4XK4A

E. coli transcriptional regulator rutr with dihydrouracil
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
196
structure length
196
Chain Sequence
b'SAKKKAILSAALDTFSQFGFHGTRLEQIAELAGVSKTNLLYYFPSKEALYIAVLRQILDIWLAPLKAFREDFAPLAAIKEYIRLKLEVSRDYPQASRLFCMEMLAGAPLLMDELTGDLKALIDEKSALIAGWVKSGKLAPIDPQHLIFMIWASTQHYADFAPQVEAVTGATLRDEVFFNQTVENVQRIIIEGIRPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator RutR
publication title E. COLI TRANSCRIPTIONAL REGULATOR RUTR WITH DIHYDROURACIL
rcsb
source organism Escherichia coli (strain k12)
molecule tags Transcription regulator
total genus 78
structure length 196
sequence length 196
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08362 TetR_C_3 YcdC-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4xk4A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 4xk4A02
5FKMA 1Q1VA 3B6CA 3ZQFA 5EG0B 3IH4A 4GFBA 5K58A 2K9QA 3QKXA 2XGCA 3BG9A 3FRQA 2F07A 2ECCA 1RKWA 1GV2A 3TW6A 5IOYA 4JNNA 2NVXJ 3NI7A 1Y1WJ 1MNMC 2NVYJ 5IPAA 2LY9A 3I4NJ 3PASA 5IYDJ 2XPUA 3I4MJ 4W97A 2DJNA 2MW8A 2G7GA 1S7EA 3GEUA 3BG5A 2UXOA 4X6AJ 4V2GA 4V2FA 3HB9A 3S2DJ 3CCYA 3LSGA 1JTYA 4FISA 5DS9A 2R0QC 3A02A 2DA2A 3ZQIA 1AKHB 2JK3A 3QQAA 2HOAA 4DZJA 4L62A 2M0CA 5IYCJ 1AHDP 4I76A 5C4XJ 2GUHA 3BNIA 3EGQA 3NARA 2H1KA 3W6VA 2M34A 1BL0A 2DMTA 2ID3A 1ZK8A 2GENA 2ZCNA 3RQIA 3H0GJ 4MXMA 2G0EA 1A5JA 2YVEA 1X2MA 2X6OA 1X58A 2GM4A 5M5XJ 3IV5A 4JX6A 1YRNB 4DYQA 2GLOA 5M5YJ 4GCLA 2L7ZA 4RBOA 3S1MJ 2NVTJ 4JL3A 1JJ6C 5EF6A 2CUEA 5E3LA 3ANPA 2HKUA 3GBGA 3TEDA 1ETWA 2TRTA 3ZQGA 2LTPA 1MBGA 3JRGA 3ON4A 1IG7A 2XDNA 1B8IA 4GCKA 2LFBA 2R5ZA 2Y30A 5E3OA 1NTCA 1TWHJ 1PUFA 3H3VK 4NN1A 1G2HA 5EZHA 3K7AJ 2DMQA 4A69C 2PBXA 3S1NJ 4A93J 3G56A 2CJJA 2EH3A 3CDLA 5CW8A 2HYTA 2DA6A 3HOYJ 1OFCX 3D1NI 4BY1J 2DG7A 5IOZA 1MBJA 1TWAJ 3BG3A 4M3FA 3BR0A 3HBLA 3RH2A 2YS9A 3ANGA 2WV1A 5HBUA 1H88C 3NRGA 3WHBA 3OOUA 3PO2J 2ZCMA 3IUVA 3RKQA 3FKIJ 2FBQA 3S1RJ 5EZGA 1XC5A 4A3IJ 2H8RA 2O8KA 4A3GJ 3FK7A 2HYJA 3C07A 5F1JA 2QIBA 4JKZA 1H8AC 3V78A 2DG8A 2VKEA 3M3YJ 3JRAA 2M8GX 2REKA 3NPIA 2DN0A 2RASA 1SANA 2LKXA 3S17J 3Q3SA 1W0TA 4IHXA 2EZLA 5AQCA 2RAEA 3MN2A 4M3BA 1OJLA 3PPBA 4CYCA 3QBMA 4BBRJ 2CQQA 3KZ9A 1ETKA 3GTJJ 3BR6A 5CXIA 4A3KJ 5IYBJ 3JRFA 1B8IB 5J1RA 3HOWJ 2COBA 2R5ZB 5HSZA 3HOVJ 2XB5A 3HTAA 3PO3J 2LP0A 4FTHA 3HGYA 1PUFB 1GDTA 3LOCA 5EYRA 2HXOA 2X9DA 4AC0A 4AUXA 2G7SA 2N8GA 1DU6A 2CU7A 1LFBA 1HDPA 3Q0VA 3BCGA 2FQ4A 1UHSA 4IEJA 2LK2A 2EQRA 3FK6A 1X2NA 2R93J 3G7RA 1FTTA 5M3MJ 4MFEA 3O8GA 2PMZN 4XIDA 3GZIA 4DW6A 4CGRA 5IP6A 4ME9A 5K7FA 5EDNA 2DMPA 1HF0A 1FJLA 2LLKA 1SGMA 1P7IA 2LD5A 3JRBA 2JWTA 4RDUA 1U8BA 3F0CA 1ZR4A 2O7TA 1TWCJ 2OPTA 2EZKA 2NVQJ 3S1QJ 1U9NA 1TWGJ 3MKLA 4B4CA 4A3FJ 1AU7A 2UXPA 3LWJA 3E7QA 3OSFA 3NAUA 3VVXA 4C3IJ 1JT6A 3TP0A 5FGLA 1Y1VJ 3DEWA 2L7FP 2HOTA 3BR1A 2E19A 2E2IJ 3EUPA 3BR5A 1MH4A 5JLXA 5F0HA 3HEFA 2QTQA 4GCTA 2JJ7A 2P81A 1T56A 3GTPJ 3BQZA 2UXHA 4M3DA 3B81A 4CYCB 4UDSA 1D5YA 3GTMJ 3LHQA 1JKOC 3G1OA 3VW0A 3HTJA 4MLOA 3FIWA 5M3FJ 1IV6A 3JRDA 3V6GA 3AQTA 5D1RA 3VVZA 5F04A 4FE7A 2I10A 3ZOBA 4JYKA 4UUSA 3HTIA 3VW1A 1MBHA 3JREA 1JGGA 3ZQHA 1I50J 2OERA 3MVPA 4HNVA 4XICA 3LSJA 1XG1A 3CMYA 4IHWA 4MFDA 2DA4A 5IP7J 1NK3P 2DTZA 1WH7A 5FJ8J 2IBDA 3IH2A 1LFUP 1UI6A 3PM1A 3ON2A 3RD3A 5J3LA 3SDGA 2IU5A 3S2HJ 4XK4A 3ZQLA 3RZDJ 1HDDC 4BY7J 2YUSA 1BA5A 4Y52J 1ORKA 4C3JJ 2M9HA 4Y7NJ 1F36A 2JA5J 2HQ5A 5EGOA 4BBSJ 2VKVA 1ZGWA 3HGGA 3JR9A 2CUFA 2IAIA 2K9NA 3AQSA 1GUUA 3WHCA 2ME6A 5HAWA 2D5VA 1BW5A 2QKOA 3NNRA 1E3OC 1K83J 2O9LA 1IRZA 4GFLA 5C4YA 4D5CA 3BTJA 3S16J 3BT9A 3L1PA 2HI3A 1BW6A 3T6NA 1Z0XA 1ETYA 1RR7A 2GBYA 4A3JJ 3G1MA 3G1LA 1HLVA 4NELA 2DMUA 2JA7J 4JX4A 3KNWA 4BKXA 1WGXA 2GFNA 1NK2P 5C4JJ 3VW2A 5IP9J 4A3MJ 2JN6A 1EF4A 4D5FA 4GFKA 2K40A 4HKUA 2Q24A 5CXGA 3VOXA 2ZB9A 2FD5A 1H89C 1HOMA 4DYRA 4A3DJ 4AF5A 4UUTA 4LOCA 1CQTA 2XPVA 4AYBN 2ECBA 2DA1A 1A6IA 4A3CJ 1GVDA 1MBFA 2NS7A 2CQXA 2NOGA 4D7MA 5FKOA 4EEFG 1WH5A 2R92J 1MBKA 1LE8A 2JA6J 1XS9A 3HKZN 1QVUA 4UUSB 2CRGA 3S15J 2XB0X 2LR8A 4MO7A 2RHAA 3S5RA 1ETOA 2MG4A 2Y9YA 2XRLA 4X1EA 2NX4A 1OCPA 3BHQA 2QOPA 5C44J 9ANTA 1VFCA 1WI3A 2DMNA 4QIWN 1MSEC 1POGA 5E3NA 1IDZA 3BR2A 3DCFA 1RPWA 2Y2ZA 1ITYA 3GTQJ 4C2MJ 2G7LA 4B1RA 3LSRA 1FIPA 4XRMA 4MK6A 3M4OJ 1QPIA 5K7HA 2Y31A 2DA7A 1ZQ3P 3B6AA 2L0KA 5F27A 2EZIA 2XSDC 3HM5A 5EGOB 3SFIA 1IDYA 4M3EA 2YVHA 2DA5A 3CWRA 2MSYA 1T33A 2QCOA 2PZ9A 3GTGJ 2X48A 3IH3A 3LNQA 3LSPA 3VP5A 1GV5A 2L7MP 2NP5A 2D6YA 1U9OA 3HIMA 4JX5A 4AC6A 1F43A 1ZTRA 4XRSA 1P7JA 2ID6A 4A3EJ 3BJBA 2FJ1A 1ETVA 4YZEA 4FCYA 1WCMJ 2W48A 4A3LJ 3GTLJ 3LJLA 1TC3C 5DAJA 4ICHA 4IHVA 3BQYA 2M2EA 3A01A 2IEKA 2TCTA 1BJZA 5BNGA 3CJDA 2VPRA 1JUSA 2Y9ZA 4QTRA 3DPJA 3GTOJ 4C3HJ 4KWAA 1I3QJ 1K61A 3O8HA 3BTIA 1FIAA 3BTCA 5GP9A 3VPRA 4XRSG 1LE8B 4MIMA 1IJWC 2FX0A 5HODA 1TWFJ 2OF7A 5J1UA 3P9TA 4BXXJ 4DZPA 1ETQA 2XPWA 5E3MA 2HXIA 2ME0A 2NS8A 3JRHA 3KKDA 5FKKA 5FLVA 3VOKA 2UXUA 1IUFA 2ZOYA 2WGBA 5C3EJ 1JJ8C 2E2HJ 1VNDA 4IHYA 2HOSA 2G3BA 2UXIA 4M6VA 2KDZA 1APLC 4NDLA 2KT0A 3COLA 3VVYA 4DYCA 2L9RA 1B72A 1FTZA 1RKTA 5EEAA 1JUPA 3Q0UA 2R5YA 1SFOJ 3ZQCA 5K7ZA 2HDDA 2E1OA 3SJMA 2MGQA 2VUMJ 3BRUA 2AO9A 3BR3A 3OSGA 4ABZA 1ETXA 1GT0C 2EZHA 3FISA 5FKNA 5JLWA 1QVTA 1IC8A 1OCTC 5EFYA 2ELKA 1QRYA 3NXCA 1ZKGA 4FE4A 4I6ZA 3BTLA 5GPAA 2XGDA 1U78A 1JUMA 5FMPA 3CQZJ 1UG2A 3QPLA 5J1YA 4S0HB 3Q0WA 5FHPA 3A01B 5FLMJ 5M5WJ 1I6HJ 2W53A 3HTHA 2DA3A 5D18A 1RESA 3KKCA 5EG0A 1IGNA 1JKQC 4J19A 1ZR2A 2LVSA 3GTKJ 2VI6A 3TW7A 4A3BJ 2OI8A 3JRIA 3HOUJ 2EBIA 3TP3A 3HE0A 2JMWA 5H9TA 2YU9J 1JTXA 3S14J 1DU0A 3VIBA 2ZOZA 4D7NA 3HOZJ 1JKRC 1HCRA 1MBEA 4JP0A 2WAQN 2NP3A 3JSJA 3F1BA 3O60A 1Z77A 1ENHA 1FEXA 4B3AA 3VUQA 2B63J 2E2JJ 3UKGA 1RETA 3CRJA 4G12A 1VF9A 2O7OA 2WB1N 1VI0A 1JT0A 2Y0SN 3C2BA 3HDDA 4L5EA 1B72B 3MNLA 2R5YB 1WPKA 3K2AA 3A03A 1AKHA 2QF7A 3OIOA 1R9TJ 5DTDA 1MSFC 2R7ZJ 2ZCXA 2JA8J 5FKLA 3RZOJ 2QWTA 4PXIA 2AHQA 5F0CA 2K9SA 3JRCA 1MH3A 4W1UA 2XGEA 3QPSA 2V57A 3E7LA 1W0UA 3HOXJ 1JKPC 4ACIA 4QSHA 5GPCA 5F08A 1O4XA 5D19A 2WUIA 1UMQA 1YRNA 5F0FA 1UI5A 4M3GA
chains in the Genus database with same CATH superfamily
4XN3A 2JVHA 5FKMA 1TP4A 5JI6A 3GUDA 3BG9A 3PL8A 2F07A 5D5VB 1Y0UA 4R8HA 2FOKA 4ON0A 4E7HA 3TW6A 1YLFA 5LRRA 3KCCA 3V7RA 2NVXJ 1OYYA 1VQ9I 2VE9A 3MD2A 2UXNA 4ENJA 1J9IA 1MNMC 1NG6A 2NVYJ 2HEOA 1CF7A 5EJCA 2XPUA 2DYRH 3S3OA 3J7ZI 2HKOA 1MDMA 3W3CA 2JA2A 1LDKB 3CP8A 3F8NA 3BG5A 2UXOA 2FXAA 1Z7UA 4FHTA 2VQGA 5K5OA 3JAMK 1IN8A 3PQJA 1DPRA 3Q5FA 2E36A 4HAMA 3DPUA 2JK3A 1IO2A 1D1CA 2L4MA 1Z1DA 2OA4A 2M0CA 4MNUA 3ZMZA 4I76A 3BNIA 2GUHA 4A12A 2RKHA 3NARA 2H1KA 2GZWA 3W6VA 1SFXA 1MGTA 2BEOA 5FFZA 2ID3A 1UHWA 2GENA 1U8RA 3RQIA 2HZTA 2G0EA 1F9NA 3HOSA 2K3FA 5DM6F 2ESNA 4KYWA 2VODA 4OIPF 3E5XA 3IV5A 5IT3A 5A2QK 4JX6A 1LJ9A 3OL4A 4UHTA 4E7LA 4DYQA 1YRNB 1UZCA 5K5QA 5M5YJ 3S1MJ 2RNJA 3QP5A 3K70D 4JL3A 1JJ6C 1X3WB 1D1BA 3ANPA 1OISA 2TRTA 3ZQGA 2VXDA 3ON4A 4Z2YA 3O2PE 1B8IA 1ZELA 5H6RA 1CF7B 1NTCA 1OCCH 1LNWA 2BV6A 5IY5H 4NN1A 1MDMB 3W6KB 4KIFA 2X1EA 2CJJA 5CW8A 4XKVA 2DA6A 3HOYJ 4CH7A 2A3SA 2M1BA 5EEGA 3D1NI 4F55A 1HKQA 4E7SA 2B1EA 3ML6A 3PIOF 3BR0A 3DLLF 2YS9A 3VYSB 5H6QA 5FD6A 4H4KC 2DBBA 2IA0A 3WHBA 3KETA 3OOUA 1YOVB 3RKQA 1FX7A 5DUIA 3S1RJ 4RAFA 4Y13A 4FQGA 1P4XA 3FK7A 2OZ6A 3OYNA 1UB9A 1WRJA 4JKZA 1H8AC 1D0XA 2HDWA 4UUVA 3VODA 1FOYA 4KMUX 1WFXA 3X2QH 1FSHA 2WY7Q 1VQNI 3EUHC 2REKA 5HS7A 3EUHA 4O6JA 2RASA 3HL2A 4EJOA 1VQ5I 2EZLA 2RAEA 3BJAA 1WJFA 4M3BA 4L0ZB 2M8EA 1OJLA 4QLCU 4XORA 5HVQC 3GFMA 4II3A 3V8JA 2LC2A 4CO8A 3RCOA 3L2WA 4CICA 3HJEA 2CQKA 3M8EA 3QP6A 3CDHA 3OS2A 4A3KJ 1EH7A 3JRFA 1B8IB 1LFPA 4RA2A 3RYRA 3QU3A 3LFKA 4FTHA 3A0HC 1GDTA 1ODDA 5FO5A 3J81Z 2G7SA 3G3ZA 3TO9A 2V1NA 4XLFA 1XGSA 3GFIA 3BCGA 1R1TA 1NHAA 1P92A 1SD5A 1UHSA 2LK2A 4XKWA 4BXFA 2EQRA 3FK6A 3HOTA 2DDAA 2H09A 2DFEA 5M3MJ 2BBYA 3O8GA 2PMZN 4LLNA 4XIDA 1YIJI 1Q1HA 5ICGA 2FA5A 5K7FA 2NNYA 3OYAA 2LLKA 3ZR8X 4P9UA 3U9GA 1V54H 1KU9A 2Y0MA 1Z6TA 4G94A 1EKEA 2KIMA 2VJIA 1TWCJ 3WTTC 2OTLI 2PFVA 1U9NA 3MKLA 2UXPA 1AU7A 3KP2A 4HW0A 3DPTA 1K78A 4BHCA 3RYPA 3OSFA 2RVCA 4EGYA 4L9NA 5FGLA 4C2MA 4RGXA 3VWBA 3CF5F 3MQ0A 1D8JA 3OR2C 1KQ9A 3K1NA 2HOTA 3BR1A 5DM7F 3KEQA 5F64A 4EJWA 2EFQA 2CQNA 4LIVA 3MKWB 2JJ7A 4GCTA 3CMMA 1XTAA 2UXHA 4BAYA 1UELB 3V4GA 1JKOC 2BXZA 2Q1ZB 1Z05A 2O03A 1R00A 4AU7A 3VW0A 1XGNA 4TV7A 1G3SA 2A05A 4KJZA 3K1MA 3L2RA 2K3PA 2IS1A 4FE7A 1SD7A 3ZRGA 2R7VA 5ILVA 4JYKA 4M73A 2QQAA 2BHYA 1WWXA 4HNVA 4KT6A 5JFRA 2DA4A 2BVLA 4U9NA 1OMIA 1WJAA 3IH2A 3JTHA 3OOPA 3D5RC 3J81K 3PM1A 3ON2A 4DBQA 3K4BA 3RD3A 4C2UA 3E6CC 2PMHA 2IU5A 1VQ4I 3ZQLA 4BY7J 2YUSA 4Y52J 1ORKA 2EB7A 3E6BA 4C3JJ 1GXQA 1XMAA 2BY2A 2HYFA 5EGOA 4OWRB 2VKVA 3AG3H 3DFGA 4N9IA 3AKZA 2K9NA 2JSCA 3WHCA 1X19A 2IVMA 3NNRA 1E3OC 2E34A 4Y17A 4AIKA 1LVKA 1K78B 3S16J 3GFJA 4QPOA 1RC9A 3L1PA 1BW6A 3GW2A 4CDGA 2ZXIA 3G1LA 1HLVA 2CW8A 4PJNA 3MZ8A 2STTA 4HPQA 3RIRA 1FMVA 2DO7A 4IF4A 4BKXA 1G59A 5LBQA 5C4JJ 3E5UA 5IP9J 1EF4A 4D5FA 5CXGA 2HWVA 3MZHA 4AF5A 4LOCA 1CQTA 1YQAA 1TBXA 1V4RA 3FXJA 4A6DA 5TISC 4CHUA 4HRIA 3SZGA 1GVDA 2DXIA 4IHTA 3OYJA 2O5RA 4Q4ZF 1G6NA 4D7MA 2ZNYA 2JQ7A 2VT3A 1FP1D 1WH5A 2FBHA 1SEUA 2R92J 4LFUA 3HKZN 4CZZA 1QVUA 2BZTA 3LQRA 3ISPA 2LKPA 1DPUA 2LR8A 2X6YA 3S5RA 3R0AA 4IVNA 2ZFWA 1YJ9I 1FMWA 2M4GA 4X1EA 3S32A 2QOPA 3ZCOA 1WI3A 2DMNA 3ZN1A 1W5CC 5LHHA 3KIOA 5E3NA 3QYEA 2MBFA 4CCMA 4IQJA 5H20A 3BCAA 5CVIA 4YELA 1DP3A 2G7LA 2ZKZA 2E1CA 2EILH 3HSRA 4XRMA 2HVRA 2OQGA 4MK6A 5K7HA 2DA7A 3W2WA 2P5KA 5F27A 3KLNA 3HM5A 5EGOB 1IDYA 5J8FA 3ZPLA 1ZRCA 1JI8A 1T33A 2QCOA 2ZCWA 2Z16A 4MEYF 4HSRA 1SD6A 2PJRA 1OYIA 3S2WA 3NWTA 4A5NA 2D6YA 2DPUA 3HIMA 1S7OA 1MKMA 1E0EA 4Y33A 2IT0A 5ED4A 3LAJA 2FJ1A 3M8JA 2CV0A 1D1AA 1SMYF 4FCYA 5HS8A 