2Q24A

Crystal structure of tetr transcriptional regulator sco0520 from streptomyces coelicolor
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
173
structure length
173
Chain Sequence
b'NRDKILAAAVRVFSEEGLDAHLERIAREAGVGSGTLYRNFPTREALIEAAYRNEVARLCDSVPGLLAELPPAEALRAWTRRFIDYATAKLGMADALRAVVASGGDPYGDSRQLIQSALTALMDAAAAAGEIRSDIRSTDMFAALAGIALTSSRPDQRAQAERLLDLVLDGLRP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative tetR family transcriptional regulator
molecule tags Transcription
source organism Streptomyces coelicolor a3(2)
publication title Crystal structure of a putative transcriptional regulator SCO0520 from Streptomyces coelicolor A3(2) reveals an unusual dimer among TetR family proteins.
pubmed doi rcsb
total genus 63
structure length 173
sequence length 173
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2q24A00
5CW8A 3HGGA 1UI6A 2W53A 2RAEA 4I76A 5C4YA 2OI8A 3QPLA 3IH3A 3BT9A 5FKOA 2ZCNA 1QPIA 3NNRA 2WGBA 4V2GA 2Y30A 3JSJA 5H9TA 3BHQA 1JT6A 4W97A 1T33A 3COLA 3BR6A 3HTIA 3QPSA 4ME9A 4W1UA 3HIMA 5FHPA 3VOKA 1JUPA 2XGDA 2XB5A 5F08A 4M3DA 5F1JA 2TRTA 3G7RA 4M3FA 3ANPA 5F0HA 3E7QA 5IOYA 4MK6A 4M3BA 4CGRA 1T56A 4KWAA 5FKNA 2XGCA 3VVYA 3LSRA 1A6IA 3Q0WA 2G7LA 3LJLA 2F07A 5FKKA 3LSPA 5HSZA 4X1EA 4PXIA 3SDGA 4MO7A 5FMPA 4YZEA 2FQ4A 3VUQA 3DPJA 3LSJA 3VW0A 4XK4A 1JUMA 2FD5A 2X9DA 1ZK8A 2DG7A 4GCKA 5EZHA 3DEWA 5DAJA 1ORKA 2GUHA 5J1UA 3VW2A 3TP3A 2OERA 2I10A 3HTHA 3TP0A 1JTXA 4ABZA 4B3AA 5FKMA 5IOZA 3AQTA 3LHQA 5EYRA 2HXIA 3ZQLA 3V6GA 1UI5A 3VVXA 3ON4A 2X6OA 3BJBA 3BR2A 3ZQGA 3ZQFA 1VI0A 2WV1A 5CXIA 2FJ1A 5K58A 3F0CA 2IEKA 2O7TA 5EZGA 3O60A 3IH4A 1ZKGA 3CCYA 3VOXA 3G1OA 2HYJA 4ACIA 2D6YA 4G12A 3B81A 3HGYA 2NX4A 2ZOYA 2ZCMA 2YVEA 5FGLA 3BTLA 5J1RA 5GPAA 1QVTA 3Q3SA 3VPRA 5F0CA 3GZIA 2TCTA 3NRGA 4NN1A 1BJZA 2G0EA 2ZB9A 2HKUA 4NELA 1Z0XA 1JUSA 2UXOA 3EUPA 3O8GA 2O7OA 4L62A 5D18A 3B6AA 3F1BA 3T6NA 3G1MA 5D1RA 5IPAA 2GBYA 2YVHA 3KKCA 1JTYA 2GENA 3KNWA 5EFYA 2NP3A 3MVPA 2NS8A 2QOPA 3V78A 3WHBA 4JKZA 5F04A 3VP5A 3LOCA 3BTJA 2UXUA 3BQZA 2G7SA 5K7ZA 3DCFA 3KKDA 4JYKA 2RASA 3CDLA 5K7HA 2XPWA 5F27A 3C2BA 5CXGA 1RKTA 4GCTA 3WHCA 2ZCXA 4AF5A 4GCLA 1SGMA 3SFIA 5J3LA 2QKOA 2XPVA 2XRLA 3GEUA 2NP5A 2XPUA 3ZQIA 3ON2A 2XDNA 2UXIA 5J1YA 4GFKA 5HAWA 3QQAA 