2EH3A

Crystal structure of aq_1058, a transcriptional regulator (terr/acrr family) from aquifex aeolicus vf5
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
171
structure length
171
Chain Sequence
GTKERILEVSKELFFEKGYQGTSVEEIVKRANLSKGAFYFHFKSKEELITEIIERTHKKIISLFEENKEKTPEELLEMFLEVLYREKKVVYIFLFDLLCSEKFRNIYFEKIEDAKRRFEKFLEKHFPSKAEILSEIILGFLRQLILHYVIKEERELPFLKEKLREGLKLIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator
publication title Crystal structure of aq_1058, a transcriptional regulator (TerR/AcrR family) from Aquifex aeolicus VF5
rcsb
source organism Aquifex aeolicus
molecule tags Transcription
total genus 71
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2007-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2eh3A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2eh3A02
3S16J 5AQCA 5FGLA 2DA6A 2HYJA 5CXIA 1X58A 4BY7J 4DZPA 2MGQA 1APLC 1JTXA 3LHQA 3LSJA 1GVDA 3EGQA 5BNGA 1ZKGA 2YS9A 4A93J 2LLKA 3FK7A 1JT0A 3BR6A 4I6ZA 3BG3A 2R5ZA 3HKZN 2WAQN 3A03A 1JT6A 2NVXJ 3C2BA 3WHBA 1DU0A 3VIBA 1ZQ3P 4UDSA 3JRDA 5IYDJ 2M2EA 2G7SA 5FKLA 4C2MJ 2CU7A 3NARA 1GT0C 1GDTA 3W6VA 2XPVA 2TCTA 3BCGA 5D1RA 4M3GA 1WH5A 4A3IJ 3MKLA 5IP9J 5HAWA 3BG5A 2ME6A 1A5JA 2FX0A 3TP3A 2CJJA 1FIPA 1DU6A 2OERA 2ECBA 2H1KA 3PO2J 2UXHA 2AO9A 1X2MA 2KT0A 2LP0A 5J1UA 2PBXA 2XDNA 1AHDP 3ANPA 3HOZJ 4KWAA 5M5XJ 2HDDA 5M3FJ 3E7QA 2NVTJ 3VUQA 2IBDA 4BBRJ 5JLWA 3BR5A 1MBEA 3V6GA 2HKUA 2QKOA 5FKNA 4M3FA 5C4YA 2ZCNA 4A3CJ 2CUFA 3ZQHA 2RHAA 1U9NA 3HIMA 4BXXJ 2O9LA 4MK6A 2ME0A 1ETOA 1HDPA 3IH2A 2RASA 2N8GA 2KDZA 4IHWA 4MIMA 1Q1VA 2QWTA 3S17J 2DG8A 4J19A 5E3OA 1GUUA 3LSRA 3VW2A 3RZDJ 1RR7A 2VI6A 1XC5A 2HOAA 2IEKA 4JX6A 2LD5A 2Y30A 3LJLA 1QVTA 1U9OA 2HI3A 3BTIA 1QPIA 3S14J 4B4CA 4FE7A 1JUSA 3QKXA 1VI0A 4X6AJ 2ZOZA 4A3KJ 4L62A 3VP5A 3I4MJ 1Y1VJ 4NDLA 1QRYA 5IOZA 2XPUA 1TWHJ 3RH2A 3SFIA 1Z0XA 5EFYA 4GCTA 2JN6A 2EQRA 2NS8A 2EZIA 2REKA 2ID3A 3CQZJ 2DA7A 2CRGA 3HEFA 1K61A 4M3BA 2W53A 2WUIA 1MBKA 5K7ZA 4A3GJ 3M3YJ 5C44J 3H3VK 1Y1WJ 4M3DA 5JLXA 1B8IB 2K9QA 3JSJA 3S1RJ 1UG2A 1HCRA 4FE4A 2GBYA 5EDNA 1OFCX 1JKOC 3B6CA 2ZCXA 4MO7A 1JUMA 2HOSA 1TWFJ 1NTCA 4QSHA 5FKMA 1GV5A 1ORKA 5M3MJ 1AKHB 4ME9A 1MSEC 4MFDA 2NP3A 1E3OC 3BQZA 3BHQA 3BR3A 3KZ9A 3OOUA 5F04A 1R9TJ 1JKPC 1JKQC 2DA4A 4NELA 1BW5A 4JL3A 2L9RA 2NS7A 3JRIA 4L5EA 3HDDA 5IP6A 4IHXA 1MBJA 3SDGA 1PUFB 4BBSJ 3PASA 3DCFA 4FTHA 1IJWC 1I6HJ 4AC6A 3A01B 2XSDC 3F1BA 2O8KA 4DYCA 4DW6A 2I10A 4A3EJ 5DAJA 2M8GX 4MXMA 1OCPA 2JA8J 3O8HA 3BR1A 2LVSA 5D18A 2FJ1A 1TC3C 3CCYA 2W48A 4JX4A 1XG1A 2PMZN 1ETYA 1RKWA 1RESA 3BT9A 5E3NA 3FK6A 2DMQA 3VPRA 1AU7A 1D5YA 2DA1A 1JUPA 3JR9A 3ZQCA 2O7OA 2LR8A 2P81A 4ABZA 4W1UA 5M5WJ 1OCTC 3Q0WA 1HF0A 3A02A 3JRBA 2X6OA 3COLA 4ICHA 3P9TA 3JRHA 2VKEA 1WCMJ 5J1YA 2LTPA 3Q0VA 4W97A 3HOXJ 2NVYJ 2MSYA 2OF7A 3MNLA 2WV1A 4BKXA 2IAIA 2DN0A 3G1LA 1MBFA 2JJ7A 4C3HJ 1S7EA 1SFOJ 1ETXA 2ECCA 4MLOA 2JWTA 5F08A 2DMTA 3IH4A 5F27A 4A3DJ 3QPSA 1LE8A 1ZK8A 1G2HA 3HOWJ 2L7MP 3H0GJ 1YRNB 2DA2A 2G7LA 5J1RA 1ITYA 1HOMA 3OSFA 5DS9A 3ON4A 1T56A 3GTQJ 1IC8A 1I50J 5H9TA 1B72B 2IU5A 2GLOA 5EEAA 2H8RA 4QIWN 5IPAA 3QBMA 2L7FP 3OIOA 5C4JJ 1B8IA 3CRJA 3LSGA 3GTJJ 2XRLA 4BY1J 3HTIA 5GPAA 4MFEA 4M6VA 1FIAA 1NK3P 3O60A 2XGCA 2L7ZA 1AKHA 4PXIA 1BW6A 5C3EJ 2DMNA 1ZR2A 1JJ8C 3V78A 1U8BA 4C3JJ 1HDDC 4D7MA 3IH3A 2R93J 3ZQIA 3PO3J 5F0CA 2GM4A 1TWGJ 3HOYJ 5HSZA 3QPLA 4V2FA 1VFCA 3KNWA 5FKOA 3PPBA 4XK4A 2R5YB 3M4OJ 3NI7A 1BA5A 2UXPA 1U78A 3E7LA 2FQ4A 4JKZA 2F07A 1PUFA 4JYKA 3JRCA 9ANTA 1UI6A 2ZB9A 5EZHA 1LE8B 1BJZA 5K7HA 5EG0A 3A01A 1TWAJ 2VKVA 3BR2A 3O8GA 2EZKA 2E2HJ 1LFUP 3SJMA 2Q24A 1ETQA 4DYRA 3VW0A 1JTYA 1X2NA 3RZOJ 1SGMA 1IG7A 3KKCA 4B3AA 2R92J 4Y52J 1TWCJ 1W0TA 3S15J 2E1OA 2NP5A 1RKTA 4LOCA 1IDYA 1RETA 2Y0SN 1WI3A 1A6IA 3WHCA 3RD3A 2E19A 5FLVA 3BR0A 3HGGA 1BL0A 3MN2A 3AQSA 2K9NA 2GUHA 5D19A 4G12A 3TEDA 4XIDA 1ZR4A 4I76A 3GZIA 3F0CA 1P7JA 2Y9YA 1JJ6C 4V2GA 3FISA 5HODA 3VOXA 3C07A 5EYRA 4UUTA 2XB5A 2EZHA 1FTTA 3S1MJ 4XRSG 2G7GA 4ACIA 3ZOBA 5FJ8J 3S1QJ 3BTCA 4RDUA 3VOKA 3NNRA 3ZQGA 4A3JJ 3CJDA 2Y2ZA 2OPTA 2DG7A 3G56A 1RPWA 1YRNA 2QTQA 4NN1A 3JRFA 1MSFC 4EEFG 4GFBA 2FD5A 2JK3A 2OI8A 1ZTRA 5EG0B 2E2IJ 1B72A 3Q0UA 3RQIA 2QOPA 4A3FJ 2JMWA 3VVYA 4XRSA 3GTPJ 2DA5A 2MG4A 3GTKJ 3NRGA 3K2AA 3JREA 3HTHA 3JRAA 3FKIJ 1IUFA 2V57A 3MVPA 3TW6A 2NVQJ 1P7IA 1UI5A 1ETKA 1CQTA 2GENA 3RKQA 2HXOA 4GFKA 4YZEA 4A69C 1EF4A 1H88C 3BQYA 2HXIA 2RAEA 4JX5A 3LOCA 2M34A 2DA3A 5EGOB 2R5YA 3K7AJ 2JA7J 1FEXA 5FHPA 3S2HJ 1MBGA 3ZQFA 4A3LJ 1GV2A 5FMPA 2MW8A 5DTDA 2LFBA 4XRMA 2AHQA 4D5FA 3NXCA 3ON2A 3BTJA 5EF6A 1HLVA 3GEUA 4D7NA 5C4XJ 3Q3SA 2DTZA 3IV5A 1NK2P 3VW1A 1O4XA 4UUSB 3VVXA 3CWRA 3BJBA 5IOYA 4CYCA 1IV6A 4XICA 3HTJA 2LK2A 2CQQA 2CUEA 2TRTA 5IP7J 5K7FA 3BG9A 5IYCJ 4JNNA 3LSPA 2YVEA 2R0QC 2WB1N 3JRGA 5FLMJ 4GCLA 1F36A 3D1NI 1QVUA 1F43A 2B63J 2K40A 3BTLA 4IHVA 2DJNA 2G0EA 3GBGA 1FJLA 3CDLA 3LWJA 1IDZA 4AF5A 2M0CA 3T6NA 5HBUA 4GFLA 3S2DJ 3IUVA 2EBIA 1ETWA 4X1EA 3BNIA 1UMQA 2YVHA 2L0KA 2COBA 4Y7NJ 3L1PA 3ANGA 2QIBA 4DYQA 3HTAA 2DMUA 2VPRA 3TP0A 1K83J 3GTMJ 3S5RA 1WH7A 2Y9ZA 4HKUA 3HM5A 1LFBA 2X9DA 5M5YJ 1H89C 2UXOA 1MNMC 2HYTA 3VVZA 2UXUA 2X48A 5E3MA 4C3IJ 2GFNA 3KKDA 3G1OA 2YU9J 5GPCA 4AYBN 3NPIA 4AC0A 2NX4A 2R5ZB 2QF7A 2DMPA 2WGBA 4A3MJ 2M9HA 4JP0A 3LNQA 3QQAA 2ZOYA 5CW8A 4IHYA 2ELKA 2YUSA 5EZGA 3FRQA 3NAUA 3GTOJ 4D5CA 4M3EA 1T33A 4HNVA 2K9SA 4CYCB 4RBOA 3S1NJ 4IEJA 3OSGA 1ETVA 5F0FA 4A3BJ 2NOGA 4AUXA 3EUPA 3I4NJ 2D5VA 2R7ZJ 1MH3A 1H8AC 2EH3A 2XB0X 5GP9A 1OJLA 1JGGA 3BRUA 1WPKA 2PZ9A 3HBLA 1ZGWA 5EGOA 3DPJA 4B1RA 5K58A 2JA5J 5F1JA 3TW7A 3HOUJ 2ID6A 1FTZA 2CQXA 1W0UA 1XS9A 1JKRC 2XGDA 3HOVJ 2ZCMA 3DEWA 1UHSA 2FBQA 5E3LA 2VUMJ 4S0HB 1MH4A 3PM1A 4UUSA 5CXGA 2JA6J 3UKGA 2XGEA 2D6YA 2E2JJ 1WGXA 2QCOA 3HGYA 3ZQLA 1IGNA 4CGRA 3B6AA 2HOTA 3GTGJ 3G1MA 3B81A 3HE0A 2EZLA 1POGA 5F0HA 2G3BA 3G7RA 2LY9A 1SANA 2XPWA 1IRZA 2UXIA 2O7TA 5FKKA 4QTRA 3GTLJ 1MBHA 1Z77A 5J3LA 3HB9A 2Y31A 4FISA 1ENHA 4FCYA 3CMYA 5IYBJ 1I3QJ 3AQTA 2LKXA 4GCKA 1VNDA 1VF9A 3FIWA 4DZJA 2HQ5A
chains in the Genus database with same CATH superfamily
5FGLA 3OYNA 2HYJA 2UUZA 2Y48A 5E1XA 4DZPA 3IWFA 1APLC 5D5WB 3HTUA 4M74A 2IS6A 2IPQX 3PUFA 2WY7Q 3EGQA 5BNGA 1ZKGA 3W6JB 2DQRA 1MW7A 1JT0A 2L02A 3VB2A 2EIKH 4I6ZA 3BG3A 1SEUA 3HKZN 3MKYB 3L2CA 2FMLA 2NVXJ 3I54A 3WHBA 4BYYA 2FU4A 4M6XA 4EGYA 4C2MJ 3P7NA 2ZBKA 2CU7A 1U6GA 2PJRB 4UNOA 2CW7A 3DF8A 5IP9J 5HAWA 1D1BA 2FF4A 2ME6A 1BI1A 3HL2A 3KZZA 3TDZC 1FMVA 2MLKA 1DP7P 1ZGJA 3CUOA 1E2XA 2ADUA 3S3MA 4IHTA 3PO2J 2UXHA 2XDNA 1AHDP 4CCMA 3HOZJ 3CCRI 3LSMA 2J5PA 3GZ5A 1XSDA 3OYHA 2IBDA 3DEUA 5JLWA 3BR5A 1MKMA 1MBEA 2Q2EA 3JCUC 1FT9A 3V6GA 5FKNA 5JHFA 1BR2A 4MNUA 1W5SA 1PVEA 4BHBA 3HUGB 1I5ZA 2IGOA 3DPUA 2EFNA 2RHAA 5JVGF 1R5ID 3HG9A 1LEBA 1LDKB 3HIMA 2CO5A 2FE3A 1I39A 4BJ6C 2ME0A 2A69F 1J75A 1TLHB 4KDPA 4EJOA 3IH2A 1KU3A 2XAJA 4BUPA 3L2QA 4J19A 5E3OA 2VOPA 1GUUA 3RZDJ 3L7WA 2HOAA 2KIMA 1WRJA 2DDBA 2Y30A 2HQNA 2V26A 3K2ZA 1QVTA 2HVRA 2WBMA 3LJLA 3VSLA 1XMKA 5EEHA 3TKYA 1Z67A 2TDXA 3K1NA 1I1GA 4L62A 1Y1VJ 4HV6A 2XDVA 3M07A 4DJAA 2PI0A 1GXQA 2BY0A 2WV0A 3CMEI 3DPTA 2NS8A 5HLHA 2REKA 2CRGA 1LDJA 3HXLA 3WU1B 5DCMA 1K61A 1VQ4I 1MBKA 5K7ZA 4D0PA 4A3GJ 2W53A 2R7DA 3JSJA 1V5GA 1HCRA 4ZYEA 4FE4A 2GBYA 4RLFA 2L9SA 1D1AA 1UJ8A 1I6XA 1JKOC 2ZCXA 3H9GA 1IN8A 1JUMA 1TWFJ 4I0AA 4BHCA 3GW2A 2FBKA 2MLGA 1W36D 1FYMA 4I7HA 1ORKA 2NP3A 2KJCA 3BQZA 4IRGA 3BR3A 3ZMUA 1S8NA 1DDNA 1K79A 5F04A 1R9TJ 2R7UA 2PFBA 5CKTA 4A12A 4XORA 3PQKA 2ZMEB 3G6EI 4B44A 1IRXA 2ICWG 2VL8A 3I59B 3TDUC 2NS7A 3JRIA 2K4JA 5IP6A 1R7JA 1SD5A 3SDGA 4HYEA 4HF0A 3DCFA 1CGPA 3J80K 2XSJC 3BY6A 1IRFA 2BY1A 1IJWC 4V19K 1WJBA 4RS8A 3S8PA 3P9CA 2CMPA 2YPRA 3ECHA 4G9YA 4DW6A 3PNTA 1YJNI 3ZQQA 5DAJA 2M8GX 1H9TA 5D18A 1TC3C 4IRHA 3CUQA 1ZELA 1XG1A 2IGNA 1YX3A 4Q5SF 5K5OA 3NQOA 2DMQA 2OCCH 1AU7A 2KQRA 2P81A 4ABZA 4W1UA 3IUOA 3VDXA 2O8XA 2STWA 2EINH 2VKEA 4HDUA 3QPTA 4ZDLA 2V7FA 1ZGAA 3PQJA 2LTPA 3GXOA 5K5RA 3MNLA 1DUXC 1TW3A 5LEKA 2F5FA 2ZCWA 2MBFA 1T8IA 3T1BA 4HG2A 4HW0A 1P4XA 2JWTA 4MLOA 5F08A 3IH4A 3QP5A 1YG2A 3T8TA 3QPSA 3SDBA 3BDDA 3MCZA 1ZK8A 2BW3B 1YRNB 1HOMA 2COMA 3K4BA 1D3YA 1OISA 1U5TB 4N0BA 1YTYA 1P92A 2VKHA 3J7AY 2P7CB 4Z6YA 3ZMDA 1FWZA 5H9TA 2M1BA 3OR2C 4QIWN 5JVTA 3SZTA 3OOPA 3RIRA 4PGGA 5E1WA 5C4JJ 1B8IA 3CRJA 3OYMA 3GTJJ 4C2TA 3WU2C 3DBLB 2H09A 2FEZA 4BY1J 1G4DA 4R8HA 5D8KB 5FGMA 3ERMA 2XF7A 3CP2A 4Y15A 5HS9A 1WJFA 5E17F 4BXUA 3BZCA 3O60A 4NQWA 1U8BA 2VKDA 3ZQIA 4BNCA 1ULYA 1TWGJ 4IQ4A 2F2EA 3QPLA 2CG4A 4V2FA 5ICEA 1VFCA 2V79A 5L3BA 4FHTA 2F5VA 2W4SA 3BROA 3E7LA 1FSHA 3TO6A 2P5VA 2NXNB 1FSEA 1PUFA 4CCNA 9ANTA 1UI6A 2ZB9A 2EA4A 3CUQC 5EZHA 3DPLC 3K4MA 4QPQA 2VODA 4OIRF 2M30A 2VKVA 3BR2A 3DU6A 3K1PA 4YG2F 3UNGC 1ETQA 4DYRA 2K9MA 2L3DA 1JE8A 5DV5A 2HS5A 1YX5A 2A3SA 4QWQA 3AAFA 1TWCJ 1IN5A 1VQPI 1OPCA 1X1BA 2X51A 1KQ8A 1A6IA 2RNGA 3GZ6A 1K6YA 2R4GA 2K9NA 2JUGA 1WJAA 5D19A 4B8XA 2VJ5A 3WTVC 1RIOH 1JJ6C 1EJ9A 3FISA 2ZJQF 3C07A 2ZFWA 2EZHA 1CF7B 1W7PD 4UB6C 2AXTC 4RDUA 2CQ7A 3ZQGA 4A3JJ 3I71A 2Y2ZA 2DG7A 2VQHA 3M8FA 3EUAA 3KP4A 4GYIA 1IN7A 2L2OA 3GLLA 3KPHA 2FD5A 2JK3A 3KCCA 2OI8A 2QQAA 1QA6A 4E4HA 4P5OA 3PFIA 3RQIA 1HW5A 4L5JA 2R7RA 2R7XA 4Y3OA 5HS7A 2RQQA 2PEXA 4EJTA 4UUVA 1I27A 2QA4I 2QZ8A 3HTHA 1IUFA 3UR3C 2JPBA 5B66C 1P7IA 3CMAI 1UI5A 4DVYP 3CZ6A 2GENA 3SYTA 2IS4A 1DP3A 2ISZA 3WTXC 2OTJI 4N4NB 3OR1C 2IXSA 3HRMA 2FUG2 4FASD 3Q9VA 3EQLF 3BQYA 4UXNA 3KP5A 1Y56A 4U9NA 4AVZA 2R5YA 3FHZA 3CCLI 3S2HJ 2O3FA 2AHQA 5CYVA 3RTRA 2DK5A 4YRVA 1YO5C 3BTJA 3ON2A 1OLTA 4UV9A 4X0GA 2UZKA 3LSTA 3MFKA 3IV5A 1NK2P 1O4XA 3CP8A 3K0LA 2QKLB 2H27A 4CYCA 1XD7A 4OAYA 4Q48A 4C30A 1IV6A 1W5TA 2CUEA 2XKOA 2F5EA 2LK2A 3I9V2 3BG9A 3ZMVA 2WC2A 5IP7J 