2DTZA

Crystal structure of multidrug binding protein qacr from staphylococcus aureus cocrystallized with compound db75
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
186
structure length
186
Chain Sequence
NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKKEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords HTH-type transcriptional regulator qacR
publication title Multidrug-Binding Transcription Factor QacR Binds the Bivalent Aromatic Diamidines DB75 and DB359 in Multiple Positions
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 76
structure length 186
sequence length 186
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2006-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2dtzA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2dtzA02
3JREA 3DPJA 1W0UA 2ZOZA 1ORKA 1Z0XA 3JSJA 2CRGA 4CYCA 4DW6A 1WPKA 4ME9A 2H1KA 1ETOA 3VW2A 2O9LA 1MBFA 1GT0C 3LJLA 3MKLA 1ETKA 2DA5A 2M8GX 2O7OA 3VUQA 2JA7J 3VP5A 5EG0A 3VVYA 3RKQA 3HTAA 5C4JJ 1MH4A 1MNMC 4L5EA 3GTKJ 2NVQJ 1BW5A 1QVUA 5M5YJ 2L9RA 1ZK8A 3RZDJ 3AQSA 5EDNA 4A3FJ 4DYRA 3M3YJ 3HTHA 1MBGA 2HOTA 3IV5A 1MSFC 3HTIA 3GTOJ 1ETVA 4A93J 2Y9ZA 3S2DJ 4HKUA 4DYCA 1UHSA 3WHCA 2DA3A 2DA4A 3BCGA 4GCKA 3VOKA 4ABZA 4A3CJ 2HI3A 2JN6A 3E7LA 2OERA 4JP0A 1LFUP 3BT9A 1BL0A 3HKZN 3ZQHA 3MVPA 3JRBA 3QQAA 1R9TJ 1T56A 1B72B 4ICHA 4RDUA 1GUUA 4A3BJ 2G3BA 2K9QA 2R0QC 2GENA 3HOYJ 3K2AA 2ID3A 2R5ZA 2V57A 1P7JA 4CYCB 2CUFA 3BTJA 3BHQA 3OSGA 3S1RJ 2CJJA 1RKWA 3A02A 5J1UA 4Y52J 4JYKA 2LK2A 1AHDP 5M3FJ 2DMTA 1BA5A 1JKRC 3HE0A 3IH4A 5EG0B 4B3AA 3S17J 3O60A 3A01A 1JTYA 1D5YA 2ECBA 4HNVA 1JUPA 2EZIA 3L1PA 1POGA 1LE8A 1VNDA 3HDDA 2FJ1A 1JUSA 2NS8A 5IOYA 4X6AJ 2MGQA 4UUTA 2M34A 5EYRA 3NI7A 3QPLA 3QBMA 2HOAA 5FMPA 2ME6A 4DYQA 3UKGA 3ZQCA 2XPUA 3T6NA 3C2BA 1OCPA 3FK6A 2N8GA 1F43A 2XGCA 1JTXA 3Q0UA 2Q24A 1H88C 5BNGA 5K7ZA 2ZOYA 5K7HA 2R5YA 2DA7A 2Y0SN 1PUFA 4M3GA 5F0FA 2FQ4A 2R5ZB 3VOXA 2AO9A 1ZR2A 2YVHA 4M3FA 4XRSG 2UXUA 3GTGJ 3FIWA 2VUMJ 3A03A 3BR5A 2W48A 2XPVA 1MBEA 1T33A 5GP9A 2F07A 4D7NA 2DA6A 2YVEA 4QTRA 4FTHA 2WAQN 4A3MJ 2LKXA 3A01B 4FE4A 4Y7NJ 1OFCX 5J1YA 3G1LA 4A3EJ 1HOMA 5E3MA 2UXOA 4KWAA 3AQTA 1LE8B 2ELKA 2GM4A 2OI8A 2LD5A 3NRGA 1AKHA 5C4YA 3G7RA 4FISA 1YRNA 2RASA 1UI6A 2W53A 2COBA 1GV5A 1MSEC 3JRIA 3HIMA 4IEJA 3JRGA 5D19A 3COLA 3FK7A 3B6AA 3C07A 5EZGA 1APLC 1HDDC 5CXGA 2Y30A 1RKTA 3FISA 2KDZA 1NK2P 2VKVA 4C3IJ 3HOWJ 5F0HA 2DMNA 2HDDA 4I6ZA 3KNWA 3OIOA 2R5YB 2XB0X 5C44J 1PUFB 5IP9J 2ZCNA 2L7FP 3B6CA 1F36A 4JKZA 1RPWA 1TWGJ 2WB1N 2LLKA 4XIDA 2DTZA 3ANPA 5DAJA 3SFIA 2XSDC 4JL3A 2XB5A 4DZJA 2JA5J 3HTJA 1VF9A 3SJMA 5FLVA 4A3JJ 2QWTA 3P9TA 3JR9A 1SANA 1BW6A 2D5VA 3MN2A 1ETXA 3S1MJ 4GCLA 4QSHA 2FBQA 1MBJA 1TWFJ 2DN0A 2G7GA 2IU5A 1WGXA 2EBIA 1AKHB 3H3VK 1YRNB 2X6OA 3G1MA 4GFLA 3LSJA 5C3EJ 4NN1A 3BR3A 2G7SA 1SGMA 3V78A 4XRMA 2K40A 3KKDA 2WV1A 2OPTA 2IAIA 1FTZA 2Y9YA 3JRAA 3ZOBA 1U78A 5E3OA 1U9OA 4DZPA 3TEDA 1U8BA 2LVSA 1B8IB 4XRSA 5GPAA 5HBUA 2LP0A 2NP5A 1WCMJ 1DU6A 2NVYJ 3H0GJ 3BTIA 1JT0A 4MXMA 3S2HJ 1ETYA 3BTLA 3Q3SA 3VVZA 4AF5A 3RZOJ 4IHVA 3TW7A 1RETA 3PM1A 2XGDA 5F27A 3I4MJ 5EGOA 2DG7A 1UG2A 3LNQA 2R92J 3G1OA 4NELA 3BRUA 2ECCA 1DU0A 2CU7A 2HYTA 4GCTA 4A3LJ 1BJZA 1H8AC 3HBLA 4A3GJ 1TWCJ 3TP3A 3VPRA 4GFKA 3D1NI 1Z77A 2HKUA 4YZEA 4BBRJ 3JRDA 1HCRA 2JA8J 3QPSA 2ME0A 4XICA 3NARA 2NX4A 3VVXA 2XGEA 2R93J 2CUEA 2ZCMA 2GBYA 3GTPJ 1K83J 3NNRA 1W0TA 5J3LA 4S0HB 5IYDJ 1EF4A 2NOGA 1WI3A 2EH3A 3GBGA 4D5FA 1VI0A 5FHPA 2IEKA 1ETQA 3O8HA 2NS7A 1X2MA 3W6VA 3FRQA 2E2JJ 2MSYA 1MBHA 3DEWA 1QVTA 4UDSA 3LOCA 2NVTJ 1JGGA 2EZHA 3S5RA 4IHXA 4X1EA 3WHBA 2M0CA 5FGLA 2P81A 2KT0A 1CQTA 4NDLA 5JLWA 4A3KJ 2DA1A 2JJ7A 2LR8A 3NXCA 4MFEA 2M9HA 4BKXA 5EGOB 4UUSA 5DS9A 3KKCA 2EQRA 3BR0A 2D6YA 2X48A 5FJ8J 2QIBA 3TP0A 5EEAA 4GFBA 1QRYA 2ZB9A 2R7ZJ 5AQCA 1JT6A 2CQXA 1ZTRA 3GTQJ 3EUPA 1UI5A 5IOZA 3E7QA 2K9SA 2M2EA 3K7AJ 1H89C 1XG1A 5FKOA 2YU9J 5JLXA 1HLVA 2VKEA 1I3QJ 1TC3C 5FLMJ 2FX0A 1IGNA 1I50J 1ETWA 2JK3A 2VPRA 1ZQ3P 4MLOA 4W1UA 5CXIA 3NAUA 2FD5A 1U9NA 3LSGA 1IJWC 5DTDA 1NTCA 2L0KA 5FKMA 3HOXJ 2UXIA 3ZQFA 1XC5A 1JKPC 5D18A 1K61A 3JRFA 4RBOA 4MO7A 1NK3P 2TRTA 2PMZN 3G56A 2REKA 2QF7A 1QPIA 4ACIA 2GLOA 5IYCJ 3CQZJ 3SDGA 4PXIA 3O8GA 4M3EA 2ZCXA 2DA2A 4UUSB 5EF6A 2XRLA 1A6IA 2DG8A 3BJBA 1GVDA 1S7EA 2TCTA 1IDYA 3CJDA 2HQ5A 3DCFA 4M3BA 4MK6A 3QKXA 4BY7J 1WH5A 4AC0A 5J1RA 1JKOC 1B72A 2E19A 1A5JA 2Y31A 3HGGA 1FIAA 4AUXA 3BTCA 3GTMJ 4L62A 2QTQA 4V2FA 3PASA 1Y1VJ 1WH7A 5F04A 4B4CA 1FEXA 4A69C 4EEFG 4QIWN 2RAEA 5F08A 2DJNA 4A3IJ 2UXHA 4BY1J 3ZQGA 3JRHA 2H8RA 4M6VA 5F1JA 1X58A 3HOUJ 2QOPA 2PBXA 2X9DA 2E1OA 3GTLJ 3NPIA 4JX4A 4D7MA 3CCYA 4AYBN 4BXXJ 5M3MJ 2HXIA 3ANGA 4MFDA 3BR6A 1FJLA 2QKOA 1AU7A 2YUSA 3PPBA 3RD3A 2WGBA 5IP6A 2LTPA 2NP3A 2EZLA 4D5CA 3BR2A 5IP7J 1JUMA 1TWAJ 2L7ZA 1XS9A 1RESA 1VFCA 4I76A 5K58A 1ZR4A 3FKIJ 3VW0A 5K7FA 3I4NJ 2GUHA 1E3OC 5HAWA 1I6HJ 3BG9A 4C2MJ 1ZKGA 5FKKA 2G0EA 3GEUA 2XPWA 3OSFA 2LY9A 1TWHJ 1MBKA 2DMQA 5IYBJ 3ZQLA 1SFOJ 2XDNA 4LOCA 3RQIA 2B63J 3S15J 2GFNA 1OJLA 4JX6A 3LSRA 2WUIA 3B81A 2G7LA 1IV6A 3RH2A 5F0CA 4FCYA 4J19A 1FTTA 3CMYA 1OCTC 3HEFA 3F0CA 5HODA 1FIPA 5FKLA 3VW1A 1GDTA 2HXOA 3LSPA 5EFYA 2AHQA 5M5WJ 4G12A 2HYJA 1X2NA 5E3NA 4IHWA 1HDPA 3S14J 3S1QJ 5HSZA 1Q1VA 1JJ6C 5C4XJ 2YS9A 3CDLA 2E2IJ 2RHAA 4C3HJ 1LFBA 2IBDA 3ON4A 4C3JJ 4IHYA 1JKQC 3KZ9A 3OOUA 3TW6A 1ITYA 1IG7A 3HOVJ 3Q0WA 3MNLA 2MG4A 2Y2ZA 2DMUA 2K9NA 3BG3A 4A3DJ 3S16J 2HOSA 9ANTA 2EZKA 4B1RA 4AC6A 3PO2J 2PZ9A 3BNIA 4MIMA 1ZGWA 2I10A 3BQYA 3GTJJ 2QCOA 2JWTA 3M4OJ 2LFBA 2O7TA 5IPAA 1Y1WJ 1O4XA 2CQQA 3JRCA 4JX5A 4XK4A 2NVXJ 3GZIA 1P7IA 2ID6A 1IUFA 3HOZJ 2E2HJ 1UMQA 2JA6J 3ON2A 3CRJA 2OF7A 3IH2A 5GPCA 2UXPA 2O8KA 3BQZA 3IUVA 1IRZA 2DMPA 4CGRA 3EGQA 2L7MP 3HB9A 5H9TA 5M5XJ 3HGYA 1G2HA 1ENHA 1RR7A 4W97A 1IC8A 1HF0A 1IDZA 5FKNA 5D1RA 3VIBA 2VI6A 4BBSJ 3IH3A 5CW8A 2JMWA 3BR1A 3PO3J 3S1NJ 3V6GA 5E3LA 3LHQA 3ZQIA 5EZHA 3HM5A 1GV2A 2MW8A 4FE7A 3LWJA 3BG5A 4M3DA 1JJ8C 3CWRA 3F1BA 1MH3A 4V2GA 4JNNA 1B8IA 3Q0VA
chains in the Genus database with same CATH superfamily
1W0UA 2HGCA 1Z0XA 4N9HA 3JSJA 1HSTA 3QU6A 4CYCA 4M72A 4DW6A 5ICGA 1WPKA 3WTSC 5BMZA 1T8IA 2HEOA 1NG6A 3K4BA 1W36D 3BROA 2H1KA 4Y33A 5FRMA 3PUFA 4DNCA 2IS2A 3MKLA 2A69F 2E71A 4CA0A 1Z9CA 2D45A 3MCZA 3VUQA 1K4TA 2OQRA 1IO2A 1P9QC 4IOCF 1MNMC 3LAJA 4OWRB 1FZPB 3HXLA 3ZMTA 4KICA 1P4AA 4N4NB 3FXMA 3R0JA 4BE2A 3T8TA 1KU9A 3MFKA 4HSTA 4NHJA 2NS0A 1MBGA 3GTOJ 5D6FA 1UHSA 4G7HF 3BPXA 3HC7A 3JTGA 4ABZA 3I4PA 3VOKA 3RKWA 2EILH 2KP6A 3BT9A 3HKZN 1S6LA 3A4CA 3FBNB 3MVPA 2Z3YA 1B72B 2EPFA 2VLAA 2W00A 3HOYJ 2B0LA 3C2HA 1XX5A 1DQUA 2CUFA 4CCJA 3BTJA 2DLLA 4U0YA 2VQGA 2CJJA 1RKWA 5J1UA 1G4DA 2B1EA 3ERMA 3J81K 3LL7A 4HA8A 1AHDP 3DTIA 3AG1H 1FBQA 1H0MA 1LDJA 1R5HA 2K85A 3DU6A 2H09A 2V1DA 2KIFA 4LD5A 1YW7A 3L1PA 1PDNC 2Q2EB 1JUSA 3IKTA 1MJBA 2EB7A 2MGQA 4UUTA 2M34A 3CMAI 3QBMA 5B1BH 3S32A 4GDFA 4AVZA 3UKGA 3J7AY 1R36A 1Y0NA 3T6NA 2CUJA 2XAGA 1F43A 2GA1A 2IVMA 4UV8A 4PCQA 1T95A 2ZNZA 4RMNA 5BNGA 1S7AA 2RVCA 2E1CA 2Y0SN 4FASD 2V1NA 1J59A 1KYWA 1Z21A 1TTYA 2A3SA 4GRIA 1BI1A 4UVAA 2R5ZB 5JI6A 1DP3A 2YVHA 3WG9A 1IN7A 1QGPA 2A07F 3FIWA 3BR5A 1N75A 1TW2A 1D8KA 5LHHA 1BC7C 4PFPA 2F07A 2LBFA 3FXQA 4FTHA 2WAQN 4A3MJ 4FE4A 4Y7NJ 1OFCX 2JQ7A 3G1LA 1MZBA 3ABKH 3V7RA 1L3LA 1DP7P 2CV1A 4LFUA 2GM4A 2FA5A 3ZXSA 4ENKA 2LD5A 1EKEA 1FP2A 3H5AA 2RASA 1ONVA 2HDCA 3DBLB 3EETA 5D4RA 3HL2A 2VASA 3HPGA 3GF2A 1W5CC 4IRIA 3I64A 3JRGA 3MKYB 3K69A 5EZGA 5CXGA 2Y30A 3PFYA 4M6YA 4YFXF 1NK2P 2VOOA 1PUEE 2XRNA 3OIOA 3KZYA 5JHFA 2YX7A 5HDNA 4JKZA 1RPWA 1FYLA 2FF4A 5CQGA 1EA3A 5DAJA 4LG3A 2DT7B 2JA5J 1YI2I 1VF9A 5LGNA 3F72A 2EV6A 5GADJ 2W57A 2A6TA 3P9TA 1BW6A 2D5VA 3MN2A 1XTAA 3HG9A 5FFZA 2XAJA 3S2WA 3OYIA 3OL3A 3DWLE 4QSHA 4XLPF 2KKOA 3DBHB 1V5EA 4I2OA 5J4VA 1QZEA 2EBIA 2IW5A 2B9SA 1AKHB 1YRNB 3H3VK 2WADA 2RNJA 2W85A 3G1MA 2HFHA 1O3RA 2X1DA 1MDMB 4CCNA 1WJ5A 3KP4A 1YS6A 2EJRA 3QOPA 2G7SA 3V78A 2BHZA 4XRMA 2QLZA 3KKDA 4BL0B 2BYVE 2ESHA 1FTZA 3JRAA 3ZOBA 4G94A 1DPRA 2X0LA 1W7PB 4I0BA 3FHZA 4DZPA 1EH7A 1LVAA 1U8BA 1OCRH 4P96A 4BJ6C 1B8IB 1MD0A 4XRSA 1FBSA 2W1OA 3CUQB 5DV5A 4EJTA 1U0JA 1GXPA 3DLAA 2IA1A 2UXXA 2ESNA 2O6GE 4LMYA 4WIBA 4LB5A 4AF5A 4IHVA 1BR4A 2GA2A 3CO6C 1RETA 3PM1A 2XGDA 1UG2A 1MMGA 4BDZA 2R92J 4NELA 1Y39A 2K4BA 3ZPLA 2HYTA 1YJWI 2IXSA 1TWCJ 2BZTA 4H4KC 3VPRA 3LQRA 1BC8C 2DQLA 4GFKA 2H94A 2JA8J 4XICA 3GFJA 5K5QA 3JSPA 4UB8C 2R93J 3K1MA 3CJQB 3NNRA 1WRJA 2HQRA 1U8RA 4CGZA 1XSDA 4S0HB 3KETA 3DFGA 1EF4A 1AA7A 3GBGA 4BHPA 4D5FA 3DTEA 4DOZA 2Y0MA 2NS7A 3M8JA 5GAEJ 1X2MA 2Z9OA 3W6VA 2L02A 1MBHA 3J7AO 4M6XA 2R7SA 1LFPA 2LH9A 1IRFA 3WHBA 3DV8A 2RC4A 1T39A 2KT0A 1CQTA 2LOOA 4KIFA 2P4WA 4E7ZA 3A0HC 2CFOA 5HNHA 2LR8A 2JJ7A 4YG2F 5JLWA 4ZDLA 4OMYA 3NXCA 3KP6A 3MEXA 3I55I 3NRVA 3T0YA 2GZWA 5DS9A 3OIQA 1I1SA 1FMVA 1LJ9A 2WY8Q 2K3FA 2R4GA 3COAC 3RI4A 3E6MA 5HVQC 2X48A 2CH0A 1WFXA 4PFOA 4GYIA 4GFBA 1K6YA 4HF2A 3HZJA 2CQXA 1UJ8A 1J7KA 3ZR8X 3EUPA 2STWA 2PG4A 2K4JA 2K9SA 3T8RA 2M2EA 1H89C 3FXJA 5FKOA 2YU9J 2PBIA 5JLXA 3CCMI 4Q4ZF 3K4KA 3GO5A 1BN5A 1EH8A 2PJRB 3GVAA 4W1UA 5KAIC 2LSOA 2FD5A 3NAUA 3OYMA 3N4MA 1IJWC 5DTDA 1NTCA 2LKSA 3HOXJ 5CVIA 2UXIA 3M07A 3G71I 1K61A 3LAPA 4RBOA 4MO7A 4CXFA 4HZFA 1N25A 3BJ6A 4EVIA 1Y0UA 2DOAA 1OYYA 2QF7A 2GWRA 2V9PA 5LRRA 2ZJ2A 4OOIA 3CQZJ 5IYCJ 4AU7A 4IO9F 4OU0A 1S72I 1TQIA 4N4OB 3O8GA 4BYYA 5EF6A 1A6IA 3FX3A 2E34A 5H2FC 4DJAA 5LEKA 2DXIA 2M4KA 3DCFA 1YLFA 3VTIA 5J1RA 3HRMA 1R5GA 2ZMEB 4HV5A 2E19A 2VQCA 3TKYA 2JRTA 1CF7B 4XLNF 2Y31A 3FMQA 1OR7C 2ZXJA 3HGGA 4QLCU 2ISYA 3K70C 1Z6RA 1LDDA 2QTQA 3PASA 1RZ4A 4HX4A 3TQNA 4EEFG 4BJ5C 1BI0A 1Z7UA 4PSWA 4BXFA 3WTVC 2QBYA 2UXHA 1K79A 4G7ZF 1ON1A 4DBRA 2CFXA 3CP2A 2H8RA 