3KZ9A

Crystal structure of the master transcriptional regulator, smcr, in vibrio vulnificus provides insight into its dna recognition mechanism
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
201
structure length
201
Chain Sequence
b'AKRPRTRLSPLKRKQQLMEIALEVFARRGIGRGGHADIAEIAQVSVATVFNYFPTREDLVDEVLNHVVRQFSNFLSDNIDLDLHAKENIANITNAMIELVVQDNHWLKVWFEWSASTRDEVWPLFVTTNRTNQLLVQNMFIKAIERGEVCDQHNPEDLANLFHGICYSLFVQANRTNNTAELSKLVSSYLDMLCIYKREHE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SmcR
publication title The crystal structure of SmcR, a quorum-sensing master regulator of Vibrio vulnificus, provides insight into its regulation of transcription
pubmed doi rcsb
source organism Vibrio vulnificus
molecule tags Transcription regulator
total genus 70
structure length 201
sequence length 201
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3kz9A00
5FKKA 2G7GA 1T56A 3ZQIA 3BHQA 3NI7A 2GFNA 2RASA 2G3BA 3QBMA 1BJZA 5HSZA 4JYKA 3PPBA 2GUHA 1Z0XA 3WHCA 2JK3A 5FKNA 5K58A 2XGEA 4M3DA 3P9TA 2FQ4A 3HGGA 3TP3A 3BCGA 2IAIA 5DAJA 3Q0WA 2FJ1A 4NN1A 3VIBA 3JSJA 3VVZA 4D7MA 3SDGA 3V78A 4W1UA 2ZB9A 5CXGA 2XDNA 3KNWA 2WGBA 3CJDA 2ZOZA 3QKXA 2XPVA 5F1JA 5AQCA 3ANGA 2HQ5A 3O60A 2YVHA 2ID3A 3G56A 3VPRA 3BR2A 3ON2A 5D19A 2GBYA 3F0CA 3BR5A 3Q0VA 3DEWA 4MXMA 4JNNA 2ZOYA 4M3BA 2IU5A 3DCFA 2HYJA 3VVXA 3HTAA 2DG8A 1ZK8A 3FIWA 3BTCA 5FKOA 2I10A 3V6GA 2XGDA 3CCYA 2X6OA 3KKDA 3T6NA 3BTJA 3PM1A 1JT6A 2W53A 5EFYA 3QPLA 1JTYA 3VW1A 5EYRA 3G1LA 5J3LA 1RKTA 2Q24A 5GPCA 4HKUA 1JUPA 4ABZA 2EH3A 2QKOA 3LHQA 2FX0A 2XB5A 5HBUA 2HKUA 2HXIA 4MK6A 3DPJA 2DG7A 2WV1A 5HAWA 4D7NA 5GP9A 4X1EA 1Z77A 2IEKA 2ZCXA 5IOZA 1JT0A 3BRUA 4CGRA 5F0CA 5IP6A 2X9DA 3LSJA 4ICHA 2GENA 3BR0A 4B1RA 4AUXA 5K7ZA 3KZ9A 5K7HA 3MVPA 2UXIA 2G7SA 1QVTA 2QTQA 4PXIA 3FK7A 3TP0A 2V57A 3LOCA 3VW2A 2VPRA 3C2BA 3O8HA 5FKMA 3QQAA 4XK4A 3VVYA 3FRQA 2G7LA 4GCLA 3BR3A 3EGQA 2VKEA 2Y2ZA 3B6CA 2VKVA 2ZCMA 3VOXA 3VOKA 4AC6A 2FBQA 2G0EA 3AQSA 2QIBA 3IH4A 3G1MA 3ON4A 3Q0UA 2ID6A 3CWRA 4UDSA 3HE0A 4D5CA 4NELA 5FGLA 4I6ZA 4JL3A 5F0FA 4L62A 3HTHA 4GCTA 3NRGA 4I76A 3LJLA 2UXUA 3C07A 1JUSA 2IBDA 3G1OA 2QWTA 2XPUA 3GZIA 2NP5A 2O7OA 2UXHA 3LSRA 4AF5A 3BTLA 3CDLA 1QVUA 3BT9A 2DTZA 5FMPA 4GFLA 3BR6A 1U9OA 5D1RA 2XGCA 2UXPA 3S5RA 3BNIA 