3BTJA

Crystal structure of qacr(e58q) bound to dequalinium
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
186
structure length
186
Chain Sequence
NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEQSKWQEQWKKEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords HTH-type transcriptional regulator qacR
publication title QacR-cation recognition is mediated by a redundancy of residues capable of charge neutralization
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 83
structure length 186
sequence length 186
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2007-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3btjA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3btjA02
2DG7A 3JRCA 3D1NI 1RR7A 4B3AA 2AO9A 3WHCA 1GVDA 1HOMA 2HQ5A 2YUSA 1OFCX 2KDZA 2ELKA 2Y31A 4FISA 5IYBJ 3CQZJ 4V2FA 2O7OA 5E3OA 4Y7NJ 3LNQA 3OOUA 1NTCA 2Y9ZA 3K7AJ 1A5JA 3O8GA 3T6NA 1F36A 3QPSA 3KZ9A 5HBUA 2M34A 4DYRA 5CXGA 1MH4A 1S7EA 4G12A 5K7FA 2HXOA 2X9DA 1RETA 2JA7J 4AC0A 5DAJA 2JA6J 4FE4A 1F43A 1I6HJ 5CXIA 2COBA 4A3LJ 3DPJA 3BRUA 1FIAA 2NOGA 1YRNB 1ETWA 1QVTA 2DMPA 2E19A 3BTJA 1HDPA 1RKTA 1TC3C 9ANTA 1JTYA 3VPRA 1MSEC 1FJLA 5FMPA 1ZK8A 2K40A 4M6VA 2G7SA 2NX4A 2RASA 3BR5A 1ZR2A 3V78A 3S16J 3E7LA 3F1BA 1ETXA 4GCLA 2R0QC 3LSGA 2EZLA 3RQIA 4UDSA 1SANA 3FIWA 2K9SA 3BTLA 1TWCJ 1ZTRA 3IUVA 3OSGA 1OCTC 3HGGA 2HYTA 1HCRA 5D1RA 2D5VA 3L1PA 3A03A 5EG0A 3GBGA 1IGNA 3LSRA 3JRDA 3A01A 4NELA 3HOWJ 4YZEA 4MIMA 5EEAA 2CUFA 3VVYA 3HOVJ 1LFBA 2TCTA 4NDLA 3JRGA 5FLVA 1WI3A 2GM4A 3VVXA 2L0KA 5EGOA 3BR3A 3G1OA 1JT0A 1TWFJ 5IP9J 3HTHA 2QOPA 1VNDA 2K9NA 3VP5A 3GEUA 2DMUA 3HM5A 3Q0WA 3MN2A 1QVUA 3BHQA 3Q0VA 3BT9A 5EYRA 4UUSA 1W0UA 3A02A 3HGYA 3LHQA 2JA5J 3HIMA 1B72B 4FTHA 5K58A 3S2DJ 5F0HA 3GTLJ 1T33A 2FBQA 5F1JA 1BA5A 1IG7A 2XGDA 3HOYJ 2JJ7A 2JN6A 3HOZJ 1JUPA 3ZQGA 3BR6A 2OPTA 1AKHB 2OF7A 4QIWN 1ZGWA 2UXOA 5K7ZA 2L7ZA 2DG8A 3WHBA 2QKOA 5D19A 2NP5A 3O8HA 3MNLA 4JYKA 4MK6A 5FKLA 2ID6A 2DA6A 5FKOA 2UXPA 3I4MJ 1ENHA 3DCFA 3PO2J 5EZHA 5IYDJ 4AYBN 3NNRA 2EZIA 3EUPA 4IHYA 1OJLA 2XRLA 4X1EA 4XRMA 2XGEA 2L7MP 1APLC 4AF5A 1ZQ3P 5JLWA 4GCKA 2ZB9A 2ME0A 2MG4A 2HDDA 5IP7J 1XS9A 3HTIA 3ZQIA 2DA3A 2HI3A 2LY9A 3ANGA 2UXUA 1MBGA 4D5CA 1PUFA 2CQXA 3HTAA 4M3BA 3NXCA 3HEFA 3Q3SA 3GTMJ 2NVXJ 2XPVA 2VKVA 3BQYA 1U78A 5FJ8J 2ZCXA 1Y1WJ 2CQQA 1FEXA 2I10A 3FK6A 1QRYA 3IH2A 5JLXA 2H8RA 4W1UA 1H89C 3UKGA 1E3OC 2HOSA 2HOAA 1JJ8C 2LVSA 1ETQA 3MKLA 2LLKA 1ZKGA 4CYCA 4BY7J 1Z0XA 4ABZA 1MNMC 3QKXA 1G2HA 1MSFC 5M5WJ 4DYCA 2MSYA 2PZ9A 4D5FA 3ZQLA 3JRHA 4JX5A 5M5YJ 1ETOA 4JX4A 3ZOBA 4BKXA 2M0CA 3GTGJ 3QPLA 2NVYJ 2YU9J 3S15J 4UUTA 2GFNA 1TWAJ 4C3HJ 5F27A 3GTQJ 2OI8A 4GFBA 3MVPA 2PMZN 1IV6A 5GPAA 2Y0SN 4QSHA 1GUUA 1ZR4A 2E2JJ 1UI6A 3ON2A 1U8BA 2ZOZA 3OSFA 3H3VK 2RAEA 2LP0A 4HNVA 3B81A 4LOCA 5IOZA 1POGA 3FISA 5GP9A 4A3MJ 2WAQN 2K9QA 3BCGA 5GPCA 5F0FA 4X6AJ 5DTDA 4A93J 3GTKJ 3QQAA 2YVEA 3V6GA 1MBFA 4BY1J 2DJNA 1AHDP 3TW6A 2Q24A 1JT6A 2R92J 3LJLA 3BR1A 2ZOYA 2W53A 5J1YA 2NVQJ 2OERA 5HODA 3RD3A 3ZQCA 2MGQA 4RBOA 2ECCA 2LFBA 2XSDC 2TRTA 3HOUJ 5FKNA 3PO3J 4IHXA 1R9TJ 2WGBA 2M9HA 2CUEA 4J19A 2QF7A 1OCPA 2RHAA 5IOYA 5IP6A 2R5ZB 1FTTA 1B8IA 2IU5A 2DMNA 2FJ1A 2JWTA 4DW6A 5EDNA 2WUIA 1BL0A 2O8KA 3TW7A 1UMQA 2EZKA 4GFKA 3OIOA 1ITYA 1I50J 1MBJA 2XGCA 1Z77A 3BNIA 4PXIA 1WH5A 3FKIJ 3Q0UA 2G7GA 1RPWA 3M4OJ 2NS8A 3FK7A 5FLMJ 2R93J 2NVTJ 4QTRA 2FD5A 2VI6A 4AC6A 2ECBA 1RESA 2ZCNA 4DYQA 4NN1A 3DEWA 1LE8A 4FCYA 4B1RA 2XPUA 2DA7A 3A01B 4A3JJ 4JKZA 2X6OA 3S1MJ 3VOXA 2YVHA 1IDZA 3CDLA 4MO7A 2UXIA 1CQTA 2GENA 3RZDJ 2EQRA 4BBRJ 3KKDA 1MBHA 5EGOB 4D7NA 3TEDA 4V2GA 5FKMA 2LTPA 2KT0A 2XB0X 2XPWA 2CRGA 3ANPA 1IDYA 1XC5A 5H9TA 5E3MA 2O7TA 2IAIA 2LKXA 1WCMJ 1TWGJ 4JP0A 4UUSB 3I4NJ 5F08A 3LWJA 5E3LA 3BTIA 5AQCA 3F0CA 1I3QJ 1BW5A 4A69C 4BXXJ 1XG1A 3JRIA 4D7MA 3JRBA 4ACIA 2GBYA 5K7HA 1P7JA 4IHVA 1ETKA 1JUSA 3BG5A 2EBIA 2QCOA 3TP0A 4A3KJ 3CCYA 5F04A 4ME9A 4XRSG 3HTJA 5BNGA 4XICA 3AQTA 4DZPA 1H88C 3FRQA 3RZOJ 5F0CA 3JRAA 2EZHA 3QBMA 2HKUA 2FQ4A 1EF4A 1MBKA 3S5RA 3ZQHA 5C44J 3EGQA 1FTZA 2X48A 3BR0A 4JL3A 2WV1A 4M3GA 5C4YA 1YRNA 2M2EA 4M3DA 4C3JJ 3TP3A 1VI0A 1X58A 2L9RA 3JSJA 2B63J 4ICHA 1JKOC 5FGLA 5M5XJ 3S17J 5J3LA 2N8GA 1IJWC 5HSZA 2HOTA 2ID3A 5C4XJ 1WGXA 5IYCJ 1HLVA 2E1OA 2DMQA 3C2BA 4XIDA 2MW8A 1Q1VA 2L7FP 2R5YB 5M3FJ 3IV5A 3M3YJ 2DTZA 1PUFB 4JNNA 3VUQA 3LOCA 3VW0A 4CGRA 2FX0A 2JK3A 1WPKA 2W48A 3BG3A 1DU0A 1A6IA 3CJDA 3ZQFA 2QIBA 4L5EA 3C07A 5DS9A 3BR2A 1HF0A 2YS9A 2JA8J 3LSPA 3GZIA 1ETYA 4B4CA 4IHWA 2E2IJ 4MLOA 3KKCA 4MFDA 4C2MJ 2O9LA 2R5ZA 1P7IA 2Y9YA 4CYCB 1SGMA 2NP3A 1JUMA 3VW1A 1RKWA 2IBDA 5FKKA 4M3EA 5J1RA 1D5YA 2G3BA 3JREA 3GTOJ 4AUXA 1JTXA 3HKZN 4I6ZA 2LD5A 1O4XA 4Y52J 2Y2ZA 5M3MJ 2XB5A 4MXMA 5HAWA 4KWAA 3HDDA 2D6YA 2Y30A 1VF9A 1B72A 3VIBA 1ORKA 4A3FJ 3GTPJ 3PASA 3S1NJ 2VUMJ 2CJJA 1IUFA 4MFEA 4IEJA 1JKPC 3SDGA 2F07A 4A3DJ 3CWRA 4JX6A 2ME6A 1AKHA 3BJBA 4HKUA 2H1KA 3NI7A 4A3GJ 2UXHA 3CRJA 3BTCA 2G0EA 2HXIA 1JGGA 1UG2A 3RKQA 5FHPA 4S0HB 1DU6A 1MH3A 3G1MA 2HYJA 1IC8A 4FE7A 3RH2A 2EH3A 5J1UA 5EG0B 3S1RJ 3BG9A 2E2HJ 2XDNA 5CW8A 2PBXA 1X2NA 4I76A 2GUHA 3O60A 3S1QJ 1BJZA 4L62A 4W97A 2DA5A 1GV2A 2NS7A 2VKEA 5EZGA 3ON4A 3NRGA 5D18A 4A3BJ 2DA2A 5IPAA 1QPIA 4A3IJ 3PPBA 3GTJJ 3JRFA 1HDDC 1UHSA 1WH7A 1JJ6C 5EF6A 1GV5A 4A3EJ 1X2MA 5C3EJ 4XRSA 1B8IB 1MBEA 4EEFG 2ZCMA 1TWHJ 3NAUA 1BW6A 1FIPA 1K83J 3SJMA 2QTQA 3PM1A 5C4JJ 2IEKA 3K2AA 1AU7A 3COLA 2AHQA 1U9NA 2DA4A 3P9TA 2DN0A 4RDUA 1U9OA 1K61A 1JKQC 1NK3P 3VVZA 3JR9A 2VPRA 4A3CJ 4DZJA 3S14J 1Y1VJ 3W6VA 2GLOA 1GDTA 2R7ZJ 3HB9A 2REKA 3SFIA 4M3FA 3NARA 3VW2A 3AQSA 2LK2A 1NK2P 1T56A 3B6AA 1H8AC 2DA1A 2G7LA 3B6CA 3IH3A 3E7QA 1LE8B 1GT0C 3G1LA 1W0TA 1JKRC 2JMWA 4XK4A 2M8GX 5EFYA 1UI5A 4GCTA 1SFOJ 3CMYA 2CU7A 1IRZA 3G7RA 3VOKA 3HBLA 5E3NA 3BQZA 3S2HJ 2WB1N 3LSJA 2QWTA 4C3IJ 3HOXJ 3IH4A 2R5YA 4GFLA 3G56A 1ETVA 1LFUP 2DMTA 3KNWA 3NPIA 2LR8A 2V57A 4BBSJ 3HE0A 3H0GJ 2P81A 1VFCA
chains in the Genus database with same CATH superfamily
2PG4A 1TP4A 2I5UA 3JRCA 2H94A 2MC3A 3L00A 2BZTA 2AO9A 2V9PA 4C2UA 3P9CA 2ZMEB 4B09A 1A6QA 3HRTA 3N4MA 4BE0A 3G6EI 3WE3A 3SEQA 3OYMA 1K78A 3K7AJ 3SFZA 3W2WA 3X2QH 1A5JA 3T6NA 1W1WE 4HPQA 4B3XA 3ZPLA 4AU7A 4PJ0C 4DYRA 4G12A 4KIBA 1PP8F 3LAPA 4XR6A 2L9NA 2HXOA 2X9DA 2K85A 2VE9A 3K70C 1Y6IA 1GLNA 3BRUA 2NOGA 4RAZA 2E1CA 4GO1A 3TO6A 1STZA 1Y8RB 1G8XA 1WJFA 3TOAA 5FMPA 2KISA 2XDVA 3U9GA 4MTDA 3GVAA 4HBLA 1SAXA 2F4MB 4D0PA 3S16J 3V8KA 4GCLA 2IPQX 3AG2H 3FIWA 2K9SA 2W7NA 2P5LC 3FM3A 4EQQA 1OCTC 4OIOF 3HGGA 2O5RA 2BBYA 3MKWB 3L1PA 5BMZA 3GBGA 4NC6A 3I55I 5F1RA 3JRDA 4Y13A 1G3YA 1XGOA 2B3WA 1S9HA 5EEAA 2HVSA 1A04A 1R1VA 1W36C 1X1BA 1T95A 2TCTA 2FUG2 1LUJB 2HR3A 5D5XB 1IUYA 4O6JA 5HLGA 1O7FA 5EGOA 1FOXA 1KU9A 5CJ9A 3ECOA 3G1OA 2Y0MA 5LD2C 3ZRGA 1JT0A 4E7LA 2QENA 5IP9J 3HTHA 1UFMA 1YX3A 2QOPA 4RGUA 2ZXHA 2EFWA 3VP5A 1ERDA 2M7AA 3Q0WA 5IY5H 5CKTA 3NS4A 3BHQA 4EJTA 2WBMA 3BT9A 2VBWA 2DYSH 1ZN2A 3A02A 3HGYA 1Z9CA 3R6SA 5E8GA 5J4YA 1YFHA 1B72B 2AQFA 2HQNA 1MZBA 2JVGA 2NNNA 2DOEA 5F0HA 2E7XA 3BG6A 3IC7A 4AWXB 4P5OA 1IG7A 1WI9A 3A0HC 3GZ6A 4RB3C 1JUPA 1B1BA 1XGSA 1YYVA 2M1BA 3ZQGA 2OF7A 1T0FC 4QIWN 3MZYA 1ZGWA 2L3DA 1Z7UA 4MNUA 2ZFWA 3U21A 5KNLA 1W5SA 3DKWA 4XM3A 4GRIA 4I7HA 3CC4I 2ID6A 2L4MA 2CYYA 5FLXK 4RS8A 2STWA 1TT0A 4PJLA 5IYDJ 2IVMA 3EYYA 4IZZA 2KFDA 2HTJA 3EUPA 4LJZF 4IHYA 1SD5A 2IA2A 1I6XA 4X1EA 4E6KG 1LVKA 1RNLA 4LK1F 2A68F 1B6AA 4HQMA 4Y3OA 4EV0A 3J7AO 2Y69H 5JLWA 5GADJ 2ME0A 3MKZA 5JFRA 3I4PA 1EH8A 2YX7A 3ZQIA 1GXQA 2LY9A 1X3UA 2BXZA 3AG4H 2KZVA 3D5SC 3GFLA 3MCZA 4D5CA 2WC2A 5LBQA 1WSUA 1RI7A 3EETA 3LA3A 4M3BA 3VDXA 4S04A 4QLCU 3Q3SA 2BHYA 3E6CC 2XPVA 2Z1DA 4P96A 1BI3A 1XD7A 5HLHA 2I10A 3FK6A 1AA7A 3IH2A 1MGTA 1X1CA 4CCLA 3DWLE 4W1UA 3CJNA 3EUHC 2BE5F 4A5MA 2CV0A 2OQRA 4B43A 3OMYA 1ZKGA 4BY7J 1Z0XA 3TL4X 4ABZA 1MNMC 3QKXA 3QYFA 1J2XA 2FA5A 4HX7A 2MSYA 2CSOA 2XIGA 1MJAA 2VOPA 4XRFA 3JRHA 4JX5A 4RGXA 2VN2A 3LQQA 4BKXA 1UELB 3KP7A 2KLOA 1D5VA 3S15J 3C2GA 2P6SA 3H3UA 4ZDLA 1G59A 1I1SA 3VWBA 4GFBA 2R7RA 3MVPA 5GPAA 2XAQA 2DOFA 3WTSC 3ON2A 1U8BA 5AIPA 3OSFA 3H3VK 2LP0A 2NYXA 4LIVA 3HKZA 3ABUA 1VQLI 4LOCA 5IOZA 1POGA 3FISA 4A3MJ 3QP6A 4ESBA 4BQOA 2UXXA 3GEZA 3CCJI 5GPCA 1LQ1A 1DDNA 3IKVA 3FBNB 2MFZA 5A2QZ 1W36D 1K78B 3RYPA 4XLPF 2ELHA 2HDWA 1YIJI 2R92J 3LJLA 2W53A 3B02A 5HODA 1H0MA 2R7WA 2LFBA 2TRTA 1UG0A 1SD4A 2WGBA 3JCUC 2V9VA 2FBIA 4XLHA 5IP6A 2IU5A 4DW6A 4XLFA 4KITB 2V4JC 3TW7A 3RPUD 2L01A 1G3WA 3OIOA 4XLAA 1DGWY 4AVPA 3LQRA 4UNOA 1Z77A 1X1PA 4PJNA 4HQEA 1R71A 4PXIA 1WH5A 3QP5A 2Z2SB 1KQ9A 4HNUA 3WTTC 3K8PC 2G7GA 4CUGA 2P8TA 3CCSI 3M4OJ 3TDUC 1VQPI 1D1BA 5FLMJ 2CWEA 3HSEA 3COAC 3I0TA 4M73A 1FMVA 1B4AA 3FXQA 3ASOH 2HS5A 3FWEA 2V6CA 3PIOF 2CW0F 1MJ9A 2KRCA 2LBFA 4FCYA 2DA7A 4F3QA 1FY7A 1YS7A 2DO7A 3K0LA 3K4MA 1TT5B 4XN0A 3S1MJ 3RPQA 1IDZA 2PQ8A 1P6RA 4MO7A 4NB5A 3VSLA 1SC7A 2UXIA 1MDMA 3RZDJ 4MEXF 2IS6A 3IWZA 4RMNA 5EGOB 3OYEA 4D7NA 3TEDA 1V3FA 4AYBA 1FX7A 2HZTA 2LTPA 1IV8A 1S6LA 2KT0A 2XPWA 2VLAA 1CF7A 3ANPA 1IDYA 5E79C 1XC5A 5H9TA 5J8FA 1WQ2A 2O7TA 4PJJA 2LMDA 4PSWA 4OU0A 2W57A 1A31A 3I4NJ 3JTHA 1NHAA 3PQJA 2M4KA 4BUPA 1I3QJ 1WJCA 3F0CA 4OAYA 1PUEE 2GBYA 5K7HA 4IHVA 3F22A 2L9SA 4KUMA 3RQ4A 4XKVA 2DXIA 4ZYEA 4ME9A 1J5YA 3OL3A 1G3SA 4DZPA 3HSRA 1LEAA 3RZOJ 2WAEA 3JRAA 3QBMA 4GCVA 2UV1A 1B9MA 1ZLJA 2OCCH 2PN6A 4NUBA 3T5XA 3ZQHA 2ZJRF 3S5RA 5C44J 4EJWA 3QYEA 3G3ZA 4JL3A 2DT7B 3RKYA 2O3FA 3ONQA 3TP3A 4HX4A 4QWQA 4L0ZB 2H8WA 5FD5A 1JKOC 4EMSA 2N8GA 5HSZA 4A6DA 3V8JA 4F52A 3DQVC 2W1OA 5TRDA 4UV9A 3QWLA 3A2KA 2W4SA 2ZO4A 4XIDA 4CCOA 1HA8A 4UVBA 2HQAA 2HPIA 1KGSA 3OY9A 2FX0A 4WK8F 3BG3A 2W48A 5EEHA 2EV0A 1LDJA 1OQYA 4E7ZA 5LRRA 3QYBA 1QHGA 1QO0D 1X19A 4B4CA 2VOOA 