2DTZA

Crystal structure of multidrug binding protein qacr from staphylococcus aureus cocrystallized with compound db75
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
186
structure length
186
Chain Sequence
b'NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKKEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator qacR
publication title Multidrug-Binding Transcription Factor QacR Binds the Bivalent Aromatic Diamidines DB75 and DB359 in Multiple Positions
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription
total genus 76
structure length 186
sequence length 186
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2006-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2dtzA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2dtzA02
2QF7A 3I4MJ 4DZJA 2DA6A 3RD3A 4B3AA 3CMYA 5HODA 1RKTA 2MSYA 2DG8A 3PPBA 2Y9ZA 1WH7A 2E2HJ 1IG7A 1FTTA 1YRNA 1T33A 1TWCJ 2DA5A 5K7HA 3BQZA 5M5YJ 2G7LA 3HDDA 1WCMJ 3TW6A 5M5XJ 2PMZN 5EZGA 1HLVA 1OCPA 2YS9A 4RBOA 3LSGA 4XRMA 3GTJJ 5D1RA 2HOAA 1TWAJ 3JRGA 3QBMA 1MBJA 2H1KA 1RKWA 3LOCA 2TCTA 4FE4A 3M4OJ 1MBEA 1RESA 1NK2P 2HOSA 3CWRA 3QPLA 5JLWA 4NN1A 1ENHA 1LFUP 3HGYA 2V57A 4HNVA 5C4JJ 1TWGJ 3UKGA 4GFKA 1H8AC 4L5EA 3K7AJ 1QRYA 2KT0A 3HOYJ 3GTQJ 2EBIA 5FKKA 3FK6A 4JKZA 3Q0UA 4D7MA 3S2DJ 3VP5A 2B63J 2R93J 2VPRA 4A3KJ 2HQ5A 2CRGA 3ZQGA 2Y2ZA 2LKXA 1VFCA 3GEUA 3ON2A 2FD5A 2E19A 2XGCA 5C3EJ 4A3DJ 3VOXA 4M3FA 4NDLA 5IYCJ 2ZOZA 3D1NI 2HXOA 4A3JJ 3CDLA 3S2HJ 1W0UA 5C4XJ 1IDZA 5EG0A 3BRUA 2X48A 1APLC 3JRCA 9ANTA 1WI3A 2ZOYA 1O4XA 1I50J 1SANA 2EZIA 1RETA 3HM5A 5EGOB 2XGEA 3C2BA 2FBQA 3FRQA 3HOUJ 4A69C 3K2AA 5HBUA 3KNWA 3IV5A 3GTOJ 5EZHA 3M3YJ 2G7SA 2L0KA 5IOYA 2O7TA 3Q0VA 3MVPA 3TEDA 1HDDC 1EF4A 4AYBN 2GFNA 2YUSA 2K9QA 1GT0C 2OI8A 2AO9A 1T56A 3LSRA 3S15J 2DTZA 4M3BA 1JTYA 5F0CA 2DA3A 1AHDP 2IU5A 3GTLJ 4B1RA 2QKOA 2QCOA 3HE0A 3SFIA 3IH3A 1HOMA 2HKUA 3G1OA 2RAEA 1ETXA 2CQXA 1RR7A 1F43A 4LOCA 5EYRA 2M34A 1XC5A 2DN0A 2NVXJ 2NOGA 2CUFA 2DJNA 5FJ8J 2UXPA 3OSGA 4FTHA 1LE8B 4A3MJ 5FHPA 4D7NA 3ON4A 3S5RA 3JREA 5FLVA 1VI0A 3ZQHA 4JL3A 3ZQFA 1JJ6C 2OERA 2L7ZA 4XIDA 3O8GA 5F1JA 3BR6A 3RKQA 3P9TA 3CQZJ 2K9NA 2ID6A 1PUFA 1X2MA 2R7ZJ 3BCGA 1F36A 2OPTA 4IEJA 4ME9A 5E3MA 2H8RA 3QKXA 4AC0A 3WHCA 3B6AA 4FISA 5FKLA 3NARA 4FE7A 2XPWA 2TRTA 1UHSA 1BL0A 1WH5A 2X9DA 3LJLA 1W0TA 3COLA 1ETKA 4D5CA 4A3CJ 5F0FA 1IUFA 2KDZA 1MBFA 4XK4A 4XICA 1MH3A 2K9SA 1JKRC 3WHBA 5F04A 3LSPA 1IGNA 4JX4A 1NK3P 1MBKA 4QSHA 2O7OA 5F08A 2IAIA 3NI7A 2Y30A 2R5YA 3O8HA 1FIAA 4ABZA 4A3GJ 1AU7A 1WPKA 3HOXJ 5HSZA 3DEWA 1TWFJ 3G56A 3HB9A 1Q1VA 3S1NJ 2M2EA 1H88C 1MBHA 2W53A 1G2HA 3VVXA 3HOWJ 5D19A 3HTAA 5EF6A 1HF0A 3BR3A 3BHQA 4JX6A 5FKNA 3LNQA 1NTCA 2Y31A 2Q24A 2REKA 3S16J 2O8KA 2ME0A 4DYQA 1YRNB 4Y52J 1OJLA 1K83J 2EQRA 2XB0X 4V2FA 2IBDA 2YVEA 2PZ9A 2WV1A 3BG9A 1JKPC 4JNNA 2E2JJ 2ECCA 4W1UA 1BW5A 3E7QA 1X2NA 2FQ4A 1UI5A 4D5FA 3L1PA 5FKMA 1ZK8A 1P7IA 2COBA 3BR0A 4MXMA 3BTJA 1IV6A 2ZCXA 2EZHA 3VPRA 4HKUA 3A02A 3TP0A 5F0HA 3EUPA 3VW1A 3BTLA 4IHXA 3BTIA 4MFDA 1VF9A 5J1YA 3HTIA 4RDUA 2XGDA 1MSFC 3KKDA 2EZKA 3FIWA 3A01A 4J19A 3ZQLA 4GFLA 1B72B 1X58A 2M9HA 5F27A 2LLKA 4A3IJ 4KWAA 1JKOC 2DMUA 2I10A 4BBSJ 1FTZA 4MIMA 3JSJA 5IPAA 2DG7A 5E3NA 5CW8A 5GPAA 2O9LA 2DA2A 5EGOA 3BR2A 3VIBA 3MN2A 2LR8A 3JRFA 1XG1A 4CYCB 2NP3A 3NNRA 2JJ7A 3PO3J 1B8IB 5IP7J 1SFOJ 5GPCA 4BXXJ 3VUQA 2HOTA 5J1RA 3LSJA 3RQIA 1R9TJ 3BG3A 1I3QJ 2JA6J 2L7MP 1SGMA 2DA1A 3TP3A 1JT0A 3BG5A 2MGQA 4JX5A 2WB1N 3V78A 4MO7A 1GUUA 3HOVJ 2JMWA 2QIBA 2WAQN 3QQAA 2ZCNA 3AQTA 5IOZA 2L7FP 4BKXA 2FJ1A 3JRHA 1ETOA 3OSFA 1LE8A 3GTPJ 5DAJA 3RZDJ 4C3IJ 3W6VA 1ZKGA 2IEKA 2VKVA 4JYKA 1HDPA 5DTDA 2UXOA 2NS8A 5D18A 2LP0A 4C3HJ 3GTKJ 3NRGA 4EEFG 2EZLA 1U9OA 3G1LA 2EH3A 1JGGA 2HI3A 1Y1WJ 3T6NA 4A3EJ 3JRIA 1JTXA 2R5ZA 4ICHA 1I6HJ 3BR5A 3EGQA 3FISA 1XS9A 3E7LA 3SJMA 3DPJA 1ETVA 2VI6A 3HEFA 2Y0SN 4UUSB 3VVZA 3HIMA 4A3FJ 4DW6A 2ECBA 5J3LA 3F0CA 3S17J 5CXIA 3B6CA 3ZOBA 1CQTA 4XRSA 4A3LJ 1ITYA 3VVYA 1GDTA 2LTPA 2NVTJ 4GCKA 2DA7A 1UI6A 1ZR4A 3AQSA 1H89C 5FLMJ 4AF5A 2D5VA 4M3DA 2ZB9A 3IH2A 4AUXA 1AKHB 2QTQA 5M3FJ 3BJBA 5FMPA 2YU9J 2W48A 2LD5A 5IYBJ 2DMNA 5AQCA 5EFYA 2R0QC 1BA5A 2E2IJ 2WUIA 2CU7A 2CUEA 2DMTA 1JUPA 2XPVA 2MG4A 2VUMJ 3I4NJ 4Y7NJ 5K58A 5EEAA 2NVYJ 4IHWA 1FEXA 4DYRA 2DMPA 4FCYA 1UMQA 2NP5A 3OOUA 4GFBA 2HYJA 3B81A 2DA4A 5IYDJ 1U78A 4M6VA 3CJDA 1JKQC 3DCFA 3H3VK 4C3JJ 2GENA 2QWTA 3ZQCA 2LVSA 2NS7A 3Q3SA 1Z77A 3H0GJ 1S7EA 2ID3A 2XSDC 3JR9A 3IH4A 3MKLA 4W97A 4M3EA 1MNMC 1GV5A 2ME6A 2GLOA 3PO2J 3HBLA 2LK2A 2PBXA 1TWHJ 4A93J 3QPSA 4B4CA 3IUVA 2P81A 5IP6A 5IP9J 3S1RJ 1IC8A 4I76A 3NPIA 4ACIA 1TC3C 3KZ9A 2OF7A 4YZEA 4QIWN 4V2GA 5C44J 3VOKA 2VKEA 2NX4A 2QOPA 4PXIA 5HAWA 4X6AJ 1K61A 4C2MJ 3C07A 4L62A 3S1MJ 3ANPA 4GCTA 3JRDA 3HGGA 1B72A 1OFCX 3CCYA 4MFEA 5M5WJ 3GTMJ 2LFBA 1DU6A 3V6GA 2M0CA 3BR1A 3KKCA 1ORKA 3A01B 1JJ8C 1QPIA 3HTHA 4UUTA 1A5JA 3JRBA 2XRLA 2DMQA 5EG0B 3OIOA 5J1UA 5K7FA 1LFBA 3FKIJ 5C4YA 1U9NA 3BTCA 3PM1A 2UXIA 4CYCA 5EDNA 2K40A 4X1EA 5GP9A 4BY7J 2L9RA 1B8IA 3LHQA 5E3OA 3O60A 1ZR2A 2HDDA 2M8GX 5DS9A 3JRAA 1ETYA 1MBGA 1MSEC 2JN6A 4GCLA 3GBGA 2G3BA 3F1BA 2CJJA 1ZTRA 1HCRA 2JA5J 2D6YA 3LWJA 3PASA 2E1OA 3ANGA 4IHVA 2WGBA 2ELKA 3SDGA 1DU0A 4CGRA 3NAUA 1POGA 2YVHA 3G7RA 3A03A 2MW8A 1JUSA 1QVTA 3CRJA 1P7JA 5JLXA 2XPUA 2UXHA 1ZGWA 2NVQJ 2R92J 1A6IA 1ETQA 5FGLA 2XDNA 4DYCA 3GZIA 5BNGA 2HXIA 3FK7A 1FJLA 3HOZJ 4S0HB 4G12A 3BNIA 1ZQ3P 4XRSG 3GTGJ 3G1MA 1ETWA 4BBRJ 1Y1VJ 4DZPA 4UDSA 1D5YA 4MLOA 1BW6A 1MH4A 1Z0XA 2ZCMA 1WGXA 4IHYA 4A3BJ 5E3LA 1PUFB 3BQYA 1IJWC 1VNDA 4UUSA 3S1QJ 2JK3A 5FKOA 5K7ZA 1GV2A 2XB5A 4MK6A 2LY9A 2R5ZB 3TW7A 2N8GA 2F07A 1FIPA 3NXCA 1RPWA 2CQQA 3HKZN 1OCTC 3S14J 1GVDA 1IRZA 3RZOJ 2Y9YA 3BT9A 2RHAA 4JP0A 1IDYA 4BY1J 2GUHA 4M3GA 2GBYA 3Q0WA 1AKHA 1U8BA 2JA8J 1E3OC 4AC6A 2FX0A 1JUMA 2GM4A 1QVUA 5CXGA 2X6OA 4QTRA 1BJZA 2RASA 5H9TA 2AHQA 2G0EA 2JWTA 5M3MJ 4I6ZA 2G7GA 2UXUA 3MNLA 4NELA 2HYTA 1UG2A 3VW0A 1JT6A 3ZQIA 2JA7J 3VW2A 2R5YB 3RH2A 3HTJA
chains in the Genus database with same CATH superfamily
3ZN1A 2L2OA 2M7BA 5HODA 1IN8A 2ZBKA 3VYUB 1SAUA 5LEKA 1G3YA 5DUKA 3L2VA 3VWBA 1FTTA 3BQZA 2G7LA 1EA3A 2KQRA 4L9VA 3SFZA 5M5XJ 4M74A 1HLVA 3CDHA 3IRQA 3CDIA 4L18B 2ZJRF 1K78B 5D1RA 4LLLA 2IJLA 2IP2A 2H1KA 3BZKA 1RKWA 1F5TA 3FHZA 4H0EA 5L3DA 1RESA 1EKEA 4PZJA 2DOAA 3QPLA 2UZKA 4I0BA 4BU2A 3SXYA 5K5QA 1J09A 5JVGF 2COMA 5AONA 2FUG2 2QGUA 3OYDA 3KZYA 4DBRA 1IRGA 4E4HA 1X3WB 3HRTA 4BYYA 1TQPA 3CO6C 1K4TA 4M72A 1XX5A 4L5EA 1WJBA 3K7AJ 5CKTA 3HOYJ 5FKKA 4HQEA 3S2DJ 4ASNA 3E6BA 3K4BA 3ML6A 1I39A 2VPRA 4E7JA 2CRGA 3ZQGA 1U2WA 2Y2ZA 3HSFA 2VBYA 4PGGA 2E19A 3N05A 1YS6A 5C3EJ 4YFNF 3VOXA 2ZOZA 2VKHA 5FFXA 2HNHA 4WXHA 3O6BB 4XORA 3MAJA 4YIIA 9ANTA 2ZOYA 2QUFA 1WI3A 3BCAA 3OYEA 1I50J 3S32A 1TBXA 1O3QA 1B6AA 1LFPA 1IXRC 1FWZA 2P5VA 3FKJA 4R8HA 3I59A 4HDVA 1JE8A 2KMUA 5HBUA 2LKSA 4N9IA 4EJUA 1HDDC 2YUSA 3SEZA 2K4JA 2K9QA 3A4CA 4L5IA 1WJ5A 3S15J 2DTZA 1KYZA 4CCKA 3K69A 2JQ7A 2IU5A 3GTLJ 1P4WA 2LG4A 1C0WA 4C2MA 2ZC2A 1HOMA 4FHTA 3GYHX 2CQXA 5H2FC 4GGGA 1RR7A 4I01A 4LOCA 5BPDA 1DP3A 1F43A 2M34A 3MD2A 2YR2A 2ISZA 3WTYC 4E7LA 3OV8A 2K3FA 2QA4I 1XGOA 4IX7A 4BJ6C 1ZELA 1TQIA 3ON4A 2YX7A 3JREA 4NB5A 3DTIA 1FLIA 2V1UA 4LB5A 1WZ2A 1OKRA 1JJ6C 2RREA 5D8LB 2ZXJA 3H35A 1Z6TA 4ANJA 3CMAI 1SD4A 4BE2A 1ZGAA 5HNHA 3P9TA 3EUKL 2ID6A 2VT3A 2R7FA 5DEQA 1PUFA 1F36A 3FMQA 4KITB 1X4PA 5LBQA 2HDWA 2V79A 1TTYA 3GFMA 4A6DA 2ZMEA 3H5AA 3DPTA 3ERMA 4XLPF 5GAEJ 1ULYA 3O2PE 4RAZA 2YVXA 2A5YB 1S6LA 3COLA 1XTAA 3FM5A 3I9V2 4ZYAA 2FEZA 3KP6A 1BC8C 3BCBA 2DFEA 1R36A 2O8XA 4PJLA 2XKPA 1TL8A 2RKHA 1BIAA 2VJ4A 2O7OA 5F08A 2IRFG 4IQJA 3NI7A 3R60A 3OWTA 5CVUA 1PP8F 3O8HA 3WTVC 2G7HA 1DUXC 3CTAA 2OCCH 2L9VA 1PYVA 3LMMA 4O5VA 2D1VA 2F4IA 1H88C 2L5QA 3VVXA 3JAMK 3BR3A 1VQ7I 3HHHA 4JX6A 3BHQA 3S16J 2ETHA 2XUBA 2ZXHA 2O8KA 3CC4I 5E1ZB 2VOPA 4Y52J 4CSWA 5HOOA 1QPMA 4V2FA 2NVUB 2HS5A 3ROUA 1BW5A 1D0YA 3E7QA 2A07F 4N4OB 4ZTFA 5FKMA 4IKFA 3RSNA 4BHBA 3TO6A 2NNYA 1BBYA 5KCMA 4EVIA 4HKUA 3PL8A 3DBRB 4IHXA 3I55I 2HQNA 1X1DA 3I64A 3ZQLA 4OIOF 1IN5A 2EV0A 3DTKA 4Q4ZF 1B72B 3H0DA 3M7GA 5F27A 1DGWY 1XDUA 4XSZF 3VYSB 3I5UA 1WQ2A 2K27A 4EM1A 3CF2A 5BOXA 2C6YA 2DG7A 2JVGA 2KJCA 2KDOA 3LSHA 2W7NA 5CW8A 3DWLE 4KIFA 1G3TA 3RJPA 1O57A 1P6RA 2MC4A 4RLFA 1FYKA 2O9LA 1KQ8A 2XHKA 2KIMA 2MD5A 3K4NA 2P0WA 1UFMA 2E1NA 3W3CA 1TNTA 4LITA 2R3SA 4CYCB 1LB2A 2JJ7A 3EUHA 1SFOJ 4BXXJ 3VUQA 1OLTA 4OMYA 3QP5A 5J1RA 2VXDA 1ERDA 2P5KA 1SGMA 2DA1A 2E60A 3GUDA 1KU9A 2MGQA 2WB1N 2W00A 1P4AA 4QWQA 3L2UA 2QKMB 3HOVJ 3GFLA 2ZCNA 5ILSA 3VSLA 1SVMA 5IOZA 4HEA2 4BKXA 2WWYA 3LA7A 2CQ7A 4WK8F 3W6VA 3VYRB 2VKVA 2LP0A 2Z5UA 3MQ0A 4RB3C 3NRGA 5FRNA 3KP7A 2F4OB 5D5UB 1W5SA 4HLYA 2HI3A 3U1KA 1FZPB 3JRIA 2UUZA 2Q8KA 1ZHFA 1WJFA 4F7ZA 3QOPA 1YX5A 3FISA 2DQLA 4BAYA 1ETVA 3ZGKA 4ZYGA 2PFBA 2ZFUA 2MLGA 1MMNA 1MNDA 3R4KA 4EQQA 4UUSB 4CYDA 2QYOA 2ZSIB 3G71I 4E7IA 5ICFA 2GIVA 2ECBA 5J3LA 3F0CA 5D5WB 3EYIA 3B6CA 3K4MA 2X51A 2XV4S 3ZOBA 2ZJPF 3PUFA 4A3LJ 2LBFB 1XSDA 2NVTJ 4F93B 3M8EA 2ZSHB 3TGNA 1ZR4A 3SZGA 1H89C 3QU3A 4AF5A 2MC3A 2D5VA 4AUXA 2HTSA 1AKHB 2QTQA 3BJOA 2MH9A 2VBZA 3D5LA 1LDDA 5M3FJ 2DT7B 4XSXF 4WWCA 2EFQA 3MZYA 3EETA 2E7WA 5IYBJ 1L0OC 3LQQA 5FD5A 1BA5A 2DFIA 4B43A 3WTZA 2B3WA 3QWLA 3K9TA 5HDNA 2MG4A 1OCCH 2IVMA 2VUMJ 3I4NJ 5EEAA 1FOKA 2ESNA 4BACA 2JRTA 4PFOA 3OYJA 2ZJ2A 5LHHA 1UMQA 1K78A 3QYEA 3RYRA 5IYDJ 2PI0A 1U78A 3CJDA 1JKQC 1GVJA 1KU7A 2FOWA 1P4XA 2QWTA 3BZ6A 5KHDA 1Z77A 2QKLB 1S7EA 3MZHA 2BXZA 2PMZA 4LFUA 1KONA 2XKOA 2P7CB 5B5EC 2ZCWA 1TWHJ 3GVAA 1O7LA 2LKPA 1IC8A 4XM3A 3CD6I 4I76A 4KT5C 4BE0A 4JOMA 3J80K 2OF7A 5H6RA 3LWFA 3P9KA 3PQKA 4V2GA 5C44J 1R22A 2FF4A 1OCZH 2JZYA 2W4SA 2NX4A 4PXIA 2LH9A 