3NPIA 3Q0VA 2NS7A 1U9OA 4JL3A 2IBDA 2V57A 4I6ZA 2FX0A 4D5CA 3CWRA 3PM1A 2QIBA 3BTIA 2JJ7A 3G1LA 3BNIA 4D5FA 2WUIA 2OPTA 2QWTA 3PASA 5D19A 2REKA 3CRJA 3BTCA 4AC0A 2QTQA 3ZQHA 4AUXA 2VKEA 2GFNA 3LWJA 3P9TA 2DG8A 5HBUA 4MXMA 2IU5A 3B6CA 3BCGA 2VKVA 4AC6A 4HKUA 2XGEA 3BRUA 4D7MA 4JNNA 3MNLA 3RH2A 3BR0A 2FBQA 4M3EA 2UXPA 4DW6A 3IH2A 1RKWA 3FIWA 5GPCA 2ID3A 3O8HA 3KZ9A 2RHAA 1RPWA 2G7GA 1QVUA 2ID6A 3VIBA 3BR1A 5GP9A 3NXCA 4GFLA 3HTJA 3CJDA 3FK6A 5IP6A 3FRQA 3Q0UA 3NI7A 3QBMA 3VW1A 2QCOA 1Z77A 4B1RA 2G3BA 5AQCA 5FKLA 2PBXA 2ZOZA 2JK3A 4D7NA 1JT0A 2VPRA 3BQYA 2IAIA 3C07A 3HTAA 4UDSA 2UXHA 3BR5A 5K7FA 2HXOA 2Q24A 3AQSA 3FK7A 4ICHA 2PZ9A 5F0FA 4V2FA 3QKXA 3IUVA 3EGQA 2DTZA 3ANGA 2OF7A 2HQ5A 3RD3A 2Y2ZA 3G56A 3VVZA 4M3GA 3BR3A 3HE0A 1U9NA 2Y31A 2EH3A 2HYTA 3PPBA 3S5RA
chains in the Genus database with same CATH superfamily
5CW8A 3HGGA 1UI6A 2W53A 2RAEA 4I76A 5C4YA 2OI8A 3QPLA 3IH3A 3BT9A 5FKOA 2ZCNA 1QPIA 3NNRA 2WGBA 4V2GA 2Y30A 3JSJA 5H9TA 3BHQA 1JT6A 4W97A 1T33A 3COLA 3BR6A 3HTIA 3QPSA 4ME9A 4W1UA 3HIMA 5FHPA 3VOKA 2FJI1 1JUPA 2B1EA 2XGDA 5CQGA 2XB5A 5F08A 4U9NA 4M3DA 5F1JA 2TRTA 3G7RA 4M3FA 3ANPA 5F0HA 3E7QA 5IOYA 4MK6A 4M3BA 4CGRA 1T56A 2PFVA 4KWAA 5FKNA 2B3WA 2XGCA 3VVYA 3LSRA 1A6IA 3Q0WA 2G7LA 3LJLA 2F07A 5FKKA 3LSPA 5HSZA 4X1EA 4IRVA 4PXIA 3SDGA 4MO7A 5FMPA 4YZEA 2FQ4A 3VUQA 3DPJA 3LSJA 4OD4A 3VW0A 4XK4A 1JUMA 2FD5A 2X9DA 1ZK8A 2DG7A 4GCKA 5EZHA 3K8PC 3DEWA 5DAJA 1ORKA 2GUHA 5J1UA 3VW2A 3TP3A 2OERA 2I10A 3HTHA 3TP0A 1JTXA 4ABZA 4B3AA 5FKMA 2R7WA 5IOZA 3AQTA 3LHQA 5EYRA 2HXIA 3ZQLA 3V6GA 2R7VA 1UI5A 3VVXA 3FHNA 3ON4A 2X6OA 3BJBA 3BR2A 3ZQGA 3ZQFA 1VI0A 2WV1A 5CXIA 2FJ1A 5K58A 3F0CA 2IEKA 2O7TA 5EZGA 3O60A 3IH4A 1ZKGA 4U9LA 3CCYA 3VOXA 3G1OA 2HYJA 4ACIA 2R7RA 2D6YA 4G12A 3B81A 3HGYA 4OD5A 2NX4A 2ZOYA 2ZCMA 2YVEA 5FGLA 3BTLA 3NS4A 5J1RA 5GPAA 1QVTA 3Q3SA 3VPRA 5F0CA 3GZIA 2TCTA 3NRGA 4NN1A 1BJZA 2G0EA 2ZB9A 2HKUA 4NELA 1Z0XA 1JUSA 2UXOA 3VTIA 3EUPA 3O8GA 2O7OA 4L62A 5D18A 3B6AA 3F1BA 3T6NA 2YVXA 2R7QA 3G1MA 5D1RA 5IPAA 2GBYA 2R7XA 2YVHA 3KKCA 1JTYA 2GENA 2R7OA 3KNWA 5EFYA 2NP3A 3MVPA 2NS8A 2QOPA 3V78A 3WHBA 4JKZA 5F04A 3VP5A 3LOCA 3BTJA 2UXUA 3BQZA 2G7SA 5K7ZA 3DCFA 3KKDA 4JYKA 2RASA 3CDLA 5K7HA 2XPWA 5F27A 3C2BA 5CXGA 1RKTA 4GCTA 3WHCA 2ZCXA 4AF5A 4GCLA 