3KKCA 2DTRA 5F6FA 4C2MJ 1SD6A 4BHBA 1HSJA 1P7IA 1I27A 3CMAI 2NP3A 2LF8A 2ZY9A 1QPMA 1JUMA 4ZC3A 4RB2C 1QA6A 2RVCA 5ILSA 2Z33A 3GF2A 1UZCA 2O0YA 2CMPA 4H4KC 4E7SA 5J1RA 3JREA 1D5YA 1XTAA 4AUXA 4MHGA 4I6ZA 1XGNA 2MLGA 1D3YA 4DIQA 3K4BA 1G3TA 1B59A 2Y2ZA 1OCZH 2MBFA 2XB5A 3VIBA 2RV8A 2UUZA 3KZYA 2ZSHB 3R60A 4NQWA 3REOA 3TQNA 4A3FJ 1D1CA 1LPQA 1FBQA 4MFEA 3H35A 2A3SA 3SDGA 2XC7A 1VQ9I 2F07A 2OAZA 2OV7A 4MQVA 2ELJA 2JPBA 3OYBA 4WX9A 3ZMTA 4WXDA 2MD5A 3BJBA 4HKUA 2EFOA 2COMA 2ZXIA 3CCQI 3DFGA 1JGGA 3F72A 4PZJA 1DU6A 2M8EA 2NAZA 3G1MA 4FE7A 3RH2A 2EH3A 5ED4A 3S1RJ 3CMMA 2PJPA 2L02A 2CFOA 1BJZA 3H1CA 3A0BC 3GXOA 1YW7A 2K4BA 3FXMA 3V7RA 2DA2A 4ANJA 4A3IJ 2HVQA 1BJAA 2O61A 1HXDA 1RIOH 1XX5A 1OR7C 1X2MA 1TWHJ 2ZNYA 3KP2A 1K83J 3MFKA 3K2AA 1NG7A 1KYZA 3LSKA 3M8JA 3CCUI 1IN4A 2JT1A 4XORA 3P9TA 1R58A 4ASNA 2DU9A 1XMAA 2EFQA 1K61A 1V4RA 2IS2A 2VPRA 3S14J 1OLTA 1Y1VJ 2GLOA 3I3LA 2GXBA 4M3FA 2IS1A 2JZYA 3TOBA 3AQSA 2RNGA 4LFUA 3B6AA 1HC8A 1N25A 3E3VA 3TBIA 4EGYA 2DFHA 3WODF 3G1LA 5DCMA 2LBFB 2JMWA 5DUKA 1IRGA 4Y15A 1UI5A 1ZAOA 3HOTA 4E7KA 3G7RA 5E3NA 2A5WA 2CQNA 2NS0A 3BQZA 4AIJA 3S2HJ 2X6WA 3LSJA 3HOXJ 3H92A 1T38A 3IH4A 4ZH4F 2E35A 4YFNF 5GTHC 2VXZA 1IXCA 2A05A 4I01A 2DMTA 2E1MC 4O5VA 4LLLA 4BBSJ 1CF7B 3LSMA 2HKXA 3CUOA 2L7MP 1FP2A 3GZ5A 3GWZA 2QKLB 1IRXA 3BY6A 3D1NI 1E3HA 1I3AA 3WHCA 2YUSA 1OFCX 2KDZA 2Y31A 2A61A 5IYBJ 3CQZJ 4V2FA 4TV7A 2O7OA 2IT0A 4ON0A 1V55H 4UXNA 3OOUA 1HW2A 3KP5A 3O8GA 1FLIA 4CHUA 2K5CA 3OR2C 3QPSA 2X1DA 2ZJPF 5HDGA 2DFEA 4G6DA 2M0MA 1MH4A 1P4AA 4HRIA 2O03A 2ZJ2A 3K1PA 4CGZA 2PFVA 1LNWA 1RETA 2WAQA 2JA7J 3FM5A 1MNEA 1VQKI 4FE4A 1WKMA 4PCQA 1F43A 2X1CA 5CLSA 3BPVA 3G2BA 3TKYA 4WWCA 5L3DA 4ZZDA 3OYCA 4A3LJ 3ZXSA 2GOXB 3J81Z 3BG7A 3IRRA 3BZCA 2DMPA 2E19A 4BS9A 5BQTA 3HL2A 1TC3C 9ANTA 2F4OB 2MABA 1FSEA 3VPRA 1MSEC 3BP8A 2EJRA 3NWTA 3BR5A 1J9IA 2ICWG 4UVAA 2R4GA 1ETXA 2ISZA 4UDSA 3BTLA 1ZTRA 2OZUA 1HCRA 5D1RA 3M1CA 1FOWA 3HRUA 4PSXA 3LSRA 1S7AA 3ESWB 4KYWA 2XF5A 4DBRA 2PFBA 2V1NA 3P7NA 2HYFA 1RR8C 2DBBA 1USSA 2B1EA 2M7BA 3HOVJ 2HYGD 1Q1HA 3H9GA 1QNTA 2IGMA 2KIFA 2EB7A 1CGPA 1P4WA 5FLVA 2TDXA 2DJIA 2GM4A 1YIOA 1LEBA 5JVGF 2XAUA 2OD5A 2BW3A 2DMUA 2Z16A 1W5CC 2WTEA 3Q0VA 5FROA 4PJMA 4UY8I 3PSIA 4B44A 2CQ7A 3ISPA 4Q48A 3IWFA 5FGMA 5HDKA 2LF7A 4NQWB 1KQ8A 1IN6A 4XBFA 2FBQA 2QQ9A 5F1JA 4LG3A 2LYCA 3HG9A 3KPHA 2XGDA 2JJ7A 5HLTA 3C1DA 3Q9SA 3L2QA 4D9JA 2IJLA 4LMYA 2UXOA 5K7ZA 3DBHB 3WHBA 2QKOA 5D19A 1E17A 1REPC 3O8HA 2H09A 4MK6A 2I8DA 3EPZA 5FKOA 3BZ6A 1ENHA 4BACA 5EZHA 4WCGA 3HXLA 2K9MA 3TDZC 2JQ7A 2EZIA 2LH9A 3PIPF 2XRLA 2XUBA 3F8MA 1WJEA 1ZQ3P 3EUHA 3CP2A 4WXCA 2KP6A 2X0LA 4GGGA 4LB5A 4GCKA 3S3MA 2B0LA 3QU6A 1BI2A 2MG4A 2HWVA 5HS7A 3OYGA 3N05A 4WIBA 4A0ZA 2DA3A 1VZ0A 3RYRA 1ZREA 1U5TC 1MBGA 3H0DA 2RDPA 3HTAA 4XKCA 4IQJA 3GTMJ 4MEYF 5DM7F 1EH7A 1LDDA 2CQQA 2XSJC 4XLNF 3ZMZA 4BE1A 3S3OA 1H89C 4UV8A 1E3OC 2HOSA 2PMHA 1ETQA 3FX3A 2Y48A 4L5JA 2LLKA 3VYUB 4CYCA 4BDZA 1Y0NA 1Y56A 2HPMA 3ABTA 2ZMEC 5DD8A 4OMYA 4LLGF 1G2HA 3ERMA 4BNCA 2Z5UA 3QPHA 1MSFC 1Z67A 3PNTA 5DCMB 5LLQA 5HDNA 3AKZA 4N0BA 1ETOA 2L54A 2FOKA 2P7CB 2M0CA 4IOCF 3JSOA 1U3EM 1YJNI 4KIFA 3SZPA 1YO5C 5F27A 3T8RA 4E70A 5D5UB 3GTQJ 2PMUA 4U0WA 2KPMA 4QSHA 1IXRC 3E6DA 2E2JJ 2KZGA 3RJPA 1UI6A 5AIQA 2RAEA 2ZFUA 2J5OA 1SD7A 2JSPA 3LA2A 3FMQA 2VASA 1ZG1A 4IXAA 2UXNA 1TZLA 3BCGA 4X6AJ 5DTDA 3OYLA 3R0AA 1P92A 3CD6I 2YVEA 1YX5A 3RTRA 4DNCA 4Y33A 4U7BA 3BR1A 2ZOYA 2JTVA 1PJRA 1KU2A 3WG9A 1F1ZA 3ZQCA 2ECCA 2XSDC 1ZHFA 3HOUJ 5FKNA 5BS6A 4PFPA 1R9TJ 2C6YA 3OIPA 2XAFA 2CUEA 3SWHA 2RHAA 1B9NA 3WG7H 5IOYA 1FTTA 1B8IA 2P5VA 2DMNA 2FJ1A 2JWTA 4QPOA 3KYLA 3GO5A 3NWSA 1UMQA 2EZKA 4S05A 5CVRA 4MQ9F 3OS1A 1MKMA 2IA1A 3LAJA 2R7QA 1RPWA 4KDPA 2QSGX 1XMKA 2RN7A 5GAHJ 1K4SA 3CUQA 2CS3A 3I58A 2R93J 2Z3YA 4LITA 2MH9A 4PDKA 1TTYA 1UB9A 2NVTJ 2VI6A 3JAMK 2VJIA 1RESA 2K4JA 2CGPA 4Z2YA 3PUFA 4G6QA 2R7UA 3CC7I 2QBYA 3OYKA 4Y4RA 3RI4A 2ZCNA 3FXUA 2IW5A 1P4XA 3K4LA 4KMUX 4HG2A 4ZYAA 4CCNA 1LE8A 2A07F 3HC7A 3VOXA 4YIRX 4KNYA 2YVHA 1Z6TA 1X1DA 5HNFA 3CDLA 3CO7C 4XLEA 4CH7A 4IL6C 2VIXA 3F6OA 4I0AA 2EQRA 2AXLA 4BBRJ 3DTEA 1MBHA 2E7WA 2K3PA 5FKMA 3J81K 2XB0X 1QZZA 2DK8A 2CRGA 1ZG3A 2BW3B 5E3MA 3M7GA 3LFUA 4LGWA 1Z3YA 1WCMJ 1TWGJ 5TJJA 3AL0B 1FYLA 1USTA 3LWJA 2CQKA 3BOQA 4OIRF 2V26A 3BTIA 3L2RA 4A69C 4BXXJ 3JRBA 4ACIA 4KMFA 3BG5A 3PNVA 3GCMA 3CZ6A 3I59A 1IN7A 3ZN0A 2OU2A 1W7PA 4JQFA 4A3KJ 3KP4A 3R61A 4XRSG 2ZCWA 1BIAA 5BNGA 1OMIA 1YS6A 4EM2A 1J0RA 3FRQA 3EYIA 1JI8A 1N77A 1BR1A 2BV6A 3DBRB 2EZHA 3F3XA 5KCMA 1JE8A 3BJAA 1VQOI 3CCVI 5LHHA 2X48A 4IRGA 1YJWI 1VQ7I 4CDGA 2HTSA 1MMDA 5C4YA 1YRNA 4HAMA 1XSVA 2MLKA 4C3JJ 5J6XA 2VQCA 1VI0A 1X58A 2OA4A 2B9SA 2B63J 3JSJA 4FHTA 2FE3A 1ZRDA 4ZDPA 1TNTA 3OYFA 3ELKA 1Z7LA 2F48A 1MMNA 2ID3A 2KQRA 1WGXA 1HLVA 3C3WA 2E1OA 1X1AA 3C2BA 2MW8A 2ZKZA 4R8HA 1G4DA 2R5YB 3SZTA 2KDOA 3VUQA 1V5GA 3LOCA 4DQ2A 1F5TA 3ABKH 3VW0A 1SVOA 1WPKA 5FFZA 1Z3XA 4G7OF 1GXPA 3ZQFA 3CJDA 5DS9A 2QVOA 2ZBKA 3BR2A 3QRFF 2CV2A 2VONA 2VJJA 3LSPA 3I56I 1UHMA 1ETYA 2O8XA 4UVCA 3KEYA 2E2IJ 2CFXA 2XF7A 4PGGA 2VODA 4C2TA 2WY8Q 1L3LA 2CO5A 2R5ZA 3HSFA 2Y9YA 3C2HA 4CYCB 1V54H 1RKWA 2GAUA 5H6QA 1XSDA 1IO2A 4FX4A 2IGKA 4M3EA 2G3BA 2BEOA 3GTOJ 1IF1A 3UR3C 4CXFA 1TLHB 3HKZN 2LREA 4LIUA 2LD5A 1O4XA 3CF5F 2A5YB 4HDVA 3L2WA 3CC2I 4HNTA 1H9TA 2ZSIB 2B7EA 5HAWA 1YTYA 1R4MB 2XVCA 2Y30A 2XHKA 2EA4A 1L0OC 2DCEA 2P5KA 4BXUA 3S1NJ 1ULYA 2LKSA 1HBXG 4XONA 4CCKA 2M5WA 3DEEA 5CVVA 5HOOA 4JX6A 5CVJA 1FC3A 2ME6A 5D6FA 2VBXA 3CJRB 4BJ5C 4A3GJ 3HTSB 4N4OB 4BHPA 2QUFA 3F8BA 4L9TA 5HS9A 3JTGA 3CCEI 3DBLB 4S0HB 5E8IA 2HEOA 1W5TA 3KIOA 2AS5F 3DTIA 2EK5A 4I76A 2X6XA 2GUHA 5FRMA 2VJ5A 4KJZA 4U88A 1GV2A 4XSXF 5ILUA 4RAGA 1DPUA 4A3BJ 1RZ4A 3MZ8A 1HDDC 3VYSB 1WH7A 3SHFA 2QYOA 4I99C 5E1WA 4EM1A 4A3EJ 1B8IB 1UAAA 2ZCMA 2ZXJA 5JVTA 3JW4A 3IKTA 3PM1A 2IEKA 2DDAA 2NVUB 1AU7A 2K27A 2HQRA 3S2WA 1ZRCA 2L5QA 4EM0B 1J7KA 4Z6YA 1ZGJA 2DA4A 5J40A 3TMOA 2X4HA 3CUQB 2BGCA 2CV1A 4DZJA 4OD4A 2DPUA 3I5UA 1KQ0A 2BY3A 2REKA 4E7HA 3NQOA 3NARA 2E71A 3ZMSA 1HQCA 2LK2A 1PYVA 1T56A 4XOTA 1H8AC 2QBYB 4HDUA 3B6CA 2XRNA 4HV6A 1LE8B 3E7QA 1W0TA 3WTVC 1JKRC 4CSWA 4GXOA 3CMYA 3GMEA 1IRZA 1OYYA 4IRVA 2WB1N 1U6GA 3HYIA 4IF4A 2QWTA 5E17F 3NPIA 2LR8A 3HUGA 1A36A 3HE0A 2R7SA 4HX8A 2OTJI 5D6EA 4EATA 2P81A 5EEGA 2QSHX 3MEXA 3E6BA 2CW7A 4B3AA 1TNSA 4C9YA 5KAIC 2Q1ZB 1GVDA 2HQ5A 2ELKA 1HW1A 3KFWX 2GZWA 3BROA 3LNQA 2Y0SA 3AG1H 4KISA 1YI2I 1X4PA 3HTUA 3LSTA 3I59B 1W7PB 3KZ9A 5HBUA 3ROUA 2M34A 5CXGA 1S7EA 2FMLA 3PNYA 1C0WA 1TBXA 3E97A 3GX4X 3C18A 3MD2A 3OWTA 4KIGA 4BL0B 1OKRA 2JA6J 4DOZA 1I6HJ 5CXIA 3CTAA 1QZYA 2V6EA 3KLOA 1FIAA 2BXYA 3O2PE 2LY1A 1MW7A 1YRNB 4PUSA 2QQ8A 3BTJA 4F7ZA 4UUVA 1HDPA 1RKTA 3S8PA 5E18F 4YRVA 2HNHA 4AIHA 4II2A 4ENJA 1R1TA 2KRHA 3ZCOA 3F9KA 1W4MA 1XDSA 1ZK8A 2K40A 2LRDA 1VTNC 5TISC 2NX4A 2RASA 1ZR2A 4ENNA 3E7LA 3VYTB 3GYHX 3F1BA 2R0QC 3LSGA 3DKXA 3RQIA 1XSXA 4BQQA 1SANA 2W82A 1YE9A 2E34A 1TWCJ 2V79A 1J75A 3F23A 5LHIA 4WF2A 5AONA 2D5VA 5BPDA 5EG0A 3OL4A 2VT3A 5H20A 3DP7A 4CO8A 1IGNA 5HVQC 2BHZA 3GFIA 3CMEI 4GYIA 1DGRM 2K86A 3A01A 1D8JA 4IRHA 4NELA 3HOWJ 2EPFA 4MIMA 1KU7A 4YIFA 4M6YA 5BOXA 2CUFA 2H6CA 4NDLA 2DFFA 2Q0OA 4B47A 1BC7C 1D0ZA 1YITI 2L7KA 3H9JA 1WI3A 3C7JA 3VVXA 1LJ9A 3ML6A 4P9UA 2GA2A 1VNDA 1V5FA 4N9IA 3GEUA 3HM5A 3MN2A 3DTKA 1KA8A 4ZYGA 3SEZA 1PDNC 3H5NA 4RB0A 4A0YA 4UB6C 2D1VA 5EYRA 4UUSA 3DU6A 3LHQA 1T8IA 2JA2A 4DJAA 4K2EA 3G71I 5K58A 1WJBA 3GTLJ 1T33A 2D2WA 2DDBA 1SFKA 2UZKA 3RKXA 1ONVA 4IHSA 3WTUC 2XGXA 1FYKA 2JN6A 3BR6A 1LVAA 2L7ZA 1O57A 2DG8A 1IN8A 5K1YA 3MNLA 2GIZA 3FXRA 4JYKA 2RC4A 2DA6A 2UXPA 2HZDA 4P1WA 3I4MJ 2IP2A 4L5IA 4Q47A 5B5EC 1SFUA 4EJVA 2EILH 4CICA 4XL9A 2FEZA 5LGNA 3O3KA 3NNRA 3M9AA 5DDGA 5ICEA 1OJLA 4XRMA 2XGEA 1APLC 2M3AA 3T0YA 4H0EA 3AG3H 3IRQA 4R79A 1MDMB 1IAWA 2F5DA 3DPUA 3AAFA 2Z9OA 3ANGA 1J09A 2UXUA 1T08B 3DEUA 4HSTA 1PUFA 2CQXA 5ICCA 1LKXA 5IT3A 3NXCA 2E1NA 4KICA 2FMYA 5DM6F 2RQQA 3BQYA 1U78A 2FNAA 1Y1WJ 1FEXA 2F6CA 2YU3A 4KA4A 5H6RA 3K1NA 1F9NA 3UKGA 2XV4S 5CPRB 4XLCA 5DCFA 3KZZA 3ZQQA 1IXSB 3JAMZ 2HOAA 2XKOA 4ZTJA 1XCVA 1IZ1A 2M45A 4MTEA 4ZJZA 3FHNA 1O3QA 4I0BA 3SQNA 3DLLF 2V1XA 3OOPA 3DF8A 4IHTA 2DOAA 2PZ9A 5F64A 3WGHA 3BCBA 2OQGA 2HKOA 3OR1C 5K5RA 2CW8A 4JX4A 1ON2A 3ULQB 3QPLA 2NVYJ 3H9QA 3QPTA 1BOAA 3HJEA 2AXTC 3FXLA 2NNYA 2VT2A 3O6BB 4UUTA 6PAXA 2KL4A 3BCAA 2OI8A 3OYIA 2PMZN 3WE2A 3L2UA 1S3JA 2FF4A 1IV6A 2YX4A 1KZHA 4RM2A 1GUUA 3HUGB 2Q8KA 2GWRA 2ZOZA 3KEQA 4RAYA 2QZ8A 1WZ2A 1QGPA 3B81A 2GA1A 2E5NA 5HNHA 5TGTA 2GXAA 3ABLH 2OC6A 2WAQN 1U0JA 2K9QA 2W25A 5F0FA 1FWZA 1WJ5A 2QQBA 3GTKJ 3V6GA 3ZR8X 3IP4B 4L0YB 1MBFA 4UHTA 4BY1J 2DJNA 1FOKA 4LK0F 1K6YA 2K02A 1BOBA 1X3ZB 5J1YA 1UHWA 3CJQB 5LGTA 3RD3A 2MGQA 1DP3A 2E5ZA 1MMAA 3M07A 2EV6A 4U9NA 1XPXA 4M6XA 4J19A 3HHGA 1OCPA 4HOBA 3QODA 2YPRA 2R7OA 5CYVA 3KEOA 1O7LA 1IRFA 3FF5A 2VE8A 5EDNA 3IAS2 3L2VA 1BL0A 1E2XA 2O8KA 4U9LA 4E7IA 4HV5A 3W2AA 1FPQA 1T0FA 3BZKA 3MAJA 4LD5A 1ITYA 2JSCA 4AD9A 1SFEA 3Q0UA 1LFPA 4KT5C 5E20A 3BWGA 3DV8A 3FKJA 3K10A 1E0EA 3FK7A 1MNDA 3E6MA 4IVNA 1WHUA 3WGIA 1BC8C 2OCEA 2FD5A 2STTA 4O3MA 2WAFA 2R7DA 1S5LC 5DD4A 2BY2A 2LG4A 3WTXC 4DYQA 4NN1A 4AIKA 1VQ8I 3OV8A 4F55A 1HKQA 1S29A 5B1BH 2XPUA 3A01B 4JKZA 4OINF 2FQ3A 2MH2A 4FX0A 2X6OA 1SMYF 1OPCA 2RGVA 3B73A 3F8CA 4GYGA 1T6SA 1WJAA 3QU3A 1CQTA 2GENA 3L2CA 1FSHA 2EIMH 2L4AA 3H5AA 2MC4A 4RGRA 3PJRA 2BVMA 5GAEJ 3JSPA 3HOSA 1H9GA 2E36A 4G8XA 3ZQ7A 2FBKA 3L9FA 3WU1B 1PVEA 2O6GE 2Z99A 4OMZA 4J00A 3VODA 3UNGC 2EV5A 1BBYA 3CLOA 3GFMA 2F2EA 2FU4A 3I9V2 2LKXA 2OJED 2DPDA 1SAUA 4JP0A 3AFHA 4RA2A 4UUSB 1MMSA 3I53A 3P9KA 3VFZA 2X6YA 5E3LA 4DBQA 5AQCA 1KU3A 3TO9A 1I1GA 2ISYA 1XG1A 4D7MA 2IS4A 2UWMA 1P7JA 1ZYRF 3M8FA 