2Q24A

Crystal structure of tetr transcriptional regulator sco0520 from streptomyces coelicolor
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
173
structure length
173
Chain Sequence
b'NRDKILAAAVRVFSEEGLDAHLERIAREAGVGSGTLYRNFPTREALIEAAYRNEVARLCDSVPGLLAELPPAEALRAWTRRFIDYATAKLGMADALRAVVASGGDPYGDSRQLIQSALTALMDAAAAAGEIRSDIRSTDMFAALAGIALTSSRPDQRAQAERLLDLVLDGLRP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative tetR family transcriptional regulator
publication title Crystal structure of a putative transcriptional regulator SCO0520 from Streptomyces coelicolor A3(2) reveals an unusual dimer among TetR family proteins.
pubmed doi rcsb
source organism Streptomyces coelicolor a3(2)
molecule tags Transcription
total genus 63
structure length 173
sequence length 173
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2q24A00
2IU5A 3P9TA 5HAWA 5J3LA 2HYTA 1ZKGA 2GENA 1U9NA 3FIWA 3NRGA 2REKA 2UXIA 3LSJA 3Q0VA 3EUPA 4JYKA 5EZGA 5GPCA 2Y2ZA 5H9TA 3LOCA 5EFYA 1U9OA 2G7LA 2FX0A 5J1UA 2I10A 2QWTA 3NI7A 3MNLA 4M3EA 3JSJA 3BR0A 2WV1A 3LJLA 4W97A 3DPJA 5CXGA 5GPAA 3VVYA 2WGBA 3KKCA 2G0EA 1JUSA 3IUVA 2DG7A 3COLA 2NX4A 2O7TA 4V2FA 2QKOA 3GEUA 2GFNA 3VPRA 5K7HA 2PBXA 3O60A 2FJ1A 4JL3A 3V6GA 3Q3SA 2JK3A 3BTJA 3MVPA 1JT6A 4ICHA 3VIBA 4M3DA 3VW0A 3C07A 2NP3A 1JTYA 5IP6A 3VP5A 2WUIA 2G3BA 2G7SA 4UDSA 5F0CA 1RKTA 5J1YA 4ME9A 2DTZA 2IAIA 3PASA 1SGMA 3VUQA 3BQYA 3SFIA 3AQTA 3QPSA 3NPIA 4M3FA 3Q0WA 4NELA 1A6IA 2JJ7A 1UI5A 2FBQA 4JKZA 5FKLA 4I76A 2UXUA 3FK7A 3EGQA 1QVTA 1ORKA 2UXOA 3CCYA 5EYRA 3RH2A 5K58A 3LSPA 2QCOA 3HTJA 5F1JA 5F04A 3DCFA 1RPWA 2PZ9A 2IEKA 3BT9A 3BTIA 3HGYA 2FQ4A 5IOYA 2ZCXA 5AQCA 5CW8A 2XPUA 3B6CA 2HKUA 3CWRA 4ABZA 5IOZA 3VW1A 1QVUA 4GFLA 5FMPA 4B1RA 2OF7A 3IH2A 1JUMA 2VKVA 2OI8A 4D7MA 5F27A 3HE0A 3BQZA 3S5RA 2VPRA 3KKDA 4AC6A 3BR1A 3BCGA 2XGCA 3ANPA 2NS7A 5FKOA 4NN1A 2XRLA 3NXCA 2XPVA 4I6ZA 5GP9A 3BTCA 1JUPA 2UXHA 4W1UA 3BR6A 2XGEA 5EZHA 3QQAA 2ZOYA 3GZIA 3G1OA 2YVHA 3PPBA 4GCTA 3F0CA 3BR2A 4MK6A 5C4YA 3VVZA 2XPWA 3ON2A 4B3AA 3C2BA 2GUHA 3BR3A 4D7NA 5K7FA 5D19A 2TRTA 3B6AA 5K7ZA 4G12A 3PM1A 2IBDA 5FKMA 2F07A 3T6NA 3BNIA 4X1EA 4YZEA 2OERA 3O8GA 3FK6A 3NNRA 2ZOZA 3BHQA 4HKUA 1UI6A 3ZQFA 2ZCMA 1T56A 3G1LA 3LSRA 1ZK8A 3VVXA 4L62A 1RKWA 2D6YA 