3KZ9A

Crystal structure of the master transcriptional regulator, smcr, in vibrio vulnificus provides insight into its dna recognition mechanism
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
201
structure length
201
Chain Sequence
AKRPRTRLSPLKRKQQLMEIALEVFARRGIGRGGHADIAEIAQVSVATVFNYFPTREDLVDEVLNHVVRQFSNFLSDNIDLDLHAKENIANITNAMIELVVQDNHWLKVWFEWSASTRDEVWPLFVTTNRTNQLLVQNMFIKAIERGEVCDQHNPEDLANLFHGICYSLFVQANRTNNTAELSKLVSSYLDMLCIYKREHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of SmcR, a quorum-sensing master regulator of Vibrio vulnificus, provides insight into its regulation of transcription
pubmed doi rcsb
source organism Vibrio vulnificus
molecule tags Transcription regulator
molecule keywords SmcR
total genus 70
structure length 201
sequence length 201
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3kz9A00
3FK7A 4NELA 3VP5A 4AUXA 3C2BA 5FGLA 3BQYA 3BTCA 2ZOZA 1Z77A 5K7FA 5F0HA 3EGQA 3F1BA 3VUQA 3O8HA 5K7ZA 3G1LA 2NS8A 3BTIA 5HSZA 5D18A 3AQTA 3BT9A 3NI7A 1QVUA 3IH2A 3KZ9A 2GUHA 3CJDA 5D19A 1RKWA 3AQSA 3NPIA 3E7QA 3HGGA 3IH3A 4YZEA 3Q0WA 1Z0XA 5J3LA 2IU5A 3IH4A 3BCGA 5J1YA 3Q3SA 4KWAA 3B6CA 3ZQFA 5F04A 3LHQA 1JT6A 5IOYA 1ZKGA 5EZHA 4G12A 1ZK8A 5K58A 4UDSA 3CCYA 4V2GA 2HXOA 2NP5A 2O7OA 2IEKA 2WV1A 3G7RA 2XGCA 3ZQHA 3G56A 3JSJA 3RD3A 2DTZA 2VPRA 5FHPA 1JT0A 3ON4A 3Q0VA 5CXGA 4JKZA 4GCKA 4MXMA 2G7SA 2W53A 4GFKA 5F27A 1SGMA 5EZGA 3VW2A 2DG8A 3IUVA 4V2FA 5C4YA 5AQCA 2NP3A 3QBMA 5F0CA 4I6ZA 5FKMA 3HTJA 3DEWA 2HYJA 4HKUA 3VPRA 2QWTA 3C07A 3BTLA 3BR5A 3ZQIA 3HTIA 3EUPA 1QPIA 2QCOA 4AC6A 1QVTA 3VOKA 3BJBA 2X6OA 3PPBA 3PM1A 3BHQA 1ORKA 3BR2A 3TP3A 3VVXA 3COLA 2GBYA 5GPCA 2RASA 4D5FA 3VIBA 3RH2A 5EYRA 3ANPA 4DW6A 4GFLA 3O60A 5GPAA 2IBDA 1UI6A 3BR1A 5D1RA 3FRQA 2PBXA 2Y2ZA 1RPWA 2G3BA 5GP9A 3GZIA 2Y31A 3QPSA 2JK3A 3S5RA 5HAWA 1JUSA 2FQ4A 5HBUA 5F08A 2XPWA 2HKUA 4AF5A 2PZ9A 2REKA 1T56A 2HQ5A 4JL3A 3HE0A 2X9DA 3B6AA 4ME9A 1U9OA 4AC0A 2FX0A 2NS7A 3ZQGA 2ZCMA 5FKOA 3ON2A 2NX4A 2QIBA 5IOZA 5J1RA 2ID3A 3Q0UA 1UI5A 2FBQA 3WHBA 2F07A 2ZB9A 2RAEA 3FIWA 4NN1A 2OF7A 3PASA 1VI0A 3VVYA 1JUMA 2UXHA 1T33A 4M3FA 3LSJA 3KNWA 3TP0A 1JUPA 3CDLA 2OERA 3QKXA 4ABZA 2I10A 3SFIA 2YVHA 2FJ1A 3DCFA 4ACIA 2G0EA 3VW0A 2HXIA 1U9NA 3V6GA 3BR0A 3VW1A 4PXIA 2UXUA 2RHAA 