3KZ9A

Crystal structure of the master transcriptional regulator, smcr, in vibrio vulnificus provides insight into its dna recognition mechanism
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
201
structure length
201
Chain Sequence
AKRPRTRLSPLKRKQQLMEIALEVFARRGIGRGGHADIAEIAQVSVATVFNYFPTREDLVDEVLNHVVRQFSNFLSDNIDLDLHAKENIANITNAMIELVVQDNHWLKVWFEWSASTRDEVWPLFVTTNRTNQLLVQNMFIKAIERGEVCDQHNPEDLANLFHGICYSLFVQANRTNNTAELSKLVSSYLDMLCIYKREHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SmcR
publication title The crystal structure of SmcR, a quorum-sensing master regulator of Vibrio vulnificus, provides insight into its regulation of transcription
pubmed doi rcsb
source organism Vibrio vulnificus
molecule tags Transcription regulator
total genus 70
structure length 201
sequence length 201
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3kz9A00
2VKVA 2DG7A 2WGBA 5IP6A 1UI5A 2IAIA 2X9DA 2ID3A 3SDGA 3JSJA 2NS8A 3V6GA 3B81A 3NPIA 3IUVA 2FD5A 3F1BA 4GFKA 3Q0VA 5FGLA 3TP3A 1RPWA 2TCTA 5HSZA 2NP5A 3NXCA 4AUXA 2HYTA 4UDSA 5K7ZA 3CWRA 3DPJA 3PPBA 2OPTA 3VOXA 5FKOA 3QKXA 3HTIA 5J1YA 3ON4A 2YVHA 3FK7A 4GCKA 4ICHA 1JTXA 2JK3A 3VW0A 3HTAA 3LJLA 2DTZA 2IBDA 3IH2A 3FIWA 4D5CA 5K7FA 5F27A 3G56A 3C07A 3SFIA 3O8HA 3CCYA 5J3LA 5CW8A 2G7GA 1RKTA 4B1RA 2NP3A 3BR0A 3HTJA 5F08A 3EUPA 2Y31A 5FHPA 3IH4A 3BR6A 3ON2A 2GFNA 4X1EA 3BT9A 4I76A 2G3BA 3E7QA 4D7NA 2RAEA 3LHQA 5F04A 3VOKA 2HQ5A 2YVEA 5H9TA 2UXIA 2UXHA 2QWTA 5CXIA 5GPCA 2UXUA 3EGQA 3NNRA 2XGEA 5CXGA 3BR5A 2JJ7A 3Q3SA 3HTHA 3RH2A 4MXMA 5C4YA 4JL3A 1T56A 2FX0A 1A6IA 3KNWA 4PXIA 2ZB9A 4GFLA 2GBYA 3DCFA 4ME9A 3PM1A 1U9NA 2TRTA 3V78A 4AC0A 4ACIA 2XDNA 5GPAA 5HAWA 2QKOA 2X6OA 4M3BA 3BR1A 2EH3A 3QPSA 3BTIA 4ABZA 1UI6A 1JT6A 2XB5A 1JUPA 3HIMA 2GUHA 2Q24A 4NELA 2G7SA 5EZHA 3BCGA 3O60A 2REKA 4AC6A 3VP5A 5D19A 1QPIA 5FKLA 3LSRA 1BJZA 4JNNA 4XK4A 3BTCA 3BJBA 4HKUA 3B6CA 5FKNA 3AQTA 3ZQIA 3BR3A 2PBXA 3BQZA 3RD3A 2VPRA 3MVPA 1VI0A 3WHCA 5IOYA 2NS7A 5EYRA 4M3FA 4NN1A 5D18A 3VVYA 4M3GA 4W1UA 1T33A 4MK6A 1U9OA 4W97A 2ID6A 5FKKA 3CDLA 2UXOA 3QBMA 2XPWA 4YZEA 2QTQA 5D1RA 3AQSA 2VKEA 2Y2ZA 5IPAA 2Y30A 1ZK8A 3PASA 5F0FA 2RASA 3G1MA 3ZQGA 3IH3A 5FMPA 3B6AA 5F0HA 3ANPA 3FK6A 2G0EA 2GENA 3VPRA 3BRUA 2XGDA 2NX4A 3F0CA 1QVUA 4D5FA 