4XK4A

E. coli transcriptional regulator rutr with dihydrouracil
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
196
structure length
196
Chain Sequence
SAKKKAILSAALDTFSQFGFHGTRLEQIAELAGVSKTNLLYYFPSKEALYIAVLRQILDIWLAPLKAFREDFAPLAAIKEYIRLKLEVSRDYPQASRLFCMEMLAGAPLLMDELTGDLKALIDEKSALIAGWVKSGKLAPIDPQHLIFMIWASTQHYADFAPQVEAVTGATLRDEVFFNQTVENVQRIIIEGIRPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title E. COLI TRANSCRIPTIONAL REGULATOR RUTR WITH DIHYDROURACIL
rcsb
source organism Escherichia coli (strain k12)
molecule tags Transcription regulator
molecule keywords HTH-type transcriptional regulator RutR
total genus 78
structure length 196
sequence length 196
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08362 TetR_C_3 YcdC-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4xk4A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 4xk4A02
1Y1VJ 3ZQCA 3H0GJ 3BTIA 2R5ZB 3NXCA 3AQTA 5D18A 3K2AA 4Y7NJ 5FJ8J 1U8BA 2M34A 3BR3A 4MK6A 2UXPA 2REKA 2NP3A 1GVDA 1EF4A 3JSJA 2HOAA 5EF6A 3RH2A 3G56A 2JWTA 1I3QJ 2L7ZA 3A02A 3GBGA 3QPSA 5K58A 1MBFA 2TRTA 2DA5A 2G7SA 5FGLA 5K7HA 5FLVA 1AKHA 4JL3A 2LLKA 2LP0A 4XRMA 1HLVA 5F27A 3BNIA 3NRGA 1TWCJ 1MSEC 4ME9A 5E3MA 4X1EA 5EG0A 5C4JJ 4DYRA 4UUSA 2OPTA 2XSDC 3JRHA 2HYTA 1Z0XA 3CWRA 2R5YB 2HI3A 4GFKA 2P81A 3BG5A 5M5YJ 3KZ9A 2NS8A 3OSGA 4UUTA 3CQZJ 3HE0A 2OI8A 5E3OA 3HOYJ 5F0FA 1BW5A 4YZEA 2W48A 2RASA 1BJZA 3DPJA 1ETQA 2FBQA 1IC8A 2JJ7A 3FIWA 3HOZJ 3ZQHA 3V78A 2DMUA 2IBDA 1BA5A 4IHXA 3JRGA 3HGGA 2E2IJ 2EH3A 1RETA 1TWFJ 1U9NA 2JN6A 1E3OC 3HIMA 3TP3A 1XC5A 4AC6A 2HXIA 2RAEA 3SDGA 4A3IJ 2FD5A 4GFBA 4A3MJ 5K7ZA 2YVEA 3AQSA 4JNNA 4MIMA 1NK2P 2HXOA 3LSJA 2R0QC 2DMPA 1QPIA 2G7GA 3ANGA 3HKZN 2V57A 2QKOA 1BL0A 3HTHA 3IUVA 4B4CA 3HOWJ 3S1QJ 3BTJA 3GTJJ 3UKGA 2CUFA 2R7ZJ 2NVYJ 2XPVA 5IP6A 2W53A 3NARA 4BXXJ 4FTHA 4BY7J 1JTYA 1X58A 1OFCX 4FE7A 4M6VA 3LJLA 4CGRA 3ZQFA 4L5EA 1MH3A 3HTIA 3FISA 4XRSG 4A69C 2N8GA 1R9TJ 1Q1VA 3O8HA 1LE8A 1ZQ3P 3LHQA 1OCTC 3KKCA 2JMWA 4DW6A 2LD5A 3SFIA 3TW6A 3B81A 1JT6A 4JX5A 4DZPA 1JKOC 2QOPA 1GV5A 3WHBA 3ON2A 1X2MA 1ZGWA 1IDZA 3VPRA 3BR0A 3CJDA 5GP9A 3CDLA 3D1NI 5IYBJ 5IYDJ 2MGQA 3EUPA 3NNRA 2M9HA 2FJ1A 4IHYA 2D6YA 3JRFA 4ABZA 2HKUA 2WV1A 1K83J 3BR6A 2CRGA 5F08A 3ANPA 4HKUA 1SANA 2XB5A 2VUMJ 3VW1A 2DTZA 1JTXA 2L9RA 3L1PA 2G3BA 3QBMA 3OOUA 4MFEA 3VVXA 5J3LA 2DA6A 2ZCMA 2DMTA 4C3JJ 5HBUA 2PMZN 3S5RA 4C3IJ 4FE4A 1X2NA 1DU0A 2PBXA 3W6VA 2EZKA 1UHSA 3LSGA 4QTRA 3PO2J 2DG7A 5CW8A 4DYQA 2O7OA 5F0HA 1ZKGA 1HDDC 5EGOB 3FKIJ 2G7LA 1WI3A 2R5ZA 1JKPC 4A93J 1ORKA 4KWAA 2LK2A 3RD3A 3V6GA 5D19A 2Y30A 1T33A 4XK4A 1ZK8A 4M3DA 1QVUA 3BQYA 2YU9J 3NAUA 5GPAA 2YVHA 2FX0A 1JUPA 1U9OA 2DA7A 4LOCA 2CQXA 4G12A 2WB1N 2X48A 2FQ4A 1Y1WJ 4GFLA 3GTLJ 4GCTA 1DU6A 3BCGA 5IOYA 3G7RA 4BBSJ 3HTJA 2CQQA 1FTTA 2X6OA 3TP0A 3ZQLA 4RDUA 3JRAA 4V2GA 2JA6J 3QQAA 2H8RA 5HAWA 1FTZA 4CYCA 1ZTRA 5IP9J 5EZHA 2IEKA 2ZOZA 5GPCA 1WGXA 1IRZA 2XDNA 4C2MJ 2E1OA 2R93J 4NN1A 1IJWC 3F0CA 1PUFB 1APLC 3HM5A 4MO7A 3Q0WA 3GTQJ 5EYRA 5JLXA 4A3EJ 5HODA 2VKEA 1FIAA 2EZIA 2MSYA 1NK3P 2EZHA 3Q3SA 2JK3A 3BRUA 3VP5A 2AHQA 3LWJA 2EBIA 2Y0SN 4V2FA 3LSRA 3BR2A 3HOVJ 3NPIA 4M3BA 2NVTJ 2K9SA 4JYKA 4MFDA 4M3EA 2O7TA 3H3VK 1GT0C 4D7NA 1ETXA 1VFCA 3Q0UA 5IYCJ 1HOMA 3OSFA 1GUUA 3GTPJ 1HCRA 2NVXJ 3VOXA 1G2HA 3FK7A 3C2BA 3VOKA 1GDTA 4FISA 1VNDA 3ZOBA 4B3AA 1I50J 1AU7A 2ME6A 2HQ5A 1RKWA 5FKOA 5M5XJ 3HTAA 1QVTA 3GTOJ 2WGBA 3BJBA 1POGA 2ID6A 3LOCA 2LFBA 1LFUP 5FHPA 1O4XA 5FMPA 3JRCA 1LE8B 1MBEA 3BG3A 2XPWA 5F04A 3HOXJ 1YRNA 3PASA 5M3MJ 5IP7J 2CUEA 2Y2ZA 4AUXA 3I4NJ 1GV2A 4Y52J 3VUQA 2GFNA 5FKKA 3S16J 2JA7J 1UI5A 3C07A 1ZR4A 1JUMA 1WPKA 2H1KA 4XICA 4A3BJ 5AQCA 1U78A 1H89C 2I10A 3B6CA 5M3FJ 1UI6A 2QCOA 3P9TA 4ACIA 5EDNA 5D1RA 1AKHB 5JLWA 2IU5A 2DA2A 4IEJA 2ZCNA 2VKVA 2DA1A 5EGOA 3HBLA 4MXMA 5EZGA 4W97A 4RBOA 1OJLA 2UXOA 5HSZA 5FKLA 3BT9A 2GBYA 1TWGJ 3CRJA 2L0KA 1HDPA 4D5FA 4FCYA 2M8GX 3GTGJ 4DYCA 1PUFA 9ANTA 1A5JA 2ID3A 2XPUA 4HNVA 3QKXA 4DZJA 3O60A 1CQTA 2JA5J 2OERA 2GLOA 4M3FA 3QPLA 3VW2A 1ZR2A 2XGEA 5J1YA 3GEUA 3RKQA 1IGNA 1RPWA 5FLMJ 2L7MP 3BG9A 3E7QA 2KT0A 4IHWA 3O8GA 5C3EJ 1B72B 2HDDA 3SJMA 4X6AJ 3VVYA 1MBJA 2DJNA 1VI0A 4EEFG 3JR9A 2G0EA 1ETOA 2DMQA 1WH5A 1AHDP 1OCPA 4NDLA 2K40A 2KDZA 4A3JJ 2DN0A 2NP5A 3F1BA 3VW0A 1RR7A 1ENHA 4D7MA 5CXIA 4NELA 3WHCA 1UG2A 1A6IA 2YS9A 3GZIA 2ME0A 4ICHA 3ZQIA 4PXIA 1QRYA 2MG4A 5E3NA 1B8IB 2LTPA 3TEDA 3COLA 4B1RA 2HOTA 1FEXA 4JX4A 1IG7A 4A3FJ 4GCLA 1ETYA 1ETVA 4JP0A 1MBKA 2MW8A 3KKDA 3VVZA 4I76A 1JJ6C 2UXUA 4L62A 2AO9A 3IH4A 2QIBA 1FIPA 3MKLA 3BTCA 1WCMJ 2LVSA 3K7AJ 3PO3J 2R5YA 1JKQC 3A01B 1JKRC 2CJJA 5DS9A 3FRQA 3G1OA 4QSHA 2QF7A 2ZB9A 1JT0A 5FKNA 3HB9A 4W1UA 1ETWA 2CU7A 4M3GA 1MH4A 4XRSA 4A3CJ 3OIOA 2UXIA 3BHQA 3S14J 4UUSB 3S1RJ 2NVQJ 3BR1A 3IH3A 1F43A 4CYCB 1MBHA 1P7JA 1K61A 2K9NA 4AC0A 2GM4A 3BQZA 3LNQA 2E2HJ 2E2JJ 4A3LJ 3KNWA 1WH7A 1Z77A 1D5YA 4UDSA 2XGCA 3MN2A 2HOSA 2LY9A 5J1UA 4BBRJ 3G1MA 3M4OJ 2Q24A 1MSFC 1XG1A 2LR8A 3DEWA 3IH2A 1F36A 2Y9ZA 4S0HB 3PM1A 3CMYA 2DG8A 2F07A 2ECCA 1MBGA 5FKMA 2D5VA 3BR5A 3S2DJ 3MNLA 4MLOA 4BY1J 5CXGA 1NTCA 5M5WJ 4C3HJ 5C44J 2PZ9A 2B63J 1VF9A 2XRLA 1XS9A 2ECBA 1IV6A 4GCKA 5E3LA 4I6ZA 3JRDA 2M0CA 3S1NJ 2XGDA 4JX6A 5EEAA 5EG0B 5K7FA 1HF0A 1IDYA 4QIWN 5IOZA 1JGGA 3GTMJ 3HDDA 5F0CA 2YUSA 2DMNA 3JRBA 1TC3C 3M3YJ 3VIBA 2COBA 2K9QA 2Y31A 1IUFA 2ZCXA 2EZLA 5EFYA 3A01A 2VI6A 1H88C 1JUSA 2OF7A 3MVPA 3FK6A 5BNGA 2DA3A 3EGQA 2O9LA 1SFOJ 1T56A 2HYJA 2M2EA 5C4YA 3NI7A 4A3KJ 2Y9YA 2VPRA 3CCYA 2WAQN 3JRIA 4A3GJ 5F1JA 1H8AC 4AF5A 3S15J 1ITYA 3A03A 3HOUJ 3E7LA 3G1LA 2O8KA 2LKXA 3DCFA 4BKXA 3GTKJ 1W0TA 3HEFA 3RQIA 4D5CA 1ETKA 3I4MJ 2GENA 1TWAJ 3B6AA 4A3DJ 1W0UA 1TWHJ 1S7EA 3JREA 3RZDJ 5IPAA 1RKTA 5DTDA 3S1MJ 3BTLA 2EQRA 2NX4A 4XIDA 3LSPA 4J19A 2NS7A 2ZOYA 1BW6A 1MNMC 2GUHA 1P7IA 2UXHA 5DAJA 4IHVA 3ON4A 2QWTA 1YRNB 1B72A 2NOGA 4AYBN 3S17J 1UMQA 2DA4A 3RZOJ 3TW7A 2IAIA 4JKZA 2ELKA 2XB0X 3Q0VA 3HGYA 2JA8J 2TCTA 2L7FP 1I6HJ 1JJ8C 2WUIA 1RESA 2X9DA 3ZQGA 5C4XJ 3T6NA 5H9TA 3PPBA 5J1RA 2E19A 3IV5A 1LFBA 3S2HJ 1B8IA 1SGMA 2RHAA 2QTQA 1FJLA 2R92J
chains in the Genus database with same CATH superfamily
2V7FA 3DLLF 3TO7A 3H0GJ 1LNWA 3BZKA 4PGHA 1BIBA 2JSCA 5FO5A 1YOVB 4BJ6C 4Y7NJ 3IKTA 3HTJA 1U8BA 2XSJC 4ZZDA 2PJRA 1GVDA 1KYWA 5ED4A 1EF4A 2EJRA 2F5FA 2MYSA 3ML6A 5DM6F 1YFHA 3G56A 4IRVA 2JWTA 2WB1A 4I02A 4LJZF 4BUPA 2L7ZA 4OIPF 3GBGA 1GXPA 3J81Z 1R1TA 5K58A 2TRTA 1LDJA 5CQGA 5FLVA 4Y4RA 2LLKA 2VQHA 4XRMA 3DU5A 3BNIA 5C4JJ 4M6YA 4UUSA 2XSDC 1G3SA 2QBYA 1LJ9A 1UG0A 2MLGA 3CWRA 2R5YB 3I54A 3CF5F 1KU7A 1IN6A 3HRTA 2JTVA 4F52A 2L4AA 4CCKA 3HOYJ 2GA2A 1FLIA 2BVMA 1BJZA 2EK5A 2V1DA 4BE1A 2FBQA 1IC8A 3U1DA 1ZRCA 1UAAA 2IBDA 4U0VA 4NBQA 4KDPA 2CUJA 4IHXA 3JRGA 2XAFA 4Y15A 2M30A 1U5TB 2EH3A 2Z5UA 1RETA 1U9NA 2JN6A 3KZYA 4HW0A 2VBYA 3TP3A 1HW1A 2GIVA 4EMSA 4P96A 4HX7A 2HQAA 4GFBA 3O3KA 4A3MJ 1HC8A 2KJCA 5K7ZA 3E6MA 4MIMA 1NK2P 2HXOA 3LSJA 1T08B 2DMPA 2HDCA 2XF5A 1FOXA 5D4SA 3IUVA 2FEZA 4HAMA 2ZXIA 2R7ZJ 5IP6A 3NARA 4BY7J 3DFGA 3HG9A 1WJDA 3K1PA 2KISA 3T5XA 3PL8A 4JQFA 5GAEJ 4XQFA 3LSKA 3T8TA 4A12A 1I1SA 1QZYA 2KFDA 1MH3A 3ZP5A 2OC6A 3FISA 4KIBA 4A69C 1Q1VA 3O8HA 1OCTC 1YJWI 3KKCA 1Z21A 2L54A 3CP8A 4XKVA 4DW6A 4A0XA 4HDVA 2O3FA 3K9TA 3SFIA 3P5JA 4CDGA 1JT6A 3BZCA 4ZYDA 4JX5A 1JKOC 2QOPA 5GTHC 4IRIA 4WIBA 1BC8C 3ABLH 4ZZLA 3CJDA 3DTEA 1YHQI 1G3WA 2P5KA 2FJ1A 4HV6A 3BLYA 2A6TA 1HKSA 1RUNA 4ABZA 3FBIB 5D6EA 1MKMA 2QQAA 1YYVA 3ANPA 5BS6A 2HR3A 2QGUA 4HKUA 4ZYGA 3HPGA 2ESHA 2L9RA 4B44A 3OOUA 4WWCA 4KYWA 3K4MA 4AVZA 2DA6A 1IRXA 2E1MB 2ZCMA 3NWTA 3CUQC 3H3UA 4C2TA 5HBUA 5CVUA 2X6WA 3DBRB 4YIIA 2PMZN 3S5RA 3E97A 3HSFA 3WTYC 3TDUC 1D0XA 5E18F 4QTRA 3KX2A 2PBIA 1RIOH 2FMYA 3FKIJ 2R5ZA 3WTZA 4A93J 2GWRA 4AM3A 4M9ZA 2XKOA 4OD4A 2XVCA 5D5VB 4XSZF 1ZREA 5D19A 4BL0B 5CKTA 2ETHA 3CO7C 3OS0A 2DXIA 2LBFB 3F22A 4P55A 2M5WA 2RREA 3I5UA 2YVHA 3M1EA 2NNYA 4AWXB 2NXNB 3CCMI 1J59A 1JUPA 1U9OA 2OU2A 2WAQA 2HU9A 2HPMA 4LOCA 1OYWA 2CGPA 1S5LC 3ECOA 2CQXA 5K5RA 4KT6A 4G12A 4BYYA 1D8KA 2ZJ2A 2X48A 1BI3A 3MKYB 3AL0B 2HYFA 4GFLA 2R7VA 3CMEI 2Z33A 4XL9A 3PSFA 2HNHA 4NC7A 3JRAA 4JBAA 3JTGA 1IUYA 2VJIA 3OIPA 3ABKH 4HEA2 3HRUA 4E7ZA 4H0EA 1FTZA 4BS9A 4OINF 2GXGA 4OIRF 2HTJA 4NC6A 4E6KG 1WGXA 3V7RA 1IRZA 2UXNA 2R93J 2NAZA 1IJWC 3RDIA 1PUFB 1APLC 4LK1F 2RC4A 3HM5A 5LHGA 5D5WB 3Q0WA 2F4MB 3FXMA 5JLXA 1VZ0A 1ON1A 2VKEA 4L18B 4HV5A 1LFPA 2FUG2 2IVMA 2AHQA 1Y6IA 5AIPA 1R1UA 4HBLA 3V8KA 4V2FA 1GLNA 3AFHA 3FMQA 2YX4A 3DBLB 3M8JA 4MFDA 2XV4S 4Q5SF 3U1KA 3J7AY 2HQRA 1S29A 4CICA 1S7AA 2A07F 2NVXJ 2XROA 2BW3A 3C2BA 1MZBA 3CD6I 3ZOBA 1I50J 4HQMA 3K4BA 3F8FA 4CZCA 4G94A 5FKOA 4II3A 1Q1HA 1XGNA 3TGNA 3HTAA 2M7AA 3P9CA 3K10A 2JVHA 5H6QA 2WGBA 1POGA 3LMMA 2FBHA 4KN7X 1O4XA 1J9IA 1SD7A 5FMPA 2DTRA 1ZG5A 2B3WA 5F04A 1B9NA 2IGNA 3ECHA 1O3QA 3I4NJ 3KP5A 1LKXA 1VQKI 1FOWA 1MJ9A 5KAIC 5GAHJ 1BOAA 4PJMA 2DFIA 2QKMB 2V6EA 1JUMA 2H1KA 3OR2C 4OWRB 2K85A 1MNEA 2I10A 3P9TA 2E5ZA 2QCOA 2ZXWH 3EUKL 4ZDLA 4LIUA 3DPTA 5EDNA 1YTYA 1W36C 4ACIA 5JLWA 3EUAA 1U6GA 2K7LA 2X85A 3QP5A 3E6CC 1XSDA 2WWYA 2PX9A 5EZGA 1PYVA 2HGCA 1Z67A 3FXJA 2UXOA 3H36A 4EM2A 5FKLA 4N4NB 2GBYA 1TWGJ 3CRJA 1BC7C 4ENKA 4RGSA 4XKWA 1LB2A 3SDBA 2E36A 4DYCA 4XLNF 2K86A 3Q9SA 4G9YA 4HNVA 1VQPI 1P4WA 2Q1ZB 2JA5J 2OERA 3DV8A 4IPAA 4A0ZA 2V1XA 3GEUA 5J1YA 1YJNI 1MIJA 4XKBA 2A69F 4RM2A 1FBQA 1RPWA 2I5UA 2BY2A 2M7BA 4ZDPA 3COAC 2ZY9A 4IHWA 1QNTA 2MABA 1B72B 4X6AJ 1Z7LA 3H5NA 1V5GA 2DJNA 3C2GA 3RJPA 3K69A 2JUGA 4EEFG 4DNCA 4B48A 2G0EA 2VE8A 1WKMA 3FM3A 2L4MA 2K40A 3CJNA 2KDZA 2DN0A 5FB2A 3F1BA 2O8XA 1RR7A 1W36D 2EPFA 4BACA 2AS5F 5CXIA 4NELA 3WHCA 2P7CB 4U7DA 2DW4A 4G8XA 3L2WA 3ZQIA 4PXIA 4XKCA 5CPRB 5E3NA 2GIZA 4B1RA 3DPUA 1TL8A 