2EH3A

Crystal structure of aq_1058, a transcriptional regulator (terr/acrr family) from aquifex aeolicus vf5
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
171
structure length
171
Chain Sequence
b'GTKERILEVSKELFFEKGYQGTSVEEIVKRANLSKGAFYFHFKSKEELITEIIERTHKKIISLFEENKEKTPEELLEMFLEVLYREKKVVYIFLFDLLCSEKFRNIYFEKIEDAKRRFEKFLEKHFPSKAEILSEIILGFLRQLILHYVIKEERELPFLKEKLREGLKLIF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator
publication title Crystal structure of aq_1058, a transcriptional regulator (TerR/AcrR family) from Aquifex aeolicus VF5
rcsb
source organism Aquifex aeolicus
molecule tags Transcription
total genus 71
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2007-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2eh3A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 2eh3A02
2DA7A 2Y0SN 2AO9A 3COLA 3BTIA 1X2MA 1QPIA 4GFLA 4W97A 4HKUA 4IEJA 4DZJA 1BL0A 2M2EA 5JLXA 2JWTA 1IDZA 2RHAA 5K58A 1SANA 1HDPA 3JRCA 3DCFA 3FIWA 5IYDJ 2L0KA 3NXCA 4C3IJ 3G7RA 3HTJA 4FISA 1HDDC 3JRFA 2KDZA 3KZ9A 1YRNA 2O8KA 3ZQIA 2LD5A 5EZGA 1ETKA 3JRIA 3GTOJ 2W53A 5F1JA 2ID3A 2DMPA 4C3HJ 4DYRA 2W48A 2G0EA 1A5JA 1ENHA 4GFKA 3VVXA 2L7ZA 3C2BA 3TEDA 4Y52J 5GPAA 2XPWA 4YZEA 2I10A 3IH3A 2HOTA 1IRZA 5K7FA 3HOUJ 2HXIA 1QVUA 5J1YA 1JUMA 4A3LJ 1XC5A 2VKVA 1JKQC 3JREA 4V2FA 4I6ZA 3QPLA 3LSJA 3IV5A 4M3BA 2ZOZA 1RESA 2HI3A 5GP9A 4BY7J 1B8IA 3OSGA 2O7OA 2NVQJ 4MXMA 1QVTA 3ZOBA 2X9DA 1RETA 4ME9A 2E1OA 2NP3A 4GCTA 3S15J 2NS7A 1OFCX 3BR1A 4NDLA 3GEUA 5FHPA 2NVYJ 2QCOA 3JR9A 1MNMC 1WPKA 4ABZA 2R0QC 4FTHA 3PASA 3IH2A 1DU6A 3C07A 3A01A 4ACIA 2OERA 2NVXJ 2R7ZJ 2YS9A 2VI6A 4M3EA 4D7NA 2H1KA 2EBIA 5C4JJ 3CQZJ 3W6VA 2NX4A 3LHQA 1LFBA 1ETYA 2EZIA 4QIWN 3S2HJ 3AQSA 3G56A 2UXIA 2XRLA 1BA5A 3HOVJ 1IDYA 5EGOB 4MFEA 4X6AJ 1IC8A 3JRGA 2G7SA 1ETOA 4RDUA 2G7GA 3O60A 2HXOA 5AQCA 4IHVA 2DG8A 2OI8A 2JA5J 3HE0A 2QKOA 1A6IA 4W1UA 3GBGA 1WI3A 2DA3A 2WB1N 5EEAA 2XGCA 4M6VA 4BBRJ 2NOGA 1I6HJ 2DMTA 3NARA 3TW7A 2N8GA 4B3AA 3RH2A 5IYCJ 3LSPA 3G1LA 1TWCJ 3ON2A 3F1BA 4BXXJ 3F0CA 5HSZA 5D18A 5D1RA 2DJNA 4D5FA 2Y30A 4FE4A 2E2IJ 4I76A 3HEFA 3JRDA 1TWAJ 3GTPJ 3V6GA 4V2GA 4A3KJ 1VFCA 1O4XA 4C3JJ 1GV2A 1B72A 5CXGA 2ECCA 3ZQFA 1ZKGA 5K7ZA 1FTZA 3LNQA 3HTIA 1RPWA 1MH4A 2YU9J 2QF7A 4XRSA 3M3YJ 4UUTA 4EEFG 3VP5A 4JKZA 2GUHA 4JYKA 4FE7A 1JKPC 1JT0A 2EQRA 3GTJJ 2ELKA 2NS8A 2P81A 2WV1A 2XPVA 1LE8A 3BNIA 2ME6A 2EZKA 2JN6A 2EZLA 1JKOC 2G7LA 4MLOA 1MBKA 3Q0WA 4NN1A 1ZR4A 2MGQA 9ANTA 2R5ZB 2Q24A 5F27A 2UXUA 3BQYA 4JX4A 3WHCA 1PUFB 1OCPA 2TCTA 2MG4A 4B4CA 3QKXA 2AHQA 1MBEA 5EG0B 1U78A 2JMWA 2LR8A 2XB0X 1JUSA 3BR6A 3CWRA 1OCTC 4BY1J 3S1NJ 2HYTA 5DS9A 5HODA 1MH3A 5IPAA 3SDGA 1B8IB 4MO7A 3CCYA 1JJ8C 2LK2A 4DYQA 1CQTA 3S17J 3B6CA 2LFBA 3H0GJ 2VKEA 1HOMA 2PMZN 2VUMJ 3GTGJ 2Y9YA 1BW6A 3HOWJ 1AHDP 4AC0A 3G1OA 1JKRC 1GDTA 4XRSG 4GFBA 3CDLA 4A3GJ 2R5YB 1BW5A 3A01B 5F0FA 3K7AJ 2X6OA 3BG9A 1Y1WJ 2GENA 1HCRA 4M3DA 3FK6A 5FKMA 1GVDA 2MW8A 2ZCMA 2QOPA 3B81A 1X2NA 3LOCA 2Y2ZA 2GM4A 3DPJA 2NP5A 4JX6A 4UUSA 4ICHA 1VNDA 2VPRA 1U9OA 1ZK8A 5F08A 1MBJA 3OIOA 1IUFA 1WCMJ 3QPSA 2D5VA 2PZ9A 3NRGA 4AUXA 3FISA 2ME0A 3P9TA 1WGXA 5C4YA 2IAIA 2IBDA 3G1MA 1UI6A 3K2AA 2ZCXA 3FKIJ 4X1EA 2IU5A 1UMQA 3GTKJ 3ANPA 2CRGA 1HLVA 1S7EA 1IG7A 1QRYA 1MBHA 2M0CA 4QTRA 3VIBA 5FKNA 1RKTA 1I50J 4QSHA 1FJLA 5D19A 2ZOYA 3A02A 1TC3C 2XB5A 4A3FJ 2EH3A 1MBFA 3PPBA 1ETWA 2MSYA 4A3IJ 1TWFJ 4CYCB 1B72B 2CQXA 2EZHA 3HIMA 3VW0A 2R93J 3BTLA 3HB9A 3BR3A 1G2HA 4A3EJ 5EYRA 1IGNA 2O7TA 2YUSA 3VW2A 4GCKA 1U8BA 3Q0UA 4IHXA 3HTAA 2NVTJ 3KNWA 1WH7A 3H3VK 4XIDA 2JK3A 3T6NA 3ZQCA 3BRUA 3MVPA 3RZDJ 4FCYA 3HOZJ 3ZQGA 2TRTA 3IUVA 2B63J 1R9TJ 3DEWA 5K7HA 1UI5A 2LVSA 1K83J 1AKHB 2PBXA 4G12A 4DYCA 5IOYA 1Z77A 2QIBA 1JUPA 4BBSJ 5FKLA 5E3OA 5EZHA 1H88C 2UXHA 2GLOA 5EFYA 4JL3A 3HDDA 5FGLA 5M3FJ 3FK7A 2HOAA 3SJMA 3HKZN 3PO2J 3VOXA 3LSRA 2XGDA 1ETVA 4MFDA 3BQZA 3BTCA 3B6AA 3TP0A 2HKUA 2LKXA 1YRNB 3GTLJ 2QTQA 3BR2A 3ZQLA 1APLC 2GFNA 4JNNA 3CJDA 2K9NA 3KKDA 1TWHJ 1VI0A 1ZR2A 3PM1A 2HQ5A 2CJJA 1FIAA 2KT0A 5C4XJ 2DMUA 4S0HB 3ZQHA 2XGEA 1IJWC 5HAWA 3GZIA 1OJLA 1WH5A 1D5YA 5J1RA 4HNVA 4D5CA 2F07A 1ORKA 3TW6A 2DMNA 3D1NI 2HOSA 3FRQA 3S1MJ 1RR7A 4XICA 4J19A 5DAJA 1MSFC 3ANGA 5C3EJ 1E3OC 5C44J 3VPRA 2H8RA 4A3JJ 2E2HJ 4L62A 3HGYA 4PXIA 2QWTA 1GT0C 1NK2P 1UG2A 2M9HA 1ZQ3P 2LP0A 3BTJA 1W0UA 2DA4A 2ZCNA 3BR0A 1AU7A 1FEXA 1I3QJ 5FKOA 4D7MA 2ZB9A 3HGGA 5FKKA 5F0CA 1F36A 1U9NA 3EGQA 3UKGA 1T56A 4L5EA 1FTTA 4CGRA 2Y31A 1EF4A 3VVYA 5EDNA 3JRBA 2M34A 3HM5A 1P7IA 3NI7A 4RBOA 3OOUA 2WAQN 3JRHA 2FX0A 4MK6A 3WHBA 2E19A 2D6YA 3LWJA 1JT6A 2UXOA 4DZPA 2L7FP 4A93J 4JX5A 3MN2A 1K61A 5IYBJ 2V57A 2RAEA 4UDSA 3BR5A 4AYBN 3V78A 1SFOJ 3VW1A 2YVEA 1IV6A 2HYJA 5JLWA 5FMPA 3O8HA 1GUUA 2R5ZA 3VOKA 2FD5A 2ECBA 1VF9A 4C2MJ 3RQIA 3E7QA 2GBYA 4IHYA 5EF6A 2Y9ZA 1PUFA 2YVHA 2E2JJ 3S14J 3O8GA 3SFIA 2IEKA 1HF0A 2K9QA 4DW6A 5HBUA 1JTYA 5EG0A 1T33A 2G3BA 5F04A 3VVZA 4A3BJ 2XPUA 3BJBA 4AC6A 2K9SA 4AF5A 2FQ4A 5FJ8J 3M4OJ 1LFUP 3S16J 2R92J 1JJ6C 2DA1A 4LOCA 1Z0XA 1XG1A 1Y1VJ 1NK3P 4XRMA 2XDNA 4M3FA 3E7LA 1H89C 3Q0VA 2HDDA 1XS9A 2COBA 1JGGA 2REKA 4JP0A 2L9RA 5FLMJ 4KWAA 2R5YA 3BCGA 2O9LA 1LE8B 5M5YJ 5J3LA 1FIPA 3S1RJ 2JA8J 3RD3A 3VUQA 4A3DJ 2L7MP 4MIMA 2WUIA 3HOXJ 1ZGWA 3I4MJ 4NELA 3IH4A 3HBLA 2DA5A 5FLVA 3CMYA 3LSGA 1JTXA 3S2DJ 3LJLA 1ETXA 2LTPA 3NNRA 3RZOJ 4XK4A 3BT9A 3PO3J 3MNLA 2CQQA 2UXPA 2CUFA 3L1PA 2DMQA 2OPTA 1Q1VA 2X48A 4IHWA 2DA6A 4B1RA 5E3MA 4A69C 5J1UA 5IP9J 1TWGJ 3JRAA 2JJ7A 3OSFA 5BNGA 5F0HA 2JA6J 2LY9A 1H8AC 2DG7A 3TP3A 5M3MJ 5GPCA 5E3NA 2RASA 1F43A 4M3GA 4BKXA 1ITYA 5E3LA 3JSJA 1W0TA 2DA2A 4GCLA 1RKWA 3GTQJ 3CRJA 4A3CJ 1MSEC 3NAUA 1P7JA 5H9TA 4A3MJ 3Q3SA 1GV5A 2XSDC 4CYCA 3AQTA 1BJZA 3S5RA 5IP6A 1MBGA 1ZTRA 2CU7A 2M8GX 2JA7J 4Y7NJ 5EGOA 2FBQA 3BHQA 2ID6A 3EUPA 5DTDA 3HTHA 3S1QJ 3A03A 3RKQA 4UUSB 2CUEA 3GTMJ 2K40A 3MKLA 3I4NJ 2FJ1A 3BG3A 2DTZA 3KKCA 5IOZA 3NPIA 2OF7A 2DN0A 3BG5A 3QBMA 5M5XJ 1ETQA 3ON4A 5CW8A 2WGBA 1POGA 1SGMA 1AKHA 5CXIA 1X58A 5M5WJ 3QQAA 1DU0A 3HOYJ 1NTCA 5IP7J 2LLKA 1UHSA
chains in the Genus database with same CATH superfamily
2Y0SN 1U8RA 2AO9A 3H3ZA 4WCGA 3FKJA 3MZ8A 3V8KA 1QPIA 1BOAA 3PNVA 4RLFA 2HKOA 4DZJA 2M2EA 2V6CA 1S7AA 2JWTA 3H1CA 1IDZA 3K8PC 2DU9A 3DCFA 3R6SA 5IYDJ 3L2UA 2W85A 3G7RA 3O6BB 2BY3A 4XOTA 3HTJA 3KEQA 2ETHA 3EDPA 4KJZA 2LD5A 2VBZA 5DM6F 4RGXA 3WG7H 4II3A 1I39A 1XDSA 4EATA 2ID3A 4HLYA 3K70D 3HSEA 1TTYA 2LNBA 4PFOA 1RI7A 1RC9A 4HQEA 3F6VA 1XMKA 1G3YA 1LDDA 2ZSIB 4YZEA 2K9MA 2LMDA 1MDMA 2HOTA 3SEQA 5J1YA 3JREA 3QPTA 2L4MA 4V2FA 2X4HA 3LSJA 3IV5A 1WZ2A 3E5UA 3W2AA 2J5OA 2L9VA 2KMUA 1QNTA 3F6OA 2JA2A 2NVQJ 2O7OA 2FRHA 3HXLA 1U5TC 1QVTA 4E4HA 3HPHA 2A69F 1VTNC 3BDDA 3S15J 2R7SA 2DW4A 3BR1A 5FHPA 4IQ4A 4CCOA 3QWLA 4B09A 1BR4A 2R7UA 3KZYA 4DJAA 3J7AO 3KEYA 3C1DA 3SQNA 3IKVA 4ENMA 3HRTA 3G4SI 2NVXJ 2E60A 4XNFA 3CJTB 4M3EA 2ZMEA 3TMOA 2DAOA 2CW0F 2NX4A 1O7LA 4HQMA 2BZTA 3HYIA 4RAFA 4CO8A 4QIWN 2LKPA 3KP5A 3G56A 1BA5A 2IA2A 5J8CA 3OYEA 4LK0F 1GHCA 4WF2A 1IDYA 5EGOB 2QSGX 2XAFA 1ETOA 3R4KA 3DLAA 1IRGA 2OI8A 3L7WA 1X3WB 1MMGA 3GEZA 1IO2A 2QBYB 4MEXF 1WI3A 3M8JA 2DA3A 1K4SA 2K4JA 4PJNA 3OYAA 3EETA 4CGZA 5BS6A 3G1LA 1BC8C 1B1BA 4ESBA 2KJBA 1T98A 4F55A 2HVRA 3DBLB 2JUCA 2ZNZA 3MMYB 3TO7A 2DJNA 2W57A 2QSHX 2ZXHA 2E2IJ 4I76A 3OYJA 2IPQX 2AQEA 3JRDA 1TWAJ 2EFNA 3GTPJ 3SDBA 2W4SA 1KU3A 1SEUA 1O4XA 4C3JJ 4F52A 2ECCA 1ZKGA 5J4VA 1J59A 4F93B 1EA3A 3BLYA 2YU9J 3M3YJ 3ZP5A 2DXIA 3VP5A 3TDUC 4JKZA 1WJEA 2DYSH 4JYKA 3VYUB 4D0PA 5K1YA 3OR2C 3BZCA 3K4KA 1TNTA 3QYEA 2EQRA 2K5CA 2ELKA 1LE8A 3BNIA 5J47A 4ZDLA 1HW5A 1YYVA 4PSWA 5KHDA 1OYIA 2RNJA 5D8KB 4FETA 2EIJH 9ANTA 3GWZA 1W5SA 3CMMA 2L5QA 3FX3A 1BIBA 3E3VA 3FXUA 4UNOA 1HKQA 2FBKA 2L9SA 5L3DA 4XSXF 1D0YA 3N97A 2JPCA 3K4NA 4BY1J 3S1NJ 4F7ZA 5HODA 2M0MA 1MH3A 2AS5F 3B6CA 2LFBA 3CCMI 4BE0A 3FMSA 1HOMA 5DM7F 4AIKA 5BOXA 1LKXA 5AONA 2KIQA 3R0AA 3QYBA 1AHDP 4BAYA 4AC0A 3HJEA 2K9LA 4OU0A 4XRSG 1KYWA 1RRJA 3CDLA 4F3QA 5GTHC 2H6CA 3K7AJ 3KYCB 1Y1WJ 4HSRA 5B1AH 1V54H 1Z6TA 5JI6A 1F4KA 4H0EA 2ZCMA 4ZYGA 2COMA 3HRSA 1Y8RB 2DFEA 4JX6A 5HLHA 1U9OA 1G3WA 1ZK8A 5ILVA 1IUFA 1CF7A 1KONA 3PL8A 2VC0A 4LJZF 2B9SA 2D5VA 3FISA 1ZG5A 1P6RA 3L00A 3K2AA 4D9JA 1Y6IA 3MKZA 3FKIJ 3LL7A 1H9TA 2OQGA 3ANPA 2CRGA 2A61A 4S05A 3S3OA 1N78A 1MBHA 3M1EA 1YITI 3VIBA 3C2HA 4U87A 4EMSA 1I50J 2B1EA 3G2BA 3VB2A 2IGNA 3GFJA 3ABLH 1JE8A 3A02A 4QWQA 4LG0A 1TC3C 2XB5A 1KQ9A 3A1YA 1TT5B 1MBFA 1P2FA 1Y8QB 1DGRM 1QQIA 4BNCA 3HSRA 3PFYA 4KFCA 4CYCB 2F5VA 2CQXA 4XLCA 3VW0A 2R93J 2HVQA 2XAGA 1EH6A 2YUSA 3VW2A 5LGUA 4HBLA 4HPQA 3Q0UA 2O3FA 1K4TA 3P9CA 5K5QA 2ZKZA 3FXKA 1XMXA 2OBPA 2V1DA 4ZC3A 3H3UA 2JSPA 3BRUA 3TBIA 2DK5A 2RV8A 2DBBA 5D5VB 4IRIA 4AU7A 1R9TJ 1H0MA 3K4CA 3IKTA 2BEOA 3SEZA 3DV8A 1ZARA 5LHHA 1ULYA 5FKLA 2Z33A 2A5YB 1Z91A 4IXAA 1ACIA 1X1PA 3RSNA 2JVGA 2PN6A 3IRQA 4P1WA 3F3XA 3J80Z 4NC6A 2YR2A 2DFHA 3V4GA 3OYDA 2LSOA 4HX8A 1ZHFA 4BGDA 3TP0A 4FX4A 4XN3A 2HKUA 2LKXA 2DT6A 1YRNB 2GFNA 4MNUA 3CJDA 2VLAA 3TGNA 1FIAA 4C2MA 4ESJA 5C4XJ 2QYOA 4HG2A 4S0HB 1D5VA 2ZC2A 1LUJB 5HAWA 4CH7A 1EH8A 4KITB 5H2FC 4ZTFA 2K7LA 3T8RA 1ONVA 2F2EA 4UV9A 5DD8A 4IF4A 4HNVA 5KAFC 3ECOA 1ORKA 5D5XB 2QBYA 3TW6A 4E7ZA 3P9IA 2HOSA 2ACJA 1RR7A 1LPQA 5DAJA 4XKVA 3FMQA 2BBYA 5KAIC 1QZZA 5CVUA 4A3JJ 4EM2A 2QVOA 3OS1A 4IRHA 3DPLC 3FXQA 3BR0A 1VQOI 2ZB9A 1D0ZA 5F0CA 1F36A 3BOQA 1SC7A 4L5EA 5EEHA 2M34A 3NI7A 4RBOA 2JTVA 3OOUA 2WAQN 3CMEI 4MK6A 1JT6A 3F22A 2UXOA 1MZBA 3NWSA 4JX5A 2XHKA 2FE3A 4N4NB 2EILH 1T2KA 2UZKA 2EV6A 2M4GA 5HLGA 1SVLA 1IV6A 2RKHA 1STZA 2W84A 2VJ5A 3KP7A 5DV5A 1T95A 5B3SH 1YX3A 3NWTA 3AL0B 3ABUA 3CUQC 1ON1A 2FD5A 2FSWA 2VQCA 4L5IA 3O2PE 3OYGA 5EF6A 1UFMA 3LFKA 3CCVI 2IEKA 5CQEA 1HF0A 4HLXA 2FBIA 1SFXA 