3KZ9A

Crystal structure of the master transcriptional regulator, smcr, in vibrio vulnificus provides insight into its dna recognition mechanism
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
201
structure length
201
Chain Sequence
AKRPRTRLSPLKRKQQLMEIALEVFARRGIGRGGHADIAEIAQVSVATVFNYFPTREDLVDEVLNHVVRQFSNFLSDNIDLDLHAKENIANITNAMIELVVQDNHWLKVWFEWSASTRDEVWPLFVTTNRTNQLLVQNMFIKAIERGEVCDQHNPEDLANLFHGICYSLFVQANRTNNTAELSKLVSSYLDMLCIYKREHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of SmcR, a quorum-sensing master regulator of Vibrio vulnificus, provides insight into its regulation of transcription
pubmed doi rcsb
source organism Vibrio vulnificus
molecule tags Transcription regulator
molecule keywords SmcR
total genus 70
structure length 201
sequence length 201
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3kz9A00
2YVEA 3DEWA 5FKOA 3VW2A 2HXIA 3VIBA 2X6OA 3LSPA 3Q0WA 4M3EA 4KWAA 3B6CA 3G1MA 2FQ4A 2XPUA 5AQCA 5H9TA 2F07A 3O8HA 4D7NA 2I10A 5FHPA 2IU5A 3V6GA 5F1JA 3G1OA 3F1BA 4JL3A 1ZKGA 3BRUA 2VPRA 5K58A 3FK7A 4G12A 3IH2A 3HTJA 3KKDA 5F0CA 5D19A 3ZQHA 3HGYA 3IH4A 5GP9A 2G7SA 4GCLA 3V78A 3RD3A 5CXGA 5EYRA 4JYKA 1ZK8A 2FD5A 3NPIA 3BR1A 2PZ9A 4DW6A 1QVTA 1QVUA 3LSRA 3LOCA 3BQZA 3BHQA 5IPAA 3SFIA 3CWRA 3B81A 3C07A 2QCOA 1JUMA 3O60A 3ON4A 3LJLA 2PBXA 4JKZA 2UXHA 3T6NA 3VVXA 1T56A 3VVYA 3KNWA 5CW8A 4ME9A 2QWTA 1RKWA 3PPBA 5HSZA 1JTYA 3G1LA 2IAIA 3WHCA 4W97A 1JUPA 3VUQA 2ID6A 2Y30A 3BR0A 3BTLA 3ZQGA 1RKTA 3S5RA 3VW1A 3Q0UA 1U9NA 2XPVA 2FJ1A 4GCKA 2FX0A 3HGGA 4D5CA 3CRJA 3BR3A 3EUPA 3FRQA 2NS7A 3P9TA 3VOXA 3ZQFA 2REKA 2O7TA 2GBYA 3BNIA 5IOZA 3HE0A 4YZEA 1UI5A 1Z0XA 5J3LA 1U9OA 5D18A 2W53A 3PM1A 3ANPA 3BR5A 4V2GA 3BR6A 5FGLA 5FMPA 4V2FA 4AUXA 3E7QA 3HTIA 2TCTA 3VOKA 5K7ZA 5J1YA 2Q24A 3G7RA 4CGRA 2D6YA 3CJDA 2O7OA 2WUIA 3BTCA 4NELA 2XGCA 3Q3SA 3HTAA 3O8GA 2QKOA 2NP3A 4AC6A 1Z77A 3GZIA 4D7MA 3G56A 5D1RA 5CXIA 1VI0A 1BJZA 2QTQA 3HIMA 3LSJA 4I6ZA 3AQTA 2EH3A 2G7GA 4L62A 3TP0A 2ZCXA 2VKEA 2UXUA 3BR2A 2HXOA 4NN1A 2WGBA 3MVPA 2ZOZA 2GENA 3DPJA 2XPWA 2V57A 2UXIA 3WHBA 3C2BA 1SGMA 5DAJA 2ZB9A 3ANGA 4D5FA 3RH2A 2DG7A 2HYJA 3CCYA 2RASA 2HQ5A 4JNNA 4M3BA 3COLA 2UXOA 3KZ9A 3TP3A 2DG8A 2HKUA 5FKKA 5EZGA 4AC0A 3BTIA 3NNRA 4HKUA 2XDNA 1JT0A 2IEKA 2OPTA 4PXIA 