME0A 3BR1A 1IDZA 5IP6A 2LLKA 3T6NA 3LJLA 3V78A 1A6IA 5D1RA 1HF0A 2QKOA 1AHDP 4NDLA 1UG2A 4QSHA 3BT9A 4JYKA 4FE7A 3BQYA 4MLOA 4XRMA 3SFIA 1UI6A 2L9RA 2GFNA 2YUSA 1B8IA 3GTLJ 1MH4A 2R93J 3S16J 3JRIA 2E19A 3KZ9A 2VUMJ 3WHBA 3JRFA 3G7RA 2H1KA 5JLXA 3CQZJ 3LSGA 3HE0A 4FE4A 1NK2P 3VOXA 4MO7A 3E7QA 3TEDA 3IH2A 4BY7J 3G56A 1MNMC 2XPWA 4L62A 4DYCA 3CCYA 1I3QJ 5DAJA 1JKOC 4CYCB 3M3YJ 1MSFC 3V6GA 3O8HA 2X48A 1RR7A 5E3NA 4IHWA 2REKA 1FIAA 5F0CA 2QCOA 1MH3A 4A3MJ 3GTGJ 2XDNA 5D18A 2G7SA 3Q0WA 1ETXA 1FJLA 4V2GA 4C2MJ 5F0FA 3VW1A 3OOUA 1JJ8C 3HOYJ 2D5VA 1QRYA 3A01B 4FISA 5IP7J 2CU7A 4X1EA 2DMPA 5IYDJ 1OCTC 1F43A 3RZOJ 2MG4A 3H3VK 3HM5A 2EZKA 1SGMA 1QPIA 2UXPA 3HBLA 3CJDA 4RDUA 3RKQA 1FTZA 1WI3A 3JRBA 3ZQLA 3JR9A 3HB9A 2QF7A 5J1RA 1ZTRA 3AQTA 1YRNA 3OSGA 2UXHA 3BCGA 3C2BA 1LE8B 2GM4A 1GUUA 1WGXA 3MKLA 1ZR2A 3FRQA 1TWGJ 3RZDJ 2XGCA 4D7MA 1RKWA 1K61A 1IG7A 1EF4A 3HEFA 3CWRA 4JKZA 3EUPA 3IH4A 2H8RA 4HNVA 4A3CJ 2X9DA 1ORKA 1Z0XA 2JA6J 9ANTA 1POGA 2CQXA 3S5RA 2WB1N 1X2NA 1WPKA 3TP3A 3BR0A 2CUEA 1GT0C 1H89C 1X2MA 2W48A 3GZIA 2LK2A 1HCRA 2Y9ZA 3JREA 5CW8A 4XK4A 1ETQA 4X6AJ 1U8BA 5IYCJ 1AKHB 2E1OA 5CXIA 3NNRA 4ABZA 3MNLA 2RAEA 5FKMA 5M3FJ 2L7ZA 2M9HA 2DA6A 3HGYA 3GTJJ 1B72B 4M6VA 1U9NA 2YS9A 3RQIA 4ICHA 2TRTA 5FLMJ 2Y30A 3FKIJ 3FISA 4A3DJ 3P9TA 5EZGA 2DMNA 5EDNA 2R7ZJ 3PO3J 3S2HJ 2IU5A 3HGGA 4EEFG 4A3KJ 2OF7A 2FBQA 3S14J 1JKPC 5K7FA 2LVSA 2ECBA 2XPVA 3C07A 3M4OJ 3VOKA 1FEXA 1BW5A 1GVDA 1JUMA 4DZJA 1GDTA 2OI8A 2QIBA 2CJJA 3B6CA 1R9TJ 3JSJA 5HAWA 2LKXA 5EZHA 4GCTA 2HXOA 2M34A 2NVXJ 3S17J 2RASA 1LFUP 1MBHA 1OFCX 3BG5A 4RBOA 4XRSG 1U78A 3HTIA 2ELKA 3O8GA 4ACIA 5EGOB 4A3FJ 2JMWA 4JX6A 4JX4A 3S1RJ 1HOMA 1MBJA 1JTXA 1HDPA 5FKLA 2QWTA 4C3JJ 2DG8A 2ZCMA 5J1UA 5J3LA 1B8IB 1T33A 1TWCJ 1E3OC 1X58A 1Y1VJ 2EBIA 3PPBA 5M5WJ 4S0HB 2VKEA 4A93J 4JNNA 2LD5A 2HOTA 3NXCA 2AHQA 3A02A 3JRDA 5EFYA 2XPUA 1WCMJ 1SFOJ 2DJNA 3IH3A 2HYTA 1W0TA 2IBDA 3S1NJ 4D5FA 2GUHA 5IYBJ 2W53A 3KKCA 2HOSA 3NARA 2JJ7A 1RESA 4QTRA 4UUTA 1ETOA 2DA1A 2LR8A 3PM1A 4A3BJ 4UUSA 3BR3A 2MSYA 3HIMA 5E3OA 3B6AA 2VKVA 4IHXA 1NTCA 2LTPA 2YVHA 1P7JA 2B63J 1I6HJ 4M3FA 5C3EJ 3LOCA 2HDDA 1ZR4A 2G7GA 2DMQA 5AQCA 4JP0A 4M3GA 4A3LJ 3G1OA 1D5YA 3ZQGA 3JRHA 2GBYA 2DA2A 3GTPJ 1P7IA 2G3BA 2DMUA 2F07A 4M3BA 3BTIA 3VIBA 2CUFA 2V57A 4UDSA 1FTTA 4W97A 4IHVA 3BTLA 4GFLA 1LFBA 2E2HJ 3D1NI 1BL0A 5EF6A 1UI5A 3G1LA 4JL3A 1U9OA 5H9TA 2D6YA 3IUVA 1Y1WJ 1AU7A 3LWJA 5F0HA 4CGRA 3JRGA 3GTMJ 1UHSA 1GV2A 2LFBA 4DYRA 2GLOA 1WH5A 2NP3A 1TWHJ 4IHYA 2Y0SN 4XIDA 5CXGA 1VNDA 2HKUA 2QTQA 2ZCXA 3NAUA 2O7TA 3QBMA 3AQSA 2ID3A 2NS8A 2XRLA 3BTCA 2N8GA 5GP9A 3Q0VA 2M2EA 2LP0A 5C44J 3S1MJ 3CDLA 1JJ6C 3RD3A 1VF9A 3S2DJ 3VW0A 4BBSJ 3F1BA 3TP0A 1W0UA 3W6VA 3VP5A 3BNIA 5F08A 1VFCA 3Q3SA 1T56A 4XICA 3MN2A 3TW6A 2PMZN 1RETA 2NOGA 1TC3C 5EG0B 3LSRA 2Y31A 2PBXA 2CQQA 3COLA 2XSDC 2LY9A 3SDGA 2EZIA 1O4XA 4BY1J 5IP9J 1A5JA 4Y7NJ 5FGLA 3QKXA 3A03A 2L7FP 3BQZA 5FKOA 3GBGA 1PUFA 2OERA 2UXUA 2ECCA 1MBGA 2ZOYA 3ANGA 4B1RA 5D19A 1JT6A 4GFKA 5E3MA 1MBEA 3IV5A 5FLVA 3NI7A 1JTYA 4BBRJ 4NN1A 1IDYA 3O60A 1ZKGA 2VPRA 1RPWA 2TCTA 1K83J 3FIWA 2E2JJ 5IOZA 3NRGA 3HTHA 4M3EA 2ZB9A 4AC6A 3L1PA 2R0QC 2R92J 1XG1A 3LSPA 5F1JA 4D7NA 4ME9A 3ON2A 5FKKA 4YZEA 1MBKA 2DMTA 1TWAJ 4QIWN 3GTOJ 3FK7A 2COBA 1GV5A 2JA5J 2IAIA 1OJLA 1IV6A 2HYJA 4A3GJ 2FQ4A 2R5ZA 2ZCNA 1ITYA 3WHCA 4IEJA 1BJZA 1B72A 3BG9A 4NELA 2XB0X 3LNQA 2XB5A 2M8GX 5IPAA 3ZQCA 4PXIA 1I50J 4UUSB 2NS7A 2K9QA 2L7MP 4XRSA 3EGQA 2UXIA 1OCPA 2RHAA 3K2AA 1BA5A 2KT0A 4J19A 3G1MA 1WH7A 4B3AA 2FJ1A 2WAQN 3BR6A 2JA7J 2DA7A 5K7ZA 3B81A 1ETYA 2E2IJ 3ON4A 3H0GJ 4GCKA 4MXMA 4I76A 2R5YA 2Y2ZA 2K40A 4AC0A 3HOWJ 3HDDA 1JKQC 1NK3P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ID6 A;  4KWA A;  3VUQ A;  2FD5 A;  4C3I J;  2MW8 A;  1S7E A;  2KDZ A;  2HI3 A;  2M0C A;  2P81 A;  1XC5 A;  3CRJ A;  5HBU A;  5EGO A;  3QPL A;  4LOC A;  3JRC A;  1RKT A;  2Q24 A;  3HTA A;  1MSE C;  1ENH A;  3JRA A;  4GCL A;  3E7L A;  3GTQ J;  2O8K A;  4V2F A;  4D5C A;  3ZOB A;  2NP5 A;  4L5E A;  2ZOZ A;  5BNG A;  2FX0 A;  3BHQ A;  2DA3 A;  4AUX A;  2O9L A;  3BG3 A;  5FKN A;  1YRN B;  5GPA A;  1JGG A;  2XGD A;  1IJW C;  2NVQ J;  4Y52 J;  2O7O A;  2G7L A;  5FHP A;  5J1Y A;  3SJM A;  1FIP A;  1IGN A;  4MIM A;  3VPR A;  1UMQ A;  5DS9 A;  1JUP A;  1F36 A;  3BR5 A;  2OPT A;  1Z77 A;  4DZP A;  5K58 A;  2HQ5 A;  2JA8 J;  3TW7 A;  2WV1 A;  1H88 C;  5F04 A;  3VVY A;  3VVZ A;  1CQT A;  1ETK A;  2X6O A;  3DPJ A;  1ZGW A;  3GTK J;  5E3L A;  3DCF A;  1DU0 A;  2MGQ A;  4DW6 A;  3PAS A;  3BJB A;  1Q1V A;  3OIO A;  1ZQ3 P;  4CYC A;  1MBF A;  1ZK8 A;  5C4J J;  2NVY J;  1PUF B;  3ZQI A;  4C3H J;  5M5Y J;  1TWF J;  2L0K A;  3QPS A;  3KNW A;  3A01 A;  5EYR A;  2VI6 A;  2G0E A;  3FK6 A;  2DG7 A;  3VW2 A;  1JKR C;  4HKU A;  1HLV A;  4BKX A;  4I6Z A;  2ME6 A;  2GEN A;  5EEA A;  1QVU A;  4A69 C;  5IOY A;  1HDD C;  1APL C;  2EQR A;  1IRZ A;  4DYQ A;  3LSJ A;  5GPC A;  4FCY A;  3HOX J;  2CRG A;  2IEK A;  3VVX A;  3MVP A;  1LE8 A;  5F27 A;  4GFB A;  4A3E J;  5FJ8 J;  4A3J J;  3ZQH A;  2DTZ A;  1ETV A;  2K9N A;  4B4C A;  2EZH A;  3HOZ J;  2DN0 A;  3OSF A;  3NPI A;  2JWT A;  1SAN A;  1XS9 A;  3KKD A;  2R5Z B;  3BTJ A;  5HOD A;  2PZ9 A;  5HSZ A;  1IC8 A;  1IUF A;  2HOA A;  3HOV J;  3I4M J;  2NX4 A;  3LHQ A;  4FTH A;  5EG0 A;  5FMP A;  3S1Q J;  4AF5 A;  5K7H A;  3DEW A;  4M3D A;  2WUI A;  2AO9 A;  1AKH A;  5C4X J;  2JK3 A;  5JLW A;  2QOP A;  3HOU J;  2HXI A;  4AYB N;  2YU9 J;  4W1U A;  5DTD A;  1JT0 A;  5C4Y A;  4MFD A;  2R5Y B;  1G2H A;  3I4N J;  3Q0U A;  4BXX J;  3HTJ A;  3S15 J;  3UKG A;  2NVT J;  2YVE A;  1DU6 A;  4MFE A;  4JX5 A;  1QVT A;  4A3I J;  4MK6 A;  2Y9Y A;  1ETW A;  3BRU A;  2WGB A;  4G12 A;  2UXO A;  2EH3 A;  3HKZ N;  1BW6 A;  2DA4 A;  3GEU A;  3BR2 A;  5M5X J;  3PO2 J;  3CMY A;  3ANP A;  3ZQF A;  2K9S A;  3QQA A;  1JUS A;  2DA5 A;  3K7A J;  1H8A C;  2XGE A;  2I10 A;  5M3M J;  3RH2 A;  2EZL A;  3F0C A;  1VI0 A;  2JN6 A;  2ME0 A;  3BR1 A;  1IDZ A;  5IP6 A;  2LLK A;  3T6N A;  3LJL A;  3V78 A;  1A6I A;  5D1R A;  1HF0 A;  2QKO A;  1AHD P;  4NDL A;  1UG2 A;  4QSH A;  3BT9 A;  4JYK A;  4FE7 A;  3BQY A;  4MLO A;  4XRM A;  3SFI A;  1UI6 A;  2L9R