3BTJA

Crystal structure of qacr(e58q) bound to dequalinium
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
186
structure length
186
Chain Sequence
b'NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEQSKWQEQWKKEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator qacR
publication title QacR-cation recognition is mediated by a redundancy of residues capable of charge neutralization
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription
total genus 83
structure length 186
sequence length 186
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2007-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3btjA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3btjA02
1IDZA 2MG4A 4ICHA 2DA6A 4MK6A 2HOAA 3G1LA 2D6YA 4MXMA 1WPKA 2L7MP 5C44J 3BQYA 5GP9A 1XS9A 3BR6A 1ETKA 4M3GA 1QRYA 3ZQHA 3VVYA 2WAQN 1BW6A 4D5CA 1SGMA 3LSGA 4DZJA 1UG2A 4MIMA 3LJLA 2X9DA 1ETWA 3OSFA 3ON4A 4ME9A 1MBGA 3RH2A 1A6IA 2M34A 4EEFG 3EGQA 3UKGA 2Y31A 3RZOJ 4AUXA 3ANGA 3D1NI 3FRQA 4DYCA 3JRDA 2REKA 2GUHA 5IP6A 2EQRA 1APLC 4AF5A 2K9QA 2QWTA 4DYQA 1YRNB 3ANPA 4AC0A 3S14J 1D5YA 1TWAJ 2KT0A 5FHPA 3BR5A 1VNDA 4D7MA 3QBMA 5AQCA 2P81A 1QVUA 1O4XA 5F04A 2RASA 3O8HA 4BBSJ 2CUFA 4A3JJ 4NN1A 2R7ZJ 1MBEA 2QOPA 2R5ZA 2ZCXA 3HOWJ 3HBLA 3HOZJ 3NI7A 3A03A 3FK6A 3WHBA 4GFBA 2M9HA 3S16J 5DAJA 3HOYJ 2AO9A 5FLVA 3JRAA 2CRGA 1X2MA 5FKKA 4S0HB 1TWGJ 2XB5A 5E3NA 3S17J 2IBDA 2JA5J 1JUPA 2HXIA 1FJLA 1ITYA 4FE4A 3KNWA 1K83J 2NVXJ 2WUIA 1SANA 2DA1A 3AQTA 3JSJA 4XRSG 2LD5A 3ZQIA 2E1OA 2DMQA 2ID3A 3C2BA 3BQZA 1XC5A 3HOUJ 2HYTA 2UXPA 5E3MA 1HDDC 1W0UA 4QTRA 2N8GA 3RZDJ 2CJJA 2EZKA 1Z77A 2ELKA 1JGGA 1MBKA 4W97A 1TC3C 4GCTA 1E3OC 3JRIA 3HTIA 5M3FJ 2QCOA 4W1UA 2WGBA 1JUMA 2CQXA 1GDTA 3B81A 5FKNA 2ECCA 4X6AJ 3BHQA 3NNRA 4XICA 3HOXJ 1GVDA 1OFCX 4IHWA 4MLOA 2JN6A 2Y9YA 2ZB9A 4A3LJ 1IUFA 1JT6A 3E7QA 3HE0A 5K7HA 5EYRA 4MFDA 2G7GA 2QTQA 1FIPA 5J3LA 4KWAA 2R5YA 1B8IA 2O7OA 3BT9A 1QVTA 3F0CA 3CDLA 4V2FA 5IP7J 3WHCA 2X6OA 5HODA 3ZQGA 4A3EJ 4I76A 3W6VA 4L62A 5E3OA 1P7IA 5C3EJ 1G2HA 3QPLA 1A5JA 3G1MA 3P9TA 3TW6A 3VOKA 1ZTRA 3HTHA 2DMTA 3S15J 2E19A 4C3JJ 5FKMA 1U8BA 1MSEC 3BR2A 1S7EA 2O7TA 5EFYA 1VF9A 3CCYA 1ORKA 1BA5A 2UXOA 2G3BA 3KZ9A 4A3CJ 3BJBA 4A3BJ 2FBQA 3B6CA 2CQQA 5FKOA 4C3IJ 5FKLA 2DA4A 2V57A 1EF4A 4DYRA 3FK7A 4HKUA 4HNVA 1H8AC 1TWHJ 5EGOB 3GTJJ 3SJMA 5JLWA 2XPVA 2NOGA 3FKIJ 4LOCA 3S1RJ 3I4NJ 2LFBA 3BR1A 2QIBA 3H0GJ 5DS9A 5IPAA 4L5EA 1B72B 3FISA 3VIBA 3VVXA 3L1PA 3JRBA 2CU7A 1JUSA 2KDZA 2DN0A 1F43A 4IHVA 3BTIA 3HB9A 3BR0A 2M8GX 4XK4A 4X1EA 2JA8J 3MKLA 1TWCJ 4D5FA 1YRNA 3LNQA 5M5WJ 1GUUA 2HQ5A 3JRFA 4XRMA 2M0CA 5K7FA 3HTAA 3V6GA 1FTZA 4RDUA 2XRLA 1JKRC 3T6NA 1WH7A 5K58A 3OOUA 1ZK8A 5GPAA 2NVQJ 4A3IJ 3G7RA 2XGCA 2AHQA 4M3EA 3TP0A 2GENA 1BJZA 4UUSB 5D1RA 2L7FP 2Y0SN 3CQZJ 5EEAA 4V2GA 5H9TA 4BXXJ 2MW8A 1H88C 3GBGA 3G1OA 4GFKA 2RHAA 1NK3P 1GV2A 2X48A 4FTHA 3VW0A 5J1RA 1IG7A 4QIWN 3JRCA 2L0KA 3CWRA 2ID6A 2LTPA 2COBA 2H8RA 2ZOYA 5F08A 5F1JA 3PO2J 1W0TA 3LSPA 3O60A 3HGYA 5J1UA 3SDGA 1IV6A 2JJ7A 1ETYA 1NK2P 3TP3A 3VPRA 5F0HA 2NS7A 2IEKA 1MNMC 1OCTC 3HDDA 4JX6A 2XPWA 5D18A 2DTZA 1OCPA 1RR7A 2Y9ZA 1R9TJ 2R93J 2JMWA 1OJLA 5M5XJ 4IHYA 1ETQA 2LK2A 4M3FA 1VFCA 1BW5A 5CXIA 2Y2ZA 3LHQA 4A3FJ 2CUEA 2DA2A 3ZQFA 5F27A 2VPRA 5IP9J 2HDDA 4B1RA 4A69C 4C3HJ 1X58A 4A93J 3GZIA 3BTLA 3K7AJ 5C4XJ 3QQAA 1IC8A 1ETXA 5HBUA 3A02A 5IYDJ 2NP3A 2GM4A 2UXUA 3RQIA 1I50J 2HI3A 1UMQA 3IH3A 2FD5A 3E7LA 1RPWA 1IRZA 2XGDA 4UUTA 1WH5A 2E2IJ 4FE7A 2TCTA 3FIWA 1ZQ3P 2JK3A 3DEWA 4M6VA 3DCFA 2DA7A 1I6HJ 4UDSA 2PZ9A 4Y7NJ 2O8KA 1GT0C 1RETA 2WB1N 1UI5A 4JYKA 2NS8A 4RBOA 3OSGA 3HTJA 2DJNA 1U9NA 4JX4A 3S2DJ 2ZOZA 5CXGA 4QSHA 1JKOC 1JJ8C 4AYBN 4A3MJ 1LFUP 5HAWA 2YU9J 1VI0A 3KKCA 1WGXA 3PM1A 1IDYA 3RKQA 3GTKJ 3BTJA 2H1KA 2R0QC 2IAIA 5EZHA 2MSYA 5GPCA 2L9RA 1H89C 1B72A 2W53A 4C2MJ 2G7LA 5FLMJ 3K2AA 1U78A 3GTLJ 4NELA 3MVPA 3HEFA 3QPSA 4MO7A 2Q24A 4XRSA 1LE8B 1AKHB 2OPTA 2VKEA 1RESA 3BTCA 2FX0A 2LR8A 3GTMJ 4B4CA 2E2JJ 1UHSA 1HLVA 1RKTA 2JA6J 4BY1J 1DU6A 3Q0WA 4CYCB 5BNGA 1T56A 1SFOJ 5IOZA 4JL3A 5FJ8J 1HOMA 5EG0B 1PUFB 2PBXA 3DPJA 3MN2A 5CW8A 2VUMJ 2UXIA 3NXCA 2Y30A 3A01B 1HDPA 3PASA 2DA5A 4ACIA 4MFEA 4NDLA 2HKUA 1ENHA 4G12A 3ZQLA 5FGLA 5E3LA 2YVEA 2K9SA 3PO3J 3TW7A 2FQ4A 3BG5A 1NTCA 3G56A 2E2HJ 3VW2A 4J19A 3JRHA 2JA7J 9ANTA 3B6AA 1TWFJ 3PPBA 2LVSA 3HM5A 1MH4A 2L7ZA 3AQSA 3HGGA 3ON2A 1Q1VA 5M3MJ 5C4JJ 3IH4A 1ZR4A 1UI6A 5D19A 2MGQA 1CQTA 4PXIA 2QF7A 1MSFC 1FTTA 3MNLA 2GFNA 2TRTA 2DMUA 3CRJA 1ZR2A 1JT0A 3NPIA 5IOYA 4XIDA 3CJDA 2M2EA 1JKQC 2XSDC 4I6ZA 4Y52J 1JTXA 1GV5A 3IV5A 4A3KJ 2R92J 2ME6A 3Q3SA 2LY9A 1T33A 2B63J 2WV1A 1AU7A 3NAUA 2YS9A 2G7SA 1ZKGA 5J1YA 2EBIA 5C4YA 3S1NJ 3HKZN 1LFBA 2YVHA 1U9OA 3GTGJ 2HYJA 5EZGA 2XDNA 2PMZN 1Z0XA 3BCGA 2OF7A 2VKVA 1IJWC 1XG1A 1HCRA 1BL0A 2I10A 2XGEA 2EZHA 4JX5A 2HXOA 3BNIA 2DMNA 3TEDA 2DG8A 3HIMA 3VVZA 2LKXA 3M4OJ 1MH3A 2NX4A 3LSJA 3COLA 2D5VA 2OI8A 2NVTJ 3NARA 4GCLA 1MBHA 4M3BA 4JKZA 2FJ1A 3HOVJ 2ZCNA 1K61A 2HOTA 5DTDA 4YZEA 1FIAA 5M5YJ 3CMYA 4CGRA 3VOXA 2R5ZB 3S1QJ 2OERA 3LOCA 3M3YJ 3Q0UA 3GEUA 2EH3A 4A3GJ 2ME0A 3RD3A 3F1BA 2XB0X 1WI3A 3ZQCA 3VUQA 3IUVA 3KKDA 3BRUA 3IH2A 4B3AA 2O9LA 1I3QJ 5IYCJ 1JJ6C 2GBYA 2GLOA 1P7JA 1F36A 2EZIA 4D7NA 5F0CA 1LE8A 1QPIA 1AKHA 4GFLA 4DW6A 1RKWA 1IGNA 3GTOJ 3S1MJ 3BG9A 3S2HJ 2JWTA 3GTPJ 3ZOBA 5EGOA 1ETVA 4JP0A 2ZCMA 2LLKA 3JR9A 4CYCA 2XPUA 1FEXA 2EZLA 5EG0A 1PUFA 1ETOA 1Y1WJ 4FCYA 3O8GA 5F0FA 1DU0A 2QKOA 3LWJA 3VP5A 2HOSA 4M3DA 2ECBA 2K9NA 3A01A 1POGA 5K7ZA 5HSZA 5FMPA 2UXHA 3Q0VA 4JNNA 4AC6A 5EF6A 3OIOA 4BKXA 3LSRA 2NVYJ 4GCKA 2DMPA 4BBRJ 4IHXA 1Y1VJ 2F07A 3SFIA 1AHDP 3QKXA 1X2NA 2VI6A 2W48A 2G0EA 3I4MJ 2IU5A 2DG7A 3S5RA 5IYBJ 1JKPC 3BG3A 1MBFA 2DA3A 2K40A 1JTYA 4UUSA 2R5YB 1MBJA 4FISA 1B8IB 1WCMJ 4IEJA 1HF0A 3H3VK 3GTQJ 3JREA 3C07A 3V78A 4BY7J 4A3DJ 2NP5A 3JRGA 3VW1A 3EUPA 2LP0A 4DZPA 3NRGA 2RAEA 5EDNA 5JLXA 1ZGWA 4ABZA 2YUSA 3BR3A
chains in the Genus database with same CATH superfamily
2V1UA 4PK4A 3U2RA 2QSHX 4MK6A 3E6DA 1LJ9A 3MWMA 3G3ZA 4MXMA 2A3SA 2CO5A 2FBIA 1QRYA 2K3FA 2WAQN 1IN4A 4HV5A 1SGMA 4DZJA 5DD4A 4ENJA 1O7FA 3L09A 1U5TA 3F8MA 3COAC 3RH2A 1A6IA 1MGTA 4EEFG 3UKGA 2EB7A 3ANGA 3P9KA 3D1NI 3NS4A 1R4MB 1OR7A 5IP6A 1FWZA 2EQRA 4EGZA 4AF5A 2B0LA 4A2UA 2ZXJA 4ENNA 2QQ8A 3EQLF 2XVCA 1FBQA 4DVYP 1XSXA 4D7MA 4XQFA 1VQPI 2VKDA 3MKYB 4CCKA 5AQCA 5KNLA 5B1BH 3RIRA 2JZYA 1QVUA 3HSFA 2DFIA 3IHUA 4IPAA 2BVMA 3I53A 1ON2A 1IN5A 2R5ZA 3EPZA 4AVPA 3KETA 3HBLA 1QNTA 1U0JA 3A03A 3FK6A 2HR3A 2RN7A 1XTAA 4CA0A 3NWTA 1OCCH 1V5EA 4XM3A 1I1SA 3QPTA 1UHWA 4NB5A 2OU2A 2CRGA 1X2MA 1G8XA 5J40A 3TBIA 4S0HB 3S17J 2IBDA 4U87A 3E1SA 4GGGA 3U21A 3ESWB 4P5OA 2PMZA 1SANA 3JSJA 2GIZA 4XLHA 3E6BA 3ASNH 3CESA 3V8LA 4L9TA 3SYTA 2M45A 1OMIA 1XC5A 4OOIA 3FXLA 1D5VA 1HDDC 1JHFA 2EFNA 1FT9A 2CJJA 1X1PA 2L4AA 2WBMA 5LGTA 4R1HA 3D5LA 1TC3C 3C7JA 2CUZA 2L01A 3JSPA 3UNGC 1E3OC 4KT6A 2QKLB 1ZRDA 2PJRB 4CDGA 3TGNA 2GXBA 4II3A 4LLGF 4WWCA 1GDTA 3FXMA 2M4KA 1Z7LA 2HKXA 2RNJA 4AIKA 1ZG5A 1RR8C 1UHMA 2OZUA 4X6AJ 3DU5A 4HG2A 4B48A 3M7GA 4E7KA 4AIHA 4F7ZA 1ZH5A 2ESNA 2M7BA 2CQKA 3RPUD 2JN6A 2HU9A 3AG2H 1S72I 3E7QA 2E60A 3HE0A 1FPQA 1K4SA 1FIPA 2R5YA 1B8IA 5DM7F 1IZ1A 3F0CA 3H5RA 3CDLA 2NS0A 1SFKA 2XGXA 3ABTA 2X6OA 2XKOA 3CUOA 2ELJA 3GF2A 3GWZA 4A3EJ 4L62A 1XGOA 1DDNA 2PBIA 3OL3A 1A36A 4Z6YA 4E7ZA 2ZSHB 4NNJA 5A2QZ 3TW6A 2DMTA 4C3JJ 3LSKA 5FKMA 1FOYA 1MSEC 3BR2A 3GCMA 1BA5A 3VDXA 2W82A 2JRMA 3DEEA 3O6BB 3BJBA 3L2CA 3KZ9A 3BDDA 2GQQA 5CPRB 2DA4A 5CJ9A 3F22A 2R7SA 2F4MB 4L0ZB 1O3QA 4Y17A 2HQNA 3ZMSA 2EV5A 3J81K 3HSRA 3CMMA 2CYYA 1IRFA 2XPVA 3TO9A 3FKIJ 4LOCA 3I4NJ 5F64A 1F1ZA 3BR1A 1YIJI 2G9WA 3H0GJ 4BS9A 5DS9A 2NAZA 3P9IA 3R0AA 3VIBA 3JRBA 2V1NA 2KDZA 1F43A 1KU9A 4B43A 2QLZA 3HB9A 2A6HF 5EEGA 4X1EA 3QWLA 3HHHA 1WKMA 2QQBA 2KQRA 1A04A 4UB6C 4ZC3A 1YRNA 3C18A 3R6SA 1BC7C 3JRFA 4XRMA 1FP1D 5CQEA 3WG9A 5CVVA 3HTAA 4Q47A 1EKEA 4OAYA 2MC3A 1JKRC 3OOUA 1FYMA 1T38A 2FQ3A 2NVQJ 2R7TA 4NC7A 2XGCA 4M3EA 4G7HF 1BJZA 2DODA 3OR1C 2VC0A 5JR3A 1ZAOA 1LUJB 4BXXJ 1H88C 2PI0A 3GFJA 1R36A 2DW4A 3SDBA 3AG4H 3VW0A 2LOOA 1IG7A 4LD5A 3OYCA 2L0KA 2QYOA 3K0LA 1W36D 4NQWB 2COBA 1F9NA 2EV6A 3L2UA 5ICFA 2M1BA 2HNHA 5GTIC 3I71A 4AVZA 2VBYA 5J1UA 2CUJA 1XGMA 5TISC 3OYHA 3GFIA 4IKFA 1IV6A 5AIQA 3F8CA 1ETYA 1NK2P 3TP3A 1WJ5A 2NS7A 4KN4X 2IEKA 1BN5A 2OUMA 2X0LA 1OCTC 2BHYA 2LKPA 5D18A 3ECOA 1SD5A 3ZMUA 3KP6A 2Y9ZA 3F72A 3L2RA 2R93J 2HDCA 1Z3YA 1OJLA 5M5XJ 2VONA 1GXPA 1MZBA 5CXIA 2PLYA 1V3FA 2QZ8A 3FXQA 1DQUA 1VQMI 2W57A 4ZYDA 1XDSA 3P7NA 2PQ8A 3VYSB 3J7AY 4N9HA 5IP9J 2HDDA 4B1RA 1S6LA 3O3KA 2BBYA 1YQAA 3OL4A 5HDKA 3GZIA 2GIVA 3BJAA 2XSJC 3BCAA 2DLLA 3TMOA 3MEXA 5D4SA 3LA7A 3T5XA 4PJ0C 3IH3A 1MMDA 3K1PA 2VBXA 2XC7A 3S32A 1WJBA 2A69F 4G7OF 2ADUA 4FE7A 2TCTA 3FIWA 3TQNA 3ZR8X 3DEWA 1U2WA 4HOBA 2BE5F 3KEOA 4LG0A 1I6HJ 1XD7A 2PZ9A 4BACA 3EUAA 2HPIA 5IT9Z 1Z6TA 1SAUA 1RETA 2M87A 5DEQA 3MQ0A 2FMLA 2EIJH 2DT7B 3VYUB 5J4YA 1Y0NA 5CXGA 3ZMTA 2M4GA 3EUHC 3TDZC 3GX4X 2BYVE 1IV8A 1WGXA 3PM1A 1IDYA 4NUBA 5DV5A 5ERIA 3RKQA 4M71A 2XUBA 4F93B 3U1DA 5GPCA 1H0MA 1H89C 4ZH4F 2P5LC 3ZN0A 1G4DA 3E5QA 5FLMJ 1U78A 2ZNYA 4NELA 4WXCA 5L3FA 2DPUA 2Q24A 3AFHA 3HRUA 1LE8B 2W1OA 2VC1A 4UXNA 3J7ZI 1VQ5I 2W85A 1RIOH 2MD0A 1LQ1A 3R0JA 5H2FC 4YRVA 2NOJB 1Y8QB 2LBFA 5HS9A 1RKTA 1HLVA 1DU6A 3Q0WA 1T6SA 3DWLE 2R7RA 5ILVA 1W7PA 4KMUX 5L3BA 2NXNB 4BUPA 1ZGAA 2J5OA 1TNTA 2X6YA 3MN2A 2XF5A 2VUMJ 2UXIA 3TOAA 4F55A 3DKXA 3PASA 2DA5A 2LKSA 2Y48A 4ACIA 2QBYA 5E20A 1IXCA 3ZRGA 5FGLA 4PGHA 5E3LA 2HVQA 4IZZA 5LHGA 5E79C 4WXHA 4PGGA 3V42A 5J8CA 4A0YA 1J5YA 3HTUA 4I7HA 2HZDA 1T39A 4I02A 3HM5A 1KU3A 3KP7A 2L7ZA 2AQFA 3HGGA 2A07F 2CFXA 4RM3A 4HLXA 1UI6A 5D19A 2F5DA 4WF2A 