3BTJA

Crystal structure of qacr(e58q) bound to dequalinium
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
186
structure length
186
Chain Sequence
NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEQSKWQEQWKKEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title QacR-cation recognition is mediated by a redundancy of residues capable of charge neutralization
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription
molecule keywords HTH-type transcriptional regulator qacR
total genus 83
structure length 186
sequence length 186
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2007-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3btjA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3btjA02
2CQQA 4D5CA 3NXCA 2G7GA 4DYCA 3HB9A 2UXPA 2HQ5A 2D6YA 1U78A 1LFUP 4DYRA 5C3EJ 4A3FJ 3JSJA 1GV5A 2IEKA 1I50J 2LD5A 2Y2ZA 4I76A 3K7AJ 1XS9A 2L7MP 3VIBA 3L1PA 1F36A 1X58A 3HDDA 4AC6A 2FJ1A 1VFCA 2D5VA 3K2AA 4S0HB 4XRMA 3S1QJ 1K83J 1ZTRA 4M3GA 2ME0A 2ID6A 3GTMJ 4JKZA 3QQAA 3JR9A 2ZOYA 1Z77A 3HOXJ 2HKUA 2E2JJ 2QTQA 4GFLA 3CWRA 1ZKGA 3IH3A 3S16J 3JRIA 1MSFC 5JLXA 1F43A 2XGDA 3MN2A 5J3LA 3HEFA 4BKXA 4XRSA 4CYCB 1BW6A 3IH4A 4XK4A 3VOXA 2NOGA 3BT9A 3BTJA 5DS9A 1JKOC 2MW8A 3BRUA 5IPAA 1NK3P 1HDDC 3VP5A 5HODA 2K40A 2RAEA 1A5JA 4A3MJ 3ON2A 4A3BJ 2E2HJ 2HDDA 2CU7A 3GTOJ 2JN6A 4V2GA 1JTYA 5FKNA 1B8IB 1MSEC 2G3BA 3G1OA 2QOPA 2MGQA 1HDPA 1RKTA 3W6VA 5EDNA 2NVQJ 3GTLJ 2QIBA 1VNDA 1FTZA 3VPRA 3G1LA 2NS7A 4M3EA 1IUFA 2CJJA 3JRDA 2ELKA 1U9NA 3ZQIA 2TCTA 3BTIA 1YRNA 2F07A 3MNLA 4GFKA 2DA6A 4MK6A 1JJ6C 2EBIA 1JKPC 4IHYA 2JJ7A 3KNWA 2O8KA 3PM1A 1WCMJ 3HOZJ 4A3DJ 3FKIJ 3B6AA 1SANA 1WGXA 9ANTA 3HOVJ 3AQSA 3S2HJ 3ZQGA 4ICHA 4C3JJ 5C4XJ 3FIWA 4W1UA 3IV5A 3BCGA 2ZCXA 2R7ZJ 2XPUA 3HOWJ 3JRAA 2NVTJ 3HTAA 1TWGJ 2DMQA 3TP0A 5CW8A 1CQTA 3Q0WA 2DG7A 3DPJA 1WI3A 3BG9A 3LSJA 3NPIA 2R5YB 3BG3A 5K7HA 3BNIA 5AQCA 5E3NA 5M5WJ 3OIOA 1XC5A 1GVDA 4JX4A 4IHWA 4XRSG 1JGGA 1Z0XA 2PZ9A 2UXOA 2M34A 3IH2A 2CRGA 1MH4A 3O8GA 2K9NA 1PUFB 4NN1A 5IYBJ 5E3MA 5D18A 1SFOJ 3HE0A 2DA2A 3ZQLA 1GV2A 2YU9J 5EZHA 3NI7A 3V6GA 4GCTA 2NP3A 1ETOA 2ID3A 2XPVA 4L5EA 4A3EJ 2Y9ZA 3MKLA 4MFEA 4AC0A 4XIDA 1TC3C 3BJBA 2CUFA 3OSGA 2G0EA 1ETXA 3JRCA 2XB5A 3VW0A 1WH7A 5FMPA 2LVSA 3M3YJ 3COLA 3GEUA 1IC8A 2GBYA 2JA5J 3LJLA 4M6VA 3TW7A 3D1NI 5C4JJ 1ETYA 2Y31A 3ZQFA 1DU0A 3JREA 4A3JJ 4LOCA 2WAQN 1IDZA 3CJDA 5EFYA 3ZQCA 2HI3A 3Q0VA 4UUSA 1B8IA 3NAUA 3O60A 1JTXA 4KWAA 2LY9A 3EUPA 2HOAA 4C3HJ 3RKQA 1TWHJ 3S5RA 5EEAA 1E3OC 2NVXJ 1BW5A 2DA5A 1JKQC 4X6AJ 5C44J 3GTQJ 3HTJA 1TWCJ 2H1KA 2XB0X 2DTZA 3GBGA 5EG0B 2HYJA 2DA4A 4JYKA 1H89C 2HOTA 4A69C 2DMTA 3FK7A 4BY7J 1UI5A 1RETA 3RZOJ 5FKLA 3SJMA 5H9TA 3NARA 1ETVA 4XICA 3BR0A 3RQIA 2GENA 4EEFG 2LKXA 1ITYA 1UMQA 2Q24A 3IUVA 5JLWA 4J19A 1AU7A 2DN0A 2R0QC 3H3VK 2OPTA 2ECCA 3SDGA 3HKZN 2UXIA 3LOCA 5FLVA 4BBRJ 1JKRC 2OERA 2L7ZA 2UXHA 3P9TA 1OJLA 1MBGA 2VKVA 4A3KJ 1AKHA 3ANPA 5IP6A 2LR8A 4A93J 3VW1A 3A02A 4FE4A 2K9SA 4B3AA 1WPKA 3HBLA 4BXXJ 4Y7NJ 4L62A 5EZGA 1B72B 4JX5A 5M5XJ 1ETQA 1NK2P 5K7ZA 5CXGA 2COBA 1P7JA 2FBQA 1I3QJ 4C3IJ 3BHQA 2GLOA 2O7OA 3E7QA 2GUHA 4QSHA 2O9LA 3ANGA 2UXUA 2LTPA 2V57A 2XRLA 1MBKA 4MIMA 4IHXA 2HYTA 4GFBA 1HCRA 4X1EA 3H0GJ 4AF5A 5F0CA 3PASA 1TWFJ 3TP3A 1VI0A 4M3DA 1R9TJ 2B63J 3KZ9A 4QIWN 3F1BA 3NRGA 3CQZJ 5K58A 1HOMA 5BNGA 2G7SA 1JT6A 1TWAJ 1H88C 2PMZN 5C4YA 5K7FA 4A3GJ 3RH2A 5IP9J 4QTRA 1YRNB 3PO2J 2O7TA 1X2MA 1D5YA 4GCKA 5F0FA 1FIPA 4G12A 1IJWC 2HOSA 4D5FA 1U9OA 3TEDA 3S15J 2XSDC 1GT0C 2E1OA 3UKGA 1ORKA 2Y30A 3G1MA 5DAJA 1HLVA 5M3MJ 2M8GX 3B81A 2LFBA 2RASA 1G2HA 2L9RA 3I4NJ 1RKWA 1RESA 3BTLA 3VW2A 5HAWA 4V2FA 3LWJA 3CDLA 4ME9A 3LSGA 1SGMA 1BL0A 3WHBA 1FJLA 4CYCA 5FKKA 2NVYJ 4I6ZA 4BY1J 2HXIA 2DMNA 3LSPA 3KKCA 4PXIA 2JA7J 3GTGJ 4MO7A 4UUTA 2DA3A 3Q0UA 3C07A 1QVTA 1Q1VA 2DJNA 4DYQA 2WUIA 5FHPA 5DTDA 2W48A 4B1RA 5J1RA 2XDNA 1DU6A 5J1YA 2NP5A 3WHCA 1T56A 3JRGA 4NDLA 3FRQA 3OSFA 4NELA 3CMYA 2VI6A 4D7NA 1AKHB 3FK6A 3SFIA 3A03A 2XPWA 5F0HA 1OCTC 2EQRA 1MBHA 2ZCNA 1Y1VJ 4M3FA 2RHAA 5FLMJ 3RZDJ 4FCYA 2E19A 4DZPA 3GTPJ 1OCPA 2I10A 5J1UA 4A3IJ 2QKOA 3QBMA 4CGRA 3QPLA 3LSRA 3JRFA 1APLC 3ON4A 2LLKA 3HGGA 2EZHA 2JWTA 4YZEA 2FQ4A 2P81A 1LFBA 2N8GA 1RR7A 5EG0A 1UI6A 4JNNA 3LNQA 3GZIA 4DZJA 2MSYA 5FJ8J 3ZQHA 4B4CA 1K61A 4MXMA 4FISA 4UDSA 4ABZA 1IV6A 5IOZA 1NTCA 3A01B 2Y0SN 1LE8A 2MG4A 3BR2A 2Y9YA 2JK3A 1ZK8A 1BJZA 3BR6A 2H8RA 3FISA 2ECBA 2L7FP 3LHQA 1AHDP 2IAIA 5IOYA 1MBJA 1LE8B 2VUMJ 2ZOZA 3A01A 2KDZA 3E7LA 5F04A 1GUUA 4C2MJ 3OOUA 5IYCJ 3O8HA 5EYRA 1JUPA 3JRBA 1OFCX 2WGBA 3S1RJ 1BA5A 1ZR2A 4JX6A 1JJ8C 5F1JA 2E2IJ 5GP9A 5IP7J 1X2NA 1P7IA 4M3BA 2CQXA 2IBDA 1FTTA 1IRZA 4D7MA 3MVPA 1IDYA 2FX0A 1MBEA 2X9DA 3S1MJ 3S2DJ 2NS8A 1S7EA 4AUXA 5EGOA 1UHSA 3BTCA 4GCLA 3NNRA 2DA7A 1IGNA 5FKMA 2XGEA 4Y52J 4RBOA 1ZR4A 1ETWA 4FE7A 5D19A 2R5ZA 2OI8A 3M4OJ 3JRHA 2QCOA 2AHQA 1FIAA 1MNMC 1I6HJ 1Y1WJ 2EZIA 2R93J 3HOYJ 2WV1A 2K9QA 2X48A 2ZB9A 1PUFA 1UG2A 4A3CJ 3BR5A 2AO9A 2VPRA 5E3LA 3AQTA 3S17J 1JUMA 2QWTA 2GFNA 2R92J 2DG8A 4A3LJ 1ENHA 2LK2A 3QKXA 3T6NA 3BR3A 3TW6A 2NX4A 5CXIA 5F27A 3G7RA 3F0CA 2YVEA 3HM5A 2R5YA 1WH5A 1VF9A 5D1RA 1XG1A 2X6OA 3HIMA 2JMWA 1GDTA 1ZQ3P 3CRJA 3PPBA 4DW6A 1QPIA 1FEXA 3GTKJ 5EF6A 2LP0A 3I4MJ 3GTJJ 2R5ZB 2XGCA 1O4XA 3S14J 2IU5A 3KKDA 2M9HA 4MLOA 1A6IA 1ZGWA 3S1NJ 4HKUA 1H8AC 5F08A 3BQYA 1EF4A 3C2BA 2FD5A 1T33A 2YS9A 1W0TA 2DMUA 3HTHA 5EGOB 3ZOBA 5E3OA 1RPWA 3QPSA 2CUEA 5IYDJ 3PO3J 5GPAA 1W0UA 5HBUA 5HSZA 3HGYA 1JUSA 2EH3A 2EZLA 5M3FJ 4RDUA 3BR1A 3Q3SA 2W53A 1JT0A 4IHVA 2ZCMA 4ACIA 2M2EA 1QVUA 1QRYA 2EZKA 2YUSA 3BG5A 3DCFA 4HNVA 1MH3A 2REKA 3VVZA 2L0KA 2QF7A 1IG7A 3HOUJ 5FGLA 4UUSB 1U8BA 4AYBN 2VKEA 5FKOA 1ETKA 4BBSJ 3BQZA 3VVXA 2OF7A 2JA8J 2GM4A 3VVYA 2G7LA 4W97A 3RD3A 3VUQA 1MBFA 3HTIA 3V78A 2YVHA 2M0CA 4IEJA 2PBXA 3G56A 4FTHA 2HXOA 2TRTA 2KT0A 2WB1N 2ME6A 2JA6J 1HF0A 4JP0A 3B6CA 5M5YJ 2DMPA 3VOKA 3EGQA 4JL3A 5GPCA 4MFDA 2DA1A 3DEWA 1POGA 1B72A 3CCYA
chains in the Genus database with same CATH superfamily
5K5RA 2ETHA 2G7GA 4HQMA 2ZMEC 3R61A 4G7ZF 4MQVA 3H5AA 4DYRA 3MKZA 4A3FJ 1I50J 4HF0A 4MNUA 4A5MA 1R00A 1VZ0A 3K7AJ 3ONQA 4XKWA 3F23A 5E18F 3PNTA 3DFGA 5HS7A 2OQGA 3HDDA 1LPQA 1BN5A 2HKOA 4HV5A 4AC6A 3HC7A 3K4MA 1ZTRA 4EM0B 2X6WA 2VOPA 1TP4A 4JKZA 3H9GA 3HTUA 2ZOYA 1YLFA 2E2JJ 3DLLF 4XRFA 4KA4A 5AONA 5JVTA 2OA4A 3JRIA 3K70C 1MSFC 3HEFA 5GAHJ 2DI3A 1BW6A 2DTRA 2KHMA 2WBMA 1JKOC 3GWZA 2W82A 4MEYF 2OTLI 3VYRB 2RAEA 3BDDA 1PVEA 1XGOA 4A3MJ 1T8IA 4A3BJ 2F48A 3GTOJ 4F3QA 1JTYA 1USTA 3C2HA 3E5UA 3I58A 5FKNA 2G3BA 2JUGA 3HRSA 3G1OA 2QOPA 3K70D 2MGQA 1T08B 5B66C 1UFMA 5EDNA 1SD6A 3GCMA 1UHMA 2K86A 5LHHA 1XGSA 1FTZA 3RYRA 2NS7A 3OYGA 4M3EA 1IUFA 5E79C 1FP1D 2TCTA 2F07A 1A6QA 3H3ZA 4LFUA 1KU3A 2VODA 1BR2A 3KNWA 3HOZJ 4WX9A 2ELHA 3B6AA 5DYMA 2OJED 3VSLA 2KRCA 4OD4A 3AQSA 3CJTB 1C0WA 2Q8KA 4ICHA 3FIWA 4XM3A 2ZC2A 4WK8F 1MD0A 4W1UA 3IV5A 2UXNA 3OS2A 2ZCXA 4XORA 1DUXC 1TWGJ 2DMQA 5IT3A 4Y3OA 3TP0A 4CHUA 2GXBA 2B3WA 3F8NA 1YG2A 4EGYA 2WAEA 3Q0WA 2CFOA 1B4AA 1WI3A 1U8RA 2EJRA 2JZYA 4HSRA 2ZXJA 2L01A 3LSJA 4K2EA 3NPIA 5K7HA 1FP2A 5CKTA 3BNIA 5E3NA 4A6DA 4JX4A 1QQIA 3OIQA 3A0HC 4IO9F 2H6BA 2EFWA 4XLAA 1Z0XA 3DXJF 5D6FA 4CCMA 1F5TA 3K2ZA 2UXOA 3IH2A 5AIPA 2L02A 1MH4A 1Y0UA 2MD5A 3O8GA 3FXLA 3CCSI 2A5WA 2DFEA 2ZKZA 4C30A 4UV8A 1SMTA 2IS1A 1HQCA 1R6RA 3LAJA 2KZVA 3HE0A 1GV2A 4GCTA 1LDKB 2ID3A 4L5EA 3WTWC 2Y9ZA 4MFEA 3FM3A 4XIDA 2KIUA 4YELA 1TC3C 2G9WA 3GUDA 3BJBA 4F91B 2XSJC 2PLYA 3VW0A 1WH7A 3COLA 3ECHA 2RQPA 4BQQA 3HPGA 5KHDA 3OMYA 3B73A 5K5QA 1YYVA 1Z9CA 1DPUA 3MQ0A 2O0YA 4WXCA 5DCMB 1XN7A 3SQNA 1XSXA 4B44A 5LLQA 4BL0B 5BPIA 3J7ZI 4A3JJ 1KU9A 2OV7A 2WA0A 1V5FA 2A07F 1K78A 5L3BA 2QEXI 1B8IA 1TT5B 1E2XA 2YX7A 4Y17A 2F4IA 2LY9A 3K1MA 5H2FC 3EUPA 4RMNA 4C3HJ 5EEAA 4E7LA 1YITI 1SD4A 5EG0B 4YFNF 2DA4A 3L2QA 1FSEA 2DMTA 4PGHA 3RJPA 1UI5A 2HVSA 2LF8A 3WG9A 3EETA 3MMYB 1ETVA 3NARA 2P4WA 5JR3A 5D8LB 1PDNC 5IT9K 1LDDA 4U0WA 2ESHA 2LKXA 1N78A 1WJ5A 1LNWA 1MZBA 2W24A 4ESJA 1FMVA 2ZY9A 2R0QC 3H3VK 2OPTA 3NEUA 3QOEA 2B0LA 3KZIC 3V7SA 3I59A 3A2KA 4BBRJ 4HOBA 1JKRC 2UXHA 1KU2A 4RM2A 2X51A 4A3KJ 1XSDA 5LHIA 4MEXF 1HW1A 2LR8A 2HPMA 3VW1A 4XSXF 3SEZA 3QP6A 5EJCA 2WADA 1PYVA 5BOXA 4Y7NJ 4L62A 5EZGA 4CGZA 5EEGA 1X4PA 1NK2P 5K7ZA 2ISZA 1I3QJ 3VEPA 3EYIA 4BYYA 1T6SA 3IRRA 1X3UA 3F6VA 3T8RA 4BHBA 4LG0B 2M5WA 4B48A 3D5SC 1VTNC 4KDPA 2X1DA 4QSHA 3ANGA 2LTPA 4EM1A 1G3WA 3CP8A 5DEQA 4GFBA 1KQ9A 4XKVA 1HCRA 2QQBA 4BDYA 5BS6A 1TWFJ 2B7EA 3W2AA 3SHFA 3H35A 3KZ9A 4QIWN 3F1BA 4D0PA 5HDGA 3OYMA 2G7SA 2F5CA 3VODA 3CDHA 2Z33A 4FX0A 2DK8A 2XKPA 2DLLA 3QYBA 5ICEA 1D5YA 2O7TA 4ZJZA 1SAUA 2K85A 2HOSA 1U9OA 3KP2A 3DEUA 2X6YA 1EH6A 2PX9A 3S15J 1MJ9A 3W3CA 1ORKA 3DBRB 4HW0A 2E35A 2QLZA 2QVOA 3MEXA 3E5XA 1R49A 4IRVA 2FOWA 1ZGAA 2M8GX 1RUNA 3RPQA 3W6KB 3J81Z 5ILVA 2NNYA 1G2HA 2L9RA 4I7HA 4IRIA 2AQEA 1RKWA 3VW2A 1OPCA 3J7AO 4NBQA 2VASA 3F8CA 2EV0A 3CDLA 4DVYP 4RS8A 1SGMA 2DOFA 4Y4RA 3H92A 3C1DA 1YHQI 3WTTC 3CO6C 2EIJH 1PUEE 2O3FA 1E0EA 3CUQA 5JI6A 2JA7J 4OWRB 1XGNA 2IVMA 1OQYA 3OYJA 1OYYA 5FHPA 1USSA 1YJNI 5J1RA 3VYUB 2HU9A 4GDFA 4HSTA 3H9QA 4NELA 4BJ6C 3BOQA 2V1DA 2RN7A 2ZFWA 4D7NA 2HTJA 1BI1A 3LQQA 3FK6A 3KPHA 3A03A 2XPWA 2VJ4A 5F0HA 1OCTC 1B59A 2EQRA 2MABA 3VOEA 2ZCNA 1Y1VJ 2CQKA 1FYKA 4OIOF 3GXOA 2A6HF 1V5EA 2E19A 3CTAA 4DZPA 2I10A 3LSKA 2UV1A 2KPMA 2WY8Q 3KYLA 1E17A 5TRDA 3LSRA 2VJ5A 3ON4A 3H0DA 3MKWB 2JWTA 3HGGA 1TNTA 3GYHX 4FT8A 1LFBA 4BU2A 1IN5A 2N8GA 4F93B 5EG0A 2QSGX 1B6AA 4ASNA 5FJ8J 5KVRA 2LKSA 2Z9OA 2WAQA 4F7ZA 2HFHA 1YFHA 1LE8A 3PUBA 2MG4A 4CICA 3BR2A 3PQJA 1JE8A 3S32A 3ZGKA 3FISA 3CF2A 2ECBA 3DPLC 2EA4A 2L7FP 4DNCA 3WTSC 5IOYA 1MBJA 1Y8RB 2P5VA 1WFXA 2E7XA 1KYZA 4F52A 2O8XA 4RB1A 