3KZ9A

Crystal structure of the master transcriptional regulator, smcr, in vibrio vulnificus provides insight into its dna recognition mechanism
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
201
structure length
201
Chain Sequence
AKRPRTRLSPLKRKQQLMEIALEVFARRGIGRGGHADIAEIAQVSVATVFNYFPTREDLVDEVLNHVVRQFSNFLSDNIDLDLHAKENIANITNAMIELVVQDNHWLKVWFEWSASTRDEVWPLFVTTNRTNQLLVQNMFIKAIERGEVCDQHNPEDLANLFHGICYSLFVQANRTNNTAELSKLVSSYLDMLCIYKREHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords SmcR
publication title The crystal structure of SmcR, a quorum-sensing master regulator of Vibrio vulnificus, provides insight into its regulation of transcription
pubmed doi rcsb
source organism Vibrio vulnificus
total genus 70
structure length 201
sequence length 201
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3kz9A00
1RPWA 2DG8A 3HGGA 2QKOA 2ZOZA 4ABZA 5K7ZA 2ID3A 3G7RA 5FKNA 3KNWA 1RKWA 2RAEA 5IOZA 2UXPA 5C4YA 5FKKA 3CCYA 2GUHA 3Q0WA 2QTQA 3WHBA 3MNLA 4ACIA 3O60A 3ZQIA 4GFLA 2HYTA 3AQTA 5FGLA 2G7LA 3B6AA 1JTYA 4MK6A 5F0HA 4B3AA 3ZQGA 3VIBA 5J1UA 4W97A 4M3DA 3P9TA 2GBYA 2ZB9A 2UXHA 3IH3A 4CGRA 3ZQLA 3RH2A 5F1JA 2NP3A 2WGBA 3QPLA 2FX0A 2XPUA 3BCGA 3HTJA 4AC6A 3LSPA 3E7QA 3LOCA 3DPJA 4G12A 2G7GA 2VKEA 2D6YA 5HBUA 5J1RA 3B81A 4L62A 3BTCA 4AUXA 3KZ9A 3NRGA 3F0CA 5F27A 1QVTA 2F07A 2I10A 3BTLA 2FJ1A 2ID6A 5GPCA 3QPSA 3RD3A 3BR5A 2UXIA 2RHAA 5IP6A 1ZK8A 3BQYA 2X9DA 5IPAA 3CDLA 1JUMA 3BR2A 2HQ5A 1U9OA 5D18A 1Z77A 4D7MA 4GCKA 3G1OA 5F04A 4JNNA 3DCFA 3T6NA 5EZHA 2FBQA 3NXCA 4AC0A 1A6IA 2IBDA 2PBXA 3G1LA 3WHCA 3COLA 3VW0A 4NN1A 3S5RA 2DG7A 3JSJA 3TP3A 4GCLA 1JUPA 2XGEA 2GENA 2GFNA 2EH3A 2G0EA 1VI0A 1ORKA 3KKCA 2ZCXA 5GP9A 1T33A 1T56A 3Q0VA 2NX4A 5EFYA 3EGQA 3BNIA 3BQZA 3V78A 5GPAA 4B1RA 3HTAA 2WV1A 2G3BA 3Q3SA 2UXUA 2XPVA 5FHPA 3CWRA 4W1UA 4YZEA 2QIBA 4JKZA 3B6CA 2PZ9A 3FIWA 3BRUA 4AF5A 2Q24A 5F0FA 2ZOYA 3G1MA 1JTXA 5IOYA 3IH2A 2ZCNA 2UXOA 4MO7A 3TP0A 3KKDA 4D7NA 2HXOA 4X1EA 2IAIA 3BJBA 4D5CA 3SDGA 5HSZA 4M3BA 3PPBA 2VKVA 1QPIA 3C2BA 3VOXA 1BJZA 4GFKA 3ZQHA 2HYJA 2IU5A 3VVZA 5K58A 2OPTA 3HTIA 5HAWA 1ZKGA 3O8GA 3QQAA 3ON2A 3VUQA 2QOPA 3BHQA 2G7SA 5EZGA 3NNRA 3DEWA 3FK6A 3EUPA 2NS7A 2RASA 5J3LA 2Y2ZA 5D1RA 5K7HA 3ZQFA 4I6ZA 2JK3A 5AQCA 2Y30A 2HXIA 3ON4A 