2IBDA

Crystal structure of probable transcriptional regulatory protein rha5900
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
192
structure length
192
Chain Sequence
GKSGRRTELLDIAATLFAERGLRATTVRDIADAAGILSGSLYHHFDSKESMVDEILRGFLDDLFGKYREIVASGLDSRATLEALVTTSYEAIDASHSAVAIYQDEVKHLVANERFTYLSELNTEFRELWMGVLEAGVKDGSFRSDIDVELAFRFLRDTAWVAVRWYRPGGSVTVDTVAKQYLSIVLDGLASP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Possible transcriptional regulator
publication title Crystal structure of Probable transcriptional regulatory protein RHA5900
rcsb
source organism Rhodococcus sp.
molecule tags Structural genomics, unknown function
total genus 72
structure length 192
sequence length 192
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17932 TetR_C_24 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2ibdA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2ibdA02
4DZPA 3UKGA 1NK3P 1QVUA 3BJBA 3PM1A 5C44J 2DG8A 2EZIA 1FIAA 1VNDA 3HEFA 2H1KA 2UXUA 3E7QA 4BBRJ 3JRDA 3Q3SA 3AQTA 2ME0A 1IV6A 3GTOJ 2L7MP 3ZQIA 3RH2A 2LKXA 1Z77A 3OSFA 2JK3A 1GVDA 1APLC 1FEXA 2NP3A 5EZHA 2QIBA 2K9QA 4I6ZA 1VF9A 1TWAJ 2ZCNA 3JSJA 4QSHA 2XRLA 5C4JJ 3LSJA 3GTQJ 4GCKA 3S1NJ 2R7ZJ 4A3MJ 3OOUA 1W0UA 5HBUA 1RR7A 1Y1WJ 3G1LA 2QKOA 4B4CA 4IHYA 2NVQJ 2M34A 5DAJA 3HGGA 1AKHB 2EZKA 4M3BA 2YVHA 2KT0A 5EZGA 1ETYA 1LE8B 1JUMA 5EGOB 3JRFA 2UXOA 1B72B 3GTLJ 4GFKA 3HE0A 2F07A 3VOXA 1NTCA 2PZ9A 4CGRA 2EBIA 2L0KA 2X48A 2X6OA 1CQTA 2GBYA 1A6IA 5BNGA 2G7LA 1HDDC 3A01B 1SFOJ 5FKLA 1FTTA 3VW2A 1Z0XA 4QIWN 1MBHA 1UMQA 3AQSA 5IP9J 3KKCA 3H0GJ 4V2GA 3VOKA 3K7AJ 4DZJA 5E3MA 1OCTC 4FCYA 3GZIA 1POGA 3HTAA 2EH3A 2GUHA 3BQYA 2UXHA 3NI7A 1TC3C 3QKXA 2LFBA 5FKNA 3FRQA 3NNRA 2P81A 3ON2A 1RPWA 2H8RA 2G3BA 1R9TJ 2CU7A 2YUSA 5M3FJ 3JRAA 1WPKA 1GT0C 3LJLA 2Y0SN 5F27A 1JKPC 1WH7A 3QBMA 3GTMJ 5IYBJ 2LP0A 5EYRA 2HDDA 3S17J 2M8GX 3IH2A 2LR8A 1MSEC 4M3DA 1ZK8A 3HM5A 3B6CA 2CRGA 2L9RA 2R5ZA 4IHWA 3BTJA 1LFUP 2O8KA 3QPLA 3HGYA 2XPVA 5F1JA 4MIMA 1VI0A 2XPUA 3IH4A 3GTJJ 3LSRA 2VPRA 4FE4A 3NPIA 3BG9A 3M4OJ 3HOZJ 2LK2A 1IDYA 4FISA 4IHXA 3Q0WA 5FJ8J 5CW8A 3TW7A 4C3IJ 1F36A 3KZ9A 4X6AJ 2DMTA 1QRYA 1UI6A 2LD5A 1FJLA 2G7SA 3QPSA 3TEDA 3OSGA 2N8GA 1A5JA 2ZOYA 3T6NA 1H88C 3G1MA 2AO9A 3BR2A 4M3EA 4JKZA 2K9NA 2AHQA 2D5VA 3PPBA 2YS9A 2R93J 2K9SA 2DA5A 2Q24A 3F1BA 4A69C 2G7GA 3HOUJ 1QVTA 4X1EA 4L62A 2L7FP 3B6AA 1B8IB 1ETQA 2JMWA 3RD3A 4CYCB 4M6VA 1JKRC 3O8HA 3RZOJ 5FLMJ 3KNWA 2E19A 5CXGA 1XS9A 3HIMA 3HTIA 4ABZA 1ORKA 1MH3A 5IOYA 1H8AC 1X2NA 2V57A 2HOAA 5FMPA 1UHSA 1I50J 2HOSA 3IV5A 3M3YJ 1EF4A 2W48A 4JL3A 5DTDA 3EUPA 3Q0VA 1HCRA 3D1NI 3DPJA 1JJ8C 3BTCA 1ETOA 5J3LA 5IYDJ 4GCTA 4I76A 2PMZN 4AUXA 3JRCA 1BL0A 3JRGA 2QOPA 3BTLA 2LLKA 1U78A 3G56A 1MH4A 1ENHA 1OJLA 3NARA 3BTIA 2XPWA 1D5YA 3ZQFA 2Y2ZA 3NXCA 4UUSA 2WUIA 2RASA 1T56A 3VW0A 2JA5J 2L7ZA 5D1RA 4YZEA 3NAUA 1U9NA 3S15J 5HODA 3WHBA 5J1RA 2MGQA 4FE7A 1RESA 9ANTA 1ZGWA 2DMUA 2TRTA 3S5RA 5EG0A 4J19A 5K7ZA 4JP0A 2JJ7A 3FKIJ 3CMYA 1JKQC 5E3NA 4AC0A 3VP5A 3BG3A 2DA4A 2M9HA 4B1RA 1P7IA 3COLA 3FIWA 3CQZJ 2E1OA 1GV5A 1UG2A 5F0FA 3C07A 3KKDA 5FKKA 2K40A 2DMNA 4MFEA 3ZQCA 5FLVA 3QQAA 2JA8J 3BRUA 1PUFA 3HB9A 2HOTA 3I4NJ 1JGGA 2XDNA 2ID6A 1U8BA 4GCLA 3VVYA 3MN2A 1BW6A 1FTZA 1MNMC 2CJJA 1I6HJ 3EGQA 3HOYJ 1SANA 4FTHA 4JNNA 2QWTA 2HXIA 3BR5A 2RAEA 3JRBA 4DYQA 3ZOBA 2R5YB 2E2JJ 1ZQ3P 2KDZA 4XRSG 1K83J 2JWTA 4A3IJ 2R0QC 4MXMA 2I10A 3MVPA 5GPCA 3W6VA 1MBEA 5IPAA 2WGBA 1BA5A 3P9TA 3LWJA 1IGNA 4IHVA 1RETA 2O7OA 2XB0X 2ECCA 2JA6J 4A3BJ 3GEUA 4UUTA 3FISA 4ICHA 3HOVJ 3BR3A 2E2IJ 2DMQA 2DMPA 2NS7A 2LTPA 5J1UA 5FKMA 3ZQGA 3GTPJ 2DJNA 4M3GA 3RZDJ 2D6YA 5C3EJ 2DA6A 3BQZA 3RKQA 1JTXA 4A3EJ 5FKOA 4A3FJ 3HOXJ 2W53A 1O4XA 2ELKA 2O9LA 1JJ6C 1AKHA 1JT6A 2CQQA 2XGCA 1JUPA 3E7LA 3HBLA 3A03A 3Q0UA 1LE8A 1DU0A 1ZTRA 2ZB9A 4XK4A 1TWFJ 5EGOA 1UI5A 1AU7A 1B72A 2ID3A 1IG7A 5M5YJ 4B3AA 3S16J 4AF5A 5F04A 2WV1A 3CDLA 4C3HJ 2ME6A 5HAWA 3A01A 4A3JJ 2QCOA 3MNLA 3HOWJ 3G1OA 3O8GA 4QTRA 1OCPA 2M0CA 4JX5A 2XGEA 3C2BA 4V2FA 2CUFA 4Y52J 1S7EA 2OERA 1WGXA 2QF7A 2VI6A 2GFNA 3VVXA 1W0TA 1BJZA 1X58A 1DU6A 3S14J 3S1MJ 3S2HJ 5FGLA 4A3DJ 3CRJA 2UXIA 4AC6A 2FD5A 3DEWA 4RBOA 4G12A 1U9OA 2IBDA 4ME9A 1NK2P 5IYCJ 5JLXA 5IP7J 1HDPA 1ZR4A 4DYCA 4EEFG 2DG7A 5EFYA 2ZCMA 5D18A 2DA3A 4A3CJ 1K61A 1GV2A 5GPAA 3SJMA 2FQ4A 4D5CA 4BXXJ 4M3FA 1RKTA 1MBJA 3CJDA 3V6GA 2IEKA 2NVYJ 2DN0A 4XICA 3GTKJ 2ECBA 1VFCA 5M3MJ 2QTQA 1JUSA 2OPTA 1WH5A 4MO7A 1YRNB 1IUFA 5H9TA 1Y1VJ 2XB5A 2RHAA 5HSZA 3OIOA 1Q1VA 2HQ5A 5IOZA 4C2MJ 1WI3A 3WHCA 5K7HA 4BY7J 2OF7A 3A02A 3VW1A 3LOCA 4GFLA 1HOMA 3VUQA 1JT0A 1ETWA 1WCMJ 1AHDP 1ZKGA 2NVTJ 1T33A 3LSPA 2HI3A 2DA1A 2Y9YA 1G2HA 2VUMJ 1B8IA 2GM4A 1ETKA 2EZHA 4CYCA 2NX4A 3VIBA 5J1YA 1JKOC 1MSFC 2FX0A 4D7MA 2OI8A 4Y7NJ 1MBFA 1IJWC 3B81A 3PO3J 4NN1A 1MBKA 4NDLA 5EF6A 1QPIA 3LHQA 3JR9A 5C4YA 2R5ZB 3PASA 2NS8A 5GP9A 4A93J 1XC5A 3S2DJ 3ON4A 1FIPA 3HTJA 4DW6A 3TW6A 2MG4A 4A3KJ 3HTHA 3FK6A 2DTZA 1IC8A 5JLWA 2GENA 3GBGA 2GLOA 4A3GJ 4AYBN 4BY1J 3ANGA 2JN6A 1RKWA 3LSGA 2NVXJ 3H3VK 1E3OC 3RQIA 1YRNA 5E3LA 4IEJA 4BKXA 4S0HB 4W1UA 1HF0A 4JYKA 3BG5A 2HYJA 4NELA 2JA7J 2YVEA 5CXIA 3TP3A 5DS9A 1XG1A 4JX6A 3VPRA 4MFDA 5K58A 2FJ1A 2E2HJ 3TP0A 1HLVA 2XGDA 1I3QJ 4HKUA 2HKUA 2O7TA 3V78A 2ZOZA 1BW5A 3K2AA 4MLOA 1LFBA 1MBGA 5M5WJ 2FBQA 2HYTA 1ITYA 5IP6A 3SFIA 2Y30A 4LOCA 2IU5A 5F0HA 2TCTA 2WAQN 2VKEA 2LY9A 5F0CA 1TWHJ 4PXIA 2VKVA 2LVSA 5K7FA 4C3JJ 2XSDC 3BR6A 1ZR2A 2X9DA 3JRHA 2REKA 3IUVA 1IDZA 2PBXA 5F08A 4D5FA 4ACIA 2DA2A 4RDUA 3BR0A 3NRGA 3HKZN 5EDNA 3BHQA 1JTYA 3BT9A 3BR1A 2CQXA 1ETXA 2Y31A 2EZLA 1X2MA 4DYRA 2R5YA 1GUUA 2HXOA 3SDGA 1TWCJ 3L1PA 2YU9J 3HDDA 2COBA 4UUSB 5D19A 4HNVA 1OFCX 2MW8A 2CUEA 3I4MJ 4UDSA 2R92J 3JRIA 3GTGJ 2UXPA 4D7NA 3F0CA 3S1QJ 3CCYA 5AQCA 3LNQA 4W97A 2MSYA 3G7RA 3IH3A 4BBSJ 4MK6A 2M2EA 5EG0B 5FHPA 3O60A 5E3OA 2IAIA 4L5EA 3ZQLA 3BCGA 3VVZA 4XRSA 1P7JA 2Y9ZA 3DCFA 5EEAA 4A3LJ 5C4XJ 1IRZA 2NP5A 1GDTA 4GFBA 2NOGA 2EQRA 3MKLA 5M5XJ 3CWRA 2B63J 1PUFB 2DA7A 3S1RJ 3BNIA 1F43A 3ZQHA 1H89C 3PO2J 2ZCXA 2G0EA 1TWGJ 1ETVA 2WB1N 3JREA 1SGMA 4JX4A 4XRMA 4XIDA 4KWAA 3ANPA 3FK7A
chains in the Genus database with same CATH superfamily
2RKHA 1QNTA 4DZPA 3UKGA 1EKEA 3PM1A 5C44J 2LG4A 1V54H 2A68F 2DG8A 3RYPA 1VNDA 2H1KA 2JUGA 2X0LA 3AQTA 3FXOA 3O6BB 4BL0B 3ZQIA 1IV6A 1FPQA 3CMMA 2JK3A 2DI3A 4UXNA 2ZMEA 1FEXA 5JVGF 3EQLF 5EZHA 4C2TA 1FNNA 2HFHA 2ZCNA 3I59A 2R3SA 2BY1A 3E6MA 4QSHA 3SZTA 5C4JJ 2Q0OA 4L0YB 1BBYA 3GTQJ 4GCKA 3DFGA 5ILVA 2Z1DA 5LD2C 1U2WA 4A3MJ 2GZWA 3MMYB 1CGPA 4IQ4A 2ZC2A 2VT2A 2M34A 2G7UA 2F5CA 3HGGA 2F4OB 4HSTA 1AKHB 1GHCA 4GO1A 1ZN2A 2KT0A 5EZGA 1LE8B 3JRFA 2UXOA 3GTLJ 1NTCA 2PZ9A 2FOWA 2X48A 2I5UA 2X6OA 2PI0A 2Z3YA 2KRFA 3PIOF 1DGRM 3IAS2 2EV0A 5L3CA 3A01B 3A2KA 1I3AA 2VXZA 5KK1A 3K9TA 4QIWN 2CUJA 2CV1A 5TJJA 1O3RA 4XLCA 2DODA 1UHWA 4MGRA 3KKCA 4V2GA 4DZJA 1I39A 4XBFA 2R7FA 4AIJA 3HTAA 2L3DA 2ZNZA 4LB6B 2EH3A 3H5NA 3IRRA 2UXHA 3U2RA 3DQVC 2LREA 3NNRA 1RPWA 3I56I 2ZXHA 1R9TJ 1OR7C 2CU7A 1WI9A 3QBMA 4ON0A 3N97A 1AWCA 3GTMJ 4A2UA 4BE2A 2HDDA 3S17J 3AL0C 2DTRA 1F9NA 3JAMZ 1ZK8A 3HM5A 4KYWA 2C6YA 2F4MB 4AVPA 1YFHA 2GXGA 3BTJA 1LFUP 3LA3A 4CCOA 2O8KA 3QPLA 2NAZA 3WG9A 2IGNA 2QBYA 3M7GA 5H6QA 3EDPA 1YW8A 1VI0A 5J4YA 5TISC 1MMAA 3NPIA 4D0PA 2QSHX 2LK2A 3BZKA 5CKTA 3PFIA 1MKMA 3Q0WA 4CO8A 3K6GA 3TW7A 1R1VA 4C3IJ 1F5TA 2DMTA 3PSFA 1TT5B 1QRYA 3AG2H 5J6XA 4WWCA 3TEDA 3OSGA 1A5JA 2N8GA 3K69A 3K4LA 3T6NA 3ZXSA 2HR3A 4XKCA 2AO9A 4IKFA 4BQOA 2ACJA 4A5NA 2K9NA 1LEAA 2YS9A 3ULQB 4HAMA 4GYIA 5HDNA 2DA5A 1TNTA 2Q24A 3RJPA 4P5OA 3WG7H 1YIJI 4X1EA 3B6AA 2P5KA 4LIUA 4XOPA 1B8IB 2JMWA 2NRAC 2V9PA 4I99C 2VN2A 3RZOJ 3P9CA 5FLMJ 3KNWA 1VQ8I 3JTHA 1XS9A 1U5TB 2XRNA 3LSHA 1ORKA 1MH3A 1TQIA 3SZGA 4ABZA 3WTSC 2P6SA 1H8AC 4TV7A 2HOSA 2KZVA 2F5DA 3KEYA 2GAUA 4LD5A 5DTDA 5HS9A 4F7ZA 1YW7A 1HCRA 1SVMA 3D1NI 3CCJI 3HRTA 4XKVA 3BTCA 5IYDJ 4IOAF 2R7UA 3E6CC 4AUXA 3JRCA 1YO5C 1BL0A 3L2QA 1K78A 1RUOA 1MGTA 4IO9F 2BHYA 3QU3A 2QEXI 1U78A 2EIJH 5KAFC 5DD8A 1U5TC 3NARA 1WJEA 3BTIA 4ASNA 1W7PA 1VTNC 2WUIA 3OWTA 2JA5J 1T2KA 3J7ZI 4UVCA 3K8PC 4ZH4F 4RS8A 2DPUA 4LG0B 3S15J 4BE0A 5HNFA 5HODA 4JK1X 4E7KA 4KISA 2DMUA 1O57A 2TRTA 3FM3A 3OR2C 4A6DA 2R4GA 3KP2A 3B02A 5K7ZA 4JP0A 4B48A 4BACA 4RB0A 3R60A 3FBIB 2D2WA 2VC0A 1KA8A 2BZTA 1YS7A 1S9HA 2EV6A 2G7HA 3FIWA 2E1OA 1GV5A 5F0FA 2IA2A 1DP7P 2K40A 3J80Z 5FLVA 1D1AA 4XLNF 4HLXA 2XUBA 3MD2A 3VOEA 5DM6F 3M8FA 5B3SH 1BW6A 1FTZA 4HPQA 3AG3H 1BIBA 2V26A 4M74A 2E60A 2P6TA 3DF8A 2RVCA 3DPTA 5CQEA 2CW0F 3BR5A 2QWWA 3KPHA 3H5AA 4EM0B 2H1LA 2PEXA 4G7ZF 2UV1A 1C0WA 3MVPA 3QP5A 3ECOA 3W6VA 5H20A 2IXSA 5HS8A 5IPAA 3H5RA 2ZJPF 1R23A 3L2WA 2E1CA 3J7YJ 2JA6J 1MMNA 4UUTA 2GQQA 4M6XA 5FFXA 2E2IJ 2DMQA 3HSRA 3KCCA 3ZQGA 3E6BA 4CDGA 4M9ZA 3RSNA 1DDNA 1CF7B 2EWNA 5C3EJ 1MDMB 2RC4A 3BQZA 3RKQA 2XGXA 4A3EJ 1XMKA 2W25A 2XAQA 3C2HA 3HOXJ 4IJAA 5DYMA 2FBIA 2PFBA 1JJ6C 2O9LA 2W85A 4NC8A 2CQQA 1ACIA 2OTJI 2ZB9A 4XK4A 4N9IA 4CXFA 3OMYA 4OINF 5BQTA 2ID3A 4RM3A 2IT0A 1ZRFA 1DGWY 4J00A 2WV1A 3CDLA 4FETA 2ME6A 3V7SA 1PYVA 1HW1A 3MNLA 3HOWJ 4QTRA 1RRJA 2M0CA 2R7SA 3RIRA 4YG2F 1QQIA 2CUFA 4LK1F 3VYTB 3WTTC 2X51A 3DTIA 2VI6A 3DLAA 2DOEA 1PJRA 3S2HJ 4IF4A 2FD5A 3A0BC 4RBOA 1SD4A 4HF1A 4AC6A 3ZGKA 2M8EA 1ON2A 3U21A 5JVTA 2LDUA 5HNHA 2ZFWA 1NK2P 4GYGA 1ZR4A 5E8IA 2HDWA 2VJJA 1DP3A 3RPUD 2FXAA 1FBUA 1D5VA 5EFYA 4B09A 2M4GA 4BGDA 2ZSIB 3HHHA 1ZAOA 3DBHB 3WU1B 4BJTA 4UB6C 4WIBA 2RGVA 4EJOA 4BXXJ 4M3FA 2QVOA 2Y69H 3S3NA 3BC8A 2K3PA 2EA4A 2DN0A 4LMYA 5DCFA 3TQNA 2KRCA 2OPTA 2R7DA 1IUFA 4ESFA 4EJUA 1A36A 3CD6I 4OWRB 1UCRA 3OIOA 2B1EA 4XLHA 2BYVE 1UJ8A 1SC7A 4XL9A 2VPLA 3PNTA 2OF7A 3A02A 1V5EA 3P9IA 3LFUA 5FFZA 3VUQA 1AHDP 1PUEE 3OYBA 4U0WA 1JI8A 1FOXA 4S04A 3TKYA 