2IBDA

Crystal structure of probable transcriptional regulatory protein rha5900
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
192
structure length
192
Chain Sequence
GKSGRRTELLDIAATLFAERGLRATTVRDIADAAGILSGSLYHHFDSKESMVDEILRGFLDDLFGKYREIVASGLDSRATLEALVTTSYEAIDASHSAVAIYQDEVKHLVANERFTYLSELNTEFRELWMGVLEAGVKDGSFRSDIDVELAFRFLRDTAWVAVRWYRPGGSVTVDTVAKQYLSIVLDGLASP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Possible transcriptional regulator
publication title Crystal structure of Probable transcriptional regulatory protein RHA5900
rcsb
source organism Rhodococcus sp.
molecule tags Structural genomics, unknown function
total genus 72
structure length 192
sequence length 192
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17932 TetR_C_24 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2ibdA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2ibdA02
5HBUA 3K2AA 3KZ9A 2HXOA 1RESA 1YRNA 3M4OJ 2P81A 3V6GA 2CUFA 3TP0A 4A93J 3OSFA 5EG0A 1E3OC 3KKCA 2VI6A 2Y30A 3JR9A 3I4MJ 3S1QJ 1FTTA 3HOWJ 3ZQGA 4ABZA 3BHQA 1Y1WJ 2YUSA 2WV1A 1H88C 1NTCA 2JJ7A 2E2JJ 4JYKA 4PXIA 5FKKA 3TP3A 4BKXA 5IP7J 2YVEA 4CYCB 3G7RA 5FKMA 1POGA 3LWJA 3VPRA 2DG7A 3S1RJ 2WAQN 4DZJA 3TW7A 2HKUA 2O7OA 1OFCX 2XGCA 3BR0A 3GTOJ 4A3FJ 3BR5A 4NELA 4A3JJ 5FJ8J 1HF0A 3HTIA 4LOCA 2XPUA 3S17J 5HSZA 3JRCA 5FKNA 2K9NA 5J1UA 3ON2A 3KNWA 2AHQA 3JRHA 3ZQCA 1IRZA 4UUSA 3JREA 2IBDA 3FIWA 1VI0A 3LNQA 4JX6A 1ZK8A 1MBKA 4M3GA 3DCFA 2K9QA 3Q0WA 1ETWA 3VP5A 1Z77A 2DA2A 3RZDJ 1R9TJ 1PUFA 1JT6A 5F1JA 1JKQC 5FLVA 3S16J 2JWTA 2EZHA 2L0KA 5E3NA 1JJ8C 4D7NA 5EFYA 1S7EA 4C3IJ 2E1OA 2DA6A 2XPWA 4XRMA 4RBOA 4UDSA 3HEFA 3FRQA 3SJMA 1UHSA 2XGDA 2D5VA 1ETXA 4DYRA 3ANPA 2NS7A 4EEFG 1ETVA 4M3EA 4X1EA 4QIWN 3AQSA 4GCLA 5M5YJ 1Q1VA 3BNIA 5IOYA 4DW6A 2L7FP 5DTDA 1IG7A 2R5YA 1WH5A 2HXIA 1BW6A 2I10A 1MNMC 3O8GA 3Q0VA 2QCOA 3BR2A 5K7FA 2MSYA 4XICA 3ANGA 5K7HA 1BA5A 1U9OA 2ECCA 2HYJA 2ZCXA 5CXIA 3QPSA 5EGOB 2G7LA 1UI6A 5DS9A 3CQZJ 2EQRA 3ZQHA 4NDLA 1APLC 2NVTJ 3QQAA 1ZR4A 3PPBA 1VNDA 1NK2P 1JT0A 2L9RA 4AYBN 2HDDA 1JUSA 1F36A 1Z0XA 1TWFJ 4XK4A 3IH3A 3O60A 2JA7J 2QWTA 2VPRA 1ZTRA 3MNLA 5IYCJ 1XG1A 1TC3C 3B6CA 1RETA 2OF7A 3ZQFA 3HTAA 3BR6A 2ECBA 3TEDA 5JLWA 3C2BA 2F07A 2JMWA 2HOSA 2DMQA 2R5ZB 1IC8A 1DU6A 1RPWA 3C07A 3VIBA 3BR1A 2HQ5A 2X9DA 1P7IA 3VOXA 4JP0A 4L62A 3HE0A 2CJJA 3NARA 1D5YA 4BXXJ 3FKIJ 4G12A 4D5CA 1MH4A 4BBRJ 3BCGA 4I76A 3HM5A 2JA5J 3T6NA 2EH3A 5E3OA 2JA6J 1JJ6C 4C2MJ 1X2MA 5E3MA 1JKOC 4MXMA 3M3YJ 4AUXA 2G7GA 3VUQA 3JRFA 2CRGA 4W1UA 2YS9A 1AKHA 2W53A 3IH2A 5IYDJ 2PBXA 5F0HA 5JLXA 1MH3A 2M0CA 2UXUA 3WHBA 1W0TA 2ZCMA 3P9TA 2GENA 3QKXA 1G2HA 1WCMJ 2IEKA 1SFOJ 1MSFC 2E2IJ 1FEXA 1EF4A 1TWHJ 2O7TA 2YVHA 1B72A 3E7QA 1H89C 3JRBA 4D7MA 2HOTA 2G0EA 3HKZN 1LFBA 4MFEA 5IPAA 4IHWA 3A03A 3IH4A 3EGQA 2Y0SN 2LTPA 3HGGA 2G3BA 2L7MP 3B6AA 3BQYA 4W97A 2LFBA 3CRJA 2ME6A 2B63J 3GEUA 3G1LA 2D6YA 2LLKA 1UI5A 3LHQA 3VVXA 2W48A 4IHVA 3VW0A 3HIMA 4HKUA 3BTLA 2FX0A 1NK3P 3B81A 3QBMA 5C44J 1GUUA 2GBYA 4AF5A 2XB5A 4FE4A 3IUVA 4A69C 3PO3J 3LSRA 2HOAA 2WB1N 5EZHA 3NRGA 3A01A 3SDGA 5FLMJ 2FBQA 2H1KA 1ZGWA 5D1RA 3E7LA 2OERA 3PASA 3BTIA 2DMTA 2MGQA 4XRSA 4RDUA 5GPAA 2KT0A 2M34A 3S2HJ 3HTJA 4A3LJ 2KDZA 4AC0A 1K83J 2WGBA 1ENHA 2E2HJ 2R0QC 2GM4A 3BRUA 1SGMA 2QF7A 3HGYA 3HDDA 3TW6A 3S15J 1HDDC 1YRNB 3LSGA 2Y2ZA 3WHCA 1HCRA 1FIAA 1ETKA 4JL3A 1WPKA 3COLA 2ID3A 3GBGA 1RKWA 4M3FA 4MLOA 5C4XJ 2ME0A 3Q0UA 2EZLA 3S1MJ 4FTHA 1WGXA 4FE7A 2G7SA 2FJ1A 3RD3A 3NAUA 4XRSG 3LJLA 2O9LA 1SANA 1JTXA 5K58A 5C3EJ 5J1YA 5GPCA 1JTYA 3VOKA 4B1RA 2ID6A 1FIPA 1BJZA 3K7AJ 1IDZA 3SFIA 3GTPJ 4ME9A 3CCYA 5J3LA 4J19A 4A3BJ 3JRAA 3W6VA 4A3KJ 3F1BA 1RKTA 2N8GA 2XPVA 4GFLA 1ZQ3P 3VW1A 3F0CA 1WH7A 1IDYA 2UXPA 3FK6A 2UXHA 3LSJA 2TCTA 4QSHA 3ZQLA 2LD5A 1QVUA 1A5JA 4CYCA 5EF6A 3GTJJ 2NVXJ 3KKDA 5F27A 1B8IB 3HOUJ 3GZIA 1PUFB 5IYBJ 1IGNA 3A02A 1T56A 2PMZN 3BG3A 2PZ9A 3Q3SA 2VKVA 5M3FJ 2DA7A 2DA1A 1LE8B 2Q24A 1WI3A 1W0UA 5CW8A 1XC5A 1VF9A 4JX5A 3ZQIA 5D19A 2XRLA 1ETYA 2DN0A 4Y7NJ 5FKLA 3GTLJ 2GLOA 4DYQA 3LOCA 5M5WJ 2MG4A 4ICHA 3FK7A 4A3DJ 2LR8A 2HYTA 1LFUP 1AHDP 4M3DA 1ZR2A 1A6IA 1GV2A 2DA4A 3BG5A 5EYRA 1TWAJ 2GUHA 5BNGA 4QTRA 3MKLA 4ACIA 3OOUA 3RH2A 5F0FA 1JGGA 2JN6A 4FCYA 2NVQJ 1P7JA 3S2DJ 3GTQJ 3QPLA 1HLVA 2HI3A 1F43A 1CQTA 1FJLA 3VVYA 4GCKA 3JSJA 3BTJA 3VW2A 3UKGA 1XS9A 4C3JJ 2NOGA 2REKA 3G1MA 2XSDC 5E3LA 3O8HA 2DA3A 1U8BA 1QRYA 1IV6A 2FQ4A 3S5RA 2RASA 3G56A 4MFDA 1ORKA 2QOPA 2IAIA 4NN1A 5EEAA 2RHAA 3IV5A 4GCTA 2M8GX 3PM1A 4A3CJ 3HBLA 2AO9A 1BL0A 2CU7A 4I6ZA 4V2FA 2XGEA 5GP9A 1FTZA 2ZOYA 2TRTA 1ETQA 3HB9A 5F04A 2Y31A 2QTQA 2DA5A 1U78A 3CWRA 3JRIA 5F08A 5FHPA 5EGOA 1TWGJ 2JK3A 5M3MJ 2NP5A 3BQZA 2Y9ZA 2XDNA 1ITYA 2VUMJ 1UG2A 1I50J 3OSGA 3RKQA 1TWCJ 4B4CA 5HAWA 3DPJA 1IUFA 4DZPA 1ZKGA 2NVYJ 5J1RA 2XB0X 4IEJA 3D1NI 1DU0A 1OCTC 2YU9J 1I3QJ 3ZOBA 2OPTA 2X6OA 1AKHB 1AU7A 4BY1J 2GFNA 1X2NA 9ANTA 2WUIA 2MW8A 5IP9J 4L5EA 1OCPA 3NXCA 2NP3A 5AQCA 1HOMA 2ELKA 3H0GJ 2NX4A 5EG0B 2R5ZA 3NI7A 2JA8J 1H8AC 3S14J 4C3HJ 5D18A 1RR7A 1B72B 3GTKJ 3HOYJ 2ZCNA 3BR3A 3RQIA 2DMPA 1MBFA 2QKOA 1B8IA 2H8RA 4JKZA 4FISA 3S1NJ 1JKRC 2O8KA 3HOVJ 2K40A 2ZB9A 3CMYA 3JRDA 3LSPA 3OIOA 1GV5A 5IOZA 2DMUA 3HOXJ 2M9HA 2NS8A 1LE8A 4GFKA 2LVSA 5C4YA 5K7ZA 2EZIA 5IP6A 3H3VK 1BW5A 3AQTA 1GDTA 3CJDA 1I6HJ 3EUPA 1QVTA 4D5FA 1VFCA 5F0CA 4MK6A 5FGLA 3GTMJ 3HOZJ 2M2EA 2EZKA 1X58A 1T33A 2LK2A 5M5XJ 1GVDA 4IHYA 5EDNA 2L7ZA 1MBEA 1Y1VJ 4S0HB 4IHXA 1HDPA 1MBGA 4XIDA 1O4XA 5FMPA 2CQQA 2RAEA 3CDLA 3VVZA 3NPIA 5H9TA 3A01B 3L1PA 4UUSB 2CQXA 2LY9A 4B3AA 4A3IJ 4BY7J 5EZGA 1U9NA 3BTCA 1OJLA 2VKEA 4UUTA 3MVPA 3V78A 3FISA 4DYCA 3MN2A 4HNVA 2UXIA 3I4NJ 2IU5A 5FKOA 1MSEC 1ETOA 4A3MJ 3GTGJ 2DG8A 1MBHA 1UMQA 5CXGA 2R92J 2DTZA 1JKPC 2E19A 2LKXA 1IJWC 2ZOZA 3ON4A 2V57A 3BG9A 3HTHA 4KWAA 2COBA 5C4JJ 1QPIA 3JRGA 4Y52J 2R5YB 1K61A 2FD5A 3PO2J 2K9SA 4M3BA 3NNRA 2X48A 2LP0A 2DJNA 2Y9YA 4MIMA 4YZEA 5DAJA 4AC6A 4GFBA 2CUEA 1JUMA 4M6VA 4JNNA 4A3EJ 2R93J 4JX4A 4BBSJ 5HODA 2R7ZJ 3RZOJ 4A3GJ 3DEWA 2OI8A 3BT9A 4X6AJ 3G1OA 3BJBA 2EBIA 4V2GA 2QIBA 1GT0C 2DMNA 4CGRA 4MO7A 2UXOA 1JUPA 1MBJA
chains in the Genus database with same CATH superfamily
1RUOA 3K2AA 3TDUC 1U0JA 3M4OJ 1LNWA 3S3MA 2CUFA 3AL0C 2KPMA 1D1CA 2WBMA 4OIRF 3TP0A 3OSFA 3KKCA 4PZJA 2VI6A 2QZ8A 1FTTA 4HW0A 2XVCA 2F4IA 2IS4A 2K3FA 2L02A 1Y1WJ 5FB2A 1X4OA 3VSLA 2X1CA 2FNAA 4F55A 2E2JJ 2CFXA 2W24A 3G7RA 2YVEA 4CYCB 3WU2C 4HF1A 3LWJA 5FRMA 1YW8A 2P5KA 4EJTA 4ZC3A 2HKUA 3L09A 1LB2A 4H0EA 3MCZA 1OFCX 5HLHA 1RC9A 1IRGA 4HA8A 2LC2A 3KP4A 3PL8A 1RRJA 2VJ4A 4A3JJ 1HF0A 3HTIA 3KYLA 2YX7A 2UV1A 3J7YJ 1G3TA 3LQRA 3PIPF 2KIQA 4AIJA 1YYVA 3S17J 1FX7A 5J1UA 3ZQ7A 4XLFA 3I3LA 3KNWA 1OKRA 1R1UA 2HZDA 2VKHA 4DJAA 1TW2A 2IBDA 2ZO4A 1VI0A 2EFWA 1SD6A 4JX6A 3RJPA 4RGRA 3SQNA 2R3SA 3DCFA 3Q0WA 1ETWA 2PMHA 2WY8Q 1Z77A 2DA2A 1XCVA 4OAZA 1D1BA 3AFHA 2FOWA 5E3NA 4D7NA 5EFYA 3GFIA 3TO6A 2LBFB 2CO5A 4G6TB 2EV5A 4L9TA 1S7OA 5GADJ 4XRMA 1UHSA 3L2CA 3CCRI 4ENMA 1FYKA 1KA8A 3I53A 2IPQX 1ZGJA 4QIWN 5GAHJ 2E5NA 5DEQA 4UUVA 2K85A 3H5RA 2JVGA 5IOYA 5E20A 3WGHA 4DW6A 3RI4A 1IG7A 1WH5A 4MEXF 1ZHFA 1BW6A 3RPUA 1WJEA 3OYIA 3RPQA 3FXKA 4M9XA 2VOPA 2EV0A 3RKXA 4XLPF 3IL2A 5LHGA 3I56I 2WTEA 3ZGKA 2G7LA 3DP7A 3DPUA 1QZYA 2EQRA 2VBZA 3I4PA 4NDLA 3WE3A 1Z05A 1YIOA 4FETA 5CVJA 3HL2A 2HPIA 2M4KA 2KRCA 3WTSC 3I0TA 1VNDA 3NWTA 2DT7B 1IN4A 4L5IA 2UZKA 3S3OA 1Z0XA 2IGMA 4Q48A 4U7BA 2JA7J 2DYSH 1KQ0A 1EH8A 1I6XA 3O2PE 3ELKA 2OF7A 3HTAA 4CCLA 1OCCH 3BR6A 2B0LA 2FMYA 1WHUA 2X0LA 2R5ZB 2MD5A 1RPWA 4E7SA 3M1EA 4MTDA 3C07A 3VIBA 2H6CA 1J09A 5TISC 3HUGB 4ENKA 2OD5A 1P7IA 4IRGA 4BEHA 3IRQA 3WU1B 2MC3A 2V6CA 1XDUA 3NARA 1OISA 2XAUA 1FWZA 1MMDA 4BXXJ 3DBRB 2Q1ZB 3P9CA 4D5CA 2Q2EA 3GLLA 3VOEA 4BBRJ 1IN6A 2ETHA 2Z16A 3WTZA 2JA6J 2L9NA 4E7HA 1XGOA 1JKOC 3VUQA 3M3YJ 3JRFA 4B43A 2EIJH 1JHFA 1HW1A 1V5EA 2M0CA 5FO5A 2UXUA 3DLLF 1AOYA 2BY3A 3EYIA 4DNCA 1LFPA 4X0GA 2GENA 2EFPA 2FF4A 2KRFA 1MSFC 2O7TA 5GTHC 1W7PD 3K1MA 4M71A 2YVHA 1B72A 2E60A 3OYJA 5DM6F 3E7QA 3M8EA 3F72A 2Y48A 4HSTA 2H09A 4PSWA 2CG4A 2IW5A 4MFEA 5B1AH 1G3WA 4P9UA 2A6TA 4IHWA 3JW4A 1Z3YA 3A03A 4KJZA 3EGQA 1KQ9A 2Y0SN 3EPZA 2L4AA 2L7MP 2PEXA 2GOMA 4LLNA 3DF8A 3BQYA 4W97A 4ZYDA 4IF4A 2ME6A 5KHDA 4II3A 1EKEA 1YX3A 2B63J 3TL4X 2XROA 4WX9A 5J8CA 1UI5A 3VVXA 3HIMA 2FX0A 3QBMA 5C44J 1GUUA 2F6CA 3R61A 2XB5A 4OIPF 3PO3J 3EUAA 3RQ4A 2HOAA 2WB1N 5EZHA 5D5WB 1PP7U 1BC8C 3NRGA 3LSKA 4LK0F 1ONVA 3FXUA 5FLMJ 4OIOF 2H1KA 5D1RA 3X2QH 4RAFA 1WI9A 3B02A 2HVSA 3PQKA 2MGQA 1IXSB 2M34A 2XC7A 3S2HJ 1YI2I 2R7UA 4ZDPA 4WCGA 2Y0SA 3NRVA 4GRIA 4AC0A 5HS8A 1D8JA 1H0MA 3CJQB 3H9GA 3BRUA 2GM4A 2VB6A 1E0EA 3TW6A 2LNBA 1HCRA 4HYEA 2R7VA 5FGMA 1J59A 2CFOA 5BOXA 2HDWA 4BDZA 2F2EA 3V7SA 4XSXF 1XD7A 4MLOA 4M3FA 2V1UA 3OMYA 4CA0A 2JSCA 3HUGA 2Z5UA 2UUZA 1W7PB 1I39A 3HG9A 2KQRA 2FJ1A 2P5VA 1USTA 2W00A 2ZSIB 3MFKA 1MMAA 4O3MA 1KU2A 2DT5A 4UXNA 1VQ7I 3R60A 1S7AA 3DBHB 4CHUA 4B1RA 2ID6A 3BROA 4M6XA 4E7JA 3A1YA 3RYRA 2EA2A 2ZXHA 1IDZA 3SFIA 3GTPJ 3H0DA 4KFCA 2LKPA 3KCCA 2QQ9A 4PDKA 4YELA 2AXLA 1I1SA 5LGNA 3U2RA 4JK1X 1TT0A 2HDCA 2LDUA 1IXRC 2XGXA 2UXPA 3FK6A 1WJ5A 1YIJI 2YSRA 4BHPA 3JSOA 2W4SA 2FRHA 3I9V2 1K78B 2NRAC 3LSTA 2LD5A 2VIXA 4DIQA 1Y0UA 1QVUA 2DLLA 1A5JA 5EF6A 1FPQA 4ZDOA 2KP6A 3GXOA 4UVCA 2BW3A 4YEJA 4RS8A 4ZZLA 3GZIA 1PUFB 5IYBJ 3A02A 3KZZA 2P4WA 1OR7A 2R7QA 3GVAA 4A6EA 2KMUA 2W57A 2V7FA 1LE8B 1G4DA 2Q24A 1FY7A 2FE3A 4HSRA 2WV0A 3ZQIA 1XTAA 5D19A 3OL4A 2WADA 1SD5A 2M0MA 3JTHA 3VODA 4DYQA 4P55A 3QYFA 4EM1A 3ROUA 3FK7A 1F5TA 2C6YA 2LR8A 2HYTA 1LFUP 1ZR2A 3BG5A 2DA4A 4L18B 2GUHA 3BG6A 3DU6A 3W2WA 4HX7A 4B48A 1KU7A 2H6BA 1JGGA 2JN6A 4I01A 2NVQJ 2DI3A 4D0PA 3E5XA 3HOTA 2R7TA 3OYAA 3VWBA 1IZ1A 3V8KA 3CZ6A 4BH9A 3GX4X 