2DMUA 1YITI 4L5JA 3HRMA 1JT0A 1YX5A 2Q0OA 3X2QH 4BEHA 5BPIA 4O5VA 1KYWA 4EJVA 4IQ4A 2K4JA 4LIVA 3QU6A 3FMQA 4IHTA 3OYKA 4ZDLA 2KFDA 1V4RA 1T33A 3O2PE 1ZHFA 2WV1A 2B63J 3H0DA 2VLAA 3IUOA 3DV8A 3GYHX 2QEXI 1YX3A 5CVJA 2XROA 2FBHA 4J01A 3PSIA 2ESHA 2WC2A 2IA0A 2HYJA 2PMZN 1Z0XA 3NQOA 4P9FA 4XLFA 1B6AA 4CHUA 5F6FA 3BCGA 2KRHA 3ZP5A 4UNOA 1VQLI 1IAWA 2H27A 3I3LA 3RYRA 2DG8A 2IXSA 3VVZA 2LKXA 3H5AA 3I64A 1MH3A 2NX4A 2F5CA 3ABKH 4F91B 1IXRC 2YX7A 3WTTC 3REOA 2D5VA 3AL0C 2OI8A 2NVTJ 4RM2A 4GCLA 1Y39A 1N75A 1UB9A 1U8RA 1K61A 2DYRH 3LAJA 2HOTA 2VJIA 5DM6F 5DTDA 3J80K 1FIAA 5M5YJ 3VOXA 2JA2A 1PVEA 2X85A 3RJPA 2O3FA 2ZJRF 4KNYA 3Q5FA 1W4MA 1I3QJ 3SZTA 1P6RA 1YTYA 3CUQB 2RREA 3CCUI 3FX3A 1P7JA 2L7KA 3DU6A 1S7OA 2DFFA 2HS5A 4MTDA 4O3MA 2DO7A 2H94A 4YELA 3WGIA 1IGNA 4GFLA 3S1MJ 2OA4A 5FLXK 2GXAA 2XPUA 4BQAA 5HNHA 1IF1A 3MZYA 3PFYA 5EG0A 4BQQA 2A5YB 1PUFA 1DU0A 3LWJA 4KN7X 4M3DA 3A01A 1XX5A 3DPLC 2WV0A 4XL9A 1HC8A 3RQ4A 1Z21A 1XCBA 4ETSA 4AC6A 2YVXA 3JAMZ 2JPCA 3RDIA 2DMPA 3HXLA 4BBRJ 3SZPA 2R7FA 2A2FX 3CDIA 1AHDP 2EK5A 4G6DA 2IU5A 2UXXA 1OYYA 1TQIA 2F5VA 2DA3A 3IRRA 4FISA 2IS2A 1VZ0A 3ZQQA 2CQ7A 3QAHA 5LBQA 3H3VK 1N77A 3V78A 4BY7J 2CFOA 2NP5A 3JRGA 3VW1A 2DOEA 1CF7B 4IF4A 2KZVA 1YJWI 3T1BA 2LP0A 1YW9A 4DZPA 3GO5A 3OYBA 1BR2A 3A0BC 1TT0A 3DBRB 2STTA 3M8EA 5E1WA 5J6XA 2MFZA 1SFEA 2R3SA 1Z7UA 4KJZA 2HOAA 3G1LA 2OJED 2O8XA 5HNFA 1WPKA 3F8FA 4BHBA 3BQYA 5C44J 4LK1F 2W84A 1EH6A 2DFEA 2RGVA 1D1BA 3ZQHA 2DYSH 1D8KA 3VVYA 1BW6A 4D5CA 3LSGA 3SZGA 3QYBA 3LJLA 4MIMA 1MDMB 3ON4A 2IP2A 3PNTA 3H36A 4HDVA 1WRJA 1XSVA 2BW3A 2X6WA 4Q4ZF 2LC2A 1MW7A 4HNUA 2BY3A 1ACIA 3M9AA 4RGRA 1TQMA 3F8NA 2I5UA 4M9ZA 4RAGA 1YW8A 4LB6B 2DU9A 4U7DA 3WGGA 4WK8F 4EGYA 4AC0A 4BDYA 3IAS2 3S14J 1TWAJ 5FHPA 1J0RA 2M3AA 1JE8A 2V4JC 4UY8I 1QO0D 4QWQA 2VKHA 1Y6IA 2DOAA 4E7LA 2X1DA 4HX8A 4BDZA 2OC6A 1FC3A 5FRMA 4KUMA 3DTEA 4CYDA 3K4NA 1O4XA 3O8HA 1MNDA 1R58A 1XGSA 2K9MA 2QOPA 4NN1A 4KDPA 3P5JA 2VBZA 1D0XA 5GAGJ 3HOZJ 3BJOA 3BZ6A 3WHBA 1UELB 4CZCA 1ZLKA 2YR2A 3K70D 3S16J 3HOYJ 5FLVA 4F3QA 2E1MB 1MKMA 1X1CA 2XB5A 4Q5SF 5D5UB 2ETHA 3KNWA 3UR3C 2WUIA 2DA1A 2L3DA 1LPQA 4WIBA 5KAIC 1WJFA 2MC4A 3VODA 4EJWA 1UJ8A 4P96A 4U0WA 5LEJA 2QA4I 1JI8A 1W0UA 2VT2A 4QTRA 3DQVC 1J09A 1MIJA 2J5PA 2L9VA 4OMYA 2FUG2 5CLSA 1Z77A 1B1BA 3NEUA 1MBKA 2NRAC 4GCTA 4XORA 4B8XA 4DBQA 5LD2C 4AM3A 2XV4S 3HTIA 1WJCA 2E5ZA 4W1UA 1E17A 2WGBA 1JUMA 4NC8A 4L9NA 3L2QA 3CMEI 2HQRA 1G59A 4LG3A 3FXJA 1Y56A 2DDAA 4XICA 4Y13A 4RMNA 3J7AO 3DBHB 4MLOA 4MHGA 4XLEA 2ZB9A 3CC7I 5LGUA 1SD6A 2QKMB 4EQQA 3FMSA 4R8HA 5J3LA 4KWAA 2O7OA 4RGUA 2KPMA 5IP7J 4V2FA 2GA2A 2DTRA 4HEA2 3HUGB 4I76A 4CCJA 1NG6A 5ICEA 5FGMA 4U9LA 2JVHA 3FWEA 1SAXA 3AG1H 1JGSA 1ZTRA 2R7XA 2EA4A 1SVOA 2E19A 1SD7A 4KICA 1VF9A 3CCYA 3F6VA 1VQKI 3M1EA 4HDUA 2FU4A 2UXOA 3NRVA 4A3CJ 1BI2A 3B6CA 2E1CA 2CQQA 2ZBKA 2EPFA 1FMWA 1XGNA 4EATA 3V7RA 1SVLA 2DCEA 3FK7A 5DUIA 2CGPA 1AA7A 1CGPA 3GTJJ 2W25A 2MABA 2VE9A 2NOGA 3LL7A 4A0ZA 3S1RJ 1YE9A 1B72B 2M5WA 1IRGA 3L1PA 5JI6A 1JUSA 4GCVA 4IHVA 2B7EA 3BTIA 3ROUA 1X3WB 2XDVA 2ZXHA 3KLNA 5HDNA 3BR0A 2M8GX 1LKXA 1TP4A 2JA8J 3QOEA 4D5FA 1OCZH 5M5WJ 1GUUA 2VBWA 4LLLA 3ZMDA 1DP7P 3V6GA 3GVAA 3T6NA 5GPAA 4A3IJ 3G7RA 1B4AA 1KYZA 1U6GA 2GZWA 1YI2I 4YFXF 5HLTA 3L2VA 2Q2EA 5D1RA 2BV6A 3CQZJ 5EEAA 2L02A 4KFCA 1ZGJA 2O61A 3SXYA 1KU7A 4GFKA 4FQGA 1NK3P 1GV2A 2X48A 4FTHA 1KA8A 5D5WB 4QIWN 2XHKA 3RPQA 2X4HA 1HKTA 1FY7A 3W6KB 3MKZA 2KISA 1QQIA 2FOWA 2JSPA 2H8RA 3TKYA 4YEJA 1DP3A 2KIFA 4N4OB 5F08A 1XCVA 3O60A 5HS8A 3W2VA 2JJ7A 4R79A 2E1NA 3KZYA 3EUHA 1R4NB 1GHCA 2O6GE 1R5HA 3OS1A 1UAAA 2MA3A 2DTZA 3OYJA 1FP2A 2WAEA 2V9VA 2CV0A 3G4SI 4DGWB 4YIRX 2LK2A 2XIGA 4IRGA 1BW5A 4L18B 1A31A 4G9YA 3TO7A 2EIMH 5HOOA 1ZG1A 2IGNA 2QQAA 2YSRA 3LA2A 3ZQFA 5F27A 2VPRA 2YX4A 3JTGA 1J9IA 3LSHA 3K1NA 3F21A 2MLKA 4TV7A 4A93J 3K7AJ 1X19A 1IC8A 4PSXA 3CZ6A 5IYDJ 1S7AA 2NP3A 3WU2C 5H6QA 2GM4A 3RQIA 2MH2A 3I55I 2HOEA 1I50J 2HI3A 5FROA 3QPHA 2LF8A 3WTXC 1BR1A 4WXDA 1NHAA 2ISZA 4U9NA 5A2QK 2JK3A 2GXGA 3DCFA 2STWA 3MCZA 2LMDA 1GT0C 3Q9VA 3VFZA 3GZNB 1ZG3A 3HTJA 4D0PA 2Z5UA 4EM0B 4JX4A 2EA2A 5H6RA 3VEPA 2ZOZA 1JKOC 2F5FA 1RRJA 3RSNA 1JJ8C 4NHJA 1N78A 1S5LC 1KU2A 1VI0A 3KKCA 3MD2A 1ZYRF 1LEBA 4A5NA 4AU7A 3ONQA 1WWXA 1OLTA 3HRTA 2R0QC 4BQNA 2E34A 2JUCA 4C2MJ 5L3GA 1X3ZB 3ERMA 1YG2A 4G6TB 2DDBA 3KYCB 2X51A 4LLNA 2CW7A 3B73A 3HEFA 4RS8A 4XRSA 2QSGX 1AKHB 2VKEA 1IW7F 4HQEA 2FX0A 4XBFA 3D5SC 3S3OA 4L9VA 1V55H 4CYCB 1T56A 4QPOA 3H3ZA 1SFOJ 2V6EA 1SMTA 4A12A 4KYWA 1LDDA 3GFLA 4EM2A 1SFUA 4B09A 2KDOA 4M6XA 3VSKA 4A5MA 1YFHA 4HSTA 4NDLA 2HKUA 1L3LA 1ENHA 1I6XA 4G12A 2X1EA 1Z9CA 3IC7A 3CF5F 5LHIA 1B9NA 5B3SH 4P1WA 3TW7A 1IN7A 3MZHA 1W36C 3KP4A 4G8XA 3JRHA 4YFKF 1TL8A 2VJJA 2LVSA 4OIRF 3DKYA 1VQ7I 2QQ9A 5DCMA 4U0YA 3A1YA 4I99C 1Q1VA 2E71A 3FF5A 4E7JA 2FOKA 1CQTA 4PXIA 1G3SA 3ZMZA 2WY8Q 2EFQA 3CRJA 4RLFA 3WTWC 2IS1A 4IL6C 1OQYA 4LFUA 2M2EA 2K7LA 4I6ZA 2I8DA 1H9GA 4M9XA 2IW5A 1UFMA 3WTVC 1TNSA 3IWFA 4ESBA 4HBLA 5D5XB 1DPUA 2V7FA 3Q3SA 4ZDPA 3JCUC 2Y0SA 1DGRM 1LEAA 2Z2SB 1O57A 3NAUA 1K6YA 4XSZF 5J1YA 2KKOA 1U5TB 3R4KA 5C4YA 1LFBA 1U9OA 2L2OA 3GTGJ 1BOAA 2RVCA 3CDHA 2L5QA 3S93A 4ZTJA 1IJWC 2WA0A 3H35A 4Y33A 5IY5H 2EZHA 4E7IA 2DMNA 1TQPA 5CVIA 3V4GA 1LDJA 1BM9A 3GLXA 3HIMA 3TL4X 2OTLI 1BR4A 1Z1DA 2CG4A 2FMYA 1W5SA 3LFKA 4BAYA 4B47A 1DGWY 3GXOA 4ZZDA 1F4KA 1ZRFA 3HPHA 5FD5A 3CO7C 3JW4A 3CJRB 1TT5B 1J7KA 1WHUA 4JKZA 2V79A 2FJ1A 2E7XA 2K85A 3N97A 5IT9K 2ZCNA 4YIIA 3K10A 4F92B 3RKYA 2DK5A 4UVCA 1RZ4A 3HRSA 2R5ZB 3Q9SA 5HS7A 2OERA 1SMYF 1R7JA 2P0WA 2GWRA 3BCBA 3G6EI 3F1BA 5HLHA 5FB2A 3ZQCA 3KKDA 2Y75A 2ZFWA 2PMHA 3VYRB 4B3AA 1MJBA 2IPQX 2OZ6A 4XOTA 2GLOA 1FMVA 2EZIA 1R6RA 2O0YA 4XKBA 3I56I 3HOTA 1QPIA 2L9NA 1PP8F 3GTOJ 3BG9A 2VOOA 4GRIA 3HC7A 3I5UA 3ZOBA 3G71I 2KIQA 4JP0A 4XKVA 2LLKA 3KIOA 2ZMEC 1X1AA 1BIBA 1Z6RA 3E6CC 1X3UA 1UG0A 4ESJA 5D4RA 3O8GA 5F0FA 1OYWA 1VQ9I 3DLAA 2Y69H 2ACJA 2RKHA 2K9NA 4I09A 5FMPA 2ISYA 2VN2A 2X1CA 2UXHA 1HBXG 3Q0VA 4AIJA 2VQCA 4JNNA 1W5TA 2RV8A 3IP4B 4PDKA 4RGXA 4BKXA 5EF6A 2HVSA 3PFIA 1BI0A 2NVYJ 3PNVA 4P9UA 4LB5A 5E1ZB 2XAUA 2EFOA 4IHSA 1FZPB 4IHXA 1Y1VJ 1P2FA 1FOKA 2JQ7A 2HPMA 2K86A 5BQTA 2QVOA 4Q48A 2W48A 2XRNA 5HLIA 1YW7A 5IYBJ 1JKPC 1XN7A 2R5YB 1IXSB 2IA1A 4LITA 3W6JB 4UUSA 1B8IB 3HPGA 1WCMJ 3PIOF 4IEJA 4HYEA 2K5CA 3CD6I 3GTQJ 3RCOA 2PFBA 5L3CA 3C07A 3W2AA 4CCNA 1P9QC 1BBYA 5JLXA 1ZGWA 1LB2A 3ZN1A 3BR3A 1IDZA 1YHQI 2MG4A 4ICHA 1D1CA 5E8GA 1W1WE 2P5VA 2D1HA 3FM5A 2IGOA 2L7MP 4LK0F 5GP9A 1XS9A 2AXLA 1ETKA 3M8FA 4M3GA 3L9FA 1S9HA 1TZLA 3NWSA 4EVIA 2K4BA 3WG7H 2FE3A 2X9DA 3OSFA 1MBGA 2VXDA 4HV6A 1KQ8A 1YS6A 2XAGA 4AUXA 4Y4RA 4UB8C 5LHHA 3FRQA 3FXOA 2REKA 1YYVA 3QYFA 4HAMA 4ITVA 3JSOA 2BY0A 2GUHA 4C2MA 2HVRA 3CMAI 2K9QA 2V9PA 5K1YA 1T95A 2D1VA 1YRNB 2ZC2A 2FNAA 5BOXA 1YJ9I 3RTRA 1RC9A 3OS2A 4II2A 1VNDA 4M72A 2NNNA 2RC4A 2E35A 3HJEA 4BQOA 1BJAA 2P81A 4RA2A 2B1EA 1FLIA 3PL8A 5F04A 5D8LB 4DQ2A 4A3JJ 3HTSB 1R71A 2PJPA 1MBEA 4HF2A 3VSLA 3A2KA 3E0JB 3FM3A 4RAFA 3V8JA 4GFBA 3HSEA 2M9HA 3LQQA 1R22A 2IRFG 3BG7A 5DAJA 1K4TA 3JRAA 1MJAA 5E3NA 5FKKA 1TWGJ 2ZXWH 3ASOH 1I1GA 1ZARA 4FE4A 2NVXJ 4XRSG 2LD5A 3ZQIA 2V26A 2DMQA 2ID3A 1K78A 3BQZA 2HYTA 1MMNA 2UUZA 5E3MA 4YG2F 2N8GA 1Z91A 1SEUA 2ZKZA 4MNUA 4OINF 1OCOH 2A6EF 2OQGA 5JHFA 3G73A 2R7WA 3PJRA 4JK1X 3AAFA 2QCOA 4ZDOA 5FKNA 4G94A 1FSEA 3NNRA 4HSRA 5J8FA 3HOXJ 4F52A 4ENKA 5CYVA 1OFCX 2HQAA 4PZJA 2EV0A 3LFUA 3N05A 3W2WA 2O03A 2K3PA 1JT6A 4L0YB 2G7UA 5K7HA 2QTQA 4HNTA 1YOVB 3K4CA 2HFHA 3KPHA 4MQVA 3CTAA 3ZQGA 3W6VA 5LLQA 5IT3A 1P7IA 5E3OA 3VWBA 3QPLA 4HX4A 2VJ4A 3I59A 3P9TA 2V6CA 1VQ4I 4GYGA 4KIBA 3DTIA 2XAHA 3HTHA 5DDGA 1X4OA 2ZJQF 1S7EA 2O7TA 5EFYA 1MMAA 4LG0B 3CUQC 4RB2C 2VJ5A 4AD9A 3KYDB 2G3BA 4CICA 4A6EA 2P5KA 5KCMA 4A3BJ 2HKOA 2LF7A 4C3IJ 2AS5F 2LYCA 1EF4A 2HDWA 1B59A 3VOEA 1R1UA 2VQGA 2WTEA 4MGRA 2DBBA 3EUKL 4HKUA 4HNVA 3SEZA 1H8AC 4M73A 3SJMA 5KVRA 1D8JA 4XKWA 5H20A 2G7HA 1IN6A 4FT8A 1A6QA 3V7CA 2QIBA 5IPAA 3FISA 1P92A 3H9QA 1WZ2A 2EJRA 2DN0A 2WAFA 4B44A 1ERDA 5EJCA 3K9TA 2IJLA 2JRTA 2M8EA 4XK4A 3BP8A 2LNBA 3MKLA 1TWCJ 4N4NB 1USTA 2HQ5A 3BPVA 1TW2A 2KL4A 3QRFF 1J75A 5K7FA 2LBFB 3QP5A 3KP2A 3RPUA 1FTZA 2XRLA 2BHZA 1WH7A 4XKCA 1XSDA 1W7PB 3S8PA 2V1XA 1FYKA 3WTZA 1JHHA 2R7QA 3ZGKA 5K5QA 4UUSB 2L7FP 2Y0SN 1T0FC 2V1DA 1K6OA 2B3WA 4NBQA 4V2GA 1WQ2A 4PJLA 3EETA 5CQGA 3GBGA 2QBYB 3CP8A 3E3VA 2Y0MA 2HGCA 4N9IA 5J1RA 3K70C 3H1CA 3GZ6A 3CF2A 4G6QA 4GXOA 3JRCA 3CWRA 2KIMA 4P55A 1OCRH 2JT1A 1QGPA 2GAUA 3WE3A 3WU1B 1I39A 2GOXB 1W0TA 2EILH 4EV0A 1WI9A 3HGYA 3SDGA 1G3WA 3MKWB 3FHNA 1J59A 1BI3A 2PG4A 4XLCA 4MQ9F 5DCFA 4BHPA 1AOYA 1P4AA 1Y8RB 4JX6A 2XPWA 3WE2A 2EWNA 2ZCWA 4M6YA 1H9TA 1OCPA 2W4SA 4BEHB 3SFZA 1K79A 1RR7A 1R9TJ 2DQRA 2OTJI 3OIPA 1QHGA 4IHYA 2XASA 4XNFA 2PJRA 4M3FA 1VQ6I 4OD4A 2VASA 3PSFA 5F1RA 1FYLA 5LGNA 3OYGA 2Y2ZA 2DXIA 3R61A 1HKQA 2NNYA 1VQNI 3FXKA 3CLOA 4PJNA 2Z99A 2ZY9A 4HZFA 3DPTA 3OIQA 4GDFA 4HF1A 4A69C 4C3HJ 3FXUA 3BTLA 4H0EA 1BIAA 3I0TA 3K8PC 1ETXA 5AIPA 5HBUA 4HX7A 1O3RA 1MD0A 4E4HA 4CZZA 2P8TA 3HZJA 1UMQA 3OYNA 4PCQA 2IGMA 2H6BA 5JVTA 4XLNF 3TO6A 1IRZA 2XGDA 3CCSI 2E2IJ 1Z67A 1HW1A 3A4CA 4X0GA 1ZQ3P 1BC8C 3WGHA 4PFPA 2E1MC 2DFHA 4C2TA 1IN8A 2DA7A 2LDUA 2R7DA 1NH3A 4UDSA 2KJBA 1GXQA 4Y7NJ 4UVAA 3BZCA 4RAYA 2EINH 3EYYA 4JYKA 2NS8A 4RBOA 1U9NA 1FOWA 1LFUP 1K78B 5HAWA 2YU9J 3BY6A 1S3JA 2KIUA 2VT3A 1KONA 2MSYA 2MYSA 3KX2A 2P6SA 2OBPA 2G7LA 3GTLJ 1G3YA 5BS6A 4EJTA 5LRSA 3N4MA 1USSA 4IOCF 1RESA 2IS4A 1E3PA 3QU3A 2HTJA 2LR8A 1IRXA 1UHSA 3C2GA 4EJUA 1M1EB 4BJ5C 3MAJA 3PNYA 4C9YA 5IOZA 3DLLF 2XF6A 5FJ8J 4KA4A 2PN6A 4IVNA 5EG0B 4KMFA 1HOMA 1PUFB 2PBXA 4XRFA 3DPJA 5CW8A 3NXCA 4A0XA 2DT5A 2ICWG 5EEHA 4ZTFA 2Y30A 4U88A 