2QQ9A 2G3BA 4O6JA 5ED4A 1KU7A 1J09A 1P9QC 1R5HA 1K78B 2K9SA 4AF5A 5GAHJ 3ZGKA 3QU3A 1MNDA 1QPMA 1Z9CA 2DT7B 1Z0XA 2HGCA 2PMZA 1NK3P 3M1CA 2R7FA 2ESNA 2HZDA 2KDOA 3OWTA 4JQFA 4HF1A 3S3MA 2DO7A 4BJTA 2OZ6A 2HDDA 1Y0NA 3AG2H 2FU4A 2REKA 4EV0A 2ZNYA 4PSXA 2DDAA 3SFZA 2B0LA 3QPHA 1V5FA 2ELHA 2O9LA 3MEXA 5J3LA 1FIPA 4U7DA 2VBYA 2XF5A 4Z2YA 4HNUA 1V5EA 4EJVA 1N25A 1U2WA 3DKWA 1NG6A 4OOIA 4NELA 4RB1A 1I3AA 1JTXA 3S2DJ 4MQVA 1MJ9A 1O3RA 3WTZA 4NHJA 2XDVA 3NNRA 1MGTA 5B5EC 3PO3J 4FASD 1D8JA 1K79A 2RREA 4KMFA 2NAZA 4OIQF 3MNLA 1I27A 4WXCA 2XASA 1D0XA 1ZELA 3PQKA 4IQJA 2X1EA 4E7JA 5H6QA 1EV7A 2Q0OA 3M07A 4LIUA 2P4WA 2JQ7A 3GX4X 5BNGA 4B44A 3BZ6A 4RMNA 3K4MA 2JA6J 3ERMA 1VQ4I 1H8AC 1X1BA 3TP3A 3LAPA 2IVMA 4LGWA 3KP4A 3ZMVA 4RAZA 1OCZH 1F43A 3A0HC 5E3LA 4ZYEA 3HC7A 1W0TA 3JSJA 4CHUA 1BI1A 1MMAA 4BXFA 3GTQJ 3R0JA 3KE2A 1LVAA 1MSEC 1FOKA 4A3MJ 1GV5A 3OIQA 3DP7A 2FF4A 4CYCA 2V1UA 5KK1A 5JR3A 1W36C 4I0AA 3AQTA 4DGWB 2CU7A 3Q5FA 4Y7NJ 3ISPA 4RGRA 5F6FA 4PCQA 5HVQC 1BR1A 5K5RA 1IXCA 1WJAA 1OYYA 2A68F 2I8DA 3GTMJ 1FEXA 4BDZA 4IOCF 3H35A 2E1MB 4OINF 3KKCA 1J9IA 3IHUA 3NPIA 2DN0A 3ON4A 4ENKA 1UELB 4UHTA 3C2GA 2GQQA 5CXIA 2QLZA 1REPC 2STWA 3RJPA 1NTCA 2IXSA 1X1AA 3CO7C 1UHSA 2DFIA 4PJJA 3COLA 3ZMTA 3BTIA 2IS4A 1OISA 3I5UA 2CGPA 1X2MA 4GFLA 4IO9F 1SVMA 4HKUA 4WIBA 3ZCOA 1SVOA 2Y69H 2GAUA 3IAS2 4XLFA 1G4DA 1S72I 3DEUA 1FY7A 2RHAA 3VDXA 2VOPA 3EUHA 2L0KA 3NXCA 3U1KA 2FA5A 2VXDA 2DPDA 4FISA 3W6KB 3JCUC 3ROUA 2FMYA 3KZ9A 1YRNA 2O8KA 5EZGA 2K86A 4ZH4F 2KZVA 1P4WA 4I01A 3M9AA 1DP7P 3GTOJ 4O5VA 4WK8F 2QGUA 4RB3C 5H6RA 3KYLA 5F1JA 1Y56A 4XBFA 1A5JA 1ENHA 3GZNB 1NH3A 4Y52J 2HWVA 1BM9A 4AVPA 3L2QA 2H1LA 5D6EA 3QOEA 3LMMA 2HXIA 1QVUA 3LSMA 4IHTA 4A3LJ 3OL4A 2ZJPF 1XGMA 2C6YA 4I6ZA 4HV5A 2DOAA 2BGCA 1OR7A 3GFIA 2WTEA 1YJWI 3OR1C 2A05A 4ETSA 3ZOBA 2X9DA 1RETA 4ME9A 3CD6I 4GCTA 2NS7A 3GEUA 1UG0A 2Z1DA 4GRIA 1WQ2A 2ZFUA 3JR9A 4FTHA 3EUKL 3U9GA 1WJBA 4KA4A 2HQAA 2NNNA 2CQ7A 2ZSHB 1GXPA 3HOTA 4YIIA 2VI6A 4IRVA 3HRUA 2EBIA 1IF1A 4XMYA 2EINH 3S2WA 4Q5SF 3S2HJ 2XUBA 2UXIA 2CFOA 1TW3A 2L3DA 2W82A 4X6AJ 3JRGA 2G7SA 4MTDA 3FXMA 1YOVB 2EV0A 4QLCU 3S3NA 4W1UA 4B48A 3GBGA 1LDJA 1S29A 2WB1N 3WTUC 1FYLA 1IRFA 4BBRJ 2NOGA 1I6HJ 2CO5A 4U0VA 4EGYA 4B3AA 2R7VA 1Z05A 4Q47A 3RH2A 3RTRA 1WI9A 3F1BA 2R7RA 2ZJRF 3F0CA 1HA8A 1C0WA 2NOJB 1FZPB 2R3SA 3DEEA 3KX2A 2HDCA 5AIQA 4LIVA 4R1HA 2PMHA 1K78A 3V6GA 2E1NA 1GV2A 5K7ZA 1TQIA 4RM2A 2PJRA 3SZTA 4UUTA 2L54A 4YIFA 1IN6A 2JUGA 2QA4I 2GUHA 2GIVA 3DTIA 2GOXB 3K0LA 1SFUA 2WV1A 2OV7A 2CS3A 2ME6A 3OYNA 2EZLA 1JKOC 4Z6YA 4EJWA 2G7LA 2MC3A 2D2WA 3Q0WA 2DTRA 3WU1B 3CCLI 1TQMA 3WTSC 2MGQA 4M6XA 3FMRA 5DDGA 3WTXC 5F27A 3VYRB 2CQKA 2L9NA 3BQYA 4HV6A 1A6QA 1TT0A 2O0YA 1JHHA 4JX4A 2H6BA 1FMWA 1K6YA 1S6LA 1WRJA 4KIFA 4CZCA 1OCPA 4CCNA 1G3SA 1R49A 5EG0B 1U78A 4G7OF 2JMWA 1E2XA 2VJIA 1JUSA 3CWRA 1OCTC 1S5LC 3HKZA 4MHGA 1XCBA 2HYTA 3VSLA 2GWRA 4HRIA 1B8IB 4MO7A 1XGOA 3H5RA 4A6DA 5J40A 1LB2A 3FM5A 2X6YA 2VKEA 4YRVA 1SD6A 2Y9YA 1BW6A 3DLLF 1AWCA 1VQNI 5FRMA 2HYGD 2XKOA 3G1OA 1GDTA 2VPLA 4II2A 4GFBA 3H5AA 5AIPA 3U2RA 1BW5A 3A01B 5F0FA 3FF5A 3JSOA 3BG9A 4HZFA 2GENA 3H9QA 1G6NA 4G94A 1QA6A 2DDBA 2MW8A 1IN5A 4V19K 3B81A 4ZZLA 2JT1A 3GFMA 2IS6A 2Y2ZA 2CUJA 2NP5A 1J5YA 2K02A 1YHQI 2V79A 1VNDA 3FHNA 1IAWA 1Y39A 1MBJA 3QPSA 1WCMJ 5TRDA 1Z21A 4C30A 4AUXA 4C2TA 2A3SA 2IGKA 4N9HA 1LVKA 4HA8A 1R6RA 2IAIA 2FEZA 3G1MA 4RGUA 2ZCXA 3H0DA 1BI0A 2J5PA 2G9WA 1ZH5A 4FQGA 1S7EA 1D3YA 2M0CA 3OOPA 1R36A 1XGNA 1TZLA 2Y0SA 5FKNA 5BQTA 4YFXF 2ZOYA 1KA8A 3J7YJ 2X6XA 2EH3A 3PPBA 5HS8A 2V6EA 1OCRH 4JK1X 1HBXG 1B72B 1DQUA 5HDGA 3OYMA 3HIMA 1R71A 2H8WA 1G2HA 2K27A 3GUDA 3ELKA 2RC4A 1O3TA 1WJCA 1QGPA 3T0YA 1V5GA 3IWZA 4IOAF 3H3VK 4XIDA 1XCVA 2JK3A 5B66C 1W7PB 3T6NA 2M30A 3EUAA 4L9TA 4L0ZB 3ZN1A 2BOLA 3IUVA 3J81Z 2B63J 3DEWA 1KU9A 4KN4X 4E6KG 2WBMA 4ZYHA 2CQNA 5K7HA 3IRRA 2PBXA 5IT9K 1WJ5A 3SZPA 5E3OA 5EZHA 1T0FA 1SD5A 3DPUA 3M8EA 2K85A 5EFYA 4O3MA 2P0WA 3JAMK 5CQGA 1YFHA 1OCCH 3HSFA 4KICA 2XV4S 3SJMA 3I71A 4NNJA 1D1AA 3H92A 5DYMA 1BBYA 4G6TB 3GVAA 2XGDA 4AVZA 5D8LB 2HDWA 3BTCA 4EQQA 4DOZA 2BE5F 2MD0A 1U6GA 3ZQLA 4JNNA 2CW7A 1FLIA 5HS9A 3KKDA 1VI0A 4KIGA 2WY7Q 3PM1A 3K1MA 4B47A 3GCMA 4U9NA 2HU9A 3CJQB 2KPMA 2XGEA 1XB4A 1H9GA 2CUZA 2RQQA 2OTJI 5TGTA 2H09A 3QYFA 1OJLA 1WH5A 4YIRX 1A36A 4GCVA 2ZJQF 2V9KA 5FLXZ 3I59B 5CJ9A 4CXFA 3S1MJ 4DVYP 1S7OA 1F5TA 3ASNH 2PI0A 2IJLA 3I4PA 3MQ0A 4BE2A 1M1EB 2QWTA 1GT0C 2A6TA 3E6BA 3ZQ7A 2BY1A 2EK5A 1PP8F 2XAQA 3CDHA 3BTJA 4E7IA 1W0UA 3ZMUA 2DA4A 2PEXA 2ISYA 3OYFA 3KYDB 1ZN2A 3CDIA 3NQOA 5DCFA 5FKOA 3TOBA 2GXAA 1BI3A 1LJ9A 3HGGA 2EIMH 2MA3A 1BIAA 2EB7A 4M73A 2LY2A 5DUIA 3EGQA 1DDNA 2M7AA 4CGRA 2Y31A 2XROA 2O61A 3HM5A 3VYTB 2FBHA 2ZMEC 2FX0A 5LLQA 3FDYA 1SMTA 3WHBA 2E19A 2G7HA 2JZYA 1YJNI 1D8KA 1LFPA 5HNFA 3MN2A 3K4JA 4AIJA 4KISA 5JHUA 2YVEA 4OMZA 2VONA 2DQRA 3RPQA 2ZXWH 1X4PA 1MKMA 4EVIA 4IJAA 2ECBA 4OAYA 4A5MA 2LY1A 2JRMA 3OS0A 3E7QA 4OD4A 4UVBA 3O8GA 2VASA 3SFIA 1WJDA 2V1NA 5LEJA 1FOXA 2BY0A 2K9QA 3C7JA 3PIOF 2IRFG 1YG2A 2MD5A 5EG0A 1T33A 3VVZA 3HTUA 4BQNA 1T0FC 2FQ4A 4RM3A 3S16J 4HDVA 2R92J 3D5SC 1DP3A 3E97A 4WWCA 4LD5A 1XG1A 1I6XA 2XDNA 4M3FA 2CG4A 3I3LA 4I09A 4IX7A 2QQBA 1BI2A 3LWFA 2QQ8A 1XS9A 4C9YA 1JGGA 4RA2A 5CVRA 4JP0A 2X1DA 1UJ8A 4KWAA 3BCGA 3PUFA 2V7FA 4XLNF 3ZR8X 1FP2A 3S1RJ 2L7MP 4MIMA 3HTSB 4GDFA 4XONA 3IH4A 3HBLA 1U0JA 2E35A 2KFDA 3A2KA 5BPDA 4XK4A 1QZEA 4U88A 2L4AA 2P5LC 3K1PA 2UXPA 5B1BH 2DMQA 2OPTA 2HPIA 3GXOA 1MJBA 3CJRB 3LSTA 2DA6A 4B1RA 2E5NA 1YO5C 4A69C 3LA7A 1TWGJ 1YE9A 3JRAA 2WAEA 1VQLI 5CVIA 4G6QA 1IXRC 2HQNA 2K3PA 3LSHA 1DGWY 2ZY9A 1WVRA 4DIQA 1XSDA 5E3NA 3MZHA 2RASA 1FP1D 4M3GA 1ITYA 3I0TA 3PFIA 2LRDA 2A5WA 3CRJA 4A3CJ 3NAUA 1P7JA 3BROA 4XL9A 2VJ4A 2DCEA 1S9HA 4OIOF 4HEA2 1MBGA 5E79C 1KU2A 4A2UA 2NYXA 3WU2C 5EGOA 2FBQA 2XGXA 3DPTA 3HTHA 2O8XA 2RGVA 3DKXA 5DEQA 1HC8A 3RKQA 4UUSB 1T39A 1KGSA 2CMPA 5E8GA 2DK8A 3I4NJ 1W7PA 2M7BA 2OF7A 4M9XA 3AG1H 5CW8A 2WGBA 2QEXI 1POGA 1S3JA 3CTAA 1SD7A 2HEOA 4WX9A 4BACA 3HOYJ 1YS6A 5IP7J 5L3EA 2KP6A 4A0ZA 3DU5A 2DA7A 3DBHB 3OYKA 4BUPA 1FT9A 4ASNA 1SMYF 3G6EI 4M71A 3P7NA 3KZIC 3GYHX 4GO1A 4IEJA 2EFPA 2WADA 3BZKA 1BL0A 4ZTJA 4Y17A 1HDPA 3X2QH 3JRCA 2M4KA 3FIWA 3FZVA 1ZG3A 3HUGB 3OYHA 2R4GA 4UVAA 4C3IJ 2EIKH 2XRNA 1HDDC 3RPUA 4KUMA 4MGRA 3JRFA 4NC7A 2KDZA 3AG4H 4HSTA 3E6MA 3L2WA 1EJ9A 3JRIA 2OTLI 1MIJA 3CC4I 3BJAA 4HAMA 1F1ZA 5BPIA 2DMPA 4C3HJ 2W48A 1RR8C 1LQ1A 2L7ZA 4PK4A 4L9NA 2ESHA 3H36A 3JW4A 5LRRA 1NHAA 3IP4B 3I59A 2QZ8A 1IRZA 3SHFA 4OIRF 1FOYA 4KMUX 1J2XA 3QPLA 2ZOZA 4M3BA 4J00A 1RESA 5ILSA 2V4JC 3GZ5A 4G9YA 1HQCA 1U5TB 2QKMB 1ZG1A 2EA2A 3QU6A 3J7AY 1HKSA 3KLNA 2KRHA 4Y3OA 5AQCA 4I0BA 2NP3A 4RS8A 1VQ9I 1OFCX 1Z3XA 2EWNA 1D1CA 1XD7A 2QCOA 4AIDA 1WPKA 2WV0A 3PASA 4CDGA 3IH2A 4NB5A 2Q8KA 5TISC 1DU6A 3C07A 2HQRA 2R7TA 3HZJA 2OERA 5GAGJ 2R7ZJ 2YS9A 3C18A 3R60A 2E5ZA 2Q1ZB 3GLXA 2IA1A 3CQZJ 1X1DA 2WAQA 5FROA 4H4KC 2EZIA 3EYYA 4BHCA 3PNYA 1A35A 1CGPA 3AQSA 3G71I 4L0YB 3K4LA 3ZXSA 5TJJA 3ZQQA 3EQLF 4RDUA 2G7GA 1O57A 2V9PA 1KQ0A 2OJED 1N75A 3HE0A 2QKOA 4YFKF 1L0OC 3K4BA 3U21A 2R7XA 1PUEE 3F23A 3GFLA 2DFFA 4G7ZF 4GGGA 2XC7A 5EEAA 2XGCA 4M6VA 2LH9A 2X85A 4AD9A 1JXSA 3HHGA 4BQAA 3NARA 1MMDA 2N8GA 4GYIA 3RKWA 5IYCJ 3LSPA 1TWCJ 3I9V2 2QKLB 2IS1A 5HSZA 4PFPA 1R23A 2DYRH 4FT8A 1YIOA 2L7KA 3RKYA 5D1RA 3RI4A 4FE4A 2LDUA 5IY5H 2WWYA 3HEFA 3KCCA 3V8LA 2XAUA 2EFQA 3W3CA 2IP2A 2HTJA 1O7FA 5CXGA 5KNLA 3ZMZA 2R7WA 5KCMA 3LNQA 3HTIA 1RPWA 5D5WB 2LF7A 2QF7A 4EEFG 4ZJZA 3IUOA 5LD2C 2BVMA 4LG3A 4ZYDA 4FE7A 1JKPC 2BW3B 1XDUA 1JT0A 3GTJJ 2NS8A 2KHMA 1HW1A 2P81A 2XPVA 4UB8C 3WE3A 4MQ9F 3RQ4A 3TKYA 2EZKA 2GA1A 2Z99A 4F92B 5LGTA 3I56I 1MBKA 3HHHA 1ZR4A 3QP6A 1IN4A 1Z7UA 2R5ZB 5HDKA 1OQYA 1TBXA 3FHZA 1PUFB 2EFWA 4ZDPA 3NEUA 2MG4A 2NVUB 4Y33A 3WGGA 5LGNA 3QKXA 1ZRCA 3WE2A 2KQRA 2LR8A 3W6JB 3BR6A 4Y13A 4XORA 1Z3YA 2DJIA 2HNHA 3GMEA 5FO5A 5ILUA 5DS9A 1UHMA 2RVCA 3RYPA 3D5LA 2D1VA 5IPAA 2F48A 1CQTA 2LK2A 4DYQA 3I55I 2YVXA 4BQOA 4QPOA 3HOWJ 3WTVC 1U3EM 2OC6A 5E1WA 2GA2A 2M45A 3GZ6A 4Y15A 2R5YB 4BS9A 3CUOA 2VL8A 3OY9A 4P5OA 4LITA 3FK6A 2HR3A 5FKMA 5A2QK 3LAJA 2PFVA 4P55A 1LDKB 2X1CA 5F1RA 4I99C 4UUSA 3LQQA 2VPRA 4BE1A 5F08A 4XR6A 4GYGA 3B02A 1FPQA 3CLQA 2ME0A 3P9TA 3E5XA 4XQFA 5C4YA 2IBDA 3PIPF 2I5UA 3S32A 1YX5A 2VQHA 2IU5A 3WG9A 2QQAA 4PJMA 5K5OA 4IKFA 1HLVA 1IG7A 4LLNA 3N05A 1RKTA 3F21A 1K6OA 2E36A 3RDIA 1X3UA 5D19A 2KZGA 3JTGA 2HS5A 1R00A 5FD6A 1BJAA 3VODA 3CJNA 4RLQA 4A3FJ 3I58A 2RNGA 5IT9Z 2FNPA 3HUGA 2L02A 2X6WA 2KKOA 2A07F 1R1UA 4HOBA 2UWMA 1IXSB 1W36D 2L01A 4A3EJ 1IN7A 4NQWB 4EM1A 4AYBA 1JGSA 1BC7C 3JAMZ 4LB5A 5ICCA 1YJ9I 4OAZA 5L3FA 2NVTJ 3KNWA 1WH7A 5ICEA 1ZLKA 4IHSA 1TNSA 3OYIA 4CCMA 3RZDJ 3HOZJ 3R61A 2Q2EB 1QHHD 2TRTA 2M5WA 5KVRA 1PDNC 4IPAA 2LVSA 1K83J 3BCBA 3M7GA 1J0RA 2VJJA 1A31A 1IUYA 5IOYA 2XF7A 1JUPA 1OKRA 4BBSJ 2UXXA 2QIBA 3GF2A 3JSPA 2GLOA 1YW7A 2Z3YA 3Q9SA 3KFWX 1E3HA 1U5TA 2K4BA 5FGLA 1FBQA 1DUXC 5M3FJ 3FK7A 2HOAA 3LA3A 1DPUA 3HKZN 2FUG2 2Y0MA 5E20A 3PO2J 3VOXA 3FXRA 1FYMA 1DPRA 3AAFA 2VOOA 1WHUA 3EUHC 2Z2SB 4MFDA 3BQZA 1O3QA 3H9GA 3B6AA 1R4NB 3MD2A 3BR2A 2BHYA 2F5FA 2VXZA 2VT3A 4ITVA 3ZMSA 2K9NA 3E1SA 5IT3A 1TQPA 4KIBA 2HQ5A 2CJJA 4G7HF 4E7HA 5DCMB 1Y0UA 2DMUA 3ZQHA 1ON2A 1UHWA 3DF8A 4K2EA 1IJWC 3BCAA 1I5ZA 2OCCH 3WTTC 2XSJC 4I2OA 5J1RA 3FBNB 2F07A 2OUMA 1IZ1A 2LOOA 3FRQA 2DMNA 1WJFA 3VOEA 4XICA 4J19A 3V7RA 3OIPA 1ZGAA 5C3EJ 1E3OC 2DOFA 3VPRA 4FX0A 2H8RA 4L62A 1P4AA 3HGYA 3HIFA 5HNHA 1OR7C 1YQAA 4N9IA 1NK2P 4YELA 4ZDOA 4CYDA 4LB6B 4I02A 3P9KA 4KT6A 5JVTA 4LLLA 4PZJA 5J8FA 2LP0A 4UVCA 3DU6A 4CUGA 1ZGJA 3CF2A 3WGIA 2UXNA 1AU7A 3QP5A 4N0BA 1I3QJ 3F8BA 4D7MA 5FKKA 2NXNB 2D45A 3E5QA 1YTYA 3GLLA 4DBRA 4MEYF 1FTTA 