1JTYA

Crystal structure of the multidrug binding transcriptional regulator qacr bound to ethidium
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
186
structure length
186
Chain Sequence
NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKKEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOTHETICAL TRANSCRIPTIONAL REGULATOR IN QACA 5'REGION
publication title Structural mechanisms of QacR induction and multidrug recognition.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription
total genus 71
structure length 186
sequence length 186
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2001-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1jtyA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 1jtyA02
4PXIA 4A3MJ 2D5VA 1JKOC 2F07A 1AU7A 2NP3A 3SJMA 4XRMA 5GP9A 5F08A 2TRTA 1RKTA 2IEKA 2K9NA 2ZOYA 4DYRA 2KT0A 3CCYA 4AC6A 4D7NA 3DPJA 3G56A 2LKXA 1POGA 3A03A 4A69C 5M3MJ 3RQIA 5HAWA 1LFUP 2P81A 3BHQA 3I4NJ 2WB1N 3GTMJ 3NXCA 4A3BJ 2HOTA 1SANA 1LE8B 3P9TA 4MXMA 2HYJA 2B63J 4B1RA 3QQAA 3QPLA 1Y1WJ 4UUSB 4NDLA 2E1OA 2L7MP 2R0QC 1LE8A 3ZQIA 4GFBA 4M3DA 3SDGA 2XRLA 5FKMA 3LSRA 2Q24A 3GTQJ 5CXIA 3BNIA 5EG0B 2VKEA 3LOCA 4UUSA 1ZR4A 1FTZA 1XC5A 2UXPA 4L62A 2R93J 3BCGA 4HKUA 1FIPA 4M3EA 4V2FA 3COLA 2EH3A 5EG0A 1JGGA 3C07A 5F0CA 4B4CA 3BRUA 3H3VK 3LWJA 2NVQJ 1OFCX 3M4OJ 3BTIA 3GTJJ 3BR5A 5IYCJ 4ABZA 2JA5J 3MKLA 5GPAA 2EZIA 1GT0C 1JT6A 4MO7A 4KWAA 3EGQA 2GM4A 3GTPJ 1TWHJ 2K9QA 5E3MA 4MFDA 3S1QJ 1JT0A 3L1PA 2L7FP 3JR9A 2M34A 2DMQA 2R7ZJ 2DA5A 5CXGA 5K7HA 5F0FA 1JKQC 3DCFA 5DTDA 1RPWA 3IH3A 2XGDA 1QRYA 4NELA 2QWTA 3TP3A 1IDZA 3GTOJ 5FGLA 2E2JJ 1NK2P 3LSGA 3Q0WA 3JSJA 3B6CA 2MW8A 3LNQA 5C4YA 2M8GX 3HOWJ 2VUMJ 2LR8A 3HOXJ 3RD3A 1I3QJ 1B72B 2CRGA 1IC8A 4A3FJ 2M2EA 2NVXJ 3VPRA 5C44J 4IHXA 1MBEA 1U8BA 2X6OA 3IH2A 1B72A 4Y52J 1JTXA 2IAIA 1S7EA 5H9TA 3JRIA 3I4MJ 1GV5A 2ELKA 1MBFA 1RETA 5IP9J 5FMPA 2YS9A 2ECCA 2I10A 5F04A 5FKLA 2AO9A 2YVHA 2LTPA 2ME6A 1G2HA 2K9SA 1YRNB 2NP5A 5IPAA 3S2HJ 5HODA 3A02A 4YZEA 1GV2A 2O7TA 1GVDA 1YRNA 2UXIA 2EZHA 2JK3A 2UXUA 2DA6A 2OPTA 2NS7A 3OSGA 2DA3A 2O9LA 2HOSA 2N8GA 3BTLA 4FE4A 1U9OA 4DYCA 2E2IJ 2Y2ZA 5IOYA 3GTLJ 3HOUJ 2JA6J 2JA7J 3OIOA 1TWAJ 2M9HA 2XPUA 3VW2A 3GBGA 3IV5A 4A3DJ 4Y7NJ 1IRZA 1FJLA 3CMYA 2ZCXA 3JREA 2DA4A 4IHYA 4MK6A 5EFYA 2QCOA 3E7LA 3Q0VA 3LSPA 2KDZA 5FKOA 4D7MA 3BR0A 3ZQGA 5GPCA 2MG4A 3S5RA 4M3FA 4JKZA 2WUIA 4A3EJ 5J1UA 4A3JJ 2VKVA 2LFBA 3HOZJ 3FRQA 2FQ4A 2V57A 1SFOJ 1Z0XA 1BJZA 1ETOA 1X58A 3HB9A 1ETVA 1DU0A 5D1RA 2O8KA 1XS9A 3TW6A 2CQQA 1FIAA 3PO2J 4V2GA 2NX4A 1ZTRA 3PO3J 1MH3A 5M3FJ 3FIWA 1BL0A 1JTYA 3FISA 1WGXA 1ITYA 3HEFA 2LLKA 2CU7A 3H0GJ 3HGGA 1TWCJ 3O8GA 2GUHA 3GZIA 1FEXA 1BW6A 2XGCA 3BR3A 3HM5A 1WH5A 5FKKA 4A3GJ 2AHQA 3UKGA 2X48A 1HCRA 5FJ8J 1RESA 1WH7A 2HQ5A 1HDDC 1H8AC 1GDTA 1U9NA 5F1JA 3V78A 2E2HJ 4GCLA 5C4XJ 4XRSG 3LSJA 3NARA 4AC0A 5F27A 2LP0A 4DYQA 1VF9A 5E3OA 2FJ1A 1ZQ3P 1LFBA 1MH4A 5IP6A 2E19A 2HXIA 3CQZJ 3F0CA 3KNWA 1X2MA 2FD5A 4FCYA 4D5CA 2G7GA 2DJNA 2EBIA 2ME0A 1VFCA 3JRAA 4JX6A 4LOCA 4BKXA 1UI6A 3T6NA 1ETWA 3HOVJ 2DTZA 1Z77A 2NVYJ 3HIMA 2UXHA 2M0CA 1ZR2A 4AF5A 3IUVA 3K2AA 3TEDA 2R5YB 4NN1A 1UG2A 3S16J 1RR7A 3BR1A 2GFNA 2RASA 3S1RJ 1BW5A 2XPWA 2R5YA 2QIBA 1ZK8A 3AQTA 2XB5A 2ZOZA 2RHAA 5J1YA 3ZQLA 3JRBA 3VOXA 4C2MJ 3BTCA 3HTJA 5FHPA 1IDYA 4C3IJ 2ECBA 2H8RA 1DU6A 1MBGA 3QBMA 2ZB9A 3BG5A 3K7AJ 3C2BA 3PASA 2JN6A 4A3CJ 4GCTA 2ZCMA 2JMWA 3ANGA 3GTKJ 3Q0UA 3PPBA 1A5JA 1VNDA 5M5WJ 1MSEC 1Y1VJ 2EZLA 5M5XJ 3S1MJ 4X6AJ 2LD5A 5D18A 4I76A 1I50J 4GFKA 3FK7A 3LJLA 4FTHA 1SGMA 3HBLA 4W97A 2YU9J 3A01B 1RKWA 5EGOB 4FE7A 1JUSA 3JRDA 3CDLA 3EUPA 2W48A 3A01A 2H1KA 2ZCNA 2R5ZB 1HLVA 1NTCA 1WPKA 3JRCA 4GFLA 1T56A 3G7RA 2JWTA 2Y31A 2R5ZA 4ME9A 1ETKA 1P7IA 1QVTA 5J1RA 2R92J 1MBKA 3GEUA 1IV6A 4A3KJ 1AKHB 2IBDA 4CYCB 3CWRA 2LVSA 2ID6A 3FK6A 1K61A 3E7QA 4BXXJ 5EF6A 1W0TA 1AKHA 4CYCA 3ZQCA 2MGQA 3W6VA 1JKRC 5IOZA 4A93J 1MNMC 4M6VA 3ON4A 4JL3A 3BQYA 3S14J 2COBA 4JYKA 5IP7J 4BBRJ 4BY7J 3NPIA 3TP0A 4RDUA 1TC3C 4S0HB 2CUFA 3VVYA 2DN0A 3KKCA 1T33A 4QIWN 3BJBA 3HTIA 2HXOA 1ETXA 5D19A 3OOUA 3BG3A 3VW1A 1H89C 3BR6A 2IU5A 2DG8A 3TW7A 1ETQA 2HI3A 4XRSA 3HE0A 4UDSA 1BA5A 5C4JJ 2G0EA 9ANTA 2FX0A 3RKQA 1JUMA 2L7ZA 5K7ZA 2XB0X 5FKNA 1F43A 3GTGJ 2Y9YA 2YUSA 3HDDA 4L5EA 4QTRA 3JRGA 4JNNA 1CQTA 1IG7A 3M3YJ 5J3LA 2UXOA 1I6HJ 2X9DA 2LY9A 4XICA 3WHBA 1ZKGA 2O7OA 3FKIJ 3KKDA 2GBYA 2XPVA 2NVTJ 3ZQFA 1JJ8C 2MSYA 5C3EJ 3S15J 2G7LA 3BR2A 4JP0A 5IYBJ 1IGNA 4XK4A 5FLVA 1QPIA 3MNLA 4M3GA 2DA2A 4A3IJ 1HDPA 3B81A 3BG9A 3S1NJ 2PBXA 1K83J 3MVPA 3VP5A 5EYRA 2L0KA 4FISA 1UHSA 3AQSA 3VIBA 5EZGA 5EZHA 5E3LA 1VI0A 1PUFB 1ETYA 1Q1VA 4EEFG 5AQCA 2DA7A 3VVZA 4ACIA 4JX4A 3OSFA 1ENHA 2Y30A 2L9RA 4D5FA 3F1BA 3NRGA 2CUEA 1PUFA 1AHDP 4A3LJ 4J19A 1ZGWA 3QPSA 3NNRA 2G3BA 3Q3SA 1IJWC 2ID3A 1OCPA 2XSDC 1NK3P 2VI6A 2OI8A 3NI7A 3O8HA 3ZQHA 4W1UA 4RBOA 2K40A 2JA8J 5DAJA 5JLWA 1X2NA 3MN2A 3ZOBA 4BBSJ 2RAEA 2QF7A 3KZ9A 3DEWA 1UMQA 2HOAA 5FLMJ 2G7SA 2DG7A 1D5YA 3ANPA 1B8IB 3HTAA 2DMPA 2CJJA 1APLC 1IUFA 4XIDA 1R9TJ 2DMTA 2EZKA 3V6GA 4CGRA 3G1MA 4HNVA 4C3HJ 1B8IA 2QTQA 2YVEA 3CJDA 3D1NI 2NS8A 3HOYJ 1JKPC 2QOPA 4QSHA 2EQRA 1QVUA 5JLXA 4M3BA 3VUQA 2GENA 3S2DJ 3JRFA 1WI3A 1OCTC 1O4XA 4IHWA 2FBQA 2JJ7A 2WAQN 2WV1A 2HDDA 1HOMA 4B3AA 5EEAA 3HGYA 2PMZN 3RZOJ 4MFEA 4ICHA 2HYTA 4IHVA 1F36A 3HTHA 1P7JA 3VOKA 1XG1A 4IEJA 2OF7A 4I6ZA 1A6IA 4G12A 2WGBA 5M5YJ 5F0HA 3RZDJ 3RH2A 1TWGJ 4X1EA 1MBHA 3NAUA 5CW8A 2Y9ZA 3VW0A 3JRHA 5EDNA 3O60A 2QKOA 1JJ6C 3BQZA 5HSZA 1H88C 4DZJA 3WHCA 3G1OA 2NOGA 2Y0SN 3B6AA 5EGOA 5E3NA 5HBUA 3G1LA 2XGEA 3S17J 2REKA 5IYDJ 3HKZN 1WCMJ 2OERA 4MIMA 2DMNA 2VPRA 1GUUA 4DW6A 4C3JJ 2GLOA 2W53A 3IH4A 4BY1J 1MBJA 2XDNA 3BT9A 1JUPA 1MSFC 3BTJA 4AYBN 2DMUA 1OJLA 1EF4A 3QKXA 4GCKA 1U78A 5BNGA 3VVXA 2D6YA 3LHQA 2CQXA 2LK2A 1UI5A 2HKUA 4JX5A 1TWFJ 5DS9A 4UUTA 3PM1A 5K7FA 1HF0A 2PZ9A 2TCTA 5K58A 4AUXA 2DA1A 3ON2A 1FTTA 4MLOA 4DZPA 1E3OC 3SFIA 3CRJA 1W0UA 1ORKA
chains in the Genus database with same CATH superfamily
3CESA 4PXIA 2V4JC 2D5VA 2KZVA 1JKOC 5E1XA 3LSIA 3W2WA 1AU7A 2NP3A 3HPHA 1YW9A 3EUKL 5F08A 1RKTA 1YITI 5AONA 2GOMA 2IP2A 2B9SA 1SD4A 2RN7A 4D7NA 1FYKA 2JT1A 2OZUA 2ZXIA 2AQEA 2VXDA 5HLGA 5J8FA 2F5VA 3ELKA 3RQIA 1YOVB 3CCRI 3QPTA 1XSDA 5DEQA 2P81A 2IGMA 1SD5A 3NXCA 3JSOA 2V9VA 5LLQA 2HOTA 1LE8B 1YE9A 2HYJA 3FMSA 2CW7A 4B1RA 2ZKZA 3IRQA 3F8FA 2BGCA 4MGRA 2LC2A 2JRTA 1XDUA 3DKXA 4Y4RA 1Y1WJ 4UUSB 3J7YJ 1LE8A 4GFBA 4UV8A 4WIBA 2Q24A 3GCMA 3NEUA 3GTQJ 3BNIA 5CXIA 1T08B 2P4WA 3P9CA 5HNHA 1MMNA 4UUSA 1ZR4A 2Z9OA 2UXPA 4L62A 1LPQA 5DCFA 1FIPA 1MMSA 1JGGA 1TT5B 3GO5A 4XSXF 1O3TA 3H3VK 5GPAA 1JT6A 1XD7A 1IN5A 3K4NA 3BLYA 4TV7A 3OS2A 4KWAA 5D8KB 2TDXA 1EH6A 2K9QA 4IF4A 4KUMA 2FNPA 5E3MA 2IS4A 1JT0A 3GZ6A 2VOPA 1DGWY 2WY7Q 4PFPA 4PSXA 1WJBA 1KGSA 5CXGA 4LFUA 3RCOA 2X6WA 5K7HA 5F0FA 4O5VA 3DCFA 3I64A 1RPWA 2EV5A 2XGDA 4RAYA 1KZHA 3ERMA 2DPUA 3G4SI 2MC4A 2ADUA 2WBMA 2WWYA 1NK2P 1YI2I 2BV6A 3LSGA 2PMUA 4KT6A 5L3DA 2PLYA 2A69F 2MW8A 2QM3A 4OAZA 4YRVA 3HOXJ 5HOOA 4A3FJ 4KISA 1HW2A 3ZMDA 2LMDA 2NVXJ 4PJMA 3T0YA 5C44J 2ZFWA 2D1VA 1OYIA 3IH2A 3GFJA 1JTXA 3FM3A 3NRVA 1R5HA 5HDNA 1OYWA 3I4MJ 1EV7A 3OYJA 3DV8A 2ZSIB 3OYGA 5FMPA 4GYIA 2YS9A 2ECCA 1D0XA 2I10A 4IJAA 2R7TA 5ED4A 2ME6A 1BR1A 1T0FA 4QLCU 3U21A 3SWHA 1ZLKA 1O7LA 3S32A 4CDGA 3FXOA 1J0RA 4HV6A 2UXIA 1HW1A 4YELA 2UXUA 2KISA 1VTNC 4P55A 1V5GA 2M8EA 2UUZA 1YG2A 4DYCA 2UV1A 3HJEA 5E17F 5IOYA 3OYIA 3HOUJ 4GYGA 3S3NA 2P6TA 3OIOA 1U2WA 2HTSA 1WJAA 2HYGD 2F4OB 2XPUA 1J9IA 3GMEA 1J09A 1R5GA 1SD7A 3CMYA 2FXAA 2L5QA 2BHYA 3JREA 1D8JA 3ABTA 2KIFA 3HHHA 4BL0B 2QCOA 3LSHA 3Q0VA 1IUYA 4ZDLA 5LEKA 1PYVA 2DQLA 3ZQGA 4U7DA 2LKSA 4S04A 5GPCA 2X6YA 1R49A 3C2GA 3PNTA 2WUIA 2VQLA 2WA0A 2WY8Q 1OCOH 2OQGA 3OYAA 1Z0XA 2DTRA 3DBHB 1BJZA 1ETOA 3SZGA 1ETVA 2K85A 1TP4A 5D1RA 5LGTA 4X0GA 3CCMI 3Q9SA 3TW6A 1J7KA 4V2GA 3PO2J 2RV8A 3I9V2 1PDNC 4DVYP 1G3YA 3AG3H 4WXHA 1WGXA 1HXDA 3I58A 3HGGA 3GZIA 3HZJA 3I54A 2DFFA 2HR3A 4H0EA 1X1BA 3AG1H 2FSWA 3M8EA 3FZVA 1WH5A 4DIQA 5FKKA 3UKGA 4GXOA 2HOEA 5D4RA 5FJ8J 3MKWB 1WH7A 5HS9A 4ZTJA 1KQ8A 2MLKA 4BUPA 1O7FA 2Z3YA 3KZYA 1G3SA 4AVPA 2HWVA 2JZYA 1RIOH 2V9PA 5CJ9A 3IKVA 3NARA 2LP0A 4I7HA 4XR6A 1ZQ3P 1LFBA 3GZ5A 1TT0A 1JGSA 5JI6A 2ISYA 3E0JB 3CQZJ 2HXIA 3D5RC 4FCYA 1Y56A 2EBIA 2ME0A 4BKXA 4Y3OA 5B1AH 4PFOA 4JK1X 3BP8A 1XCBA 4L18B 3TDZC 1WRJA 1LFPA 1ZR2A 4ZH4F 4AF5A 1H9TA 3CRJA 2R5YB 3K69A 1KYZA 5TGTA 2KDOA 2GFNA 2M87A 4AWXB 4P5OA 2R5YA 3S1RJ 1REPC 1ZK8A 2M7AA 2ZOZA 4MQVA 5DDGA 5J1YA 3ZQLA 3WTVC 3MQ0A 2R4GA 3FXLA 2VQGA 1KU2A 2VXZA 4NUBA 2Y69H 2ECBA 1TL8A 3DBLB 1MBGA 1JI8A 4UNOA 3BG5A 2G7UA 4HEA2 2CFXA 4C30A 1VQ5I 4ZYHA 1Z67A 1J75A 5BS6A 2JMWA 4CCNA 3OYEA 2EA2A 2K9LA 4U0VA 4MTDA 2Z2SB 4KNYA 3GTKJ 1VNDA 3RPUA 3DLLF 5M5WJ 1USTA 1Y1VJ 4M9XA 5HLIA 4C2TA 2LD5A 4KMFA 5D18A 3PIOF 2VJ4A 4GFKA 3FK7A 3AKZA 2H6BA 2VL8A 4ANJA 2YU9J 3S93A 2JPCA 4LIUA 2Q8KA 5EEHA 3E6CC 3IL2A 4KFCA 4XM3A 2JRMA 1W36C 4KYWA 3CDLA 5IT9Z 2LSOA 2ZCNA 4Q4ZF 1NTCA 2R7VA 3TOBA 4BHBA 2O5RA 2A07F 3C2HA 2PJPA 2Y31A 3MMYB 4EVIA 4ME9A 1ETKA 5J1RA 4AIJA 5FLXZ 1IV6A 1XMAA 4A3KJ 2ZY9A 3DF8A 1R1UA 2IBDA 5FRNA 2LVSA 1YW8A 2ID6A 3JAMK 2HPIA 3ZQCA 1RUOA 2DK5A 4JL3A 3WTZA 5CYVA 4E7IA 2RQPA 2CV0A 4C2MA 2EFQA 2DLLA 3ZQQA 4Z2YA 1IRGA 3NPIA 4ZJZA 1E3PA 4CSWA 1TC3C 4S0HB 3L2CA 2V6CA 1QQIA 3HTIA 1RRJA 2HXOA 3WG9A 1FPQA 2Q0OA 3A4CA 4E7ZA 3BG3A 5LBQA 4A0ZA 1H89C 2E5ZA 4RA2A 4RS8A 4CICA 1EJ9A 1ETQA 2HI3A 3ZMSA 1AOYA 3HE0A 4UDSA 2L7ZA 1FSHA 1J5YA 2Y9YA 2YUSA 3A1YA 1ZHFA 2UXXA 4G6TB 3LAPA 4JNNA 4KJZA 1FBUA 2LY9A 4YIIA 1ZKGA 2O7OA 3FXRA 5LFAA 3W2VA 2GBYA 5FFXA 1T6SA 2XPVA 5B5EC 3ZQFA 2MFZA 5C3EJ 4E7JA 5IYBJ 2A68F 2XHKA 3CCVI 3K4BA 4A3IJ 3VTIA 3K4KA 