2EH3A

Crystal structure of aq_1058, a transcriptional regulator (terr/acrr family) from aquifex aeolicus vf5
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
171
structure length
171
Chain Sequence
GTKERILEVSKELFFEKGYQGTSVEEIVKRANLSKGAFYFHFKSKEELITEIIERTHKKIISLFEENKEKTPEELLEMFLEVLYREKKVVYIFLFDLLCSEKFRNIYFEKIEDAKRRFEKFLEKHFPSKAEILSEIILGFLRQLILHYVIKEERELPFLKEKLREGLKLIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Transcriptional regulator
publication title Crystal structure of aq_1058, a transcriptional regulator (TerR/AcrR family) from Aquifex aeolicus VF5
rcsb
source organism Aquifex aeolicus
total genus 71
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2007-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2eh3A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2eh3A02
4MIMA 2YVEA 2Y31A 3LOCA 5GP9A 5F0CA 1UMQA 1LE8A 1ETVA 1X2NA 3CCYA 2GLOA 1IDZA 2CRGA 3ZQCA 1WH5A 4JYKA 3PO3J 1FEXA 5IP9J 3BG9A 1A6IA 3DEWA 4AUXA 2ZOYA 2ID6A 1HDDC 2HOSA 4MXMA 3VVXA 1T33A 3B6AA 2R5ZB 2E2HJ 3GZIA 2CU7A 1BW5A 4Y7NJ 4NDLA 2R5YB 2XSDC 4A3LJ 3COLA 3BTIA 3BR1A 2DG7A 1RESA 3A01A 4IHXA 2LTPA 3K7AJ 4ICHA 3JRHA 5BNGA 4MFEA 1WGXA 2COBA 3QPLA 5EG0B 3ZQIA 2MW8A 4IHVA 1K83J 2JMWA 4UUSB 4A3GJ 2WB1N 1Y1WJ 3H3VK 4A3BJ 2ZCXA 2LKXA 2VPRA 4GCLA 5GPAA 5EGOA 2UXOA 3BHQA 1QVUA 2VKEA 1D5YA 3HGGA 2YS9A 1A5JA 1Y1VJ 3SDGA 3F1BA 1GDTA 3L1PA 1GV2A 3DPJA 2ZCNA 1DU6A 1BJZA 3I4NJ 2FJ1A 1XS9A 2XPWA 2L0KA 2DMQA 2EQRA 3IH3A 4MO7A 1MSEC 3BTJA 3FK6A 4C2MJ 3S1MJ 1SFOJ 2EZIA 3F0CA 2IBDA 1K61A 5M5WJ 1EF4A 3VOXA 2H8RA 3HKZN 3BNIA 2LK2A 2K9QA 4V2FA 1JJ8C 4XRSA 5FKMA 4BBRJ 1U8BA 4G12A 1UI6A 3KZ9A 1E3OC 3NXCA 3PASA 1JT6A 1IGNA 2CQQA 2WV1A 4ACIA 2HXIA 2E19A 2OF7A 1O4XA 1ZGWA 2M0CA 3NPIA 3HTJA 2X48A 4JNNA 4A3CJ 3V6GA 4Y52J 3MNLA 3VW1A 3FKIJ 2RAEA 4QSHA 1ETWA 4XRSG 1ETQA 1RETA 1Z0XA 2EH3A 1IC8A 2QKOA 1QRYA 2XRLA 5F08A 2HYTA 2G0EA 5F27A 3JRCA 3G7RA 4BKXA 4D5FA 1BL0A 2QF7A 3VVZA 2DA7A 2NVYJ 1FIPA 4XK4A 1HCRA 1ITYA 1LFBA 2CUEA 1IDYA 4A3KJ 2XGCA 1OJLA 4A3EJ 4A93J 2ZB9A 5IOYA 4PXIA 3ZQGA 2O7OA 4B4CA 2CQXA 5M3MJ 5D19A 3GTQJ 5AQCA 2HQ5A 1FIAA 3HOWJ 5J1UA 1X2MA 2Y2ZA 3KKCA 5IP7J 1RR7A 1ETKA 2NS7A 1OCPA 3H0GJ 4L5EA 1AU7A 3CQZJ 3RQIA 1F36A 2XDNA 3PPBA 4DZPA 3BQYA 2W48A 3IUVA 1MNMC 5FKLA 1FTTA 1JUMA 5FLMJ 1GT0C 2DMUA 4M3BA 3ZOBA 1B8IA 2JA5J 2PBXA 5EYRA 3LNQA 5JLWA 2DA4A 2GBYA 2AHQA 4D7MA 4IHYA 4GCKA 5CXGA 2ECBA 3QPSA 2L7FP 3ANPA 1AHDP 3PO2J 3NAUA 1G2HA 3C07A 2P81A 3QBMA 3Q0UA 4A3FJ 1JKOC 2DA2A 3K2AA 1X58A 2PMZN 3SJMA 2PZ9A 4A3DJ 4MFDA 4IEJA 2ELKA 3HOVJ 3LSGA 3PM1A 1IJWC 3JRBA 1JJ6C 2R5ZA 2LVSA 2VKVA 5IYBJ 5FKOA 1HF0A 3BTCA 2L9RA 2QTQA 3E7QA 3S2DJ 3VOKA 4CYCB 4MLOA 2R93J 2R5YA 2KT0A 4W97A 2NVTJ 2MG4A 3ZQFA 4AC0A 2EZLA 4C3HJ 2ZOZA 3S17J 5EG0A 4HNVA 3HM5A 3TW7A 3RD3A 1JUPA 4UUSA 1TC3C 3BG5A 4I76A 5HAWA 1I6HJ 1NK3P 2CJJA 3IH2A 1MBJA 4DYQA 2G7LA 3ANGA 2HOTA 3VP5A 1P7IA 1GUUA 4XIDA 3S1NJ 2V57A 2VI6A 2LD5A 2FBQA 5FMPA 3RZDJ 1TWFJ 4JX4A 4JX6A 5IOZA 4M3FA 1YRNA 3BRUA 3S2HJ 3NI7A 2G7GA 3VW2A 3LSRA 1MH3A 4L62A 3HDDA 2G3BA 3BT9A 4BBSJ 2JJ7A 3IV5A 4AC6A 3JRGA 3HTHA 4FISA 4HKUA 2Y9ZA 1VFCA 5FJ8J 1XC5A 3SFIA 1B72B 3EUPA 4DYCA 4DYRA 5K7HA 2X6OA 5FKKA 1ZTRA 1IUFA 3OSFA 1UI5A 2OI8A 3LHQA 2D5VA 3DCFA 2W53A 3RZOJ 4KWAA 3C2BA 3QKXA 3QQAA 1TWHJ 5FGLA 5D1RA 4MK6A 2NOGA 1LFUP 5DS9A 4BXXJ 5FLVA 2GUHA 3JRIA 4RDUA 1PUFB 1I3QJ 1SANA 2YU9J 3GTLJ 4FTHA 4M6VA 4ABZA 3HTAA 2EZHA 2M9HA 4YZEA 3T6NA 3TP3A 3MKLA 4D5CA 2E2JJ 1U9OA 4CGRA 2B63J 2EBIA 2L7ZA 1OFCX 1XG1A 3B6CA 3FIWA 3WHBA 5HODA 3HOUJ 3HBLA 2FD5A 1TWCJ 1VI0A 3G1OA 3M4OJ 1BW6A 1R9TJ 2FX0A 4J19A 2EZKA 3V78A 2JA7J 5F04A 2ME6A 1W0TA 5C4JJ 1UHSA 3GTPJ 4GFKA 3BR3A 3LSJA 1ETYA 5F0HA 1JKQC 2HKUA 1FJLA 1VF9A 3NNRA 9ANTA 2IU5A 4EEFG 2LR8A 2NX4A 2HOAA 2DMTA 1ENHA 3WHCA 3UKGA 1MBHA 3JRDA 4GFBA 2DA6A 2Y0SN 3GTJJ 5DAJA 2YUSA 1NTCA 4V2GA 2R92J 3HGYA 1JUSA 4RBOA 5IYCJ 1FTZA 3CJDA 2ECCA 4JP0A 4AYBN 2DA1A 1DU0A 1I50J 2DJNA 1IRZA 2XGEA 2UXHA 2YVHA 1P7JA 3D1NI 5JLXA 3NRGA 4JKZA 2L7MP 2AO9A 2O7TA 2LFBA 1MBKA 3S16J 2DMNA 2WUIA 2WAQN 3O60A 2K9SA 3LJLA 4IHWA 1APLC 2M2EA 3B81A 3EGQA 3MVPA 1QVTA 3W6VA 2NS8A 4JL3A 2N8GA 4UUTA 1H8AC 5M5YJ 4CYCA 3S5RA 3BR5A 2M34A 2QOPA 3BR2A 1IV6A 4M3GA 3GTKJ 3CMYA 2NP5A 4XICA 3BR6A 5D18A 1JKPC 2REKA 2O9LA 2HYJA 3VW0A 3TP0A 2DA3A 2IEKA 4NELA 5C4XJ 1ZKGA 4D7NA 1ZR4A 2ID3A 3VUQA 3JREA 5CXIA 5C3EJ 3OIOA 3LSPA 4X6AJ 3GTMJ 3HOZJ 1H88C 5IYDJ 2F07A 1ORKA 2XPUA 5C44J 4X1EA 2GM4A 1GV5A 1ZQ3P 1RKWA 3M3YJ 1W0UA 2NVQJ 4DZJA 1TWGJ 1F43A 1AKHB 2VUMJ 5EF6A 3GTOJ 3FRQA 1CQTA 2NP3A 1LE8B 3G1MA 5EEAA 4UDSA 2DA5A 3E7LA 2NVXJ 3AQTA 4ME9A 5FHPA 3ON4A 4C3IJ 2JA6J 3VPRA 3BJBA 5FKNA 2XB0X 2XB5A 1B72A 2XPVA 2HDDA 4NN1A 1JTXA 3HEFA 4JX5A 1MBFA 3JSJA 3TEDA 5M3FJ 2I10A 5CW8A 3LWJA 1WH7A 4XRMA 3S15J 3BTLA 2JN6A 2LY9A 4M3DA 1JT0A 5IP6A 2DN0A 1RKTA 3BR0A 3A01B 1T56A 2M8GX 1ZR2A 1PUFA 2CUFA 3Q0WA 5F1JA 1OCTC 2FQ4A 3IH4A 1ETOA 3HOXJ 2MGQA 1ZK8A 2Y30A 5E3OA 4A3IJ 1U9NA 1UG2A 1H89C 2UXUA 5EGOB 4I6ZA 5E3LA 3ZQHA 3CWRA 4M3EA 3CDLA 1YRNB 1POGA 3GBGA 5F0FA 5DTDA 1HLVA 2MSYA 2QCOA 4FE7A 1SGMA 5E3MA 3HIMA 1JGGA 3FISA 2O8KA 1ETXA 1JTYA 1TWAJ 2IAIA 3HB9A 3NARA 5EZGA 3HTIA 3ON2A 2XGDA 3KKDA 1MSFC 5J3LA 2G7SA 2Y9YA 4LOCA 4A3JJ 5E3NA 2JK3A 2K9NA 2TCTA 2WGBA 2UXIA 1HDPA 3VVYA 2GFNA 2DTZA 3ZQLA 2H1KA 5K58A 3G56A 2ZCMA 3GEUA 2R7ZJ 5EFYA 2LLKA 3VIBA 3OSGA 4GCTA 3RKQA 4C3JJ 2RHAA 1IG7A 3KNWA 3O8HA 4S0HB 2HI3A 2QIBA 1QPIA 2KDZA 2JA8J 1WPKA 1JKRC 1MBGA 3O8GA 2UXPA 3S1QJ 3TW6A 3CRJA 4BY7J 4B3AA 5GPCA 3HOYJ 3JR9A 4A3MJ 3JRAA 1WI3A 4DW6A 3OOUA 5EZHA 1MH4A 3A03A 2RASA 2Q24A 4QIWN 3GTGJ 3S14J 3BCGA 5K7FA 3HE0A 3JRFA 3I4MJ 2TRTA 3Q0VA 3G1LA 4QTRA 2OERA 1Z77A 2HXOA 2E2IJ 3MN2A 4FCYA 2X9DA 3S1RJ 4BY1J 1WCMJ 2K40A 1BA5A 3FK7A 1VNDA 5IPAA 2DG8A 4GFLA 4B1RA 2LP0A 3BQZA 5K7ZA 4W1UA 3A02A 2DMPA 4A69C 1S7EA 5J1RA 3Q3SA 1MBEA 1HOMA 5C4YA 1Q1VA 3BG3A 1U78A 5HSZA 2GENA 5EDNA 5HBUA 5M5XJ 1GVDA 2ME0A 3P9TA 2R0QC 2OPTA 3AQSA 2JWTA 4AF5A 2E1OA 2D6YA 4FE4A 1B8IB 1RPWA 1AKHA 1NK2P 5H9TA 2QWTA 3RH2A 5J1YA
chains in the Genus database with same CATH superfamily
2QSFX 2YVXA 2IP2A 3PNVA 3FXMA 3QU6A 1T0FA 1OCCH 3CCYA 2ISZA 3ZQCA 5BMZA 4NB5A 1FEXA 2RVCA 5IP9J 3BLYA 3BG9A 3DF8A 4YIFA 3OYMA 1HDDC 5FLXZ 4I02A 1O7FA 3KIOA 1J75A 3FXKA 1W4MA 3L00A 3GZIA 2E2HJ 2CU7A 2BBYA 3ELKA 3HRSA 4ASNA 1HKTA 3FMRA 2XVCA 2F5DA 3OYEA 2XSDC 5LLQA 2HVQA 3COLA 2DG7A 1XX5A 3U21A 3TOAA 2WC2A 2OCEA 4RB0A 3JRHA 5KVRA 2MW8A 3P5JA 4IHVA 1K83J 3DTKA 2WB1N 2LKXA 2VKEA 1K7AA 1KU7A 2AXTC 3RDIA 3K8PC 1BR2A 1IAWA 3J80K 1GDTA 3HHHA 1GV2A 1BJZA 2FUG2 1OYYA 3MMYB 4U7BA 2FJ1A 5J8FA 1XS9A 3OYGA 4XMYA 4YELA 2P5KA 3BC8A 3FK6A 3NEUA 1G4DA 3S1MJ 3TOBA 3D0SA 3VOXA 4CCNA 4FX4A 2H8RA 3HKZN 2EB7A 4RAFA 3G6EI 2IT0A 3J80Z 2R7FA 4BJ5C 2K9QA 1XCBA 4PJLA 1FOWA 1U8BA 2CW8A 3V8JA 2XAJA 1JT6A 1IGNA 3QWLA 4E7JA 1YO5C 2HXIA 2OF7A 1OLTA 1ZGAA 1EJ9A 3BJAA 2CW0F 2ZJ2A 4A3CJ 1U3EM 3V6GA 5DV5A 3IL2A 3OS1A 3FKIJ 2XUBA 5AIPA 5LRSA 2EFOA 4E7ZA 2HWVA 2STWA 2EH3A 1K79A 2QKOA 1ULYA 1J59A 2A69F 2VQGA 2GIZA 3GZ5A 2G0EA 2YU3A 4XLFA 1Y0UA 3JRCA 2A6TA 1KQ0A 5TGTA 3CJQB 4C30A 4BKXA 4LLGF 1AWCA 1IUYA 2G7HA 1DUXC 1JHHA 3VVZA 2DA7A 2NVYJ 4XK4A 3T1BA 1MDMA 2DBBA 1ITYA 3OYCA 1P92A 2WB1A 4KFCA 2ZXWH 2BW3A 3IWFA 4A3KJ 3DP7A 3OL4A 2FMLA 4PXIA 1QHHD 5M3MJ 4U0WA 3TBIA 3I59A 3RYPA 2LH9A 3O6BB 3VSKA 3WTTC 1X2MA 3KKCA 2OQGA 4B43A 4PSWA 3H9JA 2BOLA 3CQZJ 1YJWI 4DZPA 5FGMA 2Q2EA 1D0XA 1R6RA 2E35A 5FKLA 2Y75A 3G73A 4IO9F 1JUMA 5FLMJ 1GT0C 2DMUA 2JA5J 2PBXA 5EYRA 2DA4A 2AHQA 2R7QA 3H5AA 4KICA 3L2CA 1YW9A 3HKZA 3A2KA 4OD4A 3EYYA 4B47A 2QYOA 2ZXJA 3QPSA 4ZTFA 3K4JA 2L7FP 3HPGA 1HW5A 3P9IA 3ANPA 1AHDP 3C07A 5E8IA 1BOAA 3EQLF 2P81A 3CCUI 3Q0UA 5BS6A 5FRNA 2TDXA 3K2AA 5IT9Z 1X58A 2HYFA 3FDYA 4YFKF 2PZ9A 4MFDA 1YJ9I 2YSRA 3KLNA 3ZR8X 1YIOA 1F5TA 2M4GA 2Q0OA 2LVSA 4EGYA 2HVSA 2PJRB 3LSMA 3EPZA 5DUIA 5LGUA 4L9TA 3IWZA 2NVTJ 1RC9A 3CLQA 2MG4A 4AC0A 1IV8A 4DIQA 1X4PA 3GLLA 1JXSA 3G4SI 4DBQA 2H6BA 1G3WA 1I39A 1L0OC 3A0BC 3CJNA 2VBYA 3TW7A 4UUSA 2J5PA 4ZYAA 1S7OA 2F4IA 2BY0A 5CYVA 3OYDA 1F4KA 1KYZA 2DK8A 2PBIA 4LB6B 3DPUA 4YIRX 3PL8A 4XKBA 2K86A 3IH2A 3E6MA 4A0YA 3J7AO 2G7LA 3CESA 4UUVA 3VP5A 1P7IA 4XIDA 2V57A 2OBPA 2LD5A 1KQ8A 2FBQA 3SQNA 4JX6A 4NQWB 5IOZA 5LEJA 3S8PA 1Y39A 1LPQA 2GOXB 4CGZA 3DQVC 3LSRA 4ESFA 4HF1A 1FX7A 2KISA 4L62A 2LSOA 2ZXIA 2G3BA 1O3QA 3BT9A 2Z99A 2JJ7A 3IV5A 2DT7B 3FHZA 1WJDA 1QU3A 3LQRA 3H9GA 2MA3A 3JRGA 4CHUA 1K6OA 3ZGKA 4U9NA 1W7PB 5D5VB 3GYHX 4DYRA 3VTIA 4K2EA 1MMGA 1ZTRA 2OI8A 1W7PD 2V1NA 3DCFA 3C2BA 2B3WA 2HEOA 1WJCA 5J40A 3WGGA 3FXUA 4U87A 5FLVA 2FRHA 3S3OA 2XAHA 3JRIA 4RDUA 3H5RA 4IQJA 1SANA 1HKSA 2QQBA 4BXUA 3WTYC 2FBHA 2YU9J 4GGGA 3S2WA 2EZHA 4XSXF 3DTIA 4YZEA 2CQ7A 3DEUA 1YQAA 1OFCX 4HDUA 1XSVA 2B9SA 1E17A 4ON0A 2FD5A 3R60A 3G1OA 1R9TJ 1IZ1A 2QA4I 2QENA 4AU7A 3F6VA 4UY8I 1TLHB 3JTGA 5F04A 2ME6A 1A31A 2NXNB 2FA5A 3BR3A 3LSJA 1ETYA 5F0HA 3W2VA 2MYSA 4AIHA 2LBFA 2KMUA 2LR8A 3DXJF 1KU2A 1TTYA 2L01A 2DMTA 1ENHA 2DCEA 3U2RA 1HC8A 1MBHA 3JRDA 2DA6A 4M74A 3TMOA 2E7WA 2Y0SN 2K3PA 5GAEJ 1R1TA 4RBOA 1W1WE 2DOFA 1LEBA 3WTSC 2HDCA 2OTJI 3AKZA 4UV8A 1RZ4A 3K1NA 1IRZA 4Y3OA 3SYTA 2R7SA 2UXHA 3IAM2 4ZDPA 3NRGA 1AOYA 4JKZA 2O7TA 3GLXA 3H3ZA 1B4AA 1MBKA 3S16J 4M6YA 3HRMA 3DPLC 4IL6C 1P4WA 2RGVA 4RB2C 4I2OA 2RNJA 2N8GA 4UUTA 3S5RA 2GWRA 1ZLKA 1P2FA 3BR6A 2CGPA 4LLLA 4LLNA 1P4AA 3VW0A 3TP0A 2V1XA 1FOXA 2CW7A 2DA3A 2IEKA 2HZDA 4BU2A 2EV6A 1H9TA 4NELA 2W25A 2ID3A 4IRVA 2P0WA 2EFWA 5DD8A 4X6AJ 2IRFG 2LNBA 2LMDA 2A3SA 4FETA 1SD6A 2V26A 3K2ZA 3CC7I 2GM4A 1OISA 1GV5A 3C7JA 1RKWA 2FNAA 4I09A 1W0UA 1U6GA 4CH7A 2NVQJ 1WSUA 4D9JA 1LUJB 4HX7A 5KCMA 4EM1A 1O3RA 1ZRCA 4AM3A 1YS7A 5DCFA 3IP4B 4BJTA 2X6XA 3KP5A 2VXZA 3JAMK 2NP3A 