1R00A 3GYHX 1OCCH 1X19A 4M73A 1IF1A 4IPAA 2FU4A 4JQFA 1QNTA 4PGHA 2QOPA 2PBXA 3GTLJ 4IRGA 4O5VA 2M87A 3CDIA 3P5JA 1V3FA 1FJLA 2WAFA 4PJNA 4MTDA 3RQ4A 5J8FA 3KYCB 1TWAJ 4HNUA 2L2OA 4HF1A 4D9JA 2EINH 1D0ZA 3IP4B 3OYEA 3AG2H 4I76A 2WV0A 4IQJA 5K58A 3SHFA 4C9YA 1HKTA 5K7FA 2VBZA 3I4NJ 2DPDA 2PX9A 2ZFUA 5HAWA 3HHHA 3BG9A 1X1DA 3L2QA 3FMRA 4C2MJ 3GCMA 2DI3A 1ZKGA 4HV6A 4XQFA 5FFXA 3MZ8A 5LEJA 3TO9A 3FZVA 3OSFA 2LY9A 2A6HF 1WJAA 4EJVA 1X3UA 2VQLA 4YEJA 5IYBJ 1BR1A 1SFOJ 2XAHA 3RKYA 3BOQA 3ZQ7A 1OJLA 1ZGJA 4IVNA 4A5MA 2MC4A 5DM6F 1A31A 4PJJA 1YHQI 3KLNA 3EYYA 4QPQA 2MD0A 5F0CA 3RH2A 4FCYA 1FTTA 1GDTA 2CV2A 2AHQA 2ZJQF 2V9KA 5E3NA 4Y3OA 2R7WA 2OBPA 1MGTA 3CLOA 1OYIA 2EV0A 1FP1D 2NNNA 2JPBA 3QP5A 2KL4A 5AIQA 2RHAA 1W7PD 5FO5A 3FXKA 1MW7A 2RQQA 3O6BB 1XDSA 3FXUA 4IHYA 2TDXA 1JKQC 3IAS2 4O3MA 4RGRA 1LEBA 2HZTA 1ITYA 3M1CA 3HOVJ 5D8LB 4WX9A 5B3SH 3MNLA 3FF5A 2HU9A 2FMLA 4EATA 2DMUA 1ZH5A 3BG3A 2ZO4A 4A3DJ 1FSEA 4B1RA 1TQMA 3PO2J 2PZ9A 2EA2A 1OPCA 4XN3A 4GGGA 1P4XA 3IAM2 3GTJJ 1D1CA 3V7CA 3DKXA 2EIKH 2L4AA 3E3VA 1CGPA 4NC8A 2XAFA 2DYRH 5F1RA 2NVXJ 2QEXI 1P7IA 1ON2A 1IUFA 2FQ3A 2JVGA 3KEQA 4NC7A 3G6EI 2E2HJ 1XSXA 4IOAF 3K70D 3K1NA 5GPCA 3IUVA 3Q9SA 1YTYA 3WTUC 1ACIA 1T98A 1G3YA 5IY5H 4HQEA 3HB9A 3X2QH 4NB5A 3F8BA 1WSUA 1HF0A 5FKNA 2E7XA 3PO3J 1U3EM 1IXCA 5F6FA 5E3LA 2OZ6A 4CO8A 3LWFA 4RGUA 3M8EA 1FOKA 2MW8A 2QQAA 4HEA2 3GX4X 4FE7A 2WTEA 4BS9A 1N77A 3PNYA 3CUOA 3K4MA 3CJNA 1F4KA 1KA8A 1TP4A 3OYAA 4V2GA 2P5LC 2EFPA 3ZMVA 3MAJA 3VYUB 2A5YB 2QENA 3F8CA 1J0RA 1VQMI 1ORKA 1J09A 2ZNYA 2DAOA 1ETOA 2VIXA 3VW2A 2O9LA 4ESJA 2VB6A 1K7AA 2A6EF 2BEOA 4NNJA 1ETKA 1R4MB 2GOXB 2H1LA 2M8GX 3QYEA 3WGIA 4LK0F 2MBFA 3GMEA 3RKQA 3HTAA 4DBQA 3WTXC 2A68F 1T08B 3KZIC 1ZLJA 2X6YA 1GLNA 2Q2EA 3QYBA 4UVCA 1T38A 4TV7A 2YX4A 5L3EA 3RZDJ 3AQSA 2OQGA 3HTHA 3M3YJ 3IUOA 2VQHA 4D0PA 5JVGF 2AS5F 1MSFC 3E5XA 2HOTA 4MQVA 3AL0B 1MMDA 3WHCA 3LA2A 1TBXA 2K7LA 1OMIA 3R4KA 3VYTB 4AYBA 4GCKA 1WKMA 5LGUA 3HOSA 2AQEA 3E7LA 1RI7A 4JP0A 1U2WA 1BL0A 4YIRX 3BG7A 4I01A 3VYRB 3KIOA 2IT0A 1H9GA 1R9TJ 1D0XA 3QQAA 1T56A 4IXAA 4RDUA 1JE8A 2HOEA 2IGOA 4A3BJ 2A2FX 2G3BA 2R0QC 2UUZA 2O3FA 2RREA 2KISA 2R5ZA 2V57A 3MZHA 4M9SA 3JAMK 1RUOA 4ITVA 2MABA 3FXLA 4WWCA 1FY7A 2LK2A 2MA3A 3VB2A 3HE0A 4B3AA 1QA6A 3CC2I 3GFMA 1D0YA 2XF5A 1PJRA 1SVMA 3GZ5A 5K5RA 1IZ1A 2KJCA 2Z99A 3K10A 5DM7F 2CYYA 4HNVA 1JUPA 4KT5C 5DCMB 3HDDA 1ZHFA 1BOAA 4LIUA 1JHHA 3LSKA 5FLXZ 4E6KG 4L5IA 3NI7A 5B66C 3QPLA 3ZP5A 3QODA 2HOAA 2QKLB 4QWQA 4HG2A 2X6WA 2GXBA 1TZLA 3ZQCA 2XPUA 3C2BA 4C2UA 3BP8A 1JI8A 2F5EA 1R6RA 4BJTA 5LFAA 4JOMA 1RC9A 1YJNI 2ZOYA 4MTEA 3VWBA 4Y13A 5IT3A 3K4LA 2YVXA 4KISA 5ILVA 3DTKA 4XN0A 2DW4A 2NRAC 2PFBA 4M3FA 2VUMJ 1KQ0A 3F8NA 2DDAA 2XPVA 2DFFA 5GP9A 3OMYA 4PDKA 2XIGA 2Y0SA 3KCCA 2P0WA 4LLNA 1ZGAA 2HPMA 3EYIA 3A01B 1IXSB 5E3MA 3W2VA 3AQTA 1LE8B 2ELKA 2XKOA 1EJ9A 4YELA 2F4OB 2L01A 1J75A 1AKHA 3NRGA 1YRNA 2WAQA 1XMXA 2Q1ZB 1UI6A 2W53A 1GV5A 4EJOA 2QZ8A 2QA4I 3DPLC 3WTTC 3BY6A 1MDMA 4IF4A 3B6AA 3DF8A 1W4MA 2DQRA 5ILSA 1APLC 1P92A 2M30A 1SAUA 4YFKF 1HDDC 3HUGB 3FISA 2KDZA 5TISC 3RYRA 4C3IJ 2IS6A 3K4NA 2JSCA 4D1QA 1W7PA 2XF7A 5A2QZ 1WJFA 2XB0X 1PUFB 3ASNH 2ZCNA 1F36A 2COMA 3SWHA 3CCRI 1TWGJ 2HVSA 1XMAA 1BJAA 2WB1N 3CUQA 5CYVA 4XIDA 2IRFG 2KPMA 3DXJF 3SFIA 1PP7U 4JL3A 1I39A 2CQ7A 4Z6YA 3HTJA 3ELKA 2A61A 1IN4A 4OMZA 3S3NA 2X4HA 3JR9A 4P55A 2VC0A 3LSTA 1XSVA 3OYBA 3OYCA 1O57A 4OIRF 3PJRA 2OJED 4PUSA 4PJMA 1MBJA 1TWFJ 2FBQA 2DN0A 3L00A 2QQBA 1OR7A 2XVCA 4HPQA 3RJPA 4BE0A 2G7GA 3SXYA 1WGXA 2IU5A 3E97A 2ZXHA 2BY1A 2IGMA 1USSA 2YPRA 2KZGA 1BBYA 3VDXA 5FB2A 5ED4A 4GFLA 2EFWA 1FOXA 2M1BA 1R58A 1I3AA 2Y9YA 4M9XA 4OIOF 4XOTA 5E3OA 3GLLA 1U9OA 3TEDA 2P5KA 4FT8A 3KFWX 1WCMJ 1B1BA 3PQKA 3FKJA 4GYGA 2RN7A 1VQLI 4RAFA 3J80Z 2M7AA 3VVZA 3U1KA 4WK8F 3I4MJ 3BRUA 2P6TA 2DDBA 2ECCA 4XBFA 4AD9A 1DU0A 2R7TA 4GCTA 4DIQA 4UB6C 3WODF 4BDYA 4YZEA 1Z77A 4M74A 2VJ4A 2HKUA 4BBRJ 3JRDA 3QPSA 3OY9A 4E7HA 3BLYA 2NX4A 3LQQA 2XGEA 1XCVA 1S7OA 1IXRC 3KYDB 2ZCMA 1KONA 3GTPJ 1X1AA 5J3LA 5IYDJ 2ETHA 5FHPA 4L9VA 2E7WA 2PJRA 4HX8A 3FRQA 4BH9A 2MSYA 2A05A 2QYOA 5ICFA 3DEWA 5J40A 1QVTA 5TRDA 2NVTJ 3DP7A 2L9SA 3S5RA 3P9CA 4IHXA 4X1EA 2CGPA 1BI3A 4RGXA 2DBBA 1YIJI 1UG0A 3RYPA 2P81A 3K4JA 4EGYA 4B3XA 5FGLA 1TT5B 1BM9A 3EQLF 4A3KJ 4M9ZA 3IWFA 3ZMZA 1REPC 5EGOB 5DD8A 1YO5C 1L0OC 2HVQA 2CUZA 5IT9Z 2RKHA 3HTUA 2D6YA 2PN6A 2ZC2A 5E17F 2QIBA 2HQNA 1ZN2A 5EEAA 2CO5A 1QRYA 2ZB9A 2ZMEA 2R7ZJ 5AQCA 1ZTRA 1CF7A 4O6JA 1UI5A 3E7QA 5LD2C 3K7AJ 2XV4S 1UHWA 1HLVA 1I3QJ 4FETA 1UB9A 4AWXB 1I50J 1VQ6I 1ETWA 4P1WA 1YX5A 2JK3A 4R8HA 3CD6I 4XMYA 4XLAA 3WU2C 2WWYA 5CXIA 5DEQA 1Z7LA 4GO1A 2L0KA 1SMYF 4WXCA 4CYDA 2VBYA 2VONA 3ZQFA 1XC5A 5D18A 4HF0A 2EFQA 2RGVA 1QBJA 2PMZN 3K1PA 4N0BA 2D1VA 4ZYAA 4F3QA 1XDUA 1EH6A 2BY3A 4UHTA 3R60A 4U87A 4GXOA 3OS2A 4YFNF 3G3ZA 3C2GA 4UUSB 1Y8RB 2RV8A 4Z2YA 2DG8A 3TMOA 1S7EA 2YU3A 2V6EA 4RGSA 3CJDA 4M3BA 4MK6A 2JVHA 3OYFA 1WH5A 2BOLA 3TO7A 1ZAOA 3H3ZA 3S3MA 1P6RA 1DUXC 1FIAA 4AUXA 1ZLKA 4ZH4F 1LKXA 3IC7A 4WCGA 1FEXA 1YYVA 1TT0A 4A69C 4QIWN 2RAEA 2IGKA 1Z05A 3JTHA 5CQEA 3J81Z 2F2EA 1SEUA 2P7VB 5E1XA 2B7EA 1TL8A 1WJEA 2MLGA 4HX7A 4RA2A 2X85A 4M6VA 1X58A 4RB2C 3HOUJ 2X9DA 4U7BA 3CCYA 4LB6B 5L3FA 1V54H 3AAFA 2HXIA 3D5LA 4MFDA 1R49A 3BR6A 5DYMA 2YUSA 4ENJA 2CW0F 5IP6A 2CWEA 1HKSA 2IS1A 2NP3A 3BR2A 5IP7J 1JUMA 2M5WA 3HYIA 3OS1A 1VFCA 2W24A 1SD7A 2JRMA 4ESFA 2IA0A 3E6CC 4LK1F 1ZR4A 1SAXA 3VW0A 1Y6IA 2GUHA 3P9IA 4E7IA 2O61A 1FWZA 2R7XA 2VKDA 5FKKA 4IQ4A 4AIKA 3CC4I 2VXDA 4Y4RA 1Z91A 2RQPA 1T2KA 3FDYA 1WJDA 1X1CA 1FBUA 3D5SC 4XLHA 3I54A 3P9KA 4LOCA 1FOYA 3I53A 3NEUA 2R7DA 3RQIA 1BOBA 3S15J 2GFNA 5EEHA 3BWGA 3VODA 3RPUD 2WUIA 3OYNA 2WC2A 2JSPA 1X1PA 2G7LA 1IV6A 1LUJB 3CF5F 1YITI 1OCTC 5KK1A 5HODA 3D0SA 3WU0A 2HXOA 5D5WB 3LSPA 3V4GA 1FLIA 3AFHA 1R1UA 3L2UA 2HYJA 1K78B 2V9VA 3S1QJ 2QSFX 4ZZDA 2IJLA 2FOWA 4C3HJ 3BJOA 3ML6A 2JZYA 1LFBA 2IBDA 4AIHA 4E7KA 3ZN1A 3H0DA 2E35A 3KZ9A 2FE3A 1FOWA 1LDKB 1IG7A 3CCUI 2HYGD 2JTVA 1WJBA 1ZRCA 2BXYA 4ON0A 1J2XA 3FM5A 5LHGA 3S16J 2EZKA 3CCLI 4AM3A 4MIMA 5JR3A 1ZGWA 1XD7A 1E3HA 2JWTA 3M4OJ 2LFBA 3N97A 2F5VA 4HLXA 1Y1WJ 2ZXWH 1RR8C 2CQQA 4F93B 3JRCA 3GZIA 5HLGA 1LNWA 2VJJA 2ZXIA 2ID6A 4UY8I 2JA6J 3C3WA 3BG6A 3TOAA 1O7LA 2ISZA 2XAQA 1F5TA 1R7JA 1X4OA 5M5XJ 3CUQC 4HDUA 3T1BA 2DFIA 3ZRGA 1RR7A 3L9FA 4W97A 1IRGA 3VIBA 4HBLA 4N9IA 3T5XA 3V42A 2XSJC 2QM3A 1Y8QB 3LHQA 2P5VA 3ZCOA 3ZQIA 5EZHA 3ESWB 2BY2A 4CSWA 3DLLF 2E1NA 3KP3A 2J5OA 4B47A 3CCJI 1USTA 1YIOA 5K5OA 4FX0A 4CUGA 2MLKA 2CS3A 3H35A 3F1BA 4BGDA 2FBIA 3U9GA 3DPJA 2ZOZA 4DGWB 3CCSI 2JUCA 2CRGA 3H3UA 2Y69H 4HOBA 4BEHB 2JUGA 3CJTB 1IN6A 1QPMA 1GT0C 2DA5A 3F6OA 3SEZA 5GTHC 3LSHA 4L9JA 4B48A 2OU2A 4XOPA 5C4JJ 4L5EA 5FD6A 3GTKJ 2XGXA 1BW5A 3L2CA 5DCMA 1IV8A 2XASA 4ZYEA 1ZK8A 2VE8A 4F91B 5EDNA 4A3FJ 3IV5A 1WI9A 1ETVA 4A93J 4DYCA 4EM0B 2HZDA 2DA3A 2DA4A 4HQMA 3PUBA 4A3CJ 2OERA 2P7CB 2H8WA 2L9NA 1R4NB 4A0XA 5HS8A 1BIAA 4ICHA 1QU3A 1T0FA 4FHTA 4IZZA 2GENA 3K2AA 3VOEA 2ID3A 3HHGA 1P7JA 4UV9A 2IS4A 2AQFA 1XGMA 3L2VA 3EUKL 3FHNA 4R1HA 5LBQA 1LVKA 3CDHA 3G2BA 5M3FJ 2DMTA 2G7UA 2GOMA 2Z16A 4ESBA 4KDPA 5EG0B 3W6KB 3A2KA 3O60A 1D1BA 3A01A 5ICEA 4Y15A 2VT2A 2Y48A 1POGA 3TGNA 1VNDA 1LE8A 3I59B 4CHUA 2FJ1A 2HTSA 5IOYA 1R23A 3F23A 2OCEA 3SEQA 3NWSA 5EYRA 4KUMA 4EJUA 3AG3H 3OIPA 2QWWA 2ME6A 2HKOA 3RPQA 4XLCA 2IPQX 1OCPA 3HUGA 1R1TA 2XGCA 2NXNB 1JTXA 4IKFA 1H88C 3KYLA 3K8PC 3QOEA 1A04A 2LF7A 2RDPA 4C30A 3Q5FA 1RUNA 1PUFA 3M8FA 5F0FA 3H92A 2FQ4A 3HJEA 5KHDA 3BZKA 3ABUA 2ZMEC 5AONA 3ZMDA 4ZYHA 1WVRA 3LFKA 4XRSG 1ZR2A 3C1DA 3GTGJ 4IL6C 2VL8A 2JT1A 3IKVA 1IUYA 4NQWB 2W48A 4Q48A 1GHCA 2JPCA 1FC3A 1MBEA 3OWTA 4RM3A 3KP2A 1TQPA 3S3OA 1VQPI 3MKZA 1HOMA 2UXOA 4KWAA 3MMYB 3RPUA 3H9QA 1PP8F 2BV6A 4KN4X 2OI8A 4OD5A 1KYZA 5CJ9A 4Q5SF 5J47A 4FISA 1BIBA 3G7RA 4A0YA 3DBRB 2COBA 2VC1A 2PQ8A 1E17A 2OAZA 1MSEC 4BHBA 3JRIA 4U7DA 1XN7A 4IEJA 5D19A 2JA2A 3COLA 3CCVI 2M4GA 1G8XA 3C07A 2DTRA 3F3XA 1B6AA 3SZGA 2V1UA 3R6SA 1ZRDA 4KMFA 2VKVA 2OD5A 3U2RA 5F0HA 2DMNA 3KNWA 2DO7A 3W3CA 3SZPA 2R5YB 5C44J 4XKCA 2L7FP 3P7NA 1GVJA 2KFDA 4NUBA 3ANPA 2DTZA 2FBKA 4EM1A 5D8KB 4CCLA 4A0ZA 2XSDC 4DZJA 2GAUA 4A6DA 3SJMA 5FLVA 1V5FA 2BVLA 5HDKA 2QWTA 2CW8A 2EFOA 2WB1A 3CP8A 1ETXA 2LKPA 2R7FA 4EQQA 3K4CA 2PJPA 3S1MJ 4GCLA 2BGCA 4U0VA 1V55H 3FWEA 1SFKA 1K4SA 3ZN0A 2ZJRF 3OS0A 3F6VA 1UAAA 4LITA 1XPXA 5C3EJ 3BR3A 2CMPA 2M45A 3TO6A 1S9HA 2DFHA 2IAIA 4UVBA 1HW5A 3F8MA 2DOFA 1U78A 3AG4H 2HWVA 5B5EC 4F7ZA 2HDWA 1SFXA 3D5RC 3EPZA 2LVSA 1F1ZA 3GZNB 3HSEA 4S04A 5HBUA 1EV7A 3OYJA 4J01A 3EUHA 5J8CA 4BNCA 5LLQA 1JT0A 3VFZA 1ETYA 2K02A 3HKZA 3OYLA 3RIRA 3NQOA 1YOVB 2W82A 2R7QA 3TW7A 1WZ2A 3V8KA 5EGOA 3W2WA 2DG7A 3LNQA 3FXRA 1B4AA 1QQIA 1A35A 5E8GA 3HSRA 1BJZA 3J7YJ 1H8AC 3HBLA 4KN7X 3TP3A 2HNHA 1LEAA 4KT6A 2V4JC 1YJ9I 3H1CA 1RIOH 3L2RA 2ME0A 3NARA 5HOOA 4AIJA 2PLYA 2GBYA 4L9TA 1OQYA 4CZCA 3RSNA 4MQ9F 3N05A 1SD6A 1VQ8I 2ZFWA 4RM2A 1WI3A 2EH3A 4BQQA 5D5UB 2L7KA 1VI0A 1MKMA 1ETQA 4I02A 3FM3A 3WGGA 2DCEA 3LOCA 2LY1A 5GAGJ 2ZBKA 5F64A 3VEPA 3CO7C 1E2XA 3IWZA 2F5FA 4OAYA 4CH7A 4XL9A 2R7UA 1UFMA 3M1EA 3V8JA 2LG4A 4LG0B 4A5NA 1HW1A 3QAHA 3VSLA 3GFLA 4MFEA 3QPHA 2M9HA 4BKXA 5B1AH 4DVYP 4UUSA 3HRTA 3K0LA 4RB3C 3ERED 3KLOA 3LA3A 4I0AA 2EQRA 3V7SA 3BR0A 5FJ8J 3TP0A 4ZTFA 4H0EA 3PSFA 4BAYA 2YR2A 4HW0A 3A1YA 2H6BA 2UZKA 3J7ZI 3GTQJ 2KIMA 5IOZA 2VBXA 3CMEI 1IW7F 3K6GA 1TC3C 4PK4A 2F4IA 3BPVA 5FLMJ 2FX0A 2CW7A 2PEXA 1R1VA 4MLOA 4XKWA 2LDUA 3BDDA 3AL0C 4EJWA 1U9NA 1Y56A 2O8XA 5FKMA 5DD4A 2EK5A 4ETSA 2Z2SB 3HIFA 2ZSIB 5D6EA 2W4SA 3JRFA 1NK3P 3K9TA 2TRTA 3EUAA 2REKA 1VQ5I 4ACIA 2GLOA 2K9MA 4XKVA 4OINF 1IAWA 2Q0OA 4HLYA 1NH3A 2VJIA 2HQAA 1X3ZB 1ZYRF 2DA2A 4JK1X 5EEGA 2XRLA 