2R7DA 3REOA 4LG0B 2GXBA 1EF4A 1EKEA 3VVYA 2BXZA 3JRBA 3VWBA 3TDZC 2LREA 3SWHA 2R7QA 3S93A 4D1QA 2CV0A 4U7BA 4U0YA 4DZPA 2L7FP 4A93J 2BW3A 1YS7A 4QPQA 5IYBJ 5LRSA 4HX7A 2UV1A 4UDSA 2Z16A 2F4IA 3V78A 2BV6A 2FOKA 1E17A 2UUZA 5GTIC 3O8HA 1ZRFA 3CUQB 3TL4X 3BY6A 2R5ZA 4S04A 5DUKA 3VOKA 4ESFA 3AL0C 1Z1DA 2E71A 3RQIA 5L3CA 2BYVE 4IHYA 2Y9ZA 1PUFA 3PUBA 3FXOA 3S14J 1B6AA 2CWEA 2W24A 4DW6A 3VFZA 1Z6RA 2YX4A 2M3AA 1J7KA 4A3BJ 5EEGA 5F64A 2CSOA 2A2FX 2ZXIA 3N4MA 1R7JA 2KIUA 1E0EA 3SZGA 4LOCA 1NG7A 2CFXA 4XRMA 2W7NA 3A0BC 3ML6A 1H89C 2V26A 1JI8A 2IGOA 2COBA 4L9VA 2L9RA 5FLMJ 2R5YA 1MNEA 4LLGF 5M5YJ 4BJ5C 3BPXA 4A3DJ 4XLHA 4PUSA 3FWEA 2WUIA 3HOXJ 2VKDA 1SD4A 2R7OA 4TV7A 1Z7LA 4N4OB 2ELJA 4A6EA 2ADUA 5E1XA 3LSGA 2VN2A 5HLIA 1ETXA 4CICA 2VQGA 5FB2A 4LMYA 4ZYAA 1X3ZB 5CLSA 4IVNA 5E3MA 4A5NA 1OCOH 2FQ3A 5J1UA 1BOBA 3KP3A 2WC2A 4BHBA 3DKYA 3LA2A 3T8TA 2VKHA 2P8TA 5ERIA 1OMIA 3IAM2 1XSVA 2LY9A 4BEHB 4EJTA 2ISZA 5GPCA 2MLGA 3F8CA 3F8NA 1SAUA 2P6SA 1UCRA 2IT0A 4OIPF 3NS4A 2DA2A 5E8IA 3GO5A 3DTEA 1RUOA 4EM0B 1HW2A 5H9TA 3Q3SA 5D6FA 1YIJI 1BJZA 1ZTRA 2JA7J 2OCEA 1T8IA 4NQWA 3BHQA 1FX7A 2ID6A 5DTDA 3EUPA 3DTKA 3A03A 4UXNA 2HPMA 3LQRA 5LHGA 2AXTC 2K40A 3RKXA 3MKLA 2FJ1A 3BG3A 2CW8A 1B59A 2E1MC 3K6GA 4XOPA 5IOZA 4HDUA 1YW8A 2Q2EA 2DODA 1HSJA 4DQ2A 4B43A 2QENA 1SGMA 4M74A 2PJPA 1FMVA 2M8EA 1X58A 3QQAA 1DU0A 4UUVA 1PJRA 3DQVC 4L18B 3WU0A 1GVJA 4R79A 1SFEA 2B3WA 1RIOH 3HG9A 4Q48A 4W97A 2YPRA 3VTIA 2VBWA 5JLXA 4P96A 4XKWA 5HOOA 5K58A 1SANA 4KDPA 1TP4A 3FM3A 1GXQA 1RUNA 5GADJ 3K1NA 2LYCA 2KRCA 4BU2A 3ZQIA 5J4YA 4EGZA 2M87A 1GLNA 1ETKA 3F72A 3OYCA 2W53A 1PYVA 2VODA 2BY2A 2W1OA 2P6TA 5DCMA 4DYRA 2YU3A 1BN5A 2G0EA 1FYKA 2MBFA 4GFKA 3VVXA 3C2BA 3TEDA 2KIMA 5GPAA 4L5JA 2XPWA 3UNGC 5D5UB 1X4OA 4BJ6C 3JTHA 2F5CA 1W5CC 4I7HA 4ON0A 1KYZA 5E17F 2E34A 2I10A 3IH3A 2DOEA 2FOWA 5K7FA 2OU2A 3HOUJ 1R1TA 3MAJA 1JUMA 2AQFA 2ZJ2A 1ZYRF 1XC5A 2RN7A 2VKVA 3EPZA 4P9FA 1JKQC 4GXOA 1XPXA 2HI3A 5GP9A 2LC2A 4BY7J 3VEPA 1B8IA 3OSGA 4MXMA 3ECHA 2HTSA 2E1OA 3DXJF 2F5DA 4NDLA 3SXYA 5D4RA 2G7UA 2NVYJ 1N77A 3PSFA 3CCSI 1ERDA 1MNMC 3CP8A 4ABZA 2HKXA 2R0QC 3GW2A 1R5GA 3NRVA 3M8FA 3A01A 4ACIA 2FMLA 2YSRA 1WWXA 1IW7F 4D7NA 1J75A 2H1KA 3LHQA 5C4JJ 3W6VA 2M1BA 1G3TA 2ICWG 1LFBA 1ETYA 4U9LA 2GZWA 3U1DA 1EH7A 2XRLA 3A4CA 3HOVJ 2BHZA 2FJI1 4MFEA 1IC8A 1VQ6I 4C2UA 3O60A 1T08B 2HXOA 2PMUA 4IHVA 4HW0A 4XLAA 3WODF 2VE8A 3I64A 2DG8A 4U0WA 2JA5J 2KL4A 1A6IA 1QZYA 4KN7X 2XAHA 1XX5A 3CC7I 5HDNA 3CUQA 5H20A 3J7ZI 2VT2A 4E7SA 2DMTA 3TW7A 5BMZA 2PX9A 3ON2A 4HF2A 4R8HA 2HYFA 3ABTA 3PQJA 4JOMA 4BXXJ 1HKTA 1MD0A 2QM3A 1ZREA 2CV1A 3BC8A 1TLHB 5D18A 2H94A 1WKMA 4D5FA 3COAC 2Y30A 3RYRA 5CYVA 2K3FA 3L2CA 2PLYA 2O6GE 3ESWB 4HX4A 2E7WA 4PJ0C 2P7VB 4V2GA 2LBFB 4A3KJ 3FXLA 3KIOA 1VFCA 1B72A 4WXDA 3ZQFA 4OWRB 1FTZA 3OS2A 1MH4A 4XRSA 3D5RC 1V3FA 3EYIA 2OA4A 1QHGA 2OZUA 3W2WA 3BG6A 2KISA 3J81K 2EPFA 3O3KA 2B7EA 4IRGA 5E1ZB 4EJOA 1T6SA 4PGHA 2JN6A 3AKZA 1ODDA 4MLOA 3W2VA 3CCRI 4NN1A 3DFGA 2GIZA 3ASOH 3RIRA 3TOAA 2DLLA 1VQ8I 2Q24A 2UXUA 5FGMA 2MLKA 3T1BA 2WA0A 3WHCA 4IZZA 4FHTA 1FBUA 4PDKA 2TCTA 3FBIB 4G8XA 4B4CA 4ENNA 1OYWA 2AHQA 1MBEA 4A0YA 1B9MA 5A2QZ 3KZZA 2XB0X 3D0SA 3K10A 2OAZA 2L2OA 3SDGA 3F8FA 3CCYA 1B9NA 1JJ8C 1VQ7I 3S17J 4RGSA 3CMAI 1LEBA 4BEHA 2KRFA 2H27A 3H0GJ 1MMSA 1Z67A 2PMZN 2VUMJ 3CLOA 4BDYA 5L3GA 3GTGJ 1XTAA 1LNWA 1WFXA 5CVVA 4OMYA 3LSKA 3FXJA 4A0XA 2Z9OA 1JKRC 2MFZA 4XN0A 4A3GJ 3KP6A 2DPUA 2X6OA 3CCUI 5FLXK 4NBQA 4AIHA 4YG2F 1HCRA 3QODA 4M3DA 3CCQI 1VQKI 4DBQA 1GVDA 2F4OB 1HSTA 2ZFWA 4XSZF 1P92A 1FNNA 2QOPA 4M9ZA 1X2NA 1IV8A 3LOCA 4LK1F 2NS0A 1USTA 4M72A 2GM4A 3DPJA 5EJCA 4OD5A 3QOPA 4RB2C 5LHIA 4ICHA 1FC3A 4XM3A 3OIOA 4BHPA 3NRGA 1T38A 2PZ9A 1KQ8A 1L3LA 3HPGA 1WGXA 3ABKH 4M9SA 3KPHA 1MJAA 4BXUA 1UI6A 1A04A 2XIGA 3AFHA 4X1EA 1BR2A 1UMQA 5LBQA 3GTKJ 1AOYA 3ABMH 2O5RA 4KYWA 1D1BA 1QRYA 4QTRA 4CA0A 4QSHA 3PSIA 3BPVA 1FJLA 4HYEA 1G59A 3ZPLA 3OL3A 2FXAA 1RZ4A 4Q4ZF 2P5VA 3OYBA 2QSFX 3CESA 4LFUA 3ULQB 3MKWB 2X0LA 1V4RA 1ETWA 2CH0A 2MSYA 4A3IJ 4J01A 1TWFJ 2KLOA 2PG4A 2VB6A 4I98B 4HNTA 2EZHA 2PJRB 3BTLA 2VQLA 3HB9A 3BR3A 3HOSA 1IGNA 5EYRA 2O7TA 1FWZA 5ICGA 1F9NA 4GCKA 2F5EA 1U8BA 4IHXA 5E18F 3HTAA 1W1WE 3IWFA 3DWLE 1R58A 5FD5A 3QRFF 2MH9A 3ZQCA 2HFHA 3V7CA 1K7AA 2X51A 3MVPA 4FCYA 1LEAA 3ZQGA 2LF8A 3OYLA 4M6YA 3MWMA 1AA7A 1WSUA 2F6CA 3CC2I 1UI5A 4RAYA 1AKHB 4HF0A 3E0JB 4G12A 4DYCA 4MTEA 2MYSA 3WTYC 1Z77A 1USSA 1H88C 3S8PA 2BXYA 2UXHA 4XRFA 2PBIA 3F9KA 4JL3A 3BJ6A 3HDDA 1YI2I 2PFBA 1JHFA 5DD4A 4B3XA 1HXDA 2E1CA 3V42A 3LSRA 5JHFA 4XKBA 4E70A 1ETVA 4KT5C 1IRXA 3HL2A 2NNYA 3VSKA 3GTLJ 4A12A 2QTQA 1APLC 3L2VA 2GOMA 2IS2A 1TWHJ 3L09A 3MZYA 3TO9A 3BP8A 1ZR2A 2JSCA 2P5KA 5CVJA 2KT0A 2WY8Q 1MW7A 2E7XA 3CZ6A 5FFZA 3BJOA 1SFKA 1G8XA 1ZAOA 3IL2A 2O03A 3GZIA 3TO6A 1XGSA 1D5YA 2P7CB 4D5CA 2HOEA 5CPRB 3J80K 2W00A 4F91B 4NC8A 1MDMB 2BVLA 2OQRA 4XKCA 3D1NI 3L9FA 5HLTA 3Q9VA 2LKSA 1MSFC 4ANJA 3ANGA 3P5JA 4NUBA 2FNAA 4DNCA 5C44J 2E2HJ 4PXIA 3K69A 1UG2A 5GAEJ 1OLTA 2AXLA 1PVEA 2M9HA 1ZQ3P 2ZCNA 2CV2A 2MH2A 3LSIA 1IN8A 3H9JA 4CSWA 3KETA 1W4MA 2EFOA 2D1HA 2VC1A 4KNYA 1U9NA 2IA0A 3I54A 3UKGA 2Y48A 1FBSA 4G6DA 1R5ID 1T56A 2LBFA 4IL6C 4PJLA 5EDNA 2ZMEB 2CYYA 2TDXA 1P7IA 2MABA 2EJRA 3JRHA 4CCKA 1MMNA 2D6YA 3LWJA 1VQ5I 3IC7A 5L3BA 1R22A 3V8JA 2JRTA 3ZMDA 1K61A 5D4SA 2MC4A 1UB9A 3T5XA 1VQMI 2V57A 2RAEA 3BR5A 1TW2A 2DQLA 4AYBN 1SFOJ 1FSHA 3VW1A 3PJRA 2ZBKA 1YLFA 1ZLJA 1B4AA 2HYJA 2ZCWA 5JLWA 1UAAA 3E6DA 4E7LA 5FMPA 3TQNA 3MKYB 2RDPA 4PGGA 3AG3H 1GUUA 2A6EF 5JFRA 2A6HF 3ONQA 4B8XA 1VF9A 2KIFA 1W7PD 2W25A 4C2MJ 3KEOA 3ZN0A 2GBYA 2YVHA 4P9UA 1FSEA 5FFXA 2E2JJ 1I1SA 2XKPA 3I53A 2OD5A 1VZ0A 2QUFA 4ZZDA 2KJCA 1SAXA 5HBUA 1JTYA 3E6CC 1Q1HA 3WTWC 5F04A 2WAFA 1KZHA 2XPUA 4JBAA 3BJBA 4BH9A 4AC6A 3RCOA 2JVHA 5FJ8J 3WGHA 1LFUP 3M4OJ 1O3SA 1JJ6C 2DA1A 1ZRDA 5CKTA 1Y1VJ 3VYSB 3C3WA 2XVCA 3E7LA 4AWXB 3Q0VA 1PP7U 1I1GA 2QWWA 3CO6C 3SYTA 3BWGA 3KP2A 2RQPA 4WXHA 1XMAA 4E7KA 3QAHA 3K2ZA 3PNTA 3K70C 1LE8B 5FRNA 2JA8J 3RPUD 3RD3A 3VUQA 2JPBA 4X0GA 2XAJA 4RB0A 1ZGWA 5LEKA 3I4MJ 3K9TA 5LFAA 4BL0B 2DA5A 1QU3A 5FLVA 3CMYA 3LJLA 4YFNF 4L9JA 2LTPA 1W5TA 3RZOJ 3HRMA 1FOWA 3BT9A 2ZXJA 2CQQA 1R1VA 2PQ8A 2CUFA 2X48A 3L1PA 1Q1VA 1QBJA 4Y4RA 4IHWA 2F4MB 2IW5A 4CCLA 2HVSA 4UB6C 3MCZA 5IP9J 1RNLA 1XSXA 3KLOA 2NRAC 4UY8I 2JJ7A 3OSFA 1OPCA 2VIXA 3CCJI 2EV5A 5F0HA 4ENJA 2DG7A 5M3MJ 3LFUA 4BYYA 2Z5UA 3BG7A 3B73A 2HZTA 4BKXA 4CCJA 1QO0D 4BQQA 1E3PA 6PAXA 4XLPF 2V1XA 4AM3A 1V55H 3H5NA 4GCLA 1RKWA 3OV8A 3V7SA 2EA4A 3G73A 1X1CA 2VBXA 4RAGA 2STTA 2XSDC 5ICFA 3S5RA 3ERED 5IP6A 2M8GX 2Y75A 4XLEA 4EJUA 2DI3A 2GXGA 3ZRGA 3L2RA 2DT5A 2V9VA 3S1QJ 1X19A 2VE9A 1VQPI 1S8NA 3CP2A 3OMYA 3MFKA 2ZO4A 2CUEA 2WB1A 1TL8A 5HS7A 1XN7A 4CZZA 3CCEI 2DTZA 2XF6A 1CF7B 3BG5A 3QBMA 2IGMA 5M5XJ 1ETQA 1YW9A 4YEJA 3UR3C 5J6XA 3CF5F 3DBRB 1AKHA 3G3ZA 1P4XA 5M5WJ 1UZCA 4UV8A 5JVGF 3F8MA 1R4MB 2LG4A 2LLKA 2YX7A
chains in the Genus database with same CATH topology
2DA7A 2Y0SN 2AO9A 3COLA 3BTIA 1X2MA 1QPIA 4GFLA 4W97A 4HKUA 4IEJA 4DZJA 1BL0A 2M2EA 5JLXA 2JWTA 1IDZA 2RHAA 5K58A 1SANA 1HDPA 3JRCA 3DCFA 3FIWA 5IYDJ 2L0KA 3NXCA 4C3IJ 3G7RA 3HTJA 4FISA 1HDDC 3JRFA 2KDZA 3KZ9A 1YRNA 2O8KA 3ZQIA 2LD5A 5EZGA 1ETKA 3JRIA 3GTOJ 2W53A 5F1JA 2ID3A 2DMPA 4C3HJ 4DYRA 2W48A 2G0EA 1A5JA 1ENHA 4GFKA 3VVXA 2L7ZA 3C2BA 3TEDA 4Y52J 5GPAA 2XPWA 4YZEA 2I10A 3IH3A 2HOTA 1IRZA 5K7FA 3HOUJ 2HXIA 1QVUA 5J1YA 1JUMA 4A3LJ 1XC5A 2VKVA 1JKQC 3JREA 4V2FA 4I6ZA 3QPLA 3LSJA 3IV5A 4M3BA 2ZOZA 1RESA 2HI3A 5GP9A 4BY7J 1B8IA 3OSGA 2O7OA 2NVQJ 4MXMA 1QVTA 3ZOBA 2X9DA 1RETA 4ME9A 2E1OA 2NP3A 4GCTA 3S15J 2NS7A 1OFCX 3BR1A 4NDLA 3GEUA 5FHPA 2NVYJ 2QCOA 3JR9A 1MNMC 1WPKA 4ABZA 2R0QC 4FTHA 3PASA 3IH2A 1DU6A 3C07A 3A01A 4ACIA 2OERA 2NVXJ 2R7ZJ 2YS9A 2VI6A 4M3EA 4D7NA 2H1KA 2EBIA 5C4JJ 3CQZJ 3W6VA 2NX4A 3LHQA 1LFBA 1ETYA 2EZIA 4QIWN 3S2HJ 3AQSA 3G56A 2UXIA 2XRLA 1BA5A 3HOVJ 1IDYA 5EGOB 4MFEA 4X6AJ 1IC8A 3JRGA 2G7SA 1ETOA 4RDUA 2G7GA 3O60A 2HXOA 5AQCA 4IHVA 2DG8A 2OI8A 2JA5J 3HE0A 2QKOA 1A6IA 4W1UA 3GBGA 1WI3A 2DA3A 2WB1N 5EEAA 2XGCA 4M6VA 4BBRJ 2NOGA 1I6HJ 2DMTA 3NARA 3TW7A 2N8GA 4B3AA 3RH2A 5IYCJ 3LSPA 3G1LA 1TWCJ 3ON2A 3F1BA 4BXXJ 3F0CA 5HSZA 5D18A 5D1RA 2DJNA 4D5FA 2Y30A 4FE4A 2E2IJ 4I76A 3HEFA 3JRDA 1TWAJ 3GTPJ 3V6GA 4V2GA 4A3KJ 1VFCA 1O4XA 4C3JJ 1GV2A 1B72A 5CXGA 2ECCA 3ZQFA 1ZKGA 5K7ZA 1FTZA 3LNQA 3HTIA 1RPWA 1MH4A 2YU9J 2QF7A 4XRSA 3M3YJ 4UUTA 4EEFG 3VP5A 4JKZA 2GUHA 4JYKA 4FE7A 1JKPC 1JT0A 2EQRA 3GTJJ 2ELKA 2NS8A 2P81A 2WV1A 2XPVA 1LE8A 3BNIA 2ME6A 2EZKA 2JN6A 2EZLA 1JKOC 2G7LA 4MLOA 1MBKA 3Q0WA 4NN1A 1ZR4A 2MGQA 9ANTA 2R5ZB 2Q24A 5F27A 2UXUA 3BQYA 4JX4A 3WHCA 1PUFB 1OCPA 2TCTA 2MG4A 4B4CA 3QKXA 2AHQA 1MBEA 5EG0B 1U78A 2JMWA 2LR8A 2XB0X 1JUSA 3BR6A 3CWRA 1OCTC 4BY1J 3S1NJ 2HYTA 5DS9A 5HODA 1MH3A 5IPAA 3SDGA 1B8IB 4MO7A 3CCYA 1JJ8C 2LK2A 4DYQA 1CQTA 3S17J 3B6CA 2LFBA 3H0GJ 2VKEA 1HOMA 2PMZN 2VUMJ 3GTGJ 2Y9YA 1BW6A 3HOWJ 1AHDP 4AC0A 3G1OA 1JKRC 1GDTA 4XRSG 4GFBA 3CDLA 4A3GJ 2R5YB 1BW5A 3A01B 5F0FA 3K7AJ 2X6OA 3BG9A 1Y1WJ 2GENA 1HCRA 4M3DA 3FK6A 5FKMA 1GVDA 2MW8A 2ZCMA 2QOPA 3B81A 1X2NA 3LOCA 2Y2ZA 2GM4A 3DPJA 2NP5A 4JX6A 4UUSA 4ICHA 1VNDA 2VPRA 1U9OA 1ZK8A 5F08A 1MBJA 3OIOA 1IUFA 1WCMJ 3QPSA 2D5VA 2PZ9A 3NRGA 4AUXA 3FISA 2ME0A 3P9TA 1WGXA 5C4YA 2IAIA 2IBDA 3G1MA 1UI6A 3K2AA 2ZCXA 3FKIJ 4X1EA 2IU5A 1UMQA 3GTKJ 3ANPA 2CRGA 1HLVA 1S7EA 1IG7A 1QRYA 1MBHA 2M0CA 4QTRA 3VIBA 5FKNA 1RKTA 1I50J 4QSHA 1FJLA 5D19A 2ZOYA 3A02A 1TC3C 2XB5A 4A3FJ 2EH3A 1MBFA 3PPBA 1ETWA 2MSYA 4A3IJ 1TWFJ 4CYCB 1B72B 2CQXA 2EZHA 3HIMA 3VW0A 2R93J 3BTLA 3HB9A 3BR3A 1G2HA 4A3EJ 5EYRA 1IGNA 2O7TA 2YUSA 3VW2A 4GCKA 1U8BA 3Q0UA 4IHXA 3HTAA 2NVTJ 3KNWA 1WH7A 3H3VK 4XIDA 2JK3A 3T6NA 3ZQCA 