2DTZA

Crystal structure of multidrug binding protein qacr from staphylococcus aureus cocrystallized with compound db75
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
186
structure length
186
Chain Sequence
NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKKEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Multidrug-Binding Transcription Factor QacR Binds the Bivalent Aromatic Diamidines DB75 and DB359 in Multiple Positions
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription
molecule keywords HTH-type transcriptional regulator qacR
total genus 76
structure length 186
sequence length 186
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2006-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2dtzA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2dtzA02
2JA6J 2M0CA 1MBGA 2XSDC 3ON4A 3BTLA 1QRYA 2ECCA 3RKQA 1YRNB 4S0HB 3S2DJ 3BHQA 3HKZN 1OCPA 1JUPA 1JTXA 2M34A 3A01B 3HTJA 5HAWA 1WGXA 1JUMA 3QKXA 4GCKA 2DTZA 1GV2A 3G1MA 4XICA 1JJ6C 5D19A 1LFUP 2HXOA 2K9QA 5JLXA 5M5XJ 4XRMA 2LK2A 2HQ5A 5EZHA 1ZQ3P 5FJ8J 2E2IJ 5IOZA 3S17J 3S1QJ 1AKHB 3ZQFA 3VUQA 1OCTC 1H88C 2MGQA 4A3EJ 1F36A 2R0QC 1BA5A 2Y31A 5M3FJ 1R9TJ 2TCTA 4HNVA 4ME9A 2H8RA 2LP0A 2KDZA 3D1NI 1P7IA 1H89C 1NK3P 1GUUA 1JKPC 2ZB9A 4CYCB 2Y30A 3S1RJ 2XRLA 5AQCA 4RBOA 1ENHA 1PUFA 1XS9A 2JWTA 1MBFA 1LE8B 2EBIA 2LY9A 2OPTA 2ME6A 4D7MA 5HODA 4MXMA 3JRIA 4X1EA 1VNDA 2R5ZA 2LLKA 2WB1N 3IUVA 3QPLA 5EYRA 3RZOJ 3GTKJ 4NDLA 4B4CA 2YVHA 1ZK8A 5FLVA 3BQZA 2DJNA 2FD5A 3HTHA 2GLOA 5C44J 3L1PA 3GTQJ 4XK4A 1ZTRA 3ZQIA 1OJLA 4FE7A 5IPAA 3GEUA 1K61A 1ZR4A 3RQIA 2DA7A 3MVPA 2NS7A 1ETXA 3V6GA 3JRHA 4PXIA 2CRGA 2R5YB 3LOCA 2JA8J 2LVSA 2R93J 3W6VA 2HXIA 2DA2A 2QF7A 3FIWA 9ANTA 2R92J 3JRFA 1RESA 3NPIA 4A3MJ 3G1OA 3ZQCA 3VVYA 3K2AA 3LSGA 1U9NA 1BJZA 2G7GA 1UHSA 1ZR2A 1SGMA 2ZCMA 1QPIA 3A03A 2PBXA 3GTPJ 2O7TA 2JA7J 1D5YA 1VF9A 2F07A 4XIDA 4BY1J 3VP5A 1HDPA 1ETQA 3G1LA 3PM1A 3VW2A 1CQTA 1HF0A 5EEAA 2IBDA 1XG1A 3H0GJ 3FISA 4DYCA 3JREA 4IHVA 5DAJA 4JX6A 2MW8A 4KWAA 5GPAA 3PASA 5EDNA 3BNIA 4IEJA 4QSHA 1POGA 3BJBA 2WV1A 3JRBA 2V57A 4D7NA 2L0KA 3GTGJ 1Z77A 1JJ8C 3F1BA 4I76A 1UMQA 2ID3A 2YUSA 1JTYA 2QCOA 2VKEA 5DTDA 4Y7NJ 4UUSB 4JNNA 3PPBA 2E19A 3QPSA 1RKTA 1JUSA 5K7FA 2NVQJ 2GUHA 5F08A 3LNQA 2GFNA 1JKQC 4V2GA 4RDUA 3EUPA 4C3JJ 3TEDA 2E2JJ 4A3KJ 3A02A 3WHBA 4FISA 3OIOA 2G3BA 1TWCJ 3EGQA 3BTCA 4M3EA 1T33A 1ETVA 3FKIJ 5BNGA 5F04A 3BQYA 2HOAA 3HOXJ 4DZJA 3I4MJ 2QOPA 1BL0A 3FRQA 1MNMC 5M5WJ 3NNRA 2NVTJ 3S1MJ 4C3IJ 2ID6A 4QIWN 3LSRA 3JR9A 4MLOA 2Y2ZA 5F0HA 4FCYA 5C3EJ 1A5JA 4B1RA 1DU6A 1NTCA 1MH3A 1U8BA 3O60A 3ON2A 4UDSA 5JLWA 1TWFJ 2W53A 1ORKA 4M3BA 1B8IA 1PUFB 5IP6A 3JRAA 1OFCX 4IHYA 1WPKA 1ETKA 3IH2A 2O7OA 3BTJA 1APLC 5J1YA 3S14J 2L7MP 2XPVA 4YZEA 2YS9A 2L7FP 5F0FA 2XDNA 4MFDA 3S1NJ 1F43A 3NXCA 5IYCJ 2ZCNA 3UKGA 2FJ1A 1IV6A 3S5RA 4JX4A 1MH4A 2OERA 4UUTA 3CJDA 3M3YJ 3ANPA 2FQ4A 1FJLA 3B81A 2HYTA 4I6ZA 2GBYA 5E3OA 3S2HJ 3TP0A 4A3IJ 5FKMA 1IC8A 1VI0A 3VOKA 2L9RA 4MIMA 3CMYA 3E7QA 4FTHA 3HOYJ 4AC6A 3B6AA 2DA6A 5K7ZA 3ZQHA 4JKZA 5FKKA 5IP9J 3SJMA 1GV5A 2CJJA 3ANGA 3TW7A 3M4OJ 3G56A 4MK6A 4JX5A 1B72B 2XB5A 3K7AJ 2PZ9A 4B3AA 2AO9A 2NS8A 3GBGA 3OSFA 3VVZA 1HOMA 3GTLJ 4BKXA 2AHQA 2VI6A 2COBA 2E1OA 2B63J 1ITYA 2Q24A 3KKCA 4A3LJ 4J19A 1UI5A 2H1KA 1VFCA 2UXIA 1P7JA 4V2FA 3HOZJ 2DMUA 4W1UA 5IOYA 1I6HJ 3HIMA 1WCMJ 1X2NA 3QQAA 4L62A 1RR7A 1U78A 1TWHJ 1B72A 1W0UA 2EZIA 5FGLA 1X2MA 4A3CJ 2VUMJ 3F0CA 1I3QJ 5M3MJ 2E2HJ 2O8KA 3JRGA 2NVXJ 3HDDA 3KNWA 2Y9YA 1IDZA 4UUSA 3MN2A 2DG8A 5HSZA 5FKOA 4AC0A 3CCYA 1O4XA 1FIPA 1NK2P 5E3LA 1JGGA 1MBJA 1WI3A 2ZCXA 4M6VA 4XRSA 2JK3A 2CQQA 2IEKA 2OF7A 2QIBA 2JJ7A 1HDDC 3NARA 5FLMJ 2M9HA 2WAQN 1LFBA 3OOUA 1SFOJ 2HYJA 1Y1VJ 3LSJA 2XPWA 3COLA 2HOSA 2CUEA 3IH3A 4C2MJ 4BBRJ 5E3MA 2G0EA 2LR8A 5GP9A 5EZGA 3HEFA 2R5YA 4CYCA 1FTZA 2HKUA 1JT0A 4A69C 1W0TA 2VPRA 3LSPA 1LE8A 3RD3A 2DMPA 2K40A 2GM4A 1WH5A 1X58A 2YU9J 1RETA 3LJLA 3V78A 2DN0A 3DCFA 3ZQLA 3ZQGA 2CQXA 4A3JJ 4GCTA 4Y52J 3I4NJ 2IAIA 4GFBA 4AF5A 1BW5A 2O9LA 3BR6A 3CDLA 1HCRA 4EEFG 4GFKA 3CRJA 2MSYA 3E7LA 2XPUA 4MO7A 2R5ZB 4M3FA 4C3HJ 3IV5A 3Q0WA 4IHXA 5CW8A 2NVYJ 3ZOBA 3C07A 1GVDA 1FTTA 1JT6A 3GTMJ 5E3NA 5J1UA 3HOWJ 5FHPA 1TWAJ 3S16J 1ETYA 2HOTA 3BTIA 2R7ZJ 3DEWA 3IH4A 3GTOJ 4M3GA 2EZKA 3Q0UA 2RAEA 4AYBN 5D1RA 5IYDJ 2M2EA 1ZKGA 3FK7A 2DMQA 3SFIA 4A3FJ 2ZOZA 3VW1A 1IJWC 1WH7A 5D18A 2PMZN 5CXIA 4ACIA 1MBEA 3BT9A 4GCLA 4DZPA 4M3DA 2XGCA 4HKUA 3VW0A 3HM5A 3S15J 2LD5A 2UXUA 1YRNA 3B6CA 2X9DA 1DU0A 4D5FA 2TRTA 4XRSG 3BR2A 4LOCA 5M5YJ 4A3GJ 1G2HA 3C2BA 4CGRA 2DA5A 1GT0C 1GDTA 2JN6A 5K7HA 2K9SA 3BG3A 2DG7A 2IU5A 4QTRA 2MG4A 2GENA 3HB9A 1B8IB 2JMWA 2VKVA 3VIBA 4ABZA 2YVEA 2WGBA 5EFYA 1MBHA 2XGDA 4BY7J 5GPCA 1IDYA 2UXPA 1IUFA 3JRCA 4ICHA 1T56A 1SANA 3VOXA 1HLVA 1AU7A 3BR5A 3Q3SA 4NN1A 5C4JJ 2RHAA 1K83J 3VPRA 1Y1WJ 2XGEA 4DYRA 3HTAA 3KZ9A 1FIAA 3HGGA 3OSGA 1IGNA 2FBQA 2G7SA 3NRGA 3DPJA 4L5EA 3PO2J 4NELA 3T6NA 2L7ZA 1QVUA 4FE4A 5IP7J 3H3VK 3AQSA 3BG5A 4DW6A 2QTQA 2ZOYA 2NOGA 5J3LA 3KKDA 4A93J 3AQTA 5C4YA 1H8AC 3CQZJ 2N8GA 2KT0A 3O8GA 2XB0X 3BR0A 4IHWA 5H9TA 3HTIA 5EF6A 1QVTA 1UG2A 4BBSJ 5F1JA 3TP3A 2DA4A 1FEXA 4JL3A 3BR3A 2D5VA 4G12A 4X6AJ 2LFBA 2M8GX 3GTJJ 3MKLA 2WUIA 2LKXA 4MFEA 2UXHA 4W97A 3A01A 1BW6A 5FKLA 4JYKA 1A6IA 3HOUJ 2P81A 1AHDP 5C4XJ 1UI6A 3JSJA 3G7RA 2NX4A 4AUXA 1MSFC 3BR1A 2DA1A 2FX0A 3P9TA 2RASA 1EF4A 2ME0A 5FMPA 1Q1VA 3SDGA 3GZIA 3MNLA 1E3OC 3TW6A 1JKRC 2EZHA 1IG7A 2K9NA 1ZGWA 1MBKA 5CXGA 5EGOB 3CWRA 1S7EA 5EG0B 3HE0A 2HI3A 2LTPA 2X48A 2REKA 5K58A 1IRZA 2HDDA 2EQRA 3FK6A 2Y0SN 3HOVJ 5DS9A 4GFLA 2JA5J 4JP0A 3HGYA 3LWJA 1U9OA 2CUFA 5J1RA 3HBLA 1MSEC 1RKWA 1TWGJ 3NAUA 3RZDJ 2I10A 3QBMA 5EGOA 1AKHA 1Z0XA 2ELKA 5EG0A 4A3DJ 5IYBJ 1RPWA 5FKNA 2DMNA 4DYQA 2DMTA 2QKOA 5F0CA 4D5CA 2Y9ZA 5HBUA 2EZLA 2QWTA 4BXXJ 2CU7A 3LHQA 1ETWA 1JKOC 3VVXA 2UXOA 3NI7A 2NP3A 1XC5A 3O8HA 3RH2A 4A3BJ 2X6OA 2ECBA 2DA3A 2OI8A 3JRDA 2W48A 3Q0VA 2EH3A 3PO3J 3BCGA 5F27A 3BG9A 3WHCA 3BRUA 1I50J 2G7LA 2D6YA 1TC3C 1ETOA 2NP5A
chains in the Genus database with same CATH superfamily
2GIVA 2DFHA 1MBGA 2F5EA 3T1BA 2VB6A 2BZTA 1J0RA 2H94A 2ECCA 3H92A 2HTSA 4ZH4F 5E8IA 4OAZA 3GEZA 1JGSA 1LQ1A 1OCPA 2MH2A 1EV7A 2KRHA 2X1DA 2ZSIB 1JUPA 4A0YA 4CCMA 5E17F 1JTXA 3J80K 2M34A 2WADA 4RM2A 4GDFA 4PJMA 3EYIA 3AL0C 4XLPF 3BWGA 1V54H 3ONQA 4U9NA 4XICA 1JJ6C 2BV6A 3Q9VA 4WF2A 5D19A 3KIOA 2K9QA 1W1WE 5M5XJ 1DUXC 4XRMA 2LK2A 2CW8A 1JHFA 5EZHA 2XSJC 1S8NA 1ZQ3P 5HLHA 2E2IJ 2BOLA 4LG0B 1ZG5A 2XKPA 3PQKA 1H88C 3OS0A 1SD6A 3GCMA 1TQMA 3BJAA 1F36A 1XCVA 2GXGA 2TCTA 4ME9A 4EQQA 1GUUA 3V42A 1WJDA 2AQEA 2HDCA 5F6FA 2AXLA 4LIUA 3FM3A 3OR1C 4KFCA 2B7EA 1R7JA 3QP6A 5B66C 1ENHA 1PUFA 2FNAA 2QBYB 3OIQA 1HW5A 2W25A 2M8EA 1BIBA 2XRNA 4P96A 4BL0B 2QQ8A 3WTTC 2R7TA 2LLKA 1T6SA 2WB1N 3K4NA 3DEEA 1OCCH 2O5RA 3RZOJ 4NQWB 4BXFA 2YVHA 3HTHA 4ZYDA 3HSFA 1DPRA 3KP4A 3P9CA 3Q5FA 4OIQF 1PJRA 5FRNA 2IRFG 2QUFA 3JAMK 3SQNA 1IXRC 4YIFA 3F6OA 4CCOA 3ZP5A 3MVPA 1OR7A 3KFWX 3V6GA 3MWMA 3LOCA 1BBYA 2XIGA 4C30A 2HXIA 1MKMA 5F1RA 3ZQCA 1U5TC 1E2XA 1U9NA 3T0YA 1BJZA 4E7LA 3PFYA 3E5QA 4OAYA 1XD7A 2Z33A 2RNGA 2CH0A 2JA7J 1VF9A 4L0YB 4BE2A 4XIDA 1ETQA 1R5ID 3CJRB 2L3DA 5EEAA 4EM0B 1DDNA 3O6BB 3JREA 3MKYB 3GVAA 4NNJA 4GYIA 5CJ9A 2VN2A 1PP7U 3DV8A 5EDNA 2ICWG 2O61A 4QSHA 3BJBA 2MD0A 3S32A 3A1YA 1Z67A 1JJ8C 3TDUC 2ID3A 5DTDA 2VKEA 3J80Z 3ZQQA 2BE5F 3EETA 4JNNA 2XASA 2NVQJ 4L5IA 3W3CA 3LNQA 4M9XA 3KP2A 3BZKA 3EUPA 3AG2H 4C3JJ 1S3JA 4E7SA 2G3BA 1TWCJ 1XCBA 3IWZA 5DCFA 4BDZA 4AWXB 5D5XB 2STTA 3WTYC 3FKIJ 5J8FA 4PCQA 2OTLI 1KU9A 1O3SA 2A6HF 4UVCA 3ZGKA 2QOPA 4U7BA 1U8RA 1N77A 1VQKI 2ESNA 2LG4A 2HQAA 2KRCA 2VC0A 3FBNB 4QIWN 3LSRA 3JR9A 4MLOA 2Y2ZA 3CO7C 3BP8A 5DUKA 4M73A 5D5UB 4FCYA 1UJ8A 2IS1A 4EJOA 1B9NA 1DU6A 2VJJA 1NTCA 1V5GA 1TWFJ 1B8IA 3CCSI 2WB1A 1QPMA 2YU3A 3I0TA 1YW9A 4KYWA 2W85A 2CQNA 2O7OA 2OV7A 5EEGA 3ULQB 2H1LA 1YX5A 1X3WB 2P4WA 1XX5A 4KN4X 2ZC2A 3OYLA 2B9SA 2L7MP 4YZEA 2K3PA 2L7FP 3I59A 3PQJA 3EUAA 2XDNA 2I8DA 3BLYA 2P5LC 3CCMI 3LSTA 3UKGA 3S5RA 5FB2A 1MH4A 3M3YJ 2P7VB 2FQ4A 1FJLA 2FBIA 4FT8A 2GBYA 2X1EA 4IF4A 3OYBA 1XPXA 1IC8A 4ZDOA 3HSEA 3JSPA 4IRVA 4FTHA 4XN3A 3B6AA 5K7ZA 5D4RA 5FKKA 5IP9J 3SJMA 4PJLA 4B47A 4L18B 1BOAA 1GV5A 3ANGA 4MK6A 5A2QZ 1B72B 4E6KG 3KP7A 3K7AJ 3E5UA 2PZ9A 4B3AA 3SXYA 3FX3A 3BC8A 3AFHA 1D1CA 4QPOA 4BKXA 1TZLA 1WI9A 2Q24A 3AG1H 2OUMA 2BY2A 2E5NA 3OYDA 3BPXA 3DU5A 2HR3A 3MQ0A 2HVRA 1KQ8A 4V2FA 4W1UA 5IOYA 2PMHA 5L3BA 1I6HJ 4P9UA 1OYWA 1AOYA 3PFIA 3VOEA 4BEHB 3BPVA 3FKJA 3ZMTA 3G71I 1W0UA 3LA3A 1O3TA 2M7BA 5DD8A 1T98A 1TQPA 1OR7C 2EIMH 5DEQA 2E60A 3QRFF 2O8KA 5JVTA 2HPMA 4KMFA 3HDDA 4G7OF 1IDZA 1TT0A 2DG8A 4QWQA 3V4GA 1K78B 2YX4A 3V7CA 4F91B 5LRSA 3FXUA 4JOMA 3K4KA 3P9KA 5FLMJ 1SFOJ 2KISA 2DK5A 3FXKA 4UHTA 1MMNA 3GFLA 4C2MJ 2PQ8A 3DQVC 4KNYA 1DP3A 3M8EA 3P7NA 4YEJA 4KDPA 5J8CA 3FXQA 3S3OA 1VTNC 1FTZA 1R1VA 4GXOA 3F3XA 4XM3A 3DXJF 2CO5A 5H6QA 1K6YA 2V1DA 4A69C 1WJFA 1W0TA 4DVYP 2GM4A 2PJPA 2PJRA 4BEHA 5IT9Z 1X58A 2YU9J 2ZJ2A 3JCUC 4S05A 1TT5B 3E97A 3RDIA 3C18A 1DPUA 5FGMA 2BY3A 3DPUA 5TISC 2KDOA 4A3JJ 2MC4A 3I4NJ 4BE1A 2A5WA 4AF5A 1BW5A 5AIQA 3M9AA 1ZGJA 2CV2A 5TRDA 4EGZA 3W6KB 4AIHA 1HA8A 3B02A 4GFKA 2OC6A 4O6JA 4HW0A 2R5ZB 4C3HJ 4Q4ZF 2JPBA 3ZOBA 1EA3A 5LFAA 2FXAA 3GLLA 2V4JC 4XMYA 2M1BA 1BI1A 2RC4A 2HGCA 3D5RC 1E3HA 3M7GA 3T5XA 4YFNF 3GTMJ 5JHFA 1TWAJ 2ZJQF 1FSEA 5D6FA 2R7ZJ 3DEWA 4M3GA 2RVCA 3VFZA 5D1RA 2LNBA 3FK7A 4IX7A 3H36A 2V1UA 4WIBA 3VW1A 1YX3A 3SYTA 5D18A 1BC7C 2PMZN 3BT9A 2CGPA 3ROUA 2FA5A 3VW0A 4II2A 1YRNA 4L9TA 3ASNH 2L5QA 4LK1F 2X9DA 4G7HF 4D5FA 3S3MA 4Z2YA 2TRTA 3OYAA 2Z3YA 2QWWA 3BR2A 4Y15A 4RLQA 4LOCA 5M5YJ 3T8RA 3H0DA 5K7HA 3BG3A 2MG4A 3L2WA 2DDBA 2JMWA 3EQLF 