2O7TA 4JYKA 3DPJA 3T6NA 3BTJA 4W1UA 2WUIA 2Y30A 2FD5A 5J1UA 3CWRA 2ID6A 3BNIA 2V57A 5F1JA 5CW8A 2EH3A 3GEUA 4MK6A 5FKKA 5K7HA 2OPTA 2VKVA 3FK6A 3HTAA 2G7LA 1JTYA 2ZCXA 2ZOYA 5F0FA 3NXCA 5DAJA 2GFNA 2YVEA 3BR6A 3KKDA 3LOCA 3BQZA 4M3GA 4D7NA 4GCLA 2QTQA 3G1OA 3WHCA 3LWJA 2DG7A 4M3BA 4X1EA 4B3AA 5FMPA 3ANGA 4I76A 5FKLA 3LJLA 3HIMA 2GENA 4GCTA 2XGDA 2VKEA 3G1MA 3B81A 1JTXA 4W97A 3SDGA 4CGRA 4MO7A 2ZCNA 2UXIA 4M3EA 4L62A 2WGBA 3VVZA 1BJZA 4JNNA 4D5CA 2TCTA 1A6IA 5FKNA 4M3DA 5CXIA 3CRJA 2UXOA 2D6YA 3LSRA 3O8GA 3V78A 2TRTA 3KKCA 2IAIA 5IPAA 3HTHA 2XGEA 2XB5A 2XRLA 2JJ7A 3VOXA 4XK4A 3BRUA 4D7MA 2XDNA 4B1RA 2QOPA 3ZQLA 5EFYA 2HYTA 3NNRA 2G7GA 2XPUA 1RKTA 3BR3A 3P9TA 3QQAA 2UXPA 5H9TA 5IP6A 3HGYA 2Q24A 2XPVA 3MNLA 3F0CA 4ICHA 3QPLA 2QKOA 3NRGA 3MVPA 2OI8A 3LSPA
chains in the Genus database with same CATH superfamily
3FK7A 4NELA 3VP5A 4AUXA 3C2BA 5FGLA 3BQYA 3BTCA 3NS4A 2ZOZA 1Z77A 5K7FA 5F0HA 3EGQA 3F1BA 3VUQA 3O8HA 5K7ZA 3G1LA 2NS8A 3BTIA 4DVYP 5HSZA 5D18A 3AQTA 3BT9A 3NI7A 1QVUA 3IH2A 2R7XA 3KZ9A 2GUHA 3CJDA 5D19A 1RKWA 3AQSA 3NPIA 3E7QA 3HGGA 3IH3A 4YZEA 3Q0WA 1Z0XA 5J3LA 2IU5A 2R7UA 3IH4A 3BCGA 5J1YA 3Q3SA 4KWAA 3B6CA 2B1EA 3ZQFA 5F04A 3LHQA 1JT6A 4C2MA 5IOYA 1ZKGA 5EZHA 4G12A 1ZK8A 5K58A 4UDSA 3CCYA 4V2GA 2HXOA 2NP5A 2O7OA 2IEKA 2WV1A 3G7RA 2XGCA 3ZQHA 3G56A 3JSJA 4U9NA 3RD3A 2DTZA 2VPRA 5FHPA 1JT0A 3ON4A 3Q0VA 5CXGA 4JKZA 4GCKA 4MXMA 2G7SA 2W53A 4GFKA 5F27A 1SGMA 5EZGA 3VW2A 2DG8A 3IUVA 4V2FA 5C4YA 5AQCA 2NP3A 3QBMA 2A2FX 5F0CA 4I6ZA 5FKMA 3HTJA 3DEWA 2HYJA 4HKUA 3VPRA 2QWTA 3C07A 3BTLA 3BR5A 4IRVA 3ZQIA 3HTIA 3EUPA 1QPIA 2QCOA 4AC6A 1QVTA 3VOKA 3BJBA 2X6OA 3PPBA 3PM1A 3BHQA 1ORKA 3BR2A 3TP3A 3VVXA 3COLA 2GBYA 5GPCA 2RASA 4U9LA 4D5FA 3VIBA 3RH2A 5EYRA 3ANPA 4DW6A 2FJI1 4GFLA 3O60A 5GPAA 2IBDA 1UI6A 3KYLA 3BR1A 5D1RA 3FRQA 2PBXA 2Y2ZA 1RPWA 2G3BA 5GP9A 3GZIA 2Y31A 3QPSA 5CQGA 2JK3A 3S5RA 5HAWA 3VTIA 1JUSA 2FQ4A 5HBUA 5F08A 2XPWA 2HKUA 4AF5A 2PZ9A 2REKA 1T56A 2ZY9A 2HQ5A 4JL3A 3HE0A 2X9DA 3B6AA 4ME9A 1U9OA 4AC0A 2FX0A 2NS7A 3ZQGA 2ZCMA 5FKOA 3ON2A 3DU6A 2NX4A 2QIBA 5IOZA 5J1RA 2ID3A 3Q0UA 1UI5A 2FBQA 3WHBA 2F07A 2ZB9A 2RAEA 3FIWA 3FHNA 4NN1A 2OF7A 3PASA 1VI0A 3VVYA 1JUMA 2UXHA 1T33A 4M3FA 3LSJA 2R7QA 3KNWA 3TP0A 1JUPA 3CDLA 2OERA 3QKXA 4ABZA 2I10A 