4XK4A

E. coli transcriptional regulator rutr with dihydrouracil
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
196
structure length
196
Chain Sequence
SAKKKAILSAALDTFSQFGFHGTRLEQIAELAGVSKTNLLYYFPSKEALYIAVLRQILDIWLAPLKAFREDFAPLAAIKEYIRLKLEVSRDYPQASRLFCMEMLAGAPLLMDELTGDLKALIDEKSALIAGWVKSGKLAPIDPQHLIFMIWASTQHYADFAPQVEAVTGATLRDEVFFNQTVENVQRIIIEGIRPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator RutR
publication title E. COLI TRANSCRIPTIONAL REGULATOR RUTR WITH DIHYDROURACIL
rcsb
source organism Escherichia coli (strain k12)
molecule tags Transcription regulator
total genus 78
structure length 196
sequence length 196
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08362 TetR_C_3 YcdC-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4xk4A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 4xk4A02
4I76A 3HOVJ 2KDZA 2Y31A 1MBGA 1SFOJ 2F07A 2ZCMA 2XDNA 1TWGJ 1NK3P 1ETQA 5JLXA 3I4NJ 5J1UA 3DEWA 2GLOA 3RH2A 5EGOA 5IOZA 1UI6A 3AQSA 1AHDP 2UXUA 2ME6A 2Q24A 1I50J 1RKWA 1FIAA 3LOCA 4C3HJ 1HF0A 4L5EA 3AQTA 1GV5A 3HIMA 2DMTA 2XGCA 4YZEA 5D1RA 1LE8B 3LSJA 3BQYA 3A01B 5FKKA 3BRUA 3Q0VA 2LLKA 5EF6A 1GUUA 2JK3A 1FJLA 4UUSA 4A3KJ 1T56A 4FTHA 5C4YA 2R92J 2XB0X 1E3OC 3S16J 5EZGA 2DMNA 5FKLA 4A3CJ 3G7RA 4Y7NJ 1WGXA 3V6GA 2AHQA 4AYBN 4A3EJ 1BW5A 3RZOJ 4RBOA 3PM1A 5GPCA 1SANA 3HGYA 1CQTA 3A02A 5J1YA 4A3IJ 2HDDA 1H89C 2IBDA 2KT0A 3HTJA 1JJ6C 2G7GA 5E3LA 3S14J 3VP5A 2P81A 2NVYJ 4BBSJ 5EG0A 2R5ZB 3CWRA 3PASA 2WGBA 1B72A 3LSPA 3JRHA 5IYCJ 2UXHA 1GVDA 2HXIA 1OJLA 3HTAA 1JTXA 4A69C 1PUFA 1YRNA 4GCTA 2HOTA 1HDDC 2D6YA 4UDSA 1OFCX 2E1OA 5E3NA 3VVYA 5FMPA 3HBLA 5K7FA 2VUMJ 2M0CA 3MKLA 2E2IJ 1HCRA 3NAUA 3S1RJ 3QBMA 2CRGA 1JUPA 1SGMA 3VOKA 1BW6A 3ZQIA 2GM4A 2EBIA 3NI7A 4ABZA 1P7IA 4JNNA 2HI3A 2WAQN 3IUVA 5M3FJ 3RZDJ 4FE4A 4MLOA 2AO9A 1X2NA 2W53A 2Y9YA 2GUHA 3JRDA 4LOCA 3OOUA 2G7LA 2FQ4A 1ETYA 1LE8A 5H9TA 5M5WJ 2V57A 3GTKJ 3A01A 3E7LA 3HKZN 3E7QA 2CJJA 3HM5A 3S17J 1JJ8C 1F43A 4XRSG 1FIPA 3SDGA 1WPKA 2EZHA 3FISA 2L0KA 3LSRA 1TWCJ 3MVPA 1FTTA 2QCOA 1XC5A 1DU6A 3JR9A 3RD3A 4M6VA 4CYCA 3VIBA 3GBGA 1JKPC 2M34A 4AC0A 2HKUA 5F0HA 4S0HB 2W48A 4A3LJ 3HTHA 3BNIA 2LTPA 3KKDA 1IGNA 1Z0XA 2O7OA 5EZHA 1IDZA 4M3DA 3BR0A 2R5ZA 5FKNA 2NP3A 1LFBA 3LHQA 4L62A 3VVZA 1HOMA 3S2HJ 5M3MJ 3B81A 2I10A 1Q1VA 2X9DA 4J19A 5IYDJ 2NP5A 4MIMA 4MO7A 2L7ZA 3JREA 2LY9A 4IHVA 3BHQA 3T6NA 4V2FA 2ID6A 5F08A 3IH4A 1B72B 1H8AC 3QKXA 2YVEA 4X6AJ 2H8RA 1GT0C 1TWAJ 3OSFA 2E2HJ 4A3DJ 1RPWA 3G1MA 4IEJA 3L1PA 4GFKA 2ELKA 2XRLA 1QVTA 3BTJA 3NNRA 3M3YJ 2MGQA 1MBKA 2LD5A 3FKIJ 4D5FA 3GZIA 4C3JJ 5FKMA 5M5YJ 1ZTRA 3HGGA 5FKOA 3JRBA 3IH3A 4DW6A 4QIWN 3BJBA 2CQXA 1ORKA 1RESA 4XIDA 3KKCA 3SJMA 3BTLA 4UUTA 3P9TA 4X1EA 4ACIA 2ZCXA 1R9TJ 2NX4A 3FK7A 2HYTA 1FTZA 2DG7A 3CQZJ 4DYCA 2WV1A 4GFLA 1ZK8A 3BR2A 1ETVA 5EEAA 3ZQLA 1MSFC 1IV6A 5E3MA 2M8GX 4DZJA 3NXCA 4AF5A 2DMUA 2K40A 3F0CA 5HODA 4KWAA 3Q3SA 1F36A 2G0EA 5F1JA 3GTLJ 1JKRC 4CYCB 2DTZA 2NOGA 1WCMJ 2K9SA 2VI6A 3BG9A 2R7ZJ 4BXXJ 2ZCNA 2JA8J 3FIWA 4AUXA 1IG7A 2H1KA 2Y30A 3BR3A 1X58A 2FD5A 1MBFA 3CCYA 3LNQA 3QPSA 2NS8A 3TW6A 5GPAA 2NVQJ 3NRGA 3A03A 2NVTJ 1BL0A 2Y0SN 2GFNA 4XRSA 5FGLA 1UG2A 3PO3J 2DMPA 4BY1J 3LWJA 3TW7A 2L9RA 3S1NJ 3H0GJ 4BKXA 4A3BJ 2TRTA 1HLVA 3EGQA 2XPWA 1HDPA 4ME9A 3VUQA 5F27A 2VPRA 3B6CA 5J1RA 3S1MJ 2RAEA 3HOYJ 3GTGJ 2TCTA 3OSGA 3V78A 5EDNA 2DG8A 1FEXA 2VKEA 4FCYA 4DYRA 1AKHB 4NELA 4JX6A 2PZ9A 1IRZA 2MG4A 2UXPA 1ZQ3P 1LFUP 5HBUA 3KNWA 2HXOA 1NK2P 1VI0A 1MBEA 1Y1VJ 2OERA 2NS7A 3HOZJ 3HTIA 2DA5A 3M4OJ 2LR8A 4I6ZA 3S2DJ 1IJWC 3PPBA 1A6IA 2YUSA 2MSYA 4M3EA 2ZOYA 5HAWA 3F1BA 3BT9A 2JA5J 2JN6A 5C3EJ 1O4XA 3OIOA 3GTQJ 2HQ5A 2LFBA 3ZQHA 2E19A 1T33A 1IUFA 5EFYA 4JX4A 1UI5A 4M3BA 2CUEA 1EF4A 5GP9A 4AC6A 2FBQA 5K58A 3HB9A 5AQCA 2B63J 2DN0A 2D5VA 1VF9A 4MFEA 2DA7A 4JYKA 5C44J 3TEDA 2L7FP 1ZGWA 3EUPA 3G1LA 5K7ZA 3ZQGA 3HDDA 3H3VK 4GCKA 1QVUA 2WB1N 2EZLA 2IEKA 3Q0UA 1MH4A 1U9NA 4RDUA 5BNGA 3D1NI 1MNMC 2NVXJ 3S1QJ 4FE7A 4FISA 4A3MJ 4B1RA 5HSZA 4M3FA 4A3GJ 2XB5A 3G1OA 2GENA 2DA2A 2X6OA 4MFDA 4GCLA 2CUFA 3GTMJ 3VW2A 5D18A 4JL3A 2R5YB 2CU7A 2UXOA 3QQAA 4XRMA 2COBA 1AU7A 4JKZA 4XICA 2O9LA 1AKHA 4D7MA 2VKVA 2L7MP 1OCPA 2WUIA 4G12A 1W0TA 1MBHA 1WH7A 4M3GA 3VW1A 5IYBJ 2REKA 3S15J 2G3BA 3LSGA 1TWHJ 3PO2J 2LK2A 3ON2A 3C07A 1ETKA 3B6AA 2QIBA 3HE0A 2R0QC 2K9QA 5IP9J 4B3AA 2DA6A 2XGEA 2ECBA 4BBRJ 3DCFA 2HOSA 3BCGA 3O8GA 1POGA 1ITYA 1JUMA 4BY7J 4EEFG 2RASA 3C2BA 5CXIA 5JLWA 3VOXA 2DA4A 2QF7A 1XG1A 2DA3A 4QTRA 5C4XJ 5F0FA 2MW8A 3BG5A 5IP7J 2M9HA 2YU9J 2E2JJ 3MNLA 4HNVA 5CW8A 2Y9ZA 3S5RA 5DS9A 4HKUA 3JRIA 1BJZA 2M2EA 1A5JA 4D7NA 1ZKGA 1MSEC 2G7SA 4C2MJ 1P7JA 4W97A 3W6VA 4ICHA 3ZOBA 3K7AJ 5K7HA 1I3QJ 1U78A 1APLC 3KZ9A 3HOWJ 4MK6A 5CXGA 3ZQFA 5C4JJ 1NTCA 5IP6A 4A93J 4B4CA 3O60A 3QPLA 4MXMA 2FJ1A 1QRYA 3Q0WA 2OF7A 1K83J 2XSDC 2DA1A 4JP0A 2LP0A 3JRAA 3IV5A 3LJLA 1RETA 3ANPA 4IHXA 2O7TA 1OCTC 3HOXJ 1ZR2A 1JT6A 5DAJA 2N8GA 1ETOA 3O8HA 3G56A 3IH2A 4JX5A 1XS9A 3GTJJ 2R5YA 3NARA 3JRCA 1MH3A 1W0UA 4DZPA 5FHPA 1G2HA 3JRGA 3RKQA 3CMYA 1UHSA 2FX0A 1K61A 1BA5A 2RHAA 2EQRA 3VW0A 1U9OA 4IHYA 2XGDA 3I4MJ 3VVXA 2IAIA 3ANGA 2X48A 3BTIA 2JWTA 2K9NA 2CQQA 1X2MA 2O8KA 3GTOJ 2YVHA 3BR6A 3TP0A 5IOYA 1WH5A 3FRQA 4NN1A 4NDLA 4QSHA 3ON4A 2HOAA 2JMWA 4C3IJ 1B8IB 2ZOZA 2LKXA 3JRFA 1IC8A 2Y2ZA 1TWFJ 1JKQC 5FLVA 3BTCA 2ECCA 2ME0A 1JGGA 5M5XJ 4PXIA 2JA6J 5E3OA 4D5CA 2DMQA 3JSJA 1H88C 9ANTA 2HYJA 2EZKA 1I6HJ 4W1UA 1VFCA 1RKTA 5EGOB 4Y52J 3BR1A 3UKGA 3HEFA 1Z77A 1GV2A 1VNDA 2EZIA 1ENHA 2PMZN 3BQZA 3SFIA 1Y1WJ 4CGRA 1WI3A 2UXIA 1RR7A 5EYRA 4A3FJ 1GDTA 2EH3A 2ZB9A 3COLA 1TC3C 3GEUA 2QOPA 4DYQA 3WHBA 1JTYA 3RQIA 4XK4A 3BR5A 2OI8A 4V2GA 1ETXA 3K2AA 4UUSB 3NPIA 5IPAA 2XPVA 1MBJA 1ZR4A 4GFBA 5F0CA 1JKOC 3ZQCA 3CDLA 3MN2A 5DTDA 2QWTA 3WHCA 3TP3A 2YS9A 2QKOA 1JUSA 2XPUA 1D5YA 1U8BA 2QTQA 2R93J 5D19A 1ETWA 1IDYA 2DJNA 1UMQA 3FK6A 3GTPJ 5FJ8J 2PBXA 3VPRA 5EG0B 3CJDA 5F04A 4A3JJ 3HOUJ 5J3LA 1JT0A 2LVSA 1B8IA 1S7EA 1QPIA 2GBYA 1PUFB 3BG3A 2ID3A 5FLMJ 1YRNB 3DPJA 2OPTA 2JJ7A 1DU0A 2JA7J 2IU5A 4IHWA 3CRJA
chains in the Genus database with same CATH superfamily
2KHMA 1BR4A 3HRSA 2KDZA 3PNYA 4A0XA 4B3XA 4DNCA 2XDNA 1H0MA 1ETQA 5JLXA 3J80K 5J1UA 2QENA 2ME6A 2HZTA 1ZHFA 2E36A 3DU6A 2X6YA 4P55A 4XLNF 1HF0A 4L5EA 2VE9A 1GV5A 2L9SA 3LSJA 4YIIA 3DLLF 2EWNA 2HYGD 3ZMSA 2LLKA 3E1SA 2JK3A 2F5CA 4RLFA 4BXUA 4C9YA 2RN7A 2GOMA 5B1AH 4A3KJ 1T56A 1ZLJA 1AA7A 2XB0X 4NBQA 3S16J 4UXNA 4A3CJ 2F5DA 3NWSA 5GAGJ 3KZZA 3QOEA 4AYBN 3FMQA 4LGWA 1SANA 4DBRA 5GPCA 5LGTA 4NQWA 4E70A 2VASA 2XAJA 2L9NA 5J1YA 3DTIA 4PSXA 1EV7A 2ZSIB 2AXLA 3C2HA 3S14J 2EFWA 3M1EA 2NVYJ 5D5WB 4UVBA 3CWRA 5K5OA 1KQ9A 4WX9A 4RM2A 4E7SA 1W7PA 2HXIA 1FZPB 3C2GA 2PFBA 1D0ZA 2D6YA 3W6JB 1FBQA 3SZTA 3VEPA 3C1DA 2VUMJ 2KP6A 2K5CA 3MKLA 4E7LA 4LMYA 2CWEA 1K4TA 2HGCA 4EJUA 1JUPA 4LLLA 4JK1X 2Y0MA 4Q4ZF 4Y3OA 3D5SC 4JNNA 1TQMA 1YQAA 2OZ6A 1KQ8A 1X1AA 2W53A 2ZY9A 2GUHA 1XDUA 3JRDA 4A6EA 4JBAA 2FUG2 3OOUA 2IT0A 2R7OA 2BVLA 5GAEJ 1KQ0A 2V57A 1XMAA 3ZQ7A 2HEOA 3E7QA 2CJJA 1JJ8C 3CTAA 4C2UA 4GXOA 1ACIA 1F43A 2E1MC 5ICFA 4XRSG 4BAYA 3KEYA 5HLHA 3ZMUA 3MVPA 3TQNA 2LBFA 3OYGA 3JR9A 1UELB 2A6TA 1I3AA 2RVCA 4CYCA 3H9QA 2C6YA 3OYAA 4OIQF 1TQIA 1V5EA 1PP8F 2DQRA 4XLEA 3BNIA 2DT7B 4ZTFA 3CCVI 2NXNB 4A2UA 4XKWA 2OQRA 3K4NA 3BCAA 4NQWB 4M3DA 1LFBA 1TP4A 5DV5A 2B9SA 4BUPA 2O7TA 2JVHA 2X9DA 4J19A 1FWZA 1SVOA 1QU3A 2RNGA 1AOYA 1TQPA 1ZARA 4MO7A 4GDFA 2ADUA 2NOJB 4V2FA 3J7ZI 2PMHA 3CCRI 3CJQB 1U0JA 3AAFA 2YVEA 5KAFC 2H8RA 5J8CA 3OSFA 1X1DA 4FETA 4XOTA 4IEJA 3L2CA 2LKSA 4GFKA 3G2BA 2ELKA 3ZMVA 3NNRA 2RGVA 4BL0B 1KONA 1X3WB 2PX9A 3TOAA 5DEQA 3HTSB 2KIQA 5JI6A 3JRBA 4C2TA 4DW6A 2E7XA 2B1EA 2ZFUA 4AVZA 5HOOA 2NYXA 4FHTA 4UUTA 5CQGA 5LHHA 2FNAA 2EPFA 4ANJA 1S7AA 1QHHD 3QWLA 4Q5SF 1K6YA 2XDVA 2A6EF 1ON1A 2HQNA 2D2WA 2NAZA 2VE8A 2DG7A 3BR2A 3BLYA 5EEAA 1S7OA 4MEXF 2D45A 2F5FA 1U6GA 2X51A 3MKYB 4DZJA 4I01A 2KIUA 2K40A 1MMGA 4P9UA 2I5UA 1F36A 3Q3SA 2G0EA 4GO1A 5F1JA 3VFZA 3GMEA 2HVRA 2P5VA 3FM3A 4CYCB 5E79C 4ZYEA 2WV0A 2X6WA 1RI7A 4L5IA 2ZCNA 2ZJQF 3WE2A 3IHUA 1HBXG 2LMDA 1PUEE 1HW1A 1IG7A 4HX4A 1CF7A 4M9ZA 2H1KA 3HKZA 5D5VB 1QZZA 1K7AA 1HKQA 1SFEA 5GPAA 4NUBA 3K69A 2UXNA 5B3SH 4HF0A 4YG2F 3CC2I 1HC8A 2QVOA 4XLFA 2V1XA 3PO3J 4KITB 2L9RA 2GWRA 2BY0A 3QP5A 3S1NJ 2TRTA 2VKDA 3VUQA 2MYSA 1BI3A 1JGSA 2RAEA 1S6LA 2VONA 3HOYJ 3GTGJ 1VQKI 1YYVA 3CLOA 2MFZA 5DCMB 5J6XA 5CVUA 1U2WA 4DYRA 1AKHB 3LAPA 1IRZA 2MG4A 4YIFA 3DBLB 1ZQ3P 1TBXA 4UB6C 4HV6A 2VQCA 1OCCH 3W6KB 3FXUA 2GXAA 2YR2A 1XN7A 1SD5A 3K10A 3KYCB 5E1ZB 3L2RA 3MZYA 4A12A 2V7FA 1SVLA 2H09A 3DQVC 4L9JA 3IWFA 3M4OJ 2RKHA 3BY6A 2WY8Q 1BI2A 3CDHA 3ZCOA 2W1OA 1E3HA 4CCMA 1KGSA 4M3EA 2ZOYA 1L0OC 2PEXA 1IN4A 3K70C 1FOXA 2JN6A 1MJBA 2EIJH 2BE5F 1UHWA 2E19A 2HZDA 3S93A 5FFXA 3O3KA 2R7RA 2GIZA 4BHBA 2G7HA 3H36A 4OAYA 1YE9A 2ZXJA 2DW4A 4M3BA 1EF4A 2X4HA 2JRMA 4HEA2 5K58A 4EJWA 2O61A 2XC7A 3SEQA 3FXRA 2B63J 2D5VA 5B5EC 3FHZA 4XOPA 3VSKA 3EUPA 4XL9A 5K7ZA 1T2KA 3HDDA 1K78A 2FXAA 2XF6A 2W4SA 4AD9A 2DK5A 2L9VA 2DFIA 3JAMK 3W3CA 4ZDOA 4M74A 3M9AA 2ELHA 4O5VA 3GYHX 3PJRA 3S1QJ 3ZPLA 4B1RA 5HSZA 4F93B 4A3GJ 2GENA 5TRDA 4MFDA 3GTMJ 3F8FA 3VW2A 4HQMA 5HVQC 1GVJA 3I59A 1IZ1A 5KHDA 1X1BA 2COBA 4OAZA 4WXDA 1AU7A 2EV6A 4M6XA 1Z21A 2WUIA 4G12A 1W0TA 1MBHA 3VW1A 2F4OB 3C3WA 1T8IA 3FBIB 2ETHA 5HDGA 3ON2A 2LK2A 1NG6A 3C07A 1ETKA 1FOYA 2VC1A 4A5NA 3HE0A 4XSXF 4DJAA 3CMEI 2K9QA 3CJNA 5IP9J 3SDBA 4N0BA 2PFVA 1EH8A 3ZXSA 3DKXA 4BBRJ 1BOBA 1B1BA 3O8GA 4F55A 1JUMA 2Z99A 3VOXA 2DYSH 2DA4A 5DUIA 2XHKA 3Q9VA 1XG1A 2DA3A 4BXFA 5C4XJ 2ZJPF 2GOXB 1LDJA 2ZO4A 3WGGA 1LEBA 1D3YA 4R8HA 3X2QH 2CQNA 2EFNA 3H92A 3L00A 1M1EB 5CW8A 3S5RA 2M2EA 3QU3A 2CSOA 4P96A 1ZKGA 1MSEC 2IA0A 4L9TA 