4V2FA 3LHQA 3QKXA 4NELA 3MVPA 3SFIA 1UI6A 5FKLA 4GCTA 1QVUA 3VW1A 5J1YA 3VVYA 2TRTA 3IH4A 4MXMA 4D5FA 5FKMA 3BT9A 4JYKA 3LJLA 2X6OA 3LSJA 2XDNA 3VW2A 1Z0XA 2O7OA 3V6GA 2OF7A 4M3FA 2IEKA 5FKOA 5DAJA 4I76A 3VP5A 3NPIA 1UI5A 2NP5A 3HE0A 2OI8A 1JUSA 2TCTA 2YVEA 2FD5A 3CJDA 4HKUA 2XB5A 1SGMA 5EYRA 2Y31A 3GEUA 2WUIA 2OERA 4JL3A 2DTZA 4DW6A 3QBMA 3GZIA 4M3GA 4M3EA 1RKTA 2REKA 3HTHA 3BTIA 4ME9A 2QWTA 5CW8A 5FMPA 3HGYA 2ZCMA 3ANPA 4UDSA 3BTJA 2NS8A 3BR3A 4V2GA 5F08A 3ANGA 2JJ7A 3LSRA 4KWAA 1U9NA 5K7FA 5F0CA 2YVHA 3VVXA 2VPRA 3LWJA 2QCOA 2XRLA 3FRQA 3BR0A 1JT6A 5CXGA 2XGCA 3G56A 1JT0A 3AQSA 2HKUA 3BR6A 3NI7A 3HIMA 5H9TA 5D19A 5CXIA 3F1BA 3IUVA 3PASA 2V57A 3Q0UA 3VOKA 4ICHA 3BR1A 2FQ4A 4XK4A 2O7TA 4PXIA 3VPRA 2W53A 2XPWA 3FK7A 3CRJA 3PM1A 3O8HA 2XGDA 3C07A
chains in the Genus database with same CATH superfamily
1RPWA 2DG8A 3HGGA 2QKOA 2ZOZA 4ABZA 5K7ZA 2ID3A 3G7RA 5FKNA 3KNWA 2A2FX 1RKWA 2RAEA 5IOZA 2UXPA 5C4YA 5FKKA 3CCYA 2GUHA 3Q0WA 2QTQA 3WHBA 2R7UA 3MNLA 4ACIA 3O60A 3ZQIA 2R7WA 4GFLA 2HYTA 3AQTA 5FGLA 2G7LA 3B6AA 1JTYA 4MK6A 5F0HA 4B3AA 3ZQGA 3VIBA 5J1UA 4OD5A 4W97A 4M3DA 3P9TA 2GBYA 2ZB9A 2UXHA 3IH3A 4CGRA 3ZQLA 3RH2A 5F1JA 2NP3A 2WGBA 3QPLA 2FX0A 2XPUA 3BCGA 3HTJA 4AC6A 3LSPA 3E7QA 3K8PC 3LOCA 3DPJA 4G12A 2G7GA 2VKEA 2D6YA 5HBUA 5J1RA 3B81A 4L62A 2PFVA 3BTCA 4AUXA 3KZ9A 3NRGA 3F0CA 5F27A 1QVTA 2F07A 2I10A 3BTLA 2R7OA 2FJ1A 2ID6A 5GPCA 3QPSA 3RD3A 3BR5A 2UXIA 4DVYP 2RHAA 3DU6A 5IP6A 1ZK8A 3BQYA 2X9DA 5IPAA 3CDLA 1JUMA 3BR2A 2HQ5A 1U9OA 5D18A 1Z77A 4D7MA 4GCKA 3G1OA 5F04A 4JNNA 3DCFA 3T6NA 5EZHA 2FBQA 3KYLA 3NXCA 4AC0A 1A6IA 2IBDA 2PBXA 3G1LA 3WHCA 3COLA 3VW0A 4NN1A 3S5RA 2DG7A 3JSJA 3TP3A 4U9LA 4GCLA 1JUPA 2XGEA 2GENA 2GFNA 2B1EA 2EH3A 2G0EA 1VI0A 1ORKA 3KKCA 2ZCXA 5GP9A 1T33A 1T56A 3Q0VA 2NX4A 5EFYA 3EGQA 3BNIA 3BQZA 3V78A 5GPAA 3VTIA 4B1RA 3HTAA 2WV1A 2G3BA 3Q3SA 2UXUA 2XPVA 5FHPA 3CWRA 4W1UA 4YZEA 2QIBA 4JKZA 3B6CA 2PZ9A 3FIWA 3BRUA 4AF5A 2Q24A 5F0FA 2ZOYA 3G1MA 2R7TA 1JTXA 5CQGA 5IOYA 3IH2A 2ZCNA 2UXOA 4MO7A 3TP0A 3KKDA 2YVXA 4D7NA 2HXOA 4X1EA 2IAIA 3BJBA 4D5CA 3SDGA 5HSZA 2R7VA 2R7XA 4M3BA 3PPBA 2VKVA 1QPIA 3C2BA 3VOXA 1BJZA 4GFKA 3ZQHA 2HYJA 3NS4A 2IU5A 3VVZA 5K58A 2OPTA 3HTIA 5HAWA 1ZKGA 3O8GA 3QQAA 3ON2A 3VUQA 2QOPA 3BHQA 2G7SA 5EZGA 3NNRA 