3KZ9A

Crystal structure of the master transcriptional regulator, smcr, in vibrio vulnificus provides insight into its dna recognition mechanism
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
201
structure length
201
Chain Sequence
AKRPRTRLSPLKRKQQLMEIALEVFARRGIGRGGHADIAEIAQVSVATVFNYFPTREDLVDEVLNHVVRQFSNFLSDNIDLDLHAKENIANITNAMIELVVQDNHWLKVWFEWSASTRDEVWPLFVTTNRTNQLLVQNMFIKAIERGEVCDQHNPEDLANLFHGICYSLFVQANRTNNTAELSKLVSSYLDMLCIYKREHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SmcR
publication title The crystal structure of SmcR, a quorum-sensing master regulator of Vibrio vulnificus, provides insight into its regulation of transcription
pubmed doi rcsb
source organism Vibrio vulnificus
molecule tags Transcription regulator
total genus 70
structure length 201
sequence length 201
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3kz9A00
4GCKA 2NS8A 2FQ4A 3SFIA 2OERA 4M3EA 5FKMA 3ANGA 4AC6A 5F08A 2DG7A 3E7QA 3VW2A 2DTZA 2XPWA 2I10A 2OF7A 3DEWA 2OPTA 3KKCA 3VPRA 4D7MA 2JJ7A 5FKNA 2WV1A 3VW0A 3BQZA 4JNNA 3BR5A 2GFNA 2Q24A 2F07A 2ZOYA 2O7OA 5C4YA 2NS7A 5GPCA 5K58A 5EZHA 3ON4A 1ZKGA 5J1YA 1U9NA 5F0HA 2HXIA 5CXGA 1UI5A 3CDLA 2ZB9A 4V2GA 4V2FA 2G7LA 5FKLA 5IOYA 3BTJA 1RKTA 3COLA 4PXIA 2NP5A 2UXOA 2XGCA 3BTLA 4UDSA 2XGDA 5F27A 2FJ1A 3QBMA 2JK3A 2REKA 5FGLA 5J3LA 2ZCXA 2W53A 1UI6A 2EH3A 4KWAA 3ZQIA 4M3GA 5GPAA 3PASA 3BR1A 4M3BA 3V6GA 3GEUA 2VKEA 2OI8A 3FK7A 3BHQA 3SDGA 5H9TA 4I76A 3P9TA 3G1MA 2VPRA 3BT9A 3KNWA 3BTIA 5F04A 5HBUA 5IP6A 1ZK8A 2IEKA 3BR3A 3C2BA 4AUXA 5F1JA 3BCGA 1VI0A 4GCLA 1QVTA 3T6NA 5GP9A 2ID3A 4JL3A 3BNIA 3HTJA 2ZCNA 2Y31A 3C07A 3G7RA 2UXPA 2G3BA 4MO7A 4CGRA 4D5FA 1JUPA 3FRQA 2QOPA 3LJLA 4ME9A 3MVPA 4B1RA 3WHCA 5IOZA 3HGGA 2HYTA 5HAWA 2IBDA 3QQAA 3RH2A 5K7ZA 2GENA 4YZEA 4L62A 2TCTA 3HTAA 3ANPA 2QIBA 4GCTA 5F0FA 2FBQA 5FKOA 3B6AA 3F0CA 3PM1A 3ZQGA 2PBXA 3IH4A 3IH2A 3VOKA 1Z77A 3LSJA 3EGQA 3FIWA 4MK6A 3F1BA 2UXHA 1RKWA 1RPWA 2HYJA 3NNRA 1SGMA 2XRLA 4HKUA 3TP0A 3Q3SA 1U9OA 3VVXA 3CJDA 5K7HA 1BJZA 2DG8A 3PPBA 4AF5A 2NX4A 1JTYA 1Z0XA 3Q0WA 3VW1A 4XK4A 3IH3A 2RASA 5D18A 2NP3A 3CWRA 2XGEA 2IAIA 2X6OA 3WHBA 4GFKA 5DAJA 4AC0A 2ZCMA 3O8HA 3ZQLA 3ZQFA 4JKZA 3HE0A 4NELA 3BQYA 4GFLA 5AQCA 3CCYA 3O60A 2QWTA 3NXCA 3NRGA 3BRUA 3NPIA 2UXIA 