2Q24A

Crystal structure of tetr transcriptional regulator sco0520 from streptomyces coelicolor
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
173
structure length
173
Chain Sequence
NRDKILAAAVRVFSEEGLDAHLERIAREAGVGSGTLYRNFPTREALIEAAYRNEVARLCDSVPGLLAELPPAEALRAWTRRFIDYATAKLGMADALRAVVASGGDPYGDSRQLIQSALTALMDAAAAAGEIRSDIRSTDMFAALAGIALTSSRPDQRAQAERLLDLVLDGLRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative tetR family transcriptional regulator
publication title Crystal structure of a putative transcriptional regulator SCO0520 from Streptomyces coelicolor A3(2) reveals an unusual dimer among TetR family proteins.
pubmed doi rcsb
source organism Streptomyces coelicolor a3(2)
molecule tags Transcription
total genus 63
structure length 173
sequence length 173
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2q24A00
5AQCA 3IH3A 1Z0XA 3KKDA 3IH4A 3ZQGA 4NELA 4MXMA 3CRJA 4NN1A 5F0FA 3IUVA 4YZEA 5GPAA 5F08A 5FKLA 4GFLA 3AQTA 5F27A 3G7RA 3VUQA 5FGLA 2O7OA 1U9OA 3VVZA 3VOXA 3COLA 5IPAA 1T33A 5EZGA 2NX4A 3ON4A 3NPIA 4UDSA 1ZK8A 2IEKA 2Q24A 3NRGA 3CJDA 2YVHA 5D19A 1BJZA 1ORKA 2DG8A 2XB5A 2VPRA 5HAWA 3BR6A 3GZIA 4AUXA 1ZKGA 1RKTA 1JUSA 2W53A 3Q3SA 4W1UA 2VKEA 3G1OA 2HQ5A 3HTAA 4GCKA 3JSJA 3QKXA 1JUPA 3LJLA 5IOYA 3BJBA 2NS7A 4JNNA 4GCTA 5FKNA 2G7LA 3LSPA 4M3EA 2XRLA 5EFYA 3BR0A 4M3FA 3QBMA 4ABZA 2UXOA 3Q0VA 1QPIA 3FK7A 4L62A 3CCYA 4ACIA 3VVYA 5F0HA 2I10A 1RPWA 2Y30A 4D7MA 2XDNA 3ON2A 3LWJA 1T56A 5J1YA 3HTIA 2G0EA 1SGMA 2XGEA 2HXIA 3BNIA 3BTIA 3LSRA 1QVUA 3LHQA 3SFIA 2QWTA 3C07A 5F04A 5F1JA 3BR1A 3NXCA 2X9DA 5CXGA 2UXPA 3WHCA 2NP3A 5K7ZA 3CWRA 2RASA 3O8GA 3VW1A 3VIBA 1QVTA 3FRQA 4AC6A 2RHAA 2WV1A 3KZ9A 2UXIA 3NI7A 3ZQHA 3QPLA 2GFNA 3HGGA 5IP6A 3DEWA 3ANGA 2O7TA 2ZB9A 3MNLA 1Z77A 4I76A 2YVEA 5EZHA 5K58A 3QPSA 4G12A 3ANPA 2QTQA 2OERA 3VOKA 4M3GA 3WHBA 1UI6A 3HIMA 4JKZA 3GEUA 3ZQIA 1A6IA 3DPJA 3BQZA 4PXIA 4HKUA 3VW0A 3BCGA 4W97A 3G1MA 3HGYA 3LOCA 4CGRA 2D6YA 3PASA 3T6NA 1JTYA 4MK6A 3HTJA 2QKOA 2G7GA 2IBDA 4V2GA 4DW6A 3RH2A 3BHQA 3LSJA 3TP3A 2NP5A 5C4YA 3RD3A 2OI8A 2TCTA 4GCLA 2XGDA 1JUMA 3KNWA 2IAIA 2UXUA 2HYTA 2QOPA 4JL3A 3C2BA 3Q0UA 3PM1A 3QQAA 4AC0A 3BTLA 2ID6A 2PBXA 2NS8A 3BR5A 2V57A 1UI5A 5GPCA 5K7FA 5HSZA 2QIBA 2GBYA 3MVPA 4MO7A 4D5CA 2ZCXA 