3DEWA 3FK6A 3EUPA 2NS7A 2RASA 5J3LA 2Y2ZA 5D1RA 5K7HA 3ZQFA 4I6ZA 2JK3A 5AQCA 2Y30A 2HXIA 3ON4A 4V2FA 3LHQA 3QKXA 4NELA 3MVPA 3SFIA 1UI6A 5FKLA 4GCTA 1QVUA 3VW1A 5J1YA 3VVYA 4WIBA 2TRTA 3IH4A 4MXMA 4D5FA 5FKMA 3BT9A 4JYKA 3LJLA 2X6OA 3LSJA 2XDNA 3VW2A 1Z0XA 2O7OA 3V6GA 2OF7A 4M3FA 2IEKA 5FKOA 5DAJA 3FHNA 4I76A 3VP5A 3NPIA 1UI5A 2NP5A 3HE0A 2OI8A 1JUSA 2ZY9A 2TCTA 2YVEA 2FD5A 4OD4A 3CJDA 4HKUA 2XB5A 1SGMA 5EYRA 2Y31A 3GEUA 2WUIA 2OERA 4JL3A 2DTZA 4DW6A 3QBMA 3GZIA 4M3GA 4M3EA 4U9NA 1RKTA 2REKA 3HTHA 3BTIA 4ME9A 2QWTA 5CW8A 5FMPA 3HGYA 2ZCMA 3SWHA 3ANPA 4UDSA 3BTJA 2NS8A 3BR3A 4V2GA 5F08A 3ANGA 2JJ7A 3LSRA 2B3WA 4KWAA 1U9NA 5K7FA 5F0CA 2YVHA 2FJI1 3VVXA 2VPRA 3LWJA 2R7RA 2QCOA 2XRLA 3FRQA 3BR0A 1JT6A 5CXGA 2XGCA 3G56A 2R7SA 1JT0A 3AQSA 2HKUA 3BR6A 3NI7A 3HIMA 5H9TA 5D19A 5CXIA 4C2MA 3F1BA 3IUVA 3PASA 2V57A 3Q0UA 3VOKA 4ICHA 3BR1A 3DU5A 2FQ4A 4IRVA 4XK4A 2O7TA 4PXIA 2R7QA 3VPRA 2W53A 2XPWA 3FK7A 3CRJA 3PM1A 3O8HA 2XGDA 3C07A
chains in the Genus database with same CATH topology
1RPWA 2DG8A 3HGGA 2QKOA 2ZOZA 4ABZA 5K7ZA 2ID3A 3G7RA 5FKNA 3KNWA 1RKWA 2RAEA 5IOZA 2UXPA 5C4YA 5FKKA 3CCYA 2GUHA 3Q0WA 2QTQA 3WHBA 3MNLA 4ACIA 3O60A 3ZQIA 4GFLA 2HYTA 3AQTA 5FGLA 2G7LA 3B6AA 1JTYA 4MK6A 5F0HA 4B3AA 3ZQGA 3VIBA 5J1UA 4W97A 4M3DA 3P9TA 2GBYA 2ZB9A 2UXHA 3IH3A 4CGRA 3ZQLA 3RH2A 5F1JA 2NP3A 2WGBA 3QPLA 2FX0A 2XPUA 3BCGA 3HTJA 4AC6A 3LSPA 3E7QA 3LOCA 3DPJA 4G12A 2G7GA 2VKEA 2D6YA 5HBUA 5J1RA 3B81A 4L62A 3BTCA 4AUXA 3KZ9A 3NRGA 3F0CA 5F27A 1QVTA 2F07A 2I10A 3BTLA 2FJ1A 2ID6A 5GPCA 3QPSA 3RD3A 3BR5A 2UXIA 2RHAA 5IP6A 1ZK8A 3BQYA 2X9DA 5IPAA 3CDLA 1JUMA 3BR2A 2HQ5A 1U9OA 5D18A 1Z77A 4D7MA 4GCKA 3G1OA 5F04A 4JNNA 3DCFA 3T6NA 5EZHA 2FBQA 3NXCA 4AC0A 1A6IA 2IBDA 2PBXA 3G1LA 3WHCA 3COLA 3VW0A 4NN1A 3S5RA 2DG7A 3JSJA 3TP3A 4GCLA 1JUPA 2XGEA 2GENA 2GFNA 2EH3A 2G0EA 1VI0A 1ORKA 3KKCA 2ZCXA 5GP9A 1T33A 1T56A 3Q0VA 2NX4A 5EFYA 3EGQA 3BNIA 3BQZA 3V78A 5GPAA 4B1RA 3HTAA 2WV1A 2G3BA 3Q3SA 2UXUA 2XPVA 5FHPA 3CWRA 4W1UA 4YZEA 2QIBA 4JKZA 3B6CA 2PZ9A 3FIWA 3BRUA 4AF5A 2Q24A 5F0FA 2ZOYA 3G1MA 1JTXA 5IOYA 3IH2A 2ZCNA 2UXOA 4MO7A 3TP0A 3KKDA 4D7NA 2HXOA 4X1EA 2IAIA 3BJBA 4D5CA 3SDGA 5HSZA 4M3BA 3PPBA 2VKVA 1QPIA 3C2BA 3VOXA 1BJZA 4GFKA 3ZQHA 2HYJA 2IU5A 3VVZA 5K58A 2OPTA 3HTIA 5HAWA 