4MHGA 4RGUA 3DBRB 2VUMJ 3ERMA 4ESBA 2GM4A 1PP8F 2EZHA 2R7QA 2HVSA 2NX4A 3CJNA 3QYEA 1XGMA 5E17F 2E7WA 4JOMA 2OU2A 1OYYA 4M73A 1IJWC 3H35A 3ASNH 3B81A 4YIFA 4NN1A 1MBKA 3J81Z 2K5CA 3PASA 4MNUA 3L9FA 5E8GA 3W6KB 1XC5A 1X19A 1FIPA 1I5ZA 3F8FA 3TW6A 3HTHA 3NWSA 3AG4H 4E7ZA 4BEHA 2E7XA 2L54A 2GLOA 1WJCA 1XDUA 2Z9OA 5B66C 2JRMA 4BY1J 4I09A 3U1KA 4BXFA 1BIAA 2NVXJ 2Y0SA 2X85A 3K4MA 4M72A 5TRDA 1E3OC 2P7CB 3BCAA 4CZZA 4RB2C 3RDIA 1HF0A 1X4OA 3BG5A 1XGNA 4NELA 2DFIA 3MZHA 2JA7J 3HKZA 3G6EI 3TP3A 3GCMA 5DS9A 1RI7A 2YVEA 2A6EF 5K58A 1I3QJ 2X1DA 4D1QA 2V9KA 4HKUA 4KUMA 1HKQA 3CUOA 3N4MA 3C3WA 6PAXA 3E5UA 5D8LB 3I54A 1T38A 4XKWA 2BHZA 5CVJA 2FBQA 2HYTA 2QQAA 3AKZA 2PFVA 3FXKA 5LEJA 2DYRH 4NBQA 4Y33A 5F0HA 2TCTA 2WAQN 4O3MA 5F0CA 1HC8A 5ICFA 2HGCA 4IL6C 4E6KG 2UUZA 5K7FA 1WVRA 1MW7A 2XSDC 1ZR2A 2AXTC 2K9LA 4OMZA 4B44A 3BG7A 4LFUA 5ILUA 1OYIA 3HG9A 5LHIA 2PN6A 4LK0F 1JTYA 1YTYA 1PDNC 2H6CA 3BR1A 3HSFA 3TBIA 1TW3A 2OV7A 3CCSI 4ITVA 3W3CA 3VFZA 2BVMA 1SD6A 1WJFA 1I1GA 3BDDA 4Z6YA 4WCGA 3OYGA 2M4KA 3HDDA 3PFYA 1SFUA 3OYIA 3LFKA 2P0WA 2HKOA 2LY2A 2MW8A 4HNVA 4UDSA 2R92J 3KP7A 3GX4X 1J59A 3QAHA 3RQ4A 4U0YA 4NQWB 4D7NA 2ZXIA 2R7OA 3BROA 2F5VA 2K3FA 4EJWA 4O5VA 3DPLC 5IY5H 1IRGA 2MSYA 3G7RA 3IH3A 3IUOA 2WB1A 3LQRA 4XRFA 5E3OA 4U9LA 3AG1H 1IW7F 1IXCA 1ZGAA 4ZYEA 3RI4A 4ZYHA 3BCGA 5FLXZ 1P7JA 2X6XA 4CSWA 5EEAA 4HBLA 1FP1D 4I01A 1IRZA 1GDTA 1WFXA 4G8XA 3MKLA 5M5XJ 1ONVA 2H27A 3CWRA 1Y0UA 3COAC 1MNDA 1TBXA 5K1YA 1PUFB 4IRIA 3BNIA 5E79C 1WWXA 2FMYA 2M87A 2ZXWH 4PCQA 1K6YA 4HX8A 2CO5A 1MJAA 1K7AA 4Q5SF 1S3JA 4CZCA 4CH7A 3GW2A 5ILSA 1TWGJ 5L3BA 3ZR8X 2WC2A 5KHDA 3F8NA 2MYSA 4KWAA 3ANPA 2MLGA 2LBFA 3FZVA 2BW3B 2HYGD 3S2WA 4F91B 2EZIA 3AAFA 3FXRA 4BHCA 3V42A 3Q3SA 1WZ2A 2L7MP 2JT1A 1Z77A 2A3SA 3OYKA 2ZKZA 4JQFA 2NP3A 1OMIA 1OPCA 2H8WA 2IW5A 1VF9A 1TWAJ 4HQMA 3MKZA 3PIPF 2BXYA 3TDUC 3FMRA 4IX7A 5D5VB 3OYNA 3PNYA 2R7ZJ 1R6RA 3IAM2 1RR7A 2B7EA 2NOJB 1Y1WJ 1YYVA 3G1LA 2QKOA 1J75A 4B4CA 1D0XA 3F8CA 2EZKA 5LBQA 5D6EA 2EFOA 2XHKA 2OBPA 1V3FA 5EGOB 2JUCA 2QA4I 3GLLA 4CGRA 1IN7A 2BBYA 1CQTA 2FRHA 2GBYA 2KMUA 3BOQA 2G7LA 4RMNA 1Z0XA 2JVGA 2Q2EB 3D5SC 3QRFF 1IRXA 1MBHA 1R49A 3AQSA 5IP9J 3H0GJ 2W57A 3U1DA 4L9TA 3NRVA 4EGYA 4FX4A 5E3MA 4FCYA 1QU3A 1B9MA 2YPRA 1POGA 2FE3A 2E5ZA 2WY7Q 4HA8A 2STWA 4HX7A 5H6RA 4FASD 4OIQF 5DCMB 5LGNA 3QKXA 3HOSA 2P81A 3BG6A 5CVRA 3CDIA 5M3FJ 1W1WE 4QPQA 3PQKA 1JKPC 5ED4A 3RKYA 2MABA 5IYBJ 2OUMA 2VC1A 1G3TA 3H3ZA 5EYRA 2XROA 2W82A 4HZFA 2G9WA 2LR8A 4KDPA 4M3DA 5HLTA 4CA0A 3B6CA 2CRGA 1YIOA 1R1UA 2L9RA 1FT9A 3JCUC 1Q1HA 2JQ7A 3CCLI 1YJ9I 4IHWA 1P4WA 2LY1A 5F1JA 2A6HF 1ZREA 3GTJJ 3DU6A 3JSOA 3LSRA 2HNHA 3J7AO 4FE4A 4YIIA 3M4OJ 2LF8A 2A05A 1IDYA 2RQPA 3SWHA 1IAWA 4FISA 3GVAA 2DFFA 1FYLA 2LYCA 4PJLA 3KZ9A 1U6GA 1B9NA 3FX3A 5DUKA 2EFNA 1FJLA 2G7SA 3GWZA 2M7BA 3H9GA 3GXOA 2K7LA 2V79A 2ICWG 2FQ3A 1NH3A 2E5NA 1FP2A 5D5XB 2H09A 3BR2A 2PQ8A 2FBHA 2AHQA 4GGGA 2D5VA 2EIMH 3F8BA 2R93J 1EA3A 4HDVA 3F1BA 2PMZA 4WXDA 1YG2A 3TMOA 4UY8I 4G9YA 4DGWB 2X6WA 2L7FP 1ETQA 4CYCB 5AIQA 1JKRC 3O8HA 5CYVA 2LRDA 4OU0A 4BS9A 5CXGA 1FMVA 3FMQA 1S72I 3KEQA 3HIMA 5IT9K 3R6SA 2HOAA 2HPIA 4RM2A 1I50J 3QYBA 5FMPA 3VB2A 2DDBA 3WTUC 3IV5A 3EYYA 1LKXA 2W48A 3HTUA 3EUPA 2ADUA 1FC3A 1SAXA 1JJ8C 1ETOA 4GCTA 2YU3A 3L2CA 1OCZH 2L2OA 2LLKA 1TTYA 3G56A 1W5TA 1OJLA 1B6AA 3VSLA 4XONA 5LHHA 1V55H 2IJLA 4RLFA 4YZEA 3NAUA 1U9NA 2K4JA 5J1RA 2KIMA 5HLGA 2JTVA 2O61A 1R5ID 5LHGA 5EG0A 3GZ6A 2RDPA 3FKIJ 3OYFA 1JKQC 3WGIA 4BJ5C 4XLFA 4AC0A 2PX9A 3VP5A 2DA4A 3FDYA 2ZFUA 3RYRA 2EFWA 3NEUA 1UG2A 2A69F 2DAOA 3OS0A 3KKDA 3A4CA 2DMNA 1KQ8A 1ZG3A 4MEYF 4MFEA 3ZQCA 2DOFA 3IP4B 5FO5A 2JA8J 3GZNB 2HOTA 4ZC3A 4GCLA 1U8BA 3GYHX 2HTSA 1ZARA 1L3LA 3ML6A 3MEXA 3RKWA 2GOXB 4QWQA 1KU3A 1SANA 1TQPA 4FTHA 2K85A 2QWTA 3AL0B 3JRBA 4ENNA 1T0FC 3ABLH 3ZOBA 2R5YB 5LEKA 5LGUA 2Z16A 3HZJA 2B9SA 4MXMA 2M5WA 2AXLA 1FOWA 1I6XA 4JBAA 5BMZA 2I8DA 3BZCA 5KVRA 2MA3A 1AA7A 3GUDA 1YLFA 4IHVA 2W84A 2PLYA 2HZDA 1T8IA 2XB0X 2DYSH 4OIPF 1Z1DA 2ECCA 3FWEA 4LG0A 2VOOA 3QP6A 4PK4A 3L00A 4KIBA 2ZNYA 3EUHC 3F3XA 2LC2A 3WGHA 5J1UA 4RAFA 3GTPJ 2V6EA 2DJNA 2D6YA 3RZDJ 3DU5A 4S05A 1X4PA 5E1WA 1R7JA 2VKDA 4CCJA 2VIXA 5E1XA 4BQQA 3ZMUA 1JT6A 1LVKA 4CUGA 4KIFA 2STTA 1LEBA 2F2EA 4OIOF 2PJRB 2OZ6A 1ZTRA 1TWFJ 4KMUX 2HEOA 2B3WA 4RGRA 3OYAA 1B72A 1XGOA 2VT3A 2ZJRF 3AFHA 5M5YJ 4WXHA 3S16J 4AF5A 1IV8A 5HAWA 2IP2A 2XKOA 4A3JJ 3QODA 2CW8A 2JRTA 1Y56A 2QCOA 1T08B 1ON1A 2P8TA 4RAYA 2VB6A 1OCPA 2XGEA 2CUZA 1DQUA 1E2XA 2XASA 1ZH5A 4Y52J 5DV5A 1WGXA 4Q47A 3CMAI 4NC6A 2GFNA 2KIQA 3ZMVA 2JA2A 2CS3A 1P9QC 4U9NA 2UXIA 3DEWA 2ZMEB 2BEOA 1U9OA 5BOXA 4R8HA 4ME9A 1X1DA 2UXNA 3U9GA 2HZTA 1TNSA 4R1HA 3SFZA 3D0SA 4DYCA 1R5HA 3ZP5A 3Q5FA 1CF7A 4EEFG 5JR3A 1X1BA 1B1BA 5K5OA 5D18A 1MDMA 2L01A 4A3CJ 1K61A 4HNTA 5GPAA 3SJMA 2DBBA 4D5CA 1RKTA 1UZCA 3V6GA 2IEKA 1J2XA 1EH7A 2ZMEC 2ECBA 1VFCA 2R7TA 1JUSA 4MO7A 5H9TA 1WKMA 4A12A 3GFIA 3CJQB 2WADA 2XB5A 5HSZA 3ZCOA 2BY2A 1VQOI 2W4SA 4CYDA 2RREA 1P92A 2MD0A 3CCMI 3ZPLA 1P4AA 1ZKGA 1UB9A 2KPMA 2ESHA 2V1DA 3KLNA 1UHMA 3KLOA 1MJBA 2COMA 3DWLE 1SVOA 3HUGB 3LMMA 1G59A 2LNBA 3H36A 3E5QA 1MSFC 2A6TA 3HPGA 2FA5A 1MBFA 1U0JA 1W7PD 2E36A 2DPDA 1B59A 4AIHA 4NDLA 5EF6A 1QPIA 1VQLI 1J9IA 3LHQA 4I2OA 5CJ9A 4IQJA 1S6LA 3I9V2 5ICCA 3HTJA 4DW6A 2MG4A 3OYMA 2QBYB 2DTZA 1HBXG 2GENA 4P1WA 1TQMA 1J0RA 2MD5A 4PGGA 1N25A 4AYBN 3BJOA 4L5IA 4HLYA 1RKWA 2JPBA 4IHSA 2PMHA 1HXDA 1G3SA 3H3VK 2EINH 3HJEA 4LGWA 1BR1A 2EPFA 2KDOA 4PJJA 3ZMSA 4IEJA 5AIPA 4WX9A 4EQQA 2HQAA 2DT5A 2KIFA 4G7HF 2HYJA 5CXIA 1XG1A 3VPRA 4MFDA 5J8FA 3HRUA 1HLVA 2XGDA 3M1CA 2EV5A 1LJ9A 2GA1A 1FYKA 2Q1ZB 2RNJA 5M5WJ 3CP2A 3K10A 3W2VA 2W00A 3FXUA 1ITYA 2Y30A 3FM5A 2VKEA 1KU9A 3P7NA 4PUSA 3I5UA 2LVSA 2J5OA 2P7VB 2BXZA 4L9NA 2EK5A 4Y3OA 3FXLA 3HL2A 3IUVA 4L18B 4J01A 5F08A 1BI0A 2R7XA 1VQ9I 3HKZN 5EDNA 3HRMA 4PGHA 1SFXA 2ZJQF 4ESJA 2FMLA 1YHQI 1QZEA 1K78B 1W4MA 3OIPA 3REOA 3PUBA 4PZJA 3VTIA 3MQ0A 1QPMA 4C30A 5BPDA 1W7PB 1VQ5I 5D19A 1ZG5A 2BOLA 4N0BA 4EMSA 3I4MJ 2HTJA 2IVMA 5L3DA 3JRIA 1O3SA 4E70A 4I02A 3ZN1A 2A07F 3S1QJ 3E0JB 3CCYA 3HTSB 3Q9VA 3LNQA 1PVEA 1T39A 3OYHA 4HRIA 3CO7C 5DD4A 4MK6A 1F1ZA 2CV0A 2DFEA 3S3MA 4L5EA 3KP3A 1O7LA 3OY9A 4XRSA 4RA2A 3PJRA 1TL8A 2NP5A 3DLLF 1RNLA 4GFBA 2K02A 1DUXC 3V7CA 2NOGA 2M3AA 2EQRA 3O2PE 4FHTA 4L0ZB 3LA7A 1R5GA 3CP8A 2LMDA 5H2FC 5FD6A 4Y13A 5F1RA 2R7WA 1RR8C 2DA7A 3TOAA 3S1RJ 2BV6A 2R7VA 3BPVA 4PJNA 4WXCA 2VQCA 3PO2J 4ZYDA 2OC6A 4XLEA 1XD7A 2ETHA 5D5UB 1XSDA 2WB1N 3M8JA 4JX4A 4DJAA 4XRMA 4XIDA 1FSEA 4BUPA 5J3LA 3NQOA 4UV8A 2LKPA 3WGGA 1NK3P 3EYIA 1TW2A 3SXYA 4HF2A 3HEFA 2A5WA 2XSJC 3E7QA 4CHUA 5CVVA 1LPQA 2ISZA 3JRDA 2DCEA 1O3QA 3RH2A 2LOOA 3ZMDA 2V1XA 2DT7B 1X1AA 1APLC 1KU7A 2RNGA 1YS6A 3JSJA 4HV6A 3LSJA 1XSXA 1KGSA 1R58A 2OZUA 3OOUA 2CYYA 3MWMA 2F5FA 4A6EA 1JHHA 2EFPA 2LKSA 3SDBA 5J8CA 1MMGA 2DQRA 2YX7A 1IN5A 1W5CC 4HOBA 2YVHA 2DFHA 2JSPA 1OQYA 3HPHA 3I55I 1JUMA 3ABUA 4XLPF 1J5YA 1FY7A 2Q8KA 2F4IA 5FD5A 4AU7A 2EBIA 2L0KA 3F22A 1LB2A 3A1YA 2O8XA 4IVNA 2V6CA 1SFOJ 3OV8A 1FTTA 4Y15A 3GZ5A 3HYIA 1BC7C 2GIZA 4LB5A 4DQ2A 2XKPA 3DTKA 2HWVA 1YE9A 3K4BA 1D8KA 1MZBA 1QHGA 3GMEA 2K4BA 4C2UA 2GUHA 2QLZA 3BQYA 1R1TA 4I0BA 3ZQQA 3F8MA 5FKNA 3KP5A 3K4NA 2H8RA 2TDXA 4FQGA 1LQ1A 1XCBA 1GT0C 2CV2A 3QYFA 2KHMA 2IGKA 4UUVA 2LP0A 3WTZA 4HYEA 3IHUA 4P9FA 1MSEC 3CTAA 4NB5A 2VJ4A 1FOKA 2RN7A 3LAPA 4BQAA 3LSIA 2R5ZA 4UVBA 3S32A 3HGYA 3LL7A 2XPVA 4NC7A 4MIMA 4U0VA 2XPUA 3IH4A 3ISPA 2VONA 2VPRA 2VE9A 2CFOA 3BG9A 2V1UA 2MH2A 4IHXA 4L5JA 4HX4A 5FJ8J 4N4OB 1F36A 1IZ1A 2WAEA 3CCUI 4AM3A 2HQRA 2OD5A 5E18F 1FOYA 1UI6A 3E6DA 4IXAA 1VQPI 1IN4A 2ZOYA 1KYZA 5HS7A 4RGSA 1X3WB 3F9KA 4M3EA 4ZDOA 1LNWA 1D0YA 3PPBA 2K9SA 4EM1A 5ICEA 2QSGX 1KONA 2G7GA 3HOUJ 2QKMB 1OCOH 1QVTA 2L7KA 3M07A 4OD5A 3CLOA 3KETA 3RD3A 1IUYA 4M6VA 2ZXJA 1Y8RB 2HU9A 5KAIC 2AS5F 5DCMA 3FXJA 1NG6A 5HLHA 4KT5C 2KL4A 2O5RA 2XAHA 3G2BA 5FRMA 1USTA 1REPC 1WJ5A 4KN7X 4UVAA 1X2NA 4ZDPA 2DQLA 4A5MA 2E1NA 2CQKA 3H9JA 4XNFA 2M1BA 1SFKA 5GADJ 2LH9A 3TOBA 4GCVA 4KITB 3F72A 3Q0VA 5D8KB 2LSOA 3MZYA 3W2WA 3DPJA 4A0YA 4KIGA 1XMXA 4BEHB 2XDVA 2PMZN 4CCLA 4BAYA 1XSVA 3BTLA 4KNYA 2JPCA 3GF2A 4BYYA 3ZMTA 1MH4A 3CUQA 2F6CA 4N9HA 2KRHA 2XPWA 3ZQFA 4ZZDA 2Y2ZA 4L9VA 1D5YA 4UUSA 3NXCA 4II3A 3VW0A 2L7ZA 5DUIA 1ZLKA 3OS1A 1ODDA 3WHBA 2MGQA 2BY0A 3NWTA 4UHTA 2LF7A 4XOTA 1MJ9A 1SEUA 1PP7U 1HKSA 4J19A 3GFLA 1P2FA 1Z9CA 1HA8A 3VDXA 2M9HA 3SEZA 1FMWA 5K5QA 3COLA 3C1DA 3CQZJ 1YITI 1XCVA 4ZYGA 3O3KA 1E0EA 2GA2A 4E7IA 2QUFA 3JSPA 1Z91A 4LITA 4LIVA 1IF1A 2A2FX 2XDNA 2ID6A 2HVRA 1N75A 2NVUB 3BY6A 3MN2A 5HLIA 4DIQA 1MNMC 2H94A 2MC3A 2CJJA 3EGQA 4K2EA 1ZELA 3SEQA 1LDKB 5A2QK 4JNNA 4BNCA 3TL4X 4AVZA 1QZYA 3VYRB 1H0MA 3R4KA 1SVLA 4IRGA 1G3WA 4XRSG 1K83J 2R0QC 2OCCH 2QYOA 5GPCA 3F6OA 1MBEA 3ABTA 4RB3C 1X3UA 2FEZA 4WK8F 4CICA 1IGNA 2VBZA 3PUFA 1VZ0A 1XN7A 2ELJA 4UV9A 3OR1C 1XMAA 2EFQA 4A3BJ 3FISA 3E5XA 2EJRA 1BOBA 2RQQA 5D4RA 2K86A 2QSFX 3IKTA 2LTPA 3BJAA 1DPRA 3T1BA 4IOCF 1GLNA 1WSUA 4M3GA 3CCRI 4XORA 2DK8A 1JTXA 5BPIA 1OCCH 1R36A 4A3FJ 3Q9SA 3ABKH 2KKOA 4M71A 5GTIC 2W53A 2VQGA 3ELKA 1O4XA 1IN8A 2FNPA 1AKHA 2CG4A 4XM3A 3E7LA 3HBLA 1LE8A 1DU0A 3KE2A 4PJMA 3A0HC 2P5LC 1UI5A 3MFKA 4AWXB 3LAJA 3MKYB 3OYCA 3QOPA 3DKWA 5LGTA 1IG7A 4B3AA 4C9YA 1ZRDA 2IGOA 1OR7A 4C3HJ 3A01A 3HRSA 2ZCWA 4QPOA 3OYJA 1YOVB 2JVHA 4YFKF 4II2A 1D8JA 1OLTA 4BHBA 4JX5A 2LBFB 1S8NA 4WF2A 1UFMA 2W7NA 5J4VA 3FKJA 2OERA 2ESNA 5D5WB 2QF7A 2M45A 2DOAA 2WWYA 4KFCA 1KU2A 3VVXA 1W0TA 3F21A 1BJZA 1X58A 3RTRA 1DU6A 3S14J 4A3DJ 3CRJA 3W6JB 1HSTA 4OMYA 3VYUB 2OJED 4G12A 2FJI1 3B73A 4EJVA 1WJAA 2IBDA 3K1NA 1Y8QB 1TP4A 5IP7J 1HDPA 2L4MA 2RV8A 1S5LC 3BZ6A 4OAYA 2ISYA 1YJWI 1VQNI 3R0JA 1FBQA 3CC4I 2ZCMA 1SD7A 3QWLA 