3BTJA

Crystal structure of qacr(e58q) bound to dequalinium
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
186
structure length
186
Chain Sequence
NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEQSKWQEQWKKEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator qacR
publication title QacR-cation recognition is mediated by a redundancy of residues capable of charge neutralization
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription
total genus 83
structure length 186
sequence length 186
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2007-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3btjA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3btjA02
1ZR2A 4GCKA 4UUTA 3ZOBA 1OCTC 4UDSA 1ETKA 2DG8A 1X2NA 5FJ8J 2G3BA 4XICA 2CJJA 1G2HA 2L0KA 1ETQA 2DA3A 2O7OA 3O8HA 4MFEA 2HXOA 4HNVA 1VI0A 2L7FP 3M3YJ 2FJ1A 1B8IB 5EDNA 5D18A 3VVZA 1Q1VA 1POGA 1XC5A 3BR5A 5EEAA 2ZOZA 1WH7A 4JX5A 3V78A 2W53A 2YU9J 3Q0WA 1T33A 1K83J 2L9RA 2ZCXA 3A03A 3QPSA 3MVPA 1OJLA 4GFLA 4DW6A 3IH4A 1B72B 1AKHB 2PZ9A 3LJLA 1ZR4A 1S7EA 3O8GA 2LD5A 1WH5A 5DS9A 5F27A 3C07A 2HI3A 5E3OA 4JX4A 2Y0SN 3ON2A 2UXIA 3HOUJ 3ZQIA 2KT0A 2XSDC 2K9NA 4FISA 1JT6A 2COBA 2R0QC 3HOZJ 3S17J 1QVUA 3CWRA 3JRHA 1RKWA 4A3DJ 4S0HB 2CQXA 2VPRA 2L7ZA 2W48A 4PXIA 1MBHA 3HKZN 4AC0A 2XPVA 2YS9A 2XPWA 1QPIA 3D1NI 2WGBA 5D1RA 2LY9A 1MSFC 2E2IJ 1LFBA 3BG5A 1ETVA 5FHPA 3SFIA 2GM4A 4GFKA 2GUHA 2O7TA 3BR1A 3HOYJ 3S14J 2OF7A 4AYBN 2HYJA 2K9SA 1BW6A 3FK6A 3IV5A 1CQTA 3QQAA 2HOSA 1ENHA 1I50J 3HTJA 3TEDA 1ORKA 4B4CA 2HQ5A 4CGRA 1ETOA 2N8GA 2G7SA 3T6NA 4B3AA 1JKPC 5E3MA 3GTPJ 1NK3P 5E3LA 5C4XJ 1MNMC 2O8KA 3QKXA 4W97A 2XGDA 3JRCA 2B63J 5FLVA 1TWHJ 3BQYA 1EF4A 4B1RA 1GV2A 2XPUA 3HGYA 5IOYA 1ETYA 2JA8J 2M9HA 2DA5A 1WGXA 3PO2J 3G7RA 2CRGA 2YVHA 3EGQA 2EZLA 2LR8A 1D5YA 2R92J 1UHSA 2IAIA 2QF7A 1NTCA 1MBFA 4GCLA 3BR2A 3MNLA 2VUMJ 3VOKA 1TWGJ 4V2FA 3BRUA 1ZTRA 1XS9A 3H0GJ 2DA7A 2EZKA 4A3BJ 4FTHA 3GTGJ 4XK4A 4I76A 2VI6A 4MLOA 4ACIA 2OI8A 1Y1WJ 5FKOA 5HBUA 4C3IJ 3JRIA 1IDYA 2VKVA 2H1KA 5FMPA 2DA2A 2V57A 3JRFA 1UI5A 2QWTA 3NARA 2K40A 2NVTJ 2DG7A 5FGLA 4MXMA 3BTJA 3TP0A 2UXUA 1ETWA 3NI7A 2F07A 1JKQC 2RAEA 3SJMA 4XIDA 2NX4A 4BBSJ 2DMPA 2NS8A 2TRTA 2ZB9A 5M5YJ 1LE8B 5GPCA 1JJ8C 2NVXJ 3K7AJ 4C3JJ 2WAQN 2LVSA 3ON4A 1U8BA 5FKKA 2E2HJ 2GFNA 1IV6A 4XRSG 3LOCA 3S1QJ 2OERA 9ANTA 3E7QA 3IH2A 3JREA 4DZJA 3VW1A 2DA1A 1PUFB 3S5RA 4C3HJ 1P7IA 2FQ4A 1W0TA 2L7MP 5HODA 4MFDA 2Y30A 2ME6A 1SGMA 3WHCA 1DU0A 1ZGWA 2EZIA 4A3FJ 4JL3A 2XGCA 3HTIA 3RD3A 3E7LA 1AKHA 1B72A 5GPAA 5F08A 4UUSB 4D5FA 4XRSA 1WCMJ 3RKQA 1OFCX 3MKLA 4JKZA 2HDDA 1TWCJ 2EBIA 1A6IA 3LSGA 2RHAA 1JT0A 1XG1A 5IPAA 3BR3A 2ZOYA 3WHBA 1MH4A 4DZPA 4M3DA 4RDUA 3CQZJ 3HDDA 2Q24A 2UXPA 3NRGA 2MGQA 5AQCA 3VW0A 2WUIA 4IHYA 4MIMA 5IYCJ 4IHVA 2XB0X 4NDLA 1APLC 2ZCNA 4IHWA 2R7ZJ 2ME0A 3Q3SA 5J1UA 4XRMA 2QIBA 3VVXA 2Y31A 4X6AJ 1U78A 2QKOA 3DEWA 3K2AA 4CYCB 3LWJA 1GV5A 2G7GA 2I10A 4DYCA 3HE0A 2QCOA 5CXIA 1SFOJ 1GDTA 5EGOB 5M3MJ 3DCFA 1HOMA 3OIOA 1JUPA 1U9OA 3A02A 1TWAJ 2E19A 3A01B 3GTJJ 5GP9A 3OSGA 2JA6J 3S16J 2JA7J 3S15J 1FTTA 3MN2A 3BCGA 2E2JJ 1TC3C 2MW8A 5JLWA 4FCYA 2AHQA 3V6GA 3QPLA 3HGGA 4FE4A 5K7FA 3KKCA 5HAWA 5CW8A 4BXXJ 1BA5A 4JX6A 2ZCMA 1JKRC 2VKEA 5M5XJ 1HDPA 2DA6A 3GBGA 3NNRA 3BJBA 2ID6A 5DTDA 3GTMJ 4IHXA 1RR7A 3B6AA 4M3FA 2NVQJ 5JLXA 3GTKJ 1RESA 4X1EA 3S1MJ 4AC6A 2E1OA 4YZEA 3O60A 4BBRJ 1HLVA 3JRAA 2HOAA 4C2MJ 2JN6A 3JR9A 4IEJA 4AUXA 3JRBA 1ZQ3P 1ZKGA 1LFUP 3GEUA 2Y9ZA 5FKLA 2M2EA 2R5ZB 3L1PA 2JWTA 4W1UA 3CJDA 4NELA 3BR6A 2QTQA 1HDDC 1VFCA 3BTLA 3NAUA 2DMUA 3VW2A 3BQZA 2RASA 1H88C 3KNWA 4A3KJ 5J1RA 4BY1J 3DPJA 4Y7NJ 5C44J 3LSJA 5FKMA 1LE8A 1GVDA 4A93J 1JUSA 1T56A 2GBYA 1F36A 1MSEC 2R5YB 3VPRA 1E3OC 3F0CA 4L5EA 1HF0A 3VVYA 2UXHA 2XB5A 1MBKA 4HKUA 4Y52J 1JJ6C 5F1JA 1IC8A 3VP5A 2DN0A 3ZQFA 3LSRA 5D19A 1MBJA 2HYTA 1PUFA 3TP3A 4A3IJ 2X6OA 4DYQA 5C3EJ 5DAJA 4ABZA 3ZQLA 1X58A 4M3EA 5F04A 2MG4A 2JA5J 2NS7A 2WB1N 1IRZA 3LSPA 3RH2A 1Y1VJ 2DTZA 2JJ7A 3VIBA 4UUSA 1B8IA 1IUFA 3NXCA 2LFBA 1QRYA 4A3MJ 1H8AC 1UI6A 3LNQA 3HTAA 3BTIA 4QSHA 4QIWN 2ID3A 3Q0VA 5FKNA 3Q0UA 1BJZA 3BG3A 2DA4A 3HOVJ 3RQIA 1Z77A 3G1OA 5BNGA 5C4YA 5EFYA 4M6VA 5K7HA 2REKA 3PM1A 3QBMA 4RBOA 4JP0A 4AF5A 3UKGA 1U9NA 1UMQA 4BKXA 2D6YA 2M0CA 1YRNB 5EG0B 3FKIJ 1IG7A 5F0HA 3TW7A 3ANGA 3AQTA 4ME9A 4LOCA 4CYCA 5FLMJ 1RKTA 3FISA 2DMQA 1P7JA 3I4NJ 4KWAA 5IYDJ 5EGOA 3W6VA 3COLA 2DMNA 1QVTA 2M8GX 3IH3A 1AU7A 1O4XA 3SDGA 3JRGA 1H89C 3BT9A 2ECBA 5C4JJ 3A01A 3GTOJ 1X2MA 2NP5A 2PMZN 4MO7A 2TCTA 1SANA 3BNIA 4A3EJ 2EH3A 2LP0A 2ELKA 3B81A 2WV1A 2NOGA 5CXGA 2X9DA 3CCYA 1I3QJ 2LTPA 3VOXA 2FX0A 2EZHA 3HIMA 2CUFA 5EZGA 2R93J 2HOTA 3I4MJ 1MBGA 1IDZA 3IUVA 2QOPA 2P81A 1JKOC 1K61A 3PO3J 2LK2A 3S1NJ 3RZOJ 3PASA 2MSYA 3OOUA 3GTLJ 4D7MA 1OCPA 1VNDA 4G12A 4A3CJ 3LHQA 2LKXA 2ECCA 2YVEA 3G1MA 1GUUA 2FBQA 3S2DJ 4D5CA 3F1BA 3VUQA 2Y2ZA 3H3VK 4EEFG 5IP6A 3ZQGA 4A3LJ 5J1YA 4DYRA 1VF9A 1R9TJ 3G56A 1IJWC 3EUPA 2IBDA 2PBXA 3HOWJ 1MH3A 4A3GJ 1RETA 2K9QA 2NVYJ 2R5ZA 3S2HJ 4FE7A 3FIWA 1FJLA 1ZK8A 3GTQJ 5EF6A 1I6HJ 2IEKA 1ITYA 3JSJA 2YUSA 1WPKA 5M3FJ 3B6CA 3CRJA 2EQRA 2JMWA 1FIAA 1RPWA 2M34A 1JGGA 4A3JJ 1BW5A 2IU5A 4J19A 3ZQCA 4JYKA 3RZDJ 1UG2A 5J3LA 5IP7J 5E3NA 3CDLA 3HEFA 3GZIA 1JTXA 2R5YA 1F43A 2GENA 3HOXJ 2G0EA 1JTYA 2DJNA 3BTCA 4V2GA 3ZQHA 5IOZA 3HM5A 5F0FA 3C2BA 4D7NA 3FK7A 4A69C 2G7LA 2UXOA 2CQQA 5EZHA 2XDNA 5M5WJ 1ETXA 4M3GA 2HKUA 4ICHA 5F0CA 4GFBA 1DU6A 1JUMA 1NK2P 1WI3A 1BL0A 1HCRA 3ANPA 3HBLA 3BHQA 3HTHA 1Z0XA 5H9TA 2GLOA 3BG9A 2XRLA 2KDZA 1A5JA 2OPTA 3G1LA 5IYBJ 2O9LA 2H8RA 3NPIA 3JRDA 3M4OJ 4MK6A 2NP3A 1AHDP 5EYRA 5IP9J 2X48A 2DMTA 3S1RJ 4BY7J 3OSFA 2D5VA 5HSZA 5K7ZA 2XGEA 3BR0A 1IGNA 2FD5A 1GT0C 3FRQA 1W0UA 1FEXA 4JNNA 1YRNA 5EG0A 4QTRA 4I6ZA 3CMYA 1FTZA 4L62A 3PPBA 2JK3A 3AQSA 2Y9YA 3KZ9A 3P9TA 1FIPA 3TW6A 2AO9A 2HXIA 3HB9A 4M3BA 2LLKA 3KKDA 4GCTA 4NN1A 1TWFJ 2CUEA 1MBEA 2CU7A 5K58A
chains in the Genus database with same CATH superfamily
4Y4RA 2KIFA 1OCTC 1ZGAA 1VQ5I 4UDSA 2DG8A 1X2NA 2LRDA 4XICA 1ON2A 1GT0C 1ETQA 2IA0A 4JNNA 3DKWA 4HNVA 1VI0A 2FJ1A 5A2QZ 1POGA 2JVHA 5EEAA 4JX5A 4RAFA 3V78A 1I27A 3Q0WA 2YU9J 1X4PA 4KA4A 1LQ1A 2DJIA 4NB5A 1V54H 5TJJA 3MVPA 1OJLA 2RGVA 3WE2A 4GFLA 2MA3A 2QVOA 1OYWA 2ADUA 3S3OA 2BVMA 3V4GA 1S7EA 2YVXA 4BGDA 4OOIA 2LD5A 5F27A 3GFMA 3C07A 2UXIA 3HOUJ 4YG2F 4LGWA 2COBA 3S17J 2Y0SA 4HBLA 3KCCA 5JI6A 2WTEA 1WSUA 4BQAA 3MZYA 1X3UA 3BPVA 4A3DJ 1MIJA 4AM3A 4CCLA 3R4KA 5H6RA 2EFWA 2L7ZA 3R60A 1I6XA 1O3TA 2HNHA 5CQGA 1VQOI 5K5QA 3O3KA 3QP6A 2HGCA 3L2QA 4PXIA 1MBHA 3HKZN 3I9V2 5D6EA 5EEGA 4RB0A 2BY2A 2XPWA 1EH8A 3ZMDA 3D1NI 1H9TA 2M7BA 4QWQA 2WGBA 2D1VA 1LFBA 2WY7Q 1R5HA 1OLTA 4YIFA 4AYBN 4XLCA 1CQTA 2JUGA 1SD7A 3HTJA 3JTHA 3VYRB 2KRCA 2HQ5A 2ISYA 2M1BA 4B4CA 1B1BA 3V7SA 4A6DA 5LBQA 5EJCA 1P4XA 2MC4A 2BV6A 5E3LA 4W97A 3ECOA 3OYGA 1Z3XA 1FWZA 3K4LA 4HLXA 2L9NA 3HGYA 5IOYA 4ENNA 3ASOH 5JHUA 3VYUB 2M9HA 2YVHA 3EGQA 2O3FA 2KIUA 5FLXZ 5FROA 4I01A 1T8IA 4XKBA 4GCLA 4EQQA 4XOPA 3WODF 5J47A 3QOEA 1TWGJ 4V2FA 3BRUA 3DPUA 1OR7C 3F72A 3KYCB 1O7FA 1WFXA 1FY7A 4I76A 4CSWA 2VOPA 1Y1WJ 3RYPA 1QA6A 2K85A 2WADA 4BE2A 5HBUA 5TGTA 4LG0B 1ZG3A 3JRFA 1MNEA 1UI5A 1SVMA 3QAHA 2A5YB 1QBJA 4RGUA 3F23A 2DXIA 4LIVA 3TQNA 5F6FA 3OYBA 3H3UA 5GTHC 3RIRA 1YQAA 1JKQC 4RAZA 1VTNC 2X1EA 4E7KA 2NOJB 1P6RA 2XAUA 1XCBA 1XN7A 3WTWC 5BPDA 1HKQA 3GFIA 3K7AJ 3OL3A 3C2GA 4C3JJ 1U8BA 5FKKA 3I3LA 4OAYA 3WG9A 2ZKZA 1XSVA 3EDPA 3CO7C 2EFOA 4YIRX 1WHUA 4GYIA 3E3VA 5DCFA 2L7MP 5HODA 2XDVA 2Y30A 4FT8A 4A5MA 1SGMA 2IJLA 3WHCA 2GAUA 1EH6A 2XASA 4DQ2A 2IT0A 5L3FA 1Z7LA 1T6SA 1W7PA 2PFVA 1AKHA 2R7WA 2IVMA 1J75A 2Z1DA 3J80K 2WAEA 5DV5A 1RIOH 3GO5A 4E7LA 1OFCX 1TWCJ 3TOAA 4ZYEA 3LSGA 4BE1A 2ZXHA 1SFKA 3DKYA 3LFKA 2WAFA 1XG1A 5IPAA 4DZPA 5AQCA 3CQZJ 1H9GA 2AXTC 1ULYA 3CP8A 2DDAA 2HOEA 3ZMSA 1U6GA 2NS0A 2ZXJA 3M8FA 3SEZA 2ZSIB 3DP7A 4LIUA 1X1BA 2NXNB 4HSRA 3Q3SA 4XRMA 5J1UA 5FB2A 1BN5A 1XX5A 4XKCA 4XQFA 4ZYHA 2EILH 1U78A 2HDCA 2KZGA 3DEWA 4YRVA 2G7GA 1YX3A 3HE0A 1SFOJ 1KU7A 4II2A 1FSEA 1X3ZB 2L9SA 3T1BA 4C30A 1Z1DA 1TWAJ 3OSGA 2O6GE 2KZVA 4CCNA 2ISZA 1X1AA 3BJAA 1FTTA 4BACA 4HPQA 1TC3C 3FXLA 4LITA 5FD6A 2IXSA 2WC2A 3HG9A 2JSCA 2ETHA 1DDNA 4JBAA 3KKCA 3F9KA 1XGSA 3CCJI 5FRMA 1ZH5A 2GXBA 1IRGA 1PJRA 1BA5A 2FE3A 3I55I 4R79A 4LB5A 3IAM2 3VSLA 2QSFX 3GBGA 5B66C 4XKVA 3NNRA 2NNYA 4S04A 2IGKA 3BJBA 2ID6A 2CMPA 1HQCA 1D8JA 3DU6A 1LDDA 3I59B 3LSIA 4PK4A 4X1EA 1E3PA 3EUAA 3H0DA 2P6SA 3QOPA 5F64A 2XV4S 2QGUA 3F22A 1V5FA 1ZG5A 3D5RC 5GTIC 1ZGJA 2COMA 4P5OA 4GDFA 3KE2A 1S29A 2K5CA 4KT6A 1Y6IA 1ZKGA 2UXNA 5KNLA 3E97A 1WJEA 3CJDA 2BBYA 4RGSA 5DM7F 3NAUA 3I58A 3ZN1A 2R7UA 2RASA 5CKTA 5E8GA 4I0BA 3FMRA 4KJZA 4ZDPA 4G7ZF 3KNWA 5K5OA 2E1MB 2FBIA 1HKSA 3CCUI 2D45A 1X1CA 1LE8A 1GVDA 2GZWA 2O61A 3QPHA 1JUSA 2L5QA 3FXMA 4RS8A 4WX9A 2EV0A 4S05A 2R5YB 1E2XA 3VVYA 1R5ID 1PP7U 3S3MA 2AQFA 4Y52J 5F1JA 1IC8A 1ZLKA 3ZQFA 2ZNZA 3Q9VA 5D19A 1MBJA 2HYTA 3P9KA 1PUFA 4ENMA 2X6OA 4DYQA 5HLTA 3LSMA 3M1EA 3E5QA 1K7AA 3A0BC 2XKOA 2BGCA 3GZ5A 4ABZA 4IX7A 4HQMA 3LQQA 4IRHA 4M3EA 5F04A 1K4SA 2JA5J 5A2QK 5HDGA 3RH2A 1Y1VJ 2JJ7A 1S6LA 2M30A 3FXKA 1IN4A 2CO5A 4M6YA 2R7TA 1IUFA 2WB1A 3NWTA 1UI6A 2R7SA 4HF2A 3BTIA 1Z3YA 4QIWN 1DGWY 5HLHA 5FKNA 2VODA 3Q0UA 1ZRCA 3BG3A 1WQ2A 1RC9A 3K4BA 1Z77A 2YR2A 3G1OA 4AWXB 4M6VA 3QU6A 1UB9A 2REKA 2KISA 4RBOA 4WCGA 4LLGF 1E3HA 4U0VA 3UKGA 1U9NA 1FOKA 4XSXF 2I8DA 4I02A 5CJ9A 2D6YA 5EG0B 3FKIJ 3I4PA 3H92A 3LQRA 5ILVA 1F1ZA 4CYCA 2PJPA 3U9GA 5HLGA 1RKTA 1R4NB 1MMSA 3FISA 1K78A 4KWAA 5EGOA 3TDUC 4HV6A 1NHAA 3CCSI 5ICFA 3JRGA 3L2UA 1X3WB 2HZDA 1X2MA 3RJPA 5HVQC 1YS7A 2E5ZA 4XLNF 1TW3A 2ZO4A 3G2BA 2TCTA 3F8BA 4I99C 2A05A 2EH3A 2ELKA 3GWZA 2H94A 2V4JC 