3OOUA 5IYCJ 3O8HA 2DPUA 5ICCA 2WGBA 3S1RJ 1NHAA 3AG4H 2A68F 2E2IJ 5IP7J 1X2NA 1REPC 2P6SA 1VQPI 3DTIA 2QKLB 1IRZA 2EFNA 4D7MA 3G2BA 1IDYA 2FX0A 2X9DA 4KT5C 3TL4X 3S2DJ 1B1BA 2XRNA 2YR2A 3R4KA 5GAEJ 5E20A 1QGPA 2CYYA 4XLEA 1I1GA 2LBFA 1OR7C 2DA7A 1YS7A 2XGEA 2FBKA 5LRSA 5D19A 1UJ8A 4AU7A 2XAQA 3S8PA 2AHQA 4GGGA 5CQGA 2Y0MA 1YQAA 2EZIA 1Y1WJ 1OLTA 2K9QA 1UG2A 1DGRM 2LSOA 4M73A 3PIOF 1GHCA 2VPRA 3ERED 1KONA 4C2UA 2L9NA 4ETSA 2QWTA 2DG8A 3KX2A 1ENHA 3O6BB 5FB2A 2KP6A 3T8TA 3QKXA 3OR1C 5CXIA 3CLQA 3CLOA 2DYSH 1XCBA 3HM5A 3AG3H 2R4GA 3FKJA 1VF9A 2M4KA 2D1HA 3CP2A 1ZQ3P 4BE2A 2M7AA 3FXJA 5EF6A 2LREA 3IP4B 5J4YA 1SD7A 2RNJA 3K69A 3FMQA 2XGCA 3J7YJ 1IN7A 2M9HA 1I27A 3SZPA 2BE5F 3DP7A 5B1BH 2KJCA 3KYCB 1YO5C 3IWZA 1QZEA 1ZN2A 3I64A 5EGOB 3N97A 5E3OA 3GLXA 1RPWA 3GLLA 3ZMDA 1ON2A 3E0JB 1X1PA 2H94A 1J5YA 3A0BC 4XQFA 3VTIA 5HSZA 3BC8A 1JUSA 4A2UA 1ZH5A 3BR1A 4BACA 3QYEA 3RKXA 1WJCA 4IHVA 4ACIA 2EK5A 1QVUA 2KRFA 4R1HA 4EJUA 3BG5A 2W00A 3A1YA 4HG2A 2BW3B 2JVHA 2VBXA 3OL4A 3PNVA 4CCNA 3BZKA 2VKEA 2WV0A 4RGRA 1Y56A 1WJBA 3BQZA 1G3SA 1Z7UA 1WJAA 1VQ9I 2H09A 1WSUA 2JA8J 3VVYA 3VUQA 1MBFA 4IOAF 1EV7A 2VB6A 3ULQB 4IEJA 3G56A 2YVHA 3KLOA 1V3FA 4IHTA 2BV6A 3P9KA 2ZJRF 2TRTA 3E6CC 5DCMA 2KT0A 3PSIA 2OAZA 2GXGA 2JA6J 2ZBKA 4HYEA 3RCOA 4L5JA 3DPUA 3M7GA 4YG2F 4GYIA 2KIMA 5DCFA 2IGNA 5CJ9A 3OYLA 4M9SA 1S7AA 2LC2A 3FMRA 1RNLA 2CW8A 4PSWA 2VOOA 5C3EJ 2FMLA 4UNOA 3BCBA 2Y2ZA 1XS9A 3VIBA 1F36A 1B9MA 2FJ1A 2WB1A 4S0HB 2NXNB 4B8XA 2KJBA 2VBYA 4M3GA 2ME0A 4RM3A 1YE9A 2LKPA 2ID6A 3GTMJ 5F6FA 2P8TA 3QQAA 4XN0A 1SFXA 4UVAA 3HOXJ 5AIQA 2E34A 3TKYA 2K4BA 3IH3A 2A05A 4N9IA 2UUZA 2AQFA 5JLXA 1F43A 2PFVA 2XGDA 3K8PC 5J3LA 1KQ0A 4EVIA 4XRSA 1O57A 4XK4A 3VOXA 1QU3A 5D8KB 5D4RA 3BTJA 3HUGA 5DS9A 4MTEA 2FUG2 3VP5A 1N77A 3GFLA 1W7PD 3CESA 3CJNA 4CCKA 4D9JA 2RREA 3R6SA 2CUZA 3DU5A 1I1SA 1OYIA 2QBYA 1EH7A 2NVQJ 3VPRA 1U9NA 2BY2A 2KIFA 2P5LC 2VN2A 4DIQA 1JKPC 3N05A 3CCEI 2WY7Q 2O8KA 3GFMA 1J75A 1U2WA 3X2QH 4A3DJ 2O61A 4I0AA 3HOVJ 5FRNA 3S2HJ 4C3JJ 4RAYA 3QRFF 3F21A 1BIBA 3OS1A 4NHJA 2OTJI 3GZNB 3JRAA 2NVTJ 5ED4A 3HTAA 1F1ZA 4BJTA 2JPCA 3CMEI 3OYDA 1DP7P 2ZJ2A 3AAFA 2YVXA 1S6LA 1OCOH 2DW4A 4P1WA 3SFZA 2LRDA 1Z6RA 2VQCA 1S5LC 3KIOA 1NG7A 4G8XA 1D0YA 2FU4A 4M6YA 3OIOA 3ABMH 2A6EF 3OYCA 4XRSG 4I01A 4A5NA 2CW7A 3HZJA 5L3GA 4U9NA 2JRTA 3CCUI 2Q0OA 3LA7A 4EGZA 2M34A 2KZGA 3C18A 1PUFB 1IXRC 1R71A 4XSZF 1ZARA 2LMDA 5IYBJ 5D18A 4FX4A 1E3HA 3V6GA 1MDMA 2K4JA 2NP3A 3SZGA 1FBSA 4A3EJ 3K9TA 3BJOA 3MKLA 4M9ZA 5J40A 4AC0A 3U9GA 2CUFA 1BM9A 3ZMVA 4LG3A 3LA2A 1K6OA 3S2WA 1ETXA 5H6RA 1FZPB 2XB5A 3F8MA 1V4RA 4LLLA 2EWNA 4YIFA 3M3YJ 3GEUA 4BXFA 2OQRA 2R7DA 1YW8A 1U5TC 2DOEA 3QP5A 3D1NI 1D0ZA 4GYGA 2X85A 2NYXA 4NC8A 2M45A 2Z99A 1R7JA 2Y31A 3DKXA 4ESFA 1O3SA 3UR3C 2OD5A 3Q0VA 5HDNA 4C2MA 1JTXA 4AVZA 5LRRA 3CD6I 5FGMA 3RKQA 3S5RA 3FHNA 1LDJA 2NVXJ 2DA5A 4ON0A 3GTQJ 5LEJA 5K5OA 5ICFA 3O2PE 3GBGA 3E6MA 1EKEA 2HOTA 2JQ7A 3ML6A 2CQ7A 3C3WA 1LFPA 3FK7A 4BY7J 4ZTJA 3CC2I 5FKLA 4HF1A 3J7AY 3SJMA 4P9UA 4XICA 3RQIA 2JPBA 2F6CA 3LL7A 3LSIA 4PJLA 3EUHC 4AIKA 2GENA 1ITYA 2X6XA 3CDIA 2Q24A 5CQEA 3CCJI 3RPUA 5F1RA 2JSPA 3PNYA 2LF7A 3GZ5A 1P6RA 1IN4A 3KP7A 2UXIA 1FBQA 4KMFA 1WWXA 5FLVA 2CV0A 3BP8A 4C9YA 1FOYA 2OERA 2VKVA 1VQ4I 2DDBA 3NQOA 1FOXA 3A02A 3ZCOA 2K9SA 2PJPA 1WPKA 3HBLA 4DJAA 4LG0A 4JX5A 5M5XJ 5CXGA 1P7JA 3U1DA 3OYHA 4HX8A 3CCQI 1HW5A 1P4WA 1SMYF 4HLYA 5TGTA 2KL4A 3JW4A 3E7QA 1FSHA 4OD5A 3ZPLA 1ZREA 2J5OA 4ENJA 1YW9A 2CWEA 1W5CC 3D5RC 4MIMA 5DM7F 2HYTA 1WJFA 2IRFG 4UB8C 5F0CA 2HS5A 2VKDA 2MH2A 3TP3A 4M3DA 1VQ8I 2B63J 1BR4A 3WODF 1R23A 2F2EA 3ZMZA 3NRGA 1HOMA 3RH2A 1TWAJ 4EMSA 5C4YA 2NS0A 4A3GJ 1RI7A 2ZMEA 3I53A 3DU6A 1MMDA 2CSOA 4QTRA 2VT2A 4IHSA 1T2KA 1IJWC 3KP4A 3GX4X 3DQVC 2ZXWH 2CO5A 3OV8A 5CYVA 3V7RA 1W1WE 3DWLE 4KITB 2E1OA 4PJJA 2BXZA 2Y30A 3DF8A 2HOEA 2EFOA 3OWTA 3B81A 2RASA 3OYNA 4ZDPA 4IRHA 4XN3A 3KEYA 2MBFA 5HAWA 3G4SI 4BQNA 2NRAC 5B5EC 4V2FA 1JHFA 4KN4X 4E70A 4AWXB 3TO7A 4RGXA 3K4KA 4AIHA 2CGPA 3WHBA 2HYFA 2QKMB 2NVYJ 3NWSA 4I6ZA 2HXIA 2DMNA 2ADUA 2Z2SB 4LIVA 1CF7A 4PXIA 4MO7A 1V55H 5FROA 3ZN0A 2VXDA 4ZZDA 1H9TA 6PAXA 4O3MA 3GW2A 2W48A 1CGPA 1LVKA 1TQMA 1WRJA 3L9FA 5J1YA 4N4OB 2NP5A 1Z1DA 2H8WA 1ZG5A 2O6GE 2KKOA 1RZ4A 3LSTA 3FF5A 4TV7A 2VJJA 3I54A 4CSWA 3FRQA 3PL8A 2VI6A 2R7SA 1AKHB 3NS4A 2BY0A 3SFIA 2ZO4A 2ZSIB 4ITVA 1MBHA 3DV8A 4IPAA 4HA8A 2A5YB 2BZTA 5H6QA 2L54A 2GOMA 3RDIA 1OCPA 1MGTA 5J1UA 2YX4A 2ZNYA 4A3IJ 2QKOA 3QBMA 5K1YA 4CGRA 4P55A 3QPLA 5HLIA 5HNHA 2IGMA 2LLKA 2QA4I 1STZA 4BH9A 2FQ4A 2K27A 1HSTA 4YZEA 1K4SA 1UI6A 4ENKA 1YOVB 4HX7A 4B4CA 1I39A 3QAHA 4MXMA 2GAUA 3AKZA 1Y0NA 1VQNI 2Y0SN 2BBYA 4KUMA 2BYVE 3HJEA 3EYYA 2Y9YA 1GVJA 1ZK8A 1BJZA 2HDWA 2EV5A 2H8RA 2EILH 1AHDP 3A4CA 3CZ6A 4I98B 4LK1F 4HNTA 4I09A 2W25A 4CZZA 2KDZA 3OOPA 4L9VA 3F9KA 4U9LA 5EYRA 1JUPA 3I0TA 1OFCX 3IUOA 5J8CA 1BA5A 1HC8A 1ZR2A 4JX6A 2ISYA 5F1JA 2VC0A 1UB9A 2BXYA 1G6NA 2H27A 2CQXA 1YS6A 2IBDA 2H1LA 3PFYA 1FTTA 3MVPA 4O5VA 3I4PA 3K1PA 4NB5A 4AUXA 3E5QA 4BGDA 3H5NA 3ESWB 5KK1A 1IGNA 1X4OA 3HOSA 4Y52J 1W4MA 4Y15A 5D4SA 2EFQA 2R5ZA 2OI8A 5FFZA 3JRHA 1TLHB 2PMZA 1BI0A 3OYAA 1E3PA 2X48A 4AIDA 2XKOA 3BR5A 1ERDA 2AO9A 1BI2A 5LFAA 3S17J 2OZ6A 1XGMA 2GFNA 1PP8F 2LK2A 2K3FA 5FD6A 2YSRA 4ANJA 2HR3A 4A0YA 4CUGA 2X4HA 2R5YA 1W7PA 1WH5A 5LEKA 3E6DA 2E36A 1XG1A 2HQNA 2XAFA 3HIMA 1HKQA 3I3LA 3CRJA 3PPBA 3F22A 4DW6A 2XGXA 2MC4A 4GCVA 2OU2A 2P7VB 3RKYA 2DJIA 3WTYC 3AL0B 3MKYB 3BZCA 1HA8A 3BPXA 1FNNA 3KKDA 1HKSA 1YIOA 1XMKA 2HYGD 3T0YA 2L9SA 3ZMUA 1ZGWA 3S1NJ 3TMOA 3SYTA 3HHHA 1SFEA 2AS5F 4HQEA 2HDCA 4CYDA 3SZTA 3L2WA 1BJAA 5FO5A 3M1CA 3EPZA 4U0YA 2FA5A 3HGYA 2EH3A 3L2RA 2P6TA 1NH3A 5E1ZB 2EZLA 5M3FJ 4BXUA 1IXSB 4XLCA 5KAIC 1JT0A 2ZCMA 2QENA 4PGGA 4BE0A 1QRYA 2YUSA 2EZKA 3DCFA 2VBZA 2REKA 1MH3A 1S8NA 1MNDA 2RDPA 1IF1A 4M71A 3M1EA 2AXLA 1K78B 1X3WB 4B43A 5FKOA 1LQ1A 1ZYRF 3VVXA 3PSFA 1O3TA 3CJRB 4ZDOA 2OCCH 4UUVA 3TQNA 3V78A 3S3MA 2PBXA 2PFBA 2VXZA 1ON1A 2OZUA 1SC7A 2HEOA 5DM6F 1XPXA 1GLNA 2ME6A 4WCGA 1KGSA 1P9QC 2MLKA 3EGQA 4JL3A 2L7KA 2DA1A 3DEWA 4MQ9F 1MW7A 1POGA 3KFWX 1B72A 2L4MA 3G6EI 4D5CA 1MMNA 1SFKA 3HB9A 2HQ5A 5GTIC 2D6YA 3CCMI 4UVBA 1Z3YA 3QU3A 1LFUP 3JSJA 1GV5A 2IEKA 3PFIA 3WE2A 3H9JA 3WU2C 3EUHA 4I76A 3ZQQA 1L3LA 1D1AA 4S05A 1ZELA 3L09A 3L1PA 2PJRA 4QPOA 1VFCA 2J5PA 3K2AA 2D5VA 3LMMA 4UVCA 1K83J 3S1QJ 5HDKA 1OR7A 2CW0F 4PFOA 3E97A 4BQAA 1ZHFA 4Z2YA 4ZYAA 1Z77A 2WC2A 2VLAA 3CWRA 4GFLA 2ICWG 2GOXB 1T0FC 4I0BA 4AYBA 3WGIA 4BKXA 2E71A 4CYCB 2V1UA 3IH4A 3L2UA 1LUJB 2VL8A 2HZDA 2NOGA 3BT9A 4GO1A 1EA3A 4I99C 3BRUA 1FY7A 3HXLA 1VQOI 1HDDC 1R4NB 2V9VA 3MFKA 5HODA 1A5JA 1BIAA 3TGNA 3ON2A 2HDDA 2CU7A 4XMYA 2JN6A 1YJ9I 2VKHA 3MD2A 2DDAA 3EDPA 1MSEC 2DOAA 1TTYA 4QWQA 1TT0A 3E3VA 1HDPA 1RKTA 3OYIA 3W6VA 3MWMA 3GTLJ 4JQFA 1VNDA 3CO7C 2GQQA 5B1AH 3FXRA 1Y6IA 2CJJA 4G6TB 3JRDA 3BTIA 4MHGA 4R79A 2ZNZA 1YI2I 3MNLA 4GFKA 2ZJQF 2C6YA 4MK6A 1R22A 1ACIA 1XDUA 3D0SA 4IHYA 2BY3A 3VB2A 3FKIJ 1SANA 2FXAA 2KIQA 5HOOA 4LD5A 2D45A 3V8LA 3ZQGA 4BEHB 5C4XJ 3BWGA 1WHUA 2QGUA 2VQLA 4QLCU 2R7ZJ 2IW5A 1VQ7I 3HOWJ 1LJ9A 4U88A 3V7CA 5CW8A 2ELJA 4KIFA 4JOMA 1D3YA 4GRIA 3OS0A 4RLQA 4P9FA 4AVPA 3P9IA 2DG7A 2XUBA 1FX7A 3BG9A 1OCCH 2STWA 2R5YB 3MAJA 2PN6A 2VONA 3QOPA 5M5WJ 1KA8A 1GVDA 2VIXA 4U7BA 5CVUA 2KQRA 4IHWA 4IX7A 1R4MB 3ZN1A 1JGGA 2FE3A 3KETA 4R8HA 2CRGA 3WGGA 1RRJA 1P92A 2VJIA 2H6CA 4RB0A 4NN1A 3DLAA 5E3MA 3ASOH 4DQ2A 1EH8A 3L2CA 2YU9J 3NI7A 2PMUA 3HYIA 3TDZC 3BPVA 4PFPA 5TISC 3HSEA 4KNYA 2CH0A 3OSGA 1N75A 3MZYA 3VSKA 3E1SA 1SAXA 2BVMA 5FMPA 2LVSA 2DT5A 2G7HA 1IC8A 1XMAA 2Z3YA 2GBYA 2V9PA 4II2A 2JA5J 1BOAA 2L5QA 4UHTA 3LJLA 1LEAA 4LITA 1Z21A 1ETYA 2R7XA 2VE8A 2XDVA 2Y0SA 2HWVA 2FRHA 4LOCA 5LBQA 1ZRCA 1IDZA 4EATA 1A31A 3CJDA 3H1CA 3ZQCA 5EFYA 2HI3A 3IL2A 4UUSA 3NAUA 1XX5A 3O60A 2DO7A 2RQQA 2X0LA 4OMYA 4BHPA 1E3OC 2ZCWA 1HSJA 3PIPF 3ZP5A 1JKQC 4X6AJ 2IS2A 4BS9A 3HUGB 5C44J 3HTJA 1TWCJ 2H1KA 2BHYA 2HVQA 2HYJA 2HTSA 4JYKA 1D8KA 1K6YA 4NC6A 1VQKI 1D8JA 3C2GA 4YIRX 2HPIA 1K79A 2E5NA 1R1VA 1RETA 3RZOJ 3RQ4A 5TJJA 4BAYA 5LD2C 2CFXA 5H9TA 3BR0A 3FBNB 2XROA 4EEFG 4ZZLA 1UMQA 3FXQA 4M72A 4KN7X 5E8GA 3V8JA 4CCJA 2EIKH 5JLWA 1T95A 2XF5A 2BVLA 4ZH4F 4XOPA 2ECCA 3SDGA 2VT3A 2K5CA 3W2VA 3HKZN 3SXYA 4E4HA 3VWBA 1Y8QB 3JCUC 2L7ZA 1OJLA 3ANPA 1AKHA 1DPRA 1VQ5I 4AD9A 4A93J 4FE4A 4B3AA 2LYCA 4XONA 1J2XA 1B72B 2E7WA 4XNFA 3TOBA 3KP6A 2COBA 1XB4A 3ZR8X 4C3IJ 5GTHC 2OCEA 4NQWA 2Y69H 3CUQB 3U21A 3V42A 4BDZA 4Y13A 5E17F 2GUHA 1IXCA 1IRFA 4XLPF 2PG4A 1T39A 2O9LA 3RIRA 2UXUA 1N25A 1OYWA 3M07A 4M6XA 2CG4A 2YPRA 4A12A 3JAMZ 1J7KA 1MBKA 4IHXA 4CO8A 4E6KG 1KU7A 4KISA 2F4MB 3H0GJ 3PASA 2O5RA 4X0GA 1PJRA 2BHZA 4IVNA 2D1VA 1QBJA 2MA3A 1Z91A 4ENNA 2IGKA 3KZYA 3CQZJ 5K58A 2I5UA 5BNGA 1SFUA 1H88C 2PMZN 3IHUA 4CCOA 3TDUC 3HKZA 5K7FA 3V8KA 3S3OA 4LIUA 4RB2C 1QPMA 1YRNB 3PO2J 2V7FA 2X1EA 3AFHA 1BR1A 1X2MA 1YW7A 3R60A 5F0FA 1FIPA 4G12A 1O3QA 4EJOA 4GCKA 4KFCA 4D5FA 1IN8A 2EFPA 5LGNA 1WJEA 3TEDA 4HPQA 2R7QA 3IAS2 2XSDC 2P0WA 3AL0C 3OL3A 4N4NB 3G1MA 2Q1ZB 2QBYB 4G94A 2LFBA 3U1KA 3QWLA 4E7ZA 1WI9A 2DAOA 2QZ8A 3I4NJ 1SVLA 4G7OF 3BTLA 3BJAA 3QPHA 3K6GA 1V5GA 2NOJB 3ERMA 2WWYA 2DYRH 1A35A 1ZG1A 3LFKA 2EB7A 4ME9A 2A69F 1F9NA 3LSGA 1UCRA 1FWZA 1OISA 2AXTC 4FQGA 1ONVA 1R5GA 2FJI1 2PQ8A 2K02A 2W1OA 3GTGJ 2NNNA 2R7UA 2M4GA 3HTSB 3C07A 1QVTA 2D2WA 5HVQC 4UXNA 2DJNA 4DYQA 3WTXC 4B1RA 4IF4A 1LB2A 2KFDA 4RAGA 5CVIA 1T38A 1DU6A 3L7WA 4KIBA 3SEQA 3CCRI 3JRGA 4HRIA 3KCCA 1OCRH 2XC7A 3E6BA 4BUPA 3OSFA 3RSNA 1T0FA 2PBIA 1IW7F 2GIVA 1QHGA 2UZKA 3DKWA 3LAPA 1XSVA 2DU9A 2PI0A 1Q1HA 4FCYA 4PK4A 3ABLH 3AG2H 2M1BA 5BQTA 5JHUA 5A2QZ 4DGWB 1OMIA 1UELB 2BY1A 3EUAA 2EZHA 2NVUB 3H36A 4ZYEA 1IV8A 2VC1A 4E7JA 1RR7A 