4QLCU 3A01B 1HDPA 2RQQA 2L54A 4JBAA 5E1XA 3ZQLA 2OD5A 2KRCA 4GYIA 2R7OA 1PUEE 3PO3J 1HA8A 1NTCA 2BXZA 2E2HJ 4NQWA 3VW2A 4J19A 2JA7J 4IRHA 2M30A 2XAQA 3PPBA 5GAEJ 3OYMA 1MH4A 1RNLA 4ON0A 2BY2A 4XLAA 4XOPA 3AQSA 1AWCA 3ON2A 5GAHJ 3IH4A 2CH0A 2MGQA 3CLQA 3GLLA 2QF7A 3KEYA 4UV9A 1MSFC 3MNLA 2TRTA 3K2ZA 2VQHA 3BOQA 4XIDA 3DKWA 1JKQC 4OIOF 2YU3A 3OYFA 2LH9A 3HOSA 1JTXA 2LY2A 4A3KJ 4BH9A 2PX9A 3ZQ7A 3PQJA 5LEKA 3QP6A 2BZTA 3IRQA 1Z3XA 2JUGA 3MMYB 5E17F 2YVHA 2XKPA 2ZMEA 5EZGA 3LSMA 4PJMA 2BW3B 4RB3C 1FBSA 1ZELA 4DOZA 3FMRA 2OF7A 2VKVA 6PAXA 1BL0A 3CC4I 3DPUA 3EYIA 5ICGA 2HXOA 3HYIA 4EJOA 1FOXA 1FNNA 2HYGD 2XAFA 3DBLB 2OCCH 3M4OJ 2KP6A 2LY1A 3V7SA 1P4XA 1MMSA 3L00A 1EH8A 3COLA 3CCQI 4OIQF 5HLGA 1FBUA 2QSFX 1MBHA 2IA2A 4M3BA 3HOVJ 4LIUA 3T8RA 1N25A 5K5RA 2CV2A 3T8TA 1D1AA 1XMKA 3ZXSA 4CGRA 3CMYA 1HSJA 4XSXF 4ZYHA 2MD5A 3Q0UA 3GEUA 4A3GJ 2PEXA 2Q8KA 1MMGA 2H09A 1QZEA 2MLGA 3IH2A 4OIPF 1SFXA 5IYCJ 3K4JA 3LSIA 1JJ6C 1ZN2A 2V9KA 1UZCA 1X4PA 2KHMA 3WTYC 2YPRA 1F36A 2RNGA 5F0CA 1R23A 3K4MA 5ED4A 1LE8A 2Z9OA 4NC6A 4I0BA 1RKWA 5LFAA 2D45A 2JWTA 3PUFA 2NYXA 1LNWA 3CJQB 5EGOA 2ZCMA 3JR9A 2NVUB 4BGDA 3HG9A 5BMZA 4AIDA 2VB6A 3K4BA 3BLYA 2FJI1 3K69A 1ETOA 1Y1WJ 2BGCA 4OU0A 3VP5A 3A0HC 3IWZA 2ELHA 4UUVA 5K7ZA 3H9GA 1YO5C 4ESFA 1V5GA 3C3WA 2WB1A 3GUDA 5FFXA 1ODDA 1R1TA 4IX7A 3C2HA 4I0AA 4AYBA 1WFXA 3I4PA 2FF4A 1STZA 3KEQA 1KGSA 4M9SA 3QKXA 2ZNZA 4MTEA 5L3DA 3BG6A 2VI6A 2G0EA 3F6OA 2ZO4A 5BPDA 2DG7A 5FRNA 1MBFA 1JTYA 3CCMI 2IS6A 3I54A 5D8KB 2GOMA 3JREA 4S05A 1HXDA 2RQPA 4A3DJ 2Z33A 1XPXA 3EUPA 2FSWA 3NRGA 3FBNB 4UVBA 4CO8A 4ABZA 3SHFA 2YUSA 4PFOA 4KITB 3J7YJ 2DA6A 2LREA 4ZZLA 2D6YA 4HPQA 2FXAA 3EDPA 2D2WA 4XR6A 1VQOI 4ASNA 2EFPA 3BR6A 2P7VB 2CWEA 1X1DA 5GTHC 3J81Z 4D9JA 2IVMA 5CKTA 4BE2A 1UG2A 1ETWA 4ME9A 1G3TA 2CSOA 2M34A 3EGQA 3CC2I 4RB0A 2E7WA 2Y31A 5JVGF 1O7LA 4LJZF 3RZOJ 4IRVA 3TOBA 2ZJ2A 1TW3A 4DYCA 1WJAA 3VTIA 2QM3A 3JRDA 4RLQA 3DP7A 1APLC 3S3MA 2A61A 2QWTA 4DYQA 2MBFA 4FX4A 4XONA 3ANPA 1D3YA 4E70A 1D5YA 2KT0A 4E6KG 3LQRA 5E18F 3BR5A 4IXAA 2R7UA 4B3XA 4YIFA 5JHUA 2CMPA 3AG3H 3M1CA 1HSTA 5KAFC 3QBMA 4ZJZA 2VE8A 4KIGA 2Q2EB 2RASA 1XB4A 3GW2A 4BBSJ 2CUFA 2R7ZJ 2ZCXA 1HKSA 3HOWJ 4YFNF 3NI7A 1J2XA 3VB2A 2A6TA 4MEXF 1GVJA 4CH7A 1HW5A 1LVAA 2AO9A 3LAPA 2QUFA 3CUQA 3HKZA 2JA5J 3FKJA 1JUPA 2HXIA 4BHCA 4WCGA 1FJLA 1QU3A 1ITYA 1VQ8I 1K83J 2Q1ZB 3AQTA 2P4WA 4H4KC 1KQ0A 1I27A 2E1OA 3OR2C 4KISA 3C2BA 4BJ6C 1T8IA 1Q1HA 3HOUJ 5D5VB 2UXPA 4E7SA 3QOPA 2KRFA 1U5TC 2DJIA 3RZDJ 2UZKA 2EZKA 3L7WA 2ELKA 1JGGA 2ZMEB 4GO1A 5CVUA 4W97A 5TRDA 2ZXIA 3WTSC 3FHZA 1R5GA 3JRIA 3KYLA 5M3FJ 1OR7C 3MZ8A 2BXYA 3OYLA 1TLHB 2CQXA 3K6GA 3B81A 2PFVA 1OPCA 2ECCA 2VOPA 3BHQA 2VIXA 1D0ZA 1GVDA 2LSOA 4IHWA 3DTKA 1WJDA 4C2UA 2Y9YA 1HQCA 4A3LJ 1IUFA 5EYRA 4MFDA 1DPRA 2BY1A 4PJJA 1QA6A 1C0WA 2G7GA 2HWVA 1R5ID 3BT9A 1QVTA 1RUOA 1TBXA 4IJAA 1T0FA 4PUSA 4RGSA 3WHCA 1REPC 5HODA 1I3AA 4I01A 3G2BA 3AKZA 1V54H 4KT5C 5C3EJ 1CF7A 1G2HA 1LVKA 1QHHD 4DIQA 1A5JA 3G1MA 1S8NA 2F2EA 2UV1A 3VOKA 3F3XA 3S15J 1U8BA 5B66C 1SC7A 1ORKA 3CJTB 3ABUA 4XN0A 5FD6A 2L9SA 3KCCA 3VYTB 4CCLA 2M7AA 2FBQA 5FKOA 1O3SA 5FKLA 3PIPF 1ONVA 2V57A 2EIKH 4DYRA 1TWHJ 5EGOB 2R7VA 3BWGA 5JLWA 3GMEA 3FZVA 1WSUA 1MDMA 3PQKA 3CCLI 2LFBA 2DI3A 4L5EA 5FFZA 3P9CA 3VVXA 1Y0UA 1QZZA 2CU7A 2EFWA 4AWXB 4FX0A 3KFWX 5HDGA 3BPXA 2VQLA 4WX9A 1SVMA 2FNPA 4ANJA 5GADJ 4ZYGA 3LNQA 3OYAA 4PSWA 2M0CA 2H6CA 3ERED 1VTNC 2CQNA 4RDUA 5K58A 2VPLA 1ZK8A 1YLFA 1HW2A 1DUXC 1PDNC 2IGKA 4FASD 2HYFA 3RKXA 2K02A 2AQEA 1MJ9A 2AHQA 2Z1DA 3TP0A 2F5EA 2GENA 3D0SA 1MNEA 5ILUA 4M74A 5H9TA 1T08B 2KZGA 2MW8A 5HVQC 4U7BA 3F8BA 1XDUA 2AXTC 3SQNA 3G1OA 1RUNA 2WY7Q 3MFKA 3DF8A 2RHAA 3RKWA 4BXFA 1YIOA 4HF0A 2P7CB 2WAQA 3AL0B 2LTPA 2ID6A 1A35A 4K2EA 4IOAF 2L4MA 2ZOYA 5F1JA 3PO2J 3KZIC 3LSPA 1U3EM 3BROA 2B9SA 4HLYA 4BL0B 2F6CA 2W7NA 3E5UA 3C1DA 5DCMB 5TJJA 2UXNA 3I58A 2C6YA 2OQRA 3VPRA 4HRIA 4BXUA 3LSTA 5F0HA 3H5NA 1MNMC 3JTHA 3HDDA 1FSHA 4FETA 5B5EC 4XMYA 2A05A 3HHGA 4BU2A 1UCRA 2JPBA 4CCOA 1TTYA 2JMWA 2JTVA 3BJ6A 3HIFA 2CS3A 3V8KA 2VODA 1ETQA 1X1BA 4DJAA 3M07A 1OISA 4HQMA 1VFCA 4L5IA 3GEZA 3LHQA 4A3FJ 3ULQB 2X6XA 3ELKA 2CUEA 4CXFA 3PUBA 2DA2A 5TGTA 4I2OA 1S29A 3B02A 3HL2A 2KJCA 1YS7A 1X58A 2LG4A 3F9KA 4EMSA 2BVLA 2FRHA 3S3NA 5C4XJ 3OYIA 3QQAA 2DPDA 3A02A 4OD5A 4A6DA 5ICCA 2UXUA 3F23A 3DFGA 2P6TA 3HUGA 2FD5A 1LFPA 3E7LA 5KHDA 1RPWA 4EM1A 3JAMK 4RB1A 4UUTA 5J4VA 1WH5A 1R1VA 3CCRI 3LA3A 4M6VA 3RI4A 1F5TA 4RAZA 3H3UA 3IAM2 4BE1A 3CCEI 5LRRA 2O8KA 5ILSA 4JOMA 1PJRA 2LRDA 3M8JA 2WB1N 3R60A 3J80Z 1UI5A 1BOBA 3IKVA 3OSGA 2OCEA 2DAOA 1EA3A 2DJNA 3S2DJ 1EV7A 4QSHA 4AYBN 4A3MJ 2M0MA 2JSCA 2E36A 3GTKJ 1IO2A 3BTJA 3U9GA 2H1KA 2IAIA 5EZHA 4ZYAA 1B72A 2L9RA 3H92A 3ZPLA 2W53A 4ENMA 3LWFA 4IO9F 3K2AA 3KLOA 2A68F 4CUGA 3MVPA 3QPSA 3FDYA 4MO7A 1G6NA 2OPTA 3GZ5A 3BTCA 4LGWA 2MH9A 4CGZA 5E8IA 4BNCA 5DUKA 3CCVI 3GTMJ 4B4CA 2E2JJ 4UHTA 2JA6J 5FLXZ 3IKTA 3OYDA 3FBIB 4KIFA 4BY1J 5BNGA 2DT6A 3OV8A 4JL3A 1PYVA 2DOFA 2H8WA 3K4LA 2BOLA 4MEYF 4OAZA 1OYIA 4MFEA 2RDPA 3SWHA 4V19K 2WADA 2YVEA 2K9SA 5FO5A 2FQ4A 3BG5A 1LDKB 3I9V2 5B1AH 2ZJPF 3G56A 4CCMA 2HTSA 3E97A 9ANTA 3B6AA 1TWFJ 3T0YA 2KMUA 4N0BA 1ON1A 1EJ9A 4Y3OA 1R00A 3GFMA 4CSWA 1FX7A 1EH7A 1NG7A 5M3MJ 5C4JJ 3L2WA 2CW0F 4JQFA 1ZR4A 3QYEA 3ZCOA 4O6JA 5CVRA 1FTTA 2K27A 2JVGA 2GFNA 1ZR2A 2OV7A 3NPIA 5IOYA 1E3HA 2Z3YA 3CJDA 2BEOA 4DNCA 2XSDC 4U0VA 4Y52J 2OAZA 3E5XA 1GV5A 4QPQA 2ZFUA 4OMZA 4XN3A 2F4IA 3U1KA 3ZMVA 3IV5A 1YJNI 2R92J 2ME6A 1XMXA 2XAJA 4DBRA 4IRIA 3BZKA 2R4GA 2K9LA 1AU7A 2HEOA 2YS9A 2G7SA 1ZKGA 2EBIA 1E0EA 1T98A 3OOPA 3CJNA 3DXJF 5DYMA 2W00A 3HKZN 3S1NJ 3OYEA 3CP2A 2XDNA 4J00A 4Z2YA 3OS0A 4Y15A 3TDUC 1XG1A 1W5CC 1HCRA 1ZLJA 3SEQA 1E2XA 2I10A 4D1QA 2UWMA 2XGEA 4JX5A 3BNIA 4BE0A 2QENA 3RYPA 3TEDA 3LMMA 2DQLA 3K1MA 4HA8A 3W3CA 2E5NA 1PP7U 3KZZA 1ZREA 3E6MA 3WU0A 3LSJA 3BC8A 2H1LA 4BYYA 1V5FA 1OKRA 3ABMH 3NARA 2CW8A 5D6FA 1W7PD 3WTUC 1XMAA 1K7AA 2W24A 1R49A 4HW0A 4C30A 4YZEA 2HZTA 1KQ9A 2KLOA 1QBJA 3S1QJ 1WVRA 2F4OB 3LOCA 5K5OA 3M3YJ 2TDXA 2EH3A 2QGUA 3ML6A 2ME0A 3RD3A 1ULYA 2XB0X 1WI3A 2PMUA 3VUQA 3IUVA 3DEUA 1GLNA 3KP5A 4I98B 3BRUA 1D0YA 5DD8A 2O9LA 1JXSA 2GBYA 2VL8A 4UV8A 5D6EA 4D7NA 4E7HA 3H9JA 1AKHA 4LMYA 4DW6A 3S2HJ 3D5RC 3GTPJ 5KK1A 2Z16A 2VXZA 2GA1A 3FXRA 1ETVA 2A5WA 4FHTA 4CYCA 3WODF 1O3TA 1FEXA 1B9MA 2EZLA 3IL2A 1BI1A 5JFRA 1KZHA 4IQJA 4FCYA 2DK8A 5AONA 2QKOA 1RI7A 2F48A 2HOSA 2ECBA 1POGA 1I5ZA 3KE2A 1P4WA 5HSZA 1ZRCA 1L0OC 3OWTA 1QZYA 2IT0A 3OIOA 3LSRA 4GCKA 3OY9A 4L9JA 3CCJI 2CV1A 3QODA 3OMYA 2F07A 1SD4A 3SFIA 3ISPA 1IUYA 3KP3A 1X2NA 3I4MJ 3S5RA 3BG3A 3K4KA 2K40A 5L3EA 1QPMA 1Z05A 1MBJA 1WJEA 4S04A 1HF0A 2O5RA 1T2KA 4ZYEA 4G7ZF 2ZSIB 2FBKA 5J47A 3S2WA 4XLPF 3CO6C 3I59B 4BJTA 3ABLH 2RAEA 2XF7A 2FA5A 4OWRB 3ECHA 5EDNA 2WWYA 2COMA 2FEZA 2QWWA 2LY9A
chains in the Genus database with same CATH topology
1IDZA 2MG4A 4ICHA 2DA6A 4MK6A 2HOAA 3G1LA 2D6YA 4MXMA 1WPKA 2L7MP 5C44J 3BQYA 5GP9A 1XS9A 3BR6A 1ETKA 4M3GA 1QRYA 3ZQHA 3VVYA 2WAQN 1BW6A 4D5CA 1SGMA 3LSGA 4DZJA 1UG2A 4MIMA 3LJLA 2X9DA 1ETWA 3OSFA 3ON4A 4ME9A 1MBGA 3RH2A 1A6IA 2M34A 4EEFG 3EGQA 3UKGA 2Y31A 3RZOJ 4AUXA 3ANGA 3D1NI 3FRQA 4DYCA 3JRDA 2REKA 2GUHA 5IP6A 2EQRA 1APLC 4AF5A 2K9QA 2QWTA 4DYQA 1YRNB 3ANPA 4AC0A 3S14J 1D5YA 1TWAJ 2KT0A 5FHPA 3BR5A 1VNDA 4D7MA 3QBMA 5AQCA 2P81A 1QVUA 1O4XA 5F04A 2RASA 3O8HA 4BBSJ 2CUFA 4A3JJ 4NN1A 2R7ZJ 1MBEA 2QOPA 2R5ZA 2ZCXA 3HOWJ 3HBLA 3HOZJ 3NI7A 3A03A 3FK6A 3WHBA 4GFBA 2M9HA 3S16J 5DAJA 3HOYJ 2AO9A 5FLVA 3JRAA 2CRGA 1X2MA 5FKKA 4S0HB 1TWGJ 2XB5A 5E3NA 3S17J 2IBDA 2JA5J 1JUPA 2HXIA 1FJLA 1ITYA 4FE4A 3KNWA 1K83J 2NVXJ 2WUIA 1SANA 2DA1A 3AQTA 3JSJA 4XRSG 2LD5A 3ZQIA 2E1OA 2DMQA 2ID3A 3C2BA 3BQZA 1XC5A 3HOUJ 2HYTA 2UXPA 5E3MA 1HDDC 1W0UA 4QTRA 2N8GA 3RZDJ 2CJJA 2EZKA 1Z77A 2ELKA 1JGGA 1MBKA 4W97A 1TC3C 4GCTA 1E3OC 3JRIA 3HTIA 5M3FJ 2QCOA 4W1UA 2WGBA 1JUMA 2CQXA 1GDTA 3B81A 5FKNA 2ECCA 4X6AJ 3BHQA 3NNRA 4XICA 3HOXJ 1GVDA 1OFCX 4IHWA 4MLOA 2JN6A 2Y9YA 2ZB9A 4A3LJ 1IUFA 1JT6A 3E7QA 3HE0A 5K7HA 5EYRA 4MFDA 2G7GA 2QTQA 1FIPA 5J3LA 4KWAA 2R5YA 1B8IA 2O7OA 3BT9A 1QVTA 3F0CA 3CDLA 4V2FA 5IP7J 3WHCA 2X6OA 5HODA 3ZQGA 4A3EJ 4I76A 3W6VA 4L62A 5E3OA 1P7IA 5C3EJ 1G2HA 3QPLA 1A5JA 3G1MA 3P9TA 3TW6A 3VOKA 1ZTRA 3HTHA 2DMTA 3S15J 2E19A 4C3JJ 5FKMA 1U8BA 1MSEC 3BR2A 1S7EA 2O7TA 5EFYA 1VF9A 3CCYA 1ORKA 1BA5A 2UXOA 2G3BA 3KZ9A 4A3CJ 3BJBA 4A3BJ 2FBQA 3B6CA 2CQQA 5FKOA 4C3IJ 5FKLA 2DA4A 2V57A 1EF4A 4DYRA 3FK7A 4HKUA 4HNVA 1H8AC 1TWHJ 5EGOB 3GTJJ 3SJMA 5JLWA 2XPVA 2NOGA 3FKIJ 4LOCA 3S1RJ 3I4NJ 2LFBA 3BR1A 2QIBA 3H0GJ 5DS9A 5IPAA 4L5EA 1B72B 3FISA 3VIBA 3VVXA 3L1PA 3JRBA 2CU7A 1JUSA 2KDZA 2DN0A 1F43A 4IHVA 3BTIA 3HB9A 3BR0A 2M8GX 4XK4A 4X1EA 2JA8J 3MKLA 1TWCJ 4D5FA 1YRNA 3LNQA 5M5WJ 1GUUA 2HQ5A 3JRFA 4XRMA 2M0CA 5K7FA 3HTAA 3V6GA 1FTZA 4RDUA 2XRLA 1JKRC 3T6NA 1WH7A 5K58A 3OOUA 1ZK8A 5GPAA 2NVQJ 4A3IJ 3G7RA 2XGCA 2AHQA 4M3EA 3TP0A 2GENA 1BJZA 4UUSB 5D1RA 2L7FP 2Y0SN 3CQZJ 5EEAA 4V2GA 5H9TA 4BXXJ 2MW8A 1H88C 3GBGA 3G1OA 4GFKA 2RHAA 1NK3P 1GV2A 2X48A 4FTHA 3VW0A 5J1RA 1IG7A 4QIWN 3JRCA 2L0KA 3CWRA 2ID6A 2LTPA 2COBA 2H8RA 2ZOYA 5F08A 5F1JA 3PO2J 1W0TA 3LSPA 3O60A 3HGYA 5J1UA 3SDGA 1IV6A 2JJ7A 1ETYA 1NK2P 3TP3A 3VPRA 5F0HA 2NS7A 2IEKA 1MNMC 1OCTC 3HDDA 4JX6A 2XPWA 5D18A 2DTZA 1OCPA 1RR7A 2Y9ZA 1R9TJ 2R93J 2JMWA 1OJLA 5M5XJ 4IHYA 1ETQA 2LK2A 4M3FA 1VFCA 1BW5A 5CXIA 2Y2ZA 3LHQA 4A3FJ 2CUEA 2DA2A 3ZQFA 5F27A 2VPRA 5IP9J 2HDDA 4B1RA 4A69C 4C3HJ 1X58A 4A93J 3GZIA 3BTLA 3K7AJ 5C4XJ 3QQAA 1IC8A 1ETXA 5HBUA 3A02A 5IYDJ 2NP3A 2GM4A 2UXUA 3RQIA 1I50J 2HI3A 1UMQA 3IH3A 2FD5A 3E7LA 1RPWA 1IRZA 2XGDA 4UUTA 1WH5A 2E2IJ 4FE7A 2TCTA 3FIWA 1ZQ3P 2JK3A 3DEWA 4M6VA 3DCFA 2DA7A 1I6HJ 