1P7JA 3M1CA 3UNGC 3V8KA 5H2FC 1E0EA 2FOWA 1KU3A 5D1RA 4M73A 3HOWJ 2HTSA 3ZQFA 2L4MA 1UB9A 4I02A 4A93J 1YJWI 2FJ1A 1QRYA 3K1NA 1WQ2A 2XSDC 2A5YB 1LQ1A 2JUGA 3JRAA 2BXYA 3DBHB 3IV5A 1WRJA 3ASNH 2F5EA 5DAJA 2UV1A 3O8HA 3S3MA 4KYWA 2JUCA 3CO6C 4G8XA 2O03A 3PSFA 2R5YA 1P2FA 1DPRA 3EQLF 4ETSA 2OJED 3EETA 1W0UA 2FA5A 2LH9A 3GZ5A 1Z7LA 3ABLH 1R4MB 3AG3H 4ENJA 2VBYA 3HRMA 3VW0A 1U9OA 4IHYA 5E1WA 2HR3A 1F1ZA 1G6NA 2WB1A 3LA7A 4RAZA 1XMKA 2VL8A 3T5XA 5B1BH 2NRAC 3I4MJ 4AVPA 4V19K 3TDUC 3ROUA 2JWTA 4CHUA 2DXIA 3H5RA 3HL2A 2HPMA 5FD5A 3LSMA 5FROA 4EM2A 3BR6A 3WTSC 1Z3XA 1RZ4A 2PG4A 2CV2A 4NN1A 4NDLA 2R7WA 4OU0A 2D1HA 4QSHA 2CQKA 3E6CC 1X19A 2HOAA 3W2WA 1B8IB 2ZOZA 3L2UA 4OWRB 4PZJA 1VQOI 5KCMA 1IC8A 2UZKA 2EIKH 4PGHA 5CJ9A 5TJJA 1BIAA 3ABTA 4JOMA 2ECCA 2ME0A 1P6RA 1JGGA 5FLVA 4TV7A 5E3OA 4H4KC 2DMQA 2A5WA 1IN5A 2HU9A 2EZKA 4XN0A 4CA0A 4IL6C 2DCEA 2FBHA 1C0WA 3H9GA 1MDMA 2IS2A 3PL8A 5E8IA 1I1GA 4LB6B 1Z77A 2EILH 2DU9A 2PMZN 4LD5A 4HNUA 2M45A 2UXIA 4A3FJ 5LRRA 4E7KA 1ZG3A 2ZB9A 3RSNA 1GDTA 3GEUA 5A2QZ 1JTYA 1FOKA 1D1AA 1P92A 4J00A 3TGNA 2XF7A 4NC7A 3MKZA 2XPVA 1YG2A 1MBJA 3HZJA 1XCBA 3ZQCA 3GO5A 5DUKA 1MMDA 3MN2A 3F23A 4WK8F 2XVCA 2YS9A 4HSRA 2ELJA 3CP2A 2XPUA 3OWTA 2XRNA 1KA8A 2M87A 2EA4A 2QTQA 4ON0A 2L7KA 5L3GA 4HG2A 1WSUA 2DJNA 4G6TB 3MFKA 3GTPJ 3H5AA 5FJ8J 2FF4A 1OQYA 2DOFA 3BPVA 4A3JJ 3HOUJ 3CDIA 1JT0A 3FXJA 4IQJA 2JPBA 2KJBA 4IJAA 1YRNB 3DPJA 3CCMI 1O7LA 2ESHA 2JJ7A 3CF5F 4IQ4A 2IS4A 2ZCMA 4AU7A 5HNFA 4BDZA 1NK3P 4IRGA 4M9SA 3DEWA 4DIQA 4AM3A 2XF5A 4N4NB 3RH2A 5EGOA 3KYDB 3AQSA 2UXUA 1XSDA 4ZH4F 1I50J 1RKWA 1FIAA 4C3HJ 3GX4X 2XGCA 3Q5FA 2V9PA 2QSHX 5AONA 3TO7A 2W00A 4UNOA 4N9HA 3A01B 5L3BA 2IVMA 3FX3A 4RGUA 4D9JA 5EF6A 2ICWG 3AKZA 4E7JA 1FJLA 4E7HA 4UUSA 2NVUB 4FTHA 4DVYP 2CUZA 2XV4S 3KP2A 1LNWA 2IP2A 3R0AA 2OU2A 5EZGA 4XLCA 4Y7NJ 5D4SA 1WGXA 3BJAA 1UFMA 3CCJI 1X3ZB 5JR3A 4RBOA 1I1SA 3K9TA 3PFIA 2L54A 3PM1A 3OIQA 4FQGA 2VJIA 1WFXA 3A02A 4N4OB 1SC7A 2Q0OA 2FU4A 3QPHA 3QRFF 2P5KA 3HYIA 4ZDPA 5LLQA 2QQBA 1XD7A 4I99C 2OC6A 4S05A 2BGCA 4BBSJ 5EG0A 2R5ZB 2YX7A 1A04A 1B72A 2ZCWA 4WF2A 4BU2A 3ZR8X 5K1YA 3LAJA 4BE2A 3NEUA 2UXHA 1GVDA 2P5LC 4WIBA 1JTXA 4A69C 4GCTA 3OL3A 3VVYA 2E1OA 5E3NA 4KISA 1E2XA 5K7FA 1S72I 2LC2A 3OYHA 2V9VA 3GVAA 4CUGA 2E2IJ 1HCRA 2AQFA 5K5QA 1JHFA 3F21A 4HF1A 5JVGF 1SGMA 3VOKA 3O6BB 2O8XA 1YS7A 2EBIA 4CCJA 3NI7A 4ABZA 1P7IA 3BP8A 3DFGA 5M3FJ 4MLOA 4NC6A 2AO9A 3RKYA 1R1VA 2HQRA 5ICEA 4MTDA 4LOCA 4HX7A 2M8EA 2G7LA 4QPOA 2FQ4A 1ETYA 2OV7A 4XN3A 5H9TA 5BPIA 2A2FX 5CPRB 3GTKJ 2Y69H 2E34A 2W24A 5BS6A 1FIPA 3KEOA 4PJLA 1NH3A 2OTLI 1IO2A 2EZHA 2VJ5A 1WJDA 1TWCJ 3OR1C 3LSTA 4FX0A 1U3EM 1XC5A 4FASD 1ON2A 1O57A 2F2EA 2PMUA 1B4AA 3PUBA 5FO5A 3WGHA 2RREA 1R49A 4ASNA 2DFFA 3T8RA 2ZNZA 4S0HB 3DEEA 2Z3YA 1Y8RB 1DDNA 2LTPA 4RAGA 3KKDA 1OCRH 4I0AA 1D5VA 1N75A 4ESBA 3QP6A 1ZGAA 3U9GA 1A36A 1IDZA 4HLXA 1ZELA 3I56I 2YU3A 1VQNI 1OYIA 1HOMA 4C30A 5M3MJ 3B81A 2I10A 2QBYA 1BR1A 3HIFA 3G3ZA 4KFCA 5IYDJ 3IUOA 5D8LB 1D8JA 4EJOA 4IHVA 4CGZA 1BR2A 1MJAA 3GUDA 1B72B 1FT9A 1H8AC 1RC9A 3QKXA 4BDYA 3LSHA 1GT0C 3K0LA 1RPWA 1J9IA 2Q2EA 3BROA 3L1PA 6PAXA 2WBMA 1ZG5A 1MBKA 3M7GA 2PBIA 2QQAA 3OIPA 2ZMEB 4LB5A 2K02A 1ZTRA 5FKOA 3R0JA 2R7XA 3RPUD 1RESA 2R7VA 1TT0A 3SJMA 2V4JC 3BTLA 4HYEA 3JW4A 3P9TA 1I6XA 4P5OA 2ZCXA 2E7WA 4IOCF 2NX4A 3FK7A 4MGRA 1FTZA 3TMOA 1Z67A 4DYCA 1IF1A 1ETVA 2Y75A 5J4VA 1MSFC 1JHHA 1IV6A 4A0ZA 1J5YA 1VQ6I 3NXCA 2PN6A 2DMUA 5HODA 3PFYA 3SZGA 2BV6A 2WAQA 3CCQI 3GTLJ 4NB5A 3A0HC 2OA4A 4PUSA 2K9SA 2VI6A 3BDDA 2CMPA 3BG9A 1TL8A 1PDNC 5KK1A 1KYZA 1Y0NA 4CXFA 1ZRFA 3PIOF 3BR3A 1X58A 4PSWA 3LNQA 2QLZA 3QPSA 2NS8A 1G3WA 3BZKA 1Y56A 1MKMA 4BE0A 3A03A 1XMXA 2D1VA 3NS4A 2LY2A 4OIRF 2A3SA 1MNEA 4RGXA 2IGMA 2QBYB 2XAFA 3CZ6A 4IX7A 2KJCA 2FBIA 2FE3A 3H0GJ 2DDBA 2BEOA 2VXDA 1HDPA 1RUOA 2BHZA 4CDGA 4ME9A 2VPRA 1W5SA 4BGDA 5KAIC 2OAZA 3SHFA 2X6XA 2TCTA 4WXHA 1OCZH 5EDNA 4BJ6C 5CKTA 2Q2EB 2QWWA 4FCYA 1UZCA 3K1MA 2XASA 3FKJA 3TBIA 1R23A 2KZVA 3MQ0A 4E4HA 1QBJA 1YITI 1LFUP 2UXPA 3HSFA 4BEHB 1B9NA 2G7UA 2JPCA 2NS7A 2XKOA 3HOZJ 3F8BA 4YFNF 3ERED 3S2DJ 1Z1DA 1Z3YA 2W57A 4ZYDA 2DK8A 2ZNYA 1BC8C 1A6IA 2YUSA 2MSYA 2JRTA 3CCEI 3WTUC 2QYOA 3F1BA 3BT9A 5C3EJ 3OIOA 5HLIA 3GTQJ 2LFBA 3MCZA 4L9VA 3WTVC 1S5LC 4UY8I 4CZCA 2M7BA 4AIDA 3V7SA 5EFYA 4JX4A 1B6AA 5CVRA 4LG3A 1QQIA 3GFJA 2CUEA 4AC6A 2EA2A 5L3EA 4AIJA 4KUMA 5HS9A 4A5MA 3OS2A 1Z6RA 4U88A 5AQCA 1R7JA 2CUJA 1MIJA 3TEDA 1YO5C 2KIMA 5FB2A 1WI9A 3ZQGA 3H3VK 4GCKA 2W82A 1SD4A 3RCOA 2NS0A 3WG7H 2DDAA 3P9IA 2RDPA 4RAYA 1BN5A 1HQCA 2X85A 2IEKA 3Q0UA 1MH4A 5CVJA 1IV8A 3OYCA 1MNMC 4FE7A 4G6QA 5JFRA 4FISA 2GIVA 4B48A 2ZMEC 3K4MA 1USSA 2XB5A 2ESNA 3WG9A 2CUFA 1FNNA 5GTHC 5DCMA 1VQMI 3HG9A 2FRHA 2CU7A 4CCOA 4XRMA 2K9LA 1AKHA 3VSLA 1R4NB 4D7MA 1OYYA 3GFMA 2L7MP 1P9QC 2O6GE 3FXMA 1QNTA 3GXOA 4L5JA 2G3BA 1SD6A 2Y0SA 1TWHJ 4CCKA 3PO2J 4C2MA 2PQ8A 3B6AA 3RJPA 3S2WA 3OYDA 4HPQA 3BG6A 4YIRX 2KKOA 4ZC3A 5EEGA 4F52A 2R4GA 3PIPF 4LLNA 1TNTA 2BY3A 1POGA 4JQFA 4EEFG 3C2BA 5HLTA 2RASA 5CXIA 4QTRA 4KNYA 4ZJZA 5LHIA 2OTJI 2VC0A 2MW8A 3BG5A 3ZGKA 2GXBA 2M9HA 3U2RA 3EDPA 5GAHJ 2E2JJ 1Z05A 2CS3A 3E6DA 5LD2C 3CD6I 2M30A 2VQHA 3I0TA 4GGGA 2M1BA 3JRIA 4IO9F 1RRJA 4LIUA 3FWEA 3IKVA 2KISA 2DLLA 4W97A 3W6VA 4ICHA 1VQ5I 3JSPA 3RQ4A 2P6TA 3K4LA 1I3QJ 2Y48A 3JTHA 5K7HA 1APLC 2K85A 1W5TA 1QGPA 3OYJA 4PDKA 1K83J 2DA1A 4JP0A 3B02A 2PJRA 2VT2A 3LJLA 3DXJF 4PGGA 1Z7UA 1E17A 3QYFA 3O2PE 3HOXJ 1W1WE 3J7YJ 2VODA 1ETOA 3G56A 4OMZA 2M4GA 2DYRH 2KQRA 2XGXA 5BMZA 3KEQA 3TDZC 1BBYA 1FP2A 3I53A 4CICA 3JRCA 1W36C 1U8RA 1MH3A 2JT1A 5GADJ 2BZTA 4Q47A 2FEZA 3FHNA 3NQOA 4DZPA 5FHPA 2DT6A 2FX0A 2V1NA 1K61A 3LFKA 1BA5A 4IPAA 5CVIA 2RHAA 3EPZA 4I0BA 2YPRA 1IN7A 1W4MA 3VYSB 1NHAA 3ANGA 2VQLA 3E5UA 2OCCH 1X2MA 3P5JA 5EJCA 2YVHA 4EMSA 4U9NA 2WTEA 4EQQA 1WH5A 3A2KA 3FRQA 3OV8A 1TW2A 4BQQA 3W2VA 4BNCA 3F6OA 4CSWA 2JMWA 3U1KA 3JRFA 2R7DA 2EV5A 2LF8A 4HDVA 1G8XA 5M5XJ 5ILSA 2JA6J 1EH7A 5D6EA 4X0GA 5ICCA 1R71A 1H88C 1W36D 1TT5B 2XKPA 3BJ6A 3PUFA 4W1UA 4UV9A 5DD8A 3UKGA 2BOLA 2F6CA 4QLCU 4XMYA 2O0YA 1SVMA 2EZIA 1ENHA 1Y1WJ 1XGMA 4EM1A 4CGRA 3HSEA 2WWYA 3HRTA 3COLA 2E1CA 5ED4A 2H94A 5LFAA 1PVEA 2E1NA 3WU2C 3S32A 2HDCA 2XAQA 2PJRB 1ETXA 3E6BA 4Q48A 3NPIA 4N9IA 1ZR4A 2QQ8A 2W25A 5LHGA 2E35A 3CDLA 2EFPA 3H0DA 2VIXA 4UB8C 5DTDA 5H6QA 4KN4X 1JUSA 2E5NA 3IAS2 5F64A 1EA3A 3ZN0A 3I71A 1FMWA 3LL7A 2MABA 3HRUA 3KCCA 3V8LA 4L0ZB 4MNUA 1FSEA 1FYLA 4HF2A 2A61A 2R93J 3GLXA 1FY7A 3LA2A 3I54A 3KIOA 1QHGA 1O3QA 4HW0A 2PBXA 4UVAA 1FX7A 3CJDA 5FRNA 1ZLKA 4NNJA 5HNHA 1JI8A 3F22A 2LVSA 1B8IA 3RIRA 2P0WA 1PUFB 3BG3A 1DU0A 1XGNA 3L09A 4IHWA 3CRJA 3V7CA 5JVTA 1R5ID 1SFOJ 3LFUA 1XB4A 2V1UA 2GZWA 3RYPA 2UUZA 2HKXA 3OYFA 5TGTA 4BJTA 5LGUA 2GLOA 2HNHA 2WC2A 2BY1A 4IRIA 2Q24A 2H8WA 3QYEA 3LOCA 1ZRDA 3AQTA 3HIMA 2DMTA 4YZEA 4XR6A 2PLYA 1LE8B 4M6YA 4EVIA 2ZKZA 5FKKA 3BRUA 3Q0VA 1S3JA 1A35A 1GUUA 3LA3A 2P8TA 3J81Z 1G3SA 2FMLA 2LRDA 5D4RA 5C4YA 2R92J 1E3OC 5FKLA 2JTVA 4OD4A 3CMMA 3HSRA 3V6GA 2VQGA 5H20A 2B7EA 2ZSHB 1BW5A 3RZOJ 2HS5A 5AIQA 1OISA 1IUYA 3T1BA 2CW8A 4OOIA 2HDDA 1H89C 4EJVA 3HTJA 5FLXZ 1JJ6C 1FC3A 2L2OA 5E3LA 2P81A 3DBRB 3I4PA 1USTA 5DCFA 1R1TA 3RPUA 2E5ZA 5EEHA 1RR8C 2OQGA 3PASA 1SAUA 2ZJ2A 3DWLE 3L9FA 3J7AY 2K3PA 2WGBA 2H1LA 3LSPA 4XKVA 5HDKA 4HRIA 5IYCJ 2DAOA 1OJLA 3GEZA 1QZEA 1YRNA 3EUKL 1HDDC 3D5RC 1HXDA 4Y17A 1OFCX 4RB1A 4DGWB 1ULYA 5FMPA 3HBLA 4OIPF 4HV5A 2IXSA 3FM5A 1XPXA 4XLAA 5IT9K 2XROA 1KU2A 2A69F 4WXCA 3S1RJ 1YS6A 3J80Z 2CRGA 2DBBA 3BWGA 3HPHA 3ZQIA 4ZYAA 1DQUA 2HI3A 3RZDJ 2QKLB 2F4MB 2RNJA 4LLGF 2Z33A 1DP7P 1EJ9A 1IRXA 3F3XA 2LOOA 4IXAA 3RKWA 5M5WJ 3ZMZA 3A01A 3H5NA 3E7LA 3HKZN 2UXXA 3S17J 2IS6A 1OPCA 1R58A 2XAHA 2Q8KA 2CYYA 1IRFA 1ZYRF 3LSRA 1FTTA 2PJPA 1DU6A 4OD5A 3HC7A 4M6VA 3WU0A 2ISYA 1JKPC 2KIFA 2M34A 4AIHA 5F0HA 1BC7C 2W48A 1LJ9A 3DPUA 4DBQA 4IOAF 1T6SA 1O3SA 3REOA 3I64A 4IRVA 2K7LA 3WTWC 1XTAA 1Z0XA 2J5PA 3F8MA 4A0YA 3G6EI 2EINH 5EZHA 2NP3A 3BR0A 1PYVA 5FKNA 2R5ZA 4L62A 2V79A 3VVZA 1IXSB 2K27A 1ZH5A 1Q1VA 1Y0UA 3I58A 3WTYC 2NP5A 2LKPA 3OYBA 3FXKA 2L7ZA 3T6NA 2LY9A 2EFQA 5F08A 3HOTA 1P4AA 3IH4A 3A1YA 2CV0A 2Z9OA 1L3LA 4KN7X 3GFLA 3ABMH 4X6AJ 1ZN2A 1TWAJ 1WJEA 2E2HJ 1XSXA 1LFPA 3OYNA 4YRVA 2XRLA 3DLAA 3BTJA 3GLLA 4ZYHA 3M3YJ 2MGQA 2E71A 3FKIJ 4D5FA 4C3JJ 3WTTC 2DODA 3KZIC 5M5YJ 3FZVA 3IH3A 4QIWN 3TO9A 1TTYA 4UUVA 4BJ5C 1YIJI 4G6DA 4M72A 2A07F 1FYKA 3QYBA 4X1EA 3K4BA 4ACIA 4EM0B 1YX5A 3OR2C 4E6KG 3QU6A 5AIPA 3OYKA 2HYTA 1OCOH 3CQZJ 4EATA 1BJAA 2WV1A 1ZK8A 2BW3B 3F6VA 4R1HA 2FOKA 3AFHA 5E3MA 2M8GX 4KWAA 4BHCA 4IRHA 5ILUA 1K6OA 1V54H 1WCMJ 2R7ZJ 1XGSA 3S3NA 3CCUI 2JA8J 2F5VA 4AUXA 3VODA 2EB7A 1TNSA 3TW6A 2NVQJ 5E1XA 1F5TA 5D5XB 3NRGA 2A6HF 2Z5UA 3ISPA 1DPUA 3GZNB 2XSJC 2CFXA 3NWTA 4XNFA 5FGLA 3IC7A 3DPTA 3RYRA 3LWJA 1GLNA 4MQ9F 3CUOA 3HUGB 2XPWA 5F27A 2HPIA 2QEXI 1WJFA 1E3PA 2YSRA 1ZG1A 3S1MJ 3SZPA 3ASOH 2HYFA 5E20A 4MHGA 5J8FA 4S04A 3V78A 2LF7A 3CP8A 2ZMEA 1K4SA 4YFKF 2DG8A 4KDPA 2VJJA 1FEXA 2Z16A 5FFZA 5L3FA 4LJZF 2H27A 4RS8A 1GXPA 4JX6A 4UHTA 3ZP5A 2PZ9A 5BOXA 3VOEA 5BPDA 3E6MA 1Z6TA 4U0YA 2HXOA 3GF2A 1X4OA 1VI0A 1NK2P 4F7ZA 1WJAA 2IGNA 1OKRA 2IGOA 2OERA 2WA0A 1S9HA 2W7NA 2IPQX 2WY7Q 3PNTA 2BBYA 3E97A 1KU9A 4EJTA 2WAFA 3PPBA 2W85A 1I27A 5HAWA 5K5RA 1STZA 1O4XA 5JHUA 2MBFA 3ZQHA 3CMAI 3CC4I 1SMYF 1LEAA 4U7BA 3FF5A 1R5GA 2LY1A 1T33A 2B0LA 2AQEA 2M7AA 2ZBKA 1UI5A 1MZBA 2QZ8A 1IRGA 3PQKA 3K8PC 3L7WA 2CW0F 4Y33A 2BVMA 2P4WA 3K1PA 3HB9A 3CO7C 2DN0A 4UVCA 5L3DA 4MFEA 2STTA 1ZGWA 4XKCA 2L7FP 1GXQA 2R7SA 4PJJA 1G59A 1AWCA 1H9TA 3BJOA 1QVUA 2DI3A 2WB1N 4CZZA 1FSHA 3CJRB 3LMMA 5KVRA 2EZLA 2QA4I 5LBQA 4RDUA 2KRFA 2CGPA 3ML6A 5BNGA 1LPQA 2JQ7A 2NVXJ 1EKEA 4A3MJ 1SEUA 1UAAA 3WU1B 3V42A 2X6OA 3MKWB 