4X6AJ 3AAFA 1SEUA 3S1MJ 2BEOA 3ANPA 4A2UA 1Y6IA 3ISPA 3CCYA 4RGXA 2LFBA 1Z7LA 3OY9A 3FMRA 3IP4B 1YITI 3A01B 2VIXA 2GAUA 4KNYA 2K9MA 3OMYA 5H20A 2MA3A 2XRLA 3C7JA 3I0TA 3K1PA 4AIDA 1LFBA 2XROA 5L3GA 2O61A 2CWEA 1U9NA 5E79C 2BW3B 4YIFA 1FBQA 1HXDA 4F55A 4X1EA 5EDNA 3I59B 4NHJA 1QQIA 2PBIA 5LRSA 1A35A 2M8GX 1ETYA 1SFKA 1MBGA 4DJAA 1MSEC 2M7AA 1HCRA 2JA5J 4CA0A 4DNCA 3R61A 4OAZA 3J7AO 1POGA 4FX0A 3G7RA 1JUSA 1PJRA 3LA3A 2UXHA 4ZZLA 5JR3A 2K86A 2NVQJ 1Y0NA 2PN6A 3E5UA 1MIJA 1ETQA 2EFNA 3CESA 1HSTA 3K6GA 5FGLA 4D0PA 3CCJI 2M4GA 2P8TA 3HHGA 1FJLA 3HOZJ 3ZQQA 1T0FC 3LFUA 5CQEA 4J00A 1I27A 1BC7C 1DGRM 2F4MB 4XLAA 1Y1VJ 3FXRA 2EV5A 2NOJB 1D5YA 1QZZA 4BDZA 1WGXA 4X0GA 2O3FA 4QPQA 1ODDA 4A3BJ 1Z3XA 5E3LA 3IAM2 1PUFB 3BP8A 2JK3A 4MNUA 2JA2A 2FBIA 4KMUX 4PJMA 3QRFF 3CO7C 2R5ZB 2ZMEB 4MK6A 1R4MB 1FIPA 2WV0A 3ABLH 3HIFA 3KE2A 3FWEA 1IV8A 2FMYA 4ZTJA 1J5YA 4BY1J 1IDYA 1OQYA 5HLHA 4M3GA 2DI3A 2GBYA 4RGSA 2WTEA 1R00A 4PDKA 1FP1D 4HA8A 4HV6A 1U8BA 2DT5A 4CO8A 4AC6A 1JUMA 2R4GA 3PNTA 2JUGA 1MD0A 5CXGA 2FBHA 3G73A 2X6OA 1SD7A 4R1HA 4P55A 5M3MJ 1UG2A 2I5UA 2WADA 2DW4A 4WIBA 3VW2A 2HYGD 3RH2A 1ACIA 3K4CA 4RAGA 1R49A 4B3AA 1FMVA 3CMYA 1RKTA 1XGMA 3FHNA 1VQOI 1WH7A 2X6WA 5HS7A 1T33A 5M5YJ 3W6KB 1S9HA 2H94A 2VC1A 3L9FA 2D45A 1M1EB 2IXSA 3K1MA 1J59A 1E3HA 3KZIC 3V8JA 1F9NA 1TWAJ 2E35A 1MBJA 4A5MA 3CLOA 4GDFA 3LOCA 3SZTA 4PJ0C 1T2KA 1Z91A 2TCTA 3M4OJ 4LD5A 4KDPA 3HSRA 2X4HA 1O7FA 3VEPA 1S7OA 1HKTA 3EQLF 4NN1A 3H92A 4OIQF 1ENHA 4XONA 1R58A 3HGYA 3HRUA 3WU2C 4XMYA 3ZMDA 3OYBA 3L2CA 3GXOA 4HNVA 5EJCA 1AA7A 1TWGJ 2DDBA 4GFKA 1H8AC 4KMFA 2KT0A 3D5SC 3S8PA 4BNCA 1USSA 4JKZA 3BOQA 4D7MA 4IHSA 2CS3A 3BDDA 1U6GA 4BGDA 2B63J 2L9SA 2R93J 2IGMA 4FQGA 2K02A 3BWGA 3KLNA 4RB1A 2FD5A 2O0YA 5JVTA 4M3FA 4NDLA 3DBLB 4EJWA 3QYFA 1DPRA 5IYCJ 1VQLI 1HQCA 3CDLA 3S2HJ 1W0UA 5C4XJ 2X6XA 1APLC 1SANA 2EZIA 4OIRF 3I4PA 1V55H 4P1WA 4XLFA 3C2BA 3ZXSA 4KA4A 4DBQA 2IS4A 2VXZA 3HOUJ 2KJBA 3K2AA 3TDUC 3GTOJ 1BI0A 2GWRA 1NH3A 3M3YJ 3BZCA 2L0KA 5IOYA 2G7SA 4TV7A 3BJ6A 3KYCB 1GT0C 1X1CA 2BZTA 1T56A 5ERIA 3AKZA 5F0CA 4LLGF 3S3OA 5J8CA 2QKOA 1FPQA 3DKWA 1Z05A 3FM3A 3KETA 4IRHA 1ETXA 5EYRA 2WAEA 3OL4A 2H09A 4IQ4A 1XC5A 1UG0A 4LIUA 4IF4A 2FQ3A 3H9GA 2K5CA 3X2QH 3HOTA 1YW7A 3KIOA 4L5JA 1OCRH 3OYHA 3HYIA 2FBKA 3KCCA 2EFOA 3G2BA 2XF7A 5FLVA 2WAQA 1VI0A 1MJAA 4RGUA 3ZQFA 3K4KA 2OERA 4QLCU 4BJTA 4C2UA 3G6EI 5F1JA 3BR6A 2EK5A 3E6MA 3V7RA 2K9NA 5H6QA 4AIJA 3EYYA 3BCGA 2OPTA 4AVZA 2LBFA 2RV8A 3KX2A 5D6EA 3SWHA 3V8KA 2JSPA 1Z6RA 2L7KA 4Q48A 4NC7A 5AIQA 4GO1A 4O3MA 3B6AA 2R7QA 4FE7A 2M30A 4IXAA 3S93A 3PUBA 1UHSA 2CO5A 2QM3A 4A3CJ 3DF8A 4XK4A 1XSVA 1MH3A 3IRRA 2K9SA 2OQGA 3VFZA 3HKZA 4NNJA 1SAXA 2IAIA 3KEYA 3CF5F 2LY2A 2Z1DA 4BHCA 4CHUA 3O3KA 2Q0OA 2R5YA 2ZY9A 3DPUA 2OTJI 4NUBA 3OR2C 1TW3A 1WPKA 1ZYRF 5HSZA 2KRCA 1LJ9A 3DPLC 3ULQB 3HB9A 1I6XA 1ONVA 1Q1VA 3PQJA 4PSWA 3CCQI 3S1NJ 1MBHA 3HOWJ 5E8GA 3FBNB 5EF6A 2OJED 4JK1X 1HF0A 3ZPLA 3LNQA 5FGMA 2Q24A 4G7OF 4DYQA 4MTEA 5IY5H 4EM2A 3NS4A 1G3WA 4XLHA 2YVEA 2WV1A 2DLLA 1F1ZA 1XD7A 2E2JJ 4W1UA 3F8MA 2M5WA 2UV1A 3QOEA 1X2NA 4G6QA 2FQ4A 3RKWA 4F91B 3MKWB 1UI5A 1G59A 3CCVI 2CV0A 4M9ZA 3FBIB 4MXMA 3BTJA 4UY8I 2HR3A 4K2EA 1T95A 2E36A 3K0LA 4XLCA 3K4JA 3VPRA 1VTNC 1E2XA 3VW1A 2H6CA 3BTIA 1VF9A 2DK8A 1R4NB 3PNYA 2ACJA 3KKDA 3A01A 3WGHA 1X1PA 4J19A 4OIPF 4D1QA 4UB6C 1DPUA 1XGSA 3EDPA 4HRIA 3FXMA 5HLGA 2L4MA 4KWAA 3TQNA 4E7SA 1JKOC 2I10A 1Z1DA 2CYYA 1FTZA 1AWCA 2BW3A 4MIMA 4HX8A 1MW7A 2EINH 3GW2A 5GPAA 2LMDA 2PG4A 4F3QA 4U9LA 4RB0A 4M71A 5EGOA 4MEYF 1QBJA 3JRFA 2F5FA 2V9VA 4I7HA 2QVOA 4E7ZA 2J5PA 3OL3A 2NNNA 3ABUA 3TOBA 3COAC 2E5ZA 1KGSA 4LG3A 1SFXA 1Z21A 3KP2A 3ZR8X 3PFIA 4NBQA 3H36A 1WJAA 3RQIA 4U0WA 1R9TJ 3BG3A 1W7PA 1LVKA 2A6HF 4BEHA 1JT0A 4JX5A 1IO2A 1MJ9A 2Z33A 2F2EA 3LL7A 2QIBA 3QQAA 1LDJA 3RYPA 3AQTA 1XSXA 5KNLA 2QQ9A 4U0YA 3JRHA 2FJ1A 3OSFA 1P2FA 3RI4A 3IKVA 5DAJA 3RZDJ 3CLQA 2RNGA 5KAIC 6PAXA 1W36C 1YOVB 2I8DA 1ZG3A 2EZLA 2BGCA 3G1LA 4KUMA 1N75A 4XRFA 1YO5C 5CVVA 3T6NA 4A3EJ 5BS6A 5ICEA 1JTXA 3K70D 1U8RA 1PVEA 1T8IA 2XAQA 2R5ZA 2QQBA 1FOXA 2EB7A 3CUOA 1OYWA 4DIQA 1XS9A 4Z6YA 3E7LA 2IT0A 3DPJA 2VI6A 1R71A 3CJQB 2ZFWA 1IF1A 4HX4A 3VVZA 5DM6F 2M8EA 2V6CA 2JPCA 1YFHA 2IGOA 3OS0A 1R7JA 4GYIA 5FROA 2VQCA 3DKXA 4N0BA 1A6QA 4FX4A 3S17J 1YYVA 1WWXA 1CQTA 3AG1H 2XAFA 4LK0F 2QSGX 3H5NA 3PSIA 1D1AA 1RZ4A 4G6TB 5L3CA 3F21A 3IC7A 5AQCA 5EFYA 3VODA 2R0QC 2WUIA 2CU7A 2M4KA 2X85A 3HJEA 5EEGA 4G7HF 4Z2YA 3ZN0A 5K58A 1K7AA 4PJJA 4IHWA 2R7SA 5IT9K 1SMTA 3OOPA 5J8FA 2DJIA 3GWZA 1XMAA 4FCYA 1WKMA 2W82A 3B81A 2DA4A 3J81K 1OPCA 3ZCOA 1Y0UA 4E7HA 2XSJC 3LA2A 1MZBA 3DCFA 3MKYB 2EFWA 2XDVA 1W5CC 4C3JJ 1AOYA 2XAUA 2LVSA 3Q3SA 2LSOA 4OMZA 4PUSA 3T5XA 3H0GJ 1R5HA 5KAFC 3OYFA 1VQPI 3JR9A 3IH4A 5BPIA 2R7UA 4M3EA 4XKBA 4CICA 2IA2A 2MH2A 3PO2J 5FLXZ 3HBLA 4M6YA 4B4CA 2IGNA 2KKOA 1W5TA 2VPLA 1YLFA 3FXOA 3S1RJ 3NPIA 4UXNA 3F8CA 4YELA 1B4AA 4BHPA 3VOKA 1X19A 2VKEA 2QOPA 3P9CA 2P6TA 3C2HA 1K61A 2XAGA 2HZDA 1YW8A 2V9KA 1BOBA 1S5LC 2ESHA 2XVCA 4HSRA 4GCTA 3WE3A 3HGGA 2DOFA 3GTMJ 5M5WJ 1D5VA 5F1RA 3V6GA 4A12A 3VDXA 2OZ6A 1JJ8C 1FBSA 1V5GA 2A05A 1S8NA 1B59A 3H5RA 3I58A 1YE9A 5CVJA 5LHIA 3JRBA 3KEOA 2MFZA 2V9PA 2M1BA 3OIOA 2RVCA 4L0YB 5C4YA 2P6SA 3FKIJ 4N9HA 1HBXG 5B1AH 1T0FA 4EGZA 3PM1A 4HQMA 2YSRA 2K40A 3E0JB 3HTUA 5GP9A 2L9RA 4BY7J 1IN4A 3LHQA 1ZR2A 3LSMA 3GF2A 2VE8A 4A6EA 5ICCA 2LY1A 3WTUC 1VQMI 3KPHA 3K8PC 1ZLJA 3GFJA 2KIUA 3ZMZA 4UVBA 2FOKA 3T8TA 1WSUA 4GCLA 3ONQA 3F1BA 3LWJA 3I3LA 1X3ZB 4C30A 1PP7U 3CWRA 2E1OA 2WGBA 2EA2A 3DU6A 1DU0A 3ELKA 1MMSA 1QGPA 2YVHA 4E70A 1D8JA 1QVTA 1P7JA 5E8IA 3TDZC 5JLXA 3RDIA 5GTHC 2XPUA 1ZGWA 2FNPA 4WX9A 1VQKI 3QYBA 5JFRA 1T08B 4EJVA 3GZIA 2EIKH 2B9SA 2E71A 2ZO4A 3M1EA 4II3A 2WB1A 5DYMA 1ZQ3P 1L3LA 1J7KA 2W85A 4XKCA 3G4SI 2LDUA 2A3SA 5TJJA 3DV8A 4HG2A 1YIJI 1H0MA 4MQ9F 2TDXA 3BQYA 1IJWC 1VNDA 4HDUA 4B3XA 5A2QZ 3NRVA 1GV2A 2RC4A 1UJ8A 2CQQA 2HKXA 3HOSA 3CP2A 2CSOA 2M0MA 3SZPA 4B8XA 3CCMI 2Y9YA 1P9QC 3KP5A 2O6GE 3TBIA 2GUHA 2A5WA 2E7XA 1ZGJA 2BHYA 1B1BA 2L4AA 4ZYDA 2JA8J 1E3OC 4U9NA 3CCRI 4IHTA 1BJZA 5LD2C 1IRFA 4RM2A 2VBXA 2AHQA 4DOZA 2G0EA 3CJRB 2W84A 5L3BA 2GXBA 1KA8A 4I6ZA 2UXUA 2HYTA 4XOPA 2JA7J 5F6FA 2R5YB 5JHFA 4XLEA 2EIJH 3I4MJ 5IT9Z 1V5FA 3M1CA 3CCLI 3HTSB 3RD3A 2KL4A 1QZYA 2MSYA 2DG8A 2Q1ZB 3V7CA 2V7FA 2H8WA 3S3NA 1BI2A 1WHUA 2E2HJ 1IG7A 3J81Z 1TWCJ 3CMEI 2CFXA 4XN0A 1WCMJ 2XIGA 2ZKZA 2Z3YA 4PJNA 2PMZN 1O3RA 1FMWA 1OCPA 1SFEA 3MMYB 5IT3A 3LSGA 4KIBA 2GIZA 4LJZF 1ZG1A 3QP6A 4FE4A 4EM0B 3S2WA 2RN7A 2HOSA 2HKOA 1VZ0A 3W2VA 3CZ6A 1HW5A 2ZNYA 2HOEA 3E6DA 2P4WA 3JTGA 1J9IA 3CP8A 3H3UA 4XLNF 5C4JJ 5EEHA 1FOYA 3N4MA 1QRYA 4EV0A 3DU5A 5LHGA 3GTQJ 2IS6A 5TGTA 1JXSA 3Q0UA 3FZVA 2E1MC 4LG0A 2LKXA 1V3FA 2DYSH 2XGCA 4A3DJ 1GXQA 2E5NA 2GA1A 3DEUA 2HXOA 3DXJF 4A3JJ 2Z9OA 3FF5A 1IDZA 5EG0A 2BXYA 2VOOA 2X48A 4RLQA 3JRCA 5LFAA 1O4XA 1Y39A 2PQ8A 1W1WE 2EV6A 5EGOB 4CDGA 1I1GA 2FBQA 2FE3A 3FRQA 3DTEA 3FX3A 4A69C 4U7BA 3IV5A 5EZHA 1YJNI 2AQFA 3TMOA 2O7TA 3Q0VA 3TEDA 3F72A 1EF4A 3VTIA 4AYBN 4OOIA 4B47A 2GFNA 2EA4A 3NWSA 3TOAA 3LSRA 1XCBA 1X1AA 1JTYA 2LYCA 1W7PB 2LOOA 1HKQA 1Y8QB 3P5JA 4P9UA 2BY0A 2QCOA 3ZMSA 4BEHB 2R7WA 5E17F 3HE0A 3IH3A 4M9SA 3G1OA 2RAEA 4ETSA 4CH7A 2XAJA 1SVOA 2DN0A 3F9KA 2NVXJ 4E7KA 2DJNA 5FJ8J 4IRGA 2R7XA 1RC9A 3ZP5A 1A31A 5FHPA 4Q5SF 4ENNA 3S5RA 4LGWA 1IW7F 3ESWB 4IZZA 3I53A 3OIQA 3ZQHA 4ZZDA 4MTDA 4JL3A 3BPVA 2NYXA 4PCQA 2H1LA 4XIDA 1XMXA 3O8GA 5D4RA 3RKQA 1LPQA 1OYYA 3RPQA 3L2QA 3WU0A 2E34A 3CQZJ 2RGVA 3WTTC 2HDCA 1T98A 4IRIA 4AVPA 4ME9A 3PJRA 3TL4X 5DD4A 3QKXA 4LK1F 3I56I 2OTLI 1BI1A 3WU1B 3WHCA 2HPMA 3AFHA 1MNEA 3NARA 1W7PD 2HU9A 1TP4A 2VJ5A 3EUAA 2KPMA 2TRTA 1B9MA 4KISA 4IOAF 2BY2A 1WH5A 2X9DA 5K5RA 1W0TA 1ETKA 4D5CA 2CV2A 1BOAA 5F0FA 2PEXA 2KDZA 2RQPA 5DD8A 4WCGA 4IRVA 3WHBA 1UZCA 5F04A 1NK3P 1IUYA 3OR1C 3SQNA 4CCJA 1RRJA 1EJ9A 3T0YA 1LEBA 2Y30A 3RKXA 1MGTA 3WTSC 2DQRA 1FIAA 4A3GJ 1AU7A 3DEWA 4U88A 1QHGA 2ZJQF 2DTRA 2R7TA 3CCSI 1KQ9A 4B48A 4PK4A 5CVIA 2WY7Q 3BROA 3V7SA 1G2HA 1OISA 2KHMA 1FP2A 5D19A 3OS2A 1RUNA 1MDMB 4AIKA 3GCMA 3JCUC 2DPUA 5FKNA 1RUOA 3EPZA 2V1XA 1NTCA 2Y31A 2REKA 4NC8A 2ME0A 2OU2A 2LF7A 3GZ5A 2KZVA 3LQRA 4R79A 1YRNB 1K83J 3IL2A 2GZWA 4CZZA 2QEXI 4DVYP 1JKPC 3BG9A 4U87A 3LAJA 2OUMA 3BPXA 4ZC3A 1ZK8A 1P7IA 4ESFA 3BR0A 1FBUA 4BUPA 2EZHA 4DGWB 2F5DA 5LGNA 1V5EA 3A02A 4BJ5C 3TP0A 5F0HA 4KJZA 4XR6A 4BH9A 1ZRDA 4MFDA 3HTIA 1QO0D 1FC3A 2VC0A 1Q1HA 2V6EA 2EZKA 2GOMA 3FIWA 4NC6A 1XGNA 4LMYA 4O6JA 1B9NA 1X58A 1LEAA 1VQ5I 1OR7C 2LLKA 3HRSA 3KLOA 5D8KB 2M45A 4BBSJ 4RGRA 1XMKA 4BQAA 2CW8A 2HVSA 4E6KG 5E3NA 1XCVA 4HNUA 3H9JA 1ZRCA 2XASA 2DA2A 2HYFA 2LR8A 1V54H 2CQKA 1XG1A 2VONA 1D0XA 1JI8A 4ENKA 2G9WA 5IP7J 2A61A 3Q9SA 3ZRGA 2HOTA 3LSJA 3DP7A 1UAAA 2NRAC 2JA6J 5HLTA 3TP3A 1D0ZA 3BG5A 3HC7A 1WJDA 1MJBA 1GUUA 2OZUA 2RDPA 2WAQN 3C2GA 3CJNA 2HQRA 1SVLA 3B02A 2L7FP 5DCFA 1LE8A 4BL0B 2BBYA 3IUOA 3GTPJ 1R23A 4JYKA 2KIQA 5DTDA 1A36A 4CXFA 2EIMH 3LSTA 4Q47A 2UXOA 2VKDA 3ECHA 4C3HJ 1SC7A 3MCZA 5CLSA 4A0ZA 2EH3A 1IAWA 4EJOA 1JGGA 1Y1WJ 3ECOA 3NWTA 3AG3H 3HSEA 4Y15A 3ZMTA 3CC7I 1P92A 1D3YA 4IL6C 2A6TA 4ICHA 2W1OA 3SYTA 1I6HJ 3BR5A 2CW7A 3EGQA 4HPQA 3SJMA 2Y0SN 1Z7UA 3DLLF 1IZ1A 4A3FJ 2VODA 2CH0A 5CXIA 4UB8C 4F92B 4XRSA 1N77A 2BV6A 1GDTA 1U3EM 4YRVA 2CFOA 4GCKA 2DA7A 1UI6A 3AQSA 3H9QA 4UNOA 5FLMJ 4M3DA 2ZB9A 3IH2A 2VT2A 1U5TC 3UNGC 4U7DA 5FMPA 5CJ9A 2NAZA 1A04A 3FMSA 1U0JA 4G9YA 4PFPA 2DMNA 5DV5A 3HXLA 5LGTA 4ENJA 2FJI1 4HNTA 2J5OA 4CZCA 2QLZA 2DMTA 2KFDA 2PX9A 1R1UA 2NVYJ 3KP4A 2ISYA 2BVMA 4HZFA 4BS9A 4DYRA 3WGGA 2DMPA 1RIOH 2JTVA 2JUCA 2F6CA 2NP5A 3OOUA 2P5LC 5DM7F 1YW9A 4M6VA 3HRMA 3D0SA 3H3VK 2FU4A 2GENA 1GLNA 4GRIA 4EATA 5HNFA 3ZQCA 2NS7A 2XSDC 3ZMUA 