4XK4A

E. coli transcriptional regulator rutr with dihydrouracil
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
196
structure length
196
Chain Sequence
SAKKKAILSAALDTFSQFGFHGTRLEQIAELAGVSKTNLLYYFPSKEALYIAVLRQILDIWLAPLKAFREDFAPLAAIKEYIRLKLEVSRDYPQASRLFCMEMLAGAPLLMDELTGDLKALIDEKSALIAGWVKSGKLAPIDPQHLIFMIWASTQHYADFAPQVEAVTGATLRDEVFFNQTVENVQRIIIEGIRPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator RutR
publication title E. COLI TRANSCRIPTIONAL REGULATOR RUTR WITH DIHYDROURACIL
rcsb
source organism Escherichia coli (strain k12)
molecule tags Transcription regulator
total genus 78
structure length 196
sequence length 196
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08362 TetR_C_3 YcdC-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4xk4A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 4xk4A02
2HXIA 3Q0UA 2ZOYA 4QTRA 2E2IJ 3A02A 5EG0B 5CXGA 3G1LA 3GTGJ 3JSJA 3JRGA 3GTLJ 2YVEA 1ETQA 1NK3P 2DG8A 1FJLA 2TCTA 3M4OJ 1XS9A 2DA7A 1APLC 4M3BA 2K9SA 5F1JA 4C3HJ 4EEFG 5FKMA 3RQIA 4AUXA 2E2HJ 1IDZA 3JRIA 2WUIA 2TRTA 3MN2A 1TWAJ 2LTPA 1W0UA 2AHQA 2YS9A 2RHAA 1D5YA 2JA7J 1B8IA 4C3JJ 4DZPA 2QF7A 4C2MJ 1HDDC 1HOMA 2LR8A 5CW8A 3TP0A 2FD5A 3PO3J 2UXUA 2XRLA 3ZOBA 3M3YJ 3S1NJ 5FKNA 5M5XJ 5IP9J 2R92J 3MKLA 1SGMA 3JRFA 4CYCB 2YVHA 3FKIJ 4MXMA 1MBJA 2CUEA 2NP3A 1NK2P 5E3LA 3GTJJ 4MK6A 2REKA 1S7EA 5GP9A 5IPAA 2DTZA 3HTHA 1SFOJ 1GV2A 5JLWA 4YZEA 3NARA 1FEXA 1ZR2A 2HOTA 3C07A 2FQ4A 3ON2A 4CYCA 1IG7A 3SJMA 4NELA 1H88C 1W0TA 1UG2A 2QCOA 5EYRA 3TW7A 3JRAA 2EQRA 2XPUA 4A3MJ 2YU9J 4B4CA 1H8AC 2JA5J 3BR2A 1UI5A 3ZQIA 5FLMJ 3TW6A 2FX0A 3WHCA 2CRGA 1H89C 2EZHA 1B72B 4QSHA 4NDLA 2MGQA 2ME6A 5GPAA 2LFBA 2OPTA 3O8GA 2E1OA 5E3MA 1PUFB 1RKTA 2LVSA 2XB0X 3ZQCA 3RZDJ 3PASA 5EGOB 4XIDA 3BR5A 5J1RA 4GCLA 5C44J 1AU7A 2ZCMA 2X48A 4ME9A 3S1QJ 2WAQN 4HKUA 4JX6A 3LWJA 1I50J 3BTLA 3HOVJ 1PUFA 5IOYA 3HOYJ 5EGOA 2RAEA 3NAUA 3FK7A 1U78A 4ABZA 2VKEA 4BY1J 1VI0A 2DMNA 4AC6A 4DW6A 3E7QA 3NI7A 2V57A 1IRZA 5D1RA 4A3IJ 2NP5A 1RKWA 2NVYJ 2Q24A 1WH5A 3F0CA 2GBYA 2CU7A 3JREA 1Y1VJ 4GFLA 2HQ5A 1MBEA 2WV1A 3HE0A 2X9DA 1QRYA 2P81A 4FE7A 1JKOC 3OSFA 3LJLA 1ZK8A 3F1BA 3HM5A 1Z77A 4BBSJ 4FCYA 2ID6A 5HODA 4XRMA 2Y31A 3S1MJ 2UXOA 5FKOA 3S5RA 3BTCA 4ACIA 1JT6A 1OFCX 3HB9A 3HGYA 1IGNA 3BCGA 3SDGA 2OERA 3LSGA 2K9NA 2ID3A 4MLOA 3O60A 3UKGA 1ZGWA 1A6IA 3CRJA 2L9RA 3OOUA 2ELKA 2JMWA 5C3EJ 3NRGA 3HDDA 5DTDA 3VVZA 2R5ZA 1JKRC 2QWTA 2JK3A 1Y1WJ 3VVYA 4M3EA 3K2AA 5M3FJ 4JX5A 2QIBA 2QOPA 2M9HA 2ZB9A 1FIAA 2W48A 1TWGJ 4IHXA 3G1OA 1UI6A 2Y0SN 4GFBA 1ORKA 1P7IA 3V78A 2NOGA 3BR0A 3BT9A 4A3KJ 1B8IB 3BG5A 2OI8A 4RDUA 2DMPA 2R0QC 2M8GX 2I10A 4HNVA 1TWFJ 3HOUJ 1AKHA 2COBA 3RZOJ 5AQCA 2XB5A 4ICHA 1G2HA 1GV5A 4FE4A 3WHBA 4MFEA 3LSPA 1DU6A 1FTTA 2GLOA 2JA6J 2MSYA 2QKOA 1JTXA 2UXHA 3FISA 2EZKA 4AC0A 3G56A 3P9TA 2K9QA 3H0GJ 4M6VA 5F04A 5H9TA 5EEAA 2F07A 2WB1N 4XK4A 2L7FP 3VOKA 1ZTRA 1XC5A 1MNMC 2O7OA 2HKUA 3QQAA 4BY7J 1JJ8C 3VW2A 2DA5A 1EF4A 1LE8A 2IU5A 1RPWA 3V6GA 1QVUA 2L7ZA 1IJWC 2PZ9A 5IYDJ 4MIMA 1F43A 3QPLA 5FLVA 3Q0VA 3JRDA 2HDDA 3IH2A 1JTYA 2IAIA 3PO2J 3HOZJ 2XSDC 2NS7A 3BG9A 2KT0A 3RH2A 2D6YA 5K58A 3EUPA 3CMYA 2HXOA 1X2NA 3K7AJ 1U9NA 2FJ1A 3ZQFA 3ON4A 3LOCA 4UUSB 1GVDA 1ETYA 2GUHA 3HIMA 2LLKA 2DG7A 4A3GJ 3OIOA 3RKQA 4FISA 2MG4A 2CQQA 5C4XJ 3HKZN 1GDTA 3HBLA 2ECBA 2G7GA 3CDLA 4IHYA 1ETWA 2G0EA 4IHVA 3VUQA 1P7JA 1XG1A 3HGGA 3SFIA 2EZLA 4JYKA 4Y52J 1FTZA 2NVQJ 4UUSA 1SANA 5DS9A 3LSRA 2O9LA 1HDPA 2Y2ZA 3IH3A 5IYCJ 5M5WJ 3BJBA 2R93J 1ETVA 4XRSA 4UUTA 1BA5A 3BG3A 1ZKGA 3KKDA 2VKVA 2FBQA 3BHQA 3KZ9A 2EBIA 2XGDA 5M3MJ 3HTIA 4A3EJ 3MNLA 3VW0A 2JA8J 5EDNA 2LY9A 4QIWN 1OCTC 1JJ6C 1MBKA 1JKPC 3CJDA 4W97A 1MSEC 4M3FA 2CQXA 4BBRJ 5FKLA 3W6VA 4AYBN 2M0CA 2Y9YA 5HSZA 1E3OC 2GENA 3LHQA 4GFKA 2NVTJ 5GPCA 1MBHA 4FTHA 4A3CJ 2HOSA 4NN1A 1ZQ3P 2H8RA 2DMQA 1VNDA 1Z0XA 3EGQA 2IEKA 5J1UA 4DYRA 3QBMA 1O4XA 3BTIA 1QPIA 3L1PA 1IDYA 3A03A 4D5CA 2AO9A 1JUMA 2R5ZB 3JRHA 2M34A 5JLXA 1R9TJ 3FRQA 1TWHJ 2PBXA 2O8KA 3DCFA 2VPRA 2GFNA 4A3JJ 1HF0A 1F36A 2NX4A 3LNQA 2Y30A 2ME0A 4IEJA 1BW5A 1WGXA 5IOZA 4L62A 5EFYA 5CXIA 5F08A 2HYJA 3TP3A 4I76A 3GZIA 4UDSA 1AKHB 2CJJA 1RETA 4PXIA 2EZIA 1ITYA 2CUFA 1FIPA 2XPVA 3G7RA 2ZCNA 1GUUA 1JGGA 3MVPA 5BNGA 2UXIA 3GTQJ 3C2BA 1U8BA 3HOWJ 3Q3SA 4XRSG 2E2JJ 1T56A 4JP0A 5DAJA 2DA6A 4DYQA 3TEDA 2LP0A 3B6AA 4G12A 3FK6A 1I6HJ 1RR7A 3OSGA 3AQSA 5IP7J 2JJ7A 3JR9A 1U9OA 3NXCA 5F0CA 5F0HA 2M2EA 3ZQLA 3I4MJ 5EZHA 3BQYA 4W1UA 3GTKJ 2DMUA 1IC8A 3DPJA 3HTJA 4B1RA 1LE8B 5F27A 2OF7A 3NPIA 4JNNA 1IV6A 5FMPA 3H3VK 1X2MA 5K7ZA 5HBUA 3QPSA 1GT0C 1DU0A 3CCYA 3BNIA 3T6NA 1ETXA 3LSJA 3VW1A 2WGBA 4XICA 3O8HA 1WCMJ 2HOAA 3PM1A 1RESA 1ETOA 5EG0A 3NNRA 3BR1A 2MW8A 2DJNA 3B81A 2RASA 2XDNA 2QTQA 3VPRA 4A69C 2LK2A 3B6CA 5K7FA 4DYCA 3E7LA 1AHDP 4M3DA 4X1EA 1MBFA 3PPBA 4KWAA 2DA4A 1A5JA 2XPWA 4GCKA 4IHWA 5FHPA 4D5FA 4A3FJ 2X6OA 4Y7NJ 2R5YB 2N8GA 3VP5A 2ZOZA 2NS8A 5C4JJ 3KNWA 5F0FA 1TWCJ 2XGCA 4L5EA 3ANGA 5J3LA 1WH7A 2L7MP 5FGLA 2DMTA 1ETKA 1BW6A 2IBDA 3CWRA 3BQZA 5FJ8J 5E3OA 2O7TA 3S14J 1HCRA 1K61A 3S1RJ 1OJLA 3G1MA 4D7NA 2R5YA 3GTMJ 1OCPA 3S15J 1POGA 3VIBA 1T33A 1JUPA 3D1NI 2KDZA 1I3QJ 1BJZA 2ZCXA 2DN0A 4MO7A 5K7HA 2ECCA 3BTJA 2UXPA 1MBGA 1WI3A 4A93J 4DZJA 3DEWA 4I6ZA 3VVXA 3S2DJ 2G7LA 4LOCA 1JKQC 3BR3A 2JWTA 2LD5A 4B3AA 2DA2A 4JX4A 2Y9ZA 3ZQHA 2EH3A 3CQZJ 1ZR4A 4JKZA 2HI3A 3Q0WA 5EF6A 3AQTA 5E3NA 2B63J 1YRNB 1B72A 4X6AJ 1Q1VA 2LKXA 2VI6A 1K83J 2GM4A 1ENHA 3GTOJ 1UMQA 5D18A 2VUMJ 4V2GA 3BR6A 4BKXA 1LFUP 4BXXJ 4JL3A 5HAWA 3HEFA 3GEUA 3ANPA 5EZGA 3KKCA 4S0HB 3HOXJ 1HLVA 3RD3A 2NVXJ 3IH4A 3JRBA 1YRNA 2H1KA 2W53A 1QVTA 3FIWA 4A3LJ 3S2HJ 4RBOA 5IP6A 1VFCA 3BRUA 4V2FA 2D5VA 4J19A 2K40A 4MFDA 5M5YJ 9ANTA 3IV5A 3VOXA 5D19A 4D7MA 2DA1A 1JT0A 3JRCA 3S17J 2YUSA 1BL0A 1LFBA 2R7ZJ 1IUFA 1MH3A 2DA3A 2XGEA 5FKKA 3GBGA 1NTCA 3GTPJ 3HTAA 3A01B 4M3GA 5C4YA 1WPKA 1CQTA 1MSFC 3IUVA 2JN6A 4GCTA 1JUSA 1VF9A 3S16J 1X58A 2PMZN 3ZQGA 4AF5A 3QKXA 2G3BA 4CGRA 1MH4A 5IYBJ 1TC3C 4C3IJ 4A3DJ 3I4NJ 4A3BJ 3A01A 2E19A 2G7SA 2L0KA 3COLA 2HYTA 5J1YA 1UHSA
chains in the Genus database with same CATH superfamily
2VJJA 2ZOYA 4QTRA 2HTSA 3IL2A 4BDYA 1QZYA 3GTGJ 1BR2A 3GTLJ 4LLNA 1HKQA 4ZDLA 2R7XA 1QO0D 1FJLA 3CDHA 3CJRB 1MW7A 2XV4S 1REPC 2VN2A 4EEFG 1BM9A 4HAMA 2P8TA 2E2HJ 1IDZA 2WUIA 4HX4A 5BPIA 3OWTA 2TRTA 4IOCF 2RHAA 2AHQA 2JTVA 2RQPA 3SQNA 4XOPA 2KZVA 4LB6B 3RPUA 1B8IA 4C3JJ 4JOMA 1KGSA 4M9XA 3F8CA 1HOMA 1U5TA 2ACJA 4B44A 2HDCA 2PG4A 1KZHA 3SZPA 3FBNB 3FXOA 4N0BA 1ZLKA 5FKNA 1XGMA 1P6RA 4RLFA 4MHGA 2M45A 5IP9J 1ACIA 2DQLA 3IAM2 1SGMA 4RB2C 1SVLA 3WTUC 2X6YA 3DP7A 3PQKA 1WSUA 1WZ2A 3IRRA 4HQEA 4L9NA 1NK2P 3J81Z 2A68F 2E34A 3HRSA 1TT5B 2IS6A 4OD5A 3HTHA 4M9SA 2W4SA 4HQMA 4UXNA 2K86A 5EJCA 4OIRF 2HOTA 4C2UA 1J0RA 1LVKA 1FEXA 3ON2A 3SJMA 5DUIA 3P9KA 2QCOA 3TW7A 1ERDA 1BR1A 4BJ6C 3BR2A 4UB8C 2JA5J 5FLMJ 1UI5A 1PP8F 4ZTFA 3BOQA 4HV5A 1B72B 1N78A 2EA4A 4MEXF 2CV1A 4AIJA 5GPAA 5B66C 4BE1A 5E3MA 3U21A 2LVSA 3B73A 2XVCA 3QP6A 3ZQCA 4PDKA 3CJNA 5EGOB 4CDGA 3BR5A 4KJZA 2KIUA 5D4SA 4GCLA 4EATA 4ITVA 2HKXA 1GHCA 3M07A 1JE8A 4ME9A 3QP5A 2RN7A 3HPHA 3LWJA 1IXRC 2X1DA 2COMA 2EK5A 3S2WA 3QOEA 4BUPA 2HVSA 1OISA 2WADA 3FK7A 3L2WA 3ROUA 2VKEA 1W7PB 4II3A 4E7IA 1Z67A 2HZTA 2Y69H 2FBHA 2ZFUA 2MA3A 6PAXA 2NVYJ 4FX4A 2DAOA 2Q24A 2GBYA 4BQQA 5LGNA 2Y48A 3JREA 1J7KA 2VODA 2X6XA 4GFLA 1F1ZA 2L01A 1OQYA 4LLLA 3G6EI 1VQ6I 4AWXB 1QRYA 1O3TA 2DK8A 3SHFA 1QNTA 3LJLA 2F5VA 4BBSJ 2ID6A 3QYBA 2R7FA 2ELJA 3L2RA 3H1CA 1UB9A 2UXOA 3GFIA 2QWWA 3HB9A 1P2FA 4CCJA 1MDMA 4MLOA 3UKGA 1A6IA 3OOUA 2M5WA 2ELKA 3OYNA 3VVZA 5DTDA 1SMYF 2QWTA 5TGTA 3AAFA 1Y1WJ 3VVYA 4J00A 4PGGA 1EJ9A 1Z91A 1MKMA 4N4OB 4F55A 2QIBA 1IZ1A 1FSHA 1OCRH 1VQLI 2R7OA 5FRNA 5HLHA 4U9NA 1W5TA 2JRTA 3PNTA 1FIAA 4U9LA 1TWGJ 4IHXA 1UI6A 1ORKA 2NOGA 5FO5A 1J09A 2K4JA 3VYRB 5H20A 2OI8A 4XN3A 2E5NA 5K5QA 4NQWB 1UHWA 5CQEA 2KKOA 4HF1A 3RZOJ 1RR8C 2XB5A 2LBFA 2HWVA 1GV5A 2EFWA 1N77A 4B48A 4HYEA 1Z21A 1QHHD 2YPRA 2LDUA 5D4RA 4YFXF 4RAFA 4B43A 4BAYA 4Y13A 1JTXA 2QKOA 4OD4A 3GO5A 3KFWX 2R7UA 3H0GJ 5LFAA 5H9TA 2QEXI 3QODA 5EEAA 5LGUA 2WB1N 1MNMC 4ZYGA 4BY7J 2DTRA 4U0WA 1JJ8C 4IQ4A 2H6BA 1EF4A 2IU5A 2RGVA 1R49A 3V6GA 4ZZLA 3Q0VA 2HDDA 3PO2J 3I9V2 2NS7A 2F2EA 2KFDA 3REOA 3WE3A 3L7WA 3GMEA 3ZQFA 1KU9A 5FROA 1V5FA 1PVEA 2MYSA 1X1PA 2GUHA 4N9IA 5ED4A 1U0JA 2J5OA 3RKQA 1EKEA 5HLGA 4GXOA 4L5IA 5HLTA 3HKZN 3L2VA 2ECBA 4OAZA 3KP7A 4S05A 3KPHA 2VQGA 1P7JA 2NS0A 2NYXA 2WC2A 2EZLA 4JYKA 4L0ZB 4LG0A 5L3EA 3K70C 3CJQB 3OIPA 2UZKA 5DS9A 2KJCA 1HDPA 5M5WJ 3IH3A 3FM3A 4EJUA 1CF7B 4H4KC 2ZXIA 3WTZA 1BA5A 4ENMA 1YIJI 1H9GA 1SEUA 1AOYA 1SFUA 1T0FC 1WJEA 1ZRFA 2VKVA 2FBQA 3BHQA 5LBQA 4C2TA 3DEUA 1XSVA 3E5XA 3KP2A 3VTIA 5M3MJ 3TQNA 3MNLA 3VW0A 5EDNA 4PFPA 2LC2A 3S3NA 1FP1D 2M7BA 3QU6A 5E1ZB 2EFOA 4IJAA 3TOAA 2X6WA 3GUDA 2ADUA 4BU2A 1W5CC 2W7NA 5L3BA 1LQ1A 2P7CB 2NVTJ 1EH6A 4OMYA 4FTHA 3ZXSA 5BPDA 3C1DA 3CDIA 4CH7A 3LAPA 3OMYA 4CGZA 2BOLA 2L5QA 4F52A 4DYRA 3EUAA 3PUBA 2VT3A 4HV6A 1IDYA 3EDPA 4BE0A 1FWZA 2E60A 4IRHA 2R7QA 3WTWC 1TWHJ 2PBXA 2B1EA 1SAUA 3ZMDA 4Y17A 3IC7A 2O8KA 2MH9A 3DCFA 2V1NA 2V1UA 3LA3A 2BGCA 4A3JJ 2DT5A 5L3GA 4IEJA 2ME0A 5ERIA 1I27A 2WY7Q 3DPLC 4ENJA 4NC6A 3KP3A 5LHIA 5F08A 3RPQA 3GZIA 4GYGA 2HOEA 2LKPA 3HG9A 3RQ4A 1UELB 3OR1C 2FXAA 3QYEA 4WIBA 2F4MB 2ZCNA 3CUOA 2CW8A 2UXIA 3W6JB 3IKTA 1F4KA 1K4SA 2DA6A 4RLQA 3TEDA 3QYFA 4GGGA 1Z7UA 2IP2A 4YIIA 3CF2A 2JJ7A 5DCMA 2EJRA 3NXCA 3KEYA 1YW9A 3D5LA 4NC7A 4BHBA 1LE8B 3LSHA 2E1MC 2FOKA 3IKVA 3TO9A 3H3VK 1I1GA 1OR7A 1U2WA 3ZQ7A 3CC2I 2O5RA 2H8WA 5GTIC 4DGWB 2ZFWA 5D5UB 3RIRA 1BI2A 3ZMSA 3AG1H 4BYYA 4R79A 2DXIA 3CCSI 2L9NA 3VSKA 1A31A 2IGOA 3O8HA 3PM1A 1ETOA 1TT0A 4F93B 2JVHA 1I6XA 3KIOA 3F21A 2DDAA 