1ETKA 4DGWB 1JUSA 3VTIA 2DW4A 1GVJA 3TP0A 3F21A 5ICGA 3CJTB 4G9YA 3CCYA 3HTJA 3ZGKA 3AQTA 1S8NA 1O3RA 5E1XA 4IQ4A 3FMRA 2DK5A 2HKUA 1EF4A 1MBKA 1MIJA 2EA2A 3QAHA 4LB6B 1FP1D 3TO7A 1FTZA 3BR0A 2WV1A 5EJCA 4EGZA 2M2EA 2WY7Q 3ZMVA 4M3DA 3OIQA 2XAJA 2LSOA 1BI1A 5M5XJ 3S17J 5J3LA 3ABMH 3OS2A 2G9WA 3E0JB 5C4XJ 1OISA 4L9VA 2CG4A 1EA3A 2DMQA 4U0VA 1VQNI 3CDHA 4D1QA 1DPRA 5M3FJ 3K2ZA 5H2FC 3IV5A 1SFXA 3M3YJ 2DTZA 1PUFB 4CGRA 1JHHA 2QSFX 2JK3A 1DU0A 1A6IA 4EJUA 2WV0A 5L3FA 2QIBA 2YS9A 2JA8J 1OCCH 3GZIA 2RQPA 2DQLA 4JBAA 4IHWA 3V42A 4CYDA 1JGSA 4MFDA 2H27A 4ZZLA 2JPCA 2O9LA 2VBYA 2KHMA 4KN7X 1YHQI 2YR2A 5K5OA 4II3A 2K3FA 5B1AH 2ZJQF 4BEHA 5FKKA 4OIPF 3KLNA 4BE2A 2F5VA 2G7UA 3LL7A 1TQMA 1JTXA 3RSNA 2FXAA 5LEJA 3IUOA 1ZG5A 1FBUA 2L9VA 2LNBA 3A4CA 4PK4A 3E5UA 1OCRH 2FBHA 2KMUA 4IRIA 4QPQA 1ZH5A 1EH6A 1XCBA 5FB2A 4JOMA 2PI0A 1XMXA 1DQUA 2QLZA 3WU2C 4HLYA 3HIFA 4IEJA 4N4NB 1JKPC 4PFOA 4A3DJ 3BJOA 3BLYA 5DEQA 3CCMI 4L18B 2R7TA 3CWRA 2JUGA 3GUDA 1AKHA 4JK1X 1E3PA 3CRJA 3BTCA 4MGRA 4OOIA 4M71A 5FHPA 2HXIA 3U1KA 3WGGA 3U1DA 3CP8A 1MH3A 2HYJA 3MMYB 1IC8A 2XKPA 3FMSA 2IXSA 3BG9A 4EVIA 1FBSA 2P6TA 1BN5A 3A1YA 2WADA 3O60A 3SDBA 4BJ6C 4W97A 3WTZA 4NC8A 2JRTA 1ZARA 2DA5A 2VKEA 2K9LA 4BDYA 3ON4A 1R23A 2R3SA 3F6VA 3G4SI 2MA3A 5IPAA 5D18A 3PPBA 2X85A 3J80K 2F5CA 3JRFA 4G94A 4ENKA 4YELA 1GV5A 5LRSA 1AOYA 1YW9A 5C3EJ 4XRSA 1MBEA 1MMGA 4EEFG 4WXHA 3NAUA 1FIPA 1TW3A 3GLXA 4RAFA 5C4JJ 3W6KB 1SMTA 3DPTA 2QWWA 3SYTA 3J7AY 3KE2A 1WRJA 1U2WA 1Z6RA 2EINH 1EJ9A 4CZZA 4OWRB 2RREA 2WWYA 2YSRA 1JKQC 5CQEA 1NK3P 2YVXA 2V9KA 5GTIC 1K4TA 3E1SA 1HW5A 4V19K 1QQIA 2PEXA 1PP7U 2R7ZJ 2KJCA 3HB9A 3SFIA 1BR4A 3AL0C 3VW2A 1R4NB 1NK2P 2DA1A 2G7LA 5CVUA 2X51A 2A6EF 4OD5A 2LY2A 5EFYA 3PFIA 2QKMB 2CU7A 1WVRA 2DYRH 3EUAA 3HBLA 3F8NA 2KIUA 1Y0UA 3WU0A 2VQHA 4C3IJ 3CDIA 4BYYA 5ERIA 4GFLA 3K69A 3K6GA 1RRJA 3PSFA 1LFUP 2V57A 2QGUA 1HKSA 2QA4I 3QOPA 2VL8A 3KX2A 2F5FA 2DG7A 1QBJA 3FDYA 2JUCA 2EWNA 3HRSA 1RR7A 3E5XA 3PQKA 1NH3A 1HOMA 2OBPA 2DT6A 1A35A 4FISA 2DFIA 4U87A 1D1AA 4HSRA 5D5VB 5E3OA 4Y7NJ 4PGHA 2W24A 3K70D 1NTCA 1Z1DA 2Y9ZA 1RUNA 3I54A 1QZEA 1F36A 3IL2A 2A6HF 3RDIA 3BC8A 5DUIA 5K7FA 4IX7A 3L09A 1ZLKA 3EDPA 2VQLA 4AC0A 5DAJA 2CUJA 1FNNA 3VEPA 4BGDA 2KRFA 2COBA 3DPJA 1I5ZA 2J5PA 2BVLA 4AIDA 4IO9F 1ETWA 1QVTA 1ZELA 2HVRA 4YFXF 1Z91A 4Q4ZF 2XROA 2P0WA 3OS0A 5IT9Z 1N75A 1YJ9I 1DP7P 2XAHA 1JTYA 1ZGAA 4UB8C 4XSZF 1FJLA 1TQIA 3RIRA 3OYHA 4M6VA 2G7SA 3V78A 2A6TA 1P2FA 1TW2A 3K4NA 4A6EA 2EZLA 2W00A 1IW7F 4HA8A 5ICFA 3OSGA 2HYTA 3V7SA 4HF2A 2F4IA 1OYWA 3A03A 1DUXC 5FRNA 3E5QA 2BOLA 1K7AA 1R5GA 5LHGA 2MYSA 4M74A 4LG0A 4AM3A 2W85A 1OR7A 2WA0A 4BQAA 4YZEA 1XGMA 3FXKA 3VVYA 3J7ZI 1LFBA 3LSIA 2BY0A 2M4GA 3P9IA 1UCRA 3JRGA 3H3ZA 3QOEA 5D8KB 4NBQA 2L0KA 3BR3A 4BEHB 4ZTFA 1JXSA 1LB2A 1TWFJ 2XF6A 4RM3A 3S32A 2RNJA 2K9NA 4RLFA 2M30A 2OUMA 2PBIA 3M1EA 1QVUA 1Y39A 1W0UA 2ACJA 4XNFA 1HSTA 2JA5J 1EV7A 4FTHA 3HIMA 4EJOA 1OCOH 3GLLA 5B66C 4XMYA 4NNJA 3S2DJ 4ETSA 3DXJF 1TL8A 1D0YA 3D5RC 3LFKA 1BA5A 3HOYJ 3RCOA 3HOZJ 1J59A 2OPTA 4U7DA 1AKHB 3S93A 3T1BA 1D8KA 3H5RA 1T98A 3PL8A 4OAZA 4M9ZA 2NP5A 5FKLA 4C30A 2HU9A 2L2OA 3PO2J 1I39A 3DCFA 3PFYA 3CUQC 3VOEA 4J01A 3OYAA 4AYBN 1KONA 2BY1A 1R6RA 4AF5A 2XAGA 3D5LA 5B3SH 4XKBA 2DQRA 1S7OA 3I71A 2ZB9A 4A2UA 4KN4X 2HDDA 5J8CA 4I2OA 5IP7J 1TQPA 2WB1A 3KZIC 2JVHA 2CUZA 1XS9A 3HTIA 4HZFA 1Z21A 2HI3A 2LC2A 4GDFA 3G73A 2ZXWH 3K1MA 3HEFA 4P9FA 4F91B 2NVXJ 4CCJA 2VKVA 1R5ID 5FJ8J 2ZCXA 3GW2A 2LDUA 2V7FA 1JHFA 1OYIA 1QRYA 5CQGA 5JLXA 4LLNA 5E1ZB 4ESFA 3M8EA 2H8RA 2G7HA 3HHHA 3EQLF 5LGUA 1JJ8C 2LVSA 3MKLA 1BIBA 5BPIA 2EFNA 1FT9A 5JHFA 2FRHA 4ZYHA 3CESA 5J4VA 2Q2EA 3CF2A 5M5WJ 1O3SA 4DYCA 1T39A 3OYNA 2HFHA 1EKEA 4D5FA 3ZQLA 2IGOA 5M5YJ 1YOVB 3ZOBA 3GTGJ 3FXJA 2R7VA 2KJBA 4A0XA 4XKWA 4IJAA 1R36A 2YU9J 3IAM2 2D45A 2VB6A 2GFNA 1TWAJ 1VQMI 3OYDA 4C3HJ 2Y75A 5JI6A 4RB1A 2Y0SN 4FASD 4ITVA 4Q5SF 1ZR4A 2V1DA 1R7JA 3H36A 3K4KA 4HNVA 3KYCB 2JRMA 2VKDA 1M1EB 1KYWA 2A69F 5GP9A 5L3EA 4G7HF 1MD0A 2BYVE 4HF1A 4A93J 3QQAA 4BH9A 5FD6A 2EFPA 3FZVA 1NG6A 3ZMDA 5JR3A 4HYEA 3TW6A 1AHDP 2Q24A 1YG2A 1JT6A 2PJRA 5KHDA 2NVQJ 2OERA 1BR2A 3WTWC 4RBOA 3PO3J 4X0GA 4IHXA 5HS8A 1R00A 3ECHA 2M9HA 2P7VB 2QF7A 4F93B 3ERED 4YG2F 2GXGA 2R5ZB 1AWCA 2WUIA 4C2MA 4GFKA 1K79A 1F4KA 1I50J 1MBJA 2XGCA 3BNIA 4P55A 3RKWA 2CH0A 3FKIJ 3HPGA 2NS8A 5J47A 3KCCA 3U2RA 2DODA 2QEXI 3LWFA 2DAOA 4QTRA 4AC6A 3LMMA 2ECBA 1X3WB 4BJTA 3DEWA 4LG0B 3ZMUA 4YEJA 3CLQA 4B1RA 1T2KA 4A3JJ 3F8FA 3BJ6A 3CO6C 3TGNA 1RC9A 1U5TA 1RUOA 2OTLI 2DI3A 2GOMA 4FETA 3KKDA 1BI0A 4ZDOA 4V2GA 2FNPA 3EUKL 2VBZA 1ODDA 1V5EA 3KYDB 5IT9K 2IAIA 2H1LA 1SEUA 1YW8A 3KP3A 3WTYC 5F08A 3D0SA 4YFKF 2ZMEA 3I64A 4CCMA 1R49A 4E4HA 1P9QC 4G6TB 1BW5A 1VQ6I 3MWMA 5JHUA 3JRIA 5D5WB 2RKHA 2DT5A 1IN5A 4N9HA 1XDUA 5A2QK 4RLQA 2EBIA 2QCOA 1G6NA 5KAFC 4HEA2 4M9XA 1QHHD 5F04A 5LEKA 4XICA 3PUBA 5KVRA 1H88C 4R1HA 5F0CA 4FQGA 4XOPA 3VB2A 3K4CA 2NRAC 2KIQA 2KIMA 2E1MB 2FQ4A 2K7LA 4IOAF 2H6BA 1W7PD 5CVIA 3W2VA 3EGQA 4RGSA 3Q9VA 2FOWA 3GZNB 4M3GA 4NHJA 2EIKH 1X4OA 2LOOA 4ENMA 3SXYA 3MQ0A 4L9JA 4BHCA 1FMWA 2L9RA 3LA7A 4ICHA 5L3BA 1Y8QB 5FGLA 2ZC2A 3J80Z 1IJWC 1R5HA 2D1HA 2HOTA 2IGNA 2NXNB 4L9NA 5IYCJ 2GQQA 2HOEA 4KT6A 3NRVA 3W3CA 1Q1VA 2L7FP 2QM3A 1Z05A 2PMZA 4JNNA 1ON1A 1FOYA 3HPHA 1O3TA 1UJ8A 2ETHA 2R7FA 1D0XA 4CA0A 2VC0A 4L5EA 5D4SA 3W6JB 1QU3A 1HF0A 3C07A 4HF0A 1S72I 2OZ6A 3K9TA 5FFXA 3VYRB 3V4GA 1WWXA 2VJ4A 4MLOA 4AVZA 5FLXZ 5D8LB 4U0YA 2P4WA 4I02A 1U8RA 1SGMA 3ZP5A 3VW1A 2IBDA 2Q2EB 2E60A 4M72A 2R7XA 1GHCA 1ACIA 4B48A 4BAYA 3RPUA 4ZYDA 2QQAA 4E7JA 3MZHA 4KFCA 2F5EA 4Y52J 3N97A 1FYMA 4XN3A 5M3MJ 4MXMA 2ZNZA 3OYJA 4KWAA 3HDDA 2FSWA 2D6YA 1B72A 1VF9A 1ORKA 2IA0A 3DKYA 4HLXA 4NC7A 5HLIA 3R4KA 3GTPJ 3V8LA 3PASA 4IKFA 4I98B 2VUMJ 2CJJA 1IUFA 5GAGJ 3R0JA 1VQ4I 1R1UA 2W84A 4CZCA 2H1KA 3NI7A 3IHUA 2UXHA 1LDKB 2ESNA 3ZN1A 5K5QA 2G0EA 1WJDA 1UG2A 3RKQA 3KETA 2AQEA 1HKTA 3J7YJ 2IRFG 2A2FX 3HZJA 5J1UA 2PJRB 5EG0B 2E2HJ 2EIJH 2XDNA 5CW8A 2VC1A 1N78A 2PBXA 1X2NA 3Q5FA 4G7ZF 3S1QJ 4L62A 4DVYP 5L3GA 2NS7A 4FT8A 5EZGA 1ZRFA 3NRGA 1QPIA 1WFXA 3L7WA 3GTJJ 2M87A 3MKYB 4A12A 1UHSA 1JJ6C 5L3CA 3DLAA 3BPXA 3V7CA 4XQFA 5EF6A 2HDCA 2PLYA 3SZGA 2DLLA 2VQGA 1BW6A 2ADUA 4B8XA 4I09A 2MD0A 3SJMA 3K4JA 2V1UA 2QTQA 4OIQF 1YLFA 1YQAA 3COLA 2AHQA 1U9NA 4F92B 3VSKA 3CCLI 3BDDA 2XASA 2DN0A 4YIIA 4RDUA 1U9OA 1MJBA 1FZPB 2PX9A 5LFAA 1R22A 3P5JA 3VVZA 3JR9A 2HGCA 4A3CJ 3FBIB 3W6VA 3S3NA 1GDTA 4Y17A 1XN7A 5KK1A 3ASNH 3CCRI 1SVMA 4ESJA 3T8TA 4IPAA 4BXFA 2X1EA 4A5NA 2FJI1 1XB4A 2KKOA 5DV5A 3IH3A 1SVLA 1GT0C 4HW0A 2VPLA 2ESHA 4XK4A 2M8GX 4BQNA 2VXDA 5D4RA 4GCTA 5FO5A 1SFOJ 1K6OA 3GFJA 5DYMA 1U5TB 3VOKA 1VQ5I 3HRMA 3LSHA 5ILVA 3FHZA 1BM9A 4BU2A 2R5YA 3DPLC 2VKHA 3G56A 3KP6A 1ETVA 2NOJB 2GIVA 2LKPA 3FXOA 3KNWA 3DU5A 3NEUA 3H0GJ 3IUVA 1VFCA 4M9SA
chains in the Genus database with same CATH topology
2DG7A 3JRCA 3D1NI 1RR7A 4B3AA 2AO9A 3WHCA 1GVDA 1HOMA 2HQ5A 2YUSA 1OFCX 2KDZA 2ELKA 2Y31A 4FISA 5IYBJ 3CQZJ 4V2FA 2O7OA 5E3OA 4Y7NJ 3LNQA 3OOUA 1NTCA 2Y9ZA 3K7AJ 1A5JA 3O8GA 3T6NA 1F36A 3QPSA 3KZ9A 5HBUA 2M34A 4DYRA 5CXGA 1MH4A 1S7EA 4G12A 5K7FA 2HXOA 2X9DA 1RETA 2JA7J 4AC0A 5DAJA 2JA6J 4FE4A 1F43A 1I6HJ 5CXIA 2COBA 4A3LJ 3DPJA 3BRUA 1FIAA 2NOGA 1YRNB 1ETWA 1QVTA 2DMPA 2E19A 3BTJA 1HDPA 1RKTA 1TC3C 9ANTA 1JTYA 3VPRA 1MSEC 1FJLA 5FMPA 1ZK8A 2K40A 4M6VA 2G7SA 2NX4A 2RASA 3BR5A 1ZR2A 3V78A 3S16J 3E7LA 3F1BA 1ETXA 4GCLA 2R0QC 3LSGA 2EZLA 3RQIA 4UDSA 1SANA 3FIWA 2K9SA 3BTLA 1TWCJ 1ZTRA 3IUVA 3OSGA 1OCTC 3HGGA 2HYTA 1HCRA 5D1RA 2D5VA 3L1PA 3A03A 5EG0A 3GBGA 1IGNA 3LSRA 3JRDA 3A01A 4NELA 3HOWJ 4YZEA 4MIMA 5EEAA 2CUFA 3VVYA 3HOVJ 1LFBA 2TCTA 4NDLA 3JRGA 5FLVA 1WI3A 2GM4A 3VVXA 2L0KA 5EGOA 3BR3A 3G1OA 1JT0A 1TWFJ 5IP9J 3HTHA 2QOPA 1VNDA 2K9NA 3VP5A 3GEUA 2DMUA 3HM5A 3Q0WA 3MN2A 1QVUA 3BHQA 3Q0VA 3BT9A 5EYRA 4UUSA 1W0UA 3A02A 3HGYA 3LHQA 2JA5J 3HIMA 1B72B 4FTHA 5K58A 3S2DJ 5F0HA 3GTLJ 1T33A 2FBQA 5F1JA 1BA5A 1IG7A 2XGDA 3HOYJ 2JJ7A 2JN6A 3HOZJ 1JUPA 3ZQGA 3BR6A 2OPTA 1AKHB 2OF7A 4QIWN 1ZGWA 2UXOA 5K7ZA 2L7ZA 2DG8A 3WHBA 2QKOA 5D19A 2NP5A 3O8HA 3MNLA 4JYKA 4MK6A 5FKLA 2ID6A 2DA6A 5FKOA 2UXPA 3I4MJ 1ENHA 3DCFA 3PO2J 5EZHA 5IYDJ 4AYBN 3NNRA 2EZIA 3EUPA 4IHYA 1OJLA 2XRLA 4X1EA 4XRMA 2XGEA 2L7MP 1APLC 4AF5A 1ZQ3P 5JLWA 4GCKA 2ZB9A 2ME0A 2MG4A 2HDDA 5IP7J 1XS9A 3HTIA 3ZQIA 2DA3A 2HI3A 2LY9A 3ANGA 2UXUA 1MBGA 4D5CA 1PUFA 2CQXA 3HTAA 4M3BA 3NXCA 3HEFA 3Q3SA 3GTMJ 2NVXJ 2XPVA 2VKVA 3BQYA 1U78A 5FJ8J 2ZCXA 1Y1WJ 2CQQA 1FEXA 2I10A 3FK6A 1QRYA 3IH2A 5JLXA 2H8RA 4W1UA 1H89C 3UKGA 1E3OC 2HOSA 2HOAA 1JJ8C 2LVSA 1ETQA 3MKLA 2LLKA 1ZKGA 4CYCA 4BY7J 1Z0XA 4ABZA 1MNMC 3QKXA 1G2HA 1MSFC 5M5WJ 4DYCA 2MSYA 2PZ9A 4D5FA 3ZQLA 3JRHA 4JX5A 5M5YJ 1ETOA 4JX4A 3ZOBA 4BKXA 2M0CA 3GTGJ 3QPLA 2NVYJ 2YU9J 3S15J 4UUTA 2GFNA 1TWAJ 4C3HJ 5F27A 3GTQJ 2OI8A 4GFBA 3MVPA 2PMZN 1IV6A 5GPAA 2Y0SN 4QSHA 1GUUA 1ZR4A 2E2JJ 1UI6A 3ON2A 1U8BA 2ZOZA 3OSFA 3H3VK 2RAEA 2LP0A 4HNVA 3B81A 4LOCA 5IOZA 1POGA 3FISA 5GP9A 4A3MJ 2WAQN 2K9QA 3BCGA 5GPCA 5F0FA 4X6AJ 5DTDA 4A93J 3GTKJ 3QQAA 2YVEA 3V6GA 1MBFA 4BY1J 2DJNA 1AHDP 3TW6A 2Q24A 1JT6A 2R92J 3LJLA 3BR1A 2ZOYA 2W53A 5J1YA 2NVQJ 2OERA 5HODA 3RD3A 3ZQCA 2MGQA 4RBOA 2ECCA 2LFBA 2XSDC 2TRTA 3HOUJ 5FKNA 3PO3J 4IHXA 1R9TJ 2WGBA 2M9HA 2CUEA 4J19A 2QF7A 1OCPA 2RHAA 5IOYA 5IP6A 2R5ZB 1FTTA 1B8IA 2IU5A 2DMNA 2FJ1A 2JWTA 4DW6A 5EDNA 2WUIA 1BL0A 2O8KA 3TW7A 1UMQA 2EZKA 4GFKA 3OIOA 1ITYA 1I50J 1MBJA 2XGCA 1Z77A 3BNIA 4PXIA 1WH5A 3FKIJ 3Q0UA 2G7GA 1RPWA 3M4OJ 2NS8A 3FK7A 5FLMJ 2R93J 2NVTJ 4QTRA 2FD5A 2VI6A 4AC6A 2ECBA 1RESA 2ZCNA 4DYQA 4NN1A 3DEWA 1LE8A 4FCYA 4B1RA 2XPUA 2DA7A 3A01B 4A3JJ 4JKZA 2X6OA 3S1MJ 3VOXA 2YVHA 1IDZA 3CDLA 4MO7A 2UXIA 