4GCLA 2BY2A 3M8EA 4XSZF 4ENKA 3DTKA 2K4BA 3TL4X 1UJ8A 1SFUA 2UXOA 4ZTJA 2OCEA 2QUFA 2X0LA 2DPDA 1Q1HA 1OCPA 3E5QA 1WH7A 4YFXF 4BEHA 1WVRA 1VQ9I 2L02A 2DFEA 3KLOA 4G9YA 1WHUA 3KX2A 3LSGA 4KIFA 3S15J 1YX3A 3CF2A 4RM3A 5DYMA 3OYMA 4B47A 2LSOA 4O3MA 2QIBA 4IF4A 4ITVA 4ENNA 3JSOA 4Y15A 2F48A 3OS1A 3G73A 2XGEA 1O3RA 1J09A 4P1WA 2HOSA 4LK1F 3BCGA 1ITYA 2GA2A 1LVKA 2P6SA 4EGYA 4Z6YA 2IS1A 2FMYA 1FP1D 2ZXWH 5IP7J 3CCSI 2ZJRF 2LYCA 2YU9J 3MNLA 4HNVA 4BE1A 1OR7C 3H35A 5J40A 5B66C 1T98A 2BHYA 3PSIA 4PJNA 3VYRB 3I3LA 2G7SA 2R3SA 3ZOBA 4U7DA 3K7AJ 1U78A 4MK6A 3G4SI 5CXGA 2RV8A 1HSJA 4MXMA 3EUAA 3KLNA 3KP5A 2OF7A 3Q0WA 1CGPA 1OYWA 2LP0A 3AG4H 4XLHA 3JAMZ 4IHXA 2YX4A 5A2QK 2R7FA 1OCTC 1MW7A 2EV0A 1T08B 1OLTA 1N25A 1Y6IA 4R79A 1DP3A 2K9MA 3FMSA 4HDUA 2AS5F 3TO6A 5D6FA 1MD0A 3ERMA 3C7JA 3U21A 3JRGA 3RKQA 2MD0A 3BG7A 3S3OA 3IAM2 4II3A 3UR3C 1X1PA 2EQRA 3ZN1A 1X3UA 3FXOA 4KMUX 2P7VB 4PJMA 4L9NA 2IAIA 2A68F 3BTIA 1NG7A 1DGRM 3GTOJ 5D5UB 4B43A 1T39A 5IOYA 2ZXIA 1PP7U 2L4AA 2K3FA 4ESFA 2IA2A 3ECOA 3NRVA 2WADA 3VWBA 5E18F 1VZ0A 4KICA 2MLGA 1X1CA 2LNBA 1TWFJ 2Y2ZA 4WCGA 4OINF 3SFZA 3BTCA 4PXIA 3DP7A 3JSJA 1RIOH 3I5UA 1IN6A 2KPMA 4U87A 2HYJA 3OYLA 1VFCA 4HNTA 1RKTA 4Y52J 3BR1A 1QA6A 3LWFA 2M3AA 1LB2A 4LITA 3V4GA 4II2A 1HSTA 1VNDA 5LGNA 3R4KA 4D0PA 3W2AA 2QSGX 5EYRA 2EJRA 2VLAA 1TC3C 2QOPA 4DYQA 2KRCA 5E17F 4XK4A 4HAMA 4V2GA 3KP3A 3FBNB 3QODA 3EUHA 1YJ9I 1T0FA 1ODDA 2K86A 3V8JA 1J2XA 3H9JA 2QWTA 1LVAA 3ECHA 3K4JA 1B59A 2QKOA 4BQNA 2JA2A 1U8BA 2O5RA 1F4KA 4B44A 4KIBA 3COAC 5D19A 1OMIA 1IDYA 3FK6A 2XIGA 5HS8A 4IHTA 3CLQA 1YW7A 4HQEA 2NNNA 5LEKA 3LSKA 5J3LA 1WJBA 1YTYA 1S7EA 4PFPA 1W7PB 1QPIA 1F9NA 2GBYA 3FXLA 5IT9Z 1DUXC 5J47A 1Z91A 2ZXHA 1XDSA 3DEUA 3GCMA 4PJ0C 1WKMA 3R61A 4RB2C 4I76A 3OYEA 3HOVJ 2F07A 2Y31A 1MBGA 4KMFA 3N97A 1V3FA 1TWGJ 1SFXA 3SQNA 1LDDA 2HTJA 3I4NJ 1LUJB 3VYTB 5IOZA 2VXZA 1UI6A 3VB2A 1AHDP 2V9KA 2OZUA 4DQ2A 2VOOA 1O7FA 1T38A 1U5TA 4B8XA 4L18B 4G7ZF 3V7RA 2CFOA 3OOPA 3BQYA 3MZ8A 4IHSA 2GQQA 4GCVA 1R00A 4H0EA 3VTIA 5IT3A 3E5XA 1FBUA 4ZZDA 4HZFA 3P9CA 2PI0A 1LKXA 2LBFB 3CUQA 2L5QA 2QKMB 2DMNA 3G7RA 1EH6A 2AHQA 2MA3A 4A3EJ 3KETA 1UG0A 1YI2I 2VPLA 1ONVA 2COMA 3HGYA 2DFHA 4XONA 1CQTA 3ULQB 5CVVA 3OL4A 4A3IJ 1KYWA 2IBDA 2KT0A 3B73A 3DF8A 1D0YA 4U0WA 2G7GA 2PMZA 2DQLA 3IP4B 2DTRA 4HA8A 4XORA 3G71I 1RUNA 3VP5A 4KT6A 4F91B 3EYYA 2A05A 4XRFA 1TZLA 4QWQA 2RQQA 5J4YA 4HOBA 3JRHA 2KRHA 3HTAA 1REPC 1PUFA 2HOTA 4UDSA 1S8NA 2IRFG 3E3VA 2M0CA 5CQEA 3NAUA 4MTEA 2I8DA 3QBMA 3BPXA 2R7QA 1R22A 3LSIA 1HW2A 1BW6A 1SD7A 1JE8A 1J75A 2GM4A 1BIBA 1R1UA 4QPQA 5HS7A 2ZFWA 3D5LA 4PFOA 2DJIA 2WAQN 3IUVA 4FE4A 1X2NA 4KA4A 2Y9YA 1MMNA 3OS0A 4E7IA 2MH2A 1LE8A 4HLYA 2MD5A 1QZYA 3HPGA 3MEXA 3HM5A 1O3TA 1U5TB 3KZYA 3VDXA 3KP7A 2HWVA 1KU7A 2Z2SB 3SDGA 4G7HF 1WPKA 3FISA 2L0KA 1TLHB 3DPLC 2QCOA 3HTUA 3HJEA 2OBPA 4BQOA 4OMYA 5HDNA 3H3UA 4M9XA 2TDXA 3RD3A 3H3ZA 4RGRA 3VIBA 3GBGA 5CYVA 4AC0A 2HKUA 2DOEA 3WODF 4A3LJ 1SAXA 3HTHA 3CUQB 1YJNI 2DPUA 5FGMA 1FOWA 2STWA 3K4KA 1V55H 1YIOA 4LFUA 4CCLA 4GYGA 3OMYA 1IGNA 2VJ4A 2O7OA 2QSFX 3U1DA 3LHQA 1G3TA 1CF7B 1Z9CA 1VQLI 3M07A 1VQ8I 4NC8A 4D1QA 4ZDLA 3S2HJ 3Q9SA 4XKBA 4LK0F 3HHHA 3GWZA 2HFHA 4MIMA 1A31A 3JREA 3BHQA 2ID6A 4CH7A 3WTXC 3EYIA 4HBLA 3M8JA 3L2VA 1P4WA 2L3DA 2V6EA 3K70D 1QPMA 2AXTC 4A3DJ 3G1MA 4ENMA 1BI0A 1QVTA 1UHMA 2K4JA 1G3YA 3HXLA 1S29A 4GYIA 2LD5A 3A0BC 3GZIA 5FKMA 3P9KA 2XUBA 2R7UA 3LQRA 5F1RA 3ONQA 3HGGA 3KP4A 2UWMA 1XSVA 1GHCA 3BJBA 2GXGA 2L01A 2CQXA 4EGZA 4OIOF 4I09A 1ORKA 5BQTA 4CYDA 4XIDA 3KKCA 1ZRCA 4P9FA 2OUMA 1W7PD 5F6FA 1R9TJ 2CW7A 4A6DA 4LG0A 1UCRA 4GFLA 3ZQLA 5L3CA 1MMAA 2F4IA 3EUHC 3A4CA 4RA2A 3HOSA 4AF5A 3F0CA 1T0FC 3OYIA 1Y8QB 1VTNC 3BZCA 2V6CA 4BS9A 2HKOA 1JKRC 3KE2A 2DTZA 2NOGA 4BH9A 4MQVA 3SYTA 4B09A 4BXXJ 2M5WA 2MH9A 3SXYA 1J0RA 2KFDA 3RTRA 3RI4A 3FIWA 2LDUA 2M4KA 2Y30A 2V1DA 2FD5A 1MBFA 3C18A 3CCYA 3GW2A 2CV1A 3J7AO 1N77A 3L2QA 1ZREA 2NVTJ 5FD6A 1KZHA 1K78B 1BL0A 2Y0SN 4U0VA 2GFNA 1P4XA 3ZMDA 4XRSA 1UG2A 2EFOA 2DMPA 4BY1J 3K6GA 3TW7A 3L2WA 2H6BA 4I2OA 4BKXA 5HLGA 4A3BJ 3EGQA 1HLVA 3OY9A 1B9MA 1WZ2A 1TW3A 3B6CA 1QO0D 5J1RA 1FMVA 2VBZA 4LIVA 3OSGA 3AL0B 1MMSA 2IJLA 3ABUA 2VKEA 4Z2YA 3I59B 2FJI1 1V4RA 2DO7A 3MMYB 4RMNA 2BYVE 4NELA 1U5TC 5HBUA 3F72A 3F8NA 3KNWA 2X1EA 1YHQI 1IAWA 1D0XA 5GTIC 3IL2A 4MEYF 1MBEA 1Y1VJ 4Y13A 3QPTA 3VYUB 3HTIA 3R6SA 2DA5A 4I98B 1VQ4I 2LR8A 4I6ZA 1JXSA 3QOPA 2BW3A 2HDWA 4L0YB 1BOAA 3ZQQA 2Z1DA 1IJWC 2CO5A 4F3QA 2J5OA 3CUQC 2M0MA 4FX4A 1VQ7I 2JA5J 4LG0B 2CQ7A 2HQ5A 2FQ3A 2Q1ZB 2ZC2A 1LDKB 1XCVA 4RAFA 1IUFA 3ESWB 3T0YA 4CCNA 5DDGA 1IN8A 5GP9A 3R60A 3MWMA 2FBQA 4YELA 1D8KA 4ESJA 5LEJA 1OR7A 2VKHA 1VF9A 2DA7A 2IA1A 4JYKA 5C44J 3I9V2 1I39A 3ZRGA 1G4DA 3G1LA 2EIMH 2G9WA 1XX5A 2XAGA 4BHPA 1SMTA 3M8FA 3DV8A 1U9NA 1V5GA 1ZAOA 2HQAA 3HUGA 3KYLA 3D1NI 3E0JB 3H1CA 5ERIA 2X1CA 3CESA 4M3FA 1V5FA 3G1OA 3BCBA 2DA2A 4XQFA 1HKTA 3KP6A 2MC3A 3RPQA 2E60A 4AYBA 5D18A 4FT8A 4RLQA 4JL3A 2R5YB 4JKZA 4NHJA 3QQAA 2IW5A 4XICA 2O9LA 2VKVA 1BI1A 4M3GA 1X4PA 5IYBJ 1YLFA 2BXZA 2FNPA 2REKA 1PJRA 5E8GA 3P7NA 4DOZA 3TKYA 4CO8A 2R0QC 2V26A 5ILVA 4RB0A 2ISZA 1WWXA 3WE3A 3WGIA 4B3AA 2DA6A 1FLIA 2ECBA 3DCFA 5TISC 4UV8A 2RQPA 1J59A 2VBWA 2KMUA 3AG2H 4PCQA 4BY7J 5JLWA 2HVQA 2QF7A 4ZYGA 1R6RA 2VN2A 1J7KA 2VT3A 5F0FA 5ICGA 2CH0A 3IRRA 3F9KA 2LG4A 3DKYA 3PQJA 2Y9ZA 5H6RA 5DS9A 3TOBA 4BYYA 4HKUA 1YOVB 1BJZA 1A5JA 4D7NA 4EV0A 4C2MJ 4E7ZA 3KFWX 1MDMB 3CC7I 3IKTA 3KZ9A 4IZZA 5C4JJ 1NTCA 5IP6A 2DT5A 1HKSA 4B4CA 3O60A 3QPLA 3BC8A 3JCUC 2HOEA 1D1BA 2EK5A 3IRQA 1RETA 3ANPA 2R7TA 3WTZA 4BACA 1MGTA 3PNVA 3JTGA 5CLSA 3SEZA 1JT6A 4PK4A 4K2EA 5DM6F 2N8GA 3GZ6A 1ZR2A 3AL0C 4J01A 1WJCA 3DKWA 2JVGA 3IH2A 3N05A 2KLOA 4JX5A 3K4CA 2RC4A 2WAEA 3GTJJ 1YFHA 1XS9A 5D8KB 4IKFA 3NARA 1YW9A 1DGWY 3FDYA 1BM9A 1IXRC 1ZGJA 1G2HA 3FXQA 2ACJA 3CMYA 1UHSA 1R5HA 1A6QA 4Y4RA 2KZGA 1K79A 2QGUA 2XGDA 2FBKA 2IGKA 2QQ9A 4WWCA 1FBSA 4HSTA 3VVXA 1VQPI 2X48A 3MD2A 2LREA 3FMRA 3MZHA 2FSWA 4XM3A 2K9NA 2CQQA 4GRIA 2O8KA 2XAUA 1R36A 3QAHA 3TP0A 1N78A 2HVSA 2VOPA 3DTEA 2JSPA 5DD4A 3D0SA 3ON4A 3GFIA 4I7HA 4C3IJ 5DM7F 2LKXA 2MLKA 3SWHA 2P7CB 4G94A 2YVXA 4G7OF 5IY5H 1JKQC 4RB3C 3F8CA 4AWXB 4D5CA 2MC4A 1W5CC 2CG4A 4KIGA 2JSCA 3RDIA 9ANTA 3DU5A 4HX8A 4M71A 1I6HJ 2KL4A 3RKXA 5EGOB 1H9GA 3MAJA 3HEFA 1GV2A 5KNLA 3ABKH 3SFIA 3BQZA 2DOAA 1WI3A 1RR7A 1IW7F 1SFKA 1WJ5A 2EH3A 3LQQA 4XBFA 2GAUA 3WHBA 1D1CA 4O6JA 1XGOA 3RQIA 3S8PA 3BR5A 3KPHA 2OI8A 3AG1H 3BOQA 3K2AA 4UUSB 2NNYA 5IPAA 2E1MB 3J81K 5LRSA 4GFBA 5F0CA 2B3WA 1JKOC 1HW5A 1YW8A 3K2ZA 4U9LA 2VBXA 4IVNA 2W84A 4AIKA 3ELKA 3TP3A 3WHCA 1ERDA 4BQAA 2X1DA 1Y39A 3CCLI 1I5ZA 2JZYA 5FRMA 1D5YA 2VB6A 3I55I 3CJTB 3T8TA 5FLXK 2OD5A 3ZMTA 1ETWA 1MJ9A 1UMQA 3HHGA 3IWZA 2O3FA 3VPRA 5EG0B 5F04A 4XLPF 4KJZA 2H6CA 2KDOA 4RGSA 5JHFA 1RNLA 2QM3A 3N4MA 1HA8A 2GA1A 3BZ6A 1T95A 2ID3A 4F92B 4YEJA 1IXCA 4KT5C 2OPTA 5FLMJ 1FYMA 2JA7J 2IU5A 4ZZLA 1FPQA 1MNDA
chains in the Genus database with same CATH topology
4I76A 3HOVJ 2KDZA 2Y31A 1MBGA 1SFOJ 2F07A 2ZCMA 2XDNA 1TWGJ 1NK3P 1ETQA 5JLXA 3I4NJ 5J1UA 3DEWA 2GLOA 3RH2A 5EGOA 5IOZA 1UI6A 3AQSA 1AHDP 2UXUA 2ME6A 2Q24A 1I50J 1RKWA 1FIAA 3LOCA 4C3HJ 1HF0A 4L5EA 3AQTA 1GV5A 3HIMA 2DMTA 2XGCA 4YZEA 5D1RA 1LE8B 3LSJA 3BQYA 3A01B 5FKKA 3BRUA 3Q0VA 2LLKA 5EF6A 1GUUA 2JK3A 1FJLA 4UUSA 4A3KJ 1T56A 4FTHA 5C4YA 2R92J 2XB0X 1E3OC 3S16J 5EZGA 2DMNA 5FKLA 4A3CJ 3G7RA 4Y7NJ 1WGXA 3V6GA 2AHQA 4AYBN 4A3EJ 1BW5A 3RZOJ 4RBOA 3PM1A 5GPCA 1SANA 3HGYA 1CQTA 3A02A 5J1YA 4A3IJ 2HDDA 1H89C 2IBDA 2KT0A 3HTJA 1JJ6C 2G7GA 5E3LA 3S14J 3VP5A 2P81A 2NVYJ 4BBSJ 5EG0A 2R5ZB 3CWRA 3PASA 2WGBA 1B72A 3LSPA 3JRHA 5IYCJ 2UXHA 1GVDA 2HXIA 1OJLA 3HTAA 1JTXA 4A69C 1PUFA 1YRNA 4GCTA 2HOTA 1HDDC 2D6YA 4UDSA 1OFCX 2E1OA 5E3NA 3VVYA 5FMPA 3HBLA 5K7FA 2VUMJ 2M0CA 3MKLA 2E2IJ 1HCRA 3NAUA 3S1RJ 3QBMA 2CRGA 1JUPA 1SGMA 3VOKA 1BW6A 3ZQIA 2GM4A 2EBIA 3NI7A 4ABZA 1P7IA 4JNNA 2HI3A 2WAQN 3IUVA 5M3FJ 3RZDJ 4FE4A 4MLOA 2AO9A 1X2NA 2W53A 2Y9YA 2GUHA 3JRDA 4LOCA 3OOUA 2G7LA 2FQ4A 1ETYA 1LE8A 5H9TA 5M5WJ 2V57A 3GTKJ 3A01A 3E7LA 3HKZN 3E7QA 2CJJA 3HM5A 3S17J 1JJ8C 1F43A 4XRSG 1FIPA 3SDGA 1WPKA 2EZHA 3FISA 2L0KA 3LSRA 1TWCJ 3MVPA 1FTTA 2QCOA 1XC5A 1DU6A 3JR9A 3RD3A 4M6VA 4CYCA 3VIBA 3GBGA 1JKPC 2M34A 4AC0A 2HKUA 5F0HA 4S0HB 2W48A 4A3LJ 3HTHA 3BNIA 2LTPA 3KKDA 1IGNA 1Z0XA 2O7OA 5EZHA 1IDZA 4M3DA 3BR0A 2R5ZA 5FKNA 2NP3A 1LFBA 3LHQA 4L62A 3VVZA 1HOMA 3S2HJ 5M3MJ 3B81A 2I10A 1Q1VA 2X9DA 4J19A 5IYDJ 2NP5A 4MIMA 4MO7A 2L7ZA 3JREA 2LY9A 4IHVA 3BHQA 3T6NA 4V2FA 2ID6A 5F08A 3IH4A 1B72B 1H8AC 3QKXA 2YVEA 4X6AJ 2H8RA 1GT0C 1TWAJ 3OSFA 2E2HJ 4A3DJ 1RPWA 3G1MA 4IEJA 3L1PA 4GFKA 2ELKA 2XRLA 1QVTA 3BTJA 3NNRA 3M3YJ 2MGQA 1MBKA 2LD5A 3FKIJ 4D5FA 3GZIA 4C3JJ 5FKMA 5M5YJ 1ZTRA 3HGGA 5FKOA 3JRBA 3IH3A 4DW6A 4QIWN 3BJBA 2CQXA 1ORKA 1RESA 4XIDA 3KKCA 3SJMA 3BTLA 4UUTA 3P9TA 4X1EA 4ACIA 2ZCXA 1R9TJ 2NX4A 3FK7A 2HYTA 1FTZA 2DG7A 3CQZJ 4DYCA 2WV1A 4GFLA 1ZK8A 3BR2A 1ETVA 5EEAA 3ZQLA 1MSFC 1IV6A 5E3MA 2M8GX 4DZJA 3NXCA 4AF5A 2DMUA 2K40A 3F0CA 5HODA 4KWAA 3Q3SA 1F36A 2G0EA 5F1JA 3GTLJ 1JKRC 4CYCB 2DTZA 2NOGA 1WCMJ 2K9SA 2VI6A 3BG9A 2R7ZJ 4BXXJ 2ZCNA 2JA8J 3FIWA 4AUXA 1IG7A 2H1KA 2Y30A 3BR3A 1X58A 2FD5A 1MBFA 3CCYA 3LNQA 3QPSA 2NS8A 3TW6A 5GPAA 2NVQJ 3NRGA 3A03A 2NVTJ 1BL0A 2Y0SN 2GFNA 4XRSA 5FGLA 1UG2A 3PO3J 2DMPA 4BY1J 3LWJA 3TW7A 2L9RA 3S1NJ 3H0GJ 4BKXA 4A3BJ 2TRTA 1HLVA 3EGQA 2XPWA 1HDPA 4ME9A 3VUQA 5F27A 2VPRA 3B6CA 5J1RA 3S1MJ 2RAEA 3HOYJ 3GTGJ 2TCTA 3OSGA 3V78A 5EDNA 2DG8A 1FEXA 2VKEA 4FCYA 4DYRA 1AKHB 4NELA 4JX6A 2PZ9A 1IRZA 2MG4A 2UXPA 1ZQ3P 1LFUP 5HBUA 3KNWA 2HXOA 1NK2P 1VI0A 1MBEA 1Y1VJ 2OERA 2NS7A 3HOZJ 3HTIA 2DA5A 3M4OJ 2LR8A 4I6ZA 3S2DJ 1IJWC 3PPBA 1A6IA 2YUSA 2MSYA 4M3EA 