5FHPA 1JTXA 2Y2ZA 2YVEA 4M3DA 3RD3A 3VVYA 2IU5A 3BR2A 2XPUA 3V78A 2HXOA 4ICHA 2QKOA 4ABZA 3QKXA 3ON2A 1JT0A 1ORKA 4ACIA 2V57A 2G7SA 3JSJA 3GZIA 4D7NA 3LSPA 5HSZA 3HIMA 3LSRA 2RAEA 2XB5A 3LHQA 3MNLA 2UXUA 3G1LA 2QCOA 2ID6A 3ZQHA 5EYRA 4JYKA 2HQ5A 2WUIA 2XDNA 5CXIA 2GBYA 3G1OA 3FK6A 2O7TA 4W97A 3BR6A 3EUPA 4W1UA 3VP5A 1QPIA 3BR0A 2G7GA 1JUSA 3VUQA 2ZOZA 4NN1A 5D1RA 4I6ZA 2YVHA 2Y30A 1A6IA 1QVUA 5EFYA 2TRTA 4D5CA 3Q0VA 2XPVA 3S5RA 2PZ9A 3VVZA 3DCFA 5F0CA 3KKDA 2FD5A 3G56A 3HGYA 3B6CA 2FX0A 3BJBA 5J1RA 5J1UA 5FMPA 3AQSA 2RHAA 5FKKA 5K7FA 3VOXA 3HTIA 1T33A 3CRJA 3Q0UA 3TP3A 4MXMA 2QTQA 1T56A 4X1EA 2X9DA 3QPSA 4DW6A 2D6YA 3DPJA 5EZGA 2VKVA 3KZ9A 1JUMA 3LWJA 5IPAA 3O8GA 3BTCA 4B3AA 3QPLA 3IUVA 3B81A 2HKUA 3NI7A 2WGBA 2G0EA 5D19A 3HTHA 3VIBA 2GUHA 5CW8A 3AQTA 4M3FA 3LOCA 4G12A 1JT6A
chains in the Genus database with same CATH superfamily
4GCKA 2NS8A 2FQ4A 3SFIA 2ZY9A 2OERA 4M3EA 5FKMA 3ANGA 4AC6A 5F08A 2B1EA 2DG7A 3E7QA 3FHNA 3VW2A 2DTZA 2XPWA 2I10A 2OF7A 3DEWA 2OPTA 3KKCA 3VPRA 4D7MA 2JJ7A 5FKNA 2WV1A 3VW0A 3BQZA 4JNNA 3BR5A 2GFNA 2Q24A 2F07A 3NS4A 2ZOYA 2O7OA 5C4YA 2NS7A 5GPCA 5K58A 5EZHA 3ON4A 1ZKGA 5J1YA 1U9NA 5F0HA 2HXIA 5CXGA 1UI5A 3CDLA 2ZB9A 4V2GA 4V2FA 2G7LA 5FKLA 5IOYA 3BTJA 1RKTA 3COLA 4PXIA 2NP5A 2UXOA 2XGCA 3BTLA 4UDSA 2XGDA 5F27A 2FJ1A 3QBMA 4OD4A 2R7XA 2JK3A 2REKA 5FGLA 5J3LA 2ZCXA 3DU5A 2W53A 1UI6A 2EH3A 4KWAA 3ZQIA 4M3GA 5GPAA 3PASA 3BR1A 4M3BA 3V6GA 3GEUA 2VKEA 2OI8A 3FK7A 3BHQA 3SDGA 5H9TA 4I76A 5CQGA 3P9TA 3G1MA 2VPRA 4C2MA 3BT9A 3KNWA 3BTIA 5F04A 5HBUA 5IP6A 1ZK8A 2IEKA 3BR3A 3C2BA 4AUXA 5F1JA 3BCGA 1VI0A 4GCLA 1QVTA 3T6NA 2R7TA 5GP9A 2ID3A 4JL3A 3BNIA 3HTJA 2ZCNA 2Y31A 3C07A 3G7RA 2UXPA 2G3BA 3VTIA 4MO7A 4CGRA 4D5FA 1JUPA 3FRQA 2QOPA 3LJLA 4ME9A 3MVPA 4B1RA 3WHCA 5IOZA 3HGGA 2R7VA 2HYTA 5HAWA 2IBDA 3QQAA 3RH2A 5K7ZA 2GENA 4YZEA 4L62A 4IRVA 2TCTA 3HTAA 3ANPA 2QIBA 4GCTA 5F0FA 2FBQA 5FKOA 3B6AA 3F0CA 3PM1A 3ZQGA 2R7WA 2PBXA 3IH4A 3IH2A 3VOKA 3SWHA 1Z77A 3LSJA 3EGQA 2FJI1 2YVXA 3FIWA 4MK6A 3F1BA 2UXHA 1RKWA 1RPWA 2HYJA 3NNRA 1SGMA 2XRLA 4HKUA 3Q3SA 3TP0A 1U9OA 3VVXA 2R7OA 3CJDA 5K7HA 1BJZA 2DG8A 2R7QA 3PPBA 4AF5A 2NX4A 1JTYA 1Z0XA 3Q0WA 3VW1A 4XK4A 3IH3A 2RASA 5D18A 4OD5A 2NP3A 3CWRA 2XGEA 2IAIA 2X6OA 3WHBA 4GFKA 5DAJA 4AC0A 2ZCMA 3O8HA 