2BGCA 2Y69H 4ZH4F 4ZYAA 3R0JA 4J00A 2WTEA 1BI1A 3A01A 2EA4A 3HTUA 2CW0F 1Z3YA 5BNGA 5D6EA 1RNLA 2Y9ZA 4QTRA 1HW5A 1YITI 4C3HJ 4KWAA 1G3TA 3BTIA 1X4OA 1FIAA 2JVGA 5GP9A 1I27A 3VPRA 2K9LA 4XRSG 2K5CA 4EJUA 2FX0A 2ZXJA 4RM3A 2OF7A 2E7WA 3CO7C 3P9TA 1ZH5A 4DZPA 4BXXJ 5HLIA 5F1RA 2ME0A 2DK5A 2E60A 3G4SI 3M7GA 3KKDA 3OWTA 3H5AA 2DK8A 5C3EJ 4NB5A 1D0YA 1VNDA 5K5RA 4BH9A 3CCUI 2UXIA 2PQ8A 2KDZA 1APLC 2F5DA 3CCLI 1HC8A 2QZ8A 3T5XA 1RUOA 4B09A 2L9RA 3VB2A 3CCJI 3B73A 1RKTA 4Z6YA 2QSFX 4G9YA 3Q0UA 2HDDA 5AQCA 3CMAI 2PJRB 2JRTA 2AO9A 4PJ0C 4ABZA 1ETXA 4F7ZA 4MEXF 2EZHA 3FISA 1S7AA 5JLWA 5EFYA 2ELKA 2K27A 1QZEA 4XRFA 4IPAA 1TLHB 1QZYA 3F9KA 5GPAA 4XBFA 1WJDA 1BI2A 2YU3A 4HX8A 4KISA 2V6CA 4UVBA 1YIOA 4S0HB 2GIVA 3K4CA 5DEQA 1W5SA 4PUSA 3A01B 2LNBA 2O3FA 5D18A 3SXYA 1ZR2A 2VI6A 3TW7A 2OI8A 4BNCA 4RB2C 3FHZA 2M45A 3VDXA 1JTXA 2GWRA 3VIBA 1REPC 3AG4H 1LEAA 1V3FA 3OYFA 3C2GA 4E7KA 4UB8C 3HOZJ 1A6QA 1N75A 4C9YA 2QEXI 3F1BA 2OCCH 2ICWG 2VQCA 1HKSA 3LSHA 2QVOA 1ENHA 2W00A 4U7DA 3CRJA 2QSGX 5LEKA 4F93B 1PYVA 4CCNA 2GAUA 2W57A 1WVRA 2Y0SN 4I98B 1GLNA 2E71A 1MSFC 5LRSA 2QF7A 1R9TJ 2R7RA 2QWTA 3SDBA 4E7ZA 1MMSA 1JE8A 2H27A 1YJNI 1YHQI 4XN0A 3N97A 1IN7A 1RRJA 1BOBA 3JRCA 2LF7A 2XGEA 3HHGA 3EYIA 4ACIA 1TNSA 4N4NB 2XAHA 2F4IA 5GPCA 5F08A 4WWCA 3WTUC 1O4XA 1P4WA 1UJ8A 1P2FA 4HEA2 4KDPA 3F72A 4MGRA 4OD4A 3KZYA 2IP2A 1HXDA 1FOKA 2OUMA 1Q1VA 5GAEJ 5DCFA 3ZQFA 3IH4A 5K58A 3PJRA 4YEJA 5FROA 2ECCA 3BPVA 1OLTA 2YX4A 5IOYA 4CZCA 1VZ0A 2V6EA 2DT5A 1Y1WJ 2NYXA 2JSPA 5IPAA 1Z7LA 3ASOH 2BY3A 1S3JA 3FZVA 1XPXA 3TKYA 2MW8A 1S7EA 1G4DA 2PFBA 2VIXA 3MWMA 4M9XA 2HS5A 1JGSA 3HB9A 2Q2EA 2IPQX 3H9JA 3MMYB 5DS9A 2R0QC 3O3KA 3ZQIA 3FMSA 2EIMH 4PJLA 1HA8A 3SWHA 2HZDA 3EUAA 1LKXA 2HOAA 2L01A 4L62A 3DQVC 3E97A 1AHDP 3EGQA 1LVAA 3KZZA 2XVCA 2VBZA 1BL0A 1XDUA 2DMTA 1ZK8A 1BM9A 3DV8A 4MXMA 1ZYRF 2X6WA 4WXHA 2HGCA 1FNNA 1X2MA 2X6OA 1ZRFA 1LEBA 5D8KB 3AAFA 4OMZA 2HVQA 3FBNB 3BP8A 4G6QA 5AIQA 3HG9A 1ZGJA 2R7WA 4ZZDA 1ACIA 4MQ9F 5E3LA 3C7JA 2F4OB 4FETA 2KIQA 1X1PA 2Q0OA 1T6SA 3I64A 3PIPF 3CCMI 2Q8KA 4S05A 2KLOA 2MABA 4O5VA 4GCKA 2LFBA 4EJVA 2R5ZA 2Y30A 4F52A 5E3OA 1Y6IA 3LA3A 5B3SH 5CVRA 4LG0A 1OQYA 3BC8A 1PUFA 3H3VK 2KHMA 5LGUA 1HSTA 2OCEA 4A69C 1O3QA 5JVGF 3LSKA 1D5VA 2VASA 5J4YA 3H0DA 2HYTA 1OFCX 2Q2EB 3ECOA 3VEPA 1IUYA 3KP3A 4E70A 1B9NA 1MBJA 1R23A 3BG3A 2IGMA 1R1UA 3HRMA 1MMGA 1FOXA 4HDUA 4FASD 1H88C 2VN2A 4GO1A 1FT9A 1KYZA 3NRGA 3D5SC 3TMOA 1J09A 3CJQB 3F8BA 2FBQA 3R4KA 3OYDA 4I09A 3L2UA 1XC5A 2EIKH 3LSTA 2E35A 2HYJA 3C07A 2NXNB 3ZXSA 2XDVA 5HOOA 2EA2A 3D5LA 4C30A 2VONA 2WAQA 1L0OC 3VOEA 5E8IA 2E1MC 3V8KA 3F22A 2DI3A 1A36A 4KMFA 1W0TA 4IHXA 3PNVA 3GX4X 3PPBA 2V26A 1SFUA 1JHHA 2CS3A 1ETKA 4IOAF 5CXIA 2O8XA 3S93A 2YVXA 5IYBJ 3K4JA 3KEYA 5J8CA 5J1RA 3QODA 1BR1A 2ADUA 2COBA 2R5ZB 1FOWA 2ZY9A 2BHZA 5TGTA 1T2KA 4LG0B 3PO3J 1PUFB 1TQPA 3HTAA 2IA2A 1U5TC 1T98A 3HYIA 3LOCA 5EYRA 2HXOA 4UVAA 4ZJZA 3CCQI 1U5TA 3F3XA 1DU6A 1FYKA 1KYWA 3L9FA 4Q48A 2Z1DA 2XV4S 4OIQF 4IEJA 2QKMB 1A31A 1D3YA 1NG7A 2F5EA 3G7RA 3QU6A 3KE2A 4EGZA 3ROUA 1Z67A 1R58A 3ZQQA 3E1SA 1XMKA 3OIPA 2DW4A 2DMPA 2FF4A 5EDNA 3ABUA 1P7IA 2LD5A 3ERMA 3JRBA 2KIUA 3FXUA 3D0SA 2VLAA 3N4MA 4GXOA 2OPTA 2EZKA 2NVQJ 2F5CA 4A3FJ 3DEUA 4PSWA 1BC7C 3WGHA 5F6FA 2LG4A 3NAUA 4C3IJ 4NC6A 2QQ9A 4DBRA 1OYWA 2ELHA 2LF8A 2ZBKA 2E1MB 2E5ZA 2F6CA 4KITB 1WSUA 1FWZA 3EUPA 2A68F 4ZTFA 1MH4A 5JLXA 3F8CA 2EFPA 1J7KA 1O7LA 1R1VA 3BZ6A 3QYFA 3GTPJ 5GTIC 1R4MB 4DQ2A 2VOOA 4UDSA 1D5YA 4Q5SF 3LL7A 3G1OA 3TL4X 4L9JA 3VYUB 2V79A 2BVMA 3AQTA 5D1RA 3WE3A 4I0BA 2I10A 1QNTA 2M7AA 3UNGC 4YFXF 3VW1A 1MBHA 4RLQA 5BS6A 2DODA 1P9QC 3L00A 2QGUA 3HSEA 1U5TB 2KRCA 1V5GA 1XG1A 2XGXA 1O57A 2PLYA 3FX3A 3KLOA 3EYYA 1TW2A 3F8FA 5J3LA 3WTXC 1Y0NA 4RGUA 3S2HJ 1M1EB 1MZBA 1HDDC 3RZDJ 3KZIC 2WC2A 3Q9SA 4M72A 3WGGA 4F3QA 4YG2F 2HQ5A 3TBIA 3WU1B 4NHJA 1HSJA 2ZC2A 1MJ9A 3ZMSA 2R4GA 4ENMA 2GXBA 2IAIA 4HG2A 1JHFA 2HQRA 3GXOA 2VC0A 5AONA 4OINF 2ME6A 2QM3A 4P9FA 1BW5A 4GFLA 1USSA 1K83J 1ZLJA 3I4PA 3E6DA 2UWMA 2HI3A 4AVPA 1C0WA 1ETYA 4A3JJ 2A6EF 4BXUA 3G1MA 2DMUA 4JX4A 2GFNA 1WGXA 3NRVA 2FUG2 2HPIA 2YX7A 3CTAA 2XAQA 1FBUA 2QQBA 2JN6A 3CUOA 4GFKA 3IWZA 3VOXA 1BR2A 2K85A 1H89C 1HOMA 1XCVA 1R71A 2PG4A 1Z6RA 2XPVA 3WTYC 2JPBA 4AYBN 4PZJA 1A6IA 1XD7A 4XLAA 4A3CJ 1IF1A 2LY1A 2CQXA 3DKWA 4EMSA 4EEFG 1LE8A 4BJTA 5BPIA 2JA6J 2HFHA 2V4JC 3MEXA 4ZDOA 1N78A 3S15J 3AFHA 3F8MA 4AD9A 4A5MA 4MO7A 4UB6C 3H35A 3DBLB 1U2WA 4Y15A 2P5VA 4I01A 1VFCA 1DQUA 4ZDPA 2QUFA 4QIWN 1IDZA 3FM5A 2AQFA 2E1NA 1ITYA 4M74A 4RS8A 3ZP5A 1HKTA 4F92B 4PSXA 1QPIA 1YYVA 2PMUA 2Y31A 5CYVA 3COAC 1ZQ3P 3B6AA 2L0KA 2J5PA 4LJZF 2XSDC 1AA7A 3RPUA 1I3AA 3OYEA 1IXCA 1ERDA 2L3DA 1EJ9A 3SZTA 2YVHA 3FXMA 2DA5A 2UV1A 3CWRA 2PZ9A 3LWFA 4XKCA 2Y75A 2R7SA 1GV5A 4LD5A 1OCZH 2KP6A 3MFKA 1F43A 1ZTRA 4XRSA 1P7JA 2PN6A 2CSOA 3T1BA 1ETVA 4YZEA 2LDUA 1W7PA 4LLGF 4A3LJ 5HNFA 1FBQA 3G6EI 2ISZA 5HLGA 3V7CA 3U2RA 4DGWB 2HTSA 5ICFA 2LYCA 3H5NA 1IZ1A 3IWFA 2K86A 3GVAA 3CP2A 1JUSA 2QWWA 2KIFA 2WADA 1WI9A 1I3QJ 2HU9A 3ESWB 3O8HA 1LE8B 4RB3C 4RAZA 4ETSA 3R60A 1UG0A 3TOAA 4ZYGA 2CQ7A 1LQ1A 4A2UA 1TWFJ 2VXZA 5HLHA 2F5FA 4ZYDA 2K4JA 1ETQA 4A0YA 5FKKA 1SAUA 1DP7P 1IUFA 2ZOYA 2NAZA 5HDNA 1IN6A 1XSXA 3BZKA 2QYOA 1JJ8C 1FYLA 2IA1A 2HOSA 4N4OB 2DOEA 2VKDA 2MD0A 3CF2A 4M6VA 3I5UA 4BJ6C 4CUGA 3ABLH 3PUFA 4D1QA 1WJ5A 2ZJ2A 3V42A 2A07F 3COLA 1OCOH 1T39A 3HZJA 1B72A 1FTZA 2R5YA 4H0EA 5K7ZA 2E1OA 3SJMA 2MGQA 1FC3A 2BYVE 2XAGA 2UUZA 4AM3A 2K9MA 3CCVI 3RKYA 1K6YA 2KZVA 1GT0C 1QBJA 1GVJA 5IT9Z 3NXCA 3PNTA 4I6ZA 1TQIA 4BEHA 1W7PB 2NVUB 2B0LA 5FMPA 3CQZJ 1ZRDA 2ZO4A 5E17F 2BY1A 5GAHJ 5FHPA 5KAFC 4MQVA 3JSOA 4WF2A 3HTHA 2IW5A 3I59A 3P5JA 3PNYA 5EG0A 4HX7A 2LH9A 1LDDA 2LVSA 3NWSA 3HE0A 3TP3A 2B7EA 2YU9J 1DU0A 2FQ3A 3G2BA 3JCUC 2ZOZA 3NS4A 2VPLA 4D7NA 4RM2A 2MH2A 2YSRA 2KPMA 2OBPA 3OYIA 1W36C 3O6BB 2KMUA 3T8TA 2GOMA 3O60A 5CPRB 4GYIA 3VUQA 5L3CA 2AQEA 2W25A 2WB1N 3CC2I 3EDPA 3FXLA 4II2A 5AIPA 5L3FA 3OS0A 3M8FA 3HDDA 1BOAA 2OJED 1B72B 2R5YB 1AKHA 3A03A 2YPRA 3T0YA 3OIOA 1K79A 3RZOJ 4I2OA 2AHQA 5K1YA 3B02A 4HA8A 1FYMA 1F1ZA 3R6SA 4BEHB 2P7VB 3OYBA 3HKZA 1F5TA 3HHHA 5FLXZ 3E7LA 2VJ5A 2XKOA 2H6BA 1W0UA 3HOXJ 5IT9K 1KU7A 5DD8A 3A0BC 4CCOA 3FMQA 2UXXA 2K4BA 2KZGA 1XGMA 2VBXA 1MMAA 2PJPA 2R7XA 3I59B 3K4KA 4NC8A 5EG0B 2ZFUA 2K9QA 3QKXA 2XGCA 4P55A 2CUJA 5BOXA 1K4SA 4UY8I 1EA3A 1ZG1A 1GV2A 1MJBA 4EM2A 2Y48A 4R79A 5LFAA 2W82A 1G8XA 1P4AA 4E6KG 3NI7A 1XB4A 2W7NA 2LMDA 2WA0A 2XAUA 2LY9A 4BJ5C 3PASA 1JXSA 2DFHA 5IYDJ 1PJRA 3W2AA 1QQIA 4BUPA 2JPCA 4GRIA 3WG7H 1H0MA 3I4MJ 1PP7U 4YRVA 2VKHA 4M6XA 4CXFA 1IAWA 2L2OA 3DTKA 2KKOA 4X6AJ 1VQLI 4NNJA 4I0AA 3A4CA 1OR7C 3CCYA 1OR7A 3LSGA 3DBRB 3A02A 3K8PC 1IRXA 1USTA 1YW7A 2DFIA 2EV0A 4HZFA 3RTRA 4U87A 1I39A 4ENKA 1AKHB 3QQAA 1T0FC 4P96A 4DZJA 3CESA 1T0FA 4LK0F 1QPMA 1VQ8I 3QPTA 4HQEA 5BPDA 4GGGA 2CFOA 4HNTA 2ZCNA 1VQ7I 5ICEA 3H0GJ 2RQQA 2XAFA 3DBHB 2CW7A 4XM3A 5ILUA 2HDCA 3OS1A 4IQ4A 1A5JA 3PUBA 2YVEA 1X58A 3DF8A 2GM4A 5FLXK 2BOLA 1J2XA 4U88A 1DUXC 4IX7A 3QYBA 4WX9A 2L7ZA 4RBOA 3HXLA 2NVTJ 5H2FC 5EF6A 1YTYA 2CUEA 5D6FA 2MC3A 2L9SA 3MZYA 1CGPA 3GBGA 3TEDA 4L9VA 1I1SA 2X1DA 4PFOA 3H3UA 2FNAA 2STWA 4OAZA 3JRGA 1IG7A 2XDNA 2KDOA 3I71A 3SEZA 1YS7A 3K10A 2MYSA 3K7AJ 2UZKA 1XN7A 2DMQA 2TDXA 2QSHX 4A93J 1TNTA 3HIFA 4WXDA 2MH9A 4E4HA 5IOZA 3CJRB 3SQNA 3HBLA 3EPZA 4M3FA 1ZG5A 2HPMA 1D0ZA 3ANGA 1PDNC 5HBUA 2P6TA 1ON2A 2ZJPF 1TQMA 3CCEI 4NUBA 1MD0A 3IUVA 3FKIJ 3KFWX 2O0YA 3IP4B 2CG4A 5EZGA 4XQFA 2K7LA 4A3IJ 3CC4I 2H8RA 4B48A 2O8KA 2LRDA 2PI0A 2OD5A 4B44A 2NOJB 3JW4A 2QIBA 4ZTJA 2KISA 2CMPA 5KHDA 3CJTB 4KUMA 2DG8A 2VKEA 2EK5A 2DN0A 4HV6A 5ICCA 1SANA 2L7KA 2WAFA 3Q3SA 2LKXA 2A61A 2P0WA 1HQCA 4HNUA 3K4MA 2V9VA 4CYCA 3QBMA 5DCMA 5CVVA 2A69F 3HC7A 2KRFA 3LA7A 1LPQA 1FZPB 3KZ9A 3GTJJ 3K69A 4B47A 3H1CA 1DDNA 1Z91A 3F6VA 4P5OA 2QLZA 5GADJ 2ZSHB 2JTVA 1U0JA 4RGSA 3HOVJ 2XB5A 2CH0A 1X1BA 5E20A 4GDFA 1UFMA 2X9DA 4AC0A 4AUXA 3VYTB 1SFKA 2CU7A 4BHPA 1LFBA 1HDPA 3Q0VA 2EFOA 3WTSC 1W4MA 2FQ4A 1QHHD 2CUZA 3BLYA 1YG2A 3GWZA 3F23A 3DKXA 1B6AA 3OL3A 4I99C 3GCMA 4ESBA 5JHUA 1A35A 2HR3A 3GZIA 4DW6A 2L9VA 4L9TA 4QWQA 1S72I 4GCVA 4NQWA 1HF0A 4I02A 4L5JA 5TRDA 2OTJI 4O3MA 1U8BA 4FT8A 3F0CA 2E7XA 2M5WA 4GYGA 2O7TA 1V5EA 4OMYA 3S1QJ 1HW1A 1TWGJ 1UHMA 4B4CA 4A0ZA 5L3EA 3LWJA 3GYHX 3C2HA 2LKSA 3E7QA 3HTSB 1V55H 3I9V2 2D45A 3DKYA 3N05A 3H9QA 5LGTA 1JT6A 2L4AA 1EV7A 1MJAA 3J80Z 2X0LA 1BIAA 2R7TA 2L7FP 2FRHA 2HYGD 4LGWA 3H5RA 3BR5A 3DXJF 3HEFA 3KP4A 5KCMA 5F0HA 3BQZA 3M9AA 4M3DA 3B81A 4CYCB 3HSFA 5DCMB 3GTMJ 2F4MB 5B1AH 3WU2C 3IUOA 3CJNA 3MCZA 2XRNA 2VQLA 4DOZA 3HTJA 4CSWA 3FIWA 3EQLF 3K70C 5M3FJ 1IV6A 3V6GA 1GHCA 1STZA 3HRUA 1FPQA 1KZHA 3JREA 2RGVA 1JGGA 1I50J 2LOOA 2X51A 1MMDA 3MVPA 4HLYA 4XICA 3LSJA 2RN7A 3CMYA 1EH8A 3W2VA 5IP7J 1PVEA 1NK3P 2IBDA 4AWXB 1LFUP 1R49A 4KNYA 4BQOA 3K4NA 3I56I 1GXPA 4XK4A 1XDSA 3M07A 3WTZA 1BA5A 3K0LA 2FMYA 3SFZA 2JA5J 4NQWB 3LAPA 4E7IA 1X1AA 1YW8A 4JBAA 4B43A 1T8IA 4BBSJ 3K4LA 1ZGWA 3HGGA 2COMA 1GUUA 1TT0A 2H8WA 4NC7A 5HAWA 2D5VA 2QKOA 2O9LA 1IRZA 2X85A 3CC7I 3IRQA 1O3RA 2LBFA 2GIZA 3JSPA 3T6NA 1Z0XA 1RR7A 2QA4I 2FOWA 4BQAA 4NELA 2A6HF 3KNWA 3I3LA 4HQMA 3J80K 3OYHA 1A04A 4EQQA 3IL2A 4HKUA 2FEZA 2MFZA 4LMYA 2Q24A 3IKTA 2ZB9A 4DVYP 3J7AY 4DYRA 2AS5F 3I55I 4A3DJ 1KGSA 1PP8F 1R6RA 5E79C 5J40A 5ILSA 4MTDA 2ECBA 2DA1A 3U1KA 1MBFA 3CUQC 2W85A 3OIQA 2NS7A 4KN7X 4BDZA 3CUQA 5FKOA 1SD4A 3BOQA 1G3WA 3BY6A 5BMZA 4HOBA 4BHBA 5FD5A 2CRGA 3GZ5A 2VE8A 2XB0X 2CGPA 1WJCA 1XX5A 1J5YA 4QPQA 1IN5A 4OIRF 1T38A 2Y9YA 3BHQA 1OCPA 2VBYA 1Y39A 5HS9A 9ANTA 3U21A 1SVLA 5B5EC 4ASNA 1MSEC 2DCEA 1POGA 4RB1A 4HX4A 3K6GA 1KU2A 1RPWA 2V1DA 4N0BA 3HPHA 4C2MJ 4AIJA 4Y4RA 4B1RA 2RREA 3LSRA 3GTQJ 1TTYA 