3BJ6A 2QQBA 3LA2A 1UAAA 3R0AA 3F6VA 2XAFA 1H9GA 3PSIA 3CJDA 3FF5A 3MAJA 2NVYJ 1T98A 1R4MB 3MCZA 2CGPA 4XICA 1Z3XA 1EV7A 2QTQA 3UNGC 1WH5A 1YRNB 5ERIA 3H1CA 4Y17A 5HVQC 3OYEA 4KA4A 2HQ5A 3CC2I 2Z99A 1Z67A 3DKYA 1WI3A 3WHCA 4BY7J 2XF6A 3LOCA 4GFLA 3ESWB 5J40A 4P55A 5KCMA 5B1AH 1ETWA 1WCMJ 1T33A 3LSPA 3SZPA 4LLGF 3KEOA 2V4JC 2NNYA 2Y9YA 1YX3A 1S7OA 2IRFG 2P5VA 1XDSA 3ONQA 3QU6A 2ZO4A 2CQNA 1E3HA 1B8IA 1JGSA 4F55A 3JAMK 1BR4A 1Z7UA 2Z5UA 4BE1A 3JW4A 3VIBA 3WTYC 5J1YA 3CJTB 1JKOC 3SQNA 2FX0A 1ZG1A 2DU9A 3VODA 3K2ZA 2QQ8A 5CVIA 4Y7NJ 1U5TA 2DO7A 1ZGJA 3RKXA 1RIOH 3PO3J 3RPQA 1ZHFA 4MTDA 5C4YA 2E1MC 1V5FA 2X1CA 2NS8A 5GP9A 4A93J 3E3VA 5IT9Z 1V5GA 3KFWX 2NYXA 3FK6A 3KZZA 2YX4A 1QGPA 1IC8A 2IS1A 3GBGA 2EIKH 3SHFA 2HS5A 4A3GJ 1MNEA 1MD0A 2OQGA 1JHFA 2O6GE 2L9SA 5EJCA 4QLCU 4BQNA 3RQIA 4U87A 1AOYA 1Y39A 3IC7A 5E3LA 2BE5F 4EATA 4ZZLA 4S0HB 4W1UA 2HKXA 4BHPA 2ZBKA 4ANJA 2K27A 1LVAA 4G7OF 4KJZA 1K79A 2ZSHB 2FJ1A 5HDGA 2VXDA 4XKBA 1HW5A 3WU0A 2HKUA 2O7TA 3V78A 4XQFA 2CWEA 1LUJB 1MBGA 3WU2C 2WA0A 3GFJA 4X0GA 4ZTJA 5LFAA 4HV5A 2VOPA 3HUGA 5IP6A 3BWGA 5GAGJ 4LOCA 2V7FA 4V19K 2IU5A 4AIDA 2VBYA 2KISA 2VJIA 1TWHJ 4PXIA 2VKVA 2HQNA 4OAZA 2QKLB 3PNVA 4F3QA 4IRHA 4C3JJ 2XC7A 3BR6A 1YI2I 1WJBA 1EH8A 2X9DA 2FU4A 2WBMA 3JRHA 1IDZA 2A5YB 5B5EC 3M1EA 2PBXA 2XV4S 4ACIA 4D5FA 3CF2A 2VBXA 4RDUA 1WQ2A 3L2UA 2L9VA 1IXSB 3OS2A 4FT8A 3TDZC 2JSCA 4UNOA 2CQXA 4BJ6C 1ETXA 4ZTFA 4BXUA 2EZLA 3V7RA 1D0ZA 1HQCA 3KX2A 3C7JA 3I0TA 1GUUA 1X1CA 2HXOA 4L9JA 2Y48A 1OISA 3OYLA 3QPTA 2CUEA 3HIFA 3GTGJ 3DEEA 2BY3A 5AQCA 3GEZA 4W97A 3I59B 4P96A 4BBSJ 2M2EA 5EG0B 3V8LA 4F52A 2NNNA 3ABMH 1BC8C 2YR2A 1A31A 3J80K 2VLAA 1R00A 4GXOA 1BM9A 5C4XJ 2F48A 3L09A 2KLOA 3IWFA 2YSRA 1X1PA 4EGZA 5DEQA 1RC9A 5EEGA 1SD5A 1QBJA 2B63J 3ZQ7A 3M8EA 3G4SI 2IPQX 4B43A 2XIGA 3ZQHA 3CC7I 1H89C 1E3PA 2WV0A 2GWRA 1T6SA 5AONA 4YELA 2G0EA 2YVXA 3T5XA 2HOEA 3ROUA 3T8TA 3JREA 1BOAA 3TGNA 2QGUA 1VQKI 3L2RA 3DXJF 3FK7A 2MLKA 2X4HA 1QVUA 3BJBA 3W2AA 2IS4A 3M9AA 2V1NA 1FIAA 1XTAA 2UXUA 4BBRJ 3NS4A 2ME0A 3GTOJ 1M1EB 4G94A 4RAGA 2LKXA 3OSFA 4PDKA 1BN5A 1GVDA 2QIBA 2K9QA 4DVYP 3HOTA 2QQ9A 4I6ZA 1O3TA 2KQRA 2XRLA 4YFXF 1HW2A 3S1NJ 3LSMA 2PBIA 2W1OA 2IA1A 2O3FA 3OL3A 4PSXA 4HDUA 1W0UA 5HBUA 1FLIA 3HHGA 2NVQJ 4IHYA 1I27A 5K5RA 2UXXA 5DAJA 4M3BA 3DTEA 2P4WA 1ETYA 2VE8A 4C2MA 1B72B 2JZYA 4GFKA 3GO5A 2F07A 3HE0A 4ZJZA 3VOXA 3SYTA 1ULYA 4OIRF 2Z33A 1A6IA 5BNGA 2L9NA 3ZN0A 1HDDC 2E34A 5FKLA 3VW2A 1S7AA 5GAHJ 1UMQA 3VEPA 4MEXF 1A04A 2PG4A 3CCEI 3K7AJ 3VOKA 1D3YA 2DK5A 1OCTC 3GZIA 1QO0D 4IZZA 1K4TA 3KIOA 2L02A 2F5EA 3ECHA 1O7FA 4XLAA 1UG0A 1TC3C 3NI7A 2LFBA 4U7DA 2MC4A 3FRQA 3ON2A 2G3BA 2ZJ2A 1YJNI 1J09A 2YUSA 3JRAA 4BU2A 1WPKA 3LJLA 2QM3A 2Y0SN 5F27A 1WH7A 2EA2A 4FX0A 1USSA 1GXQA 1G8XA 2M8GX 3IH2A 1A35A 3WTXC 3BLYA 2CSOA 2W24A 4Y4RA 5LRRA 1T95A 2WY8Q 5J47A 1MMSA 5LRSA 3CESA 3KYDB 5GTHC 2GXAA 4NUBA 4E4HA 3S3OA 4HW0A 3HOZJ 2CH0A 4Z2YA 4B8XA 2PJPA 2HDCA 3TO7A 4ENKA 1I1SA 5CW8A 1KQ0A 2OAZA 1SFEA 3F23A 4X6AJ 3D5LA 2VJ5A 3WE2A 2KJCA 1R22A 3RPUA 2LD5A 3QPSA 4LLLA 3L7WA 1E17A 1H88C 3G1MA 2X6YA 4F93B 3I4PA 5FRNA 4JKZA 4YRVA 2KJBA 4AD9A 2UWMA 3GFMA 1P4XA 4UB8C 4A69C 3OL4A 4L62A 3D5RC 1WJDA 1A6QA 3BCBA 3J81K 5DDGA 2D45A 2E19A 2DT6A 3HTIA 3HSEA 1VQ4I 5IOYA 2V57A 4RGXA 1TLHB 3OOPA 1UHSA 1FSHA 3OYDA 1MMDA 4D9JA 2R7RA 3BP8A 3M3YJ 1EF4A 4M9XA 4JL3A 3OIQA 1KQ9A 3T0YA 4BH9A 2QENA 4GDFA 1JE8A 4I76A 2MBFA 2QOPA 3JRGA 3FHNA 5JFRA 2CFXA 1TT0A 4CGZA 2H6BA 4IPAA 1Y6IA 3CZ6A 1ENHA 4KT6A 5CPRB 3ZMZA 2UZKA 2OA4A 2RASA 1T56A 4GRIA 3HC7A 5D1RA 2VQHA 1D1BA 3DEUA 4NQWA 2PMUA 2XF7A 2XAUA 2KFDA 4FE7A 1RESA 2Y0MA 9ANTA 5B1BH 1ZGWA 4N4NB 1QZZA 3S5RA 2Z2SB 3CDHA 2WAFA 1J7KA 4I98B 3QOEA 1LFPA 2JJ7A 3CMYA 3K70D 4AYBA 4XSZF 2X1EA 2XF5A 5E3NA 1LDJA 3BG3A 2XAJA 4B1RA 1BI3A 1P7IA 2E71A 2Y75A 3CLQA 4CCMA 4HF0A 3C07A 3DPUA 3LWFA 5IT3A 3E1SA 2FF4A 5FKKA 3J7AY 2BGCA 3QQAA 1H9TA 4E7HA 1PUFA 3MKWB 2DLLA 3HB9A 3BRUA 3C2GA 2DW4A 2O03A 3EPZA 3I4NJ 1JGGA 1HKTA 1VQ7I 3VVYA 2B0LA 4XSXF 1I6HJ 2VL8A 4CCKA 3HOYJ 2L4AA 2OCEA 3I64A 2HXIA 1MIJA 4LJZF 2RAEA 1KYWA 1Z6TA 1FWZA 4DYQA 4DNCA 2E2JJ 1ZQ3P 1G6NA 2KDZA 1JXSA 1FYMA 2BW3A 2JWTA 4A3IJ 2I10A 2NS0A 5CQGA 3ASOH 1X3ZB 3VYSB 3WE3A 3CJRB 1ERDA 2WGBA 3H92A 4RAZA 1BA5A 3P9TA 3LWJA 1NG7A 1RETA 5FLXK 2O7OA 1STZA 3G3ZA 1IRFA 1EH6A 2A61A 3GEUA 4ICHA 3HXLA 4M9SA 3BR3A 3CF5F 3HOVJ 2E1MB 2DMPA 2NS7A 4HSRA 5FKMA 1G4DA 4H4KC 1IN6A 2DA6A 5L3GA 1WRJA 2XAGA 4LLNA 4G6QA 2GOMA 4U88A 5FKOA 4BDYA 3R61A 3LSTA 1GVJA 2GXBA 1QHHD 2IS6A 4I0AA 2ELKA 2AQFA 2XGCA 5HDKA 1JUPA 1UELB 3RCOA 3A03A 3Q0UA 5JHUA 5EGOA 4ENMA 1AU7A 2M7AA 1YW9A 3FXMA 4YIRX 1XB4A 3K1PA 3LSKA 3H0DA 4XN3A 1RUNA 5F04A 4G6DA 1BJAA 5FROA 3ERED 3CCVI 2IS2A 3KYLA 2Q2EA 1Z05A 5F64A 3G1OA 3CO6C 1XPXA 3O8GA 3I3LA 5D4SA 4DOZA 3C2BA 4CCNA 1ZRCA 4V2FA 2AQEA 2EB7A 3TO9A 4EJTA 1S7EA 1W36D 4PFOA 4HG2A 2DJIA 4EV0A 4Q4ZF 3X2QH 3S1MJ 5FGLA 3UR3C 3V8JA 3DP7A 1Z21A 1QA6A 3K70C 3CCQI 3TO6A 4OD4A 4HEA2 5IYCJ 5JLXA 4EM2A 4A0ZA 4XMYA 5CVUA 3IKVA 5FGMA 2DG7A 4O6JA 2DA3A 4XN0A 3DBLB 3PQJA 1GV2A 1IXRC 4ZDLA 3K0LA 2FQ4A 3ZRGA 5KNLA 1VQMI 1EJ9A 1MBJA 5BS6A 4KN4X 2J5PA 3GTKJ 2VQLA 5M3MJ 4IHTA 1U3EM 2CQ7A 4BDZA 4P9UA 1Y1VJ 2EILH 4I7HA 1VQ6I 2RHAA 1Q1VA 5IOZA 4C2MJ 3GLXA 3I71A 5K7HA 3BPXA 4MTEA 3T8RA 4F92B 3VW1A 3WTVC 2D1HA 1DPUA 1HOMA 3VWBA 5E20A 1ZLJA 1JT0A 5JHFA 2NVTJ 1R4NB 3P5JA 5EEHA 2HI3A 4E7JA 2DA1A 4LG3A 4YFNF 3N05A 1XGSA 3KP4A 1G2HA 1Y0NA 3K4JA 1ETKA 2D1VA 3WODF 4CYCA 3I53A 2CW7A 3V8KA 1YQAA 3DV8A 2FOKA 3IWZA 4D7MA 4ZYAA 2OI8A 4MQ9F 3S93A 1ZYRF 1FBSA 4KICA 4XR6A 4A0XA 3PL8A 3JR9A 3VSKA 2R5ZB 3FXQA 4KMFA 3DKXA 1GXPA 3S2DJ 3ON4A 4A3KJ 4B3XA 5JLWA 1K4SA 5HOOA 4PSWA 2XVCA 4YEJA 3FHZA 5LLQA 2WAQA 3ANGA 1FX7A 2JN6A 3CMEI 1LDDA 2HYFA 3LSGA 2K9MA 2FNAA 4AIKA 1YRNA 3K4CA 4RB1A 1NHAA 1W5SA 1KZHA 2ZY9A 4BKXA 4E7LA 4B47A 4JYKA 1BR2A 1W36C 1L0OC 2MFZA 4JX6A 4R79A 3E97A 2E2HJ 3TP0A 3V4GA 4E7SA 2ZOZA 1BW5A 3K2AA 1D1CA 4MLOA 1LFBA 1XX5A 4MQVA 5FB2A 4M6YA 4RLQA 3H3UA 1FZPB 3SFIA 2DDAA 1T0FA 4PJ0C 3EUKL 1P6RA 2WTEA 2CMPA 2LY9A 3MZ8A 5D6FA 2NXNB 1G3YA 2MH9A 3I58A 4DBRA 1N77A 2REKA 4PFPA 5E1ZB 3FMSA 1R71A 1TZLA 1S29A 2DA2A 1IO2A 3C18A 3BR0A 3KYCB 2V9VA 3P9KA 3NRGA 2ELHA 4DBQA 3IRQA 3BHQA 3BT9A 4HNUA 3KZYA 1Z3YA 3EUHA 2IA0A 3FBNB 4EVIA 3L2VA 2Y31A 1YX5A 1N78A 1X2MA 2VKHA 2VASA 4DYRA 2R5YA 2DXIA 2M30A 3S8PA 4G6TB 2KZGA 1TWCJ 3SDGA 3L1PA 3CUQB 2YU9J 1B4AA 1SMTA 2O0YA 5A2QZ 3IL2A 2HVQA 2COBA 5F6FA 4UUSB 4U7BA 2OTLI 1OFCX 2IGMA 4NNJA 3LQQA 2HPMA 1SMYF 1SAUA 2VODA 2UXPA 1OYWA 3F0CA 4H0EA 3JTGA 1K6OA 3WTWC 1Z6RA 1WHUA 2BVLA 4IRVA 5FHPA 3O60A 3EETA 2IAIA 5ICGA 3ZQLA 2KP6A 2M0MA 3VVZA 1BI2A 2E35A 3DCFA 3K4KA 2Y9ZA 1F4KA 4A3LJ 3CUQC 4ETSA 1Z7LA 4NHJA 2VBWA 4HQEA 4Q48A 4ENJA 5JI6A 1OKRA 3H9QA 2L5QA 3EUAA 2QZ8A 2OQRA 2FBKA 4OOIA 2PJRA 1F43A 1BI1A 5TGTA 5GAEJ 5DM7F 2ZCXA 1V4RA 3KP6A 3K1MA 3KZIC 3QPHA 2FSWA 2GIVA 3G71I 1U8RA 1ETVA 1RZ4A 5L3FA 1SGMA 3G73A 1OCRH 5CLSA 5L3EA 2FUG2 1HSJA 2KIUA
chains in the Genus database with same CATH topology
4DZPA 3UKGA 1NK3P 1QVUA 3BJBA 3PM1A 5C44J 2DG8A 2EZIA 1FIAA 1VNDA 3HEFA 2H1KA 2UXUA 3E7QA 4BBRJ 3JRDA 3Q3SA 3AQTA 2ME0A 1IV6A 3GTOJ 2L7MP 3ZQIA 3RH2A 2LKXA 1Z77A 3OSFA 2JK3A 1GVDA 1APLC 1FEXA 2NP3A 5EZHA 2QIBA 2K9QA 4I6ZA 1VF9A 1TWAJ 2ZCNA 3JSJA 4QSHA 2XRLA 5C4JJ 3LSJA 3GTQJ 4GCKA 3S1NJ 2R7ZJ 4A3MJ 3OOUA 1W0UA 5HBUA 1RR7A 1Y1WJ 3G1LA 2QKOA 4B4CA 4IHYA 2NVQJ 2M34A 5DAJA 3HGGA 1AKHB 2EZKA 4M3BA 2YVHA 2KT0A 5EZGA 1ETYA 1LE8B 1JUMA 5EGOB 3JRFA 2UXOA 1B72B 3GTLJ 4GFKA 3HE0A 2F07A 3VOXA 1NTCA 2PZ9A 4CGRA 2EBIA 2L0KA 2X48A 2X6OA 1CQTA 2GBYA 1A6IA 5BNGA 2G7LA 1HDDC 3A01B 1SFOJ 5FKLA 1FTTA 3VW2A 1Z0XA 4QIWN 1MBHA 1UMQA 3AQSA 5IP9J 3KKCA 3H0GJ 4V2GA 3VOKA 3K7AJ 4DZJA 5E3MA 1OCTC 4FCYA 3GZIA 1POGA 3HTAA 2EH3A 2GUHA 3BQYA 2UXHA 3NI7A 1TC3C 3QKXA 2LFBA 5FKNA 3FRQA 3NNRA 2P81A 3ON2A 1RPWA 2H8RA 2G3BA 1R9TJ 2CU7A 2YUSA 5M3FJ 3JRAA 1WPKA 1GT0C 3LJLA 2Y0SN 5F27A 1JKPC 1WH7A 3QBMA 3GTMJ 5IYBJ 2LP0A 5EYRA 2HDDA 3S17J 2M8GX 3IH2A 2LR8A 1MSEC 4M3DA 1ZK8A 3HM5A 3B6CA 2CRGA 2L9RA 2R5ZA 4IHWA 3BTJA 1LFUP 2O8KA 3QPLA 3HGYA 2XPVA 5F1JA 4MIMA 1VI0A 2XPUA 3IH4A 3GTJJ 3LSRA 2VPRA 4FE4A 3NPIA 3BG9A 3M4OJ 3HOZJ 2LK2A 1IDYA 4FISA 4IHXA 3Q0WA 5FJ8J 5CW8A 3TW7A 4C3IJ 1F36A 3KZ9A 4X6AJ 2DMTA 1QRYA 1UI6A 2LD5A 1FJLA 2G7SA 3QPSA 3TEDA 3OSGA 2N8GA 1A5JA 2ZOYA 3T6NA 1H88C 3G1MA 2AO9A 3BR2A 4M3EA 4JKZA 2K9NA 2AHQA 2D5VA 3PPBA 2YS9A 2R93J 2K9SA 2DA5A 2Q24A 3F1BA 4A69C 2G7GA 3HOUJ 1QVTA 4X1EA 4L62A 2L7FP 3B6AA 1B8IB 1ETQA 2JMWA 3RD3A 4CYCB 4M6VA 1JKRC 3O8HA 3RZOJ 5FLMJ 3KNWA 2E19A 5CXGA 1XS9A 3HIMA 3HTIA 4ABZA 1ORKA 1MH3A 5IOYA 1H8AC 1X2NA 2V57A 2HOAA 5FMPA 1UHSA 1I50J 2HOSA 3IV5A 3M3YJ 1EF4A 2W48A 4JL3A 5DTDA 3EUPA 3Q0VA 1HCRA 3D1NI 3DPJA 1JJ8C 3BTCA 1ETOA 5J3LA 5IYDJ 4GCTA 4I76A 2PMZN 4AUXA 3JRCA 1BL0A 3JRGA 2QOPA 3BTLA 2LLKA 1U78A 3G56A 1MH4A 1ENHA 1OJLA 3NARA 3BTIA 2XPWA 1D5YA 3ZQFA 2Y2ZA 3NXCA 4UUSA 2WUIA 2RASA 1T56A 3VW0A 2JA5J 2L7ZA 5D1RA 4YZEA 3NAUA 1U9NA 3S15J 5HODA 3WHBA 5J1RA 2MGQA 4FE7A 1RESA 9ANTA 1ZGWA 2DMUA 2TRTA 3S5RA 5EG0A 4J19A 5K7ZA 4JP0A 2JJ7A 3FKIJ 3CMYA 1JKQC 5E3NA 4AC0A 3VP5A 3BG3A 2DA4A 2M9HA 4B1RA 1P7IA 3COLA 3FIWA 3CQZJ 2E1OA 1GV5A 1UG2A 5F0FA 3C07A 3KKDA 5FKKA 2K40A 2DMNA 4MFEA 3ZQCA 5FLVA 3QQAA 2JA8J 3BRUA 1PUFA 3HB9A 2HOTA 3I4NJ 1JGGA 2XDNA 2ID6A 1U8BA 4GCLA 3VVYA 3MN2A 1BW6A 1FTZA 1MNMC 2CJJA 1I6HJ 3EGQA 3HOYJ 1SANA 4FTHA 4JNNA 2QWTA 2HXIA 3BR5A 2RAEA 3JRBA 4DYQA 3ZOBA 2R5YB 2E2JJ 1ZQ3P 2KDZA 4XRSG 1K83J 2JWTA 4A3IJ 2R0QC 4MXMA 2I10A 3MVPA 5GPCA 3W6VA 1MBEA 5IPAA 2WGBA 1BA5A 3P9TA 3LWJA 1IGNA 4IHVA 1RETA 2O7OA 2XB0X 2ECCA 2JA6J 4A3BJ 3GEUA 4UUTA 3FISA 4ICHA 3HOVJ 3BR3A 2E2IJ 2DMQA 2DMPA 2NS7A 2LTPA 5J1UA 5FKMA 3ZQGA 3GTPJ 2DJNA 