4JNNA 4IRGA 4ZTFA 4HF2A 3ABTA 2MSYA 1S7OA 3HG9A 5CVRA 1K61A 4I02A 2RNGA 2FBIA 2JRMA 4UDSA 2JA2A 5IOZA 4IZZA 1XCVA 1F4KA 1K7AA 4DBQA 3QODA 1FT9A 2V1XA 4IQ4A 2EV6A 3LHQA 4Q5SF 5CVJA 4IOCF 1J9IA 5DV5A 1FYLA 1X1BA 3IC7A 4IJAA 1GUUA 5F04A 4E7HA 4C2MJ 1X19A 3B02A 4HEA2 3WG7H 1YJWI 1W36D 3W2WA 4LB5A 3ECOA 2XV4S 4BQOA 2B1EA 2EIMH 5GP9A 1Z67A 1P7IA 4M3BA 2Q2EB 1WQ2A 3BZ6A 1W5SA 3QYFA 3JSOA 4L18B 4FETA 3S1MJ 3CUQC 1IN6A 5DD8A 1RR8C 2XAHA 5LGUA 1FLIA 1HKTA 5EGOA 2W85A 2Y48A 2UWMA 3BTCA 3FZVA 3NNRA 5FKMA 2FBHA 4RBOA 1ZR4A 1ETWA 5HLHA 2E1NA 4FE7A 1G3YA 3QU6A 2K3PA 3G71I 3M4OJ 3OYFA 1TL8A 3HOTA 2ZXHA 4H4KC 5GAGJ 1MNMC 3M8FA 1ZRFA 1I6HJ 2NAZA 4WXHA 3HOYJ 2WV1A 1PUFA 1D5VA 2RVCA 4S04A 4LMYA 5JFRA 2R7WA 1FC3A 2BOLA 2HQRA 1YX5A 5E3LA 4Y33A 4ZC3A 4YFXF 1J59A 2XIGA 2HVRA 4M9XA 3SWHA 4P96A 1W7PB 3RI4A 2NX4A 1ZGJA 2X1CA 3W6JB 3G7RA 3K10A 1ZG3A 1P2FA 2JUCA 2F5FA 4PZJA 5FD5A 4EQQA 3GFIA 1O3RA 2X6OA 2LDUA 3COAC 5D1RA 5HS8A 4B47A 1R1TA 3HRUA 1GDTA 1IUYA 1QPIA 3BCAA 3GTKJ 1BC8C 2FNPA 3I4MJ 3GTJJ 4OMZA 1X1AA 2A6TA 2R5ZB 4HDUA 3S14J 2A2FX 2IU5A 2MLGA 3TBIA 4L9TA 3CMMA 1EJ9A 1IZ1A 3M8JA 4G6DA 2R7VA 1ODDA 2MFZA 5F08A 4UV9A 1EF4A 3C2BA 3JSPA 4EJTA 2FD5A 3LSHA 2MYSA 3CC7I 3HTHA 3F6OA 2F5DA 2P5KA 4DOZA 2W7NA 1UAAA 2CUEA 4RA2A 5IYDJ 3I55I 4PJ0C 2O03A 5GPAA 2IT0A 1MJAA 1Z05A 3PO3J 5HBUA 1ZLKA 2W53A 4LK0F 2KRHA 5FLXK 1KYWA 2M2EA 2YU3A 3NWTA 4PJMA 1YX3A 2CS3A 2L0KA 2QF7A 4NC7A 3I5UA 5FGLA 3ELKA 5F64A 4UUSB 1U8BA 3DKYA 4AYBN 2XASA 3OYKA 4BBSJ 3CCVI 3M8EA 3RD3A 3HSFA 4W97A 2LG4A 2LH9A 1R5ID 4C2TA 3F3XA 3CC4I 1IRXA 2W4SA 2CV2A 5HS9A 5LHGA 1GXPA 2HXOA 1P4AA 1O7LA 2DODA 2WB1N 1QNTA 3I71A 2F5EA 5ILUA 4JP0A 5M5YJ 1G59A 2IA0A 2ZSHB 1Z3XA 3IKVA 4MFDA 2CV1A 5BPDA 4G9YA 3K1NA 2CQQA 4CXFA 3NXCA 3MCZA 4DYCA 3G3ZA 2UXPA 3OR2C 1U78A 2PJRB 1R36A 2M87A 1MIJA 4XLNF 1H9GA 2LD5A 5A2QK 5J4VA 3S93A 2L7MP 2PMHA 2LOOA 1X58A 4HLXA 4OINF 3VYTB 4AIJA 1HBXG 2L9VA 4E7SA 1BI3A 4XRMA 4HNUA 4IXAA 1TQPA 3VYSB 4F92B 3JR9A 2P7CB 3H3UA 2HKUA 3GEZA 2QTQA 4IQJA 2R7TA 1MKMA 1ZKGA 4AM3A 1G3TA 1MMAA 3S16J 1JI8A 4PDKA 3MN2A 3JAMK 4Q4ZF 2MW8A 4WXDA 5CPRB 2ZJPF 1RUOA 5IPAA 1B9NA 2IS4A 1NK3P 1XMXA 2IP2A 5D5UB 2K40A 2M3AA 1DGWY 4KT6A 3KP5A 2E2HJ 5DUIA 3LWFA 4V2GA 4J00A 3KP3A 1B8IB 2XAUA 5GADJ 2VQHA 1TNSA 4B3XA 2W84A 1R1UA 3FHZA 3L00A 3IAM2 3Q9SA 4KYWA 3K4JA 2QIBA 3R0AA 1QZZA 5JHFA 3KYDB 3G1LA 4HDVA 2ELKA 1RC9A 2M8EA 2R7FA 4XL9A 2Q2EA 3ZQIA 3ZRGA 3IRQA 1YRNA 4L0YB 2DA6A 3FXMA 1TBXA 4WF2A 4EV0A 1JJ6C 2EBIA 2IS6A 2JJ7A 3PM1A 1FMWA 3RKWA 1WCMJ 2W57A 4RAFA 3ABKH 1NG6A 1R58A 1WGXA 9ANTA 2E5ZA 4OIRF 1HXDA 4N0BA 1ZRDA 3I9V2 2JSCA 3BCGA 5CVVA 5DDGA 3JTGA 2XPUA 3FWEA 4L5IA 1IAWA 2GWRA 5FRMA 4XKCA 1QO0D 1CQTA 3REOA 2V79A 3DPJA 3BG7A 2GA2A 3BG3A 5AQCA 3OY9A 4BHCA 1XC5A 2CUJA 3F8BA 3WU1B 3HL2A 3FDYA 2VQGA 3VDXA 2FMYA 2PZ9A 4U7DA 3FBIB 1D1BA 2V6EA 2R7OA 4E7IA 2K9NA 2TDXA 4XLHA 1RIOH 3CJQB 4G7HF 1D0XA 1SFOJ 2DA2A 2Z5UA 3F8FA 3PQKA 4CDGA 3ZQLA 5J8FA 5EZHA 3L2VA 3TOAA 2M30A 1ETOA 2XPVA 3FM5A 2LBFB 3N4MA 2VPLA 1FOKA 2JT1A 2G0EA 3PJRA 5LGTA 3JRCA 2QYOA 4YFKF 2XVCA 4KJZA 3R0JA 2E1MC 3T5XA 2QSHX 4CZCA 1AWCA 2EA2A 3HIFA 3Q9VA 4PCQA 2XF7A 2M7BA 4M6VA 1A04A 5CLSA 3TW7A 1KQ8A 1BBYA 1FPQA 2ACJA 4FHTA 5C4JJ 1OCZH 2R7RA 5DD4A 1S29A 3ZMSA 5HLTA 2PEXA 3ZQFA 1DU0A 3JREA 2GXAA 2M0MA 3IWFA 5L3DA 2QSFX 2WAQN 4QPQA 4ZDLA 2RC4A 2CQNA 5BMZA 3WTZA 2UXXA 3MZHA 5IT9Z 2XAGA 4KWAA 1S3JA 1U0JA 1UZCA 2HOAA 1TWHJ 3CCLI 2EINH 4L9JA 2RGVA 1BW5A 5E1WA 1AOYA 2K9LA 3QPTA 2XB0X 2DTZA 3GF2A 4JBAA 3SDBA 1H89C 2GIZA 4A69C 2MC3A 2STTA 1LEBA 2XHKA 4Z6YA 3DBLB 3ASNH 3DEEA 3GMEA 1VQMI 1TW2A 1W5TA 1FYMA 3OYEA 4KMUX 1IRGA 2QQAA 3DTKA 1LVAA 3IUVA 5KNLA 3HHGA 4J19A 1QHHD 1WVRA 2DN0A 4OU0A 1AU7A 2CMPA 1K4TA 4IL6C 2OC6A 3LOCA 3GFJA 4RAZA 3P9TA 1MBGA 3H5RA 4Q47A 5IP6A 2ESNA 2K9MA 1UHWA 1DDNA 4F55A 1GXQA 1TW3A 2DCEA 3WTUC 4BXXJ 2DFFA 2F4OB 4YIIA 2WAFA 4NQWB 1U5TB 1ETQA 2JTVA 4RGUA 2EPFA 2L2OA 1TQIA 1PP7U 2FBQA 2LY2A 4XKBA 4J01A 2L4AA 4NUBA 3ABUA 3CUOA 3LQRA 3BHQA 2GLOA 4A6EA 2O7OA 4KIGA 1Z7LA 1L0OC 1ZAOA 3LFUA 2FSWA 1R5HA 2KLOA 2HNHA 4N9HA 5L3EA 2V9KA 2V57A 3IKTA 2XRLA 3CF5F 4XR6A 5J47A 3FX3A 4A0XA 4X1EA 2LNBA 4AF5A 5J6XA 4A0ZA 1VI0A 5L3CA 1R9TJ 4OOIA 4G6QA 2JVGA 2DBBA 2R3SA 1KZHA 4BJ5C 1HW2A 2ZOZA 3TO6A 4ENMA 1G8XA 1JT6A 4CH7A 1SVMA 5IP9J 2COMA 4II3A 4ZYHA 3EUKL 2WTEA 4YRVA 4P5OA 2ZMEB 2MH9A 3WGHA 2G7UA 1G4DA 2DT6A 3J80K 1GT0C 2E1CA 1YTYA 3UKGA 1QZYA 2QWWA 5DAJA 2VBWA 1HLVA 5FFXA 3JTHA 5M3MJ 3DPTA 3BROA 2FF4A 1I6XA 1RESA 3K0LA 1MNEA 4WWCA 3KEQA 2XF6A 3WU0A 4HX4A 3LWJA 3FMSA 2L3DA 4NNJA 5HNFA 1BL0A 1FJLA 4DBRA 5D5WB 4CYCA 1XDSA 5FKKA 4ZYDA 2KMUA 4BY1J 1J0RA 1DQUA 3HRTA 4FASD 4BE1A 3LSPA 3KKCA 3F72A 4UUTA 2DA3A 3Q0UA 3OIPA 4CCLA 1Q1VA 2DQLA 2DQRA 4RB3C 1YIJI 2WUIA 2V4JC 2RV8A 1X1DA 5DTDA 3GZ6A 1U5TA 3P5JA 2Y75A 2XDNA 1ULYA 3BJ6A 4RGSA 4LGWA 3U2RA 1T56A 3WHCA 3WE3A 4OIPF 2Z1DA 2ZXIA 4NDLA 2OBPA 3CMYA 1Z6TA 3DBHB 3I59B 2LY1A 1MDMB 1U6GA 4CA0A 3G73A 2GA1A 2RHAA 1JXSA 1M1EB 3HRMA 3J80Z 2HZTA 4M3FA 3HSRA 4PSXA 2HQAA 2BGCA 3MZ8A 4XOTA 5FLMJ 5FLXZ 4H0EA 3PUFA 3RZDJ 3CMAI 1WZ2A 3GTPJ 2VE9A 1S72I 4HZFA 2MD0A 4HV6A 3EQLF 4I2OA 1CF7B 5D5VB 3ZXSA 1APLC 3JRFA 4Q48A 2P81A 3P9CA 4OAZA 3LNQA 1BOBA 3GZIA 3O3KA 4DZJA 3ZQHA 3ISPA 4FISA 4ABZA 3K4LA 1IV6A 1NTCA 3A01B 2FNAA 1O7FA 3UNGC 2JK3A 1SVOA 3BR6A 1LKXA 4RLFA 2QQ8A 2IAIA 2BW3A 4LLNA 2FEZA 3RYPA 1WJDA 3ZQ7A 1LE8B 3TO9A 2IA1A 4BEHA 3A01A 1VQ6I 5ILSA 2VUMJ 1FBUA 3E7LA 2V6CA 2A61A 3ROUA 1Y39A 1SD5A 5HLGA 3FXUA 3BY6A 3JRBA 2ZFUA 4EJWA 5L3FA 4JK1X 2FQ3A 3KLNA 2DFHA 1JJ8C 2A3SA 2DPDA 2DT7B 2QQ9A 1AA7A 2IPQX 4UB6C 4PJNA 3DTEA 2HKXA 2E1MB 3AG1H 3FXOA 5E1XA 1MBEA 3J81K 4U0VA 3OYBA 2FOKA 2IJLA 1S7EA 2NS8A 1UHSA 2OUMA 5ERIA 3T1BA 1H0MA 4GCLA 1JHHA 1MMSA 5D6EA 1JGSA 2QCOA 1FIAA 1P4XA 3P7NA 4HBLA 5DUKA 3HPHA 3K4BA 1DP3A 2R93J 4U87A 2ZB9A 3RPUD 4A3CJ 4BNCA 3KZZA 1OKRA 2B9SA 3K4CA 4O6JA 1A36A 3KEOA 3AQTA 2DXIA 4LJZF 1JUMA 2R92J 4L9NA 4A3LJ 2BEOA 3C7JA 4IKFA 1WKMA 3GVAA 1D1CA 3T6NA 3BR3A 3TW6A 4KICA 5B3SH 5F27A 2XAJA 5H20A 4YEJA 4ESBA 3F0CA 2YVEA 5KAFC 2RKHA 2QM3A 3S3NA 2KDOA 4OAYA 2V26A 2JMWA 4MGRA 4XBFA 2IGOA 1FEXA 1MJBA 3GO5A 4WIBA 4PUSA 4UY8I 1IO2A 2LP0A 1SEUA 1X3ZB 1S9HA 5D5XB 3RTRA 4B09A 4EM2A 1O4XA 1ZLJA 1X1CA 5E8IA 4MLOA 1A6IA 2IXSA 4HKUA 1H8AC 2DK5A 3BQYA 3V4GA 3ZMTA 3Q5FA 1I3AA 4GXOA 1T33A 2YS9A 1W0TA 1J09A 2DMUA 3ZOBA 1TZLA 2K7LA 3QPSA 4V19K 3NRVA 4OIQF 1U3EM 1XTAA 1W0UA 1MMGA 1UG0A 4XLFA 3D5LA 1I5ZA 3BG6A 2HGCA 5EEHA 4ZYGA 2E60A 3Q3SA 4RDUA 3M9AA 4E7KA 1XD7A 2KISA 4MTDA 4HNVA 1QA6A 4L0ZB 4EJVA 3VVZA 1W36C 2Z16A 3FXKA 4LB6B 5IY5H 1IG7A 3HOUJ 3K4NA 3LSMA 5KCMA 2I8DA 2GZWA 1T98A 2F5VA 3LA3A 1ETKA 4M74A 2OF7A 2GM4A 2G7LA 2V1NA 1V54H 2QUFA 4HAMA 4LLGF 3I56I 3HTIA 2M0CA 4FTHA 3BLYA 2DFIA 1FOWA 5JVGF 1VQLI 3VFZA 3KE2A 1HF0A 3B6CA 3VOKA 2DMPA 5ICGA 5GPCA 1BC7C 2IA2A 4D1QA 3CCYA 3WTVC
chains in the Genus database with same CATH topology
2CQQA 4D5CA 3NXCA 2G7GA 4DYCA 3HB9A 2UXPA 2HQ5A 2D6YA 1U78A 1LFUP 4DYRA 5C3EJ 4A3FJ 3JSJA 1GV5A 2IEKA 1I50J 2LD5A 2Y2ZA 4I76A 3K7AJ 1XS9A 2L7MP 3VIBA 3L1PA 1F36A 1X58A 3HDDA 4AC6A 2FJ1A 1VFCA 2D5VA 3K2AA 4S0HB 4XRMA 3S1QJ 1K83J 1ZTRA 4M3GA 2ME0A 2ID6A 3GTMJ 4JKZA 3QQAA 3JR9A 2ZOYA 1Z77A 3HOXJ 2HKUA 2E2JJ 2QTQA 4GFLA 3CWRA 1ZKGA 3IH3A 3S16J 3JRIA 1MSFC 5JLXA 1F43A 2XGDA 3MN2A 5J3LA 3HEFA 4BKXA 4XRSA 4CYCB 1BW6A 3IH4A 4XK4A 3VOXA 2NOGA 3BT9A 3BTJA 5DS9A 1JKOC 2MW8A 3BRUA 5IPAA 1NK3P 1HDDC 3VP5A 5HODA 2K40A 2RAEA 1A5JA 4A3MJ 3ON2A 4A3BJ 2E2HJ 2HDDA 2CU7A 3GTOJ 2JN6A 4V2GA 1JTYA 5FKNA 1B8IB 1MSEC 2G3BA 3G1OA 2QOPA 2MGQA 1HDPA 1RKTA 3W6VA 5EDNA 2NVQJ 3GTLJ 2QIBA 1VNDA 1FTZA 3VPRA 3G1LA 2NS7A 4M3EA 1IUFA 2CJJA 3JRDA 2ELKA 1U9NA 3ZQIA 2TCTA 3BTIA 1YRNA 2F07A 3MNLA 4GFKA 2DA6A 4MK6A 1JJ6C 2EBIA 1JKPC 4IHYA 2JJ7A 3KNWA 2O8KA 3PM1A 1WCMJ 3HOZJ 4A3DJ 3FKIJ 3B6AA 1SANA 1WGXA 9ANTA 3HOVJ 3AQSA 3S2HJ 3ZQGA 4ICHA 4C3JJ 5C4XJ 3FIWA 4W1UA 3IV5A 3BCGA 2ZCXA 2R7ZJ 2XPUA 3HOWJ 3JRAA 2NVTJ 3HTAA 1TWGJ 2DMQA 3TP0A 5CW8A 1CQTA 3Q0WA 2DG7A 3DPJA 1WI3A 3BG9A 3LSJA 3NPIA 2R5YB 3BG3A 5K7HA 3BNIA 5AQCA 5E3NA 5M5WJ 3OIOA 1XC5A 1GVDA 4JX4A 4IHWA 4XRSG 1JGGA 1Z0XA 2PZ9A 2UXOA 2M34A 3IH2A 2CRGA 1MH4A 3O8GA 2K9NA 1PUFB 4NN1A 5IYBJ 5E3MA 5D18A 1SFOJ 3HE0A 2DA2A 3ZQLA 1GV2A 2YU9J 5EZHA 3NI7A 3V6GA 4GCTA 2NP3A 1ETOA 2ID3A 2XPVA 4L5EA 4A3EJ 2Y9ZA 3MKLA 4MFEA 4AC0A 4XIDA 1TC3C 3BJBA 2CUFA 3OSGA 2G0EA 1ETXA 3JRCA 2XB5A 3VW0A 1WH7A 5FMPA 2LVSA 3M3YJ 3COLA 3GEUA 1IC8A 2GBYA 2JA5J 3LJLA 4M6VA 3TW7A 3D1NI 5C4JJ 1ETYA 2Y31A 3ZQFA 1DU0A 3JREA 4A3JJ 4LOCA 2WAQN 1IDZA 3CJDA 5EFYA 3ZQCA 2HI3A 3Q0VA 4UUSA 1B8IA 3NAUA 3O60A 1JTXA 4KWAA 2LY9A 3EUPA 2HOAA 4C3HJ 3RKQA 1TWHJ 3S5RA 5EEAA 1E3OC 2NVXJ 1BW5A 2DA5A 1JKQC 4X6AJ 5C44J 3GTQJ 3HTJA 1TWCJ 2H1KA 2XB0X 2DTZA 3GBGA 5EG0B 2HYJA 2DA4A 4JYKA 1H89C 2HOTA 4A69C 2DMTA 3FK7A 4BY7J 1UI5A 1RETA 3RZOJ 5FKLA 3SJMA 5H9TA 3NARA 1ETVA 4XICA 3BR0A 3RQIA 2GENA 4EEFG 2LKXA 1ITYA 1UMQA 2Q24A 3IUVA 5JLWA 4J19A 1AU7A 2DN0A 2R0QC 3H3VK 2OPTA 2ECCA 3SDGA 3HKZN 2UXIA 3LOCA 5FLVA 4BBRJ 1JKRC 2OERA 2L7ZA 2UXHA 3P9TA 1OJLA 1MBGA 2VKVA 4A3KJ 1AKHA 3ANPA 5IP6A 2LR8A 4A93J 3VW1A 3A02A 4FE4A 2K9SA 4B3AA 1WPKA 3HBLA 4BXXJ 4Y7NJ 4L62A 5EZGA 1B72B 4JX5A 5M5XJ 1ETQA 1NK2P 5K7ZA 5CXGA 2COBA 1P7JA 2FBQA 1I3QJ 4C3IJ 3BHQA 2GLOA 2O7OA 3E7QA 2GUHA 4QSHA 2O9LA 3ANGA 2UXUA 2LTPA 2V57A 2XRLA 1MBKA 4MIMA 4IHXA 2HYTA 4GFBA 1HCRA 4X1EA 3H0GJ 4AF5A 5F0CA 3PASA 1TWFJ 3TP3A 1VI0A 4M3DA 1R9TJ 2B63J 3KZ9A 4QIWN 3F1BA 3NRGA 3CQZJ 5K58A 1HOMA 5BNGA 2G7SA 1JT6A 1TWAJ 1H88C 2PMZN 5C4YA 5K7FA 4A3GJ 3RH2A 5IP9J 4QTRA 1YRNB 3PO2J 2O7TA 1X2MA 1D5YA 4GCKA 5F0FA 1FIPA 4G12A 1IJWC 2HOSA 4D5FA 1U9OA 3TEDA 3S15J 2XSDC 1GT0C 2E1OA 3UKGA 1ORKA 2Y30A 3G1MA 5DAJA 1HLVA 