3ZQLA 3ZQFA 4JKZA 3HE0A 4NELA 3BQYA 4GFLA 5AQCA 2B3WA 3CCYA 3O60A 2QWTA 3NXCA 3NRGA 4U9NA 3BRUA 3NPIA 2UXIA 5FHPA 1JTXA 2Y2ZA 2YVEA 4M3DA 3RD3A 3VVYA 2IU5A 3BR2A 2XPUA 2R7UA 3DU6A 3V78A 2HXOA 4ICHA 2QKOA 4ABZA 3QKXA 3ON2A 1JT0A 1ORKA 3K8PC 4ACIA 2V57A 2G7SA 3JSJA 3GZIA 4D7NA 3LSPA 5HSZA 3HIMA 3LSRA 3LHQA 2RAEA 2XB5A 3MNLA 2UXUA 3G1LA 2QCOA 2ID6A 3ZQHA 5EYRA 4JYKA 2HQ5A 2WUIA 2XDNA 5CXIA 2GBYA 3G1OA 3FK6A 2R7RA 2O7TA 4W97A 3BR6A 3EUPA 4W1UA 3VP5A 1QPIA 3BR0A 2G7GA 1JUSA 3VUQA 2ZOZA 4NN1A 5D1RA 4I6ZA 2PFVA 2YVHA 2Y30A 1A6IA 4WIBA 1QVUA 5EFYA 2TRTA 4D5CA 3Q0VA 2R7SA 2XPVA 3S5RA 2PZ9A 3VVZA 3DCFA 4U9LA 5F0CA 2A2FX 3KKDA 2FD5A 3G56A 3HGYA 3B6CA 2FX0A 3BJBA 5J1RA 5J1UA 5FMPA 3AQSA 2RHAA 5FKKA 5K7FA 3VOXA 3HTIA 1T33A 3CRJA 3Q0UA 3KYLA 3TP3A 4DVYP 4MXMA 2QTQA 1T56A 4X1EA 2X9DA 3QPSA 4DW6A 2D6YA 3DPJA 5EZGA 2VKVA 3KZ9A 1JUMA 3LWJA 5IPAA 3O8GA 3BTCA 4B3AA 3QPLA 3IUVA 3B81A 2HKUA 3NI7A 2WGBA 2G0EA 5D19A 3HTHA 3VIBA 2GUHA 5CW8A 3AQTA 4M3FA 3LOCA 4G12A 1JT6A
chains in the Genus database with same CATH topology
4GCKA 2NS8A 2FQ4A 3SFIA 2OERA 4M3EA 5FKMA 3ANGA 4AC6A 5F08A 2DG7A 3E7QA 3VW2A 2DTZA 2XPWA 2I10A 2OF7A 3DEWA 2OPTA 3KKCA 3VPRA 4D7MA 2JJ7A 5FKNA 2WV1A 3VW0A 3BQZA 4JNNA 3BR5A 2GFNA 2Q24A 2F07A 2ZOYA 2O7OA 5C4YA 2NS7A 5GPCA 5K58A 5EZHA 3ON4A 1ZKGA 5J1YA 1U9NA 5F0HA 2HXIA 5CXGA 1UI5A 3CDLA 2ZB9A 4V2GA 4V2FA 2G7LA 5FKLA 5IOYA 3BTJA 1RKTA 3COLA 4PXIA 2NP5A 2UXOA 2XGCA 3BTLA 4UDSA 2XGDA 5F27A 2FJ1A 3QBMA 2JK3A 2REKA 5FGLA 5J3LA 2ZCXA 2W53A 1UI6A 2EH3A 4KWAA 3ZQIA 4M3GA 5GPAA 3PASA 3BR1A 4M3BA 3V6GA 3GEUA 2VKEA 2OI8A 3FK7A 3BHQA 3SDGA 5H9TA 4I76A 3P9TA 3G1MA 2VPRA 3BT9A 3KNWA 3BTIA 5F04A 5HBUA 5IP6A 1ZK8A 2IEKA 3BR3A 3C2BA 4AUXA 5F1JA 3BCGA 1VI0A 4GCLA 1QVTA 3T6NA 5GP9A 2ID3A 4JL3A 3BNIA 3HTJA 2ZCNA 2Y31A 3C07A 3G7RA 2UXPA 2G3BA 4MO7A 4CGRA 4D5FA 1JUPA 3FRQA 2QOPA 3LJLA 4ME9A 3MVPA 4B1RA 3WHCA 5IOZA 3HGGA 2HYTA 5HAWA 2IBDA 3QQAA 3RH2A 5K7ZA 2GENA 4YZEA 4L62A 2TCTA 3HTAA 3ANPA 2QIBA 4GCTA 5F0FA 2FBQA 5FKOA 3B6AA 3F0CA 3PM1A 3ZQGA 2PBXA 3IH4A 3IH2A 3VOKA 1Z77A 3LSJA 3EGQA 3FIWA 4MK6A 3F1BA 2UXHA 1RKWA 1RPWA 2HYJA 3NNRA 1SGMA 2XRLA 4HKUA 3TP0A 3Q3SA 1U9OA 3VVXA 3CJDA 5K7HA 1BJZA 2DG8A 3PPBA 4AF5A 2NX4A 1JTYA 1Z0XA 3Q0WA 3VW1A 4XK4A 3IH3A 2RASA 5D18A 2NP3A 3CWRA 