1HW2A 4C2TA 4UDSA 1VQ5I 2DFFA 5AONA 3OYFA 3FXLA 4CO8A 3K4LA 2Z1DA 3IC7A 4BQAA 4RLQA 3E5QA 3KP4A 4DOZA 1BI0A 5FHPA 1YHQI 3O3KA 3ZMUA 5FKNA 2QVOA 2XB5A 3V8KA 2XPVA 1B72A 2HDDA 2F5FA 2X51A 4NN1A 3JSJA 4JX5A 1Y8QB 1RI7A 2KLOA 4MEYF 2UWMA 1XDUA 1SAXA 4L9JA 1MMNA 3VODA 2BXYA 2EFNA 1IN8A 3BR0A 3EDPA 2ZSHB 2R3SA 3TO7A 1PUFA 3ERED 1N25A 4R79A 3Q0WA 1JE8A 2FQ4A 3F8MA 3IH4A 4A12A 1Y0NA 1Q1HA 2F2EA 3DU6A 3CUQC 1U2WA 4WWCA 1H89C 3B02A 4LG3A 2XF5A 2KIFA 3I71A 4M3EA 1K78A 3MZYA 1IRFA 5F0FA 1HLVA 2KRHA 4KT6A 3RYRA 2F5EA 4HQEA 3K6GA 1SGMA 1USTA 1WI9A 4S05A 4Q5SF 3J7YJ 1JTYA 3HB9A 3NARA 5EZGA 2M1BA 4GDFA 3ON2A 2XGDA 1X3UA 4O6JA 5J3LA 2KKOA 2RNGA 3K4KA 3H36A 4G8XA 4DJAA 4ENKA 2W4SA 1CF7A 4AVZA 2JTVA 2KHMA 3HG9A 4MQVA 4BGDA 4IJAA 2W85A 3ZQLA 4UB8C 2CSOA 3S32A 3MKWB 1FYKA 1BJAA 1ON1A 2DXIA 3K70C 1JHFA 1IG7A 4XLCA 5F64A 3ABUA 2XAQA 3AAFA 3QPTA 4CA0A 2PEXA 2WWYA 1QPIA 2JA8J 1WPKA 2B0LA 1MBGA 1I6XA 3CC2I 1TL8A 4YFXF 3TW6A 4KA4A 1R1UA 4AWXB 4BY7J 4B3AA 3IUOA 1TQIA 4XQFA 2CUZA 2M4KA 1KYWA 1BN5A 5J6XA 4AD9A 1KA8A 2BZTA 2VXDA 2QKMB 4RB1A 2LREA 2P5VA 4QPOA 1V54H 3S14J 2VBXA 5CPRB 5ICCA 5LFAA 3I4MJ 3Q0VA 1ON2A 1FYMA 5GADJ 1YYVA 3NWTA 2R7TA 4FCYA 2JPCA 4BY1J 2QQ8A 1MMAA 3WTVC 4B1RA 4CCJA 2LP0A 3RJPA 5K7ZA 4P96A 2HU9A 4EQQA 2WAFA 2X0LA 5FD5A 1VQOI 2QSHX 1Q1VA 4S04A 4HDVA 3ZMZA 5EDNA 2ME0A 2FE3A 4LIVA 1V3FA 1QZYA 2OPTA 3AQSA 2JWTA 2E1OA 3RKWA 3S93A 3DLLF 2D6YA 1B8IB 1RPWA 3KP3A 1Z7UA 4HQMA 1U5TB 5J1YA 1HKQA 2HVRA 3LOCA 5E17F 3G3ZA 1MJAA 1UMQA 3R0JA 1ETVA 3ULQB 1ZRFA 2GLOA 1IXRC 1MGTA 4HOBA 4KMUX 4LK1F 4F92B 4ITVA 4Q48A 2DAOA 1OPCA 5H20A 1FP1D 5K5RA 4RB3C 2V79A 3E5XA 1JGSA 3RPUA 4NDLA 2E1MC 2XKPA 3KEOA 4NUBA 4B09A 4DBRA 1QO0D 4A3LJ 5DDGA 3A01A 4JK1X 2QWWA 3GFLA 4MHGA 2LTPA 3OYBA 4M9SA 4AIJA 4HG2A 4G6DA 2M8EA 4GXOA 2NS0A 2AQEA 1XGOA 3ZQIA 4CCMA 2F5CA 3PSIA 4F93B 4NC6A 4A3BJ 2ZCWA 3GO5A 2HKXA 4XM3A 4N4OB 2X6YA 3SWHA 4N4NB 1RNLA 2JSCA 1Y1VJ 1DGWY 1BOBA 4MNUA 3L1PA 3DPJA 4RGXA 1SD7A 1L3LA 1QZZA 3HRTA 2X1EA 4PDKA 4Y33A 4XRFA 6PAXA 2XPWA 1HSTA 3EUHC 4WXDA 2ZMEB 3BTJA 4ZDOA 3F9KA 1Z21A 2UUZA 2DFHA 2L7KA 5M5WJ 4JQFA 4WK8F 4RM3A 4BEHA 2QGUA 3D5SC 2K7LA 1QGPA 4V2FA 4IHTA 4YFNF 4N0BA 4BBRJ 3KZ9A 4G12A 3MCZA 4IRHA 3NXCA 3E1SA 2HTJA 4XOPA 4E7SA 1S72I 1ODDA 5IT3A 3BY6A 2P6SA 5D6EA 2D2WA 2X48A 3OYKA 1C0WA 1S3JA 1YJNI 1K4TA 1LDKB 3HYIA 1IRXA 4X0GA 4XRSG 4N9IA 1Z0XA 2VC0A 3SEQA 1VQ9I 4EM2A 4XOTA 4A5MA 4V19K 3HOSA 2V6EA 2QF7A 1HXDA 1FIPA 4A5NA 3I0TA 4G94A 2W00A 4LG0A 1ZG1A 3K69A 1XN7A 2DTRA 1IXCA 4D0PA 4WX9A 4A93J 2DFIA 3MKZA 1FP2A 1VQPI 4B4CA 2M3AA 2NAZA 4UHTA 4IZZA 2BY2A 1FIAA 2P4WA 1IO2A 4NBQA 2NS7A 4UV9A 4II2A 2BXZA 2VN2A 2VQLA 4B3XA 3BQYA 2W48A 1ZAOA 4XN0A 3R6SA 5JHFA 2XC7A 2ADUA 3ZOBA 2H1LA 3W2AA 5JLWA 2GBYA 3ML6A 3WU0A 2HQNA 5F1RA 3P9KA 2R7XA 4XNFA 3N97A 4ZYEA 1NHAA 4EV0A 3NAUA 2PFVA 2GQQA 5HS8A 3TO9A 1B1BA 4I01A 4L5JA 1BIAA 1JKOC 3OOPA 3VEPA 1G3TA 4KYWA 4ZYGA 3CCSI 1TT0A 2J5OA 2L54A 2YX4A 5GAHJ 3LSGA 2XASA 1M1EB 3LFKA 4WXHA 2L9RA 3L2RA 1WVRA 3S2DJ 2R93J 4IRIA 2KT0A 5D5XB 5HLHA 1A35A 4KISA 3TL4X 5DM6F 2PMHA 4ZYDA 4NC7A 4M71A 2BHYA 2EZLA 4EJVA 4CXFA 4C3HJ 3AL0C 2ZOZA 3S17J 2KRCA 3BWGA 4HNVA 3HM5A 4OIQF 3RD3A 4EVIA 4BE1A 3ECOA 4I76A 4LK0F 3HSEA 2L5QA 1I6HJ 3CTAA 3H1CA 2B7EA 3CCQI 3CC4I 4EGZA 2CV1A 2CJJA 1UELB 2E5ZA 3ANGA 3FXRA 5L3FA 2HOTA 2M7BA 5A2QK 3GMEA 4AVPA 4E7KA 2O0YA 2VIXA 2HDWA 5CVRA 3GEZA 4M3FA 1YRNA 3BRUA 3E3VA 3RQ4A 3NI7A 2G7GA 2G7UA 2MBFA 2ZSIB 3LA7A 1YW8A 4LITA 4IHSA 1V4RA 1XMKA 1LJ9A 2L3DA 2QLZA 4FISA 1VFCA 3V42A 2WAQA 2OV7A 1XC5A 3EUPA 4RGRA 2H6CA 2Z3YA 3LHQA 1QPMA 1MD0A 3ZN1A 3DEEA 4Q47A 1IN7A 1S9HA 5FGLA 1BI1A 4WF2A 2NOGA 1SVMA 4F3QA 2CMPA 4O3MA 2GUHA 5DUKA 5H2FC 1I3QJ 1YX3A 3LWFA 5DCMA 3LSTA 4HV6A 3HZJA 1TNTA 5EEHA 3LFUA 4MEXF 3FXJA 5FRMA 4WIBA 2JVHA 2E2JJ 4CGRA 2XAFA 2KIQA 4GO1A 4PFOA 3B6CA 2R7UA 1XTAA 3FIWA 3RKXA 3WHBA 3HOUJ 2X4HA 4BQQA 1TWCJ 1VI0A 3GF2A 3QAHA 1IXSB 4J19A 2RN7A 5E1XA 3V78A 5FB2A 3CCJI 5ILVA 5C4JJ 5K1YA 4GFKA 3CCLI 3GZNB 1JKQC 1FJLA 2DPDA 1R22A 5H6QA 1YX5A 5ICFA 4XORA 3CMAI 2IS1A 3WHCA 3UKGA 4BS9A 1SD5A 1XD7A 3CCRI 2PJPA 5ILSA 3GTJJ 1FY7A 1NTCA 1R23A 2EA2A 1JUSA 2DK5A 5IYCJ 2HOEA 1IRGA 1PYVA 2K9LA 3IRQA 2WY7Q 3U1KA 1D0ZA 2ECCA 5CLSA 3VWBA 2XGEA 3PSFA 2JQ7A 2IS6A 1I1SA 4RGSA 1IN4A 2V7FA 4G6TB 5L3EA 2RREA 2VBZA 4UVAA 1HSJA 2A05A 2MC4A 2RDPA 2LFBA 1X1DA 1KGSA 3FXOA 1FC3A 4G9YA 4HPQA 3GZ6A 2WUIA 5B1BH 3LJLA 3H9QA 1X19A 2ELJA 3LSIA 3EGQA 2L9SA 4IF4A 2UXXA 1SFEA 2DFEA 2XKOA 2PJRA 4JL3A 3PUBA 2DO7A 2P8TA 1WZ2A 3I56I 4RAYA 1FOYA 4II3A 1X1PA 3P7NA 3TDZC 1FZPB 4F52A 2CO5A 2REKA 5D4RA 2HYJA 1T2KA 2VL8A 1MNEA 2KIUA 1W5CC 2Q2EB 3F8BA 1ZKGA 4MTEA 3LAJA 5KK1A 1ZR4A 3BCBA 3OIOA 3LSPA 2W57A 1YE9A 3EUAA 3BG6A 2F07A 2QBYA 1E3PA 5C44J 4X1EA 2EK5A 2HPMA 1QBJA 1TWGJ 1F43A 1HW1A 2A6HF 3W3CA 3HTSB 4NQWA 4OOIA 1LEAA 3FBIB 3V4GA 2B1EA 2JSPA 2F6CA 1GXPA 2DT6A 2P7VB 1CQTA 3OYNA 1T8IA 1LE8B 2VBWA 5EEAA 1PDNC 4QLCU 4PUSA 3IAS2 2DA5A 2LY1A 3E7LA 2HNHA 3VYUB 2NVXJ 3AQTA 5KNLA 1Z1DA 2ZKZA 2DQRA 3SZGA 3VPRA 1FLIA 3BJBA 3RIRA 1W7PA 4YG2F 4BQNA 3OYHA 2GA2A 1D5VA 3F3XA 4ETSA 5HS9A 5CW8A 2WADA 2WBMA 1YS6A 1B6AA 3WG7H 1WH7A 4HSRA 4XRMA 1T98A 4BDYA 2M7AA 3S15J 4M3DA 1JT0A 3H5NA 1WJAA 1QNTA 1YITI 2IW5A 1T56A 1ZR2A 2VE8A 1W5TA 2CUFA 1MMDA 1YG2A 2V1DA 4PJ0C 2I5UA 4RGUA 5F1JA 3ONQA 1SD4A 3PQJA 4U88A 4HYEA 2DDAA 1ZK8A 2DT5A 3OL3A 3NS4A 3PUFA 5EGOB 2E7XA 3ZQHA 1NH3A 2IA0A 4C2MA 3OR1C 3F23A 3GBGA 2GZWA 5DTDA 4BHBA 3COAC 2MSYA 4L0YB 2W1OA 3FISA 1TWAJ 3KKDA 5HDKA 3MKYB 2L4MA 2Y9YA 2EFQA 3KE2A 2WGBA 2UXIA 3VVYA 2GFNA 4DGWB 4E6KG 3GFIA 5K58A 2JZYA 2ZCMA 2A6EF 2L9VA 2R7ZJ 5EFYA 2LLKA 2M30A 1PUEE 4L5IA 4IPAA 4A0XA 2MC3A 3JTHA 1G3YA 2WA0A 3VFZA 4C3JJ 3BDDA 1H0MA 1Z67A 3WTXC 2HI3A 1FNNA 5JVTA 3HTUA 5D6FA 2XGXA 2FNPA 4IQ4A 3FZVA 1SMYF 3S1QJ 3IHUA 3HSFA 1SVLA 3I58A 4PSXA 4RAGA 3HOYJ 3JRAA 3NWSA 5ICEA 5EZHA 1MH4A 3KLOA 2BY1A 3GX4X 3Q5FA 2Q24A 4BL0B 2ZY9A 3GTGJ 3OS2A 5K7FA 4XONA 2GIVA 1N75A 3JRFA 4JOMA 2Y69H 3FMSA 4R8HA 2VASA 3H92A 2HXOA 3D5RC 3MN2A 4NNJA 2LBFB 3S1RJ 2LY2A 1SFUA 2V1UA 1BA5A 3FK7A 1VNDA 2DG8A 4HNUA 2ISYA 3BQZA 4HA8A 2DMPA 4A69C 1YIJI 3PFIA 4GYIA 4KT5C 4KUMA 2DDBA 1YLFA 3RKYA 5M5XJ 3FF5A 2JUCA 4NHJA 3P9TA 2CG4A 2R0QC 1ZG5A 5DYMA 3OS0A 2V6CA 1B9NA 4LMYA 2DLLA 2K5CA 2O3FA 3QODA 2VQHA 1R58A 4PCQA 1UB9A 2Q8KA 3RH2A 3BCAA 2DW4A 4MIMA 3DKYA 2YVEA 2Y31A 1GVJA 5F0CA 3HXLA 2LYCA 2KPMA 2NVUB 2PQ8A 3N05A 1GXQA 4CCOA 5L3BA 3CD6I 2BVMA 3PNYA 3ESWB 5LGNA 3DEWA 1A6IA 3ZQQA 3ZMDA 4GCVA 2ID6A 2HOSA 3ZMVA 4MXMA 2EWNA 4IXAA 1T08B 1DPUA 1T33A 1ZELA 3B6AA 2R5ZB 1BW5A 4Y7NJ 2IA2A 1Z3XA 2K3FA 1WWXA 1MJBA 2RC4A 1ZLJA 2R5YB 2EPFA 4ENMA 3BR1A 1RESA 2R7OA 1SMTA 4M73A 2E1CA 3AG2H 3K7AJ 4UNOA 4PGGA 4ICHA 5BNGA 4MFEA 3LAPA 1WGXA 2COBA 3QPLA 4UVBA 3JAMZ 4O5VA 5EG0B 1LKXA 5CVVA 3G71I 3H3VK 1S6LA 4HLXA 2VPRA 4GCLA 5GPAA 3CDHA 1R00A 3J7AY 2UXOA 2GOMA 4UVCA 2VLAA 4J00A 2JPBA 3ZQ7A 1BI3A 3K4NA 2YS9A 3LL7A 2IGKA 2XHKA 3SDGA 3F1BA 2F4MB 3QOEA 2ZCNA 1FMVA 2MFZA 2DODA 4LD5A 3I4NJ 3ABMH 3CP2A 5HOOA 2IJLA 5E1ZB 4BDZA 3IH3A 4MO7A 2EQRA 3H35A 3BPVA 4Z6YA 1MSEC 1O57A 4UXNA 2FF4A 3K4BA 4G7ZF 1SFOJ 4KN4X 1HBXG 1K61A 3M8JA 2L9NA 1EF4A 3FWEA 3DKXA 2Q1ZB 1EV7A 1P6RA 4L9VA 3C18A 1Z7LA 1F1ZA 1VQ7I 5FKMA 1UI6A 3ERMA 2E1NA 1R4NB 2WV1A 3GCMA 3KPHA 1X1CA 2HS5A 4LFUA 4G6QA 2E19A 3TO6A 1ZGWA 4DQ2A 4IOAF 4JNNA 3L2UA 2MH9A 4CUGA 3Q9VA 4EJOA 3MNLA 3VW1A 2RAEA 4QSHA 1ETWA 2OAZA 4P5OA 4JBAA 1ETQA 2CQNA 1RETA 4ZC3A 1IC8A 3QU3A 3FM3A 3SDBA 1OYWA 1R1VA 1QRYA 5F08A 2COMA 1XMXA 1RRJA 1X1BA 3KZZA 2BVLA 4B8XA 2M5WA 4FQGA 3IKVA 2ZJQF 1VQKI 1FWZA 2CUEA 2FJI1 1IDYA 3MFKA 2XGCA 1OJLA 3U1DA 1NG6A 4A3EJ 2YPRA 5IOYA 2NOJB 2BV6A 4RMNA 3ZQGA 5EJCA 2QQ9A 4HLYA 2X1CA 2V9PA 2E34A 3K0LA 2CYYA 1FSEA 4YEJA 1BI2A 2Y2ZA 3AG3H 1OCPA 3DU5A 1J2XA 1AU7A 3CCVI 1D1BA 3RQIA 3KZIC 3PPBA 2DPUA 3MAJA 3C3WA 1FTTA 2O8XA 4CYDA 5DEQA 4KIFA 1W36C 2VJIA 2RKHA 2FEZA 4M3BA 1B8IA 2NRAC 3ZMSA 1XGNA 1U5TA 4D7MA 5B5EC 4IHYA 5KHDA 4OINF 5CXGA 4XKWA 4A6DA 4P9UA 1GLNA 2ECBA 5KAIC 3V7RA 3BJOA 2UXNA 2IVMA 3PO2J 2ZO4A 4ENNA 5LEKA 3QBMA 2JT1A 3FX3A 2DA2A 2PMZN 2VQCA 3SJMA 4A3DJ 5K5QA 4IEJA 3WGIA 2ELKA 3HOVJ 3PM1A 3DBRB 3CUQB 1JJ6C 1XMAA 2CV2A 3RI4A 5LHHA 3LA2A 2C6YA 2VKVA 5FKOA 1HF0A 3BTCA 3E7QA 2ESNA 3EUKL 3VOKA 4D1QA 4CYCB 4MLOA 4E70A 2MLGA 2V4JC 3GXOA 2EINH 4W97A 2GXBA 1MKMA 3ZQFA 2R7DA 5L3GA 2R7VA 4IOCF 4I98B 3DTEA 3KP6A 3GFMA 3FMQA 3WGHA 3J81K 2WAEA 3ISPA 3KP2A 4Y13A 2ZC2A 4U7DA 3QYEA 2DOAA 2ACJA 2VODA 5D4SA 1NK3P 3ZP5A 1MBJA 4BXFA 1DPRA 1PJRA 4DYQA 2K85A 4DVYP 1UJ8A 1WQ2A 3JW4A 1GUUA 1ZREA 2EILH 2VI6A 3TQNA 5FMPA 3RTRA 2GA1A 3RZDJ 4JX4A 3QPHA 5JVGF 3OIQA 1D8KA 4AYBA 3S2HJ 1ZRDA 3VW2A 3OMYA 1MH3A 3DPTA 2ZMEA 2EV0A 2CV0A 4XN3A 2ZFUA 3K70D 1A36A 1TW3A 1ZHFA 4PZJA 3RCOA 4BBSJ 4HKUA 2VT2A 1VZ0A 5HLGA 5K7HA 2X6OA 1UI5A 1IUFA 3ZMTA 2CS3A 1J5YA 1QQIA 3K10A 2QM3A 3RZOJ 2Z33A 2PMZA 3QKXA 4EJUA 1ERDA 4BNCA 5FFXA 3HUGB 5D1RA 1I3AA 1WJ5A 1FMWA 1LFUP 3Q9SA 1N78A 2Z5UA 5DS9A 4BXXJ 1KU9A 3CLOA 4PJMA 1H9GA 3KX2A 4FTHA 2L2OA 1EH8A 4M6VA 4ABZA 4KIBA 4E4HA 3DBHB 2K9MA 3I3LA 3QP5A 2L02A 4WXCA 1Z6RA 2IXSA 1U9OA 4D5CA 2B63J 4I0AA 5HS7A 1XG1A 1FPQA 3ZCOA 3QP6A 3HBLA 2AXLA 1G8XA 4XSZF 5LHIA 4F91B 3JSPA 5J4YA 1X3WB 5J47A 1BW6A 2FX0A 3G2BA 4HZFA 4CICA 2EZKA 2JA7J 4PFPA 5D5WB 5JI6A 1XB4A 1W0TA 4BEHB 1TBXA 5LGTA 4HNTA 3LSKA 4M9XA 3M8FA 2KZGA 2HKUA 1VF9A 3NNRA 2IU5A 3CDIA 3REOA 2NX4A 2CH0A 2KFDA 4CDGA 1Y6IA 1SEUA 4N9HA 1CGPA 2AS5F 5KAFC 2H94A 4V2GA 2R92J 3HGYA 4IX7A 1VQ4I 5EEGA 4KDPA 4ZDLA 1FTZA 3W6JB 3CJDA 5FROA 3M7GA 2EJRA 4JP0A 5BPDA 2DA1A 1DU0A 1J09A 1I50J 2DJNA 1E2XA 2YVHA 1P7JA 3D1NI 2XAGA 2X1DA 2L7MP 1Y56A 2K4JA 2BGCA 2FOKA 3JSOA 2VKDA 2DMNA 5E79C 2EIMH 2WAQN 3CZ6A 3O60A 2K9SA 3OIPA 3E6DA 1APLC 2EFPA 5L3CA 