1ZKGA 3O8GA 3QQAA 3ON2A 3VUQA 2QOPA 3BHQA 2G7SA 5EZGA 3NNRA 3DEWA 3FK6A 3EUPA 2NS7A 2RASA 5J3LA 2Y2ZA 5D1RA 5K7HA 3ZQFA 4I6ZA 2JK3A 5AQCA 2Y30A 2HXIA 3ON4A 4V2FA 3LHQA 3QKXA 4NELA 3MVPA 3SFIA 1UI6A 5FKLA 4GCTA 1QVUA 3VW1A 5J1YA 3VVYA 2TRTA 3IH4A 4MXMA 4D5FA 5FKMA 3BT9A 4JYKA 3LJLA 2X6OA 3LSJA 2XDNA 3VW2A 1Z0XA 2O7OA 3V6GA 2OF7A 4M3FA 2IEKA 5FKOA 5DAJA 4I76A 3VP5A 3NPIA 1UI5A 2NP5A 3HE0A 2OI8A 1JUSA 2TCTA 2YVEA 2FD5A 3CJDA 4HKUA 2XB5A 1SGMA 5EYRA 2Y31A 3GEUA 2WUIA 2OERA 4JL3A 2DTZA 4DW6A 3QBMA 3GZIA 4M3GA 4M3EA 1RKTA 2REKA 3HTHA 3BTIA 4ME9A 2QWTA 5CW8A 5FMPA 3HGYA 2ZCMA 3ANPA 4UDSA 3BTJA 2NS8A 3BR3A 4V2GA 5F08A 3ANGA 2JJ7A 3LSRA 4KWAA 1U9NA 5K7FA 5F0CA 2YVHA 3VVXA 2VPRA 3LWJA 2QCOA 2XRLA 3FRQA 3BR0A 1JT6A 5CXGA 2XGCA 3G56A 1JT0A 3AQSA 2HKUA 3BR6A 3NI7A 3HIMA 5H9TA 5D19A 5CXIA 3F1BA 3IUVA 3PASA 2V57A 3Q0UA 3VOKA 4ICHA 3BR1A 2FQ4A 4XK4A 2O7TA 4PXIA 3VPRA 2W53A 2XPWA 3FK7A 3CRJA 3PM1A 3O8HA 2XGDA 3C07A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RPW A;  2DG8 A;  3HGG A;  2QKO A;  2ZOZ A;  4ABZ A;  5K7Z A;  2ID3 A;  3G7R A;  5FKN A;  3KNW A;  1RKW A;  2RAE A;  5IOZ A;  2UXP A;  5C4Y A;  5FKK A;  3CCY A;  2GUH A;  3Q0W A;  2QTQ A;  3WHB A;  3MNL A;  4ACI A;  3O60 A;  3ZQI A;  4GFL A;  2HYT A;  3AQT A;  5FGL A;  2G7L A;  3B6A A;  1JTY A;  4MK6 A;  5F0H A;  4B3A A;  3ZQG A;  3VIB A;  5J1U A;  4W97 A;  4M3D A;  3P9T A;  2GBY A;  2ZB9 A;  2UXH A;  3IH3 A;  4CGR A;  3ZQL A;  3RH2 A;  5F1J A;  2NP3 A;  2WGB A;  3QPL A;  2FX0 A;  2XPU A;  3BCG A;  3HTJ A;  4AC6 A;  3LSP A;  3E7Q A;  3LOC A;  3DPJ A;  4G12 A;  2G7G A;  2VKE A;  2D6Y A;  5HBU A;  5J1R A;  3B81 A;  4L62 A;  3BTC A;  4AUX A;  3KZ9 A;  3NRG A;  3F0C A;  5F27 A;  1QVT A;  2F07 A;  2I10 A;  3BTL A;  2FJ1 A;  2ID6 A;  5GPC A;  3QPS A;  3RD3 A;  3BR5 A;  2UXI A;  2RHA A;  5IP6 A;  1ZK8 A;  3BQY A;  2X9D A;  5IPA A;  3CDL A;  1JUM A;  3BR2 A;  2HQ5 A;  1U9O A;  5D18 A;  1Z77 A;  4D7M A;  4GCK A;  3G1O A;  5F04 A;  4JNN A;  3DCF A;  3T6N A;  5EZH A;  2FBQ A;  3NXC A;  4AC0 A;  1A6I A;  2IBD A;  2PBX A;  3G1L A;  3WHC A;  3COL A;  3VW0 A;  4NN1 A;  3S5R A;  2DG7 A;  3JSJ A;  3TP3 A;  4GCL A;  1JUP A;  2XGE A;  2GEN A;  2GFN A;  2EH3 A;  2G0E A;  1VI0 A;  1ORK A;  3KKC A;  2ZCX A;  5GP9 A;  