2XGEA 2IAIA 2X6OA 3WHBA 4GFKA 5DAJA 4AC0A 2ZCMA 3O8HA 3ZQLA 3ZQFA 4JKZA 3HE0A 4NELA 3BQYA 4GFLA 5AQCA 3CCYA 3O60A 2QWTA 3NXCA 3NRGA 3BRUA 3NPIA 2UXIA 5FHPA 1JTXA 2Y2ZA 2YVEA 4M3DA 3RD3A 3VVYA 2IU5A 3BR2A 2XPUA 3V78A 2HXOA 4ICHA 2QKOA 4ABZA 3QKXA 3ON2A 1JT0A 1ORKA 4ACIA 2V57A 2G7SA 3JSJA 3GZIA 4D7NA 3LSPA 5HSZA 3HIMA 3LSRA 2RAEA 2XB5A 3LHQA 3MNLA 2UXUA 3G1LA 2QCOA 2ID6A 3ZQHA 5EYRA 4JYKA 2HQ5A 2WUIA 2XDNA 5CXIA 2GBYA 3G1OA 3FK6A 2O7TA 4W97A 3BR6A 3EUPA 4W1UA 3VP5A 1QPIA 3BR0A 2G7GA 1JUSA 3VUQA 2ZOZA 4NN1A 5D1RA 4I6ZA 2YVHA 2Y30A 1A6IA 1QVUA 5EFYA 2TRTA 4D5CA 3Q0VA 2XPVA 3S5RA 2PZ9A 3VVZA 3DCFA 5F0CA 3KKDA 2FD5A 3G56A 3HGYA 3B6CA 2FX0A 3BJBA 5J1RA 5J1UA 5FMPA 3AQSA 2RHAA 5FKKA 5K7FA 3VOXA 3HTIA 1T33A 3CRJA 3Q0UA 3TP3A 4MXMA 2QTQA 1T56A 4X1EA 2X9DA 3QPSA 4DW6A 2D6YA 3DPJA 5EZGA 2VKVA 3KZ9A 1JUMA 3LWJA 5IPAA 3O8GA 3BTCA 4B3AA 3QPLA 3IUVA 3B81A 2HKUA 3NI7A 2WGBA 2G0EA 5D19A 3HTHA 3VIBA 2GUHA 5CW8A 3AQTA 4M3FA 3LOCA 4G12A 1JT6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GCK A;  2NS8 A;  2FQ4 A;  3SFI A;  2OER A;  4M3E A;  5FKM A;  3ANG A;  4AC6 A;  5F08 A;  2DG7 A;  3E7Q A;  3VW2 A;  2DTZ A;  2XPW A;  2I10 A;  2OF7 A;  3DEW A;  2OPT A;  3KKC A;  3VPR A;  4D7M A;  2JJ7 A;  5FKN A;  2WV1 A;  3VW0 A;  3BQZ A;  4JNN A;  3BR5 A;  2GFN A;  2Q24 A;  2F07 A;  2ZOY A;  2O7O A;  5C4Y A;  2NS7 A;  5GPC A;  5K58 A;  5EZH A;  3ON4 A;  1ZKG A;  5J1Y A;  1U9N A;  5F0H A;  2HXI A;  5CXG A;  1UI5 A;  3CDL A;  2ZB9 A;  4V2G A;  4V2F A;  2G7L A;  5FKL A;  5IOY A;  3BTJ A;  1RKT A;  3COL A;  4PXI A;  2NP5 A;  2UXO A;  2XGC A;  3BTL A;  4UDS A;  2XGD A;  5F27 A;  2FJ1 A;  3QBM A;  2JK3 A;  2REK A;  5FGL A;  5J3L A;  2ZCX A;  2W53 A;  1UI6 A;  2EH3 A;  4KWA A;  3ZQI A;  4M3G A;  5GPA A;  3PAS A;  3BR1 A;  4M3B A;  3V6G A;  3GEU A;  2VKE A;  2OI8 A;  3FK7 A;  3BHQ A;  3SDG A;  5H9T A;  4I76 A;  3P9T A;  3G1M A;  2VPR A;  3BT9 A;  3KNW A;  3BTI A;  5F04 A;  5HBU A;  5IP6 A;  1ZK8 A;  2IEK A;  3BR3 A;  3C2B A;  4AUX A;  5F1J A;  3BCG A;  1VI0 A;  4GCL A;  1QVT A;  3T6N A;  5GP9 A;  2ID3 A;  4JL3 A;  3BNI A;  3HTJ A;  2ZCN A;  2Y31 A;  3C07 A;  3G7R A;  2UXP A;  2G3B A;  4MO7 A;  4CGR A;  4D5F A;  1JUP A;  3FRQ A;  2QOP A;  3LJL A;  4ME9 A;  3MVP A;  4B1R A;  3WHC A;  