4JX4A 1Z9CA 4G6QA 2F2EA 3CUOA 5HS9A 2XAUA 3BP8A 3VVZA 2MW8A 3N05A 3EUHA 1NG7A 2BY3A 3KIOA 5E1ZB 4F93B 3QRFF 2OTLI 1XMAA 3IH4A 1E3HA 4H4KC 2J5OA 2K02A 4CSWA 3F23A 1N75A 4F92B 5TISC 4IKFA 2LY2A 2IJLA 3EYIA 1NHAA 1T0FA 2CW7A 1R7JA 2CFXA 4N9IA 2R3SA 2PI0A 4A3CJ 1Z91A 4CXFA 1K4SA 1R1VA 4L9VA 2V9PA 4UUSB 1FWZA 5BQTA 1E0EA 3ABMH 4BH9A 1X1BA 4ESBA 4R79A 4OIOF 4AC0A 2XDVA 2LG4A 3ZGKA 2E2HJ 1YIOA 2DOEA 1WH7A 1Z77A 2XGCA 4A5NA 1R23A 2HOSA 5HNFA 4B8XA 1P2FA 4J00A 5CJ9A 1ACIA 2HKOA 3ZMVA 1F36A 4UB8C 3PM1A 5JHFA 1BOBA 4OOIA 3TOAA 2D5VA 1B4AA 2B1EA 3BR5A 4BY1J 2XAQA 5CXGA 5M5WJ 4C3HJ 2GAUA 2ESNA 5C44J 2ZJPF 1U0JA 2PZ9A 4KISA 6PAXA 1VF9A 2NOJB 4GCKA 5FFXA 3S1NJ 5L3DA 5EEAA 5K7FA 3MKZA 2VXDA 2DOAA 1IDYA 4QIWN 2FBKA 5IOZA 4Y3OA 4LITA 3I3LA 3K70C 3HDDA 4RB0A 5F0CA 4UUVA 4PCQA 3PJRA 2JPBA 2MC3A 4OMZA 1YJ9I 2PEXA 4PZJA 3VIBA 2Y31A 3MKWB 4FX0A 2EZLA 4R1HA 1FYKA 5H6RA 4RB2C 3KPHA 5EFYA 3BROA 2VI6A 1H88C 1JUSA 3IRQA 3MVPA 3K4KA 1SAUA 1O3TA 3EGQA 4LLLA 4EQQA 4IRGA 4O6JA 2O9LA 1T56A 4LMYA 3OYBA 4A3KJ 3HRSA 5J4YA 3KP4A 2MH9A 3JRIA 1ZLJA 3KLOA 4HF0A 5L3CA 2H09A 5HLTA 1ITYA 3W2WA 3I64A 3E7LA 1QO0D 2AQEA 2O8KA 3KEYA 3A1YA 2LKXA 3DCFA 2ZSIB 3GLLA 3LAJA 3GTKJ 2FA5A 3HKZA 3OYFA 2DPUA 3G2BA 4F55A 3M9AA 3MZYA 3S3MA 1TWHJ 1W0UA 5LEKA 4KUMA 3PNVA 3VDXA 5DTDA 3S1MJ 2FOKA 2EQRA 3GZ5A 3LSPA 4J19A 1R00A 1S3JA 1BI1A 2ACJA 2XAJA 1EA3A 3WG9A 1P7IA 3ON4A 1LEAA 2NOGA 1W5CC 2LKSA 2ELKA 3Q0VA 3CCUI 2ZFUA 1WJFA 2TCTA 3GW2A 5AONA 2L7FP 2Q2EB 1RESA 3RKXA 1D8JA 3GUDA 3ZQGA 1L3LA 5C4XJ 3J81K 3T6NA 2E19A 2IS4A 2CMPA 3IAS2 2A5YB 3L7WA 3CUQB 3WTTC 3E5QA 2X1EA 1X4PA 3Q9VA 1B8IA 3ZMDA 3CCRI 4RA2A 1K79A 2DK5A 5DYMA 5D8LB 1RNLA 2DT6A 2BE5F 3GZ6A 2JRMA 3ZQCA 3NXCA 4LK0F 3AQTA 5DEQA 3IWZA 3LL7A 1A35A 3LA7A 3BR3A 5DM7F 4MK6A 4LLNA 1XDUA 2D1VA 4XMYA 1D1AA 3T8RA 2V6CA 3C7JA 3QU3A 3V42A 2M4GA 1FY7A 3RH2A 4F91B 1FOKA 2L9SA 3H9JA 3A02A 3ZQQA 2VQGA 3M1CA 2GA1A 1PP7U 5K7HA 2G7SA 1AKHA 5FGLA 5DCMB 2UZKA 4GCVA 5LHIA 1YQAA 5F27A 1IXSB 4DJAA 1TWCJ 1MSEC 1IV8A 2WA0A 4HOBA 4G6TB 2HYTA 2IRFG 1LDKB 2BV6A 5E8IA 4FQGA 1X1CA 2P0WA 2KMUA 2P81A 3D0SA 5M5YJ 1XN7A 4LB5A 2MD0A 3KYCB 1XB4A 4R8HA 1XCVA 4KA4A 2W24A 4EATA 5E3OA 2OBPA 3HSRA 2HS5A 1N78A 5F0FA 2FF4A 4AIDA 4YZEA 1IW7F 1VQMI 2W48A 4Q4ZF 1ETQA 1HQCA 3BDDA 2DAOA 3V78A 1XMXA 1BA5A 2NYXA 3BJOA 1XDSA 2BYVE 1XPXA 3HIMA 1I27A 4NHJA 2O6GE 2LMDA 5HLGA 3FZVA 4AC6A 2X1DA 4HYEA 2HXIA 3SDGA 1LUJB 3AQSA 3NS4A 4RAZA 1RC9A 1G59A 2R0QC 2G7GA 1JGSA 3C1DA 4ZTJA 3DBHB 4ANJA 3BCAA 2V57A 3WU1B 3HTHA 3VYRB 4B4CA 3HOWJ 2G7HA 3FM5A 4BJ5C 3GTJJ 1K6YA 2XPVA 2L7KA 1O3RA 1X58A 2PMUA 4IJAA 4CGRA 4CCJA 3GLXA 3ZCOA 5B66C 4L5EA 3LWFA 1LE8A 1R9TJ 3GMEA 4U9NA 2HZTA 2JMWA 2KZGA 1YITI 3BCBA 4NC8A 4U9LA 2IT0A 5LBQA 1X2MA 1ZGWA 3DQVC 2HZDA 4N9HA 2BHZA 3EUPA 2E35A 2M9HA 3PIOF 4NUBA 2FNPA 2HKUA 5F1RA 1MD0A 2K27A 3K6GA 2CRGA 1E3PA 3GXOA 5E1XA 3K2ZA 2XB5A 4HSTA 4IX7A 4XM3A 3SHFA 1I6XA 2DTZA 3L1PA 1HSJA 4NNJA 2UXXA 2XAGA 5J3LA 4AIHA 3FKJA 4C3JJ 3L2UA 2EILH 1VQ4I 1BN5A 1QGPA 2H6CA 3JSPA 3W6VA 4PJ0C 4QWQA 4RAGA 5CW8A 2O7OA 5F0HA 2QSHX 2CV0A 1HDDC 5EGOB 4HZFA 1JKPC 1ORKA 1E17A 2KL4A 2STTA 2CG4A 3V6GA 2Y30A 3W3CA 3A0BC 1TW2A 4XK4A 4BXFA 1TLHB 4KNYA 2P5VA 1TP4A 5GPAA 3RKWA 3R60A 2R7TA 3FXOA 4BHPA 3KP2A 1VQ8I 4NQWB 1Y56A 3OR1C 3LSTA 1Z3XA 3GFLA 4CUGA 4N0BA 2Z16A 1OYIA 1EH7A 1MMNA 2CSOA 2FQ3A 2O5RA 1GHCA 1U3EM 1FYLA 4YRVA 1PUEE 3LQRA 2X6OA 3ZQLA 4RDUA 3F8MA 1X3ZB 2JA6J 2KDOA 1ZYRF 3KCCA 5IP9J 5EZHA 2IEKA 1UELB 1D3YA 2EV6A 5FRNA 4YFNF 4C2MJ 1S72I 1OCZH 2HVRA 2V26A 2KRCA 2JT1A 2OZ6A 2P7VB 3S32A 4MO7A 4NQWA 3CCQI 2XIGA 3I59B 5EYRA 4A3EJ 1F4KA 3SQNA 3VYSB 2EZIA 1NK3P 2EZHA 3BRUA 3VP5A 1QZZA 3I58A 2Y0SN 1JHFA 2H27A 4KMFA 3LSRA 4A0YA 2YR2A 3HTSB 3D5SC 4WXCA 2PG4A 1T98A 4M3BA 4LG3A 4BGDA 5K1YA 2G7UA 3MQ0A 3E5UA 4M3EA 2O7TA 4B43A 3RYPA 1GT0C 3VFZA 2EA2A 2H8WA 3FXRA 5IYCJ 3OSFA 2VC0A 4UHTA 1RUOA 2PN6A 1G2HA 3FK7A 2DLLA 2W84A 1WQ2A 1OISA 2JVGA 1W7PB 1DQUA 2ME6A 4RGUA 2ZO4A 3J80Z 1L0OC 3H92A 3GCMA 3MD2A 3GTOJ 1SFUA 2ID6A 4WK8F 1DGWY 2QLZA 4KFCA 3EYYA 3KYDB 5ICEA 3OYNA 2MBFA 1T2KA 1MBEA 3BG3A 1D0YA 2XPWA 2R7RA 2PJPA 4CGZA 3ERED 2NNNA 3PASA 5M3MJ 2VKDA 2CUEA 3FXUA 1J75A 4KJZA 2Y2ZA 2P6TA 1GV2A 3TO9A 3TBIA 2GFNA 3VEPA 1YX5A 4WX9A 3KLNA 1G8XA 2E1MC 5EEGA 1ZR4A 4E7KA 3C07A 4BEHB 2VJ4A 5AQCA 1W1WE 3OV8A 3BJAA 1H89C 3OL3A 1REPC 3PUBA 1AKHB 1SVLA 2DA2A 4IEJA 1CGPA 2M8EA 2DA1A 4P9UA 4MXMA 2EB7A 4XLAA 2WAFA 1PDNC 1FT9A 3VYUB 4U87A 3GO5A 5DCFA 1F1ZA 2JPCA 2Q0OA 1SFXA 3CLOA 5J40A 4AD9A 2HEOA 2GQQA 5HS8A 1HDPA 5CVVA 5HVQC 1OCOH 3NRVA 4M6XA 3TKYA 3HIFA 9ANTA 2ID3A 3QOEA 3QKXA 1TW3A 2M0MA 1CQTA 1TNSA 2VC1A 4DGWB 2PLYA 3QPLA 2DODA 2OD5A 2XGEA 4XLPF 2E7XA 2JUCA 3U21A 1IGNA 1K7AA 3ASNH 3SZTA 1X4OA 4CYDA 4V19K 3L2CA 2HDDA 4EJUA 4YG2F 3DEEA 2B9SA 3VVYA 1W4MA 1VI0A 3WE3A 3K70D 2DYSH 3JCUC 1ETOA 4ASNA 1VQ6I 2YX7A 1WH5A 1AHDP 1OCPA 3GF2A 1KONA 3V4GA 2HDWA 4YIRX 2F4OB 3VW0A 4QPQA 4D7MA 1S8NA 3RKYA 5F64A 5J47A 2QENA 2RN7A 4OD5A 2RV8A 2VT2A 3TO6A 3CUQA 4J01A 3GVAA 2GXAA 2F5VA 2V4JC 4GCLA 2LDUA 1ETYA 1Z6RA 1MBKA 1XGOA 1JJ6C 1OMIA 2UXUA 1Y0NA 1YS6A 3VB2A 3SZGA 2F5CA 2DU9A 1FIPA 3BTCA 1YG2A 3BC8A 3I0TA 2EIMH 2F5DA 3PO3J 2R5YA 1JKQC 1X3WB 4LG0B 3N4MA 3FRQA 2QF7A 3I59A 4BE0A 1DUXC 4W1UA 1ETWA 2CU7A 3JAMZ 4M3GA 4UVAA 2E1NA 4G7ZF 2IS6A 2Z2SB 4XRSA 2UXIA 4PFPA 4G7OF 2RGVA 3S14J 4U0WA 2NVQJ 4D9JA 5D5UB 3IH3A 3ZN1A 3PNTA 5L3BA 4CYCB 1MBHA 2GZWA 1K61A 2NRAC 1BR4A 5B1BH 4A3LJ 4UDSA 1SFKA 2L3DA 1D5YA 1SVOA 1K78A 1XD7A 5J1UA 1TZLA 3BJ6A 4BBRJ 3G1MA 3CC7I 4EV0A 2Q24A 2LR8A 4IOAF 2DG8A 5KNLA 2F07A 2ECCA 3ZMUA 1AWCA 4FX4A 1HXDA 1FX7A 3S2DJ 2DO7A 4TV7A 1ZELA 4MGRA 4ENJA 2B63J 1FZPB 2FBIA 2XRLA 2ECBA 2GOMA 2QYOA 2WAEA 5E3LA 4I6ZA 3JRDA 2M0CA 2XGDA 3OL4A 1X19A 3D5LA 5FGMA 4UNOA 4O5VA 5A2QZ 1JGGA 3GTMJ 2EA4A 5JVGF 2DMNA 5KK1A 3RPUA 3KETA 3JRBA 3ABTA 1J7KA 1BJAA 5E17F 4GRIA 1IUFA 1SVMA 5K5QA 4XN3A 3H35A 3A01A 2QA4I 1JI8A 1YS7A 3HC7A 5FROA 1DGRM 2OV7A 3W2VA 2FU4A 3D5RC 3KP6A 3GFJA 2ZMEB 1SFOJ 2M2EA 3T1BA 5JFRA 3RTRA 3QPHA 5DDGA 2WAQN 2V9VA 4Z2YA 4L9JA 2D45A 1XGMA 5F1JA 1YI2I 4HNTA 1KYZA 4S05A 4AF5A 5JI6A 3A03A 3G73A 1ZG1A 4M74A 1WJEA 1EV7A 3PIPF 1O3SA 1W0TA 3CCEI 4D5CA 1ETKA 2W7NA 3GFMA 3E6DA 3I4MJ 2GENA 3I55I 2W4SA 1TWAJ 3IKVA 4M9XA 4A3DJ 1BR2A 4BAYA 3OYKA 2D2WA 1ZGAA 3JREA 3RZDJ 1VQLI 2Q8KA 1PVEA 2NX4A 2LNBA 4MTDA 4XIDA 4XR6A 2ZOYA 2V9KA 5DAJA 1OKRA 3DU6A 2A2FX 1M1EB 2EFOA 4OAZA 3RZOJ 3TW7A 1FSHA 2PMHA 2XB0X 3HGYA 1IXRC 2JA8J 3TOBA 1I6HJ 1JJ8C 2WUIA 1R36A 3QPTA 3EDPA 3BZ6A 3PSIA 3CCSI 2A5WA 3EQLF 2ZJQF 3PPBA 4XBFA 1LFBA 2VBXA 2FXAA 4DBQA 2CV1A 1W7PD 1IN8A 3K1NA 4CCLA 5ILVA 4L9NA 2HPIA 2WTEA 1LVKA 1SGMA 2RHAA 1R4MB 3L2RA 3K8PC 2MLKA 2LKPA 1KQ9A 5HDNA 5ICGA 3K2AA 4ITVA 1UFMA 4S04A 3IRRA 3HHGA 3JTHA 2OJED 2QKLB 2UXPA 2Z99A 3TMOA 2ZXJA 3MFKA 2JQ7A 3JSJA 2HOAA 4RMNA 5EF6A 3DKYA 2HWVA 3S2WA 3ZN0A 5D5XB 3IHUA 3KP3A 2ZSHB 2Y48A 3QYBA 4EJOA 1I3QJ 1UB9A 2ZFWA 1DPUA 3HUGA 4B09A 4JL3A 2E7WA 1SMTA 2LP0A 1TTYA 5CVJA 2BBYA 3AAFA 1X1PA 3NRGA 3HL2A 4EGYA 2R7UA 3RIRA 2CFOA 3I53A 2VQLA 4BQNA 1MNDA 2CUZA 2DQLA 4BXUA 4E7HA 2XF7A 2HI3A 4GFKA 1WFXA 1YW8A 1CF7A 3KZ9A 2NS8A 5KAFC 3OSGA 4UUTA 3PFYA 3CQZJ 4BHBA 2XRNA 2EV0A 3HE0A 2OI8A 3VWBA 4NB5A 3RPQA 2IA0A 4MEYF 3LSMA 2CO5A 4UVBA 3TL4X 5HOOA 2BEOA 2JJ7A 1QHHD 1ZRFA 3HOZJ 2KLOA 1ZH5A 4AIJA 5E1WA 2DMUA 2LYCA 3OYIA 1I3AA 3C18A 2X0LA 3DTIA 1SFEA 3HGGA 2F48A 2Y69H 3MMYB 1E3OC 2VONA 2HQNA 2RAEA 2FD5A 1WRJA 2X4HA 2YVEA 4IZZA 5E8GA 4ZYAA 4P9FA 2D1HA 4CH7A 1JHHA 2B7EA 4EGZA 2LC2A 1QPIA 3M7GA 3ANGA 1QZEA 3KEQA 2Q2EA 2A05A 1BL0A 2WC2A 3R0JA 1F9NA 3ASOH 2OTJI 4RB1A 1ONVA 5HDKA 1YW9A 4KIGA 4XORA 2K3PA 3CJRB 2L2OA 3IL2A 1XMKA 2KJBA 4YIFA 4XRSG 3HTIA 2VLAA 4LIVA 5DV5A 3QODA 3OYEA 4IL6C 3U2RA 4CCMA 3B81A 1WWXA 2ICWG 3OYDA 2P8TA 5TGTA 1LEBA 3HYIA 2DFHA 4BJTA 4DZPA 3WHBA 2VBWA 1O7FA 3VPRA 1RI7A 3QWLA 4KICA 3CDLA 5GP9A 4I09A 1KZHA 2MGQA 5IYDJ 2KRFA 2Y0MA 4ZTFA 4HF1A 4O3MA 1J5YA 2WV1A 3R0AA 5KVRA 4A5MA 1MDMA 3BR6A 1RZ4A 4HRIA 1IN4A 1JE8A 1SANA 2VUMJ 3VW1A 4OIQF 1JTXA 2G3BA 4IHTA 4MFEA 3VVXA 3C3WA 1YLFA 3F72A 1SD5A 2DMTA 2IS1A 3HPHA 1XCBA 3OYJA 1H9GA 1TQPA 1DU0A 2IW5A 4LLGF 2PBXA 3G4SI 3FHZA 4M71A 2EZKA 2FE3A 5JVTA 1QA6A 3PO2J 2DG7A 3WTXC 1KU9A 2MFZA 5FLXZ 5CVRA 2HFHA 1UZCA 2P6SA 5LEJA 1W5SA 2VJ5A 2LK2A 3FX3A 1G4DA 1GVJA 3JSOA 3NWSA 3ZMTA 3IWFA 4ZH4F 4N4OB 1ZK8A 4HSRA 2LRDA 3DKWA 4AYBA 4HDUA 3NAUA 3OYCA 2YU9J 4DVYP 3HHHA 3LAPA 5LD2C 2DPDA 2AQFA 1MJBA 1MW7A 1QQIA 2VL8A 2DA7A 1TT0A 3ELKA 1OR7A 2FQ4A 1OQYA 3GTLJ 4GCTA 3VOEA 1H9TA 4U0YA 2HVQA 1XGSA 3ZR8X 4AU7A 1NH3A 4BBSJ 3G7RA 2CQQA 4L5JA 4WXHA 1FTTA 4L9TA 2BZTA 4IHSA 2F6CA 1IF1A 2JRTA 2H8RA 5HAWA 1FP1D 1ZTRA 2YU3A 1Z1DA 1DPRA 5BPDA 2C6YA 2ZOZA 1P92A 3EUHC 3WODF 2XDNA 2E1OA 2KIQA 3HJEA 3F0CA 3QOPA 4B3XA 1HW2A 2KHMA 1AA7A 5IY5H 3GTQJ 1Y8QB 5HODA 1O7LA 1FIAA 2MSYA 3CDIA 3BPXA 3LWJA 5CLSA 2EBIA 1TNTA 2MA3A 2QVOA 1WJBA 3GWZA 3FMRA 3BR2A 3HOVJ 1D1BA 4GXOA 1SC7A 1RRJA 2NVTJ 3UR3C 5BMZA 4HNUA 1YX3A 3H3VK 3GEZA 3OY9A 1BIAA 1ETXA 1VFCA 3M8EA 1HOMA 1GUUA 4RAYA 3GTPJ 4A6EA 4FASD 2LBFA 2UUZA 2K9LA 1VNDA 3ERMA 2DI3A 3ISPA 1RKWA 1IRGA 4RAFA 2ZCWA 3BG6A 4D0PA 5AIQA 4E7IA 1BBYA 2A3SA 2CW0F 2JSPA 2MC4A 2XKPA 3LOCA 4YEJA 1LFUP 2OQRA 1LE8B 3V7CA 3B73A 3SWHA 1I1GA 3HOXJ 1USTA 4EM0B 4LGWA 2XUBA 3CJQB 4AUXA 2FJI1 3WTVC 3I4PA 3F21A 5HNHA 2JA7J 1UI5A 3S3NA 5LRSA 1WPKA 4XICA 4EM1A 2DK8A 1TBXA 3B6CA 3LSHA 4LFUA 2CQKA 4GYIA 5M3FJ 3CC4I 2RNGA 4Y13A 2JA2A 4WXDA 2HOEA 2VKVA 5EGOA 5J6XA 3HBLA 4W97A 5GTIC 2K3FA 4HF2A 1OJLA 5HSZA 3CF2A 2E1CA 3QYFA 2QM3A 2UV1A 2L0KA 4UVCA 4ZC3A 3IP4B 4BNCA 3MAJA 1P9QC 2IXSA 2Z1DA 5ICCA 2V1UA 3OYMA 4OMYA 2FMLA 1R71A 2GLOA 1OYYA 1S7OA 2H94A 4XOPA 1D5VA 2F4IA 2R7OA 3GX4X 3REOA 3HRMA 3AG3H 2O03A 3BG9A 4PGGA 2X51A 