5GPAA 2YVEA 3F1BA 1UI6A 3IH2A 2F07A 5C4YA 3ANPA 2NP3A 3HIMA 3NXCA 3KKCA 2QCOA 2TCTA 5FKLA 3BQYA 2RAEA 3O8GA 4M3EA 5K7FA 5J1YA 2NS8A 2PBXA 4W97A 3NNRA 4M3GA 2OPTA 4AC0A 4M3FA 4KWAA 4GCKA 3ZQHA 5EZGA 3LSPA 2TRTA 3IUVA 2OI8A 3FK6A 1UI5A 2ZCNA 4G12A 3VW0A 3PASA 5D18A 4GFKA 3E7QA 4DW6A 2NS7A 3LWJA 1SGMA 2WUIA 3COLA 3VUQA 5FHPA 3BR1A 3MNLA 3ZQFA 2FD5A 5H9TA 1VI0A 2O7TA 3GEUA 3QPSA 1JTXA 1U9NA 4D5FA 5IOYA 5J1RA 2Y31A 3G7RA 5F0HA 3B81A 4V2FA 2QOPA 3B6AA 2OERA 4ACIA 5F04A 3RD3A 2Y30A 2RHAA 4ME9A 3ZQGA 3EUPA 5EZHA 3IH3A 4V2GA 5J1UA 2D6YA 3HTIA 1A6IA 2XRLA 1JUMA 1T33A 3CRJA 2XPWA 3HGYA 2UXOA 4YZEA 5F08A 1ORKA 3Q3SA 4JKZA 5CXIA 3RH2A 2PZ9A 2NX4A 2OF7A 5IPAA 1RKWA 2HYTA 2REKA 5F27A 3VP5A 3BJBA 3SFIA 3BTIA 3HTJA 1RPWA 3AQTA 4MO7A 3WHBA 3BQZA 1QPIA 4B3AA 3NPIA 3ZQLA 1ZKGA 5CW8A 2JJ7A 2HXOA
chains in the Genus database with same CATH superfamily
5FKKA 2G7GA 1T56A 3ZQIA 3BHQA 3NI7A 2GFNA 2RASA 2G3BA 3QBMA 1BJZA 5HSZA 4JYKA 3PPBA 2GUHA 1Z0XA 3WHCA 2JK3A 5FKNA 5K58A 2XGEA 4M3DA 3P9TA 2FQ4A 3KYLA 3HGGA 3TP3A 3BCGA 2IAIA 5DAJA 2R7SA 3Q0WA 2FJ1A 4NN1A 3VIBA 4U9LA 3JSJA 3VVZA 4D7MA 3SDGA 3V78A 4W1UA 2ZB9A 5CXGA 2XDNA 3KNWA 2WGBA 3CJDA 2ZOZA 3QKXA 2XPVA 5F1JA 5AQCA 3ANGA 2HQ5A 3O60A 2YVHA 2ID3A 4OD4A 3G56A 2FJI1 3VPRA 3BR2A 2R7WA 3ON2A 5D19A 2GBYA 3F0CA 3BR5A 3Q0VA 3DEWA 4MXMA 4JNNA 2ZOYA 4M3BA 2IU5A 3DCFA 2HYJA 3VVXA 3HTAA 2DG8A 1ZK8A 3FIWA 3BTCA 5FKOA 2I10A 3V6GA 2XGDA 3CCYA 2X6OA 3KKDA 2R7VA 3T6NA 3BTJA 3PM1A 1JT6A 2W53A 5EFYA 3QPLA 1JTYA 4U9NA 3VW1A 5EYRA 3G1LA 5J3LA 1RKTA 2Q24A 5GPCA 4HKUA 1JUPA 4ABZA 2EH3A 2R7TA 2QKOA 3LHQA 2FX0A 2XB5A 5HBUA 2R7XA 2HKUA 2HXIA 2R7QA 4MK6A 3DPJA 2DG7A 2WV1A 3VTIA 4D7NA 5HAWA 5GP9A 4X1EA 1Z77A 2IEKA 2ZCXA 5IOZA 1JT0A 3BRUA 4CGRA 5F0CA 5IP6A 2X9DA 3LSJA 4ICHA 2GENA 3BR0A 4WIBA 4B1RA 4AUXA 4DVYP 5K7ZA 3KZ9A 5K7HA 3MVPA 2UXIA 2G7SA 1QVTA 2QTQA 4PXIA 3FK7A 3TP0A 2V57A 3LOCA 3VW2A 2VPRA 4IRVA 3C2BA 3O8HA 5FKMA 2R7RA 3NS4A 3QQAA 4XK4A 3VVYA 3FRQA 2G7LA 4GCLA 3BR3A 3EGQA 2VKEA 2Y2ZA 3B6CA 2VKVA 2ZCMA 3VOXA 3VOKA 4AC6A 2FBQA 2G0EA 3AQSA 2QIBA 3IH4A 3G1MA 3ON4A 4C2MA 3Q0UA 2ID6A 3CWRA 4UDSA 3HE0A 4D5CA 4NELA 5FGLA 4I6ZA 4JL3A 5F0FA 4L62A 3HTHA 4GCTA 3NRGA 4I76A 3LJLA 2UXUA 3C07A 1JUSA 2IBDA 3G1OA 2QWTA 2XPUA 3GZIA 2NP5A 2O7OA 2UXHA 3LSRA 4AF5A 