1SGMA 3SFIA 5J3LA 2QKOA 2XPVA 2XRLA 3GEUA 2NP5A 2XPUA 2R7UA 3ZQIA 3ON2A 2XDNA 2UXIA 5J1YA 4GFKA 5HAWA 3QQAA 3NPIA 3Q0VA 2NS7A 1U9OA 4JL3A 2IBDA 2V57A 4I6ZA 2FX0A 4D5CA 3CWRA 3PM1A 2QIBA 3BTIA 2JJ7A 2R7SA 3G1LA 3BNIA 4D5FA 2WUIA 2OPTA 2QWTA 3PASA 5D19A 2REKA 3CRJA 3BTCA 4AC0A 2QTQA 3SWHA 3ZQHA 4AUXA 2VKEA 2GFNA 3LWJA 3P9TA 2DG8A 5HBUA 4MXMA 2IU5A 3B6CA 3BCGA 2VKVA 4AC6A 4HKUA 2XGEA 3BRUA 4D7MA 4JNNA 3MNLA 3RH2A 3BR0A 2FBQA 4M3EA 2UXPA 4DW6A 3IH2A 1RKWA 3FIWA 5GPCA 2ID3A 3O8HA 3KZ9A 2RHAA 1RPWA 2G7GA 1QVUA 2ID6A 3VIBA 3BR1A 5GP9A 3NXCA 4GFLA 3HTJA 3CJDA 4DVYP 3FK6A 5IP6A 3FRQA 3Q0UA 3NI7A 3QBMA 3VW1A 2QCOA 1Z77A 4B1RA 2G3BA 2ZY9A 5AQCA 3DU5A 5FKLA 2PBXA 2ZOZA 2JK3A 4D7NA 1JT0A 2VPRA 3BQYA 2IAIA 3C07A 3HTAA 4UDSA 2UXHA 3BR5A 5K7FA 2HXOA 2Q24A 3AQSA 3FK7A 4ICHA 2PZ9A 5F0FA 4V2FA 3QKXA 3IUVA 3EGQA 2DTZA 3ANGA 2OF7A 3KYLA 2HQ5A 3RD3A 2Y2ZA 3G56A 2A2FX 3VVZA 4M3GA 4WIBA 3BR3A 3HE0A 1U9NA 2Y31A 2EH3A 4C2MA 2R7TA 3DU6A 2HYTA 3PPBA 3S5RA
chains in the Genus database with same CATH topology
5CW8A 3HGGA 1UI6A 2W53A 2RAEA 4I76A 5C4YA 2OI8A 3QPLA 3IH3A 3BT9A 5FKOA 2ZCNA 1QPIA 3NNRA 2WGBA 4V2GA 2Y30A 3JSJA 5H9TA 3BHQA 1JT6A 4W97A 1T33A 3COLA 3BR6A 3HTIA 3QPSA 4ME9A 4W1UA 3HIMA 5FHPA 3VOKA 1JUPA 2XGDA 2XB5A 5F08A 4M3DA 5F1JA 2TRTA 3G7RA 4M3FA 3ANPA 5F0HA 3E7QA 5IOYA 4MK6A 4M3BA 4CGRA 1T56A 4KWAA 5FKNA 2XGCA 3VVYA 3LSRA 1A6IA 3Q0WA 2G7LA 3LJLA 2F07A 5FKKA 3LSPA 5HSZA 4X1EA 4PXIA 3SDGA 4MO7A 5FMPA 4YZEA 2FQ4A 3VUQA 3DPJA 3LSJA 3VW0A 4XK4A 1JUMA 2FD5A 2X9DA 1ZK8A 2DG7A 4GCKA 5EZHA 3DEWA 5DAJA 1ORKA 2GUHA 5J1UA 3VW2A 3TP3A 2OERA 2I10A 3HTHA 3TP0A 1JTXA 4ABZA 4B3AA 5FKMA 5IOZA 3AQTA 3LHQA 5EYRA 2HXIA 3ZQLA 3V6GA 1UI5A 3VVXA 3ON4A 2X6OA 3BJBA 3BR2A 3ZQGA 3ZQFA 1VI0A 2WV1A 5CXIA 2FJ1A 5K58A 3F0CA 2IEKA 2O7TA 5EZGA 3O60A 3IH4A 1ZKGA 3CCYA 3VOXA 3G1OA 2HYJA 4ACIA 2D6YA 4G12A 3B81A 3HGYA 2NX4A 2ZOYA 2ZCMA 2YVEA 5FGLA 3BTLA 5J1RA 5GPAA 1QVTA 3Q3SA 3VPRA 5F0CA 3GZIA 2TCTA 3NRGA 4NN1A 1BJZA 2G0EA 2ZB9A 2HKUA 4NELA 1Z0XA 1JUSA 2UXOA 3EUPA 3O8GA 2O7OA 4L62A 5D18A 3B6AA 3F1BA 3T6NA 3G1MA 5D1RA 5IPAA 2GBYA 2YVHA 3KKCA 1JTYA 2GENA 3KNWA 5EFYA 2NP3A 3MVPA 2NS8A 2QOPA 3V78A 3WHBA 4JKZA 5F04A 3VP5A 3LOCA 3BTJA 2UXUA 3BQZA 2G7SA 5K7ZA 3DCFA 3KKDA 4JYKA 2RASA 3CDLA 5K7HA 2XPWA 