2PMHA 4OU0A 1O3RA 4ZDPA 2PBXA 1K83J 1W1WE 4FISA 5EYRA 1UHSA 5H6QA 5ILSA 1HKSA 2ZCWA 3FXQA 3F9KA 2E1MB 1Q1VA 1BI3A 5AQCA 1NG7A 2O3FA 3TO9A 2QSHX 3F1BA 2VBWA 4RLQA 3MFKA 4J19A 3HSRA 4II2A 4RAGA 2W84A 3HG9A 4HV5A 2DO7A 3GF2A 4PJ0C 1BIAA 3FHNA 2VI6A 4RAFA 3O8HA 3BJ6A 4BU2A 4N0BA 1A6QA 1EKEA 1K78B 1TQPA 3KIOA 1TLHB 2RAEA 3WG7H 4XKCA 4I09A 3E1SA 5FLMJ 2G7SA 2VOOA 3HTAA 1K78A 2CMPA 4HX8A 1SEUA 2IA1A 3V6GA 4CGRA 3GVAA 4NB5A 4I0AA 4HNVA 3C1DA 3F8BA 4C3HJ 1VQNI 3JAMZ 2KZGA 3CJDA 3FF5A 5HNFA 1J2XA 4KIFA 3HOYJ 1JKPC 2B1EA 2EQRA 4O6JA 5JLXA 4M3BA 4UVCA 5D6EA 4NHJA 2GENA 2E36A 3FXJA 2WTEA 3FX3A 3PUBA 2GA2A 3PL8A 1FYLA 1LVKA 3LA3A 1ODDA 3H0DA 3R60A 2FBQA 4E70A 2WV1A 2EIJH 1HOMA 1WSUA 3DEUA 1SAUA 4MFEA 4ICHA 3KP7A 3CC7I 4HW0A 1IN7A 2ZJ2A 3H9GA 4U9LA 3PQKA 1XG1A 3VYRB 5K5RA 4G12A 4UUVA 2VBXA 3RH2A 2QZ8A 2Y9ZA 4RGXA 3JRHA 2VPLA 3M7GA 3O60A 1JJ6C 3BQZA 1H0MA 3HRSA 4DZJA 1R23A 3HUGB 1OPCA 3G1OA 2Y0SN 2HGCA 5E3NA 1WHUA 4LB5A 1YX5A 5IYDJ 3HUGA 5K1YA 3LWFA 5ICEA 2CSOA 4HQMA 4HZFA 2VPRA 2JUGA 1MKMA 2RC4A 4HNTA 1FOKA 3K70C 1QBJA 2STWA 4BY1J 3TDUC 2XRNA 3BT9A 1GVJA 2A6TA 2DMUA 1OJLA 4KITB 4A12A 4KN7X 2HDCA 1ACIA 3QKXA 3CUQB 2E1NA 5BNGA 3VVXA 1B9NA 3ZMVA 3T1BA 3G71I 4EJUA 2VT2A 3CUQA 2VKDA 1QZEA 1AWCA 1TWFJ 5KCMA 4EV0A 1XGMA 5K7FA 3WTXC 1HF0A 2QA4I 2KMUA 5A2QK 3ON2A 4DZPA 1P2FA 1FT9A 5BPIA 2WV0A 4A3MJ 1YW7A 2KKOA 2F07A 2W7NA 3SJMA 2K5CA 1KQ9A 5GP9A 3NS4A 3F22A 2VQCA 1P4XA 2XUBA 1KONA 2QKLB 3I5UA 4DYRA 3KEQA 3R0JA 2KT0A 5J6XA 4NBQA 3ZN1A 2BHZA 3DPJA 2ZXWH 4UY8I 2LKXA 4A0XA 5E18F 3LFUA 3P9IA 4MEYF 4A69C 5M3MJ 4HDVA 3RI4A 1X4PA 2GIZA 3LA7A 3EUAA 4ZYEA 1LUJB 3OYMA 3CC2I 2O03A 3BHQA 5KHDA 3S2WA 4IOCF 3I4NJ 1ZH5A 2LKPA 3I3LA 1MMGA 4A3BJ 3GW2A 1SANA 4UB8C 1ZG1A 1S29A 2KRCA 3QPLA 2IS1A 1XDSA 2LBFB 4NDLA 2L7MP 1F1ZA 2R0QC 2ESNA 2K3FA 2L9NA 4PK4A 3CF2A 4IRHA 5DUIA 4A0YA 5JFRA 4BYYA 5EG0B 2LBFA 3LOCA 2XKPA 2P5VA 1FTZA 4EATA 2WAQA 2R93J 4HKUA 3TOAA 1Z91A 2O8XA 3COLA 5EG0A 1Y6IA 4Y33A 3LWJA 2NVQJ 3BTIA 3V7SA 3GTJJ 1J59A 1X3UA 4ABZA 3HL2A 3EYYA 3M8JA 2X85A 2E60A 1LDDA 3DPTA 4MO7A 2B0LA 1TWHJ 3IWFA 1HQCA 2XSJC 4MFDA 3S1QJ 2RQQA 2P7CB 2EB7A 5K5OA 1WI9A 1R22A 4G7ZF 3DBRB 4RB2C 3I71A 3WTUC 3SHFA 3X2QH 3IH3A 2QWWA 3FBIB 4NELA 2QWTA 1IDZA 4HPQA 2DFEA 2RNJA 4MQ9F 3GTOJ 5FGLA 5LD2C 4FX4A 1YJWI 3Q0WA 3B6CA 5A2QZ 3CZ6A 1R5ID 3LNQA 5C4YA 2DYSH 2IGKA 2K86A 3CLQA 5H6RA 3ZCOA 2CRGA 3COAC 2Z16A 2ZJRF 3J7AO 2EINH 4IHXA 2QYOA 4XLEA 5AIQA 1R71A 2X6OA 3KE2A 4Y52J 3CCEI 3SEQA 1LDKB 1QGPA 5CVIA 1GV5A 4CCKA 3JRIA 1G6NA 1IW7F 3FDYA 3V7CA 1FOWA 3FWEA 3QWLA 4FASD 4HRIA 4BAYA 2YVHA 2LTPA 4XN3A 3HTSB 1YRNB 1I1SA 3ABLH 5HODA 2W4SA 3A02A 3HSFA 2DYRH 4YZEA 3WU1B 1GV2A 2DT7B 3V8LA 2DBBA 1GVDA 5LHHA 2Z1DA 1YRNA 3ERED 4N4OB 2EZHA 1WQ2A 2NAZA 4HF0A 1X3ZB 2FOWA 3RPUD 2HOSA 4B43A 3BTLA 1UG0A 3QOPA 2E2IJ 3IUOA 2Y2ZA 2CQ7A 3IHUA 2VODA 1FWZA 4UXNA 2JA6J 3RTRA 3TL4X 3PUFA 4CGZA 2OCCH 3J80K 3L2WA 4G9YA 1IO2A 1DGRM 2M3AA 3VW2A 3OY9A 4A3DJ 1IRZA 1FJLA 2IS6A 2W25A 2ZCXA 3K4JA 2CH0A 2KIQA 3G3ZA 3R6SA 2X6XA 3EDPA 1Z3XA 3RQ4A 1UAAA 4D7MA 4NNJA 5LEJA 3BR0A 3RKWA 4V19K 1WWXA 3S5RA 2X1DA 2OTJI 4M3FA 2F48A 2L02A 4AVZA 3RJPA 4EGZA 4A3EJ 2HTJA 2LFBA 1D1AA 2LF8A 2Y48A 1Y0UA 4I98B 1ON1A 4LK0F 1S9HA 1XS9A 3CP8A 2BY1A 1PP8F 2QUFA 5DUKA 2AS5F 3QYEA 3PO3J 5M3FJ 3RKXA 4L0ZB 4XKVA 3FISA 4D9JA 1ITYA 5CVVA 2LLKA 5BOXA 1TWCJ 2V26A 1GHCA 1BW6A 1ZGJA 2FBHA 1B6AA 1S5LC 4BJTA 4BQNA 3O6BB 5FROA 4EQQA 1RESA 2HQ5A 2OA4A 2P5KA 3KEOA 1GDTA 4LLGF 2E2HJ 4NQWB 3AL0C 1X1DA 1LEAA 4ENJA 4GCLA 2PBIA 4XRSG 2GXBA 2CUJA 2VJIA 4S05A 4AC0A 5F27A 4DYQA 3OL4A 4NQWA 5E3OA 2L9SA 2F2EA 2UZKA 2E19A 1SVLA 2X51A 2ZXHA 2G7GA 1Q1HA 4L9VA 2J5OA 5JHFA 3HC7A 4BQQA 4LOCA 4ENKA 3P9KA 1VQ6I 3Q5FA 5GTHC 2F5CA 3T6NA 2BW3B 1FZPB 2NVYJ 4ESFA 2UXHA 4EJOA 3DXJF 2BW3A 3K2AA 4ON0A 1MJ9A 1BN5A 2ICWG 2IS2A 3J80Z 2XVCA 3DU6A 2F4IA 3VYUB 4OMYA 3K10A 3BDDA 4Y15A 1OMIA 2KFDA 2X4HA 3AQTA 4KT5C 1SD6A 2IGOA 1P4AA 2P8TA 3BJOA 3JCUC 4L0YB 4RM3A 4N4NB 1G3TA 1XN7A 3HPGA 4UVAA 5E79C 4C2MJ 2K3PA 5FHPA 4LMYA 3OL3A 1IDYA 4HLXA 1DU6A 4E7SA 1K6OA 1JXSA 4OOIA 2V79A 3ZMUA 2QSFX 4F91B 2PX9A 3CO7C 2JN6A 3DTIA 3O2PE 3PSIA 2IXSA 2PQ8A 2IVMA 2ZCMA 4BHPA 2MBFA 3ANGA 4KIBA 3TBIA 2LF7A 3Q0UA 2ZNYA 2LREA 3MEXA 1WVRA 3UNGC 1ON2A 1SMYF 3AAFA 4PJJA 2HU9A 4KA4A 3MZHA 3S1MJ 3KEYA 3LSKA 4I76A 2A5YB 1TNSA 2F4MB 1ZARA 2FUG2 2QQBA 5JR3A 4D1QA 4XSZF 3A01B 2LY1A 4FE7A 1JUSA 1U6GA 4GDFA 3NWTA 3EUPA 3KP5A 2V1DA 3A01A 1U5TC 5DM7F 1HLVA 4PJLA 1KU9A 3JRCA 3EUHA 1T56A 1N77A 2FQ3A 3G7RA 5D5VB 2QQAA 1F9NA 2R92J 3CMEI 2QEXI 2WAFA 1YLFA 1AKHB 2XKOA 1DP3A 4CYCB 3FK6A 2H94A 1K61A 2W57A 3DP7A 4U88A 4DOZA 4M71A 1AKHA 2K4BA 5EEGA 1S7OA 2VQHA 3H36A 4CYCA 3PFIA 4E7LA 3ON4A 2I5UA 5D6FA 2H27A 3BQYA 2K4JA 4JYKA 5IP7J 4OIOF 1VQ7I 3L09A 3TP0A 3V4GA 1B59A 2ZSHB 3FXUA 4ZYAA 3J81K 1D5VA 2DN0A 1R00A 3KKCA 4QIWN 2H6CA 3T8TA 3F23A 2IRFG 2MH2A 3OOUA 4CCMA 3VW1A 4XL9A 4L5JA 2QQ8A 3TW7A 3OYDA 4DQ2A 4HAMA 4XRSA 4OD4A 3BG7A 4HBLA 4Y13A 2G0EA 5ICFA 5L3CA 9ANTA 2XIGA 1T39A 2FE3A 2M45A 1BM9A 4FQGA 5FKNA 3GTGJ 4L5EA 1CQTA 1IG7A 3KX2A 3H5RA 3WHBA 3WTYC 3BOQA 3IP4B 1PP7U 1YIOA 4LB6B 3KKDA 1FMWA 4CCOA 1JJ8C 2R7UA 3S15J 1FOXA 2G7LA 3BR2A 4JP0A 5FLVA 3C18A 2DW4A 3MNLA 1TQIA 4XLAA 3OR2C 2OC6A 2W24A 3JSPA 4CA0A 1V54H 5E3LA 1VI0A 3LFKA 1PUFB 4EEFG 3FMRA 4JX4A 1DUXC 4ETSA 2L9RA 4D5FA 1WKMA 1MDMB 3KPHA 4EJWA 4LITA 1PUFA 1DQUA 2QKMB 1AHDP 4A3LJ 3CP2A 4A6DA 2ELHA 1RC9A 2R7OA 2QBYB 1MDMA 5F1RA 1IJWC 3NNRA 2ID3A 3F8NA 4I02A 5HLHA 1NK3P 5GAGJ 2OI8A 5BQTA 1ONVA 1SC7A 2PMZA 4YFXF 2QBYA 3NI7A 4RLFA 2A6HF 2CG4A 2HZDA 1GXQA 4UV9A 3ML6A 4BDYA 3H35A 3H3ZA 1UMQA 2DG7A 1B8IB 1X3WB 2BXYA 2DMPA 4U7BA 3BZKA 5LRSA 1IUFA 2BZTA 3V8KA 5KAFC 1IRXA 1B8IA 1OYYA 2EIMH 3E6BA 4RB3C 3D1NI 4NC7A 2NS8A 3VUQA 4QSHA 1QVUA 1YYVA 1WI3A 1O4XA 3OS1A 4OD5A 2WAQN 2XAUA 2HDWA 3J7ZI 3J81Z 2NS0A 5EEAA 2NNYA 3S3MA 5K5QA 1TW2A 1S3JA 2FRHA 1P7JA 3ABMH 4IEJA 2OF7A 2W82A 4J00A 1A6IA 3CO6C 1ZG5A 1EA3A 1OCZH 4ENMA 4HSTA 2FBIA 2LG4A 3RZDJ 4X1EA 3MWMA 3NAUA 2ZMEB 3CDHA 1LNWA 3WODF 3L2QA 1BC7C 3CCJI 1UELB 4IPAA 3QYBA 4MEXF 5HSZA 2M4KA 4FHTA 1T0FC 2MABA 4WF2A 1LVAA 2NOGA 3B6AA 5HBUA 1UFMA 5B1BH 2FF4A 3HKZN 1WCMJ 4YFKF 2ACJA 5GAHJ 5FO5A 3OYHA 2KQRA 5LGNA 4ZC3A 3ISPA 2OCEA 1BOBA 2XDNA 4LJZF 5J8CA 1FBQA 3QYFA 4EMSA 2JQ7A 2QSGX 3H92A 3I53A 4L9TA 5E1ZB 4E4HA 1W4MA 2Y0MA 1F5TA 3EUHC 4J01A 2CQXA 1LJ9A 2JSPA 4XLHA 5KK1A 2L54A 1YJ9I 5L3BA 1E0EA 1UI5A 3KP2A 2EV6A 2HKUA 1R1TA 2YPRA 2OUMA 3E5XA 4MNUA 4BHCA 1VQPI 5HDKA 3ZGKA 1QNTA 2Z99A 1ZLJA 2BY2A 1HW5A 1JHHA 2HZTA 2OD5A 2GZWA 3M1CA 3KYDB 2EWNA 4ZYDA 2XAHA 2KIMA 1D0ZA 4HNUA 4MLOA 4G8XA 1ZG3A 2OTLI 1FTTA 3D0SA 1VQKI 3SFIA 1SVMA 1N78A 1BOAA 1XMKA 5E1WA 4HF2A 1BI2A 1I6XA 2IT0A 3PNYA 4XRMA 3I4PA 2P5LC 2TRTA 3WGHA 4M6YA 2K9NA 2CGPA 2O6GE 2ZOYA 3RKYA 3QODA 2KLOA 4AC6A 4A6EA 1ZYRF 1S72I 1I5ZA 3HRUA 2DXIA 1M1EB 2PN6A 3A03A 2JA2A 2V6EA 5HAWA 2F5DA 1I1GA 1Y39A 4I01A 4KICA 4PUSA 4IO9F 2E7XA 3ONQA 3GTMJ 3E6DA 2DI3A 1N25A 1F4KA 4LG3A 3PSFA 3BROA 1FNNA 3MCZA 5CVJA 2L4AA 2B63J 2HKXA 4BDZA 1A04A 1QZYA 3GYHX 2Q2EB 1KU7A 3ZQIA 4M3DA 3WTSC 3SDGA 3ZPLA 3SYTA 4BS9A 5FKMA 2EIKH 2Q2EA 2VKEA 1GXPA 1A31A 2VC1A 2EH3A 1ZRFA 4LLNA 2ZFUA 4B4CA 1X4OA 1OFCX 2R7FA 3MKLA 1KU3A 2EZIA 1GT0C 2A6EF 5AIPA 1FBSA 3VSLA 2M4GA 1Z05A 2QENA 3EGQA 3S3OA 3ECOA 3QRFF 4I99C 2VJ5A 4AD9A 1G4DA 2L7FP 3JR9A 2M34A 4F92B 5ICGA 1LQ1A 2R7ZJ 3RIRA 3T8RA 3GFMA 2DA5A 1IF1A 2VIXA 1OLTA 2F5FA 2Y75A 1MJAA 2OAZA 5DTDA 4IQJA 5ILUA 2VLAA 1BI1A 3IRRA 3TP3A 4PSWA 4B47A 1A36A 5DCMB 2IW5A 4XQFA 2STTA 2E2JJ 5LRRA 4IKFA 1HA8A 3JSJA 3KP3A 1T98A 2M8GX 2CQKA 5DCMA 5J4YA 1HKTA 1Z1DA 1I3QJ 1G59A 4QPOA 4EJVA 1B72B 2F6CA 1IC8A 3OWTA 4RM2A 5D5XB 1IXSB 4M6XA 1DPUA 1OR7A 3FMQA 3RYRA 1B72A 2AQFA 2IAIA 3Q9VA 3FM5A 5H9TA 2NNNA 2BY3A 2ELKA 4CYDA 2QVOA 4N9HA 4I2OA 5IP9J 5J47A 4G94A 1VQ8I 2BY0A 5FKLA 3EQLF 3L00A 1BIBA 1G2HA 2IPQX 3E3VA 3ZXSA 2E71A 2K9SA 4BH9A 2NP5A 4QPQA 5ICCA 3SXYA 5IPAA 3CLOA 2O7TA 3D5LA 3SDBA 1Z6TA 4PJNA 5TRDA 1DPRA 2DA6A 2OPTA 3OSGA 2EFNA 2DA3A 4CCJA 3OYLA 4FE4A 1BC8C 1U9OA 3DPUA 1YS7A 2ZXJA 3BZ6A 3KLNA 4HA8A 1RR8C 4LD5A 2DOEA 1SFKA 4XKBA 3K1NA 4KIGA 2M9HA 5LHGA 2JUCA 1YFHA 2WB1A 4CZCA 3IV5A 2PFVA 3W6JB 3RYPA 1R7JA 5E8GA 3CJRB 1OQYA 3WTTC 4IHYA 1YTYA 4Q48A 2L2OA 4MK6A 3E7LA 1O3QA 3LSPA 2NOJB 2KDZA 3C7JA 5FKOA 5TJJA 4Z6YA 4XLNF 1YHQI 2WC2A 4DBQA 2ZC2A 3CJNA 2HVSA 3RSNA 1ZN2A 4JKZA 2GXGA 2EJRA 1QPMA 2VKVA 1YO5C 3FRQA 2JPBA 2V57A 4XOPA 1SFOJ 4BE1A 3HB9A 1DU0A 1Z3YA 1B1BA 1V5FA 2V1XA 4PGGA 3ABKH 3E5QA 3BCAA 2YX7A 3QPHA 4DJAA 2CQQA 5DD4A 3OYBA 1FIAA 4E7KA 2CYYA 2NX4A 2XROA 3FIWA 1BL0A 3HEFA 3GFLA 1MJBA 3H0GJ 2CU7A 3O8GA 2LH9A 2FNAA 3F21A 2XGCA 4B8XA 1U3EM 3CJTB 3M07A 4A3GJ 4CZZA 2AHQA 2MLGA 2COMA 1IRFA 2E34A 2X48A 4HF1A 2L3DA 2HFHA 3GLXA 2D1HA 5FB2A 1H8AC 3L7WA 1O3SA 2V7FA 1U9NA 4XONA 5F1JA 1DP7P 2XAQA 2W1OA 3BCBA 3E5UA 1WJFA 3GXOA 2BE5F 2HKOA 1WFXA 3LSJA 1KQ0A 3MAJA 3VDXA 2E1MC 2K02A 1QU3A 3PJRA 4A2UA 2A05A 3CJQB 2ZNZA 3O3KA 2FJ1A 1MH4A 1K6YA 4WK8F 3KFWX 1S6LA 3GEZA 3KNWA 3F0CA 4JOMA 1X2MA 2LDUA 1HSJA 1OISA 2FU4A 4G6DA 4IXAA 2MC3A 3I56I 4JX6A 3JRAA 1VFCA 2HPMA 1BI0A 3HRTA 1QO0D 2DTZA 4DGWB 5JVTA 2NXNB 5KNLA 3EETA 2GXAA 3A2KA 2M0CA 4N9IA 3IUVA 4YFNF 3TQNA 3MZYA 1MNEA 5ERIA 2DJIA 4ZZLA 4NN1A 5HDGA 4ASNA 1TBXA 2CW8A 5B66C 1RR7A 4ZDOA 3K2ZA 2UXNA 2XPWA 2ZJPF 4BJ5C 5CVUA 4R8HA 4HSRA 3VFZA 2RHAA 3DTEA 1QHHD 2H1LA 3H5NA 2VE8A 3BTCA 2VB6A 3HTJA 2KHMA 2HQNA 4GO1A 1X1AA 3L2RA 2HEOA 1P4WA 4C3IJ 2H8RA 1D0YA 2AXLA 1NH3A 1JHFA 2BOLA 2ZB9A 5J40A 1K4SA 1BBYA 3SZPA 1R36A 1A35A 4Y17A 3KETA 4UHTA 2DFIA 3CCUI 1MSEC 4OIRF 2M1BA 5M5XJ 4F55A 4X6AJ 2NVUB 2MD5A 2FMLA 3I59B 4LG0B 2NRAC 3DPLC 1W7PD 1I50J 2JTVA 3DKWA 4FTHA 1MW7A 1SGMA 2EK5A 3HBLA 2XF5A 