1ZRFA 3ABLH 4KMUX 4ABZA 1T08B 1WJ5A 2KZGA 3F22A 3I54A 2XGDA 3VYTB 2P7CB 3JRCA 3TOBA 1T56A 1YLFA 1R71A 2PFVA 1FC3A 2P8TA 2L4AA 3BR5A 3Q3SA 3OOPA 1NG7A 1ZN2A 3FF5A 3O2PE 4V19K 4WX9A 3HTAA 2L54A 1P92A 2GOXB 1X4OA 1UG0A 1DGWY 3V7RA 1FIAA 3E5XA 4Q48A 1IGNA 3GW2A 2JUGA 4BS9A 3DPJA 3PO2J 2E1MC 4LITA 2X4HA 5LRRA 1QVUA 2GA1A 4E7ZA 5HLTA 2ZCWA 1IXSB 3H9GA 3BY6A 3OIPA 3OYMA 2LY2A 2XF5A 3U1DA 4HDUA 1MJ9A 3FDYA 4WXHA 4DW6A 2ESHA 2QTQA 2NOGA 3KKDA 4E7KA 3GZNB 3WU0A 4U0YA 2F6CA 2N8GA 1KU3A 2DLLA 1HW1A 5H9TA 1JHHA 1QVTA 1Y39A 4BBSJ 2PMUA 4IZZA 1SVOA 1T0FA 2TDXA 2WAFA 2DA4A 3WGHA 4HEA2 2EWNA 1X1PA 3W2VA 1PP8F 3CLOA 3GTJJ 1W5TA 2R4GA 1J7KA 4G6TB 1FYKA 1AWCA 3HPHA 2GZWA 3O3KA 1P4XA 2BHYA 3D5LA 2ZMEB 3VODA 4XRFA 1BW6A 3JTHA 4NUBA 3VEPA 5CVVA 1A6IA 3CUQB 3CCLI 1AHDP 3JSJA 2NVUB 2RREA 1U2WA 1GHCA 2L9NA 3BR1A 2DA1A 2VQCA 2K4JA 2ELHA 3DBRB 4BJTA 5CVRA 3F8BA 5K5RA 4FX0A 5KAFC 1ZAOA 1P4WA 4G6DA 4ESJA 3MNLA 3EUHC 3TW6A 1JKRC 5L3EA 2IA2A 4E7IA 4XQFA 1ZREA 1G3SA 1MBKA 5CXGA 5EGOB 3W2AA 2HNHA 4RAZA 2LTPA 2ZXHA 3QU3A 2A6EF 1MMAA 3BDDA 4B43A 2HZTA 3RCOA 2BVLA 2Q1ZB 1BR4A 4GGGA 4ZJZA 2JA5J 1D1AA 4JP0A 4GFLA 3LWJA 3S8PA 2QEXI 1U9OA 2FU4A 5A2QK 5J1RA 3CJTB 1BJAA 3L00A 2ETHA 2LH9A 2UXXA 4LG3A 1AKHA 3KP6A 1TTYA 4MNUA 4L9NA 5EG0A 2JQ7A 1XTAA 4NB5A 2DMNA 4XONA 5FKNA 3WTZA 4AVZA 4DYQA 4EVIA 5HBUA 2UXNA 3K1MA 2EZLA 3U21A 2CU7A 3VVXA 1XC5A 1EH6A 1J2XA 3I5UA 2ECBA 3VSLA 2OI8A 3JRDA 2KPMA 3K4MA 1UFMA 2KJCA 1GXPA 4B3XA 5FD5A 4NHJA 1B59A 1TQIA 3WHCA 2F5DA 2DAOA 3CMAI 2NP5A 2XSDC 4L0ZB 1RUNA 4CDGA 3BTLA 1J5YA 1TLHB 3KLOA 3RKQA 4S0HB 4E70A 4PJ0C 3HTJA 2FMYA 5HAWA 2ZXWH 4XOPA 2RN7A 1OISA 3GXOA 2LYCA 1GV2A 3ELKA 1WFXA 2QQAA 2X6WA 5HS9A 1ZG3A 4BGDA 2CV1A 1LFUP 1MNDA 4L5JA 2EA2A 5JLXA 4CGZA 5FJ8J 1J75A 1I5ZA 1FMVA 3ZQFA 2IS4A 4HNTA 3VUQA 3E6MA 2J5OA 1LFPA 2OU2A 3JAMZ 1QZEA 4A2UA 2Y31A 4HNVA 2H8RA 1H89C 3I53A 3R60A 1JKPC 1HSTA 2IVMA 4A6DA 2IJLA 1TNSA 4DBQA 5AQCA 1XS9A 4O3MA 1SMYF 1MBFA 3VYUB 3KZYA 4MXMA 4D7MA 2ME6A 5HODA 1FZPB 1VQPI 1VNDA 3IUVA 1FY7A 3GTKJ 3L2RA 4B4CA 3I59B 2Y48A 4AM3A 4KJZA 4CZZA 1W7PA 5C44J 2GLOA 4XK4A 2ZJRF 4IJAA 5DDGA 1IUYA 2QKLB 5KHDA 3KE2A 1OJLA 5HS7A 4F93B 3CC2I 1WJBA 2X1CA 3U1KA 3BCAA 4I99C 2QSGX 5J40A 3RQIA 4XLHA 2NS7A 1ETXA 2O3FA 3JRHA 2ZJPF 2G9WA 3ABMH 4UNOA 2JA8J 3GWZA 2R93J 4HNUA 2DA2A 2QF7A 2R92J 2ELJA 4A3MJ 1A04A 3VVYA 3K2AA 3A0HC 1ON1A 2ISYA 3SEZA 5E79C 3OS2A 3VTIA 1YOVB 3WTUC 1AA7A 3SWHA 1PYVA 1SGMA 4PDKA 1ZLKA 3CJQB 4OOIA 3OYCA 4LFUA 4IQJA 2BY1A 3QAHA 2PBXA 2JVHA 3GTPJ 1RR8C 1D5YA 2F07A 2EB7A 4BY1J 3NWSA 3G1LA 4HLYA 3VW2A 2D2WA 4G6QA 3H0GJ 3FISA 5DAJA 2MW8A 1BM9A 2VOPA 1FSHA 3PASA 4EMSA 2Y75A 1Z6RA 2RQQA 4HSRA 2F4MB 4IQ4A 4C2UA 1SFEA 1UHWA 3JRBA 5E8GA 1YW8A 5DM7F 2V57A 1KGSA 2HZDA 4BNCA 4NC6A 2PG4A 2OQGA 1FBSA 2BEOA 2Z5UA 4N0BA 2EJRA 1QZZA 4R8HA 5J4VA 2EILH 1RKTA 1V3FA 3QPSA 2V7FA 1JUSA 3UR3C 4RLFA 1OCZH 3EPZA 1JKQC 4RDUA 5LHHA 3TEDA 3A02A 1L3LA 3WHBA 4FISA 4EM1A 2EIJH 3EGQA 1QHGA 4RGRA 4M3EA 4P55A 1ETVA 3GF2A 3Q9SA 5F04A 3OYKA 2VKDA 5EJCA 2HOAA 2DOAA 4F55A 3I4MJ 2LKPA 4DZJA 5DYMA 1USSA 1UB9A 1MNMC 4NC8A 3PL8A 4BAYA 2NVTJ 1MMSA 3S1MJ 4C3IJ 1BOBA 2R7OA 3CC7I 3CCEI 4B1RA 1RRJA 5TGTA 1LPQA 2EFOA 1TNTA 2OA4A 5F64A 1U8BA 2PJRB 1XSDA 1TP4A 3ON2A 3CCUI 1ORKA 4KT6A 1USTA 4M3BA 4RB2C 3M8FA 4DBRA 4IHYA 1WPKA 1YW7A 2W4SA 3H5NA 3CUQC 1KZHA 3S14J 2QKMB 5B1BH 2GA2A 2XPVA 4E7JA 3I71A 5DD4A 1S7OA 1O3RA 2L9VA 4KIGA 2V6CA 4WXCA 2QM3A 1IV6A 4OWRB 4JX4A 4CA0A 3DTEA 2DODA 3KCCA 4CXFA 2VKHA 3ANPA 5DUIA 4HX8A 3CD6I 3F9KA 3OYNA 2EV6A 2VIXA 1YO5C 3TP0A 4LJZF 1QZYA 1VI0A 1WKMA 4Y33A 1XSXA 4MIMA 1ZELA 2JUCA 4HF2A 4A5NA 2E1CA 1X1AA 2OJED 2LBFA 1I27A 1I3AA 3G56A 3TW7A 1LNWA 3OYEA 1K6OA 4S04A 3QYFA 2HYFA 2OCEA 3OSFA 1IN5A 3GTLJ 4G9YA 2AHQA 3MZYA 2VI6A 2B63J 2EFNA 1ITYA 3KKCA 4EJVA 2XKOA 3LSIA 4A3LJ 4HV5A 3LWFA 4I09A 1UI5A 2H1KA 1QA6A 2UXIA 1O7FA 4OU0A 1X19A 2E36A 2R7FA 1X2NA 4L62A 1RR7A 1U78A 1TWHJ 1FOKA 4RGUA 4L9VA 4OD5A 1IAWA 1IXCA 5CPRB 3SZTA 3CCQI 1KQ0A 3QPHA 5M3MJ 2FOWA 4ZZDA 2XF7A 2E2HJ 3JRGA 5L3FA 1REPC 3ZXSA 4KIFA 4HAMA 4HA8A 1J09A 4UUSA 3MN2A 5HSZA 2E35A 3IL2A 2W84A 3CCYA 1FIPA 3R0AA 3ZMVA 4ZTFA 1LJ9A 1O4XA 4AVPA 5E3LA 4XL9A 1U3EM 2ZCXA 2CV0A 4M6VA 3J7YJ 2JPCA 1G3WA 1K4SA 1JI8A 1HDDC 3HXLA 2M9HA 2WAQN 1LFBA 2NAZA 3LSMA 2HYJA 2PX9A 4P9FA 3LSJA 2XPWA 2X6YA 1SFKA 2HOSA 4WK8F 5E3MA 2ZMEC 2FEZA 1UZCA 4ZDLA 4CH7A 3IWFA 2LR8A 5ERIA 4RB1A 3WGGA 3CDIA 3HEFA 2HKUA 2JRTA 2NOJB 3TO6A 4MTDA 3GFJA 1P9QC 1N25A 2K40A 2ZFWA 2MBFA 3FHZA 5GADJ 4ASNA 3H35A 5D8KB 1XDSA 1TW2A 2DOFA 2MYSA 1I1GA 4UB8C 4R1HA 3FMQA 3IRRA 2CQXA 1I39A 1YQAA 3HHGA 1A31A 2KKOA 2Z9OA 3CTAA 4TV7A 2R7XA 3BR6A 3QODA 3CDLA 1HCRA 2DFFA 2B1EA 4N9IA 3GYHX 2DW4A 2ZMEA 3IV5A 1HC8A 2DFIA 1HKTA 1WJCA 1R1UA 1DGRM 4IVNA 2EA4A 5CQGA 3CCJI 1GVDA 3ZR8X 1FTTA 5J1UA 3R4KA 2DT7B 3HOWJ 1GVJA 5E20A 1YYVA 4XLAA 3IH4A 3GTOJ 2EZKA 1HW2A 3OL3A 4RAGA 3ZMUA 3TO7A 3ZRGA 3KYDB 2CUZA 2H27A 2DMQA 2Q0OA 4ZYAA 4G8XA 5ILSA 2Q2EA 1Z3YA 1IN6A 1G3TA 3S15J 5JI6A 3TKYA 1V4RA 2CMPA 5HS8A 5TJJA 1KYWA 1B1BA 3H5RA 3B6CA 3V7SA 1FOXA 3HUGA 4IHTA 2F5CA 2HKXA 3C2BA 4IHSA 2DA5A 1Y8QB 1GDTA 2JN6A 5KAIC 4BQNA 3KZZA 5D6EA 5BPIA 2RGVA 4HQMA 4CCKA 1B8IB 3ABKH 2A5YB 5HNFA 1QBJA 2YVEA 1VQ7I 2WGBA 1A6QA 1P6RA 3DPLC 2XAQA 5GPCA 2CW7A 3PUFA 4DJAA 2GXAA 3AL0B 4ICHA 2DOEA 1SANA 4AIJA 3VOXA 1STZA 1HLVA 2RKHA 2O0YA 4U88A 4NN1A 4UXNA 3CESA 3WTXC 1WWXA 3VPRA 1Y1WJ 1IRFA 4DYRA 3HRUA 1KU7A 3DP7A 2Z16A 3OSGA 2XAJA 2LY1A 2G7SA 4HX4A 4U0VA 3NRGA 2PFBA 2L7ZA 3J81Z 1IZ1A 3E6DA 3MD2A 3TMOA 4FE4A 2F48A 2QSFX 3AQSA 3J81K 2VT3A 4O5VA 2VXDA 4XR6A 1FOYA 2ZOYA 5J3LA 5C4YA 2M30A 2ZSHB 1KU2A 5GTHC 3SZGA 4F92B 3ZN1A 4CUGA 4D1QA 3RYPA 4AIKA 3G4SI 3I4PA 4JL3A 5HNHA 4ESBA 1JXSA 2CFXA 1E17A 2LFBA 3P9IA 4XKBA 4Q5SF 3MKLA 2B0LA 2GAUA 2LKXA 3H3ZA 3KEQA 3CDHA 1KONA 2WY8Q 1SVLA 3TBIA 3CF2A 1Q1HA 1YHQI 2ZXJA 1HKSA 4LLNA 2P81A 4LLLA 4BACA 5BMZA 4AUXA 5LLQA 2Z2SB 2DJIA 1ZRDA 1EF4A 2RASA 1R36A 1LVAA 2Z99A 3WE3A 1WSUA 3PJRA 3SDGA 5JR3A 5AIPA 1J59A 1OQYA 3C2HA 1E3OC 4H4KC 2V6EA 4J00A 3EUKL 1ZLJA 1ZGWA 3OS1A 2FBHA 2H09A 1E0EA 2IXSA 1S7EA 5FROA 4BHPA 3HE0A 1LDJA 3HIFA 2HI3A 5ED4A 5K58A 3WGIA 3RSNA 3CUOA 2NYXA 1HKQA 3K9TA 3FK6A 2KFDA 3IAM2 3HOTA 5DS9A 4GO1A 1YE9A 4HLXA 2CUFA 2KQRA 3TQNA 1BR1A 1RKWA 2UUZA 1X4PA 2QGUA 2W7NA 4A6EA 5LHIA 1Z0XA 1T8IA 3EUHA 2DMTA 2JRMA 3B73A 5EEHA 1YG2A 4UY8I 2O8XA 5D4SA 2Y9ZA 2BW3A 2LF8A 3ZN0A 2V9VA 3DFGA 4PUSA 4BHBA 5B1AH 2Q8KA 1YJNI 1RUOA 3O8HA 2NP3A 2X6OA 2KIMA 2VT2A 3RIRA 1T2KA 3C2GA 2G7UA 3MZ8A 2EH3A 4M71A 3OYJA 4UVBA 2KL4A 4R79A 3H9QA 1I50J 2G7LA 4BE0A 2D6YA 1TC3C 2K9LA 2JA6J 3HL2A 2M0CA 3ASOH 3G3ZA 3ON4A 1QRYA 5DCMA 2PMZA 1L0OC 3TOAA 1ON2A 3MFKA 5DCMB 2VJ5A 3HHHA 3IUOA 2M3AA 1WGXA 1JUMA 3QKXA 5GTIC 4GCKA 3M1CA 1Y56A 3G1MA 4IRGA 2QA4I 4ENNA 2HVSA 2HXOA 1S72I 1LDDA 2VE9A 2QBYA 2HS5A 1LKXA 3C3WA 3WE2A 5FFZA 1AKHB 3K8PC 3LAPA 4N9HA 1D1BA 1OCTC 2CQKA 2MGQA 3LFKA 1R9TJ 2XGXA 2LP0A 4BDYA 2KDZA 3H5AA 3D1NI 1NK3P 2ZB9A 4DOZA 2XRLA 3DKYA 4XNFA 3REOA 4RBOA 2EBIA 2LY9A 2HYGD 1Y0UA 2EV0A 3FBIB 2AS5F 2R7WA 3H1CA 3V8KA 1ZHFA 3J7AY 3WTWC 3RQ4A 1ZK8A 5FLVA 2DJNA 2FD5A 2CUJA 1RZ4A 3GTQJ 1ACIA 1NHAA 1RNLA 1UAAA 2FUG2 1ZTRA 3ZQIA 4ZDPA 4RS8A 2E1NA 2UWMA 2H6CA 3MZHA 1YIJI 1K61A 2YVXA 1H0MA 1ZR4A 1VQ9I 1OCOH 2CRGA 3K2ZA 1B9MA 1OPCA 2LKSA 4XN0A 4ZYGA 2R5YB 1FP1D 4ENJA 2ZO4A 2NS0A 3FIWA 4YIIA 3HRMA 3NPIA 4LK0F 2L01A 4DIQA 3TGNA 2G7GA 1VQ8I 4MGRA 4RB0A 1UHSA 1ZR2A 3HZJA 2W24A 2MD5A 4XKWA 3BZCA 3FHNA 2QZ8A 5ILVA 2C6YA 2O7TA 2IS6A 3OV8A 2XAHA 3V8JA 5ICCA 1HDPA 2EFQA 4LG0A 3PM1A 3VP5A 3SEQA 1CQTA 1HF0A 1ULYA 2M4KA 1XG1A 2KHMA 3PSIA 3DEUA 5L3DA 4MTEA 5LEJA 2P5VA 3K4JA 4CO8A 1SEUA 1XMAA 4JX6A 1BR2A 2QVOA 3KEOA 5GPAA 1U5TB 4MQVA 3I55I 3BNIA 2K3FA 4C9YA 4IPAA 1DP7P 3HG9A 3FXLA 3F1BA 3DTIA 5LHGA 3F8CA 4I76A 1UMQA 2YUSA 1JTYA 1R5GA 1W5SA 4Y7NJ 4UUSB 2IA0A 3OYIA 2CWEA 2ZNYA 5HLGA 3PPBA 1OKRA 3ZMZA 1YS7A 4Y3OA 3F72A 3F21A 2ACJA 1BC8C 2XROA 2GUHA 3RYRA 5FLXZ 3CCRI 2CS3A 2GFNA 3KYCB 3ERED 2E2JJ 1J9IA 4FQGA 4KA4A 4A3KJ 2VBXA 1W5CC 4IRHA 3OIOA 1SFUA 4EGYA 2XAUA 2DTRA 3BTCA 2XUBA 1T33A 4YG2F 3WU2C 1WRJA 1SD4A 2NNNA 4A0ZA 2WBMA 3BQYA 4F52A 2A07F 3A4CA 3CF5F 2HKOA 4ENKA 3HOXJ 1BN5A 4EJWA 3K70D 2P6SA 1R49A 1UCRA 3W2WA 3LA2A 4RMNA 5L3GA 1LB2A 2FSWA 5F0HA 3MMYB 3J7AO 1A5JA 3SFZA 1MH3A 3O60A 4A0XA 2GQQA 1I1SA 3HTSB 1PUFB 3JRAA 1OFCX 4KITB 2DPUA 4B44A 4ANJA 3IKVA 2HVQA 4LGWA 2IP2A 4I0AA 4MFDA 1F43A 3NXCA 5IYCJ 1FLIA 2ZCNA 2IGMA 3BJ6A 1MDMA 1IN4A 1SVMA 4UUTA 5D8LB 2OERA 1VZ0A 2DDAA 4YFXF 3OYFA 3B81A 2HYTA 1FBUA 3HSRA 2Y0MA 4UV9A 2DBBA 4A3IJ 5FKMA 5H2FC 3DTKA 3VOKA 2L9RA 2E7WA 1T38A 3E7QA 1KA8A 3HOYJ 1VQ6I 2DA6A 1XDUA 3ZQHA 4HF0A 4OINF 2CJJA 4A12A 1FPQA 2WTEA 2F5FA 4XSXF 3GUDA 3I56I 3CUQA 2XB5A 4BHCA 4IXAA 4D0PA 1U0JA 2NS8A 3GBGA 3HKZA 4OD4A 1Z7LA 1XGMA 2E1OA 3RKWA 3KZIC 2PI0A 5AONA 4J19A 1R6RA 2IW5A 2V1XA 4GYGA 1VFCA 2DMUA 1K4TA 4HX7A 1O57A 1SD5A 2LF7A 1MMDA 3F8FA 3PIPF 5J4YA 1CGPA 3IP4B 1X2MA 2JSPA 3DU6A 4LMYA 3K4LA 3DLLF 3F0CA 1I3QJ 3HRTA 3DPTA 1RIOH 2KMUA 2NVXJ 2RQPA 1XMKA 4EV0A 2Y9YA 3H9JA 3LL7A 4QPQA 1MIJA 1QHHD 5FKOA 4XLNF 3VB2A 2ZNZA 2XF6A 3COAC 1WQ2A 2X6XA 1MBJA 1WI3A 2JK3A 2CQQA 2JJ7A 3LAJA 4MHGA 3M8JA 3OOUA 2OD5A 2QQ9A 3TO9A 5K5OA 1Y1VJ 2H8WA 5LEKA 3KP5A 2YPRA 3IAS2 3COLA 5LBQA 3T8TA 3OYHA 3EYYA 1XN7A 2M5WA 1G8XA 2D45A 1FT9A 2DYSH 2G0EA 2P5KA 5EZGA 2R5YA 4KUMA 4CYCA 3NEUA 1JT0A 2PBIA 2DXIA 3HC7A 4RAFA 3KYLA 2VPRA 1LE8A 4B09A 2A6TA 2DMPA 1N78A 5CVUA 1WH5A 3E3VA 1JE8A 1RETA 3LJLA 3CMEI 3V78A 2AXTC 4Z6YA 2DN0A 3DCFA 4LB5A 2CQ7A 1BI0A 1YI2I 3RPUA 4Y52J 3I9V2 2IAIA 2KP6A 1IRXA 1H9GA 4BYYA 4GFBA 3F8MA 1ZRCA 5BOXA 4DNCA 1FMWA 2RV8A 1K79A 1I6XA 3G73A 4F3QA 1F5TA 4DQ2A 4EEFG 1FOWA 2FQ3A 3CRJA 4KN7X 4RGXA 5FFXA 3E7LA 