3ZXSA 1FJLA 2FBIA 2LYCA 3VYTB 2HNHA 1Y8RB 1UG0A 4U0WA 2W82A 4XSZF 4B44A 1ODDA 2CMPA 2NOGA 2W25A 3MD2A 5L3EA 4HRIA 3ABUA 1WKMA 3GZNB 1N25A 2RASA 4LLGF 4LMYA 1ORKA 2IAIA 3BLYA 1G6NA 4A3CJ 1HKQA 1BL0A 4PJJA 2VL8A 4V2FA 1TL8A 4RA2A 3AG4H 2QTQA 2Y31A 3F21A 5FD5A 3C18A 1UFMA 3CWRA 3FMQA 5DCFA 5FHPA 5EGOA 1S8NA 2NOJB 5M3MJ 2B1EA 3SFZA 5K1YA 3BQZA 3DFGA 3QU3A 3TO9A 1W36C 2F5CA 1LDJA 2H27A 2VUMJ 1I50J 2KIMA 3WTUC 3CC2I 2HWVA 1TWCJ 2DFIA 3DPJA 1V55H 2NVYJ 1Y8QB 3M7GA 4AVZA 5H6RA 1HQCA 1K7AA 2RNGA 2OPTA 1AKHB 2GFNA 1X2NA 3FMRA 4YRVA 5E1XA 2MW8A 1UHWA 5IP9J 3REOA 2H8WA 1K6OA 4C2MA 5AQCA 1T98A 1K78A 4BJ5C 4MQVA 3S14J 4C3HJ 3HOYJ 2ZCNA 1XCBA 3MKZA 4BE0A 1PVEA 2DMPA 1FP1D 2OBPA 3BOQA 3ZMDA 2B9SA 3FM3A 2HS5A 2A61A 3DTEA 5J6XA 2WAQA 3HOVJ 4GDFA 1TW3A 2KRHA 3LSPA 2M9HA 1G3YA 1LE8A 1IXCA 2DQRA 3H3VK 1BW5A 3AQTA 1I6HJ 1QVTA 3KZIC 4QLCU 5FGLA 3IUOA 3GTMJ 2M2EA 3ZMTA 5K5QA 2CQ7A 2LK2A 4G9YA 1KGSA 3BG7A 1IAWA 4XLCA 3F8FA 1SD4A 3MKYB 1O4XA 3OV8A 1Q1HA 2OTLI 1IO2A 2VJJA 2R7RA 3VVZA 5H9TA 1L0OC 4NBQA 4WIBA 2K27A 3L1PA 2EFQA 4LGWA 1IUYA 5DD8A 4Q4ZF 1R22A 4A3IJ 2RC4A 3OYDA 2VKEA 5B3SH 1VQLI 1J0RA 3MVPA 2P0WA 3SZPA 1UZCA 4LFUA 3FISA 3S8PA 2W84A 3CUOA 2WWYA 5FKOA 1WJBA 2OCCH 2ICWG 1DPUA 1V3FA 1JKPC 3FHNA 2XHKA 2ZOZA 3ON4A 3BG9A 1YJ9I 3HTHA 2COBA 2XRNA 1MMGA 1MJ9A 3ZN0A 1QPIA 4HPQA 1TTYA 3CMAI 1ZRDA 4EATA 1BC7C 4UNOA 1WQ2A 4EV0A 2LP0A 2DJNA 2Y9YA 1QGPA 4AC6A 4KN7X 4WK8F 4LG0B 2PLYA 1YW7A 2R93J 3QYBA 1UELB 4BBSJ 5HODA 2BY2A 1QO0D 2D45A 2R7ZJ 4A3GJ 4E7KA 3G1OA 5AONA 1MD0A 4EJOA 2EBIA 4M9SA 1GT0C 2DMNA 4MO7A 2UXOA 2QUFA 1JUPA 4HNUA 2HXOA 3L7WA 4U0YA 1YRNA 3K4KA 2P81A 3V6GA 3J81Z 4BE1A 3VFZA 1LUJB 1XSDA 5IY5H 1E3OC 3S1QJ 3IP4B 4DBQA 2V9PA 4ABZA 3CCEI 2EINH 3PJRA 5KVRA 4JYKA 4PXIA 2LRDA 5HDGA 5IP7J 1BR4A 2HFHA 1POGA 5JVTA 2JUCA 3E5UA 2QSFX 3S1RJ 3A2KA 2QKMB 5LFAA 1X3WB 2O7OA 2XUBA 2VN2A 1J9IA 1B59A 4HX4A 3VYSB 4XQFA 3W6KB 1ZARA 4NELA 5HDNA 3BPXA 1OCRH 3PNVA 4CCOA 2D1HA 2XPUA 4FASD 1A31A 1Y6IA 4BXUA 5HSZA 4ETSA 5AIQA 1Z1DA 2QWWA 1BOAA 2E1MB 5AIPA 3TMOA 3S3NA 4RGSA 2JZYA 4EMSA 2HQNA 3HIFA 3OR2C 2RDPA 3LSIA 4IZZA 2IP2A 1MZBA 3JREA 1SEUA 2VE9A 4CGRA 1HKSA 3NEUA 3KETA 4IL6C 4IRHA 3VP5A 1YS7A 3E97A 2B7EA 1JT6A 2FOKA 1JJ8C 1DDNA 3K70D 2V1XA 3CESA 4M72A 2VPLA 3L2RA 3N4MA 2XPWA 5DUKA 3SJMA 2VQLA 1BBYA 3R0JA 1O3QA 4EEFG 2HYFA 3LWFA 5K5OA 5M5YJ 3WU0A 1Y39A 2J5OA 2L7FP 4I98B 2JVHA 3O6BB 3GCMA 4A2UA 2K86A 3O8GA 4YIFA 2YX4A 5JR3A 4LG0A 4A5MA 3QPSA 1K4TA 3AG3H 3IWZA 2BE5F 3WTTC 1G3SA 5FFZA 3CDHA 3HJEA 1U5TA 1LQ1A 2L9RA 1B4AA 3LMMA 2HDDA 1HSJA 1ZGAA 2PG4A 3K10A 3D5SC 5CVVA 4XK4A 3IH3A 3O60A 3SDBA 2EIKH 4OAYA 5IYCJ 2RKHA 1XG1A 4R79A 1AWCA 1TC3C 4QPOA 2RQPA 1RETA 2X1DA 3W3CA 3ASNH 5CQEA 3C2BA 1VQ9I 2F07A 2HOSA 5H6QA 1R49A 1IC8A 5LRRA 4U7DA 4F91B 4F92B 2KIUA 3BR1A 2X9DA 2YU3A 3DPTA 1A04A 3FXJA 5LGUA 4JP0A 4P96A 3VOXA 4L62A 2CJJA 3KLNA 1ZRFA 4MGRA 1LDKB 3FKIJ 3FBNB 4RLQA 3M07A 2VOOA 2IXSA 4HEA2 1FYMA 4E7LA 2JPCA 3F8CA 4E70A 2R4GA 2JA5J 1Z3XA 2PFBA 3EQLF 1FLIA 4N0BA 4MXMA 4E6KG 2E34A 1R7JA 4AUXA 4W1UA 2YS9A 4GYGA 2DJIA 2R7WA 3K6GA 2KJBA 5IYDJ 3V8JA 2DBBA 2PBXA 1MH3A 4HQEA 4B09A 3WHBA 2ZXWH 5HLGA 2ZCMA 4Y15A 3CUQB 3QKXA 2IEKA 1SFOJ 2E2IJ 1EF4A 1TWHJ 4KIBA 3LFUA 1J2XA 2LOOA 4EGYA 3RDIA 1H89C 4EQQA 1ON1A 2KHMA 2HOTA 2G0EA 3HKZN 1LFBA 1PP8F 3ZR8X 2ZMEB 2QSGX 4HAMA 4DBRA 1NG7A 3HGGA 5J40A 4HDVA 4PK4A 3CRJA 3OIQA 3K9TA 4A0XA 2WAEA 3Q9VA 3OYGA 4HKUA 3DKYA 1BI3A 1NK3P 4M74A 5FFXA 4A0ZA 2COMA 4AF5A 1QHHD 2FEZA 2K7LA 2L01A 2QYOA 2M45A 4CCKA 1R58A 2PBIA 3A01A 5H20A 4WXHA 3SDGA 2FBQA 1ZGWA 3OR1C 1KYWA 2EK5A 1U6GA 2OERA 1HW5A 1VZ0A 3BTIA 3PASA 2DMTA 5CLSA 4XRSA 3HKZA 5D5VB 4A3LJ 1NH3A 1K83J 1X1AA 3CCMI 1WZ2A 4ZYGA 5LD2C 2R7FA 3H9QA 4BQAA 1SGMA 1UCRA 2CUZA 3HDDA 2HR3A 1XMAA 4R1HA 4RM2A 4KICA 5D6FA 1D3YA 2Y2ZA 4BDYA 1FIAA 3I5UA 2F48A 3KYCB 1WPKA 1YFHA 3COLA 1WJAA 3Q0UA 3DKXA 2BGCA 2IA1A 3BZKA 4FTHA 1FBSA 2MFZA 3AG1H 4XLNF 4KT6A 1I27A 1RIOH 2XF5A 3LJLA 2B3WA 1JTXA 1O3SA 2LH9A 5GPCA 1JTYA 3LL7A 1VQNI 2P7VB 3VOKA 4CCJA 3K2ZA 1K6YA 3CCYA 2DT6A 2FBHA 2ZJQF 4J19A 4A3BJ 2M5WA 3GF2A 3DKWA 3JRAA 4A3KJ 1ZQ3P 3CP8A 4C30A 1WH7A 2XASA 2VBWA 4ON0A 2ZXJA 2O6GE 2E7WA 2V9VA 1QNTA 3A4CA 3HTUA 5HNHA 3DTIA 3KP2A 3WODF 2PN6A 2TCTA 3FXQA 4QSHA 3TBIA 2NYXA 1JXSA 4E7IA 4P9FA 1Z21A 2GIVA 2ZFWA 5BQTA 4CYCA 3H36A 3GTJJ 1FC3A 3GZ6A 3S32A 4BHCA 1BI2A 4A0YA 3ABTA 1T56A 4N4NB 4UVAA 5E18F 1D5VA 4FQGA 3BG3A 3EYYA 1REPC 1P4WA 3ML6A 3PUFA 3Q3SA 2DA1A 1WI3A 3QRFF 4JX5A 1V54H 2XRLA 1PJRA 5KAIC 3KP7A 1TLHB 1FSHA 2H94A 2XDVA 3IAS2 3LOCA 3OS2A 3IRRA 1FOXA 5M5WJ 1WRJA 3P5JA 1E3PA 2MG4A 4NC8A 2L4MA 2DDBA 3FBIB 4IVNA 4ICHA 3DQVC 1AHDP 4M3DA 1A6IA 3HYIA 4QWQA 4C2TA 1TWAJ 3HZJA 5BNGA 3K4CA 1F9NA 3MKLA 3ZN1A 1IF1A 2GAUA 3ZPLA 3IC7A 1ERDA 2E35A 4FCYA 5BPDA 4GGGA 3F6VA 1P7JA 2CH0A 3F23A 3GTQJ 2F5FA 1HLVA 1F43A 1CQTA 2STTA 2LBFA 3T1BA 1LKXA 1KONA 3C7JA 1BR1A 4PJLA 3VW2A 1D0XA 1WJFA 3UKGA 1XS9A 1IN7A 3G1MA 2XSDC 5E3LA 4IOAF 3PQJA 1U8BA 1QRYA 4I7HA 3S5RA 1GVJA 3G56A 3BDDA 2QOPA 3SZGA 4NN1A 2DOFA 4UHTA 5ERIA 5JHUA 3IV5A 1X3ZB 2JQ7A 4BJTA 3J80K 2AO9A 1P92A 3CTAA 3EETA 2XGEA 1FTZA 4EM2A 2HPMA 1YLFA 3HB9A 4PCQA 3CO7C 5B5EC 1R36A 1P4XA 5LGTA 5F08A 1TWGJ 2LF8A 2JK3A 3AAFA 2NP5A 2MH2A 2Y9ZA 4BNCA 2ZC2A 1YQAA 5HLTA 1S3JA 2XF6A 2M30A 2HZTA 5HAWA 3HC7A 1MDMB 2XAQA 3EUKL 1ZKGA 5TJJA 5J1RA 3TO7A 3ECOA 1U5TC 3H3ZA 4IEJA 4ESJA 1ZG5A 1GHCA 1I3QJ 2XAHA 3I71A 3ZOBA 2ZKZA 4OU0A 2X6OA 1SFKA 3OOPA 1Z67A 2ZJRF 4KYWA 2V1NA 4C9YA 4L5EA 3G2BA 2OQRA 2Y69H 4CGZA 1YS6A 1IN5A 1HOMA 2NP3A 4A6DA 1OCZH 2ELKA 5EG0B 2L9VA 2R5ZA 1T2KA 2V9KA 4HV6A 1VQ8I 1RR7A 2LSOA 3BR3A 2F4OB 2QKOA 3DEUA 2ZBKA 4E7ZA 4XKVA 1VQMI 1JKRC 4EVIA 2A2FX 2O8KA 3LSMA 5HDKA 2HTSA 3CMYA 2LG4A 3JRDA 1B9MA 2QM3A 3OIOA 3BC8A 3COAC 2DMUA 4UV9A 3HOXJ 1H9TA 2NS8A 5IT9K 5C4YA 2LVSA 5K7ZA 1NG6A 3BJ6A 1GDTA 4M9ZA 3EUPA 1GLNA 2O0YA 2V6EA 3HOZJ 2DTRA 4HLYA 2NNYA 5FLXK 1S9HA 3D0SA 5EDNA 5LLQA 2D1VA 5FMPA 2E1MC 2CQQA 1LPQA 3CDLA 1SFEA 2ZJPF 3MZHA 1FSEA 3H5NA 5BPIA 2OA4A 4FHTA 2Z1DA 1MW7A 4M73A 4ESBA 5LEKA 1SMTA 3VEPA 1ZRCA 4RB0A 2P8TA 2LY9A 3IKTA 3KEOA 2UXNA 1U9NA 2RGVA 3G73A 4UUTA 5LHHA 3LAJA 3MN2A 5CYVA 2IU5A 5LBQA 1R00A 3BCBA 1CF7B 1MBHA 1XGNA 5CXGA 3K4BA 2DK5A 3ZMUA 2E19A 1QQIA 3K69A 2V57A 2VASA 4LJZF 2D2WA 4PGGA 4UB8C 4Y52J 2E71A 2EPFA 2K9SA 3FM5A 2X48A 1TP4A 3H3UA 2CV0A 1N78A 2X51A 2QQBA 1JUMA 1BOBA 3GEZA 4JX4A 5ED4A 4E4HA 2K5CA 1MDMA 2CV1A 4I2OA 4AIKA 2G7HA 3AKZA 3TKYA 4D1QA 4L9VA 1V5FA 4AYBA 4IX7A 2DK8A 2L5QA 3J7ZI 1MBJA 5HBUA 3KZ9A 2M8EA 3F8MA 1YX5A 4YFNF 2KISA 4B3XA 4ZYHA 4G94A 3EDPA 5A2QK 4A93J 5EG0A 3TOBA 3JR9A 3I4MJ 3RCOA 1MKMA 5BMZA 3G4SI 2R7XA 1EV7A 4RB1A 5DCMB 1AA7A 1ZN2A 3D5LA 1Y56A 3HRUA 1W7PA 1XGMA 2UXXA 3TP3A 5FKMA 2GIZA 2WAQN 4DZJA 5L3CA 1TBXA 3TW7A 2RV8A 2XGCA 4KIFA 5JFRA 4EJUA 3E6DA 2IGOA 2XKPA 2OCEA 3HRTA 4A3FJ 4OD5A 1O7FA 4MQ9F 3T0YA 3N97A 3MWMA 1P2FA 1SD7A 2FXAA 2ACJA 5FKNA 3T8TA 1TZLA 3ON2A 1T8IA 1TNTA 3JRHA 1HXDA 3ZMVA 4XR6A 4F93B 2ZNYA 1LEBA 2QGUA 4GYIA 4LB6B 3U9GA 4HV5A 5CVUA 4M3GA 5L3GA 3QPTA 3CCVI 2FA5A 3KFWX 2P5LC 4ZDLA 4YIRX 5HOOA 3RZDJ 1OYYA 1PUFA 3IKVA 3K4JA 4IRVA 4Y33A 2DODA 1JKQC 5FLVA 3S16J 2L0KA 2IRFG 3K4MA 4GCVA 1DP7P 2G7UA 4BUPA 1S7EA 4C3IJ 3CCQI 2E1OA 1SVOA 1CF7A 4Z6YA 4UDSA 4RBOA 3HEFA 4B47A 2D5VA 1ETXA 4XORA 2L7KA 3FXRA 3ANPA 3IHUA 4BGDA 2CUJA 3M8JA 1XSXA 1J75A 1ACIA 2FMLA 4X1EA 2DAOA 4PJ0C 3VYUB 4ESFA 1Q1VA 4I0AA 2CW8A 5CVRA 3U21A 1HA8A 5L3BA 3VYRB 4CYDA 1MNMC 5CQGA 3Q0VA 4P5OA 3BR2A 2MSYA 4XICA 5K7HA 1BA5A 1TQIA 1BI0A 3RKYA 2HYJA 2ZCXA 2XKOA 5CXIA 3GMEA 2VJIA 3WGGA 1UI6A 1RI7A 3ZQHA 2P7CB 2NVTJ 3QQAA 1ZR4A 3CF2A 3F22A 2IT0A 1JT0A 2IGKA 1STZA 4KITB 1JUSA 1Z7UA 3L2UA 1F36A 1ZG1A 5FD6A 2DPUA 1TWFJ 2JRMA 2QWTA 2DFFA 3OWTA 1ZTRA 4NHJA 4KIGA 2MA3A 2X4HA 4CH7A 3B6CA 4DOZA 1OLTA 1FBQA 3PNTA 2PMUA 1T08B 4EJWA 5JLWA 4B8XA 5J4YA 1TT5B 3NWSA 5DCMA 4G7ZF 3D5RC 3P9KA 4I02A 4L5JA 3LSHA 1KZHA 3HE0A 2Z33A 2QQ8A 3CCJI 3LAPA 4Q5SF 2GA2A 2JSPA 3FMSA 2E1NA 4IHSA 2ELHA 4ITVA 3BZ6A 2KL4A 4ENNA 2F5EA 3FXLA 1DQUA 3OYLA 3BCGA 5TRDA 3DV8A 2OU2A 2EH3A 5KCMA 5D4SA 1JJ6C 4WF2A 2YPRA 4PSXA 2XSJC 5E3MA 1MMSA 5LRSA 4XKWA 2Z9OA 2G7GA 3GUDA 1AKHA 1SFXA 3GLXA 3QP6A 3QAHA 3TOAA 1T0FA 1XB4A 5F0HA 3J7AO 1R1TA 2VLAA 2VKDA 3HSFA 4KDPA 1W0TA 2K02A 4KNYA 1PDNC 3P9TA 4D9JA 4HF2A 3MZYA 1G2HA 1VQ4I 4U0VA 1BJAA 1YTYA 1FEXA 2BXZA 2OZUA 4XN3A 3FF5A 2NAZA 3OYMA 4IO9F 3IH4A 4CDGA 4U87A 2GZWA 4G7OF 4HX8A 2K4BA 1QBJA 2LFBA 4KMUX 3GFJA 3V8LA 4JQFA 3FWEA 1LEAA 1ZREA 3KEQA 2LLKA 4NQWB 4F7ZA 1MGTA 3CC4I 2PJPA 2GXAA 1QZZA 4S04A 1UB9A 1QZEA 3B73A 3HSRA 2GBYA 3H92A 1N77A 1FOWA 2HOEA 3IUVA 1R4NB 2F5VA 1XDSA 2O8XA 4A69C 3JAMZ 1YJWI 1I1GA 1A35A 2YVXA 2CQKA 3LA3A 2BHYA 4ZTJA 1R4MB 1B6AA 2OUMA 3E7LA 3AG2H 5E8IA 5F1RA 5J4VA 2V79A 3LA7A 3HTJA 1X4PA 3ABMH 4LK1F 1DPRA 2E2HJ 3OS1A 1X1DA 2QF7A 4MTEA 1R6RA 4O6JA 1HDDC 2W85A 4BE2A 1SVLA 4KMFA 1OYWA 4XM3A 3DLAA 3RPUD 3GBGA 4RAZA 1RKWA 2HU9A 2ME0A 1WJDA 1XSVA 3MEXA 2EZLA 4YIIA 1HBXG 1MNDA 4JBAA 3S1MJ 3GFLA 1PYVA 1NHAA 5D6EA 1WGXA 1W36D 4HNTA 1K4SA 1S6LA 3RD3A 3NAUA 4XRSG 1BR2A 4AU7A 3TGNA 4G7HF 3KLOA 1X19A 5DYMA 2DFEA 3K7AJ 4LITA 4BACA 4ME9A 1BN5A 2NVUB 4Y3OA 1X3UA 3JCUC 3W6VA 1R23A 1RKTA 2N8GA 3WTVC 4XKCA 4GFLA 4A5NA 1LVAA 1X1CA 3GO5A 3WG9A 4J00A 5GTIC 3CJRB 1IV8A 1ZAOA 4KT5C 3HTSB 3FZVA 2BOLA 2M87A 2G9WA 3BJOA 2VJ5A 3C3WA 5HS7A 3H5AA 1DP3A 3CC7I 2STWA 2HTJA 3FXMA 5EJCA 5L3FA 1B8IB 2NVXJ 3BP8A 2QVOA 3SYTA 3ZMSA 4IHTA 3VTIA 4EJVA 2PMZN 2PZ9A 3QODA 4CICA 1Z6RA 2M7BA 4NQWA 5M3FJ 2CW0F 2WA0A 4Y17A 3CO6C 1XC5A 1R5GA 3M8FA 1VF9A 2EILH 3P9IA 5DD4A 1ETYA 3GTLJ 3VB2A 3CCUI 2DFHA 4C2UA 1W5TA 2AQEA 2I5UA 5GAEJ 4NC7A 2QLZA 3K0LA 2V26A 5TGTA 4AVPA 2XAGA 3OYFA 3PFIA 5EYRA 1BM9A 4ZJZA 3HRSA 4ACIA 3OOUA 4Z2YA 5F0FA 