4XK4A

E. coli transcriptional regulator rutr with dihydrouracil
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
196
structure length
196
Chain Sequence
SAKKKAILSAALDTFSQFGFHGTRLEQIAELAGVSKTNLLYYFPSKEALYIAVLRQILDIWLAPLKAFREDFAPLAAIKEYIRLKLEVSRDYPQASRLFCMEMLAGAPLLMDELTGDLKALIDEKSALIAGWVKSGKLAPIDPQHLIFMIWASTQHYADFAPQVEAVTGATLRDEVFFNQTVENVQRIIIEGIRPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords HTH-type transcriptional regulator RutR
publication title E. COLI TRANSCRIPTIONAL REGULATOR RUTR WITH DIHYDROURACIL
rcsb
source organism Escherichia coli (strain k12)
total genus 78
structure length 196
sequence length 196
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08362 TetR_C_3 YcdC-like protein, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4xk4A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 4xk4A02
1JKOC 4A3MJ 3ZQFA 3KNWA 3HOXJ 2EZLA 1H88C 2REKA 5FMPA 4MK6A 4JYKA 2W53A 4L5EA 1MSFC 1FTZA 4NELA 4GCKA 1SANA 3HTHA 2XPUA 4NDLA 2ME0A 4QSHA 5C4JJ 3ZQIA 5F0FA 1T56A 4MXMA 4DYQA 2JA5J 1FIAA 2F07A 2CQQA 2K9NA 3JREA 3BTIA 5FHPA 3IUVA 3WHBA 3S2HJ 5IYDJ 3I4NJ 1IV6A 3OIOA 5F27A 4W97A 2JK3A 4XICA 5C4YA 1PUFB 1WI3A 3A02A 3GZIA 2GBYA 3G7RA 3V6GA 1ENHA 2LLKA 2K40A 3GTQJ 2NS8A 3SJMA 1ITYA 3MVPA 3CRJA 2WV1A 1SGMA 1P7IA 2NVYJ 4QIWN 2ECCA 3IH2A 1UI5A 2ELKA 1OCPA 2RHAA 4JKZA 1ETVA 1XC5A 3VVXA 2XSDC 3OSFA 2XB5A 2NX4A 2UXPA 1SFOJ 3S1RJ 3IH3A 1HCRA 4DW6A 2WB1N 4BY7J 1TWGJ 2X6OA 5EG0A 2D6YA 4CGRA 2DG8A 3BTLA 3GBGA 3QKXA 3HB9A 1MNMC 2GLOA 3B6AA 3KKCA 3RD3A 1I50J 1ETXA 3JRCA 4I6ZA 9ANTA 4XRSG 1ETYA 5FLMJ 3V78A 5E3OA 4XRSA 2R5YB 2LTPA 3G56A 3ZOBA 3LNQA 2PMZN 1IUFA 4A3EJ 2W48A 3MN2A 3TEDA 1VFCA 2X48A 2IU5A 4BKXA 2DMTA 4A3FJ 2L9RA 2M2EA 5EZGA 1HDPA 5FLVA 3QBMA 4BY1J 5C3EJ 1OFCX 2IEKA 2QOPA 2DA3A 2DA1A 4DYRA 1AKHB 3G1OA 3SDGA 3PASA 3O8GA 4IHYA 3ON2A 4HNVA 1GVDA 3A01A 4A69C 3HOWJ 2DA2A 1R9TJ 1RR7A 3GTJJ 3GTGJ 1GDTA 3VW0A 3Q0WA 5F08A 1WCMJ 2L7FP 5IOYA 3BHQA 3PM1A 2E2JJ 2K9SA 2NOGA 1UI6A 2GUHA 3HIMA 3HKZN 2M8GX 1RPWA 5EDNA 3HTAA 2LFBA 3QPSA 1HLVA 3UKGA 2EH3A 3ZQLA 2O7OA 4M3FA 4S0HB 4A3BJ 5F04A 3VUQA 3E7QA 3JRIA 2DTZA 4EEFG 2GENA 4GFKA 4JX5A 3BG5A 4FE7A 1QVTA 2L7ZA 2LK2A 4JL3A 3CWRA 5CXGA 4A3JJ 3BTCA 4JP0A 1POGA 1RKWA 1X58A 5FKKA 1U8BA 2QF7A 5CXIA 1JKRC 2CUEA 2XPVA 4V2FA 3KKDA 2WAQN 1IDZA 5HSZA 4ABZA 5F1JA 3VVZA 1BJZA 1GUUA 5J1RA 1ZR4A 1P7JA 1HOMA 1JUPA 3LSPA 3FISA 3B81A 4M3BA 1Z0XA 2ZOYA 4IEJA 2YUSA 4A3LJ 3A03A 2I10A 1B8IB 5K7HA 1MBHA 5E3LA 3VW2A 3BRUA 3CDLA 2GFNA 2X9DA 1A5JA 1XS9A 2XB0X 2ID6A 3K2AA 3NARA 1LFUP 4JX6A 2VKVA 4AC6A 1F36A 4C2MJ 1LE8B 2MGQA 4IHVA 2GM4A 1NTCA 1PUFA 3HGYA 1ZTRA 4CYCA 5EFYA 5IPAA 2R5ZA 3S1MJ 4X6AJ 4LOCA 5K7FA 3LSRA 2Y9YA 3JRFA 1MSEC 2DMUA 2JJ7A 1JJ8C 4Y7NJ 4BBSJ 1U9OA 5FKOA 4AUXA 2IAIA 3BTJA 3FK6A 4JX4A 1XG1A 2JWTA 5EEAA 2O7TA 3LOCA 2DA4A 3HBLA 1JTYA 4DZJA 2KDZA 3GTOJ 3ZQGA 2DA6A 4C3JJ 5EYRA 2LR8A 3BR0A 1YRNA 1LFBA 3EUPA 1ZKGA 4QTRA 4IHWA 2TCTA 2LP0A 4AC0A 2DN0A 2G7LA 3VOXA 4A3CJ 4GFLA 1WH7A 5M5YJ 2AHQA 1QRYA 4ICHA 3JRDA 1ORKA 2NS7A 3S16J 2NP5A 2YVEA 1O4XA 3I4MJ 1I6HJ 2CU7A 3TP3A 5IOZA 5EZHA 4DYCA 5DS9A 5C44J 2LVSA 1JGGA 5EF6A 5CW8A 5AQCA 2VPRA 4V2GA 4B3AA 2FX0A 1ETWA 1JT6A 3BR1A 2HOAA 2XRLA 2L7MP 2YVHA 1TWCJ 3H3VK 2Y0SN 3RZDJ 4JNNA 3FRQA 4FTHA 2MSYA 1HDDC 5IYCJ 3VVYA 2R5YA 1JKQC 2QWTA 1AHDP 1MBKA 3FIWA 4HKUA 2R92J 5M3MJ 4NN1A 2YS9A 3HOYJ 3NPIA 2EZHA 2LKXA 4IHXA 5E3NA 1EF4A 2UXHA 3BJBA 2UXOA 2XPWA 3HTIA 4B1RA 1IJWC 3VOKA 4XRMA 1W0UA 4Y52J 3JSJA 3LWJA 3SFIA 1WH5A 1FTTA 4MFEA 1TWAJ 3RH2A 1NK3P 1MBJA 2FD5A 5IP9J 2DJNA 1X2NA 4X1EA 1JKPC 3RKQA 3ON4A 1BL0A 1UHSA 3LHQA 3VIBA 5JLWA 3CQZJ 4XIDA 2HYJA 2QIBA 3HE0A 5J1YA 3IV5A 3WHCA 2XGCA 2NVQJ 4C3IJ 4G12A 1RESA 3O8HA 4KWAA 3NNRA 5EG0B 2JA6J 4PXIA 4FE4A 3HOVJ 1TWHJ 2CUFA 2DMPA 3GEUA 3S2DJ 3D1NI 2FJ1A 2XGEA 5FKNA 1FJLA 1CQTA 1QPIA 3TP0A 2JN6A 4UUSA 2Y9ZA 3K7AJ 1D5YA 1ZQ3P 1MBGA 2HYTA 3QQAA 1NK2P 2PZ9A 2HXOA 3Q0VA 3HEFA 4FISA 2Y30A 3EGQA 3LSGA 5M5WJ 4J19A 1B72B 3BG9A 1B8IA 4BBRJ 2HOSA 1ZR2A 3HOZJ 1ETQA 2PBXA 2IBDA 5EGOB 2ME6A 2ZOZA 2E19A 4D7MA 2JA8J 5FKMA 3BT9A 2ID3A 2JMWA 2DA5A 3IH4A 1GT0C 2OERA 3VW1A 2WUIA 3NI7A 3CCYA 4YZEA 1BW5A 1I3QJ 5DTDA 5IP6A 3OSGA 3S15J 2HQ5A 1IGNA 1Z77A 2Q24A 4GFBA 2K9QA 1RKTA 2G3BA 3RQIA 3VPRA 1OJLA 3F0CA 1Y1VJ 3H0GJ 1UG2A 2DMQA 3G1LA 1DU0A 3BCGA 4UDSA 5GPCA 5K58A 3W6VA 1ZGWA 2XDNA 1VF9A 1HF0A 1Q1VA 2FBQA 3GTMJ 3M3YJ 1BA5A 2QKOA 2N8GA 2EBIA 2EZKA 1TC3C 3BR5A 1FEXA 4XK4A 2E1OA 1GV5A 3FKIJ 2EZIA 3ZQHA 2RASA 1WGXA 1W0TA 3FK7A 1ZK8A 4GCTA 3QPLA 3Q3SA 4D5CA 4I76A 2WGBA 2EQRA 5FGLA 5K7ZA 2ZCXA 1S7EA 2R7ZJ 2UXIA 4B4CA 4BXXJ 1IG7A 4A3DJ 2R93J 2R0QC 3BG3A 3HM5A 2OF7A 2M34A 4MLOA 3TW7A 2HKUA 3DEWA 2G0EA 4UUTA 3T6NA 2MW8A 1X2MA 2CJJA 2DMNA 3M4OJ 2LY9A 1APLC 5E3MA 5J3LA 2L0KA 2H1KA 1MBEA 3O60A 3PPBA 1VI0A 3ZQCA 1RETA 4MFDA 4AYBN 1A6IA 3S5RA 5H9TA 1K83J 5IYBJ 1F43A 3COLA 4DZPA 4CYCB 2HI3A 2R5ZB 5D19A 3JRAA 1BW6A 4D5FA 3BR3A 2G7SA 1T33A 2M9HA 3LSJA 1WPKA 2VKEA 2UXUA 3Q0UA 2HDDA 2NVXJ 5GPAA 2O9LA 3GTPJ 5M3FJ 2OPTA 1JJ6C 4M3EA 3MKLA 3OOUA 2CQXA 2CRGA 1MH4A 3GTKJ 1YRNB 3BR6A 5JLXA 5FKLA 1AKHA 2M0CA 2ZCNA 1Y1WJ 1H89C 2OI8A 4MIMA 5F0HA 1JUMA 5HBUA 1DU6A 5F0CA 4D7NA 1K61A 3DCFA 5D18A 4ME9A 5IP7J 4AF5A 5FJ8J 5GP9A 5BNGA 2VI6A 1VNDA 3CMYA 5D1RA 4M6VA 3E7LA 2DG7A 4M3GA 2DA7A 3B6CA 1UMQA 1JT0A 2HOTA 4A3GJ 3HTJA 1JUSA 3RZOJ 3NRGA 1QVUA 1E3OC 2TRTA 3AQTA 4RBOA 3S17J 2D5VA 2ZB9A 4RDUA 1B72A 3C07A 2O8KA 3DPJA 2LD5A 2COBA 2Y31A 4ACIA 3BR2A 2ECBA 1ETKA 2P81A 1JTXA 2G7GA 1GV2A 5EGOA 2KT0A 3BQYA 5M5XJ 2HXIA 1AU7A 1ETOA 2MG4A 1G2HA 2QTQA 1IC8A 4MO7A 3S1QJ 2RAEA 3C2BA 3G1MA 1FIPA 2E2IJ 2AO9A 4M3DA 3L1PA 2YU9J 5J1UA 3JR9A 3HDDA 2E2HJ 1LE8A 2Y2ZA 3A01B 3JRHA 1IRZA 3ANPA 3MNLA 1OCTC 2V57A 5DAJA 3PO3J 3VP5A 2VUMJ 3JRBA 3HGGA 3HOUJ 1H8AC 4A93J 3ANGA 4GCLA 4L62A 3NXCA 1MH3A 1MBFA 3GTLJ 4C3HJ 3TW6A 4A3KJ 1U78A 5HAWA 2B63J 2NVTJ 5HODA 4UUSB 4A3IJ 3F1BA 3NAUA 1IDYA 2QCOA 2H8RA 5C4XJ 1TWFJ 3S1NJ 3P9TA 1U9NA 3CJDA 2JA7J 3BQZA 3S14J 3LJLA 3PO2J 2ZCMA 4W1UA 3KZ9A 3JRGA 2FQ4A 4FCYA 3BNIA 2NP3A 3AQSA 2XGDA
chains in the Genus database with same CATH superfamily
2ZSHB 1U6GA 4BHPA 3KNWA 1R23A 3V7CA 1WKMA 2KLOA 2ZBKA 2J5PA 1U5TA 4OIRF 4PUSA 4XNFA 1H88C 1ZHFA 5B3SH 2IJLA 2P5KA 3IRRA 1MSFC 1FTZA 3AG4H 1PVEA 3FBNB 1L3LA 2OTJI 3CP8A 3HTHA 2XPUA 3C1DA 3FM5A 2ME0A 1RI7A 1I1SA 1T56A 5DCMB 1WSUA 2R7VA 1FIAA 1W5CC 4ZYEA 4E7JA 3TDZC 3JREA 1BR4A 2DU9A 3DBRB 1QA6A 1IV6A 3I4NJ 2KP6A 5F27A 2F5EA 4XICA 4MQ9F 4PSWA 1PUFB 1IV8A 2FQ3A 1YJNI 2A6EF 3V4GA 2RQQA 3G7RA 1ENHA 2LLKA 2K40A 3GFIA 3DTKA 4HDUA 2KJCA 3RJPA 4G8XA 3HRTA 1MD0A 2WV1A 2IS4A 1RZ4A 1LUJB 2HVQA 1MMGA 2GA1A 1W7PA 3PUFA 4F92B 3PQKA 2NVYJ 3IH2A 4E7KA 2MC3A 2R7WA 3I55I 3IWZA 1XMAA 2DQLA 2FE3A 1S72I 5J47A 3NS4A 2XSDC 2PG4A 3OSFA 2KFDA 5EEHA 1OYYA 3OR1C 3FXOA 3SWHA 3GZ6A 2UXPA 1HCRA 2WB1N 2HR3A 3H35A 2DFFA 5BQTA 5EG0A 4XLFA 2D6YA 2BY1A 2P6TA 3DV8A 1K6YA 3E6BA 1QZEA 1SAUA 3R4KA 4CICA 1MNMC 2Z2SB 2ZC2A 5CKTA 4CCKA 3CCUI 9ANTA 4NNJA 2FF4A 3RI4A 2EK5A 5HDGA 2DJIA 5J8FA 2LTPA 2WA0A 2PMZN 1IUFA 2L4AA 1B4AA 1B9MA 1R1UA 1EJ9A 2M2EA 5EZGA 4YFXF 2DOEA 4OAYA 5IT3A 5C3EJ 2CFXA 4HX4A 2DA3A 2DQRA 5D5VB 4Y13A 2GAUA 1R5ID 5K5RA 4EGYA 1J0RA 4IHYA 5E17F 3OR2C 1GVDA 2DW4A 2W00A 2DA2A 3SZGA 2KMUA 1RR7A 3GTJJ 2XF5A 3VW0A 2YPRA 5F08A 2L7FP 1W5TA 4R1HA 3W2VA 3PM1A 1D5VA 3LSKA 3J81K 2K9SA 2BXZA 2OQRA 2R7RA 1KQ8A 4NQWA 2BVMA 4HYEA 1RPWA 2M8GX 2PFBA 4PJJA 4CSWA 1FBUA 2LFBA 3GZNB 2CS3A 3L2UA 2VJIA 4KICA 1X1PA 4GYIA 2R7OA 2EH3A 2AQEA 3ZQLA 1R49A 2E5ZA 5LHGA 3GVAA 4GFKA 2GENA 2IGKA 4JX5A 2L7ZA 3CWRA 4M73A 3PJRA 3ERMA 5CXGA 1XX5A 4MNUA 1POGA 1R4MB 2M3AA 2IS1A 3TQNA 4LIVA 2EFOA 5LHIA 2CUEA 1IN8A 3FXJA 2V1DA 4ABZA 4YIFA 3VVZA 4UNOA 1H9GA 3B81A 4M3BA 1V4RA 4UB6C 2ZOYA 2YUSA 5GAHJ 2HDCA 5K7HA 1MBHA 3VW2A 3U2RA 1Z67A 5JVGF 1VQPI 4UVBA 4S05A 3OY9A 3CCVI 5KHDA 4U9LA 1F36A 1MDMA 1KQ9A 2E1MB 1K78B 3BG6A 3M8FA 2GM4A 