1JTYA

Crystal structure of the multidrug binding transcriptional regulator qacr bound to ethidium
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
186
structure length
186
Chain Sequence
b'NLKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKKEQIKAKTNREKFYLYNELSLTTEYYYPLQNAIIEFYTEYYKTNSINEKMNKLENKYIDAYHVIFKEGNLNGEWSINDVNAVSKIAANAVNGIVTFTHEQNINERIKLMNKFSQIFLNGLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOTHETICAL TRANSCRIPTIONAL REGULATOR IN QACA 5'REGION
publication title Structural mechanisms of QacR induction and multidrug recognition.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription
total genus 71
structure length 186
sequence length 186
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2001-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08360 TetR_C_5 QacR-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1jtyA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 1jtyA02
4V2GA 3Q0VA 1FIPA 1JJ8C 5F0FA 3QPSA 4D7MA 2E2JJ 4MFEA 3HOVJ 3RZOJ 1WH5A 4GFKA 3M3YJ 1DU0A 1B8IA 4L5EA 3GTJJ 1SGMA 2M34A 1VFCA 3WHBA 3M4OJ 2L7MP 2X6OA 3BRUA 2EZHA 4MFDA 9ANTA 3TW6A 1EF4A 5CXGA 1E3OC 3L1PA 5J1RA 3BG5A 5M3MJ 3FK7A 4QIWN 3GTOJ 5F08A 5IYDJ 5E3LA 2UXOA 1H88C 3GTLJ 2NP5A 5J3LA 3BTIA 5E3OA 1MBJA 3JSJA 5D18A 1RKWA 2EZKA 2G7SA 3HEFA 2GENA 2L9RA 3E7LA 3S1RJ 4UUSA 2TCTA 1ETYA 3JRHA 5K7HA 4MO7A 4M3BA 3G56A 1JTXA 5M5YJ 2R0QC 4S0HB 2LTPA 5K58A 2G7GA 4JL3A 3H0GJ 3A01A 2E2IJ 2QF7A 1LFUP 2CUFA 2Q24A 1AKHA 1MH4A 3FRQA 2JA7J 1LE8A 1VNDA 2R5YA 1MBHA 3HOUJ 4A3CJ 4AYBN 3T6NA 3VOKA 5C4JJ 4FE7A 2HQ5A 1ZQ3P 2EQRA 1P7JA 2COBA 3LJLA 2LVSA 4I76A 4DW6A 1B8IB 5FKOA 5FLVA 5EZGA 2DA6A 2MSYA 3HIMA 1Q1VA 2G3BA 2K40A 5FJ8J 4A3KJ 1QPIA 1Z77A 2KDZA 2WB1N 3MN2A 4XIDA 2HOTA 3ANGA 1T33A 2E1OA 1XS9A 3JRAA 1SANA 3CDLA 3VW0A 4AF5A 2OI8A 1MBGA 2DN0A 3CWRA 3JREA 4AUXA 2R5ZA 5M3FJ 1OFCX 3S15J 1IG7A 3HDDA 4ME9A 4MXMA 1PUFA 4G12A 3MVPA 3KNWA 2QKOA 3EGQA 2ID3A 3TP0A 1LFBA 5EGOB 1UI5A 2HI3A 1ETWA 4XK4A 3A01B 2CU7A 3G7RA 4JNNA 2JA6J 2UXUA 2IU5A 4CGRA 1U9OA 1AKHB 1A5JA 3DEWA 2FX0A 3FISA 2ZOZA 3VPRA 2L7ZA 1IRZA 2R7ZJ 2R5YB 1HOMA 4RDUA 2K9SA 2ZCXA 1BJZA 3KKDA 3LHQA 4FE4A 3FK6A 2QOPA 2LLKA 4LOCA 1X2MA 3VVYA 1FTTA 1POGA 3BQZA 4A69C 4D5CA 4C2MJ 5FLMJ 4JP0A 5FKKA 2HOSA 1NK3P 4IEJA 2ELKA 1BW5A 5F1JA 5EF6A 4FCYA 4A3LJ 1VI0A 2DMUA 3HBLA 1XC5A 2QWTA 1SFOJ 5FHPA 3RH2A 1Y1VJ 3BNIA 2ZCNA 3DCFA 3NRGA 2EZLA 1R9TJ 3MNLA 1ZKGA 2UXPA 2M0CA 2FD5A 1JUSA 4D5FA 3HE0A 2QTQA 3GTMJ 3BTLA 1TWFJ 1BA5A 4JX6A 1IUFA 3H3VK 4HKUA 4FTHA 2D5VA 3PPBA 4XRSG 1WH7A 3O8GA 2NVYJ 1W0UA 3Q0WA 2PBXA 5JLWA 2DA4A 2DTZA 1Z0XA 1GV2A 1WPKA 5IYCJ 2GUHA 3AQSA 3DPJA 2GM4A 2O8KA 2LY9A 1RESA 3SDGA 1IV6A 2O9LA 2TRTA 2H1KA 2NP3A 3Q0UA 5EFYA 1RPWA 1JKRC 4A3DJ 2CRGA 3RZDJ 1ETXA 2JWTA 4UUTA 1ETKA 5BNGA 3ON2A 1JUMA 2DA1A 4M3EA 1U78A 5FMPA 2M8GX 4CYCA 3S1QJ 1FJLA 2VKEA 3ZQLA 4BY1J 3KKCA 3BCGA 3BR6A 2VKVA 2YU9J 2ID6A 5EDNA 2NX4A 1GT0C 4A3IJ 3IV5A 2GFNA 3QQAA 2MG4A 2L7FP 3S2HJ 1ENHA 1MSEC 1I3QJ 2W53A 1U9NA 4GCLA 2ZCMA 4PXIA 5IP6A 2QIBA 2EBIA 1ZGWA 1IJWC 1K61A 1B72A 2G7LA 1FIAA 4MK6A 5IYBJ 5C4YA 2XB0X 3LOCA 2EH3A 2JMWA 2L0KA 1HF0A 5GP9A 3HGYA 5EG0A 2M2EA 2R93J 3NXCA 1X2NA 2O7TA 2AO9A 2HOAA 1FEXA 1RKTA 3S1MJ 4IHYA 4C3HJ 4D7NA 3JR9A 1S7EA 2JK3A 4M3GA 3JRGA 3HOZJ 3BR1A 4I6ZA 3A02A 5F27A 5C4XJ 3UKGA 2DA2A 2Y31A 3BR5A 1ZTRA 1UMQA 1TWHJ 1F43A 2XGDA 2K9NA 5DS9A 2KT0A 4CYCB 1JKPC 2JA5J 2XPVA 3TW7A 3LSGA 2LP0A 1QVTA 2REKA 2JN6A 4ICHA 2HXIA 5EYRA 3TEDA 2Y30A 4XICA 1APLC 5AQCA 1RR7A 3A03A 2MW8A 2WGBA 1I50J 5IOYA 5K7ZA 3IH3A 4UUSB 3LWJA 2IBDA 3FKIJ 4GFLA 1JUPA 5CXIA 1OJLA 3VIBA 2DA3A 2K9QA 2GLOA 2HYJA 2VI6A 3NPIA 3IH2A 4B3AA 1GDTA 5HAWA 1YRNA 2AHQA 3BG9A 3SJMA 3JRCA 1MNMC 1TWGJ 4B4CA 2XGCA 2HKUA 2NVXJ 2NOGA 2I10A 2ZOYA 3BJBA 3CJDA 2M9HA 4AC6A 3OSGA 1U8BA 2XPWA 1LE8B 2CJJA 3GTKJ 3JRDA 2MGQA 3ZQGA 4GFBA 3PO2J 4J19A 1GUUA 1MBEA 2E19A 2HDDA 4W1UA 3HKZN 4DYQA 3AQTA 2N8GA 4A3MJ 1FTZA 4YZEA 3Q3SA 1JT0A 2ZB9A 3NAUA 2PZ9A 3K7AJ 3ZOBA 5H9TA 5DTDA 2RHAA 4XRMA 1QVUA 2DA7A 2LK2A 2DG8A 4L62A 4BBSJ 2HYTA 3HTIA 3E7QA 1TWCJ 2OPTA 3S2DJ 2R5ZB 2RASA 2XDNA 2UXHA 1HDDC 2YUSA 4UDSA 1PUFB 5D1RA 2B63J 3ON4A 2LKXA 5HSZA 1NK2P 4GCTA 1YRNB 2XRLA 2ECCA 4M3FA 5M5WJ 1JGGA 2QCOA 4X1EA 3D1NI 2DG7A 1DU6A 1GVDA 3S14J 3B6CA 4ACIA 3CCYA 3MKLA 2ME6A 2WUIA 1MBKA 1BW6A 3S5RA 2IEKA 5E3MA 5IPAA 2PMZN 4JYKA 3COLA 3BR3A 5JLXA 1UHSA 4Y52J 4B1RA 4NDLA 2DA5A 2HXOA 3OIOA 3HM5A 4A93J 1T56A 1HLVA 3OSFA 2OERA 1CQTA 1WGXA 2CUEA 2FQ4A 4QSHA 4C3JJ 3I4NJ 3LSJA 5F0HA 2P81A 4DZPA 4JX5A 1I6HJ 3CQZJ 3O60A 4NELA 4A3GJ 1ETQA 1MBFA 2V57A 1ZR2A 4A3BJ 3ZQCA 2DMQA 3EUPA 1ITYA 2Y9YA 3BHQA 5EEAA 2FJ1A 3S16J 4IHXA 3I4MJ 5FGLA 3GTPJ 4BXXJ 2DMTA 3BR2A 4RBOA 3F0CA 3JRIA 3HOXJ 3BG3A 4AC0A 2LD5A 2NS8A 1ZR4A 1ETOA 4Y7NJ 1JKOC 2XB5A 3LNQA 1JT6A 2OF7A 5J1YA 2JJ7A 2Y0SN 2LFBA 5J1UA 1HCRA 3CRJA 5C3EJ 3QKXA 2O7OA 5CW8A 3ZQIA 1IGNA 3G1MA 2G0EA 3VVZA 4A3FJ 1MSFC 1A6IA 4IHVA 3W6VA 5D19A 5C44J 3HTJA 2Y2ZA 3CMYA 1JKQC 3QBMA 3SFIA 2R92J 5F0CA 5EGOA 3FIWA 1Y1WJ 2W48A 2VUMJ 3ANPA 2CQXA 1AU7A 1X58A 5GPCA 5IP9J 3F1BA 3RD3A 3BTJA 3C2BA 1XG1A 3PM1A 3RQIA 4IHWA 3LSPA 4EEFG 3GBGA 1G2HA 2ECBA 4MLOA 2NS7A 2H8RA 3G1LA 5F04A 2XSDC 1WCMJ 3RKQA 3TP3A 1TWAJ 1B72B 1ETVA 1D5YA 4X6AJ 1UG2A 3OOUA 3B81A 1TC3C 2DJNA 2JA8J 3K2AA 1H8AC 3VP5A 1GV5A 2NVTJ 5EG0B 1AHDP 2E2HJ 5EZHA 4DYCA 2DMNA 4JX4A 5DAJA 1HDPA 1OCTC 5IOZA 1OCPA 1NTCA 4BY7J 3V6GA 3VOXA 2EZIA 2YS9A 1IC8A 1O4XA 5FKMA 3HTHA 4A3JJ 2WV1A 3PASA 3HGGA 4QTRA 3BR0A 2DMPA 2IAIA 2NVQJ 2UXIA 1QRYA 3JRBA 5IP7J 4M6VA 3HOWJ 3WHCA 3KZ9A 4MIMA 5FKNA 1WI3A 1H89C 5HODA 2ME0A 1IDZA 3PO3J 3NNRA 2X48A 4V2FA 3NI7A 4NN1A 4DZJA 5E3NA 2CQQA 1RETA 2FBQA 4M3DA 5HBUA 4DYRA 3S1NJ 2XGEA 5GPAA 3V78A 1JJ6C 2F07A 1BL0A 2XPUA 3JRFA 3C07A 4C3IJ 2Y9ZA 4JKZA 3HTAA 3GTGJ 2LR8A 1IDYA 2GBYA 1MH3A 2VPRA 5M5XJ 4XRSA 3BTCA 3QPLA 4HNVA 3GTQJ 1JTYA 3G1OA 3ZQFA 3BT9A 4A3EJ 1ZK8A 3O8HA 3S17J 2YVEA 1VF9A 3IUVA 4FISA 3P9TA 1F36A 1K83J 2WAQN 4KWAA 3LSRA 3GZIA 4GCKA 5FKLA 3B6AA 1UI6A 3BQYA 3VUQA 1ORKA 1P7IA 3VW1A 5K7FA 3HB9A 2YVHA 2RAEA 3HOYJ 1W0TA 3GEUA 3NARA 4ABZA 3ZQHA 4BKXA 3VW2A 3IH4A 4BBRJ 2D6YA 2X9DA 3VVXA 4W97A
chains in the Genus database with same CATH superfamily
5IT9K 3Q0VA 2GXGA 1RUOA 4NUBA 4HNTA 3GO5A 3RJPA 4MFEA 3HOVJ 2CFOA 2EJRA 3KP6A 2M30A 2Z1DA 1USTA 3S3OA 3PL8A 2W82A 2NNYA 1MKMA 2D1VA 2L7MP 2X6OA 1VFCA 3M4OJ 1XPXA 3VSLA 5LEKA 2WY7Q 3UNGC 2FUG2 4P55A 1TL8A 4ZYEA 5JVTA 1VQNI 5CVIA 3DF8A 5M3MJ 1VQLI 5F08A 1WRJA 2NOJB 5E18F 5IYDJ 1H88C 5J3LA 2DODA 5E3OA 3JSJA 4HF0A 1N78A 3EQLF 4ESJA 2O5RA 3ZR8X 3JRHA 1BR2A 1JTXA 4WX9A 2HQNA 3G4SI 1J7KA 2FEZA 2Q1ZB 4U9NA 1D8KA 4LB5A 2UUZA 4JL3A 2WY8Q 3DKYA 3GXOA 3MCZA 2GXAA 2VXDA 2V9KA 4XOTA 4NQWA 1LFUP 4RB1A 4IZZA 1XD7A 1X1PA 3VOKA 4JOMA 5KNLA 1X4PA 5AIPA 5C4JJ 1J09A 2COBA 3JW4A 3LJLA 4KICA 1P4WA 4I76A 4OU0A 1B8IB 5FLVA 2DA6A 2CUZA 4IRIA 2MSYA 1F1ZA 3HIMA 2RQPA 5D4RA 1VQKI 4C2TA 4CA0A 2V1DA 4M74A 3WODF 5FJ8J 1BI1A 2H6CA 5HOOA 4AIJA 4RB0A 1XS9A 1E3PA 3AG1H 1YIOA 1SANA 2XRNA 3DP7A 4AF5A 5CJ9A 1BIBA 1ONVA 3OYCA 5HLIA 3DPUA 1K7AA 4CCNA 2R5ZA 4HDVA 4LJZF 3S15J 4PZJA 1IG7A 4MXMA 3VSKA 1Z9CA 1REPC 4R8HA 4UVCA 2L4MA 4BXUA 1PUFA 1SAUA 3QOPA 2VBXA 5EEGA 1FZPB 2L2OA 2WAEA 3AAFA 1LFBA 1D3YA 3PQJA 4XK4A 1W1WE 5D4SA 3JAMZ 2IGNA 2IU5A 4CGRA 1AKHB 1A5JA 3EUHC 4XNFA 4PSWA 2R5YB 1HOMA 5DCMA 2PMHA 3CUQA 4RDUA 3OYLA 4FX4A 3KKDA 4C9YA 1ULYA 4JQFA 2QOPA 5TGTA 1X2MA 5L3GA 1TW2A 1DP3A 4D5CA 4A69C 4RAYA 4WXCA 3SEZA 1IRXA 2BHZA 1P2FA 2IVMA 2V1UA 2CS3A 2VE8A 3E6DA 4IEJA 2QSFX 1V54H 3IAS2 5EF6A 1FSHA 2RDPA 2KJBA 5KHDA 5FHPA 3BNIA 2ZCNA 1MMSA 3AG2H 4DQ2A 1ZKGA 1ODDA 4S04A 2UXPA 2M0CA 1JUSA 4ESBA 5DD8A 2F4OB 2QTQA 4DGWB 2V7FA 3RQ4A 3GFIA 4UB6C 3CTAA 2NVYJ 2PBXA 1MZBA 3DPJA 5IYCJ 1Z0XA 1GV2A 2VKHA 4WXHA 1WWXA 1RESA 4F93B 2PN6A 2W85A 2TRTA 5B5EC 3GWZA 3OYNA 1RPWA 2VN2A 4UUTA 3ON2A 2A5YB 4G94A 4EM2A 2V9PA 5FB2A 3FMSA 1FJLA 1KA8A 2X85A 4BY1J 2BBYA 3BCGA 2O6GE 2YU9J 1B9MA 1K79A 2L7KA 3OIPA 2NX4A 2ZXHA 2CGPA 2Z16A 1VQ9I 5H6RA 4BDYA 2B9SA 2GFNA 5FLXK 2VJ4A 3S2HJ 3K9TA 1K4TA 3VYUB 4BUPA 2VJ5A 4GCLA 3J7AY 2QIBA 1ZGWA 3L7WA 5E1XA 5D8LB 3CMMA 4Z6YA 3MFKA 2P7VB 3V8KA 2UXNA 2EH3A 2JMWA 2WB1A 3GF2A 2IS2A 3HOTA 1Y39A 1O3QA 2R7FA 3J7AO 3OYKA 2DK8A 2DFHA 1UAAA 1FSEA 1YX3A 4G6QA 4RGRA 3N05A 2K27A 1BJAA 2DYRH 3R6SA 1WFXA 4J01A 1S29A 1YJ9I 1D1BA 2IRFG 3HOZJ 3OYHA 3OYEA 3BR1A 5F27A 1IV8A 3GFMA 1ZGAA 4HSTA 4I98B 5C4XJ 3IRQA 1S3JA 5FFXA 3AL0C 4PFPA 1YE9A 4E7ZA 5DS9A 4U0YA 2O0YA 4WK8F 1ZREA 2KLOA 2Q0OA 2B3WA 2XPVA 2FQ3A 4UUVA 2FNAA 3GUDA 4L9VA 4LLNA 1QU3A 2HPMA 2JN6A 3REOA 3M8FA 5EYRA 2Y30A 1XX5A 1XGOA 1Y6IA 1R00A 2HYGD 1APLC 3CCRI 2WA0A 2OC6A 3M07A 5DV5A 5GTIC 1Q1HA 3DXJF 1FT9A 5K7ZA 1JXSA 4BE0A 2CV2A 4KFCA 4XKCA 2IBDA 2DFEA 2LKPA 1QO0D 1OJLA 3GEZA 2GLOA 2K9QA 2ICWG 1GDTA 5HDNA 1H9GA 1BM9A 2V26A 5JI6A 4UV8A 1MNMC 4B4CA 3EUHA 2NOGA 2ZOYA 5B3SH 2CFXA 4A12A 5BPDA 3GTKJ 4Y17A 1R5HA 3KFWX 4GYGA 1Z1DA 1GUUA 2E19A 1R5GA 3HKZN 1MJAA 3OL4A 4KYWA 3PIOF 2HVQA 5B1AH 2O8XA 3Q3SA 2HVRA 3LA3A 3NWSA 3GCMA 3OMYA 4I02A 2PZ9A 2XAHA 3SZTA 2J5PA 3T8RA 1USSA 5J40A 2IGOA 1U2WA 1KU7A 1QPMA 5LEJA 4I09A 3WTWC 2LK2A 1YYVA 2DG8A 2HR3A 2F6CA 4XKVA 4E7SA 2HYTA 3ELKA 4ZYHA 3CJQB 4LG0B 1RNLA 3LWFA 2YUSA 4UDSA 5D1RA 3KP5A 3CC7I 2BY3A 3ZMDA 1N77A 1YRNB 2OJED 3K1PA 2ZJPF 4KA4A 2QCOA 2FXAA 1LVKA 2PEXA 3TDZC 3MKLA 3QP6A 2WUIA 2IEKA 3I64A 5E3MA 2R7RA 3FDYA 3BR3A 2DXIA 4XLPF 5FROA 3COLA 4Y52J 2LREA 3PUBA 1ZARA 2DA5A 4AU7A 5L3BA 3OIOA 4AIKA 1QNTA 4A6EA 4XQFA 2BV6A 2E34A 2QLZA 3FMRA 3K4LA 1JHFA 1G3SA 1WGXA 2A6TA 2CUEA 5D5XB 3WTXC 3HRUA 3WTTC 4JX5A 1YITI 5ERIA 3LQQA 1LKXA 1MBFA 4BJ5C 2WAFA 4P1WA 4CICA 2I8DA 2LSOA 4RM2A 1G3YA 2X1EA 3DPTA 4UV9A 3M9AA 1OQYA 1T0FC 4PCQA 3ZN1A 