3BTLA 3CDLA 1QVUA 3BT9A 2DTZA 5FMPA 4GFLA 3BR6A 1U9OA 5D1RA 2XGCA 2UXPA 3S5RA 3BNIA 5GPAA 2R7OA 2YVEA 3F1BA 1UI6A 3IH2A 2F07A 5C4YA 3ANPA 2NP3A 3HIMA 3NXCA 2R7UA 3KKCA 2QCOA 2TCTA 5FKLA 3BQYA 2RAEA 3O8GA 4M3EA 5K7FA 5J1YA 2NS8A 2PBXA 4W97A 3NNRA 4M3GA 2OPTA 4AC0A 4M3FA 4KWAA 4GCKA 3ZQHA 5EZGA 3LSPA 2TRTA 3SWHA 3IUVA 2OI8A 3FK6A 1UI5A 3DU6A 2ZCNA 2ZY9A 4G12A 3VW0A 2B3WA 3PASA 3FHNA 5D18A 4GFKA 3E7QA 4DW6A 2NS7A 3LWJA 1SGMA 2WUIA 3COLA 3VUQA 5CQGA 5FHPA 3BR1A 2PFVA 3MNLA 3ZQFA 2FD5A 5H9TA 1VI0A 2O7TA 3GEUA 3QPSA 1JTXA 1U9NA 4D5FA 5IOYA 5J1RA 3K8PC 2Y31A 3G7RA 5F0HA 3B81A 4V2FA 2QOPA 3B6AA 2OERA 4ACIA 5F04A 3RD3A 2Y30A 2RHAA 4ME9A 3ZQGA 3EUPA 5EZHA 3IH3A 4V2GA 5J1UA 2D6YA 3DU5A 3HTIA 1A6IA 2XRLA 1JUMA 1T33A 3CRJA 2XPWA 3HGYA 2UXOA 4YZEA 2YVXA 5F08A 1ORKA 3Q3SA 4JKZA 5CXIA 3RH2A 2PZ9A 2NX4A 2OF7A 5IPAA 1RKWA 2HYTA 2REKA 5F27A 3VP5A 4OD5A 3BJBA 3SFIA 3BTIA 3HTJA 1RPWA 3AQTA 4MO7A 3WHBA 3BQZA 2B1EA 2A2FX 1QPIA 4B3AA 3NPIA 3ZQLA 1ZKGA 5CW8A 2JJ7A 2HXOA
chains in the Genus database with same CATH topology
5FKKA 2G7GA 1T56A 3ZQIA 3BHQA 3NI7A 2GFNA 2RASA 2G3BA 3QBMA 1BJZA 5HSZA 4JYKA 3PPBA 2GUHA 1Z0XA 3WHCA 2JK3A 5FKNA 5K58A 2XGEA 4M3DA 3P9TA 2FQ4A 3HGGA 3TP3A 3BCGA 2IAIA 5DAJA 3Q0WA 2FJ1A 4NN1A 3VIBA 3JSJA 3VVZA 4D7MA 3SDGA 3V78A 4W1UA 2ZB9A 5CXGA 2XDNA 3KNWA 2WGBA 3CJDA 2ZOZA 3QKXA 2XPVA 5F1JA 5AQCA 3ANGA 2HQ5A 3O60A 2YVHA 2ID3A 3G56A 3VPRA 3BR2A 3ON2A 5D19A 2GBYA 3F0CA 3BR5A 3Q0VA 3DEWA 4MXMA 4JNNA 2ZOYA 4M3BA 2IU5A 3DCFA 2HYJA 3VVXA 3HTAA 2DG8A 1ZK8A 3FIWA 3BTCA 5FKOA 2I10A 3V6GA 2XGDA 3CCYA 2X6OA 3KKDA 3T6NA 3BTJA 3PM1A 1JT6A 2W53A 5EFYA 3QPLA 1JTYA 3VW1A 5EYRA 3G1LA 5J3LA 1RKTA 2Q24A 5GPCA 4HKUA 1JUPA 4ABZA 2EH3A 2QKOA 3LHQA 2FX0A 2XB5A 5HBUA 2HKUA 2HXIA 4MK6A 3DPJA 2DG7A 2WV1A 5HAWA 4D7NA 5GP9A 4X1EA 1Z77A 2IEKA 2ZCXA 5IOZA 1JT0A 3BRUA 4CGRA 5F0CA 5IP6A 2X9DA 3LSJA 4ICHA 2GENA 3BR0A 4B1RA 4AUXA 5K7ZA 3KZ9A 5K7HA 3MVPA 2UXIA 2G7SA 1QVTA 2QTQA 4PXIA 3FK7A 3TP0A 2V57A 3LOCA 3VW2A 2VPRA 3C2BA 3O8HA 5FKMA 3QQAA 4XK4A 3VVYA 3FRQA 2G7LA 4GCLA 3BR3A 3EGQA 2VKEA 2Y2ZA 3B6CA 2VKVA 2ZCMA 3VOXA 3VOKA 4AC6A 2FBQA 2G0EA 3AQSA 2QIBA 3IH4A 3G1MA 3ON4A 3Q0UA 2ID6A 3CWRA 4UDSA 3HE0A 4D5CA 4NELA 5FGLA 4I6ZA 4JL3A 5F0FA 4L62A 3HTHA 4GCTA 3NRGA 4I76A 3LJLA 2UXUA 3C07A 