3SFIA 2YVHA 2FJ1A 3DCFA 4ACIA 2G0EA 3VW0A 2HXIA 1U9NA 3V6GA 3BR0A 3VW1A 4PXIA 2UXUA 3DU5A 2RHAA 2O7TA 4JYKA 3DPJA 3T6NA 3BTJA 4W1UA 2WUIA 2Y30A 2FD5A 5J1UA 3CWRA 2ID6A 3BNIA 2V57A 5F1JA 5CW8A 2EH3A 3GEUA 4MK6A 5FKKA 5K7HA 2OPTA 2VKVA 3FK6A 3HTAA 2G7LA 1JTYA 2ZCXA 2R7SA 2ZOYA 5F0FA 3NXCA 5DAJA 2GFNA 4OD4A 2YVEA 4WIBA 3BR6A 3KKDA 3LOCA 3BQZA 4M3GA 4D7NA 4GCLA 2QTQA 3G1OA 3WHCA 3LWJA 2DG7A 4M3BA 4X1EA 4B3AA 5FMPA 3ANGA 4I76A 5FKLA 3LJLA 3HIMA 2GENA 4GCTA 2XGDA 2VKEA 3G1MA 3B81A 3SWHA 1JTXA 4W97A 2R7OA 3SDGA 4CGRA 3K8PC 4MO7A 2ZCNA 2UXIA 4M3EA 4L62A 2WGBA 3VVZA 1BJZA 4JNNA 4D5CA 2TCTA 1A6IA 5FKNA 4M3DA 5CXIA 3CRJA 2UXOA 2D6YA 3LSRA 3O8GA 2R7TA 4OD5A 3V78A 2TRTA 3KKCA 2IAIA 5IPAA 3HTHA 2XGEA 2XB5A 2R7WA 2XRLA 2JJ7A 3VOXA 4XK4A 3BRUA 4D7MA 2XDNA 4B1RA 2QOPA 3ZQLA 5EFYA 2HYTA 3NNRA 2G7GA 2XPUA 1RKTA 3BR3A 3P9TA 3QQAA 2UXPA 5H9TA 3HGYA 5IP6A 2B3WA 2Q24A 2XPVA 3MNLA 2R7RA 2YVXA 3F0CA 4ICHA 3QPLA 2QKOA 2PFVA 3NRGA 3MVPA 2OI8A 3LSPA 2R7VA
chains in the Genus database with same CATH topology
3FK7A 4NELA 3VP5A 4AUXA 3C2BA 5FGLA 3BQYA 3BTCA 2ZOZA 1Z77A 5K7FA 5F0HA 3EGQA 3F1BA 3VUQA 3O8HA 5K7ZA 3G1LA 2NS8A 3BTIA 5HSZA 5D18A 3AQTA 3BT9A 3NI7A 1QVUA 3IH2A 3KZ9A 2GUHA 3CJDA 5D19A 1RKWA 3AQSA 3NPIA 3E7QA 3HGGA 3IH3A 4YZEA 3Q0WA 1Z0XA 5J3LA 2IU5A 3IH4A 3BCGA 5J1YA 3Q3SA 4KWAA 3B6CA 3ZQFA 5F04A 3LHQA 1JT6A 5IOYA 1ZKGA 5EZHA 4G12A 1ZK8A 5K58A 4UDSA 3CCYA 4V2GA 2HXOA 2NP5A 2O7OA 2IEKA 2WV1A 3G7RA 2XGCA 3ZQHA 3G56A 3JSJA 3RD3A 2DTZA 2VPRA 5FHPA 1JT0A 3ON4A 3Q0VA 5CXGA 4JKZA 4GCKA 4MXMA 2G7SA 2W53A 4GFKA 5F27A 1SGMA 5EZGA 3VW2A 2DG8A 3IUVA 4V2FA 5C4YA 5AQCA 2NP3A 3QBMA 5F0CA 4I6ZA 5FKMA 3HTJA 3DEWA 2HYJA 4HKUA 3VPRA 2QWTA 3C07A 3BTLA 3BR5A 3ZQIA 3HTIA 3EUPA 1QPIA 2QCOA 4AC6A 1QVTA 3VOKA 3BJBA 2X6OA 3PPBA 3PM1A 3BHQA 1ORKA 3BR2A 3TP3A 3VVXA 3COLA 2GBYA 5GPCA 2RASA 4D5FA 3VIBA 3RH2A 5EYRA 3ANPA 4DW6A 4GFLA 3O60A 5GPAA 2IBDA 1UI6A 3BR1A 5D1RA 3FRQA 2PBXA 2Y2ZA 1RPWA 2G3BA 5GP9A 3GZIA 2Y31A 3QPSA 2JK3A 3S5RA 5HAWA 1JUSA 2FQ4A 5HBUA 5F08A 2XPWA 2HKUA 4AF5A 2PZ9A 2REKA 1T56A 2HQ5A 4JL3A 3HE0A 2X9DA 3B6AA 4ME9A 1U9OA 4AC0A 2FX0A 2NS7A 3ZQGA 2ZCMA 5FKOA 3ON2A 2NX4A 2QIBA 5IOZA 5J1RA 2ID3A 3Q0UA 1UI5A 2FBQA 3WHBA 2F07A 2ZB9A 2RAEA 3FIWA 4NN1A 2OF7A 3PASA 1VI0A 3VVYA 1JUMA 2UXHA 