1JTYA

Crystal structure of the multidrug binding transcriptional regulator qacr bound to ethidium
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
186
structure length
186
Chain Sequence
NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKKEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords HYPOTHETICAL TRANSCRIPTIONAL REGULATOR IN QACA 5'REGION
publication title Structural mechanisms of QacR induction and multidrug recognition.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 71
structure length 186
sequence length 186
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2001-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1jtyA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 1jtyA02
2XRLA 4A3BJ 4IEJA 2R93J 1F43A 5FKKA 2ZCMA 3BQYA 5H9TA 4GFLA 4KWAA 3NAUA 1LFUP 1XS9A 4XRSG 2D5VA 3DPJA 1MSEC 4A3KJ 2V57A 5HAWA 3ZQHA 3O8GA 2VKVA 3HBLA 4M3EA 5F08A 5IP7J 2CQQA 3VOKA 2QF7A 1BL0A 4DYQA 2YS9A 1Z0XA 4I6ZA 3K7AJ 1G2HA 1RKWA 3TEDA 4I76A 2WGBA 5HODA 3S1NJ 1OFCX 3IH4A 3PM1A 2Y2ZA 2ZOZA 4C2MJ 3SFIA 3S16J 2UXIA 3H0GJ 1WCMJ 3BHQA 5CXIA 1SFOJ 2IEKA 2XDNA 3ZQGA 3A01B 3LJLA 2GFNA 3G1MA 3G7RA 2DA5A 2HYJA 3S2HJ 3CRJA 1NK2P 2K9QA 4D7NA 1MSFC 4QTRA 2XGEA 2L7ZA 3HTIA 4IHVA 1E3OC 3VW2A 3TP0A 1I3QJ 3HOWJ 3HOYJ 2ECCA 3HEFA 1IUFA 2LD5A 2TCTA 1ZQ3P 3MNLA 4IHXA 2HXIA 2QOPA 2H8RA 2DA6A 2DMUA 5F0CA 4CGRA 3ON4A 3S1RJ 2WAQN 4M3BA 3JRBA 3PASA 1U9NA 3BR2A 5EZHA 2NVYJ 4Y7NJ 4S0HB 2NP5A 4AC6A 3ZQFA 5E3LA 5EYRA 4V2FA 4A69C 3HOUJ 2L7MP 4A3IJ 3KZ9A 3ZQCA 1WPKA 2R5YB 5CXGA 3B6AA 4FTHA 4JX4A 2NX4A 1P7JA 5J3LA 3SJMA 2L0KA 3IUVA 2PBXA 3TP3A 3JREA 1FTZA 5AQCA 3CWRA 5D19A 4GCKA 1WH5A 3BG9A 4MXMA 2DMPA 1B72B 1PUFB 1QPIA 1HCRA 3V6GA 1UMQA 2JMWA 3O60A 3UKGA 2Y30A 3LSPA 3G56A 2JA8J 3LSGA 1RR7A 5FMPA 1RESA 1UHSA 5EG0B 5K7HA 2IU5A 1BJZA 4FE7A 9ANTA 2GUHA 5F27A 1JT0A 3NNRA 1H88C 3CQZJ 2GM4A 4JNNA 2CU7A 2HYTA 3NARA 2FD5A 1B8IB 2CJJA 4JP0A 1UI6A 2GBYA 2HOAA 1VFCA 1DU6A 4XICA 2DA3A 1MBJA 4D5FA 1EF4A 2R92J 3GTKJ 2JA6J 1JUMA 3DEWA 3VIBA 2QWTA 3V78A 5IPAA 1NK3P 3FIWA 4UUSA 1IRZA 5C44J 4GFBA 2M2EA 3VW0A 4MIMA 4FISA 3RKQA 1SGMA 1FIAA 3PPBA 3OSGA 1MBFA 5IP9J 1JKOC 1AHDP 3BRUA 2EQRA 2LR8A 2R5ZB 3T6NA 1U9OA 1GUUA 3QPSA 1SANA 2QCOA 3QPLA 5C4XJ 1IV6A 1VI0A 4X6AJ 1H8AC 2VUMJ 1MBHA 5M5YJ 3F1BA 2HDDA 4HKUA 2WV1A 4DYCA 2WB1N 3ANPA 3LWJA 2JA5J 3BTCA 1JGGA 3JRAA 2ELKA 3S5RA 1H89C 4V2GA 2HXOA 1GV5A 2JN6A 3CMYA 3PO3J 1ZR4A 1TWGJ 4A3LJ 3Q0VA 5GPAA 3GBGA 4AF5A 2W53A 2XSDC 2ME0A 4CYCB 2M0CA 3BNIA 1U8BA 4DW6A 3ZQIA 2EZHA 3HGYA 4EEFG 4G12A 3HDDA 2O7OA 1LE8A 3HM5A 5J1UA 1IDYA 2OERA 4MFDA 1HLVA 3S15J 3BR5A 3HKZN 4PXIA 2E2JJ 1RKTA 1AU7A 2W48A 1JKRC 1ZTRA 3JR9A 5E3NA 4XIDA 3EGQA 3VVYA 4L62A 2Q24A 3WHCA 2X48A 3M3YJ 1RPWA 2ZB9A 5IP6A 5FKNA 2LP0A 1ORKA 2YUSA 2ZCXA 5FLVA 2G0EA 2JJ7A 3W6VA 3SDGA 2IBDA 3HIMA 3ZQLA 3FRQA 2Y9YA 3TW7A 2LK2A 2DA7A 1IG7A 2CUEA 2ECBA 3E7LA 1K83J 3C2BA 4A93J 3VVXA 3RD3A 5F1JA 4M3GA 2O7TA 4B3AA 2M34A 3IV5A 3BTIA 3HOVJ 4RDUA 3BR3A 5IOZA 3IH3A 2DMTA 4MO7A 2QKOA 4Y52J 3ON2A 4MK6A 2G7GA 1XG1A 1MNMC 5DAJA 2YVEA 2NVTJ 1P7IA 5HSZA 2RAEA 4MLOA 1ETVA 3VPRA 2E2IJ 3S1QJ 1HF0A 2HI3A 1I50J 1TWAJ 2F07A 2REKA 3GEUA 3HE0A 5EGOB 2G7LA 2M9HA 3BR1A 1X2MA 2DA2A 2LLKA 3C07A 4M3DA 3EUPA 1YRNB 3JRFA 2DA4A 2MGQA 1FEXA 4W97A 5FLMJ 1FJLA 4LOCA 1O4XA 3NXCA 3LHQA 1TWHJ 5J1YA 2LFBA 2G7SA 5K58A 3F0CA 2YVHA 5M5WJ 5IOYA 2XB0X 1K61A 2E2HJ 1NTCA 2R7ZJ 4M3FA 1B72A 1BW6A 1IGNA 3JRHA 2DMNA 3QBMA 4DYRA 3RZDJ 5C4JJ 1IC8A 3K2AA 1S7EA 4ICHA 3KKCA 4FE4A 4QSHA 2K9NA 2NVXJ 4IHWA 4JX5A 3P9TA 3CCYA 5EG0A 5JLWA 3S1MJ 2DG8A 2VI6A 4C3JJ 5IYCJ 5EDNA 4MFEA 5FKMA 1B8IA 3M4OJ 2O9LA 2XGDA 4D7MA 3TW6A 1Y1VJ 1AKHB 1QRYA 3RZOJ 5M5XJ 2MG4A 2FX0A 4DZJA 4XK4A 3LNQA 4A3CJ 3HTJA 1X58A 3JRDA 2DG7A 1MBGA 2JA7J 4A3MJ 1JUSA 2EZLA 3KKDA 1QVTA 2HOTA 3H3VK 1LFBA 1WH7A 3OSFA 2OI8A 2HOSA 1I6HJ 3NI7A 2GLOA 3NPIA 1D5YA 3OIOA 1ITYA 2K9SA 3HOXJ 1A6IA 1MH4A 1JKPC 2H1KA 2FBQA 4W1UA 3JSJA 4XRSA 3VUQA 3G1OA 2R5ZA 1IJWC 2ZCNA 3OOUA 2QIBA 2FJ1A 5FKLA 2EBIA 2UXHA 2LY9A 2Y9ZA 1ZK8A 2Y31A 1WI3A 3BG3A 5CW8A 3Q3SA 3HTHA 3GTQJ 1CQTA 3ZOBA 3GZIA 1JTXA 3CDLA 5M3FJ 5F0HA 2GENA 5E3MA 1T33A 4A3GJ 3HOZJ 1ETYA 3GTJJ 3RQIA 1JT6A 4B1RA 3FKIJ 3MVPA 2TRTA 3HGGA 5FHPA 1BW5A 1WGXA 5EFYA 3Q0WA 4A3EJ 1ENHA 3JRIA 3PO2J 3JRGA 3BTLA 3HTAA 1ETQA 4CYCA 1ETXA 3KNWA 3QKXA 2L7FP 3LSJA 5E3OA 1FTTA 2M8GX 1GVDA 4XRMA 1OJLA 1JUPA 3LOCA 2CQXA 4AC0A 4NELA 1GV2A 2E1OA 3BJBA 3NRGA 4NN1A 2MW8A 3MN2A 2IAIA 3BG5A 4B4CA 1X2NA 3VP5A 1OCPA 4GCTA 1QVUA 3FK7A 4ABZA 3S17J 2QTQA 1HOMA 1MBEA 1OCTC 1POGA 1IDZA 4AUXA 3A01A 2LTPA 2AHQA 5FGLA 1APLC 2ID3A 5C3EJ 4JKZA 2K40A 2MSYA 2XB5A 2VKEA 1UG2A 2DJNA 2DMQA 3VW1A 1LE8B 3B81A 3BR6A 3O8HA 3A02A 2D6YA 2NVQJ 2N8GA 2EH3A 2PMZN 2WUIA 5K7FA 3GTOJ 4A3FJ 1JKQC 2R0QC 4A3JJ 5JLXA 2COBA 3AQSA 3GTGJ 4ACIA 2ID6A 5EGOA 3S14J 3BTJA 2UXPA 1ETWA 3IH2A 4NDLA 4UUTA 3B6CA 1UI5A 4A3DJ 1FIPA 4JX6A 5IYBJ 3VOXA 1YRNA 3JRCA 2LKXA 1RETA 2O8KA 2X6OA 2L9RA 4BBRJ 1ETKA 2R5YA 2OPTA 1JTYA 2JWTA 3BR0A 2UXOA 4L5EA 2CUFA 1VF9A 5DS9A 2JK3A 2NP3A 5EEAA 3QQAA 2ZOYA 3RH2A 3BT9A 4D5CA 1TWFJ 3G1LA 4BXXJ 5M3MJ 2DN0A 2UXUA 2EZIA 3L1PA 1HDDC 3WHBA 1PUFA 2YU9J 4BBSJ 2EZKA 2NS7A 3COLA 5C4YA 1GT0C 4JYKA 1ZR2A 1W0UA 2VPRA 2NS8A 4YZEA 4FCYA 4QIWN 2NOGA 1U78A 2RASA 1F36A 4BKXA 2CRGA 3VVZA 2AO9A 1W0TA 1VNDA 1HDPA 1Q1VA 4GFKA 1AKHA 5FKOA 2RHAA 5HBUA 3DCFA 4C3HJ 3I4MJ 4X1EA 4BY1J 2HKUA 3HB9A 2XGCA 5F0FA 4DZPA 1JJ6C 3BQZA 5GPCA 1JJ8C 1BA5A 1TWCJ 4ME9A 3GTMJ 5D18A 2HQ5A 2X9DA 5GP9A 5BNGA 4C3IJ 4M6VA 5EF6A 4BY7J 2P81A 4HNVA 3E7QA 3BCGA 2B63J 1Y1WJ 2E19A 1DU0A 3CJDA 3LSRA 2LVSA 5DTDA 5F04A 3MKLA 5D1RA 2XPWA 1ZKGA 3GTLJ 5EZGA 4J19A 1MH3A 2G3BA 2Y0SN 1A5JA 4UUSB 2PZ9A 1XC5A 1T56A 3GTPJ 4JL3A 2OF7A 1GDTA 1TC3C 3I4NJ 3D1NI 2FQ4A 3FISA 2ME6A 5FJ8J 5IYDJ 4IHYA 1ETOA 3Q0UA 1Z77A 3FK6A 2I10A 2DA1A 1ZGWA 2KDZA 3ANGA 3AQTA 2KT0A 2DTZA 4GCLA 2XPVA 5J1RA 1R9TJ 4RBOA 4AYBN 4UDSA 2XPUA 1MBKA 3A03A 3S2DJ 5K7ZA
chains in the Genus database with same CATH superfamily
1O57A 1F43A 3F9KA 3LA2A 4P1WA 4RAFA 1ZRFA 1H9TA 1E3HA 2K02A 4EJVA 3NAUA 1XMKA 1HSJA 1D0YA 2BXYA 4CCKA 1FOWA 3WTZA 4Q5SF 2R7VA 3DPJA 5JVTA 4RB3C 3D5LA 1FZPB 4CSWA 4OIPF 1IN5A 3HBLA 1C0WA 2CQQA 2FNAA 3RTRA 3ZCOA 1BL0A 3JAMK 2X6YA 2XKPA 3FMRA 2LKSA 1T8IA 3K7AJ 1RKWA 2K3PA 2LOOA 4I76A 5HODA 2HS5A 1MDMA 3DTIA 1GXPA 4BUPA 2W57A 3RQ4A 2XC7A 4C2MJ 3SFIA 2ZSHB 4KYWA 3H0GJ 2M30A 3BHQA 1ZG1A 3W3CA 4E7IA 1R00A 1USTA 3FXUA 3K10A 3A01B 3HRMA 2HVRA 3KZZA 2ZMEB 3CRJA 3M1EA 3GZ5A 3ABUA 4I7HA 4ZDLA 2D2WA 4I0AA 2Z33A 1FX7A 1I6XA 1E3OC 2M87A 1I3QJ 1R1VA 1SAUA 3FMSA 1TNTA 1XGSA 2VC1A 3R60A 3HHHA 5D6EA 2O5RA 2TCTA 1D5VA 4II2A 2ZY9A 4Y15A 1ONVA 3FBIB 2QOPA 2BOLA 5CJ9A 1OPCA 3CUQB 3JTGA 1KU3A 3FF5A 1ZLKA 3JRBA 3MD2A 2Y69H 2PG4A 2PMUA 3LFKA 5EZHA 4Y7NJ 4HLYA 3ECOA 1BC7C 1I3AA 4JBAA 2JRMA 1FT9A 4A69C 4L0YB 5HNHA 1WPKA 2R5YB 5CXGA 3FM5A 4KT5C 2B3WA 3FXLA 3LAJA 3IUVA 1YIOA 1NG6A 2HDCA 1XGOA 3E5QA 3W2VA 2M0MA 2D1HA 1WH5A 3BG9A 3NWSA 2ETHA 2DOEA 2DMPA 1HCRA 1T95A 5J4VA 3ASNH 2JMWA 2NNNA 2QM3A 3FXJA 4KIBA 3VFZA 1S7OA 2M5WA 4RLQA 2JA8J 4CXFA 4Y4RA 1MMNA 5F27A 3DBHB 4A0ZA 3SYTA 2CU7A 4RM2A 3A0HC 2FD5A 1B8IB 3GFLA 3DWLE 2L2OA 2OU2A 1IN8A 2QSGX 1UI5A 1Z91A 4NNJA 1YX5A 2A6HF 1DU6A 4HSTA 4MGRA 3WG9A 2V9VA 1BI0A 1EF4A 1IW7F 5IT3A 4BDZA 3JTHA 3DEEA 4LG0A 1JUMA 4ENMA 4BQAA 2V9PA 2QWTA 3VIBA 1NK3P 3FIWA 1Y8QB 3H3UA 4BGDA 1IV8A 2F5FA 2Y48A 4GFBA 3VW0A 3RKQA 1SGMA 5GADJ 3SZTA 4D0PA 4JOMA 3OR2C 1F1ZA 4A6EA 5E18F 5J4YA 2EQRA 3QPHA 3HRUA 1U9OA 3CCSI 3V7SA 2EIMH 3RPQA 5C4XJ 1H0MA 1VI0A 4XKVA 1Y0NA 3U1KA 2CW8A 1H8AC 1SFEA 3GFJA 3KLOA 5M5YJ 3P7NA 3GO5A 1LEAA 5DCMB 2WB1N 4CYDA 2DAOA 4G8XA 1W36D 1SAXA 2R7FA 2K9LA 2HXOA 3COAC 1YS7A 3PO3J 1YLFA 1ZR4A 1VQKI 2ZXHA 4N4NB 5B66C 2ME0A 1Z21A 4BU2A 2M0CA 5E8GA 5FROA 1QGPA 5EJCA 2NNYA 1VQ9I 2L4AA 3HDDA 5LEKA 3EUHA 3I53A 2X51A 5J1UA 4TV7A 1IDYA 2V4JC 3R61A 3BR5A 3OS2A 3OL4A 3KX2A 3K70D 4XIDA 3VVYA 2X48A 3M3YJ 2OC6A 3CC7I 2LP0A 2XAUA 2YUSA 5K1YA 2G0EA 1NG7A 2JJ7A 1U2WA 2OBPA 2IBDA 3HIMA 2R3SA 5A2QK 2Y9YA 2VE9A 3ZQLA 3FX3A 4LFUA 1WFXA 3WODF 2CUEA 3I5UA 3ZMZA 2ADUA 4I2OA 5F1JA 2O7TA 2NVUB 2M34A 1R1TA 2LC2A 3HSEA 4RDUA 1X19A 5D5WB 1MDMB 3FM3A 1YI2I 2V6EA 3LMMA 5HSZA 2NVTJ 4EJTA 2BGCA 1ETVA 3I54A 3VPRA 2E2IJ 2HI3A 3M1CA 4HAMA 2JUCA 2IT0A 5E17F 2REKA 4CA0A 2M7BA 3OR1C 3I71A 4XOTA 5D6FA 4HRIA 3CJQB 1VQ6I 1O3RA 1WRJA 2E60A 1KZHA 4M3DA 2IXSA 3ZXSA 2EA4A 3ERMA 4ETSA 2ACJA 1FJLA 1DP7P 3N4MA 5J1YA 2EFNA 2LFBA 5K5RA 4YFKF 3QRFF 3QP5A 2E2HJ 3GZNB 1NTCA 2Y0MA 4CO8A 1BW6A 3RKYA 1IGNA 3RZDJ 5C4JJ 5DCFA 1BR2A 1OYIA 2B0LA 4DNCA 2QUFA 4QSHA 3V8KA 1ZN2A 3KP5A 3P9TA 1VQ5I 3F8FA 3QWLA 2KZVA 5JLWA 5CVVA 3MWMA 2XUBA 4OOIA 4N0BA 5DD8A 2HKXA 1TLHB 4UXNA 1SD5A 4EATA 1YOVB 2E1NA 1Y1VJ 1J2XA 2Q0OA 4E6KG 2ZJRF 4LLNA 1QRYA 2DQLA 3RZOJ 2RGVA 4I98B 2E35A 2BYVE 2DG7A 2DT5A 4AIKA 3KKDA 1DPRA 2VIXA 4EJOA 4Q4ZF 3OSFA 4BQNA 1EH7A 3EUAA 4B48A 5DD4A 2HOSA 3A4CA 3NPIA 4ESFA 1D5YA 1ITYA 1A6IA 4PK4A 1JKPC 4U7DA 2FBQA 2X6XA 3TDUC 5LRSA 3GFIA 1M1EB 1WWXA 3VYUB 3CLQA 2ZCNA 1IJWC 3HKZA 2ESNA 2OQGA 3V42A 5FKLA 2UXHA 4ZYAA 2L9SA 3FHNA 5B5EC 2CUZA 3Q3SA 1Z3YA 1JTXA 1PVEA 5M3FJ 5F0HA 1FYLA 5E3MA 2EPFA 4MTEA 3HOZJ 3KPHA 1ETYA 3K1MA 3F6VA 2FQ3A 3FKIJ 1LPQA 2TRTA 3HGGA 1QO0D 2VASA 3E3VA 4A3EJ 3LSIA 3JRIA 2ZXIA 3JRGA 2BW3B 3SDBA 3I56I 2CUJA 1OCRH 3QKXA 1FTTA 1GVDA 5ICGA 5HLGA 4XRMA 4ESJA 1YJNI 3ISPA 1ZRCA 5HS9A 1FOKA 3LSMA 4RLFA 3LOCA 2R7SA 2L3DA 2HVSA 1HQCA 1X1BA 2CYYA 2E1OA 2LY1A 3BJBA 1YITI 4PJNA 2IGOA 3AL0C 4B4CA 3VP5A 4AWXB 4IOAF 2E1CA 1OCPA 1P9QC 3FK7A 4EM0B 1OCTC 4AUXA 2QBYB 2R7QA 2DK5A 3CD6I 2ID3A 4JKZA 1FMWA 1X1PA 4LGWA 2VJ4A 4V19K 2BHZA 4G6TB 1I27A 2K3FA 3MZYA 4EMSA 3VW1A 3OS0A 3HRTA 3TOBA 