5IYCJ 2HDCA 2YVEA 3L2UA 4GCLA 2KFDA 2EV0A 1F43A 2D1HA 2B63J 4IHVA 2ZKZA 3GBGA 3PJRA 1IDZA 2M0CA 3EUHA 3U21A 3T6NA 5ERIA 5HDGA 2C6YA 3S2DJ 4GFLA 3ZMSA 1I1SA 2ISYA 1UMQA 2YVHA 4XR6A 4BE1A 4Z2YA 4II2A 1SFXA 1MMNA 2VPRA 3TP0A 2CH0A 3TOAA 4O5VA 4ASNA 2Y9ZA 2YSRA 3H3ZA 1NG7A 4LD5A 5AIPA 1TZLA 3VVZA 3RYRA 3OYBA 4C3IJ 2GFNA 3M8EA 3ULQB 1MZBA 2YX4A 4AYBN 3RPUD 4YELA 2WGBA 3PNYA 2ZOYA 4NC8A 2GAUA 3K4NA 3QAHA 4KA4A 1K7AA 3ZRGA 4II3A 3ISPA 4IHYA 2PLYA 5EZGA 3AKZA 3MZ8A 3GTOJ 4D5CA 4M3EA 2XV4S 2Z5UA 4K2EA 4CYCB 5FO5A 1XGSA 3DLLF 3LSKA 4A3BJ 1EKEA 2NOGA 2R7ZJ 3MKWB 3SZPA 5F1RA 1MH3A 1R22A 2JVHA 2HPIA 4CCKA 4CH7A 2KJBA 1OYWA 4WXCA 2ACJA 4YEJA 2PZ9A 4P96A 3W2VA 5EGOA 1MMGA 1OMIA 3SFZA 1D0YA 4LB6B 3TW7A 1BIAA 3AG2H 2O03A 3GCMA 2CV0A 4XLPF 3ASOH 3KE2A 2XVCA 3ERED 3M8JA 2ZCMA 3DEWA 1UHSA 2NOJB 4LGWA 3F8FA 3OS0A 4IZZA 3PM1A 3WU0A 4UUSA 3UKGA 1QQIA 2XGEA 2PG4A 2E2JJ 3LAPA 3B6AA 3OYGA 2HOTA 3EUHC 3GTGJ 3AG4H 2RGVA 1N75A 3ZCOA 3FX3A 2KLOA 2ZC2A 1POGA 3H5AA 2G3BA 2EPFA 1YE9A 3MWMA 2IP2A 3ZPLA 3LFKA 2DFFA 4AD9A 3HZJA 4CUGA 5J3LA 4CCLA 3BZ6A 1ENHA 4FCYA 2GOMA 1XSXA 2JVGA 1ZRCA 4P9FA 4B3XA 2LKXA 4IRVA 3KEYA 4EJUA 1JGSA 1SD7A 2BVLA 2F5CA 2V1UA 1FPQA 1DGRM 4A2UA 5AQCA 2DA6A 5K1YA 4RGSA 5ILSA 4M72A 1D8KA 3E6CC 4OAZA 2VASA 5IT9K 1X1DA 3L2VA 3QPHA 1UHMA 4S04A 3I55I 2W24A 2F48A 1LNWA 2YS9A 2A2FX 2LLKA 2XUBA 3V7SA 3BR6A 5DM7F 2R5ZA 4OU0A 3BJ6A 5ED4A 1D0ZA 3C2BA 1KQ9A 5HOOA 2DDAA 3F22A 3AL0B 5FKLA 2HU9A 1JXSA 2XAUA 4ZYDA 2DYSH 1GT0C 1GDTA 3E97A 4ZZDA 1OCRH 4TV7A 2ZY9A 1YW8A 1WH5A 3J80Z 1W7PB 4IX7A 2FX0A 2CJJA 4ENJA 4PJLA 1DU6A 3LSHA 3I64A 2OERA 2H1KA 2R7TA 2AO9A 2LP0A 2KT0A 4I98B 4CO8A 2A07F 3CF2A 1TNSA 1RRJA 4ZDPA 3FMSA 2V6CA 3HPGA 1A35A 5M5XJ 3KETA 2HDDA 2NRAC 2NVTJ 2X6YA 3E7QA 2M4KA 1HW2A 2VC1A 2GIZA 4EJVA 1B1BA 1UZCA 4M3FA 2ZJRF 3E6MA 5C4YA 4MEXF 4A3CJ 2OU2A 4ETSA 3CD6I 2WAEA 2O9LA 2FA5A 3WTWC 3NWTA 4UVAA 3RJPA 4MK6A 3D0SA 2M4GA 4WCGA 1J2XA 1HDPA 2RASA 4F3QA 2N8GA 2KDZA 1Q1VA 5GADJ 3S17J 5H2FC 2DG8A 3VW2A 4H4KC 1XC5A 3K1MA 2ELHA 2LD5A 2B0LA 1QZZA 1OQYA 2HI3A 1L3LA 3S14J 5FFZA 4FE7A 4M9SA 4HX4A 4E7HA 2E1CA 5LRSA 4X6AJ 2ZOZA 2VIXA 4NDLA 3ZR8X 5IOZA 1R23A 2KZGA 1AA7A 1TWHJ 2LDUA 5E1ZB 2IRFG 1EA3A 5ICFA 1UB9A 4QLCU 5EFYA 3FXQA 1TBXA 2Y69H 2R7VA 3E5UA 2EQRA 1IXRC 2EZIA 1OR7A 2HWVA 1IZ1A 3M3YJ 3ZN1A 5C44J 3GFLA 4OWRB 5H6QA 1R49A 5EDNA 1OFCX 4EM2A 2F4OB 1TL8A 1G3SA 4B09A 3EPZA 4I01A 4EQQA 3CO7C 1G59A 1T08B 5LFAA 1UAAA 2K02A 5IY5H 5M3MJ 4MFDA 3RKWA 3BHQA 2PJRA 3LA2A 3HKZA 2JRMA 1LPQA 1IUYA 4YFKF 1R4NB 3C3WA 2IS2A 1FOXA 3OS2A 4NELA 1SVLA 1ZHFA 3HJEA 3NEUA 5J47A 4A3DJ 3HC7A 2W85A 2IA2A 4ANJA 3RKYA 2A6EF 4IQJA 2FNAA 1FBSA 5LBQA 3SEZA 4HSRA 2F4MB 2DBBA 3A01B 2CW8A 2XSDC 2O8KA 2E35A 2I10A 1E3HA 3ZMTA 1O57A 2A68F 2BOLA 4E6KG 2DI3A 3S93A 4MXMA 3HPHA 2JRTA 2QBYB 3N05A 3BR1A 2LVSA 3O8HA 2FJ1A 3BLYA 4KT5C 3HUGA 2W48A 4UB8C 1BOBA 4JX4A 3CCEI 1ETYA 2E5NA 2LYCA 2P5LC 1RKWA 1FLIA 1UCRA 4LITA 3BT9A 3M7GA 3FXUA 2CGPA 4XN0A 1D5YA 2DA1A 5HLIA 1WJ5A 1XTAA 2O7OA 3RQ4A 3ZQCA 4RB0A 2HZTA 5M5WJ 2QQBA 3A02A 1VQ7I 5K5QA 2X6OA 4CICA 2QQ8A 3G3ZA 5AONA 2D2WA 1WCMJ 5J1YA 2DK8A 4F92B 2HNHA 3HOXJ 2NVYJ 3OIPA 2OF7A 1G3YA 1L0OC 1A04A 4D1QA 4BKXA 4LG3A 4U0VA 2FOKA 1ETXA 3T5XA 2DMTA 1OR7C 1D0XA 5FD6A 2DO7A 1B9NA 4GYGA 4WXDA 1O3SA 4CHUA 3HOWJ 2L7MP 2X85A 1G2HA 1QPMA 3OSFA 3K69A 1BM9A 4Y13A 1WVRA 3VYTB 2VJIA 1I50J 3G2BA 4A6DA 2IU5A 2CFOA 1EH6A 5IPAA 3H1CA 3QBMA 2L7FP 4RGRA 1U8RA 1R4MB 3R61A 4BXFA 2XGXA 4RB3C 4L9NA 2XRLA 1V5EA 5GPAA 4WXHA 1ZARA 3MAJA 3IKTA 1USTA 1NK3P 2XGCA 2L7ZA 1P9QC 1SAUA 2A05A 4HZFA 2DMNA 4UVBA 1OYIA 1JJ8C 1R1UA 2W57A 4D7MA 2HVQA 3VWBA 3PO3J 2GM4A 3WE2A 5J40A 1PP8F 3LSIA 3KNWA 2HR3A 1MGTA 2E36A 2ZMEA 5FKOA 2FJI1 3PPBA 3LQQA 1AOYA 3I59A 1U78A 2FQ4A 2V9VA 2F07A 2ZNZA 2B3WA 1MDMB 4JYKA 1IF1A 1FOKA 4XBFA 4CXFA 4NC7A 1OCZH 4NBQA 3CDHA 1D1CA 3KX2A 2R7WA 4L9JA 4OIOF 1IN6A 4A0YA 2KP6A 1IG7A 1BBYA 1FOYA 1MNDA 3NRVA 4B3AA 2R92J 4Y52J 4I2OA 1ZREA 3DBHB 1KYZA 3CMMA 2HYGD 5BQTA 2Z99A 3GLXA 4ZYGA 1SMTA 3V8KA 4LOCA 1ZRDA 2E19A 1XGMA 2KRFA 3WGGA 4KN4X 5DD8A 5HDNA 1TT0A 5CPRB 2R7QA 3TEDA 2NS0A 4I99C 1ZR4A 3TBIA 1RUNA 3GZIA 3IHUA 4O6JA 3ABMH 3FXKA 5EYRA 4BGDA 2RN7A 2XB5A 2L4AA 2BVMA 2ZXWH 4XRSG 1U3EM 3JAMZ 4ACIA 1IV8A 1Y6IA 3S1QJ 3BTCA 3T0YA 3NNRA 2X1EA 4E7IA 4B48A 1GXPA 4NUBA 3CJDA 3L2WA 3H92A 4XL9A 1WJDA 2BW3A 1YRNA 3PIPF 3FKJA 1SFUA 3JRFA 4CDGA 4ESJA 3EYYA 3FXJA 1U5TA 2XF5A 3ABTA 4FQGA 3KEOA 3KYCB 5LGNA 3Q0UA 2IS1A 2QOPA 2RVCA 4A3FJ 1J7KA 2FNPA 3F23A 3OYIA 4LB5A 4BJ5C 4XRSA 3GTPJ 2DA5A 3WG7H 2ZFUA 3GTKJ 3JREA 3GWZA 1X1AA 3ABUA 2ZMEC 2EIMH 2IVMA 2VBZA 1G6NA 1OCOH 3F8MA 5A2QZ 1LEAA 2Q0OA 3JSPA 4YZEA 4BQAA 5GTIC 1TNTA 3JW4A 5L3FA 3RKXA 2QWWA 4HX8A 2MD0A 1FEXA 4JK1X 4A3LJ 5DUKA 3ZQFA 4ENMA 5HVQC 2MW8A 2LFBA 4RM2A 3VSKA 4XRMA 2B1EA 1LVAA 5F64A 3GEUA 5ICGA 2DAOA 5C4XJ 2BV6A 3HSRA 3U9GA 2DTZA 2M5WA 3J7ZI 3HRSA 1DGWY 3M9AA 1KGSA 3VVXA 3HOSA 2GA2A 1XPXA 5L3GA 3CWRA 1LQ1A 3BJBA 5IOYA 2KISA 5LHHA 2R0QC 3RYPA 3JRGA 2EIJH 1KU7A 1RI7A 2E60A 2KPMA 2K40A 2P7VB 4HLXA 2VC0A 5DCFA 3LWJA 1YQAA 2D1VA 1QO0D 4CA0A 4CGZA 4AF5A 1T2KA 4OIPF 1FYKA 2HEOA 1ETWA 1Z6TA 3BNIA 2W7NA 3S2WA 2XAGA 2BZTA 1VQLI 1XSVA 5IT9Z 2VE9A 4DYQA 3H36A 2DMUA 1CF7A 1BN5A 3HTAA 1U5TC 3GTMJ 3DU5A 3S3OA 3S5RA 1EV7A 2R7SA 1V55H 1VQ8I 4G7OF 4HKUA 2E5ZA 4KN7X 1LFBA 1H89C 2VQLA 2CWEA 4U7DA 5E3MA 3KKDA 2UXXA 3G1OA 3GZNB 3KEQA 5GPCA 1WWXA 1MJ9A 2DMPA 1KU9A 4JP0A 4IOAF 4C2MA 4XSXF 3CJNA 2M3AA 4N9HA 4E7KA 4XLEA 2NAZA 4BS9A 4HNVA 1S72I 4BEHB 1KYWA 1U0JA 2WA0A 2OAZA 5GTHC 3BJAA 5FRMA 3S1NJ 4IEJA 5KAFC 2QEXI 5F0FA 2DODA 3B73A 5LRRA 4KJZA 3EUKL 3FF5A 4YIIA 1Q1HA 4B43A 4JOMA 3K8PC 1JGGA 3VYRB 2DFIA 3HBLA 1QHHD 4KUMA 1A36A 1ZGWA 1V5FA 4AVPA 3DPJA 3GO5A 3F8NA 3FXMA 2QENA 3E5QA 4XLFA 2CV1A 4XOPA 4L0ZB 1HKQA 4XKVA 5KCMA 3OYKA 5J8FA 3KP6A 4RLQA 3GUDA 4LLNA 1JKRC 2V1DA 1HXDA 2PX9A 4XLHA 1BOAA 3CESA 4PJJA 5E3LA 2MH2A 2VUMJ 4S0HB 3EETA 2HTSA 2JA6J 3L09A 5HNHA 1QGPA 1BI3A 2YX7A 3CCVI 2OZUA 3V7RA 3P9IA 3QU3A 1A31A 2XHKA 1HKSA 1IRZA 2O7TA 2EB7A 2QQ9A 2L5QA 1MBHA 1Z77A 2KKOA 2ZNYA 4G7ZF 5CVRA 4FISA 1O3QA 3CMYA 2AQFA 3LL7A 3WGIA 3AQTA 2K86A 1X3UA 1VF9A 3FMRA 1UHWA 4DZJA 2MYSA 1YS7A 5HNFA 5B1BH 3L00A 4EV0A 2HQ5A 2GOXB 1XCBA 4A5NA 5J6XA 1X58A 4BY7J 1E0EA 2PFVA 4M6YA 2MGQA 3KZYA 2OA4A 3LHQA 3LSJA 4XLAA 1GVDA 2DOEA 2H6CA 1SD6A 3J81Z 1RUOA 3ABLH 4NNJA 3FK7A 3FXLA 2P4WA 1ZN2A 2JQ7A 3F6VA 3CO6C 2WAQN 3C18A 1JT6A 4EM1A 3VIBA 3FBNB 2ZXIA 1ZQ3P 3KLNA 5IYDJ 2M2EA 1ZLJA 3ECOA 2VT3A 3WODF 3NARA 4AYBA 2NNNA 2P6TA 2XROA 4HDVA 2XPVA 1HBXG 5D1RA 4M3GA 2PBIA 4A3IJ 3DEEA 1YYVA 4UV8A 3U1DA 3H3UA 1LFPA 1YI2I 3Q5FA 2PBXA 1X2MA 2W00A 5BS6A 2IJLA 2HVSA 5DDGA 2A61A 3FM5A 2EFQA 3KYLA 1R71A 1X1CA 1VTNC 2YU3A 4I02A 4KWAA 3X2QH 4PSXA 4XOTA 3VUQA 2OTLI 1HA8A 1BI2A 1LDDA 2QKOA 1W36C 1MMSA 3DTKA 5GAEJ 5H6RA 2K7LA 5L3EA 3JAMK 2VXZA 4BXXJ 5J8CA 1J59A 1ETOA 4GCVA 4G94A 4Q4ZF 4DBQA 1X1PA 3E6BA 5HDKA 2AXLA 2MC3A 4MIMA 2A6TA 3OYFA 2IW5A 5KHDA 3CJQB 1X4PA 3LSRA 2OQGA 4CZCA 1RR7A 2V6EA 4JX6A 2EFPA 1VZ0A 1LUJB 4XLNF 4PJMA 2X6XA 1U9OA 1WFXA 1Z6RA 4OOIA 5BOXA 4BAYA 1PP7U 3R6SA 2MD5A 1G8XA 2YR2A 2ZSHB 1JUSA 3QKXA 2YVXA 1Z1DA 1SD4A 3M1CA 2I8DA 5DEQA 1ODDA 3V8LA 2XPUA 4RAZA 3SFIA 1Z0XA 5FFXA 1UELB 2DQLA 2JN6A 5A2QK 4BL0B 4FX0A 5JHUA 2EFOA 2WUIA 5KNLA 3H3VK 1Y1WJ 5JLXA 2K9QA 3S1RJ 1UG2A 1ZG1A 1FX7A 1Y8RB 2HOEA 3GX4X 2RNJA 4HF1A 3B6CA 4MO7A 3HOTA 2V4JC 2HOSA 3MQ0A 2RREA 4G6DA 1AKHB 1GV5A 2Q1ZB 3KIOA 1B4AA 4ME9A 1XMAA 2HYFA 3BPXA 2GXBA 1JKPC 4M9XA 1ZYRF 2FRHA 1W7PA 4JBAA 4RAFA 2O61A 3TGNA 1BW5A 3LA7A 4HV5A 1MMAA 4C9YA 2BHYA 1V3FA 5L3DA 2PMUA 3FXOA 1YLFA 2Z1DA 4IHXA 4NC6A 3N4MA 2W1OA 4PZJA 1MBJA 1R36A 2QYOA 2X1CA 4IF4A 5D4SA 4KISA 2OCEA 4BBSJ 2VQCA 3H9QA 4RMNA 4AIDA 2OJED 2WADA 4FTHA 4IHSA 4AC6A 5DD4A 4CZZA 2PJPA 3F1BA 3OL3A 4DYCA 2VB6A 2HQAA 3A4CA 4HQMA 1OCPA 4EATA 2JA8J 5FRNA 1K78B 1TTYA 5EEGA 2QKMB 3CCYA 1R6RA 2PMZN 2ZO4A 3DKYA 4MHGA 2KIUA 1TT5B 5E3NA 3MEXA 3VPRA 5J4VA 1JUPA 3JR9A 2E71A 2LR8A 2CUZA 2X4HA 1K6OA 3B02A 1YITI 1OCTC 3Q0WA 3CC2I 3JRBA 1R5HA 4ICHA 5H20A 5KAIC 3JRHA 1T6SA 2BYVE 4PGHA 2Z16A 1YIOA 2DN0A 1MBFA 2HDWA 2JJ7A 3K6GA 5GAGJ 3BZKA 4C3HJ 1S7EA 1SFOJ 1Z05A 2CQKA 3CDIA 1QZEA 1R00A 4AWXB 2ZJ2A 4HNUA 3IAM2 2KL4A 3FBIB 4ZZLA 1Z9CA 1LE8A 3H5NA 5DUIA 5ILUA 2GA1A 3NS4A 4GO1A 3RDIA 4MGRA 3FZVA 3ON4A 1T56A 1LVKA 3GTQJ 3FDYA 1IC8A 1KONA 4LIVA 4YIFA 1KU2A 1R1VA 2L9NA 1B72B 2GLOA 1XGOA 5GAHJ 1O3RA 3BP8A 3GFIA 4F7ZA 3AL0C 2DT6A 3OIOA 4LFUA 4RGUA 4CSWA 2K27A 1NG6A 3LSGA 3F9KA 1KA8A 3HTIA 4MFEA 1T39A 3IRQA 1FIAA 4BACA 2L4MA 2VBYA 5C3EJ 4WWCA 1WQ2A 3I3LA 1ZR2A 1LB2A 3V78A 4C3JJ 1HDDC 2R93J 3IH3A 2I5UA 3HRTA 1O7FA 5F0CA 4OIQF 2STTA 3U2RA 5HSZA 4UY8I 2VE8A 3OYEA 4XK4A 2LKSA 4O3MA 4EM0B 4AIJA 1BA5A 2Y75A 3PUBA 3D5RC 4IVNA 4Y4RA 4HF2A 4JKZA 3COAC 1HQCA 3JRCA 1HSTA 3QU6A 1LE8B 1BJZA 5EG0A 3PIOF 3A01A 5TISC 1REPC 2EZKA 2W82A 3ZP5A 2E2HJ 2QLZA 3W6KB 3SJMA 2Q24A 5E20A 1YW9A 4HA8A 1TQPA 4YFNF 2QBYA 3PSIA 3TOBA 5DM6F 1W0TA 1R58A 1F4KA 2E1NA 1P6RA 4HEA2 2NP5A 1RKTA 1FYLA 1WJEA 3I58A 3OWTA 3QOPA 5BMZA 2W84A 3ESWB 3RD3A 4U88A 5LD2C 5FLVA 3BR0A 3HGGA 4U7BA 1BL0A 2ZSIB 1E3PA 5L3CA 2BGCA 4G12A 4XLCA 4A6EA 4XIDA 2V9PA 3JTGA 3F0CA 2LNBA 3J81K 2V9KA 5CVUA 2VJJA 4MEYF 3KFWX 2FBHA 3VOXA 1OKRA 2H94A 1P2FA 2G7GA 3S1MJ 3BPVA 3ZOBA 3SHFA 1ON2A 1ZG5A 3VOKA 1QNTA 2HFHA 2MA3A 3KP3A 4ZC3A 5BPDA 1S5LC 3PSFA 1R5GA 4PJ0C 3G56A 2ESNA 1NHAA 1F9NA 4NN1A 1MSFC 4L18B 4OINF 4GFBA 2BXZA 4E7ZA 2P6SA 3BJOA 2XIGA 5EG0B 3QYBA 1WSUA 2E2IJ 1SVMA 4E7SA 1H9GA 4LG0B 2QUFA 4ENKA 3SXYA 3VVYA 1S7AA 2MG4A 1M1EB 4U87A 2O5RA 4A0ZA 3OY9A 4L9VA 1MIJA 3R4KA 1Y0UA 3NRGA 2MFZA 2E7WA 1GVJA 3AFHA 3DV8A 3IRRA 3MVPA 2NVQJ 3AG1H 2CS3A 4DOZA 1CQTA 4F55A 2HXOA 1FP2A 1XX5A 2G7HA 4MTDA 