1T33A 4M3FA 3LSJA 3KNWA 3TP0A 1JUPA 3CDLA 2OERA 3QKXA 4ABZA 2I10A 3SFIA 2YVHA 2FJ1A 3DCFA 4ACIA 2G0EA 3VW0A 2HXIA 1U9NA 3V6GA 3BR0A 3VW1A 4PXIA 2UXUA 2RHAA 2O7TA 4JYKA 3DPJA 3T6NA 3BTJA 4W1UA 2WUIA 2Y30A 2FD5A 5J1UA 3CWRA 2ID6A 3BNIA 2V57A 5F1JA 5CW8A 2EH3A 3GEUA 4MK6A 5FKKA 5K7HA 2OPTA 2VKVA 3FK6A 3HTAA 2G7LA 1JTYA 2ZCXA 2ZOYA 5F0FA 3NXCA 5DAJA 2GFNA 2YVEA 3BR6A 3KKDA 3LOCA 3BQZA 4M3GA 4D7NA 4GCLA 2QTQA 3G1OA 3WHCA 3LWJA 2DG7A 4M3BA 4X1EA 4B3AA 5FMPA 3ANGA 4I76A 5FKLA 3LJLA 3HIMA 2GENA 4GCTA 2XGDA 2VKEA 3G1MA 3B81A 1JTXA 4W97A 3SDGA 4CGRA 4MO7A 2ZCNA 2UXIA 4M3EA 4L62A 2WGBA 3VVZA 1BJZA 4JNNA 4D5CA 2TCTA 1A6IA 5FKNA 4M3DA 5CXIA 3CRJA 2UXOA 2D6YA 3LSRA 3O8GA 3V78A 2TRTA 3KKCA 2IAIA 5IPAA 3HTHA 2XGEA 2XB5A 2XRLA 2JJ7A 3VOXA 4XK4A 3BRUA 4D7MA 2XDNA 4B1RA 2QOPA 3ZQLA 5EFYA 2HYTA 3NNRA 2G7GA 2XPUA 1RKTA 3BR3A 3P9TA 3QQAA 2UXPA 5H9TA 5IP6A 3HGYA 2Q24A 2XPVA 3MNLA 3F0CA 4ICHA 3QPLA 2QKOA 3NRGA 3MVPA 2OI8A 3LSPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FK7 A;  4NEL A;  3VP5 A;  4AUX A;  3C2B A;  5FGL A;  3BQY A;  3BTC A;  2ZOZ A;  1Z77 A;  5K7F A;  5F0H A;  3EGQ A;  3F1B A;  3VUQ A;  3O8H A;  5K7Z A;  3G1L A;  2NS8 A;  3BTI A;  5HSZ A;  5D18 A;  3AQT A;  3BT9 A;  3NI7 A;  1QVU A;  3IH2 A;  3KZ9 A;  2GUH A;  3CJD A;  5D19 A;  1RKW A;  3AQS A;  3NPI A;  3E7Q A;  3HGG A;  3IH3 A;  4YZE A;  3Q0W A;  1Z0X A;  5J3L A;  2IU5 A;  3IH4 A;  3BCG A;  5J1Y A;  3Q3S A;  4KWA A;  3B6C A;  3ZQF A;  5F04 A;  3LHQ A;  1JT6 A;  5IOY A;  1ZKG A;  5EZH A;  4G12 A;  1ZK8 A;  5K58 A;  4UDS A;  3CCY A;  4V2G A;  2HXO A;  2NP5 A;  2O7O A;  2IEK A;  2WV1 A;  3G7R A;  2XGC A;  3ZQH A;  3G56 A;  3JSJ A;  3RD3 A;  2DTZ A;  2VPR A;  5FHP A;  1JT0 A;  3ON4 A;  3Q0V A;  5CXG A;  4JKZ A;  4GCK A;  4MXM A;  2G7S A;  2W53 A;  4GFK A;  5F27 A;  1SGM A;  5EZG A;  3VW2 A;  2DG8 A;  3IUV A;  4V2F A;  5C4Y A;  5AQC A;  2NP3 A;  3QBM A;  5F0C A;  4I6Z A;  5FKM A;  3HTJ A;  3DEW A;  2HYJ A;  4HKU A;  3VPR A;  2QWT A;  3C07 A;  3BTL A;  3BR5 A;  3ZQI A;  3HTI A;  3EUP A;  1QPI A;  2QCO A;  4AC6 A;  1QVT A;  3VOK A;  3BJB A;  2X6O A;  3PPB A;  3PM1 A;  3BHQ A;  1ORK A;  3BR2 A;  3TP3 A;  3VVX A;  3COL A;  2GBY A;  5GPC A;  2RAS A;  4D5F A;  3VIB A;  3RH2 A;  5EYR A;  3ANP A;  4DW6 