1JUSA 2IBDA 3G1OA 2QWTA 2XPUA 3GZIA 2NP5A 2O7OA 2UXHA 3LSRA 4AF5A 3BTLA 3CDLA 1QVUA 3BT9A 2DTZA 5FMPA 4GFLA 3BR6A 1U9OA 5D1RA 2XGCA 2UXPA 3S5RA 3BNIA 5GPAA 2YVEA 3F1BA 1UI6A 3IH2A 2F07A 5C4YA 3ANPA 2NP3A 3HIMA 3NXCA 3KKCA 2QCOA 2TCTA 5FKLA 3BQYA 2RAEA 3O8GA 4M3EA 5K7FA 5J1YA 2NS8A 2PBXA 4W97A 3NNRA 4M3GA 2OPTA 4AC0A 4M3FA 4KWAA 4GCKA 3ZQHA 5EZGA 3LSPA 2TRTA 3IUVA 2OI8A 3FK6A 1UI5A 2ZCNA 4G12A 3VW0A 3PASA 5D18A 4GFKA 3E7QA 4DW6A 2NS7A 3LWJA 1SGMA 2WUIA 3COLA 3VUQA 5FHPA 3BR1A 3MNLA 3ZQFA 2FD5A 5H9TA 1VI0A 2O7TA 3GEUA 3QPSA 1JTXA 1U9NA 4D5FA 5IOYA 5J1RA 2Y31A 3G7RA 5F0HA 3B81A 4V2FA 2QOPA 3B6AA 2OERA 4ACIA 5F04A 3RD3A 2Y30A 2RHAA 4ME9A 3ZQGA 3EUPA 5EZHA 3IH3A 4V2GA 5J1UA 2D6YA 3HTIA 1A6IA 2XRLA 1JUMA 1T33A 3CRJA 2XPWA 3HGYA 2UXOA 4YZEA 5F08A 1ORKA 3Q3SA 4JKZA 5CXIA 3RH2A 2PZ9A 2NX4A 2OF7A 5IPAA 1RKWA 2HYTA 2REKA 5F27A 3VP5A 3BJBA 3SFIA 3BTIA 3HTJA 1RPWA 3AQTA 4MO7A 3WHBA 3BQZA 1QPIA 4B3AA 3NPIA 3ZQLA 1ZKGA 5CW8A 2JJ7A 2HXOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FKK A;  2G7G A;  1T56 A;  3ZQI A;  3BHQ A;  3NI7 A;  2GFN A;  2RAS A;  2G3B A;  3QBM A;  1BJZ A;  5HSZ A;  4JYK A;  3PPB A;  2GUH A;  1Z0X A;  3WHC A;  2JK3 A;  5FKN A;  5K58 A;  2XGE A;  4M3D A;  3P9T A;  2FQ4 A;  3HGG A;  3TP3 A;  3BCG A;  2IAI A;  5DAJ A;  3Q0W A;  2FJ1 A;  4NN1 A;  3VIB A;  3JSJ A;  3VVZ A;  4D7M A;  3SDG A;  3V78 A;  4W1U A;  2ZB9 A;  5CXG A;  2XDN A;  3KNW A;  2WGB A;  3CJD A;  2ZOZ A;  3QKX A;  2XPV A;  5F1J A;  5AQC A;  3ANG A;  2HQ5 A;  3O60 A;  2YVH A;  2ID3 A;  3G56 A;  3VPR A;  3BR2 A;  3ON2 A;  5D19 A;  2GBY A;  3F0C A;  3BR5 A;  3Q0V A;  3DEW A;  4MXM A;  4JNN A;  2ZOY A;  4M3B A;  2IU5 A;  3DCF A;  2HYJ A;  3VVX A;  3HTA A;  2DG8 A;  1ZK8 A;  3FIW A;  3BTC A;  5FKO A;  2I10 A;  3V6G A;  2XGD A;  3CCY A;  2X6O A;  3KKD A;  3T6N A;  3BTJ A;  3PM1 A;  1JT6 A;  2W53 A;  5EFY A;  3QPL A;  1JTY A;  3VW1 A;  5EYR A;  3G1L A;  5J3L A;  1RKT A;  2Q24 A;  5GPC A;  4HKU A;  1JUP A;  4ABZ A;  2EH3 A;  2QKO A;  3LHQ A;  2FX0 A;  2XB5 A;  5HBU A;  2HKU A;  2HXI A;  4MK6 A;  3DPJ A;  2DG7 A;  2WV1 A;  5HAW A;  4D7N A;  5GP9 A;  4X1E A;  1Z77 A;  2IEK A;  2ZCX A;  5IOZ A;  1JT0 A;  3BRU A;  4CGR A;  5F0C A;  5IP6 A;  2X9D A;  3LSJ A;  4ICH A;  2GEN A;  3BR0 A;  