4G6TB 5BS6A 3BJBA 2K27A 2LMDA 2TCTA 3C18A 4BY7J 1QZYA 1TW3A 4X0GA 1SVOA 3GXOA 5DCFA 1JKOC 1VQ7I 3I3LA 2J5PA 4Q47A 1A5JA 5JFRA 2E5NA 2PMUA 1D8JA 3KEYA 3H5NA 1FSHA 1J9IA 4V2FA 3SDBA 3NWTA 1WH7A 5E1WA 3A0BC 4B4CA 4U9NA 3JAMZ 2F48A 4RB1A 4A3IJ 4BY1J 3CJRB 3DKYA 2IA2A 3MQ0A 3SQNA 2L54A 3ECHA 4WF2A 3TBIA 2FRHA 3ZQGA 2OZUA 2VOPA 2DK5A 5F1JA 3L2WA 3OR1C 4WXHA 3GWZA 2E1OA 3SFZA 1V4RA 4KJZA 3H36A 1Z3YA 2EIJH 1KU3A 2E60A 4XNFA 4AYBN 4D7MA 3NPIA 5M3MJ 3F22A 3W2AA 2D1HA 3ULQB 1T0FC 1JHFA 2H27A 2WGBA 2LTPA 5L3BA 1K78A 5E8IA 2EZLA 1BI2A 4D5CA 2L7ZA 2QVOA 3B73A 4CCMA 4UNOA 2KZVA 2AXTC 3WE2A 1FPQA 4BXUA 4EMSA 1FMWA 2E1MB 2FBHA 4KMUX 3KPHA 2K3PA 2KJBA 3PFIA 3FKIJ 5CVUA 4MNUA 5ICCA 4IHTA 1XGOA 2ELHA 5BQTA 1I6HJ 2BW3B 1DDNA 5CKTA 2W25A 1B9NA 2DT6A 2QSHX 3TDUC 3H9JA 4NC6A 2G0EA 3ABLH 5CPRB 1OYWA 4PJLA 1O3TA 4RLFA 2NNYA 2BHYA 2ACJA 3GEZA 2L3DA 1MBKA 4BUPA 3ZQLA 3GZ6A 1I1GA 2XDNA 2DOEA 1Z1DA 1MNDA 2DFEA 4JX6A 4F55A 1VQ9I 1I5ZA 3QPTA 3I71A 2STTA 4J19A 3QU3A 3F0CA 4II2A 2FMYA 5FKLA 2GQQA 2M3AA 5M5WJ 3PSIA 1YW9A 1U5TB 1X2NA 1ULYA 1HDPA 5HSZA 1Q1VA 4PGGA 2R7VA 3CDLA 2KRCA 4LLLA 1K6OA 1X4PA 2E2IJ 5H6RA 4CZZA 3E1SA 5E20A 5EJCA 4KITB 3GFIA 2X51A 2LYCA 3OOUA 1P2FA 3CZ6A 5FD5A 3RDIA 4ASNA 1D1AA 2Z5UA 4HDVA 4EV0A 2MC3A 3H9GA 2R7RA 2EWNA 1I27A 2XC7A 3F21A 2HOSA 2HR3A 4BEHA 2W84A 1U6GA 4S05A 2QCOA 1T6SA 4PJ0C 2O7TA 2X1CA 1O4XA 5DUKA 4JX5A 4XK4A 5J6XA 4R79A 1MMAA 3HOZJ 1UMQA 5L3DA 4G6DA 4C2TA 3ON2A 2O5RA 2OF7A 3CRJA 2LY2A 3IH2A 2UXPA 3BQZA 3HSFA 1IRZA 2DMPA 1OKRA 4OAZA 1SMTA 1XB4A 5H9TA 3HGYA 4ENMA 3QRFF 3PQJA 2WA0A 1ZG1A 1ENHA 5D1RA 1IC8A 1IDZA 1UHMA 3UNGC 3IH3A 4BBSJ 2JMWA 2QQ8A 1HA8A 4RAZA 2V1XA 1YS7A 3ABMH 3ECOA 4I98B 1VQ4I 3LWJA 2KMUA 3BG5A 2DJIA 2E1MC 4M3DA 2KIQA 3ZGKA 4JNNA 2IP2A 3Q0VA 1LFUP 3MWMA 3JREA 2O0YA 2HPIA 2XKPA 3GUDA 3HPHA 1IN5A 3KZZA 1S5LC 2XDVA 4ME9A 2F5DA 4AVPA 1MBFA 2VJ5A 3LJLA 2O7OA 4DQ2A 2CQNA 2JA7J 3VP5A 3RTRA 5EG0A 3VVYA 1WJCA 1O3QA 2KHMA 1MH4A 2NVUB 2NVQJ 1QVUA 2PMHA 2QKMB 5M5YJ 4XLEA 2L9RA 3I59A 1XMKA 2BXZA 4BU2A 3BJAA 3OYKA 5KCMA 3M9AA 4CDGA 2OUMA 3EUHC 3LSIA 4DYRA 3HTIA 4RAYA 2Y9ZA 1U5TC 3FBIB 4G6QA 3S2DJ 4HKUA 4XONA 3ZMSA 3BCGA 4E70A 3I56I 3G73A 2ICWG 2HI3A 4I09A 2JN6A 2H6CA 5LHIA 4BQOA 3ZQHA 1VQNI 2BVMA 3JRBA 3WTWC 1GUUA 2K9QA 4YIIA 2DODA 4F52A 4CYCB 4I7HA 2OCCH 3BHQA 3LMMA 2R7OA 2ZKZA 4HNTA 1YX3A 3OSGA 1PVEA 3S1RJ 3A02A 3WG7H 4Y52J 4NQWA 4PZJA 2FSWA 4JYKA 2QGUA 4CCKA 4L0ZB 1ZRFA 4OIQF 2VXZA 4G8XA 1BA5A 1JKRC 3IH4A 3S17J 2BE5F 1W5TA 1JTYA 3E5QA 4BHCA 1D5YA 2ECBA 2MD5A 2NAZA 2EZIA 1KQ8A 2HS5A 3V8LA 3HTSB 1FT9A 2NS8A 1RRJA 4X6AJ 2KRHA 3LSMA 2ZY9A 1R71A 4L0YB 1DGWY 2LF8A 2A5WA 5FMPA 3BC8A 3VSKA 1A6QA 3PIOF 1JXSA 4DYQA 3FK6A 5DUIA 2N8GA 1ERDA 3Q0UA 5ERIA 2Q24A 3OYDA 4WXDA 5K7ZA 4HRIA 2OTLI 5K7HA 1P4WA 2R5YA 2DA7A 2IGNA 3RKXA 3U1DA 4M3GA 4EGZA 3VOXA 4ZC3A 3ONQA 4XLFA 2AO9A 2G9WA 2UXUA 3A03A 4RAGA 3VYSB 2P8TA 1ODDA 1R22A 3M7GA 4U88A 1PYVA 1T33A 4E4HA 5BPIA 2C6YA 4D7NA 1B9MA 2DA6A 2YVEA 4QTRA 1VQOI 1XGNA 1Z67A 5AIPA 3RCOA 2LKXA 2KIUA 3DPUA 4XSXF 5J1YA 4A3EJ 3CCEI 2FNPA 3ISPA 1OLTA 1LPQA 3CF2A 4LLGF 5C4YA 4FQGA 4XKBA 5HNFA 4IRHA 1KGSA 3S93A 2QSGX 2NYXA 4HYEA 3KX2A 3HIMA 1X3WB 3FK7A 2XUBA 4ZDPA 1G3WA 4E7JA 1RKTA 2LREA 3HOWJ 3NS4A 3GW2A 4I6ZA 2HDDA 5J4YA 1I6XA 5IP9J 3B6CA 3IHUA 4XORA 3KP7A 4B09A 4LIVA 5FROA 2K9LA 2LLKA 2UV1A 2Z1DA 3WGHA 1HC8A 1X1BA 3G4SI 2XB5A 3R0AA 3OV8A 3DPTA 2FOKA 3BCAA 5KVRA 2LBFB 4A3JJ 5FRNA 3REOA 2VKHA 4MEXF 5HS9A 1SANA 4B8XA 2WAEA 3I5UA 4ZJZA 2QUFA 3I0TA 3Q9VA 2V79A 3OYGA 3HOTA 4BQAA 1SD4A 1HSJA 1NG7A 3R61A 4P9FA 2X6OA 4L9NA 1LB2A 1XGSA 3LSJA 1XCBA 2KRFA 4ZZLA 2VE9A 4B44A 2DPUA 3WE3A 4G7OF 3DEUA 4NN1A 4HSRA 2HVRA 4LJZF 4MGRA 1SGMA 2K40A 2OV7A 2D2WA 2OPTA 2WV1A 3BZCA 1D5VA 5L3GA 3K2ZA 2E5ZA 4UXNA 1HW2A 5TJJA 1MNEA 2WY7Q 5GPAA 3UR3C 3CLQA 3TOBA 2LP0A 2NP5A 1DU6A 4BQNA 2NVYJ 3H0GJ 1YQAA 3BTIA 2PFVA 4MXMA 3S2HJ 2X1EA 1MJAA 3BTLA 3Q3SA 4MEYF 3WTZA 4CCOA 4LG0A 3RZOJ 1FNNA 5F27A 4BE1A 1YG2A 1W5SA 2HKXA 3LA7A 3E0JB 3G1OA 1WQ2A 2CU7A 4A3LJ 4A3GJ 5JHUA 1IRXA 4KA4A 3O3KA 3D1NI 1O7FA 2FNAA 3I9V2 1HBXG 1HCRA 1J5YA 3VVXA 2L5QA 2CUEA 2CQKA 1K83J 2MFZA 1G59A 2KLOA 1W0TA 4IJAA 5ILUA 2NOGA 5FGMA 1OCZH 1SFEA 2OTJI 2M7BA 1G3SA 2XROA 2IEKA 1ZG5A 3O8HA 1AOYA 4V19K 2E2JJ 1QO0D 2OC6A 3U21A 2NOJB 4UDSA 3FMSA 1ZARA 1JGGA 2EZHA 2FJI1 2K5CA 2CV0A 5L3CA 1HKQA 1MMNA 2FXAA 2VBWA 3CTAA 2M0CA 2LRDA 1QHHD 4ZTJA 1TNSA 4NDLA 2DA1A 4KNYA 3FXOA 3ROUA 3IRQA 4ZDOA 2L4MA 3KKCA 5TGTA 1E0EA 4OD4A 1QZZA 1S3JA 2QQ9A 3WTYC 1UELB 5E18F 4RS8A 4OIPF 3KP5A 1SFUA 3I58A 2M0MA 2I5UA 1JGSA 1UCRA 1Z6TA 1JT6A 5FLXK 2E36A 2M8EA 2B3WA 2F4MB 1RNLA 1XG1A 3L09A 2VKEA 2XF6A 2ADUA 1G6NA 5E1ZB 1ZELA 4UUVA 1IGNA 1B59A 3C7JA 1YFHA 2VPRA 1ZQ3P 3WU1B 4XR6A 3QYFA 4G9YA 3LFUA 3F9KA 3LSGA 2MH9A 3HRUA 1WHUA 1TLHB 1R5ID 2KQRA 4LGWA 2ZJPF 2EA4A 2ELJA 2ZCWA 3OR2C 1JKPC 3CCQI 2K86A 3OL4A 3EDPA 3QWLA 3G56A 4IRVA 2VT3A 1QPIA 3KEOA 3OOPA 2VN2A 3AKZA 4RLQA 1N78A 2GIVA 3SDGA 1WWXA 4PXIA 2Q8KA 1SVLA 5HS7A 2DYSH 4M3EA 2ZCXA 4F92B 4IX7A 1VZ0A 1GVDA 4EM2A 4FX4A 1YE9A 5K1YA 1IDYA 2HQ5A 3L7WA 3ABTA 3QKXA 4GCVA 4AC0A 1E3PA 2BW3A 3B02A 1B72A 4J00A 5HLTA 1Z3XA 5CVVA 4KYWA 3BTCA 3GTMJ 5KAFC 2RNGA 2UXNA 4L62A 4M71A 4E7SA 1TNTA 1UZCA 1Y1VJ 5F04A 4P9UA 1ZREA 3E5UA 3PNTA 2VPLA 2WBMA 1F9NA 5F08A 2DJNA 4A2UA 2UWMA 4NBQA 2ZSHB 2X6XA 4YIFA 5CVJA 3O2PE 4ZYDA 5A2QK 3JRHA 2Z33A 3DKWA 4JBAA 1S8NA 2LNBA 2BBYA 4JX4A 2FEZA 1MIJA 4RB0A 4B43A 4BXXJ 3DQVC 2GIZA 3ANGA 2QKOA 1AU7A 3PPBA 1A36A 3RD3A 1U5TA 2CG4A 1OISA 4QPOA 2F6CA 1XS9A 1RESA 2P6SA 1M1EB 1FYMA 1HXDA 1VTNC 1W36C 1QHGA 2Y75A 1E3OC 6PAXA 5LRSA 3BCBA 3OYHA 1G3TA 4U0WA 4Y17A 2FUG2 3CMMA 4IHSA 3PL8A 3GEUA 2XAUA 4AIDA 3CC7I 2XPWA 5D5VB 4KIBA 1TWHJ 5HLIA 4C2MA 2DMQA 3ASOH 2DU9A 2V6CA 3MD2A 2QBYB 2B63J 2L9VA 1W1WE 5H6QA 1H9TA 3S8PA 4XM3A 2R3SA 1GXQA 3PIPF 3LSRA 4A12A 1MMSA 1FX7A 5D5XB 1V5GA 2I8DA 5E79C 4ANJA 1Q1HA 2YSRA 3B81A 2DT5A 3IL2A 1OCOH 3CMYA 3HEFA 1ZG3A 5CLSA 1FIPA 1VQKI 1S29A 3VW1A 3MZYA 2VODA 5EFYA 5KNLA 1KU7A 4G12A 4ZYGA 3J80K 3KE2A 3BZ6A 2XHKA 4K2EA 2GXAA 3IRRA 4IHWA 3S14J 1JJ6C 5C4XJ 4KIGA 2V26A 2YS9A 2AXLA 3JCUC 3PNVA 5D4SA 1O3SA 5GTIC 2PI0A 4ENNA 3ON4A 1HQCA 4XSZF 3GLXA 2HYFA 4C3JJ 2BY0A 3TW6A 1SD5A 3H5RA 2MH2A 3TL4X 3MKWB 1LQ1A 3DU5A 2EIMH 3HRSA 3Q0WA 2Y2ZA 2MG4A 2K9NA 9ANTA 4AC6A 3JW4A 2EV5A 4L5JA 4BACA 5HDGA 3BNIA 1KU2A 2I10A 3BQYA 5DDGA 4HAMA 1KZHA 3ZMUA 1D3YA 1IN8A 1YW8A 1FYKA 5IPAA 5BPDA 2LC2A 5JVTA 2F5CA 5H20A 4E7LA 2V7FA 4KFCA 3CESA 4L18B 5LGTA 2DK8A 2GXGA 1SC7A 2O8KA 4MHGA 3DEEA 4II3A 3E6DA 3SYTA 3W6JB 1C0WA 2O03A 2CSOA 1NHAA 5BOXA 4CGRA 3EGQA 3ZQQA 2L7MP 2HTJA 4CICA 1KQ9A 1AWCA 1DPUA 4PSXA 1DGRM 1G2HA 3QP6A 3TDZC 4A6EA 2G7HA 4I99C 5GAHJ 2VI6A 5CW8A 3BR1A 4XRFA 5CVRA 3JSOA 3S1NJ 2EFNA 4U9LA 2KDOA 5IT9K 3E6BA 1MJ9A 1STZA 2OA4A 3V6GA 5HLHA 3HM5A 1GV2A 2PMZA 2W7NA 2MYSA 4P5OA 3F8FA 3SZTA 1JJ8C 3CWRA 1MH3A 4YRVA 1B8IA 1BR2A
chains in the Genus database with same CATH topology
3JREA 3DPJA 1W0UA 2ZOZA 1ORKA 1Z0XA 3JSJA 2CRGA 4CYCA 4DW6A 1WPKA 4ME9A 2H1KA 1ETOA 3VW2A 2O9LA 1MBFA 1GT0C 3LJLA 3MKLA 1ETKA 2DA5A 2M8GX 2O7OA 3VUQA 2JA7J 3VP5A 5EG0A 3VVYA 3RKQA 3HTAA 5C4JJ 1MH4A 1MNMC 4L5EA 3GTKJ 2NVQJ 1BW5A 1QVUA 5M5YJ 2L9RA 1ZK8A 3RZDJ 3AQSA 5EDNA 4A3FJ 4DYRA 3M3YJ 3HTHA 1MBGA 2HOTA 3IV5A 1MSFC 3HTIA 3GTOJ 1ETVA 4A93J 2Y9ZA 3S2DJ 4HKUA 4DYCA 1UHSA 3WHCA 2DA3A 2DA4A 3BCGA 4GCKA 3VOKA 4ABZA 4A3CJ 2HI3A 2JN6A 3E7LA 2OERA 4JP0A 1LFUP 3BT9A 1BL0A 3HKZN 3ZQHA 3MVPA 3JRBA 3QQAA 1R9TJ 1T56A 1B72B 4ICHA 4RDUA 1GUUA 4A3BJ 2G3BA 2K9QA 2R0QC 2GENA 3HOYJ 3K2AA 2ID3A 2R5ZA 2V57A 1P7JA 4CYCB 2CUFA 3BTJA 3BHQA 3OSGA 3S1RJ 2CJJA 1RKWA 3A02A 5J1UA 4Y52J 4JYKA 2LK2A 1AHDP 5M3FJ 2DMTA 1BA5A 1JKRC 3HE0A 3IH4A 5EG0B 4B3AA 3S17J 3O60A 3A01A 1JTYA 1D5YA 2ECBA 4HNVA 1JUPA 2EZIA 3L1PA 1POGA 1LE8A 1VNDA 3HDDA 2FJ1A 1JUSA 2NS8A 5IOYA 4X6AJ 2MGQA 4UUTA 2M34A 5EYRA 3NI7A 3QPLA 3QBMA 2HOAA 5FMPA 2ME6A 4DYQA 3UKGA 3ZQCA 2XPUA 3T6NA 3C2BA 1OCPA 3FK6A 2N8GA 1F43A 2XGCA 1JTXA 3Q0UA 2Q24A 1H88C 5BNGA 5K7ZA 2ZOYA 5K7HA 2R5YA 2DA7A 2Y0SN 1PUFA 4M3GA 5F0FA 2FQ4A 2R5ZB 3VOXA 2AO9A 1ZR2A 2YVHA 4M3FA 4XRSG 2UXUA 3GTGJ 3FIWA 2VUMJ 3A03A 3BR5A 2W48A 2XPVA 1MBEA 1T33A 5GP9A 2F07A 4D7NA 2DA6A 2YVEA 4QTRA 4FTHA 2WAQN 4A3MJ 2LKXA 3A01B 4FE4A 4Y7NJ 1OFCX 5J1YA 3G1LA 4A3EJ 1HOMA 5E3MA 2UXOA 4KWAA 3AQTA 1LE8B 2ELKA 2GM4A 2OI8A 2LD5A 3NRGA 1AKHA 5C4YA 3G7RA 4FISA 1YRNA 2RASA 1UI6A 2W53A 2COBA 1GV5A 1MSEC 3JRIA 3HIMA 4IEJA 3JRGA 5D19A 3COLA 3FK7A 3B6AA 3C07A 5EZGA 1APLC 1HDDC 5CXGA 2Y30A 1RKTA 3FISA 2KDZA 1NK2P 2VKVA 4C3IJ 3HOWJ 5F0HA 2DMNA 2HDDA 4I6ZA 3KNWA 3OIOA 2R5YB 2XB0X 5C44J 1PUFB 5IP9J 2ZCNA 2L7FP 3B6CA 1F36A 4JKZA 1RPWA 1TWGJ 2WB1N 2LLKA 4XIDA 2DTZA 3ANPA 5DAJA 3SFIA 2XSDC 4JL3A 2XB5A 4DZJA 2JA5J 3HTJA 1VF9A 3SJMA 5FLVA 4A3JJ 2QWTA 3P9TA 3JR9A 1SANA 1BW6A 2D5VA 3MN2A 1ETXA 3S1MJ 4GCLA 4QSHA 2FBQA 1MBJA 1TWFJ 2DN0A 2G7GA 2IU5A 1WGXA 2EBIA 1AKHB 3H3VK 1YRNB 2X6OA 3G1MA 4GFLA 3LSJA 5C3EJ 4NN1A 3BR3A 2G7SA 1SGMA 3V78A 4XRMA 2K40A 3KKDA 2WV1A 2OPTA 2IAIA 1FTZA 2Y9YA 3JRAA 3ZOBA 1U78A 5E3OA 1U9OA 4DZPA 3TEDA 1U8BA 2LVSA 1B8IB 4XRSA 5GPAA 5HBUA 2LP0A 2NP5A 1WCMJ 1DU6A 2NVYJ 3H0GJ 3BTIA 1JT0A 4MXMA 3S2HJ 1ETYA 3BTLA 3Q3SA 3VVZA 4AF5A 3RZOJ 4IHVA 3TW7A 1RETA 3PM1A 2XGDA 5F27A 3I4MJ 5EGOA 2DG7A 1UG2A 3LNQA 2R92J 3G1OA 4NELA 3BRUA 2ECCA 1DU0A 2CU7A 2HYTA 4GCTA 4A3LJ 1BJZA 1H8AC 3HBLA 4A3GJ 1TWCJ 3TP3A 3VPRA 4GFKA 3D1NI 1Z77A 2HKUA 4YZEA 4BBRJ 3JRDA 1HCRA 2JA8J 3QPSA 2ME0A 4XICA 3NARA 2NX4A 3VVXA 2XGEA 2R93J 2CUEA 2ZCMA 2GBYA 3GTPJ 1K83J 3NNRA 1W0TA 5J3LA 4S0HB 5IYDJ 1EF4A 2NOGA 1WI3A 2EH3A 3GBGA 4D5FA 1VI0A 5FHPA 2IEKA 1ETQA 3O8HA 2NS7A 1X2MA 3W6VA 3FRQA 2E2JJ 2MSYA 1MBHA 3DEWA 1QVTA 4UDSA 3LOCA 2NVTJ 1JGGA 