5F27A 3C2BA 5CXGA 1RKTA 4GCTA 3WHCA 2ZCXA 4AF5A 4GCLA 1SGMA 3SFIA 5J3LA 2QKOA 2XPVA 2XRLA 3GEUA 2NP5A 2XPUA 3ZQIA 3ON2A 2XDNA 2UXIA 5J1YA 4GFKA 5HAWA 3QQAA 3NPIA 3Q0VA 2NS7A 1U9OA 4JL3A 2IBDA 2V57A 4I6ZA 2FX0A 4D5CA 3CWRA 3PM1A 2QIBA 3BTIA 2JJ7A 3G1LA 3BNIA 4D5FA 2WUIA 2OPTA 2QWTA 3PASA 5D19A 2REKA 3CRJA 3BTCA 4AC0A 2QTQA 3ZQHA 4AUXA 2VKEA 2GFNA 3LWJA 3P9TA 2DG8A 5HBUA 4MXMA 2IU5A 3B6CA 3BCGA 2VKVA 4AC6A 4HKUA 2XGEA 3BRUA 4D7MA 4JNNA 3MNLA 3RH2A 3BR0A 2FBQA 4M3EA 2UXPA 4DW6A 3IH2A 1RKWA 3FIWA 5GPCA 2ID3A 3O8HA 3KZ9A 2RHAA 1RPWA 2G7GA 1QVUA 2ID6A 3VIBA 3BR1A 5GP9A 3NXCA 4GFLA 3HTJA 3CJDA 3FK6A 5IP6A 3FRQA 3Q0UA 3NI7A 3QBMA 3VW1A 2QCOA 1Z77A 4B1RA 2G3BA 5AQCA 5FKLA 2PBXA 2ZOZA 2JK3A 4D7NA 1JT0A 2VPRA 3BQYA 2IAIA 3C07A 3HTAA 4UDSA 2UXHA 3BR5A 5K7FA 2HXOA 2Q24A 3AQSA 3FK7A 4ICHA 2PZ9A 5F0FA 4V2FA 3QKXA 3IUVA 3EGQA 2DTZA 3ANGA 2OF7A 2HQ5A 3RD3A 2Y2ZA 3G56A 3VVZA 4M3GA 3BR3A 3HE0A 1U9NA 2Y31A 2EH3A 2HYTA 3PPBA 3S5RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CW8 A;  3HGG A;  1UI6 A;  2W53 A;  2RAE A;  4I76 A;  5C4Y A;  2OI8 A;  3QPL A;  3IH3 A;  3BT9 A;  5FKO A;  2ZCN A;  1QPI A;  3NNR A;  2WGB A;  4V2G A;  2Y30 A;  3JSJ A;  5H9T A;  3BHQ A;  1JT6 A;  4W97 A;  1T33 A;  3COL A;  3BR6 A;  3HTI A;  3QPS A;  4ME9 A;  4W1U A;  3HIM A;  5FHP A;  3VOK A;  1JUP A;  2XGD A;  2XB5 A;  5F08 A;  4M3D A;  5F1J A;  2TRT A;  3G7R A;  4M3F A;  3ANP A;  5F0H A;  3E7Q A;  5IOY A;  4MK6 A;  4M3B A;  4CGR A;  1T56 A;  4KWA A;  5FKN A;  2XGC A;  3VVY A;  3LSR A;  1A6I A;  3Q0W A;  2G7L A;  3LJL A;  2F07 A;  5FKK A;  3LSP A;  5HSZ A;  4X1E A;  4PXI A;  3SDG A;  4MO7 A;  5FMP A;  4YZE A;  2FQ4 A;  3VUQ A;  3DPJ A;  3LSJ A;  3VW0 A;  4XK4 A;  1JUM A;  2FD5 A;  2X9D A;  1ZK8 A;  2DG7 A;  4GCK A;  5EZH A;  3DEW A;  5DAJ A;  1ORK A;  2GUH A;  5J1U A;  3VW2 A;  3TP3 A;  2OER A;  2I10 A;  3HTH A;  3TP0 A;  1JTX A;  4ABZ A;  4B3A A;  5FKM A;  5IOZ A;  3AQT A;  3LHQ A;  5EYR A;  2HXI A;  3ZQL A;  3V6G A;  1UI5 A;  3VVX A;  3ON4 A;  2X6O A;  3BJB A;  3BR2 A;  3ZQG A;  3ZQF A;  1VI0 A;  2WV1 A;  5CXI A;  2FJ1 A;  5K58 A;  3F0C A;  2IEK A;  2O7T A;  5EZG A;  3O60 A;  3IH4 A;  1ZKG A;  3CCY A;  3VOX A;  3G1O A;  2HYJ A;  4ACI A;  2D6Y A;  4G12 A;  3B81 A;  3HGY A;  2NX4 A;  2ZOY