1T33 A;  1T56 A;  3Q0V A;  2NX4 A;  5EFY A;  3EGQ A;  3BNI A;  3BQZ A;  3V78 A;  5GPA A;  4B1R A;  3HTA A;  2WV1 A;  2G3B A;  3Q3S A;  2UXU A;  2XPV A;  5FHP A;  3CWR A;  4W1U A;  4YZE A;  2QIB A;  4JKZ A;  3B6C A;  2PZ9 A;  3FIW A;  3BRU A;  4AF5 A;  2Q24 A;  5F0F A;  2ZOY A;  3G1M A;  1JTX A;  5IOY A;  3IH2 A;  2ZCN A;  2UXO A;  4MO7 A;  3TP0 A;  3KKD A;  4D7N A;  2HXO A;  4X1E A;  2IAI A;  3BJB A;  4D5C A;  3SDG A;  5HSZ A;  4M3B A;  3PPB A;  2VKV A;  1QPI A;  3C2B A;  3VOX A;  1BJZ A;  4GFK A;  3ZQH A;  2HYJ A;  2IU5 A;  3VVZ A;  5K58 A;  2OPT A;  3HTI A;  5HAW A;  1ZKG A;  3O8G A;  3QQA A;  3ON2 A;  3VUQ A;  2QOP A;  3BHQ A;  2G7S A;  5EZG A;  3NNR A;  3DEW A;  3FK6 A;  3EUP A;  2NS7 A;  2RAS A;  5J3L A;  2Y2Z A;  5D1R A;  5K7H A;  3ZQF A;  4I6Z A;  2JK3 A;  5AQC A;  2Y30 A;  2HXI A;  3ON4 A;  4V2F A;  3LHQ A;  3QKX A;  4NEL A;  3MVP A;  3SFI A;  1UI6 A;  5FKL A;  4GCT A;  1QVU A;  3VW1 A;  5J1Y A;  3VVY A;  2TRT A;  3IH4 A;  4MXM A;  4D5F A;  5FKM A;  3BT9 A;  4JYK A;  3LJL A;  2X6O A;  3LSJ A;  2XDN A;  3VW2 A;  1Z0X A;  2O7O A;  3V6G A;  2OF7 A;  4M3F A;  2IEK A;  5FKO A;  5DAJ A;  4I76 A;  3VP5 A;  3NPI A;  1UI5 A;  2NP5 A;  3HE0 A;  2OI8 A;  1JUS A;  2TCT A;  2YVE A;  2FD5 A;  3CJD A;  4HKU A;  2XB5 A;  1SGM A;  5EYR A;  2Y31 A;  3GEU A;  2WUI A;  2OER A;  4JL3 A;  2DTZ A;  4DW6 A;  3QBM A;  3GZI A;  4M3G A;  4M3E A;  1RKT A;  2REK A;  3HTH A;  3BTI A;  4ME9 A;  2QWT A;  5CW8 A;  5FMP A;  3HGY A;  2ZCM A;  3ANP A;  4UDS A;  3BTJ A;  2NS8 A;  3BR3 A;  4V2G A;  5F08 A;  3ANG A;  2JJ7 A;  3LSR A;  4KWA A;  1U9N A;  5K7F A;  5F0C A;  2YVH A;  3VVX A;  2VPR A;  3LWJ A;  2QCO A;  2XRL A;  3FRQ A;  3BR0 A;  1JT6 A;  5CXG A;  2XGC A;  3G56 A;  1JT0 A;  3AQS A;  2HKU A;  3BR6 A;  3NI7 A;  3HIM A;  5H9T A;  5D19 A;  5CXI A;  3F1B A;  3IUV A;  3PAS A;  2V57 A;  3Q0U A;  3VOK A;  4ICH A;  3BR1 A;  2FQ4 A;  4XK4 A;  2O7T A;  4PXI A;  3VPR A;  2W53 A;  2XPW A;  3FK7 A;  3CRJ A;  3PM1 A;  3O8H A;  2XGD A;  3C07 A; 
#chains in the Genus database with same CATH topology