A;  2GFN A;  2YUS A;  1B8I A;  3GTL J;  1MH4 A;  2R93 J;  3S16 J;  3JRI A;  2E19 A;  3KZ9 A;  2VUM J;  3WHB A;  3JRF A;  3G7R A;  2H1K A;  5JLX A;  3CQZ J;  3LSG A;  3HE0 A;  4FE4 A;  1NK2 P;  3VOX A;  4MO7 A;  3E7Q A;  3TED A;  3IH2 A;  4BY7 J;  3G56 A;  1MNM C;  2XPW A;  4L62 A;  4DYC A;  3CCY A;  1I3Q J;  5DAJ A;  1JKO C;  4CYC B;  3M3Y J;  1MSF C;  3V6G A;  3O8H A;  2X48 A;  1RR7 A;  5E3N A;  4IHW A;  2REK A;  1FIA A;  5F0C A;  2QCO A;  1MH3 A;  4A3M J;  3GTG J;  2XDN A;  5D18 A;  2G7S A;  3Q0W A;  1ETX A;  1FJL A;  4V2G A;  4C2M J;  5F0F A;  3VW1 A;  3OOU A;  1JJ8 C;  3HOY J;  2D5V A;  1QRY A;  3A01 B;  4FIS A;  5IP7 J;  2CU7 A;  4X1E A;  2DMP A;  5IYD J;  1OCT C;  1F43 A;  3RZO J;  2MG4 A;  3H3V K;  3HM5 A;  2EZK A;  1SGM A;  1QPI A;  2UXP A;  3HBL A;  3CJD A;  4RDU A;  3RKQ A;  1FTZ A;  1WI3 A;  3JRB A;  3ZQL A;  3JR9 A;  3HB9 A;  2QF7 A;  5J1R A;  1ZTR A;  3AQT A;  1YRN A;  3OSG A;  2UXH A;  3BCG A;  3C2B A;  1LE8 B;  2GM4 A;  1GUU A;  1WGX A;  3MKL A;  1ZR2 A;  3FRQ A;  1TWG J;  3RZD J;  2XGC A;  4D7M A;  1RKW A;  1K61 A;  1IG7 A;  1EF4 A;  3HEF A;  3CWR A;  4JKZ A;  3EUP A;  3IH4 A;  2H8R A;  4HNV A;  4A3C J;  2X9D A;  1ORK A;  1Z0X A;  2JA6 J;  9ANT A;  1POG A;  2CQX A;  3S5R A;  2WB1 N;  1X2N A;  1WPK A;  3TP3 A;  3BR0 A;  2CUE A;  1GT0 C;  1H89 C;  1X2M A;  2W48 A;  3GZI A;  2LK2 A;  1HCR A;  2Y9Z A;  3JRE A;  5CW8 A;  4XK4 A;  1ETQ A;  4X6A J;  1U8B A;  5IYC J;  1AKH B;  2E1O A;  5CXI A;  3NNR A;  4ABZ A;  3MNL A;  2RAE A;  5FKM A;  5M3F J;  2L7Z A;  2M9H A;  2DA6 A;  3HGY A;  3GTJ J;  1B72 B;  4M6V A;  1U9N A;  2YS9 A;  3RQI A;  4ICH A;  2TRT A;  5FLM J;  2Y30 A;  3FKI J;  3FIS A;  4A3D J;  3P9T A;  5EZG A;  2DMN A;  5EDN A;  2R7Z J;  3PO3 J;  3S2H J;  2IU5 A;  3HGG A;  4EEF G;  4A3K J;  2OF7 A;  2FBQ A;  3S14 J;  1JKP C;  5K7F A;  2LVS A;  2ECB A;  2XPV A;  3C07 A;  3M4O J;  3VOK A;  1FEX A;  1BW5 A;  1GVD A;  1JUM A;  4DZJ A;  1GDT A;  2OI8 A;  2QIB A;  2CJJ A;  3B6C A;  1R9T J;  3JSJ A;  5HAW A;  2LKX A;  5EZH A;  4GCT A;  2HXO A;  2M34 A;  2NVX J;  3S17 J;  2RAS A;  1LFU P;  1MBH A;  1OFC X;  3BG5 A;  4RBO A;  4XRS G;  1U78 A;  3HTI A;  2ELK A;  3O8G A;  4ACI A;  5EGO B;  4A3F J;  2JMW A;  4JX6 A;  4JX4 A;  3S1R J;  1HOM A;  1MBJ A;  1JTX A;  1HDP A;  5FKL A;  2QWT A;  4C3J J;  2DG8 A;  2ZCM A;  5J1U A;  5J3L A;  1B8I B;  1T33 A;  1TWC J;  1E3O C;  1X58 A;  1Y1V J;  2EBI A;  3PPB A;  5M5W J;  4S0H B;  2VKE A;  4A93 J;  4JNN A;  2LD5 A;  2HOT A;  3NXC A;  2AHQ A;  3A02 A;  3JRD A;  5EFY A;  2XPU A;  1WCM J;  1SFO J;  2DJN A;  3IH3 A;  2HYT A;  1W0T A;  2IBD A;  3S1N J;  4D5F A;  2GUH A;  5IYB J;  2W53 A;  3KKC A;  2HOS A;  3NAR A;  2JJ7 A;  1RES A;  4QTR A;  4UUT A;  1ETO A;  2DA1 A;  2LR8 A;  3PM1 A;  4A3B J;  4UUS A;  3BR3 A;  2MSY A;  3HIM A;  5E3O A;  3B6A A;  2VKV A;  4IHX A;  1NTC A;  2LTP A;  2YVH A;  1P7J A;  2B63 J;  1I6H J;  4M3F A;  5C3E J;  3LOC A;  2HDD A;  1ZR4 A;  2G7G A;  2DMQ A;  5AQC A;  4JP0 A;  4M3G A;  4A3L J;  3G1O A;  1D5Y A;  3ZQG A;  3JRH A;  2GBY A;  2DA2 A;  3GTP J;  1P7I A;  2G3B A;  2DMU A;  2F07 A;  4M3B A;  3BTI A;  3VIB A;  2CUF A;  2V57 A;  4UDS A;  1FTT A;  4W97 A;  4IHV A;  3BTL A;  4GFL A;  1LFB A;  2E2H J;  3D1N I;  1BL0 A;  5EF6 A;  1UI5 A;  3G1L A;  4JL3 A;  1U9O A;  5H9T A;  2D6Y A;  3IUV A;  1Y1W J;  1AU7 A;  3LWJ A;  5F0H A;  4CGR A;  3JRG A;  3GTM J;  1UHS A;  1GV2 A;  2LFB A;  4DYR A;  2GLO A;  1WH5 A;  2NP3 A;  1TWH J;  4IHY A;  2Y0S N;  4XID A;  5CXG A;  1VND A;  2HKU A;  2QTQ A;  2ZCX A;  3NAU A;  2O7T A;  3QBM A;  3AQS A;  2ID3 A;  2NS8 A;  2XRL A;  3BTC A;  2N8G A;  5GP9 A;  3Q0V A;  2M2E A;  2LP0 A;  5C44 J;  3S1M J;  3CDL A;  1JJ6 C;  3RD3 A;  1VF9 A;  3S2D J;  3VW0 A;  4BBS J;  3F1B A;  3TP0 A;  1W0U A;  3W6V A;  3VP5 A;  3BNI A;  5F08 A;  1VFC A;  3Q3S A;  1T56 A;  4XIC A;  3MN2 A;  3TW6 A;  2PMZ N;  1RET A;  2NOG A;  1TC3 C;  5EG0 B;  3LSR A;  2Y31 A;  2PBX A;  2CQQ A;  3COL A;  2XSD C;  2LY9 A;  3SDG A;  2EZI A;  1O4X A;  4BY1 J;  5IP9 J;  1A5J A;  4Y7N J;  5FGL A;  3QKX A;  3A03 A;  2L7F P;  3BQZ A;  5FKO A;  3GBG A;  1PUF A;  2OER A;  2UXU A;  2ECC A;  1MBG A;  2ZOY A;  3ANG A;  4B1R A;  5D19 A;  1JT6 A;  4GFK A;  5E3M A;  1MBE A;  3IV5 A;  5FLV A;  3NI7 A;  1JTY A;  4BBR J;  4NN1 A;  1IDY A;  3O60 A;  1ZKG A;  2VPR A;  1RPW A;  2TCT A;  1K83 J;  3FIW A;  2E2J J;  5IOZ A;  3NRG A;  3HTH A;  4M3E A;  2ZB9 A;  4AC6 A;  3L1P A;  2R0Q C;  2R92 J;  1XG1 A;  3LSP A;  5F1J A;  4D7N A;  4ME9 A;  3ON2 A;  5FKK A;  4YZE A;  1MBK A;  2DMT A;  1TWA J;  4QIW N;  3GTO J;  3FK7 A;  2COB A;  1GV5 A;  2JA5 J;  2IAI A;  1OJL A;  1IV6 A;  2HYJ A;  4A3G J;  2FQ4 A;  2R5Z A;  2ZCN A;  1ITY A;  3WHC A;  4IEJ A;  1BJZ A;  1B72 A;  3BG9 A;  4NEL A;  2XB0 X;  3LNQ A;  2XB5 A;  2M8G X;  5IPA A;  3ZQC A;  4PXI A;  1I50 J;  4UUS B;  2NS7 A;  2K9Q A;  2L7M P;  4XRS A;  3EGQ A;  2UXI A;  1OCP A;  2RHA A;  3K2A A;  1BA5 A;  2KT0 A;  4J19 A;  3G1M A;  1WH7 A;  4B3A A;  2FJ1 A;  2WAQ N;  3BR6 A;  2JA7 J;  2DA7 A;  5K7Z A;  3B81 A;  1ETY A;  2E2I J;  3ON4 A;  3H0G J;  4GCK A;  4MXM A;  4I76 A;  2R5Y A;  2Y2Z A;  2K40 A;  4AC0 A;  3HOW J;  3HDD A;  1JKQ C;  1NK3 P; 
#chains in the Genus database with same CATH topology