1ITYA 3DV8A 2K02A 5DM7F 1DDNA 5BS6A 4LFUA 5EEAA 4HX7A 4I99C 3K0LA 3S16J 3SEQA 4BHCA 2YPRA 2V1XA 3HOXJ 1VQOI 3BG3A 1NG7A 2LD5A 2PJRB 1ETOA 3ZQQA 1FOYA 4Y7NJ 3G71I 2IPQX 2JJ7A 1A6QA 3ISPA 4XBFA 1R4MB 2CUJA 3SHFA 1JE8A 3CRJA 4F91B 5C3EJ 2O7OA 1QHGA 4LK0F 2QYOA 1IRGA 1YTYA 2HFHA 3ZMSA 1G59A 1ZG3A 3HTSB 1SD4A 3PNYA 2EV6A 2P4WA 2R92J 2P5LC 1TQPA 2W48A 4IRVA 1KYWA 2Q2EA 3KX2A 3BCBA 5IP9J 3RD3A 4O5VA 2MH2A 1G2HA 2GWRA 2NS7A 2IS6A 3G1LA 2DOFA 3TO9A 3BLYA 2P6TA 4RMNA 1MJ9A 3K70D 5LBQA 5HS8A 2L3DA 4EM1A 1ETVA 2XAQA 4Y13A 4BJTA 4E6KG 3CCVI 3HTUA 2NVTJ 1AHDP 1TP4A 1D0XA 1BOAA 5EZHA 3T5XA 2X4HA 1OCTC 1D0ZA 3HUGB 1NTCA 1ON1A 2K4BA 3TQNA 5F1RA 4BY7J 3V6GA 2ZC2A 3LSHA 4I2OA 3FXJA 1O4XA 2NXNB 3CESA 4A3JJ 2WV1A 2X6YA 4BE1A 3PASA 5L3DA 3HGGA 3W3CA 4QTRA 4BH9A 1KU2A 3U1DA 1WJEA 4F3QA 2TDXA 2DMPA 3D5LA 2UXIA 1TQIA 1QRYA 1Y8QB 2YSRA 1FP2A 4MGRA 1M1EB 4OD4A 1WI3A 3H9GA 1SAXA 2XKPA 2COMA 3SDBA 4WCGA 2ME0A 2VQHA 2QQBA 3PO3J 3I53A 5CKTA 3LQRA 1R6RA 3CCQI 2X48A 5JHUA 1SEUA 5E3NA 4DBRA 2CQQA 3QYEA 1P9QC 3TGNA 3OS2A 1G4DA 1YI2I 2VLAA 2V4JC 3A0BC 1TNSA 2QKMB 3CJTB 5HVQC 3C07A 3I58A 2EIKH 1ZELA 2PX9A 4C3IJ 3TKYA 4JKZA 3H9JA 3GTGJ 3OYDA 1MH3A 2VPRA 3FXRA 2DCEA 2F5EA 3ZQFA 3E5UA 3KYCB 1R4NB 1O3RA 3O8HA 1VF9A 3C1DA 1F36A 1K83J 1YQAA 2HYFA 1IAWA 1XSVA 1NHAA 5TISC 3MD2A 4GCKA 4RLFA 3B6AA 1U5TB 3OYBA 1ORKA 2DDAA 3VW1A 1J5YA 5K7FA 1CF7A 2VONA 5IT9Z 2FE3A 1W36D 3S3NA 3GX4X 2BHYA 2CO5A 1W0TA 2AXTC 4ABZA 4DBQA 3QAHA 1XCBA 2OU2A 3VW2A 4BBRJ 1R71A 3WG7H 1WQ2A 1J2XA 3LFKA 4V2GA 4W97A 1T0FA 2F48A 4UXNA 1YOVB 3VVXA 4P9FA 2LF8A 1YIJI 5LFAA 1WH5A 1DU0A 4QPQA 1G6NA 3W2VA 1VQMI 3GTJJ 2JRMA 1SGMA 3WHBA 3BRUA 1D1CA 3K1NA 4XR6A 1SFUA 1J59A 1WJFA 9ANTA 1EF4A 2KZVA 1E3OC 3L1PA 4O6JA 4QIWN 2UXOA 1T39A 4BQAA 4AYBA 2VC1A 2NP5A 3SWHA 4HEA2 5D18A 1RKWA 4FETA 2QSGX 4ZDPA 2BW3A 4Q47A 2GENA 3F9KA 3S1RJ 1ETYA 2IS4A 5K7HA 5M5YJ 3BJOA 4IOAF 2LTPA 2E7XA 1VTNC 4CGZA 3FXMA 4C2MA 4PSXA 1Z3YA 1BOBA 3A01A 3K70C 2QF7A 1UHMA 2DU9A 2H1LA 3KP2A 4BDZA 4BQOA 4IX7A 4MQVA 1ZGJA 2DW4A 1XN7A 2W7NA 4IRHA 2JA7J 1MBHA 3HOUJ 1SMYF 3T6NA 2MC3A 4OOIA 2EV5A 2OTJI 1MD0A 3OOPA 5J4VA 5FKOA 1VQ5I 3H0DA 5EZGA 3T0YA 2BY0A 3G2BA 4GGGA 1J75A 3PSIA 5TJJA 1LB2A 4MTEA 1FMVA 2CQNA 2K40A 2W24A 3ERMA 4D9JA 2FBHA 3ECHA 1Z77A 3CZ6A 2WB1N 3V42A 3CDIA 4BHBA 2X0LA 3HJEA 4XIDA 2E1OA 2A5WA 3V7SA 3JRAA 1BBYA 2ESHA 3CDLA 1MBGA 2DN0A 1IZ1A 3CWRA 2LC2A 3C2GA 4AVZA 4CZZA 2PFVA 4ENNA 2VJIA 3ZQ7A 4ME9A 2A3SA 2BXYA 3U21A 4ESFA 1GXPA 2QKOA 4ZZLA 1Z67A 3K4CA 1FBUA 3EGQA 5F6FA 2X1DA 3FBNB 4XSXF 5EGOB 1UI5A 5GTHC 1ETWA 3HHHA 5D6EA 1OLTA 4JNNA 2MC4A 2B0LA 3KP4A 4EV0A 2AS5F 4P5OA 4KT6A 3DEWA 2F4IA 2FX0A 2VKDA 3FISA 4N4NB 3F22A 2WAQA 2XAUA 1IRZA 1RC9A 1YW8A 4UHTA 2M87A 1PP8F 1ZG1A 2QGUA 2K9SA 4II2A 1BJZA 2W25A 4HLXA 3ZP5A 3ERED 5CPRB 3FK6A 3O6BB 3QPTA 2E35A 1FTTA 1U5TC 2JTVA 2PBIA 2ZJRF 5FLMJ 2XHKA 4G6TB 3K6GA 5DDGA 3H1CA 1UJ8A 2HOSA 1GVJA 1NK3P 1G3TA 4HA8A 4YFXF 5F1JA 3HBLA 1XC5A 4BNCA 2CSOA 2V79A 4HV5A 3L09A 3DCFA 4Y15A 1R9TJ 1FBQA 2FD5A 3CP2A 1V5GA 2VBYA 1TWFJ 1BI0A 4PJNA 2LRDA 3J80Z 5L3CA 2D5VA 3KPHA 1FWZA 1YW9A 3SQNA 5JLWA 3N4MA 2DA4A 2GUHA 2RGVA 1WPKA 3MEXA 3ML6A 4BL0B 1U8RA 3AQSA 3CCEI 2LY9A 3GZNB 3LA7A 4OINF 3I71A 2K3PA 2EFQA 3WTYC 3IAM2 3ZMTA 4ZYDA 5EFYA 3X2QH 4A3DJ 3JSOA 2CRGA 2EFWA 1YHQI 4WIBA 3OWTA 5FMPA 1U78A 1IN7A 5GADJ 4CYCA 3S1QJ 4Q5SF 1VQ8I 5KAIC 2JUCA 3RDIA 4E7IA 5EDNA 3SXYA 1YG2A 3PNTA 4C30A 1TLHB 1R7JA 1WHUA 1AWCA 1GHCA 2RREA 2MG4A 3LAPA 2L7FP 1ENHA 4MNUA 1F5TA 2LH9A 2DDBA 2MA3A 4PXIA 2W00A 5IP6A 4MHGA 5GAEJ 5K5OA 2VT2A 2MABA 3HSRA 1K61A 2STTA 2P7CB 1FIAA 5BMZA 5IYBJ 1YS7A 1HXDA 3LOCA 4NHJA 1XDSA 4U9LA 1HF0A 5CVUA 2M7AA 4ANJA 3KLOA 3OL3A 3NXCA 3ZXSA 3CP8A 3BG6A 2AO9A 1FEXA 1RKTA 1X1DA 1O57A 4A5NA 3S1MJ 1X1CA 3HUGA 2KIUA 2P6SA 4M3GA 3MKZA 3JRGA 2UWMA 1OKRA 1Y0NA 2M1BA 4GXOA 5FD6A 4XL9A 3F72A 3CCSI 2XDVA 1I3AA 1ZTRA 3M8JA 2XGDA 2ACJA 2K9NA 3OS0A 5J8CA 5DEQA 5D5WB 3LSGA 1OCZH 3RKWA 1QVTA 2OV7A 2YX4A 3PUFA 2L02A 2CW7A 5JVGF 4EJUA 3HXLA 4LK1F 1WZ2A 3I3LA 2WGBA 1I50J 5IOYA 4HQEA 3IH3A 1IN5A 1BN5A 2R7WA 3FKIJ 1JUPA 1TQMA 4U0VA 1ON2A 4OWRB 3VIBA 4CH7A 3H35A 3DTEA 1JGSA 4HX4A 4LITA 2D2WA 2BYVE 2XGCA 5LGUA 2OUMA 3ESWB 3F8NA 3LAJA 5KAFC 4WXDA 4KMFA 2M9HA 1O3TA 2CMPA 3HPGA 5E8IA 3DKXA 1XDUA 2DPUA 4AC6A 2XPWA 1B1BA 5LHHA 3MZYA 1LE8B 2ZNYA 4YIIA 3TDUC 2MGQA 4LD5A 5LGTA 3BROA 4BHPA 2DOAA 1U5TA 5J47A 2OTLI 5CLSA 3KYDB 3OYJA 4CCOA 1RZ4A 3A2KA 3DBLB 3AQTA 2N8GA 2WV0A 1XGMA 4G8XA 4EJWA 3WTUC 4B8XA 1JT0A 4F52A 2NVUB 3K7AJ 1Z6RA 3ZOBA 4KDPA 2XAFA 1X3WB 2M45A 1LNWA 3IP4B 2IGKA 4FHTA 4FASD 4L62A 3RPUD 4BBSJ 3E7QA 1TWCJ 3HG9A 3S2DJ 1KU3A 4A0ZA 2XDNA 2QKLB 3ECOA 1HDDC 3BDDA 1MMNA 1X1AA 2B63J 3FHZA 5HSZA 4M3FA 3IL2A 2ZFWA 2Z99A 5M5WJ 4OMYA 4KN4X 4B09A 4BACA 3BG7A 1MDMA 1DU6A 4KIGA 2CYYA 2EIJH 2JVGA 3DFGA 1TW3A 2ZXJA 1ZG5A 1I27A 3TO7A 2NS0A 1K6YA 2PG4A 2AXLA 1R1TA 1G8XA 3M7GA 4L9JA 5ILVA 3L2VA 2VOPA 4E7KA 4A93J 1T56A 5E8GA 1SD7A 4L18B 1FC3A 3I4NJ 2W4SA 4C3JJ 1T8IA 3D0SA 1O7LA 2BE5F 3LSJA 3R0AA 4DZPA 2P0WA 4NELA 2EB7A 3RKXA 4DJAA 1IW7F 1ZR2A 4A3BJ 4HF1A 3G3ZA 4CHUA 1ZLKA 2HVSA 2WC2A 5HS7A 2KRCA 3WTZA 3MAJA 3K4JA 2LDUA 2DI3A 3I4MJ 2G7UA 4QWQA 2VC0A 1A31A 2B7EA 4BXXJ 3BZ6A 5LGNA 1W4MA 4N4OB 3JRIA 1KYZA 1EA3A 1SVMA 4H4KC 2NS8A 3M1EA 1JKOC 4NNJA 2OF7A 1W7PB 3EUAA 4FQGA 5J1UA 1HCRA 2ESNA 2R3SA 3R0JA 3ZCOA 5CW8A 4E4HA 2FBKA 5GAGJ 3BCAA 2VL8A 3W6JB 3VVZA 2VE9A 2XAJA 1A6IA 1MSFC 2DT7B 5C44J 3HTJA 5HNFA 3CMYA 3QBMA 3SFIA 4P9UA 1R23A 5EGOA 1Y1WJ 2ZMEB 3L2QA 3I59A 3IHUA 2VIXA 3LSMA 3I5UA 3C2BA 1XG1A 3P5JA 4IHWA 3LSPA 3JTGA 3IC7A 3LL7A 2BY2A 4CCMA 2H8RA 4G6DA 3CF2A 2DAOA 2Z9OA 1XMXA 2DPDA 2DT5A 2XSDC 1WCMJ 4IPAA 2HTJA 3TP3A 2XAGA 3MKYB 1DQUA 1B72B 2Q8KA 3VOEA 2XF5A 2OQRA 3OOUA 4ZYGA 3HOSA 1D5YA 2GA2A 2V6CA 4B48A 2HZTA 3R4KA 2E36A 5LD2C 1GV5A 3E1SA 5EG0B 1H0MA 4GDFA 2R7DA 2E2HJ 2R7VA 2Y48A 2VXZA 2DMNA 4JX4A 4DYCA 1KQ0A 1LPQA 1MW7A 5DAJA 1HDPA 2K3FA 3S3MA 1B4AA 4LGWA 2QWWA 2ZXWH 2LBFB 3VOXA 2EZIA 2YS9A 1IC8A 3B73A 1X3ZB 3HTHA 2ISYA 5FRNA 1L0OC 3Q9SA 3ZMZA 2DOEA 4HG2A 1J0RA 4ENMA 5F64A 1YX5A 3N97A 4M6VA 3KZ9A 4MIMA 1JHHA 2BGCA 2KIFA 4XRFA 2JPBA 3NNRA 1Z7LA 5J6XA 2XC7A 1GXQA 4V2FA 4B47A 3JAMK 3CO7C 4NN1A 2FBQA 1B6AA 3DTKA 3H36A 4EGZA 4DNCA 1ERDA 2XGEA 4YRVA 2LKSA 3V78A 1PP7U 4OD5A 1WSUA 2YVXA 3D5RC 1MMDA 3GMEA 1XB4A 2GIVA 2HPIA 2CG4A 1IDYA 2GBYA 1P92A 2Z33A 1OMIA 2QZ8A 4PGHA 2M4KA 3BTCA 3QPLA 1PJRA 3GTQJ 1BR4A 1VQ4I 1R5ID 3HSFA 2JQ7A 1J9IA 3IUVA 2QUFA 2WAQN 5A2QZ 1WJ5A 2MD5A 2K9MA 4YG2F 4KWAA 5B66C 1Z05A 3FBIB 3J7YJ 3GZIA 2A2FX 4XLEA 5FKLA 3CCUI 4L9NA 1P7IA 2E71A 1SD6A 3K2ZA 4KNYA 2RAEA 5K5QA 4F7ZA 4YEJA 3J81Z 1VQPI 4V19K 3F6OA 3V8LA 2X9DA 1N25A 4BU2A 3T8TA 3E5XA 4HX8A 1ZYRF 1SFEA 4GRIA 1YJNI 2RVCA 3QYFA 3MWMA 5F0FA 3QPSA 3C3WA 3WGGA 4CYDA 4D7MA 2E2JJ 2DTRA 3ZPLA 3RZOJ 3ONQA 1B8IA 2FMYA 2CH0A 1FYKA 1FOKA 1V55H 4CSWA 4HRIA 1IO2A 2HS5A 2EZHA 4MFDA 1E0EA 5DUKA 2M4GA 4Q48A 3TW6A 1K4SA 5CXGA 2BOLA 2VT3A 3BG5A 4P96A 2ZJQF 2ZMEC 4KN7X 2E5ZA 3MMYB 4AWXB 2F4MB 2DJIA 5DYMA 1OYYA 3BTIA 1MBJA 5HDGA 3H5AA 3HEFA 2L9RA 3WG9A 1UELB 4HLYA 1EH8A 4M3BA 4MO7A 3G56A 5D8KB 2R0QC 3U1KA 1BI2A 1SVOA 4S0HB 3VB2A 2A68F 4ETSA 4G9YA 3DLAA 4B43A 4F55A 1R58A 2DYSH 2IJLA 4C2UA 2E2IJ 2V6EA 4ZDOA 1IF1A 3WE3A 1K6OA 1ZN2A 2KHMA 5E79C 1MH4A 1AKHA 4A2UA 2O61A 3FRQA 1LE8A 2E1CA 2R5YA 2VJJA 5B1BH 4A3CJ 4BE2A 3V7RA 1I6XA 3QU3A 3S32A 1ZQ3P 2EQRA 1P7JA 3S2WA 1ZAOA 1IRFA 2LVSA 4DW6A 4XLFA 1DP7P 1Q1VA 2ADUA 5FRMA 2G3BA 3KP7A 1G3WA 2KIQA 3BJAA 3M8EA 4A3KJ 2DQRA 3KEYA 1QPIA 3MN2A 3ANGA 2GXBA 3G73A 2D45A 4AVPA 1UZCA 1U3EM 1RI7A 1FYLA 4QPOA 3VW0A 3MKWB 4PJJA 2JVHA 2G9WA 1Z3XA 4ZJZA 3JREA 4HAMA 2EV0A 1X19A 1OFCX 3RPUA 4NC8A 2QEXI 3HDDA 5BOXA 3K4KA 4OIQF 3H5RA 4HSRA 1QA6A 3QU6A 5BQTA 1OYWA 3I54A 3P9KA 2ID3A 1ZRFA 4EVIA 2EINH 1TT5B 2HI3A 3GW2A 4D1QA 3G7RA 4KT5C 3E5QA 3KIOA 4OAZA 3E3VA 3GFLA 2UXUA 2H09A 2ZOZA 1D0YA 1T38A 1SMTA 2EK5A 1KZHA 2STWA 3H3ZA 2RNGA 3DTIA 4PJMA 3ROUA 1D1AA 4FE4A 3E97A 4RGXA 5FO5A 4EM0B 3F23A 4IJAA 4LOCA 3LMMA 3VVYA 3KYLA 3WTVC 2ZSHB 2L9NA 2ELKA 1BW5A 4FCYA 4A3LJ 4CCJA 4YELA 1VI0A 5ICGA 2K4JA 4XN3A 2QWTA 1SFOJ 2F5VA 1Y1VJ 1TZLA 3NRGA 3MNLA 1DPRA 1TTYA 2JUGA 3P7NA 4HW0A 4RB3C 1E3HA 1OR7C 2XF6A 1S7OA 3GTMJ 1FBSA 2ZSIB 4KIBA 1BA5A 1IUFA 3L9FA 1A35A 3H3VK 3K4BA 1WH7A 3KZZA 3WTSC 1OCCH 1W0UA 3L2UA 2DK5A 3DLLF 1HKQA 2BEOA 3V8JA 1XTAA 2NAZA 4ZZDA 2O8KA 1IXRC 4PUSA 3BPVA 2GOMA 2JZYA 2A05A 3SDGA 1IV6A 3FXOA 1FMWA 4KMUX 2NP3A 3Q0UA 3WU2C 1TNTA 3RZDJ 1ETXA 1LVAA 5BNGA 1JUMA 2XSJC 4M3EA 1UFMA 3CLQA 1T95A 3DEEA 2VKEA 2ZMEA 2E1NA 5FD5A 3BR6A 2VKVA 2F5CA 4XMYA 2ID6A 3MZ8A 1FPQA 5KVRA 2V1NA 4BQQA 4A3IJ 3IV5A 1PUEE 4CZCA 1IN8A 1PYVA 3EDPA 4MTDA 1FLIA 1KU9A 5CVJA 5E17F 1MSEC 3GZ5A 2EILH 2W53A 1U9NA 1BI3A 2ZCMA 2EBIA 1B72A 3OV8A 1DUXC 2G7LA 3OYMA 2NRAC 4L0YB 2FA5A 4MK6A 2KFDA 5C4YA 2X6XA 2L0KA 4BEHB 5TRDA 3KLNA 4OIRF 3HGYA 2V9VA 3SZGA 5EG0A 4LMYA 2M2EA 2A61A 2R93J 1UHWA 1WJDA 1X2NA 2X6WA 1LJ9A 2O7TA 2HOAA 1MJBA 1WI9A 2RN7A 4HOBA 4IHYA 4MQ9F 3OS1A 3COAC 4LLGF 2CQKA 4CXFA 2DA2A 4GO1A 3QYBA 2ZY9A 2KL4A 4XKBA 1HW5A 2FRHA 3SFZA 3VYRB 1F43A 3W2AA 2JA5J 1Y0UA 3O3KA 4ENJA 1B59A 2H27A 2RNJA 4XOPA 1W5SA 2REKA 4ICHA 3TEDA 4XICA 4AD9A 3E6MA 5AQCA 4YIRX 1MMGA 2MW8A 4ITVA 3FXQA 2M3AA 3FXKA 2QQAA 4UUSB 4LG0A 2EFNA 3LWJA 5CXIA 5EEHA 2EFPA 5DM6F 2EIMH 2DA3A 3NPIA 1HQCA 1YRNA 3BWGA 3BG9A 2HDCA 1Z21A 1FOWA 2KJCA 2KRHA 1DPUA 4XLNF 1OCOH 2HKUA 2NVXJ 2OCEA 1HKTA 3PFIA 3SYTA 4ZH4F 1Y8RB 3BJBA 2ZJ2A 2UZKA 3HL2A 1U0JA 1VZ0A 1U8BA 2PJPA 3ZQGA 4M9ZA 4GFBA 3PO2J 4J19A 2P5KA 1MBEA 3VEPA 2HDDA 4RAZA 4KIFA 2W1OA 4DYQA 2IS1A 2XIGA 2YU3A 3QRFF 4A3MJ 3TMOA 2R4GA 1T2KA 4U0WA 4YZEA 2HOEA 3FKJA 1WKMA 2MFZA 2XV4S 3DU6A 3ABMH 4YFNF 5H9TA 4OIOF 2RHAA 6PAXA 4G7ZF 4XRMA 