3BRUA 3MVPA 3RZDJ 4FCYA 3HOZJ 3ZQGA 2TRTA 3IUVA 2B63J 1R9TJ 3DEWA 5K7HA 1UI5A 2LVSA 1K83J 1AKHB 2PBXA 4G12A 4DYCA 5IOYA 1Z77A 2QIBA 1JUPA 4BBSJ 5FKLA 5E3OA 5EZHA 1H88C 2UXHA 2GLOA 5EFYA 4JL3A 3HDDA 5FGLA 5M3FJ 3FK7A 2HOAA 3SJMA 3HKZN 3PO2J 3VOXA 3LSRA 2XGDA 1ETVA 4MFDA 3BQZA 3BTCA 3B6AA 3TP0A 2HKUA 2LKXA 1YRNB 3GTLJ 2QTQA 3BR2A 3ZQLA 1APLC 2GFNA 4JNNA 3CJDA 2K9NA 3KKDA 1TWHJ 1VI0A 1ZR2A 3PM1A 2HQ5A 2CJJA 1FIAA 2KT0A 5C4XJ 2DMUA 4S0HB 3ZQHA 2XGEA 1IJWC 5HAWA 3GZIA 1OJLA 1WH5A 1D5YA 5J1RA 4HNVA 4D5CA 2F07A 1ORKA 3TW6A 2DMNA 3D1NI 2HOSA 3FRQA 3S1MJ 1RR7A 4XICA 4J19A 5DAJA 1MSFC 3ANGA 5C3EJ 1E3OC 5C44J 3VPRA 2H8RA 4A3JJ 2E2HJ 4L62A 3HGYA 4PXIA 2QWTA 1GT0C 1NK2P 1UG2A 2M9HA 1ZQ3P 2LP0A 3BTJA 1W0UA 2DA4A 2ZCNA 3BR0A 1AU7A 1FEXA 1I3QJ 5FKOA 4D7MA 2ZB9A 3HGGA 5FKKA 5F0CA 1F36A 1U9NA 3EGQA 3UKGA 1T56A 4L5EA 1FTTA 4CGRA 2Y31A 1EF4A 3VVYA 5EDNA 3JRBA 2M34A 3HM5A 1P7IA 3NI7A 4RBOA 3OOUA 2WAQN 3JRHA 2FX0A 4MK6A 3WHBA 2E19A 2D6YA 3LWJA 1JT6A 2UXOA 4DZPA 2L7FP 4A93J 4JX5A 3MN2A 1K61A 5IYBJ 2V57A 2RAEA 4UDSA 3BR5A 4AYBN 3V78A 1SFOJ 3VW1A 2YVEA 1IV6A 2HYJA 5JLWA 5FMPA 3O8HA 1GUUA 2R5ZA 3VOKA 2FD5A 2ECBA 1VF9A 4C2MJ 3RQIA 3E7QA 2GBYA 4IHYA 5EF6A 2Y9ZA 1PUFA 2YVHA 2E2JJ 3S14J 3O8GA 3SFIA 2IEKA 1HF0A 2K9QA 4DW6A 5HBUA 1JTYA 5EG0A 1T33A 2G3BA 5F04A 3VVZA 4A3BJ 2XPUA 3BJBA 4AC6A 2K9SA 4AF5A 2FQ4A 5FJ8J 3M4OJ 1LFUP 3S16J 2R92J 1JJ6C 2DA1A 4LOCA 1Z0XA 1XG1A 1Y1VJ 1NK3P 4XRMA 2XDNA 4M3FA 3E7LA 1H89C 3Q0VA 2HDDA 1XS9A 2COBA 1JGGA 2REKA 4JP0A 2L9RA 5FLMJ 4KWAA 2R5YA 3BCGA 2O9LA 1LE8B 5M5YJ 5J3LA 1FIPA 3S1RJ 2JA8J 3RD3A 3VUQA 4A3DJ 2L7MP 4MIMA 2WUIA 3HOXJ 1ZGWA 3I4MJ 4NELA 3IH4A 3HBLA 2DA5A 5FLVA 3CMYA 3LSGA 1JTXA 3S2DJ 3LJLA 1ETXA 2LTPA 3NNRA 3RZOJ 4XK4A 3BT9A 3PO3J 3MNLA 2CQQA 2UXPA 2CUFA 3L1PA 2DMQA 2OPTA 1Q1VA 2X48A 4IHWA 2DA6A 4B1RA 5E3MA 4A69C 5J1UA 5IP9J 1TWGJ 3JRAA 2JJ7A 3OSFA 5BNGA 5F0HA 2JA6J 2LY9A 1H8AC 2DG7A 3TP3A 5M3MJ 5GPCA 5E3NA 2RASA 1F43A 4M3GA 4BKXA 1ITYA 5E3LA 3JSJA 1W0TA 2DA2A 4GCLA 1RKWA 3GTQJ 3CRJA 4A3CJ 1MSEC 3NAUA 1P7JA 5H9TA 4A3MJ 3Q3SA 1GV5A 2XSDC 4CYCA 3AQTA 1BJZA 3S5RA 5IP6A 1MBGA 1ZTRA 2CU7A 2M8GX 2JA7J 4Y7NJ 5EGOA 2FBQA 3BHQA 2ID6A 3EUPA 5DTDA 3HTHA 3S1QJ 3A03A 3RKQA 4UUSB 2CUEA 3GTMJ 2K40A 3MKLA 3I4NJ 2FJ1A 3BG3A 2DTZA 3KKCA 5IOZA 3NPIA 2OF7A 2DN0A 3BG5A 3QBMA 5M5XJ 1ETQA 3ON4A 5CW8A 2WGBA 1POGA 1SGMA 1AKHA 5CXIA 1X58A 5M5WJ 3QQAA 1DU0A 3HOYJ 1NTCA 5IP7J 2LLKA 1UHSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DA7 A;  2Y0S N;  2AO9 A;  3COL A;  3BTI A;  1X2M A;  1QPI A;  4GFL A;  4W97 A;  4HKU A;  4IEJ A;  4DZJ A;  1BL0 A;  2M2E A;  5JLX A;  2JWT A;  1IDZ A;  2RHA A;  5K58 A;  1SAN A;  1HDP A;  3JRC A;  3DCF A;  3FIW A;  5IYD J;  2L0K A;  3NXC A;  4C3I J;  3G7R A;  3HTJ A;  4FIS A;  1HDD C;  3JRF A;  2KDZ A;  3KZ9 A;  1YRN A;  2O8K A;  3ZQI A;  2LD5 A;  5EZG A;  1ETK A;  3JRI A;  3GTO J;  2W53 A;  5F1J A;  2ID3 A;  2DMP A;  4C3H J;  4DYR A;  2W48 A;  2G0E A;  1A5J A;  1ENH A;  4GFK A;  3VVX A;  2L7Z A;  3C2B A;  3TED A;  4Y52 J;  5GPA A;  2XPW A;  4YZE A;  2I10 A;  3IH3 A;  2HOT A;  1IRZ A;  5K7F A;  3HOU J;  2HXI A;  1QVU A;  5J1Y A;  1JUM A;  4A3L J;  1XC5 A;  2VKV A;  1JKQ C;  3JRE A;  4V2F A;  4I6Z A;  3QPL A;  3LSJ A;  3IV5 A;  4M3B A;  2ZOZ A;  1RES A;  2HI3 A;  5GP9 A;  4BY7 J;  1B8I A;  3OSG A;  2O7O A;  2NVQ J;  4MXM A;  1QVT A;  3ZOB A;  2X9D A;  1RET A;  4ME9 A;  2E1O A;  2NP3 A;  4GCT A;  3S15 J;  2NS7 A;  1OFC X;  3BR1 A;  4NDL A;  3GEU A;  5FHP A;  2NVY J;  2QCO A;  3JR9 A;  1MNM C;  1WPK A;  4ABZ A;  2R0Q C;  4FTH A;  3PAS A;  3IH2 A;  1DU6 A;  3C07 A;  3A01 A;  4ACI A;  2OER A;  2NVX J;  2R7Z J;  2YS9 A;  2VI6 A;  4M3E A;  4D7N A;  2H1K A;  2EBI A;  5C4J J;  3CQZ J;  3W6V A;  2NX4 A;  3LHQ A;  1LFB A;  1ETY A;  2EZI A;  4QIW N;  3S2H J;  3AQS A;  3G56 A;  2UXI A;  2XRL A;  1BA5 A;  3HOV J;  1IDY A;  5EGO B;  4MFE A;  4X6A J;  1IC8 A;  3JRG A;  2G7S A;  1ETO A;  4RDU A;  2G7G A;  3O60 A;  2HXO A;  5AQC A;  4IHV A;  2DG8 A;  2OI8 A;  2JA5 J;  3HE0 A;  2QKO A;  1A6I A;  4W1U A;  3GBG A;  1WI3 A;  2DA3 A;  2WB1 N;  5EEA A;  2XGC A;  4M6V A;  4BBR J;  2NOG A;  1I6H J;  2DMT A;  3NAR A;  3TW7 A;  2N8G A;  4B3A A;  3RH2 A;  5IYC J;  3LSP A;  3G1L A;  1TWC J;  3ON2 A;  3F1B A;  4BXX J;  3F0C A;  5HSZ A;  5D18 A;  5D1R A;  2DJN A;  4D5F A;  2Y30 A;  4FE4 A;  2E2I J;  4I76 A;  3HEF A;  3JRD A;  1TWA J;  3GTP J;  3V6G A;  4V2G A;  4A3K J;  1VFC A;  1O4X A;  4C3J J;  1GV2 A;  1B72 A;  5CXG A;  2ECC A;  3ZQF A;  1ZKG A;  5K7Z A;  1FTZ A;  3LNQ A;  3HTI A;  1RPW A;  1MH4 A;  2YU9 J;  2QF7 A;  4XRS A;  3M3Y J;  4UUT A;  4EEF G;  3VP5 A;  4JKZ A;  2GUH A;  4JYK A;  4FE7 A;  1JKP C;  1JT0 A;  2EQR A;  3GTJ J;  2ELK A;  2NS8 A;  2P81 A;  2WV1 A;  2XPV A;  1LE8 A;  3BNI A;  2ME6 A;  2EZK A;  2JN6 A;  2EZL A;  1JKO C;  2G7L A;  4MLO A;  1MBK A;  3Q0W A;  4NN1 A;  1ZR4 A;  2MGQ A;  9ANT A;  2R5Z B;  2Q24 A;  5F27 A;  2UXU A;  3BQY A;  4JX4 A;  3WHC A;  1PUF B;  1OCP A;  2TCT A;  2MG4 A;  4B4C A;  3QKX A;  2AHQ A;  1MBE A;  5EG0 B;  1U78 A;  2JMW A;  2LR8 A;  2XB0 X;  1JUS A;  3BR6 A;  3CWR A;  1OCT C;  4BY1 J;  3S1N J;  2HYT A;  5DS9 A;  5HOD A;  1MH3 A;  5IPA A;  3SDG A;  1B8I B;  4MO7 A;  3CCY A;  1JJ8 C;  2LK2 A;  4DYQ A;  1CQT A;  3S17 J;  3B6C A;  2LFB A;  3H0G J;  2VKE A;  1HOM A;  2PMZ N;  2VUM J;  3GTG J;  2Y9Y A;  1BW6 A;  3HOW J;  1AHD P;  4AC0 A;  3G1O A;  1JKR C;  1GDT A;  4XRS G;  4GFB A;  3CDL A;  4A3G J;  2R5Y B;  1BW5 A;  3A01 B;  5F0F A;  3K7A J;  2X6O A;  3BG9 A;  1Y1W J;  2GEN A;  1HCR A;  4M3D A;  3FK6 A;  5FKM A;  1GVD A;  2MW8 A;  2ZCM A;  2QOP A;  3B81 A;  1X2N A;  3LOC A;  2Y2Z A;  2GM4 A;  3DPJ A;  2NP5 A;  4JX6 A;  4UUS A;  4ICH A;  1VND A;  2VPR A;  1U9O A;  1ZK8 A;  5F08 A;  1MBJ A;  3OIO A;  1IUF A;  1WCM J;  3QPS A;  2D5V A;  2PZ9 A;  3NRG A;  4AUX A;  3FIS A;  2ME0 A;  3P9T A;  1WGX A;  5C4Y A;  2IAI A;  2IBD A;  3G1M A;  1UI6 A;  3K2A A;  2ZCX A;  3FKI J;  4X1E A;  2IU5 A;  1UMQ A;  3GTK J;  3ANP A;  2CRG A;  1HLV A;  1S7E A;  1IG7 A;  1QRY A;  1MBH A;  2M0C A;  4QTR A;  3VIB A;  5FKN A;  1RKT A;  1I50 J;  4QSH A;  1FJL A;  5D19 A;  2ZOY A;  3A02 A;  1TC3 C;  2XB5 A;  4A3F J;  2EH3 A;  1MBF A;  3PPB A;  1ETW A;  2MSY A;  4A3I J;  1TWF J;  4CYC B;  1B72 B;  2CQX A;  2EZH A;  3HIM A;  3VW0 A;  2R93 J;  3BTL A;  3HB9 A;  3BR3 A;  1G2H A;  4A3E J;  5EYR A;  1IGN A;  2O7T A;  2YUS A;  3VW2 A;  4GCK A;  1U8B A;  3Q0U A;  4IHX A;  3HTA A;  2NVT J;  3KNW A;  1WH7 A;  3H3V K;  4XID A;  2JK3 A;  3T6N A;  3ZQC A;  3BRU A;  3MVP A;  3RZD J;  4FCY A;  3HOZ J;  3ZQG A;  2TRT A;  3IUV A;  2B63 J;  1R9T J;  3DEW A;  5K7H A;  1UI5 A;  2LVS A;  1K83 J;  1AKH B;  2PBX A;  4G12 A;  4DYC A;  5IOY A;  1Z77 A;  2QIB A;  1JUP A;  4BBS J;  5FKL A;  5E3O A;  5EZH A;  1H88 C;  2UXH A;  2GLO A;  5EFY A;  4JL3 A;  3HDD A;  5FGL A;  5M3F J;  3FK7 A;  2HOA A;  3SJM A;  3HKZ N;  3PO2 J;  3VOX A;  3LSR A;  2XGD A;  1ETV A;  4MFD A;  3BQZ A;  3BTC A;  3B6A A;  3TP0 A;  2HKU A;  2LKX A;  1YRN B;  3GTL J;  2QTQ A;  3BR2 A;  3ZQL A;  1APL C;  2GFN A;  4JNN A;  3CJD A;  2K9N A;  3KKD A;  1TWH J;  1VI0 A;  1ZR2 A;  3PM1 A;  2HQ5 A;  2CJJ A;  1FIA A;  2KT0 A;  5C4X J;  2DMU A;  4S0H B;  3ZQH A;  2XGE A;  1IJW C;  5HAW A;  3GZI A;  1OJL A;  1WH5 A;  1D5Y A;  5J1R A;  4HNV A;  4D5C A;  2F07 A;  1ORK A;  3TW6 A;  2DMN A;  3D1N I;  2HOS A;  3FRQ A;  3S1M J;  1RR7 A;  4XIC A;  4J19 A;  5DAJ A;  1MSF C;  3ANG A;  5C3E J;  1E3O C;  5C44 J;  3VPR A;  2H8R A;  4A3J J;  2E2H J;  4L62 A;  3HGY A;  4PXI A;  2QWT A;  1GT0 C;  1NK2 P;  1UG2 A;  2M9H A;  1ZQ3 P;  2LP0 A;  3BTJ A;  1W0U A;  2DA4 A;  2ZCN A;  3BR0 A;  1AU7 A;  1FEX A;  1I3Q J;  5FKO A;  4D7M A;  2ZB9 A;  3HGG A;  5FKK A;  5F0C A;  1F36 A;  1U9N A;  3EGQ A;  3UKG A;  1T56 A;  4L5E A;  1FTT A;  4CGR A;  2Y31 A;  1EF4 A;  3VVY A;  5EDN A;  3JRB A;  2M34 A;  3HM5 A;  1P7I A;  3NI7 A;  4RBO A;  3OOU A;  2WAQ N;  3JRH A;  2FX0 A;  4MK6 A;  3WHB A;  2E19 A;  2D6Y A;  3LWJ A;  1JT6 A;  2UXO A;  4DZP A;  2L7F P;  4A93 J;  4JX5 A;  3MN2 A;  1K61 A;  5IYB J;  2V57 A;  2RAE A;  4UDS A;  3BR5 A;  4AYB N;  3V78 A;  1SFO J;  3VW1 A;  2YVE A;  1IV6 A;  2HYJ A;  5JLW A;  5FMP A;  3O8H A;  1GUU A;  2R5Z A;  3VOK A;  2FD5 A;  2ECB A;  1VF9 A;  4C2M J;  3RQI A;  3E7Q A;  2GBY A;  4IHY A;  5EF6 A;  2Y9Z A;  1PUF A;  2YVH A;  2E2J J;  3S14 J;  3O8G A;  3SFI A;  2IEK A;  1HF0 A;  2K9Q A;  4DW6 A;  5HBU A;  1JTY A;  5EG0 A;  1T33 A;  2G3B A;  5F04 A;  3VVZ A;  4A3B J;  2XPU A;  3BJB A;  4AC6 A;  2K9S A;  4AF5 A;  2FQ4 A;  5FJ8 J;  3M4O J;  1LFU P;  3S16 J;  2R92 J;  1JJ6 C;  2DA1 A;  4LOC A;  1Z0X A;  1XG1 A;  1Y1V J;  1NK3 P;  4XRM A;  2XDN A;  4M3F A;  3E7L A;  1H89 C;  3Q0V A;  2HDD A;  1XS9 A;  2COB A;  1JGG A;  2REK A;  4JP0 A;  2L9R A;  5FLM J;  4KWA A;  2R5Y A;  3BCG A;  2O9L A;  1LE8 B;  5M5Y J;  5J3L A;  1FIP A;  3S1R J;  2JA8 J;  3RD3 A;  3VUQ A;  4A3D J;  2L7M P;  4MIM A;  2WUI A;  3HOX J;  1ZGW A;  3I4M J;  4NEL A;  3IH4 A;  3HBL A;  2DA5 A;  5FLV A;  3CMY A;  3LSG A;  1JTX A;  3S2D J;  3LJL A;  1ETX A;  2LTP A;  3NNR A;  3RZO J;  4XK4 A;  3BT9 A;  3PO3 J;  3MNL A;  2CQQ A;  2UXP A;  2CUF A;  3L1P A;  2DMQ A;  2OPT A;  1Q1V A;  2X48 A;  4IHW A;  2DA6 A;  4B1R A;  5E3M A;  4A69 C;  5J1U A;  5IP9 J;  1TWG J;  3JRA A;  2JJ7 A;  3OSF A;  5BNG A;  5F0H A;  2JA6 J;  2LY9 A;  1H8A C;  2DG7 A;  3TP3 A;  5M3M J;  5GPC A;  5E3N A;  2RAS A;  1F43 A;  4M3G A;  4BKX A;  1ITY A;  5E3L A;  3JSJ A;  1W0T A;  2DA2 A;  4GCL A;  1RKW A;  3GTQ J;  3CRJ A;  4A3C J;  1MSE C;  3NAU A;  1P7J A;  5H9T A;  4A3M J;  3Q3S A;  1GV5 A;  2XSD C;  4CYC A;  3AQT A;  1BJZ A;  3S5R A;  5IP6 A;  1MBG A;  1ZTR A;  2CU7 A;  2M8G X;  2JA7 J;  4Y7N J;  5EGO A;  2FBQ A;  3BHQ A;  2ID6 A;  3EUP A;  5DTD A;  3HTH A;  3S1Q J;  3A03 A;  3RKQ A;  4UUS B;  2CUE A;  3GTM J;  2K40 A;  3MKL A;  3I4N J;  2FJ1 A;  3BG3 A;  2DTZ A;  3KKC A;  5IOZ A;  3NPI A;  2OF7 A;  2DN0 A;  3BG5 A;  3QBM A;  5M5X J;  1ETQ A;  3ON4 A;  5CW8 A;  2WGB A;  1POG A;  1SGM A;  1AKH A;  5CXI A;  1X58 A;  5M5W J;  3QQA A;  1DU0 A;  3HOY J;  1NTC A;  5IP7 J;  2LLK A;  1UHS A; 