1ULYA 4WCGA 1V3FA 3A02A 2CS3A 3A2KA 3MAJA 1D1AA 4IRGA 1UHMA 4A3FJ 1JKQC 2R0QC 1R4NB 3QAHA 5JLXA 5HVQC 3AL0B 3GTGJ 4ACIA 5EGOA 4NDLA 4PDKA 4UNOA 2LMDA 4A3DJ 1NH3A 1YRNA 1K7AA 3JRCA 4A0XA 2WC2A 2HFHA 4IHSA 2O8KA 1K6YA 1KA8A 1FP2A 3HPHA 2VOOA 2CUFA 1VF9A 2NP3A 1LDKB 5EEAA 2CH0A 1VQ8I 4KN7X 2CW7A 2G9WA 3K69A 4U0VA 2ZOYA 4MTDA 3RKWA 4LK1F 1KYZA 1HSTA 2M3AA 1QHGA 2V7FA 3BJ6A 5M3MJ 2DN0A 2B9SA 4IPAA 2UXUA 1HDDC 2GXBA 1GT0C 2H94A 1G4DA 1ZLJA 2PJRA 1ZR2A 2NRAC 4I09A 1WJ5A 2VPRA 1TQIA 2NOGA 1F36A 4BKXA 2CRGA 4UVAA 5CQEA 1S7AA 1VZ0A 2AO9A 4YFXF 2PI0A 4LB6B 1W0TA 3E6BA 3ZN1A 1AKHA 3CMMA 5FKOA 4IXAA 4RB0A 2Y75A 5KNLA 4IQJA 3DKXA 3I4MJ 4HEA2 4A2UA 4DZPA 1JJ8C 4BH9A 5GPCA 5DM7F 2XAFA 1YJ9I 5D18A 2YR2A 3GW2A 3M9AA 3VTIA 3EPZA 3PUFA 2RNJA 1DQUA 3H5NA 5GP9A 4DVYP 1SVOA 4A6DA 1YTYA 3PNYA 2WAEA 4PZJA 4BY7J 1OCCH 2LF8A 2IJLA 2X6WA 1JE8A 4ANJA 1HKQA 2EA2A 1Y1WJ 1I39A 2OZUA 5KCMA 2A07F 3W2AA 1IXCA 5DTDA 1TTYA 3LQQA 1OLTA 5CVJA 1KU2A 1N77A 4HSRA 2R7DA 3R6SA 2O3FA 1I1SA 1XC5A 1W36C 5CVRA 3L2CA 4HDUA 4JL3A 2OF7A 3BOQA 5D4SA 1GDTA 1TC3C 3I4NJ 3JW4A 3FXQA 2FQ4A 5IYDJ 5FO5A 3CCJI 1FC3A 3P5JA 4XN0A 1A6QA 1Z77A 5LEJA 2EB7A 4L0ZB 1G3YA 4FHTA 5CPRB 3WG7H 3C2GA 4BHBA 4AYBN 4GDFA 4UDSA 2KJBA 5HS7A 4XSZF 4CZZA 1A35A 4IEJA 1ERDA 5FKKA 1TW2A 1Q1HA 5IT9Z 3EUKL 1A04A 1P4XA 3HL2A 2DLLA 2ZNZA 4XRSG 3X2QH 4XLNF 3ZMTA 1AA7A 1VQLI 3O8GA 2EFPA 1BOAA 5F08A 2BE5F 3S32A 2IGKA 5KK1A 2F5EA 4OINF 4P55A 4DYQA 2YS9A 1G2HA 1LDDA 2WGBA 1H9GA 2CGPA 1B9NA 3IRRA 1S29A 1B1BA 1P2FA 1W5TA 4LIVA 5H2FC 1X1AA 2AQFA 2Q2EA 2P6SA 2KFDA 2J5OA 5CXIA 3CCUI 2IEKA 5CYVA 3REOA 1S8NA 4QWQA 3LJLA 4HQEA 1G8XA 3G7RA 2DA5A 2MD0A 1IN6A 1MNDA 2HYJA 5ERIA 1S72I 2K9QA 4D7NA 3E5UA 3MKZA 1ZAOA 2XGEA 3DKYA 4N4OB 1IF1A 3HTIA 5HS8A 2AXTC 3TP0A 4HG2A 2FXAA 4FX4A 3OIQA 1REPC 1SMYF 4MEYF 1ZQ3P 1B9MA 1D1CA 3MNLA 3J81K 5J8FA 2Z3YA 3F8CA 4PFPA 2DMUA 2ZKZA 2FBKA 3ONQA 5F0CA 5DM6F 4CGRA 3ON4A 2VLAA 3S1RJ 2WAQN 4M3BA 1FOYA 2G7UA 1U9NA 3V4GA 3BR2A 4BEHA 1SD6A 2GIZA 2NP5A 3N05A 5HLHA 2CG4A 3DPLC 5CKTA 5EYRA 3HOUJ 3KZ9A 2L7MP 4A3IJ 3J7AY 3OYJA 3CZ6A 4I0BA 3TOAA 3SJMA 2OV7A 2E71A 4NUBA 2PBXA 3PQKA 2DPDA 2RVCA 5E20A 3CWRA 3NWTA 1P92A 3AG1H 1UMQA 3OYMA 1XMAA 3BZCA 3PNVA 4RA2A 3VSLA 3OYHA 4G7ZF 3J80Z 3UKGA 2RN7A 2Y30A 3G56A 2Q8KA 1RR7A 4BL0B 5EG0B 4I01A 1BJZA 3KIOA 4FE7A 3I64A 4G9YA 2GUHA 1WQ2A 3CQZJ 2VBZA 3NARA 2JT1A 3TO7A 2KZGA 2RNGA 2GBYA 1YS6A 2HOAA 5BPIA 2COMA 3BPXA 3SXYA 1WSUA 3IWZA 1OR7A 2Q1ZB 2YVXA 1MBJA 2AQEA 4IQ4A 4DBQA 3DF8A 4MQ9F 1R6RA 3E1SA 2JA6J 3AG4H 3G6EI 3L2WA 2NOJB 2K86A 4OIQF 4KJZA 5B1BH 4OMYA 4UUSA 5FD6A 2L7KA 1MZBA 1ON1A 2YX7A 1JGSA 5C44J 3WTUC 4MIMA 1FIAA 3H92A 3VYTB 2XIGA 1R5HA 3CJRB 5IP9J 1S9HA 2OAZA 4OAYA 2QWWA 2HZTA 4DIQA 1SANA 1QNTA 3QPLA 3GF2A 1YJWI 4A0YA 2LREA 1HKSA 2DPUA 3F1BA 1OISA 2Z99A 3J7YJ 1IO2A 4HKUA 4AIHA 3L9FA 4E7JA 2OCEA 1QQIA 3GEZA 4DYCA 3GVAA 3LWJA 2JA5J 1IN4A 4KIFA 3R0AA 2UXNA 3M7GA 3JRAA 2LF7A 1BC8C 1H89C 4V2GA 3IC7A 1GV5A 3GLXA 3NS4A 2PN6A 3CMYA 3J80K 2L4MA 1TWGJ 3HUGA 1QZZA 3Q0VA 2E5ZA 3KEQA 4D1QA 2W7NA 2R7XA 2E7XA 2XSDC 4BHCA 3ZQIA 5J6XA 1K4SA 1MD0A 1AWCA 4G12A 3ZN0A 2O7OA 2M1BA 2KLOA 3LFUA 4MFDA 3DQVC 2NXNB 2XASA 1RKTA 2W48A 1JKRC 3JR9A 1XSDA 5E3NA 4IRIA 4GXOA 3IHUA 2PX9A 3H0DA 2RQQA 2ZB9A 3BJAA 1BI2A 2MC4A 4CUGA 2XROA 1ORKA 2ZCXA 2FNPA 2F2EA 2LDUA 2J5PA 2ZJQF 1HXDA 3TQNA 1QPMA 4CCJA 2R4GA 4LG3A 2DA7A 1IG7A 2W00A 1TP4A 4OAZA 1K83J 3ZPLA 4ON0A 3RD3A 1XGNA 1KONA 4B3AA 1YW9A 4B09A 5FB2A 4UB8C 5DUKA 3IH3A 2DMTA 1WJFA 4MO7A 2G7GA 1XG1A 5DAJA 1P7IA 4MLOA 2VKHA 5ICFA 3VEPA 1HF0A 4L9NA 1SFKA 3GEUA 3BZ6A 3HE0A 3WTVC 4GYIA 3V8JA 2M9HA 2ZO4A 1X2MA 3BR1A 5E1XA 5JI6A 5TRDA 2DA2A 2EILH 3EUPA 2E36A 3JRFA 2ESHA 3WGGA 2MGQA 2VE8A 4OU0A 2XV4S 4Q47A 3ZMSA 4C2UA 3LHQA 2VT2A 4RGXA 5GTIC 4BJTA 1UFMA 2VJJA 4F7ZA 2G7SA 2YVHA 4QPQA 2KPMA 2PMHA 1XPXA 2Y0SA 1WHUA 3CP8A 3F21A 2KIUA 5FFZA 4XLPF 4KISA 4M3FA 1B72A 4R8HA 1T98A 3OWTA 3EYIA 5LGNA 1HW2A 1X3UA 4BEHB 1IC8A 2ZJ2A 4AD9A 2EFWA 3GCMA 2K9NA 3ABKH 2NVXJ 3QU6A 5KHDA 2ZFUA 1CGPA 3ZMDA 4IVNA 3VDXA 4C3JJ 3HC7A 5IYCJ 3ABTA 2ZJPF 2HQNA 1OR7C 2XGDA 2XSJC 3TW6A 1YFHA 2ZNYA 4XBFA 2WB1A 3M8EA 4XK4A 3HTJA 4OIOF 2M4GA 5B1AH 2ISYA 3CF5F 1JUSA 2EZLA 1W1WE 3DEUA 3H3VK 2YX4A 3IKTA 3NI7A 2IA1A 3K6GA 4ZYGA 2GLOA 1HW1A 1EKEA 2QQ8A 1XMXA 1LQ1A 3EYYA 4NC8A 1UJ8A 3CJTB 2R5ZA 4KUMA 3OOUA 5CVUA 5CVIA 2FJ1A 3BG6A 3ZP5A 1GVJA 3I4PA 1W7PA 3IUOA 4UHTA 4D9JA 1ZK8A 2Y9ZA 4XM3A 1ZRDA 3IP4B 2F6CA 5BOXA 1CQTA 2CQKA 5E1ZB 3GZIA 3CDLA 1Y8RB 1TBXA 2X1CA 5DV5A 3HZJA 3NEUA 1IRXA 2VXZA 3GTJJ 4B1RA 3DTKA 3MVPA 3KCCA 2GXGA 4WXDA 1BW5A 1HC8A 2CFOA 2XVCA 3BLYA 1WJEA 2O6GE 2ZXWH 4NC7A 4CYCA 3KNWA 2IA2A 2L7FP 2ICWG 3E0JB 5E3OA 1VQMI 1R36A 3FMQA 3G71I 1OJLA 3BWGA 1XB4A 1YE9A 3LSKA 2QGUA 2H6BA 4NN1A 5IY5H 4X0GA 2DTRA 2MW8A 3MN2A 1LJ9A 3I0TA 1V54H 5H6QA 3DPUA 2WY7Q 1QVUA 2A6TA 2HQRA 3I59A 3HUGB 4NQWA 1U3EM 1KU7A 1HOMA 1POGA 1IDZA 1R5ID 2BV6A 3K2ZA 3QU3A 3HJEA 1FNNA 2K40A 2XB5A 1XX5A 1UG2A 2O0YA 2P6TA 2VKEA 4YIFA 4CCLA 4Z2YA 4H0EA 2V1UA 4QPOA 3B81A 4PGGA 5DDGA 1E0EA 4PJ0C 3LL7A 3OY9A 2D6YA 4XORA 2L01A 2EH3A 2PMZN 3HSFA 2IS6A 2WUIA 5K7FA 3R0JA 2VQLA 4E7KA 3HTSB 3TMOA 4HZFA 3AQSA 1EH8A 5ICCA 2ID6A 3S14J 2UXPA 1BI3A 2Z9OA 2H6CA 3B6CA 4XKWA 4ENJA 2XF6A 3LA7A 2DOFA 1RETA 1IZ1A 2X6OA 3O6BB 2FUG2 1J9IA 2HDWA 1JTYA 2OPTA 3BR0A 3FZVA 2KIQA 4R1HA 1OCOH 2JVHA 4FASD 5DS9A 4YIRX 3CCEI 4MQVA 1UZCA 2L5QA 3KP6A 3FXKA 3QQAA 5JVGF 4PGHA 3MZ8A 1J75A 2FMLA 4BXXJ 2JPCA 5BPDA 1PUFA 1JI8A 2EZKA 4PJMA 5C4YA 2GIVA 4LJZF 2X85A 1W0UA 4ZDOA 3W6JB 1DUXC 4FCYA 4QIWN 1U78A 3OYFA 3RPUD 4IO9F 4M6XA 4KFCA 2GQQA 3SHFA 5F6FA 3CC2I 1PP7U 1Q1VA 4GFKA 4LLGF 2AS5F 3IWFA 2A5WA 3I58A 3KZIC 3AKZA 3V8LA 5HBUA 4CHUA 2VT3A 2OD5A 4I02A 3WU1B 4RGSA 1BA5A 1JHHA 2XGCA 5F0FA 3B02A 1VQ4I 3GTMJ 3H9JA 2HQ5A 3HIFA 2CV2A 2X9DA 2GA1A 5BNGA 5GAEJ 4HNVA 2PFVA 1E3PA 2IVMA 4U88A 2E19A 2HR3A 1OMIA 1TNSA 4CZCA 5H6RA 2LVSA 1R4MB 3M8FA 1OQYA 3KFWX 4KN4X 2Z16A 5D1RA 3J7AO 1ZKGA 1N78A 2DDBA 4DJAA 2Z5UA 3E97A 5KAFC 4C2TA 2X0LA 4LG0B 2XAHA 4CGZA 4XN3A 5BQTA 1BIBA 1WI9A 4O3MA 1V5GA 1Y6IA 3D5RC 1XSVA 4OD4A 4KIGA 2L02A 1MMSA 2YU3A 1ETOA 2OTLI 3HRSA 1HW5A 2DA1A 1ZGWA 2GAUA 3ANGA 3W2WA 2STWA 2KT0A 4DGWB 2KP6A 2QLZA 2DTZA 5EEGA 1W7PB 2GWRA 1DGRM 3FKJA 3GFMA 3PNTA 5ILUA 5J1RA 1USSA 3WGIA 5HLTA 1ZARA 2VPLA 1TW3A 3WTYC 2XKOA 4HW0A 3GX4X 2CO5A 2FBIA 2XRLA 4BJ6C 1MW7A 3SZPA 5HNFA 3G2BA 5EEHA 4GFLA 2M8EA 5ILSA 4XLEA 3ZQ7A 2ZSIB 2A3SA 3I9V2 1ZG5A 4A3KJ 1MSEC 4LITA 3KP2A 3SFZA 5HAWA 5L3FA 1WKMA 1Z67A 3ZQHA 3IL2A 5AIQA 4E7HA 3VOKA 2JTVA 2K4BA 1P4WA 2PEXA 4I6ZA 2UXXA 2ZBKA 3KZYA 3VB2A 3RYPA 3S1NJ 4EJUA 1R49A 2K9MA 3CJNA 2QSHX 1OFCX 3IH4A 3PM1A 1PP8F 3S16J 1JXSA 1WCMJ 3DKWA 1SFOJ 3H1CA 4NQWB 3ZGKA 1STZA 1YYVA 4ZZLA 3ZQGA 1MMAA 5TISC 4R79A 2JPBA 4HPQA 2Z1DA 4HLXA 3ZRGA 3OYIA 2L7ZA 4JQFA 3IRQA 1U5TC 3VW2A 2DFHA 3HOWJ 3CCMI 3HOTA 3SQNA 3HOYJ 3LSTA 2WV0A 2XHKA 2W25A 3MFKA 2LD5A 4HYEA 2MLGA 4M73A 3SEQA 3ZMVA 2HXIA 2LBFA 5BMZA 2H8RA 2DA6A 2JRTA 4XLHA 4XNFA 2HKOA 1FYKA 3PASA 4BXFA 3PIPF 2FF4A 2WAFA 5E3LA 4UV9A 1B59A 5LHIA 3ELKA 3Q5FA 3P9KA 2XRNA 3ZQCA 3OOPA 2QEXI 2NX4A 2W1OA 5AIPA 4E4HA 1QBJA 4XKBA 4OMZA 4U0WA 3JREA 4XRFA 4E7SA 4NBQA 3H3ZA 5JR3A 3DBLB 1GHCA 3DBRB 1N75A 3U1DA 3FBNB 1PUFB 1QPIA 3V6GA 2VBWA 2BY1A 1XDUA 4II3A 3LSGA 5LD2C 5FMPA 1RESA 9ANTA 4BS9A 2GM4A 1XN7A 2HYTA 4ASNA 4HNUA 3WTSC 2CJJA 4JP0A 4AYBA 4ZYHA 4AIJA 1UI6A 2HWVA 1VFCA 1B4AA 2E1MC 4XICA 4U9LA 3P9IA 1XTAA 3V7RA 2R92J 2AXLA 3H5RA 3GTKJ 1Y0UA 3OYCA 1K79A 2VBXA 1JHFA 2UWMA 1R5GA 1TL8A 2LNBA 2M2EA 4DOZA 2JSPA 3QODA 4KT6A 4BXUA 2WWYA 4ZTFA 3PPBA 2OZ6A 3BC8A 4LD5A 3OSGA 1JKOC 4XSXF 4AU7A 1AHDP 3BRUA 2LR8A 3T6NA 1GUUA 5J47A 3QPSA 1AOYA 5J40A 3S93A 4X6AJ 3I55I 3BY6A 2IGNA 3E5XA 3PJRA 4ZYDA 4KNYA 1W4MA 3K70C 3JCUC 4EJWA 3ANPA 5HDGA 3BTCA 1FP1D 4WXCA 3S5RA 1U8RA 2ELKA 4Y13A 3M07A 3A1YA 2XF5A 3T8TA 2P5LC 4ZZDA 2KISA 1LVKA 4A3LJ 4JK1X 3OMYA 5GPAA 4P9FA 2BVMA 1UG0A 2W53A 1R58A 2OUMA 4ZH4F 3BNIA 5K5QA 4O5VA 2EZHA 1FMVA 2DXIA 4GGGA 2WAQA 2OCCH 4ENKA 3VSKA 3Q9VA 2OERA 1HLVA 1RRJA 4PXIA 2W82A 2E2JJ 1AU7A 1K6OA 3CO6C 2VQCA 2L54A 2EV5A 2DODA 4M6YA 1EA3A 1RPWA 4LIUA 5D4RA 4RM3A 5FLVA 3FDYA 1K4TA 2JQ7A 4BAYA 2MH9A 2MYSA 3TGNA 4E70A 2IGMA 3LWFA 3UR3C 3FRQA 3TW7A 1WJAA 2LK2A 1YIJI 1LB2A 1SFXA 2ECBA 3E7LA 4PJJA 3C2BA 4A93J 4M3GA 4HOBA 2DQRA 3PQJA 4B8XA 3IV5A 3BTIA 3HOVJ 2EWNA 3BR3A 3L7WA 3P9CA 3F23A 4IRVA 2A61A 1FBSA 2OQRA 1CF7A 4Y52J 4U87A 2GA2A 2CV0A 3ON2A 1FPQA 1RIOH 2YVEA 4GO1A 1X3WB 3S1QJ 4MNUA 3CUQA 2LRDA 1TWAJ 5KAIC 2F07A 4IKFA 5EGOB 2G7LA 3E6DA 2LLKA 4YEJA 1J09A 4B43A 3C07A 3OYAA 1YRNB 1FSHA 2DA4A 2VJ5A 5IT9K 1FEXA 4WK8F 2QQ9A 4LOCA 3K4KA 3T5XA 2RQPA 1TWHJ 4IHTA 2JSCA 3T8RA 5K58A 2DW4A 3F0CA 1WJCA 1A36A 3OYDA 2BXZA 1SEUA 1HKTA 4YIIA 4CH7A 2XB0X 5IOYA 2L9NA 5DUIA 1D1BA 2BZTA 2YPRA 1K61A 2P7VB 3RDIA 2FSWA 1VQNI 3WTXC 3JRHA 2F4OB 3KYLA 2CV1A 3K4LA 2PJRB 1S7EA 2LY2A 2GZWA 3HTUA 4IF4A 3LQRA 4IJAA 2HU9A 4FE4A 4BQQA 2PLYA 4IHWA 4JX5A 4H4KC 3OS1A 5GAGJ 2STTA 2VONA 2V1XA 4UY8I 1MMDA 2VI6A 4S05A 2DG8A 1WVRA 3KEYA 1B8IA 3Q9SA 3HPGA 3OYBA 1AKHB 1MMGA 4EGYA 5D5UB 3L2QA 5M5XJ 2MG4A 5L3BA 2FX0A 3LNQA 3K1PA 3K0LA 1X58A 3JRDA 2HNHA 3MZHA 2DYRH 1MBGA 2DK8A 4L18B 2JA7J 3C18A 4A3MJ 3VWBA 1QVTA 2HOTA 1FY7A 1YG2A 1ZHFA 2EJRA 2JUGA 4RAYA 1LFBA 2HZDA 4LLLA 3ZR8X 3OYLA 5L3EA 4BACA 4L9VA 2KIFA 2K9SA 1HA8A 1MH4A 1X4PA 3KYDB 3JAMZ 3S8PA 1FBUA 4W1UA 3JSJA 4M74A 5CLSA 3VUQA 4EGZA 1LEBA 1K78A 1FYMA 3C3WA 2QA4I 3N97A 2QIBA 2V1DA 2EBIA 2LY9A 5FRNA 1UHWA 3BG3A 5CW8A 3PSIA 3HTHA 1KQ9A 1PJRA 2CWEA 2F4MB 2EK5A 4PSXA 3RJPA 1T33A 1R7JA 4A3GJ 2WADA 1RI7A 2FBHA 3RQIA 1JT6A 2ZFWA 2E7WA 3CDIA 5D8KB 4P9UA 5L3GA 1L3LA 5KVRA 1WGXA 5EFYA 1ENHA 4GCVA 4FETA 2CW0F 2ZCWA 3PO2J 