1YX3A 3M4OJ 2M30A 4OD5A 1AOYA 1IXRC 2VJJA 4I7HA 4XOPA 2W1OA 4WXCA 4KICA 2G7UA 3CCRI 4MHGA 1X1DA 3OY9A 2X48A 3IH3A 3LNQA 1BC8C 2L7MP 4ZYHA 2LBFB 2NP5A 1IW7F 1U3EM 4WIBA 3K2ZA 4BL0B 5E1XA 2Z2SB 3PFYA 2CWEA 3RDIA 2ID6A 1BBYA 4A3EJ 1SAXA 3ONQA 3DTIA 2W48A 2D1VA 5DYMA 5CQGA 1L3LA 3GTLJ 3SEQA 1TC3C 5DAJA 3R61A 2L54A 1FP2A 5FGMA 3BQYA 1QO0D 4U0YA 2AXLA 1SMTA 2IEKA 4IHVA 4B3XA 1BJZA 2R7UA 1ON1A 3HRSA 2GQQA 1W1WE 4G7OF 2IS2A 3DPJA 3CUQB 1WHUA 3KP6A 4BGDA 3AG1H 4ENNA 4LK1F 3BTCA 4MIMA 2V1UA 1IJWC 5L3GA 1R4NB 3BPXA 4BDYA 1N77A 2VJ4A 3ZGKA 4CA0A 5JR3A 5ERIA 4U9LA 1HBXG 3GLXA 5EEHA 3SHFA 2XPWA 3FBIB 5D4RA 2L02A 2NS8A 3JRHA 1X1CA 5D5XB 3MKZA 1S8NA 4LIUA 4D9JA 3GEZA 2WGBA 2GA2A 2GXAA 4KFCA 4A6EA 2Z99A 4AVZA 4XLCA 2BW3A 2DQLA 1O7FA 3FDYA 1YFHA 1BIBA 2EINH 3SYTA 1S29A 1MW7A 2DLLA 3FF5A 4S04A 4EM1A 3FXQA 1YS6A 3NQOA 5EEAA 1JUPA 1SFOJ 4L18B 3BRUA 2DYSH 2VUMJ 5JHFA 3BR3A 3OSGA 1BR4A 3PQKA 4K2EA 3VFZA 2JUCA 3BG6A 1OCTC 2WY8Q 2Z3YA 2MA3A 5J47A 1B4AA 1ZKGA 4FE4A 5L3BA 1XGOA 2MC4A 4M71A 4YFKF 2XGDA 2G7HA 1U78A 1XCBA 4HF2A 1JUMA 1UG2A 1BN5A 3GLLA 4G8XA 2EWNA 3FHNA 4UVCA 1UAAA 2FU4A 1J0RA 4PFPA 2W53A 2DA3A 3KKCA 2D2WA 2OV7A 1IGNA 1JKQC 2K02A 3GTKJ 4A3BJ 4XNFA 1Y56A 1G3YA 2EBIA 2ACJA 2JMWA 2H1LA 2KJCA 2HQAA 5LGNA 4ESJA 2W24A 3S14J 2CFXA 1Y8RB 2JRMA 3E3VA 4IJAA 3PSIA 1HCRA 4HV5A 1QU3A 5KK1A 2L9NA 2KQRA 2ZXHA 4RGRA 1WJEA 5D8LB 2ETHA 5CLSA 1FEXA 1R5GA 2DQRA 2DT6A 4XONA 2B63J 3UKGA 2I5UA 4L0YB 1RETA 3QPHA 4RB0A 4BQNA 3LQQA 2BW3B 1K7AA 4U7BA 4IL6C 3RPQA 3KP5A 3J7YJ 3MKYB 1R5HA 1JT0A 3HUGA 4ZYEA 3BZCA 3GMEA 3KX2A 3Q9VA 3QOEA 2H94A 5LLQA 5D5UB 5D5WB 3MNLA 2DOAA 3TO6A 1WPKA 1ZAOA 1J75A 2ZCXA 2R7ZJ 4AYBA 5J6XA 2CYYA 1OPCA 1Z21A 5F0CA 4E7JA 2K9SA 2R3SA 3JTGA 4ANJA 1XSDA 1F4KA 1O3SA 2V57A 1YI2I 1WKMA 4NBQA 3WG9A 2DAOA 2FBKA 4YIIA 1I1GA 1S5LC 2HNHA 1J59A 1V5FA 1UI5A 3QRFF 3RKWA 3ELKA 1SVMA 2AXTC 4DJAA 3LSIA 1RZ4A 3B6CA 3G71I 4D0PA 4GFBA 4HYEA 3DPLC 2BXYA 5DDGA 4ZDLA 5KNLA 2VT2A 1T95A 1YJWI 3FRQA 1R5ID 3OR1C 2A6TA 3ULQB 1RKWA 4KT5C 4JNNA 3P9IA 2RNGA 3BDDA 4DNCA 4YFNF 4CCKA 3I4NJ 4PJJA 5HDKA 2ISYA 2HTJA 2PMZA 2EJRA 4IKFA 3TO7A 4W97A 2DJNA 3IKVA 2G7GA 1UCRA 4LITA 3FWEA 5CJ9A 1AWCA 1VQKI 2R7OA 3GEUA 1FBSA 4V2GA 2QENA 5FB2A 3L2VA 1K4TA 2MLKA 4X0GA 4V2FA 2GXGA 3HUGB 1R7JA 2FMLA 2JZYA 2P8TA 3S2DJ 3I58A 1JTYA 2HKXA 4FISA 4XKBA 6PAXA 2DA2A 4JOMA 5CKTA 4G6TB 1VQ6I 2EV5A 5E8GA 5IYCJ 2WWYA 5C4XJ 1HW2A 1WJBA 3ABMH 2OZUA 2XASA 2H6CA 4UV8A 2M34A 4KN4X 3VSKA 5E1WA 4EVIA 3ZMTA 3WODF 4A0XA 2EIJH 1YW9A 5KVRA 1ZGAA 2ZSIB 3EUKL 4BU2A 1SFEA 2RDPA 4RMNA 3ABKH 4IOCF 5M5XJ 2Z33A 2GLOA 3VSLA 4GCLA 2B3WA 4OU0A 3P9KA 3OYMA 2M7BA 4LG3A 3OMYA 2QKLB 1VTNC 2O61A 2FJI1 2Z5UA 2D1HA 3FXOA 1E3HA 2HKUA 1P6RA 1ETWA 3TOBA 2LTPA 1MBGA 3EETA 3WU0A 2X1CA 3PSFA 2M0MA 3PFIA 1TWHJ 4XSZF 1G2HA 3BROA 5EZHA 3S3MA 4XOTA 3WTVC 2PX9A 2RV8A 3CO6C 2PBXA 5TJJA 3S1NJ 5DV5A 2JUGA 1TL8A 2EH3A 1OKRA 3CDLA 4PGGA 3G56A 4IHSA 4BQQA 3BCBA 4BE1A 4BY1J 2DG7A 2XSJC 2V1XA 3ZMUA 1TWAJ 3RH2A 2WV1A 2CV1A 4G6DA 1T08B 3PO2J 2ZCMA 2KFDA 2PEXA 2WBMA 3G73A 1RIOH 1SVOA 1BI0A 4V19K 4A3GJ 3IC7A 5F1JA 4AIHA 4IRVA 2VB6A 4J01A 3QWLA 4XLHA 3V78A 2MLGA 4FX4A 3M3YJ 1BJAA 1TW3A 3OYLA 3JRAA 1KONA 1TZLA 2M8GX 3BJOA 3NPIA 2EPFA 4BE2A 4ITVA 4LB5A 3S17J 2OAZA 3LSMA 1MIJA 2ZMEC 3MN2A 3C3WA 2XF5A 2ZMEA 4RAGA 3ZN0A 5LHGA 2WB1A 4Q47A 4BBRJ 2V7FA 1E2XA 2DOFA 2CQQA 4YIRX 1ZN2A 1B9MA 2RQPA 3BR6A 5GAGJ 3ERED 4YIFA 3HOWJ 4EM0B 3CD6I 4G7HF 1I5ZA 5HSZA 3KPHA 2HQNA 2LP0A 3HGYA 4LLLA 1YO5C 3VTIA 3QAHA 1QA6A 2N8GA 1ZREA 3F6OA 2BY0A 3A2KA 1R22A 3BWGA 2V9PA 4ZC3A 1X2NA 2DT7B 3RPUD 2R93J 1FSEA 1LUJB 2XAJA 1FTTA 2VC1A 4MFEA 4UNOA 2QBYA 4CGRA 1OCRH 4PK4A 5IP6A 3RKXA 4ME9A 1FJLA 1KU3A 3FXRA 4N9HA 3F21A 3L2QA 1SGMA 3H3ZA 2OU2A 3ECHA 4CYDA 3C1DA 2JWTA 4RDUA 3RI4A 2WAEA 1ZR4A 3REOA 3KYLA 1W7PD 1X3ZB 2EFWA 3U1DA 3GF2A 3ZMDA 3VVXA 4OIOF 2XF6A 3SZPA 3TP0A 1S6LA 1Y1VJ 3E6MA 3DEWA 2DPDA 4PCQA 3WGIA 4XLPF 4CCJA 2E19A 2CO5A 4KA4A 2E2IJ 2QTQA 4C2TA 2J5OA 2P81A 4HF0A 1T56A 2F5VA 2ZMEB 4KIGA 3GO5A 3LA2A 3LHQA 4CCLA 1WZ2A 2R7DA 2W4SA 1Z3XA 3IHUA 1K6OA 4MLOA 3JRDA 4MTEA 3VVZA 4IRGA 5F04A 3WE2A 5FRMA 3ZOBA 1VQPI 1Y8QB 3S8PA 3HTIA 2IGOA 2EV6A 4UUSA 1ULYA 3ZQHA 2OERA 1B59A 1XMXA 4IHWA 4MFDA 3VYRB 2KJBA 2DTZA 1WH7A 5FJ8J 2OC6A 5KAIC 2ZJQF 4XSXF 1UI6A 2Z9OA 4L5IA 3SDGA 2P7CB 2ZNZA 2NNNA 1LDJA 3CDIA 2XIGA 1Z9CA 2QBYB 4EJTA 4BYYA 2M9HA 2F2EA 3LFUA 4Y7NJ 3AL0C 1F36A 2DDBA 2ZXWH 3KP7A 1MNDA 2CV2A 1ZARA 1VQMI 3L09A 2XUBA 3JR9A 2CUFA 1MMNA 3AQSA 2PBIA 3DTEA 3L7WA 2X6XA 3IRRA 5C4YA 5CVUA 3CCSI 3A1YA 3BTJA 4D5CA 1U6GA 3BT9A 2A5YB 4RLFA 3AG2H 2XROA 2DU9A 2GBYA 4KIBA 3H9GA 4U0WA 4PDKA 1RI7A 3UR3C 2JA7J 1NK2P 2WV0A 3I53A 3CMEI 2A5WA 5B1BH 2R7FA 3VW2A 4A3MJ 2K40A 5J4VA 3CLQA 3RQ4A 1FY7A 2FD5A 2P4WA 2VQHA 2XKPA 4JK1X 3K9TA 4UUTA 5HDGA 2HOEA 2IS6A 2DJIA 3MAJA 4JQFA 1B1BA 2X4HA 2NOGA 4P1WA 2QQ8A 1DGRM 1QZZA 3V8LA 1MBKA 1XS9A 2IXSA 1W36D 1E17A 3NEUA 4EV0A 1IN4A 4UUSB 3FM3A 3RSNA 2KRHA 1IRGA 2RHAA 3DU5A 4RAYA 3KYDB 1XSVA 2NS0A 1ETOA 2MG4A 3ZMVA 4XLEA 2XRLA 3J7AO 2NX4A 1D8KA 5C44J 2Y0SA 1ZLKA 3TDZC 3BR2A 1NH3A 3DCFA 1N25A 2B9SA 3OYCA 5B66C 2Y2ZA 2GOXB 4UXNA 2FNPA 5E1ZB 3DU6A 1FIPA 1X3UA 3I0TA 3P7NA 4IRIA 1E3PA 2R7QA 3AL0B 3IAS2 4BS9A 3GZ6A 3E5QA 2EZIA 3SFIA 2RC4A 4M3EA 1RUNA 2MSYA 1ZG3A 3H36A 3GTGJ 4EATA 3LSPA 2LY2A 3VP5A 1X4PA 4PGHA 3QOPA 4LB6B 3RJPA 4WCGA 1U9OA 4IXAA 4JX5A 3DLAA 4IZZA 4AC6A 2GA1A 3ABTA 3OYGA 1DGWY 2FSWA 2IRFG 4XR6A 3BJBA 5DUKA 1H9TA 5HNHA 1WCMJ 2VL8A 2V9KA 5HLTA 5LD2C 4U0VA 3LJLA 1O3TA 4F91B 1S9HA 2P6SA 4ICHA 4OOIA 3OYKA 2M2EA 2TCTA 5FFXA 5LEJA 5L3DA 3CJDA 2VPRA 5JVTA 3GTOJ 2IGKA 4BE0A 1K61A 4IRHA 1PUEE 3FXKA 5CQEA 2XHKA 1R36A 4HSTA 5HODA 3IAM2 4Y3OA 5J1UA 1TT5B 1WQ2A 5D4SA 2P5LC 3HPGA 2HXIA 5E3MA 4M9ZA 1MNEA 3TDUC 5FLVA 1VQOI 3VOKA 2UXUA 3DEEA 1LB2A 2E2HJ 4BACA 4IHYA 2G3BA 1IV8A 2BE5F 4HLXA 4UV9A 1YE9A 3S3NA 4NDLA 2KT0A 3VVYA 2VOPA 3M1EA 1BI3A 4DIQA 4DYCA 2NRAC 1RR8C 2ZJRF 4B8XA 3ZQCA 3ASNH 4M9SA 2G9WA 2JT1A 5FKNA 4IO9F 1QVTA 1IC8A 2C6YA 2LSOA 3K1PA 1QGPA 2IS4A 1QRYA 4HBLA 1IXSB 2XF7A 3GFLA 3TGNA 2MD5A 5BQTA 1KA8A 3BTLA 4AIDA 2M4KA 3KYCB 2YR2A 2E5NA 3V7SA 4R1HA 3QPLA 5J1YA 2IJLA 4OAYA 4M6YA 3Q0WA 3C18A 3CLOA 5FLMJ 5M5WJ 4PJMA 3DP7A 1I6HJ 3I54A 1RESA 3BJ6A 4J19A 1W5TA 5H9TA 1H9GA 4WK8F 3JRIA 3HOUJ 2A2FX 2W84A 4HDVA 4ESFA 3TQNA 2VBWA 5DD4A 1JKRC 1MBEA 4JP0A 2WAQN 2NP3A 2FE3A 3JSJA 3HRTA 3ZQ7A 2FBIA 2LREA 2L5QA 1Z77A 5FRNA 4FX0A 4B3AA 4CGZA 2E2JJ 3JAMZ 4XLNF 2IGNA 4G12A 4ZZLA 1VF9A 2I8DA 2O7OA 1VI0A 3M1CA 3BG7A 3GZNB 4XMYA 5CVJA 2KL4A 2O6GE 2ESHA 3LMMA 1IRFA 3C2BA 2EFNA 4L5EA 4XL9A 1EH6A 3CZ6A 2M3AA 3FMRA 3K2AA 3OV8A 5DTDA 3H92A 2JA8J 5FKLA 3KEOA 1FLIA 3WTWC 4PXIA 3T8RA 1QHGA 1YX5A 3DWLE 3L2CA 1SC7A 2OQRA 1MH3A 5GTHC 1KQ0A 3FKJA 1I6XA 4W1UA 2M87A 1KQ8A 2DFFA 5E18F 2DTRA 3QPSA 3E0JB 2HVSA 2XC7A 5A2QZ 2F48A 1JKPC 4QSHA 4G7ZF 5LHIA 1ONVA 5D19A 1ZHFA 2ELJA 3W6JB 2WUIA 1UMQA 1YRNA 5F0FA 4HF1A 4M3GA 3P9CA
chains in the Genus database with same CATH topology
5FKMA 1Q1VA 3B6CA 3ZQFA 5EG0B 3IH4A 4GFBA 5K58A 2K9QA 3QKXA 2XGCA 3BG9A 3FRQA 2F07A 2ECCA 1RKWA 1GV2A 3TW6A 5IOYA 4JNNA 2NVXJ 3NI7A 1Y1WJ 1MNMC 2NVYJ 5IPAA 2LY9A 3I4NJ 3PASA 5IYDJ 2XPUA 3I4MJ 4W97A 2DJNA 2MW8A 2G7GA 1S7EA 3GEUA 3BG5A 2UXOA 4X6AJ 4V2GA 4V2FA 3HB9A 3S2DJ 3CCYA 3LSGA 1JTYA 4FISA 5DS9A 2R0QC 3A02A 2DA2A 3ZQIA 1AKHB 2JK3A 3QQAA 2HOAA 4DZJA 4L62A 2M0CA 5IYCJ 1AHDP 4I76A 5C4XJ 2GUHA 3BNIA 3EGQA 3NARA 2H1KA 3W6VA 2M34A 1BL0A 2DMTA 2ID3A 1ZK8A 2GENA 2ZCNA 3RQIA 3H0GJ 4MXMA 2G0EA 1A5JA 2YVEA 1X2MA 2X6OA 1X58A 2GM4A 5M5XJ 3IV5A 4JX6A 1YRNB 4DYQA 2GLOA 5M5YJ 4GCLA 2L7ZA 4RBOA 3S1MJ 2NVTJ 4JL3A 1JJ6C 5EF6A 2CUEA 5E3LA 3ANPA 2HKUA 3GBGA 3TEDA 1ETWA 2TRTA 3ZQGA 2LTPA 1MBGA 3JRGA 3ON4A 1IG7A 2XDNA 1B8IA 4GCKA 2LFBA 2R5ZA 2Y30A 5E3OA 1NTCA 1TWHJ 1PUFA 3H3VK 4NN1A 1G2HA 5EZHA 3K7AJ 2DMQA 4A69C 2PBXA 3S1NJ 4A93J 3G56A 2CJJA 2EH3A 3CDLA 5CW8A 2HYTA 2DA6A 3HOYJ 1OFCX 3D1NI 4BY1J 2DG7A 5IOZA 1MBJA 1TWAJ 3BG3A 4M3FA 3BR0A 3HBLA 3RH2A 2YS9A 3ANGA 2WV1A 5HBUA 1H88C 3NRGA 3WHBA 3OOUA 3PO2J 2ZCMA 3IUVA 3RKQA 3FKIJ 2FBQA 3S1RJ 5EZGA 1XC5A 4A3IJ 2H8RA 2O8KA 4A3GJ 3FK7A 2HYJA 3C07A 5F1JA 2QIBA 4JKZA 1H8AC 3V78A 2DG8A 2VKEA 3M3YJ 3JRAA 2M8GX 2REKA 3NPIA 2DN0A 2RASA 1SANA 2LKXA 3S17J 3Q3SA 1W0TA 4IHXA 2EZLA 5AQCA 2RAEA 3MN2A 4M3BA 1OJLA 3PPBA 4CYCA 3QBMA 4BBRJ 2CQQA 3KZ9A 1ETKA 3GTJJ 3BR6A 5CXIA 4A3KJ 5IYBJ 3JRFA 1B8IB 5J1RA 3HOWJ 2COBA 2R5ZB 5HSZA 3HOVJ 2XB5A 3HTAA 3PO3J 2LP0A 4FTHA 3HGYA 1PUFB 1GDTA 3LOCA 5EYRA 2HXOA 2X9DA 4AC0A 4AUXA 2G7SA 2N8GA 1DU6A 2CU7A 1LFBA 1HDPA 3Q0VA 3BCGA 2FQ4A 1UHSA 4IEJA 2LK2A 2EQRA 3FK6A 1X2NA 2R93J 3G7RA 1FTTA 5M3MJ 4MFEA 3O8GA 2PMZN 4XIDA 3GZIA 4DW6A 4CGRA 5IP6A 4ME9A 5K7FA 5EDNA 2DMPA 1HF0A 1FJLA 2LLKA 1SGMA 1P7IA 2LD5A 3JRBA 2JWTA 4RDUA 1U8BA 3F0CA 1ZR4A 2O7TA 1TWCJ 2OPTA 2EZKA 2NVQJ 3S1QJ 1U9NA 1TWGJ 3MKLA 4B4CA 4A3FJ 1AU7A 2UXPA 3LWJA 3E7QA 3OSFA 3NAUA 3VVXA 4C3IJ 1JT6A 3TP0A 5FGLA 1Y1VJ 3DEWA 2L7FP 2HOTA 3BR1A 2E19A 2E2IJ 3EUPA 3BR5A 1MH4A 5JLXA 5F0HA 3HEFA 2QTQA 4GCTA 2JJ7A 2P81A 1T56A 3GTPJ 3BQZA 2UXHA 4M3DA 3B81A 4CYCB 4UDSA 1D5YA 3GTMJ 3LHQA 1JKOC 3G1OA 3VW0A 3HTJA 4MLOA 3FIWA 5M3FJ 1IV6A 3JRDA 3V6GA 3AQTA 5D1RA 3VVZA 5F04A 4FE7A 2I10A 3ZOBA 4JYKA 4UUSA 3HTIA 3VW1A 1MBHA 3JREA 1JGGA 3ZQHA 1I50J 2OERA 3MVPA 4HNVA 4XICA 3LSJA 1XG1A 3CMYA 4IHWA 4MFDA 2DA4A 5IP7J 1NK3P 2DTZA 1WH7A 5FJ8J 2IBDA 3IH2A 1LFUP 1UI6A 3PM1A 3ON2A 3RD3A 5J3LA 3SDGA 2IU5A 3S2HJ 4XK4A 3ZQLA 3RZDJ 1HDDC 4BY7J 2YUSA 1BA5A 4Y52J 1ORKA 4C3JJ 2M9HA 4Y7NJ 1F36A 2JA5J 2HQ5A 5EGOA 4BBSJ 2VKVA 1ZGWA 3HGGA 3JR9A 2CUFA 2IAIA 2K9NA 3AQSA 1GUUA 3WHCA 2ME6A 5HAWA 2D5VA 1BW5A 2QKOA 3NNRA 1E3OC 1K83J 2O9LA 1IRZA 4GFLA 5C4YA 4D5CA 3BTJA 3S16J 3BT9A 3L1PA 2HI3A 