3DEWA 2RHAA 3CJDA 5F08A 3QPLA 2HQ5A 2QOPA 4GCKA 4XK4A 2G7GA 2VKEA 4AF5A 2Y30A 3WHBA 5IPAA 2EH3A 1BJZA 3HGGA 2RAEA 3G56A 3B81A 3LHQA 5F0FA 3QBMA 2UXPA 1JTXA 2X6OA 3RD3A 2HXIA 3HIMA 3ZQIA 3HTAA 1VI0A 3BR5A 5FKKA 3HTIA 3HTHA 5FGLA 3VOKA 2HYJA 2GBYA 3G7RA 3E7QA 3AQSA 4GFKA 4AUXA 4PXIA 2FD5A 3SDGA 3FRQA 2ID3A 5F0HA 3QKXA 5CXIA 3ZQLA 3TP0A 1T33A 2NS8A 3BRUA 3G1MA 3CRJA 4DW6A 1Z0XA 2XGDA 2W53A 4JNNA 4M3BA 5D18A 2HXOA 2X9DA 4MXMA 3BTLA 1JT0A 2DG8A 4KWAA 5D1RA 2RASA 5HBUA 3IH4A 4V2GA 3IH3A 2Y31A 4MO7A 2QTQA 2XB5A 3O8HA 4AC0A 3ZQGA 3TP3A 2Q24A 3LWJA 2O7OA 2ZB9A 5DAJA 4ACIA 2QIBA 4CGRA 2OPTA 5FKNA 3VW2A 2YVEA 2NP5A 4D5CA 3ON4A 5FHPA 3KZ9A 5HSZA 3V78A 3ANGA 3WHCA 3BJBA 1Z77A 3Q0UA 4M3GA 2ZCNA 3CDLA 1QPIA 3ZQHA 4D5FA 4GCLA 5J1RA 3F1BA 2ID6A 3KNWA 2V57A 2TCTA 3VOXA 2XDNA
chains in the Genus database with same CATH superfamily
2IU5A 3P9TA 5HAWA 5J3LA 2HYTA 2R7OA 1ZKGA 2GENA 1U9NA 3FIWA 3NRGA 2REKA 2UXIA 3LSJA 3Q0VA 3EUPA 4JYKA 5EZGA 5GPCA 2Y2ZA 5H9TA 3LOCA 5EFYA 1U9OA 2G7LA 2FX0A 5J1UA 2I10A 2QWTA 3NI7A 3MNLA 4M3EA 3KYLA 3JSJA 3BR0A 2WV1A 3LJLA 4U9LA 4W97A 3DPJA 5CXGA 5GPAA 3VVYA 2WGBA 3KKCA 2G0EA 1JUSA 3IUVA 2ZY9A 4OD5A 2DG7A 3COLA 2NX4A 2O7TA 4V2FA 2QKOA 3GEUA 2GFNA 3VPRA 5K7HA 2R7TA 2PBXA 3O60A 2FJ1A 4JL3A 3V6GA 3Q3SA 4WIBA 2JK3A 3BTJA 3MVPA 1JT6A 4ICHA 3VIBA 4M3DA 3VW0A 3C07A 2NP3A 1JTYA 5IP6A 2WUIA 3VP5A 2G3BA 2G7SA 4UDSA 5F0CA 1RKTA 4U9NA 5J1YA 4ME9A 2DTZA 2IAIA 3PASA 1SGMA 3VUQA 3BQYA 3DU5A 3SFIA 2R7XA 3AQTA 3QPSA 3VTIA 3NPIA 4M3FA 3Q0WA 4NELA 1A6IA 2JJ7A 1UI5A 2FBQA 4JKZA 5FKLA 4I76A 2UXUA 3FK7A 3EGQA 1QVTA 1ORKA 2UXOA 3CCYA 5EYRA 3RH2A 5K58A 3LSPA 2B1EA 2QCOA 3HTJA 5F1JA 5F04A 3DCFA 1RPWA 2PZ9A 2IEKA 3BT9A 3BTIA 3HGYA 2FQ4A 5IOYA 2ZCXA 5AQCA 5CW8A 2XPUA 3B6CA 2HKUA 3CWRA 4ABZA 5IOZA 3VW1A 1QVUA 4GFLA 5FMPA 4B1RA 2OF7A 3IH2A 1JUMA 2VKVA 2OI8A 4D7MA 2R7UA 5F27A 3HE0A 3BQZA 3S5RA 2VPRA 3KKDA 4AC6A 3BR1A 3BCGA 2XGCA 2B3WA 3ANPA 2NS7A 2R7VA 5FKOA 4NN1A 2XRLA 3NXCA 2XPVA 4I6ZA 5GP9A 3BTCA 1JUPA 2UXHA 4W1UA 3BR6A 2XGEA 5EZHA 3QQAA 2ZOYA 3GZIA 3G1OA 2YVHA 3PPBA 4GCTA 3F0CA 3BR2A 4MK6A 5C4YA 3VVZA 2XPWA 3ON2A 4B3AA 3C2BA 2GUHA 3BR3A 4D7NA 5K7FA 5D19A 2TRTA 3B6AA 5K7ZA 4G12A 3PM1A 2IBDA 5FKMA 2F07A 3T6NA 3BNIA 4X1EA 4YZEA 2R7RA 2R7SA 2OERA 3O8GA 3FK6A 3NNRA 2ZOZA 