4M3GA 3RZDJ 2D6YA 5C3EJ 2DA6A 3BQZA 3RKQA 1JTXA 4A3EJ 5FKOA 4A3FJ 3HOXJ 2W53A 1O4XA 2ELKA 2O9LA 1JJ6C 1AKHA 1JT6A 2CQQA 2XGCA 1JUPA 3E7LA 3HBLA 3A03A 3Q0UA 1LE8A 1DU0A 1ZTRA 2ZB9A 4XK4A 1TWFJ 5EGOA 1UI5A 1AU7A 1B72A 2ID3A 1IG7A 5M5YJ 4B3AA 3S16J 4AF5A 5F04A 2WV1A 3CDLA 4C3HJ 2ME6A 5HAWA 3A01A 4A3JJ 2QCOA 3MNLA 3HOWJ 3G1OA 3O8GA 4QTRA 1OCPA 2M0CA 4JX5A 2XGEA 3C2BA 4V2FA 2CUFA 4Y52J 1S7EA 2OERA 1WGXA 2QF7A 2VI6A 2GFNA 3VVXA 1W0TA 1BJZA 1X58A 1DU6A 3S14J 3S1MJ 3S2HJ 5FGLA 4A3DJ 3CRJA 2UXIA 4AC6A 2FD5A 3DEWA 4RBOA 4G12A 1U9OA 2IBDA 4ME9A 1NK2P 5IYCJ 5JLXA 5IP7J 1HDPA 1ZR4A 4DYCA 4EEFG 2DG7A 5EFYA 2ZCMA 5D18A 2DA3A 4A3CJ 1K61A 1GV2A 5GPAA 3SJMA 2FQ4A 4D5CA 4BXXJ 4M3FA 1RKTA 1MBJA 3CJDA 3V6GA 2IEKA 2NVYJ 2DN0A 4XICA 3GTKJ 2ECBA 1VFCA 5M3MJ 2QTQA 1JUSA 2OPTA 1WH5A 4MO7A 1YRNB 1IUFA 5H9TA 1Y1VJ 2XB5A 2RHAA 5HSZA 3OIOA 1Q1VA 2HQ5A 5IOZA 4C2MJ 1WI3A 3WHCA 5K7HA 4BY7J 2OF7A 3A02A 3VW1A 3LOCA 4GFLA 1HOMA 3VUQA 1JT0A 1ETWA 1WCMJ 1AHDP 1ZKGA 2NVTJ 1T33A 3LSPA 2HI3A 2DA1A 2Y9YA 1G2HA 2VUMJ 1B8IA 2GM4A 1ETKA 2EZHA 4CYCA 2NX4A 3VIBA 5J1YA 1JKOC 1MSFC 2FX0A 4D7MA 2OI8A 4Y7NJ 1MBFA 1IJWC 3B81A 3PO3J 4NN1A 1MBKA 4NDLA 5EF6A 1QPIA 3LHQA 3JR9A 5C4YA 2R5ZB 3PASA 2NS8A 5GP9A 4A93J 1XC5A 3S2DJ 3ON4A 1FIPA 3HTJA 4DW6A 3TW6A 2MG4A 4A3KJ 3HTHA 3FK6A 2DTZA 1IC8A 5JLWA 2GENA 3GBGA 2GLOA 4A3GJ 4AYBN 4BY1J 3ANGA 2JN6A 1RKWA 3LSGA 2NVXJ 3H3VK 1E3OC 3RQIA 1YRNA 5E3LA 4IEJA 4BKXA 4S0HB 4W1UA 1HF0A 4JYKA 3BG5A 2HYJA 4NELA 2JA7J 2YVEA 5CXIA 3TP3A 5DS9A 1XG1A 4JX6A 3VPRA 4MFDA 5K58A 2FJ1A 2E2HJ 3TP0A 1HLVA 2XGDA 1I3QJ 4HKUA 2HKUA 2O7TA 3V78A 2ZOZA 1BW5A 3K2AA 4MLOA 1LFBA 1MBGA 5M5WJ 2FBQA 2HYTA 1ITYA 5IP6A 3SFIA 2Y30A 4LOCA 2IU5A 5F0HA 2TCTA 2WAQN 2VKEA 2LY9A 5F0CA 1TWHJ 4PXIA 2VKVA 2LVSA 5K7FA 4C3JJ 2XSDC 3BR6A 1ZR2A 2X9DA 3JRHA 2REKA 3IUVA 1IDZA 2PBXA 5F08A 4D5FA 4ACIA 2DA2A 4RDUA 3BR0A 3NRGA 3HKZN 5EDNA 3BHQA 1JTYA 3BT9A 3BR1A 2CQXA 1ETXA 2Y31A 2EZLA 1X2MA 4DYRA 2R5YA 1GUUA 2HXOA 3SDGA 1TWCJ 3L1PA 2YU9J 3HDDA 2COBA 4UUSB 5D19A 4HNVA 1OFCX 2MW8A 2CUEA 3I4MJ 4UDSA 2R92J 3JRIA 3GTGJ 2UXPA 4D7NA 3F0CA 3S1QJ 3CCYA 5AQCA 3LNQA 4W97A 2MSYA 3G7RA 3IH3A 4BBSJ 4MK6A 2M2EA 5EG0B 5FHPA 3O60A 5E3OA 2IAIA 4L5EA 3ZQLA 3BCGA 3VVZA 4XRSA 1P7JA 2Y9ZA 3DCFA 5EEAA 4A3LJ 5C4XJ 1IRZA 2NP5A 1GDTA 4GFBA 2NOGA 2EQRA 3MKLA 5M5XJ 3CWRA 2B63J 1PUFB 2DA7A 3S1RJ 3BNIA 1F43A 3ZQHA 1H89C 3PO2J 2ZCXA 2G0EA 1TWGJ 1ETVA 2WB1N 3JREA 1SGMA 4JX4A 4XRMA 4XIDA 4KWAA 3ANPA 3FK7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DZP A;  3UKG A;  1NK3 P;  1QVU A;  3BJB A;  3PM1 A;  5C44 J;  2DG8 A;  2EZI A;  1FIA A;  1VND A;  3HEF A;  2H1K A;  2UXU A;  3E7Q A;  4BBR J;  3JRD A;  3Q3S A;  3AQT A;  2ME0 A;  1IV6 A;  3GTO J;  2L7M P;  3ZQI A;  3RH2 A;  2LKX A;  1Z77 A;  3OSF A;  2JK3 A;  1GVD A;  1APL C;  1FEX A;  2NP3 A;  5EZH A;  2QIB A;  2K9Q A;  4I6Z A;  1VF9 A;  1TWA J;  2ZCN A;  3JSJ A;  4QSH A;  2XRL A;  5C4J J;  3LSJ A;  3GTQ J;  4GCK A;  3S1N J;  2R7Z J;  4A3M J;  3OOU A;  1W0U A;  5HBU A;  1RR7 A;  1Y1W J;  3G1L A;  2QKO A;  4B4C A;  4IHY A;  2NVQ J;  2M34 A;  5DAJ A;  3HGG A;  1AKH B;  2EZK A;  4M3B A;  2YVH A;  2KT0 A;  5EZG A;  1ETY A;  1LE8 B;  1JUM A;  5EGO B;  3JRF A;  2UXO A;  1B72 B;  3GTL J;  4GFK A;  3HE0 A;  2F07 A;  3VOX A;  1NTC A;  2PZ9 A;  4CGR A;  2EBI A;  2L0K A;  2X48 A;  2X6O A;  1CQT A;  2GBY A;  1A6I A;  5BNG A;  2G7L A;  1HDD C;  3A01 B;  1SFO J;  5FKL A;  1FTT A;  3VW2 A;  1Z0X A;  4QIW N;  1MBH A;  1UMQ A;  3AQS A;  5IP9 J;  3KKC A;  3H0G J;  4V2G A;  3VOK A;  3K7A J;  4DZJ A;  5E3M A;  1OCT C;  4FCY A;  3GZI A;  1POG A;  3HTA A;  2EH3 A;  2GUH A;  3BQY A;  2UXH A;  3NI7 A;  1TC3 C;  3QKX A;  2LFB A;  5FKN A;  3FRQ A;  3NNR A;  2P81 A;  3ON2 A;  1RPW A;  2H8R A;  2G3B A;  1R9T J;  2CU7 A;  2YUS A;  5M3F J;  3JRA A;  1WPK A;  1GT0 C;  3LJL A;  2Y0S N;  5F27 A;  1JKP C;  1WH7 A;  3QBM A;  3GTM J;  5IYB J;  2LP0 A;  5EYR A;  2HDD A;  3S17 J;  2M8G X;  3IH2 A;  2LR8 A;  1MSE C;  4M3D A;  1ZK8 A;  3HM5 A;  3B6C A;  2CRG A;  2L9R A;  2R5Z A;  4IHW A;  3BTJ A;  1LFU P;  2O8K A;  3QPL A;  3HGY A;  2XPV A;  5F1J A;  4MIM A;  1VI0 A;  2XPU A;  3IH4 A;  3GTJ J;  3LSR A;  2VPR A;  4FE4 A;  3NPI A;  3BG9 A;  3M4O J;  3HOZ J;  2LK2 A;  1IDY A;  4FIS A;  4IHX A;  3Q0W A;  5FJ8 J;  5CW8 A;  3TW7 A;  4C3I J;  1F36 A;  3KZ9 A;  4X6A J;  2DMT A;  1QRY A;  1UI6 A;  2LD5 A;  1FJL A;  2G7S A;  3QPS A;  3TED A;  3OSG A;  2N8G A;  1A5J A;  2ZOY A;  3T6N A;  1H88 C;  3G1M A;  2AO9 A;  3BR2 A;  4M3E A;  4JKZ A;  2K9N A;  2AHQ A;  2D5V A;  3PPB A;  2YS9 A;  2R93 J;  2K9S A;  2DA5 A;  2Q24 A;  3F1B A;  4A69 C;  2G7G A;  3HOU J;  1QVT A;  4X1E A;  4L62 A;  2L7F P;  3B6A A;  1B8I B;  1ETQ A;  2JMW A;  3RD3 A;  4CYC B;  4M6V A;  1JKR C;  3O8H A;  3RZO J;  5FLM J;  3KNW A;  2E19 A;  5CXG A;  1XS9 A;  3HIM A;  3HTI A;  4ABZ A;  1ORK A;  1MH3 A;  5IOY A;  1H8A C;  1X2N A;  2V57 A;  2HOA A;  5FMP A;  1UHS A;  1I50 J;  2HOS A;  3IV5 A;  3M3Y J;  1EF4 A;  2W48 A;  4JL3 A;  5DTD A;  3EUP A;  3Q0V A;  1HCR A;  3D1N I;  3DPJ A;  1JJ8 C;  3BTC A;  1ETO A;  5J3L A;  5IYD J;  4GCT A;  4I76 A;  2PMZ N;  4AUX A;  3JRC A;  1BL0 A;  3JRG A;  2QOP A;  3BTL A;  2LLK A;  1U78 A;  3G56 A;  1MH4 A;  1ENH A;  1OJL A;  3NAR A;  3BTI A;  2XPW A;  1D5Y A;  3ZQF A;  2Y2Z A;  3NXC A;  4UUS A;  2WUI A;  2RAS A;  1T56 A;  3VW0 A;  2JA5 J;  2L7Z A;  5D1R A;  4YZE A;  3NAU A;  1U9N A;  3S15 J;  5HOD A;  3WHB A;  5J1R A;  2MGQ A;  4FE7 A;  1RES A;  9ANT A;  1ZGW A;  2DMU A;  2TRT A;  3S5R A;  5EG0 A;  4J19 A;  5K7Z A;  4JP0 A;  2JJ7 A;  3FKI J;  3CMY A;  1JKQ C;  5E3N A;  4AC0 A;  3VP5 A;  3BG3 A;  2DA4 A;  2M9H A;  4B1R A;  1P7I A;  3COL A;  3FIW A;  3CQZ J;  2E1O A;  1GV5 A;  1UG2 A;  5F0F A;  3C07 A;  3KKD A;  5FKK A;  2K40 A;  2DMN A;  4MFE A;  3ZQC A;  5FLV A;  3QQA A;  2JA8 J;  3BRU A;  1PUF A;  3HB9 A;  2HOT A;  3I4N J;  1JGG A;  2XDN A;  2ID6 A;  1U8B A;  4GCL A;  3VVY A;  3MN2 A;  1BW6 A;  1FTZ A;  1MNM C;  2CJJ A;  1I6H J;  3EGQ A;  3HOY J;  1SAN A;  4FTH A;  4JNN A;  2QWT A;  2HXI A;  3BR5 A;  2RAE A;  3JRB A;  4DYQ A;  3ZOB A;  2R5Y B;  2E2J J;  1ZQ3 P;  2KDZ A;  4XRS G;  1K83 J;  2JWT A;  4A3I J;  2R0Q C;  4MXM A;  2I10 A;  3MVP A;  5GPC A;  3W6V A;  1MBE A;  5IPA A;  2WGB A;  1BA5 A;  3P9T A;  3LWJ A;  1IGN A;  4IHV A;  1RET A;  2O7O A;  2XB0 X;  2ECC A;  2JA6 J;  4A3B J;  3GEU A;  4UUT A;  3FIS A;  4ICH A;  3HOV J;  3BR3 A;  2E2I J;  2DMQ A;  2DMP A;  2NS7 A;  2LTP A;  5J1U A;  5FKM A;  3ZQG A;  3GTP J;  2DJN A;  4M3G A;  3RZD J;  2D6Y A;  5C3E J;  2DA6 A;  3BQZ A;  3RKQ A;  1JTX A;  4A3E J;  5FKO A;  4A3F J;  3HOX J;  2W53 A;  1O4X A;  2ELK A;  2O9L A;  1JJ6 C;  1AKH A;  1JT6 A;  2CQQ A;  2XGC A;  1JUP A;  3E7L A;  3HBL A;  3A03 A;  3Q0U A;  1LE8 A;  1DU0 A;  1ZTR A;  2ZB9 A;  4XK4 A;  1TWF J;  5EGO A;  1UI5 A;  1AU7 A;  1B72 A;  2ID3 A;  1IG7 A;  5M5Y J;  4B3A A;  3S16 J;  4AF5 A;  5F04 A;  2WV1 A;  3CDL A;  4C3H J;  2ME6 A;  5HAW A;  3A01 A;  4A3J J;  2QCO A;  3MNL A;  3HOW J;  3G1O A;  3O8G A;  4QTR A;  1OCP A;  2M0C A;  4JX5 A;  2XGE A;  3C2B A;  4V2F A;  2CUF A;  4Y52 J;  1S7E A;  2OER A;  1WGX A;  2QF7 A;  2VI6 A;  2GFN A;  3VVX A;  1W0T A;  1BJZ A;  1X58 A;  1DU6 A;  3S14 J;  3S1M J;  3S2H J;  5FGL A;  4A3D J;  3CRJ A;  2UXI A;  4AC6 A;  2FD5 A;  3DEW A;  4RBO A;  4G12 A;  1U9O A;  2IBD A;  4ME9 A;  1NK2 P;  5IYC J;  5JLX A;  5IP7 J;  1HDP A;  1ZR4 A;  4DYC A;  4EEF G;  2DG7 A;  5EFY A;  2ZCM A;  5D18 A;  2DA3 A;  4A3C J;  1K61 A;  1GV2 A;  5GPA A;  3SJM A;  2FQ4 A;  4D5C A;  4BXX J;  4M3F A;  1RKT A;  1MBJ A;  3CJD A;  3V6G A;  2IEK A;  2NVY J;  2DN0 A;  4XIC A;  3GTK J;  2ECB A;  1VFC A;  5M3M J;  2QTQ A;  1JUS A;  2OPT A;  1WH5 A;  4MO7 A;  1YRN B;  1IUF A;  5H9T A;  1Y1V J;  2XB5 A;  2RHA A;  5HSZ A;  3OIO A;  1Q1V A;  2HQ5 A;  5IOZ A;  4C2M J;  1WI3 A;  3WHC A;  5K7H A;  4BY7 J;  2OF7 A;  3A02 A;  3VW1 A;  3LOC A;  4GFL A;  1HOM A;  3VUQ A;  1JT0 A;  1ETW A;  1WCM J;  1AHD P;  1ZKG A;  2NVT J;  1T33 A;  3LSP A;  2HI3 A;  2DA1 A;  2Y9Y A;  1G2H A;  2VUM J;  1B8I A;  2GM4 A;  1ETK A;  2EZH A;  4CYC A;  2NX4 A;  3VIB A;  5J1Y A;  1JKO C;  1MSF C;  2FX0 A;  4D7M A;  2OI8 A;  4Y7N J;  1MBF A;  1IJW C;  3B81 A;  3PO3 J;  4NN1 A;  1MBK A;  4NDL A;  5EF6 A;  1QPI A;  3LHQ A;  3JR9 A;  5C4Y A;  2R5Z B;  3PAS A;  2NS8 A;  5GP9 A;  4A93 J;  1XC5 A;  3S2D J;  3ON4 A;  1FIP A;  3HTJ A;  4DW6 A;  3TW6 A;  2MG4 A;  4A3K J;  3HTH A;  3FK6 A;  2DTZ A;  1IC8 A;  5JLW A;  2GEN A;  3GBG A;  2GLO A;  4A3G J;  4AYB N;  4BY1 J;  3ANG A;  2JN6 A;  1RKW A;  3LSG A;  2NVX J;  3H3V K;  1E3O C;  3RQI A;  1YRN A;  5E3L A;  4IEJ A;  4BKX A;  4S0H B;  4W1U A;  1HF0 A;  4JYK A;  3BG5 A;  2HYJ A;  4NEL A;  2JA7 J;  2YVE A;  5CXI A;  3TP3 A;  5DS9 A;  1XG1 A;  4JX6 A;  3VPR A;  4MFD A;  5K58 A;  2FJ1 A;  2E2H J;  3TP0 A;  1HLV A;  2XGD A;  1I3Q J;  4HKU A;  2HKU A;  2O7T A;  3V78 A;  2ZOZ A;  1BW5 A;  3K2A A;  4MLO A;  1LFB A;  1MBG A;  5M5W J;  2FBQ A;  2HYT A;  1ITY A;  5IP6 A;  3SFI A;  2Y30 A;  4LOC A;  2IU5 A;  5F0H A;  2TCT A;  2WAQ N;  2VKE A;  2LY9 A;  5F0C A;  1TWH J;  4PXI A;  2VKV A;  2LVS A;  5K7F A;  4C3J J;  2XSD C;  3BR6 A;  1ZR2 A;  2X9D A;  3JRH A;  2REK A;  3IUV A;  1IDZ A;  2PBX A;  5F08 A;  4D5F A;  4ACI A;  2DA2 A;  4RDU A;  3BR0 A;  3NRG A;  3HKZ N;  5EDN A;  3BHQ A;  1JTY A;  3BT9 A;  3BR1 A;  2CQX A;  1ETX A;  2Y31 A;  2EZL A;  1X2M A;  4DYR A;  2R5Y A;  1GUU A;  2HXO A;  3SDG A;  1TWC J;  3L1P A;  2YU9 J;  3HDD A;  2COB A;  4UUS B;  5D19 A;  4HNV A;  1OFC X;  2MW8 A;  2CUE A;  3I4M J;  4UDS A;  2R92 J;  3JRI A;  3GTG J;  2UXP A;  4D7N A;  3F0C A;  3S1Q J;  3CCY A;  5AQC A;  3LNQ A;  4W97 A;  2MSY A;  3G7R A;  3IH3 A;  4BBS J;  4MK6 A;  2M2E A;  5EG0 B;  5FHP A;  3O60 A;  5E3O A;  2IAI A;  4L5E A;  3ZQL A;  3BCG A;  3VVZ A;  4XRS A;  1P7J A;  2Y9Z A;  3DCF A;  5EEA A;  4A3L J;  5C4X J;  1IRZ A;  2NP5 A;  1GDT A;  4GFB A;  2NOG A;  2EQR A;  3MKL A;  5M5X J;  3CWR A;  2B63 J;  1PUF B;  2DA7 A;  3S1R J;  3BNI A;  1F43 A;  3ZQH A;  1H89 C;  3PO2 J;  2ZCX A;  2G0E A;  1TWG J;  1ETV A;  2WB1 N;  3JRE A;  1SGM A;  4JX4 A;  4XRM A;  4XID A;  4KWA A;  3ANP A;  3FK7 A; 