5IOZ A;  3HGG A;  2HYT A;  5HAW A;  2IBD A;  3QQA A;  3RH2 A;  5K7Z A;  2GEN A;  4YZE A;  4L62 A;  2TCT A;  3HTA A;  3ANP A;  2QIB A;  4GCT A;  5F0F A;  2FBQ A;  5FKO A;  3B6A A;  3F0C A;  3PM1 A;  3ZQG A;  2PBX A;  3IH4 A;  3IH2 A;  3VOK A;  1Z77 A;  3LSJ A;  3EGQ A;  3FIW A;  4MK6 A;  3F1B A;  2UXH A;  1RKW A;  1RPW A;  2HYJ A;  3NNR A;  1SGM A;  2XRL A;  4HKU A;  3TP0 A;  3Q3S A;  1U9O A;  3VVX A;  3CJD A;  5K7H A;  1BJZ A;  2DG8 A;  3PPB A;  4AF5 A;  2NX4 A;  1JTY A;  1Z0X A;  3Q0W A;  3VW1 A;  4XK4 A;  3IH3 A;  2RAS A;  5D18 A;  2NP3 A;  3CWR A;  2XGE A;  2IAI A;  2X6O A;  3WHB A;  4GFK A;  5DAJ A;  4AC0 A;  2ZCM A;  3O8H A;  3ZQL A;  3ZQF A;  4JKZ A;  3HE0 A;  4NEL A;  3BQY A;  4GFL A;  5AQC A;  3CCY A;  3O60 A;  2QWT A;  3NXC A;  3NRG A;  3BRU A;  3NPI A;  2UXI A;  5FHP A;  1JTX A;  2Y2Z A;  2YVE A;  4M3D A;  3RD3 A;  3VVY A;  2IU5 A;  3BR2 A;  2XPU A;  3V78 A;  2HXO A;  4ICH A;  2QKO A;  4ABZ A;  3QKX A;  3ON2 A;  1JT0 A;  1ORK A;  4ACI A;  2V57 A;  2G7S A;  3JSJ A;  3GZI A;  4D7N A;  3LSP A;  5HSZ A;  3HIM A;  3LSR A;  2RAE A;  2XB5 A;  3LHQ A;  3MNL A;  2UXU A;  3G1L A;  2QCO A;  2ID6 A;  3ZQH A;  5EYR A;  4JYK A;  2HQ5 A;  2WUI A;  2XDN A;  5CXI A;  2GBY A;  3G1O A;  3FK6 A;  2O7T A;  4W97 A;  3BR6 A;  3EUP A;  4W1U A;  3VP5 A;  1QPI A;  3BR0 A;  2G7G A;  1JUS A;  3VUQ A;  2ZOZ A;  4NN1 A;  5D1R A;  4I6Z A;  2YVH A;  2Y30 A;  1A6I A;  1QVU A;  5EFY A;  2TRT A;  4D5C A;  3Q0V A;  2XPV A;  3S5R A;  2PZ9 A;  3VVZ A;  3DCF A;  5F0C A;  3KKD A;  2FD5 A;  3G56 A;  3HGY A;  3B6C A;  2FX0 A;  3BJB A;  5J1R A;  5J1U A;  5FMP A;  3AQS A;  2RHA A;  5FKK A;  5K7F A;  3VOX A;  3HTI A;  1T33 A;  3CRJ A;  3Q0U A;  3TP3 A;  4MXM A;  2QTQ A;  1T56 A;  4X1E A;  2X9D A;  3QPS A;  4DW6 A;  2D6Y A;  3DPJ A;  5EZG A;  2VKV A;  3KZ9 A;  1JUM A;  3LWJ A;  5IPA A;  3O8G A;  3BTC A;  4B3A A;  3QPL A;  3IUV A;  3B81 A;  2HKU A;  3NI7 A;  2WGB A;  2G0E A;  5D19 A;  3HTH A;  3VIB A;  2GUH A;  5CW8 A;  3AQT A;  4M3F A;  3LOC A;  4G12 A;  1JT6 A; 
#chains in the Genus database with same CATH topology