3BHQA 4HKUA 1UI6A 3ZQFA 2ZCMA 1T56A 3G1LA 3LSRA 1ZK8A 3VVXA 4L62A 1RKWA 2D6YA 3DEWA 2RHAA 3CJDA 5F08A 3QPLA 2HQ5A 2QOPA 4GCKA 4XK4A 3FHNA 2G7GA 2VKEA 4AF5A 2Y30A 3WHBA 5IPAA 2EH3A 1BJZA 3HGGA 2RAEA 3G56A 3B81A 3LHQA 5F0FA 3QBMA 2UXPA 1JTXA 2X6OA 3RD3A 2HXIA 3HIMA 3ZQIA 3HTAA 3K8PC 1VI0A 3BR5A 5FKKA 3HTIA 3HTHA 5FGLA 3VOKA 2HYJA 2GBYA 3G7RA 3E7QA 3AQSA 4GFKA 4IRVA 4AUXA 4PXIA 2FD5A 3SDGA 3DU6A 3FRQA 2ID3A 5F0HA 4C2MA 3QKXA 5CXIA 3ZQLA 3TP0A 1T33A 2NS8A 3BRUA 4DVYP 4OD4A 3G1MA 3CRJA 4DW6A 2R7WA 1Z0XA 2XGDA 2W53A 4JNNA 4M3BA 5D18A 3NS4A 2R7QA 2HXOA 2X9DA 4MXMA 3BTLA 1JT0A 2DG8A 4KWAA 2FJI1 2RASA 5D1RA 5HBUA 3IH4A 4V2GA 3IH3A 2Y31A 4MO7A 2QTQA 2XB5A 3O8HA 4AC0A 3ZQGA 3TP3A 2Q24A 3LWJA 2O7OA 2ZB9A 5DAJA 4ACIA 2QIBA 2A2FX 2PFVA 4CGRA 2OPTA 5FKNA 3VW2A 2YVXA 2YVEA 2NP5A 4D5CA 3ON4A 5FHPA 3KZ9A 5HSZA 3V78A 3ANGA 3WHCA 3BJBA 1Z77A 3Q0UA 4M3GA 2ZCNA 3CDLA 1QPIA 3ZQHA 4D5FA 4GCLA 5J1RA 3F1BA 2ID6A 3KNWA 2V57A 2TCTA 3SWHA 3VOXA 5CQGA 2XDNA
chains in the Genus database with same CATH topology
2IU5A 3P9TA 5HAWA 5J3LA 2HYTA 1ZKGA 2GENA 1U9NA 3FIWA 3NRGA 2REKA 2UXIA 3LSJA 3Q0VA 3EUPA 4JYKA 5EZGA 5GPCA 2Y2ZA 5H9TA 3LOCA 5EFYA 1U9OA 2G7LA 2FX0A 5J1UA 2I10A 2QWTA 3NI7A 3MNLA 4M3EA 3JSJA 3BR0A 2WV1A 3LJLA 4W97A 3DPJA 5CXGA 5GPAA 3VVYA 2WGBA 3KKCA 2G0EA 1JUSA 3IUVA 2DG7A 3COLA 2NX4A 2O7TA 4V2FA 2QKOA 3GEUA 2GFNA 3VPRA 5K7HA 2PBXA 3O60A 2FJ1A 4JL3A 3V6GA 3Q3SA 2JK3A 3BTJA 3MVPA 1JT6A 4ICHA 3VIBA 4M3DA 3VW0A 3C07A 2NP3A 1JTYA 5IP6A 3VP5A 2WUIA 2G3BA 2G7SA 4UDSA 5F0CA 1RKTA 5J1YA 4ME9A 2DTZA 2IAIA 3PASA 1SGMA 3VUQA 3BQYA 3SFIA 3AQTA 3QPSA 3NPIA 4M3FA 3Q0WA 4NELA 1A6IA 2JJ7A 1UI5A 2FBQA 4JKZA 5FKLA 4I76A 2UXUA 3FK7A 3EGQA 1QVTA 1ORKA 2UXOA 3CCYA 5EYRA 3RH2A 5K58A 3LSPA 2QCOA 3HTJA 5F1JA 5F04A 3DCFA 1RPWA 2PZ9A 2IEKA 3BT9A 3BTIA 3HGYA 2FQ4A 5IOYA 2ZCXA 5AQCA 5CW8A 2XPUA 3B6CA 2HKUA 3CWRA 4ABZA 5IOZA 3VW1A 1QVUA 4GFLA 5FMPA 4B1RA 2OF7A 3IH2A 1JUMA 2VKVA 2OI8A 4D7MA 5F27A 3HE0A 3BQZA 3S5RA 2VPRA 3KKDA 4AC6A 3BR1A 3BCGA 2XGCA 3ANPA 2NS7A 5FKOA 4NN1A 2XRLA 3NXCA 2XPVA 4I6ZA 5GP9A 3BTCA 1JUPA 2UXHA 4W1UA 3BR6A 2XGEA 5EZHA 3QQAA 2ZOYA 3GZIA 3G1OA 2YVHA 3PPBA 4GCTA 3F0CA 3BR2A 4MK6A 5C4YA 3VVZA 2XPWA 3ON2A 4B3AA 3C2BA 2GUHA 3BR3A 4D7NA 5K7FA 5D19A 2TRTA 3B6AA 5K7ZA 4G12A 