2OZ6A 1BIAA 1ZTRA 5F1RA 3S1MJ 1R36A 4KN4X 2Y9YA 3F23A 1YJ9I 2DMUA 3CDHA 1XGOA 3IP4B 1JJ8C 4HX8A 3BTJA 2VT2A 3FK6A 3QPTA 2JWTA 2VOPA 1XSVA 4XR6A 3NWSA 2AS5F 3QOPA 2XAJA 4KIGA 1DUXC 3GTOJ 3COAC 3GW2A 4F7ZA 2FMYA 2NVUB 5ICGA 3BR0A 2G7UA 4HW0A 2PFVA 2LP0A 4A5NA 1CGPA 5B66C 4Y3OA 4R79A 4QPQA 4A3CJ 3H5NA 4RM3A 2VBZA 2M5WA 1EKEA 4ICHA 2VJ5A 3DPUA 4AIKA 2NS7A 2YVEA 3I4MJ 3LQQA 4CDGA 5HLGA 5EZHA 3BCBA 1KU7A 2L2OA 2H94A 5C44J 5AQCA 1ZRFA 4PSXA 2K7LA 3FXKA 2IPQX 3BR1A 4XLCA 2HOAA 2HGCA 2K5CA 3J7ZI 4CGZA 2BW3B 2WY7Q 2M1BA 1TWCJ 2P6SA 3H3VK 2EV5A 3FRQA 2A5WA 4FTHA 3CESA 2MSYA 1HDDC 4RGRA 5IYCJ 2CQ7A 2R5YA 2HWVA 4P5OA 3CF5F 3MCZA 3MQ0A 1MBKA 4MGRA 1AA7A 4O6JA 2YS9A 3QPHA 3HXLA 3NPIA 4HDVA 5L3DA 4U0VA 4KA4A 2P0WA 3I59B 5E3NA 5IT9K 3L2QA 2UXOA 1IJWC 1LDJA 1OKRA 4XRMA 2XAHA 4Y52J 1KA8A 1X3WB 3JSOA 3SFIA 3JAMZ 3ZMZA 1WH5A 1FTTA 5IP9J 5BOXA 2DK5A 3GYHX 2EJRA 3J7AY 3ON4A 3HKZA 4H4KC 1VQKI 2OCCH 4MTDA 5HDNA 1P92A 3SEQA 3LHQA 4IOAF 2VPLA 5FO5A 2IXSA 3X2QH 4ZDLA 3TO7A 2QIBA 2HFHA 1XGMA 3O2PE 1MNEA 2QWWA 3WHCA 2ZJRF 4M9SA 3O8HA 2TDXA 5GAGJ 3CCLI 4PXIA 3KP5A 3HOVJ 2CUFA 3FKJA 2DMPA 5ICCA 1PP7U 2EA2A 3OYHA 2KZVA 1E17A 2MBFA 1X19A 2X6YA 1OCOH 3QOEA 1CQTA 2QSGX 3WTVC 2LMDA 3G4SI 3KE2A 4K2EA 2PZ9A 2HXOA 2A07F 3HEFA 4LMYA 3TBIA 4U0YA 3LSGA 5M5WJ 2XAUA 1HSJA 3BG9A 1HSTA 1UZCA 3UNGC 3KP3A 1TTYA 4WK8F 1FMWA 1ZR2A 3B73A 1KQ0A 4N4NB 4BJ6C 4U9NA 2XDVA 4DJAA 1OCZH 4HNTA 5ILVA 2CV1A 2ME6A 4D7MA 4G94A 2ID3A 1FYMA 4AVZA 3A0BC 4NC8A 2A05A 2ISZA 4YZEA 1FBSA 2KJBA 5DYMA 3BC8A 1QNTA 1Z77A 2L54A 3DKYA 3C2HA 1F1ZA 1MNDA 4PDKA 3RQIA 3H0GJ 1UG2A 5K58A 3QU6A 4XBFA 2VXZA 3DXJF 1ZGWA 2OCEA 5TISC 1Q1VA 2DO7A 1WI9A 3BPXA 1KU2A 1SVLA 2N8GA 4KIBA 2VBWA 4GCVA 2GIVA 2EZIA 3OYGA 4CZCA 4M9XA 4RAYA 3ZP5A 2IRFG 1HBXG 2ZCXA 3KYLA 1G3TA 3GX4X 4DQ2A 4BXXJ 2RN7A 1SEUA 1IG7A 4A3DJ 4Y15A 4E7LA 4NUBA 2PMUA 3BG3A 3HM5A 2BXYA 4XM3A 2EB7A 1Y56A 3OIQA 2G0EA 2FRHA 4Y17A 4P9FA 2FBKA 1QQIA 1U5TB 2EPFA 2L0KA 2BZTA 1MBEA 2B7EA 5J3LA 3RKWA 5J8CA 1K4SA 4ZZDA 3ZQCA 3FMQA 2V1NA 4MFDA 4PK4A 1YIJI 3DEEA 2EA4A 3QYBA 3HSRA 5H9TA 3F22A 1VQOI 1K83J 2HKXA 2VC0A 2Z99A 3KEYA 3FBIB 4EV0A 1BC7C 3COLA 2R5ZB 3VB2A 4A5MA 2R7SA 5D19A 1BW6A 2E7XA 3PNTA 4D5FA 2PMZA 3J81Z 3BR3A 4TV7A 3SYTA 1T33A 1WPKA 2B0LA 3MKYB 1QHHD 2NVXJ 1P4AA 3SDBA 2NS0A 2OPTA 5K5OA 4HQMA 3R6SA 1DDNA 2GXGA 2CQXA 2L5QA 3F3XA 2M0CA 3CUQC 1H89C 2H27A 2OI8A 3FXLA 1W7PB 3K4LA 1X1BA 2DFIA 1UCRA 2L01A 1DU6A 1J5YA 1SMYF 5F0CA 4D7NA 4C30A 3VTIA 1BN5A 2F6CA 4EM0B 5BNGA 2VI6A 3IHUA 5DM6F 1TNSA 5D1RA 4M6VA 1Z3XA 3HTSB 5E8IA 4BQNA 2CUJA 3B6CA 3C3WA 4WXCA 3LFKA 1JUSA 4ZYGA 3RZOJ 1HKSA 1FOXA 3NRGA 2TRTA 2VC1A 4HSTA 3AQTA 3RPUD 2P8TA 3S17J 2ZB9A 2WTEA 1B72A 1W36C 1GHCA 4XORA 4F55A 2LD5A 1K7AA 5HS7A 3BR2A 2AXLA 1ZLKA 2QM3A 4EM2A 2G7GA 5LFAA 4NHJA 4CCMA 2FJI1 4AIJA 2QGUA 1ETOA 3E3VA 4RS8A 3GUDA 4HSRA 5AONA 1W7PD 2PEXA 1IC8A 3ZGKA 4NC7A 3FMSA 4P96A 3CO6C 5B5EC 1J2XA 2AO9A 4OINF 3L1PA 1XB4A 3HL2A 3EYYA 1XCBA 1K78A 3MNLA 3JRHA 3DBHB 3KCCA 2V79A 3S93A 3HOUJ 3HGGA 4A93J 4GCLA 4L62A 4AWXB 1ERDA 2LF7A 1MBFA 2JA2A 4C3HJ 5F64A 3GTLJ 1U78A 1T98A 4HG2A 1Z6TA 1Z21A 4F3QA 1JHFA 2DLLA 2QCOA 5C4XJ 1TWFJ 3S1NJ 2BOLA 4ZZLA 1YHQI 3BQZA 1XN7A 3L7WA 3TKYA 3LJLA 1G3WA 4W1UA 4YFNF 2BBYA 3M07A 4UV8A 4FCYA 1IAWA 2NP3A 1I39A 3CC2I 3HOXJ 5IT9Z 1ZELA 1BM9A 2EINH 5GTIC 4AD9A 1VQLI 1V55H 3ZMTA 2DXIA 3MWMA 1LEAA 4NELA 3H3UA 4HBLA 2BW3A 4NDLA 3M8JA 1F5TA 3M1EA 1R58A 2HU9A 3OL4A 3GMEA 2K9NA 1I3AA 2CFOA 1BR1A 5FHPA 4HZFA 3IUVA 3GCMA 4XKVA 3WHBA 1YFHA 3OIOA 1FYKA 1MDMB 2A69F 2YX7A 3PFYA 3NRVA 4BXFA 5C4YA 3K4NA 1G3YA 1Y6IA 3H3ZA 4KNYA 1WI3A 2CYYA 3A02A 3V6GA 2WV0A 2P7CB 4PGGA 5KAIC 3LA2A 3GTQJ 2V7FA 3FZVA 1HW1A 3LAJA 1GXPA 1U0JA 5ILSA 3TOAA 1RNLA 1R5HA 1TP4A 1V5EA 4BE0A 4MEYF 3QP6A 1FY7A 1UI5A 5D4SA 4JKZA 4V19K 4HV5A 1XC5A 3IAS2 1O7LA 1A31A 3CUQA 4N9IA 2VOOA 1X1AA 2RDPA 3OOPA 2XB5A 3REOA 5JHUA 3H5RA 2H6BA 1SFOJ 4E7SA 1LB2A 2NOJB 3F8CA 4JK1X 1TWGJ 2X6OA 4LITA 4CGRA 1XDSA 3K9TA 3TO9A 1P4WA 3FDYA 4CYDA 1WZ2A 3L00A 3VOEA 2GLOA 3KKCA 4WIBA 3SFZA 3N4MA 3V78A 3QU3A 2WADA 1ZAOA 4XRSA 2R5YB 3WTUC 4RM2A 3G56A 1C0WA 4A3EJ 4CXFA 3TEDA 1VFCA 4BKXA 2HZDA 3HOTA 5L3EA 3T8RA 3AL0C 1V3FA 2QKMB 2W85A 3H1CA 2QOPA 2K27A 3MEXA 3PASA 2JVGA 3O8GA 2GQQA 3CJNA 4AIHA 1OQYA 3BZ6A 3V8LA 3A01A 2CGPA 3V42A 1AWCA 2FA5A 3GTGJ 2A3SA 3Q0WA 3W2AA 4CCJA 2CW8A 5DEQA 3BHQA 2E60A 1FMVA 2E2JJ 1IO2A 2ISYA 4E70A 1UI6A 3CF2A 3HIMA 3HKZN 1T38A 3HTAA 3ONQA 5EDNA 3JCUC 3ZRGA 3QPSA 3FM3A 5DCFA 1HLVA 3K1NA 3UKGA 2ZNZA 1MMDA 2O7OA 4S0HB 4A3BJ 1LNWA 5F04A 3VUQA 3E7QA 3JRIA 2DTZA 2CUZA 1QVTA 5HVQC 1ZG3A 4D0PA 4KFCA 1B1BA 4ENNA 1K6OA 3BDDA 5E20A 1IDZA 4DBQA 1DGRM 4GXOA 2M7AA 5A2QK 5F1JA 1X3ZB 2V1UA 4XSZF 2R7QA 3FISA 5J6XA 1E3HA 1FNNA 1D1AA 2ZXJA 2HDWA 2FNAA 2XVCA 3HPHA 5CYVA 3WG9A 4A3LJ 3VYRB 2I10A 4P1WA 5E3LA 4E4HA 1ACIA 2P7VB 2QQBA 2HTSA 5L3FA 3FHNA 2XRNA 3I3LA 1A5JA 2XB0X 2W7NA 1LFUP 4ANJA 1FBQA 5KVRA 1LVAA 1O3QA 4XONA 1SD6A 2PI0A 2MH2A 4FETA 2KRFA 2VQCA 2CSOA 3N05A 2Z33A 2R5ZA 4X6AJ 2DFHA 3CDIA 3V7RA 2W1OA 4U7DA 3OYMA 1Z6RA 3EQLF 4B8XA 4BBSJ 2ESNA 3OIPA 3RPUA 4AUXA 4JX4A 5EEAA 2MYSA 3LOCA 3ASNH 3I64A 3K2ZA 3HBLA 2LBFB 2KDZA 3GLLA 5D8KB 3ABLH 3T8TA 4L18B 2LR8A 4AVPA 1ZKGA 4QTRA 1QZZA 4ZYDA 2ETHA 2NRAC 1JGSA 4G6QA 4AC0A 2DN0A 2DT5A 3M9AA 4GFLA 1WH7A 2K4JA 5CVRA 5M5YJ 3H9QA 3GEZA 1FYLA 1IRFA 3BJ6A 5ERIA 3H9JA 3S16J 4PJLA 4CUGA 1I6HJ 1YQAA 2E7WA 5HLHA 2B9SA 1D8JA 4EM1A 5EF6A 2CQKA 4RLFA 3JW4A 2L02A 4XLNF 5GTHC 4Z2YA 1MMSA 1FC3A 2XRLA 4RAGA 3MZHA 2YVHA 2G9WA 3RZDJ 5FFZA 2IA0A 2RQPA 1AHDP 1MZBA 2JRTA 1Y39A 5M3MJ 3I9V2 4HF0A 2G7HA 1OISA 4IVNA 1EF4A 4RB3C 2D1VA 4G6DA 3HTIA 5FLXK 3BJOA 2ZKZA 1W0UA 3JSJA 5H6RA 1YX3A 4BDYA 1NK3P 2MD5A 4KISA 3M8EA 3DKWA 1UHMA 1X2NA 1BR2A 4X1EA 1JKPC 3KETA 1KYZA 1F9NA 1UHSA 3J80K 4IRGA 5JLWA 4XIDA 3IV5A 2VONA 1OCRH 2XGCA 1Y8QB 4G12A 4KWAA 1YTYA 4FASD 1IF1A 2GXBA 3GEUA 1I1GA 3BROA 3S2DJ 1G6NA 2EIMH 2WAQA 2W24A 3F8FA 4OMZA 5FKNA 3H0DA 1FJLA 3H9GA 2EFWA 3ZQQA 5CJ9A 1ZQ3P 2O8XA 3EDPA 2X1DA 4BQQA 3QQAA 2P5LC 2ELJA 2STWA 4GYGA 4FISA 3EGQA 3I58A 3L2VA 2O0YA 1B72B 2VKDA 1VTNC 3GLXA 4BBRJ 5H6QA 2HOSA 1RR8C 1ETQA 2QKLB 1D1BA 2PBXA 3ECHA 2Q1ZB 2KZGA 4HPQA 2JUGA 4BU2A 4DGWB 4CHUA 4DVYP 3RKXA 3T0YA 2E19A 4FX0A 1X1CA 2JA8J 4QLCU 3IH4A 2XKPA 1GT0C 1DPRA 3IC7A 3VW1A 3NI7A 1S6LA 5KAFC 5DTDA 3S15J 4I2OA 4BHCA 2K9QA 3LL7A 1RKTA 4I0AA 1WJDA 2G3BA 3F0CA 4YIIA 2R7UA 3CMMA 1REPC 2DDAA 2H6CA 2HKOA 2DODA 5GPCA 2PLYA 2XDNA 3G2BA 4XQFA 3KEQA 1U3EM 2DYRH 3GTMJ 1SD5A 1ZN2A 2EBIA 2EZKA 3ELKA 4XK4A 2ESHA 1TT0A 2E1OA 3NWTA 4EATA 3OYLA 3P7NA 3K4JA 3FK7A 3F8NA 4GCTA 4FQGA 4IJAA 3C2GA 3Q3SA 2KIFA 4I76A 5GAEJ 2FOWA 1IN5A 5FGLA 1KZHA 3ECOA 1R1VA 4B4CA 3CLQA 1YO5C 5LBQA 4UY8I 2R93J 2Y0SA 2AXTC 4MLOA 2HKUA 4Y33A 4UUTA 4CA0A 1DPUA 3LSHA 2MW8A 1ZRCA 1X2MA 4II2A 2A68F 3QAHA 4HOBA 1SMTA 2H1KA 3O60A 2DOFA 3DPTA 1G59A 2A6HF 5D6FA 2M8EA 3S5RA 1A6IA 3ZXSA 2ACJA 3ESWB 2X0LA 3BOQA 5IYBJ 4A12A 1K79A 1MIJA 2EFQA 4XLPF 4DZPA 1F4KA 3MAJA 2M30A 3JRAA 4Q47A 3PUBA 2G7SA 2LH9A 2M9HA 4Q48A 4M6XA 3Q0UA 3ABTA 4JQFA 3WTZA 5GPAA 5E79C 3HHHA 1WJBA 1UHWA 1YG2A 2M0MA 5TJJA 1JJ6C 3GTPJ 3OS1A 3OOUA 2W82A 3BCAA 3LQRA 1UJ8A 4BJTA 3BR6A 4M71A 2OU2A 4IF4A 1FSHA 3S8PA 2ZCNA 3Q9VA 4UXNA 1JUMA 5F0HA 1B6AA 1TL8A 4OIPF 3DKXA 3ZQ7A 3DCFA 5A2QZ 1FOWA 1QGPA 1XGNA 2GZWA 4A0YA 5GP9A 3CUQB 1VNDA 4GGGA 5LGUA 1V54H 3B02A 1O57A 4M9ZA 1E3PA 2DG7A 4M3GA 2E71A 1KYWA 2GOMA 4U7BA 3CJTB 4M72A 4KITB 1QVUA 3WU1B 2IGMA 5GADJ 5HNFA 2D5VA 4RDUA 3C07A 2IW5A 3KFWX 4IX7A 2PX9A 3DPJA 2HOEA 1NG7A 2EFPA 3WGIA 2GOXB 2Y31A 1JTXA 3EUHC 3MD2A 1GV2A 1OLTA 2OBPA 5L3GA 3T5XA 2KT0A 2R7DA 1AU7A 4ZYAA 3LSMA 4AU7A 1OYIA 4L0YB 4H0EA 3S1QJ 4MO7A 2KRHA 1USSA 5FRMA 2RAEA 5CVUA 5CPRB 1FIPA 4M6YA 2K02A 4F52A 3JR9A 2HVRA 4ITVA 3FXRA 2HQAA 4DIQA 5L3CA 1FZPB 2VXDA 3A01B 4BUPA 4CCNA 2VODA 1YX5A 3KZYA 2Y48A 3MMYB 1OCTC 5DAJA 3DFGA 3VP5A 2DAOA 2IA1A 2BVLA 4HAMA 3EETA 5FFXA 