3KZ9A 3Q0UA 2ZCMA 1JT0A 3VIBA 3FRQA 3VW2A 3CJDA 5J1RA 2G7LA 2WUIA 4B3AA 3QPLA 2UXPA 5AQCA 4M3EA 2QIBA 2WV1A 1JTYA 3VVXA 4D7MA 2W53A 2F07A 5FKMA 2IU5A 3BTLA 3BR2A 1ZKGA 4JKZA 5K7HA 3ZQHA 2XPVA 1JUMA 1QVTA 5GP9A 3LSPA 4L62A 5F1JA 3WHBA 1RKWA 3HE0A 2HXOA 3GEUA 2PZ9A 4GCLA 5F0CA 3MNLA 3CRJA 3C2BA 3BNIA 3ANGA 3GZIA 2I10A 5J1UA 4I6ZA 3ZQFA 2O7TA 3VUQA 2IEKA 2DG8A 3QQAA 4V2GA 2D6YA 2OERA 3TP0A 2ZCXA 5EFYA 1Z0XA 2XRLA 3LOCA 3BQYA 3NRGA 3G1OA 4MO7A 3G1LA 4CGRA 4KWAA 3COLA 2HKUA 2HYJA 2QCOA 5HBUA 2XGCA 3VVZA 1Z77A 3BHQA 5IOZA 2HXIA 2XPUA 2QOPA 4G12A 3P9TA 5DAJA 3S5RA 2RHAA 3VW1A 4DW6A 3DEWA 2ZOZA 4JYKA 3LWJA 1JUSA 2V57A 1ORKA 3HGYA 4M3DA 3T6NA 3KKCA 2ZCNA 3G7RA 2FQ4A 2O7OA 2OI8A 4GCTA 3BTJA 2OF7A 3O8GA 5K58A 3ZQLA 4AF5A 2FJ1A 2FBQA 4V2FA 3NI7A 2ZOYA 3Q0WA 3LSJA 3KKDA 1SGMA 3HGGA 5EZGA
chains in the Genus database with same CATH superfamily
2VKVA 2DG7A 2WGBA 5IP6A 1UI5A 2ZY9A 2R7XA 2IAIA 4OD5A 2X9DA 2ID3A 3SDGA 3JSJA 2NS8A 3V6GA 3B81A 3NPIA 2YVXA 3IUVA 2FD5A 3F1BA 4GFKA 3Q0VA 5FGLA 3TP3A 1RPWA 2TCTA 5HSZA 2NP5A 3NXCA 4AUXA 2HYTA 4UDSA 5K7ZA 3CWRA 3DPJA 3PPBA 4U9NA 2OPTA 3VOXA 2A2FX 5FKOA 3QKXA 3HTIA 5J1YA 3ON4A 2YVHA 3FK7A 4GCKA 3SWHA 4ICHA 1JTXA 2JK3A 3VW0A 3HTAA 3LJLA 2DTZA 2IBDA 3IH2A 3FIWA 2R7TA 4D5CA 5K7FA 5F27A 3G56A 3C07A 3SFIA 2FJI1 3O8HA 3CCYA 5J3LA 5CW8A 2G7GA 1RKTA 4B1RA 2NP3A 3BR0A 3HTJA 5F08A 3EUPA 2Y31A 5FHPA 3IH4A 3BR6A 3ON2A 2GFNA 4X1EA 3BT9A 4I76A 2G3BA 3E7QA 4D7NA 2RAEA 3LHQA 5F04A 3VOKA 2HQ5A 2YVEA 4C2MA 5H9TA 2UXIA 2UXHA 2QWTA 5CXIA 5GPCA 2UXUA 3EGQA 3NNRA 2XGEA 5CXGA 3BR5A 2JJ7A 3Q3SA 3HTHA 3RH2A 4MXMA 3KYLA 5C4YA 4JL3A 5CQGA 1T56A 2FX0A 1A6IA 3KNWA 4PXIA 2ZB9A 4GFLA 2GBYA 3DCFA 4ME9A 2R7SA 3PM1A 1U9NA 2TRTA 3V78A 4AC0A 4ACIA 2XDNA 5GPAA 5HAWA 2QKOA 2X6OA 4M3BA 3BR1A 2EH3A 3QPSA 3BTIA 4ABZA 1UI6A 1JT6A 2XB5A 2R7RA 1JUPA 3HIMA 3K8PC 2GUHA 2Q24A 4NELA 2G7SA 5EZHA 3BCGA 3O60A 2REKA 4AC6A 3VP5A 5D19A 4WIBA 1QPIA 5FKLA 3LSRA 1BJZA 4JNNA 4XK4A 3BTCA 3BJBA 4HKUA 3B6CA 5FKNA 3AQTA 3BR3A 3ZQIA 2PBXA 3BQZA 3DU5A 3RD3A 2VPRA 3MVPA 1VI0A 3WHCA 5IOYA 2NS7A 5EYRA 4M3FA 4NN1A 5D18A 3VVYA 4M3GA 4W1UA 1T33A 4MK6A 1U9OA 4W97A 2ID6A 5FKKA 3CDLA 2UXOA 3QBMA 2XPWA 4YZEA 2QTQA 3DU6A 5D1RA 3AQSA 2VKEA 2Y2ZA 4DVYP 5IPAA 2Y30A 1ZK8A 3PASA 5F0FA 2RASA 3G1MA 3ZQGA 