5CW8A 1W4MA 3I64A 3Q0WA 2K9MA 2V9KA 2NVYJ 2UZKA 2V1NA 2D1VA 2FRHA 2VQHA 1JT6A 4HDVA 3OR2C 4HSTA 2OCCH 3BTIA 3PSFA 2RAEA 4AYBN 3ISPA 2R7SA 2YR2A 3GO5A 2BXYA 2MLGA 1MW7A 1QO0D 1WH7A 3VYSB 1IJWC 5CXIA 1MBEA 3ECHA 2XAGA 4U7DA 3FMSA 4HKUA 4RM3A 3S2WA 1V55H 1Z1DA 1YJ9I 4ZZLA 2UXUA 2L2OA 2IS2A 5CYVA 1X3UA 4XRSG 4WXDA 2FE3A 3ESWB 4Y13A 1IW7F 1IN8A 3BROA 1GT0C 5LD2C 2IU5A 2DG7A 1G3YA 4QTRA 2GENA 3HB9A 2H6BA 1D0YA 4PGGA 2R7UA 2XC7A 3BCBA 2LSOA 3V8LA 3GZ6A 4BY7J 1IDYA 1IUFA 1Z9CA 3WG7H 2KIQA 2KLOA 1AU7A 2WWYA 3CJNA 2RHAA 2CG4A 2IGOA 2BVMA 2BY0A 2XGEA 3RKYA 5J47A 3KZ9A 4RGSA 3HGGA 4PFPA 4RB3C 1D0ZA 1S5LC 3PNTA 3WG9A 3VSKA 2PLYA 4NELA 3BOQA 2EPFA 3T6NA 1GXQA 2MLKA 2VBWA 4YELA 4HYEA 2IGNA 4PK4A 3KP3A 2BHZA 2FNPA 3H3VK 1FWZA 3BG5A 4CCNA 2I5UA 2E1MB 2ZKZA 3I58A 4F7ZA 5ICFA 4A93J 2JA2A 4NC7A 4IL6C 4NBQA 3CQZJ 5KNLA 1CF7A 3O8GA 1BIAA 2XB0X 3BR0A 5FO5A 4IHWA 3CC4I 1A35A 1UG2A 2HQRA 4I2OA 2DT6A 2EFPA 3RPQA 2BXZA 1OMIA 3D0SA 3TP3A 2X0LA 4XLEA 3BR3A 4G12A 4EJUA 1IRGA 2HEOA 3L2CA 1W36D 1IV8A 2A3SA 1NH3A 3LSHA 4GCVA 5HDKA 4W97A 5LGTA 4IKFA 2M0MA 3A01A 4UUVA 2GXBA 3K6GA 4JYKA 1Z7UA 3HOUJ 1UI6A 5C4XJ 2HOEA 1MSFC 2FX0A 2M4GA 4ZTJA 3P9TA 4ZYEA 1XMXA 5FMPA 4CICA 1T95A 4HPQA 2GWRA 3LFUA 3VDXA 2WC2A 4H0EA 3IC7A 1YFHA 2M87A 3FXOA 3ML6A 3WTVC 1MGTA 2EK5A 3KLNA 1IG7A 2K9NA 2J5PA 2VBZA 1FP2A 3VYRB 1K7AA 3QOEA 3CWRA 4EM2A 5FD6A 2F4IA 4WCGA 5EG0B 1WJEA 3G6EI 1R58A 4M9ZA 2X48A 4OIRF 3IRQA 2REKA 1IRZA 2HDDA 2KRFA 3L2VA 1LEBA 1ZGAA 2Y0SN 4U87A 5JVGF 1A36A 3NRVA 3OMYA 5IT3A 3C7JA 1MSEC 2WA0A 4M6YA 4AD9A 4HQEA 4M74A 3RZDJ 4I0BA 5FLXK 2I10A 5D5WB 2RDPA 1D8JA 4A3DJ 5IYBJ 1RPWA 2QQBA 4OIOF 2X51A 1B4AA 3R6SA 5F0CA 4CCJA 4ITVA 1G6NA 1YTYA 2LOOA 4II3A 3LHQA 2L7KA 3HYIA 4Y17A 2UXOA 3NI7A 3RH2A 3HRSA 3A0BC 4IO9F 2MH9A 1QNTA 2K85A 2W48A 4LIVA 1ERDA 2F4OB 3PO3J 2VASA 2LC2A 4FETA 3BG9A 4ETSA 1Y6IA 2VC1A 4I01A 3BRUA 2K27A 3J7ZI 3MKWB 2A2FX 2CFOA 4CZCA 1SAXA 1D3YA 4BJ5C 2MFZA 2W00A 2IA1A 3M1EA 4HZFA 1YRNB 3S2DJ 4IOCF 3BHQA 3HKZN 3RI4A 3GMEA 1OYIA 4LLGF 2LDUA 3A01B 5KCMA 3LQQA 2QENA 3DBLB 3OL4A 2DTZA 2XAFA 2E5ZA 3W6JB 4BXUA 5B3SH 4LD5A 1X3ZB 3K4CA 2XVCA 1HQCA 2HQ5A 3S17J 3G2BA 3S1QJ 5IOZA 3K1PA 3LSKA 1QQIA 2P6TA 2BYVE 4CCLA 1Z3XA 1R23A 4A3EJ 2BGCA 2LBFB 4BQOA 2R0QC 1BA5A 2DK8A 2Y69H 5M3FJ 2VODA 2BW3B 4BQQA 2IT0A 2LRDA 1P7IA 2XV4S 4CYCB 3ERMA 2Y30A 3S1RJ 3RTRA 1XGSA 5CVJA 2JWTA 2GIZA 1LE8B 2OPTA 3JRIA 4X1EA 2R5ZA 3QPLA 1VQLI 5EYRA 4NDLA 1ZH5A 3BZ6A 3BQZA 4M6XA 3L1PA 3VWBA 3N05A 1VQNI 5HDGA 1MJBA 4FE7A 5IPAA 2AQFA 3GX4X 2V9PA 4CYDA 3GEUA 2Y0SA 4MEYF 2DA7A 5FRMA 3AKZA 4PXIA 2K5CA 3BG7A 1MMGA 1VQMI 1PDNC 3U9GA 2LVSA 4UB6C 1U6GA 3W6VA 4WWCA 4P5OA 9ANTA 4I7HA 4C2MA 4I02A 1Z21A 2EINH 3JRFA 1RESA 2MABA 3G1OA 2NRAC 4HF1A 1YITI 1MNEA 1S29A 3LSGA 2XDVA 4PJJA 1WZ2A 5J6XA 4RAYA 1MD0A 1QPIA 2ZCMA 3A2KA 1YS6A 3SZPA 4YFKF 3A03A 4U9LA 4PZJA 3U2RA 1M1EB 1GLNA 3JW4A 2IBDA 5BPDA 4DYCA 3AG4H 4BH9A 1D5VA 4IHVA 4XORA 3PUBA 3ECOA 4KWAA 4ON0A 2OZ6A 4IEJA 3MAJA 1POGA 1IF1A 2WV1A 2WAQA 3K4BA 3LA7A 2DFEA 4D7NA 4OMZA 5HLIA 2L0KA 3GTGJ 1Z77A 4XBFA 2DPDA 2VBYA 3QYEA 2QCOA 3QYBA 5CLSA 2E19A 3F23A 5K7FA 1DQUA 2M45A 5F08A 1X1DA 4V2GA 1S6LA 4P1WA 3WU1B 1ONVA 1WVRA 4UVAA 1W7PD 1MDMB 5BNGA 3S3NA 3GFIA 2WAEA 1H9TA 2E7XA 2V26A 1BL0A 1R4NB 3FRQA 2X85A 2E34A 3QWLA 4HOBA 5M5WJ 3NNRA 2LMDA 3TDZC 3ABTA 2ID6A 1FX7A 1Z05A 2FBKA 1RI7A 4KISA 3DWLE 1IN7A 5C3EJ 1R22A 3KX2A 1K78A 2JTVA 1XSVA 4UDSA 5JLWA 2W53A 1PVEA 3ABUA 4FHTA 4E7HA 1R4MB 1YJWI 2HQNA 1BI2A 2XHKA 5IP6A 1ETKA 2V79A 3IH2A 1HXDA 3BTJA 2A69F 2PN6A 2JSCA 1APLC 3JTGA 2FJI1 5JFRA 1FBQA 2HDWA 4PSXA 5J1YA 2OTJI 1MZBA 3PIOF 1YIOA 1ZYRF 2K02A 2YS9A 4NQWA 3RJPA 1Y8RB 2KZVA 5F0FA 1G4DA 3S1NJ 1D8KA 2EIKH 2VJ4A 2FJ1A 3R0JA 1RC9A 2D1HA 3CJDA 2DQLA 2OZUA 1BI3A 4I6ZA 1F9NA 1NG6A 3EDPA 3K69A 5E3OA 4PGHA 3S2HJ 4A5MA 3JSOA 3MKZA 3CMYA 2STWA 4AC6A 5L3CA 4JKZA 1HBXG 6PAXA 4EATA 3M4OJ 4JX5A 3FXMA 2A05A 1WJAA 4M72A 2AO9A 3GFMA 2WY7Q 1TL8A 2OQRA 1EJ9A 3VVZA 3RPUD 4E4HA 1HOMA 2COBA 1X1CA 1E3PA 3KETA 2A61A 2DU9A 4C2TA 2Q2EB 1P7JA 3HOZJ 4HRIA 2HTJA 3FMRA 3DF8A 3HIMA 1WCMJ 2CW0F 2DQRA 3F6VA 5JHUA 2A68F 1SFXA 3QQAA 2HFHA 1B72A 1LEAA 4XLFA 1CF7B 3MCZA 2EZIA 4AU7A 5FGLA 1XB4A 2JVGA 4A3CJ 2VUMJ 4CHUA 1OYYA 5BQTA 3KPHA 3KNWA 2IGKA 4AC0A 4OIPF 4N4OB 1NK2P 2DCEA 1JGGA 1R1TA 1SAUA 3I3LA 3E6BA 4XRSA 3MEXA 2OF7A 3DLAA 2IEKA 2QIBA 4FX4A 3NARA 4UV8A 1F1ZA 3TL4X 3N4MA 4OMYA 3K0LA 3OY9A 3LQRA 2NXNB 1Z91A 4M9SA 2CUEA 3IH3A 4BBRJ 3K1NA 2YSRA 5DM6F 4EJTA 3ZMSA 5GP9A 2W57A 1T39A 2VQLA 5GAHJ 2DYRH 2VOOA 1UHMA 3LSPA 2L4MA 3RD3A 4JQFA 2VQGA 5E18F 4HBLA 2VL8A 1F4KA 3P5JA 4BUPA 4CSWA 4RA2A 3SHFA 2G7HA 3SDBA 3ZQLA 3N97A 1MJAA 2RNJA 3ZQGA 2CSOA 1G59A 4GCTA 3WTSC 1WHUA 3H3UA 3DKWA 4I98B 3FWEA 2MA3A 2O9LA 2VXZA 4N4NB 2MSYA 4G94A 4KIBA 4PJNA 5GAGJ 2XPUA 4MO7A 4IHXA 3HJEA 2F5VA 4M3FA 4U0WA 3C07A 4KICA 1EH8A 5IT9K 4FASD 4G7ZF 3C1DA 2KJBA 5E3NA 1FYLA 4KT5C 2WV0A 5FHPA 1XGOA 5H6RA 3DBHB 3S16J 1ETYA 1SC7A 4DGWB 2HOTA 3FZVA 2O03A 4ZYHA 3Q0UA 3CP2A 2R7VA 2QLZA 5IYDJ 1O7LA 2M2EA 1ZKGA 2W82A 3FXRA 3SFIA 4A3FJ 2ZOZA 2K86A 2ISZA 5E1ZB 4ACIA 3PNVA 1LUJB 4GCLA 4DZPA 4M3DA 4PFOA 5CQEA 3WODF 2XGCA 2NNYA 3AAFA 3HM5A 3NWTA 2LD5A 1ZG1A 4IOAF 2P0WA 3QU6A 1DU0A 2UV1A 3RKXA 1EH7A 1KQ9A 5KVRA 2COMA 3D5SC 3QPTA 4MEXF 3OWTA 2FOKA 2ZBKA 4A3GJ 1G2HA 2ZY9A 3IKTA 2F2EA 4CGRA 4JK1X 3HTUA 3L7WA 2K9SA 2E71A 2L02A 3ZMDA 3NQOA 4ENMA 4QLCU 1HSJA 2VKVA 3VIBA 2DI3A 3CO6C 2CYYA 2K7LA 5HDNA 5EFYA 3FM5A 1MBHA 2VONA 5LGNA 2O6GE 1W7PB 3CZ6A 2UXPA 1D0XA 2KIUA 2VLAA 4YIRX 1X1BA 5KK1A 2EV5A 4ESFA 2OAZA 2R7QA 4XLCA 3CCVI 1S9HA 5ILUA 1ODDA 2FF4A 5C4JJ 1K83J 4K2EA 3F8NA 1OLTA 1FNNA 3QOPA 5ICGA 4BQAA 1VQ4I 4Y4RA 3HOSA 3E1SA 5ICEA 1PUEE 4BJ6C 2FBQA 3KEYA 3UNGC 1UELB 1LVKA 2IPQX 4L5EA 1Z6TA 4L9JA 4PSWA 4AIDA 3CLQA 4LB6B 5D5VB 4Q47A 5E1WA 5H20A 5IP7J 2KIFA 4XOTA 2W1OA 4D9JA 3M07A 3L09A 3AQTA 2QYOA 5DV5A 3LMMA 1H8AC 2OBPA 5K1YA 2L9SA 1B6AA 2KT0A 3K10A 5CKTA 3X2QH 2GOMA 4YRVA 3HTIA 5EF6A 5HVQC 2R3SA 5F1JA 3AG3H 1FEXA 3IHUA 1R00A 1TW3A 3GZ5A 4B48A 2D5VA 4X6AJ 1TBXA 1XGNA 1EKEA 1N75A 2M8GX 2DT5A 2M7AA 2WUIA 2YX7A 4JBAA 2ADUA 4MFEA 3OYGA 3E0JB 2UXHA 1VQOI 1Y0NA 1ZARA 1KYZA 5FKLA 5BS6A 2DO7A 3PNYA 3G7RA 3HPGA 2NX4A 1LDKB 2BBYA 2R7DA 3QP5A 4HV6A 2ME0A 1Q1VA 1V5FA 2HU9A 2QSHX 1IO2A 3ZQ7A 2K4BA 5IY5H 1R5HA 4XSZF 5LGUA 2VE8A 2JT1A 4X0GA 3GZIA 5GAEJ 1C0WA 2EZHA 1VQ5I 3S93A 1S7AA 4IRIA 5CVIA 2HPIA 2VJIA 3CP8A 1T0FC 5K5QA 2JZYA 1SD7A 2EQRA 2MC3A 3CMMA 3HOVJ 4B8XA 4XKVA 3K70C 1U5TA 3DKXA 3HUGB 3HGYA 3L2QA 4MQ9F 1OCRH 3ZPLA 3L9FA 3HBLA 4AYBA 1TWGJ 4ZC3A 3NAUA 5HOOA 1O3QA 3QBMA 2Z1DA 5EGOA 1P4AA 2ELKA 2B3WA 5B5EC 3NS4A 2QKOA 4D5CA 2EFWA 1QU3A 3BJOA 4GRIA 4BXXJ 2QWTA 2ZFUA 3ZCOA 2R7RA 1FYMA 3BG6A 5E1XA 1ETWA 1JKOC 3FXJA 3L2UA 2FMLA 3E6CC 4XKCA 4A3BJ 2LREA 3R61A 2DA3A 1V5EA 3Q0VA 1QGPA 2PEXA 3GLXA 4BU2A 4J01A 2ZXIA 3BCGA 2HWVA 5F27A 4HG2A 1W36C 2VPLA 1SMTA 1ETOA 1P2FA
chains in the Genus database with same CATH topology
2JA6J 2M0CA 1MBGA 2XSDC 3ON4A 3BTLA 1QRYA 2ECCA 3RKQA 1YRNB 4S0HB 3S2DJ 3BHQA 3HKZN 1OCPA 1JUPA 1JTXA 2M34A 3A01B 3HTJA 5HAWA 1WGXA 1JUMA 3QKXA 4GCKA 2DTZA 1GV2A 3G1MA 4XICA 1JJ6C 5D19A 1LFUP 2HXOA 2K9QA 5JLXA 5M5XJ 4XRMA 2LK2A 2HQ5A 5EZHA 1ZQ3P 5FJ8J 2E2IJ 5IOZA 3S17J 3S1QJ 1AKHB 3ZQFA 3VUQA 1OCTC 1H88C 2MGQA 4A3EJ 1F36A 2R0QC 1BA5A 2Y31A 5M3FJ 1R9TJ 2TCTA 4HNVA 4ME9A 2H8RA 2LP0A 2KDZA 3D1NI 1P7IA 1H89C 1NK3P 1GUUA 1JKPC 2ZB9A 4CYCB 2Y30A 3S1RJ 2XRLA 5AQCA 4RBOA 1ENHA 1PUFA 1XS9A 2JWTA 1MBFA 1LE8B 2EBIA 2LY9A 2OPTA 2ME6A 4D7MA 5HODA 4MXMA 3JRIA 4X1EA 1VNDA 2R5ZA 2LLKA 2WB1N 3IUVA 3QPLA 5EYRA 3RZOJ 3GTKJ 4NDLA 4B4CA 2YVHA 1ZK8A 5FLVA 3BQZA 2DJNA 2FD5A 3HTHA 2GLOA 5C44J 3L1PA 3GTQJ 4XK4A 1ZTRA 3ZQIA 1OJLA 4FE7A 5IPAA 3GEUA 1K61A 1ZR4A 3RQIA 2DA7A 3MVPA 2NS7A 1ETXA 3V6GA 3JRHA 4PXIA 2CRGA 2R5YB 3LOCA 2JA8J 2LVSA 2R93J 3W6VA 2HXIA 2DA2A 2QF7A 3FIWA 9ANTA 2R92J 3JRFA 1RESA 3NPIA 4A3MJ 3G1OA 3ZQCA 3VVYA 3K2AA 3LSGA 1U9NA 1BJZA 2G7GA 1UHSA 1ZR2A 1SGMA 2ZCMA 1QPIA 3A03A 2PBXA 3GTPJ 2O7TA 2JA7J 1D5YA 1VF9A 2F07A 4XIDA 4BY1J 3VP5A 1HDPA 1ETQA 3G1LA 3PM1A 3VW2A 1CQTA 1HF0A 5EEAA 2IBDA 1XG1A 3H0GJ 3FISA 4DYCA 3JREA 4IHVA 5DAJA 4JX6A 2MW8A 4KWAA 5GPAA 3PASA 5EDNA 3BNIA 4IEJA 4QSHA 1POGA 3BJBA 2WV1A 3JRBA 2V57A 4D7NA 2L0KA 3GTGJ 1Z77A 1JJ8C 3F1BA 4I76A 1UMQA 2ID3A 2YUSA 1JTYA 2QCOA 2VKEA 5DTDA 4Y7NJ 4UUSB 4JNNA 3PPBA 2E19A 3QPSA 1RKTA 1JUSA 5K7FA 2NVQJ 2GUHA 5F08A 3LNQA 2GFNA 1JKQC 4V2GA 4RDUA 3EUPA 4C3JJ 3TEDA 2E2JJ 4A3KJ 3A02A 3WHBA 4FISA 3OIOA 2G3BA 1TWCJ 3EGQA 3BTCA 4M3EA 1T33A 1ETVA 3FKIJ 5BNGA 5F04A 3BQYA 2HOAA 3HOXJ 4DZJA 3I4MJ 2QOPA 1BL0A 3FRQA 1MNMC 5M5WJ 3NNRA 2NVTJ 3S1MJ 4C3IJ 2ID6A 4QIWN 3LSRA 3JR9A 4MLOA 2Y2ZA 5F0HA 4FCYA 5C3EJ 1A5JA 4B1RA 1DU6A 1NTCA 1MH3A 1U8BA 3O60A 3ON2A 4UDSA 5JLWA 1TWFJ 2W53A 1ORKA 4M3BA 1B8IA 1PUFB 5IP6A 3JRAA 1OFCX 4IHYA 1WPKA 1ETKA 3IH2A 2O7OA 3BTJA 1APLC 5J1YA 3S14J 2L7MP 2XPVA 4YZEA 2YS9A 2L7FP 5F0FA 2XDNA 4MFDA 3S1NJ 1F43A 3NXCA 5IYCJ 2ZCNA 3UKGA 2FJ1A 1IV6A 3S5RA 4JX4A 1MH4A 2OERA 4UUTA 3CJDA 3M3YJ 3ANPA 2FQ4A 1FJLA 3B81A 2HYTA 4I6ZA 2GBYA 5E3OA 3S2HJ 3TP0A 4A3IJ 5FKMA 1IC8A 1VI0A 3VOKA 2L9RA 4MIMA 3CMYA 3E7QA 4FTHA 3HOYJ 4AC6A 3B6AA 2DA6A 5K7ZA 3ZQHA 4JKZA 5FKKA 5IP9J 3SJMA 1GV5A 2CJJA 3ANGA 3TW7A 3M4OJ 3G56A 4MK6A 4JX5A 1B72B 2XB5A 3K7AJ 2PZ9A 4B3AA 2AO9A 2NS8A 3GBGA 3OSFA 3VVZA 1HOMA 3GTLJ 4BKXA 2AHQA 2VI6A 2COBA 2E1OA 2B63J 1ITYA 2Q24A 3KKCA 4A3LJ 4J19A 1UI5A 2H1KA 1VFCA 2UXIA 1P7JA 4V2FA 3HOZJ 2DMUA 4W1UA 5IOYA 1I6HJ 3HIMA 1WCMJ 1X2NA 3QQAA 4L62A 1RR7A 1U78A 1TWHJ 1B72A 1W0UA 2EZIA 5FGLA 1X2MA 4A3CJ 2VUMJ 3F0CA 1I3QJ 5M3MJ 2E2HJ 2O8KA 3JRGA 2NVXJ 3HDDA 3KNWA 2Y9YA 1IDZA 4UUSA 3MN2A 2DG8A 5HSZA 5FKOA 4AC0A 3CCYA 1O4XA 1FIPA 1NK2P 