3OIQA 2DPDA 2KDOA 3K4CA 4KNYA 2CQNA 5CVJA 2QSGX 1H88C 2RAEA 4JX5A 4N4OB 3LOCA 2M34A 2O0YA 1IO2A 2DA3A 2V1NA 3K7AJ 3D5SC 4S05A 1RR8C 2JA7J 1MBGA 5FHPA 2RDPA 1GV2A 3DP7A 5JFRA 1N78A 1HKTA 5FMPA 2OBPA 1DQUA 5HLTA 4D5FA 1MDMA 4C2UA 3O6BB 1TP4A 4WX9A 3Q3SA 5TGTA 1I3AA 2MABA 5B3SH 4LMYA 3JTHA 4NB5A 4P1WA 3TO9A 3K70C 2IA0A 2JA2A 4LJZF 4IOCF 1IRGA 1KZHA 3DTIA 3NWSA 3HTJA 2CQQA 2EV6A 3I4PA 2JZYA 1IXCA 3EDPA 4KICA 4M73A 2WB1N 5FLMJ 1F36A 4HSTA 4XONA 3G4SI 3D1NI 2BEOA 2F4IA 1PJRA 2JTVA 3BTLA 1OYYA 2G0EA 1FJLA 4IXAA 1X19A 3WTUC 4EMSA 1X4OA 3ELKA 3RI4A 3A0BC 2G9WA 2L0KA 1FP1D 4Y7NJ 3OYCA 2W25A 2NVUB 5D8LB 3WTTC 1T98A 2K4BA 3L2RA 2HZDA 3HIFA 4PFOA 3K4KA 1K83J 4LK0F 3I5UA 1WH7A 4GRIA 5LGUA 4WF2A 1J9IA 3QYEA 2VLAA 2X9DA 3LA3A 4HBLA 1MNMC 4LLGF 2UXUA 2WWYA 2X48A 3BG7A 3N97A 2YU9J 1N25A 4EVIA 1ZH5A 3J7AO 2ELJA 3BC8A 1IW7F 4A3MJ 2M9HA 3LNQA 3LQRA 3QQAA 3KP7A 1YS6A 4MQ9F 1YW7A 2XAFA 3FRQA 4PUSA 3NAUA 3BWGA 3M1EA 4BH9A 3VEPA 4RBOA 3OSGA 2K9LA 2VBXA 1R1TA 3A0HC 5FD5A 1SFKA 3C2GA 3CC7I 1BC7C 1K4SA 3I4NJ 5E8IA 1SVOA 2XAHA 1H8AC 1LJ9A 4P55A 3OYJA 3QODA 3RCOA 4RM3A 5GP9A 2XC7A 3MMYB 1OJLA 3DBRB 1WI9A 1XDSA 3BRUA 1WPKA 2LY1A 2PMHA 3GFJA 2KRHA 4Y17A 3AG3H 5LLQA 5F1JA 2JA5J 2FBIA 2Q2EB 2F6CA 3HOUJ 2CQXA 3I53A 4EJWA 1T38A 3A1YA 3TMOA 1W0UA 4N9IA 2B7EA 3HOVJ 3BG6A 2IA1A 4F91B 2VJ4A 5CXGA 1HW1A 2E34A 2QCOA 3HGYA 3ZQLA 1IGNA 2UXNA 2DPUA 4HRIA 4CGRA 3DLAA 3ML6A 3WGHA 2DFHA 3K4JA 5LEJA 3P5JA 3HE0A 2ZXHA 5F0HA 2R7OA 2M0MA 4XSZF 3G7RA 5FLXK 5FKKA 3W2AA 1J09A 5ICCA 4QTRA 3LWFA 4J00A 3CCQI 3HB9A 3VOEA 4XM3A 5HS8A 1VQNI 3C2HA 2ETHA 1G3TA 2L54A 2HTJA 1VNDA 1B59A 3FIWA 2A6HF 2LSOA 1V4RA 4G8XA 2CW0F 2VPLA 3S16J 5CXIA 2F5DA 4F52A 2JSPA 3H0DA 2H6BA 2XF6A 1JTXA 5CVIA 3K4LA 5DCMB 3PL8A 4H0EA 4HX7A 4E7LA 4A93J 2BXYA 2BY2A 5B1AH 1RNLA 3TL4X 3A03A 3S32A 1DU0A 2H1LA 4UDSA 3VODA 3JRDA 1Z7LA 1V54H 2G7SA 4DQ2A 2EV5A 4BEHA 1HSJA 4U0YA 1ZRFA 3OYDA 1BC8C 3EYIA 3W6VA 2FXAA 1EH7A 1S3JA 2TCTA 3BCGA 3CCUI 1D8JA 3DQVC 1PYVA 3IKVA 3MKLA 3CC4I 3BG5A 1A5JA 1YJ9I 2MH9A 3TP3A 1FIPA 2PN6A 5E18F 4ZTJA 1QBJA 2ECBA 2DT7B 5J1UA 2DLLA 2VQGA 3K9TA 3ANPA 2E1MB 2Z2SB 3F72A 2Y0MA 1FMWA 5M3FJ 3ZQ7A 2BY3A 3ASNH 4BBRJ 2K85A 2EWNA 2LF7A 2XASA 2HKUA 3OV8A 3U1KA 3CJRB 4LIUA 2LREA 2ZCNA 2L01A 3CUQB 2CUFA 3ZQHA 1UG0A 5ILVA 1U9NA 3DTEA 1A6QA 3I56I 1Z91A 4LK1F 3K10A 2Q8KA 2V1XA 4WIBA 5D5VB 1B9MA 3FMQA 4IHWA 1SC7A 5CQGA 4UVCA 2QWTA 3I0TA 1MJAA 1XCVA 2E1MC 2VI6A 3SWHA 1ZG3A 2IEKA 5FROA 1N77A 1ERDA 2A5WA 2X0LA 3HSFA 2K5CA 3E0JB 3ZN0A 1FOWA 1MNEA 3BTIA 2AQEA 1QPIA 2NYXA 4B4CA 5JI6A 4XKCA 1J5YA 4OMZA 2A5YB 4E7JA 1VI0A 1Y39A 5IT3A 4A3KJ 2GQQA 1W4MA 3VP5A 4RA2A 3I4MJ 2OQRA 1QRYA 2DT5A 3SZGA 4ZH4F 4ZDOA 3RH2A 2DYRH 3CTAA 3KYDB 3QYFA 4ON0A 2K3PA 4GCTA 3E6DA 4DIQA 2VT2A 2LMDA 2M45A 4Q47A 2ID3A 3CQZJ 2DA7A 2WTEA 3HEFA 3S3NA 4M3BA 1J0RA 2CSOA 4BE2A 5EJCA 4M3DA 3HYIA 1B8IB 3F21A 4R1HA 4L0YB 1DPUA 5AIQA 1FZPB 1RC9A 1PUEE 2LRDA 2IGKA 2KMUA 1C0WA 4P9UA 3F8BA 4PDKA 1NTCA 2LBFA 4QSHA 5FKMA 4D9JA 4HQEA 1MSEC 4NQWB 1E3OC 4A5MA 3KZ9A 4AIKA 1Z7UA 2WAQA 3OOUA 3L9FA 3PFYA 1Y0NA 2RKHA 2M8EA 5DYMA 1JKQC 2DA4A 4IKFA 3IAS2 1MD0A 4BE0A 1JHFA 4XMYA 4OD5A 4JL3A 3DFGA 2OD5A 1E17A 2L9RA 1YJWI 3DKWA 3FWEA 4L5EA 4GXOA 3HDDA 3LMMA 3CLOA 1Z21A 3GEZA 1W1WE 5J4YA 1PUFB 3PASA 4IPAA 3WG9A 1S29A 1I6HJ 2K3FA 2GZWA 4DNCA 4AIHA 1VQMI 4KFCA 4A3EJ 1S7OA 2EK5A 2FQ3A 1Y8QB 2M7BA 4ENNA 2LY2A 3IC7A 1YOVB 2OUMA 4LLLA 3VFZA 2DOFA 3LFUA 4KITB 1RESA 3BCBA 5CVVA 3FK6A 4U0WA 3IP4B 3CCMI 3ROUA 2Z3YA 2OV7A 1D5VA 3RSNA 1HF0A 2HGCA 1USSA 3COLA 2LBFB 3P9TA 2DW4A 2VOOA 4IJAA 3KLOA 3W3CA 4DBRA 3Q0VA 4W97A 4CYDA 4RB1A 2MSYA 2WV1A 1W5CC 2X1DA 4PJNA 2O6GE 3GYHX 1Z3YA 2IAIA 1LKXA 3G1LA 2VONA 1S9HA 2DOAA 5F6FA 2FMYA 2HQRA 1STZA 1WJCA 1ZAOA 3H9JA 2M7AA 5CQEA 2ECCA 1QZYA 1OCCH 5KK1A 3CCSI 1K4TA 5F27A 1VQKI 3H35A 3F3XA 2VN2A 2IGMA 4DGWB 4ZJZA 1B6AA 2G7LA 3H0GJ 2DA2A 5J1RA 1ITYA 3QRFF 2HKXA 4PCQA 3TQNA 5DS9A 4BQQA 1BR1A 2DCEA 1T95A 2UWMA 1JI8A 2H8RA 5EEAA 2CYYA 4PK4A 1YHQI 3VTIA 1TQIA 2DTRA 2QSFX 1U2WA 2OZ6A 1AWCA 4YIRX 4RAGA 4F93B 2CV2A 4XKWA 2JUCA 4KMFA 3BCAA 4M6VA 5D6FA 1X3ZB 2P8TA 1AKHA 4PXIA 2Y0SA 3CLQA 1BW6A 4HOBA 4KMUX 1FNNA 4M9ZA 2DXIA 1SMYF 4G7HF 4BHPA 2HKOA 4RB2C 4J01A 5B5EC 1ON1A 4M71A 3HOYJ 2AS5F 5BPIA 3ZGKA 6PAXA 1FBQA 2R5YB 3M4OJ 3NI7A 2BBYA 3F8CA 2UXPA 2R3SA 4NHJA 3DWLE 1IAWA 2BHZA 5FB2A 3MZHA 3P9KA 4KIFA 4A0XA 4ZYAA 2RC4A 4L5IA 5K7HA 1F5TA 1TWAJ 3O8GA 4EGZA 2DU9A 5E79C 1LFUP 3E1SA 2RV8A 3C1DA 4U9LA 2KIFA 3VW0A 1JTYA 1DPRA 1X2NA 2EFWA 3RZOJ 1SGMA 1K78A 3KKCA 2X6WA 3S15J 2E1OA 4MQVA 2JSCA 2P0WA 2KHMA 1GHCA 3K70D 1IDYA 1RETA 2Y0SN 1WI3A 3WHCA 1BIBA 4ITVA 1NH3A 3V7CA 3MN2A 3CCJI 3R0JA 3AQSA 2GUHA 2PMZA 5JR3A 2LF8A 3ZXSA 1UFMA 3DKXA 4I76A 1P7JA 3OS1A 2Y9YA 4HLYA 1YIJI 3ONQA 4V2GA 2HPMA 5HODA 4KIGA 4UUTA 1FTTA 2XKPA 2JT1A 5E8GA 3V8JA 2LG4A 5FJ8J 1RZ4A 4L9TA 3OMYA 5CLSA 3R60A 2QGUA 3VYSB 5LHGA 3O3KA 3GF2A 2L7KA 2OPTA 2NNYA 1XDUA 1ONVA 1RPWA 2QTQA 2CFXA 2FOWA 3FM3A 4ZYHA 4FT8A 3E3VA 1ZLKA 4EEFG 2WY8Q 1ZTRA 1FY7A 1B72A 3GFMA 2VBWA 3SEQA 4B47A 3QP6A 2LKPA 2JMWA 2LC2A 2L9VA 4BDYA 1BR4A 4IRIA 3K2AA 3GVAA 1TW2A 3V42A 2BE5F 3JRAA 3WE3A 3FKIJ 3HRUA 2V57A 1XGNA 1VQ9I 3TW6A 3J7YJ 3O2PE 4CCJA 1ETKA 3CJTB 4HAMA 3RKQA 3R0AA 4MTEA 4GFKA 4YFXF 4PFPA 3MZYA 4XRFA 4A69C 2Z9OA 4BU2A 4I0BA 1EF4A 1MMDA 4FX4A 2HXIA 5TJJA 2EILH 5EGOB 2LH9A 5LGTA 1QU3A 4BQNA 3VYUB 5DTDA 3OL4A 3QOEA 3NXCA 5EF6A 1HLVA 4G6QA 4D7NA 1YFHA 3PNVA 3REOA 2WAFA 1F1ZA 1EH8A 1O3TA 4I09A 5D6EA 3HSEA 2IT0A 1T0FA 3VW1A 5TRDA 3HHHA 4OD4A 3Q9SA 4UUSB 1SAXA 2P5KA 4HNTA 2UV1A 3F6OA 5FLXZ 4WK8F 4XICA 5K7FA 2TRTA 4JNNA 3ABKH 4IL6C 3V4GA 3LSPA 3A2KA 1WKMA 5CJ9A 2VXDA 1QVUA 2QM3A 4BDZA 2M87A 3QWLA 4RGXA 4AU7A 4R79A 2XRNA 2DJNA 3KP2A 4GDFA 2MC4A 3CDLA 2DJIA 1MJBA 5HBUA 1XB4A 3IUVA 2EBIA 4E70A 1XN7A 5D5UB 4X1EA 4CCOA 5D5XB 2COBA 3L1PA 3ANGA 2QIBA 1S6LA 3E5XA 2Z33A 1FBUA 3WTYC 4GGGA 2ZJPF 2R7FA 2LOOA 2B9SA 3HM5A 1VQ6I 3FHNA 1GLNA 3WTSC 3SQNA 5M5YJ 2UXOA 2HYTA 1JHHA 2XAQA 3GMEA 2CUJA 3NPIA 4UHTA 1BJAA 3D5LA 4AC0A 4IO9F 2NX4A 2R5ZB 2E7XA 2QF7A 4XKBA 3RPUA 3FXRA 4LG0A 4ZTFA 3G71I 5CW8A 2ELKA 2YUSA 3CF5F 4XNFA 1P4WA 4FETA 1WHUA 2GXGA 1T33A 2K9SA 1ETVA 2H8WA 4HPQA 1VQ5I 3OYAA 2DFEA 3HTSB 1IN4A 2KZVA 5HLGA 4AUXA 1P4AA 3HHGA 3JSOA 2KIQA 3EUPA 1X3WB 1G3WA 2ESHA 4JQFA 2D5VA 2GXAA 5D4RA 3W2WA 2EH3A 2XB0X 1O7LA 1WZ2A 1FC3A 4QPOA 2EJRA 4KYWA 4RAYA 3KZIC 2KRCA 2PQ8A 3MD2A 4B1RA 1TQMA 3LAJA 4XN3A 5K58A 2OC6A 1T0FC 3DXJF 2ZXJA 2ID6A 1FTZA 4KT6A 4Y33A 5KVRA 2G7UA 3C7JA 1XS9A 5LHIA 4PSWA 3IWZA 1ACIA 2XGDA 2FBQA 1MH4A 2GWRA 4BJTA 4ESFA 3IL2A 1QHGA 4BQOA 2EA2A 2JPCA 1WGXA 2D6YA 4AM3A 1IXSB 3MKZA 3ZMZA 4XQFA 3G1MA 3B81A 1VQOI 1SFEA 2EZLA 4ESBA 3G73A 3H5RA 3WTZA 1HC8A 2LY9A 2FSWA 1SANA 2XPWA 3TO7A 2UXIA 4KIBA 2QSHX 1Z3XA 3GTLJ 3RPQA 3T8RA 2D45A 1BI0A 1XMXA 2RQPA 2GIVA 2Y31A 2WB1A 1KQ0A 4OMYA 5IYBJ 1I3QJ 1H0MA 2J5OA 2QVOA 3OYLA 1PDNC 4GCKA 4G6TB 3BOQA
chains in the Genus database with same CATH topology
3S16J 5AQCA 5FGLA 2DA6A 2HYJA 5CXIA 1X58A 4BY7J 4DZPA 2MGQA 1APLC 1JTXA 3LHQA 3LSJA 1GVDA 3EGQA 5BNGA 1ZKGA 2YS9A 4A93J 2LLKA 3FK7A 1JT0A 3BR6A 4I6ZA 3BG3A 2R5ZA 3HKZN 2WAQN 3A03A 1JT6A 2NVXJ 3C2BA 3WHBA 1DU0A 3VIBA 1ZQ3P 4UDSA 3JRDA 5IYDJ 2M2EA 2G7SA 5FKLA 4C2MJ 2CU7A 3NARA 1GT0C 1GDTA 3W6VA 2XPVA 2TCTA 3BCGA 5D1RA 4M3GA 1WH5A 4A3IJ 3MKLA 5IP9J 5HAWA 3BG5A 2ME6A 1A5JA 2FX0A 3TP3A 2CJJA 1FIPA 1DU6A 2OERA 2ECBA 2H1KA 3PO2J 2UXHA 2AO9A 1X2MA 2KT0A 2LP0A 5J1UA 2PBXA 2XDNA 1AHDP 3ANPA 3HOZJ 4KWAA 5M5XJ 2HDDA 5M3FJ 3E7QA 2NVTJ 3VUQA 2IBDA 4BBRJ 5JLWA 3BR5A 1MBEA 3V6GA 2HKUA 2QKOA 5FKNA 4M3FA 5C4YA 2ZCNA 4A3CJ 2CUFA 3ZQHA 2RHAA 1U9NA 3HIMA 4BXXJ 2O9LA 4MK6A 2ME0A 1ETOA 1HDPA 3IH2A 2RASA 2N8GA 2KDZA 4IHWA 4MIMA 1Q1VA 2QWTA 3S17J 2DG8A 4J19A 5E3OA 1GUUA 3LSRA 3VW2A 3RZDJ 1RR7A 2VI6A 1XC5A 2HOAA 2IEKA 4JX6A 2LD5A 2Y30A 3LJLA 1QVTA 1U9OA 2HI3A 3BTIA 1QPIA 3S14J 4B4CA 4FE7A 1JUSA 3QKXA 1VI0A 4X6AJ 2ZOZA 4A3KJ 4L62A 3VP5A 3I4MJ 1Y1VJ 4NDLA 1QRYA 5IOZA 2XPUA 1TWHJ 3RH2A 3SFIA 1Z0XA 5EFYA 4GCTA 2JN6A 2EQRA 2NS8A 2EZIA 2REKA 2ID3A 3CQZJ 2DA7A 2CRGA 3HEFA 1K61A 4M3BA 2W53A 2WUIA 1MBKA 5K7ZA 4A3GJ 3M3YJ 5C44J 3H3VK 1Y1WJ 4M3DA 5JLXA 1B8IB 2K9QA 3JSJA 3S1RJ 1UG2A 1HCRA 4FE4A 2GBYA 5EDNA 1OFCX 1JKOC 3B6CA 2ZCXA 4MO7A 1JUMA 2HOSA 1TWFJ 1NTCA 4QSHA 5FKMA 1GV5A 1ORKA 5M3MJ 1AKHB 4ME9A 1MSEC 4MFDA 2NP3A 1E3OC 3BQZA 3BHQA 3BR3A 3KZ9A 3OOUA 5F04A 1R9TJ 1JKPC 1JKQC 2DA4A 4NELA 1BW5A 4JL3A 2L9RA 2NS7A 3JRIA 4L5EA 3HDDA 5IP6A 4IHXA 1MBJA 3SDGA 1PUFB 4BBSJ 3PASA 3DCFA 4FTHA 1IJWC 1I6HJ 4AC6A 3A01B 2XSDC 3F1BA 2O8KA 4DYCA 4DW6A 2I10A 4A3EJ 5DAJA 2M8GX 4MXMA 1OCPA 2JA8J 3O8HA 3BR1A 2LVSA 5D18A 2FJ1A 1TC3C 3CCYA 2W48A 4JX4A 1XG1A 2PMZN 1ETYA 1RKWA 1RESA 3BT9A 5E3NA 3FK6A 2DMQA 3VPRA 1AU7A 1D5YA 2DA1A 1JUPA 3JR9A 3ZQCA 2O7OA 2LR8A 2P81A 4ABZA 4W1UA 5M5WJ 1OCTC 3Q0WA 1HF0A 3A02A 3JRBA 2X6OA 3COLA 4ICHA 3P9TA 3JRHA 2VKEA 1WCMJ 5J1YA 2LTPA 3Q0VA 4W97A 3HOXJ 2NVYJ 2MSYA 2OF7A 3MNLA 2WV1A 4BKXA 2IAIA 2DN0A 3G1LA 1MBFA 2JJ7A 4C3HJ 1S7EA 1SFOJ 1ETXA 2ECCA 4MLOA 2JWTA 5F08A 2DMTA 3IH4A 5F27A 4A3DJ 3QPSA 1LE8A 1ZK8A 1G2HA 3HOWJ 2L7MP 3H0GJ 1YRNB 2DA2A 2G7LA 5J1RA 1ITYA 1HOMA 3OSFA 5DS9A 3ON4A 1T56A 3GTQJ 1IC8A 1I50J 5H9TA 1B72B 2IU5A 2GLOA 5EEAA 2H8RA 4QIWN 5IPAA 3QBMA 2L7FP 3OIOA 5C4JJ 1B8IA 3CRJA 3LSGA 3GTJJ 2XRLA 4BY1J 3HTIA 5GPAA 4MFEA 4M6VA 1FIAA 1NK3P 3O60A 2XGCA 2L7ZA 1AKHA 4PXIA 1BW6A 5C3EJ 2DMNA 1ZR2A 1JJ8C 3V78A 1U8BA 4C3JJ 1HDDC 4D7MA 3IH3A 2R93J 3ZQIA 3PO3J 5F0CA 2GM4A 1TWGJ 3HOYJ 5HSZA 3QPLA 4V2FA 1VFCA 3KNWA 5FKOA 3PPBA 4XK4A 2R5YB 3M4OJ 3NI7A 1BA5A 2UXPA 1U78A 3E7LA 2FQ4A 4JKZA 2F07A 1PUFA 4JYKA 3JRCA 9ANTA 1UI6A 2ZB9A 5EZHA 1LE8B 1BJZA 5K7HA 5EG0A 3A01A 1TWAJ 2VKVA 3BR2A 3O8GA 