3IH3A 5FMPA 3B6AA 5F0HA 3ANPA 3FK6A 2R7OA 2G0EA 2GENA 3VPRA 3BRUA 2XGDA 2R7QA 2NX4A 3F0CA 1QVUA 4D5FA 3KZ9A 3Q0UA 2ZCMA 1JT0A 3VIBA 3NS4A 3FRQA 3FHNA 3VW2A 3CJDA 5J1RA 2G7LA 2WUIA 4B3AA 3QPLA 2UXPA 5AQCA 4M3EA 2QIBA 2WV1A 4OD4A 1JTYA 3VVXA 4D7MA 2W53A 2F07A 5FKMA 2IU5A 3BTLA 3BR2A 1ZKGA 4IRVA 4JKZA 5K7HA 4U9LA 3ZQHA 2XPVA 1JUMA 1QVTA 5GP9A 3LSPA 4L62A 5F1JA 3WHBA 1RKWA 3HE0A 2HXOA 3GEUA 2PZ9A 4GCLA 5F0CA 3MNLA 3CRJA 3C2BA 3BNIA 3ANGA 3GZIA 2R7UA 2I10A 5J1UA 4I6ZA 3ZQFA 2O7TA 3VUQA 2IEKA 2DG8A 2R7WA 3QQAA 4V2GA 2D6YA 2OERA 3TP0A 2ZCXA 5EFYA 1Z0XA 2XRLA 3LOCA 3BQYA 3NRGA 3G1OA 4MO7A 3G1LA 4CGRA 4KWAA 3COLA 2HKUA 2HYJA 2QCOA 5HBUA 2XGCA 3VVZA 1Z77A 3BHQA 5IOZA 2HXIA 2XPUA 2B3WA 2QOPA 4G12A 3P9TA 5DAJA 3S5RA 2RHAA 3VW1A 2B1EA 3VTIA 4DW6A 3DEWA 2ZOZA 4JYKA 3LWJA 1JUSA 2V57A 1ORKA 2R7VA 3HGYA 4M3DA 3T6NA 3KKCA 2ZCNA 3G7RA 2FQ4A 2O7OA 2OI8A 4GCTA 3BTJA 2OF7A 3O8GA 5K58A 3ZQLA 4AF5A 2FJ1A 2FBQA 4V2FA 3NI7A 2ZOYA 3Q0WA 3LSJA 2PFVA 3KKDA 1SGMA 3HGGA 5EZGA
chains in the Genus database with same CATH topology
2VKVA 2DG7A 2WGBA 5IP6A 1UI5A 2IAIA 2X9DA 2ID3A 3SDGA 3JSJA 2NS8A 3V6GA 3B81A 3NPIA 3IUVA 2FD5A 3F1BA 4GFKA 3Q0VA 5FGLA 3TP3A 1RPWA 2TCTA 5HSZA 2NP5A 3NXCA 4AUXA 2HYTA 4UDSA 5K7ZA 3CWRA 3DPJA 3PPBA 2OPTA 3VOXA 5FKOA 3QKXA 3HTIA 5J1YA 3ON4A 2YVHA 3FK7A 4GCKA 4ICHA 1JTXA 2JK3A 3VW0A 3HTAA 3LJLA 2DTZA 2IBDA 3IH2A 3FIWA 4D5CA 5K7FA 5F27A 3G56A 3C07A 3SFIA 3O8HA 3CCYA 5J3LA 5CW8A 2G7GA 1RKTA 4B1RA 2NP3A 3BR0A 3HTJA 5F08A 3EUPA 2Y31A 5FHPA 3IH4A 3BR6A 3ON2A 2GFNA 4X1EA 3BT9A 4I76A 2G3BA 3E7QA 4D7NA 2RAEA 3LHQA 5F04A 3VOKA 2HQ5A 2YVEA 5H9TA 2UXIA 2UXHA 2QWTA 5CXIA 5GPCA 2UXUA 3EGQA 3NNRA 2XGEA 5CXGA 3BR5A 2JJ7A 3Q3SA 3HTHA 3RH2A 4MXMA 5C4YA 4JL3A 1T56A 2FX0A 1A6IA 3KNWA 4PXIA 2ZB9A 4GFLA 2GBYA 3DCFA 4ME9A 3PM1A 1U9NA 2TRTA 3V78A 4AC0A 4ACIA 2XDNA 5GPAA 5HAWA 2QKOA 2X6OA 4M3BA 3BR1A 2EH3A 3QPSA 3BTIA 4ABZA 1UI6A 1JT6A 2XB5A 1JUPA 3HIMA 2GUHA 2Q24A 4NELA 2G7SA 5EZHA 3BCGA 3O60A 2REKA 4AC6A 3VP5A 5D19A 1QPIA 5FKLA 3LSRA 1BJZA 4JNNA 4XK4A 3BTCA 3BJBA 4HKUA 3B6CA 5FKNA 3AQTA 3ZQIA 3BR3A 2PBXA 3BQZA 3RD3A 2VPRA 3MVPA 1VI0A 3WHCA 5IOYA 2NS7A 5EYRA 4M3FA 4NN1A 5D18A 3VVYA 4M3GA 4W1UA 1T33A 4MK6A 1U9OA 4W97A 2ID6A 5FKKA 3CDLA 2UXOA 3QBMA 2XPWA 4YZEA 2QTQA 5D1RA 3AQSA 