 5A2Q K;  3DEE A;  3M07 A;  4KWA A;  3VUQ A;  2FD5 A;  4LJZ F;  4AIH A;  4ZTJ A;  1LPQ A;  4KFC A;  2P81 A;  1OPC A;  1B4A A;  5HBU A;  4ZDL A;  3KP5 A;  4XKC A;  1MZB A;  1KQ0 A;  3ISP A;  4OIO F;  3FXJ A;  1U5T C;  4CZZ A;  2FU4 A;  1V4R A;  3JRA A;  2KDO A;  3FMQ A;  5J47 A;  4WWC A;  3TGN A;  2X1C A;  3OYK A;  1LDK B;  4D5C A;  2CMP A;  2VIX A;  3ZOB A;  4L5E A;  2VQH A;  3E6D A;  4M6X A;  2BXY A;  1ZLJ A;  2LH9 A;  2I8D A;  4ZDO A;  1JGG A;  1S9H A;  3AFH A;  5D6F A;  2ZME B;  3SJM A;  1FIP A;  3WE2 A;  1P4X A;  5CQG A;  4UNO A;  1W4M A;  2KHM A;  1I39 A;  1UCR A;  4NQW B;  4WXC A;  5K58 A;  2HQ5 A;  4LG0 B;  2JA8 J;  4GXO A;  5F04 A;  2MH9 A;  1KZH A;  3E1S A;  2ZCW A;  3OYJ A;  3VVY A;  3HRT A;  4UVA A;  3VVZ A;  1KU2 A;  3VOD A;  1ZGW A;  2CFX A;  4DW6 A;  4HLY A;  2A2F X;  3U9G A;  3BJB A;  3CC4 I;  4BEH B;  2QKM B;  2VXZ A;  2R7Q A;  1IXR C;  1MBF A;  1YOV B;  4BAY A;  5C4J J;  3PQJ A;  3L9F A;  2XDV A;  5CVI A;  2IW5 A;  5M5Y J;  1XSD A;  3ABM H;  1TWF J;  2L0K A;  4HV5 A;  3LA3 A;  5DCM A;  2DYR H;  5EYR A;  1K6Y A;  2DG7 A;  3K4K A;  1JKR C;  3S3O A;  3LFK A;  4V19 K;  1FP2 A;  2XAH A;  1QVU A;  1VQ6 I;  1APL C;  2QA4 I;  1WVR A;  1XSX A;  4DYQ A;  1Y0U A;  1LUJ B;  5HDG A;  3T0Y A;  1I3A A;  3H5A A;  4FCY A;  1LDJ A;  3VVX A;  2VBY A;  3TDU C;  2L5Q A;  1LE8 A;  3O3K A;  4L0Z B;  5FJ8 J;  3EUH C;  2DTZ A;  3CZ6 A;  4RAF A;  5GAH J;  2Z16 A;  4XLN F;  4PJJ A;  1SVL A;  2KLO A;  5H20 A;  3V7R A;  3KKD A;  4JQF A;  3ERM A;  2R7D A;  2EIM H;  1MW7 A;  2V9K A;  5HOD A;  3AL0 B;  3KYC B;  5HSZ A;  3GZN B;  3QOD A;  1IC8 A;  1IUF A;  2XUB A;  1VQK I;  3HOV J;  3I4M J;  3LHQ A;  4OWR B;  5LEJ A;  2HYG D;  2VAS A;  3IKV A;  2E1M B;  2XAS A;  2K3P A;  2JK3 A;  4AYB N;  2E1C A;  4KIS A;  3DKX A;  4W1U A;  4XRF A;  5DTD A;  3RIR A;  2BYV E;  1NG7 A;  2R5Y B;  3DV8 A;  3E5Q A;  1G2H A;  3WG9 A;  3HTJ A;  5JHU A;  2M7B A;  3S15 J;  3COA C;  3ZMV A;  5HS8 A;  1D0X A;  3QU3 A;  1DP7 P;  1DU6 A;  2OCC H;  3C7J A;  4HST A;  3CJT B;  1XTA A;  4G12 A;  1RZ4 A;  2FEZ A;  2IA2 A;  1I1S A;  5E17 F;  2DA4 A;  1FBQ A;  3BR2 A;  2VLA A;  1O3S A;  3PO2 J;  1UFM A;  3PNT A;  1B6A A;  3QQA A;  4PDK A;  1JUS A;  5B5E C;  3HOS A;  4MEX F;  2EZL A;  4KNY A;  4IVN A;  2CWE A;  3H35 A;  4OAY A;  1Z91 A;  3I71 A;  1AWC A;  4R79 A;  1C0W A;  3J7Y J;  2KL4 A;  4NDL A;  1G4D A;  3K4C A;  2D1V A;  1IF1 A;  2W4S A;  4XRM A;  3HHG A;  3SFI A;  2X1D A;  2GFN A;  1DGW Y;  4C2M A;  1MH4 A;  5CVV A;  3S16 J;  1WJB A;  3P7N A;  2WV0 A;  3PIO F;  3JRF A;  4IOA F;  5JLX A;  3JTH A;  2KMU A;  3TOB A;  5BMZ A;  4FE4 A;  1MDM B;  1NK2 P;  2FOK A;  4EQQ A;  3VWB A;  5B3S H;  3OYM A;  3VOX A;  1N25 A;  1ZHF A;  2ELJ A;  3I3L A;  4NNJ A;  5F64 A;  5GAD J;  3UR3 C;  2F5E A;  4DYC A;  1I3Q J;  3MZ8 A;  5DAJ A;  2HNH A;  1XCV A;  1MMS A;  4N0B A;  1MSF C;  3O8H A;  1RR7 A;  4FET A;  1J7K A;  2L9N A;  4I01 A;  4LIU A;  3GFJ A;  4EJV A;  5F0C A;  2AQF A;  3IP4 B;  3PUB A;  2G7S A;  5ED4 A;  1ETX A;  4OIN F;  3OS0 A;  3K4J A;  1FJL A;  4C2M J;  3D0S A;  3VW1 A;  1SMT A;  2O8X A;  3OOU A;  3TO9 A;  1JJ8 C;  1REP C;  1MJB A;  2GIZ A;  5DCM B;  5IYD J;  2VB6 A;  3HM5 A;  2BEO A;  2EZK A;  3IC7 A;  4XBF A;  1XSV A;  4XR6 A;  3N05 A;  2FBK A;  4RDU A;  2YX4 A;  1FTZ A;  2G9W A;  3ZQL A;  1YIJ I;  2HFH A;  2BBY A;  2O03 A;  3MKY B;  2DLL A;  1YRN A;  2QKL B;  1TW2 A;  1LE8 B;  3CES A;  4F3Q A;  3CCR I;  1TWG J;  1K61 A;  4ZYA A;  1IG7 A;  3RTR A;  2KIU A;  4QPO A;  5EEH A;  4IRI A;  4ENJ A;  2GQQ A;  2Q2E B;  2H8R A;  4PFP A;  4A3C J;  1HA8 A;  2X9D A;  1Z0X A;  2JA6 J;  2J5P A;  5ILS A;  3S5R A;  5FFX A;  2WB1 N;  1YS7 A;  1V55 H;  3OYA A;  4LB6 B;  2CUE A;  1GT0 C;  4O5V A;  2Y9Z A;  3HIF A;  1Z7L A;  2EFO A;  2CH0 A;  3JRE A;  4XK4 A;  4Y4R A;  1ETQ A;  4HBL A;  4PJ0 C;  2OC6 A;  2XKO A;  2VJJ A;  5AON A;  3MNL A;  3V8J A;  2HZD A;  1S3J A;  5FKM A;  4E6K G;  3CC7 I;  3HGY A;  1RR8 C;  2YR2 A;  2FE3 A;  2OCE A;  2YS9 A;  3RQI A;  5FLM J;  2Y30 A;  3FIS A;  1CF7 A;  2YSR A;  4CIC A;  2R7Z J;  4IRV A;  2OF7 A;  1UAA A;  3LFU A;  2P6T A;  5K7F A;  2KZV A;  3FXO A;  3C07 A;  1R4M B;  4LD5 A;  4IPA A;  2LC2 A;  3M4O J;  3VOK A;  1T38 A;  5LRR A;  2GXA A;  3BZC A;  2FRH A;  2VJI A;  4QPQ A;  1I1G A;  3HZJ A;  5EZH A;  4GCT A;  2EA4 A;  2MLG A;  1B1B A;  5CVJ A;  2MD5 A;  3EYI A;  1FYL A;  4P96 A;  4ACI A;  2DU9 A;  2QQA A;  2EV5 A;  3K9T A;  4JX6 A;  1HOM A;  3JAM K;  2ADU A;  2QWT A;  2DG8 A;  5KAF C;  1D8K A;  2IRF G;  4XL9 A;  4RB1 A;  4YFX F;  3V4G A;  2VBZ A;  4RA2 A;  2DQL A;  3MZH A;  1R36 A;  1U8R A;  5JVG F;  3W3C A;  2VE9 A;  3IRR A;  5M5W J;  4JNN A;  3NXC A;  4I98 B;  3K1P A;  4D0P A;  3KEY A;  4BDY A;  3PFY A;  4B47 A;  2E71 A;  2MBF A;  4Z2Y A;  2QLZ A;  4C30 A;  1R58 A;  3WTZ A;  3KYL A;  1OLT A;  2IBD A;  4L18 B;  3S1N J;  3Q5F A;  5J6X A;  3E97 A;  3NAR A;  4NHJ A;  1IN5 A;  4A3B J;  1QHH D;  2QQ9 A;  5HDK A;  2EFP A;  5GTI C;  3R60 A;  3T8T A;  4G6Q A;  4M3F A;  3OYH A;  4IX7 A;  2HDD A;  1J9I A;  5FLX K;  1G3T A;  2P7C B;  4CHU A;  2XAJ A;  1BC8 C;  4M3G A;  3ROU A;  3G1O A;  1QZE A;  3F8N A;  1W5C C;  4M3B A;  1IV8 A;  1H0M A;  2CUF A;  3FX3 A;  1Y8R B;  4KT5 C;  6PAX A;  2HQA A;  4W97 A;  2E1N A;  3BTL A;  4II2 A;  2PJR B;  3NEU A;  1BL0 A;  3G1L A;  5D4R A;  4JL3 A;  1U9O A;  3I64 A;  4IQJ A;  2OA4 A;  4I09 A;  1ZRD A;  4HZF A;  5F0H A;  3GTM J;  2LFB A;  2GLO A;  1UG0 A;  2NP3 A;  5CXG A;  4D9J A;  2PFV A;  3K1N A;  2JVG A;  3PNV A;  3CP2 A;  2VBW A;  2ZXH A;  1VTN C;  2LRE A;  3WOD F;  1KQ9 A;  3FKJ A;  2XRL A;  3BTC A;  5F1R A;  3I58 A;  1JJ6 C;  4I7H A;  2VL8 A;  2VBX A;  4JBA A;  1SFK A;  3F1B A;  4HG2 A;  3BNI A;  2BY1 A;  3U1D A;  3Q3S A;  1VFC A;  2LF8 A;  3KEO A;  3F72 A;  1J59 A;  3HTS B;  2W57 A;  2R7O A;  2W82 A;  1S5L C;  4FHT A;  1BI0 A;  4NC8 A;  3GFI A;  3MN2 A;  1J0R A;  3X2Q H;  4O3M A;  1TC3 C;  1CF7 B;  2FXA A;  1I6X A;  4XLC A;  2Y31 A;  2CQQ A;  4MHG A;  3QOP A;  3IHU A;  1GLN A;  3ML6 A;  4OIR F;  5L3C A;  1A5J A;  2VT2 A;  5FGL A;  1WHU A;  1YHQ I;  2XAF A;  3JAM Z;  2E7X A;  2UXU A;  3BQZ A;  4ZYG A;  3HTU A;  3BZ6 A;  4I0B A;  4BS9 A;  1R1V A;  2A5W A;  2IS1 A;  3WGI A;  4BQA A;  3ABU A;  2ZOY A;  3ANG A;  5FLV A;  1R1T A;  1WJF A;  2VQL A;  3BDD A;  3RPQ A;  1JTY A;  2BVM A;  4NN1 A;  4UY8 I;  4U7B A;  3ECH A;  2VOD A;  1HKT A;  1Z67 A;  2YPR A;  2VPR A;  1K83 J;  1OR7 C;  3C3W A;  3DWL E;  3KCC A;  4S04 A;  1R4N B;  4M3E A;  1O7F A;  4L0Y B;  5LHI A;  4AC6 A;  3L1P A;  1Z6T A;  4C9Y A;  3CMA I;  4ME9 A;  1WSU A;  1MBK A;  2QBY B;  3GTO J;  2HDW A;  2W84 A;  2COB A;  1XMA A;  2ZFW A;  3R6S A;  1OJL A;  3PQK A;  4A3G J;  1YTY A;  2FQ4 A;  5FLX Z;  5KAI C;  2Z5U A;  3FXQ A;  3BG9 A;  3SZG A;  3GME A;  4Y15 A;  3K8P C;  1YJN I;  4KT6 A;  2XB5 A;  3ZQC A;  4XOP A;  5DCF A;  2K9L A;  1QQI A;  4UB6 C;  4XRS A;  1P6R A;  3L2W A;  3E6C C;  1IUY A;  2HDC A;  2CFO A;  2KT0 A;  3BJO A;  2E34 A;  4B3A A;  2WAQ N;  2YU3 A;  3HSF