2Q24A

Crystal structure of tetr transcriptional regulator sco0520 from streptomyces coelicolor
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
173
structure length
173
Chain Sequence
NRDKILAAAVRVFSEEGLDAHLERIAREAGVGSGTLYRNFPTREALIEAAYRNEVARLCDSVPGLLAELPPAEALRAWTRRFIDYATAKLGMADALRAVVASGGDPYGDSRQLIQSALTALMDAAAAAGEIRSDIRSTDMFAALAGIALTSSRPDQRAQAERLLDLVLDGLRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative transcriptional regulator SCO0520 from Streptomyces coelicolor A3(2) reveals an unusual dimer among TetR family proteins.
pubmed doi rcsb
source organism Streptomyces coelicolor a3(2)
molecule tags Transcription
molecule keywords Putative tetR family transcriptional regulator
total genus 63
structure length 173
sequence length 173
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2q24A00
3KZ9A 2UXHA 3HIMA 4D5FA 3AQSA 4GFKA 4MK6A 2JJ7A 4AF5A 1SGMA 3MVPA 1UI6A 3BTLA 1JUPA 4KWAA 5FKMA 2PBXA 4M3GA 2WUIA 5CW8A 5H9TA 3B6AA 2DG7A 5J1UA 4GCLA 3CRJA 4ICHA 5IOYA 1BJZA 2F07A 2I10A 1JT6A 3BR3A 3FIWA 3LSRA 1RKTA 3TP0A 2GENA 4V2FA 4DW6A 2EH3A 1Z0XA 1RKWA 3BJBA 3BR5A 2QCOA 3EUPA 3BNIA 1ZKGA 3ON4A 2UXPA 2IBDA 2OI8A 1UI5A 2O7TA 4D7MA 3BRUA 3HTJA 3IH3A 5D1RA 5HSZA 3GZIA 2TCTA 3BTJA 2PZ9A 2RAEA 3BHQA 2G7SA 5K7ZA 2XDNA 2ZCNA 2XRLA 4X1EA 1T33A 3ANPA 2X9DA 5EFYA 5FKLA 5CXGA 2ZOZA 3KNWA 3RH2A 2VKVA 3B6CA 4B1RA 3FK7A 3ZQLA 2UXIA 4GCKA 3VW1A 4MXMA 3BR1A 2HYTA 3QPSA 2IAIA 2ID3A 3V6GA 4I76A 1A6IA 3ZQGA 2G3BA 2ID6A 3SDGA 3C07A 3DEWA 3VVZA 1U9NA 3GEUA 2XGDA 3O60A 4ABZA 3PPBA 3T6NA 3G7RA 5F0HA 2FD5A 4YZEA 3LSPA 3VOKA 1JTXA 1JUSA 2Y2ZA 2UXUA 3VVXA 3BR0A 3CJDA 3Q0UA 2XPVA 1JT0A 4M3EA 3BQYA 2X6OA 3KKCA 1JUMA 4G12A 4NELA 5IOZA 3LWJA 3VW0A 3O8HA 2XGCA 4B3AA 3DCFA 2XGEA 3NRGA 2WGBA 3G1OA 5CXIA 3HTAA 5GPAA 3BTCA 2Q24A 3VIBA 4ACIA 3ZQIA 2RASA 4V2GA 2G7LA 3IH4A 2Y31A 3HE0A 2HKUA 4W97A 3IH2A 4M3DA 3LOCA 3BCGA 5D19A 3MNLA 5GPCA 3CWRA 3NI7A 3E7QA 5F08A 2HQ5A 2RHAA 4W1UA 5DAJA 2HXIA 2IEKA 3BTIA 3QPLA 3VOXA 3F1BA 5FKOA 3V78A 2FBQA 2OF7A 3TP3A 4AUXA 3HGGA 5F0CA 3BR6A 3F0CA 5EYRA 3Q0VA 3WHCA 2NP3A 3CCYA 1VI0A 5HBUA 1T56A 2REKA 3BR2A 3COLA 3NNRA 5F27A 2HXOA 5HAWA 3ZQFA 3HTHA 3VP5A 5J1YA 2D6YA 2Y30A 4HKUA 2XPWA 3JSJA 2VKEA 4GCTA 4UDSA 2G0EA 2QWTA 2V57A 3HTIA 1QPIA 5FGLA 