2PI0A 3W6KB 1DGRM 4XLNF 3MVPA 1QVTA 1V5FA 1S29A 3F22A 1FBUA 3BR5A 2M34A 2ZNYA 3BR2A 2XV4S 1XDSA 4M3GA 5B1AH 4FT8A 3K4MA 3CJRB 2ESHA 3B73A 4XICA 2NP5A 2L4AA 3E0JB 1JKPC 1OCZH 2EV5A 4FHTA 2KDOA 3RSNA 1YW7A 2CWEA 1TT5B 2HR3A 3VUQA 2OTLI 3JREA 2LF8A 5FLXK 3CF2A 1SC7A 4L0ZB 1VQ8I 3GTMJ 2YR2A 1H88C 3JCUC 3KEQA 3L7WA 3LMMA 2W84A 3CJTB 2YX7A 2X85A 3WU2C 4OMYA 3M3YJ 1PP8F 1BIBA 3L2VA 1AKHB 2VUMJ 1UG0A 3GTOJ 4H4KC 2IGMA 3M1EA 4XLPF 3FRQA 4A6EA 1YOVB 3L9FA 3R61A 4ZJZA 2ICWG 3WTZA 4BHPA 1BBYA 2FU4A 1S7AA 3DWLE 4UB6C 3ON4A 5FD6A 2ELHA 5K5OA 3L09A 1MZBA 3F8FA 1X3ZB 2XB0X 1E3HA 1JTXA 3KFWX 5HLIA 3HEFA 5JHUA 4MQ9F 1WJFA 5M3FJ 2D1HA 1O3SA 5HDNA 4CZCA 2UZKA 3LWJA 4ZZLA 3BTLA 4HX4A 2JN6A 2LY9A 1F9NA 2M0MA 3CP8A 5A2QZ 2Y0MA 2DN0A 5IP6A 4HW0A 1RKTA 2VKHA 2ZJRF 1D1CA 4Y17A 4EATA 3DFGA 4CCLA 3BG7A 5F6FA 1BR4A 2DJIA 4M9ZA 1OCTC 1MJ9A 1IF1A 4P1WA 3L2QA 4KIGA 3HOXJ 1EKEA 1T95A 5CQEA 2UXUA 4RLFA 1IN6A 4U0VA 3CWRA 1R5GA 1U8RA 1S5LC 1YRNB 1POGA 3OV8A 3KZYA 4U0YA 3HHGA 3WODF 4FE7A 3OYLA 3HIMA 2KJCA 2O8KA 3AFHA 2MD5A 5BQTA 5CVUA 4BQOA 1ETXA 3OWTA 3CMEI 1T6SA 1MSFC 1D3YA 1EA3A 2DYRH 4M72A 2G7SA 5E3NA 3E6CC 2DU9A 2JK3A 1EH7A 2KIMA 3T0YA 3BROA 5ILUA 2FQ3A 2DTZA 5CVIA 1QHGA 2GAUA 3GEUA 1XSXA 4P9FA 4AIDA 5BOXA 2VJJA 4J01A 1OMIA 3OYIA 3VIBA 4GCTA 5JFRA 5DCMB 3NRVA 3A4CA 2RHAA 1I5ZA 3HL2A 3KNWA 3DV8A 3O8HA 4S0HB 5L3DA 1LFPA 2IPQX 2KDZA 4HF2A 3WTWC 3D5LA 1JKRC 3VB2A 1LDJA 2UXPA 1VQLI 3AL0B 5D8KB 3VSLA 5GPCA 2K27A 2DOEA 3T8RA 2O03A 3M1CA 3JR9A 4BE2A 4A3MJ 1D8JA 2W82A 3ECHA 2VPLA 2R4GA 5LHGA 3OOUA 1E0EA 4RS8A 3A03A 1ZH5A 1MW7A 3L2WA 4QIWN 1ZARA 1UFMA 1UHWA 2W24A 4HSTA 3AG1H 3WU1B 3HE0A 1XCVA 2Y48A 3QOPA 3G1LA 4QTRA 1MDMB 3OYJA 3R0AA 3MWMA 1Z77A 2BW3B 2X9DA 4OAZA 5HDGA 3WG9A 4BUPA 4GFLA 1Z91A 4W1UA 5IT9K 4ZYHA 1ZGJA 3I59B 1S7EA 1WRJA 5GTHC 5J1RA 1RR8C 3Q3SA 1MBEA 4LB5A 5HSZA 1FT9A 3I54A 2GENA 1P9QC 3BOQA 1GVDA 1SVOA 2NNNA 1UZCA 4AF5A 2OA4A 1RUNA 3C2HA 2HQRA 4FE4A 4F55A 1MMSA 3V7SA 3X2QH 1NK2P 5H9TA 4XL9A 3H3UA 4I7HA 1U0JA 5GP9A 1LE8A 1X2NA 3SFZA 2D1VA 1IDZA 2CRGA 4HEA2 1FYLA 1WH5A 4JYKA 3PO3J 5HNHA 1ACIA 3ZPLA 3E97A 3ABTA 4AUXA 3S3MA 2ZOYA 3PIOF 2OJED 3VVXA 2KZVA 1OR7C 3QYFA 4EJWA 1O3TA 2ETHA 1QA6A 2FBIA 3DKWA 2KJBA 1FOKA 4GRIA 1J7KA 2UV1A 3O2PE 1X1AA 1FBSA 3NQOA 1TZLA 2HPIA 3KETA 3BTIA 4IHXA 3OR2C 1DQUA 2H8WA 5CQGA 1K4SA 4E7HA 2A2FX 2QBYB 4YIIA 2JMWA 4A3GJ 4UUSB 1LNWA 3HRUA 1Y1WJ 1Z9CA 2ZCXA 5EGOA 3BHQA 1QVUA 5E8GA 1ZN2A 3GUDA 3GWZA 4HAMA 3I55I 1D5YA 2MD0A 3HGGA 1WJBA 1XGMA 1LVAA 2GXGA 1A5JA 2RQPA 3I4PA 2R7WA 3C2GA 1DU6A 4Y15A 2F4OB 2EIJH 2BYVE 4LJZF 4A0ZA 3CMMA 2L0KA 2DMQA 1REPC 2PN6A 4AIKA 4C2MJ 2EZIA 3ABLH 3F0CA 2IBDA 5FFZA 3WE2A 3OYAA 2OUMA 2LRDA 3KP7A 3WTUC 4L18B 3BNIA 1OQYA 2LK2A 1JJ8C 3K1PA 2A07F 4ZH4F 4GYGA 4XRSA 4HX8A 1E3OC 1OCOH 2IA1A 3PASA 2CQQA 4XBFA 3H0DA 2NNYA 1YI2I 4ACIA 2P6TA 4FASD 3DLAA 1O4XA 2M0CA 3NPIA 3HTJA 1I27A 3F6OA 1OR7A 4XLAA 5ED4A 3R4KA 4Y52J 3F8CA 5D5UB 5ICGA 1XSDA 1B9MA 5H6RA 4ESJA 1LQ1A 4PJNA 3WE3A 2QEXI 3A0HC 2EIKH 2XRLA 4XLEA 2HYTA 3GW2A 4ESBA 5F27A 3G7RA 3TKYA 1P4XA 4D5FA 1BL0A 5E20A 5TISC 4DNCA 3QRFF 3FM5A 1HCRA 3K4CA 5LBQA 1LFBA 3M07A 2ZB9A 4IVNA 3I53A 2O7OA 1OCRH 2CQXA 2Z2SB 2LF7A 4B48A 4I99C 3ZN0A 3CF5F 5D19A 3GTQJ 5AQCA 2HQ5A 4RAZA 2PFBA 3HOWJ 5J1UA 5IP7J 1RR7A 1ETKA 1WHUA 2OC6A 1BR1A 2OD5A 2QUFA 3H0GJ 4L5EA 1JI8A 4BACA 1F36A 3OY9A 2XDNA 3IUVA 3T5XA 4TV7A 1MNMC 3W2WA 3CCMI 2BEOA 3V8LA 4G7OF 4P55A 3LNQA 3HC7A 2A61A 4GCKA 4XKVA 4H0EA 1G2HA 2FSWA 1J0RA 3CO7C 2A68F 4A3FJ 3T8TA 1Z05A 2XF6A 2HKOA 1VTNC 1IJWC 4C2UA 3JRBA 2VONA 3SZTA 3LSHA 2LDUA 2NYXA 2R5ZA 2OU2A 5IYBJ 2QTQA 1D0YA 2DYSH 5J8CA 5DM7F 1DP3A 2R5YA 4F7ZA 2GXAA 3PQKA 1SFXA 1I1GA 1S8NA 1YFHA 1TQPA 1Z3YA 1IN5A 2FOWA 5EG0A 3I5UA 2LKPA 1JUPA 2KL4A 5D8LB 1TC3C 4XR6A 3BG5A 1XGSA 3SEZA 5HAWA 1ZYRF 4KJZA 2EA4A 2DI3A 4WCGA 2XAUA 3MQ0A 2Y0SA 1BC8C 3S1NJ 2ZFWA 3BPXA 3A1YA 1ONVA 2IGNA 2F48A 1WFXA 3DBLB 1TWFJ 1PP7U 1SAUA 2XROA 2H27A 4B44A 5LD2C 1KQ9A 3RPQA 2E36A 2JRTA 3I64A 2BE5F 3HDDA 1PVEA 1TQMA 5HVQC 4AC6A 4XLHA 2D45A 4YRVA 3HTHA 2ZJPF 4ANJA 2Y9ZA 2V9KA 4MTDA 5FJ8J 3SFIA 1B72B 4DYCA 4E7IA 5FKKA 3OSFA 4HRIA 2O61A 1R4MB 1U5TC 2D5VA 4KITB 1UCRA 2W53A 4KWAA 1WKMA 3QQAA 2OQRA 2DQLA 1TWHJ 2VJ5A 4CSWA 3E6BA 4MGRA 4HF0A 4ZZDA 4PK4A 2PLYA 1VQ6I 2IS4A 4MK6A 5B66C 1PUFB 2OCCH 2FXAA 2VJ4A 1A6QA 3FBNB 3PFYA 5ERIA 3GTLJ 2HFHA 1G6NA 3HTAA 3BZCA 1TP4A 3UNGC 2RQQA 2M9HA 3T6NA 3TP3A 3SHFA 1HQCA 3MKLA 4E7LA 4EJTA 2AQFA 2EBIA 2L7ZA 1R36A 2XF7A 4RA2A 5HODA 4ZTJA 1K78B 2VE9A 3EYIA 4KMFA 4OWRB 1Z6TA 1R71A 2P7CB 1D1AA 3M4OJ 2CFXA 1AA7A 1HA8A 3ZRGA 4ENJA 3HIFA 1VQNI 2M87A 1UHMA 3GVAA 1UHSA 4XKCA 1DDNA 3GTPJ 3ABKH 3VDXA 2PG4A 2XIGA 4HV5A 1G3SA 9ANTA 4EEFG 5E18F 5FO5A 1RUOA 2HOAA 1CF7B 2LOOA 3LA3A 2CFOA 4GFBA 1KONA 5DAJA 3SZPA 2MH2A 2YUSA 4PJJA 5J4VA 3HPHA 1MNDA 1BC7C 3CUOA 1T38A 4AYBN 1OYIA 3CCEI 3FHNA 2WY8Q 4CZZA 2ZMEC 5JLXA 2BHZA 2WTEA 2ZBKA 2BY3A 4NC8A 1UAAA 2KP6A 1K6YA 2AO9A 2K02A 3F21A 2CQKA 2P5LC 3HOTA 3KCCA 1T39A 3BZKA 4OMZA 2LC2A 4EMSA 4IHWA 3CUQA 2M2EA 3BP8A 3B81A 2O5RA 4I0BA 3V7CA 3W6VA 2VOOA 2NS8A 1FSHA 1IW7F 3K1MA 1H8AC 2FBKA 5M5YJ 4CYCA 2O6GE 2QOPA 1IV6A 4QPQA 3GTKJ 3CMYA 1FBQA 2KQRA 2LG4A 5B3SH 5CVJA 5D18A 4LGWA 2XDVA 3VYRB 1VQMI 1OKRA 2O9LA 1XPXA 4OIPF 4BJ6C 1EH6A 2RV8A 5C4XJ 4D7NA 2ZNZA 5CXIA 3PIPF 2Z9OA 5C3EJ 3N4MA 2CUJA 3ASNH 2KRFA 3E5UA 3P9CA 3HOZJ 2VB6A 5IYDJ 2JVGA 1A04A 1R7JA 1ORKA 2XPUA 5BPIA 1ZQ3P 3FXQA 3TDUC 4M6XA 5CKTA 4DZJA 3QYBA 1QZEA 2M45A 4C9YA 5GTIC 5EF6A 5CJ9A 1R49A 2IGOA 1SFKA 3K9TA 1KZHA 3VYTB 3G1MA 3FKJA 4CCKA 2HQAA 3J81Z 4OD5A 4ME9A 1R5HA 4C3IJ 3BJ6A 2JA6J 5HNFA 3HSRA 3BZ6A 3M8EA 5LRRA 1MBFA 1V55H 3TEDA 4Q4ZF 2I10A 2QKLB 1TW2A 2R7RA 3HUGA 1X4OA 3ASOH 3I9V2 5E1WA 3VOEA 3A01B 2M8GX 4Z2YA 2MABA 3MD2A 3RPUD 4BYYA 3SXYA 4OAYA 4RM2A 1ETOA 4R1HA 1WJEA 3VYSB 2IS2A 2MGQA 2Y30A 5E3OA 5TJJA 1U9NA 1UG2A 4A3IJ 4I6ZA 1Y8RB 3MEXA 5E3LA 1TNSA 1N77A 4FX0A 1YTYA 5DD4A 3U9GA 1W5SA 3CDLA 1NG7A 3GFJA 2Z16A 2FMYA 3F72A 2XSJC 2QCOA 3C1DA 2VT3A 3EETA 5E3MA 1JGGA 2I8DA 2QZ8A 5GAGJ 2IAIA 3HTIA 5IY5H 1W36D 3ZXSA 1USSA 4LOCA 4A3JJ 1KU3A 2STTA 1LVKA 2VC1A 1ZG3A 2K9NA 2TCTA 3IKTA 1HDPA 4L9NA 1DP7P 2E5NA 2JA2A 5HLTA 3MZHA 2E71A 2H1KA 4OIRF 3G56A 4KN7X 3UR3C 1T0FC 1G59A 4G7HF 4LIUA 2QQAA 1STZA 3IRRA 3OSGA 3KYCB 4BE0A 4KNYA 4A2UA 3RKQA 4BH9A 1R5ID 1O7LA 2W7NA 4BHCA 2H09A 3LQQA 3CO6C 3KEYA 2A5YB 2QIBA 1RIOH 1GHCA 2WV0A 2PX9A 3O8GA 2LKSA 3CRJA 3PJRA 1MIJA 2E1MB 2XRNA 1WI3A 2A5WA 4DW6A 3F8NA 1BM9A 2RASA 4U9LA 3S3NA 3BCGA 1LB2A 1J9IA 2HTSA 2TRTA 4OU0A 2QSGX 4Y4RA 4LG0B 2E60A 5JR3A 2OERA 3TGNA 2HZTA 2E2IJ 5TRDA 1WCMJ 2K40A 5IPAA 2F5VA 2K4BA 4QWQA 3A02A 2G9WA 3EUHA 5AIQA 2OZUA 1HOMA 3HJEA 5C4YA 3BG3A 4EM0B 1U78A 2PMUA 2JUGA 2VOPA 5HBUA 3M9AA 4PGHA 1B59A 2HYGD 3KYLA 2ZXHA 2JRMA 3J7ZI 2HGCA 2MLKA 2X6WA 1V5GA 3PNTA 4IKFA 4HBLA 2V9VA 3AG4H 1V5EA 3ROUA 4OIOF 2OZ6A 4IRGA 1LDDA 4BAYA 1AKHA 3KYDB 2QWTA 3MZ8A
chains in the Genus database with same CATH topology
4MIMA 2YVEA 2Y31A 3LOCA 5GP9A 5F0CA 1UMQA 1LE8A 1ETVA 1X2NA 3CCYA 2GLOA 1IDZA 2CRGA 3ZQCA 1WH5A 4JYKA 3PO3J 1FEXA 5IP9J 3BG9A 1A6IA 3DEWA 4AUXA 2ZOYA 2ID6A 1HDDC 2HOSA 4MXMA 3VVXA 1T33A 3B6AA 2R5ZB 2E2HJ 3GZIA 2CU7A 1BW5A 4Y7NJ 4NDLA 2R5YB 2XSDC 4A3LJ 3COLA 3BTIA 3BR1A 2DG7A 1RESA 3A01A 4IHXA 2LTPA 3K7AJ 4ICHA 3JRHA 5BNGA 4MFEA 1WGXA 2COBA 3QPLA 5EG0B 3ZQIA 2MW8A 4IHVA 1K83J 2JMWA 4UUSB 4A3GJ 2WB1N 1Y1WJ 3H3VK 4A3BJ 2ZCXA 2LKXA 2VPRA 4GCLA 5GPAA 5EGOA 2UXOA 3BHQA 1QVUA 2VKEA 1D5YA 3HGGA 2YS9A 1A5JA 1Y1VJ 3SDGA 3F1BA 1GDTA 3L1PA 1GV2A 3DPJA 2ZCNA 1DU6A 1BJZA 3I4NJ 2FJ1A 1XS9A 2XPWA 2L0KA 2DMQA 2EQRA 3IH3A 4MO7A 1MSEC 3BTJA 3FK6A 4C2MJ 3S1MJ 1SFOJ 2EZIA 3F0CA 2IBDA 1K61A 5M5WJ 1EF4A 3VOXA 2H8RA 3HKZN 3BNIA 2LK2A 2K9QA 4V2FA 1JJ8C 4XRSA 5FKMA 4BBRJ 1U8BA 4G12A 1UI6A 3KZ9A 1E3OC 3NXCA 3PASA 1JT6A 1IGNA 2CQQA 2WV1A 4ACIA 2HXIA 2E19A 2OF7A 1O4XA 1ZGWA 2M0CA 3NPIA 3HTJA 2X48A 4JNNA 4A3CJ 3V6GA 4Y52J 3MNLA 3VW1A 3FKIJ 2RAEA 4QSHA 1ETWA 4XRSG 1ETQA 1RETA 1Z0XA 2EH3A 1IC8A 2QKOA 1QRYA 2XRLA 5F08A 2HYTA 2G0EA 5F27A 3JRCA 3G7RA 4BKXA 4D5FA 1BL0A 2QF7A 3VVZA 2DA7A 2NVYJ 1FIPA 4XK4A 1HCRA 1ITYA 1LFBA 2CUEA 1IDYA 4A3KJ 2XGCA 1OJLA 4A3EJ 4A93J 2ZB9A 5IOYA 4PXIA 3ZQGA 2O7OA 4B4CA 2CQXA 5M3MJ 5D19A 3GTQJ 5AQCA 2HQ5A 1FIAA 3HOWJ 5J1UA 1X2MA 2Y2ZA 3KKCA 5IP7J 1RR7A 1ETKA 2NS7A 1OCPA 3H0GJ 4L5EA 1AU7A 3CQZJ 3RQIA 1F36A 2XDNA 3PPBA 4DZPA 3BQYA 2W48A 3IUVA 1MNMC 5FKLA 1FTTA 1JUMA 5FLMJ 1GT0C 2DMUA 4M3BA 3ZOBA 1B8IA 2JA5J 2PBXA 5EYRA 3LNQA 5JLWA 2DA4A 2GBYA 2AHQA 4D7MA 4IHYA 4GCKA 5CXGA 2ECBA 3QPSA 2L7FP 3ANPA 1AHDP 3PO2J 3NAUA 1G2HA 3C07A 2P81A 3QBMA 3Q0UA 4A3FJ 1JKOC 2DA2A 3K2AA 1X58A 2PMZN 3SJMA 2PZ9A 4A3DJ 4MFDA 4IEJA 2ELKA 3HOVJ 3LSGA 3PM1A 1IJWC 3JRBA 1JJ6C 2R5ZA 2LVSA 2VKVA 5IYBJ 5FKOA 1HF0A 3BTCA 2L9RA 2QTQA 3E7QA 3S2DJ 3VOKA 4CYCB 4MLOA 2R93J 2R5YA 2KT0A 4W97A 2NVTJ 2MG4A 3ZQFA 4AC0A 2EZLA 4C3HJ 2ZOZA 3S17J 5EG0A 4HNVA 3HM5A 3TW7A 3RD3A 1JUPA 4UUSA 1TC3C 3BG5A 4I76A 5HAWA 1I6HJ 1NK3P 2CJJA 3IH2A 1MBJA 4DYQA 2G7LA 3ANGA 2HOTA 3VP5A 1P7IA 1GUUA 4XIDA 3S1NJ 2V57A 2VI6A 2LD5A 2FBQA 5FMPA 3RZDJ 1TWFJ 4JX4A 4JX6A 5IOZA 4M3FA 1YRNA 3BRUA 3S2HJ 3NI7A 2G7GA 3VW2A 3LSRA 1MH3A 4L62A 3HDDA 2G3BA 3BT9A 4BBSJ 2JJ7A 3IV5A 4AC6A 3JRGA 3HTHA 4FISA 4HKUA 2Y9ZA 1VFCA 5FJ8J 1XC5A 3SFIA 1B72B 3EUPA 4DYCA 4DYRA 5K7HA 2X6OA 5FKKA 1ZTRA 1IUFA 3OSFA 1UI5A 2OI8A 3LHQA 2D5VA 3DCFA 2W53A 3RZOJ 4KWAA 3C2BA 3QKXA 3QQAA 1TWHJ 5FGLA 5D1RA 4MK6A 2NOGA 1LFUP 5DS9A 4BXXJ 5FLVA 2GUHA 3JRIA 4RDUA 1PUFB 1I3QJ 1SANA 2YU9J 3GTLJ 4FTHA 4M6VA 4ABZA 3HTAA 2EZHA 2M9HA 4YZEA 3T6NA 3TP3A 3MKLA 4D5CA 2E2JJ 1U9OA 4CGRA 2B63J 2EBIA 2L7ZA 1OFCX 1XG1A 3B6CA 3FIWA 3WHBA 5HODA 3HOUJ 3HBLA 2FD5A 1TWCJ 1VI0A 3G1OA 3M4OJ 1BW6A 