1CQTA 2GENA 3RZDJ 2EQRA 4BBRJ 3KKDA 1MBHA 5EGOB 4D7NA 3TEDA 4V2GA 5FKMA 2LTPA 2KT0A 2XB0X 2XPWA 2CRGA 3ANPA 1IDYA 1XC5A 5H9TA 5E3MA 2O7TA 2IAIA 2LKXA 1WCMJ 1TWGJ 4JP0A 4UUSB 3I4NJ 5F08A 3LWJA 5E3LA 3BTIA 5AQCA 3F0CA 1I3QJ 1BW5A 4A69C 4BXXJ 1XG1A 3JRIA 4D7MA 3JRBA 4ACIA 2GBYA 5K7HA 1P7JA 4IHVA 1ETKA 1JUSA 3BG5A 2EBIA 2QCOA 3TP0A 4A3KJ 3CCYA 5F04A 4ME9A 4XRSG 3HTJA 5BNGA 4XICA 3AQTA 4DZPA 1H88C 3FRQA 3RZOJ 5F0CA 3JRAA 2EZHA 3QBMA 2HKUA 2FQ4A 1EF4A 1MBKA 3S5RA 3ZQHA 5C44J 3EGQA 1FTZA 2X48A 3BR0A 4JL3A 2WV1A 4M3GA 5C4YA 1YRNA 2M2EA 4M3DA 4C3JJ 3TP3A 1VI0A 1X58A 2L9RA 3JSJA 2B63J 4ICHA 1JKOC 5FGLA 5M5XJ 3S17J 5J3LA 2N8GA 1IJWC 5HSZA 2HOTA 2ID3A 5C4XJ 1WGXA 5IYCJ 1HLVA 2E1OA 2DMQA 3C2BA 4XIDA 2MW8A 1Q1VA 2L7FP 2R5YB 5M3FJ 3IV5A 3M3YJ 2DTZA 1PUFB 4JNNA 3VUQA 3LOCA 3VW0A 4CGRA 2FX0A 2JK3A 1WPKA 2W48A 3BG3A 1DU0A 1A6IA 3CJDA 3ZQFA 2QIBA 4L5EA 3C07A 5DS9A 3BR2A 1HF0A 2YS9A 2JA8J 3LSPA 3GZIA 1ETYA 4B4CA 4IHWA 2E2IJ 4MLOA 3KKCA 4MFDA 4C2MJ 2O9LA 2R5ZA 1P7IA 2Y9YA 4CYCB 1SGMA 2NP3A 1JUMA 3VW1A 1RKWA 2IBDA 5FKKA 4M3EA 5J1RA 1D5YA 2G3BA 3JREA 3GTOJ 4AUXA 1JTXA 3HKZN 4I6ZA 2LD5A 1O4XA 4Y52J 2Y2ZA 5M3MJ 2XB5A 4MXMA 5HAWA 4KWAA 3HDDA 2D6YA 2Y30A 1VF9A 1B72A 3VIBA 1ORKA 4A3FJ 3GTPJ 3PASA 3S1NJ 2VUMJ 2CJJA 1IUFA 4MFEA 4IEJA 1JKPC 3SDGA 2F07A 4A3DJ 3CWRA 4JX6A 2ME6A 1AKHA 3BJBA 4HKUA 2H1KA 3NI7A 4A3GJ 2UXHA 3CRJA 3BTCA 2G0EA 2HXIA 1JGGA 1UG2A 3RKQA 5FHPA 4S0HB 1DU6A 1MH3A 3G1MA 2HYJA 1IC8A 4FE7A 3RH2A 2EH3A 5J1UA 5EG0B 3S1RJ 3BG9A 2E2HJ 2XDNA 5CW8A 2PBXA 1X2NA 4I76A 2GUHA 3O60A 3S1QJ 1BJZA 4L62A 4W97A 2DA5A 1GV2A 2NS7A 2VKEA 5EZGA 3ON4A 3NRGA 5D18A 4A3BJ 2DA2A 5IPAA 1QPIA 4A3IJ 3PPBA 3GTJJ 3JRFA 1HDDC 1UHSA 1WH7A 1JJ6C 5EF6A 1GV5A 4A3EJ 1X2MA 5C3EJ 4XRSA 1B8IB 1MBEA 4EEFG 2ZCMA 1TWHJ 3NAUA 1BW6A 1FIPA 1K83J 3SJMA 2QTQA 3PM1A 5C4JJ 2IEKA 3K2AA 1AU7A 3COLA 2AHQA 1U9NA 2DA4A 3P9TA 2DN0A 4RDUA 1U9OA 1K61A 1JKQC 1NK3P 3VVZA 3JR9A 2VPRA 4A3CJ 4DZJA 3S14J 1Y1VJ 3W6VA 2GLOA 1GDTA 2R7ZJ 3HB9A 2REKA 3SFIA 4M3FA 3NARA 3VW2A 3AQSA 2LK2A 1NK2P 1T56A 3B6AA 1H8AC 2DA1A 2G7LA 3B6CA 3IH3A 3E7QA 1LE8B 1GT0C 3G1LA 1W0TA 1JKRC 2JMWA 4XK4A 2M8GX 5EFYA 1UI5A 4GCTA 1SFOJ 3CMYA 2CU7A 1IRZA 3G7RA 3VOKA 3HBLA 5E3NA 3BQZA 3S2HJ 2WB1N 3LSJA 2QWTA 4C3IJ 3HOXJ 3IH4A 2R5YA 4GFLA 3G56A 1ETVA 1LFUP 2DMTA 3KNWA 3NPIA 2LR8A 2V57A 4BBSJ 3HE0A 3H0GJ 2P81A 1VFCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DG7 A;  3JRC A;  3D1N I;  1RR7 A;  4B3A A;  2AO9 A;  3WHC A;  1GVD A;  1HOM A;  2HQ5 A;  2YUS A;  1OFC X;  2KDZ A;  2ELK A;  2Y31 A;  4FIS A;  5IYB J;  3CQZ J;  4V2F A;  2O7O A;  5E3O A;  4Y7N J;  3LNQ A;  3OOU A;  1NTC A;  2Y9Z A;  3K7A J;  1A5J A;  3O8G A;  3T6N A;  1F36 A;  3QPS A;  3KZ9 A;  5HBU A;  2M34 A;  4DYR A;  5CXG A;  1MH4 A;  1S7E A;  4G12 A;  5K7F A;  2HXO A;  2X9D A;  1RET A;  2JA7 J;  4AC0 A;  5DAJ A;  2JA6 J;  4FE4 A;  1F43 A;  1I6H J;  5CXI A;  2COB A;  4A3L J;  3DPJ A;  3BRU A;  1FIA A;  2NOG A;  1YRN B;  1ETW A;  1QVT A;  2DMP A;  2E19 A;  3BTJ A;  1HDP A;  1RKT A;  1TC3 C;  9ANT A;  1JTY A;  3VPR A;  1MSE C;  1FJL A;  5FMP A;  1ZK8 A;  2K40 A;  4M6V A;  2G7S A;  2NX4 A;  2RAS A;  3BR5 A;  1ZR2 A;  3V78 A;  3S16 J;  3E7L A;  3F1B A;  1ETX A;  4GCL A;  2R0Q C;  3LSG A;  2EZL A;  3RQI A;  4UDS A;  1SAN A;  3FIW A;  2K9S A;  3BTL A;  1TWC J;  1ZTR A;  3IUV A;  3OSG A;  1OCT C;  3HGG A;  2HYT A;  1HCR A;  5D1R A;  2D5V A;  3L1P A;  3A03 A;  5EG0 A;  3GBG A;  1IGN A;  3LSR A;  3JRD A;  3A01 A;  4NEL A;  3HOW J;  4YZE A;  4MIM A;  5EEA A;  2CUF A;  3VVY A;  3HOV J;  1LFB A;  2TCT A;  4NDL A;  3JRG A;  5FLV A;  1WI3 A;  2GM4 A;  3VVX A;  2L0K A;  5EGO A;  3BR3 A;  3G1O A;  1JT0 A;  1TWF J;  5IP9 J;  3HTH A;  2QOP A;  1VND A;  2K9N A;  3VP5 A;  3GEU A;  2DMU A;  3HM5 A;  3Q0W A;  3MN2 A;  1QVU A;  3BHQ A;  3Q0V A;  3BT9 A;  5EYR A;  4UUS A;  1W0U A;  3A02 A;  3HGY A;  3LHQ A;  2JA5 J;  3HIM A;  1B72 B;  4FTH A;  5K58 A;  3S2D J;  5F0H A;  3GTL J;  1T33 A;  2FBQ A;  5F1J A;  1BA5 A;  1IG7 A;  2XGD A;  3HOY J;  2JJ7 A;  2JN6 A;  3HOZ J;  1JUP A;  3ZQG A;  3BR6 A;  2OPT A;  1AKH B;  2OF7 A;  4QIW N;  1ZGW A;  2UXO A;  5K7Z A;  2L7Z A;  2DG8 A;  3WHB A;  2QKO A;  5D19 A;  2NP5 A;  3O8H A;  3MNL A;  4JYK A;  4MK6 A;  5FKL A;  2ID6 A;  2DA6 A;  5FKO A;  2UXP A;  3I4M J;  1ENH A;  3DCF A;  3PO2 J;  5EZH A;  5IYD J;  4AYB N;  3NNR A;  2EZI A;  3EUP A;  4IHY A;  1OJL A;  2XRL A;  4X1E A;  4XRM A;  2XGE A;  2L7M P;  1APL C;  4AF5 A;  1ZQ3 P;  5JLW A;  4GCK A;  2ZB9 A;  2ME0 A;  2MG4 A;  2HDD A;  5IP7 J;  1XS9 A;  3HTI A;  3ZQI A;  2DA3 A;  2HI3 A;  2LY9 A;  3ANG A;  2UXU A;  1MBG A;  4D5C A;  1PUF A;  2CQX A;  3HTA A;  4M3B A;  3NXC A;  3HEF A;  3Q3S A;  3GTM J;  2NVX J;  2XPV A;  2VKV A;  3BQY A;  1U78 A;  5FJ8 J;  2ZCX A;  1Y1W J;  2CQQ A;  1FEX A;  2I10 A;  3FK6 A;  1QRY A;  3IH2 A;  5JLX A;  2H8R A;  4W1U A;  1H89 C;  3UKG A;  1E3O C;  2HOS A;  2HOA A;  1JJ8 C;  2LVS A;  1ETQ A;  3MKL A;  2LLK A;  1ZKG A;  4CYC A;  4BY7 J;  1Z0X A;  4ABZ A;  1MNM C;  3QKX A;  1G2H A;  1MSF C;  5M5W J;  4DYC A;  2MSY A;  2PZ9 A;  4D5F A;  3ZQL A;  3JRH A;  4JX5 A;  5M5Y J;  1ETO A;  4JX4 A;  3ZOB A;  4BKX A;  2M0C A;  3GTG J;  3QPL A;  2NVY J;  2YU9 J;  3S15 J;  4UUT A;  2GFN A;  1TWA J;  4C3H J;  5F27 A;  3GTQ J;  2OI8 A;  4GFB A;  3MVP A;  2PMZ N;  1IV6 A;  5GPA A;  2Y0S N;  4QSH A;  1GUU A;  1ZR4 A;  2E2J J;  1UI6 A;  3ON2 A;  1U8B A;  2ZOZ A;  3OSF A;  3H3V K;  2RAE A;  2LP0 A;  4HNV A;  3B81 A;  4LOC A;  5IOZ A;  1POG A;  3FIS A;  5GP9 A;  4A3M J;  2WAQ N;  2K9Q A;  3BCG A;  5GPC A;  5F0F A;  4X6A J;  5DTD A;  4A93 J;  3GTK J;  3QQA A;  2YVE A;  3V6G A;  1MBF A;  4BY1 J;  2DJN A;  1AHD P;  3TW6 A;  2Q24 A;  1JT6 A;  2R92 J;  3LJL A;  3BR1 A;  2ZOY A;  2W53 A;  5J1Y A;  2NVQ J;  2OER A;  5HOD A;  3RD3 A;  3ZQC A;  2MGQ A;  4RBO A;  2ECC A;  2LFB A;  2XSD C;  2TRT A;  3HOU J;  5FKN A;  3PO3 J;  4IHX A;  1R9T J;  2WGB A;  2M9H A;  2CUE A;  4J19 A;  2QF7 A;  1OCP A;  2RHA A;  5IOY A;  5IP6 A;  2R5Z B;  1FTT A;  1B8I A;  2IU5 A;  2DMN A;  2FJ1 A;  2JWT A;  4DW6 A;  5EDN A;  2WUI A;  1BL0 A;  2O8K A;  3TW7 A;  1UMQ A;  2EZK A;  4GFK A;  3OIO A;  1ITY A;  1I50 J;  1MBJ A;  2XGC A;  1Z77 A;  3BNI A;  4PXI A;  1WH5 A;  3FKI J;  3Q0U A;  2G7G A;  1RPW A;  3M4O J;  2NS8 A;  3FK7 A;  5FLM J;  2R93 J;  2NVT J;  4QTR A;  2FD5 A;  2VI6 A;  4AC6 A;  2ECB A;  1RES A;  2ZCN A;  4DYQ A;  4NN1 A;  3DEW A;  1LE8 A;  4FCY A;  4B1R A;  2XPU A;  2DA7 A;  3A01 B;  4A3J J;  4JKZ A;  2X6O A;  3S1M J;  3VOX A;  2YVH A;  1IDZ A;  3CDL A;  4MO7 A;  2UXI A;  1CQT A;  2GEN A;  3RZD J;  2EQR A;  4BBR J;  3KKD A;  1MBH A;  5EGO B;  4D7N A;  3TED A;  4V2G A;  5FKM A;  2LTP A;  2KT0 A;  2XB0 X;  2XPW A;  2CRG A;  3ANP A;  1IDY A;  1XC5 A;  5H9T A;  5E3M A;  2O7T A;  2IAI A;  2LKX A;  1WCM J;  1TWG J;  4JP0 A;  4UUS B;  3I4N J;  5F08 A;  3LWJ A;  5E3L A;  3BTI A;  5AQC A;  3F0C A;  1I3Q J;  1BW5 A;  4A69 C;  4BXX J;  1XG1 A;  3JRI A;  4D7M A;  3JRB A;  4ACI A;  2GBY A;  5K7H A;  1P7J A;  4IHV A;  1ETK A;  1JUS A;  3BG5 A;  2EBI A;  2QCO A;  3TP0 A;  4A3K J;  3CCY A;  5F04 A;  4ME9 A;  4XRS G;  3HTJ A;  5BNG A;  4XIC A;  3AQT A;  4DZP A;  1H88 C;  3FRQ A;  3RZO J;  5F0C A;  3JRA A;  2EZH A;  3QBM A;  2HKU A;  2FQ4 A;  1EF4 A;  1MBK A;  3S5R A;  3ZQH A;  5C44 J;  3EGQ A;  1FTZ A;  2X48 A;  3BR0 A;  4JL3 A;  2WV1 A;  4M3G A;  5C4Y A;  1YRN A;  2M2E A;  4M3D A;  4C3J J;  3TP3 A;  1VI0 A;  1X58 A;  2L9R A;  3JSJ A;  2B63 J;  4ICH A;  1JKO C;  5FGL A;  5M5X J;  3S17 J;  5J3L A;  2N8G A;  1IJW C;  5HSZ A;  2HOT A;  2ID3 A;  5C4X J;  1WGX A;  5IYC J;  1HLV A;  2E1O A;  2DMQ A;  3C2B A;  4XID A;  2MW8 A;  1Q1V A;  2L7F P;  2R5Y B;  5M3F J;  3IV5 A;  3M3Y J;  2DTZ A;  1PUF B;  4JNN A;  3VUQ A;  3LOC A;  3VW0 A;  4CGR A;  2FX0 A;  2JK3 A;  1WPK A;  2W48 A;  3BG3 A;  1DU0 A;  1A6I A;  3CJD A;  3ZQF A;  2QIB A;  4L5E A;  3C07 A;  5DS9 A;  3BR2 A;  1HF0 A;  2YS9 A;  2JA8 J;  3LSP A;  3GZI A;  1ETY A;  4B4C A;  4IHW A;  2E2I J;  4MLO A;  3KKC A;  4MFD A;  4C2M J;  2O9L A;  2R5Z A;  1P7I A;  2Y9Y A;  4CYC B;  1SGM A;  2NP3 A;  1JUM A;  3VW1 A;  1RKW A;  2IBD A;  5FKK A;  4M3E A;  5J1R A;  1D5Y A;  2G3B A;  3JRE A;  3GTO J;  4AUX A;  1JTX A;  3HKZ N;  4I6Z A;  2LD5 A;  1O4X A;  4Y52 J;  2Y2Z A;  5M3M J;  2XB5 A;  4MXM A;  5HAW A;  4KWA A;  3HDD A;  2D6Y A;  2Y30 A;  1VF9 A;  1B72 A;  3VIB A;  1ORK A;  4A3F J;  3GTP J;  3PAS A;  3S1N J;  2VUM J;  2CJJ A;  1IUF A;  4MFE A;  4IEJ A;  1JKP C;  3SDG A;  2F07 A;  4A3D J;  3CWR A;  4JX6 A;  2ME6 A;  1AKH A;  3BJB A;  4HKU A;  2H1K A;  3NI7 A;  4A3G J;  2UXH A;  3CRJ A;  3BTC A;  2G0E A;  2HXI A;  1JGG A;  1UG2 A;  3RKQ A;  5FHP A;  4S0H B;  1DU6 A;  1MH3 A;  3G1M A;  2HYJ A;  1IC8 A;  4FE7 A;  3RH2 A;  2EH3 A;  5J1U A;  5EG0 B;  3S1R J;  3BG9 A;  2E2H J;  2XDN A;  5CW8 A;  2PBX A;  1X2N A;  4I76 A;  2GUH A;  3O60 A;  3S1Q J;  1BJZ A;  4L62 A;  4W97 A;  2DA5 A;  1GV2 A;  2NS7 A;  2VKE A;  5EZG A;  3ON4 A;  3NRG A;  5D18 A;  4A3B J;  2DA2 A;  5IPA A;  1QPI A;  4A3I J;  3PPB A;  3GTJ J;  3JRF A;  1HDD C;  1UHS A;  1WH7 A;  1JJ6 C;  5EF6 A;  1GV5 A;  4A3E J;  1X2M A;  5C3E J;  4XRS A;  1B8I B;  1MBE A;  4EEF G;  2ZCM A;  1TWH J;  3NAU A;  1BW6 A;  1FIP A;  1K83 J;  3SJM A;  2QTQ A;  3PM1 A;  5C4J J;  2IEK A;  3K2A A;  1AU7 A;  3COL A;  2AHQ A;  1U9N A;  2DA4 A;  3P9T A;  2DN0 A;  4RDU A;  1U9O A;  1K61 A;  1JKQ C;  1NK3 P;  3VVZ A;  3JR9 A;  2VPR A;  4A3C J;  4DZJ A;  3S14 J;  1Y1V J;  3W6V A;  2GLO A;  1GDT A;  2R7Z J;  3HB9 A;  2REK A;  3SFI A;  4M3F A;  3NAR A;  3VW2 A;  3AQS A;  2LK2 A;  1NK2 P;  1T56 A;  3B6A A;  1H8A C;  2DA1 A;  2G7L A;  3B6C A;  3IH3 A;  3E7Q A;  1LE8 B;  1GT0 C;  3G1L A;  1W0T A;  1JKR C;  2JMW A;  4XK4 A;  2M8G X;  5EFY A;  1UI5 A;  4GCT A;  1SFO J;  3CMY A;  2CU7 A;  1IRZ A;  3G7R A;  3VOK A;  3HBL A;  5E3N A;  3BQZ A;  3S2H J;  2WB1 N;  3LSJ A;  2QWT A;  4C3I J;  3HOX J;  3IH4 A;  2R5Y A;  4GFL A;  3G56 A;  1ETV A;  1LFU P;  2DMT A;  3KNW A;  3NPI A;  2LR8 A;  2V57 A;  4BBS J;  3HE0 A;  3H0G J;  2P81 A;  1VFC A; 