3PM1A 2IBDA 5FKMA 2F07A 3T6NA 3BNIA 4X1EA 4YZEA 2OERA 3O8GA 3FK6A 3NNRA 2ZOZA 3BHQA 4HKUA 1UI6A 3ZQFA 2ZCMA 1T56A 3G1LA 3LSRA 1ZK8A 3VVXA 4L62A 1RKWA 2D6YA 3DEWA 2RHAA 3CJDA 5F08A 3QPLA 2HQ5A 2QOPA 4GCKA 4XK4A 2G7GA 2VKEA 4AF5A 2Y30A 3WHBA 5IPAA 2EH3A 1BJZA 3HGGA 2RAEA 3G56A 3B81A 3LHQA 5F0FA 3QBMA 2UXPA 1JTXA 2X6OA 3RD3A 2HXIA 3HIMA 3ZQIA 3HTAA 1VI0A 3BR5A 5FKKA 3HTIA 3HTHA 5FGLA 3VOKA 2HYJA 2GBYA 3G7RA 3E7QA 3AQSA 4GFKA 4AUXA 4PXIA 2FD5A 3SDGA 3FRQA 2ID3A 5F0HA 3QKXA 5CXIA 3ZQLA 3TP0A 1T33A 2NS8A 3BRUA 3G1MA 3CRJA 4DW6A 1Z0XA 2XGDA 2W53A 4JNNA 4M3BA 5D18A 2HXOA 2X9DA 4MXMA 3BTLA 1JT0A 2DG8A 4KWAA 5D1RA 2RASA 5HBUA 3IH4A 4V2GA 3IH3A 2Y31A 4MO7A 2QTQA 2XB5A 3O8HA 4AC0A 3ZQGA 3TP3A 2Q24A 3LWJA 2O7OA 2ZB9A 5DAJA 4ACIA 2QIBA 4CGRA 2OPTA 5FKNA 3VW2A 2YVEA 2NP5A 4D5CA 3ON4A 5FHPA 3KZ9A 5HSZA 3V78A 3ANGA 3WHCA 3BJBA 1Z77A 3Q0UA 4M3GA 2ZCNA 3CDLA 1QPIA 3ZQHA 4D5FA 4GCLA 5J1RA 3F1BA 2ID6A 3KNWA 2V57A 2TCTA 3VOXA 2XDNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IU5 A;  3P9T A;  5HAW A;  5J3L A;  2HYT A;  1ZKG A;  2GEN A;  1U9N A;  3FIW A;  3NRG A;  2REK A;  2UXI A;  3LSJ A;  3Q0V A;  3EUP A;  4JYK A;  5EZG A;  5GPC A;  2Y2Z A;  5H9T A;  3LOC A;  5EFY A;  1U9O A;  2G7L A;  2FX0 A;  5J1U A;  2I10 A;  2QWT A;  3NI7 A;  3MNL A;  4M3E A;  3JSJ A;  3BR0 A;  2WV1 A;  3LJL A;  4W97 A;  3DPJ A;  5CXG A;  5GPA A;  3VVY A;  2WGB A;  3KKC A;  2G0E A;  1JUS A;  3IUV A;  2DG7 A;  3COL A;  2NX4 A;  2O7T A;  4V2F A;  2QKO A;  3GEU A;  2GFN A;  3VPR A;  5K7H A;  2PBX A;  3O60 A;  2FJ1 A;  4JL3 A;  3V6G A;  3Q3S A;  2JK3 A;  3BTJ A;  3MVP A;  1JT6 A;  4ICH A;  3VIB A;  4M3D A;  3VW0 A;  3C07 A;  2NP3 A;  1JTY A;  5IP6 A;  3VP5 A;  2WUI A;  2G3B A;  2G7S A;  4UDS A;  5F0C A;  1RKT A;  5J1Y A;  4ME9 A;  2DTZ A;  2IAI A;  3PAS A;  1SGM A;  3VUQ A;  3BQY A;  3SFI A;  3AQT A;  3QPS A;  3NPI A;  4M3F A;  3Q0W A;  4NEL A;  1A6I A;  2JJ7 A;  1UI5 A;  2FBQ A;  4JKZ A;  5FKL A;  4I76 A;  2UXU A;  3FK7 A;  3EGQ A;  1QVT A;  1ORK A;  2UXO A;  3CCY A;  5EYR A;  3RH2 A;  5K58 A;  3LSP A;  2QCO A;  3HTJ A;  5F1J A;  5F04 A;  3DCF A;  1RPW A;  2PZ9 A;  2IEK A;  3BT9 A;  3BTI A;  3HGY A;  2FQ4 A;  5IOY A;  2ZCX A;  5AQC A;  5CW8 A;  2XPU A;  3B6C A;  2HKU A;  3CWR A;  4ABZ A;  5IOZ A;  3VW1 A;  1QVU A;  4GFL A;  5FMP A;  4B1R A;  2OF7 A;  3IH2 A;  1JUM A;  2VKV A;  2OI8 A;  4D7M A;  5F27 A;  3HE0 A;  3BQZ A;  3S5R A;  2VPR A;  3KKD A;  4AC6 A;  3BR1 A;  3BCG A;  2XGC A;  3ANP A;  2NS7 A;  5FKO A;  4NN1 A;  2XRL A;  3NXC A;  2XPV A;  4I6Z A;  5GP9 A;  3BTC A;  1JUP A;  2UXH A;  4W1U A;  3BR6 A;  2XGE A;  5EZH A;  3QQA A;  2ZOY A;  3GZI A;  3G1O A;  2YVH A;  3PPB A;  4GCT A;  3F0C A;  3BR2 A;  4MK6 A;  5C4Y A;  3VVZ A;  2XPW A;  3ON2 A;  4B3A A;  3C2B A;  2GUH A;  3BR3 A;  4D7N A;  5K7F A;  5D19 A;  2TRT A;  3B6A A;  5K7Z A;  4G12 A;  3PM1 A;  2IBD A;  5FKM A;  2F07 A;  3T6N A;  3BNI A;  4X1E A;  4YZE A;  2OER A;  3O8G A;  3FK6 A;  3NNR A;  2ZOZ A;  3BHQ A;  4HKU A;  1UI6 A;  3ZQF A;  2ZCM A;  1T56 A;  3G1L A;  3LSR A;  1ZK8 A;  3VVX A;  4L62 A;  1RKW A;  2D6Y A;  3DEW A;  2RHA A;  3CJD A;  5F08 A;  3QPL A;  2HQ5 A;  2QOP A;  4GCK A;  4XK4 A;  2G7G A;  2VKE A;  4AF5 A;  2Y30 A;  3WHB A;  5IPA A;  2EH3 A;  1BJZ A;  3HGG A;  2RAE A;  3G56 A;  3B81 A;  3LHQ A;  5F0F A;  3QBM A;  2UXP A;  1JTX A;  2X6O A;  3RD3 A;  2HXI A;  3HIM A;  3ZQI A;  3HTA A;  1VI0 A;  3BR5 A;  5FKK A;  3HTI A;  3HTH A;  5FGL A;  3VOK A;  2HYJ A;  2GBY A;  3G7R A;  3E7Q A;  3AQS A;  4GFK A;  4AUX A;  4PXI A;  2FD5 A;  3SDG A;  3FRQ A;  2ID3 A;  5F0H A;  3QKX A;  5CXI A;  3ZQL A;  3TP0 A;  1T33 A;  2NS8 A;  3BRU A;  3G1M A;  3CRJ A;  4DW6 A;  1Z0X A;  2XGD A;  2W53 A;  4JNN A;  4M3B A;  5D18 A;  2HXO A;  2X9D A;  4MXM A;  3BTL A;  1JT0 A;  2DG8 A;  4KWA A;  5D1R A;  2RAS A;  5HBU A;  3IH4 A;  4V2G A;  3IH3 A;  2Y31 A;  4MO7 A;  2QTQ A;  2XB5 A;  3O8H A;  4AC0 A;  3ZQG A;  3TP3 A;  2Q24 A;  3LWJ A;  2O7O A;  2ZB9 A;  5DAJ A;  4ACI A;  2QIB A;  4CGR A;  2OPT A;  5FKN A;  3VW2 A;  2YVE A;  2NP5 A;  4D5C A;  3ON4 A;  5FHP A;  3KZ9 A;  5HSZ A;  3V78 A;  3ANG A;  3WHC A;  3BJB A;  1Z77 A;  3Q0U A;  4M3G A;  2ZCN A;  3CDL A;  1QPI A;  3ZQH A;  4D5F A;  4GCL A;  5J1R A;  3F1B A;  2ID6 A;  3KNW A;  2V57 A;  2TCT A;  3VOX A;  2XDN A; 
#chains in the Genus database with same CATH topology