2VKEA 2Y2ZA 5IPAA 2Y30A 1ZK8A 3PASA 5F0FA 2RASA 3G1MA 3ZQGA 3IH3A 5FMPA 3B6AA 5F0HA 3ANPA 3FK6A 2G0EA 2GENA 3VPRA 3BRUA 2XGDA 2NX4A 3F0CA 1QVUA 4D5FA 3KZ9A 3Q0UA 2ZCMA 1JT0A 3VIBA 3FRQA 3VW2A 3CJDA 5J1RA 2G7LA 2WUIA 4B3AA 3QPLA 2UXPA 5AQCA 4M3EA 2QIBA 2WV1A 1JTYA 3VVXA 4D7MA 2W53A 2F07A 5FKMA 2IU5A 3BTLA 3BR2A 1ZKGA 4JKZA 5K7HA 3ZQHA 2XPVA 1JUMA 1QVTA 5GP9A 3LSPA 4L62A 5F1JA 3WHBA 1RKWA 3HE0A 2HXOA 3GEUA 2PZ9A 4GCLA 5F0CA 3MNLA 3CRJA 3C2BA 3BNIA 3ANGA 3GZIA 2I10A 5J1UA 4I6ZA 3ZQFA 2O7TA 3VUQA 2IEKA 2DG8A 3QQAA 4V2GA 2D6YA 2OERA 3TP0A 2ZCXA 5EFYA 1Z0XA 2XRLA 3LOCA 3BQYA 3NRGA 3G1OA 4MO7A 3G1LA 4CGRA 4KWAA 3COLA 2HKUA 2HYJA 2QCOA 5HBUA 2XGCA 3VVZA 1Z77A 3BHQA 5IOZA 2HXIA 2XPUA 2QOPA 4G12A 3P9TA 5DAJA 3S5RA 2RHAA 3VW1A 4DW6A 3DEWA 2ZOZA 4JYKA 3LWJA 1JUSA 2V57A 1ORKA 3HGYA 4M3DA 3T6NA 3KKCA 2ZCNA 3G7RA 2FQ4A 2O7OA 2OI8A 4GCTA 3BTJA 2OF7A 3O8GA 5K58A 3ZQLA 4AF5A 2FJ1A 2FBQA 4V2FA 3NI7A 2ZOYA 3Q0WA 3LSJA 3KKDA 1SGMA 3HGGA 5EZGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VKV A;  2DG7 A;  2WGB A;  5IP6 A;  1UI5 A;  2IAI A;  2X9D A;  2ID3 A;  3SDG A;  3JSJ A;  2NS8 A;  3V6G A;  3B81 A;  3NPI A;  3IUV A;  2FD5 A;  3F1B A;  4GFK A;  3Q0V A;  5FGL A;  3TP3 A;  1RPW A;  2TCT A;  5HSZ A;  2NP5 A;  3NXC A;  4AUX A;  2HYT A;  4UDS A;  5K7Z A;  3CWR A;  3DPJ A;  3PPB A;  2OPT A;  3VOX A;  5FKO A;  3QKX A;  3HTI A;  5J1Y A;  3ON4 A;  2YVH A;  3FK7 A;  4GCK A;  4ICH A;  1JTX A;  2JK3 A;  3VW0 A;  3HTA A;  3LJL A;  2DTZ A;  2IBD A;  3IH2 A;  3FIW A;  4D5C A;  5K7F A;  5F27 A;  3G56 A;  3C07 A;  3SFI A;  3O8H A;  3CCY A;  5J3L A;  5CW8 A;  2G7G A;  1RKT A;  4B1R A;  2NP3 A;  3BR0 A;  3HTJ A;  5F08 A;  3EUP A;  2Y31 A;  5FHP A;  3IH4 A;  3BR6 A;  3ON2 A;  2GFN A;  4X1E A;  3BT9 A;  4I76 A;  2G3B A;  3E7Q A;  4D7N A;  2RAE A;  3LHQ A;  5F04 A;  3VOK A;  2HQ5 A;  2YVE A;  5H9T A;  2UXI A;  2UXH A;  2QWT A;  5CXI A;  5GPC A;  2UXU A;  3EGQ A;  3NNR A;  2XGE A;  5CXG A;  3BR5 A;  2JJ7 A;  3Q3S A;  3HTH A;  3RH2 A;  4MXM A;  5C4Y A;  4JL3 A;  1T56 A;  2FX0 A;  1A6I A;  3KNW A;  4PXI A;  2ZB9 A;  4GFL A;  2GBY A;  3DCF A;  4ME9 A;  3PM1 A;  1U9N A;  2TRT A;  3V78 A;  4AC0 A;  4ACI A;  2XDN A;  5GPA A;  5HAW A;  2QKO A;  2X6O A;  4M3B A;  3BR1 A;  2EH3 A;  3QPS A;  