2FXAA 3I54A 3V8JA 1MH3A 4L0ZB 1NH3A 3S2WA 4B43A 5HAWA 3OS2A 2L4MA 4A3IJ 1TNTA 2H8RA 2LBFA 3P9TA 4O5VA 2Z9OA 4A2UA 4BACA 2DYSH 2ZCMA 5J4VA 3R61A 4E7HA 3CJRB 4KIFA 2FQ4A 3KZ9A 3ULQB 2XGDA 4A3MJ 4IRVA 3ZQFA 5LGNA 3MKWB 3FF5A 1W36D 3VSLA 1WJFA 1IRXA 4AYBA 5FLXZ 3E6DA 4PZJA 2LY2A 3IRQA 5FMPA 2WY8Q 3PNVA 3OYAA 2UV1A 4LJZF 3K10A 4QPOA 3KLOA 5LRSA 4RA2A 3E5QA 1QZYA 2D1HA 4PCQA 3TDUC 5D5XB 2PMHA 3DLLF 4QSHA 2R3SA 3ZQIA 2MLKA 5F0FA 4JBAA 2HVSA 3KIOA 2JUCA 3SHFA 2JA5J 4M74A 1IRGA 3J80Z 2NNYA 2YSRA 3S2HJ 2YR2A 3D5SC 1XSDA 4W97A 4XL9A 3HRUA 2JK3A 3RPQA 1SAXA 1VQ7I 4I09A 2ZXIA 2GBYA 2CWEA 2OV7A 2HEOA 1IXRC 1TT5B 3E97A 3P9KA 3MKZA 1ODDA 3G6EI 3SJMA 1ZREA 1L0OC 2R7TA 3MVPA 1ITYA 2ELHA 2RNGA 5LHHA 3AG3H 1WHUA 1SGMA 1P7IA 3VEPA 1FT9A 4QIWN 3LWFA 4BQOA 2IS6A 2F5FA 2UUZA 1OCPA 1FOYA 1ETVA 3AG1H 3VVXA 3N97A 4LLLA 3M7GA 4NB5A 1G3SA 4B47A 5CVJA 2NX4A 5BS6A 2L9NA 3S1RJ 3I5UA 3IH3A 3HRMA 4DW6A 4GRIA 4BY7J 3TL4X 5BPIA 2JQ7A 2DG8A 4PJ0C 2BY3A 2FMLA 3FXMA 3K4BA 5D6EA 3SZPA 3CCMI 4ESFA 1TQIA 3HB9A 3OYKA 2C6YA 3B6AA 2B1EA 3GZ5A 4F91B 5FLMJ 3IL2A 3NEUA 4D1QA 4IKFA 2X6XA 4ZC3A 5E3OA 2YX4A 2L9SA 5AIQA 1YJWI 2PN6A 3ZOBA 3LNQA 3MN2A 2PJRB 1Y8RB 2IU5A 1H0MA 2DMTA 4A3FJ 2YVXA 5JFRA 2VL8A 1HDPA 2D45A 3QBMA 1BOBA 4BY1J 2QQ9A 1OFCX 2IEKA 1VQ4I 2XHKA 2KIMA 2XROA 2DA1A 3I71A 1AKHB 3G1OA 1YE9A 3WTWC 3ABMH 3K4MA 4C2UA 4BQAA 2KL4A 3LA7A 4HNVA 4WF2A 4A69C 3AL0B 1R9TJ 3HOWJ 3GFLA 4PJMA 3R0AA 1GDTA 4G6TB 4ZYHA 1WCMJ 5IOYA 1WJ5A 3BG7A 2HPIA 2NOGA 2GUHA 5H2FC 1N78A 4Q5SF 4EGZA 3CO7C 3IAM2 1D0YA 1OYWA 2LKPA 1YI2I 2JPCA 2QYOA 3DEUA 2K3FA 4ON0A 1Z05A 2COMA 3K4KA 4EMSA 1IN7A 1MJ9A 3LFUA 4UB8C 4EEFG 4YRVA 2V26A 4FE7A 4EQQA 2LK2A 5HNHA 2QVOA 3BTCA 3CCJI 3LAPA 1RKWA 2QF7A 5CXIA 4V2FA 2WAQN 2ZNYA 5ICEA 1B59A 5K5QA 2Q2EB 3I0TA 3W6JB 3BLYA 4IL6C 1GUUA 2GXAA 3LSPA 5TGTA 3HSEA 2O5RA 4IEJA 3KX2A 4RB1A 3UR3C 2F2EA 3A03A 2KKOA 2MD0A 4XOPA 2M45A 1KGSA 1ZLJA 3HSFA 1T0FC 1FOKA 2VIXA 2X9DA 2Z5UA 3AFHA 2VT3A 3NARA 3HPGA 4BEHA 4BNCA 4JX6A 2VKVA 4AC6A 4WWCA 1T6SA 2MGQA 4IHVA 4NBQA 1NTCA 3ABKH 3HGYA 5HLIA 3IWFA 5EFYA 2E5NA 1DQUA 4LOCA 3ROUA 3LSRA 3K70D 5FD6A 1S9HA 3HHGA 4Y7NJ 4G7ZF 3OYBA 3KYCB 1U9OA 2LY1A 2LNBA 2BYVE 2MA3A 1XG1A 2VASA 2ZFWA 2ZMEC 3CMEI 1LEBA 2O7TA 3LMMA 3G71I 1JTYA 1R5GA 2DA6A 4C3JJ 2DPDA 1LDDA 2DCEA 1BJAA 3OL3A 2KQRA 3EUPA 2TCTA 3KP2A 2QEXI 2F5CA 2MC4A 3BY6A 5HS9A 3WGHA 3WTXC 4AM3A 3VOXA 2RNJA 1S7AA 2IGOA 4UVCA 2AHQA 4Z6YA 3JRDA 2QENA 1LDKB 2NP5A 3TP3A 1UAAA 4NC6A 1XCVA 2B3WA 1EH6A 1JGGA 2LVSA 1ULYA 3RSNA 1PUEE 2VPRA 3CCRI 4V2GA 4B3AA 1ETWA 1VQ6I 2H09A 2L7MP 1ZG5A 3L2WA 2Y0SN 1T95A 5AIPA 3OYIA 1UELB 3DTIA 5FD5A 3L2RA 3VVYA 4I99C 1WQ2A 4PJNA 1JKQC 2ICWG 4PGHA 1BI1A 2RC4A 2QSFX 3FIWA 5KNLA 4HKUA 3P9IA 2R92J 4NN1A 4I02A 3OYDA 1FPQA 2JZYA 1A04A 2EZHA 2JSCA 3EUKL 2AQFA 4IHXA 4BGDA 4MQVA 1RUOA 1R7JA 2EV6A 3OYNA 2FBIA 4YELA 2DBBA 3LWJA 5J40A 2O6GE 4OAZA 4IPAA 5D5UB 4LLGF 5D4RA 1H9TA 3RH2A 4ZTJA 4UUVA 2FD5A 2DJNA 2HYGD 1LQ1A 2JPBA 4N9HA 2H8WA 2PBIA 1PYVA 3R0JA 3A0HC 3DU6A 2H1LA 5DDGA 1O3SA 4YFKF 5E1XA 3CQZJ 3ERED 2HYJA 2DI3A 2DT7B 1UB9A 4PFOA 4CZZA 2JSPA 2OQGA 3NNRA 2JT1A 5IY5H 1FP2A 1Z91A 2JA6J 5K1YA 2MH9A 3K70C 1TQPA 4FE4A 5FROA 2XIGA 4CCOA 3CLOA 4HRIA 2V9KA 2XGEA 3L2CA 1P6RA 3PFIA 2HZTA 2R4GA 3K7AJ 3HOSA 2Y9ZA 1D5YA 1MBGA 2EIKH 1O7FA 3ISPA 3Q0VA 3TMOA 3OYEA 1BI0A 4LLNA 3U1DA 1SD7A 1B8IA 2V9VA 1SFXA 2Z1DA 3CC7I 3HOZJ 5CVVA 2XAQA 3E6CC 4B44A 4IZZA 2WAEA 1YS6A 1J59A 2IBDA 2M87A 2V6CA 2ZOZA 2Y75A 5FKMA 3BT9A 3K4CA 2GA2A 2DA5A 1HQCA 1GLNA 4F93B 2OERA 4ESJA 3CCYA 5LRRA 1BW5A 2M4KA 1T0FA 3DBLB 2VE9A 3OSGA 4KJZA 2Q24A 4A6EA 4L9NA 3JAMK 2CV0A 1VQMI 1IUYA 2L3DA 2NNNA 2IVMA 3W6VA 1D3YA 4N4OB 2FEZA 4RAFA 5LLQA 2L9VA 3DQVC 4EJWA 5D8LB 1VQ9I 3M3YJ 1BA5A 1T08B 2QKOA 1I5ZA 2DK8A 4FHTA 4RGSA 3K0LA 2VJ4A 1TC3C 3BR5A 1FEXA 4A0XA 2EIJH 2CW7A 4PFPA 4RGXA 2K4BA 1GV5A 1GVJA 3FKIJ 2ZMEA 5CQGA 3ZQHA 3VFZA 1SD4A 1ZK8A 1Y0NA 1SFUA 1VQ5I 2R7XA 3ASOH 4L5IA 1V5GA 2WGBA 3QWLA 3DU5A 4LK0F 4KDPA 1S7EA 2R7ZJ 2HS5A 3OV8A 3VDXA 1ON1A 4BH9A 4DBRA 1MJAA 1SVMA 4B3XA 2XKOA 3H36A 2M34A 2QQAA 3EPZA 4EJTA 5J4YA 2QBYB 3T6NA 3WU2C 4EJVA 2CJJA 4OIQF 4BL0B 3M4OJ 4XN3A 2LY9A 1APLC 1A35A 3PPBA 1RC9A 1RETA 1YLFA 5LEJA 4AYBN 3PSFA 4I01A 4ZJZA 1F43A 1XTAA 2RV8A 1XDUA 4CYCB 2HI3A 4YEJA 3K8PC 1WJEA 2LF8A 1X4OA 5B1BH 1T39A 1R71A 1ZARA 5HDKA 4ZH4F 2RVCA 3P5JA 2PJRA 4C9YA 5F6FA 2F4MB 4FT8A 4XOTA 3MKLA 3GTKJ 1XGSA 4ENMA 5LEKA 4U0WA 1YRNB 1FSEA 2CW0F 5FKLA 1FWZA 3SXYA 1AKHA 4LK1F 5HLTA 2ZO4A 4O3MA 4MIMA 3AKZA 5HBUA 4U87A 4HLXA 1MGTA 3E1SA 2I8DA 2OTLI 3HIFA 1J9IA 3K1MA 3PNYA 5D18A 4OIOF 1HC8A 5LGTA 4AF5A 4HNUA 4AIDA 1N25A 3J7AO 3ZMDA 4RB2C 4II3A 4RMNA 1OPCA 5EJCA 3FX3A 4C2MA 2DFEA 1OCCH 3CMYA 3E7LA 1LKXA 3F9KA 4LD5A 3G73A 2DA7A 4WCGA 2LC2A 1UMQA 3OWTA 2HQNA 1TLHB 2Q8KA 4P55A 1OR7C 3TOBA 2K9MA 1E3OC 4UV9A 1SVOA 2A6TA 4RBOA 1M1EB 1ZYRF 4KMFA 3EYIA 2O8KA 2NYXA 2COBA 2W84A 2F48A 3TGNA 4ACIA 2ECBA 3RIRA 1LFPA 1ETKA 2P81A 3J7YJ 4UVAA 1TBXA 3VYTB 1U8RA 2Q2EA 3IKTA 4XKBA 1I27A 5DV5A 5EGOA 3BQYA 5M5XJ 2HXIA 3QRFF 2E1CA 1YOVB 2F5VA 1G2HA 3ABUA 3P9CA 2QTQA 3E5XA 5JI6A 2WWYA 2DT6A 4KN7X 1YIOA 2LREA 3C2BA 2O3FA 4WXDA 1CF7A 2YU9J 5J1UA 4D9JA 2EFNA 3E0JB 1JXSA 2E2HJ 1IRZA 2Y2ZA 4LG0A 1RIOH 3ANPA 2HTJA 3CUOA 2X1CA 2BV6A 3ZCOA 2V57A 3HG9A 4RGUA 1Q1HA 3WODF 1DGWY 5ILUA 3JRBA 3OMYA 2UZKA 1H8AC 1YITI 3ANGA 4G7OF 1R4NB 2QLZA 3HJEA 1Z7LA 2OC6A 1U2WA 3IKVA 4A3KJ 3C7JA 2B63J 2NVTJ 3FMRA 4UUSB 4RB0A 3F1BA 1QPMA 3NAUA 2HYFA 3WU0A 4HQEA 2F4IA 4ZTFA 1LJ9A 3A4CA 2Z16A 1UG0A 3PO2J 4XRFA 2VQLA 4E7ZA 4U88A 3JRGA 3WGGA 2XC7A 1IXCA 1JKOC 1ONVA 2EZLA 3D0SA 4XKCA 1Z3YA 2REKA 4XKWA 3RYPA 2X4HA 4MK6A 4XLHA 3WE3A 4JYKA 2W53A 4L5EA 2BY0A 4GCKA 1IW7F 3S32A 1SANA 3HRSA 2E1NA 2KISA 5C4JJ 1WFXA 2IGNA 2QQ8A 4MXMA 4DYQA 1G4DA 2F07A 2CQQA 2X51A 2YU3A 1EA3A 3BTIA 4BEHB 5IYDJ 1D1CA 1A36A 4BXUA 4IQ4A 4E6KG 2MABA 4IHTA 1FP1D 1S3JA 2VQHA 1BC8C 3KEOA 3GZIA 2X85A 2F4OB 4R8HA 4IXAA 2QZ8A 3I4PA 4OD4A 3NQOA 2DPUA 2NS8A 1QHGA 3CRJA 4IO9F 4I98B 1TQMA 1TW3A 4KT5C 3KZIC 3CZ6A 2BY2A 2VBXA 2ECCA 2ELKA 2RHAA 5E18F 2V1XA 2Q0OA 1PP8F 2V6EA 2FNPA 2HNHA 4CO8A 3E5UA 3PIPF 2ZY9A 1HW2A 3RDIA 3EUAA 1W4MA 4DOZA 2KPMA 2XV4S 1Z9CA 5E8GA 3BTLA 3GBGA 3QKXA 2OUMA 2HQRA 4OU0A 5ED4A 2OJED 3BP8A 3CD6I 5D5WB 3QYFA 1BI3A 3PL8A 3RD3A 2LYCA 1I50J 1ETXA 3JRCA 4I6ZA 1LPQA 2I5UA 4XRSG 1ETYA 4I7HA 2GWRA 1OR7A 2HPMA 2PQ8A 1P2FA 3V8KA 3A2KA 3GXOA 1P4XA 3ZN0A 2W48A 2JVHA 2X48A 2L9RA 2M4GA 1D0XA 5FLVA 4JOMA 5E1WA 3CTAA 3AAFA 3RCOA 2ZSIB 4DYRA 2CH0A 3SDGA 3Q9SA 4X0GA 4OD5A 3ON2A 4CH7A 1PJRA 2CO5A 1EH8A 3C18A 3U1KA 1WVRA 3S3OA 1EV7A 4L9TA 2LOOA 1YW7A 3HC7A 1W5SA 4J01A 4MEXF 2IA2A 2W4SA 2QSHX 2KHMA 4M3FA 3H5AA 2K85A 3E6MA 4RAZA 3BG5A 1P9QC 1S7OA 2E34A 4JL3A 3IUOA 4A3JJ 4JP0A 1X58A 5FKKA 3GF2A 1U8BA 4LG3A 1JKRC 2XPVA 1IZ1A 1S8NA 2X1EA 3KKDA 4IRHA 3KYDB 4BAYA 5HSZA 2XF7A 1O3TA 2VQGA 1BJZA 5FRNA 5J1RA 1ZR4A 1HOMA 1P7JA 1JUPA 1BI2A 2EWNA 4BE2A 2E1MC 1R1TA 1IN4A 1Z0XA 3I56I 3BZKA 1BIBA 1J09A 4Q4ZF 4XN0A 1B8IB 5ICFA 2LRDA 3SEZA 2QBYA 4LB6B 1R22A 2J5OA 3CDLA 3BRUA 1XSXA 2Y69H 5DCMA 3QYEA 4LB5A 2Y0MA 2W25A 2GFNA 3HUGB 2VE8A 3W6KB 1XS9A 2ID6A 3K2AA 1VQNI 4C2MJ 2GIZA 3FXUA 3GFMA 5KCMA 3K6GA 5BPDA 3CCQI 1BOAA 1LE8B 4GDFA 1STZA 2ZXHA 3V7SA 1PUFA 2OA4A 2OZUA 4CYCA 3CCSI 1SFEA 2F5DA 5IPAA 3OYCA 2FOKA 3MZYA 5K7FA 3JRFA 1MSEC 2JJ7A 4G7HF 4Y4RA 3A1YA 5FKOA 2IAIA 3VODA 5HOOA 3U21A 2ZJPF 3W3CA 2DA4A 2XGXA 5DUKA 2CV2A 4KUMA 5DD4A 1O3RA 4DZJA 1QU3A 3ZQGA 2XASA 2E36A 5EYRA 1YRNA 1LFBA 1MJBA 2X6WA 4IHWA 1D8KA 1VZ0A 3WTTC 3CMAI 2LKSA 2G7LA 2WB1A 3ZPLA 2ZMEB 2KIUA 2BE5F 1QRYA 3O6BB 1ORKA 2PJPA 1V5FA 1O4XA 2CU7A 3ZMSA 5IOZA 4L9VA 2DOAA 2LSOA 4DYCA 5DS9A 4ZDOA 4CCLA 5CW8A 3W2WA 2XSJC 2FX0A 1JT6A 2KRCA 3PSIA 1E0EA 3PIOF 4I0BA 4JNNA 1J7KA 2FU4A 2VKHA 4QWQA 4BJ5C 4LGWA 1KONA 4KT6A 1AOYA 1ZH5A 3H92A 2QWTA 1B9NA 5HS8A 1HXDA 3HTUA 4KMUX 4L5JA 1NHAA 4OWRB 2UXNA 3HOYJ 3JTGA 2L7KA 2M7BA 2LKXA 