2QTQA 4ZDOA 3Q9VA 3EUHA 5K7FA 2O8XA 3DQVC 2OTJI 1UG0A 4X1EA 4CA0A 2L54A 1VQ4I 1FZPB 4LITA 2KIFA 1B6AA 1O3SA 4IHWA 3V7RA 2ZBKA 5LEKA 2N8GA 2QQAA 3I0TA 2CSOA 2NS8A 5C4JJ 2R7DA 2CV2A 3KNWA 5F0FA 5J8CA 3Q9SA 2KISA 3I59B 3QAHA 1EH7A 2FNAA 1HXDA 5FGLA 4OIPF 3MZ8A 3SFZA 3S93A 4BQAA 4F7ZA 1X1CA 3ZMUA 3K4JA 3J80Z 2DFIA 1XGNA 3GTMJ 5TISC 1A35A 1POGA 4LLGF 5FB2A 1T33A 2CQNA 3RPUD 1TNTA 1P4AA 2FRHA 3IWZA 3OYBA 3OYCA 2VKHA 2IGMA 2XIGA 3BTJA 4G7ZF 3K4KA 3OL3A 1TW3A 3VVXA 3S2DJ 4BXUA 4UUVA 4BXFA 5FLXZ 4PGHA 2JWTA 1ZREA 4UV9A 1O57A 1I1SA 4B3AA 2DA2A 2LF8A 4JX4A 2Y9ZA 4E4HA 2X85A 5L3FA 3M9AA 2WB1A 1R7JA 3ASNH 3MCZA 2K3PA 5JR3A 3E1SA 1WVRA 4NBQA 1ZR4A 1YRNB 1B72A 2DFFA 2R4GA 5CVVA 2VBYA 2VI6A 3GTOJ 1ENHA 2WBMA 1FBQA 2F5EA 2QGUA 2GXBA 4EJTA 1SD7A 3CP8A 3HHHA 2WWYA 4JL3A 5HAWA 3HEFA 4EJOA 1K78B 4PCQA 4S0HB 4CCOA 4NC8A 3KP6A 2GIZA 2H1KA 1QVTA 3M1CA 5AONA 3OIQA 3C2HA 3HKZA 5DCFA 1VTNC 2HZDA 4CCNA 4XQFA 3IV5A 4XM3A 3MKZA 4PUSA 4D7MA 2XROA 2V1XA 4RAGA 5JFRA 1BL0A 2VIXA 2EA2A 1TQIA 5FKKA 4M3GA 1IN4A 2OAZA 5LEJA 1MSFC 3IUVA 2JN6A 5HLIA 1E17A 2XDVA 1VF9A 3S16J 3RKYA 1R4MB 1X58A 2KL4A 2PMZN 1HSTA 3QKXA 5A2QK 1ONVA 2DOFA 1T8IA 2G3BA 5ICGA 2GQQA 1SVOA 5IYBJ 4AIKA 2E7WA 2R7RA 3PIPF 5H6RA 2E19A 3A4CA 3UNGC 2G7SA 1QQIA 1DDNA 3COLA 2CW0F 1LFPA 1OYIA 2B3WA 4J01A 3H5AA 1R58A 4Q47A 2UXXA 1P9QC 2HXIA 1TQPA 5IT9K 3Q0UA 1HA8A 2E2IJ 3A02A 3VYSB 5EG0B 2J5PA 2D1VA 2OUMA 1ZHFA 1JXSA 5CXGA 2AS5F 3WODF 2DYSH 2EPFA 3E5UA 2K02A 4WF2A 4L18B 1FC3A 3G3ZA 2TCTA 1APLC 3EYIA 3DPTA 4C3HJ 1T38A 1PUEE 1BOBA 2QENA 2O0YA 2VQLA 3RQIA 2G7UA 3VB2A 5LLQA 3RDIA 1R1UA 1XGSA 2XAFA 1TWAJ 2P0WA 2P5VA 5IT3A 3DLAA 4R8HA 4CCLA 1HDDC 2LR8A 1ZRCA 3JW4A 4ESFA 3PO3J 2XRLA 3V8KA 3ZOBA 4BEHB 3WE2A 3OYEA 3S1NJ 4GCVA 3CP2A 4GO1A 5M5XJ 2XKOA 5F1RA 4HF2A 4MQ9F 4M74A 4CSWA 2YVHA 4O3MA 4MXMA 4LJZF 4C9YA 1MBJA 5JHUA 2CUEA 2VC1A 4PZJA 4O5VA 1USSA 3BG7A 3P7NA 2ZJRF 5LGTA 4IVNA 3VSLA 1VZ0A 5IY5H 2OC6A 5JLWA 4KYWA 2JVGA 2IS2A 2YU3A 2VKDA 3CD6I 2GOXB 2KRHA 4CYCA 4E70A 2P5KA 1BI0A 1W0TA 2Z1DA 3TO7A 4IF4A 2F5DA 1S6LA 2YU9J 3V4GA 2VBXA 4PSXA 3U2RA 3HRTA 3OS1A 2HVRA 3WHCA 5K1YA 4DBRA 1H89C 1X1AA 2Y75A 2X0LA 4PJLA 1W1WE 4XKWA 4NDLA 5ICCA 2OCCH 5CQGA 2MGQA 3O2PE 2LFBA 2OPTA 3O3KA 2E1OA 3LSTA 1MNEA 2VL8A 1XMAA 2XB0X 4KT5C 3PASA 3PSFA 3OYMA 4MTEA 1HSJA 4XORA 4XIDA 3CC4I 3ULQB 3CJTB 2QKMB 4KISA 4AIHA 1NHAA 2ZCMA 4EM0B 4BQOA 5LHGA 4BJTA 2O03A 4OIQF 2QLZA 3S1QJ 4S04A 2CGPA 3K4BA 3B02A 4RM3A 5AIPA 5KAFC 4BE2A 1PUFA 3HC7A 5IOYA 3HOYJ 3CCEI 2RAEA 1B9NA 2OCEA 1OYWA 1U78A 4BY1J 1VI0A 3BY6A 4C2MA 3GF2A 3WGIA 3FXJA 1DPUA 4ESJA 5LHHA 2V57A 4A3IJ 1YJNI 1FNNA 1RKWA 4LG3A 1WH5A 1YHQI 4BDZA 4Z6YA 3DTEA 2R7WA 1XMXA 4A5NA 1D0XA 3ABTA 2P81A 4FE7A 3OYFA 1JKOC 3WTVC 1ZK8A 2BW3A 2GXAA 4BJ5C 4FCYA 1OKRA 4XRMA 2Y31A 3CO6C 1OFCX 3H9JA 3E6CC 4JK1X 1QZEA 3SDGA 2OERA 1TZLA 3PJRA 1Q1HA 2HTJA 2HQAA 3GXOA 4AIDA 5FGMA 1IF1A 2JMWA 4CZCA 2WV0A 3KYLA 3LSMA 4OIOF 2K4BA 2JK3A 3GFMA 1V3FA 1FT9A 4JX5A 4XR6A 1WWXA 2ZCWA 4II2A 5H6QA 2RNJA 1QBJA 3GX4X 2M9HA 3EPZA 3MKYB 4M6XA 1R5HA 2CFXA 1J75A 4GFBA 2IW5A 3BR0A 3BT9A 3VWBA 2KIMA 3DTKA 1OLTA 3NRVA 2GZWA 1R1VA 3OOPA 1R36A 2PN6A 3SDBA 4ICHA 1F5TA 4HA8A 1OCOH 3WHBA 1FTTA 3LSPA 3K1MA 2WAFA 1DU6A 1R23A 1M1EB 4G6QA 5DUKA 2DQRA 2EZKA 1Z3YA 3I53A 2LREA 4FT8A 3VODA 1SC7A 2K9QA 3IHUA 5JVGF 1Z6TA 3FKJA 1HW1A 3H35A 2V7FA 4XN0A 2HKOA 2L7FP 2QQ9A 1WJ5A 3P5JA 2O7OA 1Y39A 3CLOA 3QQAA 1E2XA 2QYOA 2KJBA 4XNFA 4D1QA 3VW2A 4I0AA 1LE8A 1FOWA 2XAHA 3VOEA 1TW2A 2HFHA 1RPWA 5F64A 1QVUA 1I3AA 5BS6A 1TL8A 1IJWC 1LVAA 5IYDJ 2PZ9A 2DT6A 1F43A 2JUCA 5GADJ 4YFNF 1LDKB 3D5SC 3IH2A 1JTYA 2IAIA 2EFNA 3BG9A 1AWCA 4FASD 1X2NA 4I99C 2FJ1A 1FBSA 2OV7A 3LOCA 1ETYA 2FUG2 3N05A 2HS5A 1ZGAA 2CQ7A 4A3GJ 3LA2A 3OIOA 1WQ2A 4FISA 2MG4A 2FSWA 3R0AA 4CCMA 3CDLA 4EQQA 1ETWA 1BI1A 3P9CA 1XG1A 3DKWA 1RUNA 1FTZA 4Y52J 4UUSA 3E5QA 1SANA 5AIQA 4DOZA 3PIOF 4KIBA 2ZKZA 1MMDA 1ETVA 1DPRA 3BG3A 1IXSB 1Y6IA 1ZKGA 3I59A 4XKBA 1SFKA 2AQEA 1HKTA 1YLFA 1T98A 1ODDA 1XN7A 3L2UA 3EUHC 3KZ9A 2BYVE 2EBIA 1L0OC 2JA8J 1SD6A 1KQ0A 4QIWN 2ZO4A 1E3HA 2K27A 1WJAA 1T08B 1IN8A 3ZMZA 3CJDA 1MSEC 2FJI1 5LRSA 4E7LA 4ETSA 2CO5A 4BBRJ 2L3DA 5FKLA 1VQMI 1RUOA 3J7AO 3KE2A 2M0CA 3H92A 3CCMI 3ZN1A 4ENKA 1MJBA 1FYLA 2IS4A 3CCLI 5E79C 5GPCA 4NN1A 2HOSA 2DMQA 4R1HA 1B1BA 3EGQA 2E71A 2FE3A 3H3ZA 4UVBA 1D3YA 4BQNA 1Y56A 5E1WA 3A03A 4D5CA 4QPOA 1R1TA 3SXYA 1JUMA 2R5ZB 2HR3A 3JRHA 1O3QA 1VQKI 3I5UA 5JLXA 2CS3A 2GFNA 3KZIC 2VB6A 1S9HA 5ILVA 4HLXA 2EILH 4EGYA 2FF4A 3OYHA 2EV6A 5EFYA 5CXIA 3G73A 3GLLA 3TP3A 4EM1A 5FFXA 3VFZA 1AKHB 3HTUA 1RETA 2EZIA 2GA1A 3RYRA 4LGWA 1FIPA 2XPVA 3G7RA 1BOAA 1W5SA 2W1OA 3W3CA 3RJPA 5DD4A 1JGGA 5BNGA 3GTQJ 3HOWJ 2NOJB 3Q3SA 2BY2A 4XRSG 1T56A 1X19A 4A5MA 1YTYA 4L9VA 4A2UA 3B6AA 1RR7A 1R5ID 1XSXA 1YYVA 1H0MA 2RQQA 2IGNA 5F0CA 3E6BA 4MNUA 2OQRA 2M2EA 2ICWG 5EZHA 3BQYA 3QU3A 3GTKJ 2DMUA 4ZC3A 3VP5A 4B1RA 2W25A 2STTA 3JSOA 1IV6A 5K7ZA 2ZXHA 5D6EA 2HNHA 4BH9A 2FEZA 2OZUA 3PUFA 2I8DA 3KZZA 1IN7A 2YR2A 1ETXA 3ECOA 2QBYA 1D0ZA 2WGBA 3I58A 4YIFA 2V6CA 4AU7A 5EG0A 4CCKA 4N9HA 1WRJA 3SYTA 2ZC2A 3B81A 4QLCU 2XDNA 1GLNA 3VPRA 4A69C 1FMWA 2EIMH 4DYCA 1AHDP 3KYCB 1LKXA 2PJRB 1MBFA 4D9JA 2VJ4A 4KWAA 2E35A 3DKXA 4E7SA 2XPWA 1D0YA 4Q48A 4KT6A 2EIKH 4TV7A 4D5FA 1Y0NA 1LNWA 3SZTA 2R5YB 1IXCA 1RI7A 2PBIA 4A6EA 5B5EC 2O6GE 2Z16A 2XGCA 4L5EA 1G3SA 2KHMA 2YSRA 3ANGA 5J3LA 2DMTA 1A6QA 4NNJA 1GXPA 1W36D 2IBDA 3BQZA 4F91B 2O7TA 3AL0C 4YIRX 1OCPA 3S15J 3DBLB 4HEA2 1KA8A 3VIBA 2A6TA 3VYTB 3ZR8X 4D0PA 3D1NI 3GZ5A 2KP6A 1I3QJ 4EJWA 1YO5C 4MO7A 5K7HA 3DXJF 2ECCA 4B47A 3ESWB 1WI3A 4RMNA 3WU2C 4RM2A 5A2QZ 2BHYA 2G7LA 3BJ6A 3BR3A 3CUQA 4FX0A 1OCCH 2LKSA 2L9VA 5FD6A 3FXMA 4XLEA 2L7KA 3IAS2 2EH3A 1X4PA 3SWHA 4DVYP 3H9GA 4P9UA 2MD5A 2QSFX 3CQZJ 4JKZA 5HDGA 3Q0WA 4NB5A 3HUGB 5IT9Z 5D6FA 2B63J 2ZNZA 3SEZA 4IXAA 1J5YA 1G3YA 3W2VA 1BI3A 4LK0F 5D18A 5CKTA 2E1MB 5L3DA 3GEUA 5EZGA 1TBXA 3HOXJ 3R4KA 2D1HA 4WCGA 2W53A 2A07F 1J2XA 4HG2A 3BRUA 1WHUA 5IP6A 3U1KA 4RGRA 3VOXA 2BE5F 5M5YJ 3T1BA 2ESHA 2W57A 3OYAA 1O7LA 1JT0A 3CCQI 3JSPA 2DODA 1U8RA 4U0YA 3EYYA 2A61A 3GBGA 3HTAA 3HJEA 4GDFA 3K10A 3RYPA 1S7OA 3F72A 2X1EA 4XONA 3ZQGA 4Q5SF 1XB4A 3AKZA 1YJ9I 3DFGA 1A36A 1TC3C 1BJAA 4IRGA 4XSZF 2ZJPF 1U3EM 2IT0A 4ASNA 3A01A 3QRFF 4RGSA 1XTAA 4E7ZA 2L0KA 5KHDA 4DJAA 2H6CA 2HYTA 2BXZA 1UHSA 2ZMEC 1E3OC 5E17F 1WI9A 1MMAA 5J40A 1XPXA 1HW2A 3VEPA 3G1LA 1R71A 1NG6A 2HEOA 3JSJA 3BCBA 3JRGA 2ZJQF 2MLGA 2ZSHB 2YVEA 1ZAOA 4U87A 2WA0A 1UFMA 2DA7A 2ZNYA 4YELA 1FY7A 3JTGA 3P9IA 1D8KA 2K9SA 4ZDPA 2P5LC 3I54A 5L3CA 1VQ5I 4I01A 4AUXA 4UY8I 1Z05A 1I39A 2LTPA 2DO7A 5ICFA 2YS9A 3QPHA 2D45A 1D5YA 2JA7J 1ON2A 4UV8A 4DZPA 2QF7A 4OOIA 4PSWA 5CW8A 2EFQA 3TP0A 1N75A 4ZZDA 2FD5A 3LFUA 1R4NB 4RAYA 2UXUA 3KP4A 3M3YJ 1LEBA 2PEXA 3WTXC 4X0GA 3DU5A 1J9IA 3OYLA 2UXNA 1ZARA 2XGXA 4KDPA 3BWGA 4DBQA 2R92J 2EWNA 5CVJA 2L2OA 3FKIJ 2AXTC 2JSPA 2NP3A 2HPIA 1YW8A 3WTYC 2Q2EB 3GTJJ 4MK6A 2AQFA 3ML6A 3K1PA 5GP9A 2DTZA 2ETHA 4XLCA 3NARA 3BCAA 3C07A 1RZ4A 2A5WA 2FQ4A 2JPBA 1IG7A 4NELA 3BPVA 1ZG1A 3PNVA 3MAJA 4PJMA 2Q8KA 4IHTA 1CGPA 2EQRA 2XPUA 4A3MJ 4B4CA 1H8AC 1N25A 3A1YA 3ZQIA 3FXUA 3TW6A 4NHJA 1U5TC 2CRGA 3HRUA 4MEYF 1FP2A 2JT1A 3JAMK 2NXNB 2ME6A 3X2QH 4YRVA 2BEOA 4C30A 1XD7A 4Z2YA 1KONA 2P7VB 3O8GA 1P4XA 2FBKA 1RIOH 2XKPA 2FA5A 3CC7I 5E8GA 2K5CA 2JQ7A 2LF7A 3MFKA 3QPTA 1DGRM 2IRFG 4LMYA 2X48A 5JVTA 1F9NA 4F3QA 4OINF 4HKUA 1I50J 3BTLA 1FOKA 1ZG3A 4KN7X 1VQOI 1QPMA 3F8BA 1K79A 5EGOA 3NAUA 3OYJA 3ZP5A 4ABZA 2F48A 2DMNA 4AC6A 2RNGA 3E7QA 1V55H 2LMDA 2HYFA 4CZZA 2XASA 5D1RA 4M72A 2PX9A 1V4RA 2CU7A 3FMRA 1DP3A 4EVIA 4GRIA 2DW4A 2HQ5A 1MBEA 1W7PA 2WV1A 1MDMB 2XAUA 2VASA 2K85A 3BZ6A 2X9DA 2JZYA 4RB0A 3WTTC 4P96A 1QU3A 5HNHA 1SD4A 1VQPI 1KQ9A 1Z77A 2CG4A 3HM5A 4G9YA 3F1BA 1BR4A 2WY8Q 3OY9A 1BC7C 2EFPA 2E36A 2DFHA 4MGRA 3HGYA 1OYYA 3F8MA 3LSGA 5B1AH 2HYGD 2K9NA 2ID3A 3K69A 4G8XA 2IS1A 2GIVA 3CRJA 2W00A 3FM5A 3MD2A 1IN5A 2PFVA 5C3EJ 3NRGA 3LFKA 2LSOA 2R5ZA 2RREA 4M3EA 3K2AA 2JRMA 4FQGA 4XL9A 2A69F 3F8NA 3T8TA 1LPQA 1MJ9A 2DCEA 1UZCA 3PSIA 4EV0A 2W48A 1T95A 3BLYA 2Y0SN 3T8RA 3V78A 3IP4B 3LMMA 2BY0A 3BG5A 3DEEA 4KNYA 2IJLA 1V5EA 3HL2A 2R0QC 1XDUA 2OZ6A 1G3TA 3WTSC 4HNVA 2W85A 1AKHA 2COBA 4IRIA 1YE9A 3ELKA 4MFEA 1S3JA 2GLOA 2MSYA 1FPQA 3BZKA 3FISA 4AC0A 3FDYA 4BNCA 1K6YA 3P9TA 4NQWA 1KU2A 3ZGKA 4BGDA 2PMHA 1YFHA 5F04A 1B59A 3K9TA 2M87A 4XK4A 4L9TA 3VOKA 1ZTRA 1XC5A 3DTIA 2CQKA 5J4YA 1ULYA 5D5VB 3HSEA 1JHFA 1IV8A 2P6TA 2IPQX 3LQRA 3OV8A 3GW2A 2H09A 3QPLA 5FLVA 4E7JA 3MKWB 1NG7A 2KT0A 3RH2A 4PJJA 3KLNA 3EUPA 2HXOA 2V4JC 4LG0B 2XRNA 3ON4A 3JTHA 4XLAA 2HVQA 5E8IA 3K6GA 1WKMA 3M8EA 4V19K 2C6YA 2E1CA 1QA6A 1MD0A 4KIGA 4XMYA 2RVCA 4IHYA 3ZN0A 5DV5A 2PJRA 2G0EA 1X1DA 2IGKA 2LG4A 1K4TA 4IHVA 3HGGA 3SFIA 3CCUI 3IRQA 1FLIA 3WU0A 3HXLA 1MNDA 1XGOA 3LSRA 3ERED 2GOMA 2DFEA 4IRVA 1S7AA 2A05A 2H94A 3TL4X 1RRJA 2BHZA 3BJBA 4UUTA 2IA1A 1HC8A 5LRRA 2Z5UA 1MMGA 5EEGA 2XF7A 1YQAA 3BG6A 1DQUA 4P1WA 3F9KA 2VONA 3M1EA 5BQTA 1ZELA 4A3EJ 3ERMA 1YG2A 2LYCA 2OU2A 2VT2A 2LY9A 1PYVA 1CF7A 2B7EA 3K4LA 2MABA 2DJIA 1JKPC 4CICA 4OMZA 1Z3XA 2A6EF 2FBIA 5KAIC 3N97A 2CQXA 4GYIA 3V42A 4AYBN 4LB5A 4P55A 2GENA 4GFKA 1E3PA 2G9WA 5J6XA 1MBHA 4XBFA 1MMNA 3FF5A 1ZQ3P 2H8RA 2R7VA 2JUGA 3QOPA 1Z0XA 3BJAA 4A12A 5J1UA 3S3OA 3QBMA 1O4XA 3H3UA 4IQJA 3L2QA 2AO9A 1J59A 1ZGJA 3GFJA 1Z1DA 1USTA 3FRQA 2PI0A 5LD2C 2FU4A 1G4DA 2YX4A 1HW5A 2V9KA 2PMUA 3CUQC 1QZZA 1W4MA 1R00A 3KLOA 3LNQA 1YI2I 2Y30A 3M8FA 5GTHC 1YOVB 3PNYA 3K0LA 3BROA 5IOZA 1LEAA 1YS7A 4RB3C 3U1DA 1ZLJA 2K9MA 3K4MA 2M7AA 4RAZA 1Z7LA 4HSRA 2DDBA 4I76A 4ZYHA 4IZZA 2CJJA 4LIUA 4PXIA 3F23A 2CUFA 5DCMB 1EA3A 3TO6A 1GUUA 4KICA 1ZH5A 1WJCA 5D5XB 4ZJZA 3BJOA 4U7BA 1PP7U 2E2JJ 2UWMA 