4UDSA 2PZ9A 4Y7NJ 2O8KA 1GT0C 1RETA 2WB1N 1UI5A 4JYKA 2NS8A 4RBOA 3OSGA 3HTJA 2DJNA 1U9NA 4JX4A 3S2DJ 2ZOZA 5CXGA 4QSHA 1JKOC 1JJ8C 4AYBN 4A3MJ 1LFUP 5HAWA 2YU9J 1VI0A 3KKCA 1WGXA 3PM1A 1IDYA 3RKQA 3GTKJ 3BTJA 2H1KA 2R0QC 2IAIA 5EZHA 2MSYA 5GPCA 2L9RA 1H89C 1B72A 2W53A 4C2MJ 2G7LA 5FLMJ 3K2AA 1U78A 3GTLJ 4NELA 3MVPA 3HEFA 3QPSA 4MO7A 2Q24A 4XRSA 1LE8B 1AKHB 2OPTA 2VKEA 1RESA 3BTCA 2FX0A 2LR8A 3GTMJ 4B4CA 2E2JJ 1UHSA 1HLVA 1RKTA 2JA6J 4BY1J 1DU6A 3Q0WA 4CYCB 5BNGA 1T56A 1SFOJ 5IOZA 4JL3A 5FJ8J 1HOMA 5EG0B 1PUFB 2PBXA 3DPJA 3MN2A 5CW8A 2VUMJ 2UXIA 3NXCA 2Y30A 3A01B 1HDPA 3PASA 2DA5A 4ACIA 4MFEA 4NDLA 2HKUA 1ENHA 4G12A 3ZQLA 5FGLA 5E3LA 2YVEA 2K9SA 3PO3J 3TW7A 2FQ4A 3BG5A 1NTCA 3G56A 2E2HJ 3VW2A 4J19A 3JRHA 2JA7J 9ANTA 3B6AA 1TWFJ 3PPBA 2LVSA 3HM5A 1MH4A 2L7ZA 3AQSA 3HGGA 3ON2A 1Q1VA 5M3MJ 5C4JJ 3IH4A 1ZR4A 1UI6A 5D19A 2MGQA 1CQTA 4PXIA 2QF7A 1MSFC 1FTTA 3MNLA 2GFNA 2TRTA 2DMUA 3CRJA 1ZR2A 1JT0A 3NPIA 5IOYA 4XIDA 3CJDA 2M2EA 1JKQC 2XSDC 4I6ZA 4Y52J 1JTXA 1GV5A 3IV5A 4A3KJ 2R92J 2ME6A 3Q3SA 2LY9A 1T33A 2B63J 2WV1A 1AU7A 3NAUA 2YS9A 2G7SA 1ZKGA 5J1YA 2EBIA 5C4YA 3S1NJ 3HKZN 1LFBA 2YVHA 1U9OA 3GTGJ 2HYJA 5EZGA 2XDNA 2PMZN 1Z0XA 3BCGA 2OF7A 2VKVA 1IJWC 1XG1A 1HCRA 1BL0A 2I10A 2XGEA 2EZHA 4JX5A 2HXOA 3BNIA 2DMNA 3TEDA 2DG8A 3HIMA 3VVZA 2LKXA 3M4OJ 1MH3A 2NX4A 3LSJA 3COLA 2D5VA 2OI8A 2NVTJ 3NARA 4GCLA 1MBHA 4M3BA 4JKZA 2FJ1A 3HOVJ 2ZCNA 1K61A 2HOTA 5DTDA 4YZEA 1FIAA 5M5YJ 3CMYA 4CGRA 3VOXA 2R5ZB 3S1QJ 2OERA 3LOCA 3M3YJ 3Q0UA 3GEUA 2EH3A 4A3GJ 2ME0A 3RD3A 3F1BA 2XB0X 1WI3A 3ZQCA 3VUQA 3IUVA 3KKDA 3BRUA 3IH2A 4B3AA 2O9LA 1I3QJ 5IYCJ 1JJ6C 2GBYA 2GLOA 1P7JA 1F36A 2EZIA 4D7NA 5F0CA 1LE8A 1QPIA 1AKHA 4GFLA 4DW6A 1RKWA 1IGNA 3GTOJ 3S1MJ 3BG9A 3S2HJ 2JWTA 3GTPJ 3ZOBA 5EGOA 1ETVA 4JP0A 2ZCMA 2LLKA 3JR9A 4CYCA 2XPUA 1FEXA 2EZLA 5EG0A 1PUFA 1ETOA 1Y1WJ 4FCYA 3O8GA 5F0FA 1DU0A 2QKOA 3LWJA 3VP5A 2HOSA 4M3DA 2ECBA 2K9NA 3A01A 1POGA 5K7ZA 5HSZA 5FMPA 2UXHA 3Q0VA 4JNNA 4AC6A 5EF6A 3OIOA 4BKXA 3LSRA 2NVYJ 4GCKA 2DMPA 4BBRJ 4IHXA 1Y1VJ 2F07A 3SFIA 1AHDP 3QKXA 1X2NA 2VI6A 2W48A 2G0EA 3I4MJ 2IU5A 2DG7A 3S5RA 5IYBJ 1JKPC 3BG3A 1MBFA 2DA3A 2K40A 1JTYA 4UUSA 2R5YB 1MBJA 4FISA 1B8IB 1WCMJ 4IEJA 1HF0A 3H3VK 3GTQJ 3JREA 3C07A 3V78A 4BY7J 4A3DJ 2NP5A 3JRGA 3VW1A 3EUPA 2LP0A 4DZPA 3NRGA 2RAEA 5EDNA 5JLXA 1ZGWA 4ABZA 2YUSA 3BR3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IDZ A;  2MG4 A;  4ICH A;  2DA6 A;  4MK6 A;  2HOA A;  3G1L A;  2D6Y A;  4MXM A;  1WPK A;  2L7M P;  5C44 J;  3BQY A;  5GP9 A;  1XS9 A;  3BR6 A;  1ETK A;  4M3G A;  1QRY A;  3ZQH A;  3VVY A;  2WAQ N;  1BW6 A;  4D5C A;  1SGM A;  3LSG A;  4DZJ A;  1UG2 A;  4MIM A;  3LJL A;  2X9D A;  1ETW A;  3OSF A;  3ON4 A;  4ME9 A;  1MBG A;  3RH2 A;  1A6I A;  2M34 A;  4EEF G;  3EGQ A;  3UKG A;  2Y31 A;  3RZO J;  4AUX A;  3ANG A;  3D1N I;  3FRQ A;  4DYC A;  3JRD A;  2REK A;  2GUH A;  5IP6 A;  2EQR A;  1APL C;  4AF5 A;  2K9Q A;  2QWT A;  4DYQ A;  1YRN B;  3ANP A;  4AC0 A;  3S14 J;  1D5Y A;  1TWA J;  2KT0 A;  5FHP A;  3BR5 A;  1VND A;  4D7M A;  3QBM A;  5AQC A;  2P81 A;  1QVU A;  1O4X A;  5F04 A;  2RAS A;  3O8H A;  4BBS J;  2CUF A;  4A3J J;  4NN1 A;  2R7Z J;  1MBE A;  2QOP A;  2R5Z A;  2ZCX A;  3HOW J;  3HBL A;  3HOZ J;  3NI7 A;  3A03 A;  3FK6 A;  3WHB A;  4GFB A;  2M9H A;  3S16 J;  5DAJ A;  3HOY J;  2AO9 A;  5FLV A;  3JRA A;  2CRG A;  1X2M A;  5FKK A;  4S0H B;  1TWG J;  2XB5 A;  5E3N A;  3S17 J;  2IBD A;  2JA5 J;  1JUP A;  2HXI A;  1FJL A;  1ITY A;  4FE4 A;  3KNW A;  1K83 J;  2NVX J;  2WUI A;  1SAN A;  2DA1 A;  3AQT A;  3JSJ A;  4XRS G;  2LD5 A;  3ZQI A;  2E1O A;  2DMQ A;  2ID3 A;  3C2B A;  3BQZ A;  1XC5 A;  3HOU J;  2HYT A;  2UXP A;  5E3M A;  1HDD C;  1W0U A;  4QTR A;  2N8G A;  3RZD J;  2CJJ A;  2EZK A;  1Z77 A;  2ELK A;  1JGG A;  1MBK A;  4W97 A;  1TC3 C;  4GCT A;  1E3O C;  3JRI A;  3HTI A;  5M3F J;  2QCO A;  4W1U A;  2WGB A;  1JUM A;  2CQX A;  1GDT A;  3B81 A;  5FKN A;  2ECC A;  4X6A J;  3BHQ A;  3NNR A;  4XIC A;  3HOX J;  1GVD A;  1OFC X;  4IHW A;  4MLO A;  2JN6 A;  2Y9Y A;  2ZB9 A;  4A3L J;  1IUF A;  1JT6 A;  3E7Q A;  3HE0 A;  5K7H A;  5EYR A;  4MFD A;  2G7G A;  2QTQ A;  1FIP A;  5J3L A;  4KWA A;  2R5Y A;  1B8I A;  2O7O A;  3BT9 A;  1QVT A;  3F0C A;  3CDL A;  4V2F A;  5IP7 J;  3WHC A;  2X6O A;  5HOD A;  3ZQG A;  4A3E J;  4I76 A;  3W6V A;  4L62 A;  5E3O A;  1P7I A;  5C3E J;  1G2H A;  3QPL A;  1A5J A;  3G1M A;  3P9T A;  3TW6 A;  3VOK A;  1ZTR A;  3HTH A;  2DMT A;  3S15 J;  2E19 A;  4C3J J;  5FKM A;  1U8B A;  1MSE C;  3BR2 A;  1S7E A;  2O7T A;  5EFY A;  1VF9 A;  3CCY A;  1ORK A;  1BA5 A;  2UXO A;  2G3B A;  3KZ9 A;  4A3C J;  3BJB A;  4A3B J;  2FBQ A;  3B6C A;  2CQQ A;  5FKO A;  4C3I J;  5FKL A;  2DA4 A;  2V57 A;  1EF4 A;  4DYR A;  3FK7 A;  4HKU A;  4HNV A;  1H8A C;  1TWH J;  5EGO B;  3GTJ J;  3SJM A;  5JLW A;  2XPV A;  2NOG A;  3FKI J;  4LOC A;  3S1R J;  3I4N J;  2LFB A;  3BR1 A;  2QIB A;  3H0G J;  5DS9 A;  5IPA A;  4L5E A;  1B72 B;  3FIS A;  3VIB A;  3VVX A;  3L1P A;  3JRB A;  2CU7 A;  1JUS A;  2KDZ A;  2DN0 A;  1F43 A;  4IHV A;  3BTI A;  3HB9 A;  3BR0 A;  2M8G X;  4XK4 A;  4X1E A;  2JA8 J;  3MKL A;  1TWC J;  4D5F A;  1YRN A;  3LNQ A;  5M5W J;  1GUU A;  2HQ5 A;  3JRF A;  4XRM A;  2M0C A;  5K7F A;  3HTA A;  3V6G A;  1FTZ A;  4RDU A;  2XRL A;  1JKR C;  3T6N A;  1WH7 A;  5K58 A;  3OOU A;  1ZK8 A;  5GPA A;  2NVQ J;  4A3I J;  3G7R A;  2XGC A;  2AHQ A;  4M3E A;  3TP0 A;  2GEN A;  1BJZ A;  4UUS B;  5D1R A;  2L7F P;  2Y0S N;  3CQZ J;  5EEA A;  4V2G A;  5H9T A;  4BXX J;  2MW8 A;  1H88 C;  3GBG A;  3G1O A;  4GFK A;  2RHA A;  1NK3 P;  1GV2 A;  2X48 A;  4FTH A;  3VW0 A;  5J1R A;  1IG7 A;  4QIW N;  3JRC A;  2L0K A;  3CWR A;  2ID6 A;  2LTP A;  2COB A;  2H8R A;  2ZOY A;  5F08 A;  5F1J A;  3PO2 J;  1W0T A;  3LSP A;  3O60 A;  3HGY A;  5J1U A;  3SDG A;  1IV6 A;  2JJ7 A;  1ETY A;  1NK2 P;  3TP3 A;  3VPR A;  5F0H A;  2NS7 A;  2IEK A;  1MNM C;  1OCT C;  3HDD A;  4JX6 A;  2XPW A;  5D18 A;  2DTZ A;  1OCP A;  1RR7 A;  2Y9Z A;  1R9T J;  2R93 J;  2JMW A;  1OJL A;  5M5X J;  4IHY A;  1ETQ A;  2LK2 A;  4M3F A;  1VFC A;  1BW5 A;  5CXI A;  2Y2Z A;  3LHQ A;  4A3F J;  2CUE A;  2DA2 A;  3ZQF A;  5F27 A;  2VPR A;  5IP9 J;  2HDD A;  4B1R A;  4A69 C;  4C3H J;  1X58 A;  4A93 J;  3GZI A;  3BTL A;  3K7A J;  5C4X J;  3QQA A;  1IC8 A;  1ETX A;  5HBU A;  3A02 A;  5IYD J;  2NP3 A;  2GM4 A;  2UXU A;  3RQI A;  1I50 J;  2HI3 A;  1UMQ A;  3IH3 A;  2FD5 A;  3E7L A;  1RPW A;  1IRZ A;  2XGD A;  4UUT A;  1WH5 A;  2E2I J;  4FE7 A;  2TCT A;  3FIW A;  1ZQ3 P;  2JK3 A;  3DEW A;  4M6V A;  3DCF A;  2DA7 A;  1I6H J;  4UDS A;  2PZ9 A;  4Y7N J;  2O8K A;  1GT0 C;  1RET A;  2WB1 N;  1UI5 A;  4JYK A;  2NS8 A;  4RBO A;  3OSG A;  3HTJ A;  2DJN A;  1U9N A;  4JX4 A;  3S2D J;  2ZOZ A;  5CXG A;  4QSH A;  1JKO C;  1JJ8 C;  4AYB N;  4A3M J;  1LFU P;  5HAW A;  2YU9 J;  1VI0 A;  3KKC A;  1WGX A;  3PM1 A;  1IDY A;  3RKQ A;  3GTK J;  3BTJ A;  2H1K A;  2R0Q C;  2IAI A;  5EZH A;  2MSY A;  5GPC A;  2L9R A;  1H89 C;  1B72 A;  2W53 A;  4C2M J;  2G7L A;  5FLM J;  3K2A A;  1U78 A;  3GTL J;  4NEL A;  3MVP A;  3HEF A;  3QPS A;  4MO7 A;  2Q24 A;  4XRS A;  1LE8 B;  1AKH B;  2OPT A;  2VKE A;  1RES A;  3BTC A;  2FX0 A;  2LR8 A;  3GTM J;  4B4C A;  2E2J J;  1UHS A;  1HLV A;  1RKT A;  2JA6 J;  4BY1 J;  1DU6 A;  3Q0W A;  4CYC B;  5BNG A;  1T56 A;  1SFO J;  5IOZ A;  4JL3 A;  5FJ8 J;  1HOM A;  5EG0 B;  1PUF B;  2PBX A;  3DPJ A;  3MN2 A;  5CW8 A;  2VUM J;  2UXI A;  3NXC A;  2Y30 A;  3A01 B;  1HDP A;  3PAS A;  2DA5 A;  4ACI A;  4MFE A;  4NDL A;  2HKU A;  1ENH A;  4G12 A;  3ZQL A;  5FGL A;  5E3L A;  2YVE A;  2K9S A;  3PO3 J;  3TW7 A;  2FQ4 A;  3BG5 A;  1NTC A;  3G56 A;  2E2H J;  3VW2 A;  4J19 A;  3JRH A;  2JA7 J;  9ANT A;  3B6A A;  1TWF J;  3PPB A;  2LVS A;  3HM5 A;  1MH4 A;  2L7Z A;  3AQS A;  3HGG A;  3ON2 A;  1Q1V A;  5M3M J;  5C4J J;  3IH4 A;  1ZR4 A;  1UI6 A;  5D19 A;  2MGQ A;  1CQT A;  4PXI A;  2QF7 A;  1MSF C;  1FTT A;  3MNL A;  2GFN A;  2TRT A;  2DMU A;  3CRJ A;  1ZR2 A;  1JT0 A;  3NPI A;  5IOY A;  4XID A;  3CJD A;  2M2E A;  1JKQ C;  2XSD C;  4I6Z A;  4Y52 J;  1JTX A;  1GV5 A;  3IV5 A;  4A3K J;  2R92 J;  2ME6 A;  3Q3S A;  2LY9 A;  1T33 A;  2B63 J;  2WV1 A;  1AU7 A;  3NAU A;  2YS9 A;  2G7S A;  1ZKG A;  5J1Y A;  2EBI A;  5C4Y A;  3S1N J;  3HKZ N;  1LFB A;  2YVH A;  1U9O A;  3GTG J;  2HYJ A;  5EZG A;  2XDN A;  2PMZ N;  1Z0X A;  3BCG A;  2OF7 A;  2VKV A;  1IJW C;  1XG1 A;  1HCR A;  1BL0 A;  2I10 A;  2XGE A;  2EZH A;  4JX5 A;  2HXO A;  3BNI A;  2DMN A;  3TED A;  2DG8 A;  3HIM A;  3VVZ A;  2LKX A;  3M4O J;  1MH3 A;  2NX4 A;  3LSJ A;  3COL A;  2D5V A;  2OI8 A;  2NVT J;  3NAR A;  4GCL A;  1MBH A;  4M3B A;  4JKZ A;  2FJ1 A;  3HOV J;  2ZCN A;  1K61 A;  2HOT A;  5DTD A;  4YZE A;  1FIA A;  5M5Y J;  3CMY A;  4CGR A;  3VOX A;  2R5Z B;  3S1Q J;  2OER A;  3LOC A;  3M3Y J;  3Q0U A;  3GEU A;  2EH3 A;  4A3G J;  2ME0 A;  3RD3 A;  3F1B A;  2XB0 X;  1WI3 A;  3ZQC A;  3VUQ A;  3IUV A;  3KKD A;  3BRU A;  3IH2 A;  4B3A A;  2O9L A;  1I3Q J;  5IYC J;  1JJ6 C;  2GBY A;  2GLO A;  1P7J A;  1F36 A;  2EZI A;  4D7N A;  5F0C A;  1LE8 A;  1QPI A;  1AKH A;  4GFL A;  4DW6 A;  1RKW A;  1IGN A;  3GTO J;  3S1M J;  3BG9 A;  3S2H J;  2JWT A;  3GTP J;  3ZOB A;  5EGO A;  1ETV A;  4JP0 A;  2ZCM A;  2LLK A;  3JR9 A;  4CYC A;  2XPU A;  1FEX A;  2EZL A;  5EG0 A;  1PUF A;  1ETO A;  1Y1W J;  4FCY A;  3O8G A;  5F0F A;  1DU0 A;  2QKO A;  3LWJ A;  3VP5 A;  2HOS A;  4M3D A;  2ECB A;  2K9N A;  3A01 A;  1POG A;  5K7Z A;  5HSZ A;  5FMP A;  2UXH A;  3Q0V A;  4JNN A;  4AC6 A;  5EF6 A;  3OIO A;  4BKX A;  3LSR A;  2NVY J;  4GCK A;  2DMP A;  4BBR J;  4IHX A;  1Y1V J;  2F07 A;  3SFI A;  1AHD P;  3QKX A;  1X2N A;  2VI6 A;  2W48 A;  2G0E A;  3I4M J;  2IU5 A;  2DG7 A;  3S5R A;  5IYB J;  1JKP C;  3BG3 A;  1MBF A;  2DA3 A;  2K40 A;  1JTY A;  4UUS A;  2R5Y B;  1MBJ A;  4FIS A;  1B8I B;  1WCM J;  4IEJ A;  1HF0 A;  3H3V K;  3GTQ J;  3JRE A;  3C07 A;  3V78 A;  4BY7 J;  4A3D J;  2NP5 A;  3JRG A;  3VW1 A;  3EUP A;  2LP0 A;  4DZP A;  3NRG A;  2RAE A;  5EDN A;  5JLX A;  1ZGW A;  4ABZ A;  2YUS A;  3BR3 A; 