2EZKA 2E2HJ 1LFUP 3SJMA 2Q24A 1ETQA 4DYRA 3VW0A 1JTYA 1X2NA 3RZOJ 1SGMA 1IG7A 3KKCA 4B3AA 2R92J 4Y52J 1TWCJ 1W0TA 3S15J 2E1OA 2NP5A 1RKTA 4LOCA 1IDYA 1RETA 2Y0SN 1WI3A 1A6IA 3WHCA 3RD3A 2E19A 5FLVA 3BR0A 3HGGA 1BL0A 3MN2A 3AQSA 2K9NA 2GUHA 5D19A 4G12A 3TEDA 4XIDA 1ZR4A 4I76A 3GZIA 3F0CA 1P7JA 2Y9YA 1JJ6C 4V2GA 3FISA 5HODA 3VOXA 3C07A 5EYRA 4UUTA 2XB5A 2EZHA 1FTTA 3S1MJ 4XRSG 2G7GA 4ACIA 3ZOBA 5FJ8J 3S1QJ 3BTCA 4RDUA 3VOKA 3NNRA 3ZQGA 4A3JJ 3CJDA 2Y2ZA 2OPTA 2DG7A 3G56A 1RPWA 1YRNA 2QTQA 4NN1A 3JRFA 1MSFC 4EEFG 4GFBA 2FD5A 2JK3A 2OI8A 1ZTRA 5EG0B 2E2IJ 1B72A 3Q0UA 3RQIA 2QOPA 4A3FJ 2JMWA 3VVYA 4XRSA 3GTPJ 2DA5A 2MG4A 3GTKJ 3NRGA 3K2AA 3JREA 3HTHA 3JRAA 3FKIJ 1IUFA 2V57A 3MVPA 3TW6A 2NVQJ 1P7IA 1UI5A 1ETKA 1CQTA 2GENA 3RKQA 2HXOA 4GFKA 4YZEA 4A69C 1EF4A 1H88C 3BQYA 2HXIA 2RAEA 4JX5A 3LOCA 2M34A 2DA3A 5EGOB 2R5YA 3K7AJ 2JA7J 1FEXA 5FHPA 3S2HJ 1MBGA 3ZQFA 4A3LJ 1GV2A 5FMPA 2MW8A 5DTDA 2LFBA 4XRMA 2AHQA 4D5FA 3NXCA 3ON2A 3BTJA 5EF6A 1HLVA 3GEUA 4D7NA 5C4XJ 3Q3SA 2DTZA 3IV5A 1NK2P 3VW1A 1O4XA 4UUSB 3VVXA 3CWRA 3BJBA 5IOYA 4CYCA 1IV6A 4XICA 3HTJA 2LK2A 2CQQA 2CUEA 2TRTA 5IP7J 5K7FA 3BG9A 5IYCJ 4JNNA 3LSPA 2YVEA 2R0QC 2WB1N 3JRGA 5FLMJ 4GCLA 1F36A 3D1NI 1QVUA 1F43A 2B63J 2K40A 3BTLA 4IHVA 2DJNA 2G0EA 3GBGA 1FJLA 3CDLA 3LWJA 1IDZA 4AF5A 2M0CA 3T6NA 5HBUA 4GFLA 3S2DJ 3IUVA 2EBIA 1ETWA 4X1EA 3BNIA 1UMQA 2YVHA 2L0KA 2COBA 4Y7NJ 3L1PA 3ANGA 2QIBA 4DYQA 3HTAA 2DMUA 2VPRA 3TP0A 1K83J 3GTMJ 3S5RA 1WH7A 2Y9ZA 4HKUA 3HM5A 1LFBA 2X9DA 5M5YJ 1H89C 2UXOA 1MNMC 2HYTA 3VVZA 2UXUA 2X48A 5E3MA 4C3IJ 2GFNA 3KKDA 3G1OA 2YU9J 5GPCA 4AYBN 3NPIA 4AC0A 2NX4A 2R5ZB 2QF7A 2DMPA 2WGBA 4A3MJ 2M9HA 4JP0A 3LNQA 3QQAA 2ZOYA 5CW8A 4IHYA 2ELKA 2YUSA 5EZGA 3FRQA 3NAUA 3GTOJ 4D5CA 4M3EA 1T33A 4HNVA 2K9SA 4CYCB 4RBOA 3S1NJ 4IEJA 3OSGA 1ETVA 5F0FA 4A3BJ 2NOGA 4AUXA 3EUPA 3I4NJ 2D5VA 2R7ZJ 1MH3A 1H8AC 2EH3A 2XB0X 5GP9A 1OJLA 1JGGA 3BRUA 1WPKA 2PZ9A 3HBLA 1ZGWA 5EGOA 3DPJA 4B1RA 5K58A 2JA5J 5F1JA 3TW7A 3HOUJ 2ID6A 1FTZA 2CQXA 1W0UA 1XS9A 1JKRC 2XGDA 3HOVJ 2ZCMA 3DEWA 1UHSA 2FBQA 5E3LA 2VUMJ 4S0HB 1MH4A 3PM1A 4UUSA 5CXGA 2JA6J 3UKGA 2XGEA 2D6YA 2E2JJ 1WGXA 2QCOA 3HGYA 3ZQLA 1IGNA 4CGRA 3B6AA 2HOTA 3GTGJ 3G1MA 3B81A 3HE0A 2EZLA 1POGA 5F0HA 2G3BA 3G7RA 2LY9A 1SANA 2XPWA 1IRZA 2UXIA 2O7TA 5FKKA 4QTRA 3GTLJ 1MBHA 1Z77A 5J3LA 3HB9A 2Y31A 4FISA 1ENHA 4FCYA 3CMYA 5IYBJ 1I3QJ 3AQTA 2LKXA 4GCKA 1VNDA 1VF9A 3FIWA 4DZJA 2HQ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S16 J;  5AQC A;  5FGL A;  2DA6 A;  2HYJ A;  5CXI A;  1X58 A;  4BY7 J;  4DZP A;  2MGQ A;  1APL C;  1JTX A;  3LHQ A;  3LSJ A;  1GVD A;  3EGQ A;  5BNG A;  1ZKG A;  2YS9 A;  4A93 J;  2LLK A;  3FK7 A;  1JT0 A;  3BR6 A;  4I6Z A;  3BG3 A;  2R5Z A;  3HKZ N;  2WAQ N;  3A03 A;  1JT6 A;  2NVX J;  3C2B A;  3WHB A;  1DU0 A;  3VIB A;  1ZQ3 P;  4UDS A;  3JRD A;  5IYD J;  2M2E A;  2G7S A;  5FKL A;  4C2M J;  2CU7 A;  3NAR A;  1GT0 C;  1GDT A;  3W6V A;  2XPV A;  2TCT A;  3BCG A;  5D1R A;  4M3G A;  1WH5 A;  4A3I J;  3MKL A;  5IP9 J;  5HAW A;  3BG5 A;  2ME6 A;  1A5J A;  2FX0 A;  3TP3 A;  2CJJ A;  1FIP A;  1DU6 A;  2OER A;  2ECB A;  2H1K A;  3PO2 J;  2UXH A;  2AO9 A;  1X2M A;  2KT0 A;  2LP0 A;  5J1U A;  2PBX A;  2XDN A;  1AHD P;  3ANP A;  3HOZ J;  4KWA A;  5M5X J;  2HDD A;  5M3F J;  3E7Q A;  2NVT J;  3VUQ A;  2IBD A;  4BBR J;  5JLW A;  3BR5 A;  1MBE A;  3V6G A;  2HKU A;  2QKO A;  5FKN A;  4M3F A;  5C4Y A;  2ZCN A;  4A3C J;  2CUF A;  3ZQH A;  2RHA A;  1U9N A;  3HIM A;  4BXX J;  2O9L A;  4MK6 A;  2ME0 A;  1ETO A;  1HDP A;  3IH2 A;  2RAS A;  2N8G A;  2KDZ A;  4IHW A;  4MIM A;  1Q1V A;  2QWT A;  3S17 J;  2DG8 A;  4J19 A;  5E3O A;  1GUU A;  3LSR A;  3VW2 A;  3RZD J;  1RR7 A;  2VI6 A;  1XC5 A;  2HOA A;  2IEK A;  4JX6 A;  2LD5 A;  2Y30 A;  3LJL A;  1QVT A;  1U9O A;  2HI3 A;  3BTI A;  1QPI A;  3S14 J;  4B4C A;  4FE7 A;  1JUS A;  3QKX A;  1VI0 A;  4X6A J;  2ZOZ A;  4A3K J;  4L62 A;  3VP5 A;  3I4M J;  1Y1V J;  4NDL A;  1QRY A;  5IOZ A;  2XPU A;  1TWH J;  3RH2 A;  3SFI A;  1Z0X A;  5EFY A;  4GCT A;  2JN6 A;  2EQR A;  2NS8 A;  2EZI A;  2REK A;  2ID3 A;  3CQZ J;  2DA7 A;  2CRG A;  3HEF A;  1K61 A;  4M3B A;  2W53 A;  2WUI A;  1MBK A;  5K7Z A;  4A3G J;  3M3Y J;  5C44 J;  3H3V K;  1Y1W J;  4M3D A;  5JLX A;  1B8I B;  2K9Q A;  3JSJ A;  3S1R J;  1UG2 A;  1HCR A;  4FE4 A;  2GBY A;  5EDN A;  1OFC X;  1JKO C;  3B6C A;  2ZCX A;  4MO7 A;  1JUM A;  2HOS A;  1TWF J;  1NTC A;  4QSH A;  5FKM A;  1GV5 A;  1ORK A;  5M3M J;  1AKH B;  4ME9 A;  1MSE C;  4MFD A;  2NP3 A;  1E3O C;  3BQZ A;  3BHQ A;  3BR3 A;  3KZ9 A;  3OOU A;  5F04 A;  1R9T J;  1JKP C;  1JKQ C;  2DA4 A;  4NEL A;  1BW5 A;  4JL3 A;  2L9R A;  2NS7 A;  3JRI A;  4L5E A;  3HDD A;  5IP6 A;  4IHX A;  1MBJ A;  3SDG A;  1PUF B;  4BBS J;  3PAS A;  3DCF A;  4FTH A;  1IJW C;  1I6H J;  4AC6 A;  3A01 B;  2XSD C;  3F1B A;  2O8K A;  4DYC A;  4DW6 A;  2I10 A;  4A3E J;  5DAJ A;  2M8G X;  4MXM A;  1OCP A;  2JA8 J;  3O8H A;  3BR1 A;  2LVS A;  5D18 A;  2FJ1 A;  1TC3 C;  3CCY A;  2W48 A;  4JX4 A;  1XG1 A;  2PMZ N;  1ETY A;  1RKW A;  1RES A;  3BT9 A;  5E3N A;  3FK6 A;  2DMQ A;  3VPR A;  1AU7 A;  1D5Y A;  2DA1 A;  1JUP A;  3JR9 A;  3ZQC A;  2O7O A;  2LR8 A;  2P81 A;  4ABZ A;  4W1U A;  5M5W J;  1OCT C;  3Q0W A;  1HF0 A;  3A02 A;  3JRB A;  2X6O A;  3COL A;  4ICH A;  3P9T A;  3JRH A;  2VKE A;  1WCM J;  5J1Y A;  2LTP A;  3Q0V A;  4W97 A;  3HOX J;  2NVY J;  2MSY A;  2OF7 A;  3MNL A;  2WV1 A;  4BKX A;  2IAI A;  2DN0 A;  3G1L A;  1MBF A;  2JJ7 A;  4C3H J;  1S7E A;  1SFO J;  1ETX A;  2ECC A;  4MLO A;  2JWT A;  5F08 A;  2DMT A;  3IH4 A;  5F27 A;  4A3D J;  3QPS A;  1LE8 A;  1ZK8 A;  1G2H A;  3HOW J;  2L7M P;  3H0G J;  1YRN B;  2DA2 A;  2G7L A;  5J1R A;  1ITY A;  1HOM A;  3OSF A;  5DS9 A;  3ON4 A;  1T56 A;  3GTQ J;  1IC8 A;  1I50 J;  5H9T A;  1B72 B;  2IU5 A;  2GLO A;  5EEA A;  2H8R A;  4QIW N;  5IPA A;  3QBM A;  2L7F P;  3OIO A;  5C4J J;  1B8I A;  3CRJ A;  3LSG A;  3GTJ J;  2XRL A;  4BY1 J;  3HTI A;  5GPA A;  4MFE A;  4M6V A;  1FIA A;  1NK3 P;  3O60 A;  2XGC A;  2L7Z A;  1AKH A;  4PXI A;  1BW6 A;  5C3E J;  2DMN A;  1ZR2 A;  1JJ8 C;  3V78 A;  1U8B A;  4C3J J;  1HDD C;  4D7M A;  3IH3 A;  2R93 J;  3ZQI A;  3PO3 J;  5F0C A;  2GM4 A;  1TWG J;  3HOY J;  5HSZ A;  3QPL A;  4V2F A;  1VFC A;  3KNW A;  5FKO A;  3PPB A;  4XK4 A;  2R5Y B;  3M4O J;  3NI7 A;  1BA5 A;  2UXP A;  1U78 A;  3E7L A;  2FQ4 A;  4JKZ A;  2F07 A;  1PUF A;  4JYK A;  3JRC A;  9ANT A;  1UI6 A;  2ZB9 A;  5EZH A;  1LE8 B;  1BJZ A;  5K7H A;  5EG0 A;  3A01 A;  1TWA J;  2VKV A;  3BR2 A;  3O8G A;  2EZK A;  2E2H J;  1LFU P;  3SJM A;  2Q24 A;  1ETQ A;  4DYR A;  3VW0 A;  1JTY A;  1X2N A;  3RZO J;  1SGM A;  1IG7 A;  3KKC A;  4B3A A;  2R92 J;  4Y52 J;  1TWC J;  1W0T A;  3S15 J;  2E1O A;  2NP5 A;  1RKT A;  4LOC A;  1IDY A;  1RET A;  2Y0S N;  1WI3 A;  1A6I A;  3WHC A;  3RD3 A;  2E19 A;  5FLV A;  3BR0 A;  3HGG A;  1BL0 A;  3MN2 A;  3AQS A;  2K9N A;  2GUH A;  5D19 A;  4G12 A;  3TED A;  4XID A;  1ZR4 A;  4I76 A;  3GZI A;  3F0C A;  1P7J A;  2Y9Y A;  1JJ6 C;  4V2G A;  3FIS A;  5HOD A;  3VOX A;  3C07 A;  5EYR A;  4UUT A;  2XB5 A;  2EZH A;  1FTT A;  3S1M J;  4XRS G;  2G7G A;  4ACI A;  3ZOB A;  5FJ8 J;  3S1Q J;  3BTC A;  4RDU A;  3VOK A;  3NNR A;  3ZQG A;  4A3J J;  3CJD A;  2Y2Z A;  2OPT A;  2DG7 A;  3G56 A;  1RPW A;  1YRN A;  2QTQ A;  4NN1 A;  3JRF A;  1MSF C;  4EEF G;  4GFB A;  2FD5 A;  2JK3 A;  2OI8 A;  1ZTR A;  5EG0 B;  2E2I J;  1B72 A;  3Q0U A;  3RQI A;  2QOP A;  4A3F J;  2JMW A;  3VVY A;  4XRS A;  3GTP J;  2DA5 A;  2MG4 A;  3GTK J;  3NRG A;  3K2A A;  3JRE A;  3HTH A;  3JRA A;  3FKI J;  1IUF A;  2V57 A;  3MVP A;  3TW6 A;  2NVQ J;  1P7I A;  1UI5 A;  1ETK A;  1CQT A;  2GEN A;  3RKQ A;  2HXO A;  4GFK A;  4YZE A;  4A69 C;  1EF4 A;  1H88 C;  3BQY A;  2HXI A;  2RAE A;  4JX5 A;  3LOC A;  2M34 A;  2DA3 A;  5EGO B;  2R5Y A;  3K7A J;  2JA7 J;  1FEX A;  5FHP A;  3S2H J;  1MBG A;  3ZQF A;  4A3L J;  1GV2 A;  5FMP A;  2MW8 A;  5DTD A;  2LFB A;  4XRM A;  2AHQ A;  4D5F A;  3NXC A;  3ON2 A;  3BTJ A;  5EF6 A;  1HLV A;  3GEU A;  4D7N A;  5C4X J;  3Q3S A;  2DTZ A;  3IV5 A;  1NK2 P;  3VW1 A;  1O4X A;  4UUS B;  3VVX A;  3CWR A;  3BJB A;  5IOY A;  4CYC A;  1IV6 A;  4XIC A;  3HTJ A;  2LK2 A;  2CQQ A;  2CUE A;  2TRT A;  5IP7 J;  5K7F A;  3BG9 A;  5IYC J;  4JNN A;  3LSP A;  2YVE A;  2R0Q C;  2WB1 N;  3JRG A;  5FLM J;  4GCL A;  1F36 A;  3D1N I;  1QVU A;  1F43 A;  2B63 J;  2K40 A;  3BTL A;  4IHV A;  2DJN A;  2G0E A;  3GBG A;  1FJL A;  3CDL A;  3LWJ A;  1IDZ A;  4AF5 A;  2M0C A;  3T6N A;  5HBU A;  4GFL A;  3S2D J;  3IUV A;  2EBI A;  1ETW A;  4X1E A;  3BNI A;  1UMQ A;  2YVH A;  2L0K A;  2COB A;  4Y7N J;  3L1P A;  3ANG A;  2QIB A;  4DYQ A;  3HTA A;  2DMU A;  2VPR A;  3TP0 A;  1K83 J;  3GTM J;  3S5R A;  1WH7 A;  2Y9Z A;  4HKU A;  3HM5 A;  1LFB A;  2X9D A;  5M5Y J;  1H89 C;  2UXO A;  1MNM C;  2HYT A;  3VVZ A;  2UXU A;  2X48 A;  5E3M A;  4C3I J;  2GFN A;  3KKD A;  3G1O A;  2YU9 J;  5GPC A;  4AYB N;  3NPI A;  4AC0 A;  2NX4 A;  2R5Z B;  2QF7 A;  2DMP A;  2WGB A;  4A3M J;  2M9H A;  4JP0 A;  3LNQ A;  3QQA A;  2ZOY A;  5CW8 A;  4IHY A;  2ELK A;  2YUS A;  5EZG A;  3FRQ A;  3NAU A;  3GTO J;  4D5C A;  4M3E A;  1T33 A;  4HNV A;  2K9S A;  4CYC B;  4RBO A;  3S1N J;  4IEJ A;  3OSG A;  1ETV A;  5F0F A;  4A3B J;  2NOG A;  4AUX A;  3EUP A;  3I4N J;  2D5V A;  2R7Z J;  1MH3 A;  1H8A C;  2EH3 A;  2XB0 X;  5GP9 A;  1OJL A;  1JGG A;  3BRU A;  1WPK A;  2PZ9 A;  3HBL A;  1ZGW A;  5EGO A;  3DPJ A;  4B1R A;  5K58 A;  2JA5 J;  5F1J A;  3TW7 A;  3HOU J;  2ID6 A;  1FTZ A;  2CQX A;  1W0U A;  1XS9 A;  1JKR C;  2XGD A;  3HOV J;  2ZCM A;  3DEW A;  1UHS A;  2FBQ A;  5E3L A;  2VUM J;  4S0H B;  1MH4 A;  3PM1 A;  4UUS A;  5CXG A;  2JA6 J;  3UKG A;  2XGE A;  2D6Y A;  2E2J J;  1WGX A;  2QCO A;  3HGY A;  3ZQL A;  1IGN A;  4CGR A;  3B6A A;  2HOT A;  3GTG J;  3G1M A;  3B81 A;  3HE0 A;  2EZL A;  1POG A;  5F0H A;  2G3B A;  3G7R A;  2LY9 A;  1SAN A;  2XPW A;  1IRZ A;  2UXI A;  2O7T A;  5FKK A;  4QTR A;  3GTL J;  1MBH A;  1Z77 A;  5J3L A;  3HB9 A;  2Y31 A;  4FIS A;  1ENH A;  4FCY A;  3CMY A;  5IYB J;  1I3Q J;  3AQT A;  2LKX A;  4GCK A;  1VND A;  1VF9 A;  3FIW A;  4DZJ A;  2HQ5 A; 