3GWZA 4U88A 2LP0A 1XMKA 3WGGA 4G12A 4U0VA 1I6HJ 3FMSA 1DUXC 2GA2A 3VDXA 4XSXF 1MMSA 3NWTA 2CMPA 1U9OA 2KDOA 3DU6A 2QSGX 4ENNA 4NUBA 3ONQA 4YEJA 3ZQLA 3I4MJ 1TP4A 2WTEA 3DPJA 1EV7A 3HTJA 3NPIA 2OF7A 3RKXA 2OJED 2A3SA 1X2MA 2AXLA 2OTLI 3AG2H 5HBUA 5EEHA 4P5OA 3CCYA 2BY3A 2KLOA 4LFUA 4CXFA 1NH3A 3VW1A 3CF5F 1S29A 3R0JA 2HOAA 4U7DA 1RESA 3DV8A 3D5RC 2PMZA 4KIFA 2O61A 3ZRGA 3CCVI 5D8KB 4KA4A 1V54H 3CMAI 3B6CA 3EETA 4AVZA 1JI8A 1JGSA 3ABLH 4IOAF 2DA4A 5B3SH 1A5JA 4GCKA 4HPQA 2KIQA 3BZCA 2X6OA 2ZOZA 2RV8A 3N4MA 1TWCJ 2VQCA 2L7MP 1OR7C 4WX9A 1ETKA 2Y0SA 2F5CA 3CWRA 4KMUX 3LA7A 3S14J 1HCRA 2HGCA 5CVUA 2VXZA 2YX7A 4JBAA 1O7FA 1K61A 1R6RA 3RSNA 2F4OB 3I3LA 2H27A 1HBXG 3IWFA 1JUPA 3CMMA 3ZMTA 2KDZA 3G2BA 1T6SA 2Q2EA 1FYKA 4YG2F 4DZJA 2VXDA 1FX7A 1G8XA 3DEWA 4I6ZA 2M8EA 1TQMA 4LOCA 3G71I 1JKQC 3NS4A 4FETA 1X4OA 2QQ8A 2FQ3A 5J47A 2VOOA 5KNLA 2XF5A 1XX5A 3V7CA 3ZQHA 5HOOA 3KEQA 4LK1F 2M3AA 2HI3A 3AQTA 1E0EA 1MZBA 4WXDA 2MLKA 3L00A 3HIFA 4IPAA 3V8JA 2MFZA 3PFIA 2NNNA 3TKYA 1Q1VA 4Q4ZF 4M71A 1K83J 2LKXA 4AD9A 2GM4A 3COAC 5K5OA 2EINH 2ZY9A 3GCMA 1BIBA 3BR6A 3DWLE 1LFUP 3TDZC 4L5JA 1FSEA 5DM6F 3CTAA 4LIVA 3KKCA 3ZCOA 1HLVA 2OA4A 2V9PA 2DU9A 1D8JA 2NVXJ 2DPDA 3JRBA 1YRNA 1VQ8I 2BZTA 3FZVA 2IA2A 1TNSA 4A0YA 3S2HJ 4RBOA 1VFCA 3ABUA 2D5VA 2O3FA 2K40A 4MFDA 1GXQA 4J19A 1YS6A 3L2CA 5D19A 3MZHA 4I09A 2DA1A 1LJ9A 3QWLA 2YUSA 4F92B 2Z33A 1K78A 3BPXA 2LNBA 4BHPA 2DA3A 1ZG5A 4UHTA 1NTCA 3GTPJ 2OBPA 2W84A 1WPKA 3DLLF 2QQBA 3KCCA 1ZRDA 1YX3A 3FXQA 1R5GA 1WFXA 3F6OA 2E1NA 4XKVA 1MH4A 4C3IJ 1OPCA 4A3DJ 3PFYA 3NWSA 4LD5A 5E1XA 4A3BJ 3ZQQA 4BACA 3A0HC 1WJFA 3GZNB 3WG7H 4BS9A 1LB2A 3OS0A 2QM3A 1IN6A 5BOXA 5CVRA 5J1YA 1P4WA 1XCVA 2BVLA 5ILUA 3AL0B 4AYBA 2ESNA 4HF0A 1H9TA 1W7PD 1QHGA 5GAEJ 2R7SA 1IUYA 1ETQA 1D5VA 3A0BC 3TMOA 4BL0B 1NK3P 2DG8A 3R6SA 3JAMZ 3LSIA 3M4OJ 4Y33A 1XS9A 1SVMA 2VC0A 2V1DA 4M3BA 1TLHB 3AG3H 2YVXA 5F1JA 4P9FA 3W6KB 5FKMA 3GYHX 2A2FX 3ECHA 3E6DA 2JPCA 5HS7A 2Z9OA 3WGHA 3JRIA 3MN2A 1W0UA 2XF6A 3O6BB 3J7ZI 2E5ZA 2HU9A 2IA0A 4C2MJ 1ZYRF 2RKHA 3MQ0A 2ZJ2A 2XC7A 1VQNI 1I5ZA 3HOTA 1BC8C 3MKLA 2ELHA 4WK8F 3RKWA 3JRFA 4CYCB 3MMYB 2PJPA 4KN4X 3J7AY 5JI6A 4EJVA 4K2EA 4DQ2A 2PLYA 1DP7P 3C2GA 5E3LA 4BEHA 2REKA 1S7EA 1U6GA 4DNCA 3DPUA 3OYDA 5IPAA 1W36C 2L4MA 1SFOJ 1EH8A 1GV2A 3C3WA 4XLNF 4YZEA 2RDPA 3HSRA 5KVRA 1ZR2A 1H88C 2W82A 1UG2A 5EYRA 3JRAA 4IL6C 5CVIA 3L9FA 4AM3A 4E7KA 3HHGA 3GVAA 1IRFA 2FX0A 1FMVA 1WJBA 2EZHA 4HX8A 3BP8A 4PJ0C 4QSHA 2MH2A 3K70D 3K8PC 4G94A 1PUFB 4EM2A 3VYUB 1RKTA 4L0YB 1LDDA 2RC4A 3RZDJ 4RA2A 5J1RA 4PK4A 2F6CA 2QVOA 2XAJA 5C44J 4KITB 1AU7A 2B9SA 1ON1A 1K7AA 4WXCA 2ZMEB 4E6KG 2WAQN 4FHTA 3DF8A 3F8FA 4JX6A 3HOVJ 2L9SA 1BBYA 3GZ6A 1KQ8A 3KZYA 2TDXA 3CZ6A 3R60A 2L4AA 4KUMA 1V5GA 4DW6A 3NI7A 3BDDA 2Q1ZB 3W2WA 3J81K 4QPQA 3HOSA 4G7OF 1SFEA 2BW3B 2VQHA 1IRZA 2F5FA 1KU3A 3T0YA 1KYZA 3T5XA 2VLAA 2UUZA 1D1CA 4HDUA 2NP5A 3ABKH 3F0CA 1X3WB 2XSJC 5DDGA 4HBLA 1Y1VJ 2DLLA 3KX2A 3ZMVA 1AA7A 3R61A 1YW7A 5H2FC 4N4NB 2KRCA 3HE0A 3GLXA 2VJ5A 3OSFA 2QKLB 1YIOA 5HNFA 3C18A 2V6EA 1Y8QB 3EUKL 2M30A 5HODA 2K9LA 1MJAA 4Y4RA 3S1MJ 5K5RA 2L02A 5FKOA 3S5RA 3BTCA 4CHUA 4ACIA 1JT6A 3AG4H 3CO7C 1IGNA 3DBRB 3I56I 2HQNA 3BCGA 1IRGA 3O60A 3I4PA 1ZGWA 1SD5A 4HDVA 2L9RA 1T2KA 2G7HA 4BHCA 5BMZA 3M7GA 1G6NA 3HDDA 1XDSA 2PFBA 2ZSIB 4JQFA 4MQVA 1JKRC 5HS8A 3K4NA 4L9JA 5M3FJ 2BVMA 3NQOA 2NAZA 3RCOA 4HNUA 4UVAA 2QOPA 3E6MA 2H1LA 2ZB9A 2KPMA 3EQLF 1UHMA 3H5RA 4RGUA 3G1OA 3LWFA 1P7IA 2KQRA 2Z99A 4A3KJ 1BN5A 4MTDA 4I0BA 1B8IB 3LQQA 1U5TB 4RDUA 2DMPA 2MD0A 1FOXA 2A6HF 3U9GA 2M8GX 2I10A 1G59A 1TWFJ 2VBZA 3HOUJ 2V26A 2Q0OA 5AQCA 3IUOA 2FNPA 1G2HA 4XLHA 4FE4A 3ASOH 5J8FA 3E3VA 2K7LA 5DM7F 5DEQA 2JA6J 3LAJA 1VQ9I 2UXHA 1UJ8A 3PQJA 3G56A 1Z6RA 2P6SA 3KYDB 2KRFA 2IXSA 3FXKA 4M6VA 4H0EA 3F22A 2F07A 1SAXA 3OL4A 4IO9F 2X1CA 2HKUA 2DA5A 3K4CA 2ISZA 1RC9A 1X3UA 2MC4A 3TDUC 2Y0MA 2WAEA 3LSKA 3TBIA 2L7ZA 2VBWA 2UV1A 4MIMA 4RB1A 4A0XA 5ICEA 3JRDA 3PL8A 2X4HA 3L09A 3HOZJ 2XSDC 2D6YA 2DBBA 2EB7A 5HVQC 4G6DA 3CMYA 5K58A 1KYWA 1U9NA 2R3SA 3K7AJ 2MC3A 3M8JA 1GVDA 4UUSB 3HIMA 2LLKA 2CUZA 4ZYAA 2DG7A 4IKFA 1VQ7I 5CJ9A 4B09A 1L3LA 4HLYA 2LH9A 2CQQA 1STZA 5B1BH 5D8LB 4IX7A 5C4XJ 1GDTA 2XAQA 3HBLA 2G7GA 2A5YB 4G6TB 2NRAC 4UB6C 5HDNA 3VUQA 1Z9CA 2DOAA 3TOBA 2NVQJ 3W2AA 3RI4A 2O9LA 2Y2ZA 5IYCJ 3JCUC 2X51A 4XRSA 2R93J 4ZTJA 2CWEA 3S8PA 2I5UA 3HSFA 2FMLA 2GAUA 3KKDA 3I71A 2DT7B 1Y8RB 4HNTA 4PFOA 5GAHJ 4HRIA 3V7SA 2XGDA 3HTIA 3S3MA 2QSHX 2Z3YA 1FBUA 3FX3A 3KEOA 1OCTC 2P4WA 4I02A 1A04A 3C7JA 4M6YA 3FHZA 1JJ6C 3I64A 1MBKA 2FOWA 5DD8A 3D0SA 1FOYA 4I98B 4W97A 4XLPF 1IAWA 2DK5A 3OYKA 1KU7A 5FD5A 3CLQA 1MGTA 4M3FA 3W6VA 3DKYA 2DYRH 2Y9YA 3GFLA 2EV5A 5HSZA 2NVUB 2KZGA 1TTYA 3LHQA 3GEZA 4PJNA 3G4SI 3CCRI 2W24A 2BV6A 4A3CJ 3I55I 3F3XA 5E18F 1JHHA 3ZPLA 3LL7A 4XRFA 1VNDA 2IEKA 2D2WA 3OR2C 3H9QA 3BTIA 1QPIA 2QZ8A 3L1PA 3CCJI 1O3RA 4E7HA 3E0JB 4Y3OA 2M34A 3K2ZA 1PDNC 2JSCA 4EGZA 3F6VA 1BIAA 1R9TJ 2MBFA 2XUBA 3SZGA 3MWMA 3K1NA 4HX7A 2VPRA 1HF0A 1UAAA 1F36A 2M4KA 1S5LC 2NX4A 2E7XA 1BW5A 1WGXA 1LUJB 3FWEA 2EV0A 4L62A 3V8LA 4CO8A 4KMFA 2GXGA 2DPUA 2M1BA 4ANJA 2HYJA 4UDSA 5ILSA 4QWQA 2LBFB 1ITYA 2IVMA 2BBYA 2ISYA 1D1BA 2WAQA 3MVPA 4HOBA 4UVCA 3C2BA 1U8BA 1XCBA 4JP0A 3ISPA 5DAJA 2LY2A 2V79A 4DYQA 1T39A 1YX5A 4HSTA 2XHKA 3FK6A 5E20A 3TGNA 1PJRA 5KK1A 2PQ8A 1GVJA 3OSGA 3AQSA 2QBYB 5IP7J 5GAGJ 3JR9A 3MZYA 3Q5FA 5F0HA 2JA2A 4W1UA 1IC8A 3AFHA 4JNNA 5F27A 2M4GA 3UR3C 3KETA 3A2KA 5J4VA 5FMPA 2M0MA 2FMYA 1Y0UA 3QPSA 5CLSA 2QUFA 1GT0C 1FYMA 1P92A 1DU0A 3BNIA 3T6NA 3E97A 1ZN2A 3LSJA 3WU1B 3ABMH 2EIJH 5FRMA 4XICA 3CESA 1WCMJ 3NNRA 3HRMA 3BR1A 2MW8A 1X1BA 1B9MA 3BC8A 4OAYA 4RGXA 2DJNA 4G7HF 2RASA 2NNYA 1T0FA 1IRXA 2HPMA 4UNOA 4CYDA 1SMTA 3FMQA 2LK2A 4RS8A 3E7LA 4M3DA 5F6FA 3WG9A 1MIJA 3SEQA 1XSDA 3PPBA 3HTSB 2GWRA 4WXHA 3KP5A 5FHPA 1YITI 1RNLA 4A3FJ 1G3WA 4Y7NJ 2KMUA 4I7HA 2CYYA 4EMSA 5HDKA 5KCMA 4HW0A 1WH7A 1LDJA 4IHSA 1D1AA 1SFXA 5FFZA 1BW6A 2DI3A 4Y15A 3NEUA 2F4IA 5E3OA 5FJ8J 4B8XA 2B0LA 1QGPA 2VE8A 1OJLA 3S1RJ 4XLFA 3DBHB 4HZFA 4OU0A 3G1MA 4D7NA 5JHFA 3CUQB 2R5YA 5TRDA 1C0WA 1IW7F 2STWA 1B4AA 4CUGA 4ZH4F 4O6JA 1BJZA 5CPRB 4DIQA 2ZCXA 2DN0A 1K6OA 5DYMA 2UXPA 1MBGA 2VJIA 4A93J 4ZYEA 3FHNA 2OQGA 2LD5A 3S32A 1OMIA 5CYVA 2LY1A 5HS9A 4YFKF 3J7YJ 3HZJA 4A0ZA 1OCZH 2K3FA 4OWRB 3OS2A 5EF6A 2ZXJA 5D5WB 4B3XA 5E3NA 3FBIB 4X6AJ 4XKCA 1HQCA 4AVPA 5TJJA 2BXYA 2HQRA 1UMQA 2VUMJ 4V2GA 3H5NA 4BKXA 2QA4I 4BXXJ 3ANPA 2LOOA 2OD5A 3RD3A 3HUGA 4I2OA 2HDWA 3IH4A 4WWCA 2ZXWH 2DOEA 2ZMEA 3FIWA 4A3LJ 2CW7A 1WJDA 4V2FA 3RTRA 4XOTA 2BY1A 9ANTA 2LRDA 2CFOA 3H36A 1UCRA 3OYIA 3HYIA 4A6DA 3JRCA 3J80K 1S72I 3S17J 3H0DA 1LFBA 2R7ZJ 1IUFA 1MH3A 2XGEA 4ZYDA 4KFCA 2Z2SB 1IO2A 3A01B 2VPLA 5C4YA 4M9ZA 1CQTA 4GCTA 2VE9A 1DGWY 1S8NA 1JUSA 1R22A 2XAGA 3MEXA 3OYGA 1HKSA 4AF5A 1X3ZB 1YJWI 4CGRA 5FLXK 2R7TA 3FXRA 2CV0A 2VOPA 4ESBA 3FXLA 3I4NJ 2V9VA 2CUJA 3CMEI 4ON0A 2CH0A 3HPGA 4M73A
chains in the Genus database with same CATH topology
2HXIA 3Q0UA 2ZOYA 4QTRA 2E2IJ 3A02A 5EG0B 5CXGA 3G1LA 3GTGJ 3JSJA 3JRGA 3GTLJ 2YVEA 1ETQA 1NK3P 2DG8A 1FJLA 2TCTA 3M4OJ 1XS9A 2DA7A 1APLC 4M3BA 2K9SA 5F1JA 4C3HJ 4EEFG 5FKMA 3RQIA 4AUXA 2E2HJ 1IDZA 3JRIA 2WUIA 2TRTA 3MN2A 1TWAJ 2LTPA 1W0UA 2AHQA 2YS9A 2RHAA 1D5YA 2JA7J 1B8IA 4C3JJ 4DZPA 2QF7A 4C2MJ 1HDDC 1HOMA 2LR8A 5CW8A 3TP0A 2FD5A 3PO3J 2UXUA 2XRLA 3ZOBA 3M3YJ 3S1NJ 5FKNA 5M5XJ 5IP9J 2R92J 3MKLA 1SGMA 3JRFA 4CYCB 2YVHA 3FKIJ 4MXMA 1MBJA 2CUEA 2NP3A 1NK2P 5E3LA 3GTJJ 4MK6A 2REKA 1S7EA 5GP9A 5IPAA 2DTZA 3HTHA 1SFOJ 1GV2A 5JLWA 4YZEA 3NARA 1FEXA 1ZR2A 2HOTA 3C07A 2FQ4A 3ON2A 4CYCA 1IG7A 3SJMA 4NELA 1H88C 1W0TA 1UG2A 2QCOA 5EYRA 3TW7A 3JRAA 2EQRA 2XPUA 4A3MJ 2YU9J 4B4CA 1H8AC 2JA5J 3BR2A 1UI5A 3ZQIA 5FLMJ 3TW6A 2FX0A 3WHCA 2CRGA 1H89C 2EZHA 1B72B 4QSHA 4NDLA 2MGQA 2ME6A 5GPAA 2LFBA 2OPTA 3O8GA 2E1OA 5E3MA 1PUFB 1RKTA 2LVSA 2XB0X 3ZQCA 3RZDJ 3PASA 5EGOB 4XIDA 3BR5A 5J1RA 4GCLA 5C44J 1AU7A 2ZCMA 2X48A 4ME9A 3S1QJ 2WAQN 4HKUA 4JX6A 3LWJA 1I50J 3BTLA 3HOVJ 1PUFA 5IOYA 3HOYJ 5EGOA 2RAEA 3NAUA 3FK7A 1U78A 4ABZA 2VKEA 4BY1J 1VI0A 2DMNA 4AC6A 4DW6A 3E7QA 3NI7A 2V57A 1IRZA 5D1RA 4A3IJ 2NP5A 1RKWA 2NVYJ 2Q24A 1WH5A 3F0CA 2GBYA 2CU7A 3JREA 1Y1VJ 4GFLA 2HQ5A 1MBEA 2WV1A 3HE0A 2X9DA 1QRYA 2P81A 4FE7A 1JKOC 3OSFA 3LJLA 1ZK8A 3F1BA 3HM5A 1Z77A 4BBSJ 4FCYA 2ID6A 5HODA 4XRMA 2Y31A 3S1MJ 2UXOA 5FKOA 3S5RA 3BTCA 4ACIA 1JT6A 1OFCX 3HB9A 3HGYA 1IGNA 3BCGA 3SDGA 2OERA 3LSGA 2K9NA 2ID3A 4MLOA 3O60A 3UKGA 1ZGWA 1A6IA 3CRJA 2L9RA 3OOUA 2ELKA 2JMWA 5C3EJ 3NRGA 3HDDA 5DTDA 3VVZA 2R5ZA 1JKRC 2QWTA 2JK3A 1Y1WJ 3VVYA 4M3EA 3K2AA 5M3FJ 4JX5A 2QIBA 2QOPA 2M9HA 2ZB9A 1FIAA 2W48A 1TWGJ 4IHXA 3G1OA 1UI6A 2Y0SN 4GFBA 1ORKA 1P7IA 3V78A 2NOGA 3BR0A 3BT9A 4A3KJ 1B8IB 3BG5A 2OI8A 4RDUA 2DMPA 2R0QC 2M8GX 2I10A 4HNVA 1TWFJ 3HOUJ 1AKHA 2COBA 3RZOJ 5AQCA 2XB5A 4ICHA 1G2HA 1GV5A 4FE4A 3WHBA 4MFEA 3LSPA 1DU6A 1FTTA 2GLOA 2JA6J 2MSYA 2QKOA 1JTXA 2UXHA 3FISA 2EZKA 4AC0A 3G56A 3P9TA 2K9QA 3H0GJ 4M6VA 5F04A 5H9TA 5EEAA 2F07A 2WB1N 4XK4A 2L7FP 3VOKA 1ZTRA 1XC5A 1MNMC 2O7OA 2HKUA 3QQAA 4BY7J 1JJ8C 3VW2A 2DA5A 1EF4A 1LE8A 2IU5A 1RPWA 3V6GA 1QVUA 2L7ZA 1IJWC 2PZ9A 5IYDJ 4MIMA 1F43A 3QPLA 5FLVA 3Q0VA 3JRDA 2HDDA 3IH2A 1JTYA 2IAIA 3PO2J 3HOZJ 2XSDC 2NS7A 3BG9A 2KT0A 3RH2A 2D6YA 5K58A 3EUPA 3CMYA 2HXOA 1X2NA 3K7AJ 1U9NA 2FJ1A 3ZQFA 3ON4A 3LOCA 4UUSB 1GVDA 1ETYA 2GUHA 3HIMA 2LLKA 2DG7A 4A3GJ 3OIOA 3RKQA 4FISA 2MG4A 2CQQA 5C4XJ 3HKZN 1GDTA 3HBLA 2ECBA 2G7GA 3CDLA 4IHYA 1ETWA 2G0EA 4IHVA 3VUQA 1P7JA 1XG1A 3HGGA 3SFIA 2EZLA 4JYKA 4Y52J 1FTZA 2NVQJ 4UUSA 1SANA 5DS9A 3LSRA 2O9LA 1HDPA 2Y2ZA 3IH3A 5IYCJ 5M5WJ 3BJBA 2R93J 1ETVA 4XRSA 4UUTA 1BA5A 3BG3A 1ZKGA 3KKDA 2VKVA 2FBQA 3BHQA 3KZ9A 2EBIA 2XGDA 5M3MJ 