5E3LA 1JGGA 1MBJA 1WI3A 2ZCXA 4M6VA 4XRSA 2JK3A 2CQQA 2IEKA 2OF7A 2QIBA 2JJ7A 1HDDC 3NARA 5FLMJ 2M9HA 2WAQN 1LFBA 3OOUA 1SFOJ 2HYJA 1Y1VJ 3LSJA 2XPWA 3COLA 2HOSA 2CUEA 3IH3A 4C2MJ 4BBRJ 5E3MA 2G0EA 2LR8A 5GP9A 5EZGA 3HEFA 2R5YA 4CYCA 1FTZA 2HKUA 1JT0A 4A69C 1W0TA 2VPRA 3LSPA 1LE8A 3RD3A 2DMPA 2K40A 2GM4A 1WH5A 1X58A 2YU9J 1RETA 3LJLA 3V78A 2DN0A 3DCFA 3ZQLA 3ZQGA 2CQXA 4A3JJ 4GCTA 4Y52J 3I4NJ 2IAIA 4GFBA 4AF5A 1BW5A 2O9LA 3BR6A 3CDLA 1HCRA 4EEFG 4GFKA 3CRJA 2MSYA 3E7LA 2XPUA 4MO7A 2R5ZB 4M3FA 4C3HJ 3IV5A 3Q0WA 4IHXA 5CW8A 2NVYJ 3ZOBA 3C07A 1GVDA 1FTTA 1JT6A 3GTMJ 5E3NA 5J1UA 3HOWJ 5FHPA 1TWAJ 3S16J 1ETYA 2HOTA 3BTIA 2R7ZJ 3DEWA 3IH4A 3GTOJ 4M3GA 2EZKA 3Q0UA 2RAEA 4AYBN 5D1RA 5IYDJ 2M2EA 1ZKGA 3FK7A 2DMQA 3SFIA 4A3FJ 2ZOZA 3VW1A 1IJWC 1WH7A 5D18A 2PMZN 5CXIA 4ACIA 1MBEA 3BT9A 4GCLA 4DZPA 4M3DA 2XGCA 4HKUA 3VW0A 3HM5A 3S15J 2LD5A 2UXUA 1YRNA 3B6CA 2X9DA 1DU0A 4D5FA 2TRTA 4XRSG 3BR2A 4LOCA 5M5YJ 4A3GJ 1G2HA 3C2BA 4CGRA 2DA5A 1GT0C 1GDTA 2JN6A 5K7HA 2K9SA 3BG3A 2DG7A 2IU5A 4QTRA 2MG4A 2GENA 3HB9A 1B8IB 2JMWA 2VKVA 3VIBA 4ABZA 2YVEA 2WGBA 5EFYA 1MBHA 2XGDA 4BY7J 5GPCA 1IDYA 2UXPA 1IUFA 3JRCA 4ICHA 1T56A 1SANA 3VOXA 1HLVA 1AU7A 3BR5A 3Q3SA 4NN1A 5C4JJ 2RHAA 1K83J 3VPRA 1Y1WJ 2XGEA 4DYRA 3HTAA 3KZ9A 1FIAA 3HGGA 3OSGA 1IGNA 2FBQA 2G7SA 3NRGA 3DPJA 4L5EA 3PO2J 4NELA 3T6NA 2L7ZA 1QVUA 4FE4A 5IP7J 3H3VK 3AQSA 3BG5A 4DW6A 2QTQA 2ZOYA 2NOGA 5J3LA 3KKDA 4A93J 3AQTA 5C4YA 1H8AC 3CQZJ 2N8GA 2KT0A 3O8GA 2XB0X 3BR0A 4IHWA 5H9TA 3HTIA 5EF6A 1QVTA 1UG2A 4BBSJ 5F1JA 3TP3A 2DA4A 1FEXA 4JL3A 3BR3A 2D5VA 4G12A 4X6AJ 2LFBA 2M8GX 3GTJJ 3MKLA 2WUIA 2LKXA 4MFEA 2UXHA 4W97A 3A01A 1BW6A 5FKLA 4JYKA 1A6IA 3HOUJ 2P81A 1AHDP 5C4XJ 1UI6A 3JSJA 3G7RA 2NX4A 4AUXA 1MSFC 3BR1A 2DA1A 2FX0A 3P9TA 2RASA 1EF4A 2ME0A 5FMPA 1Q1VA 3SDGA 3GZIA 3MNLA 1E3OC 3TW6A 1JKRC 2EZHA 1IG7A 2K9NA 1ZGWA 1MBKA 5CXGA 5EGOB 3CWRA 1S7EA 5EG0B 3HE0A 2HI3A 2LTPA 2X48A 2REKA 5K58A 1IRZA 2HDDA 2EQRA 3FK6A 2Y0SN 3HOVJ 5DS9A 4GFLA 2JA5J 4JP0A 3HGYA 3LWJA 1U9OA 2CUFA 5J1RA 3HBLA 1MSEC 1RKWA 1TWGJ 3NAUA 3RZDJ 2I10A 3QBMA 5EGOA 1AKHA 1Z0XA 2ELKA 5EG0A 4A3DJ 5IYBJ 1RPWA 5FKNA 2DMNA 4DYQA 2DMTA 2QKOA 5F0CA 4D5CA 2Y9ZA 5HBUA 2EZLA 2QWTA 4BXXJ 2CU7A 3LHQA 1ETWA 1JKOC 3VVXA 2UXOA 3NI7A 2NP3A 1XC5A 3O8HA 3RH2A 4A3BJ 2X6OA 2ECBA 2DA3A 2OI8A 3JRDA 2W48A 3Q0VA 2EH3A 3PO3J 3BCGA 5F27A 3BG9A 3WHCA 3BRUA 1I50J 2G7LA 2D6YA 1TC3C 1ETOA 2NP5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JA6 J;  2M0C A;  1MBG A;  2XSD C;  3ON4 A;  3BTL A;  1QRY A;  2ECC A;  3RKQ A;  1YRN B;  4S0H B;  3S2D J;  3BHQ A;  3HKZ N;  1OCP A;  1JUP A;  1JTX A;  2M34 A;  3A01 B;  3HTJ A;  5HAW A;  1WGX A;  1JUM A;  3QKX A;  4GCK A;  2DTZ A;  1GV2 A;  3G1M A;  4XIC A;  1JJ6 C;  5D19 A;  1LFU P;  2HXO A;  2K9Q A;  5JLX A;  5M5X J;  4XRM A;  2LK2 A;  2HQ5 A;  5EZH A;  1ZQ3 P;  5FJ8 J;  2E2I J;  5IOZ A;  3S17 J;  3S1Q J;  1AKH B;  3ZQF A;  3VUQ A;  1OCT C;  1H88 C;  2MGQ A;  4A3E J;  1F36 A;  2R0Q C;  1BA5 A;  2Y31 A;  5M3F J;  1R9T J;  2TCT A;  4HNV A;  4ME9 A;  2H8R A;  2LP0 A;  2KDZ A;  3D1N I;  1P7I A;  1H89 C;  1NK3 P;  1GUU A;  1JKP C;  2ZB9 A;  4CYC B;  2Y30 A;  3S1R J;  2XRL A;  5AQC A;  4RBO A;  1ENH A;  1PUF A;  1XS9 A;  2JWT A;  1MBF A;  1LE8 B;  2EBI A;  2LY9 A;  2OPT A;  2ME6 A;  4D7M A;  5HOD A;  4MXM A;  3JRI A;  4X1E A;  1VND A;  2R5Z A;  2LLK A;  2WB1 N;  3IUV A;  3QPL A;  5EYR A;  3RZO J;  3GTK J;  4NDL A;  4B4C A;  2YVH A;  1ZK8 A;  5FLV A;  3BQZ A;  2DJN A;  2FD5 A;  3HTH A;  2GLO A;  5C44 J;  3L1P A;  3GTQ J;  4XK4 A;  1ZTR A;  3ZQI A;  1OJL A;  4FE7 A;  5IPA A;  3GEU A;  1K61 A;  1ZR4 A;  3RQI A;  2DA7 A;  3MVP A;  2NS7 A;  1ETX A;  3V6G A;  3JRH A;  4PXI A;  2CRG A;  2R5Y B;  3LOC A;  2JA8 J;  2LVS A;  2R93 J;  3W6V A;  2HXI A;  2DA2 A;  2QF7 A;  3FIW A;  9ANT A;  2R92 J;  3JRF A;  1RES A;  3NPI A;  4A3M J;  3G1O A;  3ZQC A;  3VVY A;  3K2A A;  3LSG A;  1U9N A;  1BJZ A;  2G7G A;  1UHS A;  1ZR2 A;  1SGM A;  2ZCM A;  1QPI A;  3A03 A;  2PBX A;  3GTP J;  2O7T A;  2JA7 J;  1D5Y A;  1VF9 A;  2F07 A;  4XID A;  4BY1 J;  3VP5 A;  1HDP A;  1ETQ A;  3G1L A;  3PM1 A;  3VW2 A;  1CQT A;  1HF0 A;  5EEA A;  2IBD A;  1XG1 A;  3H0G J;  3FIS A;  4DYC A;  3JRE A;  4IHV A;  5DAJ A;  4JX6 A;  2MW8 A;  4KWA A;  5GPA A;  3PAS A;  5EDN A;  3BNI A;  4IEJ A;  4QSH A;  1POG A;  3BJB A;  2WV1 A;  3JRB A;  2V57 A;  4D7N A;  2L0K A;  3GTG J;  1Z77 A;  1JJ8 C;  3F1B A;  4I76 A;  1UMQ A;  2ID3 A;  2YUS A;  1JTY A;  2QCO A;  2VKE A;  5DTD A;  4Y7N J;  4UUS B;  4JNN A;  3PPB A;  2E19 A;  3QPS A;  1RKT A;  1JUS A;  5K7F A;  2NVQ J;  2GUH A;  5F08 A;  3LNQ A;  2GFN A;  1JKQ C;  4V2G A;  4RDU A;  3EUP A;  4C3J J;  3TED A;  2E2J J;  4A3K J;  3A02 A;  3WHB A;  4FIS A;  3OIO A;  2G3B A;  1TWC J;  3EGQ A;  3BTC A;  4M3E A;  1T33 A;  1ETV A;  3FKI J;  5BNG A;  5F04 A;  3BQY A;  2HOA A;  3HOX J;  4DZJ A;  3I4M J;  2QOP A;  1BL0 A;  3FRQ A;  1MNM C;  5M5W J;  3NNR A;  2NVT J;  3S1M J;  4C3I J;  2ID6 A;  4QIW N;  3LSR A;  3JR9 A;  4MLO A;  2Y2Z A;  5F0H A;  4FCY A;  5C3E J;  1A5J A;  4B1R A;  1DU6 A;  1NTC A;  1MH3 A;  1U8B A;  3O60 A;  3ON2 A;  4UDS A;  5JLW A;  1TWF J;  2W53 A;  1ORK A;  4M3B A;  1B8I A;  1PUF B;  5IP6 A;  3JRA A;  1OFC X;  4IHY A;  1WPK A;  1ETK A;  3IH2 A;  2O7O A;  3BTJ A;  1APL C;  5J1Y A;  3S14 J;  2L7M P;  2XPV A;  4YZE A;  2YS9 A;  2L7F P;  5F0F A;  2XDN A;  4MFD A;  3S1N J;  1F43 A;  3NXC A;  5IYC J;  2ZCN A;  3UKG A;  2FJ1 A;  1IV6 A;  3S5R A;  4JX4 A;  1MH4 A;  2OER A;  4UUT A;  3CJD A;  3M3Y J;  3ANP A;  2FQ4 A;  1FJL A;  3B81 A;  2HYT A;  4I6Z A;  2GBY A;  5E3O A;  3S2H J;  3TP0 A;  4A3I J;  5FKM A;  1IC8 A;  1VI0 A;  3VOK A;  2L9R A;  4MIM A;  3CMY A;  3E7Q A;  4FTH A;  3HOY J;  4AC6 A;  3B6A A;  2DA6 A;  5K7Z A;  3ZQH A;  4JKZ A;  5FKK A;  5IP9 J;  3SJM A;  1GV5 A;  2CJJ A;  3ANG A;  3TW7 A;  3M4O J;  3G56 A;  4MK6 A;  4JX5 A;  1B72 B;  2XB5 A;  3K7A J;  2PZ9 A;  4B3A A;  2AO9 A;  2NS8 A;  3GBG A;  3OSF A;  3VVZ A;  1HOM A;  3GTL J;  4BKX A;  2AHQ A;  2VI6 A;  2COB A;  2E1O A;  2B63 J;  1ITY A;  2Q24 A;  3KKC A;  4A3L J;  4J19 A;  1UI5 A;  2H1K A;  1VFC A;  2UXI A;  1P7J A;  4V2F A;  3HOZ J;  2DMU A;  4W1U A;  5IOY A;  1I6H J;  3HIM A;  1WCM J;  1X2N A;  3QQA A;  4L62 A;  1RR7 A;  1U78 A;  1TWH J;  1B72 A;  1W0U A;  2EZI A;  5FGL A;  1X2M A;  4A3C J;  2VUM J;  3F0C A;  1I3Q J;  5M3M J;  2E2H J;  2O8K A;  3JRG A;  2NVX J;  3HDD A;  3KNW A;  2Y9Y A;  1IDZ A;  4UUS A;  3MN2 A;  2DG8 A;  5HSZ A;  5FKO A;  4AC0 A;  3CCY A;  1O4X A;  1FIP A;  1NK2 P;  5E3L A;  1JGG A;  1MBJ A;  1WI3 A;  2ZCX A;  4M6V A;  4XRS A;  2JK3 A;  2CQQ A;  2IEK A;  2OF7 A;  2QIB A;  2JJ7 A;  1HDD C;  3NAR A;  5FLM J;  2M9H A;  2WAQ N;  1LFB A;  3OOU A;  1SFO J;  2HYJ A;  1Y1V J;  3LSJ A;  2XPW A;  3COL A;  2HOS A;  2CUE A;  3IH3 A;  4C2M J;  4BBR J;  5E3M A;  2G0E A;  2LR8 A;  5GP9 A;  5EZG A;  3HEF A;  2R5Y A;  4CYC A;  1FTZ A;  2HKU A;  1JT0 A;  4A69 C;  1W0T A;  2VPR A;  3LSP A;  1LE8 A;  3RD3 A;  2DMP A;  2K40 A;  2GM4 A;  1WH5 A;  1X58 A;  2YU9 J;  1RET A;  3LJL A;  3V78 A;  2DN0 A;  3DCF A;  3ZQL A;  3ZQG A;  2CQX A;  4A3J J;  4GCT A;  4Y52 J;  3I4N J;  2IAI A;  4GFB A;  4AF5 A;  1BW5 A;  2O9L A;  3BR6 A;  3CDL A;  1HCR A;  4EEF G;  4GFK A;  3CRJ A;  2MSY A;  3E7L A;  2XPU A;  4MO7 A;  2R5Z B;  4M3F A;  4C3H J;  3IV5 A;  3Q0W A;  4IHX A;  5CW8 A;  2NVY J;  3ZOB A;  3C07 A;  1GVD A;  1FTT A;  1JT6 A;  3GTM J;  5E3N A;  5J1U A;  3HOW J;  5FHP A;  1TWA J;  3S16 J;  1ETY A;  2HOT A;  3BTI A;  2R7Z J;  3DEW A;  3IH4 A;  3GTO J;  4M3G A;  2EZK A;  3Q0U A;  2RAE A;  4AYB N;  5D1R A;  5IYD J;  2M2E A;  1ZKG A;  3FK7 A;  2DMQ A;  3SFI A;  4A3F J;  2ZOZ A;  3VW1 A;  1IJW C;  1WH7 A;  5D18 A;  2PMZ N;  5CXI A;  4ACI A;  1MBE A;  3BT9 A;  4GCL A;  4DZP A;  4M3D A;  2XGC A;  4HKU A;  3VW0 A;  3HM5 A;  3S15 J;  2LD5 A;  2UXU A;  1YRN A;  3B6C A;  2X9D A;  1DU0 A;  4D5F A;  2TRT A;  4XRS G;  3BR2 A;  4LOC A;  5M5Y J;  4A3G J;  1G2H A;  3C2B A;  4CGR A;  2DA5 A;  1GT0 C;  1GDT A;  2JN6 A;  5K7H A;  2K9S A;  3BG3 A;  2DG7 A;  2IU5 A;  4QTR A;  2MG4 A;  2GEN A;  3HB9 A;  1B8I B;  2JMW A;  2VKV A;  3VIB A;  4ABZ A;  2YVE A;  2WGB A;  5EFY A;  1MBH A;  2XGD A;  4BY7 J;  5GPC A;  1IDY A;  2UXP A;  1IUF A;  3JRC A;  4ICH A;  1T56 A;  1SAN A;  3VOX A;  1HLV A;  1AU7 A;  3BR5 A;  3Q3S A;  4NN1 A;  5C4J J;  2RHA A;  1K83 J;  3VPR A;  1Y1W J;  2XGE A;  4DYR A;  3HTA A;  3KZ9 A;  1FIA A;  3HGG A;  3OSG A;  1IGN A;  2FBQ A;  2G7S A;  3NRG A;  3DPJ A;  4L5E A;  3PO2 J;  4NEL A;  3T6N A;  2L7Z A;  1QVU A;  4FE4 A;  5IP7 J;  3H3V K;  3AQS A;  3BG5 A;  4DW6 A;  2QTQ A;  2ZOY A;  2NOG A;  5J3L A;  3KKD A;  4A93 J;  3AQT A;  5C4Y A;  1H8A C;  3CQZ J;  2N8G A;  2KT0 A;  3O8G A;  2XB0 X;  3BR0 A;  4IHW A;  5H9T A;  3HTI A;  5EF6 A;  1QVT A;  1UG2 A;  4BBS J;  5F1J A;  3TP3 A;  2DA4 A;  1FEX A;  4JL3 A;  3BR3 A;  2D5V A;  4G12 A;  4X6A J;  2LFB A;  2M8G X;  3GTJ J;  3MKL A;  2WUI A;  2LKX A;  4MFE A;  2UXH A;  4W97 A;  3A01 A;  1BW6 A;  5FKL A;  4JYK A;  1A6I A;  3HOU J;  2P81 A;  1AHD P;  5C4X J;  1UI6 A;  3JSJ A;  3G7R A;  2NX4 A;  4AUX A;  1MSF C;  3BR1 A;  2DA1 A;  2FX0 A;  3P9T A;  2RAS A;  1EF4 A;  2ME0 A;  5FMP A;  1Q1V A;  3SDG A;  3GZI A;  3MNL A;  1E3O C;  3TW6 A;  1JKR C;  2EZH A;  1IG7 A;  2K9N A;  1ZGW A;  1MBK A;  5CXG A;  5EGO B;  3CWR A;  1S7E A;  5EG0 B;  3HE0 A;  2HI3 A;  2LTP A;  2X48 A;  2REK A;  5K58 A;  1IRZ A;  2HDD A;  2EQR A;  3FK6 A;  2Y0S N;  3HOV J;  5DS9 A;  4GFL A;  2JA5 J;  4JP0 A;  3HGY A;  3LWJ A;  1U9O A;  2CUF A;  5J1R A;  3HBL A;  1MSE C;  1RKW A;  1TWG J;  3NAU A;  3RZD J;  2I10 A;  3QBM A;  5EGO A;  1AKH A;  1Z0X A;  2ELK A;  5EG0 A;  4A3D J;  5IYB J;  1RPW A;  5FKN A;  2DMN A;  4DYQ A;  2DMT A;  2QKO A;  5F0C A;  4D5C A;  2Y9Z A;  5HBU A;  2EZL A;  2QWT A;  4BXX J;  2CU7 A;  3LHQ A;  1ETW A;  1JKO C;  3VVX A;  2UXO A;  3NI7 A;  2NP3 A;  1XC5 A;  3O8H A;  3RH2 A;  4A3B J;  2X6O A;  2ECB A;  2DA3 A;  2OI8 A;  3JRD A;  2W48 A;  3Q0V A;  2EH3 A;  3PO3 J;  3BCG A;  5F27 A;  3BG9 A;  3WHC A;  3BRU A;  1I50 J;  2G7L A;  2D6Y A;  1TC3 C;  1ETO A;  2NP5 A; 