1K78B 1QVUA 4I0AA 1QZZA 3W2WA 1S6LA 3CC2I 2LYCA 2RASA 3HRSA 4MEYF 1JI8A 5LLQA 1A04A 4UY8I 3ON4A 1NK2P 2XRLA 2ECCA 2QENA 2PJRA 2DT6A 1JGGA 3M1CA 4TV7A 3D1NI 4MEXF 2QBYB 2RQQA 1BW6A 3S5RA 4N0BA 5AONA 5IPAA 3W6KB 1Y56A 5JLXA 1UHSA 2MBFA 4N9IA 4EJOA 4B1RA 3F8MA 4NDLA 4LB6B 2GAUA 4QLCU 3HM5A 4HDUA 5DCFA 3OSFA 2OERA 1CQTA 4XM3A 5FLXZ 1D8JA 1DGWY 4QSHA 2FQ4A 3RTRA 3F21A 5F0HA 3O60A 3GYHX 3CQZJ 5DUIA 3OYFA 2IA2A 3QPHA 4NC6A 3F6VA 4XONA 4ZTJA 3GZ6A 2YX7A 4EQQA 4E7LA 4OIPF 2V57A 2DMQA 4UVAA 2F5DA 1LQ1A 2Y9YA 1QZEA 3D5SC 3BHQA 2FJ1A 2Z5UA 4LG3A 1SFKA 4M73A 4BJ6C 3C7JA 2XKOA 3JSPA 1FYMA 4IHXA 3GTPJ 3ULQB 3QP5A 2YR2A 3BR2A 4RBOA 3F0CA 3LSIA 4FT8A 3HIFA 2EPFA 1TBXA 4ASNA 1FP1D 1MNEA 3GLXA 2XB5A 4FX0A 5BPIA 1JT6A 2FMLA 3C18A 4A5MA 2K86A 5HS9A 1F4KA 3ABUA 4IF4A 5K5RA 2OBPA 3QKXA 3UR3C 4HF2A 1IGNA 4A3FJ 1TT0A 4IHVA 4Y4RA 3B02A 4ZTFA 1EH6A 3K10A 4HBLA 1T6SA 3FIWA 3H9QA 5JR3A 2VUMJ 2W57A 1VQ6I 3PQKA 2CQXA 2FOWA 1X58A 5GPCA 1QBJA 3F1BA 2RV8A 1V3FA 4LLLA 4EEFG 3OR1C 2K85A 2ECBA 1MIJA 1R1VA 2A69F 2GZWA 4MLOA 5JHFA 4M9SA 4K2EA 2Z2SB 2LF7A 3TL4X 2QQ8A 3L2WA 5ICCA 1TWAJ 1KONA 2HU9A 1IN6A 1OCRH 4X6AJ 4HYEA 1ZLJA 4B3XA 3FMQA 1R22A 1V5EA 4NBQA 3IKVA 5E1ZB 2FBIA 2O3FA 3K2AA 4LIVA 1H8AC 4KUMA 3QODA 3KE2A 4IVNA 3CCJI 3RIRA 3VDXA 1VQ7I 3ZN0A 3L2RA 3R61A 4AIHA 3OIQA 3AL0B 1YS6A 5FKMA 2L5QA 1Z6TA 3BC8A 4HQMA 2IAIA 1E2XA 2Q2EB 3FXUA 2NVQJ 2PMUA 3HOWJ 3WHCA 5HLGA 2HQAA 5FKNA 2GA1A 1RRJA 1H89C 3H3UA 2PMZA 2R7UA 2ZNZA 5HODA 1IDZA 2HEOA 5ICFA 3JTHA 4M3DA 5HBUA 4BGDA 3ASNH 4DYRA 3S1NJ 5GPAA 2FOKA 3ZGKA 1JJ6C 1NH3A 1BL0A 2F07A 3JRFA 3TBIA 4E7JA 5J4YA 2Y9ZA 2BY1A 4XSZF 2LR8A 3K4MA 3PSFA 1N75A 3ABLH 4U88A 1P6RA 2ZO4A 2D1HA 3CJNA 1JTYA 3G1OA 4JBAA 4E70A 4RLQA 1ZK8A 3S17J 2YVEA 2LY2A 3P9TA 4Z2YA 3VTIA 2RKHA 2MH9A 4ON0A 4B44A 3LSRA 2BZTA 1SVLA 1LFPA 2LMDA 3BQYA 3VUQA 1HC8A 4DVYP 3P9CA 2K9LA 4BEHA 3RYRA 2D6YA 3HOYJ 1R1UA 2DQLA 3RSNA 2VBZA 3HYIA 3NARA 4PFOA 3TO6A 3ZQHA 2Y0SA 3BY6A 1WJBA 2ZBKA 3K4NA 3TOBA 3BP8A 2CW8A 4KISA 3CJRB 5CQEA 3J80K 4IQ4A 1O3SA 1JJ8C 1FIPA 1UG0A 1V4RA 1WJAA 4M71A 4GFKA 3M3YJ 4L5EA 2E7WA 2M34A 4PJ0C 2VQCA 4EMSA 4M6YA 4CCKA 1R49A 1W7PD 5J1RA 3FK7A 3GTOJ 3OYIA 5E3LA 3GTLJ 3PNVA 1IN4A 3RCOA 4BXFA 2EZKA 2G7SA 3EYIA 3E7LA 1WVRA 2KDOA 3CUOA 2ELJA 2TCTA 4UUSA 1OYIA 2KZGA 1W5TA 2Y75A 4U7BA 3IUOA 2G7HA 1XGSA 5K58A 2G7GA 3CF5F 3E0JB 3RPQA 3H0GJ 2IP2A 1ZH5A 1CF7B 4U7DA 2CUFA 2P5VA 1HBXG 2Q24A 2EFOA 5E1WA 4CDGA 1VNDA 2PLYA 4IOCF 4AYBN 1I1SA 3GLLA 2W84A 2HQ5A 4FE7A 5CYVA 2BVMA 1IXSB 3FF5A 1MNDA 2XVCA 3KETA 2UXXA 1QQIA 3AG3H 2L9VA 1GLNA 1HSJA 4RA2A 1LEAA 4L5IA 1LDKB 3RI4A 2KDZA 3BZKA 2HNHA 2HOTA 4KITB 1T33A 4I0BA 4M9XA 1RIOH 1K78A 3FM5A 2VASA 3FX3A 2OI8A 2BW3B 1U6GA 2VBWA 4L5JA 3K1MA 3VYTB 3FHNA 4AUXA 4UB8C 3QWLA 5M3FJ 1I5ZA 1IXCA 3WGHA 2MLGA 3FZVA 4G12A 4JK1X 3MVPA 1P4XA 3EUKL 3KNWA 1KGSA 3R60A 3TP0A 4XLAA 2M8EA 3GFJA 4YIFA 2LNBA 3A01B 2CU7A 2IA1A 3KZIC 2JA6J 3HHGA 4H0EA 1U9OA 1X4OA 5H20A 2QBYA 3C2HA 3KEOA 3VPRA 2L7ZA 3KZYA 5HNHA 2CV0A 2R7ZJ 1RUNA 3KP3A 2ZCXA 2KKOA 4S05A 1XMKA 2QA4I 3LHQA 1BR1A 5GAHJ 5CVRA 2HQRA 2LLKA 2Z3YA 2L01A 5HLTA 3RKYA 1POGA 3LFUA 3BQZA 4GCVA 4AIDA 4C2MJ 5IT3A 5ED4A 3L00A 2ZXIA 3WU1B 2PQ8A 4EGYA 2VB6A 4JP0A 3Q5FA 2L9SA 5FKKA 2C6YA 3E6BA 1STZA 2DBBA 4RS8A 1LDDA 4F92B 4NC7A 2DMUA 1EV7A 2JRTA 4M72A 3TOAA 3DWLE 4HZFA 4PK4A 3RH2A 4GYIA 2L54A 2JT1A 3I9V2 2CV1A 1OISA 2EZLA 1RR8C 3DBRB 4ZC3A 4A0XA 4U87A 3EETA 4D5FA 3HE0A 3CO6C 1UCRA 1XMAA 3BTLA 2KPMA 3OR2C 2XGXA 4JX6A 4HKUA 2DFFA 5LHGA 4FTHA 1ZHFA 1XSXA 1V5FA 4XRSG 3PPBA 2HDWA 3O8GA 3Q0WA 2A6HF 2KMUA 1HW2A 2DTZA 3LA2A 1S72I 4RAFA 1H9TA 2GM4A 2IW5A 2FNPA 2ZKZA 2FJI1 2R7OA 2ELHA 2MD0A 2H94A 2O9LA 3A1YA 2H1KA 4R1HA 1JKRC 2JWTA 1Z91A 4O3MA 1ETKA 5LRSA 3F8BA 4UNOA 2DA1A 3CDHA 2M8GX 4A6DA 3HRMA 1S9HA 1YW7A 3ZQLA 1ACIA 3KKCA 2E1MB 2HKOA 2BXZA 2I5UA 2XASA 2H6BA 4HV6A 1NG6A 4BQNA 1GT0C 2HZDA 1SFXA 2MLKA 5AIQA 3QQAA 5H2FC 2GIZA 1FX7A 1I3QJ 1AA7A 1MGTA 2LG4A 1X3UA 1MMAA 4RM3A 1EJ9A 1IJWC 3NEUA 2CW0F 5L3FA 4RB2C 2B1EA 1B9NA 4E7HA 2JPCA 3L2CA 2WADA 2XB0X 4EJTA 3CLOA 2KIMA 4L9TA 5GP9A 2Y0MA 4XLCA 2E5NA 2X51A 2ZFUA 5KK1A 2QQ9A 4RGSA 3FWEA 4C3HJ 4D7NA 2OD5A 1S7EA 2JK3A 5HDKA 3JR9A 1T98A 2JA2A 4I6ZA 4HPQA 3A02A 3WE2A 1KQ9A 4PGGA 4CO8A 2M7BA 4IHSA 2GQQA 5H6QA 3UKGA 2Y31A 3BR5A 3ABTA 3K8PC 1UMQA 1TWHJ 3F3XA 4XLHA 4I01A 2KT0A 5ICEA 4CYCB 3A0HC 1JKPC 2XUBA 4XKWA 3F8FA 3TW7A 1D5VA 2LP0A 5CVVA 3VFZA 3A4CA 2HXIA 5ILSA 3E6CC 2A07F 4X0GA 2KP6A 4BYYA 2PI0A 1RR7A 1PVEA 3G6EI 3A03A 4XORA 1O7FA 2F2EA 2VQLA 1SC7A 3MZHA 4NB5A 2ISZA 2JSPA 3AFHA 3PFYA 3DQVC 2OZ6A 4GFLA 1HKSA 2HYJA 2VI6A 3IH2A 4B3AA 3I56I 1LEBA 5HAWA 2R7SA 2AHQA 3MQ0A 3SJMA 4IL6C 2OAZA 3JRCA 3NRVA 1TWGJ 3Q9VA 3HRTA 1S8NA 2WTEA 4PJLA 2I10A 4NQWB 3CJDA 4KJZA 3U9GA 3CMEI 3H92A 2DFIA 2WBMA 3OSGA 1S7AA 2CJJA 2L4AA 3JRDA 4YFKF 2M0MA 2DO7A 3SZPA 4W1UA 1YO5C 4IKFA 1WJCA 3JCUC 2J5OA 3IWZA 1XCVA 4BS9A 1FTZA 2ZB9A 3NAUA 2M5WA 3KCCA 2RC4A 1W5CC 3DPLC 5DTDA 2HGCA 2EA2A 3DEUA 2FU4A 2DA7A 1AOYA 3HTIA 1C0WA 2OPTA 2XROA 3AG4H 3T1BA 5J8FA 5D5VB 2R5ZB 1R36A 1T08B 2UXHA 4ENKA 4G7OF 4DIQA 1PUFB 3KEQA 4HNUA 2LKXA 4GCTA 2E1MC 1W7PA 5JFRA 4X1EA 2DG7A 2O03A 1GVDA 1XSDA 3S14J 2LY1A 2QM3A 3B6CA 4ACIA 3CCYA 2ME6A 2OA4A 1BC7C 1MBKA 3HPHA 4DOZA 1UB9A 4AM3A 2PMZN 4JYKA 5DCMB 3CUQB 4LIUA 4UVBA 3DBHB 3OY9A 1BIAA 2R7TA 2HXOA 4M6XA 1HLVA 2VPLA 1QHHD 3BOQA 2IXSA 5L3EA 5HLHA 2KQRA 5A2QK 4Y3OA 3IKTA 3RYPA 2P81A 1I6HJ 2QVOA 4A3GJ 2F5FA 4A0YA 1ETQA 2AQFA 4G7HF 3J81K 5LRRA 2NYXA 2K5CA 3ZQCA 3OYGA 3EUPA 3ZMUA 2EA4A 1F9NA 2K7LA 1YFHA 1YJWI 5FGLA 4OMZA 3U2RA 1HSTA 2DMTA 5K1YA 2CWEA 3BZCA 1QZYA 2HKXA 1E17A 4L0ZB 4AC0A 4EATA 1I39A 1ZR4A 2WWYA 5DD4A 3GVAA 3LNQA 5J1YA 1MDMB 1XGNA 2R7QA 2Y0SN 2LFBA 3BPXA 4WWCA 1EKEA 2LBFA 2OQGA 3V4GA 1EH7A 3WU0A 3ZQIA 3IRRA 1Z7UA 3O2PE 3G1MA 2G0EA 4Y33A 2ZCWA 5D19A 3W6VA 3QOEA 2Y2ZA 2QSHX 1PDNC 5CQGA 1JKQC 5F0CA 3ANPA 1IUYA 4PDKA 1AU7A 3K69A 4J00A 4IXAA 3BTJA 3P9IA 3CC4I 3PM1A 3RQIA 1P4AA 3VYSB 2VOOA 3S93A 3GBGA 3CCLI 1S5LC 3I0TA 3AKZA 2E60A 4BKXA 2FF4A 5F04A 3HKZA 3RKQA 2PFBA 2H8WA 3I4PA 2OCCH 1UG2A 3B81A 1LUJB 2ETHA 3HSEA 1TC3C 3NWTA 5E20A 2DJNA 2JA8J 3FM3A 3CD6I 3VP5A 2MYSA 5LHIA 3DKWA 3F8CA 2R7XA 1HW1A 1BC8C 2HTSA 5D6FA 1L3LA 3NS4A 5IOZA 4IHTA 1OCPA 1FY7A 2LOOA 5FFZA 4IQJA 2KRFA 3FXLA 3PJRA 3VODA 2X1CA 3HC7A 1QGPA 3VWBA 3HZJA 3ASOH 4RAGA 5KCMA 2HWVA 4N9HA 3BR0A 1CGPA 3I59B 4OAYA 3JRBA 5IP7J 2OZUA 3J7ZI 2FSWA 1OPCA 2VQGA 3V7CA 2IT0A 1A36A 1YLFA 4ZYAA 3NQOA 4CUGA 2NNNA 3OYAA 4Q4ZF 4IRGA 1HA8A 5D5UB 3EYYA 3ZRGA 3NI7A 1OR7A 4DZJA 1FOXA 1ZRDA 3LSKA 1RETA 4D0PA 3CUQC 3S8PA 2CQ7A 2A6EF 2UV1A 2Y69H 1LDJA 3CCMI 2XPUA 4IO9F 4XN0A 3HTAA 1X1BA 3EPZA 2EWNA 3DU5A 3H5NA 3LSTA 5M5XJ 1KQ8A 4II3A 4WF2A 4XRSA 2XF7A 5IY5H 3I55I 4HNVA 1W36C 2GOXB 3BT9A 4A3EJ 1SD5A 1I1GA 2VODA 4FISA 5EJCA 1DGRM 2P8TA 2IA0A 4ZDLA 3ABKH 3IWFA 2AQEA 3BJ6A 1UI6A 4CCLA 1FNNA 4I7HA 2DLLA 4EJVA 4R79A 4RGUA 3HB9A 3WGIA 2BVLA 2YVHA 1ZRCA 2JSCA 5FGMA 3PIPF 3CMAI 3GEUA 4BAYA 3IH4A 5ILUA 3ZMVA 2IGMA 2KISA
chains in the Genus database with same CATH topology
4V2GA 3Q0VA 1FIPA 1JJ8C 5F0FA 3QPSA 4D7MA 2E2JJ 4MFEA 3HOVJ 3RZOJ 1WH5A 4GFKA 3M3YJ 1DU0A 1B8IA 4L5EA 3GTJJ 1SGMA 2M34A 1VFCA 3WHBA 3M4OJ 2L7MP 2X6OA 3BRUA 2EZHA 4MFDA 9ANTA 3TW6A 1EF4A 5CXGA 1E3OC 3L1PA 5J1RA 3BG5A 5M3MJ 3FK7A 4QIWN 3GTOJ 5F08A 5IYDJ 5E3LA 2UXOA 1H88C 3GTLJ 2NP5A 5J3LA 3BTIA 5E3OA 1MBJA 3JSJA 5D18A 1RKWA 2EZKA 2G7SA 3HEFA 2GENA 2L9RA 3E7LA 3S1RJ 4UUSA 2TCTA 1ETYA 3JRHA 5K7HA 4MO7A 4M3BA 3G56A 1JTXA 5M5YJ 2R0QC 4S0HB 2LTPA 5K58A 2G7GA 4JL3A 3H0GJ 3A01A 2E2IJ 2QF7A 1LFUP 2CUFA 2Q24A 1AKHA 1MH4A 3FRQA 2JA7J 1LE8A 1VNDA 2R5YA 1MBHA 3HOUJ 4A3CJ 4AYBN 3T6NA 3VOKA 5C4JJ 4FE7A 2HQ5A 1ZQ3P 2EQRA 1P7JA 2COBA 3LJLA 2LVSA 4I76A 4DW6A 1B8IB 5FKOA 5FLVA 5EZGA 2DA6A 2MSYA 3HIMA 1Q1VA 2G3BA 2K40A 5FJ8J 4A3KJ 1QPIA 1Z77A 2KDZA 2WB1N 3MN2A 4XIDA 2HOTA 3ANGA 1T33A 2E1OA 1XS9A 3JRAA 1SANA 3CDLA 3VW0A 4AF5A 2OI8A 1MBGA 2DN0A 3CWRA 3JREA 4AUXA 2R5ZA 5M3FJ 1OFCX 3S15J 1IG7A 3HDDA 4ME9A 4MXMA 1PUFA 4G12A 3MVPA 3KNWA 2QKOA 3EGQA 2ID3A 3TP0A 1LFBA 5EGOB 1UI5A 2HI3A 1ETWA 4XK4A 3A01B 2CU7A 3G7RA 4JNNA 2JA6J 2UXUA 2IU5A 4CGRA 1U9OA 1AKHB 1A5JA 3DEWA 2FX0A 3FISA 2ZOZA 3VPRA 2L7ZA 1IRZA 2R7ZJ 2R5YB 1HOMA 4RDUA 2K9SA 2ZCXA 1BJZA 3KKDA 3LHQA 4FE4A 3FK6A 2QOPA 2LLKA 4LOCA 1X2MA 3VVYA 1FTTA 1POGA 3BQZA 4A69C 4D5CA 4C2MJ 5FLMJ 4JP0A 5FKKA 2HOSA 1NK3P 4IEJA 2ELKA 1BW5A 5F1JA 5EF6A 4FCYA 4A3LJ 1VI0A 2DMUA 3HBLA 1XC5A 2QWTA 1SFOJ 5FHPA 3RH2A 1Y1VJ 3BNIA 2ZCNA 3DCFA 3NRGA 2EZLA 1R9TJ 3MNLA 1ZKGA 2UXPA 2M0CA 2FD5A 1JUSA 4D5FA 3HE0A 2QTQA 3GTMJ 3BTLA 1TWFJ 1BA5A 4JX6A 1IUFA 3H3VK 4HKUA 4FTHA 2D5VA 3PPBA 4XRSG 1WH7A 3O8GA 2NVYJ 1W0UA 3Q0WA 2PBXA 5JLWA 2DA4A 2DTZA 1Z0XA 1GV2A 1WPKA 5IYCJ 2GUHA 3AQSA 3DPJA 2GM4A 2O8KA 2LY9A 1RESA 3SDGA 1IV6A 2O9LA 2TRTA 2H1KA 2NP3A 3Q0UA 5EFYA 1RPWA 1JKRC 4A3DJ 2CRGA 3RZDJ 1ETXA 2JWTA 4UUTA 1ETKA 5BNGA 3ON2A 1JUMA 2DA1A 4M3EA 1U78A 5FMPA 2M8GX 4CYCA 3S1QJ 1FJLA 2VKEA 3ZQLA 4BY1J 3KKCA 3BCGA 3BR6A 2VKVA 2YU9J 2ID6A 5EDNA 2NX4A 1GT0C 4A3IJ 3IV5A 2GFNA 3QQAA 2MG4A 2L7FP 3S2HJ 1ENHA 1MSEC 1I3QJ 2W53A 1U9NA 4GCLA 2ZCMA 4PXIA 5IP6A 2QIBA 2EBIA 1ZGWA 1IJWC 1K61A 1B72A 2G7LA 1FIAA 4MK6A 5IYBJ 5C4YA 2XB0X 3LOCA 2EH3A 2JMWA 2L0KA 1HF0A 5GP9A 3HGYA 5EG0A 2M2EA 2R93J 3NXCA 1X2NA 2O7TA 2AO9A 2HOAA 1FEXA 1RKTA 3S1MJ 4IHYA 4C3HJ 4D7NA 3JR9A 1S7EA 2JK3A 4M3GA 3JRGA 3HOZJ 3BR1A 4I6ZA 3A02A 5F27A 5C4XJ 3UKGA 2DA2A 2Y31A 3BR5A 1ZTRA 1UMQA 1TWHJ 1F43A 2XGDA 2K9NA 5DS9A 2KT0A 4CYCB 1JKPC 2JA5J 2XPVA 3TW7A 3LSGA 2LP0A 1QVTA 2REKA 2JN6A 4ICHA 2HXIA 5EYRA 3TEDA 2Y30A 4XICA 1APLC 5AQCA 1RR7A 3A03A 2MW8A 2WGBA 1I50J 5IOYA 5K7ZA 3IH3A 4UUSB 3LWJA 2IBDA 3FKIJ 4GFLA 1JUPA 5CXIA 1OJLA 3VIBA 2DA3A 2K9QA 