3HTIA 4A3EJ 3MNLA 3VW0A 2JA8J 5EDNA 2LY9A 4QIWN 1OCTC 1JJ6C 1MBKA 1JKPC 3CJDA 4W97A 1MSEC 4M3FA 2CQXA 4BBRJ 5FKLA 3W6VA 4AYBN 2M0CA 2Y9YA 5HSZA 1E3OC 2GENA 3LHQA 4GFKA 2NVTJ 5GPCA 1MBHA 4FTHA 4A3CJ 2HOSA 4NN1A 1ZQ3P 2H8RA 2DMQA 1VNDA 1Z0XA 3EGQA 2IEKA 5J1UA 4DYRA 3QBMA 1O4XA 3BTIA 1QPIA 3L1PA 1IDYA 3A03A 4D5CA 2AO9A 1JUMA 2R5ZB 3JRHA 2M34A 5JLXA 1R9TJ 3FRQA 1TWHJ 2PBXA 2O8KA 3DCFA 2VPRA 2GFNA 4A3JJ 1HF0A 1F36A 2NX4A 3LNQA 2Y30A 2ME0A 4IEJA 1BW5A 1WGXA 5IOZA 4L62A 5EFYA 5CXIA 5F08A 2HYJA 3TP3A 4I76A 3GZIA 4UDSA 1AKHB 2CJJA 1RETA 4PXIA 2EZIA 1ITYA 2CUFA 1FIPA 2XPVA 3G7RA 2ZCNA 1GUUA 1JGGA 3MVPA 5BNGA 2UXIA 3GTQJ 3C2BA 1U8BA 3HOWJ 3Q3SA 4XRSG 2E2JJ 1T56A 4JP0A 5DAJA 2DA6A 4DYQA 3TEDA 2LP0A 3B6AA 4G12A 3FK6A 1I6HJ 1RR7A 3OSGA 3AQSA 5IP7J 2JJ7A 3JR9A 1U9OA 3NXCA 5F0CA 5F0HA 2M2EA 3ZQLA 3I4MJ 5EZHA 3BQYA 4W1UA 3GTKJ 2DMUA 1IC8A 3DPJA 3HTJA 4B1RA 1LE8B 5F27A 2OF7A 3NPIA 4JNNA 1IV6A 5FMPA 3H3VK 1X2MA 5K7ZA 5HBUA 3QPSA 1GT0C 1DU0A 3CCYA 3BNIA 3T6NA 1ETXA 3LSJA 3VW1A 2WGBA 4XICA 3O8HA 1WCMJ 2HOAA 3PM1A 1RESA 1ETOA 5EG0A 3NNRA 3BR1A 2MW8A 2DJNA 3B81A 2RASA 2XDNA 2QTQA 3VPRA 4A69C 2LK2A 3B6CA 5K7FA 4DYCA 3E7LA 1AHDP 4M3DA 4X1EA 1MBFA 3PPBA 4KWAA 2DA4A 1A5JA 2XPWA 4GCKA 4IHWA 5FHPA 4D5FA 4A3FJ 2X6OA 4Y7NJ 2R5YB 2N8GA 3VP5A 2ZOZA 2NS8A 5C4JJ 3KNWA 5F0FA 1TWCJ 2XGCA 4L5EA 3ANGA 5J3LA 1WH7A 2L7MP 5FGLA 2DMTA 1ETKA 1BW6A 2IBDA 3CWRA 3BQZA 5FJ8J 5E3OA 2O7TA 3S14J 1HCRA 1K61A 3S1RJ 1OJLA 3G1MA 4D7NA 2R5YA 3GTMJ 1OCPA 3S15J 1POGA 3VIBA 1T33A 1JUPA 3D1NI 2KDZA 1I3QJ 1BJZA 2ZCXA 2DN0A 4MO7A 5K7HA 2ECCA 3BTJA 2UXPA 1MBGA 1WI3A 4A93J 4DZJA 3DEWA 4I6ZA 3VVXA 3S2DJ 2G7LA 4LOCA 1JKQC 3BR3A 2JWTA 2LD5A 4B3AA 2DA2A 4JX4A 2Y9ZA 3ZQHA 2EH3A 3CQZJ 1ZR4A 4JKZA 2HI3A 3Q0WA 5EF6A 3AQTA 5E3NA 2B63J 1YRNB 1B72A 4X6AJ 1Q1VA 2LKXA 2VI6A 1K83J 2GM4A 1ENHA 3GTOJ 1UMQA 5D18A 2VUMJ 4V2GA 3BR6A 4BKXA 1LFUP 4BXXJ 4JL3A 5HAWA 3HEFA 3GEUA 3ANPA 5EZGA 3KKCA 4S0HB 3HOXJ 1HLVA 3RD3A 2NVXJ 3IH4A 3JRBA 1YRNA 2H1KA 2W53A 1QVTA 3FIWA 4A3LJ 3S2HJ 4RBOA 5IP6A 1VFCA 3BRUA 4V2FA 2D5VA 4J19A 2K40A 4MFDA 5M5YJ 9ANTA 3IV5A 3VOXA 5D19A 4D7MA 2DA1A 1JT0A 3JRCA 3S17J 2YUSA 1BL0A 1LFBA 2R7ZJ 1IUFA 1MH3A 2DA3A 2XGEA 5FKKA 3GBGA 1NTCA 3GTPJ 3HTAA 3A01B 4M3GA 5C4YA 1WPKA 1CQTA 1MSFC 3IUVA 2JN6A 4GCTA 1JUSA 1VF9A 3S16J 1X58A 2PMZN 3ZQGA 4AF5A 3QKXA 2G3BA 4CGRA 1MH4A 5IYBJ 1TC3C 4C3IJ 4A3DJ 3I4NJ 4A3BJ 3A01A 2E19A 2G7SA 2L0KA 3COLA 2HYTA 5J1YA 1UHSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HXI A;  3Q0U A;  2ZOY A;  4QTR A;  2E2I J;  3A02 A;  5EG0 B;  5CXG A;  3G1L A;  3GTG J;  3JSJ A;  3JRG A;  3GTL J;  2YVE A;  1ETQ A;  1NK3 P;  2DG8 A;  1FJL A;  2TCT A;  3M4O J;  1XS9 A;  2DA7 A;  1APL C;  4M3B A;  2K9S A;  5F1J A;  4C3H J;  4EEF G;  5FKM A;  3RQI A;  4AUX A;  2E2H J;  1IDZ A;  3JRI A;  2WUI A;  2TRT A;  3MN2 A;  1TWA J;  2LTP A;  1W0U A;  2AHQ A;  2YS9 A;  2RHA A;  1D5Y A;  2JA7 J;  1B8I A;  4C3J J;  4DZP A;  2QF7 A;  4C2M J;  1HDD C;  1HOM A;  2LR8 A;  5CW8 A;  3TP0 A;  2FD5 A;  3PO3 J;  2UXU A;  2XRL A;  3ZOB A;  3M3Y J;  3S1N J;  5FKN A;  5M5X J;  5IP9 J;  2R92 J;  3MKL A;  1SGM A;  3JRF A;  4CYC B;  2YVH A;  3FKI J;  4MXM A;  1MBJ A;  2CUE A;  2NP3 A;  1NK2 P;  5E3L A;  3GTJ J;  4MK6 A;  2REK A;  1S7E A;  5GP9 A;  5IPA A;  2DTZ A;  3HTH A;  1SFO J;  1GV2 A;  5JLW A;  4YZE A;  3NAR A;  1FEX A;  1ZR2 A;  2HOT A;  3C07 A;  2FQ4 A;  3ON2 A;  4CYC A;  1IG7 A;  3SJM A;  4NEL A;  1H88 C;  1W0T A;  1UG2 A;  2QCO A;  5EYR A;  3TW7 A;  3JRA A;  2EQR A;  2XPU A;  4A3M J;  2YU9 J;  4B4C A;  1H8A C;  2JA5 J;  3BR2 A;  1UI5 A;  3ZQI A;  5FLM J;  3TW6 A;  2FX0 A;  3WHC A;  2CRG A;  1H89 C;  2EZH A;  1B72 B;  4QSH A;  4NDL A;  2MGQ A;  2ME6 A;  5GPA A;  2LFB A;  2OPT A;  3O8G A;  2E1O A;  5E3M A;  1PUF B;  1RKT A;  2LVS A;  2XB0 X;  3ZQC A;  3RZD J;  3PAS A;  5EGO B;  4XID A;  3BR5 A;  5J1R A;  4GCL A;  5C44 J;  1AU7 A;  2ZCM A;  2X48 A;  4ME9 A;  3S1Q J;  2WAQ N;  4HKU A;  4JX6 A;  3LWJ A;  1I50 J;  3BTL A;  3HOV J;  1PUF A;  5IOY A;  3HOY J;  5EGO A;  2RAE A;  3NAU A;  3FK7 A;  1U78 A;  4ABZ A;  2VKE A;  4BY1 J;  1VI0 A;  2DMN A;  4AC6 A;  4DW6 A;  3E7Q A;  3NI7 A;  2V57 A;  1IRZ A;  5D1R A;  4A3I J;  2NP5 A;  1RKW A;  2NVY J;  2Q24 A;  1WH5 A;  3F0C A;  2GBY A;  2CU7 A;  3JRE A;  1Y1V J;  4GFL A;  2HQ5 A;  1MBE A;  2WV1 A;  3HE0 A;  2X9D A;  1QRY A;  2P81 A;  4FE7 A;  1JKO C;  3OSF A;  3LJL A;  1ZK8 A;  3F1B A;  3HM5 A;  1Z77 A;  4BBS J;  4FCY A;  2ID6 A;  5HOD A;  4XRM A;  2Y31 A;  3S1M J;  2UXO A;  5FKO A;  3S5R A;  3BTC A;  4ACI A;  1JT6 A;  1OFC X;  3HB9 A;  3HGY A;  1IGN A;  3BCG A;  3SDG A;  2OER A;  3LSG A;  2K9N A;  2ID3 A;  4MLO A;  3O60 A;  3UKG A;  1ZGW A;  1A6I A;  3CRJ A;  2L9R A;  3OOU A;  2ELK A;  2JMW A;  5C3E J;  3NRG A;  3HDD A;  5DTD A;  3VVZ A;  2R5Z A;  1JKR C;  2QWT A;  2JK3 A;  1Y1W J;  3VVY A;  4M3E A;  3K2A A;  5M3F J;  4JX5 A;  2QIB A;  2QOP A;  2M9H A;  2ZB9 A;  1FIA A;  2W48 A;  1TWG J;  4IHX A;  3G1O A;  1UI6 A;  2Y0S N;  4GFB A;  1ORK A;  1P7I A;  3V78 A;  2NOG A;  3BR0 A;  3BT9 A;  4A3K J;  1B8I B;  3BG5 A;  2OI8 A;  4RDU A;  2DMP A;  2R0Q C;  2M8G X;  2I10 A;  4HNV A;  1TWF J;  3HOU J;  1AKH A;  2COB A;  3RZO J;  5AQC A;  2XB5 A;  4ICH A;  1G2H A;  1GV5 A;  4FE4 A;  3WHB A;  4MFE A;  3LSP A;  1DU6 A;  1FTT A;  2GLO A;  2JA6 J;  2MSY A;  2QKO A;  1JTX A;  2UXH A;  3FIS A;  2EZK A;  4AC0 A;  3G56 A;  3P9T A;  2K9Q A;  3H0G J;  4M6V A;  5F04 A;  5H9T A;  5EEA A;  2F07 A;  2WB1 N;  4XK4 A;  2L7F P;  3VOK A;  1ZTR A;  1XC5 A;  1MNM C;  2O7O A;  2HKU A;  3QQA A;  4BY7 J;  1JJ8 C;  3VW2 A;  2DA5 A;  1EF4 A;  1LE8 A;  2IU5 A;  1RPW A;  3V6G A;  1QVU A;  2L7Z A;  1IJW C;  2PZ9 A;  5IYD J;  4MIM A;  1F43 A;  3QPL A;  5FLV A;  3Q0V A;  3JRD A;  2HDD A;  3IH2 A;  1JTY A;  2IAI A;  3PO2 J;  3HOZ J;  2XSD C;  2NS7 A;  3BG9 A;  2KT0 A;  3RH2 A;  2D6Y A;  5K58 A;  3EUP A;  3CMY A;  2HXO A;  1X2N A;  3K7A J;  1U9N A;  2FJ1 A;  3ZQF A;  3ON4 A;  3LOC A;  4UUS B;  1GVD A;  1ETY A;  2GUH A;  3HIM A;  2LLK A;  2DG7 A;  4A3G J;  3OIO A;  3RKQ A;  4FIS A;  2MG4 A;  2CQQ A;  5C4X J;  3HKZ N;  1GDT A;  3HBL A;  2ECB A;  2G7G A;  3CDL A;  4IHY A;  1ETW A;  2G0E A;  4IHV A;  3VUQ A;  1P7J A;  1XG1 A;  3HGG A;  3SFI A;  2EZL A;  4JYK A;  4Y52 J;  1FTZ A;  2NVQ J;  4UUS A;  1SAN A;  5DS9 A;  3LSR A;  2O9L A;  1HDP A;  2Y2Z A;  3IH3 A;  5IYC J;  5M5W J;  3BJB A;  2R93 J;  1ETV A;  4XRS A;  4UUT A;  1BA5 A;  3BG3 A;  1ZKG A;  3KKD A;  2VKV A;  2FBQ A;  3BHQ A;  3KZ9 A;  2EBI A;  2XGD A;  5M3M J;  3HTI A;  4A3E J;  3MNL A;  3VW0 A;  2JA8 J;  5EDN A;  2LY9 A;  4QIW N;  1OCT C;  1JJ6 C;  1MBK A;  1JKP C;  3CJD A;  4W97 A;  1MSE C;  4M3F A;  2CQX A;  4BBR J;  5FKL A;  3W6V A;  4AYB N;  2M0C A;  2Y9Y A;  5HSZ A;  1E3O C;  2GEN A;  3LHQ A;  4GFK A;  2NVT J;  5GPC A;  1MBH A;  4FTH A;  4A3C J;  2HOS A;  4NN1 A;  1ZQ3 P;  2H8R A;  2DMQ A;  1VND A;  1Z0X A;  3EGQ A;  2IEK A;  5J1U A;  4DYR A;  3QBM A;  1O4X A;  3BTI A;  1QPI A;  3L1P A;  1IDY A;  3A03 A;  4D5C A;  2AO9 A;  1JUM A;  2R5Z B;  3JRH A;  2M34 A;  5JLX A;  1R9T J;  3FRQ A;  1TWH J;  2PBX A;  2O8K A;  3DCF A;  2VPR A;  2GFN A;  4A3J J;  1HF0 A;  1F36 A;  2NX4 A;  3LNQ A;  2Y30 A;  2ME0 A;  4IEJ A;  1BW5 A;  1WGX A;  5IOZ A;  4L62 A;  5EFY A;  5CXI A;  5F08 A;  2HYJ A;  3TP3 A;  4I76 A;  3GZI A;  4UDS A;  1AKH B;  2CJJ A;  1RET A;  4PXI A;  2EZI A;  1ITY A;  2CUF A;  1FIP A;  2XPV A;  3G7R A;  2ZCN A;  1GUU A;  1JGG A;  3MVP A;  5BNG A;  2UXI A;  3GTQ J;  3C2B A;  1U8B A;  3HOW J;  3Q3S A;  4XRS G;  2E2J J;  1T56 A;  4JP0 A;  5DAJ A;  2DA6 A;  4DYQ A;  3TED A;  2LP0 A;  3B6A A;  4G12 A;  3FK6 A;  1I6H J;  1RR7 A;  3OSG A;  3AQS A;  5IP7 J;  2JJ7 A;  3JR9 A;  1U9O A;  3NXC A;  5F0C A;  5F0H A;  2M2E A;  3ZQL A;  3I4M J;  5EZH A;  3BQY A;  4W1U A;  3GTK J;  2DMU A;  1IC8 A;  3DPJ A;  3HTJ A;  4B1R A;  1LE8 B;  5F27 A;  2OF7 A;  3NPI A;  4JNN A;  1IV6 A;  5FMP A;  3H3V K;  1X2M A;  5K7Z A;  5HBU A;  3QPS A;  1GT0 C;  1DU0 A;  3CCY A;  3BNI A;  3T6N A;  1ETX A;  3LSJ A;  3VW1 A;  2WGB A;  4XIC A;  3O8H A;  1WCM J;  2HOA A;  3PM1 A;  1RES A;  1ETO A;  5EG0 A;  3NNR A;  3BR1 A;  2MW8 A;  2DJN A;  3B81 A;  2RAS A;  2XDN A;  2QTQ A;  3VPR A;  4A69 C;  2LK2 A;  3B6C A;  5K7F A;  4DYC A;  3E7L A;  1AHD P;  4M3D A;  4X1E A;  1MBF A;  3PPB A;  4KWA A;  2DA4 A;  1A5J A;  2XPW A;  4GCK A;  4IHW A;  5FHP A;  4D5F A;  4A3F J;  2X6O A;  4Y7N J;  2R5Y B;  2N8G A;  3VP5 A;  2ZOZ A;  2NS8 A;  5C4J J;  3KNW A;  5F0F A;  1TWC J;  2XGC A;  4L5E A;  3ANG A;  5J3L A;  1WH7 A;  2L7M P;  5FGL A;  2DMT A;  1ETK A;  1BW6 A;  2IBD A;  3CWR A;  3BQZ A;  5FJ8 J;  5E3O A;  2O7T A;  3S14 J;  1HCR A;  1K61 A;  3S1R J;  1OJL A;  3G1M A;  4D7N A;  2R5Y A;  3GTM J;  1OCP A;  3S15 J;  1POG A;  3VIB A;  1T33 A;  1JUP A;  3D1N I;  2KDZ A;  1I3Q J;  1BJZ A;  2ZCX A;  2DN0 A;  4MO7 A;  5K7H A;  2ECC A;  3BTJ A;  2UXP A;  1MBG A;  1WI3 A;  4A93 J;  4DZJ A;  3DEW A;  4I6Z A;  3VVX A;  3S2D J;  2G7L A;  4LOC A;  1JKQ C;  3BR3 A;  2JWT A;  2LD5 A;  4B3A A;  2DA2 A;  4JX4 A;  2Y9Z A;  3ZQH A;  2EH3 A;  3CQZ J;  1ZR4 A;  4JKZ A;  2HI3 A;  3Q0W A;  5EF6 A;  3AQT A;  5E3N A;  2B63 J;  1YRN B;  1B72 A;  4X6A J;  1Q1V A;  2LKX A;  2VI6 A;  1K83 J;  2GM4 A;  1ENH A;  3GTO J;  1UMQ A;  5D18 A;  2VUM J;  4V2G A;  3BR6 A;  4BKX A;  1LFU P;  4BXX J;  4JL3 A;  5HAW A;  3HEF A;  3GEU A;  3ANP A;  5EZG A;  3KKC A;  4S0H B;  3HOX J;  1HLV A;  3RD3 A;  2NVX J;  3IH4 A;  3JRB A;  1YRN A;  2H1K A;  2W53 A;  1QVT A;  3FIW A;  4A3L J;  3S2H J;  4RBO A;  5IP6 A;  1VFC A;  3BRU A;  4V2F A;  2D5V A;  4J19 A;  2K40 A;  4MFD A;  5M5Y J;  9ANT A;  3IV5 A;  3VOX A;  5D19 A;  4D7M A;  2DA1 A;  1JT0 A;  3JRC A;  3S17 J;  2YUS A;  1BL0 A;  1LFB A;  2R7Z J;  1IUF A;  1MH3 A;  2DA3 A;  2XGE A;  5FKK A;  3GBG A;  1NTC A;  3GTP J;  3HTA A;  3A01 B;  4M3G A;  5C4Y A;  1WPK A;  1CQT A;  1MSF C;  3IUV A;  2JN6 A;  4GCT A;  1JUS A;  1VF9 A;  3S16 J;  1X58 A;  2PMZ N;  3ZQG A;  4AF5 A;  3QKX A;  2G3B A;  4CGR A;  1MH4 A;  5IYB J;  1TC3 C;  4C3I J;  4A3D J;  3I4N J;  4A3B J;  3A01 A;  2E19 A;  2G7S A;  2L0K A;  3COL A;  2HYT A;  5J1Y A;  1UHS A; 