3ANGA 2VPRA 2ZCMA 4XK4A 1Z77A 2NS8A 4GFLA 3FRQA 4CGRA 2HYJA 3P9TA 4AC0A 2G7GA 4D5CA 2ZCXA 3G1LA 2GUHA 2JK3A 3QKXA 5FKNA 2W53A 2QKOA 3C2BA 5IP6A 4I6ZA 5GP9A 3DPJA 3VPRA 2GBYA 1QVTA 3Q0WA 3ZQHA 3FK6A 3NXCA 2NX4A 2QOPA 2FJ1A 4AC6A 5K7FA 3IUVA 3S5RA 3O8GA 2TRTA 3BQZA 4JNNA 4M3FA 4JYKA 3CDLA 2FX0A 3LJLA 4L62A 3WHBA 2O7OA 4ME9A 2XB5A 3VUQA 3AQTA 2ZB9A 2GFNA 3KKDA 5IPAA 2ZOYA 3G1MA 1RPWA 2NS7A 5AQCA 2DG8A 3RD3A 3HGYA 3VW2A 3LHQA 5EZGA 5F0FA 4PXIA 2XPUA 1JTYA 3PASA 5K58A 4M3BA 3NPIA 4JL3A 5C4YA 2NP5A 5J1RA 5J3LA 2QTQA 3QQAA 1ORKA 3PM1A 2IU5A 2WV1A 3ON2A 2YVEA 5EZHA 1U9OA 2DTZA 2OPTA 3QBMA 3Q3SA 3VVYA 3B81A 3G56A 1QVUA 3EGQA 2UXOA 2OERA 2FQ4A 5FMPA 4D7NA 3LSJA 5D18A 5FHPA 2QIBA 5K7HA 5FKKA 4JKZA 2YVHA 5F04A 3BT9A 5F1JA 3SFIA 1ZK8A 4NN1A 4MO7A
chains in the Genus database with same CATH superfamily
3KZ9A 2UXHA 3HIMA 4D5FA 3AQSA 4GFKA 4MK6A 3KYLA 2A2FX 2R7OA 2JJ7A 4AF5A 1SGMA 3VTIA 3MVPA 2ZY9A 1UI6A 3BTLA 1JUPA 4KWAA 5FKMA 2PBXA 4M3GA 2WUIA 5CW8A 5H9TA 3B6AA 2DG7A 5J1UA 4GCLA 3CRJA 4ICHA 5IOYA 1BJZA 2F07A 2I10A 1JT6A 3BR3A 3FIWA 3LSRA 1RKTA 3TP0A 2GENA 4V2FA 4DW6A 2EH3A 2FJI1 1Z0XA 1RKWA 3BJBA 3BR5A 2QCOA 3EUPA 3BNIA 1ZKGA 3ON4A 2UXPA 2IBDA 2OI8A 1UI5A 2O7TA 4D7MA 3BRUA 3HTJA 3IH3A 5D1RA 5HSZA 3GZIA 2TCTA 3BTJA 2PZ9A 2RAEA 2B1EA 3BHQA 2G7SA 5K7ZA 2XDNA 2ZCNA 2XRLA 4X1EA 1T33A 3ANPA 2X9DA 5EFYA 4WIBA 5FKLA 5CQGA 3FHNA 5CXGA 2ZOZA 3KNWA 3RH2A 2VKVA 3B6CA 4B1RA 3FK7A 3ZQLA 2UXIA 4GCKA 3VW1A 4MXMA 3BR1A 2HYTA 3QPSA 2IAIA 2ID3A 3V6GA 3NS4A 4I76A 3DU5A 1A6IA 3ZQGA 2B3WA 2G3BA 2ID6A 3SDGA 3C07A 3DEWA 3VVZA 1U9NA 3GEUA 2XGDA 3O60A 4ABZA 3PPBA 2R7QA 3T6NA 3G7RA 5F0HA 2FD5A 2R7TA 4YZEA 3LSPA 3VOKA 1JTXA 1JUSA 2Y2ZA 2UXUA 3VVXA 3BR0A 3CJDA 3Q0UA 2XPVA 1JT0A 2R7XA 4M3EA 3BQYA 2X6OA 3KKCA 2YVXA 1JUMA 4G12A 4NELA 5IOZA 3LWJA 3VW0A 3O8HA 2XGCA 3K8PC 4B3AA 3DCFA 2XGEA 3NRGA 2WGBA 3G1OA 5CXIA 3HTAA 5GPAA 3BTCA 2Q24A 3VIBA 2R7UA 4ACIA 3ZQIA 2RASA 4V2GA 2G7LA 3IH4A 2Y31A 3HE0A 2HKUA 4W97A 3IH2A 4M3DA 3LOCA 3BCGA 5D19A 3MNLA 5GPCA 3CWRA 3NI7A 3E7QA 4C2MA 5F08A 2HQ5A 2RHAA 4W1UA 5DAJA 2HXIA 4U9NA 2IEKA 3BTIA 3QPLA 3VOXA 3F1BA 5FKOA 3V78A 2R7RA 2FBQA 2OF7A 3TP3A 4AUXA 3HGGA 5F0CA 3BR6A 3DU6A 3F0CA 5EYRA 3Q0VA 3WHCA 2NP3A 3CCYA 1VI0A 5HBUA 1T56A 2R7WA 2REKA 3BR2A 3COLA 3NNRA 