2EZHA 3S5RA 4IHXA 4X1EA 3WHBA 2M0CA 5FGLA 2P81A 2KT0A 1CQTA 4NDLA 5JLWA 4A3KJ 2DA1A 2JJ7A 2LR8A 3NXCA 4MFEA 2M9HA 4BKXA 5EGOB 4UUSA 5DS9A 3KKCA 2EQRA 3BR0A 2D6YA 2X48A 5FJ8J 2QIBA 3TP0A 5EEAA 4GFBA 1QRYA 2ZB9A 2R7ZJ 5AQCA 1JT6A 2CQXA 1ZTRA 3GTQJ 3EUPA 1UI5A 5IOZA 3E7QA 2K9SA 2M2EA 3K7AJ 1H89C 1XG1A 5FKOA 2YU9J 5JLXA 1HLVA 2VKEA 1I3QJ 1TC3C 5FLMJ 2FX0A 1IGNA 1I50J 1ETWA 2JK3A 2VPRA 1ZQ3P 4MLOA 4W1UA 5CXIA 3NAUA 2FD5A 1U9NA 3LSGA 1IJWC 5DTDA 1NTCA 2L0KA 5FKMA 3HOXJ 2UXIA 3ZQFA 1XC5A 1JKPC 5D18A 1K61A 3JRFA 4RBOA 4MO7A 1NK3P 2TRTA 2PMZN 3G56A 2REKA 2QF7A 1QPIA 4ACIA 2GLOA 5IYCJ 3CQZJ 3SDGA 4PXIA 3O8GA 4M3EA 2ZCXA 2DA2A 4UUSB 5EF6A 2XRLA 1A6IA 2DG8A 3BJBA 1GVDA 1S7EA 2TCTA 1IDYA 3CJDA 2HQ5A 3DCFA 4M3BA 4MK6A 3QKXA 4BY7J 1WH5A 4AC0A 5J1RA 1JKOC 1B72A 2E19A 1A5JA 2Y31A 3HGGA 1FIAA 4AUXA 3BTCA 3GTMJ 4L62A 2QTQA 4V2FA 3PASA 1Y1VJ 1WH7A 5F04A 4B4CA 1FEXA 4A69C 4EEFG 4QIWN 2RAEA 5F08A 2DJNA 4A3IJ 2UXHA 4BY1J 3ZQGA 3JRHA 2H8RA 4M6VA 5F1JA 1X58A 3HOUJ 2QOPA 2PBXA 2X9DA 2E1OA 3GTLJ 3NPIA 4JX4A 4D7MA 3CCYA 4AYBN 4BXXJ 5M3MJ 2HXIA 3ANGA 4MFDA 3BR6A 1FJLA 2QKOA 1AU7A 2YUSA 3PPBA 3RD3A 2WGBA 5IP6A 2LTPA 2NP3A 2EZLA 4D5CA 3BR2A 5IP7J 1JUMA 1TWAJ 2L7ZA 1XS9A 1RESA 1VFCA 4I76A 5K58A 1ZR4A 3FKIJ 3VW0A 5K7FA 3I4NJ 2GUHA 1E3OC 5HAWA 1I6HJ 3BG9A 4C2MJ 1ZKGA 5FKKA 2G0EA 3GEUA 2XPWA 3OSFA 2LY9A 1TWHJ 1MBKA 2DMQA 5IYBJ 3ZQLA 1SFOJ 2XDNA 4LOCA 3RQIA 2B63J 3S15J 2GFNA 1OJLA 4JX6A 3LSRA 2WUIA 3B81A 2G7LA 1IV6A 3RH2A 5F0CA 4FCYA 4J19A 1FTTA 3CMYA 1OCTC 3HEFA 3F0CA 5HODA 1FIPA 5FKLA 3VW1A 1GDTA 2HXOA 3LSPA 5EFYA 2AHQA 5M5WJ 4G12A 2HYJA 1X2NA 5E3NA 4IHWA 1HDPA 3S14J 3S1QJ 5HSZA 1Q1VA 1JJ6C 5C4XJ 2YS9A 3CDLA 2E2IJ 2RHAA 4C3HJ 1LFBA 2IBDA 3ON4A 4C3JJ 4IHYA 1JKQC 3KZ9A 3OOUA 3TW6A 1ITYA 1IG7A 3HOVJ 3Q0WA 3MNLA 2MG4A 2Y2ZA 2DMUA 2K9NA 3BG3A 4A3DJ 3S16J 2HOSA 9ANTA 2EZKA 4B1RA 4AC6A 3PO2J 2PZ9A 3BNIA 4MIMA 1ZGWA 2I10A 3BQYA 3GTJJ 2QCOA 2JWTA 3M4OJ 2LFBA 2O7TA 5IPAA 1Y1WJ 1O4XA 2CQQA 3JRCA 4JX5A 4XK4A 2NVXJ 3GZIA 1P7IA 2ID6A 1IUFA 3HOZJ 2E2HJ 1UMQA 2JA6J 3ON2A 3CRJA 2OF7A 3IH2A 5GPCA 2UXPA 2O8KA 3BQZA 3IUVA 1IRZA 2DMPA 4CGRA 3EGQA 2L7MP 3HB9A 5H9TA 5M5XJ 3HGYA 1G2HA 1ENHA 1RR7A 4W97A 1IC8A 1HF0A 1IDZA 5FKNA 5D1RA 3VIBA 2VI6A 4BBSJ 3IH3A 5CW8A 2JMWA 3BR1A 3PO3J 3S1NJ 3V6GA 5E3LA 3LHQA 3ZQIA 5EZHA 3HM5A 1GV2A 2MW8A 4FE7A 3LWJA 3BG5A 4M3DA 1JJ8C 3CWRA 3F1BA 1MH3A 4V2GA 4JNNA 1B8IA 3Q0VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JRE A;  3DPJ A;  1W0U A;  2ZOZ A;  1ORK A;  1Z0X A;  3JSJ A;  2CRG A;  4CYC A;  4DW6 A;  1WPK A;  4ME9 A;  2H1K A;  1ETO A;  3VW2 A;  2O9L A;  1MBF A;  1GT0 C;  3LJL A;  3MKL A;  1ETK A;  2DA5 A;  2M8G X;  2O7O A;  3VUQ A;  2JA7 J;  3VP5 A;  5EG0 A;  3VVY A;  3RKQ A;  3HTA A;  5C4J J;  1MH4 A;  1MNM C;  4L5E A;  3GTK J;  2NVQ J;  1BW5 A;  1QVU A;  5M5Y J;  2L9R A;  1ZK8 A;  3RZD J;  3AQS A;  5EDN A;  4A3F J;  4DYR A;  3M3Y J;  3HTH A;  1MBG A;  2HOT A;  3IV5 A;  1MSF C;  3HTI A;  3GTO J;  1ETV A;  4A93 J;  2Y9Z A;  3S2D J;  4HKU A;  4DYC A;  1UHS A;  3WHC A;  2DA3 A;  2DA4 A;  3BCG A;  4GCK A;  3VOK A;  4ABZ A;  4A3C J;  2HI3 A;  2JN6 A;  3E7L A;  2OER A;  4JP0 A;  1LFU P;  3BT9 A;  1BL0 A;  3HKZ N;  3ZQH A;  3MVP A;  3JRB A;  3QQA A;  1R9T J;  1T56 A;  1B72 B;  4ICH A;  4RDU A;  1GUU A;  4A3B J;  2G3B A;  2K9Q A;  2R0Q C;  2GEN A;  3HOY J;  3K2A A;  2ID3 A;  2R5Z A;  2V57 A;  1P7J A;  4CYC B;  2CUF A;  3BTJ A;  3BHQ A;  3OSG A;  3S1R J;  2CJJ A;  1RKW A;  3A02 A;  5J1U A;  4Y52 J;  4JYK A;  2LK2 A;  1AHD P;  5M3F J;  2DMT A;  1BA5 A;  1JKR C;  3HE0 A;  3IH4 A;  5EG0 B;  4B3A A;  3S17 J;  3O60 A;  3A01 A;  1JTY A;  1D5Y A;  2ECB A;  4HNV A;  1JUP A;  2EZI A;  3L1P A;  1POG A;  1LE8 A;  1VND A;  3HDD A;  2FJ1 A;  1JUS A;  2NS8 A;  5IOY A;  4X6A J;  2MGQ A;  4UUT A;  2M34 A;  5EYR A;  3NI7 A;  3QPL A;  3QBM A;  2HOA A;  5FMP A;  2ME6 A;  4DYQ A;  3UKG A;  3ZQC A;  2XPU A;  3T6N A;  3C2B A;  1OCP A;  3FK6 A;  2N8G A;  1F43 A;  2XGC A;  1JTX A;  3Q0U A;  2Q24 A;  1H88 C;  5BNG A;  5K7Z A;  2ZOY A;  5K7H A;  2R5Y A;  2DA7 A;  2Y0S N;  1PUF A;  4M3G A;  5F0F A;  2FQ4 A;  2R5Z B;  3VOX A;  2AO9 A;  1ZR2 A;  2YVH A;  4M3F A;  4XRS G;  2UXU A;  3GTG J;  3FIW A;  2VUM J;  3A03 A;  3BR5 A;  2W48 A;  2XPV A;  1MBE A;  1T33 A;  5GP9 A;  2F07 A;  4D7N A;  2DA6 A;  2YVE A;  4QTR A;  4FTH A;  2WAQ N;  4A3M J;  2LKX A;  3A01 B;  4FE4 A;  4Y7N J;  1OFC X;  5J1Y A;  3G1L A;  4A3E J;  1HOM A;  5E3M A;  2UXO A;  4KWA A;  3AQT A;  1LE8 B;  2ELK A;  2GM4 A;  2OI8 A;  2LD5 A;  3NRG A;  1AKH A;  5C4Y A;  3G7R A;  4FIS A;  1YRN A;  2RAS A;  1UI6 A;  2W53 A;  2COB A;  1GV5 A;  1MSE C;  3JRI A;  3HIM A;  4IEJ A;  3JRG A;  5D19 A;  3COL A;  3FK7 A;  3B6A A;  3C07 A;  5EZG A;  1APL C;  1HDD C;  5CXG A;  2Y30 A;  1RKT A;  3FIS A;  2KDZ A;  1NK2 P;  2VKV A;  4C3I J;  3HOW J;  5F0H A;  2DMN A;  2HDD A;  4I6Z A;  3KNW A;  3OIO A;  2R5Y B;  2XB0 X;  5C44 J;  1PUF B;  5IP9 J;  2ZCN A;  2L7F P;  3B6C A;  1F36 A;  4JKZ A;  1RPW A;  1TWG J;  2WB1 N;  2LLK A;  4XID A;  2DTZ A;  3ANP A;  5DAJ A;  3SFI A;  2XSD C;  4JL3 A;  2XB5 A;  4DZJ A;  2JA5 J;  3HTJ A;  1VF9 A;  3SJM A;  5FLV A;  4A3J J;  2QWT A;  3P9T A;  3JR9 A;  1SAN A;  1BW6 A;  2D5V A;  3MN2 A;  1ETX A;  3S1M J;  4GCL A;  4QSH A;  2FBQ A;  1MBJ A;  1TWF J;  2DN0 A;  2G7G A;  2IU5 A;  1WGX A;  2EBI A;  1AKH B;  3H3V K;  1YRN B;  2X6O A;  3G1M A;  4GFL A;  3LSJ A;  5C3E J;  4NN1 A;  3BR3 A;  2G7S A;  1SGM A;  3V78 A;  4XRM A;  2K40 A;  3KKD A;  2WV1 A;  2OPT A;  2IAI A;  1FTZ A;  2Y9Y A;  3JRA A;  3ZOB A;  1U78 A;  5E3O A;  1U9O A;  4DZP A;  3TED A;  1U8B A;  2LVS A;  1B8I B;  4XRS A;  5GPA A;  5HBU A;  2LP0 A;  2NP5 A;  1WCM J;  1DU6 A;  2NVY J;  3H0G J;  3BTI A;  1JT0 A;  4MXM A;  3S2H J;  1ETY A;  3BTL A;  3Q3S A;  3VVZ A;  4AF5 A;  3RZO J;  4IHV A;  3TW7 A;  1RET A;  3PM1 A;  2XGD A;  5F27 A;  3I4M J;  5EGO A;  2DG7 A;  1UG2 A;  3LNQ A;  2R92 J;  3G1O A;  4NEL A;  3BRU A;  2ECC A;  1DU0 A;  2CU7 A;  2HYT A;  4GCT A;  4A3L J;  1BJZ A;  1H8A C;  3HBL A;  4A3G J;  1TWC J;  3TP3 A;  3VPR A;  4GFK A;  3D1N I;  1Z77 A;  2HKU A;  4YZE A;  4BBR J;  3JRD A;  1HCR A;  2JA8 J;  3QPS A;  2ME0 A;  4XIC A;  3NAR A;  2NX4 A;  3VVX A;  2XGE A;  2R93 J;  2CUE A;  2ZCM A;  2GBY A;  3GTP J;  1K83 J;  3NNR A;  1W0T A;  5J3L A;  4S0H B;  5IYD J;  1EF4 A;  2NOG A;  1WI3 A;  2EH3 A;  3GBG A;  4D5F A;  1VI0 A;  5FHP A;  2IEK A;  1ETQ A;  3O8H A;  2NS7 A;  1X2M A;  3W6V A;  3FRQ A;  2E2J J;  2MSY A;  1MBH A;  3DEW A;  1QVT A;  4UDS A;  3LOC A;  2NVT J;  1JGG A;  2EZH A;  3S5R A;  4IHX A;  4X1E A;  3WHB A;  2M0C A;  5FGL A;  2P81 A;  2KT0 A;  1CQT A;  4NDL A;  5JLW A;  4A3K J;  2DA1 A;  2JJ7 A;  2LR8 A;  3NXC A;  4MFE A;  2M9H A;  4BKX A;  5EGO B;  4UUS A;  5DS9 A;  3KKC A;  2EQR A;  3BR0 A;  2D6Y A;  2X48 A;  5FJ8 J;  2QIB A;  3TP0 A;  5EEA A;  4GFB A;  1QRY A;  2ZB9 A;  2R7Z J;  5AQC A;  1JT6 A;  2CQX A;  1ZTR A;  3GTQ J;  3EUP A;  1UI5 A;  5IOZ A;  3E7Q A;  2K9S A;  2M2E A;  3K7A J;  1H89 C;  1XG1 A;  5FKO A;  2YU9 J;  5JLX A;  1HLV A;  2VKE A;  1I3Q J;  1TC3 C;  5FLM J;  2FX0 A;  1IGN A;  1I50 J;  1ETW A;  2JK3 A;  2VPR A;  1ZQ3 P;  4MLO A;  4W1U A;  5CXI A;  3NAU A;  2FD5 A;  1U9N A;  3LSG A;  1IJW C;  5DTD A;  1NTC A;  2L0K A;  5FKM A;  3HOX J;  2UXI A;  3ZQF A;  1XC5 A;  1JKP C;  5D18 A;  1K61 A;  3JRF A;  4RBO A;  4MO7 A;  1NK3 P;  2TRT A;  2PMZ N;  3G56 A;  2REK A;  2QF7 A;  1QPI A;  4ACI A;  2GLO A;  5IYC J;  3CQZ J;  3SDG A;  4PXI A;  3O8G A;  4M3E A;  2ZCX A;  2DA2 A;  4UUS B;  5EF6 A;  2XRL A;  1A6I A;  2DG8 A;  3BJB A;  1GVD A;  1S7E A;  2TCT A;  1IDY A;  3CJD A;  2HQ5 A;  3DCF A;  4M3B A;  4MK6 A;  3QKX A;  4BY7 J;  1WH5 A;  4AC0 A;  5J1R A;  1JKO C;  1B72 A;  2E19 A;  1A5J A;  2Y31 A;  3HGG A;  1FIA A;  4AUX A;  3BTC A;  3GTM J;  4L62 A;  2QTQ A;  4V2F A;  3PAS A;  1Y1V J;  1WH7 A;  5F04 A;  4B4C A;  1FEX A;  4A69 C;  4EEF G;  4QIW N;  2RAE A;  5F08 A;  2DJN A;  4A3I J;  2UXH A;  4BY1 J;  3ZQG A;  3JRH A;  2H8R A;  4M6V A;  5F1J A;  1X58 A;  3HOU J;  2QOP A;  2PBX A;  2X9D A;  2E1O A;  3GTL J;  3NPI A;  4JX4 A;  4D7M A;  3CCY A;  4AYB N;  4BXX J;  5M3M J;  2HXI A;  3ANG A;  4MFD A;  3BR6 A;  1FJL A;  2QKO A;  1AU7 A;  2YUS A;  3PPB A;  3RD3 A;  2WGB A;  5IP6 A;  2LTP A;  2NP3 A;  2EZL A;  4D5C A;  3BR2 A;  5IP7 J;  1JUM A;  1TWA J;  2L7Z A;  1XS9 A;  1RES A;  1VFC A;  4I76 A;  5K58 A;  1ZR4 A;  3FKI J;  3VW0 A;  5K7F A;  3I4N J;  2GUH A;  1E3O C;  5HAW A;  1I6H J;  3BG9 A;  4C2M J;  1ZKG A;  5FKK A;  2G0E A;  3GEU A;  2XPW A;  3OSF A;  2LY9 A;  1TWH J;  1MBK A;  2DMQ A;  5IYB J;  3ZQL A;  1SFO J;  2XDN A;  4LOC A;  3RQI A;  2B63 J;  3S15 J;  2GFN A;  1OJL A;  4JX6 A;  3LSR A;  2WUI A;  3B81 A;  2G7L A;  1IV6 A;  3RH2 A;  5F0C A;  4FCY A;  4J19 A;  1FTT A;  3CMY A;  1OCT C;  3HEF A;  3F0C A;  5HOD A;  1FIP A;  5FKL A;  3VW1 A;  1GDT A;  2HXO A;  3LSP A;  5EFY A;  2AHQ A;  5M5W J;  4G12 A;  2HYJ A;  1X2N A;  5E3N A;  4IHW A;  1HDP A;  3S14 J;  3S1Q J;  5HSZ A;  1Q1V A;  1JJ6 C;  5C4X J;  2YS9 A;  3CDL A;  2E2I J;  2RHA A;  4C3H J;  1LFB A;  2IBD A;  3ON4 A;  4C3J J;  4IHY A;  1JKQ C;  3KZ9 A;  3OOU A;  3TW6 A;  1ITY A;  1IG7 A;  3HOV J;  3Q0W A;  3MNL A;  2MG4 A;  2Y2Z A;  2DMU A;  2K9N A;  3BG3 A;  4A3D J;  3S16 J;  2HOS A;  9ANT A;  2EZK A;  4B1R A;  4AC6 A;  3PO2 J;  2PZ9 A;  3BNI A;  4MIM A;  1ZGW A;  2I10 A;  3BQY A;  3GTJ J;  2QCO A;  2JWT A;  3M4O J;  2LFB A;  2O7T A;  5IPA A;  1Y1W J;  1O4X A;  2CQQ A;  3JRC A;  4JX5 A;  4XK4 A;  2NVX J;  3GZI A;  1P7I A;  2ID6 A;  1IUF A;  3HOZ J;  2E2H J;  1UMQ A;  2JA6 J;  3ON2 A;  3CRJ A;  2OF7 A;  3IH2 A;  5GPC A;  2UXP A;  2O8K A;  3BQZ A;  3IUV A;  1IRZ A;  2DMP A;  4CGR A;  3EGQ A;  2L7M P;  3HB9 A;  5H9T A;  5M5X J;  3HGY A;  1G2H A;  1ENH A;  1RR7 A;  4W97 A;  1IC8 A;  1HF0 A;  1IDZ A;  5FKN A;  5D1R A;  3VIB A;  2VI6 A;  4BBS J;  3IH3 A;  5CW8 A;  2JMW A;  3BR1 A;  3PO3 J;  3S1N J;  3V6G A;  5E3L A;  3LHQ A;  3ZQI A;  5EZH A;  3HM5 A;  1GV2 A;  2MW8 A;  4FE7 A;  3LWJ A;  3BG5 A;  4M3D A;  1JJ8 C;  3CWR A;  3F1B A;  1MH3 A;  4V2G A;  4JNN A;  1B8I A;  3Q0V A; 