#chains in the Genus database with same CATH topology
 2GIV A;  2DFH A;  1MBG A;  2F5E A;  3T1B A;  2VB6 A;  2BZT A;  1J0R A;  2H94 A;  2ECC A;  3H92 A;  2HTS A;  4ZH4 F;  5E8I A;  4OAZ A;  3GEZ A;  1JGS A;  1LQ1 A;  1OCP A;  2MH2 A;  1EV7 A;  2KRH A;  2X1D A;  2ZSI B;  1JUP A;  4A0Y A;  4CCM A;  5E17 F;  1JTX A;  3J80 K;  2M34 A;  2WAD A;  4RM2 A;  4GDF A;  4PJM A;  3EYI A;  3AL0 C;  4XLP F;  3BWG A;  1V54 H;  3ONQ A;  4U9N A;  4XIC A;  1JJ6 C;  2BV6 A;  3Q9V A;  4WF2 A;  5D19 A;  3KIO A;  2K9Q A;  1W1W E;  5M5X J;  1DUX C;  4XRM A;  2LK2 A;  2CW8 A;  1JHF A;  5EZH A;  2XSJ C;  1S8N A;  1ZQ3 P;  5HLH A;  2E2I J;  2BOL A;  4LG0 B;  1ZG5 A;  2XKP A;  3PQK A;  1H88 C;  3OS0 A;  1SD6 A;  3GCM A;  1TQM A;  3BJA A;  1F36 A;  1XCV A;  2GXG A;  2TCT A;  4ME9 A;  4EQQ A;  1GUU A;  3V42 A;  1WJD A;  2AQE A;  2HDC A;  5F6F A;  2AXL A;  4LIU A;  3FM3 A;  3OR1 C;  4KFC A;  2B7E A;  1R7J A;  3QP6 A;  5B66 C;  1ENH A;  1PUF A;  2FNA A;  2QBY B;  3OIQ A;  1HW5 A;  2W25 A;  2M8E A;  1BIB A;  2XRN A;  4P96 A;  4BL0 B;  2QQ8 A;  3WTT C;  2R7T A;  2LLK A;  1T6S A;  2WB1 N;  3K4N A;  3DEE A;  1OCC H;  2O5R A;  3RZO J;  4NQW B;  4BXF A;  2YVH A;  3HTH A;  4ZYD A;  3HSF A;  1DPR A;  3KP4 A;  3P9C A;  3Q5F A;  4OIQ F;  1PJR A;  5FRN A;  2IRF G;  2QUF A;  3JAM K;  3SQN A;  1IXR C;  4YIF A;  3F6O A;  4CCO A;  3ZP5 A;  3MVP A;  1OR7 A;  3KFW X;  3V6G A;  3MWM A;  3LOC A;  1BBY A;  2XIG A;  4C30 A;  2HXI A;  1MKM A;  5F1R A;  3ZQC A;  1U5T C;  1E2X A;  1U9N A;  3T0Y A;  1BJZ A;  4E7L A;  3PFY A;  3E5Q A;  4OAY A;  1XD7 A;  2Z33 A;  2RNG A;  2CH0 A;  2JA7 J;  1VF9 A;  4L0Y B;  4BE2 A;  4XID A;  1ETQ A;  1R5I D;  3CJR B;  2L3D A;  5EEA A;  4EM0 B;  1DDN A;  3O6B B;  3JRE A;  3MKY B;  3GVA A;  4NNJ A;  4GYI A;  5CJ9 A;  2VN2 A;  1PP7 U;  3DV8 A;  5EDN A;  2ICW G;  2O61 A;  4QSH A;  3BJB A;  2MD0 A;  3S32 A;  3A1Y A;  1Z67 A;  1JJ8 C;  3TDU C;  2ID3 A;  5DTD A;  2VKE A;  3J80 Z;  3ZQQ A;  2BE5 F;  3EET A;  4JNN A;  2XAS A;  2NVQ J;  4L5I A;  3W3C A;  3LNQ A;  4M9X A;  3KP2 A;  3BZK A;  3EUP A;  3AG2 H;  4C3J J;  1S3J A;  4E7S A;  2G3B A;  1TWC J;  1XCB A;  3IWZ A;  5DCF A;  4BDZ A;  4AWX B;  5D5X B;  2STT A;  3WTY C;  3FKI J;  5J8F A;  4PCQ A;  2OTL I;  1KU9 A;  1O3S A;  2A6H F;  4UVC A;  3ZGK A;  2QOP A;  4U7B A;  1U8R A;  1N77 A;  1VQK I;  2ESN A;  2LG4 A;  2HQA A;  2KRC A;  2VC0 A;  3FBN B;  4QIW N;  3LSR A;  3JR9 A;  4MLO A;  2Y2Z A;  3CO7 C;  3BP8 A;  5DUK A;  4M73 A;  5D5U B;  4FCY A;  1UJ8 A;  2IS1 A;  4EJO A;  1B9N A;  1DU6 A;  2VJJ A;  1NTC A;  1V5G A;  1TWF J;  1B8I A;  3CCS I;  2WB1 A;  1QPM A;  2YU3 A;  3I0T A;  1YW9 A;  4KYW A;  2W85 A;  2CQN A;  2O7O A;  2OV7 A;  5EEG A;  3ULQ B;  2H1L A;  1YX5 A;  1X3W B;  2P4W A;  1XX5 A;  4KN4 X;  2ZC2 A;  3OYL A;  2B9S A;  2L7M P;  4YZE A;  2K3P A;  2L7F P;  3I59 A;  3PQJ A;  3EUA A;  2XDN A;  2I8D A;  3BLY A;  2P5L C;  3CCM I;  3LST A;  3UKG A;  3S5R A;  5FB2 A;  1MH4 A;  3M3Y J;  2P7V B;  2FQ4 A;  1FJL A;  2FBI A;  4FT8 A;  2GBY A;  2X1E A;  4IF4 A;  3OYB A;  1XPX A;  1IC8 A;  4ZDO A;  3HSE A;  3JSP A;  4IRV A;  4FTH A;  4XN3 A;  3B6A A;  5K7Z A;  5D4R A;  5FKK A;  5IP9 J;  3SJM A;  4PJL A;  4B47 A;  4L18 B;  1BOA A;  1GV5 A;  3ANG A;  4MK6 A;  5A2Q Z;  1B72 B;  4E6K G;  3KP7 A;  3K7A J;  3E5U A;  2PZ9 A;  4B3A A;  3SXY A;  3FX3 A;  3BC8 A;  3AFH A;  1D1C A;  4QPO A;  4BKX A;  1TZL A;  1WI9 A;  2Q24 A;  3AG1 H;  2OUM A;  2BY2 A;  2E5N A;  3OYD A;  3BPX A;  3DU5 A;  2HR3 A;  3MQ0 A;  2HVR A;  1KQ8 A;  4V2F A;  4W1U A;  5IOY A;  2PMH A;  5L3B A;  1I6H J;  4P9U A;  1OYW A;  1AOY A;  3PFI A;  3VOE A;  4BEH B;  3BPV A;  3FKJ A;  3ZMT A;  3G71 I;  1W0U A;  3LA3 A;  1O3T A;  2M7B A;  5DD8 A;  1T98 A;  1TQP A;  1OR7 C;  2EIM H;  5DEQ A;  2E60 A;  3QRF F;  2O8K A;  5JVT A;  2HPM A;  4KMF A;  3HDD A;  4G7O F;  1IDZ A;  1TT0 A;  2DG8 A;  4QWQ A;  3V4G A;  1K78 B;  2YX4 A;  3V7C A;  4F91 B;  5LRS A;  3FXU A;  4JOM A;  3K4K A;  3P9K A;  5FLM J;  1SFO J;  2KIS A;  2DK5 A;  3FXK A;  4UHT A;  1MMN A;  3GFL A;  4C2M J;  2PQ8 A;  3DQV C;  4KNY A;  1DP3 A;  3M8E A;  3P7N A;  4YEJ A;  4KDP A;  5J8C A;  3FXQ A;  3S3O A;  1VTN C;  1FTZ A;  1R1V A;  4GXO A;  3F3X A;  4XM3 A;  3DXJ F;  2CO5 A;  5H6Q A;  1K6Y A;  2V1D A;  4A69 C;  1WJF A;  1W0T A;  4DVY P;  2GM4 A;  2PJP A;  2PJR A;  4BEH A;  5IT9 Z;  1X58 A;  2YU9 J;  2ZJ2 A;  3JCU C;  4S05 A;  1TT5 B;  3E97 A;  3RDI A;  3C18 A;  1DPU A;  5FGM A;  2BY3 A;  3DPU A;  5TIS C;  2KDO A;  4A3J J;  2MC4 A;  3I4N J;  4BE1 A;  2A5W A;  4AF5 A;  1BW5 A;  5AIQ A;  3M9A A;  1ZGJ A;  2CV2 A;  5TRD A;  4EGZ A;  3W6K B;  4AIH A;  1HA8 A;  3B02 A;  4GFK A;  2OC6 A;  4O6J A;  4HW0 A;  2R5Z B;  4C3H J;  4Q4Z F;  2JPB A;  3ZOB A;  1EA3 A;  5LFA A;  2FXA A;  3GLL A;  2V4J C;  4XMY A;  2M1B A;  1BI1 A;  2RC4 A;  2HGC A;  3D5R C;  1E3H A;  3M7G A;  3T5X A;  4YFN F;  3GTM J;  5JHF A;  1TWA J;  2ZJQ F;  1FSE A;  5D6F A;  2R7Z J;  3DEW A;  4M3G A;  2RVC A;  3VFZ A;  5D1R A;  2LNB A;  3FK7 A;  4IX7 A;  3H36 A;  2V1U A;  4WIB A;  3VW1 A;  1YX3 A;  3SYT A;  5D18 A;  1BC7 C;  2PMZ N;  3BT9 A;  2CGP A;  3ROU A;  2FA5 A;  3VW0 A;  4II2 A;  1YRN A;  4L9T A;  3ASN H;  2L5Q A;  4LK1 F;  2X9D A;  4G7H F;  4D5F A;  3S3M A;  4Z2Y A;  2TRT A;  3OYA A;  2Z3Y A;  2QWW A;  3BR2 A;  4Y15 A;  4RLQ A;  4LOC A;  5M5Y J;  3T8R A;  3H0D A;  5K7H A;  3BG3 A;  2MG4 A;  3L2W A;  2DDB A;  2JMW A;  3EQL F;  1ZRF A;  3ABL H;  4KMU X;  4ABZ A;  1T08 B;  1WJ5 A;  2KZG A;  3F22 A;  3I54 A;  2XGD A;  3VYT B;  2P7C B;  3JRC A;  3TOB A;  1T56 A;  1YLF A;  1R71 A;  2PFV A;  1FC3 A;  2P8T A;  2L4A A;  3BR5 A;  3Q3S A;  3OOP A;  1NG7 A;  1ZN2 A;  3FF5 A;  3O2P E;  4V19 K;  4WX9 A;  3HTA A;  2L54 A;  1P92 A;  2GOX B;  1X4O A;  1UG0 A;  1DGW Y;  3V7R A;  1FIA A;  3E5X A;  4Q48 A;  1IGN A;  3GW2 A;  2JUG A;  4BS9 A;  3DPJ A;  3PO2 J;  2E1M C;  4LIT A;  2X4H A;  5LRR A;  1QVU A;  2GA1 A;  4E7Z A;  5HLT A;  2ZCW A;  1IXS B;  3H9G A;  3BY6 A;  3OIP A;  3OYM A;  2LY2 A;  2XF5 A;  3U1D A;  4HDU A;  1MJ9 A;  3FDY A;  4WXH A;  4DW6 A;  2ESH A;  2QTQ A;  2NOG A;  3KKD A;  4E7K A;  3GZN B;  3WU0 A;  4U0Y A;  2F6C A;  2N8G A;  1KU3 A;  2DLL A;  1HW1 A;  5H9T A;  1JHH A;  1QVT A;  1Y39 A;  4BBS J;  2PMU A;  4IZZ A;  1SVO A;  1T0F A;  2TDX A;  2WAF A;  2DA4 A;  3WGH A;  4HEA 2;  2EWN A;  1X1P A;  3W2V A;  1PP8 F;  3CLO A;  3GTJ J;  1W5T A;  2R4G A;  1J7K A;  4G6T B;  1FYK A;  1AWC A;  3HPH A;  2GZW A;  3O3K A;  1P4X A;  2BHY A;  3D5L A;  2ZME B;  3VOD A;  4XRF A;  1BW6 A;  3JTH A;  4NUB A;  3VEP A;  5CVV A;  1A6I A;  3CUQ B;  3CCL I;  1AHD P;  3JSJ A;  2NVU B;  2RRE A;  1U2W A;  1GHC A;  2L9N A;  3BR1 A;  2DA1 A;  2VQC A;  2K4J A;  2ELH A;  3DBR B;  4BJT A;  5CVR A;  3F8B A;  5K5R A;  4FX0 A;  5KAF C;  1ZAO A;  1P4W A;  4G6D A;  4ESJ A;  3MNL A;  3EUH C;  3TW6 A;  1JKR C;  5L3E A;  2IA2 A;  4E7I A;  4XQF A;  1ZRE A;  1G3S A;  1MBK A;  5CXG A;  5EGO B;  3W2A A;  2HNH A;  4RAZ A;  2LTP A;  2ZXH A;  3QU3 A;  2A6E F;  1MMA A;  3BDD A;  4B43 A;  2HZT A;  3RCO A;  2BVL A;  2Q1Z B;  1BR4 A;  4GGG A;  4ZJZ A;  2JA5 J;  1D1A A;  4JP0 A;  4GFL A;  3LWJ A;  3S8P A;  2QEX I;  1U9O A;  2FU4 A;  5A2Q K;  5J1R A;  3CJT B;  1BJA A;  3L00 A;  2ETH A;  2LH9 A;  2UXX A;  4LG3 A;  1AKH A;  3KP6 A;  1TTY A;  4MNU A;  4L9N A;  5EG0 A;  2JQ7 A;  1XTA A;  4NB5 A;  2DMN A;  4XON A;  5FKN A;  3WTZ A;  4AVZ A;  4DYQ A;  4EVI A;  5HBU A;  2UXN A;  3K1M A;  2EZL A;  3U21 A;  2CU7 A;  3VVX A;  1XC5 A;  1EH6 A;  1J2X A;  3I5U A;  2ECB A;  3VSL A;  2OI8 A;  3JRD A;  2KPM A;  3K4M A;  1UFM A;  2KJC A;  1GXP A;  4B3X A;  5FD5 A;  4NHJ A;  1B59 A;  1TQI A;  3WHC A;  2F5D A;  2DAO A;  3CMA I;  2NP5 A;  2XSD C;  4L0Z B;  1RUN A;  4CDG A;  3BTL A;  1J5Y A;  1TLH B;  3KLO A;  3RKQ A;  4S0H B;  4E70 A;  4PJ0 C;  3HTJ A;  2FMY A;  5HAW A;  2ZXW H;  4XOP A;  2RN7 A;  1OIS A;  3GXO A;  2LYC A;  1GV2 A;  3ELK A;  1WFX A;  2QQA A;  2X6W A;  5HS9 A;  1ZG3 A;  4BGD A;  2CV1 A;  1LFU P;  1MND A;  4L5J A;  2EA2 A;  5JLX A;  4CGZ A;  5FJ8 J;  1J75 A;  1I5Z A;  1FMV A;  3ZQF A;  2IS4 A;  4HNT A;  3VUQ A;  3E6M A;  2J5O A;  1LFP A;  2OU2 A;  3JAM Z;  1QZE A;  4A2U A;  2Y31 A;  4HNV A;  2H8R A;  1H89 C;  3I53 A;  3R60 A;  1JKP C;  1HST A;  2IVM A;  4A6D A;  2IJL A;  1TNS A;  4DBQ A;  5AQC A;  1XS9 A;  4O3M A;  1SMY F;  1MBF A;  3VYU B;  3KZY A;  4MXM A;  4D7M A;  2ME6 A;  5HOD A;  1FZP B;  1VQP I;  1VND A;  3IUV A;  1FY7 A;  3GTK J;  3L2R A;  4B4C A;  3I59 B;  2Y48 A;  4AM3 A;  4KJZ A;  4CZZ A;  1W7P A;  5C44 J;  2GLO A;  4XK4 A;  2ZJR F;  4IJA A;  5DDG A;  1IUY A;  2QKL B;  5KHD A;  3KE2 A;  1OJL A;  5HS7 A;  4F93 B;  3CC2 I;  1WJB A;  2X1C A;  3U1K A;  3BCA A;  4I99 C;  2QSG X;  5J40 A;  3RQI A;  4XLH A;  2NS7 A;  1ETX A;  2O3F A;  3JRH A;  2ZJP F;  2G9W A;  3ABM H;  4UNO A;  2JA8 J;  3GWZ A;  2R93 J;  4HNU A;  2DA2 A;  2QF7 A;  2R92 J;  2ELJ A;  4A3M J;  1A04 A;  3VVY A;  3K2A A;  3A0H C;  1ON1 A;  2ISY A;  3SEZ A;  5E79 C;  3OS2 A;  3VTI A;  1YOV B;  3WTU C;  1AA7 A;  3SWH A;  1PYV A;  