5F27A 2HXOA 5HAWA 3ZQFA 3HTHA 3VP5A 5J1YA 2D6YA 2Y30A 4HKUA 2XPWA 3JSJA 2VKEA 4GCTA 4UDSA 2G0EA 2R7VA 2QWTA 2V57A 3HTIA 1QPIA 5FGLA 3ANGA 2VPRA 2ZCMA 4XK4A 1Z77A 2NS8A 4GFLA 3FRQA 4CGRA 2HYJA 3P9TA 4AC0A 2G7GA 4D5CA 2ZCXA 3G1LA 2GUHA 2JK3A 3QKXA 5FKNA 2W53A 2QKOA 4DVYP 3C2BA 5IP6A 4I6ZA 5GP9A 3DPJA 3VPRA 2GBYA 3SWHA 1QVTA 3Q0WA 3ZQHA 3FK6A 3NXCA 2NX4A 2QOPA 2FJ1A 4AC6A 5K7FA 3IUVA 3S5RA 3O8GA 2TRTA 3BQZA 4JNNA 4M3FA 4JYKA 3CDLA 2FX0A 3LJLA 4L62A 3WHBA 2O7OA 4ME9A 2XB5A 3VUQA 3AQTA 2ZB9A 2GFNA 3KKDA 5IPAA 4IRVA 2ZOYA 3G1MA 1RPWA 2NS7A 5AQCA 2DG8A 3RD3A 3HGYA 4OD4A 3VW2A 3LHQA 5EZGA 5F0FA 4PXIA 2XPUA 1JTYA 3PASA 5K58A 4M3BA 3NPIA 4JL3A 5C4YA 2NP5A 5J1RA 5J3LA 2QTQA 3QQAA 1ORKA 3PM1A 2IU5A 2WV1A 3ON2A 2YVEA 5EZHA 1U9OA 2DTZA 2OPTA 3QBMA 3Q3SA 3VVYA 3B81A 3G56A 1QVUA 3EGQA 2UXOA 2PFVA 2OERA 2FQ4A 5FMPA 4D7NA 3LSJA 5D18A 5FHPA 2QIBA 4U9LA 5K7HA 5FKKA 4JKZA 2YVHA 2R7SA 5F04A 3BT9A 4OD5A 5F1JA 3SFIA 1ZK8A 4NN1A 4MO7A
chains in the Genus database with same CATH topology
3KZ9A 2UXHA 3HIMA 4D5FA 3AQSA 4GFKA 4MK6A 2JJ7A 4AF5A 1SGMA 3MVPA 1UI6A 3BTLA 1JUPA 4KWAA 5FKMA 2PBXA 4M3GA 2WUIA 5CW8A 5H9TA 3B6AA 2DG7A 5J1UA 4GCLA 3CRJA 4ICHA 5IOYA 1BJZA 2F07A 2I10A 1JT6A 3BR3A 3FIWA 3LSRA 1RKTA 3TP0A 2GENA 4V2FA 4DW6A 2EH3A 1Z0XA 1RKWA 3BJBA 3BR5A 2QCOA 3EUPA 3BNIA 1ZKGA 3ON4A 2UXPA 2IBDA 2OI8A 1UI5A 2O7TA 4D7MA 3BRUA 3HTJA 3IH3A 5D1RA 5HSZA 3GZIA 2TCTA 3BTJA 2PZ9A 2RAEA 3BHQA 2G7SA 5K7ZA 2XDNA 2ZCNA 2XRLA 4X1EA 1T33A 3ANPA 2X9DA 5EFYA 5FKLA 5CXGA 2ZOZA 3KNWA 3RH2A 2VKVA 3B6CA 4B1RA 3FK7A 3ZQLA 2UXIA 4GCKA 3VW1A 4MXMA 3BR1A 2HYTA 3QPSA 2IAIA 2ID3A 3V6GA 4I76A 1A6IA 3ZQGA 2G3BA 2ID6A 3SDGA 3C07A 3DEWA 3VVZA 1U9NA 3GEUA 2XGDA 3O60A 4ABZA 3PPBA 3T6NA 3G7RA 5F0HA 2FD5A 4YZEA 3LSPA 3VOKA 1JTXA 1JUSA 2Y2ZA 2UXUA 3VVXA 3BR0A 3CJDA 3Q0UA 2XPVA 1JT0A 4M3EA 3BQYA 2X6OA 3KKCA 1JUMA 4G12A 4NELA 5IOZA 3LWJA 3VW0A 3O8HA 2XGCA 4B3AA 3DCFA 2XGEA 3NRGA 2WGBA 3G1OA 5CXIA 3HTAA 5GPAA 3BTCA 2Q24A 3VIBA 4ACIA 3ZQIA 2RASA 4V2GA 2G7LA 3IH4A 2Y31A 3HE0A 2HKUA 4W97A 3IH2A 4M3DA 3LOCA 3BCGA 5D19A 3MNLA 5GPCA 3CWRA 3NI7A 3E7QA 5F08A 2HQ5A 2RHAA 4W1UA 5DAJA 2HXIA 2IEKA 3BTIA 3QPLA 3VOXA 3F1BA 5FKOA 3V78A 2FBQA 2OF7A 3TP3A 4AUXA 3HGGA 5F0CA 3BR6A 3F0CA 5EYRA 3Q0VA 3WHCA 2NP3A 3CCYA 1VI0A 