A;  4GFL A;  3O60 A;  5GPA A;  2IBD A;  1UI6 A;  3BR1 A;  5D1R A;  3FRQ A;  2PBX A;  2Y2Z A;  1RPW A;  2G3B A;  5GP9 A;  3GZI A;  2Y31 A;  3QPS A;  2JK3 A;  3S5R A;  5HAW A;  1JUS A;  2FQ4 A;  5HBU A;  5F08 A;  2XPW A;  2HKU A;  4AF5 A;  2PZ9 A;  2REK A;  1T56 A;  2HQ5 A;  4JL3 A;  3HE0 A;  2X9D A;  3B6A A;  4ME9 A;  1U9O A;  4AC0 A;  2FX0 A;  2NS7 A;  3ZQG A;  2ZCM A;  5FKO A;  3ON2 A;  2NX4 A;  2QIB A;  5IOZ A;  5J1R A;  2ID3 A;  3Q0U A;  1UI5 A;  2FBQ A;  3WHB A;  2F07 A;  2ZB9 A;  2RAE A;  3FIW A;  4NN1 A;  2OF7 A;  3PAS A;  1VI0 A;  3VVY A;  1JUM A;  2UXH A;  1T33 A;  4M3F A;  3LSJ A;  3KNW A;  3TP0 A;  1JUP A;  3CDL A;  2OER A;  3QKX A;  4ABZ A;  2I10 A;  3SFI A;  2YVH A;  2FJ1 A;  3DCF A;  4ACI A;  2G0E A;  3VW0 A;  2HXI A;  1U9N A;  3V6G A;  3BR0 A;  3VW1 A;  4PXI A;  2UXU A;  2RHA A;  2O7T A;  4JYK A;  3DPJ A;  3T6N A;  3BTJ A;  4W1U A;  2WUI A;  2Y30 A;  2FD5 A;  5J1U A;  3CWR A;  2ID6 A;  3BNI A;  2V57 A;  5F1J A;  5CW8 A;  2EH3 A;  3GEU A;  4MK6 A;  5FKK A;  5K7H A;  2OPT A;  2VKV A;  3FK6 A;  3HTA A;  2G7L A;  1JTY A;  2ZCX A;  2ZOY A;  5F0F A;  3NXC A;  5DAJ A;  2GFN A;  2YVE A;  3BR6 A;  3KKD A;  3LOC A;  3BQZ A;  4M3G A;  4D7N A;  4GCL A;  2QTQ A;  3G1O A;  3WHC A;  3LWJ A;  2DG7 A;  4M3B A;  4X1E A;  4B3A A;  5FMP A;  3ANG A;  4I76 A;  5FKL A;  3LJL A;  3HIM A;  2GEN A;  4GCT A;  2XGD A;  2VKE A;  3G1M A;  3B81 A;  1JTX A;  4W97 A;  3SDG A;  4CGR A;  4MO7 A;  2ZCN A;  2UXI A;  4M3E A;  4L62 A;  2WGB A;  3VVZ A;  1BJZ A;  4JNN A;  4D5C A;  2TCT A;  1A6I A;  5FKN A;  4M3D A;  5CXI A;  3CRJ A;  2UXO A;  2D6Y A;  3LSR A;  3O8G A;  3V78 A;  2TRT A;  3KKC A;  2IAI A;  5IPA A;  3HTH A;  2XGE A;  2XB5 A;  2XRL A;  2JJ7 A;  3VOX A;  4XK4 A;  3BRU A;  4D7M A;  2XDN A;  4B1R A;  2QOP A;  3ZQL A;  5EFY A;  2HYT A;  3NNR A;  2G7G A;  2XPU A;  1RKT A;  3BR3 A;  3P9T A;  3QQA A;  2UXP A;  5H9T A;  5IP6 A;  3HGY A;  2Q24 A;  2XPV A;  3MNL A;  3F0C A;  4ICH A;  3QPL A;  2QKO A;  3NRG A;  3MVP A;  2OI8 A;  3LSP A; 
#chains in the Genus database with same CATH topology