1YJWI 2BE5F 5FLXK 2X1CA 1HKSA 2FA5A 5K5OA 1GV5A 1W4MA 4HYEA 3NEUA 4L9JA 2PBXA 3QPSA 2OC6A 2Q2EB 1ZRFA 1ZREA 4WXDA 3IUVA 2KLOA 3F3XA 2OCEA 5IP9J 5D6FA 3IWZA 4ACIA 2D1HA 4L9TA 3KZ9A 3MWMA 4OU0A 1Y56A 1O3SA 2FNAA 4YZEA 1MKMA 4KT6A 3OYGA 4OINF 5K1YA 2CV1A 5HAWA 1JHFA 1BR2A 5DCMA 4HOBA 4L9NA 4C2MJ 3C07A 4L62A 5FD6A 4C9YA 2BY1A 3JRDA 5J6XA 1OFCX 4MFEA 4YIRX 4XKVA 4LG0B 4Y4RA 2M0CA 4CCMA 3RCOA 3SDBA 3KKCA 5E20A 1FSHA 1X4OA 1QA6A 3HTHA 1R1VA 4UUTA 2XF6A 1S72I 3A2KA 3W2WA 5EG0B 1Z67A 2XC7A 2KRHA 5HS9A 5K7FA 2Y0MA 5LGUA 4HX7A 5JHUA 3Q9VA 3E6CC 2UXIA 4AIHA 3CCUI 4ON0A 2HVRA 1IXCA 1B8IA 1XPXA 4B09A 3O60A 4HSTA 1UB9A 4A5NA 2L01A 3OYMA 4P96A 3GLLA 2A68F 2JN6A 4IO9F 1ON1A 2XGXA 2M87A 3GBGA 5J40A 2JPBA 4ZDOA 5B66C 1VQ9I 3V42A 3PASA 2ELKA 3SDGA 3C1DA 4I99C 4CGRA 2FSWA 1LVAA 4G7ZF 3L7WA 3NAUA 1PDNC 2V1NA 1FNNA 2X1DA 2MW8A 2EPFA 4I02A 4ZDLA 2GXGA 3C3WA 2EWNA 3PNVA 3A1YA 3FXLA 1WRJA 3GFIA 3WTXC 3FXUA 4P5OA 3HPHA 3VOEA 2WAFA 2VLAA 4S0HB 3HG9A 3BNIA 5J4YA 3WE2A 1U5TB 2STWA 1ETWA 2A6EF 2CG4A 2K9LA 4DZPA 2BVLA 2UWMA 4RM3A 4MLOA 1BW6A 1R5GA 1X1BA 1Z0XA 2VB6A 4IHYA 2R7OA 4Y17A 2QZ8A 4ENMA 3E5QA 4I2OA 5A2QK 2HQAA 5J47A 4YG2F 1I3AA 5K7ZA 2O03A 2CUJA 1R1TA 4GYGA 1T39A 2ADUA 2N8GA 3RQ4A 2F07A 1Y8RB 2DYRH 3V4GA 3NXCA 3V8LA 1GVDA 1IRZA 3TO7A 4HBLA 1VQ4I 1Z9CA 3BT9A 3MZ8A 3Q0WA 1REPC 2KZGA 4RA2A 2L02A 2GM4A 4HF0A 1H9GA 4QTRA 1DQUA 5D5VB 5H9TA 2PFVA 3MNLA 4UHTA 3T1BA 1BIBA 4NELA 3VW0A 1JT6A 2LC2A 1YQAA 2JSCA 3PSFA 3ZQIA 1KZHA 2E1CA 2QBYB 3QAHA 3F8FA 2QF7A 4DZJA 4UUVA 2FMLA 4WF2A 2DA6A 2VQLA 4N4NB 1MDMA 3PPBA 4UVAA 5GAHJ 2Y9ZA 1YTYA 2W25A 3A0HC 3F8NA 3DKYA 4J01A 3BG6A 3R6SA 1YRNA 3H3ZA 2DA5A 5LLQA 1X3UA 5K7HA 5B1BH 4IOCF 3RPUA 1WVRA 3HDDA 4EJTA 5JI6A 4LB6B 3TW6A 3IHUA 3CUQC 4IVNA 5EZGA 3W2AA 3KEQA 2YS9A 4RBOA 4ESJA 2DBBA 1O3TA 4XRMA 3GTJJ 2DFHA 2HOAA 1I5ZA 3KFWX 3JRGA 3QBMA 2VQGA 2DCEA 2V4JC 3FXQA 2Y75A 3VYTB 1MBEA 4MQVA 3R0AA 1NK2P 2KRFA 4P9FA 2IA1A 5JLWA 4HLXA 2K4BA 1UHWA 1YG2A 2P7VB 4QPOA 2DK5A 1CGPA 1LFUP 2ZNZA 2LNBA 1NG7A 3AG4H 4KYWA 2V57A 4Y33A 3IAS2 3UKGA 2HEOA 5J4VA 2EBIA 3FK6A 2CW0F 3WODF 3VP5A 1K6OA 4A3KJ 2HQ5A 1VFCA 3GEUA 3ON2A 2XF5A 3AG2H 5HS8A 3D1NI 1EV7A 1ZH5A 2HPIA 1LUJB 1FYLA 3BRUA 2MABA 2F48A 1BN5A 1S7AA 1RETA 3HM5A 1Z3YA 2XGEA 1USTA 2AS5F 5E1XA 4OWRB 3SHFA 2B1EA 3KNWA 1HA8A 2L54A 5HLIA 4OD5A 3MVPA 3LFKA 1BR1A 1CF7B 2DU9A 2JRMA 2OI8A 1QHHD 2AO9A 4KIGA 4G6DA 4BQNA 1VQ8I 3BG7A 3LSKA 4M3BA 3WG9A 2DA3A 1AHDP 1FYMA 4I0AA 4B1RA 2LF8A 4CCOA 5LRRA 3LSIA 5E18F 3SFIA 5ILVA 2HKUA 3F6OA 3GZ6A 1LQ1A 2WY8Q 2GQQA 2ICWG 5ED4A 3G3ZA 2LRDA 2NOGA 2CUFA 3I54A 3JW4A 4M6XA 2CUZA 1BI3A 2R7VA 2UXPA 2DPDA 2FXAA 3OSGA 4FTHA 2V26A 2ZXWH 1LE8B 4A3MJ 1ZARA 1K6YA 4D7NA 4V19K 3JSOA 2VN2A 1UELB 5DUIA 4CUGA 3IKTA 2L7ZA 2Z2SB 1W36D 1EH8A 2G7UA 2BHZA 5CVRA 1BJAA 4FT8A 4IJAA 4CCNA 1IRXA 1QU3A 1X2MA 2R7ZJ 4M73A 4XKWA 2NS0A 3WG7H 3J7AY 2DDAA 4IEJA 2MYSA 2OD5A 1HW2A 4EGYA 4LIVA 2XRNA 3OYNA 5E3MA 2H8RA 2FRHA 3LAPA 4XBFA 4AC0A 5GADJ 1WJEA 2ELJA 2DO7A 4FISA 4HV5A 5FKLA 4NQWA 3HPGA 5GTIC 3CJTB 2XPWA 2PJRB 1FT9A 3GLXA 3HUGA 1FY7A 4EMSA 4II2A 1PUEE 1BL0A 2QSHX 3LJLA 3CUQB 1IUFA 4RAFA 1MBFA 4XICA 4PGHA 3H1CA 1G3SA 1JKRC 2VQHA 1IXSB 3DBHB 3L09A 3LSPA 1IGNA 4MHGA 5FO5A 4YFXF 4JX4A 1MBKA 4QSHA 5KK1A 2EILH 4UVCA 3SEQA 3E97A 4M9XA 3P7NA 2EJRA 2A69F 3K2ZA 3ASOH 1N25A 4ABZA 3KYDB 3HOXJ 4XL9A 2WC2A 4KN7X 2UXXA 3DFGA 1KU2A 5ILUA 3AL0C 1TWFJ 3G56A 4MEXF 1F4KA 3W6JB 2M2EA 1JGSA 2W53A 3ZMVA 1OR7A 2OBPA 2ZMEC 3Q5FA 3HTAA 2EFPA 3ZQ7A 3JSPA 4A0YA 3OIPA 3JAMZ 3ERED 3ASNH 1T38A 3WTWC 4AWXB 2DXIA 1OJLA 2BOLA 2EQRA 2XB0X 2Q2EA 3REOA 2IBDA 4JNNA 3BY6A 2PZ9A 3KP3A 3OYCA 3I71A 2ECCA 3K1NA 1R6RA 2QWWA 1SD5A 4OD4A 2HWVA 2QQ8A 4D5FA 2B0LA 3UR3C 3L1PA 3QODA 4Y3OA 3CCEI 2IS2A 4RB2C 2COBA 1ZAOA 2IA0A 2MLKA 4Y13A 1XN7A 1IV6A 2ZCXA 2DODA 4G8XA 4CCLA 2ZXIA 1ZG5A 3K10A 2YU3A 2YPRA 3EUPA 3BTLA 4D9JA 1VQ6I 3A0BC 5J1YA 4RDUA 2XGDA 1MSFC 1IN6A 1HC8A 3BJAA 2OQRA 2Z99A 1V4RA 3MEXA 2K85A 5DCMB 1TT5B 2Z16A 4ITVA 2F5CA 1HSJA 3NQOA 4GFLA 4L0ZB 2M9HA 1JHHA 4A3IJ 2X6YA 3DQVC 2DMUA 2A2FX 2K7LA 3JSJA 5IPAA 3P9IA 2Y48A 4OAYA 4XN3A 3TO9A 1WFXA 3BR2A 3VIBA 3MN2A 1NHAA 5KVRA 3F22A 3J7YJ 1FSEA 1RNLA 2IS1A 4G94A 1J0RA 2NP3A 3NNRA 1QNTA 2LREA 3PO3J 1B8IB 3WGIA 5GPCA 2NXNB 4AD9A 1XB4A 1TT0A 5FRMA 3U2RA 4HAMA 3HL2A 1OCOH 1SMYF 1I3QJ 2L7MP 4ESBA 2BYVE 4IPAA 1K4SA 4WXCA 3U21A 1TQMA 4XOTA 2O5RA 3V78A 4MO7A 5HDKA 2OV7A 1YX3A 1QZEA 2JMWA 3F23A 5AIPA 4AYBA 2PJPA 4S05A 4RS8A 1ETOA 3HZJA 4BQOA 1KU3A 3U1DA 4C3IJ 1OYIA 1U5TA 1ZKGA 2IEKA 3K4LA 3RIRA 3MFKA 4BDYA 1HDPA 1YHQI 3RTRA 4MGRA 1DDNA 2NS8A 3T8RA 5D18A 3L2WA 3GTKJ 4EEFG 1U9OA 3U9GA 4AU7A 2VL8A 2DFFA 2PLYA 4JBAA 1KQ0A 1UCRA 1YIOA 1LKXA 3EUHC 3F8BA 2RQQA 3S3MA 1D8KA 2OAZA 2D2WA 4YEJA 4PSXA 3CC2I 2HVQA 3ABTA 4GXOA 3HEFA 5FB2A 5F64A 2H27A 4XNFA 1N78A 3HIMA 2AQEA 4UV9A 2QENA 4DW6A 3AL0B 1MMAA 3GEZA 2OA4A 1G4DA 3M9AA 1ITYA 3VVYA 3QPHA 2LTPA 4LLNA 2W24A 4KICA 2L9NA 1YS7A 2GXAA 4F52A 3D5RC 3BJBA 3IWFA 2QBYA 3JTHA 1SD6A 2H6BA 2R7DA 4HF2A 2YU9J 2W48A 1MMDA 2LD5A 2HTJA 2STTA 4KFCA 1GXPA 2E2IJ 4RAYA 2CUEA 2XPVA 1JUPA 2DAOA 1WJCA 2HZTA 4Y7NJ 1E3PA 3PIOF 1ON2A 3VB2A 1FEXA 2K3PA 2X1EA 1RI7A 3M07A 2E1MB 1XDSA 4XQFA 1S3JA 2KISA 4GFBA 5GAGJ 2B7EA 2HYJA 1KYWA 2VBWA 3PFYA 3OYLA 3FDYA 3OS1A 2HGCA 3KZZA 5BQTA 1TNSA 1HW1A 4YFKF 3GX4X 1T6SA 2QSFX 2ID3A 4HF1A 1G8XA 3MKLA 2WA0A 4W97A 5L3EA 5TISC 3DLAA 1MNMC 2ME6A 2GLOA 2IPQX 4ZDPA 2LK2A 2AXTC 5E1WA 4A93J 1E17A 5FFZA 2P81A 5IP6A 1RR8C 3ABMH 1TC3C 1J2XA 4AM3A 1EH6A 4I09A 3F6VA 2V1DA 4QIWN 3B73A 2GA2A 3J80Z 1BR4A 1LDKB 4H4KC 4C2TA 2DOEA 2F5VA 2W57A 1B72A 2GOXB 1DU6A 3BR1A 4FASD 4ZH4F 4RMNA 1ORKA 3BC8A 4ZYEA 2IW5A 5CPRB 1QPIA 5D4SA 2R7RA 1STZA 1A5JA 2UXNA 2VASA 5CQGA 3RPUD 2DMQA 5J1UA 2Y69H 1VQNI 1UHMA 3QPTA 1TW2A 3GMEA 3BTCA 1CF7A 2L3DA 4CYCA 1S29A 5CYVA 5B3SH 1ZLKA 5E3OA 3DEEA 2PMUA 2HDDA 5LEJA 5DS9A 3JRAA 2BY3A 3BLYA 4JQFA 2XAHA 2WBMA 3R0JA 2RNJA 2G3BA 2DT6A 2CJJA 1ZTRA 3M8FA 2D6YA 1BM9A 2IGKA 1ZN2A 3ANGA 1EH7A 4IHVA 1WI9A 3ABKH 2VJJA 4CGZA 1TLHB 1R5ID 2F5EA 2KP6A 4FETA 5TRDA 3A03A 2QQAA 3CRJA 3J7ZI 2CGPA 4ZJZA 2R92J 1D1BA 1YI2I 1A6IA 1DP7P 2MBFA 2MD0A 2XDNA 2JVHA 4DYCA 2AXLA 3L2RA 5BNGA 1I1SA 3OYIA 2HXIA 3FK7A 1SFUA 4G12A 1YJ9I 2CMPA 3QU6A 3K70C 4XRSG 1LNWA 3E1SA 3GTGJ 3FXKA 3E3VA 3G1MA 1FOWA 4BBRJ 1IN7A 3L00A 4KN4X 4UDSA 2VE9A 4BE1A 5DDGA 5ICGA 1MH4A 2ZCMA 2KIFA 5HDGA 1D1CA 3RKYA 2CQNA 2M3AA 3GO5A 4BXFA 4B44A 4UUSA 3MKZA 3S1QJ 2PJRA 5FKOA 2XB5A 4GCVA 3GZNB 2LY9A 3FXJA 4UV8A 3CMMA 3TW7A 3VSKA 3C18A 2X0LA 1TZLA 3TKYA 1MMGA 3CUQA 1RPWA 5HVQC 3HKZN 1NG6A 5L3FA 3OYAA 4S04A 1OCTC 3S14J 3PIPF 4NQWB 3RZOJ 2RHAA 4A0XA 4JP0A 3HUGB 4ZYHA 3N97A 2JT1A 1AKHA 1H9TA 1OMIA 1GHCA 4BXUA 1E0EA 2PMHA 2FX0A 2Y0SA 3OYKA 3M8JA 1QVUA 5BMZA 3KYLA 4HW0A 2RASA 1FX7A 2YX4A 4DQ2A 2VJIA 4BQQA 2JWTA 5D5XB 2G7GA 1J75A 1K79A 3E5XA 4U0VA 1G6NA 4I98B 2HFHA 2ELHA 3HTJA
chains in the Genus database with same CATH topology
2QF7A 3I4MJ 4DZJA 2DA6A 3RD3A 4B3AA 3CMYA 5HODA 1RKTA 2MSYA 2DG8A 3PPBA 2Y9ZA 1WH7A 2E2HJ 1IG7A 1FTTA 1YRNA 1T33A 1TWCJ 2DA5A 5K7HA 3BQZA 5M5YJ 2G7LA 3HDDA 1WCMJ 3TW6A 5M5XJ 2PMZN 5EZGA 1HLVA 1OCPA 2YS9A 4RBOA 3LSGA 4XRMA 3GTJJ 5D1RA 2HOAA 1TWAJ 3JRGA 3QBMA 1MBJA 2H1KA 1RKWA 3LOCA 2TCTA 4FE4A 3M4OJ 1MBEA 1RESA 1NK2P 2HOSA 3CWRA 3QPLA 5JLWA 4NN1A 1ENHA 1LFUP 3HGYA 2V57A 4HNVA 5C4JJ 1TWGJ 3UKGA 4GFKA 1H8AC 4L5EA 3K7AJ 1QRYA 2KT0A 3HOYJ 3GTQJ 2EBIA 5FKKA 3FK6A 4JKZA 3Q0UA 4D7MA 3S2DJ 3VP5A 2B63J 2R93J 2VPRA 4A3KJ 2HQ5A 2CRGA 3ZQGA 2Y2ZA 2LKXA 1VFCA 3GEUA 3ON2A 2FD5A 2E19A 2XGCA 5C3EJ 4A3DJ 3VOXA 4M3FA 4NDLA 5IYCJ 2ZOZA 3D1NI 2HXOA 4A3JJ 3CDLA 3S2HJ 1W0UA 5C4XJ 1IDZA 5EG0A 3BRUA 2X48A 1APLC 3JRCA 9ANTA 1WI3A 2ZOYA 1O4XA 1I50J 1SANA 2EZIA 1RETA 3HM5A 5EGOB 2XGEA 3C2BA 2FBQA 3FRQA 3HOUJ 4A69C 3K2AA 5HBUA 3KNWA 3IV5A 3GTOJ 5EZHA 3M3YJ 2G7SA 2L0KA 5IOYA 2O7TA 3Q0VA 3MVPA 3TEDA 1HDDC 1EF4A 4AYBN 2GFNA 2YUSA 2K9QA 1GT0C 2OI8A 2AO9A 1T56A 3LSRA 3S15J 2DTZA 4M3BA 1JTYA 5F0CA 2DA3A 1AHDP 2IU5A 3GTLJ 4B1RA 2QKOA 2QCOA 3HE0A 3SFIA 3IH3A 1HOMA 2HKUA 3G1OA 2RAEA 1ETXA 2CQXA 1RR7A 1F43A 4LOCA 5EYRA 2M34A 1XC5A 2DN0A 2NVXJ 2NOGA 2CUFA 2DJNA 5FJ8J 2UXPA 3OSGA 4FTHA 1LE8B 4A3MJ 5FHPA 4D7NA 3ON4A 3S5RA 3JREA 5FLVA 1VI0A 3ZQHA 4JL3A 3ZQFA 1JJ6C 2OERA 2L7ZA 4XIDA 3O8GA 5F1JA 3BR6A 3RKQA 3P9TA 3CQZJ 2K9NA 2ID6A 1PUFA 1X2MA 2R7ZJ 3BCGA 1F36A 2OPTA 4IEJA 4ME9A 5E3MA 2H8RA 3QKXA 4AC0A 3WHCA 3B6AA 4FISA 5FKLA 3NARA 4FE7A 2XPWA 2TRTA 1UHSA 1BL0A 1WH5A 2X9DA 3LJLA 1W0TA 3COLA 1ETKA 4D5CA 4A3CJ 5F0FA 1IUFA 2KDZA 1MBFA 4XK4A 4XICA 1MH3A 2K9SA 1JKRC 3WHBA 5F04A 3LSPA 1IGNA 4JX4A 1NK3P 1MBKA 4QSHA 2O7OA 5F08A 2IAIA 3NI7A 2Y30A 2R5YA 3O8HA 1FIAA 4ABZA 4A3GJ 1AU7A 1WPKA 3HOXJ 5HSZA 3DEWA 1TWFJ 3G56A 3HB9A 1Q1VA 3S1NJ 2M2EA 1H88C 1MBHA 2W53A 1G2HA 3VVXA 3HOWJ 5D19A 3HTAA 5EF6A 1HF0A 3BR3A 3BHQA 4JX6A 5FKNA 3LNQA 1NTCA 2Y31A 2Q24A 2REKA 3S16J 2O8KA 2ME0A 4DYQA 1YRNB 4Y52J 1OJLA 1K83J 2EQRA 2XB0X 4V2FA 2IBDA 2YVEA 2PZ9A 2WV1A 3BG9A 1JKPC 4JNNA 2E2JJ 2ECCA 4W1UA 1BW5A 3E7QA 1X2NA 2FQ4A 1UI5A 4D5FA 3L1PA 5FKMA 1ZK8A 1P7IA 2COBA 3BR0A 4MXMA 3BTJA 1IV6A 2ZCXA 2EZHA 3VPRA 4HKUA 3A02A 3TP0A 5F0HA 3EUPA 3VW1A 3BTLA 4IHXA 3BTIA 4MFDA 1VF9A 5J1YA 3HTIA 4RDUA 2XGDA 1MSFC 3KKDA 2EZKA 3FIWA 3A01A 4J19A 3ZQLA 4GFLA 1B72B 1X58A 2M9HA 5F27A 2LLKA 4A3IJ 4KWAA 1JKOC 2DMUA 2I10A 4BBSJ 1FTZA 4MIMA 3JSJA 5IPAA 2DG7A 5E3NA 5CW8A 5GPAA 2O9LA 2DA2A 5EGOA 3BR2A 3VIBA 3MN2A 2LR8A 3JRFA 1XG1A 4CYCB 2NP3A 3NNRA 2JJ7A 3PO3J 1B8IB 5IP7J 1SFOJ 5GPCA 4BXXJ 3VUQA 2HOTA 5J1RA 3LSJA 3RQIA 1R9TJ 3BG3A 1I3QJ 2JA6J 2L7MP 1SGMA 2DA1A 3TP3A 1JT0A 3BG5A 2MGQA 4JX5A 2WB1N 3V78A 4MO7A 1GUUA 3HOVJ 2JMWA 2QIBA 2WAQN 3QQAA 2ZCNA 3AQTA 5IOZA 2L7FP 4BKXA 2FJ1A 3JRHA 