5M3MJ 2M8GX 3B81A 2LFBA 2RASA 1G2HA 2L9RA 3I4NJ 1RKWA 1RESA 3BTLA 3VW2A 5HAWA 4V2FA 3LWJA 3CDLA 4ME9A 3LSGA 1SGMA 1BL0A 3WHBA 1FJLA 4CYCA 5FKKA 2NVYJ 4I6ZA 4BY1J 2HXIA 2DMNA 3LSPA 3KKCA 4PXIA 2JA7J 3GTGJ 4MO7A 4UUTA 2DA3A 3Q0UA 3C07A 1QVTA 1Q1VA 2DJNA 4DYQA 2WUIA 5FHPA 5DTDA 2W48A 4B1RA 5J1RA 2XDNA 1DU6A 5J1YA 2NP5A 3WHCA 1T56A 3JRGA 4NDLA 3FRQA 3OSFA 4NELA 3CMYA 2VI6A 4D7NA 1AKHB 3FK6A 3SFIA 3A03A 2XPWA 5F0HA 1OCTC 2EQRA 1MBHA 2ZCNA 1Y1VJ 4M3FA 2RHAA 5FLMJ 3RZDJ 4FCYA 2E19A 4DZPA 3GTPJ 1OCPA 2I10A 5J1UA 4A3IJ 2QKOA 3QBMA 4CGRA 3QPLA 3LSRA 3JRFA 1APLC 3ON4A 2LLKA 3HGGA 2EZHA 2JWTA 4YZEA 2FQ4A 2P81A 1LFBA 2N8GA 1RR7A 5EG0A 1UI6A 4JNNA 3LNQA 3GZIA 4DZJA 2MSYA 5FJ8J 3ZQHA 4B4CA 1K61A 4MXMA 4FISA 4UDSA 4ABZA 1IV6A 5IOZA 1NTCA 3A01B 2Y0SN 1LE8A 2MG4A 3BR2A 2Y9YA 2JK3A 1ZK8A 1BJZA 3BR6A 2H8RA 3FISA 2ECBA 2L7FP 3LHQA 1AHDP 2IAIA 5IOYA 1MBJA 1LE8B 2VUMJ 2ZOZA 3A01A 2KDZA 3E7LA 5F04A 1GUUA 4C2MJ 3OOUA 5IYCJ 3O8HA 5EYRA 1JUPA 3JRBA 1OFCX 2WGBA 3S1RJ 1BA5A 1ZR2A 4JX6A 1JJ8C 5F1JA 2E2IJ 5GP9A 5IP7J 1X2NA 1P7IA 4M3BA 2CQXA 2IBDA 1FTTA 1IRZA 4D7MA 3MVPA 1IDYA 2FX0A 1MBEA 2X9DA 3S1MJ 3S2DJ 2NS8A 1S7EA 4AUXA 5EGOA 1UHSA 3BTCA 4GCLA 3NNRA 2DA7A 1IGNA 5FKMA 2XGEA 4Y52J 4RBOA 1ZR4A 1ETWA 4FE7A 5D19A 2R5ZA 2OI8A 3M4OJ 3JRHA 2QCOA 2AHQA 1FIAA 1MNMC 1I6HJ 1Y1WJ 2EZIA 2R93J 3HOYJ 2WV1A 2K9QA 2X48A 2ZB9A 1PUFA 1UG2A 4A3CJ 3BR5A 2AO9A 2VPRA 5E3LA 3AQTA 3S17J 1JUMA 2QWTA 2GFNA 2R92J 2DG8A 4A3LJ 1ENHA 2LK2A 3QKXA 3T6NA 3BR3A 3TW6A 2NX4A 5CXIA 5F27A 3G7RA 3F0CA 2YVEA 3HM5A 2R5YA 1WH5A 1VF9A 5D1RA 1XG1A 2X6OA 3HIMA 2JMWA 1GDTA 1ZQ3P 3CRJA 3PPBA 4DW6A 1QPIA 1FEXA 3GTKJ 5EF6A 2LP0A 3I4MJ 3GTJJ 2R5ZB 2XGCA 1O4XA 3S14J 2IU5A 3KKDA 2M9HA 4MLOA 1A6IA 1ZGWA 3S1NJ 4HKUA 1H8AC 5F08A 3BQYA 1EF4A 3C2BA 2FD5A 1T33A 2YS9A 1W0TA 2DMUA 3HTHA 5EGOB 3ZOBA 5E3OA 1RPWA 3QPSA 2CUEA 5IYDJ 3PO3J 5GPAA 1W0UA 5HBUA 5HSZA 3HGYA 1JUSA 2EH3A 2EZLA 5M3FJ 4RDUA 3BR1A 3Q3SA 2W53A 1JT0A 4IHVA 2ZCMA 4ACIA 2M2EA 1QVUA 1QRYA 2EZKA 2YUSA 3BG5A 3DCFA 4HNVA 1MH3A 2REKA 3VVZA 2L0KA 2QF7A 1IG7A 3HOUJ 5FGLA 4UUSB 1U8BA 4AYBN 2VKEA 5FKOA 1ETKA 4BBSJ 3BQZA 3VVXA 2OF7A 2JA8J 2GM4A 3VVYA 2G7LA 4W97A 3RD3A 3VUQA 1MBFA 3HTIA 3V78A 2YVHA 2M0CA 4IEJA 2PBXA 3G56A 4FTHA 2HXOA 2TRTA 2KT0A 2WB1N 2ME6A 2JA6J 1HF0A 4JP0A 3B6CA 5M5YJ 2DMPA 3VOKA 3EGQA 4JL3A 5GPCA 4MFDA 2DA1A 3DEWA 1POGA 1B72A 3CCYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CQQ A;  4D5C A;  3NXC A;  2G7G A;  4DYC A;  3HB9 A;  2UXP A;  2HQ5 A;  2D6Y A;  1U78 A;  1LFU P;  4DYR A;  5C3E J;  4A3F J;  3JSJ A;  1GV5 A;  2IEK A;  1I50 J;  2LD5 A;  2Y2Z A;  4I76 A;  3K7A J;  1XS9 A;  2L7M P;  3VIB A;  3L1P A;  1F36 A;  1X58 A;  3HDD A;  4AC6 A;  2FJ1 A;  1VFC A;  2D5V A;  3K2A A;  4S0H B;  4XRM A;  3S1Q J;  1K83 J;  1ZTR A;  4M3G A;  2ME0 A;  2ID6 A;  3GTM J;  4JKZ A;  3QQA A;  3JR9 A;  2ZOY A;  1Z77 A;  3HOX J;  2HKU A;  2E2J J;  2QTQ A;  4GFL A;  3CWR A;  1ZKG A;  3IH3 A;  3S16 J;  3JRI A;  1MSF C;  5JLX A;  1F43 A;  2XGD A;  3MN2 A;  5J3L A;  3HEF A;  4BKX A;  4XRS A;  4CYC B;  1BW6 A;  3IH4 A;  4XK4 A;  3VOX A;  2NOG A;  3BT9 A;  3BTJ A;  5DS9 A;  1JKO C;  2MW8 A;  3BRU A;  5IPA A;  1NK3 P;  1HDD C;  3VP5 A;  5HOD A;  2K40 A;  2RAE A;  1A5J A;  4A3M J;  3ON2 A;  4A3B J;  2E2H J;  2HDD A;  2CU7 A;  3GTO J;  2JN6 A;  4V2G A;  1JTY A;  5FKN A;  1B8I B;  1MSE C;  2G3B A;  3G1O A;  2QOP A;  2MGQ A;  1HDP A;  1RKT A;  3W6V A;  5EDN A;  2NVQ J;  3GTL J;  2QIB A;  1VND A;  1FTZ A;  3VPR A;  3G1L A;  2NS7 A;  4M3E A;  1IUF A;  2CJJ A;  3JRD A;  2ELK A;  1U9N A;  3ZQI A;  2TCT A;  3BTI A;  1YRN A;  2F07 A;  3MNL A;  4GFK A;  2DA6 A;  4MK6 A;  1JJ6 C;  2EBI A;  1JKP C;  4IHY A;  2JJ7 A;  3KNW A;  2O8K A;  3PM1 A;  1WCM J;  3HOZ J;  4A3D J;  3FKI J;  3B6A A;  1SAN A;  1WGX A;  9ANT A;  3HOV J;  3AQS A;  3S2H J;  3ZQG A;  4ICH A;  4C3J J;  5C4X J;  3FIW A;  4W1U A;  3IV5 A;  3BCG A;  2ZCX A;  2R7Z J;  2XPU A;  3HOW J;  3JRA A;  2NVT J;  3HTA A;  1TWG J;  2DMQ A;  3TP0 A;  5CW8 A;  1CQT A;  3Q0W A;  2DG7 A;  3DPJ A;  1WI3 A;  3BG9 A;  3LSJ A;  3NPI A;  2R5Y B;  3BG3 A;  5K7H A;  3BNI A;  5AQC A;  5E3N A;  5M5W J;  3OIO A;  1XC5 A;  1GVD A;  4JX4 A;  4IHW A;  4XRS G;  1JGG A;  1Z0X A;  2PZ9 A;  2UXO A;  2M34 A;  3IH2 A;  2CRG A;  1MH4 A;  3O8G A;  2K9N A;  1PUF B;  4NN1 A;  5IYB J;  5E3M A;  5D18 A;  1SFO J;  3HE0 A;  2DA2 A;  3ZQL A;  1GV2 A;  2YU9 J;  5EZH A;  3NI7 A;  3V6G A;  4GCT A;  2NP3 A;  1ETO A;  2ID3 A;  2XPV A;  4L5E A;  4A3E J;  2Y9Z A;  3MKL A;  4MFE A;  4AC0 A;  4XID A;  1TC3 C;  3BJB A;  2CUF A;  3OSG A;  2G0E A;  1ETX A;  3JRC A;  2XB5 A;  3VW0 A;  1WH7 A;  5FMP A;  2LVS A;  3M3Y J;  3COL A;  3GEU A;  1IC8 A;  2GBY A;  2JA5 J;  3LJL A;  4M6V A;  3TW7 A;  3D1N I;  5C4J J;  1ETY A;  2Y31 A;  3ZQF A;  1DU0 A;  3JRE A;  4A3J J;  4LOC A;  2WAQ N;  1IDZ A;  3CJD A;  5EFY A;  3ZQC A;  2HI3 A;  3Q0V A;  4UUS A;  1B8I A;  3NAU A;  3O60 A;  1JTX A;  4KWA A;  2LY9 A;  3EUP A;  2HOA A;  4C3H J;  3RKQ A;  1TWH J;  3S5R A;  5EEA A;  1E3O C;  2NVX J;  1BW5 A;  2DA5 A;  1JKQ C;  4X6A J;  5C44 J;  3GTQ J;  3HTJ A;  1TWC J;  2H1K A;  2XB0 X;  2DTZ A;  3GBG A;  5EG0 B;  2HYJ A;  2DA4 A;  4JYK A;  1H89 C;  2HOT A;  4A69 C;  2DMT A;  3FK7 A;  4BY7 J;  1UI5 A;  1RET A;  3RZO J;  5FKL A;  3SJM A;  5H9T A;  3NAR A;  1ETV A;  4XIC A;  3BR0 A;  3RQI A;  2GEN A;  4EEF G;  2LKX A;  1ITY A;  1UMQ A;  2Q24 A;  3IUV A;  5JLW A;  4J19 A;  1AU7 A;  2DN0 A;  2R0Q C;  3H3V K;  2OPT A;  2ECC A;  3SDG A;  3HKZ N;  2UXI A;  3LOC A;  5FLV A;  4BBR J;  1JKR C;  2OER A;  2L7Z A;  2UXH A;  3P9T A;  1OJL A;  1MBG A;  2VKV A;  4A3K J;  1AKH A;  3ANP A;  5IP6 A;  2LR8 A;  4A93 J;  3VW1 A;  3A02 A;  4FE4 A;  2K9S A;  4B3A A;  1WPK A;  3HBL A;  4BXX J;  4Y7N J;  4L62 A;  5EZG A;  1B72 B;  4JX5 A;  5M5X J;  1ETQ A;  1NK2 P;  5K7Z A;  5CXG A;  2COB A;  1P7J A;  2FBQ A;  1I3Q J;  4C3I J;  3BHQ A;  2GLO A;  2O7O A;  3E7Q A;  2GUH A;  4QSH A;  2O9L A;  3ANG A;  2UXU A;  2LTP A;  2V57 A;  2XRL A;  1MBK A;  4MIM A;  4IHX A;  2HYT A;  4GFB A;  1HCR A;  4X1E A;  3H0G J;  4AF5 A;  5F0C A;  3PAS A;  1TWF J;  3TP3 A;  1VI0 A;  4M3D A;  1R9T J;  2B63 J;  3KZ9 A;  4QIW N;  3F1B A;  3NRG A;  3CQZ J;  5K58 A;  1HOM A;  5BNG A;  2G7S A;  1JT6 A;  1TWA J;  1H88 C;  2PMZ N;  5C4Y A;  5K7F A;  4A3G J;  3RH2 A;  5IP9 J;  4QTR A;  1YRN B;  3PO2 J;  2O7T A;  1X2M A;  1D5Y A;  4GCK A;  5F0F A;  1FIP A;  4G12 A;  1IJW C;  2HOS A;  4D5F A;  1U9O A;  3TED A;  3S15 J;  2XSD C;  1GT0 C;  2E1O A;  3UKG A;  1ORK A;  2Y30 A;  3G1M A;  5DAJ A;  1HLV A;  5M3M J;  2M8G X;  3B81 A;  2LFB A;  2RAS A;  1G2H A;  2L9R A;  3I4N J;  1RKW A;  1RES A;  3BTL A;  3VW2 A;  5HAW A;  4V2F A;  3LWJ A;  3CDL A;  4ME9 A;  3LSG A;  1SGM A;  1BL0 A;  3WHB A;  1FJL A;  4CYC A;  5FKK A;  2NVY J;  4I6Z A;  4BY1 J;  2HXI A;  2DMN A;  3LSP A;  3KKC A;  4PXI A;  2JA7 J;  3GTG J;  4MO7 A;  4UUT A;  2DA3 A;  3Q0U A;  3C07 A;  1QVT A;  1Q1V A;  2DJN A;  4DYQ A;  2WUI A;  5FHP A;  5DTD A;  2W48 A;  4B1R A;  5J1R A;  2XDN A;  1DU6 A;  5J1Y A;  2NP5 A;  3WHC A;  1T56 A;  3JRG A;  4NDL A;  3FRQ A;  3OSF A;  4NEL A;  3CMY A;  2VI6 A;  4D7N A;  1AKH B;  3FK6 A;  3SFI A;  3A03 A;  2XPW A;  5F0H A;  1OCT C;  2EQR A;  1MBH A;  2ZCN A;  1Y1V J;  4M3F A;  2RHA A;  5FLM J;  3RZD J;  4FCY A;  2E19 A;  4DZP A;  3GTP J;  1OCP A;  2I10 A;  5J1U A;  4A3I J;  2QKO A;  3QBM A;  4CGR A;  3QPL A;  3LSR A;  3JRF A;  1APL C;  3ON4 A;  2LLK A;  3HGG A;  2EZH A;  2JWT A;  4YZE A;  2FQ4 A;  2P81 A;  1LFB A;  2N8G A;  1RR7 A;  5EG0 A;  1UI6 A;  4JNN A;  3LNQ A;  3GZI A;  4DZJ A;  2MSY A;  5FJ8 J;  3ZQH A;  4B4C A;  1K61 A;  4MXM A;  4FIS A;  4UDS A;  4ABZ A;  1IV6 A;  5IOZ A;  1NTC A;  3A01 B;  2Y0S N;  1LE8 A;  2MG4 A;  3BR2 A;  2Y9Y A;  2JK3 A;  1ZK8 A;  1BJZ A;  3BR6 A;  2H8R A;  3FIS A;  2ECB A;  2L7F P;  3LHQ A;  1AHD P;  2IAI A;  5IOY A;  1MBJ A;  1LE8 B;  2VUM J;  2ZOZ A;  3A01 A;  2KDZ A;  3E7L A;  5F04 A;  1GUU A;  4C2M J;  3OOU A;  5IYC J;  3O8H A;  5EYR A;  1JUP A;  3JRB A;  1OFC X;  2WGB A;  3S1R J;  1BA5 A;  1ZR2 A;  4JX6 A;  1JJ8 C;  5F1J A;  2E2I J;  5GP9 A;  5IP7 J;  1X2N A;  1P7I A;  4M3B A;  2CQX A;  2IBD A;  1FTT A;  1IRZ A;  4D7M A;  3MVP A;  1IDY A;  2FX0 A;  1MBE A;  2X9D A;  3S1M J;  3S2D J;  2NS8 A;  1S7E A;  4AUX A;  5EGO A;  1UHS A;  3BTC A;  4GCL A;  3NNR A;  2DA7 A;  1IGN A;  5FKM A;  2XGE A;  4Y52 J;  4RBO A;  1ZR4 A;  1ETW A;  4FE7 A;  5D19 A;  2R5Z A;  2OI8 A;  3M4O J;  3JRH A;  2QCO A;  2AHQ A;  1FIA A;  1MNM C;  1I6H J;  1Y1W J;  2EZI A;  2R93 J;  3HOY J;  2WV1 A;  2K9Q A;  2X48 A;  2ZB9 A;  1PUF A;  1UG2 A;  4A3C J;  3BR5 A;  2AO9 A;  2VPR A;  5E3L A;  3AQT A;  3S17 J;  1JUM A;  2QWT A;  2GFN A;  2R92 J;  2DG8 A;  4A3L J;  1ENH A;  2LK2 A;  3QKX A;  3T6N A;  3BR3 A;  3TW6 A;  2NX4 A;  5CXI A;  5F27 A;  3G7R A;  3F0C A;  2YVE A;  3HM5 A;  2R5Y A;  1WH5 A;  1VF9 A;  5D1R A;  1XG1 A;  2X6O A;  3HIM A;  2JMW A;  1GDT A;  1ZQ3 P;  3CRJ A;  3PPB A;  4DW6 A;  1QPI A;  1FEX A;  3GTK J;  5EF6 A;  2LP0 A;  3I4M J;  3GTJ J;  2R5Z B;  2XGC A;  1O4X A;  3S14 J;  2IU5 A;  3KKD A;  2M9H A;  4MLO A;  1A6I A;  1ZGW A;  3S1N J;  4HKU A;  1H8A C;  5F08 A;  3BQY A;  1EF4 A;  3C2B A;  2FD5 A;  1T33 A;  2YS9 A;  1W0T A;  2DMU A;  3HTH A;  5EGO B;  3ZOB A;  5E3O A;  1RPW A;  3QPS A;  2CUE A;  5IYD J;  3PO3 J;  5GPA A;  1W0U A;  5HBU A;  5HSZ A;  3HGY A;  1JUS A;  2EH3 A;  2EZL A;  5M3F J;  4RDU A;  3BR1 A;  3Q3S A;  2W53 A;  1JT0 A;  4IHV A;  2ZCM A;  4ACI A;  2M2E A;  1QVU A;  1QRY A;  2EZK A;  2YUS A;  3BG5 A;  3DCF A;  4HNV A;  1MH3 A;  2REK A;  3VVZ A;  2L0K A;  2QF7 A;  1IG7 A;  3HOU J;  5FGL A;  4UUS B;  1U8B A;  4AYB N;  2VKE A;  5FKO A;  1ETK A;  4BBS J;  3BQZ A;  3VVX A;  2OF7 A;  2JA8 J;  2GM4 A;  3VVY A;  2G7L A;  4W97 A;  3RD3 A;  3VUQ A;  1MBF A;  3HTI A;  3V78 A;  2YVH A;  2M0C A;  4IEJ A;  2PBX A;  3G56 A;  4FTH A;  2HXO A;  2TRT A;  2KT0 A;  2WB1 N;  2ME6 A;  2JA6 J;  1HF0 A;  4JP0 A;  3B6C A;  5M5Y J;  2DMP A;  3VOK A;  3EGQ A;  4JL3 A;  5GPC A;  4MFD A;  2DA1 A;  3DEW A;  1POG A;  1B72 A;  3CCY A; 