#chains in the Genus database with same CATH topology
 1W0U A;  2HGC A;  1Z0X A;  4N9H A;  3JSJ A;  1HST A;  3QU6 A;  4CYC A;  4M72 A;  4DW6 A;  5ICG A;  1WPK A;  3WTS C;  5BMZ A;  1T8I A;  2HEO A;  1NG6 A;  3K4B A;  1W36 D;  3BRO A;  2H1K A;  4Y33 A;  5FRM A;  3PUF A;  4DNC A;  2IS2 A;  3MKL A;  2A69 F;  2E71 A;  4CA0 A;  1Z9C A;  2D45 A;  3MCZ A;  3VUQ A;  1K4T A;  2OQR A;  1IO2 A;  1P9Q C;  4IOC F;  1MNM C;  3LAJ A;  4OWR B;  1FZP B;  3HXL A;  3ZMT A;  4KIC A;  1P4A A;  4N4N B;  3FXM A;  3R0J A;  4BE2 A;  3T8T A;  1KU9 A;  3MFK A;  4HST A;  4NHJ A;  2NS0 A;  1MBG A;  3GTO J;  5D6F A;  1UHS A;  4G7H F;  3BPX A;  3HC7 A;  3JTG A;  4ABZ A;  3I4P A;  3VOK A;  3RKW A;  2EIL H;  2KP6 A;  3BT9 A;  3HKZ N;  1S6L A;  3A4C A;  3FBN B;  3MVP A;  2Z3Y A;  1B72 B;  2EPF A;  2VLA A;  2W00 A;  3HOY J;  2B0L A;  3C2H A;  1XX5 A;  1DQU A;  2CUF A;  4CCJ A;  3BTJ A;  2DLL A;  4U0Y A;  2VQG A;  2CJJ A;  1RKW A;  5J1U A;  1G4D A;  2B1E A;  3ERM A;  3J81 K;  3LL7 A;  4HA8 A;  1AHD P;  3DTI A;  3AG1 H;  1FBQ A;  1H0M A;  1LDJ A;  1R5H A;  2K85 A;  3DU6 A;  2H09 A;  2V1D A;  2KIF A;  4LD5 A;  1YW7 A;  3L1P A;  1PDN C;  2Q2E B;  1JUS A;  3IKT A;  1MJB A;  2EB7 A;  2MGQ A;  4UUT A;  2M34 A;  3CMA I;  3QBM A;  5B1B H;  3S32 A;  4GDF A;  4AVZ A;  3UKG A;  3J7A Y;  1R36 A;  1Y0N A;  3T6N A;  2CUJ A;  2XAG A;  1F43 A;  2GA1 A;  2IVM A;  4UV8 A;  4PCQ A;  1T95 A;  2ZNZ A;  4RMN A;  5BNG A;  1S7A A;  2RVC A;  2E1C A;  2Y0S N;  4FAS D;  2V1N A;  1J59 A;  1KYW A;  1Z21 A;  1TTY A;  2A3S A;  4GRI A;  1BI1 A;  4UVA A;  2R5Z B;  5JI6 A;  1DP3 A;  2YVH A;  3WG9 A;  1IN7 A;  1QGP A;  2A07 F;  3FIW A;  3BR5 A;  1N75 A;  1TW2 A;  1D8K A;  5LHH A;  1BC7 C;  4PFP A;  2F07 A;  2LBF A;  3FXQ A;  4FTH A;  2WAQ N;  4A3M J;  4FE4 A;  4Y7N J;  1OFC X;  2JQ7 A;  3G1L A;  1MZB A;  3ABK H;  3V7R A;  1L3L A;  1DP7 P;  2CV1 A;  4LFU A;  2GM4 A;  2FA5 A;  3ZXS A;  4ENK A;  2LD5 A;  1EKE A;  1FP2 A;  3H5A A;  2RAS A;  1ONV A;  2HDC A;  3DBL B;  3EET A;  5D4R A;  3HL2 A;  2VAS A;  3HPG A;  3GF2 A;  1W5C C;  4IRI A;  3I64 A;  3JRG A;  3MKY B;  3K69 A;  5EZG A;  5CXG A;  2Y30 A;  3PFY A;  4M6Y A;  4YFX F;  1NK2 P;  2VOO A;  1PUE E;  2XRN A;  3OIO A;  3KZY A;  5JHF A;  2YX7 A;  5HDN A;  4JKZ A;  1RPW A;  1FYL A;  2FF4 A;  5CQG A;  1EA3 A;  5DAJ A;  4LG3 A;  2DT7 B;  2JA5 J;  1YI2 I;  1VF9 A;  5LGN A;  3F72 A;  2EV6 A;  5GAD J;  2W57 A;  2A6T A;  3P9T A;  1BW6 A;  2D5V A;  3MN2 A;  1XTA A;  3HG9 A;  5FFZ A;  2XAJ A;  3S2W A;  3OYI A;  3OL3 A;  3DWL E;  4QSH A;  4XLP F;  2KKO A;  3DBH B;  1V5E A;  4I2O A;  5J4V A;  1QZE A;  2EBI A;  2IW5 A;  2B9S A;  1AKH B;  1YRN B;  3H3V K;  2WAD A;  2RNJ A;  2W85 A;  3G1M A;  2HFH A;  1O3R A;  2X1D A;  1MDM B;  4CCN A;  1WJ5 A;  3KP4 A;  1YS6 A;  2EJR A;  3QOP A;  2G7S A;  3V78 A;  2BHZ A;  4XRM A;  2QLZ A;  3KKD A;  4BL0 B;  2BYV E;  2ESH A;  1FTZ A;  3JRA A;  3ZOB A;  4G94 A;  1DPR A;  2X0L A;  1W7P B;  4I0B A;  3FHZ A;  4DZP A;  1EH7 A;  1LVA A;  1U8B A;  1OCR H;  4P96 A;  4BJ6 C;  1B8I B;  1MD0 A;  4XRS A;  1FBS A;  2W1O A;  3CUQ B;  5DV5 A;  4EJT A;  1U0J A;  1GXP A;  3DLA A;  2IA1 A;  2UXX A;  2ESN A;  2O6G E;  4LMY A;  4WIB A;  4LB5 A;  4AF5 A;  4IHV A;  1BR4 A;  2GA2 A;  3CO6 C;  1RET A;  3PM1 A;  2XGD A;  1UG2 A;  1MMG A;  4BDZ A;  2R92 J;  4NEL A;  1Y39 A;  2K4B A;  3ZPL A;  2HYT A;  1YJW I;  2IXS A;  1TWC J;  2BZT A;  4H4K C;  3VPR A;  3LQR A;  1BC8 C;  2DQL A;  4GFK A;  2H94 A;  2JA8 J;  4XIC A;  3GFJ A;  5K5Q A;  3JSP A;  4UB8 C;  2R93 J;  3K1M A;  3CJQ B;  3NNR A;  1WRJ A;  2HQR A;  1U8R A;  4CGZ A;  1XSD A;  4S0H B;  3KET A;  3DFG A;  1EF4 A;  1AA7 A;  3GBG A;  4BHP A;  4D5F A;  3DTE A;  4DOZ A;  2Y0M A;  2NS7 A;  3M8J A;  5GAE J;  1X2M A;  2Z9O A;  3W6V A;  2L02 A;  1MBH A;  3J7A O;  4M6X A;  2R7S A;  1LFP A;  2LH9 A;  1IRF A;  3WHB A;  3DV8 A;  2RC4 A;  1T39 A;  2KT0 A;  1CQT A;  2LOO A;  4KIF A;  2P4W A;  4E7Z A;  3A0H C;  2CFO A;  5HNH A;  2LR8 A;  2JJ7 A;  4YG2 F;  5JLW A;  4ZDL A;  4OMY A;  3NXC A;  3KP6 A;  3MEX A;  3I55 I;  3NRV A;  3T0Y A;  2GZW A;  5DS9 A;  3OIQ A;  1I1S A;  1FMV A;  1LJ9 A;  2WY8 Q;  2K3F A;  2R4G A;  3COA C;  3RI4 A;  3E6M A;  5HVQ C;  2X48 A;  2CH0 A;  1WFX A;  4PFO A;  4GYI A;  4GFB A;  1K6Y A;  4HF2 A;  3HZJ A;  2CQX A;  1UJ8 A;  1J7K A;  3ZR8 X;  3EUP A;  2STW A;  2PG4 A;  2K4J A;  2K9S A;  3T8R A;  2M2E A;  1H89 C;  3FXJ A;  5FKO A;  2YU9 J;  2PBI A;  5JLX A;  3CCM I;  4Q4Z F;  3K4K A;  3GO5 A;  1BN5 A;  1EH8 A;  2PJR B;  3GVA A;  4W1U A;  5KAI C;  2LSO A;  2FD5 A;  3NAU A;  3OYM A;  3N4M A;  1IJW C;  5DTD A;  1NTC A;  2LKS A;  3HOX J;  5CVI A;  2UXI A;  3M07 A;  3G71 I;  1K61 A;  3LAP A;  4RBO A;  4MO7 A;  4CXF A;  4HZF A;  1N25 A;  3BJ6 A;  4EVI A;  1Y0U A;  2DOA A;  1OYY A;  2QF7 A;  2GWR A;  2V9P A;  5LRR A;  2ZJ2 A;  4OOI A;  3CQZ J;  5IYC J;  4AU7 A;  4IO9 F;  4OU0 A;  1S72 I;  1TQI A;  4N4O B;  3O8G A;  4BYY A;  5EF6 A;  1A6I A;  3FX3 A;  2E34 A;  5H2F C;  4DJA A;  5LEK A;  2DXI A;  2M4K A;  3DCF A;  1YLF A;  3VTI A;  5J1R A;  3HRM A;  1R5G A;  2ZME B;  4HV5 A;  2E19 A;  2VQC A;  3TKY A;  2JRT A;  1CF7 B;  4XLN F;  2Y31 A;  3FMQ A;  1OR7 C;  2ZXJ A;  3HGG A;  4QLC U;  2ISY A;  3K70 C;  1Z6R A;  1LDD A;  2QTQ A;  3PAS A;  1RZ4 A;  4HX4 A;  3TQN A;  4EEF G;  4BJ5 C;  1BI0 A;  1Z7U A;  4PSW A;  4BXF A;  3WTV C;  2QBY A;  2UXH A;  1K79 A;  4G7Z F;  1ON1 A;  4DBR A;  2CFX A;  3CP2 A;  2H8R A;  1R00 A;  3GYH X;  1OCC H;  1X19 A;  4M73 A;  1IF1 A;  4IPA A;  2FU4 A;  4JQF A;  1QNT A;  4PGH A;  2QOP A;  2PBX A;  3GTL J;  4IRG A;  4O5V A;  2M87 A;  3CDI A;  3P5J A;  1V3F A;  1FJL A;  2WAF A;  4PJN A;  4MTD A;  3RQ4 A;  5J8F A;  3KYC B;  1TWA J;  4HNU A;  2L2O A;  4HF1 A;  4D9J A;  2EIN H;  1D0Z A;  3IP4 B;  3OYE A;  3AG2 H;  4I76 A;  2WV0 A;  4IQJ A;  5K58 A;  3SHF A;  4C9Y A;  1HKT A;  5K7F A;  2VBZ A;  3I4N J;  2DPD A;  2PX9 A;  2ZFU A;  5HAW A;  3HHH A;  3BG9 A;  1X1D A;  3L2Q A;  3FMR A;  4C2M J;  3GCM A;  2DI3 A;  1ZKG A;  4HV6 A;  4XQF A;  5FFX A;  3MZ8 A;  5LEJ A;  3TO9 A;  3FZV A;  3OSF A;  2LY9 A;  2A6H F;  1WJA A;  4EJV A;  1X3U A;  2VQL A;  4YEJ A;  5IYB J;  1BR1 A;  1SFO J;  2XAH A;  3RKY A;  3BOQ A;  3ZQ7 A;  1OJL A;  1ZGJ A;  4IVN A;  4A5M A;  2MC4 A;  5DM6 F;  1A31 A;  4PJJ A;  1YHQ I;  3KLN A;  3EYY A;  4QPQ A;  2MD0 A;  5F0C A;  3RH2 A;  4FCY A;  1FTT A;  1GDT A;  2CV2 A;  2AHQ A;  2ZJQ F;  2V9K A;  5E3N A;  4Y3O A;  2R7W A;  2OBP A;  1MGT A;  3CLO A;  1OYI A;  2EV0 A;  1FP1 D;  2NNN A;  2JPB A;  3QP5 A;  2KL4 A;  5AIQ A;  2RHA A;  1W7P D;  5FO5 A;  3FXK A;  1MW7 A;  2RQQ A;  3O6B B;  1XDS A;  3FXU A;  4IHY A;  2TDX A;  1JKQ C;  3IAS 2;  4O3M A;  4RGR A;  1LEB A;  2HZT A;  1ITY A;  3M1C A;  3HOV J;  5D8L B;  4WX9 A;  5B3S H;  3MNL A;  3FF5 A;  2HU9 A;  2FML A;  4EAT A;  2DMU A;  1ZH5 A;  3BG3 A;  2ZO4 A;  4A3D J;  1FSE A;  4B1R A;  1TQM A;  3PO2 J;  2PZ9 A;  2EA2 A;  1OPC A;  4XN3 A;  4GGG A;  1P4X A;  3IAM 2;  3GTJ J;  1D1C A;  3V7C A;  3DKX A;  2EIK H;  2L4A A;  3E3V A;  1CGP A;  4NC8 A;  2XAF A;  2DYR H;  5F1R A;  2NVX J;  2QEX I;  1P7I A;  1ON2 A;  1IUF A;  2FQ3 A;  2JVG A;  3KEQ A;  4NC7 A;  3G6E I;  2E2H J;  1XSX A;  4IOA F;  3K70 D;  3K1N A;  5GPC A;  3IUV A;  3Q9S A;  1YTY A;  3WTU C;  1ACI A;  1T98 A;  1G3Y A;  5IY5 H;  4HQE A;  3HB9 A;  3X2Q H;  4NB5 A;  3F8B A;  1WSU A;  1HF0 A;  5FKN A;  2E7X A;  3PO3 J;  1U3E M;  1IXC A;  5F6F A;  5E3L A;  2OZ6 A;  4CO8 A;  3LWF A;  4RGU A;  3M8E A;  1FOK A;  2MW8 A;  2QQA A;  4HEA 2;  3GX4 X;  4FE7 A;  2WTE A;  4BS9 A;  1N77 A;  3PNY A;  3CUO A;  3K4M A;  3CJN A;  1F4K A;  1KA8 A;  1TP4 A;  3OYA A;  4V2G A;  2P5L C;  2EFP A;  3ZMV A;  3MAJ A;  3VYU B;  2A5Y B;  2QEN A;  3F8C A;  1J0R A;  1VQM I;  1ORK A;  1J09 A;  2ZNY A;  2DAO A;  1ETO A;  2VIX A;  3VW2 A;  2O9L A;  4ESJ A;  2VB6 A;  1K7A A;  2A6E F;  2BEO A;  4NNJ A;  1ETK A;  1R4M B;  2GOX B;  2H1L A;  2M8G X;  3QYE A;  3WGI A;  4LK0 F;  2MBF A;  3GME A;  3RKQ A;  3HTA A;  4DBQ A;  3WTX C;  2A68 F;  1T08 B;  3KZI C;  1ZLJ A;  2X6Y A;  1GLN A;  2Q2E A;  3QYB A;  4UVC A;  1T38 A;  4TV7 A;  2YX4 A;  5L3E A;  3RZD J;  3AQS A;  2OQG A;  3HTH A;  3M3Y J;  3IUO A;  2VQH A;  4D0P A;  5JVG F;  2AS5 F;  1MSF C;  3E5X A;  2HOT A;  4MQV A;  3AL0 B;  1MMD A;  3WHC A;  3LA2 A;  1TBX A;  2K7L A;  1OMI A;  3R4K A;  3VYT B;  4AYB A;  4GCK A;  1WKM A;  5LGU A;  3HOS A;  2AQE A;  3E7L A;  1RI7 A;  4JP0 A;  1U2W A;  1BL0 A;  4YIR X;  3BG7 A;  4I01 A;  3VYR B;  3KIO A;  2IT0 A;  1H9G A;  1R9T J;  1D0X A;  3QQA A;  1T56 A;  4IXA A;  4RDU A;  1JE8 A;  2HOE A;  2IGO A;  4A3B J;  2A2F X;  2G3B A;  2R0Q C;  2UUZ A;  2O3F A;  2RRE A;  2KIS A;  2R5Z A;  2V57 A;  3MZH A;  4M9S A;  3JAM K;  1RUO A;  4ITV A;  2MAB A;  3FXL A;  4WWC A;  1FY7 A;  2LK2 A;  2MA3 A;  3VB2 A;  3HE0 A;  4B3A A;  1QA6 A;  3CC2 I;  3GFM A;  1D0Y A;  2XF5 A;  1PJR A;  1SVM A;  3GZ5 A;  5K5R A;  1IZ1 A;  2KJC A;  2Z99 A;  3K10 A;  5DM7 F;  2CYY A;  4HNV A;  1JUP A;  4KT5 C;  5DCM B;  3HDD A;  1ZHF A;  1BOA A;  4LIU A;  1JHH A;  3LSK