5CXGA 2HKXA 3CCYA 1P2FA 2BY3A 1I3QJ 3KLOA 3VOXA 5D5XB 2EZHA 4N0BA 3U1DA 2XF5A 5EZGA 4RB3C 3IWZA 2IP2A 3VSKA 4HDUA 2QOPA 4WXHA 4D1QA 1JKOC 1FP1D 4CHUA 2LK2A 4RM2A 5EEHA 3ECHA 1YW8A 2MSYA 3OOUA 2V6EA 4J01A 4XMYA 3GTLJ 4D7MA 2W25A 3AG2H 1VNDA 3M9AA 2IA1A 3LHQA 1TNTA 1UFMA 2LKXA 1BBYA 1Z7UA 4KFCA 5E1XA 3ZCOA 2XAFA 3AG4H 2ZSHB 4XM3A 3S2DJ 2FBQA 1LKXA 3FBNB 3CESA 2Y2ZA 2FA5A 1GXPA 3HSRA 5LFAA 2KMUA 1STZA 4PUSA 3CC2I 1W5TA 5L3BA 2F2EA 1OQYA 4HA8A 4E7ZA 4A3GJ 2K9QA 3S2HJ 2R5ZA 3FIWA 4NUBA 2ZMEC 1ZK8A 1YIOA 2LDUA 1AWCA 1FJLA 2WA0A 3GTQJ 1I6HJ 1KA8A 2VXDA 2YUSA 4BYYA 2VB6A 1VZ0A 4CO8A 1FIAA 1RPWA 1JGGA 4ZYDA 2V1XA 2IU5A 4J19A 2KRFA 3ABMH 3RZDJ 3F8NA 2EA2A 2PG4A 3CDLA 3FHNA 3GZIA 3K1MA 1QGPA 2UV1A 3JAMK 2V1DA 1KGSA 4MTDA 1ONVA 3P5JA 1Z91A 3ERMA 5HDKA 1W5SA 2ZFUA 4HX7A 2DT5A 3RSNA 1VQNI 4V2GA 2VE9A 2F48A 2E1CA 2I5UA 5IOZA 3UR3C 3DBRB 5EZHA 3GZNB 3KPHA 5KVRA 4U7BA 2HKUA 3HRTA 1JUMA 3ZN0A 1I5ZA 4KN7X 1HCRA 1O3RA 4KMUX 1J09A 2LC2A 3CCMI 5H9TA 2VC1A 5E79C 3F8MA 1A5JA 4CZZA 3G1LA 2O9LA 2VQLA 3M4OJ 2RNJA 1OCOH 5IP9J 2X48A 2DMTA 3S1RJ 4LLNA 4I09A 1QZZA 2DT7B 3RDIA 1TW2A 3K4JA 1IGNA 2L4MA 2YPRA 3IC7A 2FD5A 1G59A 3FRQA 1T08B 2K3PA 1D0XA 5LHHA 4JOMA 4J00A 4IOCF 2Z16A 2QENA 3E1SA 3ZQQA 2EINH 3CMYA 4I6ZA 3I53A 2K9MA 4L5JA 5D5WB 1A6QA 1BOBA 5KCMA 1IUYA 1IZ1A 3ROUA 1GLNA 4M3BA 1BI1A 5GAGJ 1P9QC 3C1DA 5BOXA 2DAOA 3Q9SA 1MBEA 1ODDA 2MBFA 1PP8F 1IRFA 4AIKA 1ZR2A 1WKMA 3ZOBA 4KYWA 3EQLF 5BS6A 1I1SA 5FJ8J 2G3BA 3OYCA 3TKYA 4CGZA 1J0RA 4PSXA 4MFEA 3KP4A 3J7YJ 3CC4I 4A0XA 1XC5A 1XMXA 3BR5A 2F4MB 3BZCA 4MQ9F 2ZOZA 1WH7A 3CCQI 1NG7A 2VT2A 3MCZA 2VASA 5CVRA 1K83J 1YITI 2ZCXA 3A03A 1W7PB 3QPSA 1AKHB 3IH4A 2PZ9A 2GIVA 4PJMA 4UUVA 3OYDA 2OV7A 2HKOA 5DYMA 4OD4A 1OKRA 4P96A 3A0HC 5FD5A 2HI3A 3ON2A 4A0ZA 1SFXA 4YEJA 2XSDC 4RGXA 2X51A 1K79A 3DV8A 2IGOA 1W4MA 3HUGA 4AIHA 2ICWG 3ABKH 1JE8A 4RMNA 4B3XA 2ZCWA 3PNVA 2QEXI 1UHWA 3CLOA 5JVGF 1QQIA 2XPVA 3HXLA 4XLEA 1QPIA 1BI0A 2JT1A 2CG4A 2LY9A 4GCVA 4YELA 5DD4A 3BG5A 2E2IJ 2M87A 3C18A 1R1TA 2W82A 3LFUA 3DWLE 3SFIA 2GM4A 1W7PD 2KPMA 1BW6A 3IV5A 1S9HA 2VBZA 2DT6A 1RUOA 1I50J 3IHUA 1ORKA 2X1CA 1ETOA 2N8GA 3W2AA 5ILSA 1JKPC 2HR3A 3ABLH 1NK3P 1B6AA 3QKXA 2VXZA 2XGDA 3JRCA 4M72A 4BHCA 2B63J 4UNOA 5FLVA 1G8XA 3KFWX 5DD8A 1HA8A 1FOXA 1FX7A 4B1RA 4BAYA 4HLYA 4E7HA 3ZGKA 4Z2YA 2OUMA 1J59A 1RUNA 1K6OA 2DA5A 3PO2J 3OYJA 2B3WA 2CRGA 1OCRH 3J81K 2B1EA 3G7RA 1TNSA 2EZLA 1D5YA 2IAIA 2WY8Q 1MBFA 3BR2A 4KIGA 3CCLI 2XVCA 3CLQA 5F1RA 3VOKA 3SZGA 2CH0A 3K70C 5DEQA 2DA7A 4ENJA 4FTHA 3GTGJ 4CICA 4XK4A 1FNNA 2XUBA 1ERDA 2OI8A 1ACIA 3HHHA 4KUMA 4B47A 2R4GA 4C3IJ 1IDYA 2FNAA 2VKVA 3H5RA 2H1KA 4UVAA 4HOBA 4C2UA 3T0YA 3QPTA 2F6CA 2DG7A 3K8PC 4PGGA 2RVCA 2GA2A 3S3NA 1KZHA 5CPRB 3AFHA 4AC0A 4M71A 3NI7A 1V4RA 2F07A 5HDNA 3GZ6A 2RAEA 3SJMA 3CDHA 5HOOA 5LEJA 4MHGA 4G94A 1FZPB 5DUIA 2DMPA 2DK5A 2ZB9A 4Q47A 5M5YJ 4L5IA 1LE8B 2QYOA 1FC3A 2DU9A 3ON4A 2XF7A 2WAQN 2ZXIA 2XROA 1FBSA 1WZ2A 1P4WA 1GHCA 3LOCA 2MC3A 1USSA 9ANTA 2ELJA 2V1UA 1YO5C 1YYVA 4L9VA 3S32A 5B1BH 3JREA 1MD0A 1S7AA 1PUFB 2E34A 3S5RA 1W0TA 3T8RA 1EKEA 1KU3A 4Q4ZF 1T98A 4MEXF 3D5SC 3M8EA 1DU0A 3ELKA 3CJNA 2EZIA 2OZUA 5FFZA 3WTVC 2KLOA 4HYEA 3HTIA 3RD3A 3E7LA 5GPAA 1KQ8A 3DTKA 4D5FA 5DCMB 2LBFA 3CTAA 4M9XA 4L9JA 1WCMJ 3RKQA 4A5NA 1Q1HA 2HDDA 2EBIA 1A6IA 2F5FA 1JT0A 3W6JB 4E4HA 3BR3A 3X2QH 2ZOYA 3HDDA 4RDUA 2VBWA 1REPC 4L18B 1G6NA 1HBXG 2MGQA 2WUIA 4IHVA 2LMDA 2Z99A 1WJAA 3ZMZA 4NDLA 1KYZA 1YW9A 3L2RA 2ZC2A 4IHWA 2XAQA 3MKZA 2FRHA 3PIOF 1H0MA 2HS5A 2R7QA 3PQJA 4UVBA 4X6AJ 2J5OA 1LDJA 2Z33A 4CYCB 3LWJA 1GV5A 1RZ4A 3U1KA 3FZVA 2B9SA 1HC8A 3OYKA 1K78B 4LLLA 2IS4A 3M1CA 4P1WA 5EGOB 2F5DA 3WU1B 1JUPA 2X85A 2EK5A 2L7KA 1VQ7I 2OTLI 3GCMA 4GYGA 1BR1A 3F8CA 2VQCA 2ZMEA 3VFZA 2TDXA 3S15J 2LKSA 3MN2A 3BCGA 2E2JJ 3VWBA 3H5NA 3N97A 3P9CA 4BDYA 2P5KA 1YX5A 3VEPA 1N25A 2AHQA 3DPTA 3CJQB 2LREA 2P0WA 2FU4A 3H3ZA 3BOQA 2OD5A 4BXXJ 5CW8A 1MZBA 2ZCMA 2GOMA 2K3FA 4F7ZA 4RB1A 3MD2A 2VKEA 1HDPA 3W2WA 4WIBA 1YLFA 5KK1A 5FRNA 2E71A 1F9NA 4HF1A 3QRFF 2HVQA 3CF2A 4M3FA 3VTIA 3C2HA 5D8LB 1O7LA 3HHGA 3HYIA 3CMAI 2UUZA 2ZJPF 2PQ8A 1BOAA 2R7FA 3QYFA 2E1OA 3QODA 1HLVA 3JRAA 3RKWA 2XRNA 1BC8C 2V79A 2JN6A 1WJBA 1SMYF 3RKXA 3HRUA 1MMNA 3GLLA 2Y9ZA 5FKLA 2R5ZB 5TISC 1W5CC 5CVIA 3A1YA 2FJI1 3NRVA 4Y33A 1HSJA 3LSTA 4A3KJ 3BZKA 5LEKA 5J1RA 4ZJZA 3HTUA 3DPJA 1J2XA 2LNBA 3DBHB 2E7XA 4BNCA 4A93J 1J5YA 2GBYA 2L01A 3F0CA 3ISPA 3JAMZ 2FOWA 2XB5A 1MBKA 2DDBA 1JJ6C 2H09A 1VQMI 4UXNA 2QUFA 2ESHA 4NBQA 1BM9A 5DAJA 2MG4A 1D0YA 2NS7A 4RA2A 3R6SA 3LSHA 3LSPA 2P4WA 2DTZA 3KYLA 4E6KG 3TO9A 3DLAA 4BQNA 3NXCA 1QRYA 2PMHA 3WG7H 3Q0VA 3SFZA 2VOOA 1L3LA 1IN6A 1R00A 2DA4A 1T95A 3LAPA 2LKPA 2KJBA 4NC7A 5EFYA 3CMMA 3LA7A 5K7HA 5AONA 4DJAA 3ERED 3PM1A 1WJ5A 3VYSB 1Z6RA 3C3WA 2XKPA 3I5UA 4NQWA 5F0HA 3TW7A 2Z5UA 3ANGA 4ME9A 4XN3A 5FLMJ 2JPCA 2DTRA 2GQQA 2DMQA 1P7JA 3I4NJ 5IYDJ 3F8FA 3WE3A 4XLHA 1QVTA 4RLQA 2M8GX 3IH3A 3MKYB 1AU7A 4U7DA 1Y8QB 2M8EA 1O4XA 2EB7A 2VKDA 1H89C 5J40A 3BC8A 2NP5A 3V7RA 4BE0A 3KP6A 2X6YA 1SANA 3OIQA 1DGRM 3K4KA 2BW3A 4WF2A 2A07F 2PMZA 3HTSB 1F4KA 3B81A 2WV1A 2NOGA 2FUG2 2HTSA 4EVIA 2X9DA 4IKFA 1DP7P 2LTPA 4DNCA 1EV7A 2M4KA 5CVUA 5L3CA 2R93J 1IDZA 2VN2A 3IUVA 3JTGA 1K61A 3PO3J 2STWA 1LVKA 2IA2A 4B43A 2Q1ZB 4A3CJ 2V9PA 1IF1A 1YHQI 3G1MA 4D5CA 3HUGB 4EEFG 3HOTA 1TT5B 2W84A 1Y8RB 3LA2A 5IP6A 4XL9A 3SYTA 1KONA 2XIGA 4GO1A 1VF9A 3IUOA 2DYRH 2BYVE 4G7HF 2QBYA 2DQRA 3HZJA 1BI3A 3MKWB 3HOWJ 4I0AA 4EM1A 3FXQA 1B9MA 2A5WA 1ITYA 4MEYF 3JSJA 5M3FJ 1U8RA 3B6CA 3KX2A 2EQRA 2DFIA 4G6DA 3S2WA 3V8LA 4A6EA 2ZY9A 2M34A 4A3JJ 1UG2A 5J3LA 3SDBA 3IKVA 4PCQA 4E7JA 4IRIA 2Z3YA 4ZZDA 2O5RA 3VDXA 3NQOA 2YX4A 1F43A 3D5LA 4B48A 3HOXJ 2G0EA 4AVZA 2X0LA 2V1NA 4ZH4F 2L4AA 1D3YA 2DJNA 3K6GA 3LMMA 1TTYA 2BOLA 3HM5A 4MGRA 3C2BA 4D7NA 3FK7A 2G7LA 2UXOA 3HSFA 2F4IA 2L9VA 1O3SA 2XDNA 4OWRB 4ICHA 3J81Z 3OS1A 1DU6A 1MMDA 4D9JA 2HPMA 1WI3A 3LSKA 3R61A 1BL0A 3PL8A 2CV1A 4ESBA 2EPFA 4HDVA 3HBLA 4H0EA 3H9GA 2FXAA 2P8TA 3AG1H 2FMYA 3K9TA 3LA3A 1Z0XA 2VBYA 3HL2A 3BG9A 2KL4A 2OPTA 2MABA 2MFZA 5IYBJ 3L2WA 3H5AA 3GMEA 2H8RA 3NPIA 2VC0A 1AHDP 1ZLJA 4ZZLA 2IGNA 5LRRA 3TL4X 2OC6A 1P92A 3PNTA 5DCMA 5HSZA 1O3QA 5HNFA 1R1UA 4AD9A 2GXGA 2PI0A 1XSDA 2ELHA 1W0UA 3I0TA 2JSPA 2GA1A 1YRNA 2OA4A 1DPUA 3WTZA 2HPIA 3K4MA 3AQSA 2Y9YA 3KZ9A 3CJRB 2AO9A 2OCEA 3HB9A 4BQQA 3F21A 3KKDA 5L3EA 3TO7A 2HEOA 3D0SA 2RC4A 1Z05A 4HF0A 5JR3A 1S8NA 3CD6I 4GCKA 1JXSA 4UUTA 2DCEA 2VJ4A 3ABTA 4BS9A 1MJAA 5J6XA 4CH7A 1G2HA 2L0KA 2O7OA 3H36A 4MNUA 3SZPA 3M3YJ 1R58A 1FLIA 2L7FP 3VVZA 5D18A 1B8IB 1XDSA 4JQFA 4OINF 1Q1VA 3EETA 2DOFA 1X1DA 3FHZA 4FHTA 2F5VA 3F6OA 4C2MA 1T33A 2L9RA 4BH9A 2O8XA 1R1VA 4B8XA 2KKOA 4DW6A 3CCEI 1G3YA 1GVJA 1ZR4A 4P9UA 2J5PA 2XC7A 2LBFB 4YFNF 4EATA 1WH5A 3JSOA 1EJ9A 3J7ZI 5E3OA 3ZMTA 4JX4A 2Y0SN 4XORA 2PFBA 2KT0A 3QP5A 3QYEA 3HOZJ 1QVUA 3CWRA 3T5XA 1D0ZA 1YS6A 2OCCH 4BUPA 1HKTA 1RKWA 2YU3A 2CQXA 3FKJA 3WGHA 1U3EM 2LOOA 2OJED 3KEQA 2CYYA 2E35A 3OYHA 1T2KA 5ERIA 2AXLA 4BJ5C 2YS9A 1VQ4I 5LD2C 2R7DA 5D1RA 2JA2A 3HKZA 4H4KC 5FHPA 4GFKA 2GUHA 2O7TA 2JRMA 1IV8A 2HYFA 2EA4A 3BR1A 3IRRA 3S14J 2NYXA 3FK6A 2HOSA 2KDOA 3QQAA 1SEUA 1LEBA 1SVLA 2K7LA 4CGRA 2LYCA 5CVJA 1VQKI 2W57A 2G7SA 2FF4A 3T6NA 2ZMEB 2ZJQF 4B3AA 1QO0D 3R0AA 5LHGA 4OD5A 5C4XJ 1FBUA 1MNMC 1T0FC 2YSRA 3ONQA 1V3FA 1SD6A 4DOZA 2JRTA 1R6RA 1EF4A 2XPUA 1XPXA 2RNGA 1HSTA 1ETYA 2FBHA 3FX3A 4KIBA 2D1HA 5E20A 4ZDOA 1OYIA 2LR8A 1FP2A 2EV6A 2NAZA 1UHSA 1RI7A 1NTCA 3HSEA 2BXYA 1ZAOA 3GFJA 1ZYRF 2VUMJ 3KZZA 3BZ6A 4LK1F 1XSXA 2WWYA 3PFIA 1ZRFA 1XS9A 2OQRA 1F5TA 1MGTA 4CCMA 3GEZA 4MLOA 3BP8A 4ACIA 1WRJA 2P5VA 1P4AA 3H35A 5FKOA 3JRIA 2O03A 4OIRF 5FMPA 2DA2A 4Y3OA 4CUGA 4DGWB 1TP4A 4UV9A 3OYAA 3BWGA 2EV5A 3NARA 2QWTA 2JTVA 2A3SA 2NVTJ 3S93A 3VB2A 3BTJA 3OYFA 2UXUA 1LEAA 4HNUA 3BCBA 4HZFA 4HEA2 4EGYA 3WGGA 3FF5A 3E5UA 1J7KA 5TRDA 5CVVA 2NS8A 1JJ8C 5GPCA 2VPLA 3KZYA 2LVSA 2M3AA 2MH2A 4KNYA 4B09A 3GUDA 2GFNA 1IV6A 4XRSG 1FOYA 3I71A 1BR4A 3DKXA 1YTYA 2EWNA 2ZNYA 4BQOA 3IH2A 3VW1A 1R7JA 4C3HJ 2FQ4A 2FSWA 3CUQC 3EPZA 1XMKA 1D1AA 2M5WA 4TV7A 4IRGA 4B44A 4JL3A 2XGCA 1B72A 2V26A 2DO7A 4OU0A 4PJLA 4GRIA 2W7NA 3BJ6A 2M7AA 2PN6A 4XRSA 2A68F 1TQMA 3DXJF 4IO9F 4JKZA 3CDIA 3GFLA 3H9QA 1BIAA 1MW7A 1IO2A 2HU9A 1YIJI 1MH4A 2UXPA 4OIQF 3VW0A 2X1DA 2RDPA 4PJ0C 4PZJA 3MZHA 3KEOA 3CP2A 4IHYA 1J9IA 2PMUA 3NS4A 2Q0OA 1FMVA 1I1GA 1APLC 2ZCNA 3IL2A 5K5RA 2L2OA 4G7OF 3IAS2 3TDZC 3KETA 1CF7A 2M4GA 2ME0A 2G7UA 5D4RA 2MH9A 2JQ7A 2Y31A 4NQWB 2VL8A 4Y13A 4MTEA 5K1YA 3ZP5A 2I10A 2QCOA 2R7OA 4AIJA 1WI9A 1GDTA 1HOMA 1I3AA 3DCFA 3J7AY 2PEXA 4IHTA 1U9OA 3OYIA 2R7XA 3WTTC 2E19A 3GTJJ 5GP9A 5GAEJ 4ENKA 1LVAA 3HIFA 3RCOA 3JCUC 4U0YA 2MW8A 6PAXA 2BW3B 2HVRA 2HYGD 5HNHA 3GYHX 1R71A 4FE4A 4HX8A 4R8HA 5K7FA 1ZARA 1XD7A 2DFEA 2CW7A 4JX6A 2KHMA 1JKRC 2BEOA 3ULQB 2CV2A 2EJRA 2CW0F 2Q2EA 3JW4A 2PJRA 3OYMA 3ZR8X 2W00A 5KHDA 5CYVA 1JGSA 2E36A 3GTMJ 2QSGX 2CS3A 4IHXA 3B6AA 4X0GA 5JLXA 1IW7F 3GTKJ 4F93B 1W36C 3S1MJ 3WTYC 4G6QA 1FPQA 4BBRJ 2HOAA 5H2FC 1QZYA 3O2PE 4FETA 4CCOA 4C2MJ 3JR9A 4IEJA 4M6XA 4AUXA 3L2VA 2QBYB 2CWEA 1TBXA 3DF8A 2CFXA 3OOPA 2JWTA 4BHPA 4RB2C 2BHYA 3PIPF 5LGUA 2DW4A 4KISA 4GXOA 2EIMH 2XAGA 2DMUA 2HQRA 3VW2A 3TOBA 3BQZA 1OPCA 3R0JA 2IW5A 2QA4I 1H88C 4CCKA 4OIOF 3RTRA 3COAC 4WK8F 4PGHA 1F36A 3G3ZA 1MSEC 3VPRA 1TL8A 5DM6F 4L5EA 1HF0A 3BY6A 4IQ4A 4AIDA 1JHHA 2BVLA 1SFUA 4HKUA 5J8CA 3SWHA 1UELB 3DTIA 4G9YA 3CCVI 3RPUD 3BJOA 1BR2A 3K70D 1T39A 5C3EJ 3OYEA 5D8KB 5HS9A 1S3JA 4YFKF 4LG3A 1YE9A 2WB1N 4XLPF 4OIPF 3VIBA 4UUSA 1B8IA 1I39A 2LFBA 4ZC3A 4A3MJ 3M07A 2UZKA 1H8AC 2FEZA 3HTAA 4CA0A 3ZRGA 5IT3A 1S72I 4QSHA 3E6CC 1C0WA 4U9LA 3W2VA 3KP7A 1UZCA 4HQEA 4OMYA 1FMWA 2EIKH 5E17F 2B7EA 