 2IU5 A;  3P9T A;  5HAW A;  5J3L A;  2HYT A;  2R7O A;  1ZKG A;  2GEN A;  1U9N A;  3FIW A;  3NRG A;  2REK A;  2UXI A;  3LSJ A;  3Q0V A;  3EUP A;  4JYK A;  5EZG A;  5GPC A;  2Y2Z A;  5H9T A;  3LOC A;  5EFY A;  1U9O A;  2G7L A;  2FX0 A;  5J1U A;  2I10 A;  2QWT A;  3NI7 A;  3MNL A;  4M3E A;  3KYL A;  3JSJ A;  3BR0 A;  2WV1 A;  3LJL A;  4U9L A;  4W97 A;  3DPJ A;  5CXG A;  5GPA A;  3VVY A;  2WGB A;  3KKC A;  2G0E A;  1JUS A;  3IUV A;  2ZY9 A;  4OD5 A;  2DG7 A;  3COL A;  2NX4 A;  2O7T A;  4V2F A;  2QKO A;  3GEU A;  2GFN A;  3VPR A;  5K7H A;  2R7T A;  2PBX A;  3O60 A;  2FJ1 A;  4JL3 A;  3V6G A;  3Q3S A;  4WIB A;  2JK3 A;  3BTJ A;  3MVP A;  1JT6 A;  4ICH A;  3VIB A;  4M3D A;  3VW0 A;  3C07 A;  2NP3 A;  1JTY A;  5IP6 A;  2WUI A;  3VP5 A;  2G3B A;  2G7S A;  4UDS A;  5F0C A;  1RKT A;  4U9N A;  5J1Y A;  4ME9 A;  2DTZ A;  2IAI A;  3PAS A;  1SGM A;  3VUQ A;  3BQY A;  3DU5 A;  3SFI A;  2R7X A;  3AQT A;  3QPS A;  3VTI A;  3NPI A;  4M3F A;  3Q0W A;  4NEL A;  1A6I A;  2JJ7 A;  1UI5 A;  2FBQ A;  4JKZ A;  5FKL A;  4I76 A;  2UXU A;  3FK7 A;  3EGQ A;  1QVT A;  1ORK A;  2UXO A;  3CCY A;  5EYR A;  3RH2 A;  5K58 A;  3LSP A;  2B1E A;  2QCO A;  3HTJ A;  5F1J A;  5F04 A;  3DCF A;  1RPW A;  2PZ9 A;  2IEK A;  3BT9 A;  3BTI A;  3HGY A;  2FQ4 A;  5IOY A;  2ZCX A;  5AQC A;  5CW8 A;  2XPU A;  3B6C A;  2HKU A;  3CWR A;  4ABZ A;  5IOZ A;  3VW1 A;  1QVU A;  4GFL A;  5FMP A;  4B1R A;  2OF7 A;  3IH2 A;  1JUM A;  2VKV A;  2OI8 A;  4D7M A;  2R7U A;  5F27 A;  3HE0 A;  3BQZ A;  3S5R A;  2VPR A;  3KKD A;  4AC6 A;  3BR1 A;  3BCG A;  2XGC A;  2B3W A;  3ANP A;  2NS7 A;  2R7V A;  5FKO A;  4NN1 A;  2XRL A;  3NXC A;  2XPV A;  4I6Z A;  5GP9 A;  3BTC A;  1JUP A;  2UXH A;  4W1U A;  3BR6 A;  2XGE A;  5EZH A;  3QQA A;  2ZOY A;  3GZI A;  3G1O A;  2YVH A;  3PPB A;  4GCT A;  3F0C A;  3BR2 A;  4MK6 A;  5C4Y A;  3VVZ A;  2XPW A;  3ON2 A;  4B3A A;  3C2B A;  2GUH A;  3BR3 A;  4D7N A;  5K7F A;  5D19 A;  2TRT A;  3B6A A;  5K7Z A;  4G12 A;  3PM1 A;  2IBD A;  5FKM A;  2F07 A;  3T6N A;  3BNI A;  4X1E A;  4YZE A;  2R7R A;  2R7S A;  2OER A;  3O8G A;  3FK6 A;  3NNR A;  2ZOZ A;  3BHQ A;  4HKU A;  1UI6 A;  3ZQF A;  2ZCM A;  1T56 A;  3G1L A;  3LSR A;  1ZK8 A;  3VVX A;  4L62 A;  1RKW A;  2D6Y A;  3DEW A;  2RHA A;  3CJD A;  5F08 A;  3QPL A;  2HQ5 A;  2QOP A;  4GCK A;  4XK4 A;  3FHN A;  2G7G A;  2VKE A;  4AF5 A;  2Y30 A;  3WHB A;  5IPA A;  2EH3 A;  1BJZ A;  3HGG A;  2RAE A;  3G56 A;  3B81 A;  