#chains in the Genus database with same CATH topology
 2V1U A;  4PK4 A;  3U2R A;  2QSH X;  4MK6 A;  3E6D A;  1LJ9 A;  3MWM A;  3G3Z A;  4MXM A;  2A3S A;  2CO5 A;  2FBI A;  1QRY A;  2K3F A;  2WAQ N;  1IN4 A;  4HV5 A;  1SGM A;  4DZJ A;  5DD4 A;  4ENJ A;  1O7F A;  3L09 A;  1U5T A;  3F8M A;  3COA C;  3RH2 A;  1A6I A;  1MGT A;  4EEF G;  3UKG A;  2EB7 A;  3ANG A;  3P9K A;  3D1N I;  3NS4 A;  1R4M B;  1OR7 A;  5IP6 A;  1FWZ A;  2EQR A;  4EGZ A;  4AF5 A;  2B0L A;  4A2U A;  2ZXJ A;  4ENN A;  2QQ8 A;  3EQL F;  2XVC A;  1FBQ A;  4DVY P;  1XSX A;  4D7M A;  4XQF A;  1VQP I;  2VKD A;  3MKY B;  4CCK A;  5AQC A;  5KNL A;  5B1B H;  3RIR A;  2JZY A;  1QVU A;  3HSF A;  2DFI A;  3IHU A;  4IPA A;  2BVM A;  3I53 A;  1ON2 A;  1IN5 A;  2R5Z A;  3EPZ A;  4AVP A;  3KET A;  3HBL A;  1QNT A;  1U0J A;  3A03 A;  3FK6 A;  2HR3 A;  2RN7 A;  1XTA A;  4CA0 A;  3NWT A;  1OCC H;  1V5E A;  4XM3 A;  1I1S A;  3QPT A;  1UHW A;  4NB5 A;  2OU2 A;  2CRG A;  1X2M A;  1G8X A;  5J40 A;  3TBI A;  4S0H B;  3S17 J;  2IBD A;  4U87 A;  3E1S A;  4GGG A;  3U21 A;  3ESW B;  4P5O A;  2PMZ A;  1SAN A;  3JSJ A;  2GIZ A;  4XLH A;  3E6B A;  3ASN H;  3CES A;  3V8L A;  4L9T A;  3SYT A;  2M45 A;  1OMI A;  1XC5 A;  4OOI A;  3FXL A;  1D5V A;  1HDD C;  1JHF A;  2EFN A;  1FT9 A;  2CJJ A;  1X1P A;  2L4A A;  2WBM A;  5LGT A;  4R1H A;  3D5L A;  1TC3 C;  3C7J A;  2CUZ A;  2L01 A;  3JSP A;  3UNG C;  1E3O C;  4KT6 A;  2QKL B;  1ZRD A;  2PJR B;  4CDG A;  3TGN A;  2GXB A;  4II3 A;  4LLG F;  4WWC A;  1GDT A;  3FXM A;  2M4K A;  1Z7L A;  2HKX A;  2RNJ A;  4AIK A;  1ZG5 A;  1RR8 C;  1UHM A;  2OZU A;  4X6A J;  3DU5 A;  4HG2 A;  4B48 A;  3M7G A;  4E7K A;  4AIH A;  4F7Z A;  1ZH5 A;  2ESN A;  2M7B A;  2CQK A;  3RPU D;  2JN6 A;  2HU9 A;  3AG2 H;  1S72 I;  3E7Q A;  2E60 A;  3HE0 A;  1FPQ A;  1K4S A;  1FIP A;  2R5Y A;  1B8I A;  5DM7 F;  1IZ1 A;  3F0C A;  3H5R A;  3CDL A;  2NS0 A;  1SFK A;  2XGX A;  3ABT A;  2X6O A;  2XKO A;  3CUO A;  2ELJ A;  3GF2 A;  3GWZ A;  4A3E J;  4L62 A;  1XGO A;  1DDN A;  2PBI A;  3OL3 A;  1A36 A;  4Z6Y A;  4E7Z A;  2ZSH B;  4NNJ A;  5A2Q Z;  3TW6 A;  2DMT A;  4C3J J;  3LSK A;  5FKM A;  1FOY A;  1MSE C;  3BR2 A;  3GCM A;  1BA5 A;  3VDX A;  2W82 A;  2JRM A;  3DEE A;  3O6B B;  3BJB A;  3L2C A;  3KZ9 A;  3BDD A;  2GQQ A;  5CPR B;  2DA4 A;  5CJ9 A;  3F22 A;  2R7S A;  2F4M B;  4L0Z B;  1O3Q A;  4Y17 A;  2HQN A;  3ZMS A;  2EV5 A;  3J81 K;  3HSR A;  3CMM A;  2CYY A;  1IRF A;  2XPV A;  3TO9 A;  3FKI J;  4LOC A;  3I4N J;  5F64 A;  1F1Z A;  3BR1 A;  1YIJ I;  2G9W A;  3H0G J;  4BS9 A;  5DS9 A;  2NAZ A;  3P9I A;  3R0A A;  3VIB A;  3JRB A;  2V1N A;  2KDZ A;  1F43 A;  1KU9 A;  4B43 A;  2QLZ A;  3HB9 A;  2A6H F;  5EEG A;  4X1E A;  3QWL A;  3HHH A;  1WKM A;  2QQB A;  2KQR A;  1A04 A;  4UB6 C;  4ZC3 A;  1YRN A;  3C18 A;  3R6S A;  1BC7 C;  3JRF A;  4XRM A;  1FP1 D;  5CQE A;  3WG9 A;  5CVV A;  3HTA A;  4Q47 A;  1EKE A;  4OAY A;  2MC3 A;  1JKR C;  3OOU A;  1FYM A;  1T38 A;  2FQ3 A;  2NVQ J;  2R7T A;  4NC7 A;  2XGC A;  4M3E A;  4G7H F;  1BJZ A;  2DOD A;  3OR1 C;  2VC0 A;  5JR3 A;  1ZAO A;  1LUJ B;  4BXX J;  1H88 C;  2PI0 A;  3GFJ A;  1R36 A;  2DW4 A;  3SDB A;  3AG4 H;  3VW0 A;  2LOO A;  1IG7 A;  4LD5 A;  3OYC A;  2L0K A;  2QYO A;  3K0L A;  1W36 D;  4NQW B;  2COB A;  1F9N A;  2EV6 A;  3L2U A;  5ICF A;  2M1B A;  2HNH A;  5GTI C;  3I71 A;  4AVZ A;  2VBY A;  5J1U A;  2CUJ A;  1XGM A;  5TIS C;  3OYH A;  3GFI A;  4IKF A;  1IV6 A;  5AIQ A;  3F8C A;  1ETY A;  1NK2 P;  3TP3 A;  1WJ5 A;  2NS7 A;  4KN4 X;  2IEK A;  1BN5 A;  2OUM A;  2X0L A;  1OCT C;  2BHY A;  2LKP A;  5D18 A;  3ECO A;  1SD5 A;  3ZMU A;  3KP6 A;  2Y9Z A;  3F72 A;  3L2R A;  2R93 J;  2HDC A;  1Z3Y A;  1OJL A;  5M5X J;  2VON A;  1GXP A;  1MZB A;  5CXI A;  2PLY A;  1V3F A;  2QZ8 A;  3FXQ A;  1DQU A;  1VQM I;  2W57 A;  4ZYD A;  1XDS A;  3P7N A;  2PQ8 A;  3VYS B;  3J7A Y;  4N9H A;  5IP9 J;  2HDD A;  4B1R A;  1S6L A;  3O3K A;  2BBY A;  1YQA A;  3OL4 A;  5HDK A;  3GZI A;  2GIV A;  3BJA A;  2XSJ C;  3BCA A;  2DLL A;  3TMO A;  3MEX A;  5D4S A;  3LA7 A;  3T5X A;  4PJ0 C;  3IH3 A;  1MMD A;  3K1P A;  2VBX A;  2XC7 A;  3S32 A;  1WJB A;  2A69 F;  4G7O F;  2ADU A;  4FE7 A;  2TCT A;  3FIW A;  3TQN A;  3ZR8 X;  3DEW A;  1U2W A;  4HOB A;  2BE5 F;  3KEO A;  4LG0 A;  1I6H J;  1XD7 A;  2PZ9 A;  4BAC A;  3EUA A;  2HPI A;  5IT9 Z;  1Z6T A;  1SAU A;  1RET A;  2M87 A;  5DEQ A;  3MQ0 A;  2FML A;  2EIJ H;  2DT7 B;  3VYU B;  5J4Y A;  1Y0N A;  5CXG A;  3ZMT A;  2M4G A;  3EUH C;  3TDZ C;  3GX4 X;  2BYV E;  1IV8 A;  1WGX A;  3PM1 A;  1IDY A;  4NUB A;  5DV5 A;  5ERI A;  3RKQ A;  4M71 A;  2XUB A;  4F93 B;  3U1D A;  5GPC A;  1H0M A;  1H89 C;  4ZH4 F;  2P5L C;  3ZN0 A;  1G4D A;  3E5Q A;  5FLM J;  1U78 A;  2ZNY A;  4NEL A;  4WXC A;  5L3F A;  2DPU A;  2Q24 A;  3AFH A;  3HRU A;  1LE8 B;  2W1O A;  2VC1 A;  4UXN A;  3J7Z I;  1VQ5 I;  2W85 A;  1RIO H;  2MD0 A;  1LQ1 A;  3R0J A;  5H2F C;  4YRV A;  2NOJ B;  1Y8Q B;  2LBF A;  5HS9 A;  1RKT A;  1HLV A;  1DU6 A;  3Q0W A;  1T6S A;  3DWL E;  2R7R A;  5ILV A;  1W7P A;  4KMU X;  5L3B A;  2NXN B;  4BUP A;  1ZGA A;  2J5O A;  1TNT A;  2X6Y A;  3MN2 A;  2XF5 A;  2VUM J;  2UXI A;  3TOA A;  4F55 A;  3DKX A;  3PAS A;  2DA5 A;  2LKS A;  2Y48 A;  4ACI A;  2QBY A;  5E20 A;  1IXC A;  3ZRG A;  5FGL A;  4PGH A;  5E3L A;  2HVQ A;  4IZZ A;  5LHG A;  5E79 C;  4WXH A;  4PGG A;  3V42 A;  5J8C A;  4A0Y A;  1J5Y A;  3HTU A;  4I7H A;  2HZD A;  1T39 A;  4I02 A;  3HM5 A;  1KU3 A;  3KP7 A;  2L7Z A;  2AQF A;  3HGG A;  2A07 F;  2CFX A;  4RM3 A;  4HLX A;  1UI6 A;  5D19 A;  2F5D A;  4WF2 A;  2DMU A;  1YIT I;  4L5J A;  3HRM A;  1JT0 A;  1YX5 A;  2Q0O A;  3X2Q H;  4BEH A;  5BPI A;  4O5V A;  1KYW A;  4EJV A;  4IQ4 A;  2K4J A;  4LIV A;  3QU6 A;  3FMQ A;  4IHT A;  3OYK A;  4ZDL A;  2KFD A;  1V4R A;  1T33 A;  3O2P E;  1ZHF A;  2WV1 A;  2B63 J;  3H0D A;  2VLA A;  3IUO A;  3DV8 A;  3GYH X;  2QEX I;  1YX3 A;  5CVJ A;  2XRO A;  2FBH A;  4J01 A;  3PSI A;  2ESH A;  2WC2 A;  2IA0 A;  2HYJ A;  2PMZ N;  1Z0X A;  3NQO A;  4P9F A;  4XLF A;  1B6A A;  4CHU A;  5F6F A;  3BCG A;  2KRH A;  3ZP5 A;  4UNO A;  1VQL I;  1IAW A;  2H27 A;  3I3L A;  3RYR A;  2DG8 A;  2IXS A;  3VVZ A;  2LKX A;  3H5A A;  3I64 A;  1MH3 A;  2NX4 A;  2F5C A;  3ABK H;  4F91 B;  1IXR C;  2YX7 A;  3WTT C;  3REO A;  2D5V A;  3AL0 C;  2OI8 A;  2NVT J;  4RM2 A;  4GCL A;  1Y39 A;  1N75 A;  1UB9 A;  1U8R A;  1K61 A;  2DYR H;  3LAJ A;  2HOT A;  2VJI A;  5DM6 F;  5DTD A;  3J80 K;  1FIA A;  5M5Y J;  3VOX A;  2JA2 A;  1PVE A;  2X85 A;  3RJP A;  2O3F A;  2ZJR F;  4KNY A;  3Q5F A;  1W4M A;  1I3Q J;  3SZT A;  1P6R A;  1YTY A;  3CUQ B;  2RRE A;  3CCU I;  3FX3 A;  1P7J A;  2L7K A;  3DU6 A;  1S7O A;  2DFF A;  2HS5 A;  4MTD A;  4O3M A;  2DO7 A;  2H94 A;  4YEL A;  3WGI A;  1IGN A;  4GFL A;  3S1M J;  2OA4 A;  5FLX K;  2GXA A;  2XPU A;  4BQA A;  5HNH A;  1IF1 A;  3MZY A;  3PFY A;  5EG0 A;  4BQQ A;  2A5Y B;  1PUF A;  1DU0 A;  3LWJ A;  4KN7 X;  4M3D A;  3A01 A;  1XX5 A;  3DPL C;  2WV0 A;  4XL9 A;  1HC8 A;  3RQ4 A;  1Z21 A;  1XCB A;  4ETS A;  4AC6 A;  2YVX A;  3JAM Z;  2JPC A;  3RDI A;  2DMP A;  3HXL A;  4BBR J;  3SZP A;  2R7F A;  2A2F X;  3CDI A;  1AHD P;  2EK5 A;  4G6D A;  2IU5 A;  2UXX A;  1OYY A;  1TQI A;  2F5V A;  2DA3 A;  3IRR A;  4FIS A;  2IS2 A;  1VZ0 A;  3ZQQ A;  2CQ7 A;  3QAH A;  5LBQ A;  3H3V K;  1N77 A;  3V78 A;  4BY7 J;  2CFO A;  2NP5 A;  3JRG A;  3VW1 A;  2DOE A;  1CF7 B;  4IF4 A;  2KZV A;  1YJW I;  3T1B A;  2LP0 A;  1YW9 A;  4DZP A;  3GO5 A;  3OYB A;  1BR2 A;  3A0B C;  1TT0 A;  3DBR B;  2STT A;  3M8E A;  5E1W A;  5J6X A;  2MFZ A;  1SFE A;  2R3S A;  1Z7U A;  4KJZ A;  2HOA A;  3G1L A;  2OJE D;  2O8X A;  5HNF A;  1WPK A;  3F8F A;  4BHB A;  3BQY A;  5C44 J;  4LK1 F;  2W84 A;  1EH6 A;  2DFE A;  2RGV A;  1D1B A;  3ZQH A;  2DYS H;  1D8K A;  3VVY A;  1BW6 A;  4D5C A;  3LSG A;  3SZG A;  3QYB A;  3LJL A;  4MIM A;  1MDM B;  3ON4 A;  2IP2 A;  3PNT A;  3H36 A;  4HDV A;  1WRJ A;  1XSV A;  2BW3 A;  2X6W A;  4Q4Z F;  2LC2 A;  1MW7 A;  4HNU A;  2BY3 A;  1ACI A;  3M9A A;  4RGR A;  1TQM A;  3F8N A;  2I5U A;  4M9Z A;  4RAG A;  1YW8 A;  4LB6 B;  2DU9 A;  4U7D A;  3WGG A;  4WK8 F;  4EGY A;  4AC0 A;  4BDY A;  3IAS 2;  3S14 J;  1TWA J;  5FHP A;  1J0R A;  2M3A A;  1JE8 A;  2V4J C;  4UY8 I;  1QO0 D;  4QWQ A;  2VKH A;  1Y6I A;  2DOA A;  4E7L A;  2X1D A;  4HX8 A;  4BDZ A;  2OC6 A;  1FC3 A;  5FRM A;  4KUM A;  3DTE A;  4CYD A;  3K4N A;  1O4X A;  3O8H A;  1MND A;  1R58 A;  1XGS A;  2K9M A;  2QOP A;  4NN1 A;  4KDP A;  3P5J A;  2VBZ A;  1D0X A;  5GAG J;  3HOZ J;  3BJO A;  3BZ6 A;  3WHB A;  1UEL B;  4CZC A;  1ZLK A;  2YR2 A;  3K70 D;  3S16 J;  3HOY J;  5FLV A;  4F3Q A;  2E1M B;  1MKM A;  1X1C A;  2XB5 A;  4Q5S F;  5D5U B;  2ETH A;  3KNW A;  3UR3 C;  2WUI A;  2DA1 A;  2L3D A;  1LPQ A;  4WIB A;  5KAI C;  1WJF A;  2MC4 A;  3VOD A;  4EJW A;  1UJ8 A;  4P96 A;  4U0W A;  5LEJ A;  2QA4 I;  1JI8 A;  1W0U A;  2VT2 A;  4QTR A;  3DQV C;  1J09 A;  1MIJ A;  2J5P A;  2L9V A;  4OMY A;  2FUG 2;  5CLS A;  1Z77 A;  1B1B A;  3NEU A;  1MBK A;  2NRA C;  4GCT A;  4XOR A;  4B8X A;  4DBQ A;  5LD2 C;  4AM3 A;  2XV4 S;  3HTI