#chains in the Genus database with same CATH topology
 2RKH A;  1QNT A;  4DZP A;  3UKG A;  1EKE A;  3PM1 A;  5C44 J;  2LG4 A;  1V54 H;  2A68 F;  2DG8 A;  3RYP A;  1VND A;  2H1K A;  2JUG A;  2X0L A;  3AQT A;  3FXO A;  3O6B B;  4BL0 B;  3ZQI A;  1IV6 A;  1FPQ A;  3CMM A;  2JK3 A;  2DI3 A;  4UXN A;  2ZME A;  1FEX A;  5JVG F;  3EQL F;  5EZH A;  4C2T A;  1FNN A;  2HFH A;  2ZCN A;  3I59 A;  2R3S A;  2BY1 A;  3E6M A;  4QSH A;  3SZT A;  5C4J J;  2Q0O A;  4L0Y B;  1BBY A;  3GTQ J;  4GCK A;  3DFG A;  5ILV A;  2Z1D A;  5LD2 C;  1U2W A;  4A3M J;  2GZW A;  3MMY B;  1CGP A;  4IQ4 A;  2ZC2 A;  2VT2 A;  2M34 A;  2G7U A;  2F5C A;  3HGG A;  2F4O B;  4HST A;  1AKH B;  1GHC A;  4GO1 A;  1ZN2 A;  2KT0 A;  5EZG A;  1LE8 B;  3JRF A;  2UXO A;  3GTL J;  1NTC A;  2PZ9 A;  2FOW A;  2X48 A;  2I5U A;  2X6O A;  2PI0 A;  2Z3Y A;  2KRF A;  3PIO F;  1DGR M;  3IAS 2;  2EV0 A;  5L3C A;  3A01 B;  3A2K A;  1I3A A;  2VXZ A;  5KK1 A;  3K9T A;  4QIW N;  2CUJ A;  2CV1 A;  5TJJ A;  1O3R A;  4XLC A;  2DOD A;  1UHW A;  4MGR A;  3KKC A;  4V2G A;  4DZJ A;  1I39 A;  4XBF A;  2R7F A;  4AIJ A;  3HTA A;  2L3D A;  2ZNZ A;  4LB6 B;  2EH3 A;  3H5N A;  3IRR A;  2UXH A;  3U2R A;  3DQV C;  2LRE A;  3NNR A;  1RPW A;  3I56 I;  2ZXH A;  1R9T J;  1OR7 C;  2CU7 A;  1WI9 A;  3QBM A;  4ON0 A;  3N97 A;  1AWC A;  3GTM J;  4A2U A;  4BE2 A;  2HDD A;  3S17 J;  3AL0 C;  2DTR A;  1F9N A;  3JAM Z;  1ZK8 A;  3HM5 A;  4KYW A;  2C6Y A;  2F4M B;  4AVP A;  1YFH A;  2GXG A;  3BTJ A;  1LFU P;  3LA3 A;  4CCO A;  2O8K A;  3QPL A;  2NAZ A;  3WG9 A;  2IGN A;  2QBY A;  3M7G A;  5H6Q A;  3EDP A;  1YW8 A;  1VI0 A;  5J4Y A;  5TIS C;  1MMA A;  3NPI A;  4D0P A;  2QSH X;  2LK2 A;  3BZK A;  5CKT A;  3PFI A;  1MKM A;  3Q0W A;  4CO8 A;  3K6G A;  3TW7 A;  1R1V A;  4C3I J;  1F5T A;  2DMT A;  3PSF A;  1TT5 B;  1QRY A;  3AG2 H;  5J6X A;  4WWC A;  3TED A;  3OSG A;  1A5J A;  2N8G A;  3K69 A;  3K4L A;  3T6N A;  3ZXS A;  2HR3 A;  4XKC A;  2AO9 A;  4IKF A;  4BQO A;  2ACJ A;  4A5N A;  2K9N A;  1LEA A;  2YS9 A;  3ULQ B;  4HAM A;  4GYI A;  5HDN A;  2DA5 A;  1TNT A;  2Q24 A;  3RJP A;  4P5O A;  3WG7 H;  1YIJ I;  4X1E A;  3B6A A;  2P5K A;  4LIU A;  4XOP A;  1B8I B;  2JMW A;  2NRA C;  2V9P A;  4I99 C;  2VN2 A;  3RZO J;  3P9C A;  5FLM J;  3KNW A;  1VQ8 I;  3JTH A;  1XS9 A;  1U5T B;  2XRN A;  3LSH A;  1ORK A;  1MH3 A;  1TQI A;  3SZG A;  4ABZ A;  3WTS C;  2P6S A;  1H8A C;  4TV7 A;  2HOS A;  2KZV A;  2F5D A;  3KEY A;  2GAU A;  4LD5 A;  5DTD A;  5HS9 A;  4F7Z A;  1YW7 A;  1HCR A;  1SVM A;  3D1N I;  3CCJ I;  3HRT A;  4XKV A;  3BTC A;  5IYD J;  4IOA F;  2R7U A;  3E6C C;  4AUX A;  3JRC A;  1YO5 C;  1BL0 A;  3L2Q A;  1K78 A;  1RUO A;  1MGT A;  4IO9 F;  2BHY A;  3QU3 A;  2QEX I;  1U78 A;  2EIJ H;  5KAF C;  5DD8 A;  1U5T C;  3NAR A;  1WJE A;  3BTI A;  4ASN A;  1W7P A;  1VTN C;  2WUI A;  3OWT A;  2JA5 J;  1T2K A;  3J7Z I;  4UVC A;  3K8P C;  4ZH4 F;  4RS8 A;  2DPU A;  4LG0 B;  3S15 J;  4BE0 A;  5HNF A;  5HOD A;  4JK1 X;  4E7K A;  4KIS A;  2DMU A;  1O57 A;  2TRT A;  3FM3 A;  3OR2 C;  4A6D A;  2R4G A;  3KP2 A;  3B02 A;  5K7Z A;  4JP0 A;  4B48 A;  4BAC A;  4RB0 A;  3R60 A;  3FBI B;  2D2W A;  2VC0 A;  1KA8 A;  2BZT A;  1YS7 A;  1S9H A;  2EV6 A;  2G7H A;  3FIW A;  2E1O A;  1GV5 A;  5F0F A;  2IA2 A;  1DP7 P;  2K40 A;  3J80 Z;  5FLV A;  1D1A A;  4XLN F;  4HLX A;  2XUB A;  3MD2 A;  3VOE A;  5DM6 F;  3M8F A;  5B3S H;  1BW6 A;  1FTZ A;  4HPQ A;  3AG3 H;  1BIB A;  2V26 A;  4M74 A;  2E60 A;  2P6T A;  3DF8 A;  2RVC A;  3DPT A;  5CQE A;  2CW0 F;  3BR5 A;  2QWW A;  3KPH A;  3H5A A;  4EM0 B;  2H1L A;  2PEX A;  4G7Z F;  2UV1 A;  1C0W A;  3MVP A;  3QP5 A;  3ECO A;  3W6V A;  5H20 A;  2IXS A;  5HS8 A;  5IPA A;  3H5R A;  2ZJP F;  1R23 A;  3L2W A;  2E1C A;  3J7Y J;  2JA6 J;  1MMN A;  4UUT A;  2GQQ A;  4M6X A;  5FFX A;  2E2I J;  2DMQ A;  3HSR A;  3KCC A;  3ZQG A;  3E6B A;  4CDG A;  4M9Z A;  3RSN A;  1DDN A;  1CF7 B;  2EWN A;  5C3E J;  1MDM B;  2RC4 A;  3BQZ A;  3RKQ A;  2XGX A;  4A3E J;  1XMK A;  2W25 A;  2XAQ A;  3C2H A;  3HOX J;  4IJA A;  5DYM A;  2FBI A;  2PFB A;  1JJ6 C;  2O9L A;  2W85 A;  4NC8 A;  2CQQ A;  1ACI A;  2OTJ I;  2ZB9 A;  4XK4 A;  4N9I A;  4CXF A;  3OMY A;  4OIN F;  5BQT A;  2ID3 A;  4RM3 A;  2IT0 A;  1ZRF A;  1DGW Y;  4J00 A;  2WV1 A;  3CDL A;  4FET A;  2ME6 A;  3V7S A;  1PYV A;  1HW1 A;  3MNL A;  3HOW J;  4QTR A;  1RRJ A;  2M0C A;  2R7S A;  3RIR A;  4YG2 F;  1QQI A;  2CUF A;  4LK1 F;  3VYT B;  3WTT C;  2X51 A;  3DTI A;  2VI6 A;  3DLA A;  2DOE A;  1PJR A;  3S2H J;  4IF4 A;  2FD5 A;  3A0B C;  4RBO A;  1SD4 A;  4HF1 A;  4AC6 A;  3ZGK A;  2M8E A;  1ON2 A;  3U21 A;  5JVT A;  2LDU A;  5HNH A;  2ZFW A;  1NK2 P;  4GYG A;  1ZR4 A;  5E8I A;  2HDW A;  2VJJ A;  1DP3 A;  3RPU D;  2FXA A;  1FBU A;  1D5V A;  5EFY A;  4B09 A;  2M4G A;  4BGD A;  2ZSI B;  3HHH A;  1ZAO A;  3DBH B;  3WU1 B;  4BJT A;  4UB6 C;  4WIB A;  2RGV A;  4EJO A;  4BXX J;  4M3F A;  2QVO A;  2Y69 H;  3S3N A;  3BC8 A;  2K3P A;  2EA4 A;  2DN0 A;  4LMY A;  5DCF A;  3TQN A;  2KRC A;  2OPT A;  2R7D A;  1IUF A;  4ESF A;  4EJU A;  1A36 A;  3CD6 I;  4OWR B;  1UCR A;  3OIO A;  2B1E A;  4XLH A;  2BYV E;  1UJ8 A;  1SC7 A;  4XL9 A;  2VPL A;  3PNT A;  2OF7 A;  3A02 A;  1V5E A;  3P9I A;  3LFU A;  5FFZ A;  3VUQ A;  1AHD P;  1PUE E;  3OYB A;  4U0W A;  1JI8 A;  1FOX A;  4S04 A;  3TKY A;  4MHG A;  4RGU A;  3DBR B;  2VUM J;  3ERM A;  4ESB A;  2GM4 A;  1PP8 F;  2EZH A;  2R7Q A;  2HVS A;  2NX4 A;  3CJN A;  3QYE A;  1XGM A;  5E17 F;  2E7W A;  4JOM A;  2OU2 A;  1OYY A;  4M73 A;  1IJW C;  3H35 A;  3ASN H;  3B81 A;  4YIF A;  4NN1 A;  1MBK A;  3J81 Z;  2K5C A;  3PAS A;  4MNU A;  3L9F A;  5E8G A;  3W6K B;  1XC5 A;  1X19 A;  1FIP A;  1I5Z A;  3F8F A;  3TW6 A;  3HTH A;  3NWS A;  3AG4 H;  4E7Z A;  4BEH A;  2E7X A;  2L54 A;  2GLO A;  1WJC A;  1XDU A;  2Z9O A;  5B66 C;  2JRM A;  4BY1 J;  4I09 A;  3U1K A;  4BXF A;  1BIA A;  2NVX J;  2Y0S A;  2X85 A;  3K4M A;  4M72 A;  5TRD A;  1E3O C;  2P7C B;  3BCA A;  4CZZ A;  4RB2 C;  3RDI A;  1HF0 A;  1X4O A;  3BG5 A;  1XGN A;  4NEL A;  2DFI A;  3MZH A;  2JA7 J;  3HKZ A;  3G6E I;  3TP3 A;  3GCM A;  5DS9 A;  1RI7 A;  2YVE A;  2A6E F;  5K58 A;  1I3Q J;  2X1D A;  4D1Q A;  2V9K A;  4HKU A;  4KUM A;  1HKQ A;  3CUO A;  3N4M A;  3C3W A;  6PAX A;  3E5U A;  5D8L B;  3I54 A;  1T38 A;  4XKW A;  2BHZ A;  5CVJ A;  2FBQ A;  2HYT A;  2QQA A;  3AKZ A;  2PFV A;  3FXK A;  5LEJ A;  2DYR H;  4NBQ A;  4Y33 A;  5F0H A;  2TCT A;  2WAQ N;  4O3M A;  5F0C A;  1HC8 A;  5ICF A;  2HGC A;  4IL6 C;  4E6K G;  2UUZ A;  5K7F A;  1WVR A;  1MW7 A;  2XSD C;  1ZR2 A;  2AXT C;  2K9L A;  4OMZ A;  4B44 A;  3BG7 A;  4LFU A;  5ILU A;  1OYI A;  3HG9 A;  5LHI A;  2PN6 A;  4LK0 F;  1JTY A;  1YTY A;  1PDN C;  2H6C A;  3BR1 A;  3HSF A;  3TBI A;  1TW3 A;  2OV7 A;  3CCS I;  4ITV A;  3W3C A;  3VFZ A;  2BVM A;  1SD6 A;  1WJF A;  1I1G A;  3BDD A;  4Z6Y A;  4WCG A;  3OYG A;  2M4K A;  3HDD A;  3PFY A;  1SFU A;  3OYI A;  3LFK A;  2P0W A;  2HKO A;  2LY2 A;  2MW8 A;  4HNV A;  4UDS A;  2R92 J;  3KP7 A;  3GX4 X;  1J59 A;  3QAH A;  3RQ4 A;  4U0Y A;  4NQW B;  4D7N A;  2ZXI A;  2R7O A;  3BRO A;  2F5V A;  2K3F A;  4EJW A;  4O5V A;  3DPL C;  5IY5 H;  1IRG A;  2MSY A;  3G7R A;  3IH3 A;  3IUO A;  2WB1 A;  3LQR A;  4XRF A;  5E3O A;  4U9L A;  3AG1 H;  1IW7 F;  1IXC A;  1ZGA A;  4ZYE A;  3RI4 A;  4ZYH A;  3BCG A;  5FLX Z;  1P7J A;  2X6X A;  4CSW A;  5EEA A;  4HBL A;  1FP1 D;  4I01 A;  1IRZ A;  1GDT A;  1WFX A;  4G8X A;  3MKL A;  5M5X J;  1ONV A;  2H27 A;  3CWR A;  1Y0U A;  3COA C;  1MND A;  1TBX A;  5K1Y A;  1PUF B;  4IRI A;  3BNI A;  5E79 C;  1WWX A;  2FMY A;  2M87 A;  2ZXW H;  4PCQ A;  1K6Y A;  4HX8 A;  2CO5 A;  1MJA A;  1K7A A;  4Q5S F;  1S3J A;  4CZC A;  4CH7 A;  3GW2 A;  5ILS A;  1TWG J;  5L3B A;  3ZR8 X;  2WC2 A;  5KHD A;  3F8N A;  2MYS A;  4KWA A;  3ANP A;  2MLG A;  2LBF A;  3FZV A;  2BW3 B;  2HYG D;  3S2W A;  4F91 B;  2EZI A;  3AAF A;  3FXR A;  4BHC A;  3V42 A;  3Q3S A;  1WZ2 A;  2L7M P;  2JT1 A;  1Z77 A;  2A3S A;  3OYK A;  2ZKZ A;  4JQF A;  2NP3 A;  1OMI A;  1OPC A;  2H8W A;  2IW5 A;  1VF9 A;  1TWA J;  4HQM A;  3MKZ A;  3PIP F;  2BXY A;  3TDU C;  3FMR A;  4IX7 A;  5D5V B;  3OYN A;  3PNY A;  2R7Z J;  1R6R A;  3IAM 2;  1RR7 A;  2B7E A;  2NOJ B;  1Y1W J;  1YYV A;  3G1L A;  2QKO A;  1J75 A;  4B4C A;  1D0X A;  3F8C A;  2EZK A;  5LBQ A;  5D6E A;  2EFO A;  2XHK A;  2OBP A;  1V3F A;  5EGO B;  2JUC A;  2QA4 I;  3GLL A;  4CGR A;  1IN7 A;  2BBY A;  1CQT A;  2FRH A;  2GBY A;  2KMU A;  3BOQ A;  2G7L A;  4RMN A;  1Z0X A;  2JVG A;  2Q2E B;  3D5S C;  3QRF F;  1IRX A;  1MBH A;  1R49 A;  3AQS A;  5IP9 J;  3H0G J;  2W57 A;  3U1D A;  4L9T A;  3NRV A;  4EGY A;  4FX4 A;  5E3M A;  4FCY A;  1QU3 A;  1B9M A;  2YPR A;  1POG A;  2FE3 A;  2E5Z A;  2WY7 Q;  4HA8 A;  2STW A;  4HX7 A;  5H6R A;  4FAS D;  4OIQ F;  5DCM B;  5LGN A;  3QKX A;  3HOS A;  2P81 A;  3BG6 A;  5CVR A;  3CDI A;  5M3F J;  1W1W E;  4QPQ A;  3PQK A;  1JKP C;  5ED4 A;  3RKY A;  2MAB A;  5IYB J;  2OUM A;  2VC1 A;  1G3T A;  3H3Z A;  5EYR A;  2XRO A;  2W82 A;  4HZF A;  2G9W