1PP8F 3O8GA 4MHGA 3G6EI 2KRHA 3SJMA 1ERDA 1TT5B 1MMDA 2IGOA 2V79A 2BXYA 2DMQA 4Z6YA 4IQJA 2MD5A 4RLQA 3FF5A 4A3JJ 3VSLA 2NP5A 5TJJA 1N77A 4ESJA 1EH8A 4IVNA 3P9KA 3ZMZA 3V8JA 1A6IA 5CYVA 3OMYA 4DOZA 1OPCA 2ME0A 4EJWA 4ICHA 1V5FA 4BE2A 1QHGA 2R7XA 3LA3A 4M72A 5L3GA 3L2QA 1B8IB 3AG4H 3ONQA 5HLHA 1FEXA 5HLIA 1R6RA 2CWEA 3K4CA 3ZMSA 4BQOA 4XLCA 3L2VA 1IG7A 5B1AH 3KKDA 3KE2A 4I76A 2HKXA 2XF6A 5FRMA 1XSVA 1T6SA 2A6HF 4L62A 3R4KA 2ZC2A 3AG2H 2X6XA 3NEUA 3MKLA 3FHNA 3J80K 3FBNB 3A01B 3CZ6A 1JKRC 5DS9A 4CCOA 4IF4A 2ADUA 2PQ8A 3G1OA 2ZB9A 1VQ5I 2ZBKA 3HB9A 5HS7A 4PK4A 3MCZA 3OIOA 3BHQA 2EFPA 4FHTA 3S8PA 3S1RJ 2PFVA 3BR1A 2VQCA 1IRFA 2RQQA 3ESWB 1V4RA 2K9NA 3WU2C 3BQZA 3KNWA 2VXZA 2E71A 3F6OA 2LY9A 1JXSA 5DUIA 2VOOA 1MSFC 3M4OJ 1J0RA 5B5EC 3DEWA 4GYGA 4S0HB 4ZYEA 2BVLA 4I01A 1MMGA 2QSFX 4ZYHA 1MBGA 5FKMA 5LHHA 3J7YJ 4AIKA 4EJTA 2R7FA 4BU2A 1FPQA 1XS9A 1IV6A 3CMAI 2LREA 3E1SA 5EG0B 1Y8RB 1WSUA 1DP3A 1X1DA 2QEXI 2E5NA 3OOPA 1ZAOA 1ON2A 3PUFA 3J7ZI 2VKHA 5LGNA 3VSKA 3L00A 4Y33A 4HA8A 1Z6TA 3JW4A 4WF2A 1TC3C 2ZNYA 2COBA 2HTSA 2K9QA 2PMZA 3SXYA 2KIUA 3KZIC 3RQ4A 1ZHFA 2OF7A 3H9QA 4JK1X 1J2XA 1BI0A 2WADA 4LD5A 4XRFA 2VODA 2HYJA 2VASA 2Y9YA 2VPRA 1TQIA 1V54H 1W5TA 3CCYA 4G7HF 4D1QA 4HG2A 4HLXA 1X3UA 3W6JB 2VJJA 3HSEA 4ENNA 3S15J 3G1LA 3DLAA 3QYEA 4BKXA 2EFQA 3RQIA 4IRHA 2ISZA 5FFZA 2YSRA 1HKTA 3M8FA 3B6AA 3O2PE 3P7NA 3F8BA 1S7EA 3CCJI 3BTLA 2BGCA 4B47A 1XTAA 2NS7A 4YELA 1QU3A 1BW6A 2QWTA 1ZARA 1B72A 5FLXK 1UMQA 2DA4A 5KCMA 1WJCA 3OS1A 4JKZA 1XSXA 5DD4A 4E4HA 1ZRDA 4RS8A 5IT9Z 3FDYA 3IUOA 1MJAA 2EINH 2EV5A 2L9VA 1WJAA 4P5OA 5CVIA 3P9IA 2YPRA 4JOMA 4WCGA 2DDBA 3A0HC 3DPLC 3F9KA 4A6DA 2FOWA 3HZJA 3DP7A 2RQPA 3S2HJ 3BPVA 3U9GA 1IO2A 1WJ5A 3RSNA 2FNAA 3UNGC 3CLQA 3H5RA 5IT9K 2QTQA 2K5CA 2R92J 4GDFA 1Y1VJ 3SZPA 3BTIA 2R5ZB 1HBXG 2L02A 5DUKA 4LG0A 1WZ2A 1FOYA 5D18A 1U5TC 3DWLE 5FJ8J 2LF8A 1SAXA 2M34A 3RI4A 2REKA 3CCVI 2R7QA 2NP3A 3C2HA 4UB6C 3FXQA 4F7ZA 3WE2A 2ISYA 3SEQA 1NG6A 4IOCF 3QPSA 3PFIA 3J7AO 1MBFA 2DA5A 3HXLA 1GXQA 3FXLA 2QBYB 1HLVA 1P4AA 2RDPA 4ME9A 5E3MA 4X1EA 5EG0A 4DYRA 2O0YA 2OPTA 3JRHA 3ULQB 2ZMEA 2J5PA 1Z0XA 2QWWA 4P1WA 2ZKZA 2K4BA 2W82A 3BG5A 5IT3A 3MZHA 3BG7A 3DKXA 1MGTA 2L5QA 1OCRH 2DJIA 2Y75A 1A04A 1FYMA 3B02A 1FMWA 1BW5A 2EFNA 2K9MA 4PSWA 5L3EA 2RASA 3DPJA 2KKOA 4M9SA 2STWA 2BOLA 3FIWA 4G6DA 3ZQHA 2R4GA 4KT5C 2VPLA 2X6YA 1J09A 1BM9A 4L0YB 1B59A 1WI9A 2EIKH 1KU2A 1H0MA 2WBMA 3K4JA 4ON0A 3PQJA 4QLCU 1FP2A 4PUSA 2QQ9A 2IGKA 1TWFJ 2XC7A 1DDNA 2E2IJ 3ROUA 2OZUA 3I9V2 1Z7UA 1XC5A 1YE9A 4A3IJ 5J8FA 1T8IA 1X1AA 2CQNA 3PNYA 3VTIA 4I7HA 4JNNA 3AKZA 3CC2I 4IQ4A 1V3FA 1SD6A 5ILUA 2R7DA 3HKZN 3SFZA 3K4NA 4F3QA 2QKOA 2Z9OA 3S1QJ 3BTJA 3UKGA 3LQQA 2CUFA 5JR3A 2NVYJ 2W53A 1AOYA 4E70A 4BXXJ 3ABUA 4FTHA 2XASA 1JTYA 3R61A 1OFCX 4FE7A 2CW8A 2OCEA 4M6VA 3LJLA 3MWMA 2DT5A 3AL0C 3ZQFA 1HA8A 2BY0A 5CQEA 3T0YA 3ZXSA 1ZQ3P 3LHQA 2N8GA 2P5LC 5BOXA 2LD5A 2W00A 2VB6A 3TW6A 1Y0UA 3VYTB 1UJ8A 2E34A 1GV5A 3ON2A 1HW5A 1IDZA 5JHUA 3BR0A 3D1NI 2GXBA 1UCRA 2F5EA 5IYBJ 2JZYA 5LGUA 3A2KA 3NNRA 4XN0A 4IHYA 2D6YA 3OIQA 1MMAA 3JRFA 3EETA 3GZNB 3E3VA 1K83J 4XONA 3I56I 4OU0A 5F08A 4Q47A 2BW3B 3HOSA 2KZVA 2W57A 2IP2A 1P6RA 3K1MA 3JAMK 3QBMA 1OR7C 1A6QA 4UXNA 4ENMA 5D4RA 1MMSA 2COMA 4YFKF 4I99C 1T38A 2L9NA 4C3IJ 4FE4A 1X2NA 1STZA 2HYGD 4Y17A 4I2OA 3LSGA 1UHSA 4PFOA 4DYQA 2M1BA 4HX8A 4AVPA 1ZKGA 3OYGA 2G7LA 1WI3A 2FSWA 3FWEA 3WGHA 2VE9A 1MDMB 1VQ7I 4KWAA 3RD3A 3WGIA 1U5TA 1R4NB 3HOTA 2I8DA 2R7WA 1T33A 1ZLKA 3A4CA 4XLEA 4OAYA 4M3DA 1QVUA 3BQYA 1D0ZA 2CYYA 5KHDA 1EH6A 1ZN2A 3IAM2 4PJLA 2IGMA 2FX0A 5EJCA 2NS0A 4MQ9F 5K5OA 2PJRB 1TQMA 4BEHA 2DOFA 4DQ2A 3E6BA 2WB1N 1Y1WJ 4BQQA 1YW7A 1DP7P 2K4JA 5IOYA 1DU6A 1YIJI 1LVAA 1K6OA 1QBJA 3BCGA 5BPIA 4C2MA 3BY6A 4BQAA 4CCNA 1FC3A 3TP0A 3GFIA 3Q5FA 1WHUA 4V2GA 2ELJA 3QQAA 4CYCA 2CS3A 5GPCA 2OCCH 4NN1A 2Z3YA 4PDKA 3DF8A 2GOXB 5LGTA 2QQBA 3CJTB 1B1BA 3H0DA 1LPQA 1ULYA 4I0AA 1R22A 3OWTA 4C30A 4RLFA 3Q3SA 4HLYA 2JK3A 3AG1H 2EFWA 3G71I 2LOOA 3LFKA 1G3TA 3HTUA 4I0BA 3DXJF 4I98B 4KIFA 3K4LA 1ODDA 2DYRH 3NPIA 2DDAA 2K9SA 2OA4A 1BR1A 4JYKA 3RCOA 2OUMA 2DFEA 3MEXA 1UHMA 4HQEA 2DFFA 3H5AA 4D7NA 3Q0UA 3QAHA 4BHCA 1Y39A 2RVCA 1HCRA 3VOXA 2LY1A 3VOKA 1GDTA 4FISA 4CA0A 3K0LA 4B3AA 1AU7A 2HQ5A 3WGGA 3BWGA 2B0LA 1XX5A 2Y0SA 5M5XJ 1W7PA 1UHWA 1QVTA 3BJBA 4ZDOA 2BY1A 2YVXA 2LFBA 2LSOA 5FHPA 4DBRA 1PJRA 4XNFA 3JRCA 1B6AA 2KP6A 3RYRA 1YRNA 4YFXF 4EVIA 1A36A 5IP7J 2XGXA 3OYAA 3S93A 1IXCA 2A68F 1P4XA 4Y52J 3VUQA 2WV0A 4UV9A 5F6FA 5FKKA 4M73A 4ESFA 1N25A 4IXAA 3S16J 4GO1A 2W85A 4MEXF 1EJ9A 5H20A 4A3BJ 2M4KA 4HX4A 1U78A 1UI6A 1F5TA 2KQRA 3G3ZA 5GAGJ 1LDDA 2DBBA 5D1RA 4E7LA 2IU5A 3W6KB 2ZCNA 2QUFA 3X2QH 3KZZA 3SYTA 4RBOA 4XSXF 3ZQ7A 4PJJA 4RM3A 2CV2A 3LSIA 4RGXA 3BT9A 4FT8A 5DCMA 2A61A 4RB3C 2ELHA 3VODA 4D5FA 4FCYA 1CF7B 2M8GX 3GTGJ 1PUFA 1A5JA 5E79C 2OQGA 2W1OA 4XLFA 2XPUA 2VIXA 1KU3A 4DZJA 3O60A 5ICFA 3O6BB 4M3FA 4L0ZB 3VW2A 1ZR2A 5J8CA 3RKQA 5FLMJ 1IN5A 2L7MP 1V5EA 1R49A 3E7QA 2KT0A 1R5HA 5C3EJ 1FSEA 1MBJA 2BHYA 2XHKA 3LFUA 3M07A 4QPOA 2O61A 4BDZA 1V55H 3JR9A 3WG7H 2OAZA 3ZRGA 4BDYA 3V7SA 1R5GA 1T0FC 4NDLA 5ERIA 1G6NA 1A31A 2W25A 2RKHA 3CESA 4U7BA 1U2WA 1ENHA 3LA2A 1IAWA 1UG2A 3H3ZA 2YS9A 3GZIA 2M45A 1QRYA 1VQOI 2MG4A 4MTEA 3I71A 2LTPA 3TEDA 1VQNI 3KYLA 5A2QK 3COLA 2HOTA 1S6LA 4A3FJ 1FBUA 2DQRA 3KEOA 4EJVA 1ETVA 1SMYF 4JP0A 3CMMA 3SEZA 2V1NA 1Z05A 5LRRA 2FRHA 1SEUA 2AO9A 2QIBA 2R7SA 1WCMJ 3DEUA 1KGSA 2LVSA 4K2EA 3F8CA 3K7AJ 3DTKA 3WTUC 2CJJA 3KFWX 3ZPLA 4E7JA 4QSHA 4II2A 3CP2A 1JT0A 5FKNA 1EKEA 3RPUD 1T39A 2H1LA 2P4WA 1MH4A 1I39A 1RR8C 3CTAA 1T95A 5DD8A 3BOQA 1YO5C 1K78B 1BI2A 1F43A 1K4TA 1P7JA 4PSXA 1SD4A 1OLTA 2GM4A 3LNQA 2E2JJ 2L01A 2NVUB 3MN2A 1USSA 4KN4X 3E5XA 3PQKA 5D8KB 2CH0A 4LB6B 1XG1A 1R5ID 5ILSA 3IH2A 2BXZA 4CO8A 2Y9ZA 2UWMA 3CMYA 3QP6A 1KA8A 2EWNA 2QZ8A 2VN2A 1IZ1A 4PJNA 5LFAA 1IN7A 3MZ8A 3WU0A 4MLOA 3MNLA 3H9GA 2KIMA 1NTCA 3GYHX 1C0WA 5J4VA 3HUGB 3F6VA 5LLQA 5GADJ 5H2FC 4C2UA 2TDXA 4HPQA 3FXKA 4XOTA 4U88A 4JX6A 1WVRA 2ZXHA 4A2UA 1HF0A 1D1CA 4MQVA 1Z3YA 4KMUX 4UV8A 2QSGX 4ETSA 1VTNC 1HSTA 1KQ0A 2EIJH 2YUSA 1B9MA 1OCCH 3FMSA 3L09A 3L9FA 2PFBA 3CCLI 3OYHA 3M3YJ 4UY8I 2KPMA 2DCEA 2ZCXA 1FBSA 3IC7A 1R58A 3WTWC 3N97A 3FK6A 2M87A 4FETA 5BNGA 1QPMA 2IA2A 5B3SH 2DA3A 1FNNA 1VQ9I 1HKQA 2A6EF 5FD5A 4X0GA 2DT7B 5C4YA 3NI7A 1LQ1A 1KQ8A 4DIQA 4KITB 4Q48A 2KIFA 2CQ7A 2IPQX 3CO6C 1I5ZA 4E7SA 4A3GJ 3WTSC 2VBZA 3F8NA 2ZNZA 1G3YA 3E0JB 1H8AC 4ZJZA 2IS2A 4MNUA 4C9YA 2AXTC 3HOUJ 3EPZA 2WY7Q 3S3OA 1ZGJA 4GGGA 3HEFA 4CZZA 2X1CA 1E2XA 2RNJA 3W2AA 3OS2A 2LH9A 2WY8Q 3R6SA 1ZG3A 4L5IA 2XAHA 2VT3A 2ZJRF 5IPAA 1RKTA 2QQ8A 4IO9F 4RGRA 3NQOA 2GUHA 4XLHA 3QU6A 1U8RA 2H6BA 5EEHA 1MNMC 4IHVA 3TDZC 2UXHA 1YRNB 3S17J 4AYBN 2VOPA 3TQNA 1S9HA 2MH2A 2IAIA 5HDGA 5L3FA 4CHUA 3CDHA 2X9DA 2E60A 2G9WA 3H1CA 5FD6A 5H9TA 5J1RA 2IA1A 3IV5A 5E20A 3KP7A 5D6FA 3V8LA 3F3XA 2HVSA 2ZMEC 2AXLA 1O57A 3OYLA 1FMVA 2LF7A 1FJLA 5TRDA 2M3AA
chains in the Genus database with same CATH topology
1Y1VJ 3ZQCA 3H0GJ 3BTIA 2R5ZB 3NXCA 3AQTA 5D18A 3K2AA 4Y7NJ 5FJ8J 1U8BA 2M34A 3BR3A 4MK6A 2UXPA 2REKA 2NP3A 1GVDA 1EF4A 3JSJA 2HOAA 5EF6A 3RH2A 3G56A 2JWTA 1I3QJ 2L7ZA 3A02A 3GBGA 3QPSA 5K58A 1MBFA 2TRTA 2DA5A 2G7SA 5FGLA 5K7HA 5FLVA 1AKHA 4JL3A 2LLKA 2LP0A 4XRMA 1HLVA 5F27A 3BNIA 3NRGA 1TWCJ 1MSEC 4ME9A 5E3MA 4X1EA 5EG0A 5C4JJ 4DYRA 4UUSA 2OPTA 2XSDC 3JRHA 2HYTA 1Z0XA 3CWRA 2R5YB 2HI3A 4GFKA 2P81A 3BG5A 5M5YJ 3KZ9A 2NS8A 3OSGA 4UUTA 3CQZJ 3HE0A 2OI8A 5E3OA 3HOYJ 5F0FA 1BW5A 4YZEA 2W48A 2RASA 1BJZA 3DPJA 1ETQA 2FBQA 1IC8A 2JJ7A 3FIWA 3HOZJ 3ZQHA 3V78A 2DMUA 2IBDA 1BA5A 4IHXA 3JRGA 3HGGA 2E2IJ 2EH3A 1RETA 1TWFJ 1U9NA 2JN6A 1E3OC 3HIMA 3TP3A 1XC5A 4AC6A 2HXIA 2RAEA 3SDGA 4A3IJ 2FD5A 4GFBA 4A3MJ 5K7ZA 2YVEA 3AQSA 4JNNA 4MIMA 1NK2P 2HXOA 3LSJA 2R0QC 2DMPA 1QPIA 2G7GA 3ANGA 3HKZN 2V57A 2QKOA 1BL0A 3HTHA 3IUVA 4B4CA 3HOWJ 3S1QJ 3BTJA 3GTJJ 3UKGA 2CUFA 2R7ZJ 2NVYJ 2XPVA 5IP6A 2W53A 3NARA 4BXXJ 4FTHA 4BY7J 1JTYA 1X58A 1OFCX 4FE7A 4M6VA 3LJLA 4CGRA 3ZQFA 4L5EA 1MH3A 3HTIA 3FISA 4XRSG 4A69C 2N8GA 1R9TJ 1Q1VA 3O8HA 1LE8A 1ZQ3P 3LHQA 1OCTC 3KKCA 2JMWA 4DW6A 2LD5A 3SFIA 3TW6A 3B81A 1JT6A 4JX5A 4DZPA 1JKOC 2QOPA 1GV5A 3WHBA 3ON2A 1X2MA 1ZGWA 1IDZA 3VPRA 3BR0A 3CJDA 5GP9A 3CDLA 3D1NI 5IYBJ 5IYDJ 2MGQA 3EUPA 3NNRA 2M9HA 2FJ1A 4IHYA 2D6YA 3JRFA 4ABZA 2HKUA 2WV1A 1K83J 3BR6A 2CRGA 5F08A 3ANPA 4HKUA 1SANA 2XB5A 2VUMJ 3VW1A 2DTZA 1JTXA 2L9RA 3L1PA 2G3BA 3QBMA 3OOUA 4MFEA 3VVXA 5J3LA 2DA6A 2ZCMA 2DMTA 4C3JJ 5HBUA 2PMZN 3S5RA 4C3IJ 4FE4A 1X2NA 1DU0A 2PBXA 3W6VA 2EZKA 1UHSA 3LSGA 4QTRA 3PO2J 2DG7A 5CW8A 4DYQA 2O7OA 5F0HA 1ZKGA 1HDDC 5EGOB 3FKIJ 2G7LA 1WI3A 2R5ZA 1JKPC 4A93J 1ORKA 4KWAA 2LK2A 3RD3A 3V6GA 5D19A 2Y30A 1T33A 4XK4A 1ZK8A 4M3DA 1QVUA 3BQYA 2YU9J 3NAUA 5GPAA 2YVHA 2FX0A 1JUPA 1U9OA 2DA7A 4LOCA 2CQXA 4G12A 2WB1N 2X48A 2FQ4A 1Y1WJ 4GFLA 3GTLJ 4GCTA 1DU6A 3BCGA 5IOYA 3G7RA 4BBSJ 3HTJA 2CQQA 1FTTA 2X6OA 3TP0A 3ZQLA 4RDUA 3JRAA 4V2GA 2JA6J 3QQAA 2H8RA 5HAWA 1FTZA 4CYCA 1ZTRA 5IP9J 5EZHA 2IEKA 2ZOZA 5GPCA 1WGXA 1IRZA 2XDNA 4C2MJ 2E1OA 2R93J 4NN1A 1IJWC 3F0CA 1PUFB 1APLC 3HM5A 4MO7A 3Q0WA 3GTQJ 5EYRA 5JLXA 4A3EJ 5HODA 2VKEA 1FIAA 2EZIA 2MSYA 1NK3P 2EZHA 3Q3SA 2JK3A 3BRUA 3VP5A 2AHQA 3LWJA 2EBIA 2Y0SN 4V2FA 3LSRA 3BR2A 3HOVJ 3NPIA 4M3BA 2NVTJ 2K9SA 4JYKA 4MFDA 4M3EA 2O7TA 3H3VK 1GT0C 4D7NA 1ETXA 1VFCA 3Q0UA 5IYCJ 1HOMA 3OSFA 1GUUA 3GTPJ 1HCRA 2NVXJ 3VOXA 1G2HA 3FK7A 3C2BA 3VOKA 1GDTA 4FISA 1VNDA 3ZOBA 4B3AA 1I50J 1AU7A 2ME6A 2HQ5A 1RKWA 5FKOA 5M5XJ 3HTAA 1QVTA 3GTOJ 2WGBA 3BJBA 1POGA 2ID6A 3LOCA 2LFBA 1LFUP 5FHPA 1O4XA 5FMPA 3JRCA 1LE8B 1MBEA 3BG3A 2XPWA 5F04A 3HOXJ 1YRNA 3PASA 5M3MJ 5IP7J 2CUEA 2Y2ZA 4AUXA 3I4NJ 1GV2A 4Y52J 3VUQA 2GFNA 5FKKA 