3I59A 4LG0A 1K4TA 1ERDA 4LLLA 3SZTA 5BMZA 3QU3A 1RKWA 4II3A 5EGOB 4OIPF 3DWLE 3BZCA 2DK8A 3S8PA 2H1KA 1U5TB 3F72A 1U0JA 3IKTA 4GFLA 1X1PA 1CF7B 2CV2A 3IAM2 3VW0A 2B7EA 3GEUA 4M72A 2BBYA 3OIQA 1CF7A 3R61A 4I0BA 4XLFA 2R7RA 2ESHA 5EF6A 5IY5H 3CUQC 2MGQA 3DLAA 4A93J 5IOZA 4M6VA 2VASA 4IHTA 1EH8A 2CO5A 2COBA 2XDVA 3KLOA 4BY7J 4EM2A 1TZLA 2E35A 1QA6A 3VVYA 5LGUA 5KVRA 3BJBA 1VQMI 3K4LA 1ETXA 4B09A 2MD0A 3KP6A 5H20A 1VZ0A 3KCCA 3BR6A 2DOFA 4EM0B 2GA1A 1G3WA 3J7AY 3VEPA 5C4JJ 1YIJI 1JUMA 3WGIA 2EV0A 2XB0X 4RGUA 4GGGA 3JRGA 5J3LA 2UXOA 1STZA 4XICA 4IRVA 4XORA 3LL7A 4AU7A 4XBFA 3OV8A 1UZCA 2NVTJ 2MSYA 2JSCA 2C6YA 1IV8A 2FJI1 4XK4A 4HLYA 2A61A 1QPIA 1P6RA 1R4NB 3B73A 1K7AA 1W5TA 3B81A 3BG9A 4P96A 3S1NJ 2LNBA 2L0KA 2YR2A 3AG4H 3AQSA 3VIBA 3L9FA 2CFOA 1ETYA 3R4KA 2DA7A 4ACIA 2W00A 2Y30A 3NRGA 2CUEA 2DDAA 4G7OF 5FGMA 4KDPA 2ELJA 2E1CA 1ZGWA 2J5PA 4AIDA 3M1EA 5GAEJ 1L3LA 3Q3SA 1EH7A 4B44A 1QHGA 2MA3A 2K9MA 3ZQHA 3K9TA 2XF7A 4HX7A 4RBOA 2Q1ZB 2DODA 5ILVA 5DAJA 5JLWA 1X2NA 1LDJA 3ZOBA 4EJTA 4BBSJ 3KZ9A 1S8NA 1R6RA 5F64A 2BVLA 3QP5A 3ANPA 5GADJ 2LRDA 1APLC 4WCGA 4HX4A 4IL6C 2QTQA 4WX9A 3N97A 5CQEA 1UHWA 2Y0SA 2ZBKA 2L01A 2QOPA 4IRIA 2CV1A 1R58A 4XKWA 4BQAA 3S2DJ 2YVXA 2PG4A 1OCTC 2ZJQF 1OCRH 1XMXA 5HS8A 4IVNA 4IHWA 4Q5SF 3CMAI 4D0PA 4B3AA 3P7NA 3RZOJ 2ZO4A 2D45A 2HYTA 1F36A 3R0AA 4CUGA 3V7RA 4FETA 2XAGA 3DQVC 3VOKA 4I6ZA 2WGBA 2H09A 1MIJA 5F0HA 3OYNA 4HDUA 5DYMA 1TWGJ 1T95A 5CW8A 4U9NA 3H9JA 3M8FA 1E3HA 3CUOA 4BE0A 5EDNA 2VN2A 3ESWB 5CLSA 1HC8A 2QKOA 2G7HA 3F3XA 1H88C 3E6MA 3H1CA 4WXDA 4IX7A 3GLLA 4C2UA 1MMAA 1D3YA 5HLTA 3G1LA 2XGEA 3HOTA 2OERA 3ASOH 3HHGA 5J4VA 4HYEA 4PGHA 2EPFA 3U2RA 1Z7UA 4C3JJ 2GLOA 1MNDA 2W53A 3CCSI 3IH4A 1MBJA 3BTJA 4FT8A 3EYIA 1EF4A 3REOA 1UCRA 4GCKA 1LKXA 1SAXA 3OYCA 3LHQA 2BVMA 2GOXB 3DU5A 5DS9A 4G7HF 4QWQA 3TGNA 4ESBA 4UUTA 3PM1A 2PZ9A 5K58A 2JVHA 3V42A 2DDBA 3D5SC 1LB2A 2X0LA 3ZR8X 2RNGA 4R79A 1E3OC 2AXTC 3IAS2 2HQAA 3ZP5A 2DCEA 1ORKA 4RB0A 3I55I 4LK1F 3L2UA 2KPMA 3CMMA 4A5MA 2IEKA 1HSTA 1ZAOA 3CDIA 1HBXG 2Z5UA 3CCYA 2M5WA 1USSA 4U87A 4IHSA 2P7VB 3G56A 1WJ5A 3KZZA 3QAHA 2MYSA 1POGA 1RNLA 3BWGA 5CVRA 5F6FA 4ZZDA 3K1MA 2PI0A 3VB2A 3F8CA 4F93B 4BEHB 3RPQA 1LFUP 1T8IA 4H4KC 2DQRA 5LHIA 1OCCH 2WB1N 3LA2A 4BEHA 1ZGAA 2RDPA 4YIRX 2VE9A 5EJCA 6PAXA 3P9TA 4MXMA 3QQAA 2PEXA 2A2FX 4L9JA 4ESJA 5IT9K 2E1OA 2EFPA 2GAUA 1XGNA 2XRLA 2LYCA 3QOEA 3LSRA 3SQNA 3OMYA 1V55H 5FLXK 1XC5A 2FEZA 1IN6A 1IN8A 3U1DA 1RUNA 3BCGA 4M3EA 3ASNH 4V2FA 3C07A 5F0CA 1TNTA 3BRUA 2M7BA 3HSEA 3M4OJ 1U8RA 3BR5A 1YJNI 5IYCJ 2JA5J 4AIHA 2BEOA 1FLIA 4XMYA 2GM4A 3GTPJ 1I3AA 1H9GA 2VJJA 3N05A 3L1PA 4FX0A 2EA4A 1P92A 2EILH 2DMQA 4CCLA 1W7PB 2OV7A 2XF6A 4CXFA 3KZIC 4L9NA 1JKQC 4XLCA 1XX5A 1VQ9I 1X1CA 1QRYA 1W7PA 1XCVA 2DAOA 2BYVE 1VQ4I 2G9WA 3LQQA 3W2AA 1FOYA 2LOOA 2O61A 4AYBA 1JE8A 3HOWJ 2VUMJ 2LR8A 3RD3A 4P9FA 2HQRA 2MH9A 4OMZA 4M9SA 2VBYA 2M2EA 4Q47A 3ZQ7A 4M9ZA 3VPRA 1MBEA 3W3CA 5L3EA 1U8BA 2V9KA 1S7EA 1Y8QB 1K79A 5FRMA 3CD6I 1SFUA 1MBFA 4RB1A 2FA5A 2ZMEA 1RETA 1BR2A 5F04A 2AO9A 4F7ZA 3QU6A 3G73A 1KYWA 1KA8A 3S2HJ 5CPRB 2FBKA 4P9UA 1SFXA 3DEEA 2EFWA 2JK3A 3BPVA 3F6VA 2ETHA 2NS7A 2O9LA 4LGWA 2N8GA 1W5SA 1D1CA 1HKQA 4IQ4A 1Y8RB 3GTLJ 3P5JA 3BPXA 2VBZA 3ABUA 2JA7J 1TWAJ 4R1HA 4DNCA 1PJRA 1UJ8A 4GRIA 3FHZA 2M30A 3ROUA 3GBGA 1FC3A 4Y7NJ 2L9VA 3FBNB 4BNCA 1FYMA 1UHMA 4WWCA 2DA4A 4YG2F 3H5AA 5EFYA 2DFHA 2HS5A 3OIPA 4XN0A 1TW3A 1FX7A 2R7WA 3L2VA 2V1NA 3K6GA 3GZNB 1IZ1A 3B02A 2MG4A 4U0YA 3U9GA 3WTWC 5CKTA 5J1UA 4A3JJ 4JQFA 3HOZJ 4IZZA 2FQ4A 1V4RA 3W6KB 1X58A 2HNHA 2E5NA 2YSRA 1B9MA 3MKZA 1R4MB 4ENNA 2XAJA 2HYFA 1E2XA 1V5EA 4HQEA 2O8KA 2KJCA 4XOTA 5D5WB 3JTGA 2KJBA 3KYLA 1ZTRA 1MH3A 1JTYA 2EFOA 2XV4S 3ULQB 2RVCA 2GUHA 1FEXA 3HM5A 3BR3A 2X1EA 4OAYA 1XTAA 3FKJA 3JTHA 3U1KA 3LSMA 1HCRA 4AIKA 1HDDC 2VKHA 1WJEA 2B3WA 2KRHA 3V78A 1MD0A 4BQOA 2GQQA 4BJ6C 2BXZA 3NWSA 2XASA 5GTIC 5C4XJ 2H8WA 1V3FA 5DD8A 5L3FA 1VF9A 4G6QA 4CO8A 2Z33A 2R7SA 5IP6A 1WJCA 4PDKA 1ZRDA 2R7DA 2FD5A 4D5CA 4KN4X 2DJNA 1UI6A 4M74A 2OZ6A 4L5IA 1ETWA 3PFYA 4K2EA 3HOVJ 2DT6A 2QGUA 3K0LA 1WZ2A 1Z77A 1IXRC 1TQMA 4OWRB 4A5NA 3HIMA 1NG6A 3BG6A 3TEDA 3V8JA 1I39A 4BGDA 5FFZA 2KIUA 1BJAA 1UG2A 3S16J 2IGNA 3BR1A 2RASA 1BW5A 2QIBA 1VQLI 1YX3A 2XB5A 1AA7A 3VOXA 3JRBA 2I8DA 1YQAA 4IOAF 3HIFA 2ISZA 3I0TA 3F6OA 2OJED 3DFGA 3QBMA 3HXLA 2E7WA 5JVGF 3K7AJ 3OS0A 3C2BA 3K8PC 3PASA 3QP6A 4BXUA 4MTEA 4A3CJ 5D4SA 1YS6A 2CS3A 1T2KA 1N75A 4GCTA 3CF5F 2CWEA 3F8MA 3UR3C 4B48A 3FXMA 3GFIA 3PPBA 2CW0F 1A5JA 3MKYB 2EZLA 1RZ4A 3ZRGA 1LEBA 3HTUA 1XSVA 2WADA 3HOSA 4YEJA 2R7QA 2A5WA 5BPDA 1X19A 3ZMTA 3LJLA 2ZMEC 2K27A 3KP4A 4W97A 5HVQC 2NYXA 1S7AA 4RMNA 3JRDA 2FOKA 1DDNA 2W48A 2VC0A 2RREA 1FY7A 3VYSB 2YU3A 4WXCA 5E8IA 2R5ZB 1WPKA 3WE2A 1XB4A 4AM3A 5HS7A 4RGRA 2JWTA 2R5ZA 1P7IA 1QVTA 3WU0A 1MBKA 2CQNA 2VT3A 1Z21A 1E17A 3CWRA 3H3UA 2OQRA 2KL4A 1PVEA 3ZN0A 3VYTB 2K7LA 4BXXJ 3E7QA 2JVGA 2DT5A 1W0TA 1W36D 1GLNA 1ZELA 2IJLA 4NC6A 3W6VA 3VSKA 3EPZA 1JKRC 2R7XA 1MNMC 3RDIA 2DU9A 4C9YA 3S14J 4F3QA 3CCQI 1UB9A 3A0BC 4BBRJ 2DOAA 4RDUA 2CUFA 3PNVA 1T33A 2A3SA 3KYCB 4XNFA 3SFZA 3WU2C 4HG2A 4JBAA 4ZYGA 5D19A 5D5UB 2VONA 1D1BA 2IU5A 2DG8A 4IRGA 3WGGA 1MMDA 1BA5A 1P9QC 1FSEA 1B4AA 2YX4A 3CTAA 2FX0A 3RKQA 4OIQF 1F43A 5K7ZA 1VQOI 3T5XA 3HDDA 5IT3A 5D8LB 1SMTA 3OR1C 4RGSA 2HVQA 4QTRA 3GX4X 1Z6RA 3M3YJ 1R1VA 1I6HJ 2X9DA 2XAFA 4YIFA 1XGOA 5CQGA 3GWZA 2QLZA 3FKIJ 3CC4I 3TO6A 4F52A 1Z9CA 2O0YA 1ZRCA 4GCVA 1IGNA 1SFEA 2L7KA 4M3GA 1IN4A 2DA2A 1QZZA 4CHUA 1HDPA 4P1WA 1RI7A 2IA2A 3MVPA 3VP5A 3H9QA 3E97A 3PIPF 1O57A 5TISC 3BY6A 3AL0B 1XSXA 1SVOA 1ULYA 3TO7A 5EZGA 5EZHA 3WE3A 3VVZA 3OSFA 1ENHA 3A0HC 2R3SA 5JHUA 3NQOA 4EM1A 4U0WA 2PFBA 2WAEA 1OKRA 1D8KA 5B3SH 2V1UA 1FP1D 1XGSA 3K1PA 4HOBA 4ITVA 3QPSA 3TMOA 2G3BA 2XC7A 2P6SA 1OCPA 2XSDC 1I27A 5E20A 1Y0NA 3IC7A 3ECHA 2XGXA 4W1UA 2GIVA 2L4MA 2K40A 1BR4A 2JA8J 2RKHA 3VWBA 3G6EI 3MN2A 5L3GA 2QF7A 2GWRA 4ZTFA 3DEWA 4OINF 3BJAA 2HOAA 3DTKA 2UWMA 1CGPA 1D5YA 3FXKA 3G2BA 3OYKA 4BE2A 2CJJA 4UVBA 3PQJA 4XIDA 1R9TJ 2FMYA 2X1CA 2DMTA 2EZKA 1ZREA 3G1MA 4XLPF 1G8XA 2YVEA 3K4MA 3JW4A 3BC8A 1T38A 3ZMZA 3M9AA 1L0OC 3HKZA 3JRFA 3LAJA 1FP2A 2JJ7A 2HDDA 3HGYA 2PMZN 5FD6A 4IHVA 3HTHA 3SEZA 4EGYA 1OR7C 4LIVA 2OBPA 4E7HA 4KMUX 5M5YJ 3OOPA 5H2FC 4O3MA 1MBHA 4NC8A 4UB6C 1PUEE 4XRFA 5DV5A 3DKYA 4MHGA 2KP6A 3WHCA 3VODA 3HYIA 2HVRA 2F5EA 5EGOA 3TKYA 2DPDA 1TTYA 3S17J 2REKA 4PCQA 3OYFA 1IXCA 4MIMA 1U5TA 2DMNA 2QQ9A 1GUUA 1Z7LA 4DW6A 3N4MA 3VOEA 2PJRB 2M0MA 4CH7A 3HRMA 2CUZA 3AFHA 1JUPA 5FD5A 1FMVA 1MSFC 3IWZA 4AYBN 5KAIC 1WJDA 2RGVA 4E6KG 1C0WA 2PJRA 2LY2A 1U78A 4BXFA 2D6YA 1MZBA 2LK2A 3C3WA 2P0WA 3AG2H 3MZ8A 2W85A 1IAWA 4B3XA 4JX5A 4M73A 4PZJA 1MGTA 2KRFA 2D2WA 1NHAA 3LQRA 2TCTA 5DM6F 4AUXA 2DA1A 3K70D 1W5CC 3LSTA 4BACA 3K4CA 4DBRA 3CCLI 2OU2A 3GUDA 3LMMA 3MD2A 4RAZA 1W0UA 2IA0A 1XPXA
chains in the Genus database with same CATH topology
4PXIA 4A3MJ 2D5VA 1JKOC 2F07A 1AU7A 2NP3A 3SJMA 4XRMA 5GP9A 5F08A 2TRTA 1RKTA 2IEKA 2K9NA 2ZOYA 4DYRA 2KT0A 3CCYA 4AC6A 4D7NA 3DPJA 3G56A 2LKXA 1POGA 3A03A 4A69C 5M3MJ 3RQIA 5HAWA 1LFUP 2P81A 3BHQA 3I4NJ 2WB1N 3GTMJ 3NXCA 4A3BJ 2HOTA 1SANA 1LE8B 3P9TA 4MXMA 2HYJA 2B63J 4B1RA 3QQAA 3QPLA 1Y1WJ 4UUSB 4NDLA 2E1OA 2L7MP 2R0QC 1LE8A 3ZQIA 4GFBA 4M3DA 3SDGA 2XRLA 5FKMA 3LSRA 2Q24A 3GTQJ 5CXIA 3BNIA 5EG0B 2VKEA 3LOCA 4UUSA 1ZR4A 1FTZA 1XC5A 2UXPA 4L62A 2R93J 3BCGA 4HKUA 1FIPA 4M3EA 4V2FA 3COLA 2EH3A 5EG0A 1JGGA 3C07A 5F0CA 4B4CA 3BRUA 3H3VK 3LWJA 2NVQJ 1OFCX 3M4OJ 3BTIA 3GTJJ 3BR5A 5IYCJ 4ABZA 2JA5J 3MKLA 5GPAA 2EZIA 1GT0C 1JT6A 4MO7A 4KWAA 3EGQA 2GM4A 3GTPJ 1TWHJ 2K9QA 5E3MA 4MFDA 3S1QJ 1JT0A 3L1PA 2L7FP 3JR9A 2M34A 2DMQA 2R7ZJ 2DA5A 5CXGA 5K7HA 5F0FA 1JKQC 3DCFA 5DTDA 1RPWA 3IH3A 2XGDA 1QRYA 4NELA 2QWTA 3TP3A 1IDZA 3GTOJ 5FGLA 2E2JJ 1NK2P 3LSGA 3Q0WA 3JSJA 3B6CA 2MW8A 3LNQA 5C4YA 2M8GX 3HOWJ 2VUMJ 2LR8A 3HOXJ 3RD3A 1I3QJ 1B72B 2CRGA 1IC8A 4A3FJ 2M2EA 2NVXJ 3VPRA 5C44J 4IHXA 1MBEA 1U8BA 2X6OA 3IH2A 1B72A 4Y52J 1JTXA 2IAIA 1S7EA 5H9TA 3JRIA 3I4MJ 1GV5A 2ELKA 1MBFA 1RETA 5IP9J 5FMPA 2YS9A 2ECCA 2I10A 5F04A 5FKLA 2AO9A 2YVHA 2LTPA 2ME6A 1G2HA 2K9SA 1YRNB 2NP5A 5IPAA 3S2HJ 5HODA 3A02A 4YZEA 1GV2A 2O7TA 1GVDA 1YRNA 2UXIA 2EZHA 2JK3A 2UXUA 2DA6A 2OPTA 2NS7A 3OSGA 2DA3A 2O9LA 2HOSA 2N8GA 3BTLA 4FE4A 1U9OA 4DYCA 2E2IJ 2Y2ZA 5IOYA 3GTLJ 3HOUJ 2JA6J 2JA7J 3OIOA 1TWAJ 2M9HA 2XPUA 3VW2A 3GBGA 3IV5A 4A3DJ 4Y7NJ 1IRZA 1FJLA 3CMYA 2ZCXA 3JREA 2DA4A 4IHYA 4MK6A 5EFYA 2QCOA 3E7LA 3Q0VA 3LSPA 2KDZA 5FKOA 4D7MA 3BR0A 3ZQGA 5GPCA 2MG4A 3S5RA 4M3FA 4JKZA 2WUIA 4A3EJ 5J1UA 4A3JJ 2VKVA 2LFBA 3HOZJ 3FRQA 2FQ4A 2V57A 1SFOJ 1Z0XA 1BJZA 1ETOA 1X58A 3HB9A 1ETVA 1DU0A 5D1RA 2O8KA 1XS9A 3TW6A 2CQQA 1FIAA 3PO2J 4V2GA 2NX4A 1ZTRA 3PO3J 1MH3A 5M3FJ 3FIWA 1BL0A 1JTYA 3FISA 1WGXA 1ITYA 3HEFA 2LLKA 2CU7A 3H0GJ 3HGGA 1TWCJ 3O8GA 2GUHA 3GZIA 1FEXA 1BW6A 2XGCA 3BR3A 3HM5A 1WH5A 5FKKA 4A3GJ 2AHQA 3UKGA 2X48A 1HCRA 5FJ8J 1RESA 1WH7A 2HQ5A 1HDDC 1H8AC 1GDTA 1U9NA 5F1JA 3V78A 2E2HJ 4GCLA 5C4XJ 4XRSG 3LSJA 3NARA 4AC0A 5F27A 2LP0A 4DYQA 1VF9A 5E3OA 2FJ1A 1ZQ3P 1LFBA 1MH4A 5IP6A 2E19A 2HXIA 3CQZJ 3F0CA 3KNWA 1X2MA 2FD5A 4FCYA 4D5CA 2G7GA 2DJNA 2EBIA 2ME0A 1VFCA 3JRAA 4JX6A 4LOCA 4BKXA 1UI6A 3T6NA 1ETWA 3HOVJ 2DTZA 1Z77A 2NVYJ 3HIMA 2UXHA 2M0CA 1ZR2A 4AF5A 3IUVA 3K2AA 3TEDA 2R5YB 4NN1A 1UG2A 3S16J 1RR7A 3BR1A 2GFNA 2RASA 3S1RJ 1BW5A 2XPWA 2R5YA 2QIBA 1ZK8A 3AQTA 2XB5A 2ZOZA 2RHAA 5J1YA 3ZQLA 3JRBA 3VOXA 4C2MJ 3BTCA 3HTJA 5FHPA 1IDYA 4C3IJ 2ECBA 2H8RA 1DU6A 1MBGA 3QBMA 2ZB9A 3BG5A 3K7AJ 3C2BA 3PASA 2JN6A 4A3CJ 4GCTA 2ZCMA 2JMWA 3ANGA 3GTKJ 3Q0UA 3PPBA 1A5JA 1VNDA 5M5WJ 1MSEC 1Y1VJ 2EZLA 5M5XJ 3S1MJ 4X6AJ 2LD5A 5D18A 4I76A 1I50J 4GFKA 3FK7A 3LJLA 4FTHA 