5HBUA 1T56A 2REKA 3BR2A 3COLA 3NNRA 5F27A 2HXOA 5HAWA 3ZQFA 3HTHA 3VP5A 5J1YA 2D6YA 2Y30A 4HKUA 2XPWA 3JSJA 2VKEA 4GCTA 4UDSA 2G0EA 2QWTA 2V57A 3HTIA 1QPIA 5FGLA 3ANGA 2VPRA 2ZCMA 4XK4A 1Z77A 2NS8A 4GFLA 3FRQA 4CGRA 2HYJA 3P9TA 4AC0A 2G7GA 4D5CA 2ZCXA 3G1LA 2GUHA 2JK3A 3QKXA 5FKNA 2W53A 2QKOA 3C2BA 5IP6A 4I6ZA 5GP9A 3DPJA 3VPRA 2GBYA 1QVTA 3Q0WA 3ZQHA 3FK6A 3NXCA 2NX4A 2QOPA 2FJ1A 4AC6A 5K7FA 3IUVA 3S5RA 3O8GA 2TRTA 3BQZA 4JNNA 4M3FA 4JYKA 3CDLA 2FX0A 3LJLA 4L62A 3WHBA 2O7OA 4ME9A 2XB5A 3VUQA 3AQTA 2ZB9A 2GFNA 3KKDA 5IPAA 2ZOYA 3G1MA 1RPWA 2NS7A 5AQCA 2DG8A 3RD3A 3HGYA 3VW2A 3LHQA 5EZGA 5F0FA 4PXIA 2XPUA 1JTYA 3PASA 5K58A 4M3BA 3NPIA 4JL3A 5C4YA 2NP5A 5J1RA 5J3LA 2QTQA 3QQAA 1ORKA 3PM1A 2IU5A 2WV1A 3ON2A 2YVEA 5EZHA 1U9OA 2DTZA 2OPTA 3QBMA 3Q3SA 3VVYA 3B81A 3G56A 1QVUA 3EGQA 2UXOA 2OERA 2FQ4A 5FMPA 4D7NA 3LSJA 5D18A 5FHPA 2QIBA 5K7HA 5FKKA 4JKZA 2YVHA 5F04A 3BT9A 5F1JA 3SFIA 1ZK8A 4NN1A 4MO7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KZ9 A;  2UXH A;  3HIM A;  4D5F A;  3AQS A;  4GFK A;  4MK6 A;  2JJ7 A;  4AF5 A;  1SGM A;  3MVP A;  1UI6 A;  3BTL A;  1JUP A;  4KWA A;  5FKM A;  2PBX A;  4M3G A;  2WUI A;  5CW8 A;  5H9T A;  3B6A A;  2DG7 A;  5J1U A;  4GCL A;  3CRJ A;  4ICH A;  5IOY A;  1BJZ A;  2F07 A;  2I10 A;  1JT6 A;  3BR3 A;  3FIW A;  3LSR A;  1RKT A;  3TP0 A;  2GEN A;  4V2F A;  4DW6 A;  2EH3 A;  1Z0X A;  1RKW A;  3BJB A;  3BR5 A;  2QCO A;  3EUP A;  3BNI A;  1ZKG A;  3ON4 A;  2UXP A;  2IBD A;  2OI8 A;  1UI5 A;  2O7T A;  4D7M A;  3BRU A;  3HTJ A;  3IH3 A;  5D1R A;  5HSZ A;  3GZI A;  2TCT A;  3BTJ A;  2PZ9 A;  2RAE A;  3BHQ A;  2G7S A;  5K7Z A;  2XDN A;  2ZCN A;  2XRL A;  4X1E A;  1T33 A;  3ANP A;  2X9D A;  5EFY A;  5FKL A;  5CXG A;  2ZOZ A;  3KNW A;  3RH2 A;  2VKV A;  3B6C A;  4B1R A;  3FK7 A;  3ZQL A;  2UXI A;  4GCK A;  3VW1 A;  4MXM A;  3BR1 A;  2HYT A;  3QPS A;  2IAI A;  2ID3 A;  3V6G A;  4I76 A;  1A6I A;  3ZQG A;  2G3B A;  2ID6 A;  3SDG A;  3C07 A;  3DEW A;  3VVZ A;  1U9N A;  3GEU A;  2XGD A;  3O60 A;  4ABZ A;  3PPB A;  3T6N A;  3G7R A;  5F0H A;  2FD5 A;  4YZE A;  3LSP A;  3VOK A;  1JTX A;  1JUS A;  2Y2Z A;  2UXU A;  3VVX A;  3BR0 A;  3CJD A;  3Q0U A;  2XPV A;  1JT0 A;  4M3E A;  3BQY A;  2X6O A;  3KKC A;  1JUM A;  4G12 A;  4NEL A;  