A;  5FLX Z;  4E6K G;  4L5I A;  3NI7 A;  5B66 C;  3QPL A;  3ZP5 A;  3QOD A;  2HOA A;  2QKL B;  4QWQ A;  4HG2 A;  2X6W A;  2GXB A;  1TZL A;  3ZQC A;  2XPU A;  3C2B A;  4C2U A;  3BP8 A;  1JI8 A;  2F5E A;  1R6R A;  4BJT A;  5LFA A;  4JOM A;  1RC9 A;  1YJN I;  2ZOY A;  4MTE A;  3VWB A;  4Y13 A;  5IT3 A;  3K4L A;  2YVX A;  4KIS A;  5ILV A;  3DTK A;  4XN0 A;  2DW4 A;  2NRA C;  2PFB A;  4M3F A;  2VUM J;  1KQ0 A;  3F8N A;  2DDA A;  2XPV A;  2DFF A;  5GP9 A;  3OMY A;  4PDK A;  2XIG A;  2Y0S A;  3KCC A;  2P0W A;  4LLN A;  1ZGA A;  2HPM A;  3EYI A;  3A01 B;  1IXS B;  5E3M A;  3W2V A;  3AQT A;  1LE8 B;  2ELK A;  2XKO A;  1EJ9 A;  4YEL A;  2F4O B;  2L01 A;  1J75 A;  1AKH A;  3NRG A;  1YRN A;  2WAQ A;  1XMX A;  2Q1Z B;  1UI6 A;  2W53 A;  1GV5 A;  4EJO A;  2QZ8 A;  2QA4 I;  3DPL C;  3WTT C;  3BY6 A;  1MDM A;  4IF4 A;  3B6A A;  3DF8 A;  1W4M A;  2DQR A;  5ILS A;  1APL C;  1P92 A;  2M30 A;  1SAU A;  4YFK F;  1HDD C;  3HUG B;  3FIS A;  2KDZ A;  5TIS C;  3RYR A;  4C3I J;  2IS6 A;  3K4N A;  2JSC A;  4D1Q A;  1W7P A;  2XF7 A;  5A2Q Z;  1WJF A;  2XB0 X;  1PUF B;  3ASN H;  2ZCN A;  1F36 A;  2COM A;  3SWH A;  3CCR I;  1TWG J;  2HVS A;  1XMA A;  1BJA A;  2WB1 N;  3CUQ A;  5CYV A;  4XID A;  2IRF G;  2KPM A;  3DXJ F;  3SFI A;  1PP7 U;  4JL3 A;  1I39 A;  2CQ7 A;  4Z6Y A;  3HTJ A;  3ELK A;  2A61 A;  1IN4 A;  4OMZ A;  3S3N A;  2X4H A;  3JR9 A;  4P55 A;  2VC0 A;  3LST A;  1XSV A;  3OYB A;  3OYC A;  1O57 A;  4OIR F;  3PJR A;  2OJE D;  4PUS A;  4PJM A;  1MBJ A;  1TWF J;  2FBQ A;  2DN0 A;  3L00 A;  2QQB A;  1OR7 A;  2XVC A;  4HPQ A;  3RJP A;  4BE0 A;  2G7G A;  3SXY A;  1WGX A;  2IU5 A;  3E97 A;  2ZXH A;  2BY1 A;  2IGM A;  1USS A;  2YPR A;  2KZG A;  1BBY A;  3VDX A;  5FB2 A;  5ED4 A;  4GFL A;  2EFW A;  1FOX A;  2M1B A;  1R58 A;  1I3A A;  2Y9Y A;  4M9X A;  4OIO F;  4XOT A;  5E3O A;  3GLL A;  1U9O A;  3TED A;  2P5K A;  4FT8 A;  3KFW X;  1WCM J;  1B1B A;  3PQK A;  3FKJ A;  4GYG A;  2RN7 A;  1VQL I;  4RAF A;  3J80 Z;  2M7A A;  3VVZ A;  3U1K A;  4WK8 F;  3I4M J;  3BRU A;  2P6T A;  2DDB A;  2ECC A;  4XBF A;  4AD9 A;  1DU0 A;  2R7T A;  4GCT A;  4DIQ A;  4UB6 C;  3WOD F;  4BDY A;  4YZE A;  1Z77 A;  4M74 A;  2VJ4 A;  2HKU A;  4BBR J;  3JRD A;  3QPS A;  3OY9 A;  4E7H A;  3BLY A;  2NX4 A;  3LQQ A;  2XGE A;  1XCV A;  1S7O A;  1IXR C;  3KYD B;  2ZCM A;  1KON A;  3GTP J;  1X1A A;  5J3L A;  5IYD J;  2ETH A;  5FHP A;  4L9V A;  2E7W A;  2PJR A;  4HX8 A;  3FRQ A;  4BH9 A;  2MSY A;  2A05 A;  2QYO A;  5ICF A;  3DEW A;  5J40 A;  1QVT A;  5TRD A;  2NVT J;  3DP7 A;  2L9S A;  3S5R A;  3P9C A;  4IHX A;  4X1E A;  2CGP A;  1BI3 A;  4RGX A;  2DBB A;  1YIJ I;  1UG0 A;  3RYP A;  2P81 A;  3K4J A;  4EGY A;  4B3X A;  5FGL A;  1TT5 B;  1BM9 A;  3EQL F;  4A3K J;  4M9Z A;  3IWF A;  3ZMZ A;  1REP C;  5EGO B;  5DD8 A;  1YO5 C;  1L0O C;  2HVQ A;  2CUZ A;  5IT9 Z;  2RKH A;  3HTU A;  2D6Y A;  2PN6 A;  2ZC2 A;  5E17 F;  2QIB A;  2HQN A;  1ZN2 A;  5EEA A;  2CO5 A;  1QRY A;  2ZB9 A;  2ZME A;  2R7Z J;  5AQC A;  1ZTR A;  1CF7 A;  4O6J A;  1UI5 A;  3E7Q A;  5LD2 C;  3K7A J;  2XV4 S;  1UHW A;  1HLV A;  1I3Q J;  4FET A;  1UB9 A;  4AWX B;  1I50 J;  1VQ6 I;  1ETW A;  4P1W A;  1YX5 A;  2JK3 A;  4R8H A;  3CD6 I;  4XMY A;  4XLA A;  3WU2 C;  2WWY A;  5CXI A;  5DEQ A;  1Z7L A;  4GO1 A;  2L0K A;  1SMY F;  4WXC A;  4CYD A;  2VBY A;  2VON A;  3ZQF A;  1XC5 A;  5D18 A;  4HF0 A;  2EFQ A;  2RGV A;  1QBJ A;  2PMZ N;  3K1P A;  4N0B A;  2D1V A;  4ZYA A;  4F3Q A;  1XDU A;  1EH6 A;  2BY3 A;  4UHT A;  3R60 A;  4U87 A;  4GXO A;  3OS2 A;  4YFN F;  3G3Z A;  3C2G A;  4UUS B;  1Y8R B;  2RV8 A;  4Z2Y A;  2DG8 A;  3TMO A;  1S7E A;  2YU3 A;  2V6E A;  4RGS A;  3CJD A;  4M3B A;  4MK6 A;  2JVH A;  3OYF A;  1WH5 A;  2BOL A;  3TO7 A;  1ZAO A;  3H3Z A;  3S3M A;  1P6R A;  1DUX C;  1FIA A;  4AUX A;  1ZLK A;  4ZH4 F;  1LKX A;  3IC7 A;  4WCG A;  1FEX A;  1YYV A;  1TT0 A;  4A69 C;  4QIW N;  2RAE A;  2IGK A;  1Z05 A;  3JTH A;  5CQE A;  3J81 Z;  2F2E A;  1SEU A;  2P7V B;  5E1X A;  2B7E A;  1TL8 A;  1WJE A;  2MLG A;  4HX7 A;  4RA2 A;  2X85 A;  4M6V A;  1X58 A;  4RB2 C;  3HOU J;  2X9D A;  4U7B A;  3CCY A;  4LB6 B;  5L3F A;  1V54 H;  3AAF A;  2HXI A;  3D5L A;  4MFD A;  1R49 A;  3BR6 A;  5DYM A;  2YUS A;  4ENJ A;  2CW0 F;  5IP6 A;  2CWE A;  1HKS A;  2IS1 A;  2NP3 A;  3BR2 A;  5IP7 J;  1JUM A;  2M5W A;  3HYI A;  3OS1 A;  1VFC A;  2W24 A;  1SD7 A;  2JRM A;  4ESF A;  2IA0 A;  3E6C C;  4LK1 F;  1ZR4 A;  1SAX A;  3VW0 A;  1Y6I A;  2GUH A;  3P9I A;  4E7I A;  2O61 A;  1FWZ A;  2R7X A;  2VKD A;  5FKK A;  4IQ4 A;  4AIK A;  3CC4 I;  2VXD A;  4Y4R A;  1Z91 A;  2RQP A;  1T2K A;  3FDY A;  1WJD A;  1X1C A;  1FBU A;  3D5S C;  4XLH A;  3I54 A;  3P9K A;  4LOC A;  1FOY A;  3I53 A;  3NEU A;  2R7D A;  3RQI A;  1BOB A;  3S15 J;  2GFN A;  5EEH A;  3BWG A;  3VOD A;  3RPU D;  2WUI A;  3OYN A;  2WC2 A;  2JSP A;  1X1P A;  2G7L A;  1IV6 A;  1LUJ B;  3CF5 F;  1YIT I;  1OCT C;  5KK1 A;  5HOD A;  3D0S A;  3WU0 A;  2HXO A;  5D5W B;  3LSP A;  3V4G A;  1FLI A;  3AFH A;  1R1U A;  3L2U A;  2HYJ A;  1K78 B;  2V9V A;  3S1Q J;  2QSF X;  4ZZD A;  2IJL A;  2FOW A;  4C3H J;  3BJO A;  3ML6 A;  2JZY A;  1LFB A;  2IBD A;  4AIH A;  4E7K A;  3ZN1 A;  3H0D A;  2E35 A;  3KZ9 A;  2FE3 A;  1FOW A;  1LDK B;  1IG7 A;  3CCU I;  2HYG D;  2JTV A;  1WJB A;  1ZRC A;  2BXY A;  4ON0 A;  1J2X A;  3FM5 A;  5LHG A;  3S16 J;  2EZK A;  3CCL I;  4AM3 A;  4MIM A;  5JR3 A;  1ZGW A;  1XD7 A;  1E3H A;  2JWT A;  3M4O J;  2LFB A;  3N97 A;  2F5V A;  4HLX A;  1Y1W J;  2ZXW H;  1RR8 C;  2CQQ A;  4F93 B;  3JRC A;  3GZI A;  5HLG A;  1LNW A;  2VJJ A;  2ZXI A;  2ID6 A;  4UY8 I;  2JA6 J;  3C3W A;  3BG6 A;  3TOA A;  1O7L A;  2ISZ A;  2XAQ A;  1F5T A;  1R7J A;  1X4O A;  5M5X J;  3CUQ C;  4HDU A;  3T1B A;  2DFI A;  3ZRG A;  1RR7 A;  3L9F A;  4W97 A;  1IRG A;  3VIB A;  4HBL A;  4N9I A;  3T5X A;  3V42 A;  2XSJ C;  2QM3 A;  1Y8Q B;  3LHQ A;  2P5V A;  3ZCO A;  3ZQI A;  5EZH A;  3ESW B;  2BY2 A;  4CSW A;  3DLL F;  2E1N A;  3KP3 A;  2J5O A;  4B47 A;  3CCJ I;  1UST A;  1YIO A;  5K5O A;  4FX0 A;  4CUG A;  2MLK A;  2CS3 A;  3H35 A;  3F1B A;  4BGD A;  2FBI A;  3U9G A;  3DPJ A;  2ZOZ A;  4DGW B;  3CCS I;  2JUC A;  2CRG A;  3H3U A;  2Y69 H;  4HOB A;  4BEH B;  2JUG A;  3CJT B;  1IN6 A;  1QPM A;  1GT0 C;  2DA5 A;  3F6O A;  3SEZ A;  5GTH C;  3LSH A;  4L9J A;  4B48 A;  2OU2 A;  4XOP A;  5C4J J;  4L5E A;  5FD6 A;  3GTK J;  2XGX A;  1BW5 A;  3L2C A;  5DCM A;  1IV8 A;  2XAS A;  4ZYE A;  1ZK8 A;  2VE8 A;  4F91 B;  5EDN A;  4A3F J;  3IV5 A;  1WI9 A;  1ETV A;  4A93 J;  4DYC A;  4EM0 B;  2HZD A;  2DA3 A;  2DA4 A;  4HQM A;  3PUB A;  4A3C J;  2OER A;  2P7C B;  2H8W A;  2L9N A;  1R4N B;  4A0X A;  5HS8 A;  1BIA A;  4ICH A;  1QU3 A;  1T0F A;  4FHT A;  4IZZ A;  2GEN A;  3K2A A;  3VOE A;  2ID3 A;  3HHG A;  1P7J A;  4UV9 A;  2IS4 A;  2AQF A;  1XGM A;  3L2V A;  3EUK L;  3FHN A;  4R1H A;  5LBQ A;  1LVK A;  3CDH A;  3G2B A;  5M3F J;  2DMT A;  2G7U A;  2GOM A;  2Z16 A;  4ESB A;  4KDP A;  5EG0 B;  3W6K B;  3A2K A;  3O60 A;  1D1B A;  3A01 A;  5ICE A;  4Y15 A;  2VT2 A;  2Y48 A;  1POG A;  3TGN A;  1VND A;  1LE8 A;  3I59 B;  4CHU A;  2FJ1 A;  2HTS A;  5IOY A;  1R23 A;  3F23 A;  2OCE A;  3SEQ A;  3NWS A;  5EYR A;  4KUM A;  4EJU A;  3AG3 H;  3OIP A;  2QWW A;  2ME6 A;  2HKO A;  3RPQ A;  4XLC A;  2IPQ X;  1OCP A;  3HUG A;  1R1T A;  2XGC A;  2NXN B;  1JTX A;  4IKF A;  1H88 C;  3KYL A;  3K8P C;  3QOE A;  1A04 A;  2LF7 A;  2RDP A;  4C30 A;  3Q5F A;  1RUN A;  1PUF A;  3M8F A;  5F0F A;  3H92 A;  2FQ4 A;  3HJE A;  5KHD A;  3BZK A;  3ABU A;  2ZME C;  5AON A;  3ZMD A;  4ZYH A;  1WVR A;  3LFK A;  4XRS G;  1ZR2 A;  3C1D A;  3GTG J;  4IL6 C;  2VL8 A;  2JT1 A;  3IKV A;  1IUY A;  4NQW B;  2W48 A;  4Q48 A;  1GHC A;  2JPC A;  1FC3 A;  1MBE A;  3OWT A;  4RM3 A;  3KP2 A;  1TQP A;  3S3O A;  1VQP I;  3MKZ A;  1HOM A;  2UXO A;  4KWA A;  3MMY B;  3RPU A;  3H9Q A;  1PP8 F;  2BV6 A;  4KN4 X;  2OI8 A;  4OD5 A;  1KYZ A;  5CJ9 A;  4Q5S F;  5J47 A;  4FIS A;  1BIB A;  3G7R A;  4A0Y A;  3DBR B;  2COB A;  2VC1 A;  2PQ8 A;  1E17 A;  2OAZ A;  1MSE C;  4BHB A;  3JRI A;  4U7D A;  1XN7 A;  4IEJ A;  5D19 A;  2JA2 A;  3COL A;  3CCV I;  2M4G A;  1G8X A;  3C07 A;  2DTR A;  3F3X A;  1B6A A;  3SZG A;  2V1U A;  3R6S A;  1ZRD A;  4KMF A;  2VKV A;  2OD5 A;  3U2R A;  5F0H A;  2DMN A;  3KNW A;  2DO7 A;  3W3C A;  3SZP A;  2R5Y B;  5C44 J;  4XKC A;  2L7F P;  3P7N A;  1GVJ A;  2KFD A;  4NUB A;  3ANP A;  2DTZ A;  2FBK A;  4EM1 A;  5D8K B;  4CCL A;  4A0Z A;  2XSD C;  4DZJ A;  2GAU A;  4A6D A;  3SJM A;  5FLV A;  1V5F A;  2BVL A;  5HDK A;  2QWT A;  2CW8 A;  2EFO A;  2WB1 A;  3CP8 A;  1ETX A;  2LKP A;  2R7F A;  4EQQ A;  3K4C A;  2PJP A;  3S1M J;  4GCL A;  2BGC A;  4U0V A;  1V55 H;  3FWE A;  1SFK A;  1K4S A;  3ZN0 A;  2ZJR F;  3OS0 A;  3F6V A;  1UAA A;  4LIT A;  1XPX A;  5C3E J;  3BR3 A;  2CMP A;  2M45 A;  3TO6 A;  1S9H A;  2DFH A;  2IAI A;  4UVB A;  1HW5 A;  3F8M A;  2DOF A;  1U78 A;  3AG4 H;  2HWV A;  5B5E C;  4F7Z A;  2HDW A;  1SFX A;  3D5R C;  3EPZ A;  2LVS A;  1F1Z A;  3GZN B;  3HSE A;  4S04 A;  5HBU A;  1EV7 A;  3OYJ A;  4J01 A;  3EUH A;  5J8C A;  4BNC A;  5LLQ A;  1JT0 A;  3VFZ A;  1ETY A;  2K02 A;  3HKZ A;  3OYL A;  3RIR A;  3NQO A;  1YOV B;  2W82 A;  2R7Q A;  3TW7 A;  1WZ2 A;  3V8K A;  5EGO A;  3W2W A;  2DG7 A;  3LNQ A;  3FXR A;  1B4A A;  1QQI A;  1A35 A;  5E8G A;  3HSR A;  1BJZ A;  3J7Y J;  1H8A C;  3HBL A;  4KN7 X;  3TP3 A;  2HNH A;  1LEA A;  4KT6 A;  2V4J C;  1YJ9 I;  3H1C A;  1RIO H;  3L2R A;  2ME0 A;  3NAR A;  5HOO A;  4AIJ A;  2PLY A;  2GBY A;  4L9T A;  1OQY A;  4CZC A;  3RSN A;  4MQ9 F;  3N05 A;  1SD6 A;  