3BTLA 2FMYA 4FQGA 1ETQA 3HTAA 3DU6A 2DO7A 3LSJA 4BJ5C 3W6KB 2M8GX 2JZYA 3CUOA 2LYCA 1KYWA 2A05A 2CFXA 4Q48A 3EDPA 3VOEA 5E8IA 4F3QA 3ECHA 1R23A 2ZXJA 4AC0A 2VOPA 4NELA 1J59A 2M45A 1FOXA 3PL8A 5E79C 2C6YA 3NRGA 2Z2SB 4IOCF 3BG5A 1RR8C 3VODA 4GCTA 2ZMEC 4XOPA 3HG9A 1G3WA 2QTQA 2QZ8A 3TBIA 1IN7A 3KEOA 5E1WA 2R7RA 2K5CA 2FEZA 2AHQA 5FGLA 1APLC 4XLAA 5C3EJ 4WF2A 4J01A 2LSOA 3D0SA 5LRRA 4PFOA 2DMQA 2HTSA 1PUEE 2X1DA 3BR6A 3DFGA 3O8HA 4XONA 1QZYA 2NVQJ 3CUQC 2N8GA 2VQHA 5D8LB 4C9YA 3KETA 3KP7A 3MEXA 1W5SA 1DDNA 2Q2EB 3OIPA 1V5FA 4A3JJ 1LFPA 4ENNA 3H9QA 4E7ZA 3CLOA 1UAAA 4P5OA 1U6GA 4RMNA 4CCMA 2EIKH 4O6JA 3OYGA 3VOXA 1LKXA 3K4NA 2LKXA 2B1EA 2CQ7A 2X4HA 4XL9A 2I8DA 2L9RA 4BBRJ 4F91B 1ETKA 2JWTA 3FXRA 5FGMA 1QU3A 3WGHA 1KQ8A 1OYWA 1KQ0A 2BY3A 1CF7B 3U2RA 2M7AA 3BT9A 2XDVA 1TWFJ 2KQRA 2XGXA 3M8JA 3G1LA 3GUDA 2NAZA 5LFAA 4M9XA 3ROUA 3CTAA 4LK0F 3WHBA 2BVLA 3DPTA 5HOOA 1VQPI 3H5AA 2H09A 4RB1A 2GOMA 1TT5B 2NS8A 4YZEA 1UELB 3PSFA 1O7FA 4U0YA 2WY8Q 3VVZA 1E2XA 3A0BC 3H36A 4UVCA 3H9GA 3TKYA 2A2FX 2DJIA 3JSOA 2NS0A 1VNDA 4YFNF 2A5YB 2IS1A 2OTJI 3CO7C 3L2UA 1D0XA 2HGCA 2KMUA 4X1EA 5GTHC 4BY1J 3CDHA 4Z6YA 1XDSA 2XAGA 4ME9A 4PSWA 2BY0A 3L2RA 4E7LA 1RUOA 3CMEI 5BS6A 3F8NA 4K2EA 5JHFA 3SZGA 1FSEA 4C3IJ 4NHJA 4BYYA 2H27A 2P81A 3CP2A 3E7QA 3BCGA 4HQMA 2P4WA 1EV7A 1SVLA 5HDKA 4M71A 1ZREA 1DU0A 3CJDA 3LSRA 3OV8A 4BDYA 5ILVA 3ERED 3QOEA 2XPWA 5DEQA 4XMYA 4UVBA 1MH3A 4BE0A 3S3NA 2K4JA 2G3BA 2Y0SN 4UUSB 2EINH 5A2QZ 4RAGA 2BHYA 2VN2A 2P5VA 4A5NA 1XSXA 1ZG3A 1T56A 5HDNA 3GTPJ 1MKMA 4GRIA 3TO6A 4UUVA 2W24A 1NHAA 3D1NI 2ME6A 2E34A 5LHHA 1TQMA 1U0JA 2P5KA 4Y17A 3NQOA 3Q0UA 4PJLA 2I10A 3FK6A 1K78B 4ZC3A 3K4JA 1YO5C 1DPUA 3AQTA 2BW3A 4IRHA 1J5YA 5FD5A 3E6CC 2PMZA 1VQ7I 1R9TJ 4MEXF 2A6EF 3K8PC 1MBKA 3A03A 3S2DJ 1I1GA 4BNCA 1DP3A 4A3BJ 2R93J 3GLLA 1UB9A 2ZCMA 2VKDA 3BQYA 5H9TA 3DV8A 4WXHA 4KWAA 5FLXZ 1LFUP 1XCBA 3BP8A 1XS9A 2D5VA 2V57A 2B7EA 2CMPA 1EH6A 4FT8A 1BM9A 2QBYA 2VODA 4OIRF 2VKVA 4M3EA 3DTEA 5IP7J 3L09A 4HDVA 1XGMA 2QQBA 2TDXA 4HBLA 1VTNC 2QF7A 1O3TA 2D1VA 1ZH5A 1Z0XA 2MFZA 3TEDA 4DBRA 2FOKA 1W5CC 5F1RA 3K9TA 3MQ0A 3GZ6A 4LMYA 2ZOZA 1Z05A 2Y2ZA 4UB6C 2IW5A 2UXIA 1V55H 2V9KA 4IZZA 1IRFA 3LSHA 2XDNA 3VYSB 2GFNA 3C2HA 3G1MA 2XAJA 4B44A 3S2HJ 1NK2P 5CQGA 3VYRB 4QTRA 1MSFC 1RUNA 4U9NA 4HF0A 1S6LA 2EV0A 4IHVA 2RC4A 5B3SH 4P96A 1J7KA 2GOXB 1ODDA 2ECCA 3HEFA 1BBYA 1IUFA 1U5TA 4YG2F 4HX7A 1X1CA 2BEOA 2XF7A 4IHXA 3RIRA 5HLIA 2UV1A 3PIOF 2IP2A 3K4CA 3G73A 4BHPA 1RNLA 2NVYJ 4A12A 4S0HB 2P7CB 4AC6A 1YW8A 3ZQFA 1SVMA 2R7OA 3AFHA 4ZDPA 1F9NA 3HOSA 4V2FA 1D8JA 4UV8A 3OYKA 3S3OA 5FLXK 3F8MA 1X1DA 2IS4A 2O61A 4N9HA 3B6AA 2RKHA 4FTHA 4JX4A 5ED4A 1P7JA 5J3LA 6PAXA 2L0KA 1WJDA 3AAFA 4CCNA 2VQGA 3TP3A 3KLNA 2PQ8A 1FTZA 5AQCA 5D19A 4GCKA 2NYXA 2WBMA 3HXLA 3T0YA 4MXMA 1B72B 3ASOH 2DFEA 3PFYA 3ZMUA 4KDPA 3O60A 1KGSA 3WTTC 5L3DA 4L9TA 3LSPA 2KDOA 3IAM2 5LGTA 3QYBA 3J7ZI 1UHSA 2MH2A 2IU5A 5K7HA 4EM1A 1SMTA 1JT0A 3NNRA 2WTEA 1H88C 4JNNA 1Z9CA 2JA2A 3TO9A 4RAZA 2JVGA 3S2WA 2HVQA 2V6CA 2DFIA 4I99C 2VL8A 4PCQA 2DA3A 1ZYRF 2A68F 3FHZA 1T39A 1YW7A 4D5FA 3CCLI 3CC4I 1D8KA 4L9JA 1IXRC 3RYRA 3DEWA 3TDZC 5FRMA 3V78A 5IPAA 1IRZA 2R7TA 3QP6A 3U21A 4J00A 3BJOA 2R7UA 4FISA 1L0OC 4HX8A 4B47A 2F5VA 4G7HF 1MBFA 3IKVA 1LNWA 3D5SC 3NRVA 2R5ZB 3CMAI 1T2KA 2QCOA 3BCBA 1MJ9A 1IV6A 4M9SA 5JHUA 3DLLF 2VUMJ 1MBHA 2HDDA 1T08B 1WJBA 1R71A 3L00A 1Z7LA 2WV1A 2KRFA 2KIMA 3QPTA 2FA5A 4BQOA 1VQOI 3GXOA 4HF1A 4HV6A 1JGGA 2JN6A 4IX7A 1TZLA 5H20A 5GAHJ 3BROA 1ACIA 3CCVI 3GBGA 4XR6A 4OWRB 4AF5A 2EFQA 4CYCB 3BPVA 2HQAA 3EUHC 1YX3A 1U8BA 4DW6A 4EEFG 3HGYA 3I3LA 2ELJA 1LE8A 3HM5A 4WWCA 1RC9A 1X3ZB 2MC3A 3GYHX 3S15J 2MBFA 3HKZN 3EGQA 4HNTA 1IRGA 1ZTRA 2F5DA 3K4BA 1UCRA 1T0FA 4L62A 2Q24A 2X1EA 3WHCA 3ULQB 2YSRA 4NC6A 5FKNA 5IP6A 2W85A 3I59B 4XLFA 2XAQA 4F55A 1TQPA 3W6VA 3SDGA 3O3KA 3JSPA 1MGTA 4XLCA 4G6QA 1HBXG 2KRHA 1YHQI 1SFUA 4F93B 3VVXA 3C1DA 2DOAA 2VJIA 2I5UA 2M4KA 3U9GA 5IOZA 2O8XA 4MK6A 2QKOA 4KMFA 2ISZA 1MNMC 4WX9A 1QA6A 4CDGA 2RAEA 3ZQQA 1I50J 1G3SA 3BDDA 1OKRA 2FE3A 2E5NA 3HSRA 3F72A 2BBYA 2RDPA 2MABA 1LUJB 4W97A 5FLMJ 1O4XA 3NXCA 3RPUA 4KA4A 1QZEA 1BN5A 2O03A 4GYGA 4QLCU 1U5TB 3RKXA 5M5WJ 2MA3A 3T1BA 1IAWA 1MNEA 2RV8A 4AVZA 1MIJA 2R7ZJ 4ZTJA 3HHGA 1G3TA 3FXOA 2DMNA 4EV0A 3QBMA 4DYRA 3K2AA 4KMUX 2CSOA 4HX4A 4NB5A 2IRFG 4ICHA 3G4SI 1LDJA 3KKCA 1YQAA 3CCYA 5EG0A 2FU4A 2IA0A 2MD5A 3S1MJ 3RSNA 3MCZA 3CCRI 1O3SA 5EDNA 4MFEA 2EFOA 4HV5A 5FKMA 3M4OJ 2HTJA 2O9LA 2K7LA 1SD4A 2DYSH 4D7MA 4HF2A 4MHGA 1XCVA 4G94A 2FOWA 3WTWC 4ZJZA 3AG3H 3AG2H 4DZJA 5LGUA 3LAPA 2EV6A 4A3CJ 4L5IA 3OYEA 4AIDA 3L2VA 2DT6A 2D45A 1PYVA 2V79A 1N25A 1D3YA 1S5LC 2R7WA 2HPMA 1G6NA 4ESBA 1WH7A 3ABLH 3S3MA 1BR1A 1I6HJ 1R1UA 2OI8A 3WE2A 4ITVA 3FXMA 3OIOA 3HOXJ 3OL3A 2H1KA 2P0WA 2K27A 3EQLF 1Z3XA 3CCQI 4XRSA 4YRVA 2H1LA 4A5MA 2ZC2A 1BJAA 3G1OA 4IL6C 1OYYA 3KP3A 2E1MB 2Y31A 5AONA 1LVAA 1WI3A 4RB2C 5ICEA 2LH9A 3GTQJ 2PFBA 5LLQA 3ZOBA 4B3XA 3MKYB 3MKWB 2QVOA 1B6AA 2GENA 1BI1A 4RGUA 5TGTA 1SD7A 1ZGAA 2ELHA 4EM2A 3O2PE 2K85A 2KHMA 4C30A 1J0RA 1IXSB 5FHPA 2DT7B 2QYOA 2PBIA 3Q0WA 3SEZA 3WU0A 1MJAA 1ETXA 3J81Z 2G7HA 5F64A 4M9ZA 3LA3A 3WU2C 1T0FC 3PFIA 2HYFA 4RGRA 1JUPA 2CQXA 3TL4X 4ZYEA 5D5XB 1GV2A 3F22A 3SWHA 1P4AA 3QYEA 2IAIA 1P6RA 2VBYA 1X2NA 3K1NA 4ABZA 3S17J 5JFRA 1MBEA 4N9IA 2QKMB 4XQFA 1PDNC 3A01A 2GXAA 2IS2A 2LTPA 1FLIA 4WIBA 1ON2A 2ZMEA 2MSYA 4RS8A 4M72A 2DJNA 1R22A 2RREA 1LE8B 3IAS2 1T38A 5TJJA 2UUZA 3DP7A 3GWZA 2WA0A 2VC0A 4Y33A 4YELA 1A31A 3BZKA 1BIAA 2H8WA 2OA4A 3E6MA 1WZ2A 2FRHA 5LHGA 3CESA 3G3ZA 4AM3A 2P8TA 2QENA 3K4MA 1O3QA 3F6OA 1BOBA 3GTOJ 2QSFX 2DCEA 2A69F 2COBA 4AVPA 1QHHD 2DI3A 3BTJA 1ETWA 3IH2A 1ZGJA 3KP4A 3KYCB 4UUTA 3EETA 5LBQA 1FIPA 1S3JA 4JX6A 5IYBJ 2L9VA 2F4IA 1Y56A 4FX0A 2DFFA 3F3XA 3V7CA 1Z6TA 2R5YA 2UXOA 5FFXA 1Y39A 4L5EA 4F92B 2DDAA 1ZELA 2JK3A 4BE1A 5DYMA 3RH2A 1MJBA 4EVIA 4D5CA 2CQNA 1X4OA 3HYIA 2LBFB 1Z7UA 2LG4A 1KU9A 2EZIA 3BG7A 3L1PA 3CF2A 4BBSJ 3BCAA 2YU9J 2NS7A 4EQQA 3COLA 4KICA 4JYKA 3R4KA 1F5TA 2DU9A 3DU5A 2LKPA 2OJED 3DXJF 2RASA 4PUSA 2VB6A 1DGWY 1HDPA 4XKCA 2RHAA 3GMEA 3DCFA 4C3HJ 2HPIA 3RI4A 1SC7A 2HKUA 3HB9A 1JJ6C 1TT0A 3BQZA 2QQAA 1TWCJ 1E17A 4U7BA 4LB5A 1I5ZA 3B73A 4OD5A 4G7OF 4S04A 4DQ2A 3KE2A 2V26A 2MLKA 2HYGD 4HA8A 3F8BA 4F52A 4M6VA 3WE3A 5EF6A 4G6DA 2UZKA 4L5JA 2B63J 2VXDA 5D5VB 2F5CA 2W4SA 1T6SA 4C2MA 1FWZA 3RCOA 2EIJH 3ESWB 5F04A 3MKLA 1V5EA 2KL4A 2F48A 2KRCA 3QYFA 3GTLJ 1GXQA 3C7JA 5EZGA 3QOPA 4J19A 2PJPA 1FBQA 4CCOA 5J8CA 3ABMH 1XD7A 3PUBA 1A5JA 3MMYB 2PZ9A 3UNGC 3DLAA 2HEOA 1O7LA 5DCMA 1RZ4A 2IPQX 4Y3OA 3FWEA 2QKLB 4CICA 1D0ZA 5FJ8J 3FISA 2KKOA 5L3CA 4IHYA 5K5OA 2FJI1 2BY2A 1Z1DA 1OCZH 1G59A 1BR4A 2W84A 2KDZA 2V1NA 1W7PD 1F4KA 3H35A 1GLNA 4KITB 4GCLA 2XPVA 3ML6A 4RBOA 1IUYA 1Z6RA 2DBBA 3OYNA 2XPUA 1V4RA 2KJCA 1EJ9A 2HOEA 4BE2A 5K7ZA
chains in the Genus database with same CATH topology
2XRLA 4A3BJ 4IEJA 2R93J 1F43A 5FKKA 2ZCMA 3BQYA 5H9TA 4GFLA 4KWAA 3NAUA 1LFUP 1XS9A 4XRSG 2D5VA 3DPJA 1MSEC 4A3KJ 2V57A 5HAWA 3ZQHA 3O8GA 2VKVA 3HBLA 4M3EA 5F08A 5IP7J 2CQQA 3VOKA 2QF7A 1BL0A 4DYQA 2YS9A 1Z0XA 4I6ZA 3K7AJ 1G2HA 1RKWA 3TEDA 4I76A 2WGBA 5HODA 3S1NJ 1OFCX 3IH4A 3PM1A 2Y2ZA 2ZOZA 4C2MJ 3SFIA 3S16J 2UXIA 3H0GJ 1WCMJ 3BHQA 5CXIA 1SFOJ 2IEKA 2XDNA 3ZQGA 3A01B 3LJLA 2GFNA 3G1MA 3G7RA 2DA5A 2HYJA 3S2HJ 3CRJA 1NK2P 2K9QA 4D7NA 1MSFC 4QTRA 2XGEA 2L7ZA 3HTIA 4IHVA 1E3OC 3VW2A 3TP0A 1I3QJ 3HOWJ 3HOYJ 2ECCA 3HEFA 1IUFA 2LD5A 2TCTA 1ZQ3P 3MNLA 4IHXA 2HXIA 2QOPA 2H8RA 2DA6A 2DMUA 5F0CA 4CGRA 3ON4A 3S1RJ 2WAQN 4M3BA 3JRBA 3PASA 1U9NA 3BR2A 5EZHA 2NVYJ 4Y7NJ 4S0HB 2NP5A 4AC6A 3ZQFA 5E3LA 5EYRA 4V2FA 4A69C 3HOUJ 2L7MP 4A3IJ 3KZ9A 3ZQCA 1WPKA 2R5YB 5CXGA 3B6AA 4FTHA 4JX4A 2NX4A 1P7JA 5J3LA 3SJMA 2L0KA 3IUVA 2PBXA 3TP3A 3JREA 1FTZA 5AQCA 3CWRA 5D19A 4GCKA 1WH5A 3BG9A 4MXMA 2DMPA 1B72B 1PUFB 1QPIA 1HCRA 3V6GA 1UMQA 2JMWA 3O60A 3UKGA 2Y30A 3LSPA 3G56A 2JA8J 3LSGA 1RR7A 5FMPA 1RESA 1UHSA 5EG0B 5K7HA 2IU5A 1BJZA 4FE7A 9ANTA 2GUHA 5F27A 1JT0A 3NNRA 1H88C 3CQZJ 2GM4A 4JNNA 2CU7A 2HYTA 3NARA 2FD5A 1B8IB 2CJJA 4JP0A 1UI6A 2GBYA 2HOAA 1VFCA 1DU6A 4XICA 2DA3A 1MBJA 4D5FA 1EF4A 2R92J 3GTKJ 2JA6J 1JUMA 3DEWA 3VIBA 2QWTA 3V78A 5IPAA 1NK3P 3FIWA 4UUSA 1IRZA 5C44J 4GFBA 2M2EA 3VW0A 4MIMA 4FISA 3RKQA 1SGMA 1FIAA 3PPBA 3OSGA 1MBFA 5IP9J 1JKOC 1AHDP 3BRUA 2EQRA 2LR8A 2R5ZB 3T6NA 1U9OA 1GUUA 3QPSA 1SANA 2QCOA 3QPLA 5C4XJ 1IV6A 1VI0A 4X6AJ 1H8AC 2VUMJ 1MBHA 5M5YJ 3F1BA 2HDDA 4HKUA 2WV1A 4DYCA 2WB1N 3ANPA 3LWJA 2JA5J 3BTCA 1JGGA 3JRAA 2ELKA 3S5RA 1H89C 4V2GA 2HXOA 1GV5A 2JN6A 3CMYA 3PO3J 1ZR4A 1TWGJ 4A3LJ 3Q0VA 5GPAA 3GBGA 4AF5A 2W53A 2XSDC 2ME0A 4CYCB 2M0CA 3BNIA 1U8BA 4DW6A 3ZQIA 2EZHA 3HGYA 4EEFG 4G12A 3HDDA 2O7OA 1LE8A 3HM5A 5J1UA 1IDYA 2OERA 4MFDA 1HLVA 3S15J 3BR5A 3HKZN 4PXIA 2E2JJ 1RKTA 1AU7A 2W48A 1JKRC 1ZTRA 3JR9A 5E3NA 4XIDA 3EGQA 3VVYA 4L62A 2Q24A 3WHCA 2X48A 3M3YJ 1RPWA 2ZB9A 5IP6A 5FKNA 2LP0A 1ORKA 2YUSA 2ZCXA 5FLVA 2G0EA 2JJ7A 3W6VA 3SDGA 2IBDA 3HIMA 3ZQLA 3FRQA 2Y9YA 3TW7A 2LK2A 2DA7A 1IG7A 2CUEA 2ECBA 3E7LA 1K83J 3C2BA 4A93J 3VVXA 3RD3A 5F1JA 4M3GA 2O7TA 4B3AA 2M34A 3IV5A 3BTIA 3HOVJ 4RDUA 3BR3A 5IOZA 3IH3A 2DMTA 4MO7A 2QKOA 4Y52J 3ON2A 4MK6A 2G7GA 1XG1A 1MNMC 5DAJA 2YVEA 2NVTJ 1P7IA 5HSZA 2RAEA 4MLOA 1ETVA 3VPRA 2E2IJ 3S1QJ 1HF0A 2HI3A 1I50J 1TWAJ 2F07A 2REKA 3GEUA 3HE0A 5EGOB 2G7LA 2M9HA 3BR1A 1X2MA 2DA2A 2LLKA 3C07A 4M3DA 3EUPA 1YRNB 3JRFA 2DA4A 2MGQA 1FEXA 4W97A 5FLMJ 1FJLA 4LOCA 1O4XA 3NXCA 3LHQA 1TWHJ 5J1YA 2LFBA 2G7SA 5K58A 3F0CA 2YVHA 5M5WJ 5IOYA 2XB0X 1K61A 2E2HJ 1NTCA 2R7ZJ 4M3FA 1B72A 1BW6A 1IGNA 3JRHA 2DMNA 3QBMA 4DYRA 3RZDJ 5C4JJ 1IC8A 3K2AA 1S7EA 4ICHA 3KKCA 4FE4A 4QSHA 2K9NA 2NVXJ 4IHWA 4JX5A 3P9TA 