2EH3A

Crystal structure of aq_1058, a transcriptional regulator (terr/acrr family) from aquifex aeolicus vf5
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
171
structure length
171
Chain Sequence
GTKERILEVSKELFFEKGYQGTSVEEIVKRANLSKGAFYFHFKSKEELITEIIERTHKKIISLFEENKEKTPEELLEMFLEVLYREKKVVYIFLFDLLCSEKFRNIYFEKIEDAKRRFEKFLEKHFPSKAEILSEIILGFLRQLILHYVIKEERELPFLKEKLREGLKLIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator
publication title Crystal structure of aq_1058, a transcriptional regulator (TerR/AcrR family) from Aquifex aeolicus VF5
rcsb
source organism Aquifex aeolicus
molecule tags Transcription
total genus 71
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2007-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2eh3A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2eh3A02
2DJNA 2DMQA 2GENA 1FTZA 2XGCA 4C3IJ 3CDLA 2UXIA 1JKPC 1XG1A 1UI5A 1NK3P 2CUEA 2G7GA 1FIAA 1QVTA 3VVXA 3ANPA 4AYBN 1A6IA 2IAIA 3BHQA 2PMZN 1ETOA 1JJ8C 4JKZA 5IOZA 1SGMA 3BCGA 4A3EJ 1POGA 5F0HA 3RKQA 3JRDA 2IBDA 2NS8A 2YVHA 2DA4A 4M3GA 1DU6A 4ABZA 2XB5A 4YZEA 4DYQA 1FIPA 2JA7J 2LLKA 3G1OA 3H3VK 2Q24A 3G1MA 1JJ6C 5FGLA 2GUHA 3CCYA 3MN2A 3BQYA 1BW6A 3VP5A 2DN0A 3NI7A 4X1EA 2L7MP 2Y0SN 3BG9A 2JWTA 3E7LA 1A5JA 3KZ9A 1QVUA 3LHQA 2JMWA 4XICA 2G3BA 3GBGA 2HOSA 1NTCA 2NX4A 3MKLA 2X9DA 2ZCNA 4XK4A 3VPRA 5IPAA 3FRQA 3IUVA 5E3MA 3HM5A 5K7FA 4Y52J 3VOXA 3JRIA 4FTHA 1MBEA 3S2HJ 4CGRA 3HOWJ 1TWFJ 2TCTA 5F08A 3NPIA 4HKUA 4GCKA 3FIWA 3V6GA 2HXIA 4C3HJ 4KWAA 3OIOA 2HOTA 1ORKA 3BR3A 1DU0A 3QQAA 4JX4A 1VNDA 2NVTJ 1HDPA 3K2AA 3HB9A 3S17J 1SANA 5M5XJ 3IH3A 4XIDA 3L1PA 3LSPA 2E2HJ 2LVSA 1MH3A 2E2JJ 5FHPA 4AC6A 3D1NI 2D6YA 2ECCA 3HTAA 5EDNA 1RESA 1FJLA 4QIWN 5K7HA 1ETQA 2CRGA 2KT0A 1ZR4A 5EGOA 2OPTA 1HCRA 1P7JA 3TW6A 4NN1A 3HOYJ 2XGDA 3HTIA 4BY7J 4BBRJ 5M3MJ 2JA8J 5JLWA 3ZQGA 3GTLJ 2DG7A 2WV1A 5GP9A 3ZQIA 2NVQJ 3RD3A 2L7FP 3CWRA 3V78A 5FMPA 4D7NA 3SJMA 1U9NA 5HSZA 5IOYA 2NOGA 5C3EJ 4A3GJ 2TRTA 3NNRA 1Z77A 1IUFA 1PUFB 1E3OC 1BA5A 1WPKA 5BNGA 1AU7A 2X48A 3TP0A 3E7QA 3W6VA 2LD5A 2IU5A 4JX6A 2H8RA 1VI0A 5M3FJ 5EGOB 4JP0A 1JKQC 2DMUA 2ID6A 2F07A 1JT0A 1MBJA 5D1RA 3RQIA 3KKCA 3TP3A 1Y1WJ 5D19A 2QCOA 1UI6A 2AO9A 3GTPJ 1JTYA 5HODA 2EZHA 2EH3A 1U78A 2CJJA 4JX5A 2K40A 3Q0UA 1IDYA 1ZTRA 2MSYA 3BTJA 4M3EA 4I76A 2ELKA 4BBSJ 1LFUP 2OF7A 5IYCJ 3ZOBA 1JTXA 4EEFG 4QTRA 4CYCB 2B63J 2HOAA 2W53A 2NS7A 4FE7A 3GZIA 3LSRA 1RKTA 5F0FA 2ECBA 4GFLA 2XDNA 1IGNA 1OCPA 3ON4A 4ICHA 5J1RA 1ZKGA 2EQRA 1ZR2A 2NVYJ 3JR9A 2MW8A 1X2MA 3ZQLA 3LJLA 1AHDP 2X6OA 1JKOC 3I4MJ 5FJ8J 1HLVA 2QKOA 2R0QC 1IJWC 1MBHA 2E1OA 1MBFA 3JRHA 3S1RJ 2D5VA 4XRSG 1IC8A 5C44J 5IP9J 2R93J 3WHCA 3A01A 1Y1VJ 5GPAA 1I3QJ 3Q0WA 5H9TA 3A03A 2AHQA 2O7TA 2HI3A 1ZQ3P 1B72B 3IH2A 3ZQHA 1TC3C 4A3CJ 2DA3A 1AKHA 3VOKA 1F43A 4FCYA 3NRGA 1BL0A 2WAQN 5F0CA 5JLXA 3GTJJ 1JKRC 4MFEA 1XC5A 4D5FA 4A3LJ 3F1BA 1OJLA 5E3LA 2HYTA 5C4YA 2XRLA 4A3KJ 5DS9A 2HQ5A 3HEFA 5F27A 3HDDA 2HKUA 4GFBA 1QPIA 4GFKA 1BJZA 2Y2ZA 4B4CA 4IHYA 3SFIA 1IDZA 3MVPA 2GBYA 5F04A 4JYKA 3G56A 3A01B 5EYRA 1D5YA 1LE8A 2NVXJ 5K58A 4M3FA 3JRGA 1QRYA 4Y7NJ 3TEDA 1AKHB 3S16J 2VUMJ 2NP3A 1HF0A 2K9QA 2XPWA 4MFDA 4J19A 2LTPA 2DTZA 3NARA 1ZGWA 2H1KA 3BR1A 2EZIA 3I4NJ 5DTDA 2WGBA 3QKXA 1G2HA 3S1MJ 5C4XJ 2YVEA 1LE8B 3DPJA 4ME9A 3ZQCA 3PO2J 3H0GJ 3JRBA 1MSFC 2KDZA 3LNQA 2EZKA 1GV5A 2Y9ZA 1JUMA 3GTMJ 2QF7A 3LWJA 3BNIA 2XPVA 4MXMA 1JT6A 3G7RA 3WHBA 1PUFA 3BTCA 3JREA 3P9TA 4IHVA 1OCTC 1MSEC 3ZQFA 2M2EA 2L7ZA 4GCLA 2Y31A 4BY1J 3AQTA 2G7SA 4PXIA 1R9TJ 2UXHA 4AC0A 1RKWA 3BTLA 4DZJA 5FLVA 5M5WJ 1TWHJ 4A69C 3PASA 5CXGA 3VUQA 3B6AA 1CQTA 1S7EA 2ME6A 2W48A 2O8KA 2UXUA 1P7IA 2L0KA 3K7AJ 1EF4A 1ETKA 1GVDA 1I50J 2GFNA 3T6NA 2O9LA 2YUSA 5EG0A 4A3FJ 1FEXA 3QBMA 2IEKA 3JRAA 3FISA 1IV6A 1IRZA 3BJBA 3HIMA 2LP0A 2RAEA 4CYCA 3COLA 3CMYA 5IP6A 4BKXA 3VIBA 4M6VA 5HBUA 2ZB9A 3JRCA 2R5ZB 1NK2P 4MK6A 4JL3A 3BG3A 2E2IJ 4AF5A 2DA6A 1RR7A 3UKGA 2VKVA 3EUPA 2E19A 2JK3A 5EFYA 3PPBA 2VPRA 1HOMA 2CUFA 1I6HJ 4IEJA 2EZLA 3HOUJ 2DA5A 2LKXA 2DA7A 4M3DA 4A3DJ 1OFCX 4RBOA 5EG0B 2VI6A 3BR5A 4XRMA 2R7ZJ 2R5YB 1WH7A 3SDGA 4DZPA 3S15J 2QOPA 4G12A 4S0HB 1H88C 2JA5J 2MG4A 2EBIA 2UXPA 1JGGA 1APLC 2HDDA 2ID3A 1B72A 2MGQA 2R92J 2CQXA 3BR2A 3NXCA 3BQZA 4V2FA 5FKKA 5CW8A 2DMNA 3OSFA 3PM1A 4ACIA 1H8AC 2DMTA 4DYRA 1ENHA 3FK7A 3GTOJ 1JUPA 1Z0XA 3JRFA 1YRNB 3C07A 2M0CA 1X2NA 1K83J 5J3LA 3Q3SA 2DA2A 2ZOZA 4M3BA 4FISA 1ETXA 5M5YJ 1T56A 2ME0A 3FK6A 4UUTA 1T33A 4IHWA 3S1NJ 1ETYA 3GTQJ 2DMPA 2ZCXA 3C2BA 4C3JJ 3GEUA 3FKIJ 3HOZJ 1MBGA 3VW0A 4HNVA 3PO3J 4XRSA 2QIBA 2FX0A 5FLMJ 1TWGJ 3RZDJ 3AQSA 3KNWA 3ON2A 4MO7A 4W1UA 1LFBA 4MLOA 3DCFA 3LSJA 5FKMA 4LOCA 2GM4A 4D7MA 2QWTA 2FJ1A 1U9OA 1WH5A 1U8BA 1FTTA 4L62A 2OERA 1RPWA 5AQCA 2O7OA 2JJ7A 3HTHA 2LK2A 2DG8A 3QPSA 2XSDC 3HGYA 2GLOA 2XGEA 3OOUA 3O60A 2K9NA 1MBKA 4DYCA 1JUSA 2UXOA 5FKOA 1BW5A 4QSHA 3BR6A 3F0CA 2G7LA 1Q1VA 3EGQA 3VW2A 4FE4A 4A3JJ 4L5EA 3IV5A 1GUUA 3O8GA 3NAUA 1GT0C 2K9SA 2QTQA 2OI8A 2DA1A 3G1LA 4W97A 5DAJA 1TWCJ 2XPUA 3BG5A 3M3YJ 1X58A 2RASA 2WUIA 2ZCMA 3S1QJ 1O4XA 2Y9YA 3BR0A 2CU7A 3DEWA 3HKZN 3HTJA 5J1UA 1ETWA 4MIMA 5IP7J 2REKA 1WCMJ 1XS9A 5GPCA 4GCTA 2HXOA 3BTIA 3VVYA 2R5ZA 2CQQA 1MNMC 3B81A 2LR8A 4NDLA 5E3NA 1K61A 1GDTA 1MH4A 3VW1A 3QPLA 3GTGJ 5J1YA 2N8GA 3KKDA 9ANTA 3MNLA 1VFCA 2P81A 4V2GA 3BRUA 5D18A 2XB0X 3RZOJ 4UDSA 4B1RA 2M8GX 2R5YA 3CQZJ 3CRJA 3HE0A 5E3OA 4IHXA 2JN6A 5EF6A 2G0EA 3HBLA 4I6ZA 4A3BJ 3S5RA 3ANGA 5IYBJ 4X6AJ 1WI3A 2FQ4A 3HOXJ 3S2DJ 1ITYA 3IH4A 5EZHA 2RHAA 2Y30A 5F1JA 2I10A 5EZGA 2YU9J 1B8IA 4JNNA 3HGGA 4A93J 4DW6A 1UG2A 1H89C 3B6CA 3CJDA 3JSJA 4A3IJ 4C2MJ 1IG7A 1YRNA 1UMQA 2PZ9A 1W0UA 5K7ZA 2HYJA 1RETA 1W0TA 3TW7A 1SFOJ 4UUSA 4A3MJ 2COBA 2NP5A 3BT9A 2FBQA 2JA6J 1TWAJ 3HOVJ 3RH2A 3VVZA 5FKLA 2YS9A 3LSGA 1ZK8A 5CXIA 3M4OJ 2PBXA 5EEAA 5C4JJ 1B8IB 2L9RA 1ETVA 2LFBA 3S14J 5HAWA 1UHSA 4B3AA 2LY9A 5FKNA 2ZOYA 1GV2A 1VF9A 3LOCA 3OSGA 4BXXJ 4UUSB 2FD5A 2V57A 2VKEA 3GTKJ 1WGXA 2M9HA 1HDDC 3Q0VA 4RDUA 4NELA 1F36A 4AUXA 4D5CA 2WB1N 5IYDJ 3O8HA 3A02A 2M34A
chains in the Genus database with same CATH superfamily
1A04A 2DMQA 3QU6A 3I59A 2GENA 2VBZA 4MNUA 3CDLA 2UXIA 1JKPC 1UHWA 4O6JA 1UI5A 2QYOA 2A6TA 2CUEA 5D4SA 1FIAA 1QVTA 2FA5A 3VVXA 4AYBN 1P2FA 3TOAA 2XSJC 1JJ8C 3CZ6A 4EJWA 2YVHA 3JRDA 2IBDA 2NS8A 2FE3A 3H5AA 2DA4A 2ZXWH 1DU6A 2AXLA 5E79C 2PG4A 4ABZA 2XB5A 4ANJA 4ZTJA 5B1AH 3BDDA 2DT6A 1IXRC 2Q24A 3I59B 1BW6A 2PLYA 3F3XA 4PFOA 4ENMA 2EK5A 3BPXA 4X1EA 1YW7A 3CP2A 3KZ9A 1HW1A 1WZ2A 1QVUA 4XICA 1I39A 1R4NB 5BQTA 4J01A 3SZGA 1H0MA 3G73A 1RUOA 2YVXA 2NS0A 3L9FA 5CVJA 5ERIA 1R58A 1P4AA 1RR8C 1MBEA 1R00A 1YJ9I 2P5KA 1P92A 2Q1ZB 3HHGA 1ZAOA 4CGRA 3KP7A 4HG2A 2VIXA 1X3WB 4FX0A 2R7SA 3FBNB 3NPIA 5K5QA 2F5VA 4HDVA 4KWAA 3OIOA 4G9YA 3CLQA 3LA3A 1S8NA 4H4KC 1XGSA 4XMYA 1SFKA 4L9NA 1BI0A 3HB9A 5CPRB 1YW9A 5J4YA 2HDWA 1QU3A 2E2HJ 5DUIA 2F2EA 2KDOA 5D5WB 2TDXA 3HTAA 5EDNA 4DBRA 2MD5A 2Z16A 5BS6A 2XHKA 2CRGA 2HPMA 3NQOA 2OPTA 2K5CA 2FQ3A 1G3TA 1P7JA 2IA2A 4BBRJ 4CCNA 5M3MJ 2F5EA 5ED4A 4CCJA 3GTLJ 1O7FA 5ILUA 1UELB 1XGOA 3IL2A 1EA3A 3OYGA 3IC7A 5IOYA 4A0XA 4KA4A 2NOGA 2TRTA 2GA1A 1Z77A 2G9WA 3DU6A 4RGXA 2Q2EA 3GFIA 1E3OC 1AU7A 2KRHA 2F48A 2HQRA 4DGWB 2EIKH 2LKPA 1KU9A 4GRIA 3U2RA 3FDYA 1U5TA 1R49A 4JP0A 4BQQA 1JKQC 1JI8A 5D1RA 4XKWA 1JT0A 1WJEA 3BOQA 3TP3A 3GF2A 1TP4A 4XOTA 1G3WA 3GTPJ 2EZHA 1R1VA 2RV8A 1VQLI 4P55A 4P9UA 2WA0A 3GMEA 4JX5A 2Z2SB 3CP8A 3Q0UA 3HKZA 1IDYA 2MSYA 3BTJA 3IWZA 2Q2EB 4A6DA 4OINF 1MIJA 3OY9A 1TNTA 1VQOI 4I2OA 2IGOA 4QTRA 2CQKA 2W53A 4ZYGA 3ESWB 1RKTA 1U5TB 5F0FA 1S3JA 2B9SA 2ZO4A 1IGNA 1OCPA 3ON4A 1LJ9A 2R7RA 2M30A 3DKYA 3JR9A 5CLSA 3I4MJ 2XV4S 5FJ8J 1VQPI 1MBHA 1BR4A 4XRSG 3H36A 4U87A 2A68F 4KN7X 1R1TA 4KIGA 2Z3YA 3J7YJ 2O7TA 3FHZA 2HI3A 3ZQHA 4JQFA 2KRCA 5L3CA 1FMVA 2DK5A 3L2WA 5HS7A 3F1BA 2M7BA 5E3LA 4BEHB 1IO2A 2D45A 2DJIA 1VTNC 3VWBA 4IVNA 1QQIA 2HNHA 5F27A 3S3OA 4KIFA 2DDBA 4IHYA 4KUMA 3EQLF 4NC7A 5F04A 3TOBA 2X1DA 4I99C 1U2WA 3R0AA 5K58A 2HZTA 2BV6A 3AAFA 3PSFA 1X1AA 3K10A 2XC7A 1QRYA 4M72A 1W4MA 2VUMJ 1HF0A 4YELA 2XPWA 2X1EA 1RI7A 1HBXG 4NNJA 2A05A 4EM1A 2R7FA 4GYIA 4E7KA 5KCMA 1SAUA 2EFNA 2DTZA 3IKTA 1ZGWA 3MAJA 3CCEI 3BR1A 2XVCA 2WGBA 3I4NJ 1BI2A 4RB3C 3S1MJ 1BM9A 2QENA 5C4XJ 3IHUA 2P7VB 1EH8A 4E70A 5DCMA 1U8RA 3H3UA 1IZ1A 1MSFC 2BZTA 2WY7Q 1GV5A 3GTMJ 2CFXA 2EFPA 2A3SA 3ZN0A 2XAUA 3FX3A 1JT6A 2IT0A 3WHBA 3AG2H 5F6FA 4M9SA 1SD5A 3FXUA 1LUJB 3GZNB 4CGZA 4GCLA 1V5GA 3AQTA 2VC0A 4DIQA 2CW8A 2OU2A 2PMZA 1CF7B 3HPGA 5TISC 2BY1A 4AC0A 3J7AY 2FEZA 3QAHA 1HSTA 5DCMB 3ZP5A 3K7AJ 4ZZDA 2STWA 1EF4A 1ETKA 1GVDA 4GXOA 4BQOA 3CF2A 5AIQA 1A6QA 4A3FJ 2XF7A 4AIJA 2XUBA 4R1HA 2KQRA 5IY5H 2IEKA 3FISA 3LA2A 3HIMA 3OS0A 2RAEA 2QWWA 2DK8A 4LJZF 3HJEA 4NC6A 4XLFA 5LRRA 4BKXA 4CYCA 3JRCA 2FBIA 2V1NA 4DJAA 4YG2F 1YHQI 4BXFA 3I0TA 1NK2P 3BG3A 3ELKA 4JL3A 2DA6A 3ZRGA 3NWTA 2CS3A 5HDGA 3PJRA 2M3AA 3DPUA 4BE2A 2MBFA 2QZ8A 2M8EA 1TW3A 4ZYHA 3V7SA 3CMMA 1FZPB 4A3DJ 3CCVI 2ETHA 2VI6A 3BR5A 4XRMA 3K6GA 4DZPA 3SDGA 3S15J 4U7BA 1K79A 2JA5J 1E3HA 1Z67A 3OYAA 3VSLA 2EFWA 4BYYA 1WJFA 3M07A 4G6TB 1XCBA 1QZYA 2VJIA 1B9NA 4R8HA 5CYVA 2FXAA 3FMQA 3NXCA 3BQZA 3IUOA 2HVSA 5CW8A 1V5EA 2OBPA 5LEKA 1H8AC 2QA4I 1BC8C 2DW4A 1I1GA 2HU9A 3CCRI 2X85A 4E6KG 1ENHA 3GTOJ 1JUPA 3K4JA 4FX4A 1S9HA 2A07F 4BGDA 2M0CA 1K83J 5HS8A 1ETXA 5HDNA 1T56A 2ME0A 3FK6A 3MZYA 1F1ZA 4ZC3A 2D1VA 3P9KA 3C2BA 4C3JJ 3GEUA 2HVRA 4U9NA 3FHNA 4QWQA 5J8FA 3HOZJ 3VW0A 2XKPA 1KYZA 3WGGA 2QIBA 2VE9A 2W85A 3MEXA 4NQWB 4XN0A 1TWGJ 3RZDJ 1Z91A 4MLOA 1USSA 3DCFA 3RYPA 4I0AA 3SEQA 4LOCA 2QWTA 4PZJA 2FJ1A 3H92A 4HZFA 3ERED 2XDVA 2IGNA 2LMDA 1U8BA 1PDNC 1VQKI 1FLIA 2HZDA 4WXDA 1G3SA 4LLLA 5KNLA 4L0YB 3HTHA 3W6JB 1ACIA 3VEPA 4A6EA 2UWMA 1YJWI 4OWRB 1LB2A 2XSDC 1J9IA 3ABKH 1OPCA 3ECOA 4U7DA 1XCVA 2DQRA 1MMNA 2O61A 1T0FA 2VXDA 3ASOH 2JVHA 1OR7A 2L02A 3R60A 2HDCA 2K9NA 2CUZA 4RGUA 4XSXF 3ABLH 1BC7C 1RRJA 1S7OA 1BI1A 4QSHA 3KZZA 2Y0MA 3IWFA 3SZTA 3DBHB 1B59A 2IP2A 2AQFA 5GADJ 1I6XA 5L3FA 3U1DA 1G59A 2E1MC 3DBLB 4I0BA 3F22A 3I53A 1YG2A 3BG5A 3LAJA 1FY7A 2VL8A 5HOOA 3S1QJ 3BR0A 2CU7A 4CSWA 2EV5A 3I56I 1UFMA 1IF1A 3LA7A 1ETWA 4MIMA 1Q1HA 4KMUX 4YRVA 3BTIA 4OIQF 2R5ZA 3VVYA 2CQQA 4L9JA 5E3NA 4A2UA 4U0YA 2O8XA 4FT8A 2HYFA 1BI3A 3QPLA 5J1YA 9ANTA 3F8CA 4GGGA 3H35A 3ASNH 1TTYA 2XB0X 1XDSA 4PJJA 3ERMA 4B1RA 2K7LA 2LRDA 2RQQA 4OAYA 3ZQQA 5HLGA 4IHTA 5FRMA 4O5VA 3RKWA 4C30A 3CESA 3BPVA 5DCFA 3OYKA 4Y3OA 4JOMA 2G0EA 3HBLA 4A3BJ 3S5RA 3ANGA 2H27A 2A2FX 5CKTA 3HOXJ 3HIFA 5EZHA 4FASD 5LFAA 5H2FC 3VODA 1IV8A 3HSFA 4A93J 5ICCA 1H89C 2ISZA 2JRTA 4A3IJ 4C2MJ 1YRNA 1UMQA 2PZ9A 5DV5A 3WTZA 3SFZA 4EQQA 3V8JA 2L01A 5JFRA 1DDNA 1XMXA 2A61A 2VASA 1ZRFA 1YS6A 4A3MJ 1U6GA 2COBA 3BT9A 3HOVJ 2A6EF 2KIFA 5FRNA 2PBIA 3GX4X 3F21A 2FNPA 3M8FA 1OCRH 2HTJA 2L9RA 2GIVA 2BHZA 3OS1A 3LQQA 3QPHA 1WFXA 2YX7A 1RUNA 5LHGA 4BJTA 2VKEA 4IOCF 3B02A 4P1WA 1SVOA 1I27A 3GTKJ 3GFJA 4BE0A 4F3QA 4RDUA 4HF2A 3FXQA 3MMYB 4G6QA 2ZJRF 4NELA 2PMHA 1YJNI 3COAC 3M8EA 4KICA 4BHBA 3P5JA 4OD5A 3ZMDA 3WE3A 1LKXA 5L3DA 2CV0A 1NK3P 4AVPA 1S72I 1OYIA 4RMNA 2R3SA 1A6IA 2X4HA 1UJ8A 4JKZA 3FM3A 1ULYA 3H5RA 2CSOA 2Y48A 1O57A 2Z99A 1ONVA 5ILSA 1SFXA 1T95A 2IS1A 4YZEA 2ZFWA 4FETA 2PFVA 3G1OA 2VOOA 3G1MA 1JJ6C 5FGLA 2GUHA 4J00A 1I1SA 3NI7A 2UV1A 5H6QA 3W3CA 5BOXA 4PGHA 2Y0SN 3CDHA 2JMWA 2G3BA 2XGXA 2X51A 1XSVA 4ZJZA 2K27A 3WG7H 3MKLA 2X9DA 4BH9A 2B3WA 2K4BA 3OMYA 2CGPA 3RYRA 3T8TA 5IPAA 5LD2C 2ZFUA 1J2XA 4C9YA 1FSHA 3HM5A 4BU2A 2MD0A 3M8JA 2V7FA 1QO0D 2TCTA 2XROA 2V1UA 5F1RA 1T38A 2KP6A 4HKUA 2STTA 2LF7A 4HRIA 4RM3A 3FIWA 3KLNA 1DUXC 3N4MA 1ORKA 4CHUA 5CJ9A 3BR3A 3CUQC 3QQAA 1VNDA 1D3YA 3K2AA 2W57A 2K85A 4C2TA 3S17J 3QWLA 4CO8A 5M5XJ 3LSPA 2AQEA 5FHPA 1MH3A 2FU4A 3D1NI 4UB6C 3CMEI 4IRIA 3F8FA 2IGKA 2ECCA 4Y17A 2LDUA 1STZA 3FMRA 2KT0A 3PUBA 5EGOA 1LVKA 5CVRA 4HV6A 2ACJA 3HOYJ 1R5HA 3HTIA 4OIPF 1OCCH 2JA8J 5JLWA 2DG7A 1G8XA 2L7FP 3SJMA 4XN3A 1N25A 2L4AA 1PUFB 4WXCA 3CJNA 2BW3A 2X48A 3RDIA 4DBQA 1I5ZA 1ZGJA 4IJAA 2W84A 3TKYA 5DYMA 4BDZA 3DWLE 5E20A 3OS2A 2HS5A 1VI0A 5EGOB 2DMUA 2ID6A 2F07A 2MH2A 3KKCA 3OR1C 3RKYA 5HODA 2EH3A 3J81Z 1UCRA 2CJJA 3N05A 2K40A 2QKMB 1T8IA 1X1CA 4BBSJ 1LFUP 5FLXK 2BW3B 1YTYA 1A36A 1JTXA 1TQIA 3LWFA 1R36A 1J75A 3S32A 1X1DA 3M1CA 1HXDA 3REOA 3GZIA 2CQNA 2KIQA 4RB2C 4G7ZF 4MHGA 4XLPF 5J1RA 1Z3XA 1ZKGA 1FT9A 3HG9A 1ZREA 3DEUA 1Z9CA 3MQ0A 5J40A 1WJCA 1X2MA 1AHDP 2DQLA 2X6OA 2XF6A 3K1NA 2ZXHA 4LK0F 1HLVA 4XOPA 4ESFA 2QKOA 1IJWC 1I3AA 3ABMH 3JRHA 1F4KA 1LPQA 4MEXF 2V9VA 3E6BA 3ML6A 2FOKA 3OYCA 1IC8A 1FOXA 5IP9J 2R93J 2A5YB 2MH9A 1Y1VJ 3Q0WA 2EA4A 3R6SA 3WTVC 5H9TA 3BZKA 2W7NA 1LDDA 4LIUA 1FYLA 1USTA 2QSFX 1AKHA 2X1CA 4FCYA 2UZKA 1OQYA 2WAQN 3GTJJ 1JKRC 4MFEA 4D5FA 4EM2A 4A3LJ 2VQCA 4LK1F 4LG0B 2HYTA 2E1MB 5C4YA 3KEQA 3LSMA 3AG1H 4CCMA 5DS9A 2HQ5A 1IRXA 1YI2I 4E7JA 2A6HF 1BJZA 1X3UA 2YSRA 4B4CA 1IDZA 3W6KB 2IS4A 4JYKA 2AS5F 5EYRA 2NOJB 2Q8KA 1N77A 1D5YA 1O3QA 2NVXJ 2KHMA 3DFGA 4DQ2A 2VN2A 2ZMEA 2G7HA 3E5UA 1B4AA 3JRGA 4Y7NJ 1FBUA 1AKHB 2NP3A 3F6OA 1MGTA 3CCQI 3QPTA 1ERDA 5EEHA 2K9QA 1SEUA 1YQAA 3QU3A 2E5ZA 2ZJ2A 3Q9VA 3NARA 2QVOA 2EZIA 5IT9Z 1KZHA 3BG6A 4ME9A 4PJMA 1R5ID 4XLHA 2ZMEB 2PQ8A 2DDAA 1SC7A 4Q48A 1XMKA 1PP8F 1IN7A 1EKEA 2Y9ZA 1JUMA 3EYIA 3BNIA 4MXMA 2MYSA 3G7RA 1V55H 2VE8A 4IHVA 2D2WA 1MSEC 3ZQFA 1TT5B 3DF8A 4NUBA 2Y31A 1IN8A 4AYBA 4E7HA 4PXIA 1NHAA 3F23A 1R9TJ 3RCOA 2OV7A 1RKWA 5CVUA 2MC4A 2XAJA 4UHTA 5M5WJ 5FLVA 1SMTA 2UXNA 3PASA 5FO5A 1WJDA 2O8KA 2UXUA 1ON1A 5TGTA 1I50J 3DLAA 5KHDA 2DTRA 3QBMA 1IRGA 4G7HF 4MQVA 1IV6A 2NYXA 2QSHX 2K9MA 4RLQA 2LP0A 3VFZA 3CMYA 3VIBA 4M6VA 4YEJA 3WE2A 2ZY9A 3GYHX 2E2IJ 4AF5A 2KIUA 4PGGA 3EUPA 2E19A 5EFYA 4E7IA 3PPBA 2VPRA 2VT3A 2FNAA 4IEJA 3C7JA 3E0JB 2DA7A 1Y8QB 4B48A 1G3YA 2ZKZA 4RBOA 3BJAA 1KGSA 3M1EA 5D4RA 2L3DA 2LH9A 4I02A 2R5YB 5FD6A 1H88C 2MG4A 1ON2A 2EBIA 3PQKA 3AG4H 1H9TA 3JTHA 4PUSA 4OMZA 1JGGA 4CCOA 3ZMZA 3HHHA 1PJRA 1XSXA 5DD4A 2GWRA 4V2FA 5FKKA 4YFNF 2DMNA 2DYRH 1HSJA 3PM1A 1YE9A 4F92B 3HC7A 4HQMA 2VBXA 3GWZA 1CGPA 4BEHA 2DMTA 3J7ZI 1MJ9A 1UZCA 5FB2A 1XB4A 4LITA 5FGMA 1HKTA 5EEGA 3D5RC 2LYCA 4IX7A 3OL3A 4ZTFA 3ZMTA 1VQ6I 1TQMA 4LB5A 3LSTA 2ZOZA 3Q3SA 2DA2A 4XL9A 4ENJA 2KFDA 5M5YJ 3FXRA 1Z05A 1IAWA 1MZBA 1ETYA 2ZCXA 4KNYA 3A1YA 4ZH4F 2LOOA 2EFOA 4XORA 2CH0A 1Y6IA 2E7WA 2WADA 4HNVA 3S3NA 2BGCA 2FX0A 3LQRA 1R7JA 1X4PA 4MEYF 4CZZA 3K2ZA 1IN4A 3KNWA 4W1UA 1LFBA 4I98B 1L0OC 3LSJA 2GM4A 1WI9A 4D7MA 5LGNA 1WH5A 2OAZA 4EATA 4AIKA 1VQ9I 5AQCA 4M71A 2LK2A 2DG8A 2WV0A 3HGYA 3TO7A 1S7AA 2KKOA 5HDKA 5BPIA 3CCSI 2XGEA 4UXNA 1KU3A 1T39A 2PN6A 4NBQA 4IRGA 1WQ2A 3O60A 2XAGA 1MKMA 3RPUD 4DYCA 2RREA 4A5NA 2NXNB 2UXOA 3RIRA 5FKOA 1CF7A 1BW5A 2QUFA 4ON0A 3TGNA 3ABTA 1G4DA 4HOBA 3P9IA 3NAUA 3ONQA 3LAPA 1K6OA 1DP3A 2QTQA 2P6SA 4W97A 5DAJA 3BZ6A 1TWCJ 4Q5SF 1RNLA 4YFKF 2D1HA 1X58A 1QGPA 3AFHA 3ZPLA 4BJ6C 4KT5C 3ZR8X 3DTEA 3J7AO 1R22A 4M9XA 3NEUA 3HTJA 4I7HA 2REKA 4KIBA 1WCMJ 3WTWC 2HXOA 2QKLB 3B81A 1TNSA 4IQ4A 1ZG5A 1X19A 3LSKA 3KFWX 4L5JA 1ZARA 4IO9F 2N8GA 2JPCA 2K3PA 3DV8A 3PNYA 5CQEA 3KX2A 4OMYA 3KYCB 3WTYC 4ASNA 3RZOJ 4H0EA 5L3BA 2L2OA 2VJ5A 4M9ZA 3WTSC 2J5PA 2I5UA 5E3OA 3HOTA 2R7WA 3HE0A 4IHXA 4BDYA 2HR3A 1L3LA 4N4OB 4TV7A 4HF0A 4I6ZA 2VKDA 4ZDOA 4BJ5C 1WI3A 2FQ4A 1ITYA 4ETSA 3TQNA 1D1BA 1OYYA 2ZNZA 1QA6A 3OYJA 1ZRCA 3VYRB 1BJAA 5EZGA 4JNNA 1YOVB 2XRNA 3V8LA 1FOKA 3D0SA 4ZYAA 2ZSIB 4XM3A 2ADUA 3EYYA 1W0UA 2K86A 2QEXI 2HFHA 2EIJH 5KAIC 5JHUA 3TW7A 4RM2A 5KAFC 2NP5A 4PK4A 2M4GA 5JHFA 2FBQA 1TWAJ 3CC7I 1PYVA 4ZYDA 2KZGA 4F91B 2COMA 3LSGA 1W5CC 1ZK8A 2M87A 3DTKA 4I09A 2ZJQF 2P5LC 3QYEA 3HYIA 1FWZA 2PBXA 1XX5A 4NQWA 5C4JJ 3KE2A 3J80Z 2R7TA 1YX3A 5ICGA 3S14J 2VBWA 2LY9A 5A2QK 1GV2A 2EINH 1FBSA 4U88A 4N9HA 3WU1B 1XGNA 3CCLI 4BXXJ 5LHHA 2FD5A 5FFZA 4YIFA 3MZHA 1WGXA 3QRFF 4EM0B 3FXMA 3R0JA 2CW7A 3Q0VA 3EETA 2ZC2A 4D1QA 2WB1N 1C0WA 2M34A 2DJNA 3HL2A 1AOYA 3QODA 1VQ5I 1DP7P 4C3IJ 3K4BA 1XPXA 3JAMK 3PFIA 2RC4A 2DFEA 3KYDB 1ZG3A 3BHQA 2LG4A 2VLAA 2ISYA 2YPRA 2Z5UA 1RC9A 4CUGA 2L4MA 4E4HA 5IOZA 4MTEA 3JSPA 1SFEA 4WCGA 1SGMA 1J0RA 3GEZA 4A3EJ 1POGA 5F0HA 3RKQA 1FMWA 5LHIA 4GO1A 4M3GA 1MDMA 1MMGA 3CMAI 2LLKA 2VONA 3H3VK 4E7SA 3O6BB 2QQBA 1RIOH 4D0PA 3VP5A 2YR2A 3DTIA 3EUHC 3E7LA 3BG9A 2MA3A 1R5GA 3GCMA 3PQJA 3SYTA 2HKOA 4RAZA 4ESBA 4ENNA 3LHQA 2VPLA 2HOSA 1NTCA 1HW5A 2E35A 2NX4A 4HW0A 5CQGA 2QM3A 3RI4A 3K1PA 3FRQA 1TW2A 1MDMB 3K4MA 3IUVA 3LL7A 1D0ZA 5K7FA 1EJ9A 5JVTA 3Q5FA 4FTHA 3EPZA 2CMPA 4HQEA 2ZSHB 3Q9SA 3HOWJ 1TWFJ 2OUMA 5F08A 4GCKA 3GO5A 3U21A 4ZDLA 2HXIA 4C3HJ 3OYLA 2HOTA 5CVIA 2PI0A 2LC2A 1DU0A 4LLNA 2DAOA 2FUG2 2LSOA 4JX4A 4AVZA 2Y75A 2KL4A 2W4SA 2O0YA 1S5LC 4RAYA 4XIDA 3K0LA 4AC6A 5CVVA 2LY1A 1XD7A 2Q0OA 1RESA 1M1EB 1FJLA 1ETQA 2GXBA 1VQ7I 4Y13A 2L7KA 2EJRA 1HCRA 4NN1A 2FRHA 4K2EA 1IUYA 4KITB 2H6CA 2FMYA 2W25A 2JZYA 5DUKA 5GP9A 3ZQIA 2NVQJ 3RD3A 5FMPA 3V78A 2NAZA 4DNCA 4AU7A 1YIOA 4A3GJ 3NNRA 3SEZA 2GZWA 2CV1A 3C18A 2JA2A 4HX4A 1F9NA 3DBRB 5BNGA 3TP0A 1D1CA 3WODF 2R7VA 3E7QA 2P5VA 2Z1DA 2LD5A 1FYMA 2IU5A 4JX6A 2KRFA 1J5YA 2H8RA 3FXJA 4PJLA 3CTAA 4BL0B 1P9QC 3KLOA 4MGRA 4XRFA 5TJJA 3RQIA 2O5RA 1BR1A 1XGMA 1UG0A 2GOMA 3RPUA 2QCOA 4IHSA 1FP1D 2P4WA 5D8KB 3G71I 1JHHA 3AL0C 4Y4RA 4JK1X 2KLOA 4CYDA 4CICA 2X6WA 4I76A 2XAHA 4BXUA 2OF7A 5IYCJ 4XLEA 4EJOA 3MKYB 3A2KA 2UXXA 2QLZA 1QZEA 4UVCA 5K5RA 3LSRA 3BLYA 1KQ0A 4LG3A 2ECBA 3F8NA 4Z2YA 4IOAF 4ICHA 4HEA2 2DI3A 2Z33A 3T1BA 5B1BH 2EQRA 4G6DA 3G6EI 4RLFA 1KA8A 2NVYJ 1ZR2A 1QHGA 2MW8A 3CJQB 3LJLA 2OZUA 2OJED 1JKOC 2L9NA 1W7PB 4IKFA 3CLOA 3H3ZA 2EB7A 4A0YA 2IVMA 1LQ1A 2R0QC 1UAAA 2P0WA 2E1OA 1E2XA 3S1RJ 3W2VA 2D5VA 2CWEA 5C44J 4WX9A 2FMLA 2HQAA 2JQ7A 3J81K 2GXGA 5GPAA 2XAQA 3BROA 2BVLA 2LF8A 2AHQA 1ZQ3P 1B72B 1TC3C 2FOWA 4AIHA 3GVAA 3ZMSA 4A3CJ 3FXLA 2VJ4A 5AONA 2E7XA 3KP5A 5D6EA 4B3XA 1F43A 3NRGA 5F0CA 4XKBA 3I64A 3VSKA 4EGZA 2K02A 4KT6A 3KZYA 5E1XA 3SXYA 2OCCH 3RQ4A 4Y33A 2XRLA 4A3KJ 4UVBA 3HEFA 2P6TA 5FD5A 2HKUA 4L9VA 1QPIA 4UV8A 1WSUA 2Y2ZA 1PVEA 2F6CA 3MVPA 1U5TC 2GBYA 3WU0A 3ZN1A 4KDPA 3G56A 4ZYEA 2JT1A 1BIAA 3C2HA 1LNWA 2A5WA 2X6XA 3DXJF 2UUZA 4M3FA 4CCKA 3W2WA 4E7ZA 3CCUI 3TEDA 2E60A 4BQNA 3WGIA 2Z9OA 4EV0A 3OV8A 1NH3A 4D9JA 2H1KA 2XKOA 2VODA 1ZRDA 1PUEE 3QKXA 5DTDA 2DODA 3BJOA 3CCMI 2DYSH 3I3LA 3GZ5A 3S93A 2YVEA 2HGCA 3DPJA 1A31A 4HBLA 1O3TA 1BOAA 3RSNA 4EGYA 2RVCA 3ZQCA 3E3VA 3HRSA 3JSOA 1ZH5A 2DT7B 3LNQA 1K6YA 1K78A 3LWJA 5E8IA 1PUFA 3CC2I 5KVRA 3K70C 5J4VA 1OCTC 2M2EA 1ZGAA 5HS9A 4BY1J 2XASA 3PFYA 2VQLA 5ILVA 2W00A 3GUDA 1A35A 2UXHA 3PSIA 3ZCOA 1FC3A 3SQNA 4DZJA 2VB6A 1TWHJ 2V26A 4HX7A 3TMOA 4ZDPA 1XDUA 5B3SH 4L18B 2VQHA 3K70D 3PIPF 2F4OB 2PFBA 4IF4A 3LMMA 5LRSA 3T6NA 2F5CA 3BC8A 2O9LA 2YUSA 5EG0A 1K78B 5J8CA 3SWHA 2E71A 3BJBA 4G7OF 4I01A 5F64A 5HVQC 4BS9A 1O7LA 2M0MA 4KYWA 3COLA 2Y0SA 1AA7A 5HBUA 1HKSA 3VTIA 1RR7A 3B73A 3JW4A 1MD0A 2WC2A 3IAM2 5LEJA 4A5MA 3MFKA 1HOMA 2CUFA 3OYEA 1ZN2A 4BNCA 4IRVA 3QOEA 4M3DA 3E97A 2L5QA 5EG0B 2DU9A 5ICEA 2O3FA 4CCLA 1ZG1A 4S0HB 1WHUA 4HLXA 2LKSA 3BP8A 1WVRA 4Y15A 3AKZA 3BCBA 3HRUA 1APLC 4IRHA 2MGQA 1FNNA 1BL0A 2R92J 3EUKL 3OSFA 1ZYRF 3ROUA 4X0GA 4ACIA 1Y56A 4PFPA 2MLKA 4LG0A 1K4SA 3OYFA 1XTAA 3DKXA 2MLGA 3VB2A 2RNGA 3HOSA 2I8DA 2OC6A 3V4GA 4RAGA 5J3LA 2KJBA 4PJNA 1OCOH 2XIGA 1DGWY 2OCEA 2V9PA 1BN5A 3GLLA 4U9LA 1X4OA 4UUTA 1T33A 3MKZA 4IHWA 4HF1A 3IAS2 3S1NJ 3VYUB 4GCVA 3FKIJ 1MBGA 1LEBA 1JHFA 1JGSA 2LNBA 1FBQA 4MO7A 3UR3C 4N4NB 1W1WE 2DCEA 5FKMA 2DOAA 2ELHA 3U1KA 2FSWA 4B09A 1SFUA 2CFOA 1TQPA 2WTEA 