 1RPW A;  2DG8 A;  3HGG A;  2QKO A;  2ZOZ A;  4ABZ A;  5K7Z A;  2ID3 A;  3G7R A;  5FKN A;  3KNW A;  2A2F X;  1RKW A;  2RAE A;  5IOZ A;  2UXP A;  5C4Y A;  5FKK A;  3CCY A;  2GUH A;  3Q0W A;  2QTQ A;  3WHB A;  2R7U A;  3MNL A;  4ACI A;  3O60 A;  3ZQI A;  2R7W A;  4GFL A;  2HYT A;  3AQT A;  5FGL A;  2G7L A;  3B6A A;  1JTY A;  4MK6 A;  5F0H A;  4B3A A;  3ZQG A;  3VIB A;  5J1U A;  4OD5 A;  4W97 A;  4M3D A;  3P9T A;  2GBY A;  2ZB9 A;  2UXH A;  3IH3 A;  4CGR A;  3ZQL A;  3RH2 A;  5F1J A;  2NP3 A;  2WGB A;  3QPL A;  2FX0 A;  2XPU A;  3BCG A;  3HTJ A;  4AC6 A;  3LSP A;  3E7Q A;  3K8P C;  3LOC A;  3DPJ A;  4G12 A;  2G7G A;  2VKE A;  2D6Y A;  5HBU A;  5J1R A;  3B81 A;  4L62 A;  2PFV A;  3BTC A;  4AUX A;  3KZ9 A;  3NRG A;  3F0C A;  5F27 A;  1QVT A;  2F07 A;  2I10 A;  3BTL A;  2R7O A;  2FJ1 A;  2ID6 A;  5GPC A;  3QPS A;  3RD3 A;  3BR5 A;  2UXI A;  4DVY P;  2RHA A;  3DU6 A;  5IP6 A;  1ZK8 A;  3BQY A;  2X9D A;  5IPA A;  3CDL A;  1JUM A;  3BR2 A;  2HQ5 A;  1U9O A;  5D18 A;  1Z77 A;  4D7M A;  4GCK A;  3G1O A;  5F04 A;  4JNN A;  3DCF A;  3T6N A;  5EZH A;  2FBQ A;  3KYL A;  3NXC A;  4AC0 A;  1A6I A;  2IBD A;  2PBX A;  3G1L A;  3WHC A;  3COL A;  3VW0 A;  4NN1 A;  3S5R A;  2DG7 A;  3JSJ A;  3TP3 A;  4U9L A;  4GCL A;  1JUP A;  2XGE A;  2GEN A;  2GFN A;  2B1E A;  2EH3 A;  2G0E A;  1VI0 A;  1ORK A;  3KKC A;  2ZCX A;  5GP9 A;  1T33 A;  1T56 A;  3Q0V A;  2NX4 A;  5EFY A;  3EGQ A;  3BNI A;  3BQZ A;  3V78 A;  5GPA A;  3VTI A;  4B1R A;  3HTA A;  2WV1 A;  2G3B A;  3Q3S A;  2UXU A;  2XPV A;  5FHP A;  3CWR A;  4W1U A;  4YZE A;  2QIB A;  4JKZ A;  3B6C A;  2PZ9 A;  3FIW A;  3BRU A;  4AF5 A;  2Q24 A;  5F0F A;  2ZOY A;  3G1M A;  2R7T A;  1JTX A;  5CQG A;  5IOY A;  3IH2 A;  2ZCN A;  2UXO A;  4MO7 A;  3TP0 A;  3KKD A;  2YVX A;  4D7N A;  2HXO A;  4X1E A;  2IAI A;  3BJB A;  4D5C A;  3SDG A;  5HSZ A;  2R7V A;  2R7X A;  4M3B A;  3PPB A;  2VKV A;  1QPI A;  3C2B A;  3VOX A;  1BJZ A;  4GFK A;  3ZQH A;  2HYJ A;  3NS4 A;  2IU5 A;  3VVZ A;  5K58 A;  2OPT A;  3HTI A;  5HAW A;  1ZKG A;  3O8G A;  3QQA A;  3ON2 A;  3VUQ A;  2QOP A;  3BHQ A;  2G7S A;  5EZG A;  3NNR A;  3DEW A;  3FK6 A;  3EUP A;  2NS7 A;  2RAS A;  5J3L A;  2Y2Z A;  5D1R A;  5K7H A;  3ZQF A;  4I6Z A;  2JK3 A;  5AQC A;  2Y30 A;  2HXI A;  3ON4 A;  4V2F A;  3LHQ A;  3QKX A;  4NEL A;  3MVP A;  3SFI A;  1UI6 A;  5FKL A;  4GCT A;  1QVU A;  3VW1 A;  5J1Y A;  3VVY A;  4WIB A;  2TRT A;  3IH4 A;  4MXM A;  4D5F A;  5FKM