#chains in the Genus database with same CATH topology
 5FGL A;  3OYN A;  2HYJ A;  2UUZ A;  2Y48 A;  5E1X A;  4DZP A;  3IWF A;  1APL C;  5D5W B;  3HTU A;  4M74 A;  2IS6 A;  2IPQ X;  3PUF A;  2WY7 Q;  3EGQ A;  5BNG A;  1ZKG A;  3W6J B;  2DQR A;  1MW7 A;  1JT0 A;  2L02 A;  3VB2 A;  2EIK H;  4I6Z A;  3BG3 A;  1SEU A;  3HKZ N;  3MKY B;  3L2C A;  2FML A;  2NVX J;  3I54 A;  3WHB A;  4BYY A;  2FU4 A;  4M6X A;  4EGY A;  4C2M J;  3P7N A;  2ZBK A;  2CU7 A;  1U6G A;  2PJR B;  4UNO A;  2CW7 A;  3DF8 A;  5IP9 J;  5HAW A;  1D1B A;  2FF4 A;  2ME6 A;  1BI1 A;  3HL2 A;  3KZZ A;  3TDZ C;  1FMV A;  2MLK A;  1DP7 P;  1ZGJ A;  3CUO A;  1E2X A;  2ADU A;  3S3M A;  4IHT A;  3PO2 J;  2UXH A;  2XDN A;  1AHD P;  4CCM A;  3HOZ J;  3CCR I;  3LSM A;  2J5P A;  3GZ5 A;  1XSD A;  3OYH A;  2IBD A;  3DEU A;  5JLW A;  3BR5 A;  1MKM A;  1MBE A;  2Q2E A;  3JCU C;  1FT9 A;  3V6G A;  5FKN A;  5JHF A;  1BR2 A;  4MNU A;  1W5S A;  1PVE A;  4BHB A;  3HUG B;  1I5Z A;  2IGO A;  3DPU A;  2EFN A;  2RHA A;  5JVG F;  1R5I D;  3HG9 A;  1LEB A;  1LDK B;  3HIM A;  2CO5 A;  2FE3 A;  1I39 A;  4BJ6 C;  2ME0 A;  2A69 F;  1J75 A;  1TLH B;  4KDP A;  4EJO A;  3IH2 A;  1KU3 A;  2XAJ A;  4BUP A;  3L2Q A;  4J19 A;  5E3O A;  2VOP A;  1GUU A;  3RZD J;  3L7W A;  2HOA A;  2KIM A;  1WRJ A;  2DDB A;  2Y30 A;  2HQN A;  2V26 A;  3K2Z A;  1QVT A;  2HVR A;  2WBM A;  3LJL A;  3VSL A;  1XMK A;  5EEH A;  3TKY A;  1Z67 A;  2TDX A;  3K1N A;  1I1G A;  4L62 A;  1Y1V J;  4HV6 A;  2XDV A;  3M07 A;  4DJA A;  2PI0 A;  1GXQ A;  2BY0 A;  2WV0 A;  3CME I;  3DPT A;  2NS8 A;  5HLH A;  2REK A;  2CRG A;  1LDJ A;  3HXL A;  3WU1 B;  5DCM A;  1K61 A;  1VQ4 I;  1MBK A;  5K7Z A;  4D0P A;  4A3G J;  2W53 A;  2R7D A;  3JSJ A;  1V5G A;  1HCR A;  4ZYE A;  4FE4 A;  2GBY A;  4RLF A;  2L9S A;  1D1A A;  1UJ8 A;  1I6X A;  1JKO C;  2ZCX A;  3H9G A;  1IN8 A;  1JUM A;  1TWF J;  4I0A A;  4BHC A;  3GW2 A;  2FBK A;  2MLG A;  1W36 D;  1FYM A;  4I7H A;  1ORK A;  2NP3 A;  2KJC A;  3BQZ A;  4IRG A;  3BR3 A;  3ZMU A;  1S8N A;  1DDN A;  1K79 A;  5F04 A;  1R9T J;  2R7U A;  2PFB A;  5CKT A;  4A12 A;  4XOR A;  3PQK A;  2ZME B;  3G6E I;  4B44 A;  1IRX A;  2ICW G;  2VL8 A;  3I59 B;  3TDU C;  2NS7 A;  3JRI A;  2K4J A;  5IP6 A;  1R7J A;  1SD5 A;  3SDG A;  4HYE A;  4HF0 A;  3DCF A;  1CGP A;  3J80 K;  2XSJ C;  3BY6 A;  1IRF A;  2BY1 A;  1IJW C;  4V19 K;  1WJB A;  4RS8 A;  3S8P A;  3P9C A;  2CMP A;  2YPR A;  3ECH A;  4G9Y A;  4DW6 A;  3PNT A;  1YJN I;  3ZQQ A;  5DAJ A;  2M8G X;  1H9T A;  5D18 A;  1TC3 C;  4IRH A;  3CUQ A;  1ZEL A;  1XG1 A;  2IGN A;  1YX3 A;  4Q5S F;  5K5O A;  3NQO A;  2DMQ A;  2OCC H;  1AU7 A;  2KQR A;  2P81 A;  4ABZ A;  4W1U A;  3IUO A;  3VDX A;  2O8X A;  2STW A;  2EIN H;  2VKE A;  4HDU A;  3QPT A;  4ZDL A;  2V7F A;  1ZGA A;  3PQJ A;  2LTP A;  3GXO A;  5K5R A;  3MNL A;  1DUX C;  1TW3 A;  5LEK A;  2F5F A;  2ZCW A;  2MBF A;  1T8I A;  3T1B A;  4HG2 A;  4HW0 A;  1P4X A;  2JWT A;  4MLO A;  5F08 A;  3IH4 A;  3QP5 A;  1YG2 A;  3T8T A;  3QPS A;  3SDB A;  3BDD A;  3MCZ A;  1ZK8 A;  2BW3 B;  1YRN B;  1HOM A;  2COM A;  3K4B A;  1D3Y A;  1OIS A;  1U5T B;  4N0B A;  1YTY A;  1P92 A;  2VKH A;  3J7A Y;  2P7C B;  4Z6Y A;  3ZMD A;  1FWZ A;  5H9T A;  2M1B A;  3OR2 C;  4QIW N;  5JVT A;  3SZT A;  3OOP A;  3RIR A;  4PGG A;  5E1W A;  5C4J J;  1B8I A;  3CRJ A;  3OYM A;  3GTJ J;  4C2T A;  3WU2 C;  3DBL B;  2H09 A;  2FEZ A;  4BY1 J;  1G4D A;  4R8H A;  5D8K B;  5FGM A;  3ERM A;  2XF7 A;  3CP2 A;  4Y15 A;  5HS9 A;  1WJF A;  5E17 F;  4BXU A;  3BZC A;  3O60 A;  4NQW A;  1U8B A;  2VKD A;  3ZQI A;  4BNC A;  1ULY A;  1TWG J;  4IQ4 A;  2F2E A;  3QPL A;  2CG4 A;  4V2F A;  5ICE A;  1VFC A;  2V79 A;  5L3B A;  4FHT A;  2F5V A;  2W4S A;  3BRO A;  3E7L A;  1FSH A;  3TO6 A;  2P5V A;  2NXN B;  1FSE A;  1PUF A;  4CCN A;  9ANT A;  1UI6 A;  2ZB9 A;  2EA4 A;  3CUQ C;  5EZH A;  3DPL C;  3K4M A;  4QPQ A;  2VOD A;  4OIR F;  2M30 A;  2VKV A;  3BR2 A;  3DU6 A;  3K1P A;  4YG2 F;  3UNG C;  1ETQ A;  4DYR A;  2K9M A;  2L3D A;  1JE8 A;  5DV5 A;  2HS5 A;  1YX5 A;  2A3S A;  4QWQ A;  3AAF A;  1TWC J;  1IN5 A;  1VQP I;  1OPC A;  1X1B A;  2X51 A;  1KQ8 A;  1A6I A;  2RNG A;  3GZ6 A;  1K6Y A;  2R4G A;  2K9N A;  2JUG A;  1WJA A;  5D19 A;  4B8X A;  2VJ5 A;  3WTV C;  1RIO H;  1JJ6 C;  1EJ9 A;  3FIS A;  2ZJQ F;  3C07 A;  2ZFW A;  2EZH A;  1CF7 B;  1W7P D;  4UB6 C;  2AXT C;  4RDU A;  2CQ7 A;  3ZQG A;  4A3J J;  3I71 A;  2Y2Z A;  2DG7 A;  2VQH A;  3M8F A;  3EUA A;  3KP4 A;  4GYI A;  1IN7 A;  2L2O A;  3GLL A;  3KPH A;  2FD5 A;  2JK3 A;  3KCC A;  2OI8 A;  2QQA A;  1QA6 A;  4E4H A;  4P5O A;  3PFI A;  3RQI A;  1HW5 A;  4L5J A;  2R7R A;  2R7X A;  4Y3O A;  5HS7 A;  2RQQ A;  2PEX A;  4EJT A;  4UUV A;  1I27 A;  2QA4 I;  2QZ8 A;  3HTH A;  1IUF A;  3UR3 C;  2JPB A;  5B66 C;  1P7I A;  3CMA I;  1UI5 A;  4DVY P;  3CZ6 A;  2GEN A;  3SYT A;  2IS4 A;  1DP3 A;  2ISZ A;  3WTX C;  2OTJ I;  4N4N B;  3OR1 C;  2IXS A;  3HRM A;  2FUG 2;  4FAS D;  3Q9V A;  3EQL F;  3BQY A;  4UXN A;  3KP5 A;  1Y56 A;  4U9N A;  4AVZ A;  2R5Y A;  3FHZ A;  3CCL I;  3S2H J;  2O3F A;  2AHQ A;  5CYV A;  3RTR A;  2DK5 A;  4YRV A;  1YO5 C;  3BTJ A;  3ON2 A;  1OLT A;  4UV9 A;  4X0G A;  2UZK A;  3LST A;  3MFK A;  3IV5 A;  1NK2 P;  1O4X A;  3CP8 A;  3K0L A;  2QKL B;  2H27 A;  4CYC A;  1XD7 A;  4OAY A;  4Q48 A;  4C30 A;  1IV6 A;  1W5T A;  2CUE A;  2XKO A;  2F5E A;  2LK2 A;  3I9V 2;  3BG9 A;  3ZMV A;  2WC2 A;  5IP7 J;  5IYC J;  2HDC A;  2YVE A;  3L2U A;  4GCL A;  2KFD A;  2EV0 A;  1F43 A;  2D1H A;  2B63 J;  4IHV A;  2ZKZ A;  3GBG A;  3PJR A;  1IDZ A;  2M0C A;  3EUH A;  3U21 A;  3T6N A;  5ERI A;  5HDG A;  2C6Y A;  3S2D J;  4GFL A;  3ZMS A;  1I1S A;  2ISY A;  1UMQ A;  2YVH A;  4XR6 A;  4BE1 A;  4Z2Y A;  4II2 A;  1SFX A;  1MMN A;  2VPR A;  3TP0 A;  2CH0 A;  3TOA A;  4O5V A;  4ASN A;  2Y9Z A;  2YSR A;  3H3Z A;  1NG7 A;  4LD5 A;  5AIP A;  1TZL A;  3VVZ A;  3RYR A;  3OYB A;  4C3I J;  2GFN A;  3M8E A;  3ULQ B;  1MZB A;  2YX4 A;  4AYB N;  3RPU D;  4YEL A;  2WGB A;  3PNY A;  2ZOY A;  4NC8 A;  2GAU A;  3K4N A;  3QAH A;  4KA4 A;  1K7A A;  3ZRG A;  4II3 A;  3ISP A;  4IHY A;  2PLY A;  5EZG A;  3AKZ A;  3MZ8 A;  3GTO J;  4D5C A;  4M3E A;  2XV4 S;  2Z5U A;  4K2E A;  4CYC B;  5FO5 A;  1XGS A;  3DLL F;  3LSK A;  4A3B J;  1EKE A;  2NOG A;  2R7Z J;  3MKW B;  3SZP A;  5F1R A;  1MH3 A;  1R22 A;  2JVH A;  2HPI A;  4CCK A;  4CH7 A;  2KJB A;  1OYW A;  4WXC A;  2ACJ A;  4YEJ A;  2PZ9 A;  4P96 A;  3W2V A;  5EGO A;  1MMG A;  1OMI A;  3SFZ A;  1D0Y A;  4LB6 B;  3TW7 A;  1BIA A;  3AG2 H;  2O03 A;  3GCM A;  2CV0 A;  4XLP F;  3ASO H;  3KE2 A;  2XVC A;  3ERE D;  3M8J A;  2ZCM A;  3DEW A;  1UHS A;  2NOJ B;  4LGW A;  3F8F A;  3OS0 A;  4IZZ A;  3PM1 A;  3WU0 A;  4UUS A;  3UKG A;  1QQI A;  2XGE A;  2PG4 A;  2E2J J;  3LAP A;  3B6A A;  3OYG A;  2HOT A;  3EUH C;  3GTG J;  3AG4 H;  2RGV A;  1N75 A;  3ZCO A;  3FX3 A;  2KLO A;  2ZC2 A;  1POG A;  3H5A A;  2G3B A;  2EPF A;  1YE9 A;  3MWM A;  2IP2 A;  3ZPL A;  3LFK A;  2DFF A;  4AD9 A;  3HZJ A;  4CUG A;  5J3L A;  4CCL A;  3BZ6 A;  1ENH A;  4FCY A;  2GOM A;  1XSX A;  2JVG A;  1ZRC A;  4P9F A;  4B3X A;  2LKX A;  4IRV A;  3KEY A;  4EJU A;  1JGS A;  1SD7 A;  2BVL A;  2F5C A;  2V1U A;  1FPQ A;  1DGR M;  4A2U A;  5AQC A;  2DA6 A;  5K1Y A;  4RGS A;  5ILS A;  4M72 A;  1D8K A;  3E6C C;  4OAZ A;  2VAS A;  5IT9 K;  1X1D A;  3L2V A;  3QPH A;  1UHM A;  4S04 A;  3I55 I;  2W24 A;  2F48 A;  1LNW A;  2YS9 A;  2A2F X;  2LLK A;  2XUB A;  3V7S A;  3BR6 A;  5DM7 F;  2R5Z A;  4OU0 A;  3BJ6 A;  5ED4 A;  1D0Z A;  3C2B A;  1KQ9 A;  5HOO A;  2DDA A;  3F22 A;  3AL0 B;  5FKL A;  2HU9 A;  1JXS A;  2XAU A;  4ZYD A;  2DYS H;  1GT0 C;  1GDT A;  3E97 A;  4ZZD A;  1OCR H;  4TV7 A;  2ZY9 A;  1YW8 A;  1WH5 A;  3J80 Z;  1W7P B;  4IX7 A;  2FX0 A;  2CJJ A;  4ENJ A;  4PJL A;  1DU6 A;  3LSH A;  3I64 A;  2OER A;  2H1K A;  2R7T A;  2AO9 A;  2LP0 A;  2KT0 A;  4I98 B;  4CO8 A;  2A07 F;  3CF2 A;  1TNS A;  1RRJ A;  4ZDP A;  3FMS A;  2V6C A;  3HPG A;  1A35 A;  5M5X J;  3KET A;  2HDD A;  2NRA C;  2NVT J;  2X6Y A;  3E7Q A;  2M4K A;  1HW2 A;  2VC1 A;  2GIZ A;  4EJV A;  1B1B A;  1UZC A;  4M3F A;  2ZJR F;  3E6M A;  5C4Y A;  4MEX F;  4A3C J;  2OU2 A;  4ETS A;  3CD6 I;  2WAE A;  2O9L A;  2FA5 A;  3WTW C;  3NWT A;  4UVA A;  3RJP A;  4MK6 A;  3D0S A;  2M4G A;  4WCG A;  1J2X A;  1HDP A;  2RAS A;  4F3Q A;  2N8G A;  2KDZ A;  1Q1V A;  5GAD J;  3S17 J;  5H2F C;  2DG8 A;  3VW2 A;  4H4K C;  1XC5 A;  3K1M A;  2ELH A;  2LD5 A;  2B0L A;  1QZZ A;  1OQY A;  2HI3 A;  1L3L A;  3S14 J;  5FFZ A;  4FE7 A;  4M9S A;  4HX4 A;  4E7H A;  2E1C A;  5LRS A;  4X6A J;  2ZOZ A;  2VIX A;  4NDL A;  3ZR8 X;  5IOZ A;  1R23 A;  2KZG A;  1AA7 A;  1TWH J;  2LDU A;  5E1Z B;  2IRF G;  1EA3 A;  5ICF A;  1UB9 A;  4QLC U;  5EFY A;  3FXQ A;  1TBX A;  2Y69 H;  2R7V A;  3E5U A;  2EQR A;  1IXR C;  2EZI A;  1OR7 A;  2HWV A;  1IZ1 A;  3M3Y J;  3ZN1 A;  5C44 J;  3GFL A;  4OWR B;  5H6Q A;  1R49 A;  5EDN A;  1OFC X;  4EM2 A;  2F4O B;  1TL8 A;  1G3S A;  4B09 A;  3EPZ A;  4I01 A;  4EQQ A;  3CO7 C;  1G59 A;  1T08 B;  5LFA A;  1UAA A;  2K02 