1BW6A 3T6NA 1Z0XA 1ETYA 1RR7A 2GBYA 4A3JJ 3G1MA 3G1LA 1HLVA 4NELA 2DMUA 2JA7J 4JX4A 3KNWA 4BKXA 1WGXA 2GFNA 1NK2P 5C4JJ 3VW2A 5IP9J 4A3MJ 2JN6A 1EF4A 4D5FA 4GFKA 2K40A 4HKUA 2Q24A 5CXGA 3VOXA 2ZB9A 2FD5A 1H89C 1HOMA 4DYRA 4A3DJ 4AF5A 4UUTA 4LOCA 1CQTA 2XPVA 4AYBN 2ECBA 2DA1A 1A6IA 4A3CJ 1GVDA 1MBFA 2NS7A 2CQXA 2NOGA 4D7MA 5FKOA 4EEFG 1WH5A 2R92J 1MBKA 1LE8A 2JA6J 1XS9A 3HKZN 1QVUA 4UUSB 2CRGA 3S15J 2XB0X 2LR8A 4MO7A 2RHAA 3S5RA 1ETOA 2MG4A 2Y9YA 2XRLA 4X1EA 2NX4A 1OCPA 3BHQA 2QOPA 5C44J 9ANTA 1VFCA 1WI3A 2DMNA 4QIWN 1MSEC 1POGA 5E3NA 1IDZA 3BR2A 3DCFA 1RPWA 2Y2ZA 1ITYA 3GTQJ 4C2MJ 2G7LA 4B1RA 3LSRA 1FIPA 4XRMA 4MK6A 3M4OJ 1QPIA 5K7HA 2Y31A 2DA7A 1ZQ3P 3B6AA 2L0KA 5F27A 2EZIA 2XSDC 3HM5A 5EGOB 3SFIA 1IDYA 4M3EA 2YVHA 2DA5A 3CWRA 2MSYA 1T33A 2QCOA 2PZ9A 3GTGJ 2X48A 3IH3A 3LNQA 3LSPA 3VP5A 1GV5A 2L7MP 2NP5A 2D6YA 1U9OA 3HIMA 4JX5A 4AC6A 1F43A 1ZTRA 4XRSA 1P7JA 2ID6A 4A3EJ 3BJBA 2FJ1A 1ETVA 4YZEA 4FCYA 1WCMJ 2W48A 4A3LJ 3GTLJ 3LJLA 1TC3C 5DAJA 4ICHA 4IHVA 3BQYA 2M2EA 3A01A 2IEKA 2TCTA 1BJZA 5BNGA 3CJDA 2VPRA 1JUSA 2Y9ZA 4QTRA 3DPJA 3GTOJ 4C3HJ 4KWAA 1I3QJ 1K61A 3O8HA 3BTIA 1FIAA 3BTCA 5GP9A 3VPRA 4XRSG 1LE8B 4MIMA 1IJWC 2FX0A 5HODA 1TWFJ 2OF7A 5J1UA 3P9TA 4BXXJ 4DZPA 1ETQA 2XPWA 5E3MA 2HXIA 2ME0A 2NS8A 3JRHA 3KKDA 5FKKA 5FLVA 3VOKA 2UXUA 1IUFA 2ZOYA 2WGBA 5C3EJ 1JJ8C 2E2HJ 1VNDA 4IHYA 2HOSA 2G3BA 2UXIA 4M6VA 2KDZA 1APLC 4NDLA 2KT0A 3COLA 3VVYA 4DYCA 2L9RA 1B72A 1FTZA 1RKTA 5EEAA 1JUPA 3Q0UA 2R5YA 1SFOJ 3ZQCA 5K7ZA 2HDDA 2E1OA 3SJMA 2MGQA 2VUMJ 3BRUA 2AO9A 3BR3A 3OSGA 4ABZA 1ETXA 1GT0C 2EZHA 3FISA 5FKNA 5JLWA 1QVTA 1IC8A 1OCTC 5EFYA 2ELKA 1QRYA 3NXCA 1ZKGA 4FE4A 4I6ZA 3BTLA 5GPAA 2XGDA 1U78A 1JUMA 5FMPA 3CQZJ 1UG2A 3QPLA 5J1YA 4S0HB 3Q0WA 5FHPA 3A01B 5FLMJ 5M5WJ 1I6HJ 2W53A 3HTHA 2DA3A 5D18A 1RESA 3KKCA 5EG0A 1IGNA 1JKQC 4J19A 1ZR2A 2LVSA 3GTKJ 2VI6A 3TW7A 4A3BJ 2OI8A 3JRIA 3HOUJ 2EBIA 3TP3A 3HE0A 2JMWA 5H9TA 2YU9J 1JTXA 3S14J 1DU0A 3VIBA 2ZOZA 4D7NA 3HOZJ 1JKRC 1HCRA 1MBEA 4JP0A 2WAQN 2NP3A 3JSJA 3F1BA 3O60A 1Z77A 1ENHA 1FEXA 4B3AA 3VUQA 2B63J 2E2JJ 3UKGA 1RETA 3CRJA 4G12A 1VF9A 2O7OA 2WB1N 1VI0A 1JT0A 2Y0SN 3C2BA 3HDDA 4L5EA 1B72B 3MNLA 2R5YB 1WPKA 3K2AA 3A03A 1AKHA 2QF7A 3OIOA 1R9TJ 5DTDA 1MSFC 2R7ZJ 2ZCXA 2JA8J 5FKLA 3RZOJ 2QWTA 4PXIA 2AHQA 5F0CA 2K9SA 3JRCA 1MH3A 4W1UA 2XGEA 3QPSA 2V57A 3E7LA 1W0UA 3HOXJ 1JKPC 4ACIA 4QSHA 5GPCA 5F08A 1O4XA 5D19A 2WUIA 1UMQA 1YRNA 5F0FA 1UI5A 4M3GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FKM A;  1Q1V A;  3B6C A;  3ZQF A;  5EG0 B;  3IH4 A;  4GFB A;  5K58 A;  2K9Q A;  3QKX A;  2XGC A;  3BG9 A;  3FRQ A;  2F07 A;  2ECC A;  1RKW A;  1GV2 A;  3TW6 A;  5IOY A;  4JNN A;  2NVX J;  3NI7 A;  1Y1W J;  1MNM C;  2NVY J;  5IPA A;  2LY9 A;  3I4N J;  3PAS A;  5IYD J;  2XPU A;  3I4M J;  4W97 A;  2DJN A;  2MW8 A;  2G7G A;  1S7E A;  3GEU A;  3BG5 A;  2UXO A;  4X6A J;  4V2G A;  4V2F A;  3HB9 A;  3S2D J;  3CCY A;  3LSG A;  1JTY A;  4FIS A;  5DS9 A;  2R0Q C;  3A02 A;  2DA2 A;  3ZQI A;  1AKH B;  2JK3 A;  3QQA A;  2HOA A;  4DZJ A;  4L62 A;  2M0C A;  5IYC J;  1AHD P;  4I76 A;  5C4X J;  2GUH A;  3BNI A;  3EGQ A;  3NAR A;  2H1K A;  3W6V A;  2M34 A;  1BL0 A;  2DMT A;  2ID3 A;  1ZK8 A;  2GEN A;  2ZCN A;  3RQI A;  3H0G J;  4MXM A;  2G0E A;  1A5J A;  2YVE A;  1X2M A;  2X6O A;  1X58 A;  2GM4 A;  5M5X J;  3IV5 A;  4JX6 A;  1YRN B;  4DYQ A;  2GLO A;  5M5Y J;  4GCL A;  2L7Z A;  4RBO A;  3S1M J;  2NVT J;  4JL3 A;  1JJ6 C;  5EF6 A;  2CUE A;  5E3L A;  3ANP A;  2HKU A;  3GBG A;  3TED A;  1ETW A;  2TRT A;  3ZQG A;  2LTP A;  1MBG A;  3JRG A;  3ON4 A;  1IG7 A;  2XDN A;  1B8I A;  4GCK A;  2LFB A;  2R5Z A;  2Y30 A;  5E3O A;  1NTC A;  1TWH J;  1PUF A;  3H3V K;  4NN1 A;  1G2H A;  5EZH A;  3K7A J;  2DMQ A;  4A69 C;  2PBX A;  3S1N J;  4A93 J;  3G56 A;  2CJJ A;  2EH3 A;  3CDL A;  5CW8 A;  2HYT A;  2DA6 A;  3HOY J;  1OFC X;  3D1N I;  4BY1 J;  2DG7 A;  5IOZ A;  1MBJ A;  1TWA J;  3BG3 A;  4M3F A;  3BR0 A;  3HBL A;  3RH2 A;  2YS9 A;  3ANG A;  2WV1 A;  5HBU A;  1H88 C;  3NRG A;  3WHB A;  3OOU A;  3PO2 J;  2ZCM A;  3IUV A;  3RKQ A;  3FKI J;  2FBQ A;  3S1R J;  5EZG A;  1XC5 A;  4A3I J;  2H8R A;  2O8K A;  4A3G J;  3FK7 A;  2HYJ A;  3C07 A;  5F1J A;  2QIB A;  4JKZ A;  1H8A C;  3V78 A;  2DG8 A;  2VKE A;  3M3Y J;  3JRA A;  2M8G X;  2REK A;  3NPI A;  2DN0 A;  2RAS A;  1SAN A;  2LKX A;  3S17 J;  3Q3S A;  1W0T A;  4IHX A;  2EZL A;  5AQC A;  2RAE A;  3MN2 A;  4M3B A;  1OJL A;  3PPB A;  4CYC A;  3QBM A;  4BBR J;  2CQQ A;  3KZ9 A;  1ETK A;  3GTJ J;  3BR6 A;  5CXI A;  4A3K J;  5IYB J;  3JRF A;  1B8I B;  5J1R A;  3HOW J;  2COB A;  2R5Z B;  5HSZ A;  3HOV J;  2XB5 A;  3HTA A;  3PO3 J;  2LP0 A;  4FTH A;  3HGY A;  1PUF B;  1GDT A;  3LOC A;  5EYR A;  2HXO A;  2X9D A;  4AC0 A;  4AUX A;  2G7S A;  2N8G A;  1DU6 A;  2CU7 A;  1LFB A;  1HDP A;  3Q0V A;  3BCG A;  2FQ4 A;  1UHS A;  4IEJ A;  2LK2 A;  2EQR A;  3FK6 A;  1X2N A;  2R93 J;  3G7R A;  1FTT A;  5M3M J;  4MFE A;  3O8G A;  2PMZ N;  4XID A;  3GZI A;  4DW6 A;  4CGR A;  5IP6 A;  4ME9 A;  5K7F A;  5EDN A;  2DMP A;  1HF0 A;  1FJL A;  2LLK A;  1SGM A;  1P7I A;  2LD5 A;  3JRB A;  2JWT A;  4RDU A;  1U8B A;  3F0C A;  1ZR4 A;  2O7T A;  1TWC J;  2OPT A;  2EZK A;  2NVQ J;  3S1Q J;  1U9N A;  1TWG J;  3MKL A;  4B4C A;  4A3F J;  1AU7 A;  2UXP A;  3LWJ A;  3E7Q A;  3OSF A;  3NAU A;  3VVX A;  4C3I J;  1JT6 A;  3TP0 A;  5FGL A;  1Y1V J;  3DEW A;  2L7F P;  2HOT A;  3BR1 A;  2E19 A;  2E2I J;  3EUP A;  3BR5 A;  1MH4 A;  5JLX A;  5F0H A;  3HEF A;  2QTQ A;  4GCT A;  2JJ7 A;  2P81 A;  1T56 A;  3GTP J;  3BQZ A;  2UXH A;  4M3D A;  3B81 A;  4CYC B;  4UDS A;  1D5Y A;  3GTM J;  3LHQ A;  1JKO C;  3G1O A;  3VW0 A;  3HTJ A;  4MLO A;  3FIW A;  5M3F J;  1IV6 A;  3JRD A;  3V6G A;  3AQT A;  5D1R A;  3VVZ A;  5F04 A;  4FE7 A;  2I10 A;  3ZOB A;  4JYK A;  4UUS A;  3HTI A;  3VW1 A;  1MBH A;  3JRE A;  1JGG A;  3ZQH A;  1I50 J;  2OER A;  3MVP A;  4HNV A;  4XIC A;  3LSJ A;  1XG1 A;  3CMY A;  4IHW A;  4MFD A;  2DA4 A;  5IP7 J;  1NK3 P;  2DTZ A;  1WH7 A;  5FJ8 J;  2IBD A;  3IH2 A;  1LFU P;  1UI6 A;  3PM1 A;  3ON2 A;  3RD3 A;  5J3L A;  3SDG A;  2IU5 A;  3S2H J;  4XK4 A;  3ZQL A;  3RZD J;  1HDD C;  4BY7 J;  2YUS A;  1BA5 A;  4Y52 J;  1ORK A;  4C3J J;  2M9H A;  4Y7N J;  1F36 A;  2JA5 J;  2HQ5 A;  5EGO A;  4BBS J;  2VKV A;  1ZGW A;  3HGG A;  3JR9 A;  2CUF A;  2IAI A;  2K9N A;  3AQS A;  1GUU A;  3WHC A;  2ME6 A;  5HAW A;  2D5V A;  1BW5 A;  2QKO A;  3NNR A;  1E3O C;  1K83 J;  2O9L A;  1IRZ A;  4GFL A;  5C4Y A;  4D5C A;  3BTJ A;  3S16 J;  3BT9 A;  3L1P A;  2HI3 A;  1BW6 A;  3T6N A;  1Z0X A;  1ETY A;  1RR7 A;  2GBY A;  4A3J J;  3G1M A;  3G1L A;  1HLV A;  4NEL A;  2DMU A;  2JA7 J;  4JX4 A;  3KNW A;  4BKX A;  1WGX A;  2GFN A;  1NK2 P;  5C4J J;  3VW2 A;  5IP9 J;  4A3M J;  2JN6 A;  1EF4 A;  4D5F A;  4GFK A;  2K40 A;  4HKU A;  2Q24 A;  5CXG A;  3VOX A;  2ZB9 A;  2FD5 A;  1H89 C;  1HOM A;  4DYR A;  4A3D J;  4AF5 A;  4UUT A;  4LOC A;  1CQT A;  2XPV A;  4AYB N;  2ECB A;  2DA1 A;  1A6I A;  4A3C J;  1GVD A;  1MBF A;  2NS7 A;  2CQX A;  2NOG A;  4D7M A;  5FKO A;  4EEF G;  1WH5 A;  2R92 J;  1MBK A;  1LE8 A;  2JA6 J;  1XS9 A;  3HKZ N;  1QVU A;  4UUS B;  2CRG A;  3S15 J;  2XB0 X;  2LR8 A;  4MO7 A;  2RHA A;  3S5R A;  1ETO A;  2MG4 A;  2Y9Y A;  2XRL A;  4X1E A;  2NX4 A;  1OCP A;  3BHQ A;  2QOP A;  5C44 J;  9ANT A;  1VFC A;  1WI3 A;  2DMN A;  4QIW N;  1MSE C;  1POG A;  5E3N A;  1IDZ A;  3BR2 A;  3DCF A;  1RPW A;  2Y2Z A;  1ITY A;  3GTQ J;  4C2M J;  2G7L A;  4B1R A;  3LSR A;  1FIP A;  4XRM A;  4MK6 A;  3M4O J;  1QPI A;  5K7H A;  2Y31 A;  2DA7 A;  1ZQ3 P;  3B6A A;  2L0K A;  5F27 A;  2EZI A;  2XSD C;  3HM5 A;  5EGO B;  3SFI A;  1IDY A;  4M3E A;  2YVH A;  2DA5 A;  3CWR A;  2MSY A;  1T33 A;  2QCO A;  2PZ9 A;  3GTG J;  2X48 A;  3IH3 A;  3LNQ A;  3LSP A;  3VP5 A;  1GV5 A;  2L7M P;  2NP5 A;  2D6Y A;  1U9O A;  3HIM A;  4JX5 A;  4AC6 A;  1F43 A;  1ZTR A;  4XRS A;  1P7J A;  2ID6 A;  4A3E J;  3BJB A;  2FJ1 A;  1ETV A;  4YZE A;  4FCY A;  1WCM J;  2W48 A;  4A3L J;  3GTL J;  3LJL A;  1TC3 C;  5DAJ A;  4ICH A;  4IHV A;  3BQY A;  2M2E A;  3A01 A;  2IEK A;  2TCT A;  1BJZ A;  5BNG A;  3CJD A;  2VPR A;  1JUS A;  2Y9Z A;  4QTR A;  3DPJ A;  3GTO J;  4C3H J;  4KWA A;  1I3Q J;  1K61 A;  3O8H A;  3BTI A;  1FIA A;  3BTC A;  5GP9 A;  3VPR A;  4XRS G;  1LE8 B;  4MIM A;  1IJW C;  2FX0 A;  5HOD A;  1TWF J;  2OF7 A;  5J1U A;  3P9T A;  4BXX J;  4DZP A;  1ETQ A;  2XPW A;  5E3M A;  2HXI A;  2ME0 A;  2NS8 A;  3JRH A;  3KKD A;  5FKK A;  5FLV A;  3VOK A;  2UXU A;  1IUF A;  2ZOY A;  2WGB A;  5C3E J;  1JJ8 C;  2E2H J;  1VND A;  4IHY A;  2HOS A;  2G3B A;  2UXI A;  4M6V A;  2KDZ A;  1APL C;  4NDL A;  2KT0 A;  3COL A;  3VVY A;  4DYC A;  2L9R A;  1B72 A;  1FTZ A;  1RKT A;  5EEA A;  1JUP A;  3Q0U A;  2R5Y A;  1SFO J;  3ZQC A;  5K7Z A;  2HDD A;  2E1O A;  3SJM A;  2MGQ A;  2VUM J;  3BRU A;  2AO9 A;  3BR3 A;  3OSG A;  4ABZ A;  1ETX A;  1GT0 C;  2EZH A;  3FIS A;  5FKN A;  5JLW A;  1QVT A;  1IC8 A;  1OCT C;  5EFY A;  2ELK A;  1QRY A;  3NXC A;  1ZKG A;  4FE4 A;  4I6Z A;  3BTL A;  5GPA A;  2XGD A;  1U78 A;  1JUM A;  5FMP A;  3CQZ J;  1UG2 A;  3QPL A;  5J1Y A;  4S0H B;  3Q0W A;  5FHP A;  3A01 B;  5FLM J;  5M5W J;  1I6H J;  2W53 A;  3HTH A;  2DA3 A;  5D18 A;  1RES A;  3KKC A;  5EG0 A;  1IGN A;  1JKQ C;  4J19 A;  1ZR2 A;  2LVS A;  3GTK J;  2VI6 A;  3TW7 A;  4A3B J;  2OI8 A;  3JRI A;  3HOU J;  2EBI A;  3TP3 A;  3HE0 A;  2JMW A;  5H9T A;  2YU9 J;  1JTX A;  3S14 J;  1DU0 A;  3VIB A;  2ZOZ A;  4D7N A;  3HOZ J;  1JKR C;  1HCR A;  1MBE A;  4JP0 A;  2WAQ N;  2NP3 A;  3JSJ A;  3F1B A;  3O60 A;  1Z77 A;  1ENH A;  1FEX A;  4B3A A;  3VUQ A;  2B63 J;  2E2J J;  3UKG A;  1RET A;  3CRJ A;  4G12 A;  1VF9 A;  2O7O A;  2WB1 N;  1VI0 A;  1JT0 A;  2Y0S N;  3C2B A;  3HDD A;  4L5E A;  1B72 B;  3MNL A;  2R5Y B;  1WPK A;  3K2A A;  3A03 A;  1AKH A;  2QF7 A;  3OIO A;  1R9T J;  5DTD A;  1MSF C;  2R7Z J;  2ZCX A;  2JA8 J;  5FKL A;  3RZO J;  2QWT A;  4PXI A;  2AHQ A;  5F0C A;  2K9S A;  3JRC A;  1MH3 A;  4W1U A;  2XGE A;  3QPS A;  2V57 A;  3E7L A;  1W0U A;  3HOX J;  1JKP C;  4ACI A;  4QSH A;  5GPC A;  5F08 A;  1O4X A;  5D19 A;  2WUI A;  1UMQ A;  1YRN A;  5F0F A;  1UI5 A;  4M3G A; 