3S16J 2JA7J 1UI5A 3C07A 1ZR4A 1JUMA 1WPKA 2H1KA 4XICA 4A3BJ 5AQCA 1U78A 1H89C 2I10A 3B6CA 5M3FJ 1UI6A 2QCOA 3P9TA 4ACIA 5EDNA 5D1RA 1AKHB 5JLWA 2IU5A 2DA2A 4IEJA 2ZCNA 2VKVA 2DA1A 5EGOA 3HBLA 4MXMA 5EZGA 4W97A 4RBOA 1OJLA 2UXOA 5HSZA 5FKLA 3BT9A 2GBYA 1TWGJ 3CRJA 2L0KA 1HDPA 4D5FA 4FCYA 2M8GX 3GTGJ 4DYCA 1PUFA 9ANTA 1A5JA 2ID3A 2XPUA 4HNVA 3QKXA 4DZJA 3O60A 1CQTA 2JA5J 2OERA 2GLOA 4M3FA 3QPLA 3VW2A 1ZR2A 2XGEA 5J1YA 3GEUA 3RKQA 1IGNA 1RPWA 5FLMJ 2L7MP 3BG9A 3E7QA 2KT0A 4IHWA 3O8GA 5C3EJ 1B72B 2HDDA 3SJMA 4X6AJ 3VVYA 1MBJA 2DJNA 1VI0A 4EEFG 3JR9A 2G0EA 1ETOA 2DMQA 1WH5A 1AHDP 1OCPA 4NDLA 2K40A 2KDZA 4A3JJ 2DN0A 2NP5A 3F1BA 3VW0A 1RR7A 1ENHA 4D7MA 5CXIA 4NELA 3WHCA 1UG2A 1A6IA 2YS9A 3GZIA 2ME0A 4ICHA 3ZQIA 4PXIA 1QRYA 2MG4A 5E3NA 1B8IB 2LTPA 3TEDA 3COLA 4B1RA 2HOTA 1FEXA 4JX4A 1IG7A 4A3FJ 4GCLA 1ETYA 1ETVA 4JP0A 1MBKA 2MW8A 3KKDA 3VVZA 4I76A 1JJ6C 2UXUA 4L62A 2AO9A 3IH4A 2QIBA 1FIPA 3MKLA 3BTCA 1WCMJ 2LVSA 3K7AJ 3PO3J 2R5YA 1JKQC 3A01B 1JKRC 2CJJA 5DS9A 3FRQA 3G1OA 4QSHA 2QF7A 2ZB9A 1JT0A 5FKNA 3HB9A 4W1UA 1ETWA 2CU7A 4M3GA 1MH4A 4XRSA 4A3CJ 3OIOA 2UXIA 3BHQA 3S14J 4UUSB 3S1RJ 2NVQJ 3BR1A 3IH3A 1F43A 4CYCB 1MBHA 1P7JA 1K61A 2K9NA 4AC0A 2GM4A 3BQZA 3LNQA 2E2HJ 2E2JJ 4A3LJ 3KNWA 1WH7A 1Z77A 1D5YA 4UDSA 2XGCA 3MN2A 2HOSA 2LY9A 5J1UA 4BBRJ 3G1MA 3M4OJ 2Q24A 1MSFC 1XG1A 2LR8A 3DEWA 3IH2A 1F36A 2Y9ZA 4S0HB 3PM1A 3CMYA 2DG8A 2F07A 2ECCA 1MBGA 5FKMA 2D5VA 3BR5A 3S2DJ 3MNLA 4MLOA 4BY1J 5CXGA 1NTCA 5M5WJ 4C3HJ 5C44J 2PZ9A 2B63J 1VF9A 2XRLA 1XS9A 2ECBA 1IV6A 4GCKA 5E3LA 4I6ZA 3JRDA 2M0CA 3S1NJ 2XGDA 4JX6A 5EEAA 5EG0B 5K7FA 1HF0A 1IDYA 4QIWN 5IOZA 1JGGA 3GTMJ 3HDDA 5F0CA 2YUSA 2DMNA 3JRBA 1TC3C 3M3YJ 3VIBA 2COBA 2K9QA 2Y31A 1IUFA 2ZCXA 2EZLA 5EFYA 3A01A 2VI6A 1H88C 1JUSA 2OF7A 3MVPA 3FK6A 5BNGA 2DA3A 3EGQA 2O9LA 1SFOJ 1T56A 2HYJA 2M2EA 5C4YA 3NI7A 4A3KJ 2Y9YA 2VPRA 3CCYA 2WAQN 3JRIA 4A3GJ 5F1JA 1H8AC 4AF5A 3S15J 1ITYA 3A03A 3HOUJ 3E7LA 3G1LA 2O8KA 2LKXA 3DCFA 4BKXA 3GTKJ 1W0TA 3HEFA 3RQIA 4D5CA 1ETKA 3I4MJ 2GENA 1TWAJ 3B6AA 4A3DJ 1W0UA 1TWHJ 1S7EA 3JREA 3RZDJ 5IPAA 1RKTA 5DTDA 3S1MJ 3BTLA 2EQRA 2NX4A 4XIDA 3LSPA 4J19A 2NS7A 2ZOYA 1BW6A 1MNMC 2GUHA 1P7IA 2UXHA 5DAJA 4IHVA 3ON4A 2QWTA 1YRNB 1B72A 2NOGA 4AYBN 3S17J 1UMQA 2DA4A 3RZOJ 3TW7A 2IAIA 4JKZA 2ELKA 2XB0X 3Q0VA 3HGYA 2JA8J 2TCTA 2L7FP 1I6HJ 1JJ8C 2WUIA 1RESA 2X9DA 3ZQGA 5C4XJ 3T6NA 5H9TA 3PPBA 5J1RA 2E19A 3IV5A 1LFBA 3S2HJ 1B8IA 1SGMA 2RHAA 2QTQA 1FJLA 2R92J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y1V J;  3ZQC A;  3H0G J;  3BTI A;  2R5Z B;  3NXC A;  3AQT A;  5D18 A;  3K2A A;  4Y7N J;  5FJ8 J;  1U8B A;  2M34 A;  3BR3 A;  4MK6 A;  2UXP A;  2REK A;  2NP3 A;  1GVD A;  1EF4 A;  3JSJ A;  2HOA A;  5EF6 A;  3RH2 A;  3G56 A;  2JWT A;  1I3Q J;  2L7Z A;  3A02 A;  3GBG A;  3QPS A;  5K58 A;  1MBF A;  2TRT A;  2DA5 A;  2G7S A;  5FGL A;  5K7H A;  5FLV A;  1AKH A;  4JL3 A;  2LLK A;  2LP0 A;  4XRM A;  1HLV A;  5F27 A;  3BNI A;  3NRG A;  1TWC J;  1MSE C;  4ME9 A;  5E3M A;  4X1E A;  5EG0 A;  5C4J J;  4DYR A;  4UUS A;  2OPT A;  2XSD C;  3JRH A;  2HYT A;  1Z0X A;  3CWR A;  2R5Y B;  2HI3 A;  4GFK A;  2P81 A;  3BG5 A;  5M5Y J;  3KZ9 A;  2NS8 A;  3OSG A;  4UUT A;  3CQZ J;  3HE0 A;  2OI8 A;  5E3O A;  3HOY J;  5F0F A;  1BW5 A;  4YZE A;  2W48 A;  2RAS A;  1BJZ A;  3DPJ A;  1ETQ A;  2FBQ A;  1IC8 A;  2JJ7 A;  3FIW A;  3HOZ J;  3ZQH A;  3V78 A;  2DMU A;  2IBD A;  1BA5 A;  4IHX A;  3JRG A;  3HGG A;  2E2I J;  2EH3 A;  1RET A;  1TWF J;  1U9N A;  2JN6 A;  1E3O C;  3HIM A;  3TP3 A;  1XC5 A;  4AC6 A;  2HXI A;  2RAE A;  3SDG A;  4A3I J;  2FD5 A;  4GFB A;  4A3M J;  5K7Z A;  2YVE A;  3AQS A;  4JNN A;  4MIM A;  1NK2 P;  2HXO A;  3LSJ A;  2R0Q C;  2DMP A;  1QPI A;  2G7G A;  3ANG A;  3HKZ N;  2V57 A;  2QKO A;  1BL0 A;  3HTH A;  3IUV A;  4B4C A;  3HOW J;  3S1Q J;  3BTJ A;  3GTJ J;  3UKG A;  2CUF A;  2R7Z J;  2NVY J;  2XPV A;  5IP6 A;  2W53 A;  3NAR A;  4BXX J;  4FTH A;  4BY7 J;  1JTY A;  1X58 A;  1OFC X;  4FE7 A;  4M6V A;  3LJL A;  4CGR A;  3ZQF A;  4L5E A;  1MH3 A;  3HTI A;  3FIS A;  4XRS G;  4A69 C;  2N8G A;  1R9T J;  1Q1V A;  3O8H A;  1LE8 A;  1ZQ3 P;  3LHQ A;  1OCT C;  3KKC A;  2JMW A;  4DW6 A;  2LD5 A;  3SFI A;  3TW6 A;  3B81 A;  1JT6 A;  4JX5 A;  4DZP A;  1JKO C;  2QOP A;  1GV5 A;  3WHB A;  3ON2 A;  1X2M A;  1ZGW A;  1IDZ A;  3VPR A;  3BR0 A;  3CJD A;  5GP9 A;  3CDL A;  3D1N I;  5IYB J;  5IYD J;  2MGQ A;  3EUP A;  3NNR A;  2M9H A;  2FJ1 A;  4IHY A;  2D6Y A;  3JRF A;  4ABZ A;  2HKU A;  2WV1 A;  1K83 J;  3BR6 A;  2CRG A;  5F08 A;  3ANP A;  4HKU A;  1SAN A;  2XB5 A;  2VUM J;  3VW1 A;  2DTZ A;  1JTX A;  2L9R A;  3L1P A;  2G3B A;  3QBM A;  3OOU A;  4MFE A;  3VVX A;  5J3L A;  2DA6 A;  2ZCM A;  2DMT A;  4C3J J;  5HBU A;  2PMZ N;  3S5R A;  4C3I J;  4FE4 A;  1X2N A;  1DU0 A;  2PBX A;  3W6V A;  2EZK A;  1UHS A;  3LSG A;  4QTR A;  3PO2 J;  2DG7 A;  5CW8 A;  4DYQ A;  2O7O A;  5F0H A;  1ZKG A;  1HDD C;  5EGO B;  3FKI J;  2G7L A;  1WI3 A;  2R5Z A;  1JKP C;  4A93 J;  1ORK A;  4KWA A;  2LK2 A;  3RD3 A;  3V6G A;  5D19 A;  2Y30 A;  1T33 A;  4XK4 A;  1ZK8 A;  4M3D A;  1QVU A;  3BQY A;  2YU9 J;  3NAU A;  5GPA A;  2YVH A;  2FX0 A;  1JUP A;  1U9O A;  2DA7 A;  4LOC A;  2CQX A;  4G12 A;  2WB1 N;  2X48 A;  2FQ4 A;  1Y1W J;  4GFL A;  3GTL J;  4GCT A;  1DU6 A;  3BCG A;  5IOY A;  3G7R A;  4BBS J;  3HTJ A;  2CQQ A;  1FTT A;  2X6O A;  3TP0 A;  3ZQL A;  4RDU A;  3JRA A;  4V2G A;  2JA6 J;  3QQA A;  2H8R A;  5HAW A;  1FTZ A;  4CYC A;  1ZTR A;  5IP9 J;  5EZH A;  2IEK A;  2ZOZ A;  5GPC A;  1WGX A;  1IRZ A;  2XDN A;  4C2M J;  2E1O A;  2R93 J;  4NN1 A;  1IJW C;  3F0C A;  1PUF B;  1APL C;  3HM5 A;  4MO7 A;  3Q0W A;  3GTQ J;  5EYR A;  5JLX A;  4A3E J;  5HOD A;  2VKE A;  1FIA A;  2EZI A;  2MSY A;  1NK3 P;  2EZH A;  3Q3S A;  2JK3 A;  3BRU A;  3VP5 A;  2AHQ A;  3LWJ A;  2EBI A;  2Y0S N;  4V2F A;  3LSR A;  3BR2 A;  3HOV J;  3NPI A;  4M3B A;  2NVT J;  2K9S A;  4JYK A;  4MFD A;  4M3E A;  2O7T A;  3H3V K;  1GT0 C;  4D7N A;  1ETX A;  1VFC A;  3Q0U A;  5IYC J;  1HOM A;  3OSF A;  1GUU A;  3GTP J;  1HCR A;  2NVX J;  3VOX A;  1G2H A;  3FK7 A;  3C2B A;  3VOK A;  1GDT A;  4FIS A;  1VND A;  3ZOB A;  4B3A A;  1I50 J;  1AU7 A;  2ME6 A;  2HQ5 A;  1RKW A;  5FKO A;  5M5X J;  3HTA A;  1QVT A;  3GTO J;  2WGB A;  3BJB A;  1POG A;  2ID6 A;  3LOC A;  2LFB A;  1LFU P;  5FHP A;  1O4X A;  5FMP A;  3JRC A;  1LE8 B;  1MBE A;  3BG3 A;  2XPW A;  5F04 A;  3HOX J;  1YRN A;  3PAS A;  5M3M J;  5IP7 J;  2CUE A;  2Y2Z A;  4AUX A;  3I4N J;  1GV2 A;  4Y52 J;  3VUQ A;  2GFN A;  5FKK A;  3S16 J;  2JA7 J;  1UI5 A;  3C07 A;  1ZR4 A;  1JUM A;  1WPK A;  2H1K A;  4XIC A;  4A3B J;  5AQC A;  1U78 A;  1H89 C;  2I10 A;  3B6C A;  5M3F J;  1UI6 A;  2QCO A;  3P9T A;  4ACI A;  5EDN A;  5D1R A;  1AKH B;  5JLW A;  2IU5 A;  2DA2 A;  4IEJ A;  2ZCN A;  2VKV A;  2DA1 A;  5EGO A;  3HBL A;  4MXM A;  5EZG A;  4W97 A;  4RBO A;  1OJL A;  2UXO A;  5HSZ A;  5FKL A;  3BT9 A;  2GBY A;  1TWG J;  3CRJ A;  2L0K A;  1HDP A;  4D5F A;  4FCY A;  2M8G X;  3GTG J;  4DYC A;  1PUF A;  9ANT A;  1A5J A;  2ID3 A;  2XPU A;  4HNV A;  3QKX A;  4DZJ A;  3O60 A;  1CQT A;  2JA5 J;  2OER A;  2GLO A;  4M3F A;  3QPL A;  3VW2 A;  1ZR2 A;  2XGE A;  5J1Y A;  3GEU A;  3RKQ A;  1IGN A;  1RPW A;  5FLM J;  2L7M P;  3BG9 A;  3E7Q A;  2KT0 A;  4IHW A;  3O8G A;  5C3E J;  1B72 B;  2HDD A;  3SJM A;  4X6A J;  3VVY A;  1MBJ A;  2DJN A;  1VI0 A;  4EEF G;  3JR9 A;  2G0E A;  1ETO A;  2DMQ A;  1WH5 A;  1AHD P;  1OCP A;  4NDL A;  2K40 A;  2KDZ A;  4A3J J;  2DN0 A;  2NP5 A;  3F1B A;  3VW0 A;  1RR7 A;  1ENH A;  4D7M A;  5CXI A;  4NEL A;  3WHC A;  1UG2 A;  1A6I A;  2YS9 A;  3GZI A;  2ME0 A;  4ICH A;  3ZQI A;  4PXI A;  1QRY A;  2MG4 A;  5E3N A;  1B8I B;  2LTP A;  3TED A;  3COL A;  4B1R A;  2HOT A;  1FEX A;  4JX4 A;  1IG7 A;  4A3F J;  4GCL A;  1ETY A;  1ETV A;  4JP0 A;  1MBK A;  2MW8 A;  3KKD A;  3VVZ A;  4I76 A;  1JJ6 C;  2UXU A;  4L62 A;  2AO9 A;  3IH4 A;  2QIB A;  1FIP A;  3MKL A;  3BTC A;  1WCM J;  2LVS A;  3K7A J;  3PO3 J;  2R5Y A;  1JKQ C;  3A01 B;  1JKR C;  2CJJ A;  5DS9 A;  3FRQ A;  3G1O A;  4QSH A;  2QF7 A;  2ZB9 A;  1JT0 A;  5FKN A;  3HB9 A;  4W1U A;  1ETW A;  2CU7 A;  4M3G A;  1MH4 A;  4XRS A;  4A3C J;  3OIO A;  2UXI A;  3BHQ A;  3S14 J;  4UUS B;  3S1R J;  2NVQ J;  3BR1 A;  3IH3 A;  1F43 A;  4CYC B;  1MBH A;  1P7J A;  1K61 A;  2K9N A;  4AC0 A;  2GM4 A;  3BQZ A;  3LNQ A;  2E2H J;  2E2J J;  4A3L J;  3KNW A;  1WH7 A;  1Z77 A;  1D5Y A;  4UDS A;  2XGC A;  3MN2 A;  2HOS A;  2LY9 A;  5J1U A;  4BBR J;  3G1M A;  3M4O J;  2Q24 A;  1MSF C;  1XG1 A;  2LR8 A;  3DEW A;  3IH2 A;  1F36 A;  2Y9Z A;  4S0H B;  3PM1 A;  3CMY A;  2DG8 A;  2F07 A;  2ECC A;  1MBG A;  5FKM A;  2D5V A;  3BR5 A;  3S2D J;  3MNL A;  4MLO A;  4BY1 J;  5CXG A;  1NTC A;  5M5W J;  4C3H J;  5C44 J;  2PZ9 A;  2B63 J;  1VF9 A;  2XRL A;  1XS9 A;  2ECB A;  1IV6 A;  4GCK A;  5E3L A;  4I6Z A;  3JRD A;  2M0C A;  3S1N J;  2XGD A;  4JX6 A;  5EEA A;  5EG0 B;  5K7F A;  1HF0 A;  1IDY A;  4QIW N;  5IOZ A;  1JGG A;  3GTM J;  3HDD A;  5F0C A;  2YUS A;  2DMN A;  3JRB A;  1TC3 C;  3M3Y J;  3VIB A;  2COB A;  2K9Q A;  2Y31 A;  1IUF A;  2ZCX A;  2EZL A;  5EFY A;  3A01 A;  2VI6 A;  1H88 C;  1JUS A;  2OF7 A;  3MVP A;  3FK6 A;  5BNG A;  2DA3 A;  3EGQ A;  2O9L A;  1SFO J;  1T56 A;  2HYJ A;  2M2E A;  5C4Y A;  3NI7 A;  4A3K J;  2Y9Y A;  2VPR A;  3CCY A;  2WAQ N;  3JRI A;  4A3G J;  5F1J A;  1H8A C;  4AF5 A;  3S15 J;  1ITY A;  3A03 A;  3HOU J;  3E7L A;  3G1L A;  2O8K A;  2LKX A;  3DCF A;  4BKX A;  3GTK J;  1W0T A;  3HEF A;  3RQI A;  4D5C A;  1ETK A;  3I4M J;  2GEN A;  1TWA J;  3B6A A;  4A3D J;  1W0U A;  1TWH J;  1S7E A;  3JRE A;  3RZD J;  5IPA A;  1RKT A;  5DTD A;  3S1M J;  3BTL A;  2EQR A;  2NX4 A;  4XID A;  3LSP A;  4J19 A;  2NS7 A;  2ZOY A;  1BW6 A;  1MNM C;  2GUH A;  1P7I A;  2UXH A;  5DAJ A;  4IHV A;  3ON4 A;  2QWT A;  1YRN B;  1B72 A;  2NOG A;  4AYB N;  3S17 J;  1UMQ A;  2DA4 A;  3RZO J;  3TW7 A;  2IAI A;  4JKZ A;  2ELK A;  2XB0 X;  3Q0V A;  3HGY A;  2JA8 J;  2TCT A;  2L7F P;  1I6H J;  1JJ8 C;  2WUI A;  1RES A;  2X9D A;  3ZQG A;  5C4X J;  3T6N A;  5H9T A;  3PPB A;  5J1R A;  2E19 A;  3IV5 A;  1LFB A;  3S2H J;  1B8I A;  1SGM A;  2RHA A;  2QTQ A;  1FJL A;  2R92 J; 