1ETOA 3OSFA 1LE8A 3GTPJ 5DAJA 3RZDJ 4C3IJ 3W6VA 1ZKGA 2IEKA 2VKVA 4JYKA 1HDPA 5DTDA 2UXOA 2NS8A 5D18A 2LP0A 4C3HJ 3GTKJ 3NRGA 4EEFG 2EZLA 1U9OA 3G1LA 2EH3A 1JGGA 2HI3A 1Y1WJ 3T6NA 4A3EJ 3JRIA 1JTXA 2R5ZA 4ICHA 1I6HJ 3BR5A 3EGQA 3FISA 1XS9A 3E7LA 3SJMA 3DPJA 1ETVA 2VI6A 3HEFA 2Y0SN 4UUSB 3VVZA 3HIMA 4A3FJ 4DW6A 2ECBA 5J3LA 3F0CA 3S17J 5CXIA 3B6CA 3ZOBA 1CQTA 4XRSA 4A3LJ 1ITYA 3VVYA 1GDTA 2LTPA 2NVTJ 4GCKA 2DA7A 1UI6A 1ZR4A 3AQSA 1H89C 5FLMJ 4AF5A 2D5VA 4M3DA 2ZB9A 3IH2A 4AUXA 1AKHB 2QTQA 5M3FJ 3BJBA 5FMPA 2YU9J 2W48A 2LD5A 5IYBJ 2DMNA 5AQCA 5EFYA 2R0QC 1BA5A 2E2IJ 2WUIA 2CU7A 2CUEA 2DMTA 1JUPA 2XPVA 2MG4A 2VUMJ 3I4NJ 4Y7NJ 5K58A 5EEAA 2NVYJ 4IHWA 1FEXA 4DYRA 2DMPA 4FCYA 1UMQA 2NP5A 3OOUA 4GFBA 2HYJA 3B81A 2DA4A 5IYDJ 1U78A 4M6VA 3CJDA 1JKQC 3DCFA 3H3VK 4C3JJ 2GENA 2QWTA 3ZQCA 2LVSA 2NS7A 3Q3SA 1Z77A 3H0GJ 1S7EA 2ID3A 2XSDC 3JR9A 3IH4A 3MKLA 4W97A 4M3EA 1MNMC 1GV5A 2ME6A 2GLOA 3PO2J 3HBLA 2LK2A 2PBXA 1TWHJ 4A93J 3QPSA 4B4CA 3IUVA 2P81A 5IP6A 5IP9J 3S1RJ 1IC8A 4I76A 3NPIA 4ACIA 1TC3C 3KZ9A 2OF7A 4YZEA 4QIWN 4V2GA 5C44J 3VOKA 2VKEA 2NX4A 2QOPA 4PXIA 5HAWA 4X6AJ 1K61A 4C2MJ 3C07A 4L62A 3S1MJ 3ANPA 4GCTA 3JRDA 3HGGA 1B72A 1OFCX 3CCYA 4MFEA 5M5WJ 3GTMJ 2LFBA 1DU6A 3V6GA 2M0CA 3BR1A 3KKCA 1ORKA 3A01B 1JJ8C 1QPIA 3HTHA 4UUTA 1A5JA 3JRBA 2XRLA 2DMQA 5EG0B 3OIOA 5J1UA 5K7FA 1LFBA 3FKIJ 5C4YA 1U9NA 3BTCA 3PM1A 2UXIA 4CYCA 5EDNA 2K40A 4X1EA 5GP9A 4BY7J 2L9RA 1B8IA 3LHQA 5E3OA 3O60A 1ZR2A 2HDDA 2M8GX 5DS9A 3JRAA 1ETYA 1MBGA 1MSEC 2JN6A 4GCLA 3GBGA 2G3BA 3F1BA 2CJJA 1ZTRA 1HCRA 2JA5J 2D6YA 3LWJA 3PASA 2E1OA 3ANGA 4IHVA 2WGBA 2ELKA 3SDGA 1DU0A 4CGRA 3NAUA 1POGA 2YVHA 3G7RA 3A03A 2MW8A 1JUSA 1QVTA 3CRJA 1P7JA 5JLXA 2XPUA 2UXHA 1ZGWA 2NVQJ 2R92J 1A6IA 1ETQA 5FGLA 2XDNA 4DYCA 3GZIA 5BNGA 2HXIA 3FK7A 1FJLA 3HOZJ 4S0HB 4G12A 3BNIA 1ZQ3P 4XRSG 3GTGJ 3G1MA 1ETWA 4BBRJ 1Y1VJ 4DZPA 4UDSA 1D5YA 4MLOA 1BW6A 1MH4A 1Z0XA 2ZCMA 1WGXA 4IHYA 4A3BJ 5E3LA 1PUFB 3BQYA 1IJWC 1VNDA 4UUSA 3S1QJ 2JK3A 5FKOA 5K7ZA 1GV2A 2XB5A 4MK6A 2LY9A 2R5ZB 3TW7A 2N8GA 2F07A 1FIPA 3NXCA 1RPWA 2CQQA 3HKZN 1OCTC 3S14J 1GVDA 1IRZA 3RZOJ 2Y9YA 3BT9A 2RHAA 4JP0A 1IDYA 4BY1J 2GUHA 4M3GA 2GBYA 3Q0WA 1AKHA 1U8BA 2JA8J 1E3OC 4AC6A 2FX0A 1JUMA 2GM4A 1QVUA 5CXGA 2X6OA 4QTRA 1BJZA 2RASA 5H9TA 2AHQA 2G0EA 2JWTA 5M3MJ 4I6ZA 2G7GA 2UXUA 3MNLA 4NELA 2HYTA 1UG2A 3VW0A 1JT6A 3ZQIA 2JA7J 3VW2A 2R5YB 3RH2A 3HTJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QF7 A;  3I4M J;  4DZJ A;  2DA6 A;  3RD3 A;  4B3A A;  3CMY A;  5HOD A;  1RKT A;  2MSY A;  2DG8 A;  3PPB A;  2Y9Z A;  1WH7 A;  2E2H J;  1IG7 A;  1FTT A;  1YRN A;  1T33 A;  1TWC J;  2DA5 A;  5K7H A;  3BQZ A;  5M5Y J;  2G7L A;  3HDD A;  1WCM J;  3TW6 A;  5M5X J;  2PMZ N;  5EZG A;  1HLV A;  1OCP A;  2YS9 A;  4RBO A;  3LSG A;  4XRM A;  3GTJ J;  5D1R A;  2HOA A;  1TWA J;  3JRG A;  3QBM A;  1MBJ A;  2H1K A;  1RKW A;  3LOC A;  2TCT A;  4FE4 A;  3M4O J;  1MBE A;  1RES A;  1NK2 P;  2HOS A;  3CWR A;  3QPL A;  5JLW A;  4NN1 A;  1ENH A;  1LFU P;  3HGY A;  2V57 A;  4HNV A;  5C4J J;  1TWG J;  3UKG A;  4GFK A;  1H8A C;  4L5E A;  3K7A J;  1QRY A;  2KT0 A;  3HOY J;  3GTQ J;  2EBI A;  5FKK A;  3FK6 A;  4JKZ A;  3Q0U A;  4D7M A;  3S2D J;  3VP5 A;  2B63 J;  2R93 J;  2VPR A;  4A3K J;  2HQ5 A;  2CRG A;  3ZQG A;  2Y2Z A;  2LKX A;  1VFC A;  3GEU A;  3ON2 A;  2FD5 A;  2E19 A;  2XGC A;  5C3E J;  4A3D J;  3VOX A;  4M3F A;  4NDL A;  5IYC J;  2ZOZ A;  3D1N I;  2HXO A;  4A3J J;  3CDL A;  3S2H J;  1W0U A;  5C4X J;  1IDZ A;  5EG0 A;  3BRU A;  2X48 A;  1APL C;  3JRC A;  9ANT A;  1WI3 A;  2ZOY A;  1O4X A;  1I50 J;  1SAN A;  2EZI A;  1RET A;  3HM5 A;  5EGO B;  2XGE A;  3C2B A;  2FBQ A;  3FRQ A;  3HOU J;  4A69 C;  3K2A A;  5HBU A;  3KNW A;  3IV5 A;  3GTO J;  5EZH A;  3M3Y J;  2G7S A;  2L0K A;  5IOY A;  2O7T A;  3Q0V A;  3MVP A;  3TED A;  1HDD C;  1EF4 A;  4AYB N;  2GFN A;  2YUS A;  2K9Q A;  1GT0 C;  2OI8 A;  2AO9 A;  1T56 A;  3LSR A;  3S15 J;  2DTZ A;  4M3B A;  1JTY A;  5F0C A;  2DA3 A;  1AHD P;  2IU5 A;  3GTL J;  4B1R A;  2QKO A;  2QCO A;  3HE0 A;  3SFI A;  3IH3 A;  1HOM A;  2HKU A;  3G1O A;  2RAE A;  1ETX A;  2CQX A;  1RR7 A;  1F43 A;  4LOC A;  5EYR A;  2M34 A;  1XC5 A;  2DN0 A;  2NVX J;  2NOG A;  2CUF A;  2DJN A;  5FJ8 J;  2UXP A;  3OSG A;  4FTH A;  1LE8 B;  4A3M J;  5FHP A;  4D7N A;  3ON4 A;  3S5R A;  3JRE A;  5FLV A;  1VI0 A;  3ZQH A;  4JL3 A;  3ZQF A;  1JJ6 C;  2OER A;  2L7Z A;  4XID A;  3O8G A;  5F1J A;  3BR6 A;  3RKQ A;  3P9T A;  3CQZ J;  2K9N A;  2ID6 A;  1PUF A;  1X2M A;  2R7Z J;  3BCG A;  1F36 A;  2OPT A;  4IEJ A;  4ME9 A;  5E3M A;  2H8R A;  3QKX A;  4AC0 A;  3WHC A;  3B6A A;  4FIS A;  5FKL A;  3NAR A;  4FE7 A;  2XPW A;  2TRT A;  1UHS A;  1BL0 A;  1WH5 A;  2X9D A;  3LJL A;  1W0T A;  3COL A;  1ETK A;  4D5C A;  4A3C J;  5F0F A;  1IUF A;  2KDZ A;  1MBF A;  4XK4 A;  4XIC A;  1MH3 A;  2K9S A;  1JKR C;  3WHB A;  5F04 A;  3LSP A;  1IGN A;  4JX4 A;  1NK3 P;  1MBK A;  4QSH A;  2O7O A;  5F08 A;  2IAI A;  3NI7 A;  2Y30 A;  2R5Y A;  3O8H A;  1FIA A;  4ABZ A;  4A3G J;  1AU7 A;  1WPK A;  3HOX J;  5HSZ A;  3DEW A;  1TWF J;  3G56 A;  3HB9 A;  1Q1V A;  3S1N J;  2M2E A;  1H88 C;  1MBH A;  2W53 A;  1G2H A;  3VVX A;  3HOW J;  5D19 A;  3HTA A;  5EF6 A;  1HF0 A;  3BR3 A;  3BHQ A;  4JX6 A;  5FKN A;  3LNQ A;  1NTC A;  2Y31 A;  2Q24 A;  2REK A;  3S16 J;  2O8K A;  2ME0 A;  4DYQ A;  1YRN B;  4Y52 J;  1OJL A;  1K83 J;  2EQR A;  2XB0 X;  4V2F A;  2IBD A;  2YVE A;  2PZ9 A;  2WV1 A;  3BG9 A;  1JKP C;  4JNN A;  2E2J J;  2ECC A;  4W1U A;  1BW5 A;  3E7Q A;  1X2N A;  2FQ4 A;  1UI5 A;  4D5F A;  3L1P A;  5FKM A;  1ZK8 A;  1P7I A;  2COB A;  3BR0 A;  4MXM A;  3BTJ A;  1IV6 A;  2ZCX A;  2EZH A;  3VPR A;  4HKU A;  3A02 A;  3TP0 A;  5F0H A;  3EUP A;  3VW1 A;  3BTL A;  4IHX A;  3BTI A;  4MFD A;  1VF9 A;  5J1Y A;  3HTI A;  4RDU A;  2XGD A;  1MSF C;  3KKD A;  2EZK A;  3FIW A;  3A01 A;  4J19 A;  3ZQL A;  4GFL A;  1B72 B;  1X58 A;  2M9H A;  5F27 A;  2LLK A;  4A3I J;  4KWA A;  1JKO C;  2DMU A;  2I10 A;  4BBS J;  1FTZ A;  4MIM A;  3JSJ A;  5IPA A;  2DG7 A;  5E3N A;  5CW8 A;  5GPA A;  2O9L A;  2DA2 A;  5EGO A;  3BR2 A;  3VIB A;  3MN2 A;  2LR8 A;  3JRF A;  1XG1 A;  4CYC B;  2NP3 A;  3NNR A;  2JJ7 A;  3PO3 J;  1B8I B;  5IP7 J;  1SFO J;  5GPC A;  4BXX J;  3VUQ A;  2HOT A;  5J1R A;  3LSJ A;  3RQI A;  1R9T J;  3BG3 A;  1I3Q J;  2JA6 J;  2L7M P;  1SGM A;  2DA1 A;  3TP3 A;  1JT0 A;  3BG5 A;  2MGQ A;  4JX5 A;  2WB1 N;  3V78 A;  4MO7 A;  1GUU A;  3HOV J;  2JMW A;  2QIB A;  2WAQ N;  3QQA A;  2ZCN A;  3AQT A;  5IOZ A;  2L7F P;  4BKX A;  2FJ1 A;  3JRH A;  1ETO A;  3OSF A;  1LE8 A;  3GTP J;  5DAJ A;  3RZD J;  4C3I J;  3W6V A;  1ZKG A;  2IEK A;  2VKV A;  4JYK A;  1HDP A;  5DTD A;  2UXO A;  2NS8 A;  5D18 A;  2LP0 A;  4C3H J;  3GTK J;  3NRG A;  4EEF G;  2EZL A;  1U9O A;  3G1L A;  2EH3 A;  1JGG A;  2HI3 A;  1Y1W J;  3T6N A;  4A3E J;  3JRI A;  1JTX A;  2R5Z A;  4ICH A;  1I6H J;  3BR5 A;  3EGQ A;  3FIS A;  1XS9 A;  3E7L A;  3SJM A;  3DPJ A;  1ETV A;  2VI6 A;  3HEF A;  2Y0S N;  4UUS B;  3VVZ A;  3HIM A;  4A3F J;  4DW6 A;  2ECB A;  5J3L A;  3F0C A;  3S17 J;  5CXI A;  3B6C A;  3ZOB A;  1CQT A;  4XRS A;  4A3L J;  1ITY A;  3VVY A;  1GDT A;  2LTP A;  2NVT J;  4GCK A;  2DA7 A;  1UI6 A;  1ZR4 A;  3AQS A;  1H89 C;  5FLM J;  4AF5 A;  2D5V A;  4M3D A;  2ZB9 A;  3IH2 A;  4AUX A;  1AKH B;  2QTQ A;  5M3F J;  3BJB A;  5FMP A;  2YU9 J;  2W48 A;  2LD5 A;  5IYB J;  2DMN A;  5AQC A;  5EFY A;  2R0Q C;  1BA5 A;  2E2I J;  2WUI A;  2CU7 A;  2CUE A;  2DMT A;  1JUP A;  2XPV A;  2MG4 A;  2VUM J;  3I4N J;  4Y7N J;  5K58 A;  5EEA A;  2NVY J;  4IHW A;  1FEX A;  4DYR A;  2DMP A;  4FCY A;  1UMQ A;  2NP5 A;  3OOU A;  4GFB A;  2HYJ A;  3B81 A;  2DA4 A;  5IYD J;  1U78 A;  4M6V A;  3CJD A;  1JKQ C;  3DCF A;  3H3V K;  4C3J J;  2GEN A;  2QWT A;  3ZQC A;  2LVS A;  2NS7 A;  3Q3S A;  1Z77 A;  3H0G J;  1S7E A;  2ID3 A;  2XSD C;  3JR9 A;  3IH4 A;  3MKL A;  4W97 A;  4M3E A;  1MNM C;  1GV5 A;  2ME6 A;  2GLO A;  3PO2 J;  3HBL A;  2LK2 A;  2PBX A;  1TWH J;  4A93 J;  3QPS A;  4B4C A;  3IUV A;  2P81 A;  5IP6 A;  5IP9 J;  3S1R J;  1IC8 A;  4I76 A;  3NPI A;  4ACI A;  1TC3 C;  3KZ9 A;  2OF7 A;  4YZE A;  4QIW N;  4V2G A;  5C44 J;  3VOK A;  2VKE A;  2NX4 A;  2QOP A;  4PXI A;  5HAW A;  4X6A J;  1K61 A;  4C2M J;  3C07 A;  4L62 A;  3S1M J;  3ANP A;  4GCT A;  3JRD A;  3HGG A;  1B72 A;  1OFC X;  3CCY A;  4MFE A;  5M5W J;  3GTM J;  2LFB A;  1DU6 A;  3V6G A;  2M0C A;  3BR1 A;  3KKC A;  1ORK A;  3A01 B;  1JJ8 C;  1QPI A;  3HTH A;  4UUT A;  1A5J A;  3JRB A;  2XRL A;  2DMQ A;  5EG0 B;  3OIO A;  5J1U A;  5K7F A;  1LFB A;  3FKI J;  5C4Y A;  1U9N A;  3BTC A;  3PM1 A;  2UXI A;  4CYC A;  5EDN A;  2K40 A;  4X1E A;  5GP9 A;  4BY7 J;  2L9R A;  1B8I A;  3LHQ A;  5E3O A;  3O60 A;  1ZR2 A;  2HDD A;  2M8G X;  5DS9 A;  3JRA A;  1ETY A;  1MBG A;  1MSE C;  2JN6 A;  4GCL A;  3GBG A;  2G3B A;  3F1B A;  2CJJ A;  1ZTR A;  1HCR A;  2JA5 J;  2D6Y A;  3LWJ A;  3PAS A;  2E1O A;  3ANG A;  4IHV A;  2WGB A;  2ELK A;  3SDG A;  1DU0 A;  4CGR A;  3NAU A;  1POG A;  2YVH A;  3G7R A;  3A03 A;  2MW8 A;  1JUS A;  1QVT A;  3CRJ A;  1P7J A;  5JLX A;  2XPU A;  2UXH A;  1ZGW A;  2NVQ J;  2R92 J;  1A6I A;  1ETQ A;  5FGL A;  2XDN A;  4DYC A;  3GZI A;  5BNG A;  2HXI A;  3FK7 A;  1FJL A;  3HOZ J;  4S0H B;  4G12 A;  3BNI A;  1ZQ3 P;  4XRS G;  3GTG J;  3G1M A;  1ETW A;  4BBR J;  1Y1V J;  4DZP A;  4UDS A;  1D5Y A;  4MLO A;  1BW6 A;  1MH4 A;  1Z0X A;  2ZCM A;  1WGX A;  4IHY A;  4A3B J;  5E3L A;  1PUF B;  3BQY A;  1IJW C;  1VND A;  4UUS A;  3S1Q J;  2JK3 A;  5FKO A;  5K7Z A;  1GV2 A;  2XB5 A;  4MK6 A;  2LY9 A;  2R5Z B;  3TW7 A;  2N8G A;  2F07 A;  1FIP A;  3NXC A;  1RPW A;  2CQQ A;  3HKZ N;  1OCT C;  3S14 J;  1GVD A;  1IRZ A;  3RZO J;  2Y9Y A;  3BT9 A;  2RHA A;  4JP0 A;  1IDY A;  4BY1 J;  2GUH A;  4M3G A;  2GBY A;  3Q0W A;  1AKH A;  1U8B A;  2JA8 J;  1E3O C;  4AC6 A;  2FX0 A;  1JUM A;  2GM4 A;  1QVU A;  5CXG A;  2X6O A;  4QTR A;  1BJZ A;  2RAS A;  5H9T A;  2AHQ A;  2G0E A;  2JWT A;  5M3M J;  4I6Z A;  2G7G A;  2UXU A;  3MNL A;  4NEL A;  2HYT A;  1UG2 A;  3VW0 A;  1JT6 A;  3ZQI A;  2JA7 J;  3VW2 A;  2R5Y B;  3RH2 A;  3HTJ A; 