A;  2R7V A;  2LKP A;  2Y2Z A;  1LNW A;  1HQC A;  1Y8Q B;  3F6O A;  3D5S C;  3HHH A;  4IRH A;  4U0Y A;  4C3I J;  2MW8 A;  1BOA A;  2M0C A;  3IWF A;  1D1C A;  3CRJ A;  5EGO A;  4LOC A;  2ZXI A;  1RKT A;  4KN7 X;  2RNJ A;  1ENH A;  4E7Z A;  4GCL A;  1USS A;  1FOY A;  2D1H A;  1XN7 A;  4V2F A;  5E8I A;  4UVB A;  2QM3 A;  1X1B A;  1V54 H;  3OOP A;  2FX0 A;  3VYS B;  3BHQ A;  3J80 K;  4AUX A;  1Z21 A;  2M30 A;  2O9L A;  2B3W A;  5FKN A;  4HA8 A;  1O3T A;  1YW7 A;  1W7P B;  3CME I;  2G7L A;  5JVT A;  5FHP A;  5J1Y A;  5D5U B;  3VPR A;  1UMQ A;  5DS9 A;  1JUP A;  3ZMS A;  2LG4 A;  3HKZ A;  1ZGJ A;  2K3F A;  4WXH A;  2VOO A;  3K0L A;  5K5Q A;  1XMX A;  2WV1 A;  4G9Y A;  1H88 C;  3V8K A;  1EJ9 A;  3LL7 A;  2B1E A;  1CQT A;  1ETK A;  3OYE A;  1J75 A;  3REO A;  4Q47 A;  3GTK J;  5CYV A;  5E3L A;  3OYL A;  2Y69 H;  3ELK A;  4KJZ A;  1Q1H A;  2E7W A;  4KIG A;  1J2X A;  5HS9 A;  3JW4 A;  2VXD A;  1ON1 A;  1A31 A;  4HW0 A;  5JFR A;  5HNF A;  1ZQ3 P;  4L9T A;  2BGC A;  4CYC A;  1D8J A;  1ONV A;  2FNP A;  2LKS A;  4LLG F;  4UUV A;  1LEB A;  1E0E A;  3IAM 2;  5TIS C;  1ZK8 A;  2E60 A;  3GVA A;  2X4H A;  3K4B A;  1MMN A;  2M4G A;  5LHH A;  1GVJ A;  2NVY J;  1LVA A;  4KMF A;  3VB2 A;  3IAS 2;  3KNW A;  3A01 A;  2HEO A;  2VC1 A;  2M4K A;  2F5V A;  4PUS A;  2G0E A;  3QOE A;  1HLV A;  1SVO A;  3NWT A;  3DU5 A;  5LGU A;  4BKX A;  4I6Z A;  2GEN A;  5HNH A;  2CW7 A;  2DOA A;  5IOY A;  1IRZ A;  2VC0 A;  4FAS D;  2W1O A;  3MWM A;  1Z6R A;  2NOJ B;  1K4S A;  4Q48 A;  4B09 A;  4CA0 A;  3MVP A;  3MD2 A;  1SAU A;  3OV8 A;  4GFB A;  3I9V 2;  2CO5 A;  4IHT A;  4E70 A;  2K9N A;  3ZP5 A;  3HOZ J;  3OSF A;  2LSO A;  2NRA C;  2JWT A;  2A61 A;  3LA2 A;  2H8W A;  1X1C A;  5K1Y A;  4BE2 A;  4AM3 A;  4XKV A;  1D3Y A;  2HWV A;  1YI2 I;  2NX4 A;  3EUH A;  3I5U A;  4XLF A;  1F1Z A;  4KYW A;  2AXT C;  3N97 A;  1TW3 A;  3VYU B;  3HG9 A;  4DBR A;  5JLW A;  3HOU J;  2QOP A;  1BI3 A;  1VQN I;  5AIP A;  3DP7 A;  2CGP A;  1PP8 F;  2QYO A;  3CCU I;  1SAX A;  5DYM A;  3I4N J;  3Q0U A;  3AKZ A;  3SFZ A;  3DQV C;  2HTS A;  2VOP A;  3OWT A;  5EJC A;  2YVE A;  2J5O A;  3BLY A;  3J80 Z;  3ZN0 A;  4BDZ A;  4MK6 A;  2ZKZ A;  5LRS A;  3PSI A;  4Q4Z F;  2HKX A;  4EMS A;  2XHK A;  1BW6 A;  4LG3 A;  1ERD A;  3GEU A;  1A36 A;  3CMY A;  2EPF A;  3K4M A;  1WFX A;  2DA5 A;  3P9I A;  1H8A C;  2I10 A;  3TO7 A;  3RH2 A;  3F0C A;  1VI0 A;  2ME0 A;  3KET A;  4B48 A;  4J01 A;  3I59 A;  1S72 I;  2DYS H;  3T6N A;  1HXD A;  3S2W A;  1FOW A;  1U5T B;  3QYE A;  3GYH X;  1W36 D;  1YW8 A;  1UG2 A;  4PZJ A;  4JYK A;  3G3Z A;  2IGK A;  3V8L A;  3KP7 A;  4PJL A;  4I2O A;  1ZH5 A;  2DFF A;  1ZG1 A;  3M8E A;  1B8I A;  2RKH A;  1VZ0 A;  1YG2 A;  2KQR A;  3KZ9 A;  2VUM J;  3CF2 A;  1YW9 A;  1BC7 C;  3HYI A;  3LSG A;  3DLA A;  4RAZ A;  3HE0 A;  3L2V A;  3BG6 A;  4KUM A;  2GAU A;  3CUQ A;  1MNM C;  3G56 A;  3J7Z I;  2VJ5 A;  1L0O C;  4G8X A;  4HV6 A;  1UST A;  1YLF A;  3LMM A;  4CYC B;  4X0G A;  1S29 A;  3R0A A;  1X1A A;  5E3N A;  4GDF A;  4MNU A;  1TZL A;  3GTG J;  4EJU A;  4V2G A;  1QGP A;  1FOX A;  1K6O A;  1K78 B;  1QRY A;  3A01 B;  4M9Z A;  2M0M A;  4HOB A;  1Z9C A;  2X1E A;  1OCT C;  2EIJ H;  1Z05 A;  3RZO J;  3H3V K;  2L54 A;  3OYD A;  1LVK A;  4A0Z A;  2UXP A;  4IF4 A;  2OJE D;  2KIQ A;  1WI3 A;  3EDP A;  2BXZ A;  1LEA A;  2RNG A;  5J1R A;  2JUC A;  3KPH A;  3ZRG A;  2L2O A;  5LGN A;  1WWX A;  1NHA A;  4XLE A;  3L09 A;  2FF4 A;  2GM4 A;  2EIK H;  1GUU A;  2KIS A;  4E7J A;  3RZD J;  2XAG A;  1TQI A;  5J40 A;  3LQQ A;  4YG2 F;  5LD2 C;  3EUP A;  3VYT B;  5B1A H;  4HNV A;  5B66 C;  5GAE J;  5DV5 A;  3E3V A;  3GLL A;  3F23 A;  1ORK A;  9ANT A;  3U2R A;  3ERE D;  1POG A;  2CQX A;  3CF5 F;  4OD5 A;  1WPK A;  3BOQ A;  3DLL F;  2V6E A;  1HW1 A;  3GCM A;  2W48 A;  3M1C A;  3S8P A;  5LEK A;  1HCR A;  1F9N A;  1SD4 A;  1FSE A;  4AD9 A;  3FHZ A;  2Z9O A;  3HC7 A;  1BIA A;  2KIF A;  1FLI A;  2LY1 A;  4M72 A;  4ENK A;  1W5S A;  5M3F J;  3DTK A;  3DTI A;  2UUZ A;  2L9V A;  3GTJ J;  5D5W B;  3G71 I;  4M6V A;  5BPD A;  2DAO A;  2DCE A;  5EZG A;  1AA7 A;  3TKY A;  2DMN A;  3H9G A;  3HOT A;  4M6Y A;  2VPL A;  3HGG A;  2X85 A;  4HRI A;  2FBQ A;  1MND A;  5L3B A;  2LVS A;  2KRC A;  2ECB A;  2CUZ A;  1YFH A;  4CUG A;  2EK5 A;  3WE3 A;  1P9Q C;  1LFP A;  1Z3Y A;  4KIC A;  1S8N A;  4CYD A;  2X6X A;  1GDT A;  2ZSI B;  2FA5 A;  5HAW A;  1S7A A;  4LGW A;  4EM0 B;  2ZJR F;  1G59 A;  4L9N A;  2MLK A;  5DM7 F;  3I56 I;  2M87 A;  1LFU P;  1JE8 A;  3BG5 A;  2RAS A;  2XSJ C;  4XN3 A;  4XRS G;  1U78 A;  2Z1D A;  4LK0 F;  3HTI A;  3HRM A;  3H9J A;  1FMV A;  3TQN A;  4Z6Y A;  5DD8 A;  3S1R J;  1JHH A;  1HKS A;  5F6F A;  1MBJ A;  1HDP A;  2CV2 A;  3ZN1 A;  2ZCM A;  1R1U A;  1KYZ A;  4KIB A;  4P9U A;  5LGT A;  3HPH A;  3LWF A;  1B8I B;  2QSG X;  2A69 F;  1E3O C;  2PG4 A;  3RCO A;  1P4A A;  3KZY A;  3PPB A;  1YS6 A;  1D1B A;  2AS5 F;  2VKE A;  1UB9 A;  4EVI A;  3C2G A;  3M9A A;  2FUG 2;  2AHQ A;  4BHB A;  3I54 A;  2LD5 A;  1NH3 A;  3JRD A;  3HSR A;  3RKX A;  1IN6 A;  2PX9 A;  3CCS I;  2DJN A;  3MKZ A;  4R8H A;  3H3U A;  2LY2 A;  2X6Y A;  1W0T A;  3CUQ C;  4L5I A;  3A4C A;  3HSE A;  4P5O A;  4C2T A;  5IYB J;  2W53 A;  3F8C A;  1B9N A;  3PJR A;  2M7A A;  2DA1 A;  3HIM A;  3BR3 A;  5E3O A;  2A68 F;  2VKV A;  4CO8 A;  4LK1 F;  2YVH A;  3FHN A;  1P7J A;  5C3E J;  2K27 A;  2DMQ A;  3QPT A;  3P5J A;  2DFE A;  3F9K A;  4ASN A;  4YIR X;  3F8B A;  1TNS A;  4RGR A;  1HC8 A;  1MGT A;  3ZQG A;  4B3X A;  1RNL A;  3GTP J;  1SFU A;  3BTI A;  2MAB A;  3FXL A;  1FTT A;  2R7U A;  3RQ4 A;  2QUF A;  5FRO A;  2OQR A;  1RUO A;  1LFB A;  3V42 A;  1S6L A;  3D1N I;  5EF6 A;  1FYM A;  3K69 A;  5KHD A;  1QZY A;  1R23 A;  3NRV A;  4GGG A;  2CS3 A;  4AIJ A;  1P4W A;  1AU7 A;  3BY6 A;  5D5V B;  3JRG A;  3N4M A;  4CGR A;  1GV2 A;  4MGR A;  4DYR A;  4M71 A;  3L2Q A;  2Y0S N;  1RUN A;  4EGZ A;  1BR4 A;  2QTQ A;  2ZCX A;  1RRJ A;  3PUF A;  1QZZ A;  2NS8 A;  3GZ5 A;  1JXS A;  1Y56 A;  2V26 A;  2N8G A;  2O3F A;  3CTA A;  2M2E A;  5C44 J;  2NNY A;  3RD3 A;  3CDL A;  4U9N A;  3JSP A;  1VF9 A;  2TDX A;  1W5T A;  1WQ2 A;  3TP0 A;  4NC7 A;  