 3FK7 A;  4NEL A;  3VP5 A;  4AUX A;  3C2B A;  5FGL A;  3BQY A;  3BTC A;  3NS4 A;  2ZOZ A;  1Z77 A;  5K7F A;  5F0H A;  3EGQ A;  3F1B A;  3VUQ A;  3O8H A;  5K7Z A;  3G1L A;  2NS8 A;  3BTI A;  4DVY P;  5HSZ A;  5D18 A;  3AQT A;  3BT9 A;  3NI7 A;  1QVU A;  3IH2 A;  2R7X A;  3KZ9 A;  2GUH A;  3CJD A;  5D19 A;  1RKW A;  3AQS A;  3NPI A;  3E7Q A;  3HGG A;  3IH3 A;  4YZE A;  3Q0W A;  1Z0X A;  5J3L A;  2IU5 A;  2R7U A;  3IH4 A;  3BCG A;  5J1Y A;  3Q3S A;  4KWA A;  3B6C A;  2B1E A;  3ZQF A;  5F04 A;  3LHQ A;  1JT6 A;  4C2M A;  5IOY A;  1ZKG A;  5EZH A;  4G12 A;  1ZK8 A;  5K58 A;  4UDS A;  3CCY A;  4V2G A;  2HXO A;  2NP5 A;  2O7O A;  2IEK A;  2WV1 A;  3G7R A;  2XGC A;  3ZQH A;  3G56 A;  3JSJ A;  4U9N A;  3RD3 A;  2DTZ A;  2VPR A;  5FHP A;  1JT0 A;  3ON4 A;  3Q0V A;  5CXG A;  4JKZ A;  4GCK A;  4MXM A;  2G7S A;  2W53 A;  4GFK A;  5F27 A;  1SGM A;  5EZG A;  3VW2 A;  2DG8 A;  3IUV A;  4V2F A;  5C4Y A;  5AQC A;  2NP3 A;  3QBM A;  2A2F X;  5F0C A;  4I6Z A;  5FKM A;  3HTJ A;  3DEW A;  2HYJ A;  4HKU A;  3VPR A;  2QWT A;  3C07 A;  3BTL A;  3BR5 A;  4IRV A;  3ZQI A;  3HTI A;  3EUP A;  1QPI A;  2QCO A;  4AC6 A;  1QVT A;  3VOK A;  3BJB A;  2X6O A;  3PPB A;  3PM1 A;  3BHQ A;  1ORK A;  3BR2 A;  3TP3 A;  3VVX A;  3COL A;  2GBY A;  5GPC A;  2RAS A;  4U9L A;  4D5F A;  3VIB A;  3RH2 A;  5EYR A;  3ANP A;  4DW6 A;  2FJI 1;  4GFL A;  3O60 A;  5GPA A;  2IBD A;  1UI6 A;  3KYL A;  3BR1 A;  5D1R A;  3FRQ A;  2PBX A;  2Y2Z A;  1RPW A;  2G3B A;  5GP9 A;  3GZI A;  2Y31 A;  3QPS A;  5CQG A;  2JK3 A;  3S5R A;  5HAW A;  3VTI A;  1JUS A;  2FQ4 A;  5HBU A;  5F08 A;  2XPW A;  2HKU A;  4AF5 A;  2PZ9 A;  2REK A;  1T56 A;  2ZY9 A;  2HQ5 A;  4JL3 A;  3HE0 A;  2X9D A;  3B6A A;  4ME9 A;  1U9O A;  4AC0 A;  2FX0 A;  2NS7 A;  3ZQG A;  2ZCM A;  5FKO A;  3ON2 A;  3DU6 A;  2NX4 A;  2QIB A;  5IOZ A;  5J1R A;  2ID3 A;  3Q0U A;  1UI5 A;  2FBQ A;  3WHB A;  2F07 A;  2ZB9 A;  2RAE A;  3FIW A;  3FHN A;  4NN1 A;  2OF7 A;  3PAS A;  1VI0 A;  3VVY A;  1JUM A;  2UXH A;  1T33 A;  4M3F A;  3LSJ A;  2R7Q A;  3KNW A;  3TP0 A;  1JUP A;  3CDL A;  2OER A;  3QKX A;  4ABZ A;  2I10 A;  3SFI A;  2YVH A;  2FJ1 A;  3DCF A;  4ACI A;  2G0E A;  3VW0 A;  2HXI A;  1U9N A;  3V6G A;  3BR0 A;  3VW1 A;  4PXI A;  2UXU A;  3DU5 A;  2RHA A;  2O7T A;  4JYK A;  3DPJ A;  3T6N A;  3BTJ A;  4W1U A;  2WUI A;  2Y30 A;  2FD5 A;  5J1U A;  3CWR A;  2ID6 A;  3BNI A;  2V57 A;  5F1J A;  5CW8 A;  2EH3 A;  3GEU A;  4MK6 A;  