1SGMA 3HBLA 4W97A 2YU9J 3A01B 1RKWA 5EGOB 4FE7A 1JUSA 3JRDA 3CDLA 3EUPA 2W48A 3A01A 2H1KA 2ZCNA 2R5ZB 1HLVA 1NTCA 1WPKA 3JRCA 4GFLA 1T56A 3G7RA 2JWTA 2Y31A 2R5ZA 4ME9A 1ETKA 1P7IA 1QVTA 5J1RA 2R92J 1MBKA 3GEUA 1IV6A 4A3KJ 1AKHB 2IBDA 4CYCB 3CWRA 2LVSA 2ID6A 3FK6A 1K61A 3E7QA 4BXXJ 5EF6A 1W0TA 1AKHA 4CYCA 3ZQCA 2MGQA 3W6VA 1JKRC 5IOZA 4A93J 1MNMC 4M6VA 3ON4A 4JL3A 3BQYA 3S14J 2COBA 4JYKA 5IP7J 4BBRJ 4BY7J 3NPIA 3TP0A 4RDUA 1TC3C 4S0HB 2CUFA 3VVYA 2DN0A 3KKCA 1T33A 4QIWN 3BJBA 3HTIA 2HXOA 1ETXA 5D19A 3OOUA 3BG3A 3VW1A 1H89C 3BR6A 2IU5A 2DG8A 3TW7A 1ETQA 2HI3A 4XRSA 3HE0A 4UDSA 1BA5A 5C4JJ 2G0EA 9ANTA 2FX0A 3RKQA 1JUMA 2L7ZA 5K7ZA 2XB0X 5FKNA 1F43A 3GTGJ 2Y9YA 2YUSA 3HDDA 4L5EA 4QTRA 3JRGA 4JNNA 1CQTA 1IG7A 3M3YJ 5J3LA 2UXOA 1I6HJ 2X9DA 2LY9A 4XICA 3WHBA 1ZKGA 2O7OA 3FKIJ 3KKDA 2GBYA 2XPVA 2NVTJ 3ZQFA 1JJ8C 2MSYA 5C3EJ 3S15J 2G7LA 3BR2A 4JP0A 5IYBJ 1IGNA 4XK4A 5FLVA 1QPIA 3MNLA 4M3GA 2DA2A 4A3IJ 1HDPA 3B81A 3BG9A 3S1NJ 2PBXA 1K83J 3MVPA 3VP5A 5EYRA 2L0KA 4FISA 1UHSA 3AQSA 3VIBA 5EZGA 5EZHA 5E3LA 1VI0A 1PUFB 1ETYA 1Q1VA 4EEFG 5AQCA 2DA7A 3VVZA 4ACIA 4JX4A 3OSFA 1ENHA 2Y30A 2L9RA 4D5FA 3F1BA 3NRGA 2CUEA 1PUFA 1AHDP 4A3LJ 4J19A 1ZGWA 3QPSA 3NNRA 2G3BA 3Q3SA 1IJWC 2ID3A 1OCPA 2XSDC 1NK3P 2VI6A 2OI8A 3NI7A 3O8HA 3ZQHA 4W1UA 4RBOA 2K40A 2JA8J 5DAJA 5JLWA 1X2NA 3MN2A 3ZOBA 4BBSJ 2RAEA 2QF7A 3KZ9A 3DEWA 1UMQA 2HOAA 5FLMJ 2G7SA 2DG7A 1D5YA 3ANPA 1B8IB 3HTAA 2DMPA 2CJJA 1APLC 1IUFA 4XIDA 1R9TJ 2DMTA 2EZKA 3V6GA 4CGRA 3G1MA 4HNVA 4C3HJ 1B8IA 2QTQA 2YVEA 3CJDA 3D1NI 2NS8A 3HOYJ 1JKPC 2QOPA 4QSHA 2EQRA 1QVUA 5JLXA 4M3BA 3VUQA 2GENA 3S2DJ 3JRFA 1WI3A 1OCTC 1O4XA 4IHWA 2FBQA 2JJ7A 2WAQN 2WV1A 2HDDA 1HOMA 4B3AA 5EEAA 3HGYA 2PMZN 3RZOJ 4MFEA 4ICHA 2HYTA 4IHVA 1F36A 3HTHA 1P7JA 3VOKA 1XG1A 4IEJA 2OF7A 4I6ZA 1A6IA 4G12A 2WGBA 5M5YJ 5F0HA 3RZDJ 3RH2A 1TWGJ 4X1EA 1MBHA 3NAUA 5CW8A 2Y9ZA 3VW0A 3JRHA 5EDNA 3O60A 2QKOA 1JJ6C 3BQZA 5HSZA 1H88C 4DZJA 3WHCA 3G1OA 2NOGA 2Y0SN 3B6AA 5EGOA 5E3NA 5HBUA 3G1LA 2XGEA 3S17J 2REKA 5IYDJ 3HKZN 1WCMJ 2OERA 4MIMA 2DMNA 2VPRA 1GUUA 4DW6A 4C3JJ 2GLOA 2W53A 3IH4A 4BY1J 1MBJA 2XDNA 3BT9A 1JUPA 1MSFC 3BTJA 4AYBN 2DMUA 1OJLA 1EF4A 3QKXA 4GCKA 1U78A 5BNGA 3VVXA 2D6YA 3LHQA 2CQXA 2LK2A 1UI5A 2HKUA 4JX5A 1TWFJ 5DS9A 4UUTA 3PM1A 5K7FA 1HF0A 2PZ9A 2TCTA 5K58A 4AUXA 2DA1A 3ON2A 1FTTA 4MLOA 4DZPA 1E3OC 3SFIA 3CRJA 1W0UA 1ORKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PXI A;  4A3M J;  2D5V A;  1JKO C;  2F07 A;  1AU7 A;  2NP3 A;  3SJM A;  4XRM A;  5GP9 A;  5F08 A;  2TRT A;  1RKT A;  2IEK A;  2K9N A;  2ZOY A;  4DYR A;  2KT0 A;  3CCY A;  4AC6 A;  4D7N A;  3DPJ A;  3G56 A;  2LKX A;  1POG A;  3A03 A;  4A69 C;  5M3M J;  3RQI A;  5HAW A;  1LFU P;  2P81 A;  3BHQ A;  3I4N J;  2WB1 N;  3GTM J;  3NXC A;  4A3B J;  2HOT A;  1SAN A;  1LE8 B;  3P9T A;  4MXM A;  2HYJ A;  2B63 J;  4B1R A;  3QQA A;  3QPL A;  1Y1W J;  4UUS B;  4NDL A;  2E1O A;  2L7M P;  2R0Q C;  1LE8 A;  3ZQI A;  4GFB A;  4M3D A;  3SDG A;  2XRL A;  5FKM A;  3LSR A;  2Q24 A;  3GTQ J;  5CXI A;  3BNI A;  5EG0 B;  2VKE A;  3LOC A;  4UUS A;  1ZR4 A;  1FTZ A;  1XC5 A;  2UXP A;  4L62 A;  2R93 J;  3BCG A;  4HKU A;  1FIP A;  4M3E A;  4V2F A;  3COL A;  2EH3 A;  5EG0 A;  1JGG A;  3C07 A;  5F0C A;  4B4C A;  3BRU A;  3H3V K;  3LWJ A;  2NVQ J;  1OFC X;  3M4O J;  3BTI A;  3GTJ J;  3BR5 A;  5IYC J;  4ABZ A;  2JA5 J;  3MKL A;  5GPA A;  2EZI A;  1GT0 C;  1JT6 A;  4MO7 A;  4KWA A;  3EGQ A;  2GM4 A;  3GTP J;  1TWH J;  2K9Q A;  5E3M A;  4MFD A;  3S1Q J;  1JT0 A;  3L1P A;  2L7F P;  3JR9 A;  2M34 A;  2DMQ A;  2R7Z J;  2DA5 A;  5CXG A;  5K7H A;  5F0F A;  1JKQ C;  3DCF A;  5DTD A;  1RPW A;  3IH3 A;  2XGD A;  1QRY A;  4NEL A;  2QWT A;  3TP3 A;  1IDZ A;  3GTO J;  5FGL A;  2E2J J;  1NK2 P;  3LSG A;  3Q0W A;  3JSJ A;  3B6C A;  2MW8 A;  3LNQ A;  5C4Y A;  2M8G X;  3HOW J;  2VUM J;  2LR8 A;  3HOX J;  3RD3 A;  1I3Q J;  1B72 B;  2CRG A;  1IC8 A;  4A3F J;  2M2E A;  2NVX J;  3VPR A;  5C44 J;  4IHX A;  1MBE A;  1U8B A;  2X6O A;  3IH2 A;  1B72 A;  4Y52 J;  1JTX A;  2IAI A;  1S7E A;  5H9T A;  3JRI A;  3I4M J;  1GV5 A;  2ELK A;  1MBF A;  1RET A;  5IP9 J;  5FMP A;  2YS9 A;  2ECC A;  2I10 A;  5F04 A;  5FKL A;  2AO9 A;  2YVH A;  2LTP A;  2ME6 A;  1G2H A;  2K9S A;  1YRN B;  2NP5 A;  5IPA A;  3S2H J;  5HOD A;  3A02 A;  4YZE A;  1GV2 A;  2O7T A;  1GVD A;  1YRN A;  2UXI A;  2EZH A;  2JK3 A;  2UXU A;  2DA6 A;  2OPT A;  2NS7 A;  3OSG A;  2DA3 A;  2O9L A;  2HOS A;  2N8G A;  3BTL A;  4FE4 A;  1U9O A;  4DYC A;  2E2I J;  2Y2Z A;  5IOY A;  3GTL J;  3HOU J;  2JA6 J;  2JA7 J;  3OIO A;  1TWA J;  2M9H A;  2XPU A;  3VW2 A;  3GBG A;  3IV5 A;  4A3D J;  4Y7N J;  1IRZ A;  1FJL A;  3CMY A;  2ZCX A;  3JRE A;  2DA4 A;  4IHY A;  4MK6 A;  5EFY A;  2QCO A;  3E7L A;  3Q0V A;  3LSP A;  2KDZ A;  5FKO A;  4D7M A;  3BR0 A;  3ZQG A;  5GPC A;  2MG4 A;  3S5R A;  4M3F A;  4JKZ A;  2WUI A;  4A3E J;  5J1U A;  4A3J J;  2VKV A;  2LFB A;  3HOZ J;  3FRQ A;  2FQ4 A;  2V57 A;  1SFO J;  1Z0X A;  1BJZ A;  1ETO A;  1X58 A;  3HB9 A;  1ETV A;  1DU0 A;  5D1R A;  2O8K A;  1XS9 A;  3TW6 A;  2CQQ A;  1FIA A;  3PO2 J;  4V2G A;  2NX4 A;  1ZTR A;  3PO3 J;  1MH3 A;  5M3F J;  3FIW A;  1BL0 A;  1JTY A;  3FIS A;  1WGX A;  1ITY A;  3HEF A;  2LLK A;  2CU7 A;  3H0G J;  3HGG A;  1TWC J;  3O8G A;  2GUH A;  3GZI A;  1FEX A;  1BW6 A;  2XGC A;  3BR3 A;  3HM5 A;  1WH5 A;  5FKK A;  4A3G J;  2AHQ A;  3UKG A;  2X48 A;  1HCR A;  5FJ8 J;  1RES A;  1WH7 A;  2HQ5 A;  1HDD C;  1H8A C;  1GDT A;  1U9N A;  5F1J A;  3V78 A;  2E2H J;  4GCL A;  5C4X J;  4XRS G;  3LSJ A;  3NAR A;  4AC0 A;  5F27 A;  2LP0 A;  4DYQ A;  1VF9 A;  5E3O A;  2FJ1 A;  1ZQ3 P;  1LFB A;  1MH4 A;  5IP6 A;  2E19 A;  2HXI A;  3CQZ J;  3F0C A;  3KNW A;  1X2M A;  2FD5 A;  4FCY A;  4D5C A;  2G7G A;  2DJN A;  2EBI A;  2ME0 A;  1VFC A;  3JRA A;  4JX6 A;  4LOC A;  4BKX A;  1UI6 A;  3T6N A;  1ETW A;  3HOV J;  2DTZ A;  1Z77 A;  2NVY J;  3HIM A;  2UXH A;  2M0C A;  1ZR2 A;  4AF5 A;  3IUV A;  3K2A A;  3TED A;  2R5Y B;  4NN1 A;  1UG2 A;  3S16 J;  1RR7 A;  3BR1 A;  2GFN A;  2RAS A;  3S1R J;  1BW5 A;  2XPW A;  2R5Y A;  2QIB A;  1ZK8 A;  3AQT A;  2XB5 A;  2ZOZ A;  2RHA A;  5J1Y A;  3ZQL A;  3JRB A;  3VOX A;  4C2M J;  3BTC A;  3HTJ A;  5FHP A;  1IDY A;  4C3I J;  2ECB A;  2H8R A;  1DU6 A;  1MBG A;  3QBM A;  2ZB9 A;  3BG5 A;  3K7A J;  3C2B A;  3PAS A;  2JN6 A;  4A3C J;  4GCT A;  2ZCM A;  2JMW A;  3ANG A;  3GTK J;  3Q0U A;  3PPB A;  1A5J A;  1VND A;  5M5W J;  1MSE C;  1Y1V J;  2EZL A;  5M5X J;  3S1M J;  4X6A J;  2LD5 A;  5D18 A;  4I76 A;  1I50 J;  4GFK A;  3FK7 A;  3LJL A;  4FTH A;  1SGM A;  3HBL A;  4W97 A;  2YU9 J;  3A01 B;  1RKW A;  5EGO B;  4FE7 A;  1JUS A;  3JRD A;  3CDL A;  3EUP A;  2W48 A;  3A01 A;  2H1K A;  2ZCN A;  2R5Z B;  1HLV A;  1NTC A;  1WPK A;  3JRC A;  4GFL A;  1T56 A;  3G7R A;  2JWT A;  2Y31 A;  2R5Z A;  4ME9 A;  1ETK A;  1P7I A;  1QVT A;  5J1R A;  2R92 J;  1MBK A;  3GEU A;  1IV6 A;  4A3K J;  1AKH B;  2IBD A;  4CYC B;  3CWR A;  2LVS A;  2ID6 A;  3FK6 A;  1K61 A;  3E7Q A;  4BXX J;  5EF6 A;  1W0T A;  1AKH A;  4CYC A;  3ZQC A;  2MGQ A;  3W6V A;  1JKR C;  5IOZ A;  4A93 J;  1MNM C;  4M6V A;  3ON4 A;  4JL3 A;  3BQY A;  3S14 J;  2COB A;  4JYK A;  5IP7 J;  4BBR J;  4BY7 J;  3NPI A;  3TP0 A;  4RDU A;  1TC3 C;  4S0H B;  2CUF A;  3VVY A;  2DN0 A;  3KKC A;  1T33 A;  4QIW N;  3BJB A;  3HTI A;  2HXO A;  1ETX A;  5D19 A;  3OOU A;  3BG3 A;  3VW1 A;  1H89 C;  3BR6 A;  2IU5 A;  2DG8 A;  3TW7 A;  1ETQ A;  2HI3 A;  4XRS A;  3HE0 A;  4UDS A;  1BA5 A;  5C4J J;  2G0E A;  9ANT A;  2FX0 A;  3RKQ A;  1JUM A;  2L7Z A;  5K7Z A;  2XB0 X;  5FKN A;  1F43 A;  3GTG J;  2Y9Y A;  2YUS A;  3HDD A;  4L5E A;  4QTR A;  3JRG A;  4JNN A;  1CQT A;  1IG7 A;  3M3Y J;  5J3L A;  2UXO A;  1I6H J;  2X9D A;  2LY9 A;  4XIC A;  3WHB A;  1ZKG A;  2O7O A;  3FKI J;  3KKD A;  2GBY A;  2XPV A;  2NVT J;  3ZQF A;  1JJ8 C;  2MSY A;  5C3E J;  3S15 J;  2G7L A;  3BR2 A;  4JP0 A;  5IYB J;  1IGN A;  4XK4 A;  5FLV A;  1QPI A;  3MNL A;  4M3G A;  2DA2 A;  4A3I J;  1HDP A;  3B81 A;  3BG9 A;  3S1N J;  2PBX A;  1K83 J;  3MVP A;  3VP5 A;  5EYR A;  2L0K A;  4FIS A;  1UHS A;  3AQS A;  3VIB A;  5EZG A;  5EZH A;  5E3L A;  1VI0 A;  1PUF B;  1ETY A;  1Q1V A;  4EEF G;  5AQC A;  2DA7 A;  3VVZ A;  4ACI A;  4JX4 A;  3OSF A;  1ENH A;  2Y30 A;  2L9R A;  4D5F A;  3F1B A;  3NRG A;  2CUE A;  1PUF A;  1AHD P;  4A3L J;  4J19 A;  1ZGW A;  3QPS A;  3NNR A;  2G3B A;  3Q3S A;  1IJW C;  2ID3 A;  1OCP A;  2XSD C;  1NK3 P;  2VI6 A;  2OI8 A;  3NI7 A;  3O8H A;  3ZQH A;  4W1U A;  4RBO A;  2K40 A;  2JA8 J;  5DAJ A;  5JLW A;  1X2N A;  3MN2 A;  3ZOB A;  4BBS J;  2RAE A;  2QF7 A;  3KZ9 A;  3DEW A;  1UMQ A;  2HOA A;  5FLM J;  2G7S A;  2DG7 A;  1D5Y A;  3ANP A;  1B8I B;  3HTA A;  2DMP A;  2CJJ A;  1APL C;  1IUF A;  4XID A;  1R9T J;  2DMT A;  2EZK A;  3V6G A;  4CGR A;  3G1M A;  4HNV A;  4C3H J;  1B8I A;  2QTQ A;  2YVE A;  3CJD A;  3D1N I;  2NS8 A;  3HOY J;  1JKP C;  2QOP A;  4QSH A;  2EQR A;  1QVU A;  5JLX A;  4M3B A;  3VUQ A;  2GEN A;  3S2D J;  3JRF A;  1WI3 A;  1OCT C;  1O4X A;  4IHW A;  2FBQ A;  2JJ7 A;  2WAQ N;  2WV1 A;  2HDD A;  1HOM A;  4B3A A;  5EEA A;  3HGY A;  2PMZ N;  3RZO J;  4MFE A;  4ICH A;  2HYT A;  4IHV A;  1F36 A;  3HTH A;  1P7J A;  3VOK A;  1XG1 A;  4IEJ A;  2OF7 A;  4I6Z A;  1A6I A;  4G12 A;  2WGB A;  5M5Y J;  5F0H A;  3RZD J;  3RH2 A;  1TWG J;  4X1E A;  1MBH A;  3NAU A;  5CW8 A;  2Y9Z A;  3VW0 A;  3JRH A;  5EDN A;  3O60 A;  2QKO A;  1JJ6 C;  3BQZ A;  5HSZ A;  1H88 C;  4DZJ A;  3WHC A;  3G1O A;  2NOG A;  2Y0S N;  3B6A A;  5EGO A;  5E3N A;  5HBU A;  3G1L A;  2XGE A;  3S17 J;  2REK A;  5IYD J;  3HKZ N;  1WCM J;  2OER A;  4MIM A;  2DMN A;  2VPR A;  1GUU A;  4DW6 A;  4C3J J;  2GLO A;  2W53 A;  3IH4 A;  4BY1 J;  1MBJ A;  2XDN A;  3BT9 A;  1JUP A;  1MSF C;  3BTJ A;  4AYB N;  2DMU A;  1OJL A;  1EF4 A;  3QKX A;  4GCK A;  1U78 A;  5BNG A;  3VVX A;  2D6Y A;  3LHQ A;  2CQX A;  2LK2 A;  1UI5 A;  2HKU A;  4JX5 A;  1TWF J;  5DS9 A;  4UUT A;  3PM1 A;  5K7F A;  1HF0 A;  2PZ9 A;  2TCT A;  5K58 A;  4AUX A;  2DA1 A;  3ON2 A;  1FTT A;  4MLO A;  4DZP A;  1E3O C;  3SFI A;  3CRJ A;  1W0U A;  1ORK A; 