#chains in the Genus database with same CATH topology
 3ZN1 A;  2L2O A;  2M7B A;  5HOD A;  1IN8 A;  2ZBK A;  3VYU B;  1SAU A;  5LEK A;  1G3Y A;  5DUK A;  3L2V A;  3VWB A;  1FTT A;  3BQZ A;  2G7L A;  1EA3 A;  2KQR A;  4L9V A;  3SFZ A;  5M5X J;  4M74 A;  1HLV A;  3CDH A;  3IRQ A;  3CDI A;  4L18 B;  2ZJR F;  1K78 B;  5D1R A;  4LLL A;  2IJL A;  2IP2 A;  2H1K A;  3BZK A;  1RKW A;  1F5T A;  3FHZ A;  4H0E A;  5L3D A;  1RES A;  1EKE A;  4PZJ A;  2DOA A;  3QPL A;  2UZK A;  4I0B A;  4BU2 A;  3SXY A;  5K5Q A;  1J09 A;  5JVG F;  2COM A;  5AON A;  2FUG 2;  2QGU A;  3OYD A;  3KZY A;  4DBR A;  1IRG A;  4E4H A;  1X3W B;  3HRT A;  4BYY A;  1TQP A;  3CO6 C;  1K4T A;  4M72 A;  1XX5 A;  4L5E A;  1WJB A;  3K7A J;  5CKT A;  3HOY J;  5FKK A;  4HQE A;  3S2D J;  4ASN A;  3E6B A;  3K4B A;  3ML6 A;  1I39 A;  2VPR A;  4E7J A;  2CRG A;  3ZQG A;  1U2W A;  2Y2Z A;  3HSF A;  2VBY A;  4PGG A;  2E19 A;  3N05 A;  1YS6 A;  5C3E J;  4YFN F;  3VOX A;  2ZOZ A;  2VKH A;  5FFX A;  2HNH A;  4WXH A;  3O6B B;  4XOR A;  3MAJ A;  4YII A;  9ANT A;  2ZOY A;  2QUF A;  1WI3 A;  3BCA A;  3OYE A;  1I50 J;  3S32 A;  1TBX A;  1O3Q A;  1B6A A;  1LFP A;  1IXR C;  1FWZ A;  2P5V A;  3FKJ A;  4R8H A;  3I59 A;  4HDV A;  1JE8 A;  2KMU A;  5HBU A;  2LKS A;  4N9I A;  4EJU A;  1HDD C;  2YUS A;  3SEZ A;  2K4J A;  2K9Q A;  3A4C A;  4L5I A;  1WJ5 A;  3S15 J;  2DTZ A;  1KYZ A;  4CCK A;  3K69 A;  2JQ7 A;  2IU5 A;  3GTL J;  1P4W A;  2LG4 A;  1C0W A;  4C2M A;  2ZC2 A;  1HOM A;  4FHT A;  3GYH X;  2CQX A;  5H2F C;  4GGG A;  1RR7 A;  4I01 A;  4LOC A;  5BPD A;  1DP3 A;  1F43 A;  2M34 A;  3MD2 A;  2YR2 A;  2ISZ A;  3WTY C;  4E7L A;  3OV8 A;  2K3F A;  2QA4 I;  1XGO A;  4IX7 A;  4BJ6 C;  1ZEL A;  1TQI A;  3ON4 A;  2YX7 A;  3JRE A;  4NB5 A;  3DTI A;  1FLI A;  2V1U A;  4LB5 A;  1WZ2 A;  1OKR A;  1JJ6 C;  2RRE A;  5D8L B;  2ZXJ A;  3H35 A;  1Z6T A;  4ANJ A;  3CMA I;  1SD4 A;  4BE2 A;  1ZGA A;  5HNH A;  3P9T A;  3EUK L;  2ID6 A;  2VT3 A;  2R7F A;  5DEQ A;  1PUF A;  1F36 A;  3FMQ A;  4KIT B;  1X4P A;  5LBQ A;  2HDW A;  2V79 A;  1TTY A;  3GFM A;  4A6D A;  2ZME A;  3H5A A;  3DPT A;  3ERM A;  4XLP F;  5GAE J;  1ULY A;  3O2P E;  4RAZ A;  2YVX A;  2A5Y B;  1S6L A;  3COL A;  1XTA A;  3FM5 A;  3I9V 2;  4ZYA A;  2FEZ A;  3KP6 A;  1BC8 C;  3BCB A;  2DFE A;  1R36 A;  2O8X A;  4PJL A;  2XKP A;  1TL8 A;  2RKH A;  1BIA A;  2VJ4 A;  2O7O A;  5F08 A;  2IRF G;  4IQJ A;  3NI7 A;  3R60 A;  3OWT A;  5CVU A;  1PP8 F;  3O8H A;  3WTV C;  2G7H A;  1DUX C;  3CTA A;  2OCC H;  2L9V A;  1PYV A;  3LMM A;  4O5V A;  2D1V A;  2F4I A;  1H88 C;  2L5Q A;  3VVX A;  3JAM K;  3BR3 A;  1VQ7 I;  3HHH A;  4JX6 A;  3BHQ A;  3S16 J;  2ETH A;  2XUB A;  2ZXH A;  2O8K A;  3CC4 I;  5E1Z B;  2VOP A;  4Y52 J;  4CSW A;  5HOO A;  1QPM A;  4V2F A;  2NVU B;  2HS5 A;  3ROU A;  1BW5 A;  1D0Y A;  3E7Q A;  2A07 F;  4N4O B;  4ZTF A;  5FKM A;  4IKF A;  3RSN A;  4BHB A;  3TO6 A;  2NNY A;  1BBY A;  5KCM A;  4EVI A;  4HKU A;  3PL8 A;  3DBR B;  4IHX A;  3I55 I;  2HQN A;  1X1D A;  3I64 A;  3ZQL A;  4OIO F;  1IN5 A;  2EV0 A;  3DTK A;  4Q4Z F;  1B72 B;  3H0D A;  3M7G A;  5F27 A;  1DGW Y;  1XDU A;  4XSZ F;  3VYS B;  3I5U A;  1WQ2 A;  2K27 A;  4EM1 A;  3CF2 A;  5BOX A;  2C6Y A;  2DG7 A;  2JVG A;  2KJC A;  2KDO A;  3LSH A;  2W7N A;  5CW8 A;  3DWL E;  4KIF A;  1G3T A;  3RJP A;  1O57 A;  1P6R A;  2MC4 A;  4RLF A;  1FYK A;  2O9L A;  1KQ8 A;  2XHK A;  2KIM A;  2MD5 A;  3K4N A;  2P0W A;  1UFM A;  2E1N A;  3W3C A;  1TNT A;  4LIT A;  2R3S A;  4CYC B;  1LB2 A;  2JJ7 A;  3EUH A;  1SFO J;  4BXX J;  3VUQ A;  1OLT A;  4OMY A;  3QP5 A;  5J1R A;  2VXD A;  1ERD A;  2P5K A;  1SGM A;  2DA1 A;  2E60 A;  3GUD A;  1KU9 A;  2MGQ A;  2WB1 N;  2W00 A;  1P4A A;  4QWQ A;  3L2U A;  2QKM B;  3HOV J;  3GFL A;  2ZCN A;  5ILS A;  3VSL A;  1SVM A;  5IOZ A;  4HEA 2;  4BKX A;  2WWY A;  3LA7 A;  2CQ7 A;  4WK8 F;  3W6V A;  3VYR B;  2VKV A;  2LP0 A;  2Z5U A;  3MQ0 A;  4RB3 C;  3NRG A;  5FRN A;  3KP7 A;  2F4O B;  5D5U B;  1W5S A;  4HLY A;  2HI3 A;  3U1K A;  1FZP B;  3JRI A;  2UUZ A;  2Q8K A;  1ZHF A;  1WJF A;  4F7Z A;  3QOP A;  1YX5 A;  3FIS A;  2DQL A;  4BAY A;  1ETV A;  3ZGK A;  4ZYG A;  2PFB A;  2ZFU A;  2MLG A;  1MMN A;  1MND A;  3R4K A;  4EQQ A;  4UUS B;  4CYD A;  2QYO A;  2ZSI B;  3G71 I;  4E7I A;  5ICF A;  2GIV A;  2ECB A;  5J3L A;  3F0C A;  5D5W B;  3EYI A;  3B6C A;  3K4M A;  2X51 A;  2XV4 S;  3ZOB A;  2ZJP F;  3PUF A;  4A3L J;  2LBF B;  1XSD A;  2NVT J;  4F93 B;  3M8E A;  2ZSH B;  3TGN A;  1ZR4 A;  3SZG A;  1H89 C;  3QU3 A;  4AF5 A;  2MC3 A;  2D5V A;  4AUX A;  2HTS A;  1AKH B;  2QTQ A;  3BJO A;  2MH9 A;  2VBZ A;  3D5L A;  1LDD A;  5M3F J;  2DT7 B;  4XSX F;  4WWC A;  2EFQ A;  3MZY A;  3EET A;  2E7W A;  5IYB J;  1L0O C;  3LQQ A;  5FD5 A;  1BA5 A;  2DFI A;  4B43 A;  3WTZ A;  2B3W A;  3QWL A;  3K9T A;  5HDN A;  2MG4 A;  1OCC H;  2IVM A;  2VUM J;  3I4N J;  5EEA A;  1FOK A;  2ESN A;  4BAC A;  2JRT A;  4PFO A;  3OYJ A;  2ZJ2 A;  5LHH A;  1UMQ A;  1K78 A;  3QYE A;  3RYR A;  5IYD J;  2PI0 A;  1U78 A;  3CJD A;  1JKQ C;  1GVJ A;  1KU7 A;  2FOW A;  1P4X A;  2QWT A;  3BZ6 A;  5KHD A;  1Z77 A;  2QKL B;  1S7E A;  3MZH A;  2BXZ A;  2PMZ A;  4LFU A;  1KON A;  2XKO A;  2P7C B;  5B5E C;  2ZCW A;  1TWH J;  3GVA A;  1O7L A;  2LKP A;  1IC8 A;  4XM3 A;  3CD6 I;  4I76 A;  4KT5 C;  4BE0 A;  4JOM A;  3J80 K;  2OF7 A;  5H6R A;  3LWF A;  3P9K A;  3PQK A;  4V2G A;  5C44 J;  1R22 A;  2FF4 A;  1OCZ H;  2JZY A;  2W4S A;  2NX4 A;  4PXI A;  2LH9 A;  4X6A J;  3AAF A;  1SEU A;  3S1M J;  2BEO A;  3ANP A;  4A2U A;  1Y6I A;  3ISP A;  3CCY A;  4RGX A;  2LFB A;  1Z7L A;  3OY9 A;  3FMR A;  3IP4 B;  1YIT I;  3A01 B;  2VIX A;  2GAU A;  4KNY A;  2K9M A;  3OMY A;  5H20 A;  2MA3 A;  2XRL A;  3C7J A;  3I0T A;  3K1P A;  4AID A;  1LFB A;  2XRO A;  5L3G A;  2O61 A;  2CWE A;  1U9N A;  5E79 C;  2BW3 B;  4YIF A;  1FBQ A;  1HXD A;  4F55 A;  4X1E A;  5EDN A;  3I59 B;  4NHJ A;  1QQI A;  2PBI A;  5LRS A;  1A35 A;  2M8G X;  1ETY A;  1SFK A;  1MBG A;  4DJA A;  1MSE C;  2M7A A;  1HCR A;  2JA5 J;  4CA0 A;  4DNC A;  3R61 A;  4OAZ A;  3J7A O;  1POG A;  4FX0 A;  3G7R A;  1JUS A;  1PJR A;  3LA3 A;  2UXH A;  4ZZL A;  5JR3 A;  2K86 A;  2NVQ J;  1Y0N A;  2PN6 A;  3E5U A;  1MIJ A;  1ETQ A;  2EFN A;  3CES A;  1HST A;  3K6G A;  5FGL A;  4D0P A;  3CCJ I;  2M4G A;  2P8T A;  3HHG A;  1FJL A;  3HOZ J;  3ZQQ A;  1T0F C;  3LFU A;  5CQE A;  4J00 A;  1I27 A;  1BC7 C;  1DGR M;  2F4M B;  4XLA A;  1Y1V J;  3FXR A;  2EV5 A;  2NOJ B;  1D5Y A;  1QZZ A;  4BDZ A;  1WGX A;  4X0G A;  2O3F A;  4QPQ A;  1ODD A;  4A3B J;  1Z3X A;  5E3L A;  3IAM 2;  1PUF B;  3BP8 A;  2JK3 A;  4MNU A;  2JA2 A;  2FBI A;  4KMU X;  4PJM A;  3QRF F;  3CO7 C;  2R5Z B;  2ZME B;  4MK6 A;  1R4M B;  1FIP A;  2WV0 A;  3ABL H;  3HIF A;  3KE2 A;  3FWE A;  1IV8 A;  2FMY A;  4ZTJ A;  1J5Y A;  4BY1 J;  1IDY A;  1OQY A;  5HLH A;  4M3G A;  2DI3 A;  2GBY A;  4RGS A;  2WTE A;  1R00 A;  4PDK A;  1FP1 D;  4HA8 A;  4HV6 A;  1U8B A;  2DT5 A;  4CO8 A;  4AC6 A;  1JUM A;  2R4G A;  3PNT A;  2JUG A;  1MD0 A;  5CXG A;  2FBH A;  3G73 A;  2X6O A;  1SD7 A;  4R1H A;  4P55 A;  5M3M J;  1UG2 A;  2I5U A;  2WAD A;  2DW4 A;  4WIB A;  3VW2 A;  2HYG D;  3RH2 A;  1ACI A;  3K4C A;  4RAG A;  1R49 A;  4B3A A;  1FMV A;  3CMY A;  1RKT A;  1XGM A;  3FHN A;  1VQO I;  1WH7 A;  2X6W A;  5HS7 A;  1T33 A;  5M5Y J;  3W6K B;  1S9H A;  2H94 A;  2VC1 A;  3L9F A;  2D45 A;  1M1E B;  2IXS A;  3K1M A;  1J59 A;  1E3H A;  3KZI C;  3V8J A;  1F9N A;  1TWA J;  2E35 A;  1MBJ A;  4A5M A;  3CLO A;  4GDF A;  3LOC A;  3SZT A;  4PJ0 C;  1T2K A;  1Z91 A;  2TCT A;  3M4O J;  4LD5 A;  4KDP A;  3HSR A;  2X4H A;  1O7F A;  3VEP A;  1S7O A;  1HKT A;  3EQL F;  4NN1 A;  3H92 A;  4OIQ F;  1ENH A;  4XON A;  1R58 A;  3HGY A;  3HRU A;  3WU2 C;  4XMY A;  3ZMD A;  3OYB A;  3L2C A;  3GXO A;  4HNV A;  5EJC A;  1AA7 A;  1TWG J;  2DDB A;  4GFK A;  1H8A C;  4KMF A;  2KT0 A;  3D5S C;  3S8P A;  4BNC A;  1USS A;  4JKZ A;  3BOQ A;  4D7M A;  4IHS A;  2CS3 A;  3BDD A;  1U6G A;  4BGD A;  2B63 J;  2L9S A;  2R93 J;  2IGM A;  4FQG A;  2K02 A;  3BWG A;  3KLN A;  4RB1 A;  2FD5 A;  2O0Y A;  5JVT A;  4M3F A;  4NDL A;  3DBL B;  4EJW A;  3QYF A;  1DPR A;  5IYC J;  1VQL I;  1HQC A;  3CDL A;  3S2H J;  1W0U A;  5C4X J;  2X6X A;  1APL C;  1SAN A;  2EZI A;  4OIR F;  3I4P A;  1V55 H;  4P1W A;  4XLF A;  3C2B A;  3ZXS A;  4KA4 A;  4DBQ A;  2IS4 A;  2VXZ A;  3HOU J;  2KJB A;  3K2A A;  3TDU C;  3GTO J;  1BI0 A;  2GWR A;  1NH3 A;  3M3Y J;  3BZC A;  2L0K A;  5IOY A;  2G7S A;  4TV7 A;  3BJ6 A;  3KYC B;  1GT0 C;  1X1C A;  2BZT A;  1T56 A;  5ERI A;  3AKZ A;  5F0C A;  4LLG F;  3S3O A;  5J8C A;  2QKO A;  1FPQ A;  3DKW A;  1Z05 A;  3FM3 A;  3KET A;  4IRH A;  1ETX A;  5EYR A;  2WAE A;  3OL4 A;  2H09 A;  4IQ4 A;  1XC5 A;  1UG0 A;  4LIU A;  4IF4 A;  2FQ3 A;  3H9G A;  2K5C A;  3X2Q H;  3HOT A;  1YW7 A;  3KIO A;  4L5J A;  1OCR H;  3OYH A;  3HYI A;  2FBK A;  3KCC A;  2EFO A;  3G2B A;  2XF7 A;  5FLV A;  2WAQ A;  1VI0 A;  1MJA A;  4RGU A;  3ZQF A;  3K4K A;  2OER A;  4QLC U;  4BJT A;  4C2U A;  3G6E I;  5F1J A;  3BR6 A;  2EK5 A;  3E6M A;  3V7R