#chains in the Genus database with same CATH topology
 2Y0S N;  1U8R A;  2AO9 A;  3H3Z A;  4WCG A;  3FKJ A;  3MZ8 A;  3V8K A;  1QPI A;  1BOA A;  3PNV A;  4RLF A;  2HKO A;  4DZJ A;  2M2E A;  2V6C A;  1S7A A;  2JWT A;  3H1C A;  1IDZ A;  3K8P C;  2DU9 A;  3DCF A;  3R6S A;  5IYD J;  3L2U A;  2W85 A;  3G7R A;  3O6B B;  2BY3 A;  4XOT A;  3HTJ A;  3KEQ A;  2ETH A;  3EDP A;  4KJZ A;  2LD5 A;  2VBZ A;  5DM6 F;  4RGX A;  3WG7 H;  4II3 A;  1I39 A;  1XDS A;  4EAT A;  2ID3 A;  4HLY A;  3K70 D;  3HSE A;  1TTY A;  2LNB A;  4PFO A;  1RI7 A;  1RC9 A;  4HQE A;  3F6V A;  1XMK A;  1G3Y A;  1LDD A;  2ZSI B;  4YZE A;  2K9M A;  2LMD A;  1MDM A;  2HOT A;  3SEQ A;  5J1Y A;  3JRE A;  3QPT A;  2L4M A;  4V2F A;  2X4H A;  3LSJ A;  3IV5 A;  1WZ2 A;  3E5U A;  3W2A A;  2J5O A;  2L9V A;  2KMU A;  1QNT A;  3F6O A;  2JA2 A;  2NVQ J;  2O7O A;  2FRH A;  3HXL A;  1U5T C;  1QVT A;  4E4H A;  3HPH A;  2A69 F;  1VTN C;  3BDD A;  3S15 J;  2R7S A;  2DW4 A;  3BR1 A;  5FHP A;  4IQ4 A;  4CCO A;  3QWL A;  4B09 A;  1BR4 A;  2R7U A;  3KZY A;  4DJA A;  3J7A O;  3KEY A;  3C1D A;  3SQN A;  3IKV A;  4ENM A;  3HRT A;  3G4S I;  2NVX J;  2E60 A;  4XNF A;  3CJT B;  4M3E A;  2ZME A;  3TMO A;  2DAO A;  2CW0 F;  2NX4 A;  1O7L A;  4HQM A;  2BZT A;  3HYI A;  4RAF A;  4CO8 A;  4QIW N;  2LKP A;  3KP5 A;  3G56 A;  1BA5 A;  2IA2 A;  5J8C A;  3OYE A;  4LK0 F;  1GHC A;  4WF2 A;  1IDY A;  5EGO B;  2QSG X;  2XAF A;  1ETO A;  3R4K A;  3DLA A;  1IRG A;  2OI8 A;  3L7W A;  1X3W B;  1MMG A;  3GEZ A;  1IO2 A;  2QBY B;  4MEX F;  1WI3 A;  3M8J A;  2DA3 A;  1K4S A;  2K4J A;  4PJN A;  3OYA A;  3EET A;  4CGZ A;  5BS6 A;  3G1L A;  1BC8 C;  1B1B A;  4ESB A;  2KJB A;  1T98 A;  4F55 A;  2HVR A;  3DBL B;  2JUC A;  2ZNZ A;  3MMY B;  3TO7 A;  2DJN A;  2W57 A;  2QSH X;  2ZXH A;  2E2I J;  4I76 A;  3OYJ A;  2IPQ X;  2AQE A;  3JRD A;  1TWA J;  2EFN A;  3GTP J;  3SDB A;  2W4S A;  1KU3 A;  1SEU A;  1O4X A;  4C3J J;  4F52 A;  2ECC A;  1ZKG A;  5J4V A;  1J59 A;  4F93 B;  1EA3 A;  3BLY A;  2YU9 J;  3M3Y J;  3ZP5 A;  2DXI A;  3VP5 A;  3TDU C;  4JKZ A;  1WJE A;  2DYS H;  4JYK A;  3VYU B;  4D0P A;  5K1Y A;  3OR2 C;  3BZC A;  3K4K A;  1TNT A;  3QYE A;  2EQR A;  2K5C A;  2ELK A;  1LE8 A;  3BNI A;  5J47 A;  4ZDL A;  1HW5 A;  1YYV A;  4PSW A;  5KHD A;  1OYI A;  2RNJ A;  5D8K B;  4FET A;  2EIJ H;  9ANT A;  3GWZ A;  1W5S A;  3CMM A;  2L5Q A;  3FX3 A;  1BIB A;  3E3V A;  3FXU A;  4UNO A;  1HKQ A;  2FBK A;  2L9S A;  5L3D A;  4XSX F;  1D0Y A;  3N97 A;  2JPC A;  3K4N A;  4BY1 J;  3S1N J;  4F7Z A;  5HOD A;  2M0M A;  1MH3 A;  2AS5 F;  3B6C A;  2LFB A;  3CCM I;  4BE0 A;  3FMS A;  1HOM A;  5DM7 F;  4AIK A;  5BOX A;  1LKX A;  5AON A;  2KIQ A;  3R0A A;  3QYB A;  1AHD P;  4BAY A;  4AC0 A;  3HJE A;  2K9L A;  4OU0 A;  4XRS G;  1KYW A;  1RRJ A;  3CDL A;  4F3Q A;  5GTH C;  2H6C A;  3K7A J;  3KYC B;  1Y1W J;  4HSR A;  5B1A H;  1V54 H;  1Z6T A;  5JI6 A;  1F4K A;  4H0E A;  2ZCM A;  4ZYG A;  2COM A;  3HRS A;  1Y8R B;  2DFE A;  4JX6 A;  5HLH A;  1U9O A;  1G3W A;  1ZK8 A;  5ILV A;  1IUF A;  1CF7 A;  1KON A;  3PL8 A;  2VC0 A;  4LJZ F;  2B9S A;  2D5V A;  3FIS A;  1ZG5 A;  1P6R A;  3L00 A;  3K2A A;  4D9J A;  1Y6I A;  3MKZ A;  3FKI J;  3LL7 A;  1H9T A;  2OQG A;  3ANP A;  2CRG A;  2A61 A;  4S05 A;  3S3O A;  1N78 A;  1MBH A;  3M1E A;  1YIT I;  3VIB A;  3C2H A;  4U87 A;  4EMS A;  1I50 J;  2B1E A;  3G2B A;  3VB2 A;  2IGN A;  3GFJ A;  3ABL H;  1JE8 A;  3A02 A;  4QWQ A;  4LG0 A;  1TC3 C;  2XB5 A;  1KQ9 A;  3A1Y A;  1TT5 B;  1MBF A;  1P2F A;  1Y8Q B;  1DGR M;  1QQI A;  4BNC A;  3HSR A;  3PFY A;  4KFC A;  4CYC B;  2F5V A;  2CQX A;  4XLC A;  3VW0 A;  2R93 J;  2HVQ A;  2XAG A;  1EH6 A;  2YUS A;  3VW2 A;  5LGU A;  4HBL A;  4HPQ A;  3Q0U A;  2O3F A;  1K4T A;  3P9C A;  5K5Q A;  2ZKZ A;  3FXK A;  1XMX A;  2OBP A;  2V1D A;  4ZC3 A;  3H3U A;  2JSP A;  3BRU A;  3TBI A;  2DK5 A;  2RV8 A;  2DBB A;  5D5V B;  4IRI A;  4AU7 A;  1R9T J;  1H0M A;  3K4C A;  3IKT A;  2BEO A;  3SEZ A;  3DV8 A;  1ZAR A;  5LHH A;  1ULY A;  5FKL A;  2Z33 A;  2A5Y B;  1Z91 A;  4IXA A;  1ACI A;  1X1P A;  3RSN A;  2JVG A;  2PN6 A;  3IRQ A;  4P1W A;  3F3X A;  3J80 Z;  4NC6 A;  2YR2 A;  2DFH A;  3V4G A;  3OYD A;  2LSO A;  4HX8 A;  1ZHF A;  4BGD A;  3TP0 A;  4FX4 A;  4XN3 A;  2HKU A;  2LKX A;  2DT6 A;  1YRN B;  2GFN A;  4MNU A;  3CJD A;  2VLA A;  3TGN A;  1FIA A;  4C2M A;  4ESJ A;  5C4X J;  2QYO A;  4HG2 A;  4S0H B;  1D5V A;  2ZC2 A;  1LUJ B;  5HAW A;  4CH7 A;  1EH8 A;  4KIT B;  5H2F C;  4ZTF A;  2K7L A;  3T8R A;  1ONV A;  2F2E A;  4UV9 A;  5DD8 A;  4IF4 A;  4HNV A;  5KAF C;  3ECO A;  1ORK A;  5D5X B;  2QBY A;  3TW6 A;  4E7Z A;  3P9I A;  2HOS A;  2ACJ A;  1RR7 A;  1LPQ A;  5DAJ A;  4XKV A;  3FMQ A;  2BBY A;  5KAI C;  1QZZ A;  5CVU A;  4A3J J;  4EM2 A;  2QVO A;  3OS1 A;  4IRH A;  3DPL C;  3FXQ A;  3BR0 A;  1VQO I;  2ZB9 A;  1D0Z A;  5F0C A;  1F36 A;  3BOQ A;  1SC7 A;  4L5E A;  5EEH A;  2M34 A;  3NI7 A;  4RBO A;  2JTV A;  3OOU A;  2WAQ N;  3CME I;  4MK6 A;  1JT6 A;  3F22 A;  2UXO A;  1MZB A;  3NWS A;  4JX5 A;  2XHK A;  2FE3 A;  4N4N B;  2EIL H;  1T2K A;  2UZK A;  2EV6 A;  2M4G A;  5HLG A;  1SVL A;  1IV6 A;  2RKH A;  1STZ A;  2W84 A;  2VJ5 A;  3KP7 A;  5DV5 A;  1T95 A;  5B3S H;  1YX3 A;  3NWT A;  3AL0 B;  3ABU A;  3CUQ C;  1ON1 A;  2FD5 A;  2FSW A;  2VQC A;  4L5I A;  3O2P E;  3OYG A;  5EF6 A;  1UFM A;  3LFK A;  3CCV I;  2IEK A;  5CQE A;  1HF0 A;  4HLX A;  2FBI A;  1SFX A;  2QQ9 A;  2G3B A;  4O6J A;  5ED4 A;  1KU7 A;  1J09 A;  1P9Q C;  1R5H A;  1K78 B;  2K9S A;  4AF5 A;  5GAH J;  3ZGK A;  3QU3 A;  1MND A;  1QPM A;  1Z9C A;  2DT7 B;  1Z0X A;  2HGC A;  2PMZ A;  1NK3 P;  3M1C A;  2R7F A;  2ESN A;  2HZD A;  2KDO A;  3OWT A;  4JQF A;  4HF1 A;  3S3M A;  2DO7 A;  4BJT A;  2OZ6 A;  2HDD A;  1Y0N A;  3AG2 H;  2FU4 A;  2REK A;  4EV0 A;  2ZNY A;  4PSX A;  2DDA A;  3SFZ A;  2B0L A;  3QPH A;  1V5F A;  2ELH A;  2O9L A;  3MEX A;  5J3L A;  1FIP A;  4U7D A;  2VBY A;  2XF5 A;  4Z2Y A;  4HNU A;  1V5E A;  4EJV A;  1N25 A;  1U2W A;  3DKW A;  1NG6 A;  4OOI A;  4NEL A;  4RB1 A;  1I3A A;  1JTX A;  3S2D J;  4MQV A;  1MJ9 A;  1O3R A;  3WTZ A;  4NHJ A;  2XDV A;  3NNR A;  1MGT A;  5B5E C;  3PO3 J;  4FAS D;  1D8J A;  1K79 A;  2RRE A;  4KMF A;  2NAZ A;  4OIQ F;  3MNL A;  1I27 A;  4WXC A;  2XAS A;  1D0X A;  1ZEL A;  3PQK A;  4IQJ A;  2X1E A;  4E7J A;  5H6Q A;  1EV7 A;  2Q0O A;  3M07 A;  4LIU A;  2P4W A;  2JQ7 A;  3GX4 X;  5BNG A;  4B44 A;  3BZ6 A;  4RMN A;  3K4M A;  2JA6 J;  3ERM A;  1VQ4 I;  1H8A C;  1X1B A;  3TP3 A;  3LAP A;  2IVM A;  4LGW A;  3KP4 A;  3ZMV A;  4RAZ A;  1OCZ H;  1F43 A;  3A0H C;  5E3L A;  4ZYE A;  3HC7 A;  1W0T A;  3JSJ A;  4CHU A;  1BI1 A;  1MMA A;  4BXF A;  3GTQ J;  3R0J A;  3KE2 A;  1LVA A;  1MSE C;  1FOK A;  4A3M J;  1GV5 A;  3OIQ A;  3DP7 A;  2FF4 A;  4CYC A;  2V1U A;  5KK1 A;  5JR3 A;  1W36 C;  4I0A A;  3AQT A;  4DGW B;  2CU7 A;  3Q5F A;  4Y7N J;  3ISP A;  4RGR A;  5F6F A;  4PCQ A;  5HVQ C;  1BR1 A;  5K5R A;  1IXC A;  1WJA A;  1OYY A;  2A68 F;  2I8D A;  3GTM J;  1FEX A;  4BDZ A;  4IOC F;  3H35 A;  2E1M B;  4OIN F;  3KKC A;  1J9I A;  3IHU A;  3NPI A;  2DN0 A;  3ON4 A;  4ENK A;  1UEL B;  4UHT A;  3C2G A;  2GQQ A;  5CXI A;  2QLZ A;  1REP C;  2STW A;  3RJP A;  1NTC A;  2IXS A;  1X1A A;  3CO7 C;  1UHS A;  2DFI A;  4PJJ A;  3COL A;  3ZMT A;  3BTI A;  2IS4 A;  1OIS A;  3I5U A;  2CGP A;  1X2M A;  4GFL A;  4IO9 F;  1SVM A;  4HKU A;  4WIB A;  3ZCO A;  1SVO A;  2Y69 H;  2GAU A;  3IAS 2;  4XLF A;  1G4D A;  1S72 I;  3DEU A;  1FY7 A;  2RHA A;  3VDX A;  2VOP A;  3EUH A;  2L0K A;  3NXC A;  3U1K A;  2FA5 A;  2VXD A;  2DPD A;  4FIS A;  3W6K B;  3JCU C;  3ROU A;  2FMY A;  3KZ9 A;  1YRN A;  2O8K A;  5EZG A;  2K86 A;  4ZH4 F;  2KZV A;  1P4W A;  4I01 A;  3M9A A;  1DP7 P;  3GTO J;  4O5V A;  4WK8 F;  2QGU A;  4RB3 C;  5H6R A;  3KYL A;  5F1J A;  1Y56 A;  4XBF A;  1A5J A;  1ENH A;  3GZN B;  1NH3 A;  4Y52 J;  2HWV A;  1BM9 A;  4AVP A;  3L2Q A;  2H1L A;  5D6E A;  3QOE A;  3LMM A;  2HXI A;  1QVU A;  3LSM A;  4IHT A;  4A3L J;  3OL4 A;  2ZJP F;  1XGM A;  2C6Y A;  4I6Z A;  4HV5 A;  2DOA A;  2BGC A;  1OR7 A;  3GFI A;  2WTE A;  1YJW I;  3OR1 C;  2A05 A;  4ETS A;  3ZOB A;  2X9D A;  1RET A;  4ME9 A;  3CD6 I;  4GCT A;  2NS7 A;  3GEU A;  1UG0 A;  2Z1D A;  4GRI A;  1WQ2 A;  2ZFU A;  3JR9 A;  4FTH A;  3EUK L;  3U9G A;  1WJB A;  4KA4 A;  2HQA A;  2NNN A;  2CQ7 A;  2ZSH B;  1GXP A;  3HOT A;  4YII A;  2VI6 A;  4IRV A;  3HRU A;  2EBI A;  1IF1 A;  4XMY A;  2EIN H;  3S2W A;  4Q5S F;  3S2H J;  2XUB A;  2UXI A;  2CFO A;  1TW3 A;  2L3D A;  2W82 A;  4X6A J;  3JRG A;  2G7S A;  4MTD A;  3FXM A;  1YOV B;  2EV0 A;  4QLC U;  3S3N A;  4W1U A;  4B48 A;  3GBG A;  1LDJ A;  1S29 A;  2WB1 N;  3WTU C;  1FYL A;  1IRF A;  4BBR J;  2NOG A;  1I6H J;  2CO5 A;  4U0V A;  4EGY A;  4B3A A;  2R7V A;  1Z05 A;  4Q47 A;  3RH2 A;  3RTR A;  1WI9 A;  3F1B A;  2R7R A;  2ZJR F;  3F0C A;  1HA8 A;  1C0W A;  2NOJ B;  1FZP B;  2R3S A;  3DEE A;  3KX2 A;  2HDC A;  5AIQ A;  4LIV A;  4R1H A;  2PMH A;  1K78 A;  3V6G A;  2E1N A;  1GV2 A;  5K7Z A;  1TQI A;  4RM2 A;  2PJR A;  3SZT A;  4UUT