#chains in the Genus database with same CATH topology
 3CES A;  4PXI A;  2V4J C;  2D5V A;  2KZV A;  1JKO C;  5E1X A;  3LSI A;  3W2W A;  1AU7 A;  2NP3 A;  3HPH A;  1YW9 A;  3EUK L;  5F08 A;  1RKT A;  1YIT I;  5AON A;  2GOM A;  2IP2 A;  2B9S A;  1SD4 A;  2RN7 A;  4D7N A;  1FYK A;  2JT1 A;  2OZU A;  2ZXI A;  2AQE A;  2VXD A;  5HLG A;  5J8F A;  2F5V A;  3ELK A;  3RQI A;  1YOV B;  3CCR I;  3QPT A;  1XSD A;  5DEQ A;  2P81 A;  2IGM A;  1SD5 A;  3NXC A;  3JSO A;  2V9V A;  5LLQ A;  2HOT A;  1LE8 B;  1YE9 A;  2HYJ A;  3FMS A;  2CW7 A;  4B1R A;  2ZKZ A;  3IRQ A;  3F8F A;  2BGC A;  4MGR A;  2LC2 A;  2JRT A;  1XDU A;  3DKX A;  4Y4R A;  1Y1W J;  4UUS B;  3J7Y J;  1LE8 A;  4GFB A;  4UV8 A;  4WIB A;  2Q24 A;  3GCM A;  3NEU A;  3GTQ J;  3BNI A;  5CXI A;  1T08 B;  2P4W A;  3P9C A;  5HNH A;  1MMN A;  4UUS A;  1ZR4 A;  2Z9O A;  2UXP A;  4L62 A;  1LPQ A;  5DCF A;  1FIP A;  1MMS A;  1JGG A;  1TT5 B;  3GO5 A;  4XSX F;  1O3T A;  3H3V K;  5GPA A;  1JT6 A;  1XD7 A;  1IN5 A;  3K4N A;  3BLY A;  4TV7 A;  3OS2 A;  4KWA A;  5D8K B;  2TDX A;  1EH6 A;  2K9Q A;  4IF4 A;  4KUM A;  2FNP A;  5E3M A;  2IS4 A;  1JT0 A;  3GZ6 A;  2VOP A;  1DGW Y;  2WY7 Q;  4PFP A;  4PSX A;  1WJB A;  1KGS A;  5CXG A;  4LFU A;  3RCO A;  2X6W A;  5K7H A;  5F0F A;  4O5V A;  3DCF A;  3I64 A;  1RPW A;  2EV5 A;  2XGD A;  4RAY A;  1KZH A;  3ERM A;  2DPU A;  3G4S I;  2MC4 A;  2ADU A;  2WBM A;  2WWY A;  1NK2 P;  1YI2 I;  2BV6 A;  3LSG A;  2PMU A;  4KT6 A;  5L3D A;  2PLY A;  2A69 F;  2MW8 A;  2QM3 A;  4OAZ A;  4YRV A;  3HOX J;  5HOO A;  4A3F J;  4KIS A;  1HW2 A;  3ZMD A;  2LMD A;  2NVX J;  4PJM A;  3T0Y A;  5C44 J;  2ZFW A;  2D1V A;  1OYI A;  3IH2 A;  3GFJ A;  1JTX A;  3FM3 A;  3NRV A;  1R5H A;  5HDN A;  1OYW A;  3I4M J;  1EV7 A;  3OYJ A;  3DV8 A;  2ZSI B;  3OYG A;  5FMP A;  4GYI A;  2YS9 A;  2ECC A;  1D0X A;  2I10 A;  4IJA A;  2R7T A;  5ED4 A;  2ME6 A;  1BR1 A;  1T0F A;  4QLC U;  3U21 A;  3SWH A;  1ZLK A;  1O7L A;  3S32 A;  4CDG A;  3FXO A;  1J0R A;  4HV6 A;  2UXI A;  1HW1 A;  4YEL A;  2UXU A;  2KIS A;  1VTN C;  4P55 A;  1V5G A;  2M8E A;  2UUZ A;  1YG2 A;  4DYC A;  2UV1 A;  3HJE A;  5E17 F;  5IOY A;  3OYI A;  3HOU J;  4GYG A;  3S3N A;  2P6T A;  3OIO A;  1U2W A;  2HTS A;  1WJA A;  2HYG D;  2F4O B;  2XPU A;  1J9I A;  3GME A;  1J09 A;  1R5G A;  1SD7 A;  3CMY A;  2FXA A;  2L5Q A;  2BHY A;  3JRE A;  1D8J A;  3ABT A;  2KIF A;  3HHH A;  4BL0 B;  2QCO A;  3LSH A;  3Q0V A;  1IUY A;  4ZDL A;  5LEK A;  1PYV A;  2DQL A;  3ZQG A;  4U7D A;  2LKS A;  4S04 A;  5GPC A;  2X6Y A;  1R49 A;  3C2G A;  3PNT A;  2WUI A;  2VQL A;  2WA0 A;  2WY8 Q;  1OCO H;  2OQG A;  3OYA A;  1Z0X A;  2DTR A;  3DBH B;  1BJZ A;  1ETO A;  3SZG A;  1ETV A;  2K85 A;  1TP4 A;  5D1R A;  5LGT A;  4X0G A;  3CCM I;  3Q9S A;  3TW6 A;  1J7K A;  4V2G A;  3PO2 J;  2RV8 A;  3I9V 2;  1PDN C;  4DVY P;  1G3Y A;  3AG3 H;  4WXH A;  1WGX A;  1HXD A;  3I58 A;  3HGG A;  3GZI A;  3HZJ A;  3I54 A;  2DFF A;  2HR3 A;  4H0E A;  1X1B A;  3AG1 H;  2FSW A;  3M8E A;  3FZV A;  1WH5 A;  4DIQ A;  5FKK A;  3UKG A;  4GXO A;  2HOE A;  5D4R A;  5FJ8 J;  3MKW B;  1WH7 A;  5HS9 A;  4ZTJ A;  1KQ8 A;  2MLK A;  4BUP A;  1O7F A;  2Z3Y A;  3KZY A;  1G3S A;  4AVP A;  2HWV A;  2JZY A;  1RIO H;  2V9P A;  5CJ9 A;  3IKV A;  3NAR A;  2LP0 A;  4I7H A;  4XR6 A;  1ZQ3 P;  1LFB A;  3GZ5 A;  1TT0 A;  1JGS A;  5JI6 A;  2ISY A;  3E0J B;  3CQZ J;  2HXI A;  3D5R C;  4FCY A;  1Y56 A;  2EBI A;  2ME0 A;  4BKX A;  4Y3O A;  5B1A H;  4PFO A;  4JK1 X;  3BP8 A;  1XCB A;  4L18 B;  3TDZ C;  1WRJ A;  1LFP A;  1ZR2 A;  4ZH4 F;  4AF5 A;  1H9T A;  3CRJ A;  2R5Y B;  3K69 A;  1KYZ A;  5TGT A;  2KDO A;  2GFN A;  2M87 A;  4AWX B;  4P5O A;  2R5Y A;  3S1R J;  1REP C;  1ZK8 A;  2M7A A;  2ZOZ A;  4MQV A;  5DDG A;  5J1Y A;  3ZQL A;  3WTV C;  3MQ0 A;  2R4G A;  3FXL A;  2VQG A;  1KU2 A;  2VXZ A;  4NUB A;  2Y69 H;  2ECB A;  1TL8 A;  3DBL B;  1MBG A;  1JI8 A;  4UNO A;  3BG5 A;  2G7U A;  4HEA 2;  2CFX A;  4C30 A;  1VQ5 I;  4ZYH A;  1Z67 A;  1J75 A;  5BS6 A;  2JMW A;  4CCN A;  3OYE A;  2EA2 A;  2K9L A;  4U0V A;  4MTD A;  2Z2S B;  4KNY A;  3GTK J;  1VND A;  3RPU A;  3DLL F;  5M5W J;  1UST A;  1Y1V J;  4M9X A;  5HLI A;  4C2T A;  2LD5 A;  4KMF A;  5D18 A;  3PIO F;  2VJ4 A;  4GFK A;  3FK7 A;  3AKZ A;  2H6B A;  2VL8 A;  4ANJ A;  2YU9 J;  3S93 A;  2JPC A;  4LIU A;  2Q8K A;  5EEH A;  3E6C C;  3IL2 A;  4KFC A;  4XM3 A;  2JRM A;  1W36 C;  4KYW A;  3CDL A;  5IT9 Z;  2LSO A;  2ZCN A;  4Q4Z F;  1NTC A;  2R7V A;  3TOB A;  4BHB A;  2O5R A;  2A07 F;  3C2H A;  2PJP A;  2Y31 A;  3MMY B;  4EVI A;  4ME9 A;  1ETK A;  5J1R A;  4AIJ A;  5FLX Z;  1IV6 A;  1XMA A;  4A3K J;  2ZY9 A;  3DF8 A;  1R1U A;  2IBD A;  5FRN A;  2LVS A;  1YW8 A;  2ID6 A;  3JAM K;  2HPI A;  3ZQC A;  1RUO A;  2DK5 A;  4JL3 A;  3WTZ A;  5CYV A;  4E7I A;  2RQP A;  2CV0 A;  4C2M A;  2EFQ A;  2DLL A;  3ZQQ A;  4Z2Y A;  1IRG A;  3NPI A;  4ZJZ A;  1E3P A;  4CSW A;  1TC3 C;  4S0H B;  3L2C A;  2V6C A;  1QQI A;  3HTI A;  1RRJ A;  2HXO A;  3WG9 A;  1FPQ A;  2Q0O A;  3A4C A;  4E7Z A;  3BG3 A;  5LBQ A;  4A0Z A;  1H89 C;  2E5Z A;  4RA2 A;  4RS8 A;  4CIC A;  1EJ9 A;  1ETQ A;  2HI3 A;  3ZMS A;  1AOY A;  3HE0 A;  4UDS A;  2L7Z A;  1FSH A;  1J5Y A;  2Y9Y A;  2YUS A;  3A1Y A;  1ZHF A;  2UXX A;  4G6T B;  3LAP A;  4JNN A;  4KJZ A;  1FBU A;  2LY9 A;  4YII A;  1ZKG A;  2O7O A;  3FXR A;  5LFA A;  3W2V A;  2GBY A;  5FFX A;  1T6S A;  2XPV A;  5B5E C;  3ZQF A;  2MFZ A;  5C3E J;  4E7J A;  5IYB J;  2A68 F;  2XHK A;  3CCV I;  3K4B A;  4A3I J;  3VTI A;  3K4K A;  2PMH A;  4OU0 A;  1O3R A;  4ZDP A;  2PBX A;  1K83 J;  1W1W E;  4FIS A;  5EYR A;  1UHS A;  5H6Q A;  5ILS A;  1HKS A;  2ZCW A;  3FXQ A;  3F9K A;  2E1M B;  1Q1V A;  1BI3 A;  5AQC A;  1NG7 A;  2O3F A;  3TO9 A;  2QSH X;  3F1B A;  2VBW A;  4RLQ A;  3MFK A;  4J19 A;  3HSR A;  4II2 A;  4RAG A;  2W84 A;  3HG9 A;  4HV5 A;  2DO7 A;  3GF2 A;  4PJ0 C;  1BIA A;  3FHN A;  2VI6 A;  4RAF A;  3O8H A;  3BJ6 A;  4BU2 A;  4N0B A;  1A6Q A;  1EKE A;  1K78 B;  1TQP A;  3KIO A;  1TLH B;  2RAE A;  3WG7 H;  4XKC A;  4I09 A;  3E1S A;  5FLM J;  2G7S A;  2VOO A;  3HTA A;  1K78 A;  2CMP A;  4HX8 A;  1SEU A;  2IA1 A;  3V6G A;  4CGR A;  3GVA A;  4NB5 A;  4I0A A;  4HNV A;  3C1D A;  3F8B A;  4C3H J;  1VQN I;  3JAM Z;  2KZG A;  3CJD A;  3FF5 A;  5HNF A;  1J2X A;  4KIF A;  3HOY J;  1JKP C;  2B1E A;  2EQR A;  4O6J A;  5JLX A;  4M3B A;  4UVC A;  5D6E A;  4NHJ A;  2GEN A;  2E36 A;  3FXJ A;  2WTE A;  3FX3 A;  3PUB A;  2GA2 A;  3PL8 A;  1FYL A;  1LVK A;  3LA3 A;  1ODD A;  3H0D A;  3R60 A;  2FBQ A;  4E70 A;  2WV1 A;  2EIJ H;  1HOM A;  1WSU A;  3DEU A;  1SAU A;  4MFE A;  4ICH A;  3KP7 A;  3CC7 I;  4HW0 A;  1IN7 A;  2ZJ2 A;  3H9G A;  4U9L A;  3PQK A;  1XG1 A;  3VYR B;  5K5R A;  4G12 A;  4UUV A;  2VBX A;  3RH2 A;  2QZ8 A;  2Y9Z A;  4RGX A;  3JRH A;  2VPL A;  3M7G A;  3O60 A;  1JJ6 C;  3BQZ A;  1H0M A;  3HRS A;  4DZJ A;  1R23 A;  3HUG B;  1OPC A;  3G1O A;  2Y0S N;  2HGC A;  5E3N A;  1WHU A;  4LB5 A;  1YX5 A;  5IYD J;  3HUG A;  5K1Y A;  3LWF A;  5ICE A;  2CSO A;  4HQM A;  4HZF A;  2VPR A;  2JUG A;  1MKM A;  2RC4 A;  4HNT A;  1FOK A;  3K70 C;  1QBJ A;  2STW A;  4BY1 J;  3TDU C;  2XRN A;  3BT9 A;  1GVJ A;  2A6T A;  2DMU A;  1OJL A;  4KIT B;  4A12 A;  4KN7 X;  2HDC A;  1ACI A;  3QKX A;  3CUQ B;  2E1N A;  5BNG A;  3VVX A;  1B9N A;  3ZMV A;  3T1B A;  3G71 I;  4EJU A;  2VT2 A;  3CUQ A;  2VKD A;  1QZE A;  1AWC A;  1TWF J;  5KCM A;  4EV0 A;  1XGM A;  5K7F A;  3WTX C;  1HF0 A;  2QA4 I;  2KMU A;  5A2Q K;  3ON2 A;  4DZP A;  1P2F A;  1FT9 A;  5BPI A;  2WV0 A;  4A3M J;  1YW7 A;  2KKO A;  2F07 A;  2W7N A;  3SJM A;  2K5C A;  1KQ9 A;  5GP9 A;  3NS4 A;  3F22 A;  2VQC A;  1P4X A;  2XUB A;  1KON A;  2QKL B;  3I5U A;  4DYR A;  3KEQ A;  3R0J A;  2KT0 A;  5J6X A;  4NBQ A;  3ZN1 A;  2BHZ A;  3DPJ A;  2ZXW H;  4UY8 I;  2LKX A;  4A0X A;  5E18 F;  3LFU A;  3P9I A;  4MEY F;  4A69 C;  5M3M J;  4HDV A;  3RI4 A;  1X4P A;  2GIZ A;  3LA7 A;  3EUA A;  4ZYE A;  1LUJ B;  3OYM A;  3CC2 I;  2O03 A;  3BHQ A;  5KHD A;  3S2W A;  4IOC F;  3I4N J;  1ZH5 A;  2LKP A;  3I3L A;  1MMG A;  4A3B J;  3GW2 A;  1SAN A;  4UB8 C;  1ZG1 A;  1S29 A;  2KRC A;  3QPL A;  2IS1 A;  1XDS A;  2LBF B;  4NDL A;  2L7M P;  1F1Z A;  2R0Q C;  2ESN A;  2K3F A;  2L9N A;  4PK4 A;  3CF2 A;  4IRH A;  5DUI A;  4A0Y A;  5JFR A;  4BYY A;  5EG0 B;  2LBF A;  3LOC A;  2XKP A;  2P5V A;  1FTZ A;  4EAT A;  2WAQ A;  2R93 J;  4HKU A;  3TOA A;  1Z91 A;  2O8X A;  3COL A;  5EG0 A;  1Y6I A;  4Y33 A;  3LWJ A;  2NVQ J;  3BTI A;  3V7S A;  3GTJ J;  1J59 A;  1X3U A;  4ABZ A;  3HL2 A;  3EYY A;  3M8J A;  2X85 A;  2E60 A;  1LDD A;  3DPT A;  4MO7 A;  2B0L A;  1TWH J;  3IWF A;  1HQC A;  2XSJ C;  4MFD A;  3S1Q J;  2RQQ A;  2P7C B;  2EB7 A;  5K5O A;  1WI9 A;  1R22 A;  4G7Z F;  3DBR B;  4RB2 C;  3I71 A;  3WTU C;  3SHF A;  3X2Q H;  3IH3 A;  2QWW A;  3FBI B;  4NEL A;  2QWT A;  1IDZ A;  4HPQ A;  2DFE A;  2RNJ A;  4MQ9 F;  3GTO J;  5FGL A;  5LD2 C;  4FX4 A;  1YJW I;  3Q0W A;  3B6C A;  5A2Q Z;  3CZ6 A;  1R5I D;  3LNQ A;  5C4Y A;  2DYS H;  2IGK A;  2K86 A;  3CLQ A;  5H6R A;  3ZCO A;  2CRG A;  3COA C;  2Z16 A;  2ZJR F;  3J7A O;  2EIN H;  4IHX A;  2QYO A;  4XLE A;  5AIQ A;  1R71 A;  2X6O A;  3KE2 A;  4Y52 J;  3CCE I;  3SEQ A;  1LDK B;  1QGP A;  5CVI A;  1GV5 A;  4CCK A;  3JRI A;  1G6N A;  1IW7 F;  3FDY A;  3V7C A;  1FOW A;  3FWE A;  3QWL A;  4FAS D;  4HRI A;  4BAY A;  2YVH A;  2LTP A;  4XN3 A;  3HTS B;  1YRN B;  1I1S A;  3ABL H;  5HOD A;  2W4S A;  3A02 A;  3HSF A;  2DYR H;  4YZE A;  3WU1 B;  1GV2 A;  2DT7 B;  3V8L A;  2DBB A;  1GVD A;  5LHH A;  2Z1D A;  1YRN A;  3ERE D;  4N4O B;  2EZH A;  1WQ2 A;  2NAZ A;  4HF0 A;  1X3Z B;  2FOW A;  3RPU D;  2HOS A;  4B43 A;  3BTL A;  1UG0 A;  3QOP A;  2E2I J;  3IUO A;  2Y2Z A;  2CQ7 A;  3IHU A;  2VOD A;  1FWZ A;  4UXN A;  2JA6 J;  3RTR A;  3TL4 X;  3PUF A;  4CGZ A;  2OCC H;  3J80 K;  3L2W A;  4G9Y A;  1IO2 A;  1DGR M;  2M3A A;  3VW2 A;  3OY9 A;  4A3D J;  1IRZ A;  1FJL A;  2IS6 A;  2W25 A;  2ZCX A;  3K4J A;  2CH0 A;  2KIQ A;  3G3Z A;  3R6S A;  2X6X A;  3EDP A;  1Z3X A;  3RQ4 A;  1UAA A;  4D7M A;  4NNJ A;  5LEJ A;  3BR0 A;  3RKW A;  4V19 K;  1WWX A;  3S5R A;  2X1D A;  2OTJ I;  4M3F A;  2F48 A;  2L02 A;  4AVZ A;  3RJP A;  4EGZ A;  4A3E J;  2HTJ A;  2LFB A;  1D1A A;  2LF8 A;  2Y48 A;  1Y0U A;  4I98 B;  1ON1 A;  4LK0 F;  1S9H A;  1XS9 A;  3CP8 A;  2BY1 A;  1PP8 F;  2QUF A;  5DUK A;  2AS5 F;  3QYE A;  3PO3 J;  5M3F J;  3RKX A;  4L0Z B;  4XKV A;  3FIS A;  4D9J A;  1ITY A;  5CVV A;  2LLK A;  5BOX A;  1TWC J;  2V26 A;  1GHC A;  1BW6 A;  1ZGJ A;  2FBH A;  1B6A A;  1S5L C;  4BJT A;  4BQN A;  3O6B B;  5FRO A;  4EQQ A;  1RES A;  2HQ5 A;  2OA4 A;  2P5K A;  3KEO A;  1GDT A;  4LLG F;  2E2H J;  4NQW B;  3AL0 C;  1X1D A;  1LEA A;  4ENJ A;  4GCL A;  2PBI A;  4XRS G;  2GXB A;  2CUJ A;  2VJI A;  4S05 A;  4AC0 A;  5F27 A;  4DYQ A;  3OL4 A;  4NQW A;  5E3O A;  2L9S A;  2F2E A;  2UZK A;  2E19 A;  1SVL A;  2X51 A;  2ZXH A;  2G7G A;  1Q1H A;  4L9V A;  2J5O A;  5JHF A;  3HC7 A;  4BQQ A;  4LOC A;  4ENK A;  3P9K A;  1VQ6 I;  3Q5F A;  5GTH C;  2F5C A;  3T6N A;  2BW3 B;  1FZP B;  2NVY J;  4ESF A;  2UXH A;  4EJO A;  3DXJ F;  2BW3 A;  3K2A A;  4ON0 A;  1MJ9 A;  1BN5 A;  2ICW G;  2IS2 A;  3J80 Z;  2XVC A;  3DU6 A;  2F4I A;  3VYU B;  4OMY A;  3K10 A;  3BDD A;  4Y15 A;  1OMI A;  2KFD A;  2X4H A;  3AQT A;  4KT5 C;  1SD6 A;  2IGO A;  1P4A A;  2P8T A;  3BJO A;  3JCU C;  4L0Y B;  4RM3 A;  4N4N B;  1G3T A;  1XN7 A;  3HPG A;  4UVA A;  5E79 C;  4C2M J;  2K3P A;  5FHP A;  4LMY A;  3OL3 A;  1IDY A;  4HLX A;  1DU6 A;  4E7S A;  1K6O A;  1JXS A;  4OOI A;  2V79 A;  3ZMU A;  2QSF X;  4F91 B;  2PX9 A;  3CO7 C;  2JN6 A;  3DTI A;  3O2P E;  3PSI A;  2IXS A;  2PQ8 A;  2IVM A;  2ZCM A;  4BHP A;  2MBF A;  3ANG A;  4KIB A;  3TBI A;  2LF7 A;  3Q0U A;  2ZNY A;  2LRE A;  3MEX A;  1WVR A;  3UNG C;  1ON2 A;  1SMY F;  3AAF A;  4PJJ A;  2HU9 A;  4KA4 A;  3MZH A;  3S1M J;  3KEY A;  3LSK A;  4I76 A;  2A5Y B;  1TNS A;  2F4M B;  1ZAR A;  2FUG 2;  2QQB A;  5JR3 A;  4D1Q A;  4XSZ F;  3A01 B;  2LY1 A;  4FE7 A;  1JUS A;  1U6G A;  4GDF A;  3NWT A;  3EUP A;  3KP5 A;  2V1D A;  3A01 A;  1U5T C;  5DM7 F;  1HLV A;  4PJL A;  1KU9 A;  3JRC A;  3EUH A;  1T56 A;  1N77 A;  2FQ3 A;  3G7R A;  5D5V B;  2QQA A;  1F9N A;  2R92 J;  3CME I;  2QEX I;  2WAF A;  1YLF A;  1AKH B;  2XKO A;  1DP3 A;  4CYC B;  3FK6 A;  2H94 A;  1K61 A;  2W57 A;  3DP7 A;  4U88 A;  4DOZ A;  4M71 A;  1AKH A;  2K4B A;  5EEG A;  1S7O A;  2VQH A;  3H36 A;  4CYC A;  3PFI A;  4E7L A;  3ON4 A;  2I5U A;  5D6F A;  2H27 A;  3BQY A;  2K4J A;  4JYK A;  5IP7 J;  4OIO F;  1VQ7 I;  3L09 A;  3TP0 A;  3V4G A;  1B59 A;  2ZSH B;  3FXU A;  4ZYA A;  3J81 K;  1D5V A;  2DN0 A;  1R00 A;  3KKC A;  4QIW N;  2H6C A;  3T8T A;  3F23 A;  2IRF G;  2MH2 A;  3OOU A;  4CCM A;  3VW1 A;  4XL9 A;  4L5J A;  2QQ8 A;  3TW7 A;  3OYD A;  4DQ2 A;  4HAM A;  4XRS A;  4OD4 A;  3BG7 A;  4HBL A;  4Y13 A;  2G0E A;  5ICF A;  5L3C A;  9ANT A;  2XIG A;  1T39 A;  2FE3 A;  2M45 A;  1BM9 A;  4FQG A;  5FKN A;  3GTG J;  4L5E A;  1CQT A;  1IG7 A;  3KX2 A;  3H5R A;  3WHB A;  3WTY C;  3BOQ A;  3IP4 B;  1PP7 U;  1YIO A;  4LB6 B;  3KKD A;  1FMW A;  4CCO A;  1JJ8 C;  2R7U A;  3S15 J;  1FOX A;  2G7L A;  3BR2 A;  4JP0 A;  5FLV A;  3C18 A;  2DW4 A;  3MNL A;  1TQI A;  4XLA A;  3OR2 C;  2OC6 A;  2W24 A;  3JSP A;  4CA0 A;  1V54 H;  5E3L A;  1VI0 A;  3LFK A;  1PUF B;  4EEF G;  3FMR A;  4JX4 A;  1DUX C;  4ETS A;  2L9R A;  4D5F A;  1WKM A;  1MDM B;  3KPH A;  4EJW A;  4LIT A;  1PUF A;  1DQU A;  2QKM B;  1AHD P;  4A3L J;  3CP2 A;  4A6D A;  2ELH A;  1RC9 A;  2R7O A;  2QBY B;  1MDM A;  5F1R A;  1IJW C;  3NNR A;  2ID3 A;  3F8N A;  4I02 A;  5HLH A;  1NK3 P;  5GAG J;  2OI8 A;  5BQT A;  1ONV A;  1SC7 A;  2PMZ A;  4YFX F;  2QBY A;  3NI7 A;  4RLF A;  2A6H F;  2CG4 A;  2HZD A;  1GXQ A;  4UV9 A;  3ML6 A;  4BDY A;  3H35 A;  3H3Z A;  1UMQ A;  2DG7 A;  1B8I B;  1X3W B;  2BXY A;  2DMP A;  4U7B A;  3BZK A;  5LRS A;  1IUF A;  2BZT A;  3V8K A;  5KAF C;  1IRX A;  1B8I A;  1OYY A;  2EIM H;  3E6B A;  4RB3 C;  3D1N I;  4NC7 A;  2NS8 A;  3VUQ A;  4QSH A;  1QVU A;  1YYV A;  1WI3 A;  1O4X A;  3OS1 A;  4OD5 A;  2WAQ N;  2XAU A;  2HDW A;  3J7Z I;  3J81 Z;  2NS0 A;  5EEA A;  2NNY A;  3S3M A;  5K5Q A;  1TW2 A;  1S3J A;  2FRH A;  1P7J A;  3ABM H;  4IEJ A;  2OF7 A;  2W82 A;  4J00 A;  1A6I A;  3CO6 C;  1ZG5 A;  1EA3 A;  1OCZ H;  4ENM A;  4HST A;  2FBI A;  2LG4 A;  3RZD J;  4X1E A;  3MWM A;  3NAU A;  2ZME B;  3CDH A;  1LNW A;  3WOD F;  3L2Q A;  1BC7 C;  3CCJ I;  1UEL B;  4IPA A;  3QYB A;  4MEX F;  5HSZ A;  2M4K A;  4FHT A;  1T0F C;  2MAB A;  4WF2 A;  1LVA A;  2NOG A;  3B6A A;  5HBU A;  1UFM A;  5B1B H;  2FF4 A;  3HKZ N;  1WCM J;  4YFK F;  2ACJ A;  5GAH J;  5FO5 A;  3OYH A;  2KQR A;  5LGN A;  4ZC3 A;  3ISP A;  2OCE A;  1BOB A;  2XDN A;  4LJZ F;  5J8C A;  1FBQ A;  3QYF A;  4EMS A;  2JQ7 A;  2QSG X;  3H92 A;  3I53 A;  4L9T A;  5E1Z B;  4E4H A;  1W4M A;  2Y0M A;  1F5T A;  3EUH C;  4J01 A;  2CQX A;  1LJ9 A;  2JSP A;  4XLH A;  5KK1 A;  2L54 A;  1YJ9 I;  5L3B A;  1E0E A;  1UI5 A;  3KP2 A;  2EV6 A;  2HKU A;  1R1T A;  2YPR A;  2OUM A;  3E5X A;  4MNU A;  4BHC A;  1VQP I;  5HDK A;  3ZGK A;  1QNT A;  2Z99 A;  1ZLJ A;  2BY2 A;  1HW5 A;  1JHH A;  2HZT A;  2OD5 A;  2GZW A;  3M1C A;  3KYD B;  2EWN A;  4ZYD A;  2XAH A;  2KIM A;  1D0Z A;  4HNU A;  4MLO A;  4G8X A;  1ZG3 A;  2OTL I;  1FTT A;  3D0S A;  1VQK I;  3SFI A;  1SVM A;  1N78 A;  1BOA A;  1XMK A;  5E1W A;  4HF2 A;  1BI2 A;  1I6X A;  2IT0 A;  3PNY A;  4XRM A;  3I4P A;  2P5L C;  2TRT A;  3WGH A;  4M6Y A;  2K9N A;  2CGP A;  2O6G E;  2ZOY A;  3RKY A;  3QOD A;  2KLO A;  4AC6 A;  4A6E A;  1ZYR F;  1S72 I;  1I5Z A;  3HRU A;  2DXI A;  1M1E B;  2PN6 A;  3A03 A;  2JA2 A;  2V6E A;  5HAW A;  2F5D A;  1I1G A;  1Y39 A;  4I01 A;  4KIC A;  4PUS A;  4IO9 F;  2E7X A;  3ONQ A;  3GTM J;  3E6D A;  2DI3 A;  1N25 A;  1F4K A;  4LG3 A;  3PSF A;  3BRO A;  1FNN A;  3MCZ A;  5CVJ A;  2L4A A;  2B63 J;  2HKX A;  4BDZ A;  1A04 A;  1QZY A;  3GYH X;  2Q2E B;  1KU7 A;  3ZQI A;  4M3D A;  3WTS C;  3SDG A;  3ZPL A;  3SYT A;  4BS9 A;  5FKM A;  2EIK H;  2Q2E A;  2VKE A;  1GXP A;  1A31 A;  2VC1 A;  2EH3 A;  1ZRF A;  4LLN A;  2ZFU A;  4B4C A;  1X4O A;  1OFC X;  2R7F A;  3MKL A;  1KU3 A;  2EZI A;  1GT0 C;  2A6E F;  5AIP A;  1FBS A;  3VSL A;  2M4G A;  1Z05 A;  2QEN A;  3EGQ A;  3S3O A;  3ECO A;  3QRF F;  4I99 C;  2VJ5 A;  4AD9 A;  1G4D A;  2L7F P;  3JR9 A;  2M34 A;  4F92 B;  5ICG A;  1LQ1 A;  2R7Z J;  3RIR A;  3T8R A;  3GFM A;  2DA5 A;  1IF1 A;  2VIX A;  1OLT A;  2F5F A;  2Y75 A;  1MJA A;  2OAZ A;  5DTD A;  4IQJ A;  5ILU A;  2VLA A;  1BI1 A;  3IRR A;  3TP3 A;  4PSW A;  4B47 A;  1A36 A;  5DCM B;  2IW5 A;  4XQF A;  2STT A;  2E2J J;  5LRR A;  4IKF A;  1HA8 A;  3JSJ A;  3KP3 A;  1T98 A;  2M8G X;  2CQK A;  5DCM A;  5J4Y A;  1HKT A;  1Z1D A;  1I3Q J;  1G59 A;  4QPO A;  4EJV A;  1B72 B;  2F6C A;  1IC8 A;  3OWT A;  4RM2 A;  5D5X B;  1IXS B;  4M6X A;  1DPU A;  1OR7 A;  3FMQ A;  3RYR A;  1B72 A;  2AQF A;  2IAI A;  3Q9V A;  3FM5 A;  5H9T A;  2NNN A;  2BY3 A;  2ELK A;  4CYD A;  2QVO A;  4N9H A;  4I2O A;  5IP9 J;  5J47 A;  4G94 A;  1VQ8 I;  2BY0 A;  5FKL A;  3EQL F;  3L00 A;  1BIB A;  1G2H A;  2IPQ X;  3E3V A;  3ZXS A;  2E71 A;  2K9S A;  4BH9 A;  2NP5 A;  4QPQ A;  5ICC A;  3SXY A;  5IPA A;  3CLO A;  2O7T A;  3D5L A;  3SDB A;  1Z6T A;  4PJN A;  5TRD A;  1DPR A;  2DA6 A;  2OPT A;  3OSG A;  2EFN A;  2DA3 A;  4CCJ A;  3OYL A;  4FE4 A;  1BC8 C;  1U9O A;  3DPU A;  1YS7 A;  2ZXJ A;  3BZ6 A;  3KLN A;  4HA8 A;  1RR8 C;  4LD5 A;  2DOE A;  1SFK A;  4XKB A;  3K1N A;  4KIG A;  2M9H A;  5LHG A;  2JUC A;  1YFH A;  2WB1 A;  4CZC A;  3IV5 A;  2PFV A;  3W6J B;  3RYP A;  1R7J A;  5E8G A;  3CJR B;  1OQY A;  3WTT C;  4IHY A;  1YTY A;  4Q48 A;  2L2O A;  4MK6 A;  3E7L A;  1O3Q A;  3LSP A;  2NOJ B;  2KDZ A;  3C7J A;  5FKO A;  5TJJ A;  4Z6Y A;  4XLN F;  1YHQ I;  2WC2 A;  4DBQ A;  2ZC2 A;  3CJN A;  2HVS A;  3RSN A;  1ZN2 A;  4JKZ A;  2GXG A;  2EJR A;  1QPM A;  2VKV A;  1YO5 C;  3FRQ A;  2JPB A;  2V57 A;  4XOP A;  1SFO J;  4BE1 A;  3HB9 A;  1DU0 A;  1Z3Y A;  1B1B A;  1V5F A;  2V1X A;  4PGG A;  3ABK H;  3E5Q A;  3BCA A;  2YX7 A;  3QPH A;  4DJA A;  2CQQ A;  5DD4 A;  3OYB A;  1FIA A;  4E7K A;  2CYY A;  2NX4 A;  2XRO A;  3FIW A;  1BL0 A;  3HEF A;  3GFL A;  1MJB A;  3H0G J;  2CU7 A;  3O8G A;  2LH9 A;  2FNA A;  3F21 A;  2XGC A;  4B8X A;  1U3E M;  3CJT B;  3M07 A;  4A3G J;  4CZZ A;  2AHQ A;  2MLG A;  2COM A;  1IRF A;  2E34 A;  2X48 A;  4HF1 A;  2L3D A;  2HFH A;  3GLX A;  2D1H A;  5FB2 A;  1H8A C;  3L7W A;  1O3S A;  2V7F A;  1U9N A;  4XON A;  5F1J A;  1DP7 P;  2XAQ A;  2W1O A;  3BCB A;  3E5U A;  1WJF A;  3GXO A;  2BE5 F;  2HKO A;  1WFX A;  3LSJ A;  1KQ0 