A;  2LR8 A;  4KDP A;  4M3D A;  5HLT A;  4CA0 A;  3B6C A;  2CRG A;  1YIO A;  1R1U A;  2L9R A;  1FT9 A;  3JCU C;  1Q1H A;  2JQ7 A;  3CCL I;  1YJ9 I;  4IHW A;  1P4W A;  2LY1 A;  5F1J A;  2A6H F;  1ZRE A;  3GTJ J;  3DU6 A;  3JSO A;  3LSR A;  2HNH A;  3J7A O;  4FE4 A;  4YII A;  3M4O J;  2LF8 A;  2A05 A;  1IDY A;  2RQP A;  3SWH A;  1IAW A;  4FIS A;  3GVA A;  2DFF A;  1FYL A;  2LYC A;  4PJL A;  3KZ9 A;  1U6G A;  1B9N A;  3FX3 A;  5DUK A;  2EFN A;  1FJL A;  2G7S A;  3GWZ A;  2M7B A;  3H9G A;  3GXO A;  2K7L A;  2V79 A;  2ICW G;  2FQ3 A;  1NH3 A;  2E5N A;  1FP2 A;  5D5X B;  2H09 A;  3BR2 A;  2PQ8 A;  2FBH A;  2AHQ A;  4GGG A;  2D5V A;  2EIM H;  3F8B A;  2R93 J;  1EA3 A;  4HDV A;  3F1B A;  2PMZ A;  4WXD A;  1YG2 A;  3TMO A;  4UY8 I;  4G9Y A;  4DGW B;  2X6W A;  2L7F P;  1ETQ A;  4CYC B;  5AIQ A;  1JKR C;  3O8H A;  5CYV A;  2LRD A;  4OU0 A;  4BS9 A;  5CXG A;  1FMV A;  3FMQ A;  1S72 I;  3KEQ A;  3HIM A;  5IT9 K;  3R6S A;  2HOA A;  2HPI A;  4RM2 A;  1I50 J;  3QYB A;  5FMP A;  3VB2 A;  2DDB A;  3WTU C;  3IV5 A;  3EYY A;  1LKX A;  2W48 A;  3HTU A;  3EUP A;  2ADU A;  1FC3 A;  1SAX A;  1JJ8 C;  1ETO A;  4GCT A;  2YU3 A;  3L2C A;  1OCZ H;  2L2O A;  2LLK A;  1TTY A;  3G56 A;  1W5T A;  1OJL A;  1B6A A;  3VSL A;  4XON A;  5LHH A;  1V55 H;  2IJL A;  4RLF A;  4YZE A;  3NAU A;  1U9N A;  2K4J A;  5J1R A;  2KIM A;  5HLG A;  2JTV A;  2O61 A;  1R5I D;  5LHG A;  5EG0 A;  3GZ6 A;  2RDP A;  3FKI J;  3OYF A;  1JKQ C;  3WGI A;  4BJ5 C;  4XLF A;  4AC0 A;  2PX9 A;  3VP5 A;  2DA4 A;  3FDY A;  2ZFU A;  3RYR A;  2EFW A;  3NEU A;  1UG2 A;  2A69 F;  2DAO A;  3OS0 A;  3KKD A;  3A4C A;  2DMN A;  1KQ8 A;  1ZG3 A;  4MEY F;  4MFE A;  3ZQC A;  2DOF A;  3IP4 B;  5FO5 A;  2JA8 J;  3GZN B;  2HOT A;  4ZC3 A;  4GCL A;  1U8B A;  3GYH X;  2HTS A;  1ZAR A;  1L3L A;  3ML6 A;  3MEX A;  3RKW A;  2GOX B;  4QWQ A;  1KU3 A;  1SAN A;  1TQP A;  4FTH A;  2K85 A;  2QWT A;  3AL0 B;  3JRB A;  4ENN A;  1T0F C;  3ABL H;  3ZOB A;  2R5Y B;  5LEK A;  5LGU A;  2Z16 A;  3HZJ A;  2B9S A;  4MXM A;  2M5W A;  2AXL A;  1FOW A;  1I6X A;  4JBA A;  5BMZ A;  2I8D A;  3BZC A;  5KVR A;  2MA3 A;  1AA7 A;  3GUD A;  1YLF A;  4IHV A;  2W84 A;  2PLY A;  2HZD A;  1T8I A;  2XB0 X;  2DYS H;  4OIP F;  1Z1D A;  2ECC A;  3FWE A;  4LG0 A;  2VOO A;  3QP6 A;  4PK4 A;  3L00 A;  4KIB A;  2ZNY A;  3EUH C;  3F3X A;  2LC2 A;  3WGH A;  5J1U A;  4RAF A;  3GTP J;  2V6E A;  2DJN A;  2D6Y A;  3RZD J;  3DU5 A;  4S05 A;  1X4P A;  5E1W A;  1R7J A;  2VKD A;  4CCJ A;  2VIX A;  5E1X A;  4BQQ A;  3ZMU A;  1JT6 A;  1LVK A;  4CUG A;  4KIF A;  2STT A;  1LEB A;  2F2E A;  4OIO F;  2PJR B;  2OZ6 A;  1ZTR A;  1TWF J;  4KMU X;  2HEO A;  2B3W A;  4RGR A;  3OYA A;  1B72 A;  1XGO A;  2VT3 A;  2ZJR F;  3AFH A;  5M5Y J;  4WXH A;  3S16 J;  4AF5 A;  1IV8 A;  5HAW A;  2IP2 A;  2XKO A;  4A3J J;  3QOD A;  2CW8 A;  2JRT A;  1Y56 A;  2QCO A;  1T08 B;  1ON1 A;  2P8T A;  4RAY A;  2VB6 A;  1OCP A;  2XGE A;  2CUZ A;  1DQU A;  1E2X A;  2XAS A;  1ZH5 A;  4Y52 J;  5DV5 A;  1WGX A;  4Q47 A;  3CMA I;  4NC6 A;  2GFN A;  2KIQ A;  3ZMV A;  2JA2 A;  2CS3 A;  1P9Q C;  4U9N A;  2UXI A;  3DEW A;  2ZME B;  2BEO A;  1U9O A;  5BOX A;  4R8H A;  4ME9 A;  1X1D A;  2UXN A;  3U9G A;  2HZT A;  1TNS A;  4R1H A;  3SFZ A;  3D0S A;  4DYC A;  1R5H A;  3ZP5 A;  3Q5F A;  1CF7 A;  4EEF G;  5JR3 A;  1X1B A;  1B1B A;  5K5O A;  5D18 A;  1MDM A;  2L01 A;  4A3C J;  1K61 A;  4HNT A;  5GPA A;  3SJM A;  2DBB A;  4D5C A;  1RKT A;  1UZC A;  3V6G A;  2IEK A;  1J2X A;  1EH7 A;  2ZME C;  2ECB A;  1VFC A;  2R7T A;  1JUS A;  4MO7 A;  5H9T A;  1WKM A;  4A12 A;  3GFI A;  3CJQ B;  2WAD A;  2XB5 A;  5HSZ A;  3ZCO A;  2BY2 A;  1VQO I;  2W4S A;  4CYD A;  2RRE A;  1P92 A;  2MD0 A;  3CCM I;  3ZPL A;  1P4A A;  1ZKG A;  1UB9 A;  2KPM A;  2ESH A;  2V1D A;  3KLN A;  1UHM A;  3KLO A;  1MJB A;  2COM A;  3DWL E;  1SVO A;  3HUG B;  3LMM A;  1G59 A;  2LNB A;  3H36 A;  3E5Q A;  1MSF C;  2A6T A;  3HPG A;  2FA5 A;  1MBF A;  1U0J A;  1W7P D;  2E36 A;  2DPD A;  1B59 A;  4AIH A;  4NDL A;  5EF6 A;  1QPI A;  1VQL I;  1J9I A;  3LHQ A;  4I2O A;  5CJ9 A;  4IQJ A;  1S6L A;  3I9V 2;  5ICC A;  3HTJ A;  4DW6 A;  2MG4 A;  3OYM A;  2QBY B;  2DTZ A;  1HBX G;  2GEN A;  4P1W A;  1TQM A;  1J0R A;  2MD5 A;  4PGG A;  1N25 A;  4AYB N;  3BJO A;  4L5I A;  4HLY A;  1RKW A;  2JPB A;  4IHS A;  2PMH A;  1HXD A;  1G3S A;  3H3V K;  2EIN H;  3HJE A;  4LGW A;  1BR1 A;  2EPF A;  2KDO A;  4PJJ A;  3ZMS A;  4IEJ A;  5AIP A;  4WX9 A;  4EQQ A;  2HQA A;  2DT5 A;  2KIF A;  4G7H F;  2HYJ A;  5CXI A;  1XG1 A;  3VPR A;  4MFD A;  5J8F A;  3HRU A;  1HLV A;  2XGD A;  3M1C A;  2EV5 A;  1LJ9 A;  2GA1 A;  1FYK A;  2Q1Z B;  2RNJ A;  5M5W J;  3CP2 A;  3K10 A;  3W2V A;  2W00 A;  3FXU A;  1ITY A;  2Y30 A;  3FM5 A;  2VKE A;  1KU9 A;  3P7N A;  4PUS A;  3I5U A;  2LVS A;  2J5O A;  2P7V B;  2BXZ A;  4L9N A;  2EK5 A;  4Y3O A;  3FXL A;  3HL2 A;  3IUV A;  4L18 B;  4J01 A;  5F08 A;  1BI0 A;  2R7X A;  1VQ9 I;  3HKZ N;  5EDN A;  3HRM A;  4PGH A;  1SFX A;  2ZJQ F;  4ESJ A;  2FML A;  1YHQ I;  1QZE A;  1K78 B;  1W4M A;  3OIP A;  3REO A;  3PUB A;  4PZJ A;  3VTI A;  3MQ0 A;  1QPM A;  4C30 A;  5BPD A;  1W7P B;  1VQ5 I;  5D19 A;  1ZG5 A;  2BOL A;  4N0B A;  4EMS A;  3I4M J;  2HTJ A;  2IVM A;  5L3D A;  3JRI A;  1O3S A;  4E70 A;  4I02 A;  3ZN1 A;  2A07 F;  3S1Q J;  3E0J B;  3CCY A;  3HTS B;  3Q9V A;  3LNQ A;  1PVE A;  1T39 A;  3OYH A;  4HRI A;  3CO7 C;  5DD4 A;  4MK6 A;  1F1Z A;  2CV0 A;  2DFE A;  3S3M A;  4L5E A;  3KP3 A;  1O7L A;  3OY9 A;  4XRS A;  4RA2 A;  3PJR A;  1TL8 A;  2NP5 A;  3DLL F;  1RNL A;  4GFB A;  2K02 A;  1DUX C;  3V7C A;  2NOG A;  2M3A A;  2EQR A;  3O2P E;  4FHT A;  4L0Z B;  3LA7 A;  1R5G A;  3CP8 A;  2LMD A;  5H2F C;  5FD6 A;  4Y13 A;  5F1R A;  2R7W A;  1RR8 C;  2DA7 A;  3TOA A;  3S1R J;  2BV6 A;  2R7V A;  3BPV A;  4PJN A;  4WXC A;  2VQC A;  3PO2 J;  4ZYD A;  2OC6 A;  4XLE A;  1XD7 A;  2ETH A;  5D5U B;  1XSD A;  2WB1 N;  3M8J A;  4JX4 A;  4DJA A;  4XRM A;  4XID A;  1FSE A;  4BUP A;  5J3L A;  3NQO A;  4UV8 A;  2LKP A;  3WGG A;  1NK3 P;  3EYI A;  1TW2 A;  3SXY A;  4HF2 A;  3HEF A;  2A5W A;  2XSJ C;  3E7Q A;  4CHU A;  5CVV A;  1LPQ A;  2ISZ A;  3JRD A;  2DCE A;  1O3Q A;  3RH2 A;  2LOO A;  3ZMD A;  2V1X A;  2DT7 B;  1X1A A;  1APL C;  1KU7 A;  2RNG A;  1YS6 A;  3JSJ A;  4HV6 A;  3LSJ A;  1XSX A;  1KGS A;  1R58 A;  2OZU A;  3OOU A;  2CYY A;  3MWM A;  2F5F A;  4A6E A;  1JHH A;  2EFP A;  2LKS A;  3SDB A;  5J8C A;  1MMG A;  2DQR A;  2YX7 A;  1IN5 A;  1W5C C;  4HOB A;  2YVH A;  2DFH A;  2JSP A;  1OQY A;  3HPH A;  3I55 I;  1JUM A;  3ABU A;  4XLP F;  1J5Y A;  1FY7 A;  2Q8K A;  2F4I A;  5FD5 A;  4AU7 A;  2EBI A;  2L0K A;  3F22 A;  1LB2 A;  3A1Y A;  2O8X A;  4IVN A;  2V6C A;  1SFO J;  3OV8 A;  1FTT A;  4Y15 A;  3GZ5 A;  3HYI A;  1BC7 C;  2GIZ A;  4LB5 A;  4DQ2 A;  2XKP A;  3DTK A;  2HWV A;  1YE9 A;  3K4B A;  1D8K A;  1MZB A;  1QHG A;  3GME A;  2K4B A;  4C2U A;  2GUH A;  2QLZ A;  3BQY A;  1R1T A;  4I0B A;  3ZQQ A;  3F8M A;  5FKN A;  3KP5 A;  3K4N A;  2H8R A;  2TDX A;  4FQG A;  1LQ1 A;  1XCB A;  1GT0 C;  2CV2 A;  3QYF A;  2KHM A;  2IGK A;  4UUV A;  2LP0 A;  3WTZ A;  4HYE A;  3IHU A;  4P9F A;  1MSE C;  3CTA A;  4NB5 A;  2VJ4 A;  1FOK A;  2RN7 A;  3LAP A;  4BQA A;  3LSI A;  2R5Z A;  4UVB A;  3S32 A;  3HGY A;  3LL7 A;  2XPV A;  4NC7 A;  4MIM A;  4U0V A;  2XPU A;  3IH4 A;  3ISP A;  2VON A;  2VPR A;  2VE9 A;  2CFO A;  3BG9 A;  2V1U A;  2MH2 A;  4IHX A;  4L5J A;  4HX4 A;  5FJ8 J;  4N4O B;  1F36 A;  1IZ1 A;  2WAE A;  3CCU I;  4AM3 A;  2HQR A;  2OD5 A;  5E18 F;  1FOY A;  1UI6 A;  3E6D A;  4IXA A;  1VQP I;  1IN4 A;  2ZOY A;  1KYZ A;  5HS7 A;  4RGS A;  1X3W B;  3F9K A;  4M3E A;  4ZDO A;  1LNW A;  1D0Y A;  3PPB A;  2K9S A;  4EM1 A;  5ICE A;  2QSG X;  1KON A;  2G7G A;  3HOU J;  2QKM B;  1OCO H;  1QVT A;  2L7K A;  3M07 A;  4OD5 A;  3CLO A;  3KET A;  3RD3 A;  1IUY A;  4M6V A;  2ZXJ A;  1Y8R B;  2HU9 A;  5KAI C;  2AS5 F;  5DCM A;  3FXJ A;  1NG6 A;  5HLH A;  4KT5 C;  2KL4 A;  2O5R A;  2XAH A;  3G2B A;  5FRM A;  1UST A;  1REP C;  1WJ5 A;  4KN7 X;  4UVA A;  1X2N A;  4ZDP A;  2DQL A;  4A5M A;  2E1N A;  2CQK A;  3H9J A;  4XNF A;  2M1B A;  1SFK A;  5GAD J;  2LH9 A;  3TOB A;  4GCV A;  4KIT B;  3F72 A;  3Q0V A;  5D8K B;  2LSO A;  3MZY A;  3W2W A;  3DPJ A;  4A0Y A;  4KIG A;  1XMX A;  4BEH B;  2XDV A;  2PMZ N;  4CCL A;  4BAY A;  1XSV A;  3BTL A;  4KNY A;  2JPC A;  3GF2 A;  4BYY A;  3ZMT A;  1MH4 A;  3CUQ A;  2F6C A;  4N9H A;  2KRH A;  2XPW A;  3ZQF A;  4ZZD A;  2Y2Z A;  4L9V A;  1D5Y A;  4UUS A;  3NXC A;  4II3 A;  3VW0 A;  2L7Z A;  5DUI A;  1ZLK A;  3OS1 A;  1ODD A;  3WHB A;  2MGQ A;  2BY0 A;  3NWT A;  4UHT A;  2LF7 A;  4XOT A;  1MJ9 A;  1SEU A;  1PP7 U;  1HKS A;  4J19 A;  3GFL A;  1P2F A;  1Z9C A;  1HA8 A;  3VDX A;  2M9H A;  3SEZ A;  1FMW A;  5K5Q A;  3COL A;  3C1D A;  3CQZ J;  1YIT I;  1XCV A;  4ZYG A;  3O3K A;  1E0E A;  2GA2 A;  4E7I A;  2QUF A;  3JSP A;  1Z91 A;  4LIT A;  4LIV A;  1IF1 A;  2A2F X;  2XDN A;  2ID6 A;  2HVR A;  1N75 A;  2NVU B;  3BY6 A;  3MN2 A;  5HLI A;  4DIQ A;  1MNM C;  2H94 A;  2MC3 A;  2CJJ A;  3EGQ A;  4K2E A;  1ZEL A;  3SEQ A;  1LDK B;  5A2Q K;  4JNN A;  4BNC A;  3TL4 X;  4AVZ A;  1QZY A;  3VYR B;  1H0M A;  3R4K A;  1SVL A;  4IRG A;  1G3W A;  4XRS G;  1K83 J;  2R0Q C;  2OCC H;  2QYO A;  5GPC A;  3F6O A;  1MBE A;  3ABT A;  4RB3 C;  1X3U A;  2FEZ A;  4WK8 F;  4CIC A;  1IGN A;  2VBZ A;  3PUF A;  1VZ0 A;  1XN7 A;  2ELJ A;  4UV9 A;  3OR1 C;  1XMA A;  2EFQ A;  4A3B J;  3FIS A;  3E5X A;  2EJR A;  1BOB A;  2RQQ A;  5D4R A;  2K86 A;  2QSF X;  3IKT A;  2LTP A;  3BJA A;  1DPR A;  3T1B A;  4IOC F;  1GLN A;  1WSU