1SGM A;  4PDK A;  1ZLK A;  3CJQ B;  4OOI A;  3OYC A;  4LFU A;  4IQJ A;  2BY1 A;  3QAH A;  2PBX A;  2JVH A;  3GTP J;  1RR8 C;  1D5Y A;  2F07 A;  2EB7 A;  4BY1 J;  3NWS A;  3G1L A;  4HLY A;  3VW2 A;  2D2W A;  4G6Q A;  3H0G J;  3FIS A;  5DAJ A;  2MW8 A;  1BM9 A;  2VOP A;  1FSH A;  3PAS A;  4EMS A;  2Y75 A;  1Z6R A;  2RQQ A;  4HSR A;  2F4M B;  4IQ4 A;  4C2U A;  1SFE A;  1UHW A;  3JRB A;  5E8G A;  1YW8 A;  5DM7 F;  2V57 A;  1KGS A;  2HZD A;  4BNC A;  4NC6 A;  2PG4 A;  2OQG A;  1FBS A;  2BEO A;  2Z5U A;  4N0B A;  2EJR A;  1QZZ A;  4R8H A;  5J4V A;  2EIL H;  1RKT A;  1V3F A;  3QPS A;  2V7F A;  1JUS A;  3UR3 C;  4RLF A;  1OCZ H;  3EPZ A;  1JKQ C;  4RDU A;  5LHH A;  3TED A;  3A02 A;  1L3L A;  3WHB A;  4FIS A;  4EM1 A;  2EIJ H;  3EGQ A;  1QHG A;  4RGR A;  4M3E A;  4P55 A;  1ETV A;  3GF2 A;  3Q9S A;  5F04 A;  3OYK A;  2VKD A;  5EJC A;  2HOA A;  2DOA A;  4F55 A;  3I4M J;  2LKP A;  4DZJ A;  5DYM A;  1USS A;  1UB9 A;  1MNM C;  4NC8 A;  3PL8 A;  4BAY A;  2NVT J;  1MMS A;  3S1M J;  4C3I J;  1BOB A;  2R7O A;  3CC7 I;  3CCE I;  4B1R A;  1RRJ A;  5TGT A;  1LPQ A;  2EFO A;  1TNT A;  2OA4 A;  5F64 A;  1U8B A;  2PJR B;  1XSD A;  1TP4 A;  3ON2 A;  3CCU I;  1ORK A;  4KT6 A;  1UST A;  4M3B A;  4RB2 C;  3M8F A;  4DBR A;  4IHY A;  1WPK A;  1YW7 A;  2W4S A;  3H5N A;  3CUQ C;  1KZH A;  3S14 J;  2QKM B;  5B1B H;  2GA2 A;  2XPV A;  4E7J A;  3I71 A;  5DD4 A;  1S7O A;  1O3R A;  2L9V A;  4KIG A;  2V6C A;  4WXC A;  2QM3 A;  1IV6 A;  4OWR B;  4JX4 A;  4CA0 A;  3DTE A;  2DOD A;  3KCC A;  4CXF A;  2VKH A;  3ANP A;  5DUI A;  4HX8 A;  3CD6 I;  3F9K A;  3OYN A;  2EV6 A;  2VIX A;  1YO5 C;  3TP0 A;  4LJZ F;  1QZY A;  1VI0 A;  1WKM A;  4Y33 A;  1XSX A;  4MIM A;  1ZEL A;  2JUC A;  4HF2 A;  4A5N A;  2E1C A;  1X1A A;  2OJE D;  2LBF A;  1I27 A;  1I3A A;  3G56 A;  3TW7 A;  1LNW A;  3OYE A;  1K6O A;  4S04 A;  3QYF A;  2HYF A;  2OCE A;  3OSF A;  1IN5 A;  3GTL J;  4G9Y A;  2AHQ A;  3MZY A;  2VI6 A;  2B63 J;  2EFN A;  1ITY A;  3KKC A;  4EJV A;  2XKO A;  3LSI A;  4A3L J;  4HV5 A;  3LWF A;  4I09 A;  1UI5 A;  2H1K A;  1QA6 A;  2UXI A;  1O7F A;  4OU0 A;  1X19 A;  2E36 A;  2R7F A;  1X2N A;  4L62 A;  1RR7 A;  1U78 A;  1TWH J;  1FOK A;  4RGU A;  4L9V A;  4OD5 A;  1IAW A;  1IXC A;  5CPR B;  3SZT A;  3CCQ I;  1KQ0 A;  3QPH A;  5M3M J;  2FOW A;  4ZZD A;  2XF7 A;  2E2H J;  3JRG A;  5L3F A;  1REP C;  3ZXS A;  4KIF A;  4HAM A;  4HA8 A;  1J09 A;  4UUS A;  3MN2 A;  5HSZ A;  2E35 A;  3IL2 A;  2W84 A;  3CCY A;  1FIP A;  3R0A A;  3ZMV A;  4ZTF A;  1LJ9 A;  1O4X A;  4AVP A;  5E3L A;  4XL9 A;  1U3E M;  2ZCX A;  2CV0 A;  4M6V A;  3J7Y J;  2JPC A;  1G3W A;  1K4S A;  1JI8 A;  1HDD C;  3HXL A;  2M9H A;  2WAQ N;  1LFB A;  2NAZ A;  3LSM A;  2HYJ A;  2PX9 A;  4P9F A;  3LSJ A;  2XPW A;  2X6Y A;  1SFK A;  2HOS A;  4WK8 F;  5E3M A;  2ZME C;  2FEZ A;  1UZC A;  4ZDL A;  4CH7 A;  3IWF A;  2LR8 A;  5ERI A;  4RB1 A;  3WGG A;  3CDI A;  3HEF A;  2HKU A;  2JRT A;  2NOJ B;  3TO6 A;  4MTD A;  3GFJ A;  1P9Q C;  1N25 A;  2K40 A;  2ZFW A;  2MBF A;  3FHZ A;  5GAD J;  4ASN A;  3H35 A;  5D8K B;  1XDS A;  1TW2 A;  2DOF A;  2MYS A;  1I1G A;  4UB8 C;  4R1H A;  3FMQ A;  3IRR A;  2CQX A;  1I39 A;  1YQA A;  3HHG A;  1A31 A;  2KKO A;  2Z9O A;  3CTA A;  4TV7 A;  2R7X A;  3BR6 A;  3QOD A;  3CDL A;  1HCR A;  2DFF A;  2B1E A;  4N9I A;  3GYH X;  2DW4 A;  2ZME A;  3IV5 A;  1HC8 A;  2DFI A;  1HKT A;  1WJC A;  1R1U A;  1DGR M;  4IVN A;  2EA4 A;  5CQG A;  3CCJ I;  1GVD A;  3ZR8 X;  1FTT A;  5J1U A;  3R4K A;  2DT7 B;  3HOW J;  1GVJ A;  5E20 A;  1YYV A;  4XLA A;  3IH4 A;  3GTO J;  2EZK A;  1HW2 A;  3OL3 A;  4RAG A;  3ZMU A;  3TO7 A;  3ZRG A;  3KYD B;  2CUZ A;  2H27 A;  2DMQ A;  2Q0O A;  4ZYA A;  4G8X A;  5ILS A;  2Q2E A;  1Z3Y A;  1IN6 A;  1G3T A;  3S15 J;  5JI6 A;  3TKY A;  1V4R A;  2CMP A;  5HS8 A;  5TJJ A;  1KYW A;  1B1B A;  3H5R A;  3B6C A;  3V7S A;  1FOX A;  3HUG A;  4IHT A;  2F5C A;  2HKX A;  3C2B A;  4IHS A;  2DA5 A;  1Y8Q B;  1GDT A;  2JN6 A;  5KAI C;  4BQN A;  3KZZ A;  5D6E A;  5BPI A;  2RGV A;  4HQM A;  4CCK A;  1B8I B;  3ABK H;  2A5Y B;  5HNF A;  1QBJ A;  2YVE A;  1VQ7 I;  2WGB A;  1A6Q A;  1P6R A;  3DPL C;  2XAQ A;  5GPC A;  2CW7 A;  3PUF A;  4DJA A;  2GXA A;  3AL0 B;  4ICH A;  2DOE A;  1SAN A;  4AIJ A;  3VOX A;  1STZ A;  1HLV A;  2RKH A;  2O0Y A;  4U88 A;  4NN1 A;  4UXN A;  3CES A;  3WTX C;  1WWX A;  3VPR A;  1Y1W J;  1IRF A;  4DYR A;  3HRU A;  1KU7 A;  3DP7 A;  2Z16 A;  3OSG A;  2XAJ A;  2LY1 A;  2G7S A;  4HX4 A;  4U0V A;  3NRG A;  2PFB A;  2L7Z A;  3J81 Z;  1IZ1 A;  3E6D A;  3MD2 A;  3TMO A;  4FE4 A;  2F48 A;  2QSF X;  3AQS A;  3J81 K;  2VT3 A;  4O5V A;  2VXD A;  4XR6 A;  1FOY A;  2ZOY A;  5J3L A;  5C4Y A;  2M30 A;  2ZSH B;  1KU2 A;  5GTH C;  3SZG A;  4F92 B;  3ZN1 A;  4CUG A;  4D1Q A;  3RYP A;  4AIK A;  3G4S I;  3I4P A;  4JL3 A;  5HNH A;  4ESB A;  1JXS A;  2CFX A;  1E17 A;  2LFB A;  3P9I A;  4XKB A;  4Q5S F;  3MKL A;  2B0L A;  2GAU A;  2LKX A;  3H3Z A;  3KEQ A;  3CDH A;  1KON A;  2WY8 Q;  1SVL A;  3TBI A;  3CF2 A;  1Q1H A;  1YHQ I;  2ZXJ A;  1HKS A;  4LLN A;  2P81 A;  4LLL A;  4BAC A;  5BMZ A;  4AUX A;  5LLQ A;  2Z2S B;  2DJI A;  1ZRD A;  1EF4 A;  2RAS A;  1R36 A;  1LVA A;  2Z99 A;  3WE3 A;  1WSU A;  3PJR A;  3SDG A;  5JR3 A;  5AIP A;  1J59 A;  1OQY A;  3C2H A;  1E3O C;  4H4K C;  2V6E A;  4J00 A;  3EUK L;  1ZLJ A;  1ZGW A;  3OS1 A;  2FBH A;  2H09 A;  1E0E A;  2IXS A;  1S7E A;  5FRO A;  4BHP A;  3HE0 A;  1LDJ A;  3HIF A;  2HI3 A;  5ED4 A;  5K58 A;  3WGI A;  3RSN A;  3CUO A;  2NYX A;  1HKQ A;  3K9T A;  3FK6 A;  2KFD A;  3IAM 2;  3HOT A;  5DS9 A;  4GO1 A;  1YE9 A;  4HLX A;  2CUF A;  2KQR A;  3TQN A;  1BR1 A;  1RKW A;  2UUZ A;  1X4P A;  2QGU A;  2W7N A;  4A6E A;  5LHI A;  1Z0X A;  1T8I A;  3EUH A;  2DMT A;  2JRM A;  3B73 A;  5EEH A;  1YG2 A;  4UY8 I;  2O8X A;  5D4S A;  2Y9Z A;  2BW3 A;  2LF8 A;  3ZN0 A;  2V9V A;  3DFG A;  4PUS A;  4BHB A;  5B1A H;  2Q8K A;  1YJN I;  1RUO A;  3O8H A;  2NP3 A;  2X6O A;  2KIM A;  2VT2 A;  3RIR A;  1T2K A;  3C2G A;  2G7U A;  3MZ8 A;  2EH3 A;  4M71 A;  3OYJ A;  4UVB A;  2KL4 A;  4R79 A;  3H9Q A;  1I50 J;  2G7L A;  4BE0 A;  2D6Y A;  1TC3 C;  2K9L A;  2JA6 J;  3HL2 A;  2M0C A;  3ASO H;  3G3Z A;  3ON4 A;  1QRY A;  5DCM A;  2PMZ A;  1L0O C;  3TOA A;  1ON2 A;  3MFK A;  5DCM B;  2VJ5 A;  3HHH A;  3IUO A;  2M3A A;  1WGX A;  1JUM A;  3QKX A;  5GTI C;  4GCK A;  3M1C A;  1Y56 A;  3G1M A;  4IRG A;  2QA4 I;  4ENN A;  2HVS A;  2HXO A;  1S72 I;  1LDD A;  2VE9 A;  2QBY A;  2HS5 A;  1LKX A;  3C3W A;  3WE2 A;  5FFZ A;  1AKH B;  3K8P C;  3LAP A;  4N9H A;  1D1B A;  1OCT C;  2CQK A;  2MGQ A;  3LFK A;  1R9T J;  2XGX A;  2LP0 A;  4BDY A;  2KDZ A;  3H5A A;  3D1N I;  1NK3 P;  2ZB9 A;  4DOZ A;  2XRL A;  3DKY A;  4XNF A;  3REO A;  4RBO A;  2EBI A;  2LY9 A;  2HYG D;  1Y0U A;  2EV0 A;  3FBI B;  2AS5 F;  2R7W A;  3H1C A;  3V8K A;  1ZHF A;  3J7A Y;  3WTW C;  3RQ4 A;  1ZK8 A;  5FLV A;  2DJN A;  2FD5 A;  2CUJ A;  1RZ4 A;  3GTQ J;  1ACI A;  1NHA A;  1RNL A;  1UAA A;  2FUG 2;  1ZTR A;  3ZQI A;  4ZDP A;  4RS8 A;  2E1N A;  2UWM A;  2H6C A;  3MZH A;  1YIJ I;  1K61 A;  2YVX A;  1H0M A;  1ZR4 A;  1VQ9 I;  1OCO H;  2CRG A;  3K2Z A;  1B9M A;  1OPC A;  2LKS A;  4XN0 A;  4ZYG A;  2R5Y B;  1FP1 D;  4ENJ A;  2ZO4 A;  2NS0 A;  3FIW A;  4YII A;  3HRM A;  3NPI A;  4LK0 F;  2L01 A;  4DIQ A;  3TGN A;  2G7G A;  1VQ8 I;  4MGR A;  4RB0 A;  1UHS A;  1ZR2 A;  3HZJ A;  2W24 A;  2MD5 A;  4XKW A;  3BZC A;  3FHN A;  2QZ8 A;  5ILV A;  2C6Y A;  2O7T A;  2IS6 A;  3OV8 A;  2XAH A;  3V8J A;  5ICC A;  1HDP A;  2EFQ A;  4LG0 A;  3PM1 A;  3VP5 A;  3SEQ A;  1CQT A;  1HF0 A;  1ULY A;  2M4K A;  1XG1 A;  2KHM A;  3PSI A;  3DEU A;  5L3D A;  4MTE A;  5LEJ A;  2P5V A;  3K4J A;  4CO8 A;  1SEU A;  1XMA A;  4JX6 A;  1BR2 A;  2QVO A;  3KEO A;  5GPA A;  1U5T B;  4MQV A;  3I55 I;  3BNI A;  2K3F A;  4C9Y A;  4IPA A;  1DP7 P;  3HG9 A;  3FXL A;  3F1B A;  3DTI A;  5LHG A;  3F8C A;  4I76 A;  1UMQ A;  2YUS A;  1JTY A;  1R5G A;  1W5S A;  4Y7N J;  4UUS B;  2IA0 A;  3OYI A;  2CWE A;  2ZNY A;  5HLG A;  3PPB A;  1OKR A;  3ZMZ A;  1YS7 A;  4Y3O A;  3F72 A;  3F21 A;  2ACJ A;  1BC8 C;  2XRO A;  2GUH A;  3RYR A;  5FLX Z;  3CCR I;  2CS3 A;  2GFN A;  3KYC B;  3ERE D;  2E2J J;  1J9I A;  4FQG A;  4KA4 A;  4A3K J;  2VBX A;  1W5C C;  4IRH A;  3OIO A;  1SFU A;  4EGY A;  2XAU A;  2DTR A;  3BTC A;  2XUB A;  1T33 A;  4YG2 F;  3WU2 C;  1WRJ A;  1SD4 A;  2NNN A;  4A0Z A;  2WBM A;  3BQY A;  4F52 A;  2A07 F;  3A4C A;  3CF5 F;  2HKO A;  4ENK A;  3HOX J;  1BN5 A;  4EJW A;  3K70 D;  2P6S A;  1R49 A;  1UCR A;  3W2W A;  3LA2 A;  4RMN A;  5L3G A;  1LB2 A;  2FSW A;  5F0H A;  3MMY B;  3J7A O;  1A5J A;  3SFZ A;  1MH3 A;  3O60 A;  4A0X A;  2GQQ A;  1I1S A;  3HTS B;  1PUF B;  3JRA A;  1OFC X;  4KIT B;  2DPU A;  4B44 A;  4ANJ A;  3IKV A;  2HVQ A;  4LGW A;  2IP2 A;  4I0A A;  4MFD A;  1F43 A;  3NXC A;  5IYC J;  1FLI A;  2ZCN A;  2IGM A;  3BJ6 A;  1MDM A;  1IN4 A;  1SVM A;  4UUT A;  5D8L B;  2OER A;  1VZ0 A;  2DDA A;  4YFX F;  3OYF A;  3B81 A;  2HYT A;  1FBU A;  3HSR A;  2Y0M A;  4UV9 A;  2DBB A;  4A3I J;  5FKM A;  5H2F C;  3DTK A;  3VOK A;  2L9R A;  2E7W A;  1T38 A;  3E7Q A;  1KA8 A;  3HOY J;  1VQ6 I;  2DA6 A;  1XDU A;  3ZQH A;  4HF0 A;  4OIN F;  2CJJ A;  4A12 A;  1FPQ A;  2WTE A;  2F5F A;  4XSX F;  3GUD A;  3I56 I;  3CUQ A;  2XB5 A;  4BHC A;  4IXA A;  4D0P A;  1U0J A;  2NS8 A;  3GBG A;  3HKZ A;  4OD4 A;  1Z7L A;  1XGM A;  2E1O A;  3RKW A;  3KZI C;  2PI0 A;  5AON A;  4J19 A;  1R6R A;  2IW5 A;  2V1X A;  4GYG A;  1VFC A;  2DMU A;  1K4T A;  4HX7 A;  1O57 A;  1SD5 A;  2LF7 A;  1MMD A;  3F8F A;  3PIP F;  5J4Y A;  1CGP