A;  2L54 A;  4YIF A;  1IN6 A;  2JUG A;  2QA4 I;  2GUH A;  2GIV A;  3DTI A;  2GOX B;  3K0L A;  1SFU A;  2WV1 A;  2OV7 A;  2CS3 A;  2ME6 A;  3OYN A;  2EZL A;  1JKO C;  4Z6Y A;  4EJW A;  2G7L A;  2MC3 A;  2D2W A;  3Q0W A;  2DTR A;  3WU1 B;  3CCL I;  1TQM A;  3WTS C;  2MGQ A;  4M6X A;  3FMR A;  5DDG A;  3WTX C;  5F27 A;  3VYR B;  2CQK A;  2L9N A;  3BQY A;  4HV6 A;  1A6Q A;  1TT0 A;  2O0Y A;  1JHH A;  4JX4 A;  2H6B A;  1FMW A;  1K6Y A;  1S6L A;  1WRJ A;  4KIF A;  4CZC A;  1OCP A;  4CCN A;  1G3S A;  1R49 A;  5EG0 B;  1U78 A;  4G7O F;  2JMW A;  1E2X A;  2VJI A;  1JUS A;  3CWR A;  1OCT C;  1S5L C;  3HKZ A;  4MHG A;  1XCB A;  2HYT A;  3VSL A;  2GWR A;  4HRI A;  1B8I B;  4MO7 A;  1XGO A;  3H5R A;  4A6D A;  5J40 A;  1LB2 A;  3FM5 A;  2X6Y A;  2VKE A;  4YRV A;  1SD6 A;  2Y9Y A;  1BW6 A;  3DLL F;  1AWC A;  1VQN I;  5FRM A;  2HYG D;  2XKO A;  3G1O A;  1GDT A;  2VPL A;  4II2 A;  4GFB A;  3H5A A;  5AIP A;  3U2R A;  1BW5 A;  3A01 B;  5F0F A;  3FF5 A;  3JSO A;  3BG9 A;  4HZF A;  2GEN A;  3H9Q A;  1G6N A;  4G94 A;  1QA6 A;  2DDB A;  2MW8 A;  1IN5 A;  4V19 K;  3B81 A;  4ZZL A;  2JT1 A;  3GFM A;  2IS6 A;  2Y2Z A;  2CUJ A;  2NP5 A;  1J5Y A;  2K02 A;  1YHQ I;  2V79 A;  1VND A;  3FHN A;  1IAW A;  1Y39 A;  1MBJ A;  3QPS A;  1WCM J;  5TRD A;  1Z21 A;  4C30 A;  4AUX A;  4C2T A;  2A3S A;  2IGK A;  4N9H A;  1LVK A;  4HA8 A;  1R6R A;  2IAI A;  2FEZ A;  3G1M A;  4RGU A;  2ZCX A;  3H0D A;  1BI0 A;  2J5P A;  2G9W A;  1ZH5 A;  4FQG A;  1S7E A;  1D3Y A;  2M0C A;  3OOP A;  1R36 A;  1XGN A;  1TZL A;  2Y0S A;  5FKN A;  5BQT A;  4YFX F;  2ZOY A;  1KA8 A;  3J7Y J;  2X6X A;  2EH3 A;  3PPB A;  5HS8 A;  2V6E A;  1OCR H;  4JK1 X;  1HBX G;  1B72 B;  1DQU A;  5HDG A;  3OYM A;  3HIM A;  1R71 A;  2H8W A;  1G2H A;  2K27 A;  3GUD A;  3ELK A;  2RC4 A;  1O3T A;  1WJC A;  1QGP A;  3T0Y A;  1V5G A;  3IWZ A;  4IOA F;  3H3V K;  4XID A;  1XCV A;  2JK3 A;  5B66 C;  1W7P B;  3T6N A;  2M30 A;  3EUA A;  4L9T A;  4L0Z B;  3ZN1 A;  2BOL A;  3IUV A;  3J81 Z;  2B63 J;  3DEW A;  1KU9 A;  4KN4 X;  4E6K G;  2WBM A;  4ZYH A;  2CQN A;  5K7H A;  3IRR A;  2PBX A;  5IT9 K;  1WJ5 A;  3SZP A;  5E3O A;  5EZH A;  1T0F A;  1SD5 A;  3DPU A;  3M8E A;  2K85 A;  5EFY A;  4O3M A;  2P0W A;  3JAM K;  5CQG A;  1YFH A;  1OCC H;  3HSF A;  4KIC A;  2XV4 S;  3SJM A;  3I71 A;  4NNJ A;  1D1A A;  3H92 A;  5DYM A;  1BBY A;  4G6T B;  3GVA A;  2XGD A;  4AVZ A;  5D8L B;  2HDW A;  3BTC A;  4EQQ A;  4DOZ A;  2BE5 F;  2MD0 A;  1U6G A;  3ZQL A;  4JNN A;  2CW7 A;  1FLI A;  5HS9 A;  3KKD A;  1VI0 A;  4KIG A;  2WY7 Q;  3PM1 A;  3K1M A;  4B47 A;  3GCM A;  4U9N A;  2HU9 A;  3CJQ B;  2KPM A;  2XGE A;  1XB4 A;  1H9G A;  2CUZ A;  2RQQ A;  2OTJ I;  5TGT A;  2H09 A;  3QYF A;  1OJL A;  1WH5 A;  4YIR X;  1A36 A;  4GCV A;  2ZJQ F;  2V9K A;  5FLX Z;  3I59 B;  5CJ9 A;  4CXF A;  3S1M J;  4DVY P;  1S7O A;  1F5T A;  3ASN H;  2PI0 A;  2IJL A;  3I4P A;  3MQ0 A;  4BE2 A;  1M1E B;  2QWT A;  1GT0 C;  2A6T A;  3E6B A;  3ZQ7 A;  2BY1 A;  2EK5 A;  1PP8 F;  2XAQ A;  3CDH A;  3BTJ A;  4E7I A;  1W0U A;  3ZMU A;  2DA4 A;  2PEX A;  2ISY A;  3OYF A;  3KYD B;  1ZN2 A;  3CDI A;  3NQO A;  5DCF A;  5FKO A;  3TOB A;  2GXA A;  1BI3 A;  1LJ9 A;  3HGG A;  2EIM H;  2MA3 A;  1BIA A;  2EB7 A;  4M73 A;  2LY2 A;  5DUI A;  3EGQ A;  1DDN A;  2M7A A;  4CGR A;  2Y31 A;  2XRO A;  2O61 A;  3HM5 A;  3VYT B;  2FBH A;  2ZME C;  2FX0 A;  5LLQ A;  3FDY A;  1SMT A;  3WHB A;  2E19 A;  2G7H A;  2JZY A;  1YJN I;  1D8K A;  1LFP A;  5HNF A;  3MN2 A;  3K4J A;  4AIJ A;  4KIS A;  5JHU A;  2YVE A;  4OMZ A;  2VON A;  2DQR A;  3RPQ A;  2ZXW H;  1X4P A;  1MKM A;  4EVI A;  4IJA A;  2ECB A;  4OAY A;  4A5M A;  2LY1 A;  2JRM A;  3OS0 A;  3E7Q A;  4OD4 A;  4UVB A;  3O8G A;  2VAS A;  3SFI A;  1WJD A;  2V1N A;  5LEJ A;  1FOX A;  2BY0 A;  2K9Q A;  3C7J A;  3PIO F;  2IRF G;  1YG2 A;  2MD5 A;  5EG0 A;  1T33 A;  3VVZ A;  3HTU A;  4BQN A;  1T0F C;  2FQ4 A;  4RM3 A;  3S16 J;  4HDV A;  2R92 J;  3D5S C;  1DP3 A;  3E97 A;  4WWC A;  4LD5 A;  1XG1 A;  1I6X A;  2XDN A;  4M3F A;  2CG4 A;  3I3L A;  4I09 A;  4IX7 A;  2QQB A;  1BI2 A;  3LWF A;  2QQ8 A;  1XS9 A;  4C9Y A;  1JGG A;  4RA2 A;  5CVR A;  4JP0 A;  2X1D A;  1UJ8 A;  4KWA A;  3BCG A;  3PUF A;  2V7F A;  4XLN F;  3ZR8 X;  1FP2 A;  3S1R J;  2L7M P;  4MIM A;  3HTS B;  4GDF A;  4XON A;  3IH4 A;  3HBL A;  1U0J A;  2E35 A;  2KFD A;  3A2K A;  5BPD A;  4XK4 A;  1QZE A;  4U88 A;  2L4A A;  2P5L C;  3K1P A;  2UXP A;  5B1B H;  2DMQ A;  2OPT A;  2HPI A;  3GXO A;  1MJB A;  3CJR B;  3LST A;  2DA6 A;  4B1R A;  2E5N A;  1YO5 C;  4A69 C;  3LA7 A;  1TWG J;  1YE9 A;  3JRA A;  2WAE A;  1VQL I;  5CVI A;  4G6Q A;  1IXR C;  2HQN A;  2K3P A;  3LSH A;  1DGW Y;  2ZY9 A;  1WVR A;  4DIQ A;  1XSD A;  5E3N A;  3MZH A;  2RAS A;  1FP1 D;  4M3G A;  1ITY A;  3I0T A;  3PFI A;  2LRD A;  2A5W A;  3CRJ A;  4A3C J;  3NAU A;  1P7J A;  3BRO A;  4XL9 A;  2VJ4 A;  2DCE A;  1S9H A;  4OIO F;  4HEA 2;  1MBG A;  5E79 C;  1KU2 A;  4A2U A;  2NYX A;  3WU2 C;  5EGO A;  2FBQ A;  2XGX A;  3DPT A;  3HTH A;  2O8X A;  2RGV A;  3DKX A;  5DEQ A;  1HC8 A;  3RKQ A;  4UUS B;  1T39 A;  1KGS A;  2CMP A;  5E8G A;  2DK8 A;  3I4N J;  1W7P A;  2M7B A;  2OF7 A;  4M9X A;  3AG1 H;  5CW8 A;  2WGB A;  2QEX I;  1POG A;  1S3J A;  3CTA A;  1SD7 A;  2HEO A;  4WX9 A;  4BAC A;  3HOY J;  1YS6 A;  5IP7 J;  5L3E A;  2KP6 A;  4A0Z A;  3DU5 A;  2DA7 A;  3DBH B;  3OYK A;  4BUP A;  1FT9 A;  4ASN A;  1SMY F;  3G6E I;  4M71 A;  3P7N A;  3KZI C;  3GYH X;  4GO1 A;  4IEJ A;  2EFP A;  2WAD A;  3BZK A;  1BL0 A;  4ZTJ A;  4Y17 A;  1HDP A;  3X2Q H;  3JRC A;  2M4K A;  3FIW A;  3FZV A;  1ZG3 A;  3HUG B;  3OYH A;  2R4G A;  4UVA A;  4C3I J;  2EIK H;  2XRN A;  1HDD C;  3RPU A;  4KUM A;  4MGR A;  3JRF A;  4NC7 A;  2KDZ A;  3AG4 H;  4HST A;  3E6M A;  3L2W A;  1EJ9 A;  3JRI A;  2OTL I;  1MIJ A;  3CC4 I;  3BJA A;  4HAM A;  1F1Z A;  5BPI A;  2DMP A;  4C3H J;  2W48 A;  1RR8 C;  1LQ1 A;  2L7Z A;  4PK4 A;  4L9N A;  2ESH A;  3H36 A;  3JW4 A;  5LRR A;  1NHA A;  3IP4 B;  3I59 A;  2QZ8 A;  1IRZ A;  3SHF A;  4OIR F;  1FOY A;  4KMU X;  1J2X A;  3QPL A;  2ZOZ A;  4M3B A;  4J00 A;  1RES A;  5ILS A;  2V4J C;  3GZ5 A;  4G9Y A;  1HQC A;  1U5T B;  2QKM B;  1ZG1 A;  2EA2 A;  3QU6 A;  3J7A Y;  1HKS A;  3KLN A;  2KRH A;  4Y3O A;  5AQC A;  4I0B A;  2NP3 A;  4RS8 A;  1VQ9 I;  1OFC X;  1Z3X A;  2EWN A;  1D1C A;  1XD7 A;  2QCO A;  4AID A;  1WPK A;  2WV0 A;  3PAS A;  4CDG A;  3IH2 A;  4NB5 A;  2Q8K A;  5TIS C;  1DU6 A;  3C07 A;  2HQR A;  2R7T A;  3HZJ A;  2OER A;  5GAG J;  2R7Z J;  2YS9 A;  3C18 A;  3R60 A;  2E5Z A;  2Q1Z B;  3GLX A;  2IA1 A;  3CQZ J;  1X1D A;  2WAQ A;  5FRO A;  4H4K C;  2EZI A;  3EYY A;  4BHC A;  3PNY A;  1A35 A;  1CGP A;  3AQS A;  3G71 I;  4L0Y B;  3K4L A;  3ZXS A;  5TJJ A;  3ZQQ A;  3EQL F;  4RDU A;  2G7G A;  1O57 A;  2V9P A;  1KQ0 A;  2OJE D;  1N75 A;  3HE0 A;  2QKO A;  4YFK F;  1L0O C;  3K4B A;  3U21 A;  2R7X A;  1PUE E;  3F23 A;  3GFL A;  2DFF A;  4G7Z F;  4GGG A;  2XC7 A;  5EEA A;  2XGC A;  4M6V A;  2LH9 A;  2X85 A;  4AD9 A;  1JXS A;  3HHG A;  4BQA A;  3NAR A;  1MMD A;  2N8G A;  4GYI A;  3RKW A;  5IYC J;  3LSP A;  1TWC J;  3I9V 2;  2QKL B;  2IS1 A;  5HSZ A;  4PFP A;  1R23 A;  2DYR H;  4FT8 A;  1YIO A;  2L7K A;  3RKY A;  5D1R A;  3RI4 A;  4FE4 A;  2LDU A;  5IY5 H;  2WWY A;  3HEF A;  3KCC A;  3V8L A;  2XAU A;  2EFQ A;  3W3C A;  2IP2 A;  2HTJ A;  1O7F A;  5CXG A;  5KNL A;  3ZMZ A;  2R7W A;  5KCM A;  3LNQ A;  3HTI A;  1RPW A;  5D5W B;  2LF7 A;  2QF7 A;  4EEF G;  4ZJZ A;  3IUO A;  5LD2 C;  2BVM A;  4LG3 A;  4ZYD A;  4FE7 A;  1JKP C;  2BW3 B;  1XDU A;  1JT0 A;  3GTJ J;  2NS8 A;  2KHM A;  1HW1 A;  2P81 A;  2XPV A;  4UB8 C;  3WE3 A;  4MQ9 F;  3RQ4 A;  3TKY A;  2EZK A;  2GA1 A;  2Z99 A;  4F92 B;  5LGT A;  3I56 I;  1MBK A;  3HHH A;  1ZR4 A;  3QP6 A;  1IN4 A;  1Z7U A;  2R5Z B;  5HDK A;  1OQY A;  1TBX A;  3FHZ A;  1PUF B;  2EFW A;  4ZDP A;  3NEU A;  2MG4 A;  2NVU B;  4Y33 A;  3WGG A;  5LGN A;  3QKX A;  1ZRC A;  3WE2 A;  2KQR A;  2LR8 A;  3W6J B;  3BR6 A;  4Y13 A;  4XOR A;  1Z3Y A;  2DJI A;  2HNH A;  3GME A;  5FO5 A;  5ILU A;  5DS9 A;  1UHM A;  2RVC A;  3RYP A;  3D5L A;  2D1V A;  5IPA A;  2F48 A;  1CQT A;  2LK2 A;  4DYQ A;  3I55 I;  2YVX A;  4BQO A;  4QPO A;  3HOW J;  3WTV C;  1U3E M;  2OC6 A;  5E1W A;  2GA2 A;  2M45 A;  3GZ6 A;  4Y15 A;  2R5Y B;  4BS9 A;  3CUO A;  2VL8 A;  3OY9 A;  4P5O A;  4LIT A;  3FK6 A;  2HR3 A;  5FKM A;  5A2Q K;  3LAJ A;  2PFV A;  4P55 A;  1LDK B;  2X1C A;  5F1R A;  4I99 C;  4UUS A;  3LQQ A;  2VPR A;  4BE1 A;  5F08 A;  4XR6 A;  4GYG A;  3B02 A;  1FPQ A;  3CLQ A;  2ME0 A;  3P9T A;  3E5X A;  4XQF A;  5C4Y A;  2IBD A;  3PIP F;  2I5U A;  3S32 A;  1YX5 A;  2VQH A;  2IU5 A;  3WG9 A;  2QQA A;  4PJM A;  5K5O A;  4IKF A;  1HLV A;  1IG7 A;  4LLN A;  3N05 A;  1RKT A;  3F21 A;  1K6O A;  2E36 A;  3RDI A;  1X3U A;  5D19 A;  2KZG A;  3JTG A;  2HS5 A;  1R00 A;  5FD6 A;  1BJA A;  3VOD A;  3CJN A;  4RLQ A;  4A3F J;  3I58 A;  2RNG A;  5IT9 Z;  2FNP A;  3HUG A;  2L02 A;  2X6W A;  2KKO A;  2A07 F;  1R1U A;  4HOB A;  2UWM A;  1IXS B;  1W36 D;  2L01 A;  4A3E J;  1IN7 A;  4NQW B;  4EM1 A;  4AYB A;  1JGS A;  1BC7 C;  3JAM Z;  4LB5 A;  5ICC A;  1YJ9 I;  4OAZ A;  5L3F A;  2NVT J;  3KNW A;  1WH7 A;  5ICE A;  1ZLK A;  4IHS A;  1TNS A;  3OYI A;  4CCM A;  3RZD J;  3HOZ J;  3R61 A;  2Q2E B;  1QHH D;  2TRT A;  2M5W A;  5KVR A;  1PDN C;  4IPA A;  2LVS A;  1K83 J;  3BCB A;  3M7G A;  1J0R A;  2VJJ A;  1A31 A;  1IUY A;  5IOY A;  2XF7 A;  1JUP A;  1OKR A;  4BBS J;  2UXX A;  2QIB A;  3GF2 A;  3JSP A;  2GLO A;  1YW7 A;  2Z3Y A;  3Q9S A;  3KFW X;  1E3H A;  1U5T A;  2K4B A;  5FGL A;  