3CCYA 5EG0A 5JLWA 3S1MJ 2DG8A 2VI6A 4C3JJ 5IYCJ 5EDNA 4MFEA 5FKMA 1B8IA 3M4OJ 2O9LA 2XGDA 4D7MA 3TW6A 1Y1VJ 1AKHB 1QRYA 3RZOJ 5M5XJ 2MG4A 2FX0A 4DZJA 4XK4A 3LNQA 4A3CJ 3HTJA 1X58A 3JRDA 2DG7A 1MBGA 2JA7J 4A3MJ 1JUSA 2EZLA 3KKDA 1QVTA 2HOTA 3H3VK 1LFBA 1WH7A 3OSFA 2OI8A 2HOSA 1I6HJ 3NI7A 2GLOA 3NPIA 1D5YA 3OIOA 1ITYA 2K9SA 3HOXJ 1A6IA 1MH4A 1JKPC 2H1KA 2FBQA 4W1UA 3JSJA 4XRSA 3VUQA 3G1OA 2R5ZA 1IJWC 2ZCNA 3OOUA 2QIBA 2FJ1A 5FKLA 2EBIA 2UXHA 2LY9A 2Y9ZA 1ZK8A 2Y31A 1WI3A 3BG3A 5CW8A 3Q3SA 3HTHA 3GTQJ 1CQTA 3ZOBA 3GZIA 1JTXA 3CDLA 5M3FJ 5F0HA 2GENA 5E3MA 1T33A 4A3GJ 3HOZJ 1ETYA 3GTJJ 3RQIA 1JT6A 4B1RA 3FKIJ 3MVPA 2TRTA 3HGGA 5FHPA 1BW5A 1WGXA 5EFYA 3Q0WA 4A3EJ 1ENHA 3JRIA 3PO2J 3JRGA 3BTLA 3HTAA 1ETQA 4CYCA 1ETXA 3KNWA 3QKXA 2L7FP 3LSJA 5E3OA 1FTTA 2M8GX 1GVDA 4XRMA 1OJLA 1JUPA 3LOCA 2CQXA 4AC0A 4NELA 1GV2A 2E1OA 3BJBA 3NRGA 4NN1A 2MW8A 3MN2A 2IAIA 3BG5A 4B4CA 1X2NA 3VP5A 1OCPA 4GCTA 1QVUA 3FK7A 4ABZA 3S17J 2QTQA 1HOMA 1MBEA 1OCTC 1POGA 1IDZA 4AUXA 3A01A 2LTPA 2AHQA 5FGLA 1APLC 2ID3A 5C3EJ 4JKZA 2K40A 2MSYA 2XB5A 2VKEA 1UG2A 2DJNA 2DMQA 3VW1A 1LE8B 3B81A 3BR6A 3O8HA 3A02A 2D6YA 2NVQJ 2N8GA 2EH3A 2PMZN 2WUIA 5K7FA 3GTOJ 4A3FJ 1JKQC 2R0QC 4A3JJ 5JLXA 2COBA 3AQSA 3GTGJ 4ACIA 2ID6A 5EGOA 3S14J 3BTJA 2UXPA 1ETWA 3IH2A 4NDLA 4UUTA 3B6CA 1UI5A 4A3DJ 1FIPA 4JX6A 5IYBJ 3VOXA 1YRNA 3JRCA 2LKXA 1RETA 2O8KA 2X6OA 2L9RA 4BBRJ 1ETKA 2R5YA 2OPTA 1JTYA 2JWTA 3BR0A 2UXOA 4L5EA 2CUFA 1VF9A 5DS9A 2JK3A 2NP3A 5EEAA 3QQAA 2ZOYA 3RH2A 3BT9A 4D5CA 1TWFJ 3G1LA 4BXXJ 5M3MJ 2DN0A 2UXUA 2EZIA 3L1PA 1HDDC 3WHBA 1PUFA 2YU9J 4BBSJ 2EZKA 2NS7A 3COLA 5C4YA 1GT0C 4JYKA 1ZR2A 1W0UA 2VPRA 2NS8A 4YZEA 4FCYA 4QIWN 2NOGA 1U78A 2RASA 1F36A 4BKXA 2CRGA 3VVZA 2AO9A 1W0TA 1VNDA 1HDPA 1Q1VA 4GFKA 1AKHA 5FKOA 2RHAA 5HBUA 3DCFA 4C3HJ 3I4MJ 4X1EA 4BY1J 2HKUA 3HB9A 2XGCA 5F0FA 4DZPA 1JJ6C 3BQZA 5GPCA 1JJ8C 1BA5A 1TWCJ 4ME9A 3GTMJ 5D18A 2HQ5A 2X9DA 5GP9A 5BNGA 4C3IJ 4M6VA 5EF6A 4BY7J 2P81A 4HNVA 3E7QA 3BCGA 2B63J 1Y1WJ 2E19A 1DU0A 3CJDA 3LSRA 2LVSA 5DTDA 5F04A 3MKLA 5D1RA 2XPWA 1ZKGA 3GTLJ 5EZGA 4J19A 1MH3A 2G3BA 2Y0SN 1A5JA 4UUSB 2PZ9A 1XC5A 1T56A 3GTPJ 4JL3A 2OF7A 1GDTA 1TC3C 3I4NJ 3D1NI 2FQ4A 3FISA 2ME6A 5FJ8J 5IYDJ 4IHYA 1ETOA 3Q0UA 1Z77A 3FK6A 2I10A 2DA1A 1ZGWA 2KDZA 3ANGA 3AQTA 2KT0A 2DTZA 4GCLA 2XPVA 5J1RA 1R9TJ 4RBOA 4AYBN 4UDSA 2XPUA 1MBKA 3A03A 3S2DJ 5K7ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XRL A;  4A3B J;  4IEJ A;  2R93 J;  1F43 A;  5FKK A;  2ZCM A;  3BQY A;  5H9T A;  4GFL A;  4KWA A;  3NAU A;  1LFU P;  1XS9 A;  4XRS G;  2D5V A;  3DPJ A;  1MSE C;  4A3K J;  2V57 A;  5HAW A;  3ZQH A;  3O8G A;  2VKV A;  3HBL A;  4M3E A;  5F08 A;  5IP7 J;  2CQQ A;  3VOK A;  2QF7 A;  1BL0 A;  4DYQ A;  2YS9 A;  1Z0X A;  4I6Z A;  3K7A J;  1G2H A;  1RKW A;  3TED A;  4I76 A;  2WGB A;  5HOD A;  3S1N J;  1OFC X;  3IH4 A;  3PM1 A;  2Y2Z A;  2ZOZ A;  4C2M J;  3SFI A;  3S16 J;  2UXI A;  3H0G J;  1WCM J;  3BHQ A;  5CXI A;  1SFO J;  2IEK A;  2XDN A;  3ZQG A;  3A01 B;  3LJL A;  2GFN A;  3G1M A;  3G7R A;  2DA5 A;  2HYJ A;  3S2H J;  3CRJ A;  1NK2 P;  2K9Q A;  4D7N A;  1MSF C;  4QTR A;  2XGE A;  2L7Z A;  3HTI A;  4IHV A;  1E3O C;  3VW2 A;  3TP0 A;  1I3Q J;  3HOW J;  3HOY J;  2ECC A;  3HEF A;  1IUF A;  2LD5 A;  2TCT A;  1ZQ3 P;  3MNL A;  4IHX A;  2HXI A;  2QOP A;  2H8R A;  2DA6 A;  2DMU A;  5F0C A;  4CGR A;  3ON4 A;  3S1R J;  2WAQ N;  4M3B A;  3JRB A;  3PAS A;  1U9N A;  3BR2 A;  5EZH A;  2NVY J;  4Y7N J;  4S0H B;  2NP5 A;  4AC6 A;  3ZQF A;  5E3L A;  5EYR A;  4V2F A;  4A69 C;  3HOU J;  2L7M P;  4A3I J;  3KZ9 A;  3ZQC A;  1WPK A;  2R5Y B;  5CXG A;  3B6A A;  4FTH A;  4JX4 A;  2NX4 A;  1P7J A;  5J3L A;  3SJM A;  2L0K A;  3IUV A;  2PBX A;  3TP3 A;  3JRE A;  1FTZ A;  5AQC A;  3CWR A;  5D19 A;  4GCK A;  1WH5 A;  3BG9 A;  4MXM A;  2DMP A;  1B72 B;  1PUF B;  1QPI A;  1HCR A;  3V6G A;  1UMQ A;  2JMW A;  3O60 A;  3UKG A;  2Y30 A;  3LSP A;  3G56 A;  2JA8 J;  3LSG A;  1RR7 A;  5FMP A;  1RES A;  1UHS A;  5EG0 B;  5K7H A;  2IU5 A;  1BJZ A;  4FE7 A;  9ANT A;  2GUH A;  5F27 A;  1JT0 A;  3NNR A;  1H88 C;  3CQZ J;  2GM4 A;  4JNN A;  2CU7 A;  2HYT A;  3NAR A;  2FD5 A;  1B8I B;  2CJJ A;  4JP0 A;  1UI6 A;  2GBY A;  2HOA A;  1VFC A;  1DU6 A;  4XIC A;  2DA3 A;  1MBJ A;  4D5F A;  1EF4 A;  2R92 J;  3GTK J;  2JA6 J;  1JUM A;  3DEW A;  3VIB A;  2QWT A;  3V78 A;  5IPA A;  1NK3 P;  3FIW A;  4UUS A;  1IRZ A;  5C44 J;  4GFB A;  2M2E A;  3VW0 A;  4MIM A;  4FIS A;  3RKQ A;  1SGM A;  1FIA A;  3PPB A;  3OSG A;  1MBF A;  5IP9 J;  1JKO C;  1AHD P;  3BRU A;  2EQR A;  2LR8 A;  2R5Z B;  3T6N A;  1U9O A;  1GUU A;  3QPS A;  1SAN A;  2QCO A;  3QPL A;  5C4X J;  1IV6 A;  1VI0 A;  4X6A J;  1H8A C;  2VUM J;  1MBH A;  5M5Y J;  3F1B A;  2HDD A;  4HKU A;  2WV1 A;  4DYC A;  2WB1 N;  3ANP A;  3LWJ A;  2JA5 J;  3BTC A;  1JGG A;  3JRA A;  2ELK A;  3S5R A;  1H89 C;  4V2G A;  2HXO A;  1GV5 A;  2JN6 A;  3CMY A;  3PO3 J;  1ZR4 A;  1TWG J;  4A3L J;  3Q0V A;  5GPA A;  3GBG A;  4AF5 A;  2W53 A;  2XSD C;  2ME0 A;  4CYC B;  2M0C A;  3BNI A;  1U8B A;  4DW6 A;  3ZQI A;  2EZH A;  3HGY A;  4EEF G;  4G12 A;  3HDD A;  2O7O A;  1LE8 A;  3HM5 A;  5J1U A;  1IDY A;  2OER A;  4MFD A;  1HLV A;  3S15 J;  3BR5 A;  3HKZ N;  4PXI A;  2E2J J;  1RKT A;  1AU7 A;  2W48 A;  1JKR C;  1ZTR A;  3JR9 A;  5E3N A;  4XID A;  3EGQ A;  3VVY A;  4L62 A;  2Q24 A;  3WHC A;  2X48 A;  3M3Y J;  1RPW A;  2ZB9 A;  5IP6 A;  5FKN A;  2LP0 A;  1ORK A;  2YUS A;  2ZCX A;  5FLV A;  2G0E A;  2JJ7 A;  3W6V A;  3SDG A;  2IBD A;  3HIM A;  3ZQL A;  3FRQ A;  2Y9Y A;  3TW7 A;  2LK2 A;  2DA7 A;  1IG7 A;  2CUE A;  2ECB A;  3E7L A;  1K83 J;  3C2B A;  4A93 J;  3VVX A;  3RD3 A;  5F1J A;  4M3G A;  2O7T A;  4B3A A;  2M34 A;  3IV5 A;  3BTI A;  3HOV J;  4RDU A;  3BR3 A;  5IOZ A;  3IH3 A;  2DMT A;  4MO7 A;  2QKO A;  4Y52 J;  3ON2 A;  4MK6 A;  2G7G A;  1XG1 A;  1MNM C;  5DAJ A;  2YVE A;  2NVT J;  1P7I A;  5HSZ A;  2RAE A;  4MLO A;  1ETV A;  3VPR A;  2E2I J;  3S1Q J;  1HF0 A;  2HI3 A;  1I50 J;  1TWA J;  2F07 A;  2REK A;  3GEU A;  3HE0 A;  5EGO B;  2G7L A;  2M9H A;  3BR1 A;  1X2M A;  2DA2 A;  2LLK A;  3C07 A;  4M3D A;  3EUP A;  1YRN B;  3JRF A;  2DA4 A;  2MGQ A;  1FEX A;  4W97 A;  5FLM J;  1FJL A;  4LOC A;  1O4X A;  3NXC A;  3LHQ A;  1TWH J;  5J1Y A;  2LFB A;  2G7S A;  5K58 A;  3F0C A;  2YVH A;  5M5W J;  5IOY A;  2XB0 X;  1K61 A;  2E2H J;  1NTC A;  2R7Z J;  4M3F A;  1B72 A;  1BW6 A;  1IGN A;  3JRH A;  2DMN A;  3QBM A;  4DYR A;  3RZD J;  5C4J J;  1IC8 A;  3K2A A;  1S7E A;  4ICH A;  3KKC A;  4FE4 A;  4QSH A;  2K9N A;  2NVX J;  4IHW A;  4JX5 A;  3P9T A;  3CCY A;  5EG0 A;  5JLW A;  3S1M J;  2DG8 A;  2VI6 A;  4C3J J;  5IYC J;  5EDN A;  4MFE A;  5FKM A;  1B8I A;  3M4O J;  2O9L A;  2XGD A;  4D7M A;  3TW6 A;  1Y1V J;  1AKH B;  1QRY A;  3RZO J;  5M5X J;  2MG4 A;  2FX0 A;  4DZJ A;  4XK4 A;  3LNQ A;  4A3C J;  3HTJ A;  1X58 A;  3JRD A;  2DG7 A;  1MBG A;  2JA7 J;  4A3M J;  1JUS A;  2EZL A;  3KKD A;  1QVT A;  2HOT A;  3H3V K;  1LFB A;  1WH7 A;  3OSF A;  2OI8 A;  2HOS A;  1I6H J;  3NI7 A;  2GLO A;  3NPI A;  1D5Y A;  3OIO A;  1ITY A;  2K9S A;  3HOX J;  1A6I A;  1MH4 A;  1JKP C;  2H1K A;  2FBQ A;  4W1U A;  3JSJ A;  4XRS A;  3VUQ A;  3G1O A;  2R5Z A;  1IJW C;  2ZCN A;  3OOU A;  2QIB A;  2FJ1 A;  5FKL A;  2EBI A;  2UXH A;  2LY9 A;  2Y9Z A;  1ZK8 A;  2Y31 A;  1WI3 A;  3BG3 A;  5CW8 A;  3Q3S A;  3HTH A;  3GTQ J;  1CQT A;  3ZOB A;  3GZI A;  1JTX A;  3CDL A;  5M3F J;  5F0H A;  2GEN A;  5E3M A;  1T33 A;  4A3G J;  3HOZ J;  1ETY A;  3GTJ J;  3RQI A;  1JT6 A;  4B1R A;  3FKI J;  3MVP A;  2TRT A;  3HGG A;  5FHP A;  1BW5 A;  1WGX A;  5EFY A;  3Q0W A;  4A3E J;  1ENH A;  3JRI A;  3PO2 J;  3JRG A;  3BTL A;  3HTA A;  1ETQ A;  4CYC A;  1ETX A;  3KNW A;  3QKX A;  2L7F P;  3LSJ A;  5E3O A;  1FTT A;  2M8G X;  1GVD A;  4XRM A;  1OJL A;  1JUP A;  3LOC A;  2CQX A;  4AC0 A;  4NEL A;  1GV2 A;  2E1O A;  3BJB A;  3NRG A;  4NN1 A;  2MW8 A;  3MN2 A;  2IAI A;  3BG5 A;  4B4C A;  1X2N A;  3VP5 A;  1OCP A;  4GCT A;  1QVU A;  3FK7 A;  4ABZ A;  3S17 J;  2QTQ A;  1HOM A;  1MBE A;  1OCT C;  1POG A;  1IDZ A;  4AUX A;  3A01 A;  2LTP A;  2AHQ A;  5FGL A;  1APL C;  2ID3 A;  5C3E J;  4JKZ A;  2K40 A;  2MSY A;  2XB5 A;  2VKE A;  1UG2 A;  2DJN A;  2DMQ A;  3VW1 A;  1LE8 B;  3B81 A;  3BR6 A;  3O8H A;  3A02 A;  2D6Y A;  2NVQ J;  2N8G A;  2EH3 A;  2PMZ N;  2WUI A;  5K7F A;  3GTO J;  4A3F J;  1JKQ C;  2R0Q C;  4A3J J;  5JLX A;  2COB A;  3AQS A;  3GTG J;  4ACI A;  2ID6 A;  5EGO A;  3S14 J;  3BTJ A;  2UXP A;  1ETW A;  3IH2 A;  4NDL A;  4UUT A;  3B6C A;  1UI5 A;  4A3D J;  1FIP A;  4JX6 A;  5IYB J;  3VOX A;  1YRN A;  3JRC A;  2LKX A;  1RET A;  2O8K A;  2X6O A;  2L9R A;  4BBR J;  1ETK A;  2R5Y A;  2OPT A;  1JTY A;  2JWT A;  3BR0 A;  2UXO A;  4L5E A;  2CUF A;  1VF9 A;  5DS9 A;  2JK3 A;  2NP3 A;  5EEA A;  3QQA A;  2ZOY A;  3RH2 A;  3BT9 A;  4D5C A;  1TWF J;  3G1L A;  4BXX J;  5M3M J;  2DN0 A;  2UXU A;  2EZI A;  3L1P A;  1HDD C;  3WHB A;  1PUF A;  2YU9 J;  4BBS J;  2EZK A;  2NS7 A;  3COL A;  5C4Y A;  1GT0 C;  4JYK A;  1ZR2 A;  1W0U A;  2VPR A;  2NS8 A;  4YZE A;  4FCY A;  4QIW N;  2NOG A;  1U78 A;  2RAS A;  1F36 A;  4BKX A;  2CRG A;  3VVZ A;  2AO9 A;  1W0T A;  1VND A;  1HDP A;  1Q1V A;  4GFK A;  1AKH A;  5FKO A;  2RHA A;  5HBU A;  3DCF A;  4C3H J;  3I4M J;  4X1E A;  4BY1 J;  2HKU A;  3HB9 A;  2XGC A;  5F0F A;  4DZP A;  1JJ6 C;  3BQZ A;  5GPC A;  1JJ8 C;  1BA5 A;  1TWC J;  4ME9 A;  3GTM J;  5D18 A;  2HQ5 A;  2X9D A;  5GP9 A;  5BNG A;  4C3I J;  4M6V A;  5EF6 A;  4BY7 J;  2P81 A;  4HNV A;  3E7Q A;  3BCG A;  2B63 J;  1Y1W J;  2E19 A;  1DU0 A;  3CJD A;  3LSR A;  2LVS A;  5DTD A;  5F04 A;  3MKL A;  5D1R A;  2XPW A;  1ZKG A;  3GTL J;  5EZG A;  4J19 A;  1MH3 A;  2G3B A;  2Y0S N;  1A5J A;  4UUS B;  2PZ9 A;  1XC5 A;  1T56 A;  3GTP J;  4JL3 A;  2OF7 A;  1GDT A;  1TC3 C;  3I4N J;  3D1N I;  2FQ4 A;  3FIS A;  2ME6 A;  5FJ8 J;  5IYD J;  4IHY A;  1ETO A;  3Q0U A;  1Z77 A;  3FK6 A;  2I10 A;  2DA1 A;  1ZGW A;  2KDZ A;  3ANG A;  3AQT A;  2KT0 A;  2DTZ A;  4GCL A;  2XPV A;  5J1R A;  1R9T J;  4RBO A;  4AYB N;  4UDS A;  2XPU A;  1MBK A;  3A03 A;  3S2D J;  5K7Z A; 