5IOZ A;  3LWJ A;  3VW0 A;  3O8H A;  2XGC A;  4B3A A;  3DCF A;  2XGE A;  3NRG A;  2WGB A;  3G1O A;  5CXI A;  3HTA A;  5GPA A;  3BTC A;  2Q24 A;  3VIB A;  4ACI A;  3ZQI A;  2RAS A;  4V2G A;  2G7L A;  3IH4 A;  2Y31 A;  3HE0 A;  2HKU A;  4W97 A;  3IH2 A;  4M3D A;  3LOC A;  3BCG A;  5D19 A;  3MNL A;  5GPC A;  3CWR A;  3NI7 A;  3E7Q A;  5F08 A;  2HQ5 A;  2RHA A;  4W1U A;  5DAJ A;  2HXI A;  2IEK A;  3BTI A;  3QPL A;  3VOX A;  3F1B A;  5FKO A;  3V78 A;  2FBQ A;  2OF7 A;  3TP3 A;  4AUX A;  3HGG A;  5F0C A;  3BR6 A;  3F0C A;  5EYR A;  3Q0V A;  3WHC A;  2NP3 A;  3CCY A;  1VI0 A;  5HBU A;  1T56 A;  2REK A;  3BR2 A;  3COL A;  3NNR A;  5F27 A;  2HXO A;  5HAW A;  3ZQF A;  3HTH A;  3VP5 A;  5J1Y A;  2D6Y A;  2Y30 A;  4HKU A;  2XPW A;  3JSJ A;  2VKE A;  4GCT A;  4UDS A;  2G0E A;  2QWT A;  2V57 A;  3HTI A;  1QPI A;  5FGL A;  3ANG A;  2VPR A;  2ZCM A;  4XK4 A;  1Z77 A;  2NS8 A;  4GFL A;  3FRQ A;  4CGR A;  2HYJ A;  3P9T A;  4AC0 A;  2G7G A;  4D5C A;  2ZCX A;  3G1L A;  2GUH A;  2JK3 A;  3QKX A;  5FKN A;  2W53 A;  2QKO A;  3C2B A;  5IP6 A;  4I6Z A;  5GP9 A;  3DPJ A;  3VPR A;  2GBY A;  1QVT A;  3Q0W A;  3ZQH A;  3FK6 A;  3NXC A;  2NX4 A;  2QOP A;  2FJ1 A;  4AC6 A;  5K7F A;  3IUV A;  3S5R A;  3O8G A;  2TRT A;  3BQZ A;  4JNN A;  4M3F A;  4JYK A;  3CDL A;  2FX0 A;  3LJL A;  4L62 A;  3WHB A;  2O7O A;  4ME9 A;  2XB5 A;  3VUQ A;  3AQT A;  2ZB9 A;  2GFN A;  3KKD A;  5IPA A;  2ZOY A;  3G1M A;  1RPW A;  2NS7 A;  5AQC A;  2DG8 A;  3RD3 A;  3HGY A;  3VW2 A;  3LHQ A;  5EZG A;  5F0F A;  4PXI A;  2XPU A;  1JTY A;  3PAS A;  5K58 A;  4M3B A;  3NPI A;  4JL3 A;  5C4Y A;  2NP5 A;  5J1R A;  5J3L A;  2QTQ A;  3QQA A;  1ORK A;  3PM1 A;  2IU5 A;  2WV1 A;  3ON2 A;  2YVE A;  5EZH A;  1U9O A;  2DTZ A;  2OPT A;  3QBM A;  3Q3S A;  3VVY A;  3B81 A;  3G56 A;  1QVU A;  3EGQ A;  2UXO A;  2OER A;  2FQ4 A;  5FMP A;  4D7N A;  3LSJ A;  5D18 A;  5FHP A;  2QIB A;  5K7H A;  5FKK A;  4JKZ A;  2YVH A;  5F04 A;  3BT9 A;  5F1J A;  3SFI A;  1ZK8 A;  4NN1 A;  4MO7 A; 
#chains in the Genus database with same CATH topology