A;  5IY5 H;  5M3M J;  4MFD A;  3RKW A;  3BHQ A;  2PJR A;  3LA2 A;  3HKZ A;  2JRM A;  1LPQ A;  1IUY A;  4YFK F;  1R4N B;  3C3W A;  2IS2 A;  1FOX A;  3OS2 A;  4NEL A;  1SVL A;  1ZHF A;  3HJE A;  3NEU A;  5J47 A;  4A3D J;  3HC7 A;  2W85 A;  2IA2 A;  4ANJ A;  3RKY A;  2A6E F;  4IQJ A;  2FNA A;  1FBS A;  5LBQ A;  3SEZ A;  4HSR A;  2F4M B;  2DBB A;  3A01 B;  2CW8 A;  2XSD C;  2O8K A;  2E35 A;  2I10 A;  1E3H A;  3ZMT A;  1O57 A;  2A68 F;  2BOL A;  4E6K G;  2DI3 A;  3S93 A;  4MXM A;  3HPH A;  2JRT A;  2QBY B;  3N05 A;  3BR1 A;  2LVS A;  3O8H A;  2FJ1 A;  3BLY A;  4KT5 C;  3HUG A;  2W48 A;  4UB8 C;  1BOB A;  4JX4 A;  3CCE I;  1ETY A;  2E5N A;  2LYC A;  2P5L C;  1RKW A;  1FLI A;  1UCR A;  4LIT A;  3BT9 A;  3M7G A;  3FXU A;  2CGP A;  4XN0 A;  1D5Y A;  2DA1 A;  5HLI A;  1WJ5 A;  1XTA A;  2O7O A;  3RQ4 A;  3ZQC A;  4RB0 A;  2HZT A;  5M5W J;  2QQB A;  3A02 A;  1VQ7 I;  5K5Q A;  2X6O A;  4CIC A;  2QQ8 A;  3G3Z A;  5AON A;  2D2W A;  1WCM J;  5J1Y A;  2DK8 A;  4F92 B;  2HNH A;  3HOX J;  2NVY J;  3OIP A;  2OF7 A;  1G3Y A;  1L0O C;  1A04 A;  4D1Q A;  4BKX A;  4LG3 A;  4U0V A;  2FOK A;  1ETX A;  3T5X A;  2DMT A;  1OR7 C;  1D0X A;  5FD6 A;  2DO7 A;  1B9N A;  4GYG A;  4WXD A;  1O3S A;  4CHU A;  3HOW J;  2L7M P;  2X85 A;  1G2H A;  1QPM A;  3OSF A;  3K69 A;  1BM9 A;  4Y13 A;  1WVR A;  3VYT B;  2VJI A;  1I50 J;  3G2B A;  4A6D A;  2IU5 A;  2CFO A;  1EH6 A;  5IPA A;  3H1C A;  3QBM A;  2L7F P;  4RGR A;  1U8R A;  1R4M B;  3R61 A;  4BXF A;  2XGX A;  4RB3 C;  4L9N A;  2XRL A;  1V5E A;  5GPA A;  4WXH A;  1ZAR A;  3MAJ A;  3IKT A;  1UST A;  1NK3 P;  2XGC A;  2L7Z A;  1P9Q C;  1SAU A;  2A05 A;  4HZF A;  2DMN A;  4UVB A;  1OYI A;  1JJ8 C;  1R1U A;  2W57 A;  4D7M A;  2HVQ A;  3VWB A;  3PO3 J;  2GM4 A;  3WE2 A;  5J40 A;  1PP8 F;  3LSI A;  3KNW A;  2HR3 A;  1MGT A;  2E36 A;  2ZME A;  5FKO A;  2FJI 1;  3PPB A;  3LQQ A;  1AOY A;  3I59 A;  1U78 A;  2FQ4 A;  2V9V A;  2F07 A;  2ZNZ A;  2B3W A;  1MDM B;  4JYK A;  1IF1 A;  1FOK A;  4XBF A;  4CXF A;  4NC7 A;  1OCZ H;  4NBQ A;  3CDH A;  1D1C A;  3KX2 A;  2R7W A;  4L9J A;  4OIO F;  1IN6 A;  4A0Y A;  2KP6 A;  1IG7 A;  1BBY A;  1FOY A;  1MND A;  3NRV A;  4B3A A;  2R92 J;  4Y52 J;  4I2O A;  1ZRE A;  3DBH B;  1KYZ A;  3CMM A;  2HYG D;  5BQT A;  2Z99 A;  3GLX A;  4ZYG A;  1SMT A;  3V8K A;  4LOC A;  1ZRD A;  2E19 A;  1XGM A;  2KRF A;  3WGG A;  4KN4 X;  5DD8 A;  5HDN A;  1TT0 A;  5CPR B;  2R7Q A;  3TED A;  2NS0 A;  4I99 C;  1ZR4 A;  3TBI A;  1RUN A;  3GZI A;  3IHU A;  4O6J A;  3ABM H;  3FXK A;  5EYR A;  4BGD A;  2RN7 A;  2XB5 A;  2L4A A;  2BVM A;  2ZXW H;  4XRS G;  1U3E M;  3JAM Z;  4ACI A;  1IV8 A;  1Y6I A;  3S1Q J;  3BTC A;  3T0Y A;  3NNR A;  2X1E A;  4E7I A;  4B48 A;  1GXP A;  4NUB A;  3CJD A;  3L2W A;  3H92 A;  4XL9 A;  1WJD A;  2BW3 A;  1YRN A;  3PIP F;  3FKJ A;  1SFU A;  3JRF A;  4CDG A;  4ESJ A;  3EYY A;  3FXJ A;  1U5T A;  2XF5 A;  3ABT A;  4FQG A;  3KEO A;  3KYC B;  5LGN A;  3Q0U A;  2IS1 A;  2QOP A;  2RVC A;  4A3F J;  1J7K A;  2FNP A;  3F23 A;  3OYI A;  4LB5 A;  4BJ5 C;  4XRS A;  3GTP J;  2DA5 A;  3WG7 H;  2ZFU A;  3GTK J;  3JRE A;  3GWZ A;  1X1A A;  3ABU A;  2ZME C;  2EIM H;  2IVM A;  2VBZ A;  1G6N A;  1OCO H;  3F8M A;  5A2Q Z;  1LEA A;  2Q0O A;  3JSP A;  4YZE A;  4BQA A;  5GTI C;  1TNT A;  3JW4 A;  5L3F A;  3RKX A;  2QWW A;  4HX8 A;  2MD0 A;  1FEX A;  4JK1 X;  4A3L J;  5DUK A;  3ZQF A;  4ENM A;  5HVQ C;  2MW8 A;  2LFB A;  4RM2 A;  3VSK A;  4XRM A;  2B1E A;  1LVA A;  5F64 A;  3GEU A;  5ICG A;  2DAO A;  5C4X J;  2BV6 A;  3HSR A;  3U9G A;  2DTZ A;  2M5W A;  3J7Z I;  3HRS A;  1DGW Y;  3M9A A;  1KGS A;  3VVX A;  3HOS A;  2GA2 A;  1XPX A;  5L3G A;  3CWR A;  1LQ1 A;  3BJB A;  5IOY A;  2KIS A;  5LHH A;  2R0Q C;  3RYP A;  3JRG A;  2EIJ H;  1KU7 A;  1RI7 A;  2E60 A;  2KPM A;  2K40 A;  2P7V B;  4HLX A;  2VC0 A;  5DCF A;  3LWJ A;  1YQA A;  2D1V A;  1QO0 D;  4CA0 A;  4CGZ A;  4AF5 A;  1T2K A;  4OIP F;  1FYK A;  2HEO A;  1ETW A;  1Z6T A;  3BNI A;  2W7N A;  3S2W A;  2XAG A;  2BZT A;  1VQL I;  1XSV A;  5IT9 Z;  2VE9 A;  4DYQ A;  3H36 A;  2DMU A;  1CF7 A;  1BN5 A;  3HTA A;  1U5T C;  3GTM J;  3DU5 A;  3S3O A;  3S5R A;  1EV7 A;  2R7S A;  1V55 H;  1VQ8 I;  4G7O F;  4HKU A;  2E5Z A;  4KN7 X;  1LFB A;  1H89 C;  2VQL A;  2CWE A;  4U7D A;  5E3M A;  3KKD A;  2UXX A;  3G1O A;  3GZN B;  3KEQ A;  5GPC A;  1WWX A;  1MJ9 A;  2DMP A;  1KU9 A;  4JP0 A;  4IOA F;  4C2M A;  4XSX F;  3CJN A;  2M3A A;  4N9H A;  4E7K A;  4XLE A;  2NAZ A;  4BS9 A;  4HNV A;  1S72 I;  4BEH B;  1KYW A;  1U0J A;  2WA0 A;  2OAZ A;  5GTH C;  3BJA A;  5FRM A;  3S1N J;  4IEJ A;  5KAF C;  2QEX I;  5F0F A;  2DOD A;  3B73 A;  5LRR A;  4KJZ A;  3EUK L;  3FF5 A;  4YII A;  1Q1H A;  4B43 A;  4JOM A;  3K8P C;  1JGG A;  3VYR B;  2DFI A;  3HBL A;  1QHH D;  4KUM A;  1A36 A;  1ZGW A;  1V5F A;  4AVP A;  3DPJ A;  3GO5 A;  3F8N A;  3FXM A;  2QEN A;  3E5Q A;  4XLF A;  2CV1 A;  4XOP A;  4L0Z B;  1HKQ A;  4XKV A;  5KCM A;  3OYK A;  5J8F A;  3KP6 A;  4RLQ A;  3GUD A;  4LLN A;  1JKR C;  2V1D A;  1HXD A;  2PX9 A;  4XLH A;  1BOA A;  3CES A;  4PJJ A;  5E3L A;  2MH2 A;  2VUM J;  4S0H B;  3EET A;  2HTS A;  2JA6 J;  3L09 A;  5HNH A;  1QGP A;  1BI3 A;  2YX7 A;  3CCV I;  2OZU A;  3V7R A;  3P9I A;  3QU3 A;  1A31 A;  2XHK A;  1HKS A;  1IRZ A;  2O7T A;  2EB7 A;  2QQ9 A;  2L5Q A;  1MBH A;  1Z77 A;  2KKO A;  2ZNY A;  4G7Z F;  5CVR A;  4FIS A;  1O3Q A;  3CMY A;  2AQF A;  3LL7 A;  3WGI A;  3AQT A;  2K86 A;  1X3U A;  1VF9 A;  3FMR A;  1UHW A;  4DZJ A;  2MYS A;  1YS7 A;  5HNF A;  5B1B H;  3L00 A;  4EV0 A;  2HQ5 A;  2GOX B;  1XCB A;  4A5N A;  5J6X A;  1X58 A;  4BY7 J;  1E0E A;  2PFV A;  4M6Y A;  2MGQ A;  3KZY A;  2OA4 A;  3LHQ A;  3LSJ A;  4XLA A;  1GVD A;  2DOE A;  2H6C A;  1SD6 A;  3J81 Z;  1RUO A;  3ABL H;  4NNJ A;  3FK7 A;  3FXL A;  2P4W A;  1ZN2 A;  2JQ7 A;  3F6V A;  3CO6 C;  2WAQ N;  3C18 A;  1JT6 A;  4EM1 A;  3VIB A;  3FBN B;  2ZXI A;  1ZQ3 P;  3KLN A;  5IYD J;  2M2E A;  1ZLJ A;  3ECO A;  2VT3 A;  3WOD F;  3NAR A;  4AYB A;  2NNN A;  2P6T A;  2XRO A;  4HDV A;  2XPV A;  1HBX G;  5D1R A;  4M3G A;  2PBI A;  4A3I J;  3DEE A;  1YYV A;  4UV8 A;  3U1D A;  3H3U A;  1LFP A;  1YI2 I;  3Q5F A;  2PBX A;  1X2M A;  2W00 A;  5BS6 A;  2IJL A;  2HVS A;  5DDG A;  2A61 A;  3FM5 A;  2EFQ A;  3KYL A;  1R71 A;  1X1C A;  1VTN C;  2YU3 A;  4I02 A;  4KWA A;  3X2Q H;  4PSX A;  4XOT A;  3VUQ A;  2OTL I;  1HA8 A;  1BI2 A;  1LDD A;  2QKO A;  1W36 C;  1MMS A;  3DTK A;  5GAE J;  5H6R A;  2K7L A;  5L3E A;  3JAM K;  2VXZ A;  4BXX J;  5J8C A;  1J59 A;  1ETO A;  4GCV A;  4G94 A;  4Q4Z F;  4DBQ A;  1X1P A;  3E6B A;  5HDK A;  2AXL A;  2MC3 A;  4MIM A;  2A6T A;  3OYF A;  2IW5 A;  5KHD A;  3CJQ B;  1X4P A;  3LSR A;  2OQG A;  4CZC A;  1RR7 A;  2V6E A;  4JX6 A;  2EFP A;  1VZ0 A;  1LUJ B;  4XLN F;  4PJM A;  2X6X A;  1U9O A;  1WFX A;  1Z6R A;  4OOI A;  5BOX A;  4BAY A;  1PP7 U;  3R6S A;  2MD5 A;  1G8X A;  2YR2 A;  2ZSH B;  1JUS A;  3QKX A;  2YVX A;  1Z1D A;  1SD4 A;  3M1C A;  2I8D A;  5DEQ A;  1ODD A;  3V8L A;  2XPU A;  4RAZ A;  3SFI A;  1Z0X A;  5FFX A;  1UEL B;  2DQL A;  2JN6 A;  5A2Q K;  4BL0 B;  4FX0 A;  5JHU A;  2EFO A;  2WUI A;  5KNL A;  3H3V K;  1Y1W J;  5JLX A;  2K9Q A;  3S1R J;  1UG2 A;  1ZG1 A;  1FX7 A;  1Y8R B;  2HOE A;  3GX4 X;  2RNJ A;  4HF1 A;  3B6C A;  4MO7 A;  3HOT A;  2V4J C;  2HOS A;  3MQ0 A;  2RRE A;  4G6D A;  1AKH B;  1GV5 A;  2Q1Z B;  3KIO A;  1B4A A;  4ME9 A;  1XMA A;  2HYF A;  3BPX A;  2GXB A;  1JKP C;  4M9X A;  1ZYR F;  2FRH A;  1W7P A;  4JBA A;  4RAF A;  2O61 A;  3TGN A;  1BW5 A;  3LA7 A;  4HV5 A;  1MMA A;  4C9Y A;  2BHY A;  1V3F A;  5L3D A;  2PMU A;  3FXO A;  1YLF A;  2Z1D A;  4IHX A;  4NC6 A;  3N4M A;  2W1O A;  4PZJ A;  1MBJ A;  1R36 A;  2QYO A;  2X1C A;  4IF4 A;  5D4S A;  4KIS A;  2OCE A;  4BBS J;  2VQC A;  3H9Q A;  4RMN A;  4AID A;  2OJE D;  2WAD A;  4FTH A;  4IHS A;  4AC6 A;  5DD4 A;  4CZZ A;  2PJP A;  3F1B A;  3OL3 A;  4DYC A;  2VB6 A;  2HQA A;  3A4C A;  4HQM A;  1OCP A;  4EAT A;  2JA8 J;  5FRN A;  1K78 B;  1TTY A;  5EEG A;  2QKM B;  3CCY A;  1R6R A;  2PMZ N;  2ZO4 A;  3DKY A;  4MHG A;  2KIU A;  1TT5 B;  5E3N A;  3MEX A;  3VPR A;  5J4V A;  1JUP A;  3JR9 A;  2E71 A;  2LR8 A;  2CUZ A;  2X4H A;  1K6O A;  3B02 A;  1YIT I;  1OCT C;  3Q0W A;  3CC2 I;  3JRB A;  1R5H A;  4ICH A;  5H20 A;  5KAI C;  3JRH A;  1T6S A;  2BYV E;  4PGH A;  2Z16 A;  1YIO A;  2DN0 A;  1MBF A;  2HDW A;  2JJ7 A;  3K6G A;  5GAG J;  3BZK A;  4C3H J;  1S7E A;  1SFO J;  1Z05 A;  2CQK A;  3CDI A;  1QZE A;  1R00 A;  4AWX B;  2ZJ2 A;  4HNU A;  3IAM 2;  2KL4 A;  3FBI B;  4ZZL A;  1Z9C A;  1LE8 A;  3H5N A;  5DUI A;  5ILU A;  2GA1 A;  3NS4 A;  4GO1 A;  3RDI A;  4MGR A;  3FZV A;  3ON4 A;  1T56 A;  1LVK A;  3GTQ J;  3FDY A;  1IC8 A;  1KON A;  4LIV A;  4YIF A;  1KU2 A;  1R1V A;  2L9N A;  1B72 B;  2GLO A;  1XGO A;  5GAH J;  1O3R A;  3BP8 A;  3GFI A;  4F7Z A;  3AL0 C;  2DT6 A;  3OIO A;  4LFU A;  4RGU A;  4CSW A;  2K27 A;  1NG6 A;  3LSG A;  3F9K A;  1KA8 A;  3HTI A;  4MFE A;  1T39 A;  3IRQ A;  1FIA A;  4BAC A;  2L4M A;  2VBY A;  5C3E J;  4WWC A;  1WQ2 A;  3I3L A;  1ZR2 A;  1LB2 A;  3V78 A;  4C3J J;  1HDD C;  2R93 J;  3IH3 A;  2I5U A;  3HRT A;  1O7F A;  5F0C A;  4OIQ F;  2STT A;  3U2R A;  5HSZ A;  4UY8 I;  2VE8 A;  3OYE A;  4XK4 A;  2LKS A;  4O3M A;  4EM0 B;  4AIJ A;  1BA5 A;  2Y75 A;  3PUB A;  3D5R C;  4IVN A;  4Y4R A;  4HF2 A;  4JKZ A;  3COA C;  1HQC A;  3JRC A;  1HST A;  3QU6 A;  1LE8 B;  1BJZ A;  5EG0 A;  3PIO F;  3A01 A;  5TIS C;  1REP C;  2EZK A;  2W82 A;  3ZP5 A;  2E2H J;  2QLZ A;  3W6K B;  3SJM A;  2Q24 A;  5E20 A;  1YW9 A;  4HA8 A;  1TQP A;  4YFN F;  2QBY A;  