#chains in the Genus database with same CATH topology
 2V7F A;  3DLL F;  3TO7 A;  3H0G J;  1LNW A;  3BZK A;  4PGH A;  1BIB A;  2JSC A;  5FO5 A;  1YOV B;  4BJ6 C;  4Y7N J;  3IKT A;  3HTJ A;  1U8B A;  2XSJ C;  4ZZD A;  2PJR A;  1GVD A;  1KYW A;  5ED4 A;  1EF4 A;  2EJR A;  2F5F A;  2MYS A;  3ML6 A;  5DM6 F;  1YFH A;  3G56 A;  4IRV A;  2JWT A;  2WB1 A;  4I02 A;  4LJZ F;  4BUP A;  2L7Z A;  4OIP F;  3GBG A;  1GXP A;  3J81 Z;  1R1T A;  5K58 A;  2TRT A;  1LDJ A;  5CQG A;  5FLV A;  4Y4R A;  2LLK A;  2VQH A;  4XRM A;  3DU5 A;  3BNI A;  5C4J J;  4M6Y A;  4UUS A;  2XSD C;  1G3S A;  2QBY A;  1LJ9 A;  1UG0 A;  2MLG A;  3CWR A;  2R5Y B;  3I54 A;  3CF5 F;  1KU7 A;  1IN6 A;  3HRT A;  2JTV A;  4F52 A;  2L4A A;  4CCK A;  3HOY J;  2GA2 A;  1FLI A;  2BVM A;  1BJZ A;  2EK5 A;  2V1D A;  4BE1 A;  2FBQ A;  1IC8 A;  3U1D A;  1ZRC A;  1UAA A;  2IBD A;  4U0V A;  4NBQ A;  4KDP A;  2CUJ A;  4IHX A;  3JRG A;  2XAF A;  4Y15 A;  2M30 A;  1U5T B;  2EH3 A;  2Z5U A;  1RET A;  1U9N A;  2JN6 A;  3KZY A;  4HW0 A;  2VBY A;  3TP3 A;  1HW1 A;  2GIV A;  4EMS A;  4P96 A;  4HX7 A;  2HQA A;  4GFB A;  3O3K A;  4A3M J;  1HC8 A;  2KJC A;  5K7Z A;  3E6M A;  4MIM A;  1NK2 P;  2HXO A;  3LSJ A;  1T08 B;  2DMP A;  2HDC A;  2XF5 A;  1FOX A;  5D4S A;  3IUV A;  2FEZ A;  4HAM A;  2ZXI A;  2R7Z J;  5IP6 A;  3NAR A;  4BY7 J;  3DFG A;  3HG9 A;  1WJD A;  3K1P A;  2KIS A;  3T5X A;  3PL8 A;  4JQF A;  5GAE J;  4XQF A;  3LSK A;  3T8T A;  4A12 A;  1I1S A;  1QZY A;  2KFD A;  1MH3 A;  3ZP5 A;  2OC6 A;  3FIS A;  4KIB A;  4A69 C;  1Q1V A;  3O8H A;  1OCT C;  1YJW I;  3KKC A;  1Z21 A;  2L54 A;  3CP8 A;  4XKV A;  4DW6 A;  4A0X A;  4HDV A;  2O3F A;  3K9T A;  3SFI A;  3P5J A;  4CDG A;  1JT6 A;  3BZC A;  4ZYD A;  4JX5 A;  1JKO C;  2QOP A;  5GTH C;  4IRI A;  4WIB A;  1BC8 C;  3ABL H;  4ZZL A;  3CJD A;  3DTE A;  1YHQ I;  1G3W A;  2P5K A;  2FJ1 A;  4HV6 A;  3BLY A;  2A6T A;  1HKS A;  1RUN A;  4ABZ A;  3FBI B;  5D6E A;  1MKM A;  2QQA A;  1YYV A;  3ANP A;  5BS6 A;  2HR3 A;  2QGU A;  4HKU A;  4ZYG A;  3HPG A;  2ESH A;  2L9R A;  4B44 A;  3OOU A;  4WWC A;  4KYW A;  3K4M A;  4AVZ A;  2DA6 A;  1IRX A;  2E1M B;  2ZCM A;  3NWT A;  3CUQ C;  3H3U A;  4C2T A;  5HBU A;  5CVU A;  2X6W A;  3DBR B;  4YII A;  2PMZ N;  3S5R A;  3E97 A;  3HSF A;  3WTY C;  3TDU C;  1D0X A;  5E18 F;  4QTR A;  3KX2 A;  2PBI A;  1RIO H;  2FMY A;  3FKI J;  2R5Z A;  3WTZ A;  4A93 J;  2GWR A;  4AM3 A;  4M9Z A;  2XKO A;  4OD4 A;  2XVC A;  5D5V B;  4XSZ F;  1ZRE A;  5D19 A;  4BL0 B;  5CKT A;  2ETH A;  3CO7 C;  3OS0 A;  2DXI A;  2LBF B;  3F22 A;  4P55 A;  2M5W A;  2RRE A;  3I5U A;  2YVH A;  3M1E A;  2NNY A;  4AWX B;  2NXN B;  3CCM I;  1J59 A;  1JUP A;  1U9O A;  2OU2 A;  2WAQ A;  2HU9 A;  2HPM A;  4LOC A;  1OYW A;  2CGP A;  1S5L C;  3ECO A;  2CQX A;  5K5R A;  4KT6 A;  4G12 A;  4BYY A;  1D8K A;  2ZJ2 A;  2X48 A;  1BI3 A;  3MKY B;  3AL0 B;  2HYF A;  4GFL A;  2R7V A;  3CME I;  2Z33 A;  4XL9 A;  3PSF A;  2HNH A;  4NC7 A;  3JRA A;  4JBA A;  3JTG A;  1IUY A;  2VJI A;  3OIP A;  3ABK H;  4HEA 2;  3HRU A;  4E7Z A;  4H0E A;  1FTZ A;  4BS9 A;  4OIN F;  2GXG A;  4OIR F;  2HTJ A;  4NC6 A;  4E6K G;  1WGX A;  3V7R A;  1IRZ A;  2UXN A;  2R93 J;  2NAZ A;  1IJW C;  3RDI A;  1PUF B;  1APL C;  4LK1 F;  2RC4 A;  3HM5 A;  5LHG A;  5D5W B;  3Q0W A;  2F4M B;  3FXM A;  5JLX A;  1VZ0 A;  1ON1 A;  2VKE A;  4L18 B;  4HV5 A;  1LFP A;  2FUG 2;  2IVM A;  2AHQ A;  1Y6I A;  5AIP A;  1R1U A;  4HBL A;  3V8K A;  4V2F A;  1GLN A;  3AFH A;  3FMQ A;  2YX4 A;  3DBL B;  3M8J A;  4MFD A;  2XV4 S;  4Q5S F;  3U1K A;  3J7A Y;  2HQR A;  1S29 A;  4CIC A;  1S7A A;  2A07 F;  2NVX J;  2XRO A;  2BW3 A;  3C2B A;  1MZB A;  3CD6 I;  3ZOB A;  1I50 J;  4HQM A;  3K4B A;  3F8F A;  4CZC A;  4G94 A;  5FKO A;  4II3 A;  1Q1H A;  1XGN A;  3TGN A;  3HTA A;  2M7A A;  3P9C A;  3K10 A;  2JVH A;  5H6Q A;  2WGB A;  1POG A;  3LMM A;  2FBH A;  4KN7 X;  1O4X A;  1J9I A;  1SD7 A;  5FMP A;  2DTR A;  1ZG5 A;  2B3W A;  5F04 A;  1B9N A;  2IGN A;  3ECH A;  1O3Q A;  3I4N J;  3KP5 A;  1LKX A;  1VQK I;  1FOW A;  1MJ9 A;  5KAI C;  5GAH J;  1BOA A;  4PJM A;  2DFI A;  2QKM B;  2V6E A;  1JUM A;  2H1K A;  3OR2 C;  4OWR B;  2K85 A;  1MNE A;  2I10 A;  3P9T A;  2E5Z A;  2QCO A;  2ZXW H;  3EUK L;  4ZDL A;  4LIU A;  3DPT A;  5EDN A;  1YTY A;  1W36 C;  4ACI A;  5JLW A;  3EUA A;  1U6G A;  2K7L A;  2X85 A;  3QP5 A;  3E6C C;  1XSD A;  2WWY A;  2PX9 A;  5EZG A;  1PYV A;  2HGC A;  1Z67 A;  3FXJ A;  2UXO A;  3H36 A;  4EM2 A;  5FKL A;  4N4N B;  2GBY A;  1TWG J;  3CRJ A;  1BC7 C;  4ENK A;  4RGS A;  4XKW A;  1LB2 A;  3SDB A;  2E36 A;  4DYC A;  4XLN F;  2K86 A;  3Q9S A;  4G9Y A;  4HNV A;  1VQP I;  1P4W A;  2Q1Z B;  2JA5 J;  2OER A;  3DV8 A;  4IPA A;  4A0Z A;  2V1X A;  3GEU A;  5J1Y A;  1YJN I;  1MIJ A;  4XKB A;  2A69 F;  4RM2 A;  1FBQ A;  1RPW A;  2I5U A;  2BY2 A;  2M7B A;  4ZDP A;  3COA C;  2ZY9 A;  4IHW A;  1QNT A;  2MAB A;  1B72 B;  4X6A J;  1Z7L A;  3H5N A;  1V5G A;  2DJN A;  3C2G A;  3RJP A;  3K69 A;  2JUG A;  4EEF G;  4DNC A;  4B48 A;  2G0E A;  2VE8 A;  1WKM A;  3FM3 A;  2L4M A;  2K40 A;  3CJN A;  2KDZ A;  2DN0 A;  5FB2 A;  3F1B A;  2O8X A;  1RR7 A;  1W36 D;  2EPF A;  4BAC A;  2AS5 F;  5CXI A;  4NEL A;  3WHC A;  2P7C B;  4U7D A;  2DW4 A;  4G8X A;  3L2W A;  3ZQI A;  4PXI A;  4XKC A;  5CPR B;  5E3N A;  2GIZ A;  4B1R A;  3DPU A;  1TL8 A;  4JX4 A;  1Z9C A;  4G6Q A;  2F2E A;  3CUO A;  5HS9 A;  2XAU A;  3BP8 A;  3VVZ A;  2MW8 A;  3N05 A;  3EUH A;  1NG7 A;  2BY3 A;  3KIO A;  5E1Z B;  4F93 B;  3QRF F;  2OTL I;  1XMA A;  3IH4 A;  1E3H A;  4H4K C;  2J5O A;  2K02 A;  4CSW A;  3F23 A;  1N75 A;  4F92 B;  5TIS C;  4IKF A;  2LY2 A;  2IJL A;  3EYI A;  1NHA A;  1T0F A;  2CW7 A;  1R7J A;  2CFX A;  4N9I A;  2R3S A;  2PI0 A;  4A3C J;  1Z91 A;  4CXF A;  1K4S A;  1R1V A;  4L9V A;  2V9P A;  4UUS B;  1FWZ A;  5BQT A;  1E0E A;  3ABM H;  4BH9 A;  1X1B A;  4ESB A;  4R79 A;  4OIO F;  4AC0 A;  2XDV A;  2LG4 A;  3ZGK A;  2E2H J;  1YIO A;  2DOE A;  1WH7 A;  1Z77 A;  2XGC A;  4A5N A;  1R23 A;  2HOS A;  5HNF A;  4B8X A;  1P2F A;  4J00 A;  5CJ9 A;  1ACI A;  2HKO A;  3ZMV A;  1F36 A;  4UB8 C;  3PM1 A;  5JHF A;  1BOB A;  4OOI A;  3TOA A;  2D5V A;  1B4A A;  2B1E A;  3BR5 A;  4BY1 J;  2XAQ A;  5CXG A;  5M5W J;  4C3H J;  2GAU A;  2ESN A;  5C44 J;  2ZJP F;  1U0J A;  2PZ9 A;  4KIS A;  6PAX A;  1VF9 A;  2NOJ B;  4GCK A;  5FFX A;  3S1N J;  5L3D A;  5EEA A;  5K7F A;  3MKZ A;  2VXD A;  2DOA A;  1IDY A;  4QIW N;  2FBK A;  5IOZ A;  4Y3O A;  4LIT A;  3I3L A;  3K70 C;  3HDD A;  4RB0 A;  5F0C A;  4UUV A;  4PCQ A;  3PJR A;  2JPB A;  2MC3 A;  4OMZ A;  1YJ9 I;  2PEX A;  4PZJ A;  3VIB A;  2Y31 A;  3MKW B;  4FX0 A;  2EZL A;  4R1H A;  1FYK A;  5H6R A;  4RB2 C;  3KPH A;  5EFY A;  3BRO A;  2VI6 A;  1H88 C;  1JUS A;  3IRQ A;  3MVP A;  3K4K A;  1SAU A;  1O3T A;  3EGQ A;  4LLL A;  4EQQ A;  4IRG A;  4O6J A;  2O9L A;  1T56 A;  4LMY A;  3OYB A;  4A3K J;  3HRS A;  5J4Y A;  3KP4 A;  2MH9 A;  3JRI A;  1ZLJ A;  3KLO A;  4HF0 A;  5L3C A;  2H09 A;  5HLT A;  1ITY A;  3W2W A;  3I64 A;  3E7L A;  1QO0 D;  2AQE A;  2O8K A;  3KEY A;  3A1Y A;  2LKX A;  3DCF A;  2ZSI B;  3GLL A;  3LAJ A;  3GTK J;  2FA5 A;  3HKZ A;  3OYF A;  2DPU A;  3G2B A;  4F55 A;  3M9A A;  3MZY A;  3S3M A;  1TWH J;  1W0U A;  5LEK A;  4KUM A;  3PNV A;  3VDX A;  5DTD A;  3S1M J;  2FOK A;  2EQR A;  3GZ5 A;  3LSP A;  4J19 A;  1R00 A;  1S3J A;  1BI1 A;  2ACJ A;  2XAJ A;  1EA3 A;  3WG9 A;  1P7I A;  3ON4 A;  1LEA A;  2NOG A;  1W5C C;  2LKS A;  2ELK A;  3Q0V A;  3CCU I;  2ZFU A;  1WJF A;  2TCT A;  3GW2 A;  5AON A;  2L7F P;  2Q2E B;  1RES A;  3RKX A;  1D8J A;  3GUD A;  3ZQG A;  1L3L A;  5C4X J;  3J81 K;  3T6N A;  2E19 A;  2IS4 A;  2CMP A;  3IAS 2;  2A5Y B;  3L7W A;  3CUQ B;  3WTT C;  3E5Q A;  2X1E A;  1X4P A;  3Q9V A;  1B8I A;  3ZMD A;  3CCR I;  4RA2 A;  1K79 A;  2DK5 A;  5DYM A;  5D8L B;  1RNL A;  2DT6 A;  2BE5 F;  3GZ6 A;  2JRM A;  3ZQC A;  3NXC A;  4LK0 F;  3AQT A;  5DEQ A;  3IWZ A;  3LL7 A;  1A35 A;  3LA7 A;  3BR3 A;  5DM7 F;  4MK6 A;  4LLN A;  1XDU A;  2D1V A;  4XMY A;  1D1A A;  3T8R A;  2V6C A;  3C7J A;  3QU3 A;  3V42 A;  2M4G A;  1FY7 A;  3RH2 A;  4F91 B;  1FOK A;  2L9S A;  3H9J A;  3A02 A;  3ZQQ A;  2VQG A;  3M1C A;  2GA1 A;  1PP7 U;  5K7H A;  2G7S A;  1AKH A;  5FGL A;  5DCM B;  2UZK A;  4GCV A;  5LHI A;  1YQA A;  5F27 A;  1IXS B;  4DJA A;  1TWC J;  1MSE C;  1IV8 A;  2WA0 A;  4HOB A;  4G6T B;  2HYT A;  2IRF G;  1LDK B;  2BV6 A;  5E8I A;  4FQG A;  1X1C A;  2P0W A;  2KMU A;  2P81 A;  3D0S A;  5M5Y J;  1XN7 A;  4LB5 A;  2MD0 A;  3KYC B;  1XB4 A;  4R8H A;  1XCV A;  4KA4 A;  2W24 A;  4EAT A;  5E3O A;  2OBP A;  3HSR A;  2HS5 A;  1N78 A;  5F0F A;  2FF4 A;  4AID A;  4YZE A;  1IW7 F;  1VQM I;  2W48 A;  4Q4Z F;  1ETQ A;  1HQC A;  3BDD A;  2DAO A;  3V78 A;  1XMX A;  1BA5 A;  2NYX A;  3BJO A;  1XDS A;  2BYV E;  1XPX A;  3HIM A;  1I27 A;  4NHJ A;  2O6G E;  2LMD A;  5HLG A;  3FZV A;  4AC6 A;  2X1D A;  4HYE A;  2HXI A;  3SDG A;  1LUJ B;  3AQS A;  3NS4 A;  4RAZ A;  1RC9 A;  1G59 A;  2R0Q C;  2G7G A;  1JGS A;  3C1D A;  4ZTJ A;  3DBH B;  4ANJ A;  3BCA A;  2V57 A;  3WU1 B;  3HTH A;  3VYR B;  4B4C A;  3HOW J;  2G7H A;  3FM5 A;  4BJ5 C;  3GTJ J;  1K6Y A;  2XPV A;  2L7K A;  1O3R A;  1X58 A;  2PMU A;  4IJA A;  4CGR A;  4CCJ A;  3GLX A;  3ZCO A;  5B66 C;  4L5E A;  3LWF A;  1LE8 A;  1R9T J;  3GME A;  4U9N A;  2HZT A;  2JMW A;  2KZG A;  1YIT I;  3BCB A;  4NC8 A;  4U9L A;  2IT0 A;  5LBQ A;  1X2M A;  1ZGW A;  3DQV C;  2HZD A;  4N9H A;  2BHZ A;  3EUP A;  2E35 A;  2M9H A;  3PIO F;  4NUB A;  2FNP A;  2HKU A;  5F1R A;  1MD0 A;  2K27 A;  3K6G A;  2CRG A;  1E3P A;  3GXO A;  5E1X A;  3K2Z A;  2XB5 A;  4HST A;  4IX7 A;  4XM3 A;  3SHF A;  1I6X A;  2DTZ A;  3L1P A;  1HSJ A;  4NNJ A;  2UXX A;  2XAG A;  5J3L A;  4AIH A;  3FKJ A;  4C3J J;  3L2U A;  2EIL H;  1VQ4 I;  1BN5 A;  1QGP A;  2H6C A;  3JSP A;  3W6V A;  4PJ0 C;  4QWQ A;  4RAG A;  5CW8 A;  2O7O A;  5F0H A;  2QSH X;  2CV0 A;  1HDD C;  5EGO B;  4HZF A;  1JKP C;  1ORK A;  1E17 A;  2KL4 A;  2STT A;  2CG4 A;  3V6G A;  2Y30 A;  3W3C A;  3A0B C;  1TW2 A;  4XK4 A;  4BXF A;  1TLH B;  4KNY A;  2P5V A;  1TP4 A;  5GPA A;  3RKW A;  3R60 A;  2R7T A;  3FXO A;  4BHP A;  3KP2 A;  1VQ8 I;  4NQW B;  1Y56 A;  3OR1 C;  3LST A;  1Z3X A;  3GFL A;  4CUG A;  4N0B A;  2Z16 A;  1OYI A;  1EH7 A;  1MMN A;  2CSO A;  2FQ3 A;  2O5R A;  1GHC A;  1U3E M;  1FYL A;  4YRV A;  1PUE E;  3LQR A;  2X6O A;  3ZQL A;  4RDU A;  3F8M A;  1X3Z B;  2JA6 J;  2KDO A;  1ZYR F;  3KCC A;  5IP9 J;  5EZH A;  2IEK A;  1UEL B;  1D3Y A;  2EV6 A;  5FRN A;  4YFN F;  4C2M J;  1S72 I;  1OCZ H;  2HVR A;  2V26 A;  2KRC A;  2JT1 A;  2OZ6 A;  2P7V B;  3S32 A;  4MO7 A;  4NQW A;  3CCQ I;  2XIG A;  3I59 B;  5EYR A;  4A3E J;  1F4K A;  3SQN A;  3VYS B;  2EZI A;  1NK3 P;  2EZH A;  3BRU A;  3VP5 A;  1QZZ A;  3I58 A;  2Y0S N;  1JHF A;  2H27 A;  4KMF A;  3LSR A;  4A0Y A;  2YR2 A;  3HTS B;  3D5S C;  4WXC A;  2PG4 A;  1T98 A;  4M3B A;  4LG3 A;  4BGD A;  5K1Y A;  2G7U A;  3MQ0 A;  3E5U A;  4M3E A;  2O7T A;  4B43 A;  3RYP A;  1GT0 C;  3VFZ A;  2EA2 A;  2H8W A;  3FXR A;  5IYC J;  3OSF A;  2VC0 A;  4UHT A;  1RUO A;  2PN6 A;  1G2H A;  3FK7 A;  2DLL A;  2W84 A;  1WQ2 A;  1OIS A;  2JVG A;  1W7P B;  1DQU A;  2ME6 A;  4RGU A;  2ZO4 A;  3J80 Z;  1L0O C;  3H92 A;  3GCM A;  3MD2 A;  3GTO J;  1SFU A;  2ID6 A;  4WK8 F;  1DGW Y;  2QLZ A;  4KFC A;  3EYY A;  3KYD B;  5ICE A;  3OYN A;  2MBF A;  1T2K A;  1MBE A;  3BG3 A;  1D0Y A;  2XPW A;  2R7R A;  2PJP A;  4CGZ A;  3ERE D;  2NNN A;  3PAS A;  5M3M J;  2VKD A;  2CUE A;  3FXU A;  1J75 A;  4KJZ A;  2Y2Z A;  2P6T A;  1GV2 A;  3TO9 A;  3TBI A;  2GFN A;  3VEP A;  1YX5 A;  4WX9 A;  3KLN A;  1G8X A;  2E1M C;  5EEG A;  1ZR4 A;  4E7K A;  3C07 A;  4BEH B;  2VJ4 A;  5AQC A;  1W1W E;  3OV8 A;  3BJA A;  1H89 C;  3OL3 A;  1REP C;  3PUB A;  1AKH B;  1SVL A;  2DA2 A;  4IEJ A;  1CGP A;  2M8E A;  2DA1 A;  4P9U A;  4MXM A;  2EB7 A;  4XLA A;  2WAF A;  1PDN C;  1FT9 A;  3VYU B;  4U87 A;  3GO5 A;  5DCF A;  1F1Z A;  2JPC A;  2Q0O A;  1SFX A;  3CLO A;  5J40 A;  4AD9 A;  2HEO A;  2GQQ A;  5HS8 A;  1HDP A;  5CVV A;  5HVQ C;  1OCO H;  3NRV A;  4M6X A;  3TKY A;  3HIF A;  9ANT A;  2ID3 A;  3QOE A;  3QKX A;  1TW3 A;  2M0M A;  1CQT A;  1TNS A;  2VC1 A;  4DGW B;  2PLY A;  3QPL A;  2DOD A;  2OD5 A;  2XGE A;  4XLP F;  2E7X A;  2JUC A;  3U21 A;  1IGN A;  1K7A A;  3ASN H;  3SZT A;  1X4O A;  4CYD A;  4V19 K;  3L2C A;  2HDD A;  4EJU A;  4YG2 F;  3DEE A;  2B9S A;  3VVY A;  1W4M A;  1VI0 A;  3WE3 A;  3K70 D;  2DYS H;  3JCU C;  1ETO A;  4ASN A;  1VQ6 I;  2YX7 A;  1WH5 A;  1AHD P;  1OCP A;  3GF2 A;  1KON A;  3V4G A;  2HDW A;  4YIR X;  2F4O B;  3VW0 A;  4QPQ A;  4D7M A;  1S8N A;  3RKY A;  5F64 A;  5J47 A;  2QEN A;  2RN7 A;  4OD5 A;  2RV8 A;  2VT2 A;  3TO6 A;  3CUQ A;  4J01 A;  3GVA A;  2GXA A;  2F5V A;  2V4J C;  4GCL A;  2LDU A;  1ETY A;  1Z6R A;  1MBK A;  1XGO A;  1JJ6 C;  1OMI A;  2UXU A;  1Y0N A;  1YS6 A;  3VB2 A;  3SZG A;  2F5C A;  2DU9 A;  1FIP A;  3BTC A;  1YG2 A;  3BC8 A;  3I0T A;  2EIM H;  2F5D A;  3PO3 J;  2R5Y A;  1JKQ C;  1X3W B;  4LG0 B;  3N4M A;  3FRQ A;  2QF7 A;  3I59 A;  4BE0 A;  1DUX C;  4W1U A;  1ETW A;  2CU7 A;  3JAM Z;  4M3G A;  4UVA A;  2E1N A;  4G7Z F;  2IS6 A;  2Z2S B;  4XRS A;  2UXI A;  4PFP A;  4G7O F;  2RGV A;  3S14 J;  4U0W A;  2NVQ J;  4D9J A;  5D5U B;  3IH3 A;  3ZN1 A;  3PNT A;  5L3B A;  4CYC B;  1MBH A;  2GZW A;  1K61 A;  2NRA C;  1BR4 A;  5B1B H;  4A3L J;  4UDS A;  1SFK A;  2L3D A;  1D5Y A;  1SVO A;  1K78 A;  1XD7 A;  5J1U A;  1TZL A;  3BJ6 A;  4BBR J;  3G1M A;  3CC7 I;  4EV0 A;  2Q24 A;  2LR8 A;  4IOA F;  2DG8 A;  5KNL A;  2F07 A;  2ECC A;  3ZMU A;  1AWC A;  4FX4 A;  1HXD A;  1FX7 A;  3S2D J;  2DO7 A;  4TV7 A;  1ZEL A;  4MGR A;  4ENJ A;  2B63 J;  1FZP B;  2FBI A;  2XRL A;  2ECB A;  2GOM A;  2QYO A;  2WAE A;  5E3L A;  4I6Z A;  3JRD A;  2M0C A;  2XGD A;  3OL4 A;  1X19 A;  3D5L A;  5FGM A;  4UNO A;  4O5V A;  5A2Q Z;  1JGG A;  3GTM J;  2EA4 A;  5JVG F;  2DMN A;  5KK1 A;  3RPU A;  3KET A;  3JRB A;  3ABT A;  1J7K A;  1BJA A;  5E17 F;  4GRI A;  1IUF A;  1SVM A;  5K5Q A;  4XN3 A;  3H35 A;  3A01 A;  2QA4 I;  1JI8 A;  1YS7 A;  3HC7 A;  5FRO A;  1DGR M;  2OV7 A;  3W2V A;  2FU4 A;  3D5R C;  3KP6 A;  3GFJ A;  2ZME B;  1SFO J;  2M2E A;  3T1B A;  5JFR A;  3RTR A;  3QPH A;  5DDG A;  2WAQ N;  2V9V A;  4Z2Y A;  4L9J A;  2D45 A;  1XGM A;  5F1J A;  1YI2 I;  4HNT A;  1KYZ A;  4S05 A;  4AF5 A;  5JI6 A;  3A03 A;  3G73 A;  1ZG1 A;  4M74 A;  1WJE A;  1EV7 A;  3PIP F;  1O3S A;  1W0T A;  3CCE I;  4D5C A;  1ETK A;  2W7N A;  3GFM A;  3E6D A;  3I4M J;  2GEN A;  3I55 I;  2W4S A;  1TWA J;  3IKV A;  4M9X A;  4A3D J;  1BR2 A;  4BAY A;  3OYK A;  2D2W A;  1ZGA A;  3JRE A;  3RZD J;  1VQL I;  2Q8K A;  1PVE A;  2NX4 A;  2LNB A;  4MTD A;  4XID A;  4XR6 A;  2ZOY A;  2V9K A;  5DAJ A;  1OKR A;  3DU6 A;  2A2F X;  1M1E B;  2EFO A;  4OAZ A;  3RZO J;  3TW7 A;  1FSH A;  2PMH A;  2XB0 X;  3HGY A;  1IXR C;  2JA8 J;  3TOB A;  1I6H J;  1JJ8 C;  2WUI A;  1R36 A;  3QPT A;  3EDP A;  3BZ6 A;  3PSI A;  3CCS I;  2A5W A;  3EQL F;  2ZJQ F;  3PPB A;  4XBF A;  1LFB A;  2VBX A;  2FXA A;  4DBQ A;  2CV1 A;  1W7P D;  1IN8 A;  3K1N A;  4CCL A;  5ILV A;  4L9N A;  2HPI A;  2WTE A;  1LVK A;  1SGM A;  2RHA A;  1R4M B;  3L2R A;  3K8P C;  2MLK A;  2LKP A;  1KQ9 A;  5HDN A;  5ICG A;  3K2A A;  4ITV A;  1UFM A;  4S04 A;  3IRR A;  3HHG A;  3JTH A;  2OJE D;  2QKL B;  2UXP A;  2Z99 A;  3TMO A;  2ZXJ A;  3MFK A;  2JQ7 A;  3JSJ A;  2HOA A;  4RMN A;  5EF6 A;  3DKY A;  2HWV A;  3S2W A;  3ZN0 A;  5D5X B;  3IHU A;  3KP3 A;  2ZSH B;  2Y48 A;  3QYB A;  4EJO A;  1I3Q J;  1UB9 A;  2ZFW A;  1DPU A;  3HUG A;  4B09 A;  4JL3 A;  2E7W A;  1SMT A;  2LP0 A;  1TTY A;  5CVJ A;  2BBY A;  3AAF A;  1X1P A;  3NRG A;  3HL2 A;  4EGY A;  2R7U A;  3RIR A;  2CFO A;  3I53 A;  2VQL A;  4BQN A;  1MND A;  2CUZ A;  2DQL A;  4BXU A;  4E7H A;  2XF7 A;  2HI3 A;  4GFK A;  1WFX A;  1YW8 A;  1CF7 A;  3KZ9 A;  2NS8 A;  5KAF C;  3OSG A;  4UUT A;  3PFY A;  3CQZ J;  4BHB A;  2XRN A;  2EV0 A;  3HE0 A;  2OI8 A;  3VWB A;  4NB5 A;  3RPQ A;  2IA0 A;  4MEY F;  3LSM A;  2CO5 A;  4UVB A;  3TL4 X;  5HOO A;  2BEO A;  2JJ7 A;  1QHH D;  1ZRF A;  3HOZ J;  2KLO A;  1ZH5 A;  4AIJ A;  5E1W A;  2DMU A;  2LYC A;  3OYI A;  1I3A A;  3C18 A;  2X0L A;  3DTI A;  1SFE A;  3HGG A;  2F48 A;  2Y69 H;  3MMY B;  1E3O C;  2VON A;  2HQN A;  2RAE A;  2FD5 A;  1WRJ A;  2X4H A;  2YVE A;  4IZZ A;  5E8G A;  4ZYA A;  4P9F A;  2D1H A;  4CH7 A;  1JHH A;  2B7E A;  4EGZ A;  2LC2 A;  1QPI A;  3M7G A;  3ANG A;  1QZE A;  3KEQ A;  2Q2E A;  2A05 A;  1BL0 A;  2WC2 A;  3R0J A;  1F9N A;  3ASO H;  2OTJ I;  4RB1 A;  1ONV A;  5HDK A;  1YW9 A;  4KIG A;  4XOR A;  2K3P A;  3CJR B;  2L2O A;  3IL2 A;  1XMK A;  2KJB A;  4YIF A;  4XRS G;  3HTI A;  2VLA A;  4LIV A;  5DV5 A;  3QOD A;  3OYE A;  4IL6 C;  3U2R A;  4CCM A;  3B81 A;  1WWX A;  2ICW G;  3OYD A;  2P8T A;  5TGT A;  1LEB A;  3HYI A;  2DFH A;  4BJT A;  4DZP A;  3WHB A;  2VBW A;  1O7F A;  3VPR A;  1RI7 A;  3QWL A;  4KIC A;  3CDL A;  5GP9 A;  4I09 A;  1KZH A;  2MGQ A;  5IYD J;  2KRF A;  2Y0M A;  4ZTF A;  4HF1 A;  4O3M A;  1J5Y A;  2WV1 A;  3R0A A;  5KVR A;  4A5M A;  1MDM A;  3BR6 A;  1RZ4 A;  4HRI A;  1IN4 A;  1JE8 A;  1SAN A;  2VUM J;  3VW1 A;  4OIQ F;  1JTX A;  2G3B A;  4IHT A;  4MFE A;  3VVX A;  3C3W A;  1YLF A;  3F72 A;  1SD5 A;  2DMT A;  2IS1 A;  3HPH A;  1XCB A;  3OYJ A;  1H9G A;  1TQP A;  1DU0 A;  2IW5 A;  4LLG F;  2PBX A;  3G4S I;  3FHZ A;  4M71 A;  2EZK A;  2FE3 A;  5JVT A;  1QA6 A;  3PO2 J;  2DG7 A;  3WTX C;  1KU9 A;  2MFZ A;  5FLX Z;  5CVR A;  2HFH A;  1UZC A;  2P6S A;  5LEJ A;  1W5S A;  2VJ5 A;  2LK2 A;  3FX3 A;  1G4D A;  1GVJ A;  3JSO A;  3NWS A;  3ZMT A;  3IWF A;  4ZH4 F;  4N4O B;  1ZK8 A;  4HSR A;  2LRD A;  3DKW A;  4AYB A;  4HDU A;  3NAU A;  3OYC A;  2YU9 J;  4DVY P;  3HHH A;  3LAP A;  5LD2 C;  2DPD A;  2AQF A;  1MJB A;  1MW7 A;  1QQI A;  2VL8 A;  2DA7 A;  1TT0 A;  3ELK A;  1OR7 A;  2FQ4 A;  1OQY A;  3GTL J;  4GCT A;  3VOE A;  1H9T A;  4U0Y A;  2HVQ A;  1XGS A;  3ZR8 X;  4AU7 A;  1NH3 A;  4BBS J;  3G7R A;  2CQQ A;  4L5J A;  4WXH A;  1FTT A;  4L9T A;  2BZT A;  4IHS A;  2F6C A;  1IF1 A;  2JRT A;  2H8R A;  5HAW A;  1FP1 D;  1ZTR A;  2YU3 A;  1Z1D A;  1DPR A;  5BPD A;  2C6Y A;  2ZOZ A;  1P92 A;  3EUH C;  3WOD F;  2XDN A;  2E1O A;  2KIQ A;  3HJE A;  3F0C A;  3QOP A;  4B3X A;  1HW2 A;  2KHM A;  1AA7 A;  5IY5 H;  3GTQ J;  1Y8Q B;  5HOD A;  1O7L A;  1FIA A;  2MSY A;  3CDI A;  3BPX A;  3LWJ A;  5CLS A;  2EBI A;  1TNT A;  2MA3 A;  2QVO A;  1WJB A;  3GWZ A;  3FMR A;  3BR2 A;  3HOV J;  1D1B A;  4GXO A;  1SC7 A;  1RRJ A;  2NVT J;  3UR3 C;  5BMZ A;  4HNU A;  1YX3 A;  3H3V K;  3GEZ A;  3OY9 A;  1BIA