2ZOYA 5HAWA 3F1BA 3BT9A 2JA5J 2JN6A 5C3EJ 1O4XA 3OIOA 3GTQJ 2HQ5A 2LFBA 3ZQHA 2E19A 1T33A 1IUFA 5EFYA 4JX4A 1UI5A 4M3BA 2CUEA 1EF4A 5GP9A 4AC6A 2FBQA 5K58A 3HB9A 5AQCA 2B63J 2DN0A 2D5VA 1VF9A 4MFEA 2DA7A 4JYKA 5C44J 3TEDA 2L7FP 1ZGWA 3EUPA 3G1LA 5K7ZA 3ZQGA 3HDDA 3H3VK 4GCKA 1QVUA 2WB1N 2EZLA 2IEKA 3Q0UA 1MH4A 1U9NA 4RDUA 5BNGA 3D1NI 1MNMC 2NVXJ 3S1QJ 4FE7A 4FISA 4A3MJ 4B1RA 5HSZA 4M3FA 4A3GJ 2XB5A 3G1OA 2GENA 2DA2A 2X6OA 4MFDA 4GCLA 2CUFA 3GTMJ 3VW2A 5D18A 4JL3A 2R5YB 2CU7A 2UXOA 3QQAA 4XRMA 2COBA 1AU7A 4JKZA 4XICA 2O9LA 1AKHA 4D7MA 2VKVA 2L7MP 1OCPA 2WUIA 4G12A 1W0TA 1MBHA 1WH7A 4M3GA 3VW1A 5IYBJ 2REKA 3S15J 2G3BA 3LSGA 1TWHJ 3PO2J 2LK2A 3ON2A 3C07A 1ETKA 3B6AA 2QIBA 3HE0A 2R0QC 2K9QA 5IP9J 4B3AA 2DA6A 2XGEA 2ECBA 4BBRJ 3DCFA 2HOSA 3BCGA 3O8GA 1POGA 1ITYA 1JUMA 4BY7J 4EEFG 2RASA 3C2BA 5CXIA 5JLWA 3VOXA 2DA4A 2QF7A 1XG1A 2DA3A 4QTRA 5C4XJ 5F0FA 2MW8A 3BG5A 5IP7J 2M9HA 2YU9J 2E2JJ 3MNLA 4HNVA 5CW8A 2Y9ZA 3S5RA 5DS9A 4HKUA 3JRIA 1BJZA 2M2EA 1A5JA 4D7NA 1ZKGA 1MSEC 2G7SA 4C2MJ 1P7JA 4W97A 3W6VA 4ICHA 3ZOBA 3K7AJ 5K7HA 1I3QJ 1U78A 1APLC 3KZ9A 3HOWJ 4MK6A 5CXGA 3ZQFA 5C4JJ 1NTCA 5IP6A 4A93J 4B4CA 3O60A 3QPLA 4MXMA 2FJ1A 1QRYA 3Q0WA 2OF7A 1K83J 2XSDC 2DA1A 4JP0A 2LP0A 3JRAA 3IV5A 3LJLA 1RETA 3ANPA 4IHXA 2O7TA 1OCTC 3HOXJ 1ZR2A 1JT6A 5DAJA 2N8GA 1ETOA 3O8HA 3G56A 3IH2A 4JX5A 1XS9A 3GTJJ 2R5YA 3NARA 3JRCA 1MH3A 1W0UA 4DZPA 5FHPA 1G2HA 3JRGA 3RKQA 3CMYA 1UHSA 2FX0A 1K61A 1BA5A 2RHAA 2EQRA 3VW0A 1U9OA 4IHYA 2XGDA 3I4MJ 3VVXA 2IAIA 3ANGA 2X48A 3BTIA 2JWTA 2K9NA 2CQQA 1X2MA 2O8KA 3GTOJ 2YVHA 3BR6A 3TP0A 5IOYA 1WH5A 3FRQA 4NN1A 4NDLA 4QSHA 3ON4A 2HOAA 2JMWA 4C3IJ 1B8IB 2ZOZA 2LKXA 3JRFA 1IC8A 2Y2ZA 1TWFJ 1JKQC 5FLVA 3BTCA 2ECCA 2ME0A 1JGGA 5M5XJ 4PXIA 2JA6J 5E3OA 4D5CA 2DMQA 3JSJA 1H88C 9ANTA 2HYJA 2EZKA 1I6HJ 4W1UA 1VFCA 1RKTA 5EGOB 4Y52J 3BR1A 3UKGA 3HEFA 1Z77A 1GV2A 1VNDA 2EZIA 1ENHA 2PMZN 3BQZA 3SFIA 1Y1WJ 4CGRA 1WI3A 2UXIA 1RR7A 5EYRA 4A3FJ 1GDTA 2EH3A 2ZB9A 3COLA 1TC3C 3GEUA 2QOPA 4DYQA 3WHBA 1JTYA 3RQIA 4XK4A 3BR5A 2OI8A 4V2GA 1ETXA 3K2AA 4UUSB 3NPIA 5IPAA 2XPVA 1MBJA 1ZR4A 4GFBA 5F0CA 1JKOC 3ZQCA 3CDLA 3MN2A 5DTDA 2QWTA 3WHCA 3TP3A 2YS9A 2QKOA 1JUSA 2XPUA 1D5YA 1U8BA 2QTQA 2R93J 5D19A 1ETWA 1IDYA 2DJNA 1UMQA 3FK6A 3GTPJ 5FJ8J 2PBXA 3VPRA 5EG0B 3CJDA 5F04A 4A3JJ 3HOUJ 5J3LA 1JT0A 2LVSA 1B8IA 1S7EA 1QPIA 2GBYA 1PUFB 3BG3A 2ID3A 5FLMJ 1YRNB 3DPJA 2OPTA 2JJ7A 1DU0A 2JA7J 2IU5A 4IHWA 3CRJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I76 A;  3HOV J;  2KDZ A;  2Y31 A;  1MBG A;  1SFO J;  2F07 A;  2ZCM A;  2XDN A;  1TWG J;  1NK3 P;  1ETQ A;  5JLX A;  3I4N J;  5J1U A;  3DEW A;  2GLO A;  3RH2 A;  5EGO A;  5IOZ A;  1UI6 A;  3AQS A;  1AHD P;  2UXU A;  2ME6 A;  2Q24 A;  1I50 J;  1RKW A;  1FIA A;  3LOC A;  4C3H J;  1HF0 A;  4L5E A;  3AQT A;  1GV5 A;  3HIM A;  2DMT A;  2XGC A;  4YZE A;  5D1R A;  1LE8 B;  3LSJ A;  3BQY A;  3A01 B;  5FKK A;  3BRU A;  3Q0V A;  2LLK A;  5EF6 A;  1GUU A;  2JK3 A;  1FJL A;  4UUS A;  4A3K J;  1T56 A;  4FTH A;  5C4Y A;  2R92 J;  2XB0 X;  1E3O C;  3S16 J;  5EZG A;  2DMN A;  5FKL A;  4A3C J;  3G7R A;  4Y7N J;  1WGX A;  3V6G A;  2AHQ A;  4AYB N;  4A3E J;  1BW5 A;  3RZO J;  4RBO A;  3PM1 A;  5GPC A;  1SAN A;  3HGY A;  1CQT A;  3A02 A;  5J1Y A;  4A3I J;  2HDD A;  1H89 C;  2IBD A;  2KT0 A;  3HTJ A;  1JJ6 C;  2G7G A;  5E3L A;  3S14 J;  3VP5 A;  2P81 A;  2NVY J;  4BBS J;  5EG0 A;  2R5Z B;  3CWR A;  3PAS A;  2WGB A;  1B72 A;  3LSP A;  3JRH A;  5IYC J;  2UXH A;  1GVD A;  2HXI A;  1OJL A;  3HTA A;  1JTX A;  4A69 C;  1PUF A;  1YRN A;  4GCT A;  2HOT A;  1HDD C;  2D6Y A;  4UDS A;  1OFC X;  2E1O A;  5E3N A;  3VVY A;  5FMP A;  3HBL A;  5K7F A;  2VUM J;  2M0C A;  3MKL A;  2E2I J;  1HCR A;  3NAU A;  3S1R J;  3QBM A;  2CRG A;  1JUP A;  1SGM A;  3VOK A;  1BW6 A;  3ZQI A;  2GM4 A;  2EBI A;  3NI7 A;  4ABZ A;  1P7I A;  4JNN A;  2HI3 A;  2WAQ N;  3IUV A;  5M3F J;  3RZD J;  4FE4 A;  4MLO A;  2AO9 A;  1X2N A;  2W53 A;  2Y9Y A;  2GUH A;  3JRD A;  4LOC A;  3OOU A;  2G7L A;  2FQ4 A;  1ETY A;  1LE8 A;  5H9T A;  5M5W J;  2V57 A;  3GTK J;  3A01 A;  3E7L A;  3HKZ N;  3E7Q A;  2CJJ A;  3HM5 A;  3S17 J;  1JJ8 C;  1F43 A;  4XRS G;  1FIP A;  3SDG A;  1WPK A;  2EZH A;  3FIS A;  2L0K A;  3LSR A;  1TWC J;  3MVP A;  1FTT A;  2QCO A;  1XC5 A;  1DU6 A;  3JR9 A;  3RD3 A;  4M6V A;  4CYC A;  3VIB A;  3GBG A;  1JKP C;  2M34 A;  4AC0 A;  2HKU A;  5F0H A;  4S0H B;  2W48 A;  4A3L J;  3HTH A;  3BNI A;  2LTP A;  3KKD A;  1IGN A;  1Z0X A;  2O7O A;  5EZH A;  1IDZ A;  4M3D A;  3BR0 A;  2R5Z A;  5FKN A;  2NP3 A;  1LFB A;  3LHQ A;  4L62 A;  3VVZ A;  1HOM A;  3S2H J;  5M3M J;  3B81 A;  2I10 A;  1Q1V A;  2X9D A;  4J19 A;  5IYD J;  2NP5 A;  4MIM A;  4MO7 A;  2L7Z A;  3JRE A;  2LY9 A;  4IHV A;  3BHQ A;  3T6N A;  4V2F A;  2ID6 A;  5F08 A;  3IH4 A;  1B72 B;  1H8A C;  3QKX A;  2YVE A;  4X6A J;  2H8R A;  1GT0 C;  1TWA J;  3OSF A;  2E2H J;  4A3D J;  1RPW A;  3G1M A;  4IEJ A;  3L1P A;  4GFK A;  2ELK A;  2XRL A;  1QVT A;  3BTJ A;  3NNR A;  3M3Y J;  2MGQ A;  1MBK A;  2LD5 A;  3FKI J;  4D5F A;  3GZI A;  4C3J J;  5FKM A;  5M5Y J;  1ZTR A;  3HGG A;  5FKO A;  3JRB A;  3IH3 A;  4DW6 A;  4QIW N;  3BJB A;  2CQX A;  1ORK A;  1RES A;  4XID A;  3KKC A;  3SJM A;  3BTL A;  4UUT A;  3P9T A;  4X1E A;  4ACI A;  2ZCX A;  1R9T J;  2NX4 A;  3FK7 A;  2HYT A;  1FTZ A;  2DG7 A;  3CQZ J;  4DYC A;  2WV1 A;  4GFL A;  1ZK8 A;  3BR2 A;  1ETV A;  5EEA A;  3ZQL A;  1MSF C;  1IV6 A;  5E3M A;  2M8G X;  4DZJ A;  3NXC A;  4AF5 A;  2DMU A;  2K40 A;  3F0C A;  5HOD A;  4KWA A;  3Q3S A;  1F36 A;  2G0E A;  5F1J A;  3GTL J;  1JKR C;  4CYC B;  2DTZ A;  2NOG A;  1WCM J;  2K9S A;  2VI6 A;  3BG9 A;  2R7Z J;  4BXX J;  2ZCN A;  2JA8 J;  3FIW A;  4AUX A;  1IG7 A;  2H1K A;  2Y30 A;  3BR3 A;  1X58 A;  2FD5 A;  1MBF A;  3CCY A;  3LNQ A;  3QPS A;  2NS8 A;  3TW6 A;  5GPA A;  2NVQ J;  3NRG A;  3A03 A;  2NVT J;  1BL0 A;  2Y0S N;  2GFN A;  4XRS A;  5FGL A;  1UG2 A;  3PO3 J;  2DMP A;  4BY1 J;  3LWJ A;  3TW7 A;  2L9R A;  3S1N J;  3H0G J;  4BKX A;  4A3B J;  2TRT A;  1HLV A;  3EGQ A;  2XPW A;  1HDP A;  4ME9 A;  3VUQ A;  5F27 A;  2VPR A;  3B6C A;  5J1R A;  3S1M J;  2RAE A;  3HOY J;  3GTG J;  2TCT A;  3OSG A;  3V78 A;  5EDN A;  2DG8 A;  1FEX A;  2VKE A;  4FCY A;  4DYR A;  1AKH B;  4NEL A;  4JX6 A;  2PZ9 A;  1IRZ A;  2MG4 A;  2UXP A;  1ZQ3 P;  1LFU P;  5HBU A;  3KNW A;  2HXO A;  1NK2 P;  1VI0 A;  1MBE A;  1Y1V J;  2OER A;  2NS7 A;  3HOZ J;  3HTI A;  2DA5 A;  3M4O J;  2LR8 A;  4I6Z A;  3S2D J;  1IJW C;  3PPB A;  1A6I A;  2YUS A;  2MSY A;  4M3E A;  2ZOY A;  5HAW A;  3F1B A;  3BT9 A;  2JA5 J;  2JN6 A;  5C3E J;  1O4X A;  3OIO A;  3GTQ J;  2HQ5 A;  2LFB A;  3ZQH A;  2E19 A;  1T33 A;  1IUF A;  5EFY A;  4JX4 A;  1UI5 A;  4M3B A;  2CUE A;  1EF4 A;  5GP9 A;  4AC6 A;  2FBQ A;  5K58 A;  3HB9 A;  5AQC A;  2B63 J;  2DN0 A;  2D5V A;  1VF9 A;  4MFE A;  2DA7 A;  4JYK A;  5C44 J;  3TED A;  2L7F P;  1ZGW A;  3EUP A;  3G1L A;  5K7Z A;  3ZQG A;  3HDD A;  3H3V K;  4GCK A;  1QVU A;  2WB1 N;  2EZL A;  2IEK A;  3Q0U A;  1MH4 A;  1U9N A;  4RDU A;  5BNG A;  3D1N I;  1MNM C;  2NVX J;  3S1Q J;  4FE7 A;  4FIS A;  4A3M J;  4B1R A;  5HSZ A;  4M3F A;  4A3G J;  2XB5 A;  3G1O A;  2GEN A;  2DA2 A;  2X6O A;  4MFD A;  4GCL A;  2CUF A;  3GTM J;  3VW2 A;  5D18 A;  4JL3 A;  2R5Y B;  2CU7 A;  2UXO A;  3QQA A;  4XRM A;  2COB A;  1AU7 A;  4JKZ A;  4XIC A;  2O9L A;  1AKH A;  4D7M A;  2VKV A;  2L7M P;  1OCP A;  2WUI A;  4G12 A;  1W0T A;  1MBH A;  1WH7 A;  4M3G A;  3VW1 A;  5IYB J;  2REK A;  3S15 J;  2G3B A;  3LSG A;  1TWH J;  3PO2 J;  2LK2 A;  3ON2 A;  3C07 A;  1ETK A;  3B6A A;  2QIB A;  3HE0 A;  2R0Q C;  2K9Q A;  5IP9 J;  4B3A A;  2DA6 A;  2XGE A;  2ECB A;  4BBR J;  3DCF A;  2HOS A;  3BCG A;  3O8G A;  1POG A;  1ITY A;  1JUM A;  4BY7 J;  4EEF G;  2RAS A;  3C2B A;  5CXI A;  5JLW A;  3VOX A;  2DA4 A;  2QF7 A;  1XG1 A;  2DA3 A;  4QTR A;  5C4X J;  5F0F A;  2MW8 A;  3BG5 A;  5IP7 J;  2M9H A;  2YU9 J;  2E2J J;  3MNL A;  4HNV A;  5CW8 A;  2Y9Z A;  3S5R A;  5DS9 A;  4HKU A;  3JRI A;  1BJZ A;  2M2E A;  1A5J A;  4D7N A;  1ZKG A;  1MSE C;  2G7S A;  4C2M J;  1P7J A;  4W97 A;  3W6V A;  4ICH A;  3ZOB A;  3K7A J;  5K7H A;  1I3Q J;  1U78 A;  1APL C;  3KZ9 A;  3HOW J;  4MK6 A;  5CXG A;  3ZQF A;  5C4J J;  1NTC A;  5IP6 A;  4A93 J;  4B4C A;  3O60 A;  3QPL A;  4MXM A;  2FJ1 A;  1QRY A;  3Q0W A;  2OF7 A;  1K83 J;  2XSD C;  2DA1 A;  4JP0 A;  2LP0 A;  3JRA A;  3IV5 A;  3LJL A;  1RET A;  3ANP A;  4IHX A;  2O7T A;  1OCT C;  3HOX J;  1ZR2 A;  1JT6 A;  5DAJ A;  2N8G A;  1ETO A;  3O8H A;  3G56 A;  3IH2 A;  4JX5 A;  1XS9 A;  3GTJ J;  2R5Y A;  3NAR A;  3JRC A;  1MH3 A;  1W0U A;  4DZP A;  5FHP A;  1G2H A;  3JRG A;  3RKQ A;  3CMY A;  1UHS A;  2FX0 A;  1K61 A;  1BA5 A;  2RHA A;  2EQR A;  3VW0 A;  1U9O A;  4IHY A;  2XGD A;  3I4M J;  3VVX A;  2IAI A;  3ANG A;  2X48 A;  3BTI A;  2JWT A;  2K9N A;  2CQQ A;  1X2M A;  2O8K A;  3GTO J;  2YVH A;  3BR6 A;  3TP0 A;  5IOY A;  1WH5 A;  3FRQ A;  4NN1 A;  4NDL A;  4QSH A;  3ON4 A;  2HOA A;  2JMW A;  4C3I J;  1B8I B;  2ZOZ A;  2LKX A;  3JRF A;  1IC8 A;  2Y2Z A;  1TWF J;  1JKQ C;  5FLV A;  3BTC A;  2ECC A;  2ME0 A;  1JGG A;  5M5X J;  4PXI A;  2JA6 J;  5E3O A;  4D5C A;  2DMQ A;  3JSJ A;  1H88 C;  9ANT A;  2HYJ A;  2EZK A;  1I6H J;  4W1U A;  1VFC A;  1RKT A;  5EGO B;  4Y52 J;  3BR1 A;  3UKG A;  3HEF A;  1Z77 A;  1GV2 A;  1VND A;  2EZI A;  1ENH A;  2PMZ N;  3BQZ A;  3SFI A;  1Y1W J;  4CGR A;  1WI3 A;  2UXI A;  1RR7 A;  5EYR A;  4A3F J;  1GDT A;  2EH3 A;  2ZB9 A;  3COL A;  1TC3 C;  3GEU A;  2QOP A;  4DYQ A;  3WHB A;  1JTY A;  3RQI A;  4XK4 A;  3BR5 A;  2OI8 A;  4V2G A;  1ETX A;  3K2A A;  4UUS B;  3NPI A;  5IPA A;  2XPV A;  1MBJ A;  1ZR4 A;  4GFB A;  5F0C A;  1JKO C;  3ZQC A;  3CDL A;  3MN2 A;  5DTD A;  2QWT A;  3WHC A;  3TP3 A;  2YS9 A;  2QKO A;  1JUS A;  2XPU A;  1D5Y A;  1U8B A;  2QTQ A;  2R93 J;  5D19 A;  1ETW A;  1IDY A;  2DJN A;  1UMQ A;  3FK6 A;  3GTP J;  5FJ8 J;  2PBX A;  3VPR A;  5EG0 B;  3CJD A;  5F04 A;  4A3J J;  3HOU J;  5J3L A;  1JT0 A;  2LVS A;  1B8I A;  1S7E A;  1QPI A;  2GBY A;  1PUF B;  3BG3 A;  2ID3 A;  5FLM J;  1YRN B;  3DPJ A;  2OPT A;  2JJ7 A;  1DU0 A;  2JA7 J;  2IU5 A;  4IHW A;  3CRJ A; 