3KLNA 2DBBA 4HNTA 3QYBA 4LB6B 1YJWI 2KIMA 3QBMA 3J7AO 2XAJA 4JP0A 1VQLI 4AF5A 4HSTA 2VONA 1UMQA 2G9WA 4IZZA 2M0CA 2HZTA 1KYWA 1YRNB 4BHBA 1KQ9A 2P7CB 2BZTA 2LY2A 2VT3A 1D8KA 4OMZA 4UY8I 1RRJA 2DMNA 1TQPA 1MKMA 1HXDA 4I2OA 3PSIA 2ECBA 5C4JJ 3A01A 3GTOJ 4O3MA 4CDGA 3FMQA 3MAJA 5FGMA 1G3SA 2F5EA 1VQ6I 3N05A 4XKWA 4A3EJ 2HWVA 3L00A 3ZQ7A 3GVAA 4CXFA 1MDMB 3MMYB 2QKLB 3K4CA 1AA7A 2E60A 2JZYA 3DFGA 1T0FA 2O0YA 5CQEA 3KEYA 4P55A 2CUFA 1QPMA 2ESNA 3OV8A 3H9JA 1USTA 5D4SA 2R3SA 5FFXA 4HV5A 2P81A 4XNFA 3TBIA 3PJRA 1U2WA 5HS8A 3S1NJ 3PASA 4XR6A 4WXCA 3HPHA 1N75A 2B0LA 4PDKA 4FQGA 1R4MB 2CUJA 3O6BB 3S8PA 3F1BA 3VUQA 3LAJA 3PUBA 1T38A 3H3VK 4ITVA 4A3LJ 4DYRA 2YX7A 3V7CA 2RQQA 3TO6A 3G56A 2LG4A 1IJWC 2FNPA 2PBXA 2VQHA 2K4BA 4DBQA 4WXDA 1JHFA 4MQVA 5EF6A 3FXOA 2IEKA 4M73A 1LUJB 4BJTA 5D5UB 1R5GA 2E7WA 4UB8C 1V5EA 5ILUA 1Z67A 5JHFA 2GXAA 4UHTA 1Z9CA 4IPAA 2K4JA 4KN4X 3E6BA 3HPGA 4DBRA 1B59A 5JFRA 2V7FA 4IRVA 2NNNA 5B5EC 3B02A 4U88A 2GENA 3CZ6A 3OIPA 3SEQA 3KP3A 3QU3A 3CJTB 1JTYA 4DIQA 2KFDA 5AIQA 3BTCA 1KU2A 3CMEI 3ZQHA 1HW2A 1UG0A 4K2EA 2KJCA 4A69C 4N9IA 1WJFA 3V42A 2X4HA 1ETXA 4NNJA 3GLXA 5F0CA 4GFBA 3E6MA 1N78A 3T8TA 1EH7A 2MD0A 5ICEA 1K6YA 5B3SH 2P5LC 2QWWA 2VQGA 3HJEA 2A6HF 3F3XA 3ANPA 3BHQA 1XTAA 3CUQA 2GIZA 3HTHA 1IXSB 3GF2A 4EV0A 1U0JA 1XGNA 1FYKA 2KDZA 1MMGA 3V8JA 2Y48A 1IXRC 5ED4A 3DU5A 1HW5A 3ZPLA 2OBPA 4R1HA 2K86A 2HDWA 1XMAA 2LH9A 2RREA 2OQGA 4XN0A 1S7OA 4BY7J 1AOYA 2H1LA 2HQNA 3NWSA 4IF4A 3GXOA 3I54A 2DPUA 1TLHB 5FO5A 4QTRA 4IQJA 4C2TA 5AIPA 5E18F 3PPBA 2HFHA 2JK3A 3G73A 4XBFA 2OZ6A 1BJAA 1FIPA 2A69F 3KYDB 5KAIC 3TW6A 2HXIA 3LWFA 3GX4X 4D0PA 1R23A 2LLKA 3HRSA 4BL0B 4GCTA 4NN1A 3E5XA 3MWMA 2K02A 4KIFA 1V55H 3A4CA 2CU7A 5K58A 4U87A 3HRMA 5L3GA 1FYMA 1ETKA 2CW8A 1RNLA 1FT9A 4O5VA 2CJJA 2X6WA 3O8HA 2DA3A 2EFPA 2HXOA 3SZTA 4HRIA 5EDNA 1WJDA 5GADJ 1V5GA 2A6TA 4Q48A 2W53A 2DODA 1IAWA 1G3TA 3GW2A 3CUOA 3IRQA 1B72B 3LJLA 1Y0NA 5BMZA 2VIXA 2X6XA 3RYRA 4ZYAA 5GAHJ 5CLSA 5IT9Z 3O8GA 3AL0B 2RKHA 3KZIC 3AL0C 5DS9A 4Z6YA 3PSFA 3ZQIA 2K9NA 4FISA 1JT6A 2JUCA 2R0QC 2EFQA 3JRHA 1O57A 4IXAA 2FOKA 1EA3A 5DDGA 2BE5F 3P7NA 1K4TA 4S0HB 4A2UA 3DEEA 2VPRA 2HTJA 2W48A 1OCCH 1CF7B 3K69A 2Z9OA 1N77A 3IP4B 1OCZH 2GOXB 4C9YA 3QWLA 1MSFC 3PUFA 1IN7A 1ETVA 5L3DA 2FQ3A 4UB6C 3ML6A 3HOYJ 1U5TB 2QQAA 1SD5A 2OF7A 3RPUA 2HYJA 2K9SA 1U5TC 2XHKA 1ENHA 2L54A 2ZBKA 3TEDA 4IL6C 2XGXA 3WGIA 2CGPA 1ZRDA 5E3MA 3GTPJ 2BY0A 4ESFA 2LF7A 3WU0A 4CYDA 2O8KA 3FM5A 3CCRI 1YJNI 1TWHJ 4NHJA 3BQYA 2M45A 1GV2A 4ZDLA 2LF8A 1FSHA 2JA8J 4BXFA 4PJNA 1WGXA 4EM0B 2DOAA 2R92J 1SMTA 4ESJA 5B1AH 1TQIA 1VQ8I 2QF7A 1X4OA 1XGMA 3FXUA 4Y15A 5H6QA 4KT5C 2E1NA 2QSHX 4XONA 2Q2EB 2CSOA 5E8IA 2PJRB 3MNLA 1IN8A 2DOEA 5LHIA 1YOVB 1WJCA 4I7HA 4KDPA 2K27A 4N4OB 1ZTRA 3H0GJ 3Q5FA 2EZKA 4A3BJ 3K10A 4EJVA 4F3QA 5ICCA 3L7WA 1BIBA 4Y17A 4LD5A 2VI6A 3BG6A 2STTA 4U9NA 3PNYA 5J4VA 1ZREA 4LJZF 2HQAA 3OYNA 2MD5A 3I64A 2V57A 2K40A 1X19A 1L0OC 2PBIA 2QQ9A 2E1MC 5FGLA 1D1CA 4MXMA 4O6JA 5JVTA 3TP0A 4QPOA 3UNGC 1G4DA 4AU7A 2VJJA 1ETWA 3BG7A 3U2RA 4BEHA 4CZCA 1YFHA 4YIIA 1FOWA 5H20A 4XIDA 4F91B 2NX4A 4BBSJ 3OMYA 3EUKL 3EUHC 4FX0A 2TRTA 3RQ4A 2NVXJ 3BPXA 2V9VA 4IHSA 2E2HJ 3RKYA 3S1QJ 2OERA 3HC7A 2WAQA 3E7QA 2QM3A 3MZ8A 1ZG1A 1QHHD 4DZJA 3BROA 2DA1A 1GXQA 1XGOA 1P7IA 2RN7A 5D6FA 5E1ZB 1BI2A 2QLZA 4MFDA 3BCAA 2ME6A 3I56I 4EJTA 1Y0UA 2BXZA 2H8WA 2L3DA 1ZGWA 4A3FJ 5IY5H 2H27A 2BY1A 3ASNH 4ZTJA 5F08A 3A2KA 1MDMA 4UUSB 1Y56A 4PFOA 4EJUA 4II3A 5HLIA 1A31A 2DQLA 3MKLA 2IGMA 4RLFA 2JVGA 2RHAA 2Z2SB 1UHMA 3WHBA 4E7SA 4M3DA 1CGPA 2Q24A 2G7HA 4XOTA 4A12A 4AVPA 4Q5SF 3L09A 4ETSA 3NRGA 2DLLA 4MIMA 5IYCJ 2XB0X 3E0JB 1QZEA 2R7ZJ 2XF6A 1SFEA 4KITB 1LPQA 1PUEE 3AG3H 1E17A 2QIBA 3VVXA 4F92B 2PX9A 1DUXC 1UJ8A 2QKOA 2DFFA 3WTUC 3K2AA 1QHGA 2H6BA 2CUZA 5CXIA 4DYCA 2ZXWH 4E70A 3OS0A 2VLAA 3V8KA 5M3MJ 3MEXA 4BDZA 3OIOA 3FM3A 3A02A 1LJ9A 1OMIA 2K9LA 2OU2A 1D1BA 4GGGA 2Q8KA 4G6TB 5LLQA 3S16J 3A01B 2JA6J 3CO6C 2A61A 1YJ9I 2JA7J 3TMOA 4DVYP 2Y75A 4IVNA 2CV0A 2PLYA 5JLWA 4FCYA 1LNWA 1BC7C 3SXYA 3V6GA 4AYBA 2IS6A 3QPLA 3HGGA 4EMSA 5HAWA 1SC7A 5FLXK 3RI4A 1ON1A 2C6YA 5M5XJ 1IN5A 2DA6A 4ZTFA 3NEUA 5BQTA 1JI8A 1NG6A 5DTDA 1OR7A 1RR7A 4FASD 3MFKA 2NVQJ 1D5VA 3WU2C 2HVSA 1RESA 2RQPA 3OR2C 2KP6A 1MJBA 4QLCU 4KMFA 4HX4A 4AC6A 4YZEA 5E1WA 3O60A 1MJ9A 3SHFA 3WTXC 1OISA 4XSZF 2A2FX 3FXJA 2EIJH 2IS1A 4LG0A 3WTSC 3JRBA 1XCVA 1ZQ3P 3K1PA 3M8JA 1LFUP 3GEUA 2M2EA 3L1PA 4EGZA 3B73A 4XLAA 2R7VA 4W1UA 1PDNC 4NELA 3BR6A 3VYTB 1HDDC 2QTQA 1VFCA 3BTLA 3P9IA 2CQKA 1SAXA 4BY1J 4Y7NJ 3DTEA 4UV8A 3LSJA 5FKMA 5C44J 4EJWA 1SVOA 5BPIA 4PJJA 2L02A 1T56A 2VJ5A 4KICA 1E3OC 4LFUA 2DK8A 4PFPA 3OS2A 2UXHA 2VJIA 3VP5A 2DN0A 1R36A 3LSRA 3TP3A 2V9KA 4L0ZB 4A3IJ 2LY1A 2DPDA 4HW0A 3H1CA 2ZJRF 4PSWA 4JK1X 1X58A 3ZQLA 3SQNA 3ZMUA 2XSJC 1IRZA 1KU9A 1LFPA 2Y69H 1DPRA 3CUQB 4ON0A 3ZXSA 3LNQA 2KQRA 1LB2A 1TT0A 3REOA 2QQBA 2ID3A 2DFHA 4A0YA 5IT9K 2E5NA 3TGNA 1BJZA 1YG2A 1QU3A 3K0LA 3RQIA 3HOVJ 1Y39A 3FBIB 1B9NA 5BNGA 5C4YA 4XLFA 2ZJ2A 5KAFC 1B4AA 1TZLA 2ACJA 5HS7A 1UCRA 3MQ0A 4BKXA 1IG7A 3W3CA 1IXCA 2P7VB 3AQTA 2M0MA 3FWEA 4LOCA 4RAYA 3KP5A 1FBQA 2VE8A 2OAZA 4NC6A 2IPQX 3JSPA 2CQNA 2Y0MA 3EYIA 2F5CA 3W6VA 3COLA 2MLKA 2WBMA 2KRHA 2W85A 2A6EF 3SDGA 1DP3A 2CFOA 2OTJI 3BT9A 1OYYA 3VOEA 3W6KB 2PMZN 4MO7A 3N4MA 2IRFG 3BNIA 1U5TA 2XAHA 2WV0A 4L0YB 1MMAA 2LP0A 3DBLB 4EJOA 1UAAA 4BXUA 4LK0F 2MYSA 3K4NA 3L9FA 3J80Z 4M9ZA 4ASNA 4BJ6C 4G8XA 3BLYA 4IJAA 2DI3A 2FX0A 3IWFA 1XB4A 3AKZA 3HIMA 3BDDA 1G3WA 2HOTA 3I4MJ 1MBGA 5LGNA 2RV8A 1XDUA 1W1WE 2D2WA 3G71I 3KIOA 1ZN2A 3PQKA 3RZOJ 1YI2I 4HG2A 4RM3A 1OCPA 3I59A 4G12A 4M9SA 1RR8C 2ECCA 2YVEA 5LRSA 4CCJA 1E0EA 1GUUA 3OYLA 1MNDA 4M74A 3HOSA 2GWRA 1S5LC 2AQEA 4OAZA 2VKHA 1A35A 1VQ9I 4XRFA 3ZQGA 4WWCA 3F6VA 5J1YA 4F55A 2NVUB 1PYVA 1R9TJ 2W1OA 5J4YA 3EUPA 2IBDA 3FDYA 1R49A 1MH3A 1RETA 1PVEA 2NVYJ 4LMYA 2R7RA 4FE7A 3DPLC 3AAFA 3OL4A 1WPKA 1HW1A 3U21A 3CRJA 4ANJA 1SAUA 4F52A 1LDKB 2JMWA 1A36A 1BW5A 2UXXA 3PFYA 3ZQCA 4JYKA 4EM2A 5IP7J 5E3NA 3HEFA 2W4SA 1ZELA 1DQUA 5ICGA 2VBXA 1JTXA 2QKMB 2BHZA 2R5YA 3ZMVA 3LL7A 2CQ7A 1VQPI 3EYYA 3K1NA 1R22A 3OWTA 2QZ8A 3EUHA 3KP2A 1KQ0A 3FMSA 5D5VB 5F0FA 4BU2A 2EFNA 2AS5F 5J8FA 2CQQA 1WVRA 1Z21A 3K2ZA 4U0WA 2KIQA 4L9NA 5M5WJ 3L2CA 4M3GA 1M1EB 1ZHFA 1SD4A 2LSOA 3VODA 2FMLA 2V6CA 1W36D 1NK2P 2H6CA 4NC8A 3ABUA 1NH3A 1FYLA 3G4SI 4HAMA 2F4OB 3OR1C 2P6TA 5DUKA 2GLOA 2XRLA 2DYSH 4QPQA 2QQ8A 2W24A 3JRDA 4MK6A 4RAGA 2NP3A 3DLLF 4N9HA 5EYRA 3IKTA 4P9FA 3CC7I 4L9TA 4FX4A 3OSFA 3E6DA 2MLGA 2D5VA 5K7ZA 1YW7A 2XGEA 1QNTA 3BR0A 2JPBA 3DQVC 4N4NB 4ZYGA 1IRXA 1FEXA 3ESWB 3M7GA 3OY9A 1Z6TA 3FXRA 5EG0A 4IOAF 2IS2A 3CF5F 4UVCA 1FTZA 4YFXF 5LGTA 4L62A 2UWMA 2FBKA 4BEHB 3P9TA 1X1PA 4RGRA 4E7IA 3DEUA 3RPQA 1A04A 4V19K 1TWFJ 2CUEA 3G6EI 2ZFWA 4I98B 2NRAC 3C7JA 1WWXA
chains in the Genus database with same CATH topology
1ZR2A 4GCKA 4UUTA 3ZOBA 1OCTC 4UDSA 1ETKA 2DG8A 1X2NA 5FJ8J 2G3BA 4XICA 2CJJA 1G2HA 2L0KA 1ETQA 2DA3A 2O7OA 3O8HA 4MFEA 2HXOA 4HNVA 1VI0A 2L7FP 3M3YJ 2FJ1A 1B8IB 5EDNA 5D18A 3VVZA 1Q1VA 1POGA 1XC5A 3BR5A 5EEAA 2ZOZA 1WH7A 4JX5A 3V78A 2W53A 2YU9J 3Q0WA 1T33A 1K83J 2L9RA 2ZCXA 3A03A 3QPSA 3MVPA 1OJLA 4GFLA 4DW6A 3IH4A 1B72B 1AKHB 2PZ9A 3LJLA 1ZR4A 1S7EA 3O8GA 2LD5A 1WH5A 5DS9A 5F27A 3C07A 2HI3A 5E3OA 4JX4A 2Y0SN 3ON2A 2UXIA 3HOUJ 3ZQIA 2KT0A 2XSDC 2K9NA 4FISA 1JT6A 2COBA 2R0QC 3HOZJ 3S17J 1QVUA 3CWRA 3JRHA 1RKWA 4A3DJ 4S0HB 2CQXA 2VPRA 2L7ZA 2W48A 4PXIA 1MBHA 3HKZN 4AC0A 2XPVA 2YS9A 2XPWA 1QPIA 3D1NI 2WGBA 5D1RA 2LY9A 1MSFC 2E2IJ 1LFBA 3BG5A 1ETVA 5FHPA 3SFIA 2GM4A 4GFKA 2GUHA 2O7TA 3BR1A 3HOYJ 3S14J 2OF7A 4AYBN 2HYJA 2K9SA 1BW6A 3FK6A 3IV5A 1CQTA 3QQAA 2HOSA 1ENHA 1I50J 3HTJA 3TEDA 1ORKA 4B4CA 2HQ5A 4CGRA 1ETOA 2N8GA 2G7SA 3T6NA 4B3AA 1JKPC 5E3MA 3GTPJ 1NK3P 5E3LA 5C4XJ 1MNMC 2O8KA 3QKXA 4W97A 2XGDA 3JRCA 2B63J 5FLVA 1TWHJ 3BQYA 1EF4A 4B1RA 1GV2A 2XPUA 3HGYA 5IOYA 1ETYA 2JA8J 2M9HA 2DA5A 1WGXA 3PO2J 3G7RA 2CRGA 2YVHA 3EGQA 2EZLA 2LR8A 1D5YA 2R92J 1UHSA 2IAIA 2QF7A 1NTCA 1MBFA 4GCLA 3BR2A 3MNLA 2VUMJ 3VOKA 1TWGJ 4V2FA 3BRUA 1ZTRA 1XS9A 3H0GJ 2DA7A 2EZKA 4A3BJ 4FTHA 3GTGJ 4XK4A 4I76A 2VI6A 4MLOA 4ACIA 2OI8A 1Y1WJ 5FKOA 5HBUA 4C3IJ 3JRIA 1IDYA 2VKVA 2H1KA 5FMPA 2DA2A 2V57A 3JRFA 1UI5A 2QWTA 3NARA 2K40A 2NVTJ 2DG7A 5FGLA 4MXMA 3BTJA 3TP0A 2UXUA 1ETWA 3NI7A 2F07A 1JKQC 2RAEA 3SJMA 4XIDA 2NX4A 4BBSJ 2DMPA 2NS8A 2TRTA 2ZB9A 5M5YJ 1LE8B 5GPCA 1JJ8C 2NVXJ 3K7AJ 4C3JJ 2WAQN 2LVSA 3ON4A 1U8BA 5FKKA 2E2HJ 2GFNA 1IV6A 4XRSG 3LOCA 3S1QJ 2OERA 9ANTA 3E7QA 3IH2A 3JREA 4DZJA 3VW1A 2DA1A 1PUFB 3S5RA 4C3HJ 1P7IA 2FQ4A 1W0TA 2L7MP 5HODA 4MFDA 2Y30A 2ME6A 1SGMA 3WHCA 1DU0A 1ZGWA 2EZIA 4A3FJ 4JL3A 2XGCA 3HTIA 3RD3A 3E7LA 1AKHA 1B72A 5GPAA 5F08A 4UUSB 4D5FA 4XRSA 1WCMJ 3RKQA 1OFCX 3MKLA 4JKZA 2HDDA 1TWCJ 2EBIA 1A6IA 3LSGA 2RHAA 1JT0A 1XG1A 5IPAA 3BR3A 2ZOYA 3WHBA 1MH4A 4DZPA 4M3DA 4RDUA 3CQZJ 3HDDA 2Q24A 2UXPA 3NRGA 2MGQA 5AQCA 3VW0A 2WUIA 4IHYA 4MIMA 5IYCJ 4IHVA 2XB0X 4NDLA 1APLC 2ZCNA 4IHWA 2R7ZJ 2ME0A 3Q3SA 5J1UA 4XRMA 2QIBA 3VVXA 2Y31A 4X6AJ 1U78A 2QKOA 3DEWA 3K2AA 4CYCB 3LWJA 1GV5A 2G7GA 2I10A 4DYCA 3HE0A 2QCOA 5CXIA 1SFOJ 1GDTA 5EGOB 5M3MJ 3DCFA 1HOMA 3OIOA 1JUPA 1U9OA 3A02A 1TWAJ 2E19A 3A01B 3GTJJ 5GP9A 3OSGA 2JA6J 3S16J 2JA7J 3S15J 1FTTA 3MN2A 3BCGA 2E2JJ 1TC3C 2MW8A 5JLWA 4FCYA 2AHQA 3V6GA 3QPLA 3HGGA 4FE4A 5K7FA 3KKCA 5HAWA 5CW8A 4BXXJ 1BA5A 4JX6A 2ZCMA 1JKRC 2VKEA 5M5XJ 1HDPA 2DA6A 3GBGA 3NNRA 3BJBA 2ID6A 5DTDA 3GTMJ 4IHXA 1RR7A 3B6AA 4M3FA 2NVQJ 5JLXA 3GTKJ 1RESA 4X1EA 3S1MJ 4AC6A 2E1OA 4YZEA 3O60A 4BBRJ 1HLVA 3JRAA 2HOAA 4C2MJ 2JN6A 3JR9A 4IEJA 4AUXA 3JRBA 1ZQ3P 1ZKGA 1LFUP 3GEUA 2Y9ZA 5FKLA 2M2EA 2R5ZB 3L1PA 2JWTA 4W1UA 3CJDA 4NELA 3BR6A 