4RB1A 4KISA 4KJZA 2O7OA 4QPOA 5H6RA 5D6FA 5D5VB 2HVQA 2GLOA 2IA1A 1TL8A 1MJBA 2M5WA 3WTXC 2DBBA 4HNUA 3TO6A 1IXSB 2L54A 3KP2A 2V9KA 1JUSA 1R23A 3F9KA 3S8PA 4MQ9F 2E5NA 2RNJA 2DFIA 4L9TA 2IW5A 1W5TA 3VW2A 3EGQA 4FE4A 4A3JJ 3IV5A 3GFMA 3W2AA 1GUUA 4GYGA 3O8GA 2WWYA 2K9SA 3KCCA 3G3ZA 4UVAA 5L3EA 1B9MA 4II3A 2XPUA 5E1ZB 3QOPA 2VC1A 2MC3A 2ZCMA 2RASA 2WUIA 2MABA 1O4XA 2Y9YA 1YIJI 1N78A 2BY0A 4CDGA 3HKZN 3K4NA 4BAYA 5J1UA 5IP7J 3R61A 3OYHA 4GCTA 4UB8C 3C2GA 3U9GA 2PMUA 2BHYA 4LB6B 2QQ8A 1JXSA 3PUFA 1MNMC 2LR8A 1BIBA 4HA8A 3I55I 3CJRB 2BBYA 2WAQA 3F72A 3VW1A 3GTGJ 1GXPA 3MNLA 3KKDA 5B66C 2P81A 1UB9A 3X2QH 1R1UA 1O3SA 4EVIA 5D18A 1XSDA 1O3RA 1XMAA 5DM7F 3AL0B 2R5YA 4KMFA 4WK8F 4AIDA 3CQZJ 3CRJA 1W36C 4HX8A 2AXTC 2WBMA 4XLNF 2JN6A 4LFUA 2DPDA 3KEYA 3TDZC 5IYBJ 3F8MA 5FLXZ 2BVMA 4HNTA 4AWXB 1W36D 1KU7A 2I10A 4F93B 1T0FC 2OTJI 1B8IA 1OR7C 3F8BA 1IXCA 3E6CC 2V1DA 3JSJA 2M4KA 4QLCU 1T08B 5K7ZA 2HYJA 1RETA 1YX5A 1E17A 1SFOJ 3GZ6A 3H0DA 2JA6J 4UV9A 3RH2A 1VZ0A 2G7UA 5FKLA 3MKWB 1N75A 3HUGA 1X1PA 4OOIA 3M4OJ 5CXIA 3DKWA 1B8IB 3MCZA 5HLIA 1MMDA 2LFBA 2F5FA 3NRVA 1HKQA 1D8KA 1UHSA 4HDUA 1V54H 5FFXA 5FKNA 2EWNA 1OKRA 2WAFA 2ZXJA 3LOCA 3H1CA 2VQGA 3RPQA 2VOPA 3A4CA 4A0ZA 2V57A 2M45A 3M9AA 1EH6A 3CUQA 1HDDC 2QQ9A 3HUGB 1F36A 2LBFA 4D5CA 4OIRF 5K5OA 2NNYA 4EJTA 3I9V2 3WGHA 4WWCA 2JJ7A 2CG4A 1YFHA 1FTZA 3LFKA 1LDKB 2M1BA 2XGCA 1WKMA 1J7KA 1XG1A 1G6NA 3DU5A 2G7GA 4BHCA 1NG6A 3ANPA 3J80K 2IAIA 2PMZN 1ETOA 2FBHA 4F7ZA 3L09A 1YRNB 4B43A 5E18F 3BCGA 1GHCA 2OZ6A 2VJJA 3CUQB 1F5TA 1Z6RA 1P4XA 1Z6TA 2ZCWA 2LBFB 3OYDA 4LGWA 1FIPA 1TT0A 4DYQA 4WXHA 3L2VA 2JA7J 2FF4A 2LY2A 4NB5A 3CCYA 3MN2A 3BQYA 2DN0A 4NC8A 2DFHA 1PP7U 1W7PD 2L7MP 4YIIA 3FF5A 1U0JA 1KQ8A 2JWTA 1A5JA 3KZIC 3ULQB 3GBGA 2RN7A 3ZQ7A 4Z6YA 3C3WA 5DEQA 2LREA 2ZCNA 1WJAA 4HSRA 4XK4A 1Y0NA 3VPRA 3TO9A 3K4LA 5E1WA 3V8KA 1REPC 5E3MA 1EH7A 3BJ6A 1BOBA 2HWVA 2K3FA 4Y52J 3VOXA 3JRIA 1V3FA 3ZGKA 3S2HJ 4ENKA 3VDXA 3GFLA 2GXAA 3V6GA 1QBJA 2HQNA 1D5VA 2E36A 2GA2A 2JUGA 4ITVA 4L5IA 4WF2A 2HEOA 5JVGF 2NVTJ 1HDPA 5ICFA 3KYLA 1SANA 1J59A 3IH3A 4M6XA 3L1PA 4II2A 2EA2A 3DLLF 2LVSA 2E2JJ 2KZVA 3FM5A 1D8JA 2HPIA 2QGUA 2D6YA 3OWTA 3NS4A 1MJAA 1QZZA 3LSHA 4QIWN 5K7HA 1X3ZB 1SD6A 1ZR4A 1GLNA 1D0XA 5AIPA 2O03A 3TW6A 2XGDA 4BY7J 1E0EA 3ZQGA 2H94A 2WV1A 4FHTA 4HSTA 2H09A 4RA2A 3CWRA 4D7NA 3GLXA 1U9NA 5HSZA 1IN5A 5C3EJ 3OYNA 1IUFA 3MZ8A 1BA5A 4YIRX 2ZBKA 4BQAA 1WPKA 1YS7A 4EMSA 4P96A 3K4KA 3W6VA 2W1OA 1LDJA 1J09A 1FP2A 5M3FJ 5GTIC 1MBJA 1T6SA 3CO7C 2H8WA 1Y1WJ 4FQGA 4LMYA 4S05A 3OYIA 5D19A 1UI6A 1OMIA 2AO9A 2V1XA 2R7UA 1JTYA 4XLAA 4YFXF 2O6GE 1U78A 2B7EA 4BACA 5JI6A 4AD9A 3WTUC 3QP6A 5D5XB 3RKXA 1ZTRA 3OL4A 4M3EA 1FPQA 4RB0A 2ELKA 1KU2A 1ZLJA 3I5UA 5HNHA 2DFFA 4DVYP 3OYMA 3BCAA 3HZJA 3ZOBA 3OYBA 2KMUA 5K1YA 4EEFG 1D0YA 4CYCB 2GOXB 2HOAA 3TL4X 2NS7A 4XSZF 3FXOA 4FE7A 2B63J 2R7QA 4GFLA 2W82A 3HSEA 5LBQA 3PIOF 2XDNA 3DEEA 1R4MB 2OA4A 2NRAC 3EDPA 5E8GA 3ZQLA 2H6BA 2RDPA 3C1DA 4ZZLA 1MBFA 4AM3A 2A69F 5DM6F 3K1MA 3TBIA 3FMSA 3T8RA 1KQ9A 2BXYA 3WHCA 3A01A 2ZXIA 1R71A 4V19K 2CQ7A 1I3QJ 2CV2A 3BY6A 3A03A 2DOEA 2R7OA 3IP4B 3BG7A 3IH2A 2DA3A 3LFUA 3VOKA 3QP5A 2F4IA 2R7DA 2HTSA 3L2QA 5JLXA 3NWSA 2X6YA 3PNTA 5JR3A 3CO6C 5J47A 1XC5A 4HV5A 1OJLA 2IPQX 1MNEA 4LD5A 1P4WA 1FSEA 5HAWA 3K4CA 3HDDA 4GFBA 4GFKA 4P9FA 4M74A 1JE8A 3SFIA 5D8LB 1K7AA 3CD6I 2DPUA 3A01B 3H9QA 4DOZA 2PJPA 1LE8A 1HC8A 3DP7A 3H5NA 2EPFA 1DQUA 1RZ4A 1QHHD 4PJ0C 2RQPA 2X0LA 3S16J 1Z7LA 1V5FA 4XONA 3CC4I 1SD4A 1TBXA 2V6CA 2WAEA 1WJ5A 2EFQA 4MFDA 4J19A 3V7CA 3ZMUA 3DPLC 5TRDA 2OQRA 4B47A 1MNDA 2NNNA 2LTPA 3WU2C 2VKHA 3SHFA 4EJUA 2C6YA 4OU0A 3IRRA 1T2KA 1NG7A 3I4PA 1G2HA 3LSIA 1SAXA 1LE8B 5EJCA 2GQQA 3GXOA 2QSGX 2B1EA 2GIZA 2H1LA 3A0HC 3ZXSA 3PO2J 2R7XA 2R4GA 3H0GJ 2IRFG 1BBYA 3JRBA 2KDZA 2EIMH 2KPMA 5BMZA 2WB1A 2EZKA 1Z21A 2QF7A 2XPVA 4MTDA 2ESNA 4R79A 2DXIA 2BXZA 3BTCA 2K4JA 1YYVA 4PDKA 3JREA 4L0ZB 3P9TA 4GDFA 1GXQA 4NHJA 2L7ZA 4HLYA 2KIMA 2YX4A 4IPAA 3MWMA 2G7SA 1ZHFA 2IGMA 2OQGA 3I58A 5GTHC 3ABUA 3BTLA 3KIOA 2XAFA 1QNTA 4OAZA 4A69C 3VUQA 4C2MA 5CXGA 3B6AA 4P5OA 3DPTA 1CQTA 1S7EA 2ME6A 4U0VA 2W48A 2CUJA 2ZNYA 3KETA 1P7IA 2L0KA 1OYWA 1AWCA 4RAFA 2GFNA 2EV6A 4M73A 4XBFA 2L9SA 1FEXA 1WJBA 3JRAA 1VQ8I 4F52A 3JTGA 1IRZA 4HAMA 5GAEJ 3D5SC 4UY8I 1DPUA 5IP6A 2ZB9A 3L7WA 2P8TA 3FWEA 3PL8A 4Q47A 3OOPA 2R5ZB 1YITI 4MK6A 2ZMEC 1Y8RB 2KJCA 3HTUA 4BE1A 3UKGA 2VKVA 2JK3A 3T5XA 1I6HJ 5A2QZ 3KEOA 1MMSA 1V4RA 2P7CB 1ZLKA 2EZLA 3HOUJ 2VT2A 2DA5A 2LKXA 3H9JA 1W7PA 4CH7A 2OTLI 1OFCX 1MMAA 2HYGD 3KP4A 4PSWA 2R7ZJ 1WH7A 4BUPA 2ZJPF 1VQMI 1HQCA 3CJTB 2EV0A 4G12A 2QOPA 3CF5F 4XKVA 2DO7A 3L2UA 2BY2A 4QPQA 2Y69H 4O3MA 2EILH 1WRJA 2UXPA 1SVMA 3E6DA 5H20A 2K9LA 1FX7A 3HPHA 2HDDA 2ID3A 1B72A 2CQXA 5HNFA 3BR2A 2KISA 2IA0A 3IRQA 5DDGA 4B8XA 1Z3YA 4CZCA 5D5UB 3JAMZ 4DYRA 3FK7A 3VYSB 2E34A 2J5OA 3IKVA 3BZCA 1T98A 1Z0XA 1OCZH 2JSCA 3FKJA 3JRFA 1DPRA 2CW0F 3G4SI 3C07A 2JRMA 1X2NA 2FJI1 4M3BA 4FISA 3VYTB 1X1BA 3AG3H 5GAGJ 2E1NA 1FYKA 5B5EC 2L9VA 3L00A 1SD7A 4IL6C 1DGRM 4U0WA 1P6RA 2DMPA 2FBKA 4HPQA 5DD8A 3GTQJ 1Y0UA 4EJVA 4C2UA 1Z1DA 3PO3J 4XRSA 2RKHA 4OD4A 2VBYA 2V6EA 2BYVE 5FLMJ 1E3PA 3AQSA 3HSRA 3ON2A 3CDIA 4UUVA 1R6RA 1U9OA 1FTTA 2WY8Q 3G2BA 4L62A 2OERA 4HYEA 1RPWA 4XKCA 3WTTC 1WWXA 2CYYA 4BHPA 2JTVA 1KYWA 3TDUC 2DLLA 2PEXA 3QPSA 4B44A 3QYBA 2JUCA 4LLGF 2HKXA 4CXFA 3DQVC 3I71A 5FROA 3SZPA 1U3EM 2PJRA 2ELJA 4XNFA 5LGTA 4RGSA 3OOUA 3O2PE 1W5SA 2F5DA 4IXAA 1MBKA 1Z7UA 1LVAA 2IJLA 3OR2C 4M6YA 3BR6A 3F0CA 5IT3A 1Q1VA 2G7LA 4KN4X 1D1AA 4L5EA 3E5QA 3P7NA 5GAHJ 1GT0C 1XN7A 3K69A 2QBYA 1S6LA 2IXSA 4Q4ZF 2OI8A 2DA1A 3G1LA 3GW2A 3M3YJ 3EUAA 4LIVA 1GVJA 3HRTA 1IW7F 2BE5F 1LFPA 3QYFA 3DEWA 4XLCA 1OISA 1LEAA 1MW7A 3FBIB 2PJRB 2IS2A 4IQJA 2RGVA 1XS9A 5E17F 5GPCA 3HRMA 3RTRA 3I54A 3VOEA 4PCQA 1K61A 3BWGA 4NDLA 1GDTA 4E7LA 1MH4A 4RGRA 3MD2A 3V7RA 2B0LA 1VFCA 2M7AA 2QBYB 1TZLA 1YW8A 4V2GA 5IT9K 3BRUA 4RS8A 4ESJA 4UDSA 2ICWG 2M8GX 3PNVA 1VQ4I 3UNGC 3R4KA 5HLTA 3JCUC 3O3KA 1ODDA 4F55A 2E1CA 2DT5A 2DOFA 1FOWA 1SMYF 3FXKA 4KFCA 5EF6A 1EV7A 1YLFA 1HW2A 1S29A 4G94A 3S3MA 2JSPA 4X6AJ 2VXZA 4G8XA 6PAXA 3S2DJ 3K8PC 3L2CA 1QPMA 3IH4A 2RHAA 2Y30A 5F1JA 1B1BA 3OIQA 3KPHA 3N97A 5BPDA 2YU9J 2ESHA 2QQAA 1IRFA 3HGGA 4DW6A 1UG2A 3CJDA 3B6CA 3P9CA 3RJPA 1IN6A 1YO5C 1IG7A 3KP6A 3ISPA 4XQFA 4N0BA 1K4TA 4WIBA 2V4JC 1BR2A 4S04A 4A12A 1W0TA 2F4MB 4UUSA 2MFZA 5LGUA 3S2WA 3D5LA 3SDBA 4N9IA 3EUHA 3WG9A 3HTSB 2OD5A 3A0BC 3VVZA 3E1SA 2YU3A 2YS9A 4PSXA 1HA8A 2CO5A 1Y39A 1SVLA 4CA0A 1ZELA 2BOLA 5EEAA 3E6MA 3F6VA 3HXLA 1VQNI 2XF5A 1B6AA 1ETVA 5LLQA 2W24A 3L2RA 3E5XA 4UNOA 3CUOA 4B3AA 5L3GA 3T0YA 2JVGA 3ECHA 3OIPA 3FZVA 2ZOYA 5KK1A 4XR6A 3KP3A 3V42A 3ZMVA 1VF9A 4IZZA 1KONA 3CCJI 3OSGA 4UUSB 5J6XA 2PX9A 2V79A 3M7GA 2M9HA 2JPBA 2IS6A 1H9GA 2GAUA 3H9GA 2BEOA 1TLHB 2NVUB 4AUXA 1UHMA 1OLTA 2BY3A 4JBAA 4OIOF 5IYDJ 3K9TA 5HLHA 3O8HA 3A02A 2HOEA 1FOYA
chains in the Genus database with same CATH topology
2DJNA 2DMQA 2GENA 1FTZA 2XGCA 4C3IJ 3CDLA 2UXIA 1JKPC 1XG1A 1UI5A 1NK3P 2CUEA 2G7GA 1FIAA 1QVTA 3VVXA 3ANPA 4AYBN 1A6IA 2IAIA 3BHQA 2PMZN 1ETOA 1JJ8C 4JKZA 5IOZA 1SGMA 3BCGA 4A3EJ 1POGA 5F0HA 3RKQA 3JRDA 2IBDA 2NS8A 2YVHA 2DA4A 4M3GA 1DU6A 4ABZA 2XB5A 4YZEA 4DYQA 1FIPA 2JA7J 2LLKA 3G1OA 3H3VK 2Q24A 3G1MA 1JJ6C 5FGLA 2GUHA 3CCYA 3MN2A 3BQYA 1BW6A 3VP5A 2DN0A 3NI7A 4X1EA 2L7MP 2Y0SN 3BG9A 2JWTA 3E7LA 1A5JA 3KZ9A 1QVUA 3LHQA 2JMWA 4XICA 2G3BA 3GBGA 2HOSA 1NTCA 2NX4A 3MKLA 2X9DA 2ZCNA 4XK4A 3VPRA 5IPAA 3FRQA 3IUVA 5E3MA 3HM5A 5K7FA 4Y52J 3VOXA 3JRIA 4FTHA 1MBEA 3S2HJ 4CGRA 3HOWJ 1TWFJ 2TCTA 5F08A 3NPIA 4HKUA 4GCKA 3FIWA 3V6GA 2HXIA 4C3HJ 4KWAA 3OIOA 2HOTA 1ORKA 3BR3A 1DU0A 3QQAA 4JX4A 1VNDA 2NVTJ 1HDPA 3K2AA 3HB9A 3S17J 1SANA 5M5XJ 3IH3A 4XIDA 3L1PA 3LSPA 2E2HJ 2LVSA 1MH3A 2E2JJ 5FHPA 4AC6A 3D1NI 2D6YA 2ECCA 3HTAA 5EDNA 1RESA 1FJLA 4QIWN 5K7HA 1ETQA 2CRGA 2KT0A 1ZR4A 5EGOA 2OPTA 1HCRA 1P7JA 3TW6A 4NN1A 3HOYJ 2XGDA 3HTIA 4BY7J 4BBRJ 5M3MJ 2JA8J 5JLWA 3ZQGA 3GTLJ 2DG7A 2WV1A 5GP9A 3ZQIA 2NVQJ 3RD3A 2L7FP 3CWRA 3V78A 5FMPA 4D7NA 3SJMA 1U9NA 5HSZA 5IOYA 2NOGA 5C3EJ 4A3GJ 2TRTA 3NNRA 1Z77A 1IUFA 1PUFB 1E3OC 1BA5A 1WPKA 5BNGA 1AU7A 2X48A 3TP0A 3E7QA 3W6VA 2LD5A 2IU5A 4JX6A 2H8RA 1VI0A 5M3FJ 5EGOB 4JP0A 1JKQC 2DMUA 2ID6A 2F07A 1JT0A 1MBJA 5D1RA 3RQIA 3KKCA 3TP3A 1Y1WJ 5D19A 2QCOA 1UI6A 2AO9A 3GTPJ 1JTYA 5HODA 2EZHA 2EH3A 1U78A 2CJJA 4JX5A 2K40A 3Q0UA 1IDYA 1ZTRA 2MSYA 3BTJA 4M3EA 4I76A 2ELKA 4BBSJ 1LFUP 2OF7A 5IYCJ 3ZOBA 1JTXA 4EEFG 4QTRA 4CYCB 2B63J 2HOAA 2W53A 2NS7A 4FE7A 3GZIA 3LSRA 1RKTA 5F0FA 2ECBA 4GFLA 2XDNA 1IGNA 1OCPA 3ON4A 4ICHA 5J1RA 1ZKGA 2EQRA 1ZR2A 2NVYJ 3JR9A 2MW8A 1X2MA 3ZQLA 3LJLA 1AHDP 2X6OA 1JKOC 3I4MJ 5FJ8J 1HLVA 2QKOA 2R0QC 1IJWC 1MBHA 2E1OA 1MBFA 3JRHA 3S1RJ 2D5VA 4XRSG 1IC8A 5C44J 5IP9J 2R93J 3WHCA 3A01A 1Y1VJ 5GPAA 1I3QJ 3Q0WA 5H9TA 3A03A 2AHQA 2O7TA 2HI3A 1ZQ3P 1B72B 3IH2A 3ZQHA 1TC3C 4A3CJ 2DA3A 1AKHA 3VOKA 1F43A 4FCYA 3NRGA 1BL0A 2WAQN 5F0CA 5JLXA 3GTJJ 1JKRC 4MFEA 1XC5A 4D5FA 4A3LJ 3F1BA 1OJLA 5E3LA 2HYTA 5C4YA 2XRLA 4A3KJ 5DS9A 2HQ5A 3HEFA 5F27A 3HDDA 2HKUA 4GFBA 1QPIA 4GFKA 1BJZA 2Y2ZA 4B4CA 4IHYA 3SFIA 1IDZA 3MVPA 2GBYA 5F04A 4JYKA 3G56A 3A01B 5EYRA 1D5YA 1LE8A 2NVXJ 5K58A 4M3FA 3JRGA 1QRYA 4Y7NJ 3TEDA 1AKHB 3S16J 2VUMJ 2NP3A 1HF0A 2K9QA 2XPWA 4MFDA 4J19A 2LTPA 2DTZA 3NARA 1ZGWA 2H1KA 3BR1A 2EZIA 3I4NJ 5DTDA 2WGBA 3QKXA 1G2HA 3S1MJ 5C4XJ 2YVEA 1LE8B 3DPJA 4ME9A 3ZQCA 3PO2J 3H0GJ 3JRBA 1MSFC 2KDZA 3LNQA 2EZKA 1GV5A 2Y9ZA 1JUMA 3GTMJ 2QF7A 3LWJA 3BNIA 2XPVA 4MXMA 1JT6A 3G7RA 3WHBA 1PUFA 3BTCA 3JREA 3P9TA 4IHVA 1OCTC 1MSEC 3ZQFA 2M2EA 2L7ZA 4GCLA 2Y31A 4BY1J 3AQTA 2G7SA 4PXIA 1R9TJ 2UXHA 4AC0A 1RKWA 3BTLA 4DZJA 5FLVA 5M5WJ 1TWHJ 4A69C 3PASA 