 4GCK A;  2NS8 A;  2FQ4 A;  3SFI A;  2ZY9 A;  2OER A;  4M3E A;  5FKM A;  3ANG A;  4AC6 A;  5F08 A;  2B1E A;  2DG7 A;  3E7Q A;  3FHN A;  3VW2 A;  2DTZ A;  2XPW A;  2I10 A;  2OF7 A;  3DEW A;  2OPT A;  3KKC A;  3VPR A;  4D7M A;  2JJ7 A;  5FKN A;  2WV1 A;  3VW0 A;  3BQZ A;  4JNN A;  3BR5 A;  2GFN A;  2Q24 A;  2F07 A;  3NS4 A;  2ZOY A;  2O7O A;  5C4Y A;  2NS7 A;  5GPC A;  5K58 A;  5EZH A;  3ON4 A;  1ZKG A;  5J1Y A;  1U9N A;  5F0H A;  2HXI A;  5CXG A;  1UI5 A;  3CDL A;  2ZB9 A;  4V2G A;  4V2F A;  2G7L A;  5FKL A;  5IOY A;  3BTJ A;  1RKT A;  3COL A;  4PXI A;  2NP5 A;  2UXO A;  2XGC A;  3BTL A;  4UDS A;  2XGD A;  5F27 A;  2FJ1 A;  3QBM A;  4OD4 A;  2R7X A;  2JK3 A;  2REK A;  5FGL A;  5J3L A;  2ZCX A;  3DU5 A;  2W53 A;  1UI6 A;  2EH3 A;  4KWA A;  3ZQI A;  4M3G A;  5GPA A;  3PAS A;  3BR1 A;  4M3B A;  3V6G A;  3GEU A;  2VKE A;  2OI8 A;  3FK7 A;  3BHQ A;  3SDG A;  5H9T A;  4I76 A;  5CQG A;  3P9T A;  3G1M A;  2VPR A;  4C2M A;  3BT9 A;  3KNW A;  3BTI A;  5F04 A;  5HBU A;  5IP6 A;  1ZK8 A;  2IEK A;  3BR3 A;  3C2B A;  4AUX A;  5F1J A;  3BCG A;  1VI0 A;  4GCL A;  1QVT A;  3T6N A;  2R7T A;  5GP9 A;  2ID3 A;  4JL3 A;  3BNI A;  3HTJ A;  2ZCN A;  2Y31 A;  3C07 A;  3G7R A;  2UXP A;  2G3B A;  3VTI A;  4MO7 A;  4CGR A;  4D5F A;  1JUP A;  3FRQ A;  2QOP A;  3LJL A;  4ME9 A;  3MVP A;  4B1R A;  3WHC A;  5IOZ A;  3HGG A;  2R7V A;  2HYT A;  5HAW A;  2IBD A;  3QQA A;  3RH2 A;  5K7Z A;  2GEN A;  4YZE A;  4L62 A;  4IRV A;  2TCT A;  3HTA A;  3ANP A;  2QIB A;  4GCT A;  5F0F A;  2FBQ A;  5FKO A;  3B6A A;  3F0C A;  3PM1 A;  3ZQG A;  2R7W A;  2PBX A;  3IH4 A;  3IH2 A;  3VOK A;  3SWH A;  1Z77 A;  3LSJ A;  3EGQ A;  2FJI 1;  2YVX A;  3FIW A;  4MK6 A;  3F1B A;  2UXH A;  1RKW A;  1RPW A;  2HYJ A;  3NNR A;  1SGM A;  2XRL A;  4HKU A;  3Q3S A;  3TP0 A;  1U9O A;  3VVX A;  2R7O A;  3CJD A;  5K7H A;  1BJZ A;  2DG8 A;  2R7Q A;  3PPB A;  4AF5 A;  2NX4 A;  1JTY A;  1Z0X A;  3Q0W A;  3VW1 A;  4XK4 A;  3IH3 A;  2RAS A;  5D18 A;  4OD5 A;  2NP3 A;  3CWR A;  2XGE A;  2IAI A;  2X6O A;  3WHB A;  4GFK A;  5DAJ A;  4AC0 A;  2ZCM A;  3O8H A;  3ZQL A;  3ZQF A;  4JKZ A;  3HE0 A;  4NEL A;  3BQY A;  4GFL A;  5AQC A;  2B3W A;  3CCY A;  3O60 A;  2QWT A;  3NXC A;  3NRG A;  4U9N A;  3BRU A;  3NPI A;  2UXI A;  5FHP A;  1JTX A;  2Y2Z A;  2YVE A;  4M3D A;  3RD3 A;  3VVY A;  2IU5 A;  3BR2 A;  2XPU A;  2R7U A;  3DU6 A;  3V78 A;  2HXO A;  4ICH A;  2QKO A;  4ABZ A;  3QKX A;  3ON2 A;  1JT0 