3BTI A;  4ABZ A;  1UI6 A;  1JT6 A;  2XB5 A;  1JUP A;  3HIM A;  2GUH A;  2Q24 A;  4NEL A;  2G7S A;  5EZH A;  3BCG A;  3O60 A;  2REK A;  4AC6 A;  3VP5 A;  5D19 A;  1QPI A;  5FKL A;  3LSR A;  1BJZ A;  4JNN A;  4XK4 A;  3BTC A;  3BJB A;  4HKU A;  3B6C A;  5FKN A;  3AQT A;  3ZQI A;  3BR3 A;  2PBX A;  3BQZ A;  3RD3 A;  2VPR A;  3MVP A;  1VI0 A;  3WHC A;  5IOY A;  2NS7 A;  5EYR A;  4M3F A;  4NN1 A;  5D18 A;  3VVY A;  4M3G A;  4W1U A;  1T33 A;  4MK6 A;  1U9O A;  4W97 A;  2ID6 A;  5FKK A;  3CDL A;  2UXO A;  3QBM A;  2XPW A;  4YZE A;  2QTQ A;  5D1R A;  3AQS A;  2VKE A;  2Y2Z A;  5IPA A;  2Y30 A;  1ZK8 A;  3PAS A;  5F0F A;  2RAS A;  3G1M A;  3ZQG A;  3IH3 A;  5FMP A;  3B6A A;  5F0H A;  3ANP A;  3FK6 A;  2G0E A;  2GEN A;  3VPR A;  3BRU A;  2XGD A;  2NX4 A;  3F0C A;  1QVU A;  4D5F A;  3KZ9 A;  3Q0U A;  2ZCM A;  1JT0 A;  3VIB A;  3FRQ A;  3VW2 A;  3CJD A;  5J1R A;  2G7L A;  2WUI A;  4B3A A;  3QPL A;  2UXP A;  5AQC A;  4M3E A;  2QIB A;  2WV1 A;  1JTY A;  3VVX A;  4D7M A;  2W53 A;  2F07 A;  5FKM A;  2IU5 A;  3BTL A;  3BR2 A;  1ZKG A;  4JKZ A;  5K7H A;  3ZQH A;  2XPV A;  1JUM A;  1QVT A;  5GP9 A;  3LSP A;  4L62 A;  5F1J A;  3WHB A;  1RKW A;  3HE0 A;  2HXO A;  3GEU A;  2PZ9 A;  4GCL A;  5F0C A;  3MNL A;  3CRJ A;  3C2B A;  3BNI A;  3ANG A;  3GZI A;  2I10 A;  5J1U A;  4I6Z A;  3ZQF A;  2O7T A;  3VUQ A;  2IEK A;  2DG8 A;  3QQA A;  4V2G A;  2D6Y A;  2OER A;  3TP0 A;  2ZCX A;  5EFY A;  1Z0X A;  2XRL A;  3LOC A;  3BQY A;  3NRG A;  3G1O A;  4MO7 A;  3G1L A;  4CGR A;  4KWA A;  3COL A;  2HKU A;  2HYJ A;  2QCO A;  5HBU A;  2XGC A;  3VVZ A;  1Z77 A;  3BHQ A;  5IOZ A;  2HXI A;  2XPU A;  2QOP A;  4G12 A;  3P9T A;  5DAJ A;  3S5R A;  2RHA A;  3VW1 A;  4DW6 A;  3DEW A;  2ZOZ A;  4JYK A;  3LWJ A;  1JUS A;  2V57 A;  1ORK A;  3HGY A;  4M3D A;  3T6N A;  3KKC A;  2ZCN A;  3G7R A;  2FQ4 A;  2O7O A;  2OI8 A;  4GCT A;  3BTJ A;  2OF7 A;  3O8G A;  5K58 A;  3ZQL A;  4AF5 A;  2FJ1 A;  2FBQ A;  4V2F A;  3NI7 A;  2ZOY A;  3Q0W A;  3LSJ A;  3KKD A;  1SGM A;  3HGG A;  5EZG A; 
#chains in the Genus database with same CATH topology
 2VKV A;  2DG7 A;  2WGB A;  5IP6 A;  1UI5 A;  2ZY9 A;  2R7X A;  2IAI A;  4OD5 A;  2X9D A;  2ID3 A;  3SDG A;  3JSJ A;  2NS8 A;  3V6G A;  3B81 A;  3NPI A;  2YVX A;  3IUV A;  2FD5 A;  3F1B A;  4GFK A;  3Q0V A;  5FGL A;  3TP3 A;  1RPW A;  2TCT A;  5HSZ A;  2NP5 A;  3NXC A;  4AUX A;  2HYT A;  4UDS A;  5K7Z A;  3CWR A;  3DPJ A;  3PPB A;  4U9N A;  2OPT A;  3VOX A;  2A2F X;  5FKO A;  3QKX A;  3HTI A;  5J1Y A;  3ON4 A;  2YVH A;  3FK7 A;  4GCK A;  3SWH A;  4ICH A;  1JTX A;  2JK3 A;  3VW0 A;  3HTA A;  3LJL A;  2DTZ A;  2IBD A;  3IH2 A;  3FIW A;  2R7T A;  4D5C A;  5K7F A;  5F27 A;  3G56 A;  3C07 A;  3SFI A;  2FJI 1;  3O8H A;  3CCY A;  5J3L A;  5CW8 A;  2G7G A;  1RKT A;  4B1R A;  2NP3 A;  3BR0 A;  3HTJ A;  5F08 A;  3EUP A;  2Y31 A;  5FHP A;  3IH4 A;  3BR6 A;  3ON2 A;  2GFN A;  4X1E A;  3BT9 A;  4I76 A;  2G3B A;  3E7Q A;  4D7N A;  2RAE A;  3LHQ A;  5F04 A;  3VOK A;  2HQ5 A;  2YVE A;  4C2M A;  5H9T A;  2UXI A;  2UXH A;  2QWT A;  5CXI A;  5GPC A;  2UXU A;  3EGQ A;  3NNR A;  2XGE A;  5CXG A;  3BR5 A;  2JJ7 A;  3Q3S A;  3HTH A;  3RH2 A;  4MXM A;  3KYL A;  5C4Y A;  4JL3 A;  5CQG A;  1T56 A;  2FX0 A;  1A6I A;  3KNW A;  4PXI A;  2ZB9 A;  4GFL A;  2GBY A;  3DCF A;  4ME9 A;  2R7S A;  3PM1 A;  1U9N A;  2TRT A;  3V78 A;  4AC0 A;  4ACI A;  2XDN A;  5GPA A;  5HAW A;  2QKO A;  2X6O A;  4M3B A;  3BR1 A;  2EH3 A;  3QPS A;  3BTI A;  4ABZ A;  1UI6 A;  1JT6 A;  2XB5 A;  2R7R A;  1JUP A;  3HIM A;  3K8P C;  2GUH A;  2Q24 A;  4NEL A;  2G7S A;  5EZH A;  3BCG A;  3O60 A;  2REK A;  4AC6 A;  3VP5 A;  5D19 A;  4WIB A;  1QPI A;  5FKL A;  3LSR A;  1BJZ A;  4JNN A;  4XK4 A;  3BTC A;  3BJB A;  4HKU A;  3B6C A;  5FKN A;  3AQT A;  3BR3 A;  3ZQI A;  2PBX A;  3BQZ A;  3DU5 A;  3RD3 A;  2VPR A;  3MVP A;  1VI0 A;  3WHC A;  5IOY A;  2NS7 A;  5EYR A;  4M3F A;  4NN1 A;  5D18 A;  3VVY A;  4M3G A;  4W1U A;  1T33 A;  4MK6 A;  1U9O A;  4W97 A;  2ID6 A;  5FKK A;  3CDL A;  2UXO A;  3QBM A;  2XPW A;  4YZE A;  2QTQ A;  3DU6 A;  5D1R A;  3AQS A;  2VKE A;  2Y2Z A;  4DVY P;  5IPA A;  2Y30 A;  1ZK8 A;  3PAS A;  5F0F A;  2RAS A;  3G1M A;  3ZQG A;  3IH3 A;  5FMP A;  3B6A A;  5F0H A;  3ANP A;  3FK6 A;  2R7O A;  2G0E A;  2GEN A;  3VPR A;  3BRU A;  2XGD A;  2R7Q A;  2NX4 A;  3F0C A;  1QVU A;  4D5F A;  3KZ9 A;  3Q0U A;  2ZCM A;  1JT0 A;  3VIB A;  3NS4 A;  3FRQ A;  3FHN A;  3VW2 A;  3CJD A;  5J1R A;  2G7L A;  2WUI A;  4B3A A;  3QPL A;  2UXP A;  5AQC A;  4M3E A;  2QIB A;  2WV1 A;  4OD4 