1R9TJ 2FX0A 4J19A 2EZKA 3V78A 2JA7J 5F04A 2ME6A 1W0TA 5C4JJ 1UHSA 3GTPJ 4GFKA 3BR3A 3LSJA 1ETYA 5F0HA 1JKQC 2HKUA 1FJLA 1VF9A 3NNRA 9ANTA 2IU5A 4EEFG 2LR8A 2NX4A 2HOAA 2DMTA 1ENHA 3WHCA 3UKGA 1MBHA 3JRDA 4GFBA 2DA6A 2Y0SN 3GTJJ 5DAJA 2YUSA 1NTCA 4V2GA 2R92J 3HGYA 1JUSA 4RBOA 5IYCJ 1FTZA 3CJDA 2ECCA 4JP0A 4AYBN 2DA1A 1DU0A 1I50J 2DJNA 1IRZA 2XGEA 2UXHA 2YVHA 1P7JA 3D1NI 5JLXA 3NRGA 4JKZA 2L7MP 2AO9A 2O7TA 2LFBA 1MBKA 3S16J 2DMNA 2WUIA 2WAQN 3O60A 2K9SA 3LJLA 4IHWA 1APLC 2M2EA 3B81A 3EGQA 3MVPA 1QVTA 3W6VA 2NS8A 4JL3A 2N8GA 4UUTA 1H8AC 5M5YJ 4CYCA 3S5RA 3BR5A 2M34A 2QOPA 3BR2A 1IV6A 4M3GA 3GTKJ 3CMYA 2NP5A 4XICA 3BR6A 5D18A 1JKPC 2REKA 2O9LA 2HYJA 3VW0A 3TP0A 2DA3A 2IEKA 4NELA 5C4XJ 1ZKGA 4D7NA 1ZR4A 2ID3A 3VUQA 3JREA 5CXIA 5C3EJ 3OIOA 3LSPA 4X6AJ 3GTMJ 3HOZJ 1H88C 5IYDJ 2F07A 1ORKA 2XPUA 5C44J 4X1EA 2GM4A 1GV5A 1ZQ3P 1RKWA 3M3YJ 1W0UA 2NVQJ 4DZJA 1TWGJ 1F43A 1AKHB 2VUMJ 5EF6A 3GTOJ 3FRQA 1CQTA 2NP3A 1LE8B 3G1MA 5EEAA 4UDSA 2DA5A 3E7LA 2NVXJ 3AQTA 4ME9A 5FHPA 3ON4A 4C3IJ 2JA6J 3VPRA 3BJBA 5FKNA 2XB0X 2XB5A 1B72A 2XPVA 2HDDA 4NN1A 1JTXA 3HEFA 4JX5A 1MBFA 3JSJA 3TEDA 5M3FJ 2I10A 5CW8A 3LWJA 1WH7A 4XRMA 3S15J 3BTLA 2JN6A 2LY9A 4M3DA 1JT0A 5IP6A 2DN0A 1RKTA 3BR0A 3A01B 1T56A 2M8GX 1ZR2A 1PUFA 2CUFA 3Q0WA 5F1JA 1OCTC 2FQ4A 3IH4A 1ETOA 3HOXJ 2MGQA 1ZK8A 2Y30A 5E3OA 4A3IJ 1U9NA 1UG2A 1H89C 2UXUA 5EGOB 4I6ZA 5E3LA 3ZQHA 3CWRA 4M3EA 3CDLA 1YRNB 1POGA 3GBGA 5F0FA 5DTDA 1HLVA 2MSYA 2QCOA 4FE7A 1SGMA 5E3MA 3HIMA 1JGGA 3FISA 2O8KA 1ETXA 1JTYA 1TWAJ 2IAIA 3HB9A 3NARA 5EZGA 3HTIA 3ON2A 2XGDA 3KKDA 1MSFC 5J3LA 2G7SA 2Y9YA 4LOCA 4A3JJ 5E3NA 2JK3A 2K9NA 2TCTA 2WGBA 2UXIA 1HDPA 3VVYA 2GFNA 2DTZA 3ZQLA 2H1KA 5K58A 3G56A 2ZCMA 3GEUA 2R7ZJ 5EFYA 2LLKA 3VIBA 3OSGA 4GCTA 3RKQA 4C3JJ 2RHAA 1IG7A 3KNWA 3O8HA 4S0HB 2HI3A 2QIBA 1QPIA 2KDZA 2JA8J 1WPKA 1JKRC 1MBGA 3O8GA 2UXPA 3S1QJ 3TW6A 3CRJA 4BY7J 4B3AA 5GPCA 3HOYJ 3JR9A 4A3MJ 3JRAA 1WI3A 4DW6A 3OOUA 5EZHA 1MH4A 3A03A 2RASA 2Q24A 4QIWN 3GTGJ 3S14J 3BCGA 5K7FA 3HE0A 3JRFA 3I4MJ 2TRTA 3Q0VA 3G1LA 4QTRA 2OERA 1Z77A 2HXOA 2E2IJ 3MN2A 4FCYA 2X9DA 3S1RJ 4BY1J 1WCMJ 2K40A 1BA5A 3FK7A 1VNDA 5IPAA 2DG8A 4GFLA 4B1RA 2LP0A 3BQZA 5K7ZA 4W1UA 3A02A 2DMPA 4A69C 1S7EA 5J1RA 3Q3SA 1MBEA 1HOMA 5C4YA 1Q1VA 3BG3A 1U78A 5HSZA 2GENA 5EDNA 5HBUA 5M5XJ 1GVDA 2ME0A 3P9TA 2R0QC 2OPTA 3AQSA 2JWTA 4AF5A 2E1OA 2D6YA 4FE4A 1B8IB 1RPWA 1AKHA 1NK2P 5H9TA 2QWTA 3RH2A 5J1YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MIM A;  2YVE A;  2Y31 A;  3LOC A;  5GP9 A;  5F0C A;  1UMQ A;  1LE8 A;  1ETV A;  1X2N A;  3CCY A;  2GLO A;  1IDZ A;  2CRG A;  3ZQC A;  1WH5 A;  4JYK A;  3PO3 J;  1FEX A;  5IP9 J;  3BG9 A;  1A6I A;  3DEW A;  4AUX A;  2ZOY A;  2ID6 A;  1HDD C;  2HOS A;  4MXM A;  3VVX A;  1T33 A;  3B6A A;  2R5Z B;  2E2H J;  3GZI A;  2CU7 A;  1BW5 A;  4Y7N J;  4NDL A;  2R5Y B;  2XSD C;  4A3L J;  3COL A;  3BTI A;  3BR1 A;  2DG7 A;  1RES A;  3A01 A;  4IHX A;  2LTP A;  3K7A J;  4ICH A;  3JRH A;  5BNG A;  4MFE A;  1WGX A;  2COB A;  3QPL A;  5EG0 B;  3ZQI A;  2MW8 A;  4IHV A;  1K83 J;  2JMW A;  4UUS B;  4A3G J;  2WB1 N;  1Y1W J;  3H3V K;  4A3B J;  2ZCX A;  2LKX A;  2VPR A;  4GCL A;  5GPA A;  5EGO A;  2UXO A;  3BHQ A;  1QVU A;  2VKE A;  1D5Y A;  3HGG A;  2YS9 A;  1A5J A;  1Y1V J;  3SDG A;  3F1B A;  1GDT A;  3L1P A;  1GV2 A;  3DPJ A;  2ZCN A;  1DU6 A;  1BJZ A;  3I4N J;  2FJ1 A;  1XS9 A;  2XPW A;  2L0K A;  2DMQ A;  2EQR A;  3IH3 A;  4MO7 A;  1MSE C;  3BTJ A;  3FK6 A;  4C2M J;  3S1M J;  1SFO J;  2EZI A;  3F0C A;  2IBD A;  1K61 A;  5M5W J;  1EF4 A;  3VOX A;  2H8R A;  3HKZ N;  3BNI A;  2LK2 A;  2K9Q A;  4V2F A;  1JJ8 C;  4XRS A;  5FKM A;  4BBR J;  1U8B A;  4G12 A;  1UI6 A;  3KZ9 A;  1E3O C;  3NXC A;  3PAS A;  1JT6 A;  1IGN A;  2CQQ A;  2WV1 A;  4ACI A;  2HXI A;  2E19 A;  2OF7 A;  1O4X A;  1ZGW A;  2M0C A;  3NPI A;  3HTJ A;  2X48 A;  4JNN A;  4A3C J;  3V6G A;  4Y52 J;  3MNL A;  3VW1 A;  3FKI J;  2RAE A;  4QSH A;  1ETW A;  4XRS G;  1ETQ A;  1RET A;  1Z0X A;  2EH3 A;  1IC8 A;  2QKO A;  1QRY A;  2XRL A;  5F08 A;  2HYT A;  2G0E A;  5F27 A;  3JRC A;  3G7R A;  4BKX A;  4D5F A;  1BL0 A;  2QF7 A;  3VVZ A;  2DA7 A;  2NVY J;  1FIP A;  4XK4 A;  1HCR A;  1ITY A;  1LFB A;  2CUE A;  1IDY A;  4A3K J;  2XGC A;  1OJL A;  4A3E J;  4A93 J;  2ZB9 A;  5IOY A;  4PXI A;  3ZQG A;  2O7O A;  4B4C A;  2CQX A;  5M3M J;  5D19 A;  3GTQ J;  5AQC A;  2HQ5 A;  1FIA A;  3HOW J;  5J1U A;  1X2M A;  2Y2Z A;  3KKC A;  5IP7 J;  1RR7 A;  1ETK A;  2NS7 A;  1OCP A;  3H0G J;  4L5E A;  1AU7 A;  3CQZ J;  3RQI A;  1F36 A;  2XDN A;  3PPB A;  4DZP A;  3BQY A;  2W48 A;  3IUV A;  1MNM C;  5FKL A;  1FTT A;  1JUM A;  5FLM J;  1GT0 C;  2DMU A;  4M3B A;  3ZOB A;  1B8I A;  2JA5 J;  2PBX A;  5EYR A;  3LNQ A;  5JLW A;  2DA4 A;  2GBY A;  2AHQ A;  4D7M A;  4IHY A;  4GCK A;  5CXG A;  2ECB A;  3QPS A;  2L7F P;  3ANP A;  1AHD P;  3PO2 J;  3NAU A;  1G2H A;  3C07 A;  2P81 A;  3QBM A;  3Q0U A;  4A3F J;  1JKO C;  2DA2 A;  3K2A A;  1X58 A;  2PMZ N;  3SJM A;  2PZ9 A;  4A3D J;  4MFD A;  4IEJ A;  2ELK A;  3HOV J;  3LSG A;  3PM1 A;  1IJW C;  3JRB A;  1JJ6 C;  2R5Z A;  2LVS A;  2VKV A;  5IYB J;  5FKO A;  1HF0 A;  3BTC A;  2L9R A;  2QTQ A;  3E7Q A;  3S2D J;  3VOK A;  4CYC B;  4MLO A;  2R93 J;  2R5Y A;  2KT0 A;  4W97 A;  2NVT J;  2MG4 A;  3ZQF A;  4AC0 A;  2EZL A;  4C3H J;  2ZOZ A;  3S17 J;  5EG0 A;  4HNV A;  3HM5 A;  3TW7 A;  3RD3 A;  1JUP A;  4UUS A;  1TC3 C;  3BG5 A;  4I76 A;  5HAW A;  1I6H J;  1NK3 P;  2CJJ A;  3IH2 A;  1MBJ A;  4DYQ A;  2G7L A;  3ANG A;  2HOT A;  3VP5 A;  1P7I A;  1GUU A;  4XID A;  3S1N J;  2V57 A;  2VI6 A;  2LD5 A;  2FBQ A;  5FMP A;  3RZD J;  1TWF J;  4JX4 A;  4JX6 A;  5IOZ A;  4M3F A;  1YRN A;  3BRU A;  3S2H J;  3NI7 A;  2G7G A;  3VW2 A;  3LSR A;  1MH3 A;  4L62 A;  3HDD A;  2G3B A;  3BT9 A;  4BBS J;  2JJ7 A;  3IV5 A;  4AC6 A;  3JRG A;  3HTH A;  4FIS A;  4HKU A;  2Y9Z A;  1VFC A;  5FJ8 J;  1XC5 A;  3SFI A;  1B72 B;  3EUP A;  4DYC A;  4DYR A;  5K7H A;  2X6O A;  5FKK A;  1ZTR A;  1IUF A;  3OSF A;  1UI5 A;  2OI8 A;  3LHQ A;  2D5V A;  3DCF A;  2W53 A;  3RZO J;  4KWA A;  3C2B A;  3QKX A;  3QQA A;  1TWH J;  5FGL A;  5D1R A;  4MK6 A;  2NOG A;  1LFU P;  5DS9 A;  4BXX J;  5FLV A;  2GUH A;  3JRI A;  4RDU A;  1PUF B;  1I3Q J;  1SAN A;  2YU9 J;  3GTL J;  4FTH A;  4M6V A;  4ABZ A;  3HTA A;  2EZH A;  2M9H A;  4YZE A;  3T6N A;  3TP3 A;  3MKL A;  4D5C A;  2E2J J;  1U9O A;  4CGR A;  2B63 J;  2EBI A;  2L7Z A;  1OFC X;  1XG1 A;  3B6C A;  3FIW A;  3WHB A;  5HOD A;  3HOU J;  3HBL A;  2FD5 A;  1TWC J;  1VI0 A;  3G1O A;  3M4O J;  1BW6 A;  1R9T J;  2FX0 A;  4J19 A;  2EZK A;  3V78 A;  2JA7 J;  5F04 A;  2ME6 A;  1W0T A;  5C4J J;  1UHS A;  3GTP J;  4GFK A;  3BR3 A;  3LSJ A;  1ETY A;  5F0H A;  1JKQ C;  2HKU A;  1FJL A;  1VF9 A;  3NNR A;  9ANT A;  2IU5 A;  4EEF G;  2LR8 A;  2NX4 A;  2HOA A;  2DMT A;  1ENH A;  3WHC A;  3UKG A;  1MBH A;  3JRD A;  4GFB A;  2DA6 A;  2Y0S N;  3GTJ J;  5DAJ A;  2YUS A;  1NTC A;  4V2G A;  2R92 J;  3HGY A;  1JUS A;  4RBO A;  5IYC J;  1FTZ A;  3CJD A;  2ECC A;  4JP0 A;  4AYB N;  2DA1 A;  1DU0 A;  1I50 J;  2DJN A;  1IRZ A;  2XGE A;  2UXH A;  2YVH A;  1P7J A;  3D1N I;  5JLX A;  3NRG A;  4JKZ A;  2L7M P;  2AO9 A;  2O7T A;  2LFB A;  1MBK A;  3S16 J;  2DMN A;  2WUI A;  2WAQ N;  3O60 A;  2K9S A;  3LJL A;  4IHW A;  1APL C;  2M2E A;  3B81 A;  3EGQ A;  3MVP A;  1QVT A;  3W6V A;  2NS8 A;  4JL3 A;  2N8G A;  4UUT A;  1H8A C;  5M5Y J;  4CYC A;  3S5R A;  3BR5 A;  2M34 A;  2QOP A;  3BR2 A;  1IV6 A;  4M3G A;  3GTK J;  3CMY A;  2NP5 A;  4XIC A;  3BR6 A;  5D18 A;  1JKP C;  2REK A;  2O9L A;  2HYJ A;  3VW0 A;  3TP0 A;  2DA3 A;  2IEK A;  4NEL A;  5C4X J;  1ZKG A;  4D7N A;  1ZR4 A;  2ID3 A;  3VUQ A;  3JRE A;  5CXI A;  5C3E J;  3OIO A;  3LSP A;  4X6A J;  3GTM J;  3HOZ J;  1H88 C;  5IYD J;  2F07 A;  1ORK A;  2XPU A;  5C44 J;  4X1E A;  2GM4 A;  1GV5 A;  1ZQ3 P;  1RKW A;  3M3Y J;  1W0U A;  2NVQ J;  4DZJ A;  1TWG J;  1F43 A;  1AKH B;  2VUM J;  5EF6 A;  3GTO J;  3FRQ A;  1CQT A;  2NP3 A;  1LE8 B;  3G1M A;  5EEA A;  4UDS A;  2DA5 A;  3E7L A;  2NVX J;  3AQT A;  4ME9 A;  5FHP A;  3ON4 A;  4C3I J;  2JA6 J;  3VPR A;  3BJB A;  5FKN A;  2XB0 X;  2XB5 A;  1B72 A;  2XPV A;  2HDD A;  4NN1 A;  1JTX A;  3HEF A;  4JX5 A;  1MBF A;  3JSJ A;  3TED A;  5M3F J;  2I10 A;  5CW8 A;  3LWJ A;  1WH7 A;  4XRM A;  3S15 J;  3BTL A;  2JN6 A;  2LY9 A;  4M3D A;  1JT0 A;  5IP6 A;  2DN0 A;  1RKT A;  3BR0 A;  3A01 B;  1T56 A;  2M8G X;  1ZR2 A;  1PUF A;  2CUF A;  3Q0W A;  5F1J A;  1OCT C;  2FQ4 A;  3IH4 A;  1ETO A;  3HOX J;  2MGQ A;  1ZK8 A;  2Y30 A;  5E3O A;  4A3I J;  1U9N A;  1UG2 A;  1H89 C;  2UXU A;  5EGO B;  4I6Z A;  5E3L A;  3ZQH A;  3CWR A;  4M3E A;  3CDL A;  1YRN B;  1POG A;  3GBG A;  5F0F A;  5DTD A;  1HLV A;  2MSY A;  2QCO A;  4FE7 A;  1SGM A;  5E3M A;  3HIM A;  1JGG A;  3FIS A;  2O8K A;  1ETX A;  1JTY A;  1TWA J;  2IAI A;  3HB9 A;  3NAR A;  5EZG A;  3HTI A;  3ON2 A;  2XGD A;  3KKD A;  1MSF C;  5J3L A;  2G7S A;  2Y9Y A;  4LOC A;  4A3J J;  5E3N A;  2JK3 A;  2K9N A;  2TCT A;  2WGB A;  2UXI A;  1HDP A;  3VVY A;  2GFN A;  2DTZ A;  3ZQL A;  2H1K A;  5K58 A;  3G56 A;  2ZCM A;  3GEU A;  2R7Z J;  5EFY A;  2LLK A;  3VIB A;  3OSG A;  4GCT A;  3RKQ A;  4C3J J;  2RHA A;  1IG7 A;  3KNW A;  3O8H A;  4S0H B;  2HI3 A;  2QIB A;  1QPI A;  2KDZ A;  2JA8 J;  1WPK A;  1JKR C;  1MBG A;  3O8G A;  2UXP A;  3S1Q J;  3TW6 A;  3CRJ A;  4BY7 J;  4B3A A;  5GPC A;  3HOY J;  3JR9 A;  4A3M J;  3JRA A;  1WI3 A;  4DW6 A;  3OOU A;  5EZH A;  1MH4 A;  3A03 A;  2RAS A;  2Q24 A;  4QIW N;  3GTG J;  3S14 J;  3BCG A;  5K7F A;  3HE0 A;  3JRF A;  3I4M J;  2TRT A;  3Q0V A;  3G1L A;  4QTR A;  2OER A;  1Z77 A;  2HXO A;  2E2I J;  3MN2 A;  4FCY A;  2X9D A;  3S1R J;  4BY1 J;  1WCM J;  2K40 A;  1BA5 A;  3FK7 A;  1VND A;  5IPA A;  2DG8 A;  4GFL A;  4B1R A;  2LP0 A;  3BQZ A;  5K7Z A;  4W1U A;  3A02 A;  2DMP A;  4A69 C;  1S7E A;  5J1R A;  3Q3S A;  1MBE A;  1HOM A;  5C4Y A;  1Q1V A;  3BG3 A;  1U78 A;  5HSZ A;  2GEN A;  5EDN A;  5HBU A;  5M5X J;  1GVD A;  2ME0 A;  3P9T A;  2R0Q C;  2OPT A;  3AQS A;  2JWT A;  4AF5 A;  2E1O A;  2D6Y A;  4FE4 A;  1B8I B;  1RPW A;  1AKH A;  1NK2 P;  5H9T A;  2QWT A;  3RH2 A;  5J1Y A; 