A;  1ORK A;  3K8P C;  4ACI A;  2V57 A;  2G7S A;  3JSJ A;  3GZI A;  4D7N A;  3LSP A;  5HSZ A;  3HIM A;  3LSR A;  3LHQ A;  2RAE A;  2XB5 A;  3MNL A;  2UXU A;  3G1L A;  2QCO A;  2ID6 A;  3ZQH A;  5EYR A;  4JYK A;  2HQ5 A;  2WUI A;  2XDN A;  5CXI A;  2GBY A;  3G1O A;  3FK6 A;  2R7R A;  2O7T A;  4W97 A;  3BR6 A;  3EUP A;  4W1U A;  3VP5 A;  1QPI A;  3BR0 A;  2G7G A;  1JUS A;  3VUQ A;  2ZOZ A;  4NN1 A;  5D1R A;  4I6Z A;  2PFV A;  2YVH A;  2Y30 A;  1A6I A;  4WIB A;  1QVU A;  5EFY A;  2TRT A;  4D5C A;  3Q0V A;  2R7S A;  2XPV A;  3S5R A;  2PZ9 A;  3VVZ A;  3DCF A;  4U9L A;  5F0C A;  2A2F X;  3KKD A;  2FD5 A;  3G56 A;  3HGY A;  3B6C A;  2FX0 A;  3BJB A;  5J1R A;  5J1U A;  5FMP A;  3AQS A;  2RHA A;  5FKK A;  5K7F A;  3VOX A;  3HTI A;  1T33 A;  3CRJ A;  3Q0U A;  3KYL A;  3TP3 A;  4DVY P;  4MXM A;  2QTQ A;  1T56 A;  4X1E A;  2X9D A;  3QPS A;  4DW6 A;  2D6Y A;  3DPJ A;  5EZG A;  2VKV A;  3KZ9 A;  1JUM A;  3LWJ A;  5IPA A;  3O8G A;  3BTC A;  4B3A A;  3QPL A;  3IUV A;  3B81 A;  2HKU A;  3NI7 A;  2WGB A;  2G0E A;  5D19 A;  3HTH A;  3VIB A;  2GUH A;  5CW8 A;  3AQT A;  4M3F A;  3LOC A;  4G12 A;  1JT6 A; 
#chains in the Genus database with same CATH homology
 4GCK A;  2NS8 A;  2FQ4 A;  3SFI A;  2OER A;  4M3E A;  5FKM A;  3ANG A;  4AC6 A;  5F08 A;  2DG7 A;  3E7Q A;  3VW2 A;  2DTZ A;  2XPW A;  2I10 A;  2OF7 A;  3DEW A;  2OPT A;  3KKC A;  3VPR A;  4D7M A;  2JJ7 A;  5FKN A;  2WV1 A;  3VW0 A;  3BQZ A;  4JNN A;  3BR5 A;  2GFN A;  2Q24 A;  2F07 A;  2ZOY A;  2O7O A;  5C4Y A;  2NS7 A;  5GPC A;  5K58 A;  5EZH A;  3ON4 A;  1ZKG A;  5J1Y A;  1U9N A;  5F0H A;  2HXI A;  5CXG A;  1UI5 A;  3CDL A;  2ZB9 A;  4V2G A;  4V2F A;  2G7L A;  5FKL A;  5IOY A;  3BTJ A;  1RKT A;  3COL A;  4PXI A;  2NP5 A;  2UXO A;  2XGC A;  3BTL A;  4UDS A;  2XGD A;  5F27 A;  2FJ1 A;  3QBM A;  2JK3 A;  2REK A;  5FGL A;  5J3L A;  2ZCX A;  2W53 A;  1UI6 A;  2EH3 A;  4KWA A;  3ZQI A;  4M3G A;  5GPA A;  3PAS A;  3BR1 A;  4M3B A;  3V6G A;  3GEU A;  2VKE A;  2OI8 A;  3FK7 A;  3BHQ A;  3SDG A;  5H9T A;  4I76 A;  3P9T A;  3G1M A;  2VPR A;  3BT9 A;  3KNW A;  3BTI A;  5F04 A;  5HBU A;  5IP6 A;  1ZK8 A;  2IEK A;  3BR3 A;  3C2B A;  4AUX A;  5F1J A;  3BCG A;  1VI0 A;  4GCL A;  1QVT A;  3T6N A;  5GP9 A;  2ID3 A;  4JL3 A;  