2UXHA 1ON2A 3SZTA 1XPXA 3BJBA 2V9PA 3VWBA 2UWMA 4BHBA 1WRJA 2XPWA 1TZLA 1WJCA 1ZGAA 1N75A 2EV0A 4L9JA 4B1RA 2BHZA 2WAFA 4FX4A 3VOKA 3DTEA 4ASNA 3GO5A 2EILH 4MFEA 4MTEA 1TWAJ 3RYRA 1MBJA 3VYSB 4HA8A 2WBMA 4EJUA 4KYWA 4UHTA 3BWGA 4B09A 3RKQA 6PAXA 1BL0A 5L3BA 1MMNA 3EUHA 5JVTA 1MMAA 3VIBA 2LG4A 3HE0A 5J1YA 2XAFA 1J75A 2NVQJ 3QODA 4C3IJ 1RESA 2RREA 3K69A 2ADUA 3MZ8A 5EG0B 4IQJA 1YS7A 4E7IA 3DWLE 1TWHJ 1R00A 1DP3A 3DP7A 3D1NI 4EJOA 2FJ1A 3CC4I 1MW7A 1SFKA 1D0ZA 3DF8A 3FXQA 4IOCF 3TP0A 1QPIA 2JN6A 4UUSA 1YYVA 3LA3A 2HYTA 2VN2A 3VYUB 2JRMA 1NK2P 2RGVA 4P9UA 4ETSA 2XUBA 5JHFA 2O61A 2Y30A 4XMYA 2W57A 2DTRA 4J19A 3WTSC 5FGMA 2FBHA 1IN6A 4A6DA 2K9LA 3ZMVA 2QUFA 2RKHA 5CLSA 4HX7A 1ZGJA 5EGOB 1USTA 4XLAA 3F6VA 2JMWA 1EH7A 5H20A 2VLAA 4EVIA 1N77A 3PQJA 3KP4A 2WUIA 3KLNA 4LFUA 4C2TA 1I3QJ 5IP6A 4HF1A 1WJAA 2P4WA 2HQ5A 2ZXWH 5KK1A 3VSKA 4YIRX 1IGNA 4GFBA 1CF7B 2XF6A 2A61A 4S04A 4NQWB 1OJLA 3VPRA 4YG2F 1Y1VJ 4ENJA 1DU0A 2DMQA 3G1LA 3KZZA 5EEGA 5TRDA 3BCGA 4LG0B 4UDSA 5DM7F 2KDOA 1VF9A 3F21A 1HF0A 2FBQA 1QBJA 1K4TA 1X3UA 1RUNA 3M1CA 4B48A 4N0BA 1G8XA 4G9YA 1KU9A 1T8IA 2BEOA 2MFZA 2OAZA 3RKYA 3ML6A 2ZJ2A 2RASA 1WGXA 1W0TA 3QPLA 2IP2A 4D5CA 3T1BA 3AG2H 1IXSB 4XLEA 2EQRA 1U5TC 5K7ZA 1LVKA 1HW5A 2UXIA 3D5RC 2A5YB 3F8BA 2Z3YA 1HKTA 4HF2A 3L9FA 3HYIA 2R0QC 2JTVA 2OF7A 2BHYA 3JTHA 4WXHA 5DD8A 3TW7A 5JR3A 1SC7A 3DEWA 1XD7A 4OMYA 2BGCA 2NXNB 2DMNA 3LSTA 5E3MA 1A6QA 4BE1A 3FHZA 1VI0A 2QA4I 4MHGA 3U9GA 3LSIA 3O3KA 3D5LA 3I59A 3F6OA 5E1ZB 1UFMA 2FUG2 1VQ8I 1BBYA 4ESBA 1X4PA 4ENKA 3LSJA 2VKEA 2UXUA 3OYJA 2HDDA 2O9LA 2D2WA 2IT0A 4HV6A 5M3FJ 2E35A 4M3EA 2CRGA 1MH4A 2R7FA 3KP6A 1OMIA 5JLXA 2VBYA 1X1DA 3CJQB 3FWEA 1Y1WJ 1R6RA 5DUIA 5FB2A 4A0ZA 1ZG1A 1JI8A 5B1AH 1WWXA 2ZFUA 1K61A 4ME9A 4ZDPA 5IP7J 1ZRDA 4OOIA 5FJ8J 3HZJA 1MKMA 1W1WE 3OS0A 3OYFA 1E2XA 3GWZA 3RQ4A 4GO1A 1JT0A 2HOTA 4A3GJ 3HTJA 4J00A 2LDUA 2OD5A 1PDNC 1S5LC 4WX9A 3ZR8X 1JHHA 3KPHA 1FLIA 1I6XA 4IHSA 2O03A 1QO0D 1Y0UA 4BDZA 2DDBA 3WE2A 2P5VA 1YW9A 1Z7UA 3MFKA 3F72A 2WC2A 2VB6A 3WTYC 4BS9A 4IRIA 4BYYA 1DP7P 2ZJQF 5CQEA 2MG4A 5BMZA 3ZMUA 3RTRA 4DNCA 2MLGA 3ZN1A 2XAGA 3S3NA 1XMKA 1NG6A 3R60A 2A2FX 1Z1DA 3G1MA 1YW8A 2E2IJ 3S3MA 3CP2A 3KP7A 3HUGA 4M3DA 3DLAA 1S29A 2IS2A 3HDDA 5LD2C 1HA8A 1LE8A 2CG4A 2ZCWA 2K86A 1KU3A 3TO6A 1HKQA 3PO3J 2V4JC 2VUMJ 1XMXA 1FX7A 3BZCA 3GFJA 3NXCA 1T2KA 3I53A 1GXQA 2FSWA 4LIUA 3TW6A 3JSPA 3F8MA 2CMPA 3WG7H 4HEA2 1JE8A 3G3ZA 5HODA 3BJAA 2KIQA 3Q5FA 2UXXA 4RLQA 2CQNA 1IDYA 2K3PA 3SQNA 4HLYA 1U9NA 3K1PA 3CJDA 3CCEI 2STTA 2JA7J 3S14J 3BPVA 5CVIA 2VJJA 3L09A 4XSXF 1TW2A 2NAZA 3QP5A 3BNIA 3DPLC 3AQSA 1RRJA
chains in the Genus database with same CATH topology
1JKOC 4A3MJ 3ZQFA 3KNWA 3HOXJ 2EZLA 1H88C 2REKA 5FMPA 4MK6A 4JYKA 2W53A 4L5EA 1MSFC 1FTZA 4NELA 4GCKA 1SANA 3HTHA 2XPUA 4NDLA 2ME0A 4QSHA 5C4JJ 3ZQIA 5F0FA 1T56A 4MXMA 4DYQA 2JA5J 1FIAA 2F07A 2CQQA 2K9NA 3JREA 3BTIA 5FHPA 3IUVA 3WHBA 3S2HJ 5IYDJ 3I4NJ 1IV6A 3OIOA 5F27A 4W97A 2JK3A 4XICA 5C4YA 1PUFB 1WI3A 3A02A 3GZIA 2GBYA 3G7RA 3V6GA 1ENHA 2LLKA 2K40A 3GTQJ 2NS8A 3SJMA 1ITYA 3MVPA 3CRJA 2WV1A 1SGMA 1P7IA 2NVYJ 4QIWN 2ECCA 3IH2A 1UI5A 2ELKA 1OCPA 2RHAA 4JKZA 1ETVA 1XC5A 3VVXA 2XSDC 3OSFA 2XB5A 2NX4A 2UXPA 1SFOJ 3S1RJ 3IH3A 1HCRA 4DW6A 2WB1N 4BY7J 1TWGJ 2X6OA 5EG0A 2D6YA 4CGRA 2DG8A 3BTLA 3GBGA 3QKXA 3HB9A 1MNMC 2GLOA 3B6AA 3KKCA 3RD3A 1I50J 1ETXA 3JRCA 4I6ZA 9ANTA 4XRSG 1ETYA 5FLMJ 3V78A 5E3OA 4XRSA 2R5YB 2LTPA 3G56A 3ZOBA 3LNQA 2PMZN 1IUFA 4A3EJ 2W48A 3MN2A 3TEDA 1VFCA 2X48A 2IU5A 4BKXA 2DMTA 4A3FJ 2L9RA 2M2EA 5EZGA 1HDPA 5FLVA 3QBMA 4BY1J 5C3EJ 1OFCX 2IEKA 2QOPA 2DA3A 2DA1A 4DYRA 1AKHB 3G1OA 3SDGA 3PASA 3O8GA 4IHYA 3ON2A 4HNVA 1GVDA 3A01A 4A69C 3HOWJ 2DA2A 1R9TJ 1RR7A 3GTJJ 3GTGJ 1GDTA 3VW0A 3Q0WA 5F08A 1WCMJ 2L7FP 5IOYA 3BHQA 3PM1A 2E2JJ 2K9SA 2NOGA 1UI6A 2GUHA 3HIMA 3HKZN 2M8GX 1RPWA 5EDNA 3HTAA 2LFBA 3QPSA 1HLVA 3UKGA 2EH3A 3ZQLA 2O7OA 4M3FA 4S0HB 4A3BJ 5F04A 3VUQA 3E7QA 3JRIA 2DTZA 4EEFG 2GENA 4GFKA 4JX5A 3BG5A 4FE7A 1QVTA 2L7ZA 2LK2A 4JL3A 3CWRA 5CXGA 4A3JJ 3BTCA 4JP0A 1POGA 1RKWA 1X58A 5FKKA 1U8BA 2QF7A 5CXIA 1JKRC 2CUEA 2XPVA 4V2FA 3KKDA 2WAQN 1IDZA 5HSZA 4ABZA 5F1JA 3VVZA 1BJZA 1GUUA 5J1RA 1ZR4A 1P7JA 1HOMA 1JUPA 3LSPA 3FISA 3B81A 4M3BA 1Z0XA 2ZOYA 4IEJA 2YUSA 4A3LJ 3A03A 2I10A 1B8IB 5K7HA 1MBHA 5E3LA 3VW2A 3BRUA 3CDLA 2GFNA 2X9DA 1A5JA 1XS9A 2XB0X 2ID6A 3K2AA 3NARA 1LFUP 4JX6A 2VKVA 4AC6A 1F36A 4C2MJ 1LE8B 2MGQA 4IHVA 2GM4A 1NTCA 1PUFA 3HGYA 1ZTRA 4CYCA 5EFYA 5IPAA 2R5ZA 3S1MJ 4X6AJ 4LOCA 5K7FA 3LSRA 2Y9YA 3JRFA 1MSEC 2DMUA 2JJ7A 1JJ8C 4Y7NJ 4BBSJ 1U9OA 5FKOA 4AUXA 2IAIA 3BTJA 3FK6A 4JX4A 1XG1A 2JWTA 5EEAA 2O7TA 3LOCA 2DA4A 3HBLA 1JTYA 4DZJA 2KDZA 3GTOJ 3ZQGA 2DA6A 4C3JJ 5EYRA 2LR8A 3BR0A 1YRNA 1LFBA 3EUPA 1ZKGA 4QTRA 4IHWA 2TCTA 2LP0A 4AC0A 2DN0A 2G7LA 3VOXA 4A3CJ 4GFLA 1WH7A 5M5YJ 2AHQA 1QRYA 4ICHA 3JRDA 1ORKA 2NS7A 3S16J 2NP5A 2YVEA 1O4XA 3I4MJ 1I6HJ 2CU7A 3TP3A 5IOZA 5EZHA 4DYCA 5DS9A 5C44J 2LVSA 1JGGA 5EF6A 5CW8A 5AQCA 2VPRA 4V2GA 4B3AA 2FX0A 1ETWA 1JT6A 3BR1A 2HOAA 2XRLA 2L7MP 2YVHA 1TWCJ 3H3VK 2Y0SN 3RZDJ 4JNNA 3FRQA 4FTHA 2MSYA 1HDDC 5IYCJ 3VVYA 2R5YA 1JKQC 2QWTA 1AHDP 1MBKA 3FIWA 4HKUA 2R92J 5M3MJ 4NN1A 2YS9A 3HOYJ 3NPIA 2EZHA 2LKXA 4IHXA 5E3NA 1EF4A 2UXHA 3BJBA 2UXOA 2XPWA 3HTIA 4B1RA 1IJWC 3VOKA 4XRMA 1W0UA 4Y52J 3JSJA 3LWJA 3SFIA 1WH5A 1FTTA 4MFEA 1TWAJ 3RH2A 1NK3P 1MBJA 2FD5A 5IP9J 2DJNA 1X2NA 4X1EA 1JKPC 3RKQA 3ON4A 1BL0A 1UHSA 3LHQA 3VIBA 5JLWA 3CQZJ 4XIDA 2HYJA 2QIBA 3HE0A 5J1YA 3IV5A 3WHCA 2XGCA 2NVQJ 4C3IJ 4G12A 1RESA 3O8HA 4KWAA 3NNRA 5EG0B 2JA6J 4PXIA 4FE4A 3HOVJ 1TWHJ 2CUFA 2DMPA 3GEUA 3S2DJ 3D1NI 2FJ1A 2XGEA 5FKNA 1FJLA 1CQTA 1QPIA 3TP0A 2JN6A 4UUSA 2Y9ZA 3K7AJ 1D5YA 1ZQ3P 1MBGA 2HYTA 3QQAA 1NK2P 2PZ9A 2HXOA 3Q0VA 3HEFA 4FISA 2Y30A 3EGQA 3LSGA 5M5WJ 4J19A 1B72B 3BG9A 1B8IA 4BBRJ 2HOSA 1ZR2A 3HOZJ 1ETQA 2PBXA 2IBDA 5EGOB 2ME6A 2ZOZA 2E19A 4D7MA 2JA8J 5FKMA 3BT9A 2ID3A 2JMWA 2DA5A 3IH4A 1GT0C 2OERA 3VW1A 2WUIA 3NI7A 3CCYA 4YZEA 1BW5A 1I3QJ 5DTDA 5IP6A 3OSGA 3S15J 2HQ5A 1IGNA 1Z77A 2Q24A 4GFBA 2K9QA 1RKTA 2G3BA 3RQIA 3VPRA 1OJLA 3F0CA 1Y1VJ 3H0GJ 1UG2A 2DMQA 3G1LA 1DU0A 3BCGA 4UDSA 5GPCA 5K58A 3W6VA 1ZGWA 2XDNA 1VF9A 1HF0A 1Q1VA 2FBQA 3GTMJ 3M3YJ 1BA5A 2QKOA 2N8GA 2EBIA 2EZKA 1TC3C 3BR5A 1FEXA 4XK4A 2E1OA 1GV5A 3FKIJ 2EZIA 3ZQHA 2RASA 1WGXA 1W0TA 3FK7A 1ZK8A 4GCTA 3QPLA 3Q3SA 4D5CA 4I76A 2WGBA 2EQRA 5FGLA 5K7ZA 2ZCXA 1S7EA 2R7ZJ 2UXIA 4B4CA 4BXXJ 1IG7A 4A3DJ 2R93J 2R0QC 3BG3A 3HM5A 2OF7A 2M34A 4MLOA 3TW7A 2HKUA 3DEWA 2G0EA 4UUTA 3T6NA 2MW8A 1X2MA 2CJJA 2DMNA 3M4OJ 2LY9A 1APLC 5E3MA 5J3LA 2L0KA 2H1KA 1MBEA 3O60A 3PPBA 1VI0A 3ZQCA 1RETA 4MFDA 4AYBN 1A6IA 3S5RA 5H9TA 1K83J 5IYBJ 1F43A 3COLA 4DZPA 4CYCB 2HI3A 2R5ZB 5D19A 3JRAA 1BW6A 4D5FA 3BR3A 2G7SA 1T33A 2M9HA 3LSJA 1WPKA 2VKEA 2UXUA 3Q0UA 2HDDA 2NVXJ 5GPAA 2O9LA 3GTPJ 5M3FJ 2OPTA 1JJ6C 4M3EA 3MKLA 3OOUA 2CQXA 2CRGA 1MH4A 3GTKJ 1YRNB 3BR6A 5JLXA 5FKLA 1AKHA 2M0CA 2ZCNA 1Y1WJ 1H89C 2OI8A 4MIMA 5F0HA 1JUMA 5HBUA 1DU6A 5F0CA 4D7NA 1K61A 3DCFA 5D18A 4ME9A 5IP7J 4AF5A 5FJ8J 5GP9A 5BNGA 2VI6A 1VNDA 3CMYA 5D1RA 4M6VA 3E7LA 2DG7A 4M3GA 2DA7A 3B6CA 1UMQA 1JT0A 2HOTA 4A3GJ 3HTJA 1JUSA 3RZOJ 3NRGA 1QVUA 1E3OC 2TRTA 3AQTA 4RBOA 3S17J 2D5VA 2ZB9A 4RDUA 1B72A 3C07A 2O8KA 3DPJA 2LD5A 2COBA 2Y31A 4ACIA 3BR2A 2ECBA 1ETKA 2P81A 1JTXA 2G7GA 1GV2A 5EGOA 2KT0A 3BQYA 5M5XJ 2HXIA 1AU7A 1ETOA 2MG4A 1G2HA 2QTQA 1IC8A 4MO7A 3S1QJ 2RAEA 3C2BA 3G1MA 1FIPA 2E2IJ 2AO9A 4M3DA 3L1PA 2YU9J 5J1UA 3JR9A 3HDDA 2E2HJ 1LE8A 2Y2ZA 3A01B 3JRHA 1IRZA 3ANPA 3MNLA 1OCTC 2V57A 5DAJA 3PO3J 3VP5A 2VUMJ 3JRBA 3HGGA 3HOUJ 1H8AC 4A93J 3ANGA 4GCLA 4L62A 3NXCA 1MH3A 1MBFA 3GTLJ 4C3HJ 3TW6A 4A3KJ 1U78A 5HAWA 2B63J 2NVTJ 5HODA 4UUSB 4A3IJ 3F1BA 3NAUA 1IDYA 2QCOA 2H8RA 5C4XJ 1TWFJ 3S1NJ 3P9TA 1U9NA 3CJDA 2JA7J 3BQZA 3S14J 3LJLA 3PO2J 2ZCMA 4W1UA 3KZ9A 3JRGA 2FQ4A 4FCYA 3BNIA 2NP3A 3AQSA 2XGDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JKO