#chains in the Genus database with same CATH topology
 2KHM A;  1BR4 A;  3HRS A;  2KDZ A;  3PNY A;  4A0X A;  4B3X A;  4DNC A;  2XDN A;  1H0M A;  1ETQ A;  5JLX A;  3J80 K;  5J1U A;  2QEN A;  2ME6 A;  2HZT A;  1ZHF A;  2E36 A;  3DU6 A;  2X6Y A;  4P55 A;  4XLN F;  1HF0 A;  4L5E A;  2VE9 A;  1GV5 A;  2L9S A;  3LSJ A;  4YII A;  3DLL F;  2EWN A;  2HYG D;  3ZMS A;  2LLK A;  3E1S A;  2JK3 A;  2F5C A;  4RLF A;  4BXU A;  4C9Y A;  2RN7 A;  2GOM A;  5B1A H;  4A3K J;  1T56 A;  1ZLJ A;  1AA7 A;  2XB0 X;  4NBQ A;  3S16 J;  4UXN A;  4A3C J;  2F5D A;  3NWS A;  5GAG J;  3KZZ A;  3QOE A;  4AYB N;  3FMQ A;  4LGW A;  1SAN A;  4DBR A;  5GPC A;  5LGT A;  4NQW A;  4E70 A;  2VAS A;  2XAJ A;  2L9N A;  5J1Y A;  3DTI A;  4PSX A;  1EV7 A;  2ZSI B;  2AXL A;  3C2H A;  3S14 J;  2EFW A;  3M1E A;  2NVY J;  5D5W B;  4UVB A;  3CWR A;  5K5O A;  1KQ9 A;  4WX9 A;  4RM2 A;  4E7S A;  1W7P A;  2HXI A;  1FZP B;  3C2G A;  2PFB A;  1D0Z A;  2D6Y A;  3W6J B;  1FBQ A;  3SZT A;  3VEP A;  3C1D A;  2VUM J;  2KP6 A;  2K5C A;  3MKL A;  4E7L A;  4LMY A;  2CWE A;  1K4T A;  2HGC A;  4EJU A;  1JUP A;  4LLL A;  4JK1 X;  2Y0M A;  4Q4Z F;  4Y3O A;  3D5S C;  4JNN A;  1TQM A;  1YQA A;  2OZ6 A;  1KQ8 A;  1X1A A;  2W53 A;  2ZY9 A;  2GUH A;  1XDU A;  3JRD A;  4A6E A;  4JBA A;  2FUG 2;  3OOU A;  2IT0 A;  2R7O A;  2BVL A;  5GAE J;  1KQ0 A;  2V57 A;  1XMA A;  3ZQ7 A;  2HEO A;  3E7Q A;  2CJJ A;  1JJ8 C;  3CTA A;  4C2U A;  4GXO A;  1ACI A;  1F43 A;  2E1M C;  5ICF A;  4XRS G;  4BAY A;  3KEY A;  5HLH A;  3ZMU A;  3MVP A;  3TQN A;  2LBF A;  3OYG A;  3JR9 A;  1UEL B;  2A6T A;  1I3A A;  2RVC A;  4CYC A;  3H9Q A;  2C6Y A;  3OYA A;  4OIQ F;  1TQI A;  1V5E A;  1PP8 F;  2DQR A;  4XLE A;  3BNI A;  2DT7 B;  4ZTF A;  3CCV I;  2NXN B;  4A2U A;  4XKW A;  2OQR A;  3K4N A;  3BCA A;  4NQW B;  4M3D A;  1LFB A;  1TP4 A;  5DV5 A;  2B9S A;  4BUP A;  2O7T A;  2JVH A;  2X9D A;  4J19 A;  1FWZ A;  1SVO A;  1QU3 A;  2RNG A;  1AOY A;  1TQP A;  1ZAR A;  4MO7 A;  4GDF A;  2ADU A;  2NOJ B;  4V2F A;  3J7Z I;  2PMH A;  3CCR I;  3CJQ B;  1U0J A;  3AAF A;  2YVE A;  5KAF C;  2H8R A;  5J8C A;  3OSF A;  1X1D A;  4FET A;  4XOT A;  4IEJ A;  3L2C A;  2LKS A;  4GFK A;  3G2B A;  2ELK A;  3ZMV A;  3NNR A;  2RGV A;  4BL0 B;  1KON A;  1X3W B;  2PX9 A;  3TOA A;  5DEQ A;  3HTS B;  2KIQ A;  5JI6 A;  3JRB A;  4C2T A;  4DW6 A;  2E7X A;  2B1E A;  2ZFU A;  4AVZ A;  5HOO A;  2NYX A;  4FHT A;  4UUT A;  5CQG A;  5LHH A;  2FNA A;  2EPF A;  4ANJ A;  1S7A A;  1QHH D;  3QWL A;  4Q5S F;  1K6Y A;  2XDV A;  2A6E F;  1ON1 A;  2HQN A;  2D2W A;  2NAZ A;  2VE8 A;  2DG7 A;  3BR2 A;  3BLY A;  5EEA A;  1S7O A;  4MEX F;  2D45 A;  2F5F A;  1U6G A;  2X51 A;  3MKY B;  4DZJ A;  4I01 A;  2KIU A;  2K40 A;  1MMG A;  4P9U A;  2I5U A;  1F36 A;  3Q3S A;  2G0E A;  4GO1 A;  5F1J A;  3VFZ A;  3GME A;  2HVR A;  2P5V A;  3FM3 A;  4CYC B;  5E79 C;  4ZYE A;  2WV0 A;  2X6W A;  1RI7 A;  4L5I A;  2ZCN A;  2ZJQ F;  3WE2 A;  3IHU A;  1HBX G;  2LMD A;  1PUE E;  1HW1 A;  1IG7 A;  4HX4 A;  1CF7 A;  4M9Z A;  2H1K A;  3HKZ A;  5D5V B;  1QZZ A;  1K7A A;  1HKQ A;  1SFE A;  5GPA A;  4NUB A;  3K69 A;  2UXN A;  5B3S H;  4HF0 A;  4YG2 F;  3CC2 I;  1HC8 A;  2QVO A;  4XLF A;  2V1X A;  3PO3 J;  4KIT B;  2L9R A;  2GWR A;  2BY0 A;  3QP5 A;  3S1N J;  2TRT A;  2VKD A;  3VUQ A;  2MYS A;  1BI3 A;  1JGS A;  2RAE A;  1S6L A;  2VON A;  3HOY J;  3GTG J;  1VQK I;  1YYV A;  3CLO A;  2MFZ A;  5DCM B;  5J6X A;  5CVU A;  1U2W A;  4DYR A;  1AKH B;  3LAP A;  1IRZ A;  2MG4 A;  4YIF A;  3DBL B;  1ZQ3 P;  1TBX A;  4UB6 C;  4HV6 A;  2VQC A;  1OCC H;  3W6K B;  3FXU A;  2GXA A;  2YR2 A;  1XN7 A;  1SD5 A;  3K10 A;  3KYC B;  5E1Z B;  3L2R A;  3MZY A;  4A12 A;  2V7F A;  1SVL A;  2H09 A;  3DQV C;  4L9J A;  3IWF A;  3M4O J;  2RKH A;  3BY6 A;  2WY8 Q;  1BI2 A;  3CDH A;  3ZCO A;  2W1O A;  1E3H A;  4CCM A;  1KGS A;  4M3E A;  2ZOY A;  1L0O C;  2PEX A;  1IN4 A;  3K70 C;  1FOX A;  2JN6 A;  1MJB A;  2EIJ H;  2BE5 F;  1UHW A;  2E19 A;  2HZD A;  3S93 A;  5FFX A;  3O3K A;  2R7R A;  2GIZ A;  4BHB A;  2G7H A;  3H36 A;  4OAY A;  1YE9 A;  2ZXJ A;  2DW4 A;  4M3B A;  1EF4 A;  2X4H A;  2JRM A;  4HEA 2;  5K58 A;  4EJW A;  2O61 A;  2XC7 A;  3SEQ A;  3FXR A;  2B63 J;  2D5V A;  5B5E C;  3FHZ A;  4XOP A;  3VSK A;  3EUP A;  4XL9 A;  5K7Z A;  1T2K A;  3HDD A;  1K78 A;  2FXA A;  2XF6 A;  2W4S A;  4AD9 A;  2DK5 A;  2L9V A;  2DFI A;  3JAM K;  3W3C A;  4ZDO A;  4M74 A;  3M9A A;  2ELH A;  4O5V A;  3GYH X;  3PJR A;  3S1Q J;  3ZPL A;  4B1R A;  5HSZ A;  4F93 B;  4A3G J;  2GEN A;  5TRD A;  4MFD A;  3GTM J;  3F8F A;  3VW2 A;  4HQM A;  5HVQ C;  1GVJ A;  3I59 A;  1IZ1 A;  5KHD A;  1X1B A;  2COB A;  4OAZ A;  4WXD A;  1AU7 A;  2EV6 A;  4M6X A;  1Z21 A;  2WUI A;  4G12 A;  1W0T A;  1MBH A;  3VW1 A;  2F4O B;  3C3W A;  1T8I A;  3FBI B;  2ETH A;  5HDG A;  3ON2 A;  2LK2 A;  1NG6 A;  3C07 A;  1ETK A;  1FOY A;  2VC1 A;  4A5N A;  3HE0 A;  4XSX F;  4DJA A;  3CME I;  2K9Q A;  3CJN A;  5IP9 J;  3SDB A;  4N0B A;  2PFV A;  1EH8 A;  3ZXS A;  3DKX A;  4BBR J;  1BOB A;  1B1B A;  3O8G A;  4F55 A;  1JUM A;  2Z99 A;  3VOX A;  2DYS H;  2DA4 A;  5DUI A;  2XHK A;  3Q9V A;  1XG1 A;  2DA3 A;  4BXF A;  5C4X J;  2ZJP F;  2GOX B;  1LDJ A;  2ZO4 A;  3WGG A;  1LEB A;  1D3Y A;  4R8H A;  3X2Q H;  2CQN A;  2EFN A;  3H92 A;  3L00 A;  1M1E B;  5CW8 A;  3S5R A;  2M2E A;  3QU3 A;  2CSO A;  4P96 A;  1ZKG A;  1MSE C;  2IA0 A;  4L9T A;  1P7J A;  3M1C A;  3UNG C;  3V8K A;  5H2F C;  1E0E A;  2FOW A;  1KU3 A;  5D1R A;  4M73 A;  3HOW J;  2HTS A;  3ZQF A;  2L4M A;  1UB9 A;  4I02 A;  4A93 J;  1YJW I;  2FJ1 A;  1QRY A;  3K1N A;  1WQ2 A;  2XSD C;  2A5Y B;  1LQ1 A;  2JUG A;  3JRA A;  2BXY A;  3DBH B;  3IV5 A;  1WRJ A;  3ASN H;  2F5E A;  5DAJ A;  2UV1 A;  3O8H A;  3S3M A;  4KYW A;  2JUC A;  3CO6 C;  4G8X A;  2O03 A;  3PSF A;  2R5Y A;  1P2F A;  1DPR A;  3EQL F;  4ETS A;  2OJE D;  3EET A;  1W0U A;  2FA5 A;  2LH9 A;  3GZ5 A;  1Z7L A;  3ABL H;  1R4M B;  3AG3 H;  4ENJ A;  2VBY A;  3HRM A;  3VW0 A;  1U9O A;  4IHY A;  5E1W A;  2HR3 A;  1F1Z A;  1G6N A;  2WB1 A;  3LA7 A;  4RAZ A;  1XMK A;  2VL8 A;  3T5X A;  5B1B H;  2NRA C;  3I4M J;  4AVP A;  4V19 K;  3TDU C;  3ROU A;  2JWT A;  4CHU A;  2DXI A;  3H5R A;  3HL2 A;  2HPM A;  5FD5 A;  3LSM A;  5FRO A;  4EM2 A;  3BR6 A;  3WTS C;  1Z3X A;  1RZ4 A;  2PG4 A;  2CV2 A;  4NN1 A;  4NDL A;  2R7W A;  4OU0 A;  2D1H A;  4QSH A;  2CQK A;  3E6C C;  1X19 A;  2HOA A;  3W2W A;  1B8I B;  2ZOZ A;  3L2U A;  4OWR B;  4PZJ A;  1VQO I;  5KCM A;  1IC8 A;  2UZK A;  2EIK H;  4PGH A;  5CJ9 A;  5TJJ A;  1BIA A;  3ABT A;  4JOM A;  2ECC A;  2ME0 A;  1P6R A;  1JGG A;  5FLV A;  4TV7 A;  5E3O A;  4H4K C;  2DMQ A;  2A5W A;  1IN5 A;  2HU9 A;  2EZK A;  4XN0 A;  4CA0 A;  4IL6 C;  2DCE A;  2FBH A;  1C0W A;  3H9G A;  1MDM A;  2IS2 A;  3PL8 A;  5E8I A;  1I1G A;  4LB6 B;  1Z77 A;  2EIL H;  2DU9 A;  2PMZ N;  4LD5 A;  4HNU A;  2M45 A;  2UXI A;  4A3F J;  5LRR A;  4E7K A;  1ZG3 A;  2ZB9 A;  3RSN A;  1GDT A;  3GEU A;  5A2Q Z;  1JTY A;  1FOK A;  1D1A A;  1P92 A;  4J00 A;  3TGN A;  2XF7 A;  4NC7 A;  3MKZ A;  2XPV A;  1YG2 A;  1MBJ A;  3HZJ A;  1XCB A;  3ZQC A;  3GO5 A;  5DUK A;  1MMD A;  3MN2 A;  3F23 A;  4WK8 F;  2XVC A;  2YS9 A;  4HSR A;  2ELJ A;  3CP2 A;  2XPU A;  3OWT A;  2XRN A;  1KA8 A;  2M87 A;  2EA4 A;  2QTQ A;  4ON0 A;  2L7K A;  5L3G A;  4HG2 A;  1WSU A;  2DJN A;  4G6T B;  3MFK A;  3GTP J;  3H5A A;  5FJ8 J;  2FF4 A;  1OQY A;  2DOF A;  3BPV A;  4A3J J;  3HOU J;  3CDI A;  1JT0 A;  3FXJ A;  4IQJ A;  2JPB A;  2KJB A;  4IJA A;  1YRN B;  3DPJ A;  3CCM I;  1O7L A;  2ESH A;  2JJ7 A;  3CF5 F;  4IQ4 A;  2IS4 A;  2ZCM A;  4AU7 A;  5HNF A;  4BDZ A;  1NK3 P;  4IRG A;  4M9S A;  3DEW A;  4DIQ A;  4AM3 A;  2XF5 A;  4N4N B;  3RH2 A;  5EGO A;  3KYD B;  3AQS A;  2UXU A;  1XSD A;  4ZH4 F;  1I50 J;  1RKW A;  1FIA A;  4C3H J;  3GX4 X;  2XGC A;  3Q5F A;  2V9P A;  2QSH X;  5AON A;  3TO7 A;  2W00 A;  4UNO A;  4N9H A;  3A01 B;  5L3B A;  2IVM A;  3FX3 A;  4RGU A;  4D9J A;  5EF6 A;  2ICW G;  3AKZ A;  4E7J A;  1FJL A;  4E7H A;  4UUS A;  2NVU B;  4FTH A;  4DVY P;  2CUZ A;  2XV4 S;  3KP2 A;  1LNW A;  2IP2 A;  3R0A A;  2OU2 A;  5EZG A;  4XLC A;  4Y7N J;  5D4S A;  1WGX A;  3BJA A;  1UFM A;  3CCJ I;  1X3Z B;  5JR3 A;  4RBO A;  1I1S A;  3K9T A;  3PFI A;  2L54 A;  3PM1 A;  3OIQ A;  4FQG A;  2VJI A;  1WFX A;  3A02 A;  4N4O B;  1SC7 A;  2Q0O A;  2FU4 A;  3QPH A;  3QRF F;  2P5K A;  3HYI A;  4ZDP A;  5LLQ A;  2QQB A;  1XD7 A;  4I99 C;  2OC6 A;  4S05 A;  2BGC A;  4BBS J;  5EG0 A;  2R5Z B;  2YX7 A;  1A04 A;  1B72 A;  2ZCW A;  4WF2 A;  4BU2 A;  3ZR8 X;  5K1Y A;  3LAJ A;  4BE2 A;  3NEU A;  2UXH A;  1GVD A;  2P5L C;  4WIB A;  1JTX A;  4A69 C;  4GCT A;  3OL3 A;  3VVY A;  2E1O A;  5E3N A;  4KIS A;  1E2X A;  5K7F A;  1S72 I;  2LC2 A;  3OYH A;  2V9V A;  3GVA A;  4CUG A;  2E2I J;  1HCR A;  2AQF A;  5K5Q A;  1JHF A;  3F21 A;  4HF1 A;  5JVG F;  1SGM A;  3VOK A;  3O6B B;  2O8X A;  1YS7 A;  2EBI A;  4CCJ A;  3NI7 A;  4ABZ A;  1P7I A;  3BP8 A;  3DFG A;  5M3F J;  4MLO A;  4NC6 A;  2AO9 A;  3RKY A;  1R1V A;  2HQR A;  5ICE A;  4MTD A;  4LOC