#chains in the Genus database with same CATH topology
 1O57 A;  1F43 A;  3F9K A;  3LA2 A;  4P1W A;  4RAF A;  1ZRF A;  1H9T A;  1E3H A;  2K02 A;  4EJV A;  3NAU A;  1XMK A;  1HSJ A;  1D0Y A;  2BXY A;  4CCK A;  1FOW A;  3WTZ A;  4Q5S F;  2R7V A;  3DPJ A;  5JVT A;  4RB3 C;  3D5L A;  1FZP B;  4CSW A;  4OIP F;  1IN5 A;  3HBL A;  1C0W A;  2CQQ A;  2FNA A;  3RTR A;  3ZCO A;  1BL0 A;  3JAM K;  2X6Y A;  2XKP A;  3FMR A;  2LKS A;  1T8I A;  3K7A J;  1RKW A;  2K3P A;  2LOO A;  4I76 A;  5HOD A;  2HS5 A;  1MDM A;  3DTI A;  1GXP A;  4BUP A;  2W57 A;  3RQ4 A;  2XC7 A;  4C2M J;  3SFI A;  2ZSH B;  4KYW A;  3H0G J;  2M30 A;  3BHQ A;  1ZG1 A;  3W3C A;  4E7I A;  1R00 A;  1UST A;  3FXU A;  3K10 A;  3A01 B;  3HRM A;  2HVR A;  3KZZ A;  2ZME B;  3CRJ A;  3M1E A;  3GZ5 A;  3ABU A;  4I7H A;  4ZDL A;  2D2W A;  4I0A A;  2Z33 A;  1FX7 A;  1I6X A;  1E3O C;  2M87 A;  1I3Q J;  1R1V A;  1SAU A;  3FMS A;  1TNT A;  1XGS A;  2VC1 A;  3R60 A;  3HHH A;  5D6E A;  2O5R A;  2TCT A;  1D5V A;  4II2 A;  2ZY9 A;  4Y15 A;  1ONV A;  3FBI B;  2QOP A;  2BOL A;  5CJ9 A;  1OPC A;  3CUQ B;  3JTG A;  1KU3 A;  3FF5 A;  1ZLK A;  3JRB A;  3MD2 A;  2Y69 H;  2PG4 A;  2PMU A;  3LFK A;  5EZH A;  4Y7N J;  4HLY A;  3ECO A;  1BC7 C;  1I3A A;  4JBA A;  2JRM A;  1FT9 A;  4A69 C;  4L0Y B;  5HNH A;  1WPK A;  2R5Y B;  5CXG A;  3FM5 A;  4KT5 C;  2B3W A;  3FXL A;  3LAJ A;  3IUV A;  1YIO A;  1NG6 A;  2HDC A;  1XGO A;  3E5Q A;  3W2V A;  2M0M A;  2D1H A;  1WH5 A;  3BG9 A;  3NWS A;  2ETH A;  2DOE A;  2DMP A;  1HCR A;  1T95 A;  5J4V A;  3ASN H;  2JMW A;  2NNN A;  2QM3 A;  3FXJ A;  4KIB A;  3VFZ A;  1S7O A;  2M5W A;  4RLQ A;  2JA8 J;  4CXF A;  4Y4R A;  1MMN A;  5F27 A;  3DBH B;  4A0Z A;  3SYT A;  2CU7 A;  4RM2 A;  3A0H C;  2FD5 A;  1B8I B;  3GFL A;  3DWL E;  2L2O A;  2OU2 A;  1IN8 A;  2QSG X;  1UI5 A;  1Z91 A;  4NNJ A;  1YX5 A;  2A6H F;  1DU6 A;  4HST A;  4MGR A;  3WG9 A;  2V9V A;  1BI0 A;  1EF4 A;  1IW7 F;  5IT3 A;  4BDZ A;  3JTH A;  3DEE A;  4LG0 A;  1JUM A;  4ENM A;  4BQA A;  2V9P A;  2QWT A;  3VIB A;  1NK3 P;  3FIW A;  1Y8Q B;  3H3U A;  4BGD A;  1IV8 A;  2F5F A;  2Y48 A;  4GFB A;  3VW0 A;  3RKQ A;  1SGM A;  5GAD J;  3SZT A;  4D0P A;  4JOM A;  3OR2 C;  1F1Z A;  4A6E A;  5E18 F;  5J4Y A;  2EQR A;  3QPH A;  3HRU A;  1U9O A;  3CCS I;  3V7S A;  2EIM H;  3RPQ A;  5C4X J;  1H0M A;  1VI0 A;  4XKV A;  1Y0N A;  3U1K A;  2CW8 A;  1H8A C;  1SFE A;  3GFJ A;  3KLO A;  5M5Y J;  3P7N A;  3GO5 A;  1LEA A;  5DCM B;  2WB1 N;  4CYD A;  2DAO A;  4G8X A;  1W36 D;  1SAX A;  2R7F A;  2K9L A;  2HXO A;  3COA C;  1YS7 A;  3PO3 J;  1YLF A;  1ZR4 A;  1VQK I;  2ZXH A;  4N4N B;  5B66 C;  2ME0 A;  1Z21 A;  4BU2 A;  2M0C A;  5E8G A;  5FRO A;  1QGP A;  5EJC A;  2NNY A;  1VQ9 I;  2L4A A;  3HDD A;  5LEK A;  3EUH A;  3I53 A;  2X51 A;  5J1U A;  4TV7 A;  1IDY A;  2V4J C;  3R61 A;  3BR5 A;  3OS2 A;  3OL4 A;  3KX2 A;  3K70 D;  4XID A;  3VVY A;  2X48 A;  3M3Y J;  2OC6 A;  3CC7 I;  2LP0 A;  2XAU A;  2YUS A;  5K1Y A;  2G0E A;  1NG7 A;  2JJ7 A;  1U2W A;  2OBP A;  2IBD A;  3HIM A;  2R3S A;  5A2Q K;  2Y9Y A;  2VE9 A;  3ZQL A;  3FX3 A;  4LFU A;  1WFX A;  3WOD F;  2CUE A;  3I5U A;  3ZMZ A;  2ADU A;  4I2O A;  5F1J A;  2O7T A;  2NVU B;  2M34 A;  1R1T A;  2LC2 A;  3HSE A;  4RDU A;  1X19 A;  5D5W B;  1MDM B;  3FM3 A;  1YI2 I;  2V6E A;  3LMM A;  5HSZ A;  2NVT J;  4EJT A;  2BGC A;  1ETV A;  3I54 A;  3VPR A;  2E2I J;  2HI3 A;  3M1C A;  4HAM A;  2JUC A;  2IT0 A;  5E17 F;  2REK A;  4CA0 A;  2M7B A;  3OR1 C;  3I71 A;  4XOT A;  5D6F A;  4HRI A;  3CJQ B;  1VQ6 I;  1O3R A;  1WRJ A;  2E60 A;  1KZH A;  4M3D A;  2IXS A;  3ZXS A;  2EA4 A;  3ERM A;  4ETS A;  2ACJ A;  1FJL A;  1DP7 P;  3N4M A;  5J1Y A;  2EFN A;  2LFB A;  5K5R A;  4YFK F;  3QRF F;  3QP5 A;  2E2H J;  3GZN B;  1NTC A;  2Y0M A;  4CO8 A;  1BW6 A;  3RKY A;  1IGN A;  3RZD J;  5C4J J;  5DCF A;  1BR2 A;  1OYI A;  2B0L A;  4DNC A;  2QUF A;  4QSH A;  3V8K A;  1ZN2 A;  3KP5 A;  3P9T A;  1VQ5 I;  3F8F A;  3QWL A;  2KZV A;  5JLW A;  5CVV A;  3MWM A;  2XUB A;  4OOI A;  4N0B A;  5DD8 A;  2HKX A;  1TLH B;  4UXN A;  1SD5 A;  4EAT A;  1YOV B;  2E1N A;  1Y1V J;  1J2X A;  2Q0O A;  4E6K G;  2ZJR F;  4LLN A;  1QRY A;  2DQL A;  3RZO J;  2RGV A;  4I98 B;  2E35 A;  2BYV E;  2DG7 A;  2DT5 A;  4AIK A;  3KKD A;  1DPR A;  2VIX A;  4EJO A;  4Q4Z F;  3OSF A;  4BQN A;  1EH7 A;  3EUA A;  4B48 A;  5DD4 A;  2HOS A;  3A4C A;  3NPI A;  4ESF A;  1D5Y A;  1ITY A;  1A6I A;  4PK4 A;  1JKP C;  4U7D A;  2FBQ A;  2X6X A;  3TDU C;  5LRS A;  3GFI A;  1M1E B;  1WWX A;  3VYU B;  3CLQ A;  2ZCN A;  1IJW C;  3HKZ A;  2ESN A;  2OQG A;  3V42 A;  5FKL A;  2UXH A;  4ZYA A;  2L9S A;  3FHN A;  5B5E C;  2CUZ A;  3Q3S A;  1Z3Y A;  1JTX A;  1PVE A;  5M3F J;  5F0H A;  1FYL A;  5E3M A;  2EPF A;  4MTE A;  3HOZ J;  3KPH A;  1ETY A;  3K1M A;  3F6V A;  2FQ3 A;  3FKI J;  1LPQ A;  2TRT A;  3HGG A;  1QO0 D;  2VAS A;  3E3V A;  4A3E J;  3LSI A;  3JRI A;  2ZXI A;  3JRG A;  2BW3 B;  3SDB A;  3I56 I;  2CUJ A;  1OCR H;  3QKX A;  1FTT A;  1GVD A;  5ICG A;  5HLG A;  4XRM A;  4ESJ A;  1YJN I;  3ISP A;  1ZRC A;  5HS9 A;  1FOK A;  3LSM A;  4RLF A;  3LOC A;  2R7S A;  2L3D A;  2HVS A;  1HQC A;  1X1B A;  2CYY A;  2E1O A;  2LY1 A;  3BJB A;  1YIT I;  4PJN A;  2IGO A;  3AL0 C;  4B4C A;  3VP5 A;  4AWX B;  4IOA F;  2E1C A;  1OCP A;  1P9Q C;  3FK7 A;  4EM0 B;  1OCT C;  4AUX A;  2QBY B;  2R7Q A;  2DK5 A;  3CD6 I;  2ID3 A;  4JKZ A;  1FMW A;  1X1P A;  4LGW A;  2VJ4 A;  4V19 K;  2BHZ A;  4G6T B;  1I27 A;  2K3F A;  3MZY A;  4EMS A;  3VW1 A;  3OS0 A;  3HRT A;  3TOB A;  1ULY A;  4WCG A;  1V3F A;  3A02 A;  2CS3 A;  3A2K A;  3MAJ A;  1D1A A;  4IRG A;  1UHM A;  4A3F J;  1JKQ C;  2R0Q C;  1R4N B;  3QAH A;  5JLX A;  5HVQ C;  3AL0 B;  3GTG J;  4ACI A;  5EGO A;  4NDL A;  4PDK A;  4UNO A;  2LMD A;  4A3D J;  1NH3 A;  1YRN A;  1K7A A;  3JRC A;  4A0X A;  2WC2 A;  2HFH A;  4IHS A;  2O8K A;  1K6Y A;  1KA8 A;  1FP2 A;  3HPH A;  2VOO A;  2CUF A;  1VF9 A;  2NP3 A;  1LDK B;  5EEA A;  2CH0 A;  1VQ8 I;  4KN7 X;  2CW7 A;  2G9W A;  3K69 A;  4U0V A;  2ZOY A;  4MTD A;  3RKW A;  4LK1 F;  1KYZ A;  1HST A;  2M3A A;  1QHG A;  2V7F A;  3BJ6 A;  5M3M J;  2DN0 A;  2B9S A;  4IPA A;  2UXU A;  1HDD C;  2GXB A;  1GT0 C;  2H94 A;  1G4D A;  1ZLJ A;  2PJR A;  1ZR2 A;  2NRA C;  4I09 A;  1WJ5 A;  2VPR A;  1TQI A;  2NOG A;  1F36 A;  4BKX A;  2CRG A;  4UVA A;  5CQE A;  1S7A A;  1VZ0 A;  2AO9 A;  4YFX F;  2PI0 A;  4LB6 B;  1W0T A;  3E6B A;  3ZN1 A;  1AKH A;  3CMM A;  5FKO A;  4IXA A;  4RB0 A;  2Y75 A;  5KNL A;  4IQJ A;  3DKX A;  3I4M J;  4HEA 2;  4A2U A;  4DZP A;  1JJ8 C;  4BH9 A;  5GPC A;  5DM7 F;  2XAF A;  1YJ9 I;  5D18 A;  2YR2 A;  3GW2 A;  3M9A A;  3VTI A;  3EPZ A;  3PUF A;  2RNJ A;  1DQU A;  3H5N A;  5GP9 A;  4DVY P;  1SVO A;  4A6D A;  1YTY A;  3PNY A;  2WAE A;  4PZJ A;  4BY7 J;  1OCC H;  2LF8 A;  2IJL A;  2X6W A;  1JE8 A;  4ANJ A;  1HKQ A;  2EA2 A;  1Y1W J;  1I39 A;  2OZU A;  5KCM A;  2A07 F;  3W2A A;  1IXC A;  5DTD A;  1TTY A;  3LQQ A;  1OLT A;  5CVJ A;  1KU2 A;  1N77 A;  4HSR A;  2R7D A;  3R6S A;  2O3F A;  1I1S A;  1XC5 A;  1W36 C;  5CVR A;  3L2C A;  4HDU A;  4JL3 A;  2OF7 A;  3BOQ A;  5D4S A;  1GDT A;  1TC3 C;  3I4N J;  3JW4 A;  3FXQ A;  2FQ4 A;  5IYD J;  5FO5 A;  3CCJ I;  1FC3 A;  3P5J A;  4XN0 A;  1A6Q A;  1Z77 A;  5LEJ A;  2EB7 A;  4L0Z B;  1G3Y A;  4FHT A;  5CPR B;  3WG7 H;  3C2G A;  4BHB A;  4AYB N;  4GDF A;  4UDS A;  2KJB A;  5HS7 A;  4XSZ F;  4CZZ A;  1A35 A;  4IEJ A;  1ERD A;  5FKK A;  1TW2 A;  1Q1H A;  5IT9 Z;  3EUK L;  1A04 A;  1P4X A;  3HL2 A;  2DLL A;  2ZNZ A;  4XRS G;  3X2Q H;  4XLN F;  3ZMT A;  1AA7 A;  1VQL I;  3O8G A;  2EFP A;  1BOA A;  5F08 A;  2BE5 F;  3S32 A;  2IGK A;  5KK1 A;  2F5E A;  4OIN F;  4P55 A;  4DYQ A;  2YS9 A;  1G2H A;  1LDD A;  2WGB A;  1H9G A;  2CGP A;  1B9N A;  3IRR A;  1S29 A;  1B1B A;  1P2F A;  1W5T A;  4LIV A;  5H2F C;  1X1A A;  2AQF A;  2Q2E A;  2P6S A;  2KFD A;  2J5O A;  5CXI A;  3CCU I;  2IEK A;  5CYV A;  3REO A;  1S8N A;  4QWQ A;  3LJL A;  4HQE A;  1G8X A;  3G7R A;  2DA5 A;  2MD0 A;  1IN6 A;  1MND A;  2HYJ A;  5ERI A;  1S72 I;  2K9Q A;  4D7N A;  3E5U A;  3MKZ A;  1ZAO A;  2XGE A;  3DKY A;  4N4O B;  1IF1 A;  3HTI A;  5HS8 A;  2AXT C;  3TP0 A;  4HG2 A;  2FXA A;  4FX4 A;  3OIQ A;  1REP C;  1SMY F;  4MEY F;  1ZQ3 P;  1B9M A;  1D1C A;  3MNL A;  3J81 K;  5J8F A;  2Z3Y A;  3F8C A;  4PFP A;  2DMU A;  2ZKZ A;  2FBK A;  3ONQ A;  5F0C A;  5DM6 F;  4CGR A;  3ON4 A;  2VLA A;  3S1R J;  2WAQ N;  4M3B A;  1FOY A;  2G7U A;  1U9N A;  3V4G A;  3BR2 A;  4BEH A;  1SD6 A;  2GIZ A;  2NP5 A;  3N05 A;  5HLH A;  2CG4 A;  3DPL C;  5CKT A;  5EYR A;  3HOU J;  3KZ9 A;  2L7M P;  4A3I J;  3J7A Y;  3OYJ A;  3CZ6 A;  4I0B A;  3TOA A;  3SJM A;  2OV7 A;  2E71 A;  4NUB A;  2PBX A;  3PQK A;  2DPD A;  2RVC A;  5E20 A;  3CWR A;  3NWT A;  1P92 A;  3AG1 H;  1UMQ A;  3OYM A;  1XMA A;  3BZC A;  3PNV A;  4RA2 A;  3VSL A;  3OYH A;  4G7Z F;  3J80 Z;  3UKG A;  2RN7 A;  2Y30 A;  3G56 A;  2Q8K A;  1RR7 A;  4BL0 B;  5EG0 B;  4I01 A;  1BJZ A;  3KIO A;  4FE7 A;  3I64 A;  4G9Y A;  2GUH A;  1WQ2 A;  3CQZ J;  2VBZ A;  3NAR A;  2JT1 A;  3TO7 A;  2KZG A;  