#chains in the Genus database with same CATH topology
 4XN3 A;  2JVH A;  5FKM A;  1TP4 A;  5JI6 A;  3GUD A;  3BG9 A;  3PL8 A;  2F07 A;  5D5V B;  1Y0U A;  4R8H A;  2FOK A;  4ON0 A;  4E7H A;  3TW6 A;  1YLF A;  5LRR A;  3KCC A;  3V7R A;  2NVX J;  1OYY A;  1VQ9 I;  2VE9 A;  3MD2 A;  2UXN A;  4ENJ A;  1J9I A;  1MNM C;  1NG6 A;  2NVY J;  2HEO A;  1CF7 A;  5EJC A;  2XPU A;  2DYR H;  3S3O A;  3J7Z I;  2HKO A;  1MDM A;  3W3C A;  2JA2 A;  1LDK B;  3CP8 A;  3F8N A;  3BG5 A;  2UXO A;  2FXA A;  1Z7U A;  4FHT A;  2VQG A;  5K5O A;  3JAM K;  1IN8 A;  3PQJ A;  1DPR A;  3Q5F A;  2E36 A;  4HAM A;  3DPU A;  2JK3 A;  1IO2 A;  1D1C A;  2L4M A;  1Z1D A;  2OA4 A;  2M0C A;  4MNU A;  3ZMZ A;  4I76 A;  3BNI A;  2GUH A;  4A12 A;  2RKH A;  3NAR A;  2H1K A;  2GZW A;  3W6V A;  1SFX A;  1MGT A;  2BEO A;  5FFZ A;  2ID3 A;  1UHW A;  2GEN A;  1U8R A;  3RQI A;  2HZT A;  2G0E A;  1F9N A;  3HOS A;  2K3F A;  5DM6 F;  2ESN A;  4KYW A;  2VOD A;  4OIP F;  3E5X A;  3IV5 A;  5IT3 A;  5A2Q K;  4JX6 A;  1LJ9 A;  3OL4 A;  4UHT A;  4E7L A;  4DYQ A;  1YRN B;  1UZC A;  5K5Q A;  5M5Y J;  3S1M J;  2RNJ A;  3QP5 A;  3K70 D;  4JL3 A;  1JJ6 C;  1X3W B;  1D1B A;  3ANP A;  1OIS A;  2TRT A;  3ZQG A;  2VXD A;  3ON4 A;  4Z2Y A;  3O2P E;  1B8I A;  1ZEL A;  5H6R A;  1CF7 B;  1NTC A;  1OCC H;  1LNW A;  2BV6 A;  5IY5 H;  4NN1 A;  1MDM B;  3W6K B;  4KIF A;  2X1E A;  2CJJ A;  5CW8 A;  4XKV A;  2DA6 A;  3HOY J;  4CH7 A;  2A3S A;  2M1B A;  5EEG A;  3D1N I;  4F55 A;  1HKQ A;  4E7S A;  2B1E A;  3ML6 A;  3PIO F;  3BR0 A;  3DLL F;  2YS9 A;  3VYS B;  5H6Q A;  5FD6 A;  4H4K C;  2DBB A;  2IA0 A;  3WHB A;  3KET A;  3OOU A;  1YOV B;  3RKQ A;  1FX7 A;  5DUI A;  3S1R J;  4RAF A;  4Y13 A;  4FQG A;  1P4X A;  3FK7 A;  2OZ6 A;  3OYN A;  1UB9 A;  1WRJ A;  4JKZ A;  1H8A C;  1D0X A;  2HDW A;  4UUV A;  3VOD A;  1FOY A;  4KMU X;  1WFX A;  3X2Q H;  1FSH A;  2WY7 Q;  1VQN I;  3EUH C;  2REK A;  5HS7 A;  3EUH A;  4O6J A;  2RAS A;  3HL2 A;  4EJO A;  1VQ5 I;  2EZL A;  2RAE A;  3BJA A;  1WJF A;  4M3B A;  4L0Z B;  2M8E A;  1OJL A;  4QLC U;  4XOR A;  5HVQ C;  3GFM A;  4II3 A;  3V8J A;  2LC2 A;  4CO8 A;  3RCO A;  3L2W A;  4CIC A;  3HJE A;  2CQK A;  3M8E A;  3QP6 A;  3CDH A;  3OS2 A;  4A3K J;  1EH7 A;  3JRF A;  1B8I B;  1LFP A;  4RA2 A;  3RYR A;  3QU3 A;  3LFK A;  4FTH A;  3A0H C;  1GDT A;  1ODD A;  5FO5 A;  3J81 Z;  2G7S A;  3G3Z A;  3TO9 A;  2V1N A;  4XLF A;  1XGS A;  3GFI A;  3BCG A;  1R1T A;  1NHA A;  1P92 A;  1SD5 A;  1UHS A;  2LK2 A;  4XKW A;  4BXF A;  2EQR A;  3FK6 A;  3HOT A;  2DDA A;  2H09 A;  2DFE A;  5M3M J;  2BBY A;  3O8G A;  2PMZ N;  4LLN A;  4XID A;  1YIJ I;  1Q1H A;  5ICG A;  2FA5 A;  5K7F A;  2NNY A;  3OYA A;  2LLK A;  3ZR8 X;  4P9U A;  3U9G A;  1V54 H;  1KU9 A;  2Y0M A;  1Z6T A;  4G94 A;  1EKE A;  2KIM A;  2VJI A;  1TWC J;  3WTT C;  2OTL I;  2PFV A;  1U9N A;  3MKL A;  2UXP A;  1AU7 A;  3KP2 A;  4HW0 A;  3DPT A;  1K78 A;  4BHC A;  3RYP A;  3OSF A;  2RVC A;  4EGY A;  4L9N A;  5FGL A;  4C2M A;  4RGX A;  3VWB A;  3CF5 F;  3MQ0 A;  1D8J A;  3OR2 C;  1KQ9 A;  3K1N A;  2HOT A;  3BR1 A;  5DM7 F;  3KEQ A;  5F64 A;  4EJW A;  2EFQ A;  2CQN A;  4LIV A;  3MKW B;  2JJ7 A;  4GCT A;  3CMM A;  1XTA A;  2UXH A;  4BAY A;  1UEL B;  3V4G A;  1JKO C;  2BXZ A;  2Q1Z B;  1Z05 A;  2O03 A;  1R00 A;  4AU7 A;  3VW0 A;  1XGN A;  4TV7 A;  1G3S A;  2A05 A;  4KJZ A;  3K1M A;  3L2R A;  2K3P A;  2IS1 A;  4FE7 A;  1SD7 A;  3ZRG A;  2R7V A;  5ILV A;  4JYK A;  4M73 A;  2QQA A;  2BHY A;  1WWX A;  4HNV A;  4KT6 A;  5JFR A;  2DA4 A;  2BVL A;  4U9N A;  1OMI A;  1WJA A;  3IH2 A;  3JTH A;  3OOP A;  3D5R C;  3J81 K;  3PM1 A;  3ON2 A;  4DBQ A;  3K4B A;  3RD3 A;  4C2U A;  3E6C C;  2PMH A;  2IU5 A;  1VQ4 I;  3ZQL A;  4BY7 J;  2YUS A;  4Y52 J;  1ORK A;  2EB7 A;  3E6B A;  4C3J J;  1GXQ A;  1XMA A;  2BY2 A;  2HYF A;  5EGO A;  4OWR B;  2VKV A;  3AG3 H;  3DFG A;  4N9I A;  3AKZ A;  2K9N A;  2JSC A;  3WHC A;  1X19 A;  2IVM A;  3NNR A;  1E3O C;  2E34 A;  4Y17 A;  4AIK A;  1LVK A;  1K78 B;  3S16 J;  3GFJ A;  4QPO A;  1RC9 A;  3L1P A;  1BW6 A;  3GW2 A;  4CDG A;  2ZXI A;  3G1L A;  1HLV A;  2CW8 A;  4PJN A;  3MZ8 A;  2STT A;  4HPQ A;  3RIR A;  1FMV A;  2DO7 A;  4IF4 A;  4BKX A;  1G59 A;  5LBQ A;  5C4J J;  3E5U A;  5IP9 J;  1EF4 A;  4D5F A;  5CXG A;  2HWV A;  3MZH A;  4AF5 A;  4LOC A;  1CQT A;  1YQA A;  1TBX A;  1V4R A;  3FXJ A;  4A6D A;  5TIS C;  4CHU A;  4HRI A;  3SZG A;  1GVD A;  2DXI A;  4IHT A;  3OYJ A;  2O5R A;  4Q4Z F;  1G6N A;  4D7M A;  2ZNY A;  2JQ7 A;  2VT3 A;  1FP1 D;  1WH5 A;  2FBH A;  1SEU A;  2R92 J;  4LFU A;  3HKZ N;  4CZZ A;  1QVU A;  2BZT A;  3LQR A;  3ISP A;  2LKP A;  1DPU A;  2LR8 A;  2X6Y A;  3S5R A;  3R0A A;  4IVN A;  2ZFW A;  1YJ9 I;  1FMW A;  2M4G A;  4X1E A;  3S32 A;  2QOP A;  3ZCO A;  1WI3 A;  2DMN A;  3ZN1 A;  1W5C C;  5LHH A;  3KIO A;  5E3N A;  3QYE A;  2MBF A;  4CCM A;  4IQJ A;  5H20 A;  3BCA A;  5CVI A;  4YEL A;  1DP3 A;  2G7L A;  2ZKZ A;  2E1C A;  2EIL H;  3HSR A;  4XRM A;  2HVR A;  2OQG A;  4MK6 A;  5K7H A;  2DA7 A;  3W2W A;  2P5K A;  5F27 A;  3KLN A;  3HM5 A;  5EGO B;  1IDY A;  5J8F A;  3ZPL A;  1ZRC A;  1JI8 A;  1T33 A;  2QCO A;  2ZCW A;  2Z16 A;  4MEY F;  4HSR A;  1SD6 A;  2PJR A;  1OYI A;  3S2W A;  3NWT A;  4A5N A;  2D6Y A;  2DPU A;  3HIM A;  1S7O A;  1MKM A;  1E0E A;  4Y33 A;  2IT0 A;  5ED4 A;  3LAJ A;  2FJ1 A;  3M8J A;  2CV0 A;  1D1A A;  1SMY F;  4FCY A;  5HS8 A;  2BGC A;  2Y69 H;  4ZH4 F;  4ZYA A;  3R0J A;  4J00 A;  2WTE A;  1BI1 A;  3A01 A;  2EA4 A;  3HTU A;  2CW0 F;  1Z3Y A;  5BNG A;  5D6E A;  1RNL A;  2Y9Z A;  4QTR A;  1HW5 A;  1YIT I;  4C3H J;  4KWA A;  1G3T A;  3BTI A;  1X4O A;  1FIA A;  2JVG A;  5GP9 A;  1I27 A;  3VPR A;  2K9L A;  4XRS G;  2K5C A;  4EJU A;  2FX0 A;  2ZXJ A;  4RM3 A;  2OF7 A;  2E7W A;  3CO7 C;  3P9T A;  1ZH5 A;  4DZP A;  4BXX J;  5HLI A;  5F1R A;  2ME0 A;  2DK5 A;  2E60 A;  3G4S I;  3M7G A;  3KKD A;  3OWT A;  3H5A A;  2DK8 A;  5C3E J;  4NB5 A;  1D0Y A;  1VND A;  5K5R A;  4BH9 A;  3CCU I;  2UXI A;  2PQ8 A;  2KDZ A;  1APL C;  2F5D A;  3CCL I;  1HC8 A;  2QZ8 A;  3T5X A;  1RUO A;  4B09 A;  2L9R A;  3VB2 A;  3CCJ I;  3B73 A;  1RKT A;  4Z6Y A;  2QSF X;  4G9Y A;  3Q0U A;  2HDD A;  5AQC A;  3CMA I;  2PJR B;  2JRT A;  2AO9 A;  4PJ0 C;  4ABZ A;  1ETX A;  4F7Z A;  4MEX F;  2EZH A;  3FIS A;  1S7A A;  5JLW A;  5EFY A;  2ELK A;  2K27 A;  1QZE A;  4XRF A;  4IPA A;  1TLH B;  1QZY A;  3F9K A;  5GPA A;  4XBF A;  1WJD A;  1BI2 A;  2YU3 A;  4HX8 A;  4KIS A;  2V6C A;  4UVB A;  1YIO A;  4S0H B;  2GIV A;  3K4C A;  5DEQ A;  1W5S A;  4PUS A;  3A01 B;  2LNB A;  2O3F A;  5D18 A;  3SXY A;  1ZR2 A;  2VI6 A;  3TW7 A;  2OI8 A;  4BNC A;  4RB2 C;  3FHZ A;  2M45 A;  3VDX A;  1JTX A;  2GWR A;  3VIB A;  1REP C;  3AG4 H;  1LEA A;  1V3F A;  3OYF A;  3C2G A;  4E7K A;  4UB8 C;  3HOZ J;  1A6Q A;  1N75 A;  4C9Y A;  2QEX I;  3F1B A;  2OCC H;  2ICW G;  2VQC A;  1HKS A;  3LSH A;  2QVO A;  1ENH A;  2W00 A;  4U7D A;  3CRJ A;  2QSG X;  5LEK A;  4F93 B;  1PYV A;  4CCN A;  2GAU A;  2W57 A;  1WVR A;  2Y0S N;  4I98 B;  1GLN A;  2E71 A;  1MSF C;  5LRS A;  2QF7 A;  1R9T J;  2R7R A;  2QWT A;  3SDB A;  4E7Z A;  1MMS A;  1JE8 A;  2H27 A;  1YJN I;  1YHQ I;  4XN0 A;  3N97 A;  1IN7 A;  1RRJ A;  1BOB A;  3JRC A;  2LF7 A;  2XGE A;  3HHG A;  3EYI A;  4ACI A;  1TNS A;  4N4N B;  2XAH A;  2F4I A;  5GPC A;  5F08 A;  4WWC A;  3WTU C;  1O4X A;  1P4W A;  1UJ8 A;  1P2F A;  4HEA 2;  4KDP A;  3F72 A;  4MGR A;  4OD4 A;  3KZY A;  2IP2 A;  1HXD A;  1FOK A;  2OUM A;  1Q1V A;  5GAE J;  5DCF A;  3ZQF A;  3IH4 A;  5K58 A;  3PJR A;  4YEJ A;  5FRO A;  2ECC A;  3BPV A;  1OLT A;  2YX4 A;  5IOY A;  4CZC A;  1VZ0 A;  2V6E A;  2DT5 A;  1Y1W J;  2NYX A;  2JSP A;  5IPA A;  1Z7L A;  3ASO H;  2BY3 A;  1S3J A;  3FZV A;  1XPX A;  3TKY A;  2MW8 A;  1S7E A;  1G4D A;  2PFB A;  2VIX A;  3MWM A;  4M9X A;  2HS5 A;  1JGS A;  3HB9 A;  2Q2E A;  2IPQ X;  3H9J A;  3MMY B;  5DS9 A;  2R0Q C;  3O3K A;  3ZQI A;  3FMS A;  2EIM H;  4PJL A;  1HA8 A;  3SWH A;  2HZD A;  3EUA A;  1LKX A;  2HOA A;  2L01 A;  4L62 A;  3DQV C;  3E97 A;  1AHD P;  3EGQ A;  1LVA A;  3KZZ A;  2XVC A;  2VBZ A;  1BL0 A;  1XDU A;  2DMT A;  1ZK8 A;  1BM9 A;  3DV8 A;  4MXM A;  1ZYR F;  2X6W A;  4WXH A;  2HGC A;  1FNN A;  1X2M A;  2X6O A;  1ZRF A;  1LEB A;  5D8K B;  3AAF A;  4OMZ A;  2HVQ A;  3FBN B;  3BP8 A;  4G6Q A;  5AIQ A;  3HG9 A;  1ZGJ A;  2R7W A;  4ZZD A;  1ACI A;  4MQ9 F;  5E3L A;  3C7J A;  2F4O B;  4FET A;  2KIQ A;  1X1P A;  2Q0O A;  1T6S A;  3I64 A;  3PIP F;  3CCM I;  2Q8K A;  4S05 A;  2KLO A;  2MAB A;  4O5V A;  4GCK A;  2LFB A;  4EJV A;  2R5Z A;  2Y30 A;  4F52 A;  5E3O A;  1Y6I A;  3LA3 A;  5B3S H;  5CVR A;  4LG0 A;  1OQY A;  3BC8 A;  1PUF A;  3H3V K;  2KHM A;  5LGU A;  1HST A;  2OCE A;  4A69 C;  1O3Q A;  5JVG F;  3LSK A;  1D5V A;  2VAS A;  5J4Y A;  3H0D A;  2HYT A;  1OFC X;  2Q2E B;  3ECO A;  3VEP A;  1IUY A;  3KP3 A;  4E70 A;  1B9N A;  1MBJ A;  1R23 A;  3BG3 A;  2IGM A;  1R1U A;  3HRM A;  1MMG A;  1FOX A;  4HDU A;  4FAS D;  1H88 C;  2VN2 A;  4GO1 A;  1FT9 A;  1KYZ A;  3NRG A;  3D5S C;  3TMO A;  1J09 A;  3CJQ B;  3F8B A;  2FBQ A;  3R4K A;  3OYD A;  4I09 A;  3L2U A;  1XC5 A;  2EIK H;  3LST A;  2E35 A;  2HYJ A;  3C07 A;  2NXN B;  3ZXS A;  2XDV A;  5HOO A;  2EA2 A;  3D5L A;  4C30 A;  2VON A;  2WAQ A;  1L0O C;  3VOE A;  5E8I A;  2E1M C;  3V8K A;  3F22 A;  2DI3 A;  1A36 A;  4KMF A;  1W0T A;  4IHX A;  3PNV A;  3GX4 X;  3PPB A;  2V26 A;  1SFU A;  1JHH A;  2CS3 A;  1ETK A;  4IOA F;  5CXI A;  2O8X A;  3S93 A;  2YVX A;  5IYB J;  3K4J A;  3KEY A;  5J8C A;  5J1R A;  3QOD A;  1BR1 A;  2ADU A;  2COB A;  2R5Z B;  1FOW A;  2ZY9 A;  2BHZ A;  5TGT A;  1T2K A;  4LG0 B;  3PO3 J;  1PUF B;  1TQP A;  3HTA A;  2IA2 A;  1U5T C;  1T98 A;  3HYI A;  3LOC A;  5EYR A;  2HXO A;  4UVA A;  4ZJZ A;  3CCQ I;  1U5T A;  3F3X A;  1DU6 A;  1FYK A;  1KYW A;  3L9F A;  4Q48 A;  2Z1D A;  2XV4 S;  4OIQ F;  4IEJ A;  2QKM B;  1A31 A;  1D3Y A;  1NG7 A;  2F5E A;  3G7R A;  3QU6 A;  3KE2 A;  4EGZ A;  3ROU A;  1Z67 A;  1R58 A;  3ZQQ A;  3E1S A;  1XMK A;  3OIP A;  2DW4 A;  2DMP A;  2FF4 A;  5EDN A;  3ABU A;  1P7I A;  2LD5 A;  3ERM A;  3JRB A;  2KIU A;  3FXU A;  3D0S A;  2VLA A;  3N4M A;  4GXO A;  2OPT A;  2EZK A;  2NVQ J;  2F5C A;  4A3F J;  3DEU A;  4PSW A;  1BC7 C;  3WGH A;  5F6F A;  2LG4 A;  3NAU A;  4C3I J;  4NC6 A;  2QQ9 A;  4DBR A;  1OYW A;  2ELH A;  2LF8 A;  2ZBK A;  2E1M B;  2E5Z A;  2F6C A;  4KIT B;  1WSU A;  1FWZ A;  3EUP A;  2A68 F;  4ZTF A;  1MH4 A;  5JLX A;  3F8C A;  2EFP A;  1J7K A;  1O7L A;  1R1V A;  3BZ6 A;  3QYF A;  3GTP J;  5GTI C;  1R4M B;  4DQ2 A;  2VOO A;  4UDS A;  1D5Y A;  4Q5S F;  3LL7 A;  3G1O A;  3TL4 X;  4L9J A;  3VYU B;  2V79 A;  2BVM A;  3AQT A;  5D1R A;  3WE3 A;  4I0B A;  2I10 A;  1QNT A;  2M7A A;  3UNG C;  4YFX F;  3VW1 A;  1MBH A;  4RLQ A;  5BS6 A;  2DOD A;  1P9Q C;  3L00 A;  2QGU A;  3HSE A;  1U5T B;  2KRC A;  1V5G A;  1XG1 A;  2XGX A;  1O57 A;  2PLY A;  3FX3 A;  3KLO A;  3EYY A;  1TW2 A;  3F8F A;  5J3L A;  3WTX C;  1Y0N A;  4RGU A;  3S2H J;  1M1E B;  1MZB A;  1HDD C;  3RZD J;  3KZI C;  2WC2 A;  3Q9S A;  4M72 A;  3WGG A;  4F3Q A;  4YG2 F;  2HQ5 A;  3TBI A;  3WU1 B;  4NHJ A;  1HSJ A;  2ZC2 A;  1MJ9 A;  3ZMS A;  2R4G A;  4ENM A;  2GXB A;  2IAI A;  4HG2 A;  1JHF A;  2HQR A;  3GXO A;  2VC0 A;  5AON A;  4OIN F;  2ME6 A;  2QM3 A;  4P9F A;  1BW5 A;  4GFL A;  1USS A;  1K83 J;  1ZLJ A;  3I4P A;  3E6D A;  2UWM A;  2HI3 A;  4AVP A;  1C0W A;  1ETY A;  4A3J J;  2A6E F;  4BXU A;  3G1M A;  2DMU A;  4JX4 A;  2GFN A;  1WGX A;  3NRV A;  2FUG 2;  2HPI A;  2YX7 A;  3CTA A;  2XAQ A;  1FBU A;  2QQB A;  2JN6 A;  3CUO A;  4GFK A;  3IWZ A;  3VOX A;  1BR2 A;  2K85 A;  1H89 C;  1HOM A;  1XCV A;  1R71 A;  2PG4 A;  1Z6R A;  2XPV A;  3WTY C;  2JPB A;  4AYB N;  4PZJ A;  1A6I A;  1XD7 A;  4XLA A;  4A3C J;  1IF1 A;  2LY1 A;  2CQX A;  3DKW A;  4EMS A;  4EEF G;  1LE8 A;  4BJT A;  5BPI A;  2JA6 J;  2HFH A;  2V4J C;  3MEX A;  4ZDO A;  1N78 A;  3S15 J;  3AFH A;  3F8M A;  4AD9 A;  4A5M A;  4MO7 A;  4UB6 C;  3H35 A;  3DBL B;  1U2W A;  4Y15 A;  2P5V A;  4I01 A;  1VFC A;  1DQU A;  4ZDP A;  2QUF A;  4QIW N;  1IDZ A;  3FM5 A;  2AQF A;  2E1N A;  1ITY A;  4M74 A;  4RS8 A;  3ZP5 A;  1HKT A;  4F92 B;  4PSX A;  1QPI A;  1YYV A;  2PMU A;  2Y31 A;  5CYV A;  3COA C;  1ZQ3 P;  3B6A A;  2L0K A;  2J5P A;  4LJZ F;  2XSD C;  1AA7 A;  3RPU A;  1I3A A;  3OYE A;  1IXC A;  1ERD A;  2L3D A;  1EJ9 A;  3SZT A;  2YVH A;  3FXM A;  2DA5 A;  2UV1 A;  3CWR A;  2PZ9 A;  3LWF A;  4XKC A;  2Y75 A;  2R7S A;  1GV5 A;  4LD5 A;  1OCZ H;  2KP6 A;  3MFK A;  1F43 A;  1ZTR A;  4XRS A;  1P7J A;  2PN6 A;  2CSO A;  3T1B A;  1ETV A;  4YZE A;  2LDU A;  1W7P A;  4LLG F;  4A3L J;  5HNF A;  1FBQ A;  3G6E I;  2ISZ A;  5HLG A;  3V7C A;  3U2R A;  4DGW B;  2HTS A;  5ICF A;  2LYC A;  3H5N A;  1IZ1 A;  3IWF A;  2K86 A;  3GVA A;  3CP2 A;  1JUS A;  2QWW A;  2KIF A;  2WAD A;  1WI9 A;  1I3Q J;  2HU9 A;  3ESW B;  3O8H A;  1LE8 B;  4RB3 C;  4RAZ A;  4ETS A;  3R60 A;  1UG0 A;  3TOA A;  4ZYG A;  2CQ7 A;  1LQ1 A;  4A2U A;  1TWF J;  2VXZ A;  5HLH A;  2F5F A;  4ZYD A;  2K4J A;  1ETQ A;  4A0Y A;  5FKK A;  1SAU A;  1DP7 P;  1IUF A;  2ZOY A;  2NAZ A;  5HDN A;  1IN6 A;  1XSX A;  3BZK A;  2QYO A;  1JJ8 C;  1FYL A;  2IA1 A;  2HOS A;  4N4O B;  2DOE A;  2VKD A;  2MD0 A;  3CF2 A;  4M6V A;  3I5U A;  4BJ6 C;  4CUG A;  3ABL H;  3PUF A;  4D1Q A;  1WJ5 A;  2ZJ2 A;  3V42 A;  2A07 F;  3COL A;  1OCO H;  1T39 A;  3HZJ A;  1B72 A;  1FTZ A;  2R5Y A;  4H0E A;  5K7Z A;  2E1O A;  3SJM A;  2MGQ A;  1FC3 A;  2BYV E;  2XAG A;  2UUZ A;  4AM3 A;  2K9M A;  3CCV I;  3RKY A;  1K6Y A;  2KZV A;  1GT0 C;  1QBJ A;  1GVJ A;  5IT9 Z;  3NXC A;  3PNT A;  4I6Z A;  1TQI A;  4BEH A;  1W7P B;  2NVU B;  2B0L A;  5FMP A;  3CQZ J;  1ZRD A;  2ZO4 A;  5E17 F;  2BY1 A;  5GAH J;  5FHP A;  5KAF C;  4MQV A;  3JSO A;  4WF2 A;  3HTH A;  2IW5 A;  3I59 A;  3P5J A;  3PNY A;  5EG0 A;  4HX7 A;  2LH9 A;  1LDD A;  2LVS A;  3NWS A;  3HE0 A;  3TP3 A;  2B7E A;  2YU9 J;  1DU0 A;  2FQ3 A;  3G2B A;  3JCU C;  2ZOZ A;  3NS4 A;  2VPL A;  4D7N A;  4RM2 A;  2MH2 A;  2YSR A;  2KPM A;  2OBP A;  3OYI A;  1W36 C;  3O6B B;  2KMU A;  3T8T A;  2GOM A;  3O60 A;  5CPR B;  4GYI A;  3VUQ A;  5L3C A;  2AQE A;  2W25 A;  2WB1 N;  3CC2 I;  3EDP A;  3FXL A;  4II2 A;  5AIP A;  5L3F A;  3OS0 A;  3M8F A;  3HDD A;  1BOA A;  2OJE D;  1B72 B;  2R5Y B;  1AKH A;  3A03 A;  2YPR A;  3T0Y A;  3OIO A;  1K79 A;  3RZO J;  4I2O A;  2AHQ A;  5K1Y A;  3B02 A;  4HA8 A;  1FYM A;  1F1Z A;  3R6S A;  4BEH B;  2P7V B;  3OYB A;  3HKZ A;  1F5T A;  3HHH A;  5FLX Z;  3E7L A;  2VJ5 A;  2XKO A;  2H6B A;  1W0U A;  3HOX J;  5IT9 K;  1KU7 A;  5DD8 A;  3A0B C;  4CCO A;  3FMQ A;  2UXX A;  2K4B A;  2KZG A;  1XGM A;  2VBX A;  1MMA A;  2PJP A;  2R7X A;  3I59 B;  3K4K A;  4NC8 A;  5EG0 B;  2ZFU A;  2K9Q A;  3QKX A;  2XGC A;  4P55 A;  2CUJ A;  5BOX A;  1K4S A;  4UY8 I;  1EA3 A;  1ZG1 A;  1GV2 A;  1MJB A;  4EM2 A;  2Y48 A;  4R79 A;  5LFA A;  2W82 A;  1G8X A;  1P4A A;  4E6K G;  3NI7 A;  1XB4 A;  2W7N A;  2LMD A;  2WA0 A;  2XAU A;  2LY9 A;  4BJ5 C;  3PAS A;  1JXS A;  2DFH A;  5IYD J;  1PJR A;  3W2A A;  1QQI A;  4BUP A;  2JPC A;  4GRI A;  3WG7 H;  1H0M A;  3I4M J;  1PP7 U;  4YRV A;  2VKH A;  4M6X A;  4CXF A;  1IAW A;  2L2O A;  3DTK A;  2KKO A;  4X6A J;  1VQL I;  4NNJ A;  4I0A A;  3A4C A;  1OR7 C;  3CCY A;  1OR7 A;  3LSG A;  3DBR B;  3A02 A;  3K8P C;  1IRX A;  1UST A;  1YW7 A;  2DFI A;  2EV0 A;  4HZF A;  3RTR A;  4U87 A;  1I39 A;  4ENK A;  1AKH B;  3QQA A;  1T0F C;  4P96 A;  4DZJ A;  3CES A;  1T0F A;  4LK0 F;  1QPM A;  1VQ8 I;  3QPT A;  4HQE A;  5BPD A;  4GGG A;  2CFO A;  4HNT A;  2ZCN A;  1VQ7 I;  5ICE A;  3H0G J;  2RQQ A;  2XAF A;  3DBH B;  2CW7 A;  4XM3 A;  5ILU A;  2HDC A;  3OS1 A;  4IQ4 A;  1A5J A;  3PUB A;  2YVE A;  1X58 A;  3DF8 A;  2GM4 A;  5FLX K;  2BOL A;  1J2X A;  4U88 A;  1DUX C;  4IX7 A;  3QYB A;  4WX9 A;  2L7Z A;  4RBO A;  3HXL A;  2NVT J;  5H2F C;  5EF6 A;  1YTY A;  2CUE A;  5D6F A;  2MC3 A;  2L9S A;  3MZY A;  1CGP A;  3GBG A;  3TED A;  4L9V A;  1I1S A;  2X1D A;  4PFO A;  3H3U A;  2FNA A;  2STW A;  4OAZ A;  3JRG A;  1IG7 A;  2XDN A;  2KDO A;  3I71 A;  3SEZ A;  1YS7 A;  3K10 A;  2MYS A;  3K7A J;  2UZK A;  1XN7 A;  2DMQ A;  2TDX A;  2QSH X;  4A93 J;  1TNT A;  3HIF A;  4WXD A;  2MH9 A;  4E4H A;  5IOZ A;  3CJR B;  3SQN A;  3HBL A;  3EPZ A;  4M3F A;  1ZG5 A;  2HPM A;  1D0Z A;  3ANG A;  1PDN C;  5HBU A;  2P6T A;  1ON2 A;  2ZJP F;  1TQM A;  3CCE I;  4NUB A;  1MD0 A;  3IUV A;  3FKI J;  3KFW X;  2O0Y A;  3IP4 B;  2CG4 A;  5EZG A;  4XQF A;  2K7L A;  4A3I J;  3CC4 I;  2H8R A;  4B48 A;  2O8K A;  2LRD A;  2PI0 A;  2OD5 A;  4B44 A;  2NOJ B;  3JW4 A;  2QIB A;  4ZTJ A;  2KIS A;  2CMP A;  5KHD A;  3CJT B;  4KUM A;  2DG8 A;  2VKE A;  2EK5 A;  2DN0 A;  4HV6 A;  5ICC A;  1SAN A;  2L7K A;  2WAF A;  3Q3S A;  2LKX A;  2A61 A;  2P0W A;  1HQC A;  4HNU A;  3K4M A;  2V9V A;  4CYC A;  3QBM A;  5DCM A;  5CVV A;  2A69 F;  3HC7 A;  2KRF A;  3LA7 A;  1LPQ A;  1FZP B;  3KZ9 A;  3GTJ J;  3K69 A;  4B47 A;  3H1C A;  1DDN A;  1Z91 A;  3F6V A;  4P5O A;  2QLZ A;  5GAD J;  2ZSH B;  2JTV A;  1U0J A;  4RGS A;  3HOV J;  2XB5 A;  2CH0 A;  1X1B A;  5E20 A;  4GDF A;  1UFM A;  2X9D A;  4AC0 A;  4AUX A;  3VYT B;  1SFK A;  2CU7 A;  4BHP A;  1LFB A;  1HDP A;  3Q0V A;  2EFO A;  3WTS C;  1W4M A;  2FQ4 A;  1QHH D;  2CUZ A;  3BLY A;  1YG2 A;  3GWZ A;  3F23 A;  3DKX A;  1B6A A;  3OL3 A;  4I99 C;  3GCM A;  4ESB A;  5JHU A;  1A35 A;  2HR3 A;  3GZI A;  4DW6 A;  2L9V A;  4L9T A;  4QWQ A;  1S72 I;  4GCV A;  4NQW A;  1HF0 A;  4I02 A;  4L5J A;  5TRD A;  2OTJ I;  4O3M A;  1U8B A;  4FT8 A;  3F0C A;  2E7X A;  2M5W A;  4GYG A;  2O7T A;  1V5E A;  4OMY A;  3S1Q J;  1HW1 A;  1TWG J;  1UHM A;  4B4C A;  4A0Z A;  5L3E A;  3LWJ A;  3GYH X;  3C2H A;  2LKS A;  3E7Q A;  3HTS B;  1V55 H;  3I9V 2;  2D45 A;  3DKY A;  3N05 A;  3H9Q A;  5LGT A;  1JT6 A;  2L4A A;  1EV7 A;  1MJA A;  3J80 Z;  2X0L A;  1BIA A;  2R7T A;  2L7F P;  2FRH A;  2HYG D;  4LGW A;  3H5R A;  3BR5 A;  3DXJ F;  3HEF A;  3KP4 A;  5KCM A;  5F0H A;  3BQZ A;  3M9A A;  4M3D A;  3B81 A;  4CYC B;  3HSF A;  5DCM B;  3GTM J;  2F4M B;  5B1A H;  3WU2 C;  3IUO A;  3CJN A;  3MCZ A;  2XRN A;  2VQL A;  4DOZ A;  3HTJ A;  4CSW A;  3FIW A;  3EQL F;  3K70 C;  5M3F J;  1IV6 A;  3V6G A;  1GHC A;  1STZ A;  3HRU A;  1FPQ A;  1KZH A;  3JRE A;  2RGV A;  1JGG A;  1I50 J;  2LOO A;  2X51 A;  1MMD A;  3MVP A;  4HLY A;  4XIC A;  3LSJ A;  2RN7 A;  3CMY A;  1EH8 A;  3W2V A;  5IP7 J;  1PVE A;  1NK3 P;  2IBD A;  4AWX B;  1LFU P;  1R49 A;  4KNY A;  4BQO A;  3K4N A;  3I56 I;  1GXP A;  4XK4 A;  1XDS A;  3M07 A;  3WTZ A;  1BA5 A;  3K0L A;  2FMY A;  3SFZ A;  2JA5 J;  4NQW B;  3LAP A;  4E7I A;  1X1A A;  1YW8 A;  4JBA