4ICHA 2HYTA 3QPSA 5EZHA 5F04A 3CDLA 5C4YA 2DTZA 4W1UA 2G0EA 3GEUA 5J1UA 4ABZA 5EFYA 3IH3A 3BJBA 1QPIA 5HBUA 5F08A 3BTJA 5HAWA 3VP5A 3FIWA 4GCTA 1A6IA 4MK6A 2ZCMA 3BT9A 2XB5A 5FKNA 3NRGA 5K7HA 2G7LA 4M3GA 1JTXA 2QOPA 3JSJA 2NS8A 5GPCA 4MO7A 5F0HA 2RAEA 5K7FA 4ACIA 3PASA 5F27A 2WV1A 3QQAA 5IOYA 2NX4A 4UDSA 3EGQA 2OERA 3BCGA 3MNLA 3VPRA 3F0CA 3QKXA 3QBMA 2Y2ZA 2GUHA 2ZCNA 2OF7A 3IUVA 4GFLA 3NXCA 2XRLA 1ORKA 4M3DA 5F0FA 2JK3A 3LWJA 1RPWA 2ZOYA 3ON2A 3ZQIA 2GFNA 2OI8A 4M3FA 2TRTA 3AQSA 2QIBA 4B3AA 2NP5A 3FK6A 3VW0A 4B1RA 2ID3A 4GFKA 3SDGA 4AF5A 4MXMA 2IBDA 1JT6A 2VKVA 2XGEA 5IP6A 3LHQA 3ZQLA 2YVHA 2X9DA 5FKLA 5GPAA 4X1EA 3HTHA 1T33A 4I76A 3VVZA 3BQYA 2RHAA 3QPLA 2G3BA 4XK4A 2JJ7A 1UI6A 2UXPA 2FBQA 3KKCA 5FKMA 2Y31A 3B6AA 2XGDA 3DCFA 5J1RA 3Q0VA 3NI7A 1JUSA
chains in the Genus database with same CATH superfamily
2YVEA 3DEWA 5FKOA 3VW2A 2HXIA 3VIBA 2X6OA 3LSPA 3Q0WA 4M3EA 4KWAA 3B6CA 3G1MA 2FQ4A 2FJI1 2XPUA 5AQCA 2PFVA 5H9TA 2F07A 3O8HA 4D7NA 2I10A 3KYLA 5FHPA 2IU5A 3V6GA 5F1JA 3G1OA 3F1BA 4JL3A 1ZKGA 3BRUA 2VPRA 5K58A 2B3WA 3FK7A 4G12A 3IH2A 3HTJA 3KKDA 5F0CA 5D19A 3ZQHA 3HGYA 2R7RA 3IH4A 5GP9A 2G7SA 4GCLA 3V78A 3RD3A 5CXGA 5EYRA 4JYKA 2R7XA 1ZK8A 2FD5A 3NPIA 3BR1A 2PZ9A 4DW6A 1QVTA 2R7UA 1QVUA 3LSRA 4OD4A 3LOCA 3BQZA 3BHQA 5IPAA 3SWHA 3SFIA 3CWRA 3B81A 3C07A 2QCOA 1JUMA 3O60A 3ON4A 3LJLA 2PBXA 4JKZA 2R7SA 2UXHA 3T6NA 3VVXA 1T56A 3VVYA 3KNWA 5CW8A 4ME9A 2QWTA 1RKWA 3PPBA 1JTYA 3G1LA 3WHCA 2IAIA 5HSZA 4W97A 1JUPA 3VUQA 2ID6A 2Y30A 3BR0A 3BTLA 3ZQGA 1RKTA 3S5RA 3VW1A 3Q0UA 1U9NA 2XPVA 2FJ1A 4GCKA 2FX0A 3HGGA 4D5CA 3CRJA 3BR3A 3EUPA 3FRQA 2NS7A 3P9TA 3VOXA 3ZQFA 3NS4A 2A2FX 2REKA 2O7TA 4U9NA 2GBYA 3BNIA 5IOZA 3HE0A 4YZEA 1UI5A 1Z0XA 5J3LA 1U9OA 5D18A 2W53A 3PM1A 3ANPA 3BR5A 4V2GA 3BR6A 5FGLA 3DU6A 5FMPA 4V2FA 4AUXA 3E7QA 3HTIA 2TCTA 3VOKA 5K7ZA 5J1YA 2Q24A 3G7RA 4CGRA 2D6YA 2R7VA 3CJDA 2O7OA 2WUIA 3BTCA 4NELA 2XGCA 3Q3SA 3DU5A 3HTAA 3O8GA 2QKOA 2NP3A 4AC6A 1Z77A 2R7TA 3GZIA 4D7MA 3G56A 5D1RA 5CXIA 1VI0A 1BJZA 2QTQA 3HIMA 3LSJA 4I6ZA 3AQTA 2EH3A 2G7GA 4L62A 3TP0A 2ZCXA 2VKEA 2UXUA 3BR2A 2HXOA 4NN1A 2WGBA 3MVPA 2ZOZA 2GENA 3DPJA 2XPWA 2V57A 2UXIA 3WHBA 3C2BA 1SGMA 5DAJA 2ZB9A 3ANGA 4D5FA 3RH2A 2DG7A 2HYJA 3CCYA 2HQ5A 2RASA 4JNNA 4M3BA 3COLA 2UXOA 3KZ9A 