3B6CA 5FHPA 2XPVA 3AQSA 3ZQFA 2HKUA 3EGQA 1JT0A 2FQ4A 2OF7A 3PPBA 2UXHA 3FK6A 3ZQLA 2DG7A 5EYRA 3FIWA 4M3DA 2XPWA 2ID3A 5H9TA 3S5RA 5GP9A 2Y2ZA 3G1LA 2EH3A 3BTCA 3BQYA 2GUHA 2ZOZA 3TP0A 2FJ1A 4ME9A 2ZCMA 3BRUA 4I6ZA 5J3LA 3HTHA 3BTJA 3E7QA 2G3BA 3V78A 2F07A 2XPUA 2HYJA 3HE0A 5F0CA 2REKA 5J1UA 2FD5A 1U9NA 3O8HA 3BT9A 4ICHA 3Q0WA 2GENA 2ZCNA 3EUPA 3P9TA 3VVXA 3BR3A 2RAEA 2JJ7A 4GFKA 5D18A 2IU5A 5D1RA 2PZ9A 3F0CA 5FKMA 3VP5A 4AF5A 5FKKA 4KWAA 4V2FA 3BR2A 5IOZA 3NNRA 4JYKA 4D7NA 2Y31A 1JT6A 3O60A 2TRTA 2ZOYA 4M3BA 2FX0A 3F1BA 5CW8A 2JK3A 3DCFA 3KKCA 2DTZA 4B1RA 1VI0A 2VKVA 4X1EA 2G7SA 2FBQA 2QCOA 5J1RA 3CDLA 4XK4A 5K7HA 1RKWA 4B3AA 2X6OA 3V6GA 5CXIA 3SDGA 3G56A 3VW2A 2XGCA 1JTXA 5FMPA 3VPRA 4D5FA 5DAJA 5HBUA 2OPTA 3B6AA 2HXOA 3IH2A 2WGBA 5FKOA 2WUIA 3B81A
chains in the Genus database with same CATH superfamily
5AQCA 3IH3A 1Z0XA 3KKDA 3IH4A 3ZQGA 4NELA 4MXMA 3CRJA 2R7WA 4NN1A 5F0FA 3IUVA 4YZEA 2R7TA 5GPAA 5F08A 5FKLA 2PFVA 4GFLA 3AQTA 5F27A 3G7RA 3VUQA 5FGLA 2O7OA 1U9OA 3VVZA 3VOXA 3COLA 5IPAA 1T33A 5EZGA 2NX4A 3ON4A 3NPIA 2R7SA 4UDSA 1ZK8A 2IEKA 2Q24A 2R7OA 3NRGA 3CJDA 4IRVA 2YVHA 5D19A 1BJZA 1ORKA 2DG8A 2XB5A 2VPRA 5HAWA 3BR6A 3GZIA 4AUXA 1ZKGA 1RKTA 1JUSA 2W53A 3Q3SA 4W1UA 2VKEA 3G1OA 2HQ5A 3HTAA 4GCKA 3JSJA 2ZY9A 3QKXA 1JUPA 3LJLA 5IOYA 3BJBA 2NS7A 4JNNA 4GCTA 5FKNA 2G7LA 3LSPA 4M3EA 2XRLA 5EFYA 3BR0A 4M3FA 3QBMA 4ABZA 2UXOA 3Q0VA 2A2FX 1QPIA 3DU5A 3FK7A 4L62A 3CCYA 4ACIA 3VVYA 5F0HA 2I10A 1RPWA 2Y30A 4D7MA 2XDNA 3ON2A 3LWJA 1T56A 5J1YA 3HTIA 2G0EA 1SGMA 2XGEA 2HXIA 4U9NA 3BNIA 3BTIA 3LSRA 1QVUA 3LHQA 3SFIA 2QWTA 3C07A 5F04A 5F1JA 3BR1A 3NXCA 2X9DA 5CXGA 2UXPA 4OD5A 3WHCA 2NP3A 4U9LA 5K7ZA 3CWRA 2RASA 3FHNA 3O8GA 3VW1A 3VIBA 1QVTA 3FRQA 4AC6A 2RHAA 2WV1A 3KZ9A 2UXIA 3NI7A 3ZQHA 3QPLA 2GFNA 3HGGA 5IP6A 3DEWA 3ANGA 2O7TA 2ZB9A 3MNLA 1Z77A 4I76A 2YVEA 5EZHA 5K58A 3QPSA 4G12A 3ANPA 2QTQA 5CQGA 2OERA 3VOKA 4M3GA 3WHBA 1UI6A 3HIMA 4JKZA 3GEUA 3ZQIA 1A6IA 3DPJA 3BQZA 4PXIA 4HKUA 3VTIA 3VW0A 3BCGA 4W97A 3G1MA 3HGYA 2B1EA 3LOCA 4CGRA 2D6YA 3PASA 3T6NA 1JTYA 4MK6A 3HTJA 2QKOA 2G7GA 2IBDA 2B3WA 4V2GA 4DW6A 3RH2A 3BHQA 3LSJA 3TP3A 2NP5A 5C4YA 3RD3A 2OI8A 2TCTA 4GCLA 2XGDA 1JUMA 3KNWA 2IAIA 2UXUA 2HYTA 2QOPA 4JL3A 3C2BA 3Q0UA 3PM1A 3QQAA 4AC0A 3BTLA 2ID6A 