4B1R A;  4AUX A;  5K7Z A;  3KZ9 A;  5K7H A;  3MVP A;  2UXI A;  2G7S A;  1QVT A;  2QTQ A;  4PXI A;  3FK7 A;  3TP0 A;  2V57 A;  3LOC A;  3VW2 A;  2VPR A;  3C2B A;  3O8H A;  5FKM A;  3QQA A;  4XK4 A;  3VVY A;  3FRQ A;  2G7L A;  4GCL A;  3BR3 A;  3EGQ A;  2VKE A;  2Y2Z A;  3B6C A;  2VKV A;  2ZCM A;  3VOX A;  3VOK A;  4AC6 A;  2FBQ A;  2G0E A;  3AQS A;  2QIB A;  3IH4 A;  3G1M A;  3ON4 A;  3Q0U A;  2ID6 A;  3CWR A;  4UDS A;  3HE0 A;  4D5C A;  4NEL A;  5FGL A;  4I6Z A;  4JL3 A;  5F0F A;  4L62 A;  3HTH A;  4GCT A;  3NRG A;  4I76 A;  3LJL A;  2UXU A;  3C07 A;  1JUS A;  2IBD A;  3G1O A;  2QWT A;  2XPU A;  3GZI A;  2NP5 A;  2O7O A;  2UXH A;  3LSR A;  4AF5 A;  3BTL A;  3CDL A;  1QVU A;  3BT9 A;  2DTZ A;  5FMP A;  4GFL A;  3BR6 A;  1U9O A;  5D1R A;  2XGC A;  2UXP A;  3S5R A;  3BNI A;  5GPA A;  2YVE A;  3F1B A;  1UI6 A;  3IH2 A;  2F07 A;  5C4Y A;  3ANP A;  2NP3 A;  3HIM A;  3NXC A;  3KKC A;  2QCO A;  2TCT A;  5FKL A;  3BQY A;  2RAE A;  3O8G A;  4M3E A;  5K7F A;  5J1Y A;  2NS8 A;  2PBX A;  4W97 A;  3NNR A;  4M3G A;  2OPT A;  4AC0 A;  4M3F A;  4KWA A;  4GCK A;  3ZQH A;  5EZG A;  3LSP A;  2TRT A;  3IUV A;  2OI8 A;  3FK6 A;  1UI5 A;  2ZCN A;  4G12 A;  3VW0 A;  3PAS A;  5D18 A;  4GFK A;  3E7Q A;  4DW6 A;  2NS7 A;  3LWJ A;  1SGM A;  2WUI A;  3COL A;  3VUQ A;  5FHP A;  3BR1 A;  3MNL A;  3ZQF A;  2FD5 A;  5H9T A;  1VI0 A;  2O7T A;  3GEU A;  3QPS A;  1JTX A;  1U9N A;  4D5F A;  5IOY A;  5J1R A;  2Y31 A;  3G7R A;  5F0H A;  3B81 A;  4V2F A;  2QOP A;  3B6A A;  2OER A;  4ACI A;  5F04 A;  3RD3 A;  2Y30 A;  2RHA A;  4ME9 A;  3ZQG A;  3EUP A;  5EZH A;  3IH3 A;  4V2G A;  5J1U A;  2D6Y A;  3HTI A;  1A6I A;  2XRL A;  1JUM A;  1T33 A;  3CRJ A;  2XPW A;  3HGY A;  2UXO A;  4YZE A;  5F08 A;  1ORK A;  3Q3S A;  4JKZ A;  5CXI A;  3RH2 A;  2PZ9 A;  2NX4 A;  2OF7 A;  5IPA A;  1RKW A;  2HYT A;  2REK A;  5F27 A;  3VP5 A;  3BJB A;  3SFI A;  3BTI A;  3HTJ A;  1RPW A;  3AQT A;  4MO7 A;  3WHB A;  3BQZ A;  1QPI A;  4B3A A;  3NPI A;  3ZQL A;  1ZKG A;  5CW8 A;  2JJ7 A;  2HXO A; 
#chains in the Genus database with same CATH topology