2RNG A;  2GBY A;  1YS6 A;  2HOA A;  5BPI A;  2COM A;  3BPX A;  3SXY A;  1WSU A;  3IWZ A;  1OR7 A;  2Q1Z B;  2YVX A;  1MBJ A;  2AQE A;  4IQ4 A;  4DBQ A;  3DF8 A;  4MQ9 F;  1R6R A;  3E1S A;  2JA6 J;  3AG4 H;  3G6E I;  3L2W A;  2NOJ B;  2K86 A;  4OIQ F;  4KJZ A;  5B1B H;  4OMY A;  4UUS A;  5FD6 A;  2L7K A;  1MZB A;  1ON1 A;  2YX7 A;  1JGS A;  5C44 J;  3WTU C;  4MIM A;  1FIA A;  3H92 A;  3VYT B;  2XIG A;  1R5H A;  3CJR B;  5IP9 J;  1S9H A;  2OAZ A;  4OAY A;  2QWW A;  2HZT A;  4DIQ A;  1SAN A;  1QNT A;  3QPL A;  3GF2 A;  1YJW I;  4A0Y A;  2LRE A;  1HKS A;  2DPU A;  3F1B A;  1OIS A;  2Z99 A;  3J7Y J;  1IO2 A;  4HKU A;  4AIH A;  3L9F A;  4E7J A;  2OCE A;  1QQI A;  3GEZ A;  4DYC A;  3GVA A;  3LWJ A;  2JA5 J;  1IN4 A;  4KIF A;  3R0A A;  2UXN A;  3M7G A;  3JRA A;  2LF7 A;  1BC8 C;  1H89 C;  4V2G A;  3IC7 A;  1GV5 A;  3GLX A;  3NS4 A;  2PN6 A;  3CMY A;  3J80 K;  2L4M A;  1TWG J;  3HUG A;  1QZZ A;  3Q0V A;  2E5Z A;  3KEQ A;  4D1Q A;  2W7N A;  2R7X A;  2E7X A;  2XSD C;  4BHC A;  3ZQI A;  5J6X A;  1K4S A;  1MD0 A;  1AWC A;  4G12 A;  3ZN0 A;  2O7O A;  2M1B A;  2KLO A;  3LFU A;  4MFD A;  3DQV C;  2NXN B;  2XAS A;  1RKT A;  2W48 A;  1JKR C;  3JR9 A;  1XSD A;  5E3N A;  4IRI A;  4GXO A;  3IHU A;  2PX9 A;  3H0D A;  2RQQ A;  2ZB9 A;  3BJA A;  1BI2 A;  2MC4 A;  4CUG A;  2XRO A;  1ORK A;  2ZCX A;  2FNP A;  2F2E A;  2LDU A;  2J5P A;  2ZJQ F;  1HXD A;  3TQN A;  1QPM A;  4CCJ A;  2R4G A;  4LG3 A;  2DA7 A;  1IG7 A;  2W00 A;  1TP4 A;  4OAZ A;  1K83 J;  3ZPL A;  4ON0 A;  3RD3 A;  1XGN A;  1KON A;  4B3A A;  1YW9 A;  4B09 A;  5FB2 A;  4UB8 C;  5DUK A;  3IH3 A;  2DMT A;  1WJF A;  4MO7 A;  2G7G A;  1XG1 A;  5DAJ A;  1P7I A;  4MLO A;  2VKH A;  5ICF A;  3VEP A;  1HF0 A;  4L9N A;  1SFK A;  3GEU A;  3BZ6 A;  3HE0 A;  3WTV C;  4GYI A;  3V8J A;  2M9H A;  2ZO4 A;  1X2M A;  3BR1 A;  5E1X A;  5JI6 A;  5TRD A;  2DA2 A;  2EIL H;  3EUP A;  2E36 A;  3JRF A;  2ESH A;  3WGG A;  2MGQ A;  2VE8 A;  4OU0 A;  2XV4 S;  4Q47 A;  3ZMS A;  4C2U A;  3LHQ A;  2VT2 A;  4RGX A;  5GTI C;  4BJT A;  1UFM A;  2VJJ A;  4F7Z A;  2G7S A;  2YVH A;  4QPQ A;  2KPM A;  2PMH A;  1XPX A;  2Y0S A;  1WHU A;  3CP8 A;  3F21 A;  2KIU A;  5FFZ A;  4XLP F;  4KIS A;  4M3F A;  1B72 A;  4R8H A;  1T98 A;  3OWT A;  3EYI A;  5LGN A;  1HW2 A;  1X3U A;  4BEH B;  1IC8 A;  2ZJ2 A;  4AD9 A;  2EFW A;  3GCM A;  2K9N A;  3ABK H;  2NVX J;  3QU6 A;  5KHD A;  2ZFU A;  1CGP A;  3ZMD A;  4IVN A;  3VDX A;  4C3J J;  3HC7 A;  5IYC J;  3ABT A;  2ZJP F;  2HQN A;  1OR7 C;  2XGD A;  2XSJ C;  3TW6 A;  1YFH A;  2ZNY A;  4XBF A;  2WB1 A;  3M8E A;  4XK4 A;  3HTJ A;  4OIO F;  2M4G A;  5B1A H;  2ISY A;  3CF5 F;  1JUS A;  2EZL A;  1W1W E;  3DEU A;  3H3V K;  2YX4 A;  3IKT A;  3NI7 A;  2IA1 A;  3K6G A;  4ZYG A;  2GLO A;  1HW1 A;  1EKE A;  2QQ8 A;  1XMX A;  1LQ1 A;  3EYY A;  4NC8 A;  1UJ8 A;  3CJT B;  2R5Z A;  4KUM A;  3OOU A;  5CVU A;  5CVI A;  2FJ1 A;  3BG6 A;  3ZP5 A;  1GVJ A;  3I4P A;  1W7P A;  3IUO A;  4UHT A;  4D9J A;  1ZK8 A;  2Y9Z A;  4XM3 A;  1ZRD A;  3IP4 B;  2F6C A;  5BOX A;  1CQT A;  2CQK A;  5E1Z B;  3GZI A;  3CDL A;  1Y8R B;  1TBX A;  2X1C A;  5DV5 A;  3HZJ A;  3NEU A;  1IRX A;  2VXZ A;  3GTJ J;  4B1R A;  3DTK A;  3MVP A;  3KCC A;  2GXG A;  4WXD A;  1BW5 A;  1HC8 A;  2CFO A;  2XVC A;  3BLY A;  1WJE A;  2O6G E;  2ZXW H;  4NC7 A;  4CYC A;  3KNW A;  2IA2 A;  2L7F P;  2ICW G;  3E0J B;  5E3O A;  1VQM I;  1R36 A;  3FMQ A;  3G71 I;  1OJL A;  3BWG A;  1XB4 A;  1YE9 A;  3LSK A;  2QGU A;  2H6B A;  4NN1 A;  5IY5 H;  4X0G A;  2DTR A;  2MW8 A;  3MN2 A;  1LJ9 A;  3I0T A;  1V54 H;  5H6Q A;  3DPU A;  2WY7 Q;  1QVU A;  2A6T A;  2HQR A;  3I59 A;  3HUG B;  4NQW A;  1U3E M;  1KU7 A;  1HOM A;  1POG A;  1IDZ A;  1R5I D;  2BV6 A;  3K2Z A;  3QU3 A;  3HJE A;  1FNN A;  2K40 A;  2XB5 A;  1XX5 A;  1UG2 A;  2O0Y A;  2P6T A;  2VKE A;  4YIF A;  4CCL A;  4Z2Y A;  4H0E A;  2V1U A;  4QPO A;  3B81 A;  4PGG A;  5DDG A;  1E0E A;  4PJ0 C;  3LL7 A;  3OY9 A;  2D6Y A;  4XOR A;  2L01 A;  2EH3 A;  2PMZ N;  3HSF A;  2IS6 A;  2WUI A;  5K7F A;  3R0J A;  2VQL A;  4E7K A;  3HTS B;  3TMO A;  4HZF A;  3AQS A;  1EH8 A;  5ICC A;  2ID6 A;  3S14 J;  2UXP A;  1BI3 A;  2Z9O A;  2H6C A;  3B6C A;  4XKW A;  4ENJ A;  2XF6 A;  3LA7 A;  2DOF A;  1RET A;  1IZ1 A;  2X6O A;  3O6B B;  2FUG 2;  1J9I A;  2HDW A;  1JTY A;  2OPT A;  3BR0 A;  3FZV A;  2KIQ A;  4R1H A;  1OCO H;  2JVH A;  4FAS D;  5DS9 A;  4YIR X;  3CCE I;  4MQV A;  1UZC A;  2L5Q A;  3KP6 A;  3FXK A;  3QQA A;  5JVG F;  4PGH A;  3MZ8 A;  1J75 A;  2FML A;  4BXX J;  2JPC A;  5BPD A;  1PUF A;  1JI8 A;  2EZK A;  4PJM A;  5C4Y A;  2GIV A;  4LJZ F;  2X85 A;  1W0U A;  4ZDO A;  3W6J B;  1DUX C;  4FCY A;  4QIW N;  1U78 A;  3OYF A;  3RPU D;  4IO9 F;  4M6X A;  4KFC A;  2GQQ A;  3SHF A;  5F6F A;  3CC2 I;  1PP7 U;  1Q1V A;  4GFK A;  4LLG F;  2AS5 F;  3IWF A;  2A5W A;  3I58 A;  3KZI C;  3AKZ A;  3V8L A;  5HBU A;  4CHU A;  2VT3 A;  2OD5 A;  4I02 A;  3WU1 B;  4RGS A;  1BA5 A;  1JHH A;  2XGC A;  5F0F A;  3B02 A;  1VQ4 I;  3GTM J;  3H9J A;  2HQ5 A;  3HIF A;  2CV2 A;  2X9D A;  2GA1 A;  5BNG A;  5GAE J;  4HNV A;  2PFV A;  1E3P A;  2IVM A;  4U88 A;  2E19 A;  2HR3 A;  1OMI A;  1TNS A;  4CZC A;  5H6R A;  2LVS A;  1R4M B;  3M8F A;  1OQY A;  3KFW X;  4KN4 X;  2Z16 A;  5D1R A;  3J7A O;  1ZKG A;  1N78 A;  2DDB A;  4DJA A;  2Z5U A;  3E97 A;  5KAF C;  4C2T A;  2X0L A;  4LG0 B;  2XAH A;  4CGZ A;  4XN3 A;  5BQT A;  1BIB A;  1WI9 A;  4O3M A;  1V5G A;  1Y6I A;  3D5R C;  1XSV A;  4OD4 A;  4KIG A;  2L02 A;  1MMS A;  2YU3 A;  1ETO A;  2OTL I;  3HRS A;  1HW5 A;  2DA1 A;  1ZGW A;  2GAU A;  3ANG A;  3W2W A;  2STW A;  2KT0 A;  4DGW B;  2KP6 A;  2QLZ A;  2DTZ A;  5EEG A;  1W7P B;  2GWR A;  1DGR M;  3FKJ A;  3GFM A;  3PNT A;  5ILU A;  5J1R A;  1USS A;  3WGI A;  5HLT A;  1ZAR A;  2VPL A;  1TW3 A;  3WTY C;  2XKO A;  4HW0 A;  3GX4 X;  2CO5 A;  2FBI A;  2XRL A;  4BJ6 C;  1MW7 A;  3SZP A;  5HNF A;  3G2B A;  5EEH A;  4GFL A;  2M8E A;  5ILS A;  4XLE A;  3ZQ7 A;  2ZSI B;  2A3S A;  3I9V 2;  1ZG5 A;  4A3K J;  1MSE C;  4LIT A;  3KP2 A;  3SFZ A;  5HAW A;  5L3F A;  1WKM A;  1Z67 A;  3ZQH A;  3IL2 A;  5AIQ A;  4E7H A;  3VOK A;  2JTV A;  2K4B A;  1P4W A;  2PEX A;  4I6Z A;  2UXX A;  2ZBK A;  3KZY A;  3VB2 A;  3RYP A;  3S1N J;  4EJU A;  1R49 A;  2K9M A;  3CJN A;  2QSH X;  1OFC X;  3IH4 A;  3PM1 A;  1PP8 F;  3S16 J;  1JXS A;  1WCM J;  3DKW A;  1SFO J;  3H1C A;  4NQW B;  3ZGK A;  1STZ A;  1YYV A;  4ZZL A;  3ZQG A;  1MMA A;  5TIS C;  4R79 A;  2JPB A;  4HPQ A;  2Z1D A;  4HLX A;  3ZRG A;  3OYI A;  2L7Z A;  4JQF A;  3IRQ A;  1U5T C;  3VW2 A;  2DFH A;  3HOW J;  3CCM I;  3HOT A;  3SQN A;  3HOY J;  3LST A;  2WV0 A;  2XHK A;  2W25 A;  3MFK A;  2LD5 A;  4HYE A;  2MLG A;  4M73 A;  3SEQ A;  3ZMV A;  2HXI A;  2LBF A;  5BMZ A;  2H8R A;  2DA6 A;  2JRT A;  4XLH A;  4XNF A;  2HKO A;  1FYK A;  3PAS A;  4BXF A;  3PIP F;  2FF4 A;  2WAF A;  5E3L A;  4UV9 A;  1B59 A;  5LHI A;  3ELK A;  3Q5F A;  3P9K A;  2XRN A;  3ZQC A;  3OOP A;  2QEX I;  2NX4 A;  2W1O A;  5AIP A;  4E4H A;  1QBJ A;  4XKB A;  4OMZ A;  4U0W A;  3JRE A;  4XRF A;  4E7S A;  4NBQ A;  3H3Z A;  5JR3 A;  3DBL B;  1GHC A;  3DBR B;  1N75 A;  3U1D A;  3FBN B;  1PUF B;  1QPI A;  3V6G A;  2VBW A;  2BY1 A;  1XDU A;  4II3 A;  3LSG A;  5LD2 C;  5FMP A;  1RES A;  9ANT A;  4BS9 A;  2GM4 A;  1XN7 A;  2HYT A;  4ASN A;  4HNU A;  3WTS C;  2CJJ A;  4JP0 A;  4AYB A;  4ZYH A;  4AIJ A;  1UI6 A;  2HWV A;  1VFC A;  1B4A A;  2E1M C;  4XIC A;  4U9L A;  3P9I A;  1XTA A;  3V7R A;  2R92 J;  2AXL A;  3H5R A;  3GTK J;  1Y0U A;  3OYC A;  1K79 A;  2VBX A;  1JHF A;  2UWM A;  1R5G A;  1TL8 A;  2LNB A;  2M2E A;  4DOZ A;  2JSP A;  3QOD A;  4KT6 A;  4BXU A;  2WWY A;  4ZTF A;  3PPB A;  2OZ6 A;  3BC8 A;  4LD5 A;  3OSG A;  1JKO C;  4XSX F;  4AU7 A;  1AHD P;  3BRU A;  2LR8 A;  3T6N A;  1GUU A;  5J47 A;  3QPS A;  1AOY A;  5J40 A;  3S93 A;  4X6A J;  3I55 I;  3BY6 A;  2IGN A;  3E5X A;  3PJR A;  4ZYD A;  4KNY A;  1W4M A;  3K70 C;  3JCU C;  4EJW A;  3ANP A;  5HDG A;  3BTC A;  1FP1 D;  4WXC A;  3S5R A;  1U8R A;  2ELK A;  4Y13 A;  3M07 A;  3A1Y A;  2XF5 A;  3T8T A;  2P5L C;  4ZZD A;  2KIS A;  1LVK A;  4A3L J;  4JK1 X;  3OMY A;  5GPA A;  4P9F A;  2BVM A;  1UG0 A;  2W53 A;  1R58 A;  2OUM A;  4ZH4 F;  3BNI A;  5K5Q A;  4O5V A;  2EZH A;  1FMV A;  2DXI A;  4GGG A;  2WAQ A;  2OCC H;  4ENK A;  3VSK A;  3Q9V A;  2OER A;  1HLV A;  1RRJ A;  4PXI A;  2W82 A;  2E2J J;  1AU7 A;  1K6O A;  3CO6 C;  2VQC A;  2L54 A;  2EV5 A;  2DOD A;  4M6Y A;  1EA3 A;  1RPW A;  4LIU A;  5D4R A;  4RM3 A;  5FLV A;  3FDY A;  1K4T A;  2JQ7 A;  4BAY A;  2MH9 A;  2MYS A;  3TGN A;  4E70 A;  2IGM A;  3LWF A;  3UR3 C;  3FRQ A;  3TW7 A;  1WJA A;  2LK2 A;  1YIJ I;  1LB2 A;  1SFX A;  2ECB A;  3E7L A;  4PJJ A;  3C2B A;  4A93 J;  4M3G A;  4HOB A;  2DQR A;  3PQJ A;  4B8X A;  3IV5 A;  3BTI A;  3HOV J;  2EWN A;  3BR3 A;  3L7W A;  3P9C A;  3F23 A;  4IRV A;  2A61 A;  1FBS A;  2OQR A;  1CF7 A;  4Y52 J;  4U87 A;  2GA2 A;  2CV0 A;  3ON2 A;  1FPQ A;  1RIO H;  2YVE A;  4GO1 A;  1X3W B;  3S1Q J;  4MNU A;  3CUQ A;  2LRD A;  1TWA J;  5KAI C;  2F07 A;  4IKF A;  5EGO B;  2G7L A;  3E6D A;  2LLK A;  4YEJ A;  1J09 A;  4B43 A;  3C07 A;  3OYA A;  1YRN B;  1FSH A;  2DA4 A;  2VJ5 A;  5IT9 K;  1FEX A;  4WK8 F;  2QQ9 A;  4LOC A;  3K4K A;  3T5X A;  2RQP A;  1TWH J;  4IHT A;  2JSC A;  3T8R A;  5K58 A;  2DW4 A;  3F0C A;  1WJC A;  1A36 A;  3OYD A;  2BXZ A;  1SEU A;  1HKT A;  4YII A;  4CH7 A;  2XB0 X;  5IOY A;  2L9N A;  5DUI A;  1D1B A;  2BZT A;  2YPR A;  1K61 A;  2P7V B;  3RDI A;  2FSW A;  1VQN I;  3WTX C;  3JRH A;  2F4O B;  3KYL A;  2CV1 A;  3K4L A;  2PJR