#chains in the Genus database with same CATH topology
 2VJJ A;  2ZOY A;  4QTR A;  2HTS A;  3IL2 A;  4BDY A;  1QZY A;  3GTG J;  1BR2 A;  3GTL J;  4LLN A;  1HKQ A;  4ZDL A;  2R7X A;  1QO0 D;  1FJL A;  3CDH A;  3CJR B;  1MW7 A;  2XV4 S;  1REP C;  2VN2 A;  4EEF G;  1BM9 A;  4HAM A;  2P8T A;  2E2H J;  1IDZ A;  2WUI A;  4HX4 A;  5BPI A;  3OWT A;  2TRT A;  4IOC F;  2RHA A;  2AHQ A;  2JTV A;  2RQP A;  3SQN A;  4XOP A;  2KZV A;  4LB6 B;  3RPU A;  1B8I A;  4C3J J;  4JOM A;  1KGS A;  4M9X A;  3F8C A;  1HOM A;  1U5T A;  2ACJ A;  4B44 A;  2HDC A;  2PG4 A;  1KZH A;  3SZP A;  3FBN B;  3FXO A;  4N0B A;  1ZLK A;  5FKN A;  1XGM A;  1P6R A;  4RLF A;  4MHG A;  2M45 A;  5IP9 J;  1ACI A;  2DQL A;  3IAM 2;  1SGM A;  4RB2 C;  1SVL A;  3WTU C;  2X6Y A;  3DP7 A;  3PQK A;  1WSU A;  1WZ2 A;  3IRR A;  4HQE A;  4L9N A;  1NK2 P;  3J81 Z;  2A68 F;  2E34 A;  3HRS A;  1TT5 B;  2IS6 A;  4OD5 A;  3HTH A;  4M9S A;  2W4S A;  4HQM A;  4UXN A;  2K86 A;  5EJC A;  4OIR F;  2HOT A;  4C2U A;  1J0R A;  1LVK A;  1FEX A;  3ON2 A;  3SJM A;  5DUI A;  3P9K A;  2QCO A;  3TW7 A;  1ERD A;  1BR1 A;  4BJ6 C;  3BR2 A;  4UB8 C;  2JA5 J;  5FLM J;  1UI5 A;  1PP8 F;  4ZTF A;  3BOQ A;  4HV5 A;  1B72 B;  1N78 A;  2EA4 A;  4MEX F;  2CV1 A;  4AIJ A;  5GPA A;  5B66 C;  4BE1 A;  5E3M A;  3U21 A;  2LVS A;  3B73 A;  2XVC A;  3QP6 A;  3ZQC A;  4PDK A;  3CJN A;  5EGO B;  4CDG A;  3BR5 A;  4KJZ A;  2KIU A;  5D4S A;  4GCL A;  4EAT A;  4ITV A;  2HKX A;  1GHC A;  3M07 A;  1JE8 A;  4ME9 A;  3QP5 A;  2RN7 A;  3HPH A;  3LWJ A;  1IXR C;  2X1D A;  2COM A;  2EK5 A;  3S2W A;  3QOE A;  4BUP A;  2HVS A;  1OIS A;  2WAD A;  3FK7 A;  3L2W A;  3ROU A;  2VKE A;  1W7P B;  4II3 A;  4E7I A;  1Z67 A;  2HZT A;  2Y69 H;  2FBH A;  2ZFU A;  2MA3 A;  6PAX A;  2NVY J;  4FX4 A;  2DAO A;  2Q24 A;  2GBY A;  4BQQ A;  5LGN A;  2Y48 A;  3JRE A;  1J7K A;  2VOD A;  2X6X A;  4GFL A;  1F1Z A;  2L01 A;  1OQY A;  4LLL A;  3G6E I;  1VQ6 I;  4AWX B;  1QRY A;  1O3T A;  2DK8 A;  3SHF A;  1QNT A;  3LJL A;  2F5V A;  4BBS J;  2ID6 A;  3QYB A;  2R7F A;  2ELJ A;  3L2R A;  3H1C A;  1UB9 A;  2UXO A;  3GFI A;  2QWW A;  3HB9 A;  1P2F A;  4CCJ A;  1MDM A;  4MLO A;  3UKG A;  1A6I A;  3OOU A;  2M5W A;  2ELK A;  3OYN A;  3VVZ A;  5DTD A;  1SMY F;  2QWT A;  5TGT A;  3AAF A;  1Y1W J;  3VVY A;  4J00 A;  4PGG A;  1EJ9 A;  1Z91 A;  1MKM A;  4N4O B;  4F55 A;  2QIB A;  1IZ1 A;  1FSH A;  1OCR H;  1VQL I;  2R7O A;  5FRN A;  5HLH A;  4U9N A;  1W5T A;  2JRT A;  3PNT A;  1FIA A;  4U9L A;  1TWG J;  4IHX A;  1UI6 A;  1ORK A;  2NOG A;  5FO5 A;  1J09 A;  2K4J A;  3VYR B;  5H20 A;  2OI8 A;  4XN3 A;  2E5N A;  5K5Q A;  4NQW B;  1UHW A;  5CQE A;  2KKO A;  4HF1 A;  3RZO J;  1RR8 C;  2XB5 A;  2LBF A;  2HWV A;  1GV5 A;  2EFW A;  1N77 A;  4B48 A;  4HYE A;  1Z21 A;  1QHH D;  2YPR A;  2LDU A;  5D4R A;  4YFX F;  4RAF A;  4B43 A;  4BAY A;  4Y13 A;  1JTX A;  2QKO A;  4OD4 A;  3GO5 A;  3KFW X;  2R7U A;  3H0G J;  5LFA A;  5H9T A;  2QEX I;  3QOD A;  5EEA A;  5LGU A;  2WB1 N;  1MNM C;  4ZYG A;  4BY7 J;  2DTR A;  4U0W A;  1JJ8 C;  4IQ4 A;  2H6B A;  1EF4 A;  2IU5 A;  2RGV A;  1R49 A;  3V6G A;  4ZZL A;  3Q0V A;  2HDD A;  3PO2 J;  3I9V 2;  2NS7 A;  2F2E A;  2KFD A;  3REO A;  3WE3 A;  3L7W A;  3GME A;  3ZQF A;  1KU9 A;  5FRO A;  1V5F A;  1PVE A;  2MYS A;  1X1P A;  2GUH A;  4N9I A;  5ED4 A;  1U0J A;  2J5O A;  3RKQ A;  1EKE A;  5HLG A;  4GXO A;  4L5I A;  5HLT A;  3HKZ N;  3L2V A;  2ECB A;  4OAZ A;  3KP7 A;  4S05 A;  3KPH A;  2VQG A;  1P7J A;  2NS0 A;  2NYX A;  2WC2 A;  2EZL A;  4JYK A;  4L0Z B;  4LG0 A;  5L3E A;  3K70 C;  3CJQ B;  3OIP A;  2UZK A;  5DS9 A;  2KJC A;  1HDP A;  5M5W J;  3IH3 A;  3FM3 A;  4EJU A;  1CF7 B;  4H4K C;  2ZXI A;  3WTZ A;  1BA5 A;  4ENM A;  1YIJ I;  1H9G A;  1SEU A;  1AOY A;  1SFU A;  1T0F C;  1WJE A;  1ZRF A;  2VKV A;  2FBQ A;  3BHQ A;  5LBQ A;  4C2T A;  3DEU A;  1XSV A;  3E5X A;  3KP2 A;  3VTI A;  5M3M J;  3TQN A;  3MNL A;  3VW0 A;  5EDN A;  4PFP A;  2LC2 A;  3S3N A;  1FP1 D;  2M7B A;  3QU6 A;  5E1Z B;  2EFO A;  4IJA A;  3TOA A;  2X6W A;  3GUD A;  2ADU A;  4BU2 A;  1W5C C;  2W7N A;  5L3B A;  1LQ1 A;  2P7C B;  2NVT J;  1EH6 A;  4OMY A;  4FTH A;  3ZXS A;  5BPD A;  3C1D A;  3CDI A;  4CH7 A;  3LAP A;  3OMY A;  4CGZ A;  2BOL A;  2L5Q A;  4F52 A;  4DYR A;  3EUA A;  3PUB A;  2VT3 A;  4HV6 A;  1IDY A;  3EDP A;  4BE0 A;  1FWZ A;  2E60 A;  4IRH A;  2R7Q A;  3WTW C;  1TWH J;  2PBX A;  2B1E A;  1SAU A;  3ZMD A;  4Y17 A;  3IC7 A;  2O8K A;  2MH9 A;  3DCF A;  2V1N A;  2V1U A;  3LA3 A;  2BGC A;  4A3J J;  2DT5 A;  5L3G A;  4IEJ A;  2ME0 A;  5ERI A;  1I27 A;  2WY7 Q;  3DPL C;  4ENJ A;  4NC6 A;  3KP3 A;  5LHI A;  5F08 A;  3RPQ A;  3GZI A;  4GYG A;  2HOE A;  2LKP A;  3HG9 A;  3RQ4 A;  1UEL B;  3OR1 C;  2FXA A;  3QYE A;  4WIB A;  2F4M B;  2ZCN A;  3CUO A;  2CW8 A;  2UXI A;  3W6J B;  3IKT A;  1F4K A;  1K4S A;  2DA6 A;  4RLQ A;  3TED A;  3QYF A;  4GGG A;  1Z7U A;  2IP2 A;  4YII A;  3CF2 A;  2JJ7 A;  5DCM A;  2EJR A;  3NXC A;  3KEY A;  1YW9 A;  3D5L A;  4NC7 A;  4BHB A;  1LE8 B;  3LSH A;  2E1M C;  2FOK A;  3IKV A;  3TO9 A;  3H3V K;  1I1G A;  1OR7 A;  1U2W A;  3ZQ7 A;  3CC2 I;  2O5R A;  2H8W A;  5GTI C;  4DGW B;  2ZFW A;  5D5U B;  3RIR A;  1BI2 A;  3ZMS A;  3AG1 H;  4BYY A;  4R79 A;  2DXI A;  3CCS I;  2L9N A;  3VSK A;  1A31 A;  2IGO A;  3O8H A;  3PM1 A;  1ETO A;  1TT0 A;  4F93 B;  2JVH A;  1I6X A;  3KIO A;  3F21 A;  2DDA A;  2QTQ A;  4ZDO A;  3Q9V A;  3EUH A;  5K7F A;  2O8X A;  3DQV C;  2OTJ I;  1UG0 A;  4X1E A;  4CA0 A;  2L54 A;  1VQ4 I;  1FZP B;  4LIT A;  2KIF A;  1B6A A;  1O3S A;  4IHW A;  3V7R A;  2ZBK A;  5LEK A;  2N8G A;  2QQA A;  3I0T A;  2CSO A;  2NS8 A;  5C4J J;  2R7D A;  2CV2 A;  3KNW A;  5F0F A;  5J8C A;  3Q9S A;  2KIS A;  3I59 B;  3QAH A;  1EH7 A;  2FNA A;  1HXD A;  5FGL A;  4OIP F;  3MZ8 A;  3SFZ A;  3S93 A;  4BQA A;  4F7Z A;  1X1C A;  3ZMU A;  3K4J A;  3J80 Z;  2DFI A;  1XGN A;  3GTM J;  5TIS C;  1A35 A;  1POG A;  4LLG F;  5FB2 A;  1T33 A;  2CQN A;  3RPU D;  1TNT A;  1P4A A;  2FRH A;  3IWZ A;  3OYB A;  3OYC A;  2VKH A;  2IGM A;  2XIG A;  3BTJ A;  4G7Z F;  3K4K A;  3OL3 A;  1TW3 A;  3VVX A;  3S2D J;  4BXU A;  4UUV A;  4BXF A;  5FLX Z;  4PGH A;  2JWT A;  1ZRE A;  4UV9 A;  1O57 A;  1I1S A;  4B3A A;  2DA2 A;  2LF8 A;  4JX4 A;  2Y9Z A;  4E4H A;  2X85 A;  5L3F A;  3M9A A;  2WB1 A;  1R7J A;  3ASN H;  3MCZ A;  2K3P A;  5JR3 A;  3E1S A;  1WVR A;  4NBQ A;  1ZR4 A;  1YRN B;  1B72 A;  2DFF A;  2R4G A;  5CVV A;  2VBY A;  2VI6 A;  3GTO J;  1ENH A;  2WBM A;  1FBQ A;  2F5E A;  2QGU A;  2GXB A;  4EJT A;  1SD7 A;  3CP8 A;  3HHH A;  2WWY A;  4JL3 A;  5HAW A;  3HEF A;  4EJO A;  1K78 B;  4PCQ A;  4S0H B;  4CCO A;  4NC8 A;  3KP6 A;  2GIZ A;  2H1K A;  1QVT A;  3M1C A;  5AON A;  3OIQ A;  3C2H A;  3HKZ A;  5DCF A;  1VTN C;  2HZD A;  4CCN A;  4XQF A;  3IV5 A;  4XM3 A;  3MKZ A;  4PUS A;  4D7M A;  2XRO A;  2V1X A;  4RAG A;  5JFR A;  1BL0 A;  2VIX A;  2EA2 A;  1TQI A;  5FKK A;  4M3G A;  1IN4 A;  2OAZ A;  5LEJ A;  1MSF C;  3IUV A;  2JN6 A;  5HLI A;  1E17 A;  2XDV A;  1VF9 A;  3S16 J;  3RKY A;  1R4M B;  1X58 A;  2KL4 A;  2PMZ N;  1HST A;  3QKX A;  5A2Q K;  1ONV A;  2DOF A;  1T8I A;  2G3B A;  5ICG A;  2GQQ A;  1SVO A;  5IYB J;  4AIK A;  2E7W A;  2R7R A;  3PIP F;  5H6R A;  2E19 A;  3A4C A;  3UNG C;  2G7S A;  1QQI A;  1DDN A;  3COL A;  2CW0 F;  1LFP A;  1OYI A;  2B3W A;  4J01 A;  3H5A A;  1R58 A;  4Q47 A;  2UXX A;  1P9Q C;  2HXI A;  1TQP A;  5IT9 K;  3Q0U A;  1HA8 A;  2E2I J;  3A02 A;  3VYS B;  5EG0 B;  2J5P A;  2D1V A;  2OUM A;  1ZHF A;  1JXS A;  5CXG A;  2AS5 F;  3WOD F;  2DYS H;  2EPF A;  3E5U A;  2K02 A;  4WF2 A;  4L18 B;  1FC3 A;  3G3Z A;  2TCT A;  1APL C;  3EYI A;  3DPT A;  4C3H J;  1T38 A;  1PUE E;  1BOB A;  2QEN A;  2O0Y A;  2VQL A;  3RQI A;  2G7U A;  3VB2 A;  5LLQ A;  3RDI A;  1R1U A;  1XGS A;  2XAF A;  1TWA J;  2P0W A;  2P5V A;  5IT3 A;  3DLA A;  4R8H A;  4CCL A;  1HDD C;  2LR8 A;  1ZRC A;  3JW4 A;  4ESF A;  3PO3 J;  2XRL A;  3V8K A;  3ZOB A;  4BEH B;  3WE2 A;  3OYE A;  3S1N J;  4GCV A;  3CP2 A;  4GO1 A;  5M5X J;  2XKO A;  5F1R A;  4HF2 A;  4MQ9 F;  4M74 A;  4CSW A;  2YVH A;  4O3M A;  4MXM A;  4LJZ F;  4C9Y A;  1MBJ A;  5JHU A;  2CUE A;  2VC1 A;  4PZJ A;  4O5V A;  1USS A;  3BG7 A;  3P7N A;  2ZJR F;  5LGT A;  4IVN A;  3VSL A;  1VZ0 A;  5IY5 H;  2OC6 A;  5JLW A;  4KYW A;  2JVG A;  2IS2 A;  2YU3 A;  2VKD A;  3CD6 I;  2GOX B;  2KRH A;  4CYC A;  4E70 A;  2P5K A;  1BI0 A;  1W0T A;  2Z1D A;  3TO7 A;  4IF4 A;  2F5D A;  1S6L A;  2YU9 J;  3V4G A;  2VBX A;  4PSX A;  3U2R A;  3HRT A;  3OS1 A;  2HVR A;  3WHC A;  5K1Y A;  4DBR A;  1H89 C;  1X1A A;  2Y75 A;  2X0L A;  4PJL A;  1W1W E;  4XKW A;  4NDL A;  5ICC A;  2OCC H;  5CQG A;  2MGQ A;  3O2P E;  2LFB A;  2OPT A;  3O3K A;  2E1O A;  3LST A;  1MNE A;  2VL8 A;  1XMA A;  2XB0 X;  4KT5 C;  3PAS A;  3PSF A;  3OYM A;  4MTE A;  1HSJ A;  4XOR A;  4XID A;  3CC4 I;  3ULQ B;  3CJT B;  2QKM B;  4KIS A;  4AIH A;  1NHA A;  2ZCM A;  4EM0 B;  4BQO A;  5LHG A;  4BJT A;  2O03 A;  4OIQ F;  2QLZ A;  3S1Q J;  4S04 A;  2CGP A;  3K4B A;  3B02 A;  4RM3 A;  5AIP