1VQPI 2ZNZA 4F3QA 3E1SA 3N05A 4ASNA 3S2DJ 3CLQA 3KX2A 3RKWA 3G3ZA 2IVMA 2HI3A 1A6QA 3JSJA 2PMZA 4RLFA 2R7DA 1C0WA 1OQYA 5L3DA 2QKLB 3BTJA 2FU4A 1Z6TA 2FUG2 1I3AA 2PQ8A 3O8HA 2DA3A 2FQ4A 2QA4I 3I58A 2MD0A 1T6SA 3ULQB 3F8BA 5EEAA 2RHAA 4BQQA 4GCTA 2M8GX 2HYGD 3ECHA 3HBLA 2CU7A 4I6ZA 5GP9A 2X1EA 2TRTA 3BWGA 4KISA 2DA5A 4BEHB 1U78A 2UWMA 4N9IA 1LJ9A 4AM3A 2M3AA 2GA1A 3DBLB 4JOMA 2Q2EB 4KN4X 1ITYA 1UG2A 1J7KA 3OSGA 2XF7A 3DU5A 2HEOA 1FOYA 3WE2A 3SEZA 2M1BA 1IUFA 2A69F 3O3KA 1QA6A 4DZPA 3A0BC 3KEYA 1D0ZA 1R5HA 2XB0X 3E3VA 4XLEA 2QSHX 1X1BA 5ICFA 1AU7A 2OC6A 5D8KB 4BY1J 2WUIA 3T8RA 4IXAA 3ZP5A 4NC6A 3M1CA 4Q47A 1OCPA 3NXCA 1WSUA 3Q5FA 1T95A 4HQMA 2NX4A 3H0GJ 3H9JA 3NI7A 2WY7Q 2JA8J 4LD5A 2MYSA 5D18A 1B72B 2KDOA 4AIHA 3GTKJ 3RQIA 2PJRB 2R7OA 1B8IA 4XOTA 5DM7F 2H8RA 3S1NJ 4MNUA 2JTVA 5CVIA 2O61A 3CMEI 2VT3A 3KP5A 2ZB9A 1FMWA 1V4RA 1CGPA 1GV5A 2A07F 2HVRA 1E3HA 4GFKA 2A68F 2X6WA 2XAFA 3I59B 2QQAA 2MH9A 1VFCA 4D5FA 3E0JB 2PX9A 2LKSA 3BPVA 4I09A 2EZKA 2CS3A 4IKFA 2L7ZA 1MBEA 3ERMA 3CJNA 1IW7F 3BZCA 4IHXA 1HDPA 1MBGA 1T0FC 4XIDA 1OMIA 4EM0B 2RAEA 4ZYEA 3H1CA 4BS9A 1D1AA 3CUQA 5JHFA 5EEGA 4UUSB 4FT8A 1QU3A 5FROA 2CQXA 4B3AA 4RB3C 5EZGA 3J7AY 3KYDB 2ZMEA 2J5PA 1GXQA 2OZ6A 3C2HA 1YHQI 3KP3A 2HKXA 1LDDA 3W2VA 4UY8I 1WWXA 1IRFA 3PFYA 4XMYA 3I4NJ 4HF0A 1U2WA 1JI8A 1ZH5A 4BAYA 2FQ3A 1ETOA 4A3MJ 2DG8A 1UMQA 4RMNA 2DTZA 3JTGA 3WGIA 4KWAA 3WTYC 5C4JJ 5KK1A 2P6TA 3DWLE 2L9SA 3JRGA 2R5YB 3HPGA 2KZGA 5J8FA 1DGWY 2A05A 3PO2J 4NUBA 3ZMZA 3DPLC 3NNRA 4G6DA 5ILUA 3PIOF 2CUEA 2QBYB 1HSTA 3QPHA 3SXYA 1R5ID 4A3EJ 4LB5A 3G71I 2AXTC 1RZ4A 1U8RA 2K4JA 3LA2A 4GO1A 3CCLI 1SFUA 3F3XA 2TDXA 3RZOJ 1MMNA 4OD4A 3BT9A 4X6AJ 3BJBA 4M6YA 1F4KA 4ZYAA 2EA4A 4V2GA 2HQAA 2RN7A 2EIMH 3PPBA 3ESWB 2IJLA 4FX0A 2V4JC 1RESA 4TV7A 2XIGA 5CKTA 2Y30A 3HOWJ 3BCAA 3ZQGA 3BHQA 2YUSA 4YFXF 3GW2A 2WV1A 1H88C 2PJRA 1NTCA 2JJ7A 2DYRH 5FKKA 4BKXA 3IAM2 4IOCF 3VPRA 2BW3B 2DG7A 2EFNA 2EJRA 4FX4A 1FT9A 2ADUA 2BV6A 3I59A 3BR0A 3GTOJ 3ISPA 3QU6A 4RAGA 2VC0A 3WTXC 1S5LC 2RQQA 3BR5A 3HSEA 5FJ8J 4LOCA 4KUMA 4N4OB 5HNFA 1SAUA 5KAFC 4S05A 3L2QA 4BQNA 2O5RA 3JRCA 1FYLA 1FZPB 2K9NA 1X1PA 1EH7A 4G6QA 2LY2A 1QHGA 2KKOA 3RIRA 2EWNA 2AHQA 3ZQCA 5DDGA 4U9LA 1IRZA 4UUSA 1ZLKA 2F5DA 3FIWA 1FOKA 2KJCA 4ZH4F 3LNQA 3K1PA 2MABA 1ZK8A 3V4GA 1ULYA 1MBKA 5D8LB 3CD6I 4XLHA 1SMYF 2VT2A 2K9QA 3HHHA 3ASOH 2ISZA 1SC7A 2BXYA 1R9TJ 2I8DA 5F1JA 3OIPA 3F8NA 2GOXB 2CYYA 2EZHA 2JWTA 2W1OA 4PFPA 3EUHA 5JVGF 2OQGA 2DA6A 3FX3A 3HOSA 4DGWB 2CV2A 3FRQA 1WFXA 3F9KA 4NNJA 2XGDA 2IS2A 1R1VA 4DYRA 2NS7A 2X6YA 1ETVA 4HZFA 4M3EA 1RR8C 4RGUA 4OIQF 3AQSA 1Z7LA 2HGCA 4GCLA 3BNIA 3UR3C 5DTDA 2R5YA 2HXIA 2I10A 2QCOA 5K7FA 2JPBA 2WB1A 1TQMA 3ANGA 5HS9A 4OOIA 4OINF 3W6JB 2QBYA 1U9OA 2ECCA 4CSWA 4OWRB 5EGOB 1YW9A 4AWXB 2BZTA 3PUBA 5DS9A 3CQZJ 2EV6A 3J80Z 2QENA 3R4KA 3E5QA 1APLC 3C2GA 2AS5F 2X85A 2RREA 2MC4A 4U88A 1NK2P 2EFOA 2IS1A 1VQKI 2ESNA 4AYBN 4CZCA 1XPXA 4UVBA 5E79C 2LMDA 1VQ6I 2ZXIA 1KU3A 2VPRA 1WJCA 3OL3A 3MNLA 1GXPA 2RVCA 3ZQFA 3U1DA 3AL0B 3R6SA 2CSOA 5KNLA 3TEDA 2ECBA 2WAFA 4XL9A 4OMYA 2JMWA 3MZ8A 4XKBA 2DMQA 1DU6A 5BS6A 2HQ5A 4LIUA 2ZSHB 1TQPA 4NB5A 1VQOI 2P6SA 4I99C 3OYNA 1D5YA 1EA3A 1ZG3A 5CPRB 4L9JA 4G12A 3VDXA 2BVLA 2NS0A 3GWZA 1MH4A 3QYEA 4WXDA 2Z3YA 1Y0NA 2KIFA 5D5UB 2VE8A 4I76A 3HM5A 2AQFA 3OYKA 1VQ5I 3T6NA 5E3OA 3ABKH 2VQHA 5E1WA 1HW2A 4DVYP 4C2MJ 1X2MA 4II2A 2CRGA 3CJTB 3DTKA 1O3RA 2W53A 3IH2A 4HBLA 3CCSI 4XN0A 5B1BH 3M9AA 5JLXA 3U1KA 4XONA 3FXOA 3OYEA 1MNEA 5IT9Z 1WCMJ 3RYPA 1USSA 4AD9A 2IA2A 5FLXZ 2LY1A 3JSPA 3TDZC 2ZCWA 5DUIA 6PAXA 3JRBA 4D7MA 2DU9A 4YG2F 3MQ0A 5IPAA 1MIJA 3FHZA 5E17F 4A12A 4IRIA 3V42A 2LTPA 2WC2A 2G3BA 4O5VA 2QEXI 3B6AA 5B66C 1FNNA 1O57A 1OYIA 4PFOA 1M1EB 2VONA 3S2WA 2HVQA 1R71A 4BYYA 3GEUA 3G1LA 2GWRA 2BY0A 2D6YA 1XN7A 3KIOA 3K70C 3MAJA 4PUSA 3LHQA 2W48A 1SAXA 4IHVA 1YG2A 1YE9A 3VW0A 3BTLA 3L00A 4HLXA 4WXCA 2DQLA 5H2FC 3B81A 5IT3A 2DOEA 3ZRGA 4CUGA 1H9GA 4EGZA 1JHHA 1BI1A 2GXBA 4FE4A 1W1WE 2NNNA 3QWLA 3LSRA 2BY1A 2L3DA 3DXJF 4Y4RA 5DV5A 3CUQC 3UNGC 2K9MA 3SZTA 3A0HC 1P4AA 1XMXA 2A6HF 2L54A 3PSIA 2JT1A 5ILSA 4XRFA 3ABLH 4RDUA 5GPAA 2KT0A 2OJED 1G8XA 2ZMEC 2BBYA 4RAYA 2KDZA 1K79A 4BU2A 2WGBA 1KQ8A 1ENHA 3ZQQA 2R0QC 3SEQA 1IN8A 2K9LA 4PJNA 3HGYA 2M4GA 3IWFA 1RUNA 3S15J 1HKTA 1YRNB 3LSGA 2ZJ2A 1S72I 2FSWA 3WHCA 2IA0A 3KPHA 4HOBA 1ETKA 3QOEA 4JL3A 4BJ6C 2KZVA 2ID3A 4L0YB 1F1ZA 4PJMA 5C4XJ 3CLOA 4LIVA 4HG2A 1D8KA 2Q0OA 1YO5C 4XNFA 2VBYA 4FE7A 2G7SA 5K5RA 2VQGA 3GFMA 5A2QZ 3S93A 1Z9CA 1L3LA 2FJI1 2ELJA 2O9LA 1SANA 5K58A 5C3EJ 1E2XA 2BVMA 2DDAA 3LFKA 3LQQA 5J1YA 2DPDA 2H1LA 3J81K 4RB2C 1FIPA 1KYZA 1LVKA 1BJZA 3HPHA 5JI6A 1UJ8A 2LREA 5D4RA 4PGHA 5J3LA 4CCNA 2VXDA 2Z2SB 3F1BA 2XPVA 3DEEA 1W4MA 4YFKF 1TNSA 3F0CA 3VW1A 1IDYA 3H35A 4LG3A 3OY9A 2E5ZA 2UXHA 5GAGJ 3LSJA 1YOVB 2DO7A 1D0YA 2GQQA 4WWCA 3ZQLA 1MJAA 1ZYRF 3VSKA 2W7NA 1U3EM 5HVQC 3KE2A 3KKDA 2Y0MA 5F27A 1EH6A 4ENJA 3HOUJ 1V5GA 3RTRA 1IGNA 4BXFA 3C1DA 3OYBA 1HC8A 2CWEA 2FBKA 1T39A 4ZZDA 3JAMK 2F4MB 2VBXA 2VKVA 2DA7A 1W0UA 3I54A 5CW8A 2ZFUA 3K8PC 4IQJA 4IJAA 1W5CC 2DN0A 4Y7NJ 3G6EI 5FKLA 4CZZA 1J5YA 2A3SA 2GLOA 4AIDA 4L0ZB 2JUGA 1O7LA 1ZELA 4A3DJ 3K4NA 3E6BA 2K3PA 2NXNB 4F52A 1GV2A 1XX5A 2DW4A 3HRMA 4K2EA 4U9NA 4QTRA 3RH2A 2L2OA 1EJ9A 2XAJA 1Z91A 3I55I 1DUXC 1U5TB 3NQOA 3QPLA 4ANJA 3I64A 4CO8A 4GCKA 3VVYA 4XLAA 4XBFA 2PI0A 3EUHC 1KU9A 3F6OA 2GXGA 2A6EF 5E1ZB 3ERED 1G59A 3PNYA 4C3JJ 3PSFA 2RNJA 4L9NA 2REKA 3V7RA 1IV6A 2ZY9A 2HKOA 3SWHA 1YITI 1WVRA 2CQNA 4MFDA 4BHBA 2R7SA 4BL0B 3MKWB 3PM1A 4XOPA 1B1BA 3OS0A 1OPCA 2BHZA 4MEYF 2DCEA 2ZOYA 4QPQA 4R8HA 3OYHA 1ETQA 5F04A 3Q9SA 2M7AA 2VC1A 2LF7A 5F6FA 1B9NA 3OYCA 3JRIA 2CW7A 5ICGA 2KFDA 3QOPA 2EB7A 3KZYA 1JGSA 5F64A 2XDNA 4UB6C 5ICEA 4HDUA 3CP2A 3RKQA 2OAZA 5HLIA 4B4CA 1UAAA 2OTJI 3WG7H 2XV4S 4RM3A 3ZCOA 3D1NI 2ISYA 1BIAA 1DU0A 1OCTC 2YU9J 9ANTA 3BY6A 2VXZA 5D5XB 3CF5F 2IS6A 1MJBA 5CJ9A 3CDIA 2MBFA 2E7XA 1BIBA 5LHIA 1H8AC 2VODA 5ICCA 2DOAA 3BJAA 4IPAA 1MBFA 1P6RA 3QP5A 3W2AA 2VQCA 4RGXA 3KP6A 2ESHA 4JKZA 4FISA 4I0BA 2O03A 3RSNA 5E8GA 2K40A 3E6CC 2HQRA 1OR7C 5IOZA 2E1CA 2JRTA 4LLLA 4Y13A 2EZIA 5IP6A 1YJNI 3CJDA 1RNLA 1VTNC 4CCMA 1FBUA 4MK6A 5F0CA 2X6XA 1P9QC 1E17A 1X58A 1FP2A 3ONQA 1S29A 1T33A 3FDYA 1GVDA 3T5XA 5M5XJ 4IHYA 2Y75A 3HHGA 2DXIA 1Y1VJ 4S0HB 4IQ4A 1FMVA 4J01A 5ILVA 1IRXA 3NPIA 1XGSA 3HXLA 3A01B 4MHGA 3WTWC 1PUEE 3K4LA 1SVMA 4P1WA 1JE8A 3E6MA 4BY7J 1ZLJA 4BQOA 3BTCA 1OJLA 4UV8A 4H4KC 3K1NA 5J47A 3V78A 2Z99A 1W5SA 3NS4A 4DYCA 5LEJA 3V7CA 4HNVA 5EEHA 2UXIA 2MLKA 4OMZA 3L2VA 1N75A 1ON2A 1MSEC 3L2WA 3GTGJ 2Q8KA 2O3FA 3L9FA 2R92J 2IGNA 1O3TA 2E36A 2LKXA 1IJWC 2FNPA 3SHFA 3GZ5A 1XMKA 1OCOH 2A5YB 4GXOA 2KLOA 1UHMA 3TQNA 5FRNA 2OV7A 3P7NA 2FD5A 1K61A 3GYHX 3R0AA 4M3BA 4KA4A 1A36A 2A5WA 4MIMA 1DGRM 4YZEA 5DAJA 4GFBA 2PFVA 4M6VA 4DQ2A 4JNNA 4N9HA 1QPMA 2V1DA 2BEOA 2JA2A 4V19K 3DEWA 4CXFA 2OI8A 2YR2A 3MMYB 1T38A 2MLGA 4ZTFA 2BYVE 2CGPA 2QIBA 3CMMA 3FKJA 4G8XA 1I5ZA
chains in the Genus database with same CATH topology
5HBUA 3K2AA 3KZ9A 2HXOA 1RESA 1YRNA 3M4OJ 2P81A 3V6GA 2CUFA 3TP0A 4A93J 3OSFA 5EG0A 1E3OC 3KKCA 2VI6A 2Y30A 3JR9A 3I4MJ 3S1QJ 1FTTA 3HOWJ 3ZQGA 4ABZA 3BHQA 1Y1WJ 2YUSA 2WV1A 1H88C 1NTCA 2JJ7A 2E2JJ 4JYKA 4PXIA 5FKKA 3TP3A 4BKXA 5IP7J 2YVEA 4CYCB 3G7RA 5FKMA 1POGA 3LWJA 3VPRA 2DG7A 3S1RJ 2WAQN 4DZJA 3TW7A 2HKUA 2O7OA 1OFCX 2XGCA 3BR0A 3GTOJ 4A3FJ 3BR5A 4NELA 4A3JJ 5FJ8J 1HF0A 3HTIA 4LOCA 2XPUA 3S17J 5HSZA 3JRCA 5FKNA 2K9NA 5J1UA 3ON2A 3KNWA 2AHQA 3JRHA 3ZQCA 1IRZA 4UUSA 3JREA 2IBDA 3FIWA 1VI0A 3LNQA 4JX6A 1ZK8A 1MBKA 4M3GA 3DCFA 2K9QA 3Q0WA 1ETWA 3VP5A 1Z77A 2DA2A 3RZDJ 1R9TJ 1PUFA 1JT6A 5F1JA 1JKQC 5FLVA 3S16J 2JWTA 2EZHA 2L0KA 5E3NA 1JJ8C 4D7NA 5EFYA 1S7EA 4C3IJ 2E1OA 2DA6A 2XPWA 4XRMA 4RBOA 4UDSA 3HEFA 3FRQA 3SJMA 1UHSA 2XGDA 2D5VA 1ETXA 4DYRA 3ANPA 2NS7A 4EEFG 1ETVA 4M3EA 4X1EA 4QIWN 3AQSA 4GCLA 5M5YJ 1Q1VA 3BNIA 5IOYA 4DW6A 2L7FP 5DTDA 1IG7A 2R5YA 1WH5A 2HXIA 1BW6A 2I10A 1MNMC 3O8GA 3Q0VA 2QCOA 3BR2A 5K7FA 2MSYA 4XICA 3ANGA 5K7HA 1BA5A 1U9OA 2ECCA 2HYJA 2ZCXA 5CXIA 3QPSA 5EGOB 2G7LA 1UI6A 5DS9A 3CQZJ 2EQRA 3ZQHA 4NDLA 1APLC 2NVTJ 3QQAA 1ZR4A 3PPBA 1VNDA 1NK2P 1JT0A 2L9RA 4AYBN 2HDDA 1JUSA 1F36A 1Z0XA 1TWFJ 4XK4A 3IH3A 3O60A 2JA7J 2QWTA 2VPRA 1ZTRA 3MNLA 5IYCJ 1XG1A 1TC3C 3B6CA 1RETA 2OF7A 3ZQFA 3HTAA 3BR6A 2ECBA 3TEDA 5JLWA 3C2BA 2F07A 2JMWA 2HOSA 2DMQA 2R5ZB 1IC8A 1DU6A 1RPWA 3C07A 3VIBA 3BR1A 2HQ5A 2X9DA 1P7IA 3VOXA 4JP0A 4L62A 3HE0A 2CJJA 3NARA 1D5YA 4BXXJ 3FKIJ 4G12A 4D5CA 1MH4A 4BBRJ 3BCGA 4I76A 3HM5A 2JA5J 3T6NA 2EH3A 5E3OA 2JA6J 1JJ6C 4C2MJ 1X2MA 5E3MA 1JKOC 4MXMA 3M3YJ 4AUXA 2G7GA 3VUQA 3JRFA 2CRGA 4W1UA 2YS9A 1AKHA 2W53A 3IH2A 5IYDJ 2PBXA 5F0HA 5JLXA 1MH3A 2M0CA 2UXUA 3WHBA 1W0TA 2ZCMA 3P9TA 2GENA 3QKXA 1G2HA 1WCMJ 2IEKA 1SFOJ 1MSFC 2E2IJ 1FEXA 1EF4A 1TWHJ 2O7TA 2YVHA 1B72A 3E7QA 1H89C 3JRBA 4D7MA 2HOTA 2G0EA 3HKZN 1LFBA 4MFEA 5IPAA 4IHWA 3A03A 3IH4A 3EGQA 2Y0SN 2LTPA 3HGGA 2G3BA 2L7MP 3B6AA 3BQYA 4W97A 2LFBA 3CRJA 2ME6A 2B63J 3GEUA 3G1LA 2D6YA 2LLKA 1UI5A 3LHQA 3VVXA 2W48A 4IHVA 3VW0A 3HIMA 4HKUA 3BTLA 2FX0A 1NK3P 3B81A 3QBMA 5C44J 1GUUA 2GBYA 4AF5A 2XB5A 4FE4A 3IUVA 4A69C 3PO3J 3LSRA 2HOAA 2WB1N 5EZHA 3NRGA 3A01A 3SDGA 5FLMJ 2FBQA 2H1KA 1ZGWA 5D1RA 3E7LA 2OERA 3PASA 3BTIA 2DMTA 2MGQA 4XRSA 4RDUA 5GPAA 2KT0A 2M34A 3S2HJ 3HTJA 4A3LJ 2KDZA 4AC0A 1K83J 2WGBA 1ENHA 2E2HJ 2R0QC 2GM4A 3BRUA 1SGMA 2QF7A 3HGYA 3HDDA 3TW6A 3S15J 1HDDC 1YRNB 3LSGA 2Y2ZA 3WHCA 1HCRA 1FIAA 1ETKA 4JL3A 1WPKA 3COLA 2ID3A 3GBGA 1RKWA 4M3FA 4MLOA 5C4XJ 2ME0A 3Q0UA 2EZLA 3S1MJ 4FTHA 1WGXA 4FE7A 2G7SA 2FJ1A 3RD3A 3NAUA 4XRSG 3LJLA 2O9LA 1SANA 1JTXA 5K58A 5C3EJ 5J1YA 5GPCA 1JTYA 3VOKA 4B1RA 2ID6A 1FIPA 1BJZA 3K7AJ 1IDZA 3SFIA 3GTPJ 4ME9A 