 3KZ9 A;  2UXH A;  3HIM A;  4D5F A;  3AQS A;  4GFK A;  4MK6 A;  3KYL A;  2A2F X;  2R7O A;  2JJ7 A;  4AF5 A;  1SGM A;  3VTI A;  3MVP A;  2ZY9 A;  1UI6 A;  3BTL A;  1JUP A;  4KWA A;  5FKM A;  2PBX A;  4M3G A;  2WUI A;  5CW8 A;  5H9T A;  3B6A A;  2DG7 A;  5J1U A;  4GCL A;  3CRJ A;  4ICH A;  5IOY A;  1BJZ A;  2F07 A;  2I10 A;  1JT6 A;  3BR3 A;  3FIW A;  3LSR A;  1RKT A;  3TP0 A;  2GEN A;  4V2F A;  4DW6 A;  2EH3 A;  2FJI 1;  1Z0X A;  1RKW A;  3BJB A;  3BR5 A;  2QCO A;  3EUP A;  3BNI A;  1ZKG A;  3ON4 A;  2UXP A;  2IBD A;  2OI8 A;  1UI5 A;  2O7T A;  4D7M A;  3BRU A;  3HTJ A;  3IH3 A;  5D1R A;  5HSZ A;  3GZI A;  2TCT A;  3BTJ A;  2PZ9 A;  2RAE A;  2B1E A;  3BHQ A;  2G7S A;  5K7Z A;  2XDN A;  2ZCN A;  2XRL A;  4X1E A;  1T33 A;  3ANP A;  2X9D A;  5EFY A;  4WIB A;  5FKL A;  5CQG A;  3FHN A;  5CXG A;  2ZOZ A;  3KNW A;  3RH2 A;  2VKV A;  3B6C A;  4B1R A;  3FK7 A;  3ZQL A;  2UXI A;  4GCK A;  3VW1 A;  4MXM A;  3BR1 A;  2HYT A;  3QPS A;  2IAI A;  2ID3 A;  3V6G A;  3NS4 A;  4I76 A;  3DU5 A;  1A6I A;  3ZQG A;  2B3W A;  2G3B A;  2ID6 A;  3SDG A;  3C07 A;  3DEW A;  3VVZ A;  1U9N A;  3GEU A;  2XGD A;  3O60 A;  4ABZ A;  3PPB A;  2R7Q A;  3T6N A;  3G7R A;  5F0H A;  2FD5 A;  2R7T A;  4YZE A;  3LSP A;  3VOK A;  1JTX A;  1JUS A;  2Y2Z A;  2UXU A;  3VVX A;  3BR0 A;  3CJD A;  3Q0U A;  2XPV A;  1JT0 A;  2R7X A;  4M3E A;  3BQY A;  2X6O A;  3KKC A;  2YVX A;  1JUM A;  4G12 A;  4NEL A;  5IOZ A;  3LWJ A;  3VW0 A;  3O8H A;  2XGC A;  3K8P C;  4B3A A;  3DCF A;  2XGE A;  3NRG A;  2WGB A;  3G1O A;  5CXI A;  3HTA A;  5GPA A;  3BTC A;  2Q24 A;  3VIB A;  2R7U A;  4ACI A;  3ZQI A;  2RAS A;  4V2G A;  2G7L A;  3IH4 A;  2Y31 A;  3HE0 A;  2HKU A;  4W97 A;  3IH2 A;  4M3D A;  3LOC A;  3BCG A;  5D19 A;  3MNL A;  5GPC A;  3CWR A;  3NI7 A;  3E7Q A;  4C2M A;  5F08 A;  2HQ5 A;  2RHA A;  4W1U A;  5DAJ A;  2HXI A;  4U9N A;  2IEK A;  3BTI A;  3QPL A;  3VOX A;  3F1B A;  5FKO A;  3V78 A;  2R7R A;  2FBQ A;  2OF7 A;  3TP3 A;  4AUX A;  3HGG A;  5F0C A;  3BR6 A;  3DU6 A;  3F0C A;  5EYR A;  3Q0V A;  3WHC A;  2NP3 A;  3CCY A;  1VI0 A;  5HBU A;  1T56 A;  2R7W A;  2REK A;  3BR2 A;  3COL A;  3NNR A;  5F27 A;  2HXO A;  5HAW A;  3ZQF A;  3HTH A;  3VP5 A;  5J1Y A;  2D6Y A;  2Y30 A;  4HKU A;  2XPW A;  3JSJ A;  2VKE A;  4GCT A;  4UDS A;  2G0E A;  2R7V A;  2QWT A;  2V57 A;  3HTI A;  1QPI A;  5FGL A;  3ANG A;  2VPR A;  2ZCM A;  4XK4 A;  1Z77 A;  2NS8 A;  4GFL A;  3FRQ A;  4CGR A;  2HYJ A;  3P9T