 5FKK A;  2G7G A;  1T56 A;  3ZQI A;  3BHQ A;  3NI7 A;  2GFN A;  2RAS A;  2G3B A;  3QBM A;  1BJZ A;  5HSZ A;  4JYK A;  3PPB A;  2GUH A;  1Z0X A;  3WHC A;  2JK3 A;  5FKN A;  5K58 A;  2XGE A;  4M3D A;  3P9T A;  2FQ4 A;  3KYL A;  3HGG A;  3TP3 A;  3BCG A;  2IAI A;  5DAJ A;  2R7S A;  3Q0W A;  2FJ1 A;  4NN1 A;  3VIB A;  4U9L A;  3JSJ A;  3VVZ A;  4D7M A;  3SDG A;  3V78 A;  4W1U A;  2ZB9 A;  5CXG A;  2XDN A;  3KNW A;  2WGB A;  3CJD A;  2ZOZ A;  3QKX A;  2XPV A;  5F1J A;  5AQC A;  3ANG A;  2HQ5 A;  3O60 A;  2YVH A;  2ID3 A;  4OD4 A;  3G56 A;  2FJI 1;  3VPR A;  3BR2 A;  2R7W A;  3ON2 A;  5D19 A;  2GBY A;  3F0C A;  3BR5 A;  3Q0V A;  3DEW A;  4MXM A;  4JNN A;  2ZOY A;  4M3B A;  2IU5 A;  3DCF A;  2HYJ A;  3VVX A;  3HTA A;  2DG8 A;  1ZK8 A;  3FIW A;  3BTC A;  5FKO A;  2I10 A;  3V6G A;  2XGD A;  3CCY A;  2X6O A;  3KKD A;  2R7V A;  3T6N A;  3BTJ A;  3PM1 A;  1JT6 A;  2W53 A;  5EFY A;  3QPL A;  1JTY A;  4U9N A;  3VW1 A;  5EYR A;  3G1L A;  5J3L A;  1RKT A;  2Q24 A;  5GPC A;  4HKU A;  1JUP A;  4ABZ A;  2EH3 A;  2R7T A;  2QKO A;  3LHQ A;  2FX0 A;  2XB5 A;  5HBU A;  2R7X A;  2HKU A;  2HXI A;  2R7Q A;  4MK6 A;  3DPJ A;  2DG7 A;  2WV1 A;  3VTI A;  4D7N A;  5HAW A;  5GP9 A;  4X1E A;  1Z77 A;  2IEK A;  2ZCX A;  5IOZ A;  1JT0 A;  3BRU A;  4CGR A;  5F0C A;  5IP6 A;  2X9D A;  3LSJ A;  4ICH A;  2GEN A;  3BR0 A;  4WIB A;  4B1R A;  4AUX A;  4DVY P;  5K7Z A;  3KZ9 A;  5K7H A;  3MVP A;  2UXI A;  2G7S A;  1QVT A;  2QTQ A;  4PXI A;  3FK7 A;  3TP0 A;  2V57 A;  3LOC A;  3VW2 A;  2VPR A;  4IRV A;  3C2B A;  3O8H A;  5FKM A;  2R7R A;  3NS4 A;  3QQA A;  4XK4 A;  3VVY A;  3FRQ A;  2G7L A;  4GCL A;  3BR3 A;  3EGQ A;  2VKE A;  2Y2Z A;  3B6C A;  2VKV A;  2ZCM A;  3VOX A;  3VOK A;  4AC6 A;  2FBQ A;  2G0E A;  3AQS A;  2QIB A;  3IH4 A;  3G1M A;  3ON4 A;  4C2M A;  3Q0U A;  2ID6 A;  3CWR A;  4UDS A;  3HE0 A;  4D5C A;  4NEL A;  5FGL A;  4I6Z A;  4JL3 A;  5F0F A;  4L62 A;  3HTH A;  4GCT A;  3NRG A;  4I76 A;  3LJL A;  2UXU A;  3C07 A;  1JUS A;  2IBD A;  3G1O A;  2QWT A;  2XPU A;  3GZI A;  2NP5 A;  2O7O A;  2UXH A;  3LSR A;  4AF5 A;  3BTL A;  3CDL A;  1QVU A;  3BT9 A;  2DTZ A;  5FMP A;  4GFL A;  3BR6 A;  1U9O A;  5D1R A;  2XGC A;  2UXP A;  3S5R A;  3BNI A;  5GPA A;  2R7O A;  2YVE A;  3F1B A;  1UI6 A;  3IH2 A;  2F07 A;  5C4Y A;  3ANP A;  2NP3 A;  3HIM A;  3NXC A;  2R7U A;  3KKC A;  2QCO A;  2TCT A;  5FKL A;  3BQY A;  2RAE A;  3O8G A;  4M3E A;  5K7F A;  5J1Y A;  2NS8 