A;  1JTY A;  3VVX A;  4D7M A;  2W53 A;  2F07 A;  5FKM A;  2IU5 A;  3BTL A;  3BR2 A;  1ZKG A;  4IRV A;  4JKZ A;  5K7H A;  4U9L A;  3ZQH A;  2XPV A;  1JUM A;  1QVT A;  5GP9 A;  3LSP A;  4L62 A;  5F1J A;  3WHB A;  1RKW A;  3HE0 A;  2HXO A;  3GEU A;  2PZ9 A;  4GCL A;  5F0C A;  3MNL A;  3CRJ A;  3C2B A;  3BNI A;  3ANG A;  3GZI A;  2R7U A;  2I10 A;  5J1U A;  4I6Z A;  3ZQF A;  2O7T A;  3VUQ A;  2IEK A;  2DG8 A;  2R7W A;  3QQA A;  4V2G A;  2D6Y A;  2OER A;  3TP0 A;  2ZCX A;  5EFY A;  1Z0X A;  2XRL A;  3LOC A;  3BQY A;  3NRG A;  3G1O A;  4MO7 A;  3G1L A;  4CGR A;  4KWA A;  3COL A;  2HKU A;  2HYJ A;  2QCO A;  5HBU A;  2XGC A;  3VVZ A;  1Z77 A;  3BHQ A;  5IOZ A;  2HXI A;  2XPU A;  2B3W A;  2QOP A;  4G12 A;  3P9T A;  5DAJ A;  3S5R A;  2RHA A;  3VW1 A;  2B1E A;  3VTI A;  4DW6 A;  3DEW A;  2ZOZ A;  4JYK A;  3LWJ A;  1JUS A;  2V57 A;  1ORK A;  2R7V A;  3HGY A;  4M3D A;  3T6N A;  3KKC A;  2ZCN A;  3G7R A;  2FQ4 A;  2O7O A;  2OI8 A;  4GCT A;  3BTJ A;  2OF7 A;  3O8G A;  5K58 A;  3ZQL A;  4AF5 A;  2FJ1 A;  2FBQ A;  4V2F A;  3NI7 A;  2ZOY A;  3Q0W A;  3LSJ A;  2PFV A;  3KKD A;  1SGM A;  3HGG A;  5EZG A; 
#chains in the Genus database with same CATH homology
 2VKV A;  2DG7 A;  2WGB A;  5IP6 A;  1UI5 A;  2IAI A;  2X9D A;  2ID3 A;  3SDG A;  3JSJ A;  2NS8 A;  3V6G A;  3B81 A;  3NPI A;  3IUV A;  2FD5 A;  3F1B A;  4GFK A;  3Q0V A;  5FGL A;  3TP3 A;  1RPW A;  2TCT A;  5HSZ A;  2NP5 A;  3NXC A;  4AUX A;  2HYT A;  4UDS A;  5K7Z A;  3CWR A;  3DPJ A;  3PPB A;  2OPT A;  3VOX A;  5FKO A;  3QKX A;  3HTI A;  5J1Y A;  3ON4 A;  2YVH A;  3FK7 A;  4GCK A;  4ICH A;  1JTX A;  2JK3 A;  3VW0 A;  3HTA A;  3LJL A;  2DTZ A;  2IBD A;  3IH2 A;  3FIW A;  4D5C A;  5K7F A;  5F27 A;  3G56 A;  3C07 A;  3SFI A;  3O8H A;  3CCY A;  5J3L A;  5CW8 A;  2G7G A;  1RKT A;  4B1R A;  2NP3 A;  3BR0 A;  3HTJ A;  5F08 A;  3EUP A;  2Y31 A;  5FHP A;  3IH4 A;  3BR6 A;  3ON2 A;  2GFN A;  4X1E A;  3BT9 A;  4I76 A;  2G3B A;  3E7Q A;  4D7N A;  2RAE A;  3LHQ A;  5F04 A;  3VOK A;  2HQ5 A;  2YVE A;  5H9T A;  2UXI A;  2UXH A;  2QWT A;  5CXI A;  5GPC A;  2UXU A;  3EGQ A;  3NNR A;  2XGE A;  5CXG A;  3BR5 A;  2JJ7 A;  3Q3S A;  3HTH A;  3RH2 A;  4MXM A;  5C4Y A;  4JL3 A;  1T56 A;  2FX0 A;  1A6I A;  3KNW A;  4PXI A;  2ZB9 A;  