2PBXA 2NS8A 3BR5A 2V57A 3KYLA 1UI5A 5GPCA 5K7FA 5HSZA 2QIBA 2YVXA 2GBYA 3MVPA 4MO7A 4D5CA 2ZCXA 3B6CA 3NS4A 5FHPA 2XPVA 3AQSA 3ZQFA 2HKUA 3EGQA 1JT0A 2FQ4A 2OF7A 3PPBA 2UXHA 3FK6A 3ZQLA 2DG7A 5EYRA 3FIWA 4M3DA 2XPWA 2ID3A 5H9TA 3S5RA 5GP9A 2Y2ZA 3G1LA 2EH3A 3BTCA 3BQYA 2GUHA 2ZOZA 3TP0A 2R7UA 2FJ1A 4OD4A 4ME9A 2ZCMA 3BRUA 4I6ZA 5J3LA 3DU6A 3HTHA 3BTJA 3E7QA 2G3BA 3V78A 2F07A 2XPUA 2HYJA 3HE0A 5F0CA 2REKA 5J1UA 3SWHA 2FD5A 1U9NA 3O8HA 3BT9A 4ICHA 2R7XA 3Q0WA 2GENA 2ZCNA 3EUPA 3P9TA 3VVXA 2R7VA 2R7RA 3BR3A 2RAEA 2JJ7A 4GFKA 5D18A 2IU5A 5D1RA 2PZ9A 2FJI1 4WIBA 3F0CA 4DVYP 5FKMA 3VP5A 4AF5A 5FKKA 4KWAA 4V2FA 3BR2A 2R7QA 5IOZA 3NNRA 3K8PC 4JYKA 4D7NA 2Y31A 1JT6A 3O60A 2TRTA 2ZOYA 4M3BA 2FX0A 3F1BA 5CW8A 2JK3A 3DCFA 3KKCA 2DTZA 4B1RA 1VI0A 2VKVA 4X1EA 2G7SA 2FBQA 2QCOA 5J1RA 3CDLA 4XK4A 5K7HA 1RKWA 4B3AA 2X6OA 3V6GA 5CXIA 3SDGA 3G56A 3VW2A 2XGCA 1JTXA 5FMPA 3VPRA 4D5FA 5DAJA 5HBUA 2OPTA 3B6AA 2HXOA 3IH2A 4C2MA 2WGBA 5FKOA 2WUIA 3B81A
chains in the Genus database with same CATH topology
5AQCA 3IH3A 1Z0XA 3KKDA 3IH4A 3ZQGA 4NELA 4MXMA 3CRJA 4NN1A 5F0FA 3IUVA 4YZEA 5GPAA 5F08A 5FKLA 4GFLA 3AQTA 5F27A 3G7RA 3VUQA 5FGLA 2O7OA 1U9OA 3VVZA 3VOXA 3COLA 5IPAA 1T33A 5EZGA 2NX4A 3ON4A 3NPIA 4UDSA 1ZK8A 2IEKA 2Q24A 3NRGA 3CJDA 2YVHA 5D19A 1BJZA 1ORKA 2DG8A 2XB5A 2VPRA 5HAWA 3BR6A 3GZIA 4AUXA 1ZKGA 1RKTA 1JUSA 2W53A 3Q3SA 4W1UA 2VKEA 3G1OA 2HQ5A 3HTAA 4GCKA 3JSJA 3QKXA 1JUPA 3LJLA 5IOYA 3BJBA 2NS7A 4JNNA 4GCTA 5FKNA 2G7LA 3LSPA 4M3EA 2XRLA 5EFYA 3BR0A 4M3FA 3QBMA 4ABZA 2UXOA 3Q0VA 1QPIA 3FK7A 4L62A 3CCYA 4ACIA 3VVYA 5F0HA 2I10A 1RPWA 2Y30A 4D7MA 2XDNA 3ON2A 3LWJA 1T56A 5J1YA 3HTIA 2G0EA 1SGMA 2XGEA 2HXIA 3BNIA 3BTIA 3LSRA 1QVUA 3LHQA 3SFIA 2QWTA 3C07A 5F04A 5F1JA 3BR1A 3NXCA 2X9DA 5CXGA 2UXPA 3WHCA 2NP3A 5K7ZA 3CWRA 2RASA 3O8GA 3VW1A 3VIBA 1QVTA 3FRQA 4AC6A 2RHAA 2WV1A 3KZ9A 2UXIA 3NI7A 3ZQHA 3QPLA 2GFNA 3HGGA 5IP6A 3DEWA 3ANGA 2O7TA 2ZB9A 3MNLA 1Z77A 4I76A 2YVEA 5EZHA 5K58A 3QPSA 4G12A 3ANPA 2QTQA 2OERA 3VOKA 4M3GA 3WHBA 1UI6A 3HIMA 4JKZA 3GEUA 3ZQIA 1A6IA 3DPJA 3BQZA 4PXIA 4HKUA 3VW0A 3BCGA 4W97A 3G1MA 3HGYA 3LOCA 4CGRA 2D6YA 3PASA 3T6NA 1JTYA 4MK6A 3HTJA 2QKOA 2G7GA 2IBDA 4V2GA 4DW6A 3RH2A 3BHQA 3LSJA 3TP3A 2NP5A 5C4YA 3RD3A 2OI8A 2TCTA 4GCLA 2XGDA 1JUMA 3KNWA 