A;  2PBX A;  4W97 A;  3NNR A;  4M3G A;  2OPT A;  4AC0 A;  4M3F A;  4KWA A;  4GCK A;  3ZQH A;  5EZG A;  3LSP A;  2TRT A;  3SWH A;  3IUV A;  2OI8 A;  3FK6 A;  1UI5 A;  3DU6 A;  2ZCN A;  2ZY9 A;  4G12 A;  3VW0 A;  2B3W A;  3PAS A;  3FHN A;  5D18 A;  4GFK A;  3E7Q A;  4DW6 A;  2NS7 A;  3LWJ A;  1SGM A;  2WUI A;  3COL A;  3VUQ A;  5CQG A;  5FHP A;  3BR1 A;  2PFV A;  3MNL A;  3ZQF A;  2FD5 A;  5H9T A;  1VI0 A;  2O7T A;  3GEU A;  3QPS A;  1JTX A;  1U9N A;  4D5F A;  5IOY A;  5J1R A;  3K8P C;  2Y31 A;  3G7R A;  5F0H A;  3B81 A;  4V2F A;  2QOP A;  3B6A A;  2OER A;  4ACI A;  5F04 A;  3RD3 A;  2Y30 A;  2RHA A;  4ME9 A;  3ZQG A;  3EUP A;  5EZH A;  3IH3 A;  4V2G A;  5J1U A;  2D6Y A;  3DU5 A;  3HTI A;  1A6I A;  2XRL A;  1JUM A;  1T33 A;  3CRJ A;  2XPW A;  3HGY A;  2UXO A;  4YZE A;  2YVX A;  5F08 A;  1ORK A;  3Q3S A;  4JKZ A;  5CXI A;  3RH2 A;  2PZ9 A;  2NX4 A;  2OF7 A;  5IPA A;  1RKW A;  2HYT A;  2REK A;  5F27 A;  3VP5 A;  4OD5 A;  3BJB A;  3SFI A;  3BTI A;  3HTJ A;  1RPW A;  3AQT A;  4MO7 A;  3WHB A;  3BQZ A;  2B1E A;  2A2F X;  1QPI A;  4B3A A;  3NPI A;  3ZQL A;  1ZKG A;  5CW8 A;  2JJ7 A;  2HXO A; 
#chains in the Genus database with same CATH homology
 5FKK A;  2G7G A;  1T56 A;  3ZQI A;  3BHQ A;  3NI7 A;  2GFN A;  2RAS A;  2G3B A;  3QBM A;  1BJZ A;  5HSZ A;  4JYK A;  3PPB A;  2GUH A;  1Z0X A;  3WHC A;  2JK3 A;  5FKN A;  5K58 A;  2XGE A;  4M3D A;  3P9T A;  2FQ4 A;  3HGG A;  3TP3 A;  3BCG A;  2IAI A;  5DAJ A;  3Q0W A;  2FJ1 A;  4NN1 A;  3VIB A;  3JSJ A;  3VVZ A;  4D7M A;  3SDG A;  3V78 A;  4W1U A;  2ZB9 A;  5CXG A;  2XDN A;  3KNW A;  2WGB A;  3CJD A;  2ZOZ A;  3QKX A;  2XPV A;  5F1J A;  5AQC A;  3ANG A;  2HQ5 A;  3O60 A;  2YVH A;  2ID3 A;  3G56 A;  3VPR A;  3BR2 A;  3ON2 A;  5D19 A;  2GBY A;  3F0C A;  3BR5 A;  3Q0V A;  3DEW A;  4MXM A;  4JNN A;  2ZOY A;  4M3B A;  2IU5 A;  3DCF A;  2HYJ A;  3VVX A;  3HTA A;  2DG8 A;  1ZK8 A;  3FIW A;  3BTC A;  5FKO A;  2I10 A;  3V6G A;  2XGD A;  3CCY A;  2X6O A;  3KKD A;  3T6N A;  3BTJ A;  3PM1 A;  1JT6 A;  2W53 A;  5EFY A;  3QPL A;  1JTY A;  3VW1 A;  5EYR A;  3G1L A;  5J3L A;  1RKT A;  2Q24 A;  5GPC A;  4HKU A;  1JUP A;  4ABZ A;  2EH3 A;  2QKO A;  3LHQ A;  2FX0 A;  2XB5 A;  5HBU A;  2HKU A;  2HXI A;  4MK6 A;  3DPJ A;  2DG7 A;  