3PSI A;  3TOB A;  5DM6 F;  1W0T A;  1R58 A;  1F4K A;  2E1N A;  1P6R A;  4HEA 2;  2NP5 A;  1RKT A;  1FYL A;  1WJE A;  3I58 A;  3OWT A;  3QOP A;  5BMZ A;  2W84 A;  3ESW B;  3RD3 A;  4U88 A;  5LD2 C;  5FLV A;  3BR0 A;  3HGG A;  4U7B A;  1BL0 A;  2ZSI B;  1E3P A;  5L3C A;  2BGC A;  4G12 A;  4XLC A;  4A6E A;  4XID A;  2V9P A;  3JTG A;  3F0C A;  2LNB A;  3J81 K;  2V9K A;  5CVU A;  2VJJ A;  4MEY F;  3KFW X;  2FBH A;  3VOX A;  1OKR A;  2H94 A;  1P2F A;  2G7G A;  3S1M J;  3BPV A;  3ZOB A;  3SHF A;  1ON2 A;  1ZG5 A;  3VOK A;  1QNT A;  2HFH A;  2MA3 A;  3KP3 A;  4ZC3 A;  5BPD A;  1S5L C;  3PSF A;  1R5G A;  4PJ0 C;  3G56 A;  2ESN A;  1NHA A;  1F9N A;  4NN1 A;  1MSF C;  4L18 B;  4OIN F;  4GFB A;  2BXZ A;  4E7Z A;  2P6S A;  3BJO A;  2XIG A;  5EG0 B;  3QYB A;  1WSU A;  2E2I J;  1SVM A;  4E7S A;  1H9G A;  4LG0 B;  2QUF A;  4ENK A;  3SXY A;  3VVY A;  1S7A A;  2MG4 A;  1M1E B;  4U87 A;  2O5R A;  4A0Z A;  3OY9 A;  4L9V A;  1MIJ A;  3R4K A;  1Y0U A;  3NRG A;  2MFZ A;  2E7W A;  1GVJ A;  3AFH A;  3DV8 A;  3IRR A;  3MVP A;  2NVQ J;  3AG1 H;  2CS3 A;  4DOZ A;  1CQT A;  4F55 A;  2HXO A;  1FP2 A;  1XX5 A;  2G7H A;  4MTD A;  3OIQ A;  2DPD A;  2KDO A;  3K4C A;  4KNY A;  2CQN A;  5CVJ A;  2QSG X;  1H88 C;  2RAE A;  4JX5 A;  4N4O B;  3LOC A;  2M34 A;  2O0Y A;  1IO2 A;  2DA3 A;  2V1N A;  3K7A J;  3D5S C;  4S05 A;  1RR8 C;  2JA7 J;  1MBG A;  5FHP A;  2RDP A;  1GV2 A;  3DP7 A;  5JFR A;  1N78 A;  1HKT A;  5FMP A;  2OBP A;  1DQU A;  5HLT A;  4D5F A;  1MDM A;  4C2U A;  3O6B B;  1TP4 A;  4WX9 A;  3Q3S A;  5TGT A;  1I3A A;  2MAB A;  5B3S H;  4LMY A;  3JTH A;  4NB5 A;  4P1W A;  3TO9 A;  3K70 C;  2IA0 A;  2JA2 A;  4LJZ F;  4IOC F;  1IRG A;  1KZH A;  3DTI A;  3NWS A;  3HTJ A;  2CQQ A;  2EV6 A;  3I4P A;  2JZY A;  1IXC A;  3EDP A;  4KIC A;  4M73 A;  2WB1 N;  5FLM J;  1F36 A;  4HST A;  4XON A;  3G4S I;  3D1N I;  2BEO A;  2F4I A;  1PJR A;  2JTV A;  3BTL A;  1OYY A;  2G0E A;  1FJL A;  4IXA A;  1X19 A;  3WTU C;  4EMS A;  1X4O A;  3ELK A;  3RI4 A;  3A0B C;  2G9W A;  2L0K A;  1FP1 D;  4Y7N J;  3OYC A;  2W25 A;  2NVU B;  5D8L B;  3WTT C;  1T98 A;  2K4B A;  3L2R A;  2HZD A;  3HIF A;  4PFO A;  3K4K A;  1K83 J;  4LK0 F;  3I5U A;  1WH7 A;  4GRI A;  5LGU A;  4WF2 A;  1J9I A;  3QYE A;  2VLA A;  2X9D A;  3LA3 A;  4HBL A;  1MNM C;  4LLG F;  2UXU A;  2WWY A;  2X48 A;  3BG7 A;  3N97 A;  2YU9 J;  1N25 A;  4EVI A;  1ZH5 A;  3J7A O;  2ELJ A;  3BC8 A;  1IW7 F;  4A3M J;  2M9H A;  3LNQ A;  3LQR A;  3QQA A;  3KP7 A;  1YS6 A;  4MQ9 F;  1YW7 A;  2XAF A;  3FRQ A;  4PUS A;  3NAU A;  3BWG A;  3M1E A;  4BH9 A;  3VEP A;  4RBO A;  3OSG A;  2K9L A;  2VBX A;  1R1T A;  3A0H C;  5FD5 A;  1SFK A;  3C2G A;  3CC7 I;  1BC7 C;  1K4S A;  3I4N J;  5E8I A;  1SVO A;  2XAH A;  1H8A C;  1LJ9 A;  4P55 A;  3OYJ A;  3QOD A;  3RCO A;  4RM3 A;  5GP9 A;  2XC7 A;  3MMY B;  1OJL A;  3DBR B;  1WI9 A;  1XDS A;  3BRU A;  1WPK A;  2LY1 A;  2PMH A;  3GFJ A;  2KRH A;  4Y17 A;  3AG3 H;  5LLQ A;  5F1J A;  2JA5 J;  2FBI A;  2Q2E B;  2F6C A;  3HOU J;  2CQX A;  3I53 A;  4EJW A;  1T38 A;  3A1Y A;  3TMO A;  1W0U A;  4N9I A;  2B7E A;  3HOV J;  3BG6 A;  2IA1 A;  4F91 B;  2VJ4 A;  5CXG A;  1HW1 A;  2E34 A;  2QCO A;  3HGY A;  3ZQL A;  1IGN A;  2UXN A;  2DPU A;  4HRI A;  4CGR A;  3DLA A;  3ML6 A;  3WGH A;  2DFH A;  3K4J A;  5LEJ A;  3P5J A;  3HE0 A;  2ZXH A;  5F0H A;  2R7O A;  2M0M A;  4XSZ F;  3G7R A;  5FLX K;  5FKK A;  3W2A A;  1J09 A;  5ICC A;  4QTR A;  3LWF A;  4J00 A;  3CCQ I;  3HB9 A;  3VOE A;  4XM3 A;  5HS8 A;  1VQN I;  3C2H A;  2ETH A;  1G3T A;  2L54 A;  2HTJ A;  1VND A;  1B59 A;  3FIW A;  2A6H F;  2LSO A;  1V4R A;  4G8X A;  2CW0 F;  2VPL A;  3S16 J;  5CXI A;  2F5D A;  4F52 A;  2JSP A;  3H0D A;  2H6B A;  2XF6 A;  1JTX A;  5CVI A;  3K4L A;  5DCM B;  3PL8 A;  4H0E A;  4HX7 A;  4E7L A;  4A93 J;  2BXY A;  2BY2 A;  5B1A H;  1RNL A;  3TL4 X;  3A03 A;  3S32 A;  1DU0 A;  2H1L A;  4UDS A;  3VOD A;  3JRD A;  1Z7L A;  1V54 H;  2G7S A;  4DQ2 A;  2EV5 A;  4BEH A;  1HSJ A;  4U0Y A;  1ZRF A;  3OYD A;  1BC8 C;  3EYI A;  3W6V A;  2FXA A;  1EH7 A;  1S3J A;  2TCT A;  3BCG A;  3CCU I;  1D8J A;  3DQV C;  1PYV A;  3IKV A;  3MKL A;  3CC4 I;  3BG5 A;  1A5J A;  1YJ9 I;  2MH9 A;  3TP3 A;  1FIP A;  2PN6 A;  5E18 F;  4ZTJ A;  1QBJ A;  2ECB A;  2DT7 B;  5J1U A;  2DLL A;  2VQG A;  3K9T A;  3ANP A;  2E1M B;  2Z2S B;  3F72 A;  2Y0M A;  1FMW A;  5M3F J;  3ZQ7 A;  2BY3 A;  3ASN H;  4BBR J;  2K85 A;  2EWN A;  2LF7 A;  2XAS A;  2HKU A;  3OV8 A;  3U1K A;  3CJR B;  4LIU A;  2LRE A;  2ZCN A;  2L01 A;  3CUQ B;  2CUF A;  3ZQH A;  1UG0 A;  5ILV A;  1U9N A;  3DTE A;  1A6Q A;  3I56 I;  1Z91 A;  4LK1 F;  3K10 A;  2Q8K A;  2V1X A;  4WIB A;  5D5V B;  1B9M A;  3FMQ A;  4IHW A;  1SC7 A;  5CQG A;  4UVC A;  2QWT A;  3I0T A;  1MJA A;  1XCV A;  2E1M C;  2VI6 A;  3SWH A;  1ZG3 A;  2IEK A;  5FRO A;  1N77 A;  1ERD A;  2A5W A;  2X0L A;  3HSF A;  2K5C A;  3E0J B;  3ZN0 A;  1FOW A;  1MNE A;  3BTI A;  2AQE A;  1QPI A;  2NYX A;  4B4C A;  5JI6 A;  4XKC A;  1J5Y A;  4OMZ A;  2A5Y B;  4E7J A;  1VI0 A;  1Y39 A;  5IT3 A;  4A3K J;  2GQQ A;  1W4M A;  3VP5 A;  4RA2 A;  3I4M J;  2OQR A;  1QRY A;  2DT5 A;  3SZG A;  4ZH4 F;  4ZDO A;  3RH2 A;  2DYR H;  3CTA A;  3KYD B;  3QYF A;  4ON0 A;  2K3P A;  4GCT A;  3E6D A;  4DIQ A;  2VT2 A;  2LMD A;  2M45 A;  4Q47 A;  2ID3 A;  3CQZ J;  2DA7 A;  2WTE A;  3HEF A;  3S3N A;  4M3B A;  1J0R A;  2CSO A;  4BE2 A;  5EJC A;  4M3D A;  3HYI A;  1B8I B;  3F21 A;  4R1H A;  4L0Y B;  1DPU A;  5AIQ A;  1FZP B;  1RC9 A;  1PUE E;  2LRD A;  2IGK A;  2KMU A;  1C0W A;  4P9U A;  3F8B A;  4PDK A;  1NTC A;  2LBF A;  4QSH A;  5FKM A;  4D9J A;  4HQE A;  1MSE C;  4NQW B;  1E3O C;  4A5M A;  3KZ9 A;  4AIK A;  1Z7U A;  2WAQ A;  3OOU A;  3L9F A;  3PFY A;  1Y0N A;  2RKH A;  2M8E A;  5DYM A;  1JKQ C;  2DA4 A;  4IKF A;  3IAS 2;  1MD0 A;  4BE0 A;  1JHF A;  4XMY A;  4OD5 A;  4JL3 A;  3DFG A;  2OD5 A;  1E17 A;  2L9R A;  1YJW I;  3DKW A;  3FWE A;  4L5E A;  4GXO A;  3HDD A;  3LMM A;  3CLO A;  1Z21 A;  3GEZ A;  1W1W E;  5J4Y A;  1PUF B;  3PAS A;  4IPA A;  3WG9 A;  1S29 A;  1I6H J;  2K3F A;  2GZW A;  4DNC A;  4AIH A;  1VQM I;  4KFC A;  4A3E J;  1S7O A;  2EK5 A;  2FQ3 A;  1Y8Q B;  2M7B A;  4ENN A;  2LY2 A;  3IC7 A;  1YOV B;  2OUM A;  4LLL A;  3VFZ A;  2DOF A;  3LFU A;  4KIT B;  1RES A;  3BCB A;  5CVV A;  3FK6 A;  4U0W A;  3IP4 B;  3CCM I;  3ROU A;  2Z3Y A;  2OV7 A;  1D5V A;  3RSN A;  1HF0 A;  2HGC A;  1USS A;  3COL A;  2LBF B;  3P9T A;  2DW4 A;  2VOO A;  4IJA A;  3KLO A;  3W3C A;  4DBR A;  3Q0V A;  4W97 A;  4CYD A;  4RB1 A;  2MSY A;  2WV1 A;  1W5C C;  2X1D A;  4PJN A;  2O6G E;  3GYH X;  1Z3Y A;  2IAI A;  1LKX A;  3G1L A;  2VON A;  1S9H A;  2DOA A;  5F6F A;  2FMY A;  2HQR A;  1STZ A;  1WJC A;  1ZAO A;  3H9J A;  2M7A A;  5CQE A;  2ECC A;  1QZY A;  1OCC H;  5KK1 A;  3CCS I;  1K4T A;  5F27 A;  1VQK I;  3H35 A;  3F3X A;  2VN2 A;  2IGM A;  4DGW B;  4ZJZ A;  1B6A A;  2G7L A;  3H0G J;  2DA2 A;  5J1R A;  1ITY A;  3QRF F;  2HKX A;  4PCQ A;  3TQN A;  5DS9 A;  4BQQ A;  1BR1 A;  2DCE A;  1T95 A;  2UWM A;  1JI8 A;  2H8R A;  5EEA A;  2CYY A;  4PK4 A;  1YHQ I;  3VTI A;  1TQI A;  2DTR A;  2QSF X;  1U2W A;  2OZ6 A;  1AWC A;  4YIR X;  4RAG A;  4F93 B;  2CV2 A;  4XKW A;  2JUC A;  4KMF A;  3BCA A;  4M6V A;  5D6F A;  1X3Z B;  2P8T A;  1AKH A;  4PXI A;  2Y0S A;  3CLQ A;  1BW6 A;  4HOB A;  4KMU X;  1FNN A;  4M9Z A;  2DXI A;  1SMY F;  4G7H F;  4BHP A;  2HKO A;  4RB2 C;  4J01 A;  5B5E C;  1ON1 A;  4M71 A;  3HOY J;  2AS5 F;  5BPI A;  3ZGK A;  6PAX A;  1FBQ A;  2R5Y B;  3M4O J;  3NI7 A;  2BBY A;  3F8C A;  2UXP A;  2R3S A;  4NHJ A;  3DWL E;  1IAW A;  2BHZ A;  5FB2 A;  3MZH A;  3P9K A;  4KIF A;  4A0X A;  4ZYA A;  2RC4 A;  4L5I A;  5K7H A;  1F5T A;  1TWA J;  3O8G A;  4EGZ A;  2DU9 A;  5E79 C;  1LFU P;  3E1S A;  2RV8 A;  3C1D A;  4U9L A;  2KIF A;  3VW0 A;  1JTY A;  1DPR A;  1X2N A;  2EFW A;  3RZO J;  1SGM A;  1K78 A;  3KKC A;  2X6W A;  3S15 J;  2E1O A;  4MQV A;  2JSC A;  2P0W A;  2KHM A;  1GHC A;  3K70 D;  1IDY A;  1RET A;  2Y0S N;  1WI3 A;  3WHC A;  1BIB A;  4ITV A;  1NH3 A;  3V7C A;  3MN2 A;  3CCJ I;  3R0J A;  3AQS A;  2GUH A;  2PMZ A;  5JR3 A;  2LF8 A;  3ZXS A;  1UFM A;  3DKX A;  4I76 A;  1P7J A;  3OS1 A;  2Y9Y A;  4HLY A;  1YIJ I;  3ONQ A;  4V2G A;  2HPM A;  5HOD A;  4KIG A;  4UUT A;  1FTT A;  2XKP A;  2JT1 A;  5E8G A;  3V8J A;  2LG4 A;  5FJ8 J;  1RZ4 A;  4L9T A;  3OMY A;  5CLS A;  3R60 A;  2QGU A;  3VYS B;  5LHG A;  3O3K A;  3GF2 A;  2L7K A;  2OPT A;  2NNY A;  1XDU A;  1ONV A;  1RPW A;  2QTQ A;  2CFX A;  2FOW A;  3FM3 A;  4ZYH A;  4FT8 A;  3E3V A;  1ZLK A;  4EEF G;  2WY8 Q;  1ZTR A;  1FY7 A;  1B72 A;  3GFM A;  2VBW A;  3SEQ A;  4B47 A;  3QP6 A;  2LKP A;  2JMW A;  2LC2 A;  2L9V A;  4BDY A;  1BR4 A;  4IRI A;  3K2A A;  3GVA A;  1TW2 A;  3V42 A;  2BE5 F;  3JRA A;  3WE3 A;  3FKI J;  3HRU A;  2V57 A;  1XGN A;  1VQ9 I;  3TW6 A;  3J7Y J;  3O2P E;  4CCJ A;  1ETK A;  3CJT B;  4HAM A;  3RKQ A;  3R0A A;  4MTE A;  4GFK A;  4YFX F;  4PFP A;  3MZY A;  4XRF A;  4A69 C;  2Z9O A;  4BU2 A;  4I0B A;  1EF4 A;  1MMD A;  4FX4 A;  2HXI A;  5TJJ A;  2EIL H;  5EGO B;  2LH9 A;  5LGT A;  1QU3 A;  4BQN A;  3VYU B;  5DTD A;  3OL4 A;  3QOE A;  3NXC A;  5EF6 A;  1HLV A;  4G6Q A;  4D7N A;  1YFH A;  3PNV A;  3REO A;  2WAF A;  1F1Z A;  1EH8 A;  1O3T A;  4I09 A;  5D6E A;  3HSE A;  2IT0 A;  1T0F A;  3VW1 A;  5TRD A;  3HHH A;  4OD4 A;  3Q9S A;  4UUS B;  1SAX A;  2P5K A;  4HNT A;  2UV1 A;  3F6O A;  5FLX Z;  4WK8 F;  4XIC A;  5K7F A;  2TRT A;  4JNN A;  3ABK H;  4IL6 C;  3V4G A;  3LSP A;  3A2K A;  1WKM A;  5CJ9 A;  2VXD A;  1QVU A;  2QM3 A;  4BDZ A;  2M87 A;  3QWL A;  