A;  4HX7 A;  2M8E A;  2G7L A;  4QPO A;  2FQ4 A;  1ETY A;  2OV7 A;  4XN3 A;  5H9T A;  5BPI A;  2A2F X;  5CPR B;  3GTK J;  2Y69 H;  2E34 A;  2W24 A;  5BS6 A;  1FIP A;  3KEO A;  4PJL A;  1NH3 A;  2OTL I;  1IO2 A;  2EZH A;  2VJ5 A;  1WJD A;  1TWC J;  3OR1 C;  3LST A;  4FX0 A;  1U3E M;  1XC5 A;  4FAS D;  1ON2 A;  1O57 A;  2F2E A;  2PMU A;  1B4A A;  3PUB A;  5FO5 A;  3WGH A;  2RRE A;  1R49 A;  4ASN A;  2DFF A;  3T8R A;  2ZNZ A;  4S0H B;  3DEE A;  2Z3Y A;  1Y8R B;  1DDN A;  2LTP A;  4RAG A;  3KKD A;  1OCR H;  4I0A A;  1D5V A;  1N75 A;  4ESB A;  3QP6 A;  1ZGA A;  3U9G A;  1A36 A;  1IDZ A;  4HLX A;  1ZEL A;  3I56 I;  2YU3 A;  1VQN I;  1OYI A;  1HOM A;  4C30 A;  5M3M J;  3B81 A;  2I10 A;  2QBY A;  1BR1 A;  3HIF A;  3G3Z A;  4KFC A;  5IYD J;  3IUO A;  5D8L B;  1D8J A;  4EJO A;  4IHV A;  4CGZ A;  1BR2 A;  1MJA A;  3GUD A;  1B72 B;  1FT9 A;  1H8A C;  1RC9 A;  3QKX A;  4BDY A;  3LSH A;  1GT0 C;  3K0L A;  1RPW A;  1J9I A;  2Q2E A;  3BRO A;  3L1P A;  6PAX A;  2WBM A;  1ZG5 A;  1MBK A;  3M7G A;  2PBI A;  2QQA A;  3OIP A;  2ZME B;  4LB5 A;  2K02 A;  1ZTR A;  5FKO A;  3R0J A;  2R7X A;  3RPU D;  1RES A;  2R7V A;  1TT0 A;  3SJM A;  2V4J C;  3BTL A;  4HYE A;  3JW4 A;  3P9T A;  1I6X A;  4P5O A;  2ZCX A;  2E7W A;  4IOC F;  2NX4 A;  3FK7 A;  4MGR A;  1FTZ A;  3TMO A;  1Z67 A;  4DYC A;  1IF1 A;  1ETV A;  2Y75 A;  5J4V A;  1MSF C;  1JHH A;  1IV6 A;  4A0Z A;  1J5Y A;  1VQ6 I;  3NXC A;  2PN6 A;  2DMU A;  5HOD A;  3PFY A;  3SZG A;  2BV6 A;  2WAQ A;  3CCQ I;  3GTL J;  4NB5 A;  3A0H C;  2OA4 A;  4PUS A;  2K9S A;  2VI6 A;  3BDD A;  2CMP A;  3BG9 A;  1TL8 A;  1PDN C;  5KK1 A;  1KYZ A;  1Y0N A;  4CXF A;  1ZRF A;  3PIO F;  3BR3 A;  1X58 A;  4PSW A;  3LNQ A;  2QLZ A;  3QPS A;  2NS8 A;  1G3W A;  3BZK A;  1Y56 A;  1MKM A;  4BE0 A;  3A03 A;  1XMX A;  2D1V A;  3NS4 A;  2LY2 A;  4OIR F;  2A3S A;  1MNE A;  4RGX A;  2IGM A;  2QBY B;  2XAF A;  3CZ6 A;  4IX7 A;  2KJC A;  2FBI A;  2FE3 A;  3H0G J;  2DDB A;  2BEO A;  2VXD A;  1HDP A;  1RUO A;  2BHZ A;  4CDG A;  4ME9 A;  2VPR A;  1W5S A;  4BGD A;  5KAI C;  2OAZ A;  3SHF A;  2X6X A;  2TCT A;  4WXH A;  1OCZ H;  5EDN A;  4BJ6 C;  5CKT A;  2Q2E B;  2QWW A;  4FCY A;  1UZC A;  3K1M A;  2XAS A;  3FKJ A;  3TBI A;  1R23 A;  2KZV A;  3MQ0 A;  4E4H A;  1QBJ A;  1YIT I;  1LFU P;  2UXP A;  3HSF A;  4BEH B;  1B9N A;  2G7U A;  2JPC A;  2NS7 A;  2XKO A;  3HOZ J;  3F8B A;  4YFN F;  3ERE D;  3S2D J;  1Z1D A;  1Z3Y A;  2W57 A;  4ZYD A;  2DK8 A;  2ZNY A;  1BC8 C;  1A6I A;  2YUS A;  2MSY A;  2JRT A;  3CCE I;  3WTU C;  2QYO A;  3F1B A;  3BT9 A;  5C3E J;  3OIO A;  5HLI A;  3GTQ J;  2LFB A;  3MCZ A;  4L9V A;  3WTV C;  1S5L C;  4UY8 I;  4CZC A;  2M7B A;  4AID A;  3V7S A;  5EFY A;  4JX4 A;  1B6A A;  5CVR A;  4LG3 A;  1QQI A;  3GFJ A;  2CUE A;  4AC6 A;  2EA2 A;  5L3E A;  4AIJ A;  4KUM A;  5HS9 A;  4A5M A;  3OS2 A;  1Z6R A;  4U88 A;  5AQC A;  1R7J A;  2CUJ A;  1MIJ A;  3TED A;  1YO5 C;  2KIM A;  5FB2 A;  1WI9 A;  3ZQG A;  3H3V K;  4GCK A;  2W82 A;  1SD4 A;  3RCO A;  2NS0 A;  3WG7 H;  2DDA A;  3P9I A;  2RDP A;  4RAY A;  1BN5 A;  1HQC A;  2X85 A;  2IEK A;  3Q0U A;  1MH4 A;  5CVJ A;  1IV8 A;  3OYC A;  1MNM C;  4FE7 A;  4G6Q A;  5JFR A;  4FIS A;  2GIV A;  4B48 A;  2ZME C;  3K4M A;  1USS A;  2XB5 A;  2ESN A;  3WG9 A;  2CUF A;  1FNN A;  5GTH C;  5DCM A;  1VQM I;  3HG9 A;  2FRH A;  2CU7 A;  4CCO A;  4XRM A;  2K9L A;  1AKH A;  3VSL A;  1R4N B;  4D7M A;  1OYY A;  3GFM A;  2L7M P;  1P9Q C;  2O6G E;  3FXM A;  1QNT A;  3GXO A;  4L5J A;  2G3B A;  1SD6 A;  2Y0S A;  1TWH J;  4CCK A;  3PO2 J;  4C2M A;  2PQ8 A;  3B6A A;  3RJP A;  3S2W A;  3OYD A;  4HPQ A;  3BG6 A;  4YIR X;  2KKO A;  4ZC3 A;  5EEG A;  4F52 A;  2R4G A;  3PIP F;  4LLN A;  1TNT A;  2BY3 A;  1POG A;  4JQF A;  4EEF G;  3C2B A;  5HLT A;  2RAS A;  5CXI A;  4QTR A;  4KNY A;  4ZJZ A;  5LHI A;  2OTJ I;  2VC0 A;  2MW8 A;  3BG5 A;  3ZGK A;  2GXB A;  2M9H A;  3U2R A;  3EDP A;  5GAH J;  2E2J J;  1Z05 A;  2CS3 A;  3E6D A;  5LD2 C;  3CD6 I;  2M30 A;  2VQH A;  3I0T A;  4GGG A;  2M1B A;  3JRI A;  4IO9 F;  1RRJ A;  4LIU A;  3FWE A;  3IKV A;  2KIS A;  2DLL A;  4W97 A;  3W6V A;  4ICH A;  1VQ5 I;  3JSP A;  3RQ4 A;  2P6T A;  3K4L A;  1I3Q J;  2Y48 A;  3JTH A;  5K7H A;  1APL C;  2K85 A;  1W5T A;  1QGP A;  3OYJ A;  4PDK A;  1K83 J;  2DA1 A;  4JP0 A;  3B02 A;  2PJR A;  2VT2 A;  3LJL A;  3DXJ F;  4PGG A;  1Z7U A;  1E17 A;  3QYF A;  3O2P E;  3HOX J;  1W1W E;  3J7Y J;  2VOD A;  1ETO A;  3G56 A;  4OMZ A;  2M4G A;  2DYR H;  2KQR A;  2XGX A;  5BMZ A;  3KEQ A;  3TDZ C;  1BBY A;  1FP2 A;  3I53 A;  4CIC A;  3JRC A;  1W36 C;  1U8R A;  1MH3 A;  2JT1 A;  5GAD J;  2BZT A;  4Q47 A;  2FEZ A;  3FHN A;  3NQO A;  4DZP A;  5FHP A;  2DT6 A;  2FX0 A;  2V1N A;  1K61 A;  3LFK A;  1BA5 A;  4IPA A;  5CVI A;  2RHA A;  3EPZ A;  4I0B A;  2YPR A;  1IN7 A;  1W4M A;  3VYS B;  1NHA A;  3ANG A;  2VQL A;  3E5U A;  2OCC H;  1X2M A;  3P5J A;  5EJC A;  2YVH A;  4EMS A;  4U9N A;  2WTE A;  4EQQ A;  1WH5 A;  3A2K A;  3FRQ A;  3OV8 A;  1TW2 A;  4BQQ A;  3W2V A;  4BNC A;  3F6O A;  4CSW A;  2JMW A;  3U1K A;  3JRF A;  2R7D A;  2EV5 A;  2LF8 A;  4HDV A;  1G8X A;  5M5X J;  5ILS A;  2JA6 J;  1EH7 A;  5D6E A;  4X0G A;  5ICC A;  1R71 A;  1H88 C;  1W36 D;  1TT5 B;  2XKP A;  3BJ6 A;  3PUF A;  4W1U A;  4UV9 A;  5DD8 A;  3UKG A;  2BOL A;  2F6C A;  4QLC U;  4XMY A;  2O0Y A;  1SVM A;  2EZI A;  1ENH A;  1Y1W J;  1XGM A;  4EM1 A;  4CGR A;  3HSE A;  2WWY A;  3HRT A;  3COL A;  2E1C A;  5ED4 A;  2H94 A;  5LFA A;  1PVE A;  2E1N A;  3WU2 C;  3S32 A;  2HDC A;  2XAQ A;  2PJR B;  1ETX A;  3E6B A;  4Q48 A;  3NPI A;  4N9I A;  1ZR4 A;  2QQ8 A;  2W25 A;  5LHG A;  2E35 A;  3CDL A;  2EFP A;  3H0D A;  2VIX A;  4UB8 C;  5DTD A;  5H6Q A;  4KN4 X;  1JUS A;  2E5N A;  3IAS 2;  5F64 A;  1EA3 A;  3ZN0 A;  3I71 A;  1FMW A;  3LL7 A;  2MAB A;  3HRU A;  3KCC A;  3V8L A;  4L0Z B;  4MNU A;  1FSE A;  1FYL A;  4HF2 A;  2A61 A;  2R93 J;  3GLX A;  1FY7 A;  3LA2 A;  3I54 A;  3KIO A;  1QHG A;  1O3Q A;  4HW0 A;  2PBX A;  4UVA A;  1FX7 A;  3CJD A;  5FRN A;  1ZLK A;  4NNJ A;  5HNH A;  1JI8 A;  3F22 A;  2LVS A;  1B8I A;  3RIR A;  2P0W A;  1PUF B;  3BG3 A;  1DU0 A;  1XGN A;  3L09 A;  4IHW A;  3CRJ A;  3V7C A;  5JVT A;  1R5I D;  1SFO J;  3LFU A;  1XB4 A;  2V1U A;  2GZW A;  3RYP A;  2UUZ A;  2HKX A;  3OYF A;  5TGT A;  4BJT A;  5LGU A;  2GLO A;  2HNH A;  2WC2 A;  2BY1 A;  4IRI A;  2Q24 A;  2H8W A;  3QYE A;  3LOC A;  1ZRD A;  3AQT A;  3HIM A;  2DMT A;  4YZE A;  4XR6 A;  2PLY A;  1LE8 B;  4M6Y A;  4EVI A;  2ZKZ A;  5FKK A;  3BRU A;  3Q0V A;  1S3J A;  1A35 A;  1GUU A;  3LA3 A;  2P8T A;  3J81 Z;  1G3S A;  2FML A;  2LRD A;  5D4R A;  5C4Y A;  2R92 J;  1E3O C;  5FKL A;  2JTV A;  4OD4 A;  3CMM A;  3HSR A;  3V6G A;  2VQG A;  5H20 A;  2B7E A;  2ZSH B;  1BW5 A;  3RZO J;  2HS5 A;  5AIQ A;  1OIS A;  1IUY A;  3T1B A;  2CW8 A;  4OOI A;  2HDD A;  1H89 C;  4EJV A;  3HTJ A;  5FLX Z;  1JJ6 C;  1FC3 A;  2L2O A;  5E3L A;  2P81 A;  3DBR B;  3I4P A;  1UST A;  5DCF A;  1R1T A;  3RPU A;  2E5Z A;  5EEH A;  1RR8 C;  2OQG A;  3PAS A;  1SAU A;  2ZJ2 A;  3DWL E;  3L9F A;  3J7A Y;  2K3P A;  2WGB A;  2H1L A;  3LSP A;  4XKV A;  5HDK A;  4HRI A;  5IYC J;  2DAO A;  1OJL A;  3GEZ A;  1QZE A;  1YRN A;  3EUK L;  1HDD C;  3D5R C;  1HXD A;  4Y17 A;  1OFC X;  4RB1 A;  4DGW B;  1ULY A;  5FMP A;  3HBL A;  4OIP F;  4HV5 A;  2IXS A;  3FM5 A;  1XPX A;  4XLA A;  5IT9 K;  2XRO A;  1KU2 A;  2A69 F;  4WXC A;  3S1R J;  1YS6 A;  3J80 Z;  2CRG A;  2DBB A;  3BWG A;  3HPH A;  3ZQI A;  4ZYA A;  1DQU A;  2HI3 A;  3RZD J;  2QKL B;  2F4M B;  2RNJ A;  4LLG F;  2Z33 A;  1DP7 P;  1EJ9 A;  1IRX A;  3F3X A;  2LOO A;  4IXA A;  3RKW A;  5M5W J;  3ZMZ A;  3A01 A;  3H5N A;  3E7L A;  3HKZ N;  2UXX A;  3S17 J;  2IS6 A;  1OPC A;  1R58 A;  2XAH A;  2Q8K A;  2CYY A;  1IRF A;  1ZYR F;  3LSR A;  1FTT A;  2PJP A;  1DU6 A;  4OD5 A;  3HC7 A;  4M6V A;  3WU0 A;  2ISY A;  1JKP C;  2KIF A;  2M34 A;  4AIH A;  5F0H A;  1BC7 C;  2W48 A;  1LJ9 A;  3DPU A;  4DBQ A;  4IOA F;  1T6S A;  1O3S A;  3REO A;  3I64 A;  4IRV A;  2K7L A;  3WTW C;  1XTA A;  1Z0X A;  2J5P A;  3F8M A;  4A0Y A;  3G6E I;  2EIN H;  5EZH A;  2NP3 A;  3BR0 A;  1PYV A;  5FKN A;  2R5Z A;  4L62 A;  2V79 A;  3VVZ A;  1IXS B;  2K27 A;  1ZH5 A;  1Q1V A;  1Y0U A;  3I58 A;  3WTY C;  2NP5 A;  2LKP A;  3OYB A;  3FXK A;  2L7Z A;  3T6N A;  2LY9 A;  2EFQ A;  5F08 A;  3HOT A;  1P4A A;  3IH4 A;  3A1Y A;  2CV0 A;  2Z9O A;  1L3L A;  4KN7 X;  3GFL A;  3ABM H;  4X6A J;  1ZN2 A;  1TWA J;  1WJE A;  2E2H J;  1XSX A;  1LFP A;  3OYN A;  4YRV A;  2XRL A;  3DLA A;  3BTJ A;  3GLL A;  4ZYH A;  3M3Y J;  2MGQ A;  2E71 A;  3FKI J;  4D5F A;  4C3J J;  3WTT C;  2DOD A;  3KZI C;  5M5Y J;  3FZV A;  3IH3 A;  4QIW N;  3TO9 A;  1TTY A;  4UUV A;  4BJ5 C;  1YIJ I;  4G6D A;  4M72 A;  2A07 F;  1FYK A;  3QYB A;  4X1E A;  3K4B A;  4ACI A;  4EM0 B;  1YX5 A;  3OR2 C;  4E6K G;  3QU6 A;  5AIP A;  3OYK A;  2HYT A;  1OCO H;  3CQZ J;  4EAT A;  1BJA A;  2WV1 A;  1ZK8 A;  2BW3 B;  3F6V A;  4R1H A;  2FOK A;  3AFH A;  5E3M A;  2M8G X;  4KWA A;  4BHC A;  4IRH A;  5ILU A;  1K6O A;  1V54 H;  1WCM J;  2R7Z J;  1XGS A;  3S3N A;  3CCU I;  2JA8 J;  2F5V A;  4AUX A;  3VOD A;  2EB7 A;  1TNS A;  3TW6 A;  2NVQ J;  5E1X A;  1F5T A;  5D5X B;  3NRG A;  2A6H F;  2Z5U A;  3ISP A;  1DPU A;  3GZN B;  2XSJ C;  2CFX A;  3NWT A;  4XNF A;  5FGL A;  3IC7 A;  3DPT A;  3RYR A;  3LWJ A;  1GLN A;  4MQ9 F;  3CUO A;  3HUG B;  2XPW A;  5F27 A;  2HPI A;  2QEX I;  1WJF A;  1E3P A;  2YSR A;  1ZG1 A;  3S1M J;  3SZP A;  3ASO H;  2HYF A;  5E20 A;  4MHG A;  5J8F A;  4S04 A;  3V78 A;  2LF7 A;  3CP8 A;  2ZME A;  1K4S A;  4YFK F;  2DG8 