A;  5KAF C;  4BE2 A;  1PUF A;  3HC7 A;  5IOY A;  3HOY J;  3CCE I;  2RAE A;  1B9N A;  2OCE A;  1OYW A;  1U78 A;  4BY1 J;  1VI0 A;  3BY6 A;  4C2M A;  3GF2 A;  3WGI A;  3FXJ A;  1DPU A;  4ESJ A;  5LHH A;  2V57 A;  4A3I J;  1YJN I;  1FNN A;  1RKW A;  4LG3 A;  1WH5 A;  1YHQ I;  4BDZ A;  4Z6Y A;  3DTE A;  2R7W A;  1XMX A;  4A5N A;  1D0X A;  3ABT A;  2P81 A;  4FE7 A;  3OYF A;  1JKO C;  3WTV C;  1ZK8 A;  2BW3 A;  2GXA A;  4BJ5 C;  4FCY A;  1OKR A;  4XRM A;  2Y31 A;  3CO6 C;  1OFC X;  3H9J A;  3E6C C;  4JK1 X;  1QZE A;  3SDG A;  2OER A;  1TZL A;  3PJR A;  1Q1H A;  2HTJ A;  2HQA A;  3GXO A;  4AID A;  5FGM A;  1IF1 A;  2JMW A;  4CZC A;  2WV0 A;  3KYL A;  3LSM A;  4OIO F;  2K4B A;  2JK3 A;  3GFM A;  1V3F A;  1FT9 A;  4JX5 A;  4XR6 A;  1WWX A;  2ZCW A;  4II2 A;  5H6Q A;  2RNJ A;  1QBJ A;  3GX4 X;  2M9H A;  3EPZ A;  3MKY B;  4M6X A;  1R5H A;  2CFX A;  1J75 A;  4GFB A;  2IW5 A;  3BR0 A;  3BT9 A;  3VWB A;  2KIM A;  3DTK A;  1OLT A;  3NRV A;  2GZW A;  1R1V A;  3OOP A;  1R36 A;  2PN6 A;  3SDB A;  4ICH A;  1F5T A;  4HA8 A;  1OCO H;  3WHB A;  1FTT A;  3LSP A;  3K1M A;  2WAF A;  1DU6 A;  1R23 A;  1M1E B;  4G6Q A;  5DUK A;  2DQR A;  2EZK A;  1Z3Y A;  3I53 A;  2LRE A;  4FT8 A;  3VOD A;  1SC7 A;  2K9Q A;  3IHU A;  5JVG F;  1Z6T A;  3FKJ A;  1HW1 A;  3H35 A;  2V7F A;  4XN0 A;  2HKO A;  2L7F P;  2QQ9 A;  1WJ5 A;  3P5J A;  2O7O A;  1Y39 A;  3CLO A;  3QQA A;  1E2X A;  2QYO A;  2KJB A;  4XNF A;  4D1Q A;  3VW2 A;  4I0A A;  1LE8 A;  1FOW A;  2XAH A;  3VOE A;  1TW2 A;  2HFH A;  1RPW A;  5F64 A;  1QVU A;  1I3A A;  5BS6 A;  1TL8 A;  1IJW C;  1LVA A;  5IYD J;  2PZ9 A;  2DT6 A;  1F43 A;  2JUC A;  5GAD J;  4YFN F;  1LDK B;  3D5S C;  3IH2 A;  1JTY A;  2IAI A;  2EFN A;  3BG9 A;  1AWC A;  4FAS D;  1X2N A;  4I99 C;  2FJ1 A;  1FBS A;  2OV7 A;  3LOC A;  1ETY A;  2FUG 2;  3N05 A;  2HS5 A;  1ZGA A;  2CQ7 A;  4A3G J;  3LA2 A;  3OIO A;  1WQ2 A;  4FIS A;  2MG4 A;  2FSW A;  3R0A A;  4CCM A;  3CDL A;  4EQQ A;  1ETW A;  1BI1 A;  3P9C A;  1XG1 A;  3DKW A;  1RUN A;  1FTZ A;  4Y52 J;  4UUS A;  3E5Q A;  1SAN A;  5AIQ A;  4DOZ A;  3PIO F;  4KIB A;  2ZKZ A;  1MMD A;  1ETV A;  1DPR A;  3BG3 A;  1IXS B;  1Y6I A;  1ZKG A;  3I59 A;  4XKB A;  1SFK A;  2AQE A;  1HKT A;  1YLF A;  1T98 A;  1ODD A;  1XN7 A;  3L2U A;  3EUH C;  3KZ9 A;  2BYV E;  2EBI A;  1L0O C;  2JA8 J;  1SD6 A;  1KQ0 A;  4QIW N;  2ZO4 A;  1E3H A;  2K27 A;  1WJA A;  1T08 B;  1IN8 A;  3ZMZ A;  3CJD A;  1MSE C;  2FJI 1;  5LRS A;  4E7L A;  4ETS A;  2CO5 A;  4BBR J;  2L3D A;  5FKL A;  1VQM I;  1RUO A;  3J7A O;  3KE2 A;  2M0C A;  3H92 A;  3CCM I;  3ZN1 A;  4ENK A;  1MJB A;  1FYL A;  2IS4 A;  3CCL I;  5E79 C;  5GPC A;  4NN1 A;  2HOS A;  2DMQ A;  4R1H A;  1B1B A;  3EGQ A;  2E71 A;  2FE3 A;  3H3Z A;  4UVB A;  1D3Y A;  4BQN A;  1Y56 A;  5E1W A;  3A03 A;  4D5C A;  4QPO A;  1R1T A;  3SXY A;  1JUM A;  2R5Z B;  2HR3 A;  3JRH A;  1O3Q A;  1VQK I;  3I5U A;  5JLX A;  2CS3 A;  2GFN A;  3KZI C;  2VB6 A;  1S9H A;  5ILV A;  4HLX A;  2EIL H;  4EGY A;  2FF4 A;  3OYH A;  2EV6 A;  5EFY A;  5CXI A;  3G73 A;  3GLL A;  3TP3 A;  4EM1 A;  5FFX A;  3VFZ A;  1AKH B;  3HTU A;  1RET A;  2EZI A;  2GA1 A;  3RYR A;  4LGW A;  1FIP A;  2XPV A;  3G7R A;  1BOA A;  1W5S A;  2W1O A;  3W3C A;  3RJP A;  5DD4 A;  1JGG A;  5BNG A;  3GTQ J;  3HOW J;  2NOJ B;  3Q3S A;  2BY2 A;  4XRS G;  1T56 A;  1X19 A;  4A5M A;  1YTY A;  4L9V A;  4A2U A;  3B6A A;  1RR7 A;  1R5I D;  1XSX A;  1YYV A;  1H0M A;  2RQQ A;  2IGN A;  5F0C A;  3E6B A;  4MNU A;  2OQR A;  2M2E A;  2ICW G;  5EZH A;  3BQY A;  3QU3 A;  3GTK J;  2DMU A;  4ZC3 A;  3VP5 A;  4B1R A;  2W25 A;  2STT A;  3JSO A;  1IV6 A;  5K7Z A;  2ZXH A;  5D6E A;  2HNH A;  4BH9 A;  2FEZ A;  2OZU A;  3PUF A;  2I8D A;  3KZZ A;  1IN7 A;  2YR2 A;  1ETX A;  3ECO A;  2QBY A;  1D0Z A;  2WGB A;  3I58 A;  4YIF A;  2V6C A;  4AU7 A;  5EG0 A;  4CCK A;  4N9H A;  1WRJ A;  3SYT A;  2ZC2 A;  3B81 A;  4QLC U;  2XDN A;  1GLN A;  3VPR A;  4A69 C;  1FMW A;  2EIM H;  4DYC A;  1AHD P;  3KYC B;  1LKX A;  2PJR B;  1MBF A;  4D9J A;  2VJ4 A;  4KWA A;  2E35 A;  3DKX A;  4E7S A;  2XPW A;  1D0Y A;  4Q48 A;  4KT6 A;  2EIK H;  4TV7 A;  4D5F A;  1Y0N A;  1LNW A;  3SZT A;  2R5Y B;  1IXC A;  1RI7 A;  2PBI A;  4A6E A;  5B5E C;  2O6G E;  2Z16 A;  2XGC A;  4L5E A;  1G3S A;  2KHM A;  2YSR A;  3ANG A;  5J3L A;  2DMT A;  1A6Q A;  4NNJ A;  1GXP A;  1W36 D;  2IBD A;  3BQZ A;  4F91 B;  2O7T A;  3AL0 C;  4YIR X;  1OCP A;  3S15 J;  3DBL B;  4HEA 2;  1KA8 A;  3VIB A;  2A6T A;  3VYT B;  3ZR8 X;  4D0P A;  3D1N I;  3GZ5 A;  2KP6 A;  1I3Q J;  4EJW A;  1YO5 C;  4MO7 A;  5K7H A;  3DXJ F;  2ECC A;  4B47 A;  3ESW B;  1WI3 A;  4RMN A;  3WU2 C;  4RM2 A;  5A2Q Z;  2BHY A;  2G7L A;  3BJ6 A;  3BR3 A;  3CUQ A;  4FX0 A;  1OCC H;  2LKS A;  2L9V A;  5FD6 A;  3FXM A;  4XLE A;  2L7K A;  3IAS 2;  2EH3 A;  1X4P A;  3SWH A;  4DVY P;  3H9G A;  4P9U A;  2MD5 A;  2QSF X;  3CQZ J;  4JKZ A;  5HDG A;  3Q0W A;  4NB5 A;  3HUG B;  5IT9 Z;  5D6F A;  2B63 J;  2ZNZ A;  3SEZ A;  4IXA A;  1J5Y A;  1G3Y A;  3W2V A;  1BI3 A;  4LK0 F;  5D18 A;  5CKT A;  2E1M B;  5L3D A;  3GEU A;  5EZG A;  1TBX A;  3HOX J;  3R4K A;  2D1H A;  4WCG A;  2W53 A;  2A07 F;  1J2X A;  4HG2 A;  3BRU A;  1WHU A;  5IP6 A;  3U1K A;  4RGR A;  3VOX A;  2BE5 F;  5M5Y J;  3T1B A;  2ESH A;  2W57 A;  3OYA A;  1O7L A;  1JT0 A;  3CCQ I;  3JSP A;  2DOD A;  1U8R A;  4U0Y A;  3EYY A;  2A61 A;  3GBG A;  3HTA A;  3HJE A;  4GDF A;  3K10 A;  3RYP A;  1S7O A;  3F72 A;  2X1E A;  4XON A;  3ZQG A;  4Q5S F;  1XB4 A;  3AKZ A;  1YJ9 I;  3DFG A;  1A36 A;  1TC3 C;  1BJA A;  4IRG A;  4XSZ F;  2ZJP F;  1U3E M;  2IT0 A;  4ASN A;  3A01 A;  3QRF F;  4RGS A;  1XTA A;  4E7Z A;  2L0K A;  5KHD A;  4DJA A;  2H6C A;  2HYT A;  2BXZ A;  1UHS A;  2ZME C;  1E3O C;  5E17 F;  1WI9 A;  1MMA A;  5J40 A;  1XPX A;  1HW2 A;  3VEP A;  3G1L A;  1R71 A;  1NG6 A;  2HEO A;  3JSJ A;  3BCB A;  3JRG A;  2ZJQ F;  2MLG A;  2ZSH B;  2YVE A;  1ZAO A;  4U87 A;  2WA0 A;  1UFM A;  2DA7 A;  2ZNY A;  4YEL A;  1FY7 A;  3JTG A;  3P9I A;  1D8K A;  2K9S A;  4ZDP A;  2P5L C;  3I54 A;  5L3C A;  1VQ5 I;  4I01 A;  4AUX A;  4UY8 I;  1Z05 A;  1I39 A;  2LTP A;  2DO7 A;  5ICF A;  2YS9 A;  3QPH A;  2D45 A;  1D5Y A;  2JA7 J;  1ON2 A;  4UV8 A;  4DZP A;  2QF7 A;  4OOI A;  4PSW A;  5CW8 A;  2EFQ A;  3TP0 A;  1N75 A;  4ZZD A;  2FD5 A;  3LFU A;  1R4N B;  4RAY A;  2UXU A;  3KP4 A;  3M3Y J;  1LEB A;  2PEX A;  3WTX C;  4X0G A;  3DU5 A;  1J9I A;  3OYL A;  2UXN A;  1ZAR A;  2XGX A;  4KDP A;  3BWG A;  4DBQ A;  2R92 J;  2EWN A;  5CVJ A;  2L2O A;  3FKI J;  2AXT C;  2JSP A;  2NP3 A;  2HPI A;  1YW8 A;  3WTY C;  2Q2E B;  3GTJ J;  4MK6 A;  2AQF A;  3ML6 A;  3K1P A;  5GP9 A;  2DTZ A;  2ETH A;  4XLC A;  3NAR A;  3BCA A;  3C07 A;  1RZ4 A;  2A5W A;  2FQ4 A;  2JPB A;  1IG7 A;  4NEL A;  3BPV A;  1ZG1 A;  3PNV A;  3MAJ A;  4PJM A;  2Q8K A;  4IHT A;  1CGP A;  2EQR A;  2XPU A;  4A3M J;  4B4C A;  1H8A C;  1N25 A;  3A1Y A;  3ZQI A;  3FXU A;  3TW6 A;  4NHJ A;  1U5T C;  2CRG A;  3HRU A;  4MEY F;  1FP2 A;  2JT1 A;  3JAM K;  2NXN B;  2ME6 A;  3X2Q H;  4YRV A;  2BEO A;  4C30 A;  1XD7 A;  4Z2Y A;  1KON A;  2P7V B;  3O8G A;  1P4X A;  2FBK A;  1RIO H;  2XKP A;  2FA5 A;  3CC7 I;  5E8G A;  2K5C A;  2JQ7 A;  2LF7 A;  3MFK A;  3QPT A;  1DGR M;  2IRF G;  4LMY A;  2X48 A;  5JVT A;  1F9N A;  4F3Q A;  4OIN F;  4HKU A;  1I50 J;  3BTL A;  1FOK A;  1ZG3 A;  4KN7 X;  1VQO I;  1QPM A;  3F8B A;  1K79 A;  5EGO A;  3NAU A;  3OYJ A;  3ZP5 A;  4ABZ A;  2F48 A;  2DMN A;  4AC6 A;  2RNG A;  3E7Q A;  1V55 H;  2LMD A;  2HYF A;  4CZZ A;  2XAS A;  5D1R A;  4M72 A;  2PX9 A;  1V4R A;  2CU7 A;  3FMR A;  1DP3 A;  4EVI A;  4GRI A;  2DW4 A;  2HQ5 A;  1MBE A;  1W7P A;  2WV1 A;  1MDM B;  2XAU A;  2VAS A;  2K85 A;  3BZ6 A;  2X9D A;  2JZY A;  4RB0 A;  3WTT C;  4P96 A;  1QU3 A;  5HNH A;  1SD4 A;  1VQP I;  1KQ9 A;  1Z77 A;  2CG4 A;  3HM5 A;  4G9Y A;  3F1B A;  1BR4 A;  2WY8 Q;  3OY9 A;  1BC7 C;  2EFP A;  2E36 A;  2DFH A;  4MGR A;  3HGY A;  1OYY A;  3F8M A;  3LSG A;  5B1A H;  2HYG D;  2K9N A;  2ID3 A;  3K69 A;  4G8X A;  2IS1 A;  2GIV A;  3CRJ A;  2W00 A;  3FM5 A;  3MD2 A;  1IN5 A;  2PFV A;  5C3E J;  3NRG A;  3LFK A;  2LSO A;  2R5Z A;  2RRE A;  4M3E A;  3K2A A;  2JRM A;  4FQG A;  4XL9 A;  2A69 F;  3F8N A;  3T8T A;  1LPQ A;  1MJ9 A;  2DCE A;  1UZC A;  3PSI A;  4EV0 A;  2W48 A;  1T95 A;  3BLY A;  2Y0S N;  3T8R A;  3V78 A;  3IP4 B;  3LMM A;  2BY0 A;  3BG5 A;  3DEE A;  4KNY A;  2IJL A;  1V5E A;  3HL2 A;  2R0Q C;  1XDU A;  2OZ6 A;  1G3T A;  3WTS C;  4HNV A;  2W85 A;  1AKH A;  2COB A;  4IRI A;  1YE9 A;  3ELK A;  4MFE A;  1S3J A;  2GLO A;  2MSY A;  1FPQ A;  3BZK A;  3FIS A;  4AC0 A;  3FDY A;  4BNC A;  1K6Y A;  3P9T A;  4NQW A;  1KU2 A;  3ZGK A;  4BGD A;  2PMH A;  1YFH A;  5F04 A;  1B59 A;  3K9T A;  2M87 A;  4XK4 A;  4L9T A;  3VOK A;  1ZTR A;  1XC5 A;  3DTI A;  2CQK A;  5J4Y A;  1ULY A;  5D5V B;  3HSE A;  1JHF A;  1IV8 A;  2P6T A;  2IPQ X;  3LQR A;  3OV8 A;  3GW2 A;  2H09 A;  3QPL A;  5FLV A;  4E7J A;  3MKW B;  1NG7 A;  2KT0 A;  3RH2 A;  4PJJ A;  3KLN A;  3EUP A;  2HXO A;  2V4J C;  4LG0 B;  2XRN A;  3ON4 A;  3JTH A;  4XLA A;  2HVQ A;  5E8I A;  3K6G A;  1WKM A;  3M8E A;  4V19 K;  2C6Y A;  2E1C A;  1QA6 A;  1MD0 A;  4KIG A;  4XMY A;  2RVC A;  4IHY A;  3ZN0 A;  5DV5 A;  2PJR A;  2G0E A;  1X1D A;  2IGK A;  2LG4 A;  1K4T A;  4IHV A;  3HGG A;  3SFI A;  3CCU I;  3IRQ A;  1FLI A;  3WU0 A;  3HXL A;  1MND A;  1XGO A;  3LSR A;  3ERE D;  2GOM A;  2DFE A;  4IRV A;  1S7A A;  2A05 A;  2H94 A;  3TL4 X;  1RRJ A;  2BHZ A;  3BJB A;  4UUT A;  2IA1 A;  1HC8 A;  5LRR A;  2Z5U A;  1MMG A;  5EEG A;  2XF7 A;  1YQA A;  3BG6 A;  1DQU