#chains in the Genus database with same CATH topology
 2QSF X;  2YVX A;  2IP2 A;  3PNV A;  3FXM A;  3QU6 A;  1T0F A;  1OCC H;  3CCY A;  2ISZ A;  3ZQC A;  5BMZ A;  4NB5 A;  1FEX A;  2RVC A;  5IP9 J;  3BLY A;  3BG9 A;  3DF8 A;  4YIF A;  3OYM A;  1HDD C;  5FLX Z;  4I02 A;  1O7F A;  3KIO A;  1J75 A;  3FXK A;  1W4M A;  3L00 A;  3GZI A;  2E2H J;  2CU7 A;  2BBY A;  3ELK A;  3HRS A;  4ASN A;  1HKT A;  3FMR A;  2XVC A;  2F5D A;  3OYE A;  2XSD C;  5LLQ A;  2HVQ A;  3COL A;  2DG7 A;  1XX5 A;  3U21 A;  3TOA A;  2WC2 A;  2OCE A;  4RB0 A;  3JRH A;  5KVR A;  2MW8 A;  3P5J A;  4IHV A;  1K83 J;  3DTK A;  2WB1 N;  2LKX A;  2VKE A;  1K7A A;  1KU7 A;  2AXT C;  3RDI A;  3K8P C;  1BR2 A;  1IAW A;  3J80 K;  1GDT A;  3HHH A;  1GV2 A;  1BJZ A;  2FUG 2;  1OYY A;  3MMY B;  4U7B A;  2FJ1 A;  5J8F A;  1XS9 A;  3OYG A;  4XMY A;  4YEL A;  2P5K A;  3BC8 A;  3FK6 A;  3NEU A;  1G4D A;  3S1M J;  3TOB A;  3D0S A;  3VOX A;  4CCN A;  4FX4 A;  2H8R A;  3HKZ N;  2EB7 A;  4RAF A;  3G6E I;  2IT0 A;  3J80 Z;  2R7F A;  4BJ5 C;  2K9Q A;  1XCB A;  4PJL A;  1FOW A;  1U8B A;  2CW8 A;  3V8J A;  2XAJ A;  1JT6 A;  1IGN A;  3QWL A;  4E7J A;  1YO5 C;  2HXI A;  2OF7 A;  1OLT A;  1ZGA A;  1EJ9 A;  3BJA A;  2CW0 F;  2ZJ2 A;  4A3C J;  1U3E M;  3V6G A;  5DV5 A;  3IL2 A;  3OS1 A;  3FKI J;  2XUB A;  5AIP A;  5LRS A;  2EFO A;  4E7Z A;  2HWV A;  2STW A;  2EH3 A;  1K79 A;  2QKO A;  1ULY A;  1J59 A;  2A69 F;  2VQG A;  2GIZ A;  3GZ5 A;  2G0E A;  2YU3 A;  4XLF A;  1Y0U A;  3JRC A;  2A6T A;  1KQ0 A;  5TGT A;  3CJQ B;  4C30 A;  4BKX A;  4LLG F;  1AWC A;  1IUY A;  2G7H A;  1DUX C;  1JHH A;  3VVZ A;  2DA7 A;  2NVY J;  4XK4 A;  3T1B A;  1MDM A;  2DBB A;  1ITY A;  3OYC A;  1P92 A;  2WB1 A;  4KFC A;  2ZXW H;  2BW3 A;  3IWF A;  4A3K J;  3DP7 A;  3OL4 A;  2FML A;  4PXI A;  1QHH D;  5M3M J;  4U0W A;  3TBI A;  3I59 A;  3RYP A;  2LH9 A;  3O6B B;  3VSK A;  3WTT C;  1X2M A;  3KKC A;  2OQG A;  4B43 A;  4PSW A;  3H9J A;  2BOL A;  3CQZ J;  1YJW I;  4DZP A;  5FGM A;  2Q2E A;  1D0X A;  1R6R A;  2E35 A;  5FKL A;  2Y75 A;  3G73 A;  4IO9 F;  1JUM A;  5FLM J;  1GT0 C;  2DMU A;  2JA5 J;  2PBX A;  5EYR A;  2DA4 A;  2AHQ A;  2R7Q A;  3H5A A;  4KIC A;  3L2C A;  1YW9 A;  3HKZ A;  3A2K A;  4OD4 A;  3EYY A;  4B47 A;  2QYO A;  2ZXJ A;  3QPS A;  4ZTF A;  3K4J A;  2L7F P;  3HPG A;  1HW5 A;  3P9I A;  3ANP A;  1AHD P;  3C07 A;  5E8I A;  1BOA A;  3EQL F;  2P81 A;  3CCU I;  3Q0U A;  5BS6 A;  5FRN A;  2TDX A;  3K2A A;  5IT9 Z;  1X58 A;  2HYF A;  3FDY A;  4YFK F;  2PZ9 A;  4MFD A;  1YJ9 I;  2YSR A;  3KLN A;  3ZR8 X;  1YIO A;  1F5T A;  2M4G A;  2Q0O A;  2LVS A;  4EGY A;  2HVS A;  2PJR B;  3LSM A;  3EPZ A;  5DUI A;  5LGU A;  4L9T A;  3IWZ A;  2NVT J;  1RC9 A;  3CLQ A;  2MG4 A;  4AC0 A;  1IV8 A;  4DIQ A;  1X4P A;  3GLL A;  1JXS A;  3G4S I;  4DBQ A;  2H6B A;  1G3W A;  1I39 A;  1L0O C;  3A0B C;  3CJN A;  2VBY A;  3TW7 A;  4UUS A;  2J5P A;  4ZYA A;  1S7O A;  2F4I A;  2BY0 A;  5CYV A;  3OYD A;  1F4K A;  1KYZ A;  2DK8 A;  2PBI A;  4LB6 B;  3DPU A;  4YIR X;  3PL8 A;  4XKB A;  2K86 A;  3IH2 A;  3E6M A;  4A0Y A;  3J7A O;  2G7L A;  3CES A;  4UUV A;  3VP5 A;  1P7I A;  4XID A;  2V57 A;  2OBP A;  2LD5 A;  1KQ8 A;  2FBQ A;  3SQN A;  4JX6 A;  4NQW B;  5IOZ A;  5LEJ A;  3S8P A;  1Y39 A;  1LPQ A;  2GOX B;  4CGZ A;  3DQV C;  3LSR A;  4ESF A;  4HF1 A;  1FX7 A;  2KIS A;  4L62 A;  2LSO A;  2ZXI A;  2G3B A;  1O3Q A;  3BT9 A;  2Z99 A;  2JJ7 A;  3IV5 A;  2DT7 B;  3FHZ A;  1WJD A;  1QU3 A;  3LQR A;  3H9G A;  2MA3 A;  3JRG A;  4CHU A;  1K6O A;  3ZGK A;  4U9N A;  1W7P B;  5D5V B;  3GYH X;  4DYR A;  3VTI A;  4K2E A;  1MMG A;  1ZTR A;  2OI8 A;  1W7P D;  2V1N A;  3DCF A;  3C2B A;  2B3W A;  2HEO A;  1WJC A;  5J40 A;  3WGG A;  3FXU A;  4U87 A;  5FLV A;  2FRH A;  3S3O A;  2XAH A;  3JRI A;  4RDU A;  3H5R A;  4IQJ A;  1SAN A;  1HKS A;  2QQB A;  4BXU A;  3WTY C;  2FBH A;  2YU9 J;  4GGG A;  3S2W A;  2EZH A;  4XSX F;  3DTI A;  4YZE A;  2CQ7 A;  3DEU A;  1YQA A;  1OFC X;  4HDU A;  1XSV A;  2B9S A;  1E17 A;  4ON0 A;  2FD5 A;  3R60 A;  3G1O A;  1R9T J;  1IZ1 A;  2QA4 I;  2QEN A;  4AU7 A;  3F6V A;  4UY8 I;  1TLH B;  3JTG A;  5F04 A;  2ME6 A;  1A31 A;  2NXN B;  2FA5 A;  3BR3 A;  3LSJ A;  1ETY A;  5F0H A;  3W2V A;  2MYS A;  4AIH A;  2LBF A;  2KMU A;  2LR8 A;  3DXJ F;  1KU2 A;  1TTY A;  2L01 A;  2DMT A;  1ENH A;  2DCE A;  3U2R A;  1HC8 A;  1MBH A;  3JRD A;  2DA6 A;  4M74 A;  3TMO A;  2E7W A;  2Y0S N;  2K3P A;  5GAE J;  1R1T A;  4RBO A;  1W1W E;  2DOF A;  1LEB A;  3WTS C;  2HDC A;  2OTJ I;  3AKZ A;  4UV8 A;  1RZ4 A;  3K1N A;  1IRZ A;  4Y3O A;  3SYT A;  2R7S A;  2UXH A;  3IAM 2;  4ZDP A;  3NRG A;  1AOY A;  4JKZ A;  2O7T A;  3GLX A;  3H3Z A;  1B4A A;  1MBK A;  3S16 J;  4M6Y A;  3HRM A;  3DPL C;  4IL6 C;  1P4W A;  2RGV A;  4RB2 C;  4I2O A;  2RNJ A;  2N8G A;  4UUT A;  3S5R A;  2GWR A;  1ZLK A;  1P2F A;  3BR6 A;  2CGP A;  4LLL A;  4LLN A;  1P4A A;  3VW0 A;  3TP0 A;  2V1X A;  1FOX A;  2CW7 A;  2DA3 A;  2IEK A;  2HZD A;  4BU2 A;  2EV6 A;  1H9T A;  4NEL A;  2W25 A;  2ID3 A;  4IRV A;  2P0W A;  2EFW A;  5DD8 A;  4X6A J;  2IRF G;  2LNB A;  2LMD A;  2A3S A;  4FET A;  1SD6 A;  2V26 A;  3K2Z A;  3CC7 I;  2GM4 A;  1OIS A;  1GV5 A;  3C7J A;  1RKW A;  2FNA A;  4I09 A;  1W0U A;  1U6G A;  4CH7 A;  2NVQ J;  1WSU A;  4D9J A;  1LUJ B;  4HX7 A;  5KCM A;  4EM1 A;  1O3R A;  1ZRC A;  4AM3 A;  1YS7 A;  5DCF A;  3IP4 B;  4BJT A;  2X6X A;  3KP5 A;  2VXZ A;  3JAM K;  2NP3 A;  1HW2 A;  4C2T A;  4UDS A;  1VQ5 I;  2DFF A;  5AON A;  3OYF A;  3FXL A;  4CO8 A;  3K4L A;  2Z1D A;  3IC7 A;  4BQA A;  4RLQ A;  3E5Q A;  3KP4 A;  4DOZ A;  1BI0 A;  5FHP A;  1YHQ I;  3O3K A;  3ZMU A;  5FKN A;  2QVO A;  2XB5 A;  3V8K A;  2XPV A;  1B72 A;  2HDD A;  2F5F A;  2X51 A;  4NN1 A;  3JSJ A;  4JX5 A;  1Y8Q B;  1RI7 A;  2KLO A;  4MEY F;  2UWM A;  1XDU A;  1SAX A;  4L9J A;  1MMN A;  3VOD A;  2BXY A;  2EFN A;  1IN8 A;  3BR0 A;  3EDP A;  2ZSH B;  2R3S A;  3TO7 A;  1PUF A;  3ERE D;  1N25 A;  4R79 A;  3Q0W A;  1JE8 A;  2FQ4 A;  3F8M A;  3IH4 A;  4A12 A;  1Y0N A;  1Q1H A;  2F2E A;  3DU6 A;  3CUQ C;  1U2W A;  4WWC A;  1H89 C;  3B02 A;  4LG3 A;  2XF5 A;  2KIF A;  3I71 A;  4M3E A;  1K78 A;  3MZY A;  1IRF A;  5F0F A;  1HLV A;  2KRH A;  4KT6 A;  3RYR A;  2F5E A;  4HQE A;  3K6G A;  1SGM A;  1UST A;  1WI9 A;  4S05 A;  4Q5S F;  3J7Y J;  1JTY A;  3HB9 A;  3NAR A;  5EZG A;  2M1B A;  4GDF A;  3ON2 A;  2XGD A;  1X3U A;  4O6J A;  5J3L A;  2KKO A;  2RNG A;  3K4K A;  3H36 A;  4G8X A;  4DJA A;  4ENK A;  2W4S A;  1CF7 A;  4AVZ A;  2JTV A;  2KHM A;  3HG9 A;  4MQV A;  4BGD A;  4IJA A;  2W85 A;  3ZQL A;  4UB8 C;  2CSO A;  3S32 A;  3MKW B;  1FYK A;  1BJA A;  1ON1 A;  2DXI A;  3K70 C;  1JHF A;  1IG7 A;  4XLC A;  5F64 A;  3ABU A;  2XAQ A;  3AAF A;  3QPT A;  4CA0 A;  2PEX A;  2WWY A;  1QPI A;  2JA8 J;  1WPK A;  2B0L A;  1MBG A;  1I6X A;  3CC2 I;  1TL8 A;  4YFX F;  3TW6 A;  4KA4 A;  1R1U A;  4AWX B;  4BY7 J;  4B3A A;  3IUO A;  1TQI A;  4XQF A;  2CUZ A;  2M4K A;  1KYW A;  1BN5 A;  5J6X A;  4AD9 A;  1KA8 A;  2BZT A;  2VXD A;  2QKM B;  4RB1 A;  2LRE A;  2P5V A;  4QPO A;  1V54 H;  3S14 J;  2VBX A;  5CPR B;  5ICC A;  5LFA A;  3I4M J;  3Q0V A;  1ON2 A;  1FYM A;  5GAD J;  1YYV A;  3NWT A;  2R7T A;  4FCY A;  2JPC A;  4BY1 J;  2QQ8 A;  1MMA A;  3WTV C;  4B1R A;  4CCJ A;  2LP0 A;  3RJP A;  5K7Z A;  4P96 A;  2HU9 A;  4EQQ A;  2WAF A;  2X0L A;  5FD5 A;  1VQO I;  2QSH X;  1Q1V A;  4S04 A;  4HDV A;  3ZMZ A;  5EDN A;  2ME0 A;  2FE3 A;  4LIV A;  1V3F A;  1QZY A;  2OPT A;  3AQS A;  2JWT A;  2E1O A;  3RKW A;  3S93 A;  3DLL F;  2D6Y A;  1B8I B;  1RPW A;  3KP3 A;  1Z7U A;  4HQM A;  1U5T B;  5J1Y A;  1HKQ A;  2HVR A;  3LOC A;  5E17 F;  3G3Z A;  1MJA A;  1UMQ A;  3R0J A;  1ETV A;  3ULQ B;  1ZRF A;  2GLO A;  1IXR C;  1MGT A;  4HOB A;  4KMU X;  4LK1 F;  4F92 B;  4ITV A;  4Q48 A;  2DAO A;  1OPC A;  5H20 A;  1FP1 D;  5K5R A;  4RB3 C;  2V79 A;  3E5X A;  1JGS A;  3RPU A;  4NDL A;  2E1M C;  2XKP A;  3KEO A;  4NUB A;  4B09 A;  4DBR A;  1QO0 D;  4A3L J;  5DDG A;  3A01 A;  4JK1 X;  2QWW A;  3GFL A;  4MHG A;  2LTP A;  3OYB A;  4M9S A;  4AIJ A;  4HG2 A;  4G6D A;  2M8E A;  4GXO A;  2NS0 A;  2AQE A;  1XGO A;  3ZQI A;  4CCM A;  2F5C A;  3PSI A;  4F93 B;  4NC6 A;  4A3B J;  2ZCW A;  3GO5 A;  2HKX A;  4XM3 A;  4N4O B;  2X6Y A;  3SWH A;  4N4N B;  1RNL A;  2JSC A;  1Y1V J;  1DGW Y;  1BOB A;  4MNU A;  3L1P A;  3DPJ A;  4RGX A;  1SD7 A;  1L3L A;  1QZZ A;  3HRT A;  2X1E A;  4PDK A;  4Y33 A;  4XRF A;  6PAX A;  2XPW A;  1HST A;  3EUH C;  4WXD A;  2ZME B;  3BTJ A;  4ZDO A;  3F9K A;  1Z21 A;  2UUZ A;  2DFH A;  2L7K A;  5M5W J;  4JQF A;  4WK8 F;  4RM3 A;  4BEH A;  2QGU A;  3D5S C;  2K7L A;  1QGP A;  4V2F A;  4IHT A;  4YFN F;  4N0B A;  4BBR J;  3KZ9 A;  4G12 A;  3MCZ A;  4IRH A;  3NXC A;  3E1S A;  2HTJ A;  4XOP A;  4E7S A;  1S72 I;  1ODD A;  5IT3 A;  3BY6 A;  2P6S A;  5D6E A;  2D2W A;  2X48 A;  3OYK A;  1C0W A;  1S3J A;  1YJN I;  1K4T A;  1LDK B;  3HYI A;  1IRX A;  4X0G A;  4XRS G;  4N9I A;  1Z0X A;  2VC0 A;  3SEQ A;  1VQ9 I;  4EM2 A;  4XOT A;  4A5M A;  4V19 K;  3HOS A;  2V6E A;  2QF7 A;  1HXD