A;  4M3G A;  3CCR I;  4XOR A;  2DK8 A;  1JTX A;  5BPI A;  1OCC H;  1R36 A;  4A3F J;  3Q9S A;  3ABK H;  2KKO A;  4M71 A;  5GTI C;  2W53 A;  2VQG A;  3ELK A;  1O4X A;  1IN8 A;  2FNP A;  1AKH A;  2CG4 A;  4XM3 A;  3E7L A;  3HBL A;  1LE8 A;  1DU0 A;  3KE2 A;  4PJM A;  3A0H C;  2P5L C;  1UI5 A;  3MFK A;  4AWX B;  3LAJ A;  3MKY B;  3OYC A;  3QOP A;  3DKW A;  5LGT A;  1IG7 A;  4B3A A;  4C9Y A;  1ZRD A;  2IGO A;  1OR7 A;  4C3H J;  3A01 A;  3HRS A;  2ZCW A;  4QPO A;  3OYJ A;  1YOV B;  2JVH A;  4YFK F;  4II2 A;  1D8J A;  1OLT A;  4BHB A;  4JX5 A;  2LBF B;  1S8N A;  4WF2 A;  1UFM A;  2W7N A;  5J4V A;  3FKJ A;  2OER A;  2ESN A;  5D5W B;  2QF7 A;  2M45 A;  2DOA A;  2WWY A;  4KFC A;  1KU2 A;  3VVX A;  1W0T A;  3F21 A;  1BJZ A;  1X58 A;  3RTR A;  1DU6 A;  3S14 J;  4A3D J;  3CRJ A;  3W6J B;  1HST A;  4OMY A;  3VYU B;  2OJE D;  4G12 A;  2FJI 1;  3B73 A;  4EJV A;  1WJA A;  2IBD A;  3K1N A;  1Y8Q B;  1TP4 A;  5IP7 J;  1HDP A;  2L4M A;  2RV8 A;  1S5L C;  3BZ6 A;  4OAY A;  2ISY A;  1YJW I;  1VQN I;  3R0J A;  1FBQ A;  3CC4 I;  2ZCM A;  1SD7 A;  3QWL A;  3BJ6 A;  2QQB A;  3LA2 A;  1UAA A;  3R0A A;  3F6V A;  2XAF A;  1H9G A;  3PSI A;  3CJD A;  3FF5 A;  3MAJ A;  2NVY J;  1T98 A;  1R4M B;  3MCZ A;  2CGP A;  4XIC A;  1Z3X A;  1EV7 A;  2QTQ A;  3UNG C;  1WH5 A;  1YRN B;  5ERI A;  3H1C A;  4Y17 A;  5HVQ C;  3OYE A;  4KA4 A;  2HQ5 A;  3CC2 I;  2Z99 A;  1Z67 A;  3DKY A;  1WI3 A;  3WHC A;  4BY7 J;  2XF6 A;  3LOC A;  4GFL A;  3ESW B;  5J40 A;  4P55 A;  5KCM A;  5B1A H;  1ETW A;  1WCM J;  1T33 A;  3LSP A;  3SZP A;  4LLG F;  3KEO A;  2V4J C;  2NNY A;  2Y9Y A;  1YX3 A;  1S7O A;  2IRF G;  2P5V A;  1XDS A;  3ONQ A;  3QU6 A;  2ZO4 A;  2CQN A;  1E3H A;  1B8I A;  1JGS A;  4F55 A;  3JAM K;  1BR4 A;  1Z7U A;  2Z5U A;  4BE1 A;  3JW4 A;  3VIB A;  3WTY C;  5J1Y A;  3CJT B;  1JKO C;  3SQN A;  2FX0 A;  1ZG1 A;  2DU9 A;  3VOD A;  3K2Z A;  2QQ8 A;  5CVI A;  4Y7N J;  1U5T A;  2DO7 A;  1ZGJ A;  3RKX A;  1RIO H;  3PO3 J;  3RPQ A;  1ZHF A;  4MTD A;  5C4Y A;  2E1M C;  1V5F A;  2X1C A;  2NS8 A;  5GP9 A;  4A93 J;  3E3V A;  5IT9 Z;  1V5G A;  3KFW X;  2NYX A;  3FK6 A;  3KZZ A;  2YX4 A;  1QGP A;  1IC8 A;  2IS1 A;  3GBG A;  2EIK H;  3SHF A;  2HS5 A;  4A3G J;  1MNE A;  1MD0 A;  2OQG A;  1JHF A;  2O6G E;  2L9S A;  5EJC A;  4QLC U;  4BQN A;  3RQI A;  4U87 A;  1AOY A;  1Y39 A;  3IC7 A;  5E3L A;  2BE5 F;  4EAT A;  4ZZL A;  4S0H B;  4W1U A;  2HKX A;  4BHP A;  2ZBK A;  4ANJ A;  2K27 A;  1LVA A;  4G7O F;  4KJZ A;  1K79 A;  2ZSH B;  2FJ1 A;  5HDG A;  2VXD A;  4XKB A;  1HW5 A;  3WU0 A;  2HKU A;  2O7T A;  3V78 A;  4XQF A;  2CWE A;  1LUJ B;  1MBG A;  3WU2 C;  2WA0 A;  3GFJ A;  4X0G A;  4ZTJ A;  5LFA A;  4HV5 A;  2VOP A;  3HUG A;  5IP6 A;  3BWG A;  5GAG J;  4LOC A;  2V7F A;  4V19 K;  2IU5 A;  4AID A;  2VBY A;  2KIS A;  2VJI A;  1TWH J;  4PXI A;  2VKV A;  2HQN A;  4OAZ A;  2QKL B;  3PNV A;  4F3Q A;  4IRH A;  4C3J J;  2XC7 A;  3BR6 A;  1YI2 I;  1WJB A;  1EH8 A;  2X9D A;  2FU4 A;  2WBM A;  3JRH A;  1IDZ A;  2A5Y B;  5B5E C;  3M1E A;  2PBX A;  2XV4 S;  4ACI A;  4D5F A;  3CF2 A;  2VBX A;  4RDU A;  1WQ2 A;  3L2U A;  2L9V A;  1IXS B;  3OS2 A;  4FT8 A;  3TDZ C;  2JSC A;  4UNO A;  2CQX A;  4BJ6 C;  1ETX A;  4ZTF A;  4BXU A;  2EZL A;  3V7R A;  1D0Z A;  1HQC A;  3KX2 A;  3C7J A;  3I0T A;  1GUU A;  1X1C A;  2HXO A;  4L9J A;  2Y48 A;  1OIS A;  3OYL A;  3QPT A;  2CUE A;  3HIF A;  3GTG J;  3DEE A;  2BY3 A;  5AQC A;  3GEZ A;  4W97 A;  3I59 B;  4P96 A;  4BBS J;  2M2E A;  5EG0 B;  3V8L A;  4F52 A;  2NNN A;  3ABM H;  1BC8 C;  2YR2 A;  1A31 A;  3J80 K;  2VLA A;  1R00 A;  4GXO A;  1BM9 A;  5C4X J;  2F48 A;  3L09 A;  2KLO A;  3IWF A;  2YSR A;  1X1P A;  4EGZ A;  5DEQ A;  1RC9 A;  5EEG A;  1SD5 A;  1QBJ A;  2B63 J;  3ZQ7 A;  3M8E A;  3G4S I;  2IPQ X;  4B43 A;  2XIG A;  3ZQH A;  3CC7 I;  1H89 C;  1E3P A;  2WV0 A;  2GWR A;  1T6S A;  5AON A;  4YEL A;  2G0E A;  2YVX A;  3T5X A;  2HOE A;  3ROU A;  3T8T A;  3JRE A;  1BOA A;  3TGN A;  2QGU A;  1VQK I;  3L2R A;  3DXJ F;  3FK7 A;  2MLK A;  2X4H A;  1QVU A;  3BJB A;  3W2A A;  2IS4 A;  3M9A A;  2V1N A;  1FIA A;  1XTA A;  2UXU A;  4BBR J;  3NS4 A;  2ME0 A;  3GTO J;  1M1E B;  4G94 A;  4RAG A;  2LKX A;  3OSF A;  4PDK A;  1BN5 A;  1GVD A;  2QIB A;  2K9Q A;  4DVY P;  3HOT A;  2QQ9 A;  4I6Z A;  1O3T A;  2KQR A;  2XRL A;  4YFX F;  1HW2 A;  3S1N J;  3LSM A;  2PBI A;  2W1O A;  2IA1 A;  2O3F A;  3OL3 A;  4PSX A;  4HDU A;  1W0U A;  5HBU A;  1FLI A;  3HHG A;  2NVQ J;  4IHY A;  1I27 A;  5K5R A;  2UXX A;  5DAJ A;  4M3B A;  3DTE A;  2P4W A;  1ETY A;  2VE8 A;  4C2M A;  1B72 B;  2JZY A;  4GFK A;  3GO5 A;  2F07 A;  3HE0 A;  4ZJZ A;  3VOX A;  3SYT A;  1ULY A;  4OIR F;  2Z33 A;  1A6I A;  5BNG A;  2L9N A;  3ZN0 A;  1HDD C;  2E34 A;  5FKL A;  3VW2 A;  1S7A A;  5GAH J;  1UMQ A;  3VEP A;  4MEX F;  1A04 A;  2PG4 A;  3CCE I;  3K7A J;  3VOK A;  1D3Y A;  2DK5 A;  1OCT C;  3GZI A;  1QO0 D;  4IZZ A;  1K4T A;  3KIO A;  2L02 A;  2F5E A;  3ECH A;  1O7F A;  4XLA A;  1UG0 A;  1TC3 C;  3NI7 A;  2LFB A;  4U7D A;  2MC4 A;  3FRQ A;  3ON2 A;  2G3B A;  2ZJ2 A;  1YJN I;  1J09 A;  2YUS A;  3JRA A;  4BU2 A;  1WPK A;  3LJL A;  2QM3 A;  2Y0S N;  5F27 A;  1WH7 A;  2EA2 A;  4FX0 A;  1USS A;  1GXQ A;  1G8X A;  2M8G X;  3IH2 A;  1A35 A;  3WTX C;  3BLY A;  2CSO A;  2W24 A;  4Y4R A;  5LRR A;  1T95 A;  2WY8 Q;  5J47 A;  1MMS A;  5LRS A;  3CES A;  3KYD B;  5GTH C;  2GXA A;  4NUB A;  4E4H A;  3S3O A;  4HW0 A;  3HOZ J;  2CH0 A;  4Z2Y A;  4B8X A;  2PJP A;  2HDC A;  3TO7 A;  4ENK A;  1I1S A;  5CW8 A;  1KQ0 A;  2OAZ A;  1SFE A;  3F23 A;  4X6A J;  3D5L A;  2VJ5 A;  3WE2 A;  2KJC A;  1R22 A;  3RPU A;  2LD5 A;  3QPS A;  4LLL A;  3L7W A;  1E17 A;  1H88 C;  3G1M A;  2X6Y A;  4F93 B;  3I4P A;  5FRN A;  4JKZ A;  4YRV A;  2KJB A;  4AD9 A;  2UWM A;  3GFM A;  1P4X A;  4UB8 C;  4A69 C;  3OL4 A;  4L62 A;  3D5R C;  1WJD A;  1A6Q A;  3BCB A;  3J81 K;  5DDG A;  2D45 A;  2E19 A;  2DT6 A;  3HTI A;  3HSE A;  1VQ4 I;  5IOY A;  2V57 A;  4RGX A;  1TLH B;  3OOP A;  1UHS A;  1FSH A;  3OYD A;  1MMD A;  4D9J A;  2R7R A;  3BP8 A;  3M3Y J;  1EF4 A;  4M9X A;  4JL3 A;  3OIQ A;  1KQ9 A;  3T0Y A;  4BH9 A;  2QEN A;  4GDF A;  1JE8 A;  4I76 A;  2MBF A;  2QOP A;  3JRG A;  3FHN A;  5JFR A;  2CFX A;  1TT0 A;  4CGZ A;  2H6B A;  4IPA A;  1Y6I A;  3CZ6 A;  1ENH A;  4KT6 A;  5CPR B;  3ZMZ A;  2UZK A;  2OA4 A;  2RAS A;  1T56 A;  4GRI A;  3HC7 A;  5D1R A;  2VQH A;  1D1B A;  3DEU A;  4NQW A;  2PMU A;  2XF7 A;  2XAU A;  2KFD A;  4FE7 A;  1RES A;  2Y0M A;  9ANT A;  5B1B H;  1ZGW A;  4N4N B;  1QZZ A;  3S5R A;  2Z2S B;  3CDH A;  2WAF A;  1J7K A;  4I98 B;  3QOE A;  1LFP A;  2JJ7 A;  3CMY A;  3K70 D;  4AYB A;  4XSZ F;  2X1E A;  2XF5 A;  5E3N A;  1LDJ A;  3BG3 A;  2XAJ A;  4B1R A;  1BI3 A;  1P7I A;  2E71 A;  2Y75 A;  3CLQ A;  4CCM A;  4HF0 A;  3C07 A;  3DPU A;  3LWF A;  5IT3 A;  3E1S A;  2FF4 A;  5FKK A;  3J7A Y;  2BGC A;  3QQA A;  1H9T A;  4E7H A;  1PUF A;  3MKW B;  2DLL A;  3HB9 A;  3BRU A;  3C2G A;  2DW4 A;  2O03 A;  3EPZ A;  3I4N J;  1JGG A;  1HKT A;  1VQ7 I;  3VVY A;  2B0L A;  4XSX F;  1I6H J;  2VL8 A;  4CCK A;  3HOY J;  2L4A A;  2OCE A;  3I64 A;  2HXI A;  1MIJ A;  4LJZ F;  2RAE A;  1KYW A;  1Z6T A;  1FWZ A;  4DYQ A;  4DNC A;  2E2J J;  1ZQ3 P;  1G6N A;  2KDZ A;  1JXS A;  1FYM A;  2BW3 A;  2JWT A;  4A3I J;  2I10 A;  2NS0 A;  5CQG A;  3ASO H;  1X3Z B;  3VYS B;  3WE3 A;  3CJR B;  1ERD A;  2WGB A;  3H92 A;  4RAZ A;  1BA5 A;  3P9T A;  3LWJ A;  1NG7 A;  1RET A;  5FLX K;  2O7O A;  1STZ A;  3G3Z A;  1IRF A;  1EH6 A;  2A61 A;  3GEU A;  4ICH A;  3HXL A;  4M9S A;  3BR3 A;  3CF5 F;  3HOV J;  2E1M B;  2DMP A;  2NS7 A;  4HSR A;  5FKM A;  1G4D A;  4H4K C;  1IN6 A;  2DA6 A;  5L3G A;  1WRJ A;  2XAG A;  4LLN A;  4G6Q A;  2GOM A;  4U88 A;  5FKO A;  4BDY A;  3R61 A;  3LST A;  1GVJ A;  2GXB A;  1QHH D;  2IS6 A;  4I0A A;  2ELK A;  2AQF A;  2XGC A;  5HDK A;  1JUP A;  1UEL B;  3RCO A;  3A03 A;  3Q0U A;  5JHU A;  5EGO A;  4ENM A;  1AU7 A;  2M7A A;  1YW9 A;  3FXM A;  4YIR X;  1XB4 A;  3K1P A;  3LSK A;  3H0D A;  4XN3 A;  1RUN A;  5F04 A;  4G6D A;  1BJA A;  5FRO A;  3ERE D;  3CCV I;  2IS2 A;  3KYL A;  2Q2E A;  1Z05 A;  5F64 A;  3G1O A;  3CO6 C;  1XPX A;  3O8G A;  3I3L A;  5D4S A;  4DOZ A;  3C2B A;  4CCN A;  1ZRC A;  4V2F A;  2AQE A;  2EB7 A;  3TO9 A;  4EJT A;  1S7E A;  1W36 D;  4PFO A;  4HG2 A;  2DJI A;  4EV0 A;  4Q4Z F;  3X2Q H;  3S1M J;  5FGL A;  3UR3 C;  3V8J A;  3DP7 A;  1Z21 A;  1QA6 A;  3K70 C;  3CCQ I;  3TO6 A;  4OD4 A;  4HEA 2;  5IYC J;  5JLX A;  4EM2 A;  4A0Z A;  4XMY A;  5CVU A;  3IKV A;  5FGM A;  2DG7 A;  4O6J A;  2DA3 A;  4XN0 A;  3DBL B;  3PQJ A;  1GV2 A;  1IXR C;  4ZDL A;  3K0L A;  2FQ4 A;  3ZRG A;  5KNL A;  1VQM I;  1EJ9 A;  1MBJ A;  5BS6 A;  4KN4 X;  2J5P A;  3GTK J;  2VQL A;  5M3M J;  4IHT A;  1U3E M;  2CQ7 A;  4BDZ A;  4P9U A;  1Y1V J;  2EIL H;  4I7H A;  1VQ6 I;  2RHA A;  1Q1V A;  5IOZ A;  4C2M J;  3GLX A;  3I71 A;  5K7H A;  3BPX A;  4MTE A;  3T8R A;  4F92 B;  3VW1 A;  3WTV C;  2D1H A;  1DPU A;  1HOM A;  3VWB A;  5E20 A;  1ZLJ A;  1JT0 A;  5JHF A;  2NVT J;  1R4N B;  3P5J A;  5EEH A;  2HI3 A;  4E7J A;  2DA1 A;  4LG3 A;  4YFN F;  3N05 A;  1XGS A;  3KP4 A;  1G2H A;  1Y0N A;  3K4J A;  1ETK A;  2D1V A;  3WOD F;  4CYC A;  3I53 A;  2CW7 A;  3V8K A;  1YQA A;  3DV8 A;  2FOK A;  3IWZ A;  4D7M A;  4ZYA A;  2OI8 A;  4MQ9 F;  3S93 A;  1ZYR F;  1FBS A;  4KIC A;  4XR6 A;  4A0X A;  3PL8 A;  3JR9 A;  3VSK A;  2R5Z B;  3FXQ A;  4KMF A;  3DKX A;  1GXP A;  3S2D J;  3ON4 A;  4A3K J;  4B3X A;  5JLW A;  1K4S A;  5HOO A;  4PSW A;  2XVC A;  4YEJ A;  3FHZ A;  5LLQ A;  2WAQ A;  3ANG A;  1FX7 A;  2JN6 A;  3CME I;  1LDD A;  