#chains in the Genus database with same CATH topology
 2PG4 A;  1TP4 A;  2I5U A;  3JRC A;  2H94 A;  2MC3 A;  3L00 A;  2BZT A;  2AO9 A;  2V9P A;  4C2U A;  3P9C A;  2ZME B;  4B09 A;  1A6Q A;  3HRT A;  3N4M A;  4BE0 A;  3G6E I;  3WE3 A;  3SEQ A;  3OYM A;  1K78 A;  3K7A J;  3SFZ A;  3W2W A;  3X2Q H;  1A5J A;  3T6N A;  1W1W E;  4HPQ A;  4B3X A;  3ZPL A;  4AU7 A;  4PJ0 C;  4DYR A;  4G12 A;  4KIB A;  1PP8 F;  3LAP A;  4XR6 A;  2L9N A;  2HXO A;  2X9D A;  2K85 A;  2VE9 A;  3K70 C;  1Y6I A;  1GLN A;  3BRU A;  2NOG A;  4RAZ A;  2E1C A;  4GO1 A;  3TO6 A;  1STZ A;  1Y8R B;  1G8X A;  1WJF A;  3TOA A;  5FMP A;  2KIS A;  2XDV A;  3U9G A;  4MTD A;  3GVA A;  4HBL A;  1SAX A;  2F4M B;  4D0P A;  3S16 J;  3V8K A;  4GCL A;  2IPQ X;  3AG2 H;  3FIW A;  2K9S A;  2W7N A;  2P5L C;  3FM3 A;  4EQQ A;  1OCT C;  4OIO F;  3HGG A;  2O5R A;  2BBY A;  3MKW B;  3L1P A;  5BMZ A;  3GBG A;  4NC6 A;  3I55 I;  5F1R A;  3JRD A;  4Y13 A;  1G3Y A;  1XGO A;  2B3W A;  1S9H A;  5EEA A;  2HVS A;  1A04 A;  1R1V A;  1W36 C;  1X1B A;  1T95 A;  2TCT A;  2FUG 2;  1LUJ B;  2HR3 A;  5D5X B;  1IUY A;  4O6J A;  5HLG A;  1O7F A;  5EGO A;  1FOX A;  1KU9 A;  5CJ9 A;  3ECO A;  3G1O A;  2Y0M A;  5LD2 C;  3ZRG A;  1JT0 A;  4E7L A;  2QEN A;  5IP9 J;  3HTH A;  1UFM A;  1YX3 A;  2QOP A;  4RGU A;  2ZXH A;  2EFW A;  3VP5 A;  1ERD A;  2M7A A;  3Q0W A;  5IY5 H;  5CKT A;  3NS4 A;  3BHQ A;  4EJT A;  2WBM A;  3BT9 A;  2VBW A;  2DYS H;  1ZN2 A;  3A02 A;  3HGY A;  1Z9C A;  3R6S A;  5E8G A;  5J4Y A;  1YFH A;  1B72 B;  2AQF A;  2HQN A;  1MZB A;  2JVG A;  2NNN A;  2DOE A;  5F0H A;  2E7X A;  3BG6 A;  3IC7 A;  4AWX B;  4P5O A;  1IG7 A;  1WI9 A;  3A0H C;  3GZ6 A;  4RB3 C;  1JUP A;  1B1B A;  1XGS A;  1YYV A;  2M1B A;  3ZQG A;  2OF7 A;  1T0F C;  4QIW N;  3MZY A;  1ZGW A;  2L3D A;  1Z7U A;  4MNU A;  2ZFW A;  3U21 A;  5KNL A;  1W5S A;  3DKW A;  4XM3 A;  4GRI A;  4I7H A;  3CC4 I;  2ID6 A;  2L4M A;  2CYY A;  5FLX K;  4RS8 A;  2STW A;  1TT0 A;  4PJL A;  5IYD J;  2IVM A;  3EYY A;  4IZZ A;  2KFD A;  2HTJ A;  3EUP A;  4LJZ F;  4IHY A;  1SD5 A;  2IA2 A;  1I6X A;  4X1E A;  4E6K G;  1LVK A;  1RNL A;  4LK1 F;  2A68 F;  1B6A A;  4HQM A;  4Y3O A;  4EV0 A;  3J7A O;  2Y69 H;  5JLW A;  5GAD J;  2ME0 A;  3MKZ A;  5JFR A;  3I4P A;  1EH8 A;  2YX7 A;  3ZQI A;  1GXQ A;  2LY9 A;  1X3U A;  2BXZ A;  3AG4 H;  2KZV A;  3D5S C;  3GFL A;  3MCZ A;  4D5C A;  2WC2 A;  5LBQ A;  1WSU A;  1RI7 A;  3EET A;  3LA3 A;  4M3B A;  3VDX A;  4S04 A;  4QLC U;  3Q3S A;  2BHY A;  3E6C C;  2XPV A;  2Z1D A;  4P96 A;  1BI3 A;  1XD7 A;  5HLH A;  2I10 A;  3FK6 A;  1AA7 A;  3IH2 A;  1MGT A;  1X1C A;  4CCL A;  3DWL E;  4W1U A;  3CJN A;  3EUH C;  2BE5 F;  4A5M A;  2CV0 A;  2OQR A;  4B43 A;  3OMY A;  1ZKG A;  4BY7 J;  1Z0X A;  3TL4 X;  4ABZ A;  1MNM C;  3QKX A;  3QYF A;  1J2X A;  2FA5 A;  4HX7 A;  2MSY A;  2CSO A;  2XIG A;  1MJA A;  2VOP A;  4XRF A;  3JRH A;  4JX5 A;  4RGX A;  2VN2 A;  3LQQ A;  4BKX A;  1UEL B;  3KP7 A;  2KLO A;  1D5V A;  3S15 J;  3C2G A;  2P6S A;  3H3U A;  4ZDL A;  1G59 A;  1I1S A;  3VWB A;  4GFB A;  2R7R A;  3MVP A;  5GPA A;  2XAQ A;  2DOF A;  3WTS C;  3ON2 A;  1U8B A;  5AIP A;  3OSF A;  3H3V K;  2LP0 A;  2NYX A;  4LIV A;  3HKZ A;  3ABU A;  1VQL I;  4LOC A;  5IOZ A;  1POG A;  3FIS A;  4A3M J;  3QP6 A;  4ESB A;  4BQO A;  2UXX A;  3GEZ A;  3CCJ I;  5GPC A;  1LQ1 A;  1DDN A;  3IKV A;  3FBN B;  2MFZ A;  5A2Q Z;  1W36 D;  1K78 B;  3RYP A;  4XLP F;  2ELH A;  2HDW A;  1YIJ I;  2R92 J;  3LJL A;  2W53 A;  3B02 A;  5HOD A;  1H0M A;  2R7W A;  2LFB A;  2TRT A;  1UG0 A;  1SD4 A;  2WGB A;  3JCU C;  2V9V A;  2FBI A;  4XLH A;  5IP6 A;  2IU5 A;  4DW6 A;  4XLF A;  4KIT B;  2V4J C;  3TW7 A;  3RPU D;  2L01 A;  1G3W A;  3OIO A;  4XLA A;  1DGW Y;  4AVP A;  3LQR A;  4UNO A;  1Z77 A;  1X1P A;  4PJN A;  4HQE A;  1R71 A;  4PXI A;  1WH5 A;  3QP5 A;  2Z2S B;  1KQ9 A;  4HNU A;  3WTT C;  3K8P C;  2G7G A;  4CUG A;  2P8T A;  3CCS I;  3M4O J;  3TDU C;  1VQP I;  1D1B A;  5FLM J;  2CWE A;  3HSE A;  3COA C;  3I0T A;  4M73 A;  1FMV A;  1B4A A;  3FXQ A;  3ASO H;  2HS5 A;  3FWE A;  2V6C A;  3PIO F;  2CW0 F;  1MJ9 A;  2KRC A;  2LBF A;  4FCY A;  2DA7 A;  4F3Q A;  1FY7 A;  1YS7 A;  2DO7 A;  3K0L A;  3K4M A;  1TT5 B;  4XN0 A;  3S1M J;  3RPQ A;  1IDZ A;  2PQ8 A;  1P6R A;  4MO7 A;  4NB5 A;  3VSL A;  1SC7 A;  2UXI A;  1MDM A;  3RZD J;  4MEX F;  2IS6 A;  3IWZ A;  4RMN A;  5EGO B;  3OYE A;  4D7N A;  3TED A;  1V3F A;  4AYB A;  1FX7 A;  2HZT A;  2LTP A;  1IV8 A;  1S6L A;  2KT0 A;  2XPW A;  2VLA A;  1CF7 A;  3ANP A;  1IDY A;  5E79 C;  1XC5 A;  5H9T A;  5J8F A;  1WQ2 A;  2O7T A;  4PJJ A;  2LMD A;  4PSW A;  4OU0 A;  2W57 A;  1A31 A;  3I4N J;  3JTH A;  1NHA A;  3PQJ A;  2M4K A;  4BUP A;  1I3Q J;  1WJC A;  3F0C A;  4OAY A;  1PUE E;  2GBY A;  5K7H A;  4IHV A;  3F22 A;  2L9S A;  4KUM A;  3RQ4 A;  4XKV A;  2DXI A;  4ZYE A;  4ME9 A;  1J5Y A;  3OL3 A;  1G3S A;  4DZP A;  3HSR A;  1LEA A;  3RZO J;  2WAE A;  3JRA A;  3QBM A;  4GCV A;  2UV1 A;  1B9M A;  1ZLJ A;  2OCC H;  2PN6 A;  4NUB A;  3T5X A;  3ZQH A;  2ZJR F;  3S5R A;  5C44 J;  4EJW A;  3QYE A;  3G3Z A;  4JL3 A;  2DT7 B;  3RKY A;  2O3F A;  3ONQ A;  3TP3 A;  4HX4 A;  4QWQ A;  4L0Z B;  2H8W A;  5FD5 A;  1JKO C;  4EMS A;  2N8G A;  5HSZ A;  4A6D A;  3V8J A;  4F52 A;  3DQV C;  2W1O A;  5TRD A;  4UV9 A;  3QWL A;  3A2K A;  2W4S A;  2ZO4 A;  4XID A;  4CCO A;  1HA8 A;  4UVB A;  2HQA A;  2HPI A;  1KGS A;  3OY9 A;  2FX0 A;  4WK8 F;  3BG3 A;  2W48 A;  5EEH A;  2EV0 A;  1LDJ A;  1OQY A;  4E7Z A;  5LRR A;  3QYB A;  1QHG A;  1QO0 D;  1X19 A;  4B4C A;  2VOO A;  3KKC A;  2DTR A;  5F6F A;  4C2M J;  1SD6 A;  4BHB A;  1HSJ A;  1P7I A;  1I27 A;  3CMA I;  2NP3 A;  2LF8 A;  2ZY9 A;  1QPM A;  1JUM A;  4ZC3 A;  4RB2 C;  1QA6 A;  2RVC A;  5ILS A;  2Z33 A;  3GF2 A;  1UZC A;  2O0Y A;  2CMP A;  4H4K C;  4E7S A;  5J1R A;  3JRE A;  1D5Y A;  1XTA A;  4AUX A;  4MHG A;  4I6Z A;  1XGN A;  2MLG A;  1D3Y A;  4DIQ A;  3K4B A;  1G3T A;  1B59 A;  2Y2Z A;  1OCZ H;  2MBF A;  2XB5 A;  3VIB A;  2RV8 A;  2UUZ A;  3KZY A;  2ZSH B;  3R60 A;  4NQW A;  3REO A;  3TQN A;  4A3F J;  1D1C A;  1LPQ A;  1FBQ A;  4MFE A;  3H35 A;  2A3S A;  3SDG A;  2XC7 A;  1VQ9 I;  2F07 A;  2OAZ A;  2OV7 A;  4MQV A;  2ELJ A;  2JPB A;  3OYB A;  4WX9 A;  3ZMT A;  4WXD A;  2MD5 A;  3BJB A;  4HKU A;  2EFO A;  2COM A;  2ZXI A;  3CCQ I;  3DFG A;  1JGG A;  3F72 A;  4PZJ A;  1DU6 A;  2M8E A;  2NAZ A;  3G1M A;  4FE7 A;  3RH2 A;  2EH3 A;  5ED4 A;  3S1R J;  3CMM A;  2PJP A;  2L02 A;  2CFO A;  1BJZ A;  3H1C A;  3A0B C;  3GXO A;  1YW7 A;  2K4B A;  3FXM A;  3V7R A;  2DA2 A;  4ANJ A;  4A3I J;  2HVQ A;  1BJA A;  2O61 A;  1HXD A;  1RIO H;  1XX5 A;  1OR7 C;  1X2M A;  1TWH J;  2ZNY A;  3KP2 A;  1K83 J;  3MFK A;  3K2A A;  1NG7 A;  1KYZ A;  3LSK A;  3M8J A;  3CCU I;  1IN4 A;  2JT1 A;  4XOR A;  3P9T A;  1R58 A;  4ASN A;  2DU9 A;  1XMA A;  2EFQ A;  1K61 A;  1V4R A;  2IS2 A;  2VPR A;  3S14 J;  1OLT A;  1Y1V J;  2GLO A;  3I3L A;  2GXB A;  4M3F A;  2IS1 A;  2JZY A;  3TOB A;  3AQS A;  2RNG A;  4LFU A;  3B6A A;  1HC8 A;  1N25 A;  3E3V A;  3TBI A;  4EGY A;  2DFH A;  3WOD F;  3G1L A;  5DCM A;  2LBF B;  2JMW A;  5DUK A;  1IRG A;  4Y15 A;  1UI5 A;  1ZAO A;  3HOT A;  4E7K A;  3G7R A;  5E3N A;  2A5W A;  2CQN A;  2NS0 A;  3BQZ A;  4AIJ A;  3S2H J;  2X6W A;  3LSJ A;  3HOX J;  3H92 A;  1T38 A;  3IH4 A;  4ZH4 F;  2E35 A;  4YFN F;  5GTH C;  2VXZ A;  1IXC A;  2A05 A;  4I01 A;  2DMT A;  2E1M C;  4O5V A;  4LLL A;  4BBS J;  1CF7 B;  3LSM A;  2HKX A;  3CUO A;  2L7M P;  1FP2 A;  3GZ5 A;  3GWZ A;  2QKL B;  1IRX A;  3BY6 A;  3D1N I;  1E3H A;  1I3A A;  3WHC A;  2YUS A;  1OFC X;  2KDZ A;  2Y31 A;  2A61 A;  5IYB J;  3CQZ J;  4V2F A;  4TV7 A;  2O7O A;  2IT0 A;  4ON0 A;  1V55 H;  4UXN A;  3OOU A;  1HW2 A;  3KP5 A;  3O8G A;  1FLI A;  4CHU A;  2K5C A;  3OR2 C;  3QPS A;  2X1D A;  2ZJP F;  5HDG A;  2DFE A;  4G6D A;  2M0M A;  1MH4 A;  1P4A A;  4HRI A;  2O03 A;  2ZJ2 A;  3K1P A;  4CGZ A;  2PFV A;  1LNW A;  1RET A;  2WAQ A;  2JA7 J;  3FM5 A;  1MNE A;  1VQK I;  4FE4 A;  1WKM A;  4PCQ A;  1F43 A;  2X1C A;  5CLS A;  3BPV A;  3G2B A;  3TKY A;  4WWC A;  5L3D A;  4ZZD A;  3OYC A;  4A3L J;  3ZXS A;  2GOX B;  3J81 Z;  3BG7 A;  3IRR A;  3BZC A;  2DMP A;  2E19 A;  4BS9 A;  5BQT A;  3HL2 A;  1TC3 C;  9ANT A;  2F4O B;  2MAB A;  1FSE A;  3VPR A;  1MSE C;  3BP8 A;  2EJR A;  3NWT A;  3BR5 A;  1J9I A;  2ICW G;  4UVA A;  2R4G A;  1ETX A;  2ISZ A;  4UDS A;  3BTL A;  1ZTR A;  2OZU A;  1HCR A;  5D1R A;  3M1C A;  1FOW A;  3HRU A;  4PSX A;  3LSR A;  1S7A A;  3ESW B;  4KYW A;  2XF5 A;  4DBR A;  2PFB A;  2V1N A;  3P7N A;  2HYF A;  1RR8 C;  2DBB A;  1USS A;  2B1E A;  2M7B A;  3HOV J;  2HYG D;  1Q1H A;  3H9G A;  1QNT A;  2IGM A;  2KIF A;  2EB7 A;  1CGP A;  1P4W A;  5FLV A;  2TDX A;  2DJI A;  2GM4 A;  1YIO A;  1LEB A;  5JVG F;  2XAU A;  2OD5 A;  2BW3 A;  2DMU A;  2Z16 A;  1W5C C;  2WTE A;  3Q0V A;  5FRO A;  4PJM A;  4UY8 I;  3PSI A;  4B44 A;  2CQ7 A;  3ISP A;  4Q48 A;  3IWF A;  5FGM A;  5HDK A;  2LF7 A;  4NQW B;  1KQ8 A;  1IN6 A;  4XBF A;  2FBQ A;  2QQ9 A;  5F1J A;  4LG3 A;  2LYC A;  3HG9 A;  3KPH A;  2XGD A;  2JJ7 A;  5HLT A;  