A;  2ZCM A;  2YVE A;  5FGL A;  3BTL A;  5J1R A;  5GPA A;  1QVT A;  3Q3S A;  3VPR A;  5F0C A;  3GZI A;  2TCT A;  3NRG A;  4NN1 A;  1BJZ A;  2G0E A;  2ZB9 A;  2HKU A;  4NEL A;  1Z0X A;  1JUS A;  2UXO A;  3EUP A;  3O8G A;  2O7O A;  4L62 A;  5D18 A;  3B6A A;  3F1B A;  3T6N A;  3G1M A;  5D1R A;  5IPA A;  2GBY A;  2YVH A;  3KKC A;  1JTY A;  2GEN A;  3KNW A;  5EFY A;  2NP3 A;  3MVP A;  2NS8 A;  2QOP A;  3V78 A;  3WHB A;  4JKZ A;  5F04 A;  3VP5 A;  3LOC A;  3BTJ A;  2UXU A;  3BQZ A;  2G7S A;  5K7Z A;  3DCF A;  3KKD A;  4JYK A;  2RAS A;  3CDL A;  5K7H A;  2XPW A;  5F27 A;  3C2B A;  5CXG A;  1RKT A;  4GCT A;  3WHC A;  2ZCX A;  4AF5 A;  4GCL A;  1SGM A;  3SFI A;  5J3L A;  2QKO A;  2XPV A;  2XRL A;  3GEU A;  2NP5 A;  2XPU A;  3ZQI A;  3ON2 A;  2XDN A;  2UXI A;  5J1Y A;  4GFK A;  5HAW A;  3QQA A;  3NPI A;  3Q0V A;  2NS7 A;  1U9O A;  4JL3 A;  2IBD A;  2V57 A;  4I6Z A;  2FX0 A;  4D5C A;  3CWR A;  3PM1 A;  2QIB A;  3BTI A;  2JJ7 A;  3G1L A;  3BNI A;  4D5F A;  2WUI A;  2OPT A;  2QWT A;  3PAS A;  5D19 A;  2REK A;  3CRJ A;  3BTC A;  4AC0 A;  2QTQ A;  3ZQH A;  4AUX A;  2VKE A;  2GFN A;  3LWJ A;  3P9T A;  2DG8 A;  5HBU A;  4MXM A;  2IU5 A;  3B6C A;  3BCG A;  2VKV A;  4AC6 A;  4HKU A;  2XGE A;  3BRU A;  4D7M A;  4JNN A;  3MNL A;  3RH2 A;  3BR0 A;  2FBQ A;  4M3E A;  2UXP A;  4DW6 A;  3IH2 A;  1RKW A;  3FIW A;  5GPC A;  2ID3 A;  3O8H A;  3KZ9 A;  2RHA A;  1RPW A;  2G7G A;  1QVU A;  2ID6 A;  3VIB A;  3BR1 A;  5GP9 A;  3NXC A;  4GFL A;  3HTJ A;  3CJD A;  3FK6 A;  5IP6 A;  3FRQ A;  3Q0U A;  3NI7 A;  3QBM A;  3VW1 A;  2QCO A;  1Z77 A;  4B1R A;  2G3B A;  5AQC A;  5FKL A;  2PBX A;  2ZOZ A;  2JK3 A;  4D7N A;  1JT0 A;  2VPR A;  3BQY A;  2IAI A;  3C07 A;  3HTA A;  4UDS A;  2UXH A;  3BR5 A;  5K7F A;  2HXO A;  2Q24 A;  3AQS A;  3FK7 A;  4ICH A;  2PZ9 A;  5F0F A;  4V2F A;  3QKX A;  3IUV A;  3EGQ A;  2DTZ A;  3ANG A;  2OF7 A;  2HQ5 A;  3RD3 A;  2Y2Z A;  3G56 A;  3VVZ A;  4M3G A;  3BR3 A;  3HE0 A;  1U9N A;  2Y31 A;  2EH3 A;  2HYT A;  3PPB A;  3S5R A; 
#chains in the Genus database with same CATH topology