5CXGA 3VUQA 3B6AA 1CQTA 1S7EA 2ME6A 2W48A 2O8KA 2UXUA 1P7IA 2L0KA 3K7AJ 1EF4A 1ETKA 1GVDA 1I50J 2GFNA 3T6NA 2O9LA 2YUSA 5EG0A 4A3FJ 1FEXA 3QBMA 2IEKA 3JRAA 3FISA 1IV6A 1IRZA 3BJBA 3HIMA 2LP0A 2RAEA 4CYCA 3COLA 3CMYA 5IP6A 4BKXA 3VIBA 4M6VA 5HBUA 2ZB9A 3JRCA 2R5ZB 1NK2P 4MK6A 4JL3A 3BG3A 2E2IJ 4AF5A 2DA6A 1RR7A 3UKGA 2VKVA 3EUPA 2E19A 2JK3A 5EFYA 3PPBA 2VPRA 1HOMA 2CUFA 1I6HJ 4IEJA 2EZLA 3HOUJ 2DA5A 2LKXA 2DA7A 4M3DA 4A3DJ 1OFCX 4RBOA 5EG0B 2VI6A 3BR5A 4XRMA 2R7ZJ 2R5YB 1WH7A 3SDGA 4DZPA 3S15J 2QOPA 4G12A 4S0HB 1H88C 2JA5J 2MG4A 2EBIA 2UXPA 1JGGA 1APLC 2HDDA 2ID3A 1B72A 2MGQA 2R92J 2CQXA 3BR2A 3NXCA 3BQZA 4V2FA 5FKKA 5CW8A 2DMNA 3OSFA 3PM1A 4ACIA 1H8AC 2DMTA 4DYRA 1ENHA 3FK7A 3GTOJ 1JUPA 1Z0XA 3JRFA 1YRNB 3C07A 2M0CA 1X2NA 1K83J 5J3LA 3Q3SA 2DA2A 2ZOZA 4M3BA 4FISA 1ETXA 5M5YJ 1T56A 2ME0A 3FK6A 4UUTA 1T33A 4IHWA 3S1NJ 1ETYA 3GTQJ 2DMPA 2ZCXA 3C2BA 4C3JJ 3GEUA 3FKIJ 3HOZJ 1MBGA 3VW0A 4HNVA 3PO3J 4XRSA 2QIBA 2FX0A 5FLMJ 1TWGJ 3RZDJ 3AQSA 3KNWA 3ON2A 4MO7A 4W1UA 1LFBA 4MLOA 3DCFA 3LSJA 5FKMA 4LOCA 2GM4A 4D7MA 2QWTA 2FJ1A 1U9OA 1WH5A 1U8BA 1FTTA 4L62A 2OERA 1RPWA 5AQCA 2O7OA 2JJ7A 3HTHA 2LK2A 2DG8A 3QPSA 2XSDC 3HGYA 2GLOA 2XGEA 3OOUA 3O60A 2K9NA 1MBKA 4DYCA 1JUSA 2UXOA 5FKOA 1BW5A 4QSHA 3BR6A 3F0CA 2G7LA 1Q1VA 3EGQA 3VW2A 4FE4A 4A3JJ 4L5EA 3IV5A 1GUUA 3O8GA 3NAUA 1GT0C 2K9SA 2QTQA 2OI8A 2DA1A 3G1LA 4W97A 5DAJA 1TWCJ 2XPUA 3BG5A 3M3YJ 1X58A 2RASA 2WUIA 2ZCMA 3S1QJ 1O4XA 2Y9YA 3BR0A 2CU7A 3DEWA 3HKZN 3HTJA 5J1UA 1ETWA 4MIMA 5IP7J 2REKA 1WCMJ 1XS9A 5GPCA 4GCTA 2HXOA 3BTIA 3VVYA 2R5ZA 2CQQA 1MNMC 3B81A 2LR8A 4NDLA 5E3NA 1K61A 1GDTA 1MH4A 3VW1A 3QPLA 3GTGJ 5J1YA 2N8GA 3KKDA 9ANTA 3MNLA 1VFCA 2P81A 4V2GA 3BRUA 5D18A 2XB0X 3RZOJ 4UDSA 4B1RA 2M8GX 2R5YA 3CQZJ 3CRJA 3HE0A 5E3OA 4IHXA 2JN6A 5EF6A 2G0EA 3HBLA 4I6ZA 4A3BJ 3S5RA 3ANGA 5IYBJ 4X6AJ 1WI3A 2FQ4A 3HOXJ 3S2DJ 1ITYA 3IH4A 5EZHA 2RHAA 2Y30A 5F1JA 2I10A 5EZGA 2YU9J 1B8IA 4JNNA 3HGGA 4A93J 4DW6A 1UG2A 1H89C 3B6CA 3CJDA 3JSJA 4A3IJ 4C2MJ 1IG7A 1YRNA 1UMQA 2PZ9A 1W0UA 5K7ZA 2HYJA 1RETA 1W0TA 3TW7A 1SFOJ 4UUSA 4A3MJ 2COBA 2NP5A 3BT9A 2FBQA 2JA6J 1TWAJ 3HOVJ 3RH2A 3VVZA 5FKLA 2YS9A 3LSGA 1ZK8A 5CXIA 3M4OJ 2PBXA 5EEAA 5C4JJ 1B8IB 2L9RA 1ETVA 2LFBA 3S14J 5HAWA 1UHSA 4B3AA 2LY9A 5FKNA 2ZOYA 1GV2A 1VF9A 3LOCA 3OSGA 4BXXJ 4UUSB 2FD5A 2V57A 2VKEA 3GTKJ 1WGXA 2M9HA 1HDDC 3Q0VA 4RDUA 4NELA 1F36A 4AUXA 4D5CA 2WB1N 5IYDJ 3O8HA 3A02A 2M34A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DJN A;  2DMQ A;  2GEN A;  1FTZ A;  2XGC A;  4C3I J;  3CDL A;  2UXI A;  1JKP C;  1XG1 A;  1UI5 A;  1NK3 P;  2CUE A;  2G7G A;  1FIA A;  1QVT A;  3VVX A;  3ANP A;  4AYB N;  1A6I A;  2IAI A;  3BHQ A;  2PMZ N;  1ETO A;  1JJ8 C;  4JKZ A;  5IOZ A;  1SGM A;  3BCG A;  4A3E J;  1POG A;  5F0H A;  3RKQ A;  3JRD A;  2IBD A;  2NS8 A;  2YVH A;  2DA4 A;  4M3G A;  1DU6 A;  4ABZ A;  2XB5 A;  4YZE A;  4DYQ A;  1FIP A;  2JA7 J;  2LLK A;  3G1O A;  3H3V K;  2Q24 A;  3G1M A;  1JJ6 C;  5FGL A;  2GUH A;  3CCY A;  3MN2 A;  3BQY A;  1BW6 A;  3VP5 A;  2DN0 A;  3NI7 A;  4X1E A;  2L7M P;  2Y0S N;  3BG9 A;  2JWT A;  3E7L A;  1A5J A;  3KZ9 A;  1QVU A;  3LHQ A;  2JMW A;  4XIC A;  2G3B A;  3GBG A;  2HOS A;  1NTC A;  2NX4 A;  3MKL A;  2X9D A;  2ZCN A;  4XK4 A;  3VPR A;  5IPA A;  3FRQ A;  3IUV A;  5E3M A;  3HM5 A;  5K7F A;  4Y52 J;  3VOX A;  3JRI A;  4FTH A;  1MBE A;  3S2H J;  4CGR A;  3HOW J;  1TWF J;  2TCT A;  5F08 A;  3NPI A;  4HKU A;  4GCK A;  3FIW A;  3V6G A;  2HXI A;  4C3H J;  4KWA A;  3OIO A;  2HOT A;  1ORK A;  3BR3 A;  1DU0 A;  3QQA A;  4JX4 A;  1VND A;  2NVT J;  1HDP A;  3K2A A;  3HB9 A;  3S17 J;  1SAN A;  5M5X J;  3IH3 A;  4XID A;  3L1P A;  3LSP A;  2E2H J;  2LVS A;  1MH3 A;  2E2J J;  5FHP A;  4AC6 A;  3D1N I;  2D6Y A;  2ECC A;  3HTA A;  5EDN A;  1RES A;  1FJL A;  4QIW N;  5K7H A;  1ETQ A;  2CRG A;  2KT0 A;  1ZR4 A;  5EGO A;  2OPT A;  1HCR A;  1P7J A;  3TW6 A;  4NN1 A;  3HOY J;  2XGD A;  3HTI A;  4BY7 J;  4BBR J;  5M3M J;  2JA8 J;  5JLW A;  3ZQG A;  3GTL J;  2DG7 A;  2WV1 A;  5GP9 A;  3ZQI A;  2NVQ J;  3RD3 A;  2L7F P;  3CWR A;  3V78 A;  5FMP A;  4D7N A;  3SJM A;  1U9N A;  5HSZ A;  5IOY A;  2NOG A;  5C3E J;  4A3G J;  2TRT A;  3NNR A;  1Z77 A;  1IUF A;  1PUF B;  1E3O C;  1BA5 A;  1WPK A;  5BNG A;  1AU7 A;  2X48 A;  3TP0 A;  3E7Q A;  3W6V A;  2LD5 A;  2IU5 A;  4JX6 A;  2H8R A;  1VI0 A;  5M3F J;  5EGO B;  4JP0 A;  1JKQ C;  2DMU A;  2ID6 A;  2F07 A;  1JT0 A;  1MBJ A;  5D1R A;  3RQI A;  3KKC A;  3TP3 A;  1Y1W J;  5D19 A;  2QCO A;  1UI6 A;  2AO9 A;  3GTP J;  1JTY A;  5HOD A;  2EZH A;  2EH3 A;  1U78 A;  2CJJ A;  4JX5 A;  2K40 A;  3Q0U A;  1IDY A;  1ZTR A;  2MSY A;  3BTJ A;  4M3E A;  4I76 A;  2ELK A;  4BBS J;  1LFU P;  2OF7 A;  5IYC J;  3ZOB A;  1JTX A;  4EEF G;  4QTR A;  4CYC B;  2B63 J;  2HOA A;  2W53 A;  2NS7 A;  4FE7 A;  3GZI A;  3LSR A;  1RKT A;  5F0F A;  2ECB A;  4GFL A;  2XDN A;  1IGN A;  1OCP A;  3ON4 A;  4ICH A;  5J1R A;  1ZKG A;  2EQR A;  1ZR2 A;  2NVY J;  3JR9 A;  2MW8 A;  1X2M A;  3ZQL A;  3LJL A;  1AHD P;  2X6O A;  1JKO C;  3I4M J;  5FJ8 J;  1HLV A;  2QKO A;  2R0Q C;  1IJW C;  1MBH A;  2E1O A;  1MBF A;  3JRH A;  3S1R J;  2D5V A;  4XRS G;  1IC8 A;  5C44 J;  5IP9 J;  2R93 J;  3WHC A;  3A01 A;  1Y1V J;  5GPA A;  1I3Q J;  3Q0W A;  5H9T A;  3A03 A;  2AHQ A;  2O7T A;  2HI3 A;  1ZQ3 P;  1B72 B;  3IH2 A;  3ZQH A;  1TC3 C;  4A3C J;  2DA3 A;  1AKH A;  3VOK A;  1F43 A;  4FCY A;  3NRG A;  1BL0 A;  2WAQ N;  5F0C A;  5JLX A;  3GTJ J;  1JKR C;  4MFE A;  1XC5 A;  4D5F A;  4A3L J;  3F1B A;  1OJL A;  5E3L A;  2HYT A;  5C4Y A;  2XRL A;  4A3K J;  5DS9 A;  2HQ5 A;  3HEF A;  5F27 A;  3HDD A;  2HKU A;  4GFB A;  1QPI A;  4GFK A;  1BJZ A;  2Y2Z A;  4B4C A;  4IHY A;  3SFI A;  1IDZ A;  3MVP A;  2GBY A;  5F04 A;  4JYK A;  3G56 A;  3A01 B;  5EYR A;  1D5Y A;  1LE8 A;  2NVX J;  5K58 A;  4M3F A;  3JRG A;  1QRY A;  4Y7N J;  3TED A;  1AKH B;  3S16 J;  2VUM J;  2NP3 A;  1HF0 A;  2K9Q A;  2XPW A;  4MFD A;  4J19 A;  2LTP A;  2DTZ A;  3NAR A;  1ZGW A;  2H1K A;  3BR1 A;  2EZI A;  3I4N J;  5DTD A;  2WGB A;  3QKX A;  1G2H A;  3S1M J;  5C4X J;  2YVE A;  1LE8 B;  3DPJ A;  4ME9 A;  3ZQC A;  3PO2 J;  3H0G J;  3JRB A;  1MSF C;  2KDZ A;  3LNQ A;  2EZK A;  1GV5 A;  2Y9Z A;  1JUM A;  3GTM J;  2QF7 A;  3LWJ A;  3BNI A;  2XPV A;  4MXM A;  1JT6 A;  3G7R A;  3WHB A;  1PUF A;  3BTC A;  3JRE A;  3P9T A;  4IHV A;  1OCT C;  1MSE C;  3ZQF A;  2M2E A;  2L7Z A;  4GCL A;  2Y31 A;  4BY1 J;  3AQT A;  2G7S A;  4PXI A;  1R9T J;  2UXH A;  4AC0 A;  1RKW A;  3BTL A;  4DZJ A;  5FLV A;  5M5W J;  1TWH J;  4A69 C;  3PAS A;  5CXG A;  3VUQ A;  3B6A A;  1CQT A;  1S7E A;  2ME6 A;  2W48 A;  2O8K A;  2UXU A;  1P7I A;  2L0K A;  3K7A J;  1EF4 A;  1ETK A;  1GVD A;  1I50 J;  2GFN A;  3T6N A;  2O9L A;  2YUS A;  5EG0 A;  4A3F J;  1FEX A;  3QBM A;  2IEK A;  3JRA A;  3FIS A;  1IV6 A;  1IRZ A;  3BJB A;  3HIM A;  2LP0 A;  2RAE A;  4CYC A;  3COL A;  3CMY A;  5IP6 A;  4BKX A;  3VIB A;  4M6V A;  5HBU A;  2ZB9 A;  3JRC A;  2R5Z B;  1NK2 P;  4MK6 A;  4JL3 A;  3BG3 A;  2E2I J;  4AF5 A;  2DA6 A;  1RR7 A;  3UKG A;  2VKV A;  3EUP A;  2E19 A;  2JK3 A;  5EFY A;  3PPB A;  2VPR A;  1HOM A;  2CUF A;  1I6H J;  4IEJ A;  2EZL A;  3HOU J;  2DA5 A;  2LKX A;  2DA7 A;  4M3D A;  4A3D J;  1OFC X;  4RBO A;  5EG0 B;  2VI6 A;  3BR5 A;  4XRM A;  2R7Z J;  2R5Y B;  1WH7 A;  3SDG A;  4DZP A;  3S15 J;  2QOP A;  4G12 A;  4S0H B;  1H88 C;  2JA5 J;  2MG4 A;  2EBI A;  2UXP A;  1JGG A;  1APL C;  2HDD A;  2ID3 A;  1B72 A;  2MGQ A;  2R92 J;  2CQX A;  3BR2 A;  3NXC A;  3BQZ A;  4V2F A;  5FKK A;  5CW8 A;  2DMN A;  3OSF A;  3PM1 A;  4ACI A;  1H8A C;  2DMT A;  4DYR A;  1ENH A;  3FK7 A;  3GTO J;  1JUP A;  1Z0X A;  3JRF A;  1YRN B;  3C07 A;  2M0C A;  1X2N A;  1K83 J;  5J3L A;  3Q3S A;  2DA2 A;  2ZOZ A;  4M3B A;  4FIS A;  1ETX A;  5M5Y J;  1T56 A;  2ME0 A;  3FK6 A;  4UUT A;  1T33 A;  4IHW A;  3S1N J;  1ETY A;  3GTQ J;  2DMP A;  2ZCX A;  3C2B A;  4C3J J;  3GEU A;  3FKI J;  3HOZ J;  1MBG A;  3VW0 A;  4HNV A;  3PO3 J;  4XRS A;  2QIB A;  2FX0 A;  5FLM J;  1TWG J;  3RZD J;  3AQS A;  3KNW A;  3ON2 A;  4MO7 A;  4W1U A;  1LFB A;  4MLO A;  3DCF A;  3LSJ A;  5FKM A;  4LOC A;  2GM4 A;  4D7M A;  2QWT A;  2FJ1 A;  1U9O A;  1WH5 A;  1U8B A;  1FTT A;  4L62 A;  2OER A;  1RPW A;  5AQC A;  2O7O A;  2JJ7 A;  3HTH A;  2LK2 A;  2DG8 A;  3QPS A;  2XSD C;  3HGY A;  2GLO A;  2XGE A;  3OOU A;  3O60 A;  2K9N A;  1MBK A;  4DYC A;  1JUS A;  2UXO A;  5FKO A;  1BW5 A;  4QSH A;  3BR6 A;  3F0C A;  2G7L A;  1Q1V A;  3EGQ A;  3VW2 A;  4FE4 A;  4A3J J;  4L5E A;  3IV5 A;  1GUU A;  3O8G A;  3NAU A;  1GT0 C;  2K9S A;  2QTQ A;  2OI8 A;  2DA1 A;  3G1L A;  4W97 A;  5DAJ A;  1TWC J;  2XPU A;  3BG5 A;  3M3Y J;  1X58 A;  2RAS A;  2WUI A;  2ZCM A;  3S1Q J;  1O4X A;  2Y9Y A;  3BR0 A;  2CU7 A;  3DEW A;  3HKZ N;  3HTJ A;  5J1U A;  1ETW A;  4MIM A;  5IP7 J;  2REK A;  1WCM J;  1XS9 A;  5GPC A;  4GCT A;  2HXO A;  3BTI A;  3VVY A;  2R5Z A;  2CQQ A;  1MNM C;  3B81 A;  2LR8 A;  4NDL A;  5E3N A;  1K61 A;  1GDT A;  1MH4 A;  3VW1 A;  3QPL A;  3GTG J;  5J1Y A;  2N8G A;  3KKD A;  9ANT A;  3MNL A;  1VFC A;  2P81 A;  4V2G A;  3BRU A;  5D18 A;  2XB0 X;  3RZO J;  4UDS A;  4B1R A;  2M8G X;  2R5Y A;  3CQZ J;  3CRJ A;  3HE0 A;  5E3O A;  4IHX A;  2JN6 A;  5EF6 A;  2G0E A;  3HBL A;  4I6Z A;  4A3B J;  3S5R A;  3ANG A;  5IYB J;  4X6A J;  1WI3 A;  2FQ4 A;  3HOX J;  3S2D J;  1ITY A;  3IH4 A;  5EZH A;  2RHA A;  2Y30 A;  5F1J A;  2I10 A;  5EZG A;  2YU9 J;  1B8I A;  4JNN A;  3HGG A;  4A93 J;  4DW6 A;  1UG2 A;  1H89 C;  3B6C A;  3CJD A;  3JSJ A;  4A3I J;  4C2M J;  1IG7 A;  1YRN A;  1UMQ A;  2PZ9 A;  1W0U A;  5K7Z A;  2HYJ A;  1RET A;  1W0T A;  3TW7 A;  1SFO J;  4UUS A;  4A3M J;  2COB A;  2NP5 A;  3BT9 A;  2FBQ A;  2JA6 J;  1TWA J;  3HOV J;  3RH2 A;  3VVZ A;  5FKL A;  2YS9 A;  3LSG A;  1ZK8 A;  5CXI A;  3M4O J;  2PBX A;  5EEA A;  5C4J J;  1B8I B;  2L9R A;  1ETV A;  2LFB A;  3S14 J;  5HAW A;  1UHS A;  4B3A A;  2LY9 A;  5FKN A;  2ZOY A;  1GV2 A;  1VF9 A;  3LOC A;  3OSG A;  4BXX J;  4UUS B;  2FD5 A;  2V57 A;  2VKE A;  3GTK J;  1WGX A;  2M9H A;  1HDD C;  3Q0V A;  4RDU A;  4NEL A;  1F36 A;  4AUX A;  4D5C A;  2WB1 N;  5IYD J;  3O8H A;  3A02 A;  2M34 A; 