1VQ8 I;  2ZFW A;  4RM2 A;  1WI3 A;  2EH3 A;  4BQQ A;  5D5U B;  2L7K A;  1VI0 A;  1MKM A;  1ETQ A;  4I02 A;  3FM3 A;  3WGG A;  2DCE A;  3LOC A;  2LY1 A;  5GAG J;  2ZBK A;  5F64 A;  3VEP A;  3CO7 C;  1E2X A;  3IWZ A;  2F5F A;  4OAY A;  4CH7 A;  4XL9 A;  2R7U A;  1UFM A;  3M1E A;  3V8J A;  2LG4 A;  4LG0 B;  4A5N A;  1HW1 A;  3QAH A;  3VSL A;  3GFL A;  4MFE A;  3QPH A;  2M9H A;  4BKX A;  5B1A H;  4DVY P;  4UUS A;  3HRT A;  3K0L A;  4RB3 C;  3ERE D;  3KLO A;  3LA3 A;  4I0A A;  2EQR A;  3V7S A;  3BR0 A;  5FJ8 J;  3TP0 A;  4ZTF A;  4H0E A;  3PSF A;  4BAY A;  2YR2 A;  4HW0 A;  3A1Y A;  2H6B A;  2UZK A;  3J7Z I;  3GTQ J;  2KIM A;  5IOZ A;  2VBX A;  3CME I;  1IW7 F;  3K6G A;  1TC3 C;  4PK4 A;  2F4I A;  3BPV A;  5FLM J;  2FX0 A;  2CW7 A;  2PEX A;  1R1V A;  4MLO A;  4XKW A;  2LDU A;  3BDD A;  3AL0 C;  4EJW A;  1U9N A;  1Y56 A;  2O8X A;  5FKM A;  5DD4 A;  2EK5 A;  4ETS A;  2Z2S B;  3HIF A;  2ZSI B;  5D6E A;  2W4S A;  3JRF A;  1NK3 P;  3K9T A;  2TRT A;  3EUA A;  2REK A;  1VQ5 I;  4ACI A;  2GLO A;  2K9M A;  4XKV A;  4OIN F;  1IAW A;  2Q0O A;  4HLY A;  1NH3 A;  2VJI A;  2HQA A;  1X3Z B;  1ZYR F;  2DA2 A;  4JK1 X;  5EEG A;  2XRL A;  4G6T B;  5BS6 A;  3BJB A;  2K27 A;  2LMD A;  2TCT A;  3C18 A;  4BY7 J;  1QZY A;  1TW3 A;  4X0G A;  1SVO A;  3GXO A;  5DCF A;  1JKO C;  1VQ7 I;  3I3L A;  2J5P A;  4Q47 A;  1A5J A;  5JFR A;  2E5N A;  2PMU A;  1D8J A;  3KEY A;  3H5N A;  1FSH A;  1J9I A;  4V2F A;  3SDB A;  3NWT A;  1WH7 A;  5E1W A;  3A0B C;  4B4C A;  4U9N A;  3JAM Z;  2F48 A;  4RB1 A;  4A3I J;  4BY1 J;  3CJR B;  3DKY A;  2IA2 A;  3MQ0 A;  3SQN A;  2L54 A;  3ECH A;  4WF2 A;  3TBI A;  2FRH A;  3ZQG A;  2OZU A;  2VOP A;  2DK5 A;  5F1J A;  3L2W A;  3OR1 C;  4WXH A;  3GWZ A;  2E1O A;  3SFZ A;  1V4R A;  4KJZ A;  3H36 A;  1Z3Y A;  2EIJ H;  1KU3 A;  2E60 A;  4XNF A;  4AYB N;  4D7M A;  3NPI A;  5M3M J;  3F22 A;  3W2A A;  2D1H A;  3ULQ B;  1T0F C;  1JHF A;  2H27 A;  2WGB A;  2LTP A;  5L3B A;  1K78 A;  5E8I A;  2EZL A;  1BI2 A;  4D5C A;  2L7Z A;  2QVO A;  3B73 A;  4CCM A;  4UNO A;  2KZV A;  2AXT C;  3WE2 A;  1FPQ A;  4BXU A;  4EMS A;  1FMW A;  2E1M B;  2FBH A;  4KMU X;  3KPH A;  2K3P A;  2KJB A;  3PFI A;  3FKI J;  5CVU A;  4MNU A;  5ICC A;  4IHT A;  1XGO A;  2ELH A;  5BQT A;  1I6H J;  2BW3 B;  1DDN A;  5CKT A;  2W25 A;  1B9N A;  2DT6 A;  2QSH X;  3TDU C;  3H9J A;  4NC6 A;  2G0E A;  3ABL H;  5CPR B;  1OYW A;  4PJL A;  1O3T A;  4RLF A;  2NNY A;  2BHY A;  2ACJ A;  3GEZ A;  2L3D A;  1MBK A;  4BUP A;  3ZQL A;  3GZ6 A;  1I1G A;  2XDN A;  2DOE A;  1Z1D A;  1MND A;  2DFE A;  4JX6 A;  4F55 A;  1VQ9 I;  1I5Z A;  3QPT A;  3I71 A;  2STT A;  4J19 A;  3QU3 A;  3F0C A;  4II2 A;  2FMY A;  5FKL A;  2GQQ A;  2M3A A;  5M5W J;  3PSI A;  1YW9 A;  1U5T B;  1X2N A;  1ULY A;  1HDP A;  5HSZ A;  1Q1V A;  4PGG A;  2R7V A;  3CDL A;  2KRC A;  4LLL A;  1K6O A;  1X4P A;  2E2I J;  5H6R A;  4CZZ A;  3E1S A;  5E20 A;  5EJC A;  4KIT B;  3GFI A;  2X51 A;  2LYC A;  3OOU A;  1P2F A;  3CZ6 A;  5FD5 A;  3RDI A;  4ASN A;  1D1A A;  2Z5U A;  4HDV A;  4EV0 A;  2MC3 A;  3H9G A;  2R7R A;  2EWN A;  1I27 A;  2XC7 A;  3F21 A;  2HOS A;  2HR3 A;  4BEH A;  2W84 A;  1U6G A;  4S05 A;  2QCO A;  1T6S A;  4PJ0 C;  2O7T A;  2X1C A;  1O4X A;  5DUK A;  4JX5 A;  4XK4 A;  5J6X A;  4R79 A;  1MMA A;  3HOZ J;  1UMQ A;  5L3D A;  4G6D A;  4C2T A;  3ON2 A;  2O5R A;  2OF7 A;  3CRJ A;  2LY2 A;  3IH2 A;  2UXP A;  3BQZ A;  3HSF A;  1IRZ A;  2DMP A;  1OKR A;  4OAZ A;  1SMT A;  1XB4 A;  5H9T A;  3HGY A;  4ENM A;  3QRF F;  3PQJ A;  2WA0 A;  1ZG1 A;  1ENH A;  5D1R A;  1IC8 A;  1IDZ A;  1UHM A;  3UNG C;  3IH3 A;  4BBS J;  2JMW A;  2QQ8 A;  1HA8 A;  4RAZ A;  2V1X A;  1YS7 A;  3ABM H;  3ECO A;  4I98 B;  1VQ4 I;  3LWJ A;  2KMU A;  3BG5 A;  2DJI A;  2E1M C;  4M3D A;  2KIQ A;  3ZGK A;  4JNN A;  2IP2 A;  3Q0V A;  1LFU P;  3MWM A;  3JRE A;  2O0Y A;  2HPI A;  2XKP A;  3GUD A;  3HPH A;  1IN5 A;  3KZZ A;  1S5L C;  2XDV A;  4ME9 A;  2F5D A;  4AVP A;  1MBF A;  2VJ5 A;  3LJL A;  2O7O A;  4DQ2 A;  2CQN A;  2JA7 J;  3VP5 A;  3RTR A;  5EG0 A;  3VVY A;  1WJC A;  1O3Q A;  2KHM A;  1MH4 A;  2NVU B;  2NVQ J;  1QVU A;  2PMH A;  2QKM B;  5M5Y J;  4XLE A;  2L9R A;  3I59 A;  1XMK A;  2BXZ A;  4BU2 A;  3BJA A;  3OYK A;  5KCM A;  3M9A A;  4CDG A;  2OUM A;  3EUH C;  3LSI A;  4DYR A;  3HTI A;  4RAY A;  2Y9Z A;  1U5T C;  3FBI B;  4G6Q A;  3S2D J;  4HKU A;  4XON A;  3ZMS A;  3BCG A;  4E70 A;  3I56 I;  3G73 A;  2ICW G;  2HI3 A;  4I09 A;  2JN6 A;  2H6C A;  5LHI A;  4BQO A;  3ZQH A;  1VQN I;  2BVM A;  3JRB A;  3WTW C;  1GUU A;  2K9Q A;  4YII A;  2DOD A;  4F52 A;  4CYC B;  4I7H A;  2OCC H;  3BHQ A;  3LMM A;  2R7O A;  2ZKZ A;  4HNT A;  1YX3 A;  3OSG A;  1PVE A;  3S1R J;  3A02 A;  3WG7 H;  4Y52 J;  4NQW A;  4PZJ A;  2FSW A;  4JYK A;  2QGU A;  4CCK A;  4L0Z B;  1ZRF A;  4OIQ F;  2VXZ A;  4G8X A;  1BA5 A;  1JKR C;  3IH4 A;  3S17 J;  2BE5 F;  1W5T A;  1JTY A;  3E5Q A;  4BHC A;  1D5Y A;  2ECB A;  2MD5 A;  2NAZ A;  2EZI A;  1KQ8 A;  2HS5 A;  3V8L A;  3HTS B;  1FT9 A;  2NS8 A;  1RRJ A;  4X6A J;  2KRH A;  3LSM A;  2ZY9 A;  1R71 A;  4L0Y B;  1DGW Y;  2LF8 A;  2A5W A;  5FMP A;  3BC8 A;  3VSK A;  1A6Q A;  3PIO F;  1JXS A;  4DYQ A;  3FK6 A;  5DUI A;  2N8G A;  1ERD A;  3Q0U A;  5ERI A;  2Q24 A;  3OYD A;  4WXD A;  5K7Z A;  4HRI A;  2OTL I;  5K7H A;  1P4W A;  2R5Y A;  2DA7 A;  2IGN A;  3RKX A;  3U1D A;  4M3G A;  4EGZ A;  3VOX A;  4ZC3 A;  3ONQ A;  4XLF A;  2AO9 A;  2G9W A;  2UXU A;  3A03 A;  4RAG A;  3VYS B;  2P8T A;  1ODD A;  1R22 A;  3M7G A;  4U88 A;  1PYV A;  1T33 A;  4E4H A;  5BPI A;  2C6Y A;  4D7N A;  1B9M A;  2DA6 A;  2YVE A;  4QTR A;  1VQO I;  1XGN A;  1Z67 A;  5AIP A;  3RCO A;  2LKX A;  2KIU A;  3DPU A;  4XSX F;  5J1Y A;  4A3E J;  3CCE I;  2FNP A;  3ISP A;  1OLT A;  1LPQ A;  3CF2 A;  4LLG F;  5C4Y A;  4FQG A;  4XKB A;  5HNF A;  4IRH A;  1KGS A;  3S93 A;  2QSG X;  2NYX A;  4HYE A;  3KX2 A;  3HIM A;  1X3W B;  3FK7 A;  2XUB A;  4ZDP A;  1G3W A;  4E7J A;  1RKT A;  2LRE A;  3HOW J;  3NS4 A;  3GW2 A;  4I6Z A;  2HDD A;  5J4Y A;  1I6X A;  5IP9 J;  3B6C A;  3IHU A;  4XOR A;  3KP7 A;  4B09 A;  4LIV A;  5FRO A;  2K9L A;  2LLK A;  2UV1 A;  2Z1D A;  3WGH A;  1HC8 A;  1X1B A;  3G4S I;  2XB5 A;  3R0A A;  3OV8 A;  3DPT A;  2FOK A;  3BCA A;  5KVR A;  2LBF B;  4A3J J;  5FRN A;  3REO A;  2VKH A;  4MEX F;  5HS9 A;  1SAN A;  4B8X A;  2WAE A;  3I5U A;  4ZJZ A;  2QUF A;  3I0T A;  3Q9V A;  2V79 A;  3OYG A;  3HOT A;  4BQA A;  1SD4 A;  1HSJ A;  1NG7 A;  3R61 A;  4P9F A;  2X6O A;  4L9N A;  1LB2 A;  1XGS A;  3LSJ A;  1XCB A;  2KRF A;  4ZZL A;  2VE9 A;  4B44 A;  2DPU A;  3WE3 A;  4G7O F;  3DEU A;  4NN1 A;  4HSR A;  2HVR A;  4LJZ F;  4MGR A;  1SGM A;  2K40 A;  2OV7 A;  2D2W A;  2OPT A;  2WV1 A;  3BZC A;  1D5V A;  5L3G A;  3K2Z A;  2E5Z A;  4UXN A;  1HW2 A;  5TJJ A;  1MNE A;  2WY7 Q;  5GPA A;  3UR3 C;  3CLQ A;  3TOB A;  2LP0 A;  2NP5 A;  1DU6 A;  4BQN A;  2NVY J;  3H0G J;  1YQA A;  3BTI A;  2PFV A;  4MXM A;  3S2H J;  2X1E A;  1MJA A;  3BTL A;  3Q3S A;  4MEY F;  3WTZ A;  4CCO A;  4LG0 A;  3RZO J;  1FNN A;  5F27 A;  4BE1 A;  1YG2 A;  1W5S A;  2HKX A;  3LA7 A;  3E0J B;  3G1O A;  1WQ2 A;  2CU7 A;  4A3L J;  4A3G J;  5JHU A;  1IRX A;  4KA4 A;  3O3K A;  3D1N I;  1O7F A;  2FNA A;  3I9V 2;  1HBX G;  1HCR A;  1J5Y A;  3VVX A;  2L5Q A;  2CUE A;  2CQK A;  1K83 J;  2MFZ A;  1G59 A;  2KLO A;  1W0T A;  4IJA A;  5ILU A;  2NOG A;  5FGM A;  1OCZ H;  1SFE A;  2OTJ I;  2M7B A;  1G3S A;  2XRO A;  2IEK A;  1ZG5 A;  3O8H A;  1AOY A;  4V19 K;  2E2J J;  1QO0 D;  2OC6 A;  3U21 A;  2NOJ B;  4UDS A;  3FMS A;  1ZAR A;  1JGG A;  2EZH A;  2FJI 1;  2K5C A;  2CV0 A;  5L3C A;  1HKQ A;  1MMN A;  2FXA A;  2VBW A;  3CTA A;  2M0C A;  2LRD A;  1QHH D;  4ZTJ A;  1TNS A;  4NDL A;  2DA1 A;  4KNY A;  3FXO A;  3ROU A;  3IRQ A;  4ZDO A;  2L4M A;  3KKC A;  5TGT A;  1E0E A;  4OD4 A;  1QZZ A;  1S3J A;  2QQ9 A;  3WTY C;  1UEL B;  5E18 F;  4RS8 A;  4OIP F;  3KP5 A;  1SFU A;  3I58 A;  2M0M A;  2I5U A;  1JGS A;  1UCR A;  1Z6T A;  1JT6 A;  5FLX K;  2E36 A;  2M8E A;  2B3W A;  2F4M B;  1RNL A;  1XG1 A;  3L09 A;  2VKE A;  2XF6 A;  2ADU A;  1G6N A;  5E1Z B;  1ZEL A;  4UUV A;  1IGN A;  1B59 A;  3C7J A;  1YFH A;  2VPR A;  1ZQ3 P;  3WU1 B;  4XR6 A;  3QYF A;  4G9Y A;  3LFU A;  3F9K A;  3LSG A;  2MH9 A;  3HRU A;  1WHU A;  1TLH B;  1R5I D;  2KQR A;  4LGW A;  2ZJP F;  2EA4 A;  2ELJ A;  2ZCW A;  3OR2 C;  1JKP C;  3CCQ I;  2K86 A;  3OL4 A;  3EDP A;  3QWL A;  3G56 A;  4IRV A;  2VT3 A;  1QPI A;  3KEO A;  3OOP A;  2VN2 A;  3AKZ A;  4RLQ A;  1N78 A;  2GIV A;  3SDG A;  1WWX A;  4PXI A;  2Q8K A;  1SVL A;  5HS7 A;  2DYS H;  4M3E A;  2ZCX A;  4F92 B;  4IX7 A;  1VZ0 A;  1GVD A;  4EM2 A;  4FX4 A;  1YE9 A;  5K1Y A;  1IDY A;  2HQ5 A;  3L7W A;  3ABT A;  3QKX A;  4GCV A;  4AC0 A;  1E3P A;  2BW3 A;  3B02 A;  1B72 A;  4J00 A;  5HLT A;  1Z3X A;  5CVV A;  4KYW A;  3BTC A;  3GTM J;  5KAF C;  2RNG A;  2UXN A;  4L62 A;  4M71 A;  4E7S A;  1TNT A;  1UZC A;  1Y1V J;  5F04 A;  4P9U A;  1ZRE A;  3E5U A;  3PNT A;  2VPL A;  2WBM A;  1F9N A;  5F08 A;  2DJN A;  4A2U A;  2UWM A;  4NBQ A;  2ZSH B;  2X6X A;  4YIF A;  5CVJ A;  3O2P E;  4ZYD A;  5A2Q K;  3JRH A;  2Z33 A;  3DKW A;  4JBA A;  1S8N A;  2LNB A;  2BBY A;  4JX4 A;  2FEZ A;  1MIJ A;  4RB0 A;  4B43 A;  4BXX J;  3DQV C;  2GIZ A;  3ANG A;  2QKO A;  1AU7 A;  3PPB A;  1A36 A;  3RD3 A;  1U5T A;  2CG4 A;  1OIS A;  4QPO A;  2F6C A;  1XS9 A;  1RES A;  2P6S A;  1M1E B;  1FYM A;  1HXD A;  1VTN C;  1W36 C;  1QHG A;  2Y75 A;  1E3O C;  6PAX A;  5LRS A;  3BCB A;  3OYH A;  1G3T A;  4U0W A;  4Y17 A;  2FUG 2;  3CMM A;  4IHS A;  3PL8 A;  3GEU A;  2XAU A;  4AID