3CCYA 5J3LA 4J19A 4A3BJ 3JRAA 3W6VA 4A3KJ 3F1BA 1RKTA 2N8GA 2XPVA 4GFLA 1ZQ3P 3VW1A 3F0CA 1WH7A 1IDYA 2UXPA 3FK6A 2UXHA 3LSJA 2TCTA 4QSHA 3ZQLA 2LD5A 1QVUA 1A5JA 4CYCA 5EF6A 3GTJJ 2NVXJ 3KKDA 5F27A 1B8IB 3HOUJ 3GZIA 1PUFB 5IYBJ 1IGNA 3A02A 1T56A 2PMZN 3BG3A 2PZ9A 3Q3SA 2VKVA 5M3FJ 2DA7A 2DA1A 1LE8B 2Q24A 1WI3A 1W0UA 5CW8A 1XC5A 1VF9A 4JX5A 3ZQIA 5D19A 2XRLA 1ETYA 2DN0A 4Y7NJ 5FKLA 3GTLJ 2GLOA 4DYQA 3LOCA 5M5WJ 2MG4A 4ICHA 3FK7A 4A3DJ 2LR8A 2HYTA 1LFUP 1AHDP 4M3DA 1ZR2A 1A6IA 1GV2A 2DA4A 3BG5A 5EYRA 1TWAJ 2GUHA 5BNGA 4QTRA 3MKLA 4ACIA 3OOUA 3RH2A 5F0FA 1JGGA 2JN6A 4FCYA 2NVQJ 1P7JA 3S2DJ 3GTQJ 3QPLA 1HLVA 2HI3A 1F43A 1CQTA 1FJLA 3VVYA 4GCKA 3JSJA 3BTJA 3VW2A 3UKGA 1XS9A 4C3JJ 2NOGA 2REKA 3G1MA 2XSDC 5E3LA 3O8HA 2DA3A 1U8BA 1QRYA 1IV6A 2FQ4A 3S5RA 2RASA 3G56A 4MFDA 1ORKA 2QOPA 2IAIA 4NN1A 5EEAA 2RHAA 3IV5A 4GCTA 2M8GX 3PM1A 4A3CJ 3HBLA 2AO9A 1BL0A 2CU7A 4I6ZA 4V2FA 2XGEA 5GP9A 1FTZA 2ZOYA 2TRTA 1ETQA 3HB9A 5F04A 2Y31A 2QTQA 2DA5A 1U78A 3CWRA 3JRIA 5F08A 5FHPA 5EGOA 1TWGJ 2JK3A 5M3MJ 2NP5A 3BQZA 2Y9ZA 2XDNA 1ITYA 2VUMJ 1UG2A 1I50J 3OSGA 3RKQA 1TWCJ 4B4CA 5HAWA 3DPJA 1IUFA 4DZPA 1ZKGA 2NVYJ 5J1RA 2XB0X 4IEJA 3D1NI 1DU0A 1OCTC 2YU9J 1I3QJ 3ZOBA 2OPTA 2X6OA 1AKHB 1AU7A 4BY1J 2GFNA 1X2NA 9ANTA 2WUIA 2MW8A 5IP9J 4L5EA 1OCPA 3NXCA 2NP3A 5AQCA 1HOMA 2ELKA 3H0GJ 2NX4A 5EG0B 2R5ZA 3NI7A 2JA8J 1H8AC 3S14J 4C3HJ 5D18A 1RR7A 1B72B 3GTKJ 3HOYJ 2ZCNA 3BR3A 3RQIA 2DMPA 1MBFA 2QKOA 1B8IA 2H8RA 4JKZA 4FISA 3S1NJ 1JKRC 2O8KA 3HOVJ 2K40A 2ZB9A 3CMYA 3JRDA 3LSPA 3OIOA 1GV5A 5IOZA 2DMUA 3HOXJ 2M9HA 2NS8A 1LE8A 4GFKA 2LVSA 5C4YA 5K7ZA 2EZIA 5IP6A 3H3VK 1BW5A 3AQTA 1GDTA 3CJDA 1I6HJ 3EUPA 1QVTA 4D5FA 1VFCA 5F0CA 4MK6A 5FGLA 3GTMJ 3HOZJ 2M2EA 2EZKA 1X58A 1T33A 2LK2A 5M5XJ 1GVDA 4IHYA 5EDNA 2L7ZA 1MBEA 1Y1VJ 4S0HB 4IHXA 1HDPA 1MBGA 4XIDA 1O4XA 5FMPA 2CQQA 2RAEA 3CDLA 3VVZA 3NPIA 5H9TA 3A01B 3L1PA 4UUSB 2CQXA 2LY9A 4B3AA 4A3IJ 4BY7J 5EZGA 1U9NA 3BTCA 1OJLA 2VKEA 4UUTA 3MVPA 3V78A 3FISA 4DYCA 3MN2A 4HNVA 2UXIA 3I4NJ 2IU5A 5FKOA 1MSEC 1ETOA 4A3MJ 3GTGJ 2DG8A 1MBHA 1UMQA 5CXGA 2R92J 2DTZA 1JKPC 2E19A 2LKXA 1IJWC 2ZOZA 3ON4A 2V57A 3BG9A 3HTHA 4KWAA 2COBA 5C4JJ 1QPIA 3JRGA 4Y52J 2R5YB 1K61A 2FD5A 3PO2J 2K9SA 4M3BA 3NNRA 2X48A 2LP0A 2DJNA 2Y9YA 4MIMA 4YZEA 5DAJA 4AC6A 4GFBA 2CUEA 1JUMA 4M6VA 4JNNA 4A3EJ 2R93J 4JX4A 4BBSJ 5HODA 2R7ZJ 3RZOJ 4A3GJ 3DEWA 2OI8A 3BT9A 4X6AJ 3G1OA 3BJBA 2EBIA 4V2GA 2QIBA 1GT0C 2DMNA 4CGRA 4MO7A 2UXOA 1JUPA 1MBJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HBU A;  3K2A A;  3KZ9 A;  2HXO A;  1RES A;  1YRN A;  3M4O J;  2P81 A;  3V6G A;  2CUF A;  3TP0 A;  4A93 J;  3OSF A;  5EG0 A;  1E3O C;  3KKC A;  2VI6 A;  2Y30 A;  3JR9 A;  3I4M J;  3S1Q J;  1FTT A;  3HOW J;  3ZQG A;  4ABZ A;  3BHQ A;  1Y1W J;  2YUS A;  2WV1 A;  1H88 C;  1NTC A;  2JJ7 A;  2E2J J;  4JYK A;  4PXI A;  5FKK A;  3TP3 A;  4BKX A;  5IP7 J;  2YVE A;  4CYC B;  3G7R A;  5FKM A;  1POG A;  3LWJ A;  3VPR A;  2DG7 A;  3S1R J;  2WAQ N;  4DZJ A;  3TW7 A;  2HKU A;  2O7O A;  1OFC X;  2XGC A;  3BR0 A;  3GTO J;  4A3F J;  3BR5 A;  4NEL A;  4A3J J;  5FJ8 J;  1HF0 A;  3HTI A;  4LOC A;  2XPU A;  3S17 J;  5HSZ A;  3JRC A;  5FKN A;  2K9N A;  5J1U A;  3ON2 A;  3KNW A;  2AHQ A;  3JRH A;  3ZQC A;  1IRZ A;  4UUS A;  3JRE A;  2IBD A;  3FIW A;  1VI0 A;  3LNQ A;  4JX6 A;  1ZK8 A;  1MBK A;  4M3G A;  3DCF A;  2K9Q A;  3Q0W A;  1ETW A;  3VP5 A;  1Z77 A;  2DA2 A;  3RZD J;  1R9T J;  1PUF A;  1JT6 A;  5F1J A;  1JKQ C;  5FLV A;  3S16 J;  2JWT A;  2EZH A;  2L0K A;  5E3N A;  1JJ8 C;  4D7N A;  5EFY A;  1S7E A;  4C3I J;  2E1O A;  2DA6 A;  2XPW A;  4XRM A;  4RBO A;  4UDS A;  3HEF A;  3FRQ A;  3SJM A;  1UHS A;  2XGD A;  2D5V A;  1ETX A;  4DYR A;  3ANP A;  2NS7 A;  4EEF G;  1ETV A;  4M3E A;  4X1E A;  4QIW N;  3AQS A;  4GCL A;  5M5Y J;  1Q1V A;  3BNI A;  5IOY A;  4DW6 A;  2L7F P;  5DTD A;  1IG7 A;  2R5Y A;  1WH5 A;  2HXI A;  1BW6 A;  2I10 A;  1MNM C;  3O8G A;  3Q0V A;  2QCO A;  3BR2 A;  5K7F A;  2MSY A;  4XIC A;  3ANG A;  5K7H A;  1BA5 A;  1U9O A;  2ECC A;  2HYJ A;  2ZCX A;  5CXI A;  3QPS A;  5EGO B;  2G7L A;  1UI6 A;  5DS9 A;  3CQZ J;  2EQR A;  3ZQH A;  4NDL A;  1APL C;  2NVT J;  3QQA A;  1ZR4 A;  3PPB A;  1VND A;  1NK2 P;  1JT0 A;  2L9R A;  4AYB N;  2HDD A;  1JUS A;  1F36 A;  1Z0X A;  1TWF J;  4XK4 A;  3IH3 A;  3O60 A;  2JA7 J;  2QWT A;  2VPR A;  1ZTR A;  3MNL A;  5IYC J;  1XG1 A;  1TC3 C;  3B6C A;  1RET A;  2OF7 A;  3ZQF A;  3HTA A;  3BR6 A;  2ECB A;  3TED A;  5JLW A;  3C2B A;  2F07 A;  2JMW A;  2HOS A;  2DMQ A;  2R5Z B;  1IC8 A;  1DU6 A;  1RPW A;  3C07 A;  3VIB A;  3BR1 A;  2HQ5 A;  2X9D A;  1P7I A;  3VOX A;  4JP0 A;  4L62 A;  3HE0 A;  2CJJ A;  3NAR A;  1D5Y A;  4BXX J;  3FKI J;  4G12 A;  4D5C A;  1MH4 A;  4BBR J;  3BCG A;  4I76 A;  3HM5 A;  2JA5 J;  3T6N A;  2EH3 A;  5E3O A;  2JA6 J;  1JJ6 C;  4C2M J;  1X2M A;  5E3M A;  1JKO C;  4MXM A;  3M3Y J;  4AUX A;  2G7G A;  3VUQ A;  3JRF A;  2CRG A;  4W1U A;  2YS9 A;  1AKH A;  2W53 A;  3IH2 A;  5IYD J;  2PBX A;  5F0H A;  5JLX A;  1MH3 A;  2M0C A;  2UXU A;  3WHB A;  1W0T A;  2ZCM A;  3P9T A;  2GEN A;  3QKX A;  1G2H A;  1WCM J;  2IEK A;  1SFO J;  1MSF C;  2E2I J;  1FEX A;  1EF4 A;  1TWH J;  2O7T A;  2YVH A;  1B72 A;  3E7Q A;  1H89 C;  3JRB A;  4D7M A;  2HOT A;  2G0E A;  3HKZ N;  1LFB A;  4MFE A;  5IPA A;  4IHW A;  3A03 A;  3IH4 A;  3EGQ A;  2Y0S N;  2LTP A;  3HGG A;  2G3B A;  2L7M P;  3B6A A;  3BQY A;  4W97 A;  2LFB A;  3CRJ A;  2ME6 A;  2B63 J;  3GEU A;  3G1L A;  2D6Y A;  2LLK A;  1UI5 A;  3LHQ A;  3VVX A;  2W48 A;  4IHV A;  3VW0 A;  3HIM A;  4HKU A;  3BTL A;  2FX0 A;  1NK3 P;  3B81 A;  3QBM A;  5C44 J;  1GUU A;  2GBY A;  4AF5 A;  2XB5 A;  4FE4 A;  3IUV A;  4A69 C;  3PO3 J;  3LSR A;  2HOA A;  2WB1 N;  5EZH A;  3NRG A;  3A01 A;  3SDG A;  5FLM J;  2FBQ A;  2H1K A;  1ZGW A;  5D1R A;  3E7L A;  2OER A;  3PAS A;  3BTI A;  2DMT A;  2MGQ A;  4XRS A;  4RDU A;  5GPA A;  2KT0 A;  2M34 A;  3S2H J;  3HTJ A;  4A3L J;  2KDZ A;  4AC0 A;  1K83 J;  2WGB A;  1ENH A;  2E2H J;  2R0Q C;  2GM4 A;  3BRU A;  1SGM A;  2QF7 A;  3HGY A;  3HDD A;  3TW6 A;  3S15 J;  1HDD C;  1YRN B;  3LSG A;  2Y2Z A;  3WHC A;  1HCR A;  1FIA A;  1ETK A;  4JL3 A;  1WPK A;  3COL A;  2ID3 A;  3GBG A;  1RKW A;  4M3F A;  4MLO A;  5C4X J;  2ME0 A;  3Q0U A;  2EZL A;  3S1M J;  4FTH A;  1WGX A;  4FE7 A;  2G7S A;  2FJ1 A;  3RD3 A;  3NAU A;  4XRS G;  3LJL A;  2O9L A;  1SAN A;  1JTX A;  5K58 A;  5C3E J;  5J1Y A;  5GPC A;  1JTY A;  3VOK A;  4B1R A;  2ID6 A;  1FIP A;  1BJZ A;  3K7A J;  1IDZ A;  3SFI A;  3GTP J;  4ME9 A;  3CCY A;  5J3L A;  4J19 A;  4A3B J;  3JRA A;  3W6V A;  4A3K J;  3F1B A;  1RKT A;  2N8G A;  2XPV A;  4GFL A;  1ZQ3 P;  3VW1 A;  3F0C A;  1WH7 A;  1IDY A;  2UXP A;  3FK6 A;  2UXH A;  3LSJ A;  2TCT A;  4QSH A;  3ZQL A;  2LD5 A;  1QVU A;  1A5J A;  4CYC A;  5EF6 A;  3GTJ J;  2NVX J;  3KKD A;  5F27 A;  1B8I B;  3HOU J;  3GZI A;  1PUF B;  5IYB J;  1IGN A;  3A02 A;  1T56 A;  2PMZ N;  3BG3 A;  2PZ9 A;  3Q3S A;  2VKV A;  5M3F J;  2DA7 A;  2DA1 A;  1LE8 B;  2Q24 A;  1WI3 A;  1W0U A;  5CW8 A;  1XC5 A;  1VF9 A;  4JX5 A;  3ZQI A;  5D19 A;  2XRL A;  1ETY A;  2DN0 A;  4Y7N J;  5FKL A;  3GTL J;  2GLO A;  4DYQ A;  3LOC A;  5M5W J;  2MG4 A;  4ICH A;  3FK7 A;  4A3D J;  2LR8 A;  2HYT A;  1LFU P;  1AHD P;  4M3D A;  1ZR2 A;  1A6I A;  1GV2 A;  2DA4 A;  3BG5 A;  5EYR A;  1TWA J;  2GUH A;  5BNG A;  4QTR A;  3MKL A;  4ACI A;  3OOU A;  3RH2 A;  5F0F A;  1JGG A;  2JN6 A;  4FCY A;  2NVQ J;  1P7J A;  3S2D J;  3GTQ J;  3QPL A;  1HLV A;  2HI3 A;  1F43 A;  1CQT A;  1FJL A;  3VVY A;  4GCK A;  3JSJ A;  3BTJ A;  3VW2 A;  3UKG A;  1XS9 A;  4C3J J;  2NOG A;  2REK A;  3G1M A;  2XSD C;  5E3L A;  3O8H A;  2DA3 A;  1U8B A;  1QRY A;  1IV6 A;  2FQ4 A;  3S5R A;  2RAS A;  3G56 A;  4MFD A;  1ORK A;  2QOP A;  2IAI A;  4NN1 A;  5EEA A;  2RHA A;  3IV5 A;  4GCT A;  2M8G X;  3PM1 A;  4A3C J;  3HBL A;  2AO9 A;  1BL0 A;  2CU7 A;  4I6Z A;  4V2F A;  2XGE A;  5GP9 A;  1FTZ A;  2ZOY A;  2TRT A;  1ETQ A;  3HB9 A;  5F04 A;  2Y31 A;  2QTQ A;  2DA5 A;  1U78 A;  3CWR A;  3JRI A;  5F08 A;  5FHP A;  5EGO A;  1TWG J;  2JK3 A;  5M3M J;  2NP5 A;  3BQZ A;  2Y9Z A;  2XDN A;  1ITY A;  2VUM J;  1UG2 A;  1I50 J;  3OSG A;  3RKQ A;  1TWC J;  4B4C A;  5HAW A;  3DPJ A;  1IUF A;  4DZP A;  1ZKG A;  2NVY J;  5J1R A;  2XB0 X;  4IEJ A;  3D1N I;  1DU0 A;  1OCT C;  2YU9 J;  1I3Q J;  3ZOB A;  2OPT A;  2X6O A;  1AKH B;  1AU7 A;  4BY1 J;  2GFN A;  1X2N A;  9ANT A;  2WUI A;  2MW8 A;  5IP9 J;  4L5E A;  1OCP A;  3NXC A;  2NP3 A;  5AQC A;  1HOM A;  2ELK A;  3H0G J;  2NX4 A;  5EG0 B;  2R5Z A;  3NI7 A;  2JA8 J;  1H8A C;  3S14 J;  4C3H J;  5D18 A;  1RR7 A;  1B72 B;  3GTK J;  3HOY J;  2ZCN A;  3BR3 A;  3RQI A;  2DMP A;  1MBF A;  2QKO A;  1B8I A;  2H8R A;  4JKZ A;  4FIS A;  3S1N J;  1JKR C;  2O8K A;  3HOV J;  2K40 A;  2ZB9 A;  3CMY A;  3JRD A;  3LSP A;  3OIO A;  1GV5 A;  5IOZ A;  2DMU A;  3HOX J;  2M9H A;  2NS8 A;  1LE8 A;  4GFK A;  2LVS A;  5C4Y A;  5K7Z A;  2EZI A;  5IP6 A;  3H3V K;  1BW5 A;  3AQT A;  1GDT A;  3CJD A;  1I6H J;  3EUP A;  1QVT A;  4D5F A;  1VFC A;  5F0C A;  4MK6 A;  5FGL A;  3GTM J;  3HOZ J;  2M2E A;  2EZK A;  1X58 A;  1T33 A;  2LK2 A;  5M5X J;  1GVD A;  4IHY A;  5EDN A;  2L7Z A;  1MBE A;  1Y1V J;  4S0H B;  4IHX A;  1HDP A;  1MBG A;  4XID A;  1O4X A;  5FMP A;  2CQQ A;  2RAE A;  3CDL A;  3VVZ A;  3NPI A;  5H9T A;  3A01 B;  3L1P A;  4UUS B;  2CQX A;  2LY9 A;  4B3A A;  4A3I J;  4BY7 J;  5EZG A;  1U9N A;  3BTC A;  1OJL A;  2VKE A;  4UUT A;  3MVP A;  3V78 A;  3FIS A;  4DYC A;  3MN2 A;  4HNV A;  2UXI A;  3I4N J;  2IU5 A;  5FKO A;  1MSE C;  1ETO A;  4A3M J;  3GTG J;  2DG8 A;  1MBH A;  1UMQ A;  5CXG A;  2R92 J;  2DTZ A;  1JKP C;  2E19 A;  2LKX A;  1IJW C;  2ZOZ A;  3ON4 A;  2V57 A;  3BG9 A;  3HTH A;  4KWA A;  2COB A;  5C4J J;  1QPI A;  3JRG A;  4Y52 J;  2R5Y B;  1K61 A;  2FD5 A;  3PO2 J;  2K9S A;  4M3B A;  3NNR A;  2X48 A;  2LP0 A;  2DJN A;  2Y9Y A;  4MIM A;  4YZE A;  5DAJ A;  4AC6 A;  4GFB A;  2CUE A;  1JUM A;  4M6V A;  4JNN A;  4A3E J;  2R93 J;  4JX4 A;  4BBS J;  5HOD A;  2R7Z J;  3RZO J;  4A3G J;  3DEW A;  2OI8 A;  3BT9 A;  4X6A J;  3G1O A;  3BJB A;  2EBI A;  4V2G A;  2QIB A;  1GT0 C;  2DMN A;  4CGR A;  4MO7 A;  2UXO A;  1JUP A;  1MBJ A; 