A;  1ETX A;  1VFC A;  3M8E A;  1HOM A;  1GUU A;  4RAY A;  3GTP J;  4A6E A;  4FAS D;  2LBF A;  2UUZ A;  2K9L A;  1VND A;  3ERM A;  2DI3 A;  3ISP A;  1RKW A;  1IRG A;  4RAF A;  2ZCW A;  3BG6 A;  4D0P A;  5AIQ A;  4E7I A;  1BBY A;  2A3S A;  2CW0 F;  2JSP A;  2MC4 A;  2XKP A;  3LOC A;  4YEJ A;  1LFU P;  2OQR A;  1LE8 B;  3V7C A;  3B73 A;  3SWH A;  1I1G A;  3HOX J;  1UST A;  4EM0 B;  4LGW A;  2XUB A;  3CJQ B;  4AUX A;  2FJI 1;  3WTV C;  3I4P A;  3F21 A;  5HNH A;  2JA7 J;  1UI5 A;  3S3N A;  5LRS A;  1WPK A;  4XIC A;  4EM1 A;  2DK8 A;  1TBX A;  3B6C A;  3LSH A;  4LFU A;  2CQK A;  4GYI A;  5M3F J;  3CC4 I;  2RNG A;  4Y13 A;  2JA2 A;  4WXD A;  2HOE A;  2VKV A;  5EGO A;  5J6X A;  3HBL A;  4W97 A;  5GTI C;  2K3F A;  4HF2 A;  1OJL A;  5HSZ A;  3CF2 A;  2E1C A;  3QYF A;  2QM3 A;  2UV1 A;  2L0K A;  4UVC A;  4ZC3 A;  3IP4 B;  4BNC A;  3MAJ A;  1P9Q C;  2IXS A;  2Z1D A;  5ICC A;  2V1U A;  3OYM A;  4OMY A;  2FML A;  1R71 A;  2GLO A;  1OYY A;  1S7O A;  2H94 A;  4XOP A;  1D5V A;  2F4I A;  2R7O A;  3GX4 X;  3REO A;  3HRM A;  3AG3 H;  2O03 A;  3BG9 A;  4PGG A;  2X51 A;  1PP8 F;  3O8G A;  4MHG A;  3G6E I;  2KRH A;  3SJM A;  1ERD A;  1TT5 B;  1MMD A;  2IGO A;  2V79 A;  2BXY A;  2DMQ A;  4Z6Y A;  4IQJ A;  2MD5 A;  4RLQ A;  3FF5 A;  4A3J J;  3VSL A;  2NP5 A;  5TJJ A;  1N77 A;  4ESJ A;  1EH8 A;  4IVN A;  3P9K A;  3ZMZ A;  3V8J A;  1A6I A;  5CYV A;  3OMY A;  4DOZ A;  1OPC A;  2ME0 A;  4EJW A;  4ICH A;  1V5F A;  4BE2 A;  1QHG A;  2R7X A;  3LA3 A;  4M72 A;  5L3G A;  3L2Q A;  1B8I B;  3AG4 H;  3ONQ A;  5HLH A;  1FEX A;  5HLI A;  1R6R A;  2CWE A;  3K4C A;  3ZMS A;  4BQO A;  4XLC A;  3L2V A;  1IG7 A;  5B1A H;  3KKD A;  3KE2 A;  4I76 A;  2HKX A;  2XF6 A;  5FRM A;  1XSV A;  1T6S A;  2A6H F;  4L62 A;  3R4K A;  2ZC2 A;  3AG2 H;  2X6X A;  3NEU A;  3MKL A;  3FHN A;  3J80 K;  3FBN B;  3A01 B;  3CZ6 A;  1JKR C;  5DS9 A;  4CCO A;  4IF4 A;  2ADU A;  2PQ8 A;  3G1O A;  2ZB9 A;  1VQ5 I;  2ZBK A;  3HB9 A;  5HS7 A;  4PK4 A;  3MCZ A;  3OIO A;  3BHQ A;  2EFP A;  4FHT A;  3S8P A;  3S1R J;  2PFV A;  3BR1 A;  2VQC A;  1IRF A;  2RQQ A;  3ESW B;  1V4R A;  2K9N A;  3WU2 C;  3BQZ A;  3KNW A;  2VXZ A;  2E71 A;  3F6O A;  2LY9 A;  1JXS A;  5DUI A;  2VOO A;  1MSF C;  3M4O J;  1J0R A;  5B5E C;  3DEW A;  4GYG A;  4S0H B;  4ZYE A;  2BVL A;  4I01 A;  1MMG A;  2QSF X;  4ZYH A;  1MBG A;  5FKM A;  5LHH A;  3J7Y J;  4AIK A;  4EJT A;  2R7F A;  4BU2 A;  1FPQ A;  1XS9 A;  1IV6 A;  3CMA I;  2LRE A;  3E1S A;  5EG0 B;  1Y8R B;  1WSU A;  1DP3 A;  1X1D A;  2QEX I;  2E5N A;  3OOP A;  1ZAO A;  1ON2 A;  3PUF A;  3J7Z I;  2VKH A;  5LGN A;  3VSK A;  3L00 A;  4Y33 A;  4HA8 A;  1Z6T A;  3JW4 A;  4WF2 A;  1TC3 C;  2ZNY A;  2COB A;  2HTS A;  2K9Q A;  2PMZ A;  3SXY A;  2KIU A;  3KZI C;  3RQ4 A;  1ZHF A;  2OF7 A;  3H9Q A;  4JK1 X;  1J2X A;  1BI0 A;  2WAD A;  4LD5 A;  4XRF A;  2VOD A;  2HYJ A;  2VAS A;  2Y9Y A;  2VPR A;  1TQI A;  1V54 H;  1W5T A;  3CCY A;  4G7H F;  4D1Q A;  4HG2 A;  4HLX A;  1X3U A;  3W6J B;  2VJJ A;  3HSE A;  4ENN A;  3S15 J;  3G1L A;  3DLA A;  3QYE A;  4BKX A;  2EFQ A;  3RQI A;  4IRH A;  2ISZ A;  5FFZ A;  2YSR A;  1HKT A;  3M8F A;  3B6A A;  3O2P E;  3P7N A;  3F8B A;  1S7E A;  3CCJ I;  3BTL A;  2BGC A;  4B47 A;  1XTA A;  2NS7 A;  4YEL A;  1QU3 A;  1BW6 A;  2QWT A;  1ZAR A;  1B72 A;  5FLX K;  1UMQ A;  2DA4 A;  5KCM A;  1WJC A;  3OS1 A;  4JKZ A;  1XSX A;  5DD4 A;  4E4H A;  1ZRD A;  4RS8 A;  5IT9 Z;  3FDY A;  3IUO A;  1MJA A;  2EIN H;  2EV5 A;  2L9V A;  1WJA A;  4P5O A;  5CVI A;  3P9I A;  2YPR A;  4JOM A;  4WCG A;  2DDB A;  3A0H C;  3DPL C;  3F9K A;  4A6D A;  2FOW A;  3HZJ A;  3DP7 A;  2RQP A;  3S2H J;  3BPV A;  3U9G A;  1IO2 A;  1WJ5 A;  3RSN A;  2FNA A;  3UNG C;  3CLQ A;  3H5R A;  5IT9 K;  2QTQ A;  2K5C A;  2R92 J;  4GDF A;  1Y1V J;  3SZP A;  3BTI A;  2R5Z B;  1HBX G;  2L02 A;  5DUK A;  4LG0 A;  1WZ2 A;  1FOY A;  5D18 A;  1U5T C;  3DWL E;  5FJ8 J;  2LF8 A;  1SAX A;  2M34 A;  3RI4 A;  2REK A;  3CCV I;  2R7Q A;  2NP3 A;  3C2H A;  4UB6 C;  3FXQ A;  4F7Z A;  3WE2 A;  2ISY A;  3SEQ A;  1NG6 A;  4IOC F;  3QPS A;  3PFI A;  3J7A O;  1MBF A;  2DA5 A;  3HXL A;  1GXQ A;  3FXL A;  2QBY B;  1HLV A;  1P4A A;  2RDP A;  4ME9 A;  5E3M A;  4X1E A;  5EG0 A;  4DYR A;  2O0Y A;  2OPT A;  3JRH A;  3ULQ B;  2ZME A;  2J5P A;  1Z0X A;  2QWW A;  4P1W A;  2ZKZ A;  2K4B A;  2W82 A;  3BG5 A;  5IT3 A;  3MZH A;  3BG7 A;  3DKX A;  1MGT A;  2L5Q A;  1OCR H;  2DJI A;  2Y75 A;  1A04 A;  1FYM A;  3B02 A;  1FMW A;  1BW5 A;  2EFN A;  2K9M A;  4PSW A;  5L3E A;  2RAS A;  3DPJ A;  2KKO A;  4M9S A;  2STW A;  2BOL A;  3FIW A;  4G6D A;  3ZQH A;  2R4G A;  4KT5 C;  2VPL A;  2X6Y A;  1J09 A;  1BM9 A;  4L0Y B;  1B59 A;  1WI9 A;  2EIK H;  1KU2 A;  1H0M A;  2WBM A;  3K4J A;  4ON0 A;  3PQJ A;  4QLC U;  1FP2 A;  4PUS A;  2QQ9 A;  2IGK A;  1TWF J;  2XC7 A;  1DDN A;  2E2I J;  3ROU A;  2OZU A;  3I9V 2;  1Z7U A;  1XC5 A;  1YE9 A;  4A3I J;  5J8F A;  1T8I A;  1X1A A;  2CQN A;  3PNY A;  3VTI A;  4I7H A;  4JNN A;  3AKZ A;  3CC2 I;  4IQ4 A;  1V3F A;  1SD6 A;  5ILU A;  2R7D A;  3HKZ N;  3SFZ A;  3K4N A;  4F3Q A;  2QKO A;  2Z9O A;  3S1Q J;  3BTJ A;  3UKG A;  3LQQ A;  2CUF A;  5JR3 A;  2NVY J;  2W53 A;  1AOY A;  4E70 A;  4BXX J;  3ABU A;  4FTH A;  2XAS A;  1JTY A;  3R61 A;  1OFC X;  4FE7 A;  2CW8 A;  2OCE A;  4M6V A;  3LJL A;  3MWM A;  2DT5 A;  3AL0 C;  3ZQF A;  1HA8 A;  2BY0 A;  5CQE A;  3T0Y A;  3ZXS A;  1ZQ3 P;  3LHQ A;  2N8G A;  2P5L C;  5BOX A;  2LD5 A;  2W00 A;  2VB6 A;  3TW6 A;  1Y0U A;  3VYT B;  1UJ8 A;  2E34 A;  1GV5 A;  3ON2 A;  1HW5 A;  1IDZ A;  5JHU A;  3BR0 A;  3D1N I;  2GXB A;  1UCR A;  2F5E A;  5IYB J;  2JZY A;  5LGU A;  3A2K A;  3NNR A;  4XN0 A;  4IHY A;  2D6Y A;  3OIQ A;  1MMA A;  3JRF A;  3EET A;  3GZN B;  3E3V A;  1K83 J;  4XON A;  3I56 I;  4OU0 A;  5F08 A;  4Q47 A;  2BW3 B;  3HOS A;  2KZV A;  2W57 A;  2IP2 A;  1P6R A;  3K1M A;  3JAM K;  3QBM A;  1OR7 C;  1A6Q A;  4UXN A;  4ENM A;  5D4R A;  1MMS A;  2COM A;  4YFK F;  4I99 C;  1T38 A;  2L9N A;  4C3I J;  4FE4 A;  1X2N A;  1STZ A;  2HYG D;  4Y17 A;  4I2O A;  3LSG A;  1UHS A;  4PFO A;  4DYQ A;  2M1B A;  4HX8 A;  4AVP A;  1ZKG A;  3OYG A;  2G7L A;  1WI3 A;  2FSW A;  3FWE A;  3WGH A;  2VE9 A;  1MDM B;  1VQ7 I;  4KWA A;  3RD3 A;  3WGI A;  1U5T A;  1R4N B;  3HOT A;  2I8D A;  2R7W A;  1T33 A;  1ZLK A;  3A4C A;  4XLE A;  4OAY A;  4M3D A;  1QVU A;  3BQY A;  1D0Z A;  2CYY A;  5KHD A;  1EH6 A;  1ZN2 A;  3IAM 2;  4PJL A;  2IGM A;  2FX0 A;  5EJC A;  2NS0 A;  4MQ9 F;  5K5O A;  2PJR B;  1TQM A;  4BEH A;  2DOF A;  4DQ2 A;  3E6B A;  2WB1 N;  1Y1W J;  4BQQ A;  1YW7 A;  1DP7 P;  2K4J A;  5IOY A;  1DU6 A;  1YIJ I;  1LVA A;  1K6O A;  1QBJ A;  3BCG A;  5BPI A;  4C2M A;  3BY6 A;  4BQA A;  4CCN A;  1FC3 A;  3TP0 A;  3GFI A;  3Q5F A;  1WHU A;  4V2G A;  2ELJ A;  3QQA A;  4CYC A;  2CS3 A;  5GPC A;  2OCC H;  4NN1 A;  2Z3Y A;  4PDK A;  3DF8 A;  2GOX B;  5LGT A;  2QQB A;  3CJT B;  1B1B A;  3H0D A;  1LPQ A;  1ULY A;  4I0A A;  1R22 A;  3OWT A;  4C30 A;  4RLF A;  3Q3S A;  4HLY A;  2JK3 A;  3AG1 H;  2EFW A;  3G71 I;  2LOO A;  3LFK A;  1G3T A;  3HTU A;  4I0B A;  3DXJ F;  4I98 B;  4KIF A;  3K4L A;  1ODD A;  2DYR H;  3NPI A;  2DDA A;  2K9S A;  2OA4 A;  1BR1 A;  4JYK A;  3RCO A;  2OUM A;  2DFE A;  3MEX A;  1UHM A;  4HQE A;  2DFF A;  3H5A A;  4D7N A;  3Q0U A;  3QAH A;  4BHC A;  1Y39 A;  2RVC A;  1HCR A;  3VOX A;  2LY1 A;  3VOK A;  1GDT A;  4FIS A;  4CA0 A;  3K0L A;  4B3A A;  1AU7 A;  2HQ5 A;  3WGG A;  3BWG A;  2B0L A;  1XX5 A;  2Y0S A;  5M5X J;  1W7P A;  1UHW A;  1QVT A;  3BJB A;  4ZDO A;  2BY1 A;  2YVX A;  2LFB A;  2LSO A;  5FHP A;  4DBR A;  1PJR A;  4XNF A;  3JRC A;  1B6A A;  2KP6 A;  3RYR A;  1YRN A;  4YFX F;  4EVI A;  1A36 A;  5IP7 J;  2XGX A;  3OYA A;  3S93 A;  1IXC A;  2A68 F;  1P4X A;  4Y52 J;  3VUQ A;  2WV0 A;  4UV9 A;  5F6F A;  5FKK A;  4M73 A;  4ESF A;  1N25 A;  4IXA A;  3S16 J;  4GO1 A;  2W85 A;  4MEX F;  1EJ9 A;  5H20 A;  4A3B J;  2M4K A;  4HX4 A;  1U78 A;  1UI6 A;  1F5T A;  2KQR A;  3G3Z A;  5GAG J;  1LDD A;  2DBB A;  5D1R A;  4E7L A;  2IU5 A;  3W6K B;  2ZCN A;  2QUF A;  3X2Q H;  3KZZ A;  3SYT A;  4RBO A;  4XSX F;  3ZQ7 A;  4PJJ A;  4RM3 A;  2CV2 A;  3LSI A;  4RGX A;  3BT9 A;  4FT8 A;  5DCM A;  2A61 A;  4RB3 C;  2ELH A;  3VOD A;  4D5F A;  4FCY A;  1CF7 B;  2M8G X;  3GTG J;  1PUF A;  1A5J A;  5E79 C;  2OQG A;  2W1O A;  4XLF A;  2XPU A;  2VIX A;  1KU3 A;  4DZJ A;  3O60 A;  5ICF A;  3O6B B;  4M3F A;  4L0Z B;  3VW2 A;  1ZR2 A;  5J8C A;  3RKQ A;  5FLM J;  1IN5 A;  2L7M P;  1V5E A;  1R49 A;  3E7Q A;  2KT0 A;  1R5H A;  5C3E J;  1FSE A;  1MBJ A;  2BHY A;  2XHK A;  3LFU A;  3M07 A;  4QPO A;  2O61 A;  4BDZ A;  1V55 H;  3JR9 A;  3WG7 H;  2OAZ A;  3ZRG A;  4BDY A;  3V7S A;  1R5G A;  1T0F C;  4NDL A;  5ERI A;  1G6N A;  1A31 A;  2W25 A;  2RKH A;  3CES A;  4U7B A;  1U2W A;  1ENH A;  3LA2 A;  1IAW A;  1UG2 A;  3H3Z A;  2YS9 A;  3GZI A;  2M45 A;  1QRY A;  1VQO I;  2MG4 A;  4MTE A;  3I71 A;  2LTP A;  3TED A;  1VQN I;  3KYL A;  5A2Q K;  3COL A;  2HOT A;  1S6L A;  4A3F J;  1FBU A;  2DQR A;  3KEO A;  4EJV A;  1ETV A;  1SMY F;  4JP0 A;  3CMM A;  3SEZ A;  2V1N A;  1Z05 A;  5LRR A;  2FRH A;  1SEU A;  2AO9 A;  2QIB A;  2R7S A;  1WCM J;  3DEU A;  1KGS A;  2LVS A;  4K2E A;  3F8C A;  3K7A J;  3DTK A;  3WTU C;  2CJJ A;  3KFW X;  3ZPL A;  4E7J A;  4QSH A;  4II2 A;  3CP2 A;  1JT0 A;  5FKN A;  1EKE A;  3RPU D;  1T39 A;  2H1L A;  2P4W A;  1MH4 A;  1I39 A;  1RR8 C;  3CTA A;  1T95 A;  5DD8 A;  3BOQ A;  1YO5 C;  1K78 B;  1BI2 A;  1F43 A;  1K4T A;  1P7J A;  4PSX A;  1SD4 A;  1OLT A;  2GM4 A;  3LNQ A;  2E2J J;  2L01 A;  2NVU B;  3MN2 A;  1USS A;  4KN4 X;  3E5X