3TP3A 2DG8A 2HKUA 5FKKA 5EZGA 4AC0A 3BTIA 3NNRA 4HKUA 2XDNA 1JT0A 2IEKA 2OPTA 4PXIA 4ICHA 2HYTA 3QPSA 5EZHA 5F04A 3CDLA 5C4YA 2DTZA 4W1UA 2G0EA 4C2MA 3GEUA 5J1UA 2YVXA 3VTIA 4ABZA 5EFYA 3IH3A 2B1EA 3BJBA 1QPIA 5HBUA 5F08A 3BTJA 5HAWA 3VP5A 3FIWA 4GCTA 1A6IA 4MK6A 2ZCMA 3BT9A 2XB5A 5FKNA 3NRGA 2G7LA 5K7HA 4OD5A 4M3GA 1JTXA 2QOPA 4IRVA 3JSJA 2NS8A 5GPCA 4MO7A 5F0HA 2RAEA 5K7FA 4ACIA 3PASA 5F27A 2WV1A 3QQAA 5IOYA 2NX4A 4UDSA 3EGQA 3K8PC 2ZY9A 2OERA 3BCGA 3MNLA 3VPRA 3F0CA 3QKXA 3QBMA 2Y2ZA 2GUHA 2ZCNA 4DVYP 4U9LA 2OF7A 3IUVA 4GFLA 3NXCA 2XRLA 1ORKA 4M3DA 5F0FA 2JK3A 3LWJA 1RPWA 2ZOYA 3ON2A 3ZQIA 2GFNA 2OI8A 4M3FA 2TRTA 3AQSA 2QIBA 4B3AA 2NP5A 3FK6A 3VW0A 4B1RA 2ID3A 4GFKA 3SDGA 4AF5A 4MXMA 2IBDA 1JT6A 2VKVA 2XGEA 5IP6A 3LHQA 3ZQLA 2YVHA 2X9DA 5FKLA 5GPAA 4X1EA 2R7OA 3HTHA 1T33A 2R7QA 4I76A 3VVZA 3BQYA 2RHAA 3QPLA 2G3BA 4XK4A 2JJ7A 1UI6A 2UXPA 2FBQA 3KKCA 5FKMA 2Y31A 3B6AA 2XGDA 3DCFA 5J1RA 5CQGA 2R7WA 3FHNA 4WIBA 3Q0VA 3NI7A 1JUSA
chains in the Genus database with same CATH topology
2YVEA 3DEWA 5FKOA 3VW2A 2HXIA 3VIBA 2X6OA 3LSPA 3Q0WA 4M3EA 4KWAA 3B6CA 3G1MA 2FQ4A 2XPUA 5AQCA 5H9TA 2F07A 3O8HA 4D7NA 2I10A 5FHPA 2IU5A 3V6GA 5F1JA 3G1OA 3F1BA 4JL3A 1ZKGA 3BRUA 2VPRA 5K58A 3FK7A 4G12A 3IH2A 3HTJA 3KKDA 5F0CA 5D19A 3ZQHA 3HGYA 3IH4A 5GP9A 2G7SA 4GCLA 3V78A 3RD3A 5CXGA 5EYRA 4JYKA 1ZK8A 2FD5A 3NPIA 3BR1A 2PZ9A 4DW6A 1QVTA 1QVUA 3LSRA 3LOCA 3BQZA 3BHQA 5IPAA 3SFIA 3CWRA 3B81A 3C07A 2QCOA 1JUMA 3O60A 3ON4A 3LJLA 2PBXA 4JKZA 2UXHA 3T6NA 3VVXA 1T56A 3VVYA 3KNWA 5CW8A 4ME9A 2QWTA 1RKWA 3PPBA 5HSZA 1JTYA 3G1LA 2IAIA 3WHCA 4W97A 1JUPA 3VUQA 2ID6A 2Y30A 3BR0A 3BTLA 3ZQGA 1RKTA 3S5RA 3VW1A 3Q0UA 1U9NA 2XPVA 2FJ1A 4GCKA 2FX0A 3HGGA 4D5CA 3CRJA 3BR3A 3EUPA 3FRQA 2NS7A 3P9TA 3VOXA 3ZQFA 2REKA 2O7TA 2GBYA 3BNIA 5IOZA 3HE0A 4YZEA 1UI5A 1Z0XA 5J3LA 1U9OA 5D18A 2W53A 3PM1A 3ANPA 3BR5A 4V2GA 3BR6A 5FGLA 5FMPA 4V2FA 4AUXA 3E7QA 3HTIA 2TCTA 3VOKA 5K7ZA 5J1YA 2Q24A 3G7RA 4CGRA 2D6YA 3CJDA 2O7OA 2WUIA 3BTCA 4NELA 2XGCA 3Q3SA 3HTAA 3O8GA 2QKOA 2NP3A 4AC6A 1Z77A 3GZIA 4D7MA 3G56A 5D1RA 5CXIA 1VI0A 1BJZA 2QTQA 3HIMA 3LSJA 4I6ZA 3AQTA 2EH3A 2G7GA 4L62A 3TP0A 2ZCXA 2VKEA 2UXUA 3BR2A 2HXOA 4NN1A 2WGBA 3MVPA 2ZOZA 2GENA 3DPJA 2XPWA 2V57A 2UXIA 3WHBA 3C2BA 1SGMA 5DAJA 2ZB9A 3ANGA 