A;  4B43 A;  1T8I A;  4BBS J;  3K4L A;  1ZGW A;  3HGG A;  2COM A;  1GUU A;  1TT0 A;  2H8W A;  4NC7 A;  5HAW A;  2D5V A;  2QKO A;  2O9L A;  1IRZ A;  2X85 A;  3CC7 I;  3IRQ A;  1O3R A;  2LBF A;  2GIZ A;  3JSP A;  3T6N A;  1Z0X A;  1RR7 A;  2QA4 I;  2FOW A;  4BQA A;  4NEL A;  2A6H F;  3KNW A;  3I3L A;  4HQM A;  3J80 K;  3OYH A;  1A04 A;  4EQQ A;  3IL2 A;  4HKU A;  2FEZ A;  2MFZ A;  4LMY A;  2Q24 A;  3IKT A;  2ZB9 A;  4DVY P;  3J7A Y;  4DYR A;  2AS5 F;  3I55 I;  4A3D J;  1KGS A;  1PP8 F;  1R6R A;  5E79 C;  5J40 A;  5ILS A;  4MTD A;  2ECB A;  2DA1 A;  3U1K A;  1MBF A;  3CUQ C;  2W85 A;  3OIQ A;  2NS7 A;  4KN7 X;  4BDZ A;  3CUQ A;  5FKO A;  1SD4 A;  3BOQ A;  1G3W A;  3BY6 A;  5BMZ A;  4HOB A;  4BHB A;  5FD5 A;  2CRG A;  3GZ5 A;  2VE8 A;  2XB0 X;  2CGP A;  1WJC A;  1XX5 A;  1J5Y A;  4QPQ A;  1IN5 A;  4OIR F;  1T38 A;  2Y9Y A;  3BHQ A;  1OCP A;  2VBY A;  1Y39 A;  5HS9 A;  9ANT A;  3U21 A;  1SVL A;  5B5E C;  4ASN A;  1MSE C;  2DCE A;  1POG A;  4RB1 A;  4HX4 A;  3K6G A;  1KU2 A;  1RPW A;  2V1D A;  4N0B A;  3HPH A;  4C2M J;  4AIJ A;  4Y4R A;  4B1R A;  2RRE A;  3LSR A;  3GTQ J;  1TTY A;  1YX3 A;  3M4O J;  2M30 A;  4OD5 A;  1AOY A;  1IXR C;  2VJJ A;  4I7H A;  4XOP A;  2W1O A;  4WXC A;  4KIC A;  2G7U A;  3CCR I;  4MHG A;  1X1D A;  3OY9 A;  2X48 A;  3IH3 A;  3LNQ A;  1BC8 C;  2L7M P;  4ZYH A;  2LBF B;  2NP5 A;  1IW7 F;  1U3E M;  4WIB A;  3K2Z A;  4BL0 B;  5E1X A;  2Z2S B;  3PFY A;  2CWE A;  3RDI A;  2ID6 A;  1BBY A;  4A3E J;  1SAX A;  3ONQ A;  3DTI A;  2W48 A;  2D1V A;  5DYM A;  5CQG A;  1L3L A;  3GTL J;  3SEQ A;  1TC3 C;  5DAJ A;  3R61 A;  2L54 A;  1FP2 A;  5FGM A;  3BQY A;  1QO0 D;  4U0Y A;  2AXL A;  1SMT A;  2IEK A;  4IHV A;  4B3X A;  1BJZ A;  2R7U A;  1ON1 A;  3HRS A;  2GQQ A;  1W1W E;  4G7O F;  2IS2 A;  3DPJ A;  3CUQ B;  1WHU A;  3KP6 A;  4BGD A;  3AG1 H;  4ENN A;  4LK1 F;  3BTC A;  4MIM A;  2V1U A;  1IJW C;  5L3G A;  1R4N B;  3BPX A;  4BDY A;  1N77 A;  2VJ4 A;  3ZGK A;  4CA0 A;  5JR3 A;  5ERI A;  4U9L A;  1HBX G;  3GLX A;  5EEH A;  3SHF A;  2XPW A;  3FBI B;  5D4R A;  2L02 A;  2NS8 A;  3JRH A;  1X1C A;  5D5X B;  3MKZ A;  1S8N A;  4LIU A;  4D9J A;  3GEZ A;  2WGB A;  2GA2 A;  2GXA A;  4KFC A;  4A6E A;  2Z99 A;  4AVZ A;  4XLC A;  2BW3 A;  2DQL A;  1O7F A;  3FDY A;  1YFH A;  1BIB A;  2EIN H;  3SYT A;  1S29 A;  1MW7 A;  2DLL A;  3FF5 A;  4S04 A;  4EM1 A;  3FXQ A;  1YS6 A;  3NQO A;  5EEA A;  1JUP A;  1SFO J;  4L18 B;  3BRU A;  2DYS H;  2VUM J;  5JHF A;  3BR3 A;  3OSG A;  1BR4 A;  3PQK A;  4K2E A;  3VFZ A;  2JUC A;  3BG6 A;  1OCT C;  2WY8 Q;  2Z3Y A;  2MA3 A;  5J47 A;  1B4A A;  1ZKG A;  4FE4 A;  5L3B A;  1XGO A;  2MC4 A;  4M71 A;  4YFK F;  2XGD A;  2G7H A;  1U78 A;  1XCB A;  4HF2 A;  1JUM A;  1UG2 A;  1BN5 A;  3GLL A;  4G8X A;  2EWN A;  3FHN A;  4UVC A;  1UAA A;  2FU4 A;  1J0R A;  4PFP A;  2W53 A;  2DA3 A;  3KKC A;  2D2W A;  2OV7 A;  1IGN A;  1JKQ C;  2K02 A;  3GTK J;  4A3B J;  4XNF A;  1Y56 A;  1G3Y A;  2EBI A;  2ACJ A;  2JMW A;  2H1L A;  2KJC A;  2HQA A;  5LGN A;  4ESJ A;  2W24 A;  3S14 J;  2CFX A;  1Y8R B;  2JRM A;  3E3V A;  4IJA A;  3PSI A;  1HCR A;  4HV5 A;  1QU3 A;  5KK1 A;  2L9N A;  2KQR A;  2ZXH A;  4RGR A;  1WJE A;  5D8L B;  2ETH A;  5CLS A;  1FEX A;  1R5G A;  2DQR A;  2DT6 A;  4XON A;  2B63 J;  3UKG A;  2I5U A;  4L0Y B;  1RET A;  3QPH A;  4RB0 A;  4BQN A;  3LQQ A;  2BW3 B;  1K7A A;  4U7B A;  4IL6 C;  3RPQ A;  3KP5 A;  3J7Y J;  3MKY B;  1R5H A;  1JT0 A;  3HUG A;  4ZYE A;  3BZC A;  3GME A;  3KX2 A;  3Q9V A;  3QOE A;  2H94 A;  5LLQ A;  5D5U B;  5D5W B;  3MNL A;  2DOA A;  3TO6 A;  1WPK A;  1ZAO A;  1J75 A;  2ZCX A;  2R7Z J;  4AYB A;  5J6X A;  2CYY A;  1OPC A;  1Z21 A;  5F0C A;  4E7J A;  2K9S A;  2R3S A;  3JTG A;  4ANJ A;  1XSD A;  1F4K A;  1O3S A;  2V57 A;  1YI2 I;  1WKM A;  4NBQ A;  3WG9 A;  2DAO A;  2FBK A;  4YII A;  1I1G A;  1S5L C;  2HNH A;  1J59 A;  1V5F A;  1UI5 A;  3QRF F;  3RKW A;  3ELK A;  1SVM A;  2AXT C;  4DJA A;  3LSI A;  1RZ4 A;  3B6C A;  3G71 I;  4D0P A;  4GFB A;  4HYE A;  3DPL C;  2BXY A;  5DDG A;  4ZDL A;  5KNL A;  2VT2 A;  1T95 A;  1YJW I;  3FRQ A;  1R5I D;  3OR1 C;  2A6T A;  3ULQ B;  1RKW A;  4KT5 C;  4JNN A;  3P9I A;  2RNG A;  3BDD A;  4DNC A;  4YFN F;  4CCK A;  3I4N J;  4PJJ A;  5HDK A;  2ISY A;  2HTJ A;  2PMZ A;  2EJR A;  4IKF A;  3TO7 A;  4W97 A;  2DJN A;  3IKV A;  2G7G A;  1UCR A;  4LIT A;  3FWE A;  5CJ9 A;  1AWC A;  1VQK I;  2R7O A;  3GEU A;  1FBS A;  4V2G A;  2QEN A;  5FB2 A;  3L2V A;  1K4T A;  2MLK A;  4X0G A;  4V2F A;  2GXG A;  3HUG B;  1R7J A;  2FML A;  2JZY A;  2P8T A;  3S2D J;  3I58 A;  1JTY A;  2HKX A;  4FIS A;  4XKB A;  6PAX A;  2DA2 A;  4JOM A;  5CKT A;  4G6T B;  1VQ6 I;  2EV5 A;  5E8G A;  5IYC J;  2WWY A;  5C4X J;  1HW2 A;  1WJB A;  3ABM H;  2OZU A;  2XAS A;  2H6C A;  4UV8 A;  2M34 A;  4KN4 X;  3VSK A;  5E1W A;  4EVI A;  3ZMT A;  3WOD F;  4A0X A;  2EIJ H;  1YW9 A;  5KVR A;  1ZGA A;  2ZSI B;  3EUK L;  4BU2 A;  1SFE A;  2RDP A;  4RMN A;  3ABK H;  4IOC F;  5M5X J;  2Z33 A;  2GLO A;  3VSL A;  4GCL A;  2B3W A;  4OU0 A;  3P9K A;  3OYM A;  2M7B A;  4LG3 A;  3OMY A;  2QKL B;  1VTN C;  2O61 A;  2FJI 1;  2Z5U A;  2D1H A;  3FXO A;  1E3H A;  2HKU A;  1P6R A;  1ETW A;  3TOB A;  2LTP A;  1MBG A;  3EET A;  3WU0 A;  2X1C A;  3PSF A;  2M0M A;  3PFI A;  1TWH J;  4XSZ F;  1G2H A;  3BRO A;  5EZH A;  3S3M A;  4XOT A;  3WTV C;  2PX9 A;  2RV8 A;  3CO6 C;  2PBX A;  5TJJ A;  3S1N J;  5DV5 A;  2JUG A;  1TL8 A;  2EH3 A;  1OKR A;  3CDL A;  4PGG A;  3G56 A;  4IHS A;  4BQQ A;  3BCB A;  4BE1 A;  4BY1 J;  2DG7 A;  2XSJ C;  2V1X A;  3ZMU A;  1TWA J;  3RH2 A;  2WV1 A;  2CV1 A;  4G6D A;  1T08 B;  3PO2 J;  2ZCM A;  2KFD A;  2PEX A;  2WBM A;  3G73 A;  1RIO H;  1SVO A;  1BI0 A;  4V19 K;  4A3G J;  3IC7 A;  5F1J A;  4AIH A;  4IRV A;  2VB6 A;  4J01 A;  3QWL A;  4XLH A;  3V78 A;  2MLG A;  4FX4 A;  3M3Y J;  1BJA A;  1TW3 A;  3OYL A;  3JRA A;  1KON A;  1TZL A;  2M8G X;  3BJO A;  3NPI A;  2EPF A;  4BE2 A;  4ITV A;  4LB5 A;  3S17 J;  2OAZ A;  3LSM A;  1MIJ A;  2ZME C;  3MN2 A;  3C3W A;  2XF5 A;  2ZME A;  4RAG A;  3ZN0 A;  5LHG A;  2WB1 A;  4Q47 A;  4BBR J;  2V7F A;  1E2X A;  2DOF A;  2CQQ A;  4YIR X;  1ZN2 A;  1B9M A;  2RQP A;  3BR6 A;  5GAG J;  3ERE D;  4YIF A;  3HOW J;  4EM0 B;  3CD6 I;  4G7H F;  1I5Z A;  5HSZ A;  3KPH A;  2HQN A;  2LP0 A;  3HGY A;  4LLL A;  1YO5 C;  3VTI A;  3QAH A;  1QA6 A;  2N8G A;  1ZRE A;  3F6O A;  2BY0 A;  3A2K A;  1R22 A;  3BWG A;  2V9P A;  4ZC3 A;  1X2N A;  2DT7 B;  3RPU D;  2R93 J;  1FSE A;  1LUJ B;  2XAJ A;  1FTT A;  2VC1 A;  4MFE A;  4UNO A;  2QBY A;  4CGR A;  1OCR H;  4PK4 A;  5IP6 A;  3RKX A;  4ME9 A;  1FJL A;  1KU3 A;  3FXR A;  4N9H A;  3F21 A;  3L2Q A;  1SGM A;  3H3Z A;  2OU2 A;  3ECH A;  4CYD A;  3C1D A;  2JWT A;  4RDU A;  3RI4 A;  2WAE A;  1ZR4 A;  3REO A;  3KYL A;  1W7P D;  1X3Z B;  2EFW A;  3U1D A;  3GF2 A;  3ZMD A;  3VVX A;  4OIO F;  2XF6 A;  3SZP A;  3TP0 A;  1S6L A;  1Y1V J;  3E6M A;  3DEW A;  2DPD A;  4PCQ A;  3WGI A;  4XLP F;  4CCJ A;  2E19 A;  2CO5 A;  4KA4 A;  2E2I J;  2QTQ A;  4C2T A;  2J5O A;  2P81 A;  4HF0 A;  1T56 A;  2F5V A;  2ZME B;  4KIG A;  3GO5 A;  3LA2 A;  3LHQ A;  4CCL A;  1WZ2 A;  2R7D A;  2W4S A;  1Z3X A;  3IHU A;  1K6O A;  4MLO A;  3JRD A;  4MTE A;  3VVZ A;  4IRG A;  5F04 A;  3WE2 A;  5FRM A;  3ZOB A;  1VQP I;  1Y8Q B;  3S8P A;  3HTI A;  2IGO A;  2EV6 A;  4UUS A;  1ULY A;  3ZQH A;  2OER A;  1B59 A;  1XMX A;  4IHW A;  4MFD A;  3VYR B;  2KJB A;  2DTZ A;  1WH7 A;  5FJ8 J;  2OC6 A;  5KAI C;  2ZJQ F;  4XSX F;  1UI6 A;  2Z9O A;  4L5I A;  3SDG A;  2P7C B;  2ZNZ A;  2NNN A;  1LDJ A;  3CDI A;  2XIG A;  1Z9C A;  2QBY B;  4EJT A;  4BYY A;  2M9H A;  2F2E A;  3LFU A;  4Y7N J;  3AL0 C;  1F36 A;  2DDB A;  2ZXW H;  3KP7 A;  1MND A;  2CV2 A;  1ZAR A;  1VQM I;  3L09 A;  2XUB A;  3JR9 A;  2CUF A;  1MMN A;  3AQS A;  2PBI A;  3DTE A;  3L7W A;  2X6X A;  3IRR A;  5C4Y A;  5CVU A;  3CCS I;  3A1Y A;  3BTJ A;  4D5C A;  1U6G A;  3BT9 A;  2A5Y B;  4RLF A;  3AG2 H;  2XRO A;  2DU9 A;  2GBY A;  4KIB A;  3H9G A;  4U0W A;  4PDK A;  1RI7 A;  3UR3 C;  2JA7 J;  1NK2 P;  2WV0 A;  3I53 A;  3CME I;  2A5W A;  5B1B H;  2R7F A;  3VW2 A;  4A3M J;  2K40 A;  5J4V A;  3CLQ A;  3RQ4 A;  1FY7 A;  2FD5 A;  2P4W A;  2VQH A;  2XKP A;  4JK1 X;  3K9T A;  4UUT A;  5HDG A;  2HOE A;  2IS6 A;  2DJI A;  3MAJ A;  4JQF A;  1B1B A;  2X4H A;  2NOG A;  4P1W A;  2QQ8 A;  1DGR M;  1QZZ A;  3V8L A;  1MBK A;  1XS9 A;  2IXS A;  1W36 D;  1E17 A;  3NEU A;  4EV0 A;  1IN4 A;  4UUS B;  3FM3 A;  3RSN A;  2KRH A;  1IRG A;  2RHA A;  3DU5 A;  4RAY A;  3KYD B;  1XSV A;  2NS0 A;  1ETO A;  2MG4 A;  3ZMV A;  4XLE A;  2XRL A;  3J7A O;  2NX4 A;  1D8K A;  5C44 J;  2Y0S A;  1ZLK A;  3TDZ C;  3BR2 A;  1NH3 A;  3DCF A;  1N25 A;  2B9S A;  3OYC A;  5B66 C;  2Y2Z A;  2GOX B;  4UXN A;  2FNP A;  5E1Z B;  3DU6 A;  1FIP A;  1X3U A;  3I0T A;  3P7N A;  4IRI A;  1E3P A;  2R7Q A;  3AL0 B;  3IAS 2;  4BS9 A;  3GZ6 A;  3E5Q A;  2EZI A;  3SFI A;  2RC4 A;  4M3E A;  1RUN A;  2MSY A;  1ZG3 A;  3H36 A;  3GTG J;  4EAT A;  3LSP A;  2LY2 A;  3VP5 A;  1X4P A;  4PGH A;  3QOP A;  4LB6 B;  3RJP A;  4WCG A;  1U9O A;  4IXA A;  4JX5 A;  3DLA A;  4IZZ A;  4AC6 A;  2GA1 A;  3ABT A;  3OYG A;  1DGW Y;  2FSW A;  2IRF G;  4XR6 A;  3BJB A;  5DUK A;  1H9T A;  5HNH A;  1WCM J;  2VL8 A;  2V9K A;  5HLT A;  5LD2 C;  4U0V A;  3LJL A;  1O3T A;  4F91 B;  1S9H A;  2P6S A;  4ICH A;  4OOI A;  3OYK A;  2M2E A;  2TCT A;  5FFX A;  5LEJ A;  5L3D A;  3CJD A;  2VPR A;  5JVT A;  3GTO J;  2IGK A;  4BE0 A;  1K61 A;  4IRH A;  1PUE E;  3FXK A;  5CQE A;  2XHK A;  1R36 A;  4HST A;  5HOD A;  3IAM 2;  4Y3O A;  5J1U A;  1TT5 B;  1WQ2 