2GLOA 2HYJA 2VI6A 3NPIA 3IH2A 4B3AA 1GDTA 5HAWA 1YRNA 2AHQA 3BG9A 3SJMA 3JRCA 1MNMC 1TWGJ 4B4CA 2XGCA 2HKUA 2NVXJ 2NOGA 2I10A 2ZOYA 3BJBA 3CJDA 2M9HA 4AC6A 3OSGA 1U8BA 2XPWA 1LE8B 2CJJA 3GTKJ 3JRDA 2MGQA 3ZQGA 4GFBA 3PO2J 4J19A 1GUUA 1MBEA 2E19A 2HDDA 4W1UA 3HKZN 4DYQA 3AQTA 2N8GA 4A3MJ 1FTZA 4YZEA 3Q3SA 1JT0A 2ZB9A 3NAUA 2PZ9A 3K7AJ 3ZOBA 5H9TA 5DTDA 2RHAA 4XRMA 1QVUA 2DA7A 2LK2A 2DG8A 4L62A 4BBSJ 2HYTA 3HTIA 3E7QA 1TWCJ 2OPTA 3S2DJ 2R5ZB 2RASA 2XDNA 2UXHA 1HDDC 2YUSA 4UDSA 1PUFB 5D1RA 2B63J 3ON4A 2LKXA 5HSZA 1NK2P 4GCTA 1YRNB 2XRLA 2ECCA 4M3FA 5M5WJ 1JGGA 2QCOA 4X1EA 3D1NI 2DG7A 1DU6A 1GVDA 3S14J 3B6CA 4ACIA 3CCYA 3MKLA 2ME6A 2WUIA 1MBKA 1BW6A 3S5RA 2IEKA 5E3MA 5IPAA 2PMZN 4JYKA 3COLA 3BR3A 5JLXA 1UHSA 4Y52J 4B1RA 4NDLA 2DA5A 2HXOA 3OIOA 3HM5A 4A93J 1T56A 1HLVA 3OSFA 2OERA 1CQTA 1WGXA 2CUEA 2FQ4A 4QSHA 4C3JJ 3I4NJ 3LSJA 5F0HA 2P81A 4DZPA 4JX5A 1I6HJ 3CQZJ 3O60A 4NELA 4A3GJ 1ETQA 1MBFA 2V57A 1ZR2A 4A3BJ 3ZQCA 2DMQA 3EUPA 1ITYA 2Y9YA 3BHQA 5EEAA 2FJ1A 3S16J 4IHXA 3I4MJ 5FGLA 3GTPJ 4BXXJ 2DMTA 3BR2A 4RBOA 3F0CA 3JRIA 3HOXJ 3BG3A 4AC0A 2LD5A 2NS8A 1ZR4A 1ETOA 4Y7NJ 1JKOC 2XB5A 3LNQA 1JT6A 2OF7A 5J1YA 2JJ7A 2Y0SN 2LFBA 5J1UA 1HCRA 3CRJA 5C3EJ 3QKXA 2O7OA 5CW8A 3ZQIA 1IGNA 3G1MA 2G0EA 3VVZA 4A3FJ 1MSFC 1A6IA 4IHVA 3W6VA 5D19A 5C44J 3HTJA 2Y2ZA 3CMYA 1JKQC 3QBMA 3SFIA 2R92J 5F0CA 5EGOA 3FIWA 1Y1WJ 2W48A 2VUMJ 3ANPA 2CQXA 1AU7A 1X58A 5GPCA 5IP9J 3F1BA 3RD3A 3BTJA 3C2BA 1XG1A 3PM1A 3RQIA 4IHWA 3LSPA 4EEFG 3GBGA 1G2HA 2ECBA 4MLOA 2NS7A 2H8RA 3G1LA 5F04A 2XSDC 1WCMJ 3RKQA 3TP3A 1TWAJ 1B72B 1ETVA 1D5YA 4X6AJ 1UG2A 3OOUA 3B81A 1TC3C 2DJNA 2JA8J 3K2AA 1H8AC 3VP5A 1GV5A 2NVTJ 5EG0B 1AHDP 2E2HJ 5EZHA 4DYCA 2DMNA 4JX4A 5DAJA 1HDPA 1OCTC 5IOZA 1OCPA 1NTCA 4BY7J 3V6GA 3VOXA 2EZIA 2YS9A 1IC8A 1O4XA 5FKMA 3HTHA 4A3JJ 2WV1A 3PASA 3HGGA 4QTRA 3BR0A 2DMPA 2IAIA 2NVQJ 2UXIA 1QRYA 3JRBA 5IP7J 4M6VA 3HOWJ 3WHCA 3KZ9A 4MIMA 5FKNA 1WI3A 1H89C 5HODA 2ME0A 1IDZA 3PO3J 3NNRA 2X48A 4V2FA 3NI7A 4NN1A 4DZJA 5E3NA 2CQQA 1RETA 2FBQA 4M3DA 5HBUA 4DYRA 3S1NJ 2XGEA 5GPAA 3V78A 1JJ6C 2F07A 1BL0A 2XPUA 3JRFA 3C07A 4C3IJ 2Y9ZA 4JKZA 3HTAA 3GTGJ 2LR8A 1IDYA 2GBYA 1MH3A 2VPRA 5M5XJ 4XRSA 3BTCA 3QPLA 4HNVA 3GTQJ 1JTYA 3G1OA 3ZQFA 3BT9A 4A3EJ 1ZK8A 3O8HA 3S17J 2YVEA 1VF9A 3IUVA 4FISA 3P9TA 1F36A 1K83J 2WAQN 4KWAA 3LSRA 3GZIA 4GCKA 5FKLA 3B6AA 1UI6A 3BQYA 3VUQA 1ORKA 1P7IA 3VW1A 5K7FA 3HB9A 2YVHA 2RAEA 3HOYJ 1W0TA 3GEUA 3NARA 4ABZA 3ZQHA 4BKXA 3VW2A 3IH4A 4BBRJ 2D6YA 2X9DA 3VVXA 4W97A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4V2G A;  3Q0V A;  1FIP A;  1JJ8 C;  5F0F A;  3QPS A;  4D7M A;  2E2J J;  4MFE A;  3HOV J;  3RZO J;  1WH5 A;  4GFK A;  3M3Y J;  1DU0 A;  1B8I A;  4L5E A;  3GTJ J;  1SGM A;  2M34 A;  1VFC A;  3WHB A;  3M4O J;  2L7M P;  2X6O A;  3BRU A;  2EZH A;  4MFD A;  9ANT A;  3TW6 A;  1EF4 A;  5CXG A;  1E3O C;  3L1P A;  5J1R A;  3BG5 A;  5M3M J;  3FK7 A;  4QIW N;  3GTO J;  5F08 A;  5IYD J;  5E3L A;  2UXO A;  1H88 C;  3GTL J;  2NP5 A;  5J3L A;  3BTI A;  5E3O A;  1MBJ A;  3JSJ A;  5D18 A;  1RKW A;  2EZK A;  2G7S A;  3HEF A;  2GEN A;  2L9R A;  3E7L A;  3S1R J;  4UUS A;  2TCT A;  1ETY A;  3JRH A;  5K7H A;  4MO7 A;  4M3B A;  3G56 A;  1JTX A;  5M5Y J;  2R0Q C;  4S0H B;  2LTP A;  5K58 A;  2G7G A;  4JL3 A;  3H0G J;  3A01 A;  2E2I J;  2QF7 A;  1LFU P;  2CUF A;  2Q24 A;  1AKH A;  1MH4 A;  3FRQ A;  2JA7 J;  1LE8 A;  1VND A;  2R5Y A;  1MBH A;  3HOU J;  4A3C J;  4AYB N;  3T6N A;  3VOK A;  5C4J J;  4FE7 A;  2HQ5 A;  1ZQ3 P;  2EQR A;  1P7J A;  2COB A;  3LJL A;  2LVS A;  4I76 A;  4DW6 A;  1B8I B;  5FKO A;  5FLV A;  5EZG A;  2DA6 A;  2MSY A;  3HIM A;  1Q1V A;  2G3B A;  2K40 A;  5FJ8 J;  4A3K J;  1QPI A;  1Z77 A;  2KDZ A;  2WB1 N;  3MN2 A;  4XID A;  2HOT A;  3ANG A;  1T33 A;  2E1O A;  1XS9 A;  3JRA A;  1SAN A;  3CDL A;  3VW0 A;  4AF5 A;  2OI8 A;  1MBG A;  2DN0 A;  3CWR A;  3JRE A;  4AUX A;  2R5Z A;  5M3F J;  1OFC X;  3S15 J;  1IG7 A;  3HDD A;  4ME9 A;  4MXM A;  1PUF A;  4G12 A;  3MVP A;  3KNW A;  2QKO A;  3EGQ A;  2ID3 A;  3TP0 A;  1LFB A;  5EGO B;  1UI5 A;  2HI3 A;  1ETW A;  4XK4 A;  3A01 B;  2CU7 A;  3G7R A;  4JNN A;  2JA6 J;  2UXU A;  2IU5 A;  4CGR A;  1U9O A;  1AKH B;  1A5J A;  3DEW A;  2FX0 A;  3FIS A;  2ZOZ A;  3VPR A;  2L7Z A;  1IRZ A;  2R7Z J;  2R5Y B;  1HOM A;  4RDU A;  2K9S A;  2ZCX A;  1BJZ A;  3KKD A;  3LHQ A;  4FE4 A;  3FK6 A;  2QOP A;  2LLK A;  4LOC A;  1X2M A;  3VVY A;  1FTT A;  1POG A;  3BQZ A;  4A69 C;  4D5C A;  4C2M J;  5FLM J;  4JP0 A;  5FKK A;  2HOS A;  1NK3 P;  4IEJ A;  2ELK A;  1BW5 A;  5F1J A;  5EF6 A;  4FCY A;  4A3L J;  1VI0 A;  2DMU A;  3HBL A;  1XC5 A;  2QWT A;  1SFO J;  5FHP A;  3RH2 A;  1Y1V J;  3BNI A;  2ZCN A;  3DCF A;  3NRG A;  2EZL A;  1R9T J;  3MNL A;  1ZKG A;  2UXP A;  2M0C A;  2FD5 A;  1JUS A;  4D5F A;  3HE0 A;  2QTQ A;  3GTM J;  3BTL A;  1TWF J;  1BA5 A;  4JX6 A;  1IUF A;  3H3V K;  4HKU A;  4FTH A;  2D5V A;  3PPB A;  4XRS G;  1WH7 A;  3O8G A;  2NVY J;  1W0U A;  3Q0W A;  2PBX A;  5JLW A;  2DA4 A;  2DTZ A;  1Z0X A;  1GV2 A;  1WPK A;  5IYC J;  2GUH A;  3AQS A;  3DPJ A;  2GM4 A;  2O8K A;  2LY9 A;  1RES A;  3SDG A;  1IV6 A;  2O9L A;  2TRT A;  2H1K A;  2NP3 A;  3Q0U A;  5EFY A;  1RPW A;  1JKR C;  4A3D J;  2CRG A;  3RZD J;  1ETX A;  2JWT A;  4UUT A;  1ETK A;  5BNG A;  3ON2 A;  1JUM A;  2DA1 A;  4M3E A;  1U78 A;  5FMP A;  2M8G X;  4CYC A;  3S1Q J;  1FJL A;  2VKE A;  3ZQL A;  4BY1 J;  3KKC A;  3BCG A;  3BR6 A;  2VKV A;  2YU9 J;  2ID6 A;  5EDN A;  2NX4 A;  1GT0 C;  4A3I J;  3IV5 A;  2GFN A;  3QQA A;  2MG4 A;  2L7F P;  3S2H J;  1ENH A;  1MSE C;  1I3Q J;  2W53 A;  1U9N A;  4GCL A;  2ZCM A;  4PXI A;  5IP6 A;  2QIB A;  2EBI A;  1ZGW A;  1IJW C;  1K61 A;  1B72 A;  2G7L A;  1FIA A;  4MK6 A;  5IYB J;  5C4Y A;  2XB0 X;  3LOC A;  2EH3 A;  2JMW A;  2L0K A;  1HF0 A;  5GP9 A;  3HGY A;  5EG0 A;  2M2E A;  2R93 J;  3NXC A;  1X2N A;  2O7T A;  2AO9 A;  2HOA A;  1FEX A;  1RKT A;  3S1M J;  4IHY A;  4C3H J;  4D7N A;  3JR9 A;  1S7E A;  2JK3 A;  4M3G A;  3JRG A;  3HOZ J;  3BR1 A;  4I6Z A;  3A02 A;  5F27 A;  5C4X J;  3UKG A;  2DA2 A;  2Y31 A;  3BR5 A;  1ZTR A;  1UMQ A;  1TWH J;  1F43 A;  2XGD A;  2K9N A;  5DS9 A;  2KT0 A;  4CYC B;  1JKP C;  2JA5 J;  2XPV A;  3TW7 A;  3LSG A;  2LP0 A;  1QVT A;  2REK A;  2JN6 A;  4ICH A;  2HXI A;  5EYR A;  3TED A;  2Y30 A;  4XIC A;  1APL C;  5AQC A;  1RR7 A;  3A03 A;  2MW8 A;  2WGB A;  1I50 J;  5IOY A;  5K7Z A;  3IH3 A;  4UUS B;  3LWJ A;  2IBD A;  3FKI J;  4GFL A;  1JUP A;  5CXI A;  1OJL A;  3VIB A;  2DA3 A;  2K9Q A;  2GLO A;  2HYJ A;  2VI6 A;  3NPI A;  3IH2 A;  4B3A A;  1GDT A;  5HAW A;  1YRN A;  2AHQ A;  3BG9 A;  3SJM A;  3JRC A;  1MNM C;  1TWG J;  4B4C A;  2XGC A;  2HKU A;  2NVX J;  2NOG A;  2I10 A;  2ZOY A;  3BJB A;  3CJD A;  2M9H A;  4AC6 A;  3OSG A;  1U8B A;  2XPW A;  1LE8 B;  2CJJ A;  3GTK J;  3JRD A;  2MGQ A;  3ZQG A;  4GFB A;  3PO2 J;  4J19 A;  1GUU A;  1MBE A;  2E19 A;  2HDD A;  4W1U A;  3HKZ N;  4DYQ A;  3AQT A;  2N8G A;  4A3M J;  1FTZ A;  4YZE A;  3Q3S A;  1JT0 A;  2ZB9 A;  3NAU A;  2PZ9 A;  3K7A J;  3ZOB A;  5H9T A;  5DTD A;  2RHA A;  4XRM A;  1QVU A;  2DA7 A;  2LK2 A;  2DG8 A;  4L62 A;  4BBS J;  2HYT A;  3HTI A;  3E7Q A;  1TWC J;  2OPT A;  3S2D J;  2R5Z B;  2RAS A;  2XDN A;  2UXH A;  1HDD C;  2YUS A;  4UDS A;  1PUF B;  5D1R A;  2B63 J;  3ON4 A;  2LKX A;  5HSZ A;  1NK2 P;  4GCT A;  1YRN B;  2XRL A;  2ECC A;  4M3F A;  5M5W J;  1JGG A;  2QCO A;  4X1E A;  3D1N I;  2DG7 A;  1DU6 A;  1GVD A;  3S14 J;  3B6C A;  4ACI A;  3CCY A;  3MKL A;  2ME6 A;  2WUI A;  1MBK A;  1BW6 A;  3S5R A;  2IEK A;  5E3M A;  5IPA A;  2PMZ N;  4JYK A;  3COL A;  3BR3 A;  5JLX A;  1UHS A;  4Y52 J;  4B1R A;  4NDL A;  2DA5 A;  2HXO A;  3OIO A;  3HM5 A;  4A93 J;  1T56 A;  1HLV A;  3OSF A;  2OER A;  1CQT A;  1WGX A;  2CUE A;  2FQ4 A;  4QSH A;  4C3J J;  3I4N J;  3LSJ A;  5F0H A;  2P81 A;  4DZP A;  4JX5 A;  1I6H J;  3CQZ J;  3O60 A;  4NEL A;  4A3G J;  1ETQ A;  1MBF A;  2V57 A;  1ZR2 A;  4A3B J;  3ZQC A;  2DMQ A;  3EUP A;  1ITY A;  2Y9Y A;  3BHQ A;  5EEA A;  2FJ1 A;  3S16 J;  4IHX A;  3I4M J;  5FGL A;  3GTP J;  4BXX J;  2DMT A;  3BR2 A;  4RBO A;  3F0C A;  3JRI A;  3HOX J;  3BG3 A;  4AC0 A;  2LD5 A;  2NS8 A;  1ZR4 A;  1ETO A;  4Y7N J;  1JKO C;  2XB5 A;  3LNQ A;  1JT6 A;  2OF7 A;  5J1Y A;  2JJ7 A;  2Y0S N;  2LFB A;  5J1U A;  1HCR A;  3CRJ A;  5C3E J;  3QKX A;  2O7O A;  5CW8 A;  3ZQI A;  1IGN A;  3G1M A;  2G0E A;  3VVZ A;  4A3F J;  1MSF C;  1A6I A;  4IHV A;  3W6V A;  5D19 A;  5C44 J;  3HTJ A;  2Y2Z A;  3CMY A;  1JKQ C;  3QBM A;  3SFI A;  2R92 J;  5F0C A;  5EGO A;  3FIW A;  1Y1W J;  2W48 A;  2VUM J;  3ANP A;  2CQX A;  1AU7 A;  1X58 A;  5GPC A;  5IP9 J;  3F1B A;  3RD3 A;  3BTJ A;  3C2B A;  1XG1 A;  3PM1 A;  3RQI A;  4IHW A;  3LSP A;  4EEF G;  3GBG A;  1G2H A;  2ECB A;  4MLO A;  2NS7 A;  2H8R A;  3G1L A;  5F04 A;  2XSD C;  1WCM J;  3RKQ A;  3TP3 A;  1TWA J;  1B72 B;  1ETV A;  1D5Y A;  4X6A J;  1UG2 A;  3OOU A;  3B81 A;  1TC3 C;  2DJN A;  2JA8 J;  3K2A A;  1H8A C;  3VP5 A;  1GV5 A;  2NVT J;  5EG0 B;  1AHD P;  2E2H J;  5EZH A;  4DYC A;  2DMN A;  4JX4 A;  5DAJ A;  1HDP A;  1OCT C;  5IOZ A;  1OCP A;  1NTC A;  4BY7 J;  3V6G A;  3VOX A;  2EZI A;  2YS9 A;  1IC8 A;  1O4X A;  5FKM A;  3HTH A;  4A3J J;  2WV1 A;  3PAS A;  3HGG A;  4QTR A;  3BR0 A;  2DMP A;  2IAI A;  2NVQ J;  2UXI A;  1QRY A;  3JRB A;  5IP7 J;  4M6V A;  3HOW J;  3WHC A;  3KZ9 A;  4MIM A;  5FKN A;  1WI3 A;  1H89 C;  5HOD A;  2ME0 A;  1IDZ A;  3PO3 J;  3NNR A;  2X48 A;  4V2F A;  3NI7 A;  4NN1 A;  4DZJ A;  5E3N A;  2CQQ A;  1RET A;  2FBQ A;  4M3D A;  5HBU A;  4DYR A;  3S1N J;  2XGE A;  5GPA A;  3V78 A;  1JJ6 C;  2F07 A;  1BL0 A;  2XPU A;  3JRF A;  3C07 A;  4C3I J;  2Y9Z A;  4JKZ A;  3HTA A;  3GTG J;  2LR8 A;  1IDY A;  2GBY A;  1MH3 A;  2VPR A;  5M5X J;  4XRS A;  3BTC A;  3QPL A;  4HNV A;  3GTQ J;  1JTY A;  3G1O A;  3ZQF A;  3BT9 A;  4A3E J;  1ZK8 A;  3O8H A;  3S17 J;  2YVE A;  1VF9 A;  3IUV A;  4FIS A;  3P9T A;  1F36 A;  1K83 J;  2WAQ N;  4KWA A;  3LSR A;  3GZI A;  4GCK A;  5FKL A;  3B6A A;  1UI6 A;  3BQY A;  3VUQ A;  1ORK A;  1P7I A;  3VW1 A;  5K7F A;  3HB9 A;  2YVH A;  2RAE A;  3HOY J;  1W0T A;  3GEU A;  3NAR A;  4ABZ A;  3ZQH A;  4BKX A;  3VW2 A;  3IH4 A;  4BBR J;  2D6Y A;  2X9D A;  3VVX A;  4W97 A; 