C;  4A3M J;  3ZQF A;  3KNW A;  3HOX J;  2EZL A;  1H88 C;  2REK A;  5FMP A;  4MK6 A;  4JYK A;  2W53 A;  4L5E A;  1MSF C;  1FTZ A;  4NEL A;  4GCK A;  1SAN A;  3HTH A;  2XPU A;  4NDL A;  2ME0 A;  4QSH A;  5C4J J;  3ZQI A;  5F0F A;  1T56 A;  4MXM A;  4DYQ A;  2JA5 J;  1FIA A;  2F07 A;  2CQQ A;  2K9N A;  3JRE A;  3BTI A;  5FHP A;  3IUV A;  3WHB A;  3S2H J;  5IYD J;  3I4N J;  1IV6 A;  3OIO A;  5F27 A;  4W97 A;  2JK3 A;  4XIC A;  5C4Y A;  1PUF B;  1WI3 A;  3A02 A;  3GZI A;  2GBY A;  3G7R A;  3V6G A;  1ENH A;  2LLK A;  2K40 A;  3GTQ J;  2NS8 A;  3SJM A;  1ITY A;  3MVP A;  3CRJ A;  2WV1 A;  1SGM A;  1P7I A;  2NVY J;  4QIW N;  2ECC A;  3IH2 A;  1UI5 A;  2ELK A;  1OCP A;  2RHA A;  4JKZ A;  1ETV A;  1XC5 A;  3VVX A;  2XSD C;  3OSF A;  2XB5 A;  2NX4 A;  2UXP A;  1SFO J;  3S1R J;  3IH3 A;  1HCR A;  4DW6 A;  2WB1 N;  4BY7 J;  1TWG J;  2X6O A;  5EG0 A;  2D6Y A;  4CGR A;  2DG8 A;  3BTL A;  3GBG A;  3QKX A;  3HB9 A;  1MNM C;  2GLO A;  3B6A A;  3KKC A;  3RD3 A;  1I50 J;  1ETX A;  3JRC A;  4I6Z A;  9ANT A;  4XRS G;  1ETY A;  5FLM J;  3V78 A;  5E3O A;  4XRS A;  2R5Y B;  2LTP A;  3G56 A;  3ZOB A;  3LNQ A;  2PMZ N;  1IUF A;  4A3E J;  2W48 A;  3MN2 A;  3TED A;  1VFC A;  2X48 A;  2IU5 A;  4BKX A;  2DMT A;  4A3F J;  2L9R A;  2M2E A;  5EZG A;  1HDP A;  5FLV A;  3QBM A;  4BY1 J;  5C3E J;  1OFC X;  2IEK A;  2QOP A;  2DA3 A;  2DA1 A;  4DYR A;  1AKH B;  3G1O A;  3SDG A;  3PAS A;  3O8G A;  4IHY A;  3ON2 A;  4HNV A;  1GVD A;  3A01 A;  4A69 C;  3HOW J;  2DA2 A;  1R9T J;  1RR7 A;  3GTJ J;  3GTG J;  1GDT A;  3VW0 A;  3Q0W A;  5F08 A;  1WCM J;  2L7F P;  5IOY A;  3BHQ A;  3PM1 A;  2E2J J;  2K9S A;  2NOG A;  1UI6 A;  2GUH A;  3HIM A;  3HKZ N;  2M8G X;  1RPW A;  5EDN A;  3HTA A;  2LFB A;  3QPS A;  1HLV A;  3UKG A;  2EH3 A;  3ZQL A;  2O7O A;  4M3F A;  4S0H B;  4A3B J;  5F04 A;  3VUQ A;  3E7Q A;  3JRI A;  2DTZ A;  4EEF G;  2GEN A;  4GFK A;  4JX5 A;  3BG5 A;  4FE7 A;  1QVT A;  2L7Z A;  2LK2 A;  4JL3 A;  3CWR A;  5CXG A;  4A3J J;  3BTC A;  4JP0 A;  1POG A;  1RKW A;  1X58 A;  5FKK A;  1U8B A;  2QF7 A;  5CXI A;  1JKR C;  2CUE A;  2XPV A;  4V2F A;  3KKD A;  2WAQ N;  1IDZ A;  5HSZ A;  4ABZ A;  5F1J A;  3VVZ A;  1BJZ A;  1GUU A;  5J1R A;  1ZR4 A;  1P7J A;  1HOM A;  1JUP A;  3LSP A;  3FIS A;  3B81 A;  4M3B A;  1Z0X A;  2ZOY A;  4IEJ A;  2YUS A;  4A3L J;  3A03 A;  2I10 A;  1B8I B;  5K7H A;  1MBH A;  5E3L A;  3VW2 A;  3BRU A;  3CDL A;  2GFN A;  2X9D A;  1A5J A;  1XS9 A;  2XB0 X;  2ID6 A;  3K2A A;  3NAR A;  1LFU P;  4JX6 A;  2VKV A;  4AC6 A;  1F36 A;  4C2M J;  1LE8 B;  2MGQ A;  4IHV A;  2GM4 A;  1NTC A;  1PUF A;  3HGY A;  1ZTR A;  4CYC A;  5EFY A;  5IPA A;  2R5Z A;  3S1M J;  4X6A J;  4LOC A;  5K7F A;  3LSR A;  2Y9Y A;  3JRF A;  1MSE C;  2DMU A;  2JJ7 A;  1JJ8 C;  4Y7N J;  4BBS J;  1U9O A;  5FKO A;  4AUX A;  2IAI A;  3BTJ A;  3FK6 A;  4JX4 A;  1XG1 A;  2JWT A;  5EEA A;  2O7T A;  3LOC A;  2DA4 A;  3HBL A;  1JTY A;  4DZJ A;  2KDZ A;  3GTO J;  3ZQG A;  2DA6 A;  4C3J J;  5EYR A;  2LR8 A;  3BR0 A;  1YRN A;  1LFB A;  3EUP A;  1ZKG A;  4QTR A;  4IHW A;  2TCT A;  2LP0 A;  4AC0 A;  2DN0 A;  2G7L A;  3VOX A;  4A3C J;  4GFL A;  1WH7 A;  5M5Y J;  2AHQ A;  1QRY A;  4ICH A;  3JRD A;  1ORK A;  2NS7 A;  3S16 J;  2NP5 A;  2YVE A;  1O4X A;  3I4M J;  1I6H J;  2CU7 A;  3TP3 A;  5IOZ A;  5EZH A;  4DYC A;  5DS9 A;  5C44 J;  2LVS A;  1JGG A;  5EF6 A;  5CW8 A;  5AQC A;  2VPR A;  4V2G A;  4B3A A;  2FX0 A;  1ETW A;  1JT6 A;  3BR1 A;  2HOA A;  2XRL A;  2L7M P;  2YVH A;  1TWC J;  3H3V K;  2Y0S N;  3RZD J;  4JNN A;  3FRQ A;  4FTH A;  2MSY A;  1HDD C;  5IYC J;  3VVY A;  2R5Y A;  1JKQ C;  2QWT A;  1AHD P;  1MBK A;  3FIW A;  4HKU A;  2R92 J;  5M3M J;  4NN1 A;  2YS9 A;  3HOY J;  3NPI A;  2EZH A;  2LKX A;  4IHX A;  5E3N A;  1EF4 A;  2UXH A;  3BJB A;  2UXO A;  2XPW A;  3HTI A;  4B1R A;  1IJW C;  3VOK A;  4XRM A;  1W0U A;  4Y52 J;  3JSJ A;  3LWJ A;  3SFI A;  1WH5 A;  1FTT A;  4MFE A;  1TWA J;  3RH2 A;  1NK3 P;  1MBJ A;  2FD5 A;  5IP9 J;  2DJN A;  1X2N A;  4X1E A;  1JKP C;  3RKQ A;  3ON4 A;  1BL0 A;  1UHS A;  3LHQ A;  3VIB A;  5JLW A;  3CQZ J;  4XID A;  2HYJ A;  2QIB A;  3HE0 A;  5J1Y A;  3IV5 A;  3WHC A;  2XGC A;  2NVQ J;  4C3I J;  4G12 A;  1RES A;  3O8H A;  4KWA A;  3NNR A;  5EG0 B;  2JA6 J;  4PXI A;  4FE4 A;  3HOV J;  1TWH J;  2CUF A;  2DMP A;  3GEU A;  3S2D J;  3D1N I;  2FJ1 A;  2XGE A;  5FKN A;  1FJL A;  1CQT A;  1QPI A;  3TP0 A;  2JN6 A;  4UUS A;  2Y9Z A;  3K7A J;  1D5Y A;  1ZQ3 P;  1MBG A;  2HYT A;  3QQA A;  1NK2 P;  2PZ9 A;  2HXO A;  3Q0V A;  3HEF A;  4FIS A;  2Y30 A;  3EGQ A;  3LSG A;  5M5W J;  4J19 A;  1B72 B;  3BG9 A;  1B8I A;  4BBR J;  2HOS A;  1ZR2 A;  3HOZ J;  1ETQ A;  2PBX A;  2IBD A;  5EGO B;  2ME6 A;  2ZOZ A;  2E19 A;  4D7M A;  2JA8 J;  5FKM A;  3BT9 A;  2ID3 A;  2JMW A;  2DA5 A;  3IH4 A;  1GT0 C;  2OER A;  3VW1 A;  2WUI A;  3NI7 A;  3CCY A;  4YZE A;  1BW5 A;  1I3Q J;  5DTD A;  5IP6 A;  3OSG A;  3S15 J;  2HQ5 A;  1IGN A;  1Z77 A;  2Q24 A;  4GFB A;  2K9Q A;  1RKT A;  2G3B A;  3RQI A;  3VPR A;  1OJL A;  3F0C A;  1Y1V J;  3H0G J;  1UG2 A;  2DMQ A;  3G1L A;  1DU0 A;  3BCG A;  4UDS A;  5GPC A;  5K58 A;  3W6V A;  1ZGW A;  2XDN A;  1VF9 A;  1HF0 A;  1Q1V A;  2FBQ A;  3GTM J;  3M3Y J;  1BA5 A;  2QKO A;  2N8G A;  2EBI A;  2EZK A;  1TC3 C;  3BR5 A;  1FEX A;  4XK4 A;  2E1O A;  1GV5 A;  3FKI J;  2EZI A;  3ZQH A;  2RAS A;  1WGX A;  1W0T A;  3FK7 A;  1ZK8 A;  4GCT A;  3QPL A;  3Q3S A;  4D5C A;  4I76 A;  2WGB A;  2EQR A;  5FGL A;  5K7Z A;  2ZCX A;  1S7E A;  2R7Z J;  2UXI A;  4B4C A;  4BXX J;  1IG7 A;  4A3D J;  2R93 J;  2R0Q C;  3BG3 A;  3HM5 A;  2OF7 A;  2M34 A;  4MLO A;  3TW7 A;  2HKU A;  3DEW A;  2G0E A;  4UUT A;  3T6N A;  2MW8 A;  1X2M A;  2CJJ A;  2DMN A;  3M4O J;  2LY9 A;  1APL C;  5E3M A;  5J3L A;  2L0K A;  2H1K A;  1MBE A;  3O60 A;  3PPB A;  1VI0 A;  3ZQC A;  1RET A;  4MFD A;  4AYB N;  1A6I A;  3S5R A;  5H9T A;  1K83 J;  5IYB J;  1F43 A;  3COL A;  4DZP A;  4CYC B;  2HI3 A;  2R5Z B;  5D19 A;  3JRA A;  1BW6 A;  4D5F A;  3BR3 A;  2G7S A;  1T33 A;  2M9H A;  3LSJ A;  1WPK A;  2VKE A;  2UXU A;  3Q0U A;  2HDD A;  2NVX J;  5GPA A;  2O9L A;  3GTP J;  5M3F J;  2OPT A;  1JJ6 C;  4M3E A;  3MKL A;  3OOU A;  2CQX A;  2CRG A;  1MH4 A;  3GTK J;  1YRN B;  3BR6 A;  5JLX A;  5FKL A;  1AKH A;  2M0C A;  2ZCN A;  1Y1W J;  1H89 C;  2OI8 A;  4MIM A;  5F0H A;  1JUM A;  5HBU A;  1DU6 A;  5F0C A;  4D7N A;  1K61 A;  3DCF A;  5D18 A;  4ME9 A;  5IP7 J;  4AF5 A;  5FJ8 J;  5GP9 A;  5BNG A;  2VI6 A;  1VND A;  3CMY A;  5D1R A;  4M6V A;  3E7L A;  2DG7 A;  4M3G A;  2DA7 A;  3B6C A;  1UMQ A;  1JT0 A;  2HOT A;  4A3G J;  3HTJ A;  1JUS A;  3RZO J;  3NRG A;  1QVU A;  1E3O C;  2TRT A;  3AQT A;  4RBO A;  3S17 J;  2D5V A;  2ZB9 A;  4RDU A;  1B72 A;  3C07 A;  2O8K A;  3DPJ A;  2LD5 A;  2COB A;  2Y31 A;  4ACI A;  3BR2 A;  2ECB A;  1ETK A;  2P81 A;  1JTX A;  2G7G A;  1GV2 A;  5EGO A;  2KT0 A;  3BQY A;  5M5X J;  2HXI A;  1AU7 A;  1ETO A;  2MG4 A;  1G2H A;  2QTQ A;  1IC8 A;  4MO7 A;  3S1Q J;  2RAE A;  3C2B A;  3G1M A;  1FIP A;  2E2I J;  2AO9 A;  4M3D A;  3L1P A;  2YU9 J;  5J1U A;  3JR9 A;  3HDD A;  2E2H J;  1LE8 A;  2Y2Z A;  3A01 B;  3JRH A;  1IRZ A;  3ANP A;  3MNL A;  1OCT C;  2V57 A;  5DAJ A;  3PO3 J;  3VP5 A;  2VUM J;  3JRB A;  3HGG A;  3HOU J;  1H8A C;  4A93 J;  3ANG A;  4GCL A;  4L62 A;  3NXC A;  1MH3 A;  1MBF A;  3GTL J;  4C3H J;  3TW6 A;  4A3K J;  1U78 A;  5HAW A;  2B63 J;  2NVT J;  5HOD A;  4UUS B;  4A3I J;  3F1B A;  3NAU A;  1IDY A;  2QCO A;  2H8R A;  5C4X J;  1TWF J;  3S1N J;  3P9T A;  1U9N A;  3CJD A;  2JA7 J;  3BQZ A;  3S14 J;  3LJL A;  3PO2 J;  2ZCM A;  4W1U A;  3KZ9 A;  3JRG A;  2FQ4 A;  4FCY A;  3BNI A;  2NP3 A;  3AQS A;  2XGD A; 
#chains in the Genus database with same CATH topology