A;  1WJC A;  2E5Z A;  4W1U A;  1E17 A;  2WGB A;  1JUM A;  4NC8 A;  4L9N A;  3L2Q A;  3CME I;  2HQR A;  1G59 A;  4LG3 A;  3FXJ A;  1Y56 A;  2DDA A;  4XIC A;  4Y13 A;  4RMN A;  3J7A O;  3DBH B;  4MLO A;  4MHG A;  4XLE A;  2ZB9 A;  3CC7 I;  5LGU A;  1SD6 A;  2QKM B;  4EQQ A;  3FMS A;  4R8H A;  5J3L A;  4KWA A;  2O7O A;  4RGU A;  2KPM A;  5IP7 J;  4V2F A;  2GA2 A;  2DTR A;  4HEA 2;  3HUG B;  4I76 A;  4CCJ A;  1NG6 A;  5ICE A;  5FGM A;  4U9L A;  2JVH A;  3FWE A;  1SAX A;  3AG1 H;  1JGS A;  1ZTR A;  2R7X A;  2EA4 A;  1SVO A;  2E19 A;  1SD7 A;  4KIC A;  1VF9 A;  3CCY A;  3F6V A;  1VQK I;  3M1E A;  4HDU A;  2FU4 A;  2UXO A;  3NRV A;  4A3C J;  1BI2 A;  3B6C A;  2E1C A;  2CQQ A;  2ZBK A;  2EPF A;  1FMW A;  1XGN A;  4EAT A;  3V7R A;  1SVL A;  2DCE A;  3FK7 A;  5DUI A;  2CGP A;  1AA7 A;  1CGP A;  3GTJ J;  2W25 A;  2MAB A;  2VE9 A;  2NOG A;  3LL7 A;  4A0Z A;  3S1R J;  1YE9 A;  1B72 B;  2M5W A;  1IRG A;  3L1P A;  5JI6 A;  1JUS A;  4GCV A;  4IHV A;  2B7E A;  3BTI A;  3ROU A;  1X3W B;  2XDV A;  2ZXH A;  3KLN A;  5HDN A;  3BR0 A;  2M8G X;  1LKX A;  1TP4 A;  2JA8 J;  3QOE A;  4D5F A;  1OCZ H;  5M5W J;  1GUU A;  2VBW A;  4LLL A;  3ZMD A;  1DP7 P;  3V6G A;  3GVA A;  3T6N A;  5GPA A;  4A3I J;  3G7R A;  1B4A A;  1KYZ A;  1U6G A;  2GZW A;  1YI2 I;  4YFX F;  5HLT A;  3L2V A;  2Q2E A;  5D1R A;  2BV6 A;  3CQZ J;  5EEA A;  2L02 A;  4KFC A;  1ZGJ A;  2O61 A;  3SXY A;  1KU7 A;  4GFK A;  4FQG A;  1NK3 P;  1GV2 A;  2X48 A;  4FTH A;  1KA8 A;  5D5W B;  4QIW N;  2XHK A;  3RPQ A;  2X4H A;  1HKT A;  1FY7 A;  3W6K B;  3MKZ A;  2KIS A;  1QQI A;  2FOW A;  2JSP A;  2H8R A;  3TKY A;  4YEJ A;  1DP3 A;  2KIF A;  4N4O B;  5F08 A;  1XCV A;  3O60 A;  5HS8 A;  3W2V A;  2JJ7 A;  4R79 A;  2E1N A;  3KZY A;  3EUH A;  1R4N B;  1GHC A;  2O6G E;  1R5H A;  3OS1 A;  1UAA A;  2MA3 A;  2DTZ A;  3OYJ A;  1FP2 A;  2WAE A;  2V9V A;  2CV0 A;  3G4S I;  4DGW B;  4YIR X;  2LK2 A;  2XIG A;  4IRG A;  1BW5 A;  4L18 B;  1A31 A;  4G9Y A;  3TO7 A;  2EIM H;  5HOO A;  1ZG1 A;  2IGN A;  2QQA A;  2YSR A;  3LA2 A;  3ZQF A;  5F27 A;  2VPR A;  2YX4 A;  3JTG A;  1J9I A;  3LSH A;  3K1N A;  3F21 A;  2MLK A;  4TV7 A;  4A93 J;  3K7A J;  1X19 A;  1IC8 A;  4PSX A;  3CZ6 A;  5IYD J;  1S7A A;  2NP3 A;  3WU2 C;  5H6Q A;  2GM4 A;  3RQI A;  2MH2 A;  3I55 I;  2HOE A;  1I50 J;  2HI3 A;  5FRO A;  3QPH A;  2LF8 A;  3WTX C;  1BR1 A;  4WXD A;  1NHA A;  2ISZ A;  4U9N A;  5A2Q K;  2JK3 A;  2GXG A;  3DCF A;  2STW A;  3MCZ A;  2LMD A;  1GT0 C;  3Q9V A;  3VFZ A;  3GZN B;  1ZG3 A;  3HTJ A;  4D0P A;  2Z5U A;  4EM0 B;  4JX4 A;  2EA2 A;  5H6R A;  3VEP A;  2ZOZ A;  1JKO C;  2F5F A;  1RRJ A;  3RSN A;  1JJ8 C;  4NHJ A;  1N78 A;  1S5L C;  1KU2 A;  1VI0 A;  3KKC A;  3MD2 A;  1ZYR F;  1LEB A;  4A5N A;  4AU7 A;  3ONQ A;  1WWX A;  1OLT A;  3HRT A;  2R0Q C;  4BQN A;  2E34 A;  2JUC A;  4C2M J;  5L3G A;  1X3Z B;  3ERM A;  1YG2 A;  4G6T B;  2DDB A;  3KYC B;  2X51 A;  4LLN A;  2CW7 A;  3B73 A;  3HEF A;  4RS8 A;  4XRS A;  2QSG X;  1AKH B;  2VKE A;  1IW7 F;  4HQE A;  2FX0 A;  4XBF A;  3D5S C;  3S3O A;  4L9V A;  1V55 H;  4CYC B;  1T56 A;  4QPO A;  3H3Z A;  1SFO J;  2V6E A;  1SMT A;  4A12 A;  4KYW A;  1LDD A;  3GFL A;  4EM2 A;  1SFU A;  4B09 A;  2KDO A;  4M6X A;  3VSK A;  4A5M A;  1YFH A;  4HST A;  4NDL A;  2HKU A;  1L3L A;  1ENH A;  1I6X A;  4G12 A;  2X1E A;  1Z9C A;  3IC7 A;  3CF5 F;  5LHI A;  1B9N A;  5B3S H;  4P1W A;  3TW7 A;  1IN7 A;  3MZH A;  1W36 C;  3KP4 A;  4G8X A;  3JRH A;  4YFK F;  1TL8 A;  2VJJ A;  2LVS A;  4OIR F;  3DKY A;  1VQ7 I;  2QQ9 A;  5DCM A;  4U0Y A;  3A1Y A;  4I99 C;  1Q1V A;  2E71 A;  3FF5 A;  4E7J A;  2FOK A;  1CQT A;  4PXI A;  1G3S A;  3ZMZ A;  2WY8 Q;  2EFQ A;  3CRJ A;  4RLF A;  3WTW C;  2IS1 A;  4IL6 C;  1OQY A;  4LFU A;  2M2E A;  2K7L A;  4I6Z A;  2I8D A;  1H9G A;  4M9X A;  2IW5 A;  1UFM A;  3WTV C;  1TNS A;  3IWF A;  4ESB A;  4HBL A;  5D5X B;  1DPU A;  2V7F A;  3Q3S A;  4ZDP A;  3JCU C;  2Y0S A;  1DGR M;  1LEA A;  2Z2S B;  1O57 A;  3NAU A;  1K6Y A;  4XSZ F;  5J1Y A;  2KKO A;  1U5T B;  3R4K A;  5C4Y A;  1LFB A;  1U9O A;  2L2O A;  3GTG J;  1BOA A;  2RVC A;  3CDH A;  2L5Q A;  3S93 A;  4ZTJ A;  1IJW C;  2WA0 A;  3H35 A;  4Y33 A;  5IY5 H;  2EZH A;  4E7I A;  2DMN A;  1TQP A;  5CVI A;  3V4G A;  1LDJ A;  1BM9 A;  3GLX A;  3HIM A;  3TL4 X;  2OTL I;  1BR4 A;  1Z1D A;  2CG4 A;  2FMY A;  1W5S A;  3LFK A;  4BAY A;  4B47 A;  1DGW Y;  3GXO A;  4ZZD A;  1F4K A;  1ZRF A;  3HPH A;  5FD5 A;  3CO7 C;  3JW4 A;  3CJR B;  1TT5 B;  1J7K A;  1WHU A;  4JKZ A;  2V79 A;  2FJ1 A;  2E7X A;  2K85 A;  3N97 A;  5IT9 K;  2ZCN A;  4YII A;  3K10 A;  4F92 B;  3RKY A;  2DK5 A;  4UVC A;  1RZ4 A;  3HRS A;  2R5Z B;  3Q9S A;  5HS7 A;  2OER A;  1SMY F;  1R7J A;  2P0W A;  2GWR A;  3BCB A;  3G6E I;  3F1B A;  5HLH A;  5FB2 A;  3ZQC A;  3KKD A;  2Y75 A;  2ZFW A;  2PMH A;  3VYR B;  4B3A A;  1MJB A;  2IPQ X;  2OZ6 A;  4XOT A;  2GLO A;  1FMV A;  2EZI A;  1R6R A;  2O0Y A;  4XKB A;  3I56 I;  3HOT A;  1QPI A;  2L9N A;  1PP8 F;  3GTO J;  3BG9 A;  2VOO A;  4GRI A;  3HC7 A;  3I5U A;  3ZOB A;  3G71 I;  2KIQ A;  4JP0 A;  4XKV A;  2LLK A;  3KIO A;  2ZME C;  1X1A A;  1BIB A;  1Z6R A;  3E6C C;  1X3U A;  1UG0 A;  4ESJ A;  5D4R A;  3O8G A;  5F0F A;  1OYW A;  1VQ9 I;  3DLA A;  2Y69 H;  2ACJ A;  2RKH A;  2K9N A;  4I09 A;  5FMP A;  2ISY A;  2VN2 A;  2X1C A;  2UXH A;  1HBX G;  3Q0V A;  4AIJ A;  2VQC A;  4JNN A;  1W5T A;  2RV8 A;  3IP4 B;  4PDK A;  4RGX A;  4BKX A;  5EF6 A;  2HVS A;  3PFI A;  1BI0 A;  2NVY J;  3PNV A;  4P9U A;  4LB5 A;  5E1Z B;  2XAU A;  2EFO A;  4IHS A;  1FZP B;  4IHX A;  1Y1V J;  1P2F A;  1FOK A;  2JQ7 A;  2HPM A;  2K86 A;  5BQT A;  2QVO A;  4Q48 A;  2W48 A;  2XRN A;  5HLI A;  1YW7 A;  5IYB J;  1JKP C;  1XN7 A;  2R5Y B;  1IXS B;  2IA1 A;  4LIT A;  3W6J B;  4UUS A;  1B8I B;  3HPG A;  1WCM J;  3PIO F;  4IEJ A;  4HYE A;  2K5C A;  3CD6 I;  3GTQ J;  3RCO A;  2PFB A;  5L3C A;  3C07 A;  3W2A A;  4CCN A;  1P9Q C;  1BBY A;  5JLX A;  1ZGW A;  1LB2 A;  3ZN1 A;  3BR3 A;  1IDZ A;  1YHQ I;  2MG4 A;  4ICH A;  1D1C A;  5E8G A;  1W1W E;  2P5V A;  2D1H A;  3FM5 A;  2IGO A;  2L7M P;  4LK0 F;  5GP9 A;  1XS9 A;  2AXL A;  1ETK A;  3M8F A;  4M3G A;  3L9F A;  1S9H A;  1TZL A;  3NWS A;  4EVI A;  2K4B A;  3WG7 H;  2FE3 A;  2X9D A;  3OSF A;  1MBG A;  2VXD A;  4HV6 A;  1KQ8 A;  1YS6 A;  2XAG A;  4AUX A;  4Y4R A;  4UB8 C;  5LHH A;  3FRQ A;  3FXO A;  2REK A;  1YYV A;  3QYF A;  4HAM A;  4ITV A;  3JSO A;  2BY0 A;  2GUH A;  4C2M A;  2HVR A;  3CMA I;  2K9Q A;  2V9P A;  5K1Y A;  1T95 A;  2D1V A;  1YRN B;  2ZC2 A;  2FNA A;  5BOX A;  1YJ9 I;  3RTR A;  1RC9 A;  3OS2 A;  4II2 A;  1VND A;  4M72 A;  2NNN A;  2RC4 A;  2E35 A;  3HJE A;  4BQO A;  1BJA A;  2P81 A;  4RA2 A;  2B1E A;  1FLI A;  3PL8 A;  5F04 A;  5D8L B;  4DQ2 A;  4A3J J;  3HTS B;  1R71 A;  2PJP A;  1MBE A;  4HF2 A;  3VSL A;  3A2K A;  3E0J B;  3FM3 A;  4RAF A;  3V8J A;  4GFB A;  3HSE A;  2M9H A;  3LQQ A;  1R22 A;  2IRF G;  3BG7 A;  5DAJ A;  1K4T A;  3JRA A;  1MJA A;  5E3N A;  5FKK A;  1TWG J;  2ZXW H;  3ASO H;  1I1G A;  1ZAR A;  4FE4 A;  2NVX J;  4XRS G;  2LD5 A;  3ZQI A;  2V26 A;  2DMQ A;  2ID3 A;  1K78 A;  3BQZ A;  2HYT A;  1MMN A;  2UUZ A;  5E3M A;  4YG2 F;  2N8G A;  1Z91 A;  1SEU A;  2ZKZ A;  4MNU A;  4OIN F;  1OCO H;  2A6E F;  2OQG A;  5JHF A;  3G73 A;  2R7W A;  3PJR A;  4JK1 X;  3AAF A;  2QCO A;  4ZDO A;  5FKN A;  4G94 A;  1FSE A;  3NNR A;  4HSR A;  5J8F A;  3HOX J;  4F52 A;  4ENK A;  5CYV A;  1OFC X;  2HQA A;  4PZJ A;  2EV0 A;  3LFU A;  3N05 A;  3W2W A;  2O03 A;  2K3P A;  1JT6 A;  4L0Y B;  2G7U A;  5K7H A;  2QTQ A;  4HNT A;  1YOV B;  3K4C A;  2HFH A;  3KPH A;  4MQV A;  3CTA A;  3ZQG A;  3W6V A;  5LLQ A;  5IT3 A;  1P7I A;  5E3O A;  3VWB A;  3QPL A;  4HX4 A;  2VJ4 A;  3I59 A;  3P9T A;  2V6C A;  1VQ4 I;  4GYG A;  4KIB A;  3DTI A;  2XAH A;  3HTH A;  5DDG A;  1X4O A;  2ZJQ F;  1S7E A;  2O7T A;  5EFY A;  1MMA A;  4LG0 B;  3CUQ C;  4RB2 C;  2VJ5 A;  4AD9 A;  3KYD B;  2G3B A;  4CIC A;  4A6E A;  2P5K A;  5KCM A;  4A3B J;  2HKO A;  2LF7 A;  4C3I J;  2AS5 F;  2LYC A;  1EF4 A;  2HDW A;  1B59 A;  3VOE A;  1R1U A;  2VQG A;  2WTE A;  4MGR A;  2DBB A;  3EUK L;  4HKU A;  4HNV A;  3SEZ A;  1H8A C;  4M73 A;  3SJM A;  5KVR A;  1D8J A;  4XKW A;  5H20 A;  2G7H A;  1IN6 A;  4FT8 A;  1A6Q A;  3V7C A;  2QIB A;  5IPA A;  3FIS A;  1P92 A;  3H9Q A;  1WZ2 A;  2EJR A;  2DN0 A;  2WAF A;  4B44 A;  1ERD A;  5EJC A;  3K9T A;  2IJL A;  2JRT A;  2M8E A;  4XK4 A;  3BP8 A;  2LNB A;  3MKL A;  1TWC J;  4N4N B;  1UST A;  2HQ5 A;  3BPV A;  1TW2 A;  2KL4 A;  3QRF F;  1J75 A;  5K7F A;  2LBF B;  3QP5 A;  3KP2 A;  3RPU A;  1FTZ A;  2XRL A;  2BHZ A;  1WH7 A;  4XKC A;  1XSD A;  1W7P B;  3S8P A;  2V1X A;  1FYK A;  3WTZ A;  1JHH A;  2R7Q A;  3ZGK A;  5K5Q A;  4UUS B;  2L7F P;  2Y0S N;  1T0F C;  2V1D A;  1K6O A;  2B3W A;  4NBQ A;  4V2G A;  1WQ2 A;  4PJL A;  3EET A;  5CQG A;  3GBG A;  2QBY B;  3CP8 A;  3E3V A;  2Y0M A;  2HGC A;  4N9I A;  5J1R A;  3K70 C;  3H1C A;  3GZ6 A;  3CF2 A;  4G6Q A;  4GXO A;  3JRC A;  3CWR A;  2KIM A;  4P55 A;  1OCR H;  2JT1 A;  1QGP A;  2GAU A;  3WE3 A;  3WU1 B;  1I39 A;  2GOX B;  1W0T A;  2EIL H;  4EV0 A;  1WI9 A;  3HGY A;  3SDG A;  1G3W A;  3MKW B;  3FHN A;  1J59 A;  1BI3 A;  2PG4 A;  4XLC A;  4MQ9 F;  5DCF A;  4BHP A;  1AOY A;  1P4A A;  1Y8R B;  4JX6 A;  2XPW A;  3WE2 A;  2EWN A;  2ZCW A;  4M6Y A;  1H9T A;  1OCP A;  2W4S A;  4BEH B;  3SFZ A;  1K79 A;  1RR7 A;  1R9T J;  2DQR A;  2OTJ I;  3OIP A;  1QHG A;  4IHY A;  2XAS A;  4XNF A;  2PJR A;  4M3F A;  1VQ6 I;  4OD4 A;  2VAS A;  3PSF A;  5F1R A;  1FYL A;  5LGN A;  3OYG A;  2Y2Z A;  2DXI A;  3R61 