 5CW8 A;  3HGG A;  1UI6 A;  2W53 A;  2RAE A;  4I76 A;  5C4Y A;  2OI8 A;  3QPL A;  3IH3 A;  3BT9 A;  5FKO A;  2ZCN A;  1QPI A;  3NNR A;  2WGB A;  4V2G A;  2Y30 A;  3JSJ A;  5H9T A;  3BHQ A;  1JT6 A;  4W97 A;  1T33 A;  3COL A;  3BR6 A;  3HTI A;  3QPS A;  4ME9 A;  4W1U A;  3HIM A;  5FHP A;  3VOK A;  2FJI 1;  1JUP A;  2B1E A;  2XGD A;  5CQG A;  2XB5 A;  5F08 A;  4U9N A;  4M3D A;  5F1J A;  2TRT A;  3G7R A;  4M3F A;  3ANP A;  5F0H A;  3E7Q A;  5IOY A;  4MK6 A;  4M3B A;  4CGR A;  1T56 A;  2PFV A;  4KWA A;  5FKN A;  2B3W A;  2XGC A;  3VVY A;  3LSR A;  1A6I A;  3Q0W A;  2G7L A;  3LJL A;  2F07 A;  5FKK A;  3LSP A;  5HSZ A;  4X1E A;  4IRV A;  4PXI A;  3SDG A;  4MO7 A;  5FMP A;  4YZE A;  2FQ4 A;  3VUQ A;  3DPJ A;  3LSJ A;  4OD4 A;  3VW0 A;  4XK4 A;  1JUM A;  2FD5 A;  2X9D A;  1ZK8 A;  2DG7 A;  4GCK A;  5EZH A;  3K8P C;  3DEW A;  5DAJ A;  1ORK A;  2GUH A;  5J1U A;  3VW2 A;  3TP3 A;  2OER A;  2I10 A;  3HTH A;  3TP0 A;  1JTX A;  4ABZ A;  4B3A A;  5FKM A;  2R7W A;  5IOZ A;  3AQT A;  3LHQ A;  5EYR A;  2HXI A;  3ZQL A;  3V6G A;  2R7V A;  1UI5 A;  3VVX A;  3FHN A;  3ON4 A;  2X6O A;  3BJB A;  3BR2 A;  3ZQG A;  3ZQF A;  1VI0 A;  2WV1 A;  5CXI A;  2FJ1 A;  5K58 A;  3F0C A;  2IEK A;  2O7T A;  5EZG A;  3O60 A;  3IH4 A;  1ZKG A;  4U9L A;  3CCY A;  3VOX A;  3G1O A;  2HYJ A;  4ACI A;  2R7R A;  2D6Y A;  4G12 A;  3B81 A;  3HGY A;  4OD5 A;  2NX4 A;  2ZOY A;  2ZCM A;  2YVE A;  5FGL A;  3BTL A;  3NS4 A;  5J1R A;  5GPA A;  1QVT A;  3Q3S A;  3VPR A;  5F0C A;  3GZI A;  2TCT A;  3NRG A;  4NN1 A;  1BJZ A;  2G0E A;  2ZB9 A;  2HKU A;  4NEL A;  1Z0X A;  1JUS A;  2UXO A;  3VTI A;  3EUP A;  3O8G A;  2O7O A;  4L62 A;  5D18 A;  3B6A A;  3F1B A;  3T6N A;  2YVX A;  2R7Q A;  3G1M A;  5D1R A;  5IPA A;  2GBY A;  2R7X A;  2YVH A;  3KKC A;  1JTY A;  2GEN A;  2R7O A;  3KNW A;  5EFY A;  2NP3 A;  3MVP A;  2NS8 A;  2QOP A;  3V78 A;  3WHB A;  4JKZ A;  5F04 A;  3VP5 A;  3LOC A;  3BTJ A;  2UXU A;  3BQZ A;  2G7S A;  5K7Z A;  3DCF A;  3KKD A;  4JYK A;  2RAS A;  3CDL A;  5K7H A;  2XPW A;  5F27 A;  3C2B A;  5CXG A;  1RKT A;  4GCT A;  3WHC A;  2ZCX A;  4AF5 A;  4GCL A;  1SGM A;  3SFI A;  5J3L A;  2QKO A;  2XPV A;  2XRL A;  3GEU A;  2NP5 A;  2XPU A;  2R7U A;  3ZQI A;  3ON2 A;  2XDN A;  2UXI A;  5J1Y A;  4GFK A;  5HAW A;  3QQA A;  3NPI A;  3Q0V A;  2NS7 A;  1U9O A;  4JL3 A;  2IBD A;  2V57 A;  4I6Z A;  2FX0 A;  4D5C A;  3CWR A;  3PM1 A;  2QIB A;  3BTI A;  2JJ7 A;  2R7S A;  3G1L A;  