2IAIA 2UXUA 2HYTA 2QOPA 4JL3A 3C2BA 3Q0UA 3PM1A 3QQAA 4AC0A 3BTLA 2ID6A 2PBXA 2NS8A 3BR5A 2V57A 1UI5A 5GPCA 5K7FA 5HSZA 2QIBA 2GBYA 3MVPA 4MO7A 4D5CA 2ZCXA 3B6CA 5FHPA 2XPVA 3AQSA 3ZQFA 2HKUA 3EGQA 1JT0A 2FQ4A 2OF7A 3PPBA 2UXHA 3FK6A 3ZQLA 2DG7A 5EYRA 3FIWA 4M3DA 2XPWA 2ID3A 5H9TA 3S5RA 5GP9A 2Y2ZA 3G1LA 2EH3A 3BTCA 3BQYA 2GUHA 2ZOZA 3TP0A 2FJ1A 4ME9A 2ZCMA 3BRUA 4I6ZA 5J3LA 3HTHA 3BTJA 3E7QA 2G3BA 3V78A 2F07A 2XPUA 2HYJA 3HE0A 5F0CA 2REKA 5J1UA 2FD5A 1U9NA 3O8HA 3BT9A 4ICHA 3Q0WA 2GENA 2ZCNA 3EUPA 3P9TA 3VVXA 3BR3A 2RAEA 2JJ7A 4GFKA 5D18A 2IU5A 5D1RA 2PZ9A 3F0CA 5FKMA 3VP5A 4AF5A 5FKKA 4KWAA 4V2FA 3BR2A 5IOZA 3NNRA 4JYKA 4D7NA 2Y31A 1JT6A 3O60A 2TRTA 2ZOYA 4M3BA 2FX0A 3F1BA 5CW8A 2JK3A 3DCFA 3KKCA 2DTZA 4B1RA 1VI0A 2VKVA 4X1EA 2G7SA 2FBQA 2QCOA 5J1RA 3CDLA 4XK4A 5K7HA 1RKWA 4B3AA 2X6OA 3V6GA 5CXIA 3SDGA 3G56A 3VW2A 2XGCA 1JTXA 5FMPA 3VPRA 4D5FA 5DAJA 5HBUA 2OPTA 3B6AA 2HXOA 3IH2A 2WGBA 5FKOA 2WUIA 3B81A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AQC A;  3IH3 A;  1Z0X A;  3KKD A;  3IH4 A;  3ZQG A;  4NEL A;  4MXM A;  3CRJ A;  4NN1 A;  5F0F A;  3IUV A;  4YZE A;  5GPA A;  5F08 A;  5FKL A;  4GFL A;  3AQT A;  5F27 A;  3G7R A;  3VUQ A;  5FGL A;  2O7O A;  1U9O A;  3VVZ A;  3VOX A;  3COL A;  5IPA A;  1T33 A;  5EZG A;  2NX4 A;  3ON4 A;  3NPI A;  4UDS A;  1ZK8 A;  2IEK A;  2Q24 A;  3NRG A;  3CJD A;  2YVH A;  5D19 A;  1BJZ A;  1ORK A;  2DG8 A;  2XB5 A;  2VPR A;  5HAW A;  3BR6 A;  3GZI A;  4AUX A;  1ZKG A;  1RKT A;  1JUS A;  2W53 A;  3Q3S A;  4W1U A;  2VKE A;  3G1O A;  2HQ5 A;  3HTA A;  4GCK A;  3JSJ A;  3QKX A;  1JUP A;  3LJL A;  5IOY A;  3BJB A;  2NS7 A;  4JNN A;  4GCT A;  5FKN A;  2G7L A;  3LSP A;  4M3E A;  2XRL A;  5EFY A;  3BR0 A;  4M3F A;  3QBM A;  4ABZ A;  2UXO A;  3Q0V A;  1QPI A;  3FK7 A;  4L62 A;  3CCY A;  4ACI A;  3VVY A;  5F0H A;  2I10 A;  1RPW A;  2Y30 A;  4D7M A;  2XDN A;  3ON2 A;  3LWJ A;  1T56 A;  5J1Y A;  3HTI A;  2G0E A;  1SGM A;  2XGE A;  2HXI A;  3BNI A;  3BTI A;  3LSR A;  1QVU A;  3LHQ A;  3SFI A;  2QWT A;  3C07 A;  5F04 A;  5F1J A;  3BR1 A;  3NXC A;  2X9D A;  5CXG A;  2UXP A;  3WHC A;  2NP3 A;  5K7Z A;  3CWR A;  2RAS A;  3O8G A;  3VW1 A;  3VIB A;  1QVT A;  3FRQ A;  4AC6 A;  2RHA A;  2WV1 A;  3KZ9 A;  2UXI A;  3NI7 A;  3ZQH