 2ZSH B;  1U6G A;  4BHP A;  3KNW A;  1R23 A;  3V7C A;  1WKM A;  2KLO A;  2ZBK A;  2J5P A;  1U5T A;  4OIR F;  4PUS A;  4XNF A;  1H88 C;  1ZHF A;  5B3S H;  2IJL A;  2P5K A;  3IRR A;  1MSF C;  1FTZ A;  3AG4 H;  1PVE A;  3FBN B;  1L3L A;  2OTJ I;  3CP8 A;  3HTH A;  2XPU A;  3C1D A;  3FM5 A;  2ME0 A;  1RI7 A;  1I1S A;  1T56 A;  5DCM B;  1WSU A;  2R7V A;  1FIA A;  1W5C C;  4ZYE A;  4E7J A;  3TDZ C;  3JRE A;  1BR4 A;  2DU9 A;  3DBR B;  1QA6 A;  1IV6 A;  3I4N J;  2KP6 A;  5F27 A;  2F5E A;  4XIC A;  4MQ9 F;  4PSW A;  1PUF B;  1IV8 A;  2FQ3 A;  1YJN I;  2A6E F;  3V4G A;  2RQQ A;  3G7R A;  1ENH A;  2LLK A;  2K40 A;  3GFI A;  3DTK A;  4HDU A;  2KJC A;  3RJP A;  4G8X A;  3HRT A;  1MD0 A;  2WV1 A;  2IS4 A;  1RZ4 A;  1LUJ B;  2HVQ A;  1MMG A;  2GA1 A;  1W7P A;  3PUF A;  4F92 B;  3PQK A;  2NVY J;  3IH2 A;  4E7K A;  2MC3 A;  2R7W A;  3I55 I;  3IWZ A;  1XMA A;  2DQL A;  2FE3 A;  1S72 I;  5J47 A;  3NS4 A;  2XSD C;  2PG4 A;  3OSF A;  2KFD A;  5EEH A;  1OYY A;  3OR1 C;  3FXO A;  3SWH A;  3GZ6 A;  2UXP A;  1HCR A;  2WB1 N;  2HR3 A;  3H35 A;  2DFF A;  5BQT A;  5EG0 A;  4XLF A;  2D6Y A;  2BY1 A;  2P6T A;  3DV8 A;  1K6Y A;  3E6B A;  1QZE A;  1SAU A;  3R4K A;  4CIC A;  1MNM C;  2Z2S B;  2ZC2 A;  5CKT A;  4CCK A;  3CCU I;  9ANT A;  4NNJ A;  2FF4 A;  3RI4 A;  2EK5 A;  5HDG A;  2DJI A;  5J8F A;  2LTP A;  2WA0 A;  2PMZ N;  1IUF A;  2L4A A;  1B4A A;  1B9M A;  1R1U A;  1EJ9 A;  2M2E A;  5EZG A;  4YFX F;  2DOE A;  4OAY A;  5IT3 A;  5C3E J;  2CFX A;  4HX4 A;  2DA3 A;  2DQR A;  5D5V B;  4Y13 A;  2GAU A;  1R5I D;  5K5R A;  4EGY A;  1J0R A;  4IHY A;  5E17 F;  3OR2 C;  1GVD A;  2DW4 A;  2W00 A;  2DA2 A;  3SZG A;  2KMU A;  1RR7 A;  3GTJ J;  2XF5 A;  3VW0 A;  2YPR A;  5F08 A;  2L7F P;  1W5T A;  4R1H A;  3W2V A;  3PM1 A;  1D5V A;  3LSK A;  3J81 K;  2K9S A;  2BXZ A;  2OQR A;  2R7R A;  1KQ8 A;  4NQW A;  2BVM A;  4HYE A;  1RPW A;  2M8G X;  2PFB A;  4PJJ A;  4CSW A;  1FBU A;  2LFB A;  3GZN B;  2CS3 A;  3L2U A;  2VJI A;  4KIC A;  1X1P A;  4GYI A;  2R7O A;  2EH3 A;  2AQE A;  3ZQL A;  1R49 A;  2E5Z A;  5LHG A;  3GVA A;  4GFK A;  2GEN A;  2IGK A;  4JX5 A;  2L7Z A;  3CWR A;  4M73 A;  3PJR A;  3ERM A;  5CXG A;  1XX5 A;  4MNU A;  1POG A;  1R4M B;  2M3A A;  2IS1 A;  3TQN A;  4LIV A;  2EFO A;  5LHI A;  2CUE A;  1IN8 A;  3FXJ A;  2V1D A;  4ABZ A;  4YIF A;  3VVZ A;  4UNO A;  1H9G A;  3B81 A;  4M3B A;  1V4R A;  4UB6 C;  2ZOY A;  2YUS A;  5GAH J;  2HDC A;  5K7H A;  1MBH A;  3VW2 A;  3U2R A;  1Z67 A;  5JVG F;  1VQP I;  4UVB A;  4S05 A;  3OY9 A;  3CCV I;  5KHD A;  4U9L A;  1F36 A;  1MDM A;  1KQ9 A;  2E1M B;  1K78 B;  3BG6 A;  3M8F A;  2GM4 A;  2OZ6 A;  1BIA A;  1ZTR A;  5F1R A;  3S1M J;  1R36 A;  4KN4 X;  2Y9Y A;  3F23 A;  1YJ9 I;  2DMU A;  3CDH A;  1XGO A;  3IP4 B;  1JJ8 C;  4HX8 A;  3BTJ A;  2VT2 A;  3FK6 A;  3QPT A;  2JWT A;  2VOP A;  1XSV A;  4XR6 A;  3NWS A;  2AS5 F;  3QOP A;  2XAJ A;  4KIG A;  1DUX C;  3GTO J;  3COA C;  3GW2 A;  4F7Z A;  2FMY A;  2NVU B;  5ICG A;  3BR0 A;  2G7U A;  4HW0 A;  2PFV A;  2LP0 A;  4A5N A;  1CGP A;  5B66 C;  4Y3O A;  4R79 A;  4QPQ A;  4A3C J;  3H5N A;  4RM3 A;  2VBZ A;  2M5W A;  1EKE A;  4ICH A;  2VJ5 A;  3DPU A;  4AIK A;  2NS7 A;  2YVE A;  3I4M J;  3LQQ A;  4CDG A;  5HLG A;  5EZH A;  3BCB A;  1KU7 A;  2L2O A;  2H94 A;  5C44 J;  5AQC A;  1ZRF A;  4PSX A;  2K7L A;  3FXK A;  2IPQ X;  3BR1 A;  4XLC A;  2HOA A;  2HGC A;  2K5C A;  3J7Z I;  4CGZ A;  2BW3 B;  2WY7 Q;  2M1B A;  1TWC J;  2P6S A;  3H3V K;  2EV5 A;  3FRQ A;  2A5W A;  4FTH A;  3CES A;  2MSY A;  1HDD C;  4RGR A;  5IYC J;  2CQ7 A;  2R5Y A;  2HWV A;  4P5O A;  3CF5 F;  3MCZ A;  3MQ0 A;  1MBK A;  4MGR A;  1AA7 A;  4O6J A;  2YS9 A;  3QPH A;  3HXL A;  3NPI A;  4HDV A;  5L3D A;  4U0V A;  4KA4 A;  2P0W A;  3I59 B;  5E3N A;  5IT9 K;  3L2Q A;  2UXO A;  1IJW C;  1LDJ A;  1OKR A;  4XRM A;  2XAH A;  4Y52 J;  1KA8 A;  1X3W B;  3JSO A;  3SFI A;  3JAM Z;  3ZMZ A;  1WH5 A;  1FTT A;  5IP9 J;  5BOX A;  2DK5 A;  3GYH X;  2EJR A;  3J7A Y;  3ON4 A;  3HKZ A;  4H4K C;  1VQK I;  2OCC H;  4MTD A;  5HDN A;  1P92 A;  3SEQ A;  3LHQ A;  4IOA F;  2VPL A;  5FO5 A;  2IXS A;  3X2Q H;  4ZDL A;  3TO7 A;  2QIB A;  2HFH A;  1XGM A;  3O2P E;  1MNE A;  2QWW A;  3WHC A;  2ZJR F;  4M9S A;  3O8H A;  2TDX A;  5GAG J;  3CCL I;  4PXI A;  3KP5 A;  3HOV J;  2CUF A;  3FKJ A;  2DMP A;  5ICC A;  1PP7 U;  2EA2 A;  3OYH A;  2KZV A;  1E17 A;  2MBF A;  1X19 A;  2X6Y A;  1OCO H;  3QOE A;  1CQT A;  2QSG X;  3WTV C;  2LMD A;  3G4S I;  3KE2 A;  4K2E A;  2PZ9 A;  2HXO A;  2A07 F;  3HEF A;  4LMY A;  3TBI A;  4U0Y A;  3LSG A;  5M5W J;  2XAU A;  1HSJ A;  3BG9 A;  1HST A;  1UZC A;  3UNG C;  3KP3 A;  1TTY A;  4WK8 F;  1FMW A;  1ZR2 A;  3B73 A;  1KQ0 A;  4N4N B;  4BJ6 C;  4U9N A;  2XDV A;  4DJA A;  1OCZ H;  4HNT A;  5ILV A;  2CV1 A;  2ME6 A;  4D7M A;  4G94 A;  2ID3 A;  1FYM A;  4AVZ A;  3A0B C;  4NC8 A;  2A05 A;  2ISZ A;  4YZE A;  1FBS A;  2KJB A;  5DYM A;  3BC8 A;  1QNT A;  1Z77 A;  2L54 A;  3DKY A;  3C2H A;  1F1Z A;  1MND A;  4PDK A;  3RQI A;  3H0G J;  1UG2 A;  5K58 A;  3QU6 A;  4XBF A;  2VXZ A;  3DXJ F;  1ZGW A;  2OCE A;  5TIS C;  1Q1V A;  2DO7 A;  1WI9 A;  3BPX A;  1KU2 A;  1SVL A;  2N8G A;  4KIB A;  2VBW A;  4GCV A;  2GIV A;  2EZI A;  3OYG A;  4CZC A;  4M9X A;  4RAY A;  3ZP5 A;  2IRF G;  1HBX G;  2ZCX A;  3KYL A;  1G3T A;  3GX4 X;  4DQ2 A;  4BXX J;  2RN7 A;  1SEU A;  1IG7 A;  4A3D J;  4Y15 A;  4E7L A;  4NUB A;  2PMU A;  3BG3 A;  3HM5 A;  2BXY A;  4XM3 A;  2EB7 A;  1Y56 A;  3OIQ A;  2G0E A;  2FRH A;  4Y17 A;  4P9F A;  2FBK A;  1QQI A;  1U5T B;  2EPF A;  2L0K A;  2BZT A;  1MBE A;  2B7E A;  5J3L A;  3RKW A;  5J8C A;  1K4S A;  4ZZD A;  3ZQC A;  3FMQ A;  2V1N A;  4MFD A;  4PK4 A;  1YIJ I;  3DEE A;  2EA4 A;  3QYB A;  3HSR A;  5H9T A;  3F22 A;  1VQO I;  1K83 J;  2HKX A;  2VC0 A;  2Z99 A;  3KEY A;  3FBI B;  4EV0 A;  1BC7 C;  3COL A;  2R5Z B;  3VB2 A;  4A5M A;  2R7S A;  5D19 A;  1BW6 A;  2E7X A;  3PNT A;  4D5F A;  2PMZ A;  3J81 Z;  3BR3 A;  4TV7 A;  3SYT A;  1T33 A;  1WPK A;  2B0L A;  3MKY B;  1QHH D;  2NVX J;  1P4A A;  3SDB A;  2NS0 A;  2OPT A;  5K5O A;  4HQM A;  3R6S A;  1DDN A;  2GXG A;  2CQX A;  2L5Q A;  3F3X A;  2M0C A;  3CUQ C;  1H89 C;  2H27 A;  2OI8 A;  3FXL A;  1W7P B;  3K4L A;  1X1B A;  2DFI A;  1UCR A;  2L01 A;  1DU6 A;  1J5Y A;  1SMY F;  5F0C A;  4D7N A;  4C30 A;  3VTI A;  1BN5 A;  2F6C A;  4EM0 B;  5BNG A;  2VI6 A;  3IHU A;  5DM6 F;  1TNS A;  5D1R A;  4M6V A;  1Z3X A;  3HTS B;  5E8I A;  4BQN A;  2CUJ A;  3B6C A;  3C3W A;  4WXC A;  3LFK A;  1JUS A;  4ZYG A;  3RZO J;  1HKS A;  1FOX A;  3NRG A;  2TRT A;  2VC1 A;  4HST A;  3AQT A;  3RPU D;  2P8T A;  3S17 J;  2ZB9 A;  2WTE A;  1B72 A;  1W36 C;  1GHC A;  4XOR A;  4F55 A;  2LD5 A;  1K7A A;  5HS7 A;  3BR2 A;  2AXL A;  1ZLK A;  2QM3 A;  4EM2 A;  2G7G A;  5LFA A;  4NHJ A;  4CCM A;  2FJI 1;  4AIJ A;  2QGU A;  1ETO A;  3E3V A;  4RS8 A;  3GUD A;  4HSR A;  5AON A;  1W7P D;  2PEX A;  1IC8 A;  3ZGK A;  4NC7 A;  3FMS A;  4P96 A;  3CO6 C;  5B5E C;  1J2X A;  2AO9 A;  4OIN F;  3L1P A;  1XB4 A;  3HL2 A;  3EYY A;  1XCB A;  1K78 A;  3MNL A;  3JRH A;  3DBH B;  3KCC A;  2V79 A;  3S93 A;  3HOU J;  3HGG A;  4A93 J;  4GCL A;  4L62 A;  4AWX B;  1ERD A;  2LF7 A;  1MBF A;  2JA2 A;  4C3H J;  5F64 A;  3GTL J;  1U78 A;  1T98 A;  4HG2 A;  1Z6T A;  1Z21 A;  4F3Q A;  1JHF A;  2DLL A;  2QCO A;  5C4X J;  1TWF J;  3S1N J;  2BOL A;  4ZZL A;  1YHQ I;  3BQZ A;  1XN7 A;  3L7W A;  3TKY A;  3LJL A;  1G3W A;  4W1U A;  4YFN F;  2BBY A;  3M07 A;  4UV8 A;  4FCY A;  1IAW A;  2NP3 A;  1I39 A;  3CC2 I;  3HOX J;  5IT9 Z;  1ZEL A;  1BM9 A;  2EIN H;  5GTI C;  4AD9 A;  1VQL I;  1V55 H;  3ZMT A;  2DXI A;  3MWM A;  1LEA A;  4NEL A;  3H3U A;  4HBL A;  2BW3 A;  4NDL A;  3M8J A;  1F5T A;  3M1E A;  1R58 A;  2HU9 A;  3OL4 A;  3GME A;  2K9N A;  1I3A A;  2CFO A;  1BR1 A;  5FHP A;  4HZF A;  3IUV A;  3GCM A;  4XKV A;  3WHB A;  1YFH A;  3OIO A;  