4D5FA 3RH2A 2DG7A 2HYJA 3CCYA 2RASA 2HQ5A 4JNNA 4M3BA 3COLA 2UXOA 3KZ9A 3TP3A 2DG8A 2HKUA 5FKKA 5EZGA 4AC0A 3BTIA 3NNRA 4HKUA 2XDNA 1JT0A 2IEKA 2OPTA 4PXIA 4ICHA 2HYTA 3QPSA 5EZHA 5F04A 3CDLA 5C4YA 2DTZA 4W1UA 2G0EA 3GEUA 5J1UA 4ABZA 5EFYA 3IH3A 3BJBA 1QPIA 5HBUA 5F08A 3BTJA 5HAWA 3VP5A 3FIWA 4GCTA 1A6IA 4MK6A 2ZCMA 3BT9A 2XB5A 5FKNA 3NRGA 5K7HA 2G7LA 4M3GA 1JTXA 2QOPA 3JSJA 2NS8A 5GPCA 4MO7A 5F0HA 2RAEA 5K7FA 4ACIA 3PASA 5F27A 2WV1A 3QQAA 5IOYA 2NX4A 4UDSA 3EGQA 2OERA 3BCGA 3MNLA 3VPRA 3F0CA 3QKXA 3QBMA 2Y2ZA 2GUHA 2ZCNA 2OF7A 3IUVA 4GFLA 3NXCA 2XRLA 1ORKA 4M3DA 5F0FA 2JK3A 3LWJA 1RPWA 2ZOYA 3ON2A 3ZQIA 2GFNA 2OI8A 4M3FA 2TRTA 3AQSA 2QIBA 4B3AA 2NP5A 3FK6A 3VW0A 4B1RA 2ID3A 4GFKA 3SDGA 4AF5A 4MXMA 2IBDA 1JT6A 2VKVA 2XGEA 5IP6A 3LHQA 3ZQLA 2YVHA 2X9DA 5FKLA 5GPAA 4X1EA 3HTHA 1T33A 4I76A 3VVZA 3BQYA 2RHAA 3QPLA 2G3BA 4XK4A 2JJ7A 1UI6A 2UXPA 2FBQA 3KKCA 5FKMA 2Y31A 3B6AA 2XGDA 3DCFA 5J1RA 3Q0VA 3NI7A 1JUSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YVE A;  3DEW A;  5FKO A;  3VW2 A;  2HXI A;  3VIB A;  2X6O A;  3LSP A;  3Q0W A;  4M3E A;  4KWA A;  3B6C A;  3G1M A;  2FQ4 A;  2XPU A;  5AQC A;  5H9T A;  2F07 A;  3O8H A;  4D7N A;  2I10 A;  5FHP A;  2IU5 A;  3V6G A;  5F1J A;  3G1O A;  3F1B A;  4JL3 A;  1ZKG A;  3BRU A;  2VPR A;  5K58 A;  3FK7 A;  4G12 A;  3IH2 A;  3HTJ A;  3KKD A;  5F0C A;  5D19 A;  3ZQH A;  3HGY A;  3IH4 A;  5GP9 A;  2G7S A;  4GCL A;  3V78 A;  3RD3 A;  5CXG A;  5EYR A;  4JYK A;  1ZK8 A;  2FD5 A;  3NPI A;  3BR1 A;  2PZ9 A;  4DW6 A;  1QVT A;  1QVU A;  3LSR A;  3LOC A;  3BQZ A;  3BHQ A;  5IPA A;  3SFI A;  3CWR A;  3B81 A;  3C07 A;  2QCO A;  1JUM A;  3O60 A;  3ON4 A;  3LJL A;  2PBX A;  4JKZ A;  2UXH A;  3T6N A;  3VVX A;  1T56 A;  3VVY A;  3KNW A;  5CW8 A;  4ME9 A;  2QWT A;  1RKW A;  3PPB A;  5HSZ A;  1JTY A;  3G1L A;  2IAI A;  3WHC A;  4W97 A;  1JUP A;  3VUQ A;  2ID6 A;  2Y30 A;  3BR0 A;  3BTL A;  3ZQG A;  1RKT A;  3S5R A;  3VW1 A;  3Q0U A;  1U9N A;  2XPV A;  2FJ1 A;  4GCK A;  2FX0 A;  3HGG A;  4D5C A;  3CRJ A;  3BR3 A;  3EUP A;  3FRQ A;  2NS7 A;  3P9T A;  3VOX A;  3ZQF A;  2REK A;  2O7T A;  2GBY A;  3BNI A;  5IOZ A;  3HE0 A;  4YZE A;  1UI5 A;  1Z0X A;  5J3L A;  1U9O A;  5D18 A;  2W53 A;  3PM1 A;  3ANP A;  3BR5 A;  4V2G A;  3BR6 