1FBQ A;  1DUX C;  5M3F J;  3FK7 A;  2HOA A;  3LA3 A;  1DPU A;  3HKZ N;  2FUG 2;  2Y0M A;  5E20 A;  3PO2 J;  3VOX A;  3FXR A;  1FYM A;  1DPR A;  3AAF A;  2VOO A;  1WHU A;  3EUH C;  2Z2S B;  4MFD A;  3BQZ A;  1O3Q A;  3H9G A;  3B6A A;  1R4N B;  3MD2 A;  3BR2 A;  2BHY A;  2F5F A;  2VXZ A;  2VT3 A;  4ITV A;  3ZMS A;  2K9N A;  3E1S A;  5IT3 A;  1TQP A;  4KIB A;  2HQ5 A;  2CJJ A;  4G7H F;  4E7H A;  5DCM B;  1Y0U A;  2DMU A;  3ZQH A;  1ON2 A;  1UHW A;  3DF8 A;  4K2E A;  1IJW C;  3BCA A;  1I5Z A;  2OCC H;  3WTT C;  2XSJ C;  4I2O A;  5J1R A;  3FBN B;  2F07 A;  2OUM A;  1IZ1 A;  2LOO A;  3FRQ A;  2DMN A;  1WJF A;  3VOE A;  4XIC A;  4J19 A;  3V7R A;  3OIP A;  1ZGA A;  5C3E J;  1E3O C;  2DOF A;  3VPR A;  4FX0 A;  2H8R A;  4L62 A;  1P4A A;  3HGY A;  3HIF A;  5HNH A;  1OR7 C;  1YQA A;  4N9I A;  1NK2 P;  4YEL A;  4ZDO A;  4CYD A;  4LB6 B;  4I02 A;  3P9K A;  4KT6 A;  5JVT A;  4LLL A;  4PZJ A;  5J8F A;  2LP0 A;  4UVC A;  3DU6 A;  4CUG A;  1ZGJ A;  3CF2 A;  3WGI A;  2UXN A;  1AU7 A;  3QP5 A;  4N0B A;  1I3Q J;  3F8B A;  4D7M A;  5FKK A;  2NXN B;  2D45 A;  3E5Q A;  1YTY A;  3GLL A;  4DBR A;  4MEY F;  1FTT A;  2R7D A;  3REO A;  4LG0 B;  2GXB A;  1EF4 A;  1EKE A;  3VVY A;  2BXZ A;  3JRB A;  3VWB A;  3TDZ C;  2LRE A;  3SWH A;  2R7Q A;  3S93 A;  4D1Q A;  2CV0 A;  4U7B A;  4U0Y A;  4DZP A;  2L7F P;  4A93 J;  2BW3 A;  1YS7 A;  4QPQ A;  5IYB J;  5LRS A;  4HX7 A;  2UV1 A;  4UDS A;  2Z16 A;  2F4I A;  3V78 A;  2BV6 A;  2FOK A;  1E17 A;  2UUZ A;  5GTI C;  3O8H A;  1ZRF A;  3CUQ B;  3TL4 X;  3BY6 A;  2R5Z A;  4S04 A;  5DUK A;  3VOK A;  4ESF A;  3AL0 C;  1Z1D A;  2E71 A;  3RQI A;  5L3C A;  2BYV E;  4IHY A;  2Y9Z A;  1PUF A;  3PUB A;  3FXO A;  3S14 J;  1B6A A;  2CWE A;  2W24 A;  4DW6 A;  3VFZ A;  1Z6R A;  2YX4 A;  2M3A A;  1J7K A;  4A3B J;  5EEG A;  5F64 A;  2CSO A;  2A2F X;  2ZXI A;  3N4M A;  1R7J A;  2KIU A;  1E0E A;  3SZG A;  4LOC A;  1NG7 A;  2CFX A;  4XRM A;  2W7N A;  3A0B C;  3ML6 A;  1H89 C;  2V26 A;  1JI8 A;  2IGO A;  2COB A;  4L9V A;  2L9R A;  5FLM J;  2R5Y A;  1MNE A;  4LLG F;  5M5Y J;  4BJ5 C;  3BPX A;  4A3D J;  4XLH A;  4PUS A;  3FWE A;  2WUI A;  3HOX J;  2VKD A;  1SD4 A;  2R7O A;  4TV7 A;  1Z7L A;  4N4O B;  2ELJ A;  4A6E A;  2ADU A;  5E1X A;  3LSG A;  2VN2 A;  5HLI A;  1ETX A;  4CIC A;  2VQG A;  5FB2 A;  4LMY A;  4ZYA A;  1X3Z B;  5CLS A;  4IVN A;  5E3M A;  4A5N A;  1OCO H;  2FQ3 A;  5J1U A;  1BOB A;  3KP3 A;  2WC2 A;  4BHB A;  3DKY A;  3LA2 A;  3T8T A;  2VKH A;  2P8T A;  5ERI A;  1OMI A;  3IAM 2;  1XSV A;  2LY9 A;  4BEH B;  4EJT A;  2ISZ A;  5GPC A;  2MLG A;  3F8C A;  3F8N A;  1SAU A;  2P6S A;  1UCR A;  2IT0 A;  4OIP F;  3NS4 A;  2DA2 A;  5E8I A;  3GO5 A;  3DTE A;  1RUO A;  4EM0 B;  1HW2 A;  5H9T A;  3Q3S A;  5D6F A;  1YIJ I;  1BJZ A;  1ZTR A;  2JA7 J;  2OCE A;  1T8I A;  4NQW A;  3BHQ A;  1FX7 A;  2ID6 A;  5DTD A;  3EUP A;  3DTK A;  3A03 A;  4UXN A;  2HPM A;  3LQR A;  5LHG A;  2AXT C;  2K40 A;  3RKX A;  3MKL A;  2FJ1 A;  3BG3 A;  2CW8 A;  1B59 A;  2E1M C;  3K6G A;  4XOP A;  5IOZ A;  4HDU A;  1YW8 A;  2Q2E A;  2DOD A;  1HSJ A;  4DQ2 A;  4B43 A;  2QEN A;  1SGM A;  4M74 A;  2PJP A;  1FMV A;  2M8E A;  1X58 A;  3QQA A;  1DU0 A;  4UUV A;  1PJR A;  3DQV C;  4L18 B;  3WU0 A;  1GVJ A;  4R79 A;  1SFE A;  2B3W A;  1RIO H;  3HG9 A;  4Q48 A;  4W97 A;  2YPR A;  3VTI A;  2VBW A;  5JLX A;  4P96 A;  4XKW A;  5HOO A;  5K58 A;  1SAN A;  4KDP A;  1TP4 A;  3FM3 A;  1GXQ A;  1RUN A;  5GAD J;  3K1N A;  2LYC A;  2KRC A;  4BU2 A;  3ZQI A;  5J4Y A;  4EGZ A;  2M87 A;  1GLN A;  1ETK A;  3F72 A;  3OYC A;  2W53 A;  1PYV A;  2VOD A;  2BY2 A;  2W1O A;  2P6T A;  5DCM A;  4DYR A;  2YU3 A;  1BN5 A;  2G0E A;  1FYK A;  2MBF A;  4GFK A;  3VVX A;  3C2B A;  3TED A;  2KIM A;  5GPA A;  4L5J A;  2XPW A;  3UNG C;  5D5U B;  1X4O A;  4BJ6 C;  3JTH A;  2F5C A;  1W5C C;  4I7H A;  4ON0 A;  1KYZ A;  5E17 F;  2E34 A;  2I10 A;  3IH3 A;  2DOE A;  2FOW A;  5K7F A;  2OU2 A;  3HOU J;  1R1T A;  3MAJ A;  1JUM A;  2AQF A;  2ZJ2 A;  1ZYR F;  1XC5 A;  2RN7 A;  2VKV A;  3EPZ A;  4P9F A;  1JKQ C;  4GXO A;  1XPX A;  2HI3 A;  5GP9 A;  2LC2 A;  4BY7 J;  3VEP A;  1B8I A;  3OSG A;  4MXM A;  3ECH A;  2HTS A;  2E1O A;  3DXJ F;  2F5D A;  4NDL A;  3SXY A;  5D4R A;  2G7U A;  2NVY J;  1N77 A;  3PSF A;  3CCS I;  1ERD A;  1MNM C;  3CP8 A;  4ABZ A;  2HKX A;  2R0Q C;  3GW2 A;  1R5G A;  3NRV A;  3M8F A;  3A01 A;  4ACI A;  2FML A;  2YSR A;  1WWX A;  1IW7 F;  4D7N A;  1J75 A;  2H1K A;  3LHQ A;  5C4J J;  3W6V A;  2M1B A;  1G3T A;  2ICW G;  1LFB A;  1ETY A;  4U9L A;  2GZW A;  3U1D A;  1EH7 A;  2XRL A;  3A4C A;  3HOV J;  2BHZ A;  2FJI 1;  4MFE A;  1IC8 A;  1VQ6 I;  4C2U A;  3O60 A;  1T08 B;  2HXO A;  2PMU A;  4IHV A;  4HW0 A;  4XLA A;  3WOD F;  2VE8 A;  3I64 A;  2DG8 A;  4U0W A;  2JA5 J;  2KL4 A;  1A6I A;  1QZY A;  4KN7 X;  2XAH A;  1XX5 A;  3CC7 I;  5HDN A;  3CUQ A;  5H20 A;  3J7Z I;  2VT2 A;  4E7S A;  2DMT A;  3TW7 A;  5BMZ A;  2PX9 A;  3ON2 A;  4HF2 A;  4R8H A;  2HYF A;  3ABT A;  3PQJ A;  4JOM A;  4BXX J;  1HKT A;  1MD0 A;  2QM3 A;  1ZRE A;  2CV1 A;  3BC8 A;  1TLH B;  5D18 A;  2H94 A;  1WKM A;  4D5F A;  3COA C;  2Y30 A;  3RYR A;  5CYV A;  2K3F A;  3L2C A;  2PLY A;  2O6G E;  3ESW B;  4HX4 A;  2E7W A;  4PJ0 C;  2P7V B;  4V2G A;  2LBF B;  4A3K J;  3FXL A;  3KIO A;  1VFC A;  1B72 A;  4WXD A;  3ZQF A;  4OWR B;  1FTZ A;  3OS2 A;  1MH4 A;  4XRS A;  3D5R C;  1V3F A;  3EYI A;  2OA4 A;  1QHG A;  2OZU A;  3W2W A;  3BG6 A;  2KIS A;  3J81 K;  2EPF A;  3O3K A;  2B7E A;  4IRG A;  5E1Z B;  4EJO A;  1T6S A;  4PGH A;  2JN6 A;  3AKZ A;  1ODD A;  4MLO A;  3W2V A;  3CCR I;  4NN1 A;  3DFG A;  2GIZ A;  3ASO H;  3RIR A;  3TOA A;  2DLL A;  1VQ8 I;  2Q24 A;  2UXU A;  5FGM A;  2MLK A;  3T1B A;  2WA0 A;  3WHC A;  4IZZ A;  4FHT A;  1FBU A;  4PDK A;  2TCT A;  3FBI B;  4G8X A;  4B4C A;  4ENN A;  1OYW A;  2AHQ A;  1MBE A;  4A0Y A;  1B9M A;  5A2Q Z;  3KZZ A;  2XB0 X;  3D0S A;  3K10 A;  2OAZ A;  2L2O A;  3SDG A;  3F8F A;  3CCY A;  1B9N A;  1JJ8 C;  1VQ7 I;  3S17 J;  4RGS A;  3CMA I;  1LEB A;  4BEH A;  2KRF A;  2H27 A;  3H0G J;  1MMS A;  1Z67 A;  2PMZ N;  2VUM J;  3CLO A;  4BDY A;  5L3G A;  3GTG J;  1XTA A;  1LNW A;  1WFX A;  5CVV A;  4OMY A;  3LSK A;  3FXJ A;  4A0X A;  2Z9O A;  1JKR C;  2MFZ A;  4XN0 A;  4A3G J;  3KP6 A;  2DPU A;  2X6O A;  3CCU I;  5FLX K;  4NBQ A;  4AIH A;  4YG2 F;  1HCR A;  3QOD A;  4M3D A;  3CCQ I;  1VQK I;  4DBQ A;  1GVD A;  2F4O B;  1HST A;  2ZFW A;  4XSZ F;  1P92 A;  1FNN A;  2QOP A;  4M9Z A;  1X2N A;  1IV8 A;  3LOC A;  4LK1 F;  2NS0 A;  1UST A;  4M72 A;  2GM4 A;  3DPJ A;  5EJC A;  4OD5 A;  3QOP A;  4RB2 C;  5LHI A;  4ICH A;  1FC3 A;  4XM3 A;  3OIO A;  4BHP A;  3NRG A;  1T38 A;  2PZ9 A;  1KQ8 A;  1L3L A;  3HPG A;  1WGX A;  3ABK H;  4M9S A;  3KPH A;  1MJA A;  4BXU A;  1UI6 A;  1A04 A;  2XIG A;  3AFH A;  4X1E A;  1BR2 A;  1UMQ A;  5LBQ A;  3GTK J;  1AOY A;  3ABM H;  2O5R A;  4KYW A;  1D1B A;  1QRY A;  4QTR A;  4CA0 A;  4QSH A;  3PSI A;  3BPV A;  1FJL A;  4HYE A;  1G59 A;  3ZPL A;  3OL3 A;  2FXA A;  1RZ4 A;  4Q4Z F;  2P5V A;  3OYB A;  2QSF X;  3CES A;  4LFU A;  3ULQ B;  3MKW B;  2X0L A;  1V4R A;  1ETW A;  2CH0 A;  2MSY A;  4A3I J;  4J01 A;  1TWF J;  2KLO A;  2PG4 A;  2VB6 A;  4I98 B;  4HNT A;  2EZH A;  2PJR B;  3BTL A;  2VQL A;  3HB9 A;  3BR3 A;  3HOS A;  1IGN A;  5EYR A;  2O7T A;  1FWZ A;  5ICG A;  1F9N A;  4GCK A;  2F5E A;  1U8B A;  4IHX A;  5E18 F;  3HTA A;  1W1W E;  3IWF A;  3DWL E;  1R58 A;  5FD5 A;  3QRF F;  2MH9 A;  3ZQC A;  2HFH A;  3V7C A;  1K7A A;  2X51 A;  3MVP A;  4FCY A;  1LEA A;  3ZQG A;  2LF8 A;  3OYL A;  4M6Y A;  3MWM A;  1AA7 A;  1WSU A;  2F6C A;  3CC2 I;  1UI5 A;  4RAY A;  1AKH B;  4HF0 A;  3E0J B;  4G12 A;  4DYC A;  4MTE A;  2MYS A;  3WTY C;  1Z77 A;  1USS A;  1H88 C;  3S8P A;  2BXY A;  2UXH A;  4XRF A;  2PBI A;  3F9K A;  4JL3 A;  3BJ6 A;  3HDD A;  1YI2 I;  2PFB A;  1JHF A;  5DD4 A;  4B3X A;  1HXD A;  2E1C A;  3V42 A;  3LSR A;  5JHF A;  4XKB A;  4E70 A;  1ETV A;  4KT5 C;  1IRX A;  3HL2 A;  2NNY A;  3VSK A;  3GTL J;  4A12 A;  2QTQ A;  1APL C;  3L2V A;  2GOM A;  2IS2 A;  1TWH J;  3L09 A;  3MZY A;  3TO9 A;  3BP8 A;  1ZR2 A;  2JSC A;  2P5K A;  5CVJ A;  2KT0 A;  2WY8 Q;  1MW7 A;  2E7X A;  3CZ6 A;  5FFZ A;  3BJO A;  1SFK A;  1G8X A;  1ZAO A;  3IL2 A;  2O03 A;  3GZI A;  3TO6 A;  1XGS A;  1D5Y A;  2P7C B;  4D5C A;  2HOE A;  5CPR B;  3J80 K;  2W00 A;  4F91 B;  4NC8 A;  1MDM B;  2BVL A;  2OQR A;  4XKC A;  3D1N I;  3L9F A;  5HLT A;  3Q9V A;  2LKS A;  1MSF C;  4ANJ A;  3ANG A;  3P5J A;  4NUB A;  2FNA A;  4DNC A;  5C44 J;  2E2H J;  4PXI A;  3K69 A;  1UG2 A;  5GAE J;  1OLT A;  2AXL A;  1PVE A;  2M9H A;  1ZQ3 P;  2ZCN A;  2CV2 A;  2MH2 A;  3LSI A;  1IN8 A;  3H9J A;  4CSW A;  3KET A;  1W4M A;  2EFO A;  2D1H A;  2VC1 A;  4KNY A;  1U9N A;  2IA0 A;  3I54 A;  3UKG A;  2Y48 A;  1FBS A;  4G6D A;  1R5I D;  1T56 A;  2LBF A;  4IL6 C;  4PJL A;  5EDN A;  2ZME B;  2CYY A;  2TDX A;  1P7I A;  2MAB A;  2EJR A;  3JRH A;  4CCK A;  1MMN A;  2D6Y A;  3LWJ A;  1VQ5 I;  3IC7 A;  5L3B A;  1R22 A;  3V8J A;  2JRT A;  3ZMD A;  1K61 A;  5D4S A;  2MC4 A;  1UB9 A;  3T5X A;  1VQM I;  2V57 A;  2RAE A;  3BR5 A;  1TW2 A;  2DQL A;  4AYB N;  1SFO J;  1FSH A;  3VW1 A;  3PJR A;  2ZBK A;  1YLF A;  1ZLJ A;  1B4A A;  2HYJ A;  2ZCW A;  5JLW A;  1UAA A;  3E6D A;  4E7L A;  5FMP A;  3TQN A;  3MKY B;  2RDP A;  4PGG A;  3AG3 H;  1GUU A;  2A6E F;  5JFR A;  2A6H F;  3ONQ A;  4B8X A;  1VF9 A;  2KIF A;  1W7P D;  2W25 A;  4C2M J;  3KEO A;  3ZN0 A;  2GBY A;  2YVH A;  4P9U A;  1FSE A;  5FFX A;  2E2J J;  1I1S A;  2XKP A;  3I53 A;  2OD5 A;  1VZ0 A;  2QUF A;  4ZZD A;  2KJC A;  1SAX A;  