3LAJ A;  5F08 A;  5KK1 A;  2P0W A;  4XIC A;  2BVL A;  1VQ4 I;  2LMD A;  2PMZ N;  4PK4 A;  3ZMU A;  1MJA A;  2NOG A;  2X6W A;  2QVO A;  4R1H A;  1A04 A;  5D5X B;  2PBX A;  2CUJ A;  2XSD C;  2OQG A;  5HLI A;  4N4N B;  1AOY A;  1T39 A;  2LY9 A;  1R5I D;  2EZI A;  3HPG A;  4M9X A;  3ONQ A;  1O4X A;  1T98 A;  2F5D A;  1WJE A;  1FBS A;  3CJQ B;  1MBG A;  3NWS A;  1MJ9 A;  3H0D A;  2QQ8 A;  1JT6 A;  4GFK A;  5E3M A;  2VKH A;  1KYW A;  4A12 A;  4DOZ A;  1O57 A;  3NI7 A;  4RLQ A;  3PFI A;  1JI8 A;  2G7U A;  3ZPL A;  2BW3 A;  2L02 A;  2ZBK A;  1TQM A;  2ISZ A;  3CO6 C;  2H27 A;  5TJJ A;  5ICF A;  2NVU B;  3FIW A;  1XGS A;  5IOZ A;  3NRG A;  1OCO H;  2PEX A;  3HTH A;  2ZB9 A;  2LBF A;  4GYG A;  3ZMT A;  4ZJZ A;  3QWL A;  3FM3 A;  2FNA A;  4O6J A;  3VEP A;  1XG1 A;  4IZZ A;  2JPC A;  4XM3 A;  3LSP A;  2I5U A;  2Q8K A;  4RB0 A;  2OBP A;  5F1J A;  1HBX G;  3F8F A;  3LST A;  4BE1 A;  5FKK A;  2R7T A;  5FB2 A;  1D0Z A;  2HYF A;  1TWA J;  4OIQ F;  1KU7 A;  1OR7 A;  3VYR B;  2IAI A;  5KCM A;  3SDB A;  3QRF F;  2R5Z A;  4RAG A;  1ITY A;  2ZCN A;  2DW4 A;  2O5R A;  2UV1 A;  2QGU A;  4DNC A;  2R7W A;  1B72 A;  4L9J A;  4G7O F;  4NEL A;  2X51 A;  3B02 A;  3SQN A;  2K85 A;  2M8G X;  4PXI A;  2DFH A;  2K02 A;  2RRE A;  4CGZ A;  1BOB A;  3AG4 H;  3ASN H;  2UXI A;  2RHA A;  4HEA 2;  2DT5 A;  5ICE A;  4Q5S F;  3OR2 C;  2FJ1 A;  3BR6 A;  2EV6 A;  2DA7 A;  1ETY A;  2IGM A;  2RQQ A;  2KIM A;  4MXM A;  4I76 A;  2ZXJ A;  4AC0 A;  3HDD A;  3VOE A;  2MH2 A;  2IXS A;  1PJR A;  2VQG A;  1UEL B;  4YRV A;  2HI3 A;  2BHZ A;  3CCJ I;  3T8R A;  4WK8 F;  3A0B C;  2R7F A;  3QPL A;  4XOR A;  3KP4 A;  3JRC A;  2Q24 A;  3HTA A;  2R7S A;  2DK8 A;  2FBI A;  5FFZ A;  2O8K A;  2MC4 A;  2Z3Y A;  3EUA A;  4AYB A;  1E3H A;  2K4B A;  5HLH A;  2JRM A;  2ZOZ A;  2HQN A;  2IS4 A;  2GOX B;  1R6R A;  2BOL A;  2XKP A;  3FXR A;  2NYX A;  1W36 C;  2BV6 A;  4UVC A;  2OAZ A;  1YRN B;  2K7L A;  4WCG A;  3ZCO A;  2XGD A;  3H9Q A;  1FBU A;  2E36 A;  3H3Z A;  4M9S A;  1F36 A;  2V9P A;  2P8T A;  2OPT A;  4E7I A;  3L7W A;  4UV9 A;  4S05 A;  1TT0 A;  5DM6 F;  4XKW A;  2V9V A;  1G3W A;  2EJR A;  1TQP A;  2DOD A;  5J4V A;  4A6E A;  3RYP A;  5D8K B;  1DU0 A;  1WKM A;  2MGQ A;  3PAS A;  1WJ5 A;  3RSN A;  1Q1V A;  3OIO A;  4L5J A;  2AXL A;  2EFN A;  2F5C A;  2KRH A;  3I53 A;  2DJI A;  2DPD A;  3EUK L;  4C3H J;  1YX3 A;  1LQ1 A;  3EET A;  3G73 A;  4JOM A;  1XX5 A;  4XSZ F;  1XGO A;  2VI6 A;  3FK6 A;  3VW2 A;  3S93 A;  4HKU A;  2B0L A;  1BIB A;  2BW3 B;  2ME6 A;  4PGG A;  5EEA A;  4IOC F;  4A69 C;  3BCB A;  1MMD A;  1A6Q A;  3LSJ A;  5GPC A;  3MQ0 A;  3PL8 A;  2R7R A;  2CRG A;  2CQK A;  4ZZL A;  1R00 A;  4MQV A;  2MFZ A;  1TBX A;  2LBF B;  5CKT A;  2EB7 A;  2V4J C;  5F27 A;  1LDD A;  4MEY F;  3ZQH A;  1OYY A;  1ETV A;  2COM A;  2KFD A;  3LAP A;  5K5O A;  4OD4 A;  4B4C A;  2EZH A;  3QU6 A;  4BQN A;  3NPI A;  1O7L A;  1H9T A;  1XS9 A;  1SAN A;  2R5Z B;  2BHY A;  2PZ9 A;  5HS7 A;  4PJN A;  4IO9 F;  4MTE A;  3E6M A;  3G2B A;  4UV8 A;  1FNN A;  4HX7 A;  3OYF A;  3DPT A;  2HGC A;  4BNC A;  5EG0 A;  2VJ4 A;  3FXU A;  2STW A;  2Y0S A;  4AF5 A;  5K7H A;  1TL8 A;  2CW8 A;  5CPR B;  4M3D A;  4BJT A;  2OD5 A;  3IUO A;  1AKH A;  1OIS A;  3GO5 A;  2WUI A;  3Q9S A;  4ITV A;  2YX7 A;  2O0Y A;  3BPV A;  2HXI A;  2YU9 J;  1Z1D A;  4GYI A;  3RKW A;  2FJI 1;  5C4Y A;  3M1E A;  1HST A;  4MFD A;  1B9M A;  2W7N A;  4BQO A;  1ACI A;  1VQ5 I;  4IJA A;  2NNN A;  4XQF A;  4HDV A;  5TGT A;  3K1M A;  2BY0 A;  2NVT J;  2WB1 A;  5DUK A;  1KQ8 A;  2PMZ A;  3TBI A;  4BYY A;  1DUX C;  5DDG A;  2UXO A;  3R0J A;  2KZG A;  1OKR A;  2DPU A;  3KP3 A;  3BPX A;  3CLQ A;  5M5X J;  4A6D A;  2K9S A;  3PNY A;  3OR1 C;  4HX4 A;  2P4W A;  4CZC A;  3MFK A;  3CC2 I;  5D4S A;  3BR1 A;  3VFZ A;  1FSH A;  4G6D A;  1EA3 A;  1IDZ A;  2DBB A;  2XF7 A;  3JCU C;  3LJL A;  3V78 A;  3M8J A;  4FT8 A;  4P55 A;  1STZ A;  1XGN A;  4UXN A;  4BUP A;  4QSH A;  3BT9 A;  2QSF X;  4MLO A;  5J8F A;  1QA6 A;  4EJT A;  3K10 A;  1UI6 A;  2L9R A;  2ZXW H;  3ABK H;  2ACJ A;  2YUS A;  3OYI A;  3GTL J;  2R93 J;  5E1Z B;  3E5U A;  3WTT C;  3JRI A;  4AWX B;  3U21 A;  4A5N A;  2E19 A;  4FQG A;  2IP2 A;  1XB4 A;  4H0E A;  2GZW A;  2RV8 A;  2V1U A;  4YFK F;  5ILU A;  3G7R A;  3CQZ J;  1IRX A;  2K4J A;  3EQL F;  3BJA A;  4MO7 A;  3DPL C;  4RGU A;  1KU3 A;  3J7A O;  2CV1 A;  4BY7 J;  1DP3 A;  3E7Q A;  4I02 A;  2XPW A;  2A6E F;  2IA0 A;  2KKO A;  3L00 A;  3CCL I;  1Z3X A;  2IT0 A;  1JKO C;  4Y3O A;  4CCJ A;  3I55 I;  3M3Y J;  3V6G A;  3A1Y A;  4DBQ A;  4RM2 A;  1TT5 B;  3PIP F;  1MMG A;  5D18 A;  2QCO A;  3FMR A;  1BN5 A;  5F0F A;  2CQN A;  3HJE A;  2JPB A;  1H9G A;  5IP7 J;  4CH7 A;  1U0J A;  2CU7 A;  4X1E A;  2DMP A;  3LQR A;  2GXG A;  1ZN2 A;  4BAC A;  3SWH A;  1KU9 A;  1QPI A;  3HBL A;  1WJD A;  3CJD A;  4HYE A;  1U6G A;  4ZH4 F;  3RKQ A;  3JRB A;  1UZC A;  4II3 A;  2QF7 A;  4TV7 A;  3RYR A;  2DQR A;  3DBR B;  3AG1 H;  5E18 F;  1ZTR A;  2UXH A;  3C2B A;  3QPH A;  1OQY A;  4EJO A;  2GOM A;  1ZR2 A;  2ZME A;  2V1X A;  3FRQ A;  4M73 A;  2EIL H;  1EF4 A;  4JKZ A;  4OU0 A;  3C18 A;  1PUE E;  1SD7 A;  4NQW A;  3K2Z A;  3WTV C;  1OYW A;  1IZ1 A;  3WG7 H;  1EH8 A;  1H89 C;  4U88 A;  3F22 A;  4OIP F;  2F2E A;  4WIB A;  1QBJ A;  2XRN A;  4M74 A;  3WTX C;  2KJB A;  1ZRC A;  5H6R A;  1R49 A;  2XVC A;  1U8B A;  1M1E B;  3ECO A;  3FMS A;  1AKH B;  2E1O A;  4BEH A;  1N77 A;  3NNR A;  4LIT A;  2CSO A;  3F8M A;  4NB5 A;  4RLF A;  3UNG C;  4EGY A;  3SEQ A;  2L7Z A;  3ABL H;  2DA6 A;  4IL6 C;  3KP2 A;  1U9N A;  5CVR A;  4EV0 A;  2TRT A;  3IKT A;  4ICH A;  3CCE I;  2Z2S B;  3P9T A;  1WJC A;  2Q0O A;  4FX4 A;  2HPI A;  4A3D J;  5EDN A;  3PO3 J;  2EV0 A;  4ETS A;  4EEF G;  2IU5 A;  1PP7 U;  1XDU A;  4BU2 A;  3IWZ A;  5L3F A;  1FZP B;  2KP6 A;  2XPV A;  2OV7 A;  3DEU A;  1IN4 A;  1T08 B;  1RC9 A;  5IY5 H;  1FEX A;  1BW5 A;  3C1D A;  4HSR A;  2QIB A;  4QLC U;  2LOO A;  1PYV A;  3HL2 A;  3CCM I;  4RS8 A;  1R9T J;  2LKX A;  3WTY C;  4LLL A;  2F48 A;  2ZSH B;  2D2W A;  5DD4 A;  2MC3 A;  1OFC X;  4RBO A;  1IXC A;  2JTV A;  2PN6 A;  3HRS A;  2ELK A;  2K86 A;  2Q1Z B;  