A;  3BT9 A;  4JYK A;  3LJL A;  2X6O A;  3LSJ A;  2XDN A;  3VW2 A;  1Z0X A;  2O7O A;  3V6G A;  2OF7 A;  4M3F A;  2IEK A;  5FKO A;  5DAJ A;  3FHN A;  4I76 A;  3VP5 A;  3NPI A;  1UI5 A;  2NP5 A;  3HE0 A;  2OI8 A;  1JUS A;  2ZY9 A;  2TCT A;  2YVE A;  2FD5 A;  4OD4 A;  3CJD A;  4HKU A;  2XB5 A;  1SGM A;  5EYR A;  2Y31 A;  3GEU A;  2WUI A;  2OER A;  4JL3 A;  2DTZ A;  4DW6 A;  3QBM A;  3GZI A;  4M3G A;  4M3E A;  4U9N A;  1RKT A;  2REK A;  3HTH A;  3BTI A;  4ME9 A;  2QWT A;  5CW8 A;  5FMP A;  3HGY A;  2ZCM A;  3SWH A;  3ANP A;  4UDS A;  3BTJ A;  2NS8 A;  3BR3 A;  4V2G A;  5F08 A;  3ANG A;  2JJ7 A;  3LSR A;  2B3W A;  4KWA A;  1U9N A;  5K7F A;  5F0C A;  2YVH A;  2FJI 1;  3VVX A;  2VPR A;  3LWJ A;  2R7R A;  2QCO A;  2XRL A;  3FRQ A;  3BR0 A;  1JT6 A;  5CXG A;  2XGC A;  3G56 A;  2R7S A;  1JT0 A;  3AQS A;  2HKU A;  3BR6 A;  3NI7 A;  3HIM A;  5H9T A;  5D19 A;  5CXI A;  4C2M A;  3F1B A;  3IUV A;  3PAS A;  2V57 A;  3Q0U A;  3VOK A;  4ICH A;  3BR1 A;  3DU5 A;  2FQ4 A;  4IRV A;  4XK4 A;  2O7T A;  4PXI A;  2R7Q A;  3VPR A;  2W53 A;  2XPW A;  3FK7 A;  3CRJ A;  3PM1 A;  3O8H A;  2XGD A;  3C07 A; 
#chains in the Genus database with same CATH homology
 1RPW A;  2DG8 A;  3HGG A;  2QKO A;  2ZOZ A;  4ABZ A;  5K7Z A;  2ID3 A;  3G7R A;  5FKN A;  3KNW A;  1RKW A;  2RAE A;  5IOZ A;  2UXP A;  5C4Y A;  5FKK A;  3CCY A;  2GUH A;  3Q0W A;  2QTQ A;  3WHB A;  3MNL A;  4ACI A;  3O60 A;  3ZQI A;  4GFL A;  2HYT A;  3AQT A;  5FGL A;  2G7L A;  3B6A A;  1JTY A;  4MK6 A;  5F0H A;  4B3A A;  3ZQG A;  3VIB A;  5J1U A;  4W97 A;  4M3D A;  3P9T A;  2GBY A;  2ZB9 A;  2UXH A;  3IH3 A;  4CGR A;  3ZQL A;  3RH2 A;  5F1J A;  2NP3 A;  2WGB A;  3QPL A;  2FX0 A;  2XPU A;  3BCG A;  3HTJ A;  4AC6 A;  3LSP A;  3E7Q A;  3LOC A;  3DPJ A;  4G12 A;  2G7G A;  2VKE A;  2D6Y A;  5HBU A;  5J1R A;  3B81 A;  4L62 A;  3BTC A;  4AUX A;  3KZ9 A;  3NRG A;  3F0C A;  5F27 A;  1QVT A;  2F07 A;  2I10 A;  3BTL A;  2FJ1 A;  2ID6 A;  5GPC A;  3QPS A;  3RD3 A;  3BR5 A;  2UXI A;  2RHA A;  5IP6 A;  1ZK8 A;  3BQY A;  2X9D A;  5IPA A;  3CDL A;  1JUM A;  3BR2 A;  2HQ5 A;  1U9O A;  5D18 A;  1Z77 A;  4D7M A;  4GCK A;  3G1O A;  5F04 A;  4JNN A;  3DCF A;  3T6N A;  5EZH A;  2FBQ A;  3NXC A;  4AC0 A;  1A6I A;  2IBD A;  2PBX A;  3G1L