4RGX A;  4AU7 A;  4R79 A;  2XRN A;  2DJN A;  3KP2 A;  4GDF A;  2MC4 A;  3CDL A;  2DJI A;  1MJB A;  5HBU A;  1XB4 A;  3IUV A;  2EBI A;  4E70 A;  1XN7 A;  5D5U B;  4X1E A;  4CCO A;  5D5X B;  2COB A;  3L1P A;  3ANG A;  2QIB A;  1S6L A;  3E5X A;  2Z33 A;  1FBU A;  3WTY C;  4GGG A;  2ZJP F;  2R7F A;  2LOO A;  2B9S A;  3HM5 A;  1VQ6 I;  3FHN A;  1GLN A;  3WTS C;  3SQN A;  5M5Y J;  2UXO A;  2HYT A;  1JHH A;  2XAQ A;  3GME A;  2CUJ A;  3NPI A;  4UHT A;  1BJA A;  3D5L A;  4AC0 A;  4IO9 F;  2NX4 A;  2R5Z B;  2E7X A;  2QF7 A;  4XKB A;  3RPU A;  3FXR A;  4LG0 A;  4ZTF A;  3G71 I;  5CW8 A;  2ELK A;  2YUS A;  3CF5 F;  4XNF A;  1P4W A;  4FET A;  1WHU A;  2GXG A;  1T33 A;  2K9S A;  1ETV A;  2H8W A;  4HPQ A;  1VQ5 I;  3OYA A;  2DFE A;  3HTS B;  1IN4 A;  2KZV A;  5HLG A;  4AUX A;  1P4A A;  3HHG A;  3JSO A;  2KIQ A;  3EUP A;  1X3W B;  1G3W A;  2ESH A;  4JQF A;  2D5V A;  2GXA A;  5D4R A;  3W2W A;  2EH3 A;  2XB0 X;  1O7L A;  1WZ2 A;  1FC3 A;  4QPO A;  2EJR A;  4KYW A;  4RAY A;  3KZI C;  2KRC A;  2PQ8 A;  3MD2 A;  4B1R A;  1TQM A;  3LAJ A;  4XN3 A;  5K58 A;  2OC6 A;  1T0F C;  3DXJ F;  2ZXJ A;  2ID6 A;  1FTZ A;  4KT6 A;  4Y33 A;  5KVR A;  2G7U A;  3C7J A;  1XS9 A;  5LHI A;  4PSW A;  3IWZ A;  1ACI A;  2XGD A;  2FBQ A;  1MH4 A;  2GWR A;  4BJT A;  4ESF A;  3IL2 A;  1QHG A;  4BQO A;  2EA2 A;  2JPC A;  1WGX A;  2D6Y A;  4AM3 A;  1IXS B;  3MKZ A;  3ZMZ A;  4XQF A;  3G1M A;  3B81 A;  1VQO I;  1SFE A;  2EZL A;  4ESB A;  3G73 A;  3H5R A;  3WTZ A;  1HC8 A;  2LY9 A;  2FSW A;  1SAN A;  2XPW A;  3TO7 A;  2UXI A;  4KIB A;  2QSH X;  1Z3X A;  3GTL J;  3RPQ A;  3T8R A;  2D45 A;  1BI0 A;  1XMX A;  2RQP A;  2GIV A;  2Y31 A;  2WB1 A;  1KQ0 A;  4OMY A;  5IYB J;  1I3Q J;  1H0M A;  2J5O A;  2QVO A;  3OYL A;  1PDN C;  4GCK A;  4G6T B;  3BOQ A; 
#chains in the Genus database with same CATH homology
 3S16 J;  5AQC A;  5FGL A;  2DA6 A;  2HYJ A;  5CXI A;  1X58 A;  4BY7 J;  4DZP A;  2MGQ A;  1APL C;  1JTX A;  3LHQ A;  3LSJ A;  1GVD A;  3EGQ A;  5BNG A;  1ZKG A;  2YS9 A;  4A93 J;  2LLK A;  3FK7 A;  1JT0 A;  3BR6 A;  4I6Z A;  3BG3 A;  2R5Z A;  3HKZ N;  2WAQ N;  3A03 A;  1JT6 A;  2NVX J;  3C2B A;  3WHB A;  1DU0 A;  3VIB A;  1ZQ3 P;  4UDS A;  3JRD A;  5IYD J;  2M2E A;  2G7S A;  5FKL A;  4C2M J;  2CU7 A;  3NAR A;  1GT0 C;  1GDT A;  3W6V A;  2XPV A;  2TCT A;  3BCG A;  5D1R A;  4M3G A;  1WH5 A;  4A3I J;  3MKL A;  5IP9 J;  5HAW A;  3BG5 A;  2ME6 A;  1A5J A;  2FX0 A;  3TP3 A;  2CJJ A;  1FIP A;  1DU6 A;  2OER A;  2ECB A;  2H1K A;  3PO2 J;  2UXH A;  2AO9 A;  1X2M A;  2KT0 A;  2LP0 A;  5J1U A;  2PBX A;  2XDN A;  1AHD P;  3ANP A;  3HOZ J;  4KWA A;  5M5X J;  2HDD A;  5M3F J;  3E7Q A;  2NVT J;  3VUQ A;  2IBD A;  4BBR J;  5JLW A;  3BR5 A;  1MBE A;  3V6G A;  2HKU A;  2QKO A;  5FKN A;  4M3F A;  5C4Y A;  2ZCN A;  4A3C J;  2CUF A;  3ZQH A;  2RHA A;  1U9N A;  3HIM A;  4BXX J;  2O9L A;  4MK6 A;  2ME0 A;  1ETO A;  1HDP A;  3IH2 A;  2RAS A;  2N8G A;  2KDZ A;  4IHW A;  4MIM A;  1Q1V A;  2QWT A;  3S17 J;  2DG8 A;  4J19 A;  5E3O A;  1GUU A;  3LSR A;  3VW2 A;  3RZD J;  1RR7 A;  2VI6 A;  1XC5 A;  2HOA A;  2IEK A;  4JX6 A;  2LD5 A;  2Y30 A;  3LJL A;  1QVT A;  1U9O A;  2HI3 A;  3BTI A;  1QPI A;  3S14 J;  4B4C A;  4FE7 A;  1JUS A;  3QKX A;  1VI0 A;  4X6A J;  2ZOZ A;  4A3K J;  4L62 A;  3VP5 A;  3I4M J;  1Y1V J;  4NDL A;  1QRY A;  5IOZ A;  2XPU A;  1TWH J;  3RH2 A;  3SFI A;  1Z0X A;  5EFY A;  4GCT A;  2JN6 A;  2EQR A;  2NS8 A;  2EZI A;  2REK A;  2ID3 A;  3CQZ J;  2DA7 A;  2CRG A;  3HEF A;  1K61 A;  4M3B A;  2W53 A;  2WUI A;  1MBK A;  5K7Z A;  4A3G J;  3M3Y J;  5C44 J;  3H3V K;  1Y1W J;  4M3D A;  5JLX A;  1B8I B;  2K9Q A;  3JSJ A;  3S1R J;  1UG2 A;  1HCR A;  4FE4 A;  2GBY A;  5EDN A;  1OFC X;  1JKO C;  3B6C A;  2ZCX A;  4MO7 A;  1JUM A;  2HOS A;  1TWF J;  1NTC A;  4QSH A;  5FKM A;  1GV5 A;  1ORK A;  5M3M J;  1AKH B;  4ME9 A;  1MSE C;  4MFD A;  2NP3 A;  1E3O C;  3BQZ A;  3BHQ A;  3BR3 A;  3KZ9 A;  3OOU A;  5F04 A;  1R9T J;  1JKP C;  1JKQ C;  2DA4 A;  4NEL A;  1BW5 A;  4JL3 A;  2L9R A;  2NS7 A;  3JRI A;  4L5E A;  3HDD A;  5IP6 A;  4IHX A;  1MBJ A;  3SDG A;  1PUF B;  4BBS J;  3PAS A;  3DCF A;  4FTH A;  1IJW C;  1I6H J;  4AC6 A;  3A01 B;  2XSD C;  3F1B A;  2O8K A;  4DYC A;  4DW6 A;  2I10 A;  4A3E J;  5DAJ A;  2M8G X;  4MXM A;  1OCP A;  2JA8 J;  3O8H A;  3BR1 A;  2LVS A;  5D18 A;  2FJ1 A;  1TC3 C;  3CCY A;  2W48 A;  4JX4 A;  1XG1 A;  2PMZ N;  1ETY A;  1RKW A;  1RES A;  3BT9 A;  5E3N A;  3FK6 A;  2DMQ A;  3VPR A;  1AU7 A;  1D5Y A;  2DA1 A;  1JUP A;  3JR9 A;  3ZQC A;  2O7O A;  2LR8 A;  2P81 A;  4ABZ A;  4W1U A;  5M5W J;  1OCT C;  3Q0W A;  1HF0 A;  3A02 A;  3JRB A;  2X6O A;  3COL A;  4ICH A;  3P9T A;  3JRH A;  2VKE A;  1WCM J;  5J1Y A;  2LTP A;  3Q0V A;  4W97 A;  3HOX J;  2NVY J;  2MSY A;  2OF7 A;  3MNL A;  2WV1 A;  4BKX A;  2IAI A;  2DN0 A;  3G1L A;  1MBF A;  2JJ7 A;  4C3H J;  1S7E A;  1SFO J;  1ETX A;  2ECC A;  4MLO A;  2JWT A;  5F08 A;  2DMT A;  3IH4 A;  5F27 A;  4A3D J;  3QPS A;  1LE8 A;  1ZK8 A;  1G2H A;  3HOW J;  2L7M P;  3H0G J;  1YRN B;  2DA2 A;  2G7L A;  5J1R A;  1ITY A;  1HOM A;  3OSF A;  5DS9 A;  3ON4 A;  1T56 A;  3GTQ J;  1IC8 A;  1I50 J;  5H9T A;  1B72 B;  2IU5 A;  2GLO A;  5EEA A;  2H8R A;  4QIW N;  5IPA A;  3QBM A;  2L7F P;  3OIO A;  5C4J J;  1B8I A;  3CRJ A;  3LSG A;  3GTJ J;  2XRL A;  4BY1 J;  3HTI A;  5GPA A;  4MFE A;  4M6V A;  1FIA A;  1NK3 P;  3O60 A;  2XGC A;  2L7Z A;  1AKH A;  4PXI A;  1BW6 A;  5C3E J;  2DMN A;  1ZR2 A;  1JJ8 C;  3V78 A;  1U8B A;  4C3J J;  1HDD C;  4D7M A;  3IH3 A;  2R93 J;  3ZQI A;  3PO3 J;  5F0C A;  2GM4 A;  1TWG J;  3HOY J;  5HSZ A;  3QPL A;  4V2F A;  1VFC A;  3KNW A;  5FKO A;  3PPB A;  4XK4 A;  2R5Y B;  3M4O J;  3NI7 A;  1BA5 A;  2UXP A;  1U78 A;  3E7L A;  2FQ4 A;  4JKZ A;  2F07 A;  1PUF A;  4JYK A;  3JRC A;  9ANT A;  1UI6 A;  2ZB9 A;  5EZH A;  1LE8 B;  1BJZ A;  5K7H A;  5EG0 A;  3A01 A;  1TWA J;  2VKV A;  3BR2 A;  3O8G A;  2EZK A;  2E2H J;  1LFU P;  3SJM A;  2Q24 A;  1ETQ A;  4DYR A;  3VW0 A;  1JTY A;  1X2N A;  3RZO J;  1SGM A;  1IG7 A;  3KKC A;  4B3A A;  2R92 J;  4Y52 J;  1TWC J;  1W0T A;  3S15 J;  2E1O A;  2NP5 A;  1RKT A;  4LOC A;  1IDY A;  1RET A;  2Y0S N;  1WI3 A;  1A6I A;  3WHC A;  3RD3 A;  2E19 A;  5FLV A;  3BR0 A;  3HGG A;  1BL0 A;  3MN2 A;  3AQS A;  2K9N A;  2GUH A;  5D19 A;  4G12 A;  3TED A;  4XID A;  1ZR4 A;  4I76 A;  3GZI A;  3F0C A;  1P7J A;  2Y9Y A;  1JJ6 C;  4V2G A;  3FIS A;  5HOD A;  3VOX A;  3C07 A;  5EYR A;  4UUT A;  2XB5 A;  2EZH A;  1FTT A;  3S1M J;  4XRS G;  2G7G A;  4ACI A;  3ZOB A;  5FJ8 J;  3S1Q J;  3BTC A;  4RDU A;  3VOK A;  3NNR A;  3ZQG A;  4A3J J;  3CJD A;  2Y2Z A;  2OPT A;  2DG7 A;  3G56 A;  1RPW A;  1YRN A;  2QTQ A;  4NN1 A;  3JRF A;  1MSF C;  4EEF G;  4GFB A;  2FD5 A;  2JK3 A;  2OI8 A;  1ZTR A;  5EG0 B;  2E2I J;  1B72 A;  3Q0U A;  3RQI A;  2QOP A;  4A3F J;  2JMW A;  3VVY A;  4XRS A;  3GTP J;  2DA5 A;  2MG4 A;  3GTK J;  3NRG A;  3K2A A;  3JRE A;  3HTH A;  3JRA A;  3FKI J;  1IUF A;  2V57 A;  3MVP A;  3TW6 A;  2NVQ J;  1P7I A;  1UI5 A;  1ETK A;  1CQT A;  2GEN A;  3RKQ A;  2HXO A;  4GFK A;  4YZE A;  4A69 C;  1EF4 A;  1H88 C;  3BQY A;  2HXI A;  2RAE A;  4JX5 A;  3LOC A;  2M34 A;  2DA3 A;  5EGO B;  2R5Y A;  3K7A J;  2JA7 J;  1FEX A;  5FHP A;  3S2H J;  1MBG A;  3ZQF A;  4A3L J;  1GV2 A;  5FMP A;  2MW8 A;  5DTD A;  2LFB A;  4XRM A;  2AHQ A;  4D5F A;  3NXC A;  3ON2 A;  3BTJ A;  5EF6 A;  1HLV A;  3GEU A;  4D7N A;  5C4X J;  3Q3S A;  2DTZ A;  3IV5 A;  1NK2 P;  3VW1 A;  1O4X A;  4UUS B;  3VVX A;  3CWR A;  3BJB A;  5IOY A;  4CYC A;  1IV6 A;  4XIC A;  3HTJ A;  2LK2 A;  2CQQ A;  2CUE A;  2TRT A;  5IP7 J;  5K7F A;  3BG9 A;  5IYC J;  4JNN A;  3LSP A;  2YVE A;  2R0Q C;  2WB1 N;  3JRG A;  5FLM J;  4GCL A;  1F36 A;  3D1N I;  1QVU A;  1F43 A;  2B63 J;  2K40 A;  3BTL A;  4IHV A;  2DJN A;  2G0E A;  3GBG A;  1FJL A;  3CDL A;  3LWJ A;  1IDZ A;  4AF5 A;  2M0C A;  3T6N A;  5HBU A;  4GFL A;  3S2D J;  3IUV A;  2EBI A;  1ETW A;  4X1E A;  3BNI A;  1UMQ A;  2YVH A;  2L0K A;  2COB A;  4Y7N J;  3L1P A;  3ANG A;  2QIB A;  4DYQ A;  3HTA A;  2DMU A;  2VPR A;  3TP0 A;  1K83 J;  3GTM J;  3S5R A;  1WH7 A;  2Y9Z A;  4HKU A;  3HM5 A;  1LFB A;  2X9D A;  5M5Y J;  1H89 C;  2UXO A;  1MNM C;  2HYT A;  3VVZ A;  2UXU A;  2X48 A;  5E3M A;  4C3I J;  2GFN A;  3KKD A;  3G1O A;  2YU9 J;  5GPC A;  4AYB N;  3NPI A;  4AC0 A;  2NX4 A;  2R5Z B;  2QF7 A;  2DMP A;  2WGB A;  4A3M J;  2M9H A;  4JP0 A;  3LNQ A;  3QQA A;  2ZOY A;  5CW8 A;  4IHY A;  2ELK A;  2YUS A;  5EZG A;  3FRQ A;  3NAU A;  3GTO J;  4D5C A;  4M3E A;  1T33 A;  4HNV A;  2K9S A;  4CYC B;  4RBO A;  3S1N J;  4IEJ A;  3OSG A;  1ETV A;  5F0F A;  4A3B J;  2NOG A;  4AUX A;  3EUP A;  3I4N J;  2D5V A;  2R7Z J;  1MH3 A;  1H8A C;  2EH3 A;  2XB0 X;  5GP9 A;  1OJL A;  1JGG A;  3BRU A;  1WPK A;  2PZ9 A;  3HBL A;  1ZGW A;  5EGO A;  3DPJ A;  4B1R A;  5K58 A;  2JA5 J;  5F1J A;  3TW7 A;  3HOU J;  2ID6 A;  1FTZ A;  2CQX A;  1W0U A;  1XS9 A;  1JKR C;  2XGD A;  3HOV J;  2ZCM A;  3DEW A;  1UHS A;  2FBQ A;  5E3L A;  2VUM J;  4S0H B;  1MH4 A;  3PM1 A;  4UUS A;  5CXG A;  2JA6 J;  3UKG A;  2XGE A;  2D6Y A;  2E2J J;  1WGX A;  2QCO A;  3HGY A;  3ZQL A;  1IGN A;  4CGR A;  3B6A A;  2HOT A;  3GTG J;  3G1M A;  3B81 A;  3HE0 A;  2EZL A;  1POG A;  5F0H A;  2G3B A;  3G7R A;  2LY9 A;  1SAN A;  2XPW A;  1IRZ A;  2UXI A;  2O7T A;  5FKK A;  4QTR A;  3GTL J;  1MBH A;  1Z77 A;  5J3L A;  3HB9 A;  2Y31 A;  4FIS A;  1ENH A;  4FCY A;  3CMY A;  5IYB J;  1I3Q J;  3AQT A;  2LKX A;  4GCK A;  1VND A;  1VF9 A;  3FIW A;  4DZJ A;  2HQ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...