#chains in the Genus database with same CATH topology
 1A04 A;  2DMQ A;  3QU6 A;  3I59 A;  2GEN A;  2VBZ A;  4MNU A;  3CDL A;  2UXI A;  1JKP C;  1UHW A;  4O6J A;  1UI5 A;  2QYO A;  2A6T A;  2CUE A;  5D4S A;  1FIA A;  1QVT A;  2FA5 A;  3VVX A;  4AYB N;  1P2F A;  3TOA A;  2XSJ C;  1JJ8 C;  3CZ6 A;  4EJW A;  2YVH A;  3JRD A;  2IBD A;  2NS8 A;  2FE3 A;  3H5A A;  2DA4 A;  2ZXW H;  1DU6 A;  2AXL A;  5E79 C;  2PG4 A;  4ABZ A;  2XB5 A;  4ANJ A;  4ZTJ A;  5B1A H;  3BDD A;  2DT6 A;  1IXR C;  2Q24 A;  3I59 B;  1BW6 A;  2PLY A;  3F3X A;  4PFO A;  4ENM A;  2EK5 A;  3BPX A;  4X1E A;  1YW7 A;  3CP2 A;  3KZ9 A;  1HW1 A;  1WZ2 A;  1QVU A;  4XIC A;  1I39 A;  1R4N B;  5BQT A;  4J01 A;  3SZG A;  1H0M A;  3G73 A;  1RUO A;  2YVX A;  2NS0 A;  3L9F A;  5CVJ A;  5ERI A;  1R58 A;  1P4A A;  1RR8 C;  1MBE A;  1R00 A;  1YJ9 I;  2P5K A;  1P92 A;  2Q1Z B;  3HHG A;  1ZAO A;  4CGR A;  3KP7 A;  4HG2 A;  2VIX A;  1X3W B;  4FX0 A;  2R7S A;  3FBN B;  3NPI A;  5K5Q A;  2F5V A;  4HDV A;  4KWA A;  3OIO A;  4G9Y A;  3CLQ A;  3LA3 A;  1S8N A;  4H4K C;  1XGS A;  4XMY A;  1SFK A;  4L9N A;  1BI0 A;  3HB9 A;  5CPR B;  1YW9 A;  5J4Y A;  2HDW A;  1QU3 A;  2E2H J;  5DUI A;  2F2E A;  2KDO A;  5D5W B;  2TDX A;  3HTA A;  5EDN A;  4DBR A;  2MD5 A;  2Z16 A;  5BS6 A;  2XHK A;  2CRG A;  2HPM A;  3NQO A;  2OPT A;  2K5C A;  2FQ3 A;  1G3T A;  1P7J A;  2IA2 A;  4BBR J;  4CCN A;  5M3M J;  2F5E A;  5ED4 A;  4CCJ A;  3GTL J;  1O7F A;  5ILU A;  1UEL B;  1XGO A;  3IL2 A;  1EA3 A;  3OYG A;  3IC7 A;  5IOY A;  4A0X A;  4KA4 A;  2NOG A;  2TRT A;  2GA1 A;  1Z77 A;  2G9W A;  3DU6 A;  4RGX A;  2Q2E A;  3GFI A;  1E3O C;  1AU7 A;  2KRH A;  2F48 A;  2HQR A;  4DGW B;  2EIK H;  2LKP A;  1KU9 A;  4GRI A;  3U2R A;  3FDY A;  1U5T A;  1R49 A;  4JP0 A;  4BQQ A;  1JKQ C;  1JI8 A;  5D1R A;  4XKW A;  1JT0 A;  1WJE A;  3BOQ A;  3TP3 A;  3GF2 A;  1TP4 A;  4XOT A;  1G3W A;  3GTP J;  2EZH A;  1R1V A;  2RV8 A;  1VQL I;  4P55 A;  4P9U A;  2WA0 A;  3GME A;  4JX5 A;  2Z2S B;  3CP8 A;  3Q0U A;  3HKZ A;  1IDY A;  2MSY A;  3BTJ A;  3IWZ A;  2Q2E B;  4A6D A;  4OIN F;  1MIJ A;  3OY9 A;  1TNT A;  1VQO I;  4I2O A;  2IGO A;  4QTR A;  2CQK A;  2W53 A;  4ZYG A;  3ESW B;  1RKT A;  1U5T B;  5F0F A;  1S3J A;  2B9S A;  2ZO4 A;  1IGN A;  1OCP A;  3ON4 A;  1LJ9 A;  2R7R A;  2M30 A;  3DKY A;  3JR9 A;  5CLS A;  3I4M J;  2XV4 S;  5FJ8 J;  1VQP I;  1MBH A;  1BR4 A;  4XRS G;  3H36 A;  4U87 A;  2A68 F;  4KN7 X;  1R1T A;  4KIG A;  2Z3Y A;  3J7Y J;  2O7T A;  3FHZ A;  2HI3 A;  3ZQH A;  4JQF A;  2KRC A;  5L3C A;  1FMV A;  2DK5 A;  3L2W A;  5HS7 A;  3F1B A;  2M7B A;  5E3L A;  4BEH B;  1IO2 A;  2D45 A;  2DJI A;  1VTN C;  3VWB A;  4IVN A;  1QQI A;  2HNH A;  5F27 A;  3S3O A;  4KIF A;  2DDB A;  4IHY A;  4KUM A;  3EQL F;  4NC7 A;  5F04 A;  3TOB A;  2X1D A;  4I99 C;  1U2W A;  3R0A A;  5K58 A;  2HZT A;  2BV6 A;  3AAF A;  3PSF A;  1X1A A;  3K10 A;  2XC7 A;  1QRY A;  4M72 A;  1W4M A;  2VUM J;  1HF0 A;  4YEL A;  2XPW A;  2X1E A;  1RI7 A;  1HBX G;  4NNJ A;  2A05 A;  4EM1 A;  2R7F A;  4GYI A;  4E7K A;  5KCM A;  1SAU A;  2EFN A;  2DTZ A;  3IKT A;  1ZGW A;  3MAJ A;  3CCE I;  3BR1 A;  2XVC A;  2WGB A;  3I4N J;  1BI2 A;  4RB3 C;  3S1M J;  1BM9 A;  2QEN A;  5C4X J;  3IHU A;  2P7V B;  1EH8 A;  4E70 A;  5DCM A;  1U8R A;  3H3U A;  1IZ1 A;  1MSF C;  2BZT A;  2WY7 Q;  1GV5 A;  3GTM J;  2CFX A;  2EFP A;  2A3S A;  3ZN0 A;  2XAU A;  3FX3 A;  1JT6 A;  2IT0 A;  3WHB A;  3AG2 H;  5F6F A;  4M9S A;  1SD5 A;  3FXU A;  1LUJ B;  3GZN B;  4CGZ A;  4GCL A;  1V5G A;  3AQT A;  2VC0 A;  4DIQ A;  2CW8 A;  2OU2 A;  2PMZ A;  1CF7 B;  3HPG A;  5TIS C;  2BY1 A;  4AC0 A;  3J7A Y;  2FEZ A;  3QAH A;  1HST A;  5DCM B;  3ZP5 A;  3K7A J;  4ZZD A;  2STW A;  1EF4 A;  1ETK A;  1GVD A;  4GXO A;  4BQO A;  3CF2 A;  5AIQ A;  1A6Q A;  4A3F J;  2XF7 A;  4AIJ A;  2XUB A;  4R1H A;  2KQR A;  5IY5 H;  2IEK A;  3FIS A;  3LA2 A;  3HIM A;  3OS0 A;  2RAE A;  2QWW A;  2DK8 A;  4LJZ F;  3HJE A;  4NC6 A;  4XLF A;  5LRR A;  4BKX A;  4CYC A;  3JRC A;  2FBI A;  2V1N A;  4DJA A;  4YG2 F;  1YHQ I;  4BXF A;  3I0T A;  1NK2 P;  3BG3 A;  3ELK A;  4JL3 A;  2DA6 A;  3ZRG A;  3NWT A;  2CS3 A;  5HDG A;  3PJR A;  2M3A A;  3DPU A;  4BE2 A;  2MBF A;  2QZ8 A;  2M8E A;  1TW3 A;  4ZYH A;  3V7S A;  3CMM A;  1FZP B;  4A3D J;  3CCV I;  2ETH A;  2VI6 A;  3BR5 A;  4XRM A;  3K6G A;  4DZP A;  3SDG A;  3S15 J;  4U7B A;  1K79 A;  2JA5 J;  1E3H A;  1Z67 A;  3OYA A;  3VSL A;  2EFW A;  4BYY A;  1WJF A;  3M07 A;  4G6T B;  1XCB A;  1QZY A;  2VJI A;  1B9N A;  4R8H A;  5CYV A;  2FXA A;  3FMQ A;  3NXC A;  3BQZ A;  3IUO A;  2HVS A;  5CW8 A;  1V5E A;  2OBP A;  5LEK A;  1H8A C;  2QA4 I;  1BC8 C;  2DW4 A;  1I1G A;  2HU9 A;  3CCR I;  2X85 A;  4E6K G;  1ENH A;  3GTO J;  1JUP A;  3K4J A;  4FX4 A;  1S9H A;  2A07 F;  4BGD A;  2M0C A;  1K83 J;  5HS8 A;  1ETX A;  5HDN A;  1T56 A;  2ME0 A;  3FK6 A;  3MZY A;  1F1Z A;  4ZC3 A;  2D1V A;  3P9K A;  3C2B A;  4C3J J;  3GEU A;  2HVR A;  4U9N A;  3FHN A;  4QWQ A;  5J8F A;  3HOZ J;  3VW0 A;  2XKP A;  1KYZ A;  3WGG A;  2QIB A;  2VE9 A;  2W85 A;  3MEX A;  4NQW B;  4XN0 A;  1TWG J;  3RZD J;  1Z91 A;  4MLO A;  1USS A;  3DCF A;  3RYP A;  4I0A A;  3SEQ A;  4LOC A;  2QWT A;  4PZJ A;  2FJ1 A;  3H92 A;  4HZF A;  3ERE D;  2XDV A;  2IGN A;  2LMD A;  1U8B A;  1PDN C;  1VQK I;  1FLI A;  2HZD A;  4WXD A;  1G3S A;  4LLL A;  5KNL A;  4L0Y B;  3HTH A;  3W6J B;  1ACI A;  3VEP A;  4A6E A;  2UWM A;  1YJW I;  4OWR B;  1LB2 A;  2XSD C;  1J9I A;  3ABK H;  1OPC A;  3ECO A;  4U7D A;  1XCV A;  2DQR A;  1MMN A;  2O61 A;  1T0F A;  2VXD A;  3ASO H;  2JVH A;  1OR7 A;  2L02 A;  3R60 A;  2HDC A;  2K9N A;  2CUZ A;  4RGU A;  4XSX F;  3ABL H;  1BC7 C;  1RRJ A;  1S7O A;  1BI1 A;  4QSH A;  3KZZ A;  2Y0M A;  3IWF A;  3SZT A;  3DBH B;  1B59 A;  2IP2 A;  2AQF A;  5GAD J;  1I6X A;  5L3F A;  3U1D A;  1G59 A;  2E1M C;  3DBL B;  4I0B A;  3F22 A;  3I53 A;  1YG2 A;  3BG5 A;  3LAJ A;  1FY7 A;  2VL8 A;  5HOO A;  3S1Q J;  3BR0 A;  2CU7 A;  4CSW A;  2EV5 A;  3I56 I;  1UFM A;  1IF1 A;  3LA7 A;  1ETW A;  4MIM A;  1Q1H A;  4KMU X;  4YRV A;  3BTI A;  4OIQ F;  2R5Z A;  3VVY A;  2CQQ A;  4L9J A;  5E3N A;  4A2U A;  4U0Y A;  2O8X A;  4FT8 A;  2HYF A;  1BI3 A;  3QPL A;  5J1Y A;  9ANT A;  3F8C A;  4GGG A;  3H35 A;  3ASN H;  1TTY A;  2XB0 X;  1XDS A;  4PJJ A;  3ERM A;  4B1R A;  2K7L A;  2LRD A;  2RQQ A;  4OAY A;  3ZQQ A;  5HLG A;  4IHT A;  5FRM A;  4O5V A;  3RKW A;  4C30 A;  3CES A;  3BPV A;  5DCF A;  3OYK A;  4Y3O A;  4JOM A;  2G0E A;  3HBL A;  4A3B J;  3S5R A;  3ANG A;  2H27 A;  2A2F X;  5CKT A;  3HOX J;  3HIF A;  5EZH A;  4FAS D;  5LFA A;  5H2F C;  3VOD A;  1IV8 A;  3HSF A;  4A93 J;  5ICC A;  1H89 C;  2ISZ A;  2JRT A;  4A3I J;  4C2M J;  1YRN A;  1UMQ A;  2PZ9 A;  5DV5 A;  3WTZ A;  3SFZ A;  4EQQ A;  3V8J A;  2L01 A;  5JFR A;  1DDN A;  1XMX A;  2A61 A;  2VAS A;  1ZRF A;  1YS6 A;  4A3M J;  1U6G A;  2COB A;  3BT9 A;  3HOV J;  2A6E F;  2KIF A;  5FRN A;  2PBI A;  3GX4 X;  3F21 A;  2FNP A;  3M8F A;  1OCR H;  2HTJ A;  2L9R A;  2GIV A;  2BHZ A;  3OS1 A;  3LQQ A;  3QPH A;  1WFX A;  2YX7 A;  1RUN A;  5LHG A;  4BJT A;  2VKE A;  4IOC F;  3B02 A;  4P1W A;  1SVO A;  1I27 A;  3GTK J;  3GFJ A;  4BE0 A;  4F3Q A;  4RDU A;  4HF2 A;  3FXQ A;  3MMY B;  4G6Q A;  2ZJR F;  4NEL A;  2PMH A;  1YJN I;  3COA C;  3M8E A;  4KIC A;  4BHB A;  3P5J A;  4OD5 A;  3ZMD A;  3WE3 A;  1LKX A;  5L3D A;  2CV0 A;  1NK3 P;  4AVP A;  1S72 I;  1OYI A;  4RMN A;  2R3S A;  1A6I A;  2X4H A;  1UJ8 A;  4JKZ A;  3FM3 A;  1ULY A;  3H5R A;  2CSO A;  2Y48 A;  1O57 A;  2Z99 A;  1ONV A;  5ILS A;  1SFX A;  1T95 A;  2IS1 A;  4YZE A;  2ZFW A;  4FET A;  2PFV A;  3G1O A;  2VOO A;  3G1M A;  1JJ6 C;  5FGL A;  2GUH A;  4J00 A;  1I1S A;  3NI7 A;  2UV1 A;  5H6Q A;  3W3C A;  5BOX A;  4PGH A;  2Y0S N;  3CDH A;  2JMW A;  2G3B A;  2XGX A;  2X51 A;  1XSV A;  4ZJZ A;  2K27 A;  3WG7 H;  3MKL A;  2X9D A;  4BH9 A;  2B3W A;  2K4B A;  3OMY A;  2CGP A;  3RYR A;  3T8T A;  5IPA A;  5LD2 C;  2ZFU A;  1J2X A;  4C9Y A;  1FSH A;  3HM5 A;  4BU2 A;  2MD0 A;  3M8J A;  2V7F A;  1QO0 D;  2TCT A;  2XRO A;  2V1U A;  5F1R A;  1T38 A;  2KP6 A;  4HKU A;  2STT A;  2LF7 A;  4HRI A;  4RM3 A;  3FIW A;  3KLN A;  1DUX C;  3N4M A;  1ORK A;  4CHU A;  5CJ9 A;  3BR3 A;  3CUQ C;  3QQA A;  1VND A;  1D3Y A;  3K2A A;  2W57 A;  2K85 A;  4C2T A;  3S17 J;  3QWL A;  4CO8 A;  5M5X J;  3LSP A;  2AQE A;  5FHP A;  1MH3 A;  2FU4 A;  3D1N I;  4UB6 C;  3CME I;  4IRI A;  3F8F A;  2IGK A;  2ECC A;  4Y17 A;  2LDU A;  1STZ A;  3FMR A;  2KT0 A;  3PUB A;  5EGO A;  1LVK A;  5CVR A;  4HV6 A;  2ACJ A;  3HOY J;  1R5H A;  3HTI A;  4OIP F;  1OCC H;  2JA8 J;  5JLW A;  2DG7 A;  1G8X A;  2L7F P;  3SJM A;  4XN3 A;  1N25 A;  2L4A A;  1PUF B;  4WXC A;  3CJN A;  2BW3 A;  2X48 A;  3RDI A;  4DBQ A;  1I5Z A;  1ZGJ A;  4IJA A;  2W84 A;  3TKY A;  5DYM A;  4BDZ A;  3DWL E;  5E20 A;  3OS2 A;  2HS5 A;  1VI0 A;  5EGO B;  2DMU A;  2ID6 A;  2F07 A;  2MH2 A;  3KKC A;  3OR1 C;  3RKY A;  5HOD A;  2EH3 A;  3J81 Z;  1UCR A;  2CJJ A;  3N05 A;  2K40 A;  2QKM B;  1T8I A;  1X1C A;  4BBS J;  1LFU P;  5FLX K;  2BW3 