3C1D A;  3Q9S A;  3L2Q A;  4D9J A;  2IJL A;  4LMY A;  2UXO A;  5K7Z A;  3DBH B;  3WHB A;  2QKO A;  5D19 A;  1E17 A;  1REP C;  3O8H A;  2H09 A;  4MK6 A;  2I8D A;  3EPZ A;  5FKO A;  3BZ6 A;  1ENH A;  4BAC A;  5EZH A;  4WCG A;  3HXL A;  2K9M A;  3TDZ C;  2JQ7 A;  2EZI A;  2LH9 A;  3PIP F;  2XRL A;  2XUB A;  3F8M A;  1WJE A;  1ZQ3 P;  3EUH A;  3CP2 A;  4WXC A;  2KP6 A;  2X0L A;  4GGG A;  4LB5 A;  4GCK A;  3S3M A;  2B0L A;  3QU6 A;  1BI2 A;  2MG4 A;  2HWV A;  5HS7 A;  3OYG A;  3N05 A;  4WIB A;  4A0Z A;  2DA3 A;  1VZ0 A;  3RYR A;  1ZRE A;  1U5T C;  1MBG A;  3H0D A;  2RDP A;  3HTA A;  4XKC A;  4IQJ A;  3GTM J;  4MEY F;  5DM7 F;  1EH7 A;  1LDD A;  2CQQ A;  2XSJ C;  4XLN F;  3ZMZ A;  4BE1 A;  3S3O A;  1H89 C;  4UV8 A;  1E3O C;  2HOS A;  2PMH A;  1ETQ A;  3FX3 A;  2Y48 A;  4L5J A;  2LLK A;  3VYU B;  4CYC A;  4BDZ A;  1Y0N A;  1Y56 A;  2HPM A;  3ABT A;  2ZME C;  5DD8 A;  4OMY A;  4LLG F;  1G2H A;  3ERM A;  4BNC A;  2Z5U A;  3QPH A;  1MSF C;  1Z67 A;  3PNT A;  5DCM B;  5LLQ A;  5HDN A;  3AKZ A;  4N0B A;  1ETO A;  2L54 A;  2FOK A;  2P7C B;  2M0C A;  4IOC F;  3JSO A;  1U3E M;  1YJN I;  4KIF A;  3SZP A;  1YO5 C;  5F27 A;  3T8R A;  4E70 A;  5D5U B;  3GTQ J;  2PMU A;  4U0W A;  2KPM A;  4QSH A;  1IXR C;  3E6D A;  2E2J J;  2KZG A;  3RJP A;  1UI6 A;  5AIQ A;  2RAE A;  2ZFU A;  2J5O A;  1SD7 A;  2JSP A;  3LA2 A;  3FMQ A;  2VAS A;  1ZG1 A;  4IXA A;  2UXN A;  1TZL A;  3BCG A;  4X6A J;  5DTD A;  3OYL A;  3R0A A;  1P92 A;  3CD6 I;  2YVE A;  1YX5 A;  3RTR A;  4DNC A;  4Y33 A;  4U7B A;  3BR1 A;  2ZOY A;  2JTV A;  1PJR A;  1KU2 A;  3WG9 A;  1F1Z A;  3ZQC A;  2ECC A;  2XSD C;  1ZHF A;  3HOU J;  5FKN A;  5BS6 A;  4PFP A;  1R9T J;  2C6Y A;  3OIP A;  2XAF A;  2CUE A;  3SWH A;  2RHA A;  1B9N A;  3WG7 H;  5IOY A;  1FTT A;  1B8I A;  2P5V A;  2DMN A;  2FJ1 A;  2JWT A;  4QPO A;  3KYL A;  3GO5 A;  3NWS A;  1UMQ A;  2EZK A;  4S05 A;  5CVR A;  4MQ9 F;  3OS1 A;  1MKM A;  2IA1 A;  3LAJ A;  2R7Q A;  1RPW A;  4KDP A;  2QSG X;  1XMK A;  2RN7 A;  5GAH J;  1K4S A;  3CUQ A;  2CS3 A;  3I58 A;  2R93 J;  2Z3Y A;  4LIT A;  2MH9 A;  4PDK A;  1TTY A;  1UB9 A;  2NVT J;  2VI6 A;  3JAM K;  2VJI A;  1RES A;  2K4J A;  2CGP A;  4Z2Y A;  3PUF A;  4G6Q A;  2R7U A;  3CC7 I;  2QBY A;  3OYK A;  4Y4R A;  3RI4 A;  2ZCN A;  3FXU A;  2IW5 A;  1P4X A;  3K4L A;  4KMU X;  4HG2 A;  4ZYA A;  4CCN A;  1LE8 A;  2A07 F;  3HC7 A;  3VOX A;  4YIR X;  4KNY A;  2YVH A;  1Z6T A;  1X1D A;  5HNF A;  3CDL A;  3CO7 C;  4XLE A;  4CH7 A;  4IL6 C;  2VIX A;  3F6O A;  4I0A A;  2EQR A;  2AXL A;  4BBR J;  3DTE A;  1MBH A;  2E7W A;  2K3P A;  5FKM A;  3J81 K;  2XB0 X;  1QZZ A;  2DK8 A;  2CRG A;  1ZG3 A;  2BW3 B;  5E3M A;  3M7G A;  3LFU A;  4LGW A;  1Z3Y A;  1WCM J;  1TWG J;  5TJJ A;  3AL0 B;  1FYL A;  1UST A;  3LWJ A;  2CQK A;  3BOQ A;  4OIR F;  2V26 A;  3BTI A;  3L2R A;  4A69 C;  4BXX J;  3JRB A;  4ACI A;  4KMF A;  3BG5 A;  3PNV A;  3GCM A;  3CZ6 A;  3I59 A;  1IN7 A;  3ZN0 A;  2OU2 A;  1W7P A;  4JQF A;  4A3K J;  3KP4 A;  3R61 A;  4XRS G;  2ZCW A;  1BIA A;  5BNG A;  1OMI A;  1YS6 A;  4EM2 A;  1J0R A;  3FRQ A;  3EYI A;  1JI8 A;  1N77 A;  1BR1 A;  2BV6 A;  3DBR B;  2EZH A;  3F3X A;  5KCM A;  1JE8 A;  3BJA A;  1VQO I;  3CCV I;  5LHH A;  2X48 A;  4IRG A;  1YJW I;  1VQ7 I;  4CDG A;  2HTS A;  1MMD A;  5C4Y A;  1YRN A;  4HAM A;  1XSV A;  2MLK A;  4C3J J;  5J6X A;  2VQC A;  1VI0 A;  1X58 A;  2OA4 A;  2B9S A;  2B63 J;  3JSJ A;  4FHT A;  2FE3 A;  1ZRD A;  4ZDP A;  1TNT A;  3OYF A;  3ELK A;  1Z7L A;  2F48 A;  1MMN A;  2ID3 A;  2KQR A;  1WGX A;  1HLV A;  3C3W A;  2E1O A;  1X1A A;  3C2B A;  2MW8 A;  2ZKZ A;  4R8H A;  1G4D A;  2R5Y B;  3SZT A;  2KDO A;  3VUQ A;  1V5G A;  3LOC A;  4DQ2 A;  1F5T A;  3ABK H;  3VW0 A;  1SVO A;  1WPK A;  5FFZ A;  1Z3X A;  4G7O F;  1GXP A;  3ZQF A;  3CJD A;  5DS9 A;  2QVO A;  2ZBK A;  3BR2 A;  3QRF F;  2CV2 A;  2VON A;  2VJJ A;  3LSP A;  3I56 I;  1UHM A;  1ETY A;  2O8X A;  4UVC A;  3KEY A;  2E2I J;  2CFX A;  2XF7 A;  4PGG A;  2VOD A;  4C2T A;  2WY8 Q;  1L3L A;  2CO5 A;  2R5Z A;  3HSF A;  2Y9Y A;  3C2H A;  4CYC B;  1V54 H;  1RKW A;  2GAU A;  5H6Q A;  1XSD A;  1IO2 A;  4FX4 A;  2IGK A;  4M3E A;  2G3B A;  2BEO A;  3GTO J;  1IF1 A;  3UR3 C;  4CXF A;  1TLH B;  3HKZ N;  2LRE A;  4LIU A;  2LD5 A;  1O4X A;  3CF5 F;  2A5Y B;  4HDV A;  3L2W A;  3CC2 I;  4HNT A;  1H9T A;  2ZSI B;  2B7E A;  5HAW A;  1YTY A;  1R4M B;  2XVC A;  2Y30 A;  2XHK A;  2EA4 A;  1L0O C;  2DCE A;  2P5K A;  4BXU A;  3S1N J;  1ULY A;  2LKS A;  1HBX G;  4XON A;  4CCK A;  2M5W A;  3DEE A;  5CVV A;  5HOO A;  4JX6 A;  5CVJ A;  1FC3 A;  2ME6 A;  5D6F A;  2VBX A;  3CJR B;  4BJ5 C;  4A3G J;  3HTS B;  4N4O B;  4BHP A;  2QUF A;  3F8B A;  4L9T A;  5HS9 A;  3JTG A;  3CCE I;  3DBL B;  4S0H B;  5E8I A;  2HEO A;  1W5T A;  3KIO A;  2AS5 F;  3DTI A;  2EK5 A;  4I76 A;  2X6X A;  2GUH A;  5FRM A;  2VJ5 A;  4KJZ A;  4U88 A;  1GV2 A;  4XSX F;  5ILU A;  4RAG A;  1DPU A;  4A3B J;  1RZ4 A;  3MZ8 A;  1HDD C;  3VYS B;  1WH7 A;  3SHF A;  2QYO A;  4I99 C;  5E1W A;  4EM1 A;  4A3E J;  1B8I B;  1UAA A;  2ZCM A;  2ZXJ A;  5JVT A;  3JW4 A;  3IKT A;  3PM1 A;  2IEK A;  2DDA A;  2NVU B;  1AU7 A;  2K27 A;  2HQR A;  3S2W A;  1ZRC A;  2L5Q A;  4EM0 B;  1J7K A;  4Z6Y A;  1ZGJ A;  2DA4 A;  5J40 A;  3TMO A;  2X4H A;  3CUQ B;  2BGC A;  2CV1 A;  4DZJ A;  4OD4 A;  2DPU A;  3I5U A;  1KQ0 A;  2BY3 A;  2REK A;  4E7H A;  3NQO A;  3NAR A;  2E71 A;  3ZMS A;  1HQC A;  2LK2 A;  1PYV A;  1T56 A;  4XOT A;  1H8A C;  2QBY B;  4HDU A;  3B6C A;  2XRN A;  4HV6 A;  1LE8 B;  3E7Q A;  1W0T A;  3WTV C;  1JKR C;  4CSW A;  4GXO A;  3CMY A;  3GME A;  1IRZ A;  1OYY A;  4IRV A;  2WB1 N;  1U6G A;  3HYI A;  4IF4 A;  2QWT A;  5E17 F;  3NPI A;  2LR8 A;  3HUG A;  1A36 A;  3HE0 A;  2R7S A;  4HX8 A;  2OTJ I;  5D6E A;  4EAT A;  2P81 A;  5EEG A;  2QSH X;  3MEX A;  3E6B A;  2CW7 A;  4B3A A;  1TNS A;  4C9Y A;  5KAI C;  2Q1Z B;  1GVD A;  2HQ5 A;  2ELK A;  1HW1 A;  3KFW X;  2GZW A;  3BRO A;  3LNQ A;  2Y0S A;  3AG1 H;  4KIS A;  1YI2 I;  1X4P A;  3HTU A;  3LST A;  3I59 B;  1W7P B;  3KZ9 A;  5HBU A;  3ROU A;  2M34 A;  5CXG A;  1S7E A;  2FML A;  3PNY A;  1C0W A;  1TBX A;  3E97 A;  3GX4 X;  3C18 A;  3MD2 A;  3OWT A;  4KIG A;  4BL0 B;  1OKR A;  2JA6 J;  4DOZ A;  1I6H J;  5CXI A;  3CTA A;  1QZY A;  2V6E A;  3KLO A;  1FIA A;  2BXY A;  3O2P E;  2LY1 A;  1MW7 A;  1YRN B;  4PUS A;  2QQ8 A;  3BTJ A;  4F7Z A;  4UUV A;  1HDP A;  1RKT A;  3S8P A;  5E18 F;  4YRV A;  2HNH A;  4AIH A;  4II2 A;  4ENJ A;  1R1T A;  2KRH A;  3ZCO A;  3F9K A;  1W4M A;  1XDS A;  1ZK8 A;  2K40 A;  2LRD A;  1VTN C;  5TIS C;  2NX4 A;  2RAS A;  1ZR2 A;  4ENN A;  3E7L A;  3VYT B;  3GYH X;  3F1B A;  2R0Q C;  3LSG A;  3DKX A;  3RQI A;  1XSX A;  4BQQ A;  1SAN A;  2W82 A;  1YE9 A;  2E34 A;  1TWC J;  2V79 A;  1J75 A;  3F23 A;  5LHI A;  4WF2 A;  5AON A;  2D5V A;  5BPD A;  5EG0 A;  3OL4 A;  2VT3 A;  5H20 A;  3DP7 A;  4CO8 A;  1IGN A;  5HVQ C;  2BHZ A;  3GFI A;  3CME I;  4GYI A;  1DGR M;  2K86 A;  3A01 A;  1D8J A;  4IRH A;  4NEL A;  3HOW J;  2EPF A;  4MIM A;  1KU7 A;  4YIF A;  4M6Y A;  5BOX A;  2CUF A;  2H6C A;  4NDL A;  2DFF A;  2Q0O A;  4B47 A;  1BC7 C;  1D0Z A;  1YIT I;  2L7K A;  3H9J A;  1WI3 A;  3C7J A;  3VVX A;  1LJ9 A;  3ML6 A;  4P9U A;  2GA2 A;  1VND A;  1V5F A;  4N9I A;  3GEU A;  3HM5 A;  3MN2 A;  3DTK A;  1KA8 A;  4ZYG A;  3SEZ A;  1PDN C;  3H5N A;  4RB0 A;  4A0Y A;  4UB6 C;  2D1V A;  5EYR A;  4UUS A;  3DU6 A;  3LHQ A;  1T8I A;  2JA2 A;  4DJA A;  4K2E A;  3G71 I;  5K58 A;  1WJB A;  3GTL J;  1T33 A;  2D2W A;  2DDB A;  1SFK A;  2UZK A;  3RKX A;  1ONV A;  4IHS A;  3WTU C;  2XGX A;  1FYK A;  2JN6 A;  3BR6 A;  1LVA A;  2L7Z A;  1O57 A;  2DG8 A;  1IN8 A;  5K1Y A;  3MNL A;  2GIZ A;  3FXR A;  4JYK A;  2RC4 A;  2DA6 A;  2UXP A;  2HZD A;  4P1W A;  3I4M J;  2IP2 A;  4L5I A;  4Q47 A;  5B5E C;  1SFU A;  4EJV A;  2EIL H;  4CIC A;  4XL9 A;  2FEZ A;  5LGN A;  3O3K A;  3NNR A;  3M9A A;  5DDG A;  5ICE A;  1OJL A;  4XRM A;  2XGE A;  1APL C;  2M3A A;  3T0Y A;  4H0E A;  3AG3 H;  3IRQ A;  4R79 A;  1MDM B;  1IAW A;  2F5D A;  3DPU A;  3AAF A;  2Z9O A;  3ANG A;  1J09 A;  2UXU A;  1T08 B;  3DEU A;  4HST A;  1PUF A;  2CQX A;  5ICC A;  1LKX A;  5IT3 A;  3NXC A;  2E1N A;  4KIC A;  2FMY A;  5DM6 F;  2RQQ A;  3BQY A;  1U78 A;  2FNA A;  1Y1W J;  1FEX A;  2F6C A;  2YU3 A;  4KA4 A;  5H6R A;  3K1N A;  1F9N A;  3UKG A;  2XV4 S;  5CPR B;  4XLC A;  5DCF A;  3KZZ A;  3ZQQ A;  1IXS B;  3JAM Z;  2HOA A;  2XKO A;  4ZTJ A;  1XCV A;  1IZ1 A;  2M45 A;  4MTE A;  4ZJZ A;  3FHN A;  1O3Q A;  4I0B A;  3SQN A;  3DLL F;  2V1X A;  3OOP A;  3DF8 A;  4IHT A;  2DOA A;  2PZ9 A;  5F64 A;  3WGH A;  3BCB A;  2OQG A;  2HKO A;  3OR1 C;  5K5R A;  2CW8 A;  4JX4 A;  1ON2 A;  3ULQ B;  3QPL A;  2NVY J;  3H9Q A;  3QPT A;  1BOA A;  3HJE A;  2AXT C;  3FXL A;  2NNY A;  2VT2 A;  3O6B B;  4UUT A;  6PAX A;  2KL4 A;  3BCA A;  2OI8 A;  3OYI A;  2PMZ N;  3WE2 A;  3L2U A;  1S3J A;  2FF4 A;  1IV6 A;  2YX4 A;  1KZH A;  4RM2 A;  1GUU A;  3HUG B;  2Q8K A;  2GWR A;  2ZOZ A;  3KEQ A;  4RAY A;  2QZ8 A;  1WZ2 A;  1QGP A;  3B81 A;  2GA1 A;  2E5N A;  5HNH A;  5TGT A;  2GXA A;  3ABL H;  2OC6 A;  2WAQ N;  1U0J A;  2K9Q A;  2W25 A;  5F0F A;  1FWZ A;  1WJ5 A;  2QQB A;  3GTK J;  3V6G A;  3ZR8 X;  3IP4 B;  4L0Y B;  1MBF A;  4UHT A;  4BY1 J;  2DJN A;  1FOK A;  4LK0 F;  1K6Y A;  2K02 A;  1BOB A;  1X3Z B;  5J1Y A;  1UHW A;  3CJQ B;  5LGT A;  3RD3 A;  2MGQ A;  1DP3 A;  2E5Z A;  1MMA A;  3M07 A;  2EV6 A;  4U9N A;  1XPX A;  4M6X A;  4J19 A;  3HHG A;  1OCP A;  4HOB A;  3QOD A;  2YPR A;  2R7O A;  5CYV A;  3KEO A;  1O7L A;  1IRF A;  3FF5 A;  2VE8 A;  