A;  3IP4 B;  1X2M A;  2JSP A;  3DU6 A;  4LMY A;  3K4L A;  3DLL F;  3F0C A;  1I3Q J;  3HRT A;  3DPT A;  1RIO H;  2KMU A;  2NVX J;  2RQP A;  1XMK A;  4EV0 A;  2Y9Y A;  3H9J A;  3LL7 A;  4QPQ A;  1MIJ A;  1QHH D;  5FKO A;  4XLN F;  3VB2 A;  2ZNZ A;  2XF6 A;  3COA C;  1WQ2 A;  2X6X A;  1MBJ A;  1WI3 A;  2JK3 A;  2CQQ A;  2JJ7 A;  3LAJ A;  4MHG A;  3M8J A;  3OOU A;  2OD5 A;  2QQ9 A;  3TO9 A;  5K5O A;  1Y1V J;  2H8W A;  5LEK A;  3KP5 A;  2YPR A;  3IAS 2;  3COL A;  5LBQ A;  3T8T A;  3OYH A;  3EYY A;  1XN7 A;  2M5W A;  1G8X A;  2D45 A;  1FT9 A;  2DYS H;  2G0E A;  2P5K A;  5EZG A;  2R5Y A;  4KUM A;  4CYC A;  3NEU A;  1JT0 A;  2PBI A;  2DXI A;  3HC7 A;  4RAF A;  3KYL A;  2VPR A;  1LE8 A;  4B09 A;  2A6T A;  2DMP A;  1N78 A;  5CVU A;  1WH5 A;  3E3V A;  1JE8 A;  1RET A;  3LJL A;  3CME I;  3V78 A;  2AXT C;  4Z6Y A;  2DN0 A;  3DCF A;  4LB5 A;  2CQ7 A;  1BI0 A;  1YI2 I;  3RPU A;  4Y52 J;  3I9V 2;  2IAI A;  2KP6 A;  1IRX A;  1H9G A;  4BYY A;  4GFB A;  3F8M A;  1ZRC A;  5BOX A;  4DNC A;  1FMW A;  2RV8 A;  1K79 A;  1I6X A;  3G73 A;  4F3Q A;  1F5T A;  4DQ2 A;  4EEF G;  1FOW A;  2FQ3 A;  3CRJ A;  4KN7 X;  4RGX A;  5FFX A;  3E7L A;  5CW8 A;  1W4M A;  3I64 A;  3Q0W A;  2K9M A;  2V9K A;  2NVY J;  2UZK A;  2V1N A;  2D1V A;  2FRH A;  2VQH A;  1JT6 A;  4HDV A;  3OR2 C;  4HST A;  2OCC H;  3BTI A;  3PSF A;  2RAE A;  4AYB N;  3ISP A;  2R7S A;  2YR2 A;  3GO5 A;  2BXY A;  2MLG A;  1MW7 A;  1QO0 D;  1WH7 A;  3VYS B;  1IJW C;  5CXI A;  1MBE A;  3ECH A;  2XAG A;  4U7D A;  3FMS A;  4HKU A;  4RM3 A;  3S2W A;  1V55 H;  1Z1D A;  1YJ9 I;  4ZZL A;  2UXU A;  2L2O A;  2IS2 A;  5CYV A;  1X3U A;  4XRS G;  4WXD A;  2FE3 A;  3ESW B;  4Y13 A;  1IW7 F;  1IN8 A;  3BRO A;  1GT0 C;  5LD2 C;  2IU5 A;  2DG7 A;  1G3Y A;  4QTR A;  2GEN A;  3HB9 A;  2H6B A;  1D0Y A;  4PGG A;  2R7U A;  2XC7 A;  3BCB A;  2LSO A;  3V8L A;  3GZ6 A;  4BY7 J;  1IDY A;  1IUF A;  1Z9C A;  3WG7 H;  2KIQ A;  2KLO A;  1AU7 A;  2WWY A;  3CJN A;  2RHA A;  2CG4 A;  2IGO A;  2BVM A;  2BY0 A;  2XGE A;  3RKY A;  5J47 A;  3KZ9 A;  4RGS A;  3HGG A;  4PFP A;  4RB3 C;  1D0Z A;  1S5L C;  3PNT A;  3WG9 A;  3VSK A;  2PLY A;  4NEL A;  3BOQ A;  2EPF A;  3T6N A;  1GXQ A;  2MLK A;  2VBW A;  4YEL A;  4HYE A;  2IGN A;  4PK4 A;  3KP3 A;  2BHZ A;  2FNP A;  3H3V K;  1FWZ A;  3BG5 A;  4CCN A;  2I5U A;  2E1M B;  2ZKZ A;  3I58 A;  4F7Z A;  5ICF A;  4A93 J;  2JA2 A;  4NC7 A;  4IL6 C;  4NBQ A;  3CQZ J;  5KNL A;  1CF7 A;  3O8G A;  1BIA A;  2XB0 X;  3BR0 A;  5FO5 A;  4IHW A;  3CC4 I;  1A35 A;  1UG2 A;  2HQR A;  4I2O A;  2DT6 A;  2EFP A;  3RPQ A;  2BXZ A;  1OMI A;  3D0S A;  3TP3 A;  2X0L A;  4XLE A;  3BR3 A;  4G12 A;  4EJU A;  1IRG A;  2HEO A;  3L2C A;  1W36 D;  1IV8 A;  2A3S A;  1NH3 A;  3LSH A;  4GCV A;  5HDK A;  4W97 A;  5LGT A;  4IKF A;  2M0M A;  3A01 A;  4UUV A;  2GXB A;  3K6G A;  4JYK A;  1Z7U A;  3HOU J;  1UI6 A;  5C4X J;  2HOE A;  1MSF C;  2FX0 A;  2M4G A;  4ZTJ A;  3P9T A;  4ZYE A;  1XMX A;  5FMP A;  4CIC A;  1T95 A;  4HPQ A;  2GWR A;  3LFU A;  3VDX A;  2WC2 A;  4H0E A;  3IC7 A;  1YFH A;  2M87 A;  3FXO A;  3ML6 A;  3WTV C;  1MGT A;  2EK5 A;  3KLN A;  1IG7 A;  2K9N A;  2J5P A;  2VBZ A;  1FP2 A;  3VYR B;  1K7A A;  3QOE A;  3CWR A;  4EM2 A;  5FD6 A;  2F4I A;  4WCG A;  5EG0 B;  1WJE A;  3G6E I;  1R58 A;  4M9Z A;  2X48 A;  4OIR F;  3IRQ A;  2REK A;  1IRZ A;  2HDD A;  2KRF A;  3L2V A;  1LEB A;  1ZGA A;  2Y0S N;  4U87 A;  5JVG F;  1A36 A;  3NRV A;  3OMY A;  5IT3 A;  3C7J A;  1MSE C;  2WA0 A;  4M6Y A;  4AD9 A;  4HQE A;  4M74 A;  3RZD J;  4I0B A;  5FLX K;  2I10 A;  5D5W B;  2RDP A;  1D8J A;  4A3D J;  5IYB J;  1RPW A;  2QQB A;  4OIO F;  2X51 A;  1B4A A;  3R6S A;  5F0C A;  4CCJ A;  4ITV A;  1G6N A;  1YTY A;  2LOO A;  4II3 A;  3LHQ A;  2L7K A;  3HYI A;  4Y17 A;  2UXO A;  3NI7 A;  3RH2 A;  3HRS A;  3A0B C;  4IO9 F;  2MH9 A;  1QNT A;  2K85 A;  2W48 A;  4LIV A;  1ERD A;  2F4O B;  3PO3 J;  2VAS A;  2LC2 A;  4FET A;  3BG9 A;  4ETS A;  1Y6I A;  2VC1 A;  4I01 A;  3BRU A;  2K27 A;  3J7Z I;  3MKW B;  2A2F X;  2CFO A;  4CZC A;  1SAX A;  1D3Y A;  4BJ5 C;  2MFZ A;  2W00 A;  2IA1 A;  3M1E A;  4HZF A;  1YRN B;  3S2D J;  4IOC F;  3BHQ A;  3HKZ N;  3RI4 A;  3GME A;  1OYI A;  4LLG F;  2LDU A;  3A01 B;  5KCM A;  3LQQ A;  2QEN A;  3DBL B;  3OL4 A;  2DTZ A;  2XAF A;  2E5Z A;  3W6J B;  4BXU A;  5B3S H;  4LD5 A;  1X3Z B;  3K4C A;  2XVC A;  1HQC A;  2HQ5 A;  3S17 J;  3G2B A;  3S1Q J;  5IOZ A;  3K1P A;  3LSK A;  1QQI A;  2P6T A;  2BYV E;  4CCL A;  1Z3X A;  1R23 A;  4A3E J;  2BGC A;  2LBF B;  4BQO A;  2R0Q C;  1BA5 A;  2DK8 A;  2Y69 H;  5M3F J;  2VOD A;  2BW3 B;  4BQQ A;  2IT0 A;  2LRD A;  1P7I A;  2XV4 S;  4CYC B;  3ERM A;  2Y30 A;  3S1R J;  3RTR A;  1XGS A;  5CVJ A;  2JWT A;  2GIZ A;  1LE8 B;  2OPT A;  3JRI A;  4X1E A;  2R5Z A;  3QPL A;  1VQL I;  5EYR A;  4NDL A;  1ZH5 A;  3BZ6 A;  3BQZ A;  4M6X A;  3L1P A;  3VWB A;  3N05 A;  1VQN I;  5HDG A;  1MJB A;  4FE7 A;  5IPA A;  2AQF A;  3GX4 X;  2V9P A;  4CYD A;  3GEU A;  2Y0S A;  4MEY F;  2DA7 A;  5FRM A;  3AKZ A;  4PXI A;  2K5C A;  3BG7 A;  1MMG A;  1VQM I;  1PDN C;  3U9G A;  2LVS A;  4UB6 C;  1U6G A;  3W6V A;  4WWC A;  4P5O A;  9ANT A;  4I7H A;  4C2M A;  4I02 A;  1Z21 A;  2EIN H;  3JRF A;  1RES A;  2MAB A;  3G1O A;  2NRA C;  4HF1 A;  1YIT I;  1MNE A;  1S29 A;  3LSG A;  2XDV A;  4PJJ A;  1WZ2 A;  5J6X A;  4RAY A;  1MD0 A;  1QPI A;  2ZCM A;  3A2K A;  1YS6 A;  3SZP A;  4YFK F;  3A03 A;  4U9L A;  4PZJ A;  3U2R A;  1M1E B;  1GLN A;  3JW4 A;  2IBD A;  5BPD A;  4DYC A;  3AG4 H;  4BH9 A;  1D5V A;  4IHV A;  4XOR A;  3PUB A;  3ECO A;  4KWA A;  4ON0 A;  2OZ6 A;  4IEJ A;  3MAJ A;  1POG A;  1IF1 A;  2WV1 A;  2WAQ A;  3K4B A;  3LA7 A;  2DFE A;  4D7N A;  4OMZ A;  5HLI A;  2L0K A;  3GTG J;  1Z77 A;  4XBF A;  2DPD A;  2VBY A;  3QYE A;  2QCO A;  3QYB A;  5CLS A;  2E19 A;  3F23 A;  5K7F A;  1DQU A;  2M45 A;  5F08 A;  1X1D A;  4V2G A;  1S6L A;  4P1W A;  3WU1 B;  1ONV A;  1WVR A;  4UVA A;  1W7P D;  1MDM B;  5BNG A;  3S3N A;  3GFI A;  2WAE A;  1H9T A;  2E7X A;  2V26 A;  1BL0 A;  1R4N B;  3FRQ A;  2X85 A;  2E34 A;  3QWL A;  4HOB A;  5M5W J;  3NNR A;  2LMD A;  3TDZ C;  3ABT A;  2ID6 A;  1FX7 A;  1Z05 A;  2FBK A;  1RI7 A;  4KIS A;  3DWL E;  1IN7 A;  5C3E J;  1R22 A;  3KX2 A;  1K78 A;  2JTV A;  1XSV A;  4UDS A;  5JLW A;  2W53 A;  1PVE A;  3ABU A;  4FHT A;  4E7H A;  1R4M B;  1YJW I;  2HQN A;  1BI2 A;  2XHK A;  5IP6 A;  1ETK A;  2V79 A;  3IH2 A;  1HXD A;  3BTJ A;  2A69 F;  2PN6 A;  2JSC A;  1APL C;  3JTG A;  2FJI 1;  5JFR A;  1FBQ A;  2HDW A;  4PSX A;  5J1Y A;  2OTJ I;  1MZB A;  3PIO F;  1YIO A;  1ZYR F;  2K02 A;  2YS9 A;  4NQW A;  3RJP A;  1Y8R B;  2KZV A;  5F0F A;  1G4D A;  3S1N J;  1D8K A;  2EIK H;  2VJ4 A;  2FJ1 A;  3R0J A;  1RC9 A;  2D1H A;  3CJD A;  2DQL A;  2OZU A;  1BI3 A;  4I6Z A;  1F9N A;  1NG6 A;  3EDP A;  3K69 A;  5E3O A;  4PGH A;  3S2H J;  4A5M A;  3JSO A;  3MKZ A;  3CMY A;  2STW A;  4AC6 A;  5L3C A;  4JKZ A;  1HBX G;  6PAX A;  4EAT A;  3M4O J;  4JX5 A;  3FXM A;  2A05 A;  1WJA A;  4M72 A;  2AO9 A;  3GFM A;  2WY7 Q;  1TL8 A;  2OQR A;  1EJ9 A;  3VVZ A;  3RPU D;  4E4H A;  1HOM A;  2COB A;  1X1C A;  1E3P A;  3KET A;  2A61 A;  2DU9 A;  4C2T A;  2Q2E B;  1P7J A;  3HOZ J;  4HRI A;  2HTJ A;  3FMR A;  3DF8 A;  3HIM A;  1WCM J;  2CW0 F;  2DQR A;  3F6V A;  5JHU A;  2A68 F;  1SFX A;  3QQA A;  2HFH A;  1B72 A;  1LEA A;  4XLF A;  1CF7 B;  3MCZ A;  2EZI A;  4AU7 A;  5FGL A;  1XB4 A;  2JVG A;  4A3C J;  2VUM J;  4CHU A;  1OYY A;  5BQT A;  3KPH A;  3KNW A;  2IGK A;  4AC0 A;  4OIP F;  4N4O B;  1NK2 P;  2DCE A;  1JGG A;  1R1T A;  1SAU A;  3I3L A;  3E6B A;  4XRS A;  3MEX A;  2OF7 A;  3DLA A;  2IEK A;  2QIB A;  4FX4 A;  3NAR A;  4UV8 A;  1F1Z A;  3TL4 X;  3N4M A;  4OMY A;  3K0L A;  3OY9 A;  3LQR A;  2NXN B;  1Z91 A;  4M9S A;  2CUE A;  3IH3 A;  4BBR J;  3K1N A;  2YSR A;  5DM6 F;  4EJT A;  3ZMS A;  5GP9 A;  2W57 A;  1T39 A;  2VQL A;  5GAH J;  2DYR H;  2VOO A;  1UHM A;  3LSP A;  2L4M A;  3RD3 A;  4JQF A;  2VQG A;  5E18 F;  4HBL A;  2VL8 A;  1F4K A;  3P5J A;  4BUP A;  4CSW A;  4RA2 A;  3SHF A;  2G7H A;  3SDB A;  3ZQL A;  3N97 A;  1MJA A;  2RNJ A;  3ZQG A;  2CSO A;  1G59 A;  4GCT A;  3WTS C;  1WHU A;  3H3U A;  3DKW A;  4I98 B;  3FWE A;  2MA3 A;  2O9L A;  2VXZ A;  4N4N B;  2MSY A;  4G94 A;  4KIB A;  4PJN A;  5GAG J;  2XPU A;  4MO7 A;  4IHX A;  3HJE A;  2F5V A;  4M3F A;  4U0W A;  3C07 A;  4KIC A;  1EH8 A;  5IT9 K;  4FAS D;  4G7Z F;  3C1D A;  2KJB A;  5E3N A;  1FYL A;  4KT5 C;  2WV0 A;  5FHP A;  1XGO A;  5H6R A;  3DBH B;  3S16 J;  1ETY A;  1SC7 A;  4DGW B;  2HOT A;  3FZV A;  2O03 A;  4ZYH A;  3Q0U A;  3CP2 A;  2R7V A;  2QLZ A;  5IYD J;  1O7L A;  2M2E A;  1ZKG A;  2W82 A;  3FXR A;  3SFI A;  4A3F J;  2ZOZ A;  2K86 A;  2ISZ A;  5E1Z B;  4ACI A;  3PNV A;  1LUJ B;  4GCL A;  4DZP A;  4M3D A;  4PFO A;  5CQE A;  3WOD F;  2XGC A;  2NNY A;  3AAF A;  3HM5 A;  3NWT A;  2LD5 A;  1ZG1 A;  4IOA F;  2P0W A;  3QU6 A;  1DU0 A;  2UV1 A;  3RKX A;  1EH7 A;  1KQ9 A;  5KVR A;  2COM A;  3D5S C;  3QPT A;  4MEX F;  3OWT A;  2FOK A;  2ZBK A;  4A3G J;  1G2H A;  2ZY9 A;  3IKT A;  2F2E A;  4CGR A;  4JK1 X;  3HTU A;  3L7W A;  2K9S A;  2E71 A;  2L02 A;  3ZMD A;  3NQO A;  4ENM A;  4QLC U;  1HSJ A;  2VKV A;  3VIB A;  2DI3 A;  3CO6 C;  2CYY A;  2K7L A;  5HDN A;  5EFY A;  3FM5 A;  1MBH A;  2VON A;  5LGN A;  2O6G E;  1W7P B;  3CZ6 A;  2UXP A;  1D0X A;  2KIU A;  2VLA A;  4YIR X;  1X1B A;  5KK1 A;  2EV5 A;  4ESF A;  2OAZ A;  2R7Q A;  4XLC A;  3CCV I;  1S9H A;  5ILU A;  1ODD A;  2FF4 A;  5C4J J;  1K83 J;  4K2E A;  3F8N A;  1OLT A;  1FNN A;  3QOP A;  5ICG A;  4BQA A;  1VQ4 I;  4Y4R A;  3HOS A;  