A;  4KDP A;  2VJJ A;  1FEX A;  2Z16 A;  5FFZ A;  5L3F A;  4LJZ F;  2H27 A;  4RS8 A;  1GXP A;  4JX6 A;  4UHT A;  3ZP5 A;  2PZ9 A;  5BOX A;  3VOE A;  5BPD A;  3E6M A;  1Z6T A;  4U0Y A;  2HXO A;  3GF2 A;  1X4O A;  1VI0 A;  1NK2 P;  4F7Z A;  1WJA A;  2IGN A;  1OKR A;  2IGO A;  2OER A;  2WA0 A;  1S9H A;  2W7N A;  2IPQ X;  2WY7 Q;  3PNT A;  2BBY A;  3E97 A;  1KU9 A;  4EJT A;  2WAF A;  3PPB A;  2W85 A;  1I27 A;  5HAW A;  5K5R A;  1STZ A;  1O4X A;  5JHU A;  2MBF A;  3ZQH A;  3CMA I;  3CC4 I;  1SMY F;  1LEA A;  4U7B A;  3FF5 A;  1R5G A;  2LY1 A;  1T33 A;  2B0L A;  2AQE A;  2M7A A;  2ZBK A;  1UI5 A;  1MZB A;  2QZ8 A;  1IRG A;  3PQK A;  3K8P C;  3L7W A;  2CW0 F;  4Y33 A;  2BVM A;  2P4W A;  3K1P A;  3HB9 A;  3CO7 C;  2DN0 A;  4UVC A;  5L3D A;  4MFE A;  2STT A;  1ZGW A;  4XKC A;  2L7F P;  1GXQ A;  2R7S A;  4PJJ A;  1G59 A;  1AWC A;  1H9T A;  3BJO A;  1QVU A;  2DI3 A;  2WB1 N;  4CZZ A;  1FSH A;  3CJR B;  3LMM A;  5KVR A;  2EZL A;  2QA4 I;  5LBQ A;  4RDU A;  2KRF A;  2CGP A;  3ML6 A;  5BNG A;  1LPQ A;  2JQ7 A;  2NVX J;  1EKE A;  4A3M J;  1SEU A;  1UAA A;  3WU1 B;  3V42 A;  2X6O A;  3MKW B;  4GCL A;  2BY2 A;  3M8E A;  4XSZ F;  4ENK A;  3DTK A;  2K4B A;  3TL4 X;  1UJ8 A;  1SFU A;  2UXO A;  4ZTJ A;  2OCE A;  2QUF A;  2X0L A;  2DPD A;  1Q1H A;  1OCP A;  3E5Q A;  1WH7 A;  4YFX F;  4BEH A;  1WVR A;  1VQ9 I;  2L02 A;  2DFE A;  3KLO A;  4G9Y A;  1WHU A;  3KX2 A;  3LSG A;  4KIF A;  3S15 J;  1YX3 A;  3CF2 A;  4RM3 A;  5DYM A;  3OYM A;  4B47 A;  2LSO A;  4O3M A;  2QIB A;  4IF4 A;  4ITV A;  4ENN A;  3JSO A;  4Y15 A;  2F48 A;  3OS1 A;  3G73 A;  2XGE A;  1O3R A;  1J09 A;  4P1W A;  2HOS A;  4LK1 F;  3BCG A;  1ITY A;  2GA2 A;  1LVK A;  2P6S A;  4EGY A;  4Z6Y A;  2IS1 A;  2FMY A;  1FP1 D;  2ZXW H;  5IP7 J;  3CCS I;  2ZJR F;  2LYC A;  2YU9 J;  3MNL A;  4HNV A;  4BE1 A;  1OR7 C;  3H35 A;  5J40 A;  5B66 C;  1T98 A;  2BHY A;  3PSI A;  4PJN A;  3VYR B;  3I3L A;  2G7S A;  2R3S A;  3ZOB A;  4U7D A;  3K7A J;  1U78 A;  4MK6 A;  3G4S I;  5CXG A;  2RV8 A;  1HSJ A;  4MXM A;  3EUA A;  3KLN A;  3KP5 A;  2OF7 A;  3Q0W A;  1CGP A;  1OYW A;  2LP0 A;  3AG4 H;  4XLH A;  3JAM Z;  4IHX A;  2YX4 A;  5A2Q K;  2R7F A;  1OCT C;  1MW7 A;  2EV0 A;  1T08 B;  1OLT A;  1N25 A;  1Y6I A;  4R79 A;  1DP3 A;  2K9M A;  3FMS A;  4HDU A;  2AS5 F;  3TO6 A;  5D6F A;  1MD0 A;  3ERM A;  3C7J A;  3U21 A;  3JRG A;  3RKQ A;  2MD0 A;  3BG7 A;  3S3O A;  3IAM 2;  4II3 A;  3UR3 C;  1X1P A;  2EQR A;  3ZN1 A;  1X3U A;  3FXO A;  4KMU X;  2P7V B;  4PJM A;  4L9N A;  2IAI A;  2A68 F;  3BTI A;  1NG7 A;  1DGR M;  3GTO J;  5D5U B;  4B43 A;  1T39 A;  5IOY A;  2ZXI A;  1PP7 U;  2L4A A;  2K3F A;  4ESF A;  2IA2 A;  3ECO A;  3NRV A;  2WAD A;  3VWB A;  5E18 F;  1VZ0 A;  4KIC A;  2MLG A;  1X1C A;  2LNB A;  1TWF J;  2Y2Z A;  4WCG A;  4OIN F;  3SFZ A;  3BTC A;  4PXI A;  3DP7 A;  3JSJ A;  1RIO H;  3I5U A;  1IN6 A;  2KPM A;  4U87 A;  2HYJ A;  3OYL A;  1VFC A;  4HNT A;  1RKT A;  4Y52 J;  3BR1 A;  1QA6 A;  3LWF A;  2M3A A;  1LB2 A;  4LIT A;  3V4G A;  4II2 A;  1HST A;  1VND A;  5LGN A;  3R4K A;  4D0P A;  3W2A A;  2QSG X;  5EYR A;  2EJR A;  2VLA A;  1TC3 C;  2QOP A;  4DYQ A;  2KRC A;  5E17 F;  4XK4 A;  4HAM A;  4V2G A;  3KP3 A;  3FBN B;  3QOD A;  3EUH A;  1YJ9 I;  1T0F A;  1ODD A;  2K86 A;  3V8J A;  1J2X A;  3H9J A;  2QWT A;  1LVA A;  3ECH A;  3K4J A;  1B59 A;  2QKO A;  4BQN A;  2JA2 A;  1U8B A;  2O5R A;  1F4K A;  4B44 A;  4KIB A;  3COA C;  5D19 A;  1OMI A;  1IDY A;  3FK6 A;  2XIG A;  5HS8 A;  4IHT A;  3CLQ A;  1YW7 A;  4HQE A;  2NNN A;  5LEK A;  3LSK A;  5J3L A;  1WJB A;  1YTY A;  1S7E A;  4PFP A;  1W7P B;  1QPI A;  1F9N A;  2GBY A;  3FXL A;  5IT9 Z;  1DUX C;  5J47 A;  1Z91 A;  2ZXH A;  1XDS A;  3DEU A;  3GCM A;  4PJ0 C;  1WKM A;  3R61 A;  4RB2 C;  4I76 A;  3OYE A;  3HOV J;  2F07 A;  2Y31 A;  1MBG A;  4KMF A;  3N97 A;  1V3F A;  1TWG J;  1SFX A;  3SQN A;  1LDD A;  2HTJ A;  3I4N J;  1LUJ B;  3VYT B;  5IOZ A;  2VXZ A;  1UI6 A;  3VB2 A;  1AHD P;  2V9K A;  2OZU A;  4DQ2 A;  2VOO A;  1O7F A;  1T38 A;  1U5T A;  4B8X A;  4L18 B;  4G7Z F;  3V7R A;  2CFO A;  3OOP A;  3BQY A;  3MZ8 A;  4IHS A;  2GQQ A;  4GCV A;  1R00 A;  4H0E A;  3VTI A;  5IT3 A;  3E5X A;  1FBU A;  4ZZD A;  4HZF A;  3P9C A;  2PI0 A;  1LKX A;  2LBF B;  3CUQ A;  2L5Q A;  2QKM B;  2DMN A;  3G7R A;  1EH6 A;  2AHQ A;  2MA3 A;  4A3E J;  3KET A;  1UG0 A;  1YI2 I;  2VPL A;  1ONV A;  2COM A;  3HGY A;  2DFH A;  4XON A;  1CQT A;  3ULQ B;  5CVV A;  3OL4 A;  4A3I J;  1KYW A;  2IBD A;  2KT0 A;  3B73 A;  3DF8 A;  1D0Y A;  4U0W A;  2G7G A;  2PMZ A;  2DQL A;  3IP4 B;  2DTR A;  4HA8 A;  4XOR A;  3G71 I;  1RUN A;  3VP5 A;  4KT6 A;  4F91 B;  3EYY A;  2A05 A;  4XRF A;  1TZL A;  4QWQ A;  2RQQ A;  5J4Y A;  4HOB A;  3JRH A;  2KRH A;  3HTA A;  1REP C;  1PUF A;  2HOT A;  4UDS A;  1S8N A;  2IRF G;  3E3V A;  2M0C A;  5CQE A;  3NAU A;  4MTE A;  2I8D A;  3QBM A;  3BPX A;  2R7Q A;  1R22 A;  3LSI A;  1HW2 A;  1BW6 A;  1SD7 A;  1JE8 A;  1J75 A;  2GM4 A;  1BIB A;  1R1U A;  4QPQ A;  5HS7 A;  2ZFW A;  3D5L A;  4PFO A;  2DJI A;  2WAQ N;  3IUV A;  4FE4 A;  1X2N A;  4KA4 A;  2Y9Y A;  1MMN A;  3OS0 A;  4E7I A;  2MH2 A;  1LE8 A;  4HLY A;  2MD5 A;  1QZY A;  3HPG A;  3MEX A;  3HM5 A;  1O3T A;  1U5T B;  3KZY A;  3VDX A;  3KP7 A;  2HWV A;  1KU7 A;  2Z2S B;  3SDG A;  4G7H F;  1WPK A;  3FIS A;  2L0K A;  1TLH B;  3DPL C;  2QCO A;  3HTU A;  3HJE A;  2OBP A;  4BQO A;  4OMY A;  5HDN A;  3H3U A;  4M9X A;  2TDX A;  3RD3 A;  3H3Z A;  4RGR A;  3VIB A;  3GBG A;  5CYV A;  4AC0 A;  2HKU A;  2DOE A;  3WOD F;  4A3L J;  1SAX A;  3HTH A;  3CUQ B;  1YJN I;  2DPU A;  5FGM A;  1FOW A;  2STW A;  3K4K A;  1V55 H;  1YIO A;  4LFU A;  4CCL A;  4GYG A;  3OMY A;  1IGN A;  2VJ4 A;  2O7O A;  2QSF X;  3U1D A;  3LHQ A;  1G3T A;  1CF7 B;  1Z9C A;  1VQL I;  3M07 A;  1VQ8 I;  4NC8 A;  4D1Q A;  4ZDL A;  3S2H J;  3Q9S A;  4XKB A;  4LK0 F;  3HHH A;  3GWZ A;  2HFH A;  4MIM A;  1A31 A;  3JRE A;  3BHQ A;  2ID6 A;  4CH7 A;  3WTX C;  3EYI A;  4HBL A;  3M8J A;  3L2V A;  1P4W A;  2L3D A;  2V6E A;  3K70 D;  1QPM A;  2AXT C;  4A3D J;  3G1M A;  4ENM A;  1BI0 A;  1QVT A;  1UHM A;  2K4J A;  1G3Y A;  3HXL A;  1S29 A;  4GYI A;  2LD5 A;  3A0B C;  3GZI A;  5FKM A;  3P9K A;  2XUB A;  2R7U A;  3LQR A;  5F1R A;  3ONQ A;  3HGG A;  3KP4 A;  2UWM A;  1XSV A;  1GHC A;  3BJB A;  2GXG A;  2L01 A;  2CQX A;  4EGZ A;  4OIO F;  4I09 A;  1ORK A;  5BQT A;  4CYD A;  4XID A;  3KKC A;  1ZRC A;  4P9F A;  2OUM A;  1W7P D;  5F6F A;  1R9T J;  2CW7 A;  4A6D A;  4LG0 A;  1UCR A;  4GFL A;  3ZQL A;  5L3C A;  1MMA A;  2F4I A;  3EUH C;  3A4C A;  4RA2 A;  3HOS A;  4AF5 A;  3F0C A;  1T0F C;  3OYI A;  1Y8Q B;  1VTN C;  3BZC A;  2V6C A;  4BS9 A;  2HKO A;  1JKR C;  3KE2 A;  2DTZ A;  2NOG A;  4BH9 A;  4MQV A;  3SYT A;  4B09 A;  4BXX J;  2M5W A;  2MH9 A;  3SXY A;  1J0R A;  2KFD A;  3RTR A;  3RI4 A;  3FIW A;  2LDU A;  2M4K A;  2Y30 A;  2V1D A;  2FD5 A;  1MBF A;  3C18 A;  3CCY A;  3GW2 A;  2CV1 A;  3J7A O;  1N77 A;  3L2Q A;  1ZRE A;  2NVT J;  5FD6 A;  1KZH A;  1K78 B;  1BL0 A;  2Y0S N;  4U0V A;  2GFN A;  1P4X A;  3ZMD A;  4XRS A;  1UG2 A;  2EFO A;  2DMP A;  4BY1 J;  3K6G A;  3TW7 A;  3L2W A;  2H6B A;  4I2O A;  4BKX A;  5HLG A;  4A3B J;  3EGQ A;  1HLV A;  3OY9 A;  1B9M A;  1WZ2 A;  1TW3 A;  3B6C A;  1QO0 D;  5J1R A;  1FMV A;  2VBZ A;  4LIV A;  3OSG A;  3AL0 B;  1MMS A;  2IJL A;  3ABU A;  2VKE A;  4Z2Y A;  3I59 B;  2FJI 1;  1V4R A;  2DO7 A;  3MMY B;  4RMN A;  2BYV E;  4NEL A;  1U5T C;  5HBU A;  3F72 A;  3F8N A;  3KNW A;  2X1E A;  1YHQ I;  1IAW A;  1D0X A;  5GTI C;  3IL2 A;  4MEY F;  1MBE A;  1Y1V J;  4Y13 A;  3QPT A;  3VYU B;  3HTI A;  3R6S A;  2DA5 A;  4I98 B;  1VQ4 I;  2LR8 A;  4I6Z A;  1JXS A;  3QOP A;  2BW3 A;  2HDW A;  4L0Y B;  1BOA A;  3ZQQ A;  2Z1D A;  1IJW C;  2CO5 A;  4F3Q A;  2J5O A;  3CUQ C;  2M0M A;  4FX4 A;  1VQ7 I;  2JA5 J;  4LG0 B;  2CQ7 A;  2HQ5 A;  2FQ3 A;  2Q1Z B;  2ZC2 A;  1LDK B;  1XCV A;  4RAF A;  1IUF A;  3ESW B;  3T0Y A;  4CCN A;  5DDG A;  1IN8 A;  5GP9 A;  3R60 A;  3MWM A;  2FBQ A;  4YEL A;  1D8K A;  4ESJ A;  5LEJ A;  1OR7 A;  2VKH A;  1VF9 A;  2DA7 A;  2IA1 A;  4JYK A;  5C44 J;  3I9V 2;  1I39 A;  3ZRG A;  1G4D A;  3G1L A;  2EIM H;  2G9W A;  1XX5 A;  2XAG A;  4BHP A;  1SMT A;  3M8F A;  3DV8 A;  1U9N A;  1V5G A;  1ZAO A;  2HQA A;  3HUG A;  3KYL A;  3D1N I;  3E0J B;  3H1C A;  5ERI A;  2X1C A;  3CES A;  4M3F A;  1V5F A;  3G1O A;  3BCB A;  2DA2 A;  4XQF A;  1HKT A;  3KP6 A;  2MC3 A;  3RPQ A;  2E60 A;  4AYB A;  5D18 A;  4FT8 A;  4RLQ A;  4JL3 A;  2R5Y B;  4JKZ A;  4NHJ A;  3QQA A;  2IW5 A;  4XIC A;  2O9L A;  2VKV A;  1BI1 A;  4M3G A;  1X4P A;  5IYB J;  1YLF A;  2BXZ A;  2FNP A;  2REK A;  1PJR A;  5E8G A;  3P7N A;  4DOZ A;  3TKY A;  4CO8 A;  2R0Q C;  2V26 A;  5ILV A;  4RB0 A;  2ISZ A;  1WWX A;  3WE3 A;  3WGI A;  4B3A A;  2DA6 A;  1FLI A;  2ECB A;  3DCF A;  5TIS C;  4UV8 A;  2RQP A;  1J59 A;  2VBW A;  2KMU A;  3AG2 H;  4PCQ A;  4BY7 J;  5JLW A;  2HVQ A;  2QF7 A;  4ZYG A;  1R6R A;  2VN2 A;  1J7K A;  2VT3 A;  5F0F A;  5ICG A;  2CH0 A;  3IRR A;  3F9K A;  2LG4 A;  3DKY A;  3PQJ A;  2Y9Z A;  5H6R A;  5DS9 A;  3TOB A;  4BYY A;  4HKU A;  1YOV B;  1BJZ A;  1A5J A;  4D7N A;  4EV0 A;  4C2M J;  4E7Z A;  3KFW X;  1MDM B;  3CC7 I;  3IKT A;  3KZ9 A;  4IZZ A;  5C4J J;  1NTC A;  5IP6 A;  2DT5 A;  1HKS A;  4B4C A;  3O60 A;  3QPL A;  3BC8 A;  3JCU C;  2HOE A;  1D1B A;  2EK5 A;  3IRQ A;  1RET A;  3ANP A;  2R7T A;  3WTZ A;  4BAC A;  1MGT A;  3PNV A;  3JTG A;  5CLS A;  3SEZ A;  1JT6 A;  4PK4 A;  4K2E A;  5DM6 F;  2N8G A;  3GZ6 A;  1ZR2 A;  3AL0 C;  4J01 A;  1WJC A;  3DKW A;  2JVG A;  3IH2 A;  3N05 A;  2KLO