A;  4P1W A;  3F9K A;  2VON A;  3M1E A;  5BQT A;  1ZEL A;  4A3E J;  3ERM A;  1YG2 A;  2LYC A;  2OU2 A;  2VT2 A;  2LY9 A;  1PYV A;  1CF7 A;  2B7E A;  3K4L A;  2MAB A;  2DJI A;  1JKP C;  4CIC A;  4OMZ A;  1Z3X A;  2A6E F;  2FBI A;  5KAI C;  3N97 A;  2CQX A;  4GYI A;  3V42 A;  4AYB N;  4LB5 A;  4P55 A;  2GEN A;  4GFK A;  1E3P A;  2G9W A;  5J6X A;  1MBH A;  4XBF A;  1MMN A;  3FF5 A;  1ZQ3 P;  2H8R A;  2R7V A;  2JUG A;  3QOP A;  1Z0X A;  3BJA A;  4A12 A;  5J1U A;  3S3O A;  3QBM A;  1O4X A;  3H3U A;  4IQJ A;  3L2Q A;  2AO9 A;  1J59 A;  1ZGJ A;  3GFJ A;  1Z1D A;  1UST A;  3FRQ A;  2PI0 A;  5LD2 C;  2FU4 A;  1G4D A;  2YX4 A;  1HW5 A;  2V9K A;  2PMU A;  3CUQ C;  1QZZ A;  1W4M A;  1R00 A;  3KLO A;  3LNQ A;  1YI2 I;  2Y30 A;  3M8F A;  5GTH C;  1YOV B;  3PNY A;  3K0L A;  3BRO A;  5IOZ A;  1LEA A;  1YS7 A;  4RB3 C;  3U1D A;  1ZLJ A;  2K9M A;  3K4M A;  2M7A A;  4RAZ A;  1Z7L A;  4HSR A;  2DDB A;  4I76 A;  4ZYH A;  4IZZ A;  2CJJ A;  4LIU A;  4PXI A;  3F23 A;  2CUF A;  5DCM B;  1EA3 A;  3TO6 A;  1GUU A;  4KIC A;  1ZH5 A;  1WJC A;  5D5X B;  4ZJZ A;  3BJO A;  4U7B A;  1PP7 U;  2E2J J;  2UWM A;  3GWZ A;  4U88 A;  2LP0 A;  1XMK A;  3WGG A;  4G12 A;  4U0V A;  1I6H J;  3FMS A;  1DUX C;  2GA2 A;  3VDX A;  4XSX F;  1MMS A;  3NWT A;  2CMP A;  1U9O A;  2KDO A;  3DU6 A;  2QSG X;  4ENN A;  4NUB A;  3ONQ A;  4YEJ A;  3ZQL A;  3I4M J;  1TP4 A;  2WTE A;  3DPJ A;  1EV7 A;  3HTJ A;  3NPI A;  2OF7 A;  3RKX A;  2OJE D;  2A3S A;  1X2M A;  2AXL A;  2OTL I;  3AG2 H;  5HBU A;  5EEH A;  4P5O A;  3CCY A;  2BY3 A;  2KLO A;  4LFU A;  4CXF A;  1NH3 A;  3VW1 A;  3CF5 F;  1S29 A;  3R0J A;  2HOA A;  4U7D A;  1RES A;  3DV8 A;  3D5R C;  2PMZ A;  4KIF A;  2O61 A;  3ZRG A;  3CCV I;  5D8K B;  4KA4 A;  1V54 H;  3CMA I;  3B6C A;  3EET A;  4AVZ A;  1JI8 A;  1JGS A;  3ABL H;  4IOA F;  2DA4 A;  5B3S H;  1A5J A;  4GCK A;  4HPQ A;  2KIQ A;  3BZC A;  2X6O A;  2ZOZ A;  2RV8 A;  3N4M A;  1TWC J;  2VQC A;  2L7M P;  1OR7 C;  4WX9 A;  1ETK A;  2Y0S A;  2F5C A;  3CWR A;  4KMU X;  3LA7 A;  3S14 J;  1HCR A;  2HGC A;  5CVU A;  2VXZ A;  2YX7 A;  4JBA A;  1O7F A;  1K61 A;  1R6R A;  3RSN A;  2F4O B;  3I3L A;  2H27 A;  1HBX G;  3IWF A;  1JUP A;  3CMM A;  3ZMT A;  2KDZ A;  3G2B A;  1T6S A;  2Q2E A;  1FYK A;  4YG2 F;  4DZJ A;  2VXD A;  1FX7 A;  1G8X A;  3DEW A;  4I6Z A;  2M8E A;  1TQM A;  4LOC A;  3G71 I;  1JKQ C;  3NS4 A;  4FET A;  1X4O A;  2QQ8 A;  2FQ3 A;  5J47 A;  2VOO A;  5KNL A;  2XF5 A;  1XX5 A;  3V7C A;  3ZQH A;  5HOO A;  3KEQ A;  4LK1 F;  2M3A A;  2HI3 A;  3AQT A;  1E0E A;  1MZB A;  4WXD A;  2MLK A;  3L00 A;  3HIF A;  4IPA A;  3V8J A;  2MFZ A;  3PFI A;  2NNN A;  3TKY A;  1Q1V A;  4Q4Z F;  4M71 A;  1K83 J;  2LKX A;  4AD9 A;  2GM4 A;  3COA C;  5K5O A;  2EIN H;  2ZY9 A;  3GCM A;  1BIB A;  3BR6 A;  3DWL E;  1LFU P;  3TDZ C;  4L5J A;  1FSE A;  5DM6 F;  3CTA A;  4LIV A;  3KKC A;  3ZCO A;  1HLV A;  2OA4 A;  2V9P A;  2DU9 A;  1D8J A;  2NVX J;  2DPD A;  3JRB A;  1YRN A;  1VQ8 I;  2BZT A;  3FZV A;  2IA2 A;  1TNS A;  4A0Y A;  3S2H J;  4RBO A;  1VFC A;  3ABU A;  2D5V A;  2O3F A;  2K40 A;  4MFD A;  1GXQ A;  4J19 A;  1YS6 A;  3L2C A;  5D19 A;  3MZH A;  4I09 A;  2DA1 A;  1LJ9 A;  3QWL A;  2YUS A;  4F92 B;  2Z33 A;  1K78 A;  3BPX A;  2LNB A;  4BHP A;  2DA3 A;  1ZG5 A;  4UHT A;  1NTC A;  3GTP J;  2OBP A;  2W84 A;  1WPK A;  3DLL F;  2QQB A;  3KCC A;  1ZRD A;  1YX3 A;  3FXQ A;  1R5G A;  1WFX A;  3F6O A;  2E1N A;  4XKV A;  1MH4 A;  4C3I J;  1OPC A;  4A3D J;  3PFY A;  3NWS A;  4LD5 A;  5E1X A;  4A3B J;  3ZQQ A;  4BAC A;  3A0H C;  1WJF A;  3GZN B;  3WG7 H;  4BS9 A;  1LB2 A;  3OS0 A;  2QM3 A;  1IN6 A;  5BOX A;  5CVR A;  5J1Y A;  1P4W A;  1XCV A;  2BVL A;  5ILU A;  3AL0 B;  4AYB A;  2ESN A;  4HF0 A;  1H9T A;  1W7P D;  1QHG A;  5GAE J;  2R7S A;  1IUY A;  1ETQ A;  1D5V A;  3A0B C;  3TMO A;  4BL0 B;  1NK3 P;  2DG8 A;  3R6S A;  3JAM Z;  3LSI A;  3M4O J;  4Y33 A;  1XS9 A;  1SVM A;  2VC0 A;  2V1D A;  4M3B A;  1TLH B;  3AG3 H;  2YVX A;  5F1J A;  4P9F A;  3W6K B;  5FKM A;  3GYH X;  2A2F X;  3ECH A;  3E6D A;  2JPC A;  5HS7 A;  2Z9O A;  3WGH A;  3JRI A;  3MN2 A;  1W0U A;  2XF6 A;  3O6B B;  3J7Z I;  2E5Z A;  2HU9 A;  2IA0 A;  4C2M J;  1ZYR F;  2RKH A;  3MQ0 A;  2ZJ2 A;  2XC7 A;  1VQN I;  1I5Z A;  3HOT A;  1BC8 C;  3MKL A;  2ELH A;  4WK8 F;  3RKW A;  3JRF A;  4CYC B;  3MMY B;  2PJP A;  4KN4 X;  3J7A Y;  5JI6 A;  4EJV A;  4K2E A;  4DQ2 A;  2PLY A;  1DP7 P;  3C2G A;  5E3L A;  4BEH A;  2REK A;  1S7E A;  1U6G A;  4DNC A;  3DPU A;  3OYD A;  5IPA A;  1W36 C;  2L4M A;  1SFO J;  1EH8 A;  1GV2 A;  3C3W A;  4XLN F;  4YZE A;  2RDP A;  3HSR A;  5KVR A;  1ZR2 A;  1H88 C;  2W82 A;  1UG2 A;  5EYR A;  3JRA A;  4IL6 C;  5CVI A;  3L9F A;  4AM3 A;  4E7K A;  3HHG A;  3GVA A;  1IRF A;  2FX0 A;  1FMV A;  1WJB A;  2EZH A;  4HX8 A;  3BP8 A;  4PJ0 C;  4QSH A;  2MH2 A;  3K70 D;  3K8P C;  4G94 A;  1PUF B;  4EM2 A;  3VYU B;  1RKT A;  4L0Y B;  1LDD A;  2RC4 A;  3RZD J;  4RA2 A;  5J1R A;  4PK4 A;  2F6C A;  2QVO A;  2XAJ A;  5C44 J;  4KIT B;  1AU7 A;  2B9S A;  1ON1 A;  1K7A A;  4WXC A;  2ZME B;  4E6K G;  2WAQ N;  4FHT A;  3DF8 A;  3F8F A;  4JX6 A;  3HOV J;  2L9S A;  1BBY A;  3GZ6 A;  1KQ8 A;  3KZY A;  2TDX A;  3CZ6 A;  3R60 A;  2L4A A;  4KUM A;  1V5G A;  4DW6 A;  3NI7 A;  3BDD A;  2Q1Z B;  3W2W A;  3J81 K;  4QPQ A;  3HOS A;  4G7O F;  1SFE A;  2BW3 B;  2VQH A;  1IRZ A;  2F5F A;  1KU3 A;  3T0Y A;  1KYZ A;  3T5X A;  2VLA A;  2UUZ A;  1D1C A;  4HDU A;  2NP5 A;  3ABK H;  3F0C A;  1X3W B;  2XSJ C;  5DDG A;  4HBL A;  1Y1V J;  2DLL A;  3KX2 A;  3ZMV A;  1AA7 A;  3R61 A;  1YW7 A;  5H2F C;  4N4N B;  2KRC A;  3HE0 A;  3GLX A;  2VJ5 A;  3OSF A;  2QKL B;  1YIO A;  5HNF A;  3C18 A;  2V6E A;  1Y8Q B;  3EUK L;  2M30 A;  5HOD A;  2K9L A;  1MJA A;  4Y4R A;  3S1M J;  5K5R A;  2L02 A;  5FKO A;  3S5R A;  3BTC A;  4CHU A;  4ACI A;  1JT6 A;  3AG4 H;  3CO7 C;  1IGN A;  3DBR B;  3I56 I;  2HQN A;  3BCG A;  1IRG A;  3O60 A;  3I4P A;  1ZGW A;  1SD5 A;  4HDV A;  2L9R A;  1T2K A;  2G7H A;  4BHC A;  5BMZ A;  3M7G A;  1G6N A;  3HDD A;  1XDS A;  2PFB A;  2ZSI B;  4JQF A;  4MQV A;  1JKR C;  5HS8 A;  3K4N A;  4L9J A;  5M3F J;  2BVM A;  3NQO A;  2NAZ A;  3RCO A;  4HNU A;  4UVA A;  2QOP A;  3E6M A;  2H1L A;  2ZB9 A;  2KPM A;  3EQL F;  1UHM A;  3H5R A;  4RGU A;  3G1O A;  3LWF A;  1P7I A;  2KQR A;  2Z99 A;  4A3K J;  1BN5 A;  4MTD A;  4I0B A;  1B8I B;  3LQQ A;  1U5T B;  4RDU A;  2DMP A;  2MD0 A;  1FOX A;  2A6H F;  3U9G A;  2M8G X;  2I10 A;  1G59 A;  1TWF J;  2VBZ A;  3HOU J;  2V26 A;  2Q0O A;  5AQC A;  3IUO A;  2FNP A;  1G2H A;  4XLH A;  4FE4 A;  3ASO H;  5J8F A;  3E3V A;  2K7L A;  5DM7 F;  5DEQ A;  2JA6 J;  3LAJ A;  1VQ9 I;  2UXH A;  1UJ8 A;  3PQJ A;  3G56 A;  1Z6R A;  2P6S A;  3KYD B;  2KRF A;  2IXS A;  3FXK A;  4M6V A;  4H0E A;  3F22 A;  2F07 A;  1SAX A;  3OL4 A;  4IO9 F;  2X1C A;  2HKU A;  2DA5 A;  3K4C A;  2ISZ A;  1RC9 A;  1X3U A;  2MC4 A;  3TDU C;  2Y0M A;  2WAE A;  3LSK A;  3TBI A;  2L7Z A;  2VBW A;  2UV1 A;  4MIM A;  4RB1 A;  4A0X A;  5ICE A;  3JRD A;  3PL8 A;  2X4H A;  3L09 A;  3HOZ J;  2XSD C;  2D6Y A;  2DBB A;  2EB7 A;  5HVQ C;  4G6D A;  3CMY A;  5K58 A;  1KYW A;  1U9N A;  2R3S A;  3K7A J;  2MC3 A;  3M8J A;  1GVD A;  4UUS B;  3HIM A;  2LLK A;  2CUZ A;  4ZYA A;  2DG7 A;  4IKF A;  1VQ7 I;  5CJ9 A;  4B09 A;  1L3L A;  4HLY A;  2LH9 A;  2CQQ A;  1STZ A;  5B1B H;  5D8L B;  4IX7 A;  5C4X J;  1GDT A;  2XAQ A;  3HBL A;  2G7G A;  2A5Y B;  4G6T B;  2NRA C;  4UB6 C;  5HDN A;  3VUQ A;  1Z9C A;  2DOA A;  3TOB A;  2NVQ J;  3W2A A;  3RI4 A;  2O9L A;  2Y2Z A;  5IYC J;  3JCU C;  2X51 A;  4XRS A;  2R93 J;  4ZTJ A;  2CWE A;  3S8P A;  2I5U A;  3HSF A;  2FML A;  2GAU A;  3KKD A;  3I71 A;  2DT7 B;  1Y8R B;  4HNT A;  4PFO A;  5GAH J;  4HRI A;  3V7S A;  2XGD A;  3HTI A;  3S3M A;  2QSH X;  2Z3Y A;  1FBU A;  3FX3 A;  3KEO A;  1OCT C;  2P4W A;  4I02 A;  1A04 A;  3C7J A;  4M6Y A;  3FHZ A;  1JJ6 C;  3I64 A;  1MBK A;  2FOW A;  5DD8 A;  3D0S A;  1FOY A;  4I98 B;  4W97 A;  4XLP F;  1IAW A;  2DK5 A;  3OYK A;  1KU7 A;  5FD5 A;  3CLQ A;  1MGT A;  4M3F A;  3W6V A;  3DKY A;  2DYR H;  2Y9Y A;  3GFL A;  2EV5 A;  5HSZ A;  2NVU B;  2KZG A;  1TTY A;  3LHQ A;  3GEZ A;  4PJN A;  3G4S I;  3CCR I;  2W24 A;  2BV6 A;  4A3C J;  3I55 I;  3F3X A;  5E18 F;  1JHH A;  3ZPL A;  3LL7 A;  4XRF A;  1VND A;  2IEK A;  2D2W A;  3OR2 C;  3H9Q A;  3BTI A;  1QPI A;  2QZ8 A;  3L1P A;  3CCJ I;  1O3R A;  4E7H A;  3E0J B;  4Y3O A;  2M34 A;  3K2Z A;  1PDN C;  2JSC A;  4EGZ A;  3F6V A;  1BIA A;  1R9T J;  2MBF A;  2XUB A;  3SZG A;  3MWM A;  3K1N A;  4HX7 A;  2VPR A;  1HF0 A;  1UAA A;  1F36 A;  2M4K A;  1S5L C;  2NX4 A;  2E7X A;  1BW5 A;  1WGX A;  1LUJ B;  3FWE A;  2EV0 A;  4L62 A;  3V8L A;  4CO8 A;  4KMF A;  2GXG A;  2DPU A;  2M1B A;  4ANJ A;  2HYJ A;  4UDS A;  5ILS A;  4QWQ A;  2LBF B;  1ITY A;  2IVM A;  2BBY A;  2ISY A;  1D1B A;  2WAQ A;  3MVP A;  4HOB A;  4UVC A;  3C2B A;  1U8B A;  1XCB A;  4JP0 A;  3ISP A;  5DAJ A;  2LY2 A;  2V79 A;  4DYQ A;  1T39 A;  1YX5 A;  4HST A;  2XHK A;  3FK6 A;  5E20 A;  3TGN A;  1PJR A;  5KK1 A;  2PQ8 A;  1GVJ A;  3OSG A;  3AQS A;  2QBY B;  5IP7 J;  5GAG J;  3JR9 A;  3MZY A;  3Q5F A;  5F0H A;  2JA2 A;  4W1U A;  1IC8 A;  3AFH A;  4JNN A;  5F27 A;  2M4G A;  3UR3 C;  3KET A;  3A2K A;  5J4V A;  5FMP A;  2M0M A;  2FMY A;  1Y0U A;  3QPS A;  5CLS A;  2QUF A;  1GT0 C;  1FYM A;  1P92 A;  1DU0 A;  3BNI A;  3T6N A;  3E97 A;  1ZN2 A;  3LSJ A;  3WU1 B;  3ABM H;  2EIJ H;  5FRM A;  4XIC A;  3CES A;  1WCM J;  3NNR A;  3HRM A;  3BR1 A;  2MW8 A;  1X1B A;  1B9M A;  3BC8 A;  4OAY A;  4RGX A;  2DJN A;  4G7H F;  2RAS A;  2NNY A;  1T0F A;  1IRX