#chains in the Genus database with same CATH topology
 1RUO A;  3K2A A;  3TDU C;  1U0J A;  3M4O J;  1LNW A;  3S3M A;  2CUF A;  3AL0 C;  2KPM A;  1D1C A;  2WBM A;  4OIR F;  3TP0 A;  3OSF A;  3KKC A;  4PZJ A;  2VI6 A;  2QZ8 A;  1FTT A;  4HW0 A;  2XVC A;  2F4I A;  2IS4 A;  2K3F A;  2L02 A;  1Y1W J;  5FB2 A;  1X4O A;  3VSL A;  2X1C A;  2FNA A;  4F55 A;  2E2J J;  2CFX A;  2W24 A;  3G7R A;  2YVE A;  4CYC B;  3WU2 C;  4HF1 A;  3LWJ A;  5FRM A;  1YW8 A;  2P5K A;  4EJT A;  4ZC3 A;  2HKU A;  3L09 A;  1LB2 A;  4H0E A;  3MCZ A;  1OFC X;  5HLH A;  1RC9 A;  1IRG A;  4HA8 A;  2LC2 A;  3KP4 A;  3PL8 A;  1RRJ A;  2VJ4 A;  4A3J J;  1HF0 A;  3HTI A;  3KYL A;  2YX7 A;  2UV1 A;  3J7Y J;  1G3T A;  3LQR A;  3PIP F;  2KIQ A;  4AIJ A;  1YYV A;  3S17 J;  1FX7 A;  5J1U A;  3ZQ7 A;  4XLF A;  3I3L A;  3KNW A;  1OKR A;  1R1U A;  2HZD A;  2VKH A;  4DJA A;  1TW2 A;  2IBD A;  2ZO4 A;  1VI0 A;  2EFW A;  1SD6 A;  4JX6 A;  3RJP A;  4RGR A;  3SQN A;  2R3S A;  3DCF A;  3Q0W A;  1ETW A;  2PMH A;  2WY8 Q;  1Z77 A;  2DA2 A;  1XCV A;  4OAZ A;  1D1B A;  3AFH A;  2FOW A;  5E3N A;  4D7N A;  5EFY A;  3GFI A;  3TO6 A;  2LBF B;  2CO5 A;  4G6T B;  2EV5 A;  4L9T A;  1S7O A;  5GAD J;  4XRM A;  1UHS A;  3L2C A;  3CCR I;  4ENM A;  1FYK A;  1KA8 A;  3I53 A;  2IPQ X;  1ZGJ A;  4QIW N;  5GAH J;  2E5N A;  5DEQ A;  4UUV A;  2K85 A;  3H5R A;  2JVG A;  5IOY A;  5E20 A;  3WGH A;  4DW6 A;  3RI4 A;  1IG7 A;  1WH5 A;  4MEX F;  1ZHF A;  1BW6 A;  3RPU A;  1WJE A;  3OYI A;  3RPQ A;  3FXK A;  4M9X A;  2VOP A;  2EV0 A;  3RKX A;  4XLP F;  3IL2 A;  5LHG A;  3I56 I;  2WTE A;  3ZGK A;  2G7L A;  3DP7 A;  3DPU A;  1QZY A;  2EQR A;  2VBZ A;  3I4P A;  4NDL A;  3WE3 A;  1Z05 A;  1YIO A;  4FET A;  5CVJ A;  3HL2 A;  2HPI A;  2M4K A;  2KRC A;  3WTS C;  3I0T A;  1VND A;  3NWT A;  2DT7 B;  1IN4 A;  4L5I A;  2UZK A;  3S3O A;  1Z0X A;  2IGM A;  4Q48 A;  4U7B A;  2JA7 J;  2DYS H;  1KQ0 A;  1EH8 A;  1I6X A;  3O2P E;  3ELK A;  2OF7 A;  3HTA A;  4CCL A;  1OCC H;  3BR6 A;  2B0L A;  2FMY A;  1WHU A;  2X0L A;  2R5Z B;  2MD5 A;  1RPW A;  4E7S A;  3M1E A;  4MTD A;  3C07 A;  3VIB A;  2H6C A;  1J09 A;  5TIS C;  3HUG B;  4ENK A;  2OD5 A;  1P7I A;  4IRG A;  4BEH A;  3IRQ A;  3WU1 B;  2MC3 A;  2V6C A;  1XDU A;  3NAR A;  1OIS A;  2XAU A;  1FWZ A;  1MMD A;  4BXX J;  3DBR B;  2Q1Z B;  3P9C A;  4D5C A;  2Q2E A;  3GLL A;  3VOE A;  4BBR J;  1IN6 A;  2ETH A;  2Z16 A;  3WTZ A;  2JA6 J;  2L9N A;  4E7H A;  1XGO A;  1JKO C;  3VUQ A;  3M3Y J;  3JRF A;  4B43 A;  2EIJ H;  1JHF A;  1HW1 A;  1V5E A;  2M0C A;  5FO5 A;  2UXU A;  3DLL F;  1AOY A;  2BY3 A;  3EYI A;  4DNC A;  1LFP A;  4X0G A;  2GEN A;  2EFP A;  2FF4 A;  2KRF A;  1MSF C;  2O7T A;  5GTH C;  1W7P D;  3K1M A;  4M71 A;  2YVH A;  1B72 A;  2E60 A;  3OYJ A;  5DM6 F;  3E7Q A;  3M8E A;  3F72 A;  2Y48 A;  4HST A;  2H09 A;  4PSW A;  2CG4 A;  2IW5 A;  4MFE A;  5B1A H;  1G3W A;  4P9U A;  2A6T A;  4IHW A;  3JW4 A;  1Z3Y A;  3A03 A;  4KJZ A;  3EGQ A;  1KQ9 A;  2Y0S N;  3EPZ A;  2L4A A;  2L7M P;  2PEX A;  2GOM A;  4LLN A;  3DF8 A;  3BQY A;  4W97 A;  4ZYD A;  4IF4 A;  2ME6 A;  5KHD A;  4II3 A;  1EKE A;  1YX3 A;  2B63 J;  3TL4 X;  2XRO A;  4WX9 A;  5J8C A;  1UI5 A;  3VVX A;  3HIM A;  2FX0 A;  3QBM A;  5C44 J;  1GUU A;  2F6C A;  3R61 A;  2XB5 A;  4OIP F;  3PO3 J;  3EUA A;  3RQ4 A;  2HOA A;  2WB1 N;  5EZH A;  5D5W B;  1PP7 U;  1BC8 C;  3NRG A;  3LSK A;  4LK0 F;  1ONV A;  3FXU A;  5FLM J;  4OIO F;  2H1K A;  5D1R A;  3X2Q H;  4RAF A;  1WI9 A;  3B02 A;  2HVS A;  3PQK A;  2MGQ A;  1IXS B;  2M34 A;  2XC7 A;  3S2H J;  1YI2 I;  2R7U A;  4ZDP A;  4WCG A;  2Y0S A;  3NRV A;  4GRI A;  4AC0 A;  5HS8 A;  1D8J A;  1H0M A;  3CJQ B;  3H9G A;  3BRU A;  2GM4 A;  2VB6 A;  1E0E A;  3TW6 A;  2LNB A;  1HCR A;  4HYE A;  2R7V A;  5FGM A;  1J59 A;  2CFO A;  5BOX A;  2HDW A;  4BDZ A;  2F2E A;  3V7S A;  4XSX F;  1XD7 A;  4MLO A;  4M3F A;  2V1U A;  3OMY A;  4CA0 A;  2JSC A;  3HUG A;  2Z5U A;  2UUZ A;  1W7P B;  1I39 A;  3HG9 A;  2KQR A;  2FJ1 A;  2P5V A;  1UST A;  2W00 A;  2ZSI B;  3MFK A;  1MMA A;  4O3M A;  1KU2 A;  2DT5 A;  4UXN A;  1VQ7 I;  3R60 A;  1S7A A;  3DBH B;  4CHU A;  4B1R A;  2ID6 A;  3BRO A;  4M6X A;  4E7J A;  3A1Y A;  3RYR A;  2EA2 A;  2ZXH A;  1IDZ A;  3SFI A;  3GTP J;  3H0D A;  4KFC A;  2LKP A;  3KCC A;  2QQ9 A;  4PDK A;  4YEL A;  2AXL A;  1I1S A;  5LGN A;  3U2R A;  4JK1 X;  1TT0 A;  2HDC A;  2LDU A;  1IXR C;  2XGX A;  2UXP A;  3FK6 A;  1WJ5 A;  1YIJ I;  2YSR A;  4BHP A;  3JSO A;  2W4S A;  2FRH A;  3I9V 2;  1K78 B;  2NRA C;  3LST A;  2LD5 A;  2VIX A;  4DIQ A;  1Y0U A;  1QVU A;  2DLL A;  1A5J A;  5EF6 A;  1FPQ A;  4ZDO A;  2KP6 A;  3GXO A;  4UVC A;  2BW3 A;  4YEJ A;  4RS8 A;  4ZZL A;  3GZI A;  1PUF B;  5IYB J;  3A02 A;  3KZZ A;  2P4W A;  1OR7 A;  2R7Q A;  3GVA A;  4A6E A;  2KMU A;  2W57 A;  2V7F A;  1LE8 B;  1G4D A;  2Q24 A;  1FY7 A;  2FE3 A;  4HSR A;  2WV0 A;  3ZQI A;  1XTA A;  5D19 A;  3OL4 A;  2WAD A;  1SD5 A;  2M0M A;  3JTH A;  3VOD A;  4DYQ A;  4P55 A;  3QYF A;  4EM1 A;  3ROU A;  3FK7 A;  1F5T A;  2C6Y A;  2LR8 A;  2HYT A;  1LFU P;  1ZR2 A;  3BG5 A;  2DA4 A;  4L18 B;  2GUH A;  3BG6 A;  3DU6 A;  3W2W A;  4HX7 A;  4B48 A;  1KU7 A;  2H6B A;  1JGG A;  2JN6 A;  4I01 A;  2NVQ J;  2DI3 A;  4D0P A;  3E5X A;  3HOT A;  2R7T A;  3OYA A;  3VWB A;  1IZ1 A;  3V8K A;  3CZ6 A;  4BH9 A;  3GX4 X;  3ZXS A;  1FJL A;  2FBI A;  2LYC A;  3VYT B;  2HNH A;  1Y8R B;  1UG0 A;  4U0W A;  2W82 A;  4XSZ F;  4B44 A;  1ODD A;  2CMP A;  2NOG A;  2W25 A;  3MD2 A;  5L3E A;  4HRI A;  3ABU A;  1WKM A;  3GZN B;  1N25 A;  2RAS A;  4LLG F;  4LMY A;  1ORK A;  2IAI A;  3BLY A;  1G6N A;  4A3C J;  1HKQ A;  1BL0 A;  4PJJ A;  2VL8 A;  4V2F A;  1TL8 A;  4RA2 A;  3AG4 H;  2QTQ A;  2Y31 A;  3F21 A;  5FD5 A;  3C18 A;  1UFM A;  3CWR A;  3FMQ A;  5DCF A;  5FHP A;  5EGO A;  1S8N A;  2NOJ B;  5M3M J;  2B1E A;  3SFZ A;  5K1Y A;  3BQZ A;  3DFG A;  3QU3 A;  3TO9 A;  1W36 C;  2F5C A;  1LDJ A;  2H27 A;  2VUM J;  1I50 J;  2KIM A;  3WTU C;  3CC2 I;  2HWV A;  1TWC J;  2DFI A;  3DPJ A;  1V55 H;  2NVY J;  1Y8Q B;  3M7G A;  4AVZ A;  5H6R A;  1HQC A;  1K7A A;  2RNG A;  2OPT A;  1AKH B;  2GFN A;  1X2N A;  3FMR A;  4YRV A;  5E1X A;  2MW8 A;  1UHW A;  5IP9 J;  3REO A;  2H8W A;  1K6O A;  4C2M A;  5AQC A;  1T98 A;  1K78 A;  4BJ5 C;  4MQV A;  3S14 J;  4C3H J;  3HOY J;  2ZCN A;  1XCB A;  3MKZ A;  4BE0 A;  1PVE A;  2DMP A;  1FP1 D;  2OBP A;  3BOQ A;  3ZMD A;  2B9S A;  3FM3 A;  2HS5 A;  2A61 A;  3DTE A;  5J6X A;  2WAQ A;  3HOV J;  4GDF A;  1TW3 A;  2KRH A;  3LSP A;  2M9H A;  1G3Y A;  1LE8 A;  1IXC A;  2DQR A;  3H3V K;  1BW5 A;  3AQT A;  1I6H J;  1QVT A;  3KZI C;  4QLC U;  5FGL A;  3IUO A;  3GTM J;  2M2E A;  3ZMT A;  5K5Q A;  2CQ7 A;  2LK2 A;  4G9Y A;  1KGS A;  3BG7 A;  1IAW A;  4XLC A;  3F8F A;  1SD4 A;  3MKY B;  1O4X A;  3OV8 A;  1Q1H A;  2OTL I;  1IO2 A;  2VJJ A;  2R7R A;  3VVZ A;  5H9T A;  1L0O C;  4NBQ A;  4WIB A;  2K27 A;  3L1P A;  2EFQ A;  4LGW A;  1IUY A;  5DD8 A;  4Q4Z F;  1R22 A;  4A3I J;  2RC4 A;  3OYD A;  2VKE A;  5B3S H;  1VQL I;  1J0R A;  3MVP A;  2P0W A;  3SZP A;  1UZC A;  4LFU A;  3FIS A;  3S8P A;  2W84 A;  3CUO A;  2WWY A;  5FKO A;  1WJB A;  2OCC H;  2ICW G;  1DPU A;  1V3F A;  1JKP C;  3FHN A;  2XHK A;  2ZOZ A;  3ON4 A;  3BG9 A;  1YJ9 I;  3HTH A;  2COB A;  2XRN A;  1MMG A;  1MJ9 A;  3ZN0 A;  1QPI A;  4HPQ A;  1TTY A;  3CMA I;  1ZRD A;  4EAT A;  1BC7 C;  4UNO A;  1WQ2 A;  4EV0 A;  2LP0 A;  2DJN A;  2Y9Y A;  1QGP A;  4AC6 A;  4KN7 X;  4WK8 F;  4LG0 B;  2PLY A;  1YW7 A;  2R93 J;  3QYB A;  1UEL B;  4BBS J;  5HOD A;  2BY2 A;  1QO0 D;  2D45 A;  2R7Z J;  4A3G J;  4E7K A;  3G1O A;  5AON A;  1MD0 A;  4EJO A;  2EBI A;  4M9S A;  1GT0 C;  2DMN A;  4MO7 A;  2UXO A;  2QUF A;  1JUP A;  4HNU A;  2HXO A;  3L7W A;  4U0Y A;  1YRN A;  3K4K A;  2P81 A;  3V6G A;  3J81 Z;  4BE1 A;  3VFZ A;  1LUJ B;  1XSD A;  5IY5 H;  1E3O C;  3S1Q J;  3IP4 B;  4DBQ A;  2V9P A;  4ABZ A;  3CCE I;  2EIN H;  3PJR A;  5KVR A;  4JYK A;  4PXI A;  2LRD A;  5HDG A;  5IP7 J;  1BR4 A;  2HFH A;  1POG A;  5JVT A;  2JUC A;  3E5U A;  2QSF X;  3S1R J;  3A2K A;  2QKM B;  5LFA A;  1X3W B;  2O7O A;  2XUB A;  2VN2 A;  1J9I A;  1B59 A;  4HX4 A;  3VYS B;  4XQF A;  3W6K B;  1ZAR A;  4NEL A;  5HDN A;  3BPX A;  1OCR H;  3PNV A;  4CCO A;  2D1H A;  2XPU A;  4FAS D;  1A31 A;  1Y6I A;  4BXU A;  5HSZ A;  4ETS A;  5AIQ A;  1Z1D A;  2QWW A;  1BOA A;  2E1M B;  5AIP A;  3TMO A;  3S3N A;  4RGS A;  2JZY A;  4EMS A;  2HQN A;  3HIF A;  3OR2 C;  2RDP A;  3LSI A;  4IZZ A;  2IP2 A;  1MZB A;  3JRE A;  1SEU A;  2VE9 A;  4CGR A;  1HKS A;  3NEU A;  3KET A;  4IL6 C;  4IRH A;  3VP5 A;  1YS7 A;  3E97 A;  2B7E A;  1JT6 A;  2FOK A;  1JJ8 C;  1DDN A;  3K70 D;  2V1X A;  3CES A;  4M72 A;  2VPL A;  3L2R A;  3N4M A;  2XPW A;  5DUK A;  3SJM A;  2VQL A;  1BBY A;  3R0J A;  1O3Q A;  4EEF G;  2HYF A;  3LWF A;  5K5O A;  5M5Y J;  3WU0 A;  1Y39 A;  2J5O A;  2L7F P;  4I98 B;  2JVH A;  3O6B B;  3GCM A;  4A2U A;  2K86 A;  3O8G A;  4YIF A;  2YX4 A;  5JR3 A;  4LG0 A;  4A5M A;  3QPS A;  1K4T A;  3AG3 H;  3IWZ A;  2BE5 F;  3WTT