A;  5FGL A;  5FMP A;  4V2F A;  4AUX A;  3E7Q A;  3HTI A;  2TCT A;  3VOK A;  5K7Z A;  5J1Y A;  2Q24 A;  3G7R A;  4CGR A;  2D6Y A;  3CJD A;  2O7O A;  2WUI A;  3BTC A;  4NEL A;  2XGC A;  3Q3S A;  3HTA A;  3O8G A;  2QKO A;  2NP3 A;  4AC6 A;  1Z77 A;  3GZI A;  4D7M A;  3G56 A;  5D1R A;  5CXI A;  1VI0 A;  1BJZ A;  2QTQ A;  3HIM A;  3LSJ A;  4I6Z A;  3AQT A;  2EH3 A;  2G7G A;  4L62 A;  3TP0 A;  2ZCX A;  2VKE A;  2UXU A;  3BR2 A;  2HXO A;  4NN1 A;  2WGB A;  3MVP A;  2ZOZ A;  2GEN A;  3DPJ A;  2XPW A;  2V57 A;  2UXI A;  3WHB A;  3C2B A;  1SGM A;  5DAJ A;  2ZB9 A;  3ANG A;  4D5F A;  3RH2 A;  2DG7 A;  2HYJ A;  3CCY A;  2RAS A;  2HQ5 A;  4JNN A;  4M3B A;  3COL A;  2UXO A;  3KZ9 A;  3TP3 A;  2DG8 A;  2HKU A;  5FKK A;  5EZG A;  4AC0 A;  3BTI A;  3NNR A;  4HKU A;  2XDN A;  1JT0 A;  2IEK A;  2OPT A;  4PXI A;  4ICH A;  2HYT A;  3QPS A;  5EZH A;  5F04 A;  3CDL A;  5C4Y A;  2DTZ A;  4W1U A;  2G0E A;  3GEU A;  5J1U A;  4ABZ A;  5EFY A;  3IH3 A;  3BJB A;  1QPI A;  5HBU A;  5F08 A;  3BTJ A;  5HAW A;  3VP5 A;  3FIW A;  4GCT A;  1A6I A;  4MK6 A;  2ZCM A;  3BT9 A;  2XB5 A;  5FKN A;  3NRG A;  5K7H A;  2G7L A;  4M3G A;  1JTX A;  2QOP A;  3JSJ A;  2NS8 A;  5GPC A;  4MO7 A;  5F0H A;  2RAE A;  5K7F A;  4ACI A;  3PAS A;  5F27 A;  2WV1 A;  3QQA A;  5IOY A;  2NX4 A;  4UDS A;  3EGQ A;  2OER A;  3BCG A;  3MNL A;  3VPR A;  3F0C A;  3QKX A;  3QBM A;  2Y2Z A;  2GUH A;  2ZCN A;  2OF7 A;  3IUV A;  4GFL A;  3NXC A;  2XRL A;  1ORK A;  4M3D A;  5F0F A;  2JK3 A;  3LWJ A;  1RPW A;  2ZOY A;  3ON2 A;  3ZQI A;  2GFN A;  2OI8 A;  4M3F A;  2TRT A;  3AQS A;  2QIB A;  4B3A A;  2NP5 A;  3FK6 A;  3VW0 A;  4B1R A;  2ID3 A;  4GFK A;  3SDG A;  4AF5 A;  4MXM A;  2IBD A;  1JT6 A;  2VKV A;  2XGE A;  5IP6 A;  3LHQ A;  3ZQL A;  2YVH A;  2X9D A;  5FKL A;  5GPA A;  4X1E A;  3HTH A;  1T33 A;  4I76 A;  3VVZ A;  3BQY A;  2RHA A;  3QPL A;  2G3B A;  4XK4 A;  2JJ7 A;  1UI6 A;  2UXP A;  2FBQ A;  3KKC A;  5FKM A;  2Y31 A;  3B6A A;  2XGD A;  3DCF A;  5J1R A;  3Q0V A;  3NI7 A;  1JUS A; 
#chains in the Genus database with same CATH topology