A;  2HPM A;  4UNO A;  4CYD A;  1SMT A;  3FMQ A;  2LK2 A;  4RS8 A;  3E7L A;  4M3D A;  5F6F A;  3WG9 A;  1MIJ A;  3SEQ A;  1XSD A;  3PPB A;  3HTS B;  2GWR A;  4WXH A;  3KP5 A;  5FHP A;  1YIT I;  1RNL A;  4A3F J;  1G3W A;  4Y7N J;  2KMU A;  4I7H A;  2CYY A;  4EMS A;  5HDK A;  5KCM A;  4HW0 A;  1WH7 A;  1LDJ A;  4IHS A;  1D1A A;  1SFX A;  5FFZ A;  1BW6 A;  2DI3 A;  4Y15 A;  3NEU A;  2F4I A;  5E3O A;  5FJ8 J;  4B8X A;  2B0L A;  1QGP A;  2VE8 A;  1OJL A;  3S1R J;  4XLF A;  3DBH B;  4HZF A;  4OU0 A;  3G1M A;  4D7N A;  5JHF A;  3CUQ B;  2R5Y A;  5TRD A;  1C0W A;  1IW7 F;  2STW A;  1B4A A;  4CUG A;  4ZH4 F;  4O6J A;  1BJZ A;  5CPR B;  4DIQ A;  2ZCX A;  2DN0 A;  1K6O A;  5DYM A;  2UXP A;  1MBG A;  2VJI A;  4A93 J;  4ZYE A;  3FHN A;  2OQG A;  2LD5 A;  3S32 A;  1OMI A;  5CYV A;  2LY1 A;  5HS9 A;  4YFK F;  3J7Y J;  3HZJ A;  4A0Z A;  1OCZ H;  2K3F A;  4OWR B;  3OS2 A;  5EF6 A;  2ZXJ A;  5D5W B;  4B3X A;  5E3N A;  3FBI B;  4X6A J;  4XKC A;  1HQC A;  4AVP A;  5TJJ A;  2BXY A;  2HQR A;  1UMQ A;  2VUM J;  4V2G A;  3H5N A;  4BKX A;  2QA4 I;  4BXX J;  3ANP A;  2LOO A;  2OD5 A;  3RD3 A;  3HUG A;  4I2O A;  2HDW A;  3IH4 A;  4WWC A;  2ZXW H;  2DOE A;  2ZME A;  3FIW A;  4A3L J;  2CW7 A;  1WJD A;  4V2F A;  3RTR A;  4XOT A;  2BY1 A;  9ANT A;  2LRD A;  2CFO A;  3H36 A;  1UCR A;  3OYI A;  3HYI A;  4A6D A;  3JRC A;  3J80 K;  1S72 I;  3S17 J;  3H0D A;  1LFB A;  2R7Z J;  1IUF A;  1MH3 A;  2XGE A;  4ZYD A;  4KFC A;  2Z2S B;  1IO2 A;  3A01 B;  2VPL A;  5C4Y A;  4M9Z A;  1CQT A;  4GCT A;  2VE9 A;  1DGW Y;  1S8N A;  1JUS A;  1R22 A;  2XAG A;  3MEX A;  3OYG A;  1HKS A;  4AF5 A;  1X3Z B;  1YJW I;  4CGR A;  5FLX K;  2R7T A;  3FXR A;  2CV0 A;  2VOP A;  4ESB A;  3FXL A;  3I4N J;  2V9V A;  2CUJ A;  3CME I;  4ON0 A;  2CH0 A;  3HPG A;  4M73 A; 
#chains in the Genus database with same CATH homology
 2HXI A;  3Q0U A;  2ZOY A;  4QTR A;  2E2I J;  3A02 A;  5EG0 B;  5CXG A;  3G1L A;  3GTG J;  3JSJ A;  3JRG A;  3GTL J;  2YVE A;  1ETQ A;  1NK3 P;  2DG8 A;  1FJL A;  2TCT A;  3M4O J;  1XS9 A;  2DA7 A;  1APL C;  4M3B A;  2K9S A;  5F1J A;  4C3H J;  4EEF G;  5FKM A;  3RQI A;  4AUX A;  2E2H J;  1IDZ A;  3JRI A;  2WUI A;  2TRT A;  3MN2 A;  1TWA J;  2LTP A;  1W0U A;  2AHQ A;  2YS9 A;  2RHA A;  1D5Y A;  2JA7 J;  1B8I A;  4C3J J;  4DZP A;  2QF7 A;  4C2M J;  1HDD C;  1HOM A;  2LR8 A;  5CW8 A;  3TP0 A;  2FD5 A;  3PO3 J;  2UXU A;  2XRL A;  3ZOB A;  3M3Y J;  3S1N J;  5FKN A;  5M5X J;  5IP9 J;  2R92 J;  3MKL A;  1SGM A;  3JRF A;  4CYC B;  2YVH A;  3FKI J;  4MXM A;  1MBJ A;  2CUE A;  2NP3 A;  1NK2 P;  5E3L A;  3GTJ J;  4MK6 A;  2REK A;  1S7E A;  5GP9 A;  5IPA A;  2DTZ A;  3HTH A;  1SFO J;  1GV2 A;  5JLW A;  4YZE A;  3NAR A;  1FEX A;  1ZR2 A;  2HOT A;  3C07 A;  2FQ4 A;  3ON2 A;  4CYC A;  1IG7 A;  3SJM A;  4NEL A;  1H88 C;  1W0T A;  1UG2 A;  2QCO A;  5EYR A;  3TW7 A;  3JRA A;  2EQR A;  2XPU A;  4A3M J;  2YU9 J;  4B4C A;  1H8A C;  2JA5 J;  3BR2 A;  1UI5 A;  3ZQI A;  5FLM J;  3TW6 A;  2FX0 A;  3WHC A;  2CRG A;  1H89 C;  2EZH A;  1B72 B;  4QSH A;  4NDL A;  2MGQ A;  2ME6 A;  5GPA A;  2LFB A;  2OPT A;  3O8G A;  2E1O A;  5E3M A;  1PUF B;  1RKT A;  2LVS A;  2XB0 X;  3ZQC A;  3RZD J;  3PAS A;  5EGO B;  4XID A;  3BR5 A;  5J1R A;  4GCL A;  5C44 J;  1AU7 A;  2ZCM A;  2X48 A;  4ME9 A;  3S1Q J;  2WAQ N;  4HKU A;  4JX6 A;  3LWJ A;  1I50 J;  3BTL A;  3HOV J;  1PUF A;  5IOY A;  3HOY J;  5EGO A;  2RAE A;  3NAU A;  3FK7 A;  1U78 A;  4ABZ A;  2VKE A;  4BY1 J;  1VI0 A;  2DMN A;  4AC6 A;  4DW6 A;  3E7Q A;  3NI7 A;  2V57 A;  1IRZ A;  5D1R A;  4A3I J;  2NP5 A;  1RKW A;  2NVY J;  2Q24 A;  1WH5 A;  3F0C A;  2GBY A;  2CU7 A;  3JRE A;  1Y1V J;  4GFL A;  2HQ5 A;  1MBE A;  2WV1 A;  3HE0 A;  2X9D A;  1QRY A;  2P81 A;  4FE7 A;  1JKO C;  3OSF A;  3LJL A;  1ZK8 A;  3F1B A;  3HM5 A;  1Z77 A;  4BBS J;  4FCY A;  2ID6 A;  5HOD A;  4XRM A;  2Y31 A;  3S1M J;  2UXO A;  5FKO A;  3S5R A;  3BTC A;  4ACI A;  1JT6 A;  1OFC X;  3HB9 A;  3HGY A;  1IGN A;  3BCG A;  3SDG A;  2OER A;  3LSG A;  2K9N A;  2ID3 A;  4MLO A;  3O60 A;  3UKG A;  1ZGW A;  1A6I A;  3CRJ A;  2L9R A;  3OOU A;  2ELK A;  2JMW A;  5C3E J;  3NRG A;  3HDD A;  5DTD A;  3VVZ A;  2R5Z A;  1JKR C;  2QWT A;  2JK3 A;  1Y1W J;  3VVY A;  4M3E A;  3K2A A;  5M3F J;  4JX5 A;  2QIB A;  2QOP A;  2M9H A;  2ZB9 A;  1FIA A;  2W48 A;  1TWG J;  4IHX A;  3G1O A;  1UI6 A;  2Y0S N;  4GFB A;  1ORK A;  1P7I A;  3V78 A;  2NOG A;  3BR0 A;  3BT9 A;  4A3K J;  1B8I B;  3BG5 A;  2OI8 A;  4RDU A;  2DMP A;  2R0Q C;  2M8G X;  2I10 A;  4HNV A;  1TWF J;  3HOU J;  1AKH A;  2COB A;  3RZO J;  5AQC A;  2XB5 A;  4ICH A;  1G2H A;  1GV5 A;  4FE4 A;  3WHB A;  4MFE A;  3LSP A;  1DU6 A;  1FTT A;  2GLO A;  2JA6 J;  2MSY A;  2QKO A;  1JTX A;  2UXH A;  3FIS A;  2EZK A;  4AC0 A;  3G56 A;  3P9T A;  2K9Q A;  3H0G J;  4M6V A;  5F04 A;  5H9T A;  5EEA A;  2F07 A;  2WB1 N;  4XK4 A;  2L7F P;  3VOK A;  1ZTR A;  1XC5 A;  1MNM C;  2O7O A;  2HKU A;  3QQA A;  4BY7 J;  1JJ8 C;  3VW2 A;  2DA5 A;  1EF4 A;  1LE8 A;  2IU5 A;  1RPW A;  3V6G A;  1QVU A;  2L7Z A;  1IJW C;  2PZ9 A;  5IYD J;  4MIM A;  1F43 A;  3QPL A;  5FLV A;  3Q0V A;  3JRD A;  2HDD A;  3IH2 A;  1JTY A;  2IAI A;  3PO2 J;  3HOZ J;  2XSD C;  2NS7 A;  3BG9 A;  2KT0 A;  3RH2 A;  2D6Y A;  5K58 A;  3EUP A;  3CMY A;  2HXO A;  1X2N A;  3K7A J;  1U9N A;  2FJ1 A;  3ZQF A;  3ON4 A;  3LOC A;  4UUS B;  1GVD A;  1ETY A;  2GUH A;  3HIM A;  2LLK A;  2DG7 A;  4A3G J;  3OIO A;  3RKQ A;  4FIS A;  2MG4 A;  2CQQ A;  5C4X J;  3HKZ N;  1GDT A;  3HBL A;  2ECB A;  2G7G A;  3CDL A;  4IHY A;  1ETW A;  2G0E A;  4IHV A;  3VUQ A;  1P7J A;  1XG1 A;  3HGG A;  3SFI A;  2EZL A;  4JYK A;  4Y52 J;  1FTZ A;  2NVQ J;  4UUS A;  1SAN A;  5DS9 A;  3LSR A;  2O9L A;  1HDP A;  2Y2Z A;  3IH3 A;  5IYC J;  5M5W J;  3BJB A;  2R93 J;  1ETV A;  4XRS A;  4UUT A;  1BA5 A;  3BG3 A;  1ZKG A;  3KKD A;  2VKV A;  2FBQ A;  3BHQ A;  3KZ9 A;  2EBI A;  2XGD A;  5M3M J;  3HTI A;  4A3E J;  3MNL A;  3VW0 A;  2JA8 J;  5EDN A;  2LY9 A;  4QIW N;  1OCT C;  1JJ6 C;  1MBK A;  1JKP C;  3CJD A;  4W97 A;  1MSE C;  4M3F A;  2CQX A;  4BBR J;  5FKL A;  3W6V A;  4AYB N;  2M0C A;  2Y9Y A;  5HSZ A;  1E3O C;  2GEN A;  3LHQ A;  4GFK A;  2NVT J;  5GPC A;  1MBH A;  4FTH A;  4A3C J;  2HOS A;  4NN1 A;  1ZQ3 P;  2H8R A;  2DMQ A;  1VND A;  1Z0X A;  3EGQ A;  2IEK A;  5J1U A;  4DYR A;  3QBM A;  1O4X A;  3BTI A;  1QPI A;  3L1P A;  1IDY A;  3A03 A;  4D5C A;  2AO9 A;  1JUM A;  2R5Z B;  3JRH A;  2M34 A;  5JLX A;  1R9T J;  3FRQ A;  1TWH J;  2PBX A;  2O8K A;  3DCF A;  2VPR A;  2GFN A;  4A3J J;  1HF0 A;  1F36 A;  2NX4 A;  3LNQ A;  2Y30 A;  2ME0 A;  4IEJ A;  1BW5 A;  1WGX A;  5IOZ A;  4L62 A;  5EFY A;  5CXI A;  5F08 A;  2HYJ A;  3TP3 A;  4I76 A;  3GZI A;  4UDS A;  1AKH B;  2CJJ A;  1RET A;  4PXI A;  2EZI A;  1ITY A;  2CUF A;  1FIP A;  2XPV A;  3G7R A;  2ZCN A;  1GUU A;  1JGG A;  3MVP A;  5BNG A;  2UXI A;  3GTQ J;  3C2B A;  1U8B A;  3HOW J;  3Q3S A;  4XRS G;  2E2J J;  1T56 A;  4JP0 A;  5DAJ A;  2DA6 A;  4DYQ A;  3TED A;  2LP0 A;  3B6A A;  4G12 A;  3FK6 A;  1I6H J;  1RR7 A;  3OSG A;  3AQS A;  5IP7 J;  2JJ7 A;  3JR9 A;  1U9O A;  3NXC A;  5F0C A;  5F0H A;  2M2E A;  3ZQL A;  3I4M J;  5EZH A;  3BQY A;  4W1U A;  3GTK J;  2DMU A;  1IC8 A;  3DPJ A;  3HTJ A;  4B1R A;  1LE8 B;  5F27 A;  2OF7 A;  3NPI A;  4JNN A;  1IV6 A;  5FMP A;  3H3V K;  1X2M A;  5K7Z A;  5HBU A;  3QPS A;  1GT0 C;  1DU0 A;  3CCY A;  3BNI A;  3T6N A;  1ETX A;  3LSJ A;  3VW1 A;  2WGB A;  4XIC A;  3O8H A;  1WCM J;  2HOA A;  3PM1 A;  1RES A;  1ETO A;  5EG0 A;  3NNR A;  3BR1 A;  2MW8 A;  2DJN A;  3B81 A;  2RAS A;  2XDN A;  2QTQ A;  3VPR A;  4A69 C;  2LK2 A;  3B6C A;  5K7F A;  4DYC A;  3E7L A;  1AHD P;  4M3D A;  4X1E A;  1MBF A;  3PPB A;  4KWA A;  2DA4 A;  1A5J A;  2XPW A;  4GCK A;  4IHW A;  5FHP A;  4D5F A;  4A3F J;  2X6O A;  4Y7N J;  2R5Y B;  2N8G A;  3VP5 A;  2ZOZ A;  2NS8 A;  5C4J J;  3KNW A;  5F0F A;  1TWC J;  2XGC A;  4L5E A;  3ANG A;  5J3L A;  1WH7 A;  2L7M P;  5FGL A;  2DMT A;  1ETK A;  1BW6 A;  2IBD A;  3CWR A;  3BQZ A;  5FJ8 J;  5E3O A;  2O7T A;  3S14 J;  1HCR A;  1K61 A;  3S1R J;  1OJL A;  3G1M A;  4D7N A;  2R5Y A;  3GTM J;  1OCP A;  3S15 J;  1POG A;  3VIB A;  1T33 A;  1JUP A;  3D1N I;  2KDZ A;  1I3Q J;  1BJZ A;  2ZCX A;  2DN0 A;  4MO7 A;  5K7H A;  2ECC A;  3BTJ A;  2UXP A;  1MBG A;  1WI3 A;  4A93 J;  4DZJ A;  3DEW A;  4I6Z A;  3VVX A;  3S2D J;  2G7L A;  4LOC A;  1JKQ C;  3BR3 A;  2JWT A;  2LD5 A;  4B3A A;  2DA2 A;  4JX4 A;  2Y9Z A;  3ZQH A;  2EH3 A;  3CQZ J;  1ZR4 A;  4JKZ A;  2HI3 A;  3Q0W A;  5EF6 A;  3AQT A;  5E3N A;  2B63 J;  1YRN B;  1B72 A;  4X6A J;  1Q1V A;  2LKX A;  2VI6 A;  1K83 J;  2GM4 A;  1ENH A;  3GTO J;  1UMQ A;  5D18 A;  2VUM J;  4V2G A;  3BR6 A;  4BKX A;  1LFU P;  4BXX J;  4JL3 A;  5HAW A;  3HEF A;  3GEU A;  3ANP A;  5EZG A;  3KKC A;  4S0H B;  3HOX J;  1HLV A;  3RD3 A;  2NVX J;  3IH4 A;  3JRB A;  1YRN A;  2H1K A;  2W53 A;  1QVT A;  3FIW A;  4A3L J;  3S2H J;  4RBO A;  5IP6 A;  1VFC A;  3BRU A;  4V2F A;  2D5V A;  4J19 A;  2K40 A;  4MFD A;  5M5Y J;  9ANT A;  3IV5 A;  3VOX A;  5D19 A;  4D7M A;  2DA1 A;  1JT0 A;  3JRC A;  3S17 J;  2YUS A;  1BL0 A;  1LFB A;  2R7Z J;  1IUF A;  1MH3 A;  2DA3 A;  2XGE A;  5FKK A;  3GBG A;  1NTC A;  3GTP J;  3HTA A;  3A01 B;  4M3G A;  5C4Y A;  1WPK A;  1CQT A;  1MSF C;  3IUV A;  2JN6 A;  4GCT A;  1JUS A;  1VF9 A;  3S16 J;  1X58 A;  2PMZ N;  3ZQG A;  4AF5 A;  3QKX A;  2G3B A;  4CGR A;  1MH4 A;  5IYB J;  1TC3 C;  4C3I J;  4A3D J;  3I4N J;  4A3B J;  3A01 A;  2E19 A;  2G7S A;  2L0K A;  3COL A;  2HYT A;  5J1Y A;  1UHS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...