#chains in the Genus database with same CATH topology
 5IT9 K;  3Q0V A;  2GXG A;  1RUO A;  4NUB A;  4HNT A;  3GO5 A;  3RJP A;  4MFE A;  3HOV J;  2CFO A;  2EJR A;  3KP6 A;  2M30 A;  2Z1D A;  1UST A;  3S3O A;  3PL8 A;  2W82 A;  2NNY A;  1MKM A;  2D1V A;  2L7M P;  2X6O A;  1VFC A;  3M4O J;  1XPX A;  3VSL A;  5LEK A;  2WY7 Q;  3UNG C;  2FUG 2;  4P55 A;  1TL8 A;  4ZYE A;  5JVT A;  1VQN I;  5CVI A;  3DF8 A;  5M3M J;  1VQL I;  5F08 A;  1WRJ A;  2NOJ B;  5E18 F;  5IYD J;  1H88 C;  5J3L A;  2DOD A;  5E3O A;  3JSJ A;  4HF0 A;  1N78 A;  3EQL F;  4ESJ A;  2O5R A;  3ZR8 X;  3JRH A;  1BR2 A;  1JTX A;  4WX9 A;  2HQN A;  3G4S I;  1J7K A;  2FEZ A;  2Q1Z B;  4U9N A;  1D8K A;  4LB5 A;  2UUZ A;  4JL3 A;  2WY8 Q;  3DKY A;  3GXO A;  3MCZ A;  2GXA A;  2VXD A;  2V9K A;  4XOT A;  4NQW A;  1LFU P;  4RB1 A;  4IZZ A;  1XD7 A;  1X1P A;  3VOK A;  4JOM A;  5KNL A;  1X4P A;  5AIP A;  5C4J J;  1J09 A;  2COB A;  3JW4 A;  3LJL A;  4KIC A;  1P4W A;  4I76 A;  4OU0 A;  1B8I B;  5FLV A;  2DA6 A;  2CUZ A;  4IRI A;  2MSY A;  1F1Z A;  3HIM A;  2RQP A;  5D4R A;  1VQK I;  4C2T A;  4CA0 A;  2V1D A;  4M74 A;  3WOD F;  5FJ8 J;  1BI1 A;  2H6C A;  5HOO A;  4AIJ A;  4RB0 A;  1XS9 A;  1E3P A;  3AG1 H;  1YIO A;  1SAN A;  2XRN A;  3DP7 A;  4AF5 A;  5CJ9 A;  1BIB A;  1ONV A;  3OYC A;  5HLI A;  3DPU A;  1K7A A;  4CCN A;  2R5Z A;  4HDV A;  4LJZ F;  3S15 J;  4PZJ A;  1IG7 A;  4MXM A;  3VSK A;  1Z9C A;  1REP C;  4R8H A;  4UVC A;  2L4M A;  4BXU A;  1PUF A;  1SAU A;  3QOP A;  2VBX A;  5EEG A;  1FZP B;  2L2O A;  2WAE A;  3AAF A;  1LFB A;  1D3Y A;  3PQJ A;  4XK4 A;  1W1W E;  5D4S A;  3JAM Z;  2IGN A;  2IU5 A;  4CGR A;  1AKH B;  1A5J A;  3EUH C;  4XNF A;  4PSW A;  2R5Y B;  1HOM A;  5DCM A;  2PMH A;  3CUQ A;  4RDU A;  3OYL A;  4FX4 A;  3KKD A;  4C9Y A;  1ULY A;  4JQF A;  2QOP A;  5TGT A;  1X2M A;  5L3G A;  1TW2 A;  1DP3 A;  4D5C A;  4A69 C;  4RAY A;  4WXC A;  3SEZ A;  1IRX A;  2BHZ A;  1P2F A;  2IVM A;  2V1U A;  2CS3 A;  2VE8 A;  3E6D A;  4IEJ A;  2QSF X;  1V54 H;  3IAS 2;  5EF6 A;  1FSH A;  2RDP A;  2KJB A;  5KHD A;  5FHP A;  3BNI A;  2ZCN A;  1MMS A;  3AG2 H;  4DQ2 A;  1ZKG A;  1ODD A;  4S04 A;  2UXP A;  2M0C A;  1JUS A;  4ESB A;  5DD8 A;  2F4O B;  2QTQ A;  4DGW B;  2V7F A;  3RQ4 A;  3GFI A;  4UB6 C;  3CTA A;  2NVY J;  2PBX A;  1MZB A;  3DPJ A;  5IYC J;  1Z0X A;  1GV2 A;  2VKH A;  4WXH A;  1WWX A;  1RES A;  4F93 B;  2PN6 A;  2W85 A;  2TRT A;  5B5E C;  3GWZ A;  3OYN A;  1RPW A;  2VN2 A;  4UUT A;  3ON2 A;  2A5Y B;  4G94 A;  4EM2 A;  2V9P A;  5FB2 A;  3FMS A;  1FJL A;  1KA8 A;  2X85 A;  4BY1 J;  2BBY A;  3BCG A;  2O6G E;  2YU9 J;  1B9M A;  1K79 A;  2L7K A;  3OIP A;  2NX4 A;  2ZXH A;  2CGP A;  2Z16 A;  1VQ9 I;  5H6R A;  4BDY A;  2B9S A;  2GFN A;  5FLX K;  2VJ4 A;  3S2H J;  3K9T A;  1K4T A;  3VYU B;  4BUP A;  2VJ5 A;  4GCL A;  3J7A Y;  2QIB A;  1ZGW A;  3L7W A;  5E1X A;  5D8L B;  3CMM A;  4Z6Y A;  3MFK A;  2P7V B;  3V8K A;  2UXN A;  2EH3 A;  2JMW A;  2WB1 A;  3GF2 A;  2IS2 A;  3HOT A;  1Y39 A;  1O3Q A;  2R7F A;  3J7A O;  3OYK A;  2DK8 A;  2DFH A;  1UAA A;  1FSE A;  1YX3 A;  4G6Q A;  4RGR A;  3N05 A;  2K27 A;  1BJA A;  2DYR H;  3R6S A;  1WFX A;  4J01 A;  1S29 A;  1YJ9 I;  1D1B A;  2IRF G;  3HOZ J;  3OYH A;  3OYE A;  3BR1 A;  5F27 A;  1IV8 A;  3GFM A;  1ZGA A;  4HST A;  4I98 B;  5C4X J;  3IRQ A;  1S3J A;  5FFX A;  3AL0 C;  4PFP A;  1YE9 A;  4E7Z A;  5DS9 A;  4U0Y A;  2O0Y A;  4WK8 F;  1ZRE A;  2KLO A;  2Q0O A;  2B3W A;  2XPV A;  2FQ3 A;  4UUV A;  2FNA A;  3GUD A;  4L9V A;  4LLN A;  1QU3 A;  2HPM A;  2JN6 A;  3REO A;  3M8F A;  5EYR A;  2Y30 A;  1XX5 A;  1XGO A;  1Y6I A;  1R00 A;  2HYG D;  1APL C;  3CCR I;  2WA0 A;  2OC6 A;  3M07 A;  5DV5 A;  5GTI C;  1Q1H A;  3DXJ F;  1FT9 A;  5K7Z A;  1JXS A;  4BE0 A;  2CV2 A;  4KFC A;  4XKC A;  2IBD A;  2DFE A;  2LKP A;  1QO0 D;  1OJL A;  3GEZ A;  2GLO A;  2K9Q A;  2ICW G;  1GDT A;  5HDN A;  1H9G A;  1BM9 A;  2V26 A;  5JI6 A;  4UV8 A;  1MNM C;  4B4C A;  3EUH A;  2NOG A;  2ZOY A;  5B3S H;  2CFX A;  4A12 A;  5BPD A;  3GTK J;  4Y17 A;  1R5H A;  3KFW X;  4GYG A;  1Z1D A;  1GUU A;  2E19 A;  1R5G A;  3HKZ N;  1MJA A;  3OL4 A;  4KYW A;  3PIO F;  2HVQ A;  5B1A H;  2O8X A;  3Q3S A;  2HVR A;  3LA3 A;  3NWS A;  3GCM A;  3OMY A;  4I02 A;  2PZ9 A;  2XAH A;  3SZT A;  2J5P A;  3T8R A;  1USS A;  5J40 A;  2IGO A;  1U2W A;  1KU7 A;  1QPM A;  5LEJ A;  4I09 A;  3WTW C;  2LK2 A;  1YYV A;  2DG8 A;  2HR3 A;  2F6C A;  4XKV A;  4E7S A;  2HYT A;  3ELK A;  4ZYH A;  3CJQ B;  4LG0 B;  1RNL A;  3LWF A;  2YUS A;  4UDS A;  5D1R A;  3KP5 A;  3CC7 I;  2BY3 A;  3ZMD A;  1N77 A;  1YRN B;  2OJE D;  3K1P A;  2ZJP F;  4KA4 A;  2QCO A;  2FXA A;  1LVK A;  2PEX A;  3TDZ C;  3MKL A;  3QP6 A;  2WUI A;  2IEK A;  3I64 A;  5E3M A;  2R7R A;  3FDY A;  3BR3 A;  2DXI A;  4XLP F;  5FRO A;  3COL A;  4Y52 J;  2LRE A;  3PUB A;  1ZAR A;  2DA5 A;  4AU7 A;  5L3B A;  3OIO A;  4AIK A;  1QNT A;  4A6E A;  4XQF A;  2BV6 A;  2E34 A;  2QLZ A;  3FMR A;  3K4L A;  1JHF A;  1G3S A;  1WGX A;  2A6T A;  2CUE A;  5D5X B;  3WTX C;  3HRU A;  3WTT C;  4JX5 A;  1YIT I;  5ERI A;  3LQQ A;  1LKX A;  1MBF A;  4BJ5 C;  2WAF A;  4P1W A;  4CIC A;  2I8D A;  2LSO A;  4RM2 A;  1G3Y A;  2X1E A;  3DPT A;  4UV9 A;  3M9A A;  1OQY A;  1T0F C;  4PCQ A;  3ZN1 A;  1ITY A;  3DV8 A;  2K02 A;  5DM7 F;  1DDN A;  5BS6 A;  4LFU A;  5EEA A;  4HX7 A;  4I99 C;  3K0L A;  3S16 J;  3SEQ A;  4BHC A;  2YPR A;  2V1X A;  3HOX J;  1VQO I;  3BG3 A;  1NG7 A;  2LD5 A;  2PJR B;  1ETO A;  3ZQQ A;  1FOY A;  4Y7N J;  3G71 I;  2IPQ X;  2JJ7 A;  1A6Q A;  3ISP A;  4XBF A;  1R4M B;  2CUJ A;  3SHF A;  1JE8 A;  3CRJ A;  4F91 B;  5C3E J;  2O7O A;  1QHG A;  4LK0 F;  2QYO A;  1IRG A;  1YTY A;  2HFH A;  3ZMS A;  1G59 A;  1ZG3 A;  3HTS B;  1SD4 A;  3PNY A;  2EV6 A;  2P4W A;  2R92 J;  2P5L C;  1TQP A;  2W48 A;  4IRV A;  1KYW A;  2Q2E A;  3KX2 A;  3BCB A;  5IP9 J;  3RD3 A;  4O5V A;  2MH2 A;  1G2H A;  2GWR A;  2NS7 A;  2IS6 A;  3G1L A;  2DOF A;  3TO9 A;  3BLY A;  2P6T A;  4RMN A;  1MJ9 A;  3K70 D;  5LBQ A;  5HS8 A;  2L3D A;  4EM1 A;  1ETV A;  2XAQ A;  4Y13 A;  4BJT A;  4E6K G;  3CCV I;  3HTU A;  2NVT J;  1AHD P;  1TP4 A;  1D0X A;  1BOA A;  5EZH A;  3T5X A;  2X4H A;  1OCT C;  1D0Z A;  3HUG B;  1NTC A;  1ON1 A;  2K4B A;  3TQN A;  5F1R A;  4BY7 J;  3V6G A;  2ZC2 A;  3LSH A;  4I2O A;  3FXJ A;  1O4X A;  2NXN B;  3CES A;  4A3J J;  2WV1 A;  2X6Y A;  4BE1 A;  3PAS A;  5L3D A;  3HGG A;  3W3C A;  4QTR A;  4BH9 A;  1KU2 A;  3U1D A;  1WJE A;  4F3Q A;  2TDX A;  2DMP A;  3D5L A;  2UXI A;  1TQI A;  1QRY A;  1Y8Q B;  2YSR A;  1FP2 A;  4MGR A;  1M1E B;  4OD4 A;  1WI3 A;  3H9G A;  1SAX A;  2XKP A;  2COM A;  3SDB A;  4WCG A;  2ME0 A;  2VQH A;  2QQB A;  3PO3 J;  3I53 A;  5CKT A;  3LQR A;  1R6R A;  3CCQ I;  2X48 A;  5JHU A;  1SEU A;  5E3N A;  4DBR A;  2CQQ A;  3QYE A;  1P9Q C;  3TGN A;  3OS2 A;  1G4D A;  1YI2 I;  2VLA A;  2V4J C;  3A0B C;  1TNS A;  2QKM B;  3CJT B;  5HVQ C;  3C07 A;  3I58 A;  2EIK H;  1ZEL A;  2PX9 A;  4C3I J;  3TKY A;  4JKZ A;  3H9J A;  3GTG J;  3OYD A;  1MH3 A;  2VPR A;  3FXR A;  2DCE A;  2F5E A;  3ZQF A;  3E5U A;  3KYC B;  1R4N B;  1O3R A;  3O8H A;  1VF9 A;  3C1D A;  1F36 A;  1K83 J;  1YQA A;  2HYF A;  1IAW A;  1XSV A;  1NHA A;  5TIS C;  3MD2 A;  4GCK A;  4RLF A;  3B6A A;  1U5T B;  3OYB A;  1ORK A;  2DDA A;  3VW1 A;  1J5Y A;  5K7F A;  1CF7 A;  2VON A;  5IT9 Z;  2FE3 A;  1W36 D;  3S3N A;  3GX4 X;  2BHY A;  2CO5 A;  1W0T A;  2AXT C;  4ABZ A;  4DBQ A;  3QAH A;  1XCB A;  2OU2 A;  3VW2 A;  4BBR J;  1R71 A;  3WG7 H;  1WQ2 A;  1J2X A;  3LFK A;  4V2G A;  4W97 A;  1T0F A;  2F48 A;  4UXN A;  1YOV B;  3VVX A;  4P9F A;  2LF8 A;  1YIJ I;  5LFA A;  1WH5 A;  1DU0 A;  4QPQ A;  1G6N A;  3W2V A;  1VQM I;  3GTJ J;  2JRM A;  1SGM A;  3WHB A;  3BRU A;  1D1C A;  3K1N A;  4XR6 A;  1SFU A;  1J59 A;  1WJF A;  9ANT A;  1EF4 A;  2KZV A;  1E3O C;  3L1P A;  4O6J A;  4QIW N;  2UXO A;  1T39 A;  4BQA A;  4AYB A;  2VC1 A;  2NP5 A;  3SWH A;  4HEA 2;  5D18 A;  1RKW A;  4FET A;  2QSG X;  4ZDP A;  2BW3 A;  4Q47 A;  2GEN A;  3F9K A;  3S1R J;  1ETY A;  2IS4 A;  5K7H A;  5M5Y J;  3BJO A;  4IOA F;  2LTP A;  2E7X A;  1VTN C;  4CGZ A;  3FXM A;  4C2M A;  4PSX A;  1Z3Y A;  1BOB A;  3A01 A;  3K70 C;  2QF7 A;  1UHM A;  2DU9 A;  2H1L A;  3KP2 A;  4BDZ A;  4BQO A;  4IX7 A;  4MQV A;  1ZGJ A;  2DW4 A;  1XN7 A;  2W7N A;  4IRH A;  2JA7 J;  1MBH A;  3HOU J;  1SMY F;  3T6N A;  2MC3 A;  4OOI A;  2EV5 A;  2OTJ I;  1MD0 A;  3OOP A;  5J4V A;  5FKO A;  1VQ5 I;  3H0D A;  5EZG A;  3T0Y A;  2BY0 A;  3G2B A;  4GGG A;  1J75 A;  3PSI A;  5TJJ A;  1LB2 A;  4MTE A;  1FMV A;  2CQN A;  2K40 A;  2W24 A;  3ERM A;  4D9J A;  2FBH A;  3ECH A;  1Z77 A;  3CZ6 A;  2WB1 N;  3V42 A;  3CDI A;  4BHB A;  2X0L A;  3HJE A;  4XID A;  2E1O A;  2A5W A;  3V7S A;  3JRA A;  1BBY A;  2ESH A;  3CDL A;  1MBG A;  2DN0 A;  1IZ1 A;  3CWR A;  2LC2 A;  3C2G A;  4AVZ A;  4CZZ A;  2PFV A;  4ENN A;  2VJI A;  3ZQ7 A;  4ME9 A;  2A3S A;  2BXY A;  3U21 A;  4ESF A;  1GXP A;  2QKO A;  4ZZL A;  1Z67 A;  3K4C A;  1FBU A;  3EGQ A;  5F6F