#chains in the Genus database with same CATH topology
 5K5R A;  2ETH A;  2G7G A;  4HQM A;  2ZME C;  3R61 A;  4G7Z F;  4MQV A;  3H5A A;  4DYR A;  3MKZ A;  4A3F J;  1I50 J;  4HF0 A;  4MNU A;  4A5M A;  1R00 A;  1VZ0 A;  3K7A J;  3ONQ A;  4XKW A;  3F23 A;  5E18 F;  3PNT A;  3DFG A;  5HS7 A;  2OQG A;  3HDD A;  1LPQ A;  1BN5 A;  2HKO A;  4HV5 A;  4AC6 A;  3HC7 A;  3K4M A;  1ZTR A;  4EM0 B;  2X6W A;  2VOP A;  1TP4 A;  4JKZ A;  3H9G A;  3HTU A;  2ZOY A;  1YLF A;  2E2J J;  3DLL F;  4XRF A;  4KA4 A;  5AON A;  5JVT A;  2OA4 A;  3JRI A;  3K70 C;  1MSF C;  3HEF A;  5GAH J;  2DI3 A;  1BW6 A;  2DTR A;  2KHM A;  2WBM A;  1JKO C;  3GWZ A;  2W82 A;  4MEY F;  2OTL I;  3VYR B;  2RAE A;  3BDD A;  1PVE A;  1XGO A;  4A3M J;  1T8I A;  4A3B J;  2F48 A;  3GTO J;  4F3Q A;  1JTY A;  1UST A;  3C2H A;  3E5U A;  3I58 A;  5FKN A;  2G3B A;  2JUG A;  3HRS A;  3G1O A;  2QOP A;  3K70 D;  2MGQ A;  1T08 B;  5B66 C;  1UFM A;  5EDN A;  1SD6 A;  3GCM A;  1UHM A;  2K86 A;  5LHH A;  1XGS A;  1FTZ A;  3RYR A;  2NS7 A;  3OYG A;  4M3E A;  1IUF A;  5E79 C;  1FP1 D;  2TCT A;  2F07 A;  1A6Q A;  3H3Z A;  4LFU A;  1KU3 A;  2VOD A;  1BR2 A;  3KNW A;  3HOZ J;  4WX9 A;  2ELH A;  3B6A A;  5DYM A;  2OJE D;  3VSL A;  2KRC A;  4OD4 A;  3AQS A;  3CJT B;  1C0W A;  2Q8K A;  4ICH A;  3FIW A;  4XM3 A;  2ZC2 A;  4WK8 F;  1MD0 A;  4W1U A;  3IV5 A;  2UXN A;  3OS2 A;  2ZCX A;  4XOR A;  1DUX C;  1TWG J;  2DMQ A;  5IT3 A;  4Y3O A;  3TP0 A;  4CHU A;  2GXB A;  2B3W A;  3F8N A;  1YG2 A;  4EGY A;  2WAE A;  3Q0W A;  2CFO A;  1B4A A;  1WI3 A;  1U8R A;  2EJR A;  2JZY A;  4HSR A;  2ZXJ A;  2L01 A;  3LSJ A;  4K2E A;  3NPI A;  5K7H A;  1FP2 A;  5CKT A;  3BNI A;  5E3N A;  4A6D A;  4JX4 A;  1QQI A;  3OIQ A;  3A0H C;  4IO9 F;  2H6B A;  2EFW A;  4XLA A;  1Z0X A;  3DXJ F;  5D6F A;  4CCM A;  1F5T A;  3K2Z A;  2UXO A;  3IH2 A;  5AIP A;  2L02 A;  1MH4 A;  1Y0U A;  2MD5 A;  3O8G A;  3FXL A;  3CCS I;  2A5W A;  2DFE A;  2ZKZ A;  4C30 A;  4UV8 A;  1SMT A;  2IS1 A;  1HQC A;  1R6R A;  3LAJ A;  2KZV A;  3HE0 A;  1GV2 A;  4GCT A;  1LDK B;  2ID3 A;  4L5E A;  3WTW C;  2Y9Z A;  4MFE A;  3FM3 A;  4XID A;  2KIU A;  4YEL A;  1TC3 C;  2G9W A;  3GUD A;  3BJB A;  4F91 B;  2XSJ C;  2PLY A;  3VW0 A;  1WH7 A;  3COL A;  3ECH A;  2RQP A;  4BQQ A;  3HPG A;  5KHD A;  3OMY A;  3B73 A;  5K5Q A;  1YYV A;  1Z9C A;  1DPU A;  3MQ0 A;  2O0Y A;  4WXC A;  5DCM B;  1XN7 A;  3SQN A;  1XSX A;  4B44 A;  5LLQ A;  4BL0 B;  5BPI A;  3J7Z I;  4A3J J;  1KU9 A;  2OV7 A;  2WA0 A;  1V5F A;  2A07 F;  1K78 A;  5L3B A;  2QEX I;  1B8I A;  1TT5 B;  1E2X A;  2YX7 A;  4Y17 A;  2F4I A;  2LY9 A;  3K1M A;  5H2F C;  3EUP A;  4RMN A;  4C3H J;  5EEA A;  4E7L A;  1YIT I;  1SD4 A;  5EG0 B;  4YFN F;  2DA4 A;  3L2Q A;  1FSE A;  2DMT A;  4PGH A;  3RJP A;  1UI5 A;  2HVS A;  2LF8 A;  3WG9 A;  3EET A;  3MMY B;  1ETV A;  3NAR A;  2P4W A;  5JR3 A;  5D8L B;  1PDN C;  5IT9 K;  1LDD A;  4U0W A;  2ESH A;  2LKX A;  1N78 A;  1WJ5 A;  1LNW A;  1MZB A;  2W24 A;  4ESJ A;  1FMV A;  2ZY9 A;  2R0Q C;  3H3V K;  2OPT A;  3NEU A;  3QOE A;  2B0L A;  3KZI C;  3V7S A;  3I59 A;  3A2K A;  4BBR J;  4HOB A;  1JKR C;  2UXH A;  1KU2 A;  4RM2 A;  2X51 A;  4A3K J;  1XSD A;  5LHI A;  4MEX F;  1HW1 A;  2LR8 A;  2HPM A;  3VW1 A;  4XSX F;  3SEZ A;  3QP6 A;  5EJC A;  2WAD A;  1PYV A;  5BOX A;  4Y7N J;  4L62 A;  5EZG A;  4CGZ A;  5EEG A;  1X4P A;  1NK2 P;  5K7Z A;  2ISZ A;  1I3Q J;  3VEP A;  3EYI A;  4BYY A;  1T6S A;  3IRR A;  1X3U A;  3F6V A;  3T8R A;  4BHB A;  4LG0 B;  2M5W A;  4B48 A;  3D5S C;  1VTN C;  4KDP A;  2X1D A;  4QSH A;  3ANG A;  2LTP A;  4EM1 A;  1G3W A;  3CP8 A;  5DEQ A;  4GFB A;  1KQ9 A;  4XKV A;  1HCR A;  2QQB A;  4BDY A;  5BS6 A;  1TWF J;  2B7E A;  3W2A A;  3SHF A;  3H35 A;  3KZ9 A;  4QIW N;  3F1B A;  4D0P A;  5HDG A;  3OYM A;  2G7S A;  2F5C A;  3VOD A;  3CDH A;  2Z33 A;  4FX0 A;  2DK8 A;  2XKP A;  2DLL A;  3QYB A;  5ICE A;  1D5Y A;  2O7T A;  4ZJZ A;  1SAU A;  2K85 A;  2HOS A;  1U9O A;  3KP2 A;  3DEU A;  2X6Y A;  1EH6 A;  2PX9 A;  3S15 J;  1MJ9 A;  3W3C A;  1ORK A;  3DBR B;  4HW0 A;  2E35 A;  2QLZ A;  2QVO A;  3MEX A;  3E5X A;  1R49 A;  4IRV A;  2FOW A;  1ZGA A;  2M8G X;  1RUN A;  3RPQ A;  3W6K B;  3J81 Z;  5ILV A;  2NNY A;  1G2H A;  2L9R A;  4I7H A;  4IRI A;  2AQE A;  1RKW A;  3VW2 A;  1OPC A;  3J7A O;  4NBQ A;  2VAS A;  3F8C A;  2EV0 A;  3CDL A;  4DVY P;  4RS8 A;  1SGM A;  2DOF A;  4Y4R A;  3H92 A;  3C1D A;  1YHQ I;  3WTT C;  3CO6 C;  2EIJ H;  1PUE E;  2O3F A;  1E0E A;  3CUQ A;  5JI6 A;  2JA7 J;  4OWR B;  1XGN A;  2IVM A;  1OQY A;  3OYJ A;  1OYY A;  5FHP A;  1USS A;  1YJN I;  5J1R A;  3VYU B;  2HU9 A;  4GDF A;  4HST A;  3H9Q A;  4NEL A;  4BJ6 C;  3BOQ A;  2V1D A;  2RN7 A;  2ZFW A;  4D7N A;  2HTJ A;  1BI1 A;  3LQQ A;  3FK6 A;  3KPH A;  3A03 A;  2XPW A;  2VJ4 A;  5F0H A;  1OCT C;  1B59 A;  2EQR A;  2MAB A;  3VOE A;  2ZCN A;  1Y1V J;  2CQK A;  1FYK A;  4OIO F;  3GXO A;  2A6H F;  1V5E A;  2E19 A;  3CTA A;  4DZP A;  2I10 A;  3LSK A;  2UV1 A;  2KPM A;  2WY8 Q;  3KYL A;  1E17 A;  5TRD A;  3LSR A;  2VJ5 A;  3ON4 A;  3H0D A;  3MKW B;  2JWT A;  3HGG A;  1TNT A;  3GYH X;  4FT8 A;  1LFB A;  4BU2 A;  1IN5 A;  2N8G A;  4F93 B;  5EG0 A;  2QSG X;  1B6A A;  4ASN A;  5FJ8 J;  5KVR A;  2LKS A;  2Z9O A;  2WAQ A;  4F7Z A;  2HFH A;  1YFH A;  1LE8 A;  3PUB A;  2MG4 A;  4CIC A;  3BR2 A;  3PQJ A;  1JE8 A;  3S32 A;  3ZGK A;  3FIS A;  3CF2 A;  2ECB A;  3DPL C;  2EA4 A;  2L7F P;  4DNC A;  3WTS C;  5IOY A;  1MBJ A;  1Y8R B;  2P5V A;  1WFX A;  2E7X A;  1KYZ A;  4F52 A;  2O8X A;  4RB1 A;  3OOU A;  5IYC J;  3O8H A;  2DPU A;  5ICC A;  2WGB A;  3S1R J;  1NHA A;  3AG4 H;  2A68 F;  2E2I J;  5IP7 J;  1X2N A;  1REP C;  2P6S A;  1VQP I;  3DTI A;  2QKL B;  1IRZ A;  2EFN A;  4D7M A;  3G2B A;  1IDY A;  2FX0 A;  2X9D A;  4KT5 C;  3TL4 X;  3S2D J;  1B1B A;  2XRN A;  2YR2 A;  3R4K A;  5GAE J;  5E20 A;  1QGP A;  2CYY A;  4XLE A;  1I1G A;  2LBF A;  1OR7 C;  2DA7 A;  1YS7 A;  2XGE A;  2FBK A;  5LRS A;  5D19 A;  1UJ8 A;  4AU7 A;  2XAQ A;  3S8P A;  2AHQ A;  4GGG A;  5CQG A;  2Y0M A;  1YQA A;  2EZI A;  1Y1W J;  1OLT A;  2K9Q A;  1UG2 A;  1DGR M;  2LSO A;  4M73 A;  3PIO F;  1GHC A;  2VPR A;  3ERE D;  1KON A;  4C2U A;  2L9N A;  4ETS A;  2QWT A;  2DG8 A;  3KX2 A;  1ENH A;  3O6B B;  5FB2 A;  2KP6 A;  3T8T A;  3QKX A;  3OR1 C;  5CXI A;  3CLQ A;  3CLO A;  2DYS H;  1XCB A;  3HM5 A;  3AG3 H;  2R4G A;  3FKJ A;  1VF9 A;  2M4K A;  2D1H A;  3CP2 A;  1ZQ3 P;  4BE2 A;  2M7A A;  3FXJ A;  5EF6 A;  2LRE A;  3IP4 B;  5J4Y A;  1SD7 A;  2RNJ A;  3K69 A;  3FMQ A;  2XGC A;  3J7Y J;  1IN7 A;  2M9H A;  1I27 A;  3SZP A;  2BE5 F;  3DP7 A;  5B1B H;  2KJC A;  3KYC B;  1YO5 C;  3IWZ A;  1QZE A;  1ZN2 A;  3I64 A;  5EGO B;  3N97 A;  5E3O A;  3GLX A;  1RPW A;  3GLL A;  3ZMD A;  1ON2 A;  3E0J B;  1X1P A;  2H94 A;  1J5Y A;  3A0B C;  4XQF A;  3VTI A;  5HSZ A;  3BC8 A;  1JUS A;  4A2U A;  1ZH5 A;  3BR1 A;  4BAC A;  3QYE A;  3RKX A;  1WJC A;  4IHV A;  4ACI A;  2EK5 A;  1QVU A;  2KRF A;  4R1H A;  4EJU A;  3BG5 A;  2W00 A;  3A1Y A;  4HG2 A;  2BW3 B;  2JVH A;  2VBX A;  3OL4 A;  3PNV A;  4CCN A;  3BZK A;  2VKE A;  2WV0 A;  4RGR A;  1Y56 A;  1WJB A;  3BQZ A;  1G3S A;  1Z7U A;  1WJA A;  1VQ9 I;  2H09 A;  1WSU A;  2JA8 J;  3VVY A;  3VUQ A;  1MBF A;  4IOA F;  1EV7 A;  2VB6 A;  3ULQ B;  4IEJ A;  3G56 A;  2YVH A;  3KLO A;  1V3F A;  4IHT A;  2BV6 A;  3P9K A;  2ZJR F;  2TRT A;  3E6C C;  5DCM A;  2KT0 A;  3PSI A;  2OAZ A;  2GXG A;  2JA6 J;  2ZBK A;  4HYE A;  3RCO A;  4L5J A;  3DPU A;  3M7G A;  4YG2 F;  4GYI A;  2KIM A;  5DCF A;  2IGN A;  5CJ9 A;  3OYL A;  4M9S A;  1S7A A;  2LC2 A;  3FMR A;  1RNL A;  2CW8 A;  4PSW A;  2VOO A;  5C3E J;  2FML A;  4UNO A;  3BCB A;  2Y2Z A;  1XS9 A;  3VIB A;  1F36 A;  1B9M A;  2FJ1 A;  2WB1 A;  4S0H B;  2NXN B;  4B8X A;  2KJB A;  2VBY A;  4M3G A;  2ME0 A;  4RM3 A;  1YE9 A;  2LKP A;  2ID6 A;  3GTM J;  5F6F A;  2P8T A;  3QQA A;  4XN0 A;  1SFX A;  4UVA A;  3HOX J;  5AIQ A;  2E34 A;  3TKY A;  2K4B A;  3IH3 A;  2A05 A;  4N9I A;  2UUZ A;  2AQF A;  5JLX A;  1F43 A;  2PFV A;  2XGD A;  3K8P C;  5J3L A;  1KQ0 A;  4EVI A;  4XRS A;  1O57 A;  4XK4 A;  3VOX A;  1QU3 A;  5D8K B;  5D4R A;  3BTJ A;  3HUG A;  5DS9 A;  4MTE A;  2FUG 2;  3VP5 A;  1N77 A;  3GFL A;  1W7P D;  3CES A;  3CJN A;  4CCK A;  4D9J A;  2RRE A;  3R6S A;  2CUZ A;  3DU5 A;  1I1S A;  1OYI A;  2QBY A;  1EH7 A;  2NVQ J;  3VPR A;  1U9N A;  2BY2 A;  2KIF A;  2P5L C;  2VN2 A;  4DIQ A;  1JKP C;  3N05 A;  3CCE I;  2WY7 Q;  2O8K A;  3GFM A;  1J75 A;  1U2W A;  3X2Q H;  4A3D J;  2O61 A;  4I0A A;  3HOV J;  5FRN A;  3S2H J;  4C3J J;  4RAY A;  3QRF F;  3F21 A;  1BIB A;  3OS1 A;  4NHJ A;  2OTJ I;  3GZN B;  3JRA A;  2NVT J;  5ED4 A;  3HTA A;  1F1Z A;  4BJT A;  2JPC A;  3CME I;  3OYD A;  1DP7 P;  2ZJ2 A;  3AAF A;  2YVX A;  1S6L A;  1OCO H;  2DW4 A;  4P1W A;  3SFZ A;  2LRD A;  1Z6R A;  2VQC A;  1S5L C;  3KIO A;  1NG7 A;  4G8X A;  1D0Y A;  2FU4 A;  4M6Y A;  3OIO A;  3ABM H;  2A6E F;  3OYC A;  4XRS G;  4I01 A;  4A5N A;  2CW7 A;  3HZJ A;  5L3G A;  4U9N A;  2JRT A;  3CCU I;  2Q0O A;  3LA7 A;  4EGZ A;  2M34 A;  2KZG A;  3C18 A;  1PUF B;  1IXR C;  