3AG2 H;  3KZI C;  4XLP F;  4F91 B;  3O8G A;  3FZV A;  1QHG A;  5EGO B;  2F4O B;  2GWR A;  2HVQ A;  4A3F J;  2CW0 F;  1JTX A;  3CJR B;  2EA2 A;  4C3J J;  3W2W A;  2DOF A;  1XGM A;  5CLS A;  4OMY A;  4F55 A;  2IVM A;  1NG6 A;  2ISY A;  1T33 A;  1TWC J;  4QWQ A;  3TMO A;  1FY7 A;  2M3A A;  4GO1 A;  4S0H B;  2HVR A;  4A93 J;  2P7V B;  2HOT A;  2HR3 A;  3A02 A;  2WAD A;  2XPU A;  2ZJQ F;  1V3F A;  3RPU D;  3C2H A;  2HYT A;  2QEX I;  3DTE A;  2Z99 A;  3KKC A;  2HOS A;  2ESH A;  1LJ9 A;  2DT6 A;  3KZZ A;  4QTR A;  3HRU A;  4C2U A;  5ERI A;  4UUT A;  1ETO A;  2LR8 A;  4Y13 A;  2MSY A;  5LFA A;  4IRG A;  2BE5 F;  2GA2 A;  4LMY A;  3M8F A;  1NTC A;  1Y6I A;  4WF2 A;  3OYB A;  2B63 J;  2RQP A;  3H92 A;  5HVQ C;  5KVR A;  1SFX A;  2DTR A;  4LB5 A;  2G7G A;  4E7S A;  5JI6 A;  2ZC2 A;  2K5C A;  4JP0 A;  4YEJ A;  5FO5 A;  1D5Y A;  3FM5 A;  5FRN A;  2GBY A;  2F07 A;  5CJ9 A;  2Z33 A;  3VIB A;  4U0W A;  1IN8 A;  2DDA A;  4UDS A;  1N78 A;  4Y17 A;  4PCQ A;  2RC4 A;  4HF2 A;  1BBY A;  2EFW A;  1FP1 D;  1G8X A;  2V79 A;  4IHV A;  1U3E M;  2V1N A;  1ZG3 A;  2A3S A;  2XF6 A;  2GA1 A;  4BGD A;  2F4M B;  2E2H J;  4DQ2 A;  1FC3 A;  1TTY A;  3CO7 C;  5H9T A;  3W2A A;  3EPZ A;  2ZME C;  4OMZ A;  4YII A;  3ZQQ A;  3KYD B;  5L3E A;  2WAQ A;  3LWJ A;  3GXO A;  1UHS A;  1WH5 A;  1OCZ H;  1MD0 A;  2RDP A;  2XGX A;  3CP8 A;  3E5X A;  1P2F A;  4H4K C;  4P1W A;  4ZTF A;  2LYC A;  2HKU A;  3NAU A;  1YO5 C;  3MCZ A;  2O7T A;  3QBM A;  1MDM A;  3AQS A;  1QO0 D;  2ID3 A;  3NQO A;  2FMY A;  3MAJ A;  4XON A;  5BPI A;  4ZZD A;  2WBM A;  3S1M J;  5GP9 A;  3Q0V A;  2LP0 A;  3W2V A;  1YQA A;  3CJN A;  2L7K A;  3L2C A;  3H5R A;  2DI3 A;  3W6V A;  4HF1 A;  2FSW A;  1GXQ A;  4B8X A;  1T56 A;  3CLO A;  5AIQ A;  5DEQ A;  1DPR A;  1RET A;  3K4N A;  4PFO A;  3GF2 A;  4G94 A;  2QQB A;  4G6T B;  5IT9 Z;  2EFQ A;  1XMK A;  1F5T A;  2RGV A;  3GX4 X;  3SDG A;  4Y7N J;  4GCV A;  3QKX A;  2GIV A;  2ZJP F;  1EH6 A;  2ZJ2 A;  1PUF A;  2AQE A;  2OER A;  3KIO A;  4UB8 C;  2ECC A;  1Y0N A;  4E7K A;  3RI4 A;  4DGW B;  2JUG A;  1FYK A;  5D19 A;  1SVM A;  2A6H F;  2BY3 A;  1MBE A;  3ZQ7 A;  2FML A;  4RGX A;  2HS5 A;  1ZYR F;  1VQM I;  4AIK A;  3O60 A;  3VSK A;  2LF7 A;  4MQ9 F;  5CQE A;  3V7S A;  2XAU A;  5E8G A;  2Q2E A;  1ZKG A;  2UXN A;  2TCT A;  4ESF A;  1FWZ A;  2E2J J;  3OMY A;  2VKD A;  3DF8 A;  2UXX A;  3EYY A;  2OZ6 A;  3AL0 C;  2R92 J;  1SMY F;  3BZK A;  4U0V A;  1ZRF A;  3I59 B;  3OIP A;  4CCN A;  4D7N A;  4LLN A;  5A2Q Z;  4YZE A;  2ZNY A;  2DMT A;  4QIW N;  1VQP I;  2KPM A;  3FK7 A;  1GV5 A;  2EWN A;  2E1M C;  1IV6 A;  5FGM A;  1MIJ A;  2YVX A;  5BOX A;  4IEJ A;  1YIT I;  1BI1 A;  4ZYD A;  2RN7 A;  2XB0 X;  3U1K A;  2ELH A;  1I5Z A;  1VQ7 I;  3FXK A;  2P5V A;  4ZYH A;  3GW2 A;  3K4L A;  1I50 J;  3TL4 X;  4XLH A;  2NS7 A;  3WTS C;  1O3R A;  2K9Q A;  2M5W A;  1BR2 A;  1KA8 A;  2PBI A;  3EGQ A;  3WU2 C;  1OCP A;  2PI0 A;  2GXB A;  4I99 C;  4IKF A;  1FMW A;  3CUQ B;  3G1M A;  5FRM A;  1WH7 A;  4KIT B;  2CV0 A;  5K7Z A;  3B81 A;  2E2I J;  3L2R A;  4YFN F;  3ON4 A;  4OAZ A;  4GCK A;  1Z7U A;  4RMN A;  1R71 A;  2JRT A;  4CCK A;  2LNB A;  3SZP A;  3K70 D;  3WGH A;  2JZY A;  1V5F A;  1X3U A;  2ID6 A;  3F21 A;  1ZAO A;  1GXP A;  3CCQ I;  5B1B H;  1S7E A;  2KDZ A;  2F4I A;  3HXL A;  3DU6 A;  3O2P E;  1XC5 A;  2V7F A;  1D0Y A;  4KN4 X;  1MSE C;  2JA2 A;  1OYI A;  1T6S A;  1SFE A;  3E7L A;  3GTQ J;  1W7P D;  1WRJ A;  5HLG A;  2UZK A;  2NP5 A;  3ULQ B;  5BNG A;  2DA3 A;  2NXN B;  4HF0 A;  2H6C A;  1X4P A;  4AVZ A;  4P9F A;  2PLY A;  3BG3 A;  2OTJ I;  3QAH A;  4XN0 A;  5GPA A;  2WAF A;  1IJW C;  2NVQ J;  4LIV A;  2O7O A;  4Y52 J;  1ZAR A;  3FDY A;  3DFG A;  3H36 A;  1IGN A;  4MIM A;  2JT1 A;  2BY2 A;  4BJ6 C;  3BR5 A;  4XKB A;  1R5G A;  1Z77 A;  4DVY P;  3SYT A;  3TOA A;  4DZP A;  1ZG5 A;  5FD5 A;  4XSX F;  4K2E A;  4U87 A;  3TW7 A;  1CGP A;  4NBQ A;  5H2F C;  2G7H A;  4XNF A;  3OYN A;  3RPU A;  2X6O A;  5TRD A;  1V5E A;  3DPJ A;  5LHG A;  1KON A;  3DCF A;  3BWG A;  3WTU C;  5GAG J;  1I27 A;  1DPU A;  3Q9V A;  1X4O A;  1IW7 F;  1ZEL A;  2M1B A;  1OCR H;  2ZO4 A;  3LA7 A;  3OS2 A;  1SD5 A;  2WWY A;  1PUF B;  3GFM A;  1IRF A;  4GRI A;  3ZQI A;  3KLN A;  4NUB A;  1OCC H;  3QPS A;  3GWZ A;  2EIN H;  4HPQ A;  2PJR A;  5CVU A;  2QEN A;  1E3P A;  1DGR M;  1VQ8 I;  3W6J B;  3HUG A;  1UHM A;  3OYC A;  1EV7 A;  5GTH C;  1HDD C;  1X3W B;  2EQR A;  2CG4 A;  4HNT A;  3HOX J;  2X0L A;  1WJA A;  2Y48 A;  2IEK A;  3B73 A;  3GZ6 A;  1ODD A;  4N4O B;  4XLA A;  1T8I A;  1G6N A;  4A3E J;  4BXF A;  1FPQ A;  2RVC A;  4A3J J;  2STT A;  2VT3 A;  2DN0 A;  2XAQ A;  4A5M A;  4MTD A;  5H6Q A;  3BTJ A;  4DJA A;  2K9M A;  1RI7 A;  2IGN A;  2WAE A;  2CQ7 A;  2HOA A;  4EAT A;  3WTW C;  4UHT A;  2IS6 A;  4FTH A;  4KDP A;  5FMP A;  3OYG A;  3S1Q J;  3BC8 A;  3DEW A;  3ASO H;  2AO9 A;  3G4S I;  4ZDP A;  5C4X J;  3CCV I;  4BJ5 C;  3ZGK A;  3SEZ A;  4OOI A;  1JT0 A;  4HQE A;  4BXX J;  2HKO A;  3GUD A;  3UKG A;  4WXD A;  1EH7 A;  4F92 B;  1SEU A;  2VN2 A;  1E17 A;  3FBN B;  3V7C A;  3D5L A;  3W6K B;  4EM2 A;  4MFE A;  4HX8 A;  4PGH A;  4JX5 A;  1QVT A;  4A3I J;  2WTE A;  2Y9Y A;  1ETW A;  3BRU A;  2WGB A;  2EH3 A;  2IJL A;  3HKZ N;  3WU0 A;  2O61 A;  3ANP A;  1FT9 A;  3ZQF A;  4L9V A;  2XF5 A;  3LSH A;  4D1Q A;  3K7A J;  1Y39 A;  2XGE A;  4LFU A;  1F4K A;  4RGS A;  5M3M J;  2DDB A;  2JN6 A;  2NAZ A;  5IP6 A;  4RB3 C;  2LLK A;  3ZXS A;  1BM9 A;  1A6I A;  5D1R A;  5L3D A;  1HF0 A;  1VQL I;  2QKO A;  1AHD P;  2QBY A;  2M8E A;  1UHW A;  4FE7 A;  2OUM A;  4IQ4 A;  4F52 A;  3BQY A;  3AG3 H;  3KLO A;  2VE8 A;  4RM3 A;  1ZLK A;  2W85 A;  4E7H A;  3F6V A;  4HNU A;  3WHB A;  4E4H A;  1ZGA A;  3VTI A;  1NK3 P;  2H1K A;  1V5G A;  2HQR A;  2L4M A;  3TED A;  3F3X A;  3IH2 A;  4Y33 A;  1HW2 A;  4L62 A;  1EKE A;  3CCY A;  3CMM A;  3ZMD A;  3BRO A;  1G3S A;  1K4T A;  5IT3 A;  2X48 A;  4IHW A;  3FXM A;  2REK A;  2MA3 A;  3GEZ A;  1FIA A;  2JSC A;  4A3M J;  1MH3 A;  2XDN A;  5KNL A;  3Q0W A;  4F7Z A;  3HOY J;  3FF5 A;  1L3L A;  2D5V A;  3GFL A;  4CCO A;  3CDH A;  4FIS A;  3M7G A;  4CCL A;  2IS2 A;  1F43 A;  