 2YVE A;  3DEW A;  5FKO A;  3VW2 A;  2HXI A;  3VIB A;  2X6O A;  3LSP A;  3Q0W A;  4M3E A;  4KWA A;  3B6C A;  3G1M A;  2FQ4 A;  2FJI 1;  2XPU A;  5AQC A;  2PFV A;  5H9T A;  2F07 A;  3O8H A;  4D7N A;  2I10 A;  3KYL A;  5FHP A;  2IU5 A;  3V6G A;  5F1J A;  3G1O A;  3F1B A;  4JL3 A;  1ZKG A;  3BRU A;  2VPR A;  5K58 A;  2B3W A;  3FK7 A;  4G12 A;  3IH2 A;  3HTJ A;  3KKD A;  5F0C A;  5D19 A;  3ZQH A;  3HGY A;  2R7R A;  3IH4 A;  5GP9 A;  2G7S A;  4GCL A;  3V78 A;  3RD3 A;  5CXG A;  5EYR A;  4JYK A;  2R7X A;  1ZK8 A;  2FD5 A;  3NPI A;  3BR1 A;  2PZ9 A;  4DW6 A;  1QVT A;  2R7U A;  1QVU A;  3LSR A;  4OD4 A;  3LOC A;  3BQZ A;  3BHQ A;  5IPA A;  3SWH A;  3SFI A;  3CWR A;  3B81 A;  3C07 A;  2QCO A;  1JUM A;  3O60 A;  3ON4 A;  3LJL A;  2PBX A;  4JKZ A;  2R7S A;  2UXH A;  3T6N A;  3VVX A;  1T56 A;  3VVY A;  3KNW A;  5CW8 A;  4ME9 A;  2QWT A;  1RKW A;  3PPB A;  1JTY A;  3G1L A;  3WHC A;  2IAI A;  5HSZ A;  4W97 A;  1JUP A;  3VUQ A;  2ID6 A;  2Y30 A;  3BR0 A;  3BTL A;  3ZQG A;  1RKT A;  3S5R A;  3VW1 A;  3Q0U A;  1U9N A;  2XPV A;  2FJ1 A;  4GCK A;  2FX0 A;  3HGG A;  4D5C A;  3CRJ A;  3BR3 A;  3EUP A;  3FRQ A;  2NS7 A;  3P9T A;  3VOX A;  3ZQF A;  3NS4 A;  2A2F X;  2REK A;  2O7T A;  4U9N A;  2GBY A;  3BNI A;  5IOZ A;  3HE0 A;  4YZE A;  1UI5 A;  1Z0X A;  5J3L A;  1U9O A;  5D18 A;  2W53 A;  3PM1 A;  3ANP A;  3BR5 A;  4V2G A;  3BR6 A;  5FGL A;  3DU6 A;  5FMP A;  4V2F A;  4AUX A;  3E7Q A;  3HTI A;  2TCT A;  3VOK A;  5K7Z A;  5J1Y A;  2Q24 A;  3G7R A;  4CGR A;  2D6Y A;  2R7V A;  3CJD A;  2O7O A;  2WUI A;  3BTC A;  4NEL A;  2XGC A;  3Q3S A;  3DU5 A;  3HTA A;  3O8G A;  2QKO A;  2NP3 A;  4AC6 A;  1Z77 A;  2R7T A;  3GZI A;  4D7M A;  3G56 A;  5D1R A;  5CXI A;  1VI0 A;  1BJZ A;  2QTQ A;  3HIM A;  3LSJ A;  4I6Z A;  3AQT A;  2EH3 A;  2G7G A;  4L62 A;  3TP0 A;  2ZCX A;  2VKE A;  2UXU A;  3BR2 A;  2HXO A;  4NN1 A;  2WGB A;  3MVP A;  2ZOZ A;  2GEN A;  3DPJ A;  2XPW A;  2V57 A;  2UXI A;  3WHB A;  3C2B A;  1SGM A;  5DAJ A;  2ZB9 A;  3ANG A;  4D5F A;  3RH2 A;  2DG7 A;  2HYJ A;  3CCY A;  2HQ5 A;  2RAS A;  4JNN A;  4M3B A;  3COL A;  2UXO A;  3KZ9 A;  3TP3 A;  2DG8 A;  2HKU A;  5FKK A;  5EZG A;  4AC0 A;  3BTI A;  3NNR A;  4HKU A;  2XDN A;  1JT0 A;  2IEK A;  2OPT A;  4PXI A;  4ICH A;  2HYT A;  3QPS A;  5EZH A;  5F04 A;  3CDL A;  5C4Y A;  2DTZ A;  4W1U A;  2G0E A;  4C2M A;  3GEU A;  5J1U A;  2YVX A;  3VTI A;  4ABZ A;  5EFY A;  3IH3 A;  2B1E A;  3BJB A;  1QPI A;  