1R71 A;  4XSZ F;  1ZAR A;  2LMD A;  5IYB J;  5D18 A;  4FX4 A;  1E3H A;  3V6G A;  1MDM A;  2K4J A;  2NP3 A;  3SZG A;  1FBS A;  4A3E J;  3K9T A;  3BJO A;  3MKL A;  4M9Z A;  5J40 A;  4AC0 A;  3U9G A;  2CUF A;  1BM9 A;  3ZMV A;  4LG3 A;  3LA2 A;  1K6O A;  3S2W A;  1ETX A;  5H6R A;  1FZP B;  2XB5 A;  3F8M A;  1V4R A;  4LLL A;  2EWN A;  4YIF A;  3M3Y J;  3GEU A;  4BXF A;  2OQR A;  2R7D A;  1YW8 A;  1U5T C;  2DOE A;  3QP5 A;  3D1N I;  1D0Z A;  4GYG A;  2X85 A;  2NYX A;  4NC8 A;  2M45 A;  2Z99 A;  1R7J A;  2Y31 A;  3DKX A;  4ESF A;  1O3S A;  3UR3 C;  2OD5 A;  3Q0V A;  5HDN A;  4C2M A;  1JTX A;  4AVZ A;  5LRR A;  3CD6 I;  5FGM A;  3RKQ A;  3S5R A;  3FHN A;  1LDJ A;  2NVX J;  2DA5 A;  4ON0 A;  3GTQ J;  5LEJ A;  5K5O A;  5ICF A;  3O2P E;  3GBG A;  3E6M A;  1EKE A;  2HOT A;  2JQ7 A;  3ML6 A;  2CQ7 A;  3C3W A;  1LFP A;  3FK7 A;  4BY7 J;  4ZTJ A;  3CC2 I;  5FKL A;  4HF1 A;  3J7A Y;  3SJM A;  4P9U A;  4XIC A;  3RQI A;  2JPB A;  2F6C A;  3LL7 A;  3LSI A;  4PJL A;  3EUH C;  4AIK A;  2GEN A;  1ITY A;  2X6X A;  3CDI A;  2Q24 A;  5CQE A;  3CCJ I;  3RPU A;  5F1R A;  2JSP A;  3PNY A;  2LF7 A;  3GZ5 A;  1P6R A;  1IN4 A;  3KP7 A;  2UXI A;  1FBQ A;  4KMF A;  1WWX A;  5FLV A;  2CV0 A;  3BP8 A;  4C9Y A;  1FOY A;  2OER A;  2VKV A;  1VQ4 I;  2DDB A;  3NQO A;  1FOX A;  3A02 A;  3ZCO A;  2K9S A;  2PJP A;  1WPK A;  3HBL A;  4DJA A;  4LG0 A;  4JX5 A;  5M5X J;  5CXG A;  1P7J A;  3U1D A;  3OYH A;  4HX8 A;  3CCQ I;  1HW5 A;  1P4W A;  1SMY F;  4HLY A;  5TGT A;  2KL4 A;  3JW4 A;  3E7Q A;  1FSH A;  4OD5 A;  3ZPL A;  1ZRE A;  2J5O A;  4ENJ A;  1YW9 A;  2CWE A;  1W5C C;  3D5R C;  4MIM A;  5DM7 F;  2HYT A;  1WJF A;  2IRF G;  4UB8 C;  5F0C A;  2HS5 A;  2VKD A;  2MH2 A;  3TP3 A;  4M3D A;  1VQ8 I;  2B63 J;  1BR4 A;  3WOD F;  1R23 A;  2F2E A;  3ZMZ A;  3NRG A;  1HOM A;  3RH2 A;  1TWA J;  4EMS A;  5C4Y A;  2NS0 A;  4A3G J;  1RI7 A;  2ZME A;  3I53 A;  3DU6 A;  1MMD A;  2CSO A;  4QTR A;  2VT2 A;  4IHS A;  1T2K A;  1IJW C;  3KP4 A;  3GX4 X;  3DQV C;  2ZXW H;  2CO5 A;  3OV8 A;  5CYV A;  3V7R A;  1W1W E;  3DWL E;  4KIT B;  2E1O A;  4PJJ A;  2BXZ A;  2Y30 A;  3DF8 A;  2HOE A;  2EFO A;  3OWT A;  3B81 A;  2RAS A;  3OYN A;  4ZDP A;  4IRH A;  4XN3 A;  3KEY A;  2MBF A;  5HAW A;  3G4S I;  4BQN A;  2NRA C;  5B5E C;  4V2F A;  1JHF A;  4KN4 X;  4E70 A;  4AWX B;  3TO7 A;  4RGX A;  3K4K A;  4AIH A;  2CGP A;  3WHB A;  2HYF A;  2QKM B;  2NVY J;  3NWS A;  4I6Z A;  2HXI A;  2DMN A;  2ADU A;  2Z2S B;  4LIV A;  1CF7 A;  4PXI A;  4MO7 A;  1V55 H;  5FRO A;  3ZN0 A;  2VXD A;  4ZZD A;  1H9T A;  6PAX A;  4O3M A;  3GW2 A;  2W48 A;  1CGP A;  1LVK A;  1TQM A;  1WRJ A;  3L9F A;  5J1Y A;  4N4O B;  2NP5 A;  1Z1D A;  2H8W A;  1ZG5 A;  2O6G E;  2KKO A;  1RZ4 A;  3LST A;  3FF5 A;  4TV7 A;  2VJJ A;  3I54 A;  4CSW A;  3FRQ A;  3PL8 A;  2VI6 A;  2R7S A;  1AKH B;  3NS4 A;  2BY0 A;  3SFI A;  2ZO4 A;  2ZSI B;  4ITV A;  1MBH A;  3DV8 A;  4IPA A;  4HA8 A;  2A5Y B;  2BZT A;  5H6Q A;  2L54 A;  2GOM A;  3RDI A;  1OCP A;  1MGT A;  5J1U A;  2YX4 A;  2ZNY A;  4A3I J;  2QKO A;  3QBM A;  5K1Y A;  4CGR A;  4P55 A;  3QPL A;  5HLI A;  5HNH A;  2IGM A;  2LLK A;  2QA4 I;  1STZ A;  4BH9 A;  2FQ4 A;  2K27 A;  1HST A;  4YZE A;  1K4S A;  1UI6 A;  4ENK A;  1YOV B;  4HX7 A;  4B4C A;  1I39 A;  3QAH A;  4MXM A;  2GAU A;  3AKZ A;  1Y0N A;  1VQN I;  2Y0S N;  2BBY A;  4KUM A;  2BYV E;  3HJE A;  3EYY A;  2Y9Y A;  1GVJ A;  1ZK8 A;  1BJZ A;  2HDW A;  2EV5 A;  2H8R A;  2EIL H;  1AHD P;  3A4C A;  3CZ6 A;  4I98 B;  4LK1 F;  4HNT A;  4I09 A;  2W25 A;  4CZZ A;  2KDZ A;  3OOP A;  4L9V A;  3F9K A;  4U9L A;  5EYR A;  1JUP A;  3I0T A;  1OFC X;  3IUO A;  5J8C A;  1BA5 A;  1HC8 A;  1ZR2 A;  4JX6 A;  2ISY A;  5F1J A;  2VC0 A;  1UB9 A;  2BXY A;  1G6N A;  2H27 A;  2CQX A;  1YS6 A;  2IBD A;  2H1L A;  3PFY A;  1FTT A;  3MVP A;  4O5V A;  3I4P A;  3K1P A;  4NB5 A;  4AUX A;  3E5Q A;  4BGD A;  3H5N A;  3ESW B;  5KK1 A;  1IGN A;  1X4O A;  3HOS A;  4Y52 J;  1W4M A;  4Y15 A;  5D4S A;  2EFQ A;  2R5Z A;  2OI8 A;  5FFZ A;  3JRH A;  1TLH B;  2PMZ A;  1BI0 A;  3OYA A;  1E3P A;  2X48 A;  4AID A;  2XKO A;  3BR5 A;  1ERD A;  2AO9 A;  1BI2 A;  5LFA A;  3S17 J;  2OZ6 A;  1XGM A;  2GFN A;  1PP8 F;  2LK2 A;  2K3F A;  5FD6 A;  2YSR A;  4ANJ A;  2HR3 A;  4A0Y A;  4CUG A;  2X4H A;  2R5Y A;  1W7P A;  1WH5 A;  5LEK A;  3E6D A;  2E36 A;  1XG1 A;  2HQN A;  2XAF A;  3HIM A;  1HKQ A;  3I3L A;  3CRJ A;  3PPB A;  3F22 A;  4DW6 A;  2XGX A;  2MC4 A;  4GCV A;  2OU2 A;  2P7V B;  3RKY A;  2DJI A;  3WTY C;  3AL0 B;  3MKY B;  3BZC A;  1HA8 A;  3BPX A;  1FNN A;  3KKD A;  1HKS A;  1YIO A;  1XMK A;  2HYG D;  3T0Y A;  2L9S A;  3ZMU A;  1ZGW A;  3S1N J;  3TMO A;  3SYT A;  3HHH A;  1SFE A;  2AS5 F;  4HQE A;  2HDC A;  4CYD A;  3SZT A;  3L2W A;  1BJA A;  5FO5 A;  3M1C A;  3EPZ A;  4U0Y A;  2FA5 A;  3HGY A;  2EH3 A;  3L2R A;  2P6T A;  1NH3 A;  5E1Z B;  2EZL A;  5M3F J;  4BXU A;  1IXS B;  4XLC A;  5KAI C;  1JT0 A;  2ZCM A;  2QEN A;  4PGG A;  4BE0 A;  1QRY A;  2YUS A;  2EZK A;  3DCF A;  2VBZ A;  2REK A;  1MH3 A;  1S8N A;  1MND A;  2RDP A;  1IF1 A;  4M71 A;  3M1E A;  2AXL A;  1K78 B;  1X3W B;  4B43 A;  5FKO A;  1LQ1 A;  1ZYR F;  3VVX A;  3PSF A;  1O3T A;  3CJR B;  4ZDO A;  2OCC H;  4UUV A;  3TQN A;  3V78 A;  3S3M A;  2PBX A;  2PFB A;  2VXZ A;  1ON1 A;  2OZU A;  1SC7 A;  2HEO A;  5DM6 F;  1XPX A;  1GLN A;  2ME6 A;  4WCG A;  1KGS A;  1P9Q C;  2MLK A;  3EGQ A;  4JL3 A;  2L7K A;  2DA1 A;  3DEW A;  4MQ9 F;  1MW7 A;  1POG A;  3KFW X;  1B72 A;  2L4M A;  3G6E I;  4D5C A;  1MMN A;  1SFK A;  3HB9 A;  2HQ5 A;  5GTI C;  2D6Y A;  3CCM I;  4UVB A;  1Z3Y A;  3QU3 A;  1LFU P;  3JSJ A;  1GV5 A;  2IEK A;  3PFI A;  3WE2 A;  3H9J A;  3WU2 C;  3EUH A;  4I76 A;  3ZQQ A;  1L3L A;  1D1A A;  4S05 A;  1ZEL A;  3L09 A;  3L1P A;  2PJR A;  4QPO A;  1VFC A;  2J5P A;  3K2A A;  2D5V A;  3LMM A;  4UVC A;  1K83 J;  3S1Q J;  5HDK A;  1OR7 A;  2CW0 F;  4PFO A;  3E97 A;  4BQA A;  1ZHF A;  4Z2Y A;  4ZYA A;  1Z77 A;  2WC2 A;  2VLA A;  3CWR A;  4GFL A;  2ICW G;  2GOX B;  1T0F C;  4I0B A;  4AYB A;  3WGI A;  4BKX A;  2E71 A;  4CYC B;  2V1U A;  3IH4 A;  3L2U A;  1LUJ B;  2VL8 A;  2HZD A;  2NOG A;  3BT9 A;  4GO1 A;  1EA3 A;  4I99 C;  3BRU A;  1FY7 A;  3HXL A;  1VQO I;  1HDD C;  1R4N B;  2V9V A;  3MFK A;  5HOD A;  1A5J A;  1BIA A;  3TGN A;  3ON2 A;  2HDD A;  2CU7 A;  4XMY A;  2JN6 A;  1YJ9 I;  2VKH A;  3MD2 A;  2DDA A;  3EDP A;  1MSE C;  2DOA A;  1TTY A;  4QWQ A;  1TT0 A;  3E3V A;  1HDP A;  1RKT A;  3OYI A;  3W6V A;  3MWM A;  3GTL J;  4JQF A;  1VND A;  3CO7 C;  2GQQ A;  5B1A H;  3FXR A;  1Y6I A;  2CJJ A;  4G6T B;  3JRD A;  3BTI A;  4MHG A;  4R79 A;  2ZNZ A;  1YI2 I;  3MNL A;  4GFK A;  2ZJQ F;  2C6Y A;  4MK6 A;  1R22 A;  1ACI A;  1XDU A;  3D0S A;  4IHY A;  2BY3 A;  3VB2 A;  3FKI J;  1SAN A;  2FXA A;  2KIQ A;  5HOO A;  4LD5 A;  2D45 A;  3V8L A;  3ZQG A;  4BEH B;  5C4X J;  3BWG A;  1WHU A;  2QGU A;  2VQL A;  4QLC U;  2R7Z J;  2IW5 A;  1VQ7 I;  3HOW J;  1LJ9 A;  4U88 A;  3V7C A;  5CW8 A;  2ELJ A;  4KIF A;  4JOM A;  1D3Y A;  4GRI A;  3OS0 A;  4RLQ A;  4P9F A;  4AVP A;  3P9I A;  2DG7 A;  2XUB A;  1FX7 A;  3BG9 A;  1OCC H;  2STW A;  2R5Y B;  3MAJ A;  2PN6 A;  2VON A;  3QOP A;  5M5W J;  1KA8 A;  1GVD A;  2VIX A;  4U7B A;  5CVU A;  2KQR A;  4IHW A;  4IX7 A;  1R4M B;  3ZN1 A;  1JGG A;  2FE3 A;  3KET A;  4R8H A;  2CRG A;  3WGG A;  1RRJ A;  1P92 A;  2VJI A;  2H6C A;  4RB0 A;  4NN1 A;  3DLA A;  5E3M A;  3ASO H;  4DQ2 A;  1EH8 A;  3L2C A;  2YU9 J;  3NI7 A;  2PMU A;  3HYI A;  3TDZ C;  3BPV A;  4PFP A;  5TIS C;  3HSE A;  4KNY A;  2CH0 A;  3OSG A;  1N75 A;  3MZY A;  3VSK A;  3E1S A;  1SAX A;  2BVM A;  5FMP A;  2LVS A;  2DT5 A;  2G7H A;  1IC8 A;  1XMA A;  2Z3Y A;  2GBY A;  2V9P A;  4II2 A;  2JA5 J;  1BOA A;  2L5Q A;  4UHT A;  3LJL A;  1LEA A;  4LIT A;  1Z21 A;  1ETY A;  2R7X A;  2VE8 A;  2XDV A;  2Y0S A;  2HWV A;  2FRH A;  4LOC A;  5LBQ A;  1ZRC A;  1IDZ A;  4EAT A;  1A31 A;  3CJD A;  3H1C A;  3ZQC A;  5EFY A;  2HI3 A;  3IL2 A;  4UUS A;  3NAU A;  1XX5 A;  3O60 A;  2DO7 A;  2RQQ A;  2X0L A;  4OMY A;  4BHP A;  1E3O C;  2ZCW A;  1HSJ A;  3PIP F;  3ZP5 A;  1JKQ C;  4X6A J;  2IS2 A;  4BS9 A;  3HUG B;  5C44 J;  3HTJ A;  1TWC J;  2H1K A;  2BHY A;  2HVQ A;  2HYJ A;  2HTS A;  4JYK A;  1D8K A;  1K6Y A;  4NC6 A;  1VQK I;  1D8J A;  3C2G A;  4YIR X;  2HPI A;  1K79 A;  2E5N A;  1R1V A;  1RET A;  3RZO J;  3RQ4 A;  5TJJ A;  4BAY A;  5LD2 C;  2CFX A;  5H9T A;  3BR0 A;  3FBN B;  2XRO A;  4EEF G;  4ZZL A;  1UMQ A;  3FXQ A;  4M72 A;  4KN7 X;  5E8G A;  3V8J A;  4CCJ A;  2EIK H;  5JLW A;  1T95 A;  2XF5 A;  2BVL A;  4ZH4 F;  4XOP A;  2ECC A;  3SDG A;  2VT3 A;  2K5C A;  3W2V A;  3HKZ N;  3SXY A;  4E4H A;  3VWB A;  1Y8Q B;  3JCU C;  2L7Z A;  1OJL A;  3ANP A;  1AKH A;  1DPR A;  1VQ5 I;  4AD9 A;  4A93 J;  4FE4 A;  4B3A A;  2LYC A;  4XON A;  1J2X A;  1B72 B;  2E7W A;  4XNF A;  3TOB A;  3KP6 A;  2COB A;  1XB4 A;  3ZR8 X;  4C3I J;  5GTH C;  2OCE A;  4NQW A;  2Y69 H;  3CUQ B;  3U21 A;  3V42 A;  4BDZ A;  4Y13 A;  5E17 F;  2GUH A;  1IXC A;  1IRF A;  4XLP F;  2PG4 A;  1T39 A;  2O9L A;  3RIR A;  2UXU A;  1N25 A;  1OYW A;  3M07 A;  4M6X A;  2CG4 A;  2YPR A;  4A12 A;  3JAM Z;  1J7K A;  1MBK A;  4IHX A;  4CO8 A;  4E6K G;  1KU7 A;  4KIS A;  2F4M B;  3H0G J;  3PAS A;  2O5R A;  4X0G A;  1PJR A;  2BHZ A;  4IVN A;  2D1V A;  1QBJ A;  2MA3 A;  1Z91 A;  4ENN A;  2IGK A;  3KZY A;  3CQZ J;  5K58 A;  2I5U A;  5BNG A;  1SFU A;  1H88 C;  2PMZ N;  3IHU A;  4CCO A;  3TDU C;  3HKZ A;  5K7F A;  3V8K A;  3S3O A;  4LIU A;  4RB2 C;  1QPM A;  1YRN B;  3PO2 J;  2V7F A;  2X1E A;  3AFH A;  1BR1 A;  1X2M A;  1YW7 