5FKK A;  5K7H A;  2OPT A;  2VKV A;  3FK6 A;  3HTA A;  2G7L A;  1JTY A;  2ZCX A;  2R7S A;  2ZOY A;  5F0F A;  3NXC A;  5DAJ A;  2GFN A;  4OD4 A;  2YVE A;  4WIB A;  3BR6 A;  3KKD A;  3LOC A;  3BQZ A;  4M3G A;  4D7N A;  4GCL A;  2QTQ A;  3G1O A;  3WHC A;  3LWJ A;  2DG7 A;  4M3B A;  4X1E A;  4B3A A;  5FMP A;  3ANG A;  4I76 A;  5FKL A;  3LJL A;  3HIM A;  2GEN A;  4GCT A;  2XGD A;  2VKE A;  3G1M A;  3B81 A;  3SWH A;  1JTX A;  4W97 A;  2R7O A;  3SDG A;  4CGR A;  3K8P C;  4MO7 A;  2ZCN A;  2UXI A;  4M3E A;  4L62 A;  2WGB A;  3VVZ A;  1BJZ A;  4JNN A;  4D5C A;  2TCT A;  1A6I A;  5FKN A;  4M3D A;  5CXI A;  3CRJ A;  2UXO A;  2D6Y A;  3LSR A;  3O8G A;  2R7T A;  4OD5 A;  3V78 A;  2TRT A;  3KKC A;  2IAI A;  5IPA A;  3HTH A;  2XGE A;  2XB5 A;  2R7W A;  2XRL A;  2JJ7 A;  3VOX A;  4XK4 A;  3BRU A;  4D7M A;  2XDN A;  4B1R A;  2QOP A;  3ZQL A;  5EFY A;  2HYT A;  3NNR A;  2G7G A;  2XPU A;  1RKT A;  3BR3 A;  3P9T A;  3QQA A;  2UXP A;  5H9T A;  3HGY A;  5IP6 A;  2B3W A;  2Q24 A;  2XPV A;  3MNL A;  2R7R A;  2YVX A;  3F0C A;  4ICH A;  3QPL A;  2QKO A;  2PFV A;  3NRG A;  3MVP A;  2OI8 A;  3LSP A;  2R7V A; 
#chains in the Genus database with same CATH homology
 3FK7 A;  4NEL A;  3VP5 A;  4AUX A;  3C2B A;  5FGL A;  3BQY A;  3BTC A;  2ZOZ A;  1Z77 A;  5K7F A;  5F0H A;  3EGQ A;  3F1B A;  3VUQ A;  3O8H A;  5K7Z A;  3G1L A;  2NS8 A;  3BTI A;  5HSZ A;  5D18 A;  3AQT A;  3BT9 A;  3NI7 A;  1QVU A;  3IH2 A;  3KZ9 A;  2GUH A;  3CJD A;  5D19 A;  1RKW A;  3AQS A;  3NPI A;  3E7Q A;  3HGG A;  3IH3 A;  4YZE A;  3Q0W A;  1Z0X A;  5J3L A;  2IU5 A;  3IH4 A;  3BCG A;  5J1Y A;  3Q3S A;  4KWA A;  3B6C A;  3ZQF A;  5F04 A;  3LHQ A;  1JT6 A;  5IOY A;  1ZKG A;  5EZH A;  4G12 A;  1ZK8 A;  5K58 A;  4UDS A;  3CCY A;  4V2G A;  2HXO A;  2NP5 A;  2O7O A;  2IEK A;  2WV1 A;  3G7R A;  2XGC A;  3ZQH A;  3G56 A;  3JSJ A;  3RD3 A;  2DTZ A;  2VPR A;  5FHP A;  1JT0 A;  3ON4 A;  3Q0V A;  5CXG A;  4JKZ A;  4GCK A;  4MXM A;  2G7S A;  2W53 A;  4GFK A;  5F27 A;  1SGM A;  5EZG A;  3VW2 A;  2DG8 A;  3IUV A;  4V2F A;  5C4Y A;  5AQC A;  2NP3 A;  3QBM A;  5F0C A;  4I6Z A;  5FKM A;  3HTJ A;  3DEW A;  2HYJ A;  4HKU A;  3VPR A;  2QWT A;  3C07 A;  3BTL A;  3BR5 A;  3ZQI A;  3HTI A;  3EUP A;  1QPI A;  2QCO A;  4AC6 A;  1QVT