3BNI A;  3HTJ A;  2ZCN A;  2Y31 A;  3C07 A;  3G7R A;  2UXP A;  2G3B A;  4MO7 A;  4CGR A;  4D5F A;  1JUP A;  3FRQ A;  2QOP A;  3LJL A;  4ME9 A;  3MVP A;  4B1R A;  3WHC A;  5IOZ A;  3HGG A;  2HYT A;  5HAW A;  2IBD A;  3QQA A;  3RH2 A;  5K7Z A;  2GEN A;  4YZE A;  4L62 A;  2TCT A;  3HTA A;  3ANP A;  2QIB A;  4GCT A;  5F0F A;  2FBQ A;  5FKO A;  3B6A A;  3F0C A;  3PM1 A;  3ZQG A;  2PBX A;  3IH4 A;  3IH2 A;  3VOK A;  1Z77 A;  3LSJ A;  3EGQ A;  3FIW A;  4MK6 A;  3F1B A;  2UXH A;  1RKW A;  1RPW A;  2HYJ A;  3NNR A;  1SGM A;  2XRL A;  4HKU A;  3TP0 A;  3Q3S A;  1U9O A;  3VVX A;  3CJD A;  5K7H A;  1BJZ A;  2DG8 A;  3PPB A;  4AF5 A;  2NX4 A;  1JTY A;  1Z0X A;  3Q0W A;  3VW1 A;  4XK4 A;  3IH3 A;  2RAS A;  5D18 A;  2NP3 A;  3CWR A;  2XGE A;  2IAI A;  2X6O A;  3WHB A;  4GFK A;  5DAJ A;  4AC0 A;  2ZCM A;  3O8H A;  3ZQL A;  3ZQF A;  4JKZ A;  3HE0 A;  4NEL A;  3BQY A;  4GFL A;  5AQC A;  3CCY A;  3O60 A;  2QWT A;  3NXC A;  3NRG A;  3BRU A;  3NPI A;  2UXI A;  5FHP A;  1JTX A;  2Y2Z A;  2YVE A;  4M3D A;  3RD3 A;  3VVY A;  2IU5 A;  3BR2 A;  2XPU A;  3V78 A;  2HXO A;  4ICH A;  2QKO A;  4ABZ A;  3QKX A;  3ON2 A;  1JT0 A;  1ORK A;  4ACI A;  2V57 A;  2G7S A;  3JSJ A;  3GZI A;  4D7N A;  3LSP A;  5HSZ A;  3HIM A;  3LSR A;  2RAE A;  2XB5 A;  3LHQ A;  3MNL A;  2UXU A;  3G1L A;  2QCO A;  2ID6 A;  3ZQH A;  5EYR A;  4JYK A;  2HQ5 A;  2WUI A;  2XDN A;  5CXI A;  2GBY A;  3G1O A;  3FK6 A;  2O7T A;  4W97 A;  3BR6 A;  3EUP A;  4W1U A;  3VP5 A;  1QPI A;  3BR0 A;  2G7G A;  1JUS A;  3VUQ A;  2ZOZ A;  4NN1 A;  5D1R A;  4I6Z A;  2YVH A;  2Y30 A;  1A6I A;  1QVU A;  5EFY A;  2TRT A;  4D5C A;  3Q0V A;  2XPV A;  3S5R A;  2PZ9 A;  3VVZ A;  3DCF A;  5F0C A;  3KKD A;  2FD5 A;  3G56 A;  3HGY A;  3B6C A;  2FX0 A;  3BJB A;  5J1R A;  5J1U A;  5FMP A;  3AQS A;  2RHA A;  5FKK A;  5K7F A;  3VOX A;  3HTI A;  1T33 A;  3CRJ A;  3Q0U A;  3TP3 A;  4MXM A;  2QTQ A;  1T56 A;  4X1E A;  2X9D A;  3QPS A;  4DW6 A;  2D6Y A;  3DPJ A;  5EZG A;  2VKV A;  3KZ9 A;  1JUM A;  3LWJ A;  5IPA A;  3O8G A;  3BTC A;  4B3A A;  3QPL A;  3IUV A;  3B81 A;  2HKU A;  3NI7 A;  2WGB A;  2G0E A;  5D19 A;  3HTH A;  3VIB A;  2GUH A;  5CW8 A;  3AQT A;  4M3F A;  3LOC A;  4G12 A;  1JT6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...