A;  4AC0 A;  2G7G A;  4D5C A;  2ZCX A;  3G1L A;  2GUH A;  2JK3 A;  3QKX A;  5FKN A;  2W53 A;  2QKO A;  4DVY P;  3C2B A;  5IP6 A;  4I6Z A;  5GP9 A;  3DPJ A;  3VPR A;  2GBY A;  3SWH A;  1QVT A;  3Q0W A;  3ZQH A;  3FK6 A;  3NXC A;  2NX4 A;  2QOP A;  2FJ1 A;  4AC6 A;  5K7F A;  3IUV A;  3S5R A;  3O8G A;  2TRT A;  3BQZ A;  4JNN A;  4M3F A;  4JYK A;  3CDL A;  2FX0 A;  3LJL A;  4L62 A;  3WHB A;  2O7O A;  4ME9 A;  2XB5 A;  3VUQ A;  3AQT A;  2ZB9 A;  2GFN A;  3KKD A;  5IPA A;  4IRV A;  2ZOY A;  3G1M A;  1RPW A;  2NS7 A;  5AQC A;  2DG8 A;  3RD3 A;  3HGY A;  4OD4 A;  3VW2 A;  3LHQ A;  5EZG A;  5F0F A;  4PXI A;  2XPU A;  1JTY A;  3PAS A;  5K58 A;  4M3B A;  3NPI A;  4JL3 A;  5C4Y A;  2NP5 A;  5J1R A;  5J3L A;  2QTQ A;  3QQA A;  1ORK A;  3PM1 A;  2IU5 A;  2WV1 A;  3ON2 A;  2YVE A;  5EZH A;  1U9O A;  2DTZ A;  2OPT A;  3QBM A;  3Q3S A;  3VVY A;  3B81 A;  3G56 A;  1QVU A;  3EGQ A;  2UXO A;  2PFV A;  2OER A;  2FQ4 A;  5FMP A;  4D7N A;  3LSJ A;  5D18 A;  5FHP A;  2QIB A;  4U9L A;  5K7H A;  5FKK A;  4JKZ A;  2YVH A;  2R7S A;  5F04 A;  3BT9 A;  4OD5 A;  5F1J A;  3SFI A;  1ZK8 A;  4NN1 A;  4MO7 A; 
#chains in the Genus database with same CATH homology
 3KZ9 A;  2UXH A;  3HIM A;  4D5F A;  3AQS A;  4GFK A;  4MK6 A;  2JJ7 A;  4AF5 A;  1SGM A;  3MVP A;  1UI6 A;  3BTL A;  1JUP A;  4KWA A;  5FKM A;  2PBX A;  4M3G A;  2WUI A;  5CW8 A;  5H9T A;  3B6A A;  2DG7 A;  5J1U A;  4GCL A;  3CRJ A;  4ICH A;  5IOY A;  1BJZ A;  2F07 A;  2I10 A;  1JT6 A;  3BR3 A;  3FIW A;  3LSR A;  1RKT A;  3TP0 A;  2GEN A;  4V2F A;  4DW6 A;  2EH3 A;  1Z0X A;  1RKW A;  3BJB A;  3BR5 A;  2QCO A;  3EUP A;  3BNI A;  1ZKG A;  3ON4 A;  2UXP A;  2IBD A;  2OI8 A;  1UI5 A;  2O7T A;  4D7M A;  3BRU A;  3HTJ A;  3IH3 A;  5D1R A;  5HSZ A;  3GZI A;  2TCT A;  3BTJ A;  2PZ9 A;  2RAE A;  3BHQ A;  2G7S A;  5K7Z A;  2XDN A;  2ZCN A;  2XRL A;  4X1E A;  1T33 A;  3ANP A;  2X9D A;  5EFY A;  5FKL A;  5CXG A;  2ZOZ A;  3KNW A;  3RH2 A;  2VKV A;  3B6C A;  4B1R A;  3FK7 A;  3ZQL A;  2UXI A;  4GCK A;  3VW1 A;  4MXM A;  3BR1 A;  2HYT A;  3QPS A;  2IAI A;  2ID3 A;  3V6G A;  4I76 A;  1A6I A;  3ZQG A;  2G3B A;  2ID6 A;  3SDG A;  3C07 A;  3DEW A;  3VVZ A;  1U9N A;  3GEU A;  2XGD A;  3O60 A;  4ABZ A;  3PPB A;  3T6N A;  3G7R A;  5F0H