5HBU A;  5F08 A;  3BTJ A;  5HAW A;  3VP5 A;  3FIW A;  4GCT A;  1A6I A;  4MK6 A;  2ZCM A;  3BT9 A;  2XB5 A;  5FKN A;  3NRG A;  2G7L A;  5K7H A;  4OD5 A;  4M3G A;  1JTX A;  2QOP A;  4IRV A;  3JSJ A;  2NS8 A;  5GPC A;  4MO7 A;  5F0H A;  2RAE A;  5K7F A;  4ACI A;  3PAS A;  5F27 A;  2WV1 A;  3QQA A;  5IOY A;  2NX4 A;  4UDS A;  3EGQ A;  3K8P C;  2ZY9 A;  2OER A;  3BCG A;  3MNL A;  3VPR A;  3F0C A;  3QKX A;  3QBM A;  2Y2Z A;  2GUH A;  2ZCN A;  4DVY P;  4U9L A;  2OF7 A;  3IUV A;  4GFL A;  3NXC A;  2XRL A;  1ORK A;  4M3D A;  5F0F A;  2JK3 A;  3LWJ A;  1RPW A;  2ZOY A;  3ON2 A;  3ZQI A;  2GFN A;  2OI8 A;  4M3F A;  2TRT A;  3AQS A;  2QIB A;  4B3A A;  2NP5 A;  3FK6 A;  3VW0 A;  4B1R A;  2ID3 A;  4GFK A;  3SDG A;  4AF5 A;  4MXM A;  2IBD A;  1JT6 A;  2VKV A;  2XGE A;  5IP6 A;  3LHQ A;  3ZQL A;  2YVH A;  2X9D A;  5FKL A;  5GPA A;  4X1E A;  2R7O A;  3HTH A;  1T33 A;  2R7Q A;  4I76 A;  3VVZ A;  3BQY A;  2RHA A;  3QPL A;  2G3B A;  4XK4 A;  2JJ7 A;  1UI6 A;  2UXP A;  2FBQ A;  3KKC A;  5FKM A;  2Y31 A;  3B6A A;  2XGD A;  3DCF A;  5J1R A;  5CQG A;  2R7W A;  3FHN A;  4WIB A;  3Q0V A;  3NI7 A;  1JUS A; 
#chains in the Genus database with same CATH homology
 2YVE A;  3DEW A;  5FKO A;  3VW2 A;  2HXI A;  3VIB A;  2X6O A;  3LSP A;  3Q0W A;  4M3E A;  4KWA A;  3B6C A;  3G1M A;  2FQ4 A;  2XPU A;  5AQC A;  5H9T A;  2F07 A;  3O8H A;  4D7N A;  2I10 A;  5FHP A;  2IU5 A;  3V6G A;  5F1J A;  3G1O A;  3F1B A;  4JL3 A;  1ZKG A;  3BRU A;  2VPR A;  5K58 A;  3FK7 A;  4G12 A;  3IH2 A;  3HTJ A;  3KKD A;  5F0C A;  5D19 A;  3ZQH A;  3HGY A;  3IH4 A;  5GP9 A;  2G7S A;  4GCL A;  3V78 A;  3RD3 A;  5CXG A;  5EYR A;  4JYK A;  1ZK8 A;  2FD5 A;  3NPI A;  3BR1 A;  2PZ9 A;  4DW6 A;  1QVT A;  1QVU A;  3LSR A;  3LOC A;  3BQZ A;  3BHQ A;  5IPA A;  3SFI A;  3CWR A;  3B81 A;  3C07 A;  2QCO A;  1JUM A;  3O60 A;  3ON4 A;  3LJL A;  2PBX A;  4JKZ A;  2UXH A;  3T6N A;  3VVX A;  1T56 A;  3VVY A;  3KNW A;  5CW8 A;  4ME9 A;  2QWT A;  1RKW A;  3PPB A;  5HSZ A;  1JTY A;  3G1L A;  2IAI A;  3WHC A;  4W97 A;  1JUP A;  3VUQ A;  2ID6 A;  2Y30 A;  3BR0 A;  3BTL A;  3ZQG A;  1RKT A;  3S5R A;  3VW1 A;  3Q0U A;  1U9N A;  2XPV A;  2FJ1 A;  4GCK A;  2FX0 A;  3HGG A;  4D5C A;  3CRJ A;  3BR3 A;  3EUP A;  3FRQ A;  2NS7 A;  3P9T