5HBU A;  1JTY A;  3E6C C;  1Q1H A;  3WTW C;  5F04 A;  2WAF A;  1KZH A;  2XPU A;  4JBA A;  3BJB A;  4BH9 A;  4AC6 A;  3RCO A;  2JVH A;  5FJ8 J;  3WGH A;  1LFU P;  3M4O J;  1O3S A;  1JJ6 C;  2DA1 A;  1ZRD A;  5CKT A;  1Y1V J;  3VYS B;  3C3W A;  2XVC A;  3E7L A;  4AWX B;  3Q0V A;  1PP7 U;  1I1G A;  2QWW A;  3CO6 C;  3SYT A;  3BWG A;  3KP2 A;  2RQP A;  4WXH A;  1XMA A;  4E7K A;  3QAH A;  3K2Z A;  3PNT A;  3K70 C;  1LE8 B;  5FRN A;  2JA8 J;  3RPU D;  3RD3 A;  3VUQ A;  2JPB A;  4X0G A;  2XAJ A;  4RB0 A;  1ZGW A;  5LEK A;  3I4M J;  3K9T A;  5LFA A;  4BL0 B;  2DA5 A;  1QU3 A;  5FLV A;  3CMY A;  3LJL A;  4YFN F;  4L9J A;  2LTP A;  1W5T A;  3RZO J;  3HRM A;  1FOW A;  3BT9 A;  2ZXJ A;  2CQQ A;  1R1V A;  2PQ8 A;  2CUF A;  2X48 A;  3L1P A;  1Q1V A;  1QBJ A;  4Y4R A;  4IHW A;  2F4M B;  2IW5 A;  4CCL A;  2HVS A;  4UB6 C;  3MCZ A;  5IP9 J;  1RNL A;  1XSX A;  3KLO A;  2NRA C;  4UY8 I;  2JJ7 A;  3OSF A;  1OPC A;  2VIX A;  3CCJ I;  2EV5 A;  5F0H A;  4ENJ A;  2DG7 A;  5M3M J;  3LFU A;  4BYY A;  2Z5U A;  3BG7 A;  3B73 A;  2HZT A;  4BKX A;  4CCJ A;  1QO0 D;  4BQQ A;  1E3P A;  6PAX A;  4XLP F;  2V1X A;  4AM3 A;  1V55 H;  3H5N A;  4GCL A;  1RKW A;  3OV8 A;  3V7S A;  2EA4 A;  3G73 A;  1X1C A;  2VBX A;  4RAG A;  2STT A;  2XSD C;  5ICF A;  3S5R A;  3ERE D;  5IP6 A;  2M8G X;  2Y75 A;  4XLE A;  4EJU A;  2DI3 A;  2GXG A;  3ZRG A;  3L2R A;  2DT5 A;  2V9V A;  3S1Q J;  1X19 A;  2VE9 A;  1VQP I;  1S8N A;  3CP2 A;  3OMY A;  3MFK A;  2ZO4 A;  2CUE A;  2WB1 A;  1TL8 A;  5HS7 A;  1XN7 A;  4CZZ A;  3CCE I;  2DTZ A;  2XF6 A;  1CF7 B;  3BG5 A;  3QBM A;  2IGM A;  5M5X J;  1ETQ A;  1YW9 A;  4YEJ A;  3UR3 C;  5J6X A;  3CF5 F;  3DBR B;  1AKH A;  3G3Z A;  1P4X A;  5M5W J;  1UZC A;  4UV8 A;  5JVG F;  3F8M A;  1R4M B;  2LG4 A;  2LLK A;  2YX7 A; 
#chains in the Genus database with same CATH homology
 2DA7 A;  2Y0S N;  2AO9 A;  3COL A;  3BTI A;  1X2M A;  1QPI A;  4GFL A;  4W97 A;  4HKU A;  4IEJ A;  4DZJ A;  1BL0 A;  2M2E A;  5JLX A;  2JWT A;  1IDZ A;  2RHA A;  5K58 A;  1SAN A;  1HDP A;  3JRC A;  3DCF A;  3FIW A;  5IYD J;  2L0K A;  3NXC A;  4C3I J;  3G7R A;  3HTJ A;  4FIS A;  1HDD C;  3JRF A;  2KDZ A;  3KZ9 A;  1YRN A;  2O8K A;  3ZQI A;  2LD5 A;  5EZG A;  1ETK A;  3JRI A;  3GTO J;  2W53 A;  5F1J A;  2ID3 A;  2DMP A;  4C3H J;  4DYR A;  2W48 A;  2G0E A;  1A5J A;  1ENH A;  4GFK A;  3VVX A;  2L7Z A;  3C2B A;  3TED A;  4Y52 J;  5GPA A;  2XPW A;  4YZE A;  2I10 A;  3IH3 A;  2HOT A;  1IRZ A;  5K7F A;  3HOU J;  2HXI A;  1QVU A;  5J1Y A;  1JUM A;  4A3L J;  1XC5 A;  2VKV A;  1JKQ C;  3JRE A;  4V2F A;  4I6Z A;  3QPL A;  3LSJ A;  3IV5 A;  4M3B A;  2ZOZ A;  1RES A;  2HI3 A;  5GP9 A;  4BY7 J;  1B8I A;  3OSG A;  2O7O A;  2NVQ J;  4MXM A;  1QVT A;  3ZOB A;  2X9D A;  1RET A;  4ME9 A;  2E1O A;  2NP3 A;  4GCT A;  3S15 J;  2NS7 A;  1OFC X;  3BR1 A;  4NDL A;  3GEU A;  5FHP A;  2NVY J;  2QCO A;  3JR9 A;  1MNM C;  1WPK A;  4ABZ A;  2R0Q C;  4FTH A;  3PAS A;  3IH2 A;  1DU6 A;  3C07 A;  3A01 A;  4ACI A;  2OER A;  2NVX J;  2R7Z J;  2YS9 A;  2VI6 A;  4M3E A;  4D7N A;  2H1K A;  2EBI A;  5C4J J;  3CQZ J;  3W6V A;  2NX4 A;  3LHQ A;  1LFB A;  1ETY A;  2EZI A;  4QIW N;  3S2H J;  3AQS A;  3G56 A;  2UXI A;  2XRL A;  1BA5 A;  3HOV J;  1IDY A;  5EGO B;  4MFE A;  4X6A J;  1IC8 A;  3JRG A;  2G7S A;  1ETO A;  4RDU A;  2G7G A;  3O60 A;  2HXO A;  5AQC A;  4IHV A;  2DG8 A;  2OI8 A;  2JA5 J;  3HE0 A;  2QKO A;  1A6I A;  4W1U A;  3GBG A;  1WI3 A;  2DA3 A;  2WB1 N;  5EEA A;  2XGC A;  4M6V A;  4BBR J;  2NOG A;  1I6H J;  2DMT A;  3NAR A;  3TW7 A;  2N8G A;  4B3A A;  3RH2 A;  5IYC J;  3LSP A;  3G1L A;  1TWC J;  3ON2 A;  3F1B A;  4BXX J;  3F0C A;  5HSZ A;  5D18 A;  5D1R A;  2DJN A;  4D5F A;  2Y30 A;  4FE4 A;  2E2I J;  4I76 A;  3HEF A;  3JRD A;  1TWA J;  3GTP J;  3V6G A;  4V2G A;  4A3K J;  1VFC A;  1O4X A;  4C3J J;  1GV2 A;  1B72 A;  5CXG A;  2ECC A;  3ZQF A;  1ZKG A;  5K7Z A;  1FTZ A;  3LNQ A;  3HTI A;  1RPW A;  1MH4 A;  2YU9 J;  2QF7 A;  4XRS A;  3M3Y J;  4UUT A;  4EEF G;  3VP5 A;  4JKZ A;  2GUH A;  4JYK A;  4FE7 A;  1JKP C;  1JT0 A;  2EQR A;  3GTJ J;  2ELK A;  2NS8 A;  2P81 A;  2WV1 A;  2XPV A;  1LE8 A;  3BNI A;  2ME6 A;  2EZK A;  2JN6 A;  2EZL A;  1JKO C;  2G7L A;  4MLO A;  1MBK A;  3Q0W A;  4NN1 A;  1ZR4 A;  2MGQ A;  9ANT A;  2R5Z B;  2Q24 A;  5F27 A;  2UXU A;  3BQY A;  4JX4 A;  3WHC A;  1PUF B;  1OCP A;  2TCT A;  2MG4 A;  4B4C A;  3QKX A;  2AHQ A;  1MBE A;  5EG0 B;  1U78 A;  2JMW A;  2LR8 A;  2XB0 X;  1JUS A;  3BR6 A;  3CWR A;  1OCT C;  4BY1 J;  3S1N J;  2HYT A;  5DS9 A;  5HOD A;  1MH3 A;  5IPA A;  3SDG A;  1B8I B;  4MO7 A;  3CCY A;  1JJ8 C;  2LK2 A;  4DYQ A;  1CQT A;  3S17 J;  3B6C A;  2LFB A;  3H0G J;  2VKE A;  1HOM A;  2PMZ N;  2VUM J;  3GTG J;  2Y9Y A;  1BW6 A;  3HOW J;  1AHD P;  4AC0 A;  3G1O A;  1JKR C;  1GDT A;  4XRS G;  4GFB A;  3CDL A;  4A3G J;  2R5Y B;  1BW5 A;  3A01 B;  5F0F A;  3K7A J;  2X6O A;  3BG9 A;  1Y1W J;  2GEN A;  1HCR A;  4M3D A;  3FK6 A;  5FKM A;  1GVD A;  2MW8 A;  2ZCM A;  2QOP A;  3B81 A;  1X2N A;  3LOC A;  2Y2Z A;  2GM4 A;  3DPJ A;  2NP5 A;  4JX6 A;  4UUS A;  4ICH A;  1VND A;  2VPR A;  1U9O A;  1ZK8 A;  5F08 A;  1MBJ A;  3OIO A;  1IUF A;  1WCM J;  3QPS A;  2D5V A;  2PZ9 A;  3NRG A;  4AUX A;  3FIS A;  2ME0 A;  3P9T A;  1WGX A;  5C4Y A;  2IAI A;  2IBD A;  3G1M A;  1UI6 A;  3K2A A;  2ZCX A;  3FKI J;  4X1E A;  2IU5 A;  1UMQ A;  3GTK J;  3ANP A;  2CRG A;  1HLV A;  1S7E A;  1IG7 A;  1QRY A;  1MBH A;  2M0C A;  4QTR A;  3VIB A;  5FKN A;  1RKT A;  1I50 J;  4QSH A;  1FJL A;  5D19 A;  2ZOY A;  3A02 A;  1TC3 C;  2XB5 A;  4A3F J;  2EH3 A;  1MBF A;  3PPB A;  1ETW A;  2MSY A;  4A3I J;  1TWF J;  4CYC B;  1B72 B;  2CQX A;  2EZH A;  3HIM A;  3VW0 A;  2R93 J;  3BTL A;  3HB9 A;  3BR3 A;  1G2H A;  4A3E J;  5EYR A;  1IGN A;  2O7T A;  2YUS A;  3VW2 A;  4GCK A;  1U8B A;  3Q0U A;  4IHX A;  3HTA A;  2NVT J;  3KNW A;  1WH7 A;  3H3V K;  4XID A;  2JK3 A;  3T6N A;  3ZQC A;  3BRU A;  3MVP A;  3RZD J;  4FCY A;  3HOZ J;  3ZQG A;  2TRT A;  3IUV A;  2B63 J;  1R9T J;  3DEW A;  5K7H A;  1UI5 A;  2LVS A;  1K83 J;  1AKH B;  2PBX A;  4G12 A;  4DYC A;  5IOY A;  1Z77 A;  2QIB A;  1JUP A;  4BBS J;  5FKL A;  5E3O A;  5EZH A;  1H88 C;  2UXH A;  2GLO A;  5EFY A;  4JL3 A;  3HDD A;  5FGL A;  5M3F J;  3FK7 A;  2HOA A;  3SJM A;  3HKZ N;  3PO2 J;  3VOX A;  3LSR A;  2XGD A;  1ETV A;  4MFD A;  3BQZ A;  3BTC A;  3B6A A;  3TP0 A;  2HKU A;  2LKX A;  1YRN B;  3GTL J;  2QTQ A;  3BR2 A;  3ZQL A;  1APL C;  2GFN A;  4JNN A;  3CJD A;  2K9N A;  3KKD A;  1TWH J;  1VI0 A;  1ZR2 A;  3PM1 A;  2HQ5 A;  2CJJ A;  1FIA A;  2KT0 A;  5C4X J;  2DMU A;  4S0H B;  3ZQH A;  2XGE A;  1IJW C;  5HAW A;  3GZI A;  1OJL A;  1WH5 A;  1D5Y A;  5J1R A;  4HNV A;  4D5C A;  2F07 A;  1ORK A;  3TW6 A;  2DMN A;  3D1N I;  2HOS A;  3FRQ A;  3S1M J;  1RR7 A;  4XIC A;  4J19 A;  5DAJ A;  1MSF C;  3ANG A;  5C3E J;  1E3O C;  5C44 J;  3VPR A;  2H8R A;  4A3J J;  2E2H J;  4L62 A;  3HGY A;  4PXI A;  2QWT A;  1GT0 C;  1NK2 P;  1UG2 A;  2M9H A;  1ZQ3 P;  2LP0 A;  3BTJ A;  1W0U A;  2DA4 A;  2ZCN A;  3BR0 A;  1AU7 A;  1FEX A;  1I3Q J;  5FKO A;  4D7M A;  2ZB9 A;  3HGG A;  5FKK A;  5F0C A;  1F36 A;  1U9N A;  3EGQ A;  3UKG A;  1T56 A;  4L5E A;  1FTT A;  4CGR A;  2Y31 A;  1EF4 A;  3VVY A;  5EDN A;  3JRB A;  2M34 A;  3HM5 A;  1P7I A;  3NI7 A;  4RBO A;  3OOU A;  2WAQ N;  3JRH A;  2FX0 A;  4MK6 A;  3WHB A;  2E19 A;  2D6Y A;  3LWJ A;  1JT6 A;  2UXO A;  4DZP A;  2L7F P;  4A93 J;  4JX5 A;  3MN2 A;  1K61 A;  5IYB J;  2V57 A;  2RAE A;  4UDS A;  3BR5 A;  4AYB N;  3V78 A;  1SFO J;  3VW1 A;  2YVE A;  1IV6 A;  2HYJ A;  5JLW A;  5FMP A;  3O8H A;  1GUU A;  2R5Z A;  3VOK A;  2FD5 A;  2ECB A;  1VF9 A;  4C2M J;  3RQI A;  3E7Q A;  2GBY A;  4IHY A;  5EF6 A;  2Y9Z A;  1PUF A;  2YVH A;  2E2J J;  3S14 J;  3O8G A;  3SFI A;  2IEK A;  1HF0 A;  2K9Q A;  4DW6 A;  5HBU A;  1JTY A;  5EG0 A;  1T33 A;  2G3B A;  5F04 A;  3VVZ A;  4A3B J;  2XPU A;  3BJB A;  4AC6 A;  2K9S A;  4AF5 A;  2FQ4 A;  5FJ8 J;  3M4O J;  1LFU P;  3S16 J;  2R92 J;  1JJ6 C;  2DA1 A;  4LOC A;  1Z0X A;  1XG1 A;  1Y1V J;  1NK3 P;  4XRM A;  2XDN A;  4M3F A;  3E7L A;  1H89 C;  3Q0V A;  2HDD A;  1XS9 A;  2COB A;  1JGG A;  2REK A;  4JP0 A;  2L9R A;  5FLM J;  4KWA A;  2R5Y A;  3BCG A;  2O9L A;  1LE8 B;  5M5Y J;  5J3L A;  1FIP A;  3S1R J;  2JA8 J;  3RD3 A;  3VUQ A;  4A3D J;  2L7M P;  4MIM A;  2WUI A;  3HOX J;  1ZGW A;  3I4M J;  4NEL A;  3IH4 A;  3HBL A;  2DA5 A;  5FLV A;  3CMY A;  3LSG A;  1JTX A;  3S2D J;  3LJL A;  1ETX A;  2LTP A;  3NNR A;  3RZO J;  4XK4 A;  3BT9 A;  3PO3 J;  3MNL A;  2CQQ A;  2UXP A;  2CUF A;  3L1P A;  2DMQ A;  2OPT A;  1Q1V A;  2X48 A;  4IHW A;  2DA6 A;  4B1R A;  5E3M A;  4A69 C;  5J1U A;  5IP9 J;  1TWG J;  3JRA A;  2JJ7 A;  3OSF A;  5BNG A;  5F0H A;  2JA6 J;  2LY9 A;  1H8A C;  2DG7 A;  3TP3 A;  5M3M J;  5GPC A;  5E3N A;  2RAS A;  1F43 A;  4M3G A;  4BKX A;  1ITY A;  5E3L A;  3JSJ A;  1W0T A;  2DA2 A;  4GCL A;  1RKW A;  3GTQ J;  3CRJ A;  4A3C J;  1MSE C;  3NAU A;  1P7J A;  5H9T A;  4A3M J;  3Q3S A;  1GV5 A;  2XSD C;  4CYC A;  3AQT A;  1BJZ A;  3S5R A;  5IP6 A;  1MBG A;  1ZTR A;  2CU7 A;  2M8G X;  2JA7 J;  4Y7N J;  5EGO A;  2FBQ A;  3BHQ A;  2ID6 A;  3EUP A;  5DTD A;  3HTH A;  3S1Q J;  3A03 A;  3RKQ A;  4UUS B;  2CUE A;  3GTM J;  2K40 A;  3MKL A;  3I4N J;  2FJ1 A;  3BG3 A;  2DTZ A;  3KKC A;  5IOZ A;  3NPI A;  2OF7 A;  2DN0 A;  3BG5 A;  3QBM A;  5M5X J;  1ETQ A;  3ON4 A;  5CW8 A;  2WGB A;  1POG A;  1SGM A;  1AKH A;  5CXI A;  1X58 A;  5M5W J;  3QQA A;  1DU0 A;  3HOY J;  1NTC A;  5IP7 J;  2LLK A;  1UHS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...