A;  2FD5 A;  4YZE A;  3LSP A;  3VOK A;  1JTX A;  1JUS A;  2Y2Z A;  2UXU A;  3VVX A;  3BR0 A;  3CJD A;  3Q0U A;  2XPV A;  1JT0 A;  4M3E A;  3BQY A;  2X6O A;  3KKC A;  1JUM A;  4G12 A;  4NEL A;  5IOZ A;  3LWJ A;  3VW0 A;  3O8H A;  2XGC A;  4B3A A;  3DCF A;  2XGE A;  3NRG A;  2WGB A;  3G1O A;  5CXI A;  3HTA A;  5GPA A;  3BTC A;  2Q24 A;  3VIB A;  4ACI A;  3ZQI A;  2RAS A;  4V2G A;  2G7L A;  3IH4 A;  2Y31 A;  3HE0 A;  2HKU A;  4W97 A;  3IH2 A;  4M3D A;  3LOC A;  3BCG A;  5D19 A;  3MNL A;  5GPC A;  3CWR A;  3NI7 A;  3E7Q A;  5F08 A;  2HQ5 A;  2RHA A;  4W1U A;  5DAJ A;  2HXI A;  2IEK A;  3BTI A;  3QPL A;  3VOX A;  3F1B A;  5FKO A;  3V78 A;  2FBQ A;  2OF7 A;  3TP3 A;  4AUX A;  3HGG A;  5F0C A;  3BR6 A;  3F0C A;  5EYR A;  3Q0V A;  3WHC A;  2NP3 A;  3CCY A;  1VI0 A;  5HBU A;  1T56 A;  2REK A;  3BR2 A;  3COL A;  3NNR A;  5F27 A;  2HXO A;  5HAW A;  3ZQF A;  3HTH A;  3VP5 A;  5J1Y A;  2D6Y A;  2Y30 A;  4HKU A;  2XPW A;  3JSJ A;  2VKE A;  4GCT A;  4UDS A;  2G0E A;  2QWT A;  2V57 A;  3HTI A;  1QPI A;  5FGL A;  3ANG A;  2VPR A;  2ZCM A;  4XK4 A;  1Z77 A;  2NS8 A;  4GFL A;  3FRQ A;  4CGR A;  2HYJ A;  3P9T A;  4AC0 A;  2G7G A;  4D5C A;  2ZCX A;  3G1L A;  2GUH A;  2JK3 A;  3QKX A;  5FKN A;  2W53 A;  2QKO A;  3C2B A;  5IP6 A;  4I6Z A;  5GP9 A;  3DPJ A;  3VPR A;  2GBY A;  1QVT A;  3Q0W A;  3ZQH A;  3FK6 A;  3NXC A;  2NX4 A;  2QOP A;  2FJ1 A;  4AC6 A;  5K7F A;  3IUV A;  3S5R A;  3O8G A;  2TRT A;  3BQZ A;  4JNN A;  4M3F A;  4JYK A;  3CDL A;  2FX0 A;  3LJL A;  4L62 A;  3WHB A;  2O7O A;  4ME9 A;  2XB5 A;  3VUQ A;  3AQT A;  2ZB9 A;  2GFN A;  3KKD A;  5IPA A;  2ZOY A;  3G1M A;  1RPW A;  2NS7 A;  5AQC A;  2DG8 A;  3RD3 A;  3HGY A;  3VW2 A;  3LHQ A;  5EZG A;  5F0F A;  4PXI A;  2XPU A;  1JTY A;  3PAS A;  5K58 A;  4M3B A;  3NPI A;  4JL3 A;  5C4Y A;  2NP5 A;  5J1R A;  5J3L A;  2QTQ A;  3QQA A;  1ORK A;  3PM1 A;  2IU5 A;  2WV1 A;  3ON2 A;  2YVE A;  5EZH A;  1U9O A;  2DTZ A;  2OPT A;  3QBM A;  3Q3S A;  3VVY A;  3B81 A;  3G56 A;  1QVU A;  3EGQ A;  2UXO A;  2OER A;  2FQ4 A;  5FMP A;  4D7N A;  3LSJ A;  5D18 A;  5FHP A;  2QIB A;  5K7H A;  5FKK A;  4JKZ A;  2YVH A;  5F04 A;  3BT9 A;  5F1J A;  3SFI A;  1ZK8 A;  4NN1 A;  4MO7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...