A;  1FIP A;  4A5N A;  3I0T A;  4G94 A;  2W00 A;  4LG0 A;  1ZG1 A;  3K69 A;  1XN7 A;  2DTR A;  1IXC A;  4D0P A;  4WX9 A;  4A93 J;  2DFI A;  3MKZ A;  1FP2 A;  1VQP I;  4B4C A;  2M3A A;  2NAZ A;  4UHT A;  4IZZ A;  2BY2 A;  1FIA A;  2P4W A;  1IO2 A;  4NBQ A;  2NS7 A;  4UV9 A;  4II2 A;  2BXZ A;  2VN2 A;  2VQL A;  4B3X A;  3BQY A;  2W48 A;  1ZAO A;  4XN0 A;  3R6S A;  5JHF A;  2XC7 A;  2ADU A;  3ZOB A;  2H1L A;  3W2A A;  5JLW A;  2GBY A;  3ML6 A;  3WU0 A;  2HQN A;  5F1R A;  3P9K A;  2R7X A;  4XNF A;  3N97 A;  4ZYE A;  1NHA A;  4EV0 A;  3NAU A;  2PFV A;  2GQQ A;  5HS8 A;  3TO9 A;  1B1B A;  4I01 A;  4L5J A;  1BIA A;  1JKO C;  3OOP A;  3VEP A;  1G3T A;  4KYW A;  4ZYG A;  3CCS I;  1TT0 A;  2J5O A;  2L54 A;  2YX4 A;  5GAH J;  3LSG A;  2XAS A;  1M1E B;  3LFK A;  4WXH A;  2L9R A;  3L2R A;  1WVR A;  3S2D J;  2R93 J;  4IRI A;  2KT0 A;  5D5X B;  5HLH A;  1A35 A;  4KIS A;  3TL4 X;  5DM6 F;  2PMH A;  4ZYD A;  4NC7 A;  4M71 A;  2BHY A;  2EZL A;  4EJV A;  4CXF A;  4C3H J;  3AL0 C;  2ZOZ A;  3S17 J;  2KRC A;  3BWG A;  4HNV A;  3HM5 A;  4OIQ F;  3RD3 A;  4EVI A;  4BE1 A;  3ECO A;  4I76 A;  4LK0 F;  3HSE A;  2L5Q A;  1I6H J;  3CTA A;  3H1C A;  2B7E A;  3CCQ I;  3CC4 I;  4EGZ A;  2CV1 A;  2CJJ A;  1UEL B;  2E5Z A;  3ANG A;  3FXR A;  5L3F A;  2HOT A;  2M7B A;  5A2Q K;  3GME A;  4AVP A;  4E7K A;  2O0Y A;  2VIX A;  2HDW A;  5CVR A;  3GEZ A;  4M3F A;  1YRN A;  3BRU A;  3E3V A;  3RQ4 A;  3NI7 A;  2G7G A;  2G7U A;  2MBF A;  2ZSI B;  3LA7 A;  1YW8 A;  4LIT A;  4IHS A;  1V4R A;  1XMK A;  1LJ9 A;  2L3D A;  2QLZ A;  4FIS A;  1VFC A;  3V42 A;  2WAQ A;  2OV7 A;  1XC5 A;  3EUP A;  4RGR A;  2H6C A;  2Z3Y A;  3LHQ A;  1QPM A;  1MD0 A;  3ZN1 A;  3DEE A;  4Q47 A;  1IN7 A;  1S9H A;  5FGL A;  1BI1 A;  4WF2 A;  2NOG A;  1SVM A;  4F3Q A;  2CMP A;  4O3M A;  2GUH A;  5DUK A;  5H2F C;  1I3Q J;  1YX3 A;  3LWF A;  5DCM A;  3LST A;  4HV6 A;  3HZJ A;  1TNT A;  5EEH A;  3LFU A;  4MEX F;  3FXJ A;  5FRM A;  4WIB A;  2JVH A;  2E2J J;  4CGR A;  2XAF A;  2KIQ A;  4GO1 A;  4PFO A;  3B6C A;  2R7U A;  1XTA A;  3FIW A;  3RKX A;  3WHB A;  3HOU J;  2X4H A;  4BQQ A;  1TWC J;  1VI0 A;  3GF2 A;  3QAH A;  1IXS B;  4J19 A;  2RN7 A;  5E1X A;  3V78 A;  5FB2 A;  3CCJ I;  5ILV A;  5C4J J;  5K1Y A;  4GFK A;  3CCL I;  3GZN B;  1JKQ C;  1FJL A;  2DPD A;  1R22 A;  5H6Q A;  1YX5 A;  5ICF A;  4XOR A;  3CMA I;  2IS1 A;  3WHC A;  3UKG A;  4BS9 A;  1SD5 A;  1XD7 A;  3CCR I;  2PJP A;  5ILS A;  3GTJ J;  1FY7 A;  1NTC A;  1R23 A;  2EA2 A;  1JUS A;  2DK5 A;  5IYC J;  2HOE A;  1IRG A;  1PYV A;  2K9L A;  3IRQ A;  2WY7 Q;  3U1K A;  1D0Z A;  2ECC A;  5CLS A;  3VWB A;  2XGE A;  3PSF A;  2JQ7 A;  2IS6 A;  1I1S A;  4RGS A;  1IN4 A;  2V7F A;  4G6T B;  5L3E A;  2RRE A;  2VBZ A;  4UVA A;  1HSJ A;  2A05 A;  2MC4 A;  2RDP A;  2LFB A;  1X1D A;  1KGS A;  3FXO A;  1FC3 A;  4G9Y A;  4HPQ A;  3GZ6 A;  2WUI A;  5B1B H;  3LJL A;  3H9Q A;  1X19 A;  2ELJ A;  3LSI A;  3EGQ A;  2L9S A;  4IF4 A;  2UXX A;  1SFE A;  2DFE A;  2XKO A;  2PJR A;  4JL3 A;  3PUB A;  2DO7 A;  2P8T A;  1WZ2 A;  3I56 I;  4RAY A;  1FOY A;  4II3 A;  1X1P A;  3P7N A;  3TDZ C;  1FZP B;  4F52 A;  2CO5 A;  2REK A;  5D4R A;  2HYJ A;  1T2K A;  2VL8 A;  1MNE A;  2KIU A;  1W5C C;  2Q2E B;  3F8B A;  1ZKG A;  4MTE A;  3LAJ A;  5KK1 A;  1ZR4 A;  3BCB A;  3OIO A;  3LSP A;  2W57 A;  1YE9 A;  3EUA A;  3BG6 A;  2F07 A;  2QBY A;  1E3P A;  5C44 J;  4X1E A;  2EK5 A;  2HPM A;  1QBJ A;  1TWG J;  1F43 A;  1HW1 A;  2A6H F;  3W3C A;  3HTS B;  4NQW A;  4OOI A;  1LEA A;  3FBI B;  3V4G A;  2B1E A;  2JSP A;  2F6C A;  1GXP A;  2DT6 A;  2P7V B;  1CQT A;  3OYN A;  1T8I A;  1LE8 B;  2VBW A;  5EEA A;  1PDN C;  4QLC U;  4PUS A;  3IAS 2;  2DA5 A;  2LY1 A;  3E7L A;  2HNH A;  3VYU B;  2NVX J;  3AQT A;  5KNL A;  1Z1D A;  2ZKZ A;  2DQR A;  3SZG A;  3VPR A;  1FLI A;  3BJB A;  3RIR A;  1W7P A;  4YG2 F;  4BQN A;  3OYH A;  2GA2 A;  1D5V A;  3F3X A;  4ETS A;  5HS9 A;  5CW8 A;  2WAD A;  2WBM A;  1YS6 A;  1B6A A;  3WG7 H;  1WH7 A;  4HSR A;  4XRM A;  1T98 A;  4BDY A;  2M7A A;  3S15 J;  4M3D A;  1JT0 A;  3H5N A;  1WJA A;  1QNT A;  1YIT I;  2IW5 A;  1T56 A;  1ZR2 A;  2VE8 A;  1W5T A;  2CUF A;  1MMD A;  1YG2 A;  2V1D A;  4PJ0 C;  2I5U A;  4RGU A;  5F1J A;  3ONQ A;  1SD4 A;  3PQJ A;  4U88 A;  4HYE A;  2DDA A;  1ZK8 A;  2DT5 A;  3OL3 A;  3NS4 A;  3PUF A;  5EGO B;  2E7X A;  3ZQH A;  1NH3 A;  2IA0 A;  4C2M A;  3OR1 C;  3F23 A;  3GBG A;  2GZW A;  5DTD A;  4BHB A;  3COA C;  2MSY A;  4L0Y B;  2W1O A;  3FIS A;  1TWA J;  3KKD A;  5HDK A;  3MKY B;  2L4M A;  2Y9Y A;  2EFQ A;  3KE2 A;  2WGB A;  2UXI A;  3VVY A;  2GFN A;  4DGW B;  4E6K G;  3GFI A;  5K58 A;  2JZY A;  2ZCM A;  2A6E F;  2L9V A;  2R7Z J;  5EFY A;  2LLK A;  2M30 A;  1PUE E;  4L5I A;  4IPA A;  4A0X A;  2MC3 A;  3JTH A;  1G3Y A;  2WA0 A;  3VFZ A;  4C3J J;  3BDD A;  1H0M A;  1Z67 A;  3WTX C;  2HI3 A;  1FNN A;  5JVT A;  3HTU A;  5D6F A;  2XGX A;  2FNP A;  4IQ4 A;  3FZV A;  1SMY F;  3S1Q J;  3IHU A;  3HSF A;  1SVL A;  3I58 A;  4PSX A;  4RAG A;  3HOY J;  3JRA A;  3NWS A;  5ICE A;  5EZH A;  1MH4 A;  3KLO A;  2BY1 A;  3GX4 X;  3Q5F A;  2Q24 A;  4BL0 B;  2ZY9 A;  3GTG J;  3OS2 A;  5K7F A;  4XON A;  2GIV A;  1N75 A;  3JRF A;  4JOM A;  2Y69 H;  3FMS A;  4R8H A;  2VAS A;  3H92 A;  2HXO A;  3D5R C;  3MN2 A;  4NNJ A;  2LBF B;  3S1R J;  2LY2 A;  1SFU A;  2V1U A;  1BA5 A;  3FK7 A;  1VND A;  2DG8 A;  4HNU A;  2ISY A;  3BQZ A;  4HA8 A;  2DMP A;  4A69 C;  1YIJ I;  3PFI A;  4GYI A;  4KT5 C;  4KUM A;  2DDB A;  1YLF A;  3RKY A;  5M5X J;  3FF5 A;  2JUC A;  4NHJ A;  3P9T A;  2CG4 A;  2R0Q C;  1ZG5 A;  5DYM A;  3OS0 A;  2V6C A;  1B9N A;  4LMY A;  2DLL A;  2K5C A;  2O3F A;  3QOD A;  2VQH A;  1R58 A;  4PCQ A;  1UB9 A;  2Q8K A;  3RH2 A;  3BCA A;  2DW4 A;  4MIM A;  3DKY A;  2YVE A;  2Y31 A;  1GVJ A;  5F0C A;  3HXL A;  2LYC A;  2KPM A;  2NVU B;  2PQ8 A;  3N05 A;  1GXQ A;  4CCO A;  5L3B A;  3CD6 I;  2BVM A;  3PNY A;  3ESW B;  5LGN A;  3DEW A;  1A6I A;  3ZQQ A;  3ZMD A;  4GCV A;  2ID6 A;  2HOS A;  3ZMV A;  4MXM A;  2EWN A;  4IXA A;  1T08 B;  1DPU A;  1T33 A;  1ZEL A;  3B6A A;  2R5Z B;  1BW5 A;  4Y7N J;  2IA2 A;  1Z3X A;  2K3F A;  1WWX A;  1MJB A;  2RC4 A;  1ZLJ A;  2R5Y B;  2EPF A;  4ENM A;  3BR1 A;  1RES A;  2R7O A;  1SMT A;  4M73 A;  2E1C A;  3AG2 H;  3K7A J;  4UNO A;  4PGG A;  4ICH A;  5BNG A;  4MFE A;  3LAP A;  1WGX A;  2COB A;  3QPL A;  4UVB A;  3JAM Z;  4O5V A;  5EG0 B;  1LKX A;  5CVV A;  3G71 I;  3H3V K;  1S6L A;  4HLX A;  2VPR A;  4GCL A;  5GPA A;  3CDH A;  1R00 A;  3J7A Y;  2UXO A;  2GOM A;  4UVC A;  2VLA A;  4J00 A;  2JPB A;  3ZQ7 A;  1BI3 A;  3K4N A;  2YS9 A;  3LL7 A;  2IGK A;  2XHK A;  3SDG A;  3F1B A;  2F4M B;  3QOE A;  2ZCN A;  1FMV A;  2MFZ A;  2DOD A;  4LD5 A;  3I4N J;  3ABM H;  3CP2 A;  5HOO A;  2IJL A;  5E1Z B;  4BDZ A;  3IH3 A;  4MO7 A;  2EQR A;  3H35 A;  3BPV A;  4Z6Y A;  1MSE C;  1O57 A;  4UXN A;  2FF4 A;  3K4B A;  4G7Z F;  1SFO J;  4KN4 X;  1HBX G;  1K61 A;  3M8J A;  2L9N A;  1EF4 A;  3FWE A;  3DKX A;  2Q1Z B;  1EV7 A;  1P6R A;  4L9V A;  3C18 A;  1Z7L A;  1F1Z A;  1VQ7 I;  5FKM A;  1UI6 A;  3ERM A;  2E1N A;  1R4N B;  2WV1 A;  3GCM A;  3KPH A;  1X1C A;  2HS5 A;  4LFU A;  4G6Q A;  2E19 A;  3TO6 A;  1ZGW A;  4DQ2 A;  4IOA F;  4JNN A;  3L2U A;  2MH9 A;  4CUG A;  3Q9V A;  4EJO A;  3MNL A;  3VW1 A;  2RAE A;  4QSH A;  1ETW A;  2OAZ A;  4P5O A;  4JBA A;  1ETQ A;  2CQN A;  1RET A;  4ZC3 A;  1IC8 A;  3QU3 A;  3FM3 A;  3SDB A;  1OYW A;  1R1V A;  1QRY A;  5F08 A;  2COM A;  1XMX A;  1RRJ A;  1X1B A;  3KZZ A;  2BVL A;  4B8X A;  2M5W A;  4FQG A;  3IKV A;  2ZJQ F;  1VQK I;  1FWZ A;  2CUE A;  2FJI 1;  1IDY A;  3MFK A;  2XGC A;  1OJL A;  3U1D A;  1NG6 A;  4A3E J;  2YPR A;  5IOY A;  2NOJ B;  2BV6 A;  4RMN A;  3ZQG A;  5EJC A;  2QQ9 A;  4HLY A;  2X1C A;  2V9P A;  2E34 A;  3K0L A;  2CYY A;  1FSE A;  4YEJ A;  1BI2 A;  2Y2Z A;  3AG3 H;  1OCP A;  3DU5 A;  1J2X A;  1AU7 A;  3CCV I;  1D1B A;  3RQI A;  3KZI C;  3PPB A;  2DPU A;  3MAJ A;  3C3W A;  1FTT A;  2O8X A;  4CYD A;  5DEQ A;  4KIF A;  1W36 C;  2VJI A;  2RKH A;  2FEZ A;  4M3B A;  1B8I A;  2NRA C;  3ZMS A;  1XGN A;  1U5T A;  4D7M A;  5B5E C;  4IHY A;  5KHD A;  4OIN F;  5CXG A;  4XKW A;  4A6D A;  4P9U A;  1GLN A;  2ECB A;  5KAI C;  3V7R A;  3BJO A;  2UXN A;  2IVM A;  3PO2 J;  2ZO4 A;  4ENN A;  5LEK A;  3QBM A;  2JT1 A;  3FX3 A;  2DA2 A;  2PMZ N;  2VQC A;  3SJM A;  4A3D J;  5K5Q A;  4IEJ A;  3WGI A;  2ELK A;  3HOV J;  3PM1 A;  3DBR B;  3CUQ B;  1JJ6 C;  1XMA A;  2CV2 A;  3RI4 A;  5LHH A;  3LA2 A;  2C6Y A;  2VKV A;  5FKO A;  1HF0 A;  3BTC A;  3E7Q A;  2ESN A;  3EUK L;  3VOK A;  4D1Q A;  4CYC B;  4MLO A;  4E70 A;  2MLG A;  2V4J C;  3GXO A;  2EIN H;  4W97 A;  2GXB A;  1MKM A;  3ZQF A;  2R7D A;  5L3G A;  2R7V A;  4IOC F;  4I98 B;  3DTE A;  3KP6 A;  3GFM A;  3FMQ A;  3WGH A;  3J81 K;  2WAE A;  3ISP A;  3KP2 A;  4Y13 A;  2ZC2 A;  4U7D A;  3QYE A;  2DOA A;  2ACJ A;  2VOD A;  5D4S A;  1NK3 P;  3ZP5 A;  1MBJ A;  4BXF A;  1DPR A;  1PJR A;  4DYQ A;  2K85 A;  4DVY P;  1UJ8 A;  1WQ2 A;  3JW4 A;  1GUU A;  1ZRE A;  2EIL H;  2VI6 A;  3TQN A;  5FMP A;  3RTR A;  2GA1 A;  3RZD J;  4JX4 A;  3QPH A;  5JVG F;  3OIQ A;  1D8K A;  4AYB A;  3S2H J;  1ZRD A;  3VW2 A;  3OMY A;  1MH3 A;  3DPT A;  2ZME A;  2EV0 A;  2CV0 A;  4XN3 A;  2ZFU A;  3K70 D;  1A36 A;  1TW3 A;  1ZHF A;  4PZJ A;  3RCO A;  4BBS J;  4HKU A;  2VT2 A;  1VZ0 A;  5HLG A;  5K7H A;  2X6O A;  1UI5 A;  1IUF A;  3ZMT A;  2CS3 A;  1J5Y A;  1QQI A;  3K10 A;  2QM3 A;  3RZO J;  2Z33 A;  2PMZ A;  3QKX A;  4EJU A;  1ERD A;  4BNC A;  5FFX A;  3HUG B;  5D1R A;  1I3A A;  1WJ5 A;  1FMW A;  1LFU P;  3Q9S A;  1N78 A;  2Z5U