5EDN A;  3IAS 2;  3L2V A;  1BL0 A;  1E2X A;  2O8K A;  4U9L A;  4E7I A;  4HV5 A;  3W2A A;  1FPQ A;  1T0F A;  3BZK A;  3MAJ A;  4LD5 A;  1ITY A;  2JSC A;  4AD9 A;  1SFE A;  3Q0U A;  1LFP A;  4KT5 C;  5E20 A;  3BWG A;  3DV8 A;  3FKJ A;  3K10 A;  1E0E A;  3FK7 A;  1MND A;  3E6M A;  4IVN A;  1WHU A;  3WGI A;  1BC8 C;  2OCE A;  2FD5 A;  2STT A;  4O3M A;  2WAF A;  2R7D A;  1S5L C;  5DD4 A;  2BY2 A;  2LG4 A;  3WTX C;  4DYQ A;  4NN1 A;  4AIK A;  1VQ8 I;  3OV8 A;  4F55 A;  1HKQ A;  1S29 A;  5B1B H;  2XPU A;  3A01 B;  4JKZ A;  4OIN F;  2FQ3 A;  2MH2 A;  4FX0 A;  2X6O A;  1SMY F;  1OPC A;  2RGV A;  3B73 A;  3F8C A;  4GYG A;  1T6S A;  1WJA A;  3QU3 A;  1CQT A;  2GEN A;  3L2C A;  1FSH A;  2EIM H;  2L4A A;  3H5A A;  2MC4 A;  4RGR A;  3PJR A;  2BVM A;  5GAE J;  3JSP A;  3HOS A;  1H9G A;  2E36 A;  4G8X A;  3ZQ7 A;  2FBK A;  3L9F A;  3WU1 B;  1PVE A;  2O6G E;  2Z99 A;  4OMZ A;  4J00 A;  3VOD A;  3UNG C;  2EV5 A;  1BBY A;  3CLO A;  3GFM A;  2F2E A;  2FU4 A;  3I9V 2;  2LKX A;  2OJE D;  2DPD A;  1SAU A;  4JP0 A;  3AFH A;  4RA2 A;  4UUS B;  1MMS A;  3I53 A;  3P9K A;  3VFZ A;  2X6Y A;  5E3L A;  4DBQ A;  5AQC A;  1KU3 A;  3TO9 A;  1I1G A;  2ISY A;  1XG1 A;  4D7M A;  2IS4 A;  2UWM A;  1P7J A;  1ZYR F;  3M8F A;  1ETK A;  4DGW B;  1JUS A;  3VTI A;  2DW4 A;  1GVJ A;  3TP0 A;  3F21 A;  5ICG A;  3CJT B;  4G9Y A;  3CCY A;  3HTJ A;  3ZGK A;  3AQT A;  1S8N A;  1O3R A;  5E1X A;  4IQ4 A;  3FMR A;  2DK5 A;  2HKU A;  1EF4 A;  1MBK A;  1MIJ A;  2EA2 A;  3QAH A;  4LB6 B;  1FP1 D;  3TO7 A;  1FTZ A;  3BR0 A;  2WV1 A;  5EJC A;  4EGZ A;  2M2E A;  2WY7 Q;  3ZMV A;  4M3D A;  3OIQ A;  2XAJ A;  2LSO A;  1BI1 A;  5M5X J;  3S17 J;  5J3L A;  3ABM H;  3OS2 A;  2G9W A;  3E0J B;  5C4X J;  1OIS A;  4L9V A;  2CG4 A;  1EA3 A;  2DMQ A;  4U0V A;  1VQN I;  3CDH A;  4D1Q A;  1DPR A;  5M3F J;  3K2Z A;  5H2F C;  3IV5 A;  1SFX A;  3M3Y J;  2DTZ A;  1PUF B;  4CGR A;  1JHH A;  2QSF X;  2JK3 A;  1DU0 A;  1A6I A;  4EJU A;  2WV0 A;  5L3F A;  2QIB A;  2YS9 A;  2JA8 J;  1OCC H;  3GZI A;  2RQP A;  2DQL A;  4JBA A;  4IHW A;  3V42 A;  4CYD A;  1JGS A;  4MFD A;  2H27 A;  4ZZL A;  2JPC A;  2O9L A;  2VBY A;  2KHM A;  4KN7 X;  1YHQ I;  2YR2 A;  5K5O A;  4II3 A;  2K3F A;  5B1A H;  2ZJQ F;  4BEH A;  5FKK A;  4OIP F;  3KLN A;  4BE2 A;  2F5V A;  2G7U A;  3LL7 A;  1TQM A;  1JTX A;  3RSN A;  2FXA A;  5LEJ A;  3IUO A;  1ZG5 A;  1FBU A;  2L9V A;  2LNB A;  3A4C A;  4PK4 A;  3E5U A;  1OCR H;  2FBH A;  2KMU A;  4IRI A;  4QPQ A;  1ZH5 A;  1EH6 A;  1XCB A;  5FB2 A;  4JOM A;  2PI0 A;  1XMX A;  1DQU A;  2QLZ A;  3WU2 C;  4HLY A;  3HIF A;  4IEJ A;  4N4N B;  1JKP C;  4PFO A;  4A3D J;  3BJO A;  3BLY A;  5DEQ A;  3CCM I;  4L18 B;  2R7T A;  3CWR A;  2JUG A;  3GUD A;  1AKH A;  4JK1 X;  1E3P A;  3CRJ A;  3BTC A;  4MGR A;  4OOI A;  4M71 A;  5FHP A;  2HXI A;  3U1K A;  3WGG A;  3U1D A;  3CP8 A;  1MH3 A;  2HYJ A;  3MMY B;  1IC8 A;  2XKP A;  3FMS A;  2IXS A;  3BG9 A;  4EVI A;  1FBS A;  2P6T A;  1BN5 A;  3A1Y A;  2WAD A;  3O60 A;  3SDB A;  4BJ6 C;  4W97 A;  3WTZ A;  4NC8 A;  2JRT A;  1ZAR A;  2DA5 A;  2VKE A;  2K9L A;  4BDY A;  3ON4 A;  1R23 A;  2R3S A;  3F6V A;  3G4S I;  2MA3 A;  5IPA A;  5D18 A;  3PPB A;  2X85 A;  3J80 K;  2F5C A;  3JRF A;  4G94 A;  4ENK A;  4YEL A;  1GV5 A;  5LRS A;  1AOY A;  1YW9 A;  5C3E J;  4XRS A;  1MBE A;  1MMG A;  4EEF G;  4WXH A;  3NAU A;  1FIP A;  1TW3 A;  3GLX A;  4RAF A;  5C4J J;  3W6K B;  1SMT A;  3DPT A;  2QWW A;  3SYT A;  3J7A Y;  3KE2 A;  1WRJ A;  1U2W A;  1Z6R A;  2EIN H;  1EJ9 A;  4CZZ A;  4OWR B;  2RRE A;  2WWY A;  2YSR A;  1JKQ C;  5CQE A;  1NK3 P;  2YVX A;  2V9K A;  5GTI C;  1K4T A;  3E1S A;  1HW5 A;  4V19 K;  1QQI A;  2PEX A;  1PP7 U;  2R7Z J;  2KJC A;  3HB9 A;  3SFI A;  1BR4 A;  3AL0 C;  3VW2 A;  1R4N B;  1NK2 P;  2DA1 A;  2G7L A;  5CVU A;  2X51 A;  2A6E F;  4OD5 A;  2LY2 A;  5EFY A;  3PFI A;  2QKM B;  2CU7 A;  1WVR A;  2DYR H;  3EUA A;  3HBL A;  3F8N A;  2KIU A;  1Y0U A;  3WU0 A;  2VQH A;  4C3I J;  3CDI A;  4BYY A;  5ERI A;  4GFL A;  3K69 A;  3K6G A;  1RRJ A;  3PSF A;  1LFU P;  2V57 A;  2QGU A;  1HKS A;  2QA4 I;  3QOP A;  2VL8 A;  3KX2 A;  2F5F A;  2DG7 A;  1QBJ A;  3FDY A;  2JUC A;  2EWN A;  3HRS A;  1RR7 A;  3E5X A;  3PQK A;  1NH3 A;  1HOM A;  2OBP A;  2DT6 A;  1A35 A;  4FIS A;  2DFI A;  4U87 A;  1D1A A;  4HSR A;  5D5V B;  5E3O A;  4Y7N J;  4PGH A;  2W24 A;  3K70 D;  1NTC A;  1Z1D A;  2Y9Z A;  1RUN A;  3I54 A;  1QZE A;  1F36 A;  3IL2 A;  2A6H F;  3RDI A;  3BC8 A;  5DUI A;  5K7F A;  4IX7 A;  3L09 A;  1ZLK A;  3EDP A;  2VQL A;  4AC0 A;  5DAJ A;  2CUJ A;  1FNN A;  3VEP A;  4BGD A;  2KRF A;  2COB A;  3DPJ A;  1I5Z A;  2J5P A;  2BVL A;  4AID A;  4IO9 F;  1ETW A;  1QVT A;  1ZEL A;  2HVR A;  4YFX F;  1Z91 A;  4Q4Z F;  2XRO A;  2P0W A;  3OS0 A;  5IT9 Z;  1N75 A;  1YJ9 I;  1DP7 P;  2XAH A;  1JTY A;  1ZGA A;  4UB8 C;  4XSZ F;  1FJL A;  1TQI A;  3RIR A;  3OYH A;  4M6V A;  2G7S A;  3V78 A;  2A6T A;  1P2F A;  1TW2 A;  3K4N A;  4A6E A;  2EZL A;  2W00 A;  1IW7 F;  4HA8 A;  5ICF A;  3OSG A;  2HYT A;  3V7S A;  4HF2 A;  2F4I A;  1OYW A;  3A03 A;  1DUX C;  5FRN A;  3E5Q A;  2BOL A;  1K7A A;  1R5G A;  5LHG A;  2MYS A;  4M74 A;  4LG0 A;  4AM3 A;  2W85 A;  1OR7 A;  2WA0 A;  4BQA A;  4YZE A;  1XGM A;  3FXK A;  3VVY A;  3J7Z I;  1LFB A;  3LSI A;  2BY0 A;  2M4G A;  3P9I A;  1UCR A;  3JRG A;  3H3Z A;  3QOE A;  5D8K B;  4NBQ A;  2L0K A;  3BR3 A;  4BEH B;  4ZTF A;  1JXS A;  1LB2 A;  1TWF J;  2XF6 A;  4RM3 A;  3S32 A;  2RNJ A;  2K9N A;  4RLF A;  2M30 A;  2OUM A;  2PBI A;  3M1E A;  1QVU A;  1Y39 A;  1W0U A;  2ACJ A;  4XNF A;  1HST A;  2JA5 J;  1EV7 A;  4FTH A;  3HIM A;  4EJO A;  1OCO H;  3GLL A;  5B66 C;  4XMY A;  4NNJ A;  3S2D J;  4ETS A;  3DXJ F;  1TL8 A;  1D0Y A;  3D5R C;  3LFK A;  1BA5 A;  3HOY J;  3RCO A;  3HOZ J;  1J59 A;  2OPT A;  4U7D A;  1AKH B;  3S93 A;  3T1B A;  1D8K A;  3H5R A;  1T98 A;  3PL8 A;  4OAZ A;  4M9Z A;  2NP5 A;  5FKL A;  4C30 A;  2HU9 A;  2L2O A;  3PO2 J;  1I39 A;  3DCF A;  3PFY A;  3CUQ C;  3VOE A;  4J01 A;  3OYA A;  4AYB N;  1KON A;  2BY1 A;  1R6R A;  4AF5 A;  2XAG A;  3D5L A;  5B3S H;  4XKB A;  2DQR A;  1S7O A;  3I71 A;  2ZB9 A;  4A2U A;  4KN4 X;  2HDD A;  5J8C A;  4I2O A;  5IP7 J;  1TQP A;  2WB1 A;  3KZI C;  2JVH A;  2CUZ A;  1XS9 A;  3HTI A;  4HZF A;  1Z21 A;  2HI3 A;  2LC2 A;  4GDF A;  3G73 A;  2ZXW H;  3K1M A;  3HEF A;  4P9F A;  4F91 B;  2NVX J;  4CCJ A;  2VKV A;  1R5I D;  5FJ8 J;  2ZCX A;  3GW2 A;  2LDU A;  2V7F A;  1JHF A;  1OYI A;  1QRY A;  5CQG A;  5JLX A;  4LLN A;  5E1Z B;  4ESF A;  3M8E A;  2H8R A;  2G7H A;  3HHH A;  3EQL F;  5LGU A;  1JJ8 C;  2LVS A;  3MKL A;  1BIB A;  5BPI A;  2EFN A;  1FT9 A;  5JHF A;  2FRH A;  4ZYH A;  3CES A;  5J4V A;  2Q2E A;  3CF2 A;  5M5W J;  1O3S A;  4DYC A;  1T39 A;  3OYN A;  2HFH A;  1EKE A;  4D5F A;  3ZQL A;  2IGO A;  5M5Y J;  1YOV B;  3ZOB A;  3GTG J;  3FXJ A;  2R7V A;  2KJB A;  4A0X A;  4XKW A;  4IJA A;  1R36 A;  2YU9 J;  3IAM 2;  2D45 A;  2VB6 A;  2GFN A;  1TWA J;  1VQM I;  3OYD A;  4C3H J;  2Y75 A;  5JI6 A;  4RB1 A;  2Y0S N;  4FAS D;  4ITV A;  4Q5S F;  1ZR4 A;  2V1D A;  1R7J A;  3H36 A;  3K4K A;  4HNV A;  3KYC B;  2JRM A;  2VKD A;  1M1E B;  1KYW A;  2A69 F;  5GP9 A;  5L3E A;  4G7H F;  1MD0 A;  2BYV E;  4HF1 A;  4A93 J;  3QQA A;  4BH9 A;  5FD6 A;  2EFP A;  3FZV A;  1NG6 A;  3ZMD A;  5JR3 A;  4HYE A;  3TW6 A;  1AHD P;  2Q24 A;  1YG2 A;  1JT6 A;  2PJR A;  5KHD A;  2NVQ J;  2OER A;  1BR2 A;  3WTW C;  4RBO A;  3PO3 J;  4X0G A;  4IHX A;  5HS8 A;  1R00 A;  3ECH A;  2M9H A;  2P7V B;  2QF7 A;  4F93 B;  3ERE D;  4YG2 F;  2GXG A;  2R5Z B;  1AWC A;  2WUI A;  4C2M A;  4GFK A;  1K79 A;  1F4K A;  1I50 J;  1MBJ A;  2XGC A;  3BNI A;  4P55 A;  3RKW A;  2CH0 A;  3FKI J;  3HPG A;  2NS8 A;  5J47 A;  3KCC A;  3U2R A;  2DOD A;  2QEX I;  3LWF A;  2DAO A;  4QTR A;  4AC6 A;  3LMM A;  2ECB A;  1X3W B;  4BJT A;  3DEW A;  4LG0 B;  3ZMU A;  4YEJ A;  3CLQ A;  4B1R A;  1T2K A;  4A3J J;  3F8F A;  3BJ6 A;  3CO6 C;  3TGN A;  1RC9 A;  1U5T A;  1RUO A;  2OTL I;  2DI3 A;  2GOM A;  4FET A;  3KKD A;  1BI0 A;  4ZDO A;  4V2G A;  2FNP A;  3EUK L;  2VBZ A;  1ODD A;  1V5E A;  3KYD B;  5IT9 K;  2IAI A;  2H1L A;  1SEU A;  1YW8 A;  3KP3 A;  3WTY C;  5F08 A;  3D0S A;  4YFK F;  2ZME A;  3I64 A;  4CCM A;  1R49 A;  4E4H A;  1P9Q C;  4G6T B;  1BW5 A;  1VQ6 I;  3MWM A;  5JHU A;  3JRI A;  5D5W B;  2RKH A;  2DT5 A;  1IN5 A;  4N9H A;  1XDU A;  5A2Q K;  4RLQ A;  2EBI A;  2QCO A;  1G6N A;  5KAF C;  4HEA 2;  4M9X A;  1QHH D;  5F04 A;  5LEK A;  4XIC A;  3PUB A;  5KVR A;  1H88 C;  4R1H A;  5F0C A;  4FQG A;  4XOP A;  3VB2 A;  3K4C A;  2NRA C;  2KIQ A;  2KIM A;  2E1M B;  2FQ4 A;  2K7L A;  4IOA F;  2H6B A;  1W7P D;  5CVI A;  3W2V A;  3EGQ A;  4RGS A;  3Q9V A;  2FOW A;  3GZN B;  4M3G A;  4NHJ A;  2EIK H;  1X4O A;  2LOO A;  4ENM A;  3SXY A;  3MQ0 A;  4L9J A;  4BHC A;  1FMW A;  2L9R A;  3LA7 A;  4ICH A;  5L3B A;  1Y8Q B;  5FGL A;  2ZC2 A;  3J80 Z;  1IJW C;  1R5H A;  2D1H A;  2HOT A;  2IGN A;  2NXN B;  4L9N A;  5IYC J;  2GQQ A;  2HOE A;  4KT6 A;  3NRV A;  3W3C A;  1Q1V A;  2L7F P;  2QM3 A;  1Z05 A;  2PMZ A;  4JNN A;  1ON1 A;  1FOY A;  3HPH A;  1O3T A;  1UJ8 A;  2ETH A;  2R7F A;  1D0X A;  4CA0 A;  2VC0 A;  4L5E A;  5D4S A;  3W6J B;  1QU3 A;  1HF0 A;  3C07 A;  4HF0 A;  1S72 I;  2OZ6 A;  3K9T A;  5FFX A;  3VYR B;  3V4G A;  1WWX A;  2VJ4 A;  4MLO A;  4AVZ A;  5FLX Z;  5D8L B;  4U0Y A;  2P4W A;  4I02 A;  1U8R A;  1SGM A;  3ZP5 A;  3VW1 A;  2IBD A;  2Q2E B;  2E60 A;  4M72 A;  2R7X A;  1GHC A;  1ACI A;  4B48 A;  4BAY A;  3RPU A;  4ZYD A;  2QQA A;  4E7J A;  3MZH A;  4KFC A;  2F5E A;  4Y52 J;  3N97 A;  1FYM