3BNI A;  4D5F A;  2WUI A;  2OPT A;  2QWT A;  3PAS A;  5D19 A;  2REK A;  3CRJ A;  3BTC A;  4AC0 A;  2QTQ A;  3SWH A;  3ZQH A;  4AUX A;  2VKE A;  2GFN A;  3LWJ A;  3P9T A;  2DG8 A;  5HBU A;  4MXM A;  2IU5 A;  3B6C A;  3BCG A;  2VKV A;  4AC6 A;  4HKU A;  2XGE A;  3BRU A;  4D7M A;  4JNN A;  3MNL A;  3RH2 A;  3BR0 A;  2FBQ A;  4M3E A;  2UXP A;  4DW6 A;  3IH2 A;  1RKW A;  3FIW A;  5GPC A;  2ID3 A;  3O8H A;  3KZ9 A;  2RHA A;  1RPW A;  2G7G A;  1QVU A;  2ID6 A;  3VIB A;  3BR1 A;  5GP9 A;  3NXC A;  4GFL A;  3HTJ A;  3CJD A;  4DVY P;  3FK6 A;  5IP6 A;  3FRQ A;  3Q0U A;  3NI7 A;  3QBM A;  3VW1 A;  2QCO A;  1Z77 A;  4B1R A;  2G3B A;  2ZY9 A;  5AQC A;  3DU5 A;  5FKL A;  2PBX A;  2ZOZ A;  2JK3 A;  4D7N A;  1JT0 A;  2VPR A;  3BQY A;  2IAI A;  3C07 A;  3HTA A;  4UDS A;  2UXH A;  3BR5 A;  5K7F A;  2HXO A;  2Q24 A;  3AQS A;  3FK7 A;  4ICH A;  2PZ9 A;  5F0F A;  4V2F A;  3QKX A;  3IUV A;  3EGQ A;  2DTZ A;  3ANG A;  2OF7 A;  3KYL A;  2HQ5 A;  3RD3 A;  2Y2Z A;  3G56 A;  2A2F X;  3VVZ A;  4M3G A;  4WIB A;  3BR3 A;  3HE0 A;  1U9N A;  2Y31 A;  2EH3 A;  4C2M A;  2R7T A;  3DU6 A;  2HYT A;  3PPB A;  3S5R A; 
#chains in the Genus database with same CATH homology
 5CW8 A;  3HGG A;  1UI6 A;  2W53 A;  2RAE A;  4I76 A;  5C4Y A;  2OI8 A;  3QPL A;  3IH3 A;  3BT9 A;  5FKO A;  2ZCN A;  1QPI A;  3NNR A;  2WGB A;  4V2G A;  2Y30 A;  3JSJ A;  5H9T A;  3BHQ A;  1JT6 A;  4W97 A;  1T33 A;  3COL A;  3BR6 A;  3HTI A;  3QPS A;  4ME9 A;  4W1U A;  3HIM A;  5FHP A;  3VOK A;  1JUP A;  2XGD A;  2XB5 A;  5F08 A;  4M3D A;  5F1J A;  2TRT A;  3G7R A;  4M3F A;  3ANP A;  5F0H A;  3E7Q A;  5IOY A;  4MK6 A;  4M3B A;  4CGR A;  1T56 A;  4KWA A;  5FKN A;  2XGC A;  3VVY A;  3LSR A;  1A6I A;  3Q0W A;  2G7L A;  3LJL A;  2F07 A;  5FKK A;  3LSP A;  5HSZ A;  4X1E A;  4PXI A;  3SDG A;  4MO7 A;  5FMP A;  4YZE A;  2FQ4 A;  3VUQ A;  3DPJ A;  3LSJ A;  3VW0 A;  4XK4 A;  1JUM A;  2FD5 A;  2X9D A;  1ZK8 A;  2DG7 A;  4GCK A;  5EZH A;  3DEW A;  5DAJ A;  1ORK A;  2GUH A;  5J1U A;  3VW2 A;  3TP3 A;  2OER A;  2I10 A;  3HTH A;  3TP0 A;  1JTX A;  4ABZ A;  4B3A A;  5FKM A;  5IOZ A;  3AQT A;  3LHQ A;  5EYR A;  2HXI A;  3ZQL A;  3V6G A;  1UI5 A;  3VVX A;  3ON4 A;  2X6O A;  3BJB A;  3BR2 A;  3ZQG A;  3ZQF A;  1VI0 A;  2WV1 A;  5CXI