2MG4 A;  3BJ6 A;  3BG7 A;  3O6B B;  3R61 A;  1SGM A;  4BHC A;  3HUG B;  1D1A A;  2JQ7 A;  2R3S A;  4EM1 A;  3JR9 A;  3HB9 A;  1HSJ A;  4YEL A;  3WGG A;  1O3Q A;  3A2K A;  1IRG A;  1YE9 A;  3S32 A;  3H1C A;  2XC7 A;  2VQC A;  3MKW B;  3AQT A;  3OSG A;  3BCG A;  2ESN A;  1W7P A;  2FQ3 A;  3BCA A;  1WGX A;  3MKL A;  2E5N A;  1UJ8 A;  2XGC A;  4D7M A;  1RKW A;  2PJP A;  1PVE A;  1T0F A;  2PQ8 A;  3HEF A;  3CWR A;  3IH4 A;  2O6G E;  3OY9 A;  2H09 A;  3GLX A;  5D6E A;  1PDN C;  1X2N A;  3IL2 A;  3TP3 A;  3BR0 A;  4B43 A;  5BS6 A;  1X2M A;  3GZI A;  1ON2 A;  2LK2 A;  2M45 A;  2V6C A;  2MD0 A;  3AAF A;  3FWE A;  3ESW B;  4KA4 A;  5CW8 A;  3KE2 A;  1SD6 A;  2LRD A;  2UWM A;  4X6A J;  5IYC J;  2FBH A;  3QP6 A;  5CXI A;  1YJW I;  4ESB A;  4ABZ A;  4EJW A;  4ENM A;  2H94 A;  2RAE A;  1TNT A;  3I0T A;  5E1X A;  5JHF A;  4PSX A;  3DKY A;  2M9H A;  1R7J A;  3T1B A;  1B72 B;  2D45 A;  3SZT A;  5L3G A;  3P9K A;  2OU2 A;  3FKI J;  5E79 C;  4U7D A;  3LSI A;  1P92 A;  1FX7 A;  1YJ9 I;  3S2H J;  4A3K J;  3ZMZ A;  2DFI A;  3S14 J;  1JKP C;  4BQQ A;  1JHF A;  3G6E I;  1D5V A;  2IPQ X;  4BXU A;  4ZYE A;  1GVD A;  1JUM A;  4DZJ A;  2OI8 A;  3J81 K;  2HZT A;  5ICC A;  2CJJ A;  3B6C A;  3E0J B;  3JSJ A;  4HAM A;  3QP5 A;  2HXO A;  2KJC A;  2M34 A;  2NVX J;  1TP4 A;  3S17 J;  1MBH A;  5ILV A;  2DO7 A;  5JR3 A;  1MKM A;  3K6G A;  3ZR8 X;  3T5X A;  1LKX A;  1J09 A;  3QYF A;  1KGS A;  2E35 A;  1IN7 A;  3D5R C;  2L9S A;  2JMW A;  4JX4 A;  2IA1 A;  4E7L A;  1J5Y A;  5LBQ A;  5FKL A;  1XPX A;  1BR1 A;  4IXA A;  2P6S A;  3R4K A;  5J1U A;  2IGO A;  5BQT A;  2CYY A;  5J3L A;  4NC6 A;  3KFW X;  3A0H C;  1X58 A;  1Y1V J;  2EBI A;  1MNE A;  4DIQ A;  3I4P A;  4A2U A;  1SC7 A;  1BI2 A;  1BJA A;  5EFY A;  3TDZ C;  1WCM J;  1SFO J;  2OTL I;  2Y75 A;  1B59 A;  1QPM A;  4ON0 A;  3IH3 A;  1W1W E;  1FOK A;  5J4Y A;  4D5F A;  1JGS A;  2GUH A;  3DKW A;  3KEQ A;  3KX2 A;  2HOE A;  2JJ7 A;  1G3Y A;  1RES A;  3JSO A;  1IO2 A;  2H6B A;  3PM1 A;  4UUS A;  2W00 A;  4HQM A;  3B6A A;  4AID A;  4IHX A;  2LTP A;  4BE0 A;  1HW5 A;  1I6H J;  3CDI A;  3LOC A;  4N9I A;  1IAW A;  3L2U A;  1WZ2 A;  1ZR4 A;  2ZNZ A;  4AU7 A;  5AQC A;  2DOE A;  3DBH B;  2B9S A;  4A3L J;  1HKQ A;  3P9C A;  2F6C A;  3JRH A;  2DA2 A;  3K70 C;  1P7I A;  2G3B A;  2DMU A;  2V57 A;  4KMU X;  1K7A A;  4IHS A;  3MZY A;  3SHF A;  2WY7 Q;  4GFL A;  1U5T A;  2QWW A;  1X19 A;  4ZC3 A;  3JTG A;  3IRQ A;  1UI5 A;  2PMH A;  2OZU A;  4WX9 A;  2D6Y A;  4CCM A;  1DQU A;  3IUV A;  2KRF A;  2HTJ A;  1Y1W J;  4XMY A;  3OS1 A;  3DPU A;  1T0F C;  2L4A A;  1QNT A;  4FX0 A;  2LDU A;  4CSW A;  4G7H F;  1TWH J;  4IHY A;  4XID A;  3OIQ A;  1ZRE A;  1VND A;  2QZ8 A;  3S3M A;  3CUO A;  1XDS A;  1R5H A;  4PJM A;  3DBL B;  2XIG A;  2WY8 Q;  1VQO I;  2R7X A;  2WA0 A;  5EEG A;  4A0X A;  4ANJ A;  3KP6 A;  5HLT A;  5LLQ A;  3S2D J;  3VW0 A;  2VON A;  1R22 A;  2ZFU A;  2ETH A;  1W0U A;  4BBS J;  2P5K A;  3VP5 A;  3RDI A;  2XRO A;  4G7Z F;  2A5Y B;  4LG0 A;  4I0A A;  3SXY A;  1MMA A;  1ULY A;  1T2K A;  2HVS A;  1IXS B;  3TW6 A;  4HLX A;  5K5R A;  3J81 Z;  3WU1 B;  4AVP A;  2Y0M A;  3PSF A;  3RKY A;  1K78 A;  1X1P A;  5EG0 B;  3LSR A;  2HPM A;  2FOW A;  4HDU A;  3COL A;  1LB2 A;  2XV4 S;  3FBI B;  3OL4 A;  2DXI A;  4B44 A;  3DXJ F;  2ZY9 A;  3BP8 A;  4F93 B;  1VQ9 I;  5IP9 J;  4BL0 B;  4BY1 J;  2A05 A;  2ICW G;  5HDN A;  1X1D A;  2H1L A;  1XD7 A;  3A03 A;  2L7F P;  3MMY B;  5FKO A;  3GBG A;  3VSL A;  2F5F A;  2WC2 A;  3LSM A;  1A35 A;  2V1D A;  2B7E A;  4B1R A;  1YYV A;  4CXF A;  1U2W A;  3IV5 A;  2C6Y A;  5DUI A;  1K79 A;  4BBR J;  1GHC A;  1IDY A;  3LSK A;  4BHP A;  5E20 A;  2PMU A;  1RIO H;  1YX5 A;  4RAY A;  3CD6 I;  1RPW A;  4J00 A;  2W24 A;  4CDG A;  1DDN A;  2HU9 A;  1YIO A;  5IT9 K;  2E5Z A;  2R0Q C;  1E2X A;  4N9H A;  4YIF A;  1TLH B;  2DK5 A;  5HOO A;  3J7A Y;  1S7O A;  3ON2 A;  1OMI A;  4PSW A;  2R4G A;  1T95 A;  4ESJ A;  2JA5 J;  2DT7 B;  2HYJ A;  4ENN A;  2L01 A;  2QSH X;  3WHC A;  3VDX A;  1BJZ A;  3RJP A;  3S3N A;  2L3D A;  5ICG A;  1WI9 A;  1X3Z B;  2MYS A;  2PFB A;  5IPA A;  5J8C A;  3LNQ A;  5FD6 A;  4UUS B;  5D8L B;  2NS0 A;  1XCB A;  2L7M P;  2JVH A;  3QYB A;  4RB2 C;  1N75 A;  2W25 A;  3ABT A;  3E6B A;  4KIF A;  3OL3 A;  5E1W A;  3K2A A;  2P5L C;  1BA5 A;  4A0Y A;  4J19 A;  3MEX A;  1QU3 A;  2A6T A;  2JA7 J;  2BZT A;  3H0G J;  4JK1 X;  2R5Y A;  2A07 F;  2K40 A;  4XOT A;  3HOW J;  3H5N A;  4BH9 A;  3NS4 A;  1JKQ C;  2JSP A;  4U9L A;  3TO6 A; 
#chains in the Genus database with same CATH homology
 2ID6 A;  4KWA A;  3VUQ A;  2FD5 A;  4C3I J;  2MW8 A;  1S7E A;  2KDZ A;  2HI3 A;  2M0C A;  2P81 A;  1XC5 A;  3CRJ A;  5HBU A;  5EGO A;  3QPL A;  4LOC A;  3JRC A;  1RKT A;  2Q24 A;  3HTA A;  1MSE C;  1ENH A;  3JRA A;  4GCL A;  3E7L A;  3GTQ J;  2O8K A;  4V2F A;  4D5C A;  3ZOB A;  2NP5 A;  4L5E A;  2ZOZ A;  5BNG A;  2FX0 A;  3BHQ A;  2DA3 A;  4AUX A;  2O9L A;  3BG3 A;  5FKN A;  1YRN B;  5GPA A;  1JGG A;  2XGD A;  1IJW C;  2NVQ J;  4Y52 J;  2O7O A;  2G7L A;  5FHP A;  5J1Y A;  3SJM A;  1FIP A;  1IGN A;  4MIM A;  3VPR A;  1UMQ A;  5DS9 A;  1JUP A;  1F36 A;  3BR5 A;  2OPT A;  1Z77 A;  4DZP A;  5K58 A;  2HQ5 A;  2JA8 J;  3TW7 A;  2WV1 A;  1H88 C;  5F04 A;  3VVY A;  3VVZ A;  1CQT A;  1ETK A;  2X6O A;  3DPJ A;  1ZGW A;  3GTK J;  5E3L A;  3DCF A;  1DU0 A;  2MGQ A;  4DW6 A;  3PAS A;  3BJB A;  1Q1V A;  3OIO A;  1ZQ3 P;  4CYC A;  1MBF A;  1ZK8 A;  5C4J J;  2NVY J;  1PUF B;  3ZQI A;  4C3H J;  5M5Y J;  1TWF J;  2L0K A;  3QPS A;  3KNW A;  3A01 A;  5EYR A;  2VI6 A;  2G0E A;  3FK6 A;  2DG7 A;  3VW2 A;  1JKR C;  4HKU A;  1HLV A;  4BKX A;  4I6Z A;  2ME6 A;  2GEN A;  5EEA A;  1QVU A;  4A69 C;  5IOY A;  1HDD C;  1APL C;  2EQR A;  1IRZ A;  4DYQ A;  3LSJ A;  5GPC A;  4FCY A;  3HOX J;  2CRG A;  2IEK A;  3VVX A;  3MVP A;  1LE8 A;  5F27 A;  4GFB A;  4A3E J;  5FJ8 J;  4A3J J;  3ZQH A;  2DTZ A;  1ETV A;  2K9N A;  4B4C A;  2EZH A;  3HOZ J;  2DN0 A;  3OSF A;  3NPI A;  2JWT A;  1SAN A;  1XS9 A;  3KKD A;  2R5Z B;  3BTJ A;  5HOD A;  2PZ9 A;  5HSZ A;  1IC8 A;  1IUF A;  2HOA A;  3HOV J;  3I4M J;  2NX4 A;  3LHQ A;  4FTH A;  5EG0 A;  