A;  3R60 A;  5F0F A;  1FIP A;  4G12 A;  1O3Q A;  4EJO A;  4GCK A;  4KFC A;  4D5F A;  1IN8 A;  2EFP A;  5LGN A;  1WJE A;  3TED A;  4HPQ A;  2R7Q A;  3IAS 2;  2XSD C;  2P0W A;  3AL0 C;  3OL3 A;  4N4N B;  3G1M A;  2Q1Z B;  2QBY B;  4G94 A;  2LFB A;  3U1K A;  3QWL A;  4E7Z A;  1WI9 A;  2DAO A;  2QZ8 A;  3I4N J;  1SVL A;  4G7O F;  3BTL A;  3BJA A;  3QPH A;  3K6G A;  1V5G A;  2NOJ B;  3ERM A;  2WWY A;  2DYR H;  1A35 A;  1ZG1 A;  3LFK A;  2EB7 A;  4ME9 A;  2A69 F;  1F9N A;  3LSG A;  1UCR A;  1FWZ A;  1OIS A;  2AXT C;  4FQG A;  1ONV A;  1R5G A;  2FJI 1;  2PQ8 A;  2K02 A;  2W1O A;  3GTG J;  2NNN A;  2R7U A;  2M4G A;  3HTS B;  3C07 A;  1QVT A;  2D2W A;  5HVQ C;  4UXN A;  2DJN A;  4DYQ A;  3WTX C;  4B1R A;  4IF4 A;  1LB2 A;  2KFD A;  4RAG A;  5CVI A;  1T38 A;  1DU6 A;  3L7W A;  4KIB A;  3SEQ A;  3CCR I;  3JRG A;  4HRI A;  3KCC A;  1OCR H;  2XC7 A;  3E6B A;  4BUP A;  3OSF A;  3RSN A;  1T0F A;  2PBI A;  1IW7 F;  2GIV A;  1QHG A;  2UZK A;  3DKW A;  3LAP A;  1XSV A;  2DU9 A;  2PI0 A;  1Q1H A;  4FCY A;  4PK4 A;  3ABL H;  3AG2 H;  2M1B A;  5BQT A;  5JHU A;  5A2Q Z;  4DGW B;  1OMI A;  1UEL B;  2BY1 A;  3EUA A;  2EZH A;  2NVU B;  3H36 A;  4ZYE A;  1IV8 A;  2VC1 A;  4E7J A;  1RR7 A;  4JNN A;  4IRG A;  4ZTF A;  4HF2 A;  3ABT A;  2MSY A;  1S7O A;  3HG9 A;  5CVR A;  1K61 A;  4I02 A;  2RNG A;  2FBI A;  2JRM A;  4UDS A;  2JA2 A;  5IOZ A;  4IZZ A;  1XCV A;  1F4K A;  1K7A A;  4DBQ A;  3QOD A;  1FT9 A;  2V1X A;  4IQ4 A;  2EV6 A;  3LHQ A;  4Q5S F;  5CVJ A;  4IOC F;  1J9I A;  5DV5 A;  1FYL A;  1X1B A;  3IC7 A;  4IJA A;  1GUU A;  5F04 A;  4E7H A;  4C2M J;  1X19 A;  3B02 A;  4HEA 2;  3WG7 H;  1YJW I;  1W36 D;  3W2W A;  4LB5 A;  3ECO A;  2XV4 S;  4BQO A;  2B1E A;  2EIM H;  5GP9 A;  1Z67 A;  1P7I A;  4M3B A;  2Q2E B;  1WQ2 A;  3BZ6 A;  1W5S A;  3QYF A;  3JSO A;  4L18 B;  4FET A;  3S1M J;  3CUQ C;  1IN6 A;  5DD8 A;  1RR8 C;  2XAH A;  5LGU A;  1FLI A;  1HKT A;  5EGO A;  2W85 A;  2Y48 A;  2UWM A;  3BTC A;  3FZV A;  3NNR A;  5FKM A;  2FBH A;  4RBO A;  1ZR4 A;  1ETW A;  5HLH A;  2E1N A;  4FE7 A;  1G3Y A;  3QU6 A;  2K3P A;  3G71 I;  3M4O J;  3OYF A;  1TL8 A;  3HOT A;  2ZXH A;  4H4K C;  5GAG J;  1MNM C;  3M8F A;  1ZRF A;  1I6H J;  2NAZ A;  4WXH A;  3HOY J;  2WV1 A;  1PUF A;  1D5V A;  2RVC A;  4S04 A;  4LMY A;  5JFR A;  2R7W A;  1FC3 A;  2BOL A;  2HQR A;  1YX5 A;  5E3L A;  4Y33 A;  4ZC3 A;  4YFX F;  1J59 A;  2XIG A;  2HVR A;  4M9X A;  3SWH A;  4P96 A;  1W7P B;  3RI4 A;  2NX4 A;  1ZGJ A;  2X1C A;  3W6J B;  3G7R A;  3K10 A;  1ZG3 A;  1P2F A;  2JUC A;  2F5F A;  4PZJ A;  5FD5 A;  4EQQ A;  3GFI A;  1O3R A;  2X6O A;  2LDU A;  3COA C;  5D1R A;  5HS8 A;  4B47 A;  1R1T A;  3HRU A;  1GDT A;  1IUY A;  1QPI A;  3BCA A;  3GTK J;  1BC8 C;  2FNP A;  3I4M J;  3GTJ J;  4OMZ A;  1X1A A;  2A6T A;  2R5Z B;  4HDU A;  3S14 J;  2A2F X;  2IU5 A;  2MLG A;  3TBI A;  4L9T A;  3CMM A;  1EJ9 A;  1IZ1 A;  3M8J A;  4G6D A;  2R7V A;  1ODD A;  2MFZ A;  5F08 A;  4UV9 A;  1EF4 A;  3C2B A;  3JSP A;  4EJT A;  2FD5 A;  3LSH A;  2MYS A;  3CC7 I;  3HTH A;  3F6O A;  2F5D A;  2P5K A;  4DOZ A;  2W7N A;  1UAA A;  2CUE A;  4RA2 A;  5IYD J;  3I55 I;  4PJ0 C;  2O03 A;  5GPA A;  2IT0 A;  1MJA A;  1Z05 A;  3PO3 J;  5HBU A;  1ZLK A;  2W53 A;  4LK0 F;  2KRH A;  5FLX K;  1KYW A;  2M2E A;  2YU3 A;  3NWT A;  4PJM A;  1YX3 A;  2CS3 A;  2L0K A;  2QF7 A;  4NC7 A;  3I5U A;  5FGL A;  3ELK A;  5F64 A;  4UUS B;  1U8B A;  3DKY A;  4AYB N;  2XAS A;  3OYK A;  4BBS J;  3CCV I;  3M8E A;  3RD3 A;  3HSF A;  4W97 A;  2LG4 A;  2LH9 A;  1R5I D;  4C2T A;  3F3X A;  3CC4 I;  1IRX A;  2W4S A;  2CV2 A;  5HS9 A;  5LHG A;  1GXP A;  2HXO A;  1P4A A;  1O7L A;  2DOD A;  2WB1 N;  1QNT A;  3I71 A;  2F5E A;  5ILU A;  4JP0 A;  5M5Y J;  1G59 A;  2IA0 A;  2ZSH B;  1Z3X A;  3IKV A;  4MFD A;  2CV1 A;  5BPD A;  4G9Y A;  3K1N A;  2CQQ A;  4CXF A;  3NXC A;  3MCZ A;  4DYC A;  3G3Z A;  2UXP A;  3OR2 C;  1U78 A;  2PJR B;  1R36 A;  2M87 A;  1MIJ A;  4XLN F;  1H9G A;  2LD5 A;  5A2Q K;  5J4V A;  3S93 A;  2L7M P;  2PMH A;  2LOO A;  1X58 A;  4HLX A;  4OIN F;  3VYT B;  4AIJ A;  1HBX G;  2L9V A;  4E7S A;  1BI3 A;  4XRM A;  4HNU A;  4IXA A;  1TQP A;  3VYS B;  4F92 B;  3JR9 A;  2P7C B;  3H3U A;  2HKU A;  3GEZ A;  2QTQ A;  4IQJ A;  2R7T A;  1MKM A;  1ZKG A;  4AM3 A;  1G3T A;  1MMA A;  3S16 J;  1JI8 A;  4PDK A;  3MN2 A;  3JAM K;  4Q4Z F;  2MW8 A;  4WXD A;  5CPR B;  2ZJP F;  1RUO A;  5IPA A;  1B9N A;  2IS4 A;  1NK3 P;  1XMX A;  2IP2 A;  5D5U B;  2K40 A;  2M3A A;  1DGW Y;  4KT6 A;  3KP5 A;  2E2H J;  5DUI A;  3LWF A;  4V2G A;  4J00 A;  3KP3 A;  1B8I B;  2XAU A;  5GAD J;  2VQH A;  1TNS A;  4B3X A;  2W84 A;  1R1U A;  3FHZ A;  3L00 A;  3IAM 2;  3Q9S A;  4KYW A;  3K4J A;  2QIB A;  3R0A A;  1QZZ A;  5JHF A;  3KYD B;  3G1L A;  4HDV A;  2ELK A;  1RC9 A;  2M8E A;  2R7F A;  4XL9 A;  2Q2E A;  3ZQI A;  3ZRG A;  3IRQ A;  1YRN A;  4L0Y B;  2DA6 A;  3FXM A;  1TBX A;  4WF2 A;  4EV0 A;  1JJ6 C;  2EBI A;  2IS6 A;  2JJ7 A;  3PM1 A;  1FMW A;  3RKW A;  1WCM J;  2W57 A;  4RAF A;  3ABK H;  1NG6 A;  1R58 A;  1WGX A;  9ANT A;  2E5Z A;  4OIR F;  1HXD A;  4N0B A;  1ZRD A;  3I9V 2;  2JSC A;  3BCG A;  5CVV A;  5DDG A;  3JTG A;  2XPU A;  3FWE A;  4L5I A;  1IAW A;  2GWR A;  5FRM A;  4XKC A;  1QO0 D;  1CQT A;  3REO A;  2V79 A;  3DPJ A;  3BG7 A;  2GA2 A;  3BG3 A;  5AQC A;  3OY9 A;  4BHC A;  1XC5 A;  2CUJ A;  3F8B A;  3WU1 B;  3HL2 A;  3FDY A;  2VQG A;  3VDX A;  2FMY A;  2PZ9 A;  4U7D A;  3FBI B;  1D1B A;  2V6E A;  2R7O A;  4E7I A;  2K9N A;  2TDX A;  4XLH A;  1RIO H;  3CJQ B;  4G7H F;  1D0X A;  1SFO J;  2DA2 A;  2Z5U A;  3F8F A;  3PQK A;  4CDG A;  3ZQL A;  5J8F A;  5EZH A;  3L2V A;  3TOA A;  2M30 A;  1ETO A;  2XPV A;  3FM5 A;  2LBF B;  3N4M A;  2VPL A;  1FOK A;  2JT1 A;  2G0E A;  3PJR A;  5LGT A;  3JRC A;  2QYO A;  4YFK F;  2XVC A;  4KJZ A;  3R0J A;  2E1M C;  3T5X A;  2QSH X;  4CZC A;  1AWC A;  2EA2 A;  3HIF A;  3Q9V A;  4PCQ A;  2XF7 A;  2M7B A;  4M6V A;  1A04 A;  5CLS A;  3TW7 A;  1KQ8 A;  1BBY A;  1FPQ A;  2ACJ A;  4FHT A;  5C4J J;  1OCZ H;  2R7R A;  5DD4 A;  1S29 A;  3ZMS A;  5HLT A;  2PEX A;  3ZQF A;  1DU0 A;  3JRE A;  2GXA A;  2M0M A;  3IWF A;  5L3D A;  2QSF X;  2WAQ N;  4QPQ A;  4ZDL A;  2RC4 A;  2CQN A;  5BMZ A;  3WTZ A;  2UXX A;  3MZH A;  5IT9 Z;  2XAG A;  4KWA A;  1S3J A;  1U0J A;  1UZC A;  2HOA A;  1TWH J;  3CCL I;  2EIN H;  4L9J A;  2RGV A;  1BW5 A;  5E1W A;  1AOY A;  2K9L A;  3QPT A;  2XB0 X;  2DTZ A;  3GF2 A;  4JBA A;  3SDB A;  1H89 C;  2GIZ A;  4A69 C;  2MC3 A;  2STT A;  1LEB A;  2XHK A;  4Z6Y A;  3DBL B;  3ASN H;  3DEE A;  3GME A;  1VQM I;  1TW2 A;  1W5T A;  1FYM A;  3OYE A;  4KMU X;  1IRG A;  2QQA A;  3DTK A;  1LVA A;  3IUV A;  5KNL A;  3HHG A;  4J19 A;  1QHH D;  1WVR A;  2DN0 A;  4OU0 A;  1AU7 A;  2CMP A;  1K4T A;  4IL6 C;  2OC6 A;  3LOC A;  3GFJ A;  4RAZ A;  3P9T A;  1MBG A;  3H5R A;  4Q47 A;  5IP6 A;  2ESN A;  2K9M A;  1UHW A;  1DDN A;  4F55 A;  1GXQ A;  1TW3 A;  2DCE A;  3WTU C;  4BXX J;  2DFF A;  2F4O B;  4YII A;  2WAF A;  4NQW B;  1U5T B;  1ETQ A;  2JTV A;  4RGU A;  2EPF A;  2L2O A;  1TQI A;  1PP7 U;  2FBQ A;  2LY2 A;  4XKB A;  4J01 A;  2L4A A;  4NUB A;  3ABU A;  3CUO A;  3LQR A;  3BHQ A;  2GLO A;  4A6E A;  2O7O A;  4KIG A;  1Z7L A;  1L0O C;  1ZAO A;  3LFU A;  2FSW A;  1R5H A;  2KLO A;  2HNH A;  4N9H A;  5L3E A;  2V9K A;  2V57 A;  3IKT A;  2XRL A;  3CF5 F;  4XR6 A;  5J47 A;  3FX3 A;  4A0X A;  4X1E A;  2LNB A;  4AF5 A;  5J6X A;  4A0Z A;  1VI0 A;  5L3C A;  1R9T J;  4OOI A;  4G6Q A;  2JVG A;  2DBB A;  2R3S A;  1KZH A;  4BJ5 C;  1HW2 A;  2ZOZ A;  3TO6 A;  4ENM A;  1G8X A;  1JT6 A;  4CH7 A;  1SVM A;  5IP9 J;  2COM A;  4II3 A;  4ZYH A;  3EUK L;  2WTE A;  4YRV A;  4P5O A;  2ZME B;  2MH9 A;  3WGH A;  2G7U A;  1G4D A;  2DT6 A;  3J80 K;  1GT0 C;  2E1C A;  1YTY A;  3UKG A;  1QZY A;  2QWW A;  5DAJ A;  2VBW A;  1HLV A;  5FFX A;  3JTH A;  5M3M J;  3DPT A;  3BRO A;  2FF4 A;  1I6X A;  1RES A;  3K0L A;  1MNE A;  4WWC A;  3KEQ A;  2XF6 A;  3WU0 A;  4HX4 A;  3LWJ A;  3FMS A;  2L3D A;  4NNJ A;  5HNF A;  1BL0 A;  1FJL A;  4DBR A;  5D5W B;  4CYC A;  1XDS A;  5FKK A;  4ZYD A;  2KMU A;  4BY1 J;  1J0R A;  1DQU A;  3HRT A;  4FAS D;  4BE1 A;  3LSP A;  3KKC A;  3F72 A;  4UUT A;  2DA3 A;  3Q0U A;  3OIP A;  4CCL A;  1Q1V A;  2DQL A;  2DQR A;  4RB3 C;  1YIJ I;  2WUI A;  2V4J C;  2RV8 A;  1X1D A;  5DTD A;  3GZ6 A;  1U5T A;  3P5J A;  2Y75 A;  2XDN A;  1ULY A;  3BJ6 A;  4RGS A;  4LGW A;  3U2R A;  1T56 A;  3WHC A;  3WE3 A;  4OIP F;  2Z1D A;  2ZXI A;  4NDL A;  2OBP A;  3CMY A;  1Z6T A;  3DBH B;  3I59 B;  2LY1 A;  1MDM B;  1U6G A;  4CA0 A;  3G73 A;  2GA1 A;  2RHA A;  1JXS A;  1M1E B;  3HRM A;  3J80 Z;  2HZT A;  4M3F A;  3HSR A;  4PSX A;  2HQA A;  2BGC A;  3MZ8 A;  4XOT A;  5FLM J;  5FLX Z;  4H0E A;  3PUF A;  3RZD J;  3CMA I;  1WZ2 A;  3GTP J;  2VE9 A;  1S72 I;  4HZF A;  2MD0 A;  4HV6 A;  3EQL F;  4I2O A;  1CF7 B;  5D5V B;  3ZXS A;  1APL C;  3JRF A;  4Q48 A;  2P81 A;  3P9C A;  4OAZ A;  3LNQ A;  1BOB A;  3GZI A;  3O3K A;  4DZJ A;  3ZQH A;  3ISP A;  4FIS A;  4ABZ A;  3K4L A;  1IV6 A;  1NTC A;  3A01 B;  2FNA A;  1O7F A;  3UNG C;  2JK3 A;  1SVO A;  3BR6 A;  1LKX A;  4RLF A;  2QQ8 A;  2IAI A;  2BW3 A;  4LLN A;  2FEZ A;  3RYP A;  1WJD A;  3ZQ7 A;  1LE8 B;  3TO9 A;  2IA1 A;  4BEH A;  3A01 A;  1VQ6 I;  5ILS A;  2VUM J;  1FBU A;  3E7L A;  2V6C A;  2A61 A;  3ROU A;  1Y39 A;  1SD5 A;  5HLG A;  3FXU A;  3BY6 A;  3JRB A;  2ZFU A;  4EJW A;  5L3F A;  4JK1 X;  2FQ3 A;  3KLN A;  2DFH A;  1JJ8 C;  2A3S A;  2DPD A;  2DT7 B;  2QQ9 A;  1AA7 A;  2IPQ X;  4UB6 C;  4PJN A;  3DTE A;  2HKX A;  2E1M B;  3AG1 H;  3FXO A;  5E1X A;  