A;  2FJ1 A;  5K58 A;  3F0C A;  2IEK A;  2O7T A;  5EZG A;  3O60 A;  3IH4 A;  1ZKG A;  3CCY A;  3VOX A;  3G1O A;  2HYJ A;  4ACI A;  2D6Y A;  4G12 A;  3B81 A;  3HGY A;  2NX4 A;  2ZOY A;  2ZCM A;  2YVE A;  5FGL A;  3BTL A;  5J1R A;  5GPA A;  1QVT A;  3Q3S A;  3VPR A;  5F0C A;  3GZI A;  2TCT A;  3NRG A;  4NN1 A;  1BJZ A;  2G0E A;  2ZB9 A;  2HKU A;  4NEL A;  1Z0X A;  1JUS A;  2UXO A;  3EUP A;  3O8G A;  2O7O A;  4L62 A;  5D18 A;  3B6A A;  3F1B A;  3T6N A;  3G1M A;  5D1R A;  5IPA A;  2GBY A;  2YVH A;  3KKC A;  1JTY A;  2GEN A;  3KNW A;  5EFY A;  2NP3 A;  3MVP A;  2NS8 A;  2QOP A;  3V78 A;  3WHB A;  4JKZ A;  5F04 A;  3VP5 A;  3LOC A;  3BTJ A;  2UXU A;  3BQZ A;  2G7S A;  5K7Z A;  3DCF A;  3KKD A;  4JYK A;  2RAS A;  3CDL A;  5K7H A;  2XPW A;  5F27 A;  3C2B A;  5CXG A;  1RKT A;  4GCT A;  3WHC A;  2ZCX A;  4AF5 A;  4GCL A;  1SGM A;  3SFI A;  5J3L A;  2QKO A;  2XPV A;  2XRL A;  3GEU A;  2NP5 A;  2XPU A;  3ZQI A;  3ON2 A;  2XDN A;  2UXI A;  5J1Y A;  4GFK A;  5HAW A;  3QQA A;  3NPI A;  3Q0V A;  2NS7 A;  1U9O A;  4JL3 A;  2IBD A;  2V57 A;  4I6Z A;  2FX0 A;  4D5C A;  3CWR A;  3PM1 A;  2QIB A;  3BTI A;  2JJ7 A;  3G1L A;  3BNI A;  4D5F A;  2WUI A;  2OPT A;  2QWT A;  3PAS A;  5D19 A;  2REK A;  3CRJ A;  3BTC A;  4AC0 A;  2QTQ A;  3ZQH A;  4AUX A;  2VKE A;  2GFN A;  3LWJ A;  3P9T A;  2DG8 A;  5HBU A;  4MXM A;  2IU5 A;  3B6C A;  3BCG A;  2VKV A;  4AC6 A;  4HKU A;  2XGE A;  3BRU A;  4D7M A;  4JNN A;  3MNL A;  3RH2 A;  3BR0 A;  2FBQ A;  4M3E A;  2UXP A;  4DW6 A;  3IH2 A;  1RKW A;  3FIW A;  5GPC A;  2ID3 A;  3O8H A;  3KZ9 A;  2RHA A;  1RPW A;  2G7G A;  1QVU A;  2ID6 A;  3VIB A;  3BR1 A;  5GP9 A;  3NXC A;  4GFL A;  3HTJ A;  3CJD A;  3FK6 A;  5IP6 A;  3FRQ A;  3Q0U A;  3NI7 A;  3QBM A;  3VW1 A;  2QCO A;  1Z77 A;  4B1R A;  2G3B A;  5AQC A;  5FKL A;  2PBX A;  2ZOZ A;  2JK3 A;  4D7N A;  1JT0 A;  2VPR A;  3BQY A;  2IAI A;  3C07 A;  3HTA A;  4UDS A;  2UXH A;  3BR5 A;  5K7F A;  2HXO A;  2Q24 A;  3AQS A;  3FK7 A;  4ICH A;  2PZ9 A;  5F0F A;  4V2F A;  3QKX A;  3IUV A;  3EGQ A;  2DTZ A;  3ANG A;  2OF7 A;  2HQ5 A;  3RD3 A;  2Y2Z A;  3G56 A;  3VVZ A;  4M3G A;  3BR3 A;  3HE0 A;  1U9N A;  2Y31 A;  2EH3 A;  2HYT A;  3PPB A;  3S5R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...