B;  1S7E A;  2LY2 A;  2GZW A;  3HTU A;  4IF4 A;  3LQR A;  4IJA A;  2HU9 A;  4FE4 A;  4BQQ A;  2PLY A;  4IHW A;  4JX5 A;  4H4K C;  3OS1 A;  5GAG J;  2STT A;  2VON A;  2V1X A;  4UY8 I;  1MMD A;  2VI6 A;  4S05 A;  2DG8 A;  1WVR A;  3KEY A;  1B8I A;  3Q9S A;  3HPG A;  3OYB A;  1AKH B;  1MMG A;  4EGY A;  5D5U B;  3L2Q A;  5M5X J;  2MG4 A;  5L3B A;  2FX0 A;  3LNQ A;  3K1P A;  3K0L A;  1X58 A;  3JRD A;  2HNH A;  3MZH A;  2DYR H;  1MBG A;  2DK8 A;  4L18 B;  2JA7 J;  3C18 A;  4A3M J;  3VWB A;  1QVT A;  2HOT A;  1FY7 A;  1YG2 A;  1ZHF A;  2EJR A;  2JUG A;  4RAY A;  1LFB A;  2HZD A;  4LLL A;  3ZR8 X;  3OYL A;  5L3E A;  4BAC A;  4L9V A;  2KIF A;  2K9S A;  1HA8 A;  1MH4 A;  1X4P A;  3KYD B;  3JAM Z;  3S8P A;  1FBU A;  4W1U A;  3JSJ A;  4M74 A;  5CLS A;  3VUQ A;  4EGZ A;  1LEB A;  1K78 A;  1FYM A;  3C3W A;  2QA4 I;  3N97 A;  2QIB A;  2V1D A;  2EBI A;  2LY9 A;  5FRN A;  1UHW A;  3BG3 A;  5CW8 A;  3PSI A;  3HTH A;  1KQ9 A;  1PJR A;  2CWE A;  2F4M B;  2EK5 A;  4PSX A;  3RJP A;  1T33 A;  1R7J A;  4A3G J;  2WAD A;  1RI7 A;  2FBH A;  3RQI A;  1JT6 A;  2ZFW A;  2E7W A;  3CDI A;  5D8K B;  4P9U A;  5L3G A;  1L3L A;  5KVR A;  1WGX A;  5EFY A;  1ENH A;  4GCV A;  4FET A;  2CW0 F;  2ZCW A;  3PO2 J;  3BTL A;  2FMY A;  4FQG A;  1ETQ A;  3HTA A;  3DU6 A;  2DO7 A;  3LSJ A;  4BJ5 C;  3W6K B;  2M8G X;  2JZY A;  3CUO A;  2LYC A;  1KYW A;  2A05 A;  2CFX A;  4Q48 A;  3EDP A;  3VOE A;  5E8I A;  4F3Q A;  3ECH A;  1R23 A;  2ZXJ A;  4AC0 A;  2VOP A;  4NEL A;  1J59 A;  2M45 A;  1FOX A;  3PL8 A;  5E79 C;  2C6Y A;  3NRG A;  2Z2S B;  4IOC F;  3BG5 A;  1RR8 C;  3VOD A;  4GCT A;  2ZME C;  4XOP A;  3HG9 A;  1G3W A;  2QTQ A;  2QZ8 A;  3TBI A;  1IN7 A;  3KEO A;  5E1W A;  2R7R A;  2K5C A;  2FEZ A;  2AHQ A;  5FGL A;  1APL C;  4XLA A;  5C3E J;  4WF2 A;  4J01 A;  2LSO A;  3D0S A;  5LRR A;  4PFO A;  2DMQ A;  2HTS A;  1PUE E;  2X1D A;  3BR6 A;  3DFG A;  3O8H A;  4XON A;  1QZY A;  2NVQ J;  3CUQ C;  2N8G A;  2VQH A;  5D8L B;  4C9Y A;  3KET A;  3KP7 A;  3MEX A;  1W5S A;  1DDN A;  2Q2E B;  3OIP A;  1V5F A;  4A3J J;  1LFP A;  4ENN A;  3H9Q A;  4E7Z A;  3CLO A;  1UAA A;  4P5O A;  1U6G A;  4RMN A;  4CCM A;  2EIK H;  4O6J A;  3OYG A;  3VOX A;  1LKX A;  3K4N A;  2LKX A;  2B1E A;  2CQ7 A;  2X4H A;  4XL9 A;  2I8D A;  2L9R A;  4BBR J;  4F91 B;  1ETK A;  2JWT A;  3FXR A;  5FGM A;  1QU3 A;  3WGH A;  1KQ8 A;  1OYW A;  1KQ0 A;  2BY3 A;  1CF7 B;  3U2R A;  2M7A A;  3BT9 A;  2XDV A;  1TWF J;  2KQR A;  2XGX A;  3M8J A;  3G1L A;  3GUD A;  2NAZ A;  5LFA A;  4M9X A;  3ROU A;  3CTA A;  4LK0 F;  3WHB A;  2BVL A;  3DPT A;  5HOO A;  1VQP I;  3H5A A;  2H09 A;  4RB1 A;  2GOM A;  1TT5 B;  2NS8 A;  4YZE A;  1UEL B;  3PSF A;  1O7F A;  4U0Y A;  2WY8 Q;  3VVZ A;  1E2X A;  3A0B C;  3H36 A;  4UVC A;  3H9G A;  3TKY A;  2A2F X;  2DJI A;  3JSO A;  2NS0 A;  1VND A;  4YFN F;  2A5Y B;  2IS1 A;  2OTJ I;  3CO7 C;  3L2U A;  1D0X A;  2HGC A;  2KMU A;  4X1E A;  5GTH C;  4BY1 J;  3CDH A;  4Z6Y A;  1XDS A;  2XAG A;  4ME9 A;  4PSW A;  2BY0 A;  3L2R A;  4E7L A;  1RUO A;  3CME I;  5BS6 A;  3F8N A;  4K2E A;  5JHF A;  3SZG A;  1FSE A;  4C3I J;  4NHJ A;  4BYY A;  2H27 A;  2P81 A;  3CP2 A;  3E7Q A;  3BCG A;  4HQM A;  2P4W A;  1EV7 A;  1SVL A;  5HDK A;  4M71 A;  1ZRE A;  1DU0 A;  3CJD A;  3LSR A;  3OV8 A;  4BDY A;  5ILV A;  3ERE D;  3QOE A;  2XPW A;  5DEQ A;  4XMY A;  4UVB A;  1MH3 A;  4BE0 A;  3S3N A;  2K4J A;  2G3B A;  2Y0S N;  4UUS B;  2EIN H;  5A2Q Z;  4RAG A;  2BHY A;  2VN2 A;  2P5V A;  4A5N A;  1XSX A;  1ZG3 A;  1T56 A;  5HDN A;  3GTP J;  1MKM A;  4GRI A;  3TO6 A;  4UUV A;  2W24 A;  1NHA A;  3D1N I;  2ME6 A;  2E34 A;  5LHH A;  1TQM A;  1U0J A;  2P5K A;  4Y17 A;  3NQO A;  3Q0U A;  4PJL A;  2I10 A;  3FK6 A;  1K78 B;  4ZC3 A;  3K4J A;  1YO5 C;  1DPU A;  3AQT A;  2BW3 A;  4IRH A;  1J5Y A;  5FD5 A;  3E6C C;  2PMZ A;  1VQ7 I;  1R9T J;  4MEX F;  2A6E F;  3K8P C;  1MBK A;  3A03 A;  3S2D J;  1I1G A;  4BNC A;  1DP3 A;  4A3B J;  2R93 J;  3GLL A;  1UB9 A;  2ZCM A;  2VKD A;  3BQY A;  5H9T A;  3DV8 A;  4WXH A;  4KWA A;  5FLX Z;  1LFU P;  1XCB A;  3BP8 A;  1XS9 A;  2D5V A;  2V57 A;  2B7E A;  2CMP A;  1EH6 A;  4FT8 A;  1BM9 A;  2QBY A;  2VOD A;  4OIR F;  2VKV A;  4M3E A;  3DTE A;  5IP7 J;  3L09 A;  4HDV A;  1XGM A;  2QQB A;  2TDX A;  4HBL A;  1VTN C;  2QF7 A;  1O3T A;  2D1V A;  1ZH5 A;  1Z0X A;  2MFZ A;  3TED A;  4DBR A;  2FOK A;  1W5C C;  5F1R A;  3K9T A;  3MQ0 A;  3GZ6 A;  4LMY A;  2ZOZ A;  1Z05 A;  2Y2Z A;  4UB6 C;  2IW5 A;  2UXI A;  1V55 H;  2V9K A;  4IZZ A;  1IRF A;  3LSH A;  2XDN A;  3VYS B;  2GFN A;  3C2H A;  3G1M A;  2XAJ A;  4B44 A;  3S2H J;  1NK2 P;  5CQG A;  3VYR B;  4QTR A;  1MSF C;  1RUN A;  4U9N A;  4HF0 A;  1S6L A;  2EV0 A;  4IHV A;  2RC4 A;  5B3S H;  4P96 A;  1J7K A;  2GOX B;  1ODD A;  2ECC A;  3HEF A;  1BBY A;  1IUF A;  1U5T A;  4YG2 F;  4HX7 A;  1X1C A;  2BEO A;  2XF7 A;  4IHX A;  3RIR A;  5HLI A;  2UV1 A;  3PIO F;  2IP2 A;  3K4C A;  3G73 A;  4BHP A;  1RNL A;  2NVY J;  4A12 A;  4S0H B;  2P7C B;  4AC6 A;  1YW8 A;  3ZQF A;  1SVM A;  2R7O A;  3AFH A;  4ZDP A;  1F9N A;  3HOS A;  4V2F A;  1D8J A;  4UV8 A;  3OYK A;  3S3O A;  5FLX K;  3F8M A;  1X1D A;  2IS4 A;  2O61 A;  4N9H A;  3B6A A;  2RKH A;  4FTH A;  4JX4 A;  5ED4 A;  1P7J A;  5J3L A;  6PAX A;  2L0K A;  1WJD A;  3AAF A;  4CCN A;  2VQG A;  3TP3 A;  3KLN A;  2PQ8 A;  1FTZ A;  5AQC A;  5D19 A;  4GCK A;  2NYX A;  2WBM A;  3HXL A;  3T0Y A;  4MXM A;  1B72 B;  3ASO H;  2DFE A;  3PFY A;  3ZMU A;  4KDP A;  3O60 A;  1KGS A;  3WTT C;  5L3D A;  4L9T A;  3LSP A;  2KDO A;  3IAM 2;  5LGT A;  3QYB A;  3J7Z I;  1UHS A;  2MH2 A;  2IU5 A;  5K7H A;  4EM1 A;  1SMT A;  1JT0 A;  3NNR A;  2WTE A;  1H88 C;  4JNN A;  1Z9C A;  2JA2 A;  3TO9 A;  4RAZ A;  2JVG A;  3S2W A;  2HVQ A;  2V6C A;  2DFI A;  4I99 C;  2VL8 A;  4PCQ A;  2DA3 A;  1ZYR F;  2A68 F;  3FHZ A;  1T39 A;  1YW7 A;  4D5F A;  3CCL I;  3CC4 I;  1D8K A;  4L9J A;  1IXR C;  3RYR A;  3DEW A;  3TDZ C;  5FRM A;  3V78 A;  5IPA A;  1IRZ A;  2R7T A;  3QP6 A;  3U21 A;  4J00 A;  3BJO A;  2R7U A;  4FIS A;  1L0O C;  4HX8 A;  4B47 A;  2F5V A;  4G7H F;  1MBF A;  3IKV A;  1LNW A;  3D5S C;  3NRV A;  2R5Z B;  3CMA I;  1T2K A;  2QCO A;  3BCB A;  1MJ9 A;  1IV6 A;  4M9S A;  5JHU A;  3DLL F;  2VUM J;  1MBH A;  2HDD A;  1T08 B;  1WJB A;  1R71 A;  3L00 A;  1Z7L A;  2WV1 A;  2KRF A;  2KIM A;  3QPT A;  2FA5 A;  4BQO A;  1VQO I;  3GXO A;  4HF1 A;  4HV6 A;  1JGG A;  2JN6 A;  4IX7 A;  1TZL A;  5H20 A;  5GAH J;  3BRO A;  1ACI A;  3CCV I;  3GBG A;  4XR6 A;  4OWR B;  4AF5 A;  2EFQ A;  4CYC B;  3BPV A;  2HQA A;  3EUH C;  1YX3 A;  1U8B A;  4DW6 A;  4EEF G;  3HGY A;  3I3L A;  2ELJ A;  1LE8 A;  3HM5 A;  4WWC A;  1RC9 A;  1X3Z B;  2MC3 A;  3GYH X;  3S15 J;  2MBF A;  3HKZ N;  3EGQ A;  4HNT A;  1IRG A;  1ZTR A;  2F5D A;  3K4B A;  1UCR A;  1T0F A;  4L62 A;  2Q24 A;  2X1E A;  3WHC A;  3ULQ B;  2YSR A;  4NC6 A;  5FKN A;  5IP6 A;  2W85 A;  3I59 B;  4XLF A;  2XAQ A;  4F55 A;  1TQP A;  3W6V A;  3SDG A;  3O3K A;  3JSP A;  1MGT A;  4XLC A;  4G6Q A;  1HBX G;  2KRH A;  1YHQ I;  1SFU A;  4F93 B;  3VVX A;  3C1D A;  2DOA A;  2VJI A;  2I5U A;  2M4K A;  3U9G A;  5IOZ A;  2O8X A;  4MK6 A;  2QKO A;  4KMF A;  2ISZ A;  1MNM C;  4WX9 A;  1QA6 A;  4CDG A;  2RAE A;  3ZQQ A;  1I50 J;  1G3S A;  3BDD A;  1OKR A;  2FE3 A;  2E5N A;  3HSR A;  3F72 A;  2BBY A;  2RDP A;  2MAB A;  1LUJ B;  4W97 A;  5FLM J;  1O4X A;  3NXC A;  3RPU A;  4KA4 A;  1QZE A;  1BN5 A;  2O03 A;  4GYG A;  4QLC U;  1U5T B;  3RKX A;  5M5W J;  2MA3 A;  3T1B A;  1IAW A;  1MNE A;  2RV8 A;  4AVZ A;  1MIJ A;  2R7Z J;  4ZTJ A;  3HHG A;  1G3T A;  3FXO A;  2DMN A;  4EV0 A;  3QBM A;  4DYR A;  3K2A A;  4KMU X;  2CSO A;  4HX4 A;  4NB5 A;  2IRF G;  4ICH A;  3G4S I;  1LDJ A;  3KKC A;  1YQA A;  3CCY A;  5EG0 A;  2FU4 A;  2IA0 A;  2MD5 A;  3S1M J;  3RSN A;  3MCZ A;  3CCR I;  1O3S A;  5EDN A;  4MFE A;  2EFO A;  4HV5 A;  5FKM A;  3M4O J;  2HTJ A;  2O9L A;  2K7L A;  1SD4 A;  2DYS H;  4D7M A;  4HF2 A;  4MHG A;  1XCV A;  4G94 A;  2FOW A;  3WTW C;  4ZJZ A;  3AG3 H;  3AG2 H;  4DZJ A;  5LGU A;  3LAP A;  2EV6 A;  4A3C J;  4L5I A;  3OYE A;  4AID A;  3L2V A;  2DT6 A;  2D45 A;  1PYV A;  2V79 A;  1N25 A;  1D3Y A;  1S5L C;  2R7W A;  2HPM A;  1G6N A;  4ESB A;  1WH7 A;  3ABL H;  3S3M A;  1BR1 A;  1I6H J;  1R1U A;  2OI8 A;  3WE2 A;  4ITV A;  3FXM A;  3OIO A;  3HOX J;  3OL3 A;  2H1K A;  2P0W A;  2K27 A;  3EQL F;  1Z3X A;  3CCQ I;  4XRS A;  4YRV A;  2H1L A;  4A5M A;  2ZC2 A;  1BJA A;  3G1O A;  4IL6 C;  1OYY A;  3KP3 A;  2E1M B;  2Y31 A;  5AON A;  1LVA A;  1WI3 A;  4RB2 C;  5ICE A;  2LH9 A;  3GTQ J;  2PFB A;  5LLQ A;  3ZOB A;  4B3X A;  3MKY B;  3MKW B;  2QVO A;  1B6A A;  2GEN A;  1BI1 A;  4RGU A;  5TGT A;  1SD7 A;  1ZGA A;  2ELH A;  4EM2 A;  3O2P E;  2K85 A;  2KHM A;  4C30 A;  1J0R A;  1IXS B;  5FHP A;  2DT7 B;  2QYO A;  2PBI A;  3Q0W A;  3SEZ A;  3WU0 A;  1MJA A;  1ETX A;  3J81 Z;  2G7H A;  5F64 A;  4M9Z A;  3LA3 A;  3WU2 C;  1T0F C;  3PFI A;  2HYF A;  4RGR A;  1JUP A;  2CQX A;  3TL4 X;  4ZYE A;  5D5X B;  1GV2 A;  3F22 A;  3SWH A;  1P4A A;  3QYE A;  2IAI A;  1P6R A;  2VBY A;  1X2N A;  3K1N A;  4ABZ A;  3S17 J;  5JFR A;  1MBE A;  4N9I A;  2QKM B;  4XQF A;  1PDN C;  3A01 A;  2GXA A;  2IS2 A;  2LTP A;  1FLI A;  4WIB A;  1ON2 A;  2ZME A;  2MSY A;  4RS8 A;  4M72 A;  2DJN A;  1R22 A;  2RRE A;  1LE8 B;  3IAS 2;  1T38 A;  5TJJ A;  2UUZ A;  3DP7 A;  3GWZ A;  2WA0 A;  2VC0 A;  4Y33 A;  4YEL A;  1A31 A;  3BZK A;  1BIA A;  2H8W A;  2OA4 A;  3E6M A;  1WZ2 A;  2FRH A;  5LHG A;  3CES A;  3G3Z A;  4AM3 A;  2P8T A;  2QEN A;  3K4M A;  1O3Q A;  3F6O A;  1BOB A;  3GTO J;  2QSF X;  