5FMP A;  3S1Q J;  4AF5 A;  5K7H A;  3DEW A;  4M3D A;  2WUI A;  2AO9 A;  1AKH A;  5C4X J;  2JK3 A;  5JLW A;  2QOP A;  3HOU J;  2HXI A;  4AYB N;  2YU9 J;  4W1U A;  5DTD A;  1JT0 A;  5C4Y A;  4MFD A;  2R5Y B;  1G2H A;  3I4N J;  3Q0U A;  4BXX J;  3HTJ A;  3S15 J;  3UKG A;  2NVT J;  2YVE A;  1DU6 A;  4MFE A;  4JX5 A;  1QVT A;  4A3I J;  4MK6 A;  2Y9Y A;  1ETW A;  3BRU A;  2WGB A;  4G12 A;  2UXO A;  2EH3 A;  3HKZ N;  1BW6 A;  2DA4 A;  3GEU A;  3BR2 A;  5M5X J;  3PO2 J;  3CMY A;  3ANP A;  3ZQF A;  2K9S A;  3QQA A;  1JUS A;  2DA5 A;  3K7A J;  1H8A C;  2XGE A;  2I10 A;  5M3M J;  3RH2 A;  2EZL A;  3F0C A;  1VI0 A;  2JN6 A;  2ME0 A;  3BR1 A;  1IDZ A;  5IP6 A;  2LLK A;  3T6N A;  3LJL A;  3V78 A;  1A6I A;  5D1R A;  1HF0 A;  2QKO A;  1AHD P;  4NDL A;  1UG2 A;  4QSH A;  3BT9 A;  4JYK A;  4FE7 A;  3BQY A;  4MLO A;  4XRM A;  3SFI A;  1UI6 A;  2L9R A;  2GFN A;  2YUS A;  1B8I A;  3GTL J;  1MH4 A;  2R93 J;  3S16 J;  3JRI A;  2E19 A;  3KZ9 A;  2VUM J;  3WHB A;  3JRF A;  3G7R A;  2H1K A;  5JLX A;  3CQZ J;  3LSG A;  3HE0 A;  4FE4 A;  1NK2 P;  3VOX A;  4MO7 A;  3E7Q A;  3TED A;  3IH2 A;  4BY7 J;  3G56 A;  1MNM C;  2XPW A;  4L62 A;  4DYC A;  3CCY A;  1I3Q J;  5DAJ A;  1JKO C;  4CYC B;  3M3Y J;  1MSF C;  3V6G A;  3O8H A;  2X48 A;  1RR7 A;  5E3N A;  4IHW A;  2REK A;  1FIA A;  5F0C A;  2QCO A;  1MH3 A;  4A3M J;  3GTG J;  2XDN A;  5D18 A;  2G7S A;  3Q0W A;  1ETX A;  1FJL A;  4V2G A;  4C2M J;  5F0F A;  3VW1 A;  3OOU A;  1JJ8 C;  3HOY J;  2D5V A;  1QRY A;  3A01 B;  4FIS A;  5IP7 J;  2CU7 A;  4X1E A;  2DMP A;  5IYD J;  1OCT C;  1F43 A;  3RZO J;  2MG4 A;  3H3V K;  3HM5 A;  2EZK A;  1SGM A;  1QPI A;  2UXP A;  3HBL A;  3CJD A;  4RDU A;  3RKQ A;  1FTZ A;  1WI3 A;  3JRB A;  3ZQL A;  3JR9 A;  3HB9 A;  2QF7 A;  5J1R A;  1ZTR A;  3AQT A;  1YRN A;  3OSG A;  2UXH A;  3BCG A;  3C2B A;  1LE8 B;  2GM4 A;  1GUU A;  1WGX A;  3MKL A;  1ZR2 A;  3FRQ A;  1TWG J;  3RZD J;  2XGC A;  4D7M A;  1RKW A;  1K61 A;  1IG7 A;  1EF4 A;  3HEF A;  3CWR A;  4JKZ A;  3EUP A;  3IH4 A;  2H8R A;  4HNV A;  4A3C J;  2X9D A;  1ORK A;  1Z0X A;  2JA6 J;  9ANT A;  1POG A;  2CQX A;  3S5R A;  2WB1 N;  1X2N A;  1WPK A;  3TP3 A;  3BR0 A;  2CUE A;  1GT0 C;  1H89 C;  1X2M A;  2W48 A;  3GZI A;  2LK2 A;  1HCR A;  2Y9Z A;  3JRE A;  5CW8 A;  4XK4 A;  1ETQ A;  4X6A J;  1U8B A;  5IYC J;  1AKH B;  2E1O A;  5CXI A;  3NNR A;  4ABZ A;  3MNL A;  2RAE A;  5FKM A;  5M3F J;  2L7Z A;  2M9H A;  2DA6 A;  3HGY A;  3GTJ J;  1B72 B;  4M6V A;  1U9N A;  2YS9 A;  3RQI A;  4ICH A;  2TRT A;  5FLM J;  2Y30 A;  3FKI J;  3FIS A;  4A3D J;  3P9T A;  5EZG A;  2DMN A;  5EDN A;  2R7Z J;  3PO3 J;  3S2H J;  2IU5 A;  3HGG A;  4EEF G;  4A3K J;  2OF7 A;  2FBQ A;  3S14 J;  1JKP C;  5K7F A;  2LVS A;  2ECB A;  2XPV A;  3C07 A;  3M4O J;  3VOK A;  1FEX A;  1BW5 A;  1GVD A;  1JUM A;  4DZJ A;  1GDT A;  2OI8 A;  2QIB A;  2CJJ A;  3B6C A;  1R9T J;  3JSJ A;  5HAW A;  2LKX A;  5EZH A;  4GCT A;  2HXO A;  2M34 A;  2NVX J;  3S17 J;  2RAS A;  1LFU P;  1MBH A;  1OFC X;  3BG5 A;  4RBO A;  4XRS G;  1U78 A;  3HTI A;  2ELK A;  3O8G A;  4ACI A;  5EGO B;  4A3F J;  2JMW A;  4JX6 A;  4JX4 A;  3S1R J;  1HOM A;  1MBJ A;  1JTX A;  1HDP A;  5FKL A;  2QWT A;  4C3J J;  2DG8 A;  2ZCM A;  5J1U A;  5J3L A;  1B8I B;  1T33 A;  1TWC J;  1E3O C;  1X58 A;  1Y1V J;  2EBI A;  3PPB A;  5M5W J;  4S0H B;  2VKE A;  4A93 J;  4JNN A;  2LD5 A;  2HOT A;  3NXC A;  2AHQ A;  3A02 A;  3JRD A;  5EFY A;  2XPU A;  1WCM J;  1SFO J;  2DJN A;  3IH3 A;  2HYT A;  1W0T A;  2IBD A;  3S1N J;  4D5F A;  2GUH A;  5IYB J;  2W53 A;  3KKC A;  2HOS A;  3NAR A;  2JJ7 A;  1RES A;  4QTR A;  4UUT A;  1ETO A;  2DA1 A;  2LR8 A;  3PM1 A;  4A3B J;  4UUS A;  3BR3 A;  2MSY A;  3HIM A;  5E3O A;  3B6A A;  2VKV A;  4IHX A;  1NTC A;  2LTP A;  2YVH A;  1P7J A;  2B63 J;  1I6H J;  4M3F A;  5C3E J;  3LOC A;  2HDD A;  1ZR4 A;  2G7G A;  2DMQ A;  5AQC A;  4JP0 A;  4M3G A;  4A3L J;  3G1O A;  1D5Y A;  3ZQG A;  3JRH A;  2GBY A;  2DA2 A;  3GTP J;  1P7I A;  2G3B A;  2DMU A;  2F07 A;  4M3B A;  3BTI A;  3VIB A;  2CUF A;  2V57 A;  4UDS A;  1FTT A;  4W97 A;  4IHV A;  3BTL A;  4GFL A;  1LFB A;  2E2H J;  3D1N I;  1BL0 A;  5EF6 A;  1UI5 A;  3G1L A;  4JL3 A;  1U9O A;  5H9T A;  2D6Y A;  3IUV A;  1Y1W J;  1AU7 A;  3LWJ A;  5F0H A;  4CGR A;  3JRG A;  3GTM J;  1UHS A;  1GV2 A;  2LFB A;  4DYR A;  2GLO A;  1WH5 A;  2NP3 A;  1TWH J;  4IHY A;  2Y0S N;  4XID A;  5CXG A;  1VND A;  2HKU A;  2QTQ A;  2ZCX A;  3NAU A;  2O7T A;  3QBM A;  3AQS A;  2ID3 A;  2NS8 A;  2XRL A;  3BTC A;  2N8G A;  5GP9 A;  3Q0V A;  2M2E A;  2LP0 A;  5C44 J;  3S1M J;  3CDL A;  1JJ6 C;  3RD3 A;  1VF9 A;  3S2D J;  3VW0 A;  4BBS J;  3F1B A;  3TP0 A;  1W0U A;  3W6V A;  3VP5 A;  3BNI A;  5F08 A;  1VFC A;  3Q3S A;  1T56 A;  4XIC A;  3MN2 A;  3TW6 A;  2PMZ N;  1RET A;  2NOG A;  1TC3 C;  5EG0 B;  3LSR A;  2Y31 A;  2PBX A;  2CQQ A;  3COL A;  2XSD C;  2LY9 A;  3SDG A;  2EZI A;  1O4X A;  4BY1 J;  5IP9 J;  1A5J A;  4Y7N J;  5FGL A;  3QKX A;  3A03 A;  2L7F P;  3BQZ A;  5FKO A;  3GBG A;  1PUF A;  2OER A;  2UXU A;  2ECC A;  1MBG A;  2ZOY A;  3ANG A;  4B1R A;  5D19 A;  1JT6 A;  4GFK A;  5E3M A;  1MBE A;  3IV5 A;  5FLV A;  3NI7 A;  1JTY A;  4BBR J;  4NN1 A;  1IDY A;  3O60 A;  1ZKG A;  2VPR A;  1RPW A;  2TCT A;  1K83 J;  3FIW A;  2E2J J;  5IOZ A;  3NRG A;  3HTH A;  4M3E A;  2ZB9 A;  4AC6 A;  3L1P A;  2R0Q C;  2R92 J;  1XG1 A;  3LSP A;  5F1J A;  4D7N A;  4ME9 A;  3ON2 A;  5FKK A;  4YZE A;  1MBK A;  2DMT A;  1TWA J;  4QIW N;  3GTO J;  3FK7 A;  2COB A;  1GV5 A;  2JA5 J;  2IAI A;  1OJL A;  1IV6 A;  2HYJ A;  4A3G J;  2FQ4 A;  2R5Z A;  2ZCN A;  1ITY A;  3WHC A;  4IEJ A;  1BJZ A;  1B72 A;  3BG9 A;  4NEL A;  2XB0 X;  3LNQ A;  2XB5 A;  2M8G X;  5IPA A;  3ZQC A;  4PXI A;  1I50 J;  4UUS B;  2NS7 A;  2K9Q A;  2L7M P;  4XRS A;  3EGQ A;  2UXI A;  1OCP A;  2RHA A;  3K2A A;  1BA5 A;  2KT0 A;  4J19 A;  3G1M A;  1WH7 A;  4B3A A;  2FJ1 A;  2WAQ N;  3BR6 A;  2JA7 J;  2DA7 A;  5K7Z A;  3B81 A;  1ETY A;  2E2I J;  3ON4 A;  3H0G J;  4GCK A;  4MXM A;  4I76 A;  2R5Y A;  2Y2Z A;  2K40 A;  4AC0 A;  3HOW J;  3HDD A;  1JKQ C;  1NK3 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...