2QTQA 1HDDC 1VFCA 3BTLA 3NAUA 2DMUA 3VW2A 3BQZA 2RASA 1H88C 3KNWA 4A3KJ 5J1RA 4BY1J 3DPJA 4Y7NJ 5C44J 3LSJA 5FKMA 1LE8A 1GVDA 4A93J 1JUSA 1T56A 2GBYA 1F36A 1MSEC 2R5YB 3VPRA 1E3OC 3F0CA 4L5EA 1HF0A 3VVYA 2UXHA 2XB5A 1MBKA 4HKUA 4Y52J 1JJ6C 5F1JA 1IC8A 3VP5A 2DN0A 3ZQFA 3LSRA 5D19A 1MBJA 2HYTA 1PUFA 3TP3A 4A3IJ 2X6OA 4DYQA 5C3EJ 5DAJA 4ABZA 3ZQLA 1X58A 4M3EA 5F04A 2MG4A 2JA5J 2NS7A 2WB1N 1IRZA 3LSPA 3RH2A 1Y1VJ 2DTZA 2JJ7A 3VIBA 4UUSA 1B8IA 1IUFA 3NXCA 2LFBA 1QRYA 4A3MJ 1H8AC 1UI6A 3LNQA 3HTAA 3BTIA 4QSHA 4QIWN 2ID3A 3Q0VA 5FKNA 3Q0UA 1BJZA 3BG3A 2DA4A 3HOVJ 3RQIA 1Z77A 3G1OA 5BNGA 5C4YA 5EFYA 4M6VA 5K7HA 2REKA 3PM1A 3QBMA 4RBOA 4JP0A 4AF5A 3UKGA 1U9NA 1UMQA 4BKXA 2D6YA 2M0CA 1YRNB 5EG0B 3FKIJ 1IG7A 5F0HA 3TW7A 3ANGA 3AQTA 4ME9A 4LOCA 4CYCA 5FLMJ 1RKTA 3FISA 2DMQA 1P7JA 3I4NJ 4KWAA 5IYDJ 5EGOA 3W6VA 3COLA 2DMNA 1QVTA 2M8GX 3IH3A 1AU7A 1O4XA 3SDGA 3JRGA 1H89C 3BT9A 2ECBA 5C4JJ 3A01A 3GTOJ 1X2MA 2NP5A 2PMZN 4MO7A 2TCTA 1SANA 3BNIA 4A3EJ 2EH3A 2LP0A 2ELKA 3B81A 2WV1A 2NOGA 5CXGA 2X9DA 3CCYA 1I3QJ 2LTPA 3VOXA 2FX0A 2EZHA 3HIMA 2CUFA 5EZGA 2R93J 2HOTA 3I4MJ 1MBGA 1IDZA 3IUVA 2QOPA 2P81A 1JKOC 1K61A 3PO3J 2LK2A 3S1NJ 3RZOJ 3PASA 2MSYA 3OOUA 3GTLJ 4D7MA 1OCPA 1VNDA 4G12A 4A3CJ 3LHQA 2LKXA 2ECCA 2YVEA 3G1MA 1GUUA 2FBQA 3S2DJ 4D5CA 3F1BA 3VUQA 2Y2ZA 3H3VK 4EEFG 5IP6A 3ZQGA 4A3LJ 5J1YA 4DYRA 1VF9A 1R9TJ 3G56A 1IJWC 3EUPA 2IBDA 2PBXA 3HOWJ 1MH3A 4A3GJ 1RETA 2K9QA 2NVYJ 2R5ZA 3S2HJ 4FE7A 3FIWA 1FJLA 1ZK8A 3GTQJ 5EF6A 1I6HJ 2IEKA 1ITYA 3JSJA 2YUSA 1WPKA 5M3FJ 3B6CA 3CRJA 2EQRA 2JMWA 1FIAA 1RPWA 2M34A 1JGGA 4A3JJ 1BW5A 2IU5A 4J19A 3ZQCA 4JYKA 3RZDJ 1UG2A 5J3LA 5IP7J 5E3NA 3CDLA 3HEFA 3GZIA 1JTXA 2R5YA 1F43A 2GENA 3HOXJ 2G0EA 1JTYA 2DJNA 3BTCA 4V2GA 3ZQHA 5IOZA 3HM5A 5F0FA 3C2BA 4D7NA 3FK7A 4A69C 2G7LA 2UXOA 2CQQA 5EZHA 2XDNA 5M5WJ 1ETXA 4M3GA 2HKUA 4ICHA 5F0CA 4GFBA 1DU6A 1JUMA 1NK2P 1WI3A 1BL0A 1HCRA 3ANPA 3HBLA 3BHQA 3HTHA 1Z0XA 5H9TA 2GLOA 3BG9A 2XRLA 2KDZA 1A5JA 2OPTA 3G1LA 5IYBJ 2O9LA 2H8RA 3NPIA 3JRDA 3M4OJ 4MK6A 2NP3A 1AHDP 5EYRA 5IP9J 2X48A 2DMTA 3S1RJ 4BY7J 3OSFA 2D5VA 5HSZA 5K7ZA 2XGEA 3BR0A 1IGNA 2FD5A 1GT0C 3FRQA 1W0UA 1FEXA 4JNNA 1YRNA 5EG0A 4QTRA 4I6ZA 3CMYA 1FTZA 4L62A 3PPBA 2JK3A 3AQSA 2Y9YA 3KZ9A 3P9TA 1FIPA 3TW6A 2AO9A 2HXIA 3HB9A 4M3BA 2LLKA 3KKDA 4GCTA 4NN1A 1TWFJ 2CUEA 1MBEA 2CU7A 5K58A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZR2 A;  4GCK A;  4UUT A;  3ZOB A;  1OCT C;  4UDS A;  1ETK A;  2DG8 A;  1X2N A;  5FJ8 J;  2G3B A;  4XIC A;  2CJJ A;  1G2H A;  2L0K A;  1ETQ A;  2DA3 A;  2O7O A;  3O8H A;  4MFE A;  2HXO A;  4HNV A;  1VI0 A;  2L7F P;  3M3Y J;  2FJ1 A;  1B8I B;  5EDN A;  5D18 A;  3VVZ A;  1Q1V A;  1POG A;  1XC5 A;  3BR5 A;  5EEA A;  2ZOZ A;  1WH7 A;  4JX5 A;  3V78 A;  2W53 A;  2YU9 J;  3Q0W A;  1T33 A;  1K83 J;  2L9R A;  2ZCX A;  3A03 A;  3QPS A;  3MVP A;  1OJL A;  4GFL A;  4DW6 A;  3IH4 A;  1B72 B;  1AKH B;  2PZ9 A;  3LJL A;  1ZR4 A;  1S7E A;  3O8G A;  2LD5 A;  1WH5 A;  5DS9 A;  5F27 A;  3C07 A;  2HI3 A;  5E3O A;  4JX4 A;  2Y0S N;  3ON2 A;  2UXI A;  3HOU J;  3ZQI A;  2KT0 A;  2XSD C;  2K9N A;  4FIS A;  1JT6 A;  2COB A;  2R0Q C;  3HOZ J;  3S17 J;  1QVU A;  3CWR A;  3JRH A;  1RKW A;  4A3D J;  4S0H B;  2CQX A;  2VPR A;  2L7Z A;  2W48 A;  4PXI A;  1MBH A;  3HKZ N;  4AC0 A;  2XPV A;  2YS9 A;  2XPW A;  1QPI A;  3D1N I;  2WGB A;  5D1R A;  2LY9 A;  1MSF C;  2E2I J;  1LFB A;  3BG5 A;  1ETV A;  5FHP A;  3SFI A;  2GM4 A;  4GFK A;  2GUH A;  2O7T A;  3BR1 A;  3HOY J;  3S14 J;  2OF7 A;  4AYB N;  2HYJ A;  2K9S A;  1BW6 A;  3FK6 A;  3IV5 A;  1CQT A;  3QQA A;  2HOS A;  1ENH A;  1I50 J;  3HTJ A;  3TED A;  1ORK A;  4B4C A;  2HQ5 A;  4CGR A;  1ETO A;  2N8G A;  2G7S A;  3T6N A;  4B3A A;  1JKP C;  5E3M A;  3GTP J;  1NK3 P;  5E3L A;  5C4X J;  1MNM C;  2O8K A;  3QKX A;  4W97 A;  2XGD A;  3JRC A;  2B63 J;  5FLV A;  1TWH J;  3BQY A;  1EF4 A;  4B1R A;  1GV2 A;  2XPU A;  3HGY A;  5IOY A;  1ETY A;  2JA8 J;  2M9H A;  2DA5 A;  1WGX A;  3PO2 J;  3G7R A;  2CRG A;  2YVH A;  3EGQ A;  2EZL A;  2LR8 A;  1D5Y A;  2R92 J;  1UHS A;  2IAI A;  2QF7 A;  1NTC A;  1MBF A;  4GCL A;  3BR2 A;  3MNL A;  2VUM J;  3VOK A;  1TWG J;  4V2F A;  3BRU A;  1ZTR A;  1XS9 A;  3H0G J;  2DA7 A;  2EZK A;  4A3B J;  4FTH A;  3GTG J;  4XK4 A;  4I76 A;  2VI6 A;  4MLO A;  4ACI A;  2OI8 A;  1Y1W J;  5FKO A;  5HBU A;  4C3I J;  3JRI A;  1IDY A;  2VKV A;  2H1K A;  5FMP A;  2DA2 A;  2V57 A;  3JRF A;  1UI5 A;  2QWT A;  3NAR A;  2K40 A;  2NVT J;  2DG7 A;  5FGL A;  4MXM A;  3BTJ A;  3TP0 A;  2UXU A;  1ETW A;  3NI7 A;  2F07 A;  1JKQ C;  2RAE A;  3SJM A;  4XID A;  2NX4 A;  4BBS J;  2DMP A;  2NS8 A;  2TRT A;  2ZB9 A;  5M5Y J;  1LE8 B;  5GPC A;  1JJ8 C;  2NVX J;  3K7A J;  4C3J J;  2WAQ N;  2LVS A;  3ON4 A;  1U8B A;  5FKK A;  2E2H J;  2GFN A;  1IV6 A;  4XRS G;  3LOC A;  3S1Q J;  2OER A;  9ANT A;  3E7Q A;  3IH2 A;  3JRE A;  4DZJ A;  3VW1 A;  2DA1 A;  1PUF B;  3S5R A;  4C3H J;  1P7I A;  2FQ4 A;  1W0T A;  2L7M P;  5HOD A;  4MFD A;  2Y30 A;  2ME6 A;  1SGM A;  3WHC A;  1DU0 A;  1ZGW A;  2EZI A;  4A3F J;  4JL3 A;  2XGC A;  3HTI A;  3RD3 A;  3E7L A;  1AKH A;  1B72 A;  5GPA A;  5F08 A;  4UUS B;  4D5F A;  4XRS A;  1WCM J;  3RKQ A;  1OFC X;  3MKL A;  4JKZ A;  2HDD A;  1TWC J;  2EBI A;  1A6I A;  3LSG A;  2RHA A;  1JT0 A;  1XG1 A;  5IPA A;  3BR3 A;  2ZOY A;  3WHB A;  1MH4 A;  4DZP A;  4M3D A;  4RDU A;  3CQZ J;  3HDD A;  2Q24 A;  2UXP A;  3NRG A;  2MGQ A;  5AQC A;  3VW0 A;  2WUI A;  4IHY A;  4MIM A;  5IYC J;  4IHV A;  2XB0 X;  4NDL A;  1APL C;  2ZCN A;  4IHW A;  2R7Z J;  2ME0 A;  3Q3S A;  5J1U A;  4XRM A;  2QIB A;  3VVX A;  2Y31 A;  4X6A J;  1U78 A;  2QKO A;  3DEW A;  3K2A A;  4CYC B;  3LWJ A;  1GV5 A;  2G7G A;  2I10 A;  4DYC A;  3HE0 A;  2QCO A;  5CXI A;  1SFO J;  1GDT A;  5EGO B;  5M3M J;  3DCF A;  1HOM A;  3OIO A;  1JUP A;  1U9O A;  3A02 A;  1TWA J;  2E19 A;  3A01 B;  3GTJ J;  5GP9 A;  3OSG A;  2JA6 J;  3S16 J;  2JA7 J;  3S15 J;  1FTT A;  3MN2 A;  3BCG A;  2E2J J;  1TC3 C;  2MW8 A;  5JLW A;  4FCY A;  2AHQ A;  3V6G A;  3QPL A;  3HGG A;  4FE4 A;  5K7F A;  3KKC A;  5HAW A;  5CW8 A;  4BXX J;  1BA5 A;  4JX6 A;  2ZCM A;  1JKR C;  2VKE A;  5M5X J;  1HDP A;  2DA6 A;  3GBG A;  3NNR A;  3BJB A;  2ID6 A;  5DTD A;  3GTM J;  4IHX A;  1RR7 A;  3B6A A;  4M3F A;  2NVQ J;  5JLX A;  3GTK J;  1RES A;  4X1E A;  3S1M J;  4AC6 A;  2E1O A;  4YZE A;  3O60 A;  4BBR J;  1HLV A;  3JRA A;  2HOA A;  4C2M J;  2JN6 A;  3JR9 A;  4IEJ A;  4AUX A;  3JRB A;  1ZQ3 P;  1ZKG A;  1LFU P;  3GEU A;  2Y9Z A;  5FKL A;  2M2E A;  2R5Z B;  3L1P A;  2JWT A;  4W1U A;  3CJD A;  4NEL A;  3BR6 A;  2QTQ A;  1HDD C;  1VFC A;  3BTL A;  3NAU A;  2DMU A;  3VW2 A;  3BQZ A;  2RAS A;  1H88 C;  3KNW A;  4A3K J;  5J1R A;  4BY1 J;  3DPJ A;  4Y7N J;  5C44 J;  3LSJ A;  5FKM A;  1LE8 A;  1GVD A;  4A93 J;  1JUS A;  1T56 A;  2GBY A;  1F36 A;  1MSE C;  2R5Y B;  3VPR A;  1E3O C;  3F0C A;  4L5E A;  1HF0 A;  3VVY A;  2UXH A;  2XB5 A;  1MBK A;  4HKU A;  4Y52 J;  1JJ6 C;  5F1J A;  1IC8 A;  3VP5 A;  2DN0 A;  3ZQF A;  3LSR A;  5D19 A;  1MBJ A;  2HYT A;  1PUF A;  3TP3 A;  4A3I J;  2X6O A;  4DYQ A;  5C3E J;  5DAJ A;  4ABZ A;  3ZQL A;  1X58 A;  4M3E A;  5F04 A;  2MG4 A;  2JA5 J;  2NS7 A;  2WB1 N;  1IRZ A;  3LSP A;  3RH2 A;  1Y1V J;  2DTZ A;  2JJ7 A;  3VIB A;  4UUS A;  1B8I A;  1IUF A;  3NXC A;  2LFB A;  1QRY A;  4A3M J;  1H8A C;  1UI6 A;  3LNQ A;  3HTA A;  3BTI A;  4QSH A;  4QIW N;  2ID3 A;  3Q0V A;  5FKN A;  3Q0U A;  1BJZ A;  3BG3 A;  2DA4 A;  3HOV J;  3RQI A;  1Z77 A;  3G1O A;  5BNG A;  5C4Y A;  5EFY A;  4M6V A;  5K7H A;  2REK A;  3PM1 A;  3QBM A;  4RBO A;  4JP0 A;  4AF5 A;  3UKG A;  1U9N A;  1UMQ A;  4BKX A;  2D6Y A;  2M0C A;  1YRN B;  5EG0 B;  3FKI J;  1IG7 A;  5F0H A;  3TW7 A;  3ANG A;  3AQT A;  4ME9 A;  4LOC A;  4CYC A;  5FLM J;  1RKT A;  3FIS A;  2DMQ A;  1P7J A;  3I4N J;  4KWA A;  5IYD J;  5EGO A;  3W6V A;  3COL A;  2DMN A;  1QVT A;  2M8G X;  3IH3 A;  1AU7 A;  1O4X A;  3SDG A;  3JRG A;  1H89 C;  3BT9 A;  2ECB A;  5C4J J;  3A01 A;  3GTO J;  1X2M A;  2NP5 A;  2PMZ N;  4MO7 A;  2TCT A;  1SAN A;  3BNI A;  4A3E J;  2EH3 A;  2LP0 A;  2ELK A;  3B81 A;  2WV1 A;  2NOG A;  5CXG A;  2X9D A;  3CCY A;  1I3Q J;  2LTP A;  3VOX A;  2FX0 A;  2EZH A;  3HIM A;  2CUF A;  5EZG A;  2R93 J;  2HOT A;  3I4M J;  1MBG A;  1IDZ A;  3IUV A;  2QOP A;  2P81 A;  1JKO C;  1K61 A;  3PO3 J;  2LK2 A;  3S1N J;  3RZO J;  3PAS A;  2MSY A;  3OOU A;  3GTL J;  4D7M A;  1OCP A;  1VND A;  4G12 A;  4A3C J;  3LHQ A;  2LKX A;  2ECC A;  2YVE A;  3G1M A;  1GUU A;  2FBQ A;  3S2D J;  4D5C A;  3F1B A;  3VUQ A;  2Y2Z A;  3H3V K;  4EEF G;  5IP6 A;  3ZQG A;  4A3L J;  5J1Y A;  4DYR A;  1VF9 A;  1R9T J;  3G56 A;  1IJW C;  3EUP A;  2IBD A;  2PBX A;  3HOW J;  1MH3 A;  4A3G J;  1RET A;  2K9Q A;  2NVY J;  2R5Z A;  3S2H J;  4FE7 A;  3FIW A;  1FJL A;  1ZK8 A;  3GTQ J;  5EF6 A;  1I6H J;  2IEK A;  1ITY A;  3JSJ A;  2YUS A;  1WPK A;  5M3F J;  3B6C A;  3CRJ A;  2EQR A;  2JMW A;  1FIA A;  1RPW A;  2M34 A;  1JGG A;  4A3J J;  1BW5 A;  2IU5 A;  4J19 A;  3ZQC A;  4JYK A;  3RZD J;  1UG2 A;  5J3L A;  5IP7 J;  5E3N A;  3CDL A;  3HEF A;  3GZI A;  1JTX A;  2R5Y A;  1F43 A;  2GEN A;  3HOX J;  2G0E A;  1JTY A;  2DJN A;  3BTC A;  4V2G A;  3ZQH A;  5IOZ A;  3HM5 A;  5F0F A;  3C2B A;  4D7N A;  3FK7 A;  4A69 C;  2G7L A;  2UXO A;  2CQQ A;  5EZH A;  2XDN A;  5M5W J;  1ETX A;  4M3G A;  2HKU A;  4ICH A;  5F0C A;  4GFB A;  1DU6 A;  1JUM A;  1NK2 P;  1WI3 A;  1BL0 A;  1HCR A;  3ANP A;  3HBL A;  3BHQ A;  3HTH A;  1Z0X A;  5H9T A;  2GLO A;  3BG9 A;  2XRL A;  2KDZ A;  1A5J A;  2OPT A;  3G1L A;  5IYB J;  2O9L A;  2H8R A;  3NPI A;  3JRD A;  3M4O J;  4MK6 A;  2NP3 A;  1AHD P;  5EYR A;  5IP9 J;  2X48 A;  2DMT A;  3S1R J;  4BY7 J;  3OSF A;  2D5V A;  5HSZ A;  5K7Z A;  2XGE A;  3BR0 A;  1IGN A;  2FD5 A;  1GT0 C;  3FRQ A;  1W0U A;  1FEX A;  4JNN A;  1YRN A;  5EG0 A;  4QTR A;  4I6Z A;  3CMY A;  1FTZ A;  4L62 A;  3PPB A;  2JK3 A;  3AQS A;  2Y9Y A;  3KZ9 A;  3P9T A;  1FIP A;  3TW6 A;  2AO9 A;  2HXI A;  3HB9 A;  4M3B A;  2LLK A;  3KKD A;  4GCT A;  4NN1 A;  1TWF J;  2CUE A;  1MBE A;  2CU7 A;  5K58 A; 