A;  2X1D A;  3FBN B;  4XSX F;  5EGO B;  1UI5 A;  5GTH C;  1ETW A;  3HHH A;  5D6E A;  1OLT A;  4JNN A;  2MC4 A;  2B0L A;  3KP4 A;  4EV0 A;  2AS5 F;  4P5O A;  4KT6 A;  3DEW A;  2F4I A;  2FX0 A;  2VKD A;  3FIS A;  4N4N B;  3F22 A;  2WAQ A;  2XAU A;  1IRZ A;  1RC9 A;  1YW8 A;  4UHT A;  2M87 A;  1PP8 F;  1ZG1 A;  2QGU A;  2K9S A;  4II2 A;  1BJZ A;  2W25 A;  4HLX A;  3ZP5 A;  3ERE D;  5CPR B;  3FK6 A;  3O6B B;  3QPT A;  2E35 A;  1FTT A;  1U5T C;  2JTV A;  2PBI A;  2ZJR F;  5FLM J;  2XHK A;  4G6T B;  3K6G A;  5DDG A;  3H1C A;  1UJ8 A;  2HOS A;  1GVJ A;  1NK3 P;  1G3T A;  4HA8 A;  4YFX F;  5F1J A;  3HBL A;  1XC5 A;  4BNC A;  2CSO A;  2V79 A;  4HV5 A;  3L09 A;  3DCF A;  4Y15 A;  1R9T J;  1FBQ A;  2FD5 A;  3CP2 A;  1V5G A;  2VBY A;  1TWF J;  1BI0 A;  4PJN A;  2LRD A;  3J80 Z;  5L3C A;  2D5V A;  3KPH A;  1FWZ A;  1YW9 A;  3SQN A;  5JLW A;  3N4M A;  2DA4 A;  2GUH A;  2RGV A;  1WPK A;  3MEX A;  3ML6 A;  4BL0 B;  1U8R A;  3AQS A;  3CCE I;  2LY9 A;  3GZN B;  3LA7 A;  4OIN F;  3I71 A;  2K3P A;  2EFQ A;  3WTY C;  3IAM 2;  3ZMT A;  4ZYD A;  5EFY A;  3X2Q H;  4A3D J;  3JSO A;  2CRG A;  2EFW A;  1YHQ I;  4WIB A;  3OWT A;  5FMP A;  1U78 A;  1IN7 A;  5GAD J;  4CYC A;  3S1Q J;  4Q5S F;  1VQ8 I;  5KAI C;  2JUC A;  3RDI A;  4E7I A;  5EDN A;  3SXY A;  1YG2 A;  3PNT A;  4C30 A;  1TLH B;  1R7J A;  1WHU A;  1AWC A;  1GHC A;  2RRE A;  2MG4 A;  3LAP A;  2L7F P;  1ENH A;  4MNU A;  1F5T A;  2LH9 A;  2DDB A;  2MA3 A;  4PXI A;  2W00 A;  5IP6 A;  4MHG A;  5GAE J;  5K5O A;  2VT2 A;  2MAB A;  3HSR A;  1K61 A;  2STT A;  2P7C B;  1FIA A;  5BMZ A;  5IYB J;  1YS7 A;  1HXD A;  3LOC A;  4NHJ A;  1XDS A;  4U9L A;  1HF0 A;  5CVU A;  2M7A A;  4ANJ A;  3KLO A;  3OL3 A;  3NXC A;  3ZXS A;  3CP8 A;  3BG6 A;  2AO9 A;  1FEX A;  1RKT A;  1X1D A;  1O57 A;  4A5N A;  3S1M J;  1X1C A;  3HUG A;  2KIU A;  2P6S A;  4M3G A;  3MKZ A;  3JRG A;  2UWM A;  1OKR A;  1Y0N A;  2M1B A;  4GXO A;  5FD6 A;  4XL9 A;  3F72 A;  3CCS I;  2XDV A;  1I3A A;  1ZTR A;  3M8J A;  2XGD A;  2ACJ A;  2K9N A;  3OS0 A;  5J8C A;  5DEQ A;  5D5W B;  3LSG A;  1OCZ H;  3RKW A;  1QVT A;  2OV7 A;  2YX4 A;  3PUF A;  2L02 A;  2CW7 A;  5JVG F;  4EJU A;  3HXL A;  4LK1 F;  1WZ2 A;  3I3L A;  2WGB A;  1I50 J;  5IOY A;  4HQE A;  3IH3 A;  1IN5 A;  1BN5 A;  2R7W A;  3FKI J;  1JUP A;  1TQM A;  4U0V A;  1ON2 A;  4OWR B;  3VIB A;  4CH7 A;  3H35 A;  3DTE A;  1JGS A;  4HX4 A;  4LIT A;  2D2W A;  2BYV E;  2XGC A;  5LGU A;  2OUM A;  3ESW B;  3F8N A;  3LAJ A;  5KAF C;  4WXD A;  4KMF A;  2M9H A;  1O3T A;  2CMP A;  3HPG A;  5E8I A;  3DKX A;  1XDU A;  2DPU A;  4AC6 A;  2XPW A;  1B1B A;  5LHH A;  3MZY A;  1LE8 B;  2ZNY A;  4YII A;  3TDU C;  2MGQ A;  4LD5 A;  5LGT A;  3BRO A;  4BHP A;  2DOA A;  1U5T A;  5J47 A;  2OTL I;  5CLS A;  3KYD B;  3OYJ A;  4CCO A;  1RZ4 A;  3A2K A;  3DBL B;  3AQT A;  2N8G A;  2WV0 A;  1XGM A;  4G8X A;  4EJW A;  3WTU C;  4B8X A;  1JT0 A;  4F52 A;  2NVU B;  3K7A J;  1Z6R A;  3ZOB A;  4KDP A;  2XAF A;  1X3W B;  2M45 A;  1LNW A;  3IP4 B;  2IGK A;  4FHT A;  4FAS D;  4L62 A;  3RPU D;  4BBS J;  3E7Q A;  1TWC J;  3HG9 A;  3S2D J;  1KU3 A;  4A0Z A;  2XDN A;  2QKL B;  3ECO A;  1HDD C;  3BDD A;  1MMN A;  1X1A A;  2B63 J;  3FHZ A;  5HSZ A;  4M3F A;  3IL2 A;  2ZFW A;  2Z99 A;  5M5W J;  4OMY A;  4KN4 X;  4B09 A;  4BAC A;  3BG7 A;  1MDM A;  1DU6 A;  4KIG A;  2CYY A;  2EIJ H;  2JVG A;  3DFG A;  1TW3 A;  2ZXJ A;  1ZG5 A;  1I27 A;  3TO7 A;  2NS0 A;  1K6Y A;  2PG4 A;  2AXL A;  1R1T A;  1G8X A;  3M7G A;  4L9J A;  5ILV A;  3L2V A;  2VOP A;  4E7K A;  4A93 J;  1T56 A;  5E8G A;  1SD7 A;  4L18 B;  1FC3 A;  3I4N J;  2W4S A;  4C3J J;  1T8I A;  3D0S A;  1O7L A;  2BE5 F;  3LSJ A;  3R0A A;  4DZP A;  2P0W A;  4NEL A;  2EB7 A;  3RKX A;  4DJA A;  1IW7 F;  1ZR2 A;  4A3B J;  4HF1 A;  3G3Z A;  4CHU A;  1ZLK A;  2HVS A;  2WC2 A;  5HS7 A;  2KRC A;  3WTZ A;  3MAJ A;  3K4J A;  2LDU A;  2DI3 A;  3I4M J;  2G7U A;  4QWQ A;  2VC0 A;  1A31 A;  2B7E A;  4BXX J;  3BZ6 A;  5LGN A;  1W4M A;  4N4O B;  3JRI A;  1KYZ A;  1EA3 A;  1SVM A;  4H4K C;  2NS8 A;  3M1E A;  1JKO C;  4NNJ A;  2OF7 A;  1W7P B;  3EUA A;  4FQG A;  5J1U A;  1HCR A;  2ESN A;  2R3S A;  3R0J A;  3ZCO A;  5CW8 A;  4E4H A;  2FBK A;  5GAG J;  3BCA A;  2VL8 A;  3W6J B;  3VVZ A;  2VE9 A;  2XAJ A;  1A6I A;  1MSF C;  2DT7 B;  5C44 J;  3HTJ A;  5HNF A;  3CMY A;  3QBM A;  3SFI A;  4P9U A;  1R23 A;  5EGO A;  1Y1W J;  2ZME B;  3L2Q A;  3I59 A;  3IHU A;  2VIX A;  3LSM A;  3I5U A;  3C2B A;  1XG1 A;  3P5J A;  4IHW A;  3LSP A;  3JTG A;  3IC7 A;  3LL7 A;  2BY2 A;  4CCM A;  2H8R A;  4G6D A;  3CF2 A;  2DAO A;  2Z9O A;  1XMX A;  2DPD A;  2DT5 A;  2XSD C;  1WCM J;  4IPA A;  2HTJ A;  3TP3 A;  2XAG A;  3MKY B;  1DQU A;  1B72 B;  2Q8K A;  3VOE A;  2XF5 A;  2OQR A;  3OOU A;  4ZYG A;  3HOS A;  1D5Y A;  2GA2 A;  2V6C A;  4B48 A;  2HZT A;  3R4K A;  2E36 A;  5LD2 C;  1GV5 A;  3E1S A;  5EG0 B;  1H0M A;  4GDF A;  2R7D A;  2E2H J;  2R7V A;  2Y48 A;  2VXZ A;  2DMN A;  4JX4 A;  4DYC A;  1KQ0 A;  1LPQ A;  1MW7 A;  5DAJ A;  1HDP A;  2K3F A;  3S3M A;  1B4A A;  4LGW A;  2QWW A;  2ZXW H;  2LBF B;  3VOX A;  2EZI A;  2YS9 A;  1IC8 A;  3B73 A;  1X3Z B;  3HTH A;  2ISY A;  5FRN A;  1L0O C;  3Q9S A;  3ZMZ A;  2DOE A;  4HG2 A;  1J0R A;  4ENM A;  5F64 A;  1YX5 A;  3N97 A;  4M6V A;  3KZ9 A;  4MIM A;  1JHH A;  2BGC A;  2KIF A;  4XRF A;  2JPB A;  3NNR A;  1Z7L A;  5J6X A;  2XC7 A;  1GXQ A;  4V2F A;  4B47 A;  3JAM K;  3CO7 C;  4NN1 A;  2FBQ A;  1B6A A;  3DTK A;  3H36 A;  4EGZ A;  4DNC A;  1ERD A;  2XGE A;  4YRV A;  2LKS A;  3V78 A;  1PP7 U;  4OD5 A;  1WSU A;  2YVX A;  3D5R C;  1MMD A;  3GME A;  1XB4 A;  2GIV A;  2HPI A;  2CG4 A;  1IDY A;  2GBY A;  1P92 A;  2Z33 A;  1OMI A;  2QZ8 A;  4PGH A;  2M4K A;  3BTC A;  3QPL A;  1PJR A;  3GTQ J;  1BR4 A;  1VQ4 I;  1R5I D;  3HSF A;  2JQ7 A;  1J9I A;  3IUV A;  2QUF A;  2WAQ N;  5A2Q Z;  1WJ5 A;  2MD5 A;  2K9M A;  4YG2 F;  4KWA A;  5B66 C;  1Z05 A;  3FBI B;  3J7Y J;  3GZI A;  2A2F X;  4XLE A;  5FKL A;  3CCU I;  4L9N A;  1P7I A;  2E71 A;  1SD6 A;  3K2Z A;  4KNY A;  2RAE A;  5K5Q A;  4F7Z A;  4YEJ A;  3J81 Z;  1VQP I;  4V19 K;  3F6O A;  3V8L A;  2X9D A;  1N25 A;  4BU2 A;  3T8T A;  3E5X A;  4HX8 A;  1ZYR F;  1SFE A;  4GRI A;  1YJN I;  2RVC A;  3QYF A;  3MWM A;  5F0F A;  3QPS A;  3C3W A;  3WGG A;  4CYD A;  4D7M A;  2E2J J;  2DTR A;  3ZPL A;  3RZO J;  3ONQ A;  1B8I A;  2FMY A;  2CH0 A;  1FYK A;  1FOK A;  1V55 H;  4CSW A;  4HRI A;  1IO2 A;  2HS5 A;  2EZH A;  4MFD A;  1E0E A;  5DUK A;  2M4G A;  4Q48 A;  3TW6 A;  1K4S A;  5CXG A;  2BOL A;  2VT3 A;  3BG5 A;  4P96 A;  2ZJQ F;  2ZME C;  4KN7 X;  2E5Z A;  3MMY B;  4AWX B;  2F4M B;  2DJI A;  5DYM A;  1OYY A;  3BTI A;  1MBJ A;  5HDG A;  3H5A A;  3HEF A;  2L9R A;  3WG9 A;  1UEL B;  4HLY A;  1EH8 A;  4M3B A;  4MO7 A;  3G56 A;  5D8K B;  2R0Q C;  3U1K A;  1BI2 A;  1SVO A;  4S0H B;  3VB2 A;  2A68 F;  4ETS A;  4G9Y A;  3DLA A;  4B43 A;  4F55 A;  1R58 A;  2DYS H;  2IJL A;  4C2U A;  2E2I J;  2V6E A;  4ZDO A;  1IF1 A;  3WE3 A;  1K6O A;  1ZN2 A;  2KHM A;  5E79 C;  1MH4 A;  1AKH A;  4A2U A;  2O61 A;  3FRQ A;  1LE8 A;  2E1C A;  2R5Y A;  2VJJ A;  5B1B H;  4A3C J;  4BE2 A;  3V7R A;  1I6X A;  3QU3 A;  3S32 A;  1ZQ3 P;  2EQR A;  1P7J A;  3S2W A;  1ZAO A;  1IRF A;  2LVS A;  4DW6 A;  4XLF A;  1DP7 P;  1Q1V A;  2ADU A;  5FRM A;  2G3B A;  3KP7 A;  1G3W A;  2KIQ A;  3BJA A;  3M8E A;  4A3K J;  2DQR A;  3KEY A;  1QPI A;  3MN2 A;  3ANG A;  2GXB A;  3G73 A;  2D45 A;  4AVP A;  1UZC A;  1U3E M;  1RI7 A;  1FYL A;  4QPO A;  3VW0 A;  3MKW B;  4PJJ A;  2JVH A;  2G9W A;  1Z3X A;  4ZJZ A;  3JRE A;  4HAM A;  2EV0 A;  1X19 A;  1OFC X;  3RPU A;  4NC8 A;  2QEX I;  3HDD A;  5BOX A;  3K4K A;  4OIQ F;  3H5R A;  4HSR A;  1QA6 A;  3QU6 A;  5BQT A;  1OYW A;  3I54 A;  3P9K A;  2ID3 A;  1ZRF A;  4EVI A;  2EIN H;  1TT5 B;  2HI3 A;  3GW2 A;  4D1Q A;  3G7R A;  4KT5 C;  3E5Q A;  3KIO A;  4OAZ A;  3E3V A;  3GFL A;  2UXU A;  2H09 A;  2ZOZ A;  1D0Y A;  1T38 A;  1SMT A;  2EK5 A;  1KZH A;  2STW A;  3H3Z A;  2RNG A;  3DTI A;  4PJM A;  3ROU A;  1D1A A;  4FE4 A;  3E97 A;  4RGX A;  5FO5 A;  4EM0 B;  3F23 A;  4IJA A;  4LOC A;  3LMM A;  3VVY A;  3KYL A;  3WTV C;  2ZSH B;  2L9N A;  2ELK A;  1BW5 A;  4FCY A;  4A3L J;  4CCJ A;  4YEL A;  1VI0 A;  5ICG A;  2K4J A;  4XN3 A;  2QWT A;  1SFO J;  2F5V A;  1Y1V J;  1TZL A;  3NRG A;  3MNL A;  1DPR A;  1TTY A;  2JUG A;  3P7N A;  4HW0 A;  4RB3 C;  1E3H A;  1OR7 C;  2XF6 A;  1S7O A;  3GTM J;  1FBS A;  2ZSI B;  4KIB A;  1BA5 A;  1IUF A;  3L9F A;  1A35 A;  3H3V K;  3K4B A;  1WH7 A;  3KZZ A;  3WTS C;  1OCC H;  1W0U A;  3L2U A;  2DK5 A;  3DLL F;  1HKQ A;  2BEO A;  3V8J A;  1XTA A;  2NAZ A;  4ZZD A;  2O8K A;  1IXR C;  4PUS A;  3BPV A;  2GOM A;  2JZY A;  2A05 A;  3SDG A;  1IV6 A;  3FXO A;  1FMW A;  4KMU X;  2NP3 A;  3Q0U A;  3WU2 C;  1TNT A;  3RZD J;  1ETX A;  1LVA A;  5BNG A;  1JUM A;  2XSJ C;  4M3E A;  1UFM A;  3CLQ A;  1T95 A;  3DEE A;  2VKE A;  2ZME A;  2E1N A;  5FD5 A;  3BR6 A;  2VKV A;  2F5C A;  4XMY A;  2ID6 A;  3MZ8 A;  1FPQ A;  5KVR A;  2V1N A;  4BQQ A;  4A3I J;  3IV5 A;  1PUE E;  4CZC A;  1IN8 A;  1PYV A;  3EDP A;  4MTD A;  1FLI A;  1KU9 A;  5CVJ A;  5E17 F;  1MSE C;  3GZ5 A;  2EIL H;  2W53 A;  1U9N A;  1BI3 A;  2ZCM A;  2EBI A;  1B72 A;  3OV8 A;  1DUX C;  2G7L A;  3OYM A;  2NRA C;  4L0Y B;  2FA5 A;  4MK6 A;  2KFD A;  5C4Y A;  2X6X A;  2L0K A;  4BEH B;  5TRD A;  3KLN A;  4OIR F;  3HGY A;  2V9V A;  3SZG A;  5EG0 A;  4LMY A;  2M2E A;  2A61 A;  2R93 J;  1UHW A;  1WJD A;  1X2N A;  2X6W A;  1LJ9 A;  2O7T A;  2HOA A;  1MJB A;  1WI9 A;  2RN7 A;  4HOB A;  4IHY A;  4MQ9 F;  3OS1 A;  3COA C;  4LLG F;  2CQK A;  4CXF A;  