B;  1YTY A;  1A36 A;  1JTX A;  1TQI A;  3LWF A;  1R36 A;  1J75 A;  3S32 A;  1X1D A;  3M1C A;  1HXD A;  3REO A;  3GZI A;  2CQN A;  2KIQ A;  4RB2 C;  4G7Z F;  4MHG A;  4XLP F;  5J1R A;  1Z3X A;  1ZKG A;  1FT9 A;  3HG9 A;  1ZRE A;  3DEU A;  1Z9C A;  3MQ0 A;  5J40 A;  1WJC A;  1X2M A;  1AHD P;  2DQL A;  2X6O A;  2XF6 A;  3K1N A;  2ZXH A;  4LK0 F;  1HLV A;  4XOP A;  4ESF A;  2QKO A;  1IJW C;  1I3A A;  3ABM H;  3JRH A;  1F4K A;  1LPQ A;  4MEX F;  2V9V A;  3E6B A;  3ML6 A;  2FOK A;  3OYC A;  1IC8 A;  1FOX A;  5IP9 J;  2R93 J;  2A5Y B;  2MH9 A;  1Y1V J;  3Q0W A;  2EA4 A;  3R6S A;  3WTV C;  5H9T A;  3BZK A;  2W7N A;  1LDD A;  4LIU A;  1FYL A;  1UST A;  2QSF X;  1AKH A;  2X1C A;  4FCY A;  2UZK A;  1OQY A;  2WAQ N;  3GTJ J;  1JKR C;  4MFE A;  4D5F A;  4EM2 A;  4A3L J;  2VQC A;  4LK1 F;  4LG0 B;  2HYT A;  2E1M B;  5C4Y A;  3KEQ A;  3LSM A;  3AG1 H;  4CCM A;  5DS9 A;  2HQ5 A;  1IRX A;  1YI2 I;  4E7J A;  2A6H F;  1BJZ A;  1X3U A;  2YSR A;  4B4C A;  1IDZ A;  3W6K B;  2IS4 A;  4JYK A;  2AS5 F;  5EYR A;  2NOJ B;  2Q8K A;  1N77 A;  1D5Y A;  1O3Q A;  2NVX J;  2KHM A;  3DFG A;  4DQ2 A;  2VN2 A;  2ZME A;  2G7H A;  3E5U A;  1B4A A;  3JRG A;  4Y7N J;  1FBU A;  1AKH B;  2NP3 A;  3F6O A;  1MGT A;  3CCQ I;  3QPT A;  1ERD A;  5EEH A;  2K9Q A;  1SEU A;  1YQA A;  3QU3 A;  2E5Z A;  2ZJ2 A;  3Q9V A;  3NAR A;  2QVO A;  2EZI A;  5IT9 Z;  1KZH A;  3BG6 A;  4ME9 A;  4PJM A;  1R5I D;  4XLH A;  2ZME B;  2PQ8 A;  2DDA A;  1SC7 A;  4Q48 A;  1XMK A;  1PP8 F;  1IN7 A;  1EKE A;  2Y9Z A;  1JUM A;  3EYI A;  3BNI A;  4MXM A;  2MYS A;  3G7R A;  1V55 H;  2VE8 A;  4IHV A;  2D2W A;  1MSE C;  3ZQF A;  1TT5 B;  3DF8 A;  4NUB A;  2Y31 A;  1IN8 A;  4AYB A;  4E7H A;  4PXI A;  1NHA A;  3F23 A;  1R9T J;  3RCO A;  2OV7 A;  1RKW A;  5CVU A;  2MC4 A;  2XAJ A;  4UHT A;  5M5W J;  5FLV A;  1SMT A;  2UXN A;  3PAS A;  5FO5 A;  1WJD A;  2O8K A;  2UXU A;  1ON1 A;  5TGT A;  1I50 J;  3DLA A;  5KHD A;  2DTR A;  3QBM A;  1IRG A;  4G7H F;  4MQV A;  1IV6 A;  2NYX A;  2QSH X;  2K9M A;  4RLQ A;  2LP0 A;  3VFZ A;  3CMY A;  3VIB A;  4M6V A;  4YEJ A;  3WE2 A;  2ZY9 A;  3GYH X;  2E2I J;  4AF5 A;  2KIU A;  4PGG A;  3EUP A;  2E19 A;  5EFY A;  4E7I A;  3PPB A;  2VPR A;  2VT3 A;  2FNA A;  4IEJ A;  3C7J A;  3E0J B;  2DA7 A;  1Y8Q B;  4B48 A;  1G3Y A;  2ZKZ A;  4RBO A;  3BJA A;  1KGS A;  3M1E A;  5D4R A;  2L3D A;  2LH9 A;  4I02 A;  2R5Y B;  5FD6 A;  1H88 C;  2MG4 A;  1ON2 A;  2EBI A;  3PQK A;  3AG4 H;  1H9T A;  3JTH A;  4PUS A;  4OMZ A;  1JGG A;  4CCO A;  3ZMZ A;  3HHH A;  1PJR A;  1XSX A;  5DD4 A;  2GWR A;  4V2F A;  5FKK A;  4YFN F;  2DMN A;  2DYR H;  1HSJ A;  3PM1 A;  1YE9 A;  4F92 B;  3HC7 A;  4HQM A;  2VBX A;  3GWZ A;  1CGP A;  4BEH A;  2DMT A;  3J7Z I;  1MJ9 A;  1UZC A;  5FB2 A;  1XB4 A;  4LIT A;  5FGM A;  1HKT A;  5EEG A;  3D5R C;  2LYC A;  4IX7 A;  3OL3 A;  4ZTF A;  3ZMT A;  1VQ6 I;  1TQM A;  4LB5 A;  3LST A;  2ZOZ A;  3Q3S A;  2DA2 A;  4XL9 A;  4ENJ A;  2KFD A;  5M5Y J;  3FXR A;  1Z05 A;  1IAW A;  1MZB A;  1ETY A;  2ZCX A;  4KNY A;  3A1Y A;  4ZH4 F;  2LOO A;  2EFO A;  4XOR A;  2CH0 A;  1Y6I A;  2E7W A;  2WAD A;  4HNV A;  3S3N A;  2BGC A;  2FX0 A;  3LQR A;  1R7J A;  1X4P A;  4MEY F;  4CZZ A;  3K2Z A;  1IN4 A;  3KNW A;  4W1U A;  1LFB A;  4I98 B;  1L0O C;  3LSJ A;  2GM4 A;  1WI9 A;  4D7M A;  5LGN A;  1WH5 A;  2OAZ A;  4EAT A;  4AIK A;  1VQ9 I;  5AQC A;  4M71 A;  2LK2 A;  2DG8 A;  2WV0 A;  3HGY A;  3TO7 A;  1S7A A;  2KKO A;  5HDK A;  5BPI A;  3CCS I;  2XGE A;  4UXN A;  1KU3 A;  1T39 A;  2PN6 A;  4NBQ A;  4IRG A;  1WQ2 A;  3O60 A;  2XAG A;  1MKM A;  3RPU D;  4DYC A;  2RRE A;  4A5N A;  2NXN B;  2UXO A;  3RIR A;  5FKO A;  1CF7 A;  1BW5 A;  2QUF A;  4ON0 A;  3TGN A;  3ABT A;  1G4D A;  4HOB A;  3P9I A;  3NAU A;  3ONQ A;  3LAP A;  1K6O A;  1DP3 A;  2QTQ A;  2P6S A;  4W97 A;  5DAJ A;  3BZ6 A;  1TWC J;  4Q5S F;  1RNL A;  4YFK F;  2D1H A;  1X58 A;  1QGP A;  3AFH A;  3ZPL A;  4BJ6 C;  4KT5 C;  3ZR8 X;  3DTE A;  3J7A O;  1R22 A;  4M9X A;  3NEU A;  3HTJ A;  4I7H A;  2REK A;  4KIB A;  1WCM J;  3WTW C;  2HXO A;  2QKL B;  3B81 A;  1TNS A;  4IQ4 A;  1ZG5 A;  1X19 A;  3LSK A;  3KFW X;  4L5J A;  1ZAR A;  4IO9 F;  2N8G A;  2JPC A;  2K3P A;  3DV8 A;  3PNY A;  5CQE A;  3KX2 A;  4OMY A;  3KYC B;  3WTY C;  4ASN A;  3RZO J;  4H0E A;  5L3B A;  2L2O A;  2VJ5 A;  4M9Z A;  3WTS C;  2J5P A;  2I5U A;  5E3O A;  3HOT A;  2R7W A;  3HE0 A;  4IHX A;  4BDY A;  2HR3 A;  1L3L A;  4N4O B;  4TV7 A;  4HF0 A;  4I6Z A;  2VKD A;  4ZDO A;  4BJ5 C;  1WI3 A;  2FQ4 A;  1ITY A;  4ETS A;  3TQN A;  1D1B A;  1OYY A;  2ZNZ A;  1QA6 A;  3OYJ A;  1ZRC A;  3VYR B;  1BJA A;  5EZG A;  4JNN A;  1YOV B;  2XRN A;  3V8L A;  1FOK A;  3D0S A;  4ZYA A;  2ZSI B;  4XM3 A;  2ADU A;  3EYY A;  1W0U A;  2K86 A;  2QEX I;  2HFH A;  2EIJ H;  5KAI C;  5JHU A;  3TW7 A;  4RM2 A;  5KAF C;  2NP5 A;  4PK4 A;  2M4G A;  5JHF A;  2FBQ A;  1TWA J;  3CC7 I;  1PYV A;  4ZYD A;  2KZG A;  4F91 B;  2COM A;  3LSG A;  1W5C C;  1ZK8 A;  2M87 A;  3DTK A;  4I09 A;  2ZJQ F;  2P5L C;  3QYE A;  3HYI A;  1FWZ A;  2PBX A;  1XX5 A;  4NQW A;  5C4J J;  3KE2 A;  3J80 Z;  2R7T A;  1YX3 A;  5ICG A;  3S14 J;  2VBW A;  2LY9 A;  5A2Q K;  1GV2 A;  2EIN H;  1FBS A;  4U88 A;  4N9H A;  3WU1 B;  1XGN A;  3CCL I;  4BXX J;  5LHH A;  2FD5 A;  5FFZ A;  4YIF A;  3MZH A;  1WGX A;  3QRF F;  4EM0 B;  3FXM A;  3R0J A;  2CW7 A;  3Q0V A;  3EET A;  2ZC2 A;  4D1Q A;  2WB1 N;  1C0W A;  2M34 A;  2DJN A;  3HL2 A;  1AOY A;  3QOD A;  1VQ5 I;  1DP7 P;  4C3I J;  3K4B A;  1XPX A;  3JAM K;  3PFI A;  2RC4 A;  2DFE A;  3KYD B;  1ZG3 A;  3BHQ A;  2LG4 A;  2VLA A;  2ISY A;  2YPR A;  2Z5U A;  1RC9 A;  4CUG A;  2L4M A;  4E4H A;  5IOZ A;  4MTE A;  3JSP A;  1SFE A;  4WCG A;  1SGM A;  1J0R A;  3GEZ A;  4A3E J;  1POG A;  5F0H A;  3RKQ A;  1FMW A;  5LHI A;  4GO1 A;  4M3G A;  1MDM A;  1MMG A;  3CMA I;  2LLK A;  2VON A;  3H3V K;  4E7S A;  3O6B B;  2QQB A;  1RIO H;  4D0P A;  3VP5 A;  2YR2 A;  3DTI A;  3EUH C;  3E7L A;  3BG9 A;  2MA3 A;  1R5G A;  3GCM A;  3PQJ A;  3SYT A;  2HKO A;  4RAZ A;  4ESB A;  4ENN A;  3LHQ A;  2VPL A;  2HOS A;  1NTC A;  1HW5 A;  2E35 A;  2NX4 A;  4HW0 A;  5CQG A;  2QM3 A;  3RI4 A;  3K1P A;  3FRQ A;  1TW2 A;  1MDM B;  3K4M A;  3IUV A;  3LL7 A;  1D0Z A;  5K7F A;  1EJ9 A;  5JVT A;  3Q5F A;  4FTH A;  3EPZ A;  2CMP A;  4HQE A;  2ZSH B;  3Q9S A;  3HOW J;  1TWF J;  2OUM A;  5F08 A;  4GCK A;  3GO5 A;  3U21 A;  4ZDL A;  2HXI A;  4C3H J;  3OYL A;  2HOT A;  5CVI A;  2PI0 A;  2LC2 A;  1DU0 A;  4LLN A;  2DAO A;  2FUG 2;  2LSO A;  4JX4 A;  4AVZ A;  2Y75 A;  2KL4 A;  2W4S A;  2O0Y A;  1S5L C;  4RAY A;  4XID A;  3K0L A;  4AC6 A;  5CVV A;  2LY1 A;  1XD7 A;  2Q0O A;  1RES A;  1M1E B;  1FJL A;  1ETQ A;  2GXB A;  1VQ7 I;  4Y13 A;  2L7K A;  2EJR A;  1HCR A;  4NN1 A;  2FRH A;  4K2E A;  1IUY A;  4KIT B;  2H6C A;  2FMY A;  2W25 A;  2JZY A;  5DUK A;  5GP9 A;  3ZQI A;  2NVQ J;  3RD3 A;  5FMP A;  3V78 A;  2NAZ A;  4DNC A;  4AU7 A;  1YIO A;  4A3G J;  3NNR A;  3SEZ A;  2GZW A;  2CV1 A;  3C18 A;  2JA2 A;  4HX4 A;  1F9N A;  3DBR B;  5BNG A;  3TP0 A;  1D1C A;  3WOD F;  2R7V A;  3E7Q A;  2P5V A;  2Z1D A;  2LD5 A;  1FYM A;  2IU5 A;  4JX6 A;  2KRF A;  1J5Y A;  2H8R A;  3FXJ A;  4PJL A;  3CTA A;  4BL0 B;  1P9Q C;  3KLO A;  4MGR A;  4XRF A;  5TJJ A;  3RQI A;  2O5R A;  1BR1 A;  1XGM A;  1UG0 A;  2GOM A;  3RPU A;  2QCO A;  4IHS A;  1FP1 D;  2P4W A;  5D8K B;  3G71 I;  1JHH A;  3AL0 C;  4Y4R A;  4JK1 X;  2KLO A;  4CYD A;  4CIC A;  2X6W A;  4I76 A;  2XAH A;  4BXU A;  2OF7 A;  5IYC J;  4XLE A;  4EJO A;  3MKY B;  3A2K A;  2UXX A;  2QLZ A;  1QZE A;  4UVC A;  5K5R A;  3LSR A;  3BLY A;  1KQ0 A;  4LG3 A;  2ECB A;  3F8N A;  4Z2Y A;  4IOA F;  4ICH A;  4HEA 2;  2DI3 A;  2Z33 A;  3T1B A;  5B1B H;  2EQR A;  4G6D A;  3G6E I;  4RLF A;  1KA8 A;  2NVY J;  1ZR2 A;  1QHG A;  2MW8 A;  3CJQ B;  3LJL A;  2OZU A;  2OJE D;  1JKO C;  2L9N A;  1W7P B;  4IKF A;  3CLO A;  3H3Z A;  2EB7 A;  4A0Y A;  2IVM A;  1LQ1 A;  2R0Q C;  1UAA A;  2P0W A;  2E1O A;  1E2X A;  3S1R J;  3W2V A;  2D5V A;  2CWE A;  5C44 J;  4WX9 A;  2FML A;  2HQA A;  2JQ7 A;  3J81 K;  2GXG A;  5GPA A;  2XAQ A;  3BRO A;  2BVL A;  2LF8 A;  2AHQ A;  1ZQ3 P;  1B72 B;  1TC3 C;  2FOW A;  4AIH A;  3GVA A;  3ZMS A;  4A3C J;  3FXL A;  2VJ4 A;  5AON A;  2E7X A;  3KP5 A;  5D6E A;  4B3X A;  1F43 A;  3NRG A;  5F0C A;  4XKB A;  3I64 A;  3VSK A;  4EGZ A;  2K02 A;  4KT6 A;  3KZY A;  5E1X A;  3SXY A;  2OCC H;  3RQ4 A;  4Y33 A;  2XRL A;  4A3K J;  4UVB A;  3HEF A;  2P6T A;  5FD5 A;  2HKU A;  4L9V A;  1QPI A;  4UV8 A;  1WSU A;  2Y2Z A;  1PVE A;  2F6C A;  3MVP A;  1U5T C;  2GBY A;  3WU0 A;  3ZN1 A;  4KDP A;  3G56 A;  4ZYE A;  2JT1 A;  1BIA A;  3C2H A;  1LNW A;  2A5W A;  2X6X A;  3DXJ F;  2UUZ A;  4M3F A;  4CCK A;  3W2W A;  4E7Z A;  3CCU I;  3TED A;  2E60 A;  4BQN A;  3WGI A;  2Z9O A;  4EV0 A;  3OV8 A;  1NH3 A;  4D9J A;  2H1K A;  2XKO A;  2VOD A;  1ZRD A;  1PUE E;  3QKX A;  5DTD A;  2DOD A;  3BJO A;  3CCM I;  2DYS H;  3I3L A;  3GZ5 A;  3S93 A;  2YVE A;  2HGC A;  3DPJ A;  1A31 A;  4HBL A;  1O3T A;  1BOA A;  3RSN A;  4EGY A;  2RVC A;  3ZQC A;  3E3V A;  3HRS A;  3JSO A;  1ZH5 A;  2DT7 B;  3LNQ A;  1K6Y A;  1K78 A;  3LWJ A;  5E8I A;  1PUF A;  3CC2 I;  5KVR A;  3K70 C;  5J4V A;  1OCT C;  2M2E A;  1ZGA A;  5HS9 A;  4BY1 J;  2XAS A;  3PFY A;  2VQL A;  5ILV A;  2W00 A;  3GUD A;  1A35 A;  2UXH A;  3PSI A;  3ZCO A;  1FC3 A;  3SQN A;  4DZJ A;  2VB6 A;  1TWH J;  2V26 A;  4HX7 A;  3TMO A;  4ZDP A;  1XDU A;  5B3S H;  4L18 B;  2VQH A;  3K70 D;  3PIP F;  2F4O B;  2PFB A;  4IF4 A;  3LMM A;  5LRS A;  3T6N A;  2F5C A;  3BC8 A;  2O9L A;  2YUS A;  5EG0 A;  1K78 B;  5J8C