A;  3VOK A;  3BJB A;  2X6O A;  3PPB A;  3PM1 A;  3BHQ A;  1ORK A;  3BR2 A;  3TP3 A;  3VVX A;  3COL A;  2GBY A;  5GPC A;  2RAS A;  4D5F A;  3VIB A;  3RH2 A;  5EYR A;  3ANP A;  4DW6 A;  4GFL A;  3O60 A;  5GPA A;  2IBD A;  1UI6 A;  3BR1 A;  5D1R A;  3FRQ A;  2PBX A;  2Y2Z A;  1RPW A;  2G3B A;  5GP9 A;  3GZI A;  2Y31 A;  3QPS A;  2JK3 A;  3S5R A;  5HAW A;  1JUS A;  2FQ4 A;  5HBU A;  5F08 A;  2XPW A;  2HKU A;  4AF5 A;  2PZ9 A;  2REK A;  1T56 A;  2HQ5 A;  4JL3 A;  3HE0 A;  2X9D A;  3B6A A;  4ME9 A;  1U9O A;  4AC0 A;  2FX0 A;  2NS7 A;  3ZQG A;  2ZCM A;  5FKO A;  3ON2 A;  2NX4 A;  2QIB A;  5IOZ A;  5J1R A;  2ID3 A;  3Q0U A;  1UI5 A;  2FBQ A;  3WHB A;  2F07 A;  2ZB9 A;  2RAE A;  3FIW A;  4NN1 A;  2OF7 A;  3PAS A;  1VI0 A;  3VVY A;  1JUM A;  2UXH A;  1T33 A;  4M3F A;  3LSJ A;  3KNW A;  3TP0 A;  1JUP A;  3CDL A;  2OER A;  3QKX A;  4ABZ A;  2I10 A;  3SFI A;  2YVH A;  2FJ1 A;  3DCF A;  4ACI A;  2G0E A;  3VW0 A;  2HXI A;  1U9N A;  3V6G A;  3BR0 A;  3VW1 A;  4PXI A;  2UXU A;  2RHA A;  2O7T A;  4JYK A;  3DPJ A;  3T6N A;  3BTJ A;  4W1U A;  2WUI A;  2Y30 A;  2FD5 A;  5J1U A;  3CWR A;  2ID6 A;  3BNI A;  2V57 A;  5F1J A;  5CW8 A;  2EH3 A;  3GEU A;  4MK6 A;  5FKK A;  5K7H A;  2OPT A;  2VKV A;  3FK6 A;  3HTA A;  2G7L A;  1JTY A;  2ZCX A;  2ZOY A;  5F0F A;  3NXC A;  5DAJ A;  2GFN A;  2YVE A;  3BR6 A;  3KKD A;  3LOC A;  3BQZ A;  4M3G A;  4D7N A;  4GCL A;  2QTQ A;  3G1O A;  3WHC A;  3LWJ A;  2DG7 A;  4M3B A;  4X1E A;  4B3A A;  5FMP A;  3ANG A;  4I76 A;  5FKL A;  3LJL A;  3HIM A;  2GEN A;  4GCT A;  2XGD A;  2VKE A;  3G1M A;  3B81 A;  1JTX A;  4W97 A;  3SDG A;  4CGR A;  4MO7 A;  2ZCN A;  2UXI A;  4M3E A;  4L62 A;  2WGB A;  3VVZ A;  1BJZ A;  4JNN A;  4D5C A;  2TCT A;  1A6I A;  5FKN A;  4M3D A;  5CXI A;  3CRJ A;  2UXO A;  2D6Y A;  3LSR A;  3O8G A;  3V78 A;  2TRT A;  3KKC A;  2IAI A;  5IPA A;  3HTH A;  2XGE A;  2XB5 A;  2XRL A;  2JJ7 A;  3VOX A;  4XK4 A;  3BRU A;  4D7M A;  2XDN A;  4B1R A;  2QOP A;  3ZQL A;  5EFY A;  2HYT A;  3NNR A;  2G7G A;  2XPU A;  1RKT A;  3BR3 A;  3P9T A;  3QQA A;  2UXP A;  5H9T A;  5IP6 A;  3HGY A;  2Q24 A;  2XPV A;  3MNL A;  3F0C A;  4ICH A;  3QPL A;  2QKO A;  3NRG A;  3MVP A;  2OI8 A;  3LSP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...