A;  3PQK A;  5D8K B;  2CH0 A;  4LB6 B;  1XG1 A;  1R5I D;  5ILS A;  3IH2 A;  2BXZ A;  4CO8 A;  2Y9Z A;  2UWM A;  3CMY A;  3QP6 A;  1KA8 A;  2EWN A;  2QZ8 A;  2VN2 A;  1IZ1 A;  4PJN A;  5LFA A;  1IN7 A;  3MZ8 A;  3WU0 A;  4MLO A;  3MNL A;  3H9G A;  2KIM A;  1NTC A;  3GYH X;  1C0W A;  5J4V A;  3HUG B;  3F6V A;  5LLQ A;  5GAD J;  5H2F C;  4C2U A;  2TDX A;  4HPQ A;  3FXK A;  4XOT A;  4U88 A;  4JX6 A;  1WVR A;  2ZXH A;  4A2U A;  1HF0 A;  1D1C A;  4MQV A;  1Z3Y A;  4KMU X;  4UV8 A;  2QSG X;  4ETS A;  1VTN C;  1HST A;  1KQ0 A;  2EIJ H;  2YUS A;  1B9M A;  1OCC H;  3FMS A;  3L09 A;  3L9F A;  2PFB A;  3CCL I;  3OYH A;  3M3Y J;  4UY8 I;  2KPM A;  2DCE A;  2ZCX A;  1FBS A;  3IC7 A;  1R58 A;  3WTW C;  3N97 A;  3FK6 A;  2M87 A;  4FET A;  5BNG A;  1QPM A;  2IA2 A;  5B3S H;  2DA3 A;  1FNN A;  1VQ9 I;  1HKQ A;  2A6E F;  5FD5 A;  4X0G A;  2DT7 B;  5C4Y A;  3NI7 A;  1LQ1 A;  1KQ8 A;  4DIQ A;  4KIT B;  4Q48 A;  2KIF A;  2CQ7 A;  2IPQ X;  3CO6 C;  1I5Z A;  4E7S A;  4A3G J;  3WTS C;  2VBZ A;  3F8N A;  2ZNZ A;  1G3Y A;  3E0J B;  1H8A C;  4ZJZ A;  2IS2 A;  4MNU A;  4C9Y A;  2AXT C;  3HOU J;  3EPZ A;  2WY7 Q;  3S3O A;  1ZGJ A;  4GGG A;  3HEF A;  4CZZ A;  2X1C A;  1E2X A;  2RNJ A;  3W2A A;  3OS2 A;  2LH9 A;  2WY8 Q;  3R6S A;  1ZG3 A;  4L5I A;  2XAH A;  2VT3 A;  2ZJR F;  5IPA A;  1RKT A;  2QQ8 A;  4IO9 F;  4RGR A;  3NQO A;  2GUH A;  4XLH A;  3QU6 A;  1U8R A;  2H6B A;  5EEH A;  1MNM C;  4IHV A;  3TDZ C;  2UXH A;  1YRN B;  3S17 J;  4AYB N;  2VOP A;  3TQN A;  1S9H A;  2MH2 A;  2IAI A;  5HDG A;  5L3F A;  4CHU A;  3CDH A;  2X9D A;  2E60 A;  2G9W A;  3H1C A;  5FD6 A;  5H9T A;  5J1R A;  2IA1 A;  3IV5 A;  5E20 A;  3KP7 A;  5D6F A;  3V8L A;  3F3X A;  2HVS A;  2ZME C;  2AXL A;  1O57 A;  3OYL A;  1FMV A;  2LF7 A;  1FJL A;  5TRD A;  2M3A A; 
#chains in the Genus database with same CATH homology
 1Y1V J;  3ZQC A;  3H0G J;  3BTI A;  2R5Z B;  3NXC A;  3AQT A;  5D18 A;  3K2A A;  4Y7N J;  5FJ8 J;  1U8B A;  2M34 A;  3BR3 A;  4MK6 A;  2UXP A;  2REK A;  2NP3 A;  1GVD A;  1EF4 A;  3JSJ A;  2HOA A;  5EF6 A;  3RH2 A;  3G56 A;  2JWT A;  1I3Q J;  2L7Z A;  3A02 A;  3GBG A;  3QPS A;  5K58 A;  1MBF A;  2TRT A;  2DA5 A;  2G7S A;  5FGL A;  5K7H A;  5FLV A;  1AKH A;  4JL3 A;  2LLK A;  2LP0 A;  4XRM A;  1HLV A;  5F27 A;  3BNI A;  3NRG A;  1TWC J;  1MSE C;  4ME9 A;  5E3M A;  4X1E A;  5EG0 A;  5C4J J;  4DYR A;  4UUS A;  2OPT A;  2XSD C;  3JRH A;  2HYT A;  1Z0X A;  3CWR A;  2R5Y B;  2HI3 A;  4GFK A;  2P81 A;  3BG5 A;  5M5Y J;  3KZ9 A;  2NS8 A;  3OSG A;  4UUT A;  3CQZ J;  3HE0 A;  2OI8 A;  5E3O A;  3HOY J;  5F0F A;  1BW5 A;  4YZE A;  2W48 A;  2RAS A;  1BJZ A;  3DPJ A;  1ETQ A;  2FBQ A;  1IC8 A;  2JJ7 A;  3FIW A;  3HOZ J;  3ZQH A;  3V78 A;  2DMU A;  2IBD A;  1BA5 A;  4IHX A;  3JRG A;  3HGG A;  2E2I J;  2EH3 A;  1RET A;  1TWF J;  1U9N A;  2JN6 A;  1E3O C;  3HIM A;  3TP3 A;  1XC5 A;  4AC6 A;  2HXI A;  2RAE A;  3SDG A;  4A3I J;  2FD5 A;  4GFB A;  4A3M J;  5K7Z A;  2YVE A;  3AQS A;  4JNN A;  4MIM A;  1NK2 P;  2HXO A;  3LSJ A;  2R0Q C;  2DMP A;  1QPI A;  2G7G A;  3ANG A;  3HKZ N;  2V57 A;  2QKO A;  1BL0 A;  3HTH A;  3IUV A;  4B4C A;  3HOW J;  3S1Q J;  3BTJ A;  3GTJ J;  3UKG A;  2CUF A;  2R7Z J;  2NVY J;  2XPV A;  5IP6 A;  2W53 A;  3NAR A;  4BXX J;  4FTH A;  4BY7 J;  1JTY A;  1X58 A;  1OFC X;  4FE7 A;  4M6V A;  3LJL A;  4CGR A;  3ZQF A;  4L5E A;  1MH3 A;  3HTI A;  3FIS A;  4XRS G;  4A69 C;  2N8G A;  1R9T J;  1Q1V A;  3O8H A;  1LE8 A;  1ZQ3 P;  3LHQ A;  1OCT C;  3KKC A;  2JMW A;  4DW6 A;  2LD5 A;  3SFI A;  3TW6 A;  3B81 A;  1JT6 A;  4JX5 A;  4DZP A;  1JKO C;  2QOP A;  1GV5 A;  3WHB A;  3ON2 A;  1X2M A;  1ZGW A;  1IDZ A;  3VPR A;  3BR0 A;  3CJD A;  5GP9 A;  3CDL A;  3D1N I;  5IYB J;  5IYD J;  2MGQ A;  3EUP A;  3NNR A;  2M9H A;  2FJ1 A;  4IHY A;  2D6Y A;  3JRF A;  4ABZ A;  2HKU A;  2WV1 A;  1K83 J;  3BR6 A;  2CRG A;  5F08 A;  3ANP A;  4HKU A;  1SAN A;  2XB5 A;  2VUM J;  3VW1 A;  2DTZ A;  1JTX A;  2L9R A;  3L1P A;  2G3B A;  3QBM A;  3OOU A;  4MFE A;  3VVX A;  5J3L A;  2DA6 A;  2ZCM A;  2DMT A;  4C3J J;  5HBU A;  2PMZ N;  3S5R A;  4C3I J;  4FE4 A;  1X2N A;  1DU0 A;  2PBX A;  3W6V A;  2EZK A;  1UHS A;  3LSG A;  4QTR A;  3PO2 J;  2DG7 A;  5CW8 A;  4DYQ A;  2O7O A;  5F0H A;  1ZKG A;  1HDD C;  5EGO B;  3FKI J;  2G7L A;  1WI3 A;  2R5Z A;  1JKP C;  4A93 J;  1ORK A;  4KWA A;  2LK2 A;  3RD3 A;  3V6G A;  5D19 A;  2Y30 A;  1T33 A;  4XK4 A;  1ZK8 A;  4M3D A;  1QVU A;  3BQY A;  2YU9 J;  3NAU A;  5GPA A;  2YVH A;  2FX0 A;  1JUP A;  1U9O A;  2DA7 A;  4LOC A;  2CQX A;  4G12 A;  2WB1 N;  2X48 A;  2FQ4 A;  1Y1W J;  4GFL A;  3GTL J;  4GCT A;  1DU6 A;  3BCG A;  5IOY A;  3G7R A;  4BBS J;  3HTJ A;  2CQQ A;  1FTT A;  2X6O A;  3TP0 A;  3ZQL A;  4RDU A;  3JRA A;  4V2G A;  2JA6 J;  3QQA A;  2H8R A;  5HAW A;  1FTZ A;  4CYC A;  1ZTR A;  5IP9 J;  5EZH A;  2IEK A;  2ZOZ A;  5GPC A;  1WGX A;  1IRZ A;  2XDN A;  4C2M J;  2E1O A;  2R93 J;  4NN1 A;  1IJW C;  3F0C A;  1PUF B;  1APL C;  3HM5 A;  4MO7 A;  3Q0W A;  3GTQ J;  5EYR A;  5JLX A;  4A3E J;  5HOD A;  2VKE A;  1FIA A;  2EZI A;  2MSY A;  1NK3 P;  2EZH A;  3Q3S A;  2JK3 A;  3BRU A;  3VP5 A;  2AHQ A;  3LWJ A;  2EBI A;  2Y0S N;  4V2F A;  3LSR A;  3BR2 A;  3HOV J;  3NPI A;  4M3B A;  2NVT J;  2K9S A;  4JYK A;  4MFD A;  4M3E A;  2O7T A;  3H3V K;  1GT0 C;  4D7N A;  1ETX A;  1VFC A;  3Q0U A;  5IYC J;  1HOM A;  3OSF A;  1GUU A;  3GTP J;  1HCR A;  2NVX J;  3VOX A;  1G2H A;  3FK7 A;  3C2B A;  3VOK A;  1GDT A;  4FIS A;  1VND A;  3ZOB A;  4B3A A;  1I50 J;  1AU7 A;  2ME6 A;  2HQ5 A;  1RKW A;  5FKO A;  5M5X J;  3HTA A;  1QVT A;  3GTO J;  2WGB A;  3BJB A;  1POG A;  2ID6 A;  3LOC A;  2LFB A;  1LFU P;  5FHP A;  1O4X A;  5FMP A;  3JRC A;  1LE8 B;  1MBE A;  3BG3 A;  2XPW A;  5F04 A;  3HOX J;  1YRN A;  3PAS A;  5M3M J;  5IP7 J;  2CUE A;  2Y2Z A;  4AUX A;  3I4N J;  1GV2 A;  4Y52 J;  3VUQ A;  2GFN A;  5FKK A;  3S16 J;  2JA7 J;  1UI5 A;  3C07 A;  1ZR4 A;  1JUM A;  1WPK A;  2H1K A;  4XIC A;  4A3B J;  5AQC A;  1U78 A;  1H89 C;  2I10 A;  3B6C A;  5M3F J;  1UI6 A;  2QCO A;  3P9T A;  4ACI A;  5EDN A;  5D1R A;  1AKH B;  5JLW A;  2IU5 A;  2DA2 A;  4IEJ A;  2ZCN A;  2VKV A;  2DA1 A;  5EGO A;  3HBL A;  4MXM A;  5EZG A;  4W97 A;  4RBO A;  1OJL A;  2UXO A;  5HSZ A;  5FKL A;  3BT9 A;  2GBY A;  1TWG J;  3CRJ A;  2L0K A;  1HDP A;  4D5F A;  4FCY A;  2M8G X;  3GTG J;  4DYC A;  1PUF A;  9ANT A;  1A5J A;  2ID3 A;  2XPU A;  4HNV A;  3QKX A;  4DZJ A;  3O60 A;  1CQT A;  2JA5 J;  2OER A;  2GLO A;  4M3F A;  3QPL A;  3VW2 A;  1ZR2 A;  2XGE A;  5J1Y A;  3GEU A;  3RKQ A;  1IGN A;  1RPW A;  5FLM J;  2L7M P;  3BG9 A;  3E7Q A;  2KT0 A;  4IHW A;  3O8G A;  5C3E J;  1B72 B;  2HDD A;  3SJM A;  4X6A J;  3VVY A;  1MBJ A;  2DJN A;  1VI0 A;  4EEF G;  3JR9 A;  2G0E A;  1ETO A;  2DMQ A;  1WH5 A;  1AHD P;  1OCP A;  4NDL A;  2K40 A;  2KDZ A;  4A3J J;  2DN0 A;  2NP5 A;  3F1B A;  3VW0 A;  1RR7 A;  1ENH A;  4D7M A;  5CXI A;  4NEL A;  3WHC A;  1UG2 A;  1A6I A;  2YS9 A;  3GZI A;  2ME0 A;  4ICH A;  3ZQI A;  4PXI A;  1QRY A;  2MG4 A;  5E3N A;  1B8I B;  2LTP A;  3TED A;  3COL A;  4B1R A;  2HOT A;  1FEX A;  4JX4 A;  1IG7 A;  4A3F J;  4GCL A;  1ETY A;  1ETV A;  4JP0 A;  1MBK A;  2MW8 A;  3KKD A;  3VVZ A;  4I76 A;  1JJ6 C;  2UXU A;  4L62 A;  2AO9 A;  3IH4 A;  2QIB A;  1FIP A;  3MKL A;  3BTC A;  1WCM J;  2LVS A;  3K7A J;  3PO3 J;  2R5Y A;  1JKQ C;  3A01 B;  1JKR C;  2CJJ A;  5DS9 A;  3FRQ A;  3G1O A;  4QSH A;  2QF7 A;  2ZB9 A;  1JT0 A;  5FKN A;  3HB9 A;  4W1U A;  1ETW A;  2CU7 A;  4M3G A;  1MH4 A;  4XRS A;  4A3C J;  3OIO A;  2UXI A;  3BHQ A;  3S14 J;  4UUS B;  3S1R J;  2NVQ J;  3BR1 A;  3IH3 A;  1F43 A;  4CYC B;  1MBH A;  1P7J A;  1K61 A;  2K9N A;  4AC0 A;  2GM4 A;  3BQZ A;  3LNQ A;  2E2H J;  2E2J J;  4A3L J;  3KNW A;  1WH7 A;  1Z77 A;  1D5Y A;  4UDS A;  2XGC A;  3MN2 A;  2HOS A;  2LY9 A;  5J1U A;  4BBR J;  3G1M A;  3M4O J;  2Q24 A;  1MSF C;  1XG1 A;  2LR8 A;  3DEW A;  3IH2 A;  1F36 A;  2Y9Z A;  4S0H B;  3PM1 A;  3CMY A;  2DG8 A;  2F07 A;  2ECC A;  1MBG A;  5FKM A;  2D5V A;  3BR5 A;  3S2D J;  3MNL A;  4MLO A;  4BY1 J;  5CXG A;  1NTC A;  5M5W J;  4C3H J;  5C44 J;  2PZ9 A;  2B63 J;  1VF9 A;  2XRL A;  1XS9 A;  2ECB A;  1IV6 A;  4GCK A;  5E3L A;  4I6Z A;  3JRD A;  2M0C A;  3S1N J;  2XGD A;  4JX6 A;  5EEA A;  5EG0 B;  5K7F A;  1HF0 A;  1IDY A;  4QIW N;  5IOZ A;  1JGG A;  3GTM J;  3HDD A;  5F0C A;  2YUS A;  2DMN A;  3JRB A;  1TC3 C;  3M3Y J;  3VIB A;  2COB A;  2K9Q A;  2Y31 A;  1IUF A;  2ZCX A;  2EZL A;  5EFY A;  3A01 A;  2VI6 A;  1H88 C;  1JUS A;  2OF7 A;  3MVP A;  3FK6 A;  5BNG A;  2DA3 A;  3EGQ A;  2O9L A;  1SFO J;  1T56 A;  2HYJ A;  2M2E A;  5C4Y A;  3NI7 A;  4A3K J;  2Y9Y A;  2VPR A;  3CCY A;  2WAQ N;  3JRI A;  4A3G J;  5F1J A;  1H8A C;  4AF5 A;  3S15 J;  1ITY A;  3A03 A;  3HOU J;  3E7L A;  3G1L A;  2O8K A;  2LKX A;  3DCF A;  4BKX A;  3GTK J;  1W0T A;  3HEF A;  3RQI A;  4D5C A;  1ETK A;  3I4M J;  2GEN A;  1TWA J;  3B6A A;  4A3D J;  1W0U A;  1TWH J;  1S7E A;  3JRE A;  3RZD J;  5IPA A;  1RKT A;  5DTD A;  3S1M J;  3BTL A;  2EQR A;  2NX4 A;  4XID A;  3LSP A;  4J19 A;  2NS7 A;  2ZOY A;  1BW6 A;  1MNM C;  2GUH A;  1P7I A;  2UXH A;  5DAJ A;  4IHV A;  3ON4 A;  2QWT A;  1YRN B;  1B72 A;  2NOG A;  4AYB N;  3S17 J;  1UMQ A;  2DA4 A;  3RZO J;  3TW7 A;  2IAI A;  4JKZ A;  2ELK A;  2XB0 X;  3Q0V A;  3HGY A;  2JA8 J;  2TCT A;  2L7F P;  1I6H J;  1JJ8 C;  2WUI A;  1RES A;  2X9D A;  3ZQG A;  5C4X J;  3T6N A;  5H9T A;  3PPB A;  5J1R A;  2E19 A;  3IV5 A;  1LFB A;  3S2H J;  1B8I A;  1SGM A;  2RHA A;  2QTQ A;  1FJL A;  2R92 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...