1MBE A;  3J81 K;  4U0V A;  3OYB A;  2FOK A;  2IJL A;  1S7E A;  2NS8 A;  1UHS A;  2OUM A;  5ERI A;  3T1B A;  1H0M A;  4GCL A;  1JHH A;  1MMS A;  5D6E A;  1JGS A;  2QCO A;  1FIA A;  1P4X A;  3P7N A;  4HBL A;  5DUK A;  3HPH A;  3K4B A;  1DP3 A;  2R93 J;  4U87 A;  2ZB9 A;  3RPU D;  4A3C J;  4BNC A;  3KZZ A;  1OKR A;  2B9S A;  3K4C A;  4O6J A;  1A36 A;  3KEO A;  3AQT A;  2DXI A;  4LJZ F;  1JUM A;  2R92 J;  4L9N A;  4A3L J;  2BEO A;  3C7J A;  4IKF A;  1WKM A;  3GVA A;  1D1C A;  3T6N A;  3BR3 A;  3TW6 A;  4KIC A;  5B3S H;  5F27 A;  2XAJ A;  5H20 A;  4YEJ A;  4ESB A;  3F0C A;  2YVE A;  5KAF C;  2RKH A;  2QM3 A;  3S3N A;  2KDO A;  4OAY A;  2V26 A;  2JMW A;  4MGR A;  4XBF A;  2IGO A;  1FEX A;  1MJB A;  3GO5 A;  4WIB A;  4PUS A;  4UY8 I;  1IO2 A;  2LP0 A;  1SEU A;  1X3Z B;  1S9H A;  5D5X B;  3RTR A;  4B09 A;  4EM2 A;  1O4X A;  1ZLJ A;  1X1C A;  5E8I A;  4MLO A;  1A6I A;  2IXS A;  4HKU A;  1H8A C;  2DK5 A;  3BQY A;  3V4G A;  3ZMT A;  3Q5F A;  1I3A A;  4GXO A;  1T33 A;  2YS9 A;  1W0T A;  1J09 A;  2DMU A;  3ZOB A;  1TZL A;  2K7L A;  3QPS A;  4V19 K;  3NRV A;  4OIQ F;  1U3E M;  1XTA A;  1W0U A;  1MMG A;  1UG0 A;  4XLF A;  3D5L A;  1I5Z A;  3BG6 A;  2HGC A;  5EEH A;  4ZYG A;  2E60 A;  3Q3S A;  4RDU A;  3M9A A;  4E7K A;  1XD7 A;  2KIS A;  4MTD A;  4HNV A;  1QA6 A;  4L0Z B;  4EJV A;  3VVZ A;  1W36 C;  2Z16 A;  3FXK A;  4LB6 B;  5IY5 H;  1IG7 A;  3HOU J;  3K4N A;  3LSM A;  5KCM A;  2I8D A;  2GZW A;  1T98 A;  2F5V A;  3LA3 A;  1ETK A;  4M74 A;  2OF7 A;  2GM4 A;  2G7L A;  2V1N A;  1V54 H;  2QUF A;  4HAM A;  4LLG F;  3I56 I;  3HTI A;  2M0C A;  4FTH A;  3BLY A;  2DFI A;  1FOW A;  5JVG F;  1VQL I;  3VFZ A;  3KE2 A;  1HF0 A;  3B6C A;  3VOK A;  2DMP A;  5ICG A;  5GPC A;  1BC7 C;  2IA2 A;  4D1Q A;  3CCY A;  3WTV C; 
#chains in the Genus database with same CATH homology
 2CQQ A;  4D5C A;  3NXC A;  2G7G A;  4DYC A;  3HB9 A;  2UXP A;  2HQ5 A;  2D6Y A;  1U78 A;  1LFU P;  4DYR A;  5C3E J;  4A3F J;  3JSJ A;  1GV5 A;  2IEK A;  1I50 J;  2LD5 A;  2Y2Z A;  4I76 A;  3K7A J;  1XS9 A;  2L7M P;  3VIB A;  3L1P A;  1F36 A;  1X58 A;  3HDD A;  4AC6 A;  2FJ1 A;  1VFC A;  2D5V A;  3K2A A;  4S0H B;  4XRM A;  3S1Q J;  1K83 J;  1ZTR A;  4M3G A;  2ME0 A;  2ID6 A;  3GTM J;  4JKZ A;  3QQA A;  3JR9 A;  2ZOY A;  1Z77 A;  3HOX J;  2HKU A;  2E2J J;  2QTQ A;  4GFL A;  3CWR A;  1ZKG A;  3IH3 A;  3S16 J;  3JRI A;  1MSF C;  5JLX A;  1F43 A;  2XGD A;  3MN2 A;  5J3L A;  3HEF A;  4BKX A;  4XRS A;  4CYC B;  1BW6 A;  3IH4 A;  4XK4 A;  3VOX A;  2NOG A;  3BT9 A;  3BTJ A;  5DS9 A;  1JKO C;  2MW8 A;  3BRU A;  5IPA A;  1NK3 P;  1HDD C;  3VP5 A;  5HOD A;  2K40 A;  2RAE A;  1A5J A;  4A3M J;  3ON2 A;  4A3B J;  2E2H J;  2HDD A;  2CU7 A;  3GTO J;  2JN6 A;  4V2G A;  1JTY A;  5FKN A;  1B8I B;  1MSE C;  2G3B A;  3G1O A;  2QOP A;  2MGQ A;  1HDP A;  1RKT A;  3W6V A;  5EDN A;  2NVQ J;  3GTL J;  2QIB A;  1VND A;  1FTZ A;  3VPR A;  3G1L A;  2NS7 A;  4M3E A;  1IUF A;  2CJJ A;  3JRD A;  2ELK A;  1U9N A;  3ZQI A;  2TCT A;  3BTI A;  1YRN A;  2F07 A;  3MNL A;  4GFK A;  2DA6 A;  4MK6 A;  1JJ6 C;  2EBI A;  1JKP C;  4IHY A;  2JJ7 A;  3KNW A;  2O8K A;  3PM1 A;  1WCM J;  3HOZ J;  4A3D J;  3FKI J;  3B6A A;  1SAN A;  1WGX A;  9ANT A;  3HOV J;  3AQS A;  3S2H J;  3ZQG A;  4ICH A;  4C3J J;  5C4X J;  3FIW A;  4W1U A;  3IV5 A;  3BCG A;  2ZCX A;  2R7Z J;  2XPU A;  3HOW J;  3JRA A;  2NVT J;  3HTA A;  1TWG J;  2DMQ A;  3TP0 A;  5CW8 A;  1CQT A;  3Q0W A;  2DG7 A;  3DPJ A;  1WI3 A;  3BG9 A;  3LSJ A;  3NPI A;  2R5Y B;  3BG3 A;  5K7H A;  3BNI A;  5AQC A;  5E3N A;  5M5W J;  3OIO A;  1XC5 A;  1GVD A;  4JX4 A;  4IHW A;  4XRS G;  1JGG A;  1Z0X A;  2PZ9 A;  2UXO A;  2M34 A;  3IH2 A;  2CRG A;  1MH4 A;  3O8G A;  2K9N A;  1PUF B;  4NN1 A;  5IYB J;  5E3M A;  5D18 A;  1SFO J;  3HE0 A;  2DA2 A;  3ZQL A;  1GV2 A;  2YU9 J;  5EZH A;  3NI7 A;  3V6G A;  4GCT A;  2NP3 A;  1ETO A;  2ID3 A;  2XPV A;  4L5E A;  4A3E J;  2Y9Z A;  3MKL A;  4MFE A;  4AC0 A;  4XID A;  1TC3 C;  3BJB A;  2CUF A;  3OSG A;  2G0E A;  1ETX A;  3JRC A;  2XB5 A;  3VW0 A;  1WH7 A;  5FMP A;  2LVS A;  3M3Y J;  3COL A;  3GEU A;  1IC8 A;  2GBY A;  2JA5 J;  3LJL A;  4M6V A;  3TW7 A;  3D1N I;  5C4J J;  1ETY A;  2Y31 A;  3ZQF A;  1DU0 A;  3JRE A;  4A3J J;  4LOC A;  2WAQ N;  1IDZ A;  3CJD A;  5EFY A;  3ZQC A;  2HI3 A;  3Q0V A;  4UUS A;  1B8I A;  3NAU A;  3O60 A;  1JTX A;  4KWA A;  2LY9 A;  3EUP A;  2HOA A;  4C3H J;  3RKQ A;  1TWH J;  3S5R A;  5EEA A;  1E3O C;  2NVX J;  1BW5 A;  2DA5 A;  1JKQ C;  4X6A J;  5C44 J;  3GTQ J;  3HTJ A;  1TWC J;  2H1K A;  2XB0 X;  2DTZ A;  3GBG A;  5EG0 B;  2HYJ A;  2DA4 A;  4JYK A;  1H89 C;  2HOT A;  4A69 C;  2DMT A;  3FK7 A;  4BY7 J;  1UI5 A;  1RET A;  3RZO J;  5FKL A;  3SJM A;  5H9T A;  3NAR A;  1ETV A;  4XIC A;  3BR0 A;  3RQI A;  2GEN A;  4EEF G;  2LKX A;  1ITY A;  1UMQ A;  2Q24 A;  3IUV A;  5JLW A;  4J19 A;  1AU7 A;  2DN0 A;  2R0Q C;  3H3V K;  2OPT A;  2ECC A;  3SDG A;  3HKZ N;  2UXI A;  3LOC A;  5FLV A;  4BBR J;  1JKR C;  2OER A;  2L7Z A;  2UXH A;  3P9T A;  1OJL A;  1MBG A;  2VKV A;  4A3K J;  1AKH A;  3ANP A;  5IP6 A;  2LR8 A;  4A93 J;  3VW1 A;  3A02 A;  4FE4 A;  2K9S A;  4B3A A;  1WPK A;  3HBL A;  4BXX J;  4Y7N J;  4L62 A;  5EZG A;  1B72 B;  4JX5 A;  5M5X J;  1ETQ A;  1NK2 P;  5K7Z A;  5CXG A;  2COB A;  1P7J A;  2FBQ A;  1I3Q J;  4C3I J;  3BHQ A;  2GLO A;  2O7O A;  3E7Q A;  2GUH A;  4QSH A;  2O9L A;  3ANG A;  2UXU A;  2LTP A;  2V57 A;  2XRL A;  1MBK A;  4MIM A;  4IHX A;  2HYT A;  4GFB A;  1HCR A;  4X1E A;  3H0G J;  4AF5 A;  5F0C A;  3PAS A;  1TWF J;  3TP3 A;  1VI0 A;  4M3D A;  1R9T J;  2B63 J;  3KZ9 A;  4QIW N;  3F1B A;  3NRG A;  3CQZ J;  5K58 A;  1HOM A;  5BNG A;  2G7S A;  1JT6 A;  1TWA J;  1H88 C;  2PMZ N;  5C4Y A;  5K7F A;  4A3G J;  3RH2 A;  5IP9 J;  4QTR A;  1YRN B;  3PO2 J;  2O7T A;  1X2M A;  1D5Y A;  4GCK A;  5F0F A;  1FIP A;  4G12 A;  1IJW C;  2HOS A;  4D5F A;  1U9O A;  3TED A;  3S15 J;  2XSD C;  1GT0 C;  2E1O A;  3UKG A;  1ORK A;  2Y30 A;  3G1M A;  5DAJ A;  1HLV A;  5M3M J;  2M8G X;  3B81 A;  2LFB A;  2RAS A;  1G2H A;  2L9R A;  3I4N J;  1RKW A;  1RES A;  3BTL A;  3VW2 A;  5HAW A;  4V2F A;  3LWJ A;  3CDL A;  4ME9 A;  3LSG A;  1SGM A;  1BL0 A;  3WHB A;  1FJL A;  4CYC A;  5FKK A;  2NVY J;  4I6Z A;  4BY1 J;  2HXI A;  2DMN A;  3LSP A;  3KKC A;  4PXI A;  2JA7 J;  3GTG J;  4MO7 A;  4UUT A;  2DA3 A;  3Q0U A;  3C07 A;  1QVT A;  1Q1V A;  2DJN A;  4DYQ A;  2WUI A;  5FHP A;  5DTD A;  2W48 A;  4B1R A;  5J1R A;  2XDN A;  1DU6 A;  5J1Y A;  2NP5 A;  3WHC A;  1T56 A;  3JRG A;  4NDL A;  3FRQ A;  3OSF A;  4NEL A;  3CMY A;  2VI6 A;  4D7N A;  1AKH B;  3FK6 A;  3SFI A;  3A03 A;  2XPW A;  5F0H A;  1OCT C;  2EQR A;  1MBH A;  2ZCN A;  1Y1V J;  4M3F A;  2RHA A;  5FLM J;  3RZD J;  4FCY A;  2E19 A;  4DZP A;  3GTP J;  1OCP A;  2I10 A;  5J1U A;  4A3I J;  2QKO A;  3QBM A;  4CGR A;  3QPL A;  3LSR A;  3JRF A;  1APL C;  3ON4 A;  2LLK A;  3HGG A;  2EZH A;  2JWT A;  4YZE A;  2FQ4 A;  2P81 A;  1LFB A;  2N8G A;  1RR7 A;  5EG0 A;  1UI6 A;  4JNN A;  3LNQ A;  3GZI A;  4DZJ A;  2MSY A;  5FJ8 J;  3ZQH A;  4B4C A;  1K61 A;  4MXM A;  4FIS A;  4UDS A;  4ABZ A;  1IV6 A;  5IOZ A;  1NTC A;  3A01 B;  2Y0S N;  1LE8 A;  2MG4 A;  3BR2 A;  2Y9Y A;  2JK3 A;  1ZK8 A;  1BJZ A;  3BR6 A;  2H8R A;  3FIS A;  2ECB A;  2L7F P;  3LHQ A;  1AHD P;  2IAI A;  5IOY A;  1MBJ A;  1LE8 B;  2VUM J;  2ZOZ A;  3A01 A;  2KDZ A;  3E7L A;  5F04 A;  1GUU A;  4C2M J;  3OOU A;  5IYC J;  3O8H A;  5EYR A;  1JUP A;  3JRB A;  1OFC X;  2WGB A;  3S1R J;  1BA5 A;  1ZR2 A;  4JX6 A;  1JJ8 C;  5F1J A;  2E2I J;  5GP9 A;  5IP7 J;  1X2N A;  1P7I A;  4M3B A;  2CQX A;  2IBD A;  1FTT A;  1IRZ A;  4D7M A;  3MVP A;  1IDY A;  2FX0 A;  1MBE A;  2X9D A;  3S1M J;  3S2D J;  2NS8 A;  1S7E A;  4AUX A;  5EGO A;  1UHS A;  3BTC A;  4GCL A;  3NNR A;  2DA7 A;  1IGN A;  5FKM A;  2XGE A;  4Y52 J;  4RBO A;  1ZR4 A;  1ETW A;  4FE7 A;  5D19 A;  2R5Z A;  2OI8 A;  3M4O J;  3JRH A;  2QCO A;  2AHQ A;  1FIA A;  1MNM C;  1I6H J;  1Y1W J;  2EZI A;  2R93 J;  3HOY J;  2WV1 A;  2K9Q A;  2X48 A;  2ZB9 A;  1PUF A;  1UG2 A;  4A3C J;  3BR5 A;  2AO9 A;  2VPR A;  5E3L A;  3AQT A;  3S17 J;  1JUM A;  2QWT A;  2GFN A;  2R92 J;  2DG8 A;  4A3L J;  1ENH A;  2LK2 A;  3QKX A;  3T6N A;  3BR3 A;  3TW6 A;  2NX4 A;  5CXI A;  5F27 A;  3G7R A;  3F0C A;  2YVE A;  3HM5 A;  2R5Y A;  1WH5 A;  1VF9 A;  5D1R A;  1XG1 A;  2X6O A;  3HIM A;  2JMW A;  1GDT A;  1ZQ3 P;  3CRJ A;  3PPB A;  4DW6 A;  1QPI A;  1FEX A;  3GTK J;  5EF6 A;  2LP0 A;  3I4M J;  3GTJ J;  2R5Z B;  2XGC A;  1O4X A;  3S14 J;  2IU5 A;  3KKD A;  2M9H A;  4MLO A;  1A6I A;  1ZGW A;  3S1N J;  4HKU A;  1H8A C;  5F08 A;  3BQY A;  1EF4 A;  3C2B A;  2FD5 A;  1T33 A;  2YS9 A;  1W0T A;  2DMU A;  3HTH A;  5EGO B;  3ZOB A;  5E3O A;  1RPW A;  3QPS A;  2CUE A;  5IYD J;  3PO3 J;  5GPA A;  1W0U A;  5HBU A;  5HSZ A;  3HGY A;  1JUS A;  2EH3 A;  2EZL A;  5M3F J;  4RDU A;  3BR1 A;  3Q3S A;  2W53 A;  1JT0 A;  4IHV A;  2ZCM A;  4ACI A;  2M2E A;  1QVU A;  1QRY A;  2EZK A;  2YUS A;  3BG5 A;  3DCF A;  4HNV A;  1MH3 A;  2REK A;  3VVZ A;  2L0K A;  2QF7 A;  1IG7 A;  3HOU J;  5FGL A;  4UUS B;  1U8B A;  4AYB N;  2VKE A;  5FKO A;  1ETK A;  4BBS J;  3BQZ A;  3VVX A;  2OF7 A;  2JA8 J;  2GM4 A;  3VVY A;  2G7L A;  4W97 A;  3RD3 A;  3VUQ A;  1MBF A;  3HTI A;  3V78 A;  2YVH A;  2M0C A;  4IEJ A;  2PBX A;  3G56 A;  4FTH A;  2HXO A;  2TRT A;  2KT0 A;  2WB1 N;  2ME6 A;  2JA6 J;  1HF0 A;  4JP0 A;  3B6C A;  5M5Y J;  2DMP A;  3VOK A;  3EGQ A;  4JL3 A;  5GPC A;  4MFD A;  2DA1 A;  3DEW A;  1POG A;  1B72 A;  3CCY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...