A;  3CC7 I;  2XPW A;  5D5V B;  4KIB A;  1TWH J;  5HLI A;  4C2M A;  2DMQ A;  3ASO H;  2DU9 A;  2V6C A;  3MD2 A;  2QBY B;  2B63 J;  2L9V A;  1W1W E;  5H6Q A;  1H9T A;  3S8P A;  4XM3 A;  2R3S A;  1GXQ A;  3PIP F;  3LSR A;  4A12 A;  1MMS A;  1FX7 A;  5D5X B;  1V5G A;  2I8D A;  5E79 C;  4ANJ A;  1Q1H A;  2YSR A;  3B81 A;  2DT5 A;  3IL2 A;  1OCO H;  3CMY A;  3HEF A;  1ZG3 A;  5CLS A;  1FIP A;  1VQK I;  1S29 A;  3VW1 A;  3MZY A;  2VOD A;  5EFY A;  5KNL A;  1KU7 A;  4G12 A;  4ZYG A;  3J80 K;  3KE2 A;  3BZ6 A;  2XHK A;  4K2E A;  2GXA A;  3IRR A;  4IHW A;  3S14 J;  1JJ6 C;  5C4X J;  4KIG A;  2V26 A;  2YS9 A;  2AXL A;  3JCU C;  3PNV A;  5D4S A;  1O3S A;  5GTI C;  2PI0 A;  4ENN A;  3ON4 A;  1HQC A;  4XSZ F;  3GLX A;  2HYF A;  4C3J J;  2BY0 A;  3TW6 A;  1SD5 A;  3H5R A;  2MH2 A;  3TL4 X;  3MKW B;  1LQ1 A;  3DU5 A;  2EIM H;  3HRS A;  3Q0W A;  2Y2Z A;  2MG4 A;  2K9N A;  9ANT A;  4AC6 A;  3JW4 A;  2EV5 A;  4L5J A;  4BAC A;  5HDG A;  3BNI A;  1KU2 A;  2I10 A;  3BQY A;  5DDG A;  4HAM A;  1KZH A;  3ZMU A;  1D3Y A;  1IN8 A;  1YW8 A;  1FYK A;  5IPA A;  5BPD A;  2LC2 A;  5JVT A;  2F5C A;  5H20 A;  4E7L A;  2V7F A;  4KFC A;  3CES A;  4L18 B;  5LGT A;  2DK8 A;  2GXG A;  1SC7 A;  2O8K A;  4MHG A;  3DEE A;  4II3 A;  3E6D A;  3SYT A;  3W6J B;  1C0W A;  2O03 A;  2CSO A;  1NHA A;  5BOX A;  4CGR A;  3EGQ A;  3ZQQ A;  2L7M P;  2HTJ A;  4CIC A;  1KQ9 A;  1AWC A;  1DPU A;  4PSX A;  1DGR M;  1G2H A;  3QP6 A;  3TDZ C;  4A6E A;  2G7H A;  4I99 C;  5GAH J;  2VI6 A;  5CW8 A;  3BR1 A;  4XRF A;  5CVR A;  3JSO A;  3S1N J;  2EFN A;  4U9L A;  2KDO A;  5IT9 K;  3E6B A;  1MJ9 A;  1STZ A;  2OA4 A;  3V6G A;  5HLH A;  3HM5 A;  1GV2 A;  2PMZ A;  2W7N A;  2MYS A;  4P5O A;  3F8F A;  3SZT A;  1JJ8 C;  3CWR A;  1MH3 A;  4YRV A;  1B8I A;  1BR2 A; 
#chains in the Genus database with same CATH homology
 3JRE A;  3DPJ A;  1W0U A;  2ZOZ A;  1ORK A;  1Z0X A;  3JSJ A;  2CRG A;  4CYC A;  4DW6 A;  1WPK A;  4ME9 A;  2H1K A;  1ETO A;  3VW2 A;  2O9L A;  1MBF A;  1GT0 C;  3LJL A;  3MKL A;  1ETK A;  2DA5 A;  2M8G X;  2O7O A;  3VUQ A;  2JA7 J;  3VP5 A;  5EG0 A;  3VVY A;  3RKQ A;  3HTA A;  5C4J J;  1MH4 A;  1MNM C;  4L5E A;  3GTK J;  2NVQ J;  1BW5 A;  1QVU A;  5M5Y J;  2L9R A;  1ZK8 A;  3RZD J;  3AQS A;  5EDN A;  4A3F J;  4DYR A;  3M3Y J;  3HTH A;  1MBG A;  2HOT A;  3IV5 A;  1MSF C;  3HTI A;  3GTO J;  1ETV A;  4A93 J;  2Y9Z A;  3S2D J;  4HKU A;  4DYC A;  1UHS A;  3WHC A;  2DA3 A;  2DA4 A;  3BCG A;  4GCK A;  3VOK A;  4ABZ A;  4A3C J;  2HI3 A;  2JN6 A;  3E7L A;  2OER A;  4JP0 A;  1LFU P;  3BT9 A;  1BL0 A;  3HKZ N;  3ZQH A;  3MVP A;  3JRB A;  3QQA A;  1R9T J;  1T56 A;  1B72 B;  4ICH A;  4RDU A;  1GUU A;  4A3B J;  2G3B A;  2K9Q A;  2R0Q C;  2GEN A;  3HOY J;  3K2A A;  2ID3 A;  2R5Z A;  2V57 A;  1P7J A;  4CYC B;  2CUF A;  3BTJ A;  3BHQ A;  3OSG A;  3S1R J;  2CJJ A;  1RKW A;  3A02 A;  5J1U A;  4Y52 J;  4JYK A;  2LK2 A;  1AHD P;  5M3F J;  2DMT A;  1BA5 A;  1JKR C;  3HE0 A;  3IH4 A;  5EG0 B;  4B3A A;  3S17 J;  3O60 A;  3A01 A;  1JTY A;  1D5Y A;  2ECB A;  4HNV A;  1JUP A;  2EZI A;  3L1P A;  1POG A;  1LE8 A;  1VND A;  3HDD A;  2FJ1 A;  1JUS A;  2NS8 A;  5IOY A;  4X6A J;  2MGQ A;  4UUT A;  2M34 A;  5EYR A;  3NI7 A;  3QPL A;  3QBM A;  2HOA A;  5FMP A;  2ME6 A;  4DYQ A;  3UKG A;  3ZQC A;  2XPU A;  3T6N A;  3C2B A;  1OCP A;  3FK6 A;  2N8G A;  1F43 A;  2XGC A;  1JTX A;  3Q0U A;  2Q24 A;  1H88 C;  5BNG A;  5K7Z A;  2ZOY A;  5K7H A;  2R5Y A;  2DA7 A;  2Y0S N;  1PUF A;  4M3G A;  5F0F A;  2FQ4 A;  2R5Z B;  3VOX A;  2AO9 A;  1ZR2 A;  2YVH A;  4M3F A;  4XRS G;  2UXU A;  3GTG J;  3FIW A;  2VUM J;  3A03 A;  3BR5 A;  2W48 A;  2XPV A;  1MBE A;  1T33 A;  5GP9 A;  2F07 A;  4D7N A;  2DA6 A;  2YVE A;  4QTR A;  4FTH A;  2WAQ N;  4A3M J;  2LKX A;  3A01 B;  4FE4 A;  4Y7N J;  1OFC X;  5J1Y A;  3G1L A;  4A3E J;  1HOM A;  5E3M A;  2UXO A;  4KWA A;  3AQT A;  1LE8 B;  2ELK A;  2GM4 A;  2OI8 A;  2LD5 A;  3NRG A;  1AKH A;  5C4Y A;  3G7R A;  4FIS A;  1YRN A;  2RAS A;  1UI6 A;  2W53 A;  2COB A;  1GV5 A;  1MSE C;  3JRI A;  3HIM A;  4IEJ A;  3JRG A;  5D19 A;  3COL A;  3FK7 A;  3B6A A;  3C07 A;  5EZG A;  1APL C;  1HDD C;  5CXG A;  2Y30 A;  1RKT A;  3FIS A;  2KDZ A;  1NK2 P;  2VKV A;  4C3I J;  3HOW J;  5F0H A;  2DMN A;  2HDD A;  4I6Z A;  3KNW A;  3OIO A;  2R5Y B;  2XB0 X;  5C44 J;  1PUF B;  5IP9 J;  2ZCN A;  2L7F P;  3B6C A;  1F36 A;  4JKZ A;  1RPW A;  1TWG J;  2WB1 N;  2LLK A;  4XID A;  2DTZ A;  3ANP A;  5DAJ A;  3SFI A;  2XSD C;  4JL3 A;  2XB5 A;  4DZJ A;  2JA5 J;  3HTJ A;  1VF9 A;  3SJM A;  5FLV A;  4A3J J;  2QWT A;  3P9T A;  3JR9 A;  1SAN A;  1BW6 A;  2D5V A;  3MN2 A;  1ETX A;  3S1M J;  4GCL A;  4QSH A;  2FBQ A;  1MBJ A;  1TWF J;  2DN0 A;  2G7G A;  2IU5 A;  1WGX A;  2EBI A;  1AKH B;  3H3V K;  1YRN B;  2X6O A;  3G1M A;  4GFL A;  3LSJ A;  5C3E J;  4NN1 A;  3BR3 A;  2G7S A;  1SGM A;  3V78 A;  4XRM A;  2K40 A;  3KKD A;  2WV1 A;  2OPT A;  2IAI A;  1FTZ A;  2Y9Y A;  3JRA A;  3ZOB A;  1U78 A;  5E3O A;  1U9O A;  4DZP A;  3TED A;  1U8B A;  2LVS A;  1B8I B;  4XRS A;  5GPA A;  5HBU A;  2LP0 A;  2NP5 A;  1WCM J;  1DU6 A;  2NVY J;  3H0G J;  3BTI A;  1JT0 A;  4MXM A;  3S2H J;  1ETY A;  3BTL A;  3Q3S A;  3VVZ A;  4AF5 A;  3RZO J;  4IHV A;  3TW7 A;  1RET A;  3PM1 A;  2XGD A;  5F27 A;  3I4M J;  5EGO A;  2DG7 A;  1UG2 A;  3LNQ A;  2R92 J;  3G1O A;  4NEL A;  3BRU A;  2ECC A;  1DU0 A;  2CU7 A;  2HYT A;  4GCT A;  4A3L J;  1BJZ A;  1H8A C;  3HBL A;  4A3G J;  1TWC J;  3TP3 A;  3VPR A;  4GFK A;  3D1N I;  1Z77 A;  2HKU A;  4YZE A;  4BBR J;  3JRD A;  1HCR A;  2JA8 J;  3QPS A;  2ME0 A;  4XIC A;  3NAR A;  2NX4 A;  3VVX A;  2XGE A;  2R93 J;  2CUE A;  2ZCM A;  2GBY A;  3GTP J;  1K83 J;  3NNR A;  1W0T A;  5J3L A;  4S0H B;  5IYD J;  1EF4 A;  2NOG A;  1WI3 A;  2EH3 A;  3GBG A;  4D5F A;  1VI0 A;  5FHP A;  2IEK A;  1ETQ A;  3O8H A;  2NS7 A;  1X2M A;  3W6V A;  3FRQ A;  2E2J J;  2MSY A;  1MBH A;  3DEW A;  1QVT A;  4UDS A;  3LOC A;  2NVT J;  1JGG A;  2EZH A;  3S5R A;  4IHX A;  4X1E A;  3WHB A;  2M0C A;  5FGL A;  2P81 A;  2KT0 A;  1CQT A;  4NDL A;  5JLW A;  4A3K J;  2DA1 A;  2JJ7 A;  2LR8 A;  3NXC A;  4MFE A;  2M9H A;  4BKX A;  5EGO B;  4UUS A;  5DS9 A;  3KKC A;  2EQR A;  3BR0 A;  2D6Y A;  2X48 A;  5FJ8 J;  2QIB A;  3TP0 A;  5EEA A;  4GFB A;  1QRY A;  2ZB9 A;  2R7Z J;  5AQC A;  1JT6 A;  2CQX A;  1ZTR A;  3GTQ J;  3EUP A;  1UI5 A;  5IOZ A;  3E7Q A;  2K9S A;  2M2E A;  3K7A J;  1H89 C;  1XG1 A;  5FKO A;  2YU9 J;  5JLX A;  1HLV A;  2VKE A;  1I3Q J;  1TC3 C;  5FLM J;  2FX0 A;  1IGN A;  1I50 J;  1ETW A;  2JK3 A;  2VPR A;  1ZQ3 P;  4MLO A;  4W1U A;  5CXI A;  3NAU A;  2FD5 A;  1U9N A;  3LSG A;  1IJW C;  5DTD A;  1NTC A;  2L0K A;  5FKM A;  3HOX J;  2UXI A;  3ZQF A;  1XC5 A;  1JKP C;  5D18 A;  1K61 A;  3JRF A;  4RBO A;  4MO7 A;  1NK3 P;  2TRT A;  2PMZ N;  3G56 A;  2REK A;  2QF7 A;  1QPI A;  4ACI A;  2GLO A;  5IYC J;  3CQZ J;  3SDG A;  4PXI A;  3O8G A;  4M3E A;  2ZCX A;  2DA2 A;  4UUS B;  5EF6 A;  2XRL A;  1A6I A;  2DG8 A;  3BJB A;  1GVD A;  1S7E A;  2TCT A;  1IDY A;  3CJD A;  2HQ5 A;  3DCF A;  4M3B A;  4MK6 A;  3QKX A;  4BY7 J;  1WH5 A;  4AC0 A;  5J1R A;  1JKO C;  1B72 A;  2E19 A;  1A5J A;  2Y31 A;  3HGG A;  1FIA A;  4AUX A;  3BTC A;  3GTM J;  4L62 A;  2QTQ A;  4V2F A;  3PAS A;  1Y1V J;  1WH7 A;  5F04 A;  4B4C A;  1FEX A;  4A69 C;  4EEF G;  4QIW N;  2RAE A;  5F08 A;  2DJN A;  4A3I J;  2UXH A;  4BY1 J;  3ZQG A;  3JRH A;  2H8R A;  4M6V A;  5F1J A;  1X58 A;  3HOU J;  2QOP A;  2PBX A;  2X9D A;  2E1O A;  3GTL J;  3NPI A;  4JX4 A;  4D7M A;  3CCY A;  4AYB N;  4BXX J;  5M3M J;  2HXI A;  3ANG A;  4MFD A;  3BR6 A;  1FJL A;  2QKO A;  1AU7 A;  2YUS A;  3PPB A;  3RD3 A;  2WGB A;  5IP6 A;  2LTP A;  2NP3 A;  2EZL A;  4D5C A;  3BR2 A;  5IP7 J;  1JUM A;  1TWA J;  2L7Z A;  1XS9 A;  1RES A;  1VFC A;  4I76 A;  5K58 A;  1ZR4 A;  3FKI J;  3VW0 A;  5K7F A;  3I4N J;  2GUH A;  1E3O C;  5HAW A;  1I6H J;  3BG9 A;  4C2M J;  1ZKG A;  5FKK A;  2G0E A;  3GEU A;  2XPW A;  3OSF A;  2LY9 A;  1TWH J;  1MBK A;  2DMQ A;  5IYB J;  3ZQL A;  1SFO J;  2XDN A;  4LOC A;  3RQI A;  2B63 J;  3S15 J;  2GFN A;  1OJL A;  4JX6 A;  3LSR A;  2WUI A;  3B81 A;  2G7L A;  1IV6 A;  3RH2 A;  5F0C A;  4FCY A;  4J19 A;  1FTT A;  3CMY A;  1OCT C;  3HEF A;  3F0C A;  5HOD A;  1FIP A;  5FKL A;  3VW1 A;  1GDT A;  2HXO A;  3LSP A;  5EFY A;  2AHQ A;  5M5W J;  4G12 A;  2HYJ A;  1X2N A;  5E3N A;  4IHW A;  1HDP A;  3S14 J;  3S1Q J;  5HSZ A;  1Q1V A;  1JJ6 C;  5C4X J;  2YS9 A;  3CDL A;  2E2I J;  2RHA A;  4C3H J;  1LFB A;  2IBD A;  3ON4 A;  4C3J J;  4IHY A;  1JKQ C;  3KZ9 A;  3OOU A;  3TW6 A;  1ITY A;  1IG7 A;  3HOV J;  3Q0W A;  3MNL A;  2MG4 A;  2Y2Z A;  2DMU A;  2K9N A;  3BG3 A;  4A3D J;  3S16 J;  2HOS A;  9ANT A;  2EZK A;  4B1R A;  4AC6 A;  3PO2 J;  2PZ9 A;  3BNI A;  4MIM A;  1ZGW A;  2I10 A;  3BQY A;  3GTJ J;  2QCO A;  2JWT A;  3M4O J;  2LFB A;  2O7T A;  5IPA A;  1Y1W J;  1O4X A;  2CQQ A;  3JRC A;  4JX5 A;  4XK4 A;  2NVX J;  3GZI A;  1P7I A;  2ID6 A;  1IUF A;  3HOZ J;  2E2H J;  1UMQ A;  2JA6 J;  3ON2 A;  3CRJ A;  2OF7 A;  3IH2 A;  5GPC A;  2UXP A;  2O8K A;  3BQZ A;  3IUV A;  1IRZ A;  2DMP A;  4CGR A;  3EGQ A;  2L7M P;  3HB9 A;  5H9T A;  5M5X J;  3HGY A;  1G2H A;  1ENH A;  1RR7 A;  4W97 A;  1IC8 A;  1HF0 A;  1IDZ A;  5FKN A;  5D1R A;  3VIB A;  2VI6 A;  4BBS J;  3IH3 A;  5CW8 A;  2JMW A;  3BR1 A;  3PO3 J;  3S1N J;  3V6G A;  5E3L A;  3LHQ A;  3ZQI A;  5EZH A;  3HM5 A;  1GV2 A;  2MW8 A;  4FE7 A;  3LWJ A;  3BG5 A;  4M3D A;  1JJ8 C;  3CWR A;  3F1B A;  1MH3 A;  4V2G A;  4JNN A;  1B8I A;  3Q0V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...