A;  1HKQ A;  2NNY A;  1VQN I;  3FXK A;  3CLO A;  4PJN A;  2Z99 A;  2ZY9 A;  4HZF A;  3DPT A;  3OIQ A;  4GDF A;  4HF1 A;  4A69 C;  4C3H J;  3FXU A;  3BTL A;  4H0E A;  1BIA A;  3I0T A;  3K8P C;  1ETX A;  5AIP A;  5HBU A;  4HX7 A;  1O3R A;  1MD0 A;  4E4H A;  4CZZ A;  2P8T A;  3HZJ A;  1UMQ A;  3OYN A;  4PCQ A;  2IGM A;  2H6B A;  5JVT A;  4XLN F;  3TO6 A;  1IRZ A;  2XGD A;  3CCS I;  2E2I J;  1Z67 A;  1HW1 A;  3A4C A;  4X0G A;  1ZQ3 P;  1BC8 C;  3WGH A;  4PFP A;  2E1M C;  2DFH A;  4C2T A;  1IN8 A;  2DA7 A;  2LDU A;  2R7D A;  1NH3 A;  4UDS A;  2KJB A;  1GXQ A;  4Y7N J;  4UVA A;  3BZC A;  4RAY A;  2EIN H;  3EYY A;  4JYK A;  2NS8 A;  4RBO A;  1U9N A;  1FOW A;  1LFU P;  1K78 B;  5HAW A;  2YU9 J;  3BY6 A;  1S3J A;  2KIU A;  2VT3 A;  1KON A;  2MSY A;  2MYS A;  3KX2 A;  2P6S A;  2OBP A;  2G7L A;  3GTL J;  1G3Y A;  5BS6 A;  4EJT A;  5LRS A;  3N4M A;  1USS A;  4IOC F;  1RES A;  2IS4 A;  1E3P A;  3QU3 A;  2HTJ A;  2LR8 A;  1IRX A;  1UHS A;  3C2G A;  4EJU A;  1M1E B;  4BJ5 C;  3MAJ A;  3PNY A;  4C9Y A;  5IOZ A;  3DLL F;  2XF6 A;  5FJ8 J;  4KA4 A;  2PN6 A;  4IVN A;  5EG0 B;  4KMF A;  1HOM A;  1PUF B;  2PBX A;  4XRF A;  3DPJ A;  5CW8 A;  3NXC A;  4A0X A;  2DT5 A;  2ICW G;  5EEH A;  4ZTF A;  2Y30 A;  4U88 A;  4QLC U;  3A01 B;  1HDP A;  2RQQ A;  2L54 A;  4JBA A;  5E1X A;  3ZQL A;  2OD5 A;  2KRC A;  4GYI A;  2R7O A;  1PUE E;  3PO3 J;  1HA8 A;  1NTC A;  2BXZ A;  2E2H J;  4NQW A;  3VW2 A;  4J19 A;  2JA7 J;  4IRH A;  2M30 A;  2XAQ A;  3PPB A;  5GAE J;  3OYM A;  1MH4 A;  1RNL A;  4ON0 A;  2BY2 A;  4XLA A;  4XOP A;  3AQS A;  1AWC A;  3ON2 A;  5GAH J;  3IH4 A;  2CH0 A;  2MGQ A;  3CLQ A;  3GLL A;  2QF7 A;  3KEY A;  4UV9 A;  1MSF C;  3MNL A;  2TRT A;  3K2Z A;  2VQH A;  3BOQ A;  4XID A;  3DKW A;  1JKQ C;  4OIO F;  2YU3 A;  3OYF A;  2LH9 A;  3HOS A;  1JTX A;  2LY2 A;  4A3K J;  4BH9 A;  2PX9 A;  3ZQ7 A;  3PQJ A;  5LEK A;  3QP6 A;  2BZT A;  3IRQ A;  1Z3X A;  2JUG A;  3MMY B;  5E17 F;  2YVH A;  2XKP A;  2ZME A;  5EZG A;  3LSM A;  4PJM A;  2BW3 B;  4RB3 C;  1FBS A;  1ZEL A;  4DOZ A;  3FMR A;  2OF7 A;  2VKV A;  6PAX A;  1BL0 A;  3CC4 I;  3DPU A;  3EYI A;  5ICG A;  2HXO A;  3HYI A;  4EJO A;  1FOX A;  1FNN A;  2HYG D;  2XAF A;  3DBL B;  2OCC H;  3M4O J;  2KP6 A;  2LY1 A;  3V7S A;  1P4X A;  1MMS A;  3L00 A;  1EH8 A;  3COL A;  3CCQ I;  4OIQ F;  5HLG A;  1FBU A;  2QSF X;  1MBH A;  2IA2 A;  4M3B A;  3HOV J;  4LIU A;  3T8R A;  1N25 A;  5K5R A;  2CV2 A;  3T8T A;  1D1A A;  1XMK A;  3ZXS A;  4CGR A;  3CMY A;  1HSJ A;  4XSX F;  4ZYH A;  2MD5 A;  3Q0U A;  3GEU A;  4A3G J;  2PEX A;  2Q8K A;  1MMG A;  2H09 A;  1QZE A;  2MLG A;  3IH2 A;  4OIP F;  1SFX A;  5IYC J;  3K4J A;  3LSI A;  1JJ6 C;  1ZN2 A;  2V9K A;  1UZC A;  1X4P A;  2KHM A;  3WTY C;  2YPR A;  1F36 A;  2RNG A;  5F0C A;  1R23 A;  3K4M A;  5ED4 A;  1LE8 A;  2Z9O A;  4NC6 A;  4I0B A;  1RKW A;  5LFA A;  2D45 A;  2JWT A;  3PUF A;  2NYX A;  1LNW A;  3CJQ B;  5EGO A;  2ZCM A;  3JR9 A;  2NVU B;  4BGD A;  3HG9 A;  5BMZ A;  4AID A;  2VB6 A;  3K4B A;  3BLY A;  2FJI 1;  3K69 A;  1ETO A;  1Y1W J;  2BGC A;  4OU0 A;  3VP5 A;  3A0H C;  3IWZ A;  2ELH A;  4UUV A;  5K7Z A;  3H9G A;  1YO5 C;  4ESF A;  1V5G A;  3C3W A;  2WB1 A;  3GUD A;  5FFX A;  1ODD A;  1R1T A;  4IX7 A;  3C2H A;  4I0A A;  4AYB A;  1WFX A;  3I4P A;  2FF4 A;  1STZ A;  3KEQ A;  1KGS A;  4M9S A;  3QKX A;  2ZNZ A;  4MTE A;  5L3D A;  3BG6 A;  2VI6 A;  2G0E A;  3F6O A;  2ZO4 A;  5BPD A;  2DG7 A;  5FRN A;  1MBF A;  1JTY A;  3CCM I;  2IS6 A;  3I54 A;  5D8K B;  2GOM A;  3JRE A;  4S05 A;  1HXD A;  2RQP A;  4A3D J;  2Z33 A;  1XPX A;  3EUP A;  2FSW A;  3NRG A;  3FBN B;  4UVB A;  4CO8 A;  4ABZ A;  3SHF A;  2YUS A;  4PFO A;  4KIT B;  3J7Y J;  2DA6 A;  2LRE A;  4ZZL A;  2D6Y A;  4HPQ A;  2FXA A;  3EDP A;  2D2W A;  4XR6 A;  1VQO I;  4ASN A;  2EFP A;  3BR6 A;  2P7V B;  2CWE A;  1X1D A;  5GTH C;  3J81 Z;  4D9J A;  2IVM A;  5CKT A;  4BE2 A;  1UG2 A;  1ETW A;  4ME9 A;  1G3T A;  2CSO A;  2M34 A;  3EGQ A;  3CC2 I;  4RB0 A;  2E7W A;  2Y31 A;  5JVG F;  1O7L A;  4LJZ F;  3RZO J;  4IRV A;  3TOB A;  2ZJ2 A;  1TW3 A;  4DYC A;  1WJA A;  3VTI A;  2QM3 A;  3JRD A;  4RLQ A;  3DP7 A;  1APL C;  3S3M A;  2A61 A;  2QWT A;  4DYQ A;  2MBF A;  4FX4 A;  4XON A;  3ANP A;  1D3Y A;  4E70 A;  1D5Y A;  2KT0 A;  4E6K G;  3LQR A;  5E18 F;  3BR5 A;  4IXA A;  2R7U A;  4B3X A;  4YIF A;  5JHU A;  2CMP A;  3AG3 H;  3M1C A;  1HST A;  5KAF C;  3QBM A;  4ZJZ A;  2VE8 A;  4KIG A;  2Q2E B;  2RAS A;  1XB4 A;  3GW2 A;  4BBS J;  2CUF A;  2R7Z J;  2ZCX A;  1HKS A;  3HOW J;  4YFN F;  3NI7 A;  1J2X A;  3VB2 A;  2A6T A;  4MEX F;  1GVJ A;  4CH7 A;  1HW5 A;  1LVA A;  2AO9 A;  3LAP A;  2QUF A;  3CUQ A;  3HKZ A;  2JA5 J;  3FKJ A;  1JUP A;  2HXI A;  4BHC A;  4WCG A;  1FJL A;  1QU3 A;  1ITY A;  1VQ8 I;  1K83 J;  2Q1Z B;  3AQT A;  2P4W A;  4H4K C;  1KQ0 A;  1I27 A;  2E1O A;  3OR2 C;  4KIS A;  3C2B A;  4BJ6 C;  1T8I A;  1Q1H A;  3HOU J;  5D5V B;  2UXP A;  4E7S A;  3QOP A;  2KRF A;  1U5T C;  2DJI A;  3RZD J;  2UZK A;  2EZK A;  3L7W A;  2ELK A;  1JGG A;  2ZME B;  4GO1 A;  5CVU A;  4W97 A;  5TRD A;  2ZXI A;  3WTS C;  3FHZ A;  1R5G A;  3JRI A;  3KYL A;  5M3F J;  1OR7 C;  3MZ8 A;  2BXY A;  3OYL A;  1TLH B;  2CQX A;  3K6G A;  3B81 A;  2PFV A;  1OPC A;  2ECC A;  2VOP A;  3BHQ A;  2VIX A;  1D0Z A;  1GVD A;  2LSO A;  4IHW A;  3DTK A;  1WJD A;  4C2U A;  2Y9Y A;  1HQC A;  4A3L J;  1IUF A;  5EYR A;  4MFD A;  1DPR A;  2BY1 A;  4PJJ A;  1QA6 A;  1C0W A;  2G7G A;  2HWV A;  1R5I D;  3BT9 A;  1QVT A;  1RUO A;  1TBX A;  4IJA A;  1T0F A;  4PUS A;  4RGS A;  3WHC A;  1REP C;  5HOD A;  1I3A A;  4I01 A;  3G2B A;  3AKZ A;  1V54 H;  4KT5 C;  5C3E J;  1CF7 A;  1G2H A;  1LVK A;  1QHH D;  4DIQ A;  1A5J A;  3G1M A;  1S8N A;  2F2E A;  2UV1 A;  3VOK A;  3F3X A;  3S15 J;  1U8B A;  5B66 C;  1SC7 A;  1ORK A;  3CJT B;  3ABU A;  4XN0 A;  5FD6 A;  2L9S A;  3KCC A;  3VYT B;  4CCL A;  2M7A A;  2FBQ A;  5FKO A;  1O3S A;  5FKL A;  3PIP F;  1ONV A;  2V57 A;  2EIK H;  4DYR A;  1TWH J;  5EGO B;  2R7V A;  3BWG A;  5JLW A;  3GME A;  3FZV A;  1WSU A;  1MDM A;  3PQK A;  3CCL I;  2LFB A;  2DI3 A;  4L5E A;  5FFZ A;  3P9C A;  3VVX A;  1Y0U A;  1QZZ A;  2CU7 A;  2EFW A;  4AWX B;  4FX0 A;  3KFW X;  5HDG A;  3BPX A;  2VQL A;  4WX9 A;  1SVM A;  2FNP A;  4ANJ A;  5GAD J;  4ZYG A;  3LNQ A;  3OYA A;  4PSW A;  2M0C A;  2H6C A;  3ERE D;  1VTN C;  2CQN A;  4RDU A;  5K58 A;  2VPL A;  1ZK8 A;  1YLF A;  1HW2 A;  1DUX C;  1PDN C;  2IGK A;  4FAS D;  2HYF A;  3RKX A;  2K02 A;  2AQE A;  1MJ9 A;  2AHQ A;  2Z1D A;  3TP0 A;  2F5E A;  2GEN A;  3D0S A;  1MNE A;  5ILU A;  4M74 A;  5H9T A;  1T08 B;  2KZG A;  2MW8 A;  5HVQ C;  4U7B A;  3F8B A;  1XDU A;  2AXT C;  3SQN A;  3G1O A;  1RUN A;  2WY7 Q;  3MFK A;  3DF8 A;  2RHA A;  3RKW A;  4BXF A;  1YIO A;  4HF0 A;  2P7C B;  2WAQ A;  3AL0 B;  2LTP A;  2ID6 A;  1A35 A;  4K2E A;  4IOA F;  2L4M A;  2ZOY A;  5F1J A;  3PO2 J;  3KZI C;  3LSP A;  1U3E M;  3BRO A;  2B9S A;  4HLY A;  4BL0 B;  2F6C A;  2W7N A;  3E5U A;  3C1D A;  5DCM B;  5TJJ A;  2UXN A;  3I58 A;  2C6Y A;  2OQR A;  3VPR A;  4HRI A;  4BXU A;  3LST A;  5F0H A;  3H5N A;  1MNM C;  3JTH A;  3HDD A;  1FSH A;  4FET A;  5B5E C;  4XMY A;  2A05 A;  3HHG A;  4BU2 A;  1UCR A;  2JPB A;  4CCO A;  1TTY A;  2JMW A;  2JTV A;  3BJ6 A;  3HIF A;  2CS3 A;  3V8K A;  2VOD A;  1ETQ A;  1X1B A;  4DJA A;  3M07 A;  1OIS A;  4HQM A;  1VFC A;  4L5I A;  3GEZ A;  3LHQ A;  4A3F J;  3ULQ B;  2X6X A;  3ELK A;  2CUE A;  4CXF A;  3PUB A;  2DA2 A;  5TGT A;  4I2O A;  1S29 A;  3B02 A;  3HL2 A;  2KJC A;  1YS7 A;  1X58 A;  2LG4 A;  3F9K A;  4EMS A;  2BVL A;  2FRH A;  3S3N A;  5C4X J;  3OYI A;  3QQA A;  2DPD A;  3A02 A;  4OD5 A;  4A6D A;  5ICC A;  2UXU A;  3F23 A;  3DFG A;  2P6T A;  3HUG A;  2FD5 A;  1LFP A;  3E7L A;  5KHD A;  1RPW A;  4EM1 A;  3JAM K;  4RB1 A;  4UUT A;  5J4V A;  1WH5 A;  1R1V A;  3CCR I;  3LA3 A;  4M6V A;  3RI4 A;  1F5T A;  4RAZ A;  3H3U A;  3IAM 2;  4BE1 A;  3CCE I;  5LRR A;  2O8K A;  5ILS A;  4JOM A;  1PJR A;  2LRD A;  3M8J A;  2WB1 N;  3R60 A;  3J80 Z;  1UI5 A;  1BOB A;  3IKV A;  3OSG A;  2OCE A;  2DAO A;  1EA3 A;  2DJN A;  3S2D J;  1EV7 A;  4QSH A;  4AYB N;  4A3M J;  2M0M A;  2JSC A;  2E36 A;  3GTK J;  1IO2 A;  3BTJ A;  3U9G A;  2H1K A;  2IAI A;  5EZH A;  4ZYA A;  1B72 A;  2L9R A;  3H92 A;  3ZPL A;  2W53 A;  4ENM A;  3LWF A;  4IO9 F;  3K2A A;  3KLO A;  2A68 F;  4CUG A;  3MVP A;  3QPS A;  3FDY A;  4MO7 A;  1G6N A;  2OPT A;  3GZ5 A;  3BTC A;  4LGW A;  2MH9 A;  4CGZ A;  5E8I A;  4BNC A;  5DUK A;  3CCV I;  3GTM J;  4B4C A;  2E2J J;  4UHT A;  2JA6 J;  5FLX Z;  3IKT A;  3OYD A;  3FBI B;  4KIF A;  4BY1 J;  5BNG A;  2DT6 A;  3OV8 A;  4JL3 A;  1PYV A;  2DOF A;  2H8W A;  3K4L A;  2BOL A;  4MEY F;  4OAZ A;  1OYI A;  4MFE A;  2RDP A;  3SWH A;  4V19 K;  2WAD A;  2YVE A;  2K9S A;  5FO5 A;  2FQ4 A;  3BG5 A;  1LDK B;  3I9V 2;  5B1A H;  2ZJP F;  3G56 A;  4CCM A;  2HTS A;  3E97 A;  9ANT A;  3B6A A;  1TWF J;  3T0Y A;  2KMU A;  4N0B A;  1ON1 A;  1EJ9 A;  4Y3O A;  1R00 A;  3GFM A;  4CSW A;  1FX7 A;  1EH7 A;  1NG7 A;  5M3M J;  5C4J J;  3L2W A;  2CW0 F;  4JQF A;  1ZR4 A;  3QYE A;  3ZCO A;  4O6J A;  5CVR A;  1FTT A;  2K27 A;  2JVG A;  2GFN A;  1ZR2 A;  2OV7 A;  3NPI A;  5IOY A;  1E3H A;  2Z3Y A;  3CJD A;  2BEO A;  4DNC A;  2XSD C;  4U0V A;  4Y52 J;  2OAZ A;  3E5X A;  1GV5 A;  4QPQ A;  2ZFU A;  4OMZ A;  4XN3 A;  2F4I A;  3U1K A;  3ZMV A;  3IV5 A;  1YJN I;  2R92 J;  2ME6 A;  1XMX A;  2XAJ A;  4DBR A;  4IRI A;  3BZK A;  2R4G A;  2K9L A;  1AU7 A;  2HEO A;  2YS9 A;  2G7S A;  1ZKG A;  2EBI A;  1E0E A;  1T98 A;  3OOP A;  3CJN A;  3DXJ F;  5DYM