A;  3VOX A;  3ZQF A;  2REK A;  2O7T A;  2GBY A;  3BNI A;  5IOZ A;  3HE0 A;  4YZE A;  1UI5 A;  1Z0X A;  5J3L A;  1U9O A;  5D18 A;  2W53 A;  3PM1 A;  3ANP A;  3BR5 A;  4V2G A;  3BR6 A;  5FGL A;  5FMP A;  4V2F A;  4AUX A;  3E7Q A;  3HTI A;  2TCT A;  3VOK A;  5K7Z A;  5J1Y A;  2Q24 A;  3G7R A;  4CGR A;  2D6Y A;  3CJD A;  2O7O A;  2WUI A;  3BTC A;  4NEL A;  2XGC A;  3Q3S A;  3HTA A;  3O8G A;  2QKO A;  2NP3 A;  4AC6 A;  1Z77 A;  3GZI A;  4D7M A;  3G56 A;  5D1R A;  5CXI A;  1VI0 A;  1BJZ A;  2QTQ A;  3HIM A;  3LSJ A;  4I6Z A;  3AQT A;  2EH3 A;  2G7G A;  4L62 A;  3TP0 A;  2ZCX A;  2VKE A;  2UXU A;  3BR2 A;  2HXO A;  4NN1 A;  2WGB A;  3MVP A;  2ZOZ A;  2GEN A;  3DPJ A;  2XPW A;  2V57 A;  2UXI A;  3WHB A;  3C2B A;  1SGM A;  5DAJ A;  2ZB9 A;  3ANG A;  4D5F A;  3RH2 A;  2DG7 A;  2HYJ A;  3CCY A;  2RAS A;  2HQ5 A;  4JNN A;  4M3B A;  3COL A;  2UXO A;  3KZ9 A;  3TP3 A;  2DG8 A;  2HKU A;  5FKK A;  5EZG A;  4AC0 A;  3BTI A;  3NNR A;  4HKU A;  2XDN A;  1JT0 A;  2IEK A;  2OPT A;  4PXI A;  4ICH A;  2HYT A;  3QPS A;  5EZH A;  5F04 A;  3CDL A;  5C4Y A;  2DTZ A;  4W1U A;  2G0E A;  3GEU A;  5J1U A;  4ABZ A;  5EFY A;  3IH3 A;  3BJB A;  1QPI A;  5HBU A;  5F08 A;  3BTJ A;  5HAW A;  3VP5 A;  3FIW A;  4GCT A;  1A6I A;  4MK6 A;  2ZCM A;  3BT9 A;  2XB5 A;  5FKN A;  3NRG A;  5K7H A;  2G7L A;  4M3G A;  1JTX A;  2QOP A;  3JSJ A;  2NS8 A;  5GPC A;  4MO7 A;  5F0H A;  2RAE A;  5K7F A;  4ACI A;  3PAS A;  5F27 A;  2WV1 A;  3QQA A;  5IOY A;  2NX4 A;  4UDS A;  3EGQ A;  2OER A;  3BCG A;  3MNL A;  3VPR A;  3F0C A;  3QKX A;  3QBM A;  2Y2Z A;  2GUH A;  2ZCN A;  2OF7 A;  3IUV A;  4GFL A;  3NXC A;  2XRL A;  1ORK A;  4M3D A;  5F0F A;  2JK3 A;  3LWJ A;  1RPW A;  2ZOY A;  3ON2 A;  3ZQI A;  2GFN A;  2OI8 A;  4M3F A;  2TRT A;  3AQS A;  2QIB A;  4B3A A;  2NP5 A;  3FK6 A;  3VW0 A;  4B1R A;  2ID3 A;  4GFK A;  3SDG A;  4AF5 A;  4MXM A;  2IBD A;  1JT6 A;  2VKV A;  2XGE A;  5IP6 A;  3LHQ A;  3ZQL A;  2YVH A;  2X9D A;  5FKL A;  5GPA A;  4X1E A;  3HTH A;  1T33 A;  4I76 A;  3VVZ A;  3BQY A;  2RHA A;  3QPL A;  2G3B A;  4XK4 A;  2JJ7 A;  1UI6 A;  2UXP A;  2FBQ A;  3KKC A;  5FKM A;  2Y31 A;  3B6A A;  2XGD A;  3DCF A;  5J1R A;  3Q0V A;  3NI7 A;  1JUS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...