A;  4JX5 A;  3K4C A;  2RC4 A;  2WAE A;  3GTJ J;  1YFH A;  1XS9 A;  5D8K B;  4IKF A;  3NAR A;  1YW9 A;  1DGW Y;  3FDY A;  1BM9 A;  1IXR C;  1ZGJ A;  1G2H A;  3FXQ A;  2ACJ A;  3CMY A;  1UHS A;  1R5H A;  1A6Q A;  4Y4R A;  2KZG A;  1K79 A;  2QGU A;  2XGD A;  2FBK A;  2IGK A;  2QQ9 A;  4WWC A;  1FBS A;  4HST A;  3VVX A;  1VQP I;  2X48 A;  3MD2 A;  2LRE A;  3FMR A;  3MZH A;  2FSW A;  4XM3 A;  2K9N A;  2CQQ A;  4GRI A;  2O8K A;  2XAU A;  1R36 A;  3QAH A;  3TP0 A;  1N78 A;  2HVS A;  2VOP A;  3DTE A;  2JSP A;  5DD4 A;  3D0S A;  3ON4 A;  3GFI A;  4I7H A;  4C3I J;  5DM7 F;  2LKX A;  2MLK A;  3SWH A;  2P7C B;  4G94 A;  2YVX A;  4G7O F;  5IY5 H;  1JKQ C;  4RB3 C;  3F8C A;  4AWX B;  4D5C A;  2MC4 A;  1W5C C;  2CG4 A;  4KIG A;  2JSC A;  3RDI A;  9ANT A;  3DU5 A;  4HX8 A;  4M71 A;  1I6H J;  2KL4 A;  3RKX A;  5EGO B;  1H9G A;  3MAJ A;  3HEF A;  1GV2 A;  5KNL A;  3ABK H;  3SFI A;  3BQZ A;  2DOA A;  1WI3 A;  1RR7 A;  1IW7 F;  1SFK A;  1WJ5 A;  2EH3 A;  3LQQ A;  4XBF A;  2GAU A;  3WHB A;  1D1C A;  4O6J A;  1XGO A;  3RQI A;  3S8P A;  3BR5 A;  3KPH A;  2OI8 A;  3AG1 H;  3BOQ A;  3K2A A;  4UUS B;  2NNY A;  5IPA A;  2E1M B;  3J81 K;  5LRS A;  4GFB A;  5F0C A;  2B3W A;  1JKO C;  1HW5 A;  1YW8 A;  3K2Z A;  4U9L A;  2VBX A;  4IVN A;  2W84 A;  4AIK A;  3ELK A;  3TP3 A;  3WHC A;  1ERD A;  4BQA A;  2X1D A;  1Y39 A;  3CCL I;  1I5Z A;  2JZY A;  5FRM A;  1D5Y A;  2VB6 A;  3I55 I;  3CJT B;  3T8T A;  5FLX K;  2OD5 A;  3ZMT A;  1ETW A;  1MJ9 A;  1UMQ A;  3HHG A;  3IWZ A;  2O3F A;  3VPR A;  5EG0 B;  5F04 A;  4XLP F;  4KJZ A;  2H6C A;  2KDO A;  4RGS A;  5JHF A;  1RNL A;  2QM3 A;  3N4M A;  1HA8 A;  2GA1 A;  3BZ6 A;  1T95 A;  2ID3 A;  4F92 B;  4YEJ A;  1IXC A;  4KT5 C;  2OPT A;  5FLM J;  1FYM A;  2JA7 J;  2IU5 A;  4ZZL A;  1FPQ A;  1MND A; 
#chains in the Genus database with same CATH homology
 4I76 A;  3HOV J;  2KDZ A;  2Y31 A;  1MBG A;  1SFO J;  2F07 A;  2ZCM A;  2XDN A;  1TWG J;  1NK3 P;  1ETQ A;  5JLX A;  3I4N J;  5J1U A;  3DEW A;  2GLO A;  3RH2 A;  5EGO A;  5IOZ A;  1UI6 A;  3AQS A;  1AHD P;  2UXU A;  2ME6 A;  2Q24 A;  1I50 J;  1RKW A;  1FIA A;  3LOC A;  4C3H J;  1HF0 A;  4L5E A;  3AQT A;  1GV5 A;  3HIM A;  2DMT A;  2XGC A;  4YZE A;  5D1R A;  1LE8 B;  3LSJ A;  3BQY A;  3A01 B;  5FKK A;  3BRU A;  3Q0V A;  2LLK A;  5EF6 A;  1GUU A;  2JK3 A;  1FJL A;  4UUS A;  4A3K J;  1T56 A;  4FTH A;  5C4Y A;  2R92 J;  2XB0 X;  1E3O C;  3S16 J;  5EZG A;  2DMN A;  5FKL A;  4A3C J;  3G7R A;  4Y7N J;  1WGX A;  3V6G A;  2AHQ A;  4AYB N;  4A3E J;  1BW5 A;  3RZO J;  4RBO A;  3PM1 A;  5GPC A;  1SAN A;  3HGY A;  1CQT A;  3A02 A;  5J1Y A;  4A3I J;  2HDD A;  1H89 C;  2IBD A;  2KT0 A;  3HTJ A;  1JJ6 C;  2G7G A;  5E3L A;  3S14 J;  3VP5 A;  2P81 A;  2NVY J;  4BBS J;  5EG0 A;  2R5Z B;  3CWR A;  3PAS A;  2WGB A;  1B72 A;  3LSP A;  3JRH A;  5IYC J;  2UXH A;  1GVD A;  2HXI A;  1OJL A;  3HTA A;  1JTX A;  4A69 C;  1PUF A;  1YRN A;  4GCT A;  2HOT A;  1HDD C;  2D6Y A;  4UDS A;  1OFC X;  2E1O A;  5E3N A;  3VVY A;  5FMP A;  3HBL A;  5K7F A;  2VUM J;  2M0C A;  3MKL A;  2E2I J;  1HCR A;  3NAU A;  3S1R J;  3QBM A;  2CRG A;  1JUP A;  1SGM A;  3VOK A;  1BW6 A;  3ZQI A;  2GM4 A;  2EBI A;  3NI7 A;  4ABZ A;  1P7I A;  4JNN A;  2HI3 A;  2WAQ N;  3IUV A;  5M3F J;  3RZD J;  4FE4 A;  4MLO A;  2AO9 A;  1X2N A;  2W53 A;  2Y9Y A;  2GUH A;  3JRD A;  4LOC A;  3OOU A;  2G7L A;  2FQ4 A;  1ETY A;  1LE8 A;  5H9T A;  5M5W J;  2V57 A;  3GTK J;  3A01 A;  3E7L A;  3HKZ N;  3E7Q A;  2CJJ A;  3HM5 A;  3S17 J;  1JJ8 C;  1F43 A;  4XRS G;  1FIP A;  3SDG A;  1WPK A;  2EZH A;  3FIS A;  2L0K A;  3LSR A;  1TWC J;  3MVP A;  1FTT A;  2QCO A;  1XC5 A;  1DU6 A;  3JR9 A;  3RD3 A;  4M6V A;  4CYC A;  3VIB A;  3GBG A;  1JKP C;  2M34 A;  4AC0 A;  2HKU A;  5F0H A;  4S0H B;  2W48 A;  4A3L J;  3HTH A;  3BNI A;  2LTP A;  3KKD A;  1IGN A;  1Z0X A;  2O7O A;  5EZH A;  1IDZ A;  4M3D A;  3BR0 A;  2R5Z A;  5FKN A;  2NP3 A;  1LFB A;  3LHQ A;  4L62 A;  3VVZ A;  1HOM A;  3S2H J;  5M3M J;  3B81 A;  2I10 A;  1Q1V A;  2X9D A;  4J19 A;  5IYD J;  2NP5 A;  4MIM A;  4MO7 A;  2L7Z A;  3JRE A;  2LY9 A;  4IHV A;  3BHQ A;  3T6N A;  4V2F A;  2ID6 A;  5F08 A;  3IH4 A;  1B72 B;  1H8A C;  3QKX A;  2YVE A;  4X6A J;  2H8R A;  1GT0 C;  1TWA J;  3OSF A;  2E2H J;  4A3D J;  1RPW A;  3G1M A;  4IEJ A;  3L1P A;  4GFK A;  2ELK A;  2XRL A;  1QVT A;  3BTJ A;  3NNR A;  3M3Y J;  2MGQ A;  1MBK A;  2LD5 A;  3FKI J;  4D5F A;  3GZI A;  4C3J J;  5FKM A;  5M5Y J;  1ZTR A;  3HGG A;  5FKO A;  3JRB A;  3IH3 A;  4DW6 A;  4QIW N;  3BJB A;  2CQX A;  1ORK A;  1RES A;  4XID A;  3KKC A;  3SJM A;  3BTL A;  4UUT A;  3P9T A;  4X1E A;  4ACI A;  2ZCX A;  1R9T J;  2NX4 A;  3FK7 A;  2HYT A;  1FTZ A;  2DG7 A;  3CQZ J;  4DYC A;  2WV1 A;  4GFL A;  1ZK8 A;  3BR2 A;  1ETV A;  5EEA A;  3ZQL A;  1MSF C;  1IV6 A;  5E3M A;  2M8G X;  4DZJ A;  3NXC A;  4AF5 A;  2DMU A;  2K40 A;  3F0C A;  5HOD A;  4KWA A;  3Q3S A;  1F36 A;  2G0E A;  5F1J A;  3GTL J;  1JKR C;  4CYC B;  2DTZ A;  2NOG A;  1WCM J;  2K9S A;  2VI6 A;  3BG9 A;  2R7Z J;  4BXX J;  2ZCN A;  2JA8 J;  3FIW A;  4AUX A;  1IG7 A;  2H1K A;  2Y30 A;  3BR3 A;  1X58 A;  2FD5 A;  1MBF A;  3CCY A;  3LNQ A;  3QPS A;  2NS8 A;  3TW6 A;  5GPA A;  2NVQ J;  3NRG A;  3A03 A;  2NVT J;  1BL0 A;  2Y0S N;  2GFN A;  4XRS A;  5FGL A;  1UG2 A;  3PO3 J;  2DMP A;  4BY1 J;  3LWJ A;  3TW7 A;  2L9R A;  3S1N J;  3H0G J;  4BKX A;  4A3B J;  2TRT A;  1HLV A;  3EGQ A;  2XPW A;  1HDP A;  4ME9 A;  3VUQ A;  5F27 A;  2VPR A;  3B6C A;  5J1R A;  3S1M J;  2RAE A;  3HOY J;  3GTG J;  2TCT A;  3OSG A;  3V78 A;  5EDN A;  2DG8 A;  1FEX A;  2VKE A;  4FCY A;  4DYR A;  1AKH B;  4NEL A;  4JX6 A;  2PZ9 A;  1IRZ A;  2MG4 A;  2UXP A;  1ZQ3 P;  1LFU P;  5HBU A;  3KNW A;  2HXO A;  1NK2 P;  1VI0 A;  1MBE A;  1Y1V J;  2OER A;  2NS7 A;  3HOZ J;  3HTI A;  2DA5 A;  3M4O J;  2LR8 A;  4I6Z A;  3S2D J;  1IJW C;  3PPB A;  1A6I A;  2YUS A;  2MSY A;  4M3E A;  2ZOY A;  5HAW A;  3F1B A;  3BT9 A;  2JA5 J;  2JN6 A;  5C3E J;  1O4X A;  3OIO A;  3GTQ J;  2HQ5 A;  2LFB A;  3ZQH A;  2E19 A;  1T33 A;  1IUF A;  5EFY A;  4JX4 A;  1UI5 A;  4M3B A;  2CUE A;  1EF4 A;  5GP9 A;  4AC6 A;  2FBQ A;  5K58 A;  3HB9 A;  5AQC A;  2B63 J;  2DN0 A;  2D5V A;  1VF9 A;  4MFE A;  2DA7 A;  4JYK A;  5C44 J;  3TED A;  2L7F P;  1ZGW A;  3EUP A;  3G1L A;  5K7Z A;  3ZQG A;  3HDD A;  3H3V K;  4GCK A;  1QVU A;  2WB1 N;  2EZL A;  2IEK A;  3Q0U A;  1MH4 A;  1U9N A;  4RDU A;  5BNG A;  3D1N I;  1MNM C;  2NVX J;  3S1Q J;  4FE7 A;  4FIS A;  4A3M J;  4B1R A;  5HSZ A;  4M3F A;  4A3G J;  2XB5 A;  3G1O A;  2GEN A;  2DA2 A;  2X6O A;  4MFD A;  4GCL A;  2CUF A;  3GTM J;  3VW2 A;  5D18 A;  4JL3 A;  2R5Y B;  2CU7 A;  2UXO A;  3QQA A;  4XRM A;  2COB A;  1AU7 A;  4JKZ A;  4XIC A;  2O9L A;  1AKH A;  4D7M A;  2VKV A;  2L7M P;  1OCP A;  2WUI A;  4G12 A;  1W0T A;  1MBH A;  1WH7 A;  4M3G A;  3VW1 A;  5IYB J;  2REK A;  3S15 J;  2G3B A;  3LSG A;  1TWH J;  3PO2 J;  2LK2 A;  3ON2 A;  3C07 A;  1ETK A;  3B6A A;  2QIB A;  3HE0 A;  2R0Q C;  2K9Q A;  5IP9 J;  4B3A A;  2DA6 A;  2XGE A;  2ECB A;  4BBR J;  3DCF A;  2HOS A;  3BCG A;  3O8G A;  1POG A;  1ITY A;  1JUM A;  4BY7 J;  4EEF G;  2RAS A;  3C2B A;  5CXI A;  5JLW A;  3VOX A;  2DA4 A;  2QF7 A;  1XG1 A;  2DA3 A;  4QTR A;  5C4X J;  5F0F A;  2MW8 A;  3BG5 A;  5IP7 J;  2M9H A;  2YU9 J;  2E2J J;  3MNL A;  4HNV A;  5CW8 A;  2Y9Z A;  3S5R A;  5DS9 A;  4HKU A;  3JRI A;  1BJZ A;  2M2E A;  1A5J A;  4D7N A;  1ZKG A;  1MSE C;  2G7S A;  4C2M J;  1P7J A;  4W97 A;  3W6V A;  4ICH A;  3ZOB A;  3K7A J;  5K7H A;  1I3Q J;  1U78 A;  1APL C;  3KZ9 A;  3HOW J;  4MK6 A;  5CXG A;  3ZQF A;  5C4J J;  1NTC A;  5IP6 A;  4A93 J;  4B4C A;  3O60 A;  3QPL A;  4MXM A;  2FJ1 A;  1QRY A;  3Q0W A;  2OF7 A;  1K83 J;  2XSD C;  2DA1 A;  4JP0 A;  2LP0 A;  3JRA A;  3IV5 A;  3LJL A;  1RET A;  3ANP A;  4IHX A;  2O7T A;  1OCT C;  3HOX J;  1ZR2 A;  1JT6 A;  5DAJ A;  2N8G A;  1ETO A;  3O8H A;  3G56 A;  3IH2 A;  4JX5 A;  1XS9 A;  3GTJ J;  2R5Y A;  3NAR A;  3JRC A;  1MH3 A;  1W0U A;  4DZP A;  5FHP A;  1G2H A;  3JRG A;  3RKQ A;  3CMY A;  1UHS A;  2FX0 A;  1K61 A;  1BA5 A;  2RHA A;  2EQR A;  3VW0 A;  1U9O A;  4IHY A;  2XGD A;  3I4M J;  3VVX A;  2IAI A;  3ANG A;  2X48 A;  3BTI A;  2JWT A;  2K9N A;  2CQQ A;  1X2M A;  2O8K A;  3GTO J;  2YVH A;  3BR6 A;  3TP0 A;  5IOY A;  1WH5 A;  3FRQ A;  4NN1 A;  4NDL A;  4QSH A;  3ON4 A;  2HOA A;  2JMW A;  4C3I J;  1B8I B;  2ZOZ A;  2LKX A;  3JRF A;  1IC8 A;  2Y2Z A;  1TWF J;  1JKQ C;  5FLV A;  3BTC A;  2ECC A;  2ME0 A;  1JGG A;  5M5X J;  4PXI A;  2JA6 J;  5E3O A;  4D5C A;  2DMQ A;  3JSJ A;  1H88 C;  9ANT A;  2HYJ A;  2EZK A;  1I6H J;  4W1U A;  1VFC A;  1RKT A;  5EGO B;  4Y52 J;  3BR1 A;  3UKG A;  3HEF A;  1Z77 A;  1GV2 A;  1VND A;  2EZI A;  1ENH A;  2PMZ N;  3BQZ A;  3SFI A;  1Y1W J;  4CGR A;  1WI3 A;  2UXI A;  1RR7 A;  5EYR A;  4A3F J;  1GDT A;  2EH3 A;  2ZB9 A;  3COL A;  1TC3 C;  3GEU A;  2QOP A;  4DYQ A;  3WHB A;  1JTY A;  3RQI A;  4XK4 A;  3BR5 A;  2OI8 A;  4V2G A;  1ETX A;  3K2A A;  4UUS B;  3NPI A;  5IPA A;  2XPV A;  1MBJ A;  1ZR4 A;  4GFB A;  5F0C A;  1JKO C;  3ZQC A;  3CDL A;  3MN2 A;  5DTD A;  2QWT A;  3WHC A;  3TP3 A;  2YS9 A;  2QKO A;  1JUS A;  2XPU A;  1D5Y A;  1U8B A;  2QTQ A;  2R93 J;  5D19 A;  1ETW A;  1IDY A;  2DJN A;  1UMQ A;  3FK6 A;  3GTP J;  5FJ8 J;  2PBX A;  3VPR A;  5EG0 B;  3CJD A;  5F04 A;  4A3J J;  3HOU J;  5J3L A;  1JT0 A;  2LVS A;  1B8I A;  1S7E A;  1QPI A;  2GBY A;  1PUF B;  3BG3 A;  2ID3 A;  5FLM J;  1YRN B;  3DPJ A;  2OPT A;  2JJ7 A;  1DU0 A;  2JA7 J;  2IU5 A;  4IHW A;  3CRJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...