A;  3MAJ A;  3VDX A;  2E1M C;  2K02 A;  1QU3 A;  3PJR A;  4A2U A;  2A05 A;  3CJQ B;  2ZNZ A;  3O3K A;  2FJ1 A;  1MH4 A;  1K6Y A;  4WK8 F;  3KFW X;  1S6L A;  3GEZ A;  3KNW A;  3F0C A;  4JOM A;  1X2M A;  2LDU A;  1HSJ A;  1OIS A;  2FU4 A;  4G6D A;  4IXA A;  2MC3 A;  3I56 I;  4JX6 A;  3JRA A;  1VFC A;  2HPM A;  1BI0 A;  3HRT A;  1QO0 D;  2DTZ A;  4DGW B;  5JVT A;  2NXN B;  5KNL A;  3EET A;  2GXA A;  3A2K A;  2M0C A;  4N9I A;  3IUV A;  4YFN F;  3TQN A;  3MZY A;  1MNE A;  5ERI A;  2DJI A;  4ZZL A;  4NN1 A;  5HDG A;  4ASN A;  1TBX A;  2CW8 A;  5B66 C;  1RR7 A;  4ZDO A;  3K2Z A;  2UXN A;  2XPW A;  2ZJP F;  4BJ5 C;  5CVU A;  4R8H A;  4HSR A;  3VFZ A;  2RHA A;  3DTE A;  1QHH D;  2H1L A;  3H5N A;  2VE8 A;  3BTC A;  2VB6 A;  3HTJ A;  2KHM A;  2HQN A;  4GO1 A;  1X1A A;  3L2R A;  2HEO A;  1P4W A;  4C3I J;  2H8R A;  1D0Y A;  2AXL A;  1NH3 A;  1JHF A;  2BOL A;  2ZB9 A;  5J40 A;  1K4S A;  1BBY A;  3SZP A;  1R36 A;  1A35 A;  4Y17 A;  3KET A;  4UHT A;  2DFI A;  3CCU I;  1MSE C;  4OIR F;  2M1B A;  5M5X J;  4F55 A;  4X6A J;  2NVU B;  2MD5 A;  2FML A;  3I59 B;  4LG0 B;  2NRA C;  3DPL C;  1W7P D;  1I50 J;  2JTV A;  3DKW A;  4FTH A;  1MW7 A;  1SGM A;  2EK5 A;  3HBL A;  2XF5 A;  3I59 A;  4LG0 A;  1K4T A;  1ERD A;  4LLL A;  3SZT A;  5BMZ A;  3QU3 A;  1RKW A;  4II3 A;  5EGO B;  4OIP F;  3DWL E;  3BZC A;  2DK8 A;  3S8P A;  2H1K A;  1U5T B;  3F72 A;  1U0J A;  3IKT A;  4GFL A;  1X1P A;  1CF7 B;  2CV2 A;  3IAM 2;  3VW0 A;  2B7E A;  3GEU A;  4M72 A;  2BBY A;  3OIQ A;  1CF7 A;  3R61 A;  4I0B A;  4XLF A;  2R7R A;  2ESH A;  5EF6 A;  5IY5 H;  3CUQ C;  2MGQ A;  3DLA A;  4A93 J;  5IOZ A;  4M6V A;  2VAS A;  4IHT A;  1EH8 A;  2CO5 A;  2COB A;  2XDV A;  3KLO A;  4BY7 J;  4EM2 A;  1TZL A;  2E35 A;  1QA6 A;  3VVY A;  5LGU A;  5KVR A;  3BJB A;  1VQM I;  3K4L A;  1ETX A;  4B09 A;  2MD0 A;  3KP6 A;  5H20 A;  1VZ0 A;  3KCC A;  3BR6 A;  2DOF A;  4EM0 B;  2GA1 A;  1G3W A;  3J7A Y;  3VEP A;  5C4J J;  1YIJ I;  1JUM A;  3WGI A;  2EV0 A;  2XB0 X;  4RGU A;  4GGG A;  3JRG A;  5J3L A;  2UXO A;  1STZ A;  4XIC A;  4IRV A;  4XOR A;  3LL7 A;  4AU7 A;  4XBF A;  3OV8 A;  1UZC A;  2NVT J;  2MSY A;  2JSC A;  2C6Y A;  1IV8 A;  2FJI 1;  4XK4 A;  4HLY A;  2A61 A;  1QPI A;  1P6R A;  1R4N B;  3B73 A;  1K7A A;  1W5T A;  3B81 A;  3BG9 A;  4P96 A;  3S1N J;  2LNB A;  2L0K A;  2YR2 A;  3AG4 H;  3AQS A;  3VIB A;  3L9F A;  2CFO A;  1ETY A;  3R4K A;  2DA7 A;  4ACI A;  2W00 A;  2Y30 A;  3NRG A;  2CUE A;  2DDA A;  4G7O F;  5FGM A;  4KDP A;  2ELJ A;  2E1C A;  1ZGW A;  2J5P A;  4AID A;  3M1E A;  5GAE J;  1L3L A;  3Q3S A;  1EH7 A;  4B44 A;  1QHG A;  2MA3 A;  2K9M A;  3ZQH A;  3K9T A;  2XF7 A;  4HX7 A;  4RBO A;  2Q1Z B;  2DOD A;  5ILV A;  5DAJ A;  5JLW A;  1X2N A;  1LDJ A;  3ZOB A;  4EJT A;  4BBS J;  3KZ9 A;  1S8N A;  1R6R A;  5F64 A;  2BVL A;  3QP5 A;  3ANP A;  5GAD J;  2LRD A;  1APL C;  4WCG A;  4HX4 A;  4IL6 C;  2QTQ A;  4WX9 A;  3N97 A;  5CQE A;  1UHW A;  2Y0S A;  2ZBK A;  2L01 A;  2QOP A;  4IRI A;  2CV1 A;  1R58 A;  4XKW A;  4BQA A;  3S2D J;  2YVX A;  2PG4 A;  1OCT C;  2ZJQ F;  1OCR H;  1XMX A;  5HS8 A;  4IVN A;  4IHW A;  4Q5S F;  3CMA I;  4D0P A;  4B3A A;  3P7N A;  3RZO J;  2ZO4 A;  2D45 A;  2HYT A;  1F36 A;  3R0A A;  4CUG A;  3V7R A;  4FET A;  2XAG A;  3DQV C;  3VOK A;  4I6Z A;  2WGB A;  2H09 A;  1MIJ A;  5F0H A;  3OYN A;  4HDU A;  5DYM A;  1TWG J;  1T95 A;  5CW8 A;  4U9N A;  3H9J A;  3M8F A;  1E3H A;  3CUO A;  4BE0 A;  5EDN A;  2VN2 A;  3ESW B;  5CLS A;  1HC8 A;  2QKO A;  2G7H A;  3F3X A;  1H88 C;  3E6M A;  3H1C A;  4WXD A;  4IX7 A;  3GLL A;  4C2U A;  1MMA A;  1D3Y A;  5HLT A;  3G1L A;  2XGE A;  3HOT A;  2OER A;  3ASO H;  3HHG A;  5J4V A;  4HYE A;  4PGH A;  2EPF A;  3U2R A;  1Z7U A;  4C3J J;  2GLO A;  1MND A;  2W53 A;  3CCS I;  3IH4 A;  1MBJ A;  3BTJ A;  4FT8 A;  3EYI A;  1EF4 A;  3REO A;  1UCR A;  4GCK A;  1LKX A;  1SAX A;  3OYC A;  3LHQ A;  2BVM A;  2GOX B;  3DU5 A;  5DS9 A;  4G7H F;  4QWQ A;  3TGN A;  4ESB A;  4UUT A;  3PM1 A;  2PZ9 A;  5K58 A;  2JVH A;  3V42 A;  2DDB A;  3D5S C;  1LB2 A;  2X0L A;  3ZR8 X;  2RNG A;  4R79 A;  1E3O C;  2AXT C;  3IAS 2;  2HQA A;  3ZP5 A;  2DCE A;  1ORK A;  4RB0 A;  3I55 I;  4LK1 F;  3L2U A;  2KPM A;  3CMM A;  4A5M A;  2IEK A;  1HST A;  1ZAO A;  3CDI A;  1HBX G;  2Z5U A;  3CCY A;  2M5W A;  1USS A;  4U87 A;  4IHS A;  2P7V B;  3G56 A;  1WJ5 A;  3KZZ A;  3QAH A;  2MYS A;  1POG A;  1RNL A;  3BWG A;  5CVR A;  5F6F A;  4ZZD A;  3K1M A;  2PI0 A;  3VB2 A;  3F8C A;  4F93 B;  4BEH B;  3RPQ A;  1LFU P;  1T8I A;  4H4K C;  2DQR A;  5LHI A;  1OCC H;  2WB1 N;  3LA2 A;  4BEH A;  1ZGA A;  2RDP A;  4YIR X;  2VE9 A;  5EJC A;  6PAX A;  3P9T A;  4MXM A;  3QQA A;  2PEX A;  2A2F X;  4L9J A;  4ESJ A;  5IT9 K;  2E1O A;  2EFP A;  2GAU A;  1XGN A;  2XRL A;  2LYC A;  3QOE A;  3LSR A;  3SQN A;  3OMY A;  1V55 H;  5FLX K;  1XC5 A;  2FEZ A;  1IN6 A;  1IN8 A;  3U1D A;  1RUN A;  3BCG A;  4M3E A;  3ASN H;  4V2F A;  3C07 A;  5F0C A;  1TNT A;  3BRU A;  2M7B A;  3HSE A;  3M4O J;  1U8R A;  3BR5 A;  1YJN I;  5IYC J;  2JA5 J;  4AIH A;  2BEO A;  1FLI A;  4XMY A;  2GM4 A;  3GTP J;  1I3A A;  1H9G A;  2VJJ A;  3N05 A;  3L1P A;  4FX0 A;  2EA4 A;  1P92 A;  2EIL H;  2DMQ A;  4CCL A;  1W7P B;  2OV7 A;  2XF6 A;  4CXF A;  3KZI C;  4L9N A;  1JKQ C;  4XLC A;  1XX5 A;  1VQ9 I;  1X1C A;  1QRY A;  1W7P A;  1XCV A;  2DAO A;  2BYV E;  1VQ4 I;  2G9W A;  3LQQ A;  3W2A A;  1FOY A;  2LOO A;  2O61 A;  4AYB A;  1JE8 A;  3HOW J;  2VUM J;  2LR8 A;  3RD3 A;  4P9F A;  2HQR A;  2MH9 A;  4OMZ A;  4M9S A;  2VBY A;  2M2E A;  4Q47 A;  3ZQ7 A;  4M9Z A;  3VPR A;  1MBE A;  3W3C A;  5L3E A;  1U8B A;  2V9K A;  1S7E A;  1Y8Q B;  1K79 A;  5FRM A;  3CD6 I;  1SFU A;  1MBF A;  4RB1 A;  2FA5 A;  2ZME A;  1RET A;  1BR2 A;  5F04 A;  2AO9 A;  4F7Z A;  3QU6 A;  3G73 A;  1KYW A;  1KA8 A;  3S2H J;  5CPR B;  2FBK A;  4P9U A;  1SFX A;  3DEE A;  2EFW A;  2JK3 A;  3BPV A;  3F6V A;  2ETH A;  2NS7 A;  2O9L A;  4LGW A;  2N8G A;  1W5S A;  1D1C A;  1HKQ A;  4IQ4 A;  1Y8R B;  3GTL J;  3P5J A;  3BPX A;  2VBZ A;  3ABU A;  2JA7 J;  1TWA J;  4R1H A;  4DNC A;  1PJR A;  1UJ8 A;  4GRI A;  3FHZ A;  2M30 A;  3ROU A;  3GBG A;  1FC3 A;  4Y7N J;  2L9V A;  3FBN B;  4BNC A;  1FYM A;  1UHM A;  4WWC A;  2DA4 A;  4YG2 F;  3H5A A;  5EFY A;  2DFH A;  2HS5 A;  3OIP A;  4XN0 A;  1TW3 A;  1FX7 A;  2R7W A;  3L2V A;  2V1N A;  3K6G A;  3GZN B;  1IZ1 A;  3B02 A;  2MG4 A;  4U0Y A;  3U9G A;  3WTW C;  5CKT A;  5J1U A;  4A3J J;  4JQF A;  3HOZ J;  4IZZ A;  2FQ4 A;  1V4R A;  3W6K B;  1X58 A;  2HNH A;  2E5N A;  2YSR A;  1B9M A;  3MKZ A;  1R4M B;  4ENN A;  2XAJ A;  2HYF A;  1E2X A;  1V5E A;  4HQE A;  2O8K A;  2KJC A;  4XOT A;  5D5W B;  3JTG A;  2KJB A;  3KYL A;  1ZTR A;  1MH3 A;  1JTY A;  2EFO A;  2XV4 S;  3ULQ B;  2RVC A;  2GUH A;  1FEX A;  3HM5 A;  3BR3 A;  2X1E A;  4OAY A;  1XTA A;  3FKJ A;  3JTH A;  3U1K A;  3LSM A;  1HCR A;  4AIK A;  1HDD C;  2VKH A;  1WJE A;  2B3W A;  2KRH A;  3V78 A;  1MD0 A;  4BQO A;  2GQQ A;  4BJ6 C;  2BXZ A;  3NWS A;  2XAS A;  5GTI C;  5C4X J;  2H8W A;  1V3F A;  5DD8 A;  5L3F A;  1VF9 A;  4G6Q A;  4CO8 A;  2Z33 A;  2R7S A;  5IP6 A;  1WJC A;  4PDK A;  1ZRD A;  2R7D A;  2FD5 A;  4D5C A;  4KN4 X;  2DJN A;  1UI6 A;  4M74 A;  2OZ6 A;  4L5I A;  1ETW A;  3PFY A;  4K2E A;  3HOV J;  2DT6 A;  2QGU A;  3K0L A;  1WZ2 A;  1Z77 A;  1IXR C;  1TQM A;  4OWR B;  4A5N A;  3HIM A;  1NG6 A;  3BG6 A;  3TED A;  3V8J A;  1I39 A;  4BGD A;  5FFZ A;  2KIU A;  1BJA A;  1UG2 A;  3S16 J;  2IGN A;  3BR1 A;  2RAS A;  1BW5 A;  2QIB A;  1VQL I;  1YX3 A;  2XB5 A;  1AA7 A;  3VOX A;  3JRB A;  2I8D A;  1YQA A;  4IOA F;  3HIF A;  2ISZ A;  3I0T A;  3F6O A;  2OJE D;  3DFG A;  3QBM A;  3HXL A;  2E7W A;  5JVG F;  3K7A J;  3OS0 A;  3C2B A;  3K8P C;  3PAS A;  3QP6 A;  4BXU A;  4MTE A;  4A3C J;  5D4S A;  1YS6 A;  2CS3 A;  1T2K A;  1N75 A;  4GCT A;  3CF5 F;  2CWE A;  3F8M A;  3UR3 C;  4B48 A;  3FXM A;  3GFI A;  3PPB A;  2CW0 F;  1A5J A;  3MKY B;  2EZL A;  1RZ4 A;  3ZRG A;  1LEB A;  3HTU A;  1XSV A;  2WAD A;  3HOS A;  4YEJ A;  2R7Q A;  2A5W A;  5BPD A;  1X19 A;  3ZMT A;  3LJL A;  2ZME C;  2K27 A;  3KP4 A;  4W97 A;  5HVQ C;  2NYX A;  1S7A A;  4RMN A;  3JRD A;  2FOK A;  1DDN A;  2W48 A;  2VC0 A;  2RRE A;  1FY7 A;  3VYS B;  2YU3 A;  4WXC A;  5E8I A;  2R5Z B;  1WPK A;  3WE2 A;  1XB4 A;  4AM3 A;  5HS7 A;  4RGR A;  2JWT A;  2R5Z A;  1P7I A;  1QVT A;  3WU0 A;  1MBK A;  2CQN A;  2VT3 A;  1Z21 A;  1E17 A;  3CWR A;  3H3U A;  2OQR A;  2KL4 A;  1PVE A;  3ZN0 A;  3VYT B;  2K7L A;  4BXX J;  3E7Q A;  2JVG A;  2DT5 A;  1W0T A;  1W36 D;  1GLN A;  1ZEL A;  2IJL A;  4NC6 A;  3W6V A;  3VSK A;  3EPZ A;  1JKR C;  2R7X A;  1MNM C;  3RDI A;  2DU9 A;  4C9Y A;  3S14 J;  4F3Q A;  3CCQ I;  1UB9 A;  3A0B C;  4BBR J;  2DOA A;  4RDU A;  2CUF A;  3PNV A;  1T33 A;  2A3S A;  3KYC B;  4XNF A;  3SFZ A;  3WU2 C;  4HG2 A;  4JBA A;  4ZYG A;  5D19 A;  5D5U B;  2VON A;  1D1B A;  2IU5 A;  2DG8 A;  4IRG A;  3WGG A;  1MMD A;  1BA5 A;  1P9Q C;  1FSE A;  1B4A A;  2YX4 A;  3CTA A;  2FX0 A;  3RKQ A;  4OIQ F;  1F43 A;  5K7Z A;  1VQO I;  3T5X A;  3HDD A;  5IT3 A;  5D8L B;  1SMT A;  3OR1 C;  4RGS A;  2HVQ A;  4QTR A;  3GX4 X;  1Z6R A;  3M3Y J;  1R1V A;  1I6H J;  2X9D A;  2XAF A;  4YIF A;  1XGO A;  5CQG A;  3GWZ A;  2QLZ A;  3FKI J;  3CC4 I;  3TO6 A;  4F52 A;  1Z9C A;  2O0Y A;  1ZRC A;  4GCV A;  1IGN A;  1SFE A;  2L7K A;  4M3G A;  1IN4 A;  2DA2 A;  1QZZ A;  4CHU A;  1HDP A;  4P1W A;  1RI7 A;  2IA2 A;  3MVP A;  3VP5 A;  3H9Q A;  3E97 A;  3PIP F;  1O57 A;  5TIS C;  3BY6 A;  3AL0 B;  1XSX A;  1SVO A;  1ULY A;  3TO7 A;  5EZG A;  5EZH A;  3WE3 A;  3VVZ A;  