A;  2K9N A;  5H6Q A;  4AIJ A;  3EYY A;  3BCG A;  2OPT A;  4AVZ A;  2LBF A;  2RV8 A;  3KX2 A;  5D6E A;  3SWH A;  3V8K A;  2JSP A;  1Z6R A;  2L7K A;  4Q48 A;  4NC7 A;  5AIQ A;  4GO1 A;  4O3M A;  3B6A A;  2R7Q A;  4FE7 A;  2M30 A;  4IXA A;  3S93 A;  3PUB A;  1UHS A;  2CO5 A;  2QM3 A;  4A3C J;  3DF8 A;  4XK4 A;  1XSV A;  1MH3 A;  3IRR A;  2K9S A;  2OQG A;  3VFZ A;  3HKZ A;  4NNJ A;  1SAX A;  2IAI A;  3KEY A;  3CF5 F;  2LY2 A;  2Z1D A;  4BHC A;  4CHU A;  3O3K A;  2Q0O A;  2R5Y A;  2ZY9 A;  3DPU A;  2OTJ I;  4NUB A;  3OR2 C;  1TW3 A;  1WPK A;  1ZYR F;  5HSZ A;  2KRC A;  1LJ9 A;  3DPL C;  3ULQ B;  3HB9 A;  1I6X A;  1ONV A;  1Q1V A;  3PQJ A;  4PSW A;  3CCQ I;  3S1N J;  1MBH A;  3HOW J;  5E8G A;  3FBN B;  5EF6 A;  2OJE D;  4JK1 X;  1HF0 A;  3ZPL A;  3LNQ A;  5FGM A;  2Q24 A;  4G7O F;  4DYQ A;  4MTE A;  5IY5 H;  4EM2 A;  3NS4 A;  1G3W A;  4XLH A;  2YVE A;  2WV1 A;  2DLL A;  1F1Z A;  1XD7 A;  2E2J J;  4W1U A;  3F8M A;  2M5W A;  2UV1 A;  3QOE A;  1X2N A;  4G6Q A;  2FQ4 A;  3RKW A;  4F91 B;  3MKW B;  1UI5 A;  1G59 A;  3CCV I;  2CV0 A;  4M9Z A;  3FBI B;  4MXM A;  3BTJ A;  4UY8 I;  2HR3 A;  4K2E A;  1T95 A;  2E36 A;  3K0L A;  4XLC A;  3K4J A;  3VPR A;  1VTN C;  1E2X A;  3VW1 A;  2H6C A;  3BTI A;  1VF9 A;  2DK8 A;  1R4N B;  3PNY A;  2ACJ A;  3KKD A;  3A01 A;  3WGH A;  1X1P A;  4J19 A;  4OIP F;  4D1Q A;  4UB6 C;  1DPU A;  1XGS A;  3EDP A;  4HRI A;  3FXM A;  5HLG A;  2L4M A;  4KWA A;  3TQN A;  4E7S A;  1JKO C;  2I10 A;  1Z1D A;  2CYY A;  1FTZ A;  1AWC A;  2BW3 A;  4MIM A;  4HX8 A;  1MW7 A;  2EIN H;  3GW2 A;  5GPA A;  2LMD A;  2PG4 A;  4F3Q A;  4U9L A;  4RB0 A;  4M71 A;  5EGO A;  4MEY F;  1QBJ A;  3JRF A;  2F5F A;  2V9V A;  4I7H A;  2QVO A;  4E7Z A;  2J5P A;  3OL3 A;  2NNN A;  3ABU A;  3TOB A;  3COA C;  2E5Z A;  1KGS A;  4LG3 A;  1SFX A;  1Z21 A;  3KP2 A;  3ZR8 X;  3PFI A;  4NBQ A;  3H36 A;  1WJA A;  3RQI A;  4U0W A;  1R9T J;  3BG3 A;  1W7P A;  1LVK A;  2A6H F;  4BEH A;  1JT0 A;  4JX5 A;  1IO2 A;  1MJ9 A;  2Z33 A;  2F2E A;  3LL7 A;  2QIB A;  3QQA A;  1LDJ A;  3RYP A;  3AQT A;  1XSX A;  5KNL A;  2QQ9 A;  4U0Y A;  3JRH A;  2FJ1 A;  3OSF A;  1P2F A;  3RI4 A;  3IKV A;  5DAJ A;  3RZD J;  3CLQ A;  2RNG A;  5KAI C;  6PAX A;  1W36 C;  1YOV B;  2I8D A;  1ZG3 A;  2EZL A;  2BGC A;  3G1L A;  4KUM A;  1N75 A;  4XRF A;  1YO5 C;  5CVV A;  3T6N A;  4A3E J;  5BS6 A;  5ICE A;  1JTX A;  3K70 D;  1U8R A;  1PVE A;  1T8I A;  2XAQ A;  2R5Z A;  2QQB A;  1FOX A;  2EB7 A;  3CUO A;  1OYW A;  4DIQ A;  1XS9 A;  4Z6Y A;  3E7L A;  2IT0 A;  3DPJ A;  2VI6 A;  1R71 A;  3CJQ B;  2ZFW A;  1IF1 A;  4HX4 A;  3VVZ A;  5DM6 F;  2M8E A;  2V6C A;  2JPC A;  1YFH A;  2IGO A;  3OS0 A;  1R7J A;  4GYI A;  5FRO A;  2VQC A;  3DKX A;  4N0B A;  1A6Q A;  4FX4 A;  3S17 J;  1YYV A;  1WWX A;  1CQT A;  3AG1 H;  2XAF A;  4LK0 F;  2QSG X;  3H5N A;  3PSI A;  1D1A A;  1RZ4 A;  4G6T B;  5L3C A;  3F21 A;  3IC7 A;  5AQC A;  5EFY A;  3VOD A;  2R0Q C;  2WUI A;  2CU7 A;  2M4K A;  2X85 A;  3HJE A;  5EEG A;  4G7H F;  4Z2Y A;  3ZN0 A;  5K58 A;  1K7A A;  4PJJ A;  4IHW A;  2R7S A;  5IT9 K;  1SMT A;  3OOP A;  5J8F A;  2DJI A;  3GWZ A;  1XMA A;  4FCY A;  1WKM A;  2W82 A;  3B81 A;  2DA4 A;  3J81 K;  1OPC A;  3ZCO A;  1Y0U A;  4E7H A;  2XSJ C;  3LA2 A;  1MZB A;  3DCF A;  3MKY B;  2EFW A;  2XDV A;  1W5C C;  4C3J J;  1AOY A;  2XAU A;  2LVS A;  3Q3S A;  2LSO A;  4OMZ A;  4PUS A;  3T5X A;  3H0G J;  1R5H A;  5KAF C;  3OYF A;  1VQP I;  3JR9 A;  3IH4 A;  5BPI A;  2R7U A;  4M3E A;  4XKB A;  4CIC A;  2IA2 A;  2MH2 A;  3PO2 J;  5FLX Z;  3HBL A;  4M6Y A;  4B4C A;  2IGN A;  2KKO A;  1W5T A;  2VPL A;  1YLF A;  3FXO A;  3S1R J;  3NPI A;  4UXN A;  3F8C A;  4YEL A;  1B4A A;  4BHP A;  3VOK A;  1X19 A;  2VKE A;  2QOP A;  3P9C A;  2P6T A;  3C2H A;  1K61 A;  2XAG A;  2HZD A;  1YW8 A;  2V9K A;  1BOB A;  1S5L C;  2ESH A;  2XVC A;  4HSR A;  4GCT A;  3WE3 A;  3HGG A;  2DOF A;  3GTM J;  5M5W J;  1D5V A;  5F1R A;  3V6G A;  4A12 A;  3VDX A;  2OZ6 A;  1JJ8 C;  1FBS A;  1V5G A;  2A05 A;  1S8N A;  1B59 A;  3H5R A;  3I58 A;  1YE9 A;  5CVJ A;  5LHI A;  3JRB A;  3KEO A;  2MFZ A;  2V9P A;  2M1B A;  3OIO A;  2RVC A;  4L0Y B;  5C4Y A;  2P6S A;  3FKI J;  4N9H A;  1HBX G;  5B1A H;  1T0F A;  4EGZ A;  3PM1 A;  4HQM A;  2YSR A;  2K40 A;  3E0J B;  3HTU A;  5GP9 A;  2L9R A;  4BY7 J;  1IN4 A;  3LHQ A;  1ZR2 A;  3LSM A;  3GF2 A;  2VE8 A;  4A6E A;  5ICC A;  2LY1 A;  3WTU C;  1VQM I;  3KPH A;  3K8P C;  1ZLJ A;  3GFJ A;  2KIU A;  3ZMZ A;  4UVB A;  2FOK A;  3T8T A;  1WSU A;  4GCL A;  3ONQ A;  3F1B A;  3LWJ A;  3I3L A;  1X3Z B;  4C30 A;  1PP7 U;  3CWR A;  2E1O A;  2WGB A;  2EA2 A;  3DU6 A;  1DU0 A;  3ELK A;  1MMS A;  1QGP A;  2YVH A;  4E70 A;  1D8J A;  1QVT A;  1P7J A;  5E8I A;  3TDZ C;  5JLX A;  3RDI A;  5GTH C;  2XPU A;  1ZGW A;  2FNP A;  4WX9 A;  1VQK I;  3QYB A;  5JFR A;  1T08 B;  4EJV A;  3GZI A;  2EIK H;  2B9S A;  2E71 A;  2ZO4 A;  3M1E A;  4II3 A;  2WB1 A;  5DYM A;  1ZQ3 P;  1L3L A;  1J7K A;  2W85 A;  4XKC A;  3G4S I;  2LDU A;  2A3S A;  5TJJ A;  3DV8 A;  4HG2 A;  1YIJ I;  1H0M A;  4MQ9 F;  2TDX A;  3BQY A;  1IJW C;  1VND A;  4HDU A;  4B3X A;  5A2Q Z;  3NRV A;  1GV2 A;  2RC4 A;  1UJ8 A;  2CQQ A;  2HKX A;  3HOS A;  3CP2 A;  2CSO A;  2M0M A;  3SZP A;  4B8X A;  3CCM I;  2Y9Y A;  1P9Q C;  3KP5 A;  2O6G E;  3TBI A;  2GUH A;  2A5W A;  2E7X A;  1ZGJ A;  2BHY A;  1B1B A;  2L4A A;  4ZYD A;  2JA8 J;  1E3O C;  4U9N A;  3CCR I;  4IHT A;  1BJZ A;  5LD2 C;  1IRF A;  4RM2 A;  2VBX A;  2AHQ A;  4DOZ A;  2G0E A;  3CJR B;  2W84 A;  5L3B A;  2GXB A;  1KA8 A;  4I6Z A;  2UXU A;  2HYT A;  4XOP A;  2JA7 J;  5F6F A;  2R5Y B;  5JHF A;  4XLE A;  2EIJ H;  3I4M J;  5IT9 Z;  1V5F A;  3M1C A;  3CCL I;  3HTS B;  3RD3 A;  2KL4 A;  1QZY A;  2MSY A;  2DG8 A;  2Q1Z B;  3V7C A;  2V7F A;  2H8W A;  3S3N A;  1BI2 A;  1WHU A;  2E2H J;  1IG7 A;  3J81 Z;  1TWC J;  3CME I;  2CFX A;  4XN0 A;  1WCM J;  2XIG A;  2ZKZ A;  2Z3Y A;  4PJN A;  2PMZ N;  1O3R A;  1FMW A;  1OCP A;  1SFE A;  3MMY B;  5IT3 A;  3LSG A;  4KIB A;  2GIZ A;  4LJZ F;  1ZG1 A;  3QP6 A;  4FE4 A;  4EM0 B;  3S2W A;  2RN7 A;  2HOS A;  2HKO A;  1VZ0 A;  3W2V A;  3CZ6 A;  1HW5 A;  2ZNY A;  2HOE A;  3E6D A;  2P4W A;  3JTG A;  1J9I A;  3CP8 A;  3H3U A;  4XLN F;  5C4J J;  5EEH A;  1FOY A;  3N4M A;  1QRY A;  4EV0 A;  3DU5 A;  5LHG A;  3GTQ J;  2IS6 A;  5TGT A;  1JXS A;  3Q0U A;  3FZV A;  2E1M C;  4LG0 A;  2LKX A;  1V3F A;  2DYS H;  2XGC A;  4A3D J;  1GXQ A;  2E5N A;  2GA1 A;  3DEU A;  2HXO A;  3DXJ F;  4A3J J;  2Z9O A;  3FF5 A;  1IDZ A;  5EG0 A;  2BXY A;  2VOO A;  2X48 A;  4RLQ A;  3JRC A;  5LFA A;  1O4X A;  1Y39 A;  2PQ8 A;  1W1W E;  2EV6 A;  5EGO B;  4CDG A;  1I1G A;  2FBQ A;  2FE3 A;  3FRQ A;  3DTE A;  3FX3 A;  4A69 C;  4U7B A;  3IV5 A;  5EZH A;  1YJN I;  2AQF A;  3TMO A;  2O7T A;  3Q0V A;  3TED A;  3F72 A;  1EF4 A;  3VTI A;  4AYB N;  4OOI A;  4B47 A;  2GFN A;  2EA4 A;  3NWS A;  3TOA A;  3LSR A;  1XCB A;  1X1A A;  1JTY A;  2LYC A;  1W7P B;  2LOO A;  1HKQ A;  1Y8Q B;  3P5J A;  4P9U A;  2BY0 A;  2QCO A;  3ZMS A;  4BEH B;  2R7W A;  5E17 F;  3HE0 A;  3IH3 A;  4M9S A;  3G1O A;  2RAE A;  4ETS A;  4CH7 A;  2XAJ A;  1SVO A;  2DN0 A;  3F9K A;  2NVX J;  4E7K A;  2DJN A;  5FJ8 J;  4IRG A;  2R7X A;  1RC9 A;  3ZP5 A;  1A31 A;  5FHP A;  4Q5S F;  4ENN A;  3S5R A;  4LGW A;  1IW7 F;  3ESW B;  4IZZ A;  3I53 A;  3OIQ A;  3ZQH A;  4ZZD A;  4MTD A;  4JL3 A;  3BPV A;  2NYX A;  4PCQ A;  2H1L A;  4XID A;  1XMX A;  3O8G A;  5D4R A;  3RKQ A;  1LPQ A;  1OYY A;  3RPQ A;  3L2Q A;  3WU0 A;  2E34 A;  3CQZ J;  2RGV A;  3WTT C;  2HDC A;  1T98 A;  4IRI A;  4AVP A;  4ME9 A;  3PJR A;  3TL4 X;  5DD4 A;  3QKX A;  4LK1 F;  3I56 I;  2OTL I;  1BI1 A;  3WU1 B;  3WHC A;  2HPM A;  3AFH A;  1MNE A;  3NAR A;  1W7P D;  2HU9 A;  1TP4 A;  2VJ5 A;  3EUA A;  2KPM A;  2TRT A;  1B9M A;  4KIS A;  4IOA F;  2BY2 A;  1WH5 A;  2X9D A;  5K5R A;  1W0T A;  1ETK A;  4D5C A;  2CV2 A;  1BOA A;  5F0F A;  2PEX A;  2KDZ A;  2RQP A;  5DD8 A;  4WCG A;  4IRV A;  3WHB A;  1UZC A;  5F04 A;  1NK3 P;  1IUY A;  3OR1 C;  3SQN A;  4CCJ A;  1RRJ A;  1EJ9 A;  3T0Y A;  1LEB A;  2Y30 A;  3RKX A;  1MGT A;  3WTS C;  2DQR A;  1FIA A;  4A3G J;  1AU7 A;  3DEW A;  4U88 A;  1QHG A;  2ZJQ F;  2DTR A;  2R7T A;  3CCS I;  1KQ9 A;  4B48 A;  4PK4 A;  5CVI A;  2WY7 Q;  3BRO A;  3V7S A;  1G2H A;  1OIS A;  2KHM A;  1FP2 A;  5D19 A;  3OS2 A;  1RUN A;  1MDM B;  4AIK A;  3GCM A;  3JCU C;  2DPU A;  5FKN A;  1RUO A;  3EPZ A;  2V1X A;  1NTC A;  2Y31 A;  2REK A;  4NC8 A;  2ME0 A;  2OU2 A;  2LF7 A;  3GZ5 A;  2KZV A;  3LQR A;  4R79 A;  1YRN B;  1K83 J;  3IL2 A;  2GZW A;  4CZZ A;  2QEX I;  4DVY P;  1JKP C;  3BG9 A;  4U87 A;  3LAJ A;  2OUM A;  3BPX A;  4ZC3 A;  1ZK8 A;  1P7I A;  4ESF A;  3BR0 A;  1FBU A;  4BUP A;  2EZH A;  4DGW B;  2F5D A;  5LGN A;  1V5E A;  3A02 A;  4BJ5 C;  3TP0 A;  5F0H A;  4KJZ A;  4XR6 A;  4BH9 A;  1ZRD A;  4MFD A;  3HTI A;  1QO0 D;  1FC3 A;  2VC0 A;  1Q1H A;  2V6E A;  2EZK A;  2GOM A;  3FIW A;  4NC6 A;  1XGN A;  4LMY A;  4O6J A;  1B9N A;  1X58 A;  1LEA A;  1VQ5 I;  1OR7 C;  2LLK A;  3HRS A;  3KLO A;  5D8K B;  2M45 A;  4BBS J;  4RGR A;  1XMK A;  4BQA A;  2CW8 A;  2HVS A;  4E6K G;  5E3N A;  1XCV A;  4HNU A;  3H9J A;  1ZRC A;  2XAS A;  2DA2 A;  2HYF A;  2LR8 A;  1V54 H;  2CQK A;  1XG1 A;  2VON A;  1D0X A;  1JI8 A;  4ENK A;  2G9W A;  5IP7 J;  2A61 A;  3Q9S A;  3ZRG A;  2HOT A;  3LSJ A;  3DP7 A;  1UAA A;  2NRA C;  2JA6 J;  5HLT A;  3TP3 A;  1D0Z A;  3BG5 A;  3HC7 A;  1WJD A;  1MJB A;  1GUU A;  2OZU A;  2RDP A;  2WAQ N;  3C2G A;  3CJN A;  2HQR A;  1SVL A;  3B02 A;  2L7F P;  5DCF A;  1LE8 A;  4BL0 B;  2BBY A;  3IUO A;  3GTP