A;  3QPL A;  2GFN A;  3HGG A;  5IP6 A;  3DEW A;  3ANG A;  2O7T A;  2ZB9 A;  3MNL A;  1Z77 A;  4I76 A;  2YVE A;  5EZH A;  5K58 A;  3QPS A;  4G12 A;  3ANP A;  2QTQ A;  2OER A;  3VOK A;  4M3G A;  3WHB A;  1UI6 A;  3HIM A;  4JKZ A;  3GEU A;  3ZQI A;  1A6I A;  3DPJ A;  3BQZ A;  4PXI A;  4HKU A;  3VW0 A;  3BCG A;  4W97 A;  3G1M A;  3HGY A;  3LOC A;  4CGR A;  2D6Y A;  3PAS A;  3T6N A;  1JTY A;  4MK6 A;  3HTJ A;  2QKO A;  2G7G A;  2IBD A;  4V2G A;  4DW6 A;  3RH2 A;  3BHQ A;  3LSJ A;  3TP3 A;  2NP5 A;  5C4Y A;  3RD3 A;  2OI8 A;  2TCT A;  4GCL A;  2XGD A;  1JUM A;  3KNW A;  2IAI A;  2UXU A;  2HYT A;  2QOP A;  4JL3 A;  3C2B A;  3Q0U A;  3PM1 A;  3QQA A;  4AC0 A;  3BTL A;  2ID6 A;  2PBX A;  2NS8 A;  3BR5 A;  2V57 A;  1UI5 A;  5GPC A;  5K7F A;  5HSZ A;  2QIB A;  2GBY A;  3MVP A;  4MO7 A;  4D5C A;  2ZCX A;  3B6C A;  5FHP A;  2XPV A;  3AQS A;  3ZQF A;  2HKU A;  3EGQ A;  1JT0 A;  2FQ4 A;  2OF7 A;  3PPB A;  2UXH A;  3FK6 A;  3ZQL A;  2DG7 A;  5EYR A;  3FIW A;  4M3D A;  2XPW A;  2ID3 A;  5H9T A;  3S5R A;  5GP9 A;  2Y2Z A;  3G1L A;  2EH3 A;  3BTC A;  3BQY A;  2GUH A;  2ZOZ A;  3TP0 A;  2FJ1 A;  4ME9 A;  2ZCM A;  3BRU A;  4I6Z A;  5J3L A;  3HTH A;  3BTJ A;  3E7Q A;  2G3B A;  3V78 A;  2F07 A;  2XPU A;  2HYJ A;  3HE0 A;  5F0C A;  2REK A;  5J1U A;  2FD5 A;  1U9N A;  3O8H A;  3BT9 A;  4ICH A;  3Q0W A;  2GEN A;  2ZCN A;  3EUP A;  3P9T A;  3VVX A;  3BR3 A;  2RAE A;  2JJ7 A;  4GFK A;  5D18 A;  2IU5 A;  5D1R A;  2PZ9 A;  3F0C A;  5FKM A;  3VP5 A;  4AF5 A;  5FKK A;  4KWA A;  4V2F A;  3BR2 A;  5IOZ A;  3NNR A;  4JYK A;  4D7N A;  2Y31 A;  1JT6 A;  3O60 A;  2TRT A;  2ZOY A;  4M3B A;  2FX0 A;  3F1B A;  5CW8 A;  2JK3 A;  3DCF A;  3KKC A;  2DTZ A;  4B1R A;  1VI0 A;  2VKV A;  4X1E A;  2G7S A;  2FBQ A;  2QCO A;  5J1R A;  3CDL A;  4XK4 A;  5K7H A;  1RKW A;  4B3A A;  2X6O A;  3V6G A;  5CXI A;  3SDG A;  3G56 A;  3VW2 A;  2XGC A;  1JTX A;  5FMP A;  3VPR A;  4D5F A;  5DAJ A;  5HBU A;  2OPT A;  3B6A A;  2HXO A;  3IH2 A;  2WGB A;  5FKO A;  2WUI A;  3B81 A; 
#chains in the Genus database with same CATH topology