A;  5DS9 A;  4BXX J;  1KU9 A;  3CLO A;  4PJM A;  1H9G A;  3KX2 A;  4FTH A;  2L2O A;  1EH8 A;  4M6V A;  4ABZ A;  4KIB A;  4E4H A;  3DBH B;  2K9M A;  3I3L A;  3QP5 A;  2L02 A;  4WXC A;  1Z6R A;  2IXS A;  1U9O A;  4D5C A;  2B63 J;  4I0A A;  5HS7 A;  1XG1 A;  1FPQ A;  3ZCO A;  3QP6 A;  3HBL A;  2AXL A;  1G8X A;  4XSZ F;  5LHI A;  4F91 B;  3JSP A;  5J4Y A;  1X3W B;  5J47 A;  1BW6 A;  2FX0 A;  3G2B A;  4HZF A;  4CIC A;  2EZK A;  2JA7 J;  4PFP A;  5D5W B;  5JI6 A;  1XB4 A;  1W0T A;  4BEH B;  1TBX A;  5LGT A;  4HNT A;  3LSK A;  4M9X A;  3M8F A;  2KZG A;  2HKU A;  1VF9 A;  3NNR A;  2IU5 A;  3CDI A;  3REO A;  2NX4 A;  2CH0 A;  2KFD A;  4CDG A;  1Y6I A;  1SEU A;  4N9H A;  1CGP A;  2AS5 F;  5KAF C;  2H94 A;  4V2G A;  2R92 J;  3HGY A;  4IX7 A;  1VQ4 I;  5EEG A;  4KDP A;  4ZDL A;  1FTZ A;  3W6J B;  3CJD A;  5FRO A;  3M7G A;  2EJR A;  4JP0 A;  5BPD A;  2DA1 A;  1DU0 A;  1J09 A;  1I50 J;  2DJN A;  1E2X A;  2YVH A;  1P7J A;  3D1N I;  2XAG A;  2X1D A;  2L7M P;  1Y56 A;  2K4J A;  2BGC A;  2FOK A;  3JSO A;  2VKD A;  2DMN A;  5E79 C;  2EIM H;  2WAQ N;  3CZ6 A;  3O60 A;  2K9S A;  3OIP A;  3E6D A;  1APL C;  2EFP A;  5L3C A;  2PI0 A;  3W6K B;  1DGR M;  4XLN F;  3MVP A;  1QVT A;  1V5F A;  1S29 A;  3F22 A;  1FBU A;  3BR5 A;  2M34 A;  2ZNY A;  3BR2 A;  2XV4 S;  1XDS A;  4M3G A;  5B1A H;  4FT8 A;  3K4M A;  3CJR B;  2ESH A;  3B73 A;  4XIC A;  2NP5 A;  2L4A A;  3E0J B;  1JKP C;  1OCZ H;  2EV5 A;  4FHT A;  2KDO A;  3RSN A;  1YW7 A;  2CWE A;  1TT5 B;  2HR3 A;  3VUQ A;  2OTL I;  3JRE A;  2LF8 A;  5FLX K;  3CF2 A;  1SC7 A;  4L0Z B;  1VQ8 I;  3GTM J;  2YR2 A;  1H88 C;  3JCU C;  3KEQ A;  3L7W A;  3LMM A;  2W84 A;  3CJT B;  2YX7 A;  2X85 A;  3WU2 C;  4OMY A;  3M3Y J;  1PP8 F;  1BIB A;  3L2V A;  1AKH B;  2VUM J;  1UG0 A;  3GTO J;  4H4K C;  2IGM A;  3M1E A;  4XLP F;  3FRQ A;  4A6E A;  1YOV B;  3L9F A;  3R61 A;  4ZJZ A;  2ICW G;  3WTZ A;  4BHP A;  1BBY A;  2FU4 A;  1S7A A;  3DWL E;  4UB6 C;  3ON4 A;  5FD6 A;  2ELH A;  5K5O A;  3L09 A;  1MZB A;  3F8F A;  1X3Z B;  2XB0 X;  1E3H A;  1JTX A;  3KFW X;  5HLI A;  3HEF A;  5JHU A;  4MQ9 F;  1WJF A;  5M3F J;  2D1H A;  1O3S A;  5HDN A;  4CZC A;  2UZK A;  3LWJ A;  4ZZL A;  3BTL A;  4HX4 A;  2JN6 A;  2LY9 A;  1F9N A;  2M0M A;  3CP8 A;  5A2Q Z;  2Y0M A;  2DN0 A;  5IP6 A;  4HW0 A;  1RKT A;  2VKH A;  2ZJR F;  1D1C A;  4Y17 A;  4EAT A;  3DFG A;  4CCL A;  3BG7 A;  5F6F A;  1BR4 A;  2DJI A;  4M9Z A;  1OCT C;  1MJ9 A;  1IF1 A;  4P1W A;  3L2Q A;  4KIG A;  3HOX J;  1EKE A;  1T95 A;  5CQE A;  2UXU A;  4RLF A;  1IN6 A;  4U0V A;  3CWR A;  1R5G A;  1U8R A;  1S5L C;  1YRN B;  1POG A;  3OV8 A;  3KZY A;  4U0Y A;  3HHG A;  3WOD F;  4FE7 A;  3OYL A;  3HIM A;  2KJC A;  2O8K A;  3AFH A;  2MD5 A;  5BQT A;  5CVU A;  4BQO A;  1ETX A;  3OWT A;  3CME I;  1T6S A;  1MSF C;  1D3Y A;  1EA3 A;  2DYR H;  4M72 A;  2G7S A;  5E3N A;  3E6C C;  2DU9 A;  2JK3 A;  1EH7 A;  2KIM A;  3T0Y A;  3BRO A;  5ILU A;  2FQ3 A;  2DTZ A;  5CVI A;  1QHG A;  2GAU A;  3GEU A;  1XSX A;  4P9F A;  4AID A;  5BOX A;  2VJJ A;  4J01 A;  1OMI A;  3OYI A;  3VIB A;  4GCT A;  5JFR A;  5DCM B;  3NRV A;  3A4C A;  2RHA A;  1I5Z A;  3HL2 A;  3KNW A;  3DV8 A;  3O8H A;  4S0H B;  5L3D A;  1LFP A;  2IPQ X;  2KDZ A;  4HF2 A;  3WTW C;  3D5L A;  1JKR C;  3VB2 A;  1LDJ A;  2UXP A;  1VQL I;  3AL0 B;  5D8K B;  3VSL A;  5GPC A;  2K27 A;  2DOE A;  3T8R A;  2O03 A;  3M1C A;  3JR9 A;  4BE2 A;  4A3M J;  1D8J A;  2W82 A;  3ECH A;  2VPL A;  2R4G A;  5LHG A;  3OOU A;  1E0E A;  4RS8 A;  3A03 A;  1ZH5 A;  1MW7 A;  3L2W A;  4QIW N;  1ZAR A;  1UFM A;  1UHW A;  2W24 A;  4HST A;  3AG1 H;  3WU1 B;  3HE0 A;  1XCV A;  2Y48 A;  3QOP A;  3G1L A;  4QTR A;  1MDM B;  3OYJ A;  3R0A A;  3MWM A;  1Z77 A;  2BW3 B;  2X9D A;  4OAZ A;  5HDG A;  3WG9 A;  4BUP A;  4GFL A;  1Z91 A;  4W1U A;  5IT9 K;  4ZYH A;  1ZGJ A;  3I59 B;  1S7E A;  1WRJ A;  5GTH C;  5J1R A;  1RR8 C;  3Q3S A;  1MBE A;  4LB5 A;  5HSZ A;  1FT9 A;  3I54 A;  2GEN A;  1P9Q C;  3BOQ A;  1GVD A;  1SVO A;  2NNN A;  1UZC A;  4AF5 A;  2OA4 A;  1RUN A;  3C2H A;  2HQR A;  4FE4 A;  4F55 A;  1MMS A;  3V7S A;  3X2Q H;  1NK2 P;  5H9T A;  4XL9 A;  3H3U A;  4I7H A;  1U0J A;  5GP9 A;  1LE8 A;  1X2N A;  3SFZ A;  2D1V A;  1IDZ A;  2CRG A;  4HEA 2;  1FYL A;  1WH5 A;  4JYK A;  3PO3 J;  5HNH A;  1ACI A;  3ZPL A;  3E97 A;  3ABT A;  4AUX A;  3S3M A;  2ZOY A;  3PIO F;  2OJE D;  3VVX A;  2KZV A;  1OR7 C;  3QYF A;  4EJW A;  1O3T A;  2ETH A;  1QA6 A;  2FBI A;  3DKW A;  2KJB A;  1FOK A;  4GRI A;  1J7K A;  2UV1 A;  3O2P E;  1X1A A;  1FBS A;  3NQO A;  1TZL A;  2HPI A;  3KET A;  3BTI A;  4IHX A;  3OR2 C;  1DQU A;  2H8W A;  5CQG A;  1K4S A;  4E7H A;  2A2F X;  2QBY B;  4YII A;  2JMW A;  4A3G J;  4UUS B;  1LNW A;  3HRU A;  1Y1W J;  1Z9C A;  2ZCX A;  5EGO A;  3BHQ A;  1QVU A;  5E8G A;  1ZN2 A;  3GUD A;  3GWZ A;  4HAM A;  3I55 I;  1D5Y A;  2MD0 A;  3HGG A;  1WJB A;  1XGM A;  1LVA A;  2GXG A;  1A5J A;  2RQP A;  3I4P A;  2R7W A;  3C2G A;  1DU6 A;  4Y15 A;  2F4O B;  2EIJ H;  2BYV E;  4LJZ F;  4A0Z A;  3CMM A;  2L0K A;  2DMQ A;  1REP C;  2PN6 A;  4AIK A;  4C2M J;  2EZI A;  3ABL H;  3F0C A;  2IBD A;  5FFZ A;  3WE2 A;  3OYA A;  2OUM A;  2LRD A;  3KP7 A;  3WTU C;  4L18 B;  3BNI A;  1OQY A;  2LK2 A;  1JJ8 C;  3K1P A;  2A07 F;  4ZH4 F;  4GYG A;  4XRS A;  4HX8 A;  1E3O C;  1OCO H;  2IA1 A;  3PAS A;  2CQQ A;  4XBF A;  3H0D A;  2NNY A;  1YI2 I;  4ACI A;  2P6T A;  4FAS D;  3DLA A;  1O4X A;  2M0C A;  3NPI A;  3HTJ A;  1I27 A;  3F6O A;  1OR7 A;  4XLA A;  5ED4 A;  3R4K A;  4Y52 J;  3F8C A;  5D5U B;  5ICG A;  1XSD A;  1B9M A;  5H6R A;  4ESJ A;  1LQ1 A;  4PJN A;  3WE3 A;  2QEX I;  3A0H C;  2EIK H;  2XRL A;  4XLE A;  2HYT A;  3GW2 A;  4ESB A;  5F27 A;  3G7R A;  3TKY A;  1P4X A;  4D5F A;  1BL0 A;  5E20 A;  5TIS C;  4DNC A;  3QRF F;  3FM5 A;  1HCR A;  3K4C A;  5LBQ A;  1LFB A;  3M07 A;  2ZB9 A;  4IVN A;  3I53 A;  2O7O A;  1OCR H;  2CQX A;  2Z2S B;  2LF7 A;  4B48 A;  4I99 C;  3ZN0 A;  3CF5 F;  5D19 A;  3GTQ J;  5AQC A;  2HQ5 A;  4RAZ A;  2PFB A;  3HOW J;  5J1U A;  5IP7 J;  1RR7 A;  1ETK A;  1WHU A;  2OC6 A;  1BR1 A;  2OD5 A;  2QUF A;  3H0G J;  4L5E A;  1JI8 A;  4BAC A;  1F36 A;  3OY9 A;  2XDN A;  3IUV A;  3T5X A;  4TV7 A;  1MNM C;  3W2W A;  3CCM I;  2BEO A;  3V8L A;  4G7O F;  4P55 A;  3LNQ A;  3HC7 A;  2A61 A;  4GCK A;  4XKV A;  4H0E A;  1G2H A;  2FSW A;  1J0R A;  3CO7 C;  2A68 F;  4A3F J;  3T8T A;  1Z05 A;  2XF6 A;  2HKO A;  1VTN C;  1IJW C;  4C2U A;  3JRB A;  2VON A;  3SZT A;  3LSH A;  2LDU A;  2NYX A;  2R5Z A;  2OU2 A;  5IYB J;  2QTQ A;  1D0Y A;  2DYS H;  5J8C A;  5DM7 F;  1DP3 A;  2R5Y A;  4F7Z A;  2GXA A;  3PQK A;  1SFX A;  1I1G A;  1S8N A;  1YFH A;  1TQP A;  1Z3Y A;  1IN5 A;  2FOW A;  5EG0 A;  3I5U A;  2LKP A;  1JUP A;  2KL4 A;  5D8L B;  1TC3 C;  4XR6 A;  3BG5 A;  1XGS A;  3SEZ A;  5HAW A;  1ZYR F;  4KJZ A;  2EA4 A;  2DI3 A;  4WCG A;  2XAU A;  3MQ0 A;  2Y0S A;  1BC8 C;  3S1N J;  2ZFW A;  3BPX A;  3A1Y A;  1ONV A;  2IGN A;  2F48 A;  1WFX A;  3DBL B;  1TWF J;  1PP7 U;  1SAU A;  2XRO A;  2H27 A;  4B44 A;  5LD2 C;  1KQ9 A;  3RPQ A;  2E36 A;  2JRT A;  3I64 A;  2BE5 F;  3HDD A;  1PVE A;  1TQM A;  5HVQ C;  4AC6 A;  4XLH A;  2D45 A;  4YRV A;  3HTH A;  2ZJP F;  4ANJ A;  2Y9Z A;  2V9K A;  4MTD A;  5FJ8 J;  3SFI A;  1B72 B;  4DYC A;  4E7I A;  5FKK A;  3OSF A;  4HRI A;  2O61 A;  1R4M B;  1U5T C;  2D5V A;  4KIT B;  1UCR A;  2W53 A;  4KWA A;  1WKM A;  3QQA A;  2OQR A;  2DQL A;  1TWH J;  2VJ5 A;  4CSW A;  3E6B A;  4MGR A;  4HF0 A;  4ZZD A;  4PK4 A;  2PLY A;  1VQ6 I;  2IS4 A;  4MK6 A;  5B66 C;  1PUF B;  2OCC H;  2FXA A;  2VJ4 A;  1A6Q A;  3FBN B;  3PFY A;  5ERI A;  3GTL J;  2HFH A;  1G6N A;  3HTA A;  3BZC A;  1TP4 A;  3UNG C;  2RQQ A;  2M9H A;  3T6N A;  3TP3 A;  3SHF A;  1HQC A;  3MKL A;  4E7L A;  4EJT A;  2AQF A;  2EBI A;  2L7Z A;  1R36 A;  2XF7 A;  4RA2 A;  5HOD A;  4ZTJ A;  1K78 B;  2VE9 A;  3EYI A;  4KMF A;  4OWR B;  1Z6T A;  1R71 A;  2P7C B;  1D1A A;  3M4O J;  2CFX A;  1AA7 A;  1HA8 A;  3ZRG A;  4ENJ A;  3HIF A;  1VQN I;  2M87 A;  1UHM A;  3GVA A;  1UHS A;  4XKC A;  1DDN A;  3GTP J;  3ABK H;  3VDX A;  2PG4 A;  2XIG A;  4HV5 A;  1G3S A;  9ANT A;  4EEF G;  5E18 F;  5FO5 A;  1RUO A;  2HOA A;  1CF7 B;  2LOO A;  3LA3 A;  2CFO A;  4GFB A;  1KON A;  5DAJ A;  3SZP A;  2MH2 A;  2YUS A;  4PJJ A;  5J4V A;  3HPH A;  1MND A;  1BC7 C;  3CUO A;  1T38 A;  4AYB N;  1OYI A;  3CCE I;  3FHN A;  2WY8 Q;  4CZZ A;  2ZME C;  5JLX A;  2BHZ A;  2WTE A;  2ZBK A;  2BY3 A;  4NC8 A;  1UAA A;  2KP6 A;  1K6Y A;  2AO9 A;  2K02 A;  3F21 A;  2CQK A;  2P5L C;  3HOT A;  3KCC A;  1T39 A;  3BZK A;  4OMZ A;  2LC2 A;  4EMS A;  4IHW A;  3CUQ A;  2M2E A;  3BP8 A;  3B81 A;  2O5R A;  4I0B A;  3V7C A;  3W6V A;  2VOO A;  2NS8 A;  1FSH A;  1IW7 F;  3K1M A;  1H8A C;  2FBK A;  5M5Y J;  4CYC A;  2O6G E;  2QOP A;  1IV6 A;  4QPQ A;  3GTK J;  3CMY A;  1FBQ A;  2KQR A;  2LG4 A;  5B3S H;  5CVJ A;  5D18 A;  4LGW A;  2XDV A;  3VYR B;  1VQM I;  1OKR A;  2O9L A;  1XPX A;  4OIP F;  4BJ6 C;  1EH6 A;  2RV8 A;  5C4X J;  4D7N A;  2ZNZ A;  5CXI A;  3PIP F;  2Z9O A;  5C3E J;  3N4M A;  2CUJ A;  3ASN H;  2KRF A;  3E5U A;  3P9C A;  3HOZ J;  2VB6 A;  5IYD J;  2JVG A;  1A04 A;  1R7J A;  1ORK A;  2XPU A;  5BPI A;  1ZQ3 P;  3FXQ A;  3TDU C;  4M6X A;  5CKT A;  4DZJ A;  3QYB A;  1QZE A;  2M45 A;  4C9Y A;  5GTI C;  5EF6 A;  5CJ9 A;  1R49 A;  2IGO A;  1SFK A;  3K9T A;  1KZH A;  3VYT B;  3G1M A;  3FKJ A;  4CCK A;  2HQA A;  3J81 Z;  4OD5 A;  4ME9 A;  1R5H A;  4C3I J;  3BJ6 A;  2JA6 J;  5HNF A;  3HSR A;  3BZ6 A;  3M8E A;  5LRR A;  1MBF A;  1V55 H;  3TED A;  4Q4Z F;  2I10 A;  2QKL B;  1TW2 A;  2R7R A;  