A;  4XN3 A;  5M3M J;  4MXM A;  2ZNZ A;  3OYJ A;  4KWA A;  3HDD A;  2FSW A;  2D6Y A;  1B72 A;  1VF9 A;  1ORK A;  2IA0 A;  3DKY A;  4HLX A;  4NC7 A;  5HLI A;  3R4K A;  3GTP J;  3V8L A;  3PAS A;  4IKF A;  4I98 B;  2VUM J;  2CJJ A;  1IUF A;  5GAG J;  3R0J A;  1VQ4 I;  1R1U A;  2W84 A;  4CZC A;  2H1K A;  3NI7 A;  3IHU A;  2UXH A;  1LDK B;  2ESN A;  3ZN1 A;  5K5Q A;  2G0E A;  1WJD A;  1UG2 A;  3RKQ A;  3KET A;  2AQE A;  1HKT A;  3J7Y J;  2IRF G;  2A2F X;  3HZJ A;  5J1U A;  2PJR B;  5EG0 B;  2E2H J;  2EIJ H;  2XDN A;  5CW8 A;  2VC1 A;  1N78 A;  2PBX A;  1X2N A;  3Q5F A;  4G7Z F;  3S1Q J;  4L62 A;  4DVY P;  5L3G A;  2NS7 A;  4FT8 A;  5EZG A;  1ZRF A;  3NRG A;  1QPI A;  1WFX A;  3L7W A;  3GTJ J;  2M87 A;  3MKY B;  4A12 A;  1UHS A;  1JJ6 C;  5L3C A;  3DLA A;  3BPX A;  3V7C A;  4XQF A;  5EF6 A;  2HDC A;  2PLY A;  3SZG A;  2DLL A;  2VQG A;  1BW6 A;  2ADU A;  4B8X A;  4I09 A;  2MD0 A;  3SJM A;  3K4J A;  2V1U A;  2QTQ A;  4OIQ F;  1YLF A;  1YQA A;  3COL A;  2AHQ A;  1U9N A;  4F92 B;  3VSK A;  3CCL I;  3BDD A;  2XAS A;  2DN0 A;  4YII A;  4RDU A;  1U9O A;  1MJB A;  1FZP B;  2PX9 A;  5LFA A;  1R22 A;  3P5J A;  3VVZ A;  3JR9 A;  2HGC A;  4A3C J;  3FBI B;  3W6V A;  3S3N A;  1GDT A;  4Y17 A;  1XN7 A;  5KK1 A;  3ASN H;  3CCR I;  1SVM A;  4ESJ A;  3T8T A;  4IPA A;  4BXF A;  2X1E A;  4A5N A;  2FJI 1;  1XB4 A;  2KKO A;  5DV5 A;  3IH3 A;  1SVL A;  1GT0 C;  4HW0 A;  2VPL A;  2ESH A;  4XK4 A;  2M8G X;  4BQN A;  2VXD A;  5D4R A;  4GCT A;  5FO5 A;  1SFO J;  1K6O A;  3GFJ A;  5DYM A;  1U5T B;  3VOK A;  1VQ5 I;  3HRM A;  3LSH A;  5ILV A;  3FHZ A;  1BM9 A;  4BU2 A;  2R5Y A;  3DPL C;  2VKH A;  3G56 A;  3KP6 A;  1ETV A;  2NOJ B;  2GIV A;  2LKP A;  3FXO A;  3KNW A;  3DU5 A;  3NEU A;  3H0G J;  3IUV A;  1VFC A;  4M9S A; 
#chains in the Genus database with same CATH homology
 2DG7 A;  3JRC A;  3D1N I;  1RR7 A;  4B3A A;  2AO9 A;  3WHC A;  1GVD A;  1HOM A;  2HQ5 A;  2YUS A;  1OFC X;  2KDZ A;  2ELK A;  2Y31 A;  4FIS A;  5IYB J;  3CQZ J;  4V2F A;  2O7O A;  5E3O A;  4Y7N J;  3LNQ A;  3OOU A;  1NTC A;  2Y9Z A;  3K7A J;  1A5J A;  3O8G A;  3T6N A;  1F36 A;  3QPS A;  3KZ9 A;  5HBU A;  2M34 A;  4DYR A;  5CXG A;  1MH4 A;  1S7E A;  4G12 A;  5K7F A;  2HXO A;  2X9D A;  1RET A;  2JA7 J;  4AC0 A;  5DAJ A;  2JA6 J;  4FE4 A;  1F43 A;  1I6H J;  5CXI A;  2COB A;  4A3L J;  3DPJ A;  3BRU A;  1FIA A;  2NOG A;  1YRN B;  1ETW A;  1QVT A;  2DMP A;  2E19 A;  3BTJ A;  1HDP A;  1RKT A;  1TC3 C;  9ANT A;  1JTY A;  3VPR A;  1MSE C;  1FJL A;  5FMP A;  1ZK8 A;  2K40 A;  4M6V A;  2G7S A;  2NX4 A;  2RAS A;  3BR5 A;  1ZR2 A;  3V78 A;  3S16 J;  3E7L A;  3F1B A;  1ETX A;  4GCL A;  2R0Q C;  3LSG A;  2EZL A;  3RQI A;  4UDS A;  1SAN A;  3FIW A;  2K9S A;  3BTL A;  1TWC J;  1ZTR A;  3IUV A;  3OSG A;  1OCT C;  3HGG A;  2HYT A;  1HCR A;  5D1R A;  2D5V A;  3L1P A;  3A03 A;  5EG0 A;  3GBG A;  1IGN A;  3LSR A;  3JRD A;  3A01 A;  4NEL A;  3HOW J;  4YZE A;  4MIM A;  5EEA A;  2CUF A;  3VVY A;  3HOV J;  1LFB A;  2TCT A;  4NDL A;  3JRG A;  5FLV A;  1WI3 A;  2GM4 A;  3VVX A;  2L0K A;  5EGO A;  3BR3 A;  3G1O A;  1JT0 A;  1TWF J;  5IP9 J;  3HTH A;  2QOP A;  1VND A;  2K9N A;  3VP5 A;  3GEU A;  2DMU A;  3HM5 A;  3Q0W A;  3MN2 A;  1QVU A;  3BHQ A;  3Q0V A;  3BT9 A;  5EYR A;  4UUS A;  1W0U A;  3A02 A;  3HGY A;  3LHQ A;  2JA5 J;  3HIM A;  1B72 B;  4FTH A;  5K58 A;  3S2D J;  5F0H A;  3GTL J;  1T33 A;  2FBQ A;  5F1J A;  1BA5 A;  1IG7 A;  2XGD A;  3HOY J;  2JJ7 A;  2JN6 A;  3HOZ J;  1JUP A;  3ZQG A;  3BR6 A;  2OPT A;  1AKH B;  2OF7 A;  4QIW N;  1ZGW A;  2UXO A;  5K7Z A;  2L7Z A;  2DG8 A;  3WHB A;  2QKO A;  5D19 A;  2NP5 A;  3O8H A;  3MNL A;  4JYK A;  4MK6 A;  5FKL A;  2ID6 A;  2DA6 A;  5FKO A;  2UXP A;  3I4M J;  1ENH A;  3DCF A;  3PO2 J;  5EZH A;  5IYD J;  4AYB N;  3NNR A;  2EZI A;  3EUP A;  4IHY A;  1OJL A;  2XRL A;  4X1E A;  4XRM A;  2XGE A;  2L7M P;  1APL C;  4AF5 A;  1ZQ3 P;  5JLW A;  4GCK A;  2ZB9 A;  2ME0 A;  2MG4 A;  2HDD A;  5IP7 J;  1XS9 A;  3HTI A;  3ZQI A;  2DA3 A;  2HI3 A;  2LY9 A;  3ANG A;  2UXU A;  1MBG A;  4D5C A;  1PUF A;  2CQX A;  3HTA A;  4M3B A;  3NXC A;  3HEF A;  3Q3S A;  3GTM J;  2NVX J;  2XPV A;  2VKV A;  3BQY A;  1U78 A;  5FJ8 J;  2ZCX A;  1Y1W J;  2CQQ A;  1FEX A;  2I10 A;  3FK6 A;  1QRY A;  3IH2 A;  5JLX A;  2H8R A;  4W1U A;  1H89 C;  3UKG A;  1E3O C;  2HOS A;  2HOA A;  1JJ8 C;  2LVS A;  1ETQ A;  3MKL A;  2LLK A;  1ZKG A;  4CYC A;  4BY7 J;  1Z0X A;  4ABZ A;  1MNM C;  3QKX A;  1G2H A;  1MSF C;  5M5W J;  4DYC A;  2MSY A;  2PZ9 A;  4D5F A;  3ZQL A;  3JRH A;  4JX5 A;  5M5Y J;  1ETO A;  4JX4 A;  3ZOB A;  4BKX A;  2M0C A;  3GTG J;  3QPL A;  2NVY J;  2YU9 J;  3S15 J;  4UUT A;  2GFN A;  1TWA J;  4C3H J;  5F27 A;  3GTQ J;  2OI8 A;  4GFB A;  3MVP A;  2PMZ N;  1IV6 A;  5GPA A;  2Y0S N;  4QSH A;  1GUU A;  1ZR4 A;  2E2J J;  1UI6 A;  3ON2 A;  1U8B A;  2ZOZ A;  3OSF A;  3H3V K;  2RAE A;  2LP0 A;  4HNV A;  3B81 A;  4LOC A;  5IOZ A;  1POG A;  3FIS A;  5GP9 A;  4A3M J;  2WAQ N;  2K9Q A;  3BCG A;  5GPC A;  5F0F A;  4X6A J;  5DTD A;  4A93 J;  3GTK J;  3QQA A;  2YVE A;  3V6G A;  1MBF A;  4BY1 J;  2DJN A;  1AHD P;  3TW6 A;  2Q24 A;  1JT6 A;  2R92 J;  3LJL A;  3BR1 A;  2ZOY A;  2W53 A;  5J1Y A;  2NVQ J;  2OER A;  5HOD A;  3RD3 A;  3ZQC A;  2MGQ A;  4RBO A;  2ECC A;  2LFB A;  2XSD C;  2TRT A;  3HOU J;  5FKN A;  3PO3 J;  4IHX A;  1R9T J;  2WGB A;  2M9H A;  2CUE A;  4J19 A;  2QF7 A;  1OCP A;  2RHA A;  5IOY A;  5IP6 A;  2R5Z B;  1FTT A;  1B8I A;  2IU5 A;  2DMN A;  2FJ1 A;  2JWT A;  4DW6 A;  5EDN A;  2WUI A;  1BL0 A;  2O8K A;  3TW7 A;  1UMQ A;  2EZK A;  4GFK A;  3OIO A;  1ITY A;  1I50 J;  1MBJ A;  2XGC A;  1Z77 A;  3BNI A;  4PXI A;  1WH5 A;  3FKI J;  3Q0U A;  2G7G A;  1RPW A;  3M4O J;  2NS8 A;  3FK7 A;  5FLM J;  2R93 J;  2NVT J;  4QTR A;  2FD5 A;  2VI6 A;  4AC6 A;  2ECB A;  1RES A;  2ZCN A;  4DYQ A;  4NN1 A;  3DEW A;  1LE8 A;  4FCY A;  4B1R A;  2XPU A;  2DA7 A;  3A01 B;  4A3J J;  4JKZ A;  2X6O A;  3S1M J;  3VOX A;  2YVH A;  1IDZ A;  3CDL A;  4MO7 A;  2UXI A;  1CQT A;  2GEN A;  3RZD J;  2EQR A;  4BBR J;  3KKD A;  1MBH A;  5EGO B;  4D7N A;  3TED A;  4V2G A;  5FKM A;  2LTP A;  2KT0 A;  2XB0 X;  2XPW A;  2CRG A;  3ANP A;  1IDY A;  1XC5 A;  5H9T A;  5E3M A;  2O7T A;  2IAI A;  2LKX A;  1WCM J;  1TWG J;  4JP0 A;  4UUS B;  3I4N J;  5F08 A;  3LWJ A;  5E3L A;  3BTI A;  5AQC A;  3F0C A;  1I3Q J;  1BW5 A;  4A69 C;  4BXX J;  1XG1 A;  3JRI A;  4D7M A;  3JRB A;  4ACI A;  2GBY A;  5K7H A;  1P7J A;  4IHV A;  1ETK A;  1JUS A;  3BG5 A;  2EBI A;  2QCO A;  3TP0 A;  4A3K J;  3CCY A;  5F04 A;  4ME9 A;  4XRS G;  3HTJ A;  5BNG A;  4XIC A;  3AQT A;  4DZP A;  1H88 C;  3FRQ A;  3RZO J;  5F0C A;  3JRA A;  2EZH A;  3QBM A;  2HKU A;  2FQ4 A;  1EF4 A;  1MBK A;  3S5R A;  3ZQH A;  5C44 J;  3EGQ A;  1FTZ A;  2X48 A;  3BR0 A;  4JL3 A;  2WV1 A;  4M3G A;  5C4Y A;  1YRN A;  2M2E A;  4M3D A;  4C3J J;  3TP3 A;  1VI0 A;  1X58 A;  2L9R A;  3JSJ A;  2B63 J;  4ICH A;  1JKO C;  5FGL A;  5M5X J;  3S17 J;  5J3L A;  2N8G A;  1IJW C;  5HSZ A;  2HOT A;  2ID3 A;  5C4X J;  1WGX A;  5IYC J;  1HLV A;  2E1O A;  2DMQ A;  3C2B A;  4XID A;  2MW8 A;  1Q1V A;  2L7F P;  2R5Y B;  5M3F J;  3IV5 A;  3M3Y J;  2DTZ A;  1PUF B;  4JNN A;  3VUQ A;  3LOC A;  3VW0 A;  4CGR A;  2FX0 A;  2JK3 A;  1WPK A;  2W48 A;  3BG3 A;  1DU0 A;  1A6I A;  3CJD A;  3ZQF A;  2QIB A;  4L5E A;  3C07 A;  5DS9 A;  3BR2 A;  1HF0 A;  2YS9 A;  2JA8 J;  3LSP A;  3GZI A;  1ETY A;  4B4C A;  4IHW A;  2E2I J;  4MLO A;  3KKC A;  4MFD A;  4C2M J;  2O9L A;  2R5Z A;  1P7I A;  2Y9Y A;  4CYC B;  1SGM A;  2NP3 A;  1JUM A;  3VW1 A;  1RKW A;  2IBD A;  5FKK A;  4M3E A;  5J1R A;  1D5Y A;  2G3B A;  3JRE A;  3GTO J;  4AUX A;  1JTX A;  3HKZ N;  4I6Z A;  2LD5 A;  1O4X A;  4Y52 J;  2Y2Z A;  5M3M J;  2XB5 A;  4MXM A;  5HAW A;  4KWA A;  3HDD A;  2D6Y A;  2Y30 A;  1VF9 A;  1B72 A;  3VIB A;  1ORK A;  4A3F J;  3GTP J;  3PAS A;  3S1N J;  2VUM J;  2CJJ A;  1IUF A;  4MFE A;  4IEJ A;  1JKP C;  3SDG A;  2F07 A;  4A3D J;  3CWR A;  4JX6 A;  2ME6 A;  1AKH A;  3BJB A;  4HKU A;  2H1K A;  3NI7 A;  4A3G J;  2UXH A;  3CRJ A;  3BTC A;  2G0E A;  2HXI A;  1JGG A;  1UG2 A;  3RKQ A;  5FHP A;  4S0H B;  1DU6 A;  1MH3 A;  3G1M A;  2HYJ A;  1IC8 A;  4FE7 A;  3RH2 A;  2EH3 A;  5J1U A;  5EG0 B;  3S1R J;  3BG9 A;  2E2H J;  2XDN A;  5CW8 A;  2PBX A;  1X2N A;  4I76 A;  2GUH A;  3O60 A;  3S1Q J;  1BJZ A;  4L62 A;  4W97 A;  2DA5 A;  1GV2 A;  2NS7 A;  2VKE A;  5EZG A;  3ON4 A;  3NRG A;  5D18 A;  4A3B J;  2DA2 A;  5IPA A;  1QPI A;  4A3I J;  3PPB A;  3GTJ J;  3JRF A;  1HDD C;  1UHS A;  1WH7 A;  1JJ6 C;  5EF6 A;  1GV5 A;  4A3E J;  1X2M A;  5C3E J;  4XRS A;  1B8I B;  1MBE A;  4EEF G;  2ZCM A;  1TWH J;  3NAU A;  1BW6 A;  1FIP A;  1K83 J;  3SJM A;  2QTQ A;  3PM1 A;  5C4J J;  2IEK A;  3K2A A;  1AU7 A;  3COL A;  2AHQ A;  1U9N A;  2DA4 A;  3P9T A;  2DN0 A;  4RDU A;  1U9O A;  1K61 A;  1JKQ C;  1NK3 P;  3VVZ A;  3JR9 A;  2VPR A;  4A3C J;  4DZJ A;  3S14 J;  1Y1V J;  3W6V A;  2GLO A;  1GDT A;  2R7Z J;  3HB9 A;  2REK A;  3SFI A;  4M3F A;  3NAR A;  3VW2 A;  3AQS A;  2LK2 A;  1NK2 P;  1T56 A;  3B6A A;  1H8A C;  2DA1 A;  2G7L A;  3B6C A;  3IH3 A;  3E7Q A;  1LE8 B;  1GT0 C;  3G1L A;  1W0T A;  1JKR C;  2JMW A;  4XK4 A;  2M8G X;  5EFY A;  1UI5 A;  4GCT A;  1SFO J;  3CMY A;  2CU7 A;  1IRZ A;  3G7R A;  3VOK A;  3HBL A;  5E3N A;  3BQZ A;  3S2H J;  2WB1 N;  3LSJ A;  2QWT A;  4C3I J;  3HOX J;  3IH4 A;  2R5Y A;  4GFL A;  3G56 A;  1ETV A;  1LFU P;  2DMT A;  3KNW A;  3NPI A;  2LR8 A;  2V57 A;  4BBS J;  3HE0 A;  3H0G J;  2P81 A;  1VFC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...