C;  1G3S A;  5FFZ A;  3CDH A;  3HJE A;  1U5T A;  1LQ1 A;  2L9R A;  1B4A A;  3LMM A;  2HDD A;  1HSJ A;  1ZGA A;  2PG4 A;  3K10 A;  3D5S C;  5CVV A;  4XK4 A;  3IH3 A;  3O60 A;  3SDB A;  2EIK H;  4OAY A;  5IYC J;  2RKH A;  1XG1 A;  4R79 A;  1AWC A;  1TC3 C;  4QPO A;  2RQP A;  1RET A;  2X1D A;  3W3C A;  3ASN H;  5CQE A;  3C2B A;  1VQ9 I;  2F07 A;  2HOS A;  5H6Q A;  1R49 A;  1IC8 A;  5LRR A;  4U7D A;  4F91 B;  4F92 B;  2KIU A;  3BR1 A;  2X9D A;  2YU3 A;  3DPT A;  1A04 A;  3FXJ A;  5LGU A;  4JP0 A;  4P96 A;  3VOX A;  4L62 A;  2CJJ A;  3KLN A;  1ZRF A;  4MGR A;  1LDK B;  3FKI J;  3FBN B;  4RLQ A;  3M07 A;  2VOO A;  2IXS A;  4HEA 2;  1FYM A;  4E7L A;  2JPC A;  3F8C A;  4E70 A;  2R4G A;  2JA5 J;  1Z3X A;  2PFB A;  3EQL F;  1FLI A;  4N0B A;  4MXM A;  4E6K G;  2E34 A;  1R7J A;  4AUX A;  4W1U A;  2YS9 A;  4GYG A;  2DJI A;  2R7W A;  3K6G A;  2KJB A;  5IYD J;  3V8J A;  2DBB A;  2PBX A;  1MH3 A;  4HQE A;  4B09 A;  3WHB A;  2ZXW H;  5HLG A;  2ZCM A;  4Y15 A;  3CUQ B;  3QKX A;  2IEK A;  1SFO J;  2E2I J;  1EF4 A;  1TWH J;  4KIB A;  3LFU A;  1J2X A;  2LOO A;  4EGY A;  3RDI A;  1H89 C;  4EQQ A;  1ON1 A;  2KHM A;  2HOT A;  2G0E A;  3HKZ N;  1LFB A;  1PP8 F;  3ZR8 X;  2ZME B;  2QSG X;  4HAM A;  4DBR A;  1NG7 A;  3HGG A;  5J40 A;  4HDV A;  4PK4 A;  3CRJ A;  3OIQ A;  3K9T A;  4A0X A;  2WAE A;  3Q9V A;  3OYG A;  4HKU A;  3DKY A;  1BI3 A;  1NK3 P;  4M74 A;  5FFX A;  4A0Z A;  2COM A;  4AF5 A;  1QHH D;  2FEZ A;  2K7L A;  2L01 A;  2QYO A;  2M45 A;  4CCK A;  1R58 A;  2PBI A;  3A01 A;  5H20 A;  4WXH A;  3SDG A;  2FBQ A;  1ZGW A;  3OR1 C;  1KYW A;  2EK5 A;  1U6G A;  2OER A;  1HW5 A;  1VZ0 A;  3BTI A;  3PAS A;  2DMT A;  5CLS A;  4XRS A;  3HKZ A;  5D5V B;  4A3L J;  1NH3 A;  1K83 J;  1X1A A;  3CCM I;  1WZ2 A;  4ZYG A;  5LD2 C;  2R7F A;  3H9Q A;  4BQA A;  1SGM A;  1UCR A;  2CUZ A;  3HDD A;  2HR3 A;  1XMA A;  4R1H A;  4RM2 A;  4KIC A;  5D6F A;  1D3Y A;  2Y2Z A;  4BDY A;  1FIA A;  3I5U A;  2F48 A;  3KYC B;  1WPK A;  1YFH A;  3COL A;  1WJA A;  3Q0U A;  3DKX A;  2BGC A;  2IA1 A;  3BZK A;  4FTH A;  1FBS A;  2MFZ A;  3AG1 H;  4XLN F;  4KT6 A;  1I27 A;  1RIO H;  2XF5 A;  3LJL A;  2B3W A;  1JTX A;  1O3S A;  2LH9 A;  5GPC A;  1JTY A;  3LL7 A;  1VQN I;  2P7V B;  3VOK A;  4CCJ A;  3K2Z A;  1K6Y A;  3CCY A;  2DT6 A;  2FBH A;  2ZJQ F;  4J19 A;  4A3B J;  2M5W A;  3GF2 A;  3DKW A;  3JRA A;  4A3K J;  1ZQ3 P;  3CP8 A;  4C30 A;  1WH7 A;  2XAS A;  2VBW A;  4ON0 A;  2ZXJ A;  2O6G E;  2E7W A;  2V9V A;  1QNT A;  3A4C A;  3HTU A;  5HNH A;  3DTI A;  3KP2 A;  3WOD F;  2PN6 A;  2TCT A;  3FXQ A;  4QSH A;  3TBI A;  2NYX A;  1JXS A;  4E7I A;  4P9F A;  1Z21 A;  2GIV A;  2ZFW A;  5BQT A;  4CYC A;  3H36 A;  3GTJ J;  1FC3 A;  3GZ6 A;  3S32 A;  4BHC A;  1BI2 A;  4A0Y A;  3ABT A;  1T56 A;  4N4N B;  4UVA A;  5E18 F;  1D5V A;  4FQG A;  3BG3 A;  3EYY A;  1REP C;  1P4W A;  3ML6 A;  3PUF A;  3Q3S A;  2DA1 A;  1WI3 A;  3QRF F;  4JX5 A;  1V54 H;  2XRL A;  1PJR A;  5KAI C;  3KP7 A;  1TLH B;  1FSH A;  2H94 A;  2XDV A;  3IAS 2;  3LOC A;  3OS2 A;  3IRR A;  1FOX A;  5M5W J;  1WRJ A;  3P5J A;  1E3P A;  2MG4 A;  4NC8 A;  2L4M A;  2DDB A;  3FBI B;  4IVN A;  4ICH A;  3DQV C;  1AHD P;  4M3D A;  1A6I A;  3HYI A;  4QWQ A;  4C2T A;  1TWA J;  3HZJ A;  5BNG A;  3K4C A;  1F9N A;  3MKL A;  3ZN1 A;  1IF1 A;  2GAU A;  3ZPL A;  3IC7 A;  1ERD A;  2E35 A;  4FCY A;  5BPD A;  4GGG A;  3F6V A;  1P7J A;  2CH0 A;  3F23 A;  3GTQ J;  2F5F A;  1HLV A;  1F43 A;  1CQT A;  2STT A;  2LBF A;  3T1B A;  1LKX A;  1KON A;  3C7J A;  1BR1 A;  4PJL A;  3VW2 A;  1D0X A;  1WJF A;  3UKG A;  1XS9 A;  1IN7 A;  3G1M A;  2XSD C;  5E3L A;  4IOA F;  3PQJ A;  1U8B A;  1QRY A;  4I7H A;  3S5R A;  1GVJ A;  3G56 A;  3BDD A;  2QOP A;  3SZG A;  4NN1 A;  2DOF A;  4UHT A;  5ERI A;  5JHU A;  3IV5 A;  1X3Z B;  2JQ7 A;  4BJT A;  3J80 K;  2AO9 A;  1P92 A;  3CTA A;  3EET A;  2XGE A;  1FTZ A;  4EM2 A;  2HPM A;  1YLF A;  3HB9 A;  4PCQ A;  3CO7 C;  5B5E C;  1R36 A;  1P4X A;  5LGT A;  5F08 A;  1TWG J;  2LF8 A;  2JK3 A;  3AAF A;  2NP5 A;  2MH2 A;  2Y9Z A;  4BNC A;  2ZC2 A;  1YQA A;  5HLT A;  1S3J A;  2XF6 A;  2M30 A;  2HZT A;  5HAW A;  3HC7 A;  1MDM B;  2XAQ A;  3EUK L;  1ZKG A;  5TJJ A;  5J1R A;  3TO7 A;  3ECO A;  1U5T C;  3H3Z A;  4IEJ A;  4ESJ A;  1ZG5 A;  1GHC A;  1I3Q J;  2XAH A;  3I71 A;  3ZOB A;  2ZKZ A;  4OU0 A;  2X6O A;  1SFK A;  3OOP A;  1Z67 A;  2ZJR F;  4KYW A;  2V1N A;  4C9Y A;  4L5E A;  3G2B A;  2OQR A;  2Y69 H;  4CGZ A;  1YS6 A;  1IN5 A;  1HOM A;  2NP3 A;  4A6D A;  1OCZ H;  2ELK A;  5EG0 B;  2L9V A;  2R5Z A;  1T2K A;  2V9K A;  4HV6 A;  1VQ8 I;  1RR7 A;  2LSO A;  3BR3 A;  2F4O B;  2QKO A;  3DEU A;  2ZBK A;  4E7Z A;  4XKV A;  1VQM I;  1JKR C;  4EVI A;  2A2F X;  2O8K A;  3LSM A;  5HDK A;  2HTS A;  3CMY A;  2LG4 A;  3JRD A;  1B9M A;  2QM3 A;  3OIO A;  3BC8 A;  3COA C;  2DMU A;  4UV9 A;  3HOX J;  1H9T A;  2NS8 A;  5IT9 K;  5C4Y A;  2LVS A;  5K7Z A;  1NG6 A;  3BJ6 A;  1GDT A;  4M9Z A;  3EUP A;  1GLN A;  2O0Y A;  2V6E A;  3HOZ J;  2DTR A;  4HLY A;  2NNY A;  5FLX K;  1S9H A;  3D0S A;  5EDN A;  5LLQ A;  2D1V A;  5FMP A;  2E1M C;  2CQQ A;  1LPQ A;  3CDL A;  1SFE A;  2ZJP F;  3MZH A;  1FSE A;  3H5N A;  5BPI A;  2OA4 A;  4FHT A;  2Z1D A;  1MW7 A;  4M73 A;  4ESB A;  5LEK A;  1SMT A;  3VEP A;  1ZRC A;  4RB0 A;  2P8T A;  2LY9 A;  3IKT A;  3KEO A;  2UXN A;  1U9N A;  2RGV A;  3G73 A;  4UUT A;  5LHH A;  3LAJ A;  3MN2 A;  5CYV A;  2IU5 A;  5LBQ A;  1R00 A;  3BCB A;  1CF7 B;  1MBH A;  1XGN A;  5CXG A;  3K4B A;  2DK5 A;  3ZMU A;  2E19 A;  1QQI A;  3K69 A;  2V57 A;  2VAS A;  4LJZ F;  2D2W A;  4PGG A;  4UB8 C;  4Y52 J;  2E71 A;  2EPF A;  2K9S A;  3FM5 A;  2X48 A;  1TP4 A;  3H3U A;  2CV0 A;  1N78 A;  2X51 A;  2QQB A;  1JUM A;  1BOB A;  3GEZ A;  4JX4 A;  5ED4 A;  4E4H A;  2K5C A;  1MDM A;  2CV1 A;  4I2O A;  4AIK A;  2G7H A;  3AKZ A;  3TKY A;  4D1Q A;  4L9V A;  1V5F A;  4AYB A;  4IX7 A;  2DK8 A;  2L5Q A;  3J7Z I;  1MBJ A;  5HBU A;  3KZ9 A;  2M8E A;  3F8M A;  1YX5 A;  4YFN F;  2KIS A;  4B3X A;  4ZYH A;  4G94 A;  3EDP A;  5A2Q K;  4A93 J;  5EG0 A;  3TOB A;  3JR9 A;  3I4M J;  3RCO A;  1MKM A;  5BMZ A;  3G4S I;  2R7X A;  1EV7 A;  4RB1 A;  5DCM B;  1AA7 A;  1ZN2 A;  3D5L A;  1Y56 A;  3HRU A;  1W7P A;  1XGM A;  2UXX A;  3TP3 A;  5FKM A;  2GIZ A;  2WAQ N;  4DZJ A;  5L3C A;  1TBX A;  3TW7 A;  2RV8 A;  2XGC A;  4KIF A;  5JFR A;  4EJU A;  3E6D A;  2IGO A;  2XKP A;  2OCE A;  3HRT A;  4A3F J;  4OD5 A;  1O7F A;  4MQ9 F;  3T0Y A;  3N97 A;  3MWM A;  1P2F A;  1SD7 A;  2FXA A;  2ACJ A;  5FKN A;  3T8T A;  1TZL A;  3ON2 A;  1T8I A;  1TNT A;  3JRH A;  1HXD A;  3ZMV A;  4XR6 A;  4F93 B;  2ZNY A;  1LEB A;  2QGU A;  4GYI A;  4LB6 B;  3U9G A;  4HV5 A;  5CVU A;  4M3G A;  5L3G A;  3QPT A;  3CCV I;  2FA5 A;  3KFW X;  2P5L C;  4ZDL A;  4YIR X;  5HOO A;  3RZD J;  1OYY A;  1PUF A;  3IKV A;  3K4J A;  4IRV A;  4Y33 A;  2DOD A;  1JKQ C;  5FLV A;  3S16 J;  2L0K A;  2IRF G;  3K4M A;  4GCV A;  1DP7 P;  2G7U A;  4BUP A;  1S7E A;  4C3I J;  3CCQ I;  2E1O A;  1SVO A;  1CF7 A;  4Z6Y A;  4UDS A;  4RBO A;  3HEF A;  4B47 A;  2D5V A;  1ETX A;  4XOR A;  2L7K A;  3FXR A;  3ANP A;  3IHU A;  4BGD A;  2CUJ A;  3M8J A;  1XSX A;  1J75 A;  1ACI A;  2FML A;  4X1E A;  2DAO A;  4PJ0 C;  3VYU B;  4ESF A;  1Q1V A;  4I0A A;  2CW8 A;  5CVR A;  3U21 A;  1HA8 A;  5L3B A;  3VYR B;  4CYD A;  1MNM C;  5CQG A;  3Q0V A;  4P5O A;  3BR2 A;  2MSY A;  4XIC A;  5K7H A;  1BA5 A;  1TQI A;  1BI0 A;  3RKY A;  2HYJ A;  2ZCX A;  2XKO A;  5CXI A;  3GME A;  2VJI A;  3WGG A;  1UI6 A;  1RI7 A;  3ZQH A;  2P7C B;  2NVT J;  3QQA A;  1ZR4 A;  3CF2 A;  3F22 A;  2IT0 A;  1JT0 A;  2IGK A;  1STZ A;  4KIT B;  1JUS A;  1Z7U A;  3L2U A;  1F36 A;  1ZG1 A;  5FD6 A;  2DPU A;  1TWF J;  2JRM A;  2QWT A;  2DFF A;  3OWT A;  1ZTR A;  4NHJ A;  4KIG A;  2MA3 A;  2X4H A;  4CH7 A;  3B6C A;  4DOZ A;  1OLT A;  1FBQ A;  3PNT A;  2PMU A;  1T08 B;  4EJW A;  5JLW A;  4B8X A;  5J4Y A;  1TT5 B;  3NWS A;  5DCM A;  4G7Z F;  3D5R C;  3P9K A;  4I02 A;  4L5J A;  3LSH A;  1KZH A;  3HE0 A;  2Z33 A;  2QQ8 A;  3CCJ I;  3LAP A;  4Q5S F;  2GA2 A;  2JSP A;  3FMS A;  2E1N A;  4IHS A;  2ELH A;  4ITV A;  3BZ6 A;  2KL4 A;  4ENN A;  2F5E A;  3FXL A;  1DQU A;  3OYL A;  3BCG A;  5TRD A;  3DV8 A;  2OU2 A;  2EH3 A;  5KCM A;  5D4S A;  1JJ6 C;  4WF2 A;  2YPR A;  4PSX A;  2XSJ C;  5E3M A;  1MMS A;  5LRS A;  4XKW A;  2Z9O A;  2G7G A;  3GUD A;  1AKH A;  1SFX A;  3GLX A;  3QP6 A;  3QAH A;  3TOA A;  1T0F A;  1XB4 A;  5F0H A;  3J7A O;  1R1T A;  2VLA A;  2VKD A;  3HSF A;  4KDP A;  1W0T A;  2K02 A;  4KNY A;  1PDN C;  3P9T A;  4D9J A;  4HF2 A;  3MZY A;  1G2H A;  1VQ4 I;  4U0V A;  1BJA A;  1YTY A;  1FEX A;  2BXZ A;  2OZU A;  4XN3 A;  3FF5 A;  2NAZ A;  3OYM A;  4IO9 F;  3IH4 A;  4CDG A;  4U87 A;  2GZW A;  4G7O F;  4HX8 A;  2K4B A;  1QBJ A;  2LFB A;  4KMU X;  3GFJ A;  3V8L A;  4JQF A;  3FWE A;  1LEA A;  1ZRE A;  3KEQ A;  2LLK A;  4NQW B;  4F7Z A;  1MGT A;  3CC4 I;  2PJP A;  2GXA A;  1QZZ A;  4S04 A;  1UB9 A;  1QZE A;  3B73 A;  3HSR A;  2GBY A;  3H92 A;  1N77 A;  1FOW A;  2HOE A;  3IUV A;  1R4N B;  2F5V A;  1XDS A;  2O8X A;  4A69 C;  3JAM Z;  1YJW I;  1I1G A;  1A35 A;  2YVX A;  2CQK A;  3LA3 A;  2BHY A;  4ZTJ A;  1R4M B;  1B6A A;  2OUM A;  3E7L A;  3AG2 H;  5E8I A;  5F1R A;  5J4V A;  2V79 A;  3LA7 A;  3HTJ A;  1X4P A;  3ABM H;  4LK1 F;  1DPR A;  2E2H J;  3OS1 A;  1X1D A;  2QF7 A;  4MTE A;  1R6R A;  4O6J A;  1HDD C;  2W85 A;  4BE2 A;  1SVL A;  4KMF A;  1OYW A;  4XM3 A;  3DLA A;  3RPU D;  3GBG A;  4RAZ A;  1RKW A;  2HU9 A;  2ME0 A;  1WJD A;  1XSV A;  3MEX A;  2EZL A;  4YII A;  1HBX G;  1MND A;  4JBA A;  3S1M J;  3GFL A;  1PYV A;  1NHA