J;  1R23 A;  4JYK A;  2KIQ A;  5DTD A;  1A36 A;  4CXF A;  2EIM H;  3LST A;  4Q47 A;  2UXO A;  2VKD A;  3ECH A;  4C3H J;  1SC7 A;  3MCZ A;  5CLS A;  4A0Z A;  2EH3 A;  1IAW A;  4EJO A;  1JGG A;  1Y1W J;  3ECO A;  3NWT A;  3AG3 H;  3HSE A;  4Y15 A;  3ZMT A;  3CC7 I;  1P92 A;  1D3Y A;  4IL6 C;  2A6T A;  4ICH A;  2W1O A;  3SYT A;  1I6H J;  3BR5 A;  2CW7 A;  3EGQ A;  4HPQ A;  3SJM A;  2Y0S N;  1Z7U A;  3DLL F;  1IZ1 A;  4A3F J;  2VOD A;  2CH0 A;  5CXI A;  4UB8 C;  4F92 B;  4XRS A;  1N77 A;  2BV6 A;  1GDT A;  1U3E M;  4YRV A;  2CFO A;  4GCK A;  2DA7 A;  1UI6 A;  3AQS A;  3H9Q A;  4UNO A;  5FLM J;  4M3D A;  2ZB9 A;  3IH2 A;  2VT2 A;  1U5T C;  3UNG C;  4U7D A;  5FMP A;  5CJ9 A;  2NAZ A;  1A04 A;  3FMS A;  1U0J A;  4G9Y A;  4PFP A;  2DMN A;  5DV5 A;  3HXL A;  5LGT A;  4ENJ A;  2FJI 1;  4HNT A;  2J5O A;  4CZC A;  2QLZ A;  2DMT A;  2KFD A;  2PX9 A;  1R1U A;  2NVY J;  3KP4 A;  2ISY A;  2BVM A;  4HZF A;  4BS9 A;  4DYR A;  3WGG A;  2DMP A;  1RIO H;  2JTV A;  2JUC A;  2F6C A;  2NP5 A;  3OOU A;  2P5L C;  5DM7 F;  1YW9 A;  4M6V A;  3HRM A;  3D0S A;  3H3V K;  2FU4 A;  2GEN A;  1GLN A;  4GRI A;  4EAT A;  5HNF A;  3ZQC A;  2NS7 A;  2XSD C;  3ZMU A;  1YJW I;  2BE5 F;  5FLX K;  2X1C A;  1HKS A;  2FA5 A;  5K5O A;  1GV5 A;  1W4M A;  4HYE A;  3NEU A;  4L9J A;  2PBX A;  3QPS A;  2OC6 A;  2Q2E B;  1ZRF A;  1ZRE A;  4WXD A;  3IUV A;  2KLO A;  3F3X A;  2OCE A;  5IP9 J;  5D6F A;  3IWZ A;  4ACI A;  2D1H A;  4L9T A;  3KZ9 A;  3MWM A;  4OU0 A;  1Y56 A;  1O3S A;  2FNA A;  4YZE A;  1MKM A;  4KT6 A;  3OYG A;  4OIN F;  5K1Y A;  2CV1 A;  5HAW A;  1JHF A;  1BR2 A;  5DCM A;  4HOB A;  4L9N A;  4C2M J;  3C07 A;  4L62 A;  5FD6 A;  4C9Y A;  2BY1 A;  3JRD A;  5J6X A;  1OFC X;  4MFE A;  4YIR X;  4XKV A;  4LG0 B;  4Y4R A;  2M0C A;  4CCM A;  3RCO A;  3SDB A;  3KKC A;  5E20 A;  1FSH A;  1X4O A;  1QA6 A;  3HTH A;  1R1V A;  4UUT A;  2XF6 A;  1S72 I;  3A2K A;  3W2W A;  5EG0 B;  1Z67 A;  2XC7 A;  2KRH A;  5HS9 A;  5K7F A;  2Y0M A;  5LGU A;  4HX7 A;  5JHU A;  3Q9V A;  3E6C C;  2UXI A;  4AIH A;  3CCU I;  4ON0 A;  2HVR A;  1IXC A;  1B8I A;  1XPX A;  4B09 A;  3O60 A;  4HST A;  1UB9 A;  4A5N A;  2L01 A;  3OYM A;  4P96 A;  3GLL A;  2A68 F;  2JN6 A;  4IO9 F;  1ON1 A;  2XGX A;  2M87 A;  3GBG A;  5J40 A;  2JPB A;  4ZDO A;  5B66 C;  1VQ9 I;  3V42 A;  3PAS A;  2ELK A;  3SDG A;  3C1D A;  4I99 C;  4CGR A;  2FSW A;  1LVA A;  4G7Z F;  3L7W A;  3NAU A;  1PDN C;  2V1N A;  1FNN A;  2X1D A;  2MW8 A;  2EPF A;  4I02 A;  4ZDL A;  2GXG A;  3C3W A;  2EWN A;  3PNV A;  3A1Y A;  3FXL A;  1WRJ A;  3GFI A;  3WTX C;  3FXU A;  4P5O A;  3HPH A;  3VOE A;  2WAF A;  2VLA A;  4S0H B;  3HG9 A;  3BNI A;  5J4Y A;  3WE2 A;  1U5T B;  2STW A;  1ETW A;  2A6E F;  2CG4 A;  2K9L A;  4DZP A;  2BVL A;  2UWM A;  4RM3 A;  4MLO A;  1BW6 A;  1R5G A;  1X1B A;  1Z0X A;  2VB6 A;  4IHY A;  2R7O A;  4Y17 A;  2QZ8 A;  4ENM A;  3E5Q A;  4I2O A;  5A2Q K;  2HQA A;  5J47 A;  4YG2 F;  1I3A A;  5K7Z A;  2O03 A;  2CUJ A;  1R1T A;  4GYG A;  1T39 A;  2ADU A;  2N8G A;  3RQ4 A;  2F07 A;  1Y8R B;  2DYR H;  3V4G A;  3NXC A;  3V8L A;  1GVD A;  1IRZ A;  3TO7 A;  4HBL A;  1VQ4 I;  1Z9C A;  3BT9 A;  3MZ8 A;  3Q0W A;  1REP C;  2KZG A;  4RA2 A;  2L02 A;  2GM4 A;  4HF0 A;  1H9G A;  4QTR A;  1DQU A;  5D5V B;  5H9T A;  2PFV A;  3MNL A;  4UHT A;  3T1B A;  1BIB A;  4NEL A;  3VW0 A;  1JT6 A;  2LC2 A;  1YQA A;  2JSC A;  3PSF A;  3ZQI A;  1KZH A;  2E1C A;  2QBY B;  3QAH A;  3F8F A;  2QF7 A;  4DZJ A;  4UUV A;  2FML A;  4WF2 A;  2DA6 A;  2VQL A;  4N4N B;  1MDM A;  3PPB A;  4UVA A;  5GAH J;  2Y9Z A;  1YTY A;  2W25 A;  3A0H C;  3F8N A;  3DKY A;  4J01 A;  3BG6 A;  3R6S A;  1YRN A;  3H3Z A;  2DA5 A;  5LLQ A;  1X3U A;  5K7H A;  5B1B H;  4IOC F;  3RPU A;  1WVR A;  3HDD A;  4EJT A;  5JI6 A;  4LB6 B;  3TW6 A;  3IHU A;  3CUQ C;  4IVN A;  5EZG A;  3W2A A;  3KEQ A;  2YS9 A;  4RBO A;  4ESJ A;  2DBB A;  1O3T A;  4XRM A;  3GTJ J;  2DFH A;  2HOA A;  1I5Z A;  3KFW X;  3JRG A;  3QBM A;  2VQG A;  2DCE A;  2V4J C;  3FXQ A;  2Y75 A;  3VYT B;  1MBE A;  4MQV A;  3R0A A;  1NK2 P;  2KRF A;  4P9F A;  2IA1 A;  5JLW A;  4HLX A;  2K4B A;  1UHW A;  1YG2 A;  2P7V B;  4QPO A;  2DK5 A;  1CGP A;  1LFU P;  2ZNZ A;  2LNB A;  1NG7 A;  3AG4 H;  4KYW A;  2V57 A;  4Y33 A;  3IAS 2;  3UKG A;  2HEO A;  5J4V A;  2EBI A;  3FK6 A;  2CW0 F;  3WOD F;  3VP5 A;  1K6O A;  4A3K J;  2HQ5 A;  1VFC A;  3GEU A;  3ON2 A;  2XF5 A;  3AG2 H;  5HS8 A;  3D1N I;  1EV7 A;  1ZH5 A;  2HPI A;  1LUJ B;  1FYL A;  3BRU A;  2MAB A;  2F48 A;  1BN5 A;  1S7A A;  1RET A;  3HM5 A;  1Z3Y A;  2XGE A;  1UST A;  2AS5 F;  5E1X A;  4OWR B;  3SHF A;  2B1E A;  3KNW A;  1HA8 A;  2L54 A;  5HLI A;  4OD5 A;  3MVP A;  3LFK A;  1BR1 A;  1CF7 B;  2DU9 A;  2JRM A;  2OI8 A;  1QHH D;  2AO9 A;  4KIG A;  4G6D A;  4BQN A;  1VQ8 I;  3BG7 A;  3LSK A;  4M3B A;  3WG9 A;  2DA3 A;  1AHD P;  1FYM A;  4I0A A;  4B1R A;  2LF8 A;  4CCO A;  5LRR A;  3LSI A;  5E18 F;  3SFI A;  5ILV A;  2HKU A;  3F6O A;  3GZ6 A;  1LQ1 A;  2WY8 Q;  2GQQ A;  2ICW G;  5ED4 A;  3G3Z A;  2LRD A;  2NOG A;  2CUF A;  3I54 A;  3JW4 A;  4M6X A;  2CUZ A;  1BI3 A;  2R7V A;  2UXP A;  2DPD A;  2FXA A;  3OSG A;  4FTH A;  2V26 A;  2ZXW H;  1LE8 B;  4A3M J;  1ZAR A;  1K6Y A;  4D7N A;  4V19 K;  3JSO A;  2VN2 A;  1UEL B;  5DUI A;  4CUG A;  3IKT A;  2L7Z A;  2Z2S B;  1W36 D;  1EH8 A;  2G7U A;  2BHZ A;  5CVR A;  1BJA A;  4FT8 A;  4IJA A;  4CCN A;  1IRX A;  1QU3 A;  1X2M A;  2R7Z J;  4M73 A;  4XKW A;  2NS0 A;  3WG7 H;  3J7A Y;  2DDA A;  4IEJ A;  2MYS A;  2OD5 A;  1HW2 A;  4EGY A;  4LIV A;  2XRN A;  3OYN A;  5E3M A;  2H8R A;  2FRH A;  3LAP A;  4XBF A;  4AC0 A;  5GAD J;  1WJE A;  2ELJ A;  2DO7 A;  4FIS A;  4HV5 A;  5FKL A;  4NQW A;  3HPG A;  5GTI C;  3CJT B;  2XPW A;  2PJR B;  1FT9 A;  3GLX A;  3HUG A;  1FY7 A;  4EMS A;  4II2 A;  1PUE E;  1BL0 A;  2QSH X;  3LJL A;  3CUQ B;  1IUF A;  4RAF A;  1MBF A;  4XIC A;  4PGH A;  3H1C A;  1G3S A;  1JKR C;  2VQH A;  1IXS B;  3DBH B;  3L09 A;  3LSP A;  1IGN A;  4MHG A;  5FO5 A;  4YFX F;  4JX4 A;  1MBK A;  4QSH A;  5KK1 A;  2EIL H;  4UVC A;  3SEQ A;  3E97 A;  4M9X A;  3P7N A;  2EJR A;  2A69 F;  3K2Z A;  3ASO H;  1N25 A;  4ABZ A;  3KYD B;  3HOX J;  4XL9 A;  2WC2 A;  4KN7 X;  2UXX A;  3DFG A;  1KU2 A;  5ILU A;  3AL0 C;  1TWF J;  3G56 A;  4MEX F;  1F4K A;  3W6J B;  2M2E A;  1JGS A;  2W53 A;  3ZMV A;  1OR7 A;  2OBP A;  2ZME C;  3Q5F A;  3HTA A;  2EFP A;  3ZQ7 A;  3JSP A;  4A0Y A;  3OIP A;  3JAM Z;  3ERE D;  3ASN H;  1T38 A;  3WTW C;  4AWX B;  2DXI A;  1OJL A;  2BOL A;  2EQR A;  2XB0 X;  2Q2E A;  3REO A;  2IBD A;  4JNN A;  3BY6 A;  2PZ9 A;  3KP3 A;  3OYC A;  3I71 A;  2ECC A;  3K1N A;  1R6R A;  2QWW A;  1SD5 A;  4OD4 A;  2HWV A;  2QQ8 A;  4D5F A;  2B0L A;  3UR3 C;  3L1P A;  3QOD A;  4Y3O A;  3CCE I;  2IS2 A;  4RB2 C;  2COB A;  1ZAO A;  2IA0 A;  2MLK A;  4Y13 A;  1XN7 A;  1IV6 A;  2ZCX A;  2DOD A;  4G8X A;  4CCL A;  2ZXI A;  1ZG5 A;  3K10 A;  2YU3 A;  2YPR A;  3EUP A;  3BTL A;  4D9J A;  1VQ6 I;  3A0B C;  5J1Y A;  4RDU A;  2XGD A;  1MSF C;  1IN6 A;  1HC8 A;  3BJA A;  2OQR A;  2Z99 A;  1V4R A;  3MEX A;  2K85 A;  5DCM B;  1TT5 B;  2Z16 A;  4ITV A;  2F5C A;  1HSJ A;  3NQO A;  4GFL A;  4L0Z B;  2M9H A;  1JHH A;  4A3I J;  2X6Y A;  3DQV C;  2DMU A;  2A2F X;  2K7L A;  3JSJ A;  5IPA A;  3P9I A;  2Y48 A;  4OAY A;  4XN3 A;  3TO9 A;  1WFX A;  3BR2 A;  3VIB A;  3MN2 A;  1NHA A;  5KVR A;  3F22 A;  3J7Y J;  1FSE A;  1RNL A;  2IS1 A;  4G94 A;  1J0R A;  2NP3 A;  3NNR A;  1QNT A;  2LRE A;  3PO3 J;  1B8I B;  3WGI A;  5GPC A;  2NXN B;  4AD9 A;  1XB4 A;  1TT0 A;  5FRM A;  3U2R A;  4HAM A;  3HL2 A;  1OCO H;  1SMY F;  1I3Q J;  2L7M P;  4ESB A;  2BYV E;  4IPA A;  1K4S A;  4WXC A;  3U21 A;  1TQM A;  4XOT A;  2O5R A;  3V78 A;  4MO7 A;  5HDK A;  2OV7 A;  1YX3 A;  1QZE A;  2JMW A;  3F23 A;  5AIP A;  4AYB A;  2PJP A;  4S05 A;  4RS8 A;  1ETO A;  3HZJ A;  4BQO A;  1KU3 A;  3U1D A;  4C3I J;  1OYI A;  1U5T A;  1ZKG A;  2IEK A;  3K4L A;  3RIR A;  3MFK A;  4BDY A;  1HDP A;  1YHQ I;  3RTR A;  4MGR A;  1DDN A;  2NS8 A;  3T8R A;  5D18 A;  3L2W A;  3GTK J;  4EEF G;  1U9O A;  3U9G A;  4AU7 A;  2VL8 A;  2DFF A;  2PLY A;  4JBA A;  1KQ0 A;  1UCR A;  1YIO A;  1LKX A;  3EUH C;  3F8B A;  2RQQ A;  3S3M A;  1D8K A;  2OAZ A;  2D2W A;  4YEJ A;  4PSX A;  3CC2 I;  2HVQ A;  3ABT A;  4GXO A;  3HEF A;  5FB2 A;  5F64 A;  2H27 A;  4XNF A;  1N78 A;  3HIM A;  2AQE A;  4UV9 A;  2QEN A;  4DW6 A;  3AL0 B;  1MMA A;  3GEZ A;  2OA4 A;  1G4D A;  3M9A A;  1ITY A;  3VVY A;  3QPH A;  2LTP A;  4LLN A;  2W24 A;  4KIC A;  2L9N A;  1YS7 A;  2GXA A;  4F52 A;  3D5R C;  3BJB A;  3IWF A;  2QBY A;  3JTH A;  1SD6 A;  2H6B A;  2R7D A;  4HF2 A;  2YU9 J;  2W48 A;  1MMD A;  2LD5 A;  2HTJ A;  2STT A;  4KFC A;  1GXP A;  2E2I J;  4RAY A;  2CUE A;  2XPV A;  1JUP A;  2DAO A;  1WJC A;  2HZT A;  4Y7N J;  1E3P A;  3PIO F;  1ON2 A;  3VB2 A;  1FEX A;  2K3P A;  2X1E A;  1RI7 A;  3M07 A;  2E1M B;  1XDS A;  4XQF A;  1S3J A;  2KIS A;  4GFB A;  5GAG J;  2B7E A;  2HYJ A;  1KYW A;  2VBW A;  3PFY A;  3OYL A;  3FDY A;  3OS1 A;  2HGC A;  3KZZ A;  5BQT A;  1TNS A;  1HW1 A;  4YFK F;  3GX4 X;  1T6S A;  2QSF X;  2ID3 A;  4HF1 A;  1G8X A;  3MKL A;  2WA0 A;  4W97 A;  5L3E A;  5TIS C;  3DLA A;  1MNM C;  2ME6 A;  2GLO A;  2IPQ X;  4ZDP A;  2LK2 A;  2AXT C;  5E1W A;  4A93 J;  1E17 A;  5FFZ A;  2P81 A;  5IP6 A;  1RR8 C;  3ABM H;  1TC3 C;  1J2X A;  4AM3 A;  1EH6 A;  4I09 A;  3F6V A;  2V1D A;  4QIW N;  3B73 A;  2GA2 A;  3J80 Z;  1BR4 A;  1LDK B;  4H4K C;  4C2T A;  2DOE A;  2F5V A;  2W57 A;  1B72 A;  2GOX B;  1DU6 A;  3BR1 A;  4FAS D;  4ZH4 F;  4RMN A;  1ORK A;  3BC8 A;  4ZYE A;  2IW5 