3OSF A;  1ENH A;  3A0H C;  2R3S A;  5JHU A;  3NQO A;  4EM1 A;  4U0W A;  2PFB A;  2WAE A;  1OKR A;  1D8K A;  5B3S H;  2V1U A;  1FP1 D;  1XGS A;  3K1P A;  4HOB A;  4ITV A;  3QPS A;  3TMO A;  2G3B A;  2XC7 A;  2P6S A;  1OCP A;  2XSD C;  1I27 A;  5E20 A;  1Y0N A;  3IC7 A;  3ECH A;  2XGX A;  4W1U A;  2GIV A;  2L4M A;  2K40 A;  1BR4 A;  2JA8 J;  2RKH A;  3VWB A;  3G6E I;  3MN2 A;  5L3G A;  2QF7 A;  2GWR A;  4ZTF A;  3DEW A;  4OIN F;  3BJA A;  2HOA A;  3DTK A;  2UWM A;  1CGP A;  1D5Y A;  3FXK A;  3G2B A;  3OYK A;  4BE2 A;  2CJJ A;  4UVB A;  3PQJ A;  4XID A;  1R9T J;  2FMY A;  2X1C A;  2DMT A;  2EZK A;  1ZRE A;  3G1M A;  4XLP F;  1G8X A;  2YVE A;  3K4M A;  3JW4 A;  3BC8 A;  1T38 A;  3ZMZ A;  3M9A A;  1L0O C;  3HKZ A;  3JRF A;  3LAJ A;  1FP2 A;  2JJ7 A;  2HDD A;  3HGY A;  2PMZ N;  5FD6 A;  4IHV A;  3HTH A;  3SEZ A;  4EGY A;  1OR7 C;  4LIV A;  2OBP A;  4E7H A;  4KMU X;  5M5Y J;  3OOP A;  5H2F C;  4O3M A;  1MBH A;  4NC8 A;  4UB6 C;  1PUE E;  4XRF A;  5DV5 A;  3DKY A;  4MHG A;  2KP6 A;  3WHC A;  3VOD A;  3HYI A;  2HVR A;  2F5E A;  5EGO A;  3TKY A;  2DPD A;  1TTY A;  3S17 J;  2REK A;  4PCQ A;  3OYF A;  1IXC A;  4MIM A;  1U5T A;  2DMN A;  2QQ9 A;  1GUU A;  1Z7L A;  4DW6 A;  3N4M A;  3VOE A;  2PJR B;  2M0M A;  4CH7 A;  3HRM A;  2CUZ A;  3AFH A;  1JUP A;  5FD5 A;  1FMV A;  1MSF C;  3IWZ A;  4AYB N;  5KAI C;  1WJD A;  2RGV A;  4E6K G;  1C0W A;  2PJR A;  2LY2 A;  1U78 A;  4BXF A;  2D6Y A;  1MZB A;  2LK2 A;  3C3W A;  2P0W A;  3AG2 H;  3MZ8 A;  2W85 A;  1IAW A;  4B3X A;  4JX5 A;  4M73 A;  4PZJ A;  1MGT A;  2KRF A;  2D2W A;  1NHA A;  3LQR A;  2TCT A;  5DM6 F;  4AUX A;  2DA1 A;  3K70 D;  1W5C C;  3LST A;  4BAC A;  3K4C A;  4DBR A;  3CCL I;  2OU2 A;  3GUD A;  3LMM A;  3MD2 A;  4RAZ A;  1W0U A;  2IA0 A;  1XPX A; 
#chains in the Genus database with same CATH homology
 4PXI A;  4A3M J;  2D5V A;  1JKO C;  2F07 A;  1AU7 A;  2NP3 A;  3SJM A;  4XRM A;  5GP9 A;  5F08 A;  2TRT A;  1RKT A;  2IEK A;  2K9N A;  2ZOY A;  4DYR A;  2KT0 A;  3CCY A;  4AC6 A;  4D7N A;  3DPJ A;  3G56 A;  2LKX A;  1POG A;  3A03 A;  4A69 C;  5M3M J;  3RQI A;  5HAW A;  1LFU P;  2P81 A;  3BHQ A;  3I4N J;  2WB1 N;  3GTM J;  3NXC A;  4A3B J;  2HOT A;  1SAN A;  1LE8 B;  3P9T A;  4MXM A;  2HYJ A;  2B63 J;  4B1R A;  3QQA A;  3QPL A;  1Y1W J;  4UUS B;  4NDL A;  2E1O A;  2L7M P;  2R0Q C;  1LE8 A;  3ZQI A;  4GFB A;  4M3D A;  3SDG A;  2XRL A;  5FKM A;  3LSR A;  2Q24 A;  3GTQ J;  5CXI A;  3BNI A;  5EG0 B;  2VKE A;  3LOC A;  4UUS A;  1ZR4 A;  1FTZ A;  1XC5 A;  2UXP A;  4L62 A;  2R93 J;  3BCG A;  4HKU A;  1FIP A;  4M3E A;  4V2F A;  3COL A;  2EH3 A;  5EG0 A;  1JGG A;  3C07 A;  5F0C A;  4B4C A;  3BRU A;  3H3V K;  3LWJ A;  2NVQ J;  1OFC X;  3M4O J;  3BTI A;  3GTJ J;  3BR5 A;  5IYC J;  4ABZ A;  2JA5 J;  3MKL A;  5GPA A;  2EZI A;  1GT0 C;  1JT6 A;  4MO7 A;  4KWA A;  3EGQ A;  2GM4 A;  3GTP J;  1TWH J;  2K9Q A;  5E3M A;  4MFD A;  3S1Q J;  1JT0 A;  3L1P A;  2L7F P;  3JR9 A;  2M34 A;  2DMQ A;  2R7Z J;  2DA5 A;  5CXG A;  5K7H A;  5F0F A;  1JKQ C;  3DCF A;  5DTD A;  1RPW A;  3IH3 A;  2XGD A;  1QRY A;  4NEL A;  2QWT A;  3TP3 A;  1IDZ A;  3GTO J;  5FGL A;  2E2J J;  1NK2 P;  3LSG A;  3Q0W A;  3JSJ A;  3B6C A;  2MW8 A;  3LNQ A;  5C4Y A;  2M8G X;  3HOW J;  2VUM J;  2LR8 A;  3HOX J;  3RD3 A;  1I3Q J;  1B72 B;  2CRG A;  1IC8 A;  4A3F J;  2M2E A;  2NVX J;  3VPR A;  5C44 J;  4IHX A;  1MBE A;  1U8B A;  2X6O A;  3IH2 A;  1B72 A;  4Y52 J;  1JTX A;  2IAI A;  1S7E A;  5H9T A;  3JRI A;  3I4M J;  1GV5 A;  2ELK A;  1MBF A;  1RET A;  5IP9 J;  5FMP A;  2YS9 A;  2ECC A;  2I10 A;  5F04 A;  5FKL A;  2AO9 A;  2YVH A;  2LTP A;  2ME6 A;  1G2H A;  2K9S A;  1YRN B;  2NP5 A;  5IPA A;  3S2H J;  5HOD A;  3A02 A;  4YZE A;  1GV2 A;  2O7T A;  1GVD A;  1YRN A;  2UXI A;  2EZH A;  2JK3 A;  2UXU A;  2DA6 A;  2OPT A;  2NS7 A;  3OSG A;  2DA3 A;  2O9L A;  2HOS A;  2N8G A;  3BTL A;  4FE4 A;  1U9O A;  4DYC A;  2E2I J;  2Y2Z A;  5IOY A;  3GTL J;  3HOU J;  2JA6 J;  2JA7 J;  3OIO A;  1TWA J;  2M9H A;  2XPU A;  3VW2 A;  3GBG A;  3IV5 A;  4A3D J;  4Y7N J;  1IRZ A;  1FJL A;  3CMY A;  2ZCX A;  3JRE A;  2DA4 A;  4IHY A;  4MK6 A;  5EFY A;  2QCO A;  3E7L A;  3Q0V A;  3LSP A;  2KDZ A;  5FKO A;  4D7M A;  3BR0 A;  3ZQG A;  5GPC A;  2MG4 A;  3S5R A;  4M3F A;  4JKZ A;  2WUI A;  4A3E J;  5J1U A;  4A3J J;  2VKV A;  2LFB A;  3HOZ J;  3FRQ A;  2FQ4 A;  2V57 A;  1SFO J;  1Z0X A;  1BJZ A;  1ETO A;  1X58 A;  3HB9 A;  1ETV A;  1DU0 A;  5D1R A;  2O8K A;  1XS9 A;  3TW6 A;  2CQQ A;  1FIA A;  3PO2 J;  4V2G A;  2NX4 A;  1ZTR A;  3PO3 J;  1MH3 A;  5M3F J;  3FIW A;  1BL0 A;  1JTY A;  3FIS A;  1WGX A;  1ITY A;  3HEF A;  2LLK A;  2CU7 A;  3H0G J;  3HGG A;  1TWC J;  3O8G A;  2GUH A;  3GZI A;  1FEX A;  1BW6 A;  2XGC A;  3BR3 A;  3HM5 A;  1WH5 A;  5FKK A;  4A3G J;  2AHQ A;  3UKG A;  2X48 A;  1HCR A;  5FJ8 J;  1RES A;  1WH7 A;  2HQ5 A;  1HDD C;  1H8A C;  1GDT A;  1U9N A;  5F1J A;  3V78 A;  2E2H J;  4GCL A;  5C4X J;  4XRS G;  3LSJ A;  3NAR A;  4AC0 A;  5F27 A;  2LP0 A;  4DYQ A;  1VF9 A;  5E3O A;  2FJ1 A;  1ZQ3 P;  1LFB A;  1MH4 A;  5IP6 A;  2E19 A;  2HXI A;  3CQZ J;  3F0C A;  3KNW A;  1X2M A;  2FD5 A;  4FCY A;  4D5C A;  2G7G A;  2DJN A;  2EBI A;  2ME0 A;  1VFC A;  3JRA A;  4JX6 A;  4LOC A;  4BKX A;  1UI6 A;  3T6N A;  1ETW A;  3HOV J;  2DTZ A;  1Z77 A;  2NVY J;  3HIM A;  2UXH A;  2M0C A;  1ZR2 A;  4AF5 A;  3IUV A;  3K2A A;  3TED A;  2R5Y B;  4NN1 A;  1UG2 A;  3S16 J;  1RR7 A;  3BR1 A;  2GFN A;  2RAS A;  3S1R J;  1BW5 A;  2XPW A;  2R5Y A;  2QIB A;  1ZK8 A;  3AQT A;  2XB5 A;  2ZOZ A;  2RHA A;  5J1Y A;  3ZQL A;  3JRB A;  3VOX A;  4C2M J;  3BTC A;  3HTJ A;  5FHP A;  1IDY A;  4C3I J;  2ECB A;  2H8R A;  1DU6 A;  1MBG A;  3QBM A;  2ZB9 A;  3BG5 A;  3K7A J;  3C2B A;  3PAS A;  2JN6 A;  4A3C J;  4GCT A;  2ZCM A;  2JMW A;  3ANG A;  3GTK J;  3Q0U A;  3PPB A;  1A5J A;  1VND A;  5M5W J;  1MSE C;  1Y1V J;  2EZL A;  5M5X J;  3S1M J;  4X6A J;  2LD5 A;  5D18 A;  4I76 A;  1I50 J;  4GFK A;  3FK7 A;  3LJL A;  4FTH A;  1SGM A;  3HBL A;  4W97 A;  2YU9 J;  3A01 B;  1RKW A;  5EGO B;  4FE7 A;  1JUS A;  3JRD A;  3CDL A;  3EUP A;  2W48 A;  3A01 A;  2H1K A;  2ZCN A;  2R5Z B;  1HLV A;  1NTC A;  1WPK A;  3JRC A;  4GFL A;  1T56 A;  3G7R A;  2JWT A;  2Y31 A;  2R5Z A;  4ME9 A;  1ETK A;  1P7I A;  1QVT A;  5J1R A;  2R92 J;  1MBK A;  3GEU A;  1IV6 A;  4A3K J;  1AKH B;  2IBD A;  4CYC B;  3CWR A;  2LVS A;  2ID6 A;  3FK6 A;  1K61 A;  3E7Q A;  4BXX J;  5EF6 A;  1W0T A;  1AKH A;  4CYC A;  3ZQC A;  2MGQ A;  3W6V A;  1JKR C;  5IOZ A;  4A93 J;  1MNM C;  4M6V A;  3ON4 A;  4JL3 A;  3BQY A;  3S14 J;  2COB A;  4JYK A;  5IP7 J;  4BBR J;  4BY7 J;  3NPI A;  3TP0 A;  4RDU A;  1TC3 C;  4S0H B;  2CUF A;  3VVY A;  2DN0 A;  3KKC A;  1T33 A;  4QIW N;  3BJB A;  3HTI A;  2HXO A;  1ETX A;  5D19 A;  3OOU A;  3BG3 A;  3VW1 A;  1H89 C;  3BR6 A;  2IU5 A;  2DG8 A;  3TW7 A;  1ETQ A;  2HI3 A;  4XRS A;  3HE0 A;  4UDS A;  1BA5 A;  5C4J J;  2G0E A;  9ANT A;  2FX0 A;  3RKQ A;  1JUM A;  2L7Z A;  5K7Z A;  2XB0 X;  5FKN A;  1F43 A;  3GTG J;  2Y9Y A;  2YUS A;  3HDD A;  4L5E A;  4QTR A;  3JRG A;  4JNN A;  1CQT A;  1IG7 A;  3M3Y J;  5J3L A;  2UXO A;  1I6H J;  2X9D A;  2LY9 A;  4XIC A;  3WHB A;  1ZKG A;  2O7O A;  3FKI J;  3KKD A;  2GBY A;  2XPV A;  2NVT J;  3ZQF A;  1JJ8 C;  2MSY A;  5C3E J;  3S15 J;  2G7L A;  3BR2 A;  4JP0 A;  5IYB J;  1IGN A;  4XK4 A;  5FLV A;  1QPI A;  3MNL A;  4M3G A;  2DA2 A;  4A3I J;  1HDP A;  3B81 A;  3BG9 A;  3S1N J;  2PBX A;  1K83 J;  3MVP A;  3VP5 A;  5EYR A;  2L0K A;  4FIS A;  1UHS A;  3AQS A;  3VIB A;  5EZG A;  5EZH A;  5E3L A;  1VI0 A;  1PUF B;  1ETY A;  1Q1V A;  4EEF G;  5AQC A;  2DA7 A;  3VVZ A;  4ACI A;  4JX4 A;  3OSF A;  1ENH A;  2Y30 A;  2L9R A;  4D5F A;  3F1B A;  3NRG A;  2CUE A;  1PUF A;  1AHD P;  4A3L J;  4J19 A;  1ZGW A;  3QPS A;  3NNR A;  2G3B A;  3Q3S A;  1IJW C;  2ID3 A;  1OCP A;  2XSD C;  1NK3 P;  2VI6 A;  2OI8 A;  3NI7 A;  3O8H A;  3ZQH A;  4W1U A;  4RBO A;  2K40 A;  2JA8 J;  5DAJ A;  5JLW A;  1X2N A;  3MN2 A;  3ZOB A;  4BBS J;  2RAE A;  2QF7 A;  3KZ9 A;  3DEW A;  1UMQ A;  2HOA A;  5FLM J;  2G7S A;  2DG7 A;  1D5Y A;  3ANP A;  1B8I B;  3HTA A;  2DMP A;  2CJJ A;  1APL C;  1IUF A;  4XID A;  1R9T J;  2DMT A;  2EZK A;  3V6G A;  4CGR A;  3G1M A;  4HNV A;  4C3H J;  1B8I A;  2QTQ A;  2YVE A;  3CJD A;  3D1N I;  2NS8 A;  3HOY J;  1JKP C;  2QOP A;  4QSH A;  2EQR A;  1QVU A;  5JLX A;  4M3B A;  3VUQ A;  2GEN A;  3S2D J;  3JRF A;  1WI3 A;  1OCT C;  1O4X A;  4IHW A;  2FBQ A;  2JJ7 A;  2WAQ N;  2WV1 A;  2HDD A;  1HOM A;  4B3A A;  5EEA A;  3HGY A;  2PMZ N;  3RZO J;  4MFE A;  4ICH A;  2HYT A;  4IHV A;  1F36 A;  3HTH A;  1P7J A;  3VOK A;  1XG1 A;  4IEJ A;  2OF7 A;  4I6Z A;  1A6I A;  4G12 A;  2WGB A;  5M5Y J;  5F0H A;  3RZD J;  3RH2 A;  1TWG J;  4X1E A;  1MBH A;  3NAU A;  5CW8 A;  2Y9Z A;  3VW0 A;  3JRH A;  5EDN A;  3O60 A;  2QKO A;  1JJ6 C;  3BQZ A;  5HSZ A;  1H88 C;  4DZJ A;  3WHC A;  3G1O A;  2NOG A;  2Y0S N;  3B6A A;  5EGO A;  5E3N A;  5HBU A;  3G1L A;  2XGE A;  3S17 J;  2REK A;  5IYD J;  3HKZ N;  1WCM J;  2OER A;  4MIM A;  2DMN A;  2VPR A;  1GUU A;  4DW6 A;  4C3J J;  2GLO A;  2W53 A;  3IH4 A;  4BY1 J;  1MBJ A;  2XDN A;  3BT9 A;  1JUP A;  1MSF C;  3BTJ A;  4AYB N;  2DMU A;  1OJL A;  1EF4 A;  3QKX A;  4GCK A;  1U78 A;  5BNG A;  3VVX A;  2D6Y A;  3LHQ A;  2CQX A;  2LK2 A;  1UI5 A;  2HKU A;  4JX5 A;  1TWF J;  5DS9 A;  4UUT A;  3PM1 A;  5K7F A;  1HF0 A;  2PZ9 A;  2TCT A;  5K58 A;  4AUX A;  2DA1 A;  3ON2 A;  1FTT A;  4MLO A;  4DZP A;  1E3O C;  3SFI A;  3CRJ A;  1W0U A;  1ORK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...