1FYK A;  1MDM B;  2A69 F;  2YX7 A;  3PFY A;  3NRV A;  4BXF A;  5C4Y A;  3K4N A;  1G3Y A;  1Y6I A;  3H3Z A;  4KNY A;  1WI3 A;  2CYY A;  3A02 A;  3V6G A;  2WV0 A;  2P7C B;  4PGG A;  5KAI C;  3LA2 A;  3GTQ J;  2V7F A;  3FZV A;  1HW1 A;  3LAJ A;  1GXP A;  1U0J A;  5ILS A;  3TOA A;  1RNL A;  1R5H A;  1TP4 A;  1V5E A;  4BE0 A;  4MEY F;  3QP6 A;  1FY7 A;  1UI5 A;  5D4S A;  4JKZ A;  4V19 K;  4HV5 A;  1XC5 A;  3IAS 2;  1O7L A;  1A31 A;  3CUQ A;  4N9I A;  2VOO A;  1X1A A;  2RDP A;  3OOP A;  2XB5 A;  3REO A;  5JHU A;  3H5R A;  2H6B A;  1SFO J;  4E7S A;  1LB2 A;  2NOJ B;  3F8C A;  4JK1 X;  1TWG J;  2X6O A;  4LIT A;  4CGR A;  1XDS A;  3K9T A;  3TO9 A;  1P4W A;  3FDY A;  4CYD A;  1WZ2 A;  3L00 A;  3VOE A;  2GLO A;  3KKC A;  4WIB A;  3SFZ A;  3N4M A;  3V78 A;  3QU3 A;  2WAD A;  1ZAO A;  4XRS A;  2R5Y B;  3WTU C;  4RM2 A;  3G56 A;  1C0W A;  4A3E J;  4CXF A;  3TED A;  1VFC A;  4BKX A;  2HZD A;  3HOT A;  5L3E A;  3T8R A;  3AL0 C;  1V3F A;  2QKM B;  2W85 A;  3H1C A;  2QOP A;  2K27 A;  3MEX A;  3PAS A;  2JVG A;  3O8G A;  2GQQ A;  3CJN A;  4AIH A;  1OQY A;  3BZ6 A;  3V8L A;  3A01 A;  2CGP A;  3V42 A;  1AWC A;  2FA5 A;  3GTG J;  2A3S A;  3Q0W A;  3W2A A;  4CCJ A;  2CW8 A;  5DEQ A;  3BHQ A;  2E60 A;  1FMV A;  2E2J J;  1IO2 A;  2ISY A;  4E70 A;  1UI6 A;  3CF2 A;  3HIM A;  3HKZ N;  1T38 A;  3HTA A;  3ONQ A;  5EDN A;  3JCU C;  3ZRG A;  3QPS A;  3FM3 A;  5DCF A;  1HLV A;  3K1N A;  3UKG A;  2ZNZ A;  1MMD A;  2O7O A;  4S0H B;  4A3B J;  1LNW A;  5F04 A;  3VUQ A;  3E7Q A;  3JRI A;  2DTZ A;  2CUZ A;  1QVT A;  5HVQ C;  1ZG3 A;  4D0P A;  4KFC A;  1B1B A;  4ENN A;  1K6O A;  3BDD A;  5E20 A;  1IDZ A;  4DBQ A;  1DGR M;  4GXO A;  2M7A A;  5A2Q K;  5F1J A;  1X3Z B;  2V1U A;  4XSZ F;  2R7Q A;  3FIS A;  5J6X A;  1E3H A;  1FNN A;  1D1A A;  2ZXJ A;  2HDW A;  2FNA A;  2XVC A;  3HPH A;  5CYV A;  3WG9 A;  4A3L J;  3VYR B;  2I10 A;  4P1W A;  5E3L A;  4E4H A;  1ACI A;  2P7V B;  2QQB A;  2HTS A;  5L3F A;  3FHN A;  2XRN A;  3I3L A;  1A5J A;  2XB0 X;  2W7N A;  1LFU P;  4ANJ A;  1FBQ A;  5KVR A;  1LVA A;  1O3Q A;  4XON A;  1SD6 A;  2PI0 A;  2MH2 A;  4FET A;  2KRF A;  2VQC A;  2CSO A;  3N05 A;  2Z33 A;  2R5Z A;  4X6A J;  2DFH A;  3CDI A;  3V7R A;  2W1O A;  4U7D A;  3OYM A;  1Z6R A;  3EQL F;  4B8X A;  4BBS J;  2ESN A;  3OIP A;  3RPU A;  4AUX A;  4JX4 A;  5EEA A;  2MYS A;  3LOC A;  3ASN H;  3I64 A;  3K2Z A;  3HBL A;  2LBF B;  2KDZ A;  3GLL A;  5D8K B;  3ABL H;  3T8T A;  4L18 B;  2LR8 A;  4AVP A;  1ZKG A;  4QTR A;  1QZZ A;  4ZYD A;  2ETH A;  2NRA C;  1JGS A;  4G6Q A;  4AC0 A;  2DN0 A;  2DT5 A;  3M9A A;  4GFL A;  1WH7 A;  2K4J A;  5CVR A;  5M5Y J;  3H9Q A;  3GEZ A;  1FYL A;  1IRF A;  3BJ6 A;  5ERI A;  3H9J A;  3S16 J;  4PJL A;  4CUG A;  1I6H J;  1YQA A;  2E7W A;  5HLH A;  2B9S A;  1D8J A;  4EM1 A;  5EF6 A;  2CQK A;  4RLF A;  3JW4 A;  2L02 A;  4XLN F;  5GTH C;  4Z2Y A;  1MMS A;  1FC3 A;  2XRL A;  4RAG A;  3MZH A;  2YVH A;  2G9W A;  3RZD J;  5FFZ A;  2IA0 A;  2RQP A;  1AHD P;  1MZB A;  2JRT A;  1Y39 A;  5M3M J;  3I9V 2;  4HF0 A;  2G7H A;  1OIS A;  4IVN A;  1EF4 A;  4RB3 C;  2D1V A;  4G6D A;  3HTI A;  5FLX K;  3BJO A;  2ZKZ A;  1W0U A;  3JSJ A;  5H6R A;  1YX3 A;  4BDY A;  1NK3 P;  2MD5 A;  4KIS A;  3M8E A;  3DKW A;  1UHM A;  1X2N A;  1BR2 A;  4X1E A;  1JKP C;  3KET A;  1KYZ A;  1F9N A;  1UHS A;  3J80 K;  4IRG A;  5JLW A;  4XID A;  3IV5 A;  2VON A;  1OCR H;  2XGC A;  1Y8Q B;  4G12 A;  4KWA A;  1YTY A;  4FAS D;  1IF1 A;  2GXB A;  3GEU A;  1I1G A;  3BRO A;  3S2D J;  1G6N A;  2EIM H;  2WAQ A;  2W24 A;  3F8F A;  4OMZ A;  5FKN A;  3H0D A;  1FJL A;  3H9G A;  2EFW A;  3ZQQ A;  5CJ9 A;  1ZQ3 P;  2O8X A;  3EDP A;  2X1D A;  4BQQ A;  3QQA A;  2P5L C;  2ELJ A;  2STW A;  4GYG A;  4FIS A;  3EGQ A;  3I58 A;  3L2V A;  2O0Y A;  1B72 B;  2VKD A;  1VTN C;  3GLX A;  4BBR J;  5H6Q A;  2HOS A;  1RR8 C;  1ETQ A;  2QKL B;  1D1B A;  2PBX A;  3ECH A;  2Q1Z B;  2KZG A;  4HPQ A;  2JUG A;  4BU2 A;  4DGW B;  4CHU A;  4DVY P;  3RKX A;  3T0Y A;  2E19 A;  4FX0 A;  1X1C A;  2JA8 J;  4QLC U;  3IH4 A;  2XKP A;  1GT0 C;  1DPR A;  3IC7 A;  3VW1 A;  3NI7 A;  1S6L A;  5KAF C;  5DTD A;  3S15 J;  4I2O A;  4BHC A;  2K9Q A;  3LL7 A;  1RKT A;  4I0A A;  1WJD A;  2G3B A;  3F0C A;  4YII A;  2R7U A;  3CMM A;  1REP C;  2DDA A;  2H6C A;  2HKO A;  2DOD A;  5GPC A;  2PLY A;  2XDN A;  3G2B A;  4XQF A;  3KEQ A;  1U3E M;  2DYR H;  3GTM J;  1SD5 A;  1ZN2 A;  2EBI A;  2EZK A;  3ELK A;  4XK4 A;  2ESH A;  1TT0 A;  2E1O A;  3NWT A;  4EAT A;  3OYL A;  3P7N A;  3K4J A;  3FK7 A;  3F8N A;  4GCT A;  4FQG A;  4IJA A;  3C2G A;  3Q3S A;  2KIF A;  4I76 A;  5GAE J;  2FOW A;  1IN5 A;  5FGL A;  1KZH A;  3ECO A;  1R1V A;  4B4C A;  3CLQ A;  1YO5 C;  5LBQ A;  4UY8 I;  2R93 J;  2Y0S A;  2AXT C;  4MLO A;  2HKU A;  4Y33 A;  4UUT A;  4CA0 A;  1DPU A;  3LSH A;  2MW8 A;  1ZRC A;  1X2M A;  4II2 A;  2A68 F;  3QAH A;  4HOB A;  1SMT A;  2H1K A;  3O60 A;  2DOF A;  3DPT A;  1G59 A;  2A6H F;  5D6F A;  2M8E A;  3S5R A;  1A6I A;  3ZXS A;  2ACJ A;  3ESW B;  2X0L A;  3BOQ A;  5IYB J;  4A12 A;  1K79 A;  1MIJ A;  2EFQ A;  4XLP F;  4DZP A;  1F4K A;  3MAJ A;  2M30 A;  3JRA A;  4Q47 A;  3PUB A;  2G7S A;  2LH9 A;  2M9H A;  4Q48 A;  4M6X A;  3Q0U A;  3ABT A;  4JQF A;  3WTZ A;  5GPA A;  5E79 C;  3HHH A;  1WJB A;  1UHW A;  1YG2 A;  2M0M A;  5TJJ A;  1JJ6 C;  3GTP J;  3OS1 A;  3OOU A;  2W82 A;  3BCA A;  3LQR A;  1UJ8 A;  4BJT A;  3BR6 A;  4M71 A;  2OU2 A;  4IF4 A;  1FSH A;  3S8P A;  2ZCN A;  3Q9V A;  4UXN A;  1JUM A;  5F0H A;  1B6A A;  1TL8 A;  4OIP F;  3DKX A;  3ZQ7 A;  3DCF A;  5A2Q Z;  1FOW A;  1QGP A;  1XGN A;  2GZW A;  4A0Y A;  5GP9 A;  3CUQ B;  1VND A;  4GGG A;  5LGU A;  1V54 H;  3B02 A;  1O57 A;  4M9Z A;  1E3P A;  2DG7 A;  4M3G A;  2E71 A;  1KYW A;  2GOM A;  4U7B A;  3CJT B;  4M72 A;  4KIT B;  1QVU A;  3WU1 B;  2IGM A;  5GAD J;  5HNF A;  2D5V A;  4RDU A;  3C07 A;  2IW5 A;  3KFW X;  4IX7 A;  2PX9 A;  3DPJ A;  2HOE A;  1NG7 A;  2EFP A;  3WGI A;  2GOX B;  2Y31 A;  1JTX A;  3EUH C;  3MD2 A;  1GV2 A;  1OLT A;  2OBP A;  5L3G A;  3T5X A;  2KT0 A;  2R7D A;  1AU7 A;  4ZYA A;  3LSM A;  4AU7 A;  1OYI A;  4L0Y B;  4H0E A;  3S1Q J;  4MO7 A;  2KRH A;  1USS A;  5FRM A;  2RAE A;  5CVU A;  5CPR B;  1FIP A;  4M6Y A;  2K02 A;  4F52 A;  3JR9 A;  2HVR A;  4ITV A;  3FXR A;  2HQA A;  4DIQ A;  5L3C A;  1FZP B;  2VXD A;  3A01 B;  4BUP A;  4CCN A;  2VOD A;  1YX5 A;  3KZY A;  2Y48 A;  3MMY B;  1OCT C;  5DAJ A;  3DFG A;  3VP5 A;  2DAO A;  2IA1 A;  2BVL A;  4HAM A;  3EET A;  5FFX A;  2FXA A;  3I54 A;  3V8J A;  1MH3 A;  4L0Z B;  1NH3 A;  3S2W A;  4B43 A;  5HAW A;  3OS2 A;  2L4M A;  4A3I J;  1TNT A;  2H8R A;  2LBF A;  3P9T A;  4O5V A;  2Z9O A;  4A2U A;  4BAC A;  2DYS H;  2ZCM A;  5J4V A;  3R61 A;  4E7H A;  3CJR B;  4KIF A;  2FQ4 A;  3KZ9 A;  3ULQ B;  2XGD A;  4A3M J;  4IRV A;  3ZQF A;  5LGN A;  3MKW B;  3FF5 A;  1W36 D;  3VSL A;  1WJF A;  1IRX A;  4AYB A;  5FLX Z;  3E6D A;  4PZJ A;  2LY2 A;  3IRQ A;  5FMP A;  2WY8 Q;  3PNV A;  3OYA A;  2UV1 A;  4LJZ F;  3K10 A;  4QPO A;  3KLO A;  5LRS A;  4RA2 A;  3E5Q A;  1QZY A;  2D1H A;  4PCQ A;  3TDU C;  5D5X B;  2PMH A;  3DLL F;  4QSH A;  2R3S A;  3ZQI A;  2MLK A;  5F0F A;  4JBA A;  2HVS A;  3KIO A;  2JUC A;  3SHF A;  2JA5 J;  4M74 A;  1IRG A;  3J80 Z;  2NNY A;  2YSR A;  3S2H J;  2YR2 A;  3D5S C;  1XSD A;  4W97 A;  4XL9 A;  3HRU A;  2JK3 A;  3RPQ A;  1SAX A;  1VQ7 I;  4I09 A;  2ZXI A;  2GBY A;  2CWE A;  2OV7 A;  2HEO A;  1IXR C;  1TT5 B;  3E97 A;  3P9K A;  3MKZ A;  1ODD A;  3G6E I;  3SJM A;  1ZRE A;  1L0O C;  2R7T A;  3MVP A;  1ITY A;  2ELH A;  2RNG A;  5LHH A;  3AG3 H;  1WHU A;  1SGM A;  1P7I A;  3VEP A;  1FT9 A;  4QIW N;  3LWF A;  4BQO A;  2IS6 A;  2F5F A;  2UUZ A;  1OCP A;  1FOY A;  1ETV A;  3AG1 H;  3VVX A;  3N97 A;  4LLL A;  3M7G A;  4NB5 A;  1G3S A;  4B47 A;  5CVJ A;  2NX4 A;  5BS6 A;  