A;  3SWH A;  2E71 A;  3BJB A;  4G7O F;  4I01 A;  5F64 A;  5HVQ C;  4BS9 A;  1O7L A;  2M0M A;  4KYW A;  3COL A;  2Y0S A;  1AA7 A;  5HBU A;  1HKS A;  3VTI A;  1RR7 A;  3B73 A;  3JW4 A;  1MD0 A;  2WC2 A;  3IAM 2;  5LEJ A;  4A5M A;  3MFK A;  1HOM A;  2CUF A;  3OYE A;  1ZN2 A;  4BNC A;  4IRV A;  3QOE A;  4M3D A;  3E97 A;  2L5Q A;  5EG0 B;  2DU9 A;  5ICE A;  2O3F A;  4CCL A;  1ZG1 A;  4S0H B;  1WHU A;  4HLX A;  2LKS A;  3BP8 A;  1WVR A;  4Y15 A;  3AKZ A;  3BCB A;  3HRU A;  1APL C;  4IRH A;  2MGQ A;  1FNN A;  1BL0 A;  2R92 J;  3EUK L;  3OSF A;  1ZYR F;  3ROU A;  4X0G A;  4ACI A;  1Y56 A;  4PFP A;  2MLK A;  4LG0 A;  1K4S A;  3OYF A;  1XTA A;  3DKX A;  2MLG A;  3VB2 A;  2RNG A;  3HOS A;  2I8D A;  2OC6 A;  3V4G A;  4RAG A;  5J3L A;  2KJB A;  4PJN A;  1OCO H;  2XIG A;  1DGW Y;  2OCE A;  2V9P A;  1BN5 A;  3GLL A;  4U9L A;  1X4O A;  4UUT A;  1T33 A;  3MKZ A;  4IHW A;  4HF1 A;  3IAS 2;  3S1N J;  3VYU B;  4GCV A;  3FKI J;  1MBG A;  1LEB A;  1JHF A;  1JGS A;  2LNB A;  1FBQ A;  4MO7 A;  3UR3 C;  4N4N B;  1W1W E;  2DCE A;  5FKM A;  2DOA A;  2ELH A;  3U1K A;  2FSW A;  4B09 A;  1SFU A;  2CFO A;  1TQP A;  2WTE A;  4RB1 A;  4KIS A;  4KJZ A;  2O7O A;  4QPO A;  5H6R A;  5D6F A;  5D5V B;  2HVQ A;  2GLO A;  2IA1 A;  1TL8 A;  1MJB A;  2M5W A;  3WTX C;  2DBB A;  4HNU A;  3TO6 A;  1IXS B;  2L54 A;  3KP2 A;  2V9K A;  1JUS A;  1R23 A;  3F9K A;  3S8P A;  4MQ9 F;  2E5N A;  2RNJ A;  2DFI A;  4L9T A;  2IW5 A;  1W5T A;  3VW2 A;  3EGQ A;  4FE4 A;  4A3J J;  3IV5 A;  3GFM A;  3W2A A;  1GUU A;  4GYG A;  3O8G A;  2WWY A;  2K9S A;  3KCC A;  3G3Z A;  4UVA A;  5L3E A;  1B9M A;  4II3 A;  2XPU A;  5E1Z B;  3QOP A;  2VC1 A;  2MC3 A;  2ZCM A;  2RAS A;  2WUI A;  2MAB A;  1O4X A;  2Y9Y A;  1YIJ I;  1N78 A;  2BY0 A;  4CDG A;  3HKZ N;  3K4N A;  4BAY A;  5J1U A;  5IP7 J;  3R61 A;  3OYH A;  4GCT A;  4UB8 C;  3C2G A;  3U9G A;  2PMU A;  2BHY A;  4LB6 B;  2QQ8 A;  1JXS A;  3PUF A;  1MNM C;  2LR8 A;  1BIB A;  4HA8 A;  3I55 I;  3CJR B;  2BBY A;  2WAQ A;  3F72 A;  3VW1 A;  3GTG J;  1GXP A;  3MNL A;  3KKD A;  5B66 C;  2P81 A;  1UB9 A;  3X2Q H;  1R1U A;  1O3S A;  4EVI A;  5D18 A;  1XSD A;  1O3R A;  1XMA A;  5DM7 F;  3AL0 B;  2R5Y A;  4KMF A;  4WK8 F;  4AID A;  3CQZ J;  3CRJ A;  1W36 C;  4HX8 A;  2AXT C;  2WBM A;  4XLN F;  2JN6 A;  4LFU A;  2DPD A;  3KEY A;  3TDZ C;  5IYB J;  3F8M A;  5FLX Z;  2BVM A;  4HNT A;  4AWX B;  1W36 D;  1KU7 A;  2I10 A;  4F93 B;  1T0F C;  2OTJ I;  1B8I A;  1OR7 C;  3F8B A;  1IXC A;  3E6C C;  2V1D A;  3JSJ A;  2M4K A;  4QLC U;  1T08 B;  5K7Z A;  2HYJ A;  1RET A;  1YX5 A;  1E17 A;  1SFO J;  3GZ6 A;  3H0D A;  2JA6 J;  4UV9 A;  3RH2 A;  1VZ0 A;  2G7U A;  5FKL A;  3MKW B;  1N75 A;  3HUG A;  1X1P A;  4OOI A;  3M4O J;  5CXI A;  3DKW A;  1B8I B;  3MCZ A;  5HLI A;  1MMD A;  2LFB A;  2F5F A;  3NRV A;  1HKQ A;  1D8K A;  1UHS A;  4HDU A;  1V54 H;  5FFX A;  5FKN A;  2EWN A;  1OKR A;  2WAF A;  2ZXJ A;  3LOC A;  3H1C A;  2VQG A;  3RPQ A;  2VOP A;  3A4C A;  4A0Z A;  2V57 A;  2M45 A;  3M9A A;  1EH6 A;  3CUQ A;  1HDD C;  2QQ9 A;  3HUG B;  1F36 A;  2LBF A;  4D5C A;  4OIR F;  5K5O A;  2NNY A;  4EJT A;  3I9V 2;  3WGH A;  4WWC A;  2JJ7 A;  2CG4 A;  1YFH A;  1FTZ A;  3LFK A;  1LDK B;  2M1B A;  2XGC A;  1WKM A;  1J7K A;  1XG1 A;  1G6N A;  3DU5 A;  2G7G A;  4BHC A;  1NG6 A;  3ANP A;  3J80 K;  2IAI A;  2PMZ N;  1ETO A;  2FBH A;  4F7Z A;  3L09 A;  1YRN B;  4B43 A;  5E18 F;  3BCG A;  1GHC A;  2OZ6 A;  2VJJ A;  3CUQ B;  1F5T A;  1Z6R A;  1P4X A;  1Z6T A;  2ZCW A;  2LBF B;  3OYD A;  4LGW A;  1FIP A;  1TT0 A;  4DYQ A;  4WXH A;  3L2V A;  2JA7 J;  2FF4 A;  2LY2 A;  4NB5 A;  3CCY A;  3MN2 A;  3BQY A;  2DN0 A;  4NC8 A;  2DFH A;  1PP7 U;  1W7P D;  2L7M P;  4YII A;  3FF5 A;  1U0J A;  1KQ8 A;  2JWT A;  1A5J A;  3KZI C;  3ULQ B;  3GBG A;  2RN7 A;  3ZQ7 A;  4Z6Y A;  3C3W A;  5DEQ A;  2LRE A;  2ZCN A;  1WJA A;  4HSR A;  4XK4 A;  1Y0N A;  3VPR A;  3TO9 A;  3K4L A;  5E1W A;  3V8K A;  1REP C;  5E3M A;  1EH7 A;  3BJ6 A;  1BOB A;  2HWV A;  2K3F A;  4Y52 J;  3VOX A;  3JRI A;  1V3F A;  3ZGK A;  3S2H J;  4ENK A;  3VDX A;  3GFL A;  2GXA A;  3V6G A;  1QBJ A;  2HQN A;  1D5V A;  2E36 A;  2GA2 A;  2JUG A;  4ITV A;  4L5I A;  4WF2 A;  2HEO A;  5JVG F;  2NVT J;  1HDP A;  5ICF A;  3KYL A;  1SAN A;  1J59 A;  3IH3 A;  4M6X A;  3L1P A;  4II2 A;  2EA2 A;  3DLL F;  2LVS A;  2E2J J;  2KZV A;  3FM5 A;  1D8J A;  2HPI A;  2QGU A;  2D6Y A;  3OWT A;  3NS4 A;  1MJA A;  1QZZ A;  3LSH A;  4QIW N;  5K7H A;  1X3Z B;  1SD6 A;  1ZR4 A;  1GLN A;  1D0X A;  5AIP A;  2O03 A;  3TW6 A;  2XGD A;  4BY7 J;  1E0E A;  3ZQG A;  2H94 A;  2WV1 A;  4FHT A;  4HST A;  2H09 A;  4RA2 A;  3CWR A;  4D7N A;  3GLX A;  1U9N A;  5HSZ A;  1IN5 A;  5C3E J;  3OYN A;  1IUF A;  3MZ8 A;  1BA5 A;  4YIR X;  2ZBK A;  4BQA A;  1WPK A;  1YS7 A;  4EMS A;  4P96 A;  3K4K A;  3W6V A;  2W1O A;  1LDJ A;  1J09 A;  1FP2 A;  5M3F J;  5GTI C;  1MBJ A;  1T6S A;  3CO7 C;  2H8W A;  1Y1W J;  4FQG A;  4LMY A;  4S05 A;  3OYI A;  5D19 A;  1UI6 A;  1OMI A;  2AO9 A;  2V1X A;  2R7U A;  1JTY A;  4XLA A;  4YFX F;  2O6G E;  1U78 A;  2B7E A;  4BAC A;  5JI6 A;  4AD9 A;  3WTU C;  3QP6 A;  5D5X B;  3RKX A;  1ZTR A;  3OL4 A;  4M3E A;  1FPQ A;  4RB0 A;  2ELK A;  1KU2 A;  1ZLJ A;  3I5U A;  5HNH A;  2DFF A;  4DVY P;  3OYM A;  3BCA A;  3HZJ A;  3ZOB A;  3OYB A;  2KMU A;  5K1Y A;  4EEF G;  1D0Y A;  4CYC B;  2GOX B;  2HOA A;  3TL4 X;  2NS7 A;  4XSZ F;  3FXO A;  4FE7 A;  2B63 J;  2R7Q A;  4GFL A;  2W82 A;  3HSE A;  5LBQ A;  3PIO F;  2XDN A;  3DEE A;  1R4M B;  2OA4 A;  2NRA C;  3EDP A;  5E8G A;  3ZQL A;  2H6B A;  2RDP A;  3C1D A;  4ZZL A;  1MBF A;  4AM3 A;  2A69 F;  5DM6 F;  3K1M A;  3TBI A;  3FMS A;  3T8R A;  1KQ9 A;  2BXY A;  3WHC A;  3A01 A;  2ZXI A;  1R71 A;  4V19 K;  2CQ7 A;  1I3Q J;  2CV2 A;  3BY6 A;  3A03 A;  2DOE A;  2R7O A;  3IP4 B;  3BG7 A;  3IH2 A;  2DA3 A;  3LFU A;  3VOK A;  3QP5 A;  2F4I A;  2R7D A;  2HTS A;  3L2Q A;  5JLX A;  3NWS A;  2X6Y A;  3PNT A;  5JR3 A;  3CO6 C;  5J47 A;  1XC5 A;  4HV5 A;  1OJL A;  2IPQ X;  1MNE A;  4LD5 A;  1P4W A;  1FSE A;  5HAW A;  3K4C A;  3HDD A;  4GFB A;  4GFK A;  4P9F A;  4M74 A;  1JE8 A;  3SFI A;  5D8L B;  1K7A A;  3CD6 I;  2DPU A;  3A01 B;  3H9Q A;  4DOZ A;  2PJP A;  1LE8 A;  1HC8 A;  3DP7 A;  3H5N A;  2EPF A;  1DQU A;  1RZ4 A;  1QHH D;  4PJ0 C;  2RQP A;  2X0L A;  3S16 J;  1Z7L A;  1V5F A;  4XON A;  3CC4 I;  1SD4 A;  1TBX A;  2V6C A;  2WAE A;  1WJ5 A;  2EFQ A;  4MFD A;  4J19 A;  3V7C A;  3ZMU A;  3DPL C;  5TRD A;  2OQR A;  4B47 A;  1MND A;  2NNN A;  2LTP A;  3WU2 C;  2VKH A;  3SHF A;  4EJU A;  2C6Y A;  4OU0 A;  3IRR A;  1T2K A;  1NG7 A;  3I4P A;  1G2H A;  3LSI A;  1SAX A;  1LE8 B;  5EJC A;  2GQQ A;  3GXO A;  2QSG X;  2B1E A;  2GIZ A;  2H1L A;  3A0H C;  3ZXS A;  3PO2 J;  2R7X A;  2R4G A;  3H0G J;  2IRF G;  1BBY A;  3JRB A;  2KDZ A;  2EIM H;  2KPM A;  5BMZ A;  2WB1 A;  2EZK A;  1Z21 A;  2QF7 A;  2XPV A;  4MTD A;  2ESN A;  4R79 A;  2DXI A;  2BXZ A;  3BTC A;  2K4J A;  1YYV A;  4PDK A;  3JRE A;  4L0Z B;  3P9T A;  4GDF A;  1GXQ A;  4NHJ A;  2L7Z A;  4HLY A;  2KIM A;  2YX4 A;  4IPA A;  3MWM A;  2G7S A;  1ZHF A;  2IGM A;  2OQG A;  3I58 A;  5GTH C;  3ABU A;  3BTL A;  3KIO A;  2XAF A;  1QNT A;  4OAZ A;  4A69 C;  3VUQ A;  4C2M A;  5CXG A;  3B6A A;  4P5O A;  3DPT A;  1CQT A;  1S7E A;  2ME6 A;  4U0V A;  2W48 A;  2CUJ A;  2ZNY A;  3KET A;  1P7I A;  2L0K A;  1OYW A;  1AWC A;  4RAF A;  2GFN A;  2EV6 A;  4M73 A;  4XBF A;  2L9S A;  1FEX A;  1WJB A;  3JRA A;  1VQ8 I;  4F52 A;  3JTG A;  1IRZ A;  4HAM A;  5GAE J;  3D5S C;  4UY8 I;  1DPU A;  5IP6 A;  2ZB9 A;  3L7W A;  2P8T A;  3FWE A;  3PL8 A;  4Q47 A;  3OOP A;  2R5Z B;  1YIT I;  4MK6 A;  2ZME C;  1Y8R B;  2KJC A;  3HTU A;  4BE1 A;  3UKG A;  2VKV A;  2JK3 A;  3T5X A;  1I6H J;  5A2Q Z;  3KEO A;  1MMS A;  1V4R A;  2P7C B;  1ZLK A;  2EZL A;  3HOU J;  2VT2 A;  2DA5 A;  2LKX A;  3H9J A;  1W7P A;  4CH7 A;  2OTL I;  1OFC X;  1MMA A;  2HYG D;  3KP4 A;  4PSW A;  2R7Z J;  1WH7 A;  4BUP A;  2ZJP F;  1VQM I;  1HQC A;  3CJT B;  2EV0 A;  4G12 A;  2QOP A;  3CF5 F;  4XKV A;  2DO7 A;  3L2U A;  2BY2 A;  4QPQ A;  2Y69 H;  4O3M A;  2EIL H;  1WRJ A;  2UXP A;  1SVM A;  3E6D A;  5H20 A;  2K9L A;  1FX7 A;  3HPH A;  2HDD A;  2ID3 A;  1B72 A;  2CQX A;  5HNF A;  3BR2 A;  2KIS A;  2IA0 A;  3IRQ A;  5DDG A;  4B8X A;  1Z3Y A;  4CZC A;  5D5U B;  3JAM Z;  4DYR A;  3FK7 A;  3VYS B;  2E34 A;  2J5O A;  3IKV A;  3BZC A;  1T98 A;  1Z0X A;  1OCZ H;  2JSC A;  3FKJ A;  3JRF A;  1DPR A;  2CW0 F;  3G4S I;  3C07 A;  2JRM A;  1X2N A;  2FJI 1;  4M3B A;  4FIS A;  3VYT B;  1X1B A;  3AG3 H;  5GAG J;  2E1N A;  1FYK A;  5B5E C;  2L9V A;  3L00 A;  1SD7 A;  4IL6 C;  1DGR M;  4U0W A;  1P6R A;  2DMP A;  2FBK A;  4HPQ A;  5DD8 A;  3GTQ J;  1Y0U A;  4EJV A;  4C2U A;  1Z1D A;  3PO3 J;  4XRS A;  2RKH A;  4OD4 A;  2VBY A;  2V6E A;  2BYV E;  5FLM J;  1E3P A;  3AQS A;  3HSR A;  3ON2 A;  3CDI A;  4UUV A;  1R6R A;  1U9O A;  1FTT A;  2WY8 Q;  3G2B A;  4L62 A;  2OER A;  4HYE A;  1RPW A;  4XKC A;  3WTT C;  1WWX A;  2CYY A;  4BHP A;  2JTV A;  1KYW A;  3TDU C;  2DLL A;  2PEX A;  3QPS A;  4B44 A;  3QYB A;  2JUC A;  4LLG F;  2HKX A;  4CXF A;  3DQV C;  3I71 A;  5FRO A;  3SZP A;  1U3E M;  2PJR A;  2ELJ A;  4XNF A;  5LGT A;  4RGS A;  3OOU A;  3O2P E;  1W5S A;  2F5D A;  4IXA A;  1MBK A;  1Z7U A;  1LVA A;  2IJL A;  3OR2 C;  4M6Y A;  3BR6 A;  3F0C A;  5IT3 A;  1Q1V A;  2G7L A;  4KN4 X;  1D1A A;  4L5E A;  3E5Q A;  3P7N A;  5GAH J;  1GT0 C;  1XN7 A;  3K69 A;  2QBY A;  1S6L A;  2IXS A;  4Q4Z F;  2OI8 A;  2DA1 A;  3G1L A;  3GW2 A;  3M3Y J;  3EUA A;  4LIV A;  1GVJ A;  3HRT A;  1IW7 F;  2BE5 F;  1LFP A;  