2WV1 A;  5HAW A;  4D7N A;  5GP9 A;  4X1E A;  1Z77 A;  2IEK A;  2ZCX A;  5IOZ A;  1JT0 A;  3BRU A;  4CGR A;  5F0C A;  5IP6 A;  2X9D A;  3LSJ A;  4ICH A;  2GEN A;  3BR0 A;  4B1R A;  4AUX A;  5K7Z A;  3KZ9 A;  5K7H A;  3MVP A;  2UXI A;  2G7S A;  1QVT A;  2QTQ A;  4PXI A;  3FK7 A;  3TP0 A;  2V57 A;  3LOC A;  3VW2 A;  2VPR A;  3C2B A;  3O8H A;  5FKM A;  3QQA A;  4XK4 A;  3VVY A;  3FRQ A;  2G7L A;  4GCL A;  3BR3 A;  3EGQ A;  2VKE A;  2Y2Z A;  3B6C A;  2VKV A;  2ZCM A;  3VOX A;  3VOK A;  4AC6 A;  2FBQ A;  2G0E A;  3AQS A;  2QIB A;  3IH4 A;  3G1M A;  3ON4 A;  3Q0U A;  2ID6 A;  3CWR A;  4UDS A;  3HE0 A;  4D5C A;  4NEL A;  5FGL A;  4I6Z A;  4JL3 A;  5F0F A;  4L62 A;  3HTH A;  4GCT A;  3NRG A;  4I76 A;  3LJL A;  2UXU A;  3C07 A;  1JUS A;  2IBD A;  3G1O A;  2QWT A;  2XPU A;  3GZI A;  2NP5 A;  2O7O A;  2UXH A;  3LSR A;  4AF5 A;  3BTL A;  3CDL A;  1QVU A;  3BT9 A;  2DTZ A;  5FMP A;  4GFL A;  3BR6 A;  1U9O A;  5D1R A;  2XGC A;  2UXP A;  3S5R A;  3BNI A;  5GPA A;  2YVE A;  3F1B A;  1UI6 A;  3IH2 A;  2F07 A;  5C4Y A;  3ANP A;  2NP3 A;  3HIM A;  3NXC A;  3KKC A;  2QCO A;  2TCT A;  5FKL A;  3BQY A;  2RAE A;  3O8G A;  4M3E A;  5K7F A;  5J1Y A;  2NS8 A;  2PBX A;  4W97 A;  3NNR A;  4M3G A;  2OPT A;  4AC0 A;  4M3F A;  4KWA A;  4GCK A;  3ZQH A;  5EZG A;  3LSP A;  2TRT A;  3IUV A;  2OI8 A;  3FK6 A;  1UI5 A;  2ZCN A;  4G12 A;  3VW0 A;  3PAS A;  5D18 A;  4GFK A;  3E7Q A;  4DW6 A;  2NS7 A;  3LWJ A;  1SGM A;  2WUI A;  3COL A;  3VUQ A;  5FHP A;  3BR1 A;  3MNL A;  3ZQF A;  2FD5 A;  5H9T A;  1VI0 A;  2O7T A;  3GEU A;  3QPS A;  1JTX A;  1U9N A;  4D5F A;  5IOY A;  5J1R A;  2Y31 A;  3G7R A;  5F0H A;  3B81 A;  4V2F A;  2QOP A;  3B6A A;  2OER A;  4ACI A;  5F04 A;  3RD3 A;  2Y30 A;  2RHA A;  4ME9 A;  3ZQG A;  3EUP A;  5EZH A;  3IH3 A;  4V2G A;  5J1U A;  2D6Y A;  3HTI A;  1A6I A;  2XRL A;  1JUM A;  1T33 A;  3CRJ A;  2XPW A;  3HGY A;  2UXO A;  4YZE A;  5F08 A;  1ORK A;  3Q3S A;  4JKZ A;  5CXI A;  3RH2 A;  2PZ9 A;  2NX4 A;  2OF7 A;  5IPA A;  1RKW A;  2HYT A;  2REK A;  5F27 A;  3VP5 A;  3BJB A;  3SFI A;  3BTI A;  3HTJ A;  1RPW A;  3AQT A;  4MO7 A;  3WHB A;  3BQZ A;  1QPI A;  4B3A A;  3NPI A;  3ZQL A;  1ZKG A;  5CW8 A;  2JJ7 A;  2HXO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...