3LHQ A;  5F0F A;  3QBM A;  2UXP A;  1JTX A;  2X6O A;  3RD3 A;  2HXI A;  3HIM A;  3ZQI A;  3HTA A;  3K8P C;  1VI0 A;  3BR5 A;  5FKK A;  3HTI A;  3HTH A;  5FGL A;  3VOK A;  2HYJ A;  2GBY A;  3G7R A;  3E7Q A;  3AQS A;  4GFK A;  4IRV A;  4AUX A;  4PXI A;  2FD5 A;  3SDG A;  3DU6 A;  3FRQ A;  2ID3 A;  5F0H A;  4C2M A;  3QKX A;  5CXI A;  3ZQL A;  3TP0 A;  1T33 A;  2NS8 A;  3BRU A;  4DVY P;  4OD4 A;  3G1M A;  3CRJ A;  4DW6 A;  2R7W A;  1Z0X A;  2XGD A;  2W53 A;  4JNN A;  4M3B A;  5D18 A;  3NS4 A;  2R7Q A;  2HXO A;  2X9D A;  4MXM A;  3BTL A;  1JT0 A;  2DG8 A;  4KWA A;  2FJI 1;  2RAS A;  5D1R A;  5HBU A;  3IH4 A;  4V2G A;  3IH3 A;  2Y31 A;  4MO7 A;  2QTQ A;  2XB5 A;  3O8H A;  4AC0 A;  3ZQG A;  3TP3 A;  2Q24 A;  3LWJ A;  2O7O A;  2ZB9 A;  5DAJ A;  4ACI A;  2QIB A;  2A2F X;  2PFV A;  4CGR A;  2OPT A;  5FKN A;  3VW2 A;  2YVX A;  2YVE A;  2NP5 A;  4D5C A;  3ON4 A;  5FHP A;  3KZ9 A;  5HSZ A;  3V78 A;  3ANG A;  3WHC A;  3BJB A;  1Z77 A;  3Q0U A;  4M3G A;  2ZCN A;  3CDL A;  1QPI A;  3ZQH A;  4D5F A;  4GCL A;  5J1R A;  3F1B A;  2ID6 A;  3KNW A;  2V57 A;  2TCT A;  3SWH A;  3VOX A;  5CQG A;  2XDN A; 
#chains in the Genus database with same CATH homology
 2IU5 A;  3P9T A;  5HAW A;  5J3L A;  2HYT A;  1ZKG A;  2GEN A;  1U9N A;  3FIW A;  3NRG A;  2REK A;  2UXI A;  3LSJ A;  3Q0V A;  3EUP A;  4JYK A;  5EZG A;  5GPC A;  2Y2Z A;  5H9T A;  3LOC A;  5EFY A;  1U9O A;  2G7L A;  2FX0 A;  5J1U A;  2I10 A;  2QWT A;  3NI7 A;  3MNL A;  4M3E A;  3JSJ A;  3BR0 A;  2WV1 A;  3LJL A;  4W97 A;  3DPJ A;  5CXG A;  5GPA A;  3VVY A;  2WGB A;  3KKC A;  2G0E A;  1JUS A;  3IUV A;  2DG7 A;  3COL A;  2NX4 A;  2O7T A;  4V2F A;  2QKO A;  3GEU A;  2GFN A;  3VPR A;  5K7H A;  2PBX A;  3O60 A;  2FJ1 A;  4JL3 A;  3V6G A;  3Q3S A;  2JK3 A;  3BTJ A;  3MVP A;  1JT6 A;  4ICH A;  3VIB A;  4M3D A;  3VW0 A;  3C07 A;  2NP3 A;  1JTY A;  5IP6 A;  3VP5 A;  2WUI A;  2G3B A;  2G7S A;  4UDS A;  5F0C A;  1RKT A;  5J1Y A;  4ME9 A;  2DTZ A;  2IAI A;  3PAS A;  1SGM A;  3VUQ A;  3BQY A;  3SFI A;  3AQT A;  3QPS A;  3NPI A;  4M3F A;  3Q0W A;  4NEL A;  1A6I A;  2JJ7 A;  1UI5 A;  2FBQ A;  4JKZ A;  5FKL A;  4I76 A;  2UXU A;  3FK7 A;  3EGQ A;  1QVT A;  1ORK A;  2UXO A;  3CCY A;  5EYR A;  3RH2 A;  5K58 A;  3LSP A;  2QCO A;  3HTJ A;  5F1J A;  5F04 A;  3DCF A;  1RPW A;  2PZ9 A;  2IEK A;  3BT9 A;  3BTI A;  3HGY A;  2FQ4 A;  5IOY A;  2ZCX A;  5AQC A;  5CW8 A;  2XPU A;  3B6C A;  2HKU A;  3CWR A;  4ABZ A;  5IOZ A;  3VW1 A;  1QVU A;  4GFL A;  5FMP A;  4B1R A;  2OF7 A;  3IH2 A;  1JUM A;  2VKV A;  2OI8 A;  4D7M A;  5F27 A;  3HE0 A;  3BQZ A;  3S5R A;  2VPR A;  3KKD A;  4AC6 A;  3BR1 A;  3BCG A;  2XGC A;  3ANP A;  2NS7 A;  5FKO A;  4NN1 A;  2XRL A;  3NXC A;  2XPV A;  4I6Z A;  5GP9 A;  3BTC A;  1JUP A;  2UXH A;  4W1U A;  3BR6 A;  2XGE A;  5EZH A;  3QQA A;  2ZOY A;  3GZI A;  3G1O A;  2YVH A;  3PPB A;  4GCT A;  3F0C A;  3BR2 A;  4MK6 A;  5C4Y A;  3VVZ A;  2XPW A;  3ON2 A;  4B3A A;  3C2B A;  2GUH A;  3BR3 A;  4D7N A;  5K7F A;  5D19 A;  2TRT A;  3B6A A;  5K7Z A;  4G12 A;  3PM1 A;  2IBD A;  5FKM A;  2F07 A;  3T6N A;  3BNI A;  4X1E A;  4YZE A;  2OER A;  3O8G A;  3FK6 A;  3NNR A;  2ZOZ A;  3BHQ A;  4HKU A;  1UI6 A;  3ZQF A;  2ZCM A;  1T56 A;  3G1L A;  3LSR A;  1ZK8 A;  3VVX A;  4L62 A;  1RKW A;  2D6Y A;  3DEW A;  2RHA A;  3CJD A;  5F08 A;  3QPL A;  2HQ5 A;  2QOP A;  4GCK A;  4XK4 A;  2G7G A;  2VKE A;  4AF5 A;  2Y30 A;  3WHB A;  5IPA A;  2EH3 A;  1BJZ A;  3HGG A;  2RAE A;  3G56 A;  3B81 A;  3LHQ A;  5F0F A;  3QBM A;  2UXP A;  1JTX A;  2X6O A;  3RD3 A;  2HXI A;  3HIM A;  3ZQI A;  3HTA A;  1VI0 A;  3BR5 A;  5FKK A;  3HTI A;  3HTH A;  5FGL A;  3VOK A;  2HYJ A;  2GBY A;  3G7R A;  3E7Q A;  3AQS A;  4GFK A;  4AUX A;  4PXI A;  2FD5 A;  3SDG A;  3FRQ A;  2ID3 A;  5F0H A;  3QKX A;  5CXI A;  3ZQL A;  3TP0 A;  1T33 A;  2NS8 A;  3BRU A;  3G1M A;  3CRJ A;  4DW6 A;  1Z0X A;  2XGD A;  2W53 A;  4JNN A;  4M3B A;  5D18 A;  2HXO A;  2X9D A;  4MXM A;  3BTL A;  1JT0 A;  2DG8 A;  4KWA A;  5D1R A;  2RAS A;  5HBU A;  3IH4 A;  4V2G A;  3IH3 A;  2Y31 A;  4MO7 A;  2QTQ A;  2XB5 A;  3O8H A;  4AC0 A;  3ZQG A;  3TP3 A;  2Q24 A;  3LWJ A;  2O7O A;  2ZB9 A;  5DAJ A;  4ACI A;  2QIB A;  4CGR A;  2OPT A;  5FKN A;  3VW2 A;  2YVE A;  2NP5 A;  4D5C A;  3ON4 A;  5FHP A;  3KZ9 A;  5HSZ A;  3V78 A;  3ANG A;  3WHC A;  3BJB A;  1Z77 A;  3Q0U A;  4M3G A;  2ZCN A;  3CDL A;  1QPI A;  3ZQH A;  4D5F A;  4GCL A;  5J1R A;  3F1B A;  2ID6 A;  3KNW A;  2V57 A;  2TCT A;  3VOX A;  2XDN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...