A;  3WHC A;  3COL A;  3VW0 A;  4NN1 A;  3S5R A;  2DG7 A;  3JSJ A;  3TP3 A;  4GCL A;  1JUP A;  2XGE A;  2GEN A;  2GFN A;  2EH3 A;  2G0E A;  1VI0 A;  1ORK A;  3KKC A;  2ZCX A;  5GP9 A;  1T33 A;  1T56 A;  3Q0V A;  2NX4 A;  5EFY A;  3EGQ A;  3BNI A;  3BQZ A;  3V78 A;  5GPA A;  4B1R A;  3HTA A;  2WV1 A;  2G3B A;  3Q3S A;  2UXU A;  2XPV A;  5FHP A;  3CWR A;  4W1U A;  4YZE A;  2QIB A;  4JKZ A;  3B6C A;  2PZ9 A;  3FIW A;  3BRU A;  4AF5 A;  2Q24 A;  5F0F A;  2ZOY A;  3G1M A;  1JTX A;  5IOY A;  3IH2 A;  2ZCN A;  2UXO A;  4MO7 A;  3TP0 A;  3KKD A;  4D7N A;  2HXO A;  4X1E A;  2IAI A;  3BJB A;  4D5C A;  3SDG A;  5HSZ A;  4M3B A;  3PPB A;  2VKV A;  1QPI A;  3C2B A;  3VOX A;  1BJZ A;  4GFK A;  3ZQH A;  2HYJ A;  2IU5 A;  3VVZ A;  5K58 A;  2OPT A;  3HTI A;  5HAW A;  1ZKG A;  3O8G A;  3QQA A;  3ON2 A;  3VUQ A;  2QOP A;  3BHQ A;  2G7S A;  5EZG A;  3NNR A;  3DEW A;  3FK6 A;  3EUP A;  2NS7 A;  2RAS A;  5J3L A;  2Y2Z A;  5D1R A;  5K7H A;  3ZQF A;  4I6Z A;  2JK3 A;  5AQC A;  2Y30 A;  2HXI A;  3ON4 A;  4V2F A;  3LHQ A;  3QKX A;  4NEL A;  3MVP A;  3SFI A;  1UI6 A;  5FKL A;  4GCT A;  1QVU A;  3VW1 A;  5J1Y A;  3VVY A;  2TRT A;  3IH4 A;  4MXM A;  4D5F A;  5FKM A;  3BT9 A;  4JYK A;  3LJL A;  2X6O A;  3LSJ A;  2XDN A;  3VW2 A;  1Z0X A;  2O7O A;  3V6G A;  2OF7 A;  4M3F A;  2IEK A;  5FKO A;  5DAJ A;  4I76 A;  3VP5 A;  3NPI A;  1UI5 A;  2NP5 A;  3HE0 A;  2OI8 A;  1JUS A;  2TCT A;  2YVE A;  2FD5 A;  3CJD A;  4HKU A;  2XB5 A;  1SGM A;  5EYR A;  2Y31 A;  3GEU A;  2WUI A;  2OER A;  4JL3 A;  2DTZ A;  4DW6 A;  3QBM A;  3GZI A;  4M3G A;  4M3E A;  1RKT A;  2REK A;  3HTH A;  3BTI A;  4ME9 A;  2QWT A;  5CW8 A;  5FMP A;  3HGY A;  2ZCM A;  3ANP A;  4UDS A;  3BTJ A;  2NS8 A;  3BR3 A;  4V2G A;  5F08 A;  3ANG A;  2JJ7 A;  3LSR A;  4KWA A;  1U9N A;  5K7F A;  5F0C A;  2YVH A;  3VVX A;  2VPR A;  3LWJ A;  2QCO A;  2XRL A;  3FRQ A;  3BR0 A;  1JT6 A;  5CXG A;  2XGC A;  3G56 A;  1JT0 A;  3AQS A;  2HKU A;  3BR6 A;  3NI7 A;  3HIM A;  5H9T A;  5D19 A;  5CXI A;  3F1B A;  3IUV A;  3PAS A;  2V57 A;  3Q0U A;  3VOK A;  4ICH A;  3BR1 A;  2FQ4 A;  4XK4 A;  2O7T A;  4PXI A;  3VPR A;  2W53 A;  2XPW A;  3FK7 A;  3CRJ A;  3PM1 A;  3O8H A;  2XGD A;  3C07 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...