 5AQC A;  3IH3 A;  1Z0X A;  3KKD A;  3IH4 A;  3ZQG A;  4NEL A;  4MXM A;  3CRJ A;  2R7W A;  4NN1 A;  5F0F A;  3IUV A;  4YZE A;  2R7T A;  5GPA A;  5F08 A;  5FKL A;  2PFV A;  4GFL A;  3AQT A;  5F27 A;  3G7R A;  3VUQ A;  5FGL A;  2O7O A;  1U9O A;  3VVZ A;  3VOX A;  3COL A;  5IPA A;  1T33 A;  5EZG A;  2NX4 A;  3ON4 A;  3NPI A;  2R7S A;  4UDS A;  1ZK8 A;  2IEK A;  2Q24 A;  2R7O A;  3NRG A;  3CJD A;  4IRV A;  2YVH A;  5D19 A;  1BJZ A;  1ORK A;  2DG8 A;  2XB5 A;  2VPR A;  5HAW A;  3BR6 A;  3GZI A;  4AUX A;  1ZKG A;  1RKT A;  1JUS A;  2W53 A;  3Q3S A;  4W1U A;  2VKE A;  3G1O A;  2HQ5 A;  3HTA A;  4GCK A;  3JSJ A;  2ZY9 A;  3QKX A;  1JUP A;  3LJL A;  5IOY A;  3BJB A;  2NS7 A;  4JNN A;  4GCT A;  5FKN A;  2G7L A;  3LSP A;  4M3E A;  2XRL A;  5EFY A;  3BR0 A;  4M3F A;  3QBM A;  4ABZ A;  2UXO A;  3Q0V A;  2A2F X;  1QPI A;  3DU5 A;  3FK7 A;  4L62 A;  3CCY A;  4ACI A;  3VVY A;  5F0H A;  2I10 A;  1RPW A;  2Y30 A;  4D7M A;  2XDN A;  3ON2 A;  3LWJ A;  1T56 A;  5J1Y A;  3HTI A;  2G0E A;  1SGM A;  2XGE A;  2HXI A;  4U9N A;  3BNI A;  3BTI A;  3LSR A;  1QVU A;  3LHQ A;  3SFI A;  2QWT A;  3C07 A;  5F04 A;  5F1J A;  3BR1 A;  3NXC A;  2X9D A;  5CXG A;  2UXP A;  4OD5 A;  3WHC A;  2NP3 A;  4U9L A;  5K7Z A;  3CWR A;  2RAS A;  3FHN A;  3O8G A;  3VW1 A;  3VIB A;  1QVT A;  3FRQ A;  4AC6 A;  2RHA A;  2WV1 A;  3KZ9 A;  2UXI A;  3NI7 A;  3ZQH A;  3QPL A;  2GFN A;  3HGG A;  5IP6 A;  3DEW A;  3ANG A;  2O7T A;  2ZB9 A;  3MNL A;  1Z77 A;  4I76 A;  2YVE A;  5EZH A;  5K58 A;  3QPS A;  4G12 A;  3ANP A;  2QTQ A;  5CQG A;  2OER A;  3VOK A;  4M3G A;  3WHB A;  1UI6 A;  3HIM A;  4JKZ A;  3GEU A;  3ZQI A;  1A6I A;  3DPJ A;  3BQZ A;  4PXI A;  4HKU A;  3VTI A;  3VW0 A;  3BCG A;  4W97 A;  3G1M A;  3HGY A;  2B1E A;  3LOC A;  4CGR A;  2D6Y A;  3PAS A;  3T6N A;  1JTY A;  4MK6 A;  3HTJ A;  2QKO A;  2G7G A;  2IBD A;  2B3W A;  4V2G A;  4DW6 A;  3RH2 A;  3BHQ A;  3LSJ A;  3TP3 A;  2NP5 A;  5C4Y A;  3RD3 A;  2OI8 A;  2TCT A;  4GCL A;  2XGD A;  1JUM A;  3KNW A;  2IAI A;  2UXU A;  2HYT A;  2QOP A;  4JL3 A;  3C2B A;  3Q0U A;  3PM1 A;  3QQA A;  4AC0 A;  3BTL A;  2ID6 A;  2PBX A;  2NS8 A;  3BR5 A;  2V57 A;  3KYL A;  1UI5 A;  5GPC A;  5K7F A;  5HSZ A;  2QIB A;  2YVX A;  2GBY A;  3MVP A;  4MO7 A;  4D5C A;  2ZCX A;  3B6C A;  3NS4 A;  5FHP A;  2XPV A;  3AQS A;  3ZQF A;  2HKU A;  3EGQ A;  1JT0 A;  2FQ4 A;  2OF7 A;  3PPB A;  2UXH A;  3FK6 A;  3ZQL A;  2DG7 A;  5EYR A;  3FIW A;  4M3D A;  