#chains in the Genus database with same CATH topology
 4Y4R A;  2KIF A;  1OCT C;  1ZGA A;  1VQ5 I;  4UDS A;  2DG8 A;  1X2N A;  2LRD A;  4XIC A;  1ON2 A;  1GT0 C;  1ETQ A;  2IA0 A;  4JNN A;  3DKW A;  4HNV A;  1VI0 A;  2FJ1 A;  5A2Q Z;  1POG A;  2JVH A;  5EEA A;  4JX5 A;  4RAF A;  3V78 A;  1I27 A;  3Q0W A;  2YU9 J;  1X4P A;  4KA4 A;  1LQ1 A;  2DJI A;  4NB5 A;  1V54 H;  5TJJ A;  3MVP A;  1OJL A;  2RGV A;  3WE2 A;  4GFL A;  2MA3 A;  2QVO A;  1OYW A;  2ADU A;  3S3O A;  2BVM A;  3V4G A;  1S7E A;  2YVX A;  4BGD A;  4OOI A;  2LD5 A;  5F27 A;  3GFM A;  3C07 A;  2UXI A;  3HOU J;  4YG2 F;  4LGW A;  2COB A;  3S17 J;  2Y0S A;  4HBL A;  3KCC A;  5JI6 A;  2WTE A;  1WSU A;  4BQA A;  3MZY A;  1X3U A;  3BPV A;  4A3D J;  1MIJ A;  4AM3 A;  4CCL A;  3R4K A;  5H6R A;  2EFW A;  2L7Z A;  3R60 A;  1I6X A;  1O3T A;  2HNH A;  5CQG A;  1VQO I;  5K5Q A;  3O3K A;  3QP6 A;  2HGC A;  3L2Q A;  4PXI A;  1MBH A;  3HKZ N;  3I9V 2;  5D6E A;  5EEG A;  4RB0 A;  2BY2 A;  2XPW A;  1EH8 A;  3ZMD A;  3D1N I;  1H9T A;  2M7B A;  4QWQ A;  2WGB A;  2D1V A;  1LFB A;  2WY7 Q;  1R5H A;  1OLT A;  4YIF A;  4AYB N;  4XLC A;  1CQT A;  2JUG A;  1SD7 A;  3HTJ A;  3JTH A;  3VYR B;  2KRC A;  2HQ5 A;  2ISY A;  2M1B A;  4B4C A;  1B1B A;  3V7S A;  4A6D A;  5LBQ A;  5EJC A;  1P4X A;  2MC4 A;  2BV6 A;  5E3L A;  4W97 A;  3ECO A;  3OYG A;  1Z3X A;  1FWZ A;  3K4L A;  4HLX A;  2L9N A;  3HGY A;  5IOY A;  4ENN A;  3ASO H;  5JHU A;  3VYU B;  2M9H A;  2YVH A;  3EGQ A;  2O3F A;  2KIU A;  5FLX Z;  5FRO A;  4I01 A;  1T8I A;  4XKB A;  4GCL A;  4EQQ A;  4XOP A;  3WOD F;  5J47 A;  3QOE A;  1TWG J;  4V2F A;  3BRU A;  3DPU A;  1OR7 C;  3F72 A;  3KYC B;  1O7F A;  1WFX A;  1FY7 A;  4I76 A;  4CSW A;  2VOP A;  1Y1W J;  3RYP A;  1QA6 A;  2K85 A;  2WAD A;  4BE2 A;  5HBU A;  5TGT A;  4LG0 B;  1ZG3 A;  3JRF A;  1MNE A;  1UI5 A;  1SVM A;  3QAH A;  2A5Y B;  1QBJ A;  4RGU A;  3F23 A;  2DXI A;  4LIV A;  3TQN A;  5F6F A;  3OYB A;  3H3U A;  5GTH C;  3RIR A;  1YQA A;  1JKQ C;  4RAZ A;  1VTN C;  2X1E A;  4E7K A;  2NOJ B;  1P6R A;  2XAU A;  1XCB A;  1XN7 A;  3WTW C;  5BPD A;  1HKQ A;  3GFI A;  3K7A J;  3OL3 A;  3C2G A;  4C3J J;  1U8B A;  5FKK A;  3I3L A;  4OAY A;  3WG9 A;  2ZKZ A;  1XSV A;  3EDP A;  3CO7 C;  2EFO A;  4YIR X;  1WHU A;  4GYI A;  3E3V A;  5DCF A;  2L7M P;  5HOD A;  2XDV A;  2Y30 A;  4FT8 A;  4A5M A;  1SGM A;  2IJL A;  3WHC A;  2GAU A;  1EH6 A;  2XAS A;  4DQ2 A;  2IT0 A;  5L3F A;  1Z7L A;  1T6S A;  1W7P A;  2PFV A;  1AKH A;  2R7W A;  2IVM A;  1J75 A;  2Z1D A;  3J80 K;  2WAE A;  5DV5 A;  1RIO H;  3GO5 A;  4E7L A;  1OFC X;  1TWC J;  3TOA A;  4ZYE A;  3LSG A;  4BE1 A;  2ZXH A;  1SFK A;  3DKY A;  3LFK A;  2WAF A;  1XG1 A;  5IPA A;  4DZP A;  5AQC A;  3CQZ J;  1H9G A;  2AXT C;  1ULY A;  3CP8 A;  2DDA A;  2HOE A;  3ZMS A;  1U6G A;  2NS0 A;  2ZXJ A;  3M8F A;  3SEZ A;  2ZSI B;  3DP7 A;  4LIU A;  1X1B A;  2NXN B;  4HSR A;  3Q3S A;  4XRM A;  5J1U A;  5FB2 A;  1BN5 A;  1XX5 A;  4XKC A;  4XQF A;  4ZYH A;  2EIL H;  1U78 A;  2HDC A;  2KZG A;  3DEW A;  4YRV A;  2G7G A;  1YX3 A;  3HE0 A;  1SFO J;  1KU7 A;  4II2 A;  1FSE A;  1X3Z B;  2L9S A;  3T1B A;  4C30 A;  1Z1D A;  1TWA J;  3OSG A;  2O6G E;  2KZV A;  4CCN A;  2ISZ A;  1X1A A;  3BJA A;  1FTT A;  4BAC A;  4HPQ A;  1TC3 C;  3FXL A;  4LIT A;  5FD6 A;  2IXS A;  2WC2 A;  3HG9 A;  2JSC A;  2ETH A;  1DDN A;  4JBA A;  3KKC A;  3F9K A;  1XGS A;  3CCJ I;  5FRM A;  1ZH5 A;  2GXB A;  1IRG A;  1PJR A;  1BA5 A;  2FE3 A;  3I55 I;  4R79 A;  4LB5 A;  3IAM 2;  3VSL A;  2QSF X;  3GBG A;  5B66 C;  4XKV A;  3NNR A;  2NNY A;  4S04 A;  2IGK A;  3BJB A;  2ID6 A;  2CMP A;  1HQC A;  1D8J A;  3DU6 A;  1LDD A;  3I59 B;  3LSI A;  4PK4 A;  4X1E A;  1E3P A;  3EUA A;  3H0D A;  2P6S A;  3QOP A;  5F64 A;  2XV4 S;  2QGU A;  3F22 A;  1V5F A;  1ZG5 A;  3D5R C;  5GTI C;  1ZGJ A;  2COM A;  4P5O A;  4GDF A;  3KE2 A;  1S29 A;  2K5C A;  4KT6 A;  1Y6I A;  1ZKG A;  2UXN A;  5KNL A;  3E97 A;  1WJE A;  3CJD A;  2BBY A;  4RGS A;  5DM7 F;  3NAU A;  3I58 A;  3ZN1 A;  2R7U A;  2RAS A;  5CKT A;  5E8G A;  4I0B A;  3FMR A;  4KJZ A;  4ZDP A;  4G7Z F;  3KNW A;  5K5O A;  2E1M B;  2FBI A;  1HKS A;  3CCU I;  2D45 A;  1X1C A;  1LE8 A;  1GVD A;  2GZW A;  2O61 A;  3QPH A;  1JUS A;  2L5Q A;  3FXM A;  4RS8 A;  4WX9 A;  2EV0 A;  4S05 A;  2R5Y B;  1E2X A;  3VVY A;  1R5I D;  1PP7 U;  3S3M A;  2AQF A;  4Y52 J;  5F1J A;  1IC8 A;  1ZLK A;  3ZQF A;  2ZNZ A;  3Q9V A;  5D19 A;  1MBJ A;  2HYT A;  3P9K A;  1PUF A;  4ENM A;  2X6O A;  4DYQ A;  5HLT A;  3LSM A;  3M1E A;  3E5Q A;  1K7A A;  3A0B C;  2XKO A;  2BGC A;  3GZ5 A;  4ABZ A;  4IX7 A;  4HQM A;  3LQQ A;  4IRH A;  4M3E A;  5F04 A;  1K4S A;  2JA5 J;  5A2Q K;  5HDG A;  3RH2 A;  1Y1V J;  2JJ7 A;  1S6L A;  2M30 A;  3FXK A;  1IN4 A;  2CO5 A;  4M6Y A;  2R7T A;  1IUF A;  2WB1 A;  3NWT A;  1UI6 A;  2R7S A;  4HF2 A;  3BTI A;  1Z3Y A;  4QIW N;  1DGW Y;  5HLH A;  5FKN A;  2VOD A;  3Q0U A;  1ZRC A;  3BG3 A;  1WQ2 A;  1RC9 A;  3K4B A;  1Z77 A;  2YR2 A;  3G1O A;  4AWX B;  4M6V A;  3QU6 A;  1UB9 A;  2REK A;  2KIS A;  4RBO A;  4WCG A;  4LLG F;  1E3H A;  4U0V A;  3UKG A;  1U9N A;  1FOK A;  4XSX F;  2I8D A;  4I02 A;  5CJ9 A;  2D6Y A;  5EG0 B;  3FKI J;  3I4P A;  3H92 A;  3LQR A;  5ILV A;  1F1Z A;  4CYC A;  2PJP A;  3U9G A;  5HLG A;  1RKT A;  1R4N B;  1MMS A;  3FIS A;  1K78 A;  4KWA A;  5EGO A;  3TDU C;  4HV6 A;  1NHA A;  3CCS I;  5ICF A;  3JRG A;  3L2U A;  1X3W B;  2HZD A;  1X2M A;  3RJP A;  5HVQ C;  1YS7 A;  2E5Z A;  4XLN F;  1TW3 A;  2ZO4 A;  3G2B A;  2TCT A;  3F8B A;  4I99 C;  2A05 A;  2EH3 A;  2ELK A;  3GWZ A;  2H94 A;  2V4J C;  5CXG A;  2HKX A;  3CCY A;  1P2F A;  2BY3 A;  1I3Q J;  3KLO A;  3VOX A;  5D5X B;  2EZH A;  4N0B A;  3U1D A;  2XF5 A;  5EZG A;  4RB3 C;  3IWZ A;  2IP2 A;  3VSK A;  4HDU A;  2QOP A;  4WXH A;  4D1Q A;  1JKO C;  1FP1 D;  4CHU A;  2LK2 A;  4RM2 A;  5EEH A;  3ECH A;  1YW8 A;  2MSY A;  3OOU A;  2V6E A;  4J01 A;  4XMY A;  3GTL J;  4D7M A;  2W25 A;  3AG2 H;  1VND A;  3M9A A;  2IA1 A;  3LHQ A;  1TNT A;  1UFM A;  2LKX A;  1BBY A;  1Z7U A;  4KFC A;  5E1X A;  3ZCO A;  2XAF A;  3AG4 H;  2ZSH B;  4XM3 A;  3S2D J;  2FBQ A;  1LKX A;  3FBN B;  3CES A;  2Y2Z A;  2FA5 A;  1GXP A;  3HSR A;  5LFA A;  2KMU A;  1STZ A;  4PUS A;  3CC2 I;  1W5T A;  5L3B A;  2F2E A;  1OQY A;  4HA8 A;  4E7Z A;  4A3G J;  2K9Q A;  3S2H J;  2R5Z A;  3FIW A;  4NUB A;  2ZME C;  1ZK8 A;  1YIO A;  2LDU A;  1AWC A;  1FJL A;  2WA0 A;  3GTQ J;  1I6H J;  1KA8 A;  2VXD A;  2YUS A;  4BYY A;  2VB6 A;  1VZ0 A;  4CO8 A;  1FIA A;  1RPW A;  1JGG A;  4ZYD A;  2V1X A;  2IU5 A;  4J19 A;  2KRF A;  3ABM H;  3RZD J;  3F8N A;  2EA2 A;  2PG4 A;  3CDL A;  3FHN A;  3GZI A;  3K1M A;  1QGP A;  2UV1 A;  3JAM K;  2V1D A;  1KGS A;  4MTD A;  1ONV A;  3P5J A;  1Z91 A;  3ERM A;  5HDK A;  1W5S A;  2ZFU A;  4HX7 A;  2DT5 A;  3RSN A;  1VQN I;  4V2G A;  2VE9 A;  2F48 A;  2E1C A;  2I5U A;  5IOZ A;  3UR3 C;  3DBR B;  5EZH A;  3GZN B;  3KPH A;  5KVR A;  4U7B A;  2HKU A;  3HRT A;  1JUM A;  3ZN0 A;  1I5Z A;  4KN7 X;  1HCR A;  1O3R A;  4KMU X;  1J09 A;  2LC2 A;  3CCM I;  5H9T A;  2VC1 A;  5E79 C;  3F8M A;  1A5J A;  4CZZ A;  3G1L A;  2O9L A;  2VQL A;  3M4O J;  2RNJ A;  1OCO H;  5IP9 J;  2X48 A;  2DMT A;  3S1R J;  4LLN A;  4I09 A;  1QZZ A;  2DT7 B;  3RDI A;  1TW2 A;  3K4J A;  1IGN A;  2L4M A;  2YPR A;  3IC7 A;  2FD5 A;  1G59 A;  3FRQ A;  1T08 B;  2K3P A;  1D0X A;  5LHH A;  4JOM A;  4J00 A;  4IOC F;  2Z16 A;  2QEN A;  3E1S A;  3ZQQ A;  2EIN H;  3CMY A;  4I6Z A;  3I53 A;  2K9M A;  4L5J A;  5D5W B;  1A6Q A;  1BOB A;  5KCM A;  1IUY A;  1IZ1 A;  3ROU A;  1GLN A;  4M3B A;  1BI1 A;  5GAG J;  1P9Q C;  3C1D A;  5BOX A;  2DAO A;  3Q9S A;  1MBE A;  1ODD A;  2MBF A;  1PP8 F;  1IRF A;  4AIK A;  1ZR2 A;  1WKM A;  3ZOB A;  4KYW A;  3EQL F;  5BS6 A;  1I1S A;  5FJ8 J;  2G3B A;  3OYC A;  3TKY A;  4CGZ A;  1J0R A;  4PSX A;  4MFE A;  3KP4 A;  3J7Y J;  3CC4 I;  4A0X A;  1XC5 A;  1XMX A;  3BR5 A;  2F4M B;  3BZC A;  4MQ9 F;  2ZOZ A;  1WH7 A;  3CCQ I;  1NG7 A;  2VT2 A;  3MCZ A;  2VAS A;  5CVR A;  1K83 J;  1YIT I;  2ZCX A;  3A03 A;  1W7P B;  3QPS A;  1AKH B;  3IH4 A;  2PZ9 A;  2GIV A;  4PJM A;  4UUV A;  3OYD A;  2OV7 A;  2HKO A;  5DYM A;  4OD4 A;  1OKR A;  4P96 A;  3A0H C;  5FD5 A;  2HI3 A;  3ON2 A;  4A0Z A;  1SFX A;  4YEJ A;  2XSD C;  4RGX A;  2X51 A;  1K79 A;  3DV8 A;  2IGO A;  1W4M A;  3HUG A;  4AIH A;  2ICW G;  3ABK H;  1JE8 A;  4RMN A;  4B3X A;  2ZCW A;  3PNV A;  2QEX I;  1UHW A;  3CLO A;  5JVG F;  1QQI A;  2XPV A;  3HXL A;  4XLE A;  1QPI A;  1BI0 A;  2JT1 A;  2CG4 A;  2LY9 A;  4GCV A;  4YEL A;  5DD4 A;  3BG5 A;  2E2I J;  2M87 A;  3C18 A;  1R1T A;  2W82 A;  3LFU A;  3DWL E;  3SFI A;  2GM4 A;  1W7P D;  2KPM A;  1BW6 A;  3IV5 A;  1S9H A;  2VBZ A;  2DT6 A;  1RUO A;  1I50 J;  3IHU A;  1ORK A;  2X1C A;  1ETO A;  2N8G A;  3W2A A;  5ILS A;  1JKP C;  2HR3 A;  3ABL H;  1NK3 P;  1B6A A;  3QKX A;  2VXZ A;  2XGD A;  3JRC A;  4M72 A;  4BHC A;  2B63 J;  4UNO A;  5FLV A;  1G8X A;  3KFW X;  5DD8 A;  1HA8 A;  1FOX A;  1FX7 A;  4B1R A;  4BAY A;  4HLY A;  4E7H A;  3ZGK A;  4Z2Y A;  2OUM A;  1J59 A;  1RUN A;  1K6O A;  2DA5 A;  3PO2 J;  3OYJ A;  2B3W A;  2CRG A;  1OCR H;  3J81 K;  2B1E A;  3G7R A;  1TNS A;  2EZL A;  1D5Y A;  2IAI A;  2WY8 Q;  1MBF A;  3BR2 A;  4KIG A;  3CCL I;  2XVC A;  3CLQ A;  5F1R A;  3VOK A;  3SZG A;  2CH0 A;  3K70 C;  5DEQ A;  2DA7 A;  4ENJ A;  4FTH A;  3GTG J;  4CIC A;  4XK4 A;  1FNN A;  2XUB A;  1ERD A;  2OI8 A;  1ACI A;  3HHH A;  4KUM A;  4B47 A;  2R4G A;  4C3I J;  1IDY A;  2FNA A;  2VKV A;  3H5R A;  2H1K A;  4UVA A;  4HOB A;  4C2U A;  3T0Y A;  3QPT A;  2F6C A;  2DG7 A;  3K8P C;  4PGG A;  2RVC A;  2GA2 A;  3S3N A;  1KZH A;  5CPR B;  3AFH A;  4AC0 A;  4M71 A;  3NI7 A;  1V4R A;  2F07 A;  5HDN A;  3GZ6 A;  2RAE A;  3SJM A;  3CDH A;  5HOO A;  5LEJ A;  4MHG A;  4G94 A;  1FZP B;  5DUI A;  2DMP A;  2DK5 A;  2ZB9 A;  4Q47 A;  5M5Y J;  4L5I A;  1LE8 B;  2QYO A;  1FC3 A;  2DU9 A;  3ON4 A;  2XF7 A;  2WAQ N;  2ZXI A;  2XRO A;  1FBS A;  1WZ2 A;  1P4W A;  1GHC A;  3LOC A;  2MC3 A;  1USS A;  9ANT A;  2ELJ A;  2V1U A;  1YO5 C;  1YYV A;  4L9V A;  3S32 A;  5B1B H;  3JRE A;  1MD0 A;  1S7A A;  1PUF B;  2E34 A;  3S5R A;  1W0T A;  3T8R A;  1EKE A;  1KU3 A;  4Q4Z F;  1T98 A;  4MEX F;  3D5S C;  3M8E A;  1DU0 A;  3ELK A;  3CJN A;  2EZI A;  2OZU A;  5FFZ A;  3WTV C;  2KLO A;  4HYE A;  3HTI A;  3RD3 A;  3E7L A;  5GPA A;  1KQ8 A;  3DTK A;  4D5F A;  5DCM B;  2LBF A;  3CTA A;  4M9X A;  4L9J A;  1WCM J;  3RKQ A;  4A5N A;  1Q1H A;  2HDD A;  2EBI A;  1A6I A;  2F5F A;  1JT0 A;  3W6J B;  4E4H A;  3BR3 A;  3X2Q H;  2ZOY A;  3HDD A;  4RDU A;  2VBW A;  1REP C;  4L18 B;  1G6N A;  1HBX G;  2MGQ A;  2WUI A;  4IHV A;  2LMD A;  2Z99 A;  1WJA A;  3ZMZ A;  4NDL A;  1KYZ A;  1YW9 A;  3L2R A;  2ZC2 A;  4IHW A;  2XAQ A;  3MKZ A;  2FRH A;  3PIO F;  1H0M A;  2HS5 A;  2R7Q A;  3PQJ A;  4UVB A;  4X6A J;  2J5O A;  1LDJ A;  2Z33 A;  4CYC B;  3LWJ A;  1GV5 A;  1RZ4 A;  3U1K A;  3FZV A;  2B9S A;  1HC8 A;  3OYK A;  1K78 B;  4LLL A;  2IS4 A;  3M1C A;  4P1W A;  5EGO B;  2F5D A;  3WU1 B;  1JUP A;  2X85 A;  2EK5 A;  2L7K A;  1VQ7 I;  2OTL I;  3GCM A;  4GYG A;  1BR1 A;  3F8C A;  2VQC A;  2ZME A;  3VFZ A;  2TDX A;  3S15 J;  2LKS A;  3MN2 A;  3BCG A;  2E2J J;  3VWB A;  3H5N A;  3N97 A;  3P9C A;  4BDY A;  2P5K A;  1YX5 A;  3VEP A;  1N25 A;  2AHQ A;  3DPT A;  3CJQ B;  2LRE A;  2P0W A;  2FU4 A;  3H3Z A;  3BOQ A;  2OD5 A;  4BXX J;  5CW8 A;  1MZB A;  2ZCM A;  2GOM A;  2K3F A;  4F7Z A;  4RB1 A;  3MD2 A;  2VKE A;  1HDP A;  3W2W A;  4WIB A;  1YLF A;  5KK1 A;  5FRN A;  2E71 A;  1F9N A;  4HF1 A;  3QRF F;  2HVQ A;  3CF2 A;  4M3F A;  3VTI A;  3C2H A;  5D8L B;  1O7L A;  3HHG A;  3HYI A;  3CMA I;  2UUZ A;  2ZJP F;  2PQ8 A;  1BOA A;  2R7F A;  3QYF A;  2E1O A;  3QOD A;  1HLV A;  3JRA A;  3RKW A;  2XRN A;  1BC8 C;  2V79 A;  2JN6 A;  1WJB A;  1SMY F;  3RKX A;  3HRU A;  1MMN A;  3GLL A;  2Y9Z A;  5FKL A;  2R5Z B;  5TIS C;  1W5C C;  5CVI A;  3A1Y A;  2FJI 1;  3NRV A;  4Y33 A;  1HSJ A;  3LST A;  4A3K J;  3BZK A;  5LEK A;  5J1R A;  4ZJZ A;  3HTU A;  3DPJ A;  1J2X A;  2LNB A;  3DBH B;  2E7X A;  4BNC A;  4A93 J;  1J5Y A;  2GBY A;  2L01 A;  3F0C A;  3ISP A;  3JAM Z;  2FOW A;  2XB5 A;  1MBK A;  2DDB A;  1JJ6 C;  2H09 A;  1VQM I;  4UXN A;  2QUF A;  2ESH A;  4NBQ A;  1BM9 A;  5DAJ A;  2MG4 A;  1D0Y A;  2NS7 A;  4RA2 A;  3R6S A;  3LSH A;  3LSP A;  2P4W A;  2DTZ A;  3KYL A;  4E6K G;  3TO9 A;  3DLA A;  4BQN A;  3NXC A;  1QRY A;  2PMH A;  3WG7 H;  3Q0V A;  3SFZ A;  2VOO A;  1L3L A;  1IN6 A;  1R00 A;  2DA4 A;  1T95 A;  3LAP A;  2LKP A;  2KJB A;  4NC7 A;  5EFY A;  3CMM A;  3LA7 A;  5K7H A;  5AON A;  4DJA A;  3ERE D;  3PM1 A;  1WJ5 A;  3VYS B;  1Z6R A;  3C3W A;  2XKP A;  3I5U A;  4NQW A;  5F0H A;  3TW7 A;  2Z5U A;  3ANG A;  4ME9 A;  4XN3 A;  5FLM J;  2JPC A;  2DTR A;  2GQQ A;  2DMQ A;  1P7J A;  3I4N J;  5IYD J;  3F8F A;  3WE3 A;  4XLH A;  1QVT A;  4RLQ A;  2M8G X;  3IH3 A;  3MKY B;  1AU7 A;  4U7D A;  1Y8Q B;  2M8E A;  1O4X A;  2EB7 A;  2VKD A;  1H89 C;  5J40 A;  3BC8 A;  2NP5 A;  3V7R A;  4BE0 A;  3KP6 A;  2X6Y A;  1SAN A;  3OIQ A;  1DGR M;  3K4K A;  2BW3 A;  4WF2 A;  2A07 F;  2PMZ A;  3HTS B;  1F4K A;  3B81 A;  2WV1 A;  2NOG A;  2FUG 2;  2HTS A;  4EVI A;  2X9D A;  4IKF A;  1DP7 P;  2LTP A;  4DNC A;  1EV7 A;  2M4K A;  5CVU A;  5L3C A;  2R93 J;  1IDZ A;  2VN2 A;  3IUV A;  3JTG A;  1K61 A;  3PO3 J;  2STW A;  1LVK A;  2IA2 A;  4B43 A;  2Q1Z B;  4A3C J;  2V9P A;  1IF1 A;  1YHQ I;  3G1M A;  4D5C A;  3HUG B;  4EEF G;  3HOT A;  1TT5 B;  2W84 A;  1Y8R B;  3LA2 A;  5IP6 A;  4XL9 A;  3SYT A;  1KON A;  2XIG A;  4GO1 A;  1VF9 A;  3IUO A;  2DYR H;  2BYV E;  4G7H F;  2QBY A;  2DQR A;  3HZJ A;  1BI3 A;  3MKW B;  3HOW J;  4I0A A;  4EM1 A;  3FXQ A;  1B9M A;  2A5W A;  1ITY A;  4MEY F;  3JSJ A;  5M3F J;  1U8R A;  3B6C A;  3KX2 A;  2EQR A;  2DFI A;  4G6D A;  3S2W A;  3V8L A;  4A6E A;  2ZY9 A;  2M34 A;  4A3J J;  1UG2 A;  5J3L A;  3SDB A;  3IKV A;  4PCQ A;  4E7J A;  4IRI A;  2Z3Y A;  4ZZD A;  2O5R A;  3VDX A;  3NQO A;  2YX4 A;  1F43 A;  3D5L A;  4B48 A;  3HOX J;  2G0E A;  4AVZ A;  2X0L A;  2V1N A;  4ZH4 F;  2L4A A;  1D3Y A;  2DJN A;  3K6G A;  3LMM A;  1TTY A;  2BOL A;  3HM5 A;  4MGR A;  3C2B A;  4D7N A;  3FK7 A;  2G7L A;  2UXO A;  3HSF A;  2F4I A;  2L9V A;  1O3S A;  2XDN A;  4OWR B;  4ICH A;  3J81 Z;  3OS1 A;  1DU6 A;  1MMD A;  4D9J A;  2HPM A;  1WI3 A;  3LSK A;  3R61 A;  1BL0 A;  3PL8 A;  2CV1 A;  4ESB A;  2EPF A;  4HDV A;  3HBL A;  4H0E A;  3H9G A;  2FXA A;  2P8T A;  3AG1 H;  2FMY A;  3K9T A;  3LA3 A;  1Z0X A;  2VBY A;  3HL2 A;  3BG9 A;  2KL4 A;  2OPT A;  2MAB A;  2MFZ A;  5IYB J;  3L2W A;  3H5A A;  3GME A;  2H8R A;  3NPI A;  2VC0 A;  1AHD P;  1ZLJ A;  4ZZL A;  2IGN A;  5LRR A;  3TL4 X;  2OC6 A;  1P92 A;  3PNT A;  5DCM A;  5HSZ A;  1O3Q A;  5HNF A;  1R1U A;  4AD9 A;  2GXG A;  2PI0 A;  1XSD A;  2ELH A;  1W0U A;  3I0T A;  2JSP A;  2GA1 A;  1YRN A;  2OA4 A;  1DPU A;  3WTZ A;  2HPI A;  3K4M A;  3AQS A;  2Y9Y A;  3KZ9 A;  3CJR B;  2AO9 A;  2OCE A;  3HB9 A;  4BQQ A;  3F21 A;  3KKD A;  5L3E A;  3TO7 A;  2HEO A;  3D0S A;  2RC4 A;  1Z05 A;  4HF0 A;  5JR3 A;  1S8N A;  3CD6 I;  4GCK A;  1JXS A;  4UUT A;  2DCE A;  2VJ4 A;  3ABT A;  4BS9 A;  1MJA A;  5J6X A;  4CH7 A;  1G2H A;  2L0K A;  2O7O A;  3H36 A;  4MNU A;  3SZP A;  3M3Y J;  1R58 A;  1FLI A;  2L7F P;  3VVZ A;  5D18 A;  1B8I B;  1XDS A;  4JQF A;  4OIN F;  1Q1V A;  3EET A;  2DOF A;  1X1D A;  3FHZ A;  4FHT A;  2F5V A;  3F6O A;  4C2M A;  1T33 A;  2L9R A;  4BH9 A;  2O8X A;  1R1V A;  4B8X A;  2KKO A;  4DW6 A;  3CCE I;  1G3Y A;  1GVJ A;  1ZR4 A;  4P9U A;  2J5P A;  2XC7 A;  2LBF B;  4YFN F;  4EAT A;  1WH5 A;  3JSO A;  1EJ9 A;  3J7Z I;  5E3O A;  3ZMT A;  4JX4 A;  2Y0S N;  4XOR A;  2PFB A;  2KT0 A;  3QP5 A;  3QYE A;  3HOZ J;  1QVU A;  3CWR A;  3T5X A;  1D0Z A;  1YS6 A;  2OCC H;  4BUP A;  1HKT A;  1RKW A;  2YU3 A;  2CQX A;  3FKJ A;  3WGH A;  1U3E M;  2LOO A;  2OJE D;  3KEQ A;  2CYY A;  2E35 A;  3OYH A;  1T2K A;  5ERI A;  2AXL A;  4BJ5 C;  2YS9 A;  1VQ4 I;  5LD2 C;  2R7D A;  5D1R A;  2JA2 A;  3HKZ A;  4H4K C;  5FHP A;  4GFK A;  2GUH A;  2O7T A;  2JRM A;  1IV8 A;  2HYF A;  2EA4 A;  3BR1 A;  3IRR A;  3S14 J;  2NYX A;  3FK6 A;  2HOS A;  2KDO A;  3QQA A;  1SEU A;  1LEB A;  1SVL A;  2K7L A;  4CGR A;  2LYC A;  5CVJ A;  1VQK I;  2W57 A;  2G7S A;  2FF4 A;  3T6N A;  2ZME B;  2ZJQ F;  4B3A A;  1QO0 D;  3R0A A;  5LHG A;  4OD5 A;  5C4X J;  1FBU A;  1MNM C;  1T0F C;  2YSR A;  3ONQ A;  1V3F A;  1SD6 A;  4DOZ A;  2JRT A;  1R6R A;  1EF4 A;  2XPU A;  1XPX A;  2RNG A;  1HST A;  1ETY A;  2FBH A;  3FX3 A;  4KIB A;  2D1H A;  5E20 A;  4ZDO A;  1OYI A;  2LR8 A;  1FP2 A;  2EV6 A;  2NAZ A;  1UHS A;  1RI7 A;  1NTC A;  3HSE A;  2BXY A;  1ZAO A;  3GFJ A;  1ZYR F;  2VUM J;  3KZZ A;  3BZ6 A;  4LK1 F;  1XSX A;  2WWY A;  3PFI A;  1ZRF A;  1XS9 A;  2OQR A;  1F5T A;  1MGT A;  4CCM A;  3GEZ A;  4MLO A;  3BP8 A;  4ACI A;  1WRJ A;  2P5V A;  1P4A A;  3H35 A;  5FKO A;  3JRI A;  2O03 A;  4OIR F;  5FMP A;  2DA2 A;  4Y3O A;  4CUG A;  4DGW B;  1TP4 A;  4UV9 A;  3OYA A;  3BWG A;  2EV5 A;  3NAR A;  2QWT A;  2JTV A;  2A3S A;  2NVT J;  3S93 A;  3VB2 A;  3BTJ A;  3OYF A;  2UXU A;  1LEA A;  4HNU A;  3BCB A;  4HZF A;  4HEA 2;  4EGY A;  3WGG A;  3FF5 A;  3E5U A;  1J7K A;  5TRD A;  5CVV A;  2NS8 A;  1JJ8 C;  5GPC A;  2VPL A;  3KZY A;  2LVS A;  2M3A A;  2MH2 A;  4KNY A;  4B09 A;  3GUD A;  2GFN A;  1IV6 A;  4XRS G;  1FOY A;  3I71 A;  1BR4 A;  3DKX A;  1YTY A;  2EWN A;  2ZNY A;  4BQO A;  3IH2 A;  3VW1 A;  1R7J A;  4C3H J;  2FQ4 A;  2FSW A;  3CUQ C;  3EPZ A;  1XMK A;  1D1A A;  2M5W A;  4TV7 A;  4IRG A;  4B44 A;  4JL3 A;  2XGC A;  1B72 A;  2V26 A;  2DO7 A;  4OU0 A;  4PJL A;  4GRI A;  2W7N A;  3BJ6 A;  2M7A A;  2PN6 A;  4XRS A;  2A68 F;  1TQM A;  3DXJ F;  4IO9 F;  4JKZ A;  3CDI A;  3GFL A;  3H9Q A;  1BIA A;  1MW7 A;  1IO2 A;  2HU9 A;  1YIJ I;  1MH4 A;  2UXP A;  4OIQ F;  3VW0 A;  2X1D A;  2RDP A;  4PJ0 C;  4PZJ A;  3MZH A;  3KEO A;  3CP2 A;  4IHY A;  1J9I A;  2PMU A;  3NS4 A;  2Q0O A;  1FMV A;  1I1G A;  1APL C;  2ZCN A;  3IL2 A;  5K5R A;  2L2O A;  4G7O F;  3IAS 2;  3TDZ C;  3KET A;  1CF7 A;  2M4G A;  2ME0 A;  2G7U A;  5D4R A;  2MH9 A;  2JQ7 A;  2Y31 A;  4NQW B;  2VL8 A;  4Y13 A;  4MTE A;  5K1Y A;  3ZP5 A;  2I10 A;  2QCO A;  2R7O A;  4AIJ A;  1WI9 A;  1GDT A;  1HOM A;  1I3A A;  3DCF A;  3J7A Y;  2PEX A;  4IHT A;  1U9O A;  3OYI A;  2R7X A;  3WTT C;  2E19 A;  3GTJ J;  5GP9 A;  5GAE J;  4ENK A;  1LVA A;  3HIF A;  3RCO A;  3JCU C;  4U0Y A;  2MW8 A;  6PAX A;  2BW3 B;  2HVR A;  2HYG D;  5HNH A;  3GYH X;  1R71 A;  4FE4 A;  4HX8 A;  4R8H A;  5K7F A;  1ZAR A;  1XD7 A;  2DFE A;  2CW7 A;  4JX6 A;  2KHM A;  1JKR C;  2BEO A;  3ULQ B;  2CV2 A;  2EJR A;  2CW0 F;  2Q2E A;  3JW4 