A;  2W00 A;  3HKZ N;  3S1N J;  3OYE A;  3CP2 A;  2XDN A;  4J00 A;  4Z2Y A;  3OS0 A;  4Y15 A;  3TDU C;  1XG1 A;  1W5C C;  1HCR A;  1ZLJ A;  3SEQ A;  1E2X A;  2I10 A;  4D1Q A;  2UWM A;  2XGE A;  4JX5 A;  3BNI A;  4BE0 A;  2QEN A;  3RYP A;  3TED A;  3LMM A;  2DQL A;  3K1M A;  4HA8 A;  3W3C A;  2E5N A;  1PP7 U;  3KZZ A;  1ZRE A;  3E6M A;  3WU0 A;  3LSJ A;  3BC8 A;  2H1L A;  4BYY A;  1V5F A;  1OKR A;  3ABM H;  3NAR A;  2CW8 A;  5D6F A;  1W7P D;  3WTU C;  1XMA A;  1K7A A;  2W24 A;  1R49 A;  4HW0 A;  4C30 A;  4YZE A;  2HZT A;  1KQ9 A;  2KLO A;  1QBJ A;  3S1Q J;  1WVR A;  2F4O B;  3LOC A;  5K5O A;  3M3Y J;  2TDX A;  2EH3 A;  2QGU A;  3ML6 A;  2ME0 A;  3RD3 A;  1ULY A;  2XB0 X;  1WI3 A;  2PMU A;  3VUQ A;  3IUV A;  3DEU A;  1GLN A;  3KP5 A;  4I98 B;  3BRU A;  1D0Y A;  5DD8 A;  2O9L A;  1JXS A;  2GBY A;  2VL8 A;  4UV8 A;  5D6E A;  4D7N A;  4E7H A;  3H9J A;  1AKH A;  4LMY A;  4DW6 A;  3S2H J;  3D5R C;  3GTP J;  5KK1 A;  2Z16 A;  2VXZ A;  2GA1 A;  3FXR A;  1ETV A;  2A5W A;  4FHT A;  4CYC A;  3WOD F;  1O3T A;  1FEX A;  1B9M A;  2EZL A;  3IL2 A;  1BI1 A;  5JFR A;  1KZH A;  4IQJ A;  4FCY A;  2DK8 A;  5AON A;  2QKO A;  1RI7 A;  2F48 A;  2HOS A;  2ECB A;  1POG A;  1I5Z A;  3KE2 A;  1P4W A;  5HSZ A;  1ZRC A;  1L0O C;  3OWT A;  1QZY A;  2IT0 A;  3OIO A;  3LSR A;  4GCK A;  3OY9 A;  4L9J A;  3CCJ I;  2CV1 A;  3QOD A;  3OMY A;  2F07 A;  1SD4 A;  3SFI A;  3ISP A;  1IUY A;  3KP3 A;  1X2N A;  3I4M J;  3S5R A;  3BG3 A;  3K4K A;  2K40 A;  5L3E A;  1QPM A;  1Z05 A;  1MBJ A;  1WJE A;  4S04 A;  1HF0 A;  2O5R A;  1T2K A;  4ZYE A;  4G7Z F;  2ZSI B;  2FBK A;  5J47 A;  3S2W A;  4XLP F;  3CO6 C;  3I59 B;  4BJT A;  3ABL H;  2RAE A;  2XF7 A;  2FA5 A;  4OWR B;  3ECH A;  5EDN A;  2WWY A;  2COM A;  2FEZ A;  2QWW A;  2LY9 A; 
#chains in the Genus database with same CATH homology
 1IDZ A;  2MG4 A;  4ICH A;  2DA6 A;  4MK6 A;  2HOA A;  3G1L A;  2D6Y A;  4MXM A;  1WPK A;  2L7M P;  5C44 J;  3BQY A;  5GP9 A;  1XS9 A;  3BR6 A;  1ETK A;  4M3G A;  1QRY A;  3ZQH A;  3VVY A;  2WAQ N;  1BW6 A;  4D5C A;  1SGM A;  3LSG A;  4DZJ A;  1UG2 A;  4MIM A;  3LJL A;  2X9D A;  1ETW A;  3OSF A;  3ON4 A;  4ME9 A;  1MBG A;  3RH2 A;  1A6I A;  2M34 A;  4EEF G;  3EGQ A;  3UKG A;  2Y31 A;  3RZO J;  4AUX A;  3ANG A;  3D1N I;  3FRQ A;  4DYC A;  3JRD A;  2REK A;  2GUH A;  5IP6 A;  2EQR A;  1APL C;  4AF5 A;  2K9Q A;  2QWT A;  4DYQ A;  1YRN B;  3ANP A;  4AC0 A;  3S14 J;  1D5Y A;  1TWA J;  2KT0 A;  5FHP A;  3BR5 A;  1VND A;  4D7M A;  3QBM A;  5AQC A;  2P81 A;  1QVU A;  1O4X A;  5F04 A;  2RAS A;  3O8H A;  4BBS J;  2CUF A;  4A3J J;  4NN1 A;  2R7Z J;  1MBE A;  2QOP A;  2R5Z A;  2ZCX A;  3HOW J;  3HBL A;  3HOZ J;  3NI7 A;  3A03 A;  3FK6 A;  3WHB A;  4GFB A;  2M9H A;  3S16 J;  5DAJ A;  3HOY J;  2AO9 A;  5FLV A;  3JRA A;  2CRG A;  1X2M A;  5FKK A;  4S0H B;  1TWG J;  2XB5 A;  5E3N A;  3S17 J;  2IBD A;  2JA5 J;  1JUP A;  2HXI A;  1FJL A;  1ITY A;  4FE4 A;  3KNW A;  1K83 J;  2NVX J;  2WUI A;  1SAN A;  2DA1 A;  3AQT A;  3JSJ A;  4XRS G;  2LD5 A;  3ZQI A;  2E1O A;  2DMQ A;  2ID3 A;  3C2B A;  3BQZ A;  1XC5 A;  3HOU J;  2HYT A;  2UXP A;  5E3M A;  1HDD C;  1W0U A;  4QTR A;  2N8G A;  3RZD J;  2CJJ A;  2EZK A;  1Z77 A;  2ELK A;  1JGG A;  1MBK A;  4W97 A;  1TC3 C;  4GCT A;  1E3O C;  3JRI A;  3HTI A;  5M3F J;  2QCO A;  4W1U A;  2WGB A;  1JUM A;  2CQX A;  1GDT A;  3B81 A;  5FKN A;  2ECC A;  4X6A J;  3BHQ A;  3NNR A;  4XIC A;  3HOX J;  1GVD A;  1OFC X;  4IHW A;  4MLO A;  2JN6 A;  2Y9Y A;  2ZB9 A;  4A3L J;  1IUF A;  1JT6 A;  3E7Q A;  3HE0 A;  5K7H A;  5EYR A;  4MFD A;  2G7G A;  2QTQ A;  1FIP A;  5J3L A;  4KWA A;  2R5Y A;  1B8I A;  2O7O A;  3BT9 A;  1QVT A;  3F0C A;  3CDL A;  4V2F A;  5IP7 J;  3WHC A;  2X6O A;  5HOD A;  3ZQG A;  4A3E J;  4I76 A;  3W6V A;  4L62 A;  5E3O A;  1P7I A;  5C3E J;  1G2H A;  3QPL A;  1A5J A;  3G1M A;  3P9T A;  3TW6 A;  3VOK A;  1ZTR A;  3HTH A;  2DMT A;  3S15 J;  2E19 A;  4C3J J;  5FKM A;  1U8B A;  1MSE C;  3BR2 A;  1S7E A;  2O7T A;  5EFY A;  1VF9 A;  3CCY A;  1ORK A;  1BA5 A;  2UXO A;  2G3B A;  3KZ9 A;  4A3C J;  3BJB A;  4A3B J;  2FBQ A;  3B6C A;  2CQQ A;  5FKO A;  4C3I J;  5FKL A;  2DA4 A;  2V57 A;  1EF4 A;  4DYR A;  3FK7 A;  4HKU A;  4HNV A;  1H8A C;  1TWH J;  5EGO B;  3GTJ J;  3SJM A;  5JLW A;  2XPV A;  2NOG A;  3FKI J;  4LOC A;  3S1R J;  3I4N J;  2LFB A;  3BR1 A;  2QIB A;  3H0G J;  5DS9 A;  5IPA A;  4L5E A;  1B72 B;  3FIS A;  3VIB A;  3VVX A;  3L1P A;  3JRB A;  2CU7 A;  1JUS A;  2KDZ A;  2DN0 A;  1F43 A;  4IHV A;  3BTI A;  3HB9 A;  3BR0 A;  2M8G X;  4XK4 A;  4X1E A;  2JA8 J;  3MKL A;  1TWC J;  4D5F A;  1YRN A;  3LNQ A;  5M5W J;  1GUU A;  2HQ5 A;  3JRF A;  4XRM A;  2M0C A;  5K7F A;  3HTA A;  3V6G A;  1FTZ A;  4RDU A;  2XRL A;  1JKR C;  3T6N A;  1WH7 A;  5K58 A;  3OOU A;  1ZK8 A;  5GPA A;  2NVQ J;  4A3I J;  3G7R A;  2XGC A;  2AHQ A;  4M3E A;  3TP0 A;  2GEN A;  1BJZ A;  4UUS B;  5D1R A;  2L7F P;  2Y0S N;  3CQZ J;  5EEA A;  4V2G A;  5H9T A;  4BXX J;  2MW8 A;  1H88 C;  3GBG A;  3G1O A;  4GFK A;  2RHA A;  1NK3 P;  1GV2 A;  2X48 A;  4FTH A;  3VW0 A;  5J1R A;  1IG7 A;  4QIW N;  3JRC A;  2L0K A;  3CWR A;  2ID6 A;  2LTP A;  2COB A;  2H8R A;  2ZOY A;  5F08 A;  5F1J A;  3PO2 J;  1W0T A;  3LSP A;  3O60 A;  3HGY A;  5J1U A;  3SDG A;  1IV6 A;  2JJ7 A;  1ETY A;  1NK2 P;  3TP3 A;  3VPR A;  5F0H A;  2NS7 A;  2IEK A;  1MNM C;  1OCT C;  3HDD A;  4JX6 A;  2XPW A;  5D18 A;  2DTZ A;  1OCP A;  1RR7 A;  2Y9Z A;  1R9T J;  2R93 J;  2JMW A;  1OJL A;  5M5X J;  4IHY A;  1ETQ A;  2LK2 A;  4M3F A;  1VFC A;  1BW5 A;  5CXI A;  2Y2Z A;  3LHQ A;  4A3F J;  2CUE A;  2DA2 A;  3ZQF A;  5F27 A;  2VPR A;  5IP9 J;  2HDD A;  4B1R A;  4A69 C;  4C3H J;  1X58 A;  4A93 J;  3GZI A;  3BTL A;  3K7A J;  5C4X J;  3QQA A;  1IC8 A;  1ETX A;  5HBU A;  3A02 A;  5IYD J;  2NP3 A;  2GM4 A;  2UXU A;  3RQI A;  1I50 J;  2HI3 A;  1UMQ A;  3IH3 A;  2FD5 A;  3E7L A;  1RPW A;  1IRZ A;  2XGD A;  4UUT A;  1WH5 A;  2E2I J;  4FE7 A;  2TCT A;  3FIW A;  1ZQ3 P;  2JK3 A;  3DEW A;  4M6V A;  3DCF A;  2DA7 A;  1I6H J;  4UDS A;  2PZ9 A;  4Y7N J;  2O8K A;  1GT0 C;  1RET A;  2WB1 N;  1UI5 A;  4JYK A;  2NS8 A;  4RBO A;  3OSG A;  3HTJ A;  2DJN A;  1U9N A;  4JX4 A;  3S2D J;  2ZOZ A;  5CXG A;  4QSH A;  1JKO C;  1JJ8 C;  4AYB N;  4A3M J;  1LFU P;  5HAW A;  2YU9 J;  1VI0 A;  3KKC A;  1WGX A;  3PM1 A;  1IDY A;  3RKQ A;  3GTK J;  3BTJ A;  2H1K A;  2R0Q C;  2IAI A;  5EZH A;  2MSY A;  5GPC A;  2L9R A;  1H89 C;  1B72 A;  2W53 A;  4C2M J;  2G7L A;  5FLM J;  3K2A A;  1U78 A;  3GTL J;  4NEL A;  3MVP A;  3HEF A;  3QPS A;  4MO7 A;  2Q24 A;  4XRS A;  1LE8 B;  1AKH B;  2OPT A;  2VKE A;  1RES A;  3BTC A;  2FX0 A;  2LR8 A;  3GTM J;  4B4C A;  2E2J J;  1UHS A;  1HLV A;  1RKT A;  2JA6 J;  4BY1 J;  1DU6 A;  3Q0W A;  4CYC B;  5BNG A;  1T56 A;  1SFO J;  5IOZ A;  4JL3 A;  5FJ8 J;  1HOM A;  5EG0 B;  1PUF B;  2PBX A;  3DPJ A;  3MN2 A;  5CW8 A;  2VUM J;  2UXI A;  3NXC A;  2Y30 A;  3A01 B;  1HDP A;  3PAS A;  2DA5 A;  4ACI A;  4MFE A;  4NDL A;  2HKU A;  1ENH A;  4G12 A;  3ZQL A;  5FGL A;  5E3L A;  2YVE A;  2K9S A;  3PO3 J;  3TW7 A;  2FQ4 A;  3BG5 A;  1NTC A;  3G56 A;  2E2H J;  3VW2 A;  4J19 A;  3JRH A;  2JA7 J;  9ANT A;  3B6A A;  1TWF J;  3PPB A;  2LVS A;  3HM5 A;  1MH4 A;  2L7Z A;  3AQS A;  3HGG A;  3ON2 A;  1Q1V A;  5M3M J;  5C4J J;  3IH4 A;  1ZR4 A;  1UI6 A;  5D19 A;  2MGQ A;  1CQT A;  4PXI A;  2QF7 A;  1MSF C;  1FTT A;  3MNL A;  2GFN A;  2TRT A;  2DMU A;  3CRJ A;  1ZR2 A;  1JT0 A;  3NPI A;  5IOY A;  4XID A;  3CJD A;  2M2E A;  1JKQ C;  2XSD C;  4I6Z A;  4Y52 J;  1JTX A;  1GV5 A;  3IV5 A;  4A3K J;  2R92 J;  2ME6 A;  3Q3S A;  2LY9 A;  1T33 A;  2B63 J;  2WV1 A;  1AU7 A;  3NAU A;  2YS9 A;  2G7S A;  1ZKG A;  5J1Y A;  2EBI A;  5C4Y A;  3S1N J;  3HKZ N;  1LFB A;  2YVH A;  1U9O A;  3GTG J;  2HYJ A;  5EZG A;  2XDN A;  2PMZ N;  1Z0X A;  3BCG A;  2OF7 A;  2VKV A;  1IJW C;  1XG1 A;  1HCR A;  1BL0 A;  2I10 A;  2XGE A;  2EZH A;  4JX5 A;  2HXO A;  3BNI A;  2DMN A;  3TED A;  2DG8 A;  3HIM A;  3VVZ A;  2LKX A;  3M4O J;  1MH3 A;  2NX4 A;  3LSJ A;  3COL A;  2D5V A;  2OI8 A;  2NVT J;  3NAR A;  4GCL A;  1MBH A;  4M3B A;  4JKZ A;  2FJ1 A;  3HOV J;  2ZCN A;  1K61 A;  2HOT A;  5DTD A;  4YZE A;  1FIA A;  5M5Y J;  3CMY A;  4CGR A;  3VOX A;  2R5Z B;  3S1Q J;  2OER A;  3LOC A;  3M3Y J;  3Q0U A;  3GEU A;  2EH3 A;  4A3G J;  2ME0 A;  3RD3 A;  3F1B A;  2XB0 X;  1WI3 A;  3ZQC A;  3VUQ A;  3IUV A;  3KKD A;  3BRU A;  3IH2 A;  4B3A A;  2O9L A;  1I3Q J;  5IYC J;  1JJ6 C;  2GBY A;  2GLO A;  1P7J A;  1F36 A;  2EZI A;  4D7N A;  5F0C A;  1LE8 A;  1QPI A;  1AKH A;  4GFL A;  4DW6 A;  1RKW A;  1IGN A;  3GTO J;  3S1M J;  3BG9 A;  3S2H J;  2JWT A;  3GTP J;  3ZOB A;  5EGO A;  1ETV A;  4JP0 A;  2ZCM A;  2LLK A;  3JR9 A;  4CYC A;  2XPU A;  1FEX A;  2EZL A;  5EG0 A;  1PUF A;  1ETO A;  1Y1W J;  4FCY A;  3O8G A;  5F0F A;  1DU0 A;  2QKO A;  3LWJ A;  3VP5 A;  2HOS A;  4M3D A;  2ECB A;  2K9N A;  3A01 A;  1POG A;  5K7Z A;  5HSZ A;  5FMP A;  2UXH A;  3Q0V A;  4JNN A;  4AC6 A;  5EF6 A;  3OIO A;  4BKX A;  3LSR A;  2NVY J;  4GCK A;  2DMP A;  4BBR J;  4IHX A;  1Y1V J;  2F07 A;  3SFI A;  1AHD P;  3QKX A;  1X2N A;  2VI6 A;  2W48 A;  2G0E A;  3I4M J;  2IU5 A;  2DG7 A;  3S5R A;  5IYB J;  1JKP C;  3BG3 A;  1MBF A;  2DA3 A;  2K40 A;  1JTY A;  4UUS A;  2R5Y B;  1MBJ A;  4FIS A;  1B8I B;  1WCM J;  4IEJ A;  1HF0 A;  3H3V K;  3GTQ J;  3JRE A;  3C07 A;  3V78 A;  4BY7 J;  4A3D J;  2NP5 A;  3JRG A;  3VW1 A;  3EUP A;  2LP0 A;  4DZP A;  3NRG A;  2RAE A;  5EDN A;  5JLX A;  1ZGW A;  4ABZ A;  2YUS A;  3BR3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...