2XPW A;  2ID3 A;  5H9T A;  3S5R A;  5GP9 A;  2Y2Z A;  3G1L A;  2EH3 A;  3BTC A;  3BQY A;  2GUH A;  2ZOZ A;  3TP0 A;  2R7U A;  2FJ1 A;  4OD4 A;  4ME9 A;  2ZCM A;  3BRU A;  4I6Z A;  5J3L A;  3DU6 A;  3HTH A;  3BTJ A;  3E7Q A;  2G3B A;  3V78 A;  2F07 A;  2XPU A;  2HYJ A;  3HE0 A;  5F0C A;  2REK A;  5J1U A;  3SWH A;  2FD5 A;  1U9N A;  3O8H A;  3BT9 A;  4ICH A;  2R7X A;  3Q0W A;  2GEN A;  2ZCN A;  3EUP A;  3P9T A;  3VVX A;  2R7V A;  2R7R A;  3BR3 A;  2RAE A;  2JJ7 A;  4GFK A;  5D18 A;  2IU5 A;  5D1R A;  2PZ9 A;  2FJI 1;  4WIB A;  3F0C A;  4DVY P;  5FKM A;  3VP5 A;  4AF5 A;  5FKK A;  4KWA A;  4V2F A;  3BR2 A;  2R7Q A;  5IOZ A;  3NNR A;  3K8P C;  4JYK A;  4D7N A;  2Y31 A;  1JT6 A;  3O60 A;  2TRT A;  2ZOY A;  4M3B A;  2FX0 A;  3F1B A;  5CW8 A;  2JK3 A;  3DCF A;  3KKC A;  2DTZ A;  4B1R A;  1VI0 A;  2VKV A;  4X1E A;  2G7S A;  2FBQ A;  2QCO A;  5J1R A;  3CDL A;  4XK4 A;  5K7H A;  1RKW A;  4B3A A;  2X6O A;  3V6G A;  5CXI A;  3SDG A;  3G56 A;  3VW2 A;  2XGC A;  1JTX A;  5FMP A;  3VPR A;  4D5F A;  5DAJ A;  5HBU A;  2OPT A;  3B6A A;  2HXO A;  3IH2 A;  4C2M A;  2WGB A;  5FKO A;  2WUI A;  3B81 A; 
#chains in the Genus database with same CATH homology
 5AQC A;  3IH3 A;  1Z0X A;  3KKD A;  3IH4 A;  3ZQG A;  4NEL A;  4MXM A;  3CRJ A;  4NN1 A;  5F0F A;  3IUV A;  4YZE A;  5GPA A;  5F08 A;  5FKL A;  4GFL A;  3AQT A;  5F27 A;  3G7R A;  3VUQ A;  5FGL A;  2O7O A;  1U9O A;  3VVZ A;  3VOX A;  3COL A;  5IPA A;  1T33 A;  5EZG A;  2NX4 A;  3ON4 A;  3NPI A;  4UDS A;  1ZK8 A;  2IEK A;  2Q24 A;  3NRG A;  3CJD A;  2YVH A;  5D19 A;  1BJZ A;  1ORK A;  2DG8 A;  2XB5 A;  2VPR A;  5HAW A;  3BR6 A;  3GZI A;  4AUX A;  1ZKG A;  1RKT A;  1JUS A;  2W53 A;  3Q3S A;  4W1U A;  2VKE A;  3G1O A;  2HQ5 A;  3HTA A;  4GCK A;  3JSJ A;  3QKX A;  1JUP A;  3LJL A;  5IOY A;  3BJB A;  2NS7 A;  4JNN A;  4GCT A;  5FKN A;  2G7L A;  3LSP A;  4M3E A;  2XRL A;  5EFY A;  3BR0 A;  4M3F A;  3QBM A;  4ABZ A;  2UXO A;  3Q0V A;  1QPI A;  3FK7 A;  4L62 A;  3CCY A;  4ACI A;  3VVY A;  5F0H A;  2I10 A;  1RPW A;  2Y30 A;  4D7M A;  2XDN A;  3ON2 A;  3LWJ A;  1T56 A;  5J1Y A;  3HTI A;  2G0E A;  1SGM A;  2XGE A;  2HXI A;  3BNI A;  3BTI A;  3LSR A;  1QVU A;  3LHQ A;  3SFI A;  2QWT A;  3C07 A;  5F04 A;  5F1J A;  3BR1 A;  3NXC