2DA2 A;  4GO1 A;  3QYB A;  2ZY9 A;  2KL4 A;  4XKB A;  1HW5 A;  2FRH A;  3SFZ A;  3VYR B;  1F43 A;  3W2A A;  2JA5 J;  1Y0U A;  3O3K A;  4ENJ A;  1B59 A;  2H27 A;  2RNJ A;  4XOP A;  1W5S A;  2REK A;  4ICH A;  3TED A;  4XIC A;  4AD9 A;  3E6M A;  5AQC A;  4YIR X;  1MMG A;  2MW8 A;  4ITV A;  3FXQ A;  2M3A A;  3FXK A;  2QQA A;  4UUS B;  4LG0 A;  2EFN A;  3LWJ A;  5CXI A;  5EEH A;  2EFP A;  5DM6 F;  2EIM H;  2DA3 A;  3NPI A;  1HQC A;  1YRN A;  3BWG A;  3BG9 A;  2HDC A;  1Z21 A;  1FOW A;  2KJC A;  2KRH A;  1DPU A;  4XLN F;  1OCO H;  2HKU A;  2NVX J;  2OCE A;  1HKT A;  3PFI A;  3SYT A;  4ZH4 F;  1Y8R B;  3BJB A;  2ZJ2 A;  2UZK A;  3HL2 A;  1U0J A;  1VZ0 A;  1U8B A;  2PJP A;  3ZQG A;  4M9Z A;  4GFB A;  3PO2 J;  4J19 A;  2P5K A;  1MBE A;  3VEP A;  2HDD A;  4RAZ A;  4KIF A;  2W1O A;  4DYQ A;  2IS1 A;  2XIG A;  2YU3 A;  3QRF F;  4A3M J;  3TMO A;  2R4G A;  1T2K A;  4U0W A;  4YZE A;  2HOE A;  3FKJ A;  1WKM A;  2MFZ A;  2XV4 S;  3DU6 A;  3ABM H;  4YFN F;  5H9T A;  4OIO F;  2RHA A;  6PAX A;  4G7Z F;  4XRM A;  1K78 B;  1QVU A;  4I0A A;  1QZZ A;  3W2W A;  1S6L A;  3CC2 I;  2LYC A;  2RAS A;  3HRS A;  4MEY F;  1JI8 A;  5LLQ A;  1A04 A;  4UY8 I;  3ON4 A;  1NK2 P;  2XRL A;  2ECC A;  2QEN A;  2PJR A;  2DT6 A;  1JGG A;  3M1C A;  4TV7 A;  3D1N I;  4MEX F;  2QBY B;  2RQQ A;  1BW6 A;  3S5R A;  4N0B A;  5AON A;  5IPA A;  3W6K B;  1Y56 A;  5JLX A;  1UHS A;  2MBF A;  4N9I A;  4EJO A;  4B1R A;  3F8M A;  4NDL A;  4LB6 B;  2GAU A;  4QLC U;  3HM5 A;  4HDU A;  5DCF A;  3OSF A;  2OER A;  1CQT A;  4XM3 A;  5FLX Z;  1D8J A;  1DGW Y;  4QSH A;  2FQ4 A;  3RTR A;  3F21 A;  5F0H A;  3O60 A;  3GYH X;  3CQZ J;  5DUI A;  3OYF A;  2IA2 A;  3QPH A;  4NC6 A;  3F6V A;  4XON A;  4ZTJ A;  3GZ6 A;  2YX7 A;  4EQQ A;  4E7L A;  4OIP F;  2V57 A;  2DMQ A;  4UVA A;  2F5D A;  1LQ1 A;  2Y9Y A;  1QZE A;  3D5S C;  3BHQ A;  2FJ1 A;  2Z5U A;  4LG3 A;  1SFK A;  4M73 A;  4BJ6 C;  3C7J A;  2XKO A;  3JSP A;  1FYM A;  4IHX A;  3GTP J;  3ULQ B;  3QP5 A;  2YR2 A;  3BR2 A;  4RBO A;  3F0C A;  3LSI A;  4FT8 A;  3HIF A;  2EPF A;  1TBX A;  4ASN A;  1FP1 D;  1MNE A;  3GLX A;  2XB5 A;  4FX0 A;  5BPI A;  1JT6 A;  2FML A;  3C18 A;  4A5M A;  2K86 A;  5HS9 A;  1F4K A;  3ABU A;  4IF4 A;  5K5R A;  2OBP A;  3QKX A;  3UR3 C;  4HF2 A;  1IGN A;  4A3F J;  1TT0 A;  4IHV A;  4Y4R A;  3B02 A;  4ZTF A;  1EH6 A;  3K10 A;  4HBL A;  1T6S A;  3FIW A;  3H9Q A;  5JR3 A;  2VUM J;  2W57 A;  1VQ6 I;  3PQK A;  2CQX A;  2FOW A;  1X58 A;  5GPC A;  1QBJ A;  3F1B A;  2RV8 A;  1V3F A;  4LLL A;  4EEF G;  3OR1 C;  2K85 A;  2ECB A;  1MIJ A;  1R1V A;  2A69 F;  2GZW A;  4MLO A;  5JHF A;  4M9S A;  4K2E A;  2Z2S B;  2LF7 A;  3TL4 X;  2QQ8 A;  3L2W A;  5ICC A;  1TWA J;  1KON A;  2HU9 A;  1IN6 A;  1OCR H;  4X6A J;  4HYE A;  1ZLJ A;  4B3X A;  3FMQ A;  1R22 A;  1V5E A;  4NBQ A;  3IKV A;  5E1Z B;  2FBI A;  2O3F A;  3K2A A;  4LIV A;  1H8A C;  4KUM A;  3QOD A;  3KE2 A;  4IVN A;  3CCJ I;  3RIR A;  3VDX A;  1VQ7 I;  3ZN0 A;  3L2R A;  3R61 A;  4AIH A;  3OIQ A;  3AL0 B;  1YS6 A;  5FKM A;  2L5Q A;  1Z6T A;  3BC8 A;  4HQM A;  2IAI A;  1E2X A;  2Q2E B;  3FXU A;  2NVQ J;  2PMU A;  3HOW J;  3WHC A;  5HLG A;  2HQA A;  5FKN A;  2GA1 A;  1RRJ A;  1H89 C;  3H3U A;  2PMZ A;  2R7U A;  2ZNZ A;  5HOD A;  1IDZ A;  2HEO A;  5ICF A;  3JTH A;  4M3D A;  5HBU A;  4BGD A;  3ASN H;  4DYR A;  3S1N J;  5GPA A;  2FOK A;  3ZGK A;  1JJ6 C;  1NH3 A;  1BL0 A;  2F07 A;  3JRF A;  3TBI A;  4E7J A;  5J4Y A;  2Y9Z A;  2BY1 A;  4XSZ F;  2LR8 A;  3K4M A;  3PSF A;  1N75 A;  3ABL H;  4U88 A;  1P6R A;  2ZO4 A;  2D1H A;  3CJN A;  1JTY A;  3G1O A;  4JBA A;  4E70 A;  4RLQ A;  1ZK8 A;  3S17 J;  2YVE A;  2LY2 A;  3P9T A;  4Z2Y A;  3VTI A;  2RKH A;  2MH9 A;  4ON0 A;  4B44 A;  3LSR A;  2BZT A;  1SVL A;  1LFP A;  2LMD A;  3BQY A;  3VUQ A;  1HC8 A;  4DVY P;  3P9C A;  2K9L A;  4BEH A;  3RYR A;  2D6Y A;  3HOY J;  1R1U A;  2DQL A;  3RSN A;  2VBZ A;  3HYI A;  3NAR A;  4PFO A;  3TO6 A;  3ZQH A;  2Y0S A;  3BY6 A;  1WJB A;  2ZBK A;  3K4N A;  3TOB A;  3BP8 A;  2CW8 A;  4KIS A;  3CJR B;  5CQE A;  3J80 K;  4IQ4 A;  1O3S A;  1JJ8 C;  1FIP A;  1UG0 A;  1V4R A;  1WJA A;  4M71 A;  4GFK A;  3M3Y J;  4L5E A;  2E7W A;  2M34 A;  4PJ0 C;  2VQC A;  4EMS A;  4M6Y A;  4CCK A;  1R49 A;  1W7P D;  5J1R A;  3FK7 A;  3GTO J;  3OYI A;  5E3L A;  3GTL J;  3PNV A;  1IN4 A;  3RCO A;  4BXF A;  2EZK A;  2G7S A;  3EYI A;  3E7L A;  1WVR A;  2KDO A;  3CUO A;  2ELJ A;  2TCT A;  4UUS A;  1OYI A;  2KZG A;  1W5T A;  2Y75 A;  4U7B A;  3IUO A;  2G7H A;  1XGS A;  5K58 A;  2G7G A;  3CF5 F;  3E0J B;  3RPQ A;  3H0G J;  2IP2 A;  1ZH5 A;  1CF7 B;  4U7D A;  2CUF A;  2P5V A;  1HBX G;  2Q24 A;  2EFO A;  5E1W A;  4CDG A;  1VND A;  2PLY A;  4IOC F;  4AYB N;  1I1S A;  3GLL A;  2W84 A;  2HQ5 A;  4FE7 A;  5CYV A;  2BVM A;  1IXS B;  3FF5 A;  1MND A;  2XVC A;  3KET A;  2UXX A;  1QQI A;  3AG3 H;  2L9V A;  1GLN A;  1HSJ A;  4RA2 A;  1LEA A;  4L5I A;  1LDK B;  3RI4 A;  2KDZ A;  3BZK A;  2HNH A;  2HOT A;  4KIT B;  1T33 A;  4I0B A;  4M9X A;  1RIO H;  1K78 A;  3FM5 A;  2VAS A;  3FX3 A;  2OI8 A;  2BW3 B;  1U6G A;  2VBW A;  4L5J A;  3K1M A;  3VYT B;  3FHN A;  4AUX A;  4UB8 C;  3QWL A;  5M3F J;  1I5Z A;  1IXC A;  3WGH A;  2MLG A;  3FZV A;  4G12 A;  4JK1 X;  3MVP A;  1P4X A;  3EUK L;  3KNW A;  1KGS A;  3R60 A;  3TP0 A;  4XLA A;  2M8E A;  3GFJ A;  4YIF A;  2LNB A;  3A01 B;  2CU7 A;  2IA1 A;  3KZI C;  2JA6 J;  3HHG A;  4H0E A;  1U9O A;  1X4O A;  5H20 A;  2QBY A;  3C2H A;  3KEO A;  3VPR A;  2L7Z A;  3KZY A;  5HNH A;  2CV0 A;  2R7Z J;  1RUN A;  3KP3 A;  2ZCX A;  2KKO A;  4S05 A;  1XMK A;  2QA4 I;  3LHQ A;  1BR1 A;  5GAH J;  5CVR A;  2HQR A;  2LLK A;  2Z3Y A;  2L01 A;  5HLT A;  3RKY A;  1POG A;  3LFU A;  3BQZ A;  4GCV A;  4AID A;  4C2M J;  5IT3 A;  5ED4 A;  3L00 A;  2ZXI A;  3WU1 B;  2PQ8 A;  4EGY A;  2VB6 A;  4JP0 A;  3Q5F A;  2L9S A;  5FKK A;  2C6Y A;  3E6B A;  1STZ A;  2DBB A;  4RS8 A;  1LDD A;  4F92 B;  4NC7 A;  2DMU A;  1EV7 A;  2JRT A;  4M72 A;  3TOA A;  3DWL E;  4HZF A;  4PK4 A;  3RH2 A;  4GYI A;  2L54 A;  2JT1 A;  3I9V 2;  2CV1 A;  1OIS A;  2EZL A;  1RR8 C;  3DBR B;  4ZC3 A;  4A0X A;  4U87 A;  3EET A;  4D5F A;  3HE0 A;  3CO6 C;  1UCR A;  1XMA A;  3BTL A;  2KPM A;  3OR2 C;  2XGX A;  4JX6 A;  4HKU A;  2DFF A;  5LHG A;  4FTH A;  1ZHF A;  1XSX A;  1V5F A;  4XRS G;  3PPB A;  2HDW A;  3O8G A;  3Q0W A;  2A6H F;  2KMU A;  1HW2 A;  2DTZ A;  3LA2 A;  1S72 I;  4RAF A;  1H9T A;  2GM4 A;  2IW5 A;  2FNP A;  2ZKZ A;  2FJI 1;  2R7O A;  2ELH A;  2MD0 A;  2H94 A;  2O9L A;  3A1Y A;  2H1K A;  4R1H A;  1JKR C;  2JWT A;  1Z91 A;  4O3M A;  1ETK A;  5LRS A;  3F8B A;  4UNO A;  2DA1 A;  3CDH A;  2M8G X;  4A6D A;  3HRM A;  1S9H A;  1YW7 A;  3ZQL A;  1ACI A;  3KKC A;  2E1M B;  2HKO A;  2BXZ A;  2I5U A;  2XAS A;  2H6B A;  4HV6 A;  1NG6 A;  4BQN A;  1GT0 C;  2HZD A;  1SFX A;  2MLK A;  5AIQ A;  3QQA A;  5H2F C;  2GIZ A;  1FX7 A;  1I3Q J;  1AA7 A;  1MGT A;  2LG4 A;  1X3U A;  1MMA A;  4RM3 A;  1EJ9 A;  1IJW C;  3NEU A;  2CW0 F;  5L3F A;  4RB2 C;  2B1E A;  1B9N A;  4E7H A;  2JPC A;  3L2C A;  2WAD A;  2XB0 X;  4EJT A;  3CLO A;  2KIM A;  4L9T A;  5GP9 A;  2Y0M A;  4XLC A;  2E5N A;  2X51 A;  2ZFU A;  5KK1 A;  2QQ9 A;  4RGS A;  3FWE A;  4C3H J;  4D7N A;  2OD5 A;  1S7E A;  2JK3 A;  5HDK A;  3JR9 A;  1T98 A;  2JA2 A;  4I6Z A;  4HPQ A;  3A02 A;  3WE2 A;  1KQ9 A;  4PGG A;  4CO8 A;  2M7B A;  4IHS A;  2GQQ A;  5H6Q A;  3UKG A;  2Y31 A;  3BR5 A;  3ABT A;  3K8P C;  1UMQ A;  1TWH J;  3F3X A;  4XLH A;  4I01 A;  2KT0 A;  5ICE A;  4CYC B;  3A0H C;  1JKP C;  2XUB A;  4XKW A;  3F8F A;  3TW7 A;  1D5V A;  2LP0 A;  5CVV A;  3VFZ A;  3A4C A;  2HXI A;  5ILS A;  3E6C C;  2A07 F;  4X0G A;  2KP6 A;  4BYY A;  2PI0 A;  1RR7 A;  1PVE A;  3G6E I;  3A03 A;  4XOR A;  1O7F A;  2F2E A;  2VQL A;  1SC7 A;  3MZH A;  4NB5 A;  2ISZ A;  2JSP A;  3AFH A;  3PFY A;  3DQV C;  2OZ6 A;  4GFL A;  1HKS A;  2HYJ A;  2VI6 A;  3IH2 A;  4B3A A;  3I56 I;  1LEB A;  5HAW A;  2R7S A;  2AHQ A;  3MQ0 A;  3SJM A;  4IL6 C;  2OAZ A;  3JRC A;  3NRV A;  1TWG J;  3Q9V A;  3HRT A;  1S8N A;  2WTE A;  4PJL A;  2I10 A;  4NQW B;  3CJD A;  4KJZ A;  3U9G A;  3CME I;  3H92 A;  2DFI A;  2WBM A;  3OSG A;  1S7A A;  2CJJ A;  2L4A A;  3JRD A;  4YFK F;  2M0M A;  2DO7 A;  3SZP A;  4W1U A;  1YO5 C;  4IKF A;  1WJC A;  3JCU C;  2J5O A;  3IWZ A;  1XCV A;  4BS9 A;  1FTZ A;  2ZB9 A;  3NAU A;  2M5W A;  3KCC A;  2RC4 A;  1W5C C;  3DPL C;  5DTD A;  2HGC A;  2EA2 A;  3DEU A;  2FU4 A;  2DA7 A;  1AOY A;  3HTI A;  1C0W A;  2OPT A;  2XRO A;  3AG4 H;  3T1B A;  5J8F A;  5D5V B;  2R5Z B;  1R36 A;  1T08 B;  2UXH A;  4ENK A;  4G7O F;  4DIQ A;  1PUF B;  3KEQ A;  4HNU A;  2LKX A;  4GCT A;  2E1M C;  1W7P A;  5JFR A;  4X1E A;  2DG7 A;  2O03 A;  1GVD A;  1XSD A;  3S14 J;  2LY1 A;  2QM3 A;  3B6C A;  4ACI A;  3CCY A;  2ME6 A;  2OA4 A;  1BC7 C;  1MBK A;  3HPH A;  4DOZ A;  1UB9 A;  4AM3 A;  2PMZ N;  4JYK A;  5DCM B;  3CUQ B;  4LIU A;  4UVB A;  3DBH B;  3OY9 A;  1BIA A;  2R7T A;  2HXO A;  4M6X A;  1HLV A;  2VPL A;  1QHH D;  3BOQ A;  2IXS A;  5L3E A;  5HLH A;  2KQR A;  5A2Q K;  4Y3O A;  3IKT A;  3RYP A;  2P81 A;  1I6H J;  2QVO A;  4A3G J;  2F5F A;  4A0Y A;  1ETQ A;  2AQF A;  4G7H F;  3J81 K;  5LRR A;  2NYX A;  2K5C A;  3ZQC A;  3OYG A;  3EUP A;  3ZMU A;  2EA4 A;  1F9N A;  2K7L A;  1YFH A;  1YJW I;  5FGL A;  4OMZ A;  3U2R A;  1HST A;  2DMT A;  5K1Y A;  2CWE A;  3BZC A;  1QZY A;  2HKX A;  1E17 A;  4L0Z B;  4AC0 A;  4EAT A;  1I39 A;  1ZR4 A;  2WWY A;  5DD4 A;  3GVA A;  3LNQ A;  5J1Y A;  1MDM B;  1XGN A;  2R7Q A;  2Y0S N;  2LFB A;  3BPX A;  4WWC A;  1EKE A;  2LBF A;  2OQG A;  3V4G A;  1EH7 A;  3WU0 A;  3ZQI A;  3IRR