2DCE A;  2A69 F;  2COB A;  4AVP A;  1QHH D;  2DI3 A;  3BTJ A;  1ETW A;  3IH2 A;  1ZGJ A;  3KP4 A;  3KYC B;  4UUT A;  3EET A;  5LBQ A;  1FIP A;  1S3J A;  4JX6 A;  5IYB J;  2L9V A;  2F4I A;  1Y56 A;  4FX0 A;  2DFF A;  3F3X A;  3V7C A;  1Z6T A;  2R5Y A;  2UXO A;  5FFX A;  1Y39 A;  4L5E A;  4F92 B;  2DDA A;  1ZEL A;  2JK3 A;  4BE1 A;  5DYM A;  3RH2 A;  1MJB A;  4EVI A;  4D5C A;  2CQN A;  1X4O A;  3HYI A;  2LBF B;  1Z7U A;  2LG4 A;  1KU9 A;  2EZI A;  3BG7 A;  3L1P A;  3CF2 A;  4BBS J;  3BCA A;  2YU9 J;  2NS7 A;  4EQQ A;  3COL A;  4KIC A;  4JYK A;  3R4K A;  1F5T A;  2DU9 A;  3DU5 A;  2LKP A;  2OJE D;  3DXJ F;  2RAS A;  4PUS A;  2VB6 A;  1DGW Y;  1HDP A;  4XKC A;  2RHA A;  3GME A;  3DCF A;  4C3H J;  2HPI A;  3RI4 A;  1SC7 A;  2HKU A;  3HB9 A;  1JJ6 C;  1TT0 A;  3BQZ A;  2QQA A;  1TWC J;  1E17 A;  4U7B A;  4LB5 A;  1I5Z A;  3B73 A;  4OD5 A;  4G7O F;  4S04 A;  4DQ2 A;  3KE2 A;  2V26 A;  2MLK A;  2HYG D;  4HA8 A;  3F8B A;  4F52 A;  4M6V A;  3WE3 A;  5EF6 A;  4G6D A;  2UZK A;  4L5J A;  2B63 J;  2VXD A;  5D5V B;  2F5C A;  2W4S A;  1T6S A;  4C2M A;  1FWZ A;  3RCO A;  2EIJ H;  3ESW B;  5F04 A;  3MKL A;  1V5E A;  2KL4 A;  2F48 A;  2KRC A;  3QYF A;  3GTL J;  1GXQ A;  3C7J A;  5EZG A;  3QOP A;  4J19 A;  2PJP A;  1FBQ A;  4CCO A;  5J8C A;  3ABM H;  1XD7 A;  3PUB A;  1A5J A;  3MMY B;  2PZ9 A;  3UNG C;  3DLA A;  2HEO A;  1O7L A;  5DCM A;  1RZ4 A;  2IPQ X;  4Y3O A;  3FWE A;  2QKL B;  4CIC A;  1D0Z A;  5FJ8 J;  3FIS A;  2KKO A;  5L3C A;  4IHY A;  5K5O A;  2FJI 1;  2BY2 A;  1Z1D A;  1OCZ H;  1G59 A;  1BR4 A;  2W84 A;  2KDZ A;  2V1N A;  1W7P D;  1F4K A;  3H35 A;  1GLN A;  4KIT B;  4GCL A;  2XPV A;  3ML6 A;  4RBO A;  1IUY A;  1Z6R A;  2DBB A;  3OYN A;  2XPU A;  1V4R A;  2KJC A;  1EJ9 A;  2HOE A;  4BE2 A;  5K7Z A; 
#chains in the Genus database with same CATH homology
 2XRL A;  4A3B J;  4IEJ A;  2R93 J;  1F43 A;  5FKK A;  2ZCM A;  3BQY A;  5H9T A;  4GFL A;  4KWA A;  3NAU A;  1LFU P;  1XS9 A;  4XRS G;  2D5V A;  3DPJ A;  1MSE C;  4A3K J;  2V57 A;  5HAW A;  3ZQH A;  3O8G A;  2VKV A;  3HBL A;  4M3E A;  5F08 A;  5IP7 J;  2CQQ A;  3VOK A;  2QF7 A;  1BL0 A;  4DYQ A;  2YS9 A;  1Z0X A;  4I6Z A;  3K7A J;  1G2H A;  1RKW A;  3TED A;  4I76 A;  2WGB A;  5HOD A;  3S1N J;  1OFC X;  3IH4 A;  3PM1 A;  2Y2Z A;  2ZOZ A;  4C2M J;  3SFI A;  3S16 J;  2UXI A;  3H0G J;  1WCM J;  3BHQ A;  5CXI A;  1SFO J;  2IEK A;  2XDN A;  3ZQG A;  3A01 B;  3LJL A;  2GFN A;  3G1M A;  3G7R A;  2DA5 A;  2HYJ A;  3S2H J;  3CRJ A;  1NK2 P;  2K9Q A;  4D7N A;  1MSF C;  4QTR A;  2XGE A;  2L7Z A;  3HTI A;  4IHV A;  1E3O C;  3VW2 A;  3TP0 A;  1I3Q J;  3HOW J;  3HOY J;  2ECC A;  3HEF A;  1IUF A;  2LD5 A;  2TCT A;  1ZQ3 P;  3MNL A;  4IHX A;  2HXI A;  2QOP A;  2H8R A;  2DA6 A;  2DMU A;  5F0C A;  4CGR A;  3ON4 A;  3S1R J;  2WAQ N;  4M3B A;  3JRB A;  3PAS A;  1U9N A;  3BR2 A;  5EZH A;  2NVY J;  4Y7N J;  4S0H B;  2NP5 A;  4AC6 A;  3ZQF A;  5E3L A;  5EYR A;  4V2F A;  4A69 C;  3HOU J;  2L7M P;  4A3I J;  3KZ9 A;  3ZQC A;  1WPK A;  2R5Y B;  5CXG A;  3B6A A;  4FTH A;  4JX4 A;  2NX4 A;  1P7J A;  5J3L A;  3SJM A;  2L0K A;  3IUV A;  2PBX A;  3TP3 A;  3JRE A;  1FTZ A;  5AQC A;  3CWR A;  5D19 A;  4GCK A;  1WH5 A;  3BG9 A;  4MXM A;  2DMP A;  1B72 B;  1PUF B;  1QPI A;  1HCR A;  3V6G A;  1UMQ A;  2JMW A;  3O60 A;  3UKG A;  2Y30 A;  3LSP A;  3G56 A;  2JA8 J;  3LSG A;  1RR7 A;  5FMP A;  1RES A;  1UHS A;  5EG0 B;  5K7H A;  2IU5 A;  1BJZ A;  4FE7 A;  9ANT A;  2GUH A;  5F27 A;  1JT0 A;  3NNR A;  1H88 C;  3CQZ J;  2GM4 A;  4JNN A;  2CU7 A;  2HYT A;  3NAR A;  2FD5 A;  1B8I B;  2CJJ A;  4JP0 A;  1UI6 A;  2GBY A;  2HOA A;  1VFC A;  1DU6 A;  4XIC A;  2DA3 A;  1MBJ A;  4D5F A;  1EF4 A;  2R92 J;  3GTK J;  2JA6 J;  1JUM A;  3DEW A;  3VIB A;  2QWT A;  3V78 A;  5IPA A;  1NK3 P;  3FIW A;  4UUS A;  1IRZ A;  5C44 J;  4GFB A;  2M2E A;  3VW0 A;  4MIM A;  4FIS A;  3RKQ A;  1SGM A;  1FIA A;  3PPB A;  3OSG A;  1MBF A;  5IP9 J;  1JKO C;  1AHD P;  3BRU A;  2EQR A;  2LR8 A;  2R5Z B;  3T6N A;  1U9O A;  1GUU A;  3QPS A;  1SAN A;  2QCO A;  3QPL A;  5C4X J;  1IV6 A;  1VI0 A;  4X6A J;  1H8A C;  2VUM J;  1MBH A;  5M5Y J;  3F1B A;  2HDD A;  4HKU A;  2WV1 A;  4DYC A;  2WB1 N;  3ANP A;  3LWJ A;  2JA5 J;  3BTC A;  1JGG A;  3JRA A;  2ELK A;  3S5R A;  1H89 C;  4V2G A;  2HXO A;  1GV5 A;  2JN6 A;  3CMY A;  3PO3 J;  1ZR4 A;  1TWG J;  4A3L J;  3Q0V A;  5GPA A;  3GBG A;  4AF5 A;  2W53 A;  2XSD C;  2ME0 A;  4CYC B;  2M0C A;  3BNI A;  1U8B A;  4DW6 A;  3ZQI A;  2EZH A;  3HGY A;  4EEF G;  4G12 A;  3HDD A;  2O7O A;  1LE8 A;  3HM5 A;  5J1U A;  1IDY A;  2OER A;  4MFD A;  1HLV A;  3S15 J;  3BR5 A;  3HKZ N;  4PXI A;  2E2J J;  1RKT A;  1AU7 A;  2W48 A;  1JKR C;  1ZTR A;  3JR9 A;  5E3N A;  4XID A;  3EGQ A;  3VVY A;  4L62 A;  2Q24 A;  3WHC A;  2X48 A;  3M3Y J;  1RPW A;  2ZB9 A;  5IP6 A;  5FKN A;  2LP0 A;  1ORK A;  2YUS A;  2ZCX A;  5FLV A;  2G0E A;  2JJ7 A;  3W6V A;  3SDG A;  2IBD A;  3HIM A;  3ZQL A;  3FRQ A;  2Y9Y A;  3TW7 A;  2LK2 A;  2DA7 A;  1IG7 A;  2CUE A;  2ECB A;  3E7L A;  1K83 J;  3C2B A;  4A93 J;  3VVX A;  3RD3 A;  5F1J A;  4M3G A;  2O7T A;  4B3A A;  2M34 A;  3IV5 A;  3BTI A;  3HOV J;  4RDU A;  3BR3 A;  5IOZ A;  3IH3 A;  2DMT A;  4MO7 A;  2QKO A;  4Y52 J;  3ON2 A;  4MK6 A;  2G7G A;  1XG1 A;  1MNM C;  5DAJ A;  2YVE A;  2NVT J;  1P7I A;  5HSZ A;  2RAE A;  4MLO A;  1ETV A;  3VPR A;  2E2I J;  3S1Q J;  1HF0 A;  2HI3 A;  1I50 J;  1TWA J;  2F07 A;  2REK A;  3GEU A;  3HE0 A;  5EGO B;  2G7L A;  2M9H A;  3BR1 A;  1X2M A;  2DA2 A;  2LLK A;  3C07 A;  4M3D A;  3EUP A;  1YRN B;  3JRF A;  2DA4 A;  2MGQ A;  1FEX A;  4W97 A;  5FLM J;  1FJL A;  4LOC A;  1O4X A;  3NXC A;  3LHQ A;  1TWH J;  5J1Y A;  2LFB A;  2G7S A;  5K58 A;  3F0C A;  2YVH A;  5M5W J;  5IOY A;  2XB0 X;  1K61 A;  2E2H J;  1NTC A;  2R7Z J;  4M3F A;  1B72 A;  1BW6 A;  1IGN A;  3JRH A;  2DMN A;  3QBM A;  4DYR A;  3RZD J;  5C4J J;  1IC8 A;  3K2A A;  1S7E A;  4ICH A;  3KKC A;  4FE4 A;  4QSH A;  2K9N A;  2NVX J;  4IHW A;  4JX5 A;  3P9T A;  3CCY A;  5EG0 A;  5JLW A;  3S1M J;  2DG8 A;  2VI6 A;  4C3J J;  5IYC J;  5EDN A;  4MFE A;  5FKM A;  1B8I A;  3M4O J;  2O9L A;  2XGD A;  4D7M A;  3TW6 A;  1Y1V J;  1AKH B;  1QRY A;  3RZO J;  5M5X J;  2MG4 A;  2FX0 A;  4DZJ A;  4XK4 A;  3LNQ A;  4A3C J;  3HTJ A;  1X58 A;  3JRD A;  2DG7 A;  1MBG A;  2JA7 J;  4A3M J;  1JUS A;  2EZL A;  3KKD A;  1QVT A;  2HOT A;  3H3V K;  1LFB A;  1WH7 A;  3OSF A;  2OI8 A;  2HOS A;  1I6H J;  3NI7 A;  2GLO A;  3NPI A;  1D5Y A;  3OIO A;  1ITY A;  2K9S A;  3HOX J;  1A6I A;  1MH4 A;  1JKP C;  2H1K A;  2FBQ A;  4W1U A;  3JSJ A;  4XRS A;  3VUQ A;  3G1O A;  2R5Z A;  1IJW C;  2ZCN A;  3OOU A;  2QIB A;  2FJ1 A;  5FKL A;  2EBI A;  2UXH A;  2LY9 A;  2Y9Z A;  1ZK8 A;  2Y31 A;  1WI3 A;  3BG3 A;  5CW8 A;  3Q3S A;  3HTH A;  3GTQ J;  1CQT A;  3ZOB A;  3GZI A;  1JTX A;  3CDL A;  5M3F J;  5F0H A;  2GEN A;  5E3M A;  1T33 A;  4A3G J;  3HOZ J;  1ETY A;  3GTJ J;  3RQI A;  1JT6 A;  4B1R A;  3FKI J;  3MVP A;  2TRT A;  3HGG A;  5FHP A;  1BW5 A;  1WGX A;  5EFY A;  3Q0W A;  4A3E J;  1ENH A;  3JRI A;  3PO2 J;  3JRG A;  3BTL A;  3HTA A;  1ETQ A;  4CYC A;  1ETX A;  3KNW A;  3QKX A;  2L7F P;  3LSJ A;  5E3O A;  1FTT A;  2M8G X;  1GVD A;  4XRM A;  1OJL A;  1JUP A;  3LOC A;  2CQX A;  4AC0 A;  4NEL A;  1GV2 A;  2E1O A;  3BJB A;  3NRG A;  4NN1 A;  2MW8 A;  3MN2 A;  2IAI A;  3BG5 A;  4B4C A;  1X2N A;  3VP5 A;  1OCP A;  4GCT A;  1QVU A;  3FK7 A;  4ABZ A;  3S17 J;  2QTQ A;  1HOM A;  1MBE A;  1OCT C;  1POG A;  1IDZ A;  4AUX A;  3A01 A;  2LTP A;  2AHQ A;  5FGL A;  1APL C;  2ID3 A;  5C3E J;  4JKZ A;  2K40 A;  2MSY A;  2XB5 A;  2VKE A;  1UG2 A;  2DJN A;  2DMQ A;  3VW1 A;  1LE8 B;  3B81 A;  3BR6 A;  3O8H A;  3A02 A;  2D6Y A;  2NVQ J;  2N8G A;  2EH3 A;  2PMZ N;  2WUI A;  5K7F A;  3GTO J;  4A3F J;  1JKQ C;  2R0Q C;  4A3J J;  5JLX A;  2COB A;  3AQS A;  3GTG J;  4ACI A;  2ID6 A;  5EGO A;  3S14 J;  3BTJ A;  2UXP A;  1ETW A;  3IH2 A;  4NDL A;  4UUT A;  3B6C A;  1UI5 A;  4A3D J;  1FIP A;  4JX6 A;  5IYB J;  3VOX A;  1YRN A;  3JRC A;  2LKX A;  1RET A;  2O8K A;  2X6O A;  2L9R A;  4BBR J;  1ETK A;  2R5Y A;  2OPT A;  1JTY A;  2JWT A;  3BR0 A;  2UXO A;  4L5E A;  2CUF A;  1VF9 A;  5DS9 A;  2JK3 A;  2NP3 A;  5EEA A;  3QQA A;  2ZOY A;  3RH2 A;  3BT9 A;  4D5C A;  1TWF J;  3G1L A;  4BXX J;  5M3M J;  2DN0 A;  2UXU A;  2EZI A;  3L1P A;  1HDD C;  3WHB A;  1PUF A;  2YU9 J;  4BBS J;  2EZK A;  2NS7 A;  3COL A;  5C4Y A;  1GT0 C;  4JYK A;  1ZR2 A;  1W0U A;  2VPR A;  2NS8 A;  4YZE A;  4FCY A;  4QIW N;  2NOG A;  1U78 A;  2RAS A;  1F36 A;  4BKX A;  2CRG A;  3VVZ A;  2AO9 A;  1W0T A;  1VND A;  1HDP A;  1Q1V A;  4GFK A;  1AKH A;  5FKO A;  2RHA A;  5HBU A;  3DCF A;  4C3H J;  3I4M J;  4X1E A;  4BY1 J;  2HKU A;  3HB9 A;  2XGC A;  5F0F A;  4DZP A;  1JJ6 C;  3BQZ A;  5GPC A;  1JJ8 C;  1BA5 A;  1TWC J;  4ME9 A;  3GTM J;  5D18 A;  2HQ5 A;  2X9D A;  5GP9 A;  5BNG A;  4C3I J;  4M6V A;  5EF6 A;  4BY7 J;  2P81 A;  4HNV A;  3E7Q A;  3BCG A;  2B63 J;  1Y1W J;  2E19 A;  1DU0 A;  3CJD A;  3LSR A;  2LVS A;  5DTD A;  5F04 A;  3MKL A;  5D1R A;  2XPW A;  1ZKG A;  3GTL J;  5EZG A;  4J19 A;  1MH3 A;  2G3B A;  2Y0S N;  1A5J A;  4UUS B;  2PZ9 A;  1XC5 A;  1T56 A;  3GTP J;  4JL3 A;  2OF7 A;  1GDT A;  1TC3 C;  3I4N J;  3D1N I;  2FQ4 A;  3FIS A;  2ME6 A;  5FJ8 J;  5IYD J;  4IHY A;  1ETO A;  3Q0U A;  1Z77 A;  3FK6 A;  2I10 A;  2DA1 A;  1ZGW A;  2KDZ A;  3ANG A;  3AQT A;  2KT0 A;  2DTZ A;  4GCL A;  2XPV A;  5J1R A;  1R9T J;  4RBO A;  4AYB N;  4UDS A;  2XPU A;  1MBK A;  3A03 A;  3S2D J;  5K7Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...