2HYF A;  3LSG A;  2K9M A;  2FNA A;  4AIK A;  1YRN A;  3K4C A;  4RB1 A;  1NHA A;  1W5S A;  1KZH A;  2ZY9 A;  4BKX A;  4E7L A;  4B47 A;  4JYK A;  1BR2 A;  1W36 C;  1L0O C;  2MFZ A;  4JX6 A;  4R79 A;  3E97 A;  2E2H J;  3TP0 A;  3V4G A;  4E7S A;  2ZOZ A;  1BW5 A;  3K2A A;  1D1C A;  4MLO A;  1LFB A;  1XX5 A;  4MQV A;  5FB2 A;  4M6Y A;  4RLQ A;  3H3U A;  1FZP B;  3SFI A;  2DDA A;  1T0F A;  4PJ0 C;  3EUK L;  1P6R A;  2WTE A;  2CMP A;  2LY9 A;  3MZ8 A;  5D6F A;  2NXN B;  1G3Y A;  2MH9 A;  3I58 A;  4DBR A;  1N77 A;  2REK A;  4PFP A;  5E1Z B;  3FMS A;  1R71 A;  1TZL A;  1S29 A;  2DA2 A;  1IO2 A;  3C18 A;  3BR0 A;  3KYC B;  2V9V A;  3P9K A;  3NRG A;  2ELH A;  4DBQ A;  3IRQ A;  3BHQ A;  3BT9 A;  4HNU A;  3KZY A;  1Z3Y A;  3EUH A;  2IA0 A;  3FBN B;  4EVI A;  3L2V A;  2Y31 A;  1YX5 A;  1N78 A;  1X2M A;  2VKH A;  2VAS A;  4DYR A;  2R5Y A;  2DXI A;  2M30 A;  3S8P A;  4G6T B;  2KZG A;  1TWC J;  3SDG A;  3L1P A;  3CUQ B;  2YU9 J;  1B4A A;  1SMT A;  2O0Y A;  5A2Q Z;  3IL2 A;  2HVQ A;  2COB A;  5F6F A;  4UUS B;  4U7B A;  2OTL I;  1OFC X;  2IGM A;  4NNJ A;  3LQQ A;  2HPM A;  1SMY F;  1SAU A;  2VOD A;  2UXP A;  1OYW A;  3F0C A;  4H0E A;  3JTG A;  1K6O A;  3WTW C;  1Z6R A;  1WHU A;  2BVL A;  4IRV A;  5FHP A;  3O60 A;  3EET A;  2IAI A;  5ICG A;  3ZQL A;  2KP6 A;  2M0M A;  3VVZ A;  1BI2 A;  2E35 A;  3DCF A;  3K4K A;  2Y9Z A;  1F4K A;  4A3L J;  3CUQ C;  4ETS A;  1Z7L A;  4NHJ A;  2VBW A;  4HQE A;  4Q48 A;  4ENJ A;  5JI6 A;  1OKR A;  3H9Q A;  2L5Q A;  3EUA A;  2QZ8 A;  2OQR A;  2FBK A;  4OOI A;  2PJR A;  1F43 A;  1BI1 A;  5TGT A;  5GAE J;  5DM7 F;  2ZCX A;  1V4R A;  3KP6 A;  3K1M A;  3KZI C;  3QPH A;  2FSW A;  2GIV A;  3G71 I;  1U8R A;  1ETV A;  1RZ4 A;  5L3F A;  1SGM A;  3G73 A;  1OCR H;  5CLS A;  5L3E A;  2FUG 2;  1HSJ A;  2KIU A; 
#chains in the Genus database with same CATH homology
 4DZP A;  3UKG A;  1NK3 P;  1QVU A;  3BJB A;  3PM1 A;  5C44 J;  2DG8 A;  2EZI A;  1FIA A;  1VND A;  3HEF A;  2H1K A;  2UXU A;  3E7Q A;  4BBR J;  3JRD A;  3Q3S A;  3AQT A;  2ME0 A;  1IV6 A;  3GTO J;  2L7M P;  3ZQI A;  3RH2 A;  2LKX A;  1Z77 A;  3OSF A;  2JK3 A;  1GVD A;  1APL C;  1FEX A;  2NP3 A;  5EZH A;  2QIB A;  2K9Q A;  4I6Z A;  1VF9 A;  1TWA J;  2ZCN A;  3JSJ A;  4QSH A;  2XRL A;  5C4J J;  3LSJ A;  3GTQ J;  4GCK A;  3S1N J;  2R7Z J;  4A3M J;  3OOU A;  1W0U A;  5HBU A;  1RR7 A;  1Y1W J;  3G1L A;  2QKO A;  4B4C A;  4IHY A;  2NVQ J;  2M34 A;  5DAJ A;  3HGG A;  1AKH B;  2EZK A;  4M3B A;  2YVH A;  2KT0 A;  5EZG A;  1ETY A;  1LE8 B;  1JUM A;  5EGO B;  3JRF A;  2UXO A;  1B72 B;  3GTL J;  4GFK A;  3HE0 A;  2F07 A;  3VOX A;  1NTC A;  2PZ9 A;  4CGR A;  2EBI A;  2L0K A;  2X48 A;  2X6O A;  1CQT A;  2GBY A;  1A6I A;  5BNG A;  2G7L A;  1HDD C;  3A01 B;  1SFO J;  5FKL A;  1FTT A;  3VW2 A;  1Z0X A;  4QIW N;  1MBH A;  1UMQ A;  3AQS A;  5IP9 J;  3KKC A;  3H0G J;  4V2G A;  3VOK A;  3K7A J;  4DZJ A;  5E3M A;  1OCT C;  4FCY A;  3GZI A;  1POG A;  3HTA A;  2EH3 A;  2GUH A;  3BQY A;  2UXH A;  3NI7 A;  1TC3 C;  3QKX A;  2LFB A;  5FKN A;  3FRQ A;  3NNR A;  2P81 A;  3ON2 A;  1RPW A;  2H8R A;  2G3B A;  1R9T J;  2CU7 A;  2YUS A;  5M3F J;  3JRA A;  1WPK A;  1GT0 C;  3LJL A;  2Y0S N;  5F27 A;  1JKP C;  1WH7 A;  3QBM A;  3GTM J;  5IYB J;  2LP0 A;  5EYR A;  2HDD A;  3S17 J;  2M8G X;  3IH2 A;  2LR8 A;  1MSE C;  4M3D A;  1ZK8 A;  3HM5 A;  3B6C A;  2CRG A;  2L9R A;  2R5Z A;  4IHW A;  3BTJ A;  1LFU P;  2O8K A;  3QPL A;  3HGY A;  2XPV A;  5F1J A;  4MIM A;  1VI0 A;  2XPU A;  3IH4 A;  3GTJ J;  3LSR A;  2VPR A;  4FE4 A;  3NPI A;  3BG9 A;  3M4O J;  3HOZ J;  2LK2 A;  1IDY A;  4FIS A;  4IHX A;  3Q0W A;  5FJ8 J;  5CW8 A;  3TW7 A;  4C3I J;  1F36 A;  3KZ9 A;  4X6A J;  2DMT A;  1QRY A;  1UI6 A;  2LD5 A;  1FJL A;  2G7S A;  3QPS A;  3TED A;  3OSG A;  2N8G A;  1A5J A;  2ZOY A;  3T6N A;  1H88 C;  3G1M A;  2AO9 A;  3BR2 A;  4M3E A;  4JKZ A;  2K9N A;  2AHQ A;  2D5V A;  3PPB A;  2YS9 A;  2R93 J;  2K9S A;  2DA5 A;  2Q24 A;  3F1B A;  4A69 C;  2G7G A;  3HOU J;  1QVT A;  4X1E A;  4L62 A;  2L7F P;  3B6A A;  1B8I B;  1ETQ A;  2JMW A;  3RD3 A;  4CYC B;  4M6V A;  1JKR C;  3O8H A;  3RZO J;  5FLM J;  3KNW A;  2E19 A;  5CXG A;  1XS9 A;  3HIM A;  3HTI A;  4ABZ A;  1ORK A;  1MH3 A;  5IOY A;  1H8A C;  1X2N A;  2V57 A;  2HOA A;  5FMP A;  1UHS A;  1I50 J;  2HOS A;  3IV5 A;  3M3Y J;  1EF4 A;  2W48 A;  4JL3 A;  5DTD A;  3EUP A;  3Q0V A;  1HCR A;  3D1N I;  3DPJ A;  1JJ8 C;  3BTC A;  1ETO A;  5J3L A;  5IYD J;  4GCT A;  4I76 A;  2PMZ N;  4AUX A;  3JRC A;  1BL0 A;  3JRG A;  2QOP A;  3BTL A;  2LLK A;  1U78 A;  3G56 A;  1MH4 A;  1ENH A;  1OJL A;  3NAR A;  3BTI A;  2XPW A;  1D5Y A;  3ZQF A;  2Y2Z A;  3NXC A;  4UUS A;  2WUI A;  2RAS A;  1T56 A;  3VW0 A;  2JA5 J;  2L7Z A;  5D1R A;  4YZE A;  3NAU A;  1U9N A;  3S15 J;  5HOD A;  3WHB A;  5J1R A;  2MGQ A;  4FE7 A;  1RES A;  9ANT A;  1ZGW A;  2DMU A;  2TRT A;  3S5R A;  5EG0 A;  4J19 A;  5K7Z A;  4JP0 A;  2JJ7 A;  3FKI J;  3CMY A;  1JKQ C;  5E3N A;  4AC0 A;  3VP5 A;  3BG3 A;  2DA4 A;  2M9H A;  4B1R A;  1P7I A;  3COL A;  3FIW A;  3CQZ J;  2E1O A;  1GV5 A;  1UG2 A;  5F0F A;  3C07 A;  3KKD A;  5FKK A;  2K40 A;  2DMN A;  4MFE A;  3ZQC A;  5FLV A;  3QQA A;  2JA8 J;  3BRU A;  1PUF A;  3HB9 A;  2HOT A;  3I4N J;  1JGG A;  2XDN A;  2ID6 A;  1U8B A;  4GCL A;  3VVY A;  3MN2 A;  1BW6 A;  1FTZ A;  1MNM C;  2CJJ A;  1I6H J;  3EGQ A;  3HOY J;  1SAN A;  4FTH A;  4JNN A;  2QWT A;  2HXI A;  3BR5 A;  2RAE A;  3JRB A;  4DYQ A;  3ZOB A;  2R5Y B;  2E2J J;  1ZQ3 P;  2KDZ A;  4XRS G;  1K83 J;  2JWT A;  4A3I J;  2R0Q C;  4MXM A;  2I10 A;  3MVP A;  5GPC A;  3W6V A;  1MBE A;  5IPA A;  2WGB A;  1BA5 A;  3P9T A;  3LWJ A;  1IGN A;  4IHV A;  1RET A;  2O7O A;  2XB0 X;  2ECC A;  2JA6 J;  4A3B J;  3GEU A;  4UUT A;  3FIS A;  4ICH A;  3HOV J;  3BR3 A;  2E2I J;  2DMQ A;  2DMP A;  2NS7 A;  2LTP A;  5J1U A;  5FKM A;  3ZQG A;  3GTP J;  2DJN A;  4M3G A;  3RZD J;  2D6Y A;  5C3E J;  2DA6 A;  3BQZ A;  3RKQ A;  1JTX A;  4A3E J;  5FKO A;  4A3F J;  3HOX J;  2W53 A;  1O4X A;  2ELK A;  2O9L A;  1JJ6 C;  1AKH A;  1JT6 A;  2CQQ A;  2XGC A;  1JUP A;  3E7L A;  3HBL A;  3A03 A;  3Q0U A;  1LE8 A;  1DU0 A;  1ZTR A;  2ZB9 A;  4XK4 A;  1TWF J;  5EGO A;  1UI5 A;  1AU7 A;  1B72 A;  2ID3 A;  1IG7 A;  5M5Y J;  4B3A A;  3S16 J;  4AF5 A;  5F04 A;  2WV1 A;  3CDL A;  4C3H J;  2ME6 A;  5HAW A;  3A01 A;  4A3J J;  2QCO A;  3MNL A;  3HOW J;  3G1O A;  3O8G A;  4QTR A;  1OCP A;  2M0C A;  4JX5 A;  2XGE A;  3C2B A;  4V2F A;  2CUF A;  4Y52 J;  1S7E A;  2OER A;  1WGX A;  2QF7 A;  2VI6 A;  2GFN A;  3VVX A;  1W0T A;  1BJZ A;  1X58 A;  1DU6 A;  3S14 J;  3S1M J;  3S2H J;  5FGL A;  4A3D J;  3CRJ A;  2UXI A;  4AC6 A;  2FD5 A;  3DEW A;  4RBO A;  4G12 A;  1U9O A;  2IBD A;  4ME9 A;  1NK2 P;  5IYC J;  5JLX A;  5IP7 J;  1HDP A;  1ZR4 A;  4DYC A;  4EEF G;  2DG7 A;  5EFY A;  2ZCM A;  5D18 A;  2DA3 A;  4A3C J;  1K61 A;  1GV2 A;  5GPA A;  3SJM A;  2FQ4 A;  4D5C A;  4BXX J;  4M3F A;  1RKT A;  1MBJ A;  3CJD A;  3V6G A;  2IEK A;  2NVY J;  2DN0 A;  4XIC A;  3GTK J;  2ECB A;  1VFC A;  5M3M J;  2QTQ A;  1JUS A;  2OPT A;  1WH5 A;  4MO7 A;  1YRN B;  1IUF A;  5H9T A;  1Y1V J;  2XB5 A;  2RHA A;  5HSZ A;  3OIO A;  1Q1V A;  2HQ5 A;  5IOZ A;  4C2M J;  1WI3 A;  3WHC A;  5K7H A;  4BY7 J;  2OF7 A;  3A02 A;  3VW1 A;  3LOC A;  4GFL A;  1HOM A;  3VUQ A;  1JT0 A;  1ETW A;  1WCM J;  1AHD P;  1ZKG A;  2NVT J;  1T33 A;  3LSP A;  2HI3 A;  2DA1 A;  2Y9Y A;  1G2H A;  2VUM J;  1B8I A;  2GM4 A;  1ETK A;  2EZH A;  4CYC A;  2NX4 A;  3VIB A;  5J1Y A;  1JKO C;  1MSF C;  2FX0 A;  4D7M A;  2OI8 A;  4Y7N J;  1MBF A;  1IJW C;  3B81 A;  3PO3 J;  4NN1 A;  1MBK A;  4NDL A;  5EF6 A;  1QPI A;  3LHQ A;  3JR9 A;  5C4Y A;  2R5Z B;  3PAS A;  2NS8 A;  5GP9 A;  4A93 J;  1XC5 A;  3S2D J;  3ON4 A;  1FIP A;  3HTJ A;  4DW6 A;  3TW6 A;  2MG4 A;  4A3K J;  3HTH A;  3FK6 A;  2DTZ A;  1IC8 A;  5JLW A;  2GEN A;  3GBG A;  2GLO A;  4A3G J;  4AYB N;  4BY1 J;  3ANG A;  2JN6 A;  1RKW A;  3LSG A;  2NVX J;  3H3V K;  1E3O C;  3RQI A;  1YRN A;  5E3L A;  4IEJ A;  4BKX A;  4S0H B;  4W1U A;  1HF0 A;  4JYK A;  3BG5 A;  2HYJ A;  4NEL A;  2JA7 J;  2YVE A;  5CXI A;  3TP3 A;  5DS9 A;  1XG1 A;  4JX6 A;  3VPR A;  4MFD A;  5K58 A;  2FJ1 A;  2E2H J;  3TP0 A;  1HLV A;  2XGD A;  1I3Q J;  4HKU A;  2HKU A;  2O7T A;  3V78 A;  2ZOZ A;  1BW5 A;  3K2A A;  4MLO A;  1LFB A;  1MBG A;  5M5W J;  2FBQ A;  2HYT A;  1ITY A;  5IP6 A;  3SFI A;  2Y30 A;  4LOC A;  2IU5 A;  5F0H A;  2TCT A;  2WAQ N;  2VKE A;  2LY9 A;  5F0C A;  1TWH J;  4PXI A;  2VKV A;  2LVS A;  5K7F A;  4C3J J;  2XSD C;  3BR6 A;  1ZR2 A;  2X9D A;  3JRH A;  2REK A;  3IUV A;  1IDZ A;  2PBX A;  5F08 A;  4D5F A;  4ACI A;  2DA2 A;  4RDU A;  3BR0 A;  3NRG A;  3HKZ N;  5EDN A;  3BHQ A;  1JTY A;  3BT9 A;  3BR1 A;  2CQX A;  1ETX A;  2Y31 A;  2EZL A;  1X2M A;  4DYR A;  2R5Y A;  1GUU A;  2HXO A;  3SDG A;  1TWC J;  3L1P A;  2YU9 J;  3HDD A;  2COB A;  4UUS B;  5D19 A;  4HNV A;  1OFC X;  2MW8 A;  2CUE A;  3I4M J;  4UDS A;  2R92 J;  3JRI A;  3GTG J;  2UXP A;  4D7N A;  3F0C A;  3S1Q J;  3CCY A;  5AQC A;  3LNQ A;  4W97 A;  2MSY A;  3G7R A;  3IH3 A;  4BBS J;  4MK6 A;  2M2E A;  5EG0 B;  5FHP A;  3O60 A;  5E3O A;  2IAI A;  4L5E A;  3ZQL A;  3BCG A;  3VVZ A;  4XRS A;  1P7J A;  2Y9Z A;  3DCF A;  5EEA A;  4A3L J;  5C4X J;  1IRZ A;  2NP5 A;  1GDT A;  4GFB A;  2NOG A;  2EQR A;  3MKL A;  5M5X J;  3CWR A;  2B63 J;  1PUF B;  2DA7 A;  3S1R J;  3BNI A;  1F43 A;  3ZQH A;  1H89 C;  3PO2 J;  2ZCX A;  2G0E A;  1TWG J;  1ETV A;  2WB1 N;  3JRE A;  1SGM A;  4JX4 A;  4XRM A;  4XID A;  4KWA A;  3ANP A;  3FK7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...