A;  5D6E A;  1WGX A;  1W36 D;  4HNT A;  1K4S A;  1S6L A;  3RD3 A;  3NAU A;  4XRS G;  1BR2 A;  4AU7 A;  3TGN A;  4G7H F;  3KLO A;  1X19 A;  5DYM A;  2DFE A;  3K7A J;  4LIT A;  4BAC A;  4ME9 A;  1BN5 A;  2NVU B;  4Y3O A;  1X3U A;  3JCU C;  3W6V A;  1R23 A;  1RKT A;  2N8G A;  3WTV C;  4XKC A;  4GFL A;  4A5N A;  1LVA A;  1X1C A;  3GO5 A;  3WG9 A;  4J00 A;  5GTI C;  3CJR B;  1IV8 A;  1ZAO A;  4KT5 C;  3HTS B;  3FZV A;  2BOL A;  2M87 A;  2G9W A;  3BJO A;  2VJ5 A;  3C3W A;  5HS7 A;  3H5A A;  1DP3 A;  3CC7 I;  2STW A;  2HTJ A;  3FXM A;  5EJC A;  5L3F A;  1B8I B;  2NVX J;  3BP8 A;  2QVO A;  3SYT A;  3ZMS A;  4IHT A;  3VTI A;  4EJV A;  2PMZ N;  2PZ9 A;  3QOD A;  4CIC A;  1Z6R A;  2M7B A;  4NQW A;  5M3F J;  2CW0 F;  2WA0 A;  4Y17 A;  3CO6 C;  1XC5 A;  1R5G A;  3M8F A;  1VF9 A;  2EIL H;  3P9I A;  5DD4 A;  1ETY A;  3GTL J;  3VB2 A;  3CCU I;  2DFH A;  4C2U A;  1W5T A;  2AQE A;  2I5U A;  5GAE J;  4NC7 A;  2QLZ A;  3K0L A;  2V26 A;  5TGT A;  4AVP A;  2XAG A;  3OYF A;  3PFI A;  5EYR A;  1BM9 A;  4ZJZ A;  3HRS A;  4ACI A;  3OOU A;  4Z2Y A;  5F0F A;  1VQP I;  2ZNZ A;  4F3Q A;  3E1S A;  3N05 A;  4ASN A;  3S2D J;  3CLQ A;  3KX2 A;  3RKW A;  3G3Z A;  2IVM A;  2HI3 A;  1A6Q A;  3JSJ A;  2PMZ A;  4RLF A;  2R7D A;  1C0W A;  1OQY A;  5L3D A;  2QKL B;  3BTJ A;  2FU4 A;  1Z6T A;  2FUG 2;  1I3A A;  2PQ8 A;  3O8H A;  2DA3 A;  2FQ4 A;  2QA4 I;  3I58 A;  2MD0 A;  1T6S A;  3ULQ B;  3F8B A;  5EEA A;  2RHA A;  4BQQ A;  4GCT A;  2M8G X;  2HYG D;  3ECH A;  3HBL A;  2CU7 A;  4I6Z A;  5GP9 A;  2X1E A;  2TRT A;  3BWG A;  4KIS A;  2DA5 A;  4BEH B;  1U78 A;  2UWM A;  4N9I A;  1LJ9 A;  4AM3 A;  2M3A A;  2GA1 A;  3DBL B;  4JOM A;  2Q2E B;  4KN4 X;  1ITY A;  1UG2 A;  1J7K A;  3OSG A;  2XF7 A;  3DU5 A;  2HEO A;  1FOY A;  3WE2 A;  3SEZ A;  2M1B A;  1IUF A;  2A69 F;  3O3K A;  1QA6 A;  4DZP A;  3A0B C;  3KEY A;  1D0Z A;  1R5H A;  2XB0 X;  3E3V A;  4XLE A;  2QSH X;  1X1B A;  5ICF A;  1AU7 A;  2OC6 A;  5D8K B;  4BY1 J;  2WUI A;  3T8R A;  4IXA A;  3ZP5 A;  4NC6 A;  3M1C A;  4Q47 A;  1OCP A;  3NXC A;  1WSU A;  3Q5F A;  1T95 A;  4HQM A;  2NX4 A;  3H0G J;  3H9J A;  3NI7 A;  2WY7 Q;  2JA8 J;  4LD5 A;  2MYS A;  5D18 A;  1B72 B;  2KDO A;  4AIH A;  3GTK J;  3RQI A;  2PJR B;  2R7O A;  1B8I A;  4XOT A;  5DM7 F;  2H8R A;  3S1N J;  4MNU A;  2JTV A;  5CVI A;  2O61 A;  3CME I;  2VT3 A;  3KP5 A;  2ZB9 A;  1FMW A;  1V4R A;  1CGP A;  1GV5 A;  2A07 F;  2HVR A;  1E3H A;  4GFK A;  2A68 F;  2X6W A;  2XAF A;  3I59 B;  2QQA A;  2MH9 A;  1VFC A;  4D5F A;  3E0J B;  2PX9 A;  2LKS A;  3BPV A;  4I09 A;  2EZK A;  2CS3 A;  4IKF A;  2L7Z A;  1MBE A;  3ERM A;  3CJN A;  1IW7 F;  3BZC A;  4IHX A;  1HDP A;  1MBG A;  1T0F C;  4XID A;  1OMI A;  4EM0 B;  2RAE A;  4ZYE A;  3H1C A;  4BS9 A;  1D1A A;  3CUQ A;  5JHF A;  5EEG A;  4UUS B;  4FT8 A;  1QU3 A;  5FRO A;  2CQX A;  4B3A A;  4RB3 C;  5EZG A;  3J7A Y;  3KYD B;  2ZME A;  2J5P A;  1GXQ A;  2OZ6 A;  3C2H A;  1YHQ I;  3KP3 A;  2HKX A;  1LDD A;  3W2V A;  4UY8 I;  1WWX A;  1IRF A;  3PFY A;  4XMY A;  3I4N J;  4HF0 A;  1U2W A;  1JI8 A;  1ZH5 A;  4BAY A;  2FQ3 A;  1ETO A;  4A3M J;  2DG8 A;  1UMQ A;  4RMN A;  2DTZ A;  3JTG A;  3WGI A;  4KWA A;  3WTY C;  5C4J J;  5KK1 A;  2P6T A;  3DWL E;  2L9S A;  3JRG A;  2R5Y B;  3HPG A;  2KZG A;  5J8F A;  1DGW Y;  2A05 A;  3PO2 J;  4NUB A;  3ZMZ A;  3DPL C;  3NNR A;  4G6D A;  5ILU A;  3PIO F;  2CUE A;  2QBY B;  1HST A;  3QPH A;  3SXY A;  1R5I D;  4A3E J;  4LB5 A;  3G71 I;  2AXT C;  1RZ4 A;  1U8R A;  2K4J A;  3LA2 A;  4GO1 A;  3CCL I;  1SFU A;  3F3X A;  2TDX A;  3RZO J;  1MMN A;  4OD4 A;  3BT9 A;  4X6A J;  3BJB A;  4M6Y A;  1F4K A;  4ZYA A;  2EA4 A;  4V2G A;  2HQA A;  2RN7 A;  2EIM H;  3PPB A;  3ESW B;  2IJL A;  4FX0 A;  2V4J C;  1RES A;  4TV7 A;  2XIG A;  5CKT A;  2Y30 A;  3HOW J;  3BCA A;  3ZQG A;  3BHQ A;  2YUS A;  4YFX F;  3GW2 A;  2WV1 A;  1H88 C;  2PJR A;  1NTC A;  2JJ7 A;  2DYR H;  5FKK A;  4BKX A;  3IAM 2;  4IOC F;  3VPR A;  2BW3 B;  2DG7 A;  2EFN A;  2EJR A;  4FX4 A;  1FT9 A;  2ADU A;  2BV6 A;  3I59 A;  3BR0 A;  3GTO J;  3ISP A;  3QU6 A;  4RAG A;  2VC0 A;  3WTX C;  1S5L C;  2RQQ A;  3BR5 A;  3HSE A;  5FJ8 J;  4LOC A;  4KUM A;  4N4O B;  5HNF A;  1SAU A;  5KAF C;  4S05 A;  3L2Q A;  4BQN A;  2O5R A;  3JRC A;  1FYL A;  1FZP B;  2K9N A;  1X1P A;  1EH7 A;  4G6Q A;  2LY2 A;  1QHG A;  2KKO A;  3RIR A;  2EWN A;  2AHQ A;  3ZQC A;  5DDG A;  4U9L A;  1IRZ A;  4UUS A;  1ZLK A;  2F5D A;  3FIW A;  1FOK A;  2KJC A;  4ZH4 F;  3LNQ A;  3K1P A;  2MAB A;  1ZK8 A;  3V4G A;  1ULY A;  1MBK A;  5D8L B;  3CD6 I;  4XLH A;  1SMY F;  2VT2 A;  2K9Q A;  3HHH A;  3ASO H;  2ISZ A;  1SC7 A;  2BXY A;  1R9T J;  2I8D A;  5F1J A;  3OIP A;  3F8N A;  2GOX B;  2CYY A;  2EZH A;  2JWT A;  2W1O A;  4PFP A;  3EUH A;  5JVG F;  2OQG A;  2DA6 A;  3FX3 A;  3HOS A;  4DGW B;  2CV2 A;  3FRQ A;  1WFX A;  3F9K A;  4NNJ A;  2XGD A;  2IS2 A;  1R1V A;  4DYR A;  2NS7 A;  2X6Y A;  1ETV A;  4HZF A;  4M3E A;  1RR8 C;  4RGU A;  4OIQ F;  3AQS A;  1Z7L A;  2HGC A;  4GCL A;  3BNI A;  3UR3 C;  5DTD A;  2R5Y A;  2HXI A;  2I10 A;  2QCO A;  5K7F A;  2JPB A;  2WB1 A;  1TQM A;  3ANG A;  5HS9 A;  4OOI A;  4OIN F;  3W6J B;  2QBY A;  1U9O A;  2ECC A;  4CSW A;  4OWR B;  5EGO B;  1YW9 A;  4AWX B;  2BZT A;  3PUB A;  5DS9 A;  3CQZ J;  2EV6 A;  3J80 Z;  2QEN A;  3R4K A;  3E5Q A;  1APL C;  3C2G A;  2AS5 F;  2X85 A;  2RRE A;  2MC4 A;  4U88 A;  1NK2 P;  2EFO A;  2IS1 A;  1VQK I;  2ESN A;  4AYB N;  4CZC A;  1XPX A;  4UVB A;  5E79 C;  2LMD A;  1VQ6 I;  2ZXI A;  1KU3 A;  2VPR A;  1WJC A;  3OL3 A;  3MNL A;  1GXP A;  2RVC A;  3ZQF A;  3U1D A;  3AL0 B;  3R6S A;  2CSO A;  5KNL A;  3TED A;  2ECB A;  2WAF A;  4XL9 A;  4OMY A;  2JMW A;  3MZ8 A;  4XKB A;  2DMQ A;  1DU6 A;  5BS6 A;  2HQ5 A;  4LIU A;  2ZSH B;  1TQP A;  4NB5 A;  1VQO I;  2P6S A;  4I99 C;  3OYN A;  1D5Y A;  1EA3 A;  1ZG3 A;  5CPR B;  4L9J A;  4G12 A;  3VDX A;  2BVL A;  2NS0 A;  3GWZ A;  1MH4 A;  3QYE A;  4WXD A;  2Z3Y A;  1Y0N A;  2KIF A;  5D5U B;  2VE8 A;  4I76 A;  3HM5 A;  2AQF A;  3OYK A;  1VQ5 I;  3T6N A;  5E3O A;  3ABK H;  2VQH A;  5E1W A;  1HW2 A;  4DVY P;  4C2M J;  1X2M A;  4II2 A;  2CRG A;  3CJT B;  3DTK A;  1O3R A;  2W53 A;  3IH2 A;  4HBL A;  3CCS I;  4XN0 A;  5B1B H;  3M9A A;  5JLX A;  3U1K A;  4XON A;  3FXO A;  3OYE A;  1MNE A;  5IT9 Z;  1WCM J;  3RYP A;  1USS A;  4AD9 A;  2IA2 A;  5FLX Z;  2LY1 A;  3JSP A;  3TDZ C;  2ZCW A;  5DUI A;  6PAX A;  3JRB A;  4D7M A;  2DU9 A;  4YG2 F;  3MQ0 A;  5IPA A;  1MIJ A;  3FHZ A;  5E17 F;  4A12 A;  4IRI A;  3V42 A;  2LTP A;  2WC2 A;  2G3B A;  4O5V A;  2QEX I;  3B6A A;  5B66 C;  1FNN A;  1O57 A;  1OYI A;  4PFO A;  1M1E B;  2VON A;  3S2W A;  2HVQ A;  1R71 A;  4BYY A;  3GEU A;  3G1L A;  2GWR A;  2BY0 A;  2D6Y A;  1XN7 A;  3KIO A;  3K70 C;  3MAJ A;  4PUS A;  3LHQ A;  2W48 A;  1SAX A;  4IHV A;  1YG2 A;  1YE9 A;  3VW0 A;  3BTL A;  3L00 A;  4HLX A;  4WXC A;  2DQL A;  5H2F C;  3B81 A;  5IT3 A;  2DOE A;  3ZRG A;  4CUG A;  1H9G A;  4EGZ A;  1JHH A;  1BI1 A;  2GXB A;  4FE4 A;  1W1W E;  2NNN A;  3QWL A;  3LSR A;  2BY1 A;  2L3D A;  3DXJ F;  4Y4R A;  5DV5 A;  3CUQ C;  3UNG C;  2K9M A;  3SZT A;  3A0H C;  1P4A A;  1XMX A;  2A6H F;  2L54 A;  3PSI A;  2JT1 A;  5ILS A;  4XRF A;  3ABL H;  4RDU A;  5GPA A;  2KT0 A;  2OJE D;  1G8X A;  2ZME C;  2BBY A;  4RAY A;  2KDZ A;  1K79 A;  4BU2 A;  2WGB A;  1KQ8 A;  1ENH A;  3ZQQ A;  2R0Q C;  3SEQ A;  1IN8 A;  2K9L A;  4PJN A;  3HGY A;  2M4G A;  3IWF A;  1RUN A;  3S15 J;  1HKT A;  1YRN B;  3LSG A;  2ZJ2 A;  1S72 I;  2FSW A;  3WHC A;  2IA0 A;  3KPH A;  4HOB A;  1ETK A;  3QOE A;  4JL3 A;  4BJ6 C;  2KZV A;  2ID3 A;  4L0Y B;  1F1Z A;  4PJM A;  5C4X J;  3CLO A;  4LIV A;  4HG2 A;  1D8K A;  2Q0O A;  1YO5 C;  4XNF A;  2VBY A;  4FE7 A;  2G7S A;  5K5R A;  2VQG A;  3GFM A;  5A2Q Z;  3S93 A;  1Z9C A;  1L3L A;  2FJI 1;  2ELJ A;  2O9L A;  1SAN A;  5K58 A;  5C3E J;  1E2X A;  2BVM A;  2DDA A;  3LFK A;  3LQQ A;  5J1Y A;  2DPD A;  2H1L A;  3J81 K;  4RB2 C;  1FIP A;  1KYZ A;  1LVK A;  1BJZ A;  3HPH A;  5JI6 A;  1UJ8 A;  2LRE A;  5D4R A;  4PGH A;  5J3L A;  4CCN A;  2VXD A;  2Z2S B;  3F1B A;  2XPV A;  3DEE A;  1W4M A;  4YFK F;  1TNS A;  3F0C A;  3VW1 A;  1IDY A;  3H35 A;  4LG3 A;  3OY9 A;  2E5Z A;  2UXH A;  5GAG J;  3LSJ A;  1YOV B;  2DO7 A;  1D0Y A;  2GQQ A;  4WWC A;  3ZQL A;  1MJA A;  1ZYR F;  3VSK A;  2W7N A;  1U3E M;  5HVQ C;  3KE2 A;  3KKD A;  2Y0M A;  5F27 A;  1EH6 A;  4ENJ A;  3HOU J;  1V5G A;  3RTR A;  1IGN A;  4BXF A;  3C1D A;  3OYB A;  1HC8 A;  2CWE A;  2FBK A;  1T39 A;  4ZZD A;  3JAM K;  2F4M B;  2VBX A;  2VKV A;  2DA7 A;  1W0U A;  3I54 A;  5CW8 A;  2ZFU A;  3K8P C;  4IQJ A;  4IJA A;  1W5C C;  2DN0 A;  4Y7N J;  3G6E I;  5FKL A;  4CZZ A;  1J5Y A;  2A3S A;  2GLO A;  4AID A;  4L0Z B;  2JUG A;  1O7L A;  1ZEL A;  4A3D J;  3K4N A;  3E6B A;  2K3P A;  2NXN B;  4F52 A;  1GV2 A;  1XX5 A;  2DW4 A;  3HRM A;  4K2E A;  4U9N A;  4QTR A;  3RH2 A;  2L2O A;  1EJ9 A;  2XAJ A;  1Z91 A;  3I55 I;  1DUX C;  1U5T B;  3NQO A;  3QPL A;  4ANJ A;  3I64 A;  4CO8 A;  4GCK A;  3VVY A;  4XLA A;  4XBF A;  2PI0 A;  3EUH C;  1KU9 A;  3F6O A;  2GXG A;  2A6E F;  5E1Z B;  3ERE D;  1G59 A;  3PNY A;  4C3J J;  3PSF A;  2RNJ A;  4L9N A;  2REK A;  3V7R A;  1IV6 A;  2ZY9 A;  2HKO A;  3SWH A;  1YIT I;  1WVR A;  2CQN A;  4MFD A;  4BHB A;  2R7S A;  4BL0 B;  3MKW B;  3PM1 A;  4XOP A;  1B1B A;  3OS0 A;  1OPC A;  2BHZ A;  4MEY F;  2DCE A;  2ZOY A;  4QPQ A;  4R8H A;  3OYH A;  1ETQ A;  5F04 A;  3Q9S A;  2M7A A;  2VC1 A;  2LF7 A;  5F6F A;  1B9N A;  3OYC A;  3JRI A;  2CW7 A;  5ICG A;  2KFD A;  3QOP A;  2EB7 A;  3KZY A;  1JGS A;  5F64 A;  2XDN A;  4UB6 C;  