A;  5CPR B;  1QPI A;  5D4S A;  2R7R A;  1STZ A;  1A5J A;  2UXN A;  2VAS A;  5CQG A;  3RPU D;  2DMQ A;  5J1U A;  2Y69 H;  1VQN I;  1UHM A;  3QPT A;  1TW2 A;  3GME A;  3BTC A;  1CF7 A;  2L3D A;  4CYC A;  1S29 A;  5CYV A;  5B3S H;  1ZLK A;  5E3O A;  3DEE A;  2PMU A;  2HDD A;  5LEJ A;  5DS9 A;  3JRA A;  2BY3 A;  3BLY A;  4JQF A;  2XAH A;  2WBM A;  3R0J A;  2RNJ A;  2G3B A;  2DT6 A;  2CJJ A;  1ZTR A;  3M8F A;  2D6Y A;  1BM9 A;  2IGK A;  1ZN2 A;  3ANG A;  1EH7 A;  4IHV A;  1WI9 A;  3ABK H;  2VJJ A;  4CGZ A;  1TLH B;  1R5I D;  2F5E A;  2KP6 A;  4FET A;  5TRD A;  3A03 A;  2QQA A;  3CRJ A;  3J7Z I;  2CGP A;  4ZJZ A;  2R92 J;  1D1B A;  1YI2 I;  1A6I A;  1DP7 P;  2MBF A;  2MD0 A;  2XDN A;  2JVH A;  4DYC A;  2AXL A;  3L2R A;  5BNG A;  1I1S A;  3OYI A;  2HXI A;  3FK7 A;  1SFU A;  4G12 A;  1YJ9 I;  2CMP A;  3QU6 A;  3K70 C;  4XRS G;  1LNW A;  3E1S A;  3GTG J;  3FXK A;  3E3V A;  3G1M A;  1FOW A;  4BBR J;  1IN7 A;  3L00 A;  4KN4 X;  4UDS A;  2VE9 A;  4BE1 A;  5DDG A;  5ICG A;  1MH4 A;  2ZCM A;  2KIF A;  5HDG A;  1D1C A;  3RKY A;  2CQN A;  2M3A A;  3GO5 A;  4BXF A;  4B44 A;  4UUS A;  3MKZ A;  3S1Q J;  2PJR A;  5FKO A;  2XB5 A;  4GCV A;  3GZN B;  2LY9 A;  3FXJ A;  4UV8 A;  3CMM A;  3TW7 A;  3VSK A;  3C18 A;  2X0L A;  1TZL A;  3TKY A;  1MMG A;  3CUQ A;  1RPW A;  5HVQ C;  3HKZ N;  1NG6 A;  5L3F A;  3OYA A;  4S04 A;  1OCT C;  3S14 J;  3PIP F;  4NQW B;  3RZO J;  2RHA A;  4A0X A;  4JP0 A;  3HUG B;  4ZYH A;  3N97 A;  2JT1 A;  1AKH A;  1H9T A;  1OMI A;  1GHC A;  4BXU A;  1E0E A;  2PMH A;  2FX0 A;  2Y0S A;  3OYK A;  3M8J A;  1QVU A;  5BMZ A;  3KYL A;  4HW0 A;  2RAS A;  1FX7 A;  2YX4 A;  4DQ2 A;  2VJI A;  4BQQ A;  2JWT A;  5D5X B;  2G7G A;  1J75 A;  1K79 A;  3E5X A;  4U0V A;  1G6N A;  4I98 B;  2HFH A;  2ELH A;  3HTJ A; 
#chains in the Genus database with same CATH homology
 2QF7 A;  3I4M J;  4DZJ A;  2DA6 A;  3RD3 A;  4B3A A;  3CMY A;  5HOD A;  1RKT A;  2MSY A;  2DG8 A;  3PPB A;  2Y9Z A;  1WH7 A;  2E2H J;  1IG7 A;  1FTT A;  1YRN A;  1T33 A;  1TWC J;  2DA5 A;  5K7H A;  3BQZ A;  5M5Y J;  2G7L A;  3HDD A;  1WCM J;  3TW6 A;  5M5X J;  2PMZ N;  5EZG A;  1HLV A;  1OCP A;  2YS9 A;  4RBO A;  3LSG A;  4XRM A;  3GTJ J;  5D1R A;  2HOA A;  1TWA J;  3JRG A;  3QBM A;  1MBJ A;  2H1K A;  1RKW A;  3LOC A;  2TCT A;  4FE4 A;  3M4O J;  1MBE A;  1RES A;  1NK2 P;  2HOS A;  3CWR A;  3QPL A;  5JLW A;  4NN1 A;  1ENH A;  1LFU P;  3HGY A;  2V57 A;  4HNV A;  5C4J J;  1TWG J;  3UKG A;  4GFK A;  1H8A C;  4L5E A;  3K7A J;  1QRY A;  2KT0 A;  3HOY J;  3GTQ J;  2EBI A;  5FKK A;  3FK6 A;  4JKZ A;  3Q0U A;  4D7M A;  3S2D J;  3VP5 A;  2B63 J;  2R93 J;  2VPR A;  4A3K J;  2HQ5 A;  2CRG A;  3ZQG A;  2Y2Z A;  2LKX A;  1VFC A;  3GEU A;  3ON2 A;  2FD5 A;  2E19 A;  2XGC A;  5C3E J;  4A3D J;  3VOX A;  4M3F A;  4NDL A;  5IYC J;  2ZOZ A;  3D1N I;  2HXO A;  4A3J J;  3CDL A;  3S2H J;  1W0U A;  5C4X J;  1IDZ A;  5EG0 A;  3BRU A;  2X48 A;  1APL C;  3JRC A;  9ANT A;  1WI3 A;  2ZOY A;  1O4X A;  1I50 J;  1SAN A;  2EZI A;  1RET A;  3HM5 A;  5EGO B;  2XGE A;  3C2B A;  2FBQ A;  3FRQ A;  3HOU J;  4A69 C;  3K2A A;  5HBU A;  3KNW A;  3IV5 A;  3GTO J;  5EZH A;  3M3Y J;  2G7S A;  2L0K A;  5IOY A;  2O7T A;  3Q0V A;  3MVP A;  3TED A;  1HDD C;  1EF4 A;  4AYB N;  2GFN A;  2YUS A;  2K9Q A;  1GT0 C;  2OI8 A;  2AO9 A;  1T56 A;  3LSR A;  3S15 J;  2DTZ A;  4M3B A;  1JTY A;  5F0C A;  2DA3 A;  1AHD P;  2IU5 A;  3GTL J;  4B1R A;  2QKO A;  2QCO A;  3HE0 A;  3SFI A;  3IH3 A;  1HOM A;  2HKU A;  3G1O A;  2RAE A;  1ETX A;  2CQX A;  1RR7 A;  1F43 A;  4LOC A;  5EYR A;  2M34 A;  1XC5 A;  2DN0 A;  2NVX J;  2NOG A;  2CUF A;  2DJN A;  5FJ8 J;  2UXP A;  3OSG A;  4FTH A;  1LE8 B;  4A3M J;  5FHP A;  4D7N A;  3ON4 A;  3S5R A;  3JRE A;  5FLV A;  1VI0 A;  3ZQH A;  4JL3 A;  3ZQF A;  1JJ6 C;  2OER A;  2L7Z A;  4XID A;  3O8G A;  5F1J A;  3BR6 A;  3RKQ A;  3P9T A;  3CQZ J;  2K9N A;  2ID6 A;  1PUF A;  1X2M A;  2R7Z J;  3BCG A;  1F36 A;  2OPT A;  4IEJ A;  4ME9 A;  5E3M A;  2H8R A;  3QKX A;  4AC0 A;  3WHC A;  3B6A A;  4FIS A;  5FKL A;  3NAR A;  4FE7 A;  2XPW A;  2TRT A;  1UHS A;  1BL0 A;  1WH5 A;  2X9D A;  3LJL A;  1W0T A;  3COL A;  1ETK A;  4D5C A;  4A3C J;  5F0F A;  1IUF A;  2KDZ A;  1MBF A;  4XK4 A;  4XIC A;  1MH3 A;  2K9S A;  1JKR C;  3WHB A;  5F04 A;  3LSP A;  1IGN A;  4JX4 A;  1NK3 P;  1MBK A;  4QSH A;  2O7O A;  5F08 A;  2IAI A;  3NI7 A;  2Y30 A;  2R5Y A;  3O8H A;  1FIA A;  4ABZ A;  4A3G J;  1AU7 A;  1WPK A;  3HOX J;  5HSZ A;  3DEW A;  1TWF J;  3G56 A;  3HB9 A;  1Q1V A;  3S1N J;  2M2E A;  1H88 C;  1MBH A;  2W53 A;  1G2H A;  3VVX A;  3HOW J;  5D19 A;  3HTA A;  5EF6 A;  1HF0 A;  3BR3 A;  3BHQ A;  4JX6 A;  5FKN A;  3LNQ A;  1NTC A;  2Y31 A;  2Q24 A;  2REK A;  3S16 J;  2O8K A;  2ME0 A;  4DYQ A;  1YRN B;  4Y52 J;  1OJL A;  1K83 J;  2EQR A;  2XB0 X;  4V2F A;  2IBD A;  2YVE A;  2PZ9 A;  2WV1 A;  3BG9 A;  1JKP C;  4JNN A;  2E2J J;  2ECC A;  4W1U A;  1BW5 A;  3E7Q A;  1X2N A;  2FQ4 A;  1UI5 A;  4D5F A;  3L1P A;  5FKM A;  1ZK8 A;  1P7I A;  2COB A;  3BR0 A;  4MXM A;  3BTJ A;  1IV6 A;  2ZCX A;  2EZH A;  3VPR A;  4HKU A;  3A02 A;  3TP0 A;  5F0H A;  3EUP A;  3VW1 A;  3BTL A;  4IHX A;  3BTI A;  4MFD A;  1VF9 A;  5J1Y A;  3HTI A;  4RDU A;  2XGD A;  1MSF C;  3KKD A;  2EZK A;  3FIW A;  3A01 A;  4J19 A;  3ZQL A;  4GFL A;  1B72 B;  1X58 A;  2M9H A;  5F27 A;  2LLK A;  4A3I J;  4KWA A;  1JKO C;  2DMU A;  2I10 A;  4BBS J;  1FTZ A;  4MIM A;  3JSJ A;  5IPA A;  2DG7 A;  5E3N A;  5CW8 A;  5GPA A;  2O9L A;  2DA2 A;  5EGO A;  3BR2 A;  3VIB A;  3MN2 A;  2LR8 A;  3JRF A;  1XG1 A;  4CYC B;  2NP3 A;  3NNR A;  2JJ7 A;  3PO3 J;  1B8I B;  5IP7 J;  1SFO J;  5GPC A;  4BXX J;  3VUQ A;  2HOT A;  5J1R A;  3LSJ A;  3RQI A;  1R9T J;  3BG3 A;  1I3Q J;  2JA6 J;  2L7M P;  1SGM A;  2DA1 A;  3TP3 A;  1JT0 A;  3BG5 A;  2MGQ A;  4JX5 A;  2WB1 N;  3V78 A;  4MO7 A;  1GUU A;  3HOV J;  2JMW A;  2QIB A;  2WAQ N;  3QQA A;  2ZCN A;  3AQT A;  5IOZ A;  2L7F P;  4BKX A;  2FJ1 A;  3JRH A;  1ETO A;  3OSF A;  1LE8 A;  3GTP J;  5DAJ A;  3RZD J;  4C3I J;  3W6V A;  1ZKG A;  2IEK A;  2VKV A;  4JYK A;  1HDP A;  5DTD A;  2UXO A;  2NS8 A;  5D18 A;  2LP0 A;  4C3H J;  3GTK J;  3NRG A;  4EEF G;  2EZL A;  1U9O A;  3G1L A;  2EH3 A;  1JGG A;  2HI3 A;  1Y1W J;  3T6N A;  4A3E J;  3JRI A;  1JTX A;  2R5Z A;  4ICH A;  1I6H J;  3BR5 A;  3EGQ A;  3FIS A;  1XS9 A;  3E7L A;  3SJM A;  3DPJ A;  1ETV A;  2VI6 A;  3HEF A;  2Y0S N;  4UUS B;  3VVZ A;  3HIM A;  4A3F J;  4DW6 A;  2ECB A;  5J3L A;  3F0C A;  3S17 J;  5CXI A;  3B6C A;  3ZOB A;  1CQT A;  4XRS A;  4A3L J;  1ITY A;  3VVY A;  1GDT A;  2LTP A;  2NVT J;  4GCK A;  2DA7 A;  1UI6 A;  1ZR4 A;  3AQS A;  1H89 C;  5FLM J;  4AF5 A;  2D5V A;  4M3D A;  2ZB9 A;  3IH2 A;  4AUX A;  1AKH B;  2QTQ A;  5M3F J;  3BJB A;  5FMP A;  2YU9 J;  2W48 A;  2LD5 A;  5IYB J;  2DMN A;  5AQC A;  5EFY A;  2R0Q C;  1BA5 A;  2E2I J;  2WUI A;  2CU7 A;  2CUE A;  2DMT A;  1JUP A;  2XPV A;  2MG4 A;  2VUM J;  3I4N J;  4Y7N J;  5K58 A;  5EEA A;  2NVY J;  4IHW A;  1FEX A;  4DYR A;  2DMP A;  4FCY A;  1UMQ A;  2NP5 A;  3OOU A;  4GFB A;  2HYJ A;  3B81 A;  2DA4 A;  5IYD J;  1U78 A;  4M6V A;  3CJD A;  1JKQ C;  3DCF A;  3H3V K;  4C3J J;  2GEN A;  2QWT A;  3ZQC A;  2LVS A;  2NS7 A;  3Q3S A;  1Z77 A;  3H0G J;  1S7E A;  2ID3 A;  2XSD C;  3JR9 A;  3IH4 A;  3MKL A;  4W97 A;  4M3E A;  1MNM C;  1GV5 A;  2ME6 A;  2GLO A;  3PO2 J;  3HBL A;  2LK2 A;  2PBX A;  1TWH J;  4A93 J;  3QPS A;  4B4C A;  3IUV A;  2P81 A;  5IP6 A;  5IP9 J;  3S1R J;  1IC8 A;  4I76 A;  3NPI A;  4ACI A;  1TC3 C;  3KZ9 A;  2OF7 A;  4YZE A;  4QIW N;  4V2G A;  5C44 J;  3VOK A;  2VKE A;  2NX4 A;  2QOP A;  4PXI A;  5HAW A;  4X6A J;  1K61 A;  4C2M J;  3C07 A;  4L62 A;  3S1M J;  3ANP A;  4GCT A;  3JRD A;  3HGG A;  1B72 A;  1OFC X;  3CCY A;  4MFE A;  5M5W J;  3GTM J;  2LFB A;  1DU6 A;  3V6G A;  2M0C A;  3BR1 A;  3KKC A;  1ORK A;  3A01 B;  1JJ8 C;  1QPI A;  3HTH A;  4UUT A;  1A5J A;  3JRB A;  2XRL A;  2DMQ A;  5EG0 B;  3OIO A;  5J1U A;  5K7F A;  1LFB A;  3FKI J;  5C4Y A;  1U9N A;  3BTC A;  3PM1 A;  2UXI A;  4CYC A;  5EDN A;  2K40 A;  4X1E A;  5GP9 A;  4BY7 J;  2L9R A;  1B8I A;  3LHQ A;  5E3O A;  3O60 A;  1ZR2 A;  2HDD A;  2M8G X;  5DS9 A;  3JRA A;  1ETY A;  1MBG A;  1MSE C;  2JN6 A;  4GCL A;  3GBG A;  2G3B A;  3F1B A;  2CJJ A;  1ZTR A;  1HCR A;  2JA5 J;  2D6Y A;  3LWJ A;  3PAS A;  2E1O A;  3ANG A;  4IHV A;  2WGB A;  2ELK A;  3SDG A;  1DU0 A;  4CGR A;  3NAU A;  1POG A;  2YVH A;  3G7R A;  3A03 A;  2MW8 A;  1JUS A;  1QVT A;  3CRJ A;  1P7J A;  5JLX A;  2XPU A;  2UXH A;  1ZGW A;  2NVQ J;  2R92 J;  1A6I A;  1ETQ A;  5FGL A;  2XDN A;  4DYC A;  3GZI A;  5BNG A;  2HXI A;  3FK7 A;  1FJL A;  3HOZ J;  4S0H B;  4G12 A;  3BNI A;  1ZQ3 P;  4XRS G;  3GTG J;  3G1M A;  1ETW A;  4BBR J;  1Y1V J;  4DZP A;  4UDS A;  1D5Y A;  4MLO A;  1BW6 A;  1MH4 A;  1Z0X A;  2ZCM A;  1WGX A;  4IHY A;  4A3B J;  5E3L A;  1PUF B;  3BQY A;  1IJW C;  1VND A;  4UUS A;  3S1Q J;  2JK3 A;  5FKO A;  5K7Z A;  1GV2 A;  2XB5 A;  4MK6 A;  2LY9 A;  2R5Z B;  3TW7 A;  2N8G A;  2F07 A;  1FIP A;  3NXC A;  1RPW A;  2CQQ A;  3HKZ N;  1OCT C;  3S14 J;  1GVD A;  1IRZ A;  3RZO J;  2Y9Y A;  3BT9 A;  2RHA A;  4JP0 A;  1IDY A;  4BY1 J;  2GUH A;  4M3G A;  2GBY A;  3Q0W A;  1AKH A;  1U8B A;  2JA8 J;  1E3O C;  4AC6 A;  2FX0 A;  1JUM A;  2GM4 A;  1QVU A;  5CXG A;  2X6O A;  4QTR A;  1BJZ A;  2RAS A;  5H9T A;  2AHQ A;  2G0E A;  2JWT A;  5M3M J;  4I6Z A;  2G7G A;  2UXU A;  3MNL A;  4NEL A;  2HYT A;  1UG2 A;  3VW0 A;  1JT6 A;  3ZQI A;  2JA7 J;  3VW2 A;  2R5Y B;  3RH2 A;  3HTJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...