A;  2PJR A;  3OYM A;  3ZR8 X;  2W00 A;  5KHD A;  5CYV A;  1JGS A;  2E36 A;  3GTM J;  2QSG X;  2CS3 A;  4IHX A;  3B6A A;  4X0G A;  5JLX A;  1IW7 F;  3GTK J;  4F93 B;  1W36 C;  3S1M J;  3WTY C;  4G6Q A;  1FPQ A;  4BBR J;  2HOA A;  5H2F C;  1QZY A;  3O2P E;  4FET A;  4CCO A;  4C2M J;  3JR9 A;  4IEJ A;  4M6X A;  4AUX A;  3L2V A;  2QBY B;  2CWE A;  1TBX A;  3DF8 A;  2CFX A;  3OOP A;  2JWT A;  4BHP A;  4RB2 C;  2BHY A;  3PIP F;  5LGU A;  2DW4 A;  4KIS A;  4GXO A;  2EIM H;  2XAG A;  2DMU A;  2HQR A;  3VW2 A;  3TOB A;  3BQZ A;  1OPC A;  3R0J A;  2IW5 A;  2QA4 I;  1H88 C;  4CCK A;  4OIO F;  3RTR A;  3COA C;  4WK8 F;  4PGH A;  1F36 A;  3G3Z A;  1MSE C;  3VPR A;  1TL8 A;  5DM6 F;  4L5E A;  1HF0 A;  3BY6 A;  4IQ4 A;  4AID A;  1JHH A;  2BVL A;  1SFU A;  4HKU A;  5J8C A;  3SWH A;  1UEL B;  3DTI A;  4G9Y A;  3CCV I;  3RPU D;  3BJO A;  1BR2 A;  3K70 D;  1T39 A;  5C3E J;  3OYE A;  5D8K B;  5HS9 A;  1S3J A;  4YFK F;  4LG3 A;  1YE9 A;  2WB1 N;  4XLP F;  4OIP F;  3VIB A;  4UUS A;  1B8I A;  1I39 A;  2LFB A;  4ZC3 A;  4A3M J;  3M07 A;  2UZK A;  1H8A C;  2FEZ A;  3HTA A;  4CA0 A;  3ZRG A;  5IT3 A;  1S72 I;  4QSH A;  3E6C C;  1C0W A;  4U9L A;  3W2V A;  3KP7 A;  1UZC A;  4HQE A;  4OMY A;  1FMW A;  2EIK H;  5E17 F;  2B7E A;  3KLN A;  2DBB A;  4HNT A;  3QYB A;  4LB6 B;  1YJW I;  2KIM A;  3QBM A;  3J7A O;  2XAJ A;  4JP0 A;  1VQL I;  4AF5 A;  4HST A;  2VON A;  1UMQ A;  2G9W A;  4IZZ A;  2M0C A;  2HZT A;  1KYW A;  1YRN B;  4BHB A;  1KQ9 A;  2P7C B;  2BZT A;  2LY2 A;  2VT3 A;  1D8K A;  4OMZ A;  4UY8 I;  1RRJ A;  2DMN A;  1TQP A;  1MKM A;  1HXD A;  4I2O A;  3PSI A;  2ECB A;  5C4J J;  3A01 A;  3GTO J;  4O3M A;  4CDG A;  3FMQ A;  3MAJ A;  5FGM A;  1G3S A;  2F5E A;  1VQ6 I;  3N05 A;  4XKW A;  4A3E J;  2HWV A;  3L00 A;  3ZQ7 A;  3GVA A;  4CXF A;  1MDM B;  3MMY B;  2QKL B;  3K4C A;  1AA7 A;  2E60 A;  2JZY A;  3DFG A;  1T0F A;  2O0Y A;  5CQE A;  3KEY A;  4P55 A;  2CUF A;  1QPM A;  2ESN A;  3OV8 A;  3H9J A;  1UST A;  5D4S A;  2R3S A;  5FFX A;  4HV5 A;  2P81 A;  4XNF A;  3TBI A;  3PJR A;  1U2W A;  5HS8 A;  3S1N J;  3PAS A;  4XR6 A;  4WXC A;  3HPH A;  1N75 A;  2B0L A;  4PDK A;  4FQG A;  1R4M B;  2CUJ A;  3O6B B;  3S8P A;  3F1B A;  3VUQ A;  3LAJ A;  3PUB A;  1T38 A;  3H3V K;  4ITV A;  4A3L J;  4DYR A;  2YX7 A;  3V7C A;  2RQQ A;  3TO6 A;  3G56 A;  2LG4 A;  1IJW C;  2FNP A;  2PBX A;  2VQH A;  2K4B A;  4DBQ A;  4WXD A;  1JHF A;  4MQV A;  5EF6 A;  3FXO A;  2IEK A;  4M73 A;  1LUJ B;  4BJT A;  5D5U B;  1R5G A;  2E7W A;  4UB8 C;  1V5E A;  5ILU A;  1Z67 A;  5JHF A;  2GXA A;  4UHT A;  1Z9C A;  4IPA A;  2K4J A;  4KN4 X;  3E6B A;  3HPG A;  4DBR A;  1B59 A;  5JFR A;  2V7F A;  4IRV A;  2NNN A;  5B5E C;  3B02 A;  4U88 A;  2GEN A;  3CZ6 A;  3OIP A;  3SEQ A;  3KP3 A;  3QU3 A;  3CJT B;  1JTY A;  4DIQ A;  2KFD A;  5AIQ A;  3BTC A;  1KU2 A;  3CME I;  3ZQH A;  1HW2 A;  1UG0 A;  4K2E A;  2KJC A;  4A69 C;  4N9I A;  1WJF A;  3V42 A;  2X4H A;  1ETX A;  4NNJ A;  3GLX A;  5F0C A;  4GFB A;  3E6M A;  1N78 A;  3T8T A;  1EH7 A;  2MD0 A;  5ICE A;  1K6Y A;  5B3S H;  2P5L C;  2QWW A;  2VQG A;  3HJE A;  2A6H F;  3F3X A;  3ANP A;  3BHQ A;  1XTA A;  3CUQ A;  2GIZ A;  3HTH A;  1IXS B;  3GF2 A;  4EV0 A;  1U0J A;  1XGN A;  1FYK A;  2KDZ A;  1MMG A;  3V8J A;  2Y48 A;  1IXR C;  5ED4 A;  3DU5 A;  1HW5 A;  3ZPL A;  2OBP A;  4R1H A;  2K86 A;  2HDW A;  1XMA A;  2LH9 A;  2RRE A;  2OQG A;  4XN0 A;  1S7O A;  4BY7 J;  1AOY A;  2H1L A;  2HQN A;  3NWS A;  4IF4 A;  3GXO A;  3I54 A;  2DPU A;  1TLH B;  5FO5 A;  4QTR A;  4IQJ A;  4C2T A;  5AIP A;  5E18 F;  3PPB A;  2HFH A;  2JK3 A;  3G73 A;  4XBF A;  2OZ6 A;  1BJA A;  1FIP A;  2A69 F;  3KYD B;  5KAI C;  3TW6 A;  2HXI A;  3LWF A;  3GX4 X;  4D0P A;  1R23 A;  2LLK A;  3HRS A;  4BL0 B;  4GCT A;  4NN1 A;  3E5X A;  3MWM A;  2K02 A;  4KIF A;  1V55 H;  3A4C A;  2CU7 A;  5K58 A;  4U87 A;  3HRM A;  5L3G A;  1FYM A;  1ETK A;  2CW8 A;  1RNL A;  1FT9 A;  4O5V A;  2CJJ A;  2X6W A;  3O8H A;  2DA3 A;  2EFP A;  2HXO A;  3SZT A;  4HRI A;  5EDN A;  1WJD A;  5GAD J;  1V5G A;  2A6T A;  4Q48 A;  2W53 A;  2DOD A;  1IAW A;  1G3T A;  3GW2 A;  3CUO A;  3IRQ A;  1B72 B;  3LJL A;  1Y0N A;  5BMZ A;  2VIX A;  2X6X A;  3RYR A;  4ZYA A;  5GAH J;  5CLS A;  5IT9 Z;  3O8G A;  3AL0 B;  2RKH A;  3KZI C;  3AL0 C;  5DS9 A;  4Z6Y A;  3PSF A;  3ZQI A;  2K9N A;  4FIS A;  1JT6 A;  2JUC A;  2R0Q C;  2EFQ A;  3JRH A;  1O57 A;  4IXA A;  2FOK A;  1EA3 A;  5DDG A;  2BE5 F;  3P7N A;  1K4T A;  4S0H B;  4A2U A;  3DEE A;  2VPR A;  2HTJ A;  2W48 A;  1OCC H;  1CF7 B;  3K69 A;  2Z9O A;  1N77 A;  3IP4 B;  1OCZ H;  2GOX B;  4C9Y A;  3QWL A;  1MSF C;  3PUF A;  1IN7 A;  1ETV A;  5L3D A;  2FQ3 A;  4UB6 C;  3ML6 A;  3HOY J;  1U5T B;  2QQA A;  1SD5 A;  2OF7 A;  3RPU A;  2HYJ A;  2K9S A;  1U5T C;  2XHK A;  1ENH A;  2L54 A;  2ZBK A;  3TED A;  4IL6 C;  2XGX A;  3WGI A;  2CGP A;  1ZRD A;  5E3M A;  3GTP J;  2BY0 A;  4ESF A;  2LF7 A;  3WU0 A;  4CYD A;  2O8K A;  3FM5 A;  3CCR I;  1YJN I;  1TWH J;  4NHJ A;  3BQY A;  2M45 A;  1GV2 A;  4ZDL A;  2LF8 A;  1FSH A;  2JA8 J;  4BXF A;  4PJN A;  1WGX A;  4EM0 B;  2DOA A;  2R92 J;  1SMT A;  4ESJ A;  5B1A H;  1TQI A;  1VQ8 I;  2QF7 A;  1X4O A;  1XGM A;  3FXU A;  4Y15 A;  5H6Q A;  4KT5 C;  2E1N A;  2QSH X;  4XON A;  2Q2E B;  2CSO A;  5E8I A;  2PJR B;  3MNL A;  1IN8 A;  2DOE A;  5LHI A;  1YOV B;  1WJC A;  4I7H A;  4KDP A;  2K27 A;  4N4O B;  1ZTR A;  3H0G J;  3Q5F A;  2EZK A;  4A3B J;  3K10 A;  4EJV A;  4F3Q A;  5ICC A;  3L7W A;  1BIB A;  4Y17 A;  4LD5 A;  2VI6 A;  3BG6 A;  2STT A;  4U9N A;  3PNY A;  5J4V A;  1ZRE A;  4LJZ F;  2HQA A;  3OYN A;  2MD5 A;  3I64 A;  2V57 A;  2K40 A;  1X19 A;  1L0O C;  2PBI A;  2QQ9 A;  2E1M C;  5FGL A;  1D1C A;  4MXM A;  4O6J A;  5JVT A;  3TP0 A;  4QPO A;  3UNG C;  1G4D A;  4AU7 A;  2VJJ A;  1ETW A;  3BG7 A;  3U2R A;  4BEH A;  4CZC A;  1YFH A;  4YII A;  1FOW A;  5H20 A;  4XID A;  4F91 B;  2NX4 A;  4BBS J;  3OMY A;  3EUK L;  3EUH C;  4FX0 A;  2TRT A;  3RQ4 A;  2NVX J;  3BPX A;  2V9V A;  4IHS A;  2E2H J;  3RKY A;  3S1Q J;  2OER A;  3HC7 A;  2WAQ A;  3E7Q A;  2QM3 A;  3MZ8 A;  1ZG1 A;  1QHH D;  4DZJ A;  3BRO A;  2DA1 A;  1GXQ A;  1XGO A;  1P7I A;  2RN7 A;  5D6F A;  5E1Z B;  1BI2 A;  2QLZ A;  4MFD A;  3BCA A;  2ME6 A;  3I56 I;  4EJT A;  1Y0U A;  2BXZ A;  2H8W A;  2L3D A;  1ZGW A;  4A3F J;  5IY5 H;  2H27 A;  2BY1 A;  3ASN H;  4ZTJ A;  5F08 A;  3A2K A;  1MDM A;  4UUS B;  1Y56 A;  4PFO A;  4EJU A;  4II3 A;  5HLI A;  1A31 A;  2DQL A;  3MKL A;  2IGM A;  4RLF A;  2JVG A;  2RHA A;  2Z2S B;  1UHM A;  3WHB A;  4E7S A;  4M3D A;  1CGP A;  2Q24 A;  2G7H A;  4XOT A;  4A12 A;  4AVP A;  4Q5S F;  3L09 A;  4ETS A;  3NRG A;  2DLL A;  4MIM A;  5IYC J;  2XB0 X;  3E0J B;  1QZE A;  2R7Z J;  2XF6 A;  1SFE A;  4KIT B;  1LPQ A;  1PUE E;  3AG3 H;  1E17 A;  2QIB A;  3VVX A;  4F92 B;  2PX9 A;  1DUX C;  1UJ8 A;  2QKO A;  2DFF A;  3WTU C;  3K2A A;  1QHG A;  2H6B A;  2CUZ A;  5CXI A;  4DYC A;  2ZXW H;  4E70 A;  3OS0 A;  2VLA A;  3V8K A;  5M3M J;  3MEX A;  4BDZ A;  3OIO A;  3FM3 A;  3A02 A;  1LJ9 A;  1OMI A;  2K9L A;  2OU2 A;  1D1B A;  4GGG A;  2Q8K A;  4G6T B;  5LLQ A;  3S16 J;  3A01 B;  2JA6 J;  3CO6 C;  2A61 A;  1YJ9 I;  2JA7 J;  3TMO A;  4DVY P;  2Y75 A;  4IVN A;  2CV0 A;  2PLY A;  5JLW A;  4FCY A;  1LNW A;  1BC7 C;  3SXY A;  3V6G A;  4AYB A;  2IS6 A;  3QPL A;  3HGG A;  4EMS A;  5HAW A;  1SC7 A;  5FLX K;  3RI4 A;  1ON1 A;  2C6Y A;  5M5X J;  1IN5 A;  2DA6 A;  4ZTF A;  3NEU A;  5BQT A;  1JI8 A;  1NG6 A;  5DTD A;  1OR7 A;  1RR7 A;  4FAS D;  3MFK A;  2NVQ J;  1D5V A;  3WU2 C;  2HVS A;  1RES A;  2RQP A;  3OR2 C;  2KP6 A;  1MJB A;  4QLC U;  4KMF A;  4HX4 A;  4AC6 A;  4YZE A;  5E1W A;  3O60 A;  1MJ9 A;  3SHF A;  3WTX C;  1OIS A;  4XSZ F;  2A2F X;  3FXJ A;  2EIJ H;  2IS1 A;  4LG0 A;  3WTS C;  3JRB A;  1XCV A;  1ZQ3 P;  3K1P A;  3M8J A;  1LFU P;  3GEU A;  2M2E A;  3L1P A;  4EGZ A;  3B73 A;  4XLA A;  2R7V A;  4W1U A;  1PDN C;  4NEL A;  3BR6 A;  3VYT B;  1HDD C;  2QTQ A;  1VFC A;  3BTL A;  3P9I A;  2CQK A;  1SAX A;  4BY1 J;  4Y7N J;  3DTE A;  4UV8 A;  3LSJ A;  5FKM A;  5C44 J;  4EJW A;  1SVO A;  5BPI A;  4PJJ A;  2L02 A;  1T56 A;  2VJ5 A;  4KIC A;  1E3O C;  4LFU A;  2DK8 A;  4PFP A;  3OS2 A;  2UXH A;  2VJI A;  3VP5 A;  2DN0 A;  1R36 A;  3LSR A;  3TP3 A;  2V9K A;  4L0Z B;  4A3I J;  2LY1 A;  2DPD A;  4HW0 A;  3H1C A;  2ZJR F;  4PSW A;  4JK1 X;  1X58 A;  3ZQL A;  3SQN A;  3ZMU A;  2XSJ C;  1IRZ A;  1KU9 A;  1LFP A;  2Y69 H;  1DPR A;  3CUQ B;  4ON0 A;  3ZXS A;  3LNQ A;  2KQR A;  1LB2 A;  1TT0 A;  3REO A;  2QQB A;  2ID3 A;  2DFH A;  4A0Y A;  5IT9 K;  2E5N A;  3TGN A;  1BJZ A;  1YG2 A;  1QU3 A;  3K0L A;  3RQI A;  3HOV J;  1Y39 A;  3FBI B;  1B9N A;  5BNG A;  5C4Y A;  4XLF A;  2ZJ2 A;  5KAF C;  1B4A A;  1TZL A;  2ACJ A;  5HS7 A;  1UCR A;  3MQ0 A;  4BKX A;  1IG7 A;  3W3C A;  1IXC A;  2P7V B;  3AQT A;  2M0M A;  3FWE A;  4LOC A;  4RAY A;  3KP5 A;  1FBQ A;  2VE8 A;  2OAZ A;  4NC6 A;  2IPQ X;  3JSP A;  2CQN A;  2Y0M A;  3EYI A;  2F5C A;  3W6V A;  3COL A;  2MLK A;  2WBM A;  2KRH A;  2W85 A;  2A6E F;  3SDG A;  1DP3 A;  2CFO A;  2OTJ I;  3BT9 A;  1OYY A;  3VOE A;  3W6K B;  2PMZ N;  4MO7 A;  3N4M A;  2IRF G;  3BNI A;  1U5T A;  2XAH A;  2WV0 A;  4L0Y B;  1MMA A;  2LP0 A;  3DBL B;  4EJO A;  1UAA A;  4BXU A;  4LK0 F;  2MYS A;  3K4N A;  3L9F A;  3J80 Z;  4M9Z A;  4ASN A;  4BJ6 C;  4G8X A;  3BLY A;  4IJA A;  2DI3 A;  2FX0 A;  3IWF A;  1XB4 A;  3AKZ A;  3HIM A;  3BDD A;  1G3W A;  2HOT A;  3I4M J;  1MBG A;  5LGN A;  2RV8 A;  1XDU A;  1W1W E;  2D2W A;  3G71 I;  3KIO A;  1ZN2 A;  3PQK A;  3RZO J;  1YI2 I;  4HG2 A;  4RM3 