A;  2X9D A;  5CXG A;  2UXP A;  3WHC A;  2NP3 A;  5K7Z A;  3CWR A;  2RAS A;  3O8G A;  3VW1 A;  3VIB A;  1QVT A;  3FRQ A;  4AC6 A;  2RHA A;  2WV1 A;  3KZ9 A;  2UXI A;  3NI7 A;  3ZQH A;  3QPL A;  2GFN A;  3HGG A;  5IP6 A;  3DEW A;  3ANG A;  2O7T A;  2ZB9 A;  3MNL A;  1Z77 A;  4I76 A;  2YVE A;  5EZH A;  5K58 A;  3QPS A;  4G12 A;  3ANP A;  2QTQ A;  2OER A;  3VOK A;  4M3G A;  3WHB A;  1UI6 A;  3HIM A;  4JKZ A;  3GEU A;  3ZQI A;  1A6I A;  3DPJ A;  3BQZ A;  4PXI A;  4HKU A;  3VW0 A;  3BCG A;  4W97 A;  3G1M A;  3HGY A;  3LOC A;  4CGR A;  2D6Y A;  3PAS A;  3T6N A;  1JTY A;  4MK6 A;  3HTJ A;  2QKO A;  2G7G A;  2IBD A;  4V2G A;  4DW6 A;  3RH2 A;  3BHQ A;  3LSJ A;  3TP3 A;  2NP5 A;  5C4Y A;  3RD3 A;  2OI8 A;  2TCT A;  4GCL A;  2XGD A;  1JUM A;  3KNW A;  2IAI A;  2UXU A;  2HYT A;  2QOP A;  4JL3 A;  3C2B A;  3Q0U A;  3PM1 A;  3QQA A;  4AC0 A;  3BTL A;  2ID6 A;  2PBX A;  2NS8 A;  3BR5 A;  2V57 A;  1UI5 A;  5GPC A;  5K7F A;  5HSZ A;  2QIB A;  2GBY A;  3MVP A;  4MO7 A;  4D5C A;  2ZCX A;  3B6C A;  5FHP A;  2XPV A;  3AQS A;  3ZQF A;  2HKU A;  3EGQ A;  1JT0 A;  2FQ4 A;  2OF7 A;  3PPB A;  2UXH A;  3FK6 A;  3ZQL A;  2DG7 A;  5EYR A;  3FIW A;  4M3D A;  2XPW A;  2ID3 A;  5H9T A;  3S5R A;  5GP9 A;  2Y2Z A;  3G1L A;  2EH3 A;  3BTC A;  3BQY A;  2GUH A;  2ZOZ A;  3TP0 A;  2FJ1 A;  4ME9 A;  2ZCM A;  3BRU A;  4I6Z A;  5J3L A;  3HTH A;  3BTJ A;  3E7Q A;  2G3B A;  3V78 A;  2F07 A;  2XPU A;  2HYJ A;  3HE0 A;  5F0C A;  2REK A;  5J1U A;  2FD5 A;  1U9N A;  3O8H A;  3BT9 A;  4ICH A;  3Q0W A;  2GEN A;  2ZCN A;  3EUP A;  3P9T A;  3VVX A;  3BR3 A;  2RAE A;  2JJ7 A;  4GFK A;  5D18 A;  2IU5 A;  5D1R A;  2PZ9 A;  3F0C A;  5FKM A;  3VP5 A;  4AF5 A;  5FKK A;  4KWA A;  4V2F A;  3BR2 A;  5IOZ A;  3NNR A;  4JYK A;  4D7N A;  2Y31 A;  1JT6 A;  3O60 A;  2TRT A;  2ZOY A;  4M3B A;  2FX0 A;  3F1B A;  5CW8 A;  2JK3 A;  3DCF A;  3KKC A;  2DTZ A;  4B1R A;  1VI0 A;  2VKV A;  4X1E A;  2G7S A;  2FBQ A;  2QCO A;  5J1R A;  3CDL A;  4XK4 A;  5K7H A;  1RKW A;  4B3A A;  2X6O A;  3V6G A;  5CXI A;  3SDG A;  3G56 A;  3VW2 A;  2XGC A;  1JTX A;  5FMP A;  3VPR A;  4D5F A;  5DAJ A;  5HBU A;  2OPT A;  3B6A A;  2HXO A;  3IH2 A;  2WGB A;  5FKO A;  2WUI A;  3B81 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...