5ICE A;  4HDU A;  3CP2 A;  3RKQ A;  2OAZ A;  5HLI A;  4B4C A;  1UAA A;  2OTJ I;  3WG7 H;  2XV4 S;  4RM3 A;  3ZCO A;  3D1N I;  2ISY A;  1BIA A;  1DU0 A;  1OCT C;  2YU9 J;  9ANT A;  3BY6 A;  2VXZ A;  5D5X B;  3CF5 F;  2IS6 A;  1MJB A;  5CJ9 A;  3CDI A;  2MBF A;  2E7X A;  1BIB A;  5LHI A;  1H8A C;  2VOD A;  5ICC A;  2DOA A;  3BJA A;  4IPA A;  1MBF A;  1P6R A;  3QP5 A;  3W2A A;  2VQC A;  4RGX A;  3KP6 A;  2ESH A;  4JKZ A;  4FIS A;  4I0B A;  2O03 A;  3RSN A;  5E8G A;  2K40 A;  3E6C C;  2HQR A;  1OR7 C;  5IOZ A;  2E1C A;  2JRT A;  4LLL A;  4Y13 A;  2EZI A;  5IP6 A;  1YJN I;  3CJD A;  1RNL A;  1VTN C;  4CCM A;  1FBU A;  4MK6 A;  5F0C A;  2X6X A;  1P9Q C;  1E17 A;  1X58 A;  1FP2 A;  3ONQ A;  1S29 A;  1T33 A;  3FDY A;  1GVD A;  3T5X A;  5M5X J;  4IHY A;  2Y75 A;  3HHG A;  2DXI A;  1Y1V J;  4S0H B;  4IQ4 A;  1FMV A;  4J01 A;  5ILV A;  1IRX A;  3NPI A;  1XGS A;  3HXL A;  3A01 B;  4MHG A;  3WTW C;  1PUE E;  3K4L A;  1SVM A;  4P1W A;  1JE8 A;  3E6M A;  4BY7 J;  1ZLJ A;  4BQO A;  3BTC A;  1OJL A;  4UV8 A;  4H4K C;  3K1N A;  5J47 A;  3V78 A;  2Z99 A;  1W5S A;  3NS4 A;  4DYC A;  5LEJ A;  3V7C A;  4HNV A;  5EEH A;  2UXI A;  2MLK A;  4OMZ A;  3L2V A;  1N75 A;  1ON2 A;  1MSE C;  3L2W A;  3GTG J;  2Q8K A;  2O3F A;  3L9F A;  2R92 J;  2IGN A;  1O3T A;  2E36 A;  2LKX A;  1IJW C;  2FNP A;  3SHF A;  3GZ5 A;  1XMK A;  1OCO H;  2A5Y B;  4GXO A;  2KLO A;  1UHM A;  3TQN A;  5FRN A;  2OV7 A;  3P7N A;  2FD5 A;  1K61 A;  3GYH X;  3R0A A;  4M3B A;  4KA4 A;  1A36 A;  2A5W A;  4MIM A;  1DGR M;  4YZE A;  5DAJ A;  4GFB A;  2PFV A;  4M6V A;  4DQ2 A;  4JNN A;  4N9H A;  1QPM A;  2V1D A;  2BEO A;  2JA2 A;  4V19 K;  3DEW A;  4CXF A;  2OI8 A;  2YR2 A;  3MMY B;  1T38 A;  2MLG A;  4ZTF A;  2BYV E;  2CGP A;  2QIB A;  3CMM A;  3FKJ A;  4G8X A;  1I5Z A; 
#chains in the Genus database with same CATH homology
 5HBU A;  3K2A A;  3KZ9 A;  2HXO A;  1RES A;  1YRN A;  3M4O J;  2P81 A;  3V6G A;  2CUF A;  3TP0 A;  4A93 J;  3OSF A;  5EG0 A;  1E3O C;  3KKC A;  2VI6 A;  2Y30 A;  3JR9 A;  3I4M J;  3S1Q J;  1FTT A;  3HOW J;  3ZQG A;  4ABZ A;  3BHQ A;  1Y1W J;  2YUS A;  2WV1 A;  1H88 C;  1NTC A;  2JJ7 A;  2E2J J;  4JYK A;  4PXI A;  5FKK A;  3TP3 A;  4BKX A;  5IP7 J;  2YVE A;  4CYC B;  3G7R A;  5FKM A;  1POG A;  3LWJ A;  3VPR A;  2DG7 A;  3S1R J;  2WAQ N;  4DZJ A;  3TW7 A;  2HKU A;  2O7O A;  1OFC X;  2XGC A;  3BR0 A;  3GTO J;  4A3F J;  3BR5 A;  4NEL A;  4A3J J;  5FJ8 J;  1HF0 A;  3HTI A;  4LOC A;  2XPU A;  3S17 J;  5HSZ A;  3JRC A;  5FKN A;  2K9N A;  5J1U A;  3ON2 A;  3KNW A;  2AHQ A;  3JRH A;  3ZQC A;  1IRZ A;  4UUS A;  3JRE A;  2IBD A;  3FIW A;  1VI0 A;  3LNQ A;  4JX6 A;  1ZK8 A;  1MBK A;  4M3G A;  3DCF A;  2K9Q A;  3Q0W A;  1ETW A;  3VP5 A;  1Z77 A;  2DA2 A;  3RZD J;  1R9T J;  1PUF A;  1JT6 A;  5F1J A;  1JKQ C;  5FLV A;  3S16 J;  2JWT A;  2EZH A;  2L0K A;  5E3N A;  1JJ8 C;  4D7N A;  5EFY A;  1S7E A;  4C3I J;  2E1O A;  2DA6 A;  2XPW A;  4XRM A;  4RBO A;  4UDS A;  3HEF A;  3FRQ A;  3SJM A;  1UHS A;  2XGD A;  2D5V A;  1ETX A;  4DYR A;  3ANP A;  2NS7 A;  4EEF G;  1ETV A;  4M3E A;  4X1E A;  4QIW N;  3AQS A;  4GCL A;  5M5Y J;  1Q1V A;  3BNI A;  5IOY A;  4DW6 A;  2L7F P;  5DTD A;  1IG7 A;  2R5Y A;  1WH5 A;  2HXI A;  1BW6 A;  2I10 A;  1MNM C;  3O8G A;  3Q0V A;  2QCO A;  3BR2 A;  5K7F A;  2MSY A;  4XIC A;  3ANG A;  5K7H A;  1BA5 A;  1U9O A;  2ECC A;  2HYJ A;  2ZCX A;  5CXI A;  3QPS A;  5EGO B;  2G7L A;  1UI6 A;  5DS9 A;  3CQZ J;  2EQR A;  3ZQH A;  4NDL A;  1APL C;  2NVT J;  3QQA A;  1ZR4 A;  3PPB A;  1VND A;  1NK2 P;  1JT0 A;  2L9R A;  4AYB N;  2HDD A;  1JUS A;  1F36 A;  1Z0X A;  1TWF J;  4XK4 A;  3IH3 A;  3O60 A;  2JA7 J;  2QWT A;  2VPR A;  1ZTR A;  3MNL A;  5IYC J;  1XG1 A;  1TC3 C;  3B6C A;  1RET A;  2OF7 A;  3ZQF A;  3HTA A;  3BR6 A;  2ECB A;  3TED A;  5JLW A;  3C2B A;  2F07 A;  2JMW A;  2HOS A;  2DMQ A;  2R5Z B;  1IC8 A;  1DU6 A;  1RPW A;  3C07 A;  3VIB A;  3BR1 A;  2HQ5 A;  2X9D A;  1P7I A;  3VOX A;  4JP0 A;  4L62 A;  3HE0 A;  2CJJ A;  3NAR A;  1D5Y A;  4BXX J;  3FKI J;  4G12 A;  4D5C A;  1MH4 A;  4BBR J;  3BCG A;  4I76 A;  3HM5 A;  2JA5 J;  3T6N A;  2EH3 A;  5E3O A;  2JA6 J;  1JJ6 C;  4C2M J;  1X2M A;  5E3M A;  1JKO C;  4MXM A;  3M3Y J;  4AUX A;  2G7G A;  3VUQ A;  3JRF A;  2CRG A;  4W1U A;  2YS9 A;  1AKH A;  2W53 A;  3IH2 A;  5IYD J;  2PBX A;  5F0H A;  5JLX A;  1MH3 A;  2M0C A;  2UXU A;  3WHB A;  1W0T A;  2ZCM A;  3P9T A;  2GEN A;  3QKX A;  1G2H A;  1WCM J;  2IEK A;  1SFO J;  1MSF C;  2E2I J;  1FEX A;  1EF4 A;  1TWH J;  2O7T A;  2YVH A;  1B72 A;  3E7Q A;  1H89 C;  3JRB A;  4D7M A;  2HOT A;  2G0E A;  3HKZ N;  1LFB A;  4MFE A;  5IPA A;  4IHW A;  3A03 A;  3IH4 A;  3EGQ A;  2Y0S N;  2LTP A;  3HGG A;  2G3B A;  2L7M P;  3B6A A;  3BQY A;  4W97 A;  2LFB A;  3CRJ A;  2ME6 A;  2B63 J;  3GEU A;  3G1L A;  2D6Y A;  2LLK A;  1UI5 A;  3LHQ A;  3VVX A;  2W48 A;  4IHV A;  3VW0 A;  3HIM A;  4HKU A;  3BTL A;  2FX0 A;  1NK3 P;  3B81 A;  3QBM A;  5C44 J;  1GUU A;  2GBY A;  4AF5 A;  2XB5 A;  4FE4 A;  3IUV A;  4A69 C;  3PO3 J;  3LSR A;  2HOA A;  2WB1 N;  5EZH A;  3NRG A;  3A01 A;  3SDG A;  5FLM J;  2FBQ A;  2H1K A;  1ZGW A;  5D1R A;  3E7L A;  2OER A;  3PAS A;  3BTI A;  2DMT A;  2MGQ A;  4XRS A;  4RDU A;  5GPA A;  2KT0 A;  2M34 A;  3S2H J;  3HTJ A;  4A3L J;  2KDZ A;  4AC0 A;  1K83 J;  2WGB A;  1ENH A;  2E2H J;  2R0Q C;  2GM4 A;  3BRU A;  1SGM A;  2QF7 A;  3HGY A;  3HDD A;  3TW6 A;  3S15 J;  1HDD C;  1YRN B;  3LSG A;  2Y2Z A;  3WHC A;  1HCR A;  1FIA A;  1ETK A;  4JL3 A;  1WPK A;  3COL A;  2ID3 A;  3GBG A;  1RKW A;  4M3F A;  4MLO A;  5C4X J;  2ME0 A;  3Q0U A;  2EZL A;  3S1M J;  4FTH A;  1WGX A;  4FE7 A;  2G7S A;  2FJ1 A;  3RD3 A;  3NAU A;  4XRS G;  3LJL A;  2O9L A;  1SAN A;  1JTX A;  5K58 A;  5C3E J;  5J1Y A;  5GPC A;  1JTY A;  3VOK A;  4B1R A;  2ID6 A;  1FIP A;  1BJZ A;  3K7A J;  1IDZ A;  3SFI A;  3GTP J;  4ME9 A;  3CCY A;  5J3L A;  4J19 A;  4A3B J;  3JRA A;  3W6V A;  4A3K J;  3F1B A;  1RKT A;  2N8G A;  2XPV A;  4GFL A;  1ZQ3 P;  3VW1 A;  3F0C A;  1WH7 A;  1IDY A;  2UXP A;  3FK6 A;  2UXH A;  3LSJ A;  2TCT A;  4QSH A;  3ZQL A;  2LD5 A;  1QVU A;  1A5J A;  4CYC A;  5EF6 A;  3GTJ J;  2NVX J;  3KKD A;  5F27 A;  1B8I B;  3HOU J;  3GZI A;  1PUF B;  5IYB J;  1IGN A;  3A02 A;  1T56 A;  2PMZ N;  3BG3 A;  2PZ9 A;  3Q3S A;  2VKV A;  5M3F J;  2DA7 A;  2DA1 A;  1LE8 B;  2Q24 A;  1WI3 A;  1W0U A;  5CW8 A;  1XC5 A;  1VF9 A;  4JX5 A;  3ZQI A;  5D19 A;  2XRL A;  1ETY A;  2DN0 A;  4Y7N J;  5FKL A;  3GTL J;  2GLO A;  4DYQ A;  3LOC A;  5M5W J;  2MG4 A;  4ICH A;  3FK7 A;  4A3D J;  2LR8 A;  2HYT A;  1LFU P;  1AHD P;  4M3D A;  1ZR2 A;  1A6I A;  1GV2 A;  2DA4 A;  3BG5 A;  5EYR A;  1TWA J;  2GUH A;  5BNG A;  4QTR A;  3MKL A;  4ACI A;  3OOU A;  3RH2 A;  5F0F A;  1JGG A;  2JN6 A;  4FCY A;  2NVQ J;  1P7J A;  3S2D J;  3GTQ J;  3QPL A;  1HLV A;  2HI3 A;  1F43 A;  1CQT A;  1FJL A;  3VVY A;  4GCK A;  3JSJ A;  3BTJ A;  3VW2 A;  3UKG A;  1XS9 A;  4C3J J;  2NOG A;  2REK A;  3G1M A;  2XSD C;  5E3L A;  3O8H A;  2DA3 A;  1U8B A;  1QRY A;  1IV6 A;  2FQ4 A;  3S5R A;  2RAS A;  3G56 A;  4MFD A;  1ORK A;  2QOP A;  2IAI A;  4NN1 A;  5EEA A;  2RHA A;  3IV5 A;  4GCT A;  2M8G X;  3PM1 A;  4A3C J;  3HBL A;  2AO9 A;  1BL0 A;  2CU7 A;  4I6Z A;  4V2F A;  2XGE A;  5GP9 A;  1FTZ A;  2ZOY A;  2TRT A;  1ETQ A;  3HB9 A;  5F04 A;  2Y31 A;  2QTQ A;  2DA5 A;  1U78 A;  3CWR A;  3JRI A;  5F08 A;  5FHP A;  5EGO A;  1TWG J;  2JK3 A;  5M3M J;  2NP5 A;  3BQZ A;  2Y9Z A;  2XDN A;  1ITY A;  2VUM J;  1UG2 A;  1I50 J;  3OSG A;  3RKQ A;  1TWC J;  4B4C A;  5HAW A;  3DPJ A;  1IUF A;  4DZP A;  1ZKG A;  2NVY J;  5J1R A;  2XB0 X;  4IEJ A;  3D1N I;  1DU0 A;  1OCT C;  2YU9 J;  1I3Q J;  3ZOB A;  2OPT A;  2X6O A;  1AKH B;  1AU7 A;  4BY1 J;  2GFN A;  1X2N A;  9ANT A;  2WUI A;  2MW8 A;  5IP9 J;  4L5E A;  1OCP A;  3NXC A;  2NP3 A;  5AQC A;  1HOM A;  2ELK A;  3H0G J;  2NX4 A;  5EG0 B;  2R5Z A;  3NI7 A;  2JA8 J;  1H8A C;  3S14 J;  4C3H J;  5D18 A;  1RR7 A;  1B72 B;  3GTK J;  3HOY J;  2ZCN A;  3BR3 A;  3RQI A;  2DMP A;  1MBF A;  2QKO A;  1B8I A;  2H8R A;  4JKZ A;  4FIS A;  3S1N J;  1JKR C;  2O8K A;  3HOV J;  2K40 A;  2ZB9 A;  3CMY A;  3JRD A;  3LSP A;  3OIO A;  1GV5 A;  5IOZ A;  2DMU A;  3HOX J;  2M9H A;  2NS8 A;  1LE8 A;  4GFK A;  2LVS A;  5C4Y A;  5K7Z A;  2EZI A;  5IP6 A;  3H3V K;  1BW5 A;  3AQT A;  1GDT A;  3CJD A;  1I6H J;  3EUP A;  1QVT A;  4D5F A;  1VFC A;  5F0C A;  4MK6 A;  5FGL A;  3GTM J;  3HOZ J;  2M2E A;  2EZK A;  1X58 A;  1T33 A;  2LK2 A;  5M5X J;  1GVD A;  4IHY A;  5EDN A;  2L7Z A;  1MBE A;  1Y1V J;  4S0H B;  4IHX A;  1HDP A;  1MBG A;  4XID A;  1O4X A;  5FMP A;  2CQQ A;  2RAE A;  3CDL A;  3VVZ A;  3NPI A;  5H9T A;  3A01 B;  3L1P A;  4UUS B;  2CQX A;  2LY9 A;  4B3A A;  4A3I J;  4BY7 J;  5EZG A;  1U9N A;  3BTC A;  1OJL A;  2VKE A;  4UUT A;  3MVP A;  3V78 A;  3FIS A;  4DYC A;  3MN2 A;  4HNV A;  2UXI A;  3I4N J;  2IU5 A;  5FKO A;  1MSE C;  1ETO A;  4A3M J;  3GTG J;  2DG8 A;  1MBH A;  1UMQ A;  5CXG A;  2R92 J;  2DTZ A;  1JKP C;  2E19 A;  2LKX A;  1IJW C;  2ZOZ A;  3ON4 A;  2V57 A;  3BG9 A;  3HTH A;  4KWA A;  2COB A;  5C4J J;  1QPI A;  3JRG A;  4Y52 J;  2R5Y B;  1K61 A;  2FD5 A;  3PO2 J;  2K9S A;  4M3B A;  3NNR A;  2X48 A;  2LP0 A;  2DJN A;  2Y9Y A;  4MIM A;  4YZE A;  5DAJ A;  4AC6 A;  4GFB A;  2CUE A;  1JUM A;  4M6V A;  4JNN A;  4A3E J;  2R93 J;  4JX4 A;  4BBS J;  5HOD A;  2R7Z J;  3RZO J;  4A3G J;  3DEW A;  2OI8 A;  3BT9 A;  4X6A J;  3G1O A;  3BJB A;  2EBI A;  4V2G A;  2QIB A;  1GT0 C;  2DMN A;  4CGR A;  4MO7 A;  2UXO A;  1JUP A;  1MBJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...