3HUG A;  1X4O A;  3ASO H;  3I9V 2;  5E1W A;  3VOE A;  3A01 B;  2M8G X;  4Z2Y A;  2MAB A;  3MD2 A;  3RPU D;  4BYY A;  3SXY A;  4OAY A;  4RM2 A;  1ETO A;  4R1H A;  1WJE A;  3VYS B;  2IS2 A;  2MGQ A;  2Y30 A;  5E3O A;  5TJJ A;  1U9N A;  1UG2 A;  4A3I J;  4I6Z A;  1Y8R B;  3MEX A;  5E3L A;  1TNS A;  1N77 A;  4FX0 A;  1YTY A;  5DD4 A;  3U9G A;  1W5S A;  3CDL A;  1NG7 A;  3GFJ A;  2Z16 A;  2FMY A;  3F72 A;  2XSJ C;  2QCO A;  3C1D A;  2VT3 A;  3EET A;  5E3M A;  1JGG A;  2I8D A;  2QZ8 A;  5GAG J;  2IAI A;  3HTI A;  5IY5 H;  1W36 D;  3ZXS A;  1USS A;  4LOC A;  4A3J J;  1KU3 A;  2STT A;  1LVK A;  2VC1 A;  1ZG3 A;  2K9N A;  2TCT A;  3IKT A;  1HDP A;  4L9N A;  1DP7 P;  2E5N A;  2JA2 A;  5HLT A;  3MZH A;  2E71 A;  2H1K A;  4OIR F;  3G56 A;  4KN7 X;  3UR3 C;  1T0F C;  1G59 A;  4G7H F;  4LIU A;  2QQA A;  1STZ A;  3IRR A;  3OSG A;  3KYC B;  4BE0 A;  4KNY A;  4A2U A;  3RKQ A;  4BH9 A;  1R5I D;  1O7L A;  2W7N A;  4BHC A;  2H09 A;  3LQQ A;  3CO6 C;  3KEY A;  2A5Y B;  2QIB A;  1RIO H;  1GHC A;  2WV0 A;  2PX9 A;  3O8G A;  2LKS A;  3CRJ A;  3PJR A;  1MIJ A;  2E1M B;  2XRN A;  1WI3 A;  2A5W A;  4DW6 A;  3F8N A;  1BM9 A;  2RAS A;  4U9L A;  3S3N A;  3BCG A;  1LB2 A;  1J9I A;  2HTS A;  2TRT A;  4OU0 A;  2QSG X;  4Y4R A;  4LG0 B;  2E60 A;  5JR3 A;  2OER A;  3TGN A;  2HZT A;  2E2I J;  5TRD A;  1WCM J;  2K40 A;  5IPA A;  2F5V A;  2K4B A;  4QWQ A;  3A02 A;  2G9W A;  3EUH A;  5AIQ A;  2OZU A;  1HOM A;  3HJE A;  5C4Y A;  3BG3 A;  4EM0 B;  1U78 A;  2PMU A;  2JUG A;  2VOP A;  5HBU A;  3M9A A;  4PGH A;  1B59 A;  2HYG D;  3KYL A;  2ZXH A;  2JRM A;  3J7Z I;  2HGC A;  2MLK A;  2X6W A;  1V5G A;  3PNT A;  4IKF A;  4HBL A;  2V9V A;  3AG4 H;  1V5E A;  3ROU A;  4OIO F;  2OZ6 A;  4IRG A;  1LDD A;  4BAY A;  1AKH A;  3KYD B;  2QWT A;  3MZ8 A; 
#chains in the Genus database with same CATH homology
 4MIM A;  2YVE A;  2Y31 A;  3LOC A;  5GP9 A;  5F0C A;  1UMQ A;  1LE8 A;  1ETV A;  1X2N A;  3CCY A;  2GLO A;  1IDZ A;  2CRG A;  3ZQC A;  1WH5 A;  4JYK A;  3PO3 J;  1FEX A;  5IP9 J;  3BG9 A;  1A6I A;  3DEW A;  4AUX A;  2ZOY A;  2ID6 A;  1HDD C;  2HOS A;  4MXM A;  3VVX A;  1T33 A;  3B6A A;  2R5Z B;  2E2H J;  3GZI A;  2CU7 A;  1BW5 A;  4Y7N J;  4NDL A;  2R5Y B;  2XSD C;  4A3L J;  3COL A;  3BTI A;  3BR1 A;  2DG7 A;  1RES A;  3A01 A;  4IHX A;  2LTP A;  3K7A J;  4ICH A;  3JRH A;  5BNG A;  4MFE A;  1WGX A;  2COB A;  3QPL A;  5EG0 B;  3ZQI A;  2MW8 A;  4IHV A;  1K83 J;  2JMW A;  4UUS B;  4A3G J;  2WB1 N;  1Y1W J;  3H3V K;  4A3B J;  2ZCX A;  2LKX A;  2VPR A;  4GCL A;  5GPA A;  5EGO A;  2UXO A;  3BHQ A;  1QVU A;  2VKE A;  1D5Y A;  3HGG A;  2YS9 A;  1A5J A;  1Y1V J;  3SDG A;  3F1B A;  1GDT A;  3L1P A;  1GV2 A;  3DPJ A;  2ZCN A;  1DU6 A;  1BJZ A;  3I4N J;  2FJ1 A;  1XS9 A;  2XPW A;  2L0K A;  2DMQ A;  2EQR A;  3IH3 A;  4MO7 A;  1MSE C;  3BTJ A;  3FK6 A;  4C2M J;  3S1M J;  1SFO J;  2EZI A;  3F0C A;  2IBD A;  1K61 A;  5M5W J;  1EF4 A;  3VOX A;  2H8R A;  3HKZ N;  3BNI A;  2LK2 A;  2K9Q A;  4V2F A;  1JJ8 C;  4XRS A;  5FKM A;  4BBR J;  1U8B A;  4G12 A;  1UI6 A;  3KZ9 A;  1E3O C;  3NXC A;  3PAS A;  1JT6 A;  1IGN A;  2CQQ A;  2WV1 A;  4ACI A;  2HXI A;  2E19 A;  2OF7 A;  1O4X A;  1ZGW A;  2M0C A;  3NPI A;  3HTJ A;  2X48 A;  4JNN A;  4A3C J;  3V6G A;  4Y52 J;  3MNL A;  3VW1 A;  3FKI J;  2RAE A;  4QSH A;  1ETW A;  4XRS G;  1ETQ A;  1RET A;  1Z0X A;  2EH3 A;  1IC8 A;  2QKO A;  1QRY A;  2XRL A;  5F08 A;  2HYT A;  2G0E A;  5F27 A;  3JRC A;  3G7R A;  4BKX A;  4D5F A;  1BL0 A;  2QF7 A;  3VVZ A;  2DA7 A;  2NVY J;  1FIP A;  4XK4 A;  1HCR A;  1ITY A;  1LFB A;  2CUE A;  1IDY A;  4A3K J;  2XGC A;  1OJL A;  4A3E J;  4A93 J;  2ZB9 A;  5IOY A;  4PXI A;  3ZQG A;  2O7O A;  4B4C A;  2CQX A;  5M3M J;  5D19 A;  3GTQ J;  5AQC A;  2HQ5 A;  1FIA A;  3HOW J;  5J1U A;  1X2M A;  2Y2Z A;  3KKC A;  5IP7 J;  1RR7 A;  1ETK A;  2NS7 A;  1OCP A;  3H0G J;  4L5E A;  1AU7 A;  3CQZ J;  3RQI A;  1F36 A;  2XDN A;  3PPB A;  4DZP A;  3BQY A;  2W48 A;  3IUV A;  1MNM C;  5FKL A;  1FTT A;  1JUM A;  5FLM J;  1GT0 C;  2DMU A;  4M3B A;  3ZOB A;  1B8I A;  2JA5 J;  2PBX A;  5EYR A;  3LNQ A;  5JLW A;  2DA4 A;  2GBY A;  2AHQ A;  4D7M A;  4IHY A;  4GCK A;  5CXG A;  2ECB A;  3QPS A;  2L7F P;  3ANP A;  1AHD P;  3PO2 J;  3NAU A;  1G2H A;  3C07 A;  2P81 A;  3QBM A;  3Q0U A;  4A3F J;  1JKO C;  2DA2 A;  3K2A A;  1X58 A;  2PMZ N;  3SJM A;  2PZ9 A;  4A3D J;  4MFD A;  4IEJ A;  2ELK A;  3HOV J;  3LSG A;  3PM1 A;  1IJW C;  3JRB A;  1JJ6 C;  2R5Z A;  2LVS A;  2VKV A;  5IYB J;  5FKO A;  1HF0 A;  3BTC A;  2L9R A;  2QTQ A;  3E7Q A;  3S2D J;  3VOK A;  4CYC B;  4MLO A;  2R93 J;  2R5Y A;  2KT0 A;  4W97 A;  2NVT J;  2MG4 A;  3ZQF A;  4AC0 A;  2EZL A;  4C3H J;  2ZOZ A;  3S17 J;  5EG0 A;  4HNV A;  3HM5 A;  3TW7 A;  3RD3 A;  1JUP A;  4UUS A;  1TC3 C;  3BG5 A;  4I76 A;  5HAW A;  1I6H J;  1NK3 P;  2CJJ A;  3IH2 A;  1MBJ A;  4DYQ A;  2G7L A;  3ANG A;  2HOT A;  3VP5 A;  1P7I A;  1GUU A;  4XID A;  3S1N J;  2V57 A;  2VI6 A;  2LD5 A;  2FBQ A;  5FMP A;  3RZD J;  1TWF J;  4JX4 A;  4JX6 A;  5IOZ A;  4M3F A;  1YRN A;  3BRU A;  3S2H J;  3NI7 A;  2G7G A;  3VW2 A;  3LSR A;  1MH3 A;  4L62 A;  3HDD A;  2G3B A;  3BT9 A;  4BBS J;  2JJ7 A;  3IV5 A;  4AC6 A;  3JRG A;  3HTH A;  4FIS A;  4HKU A;  2Y9Z A;  1VFC A;  5FJ8 J;  1XC5 A;  3SFI A;  1B72 B;  3EUP A;  4DYC A;  4DYR A;  5K7H A;  2X6O A;  5FKK A;  1ZTR A;  1IUF A;  3OSF A;  1UI5 A;  2OI8 A;  3LHQ A;  2D5V A;  3DCF A;  2W53 A;  3RZO J;  4KWA A;  3C2B A;  3QKX A;  3QQA A;  1TWH J;  5FGL A;  5D1R A;  4MK6 A;  2NOG A;  1LFU P;  5DS9 A;  4BXX J;  5FLV A;  2GUH A;  3JRI A;  4RDU A;  1PUF B;  1I3Q J;  1SAN A;  2YU9 J;  3GTL J;  4FTH A;  4M6V A;  4ABZ A;  3HTA A;  2EZH A;  2M9H A;  4YZE A;  3T6N A;  3TP3 A;  3MKL A;  4D5C A;  2E2J J;  1U9O A;  4CGR A;  2B63 J;  2EBI A;  2L7Z A;  1OFC X;  1XG1 A;  3B6C A;  3FIW A;  3WHB A;  5HOD A;  3HOU J;  3HBL A;  2FD5 A;  1TWC J;  1VI0 A;  3G1O A;  3M4O J;  1BW6 A;  1R9T J;  2FX0 A;  4J19 A;  2EZK A;  3V78 A;  2JA7 J;  5F04 A;  2ME6 A;  1W0T A;  5C4J J;  1UHS A;  3GTP J;  4GFK A;  3BR3 A;  3LSJ A;  1ETY A;  5F0H A;  1JKQ C;  2HKU A;  1FJL A;  1VF9 A;  3NNR A;  9ANT A;  2IU5 A;  4EEF G;  2LR8 A;  2NX4 A;  2HOA A;  2DMT A;  1ENH A;  3WHC A;  3UKG A;  1MBH A;  3JRD A;  4GFB A;  2DA6 A;  2Y0S N;  3GTJ J;  5DAJ A;  2YUS A;  1NTC A;  4V2G A;  2R92 J;  3HGY A;  1JUS A;  4RBO A;  5IYC J;  1FTZ A;  3CJD A;  2ECC A;  4JP0 A;  4AYB N;  2DA1 A;  1DU0 A;  1I50 J;  2DJN A;  1IRZ A;  2XGE A;  2UXH A;  2YVH A;  1P7J A;  3D1N I;  5JLX A;  3NRG A;  4JKZ A;  2L7M P;  2AO9 A;  2O7T A;  2LFB A;  1MBK A;  3S16 J;  2DMN A;  2WUI A;  2WAQ N;  3O60 A;  2K9S A;  3LJL A;  4IHW A;  1APL C;  2M2E A;  3B81 A;  3EGQ A;  3MVP A;  1QVT A;  3W6V A;  2NS8 A;  4JL3 A;  2N8G A;  4UUT A;  1H8A C;  5M5Y J;  4CYC A;  3S5R A;  3BR5 A;  2M34 A;  2QOP A;  3BR2 A;  1IV6 A;  4M3G A;  3GTK J;  3CMY A;  2NP5 A;  4XIC A;  3BR6 A;  5D18 A;  1JKP C;  2REK A;  2O9L A;  2HYJ A;  3VW0 A;  3TP0 A;  2DA3 A;  2IEK A;  4NEL A;  5C4X J;  1ZKG A;  4D7N A;  1ZR4 A;  2ID3 A;  3VUQ A;  3JRE A;  5CXI A;  5C3E J;  3OIO A;  3LSP A;  4X6A J;  3GTM J;  3HOZ J;  1H88 C;  5IYD J;  2F07 A;  1ORK A;  2XPU A;  5C44 J;  4X1E A;  2GM4 A;  1GV5 A;  1ZQ3 P;  1RKW A;  3M3Y J;  1W0U A;  2NVQ J;  4DZJ A;  1TWG J;  1F43 A;  1AKH B;  2VUM J;  5EF6 A;  3GTO J;  3FRQ A;  1CQT A;  2NP3 A;  1LE8 B;  3G1M A;  5EEA A;  4UDS A;  2DA5 A;  3E7L A;  2NVX J;  3AQT A;  4ME9 A;  5FHP A;  3ON4 A;  4C3I J;  2JA6 J;  3VPR A;  3BJB A;  5FKN A;  2XB0 X;  2XB5 A;  1B72 A;  2XPV A;  2HDD A;  4NN1 A;  1JTX A;  3HEF A;  4JX5 A;  1MBF A;  3JSJ A;  3TED A;  5M3F J;  2I10 A;  5CW8 A;  3LWJ A;  1WH7 A;  4XRM A;  3S15 J;  3BTL A;  2JN6 A;  2LY9 A;  4M3D A;  1JT0 A;  5IP6 A;  2DN0 A;  1RKT A;  3BR0 A;  3A01 B;  1T56 A;  2M8G X;  1ZR2 A;  1PUF A;  2CUF A;  3Q0W A;  5F1J A;  1OCT C;  2FQ4 A;  3IH4 A;  1ETO A;  3HOX J;  2MGQ A;  1ZK8 A;  2Y30 A;  5E3O A;  4A3I J;  1U9N A;  1UG2 A;  1H89 C;  2UXU A;  5EGO B;  4I6Z A;  5E3L A;  3ZQH A;  3CWR A;  4M3E A;  3CDL A;  1YRN B;  1POG A;  3GBG A;  5F0F A;  5DTD A;  1HLV A;  2MSY A;  2QCO A;  4FE7 A;  1SGM A;  5E3M A;  3HIM A;  1JGG A;  3FIS A;  2O8K A;  1ETX A;  1JTY A;  1TWA J;  2IAI A;  3HB9 A;  3NAR A;  5EZG A;  3HTI A;  3ON2 A;  2XGD A;  3KKD A;  1MSF C;  5J3L A;  2G7S A;  2Y9Y A;  4LOC A;  4A3J J;  5E3N A;  2JK3 A;  2K9N A;  2TCT A;  2WGB A;  2UXI A;  1HDP A;  3VVY A;  2GFN A;  2DTZ A;  3ZQL A;  2H1K A;  5K58 A;  3G56 A;  2ZCM A;  3GEU A;  2R7Z J;  5EFY A;  2LLK A;  3VIB A;  3OSG A;  4GCT A;  3RKQ A;  4C3J J;  2RHA A;  1IG7 A;  3KNW A;  3O8H A;  4S0H B;  2HI3 A;  2QIB A;  1QPI A;  2KDZ A;  2JA8 J;  1WPK A;  1JKR C;  1MBG A;  3O8G A;  2UXP A;  3S1Q J;  3TW6 A;  3CRJ A;  4BY7 J;  4B3A A;  5GPC A;  3HOY J;  3JR9 A;  4A3M J;  3JRA A;  1WI3 A;  4DW6 A;  3OOU A;  5EZH A;  1MH4 A;  3A03 A;  2RAS A;  2Q24 A;  4QIW N;  3GTG J;  3S14 J;  3BCG A;  5K7F A;  3HE0 A;  3JRF A;  3I4M J;  2TRT A;  3Q0V A;  3G1L A;  4QTR A;  2OER A;  1Z77 A;  2HXO A;  2E2I J;  3MN2 A;  4FCY A;  2X9D A;  3S1R J;  4BY1 J;  1WCM J;  2K40 A;  1BA5 A;  3FK7 A;  1VND A;  5IPA A;  2DG8 A;  4GFL A;  4B1R A;  2LP0 A;  3BQZ A;  5K7Z A;  4W1U A;  3A02 A;  2DMP A;  4A69 C;  1S7E A;  5J1R A;  3Q3S A;  1MBE A;  1HOM A;  5C4Y A;  1Q1V A;  3BG3 A;  1U78 A;  5HSZ A;  2GEN A;  5EDN A;  5HBU A;  5M5X J;  1GVD A;  2ME0 A;  3P9T A;  2R0Q C;  2OPT A;  3AQS A;  2JWT A;  4AF5 A;  2E1O A;  2D6Y A;  4FE4 A;  1B8I B;  1RPW A;  1AKH A;  1NK2 P;  5H9T A;  2QWT A;  3RH2 A;  5J1Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...