A;  1Z7U A;  3O2P E;  3G1M A;  2G0E A;  4Y33 A;  2ZCW A;  5D19 A;  3W6V A;  3QOE A;  2Y2Z A;  2QSH X;  1PDN C;  5CQG A;  1JKQ C;  5F0C A;  3ANP A;  1IUY A;  4PDK A;  1AU7 A;  3K69 A;  4J00 A;  4IXA A;  3BTJ A;  3P9I A;  3CC4 I;  3PM1 A;  3RQI A;  1P4A A;  3VYS B;  2VOO A;  3S93 A;  3GBG A;  3CCL I;  1S5L C;  3I0T A;  3AKZ A;  2E60 A;  4BKX A;  2FF4 A;  5F04 A;  3HKZ A;  3RKQ A;  2PFB A;  2H8W A;  3I4P A;  2OCC H;  1UG2 A;  3B81 A;  1LUJ B;  2ETH A;  3HSE A;  1TC3 C;  3NWT A;  5E20 A;  2DJN A;  2JA8 J;  3FM3 A;  3CD6 I;  3VP5 A;  2MYS A;  5LHI A;  3DKW A;  3F8C A;  2R7X A;  1HW1 A;  1BC8 C;  2HTS A;  5D6F A;  1L3L A;  3NS4 A;  5IOZ A;  4IHT A;  1OCP A;  1FY7 A;  2LOO A;  5FFZ A;  4IQJ A;  2KRF A;  3FXL A;  3PJR A;  3VOD A;  2X1C A;  3HC7 A;  1QGP A;  3VWB A;  3HZJ A;  3ASO H;  4RAG A;  5KCM A;  2HWV A;  4N9H A;  3BR0 A;  1CGP A;  3I59 B;  4OAY A;  3JRB A;  5IP7 J;  2OZU A;  3J7Z I;  2FSW A;  1OPC A;  2VQG A;  3V7C A;  2IT0 A;  1A36 A;  1YLF A;  4ZYA A;  3NQO A;  4CUG A;  2NNN A;  3OYA A;  4Q4Z F;  4IRG A;  1HA8 A;  5D5U B;  3EYY A;  3ZRG A;  3NI7 A;  1OR7 A;  4DZJ A;  1FOX A;  1ZRD A;  3LSK A;  1RET A;  4D0P A;  3CUQ C;  3S8P A;  2CQ7 A;  2A6E F;  2UV1 A;  2Y69 H;  1LDJ A;  3CCM I;  2XPU A;  4IO9 F;  4XN0 A;  3HTA A;  1X1B A;  3EPZ A;  2EWN A;  3DU5 A;  3H5N A;  3LST A;  5M5X J;  1KQ8 A;  4II3 A;  4WF2 A;  4XRS A;  2XF7 A;  5IY5 H;  3I55 I;  4HNV A;  1W36 C;  2GOX B;  3BT9 A;  4A3E J;  1SD5 A;  1I1G A;  2VOD A;  4FIS A;  5EJC A;  1DGR M;  2P8T A;  2IA0 A;  4ZDL A;  3ABK H;  3IWF A;  2AQE A;  3BJ6 A;  1UI6 A;  4CCL A;  1FNN A;  4I7H A;  2DLL A;  4EJV A;  4R79 A;  4RGU A;  3HB9 A;  3WGI A;  2BVL A;  2YVH A;  1ZRC A;  2JSC A;  5FGM A;  3PIP F;  3CMA I;  3GEU A;  4BAY A;  3IH4 A;  5ILU A;  3ZMV A;  2IGM A;  2KIS A; 
#chains in the Genus database with same CATH homology
 4V2G A;  3Q0V A;  1FIP A;  1JJ8 C;  5F0F A;  3QPS A;  4D7M A;  2E2J J;  4MFE A;  3HOV J;  3RZO J;  1WH5 A;  4GFK A;  3M3Y J;  1DU0 A;  1B8I A;  4L5E A;  3GTJ J;  1SGM A;  2M34 A;  1VFC A;  3WHB A;  3M4O J;  2L7M P;  2X6O A;  3BRU A;  2EZH A;  4MFD A;  9ANT A;  3TW6 A;  1EF4 A;  5CXG A;  1E3O C;  3L1P A;  5J1R A;  3BG5 A;  5M3M J;  3FK7 A;  4QIW N;  3GTO J;  5F08 A;  5IYD J;  5E3L A;  2UXO A;  1H88 C;  3GTL J;  2NP5 A;  5J3L A;  3BTI A;  5E3O A;  1MBJ A;  3JSJ A;  5D18 A;  1RKW A;  2EZK A;  2G7S A;  3HEF A;  2GEN A;  2L9R A;  3E7L A;  3S1R J;  4UUS A;  2TCT A;  1ETY A;  3JRH A;  5K7H A;  4MO7 A;  4M3B A;  3G56 A;  1JTX A;  5M5Y J;  2R0Q C;  4S0H B;  2LTP A;  5K58 A;  2G7G A;  4JL3 A;  3H0G J;  3A01 A;  2E2I J;  2QF7 A;  1LFU P;  2CUF A;  2Q24 A;  1AKH A;  1MH4 A;  3FRQ A;  2JA7 J;  1LE8 A;  1VND A;  2R5Y A;  1MBH A;  3HOU J;  4A3C J;  4AYB N;  3T6N A;  3VOK A;  5C4J J;  4FE7 A;  2HQ5 A;  1ZQ3 P;  2EQR A;  1P7J A;  2COB A;  3LJL A;  2LVS A;  4I76 A;  4DW6 A;  1B8I B;  5FKO A;  5FLV A;  5EZG A;  2DA6 A;  2MSY A;  3HIM A;  1Q1V A;  2G3B A;  2K40 A;  5FJ8 J;  4A3K J;  1QPI A;  1Z77 A;  2KDZ A;  2WB1 N;  3MN2 A;  4XID A;  2HOT A;  3ANG A;  1T33 A;  2E1O A;  1XS9 A;  3JRA A;  1SAN A;  3CDL A;  3VW0 A;  4AF5 A;  2OI8 A;  1MBG A;  2DN0 A;  3CWR A;  3JRE A;  4AUX A;  2R5Z A;  5M3F J;  1OFC X;  3S15 J;  1IG7 A;  3HDD A;  4ME9 A;  4MXM A;  1PUF A;  4G12 A;  3MVP A;  3KNW A;  2QKO A;  3EGQ A;  2ID3 A;  3TP0 A;  1LFB A;  5EGO B;  1UI5 A;  2HI3 A;  1ETW A;  4XK4 A;  3A01 B;  2CU7 A;  3G7R A;  4JNN A;  2JA6 J;  2UXU A;  2IU5 A;  4CGR A;  1U9O A;  1AKH B;  1A5J A;  3DEW A;  2FX0 A;  3FIS A;  2ZOZ A;  3VPR A;  2L7Z A;  1IRZ A;  2R7Z J;  2R5Y B;  1HOM A;  4RDU A;  2K9S A;  2ZCX A;  1BJZ A;  3KKD A;  3LHQ A;  4FE4 A;  3FK6 A;  2QOP A;  2LLK A;  4LOC A;  1X2M A;  3VVY A;  1FTT A;  1POG A;  3BQZ A;  4A69 C;  4D5C A;  4C2M J;  5FLM J;  4JP0 A;  5FKK A;  2HOS A;  1NK3 P;  4IEJ A;  2ELK A;  1BW5 A;  5F1J A;  5EF6 A;  4FCY A;  4A3L J;  1VI0 A;  2DMU A;  3HBL A;  1XC5 A;  2QWT A;  1SFO J;  5FHP A;  3RH2 A;  1Y1V J;  3BNI A;  2ZCN A;  3DCF A;  3NRG A;  2EZL A;  1R9T J;  3MNL A;  1ZKG A;  2UXP A;  2M0C A;  2FD5 A;  1JUS A;  4D5F A;  3HE0 A;  2QTQ A;  3GTM J;  3BTL A;  1TWF J;  1BA5 A;  4JX6 A;  1IUF A;  3H3V K;  4HKU A;  4FTH A;  2D5V A;  3PPB A;  4XRS G;  1WH7 A;  3O8G A;  2NVY J;  1W0U A;  3Q0W A;  2PBX A;  5JLW A;  2DA4 A;  2DTZ A;  1Z0X A;  1GV2 A;  1WPK A;  5IYC J;  2GUH A;  3AQS A;  3DPJ A;  2GM4 A;  2O8K A;  2LY9 A;  1RES A;  3SDG A;  1IV6 A;  2O9L A;  2TRT A;  2H1K A;  2NP3 A;  3Q0U A;  5EFY A;  1RPW A;  1JKR C;  4A3D J;  2CRG A;  3RZD J;  1ETX A;  2JWT A;  4UUT A;  1ETK A;  5BNG A;  3ON2 A;  1JUM A;  2DA1 A;  4M3E A;  1U78 A;  5FMP A;  2M8G X;  4CYC A;  3S1Q J;  1FJL A;  2VKE A;  3ZQL A;  4BY1 J;  3KKC A;  3BCG A;  3BR6 A;  2VKV A;  2YU9 J;  2ID6 A;  5EDN A;  2NX4 A;  1GT0 C;  4A3I J;  3IV5 A;  2GFN A;  3QQA A;  2MG4 A;  2L7F P;  3S2H J;  1ENH A;  1MSE C;  1I3Q J;  2W53 A;  1U9N A;  4GCL A;  2ZCM A;  4PXI A;  5IP6 A;  2QIB A;  2EBI A;  1ZGW A;  1IJW C;  1K61 A;  1B72 A;  2G7L A;  1FIA A;  4MK6 A;  5IYB J;  5C4Y A;  2XB0 X;  3LOC A;  2EH3 A;  2JMW A;  2L0K A;  1HF0 A;  5GP9 A;  3HGY A;  5EG0 A;  2M2E A;  2R93 J;  3NXC A;  1X2N A;  2O7T A;  2AO9 A;  2HOA A;  1FEX A;  1RKT A;  3S1M J;  4IHY A;  4C3H J;  4D7N A;  3JR9 A;  1S7E A;  2JK3 A;  4M3G A;  3JRG A;  3HOZ J;  3BR1 A;  4I6Z A;  3A02 A;  5F27 A;  5C4X J;  3UKG A;  2DA2 A;  2Y31 A;  3BR5 A;  1ZTR A;  1UMQ A;  1TWH J;  1F43 A;  2XGD A;  2K9N A;  5DS9 A;  2KT0 A;  4CYC B;  1JKP C;  2JA5 J;  2XPV A;  3TW7 A;  3LSG A;  2LP0 A;  1QVT A;  2REK A;  2JN6 A;  4ICH A;  2HXI A;  5EYR A;  3TED A;  2Y30 A;  4XIC A;  1APL C;  5AQC A;  1RR7 A;  3A03 A;  2MW8 A;  2WGB A;  1I50 J;  5IOY A;  5K7Z A;  3IH3 A;  4UUS B;  3LWJ A;  2IBD A;  3FKI J;  4GFL A;  1JUP A;  5CXI A;  1OJL A;  3VIB A;  2DA3 A;  2K9Q A;  2GLO A;  2HYJ A;  2VI6 A;  3NPI A;  3IH2 A;  4B3A A;  1GDT A;  5HAW A;  1YRN A;  2AHQ A;  3BG9 A;  3SJM A;  3JRC A;  1MNM C;  1TWG J;  4B4C A;  2XGC A;  2HKU A;  2NVX J;  2NOG A;  2I10 A;  2ZOY A;  3BJB A;  3CJD A;  2M9H A;  4AC6 A;  3OSG A;  1U8B A;  2XPW A;  1LE8 B;  2CJJ A;  3GTK J;  3JRD A;  2MGQ A;  3ZQG A;  4GFB A;  3PO2 J;  4J19 A;  1GUU A;  1MBE A;  2E19 A;  2HDD A;  4W1U A;  3HKZ N;  4DYQ A;  3AQT A;  2N8G A;  4A3M J;  1FTZ A;  4YZE A;  3Q3S A;  1JT0 A;  2ZB9 A;  3NAU A;  2PZ9 A;  3K7A J;  3ZOB A;  5H9T A;  5DTD A;  2RHA A;  4XRM A;  1QVU A;  2DA7 A;  2LK2 A;  2DG8 A;  4L62 A;  4BBS J;  2HYT A;  3HTI A;  3E7Q A;  1TWC J;  2OPT A;  3S2D J;  2R5Z B;  2RAS A;  2XDN A;  2UXH A;  1HDD C;  2YUS A;  4UDS A;  1PUF B;  5D1R A;  2B63 J;  3ON4 A;  2LKX A;  5HSZ A;  1NK2 P;  4GCT A;  1YRN B;  2XRL A;  2ECC A;  4M3F A;  5M5W J;  1JGG A;  2QCO A;  4X1E A;  3D1N I;  2DG7 A;  1DU6 A;  1GVD A;  3S14 J;  3B6C A;  4ACI A;  3CCY A;  3MKL A;  2ME6 A;  2WUI A;  1MBK A;  1BW6 A;  3S5R A;  2IEK A;  5E3M A;  5IPA A;  2PMZ N;  4JYK A;  3COL A;  3BR3 A;  5JLX A;  1UHS A;  4Y52 J;  4B1R A;  4NDL A;  2DA5 A;  2HXO A;  3OIO A;  3HM5 A;  4A93 J;  1T56 A;  1HLV A;  3OSF A;  2OER A;  1CQT A;  1WGX A;  2CUE A;  2FQ4 A;  4QSH A;  4C3J J;  3I4N J;  3LSJ A;  5F0H A;  2P81 A;  4DZP A;  4JX5 A;  1I6H J;  3CQZ J;  3O60 A;  4NEL A;  4A3G J;  1ETQ A;  1MBF A;  2V57 A;  1ZR2 A;  4A3B J;  3ZQC A;  2DMQ A;  3EUP A;  1ITY A;  2Y9Y A;  3BHQ A;  5EEA A;  2FJ1 A;  3S16 J;  4IHX A;  3I4M J;  5FGL A;  3GTP J;  4BXX J;  2DMT A;  3BR2 A;  4RBO A;  3F0C A;  3JRI A;  3HOX J;  3BG3 A;  4AC0 A;  2LD5 A;  2NS8 A;  1ZR4 A;  1ETO A;  4Y7N J;  1JKO C;  2XB5 A;  3LNQ A;  1JT6 A;  2OF7 A;  5J1Y A;  2JJ7 A;  2Y0S N;  2LFB A;  5J1U A;  1HCR A;  3CRJ A;  5C3E J;  3QKX A;  2O7O A;  5CW8 A;  3ZQI A;  1IGN A;  3G1M A;  2G0E A;  3VVZ A;  4A3F J;  1MSF C;  1A6I A;  4IHV A;  3W6V A;  5D19 A;  5C44 J;  3HTJ A;  2Y2Z A;  3CMY A;  1JKQ C;  3QBM A;  3SFI A;  2R92 J;  5F0C A;  5EGO A;  3FIW A;  1Y1W J;  2W48 A;  2VUM J;  3ANP A;  2CQX A;  1AU7 A;  1X58 A;  5GPC A;  5IP9 J;  3F1B A;  3RD3 A;  3BTJ A;  3C2B A;  1XG1 A;  3PM1 A;  3RQI A;  4IHW A;  3LSP A;  4EEF G;  3GBG A;  1G2H A;  2ECB A;  4MLO A;  2NS7 A;  2H8R A;  3G1L A;  5F04 A;  2XSD C;  1WCM J;  3RKQ A;  3TP3 A;  1TWA J;  1B72 B;  1ETV A;  1D5Y A;  4X6A J;  1UG2 A;  3OOU A;  3B81 A;  1TC3 C;  2DJN A;  2JA8 J;  3K2A A;  1H8A C;  3VP5 A;  1GV5 A;  2NVT J;  5EG0 B;  1AHD P;  2E2H J;  5EZH A;  4DYC A;  2DMN A;  4JX4 A;  5DAJ A;  1HDP A;  1OCT C;  5IOZ A;  1OCP A;  1NTC A;  4BY7 J;  3V6G A;  3VOX A;  2EZI A;  2YS9 A;  1IC8 A;  1O4X A;  5FKM A;  3HTH A;  4A3J J;  2WV1 A;  3PAS A;  3HGG A;  4QTR A;  3BR0 A;  2DMP A;  2IAI A;  2NVQ J;  2UXI A;  1QRY A;  3JRB A;  5IP7 J;  4M6V A;  3HOW J;  3WHC A;  3KZ9 A;  4MIM A;  5FKN A;  1WI3 A;  1H89 C;  5HOD A;  2ME0 A;  1IDZ A;  3PO3 J;  3NNR A;  2X48 A;  4V2F A;  3NI7 A;  4NN1 A;  4DZJ A;  5E3N A;  2CQQ A;  1RET A;  2FBQ A;  4M3D A;  5HBU A;  4DYR A;  3S1N J;  2XGE A;  5GPA A;  3V78 A;  1JJ6 C;  2F07 A;  1BL0 A;  2XPU A;  3JRF A;  3C07 A;  4C3I J;  2Y9Z A;  4JKZ A;  3HTA A;  3GTG J;  2LR8 A;  1IDY A;  2GBY A;  1MH3 A;  2VPR A;  5M5X J;  4XRS A;  3BTC A;  3QPL A;  4HNV A;  3GTQ J;  1JTY A;  3G1O A;  3ZQF A;  3BT9 A;  4A3E J;  1ZK8 A;  3O8H A;  3S17 J;  2YVE A;  1VF9 A;  3IUV A;  4FIS A;  3P9T A;  1F36 A;  1K83 J;  2WAQ N;  4KWA A;  3LSR A;  3GZI A;  4GCK A;  5FKL A;  3B6A A;  1UI6 A;  3BQY A;  3VUQ A;  1ORK A;  1P7I A;  3VW1 A;  5K7F A;  3HB9 A;  2YVH A;  2RAE A;  3HOY J;  1W0T A;  3GEU A;  3NAR A;  4ABZ A;  3ZQH A;  4BKX A;  3VW2 A;  3IH4 A;  4BBR J;  2D6Y A;  2X9D A;  3VVX A;  4W97 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...