4GFL A;  2GBY A;  3DCF A;  4ME9 A;  3PM1 A;  1U9N A;  2TRT A;  3V78 A;  4AC0 A;  4ACI A;  2XDN A;  5GPA A;  5HAW A;  2QKO A;  2X6O A;  4M3B A;  3BR1 A;  2EH3 A;  3QPS A;  3BTI A;  4ABZ A;  1UI6 A;  1JT6 A;  2XB5 A;  1JUP A;  3HIM A;  2GUH A;  2Q24 A;  4NEL A;  2G7S A;  5EZH A;  3BCG A;  3O60 A;  2REK A;  4AC6 A;  3VP5 A;  5D19 A;  1QPI A;  5FKL A;  3LSR A;  1BJZ A;  4JNN A;  4XK4 A;  3BTC A;  3BJB A;  4HKU A;  3B6C A;  5FKN A;  3AQT A;  3ZQI A;  3BR3 A;  2PBX A;  3BQZ A;  3RD3 A;  2VPR A;  3MVP A;  1VI0 A;  3WHC A;  5IOY A;  2NS7 A;  5EYR A;  4M3F A;  4NN1 A;  5D18 A;  3VVY A;  4M3G A;  4W1U A;  1T33 A;  4MK6 A;  1U9O A;  4W97 A;  2ID6 A;  5FKK A;  3CDL A;  2UXO A;  3QBM A;  2XPW A;  4YZE A;  2QTQ A;  5D1R A;  3AQS A;  2VKE A;  2Y2Z A;  5IPA A;  2Y30 A;  1ZK8 A;  3PAS A;  5F0F A;  2RAS A;  3G1M A;  3ZQG A;  3IH3 A;  5FMP A;  3B6A A;  5F0H A;  3ANP A;  3FK6 A;  2G0E A;  2GEN A;  3VPR A;  3BRU A;  2XGD A;  2NX4 A;  3F0C A;  1QVU A;  4D5F A;  3KZ9 A;  3Q0U A;  2ZCM A;  1JT0 A;  3VIB A;  3FRQ A;  3VW2 A;  3CJD A;  5J1R A;  2G7L A;  2WUI A;  4B3A A;  3QPL A;  2UXP A;  5AQC A;  4M3E A;  2QIB A;  2WV1 A;  1JTY A;  3VVX A;  4D7M A;  2W53 A;  2F07 A;  5FKM A;  2IU5 A;  3BTL A;  3BR2 A;  1ZKG A;  4JKZ A;  5K7H A;  3ZQH A;  2XPV A;  1JUM A;  1QVT A;  5GP9 A;  3LSP A;  4L62 A;  5F1J A;  3WHB A;  1RKW A;  3HE0 A;  2HXO A;  3GEU A;  2PZ9 A;  4GCL A;  5F0C A;  3MNL A;  3CRJ A;  3C2B A;  3BNI A;  3ANG A;  3GZI A;  2I10 A;  5J1U A;  4I6Z A;  3ZQF A;  2O7T A;  3VUQ A;  2IEK A;  2DG8 A;  3QQA A;  4V2G A;  2D6Y A;  2OER A;  3TP0 A;  2ZCX A;  5EFY A;  1Z0X A;  2XRL A;  3LOC A;  3BQY A;  3NRG A;  3G1O A;  4MO7 A;  3G1L A;  4CGR A;  4KWA A;  3COL A;  2HKU A;  2HYJ A;  2QCO A;  5HBU A;  2XGC A;  3VVZ A;  1Z77 A;  3BHQ A;  5IOZ A;  2HXI A;  2XPU A;  2QOP A;  4G12 A;  3P9T A;  5DAJ A;  3S5R A;  2RHA A;  3VW1 A;  4DW6 A;  3DEW A;  2ZOZ A;  4JYK A;  3LWJ A;  1JUS A;  2V57 A;  1ORK A;  3HGY A;  4M3D A;  3T6N A;  3KKC A;  2ZCN A;  3G7R A;  2FQ4 A;  2O7O A;  2OI8 A;  4GCT A;  3BTJ A;  2OF7 A;  3O8G A;  5K58 A;  3ZQL A;  4AF5 A;  2FJ1 A;  2FBQ A;  4V2F A;  3NI7 A;  2ZOY A;  3Q0W A;  3LSJ A;  3KKD A;  1SGM A;  3HGG A;  5EZG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...