A;  1OCP A;  3I59 A;  4G12 A;  4M9S A;  1RR8 C;  2ECC A;  2YVE A;  5LRS A;  4CCJ A;  1E0E A;  1GUU A;  3OYL A;  1MND A;  4M74 A;  3HOS A;  2GWR A;  1S5L C;  2AQE A;  4OAZ A;  2VKH A;  1A35 A;  1VQ9 I;  4XRF A;  3ZQG A;  4WWC A;  3F6V A;  5J1Y A;  4F55 A;  2NVU B;  1PYV A;  1R9T J;  2W1O A;  5J4Y A;  3EUP A;  2IBD A;  3FDY A;  1R49 A;  1MH3 A;  1RET A;  1PVE A;  2NVY J;  4LMY A;  2R7R A;  4FE7 A;  3DPL C;  3AAF A;  3OL4 A;  1WPK A;  1HW1 A;  3U21 A;  3CRJ A;  4ANJ A;  1SAU A;  4F52 A;  1LDK B;  2JMW A;  1A36 A;  1BW5 A;  2UXX A;  3PFY A;  3ZQC A;  4JYK A;  4EM2 A;  5IP7 J;  5E3N A;  3HEF A;  2W4S A;  1ZEL A;  1DQU A;  5ICG A;  2VBX A;  1JTX A;  2QKM B;  2BHZ A;  2R5Y A;  3ZMV A;  3LL7 A;  2CQ7 A;  1VQP I;  3EYY A;  3K1N A;  1R22 A;  3OWT A;  2QZ8 A;  3EUH A;  3KP2 A;  1KQ0 A;  3FMS A;  5D5V B;  5F0F A;  4BU2 A;  2EFN A;  2AS5 F;  5J8F A;  2CQQ A;  1WVR A;  1Z21 A;  3K2Z A;  4U0W A;  2KIQ A;  4L9N A;  5M5W J;  3L2C A;  4M3G A;  1M1E B;  1ZHF A;  1SD4 A;  2LSO A;  3VOD A;  2FML A;  2V6C A;  1W36 D;  1NK2 P;  2H6C A;  4NC8 A;  3ABU A;  1NH3 A;  1FYL A;  3G4S I;  4HAM A;  2F4O B;  3OR1 C;  2P6T A;  5DUK A;  2GLO A;  2XRL A;  2DYS H;  4QPQ A;  2QQ8 A;  2W24 A;  3JRD A;  4MK6 A;  4RAG A;  2NP3 A;  3DLL F;  4N9H A;  5EYR A;  3IKT A;  4P9F A;  3CC7 I;  4L9T A;  4FX4 A;  3OSF A;  3E6D A;  2MLG A;  2D5V A;  5K7Z A;  1YW7 A;  2XGE A;  1QNT A;  3BR0 A;  2JPB A;  3DQV C;  4N4N B;  4ZYG A;  1IRX A;  1FEX A;  3ESW B;  3M7G A;  3OY9 A;  1Z6T A;  3FXR A;  5EG0 A;  4IOA F;  2IS2 A;  3CF5 F;  4UVC A;  1FTZ A;  4YFX F;  5LGT A;  4L62 A;  2UWM A;  2FBK A;  4BEH B;  3P9T A;  1X1P A;  4RGR A;  4E7I A;  3DEU A;  3RPQ A;  1A04 A;  4V19 K;  1TWF J;  2CUE A;  3G6E I;  2ZFW A;  4I98 B;  2NRA C;  3C7J A;  1WWX A; 
#chains in the Genus database with same CATH homology
 1ZR2 A;  4GCK A;  4UUT A;  3ZOB A;  1OCT C;  4UDS A;  1ETK A;  2DG8 A;  1X2N A;  5FJ8 J;  2G3B A;  4XIC A;  2CJJ A;  1G2H A;  2L0K A;  1ETQ A;  2DA3 A;  2O7O A;  3O8H A;  4MFE A;  2HXO A;  4HNV A;  1VI0 A;  2L7F P;  3M3Y J;  2FJ1 A;  1B8I B;  5EDN A;  5D18 A;  3VVZ A;  1Q1V A;  1POG A;  1XC5 A;  3BR5 A;  5EEA A;  2ZOZ A;  1WH7 A;  4JX5 A;  3V78 A;  2W53 A;  2YU9 J;  3Q0W A;  1T33 A;  1K83 J;  2L9R A;  2ZCX A;  3A03 A;  3QPS A;  3MVP A;  1OJL A;  4GFL A;  4DW6 A;  3IH4 A;  1B72 B;  1AKH B;  2PZ9 A;  3LJL A;  1ZR4 A;  1S7E A;  3O8G A;  2LD5 A;  1WH5 A;  5DS9 A;  5F27 A;  3C07 A;  2HI3 A;  5E3O A;  4JX4 A;  2Y0S N;  3ON2 A;  2UXI A;  3HOU J;  3ZQI A;  2KT0 A;  2XSD C;  2K9N A;  4FIS A;  1JT6 A;  2COB A;  2R0Q C;  3HOZ J;  3S17 J;  1QVU A;  3CWR A;  3JRH A;  1RKW A;  4A3D J;  4S0H B;  2CQX A;  2VPR A;  2L7Z A;  2W48 A;  4PXI A;  1MBH A;  3HKZ N;  4AC0 A;  2XPV A;  2YS9 A;  2XPW A;  1QPI A;  3D1N I;  2WGB A;  5D1R A;  2LY9 A;  1MSF C;  2E2I J;  1LFB A;  3BG5 A;  1ETV A;  5FHP A;  3SFI A;  2GM4 A;  4GFK A;  2GUH A;  2O7T A;  3BR1 A;  3HOY J;  3S14 J;  2OF7 A;  4AYB N;  2HYJ A;  2K9S A;  1BW6 A;  3FK6 A;  3IV5 A;  1CQT A;  3QQA A;  2HOS A;  1ENH A;  1I50 J;  3HTJ A;  3TED A;  1ORK A;  4B4C A;  2HQ5 A;  4CGR A;  1ETO A;  2N8G A;  2G7S A;  3T6N A;  4B3A A;  1JKP C;  5E3M A;  3GTP J;  1NK3 P;  5E3L A;  5C4X J;  1MNM C;  2O8K A;  3QKX A;  4W97 A;  2XGD A;  3JRC A;  2B63 J;  5FLV A;  1TWH J;  3BQY A;  1EF4 A;  4B1R A;  1GV2 A;  2XPU A;  3HGY A;  5IOY A;  1ETY A;  2JA8 J;  2M9H A;  2DA5 A;  1WGX A;  3PO2 J;  3G7R A;  2CRG A;  2YVH A;  3EGQ A;  2EZL A;  2LR8 A;  1D5Y A;  2R92 J;  1UHS A;  2IAI A;  2QF7 A;  1NTC A;  1MBF A;  4GCL A;  3BR2 A;  3MNL A;  2VUM J;  3VOK A;  1TWG J;  4V2F A;  3BRU A;  1ZTR A;  1XS9 A;  3H0G J;  2DA7 A;  2EZK A;  4A3B J;  4FTH A;  3GTG J;  4XK4 A;  4I76 A;  2VI6 A;  4MLO A;  4ACI A;  2OI8 A;  1Y1W J;  5FKO A;  5HBU A;  4C3I J;  3JRI A;  1IDY A;  2VKV A;  2H1K A;  5FMP A;  2DA2 A;  2V57 A;  3JRF A;  1UI5 A;  2QWT A;  3NAR A;  2K40 A;  2NVT J;  2DG7 A;  5FGL A;  4MXM A;  3BTJ A;  3TP0 A;  2UXU A;  1ETW A;  3NI7 A;  2F07 A;  1JKQ C;  2RAE A;  3SJM A;  4XID A;  2NX4 A;  4BBS J;  2DMP A;  2NS8 A;  2TRT A;  2ZB9 A;  5M5Y J;  1LE8 B;  5GPC A;  1JJ8 C;  2NVX J;  3K7A J;  4C3J J;  2WAQ N;  2LVS A;  3ON4 A;  1U8B A;  5FKK A;  2E2H J;  2GFN A;  1IV6 A;  4XRS G;  3LOC A;  3S1Q J;  2OER A;  9ANT A;  3E7Q A;  3IH2 A;  3JRE A;  4DZJ A;  3VW1 A;  2DA1 A;  1PUF B;  3S5R A;  4C3H J;  1P7I A;  2FQ4 A;  1W0T A;  2L7M P;  5HOD A;  4MFD A;  2Y30 A;  2ME6 A;  1SGM A;  3WHC A;  1DU0 A;  1ZGW A;  2EZI A;  4A3F J;  4JL3 A;  2XGC A;  3HTI A;  3RD3 A;  3E7L A;  1AKH A;  1B72 A;  5GPA A;  5F08 A;  4UUS B;  4D5F A;  4XRS A;  1WCM J;  3RKQ A;  1OFC X;  3MKL A;  4JKZ A;  2HDD A;  1TWC J;  2EBI A;  1A6I A;  3LSG A;  2RHA A;  1JT0 A;  1XG1 A;  5IPA A;  3BR3 A;  2ZOY A;  3WHB A;  1MH4 A;  4DZP A;  4M3D A;  4RDU A;  3CQZ J;  3HDD A;  2Q24 A;  2UXP A;  3NRG A;  2MGQ A;  5AQC A;  3VW0 A;  2WUI A;  4IHY A;  4MIM A;  5IYC J;  4IHV A;  2XB0 X;  4NDL A;  1APL C;  2ZCN A;  4IHW A;  2R7Z J;  2ME0 A;  3Q3S A;  5J1U A;  4XRM A;  2QIB A;  3VVX A;  2Y31 A;  4X6A J;  1U78 A;  2QKO A;  3DEW A;  3K2A A;  4CYC B;  3LWJ A;  1GV5 A;  2G7G A;  2I10 A;  4DYC A;  3HE0 A;  2QCO A;  5CXI A;  1SFO J;  1GDT A;  5EGO B;  5M3M J;  3DCF A;  1HOM A;  3OIO A;  1JUP A;  1U9O A;  3A02 A;  1TWA J;  2E19 A;  3A01 B;  3GTJ J;  5GP9 A;  3OSG A;  2JA6 J;  3S16 J;  2JA7 J;  3S15 J;  1FTT A;  3MN2 A;  3BCG A;  2E2J J;  1TC3 C;  2MW8 A;  5JLW A;  4FCY A;  2AHQ A;  3V6G A;  3QPL A;  3HGG A;  4FE4 A;  5K7F A;  3KKC A;  5HAW A;  5CW8 A;  4BXX J;  1BA5 A;  4JX6 A;  2ZCM A;  1JKR C;  2VKE A;  5M5X J;  1HDP A;  2DA6 A;  3GBG A;  3NNR A;  3BJB A;  2ID6 A;  5DTD A;  3GTM J;  4IHX A;  1RR7 A;  3B6A A;  4M3F A;  2NVQ J;  5JLX A;  3GTK J;  1RES A;  4X1E A;  3S1M J;  4AC6 A;  2E1O A;  4YZE A;  3O60 A;  4BBR J;  1HLV A;  3JRA A;  2HOA A;  4C2M J;  2JN6 A;  3JR9 A;  4IEJ A;  4AUX A;  3JRB A;  1ZQ3 P;  1ZKG A;  1LFU P;  3GEU A;  2Y9Z A;  5FKL A;  2M2E A;  2R5Z B;  3L1P A;  2JWT A;  4W1U A;  3CJD A;  4NEL A;  3BR6 A;  2QTQ A;  1HDD C;  1VFC A;  3BTL A;  3NAU A;  2DMU A;  3VW2 A;  3BQZ A;  2RAS A;  1H88 C;  3KNW A;  4A3K J;  5J1R A;  4BY1 J;  3DPJ A;  4Y7N J;  5C44 J;  3LSJ A;  5FKM A;  1LE8 A;  1GVD A;  4A93 J;  1JUS A;  1T56 A;  2GBY A;  1F36 A;  1MSE C;  2R5Y B;  3VPR A;  1E3O C;  3F0C A;  4L5E A;  1HF0 A;  3VVY A;  2UXH A;  2XB5 A;  1MBK A;  4HKU A;  4Y52 J;  1JJ6 C;  5F1J A;  1IC8 A;  3VP5 A;  2DN0 A;  3ZQF A;  3LSR A;  5D19 A;  1MBJ A;  2HYT A;  1PUF A;  3TP3 A;  4A3I J;  2X6O A;  4DYQ A;  5C3E J;  5DAJ A;  4ABZ A;  3ZQL A;  1X58 A;  4M3E A;  5F04 A;  2MG4 A;  2JA5 J;  2NS7 A;  2WB1 N;  1IRZ A;  3LSP A;  3RH2 A;  1Y1V J;  2DTZ A;  2JJ7 A;  3VIB A;  4UUS A;  1B8I A;  1IUF A;  3NXC A;  2LFB A;  1QRY A;  4A3M J;  1H8A C;  1UI6 A;  3LNQ A;  3HTA A;  3BTI A;  4QSH A;  4QIW N;  2ID3 A;  3Q0V A;  5FKN A;  3Q0U A;  1BJZ A;  3BG3 A;  2DA4 A;  3HOV J;  3RQI A;  1Z77 A;  3G1O A;  5BNG A;  5C4Y A;  5EFY A;  4M6V A;  5K7H A;  2REK A;  3PM1 A;  3QBM A;  4RBO A;  4JP0 A;  4AF5 A;  3UKG A;  1U9N A;  1UMQ A;  4BKX A;  2D6Y A;  2M0C A;  1YRN B;  5EG0 B;  3FKI J;  1IG7 A;  5F0H A;  3TW7 A;  3ANG A;  3AQT A;  4ME9 A;  4LOC A;  4CYC A;  5FLM J;  1RKT A;  3FIS A;  2DMQ A;  1P7J A;  3I4N J;  4KWA A;  5IYD J;  5EGO A;  3W6V A;  3COL A;  2DMN A;  1QVT A;  2M8G X;  3IH3 A;  1AU7 A;  1O4X A;  3SDG A;  3JRG A;  1H89 C;  3BT9 A;  2ECB A;  5C4J J;  3A01 A;  3GTO J;  1X2M A;  2NP5 A;  2PMZ N;  4MO7 A;  2TCT A;  1SAN A;  3BNI A;  4A3E J;  2EH3 A;  2LP0 A;  2ELK A;  3B81 A;  2WV1 A;  2NOG A;  5CXG A;  2X9D A;  3CCY A;  1I3Q J;  2LTP A;  3VOX A;  2FX0 A;  2EZH A;  3HIM A;  2CUF A;  5EZG A;  2R93 J;  2HOT A;  3I4M J;  1MBG A;  1IDZ A;  3IUV A;  2QOP A;  2P81 A;  1JKO C;  1K61 A;  3PO3 J;  2LK2 A;  3S1N J;  3RZO J;  3PAS A;  2MSY A;  3OOU A;  3GTL J;  4D7M A;  1OCP A;  1VND A;  4G12 A;  4A3C J;  3LHQ A;  2LKX A;  2ECC A;  2YVE A;  3G1M A;  1GUU A;  2FBQ A;  3S2D J;  4D5C A;  3F1B A;  3VUQ A;  2Y2Z A;  3H3V K;  4EEF G;  5IP6 A;  3ZQG A;  4A3L J;  5J1Y A;  4DYR A;  1VF9 A;  1R9T J;  3G56 A;  1IJW C;  3EUP A;  2IBD A;  2PBX A;  3HOW J;  1MH3 A;  4A3G J;  1RET A;  2K9Q A;  2NVY J;  2R5Z A;  3S2H J;  4FE7 A;  3FIW A;  1FJL A;  1ZK8 A;  3GTQ J;  5EF6 A;  1I6H J;  2IEK A;  1ITY A;  3JSJ A;  2YUS A;  1WPK A;  5M3F J;  3B6C A;  3CRJ A;  2EQR A;  2JMW A;  1FIA A;  1RPW A;  2M34 A;  1JGG A;  4A3J J;  1BW5 A;  2IU5 A;  4J19 A;  3ZQC A;  4JYK A;  3RZD J;  1UG2 A;  5J3L A;  5IP7 J;  5E3N A;  3CDL A;  3HEF A;  3GZI A;  1JTX A;  2R5Y A;  1F43 A;  2GEN A;  3HOX J;  2G0E A;  1JTY A;  2DJN A;  3BTC A;  4V2G A;  3ZQH A;  5IOZ A;  3HM5 A;  5F0F A;  3C2B A;  4D7N A;  3FK7 A;  4A69 C;  2G7L A;  2UXO A;  2CQQ A;  5EZH A;  2XDN A;  5M5W J;  1ETX A;  4M3G A;  2HKU A;  4ICH A;  5F0C A;  4GFB A;  1DU6 A;  1JUM A;  1NK2 P;  1WI3 A;  1BL0 A;  1HCR A;  3ANP A;  3HBL A;  3BHQ A;  3HTH A;  1Z0X A;  5H9T A;  2GLO A;  3BG9 A;  2XRL A;  2KDZ A;  1A5J A;  2OPT A;  3G1L A;  5IYB J;  2O9L A;  2H8R A;  3NPI A;  3JRD A;  3M4O J;  4MK6 A;  2NP3 A;  1AHD P;  5EYR A;  5IP9 J;  2X48 A;  2DMT A;  3S1R J;  4BY7 J;  3OSF A;  2D5V A;  5HSZ A;  5K7Z A;  2XGE A;  3BR0 A;  1IGN A;  2FD5 A;  1GT0 C;  3FRQ A;  1W0U A;  1FEX A;  4JNN A;  1YRN A;  5EG0 A;  4QTR A;  4I6Z A;  3CMY A;  1FTZ A;  4L62 A;  3PPB A;  2JK3 A;  3AQS A;  2Y9Y A;  3KZ9 A;  3P9T A;  1FIP A;  3TW6 A;  2AO9 A;  2HXI A;  3HB9 A;  4M3B A;  2LLK A;  3KKD A;  4GCT A;  4NN1 A;  1TWF J;  2CUE A;  1MBE A;  2CU7 A;  5K58 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...