3E1S A;  5ICE A;  1PUE E;  4BJ6 C;  2FBQ A;  3KEY A;  3UNG C;  1UEL B;  1LVK A;  2IPQ X;  4L5E A;  1Z6T A;  4L9J A;  4PSW A;  4AID A;  3CLQ A;  4LB6 B;  5D5V B;  4Q47 A;  5E1W A;  5H20 A;  5IP7 J;  2KIF A;  4XOT A;  2W1O A;  4D9J A;  3M07 A;  3L09 A;  3AQT A;  2QYO A;  5DV5 A;  3LMM A;  1H8A C;  2OBP A;  5K1Y A;  2L9S A;  1B6A A;  2KT0 A;  3K10 A;  5CKT A;  3X2Q H;  2GOM A;  4YRV A;  3HTI A;  5EF6 A;  5HVQ C;  2R3S A;  5F1J A;  3AG3 H;  1FEX A;  3IHU A;  1R00 A;  1TW3 A;  3GZ5 A;  4B48 A;  2D5V A;  4X6A J;  1TBX A;  1XGN A;  1EKE A;  1N75 A;  2M8G X;  2DT5 A;  2M7A A;  2WUI A;  2YX7 A;  4JBA A;  2ADU A;  4MFE A;  3OYG A;  3E0J B;  2UXH A;  1VQO I;  1Y0N A;  1ZAR A;  1KYZ A;  5FKL A;  5BS6 A;  2DO7 A;  3PNY A;  3G7R A;  3HPG A;  2NX4 A;  1LDK B;  2BBY A;  2R7D A;  3QP5 A;  4HV6 A;  2ME0 A;  1Q1V A;  1V5F A;  2HU9 A;  2QSH X;  1IO2 A;  3ZQ7 A;  2K4B A;  5IY5 H;  1R5H A;  4XSZ F;  5LGU A;  2VE8 A;  2JT1 A;  4X0G A;  3GZI A;  5GAE J;  1C0W A;  2EZH A;  1VQ5 I;  3S93 A;  1S7A A;  4IRI A;  5CVI A;  2HPI A;  2VJI A;  3CP8 A;  1T0F C;  5K5Q A;  2JZY A;  1SD7 A;  2EQR A;  2MC3 A;  3CMM A;  3HOV J;  4B8X A;  4XKV A;  3K70 C;  1U5T A;  3DKX A;  3HUG B;  3HGY A;  3L2Q A;  4MQ9 F;  1OCR H;  3ZPL A;  3L9F A;  3HBL A;  4AYB A;  1TWG J;  4ZC3 A;  3NAU A;  5HOO A;  1O3Q A;  3QBM A;  2Z1D A;  5EGO A;  1P4A A;  2ELK A;  2B3W A;  5B5E C;  3NS4 A;  2QKO A;  4D5C A;  2EFW A;  1QU3 A;  3BJO A;  4GRI A;  4BXX J;  2QWT A;  2ZFU A;  3ZCO A;  2R7R A;  1FYM A;  3BG6 A;  5E1X A;  1ETW A;  1JKO C;  3FXJ A;  3L2U A;  2FML A;  3E6C C;  4XKC A;  4A3B J;  2LRE A;  3R61 A;  2DA3 A;  1V5E A;  3Q0V A;  1QGP A;  2PEX A;  3GLX A;  4BU2 A;  4J01 A;  2ZXI A;  3BCG A;  2HWV A;  5F27 A;  4HG2 A;  1W36 C;  2VPL A;  1SMT A;  1ETO A;  1P2F A; 
#chains in the Genus database with same CATH homology
 2JA6 J;  2M0C A;  1MBG A;  2XSD C;  3ON4 A;  3BTL A;  1QRY A;  2ECC A;  3RKQ A;  1YRN B;  4S0H B;  3S2D J;  3BHQ A;  3HKZ N;  1OCP A;  1JUP A;  1JTX A;  2M34 A;  3A01 B;  3HTJ A;  5HAW A;  1WGX A;  1JUM A;  3QKX A;  4GCK A;  2DTZ A;  1GV2 A;  3G1M A;  4XIC A;  1JJ6 C;  5D19 A;  1LFU P;  2HXO A;  2K9Q A;  5JLX A;  5M5X J;  4XRM A;  2LK2 A;  2HQ5 A;  5EZH A;  1ZQ3 P;  5FJ8 J;  2E2I J;  5IOZ A;  3S17 J;  3S1Q J;  1AKH B;  3ZQF A;  3VUQ A;  1OCT C;  1H88 C;  2MGQ A;  4A3E J;  1F36 A;  2R0Q C;  1BA5 A;  2Y31 A;  5M3F J;  1R9T J;  2TCT A;  4HNV A;  4ME9 A;  2H8R A;  2LP0 A;  2KDZ A;  3D1N I;  1P7I A;  1H89 C;  1NK3 P;  1GUU A;  1JKP C;  2ZB9 A;  4CYC B;  2Y30 A;  3S1R J;  2XRL A;  5AQC A;  4RBO A;  1ENH A;  1PUF A;  1XS9 A;  2JWT A;  1MBF A;  1LE8 B;  2EBI A;  2LY9 A;  2OPT A;  2ME6 A;  4D7M A;  5HOD A;  4MXM A;  3JRI A;  4X1E A;  1VND A;  2R5Z A;  2LLK A;  2WB1 N;  3IUV A;  3QPL A;  5EYR A;  3RZO J;  3GTK J;  4NDL A;  4B4C A;  2YVH A;  1ZK8 A;  5FLV A;  3BQZ A;  2DJN A;  2FD5 A;  3HTH A;  2GLO A;  5C44 J;  3L1P A;  3GTQ J;  4XK4 A;  1ZTR A;  3ZQI A;  1OJL A;  4FE7 A;  5IPA A;  3GEU A;  1K61 A;  1ZR4 A;  3RQI A;  2DA7 A;  3MVP A;  2NS7 A;  1ETX A;  3V6G A;  3JRH A;  4PXI A;  2CRG A;  2R5Y B;  3LOC A;  2JA8 J;  2LVS A;  2R93 J;  3W6V A;  2HXI A;  2DA2 A;  2QF7 A;  3FIW A;  9ANT A;  2R92 J;  3JRF A;  1RES A;  3NPI A;  4A3M J;  3G1O A;  3ZQC A;  3VVY A;  3K2A A;  3LSG A;  1U9N A;  1BJZ A;  2G7G A;  1UHS A;  1ZR2 A;  1SGM A;  2ZCM A;  1QPI A;  3A03 A;  2PBX A;  3GTP J;  2O7T A;  2JA7 J;  1D5Y A;  1VF9 A;  2F07 A;  4XID A;  4BY1 J;  3VP5 A;  1HDP A;  1ETQ A;  3G1L A;  3PM1 A;  3VW2 A;  1CQT A;  1HF0 A;  5EEA A;  2IBD A;  1XG1 A;  3H0G J;  3FIS A;  4DYC A;  3JRE A;  4IHV A;  5DAJ A;  4JX6 A;  2MW8 A;  4KWA A;  5GPA A;  3PAS A;  5EDN A;  3BNI A;  4IEJ A;  4QSH A;  1POG A;  3BJB A;  2WV1 A;  3JRB A;  2V57 A;  4D7N A;  2L0K A;  3GTG J;  1Z77 A;  1JJ8 C;  3F1B A;  4I76 A;  1UMQ A;  2ID3 A;  2YUS A;  1JTY A;  2QCO A;  2VKE A;  5DTD A;  4Y7N J;  4UUS B;  4JNN A;  3PPB A;  2E19 A;  3QPS A;  1RKT A;  1JUS A;  5K7F A;  2NVQ J;  2GUH A;  5F08 A;  3LNQ A;  2GFN A;  1JKQ C;  4V2G A;  4RDU A;  3EUP A;  4C3J J;  3TED A;  2E2J J;  4A3K J;  3A02 A;  3WHB A;  4FIS A;  3OIO A;  2G3B A;  1TWC J;  3EGQ A;  3BTC A;  4M3E A;  1T33 A;  1ETV A;  3FKI J;  5BNG A;  5F04 A;  3BQY A;  2HOA A;  3HOX J;  4DZJ A;  3I4M J;  2QOP A;  1BL0 A;  3FRQ A;  1MNM C;  5M5W J;  3NNR A;  2NVT J;  3S1M J;  4C3I J;  2ID6 A;  4QIW N;  3LSR A;  3JR9 A;  4MLO A;  2Y2Z A;  5F0H A;  4FCY A;  5C3E J;  1A5J A;  4B1R A;  1DU6 A;  1NTC A;  1MH3 A;  1U8B A;  3O60 A;  3ON2 A;  4UDS A;  5JLW A;  1TWF J;  2W53 A;  1ORK A;  4M3B A;  1B8I A;  1PUF B;  5IP6 A;  3JRA A;  1OFC X;  4IHY A;  1WPK A;  1ETK A;  3IH2 A;  2O7O A;  3BTJ A;  1APL C;  5J1Y A;  3S14 J;  2L7M P;  2XPV A;  4YZE A;  2YS9 A;  2L7F P;  5F0F A;  2XDN A;  4MFD A;  3S1N J;  1F43 A;  3NXC A;  5IYC J;  2ZCN A;  3UKG A;  2FJ1 A;  1IV6 A;  3S5R A;  4JX4 A;  1MH4 A;  2OER A;  4UUT A;  3CJD A;  3M3Y J;  3ANP A;  2FQ4 A;  1FJL A;  3B81 A;  2HYT A;  4I6Z A;  2GBY A;  5E3O A;  3S2H J;  3TP0 A;  4A3I J;  5FKM A;  1IC8 A;  1VI0 A;  3VOK A;  2L9R A;  4MIM A;  3CMY A;  3E7Q A;  4FTH A;  3HOY J;  4AC6 A;  3B6A A;  2DA6 A;  5K7Z A;  3ZQH A;  4JKZ A;  5FKK A;  5IP9 J;  3SJM A;  1GV5 A;  2CJJ A;  3ANG A;  3TW7 A;  3M4O J;  3G56 A;  4MK6 A;  4JX5 A;  1B72 B;  2XB5 A;  3K7A J;  2PZ9 A;  4B3A A;  2AO9 A;  2NS8 A;  3GBG A;  3OSF A;  3VVZ A;  1HOM A;  3GTL J;  4BKX A;  2AHQ A;  2VI6 A;  2COB A;  2E1O A;  2B63 J;  1ITY A;  2Q24 A;  3KKC A;  4A3L J;  4J19 A;  1UI5 A;  2H1K A;  1VFC A;  2UXI A;  1P7J A;  4V2F A;  3HOZ J;  2DMU A;  4W1U A;  5IOY A;  1I6H J;  3HIM A;  1WCM J;  1X2N A;  3QQA A;  4L62 A;  1RR7 A;  1U78 A;  1TWH J;  1B72 A;  1W0U A;  2EZI A;  5FGL A;  1X2M A;  4A3C J;  2VUM J;  3F0C A;  1I3Q J;  5M3M J;  2E2H J;  2O8K A;  3JRG A;  2NVX J;  3HDD A;  3KNW A;  2Y9Y A;  1IDZ A;  4UUS A;  3MN2 A;  2DG8 A;  5HSZ A;  5FKO A;  4AC0 A;  3CCY A;  1O4X A;  1FIP A;  1NK2 P;  5E3L A;  1JGG A;  1MBJ A;  1WI3 A;  2ZCX A;  4M6V A;  4XRS A;  2JK3 A;  2CQQ A;  2IEK A;  2OF7 A;  2QIB A;  2JJ7 A;  1HDD C;  3NAR A;  5FLM J;  2M9H A;  2WAQ N;  1LFB A;  3OOU A;  1SFO J;  2HYJ A;  1Y1V J;  3LSJ A;  2XPW A;  3COL A;  2HOS A;  2CUE A;  3IH3 A;  4C2M J;  4BBR J;  5E3M A;  2G0E A;  2LR8 A;  5GP9 A;  5EZG A;  3HEF A;  2R5Y A;  4CYC A;  1FTZ A;  2HKU A;  1JT0 A;  4A69 C;  1W0T A;  2VPR A;  3LSP A;  1LE8 A;  3RD3 A;  2DMP A;  2K40 A;  2GM4 A;  1WH5 A;  1X58 A;  2YU9 J;  1RET A;  3LJL A;  3V78 A;  2DN0 A;  3DCF A;  3ZQL A;  3ZQG A;  2CQX A;  4A3J J;  4GCT A;  4Y52 J;  3I4N J;  2IAI A;  4GFB A;  4AF5 A;  1BW5 A;  2O9L A;  3BR6 A;  3CDL A;  1HCR A;  4EEF G;  4GFK A;  3CRJ A;  2MSY A;  3E7L A;  2XPU A;  4MO7 A;  2R5Z B;  4M3F A;  4C3H J;  3IV5 A;  3Q0W A;  4IHX A;  5CW8 A;  2NVY J;  3ZOB A;  3C07 A;  1GVD A;  1FTT A;  1JT6 A;  3GTM J;  5E3N A;  5J1U A;  3HOW J;  5FHP A;  1TWA J;  3S16 J;  1ETY A;  2HOT A;  3BTI A;  2R7Z J;  3DEW A;  3IH4 A;  3GTO J;  4M3G A;  2EZK A;  3Q0U A;  2RAE A;  4AYB N;  5D1R A;  5IYD J;  2M2E A;  1ZKG A;  3FK7 A;  2DMQ A;  3SFI A;  4A3F J;  2ZOZ A;  3VW1 A;  1IJW C;  1WH7 A;  5D18 A;  2PMZ N;  5CXI A;  4ACI A;  1MBE A;  3BT9 A;  4GCL A;  4DZP A;  4M3D A;  2XGC A;  4HKU A;  3VW0 A;  3HM5 A;  3S15 J;  2LD5 A;  2UXU A;  1YRN A;  3B6C A;  2X9D A;  1DU0 A;  4D5F A;  2TRT A;  4XRS G;  3BR2 A;  4LOC A;  5M5Y J;  4A3G J;  1G2H A;  3C2B A;  4CGR A;  2DA5 A;  1GT0 C;  1GDT A;  2JN6 A;  5K7H A;  2K9S A;  3BG3 A;  2DG7 A;  2IU5 A;  4QTR A;  2MG4 A;  2GEN A;  3HB9 A;  1B8I B;  2JMW A;  2VKV A;  3VIB A;  4ABZ A;  2YVE A;  2WGB A;  5EFY A;  1MBH A;  2XGD A;  4BY7 J;  5GPC A;  1IDY A;  2UXP A;  1IUF A;  3JRC A;  4ICH A;  1T56 A;  1SAN A;  3VOX A;  1HLV A;  1AU7 A;  3BR5 A;  3Q3S A;  4NN1 A;  5C4J J;  2RHA A;  1K83 J;  3VPR A;  1Y1W J;  2XGE A;  4DYR A;  3HTA A;  3KZ9 A;  1FIA A;  3HGG A;  3OSG A;  1IGN A;  2FBQ A;  2G7S A;  3NRG A;  3DPJ A;  4L5E A;  3PO2 J;  4NEL A;  3T6N A;  2L7Z A;  1QVU A;  4FE4 A;  5IP7 J;  3H3V K;  3AQS A;  3BG5 A;  4DW6 A;  2QTQ A;  2ZOY A;  2NOG A;  5J3L A;  3KKD A;  4A93 J;  3AQT A;  5C4Y A;  1H8A C;  3CQZ J;  2N8G A;  2KT0 A;  3O8G A;  2XB0 X;  3BR0 A;  4IHW A;  5H9T A;  3HTI A;  5EF6 A;  1QVT A;  1UG2 A;  4BBS J;  5F1J A;  3TP3 A;  2DA4 A;  1FEX A;  4JL3 A;  3BR3 A;  2D5V A;  4G12 A;  4X6A J;  2LFB A;  2M8G X;  3GTJ J;  3MKL A;  2WUI A;  2LKX A;  4MFE A;  2UXH A;  4W97 A;  3A01 A;  1BW6 A;  5FKL A;  4JYK A;  1A6I A;  3HOU J;  2P81 A;  1AHD P;  5C4X J;  1UI6 A;  3JSJ A;  3G7R A;  2NX4 A;  4AUX A;  1MSF C;  3BR1 A;  2DA1 A;  2FX0 A;  3P9T A;  2RAS A;  1EF4 A;  2ME0 A;  5FMP A;  1Q1V A;  3SDG A;  3GZI A;  3MNL A;  1E3O C;  3TW6 A;  1JKR C;  2EZH A;  1IG7 A;  2K9N A;  1ZGW A;  1MBK A;  5CXG A;  5EGO B;  3CWR A;  1S7E A;  5EG0 B;  3HE0 A;  2HI3 A;  2LTP A;  2X48 A;  2REK A;  5K58 A;  1IRZ A;  2HDD A;  2EQR A;  3FK6 A;  2Y0S N;  3HOV J;  5DS9 A;  4GFL A;  2JA5 J;  4JP0 A;  3HGY A;  3LWJ A;  1U9O A;  2CUF A;  5J1R A;  3HBL A;  1MSE C;  1RKW A;  1TWG J;  3NAU A;  3RZD J;  2I10 A;  3QBM A;  5EGO A;  1AKH A;  1Z0X A;  2ELK A;  5EG0 A;  4A3D J;  5IYB J;  1RPW A;  5FKN A;  2DMN A;  4DYQ A;  2DMT A;  2QKO A;  5F0C A;  4D5C A;  2Y9Z A;  5HBU A;  2EZL A;  2QWT A;  4BXX J;  2CU7 A;  3LHQ A;  1ETW A;  1JKO C;  3VVX A;  2UXO A;  3NI7 A;  2NP3 A;  1XC5 A;  3O8H A;  3RH2 A;  4A3B J;  2X6O A;  2ECB A;  2DA3 A;  2OI8 A;  3JRD A;  2W48 A;  3Q0V A;  2EH3 A;  3PO3 J;  3BCG A;  5F27 A;  3BG9 A;  3WHC A;  3BRU A;  1I50 J;  2G7L A;  2D6Y A;  1TC3 C;  1ETO A;  2NP5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...