3QYF A;  3DEW A;  4XLC A;  1OIS A;  1LEA A;  1MW7 A;  3FBI B;  2PJR B;  2IS2 A;  4IQJ A;  2RGV A;  1XS9 A;  5E17 F;  5GPC A;  3HRM A;  3RTR A;  3I54 A;  3VOE A;  4PCQ A;  1K61 A;  3BWG A;  4NDL A;  1GDT A;  4E7L A;  1MH4 A;  4RGR A;  3MD2 A;  3V7R A;  2B0L A;  1VFC A;  2M7A A;  2QBY B;  1TZL A;  1YW8 A;  4V2G A;  5IT9 K;  3BRU A;  4RS8 A;  4ESJ A;  4UDS A;  2ICW G;  2M8G X;  3PNV A;  1VQ4 I;  3UNG C;  3R4K A;  5HLT A;  3JCU C;  3O3K A;  1ODD A;  4F55 A;  2E1C A;  2DT5 A;  2DOF A;  1FOW A;  1SMY F;  3FXK A;  4KFC A;  5EF6 A;  1EV7 A;  1YLF A;  1HW2 A;  1S29 A;  4G94 A;  3S3M A;  2JSP A;  4X6A J;  2VXZ A;  4G8X A;  6PAX A;  3S2D J;  3K8P C;  3L2C A;  1QPM A;  3IH4 A;  2RHA A;  2Y30 A;  5F1J A;  1B1B A;  3OIQ A;  3KPH A;  3N97 A;  5BPD A;  2YU9 J;  2ESH A;  2QQA A;  1IRF A;  3HGG A;  4DW6 A;  1UG2 A;  3CJD A;  3B6C A;  3P9C A;  3RJP A;  1IN6 A;  1YO5 C;  1IG7 A;  3KP6 A;  3ISP A;  4XQF A;  4N0B A;  1K4T A;  4WIB A;  2V4J C;  1BR2 A;  4S04 A;  4A12 A;  1W0T A;  2F4M B;  4UUS A;  2MFZ A;  5LGU A;  3S2W A;  3D5L A;  3SDB A;  4N9I A;  3EUH A;  3WG9 A;  3HTS B;  2OD5 A;  3A0B C;  3VVZ A;  3E1S A;  2YU3 A;  2YS9 A;  4PSX A;  1HA8 A;  2CO5 A;  1Y39 A;  1SVL A;  4CA0 A;  1ZEL A;  2BOL A;  5EEA A;  3E6M A;  3F6V A;  3HXL A;  1VQN I;  2XF5 A;  1B6A A;  1ETV A;  5LLQ A;  2W24 A;  3L2R A;  3E5X A;  4UNO A;  3CUO A;  4B3A A;  5L3G A;  3T0Y A;  2JVG A;  3ECH A;  3OIP A;  3FZV A;  2ZOY A;  5KK1 A;  4XR6 A;  3KP3 A;  3V42 A;  3ZMV A;  1VF9 A;  4IZZ A;  1KON A;  3CCJ I;  3OSG A;  4UUS B;  5J6X A;  2PX9 A;  2V79 A;  3M7G A;  2M9H A;  2JPB A;  2IS6 A;  1H9G A;  2GAU A;  3H9G A;  2BEO A;  1TLH B;  2NVU B;  4AUX A;  1UHM A;  1OLT A;  2BY3 A;  4JBA A;  4OIO F;  5IYD J;  3K9T A;  5HLH A;  3O8H A;  3A02 A;  2HOE A;  1FOY A; 
#chains in the Genus database with same CATH homology
 2DJN A;  2DMQ A;  2GEN A;  1FTZ A;  2XGC A;  4C3I J;  3CDL A;  2UXI A;  1JKP C;  1XG1 A;  1UI5 A;  1NK3 P;  2CUE A;  2G7G A;  1FIA A;  1QVT A;  3VVX A;  3ANP A;  4AYB N;  1A6I A;  2IAI A;  3BHQ A;  2PMZ N;  1ETO A;  1JJ8 C;  4JKZ A;  5IOZ A;  1SGM A;  3BCG A;  4A3E J;  1POG A;  5F0H A;  3RKQ A;  3JRD A;  2IBD A;  2NS8 A;  2YVH A;  2DA4 A;  4M3G A;  1DU6 A;  4ABZ A;  2XB5 A;  4YZE A;  4DYQ A;  1FIP A;  2JA7 J;  2LLK A;  3G1O A;  3H3V K;  2Q24 A;  3G1M A;  1JJ6 C;  5FGL A;  2GUH A;  3CCY A;  3MN2 A;  3BQY A;  1BW6 A;  3VP5 A;  2DN0 A;  3NI7 A;  4X1E A;  2L7M P;  2Y0S N;  3BG9 A;  2JWT A;  3E7L A;  1A5J A;  3KZ9 A;  1QVU A;  3LHQ A;  2JMW A;  4XIC A;  2G3B A;  3GBG A;  2HOS A;  1NTC A;  2NX4 A;  3MKL A;  2X9D A;  2ZCN A;  4XK4 A;  3VPR A;  5IPA A;  3FRQ A;  3IUV A;  5E3M A;  3HM5 A;  5K7F A;  4Y52 J;  3VOX A;  3JRI A;  4FTH A;  1MBE A;  3S2H J;  4CGR A;  3HOW J;  1TWF J;  2TCT A;  5F08 A;  3NPI A;  4HKU A;  4GCK A;  3FIW A;  3V6G A;  2HXI A;  4C3H J;  4KWA A;  3OIO A;  2HOT A;  1ORK A;  3BR3 A;  1DU0 A;  3QQA A;  4JX4 A;  1VND A;  2NVT J;  1HDP A;  3K2A A;  3HB9 A;  3S17 J;  1SAN A;  5M5X J;  3IH3 A;  4XID A;  3L1P A;  3LSP A;  2E2H J;  2LVS A;  1MH3 A;  2E2J J;  5FHP A;  4AC6 A;  3D1N I;  2D6Y A;  2ECC A;  3HTA A;  5EDN A;  1RES A;  1FJL A;  4QIW N;  5K7H A;  1ETQ A;  2CRG A;  2KT0 A;  1ZR4 A;  5EGO A;  2OPT A;  1HCR A;  1P7J A;  3TW6 A;  4NN1 A;  3HOY J;  2XGD A;  3HTI A;  4BY7 J;  4BBR J;  5M3M J;  2JA8 J;  5JLW A;  3ZQG A;  3GTL J;  2DG7 A;  2WV1 A;  5GP9 A;  3ZQI A;  2NVQ J;  3RD3 A;  2L7F P;  3CWR A;  3V78 A;  5FMP A;  4D7N A;  3SJM A;  1U9N A;  5HSZ A;  5IOY A;  2NOG A;  5C3E J;  4A3G J;  2TRT A;  3NNR A;  1Z77 A;  1IUF A;  1PUF B;  1E3O C;  1BA5 A;  1WPK A;  5BNG A;  1AU7 A;  2X48 A;  3TP0 A;  3E7Q A;  3W6V A;  2LD5 A;  2IU5 A;  4JX6 A;  2H8R A;  1VI0 A;  5M3F J;  5EGO B;  4JP0 A;  1JKQ C;  2DMU A;  2ID6 A;  2F07 A;  1JT0 A;  1MBJ A;  5D1R A;  3RQI A;  3KKC A;  3TP3 A;  1Y1W J;  5D19 A;  2QCO A;  1UI6 A;  2AO9 A;  3GTP J;  1JTY A;  5HOD A;  2EZH A;  2EH3 A;  1U78 A;  2CJJ A;  4JX5 A;  2K40 A;  3Q0U A;  1IDY A;  1ZTR A;  2MSY A;  3BTJ A;  4M3E A;  4I76 A;  2ELK A;  4BBS J;  1LFU P;  2OF7 A;  5IYC J;  3ZOB A;  1JTX A;  4EEF G;  4QTR A;  4CYC B;  2B63 J;  2HOA A;  2W53 A;  2NS7 A;  4FE7 A;  3GZI A;  3LSR A;  1RKT A;  5F0F A;  2ECB A;  4GFL A;  2XDN A;  1IGN A;  1OCP A;  3ON4 A;  4ICH A;  5J1R A;  1ZKG A;  2EQR A;  1ZR2 A;  2NVY J;  3JR9 A;  2MW8 A;  1X2M A;  3ZQL A;  3LJL A;  1AHD P;  2X6O A;  1JKO C;  3I4M J;  5FJ8 J;  1HLV A;  2QKO A;  2R0Q C;  1IJW C;  1MBH A;  2E1O A;  1MBF A;  3JRH A;  3S1R J;  2D5V A;  4XRS G;  1IC8 A;  5C44 J;  5IP9 J;  2R93 J;  3WHC A;  3A01 A;  1Y1V J;  5GPA A;  1I3Q J;  3Q0W A;  5H9T A;  3A03 A;  2AHQ A;  2O7T A;  2HI3 A;  1ZQ3 P;  1B72 B;  3IH2 A;  3ZQH A;  1TC3 C;  4A3C J;  2DA3 A;  1AKH A;  3VOK A;  1F43 A;  4FCY A;  3NRG A;  1BL0 A;  2WAQ N;  5F0C A;  5JLX A;  3GTJ J;  1JKR C;  4MFE A;  1XC5 A;  4D5F A;  4A3L J;  3F1B A;  1OJL A;  5E3L A;  2HYT A;  5C4Y A;  2XRL A;  4A3K J;  5DS9 A;  2HQ5 A;  3HEF A;  5F27 A;  3HDD A;  2HKU A;  4GFB A;  1QPI A;  4GFK A;  1BJZ A;  2Y2Z A;  4B4C A;  4IHY A;  3SFI A;  1IDZ A;  3MVP A;  2GBY A;  5F04 A;  4JYK A;  3G56 A;  3A01 B;  5EYR A;  1D5Y A;  1LE8 A;  2NVX J;  5K58 A;  4M3F A;  3JRG A;  1QRY A;  4Y7N J;  3TED A;  1AKH B;  3S16 J;  2VUM J;  2NP3 A;  1HF0 A;  2K9Q A;  2XPW A;  4MFD A;  4J19 A;  2LTP A;  2DTZ A;  3NAR A;  1ZGW A;  2H1K A;  3BR1 A;  2EZI A;  3I4N J;  5DTD A;  2WGB A;  3QKX A;  1G2H A;  3S1M J;  5C4X J;  2YVE A;  1LE8 B;  3DPJ A;  4ME9 A;  3ZQC A;  3PO2 J;  3H0G J;  3JRB A;  1MSF C;  2KDZ A;  3LNQ A;  2EZK A;  1GV5 A;  2Y9Z A;  1JUM A;  3GTM J;  2QF7 A;  3LWJ A;  3BNI A;  2XPV A;  4MXM A;  1JT6 A;  3G7R A;  3WHB A;  1PUF A;  3BTC A;  3JRE A;  3P9T A;  4IHV A;  1OCT C;  1MSE C;  3ZQF A;  2M2E A;  2L7Z A;  4GCL A;  2Y31 A;  4BY1 J;  3AQT A;  2G7S A;  4PXI A;  1R9T J;  2UXH A;  4AC0 A;  1RKW A;  3BTL A;  4DZJ A;  5FLV A;  5M5W J;  1TWH J;  4A69 C;  3PAS A;  5CXG A;  3VUQ A;  3B6A A;  1CQT A;  1S7E A;  2ME6 A;  2W48 A;  2O8K A;  2UXU A;  1P7I A;  2L0K A;  3K7A J;  1EF4 A;  1ETK A;  1GVD A;  1I50 J;  2GFN A;  3T6N A;  2O9L A;  2YUS A;  5EG0 A;  4A3F J;  1FEX A;  3QBM A;  2IEK A;  3JRA A;  3FIS A;  1IV6 A;  1IRZ A;  3BJB A;  3HIM A;  2LP0 A;  2RAE A;  4CYC A;  3COL A;  3CMY A;  5IP6 A;  4BKX A;  3VIB A;  4M6V A;  5HBU A;  2ZB9 A;  3JRC A;  2R5Z B;  1NK2 P;  4MK6 A;  4JL3 A;  3BG3 A;  2E2I J;  4AF5 A;  2DA6 A;  1RR7 A;  3UKG A;  2VKV A;  3EUP A;  2E19 A;  2JK3 A;  5EFY A;  3PPB A;  2VPR A;  1HOM A;  2CUF A;  1I6H J;  4IEJ A;  2EZL A;  3HOU J;  2DA5 A;  2LKX A;  2DA7 A;  4M3D A;  4A3D J;  1OFC X;  4RBO A;  5EG0 B;  2VI6 A;  3BR5 A;  4XRM A;  2R7Z J;  2R5Y B;  1WH7 A;  3SDG A;  4DZP A;  3S15 J;  2QOP A;  4G12 A;  4S0H B;  1H88 C;  2JA5 J;  2MG4 A;  2EBI A;  2UXP A;  1JGG A;  1APL C;  2HDD A;  2ID3 A;  1B72 A;  2MGQ A;  2R92 J;  2CQX A;  3BR2 A;  3NXC A;  3BQZ A;  4V2F A;  5FKK A;  5CW8 A;  2DMN A;  3OSF A;  3PM1 A;  4ACI A;  1H8A C;  2DMT A;  4DYR A;  1ENH A;  3FK7 A;  3GTO J;  1JUP A;  1Z0X A;  3JRF A;  1YRN B;  3C07 A;  2M0C A;  1X2N A;  1K83 J;  5J3L A;  3Q3S A;  2DA2 A;  2ZOZ A;  4M3B A;  4FIS A;  1ETX A;  5M5Y J;  1T56 A;  2ME0 A;  3FK6 A;  4UUT A;  1T33 A;  4IHW A;  3S1N J;  1ETY A;  3GTQ J;  2DMP A;  2ZCX A;  3C2B A;  4C3J J;  3GEU A;  3FKI J;  3HOZ J;  1MBG A;  3VW0 A;  4HNV A;  3PO3 J;  4XRS A;  2QIB A;  2FX0 A;  5FLM J;  1TWG J;  3RZD J;  3AQS A;  3KNW A;  3ON2 A;  4MO7 A;  4W1U A;  1LFB A;  4MLO A;  3DCF A;  3LSJ A;  5FKM A;  4LOC A;  2GM4 A;  4D7M A;  2QWT A;  2FJ1 A;  1U9O A;  1WH5 A;  1U8B A;  1FTT A;  4L62 A;  2OER A;  1RPW A;  5AQC A;  2O7O A;  2JJ7 A;  3HTH A;  2LK2 A;  2DG8 A;  3QPS A;  2XSD C;  3HGY A;  2GLO A;  2XGE A;  3OOU A;  3O60 A;  2K9N A;  1MBK A;  4DYC A;  1JUS A;  2UXO A;  5FKO A;  1BW5 A;  4QSH A;  3BR6 A;  3F0C A;  2G7L A;  1Q1V A;  3EGQ A;  3VW2 A;  4FE4 A;  4A3J J;  4L5E A;  3IV5 A;  1GUU A;  3O8G A;  3NAU A;  1GT0 C;  2K9S A;  2QTQ A;  2OI8 A;  2DA1 A;  3G1L A;  4W97 A;  5DAJ A;  1TWC J;  2XPU A;  3BG5 A;  3M3Y J;  1X58 A;  2RAS A;  2WUI A;  2ZCM A;  3S1Q J;  1O4X A;  2Y9Y A;  3BR0 A;  2CU7 A;  3DEW A;  3HKZ N;  3HTJ A;  5J1U A;  1ETW A;  4MIM A;  5IP7 J;  2REK A;  1WCM J;  1XS9 A;  5GPC A;  4GCT A;  2HXO A;  3BTI A;  3VVY A;  2R5Z A;  2CQQ A;  1MNM C;  3B81 A;  2LR8 A;  4NDL A;  5E3N A;  1K61 A;  1GDT A;  1MH4 A;  3VW1 A;  3QPL A;  3GTG J;  5J1Y A;  2N8G A;  3KKD A;  9ANT A;  3MNL A;  1VFC A;  2P81 A;  4V2G A;  3BRU A;  5D18 A;  2XB0 X;  3RZO J;  4UDS A;  4B1R A;  2M8G X;  2R5Y A;  3CQZ J;  3CRJ A;  3HE0 A;  5E3O A;  4IHX A;  2JN6 A;  5EF6 A;  2G0E A;  3HBL A;  4I6Z A;  4A3B J;  3S5R A;  3ANG A;  5IYB J;  4X6A J;  1WI3 A;  2FQ4 A;  3HOX J;  3S2D J;  1ITY A;  3IH4 A;  5EZH A;  2RHA A;  2Y30 A;  5F1J A;  2I10 A;  5EZG A;  2YU9 J;  1B8I A;  4JNN A;  3HGG A;  4A93 J;  4DW6 A;  1UG2 A;  1H89 C;  3B6C A;  3CJD A;  3JSJ A;  4A3I J;  4C2M J;  1IG7 A;  1YRN A;  1UMQ A;  2PZ9 A;  1W0U A;  5K7Z A;  2HYJ A;  1RET A;  1W0T A;  3TW7 A;  1SFO J;  4UUS A;  4A3M J;  2COB A;  2NP5 A;  3BT9 A;  2FBQ A;  2JA6 J;  1TWA J;  3HOV J;  3RH2 A;  3VVZ A;  5FKL A;  2YS9 A;  3LSG A;  1ZK8 A;  5CXI A;  3M4O J;  2PBX A;  5EEA A;  5C4J J;  1B8I B;  2L9R A;  1ETV A;  2LFB A;  3S14 J;  5HAW A;  1UHS A;  4B3A A;  2LY9 A;  5FKN A;  2ZOY A;  1GV2 A;  1VF9 A;  3LOC A;  3OSG A;  4BXX J;  4UUS B;  2FD5 A;  2V57 A;  2VKE A;  3GTK J;  1WGX A;  2M9H A;  1HDD C;  3Q0V A;  4RDU A;  4NEL A;  1F36 A;  4AUX A;  4D5C A;  2WB1 N;  5IYD J;  3O8H A;  3A02 A;  2M34 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...