A;  5D4S A;  2P5L C;  3HPG A;  2HXI A;  5E3M A;  4M9Z A;  1MNE A;  3TDU C;  5FLV A;  1VQO I;  3VOK A;  2UXU A;  3DEE A;  1LB2 A;  2E2H J;  4BAC A;  4IHY A;  2G3B A;  1IV8 A;  2BE5 F;  4HLX A;  4UV9 A;  1YE9 A;  3S3N A;  4NDL A;  2KT0 A;  3VVY A;  2VOP A;  3M1E A;  1BI3 A;  4DIQ A;  4DYC A;  2NRA C;  1RR8 C;  2ZJR F;  4B8X A;  3ZQC A;  3ASN H;  4M9S A;  2G9W A;  2JT1 A;  5FKN A;  4IO9 F;  1QVT A;  1IC8 A;  2C6Y A;  2LSO A;  3K1P A;  1QGP A;  2IS4 A;  1QRY A;  4HBL A;  1IXS B;  2XF7 A;  3GFL A;  3TGN A;  2MD5 A;  5BQT A;  1KA8 A;  3BTL A;  4AID A;  2M4K A;  3KYC B;  2YR2 A;  2E5N A;  3V7S A;  4R1H A;  3QPL A;  5J1Y A;  2IJL A;  4OAY A;  4M6Y A;  3Q0W A;  3C18 A;  3CLO A;  5FLM J;  5M5W J;  4PJM A;  3DP7 A;  1I6H J;  3I54 A;  1RES A;  3BJ6 A;  4J19 A;  1W5T A;  5H9T A;  1H9G A;  4WK8 F;  3JRI A;  3HOU J;  2A2F X;  2W84 A;  4HDV A;  4ESF A;  3TQN A;  2VBW A;  5DD4 A;  1JKR C;  1MBE A;  4JP0 A;  2WAQ N;  2NP3 A;  2FE3 A;  3JSJ A;  3HRT A;  3ZQ7 A;  2FBI A;  2LRE A;  2L5Q A;  1Z77 A;  5FRN A;  4FX0 A;  4B3A A;  4CGZ A;  2E2J J;  3JAM Z;  4XLN F;  2IGN A;  4G12 A;  4ZZL A;  1VF9 A;  2I8D A;  2O7O A;  1VI0 A;  3M1C A;  3BG7 A;  3GZN B;  4XMY A;  5CVJ A;  2KL4 A;  2O6G E;  2ESH A;  3LMM A;  1IRF A;  3C2B A;  2EFN A;  4L5E A;  4XL9 A;  1EH6 A;  3CZ6 A;  2M3A A;  3FMR A;  3K2A A;  3OV8 A;  5DTD A;  3H92 A;  2JA8 J;  5FKL A;  3KEO A;  1FLI A;  3WTW C;  4PXI A;  3T8R A;  1QHG A;  1YX5 A;  3DWL E;  3L2C A;  1SC7 A;  2OQR A;  1MH3 A;  5GTH C;  1KQ0 A;  3FKJ A;  1I6X A;  4W1U A;  2M87 A;  1KQ8 A;  2DFF A;  5E18 F;  2DTR A;  3QPS A;  3E0J B;  2HVS A;  2XC7 A;  5A2Q Z;  2F48 A;  1JKP C;  4QSH A;  4G7Z F;  5LHI A;  1ONV A;  5D19 A;  1ZHF A;  2ELJ A;  3W6J B;  2WUI A;  1UMQ A;  1YRN A;  5F0F A;  4HF1 A;  4M3G A;  3P9C A; 
#chains in the Genus database with same CATH homology
 5FKM A;  1Q1V A;  3B6C A;  3ZQF A;  5EG0 B;  3IH4 A;  4GFB A;  5K58 A;  2K9Q A;  3QKX A;  2XGC A;  3BG9 A;  3FRQ A;  2F07 A;  2ECC A;  1RKW A;  1GV2 A;  3TW6 A;  5IOY A;  4JNN A;  2NVX J;  3NI7 A;  1Y1W J;  1MNM C;  2NVY J;  5IPA A;  2LY9 A;  3I4N J;  3PAS A;  5IYD J;  2XPU A;  3I4M J;  4W97 A;  2DJN A;  2MW8 A;  2G7G A;  1S7E A;  3GEU A;  3BG5 A;  2UXO A;  4X6A J;  4V2G A;  4V2F A;  3HB9 A;  3S2D J;  3CCY A;  3LSG A;  1JTY A;  4FIS A;  5DS9 A;  2R0Q C;  3A02 A;  2DA2 A;  3ZQI A;  1AKH B;  2JK3 A;  3QQA A;  2HOA A;  4DZJ A;  4L62 A;  2M0C A;  5IYC J;  1AHD P;  4I76 A;  5C4X J;  2GUH A;  3BNI A;  3EGQ A;  3NAR A;  2H1K A;  3W6V A;  2M34 A;  1BL0 A;  2DMT A;  2ID3 A;  1ZK8 A;  2GEN A;  2ZCN A;  3RQI A;  3H0G J;  4MXM A;  2G0E A;  1A5J A;  2YVE A;  1X2M A;  2X6O A;  1X58 A;  2GM4 A;  5M5X J;  3IV5 A;  4JX6 A;  1YRN B;  4DYQ A;  2GLO A;  5M5Y J;  4GCL A;  2L7Z A;  4RBO A;  3S1M J;  2NVT J;  4JL3 A;  1JJ6 C;  5EF6 A;  2CUE A;  5E3L A;  3ANP A;  2HKU A;  3GBG A;  3TED A;  1ETW A;  2TRT A;  3ZQG A;  2LTP A;  1MBG A;  3JRG A;  3ON4 A;  1IG7 A;  2XDN A;  1B8I A;  4GCK A;  2LFB A;  2R5Z A;  2Y30 A;  5E3O A;  1NTC A;  1TWH J;  1PUF A;  3H3V K;  4NN1 A;  1G2H A;  5EZH A;  3K7A J;  2DMQ A;  4A69 C;  2PBX A;  3S1N J;  4A93 J;  3G56 A;  2CJJ A;  2EH3 A;  3CDL A;  5CW8 A;  2HYT A;  2DA6 A;  3HOY J;  1OFC X;  3D1N I;  4BY1 J;  2DG7 A;  5IOZ A;  1MBJ A;  1TWA J;  3BG3 A;  4M3F A;  3BR0 A;  3HBL A;  3RH2 A;  2YS9 A;  3ANG A;  2WV1 A;  5HBU A;  1H88 C;  3NRG A;  3WHB A;  3OOU A;  3PO2 J;  2ZCM A;  3IUV A;  3RKQ A;  3FKI J;  2FBQ A;  3S1R J;  5EZG A;  1XC5 A;  4A3I J;  2H8R A;  2O8K A;  4A3G J;  3FK7 A;  2HYJ A;  3C07 A;  5F1J A;  2QIB A;  4JKZ A;  1H8A C;  3V78 A;  2DG8 A;  2VKE A;  3M3Y J;  3JRA A;  2M8G X;  2REK A;  3NPI A;  2DN0 A;  2RAS A;  1SAN A;  2LKX A;  3S17 J;  3Q3S A;  1W0T A;  4IHX A;  2EZL A;  5AQC A;  2RAE A;  3MN2 A;  4M3B A;  1OJL A;  3PPB A;  4CYC A;  3QBM A;  4BBR J;  2CQQ A;  3KZ9 A;  1ETK A;  3GTJ J;  3BR6 A;  5CXI A;  4A3K J;  5IYB J;  3JRF A;  1B8I B;  5J1R A;  3HOW J;  2COB A;  2R5Z B;  5HSZ A;  3HOV J;  2XB5 A;  3HTA A;  3PO3 J;  2LP0 A;  4FTH A;  3HGY A;  1PUF B;  1GDT A;  3LOC A;  5EYR A;  2HXO A;  2X9D A;  4AC0 A;  4AUX A;  2G7S A;  2N8G A;  1DU6 A;  2CU7 A;  1LFB A;  1HDP A;  3Q0V A;  3BCG A;  2FQ4 A;  1UHS A;  4IEJ A;  2LK2 A;  2EQR A;  3FK6 A;  1X2N A;  2R93 J;  3G7R A;  1FTT A;  5M3M J;  4MFE A;  3O8G A;  2PMZ N;  4XID A;  3GZI A;  4DW6 A;  4CGR A;  5IP6 A;  4ME9 A;  5K7F A;  5EDN A;  2DMP A;  1HF0 A;  1FJL A;  2LLK A;  1SGM A;  1P7I A;  2LD5 A;  3JRB A;  2JWT A;  4RDU A;  1U8B A;  3F0C A;  1ZR4 A;  2O7T A;  1TWC J;  2OPT A;  2EZK A;  2NVQ J;  3S1Q J;  1U9N A;  1TWG J;  3MKL A;  4B4C A;  4A3F J;  1AU7 A;  2UXP A;  3LWJ A;  3E7Q A;  3OSF A;  3NAU A;  3VVX A;  4C3I J;  1JT6 A;  3TP0 A;  5FGL A;  1Y1V J;  3DEW A;  2L7F P;  2HOT A;  3BR1 A;  2E19 A;  2E2I J;  3EUP A;  3BR5 A;  1MH4 A;  5JLX A;  5F0H A;  3HEF A;  2QTQ A;  4GCT A;  2JJ7 A;  2P81 A;  1T56 A;  3GTP J;  3BQZ A;  2UXH A;  4M3D A;  3B81 A;  4CYC B;  4UDS A;  1D5Y A;  3GTM J;  3LHQ A;  1JKO C;  3G1O A;  3VW0 A;  3HTJ A;  4MLO A;  3FIW A;  5M3F J;  1IV6 A;  3JRD A;  3V6G A;  3AQT A;  5D1R A;  3VVZ A;  5F04 A;  4FE7 A;  2I10 A;  3ZOB A;  4JYK A;  4UUS A;  3HTI A;  3VW1 A;  1MBH A;  3JRE A;  1JGG A;  3ZQH A;  1I50 J;  2OER A;  3MVP A;  4HNV A;  4XIC A;  3LSJ A;  1XG1 A;  3CMY A;  4IHW A;  4MFD A;  2DA4 A;  5IP7 J;  1NK3 P;  2DTZ A;  1WH7 A;  5FJ8 J;  2IBD A;  3IH2 A;  1LFU P;  1UI6 A;  3PM1 A;  3ON2 A;  3RD3 A;  5J3L A;  3SDG A;  2IU5 A;  3S2H J;  4XK4 A;  3ZQL A;  3RZD J;  1HDD C;  4BY7 J;  2YUS A;  1BA5 A;  4Y52 J;  1ORK A;  4C3J J;  2M9H A;  4Y7N J;  1F36 A;  2JA5 J;  2HQ5 A;  5EGO A;  4BBS J;  2VKV A;  1ZGW A;  3HGG A;  3JR9 A;  2CUF A;  2IAI A;  2K9N A;  3AQS A;  1GUU A;  3WHC A;  2ME6 A;  5HAW A;  2D5V A;  1BW5 A;  2QKO A;  3NNR A;  1E3O C;  1K83 J;  2O9L A;  1IRZ A;  4GFL A;  5C4Y A;  4D5C A;  3BTJ A;  3S16 J;  3BT9 A;  3L1P A;  2HI3 A;  1BW6 A;  3T6N A;  1Z0X A;  1ETY A;  1RR7 A;  2GBY A;  4A3J J;  3G1M A;  3G1L A;  1HLV A;  4NEL A;  2DMU A;  2JA7 J;  4JX4 A;  3KNW A;  4BKX A;  1WGX A;  2GFN A;  1NK2 P;  5C4J J;  3VW2 A;  5IP9 J;  4A3M J;  2JN6 A;  1EF4 A;  4D5F A;  4GFK A;  2K40 A;  4HKU A;  2Q24 A;  5CXG A;  3VOX A;  2ZB9 A;  2FD5 A;  1H89 C;  1HOM A;  4DYR A;  4A3D J;  4AF5 A;  4UUT A;  4LOC A;  1CQT A;  2XPV A;  4AYB N;  2ECB A;  2DA1 A;  1A6I A;  4A3C J;  1GVD A;  1MBF A;  2NS7 A;  2CQX A;  2NOG A;  4D7M A;  5FKO A;  4EEF G;  1WH5 A;  2R92 J;  1MBK A;  1LE8 A;  2JA6 J;  1XS9 A;  3HKZ N;  1QVU A;  4UUS B;  2CRG A;  3S15 J;  2XB0 X;  2LR8 A;  4MO7 A;  2RHA A;  3S5R A;  1ETO A;  2MG4 A;  2Y9Y A;  2XRL A;  4X1E A;  2NX4 A;  1OCP A;  3BHQ A;  2QOP A;  5C44 J;  9ANT A;  1VFC A;  1WI3 A;  2DMN A;  4QIW N;  1MSE C;  1POG A;  5E3N A;  1IDZ A;  3BR2 A;  3DCF A;  1RPW A;  2Y2Z A;  1ITY A;  3GTQ J;  4C2M J;  2G7L A;  4B1R A;  3LSR A;  1FIP A;  4XRM A;  4MK6 A;  3M4O J;  1QPI A;  5K7H A;  2Y31 A;  2DA7 A;  1ZQ3 P;  3B6A A;  2L0K A;  5F27 A;  2EZI A;  2XSD C;  3HM5 A;  5EGO B;  3SFI A;  1IDY A;  4M3E A;  2YVH A;  2DA5 A;  3CWR A;  2MSY A;  1T33 A;  2QCO A;  2PZ9 A;  3GTG J;  2X48 A;  3IH3 A;  3LNQ A;  3LSP A;  3VP5 A;  1GV5 A;  2L7M P;  2NP5 A;  2D6Y A;  1U9O A;  3HIM A;  4JX5 A;  4AC6 A;  1F43 A;  1ZTR A;  4XRS A;  1P7J A;  2ID6 A;  4A3E J;  3BJB A;  2FJ1 A;  1ETV A;  4YZE A;  4FCY A;  1WCM J;  2W48 A;  4A3L J;  3GTL J;  3LJL A;  1TC3 C;  5DAJ A;  4ICH A;  4IHV A;  3BQY A;  2M2E A;  3A01 A;  2IEK A;  2TCT A;  1BJZ A;  5BNG A;  3CJD A;  2VPR A;  1JUS A;  2Y9Z A;  4QTR A;  3DPJ A;  3GTO J;  4C3H J;  4KWA A;  1I3Q J;  1K61 A;  3O8H A;  3BTI A;  1FIA A;  3BTC A;  5GP9 A;  3VPR A;  4XRS G;  1LE8 B;  4MIM A;  1IJW C;  2FX0 A;  5HOD A;  1TWF J;  2OF7 A;  5J1U A;  3P9T A;  4BXX J;  4DZP A;  1ETQ A;  2XPW A;  5E3M A;  2HXI A;  2ME0 A;  2NS8 A;  3JRH A;  3KKD A;  5FKK A;  5FLV A;  3VOK A;  2UXU A;  1IUF A;  2ZOY A;  2WGB A;  5C3E J;  1JJ8 C;  2E2H J;  1VND A;  4IHY A;  2HOS A;  2G3B A;  2UXI A;  4M6V A;  2KDZ A;  1APL C;  4NDL A;  2KT0 A;  3COL A;  3VVY A;  4DYC A;  2L9R A;  1B72 A;  1FTZ A;  1RKT A;  5EEA A;  1JUP A;  3Q0U A;  2R5Y A;  1SFO J;  3ZQC A;  5K7Z A;  2HDD A;  2E1O A;  3SJM A;  2MGQ A;  2VUM J;  3BRU A;  2AO9 A;  3BR3 A;  3OSG A;  4ABZ A;  1ETX A;  1GT0 C;  2EZH A;  3FIS A;  5FKN A;  5JLW A;  1QVT A;  1IC8 A;  1OCT C;  5EFY A;  2ELK A;  1QRY A;  3NXC A;  1ZKG A;  4FE4 A;  4I6Z A;  3BTL A;  5GPA A;  2XGD A;  1U78 A;  1JUM A;  5FMP A;  3CQZ J;  1UG2 A;  3QPL A;  5J1Y A;  4S0H B;  3Q0W A;  5FHP A;  3A01 B;  5FLM J;  5M5W J;  1I6H J;  2W53 A;  3HTH A;  2DA3 A;  5D18 A;  1RES A;  3KKC A;  5EG0 A;  1IGN A;  1JKQ C;  4J19 A;  1ZR2 A;  2LVS A;  3GTK J;  2VI6 A;  3TW7 A;  4A3B J;  2OI8 A;  3JRI A;  3HOU J;  2EBI A;  3TP3 A;  3HE0 A;  2JMW A;  5H9T A;  2YU9 J;  1JTX A;  3S14 J;  1DU0 A;  3VIB A;  2ZOZ A;  4D7N A;  3HOZ J;  1JKR C;  1HCR A;  1MBE A;  4JP0 A;  2WAQ N;  2NP3 A;  3JSJ A;  3F1B A;  3O60 A;  1Z77 A;  1ENH A;  1FEX A;  4B3A A;  3VUQ A;  2B63 J;  2E2J J;  3UKG A;  1RET A;  3CRJ A;  4G12 A;  1VF9 A;  2O7O A;  2WB1 N;  1VI0 A;  1JT0 A;  2Y0S N;  3C2B A;  3HDD A;  4L5E A;  1B72 B;  3MNL A;  2R5Y B;  1WPK A;  3K2A A;  3A03 A;  1AKH A;  2QF7 A;  3OIO A;  1R9T J;  5DTD A;  1MSF C;  2R7Z J;  2ZCX A;  2JA8 J;  5FKL A;  3RZO J;  2QWT A;  4PXI A;  2AHQ A;  5F0C A;  2K9S A;  3JRC A;  1MH3 A;  4W1U A;  2XGE A;  3QPS A;  2V57 A;  3E7L A;  1W0U A;  3HOX J;  1JKP C;  4ACI A;  4QSH A;  5GPC A;  5F08 A;  1O4X A;  5D19 A;  2WUI A;  1UMQ A;  1YRN A;  5F0F A;  1UI5 A;  4M3G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...