2L9N A;  3S1R J;  3I5U A;  3IH3 A;  3HRM A;  4DW6 A;  4GRI A;  4BY7 J;  3TL4 X;  5BPI A;  2JQ7 A;  2DG8 A;  4PJ0 C;  2BY3 A;  2FML A;  3FXM A;  3K4B A;  5D6E A;  3SZP A;  3CCM I;  4ESF A;  1TQI A;  3HB9 A;  3OYK A;  2C6Y A;  3B6A A;  2B1E A;  3GZ5 A;  4F91 B;  5FLM J;  3IL2 A;  3NEU A;  4D1Q A;  4IKF A;  2X6X A;  4ZC3 A;  5E3O A;  2YX4 A;  2L9S A;  5AIQ A;  1YJW I;  2PN6 A;  3ZOB A;  3LNQ A;  3MN2 A;  2PJR B;  1Y8R B;  2IU5 A;  1H0M A;  2DMT A;  4A3F J;  2YVX A;  5JFR A;  2VL8 A;  1HDP A;  2D45 A;  3QBM A;  1BOB A;  4BY1 J;  2QQ9 A;  1OFC X;  2IEK A;  1VQ4 I;  2XHK A;  2KIM A;  2XRO A;  2DA1 A;  3I71 A;  1AKH B;  3G1O A;  1YE9 A;  3WTW C;  3ABM H;  3K4M A;  4C2U A;  4BQA A;  2KL4 A;  3LA7 A;  4HNV A;  4WF2 A;  4A69 C;  3AL0 B;  1R9T J;  3HOW J;  3GFL A;  4PJM A;  3R0A A;  1GDT A;  4G6T B;  4ZYH A;  1WCM J;  5IOY A;  1WJ5 A;  3BG7 A;  2HPI A;  2NOG A;  2GUH A;  5H2F C;  1N78 A;  4Q5S F;  4EGZ A;  3CO7 C;  3IAM 2;  1D0Y A;  1OYW A;  2LKP A;  1YI2 I;  2JPC A;  2QYO A;  3DEU A;  2K3F A;  4ON0 A;  1Z05 A;  2COM A;  3K4K A;  4EMS A;  1IN7 A;  1MJ9 A;  3LFU A;  4UB8 C;  4EEF G;  4YRV A;  2V26 A;  4FE7 A;  4EQQ A;  2LK2 A;  5HNH A;  2QVO A;  3BTC A;  3CCJ I;  3LAP A;  1RKW A;  2QF7 A;  5CXI A;  4V2F A;  2WAQ N;  2ZNY A;  5ICE A;  1B59 A;  5K5Q A;  2Q2E B;  3I0T A;  3W6J B;  3BLY A;  4IL6 C;  1GUU A;  2GXA A;  3LSP A;  5TGT A;  3HSE A;  2O5R A;  4IEJ A;  3KX2 A;  4RB1 A;  3UR3 C;  2F2E A;  3A03 A;  2KKO A;  2MD0 A;  4XOP A;  2M45 A;  1KGS A;  1ZLJ A;  3HSF A;  1T0F C;  1FOK A;  2VIX A;  2X9D A;  2Z5U A;  3AFH A;  2VT3 A;  3NAR A;  3HPG A;  4BEH A;  4BNC A;  4JX6 A;  2VKV A;  4AC6 A;  4WWC A;  1T6S A;  2MGQ A;  4IHV A;  4NBQ A;  1NTC A;  3ABK H;  3HGY A;  5HLI A;  3IWF A;  5EFY A;  2E5N A;  1DQU A;  4LOC A;  3ROU A;  3LSR A;  3K70 D;  5FD6 A;  1S9H A;  3HHG A;  4Y7N J;  4G7Z F;  3OYB A;  3KYC B;  1U9O A;  2LY1 A;  2LNB A;  2BYV E;  2MA3 A;  1XG1 A;  2VAS A;  2ZFW A;  2ZME C;  3CME I;  1LEB A;  2O7T A;  3LMM A;  3G71 I;  1JTY A;  1R5G A;  2DA6 A;  4C3J J;  2DPD A;  1LDD A;  2DCE A;  1BJA A;  3OL3 A;  2KQR A;  3EUP A;  2TCT A;  3KP2 A;  2QEX I;  2F5C A;  2MC4 A;  3BY6 A;  5HS9 A;  3WGH A;  3WTX C;  4AM3 A;  3VOX A;  2RNJ A;  1S7A A;  2IGO A;  4UVC A;  2AHQ A;  4Z6Y A;  3JRD A;  2QEN A;  1LDK B;  2NP5 A;  3TP3 A;  1UAA A;  4NC6 A;  1XCV A;  2B3W A;  1EH6 A;  1JGG A;  2LVS A;  1ULY A;  3RSN A;  1PUE E;  2VPR A;  3CCR I;  4V2G A;  4B3A A;  1ETW A;  1VQ6 I;  2H09 A;  2L7M P;  1ZG5 A;  3L2W A;  2Y0S N;  1T95 A;  5AIP A;  3OYI A;  1UEL B;  3DTI A;  5FD5 A;  3L2R A;  3VVY A;  4I99 C;  1WQ2 A;  4PJN A;  1JKQ C;  2ICW G;  4PGH A;  1BI1 A;  2RC4 A;  2QSF X;  3FIW A;  5KNL A;  4HKU A;  3P9I A;  2R92 J;  4NN1 A;  4I02 A;  3OYD A;  1FPQ A;  2JZY A;  1A04 A;  2EZH A;  2JSC A;  3EUK L;  2AQF A;  4IHX A;  4BGD A;  4MQV A;  1RUO A;  1R7J A;  2EV6 A;  3OYN A;  2FBI A;  4YEL A;  2DBB A;  3LWJ A;  5J40 A;  2O6G E;  4OAZ A;  4IPA A;  5D5U B;  4LLG F;  5D4R A;  1H9T A;  3RH2 A;  4ZTJ A;  4UUV A;  2FD5 A;  2DJN A;  2HYG D;  1LQ1 A;  2JPB A;  4N9H A;  2H8W A;  2PBI A;  1PYV A;  3R0J A;  3A0H C;  3DU6 A;  2H1L A;  5DDG A;  1O3S A;  4YFK F;  5E1X A;  3CQZ J;  3ERE D;  2HYJ A;  2DI3 A;  2DT7 B;  1UB9 A;  4PFO A;  4CZZ A;  2JSP A;  2OQG A;  3NNR A;  2JT1 A;  5IY5 H;  1FP2 A;  1Z91 A;  2JA6 J;  5K1Y A;  2MH9 A;  3K70 C;  1TQP A;  4FE4 A;  5FRO A;  2XIG A;  4CCO A;  3CLO A;  4HRI A;  2V9K A;  2XGE A;  3L2C A;  1P6R A;  3PFI A;  2HZT A;  2R4G A;  3K7A J;  3HOS A;  2Y9Z A;  1D5Y A;  1MBG A;  2EIK H;  1O7F A;  3ISP A;  3Q0V A;  3TMO A;  3OYE A;  1BI0 A;  4LLN A;  3U1D A;  1SD7 A;  1B8I A;  2V9V A;  1SFX A;  2Z1D A;  3CC7 I;  3HOZ J;  5CVV A;  2XAQ A;  3E6C C;  4B44 A;  4IZZ A;  2WAE A;  1YS6 A;  1J59 A;  2IBD A;  2M87 A;  2V6C A;  2ZOZ A;  2Y75 A;  5FKM A;  3BT9 A;  3K4C A;  2GA2 A;  2DA5 A;  1HQC A;  1GLN A;  4F93 B;  2OER A;  4ESJ A;  3CCY A;  5LRR A;  1BW5 A;  2M4K A;  1T0F A;  3DBL B;  2VE9 A;  3OSG A;  4KJZ A;  2Q24 A;  4A6E A;  4L9N A;  3JAM K;  2CV0 A;  1VQM I;  1IUY A;  2L3D A;  2NNN A;  2IVM A;  3W6V A;  1D3Y A;  4N4O B;  2FEZ A;  4RAF A;  5LLQ A;  2L9V A;  3DQV C;  4EJW A;  5D8L B;  1VQ9 I;  3M3Y J;  1BA5 A;  1T08 B;  2QKO A;  1I5Z A;  2DK8 A;  4FHT A;  4RGS A;  3K0L A;  2VJ4 A;  1TC3 C;  3BR5 A;  1FEX A;  4A0X A;  2EIJ H;  2CW7 A;  4PFP A;  4RGX A;  2K4B A;  1GV5 A;  1GVJ A;  3FKI J;  2ZME A;  5CQG A;  3ZQH A;  3VFZ A;  1SD4 A;  1ZK8 A;  1Y0N A;  1SFU A;  1VQ5 I;  2R7X A;  3ASO H;  4L5I A;  1V5G A;  2WGB A;  3QWL A;  3DU5 A;  4LK0 F;  4KDP A;  1S7E A;  2R7Z J;  2HS5 A;  3OV8 A;  3VDX A;  1ON1 A;  4BH9 A;  4DBR A;  1MJA A;  1SVM A;  4B3X A;  2XKO A;  3H36 A;  2M34 A;  2QQA A;  3EPZ A;  4EJT A;  5J4Y A;  2QBY B;  3T6N A;  3WU2 C;  4EJV A;  2CJJ A;  4OIQ F;  4BL0 B;  3M4O J;  4XN3 A;  2LY9 A;  1APL C;  1A35 A;  3PPB A;  1RC9 A;  1RET A;  1YLF A;  5LEJ A;  4AYB N;  3PSF A;  4I01 A;  4ZJZ A;  1F43 A;  1XTA A;  2RV8 A;  1XDU A;  4CYC B;  2HI3 A;  4YEJ A;  3K8P C;  1WJE A;  2LF8 A;  1X4O A;  5B1B H;  1T39 A;  1R71 A;  1ZAR A;  5HDK A;  4ZH4 F;  2RVC A;  3P5J A;  2PJR A;  4C9Y A;  5F6F A;  2F4M B;  4FT8 A;  4XOT A;  3MKL A;  3GTK J;  1XGS A;  4ENM A;  5LEK A;  4U0W A;  1YRN B;  1FSE A;  2CW0 F;  5FKL A;  1FWZ A;  3SXY A;  1AKH A;  4LK1 F;  5HLT A;  2ZO4 A;  4O3M A;  4MIM A;  3AKZ A;  5HBU A;  4U87 A;  4HLX A;  1MGT A;  3E1S A;  2I8D A;  2OTL I;  3HIF A;  1J9I A;  3K1M A;  3PNY A;  5D18 A;  4OIO F;  1HC8 A;  5LGT A;  4AF5 A;  4HNU A;  4AID A;  1N25 A;  3J7A O;  3ZMD A;  4RB2 C;  4II3 A;  4RMN A;  1OPC A;  5EJC A;  3FX3 A;  4C2M A;  2DFE A;  1OCC H;  3CMY A;  3E7L A;  1LKX A;  3F9K A;  4LD5 A;  3G73 A;  2DA7 A;  4WCG A;  2LC2 A;  1UMQ A;  3OWT A;  2HQN A;  1TLH B;  2Q8K A;  4P55 A;  1OR7 C;  3TOB A;  2K9M A;  1E3O C;  4UV9 A;  1SVO A;  2A6T A;  4RBO A;  1M1E B;  1ZYR F;  4KMF A;  3EYI A;  2O8K A;  2NYX A;  2COB A;  2W84 A;  2F48 A;  3TGN A;  4ACI A;  2ECB A;  3RIR A;  1LFP A;  1ETK A;  2P81 A;  3J7Y J;  4UVA A;  1TBX A;  3VYT B;  1U8R A;  2Q2E A;  3IKT A;  4XKB A;  1I27 A;  5DV5 A;  5EGO A;  3BQY A;  5M5X J;  2HXI A;  3QRF F;  2E1C A;  1YOV B;  2F5V A;  1G2H A;  3ABU A;  3P9C A;  2QTQ A;  3E5X A;  5JI6 A;  2WWY A;  2DT6 A;  4KN7 X;  1YIO A;  2LRE A;  3C2B A;  2O3F A;  4WXD A;  1CF7 A;  2YU9 J;  5J1U A;  4D9J A;  2EFN A;  3E0J B;  1JXS A;  2E2H J;  1IRZ A;  2Y2Z A;  4LG0 A;  1RIO H;  3ANP A;  2HTJ A;  3CUO A;  2X1C A;  2BV6 A;  3ZCO A;  2V57 A;  3HG9 A;  4RGU A;  1Q1H A;  3WOD F;  1DGW Y;  5ILU A;  3JRB A;  3OMY A;  2UZK A;  1H8A C;  1YIT I;  3ANG A;  4G7O F;  1R4N B;  2QLZ A;  3HJE A;  1Z7L A;  2OC6 A;  1U2W A;  3IKV A;  4A3K J;  3C7J A;  2B63 J;  2NVT J;  3FMR A;  4UUS B;  4RB0 A;  3F1B A;  1QPM A;  3NAU A;  2HYF A;  3WU0 A;  4HQE A;  2F4I A;  4ZTF A;  1LJ9 A;  3A4C A;  2Z16 A;  1UG0 A;  3PO2 J;  4XRF A;  2VQL A;  4E7Z A;  4U88 A;  3JRG A;  3WGG A;  2XC7 A;  1IXC A;  1JKO C;  1ONV A;  2EZL A;  3D0S A;  4XKC A;  1Z3Y A;  2REK A;  4XKW A;  3RYP A;  2X4H A;  4MK6 A;  4XLH A;  3WE3 A;  4JYK A;  2W53 A;  4L5E A;  2BY0 A;  4GCK A;  1IW7 F;  3S32 A;  1SAN A;  3HRS A;  2E1N A;  2KIS A;  5C4J J;  1WFX A;  2IGN A;  2QQ8 A;  4MXM A;  4DYQ A;  1G4D A;  2F07 A;  2CQQ A;  2X51 A;  2YU3 A;  1EA3 A;  3BTI A;  4BEH B;  5IYD J;  1D1C A;  1A36 A;  4BXU A;  4IQ4 A;  4E6K G;  2MAB A;  4IHT A;  1FP1 D;  1S3J A;  2VQH A;  1BC8 C;  3KEO A;  3GZI A;  2X85 A;  2F4O B;  4R8H A;  4IXA A;  2QZ8 A;  3I4P A;  4OD4 A;  3NQO A;  2DPU A;  2NS8 A;  1QHG A;  3CRJ A;  4IO9 F;  4I98 B;  1TQM A;  1TW3 A;  4KT5 C;  3KZI C;  3CZ6 A;  2BY2 A;  2VBX A;  2ECC A;  2ELK A;  2RHA A;  5E18 F;  2V1X A;  2Q0O A;  1PP8 F;  2V6E A;  2FNP A;  2HNH A;  4CO8 A;  3E5U A;  3PIP F;  2ZY9 A;  1HW2 A;  3RDI A;  3EUA A;  1W4M A;  4DOZ A;  2KPM A;  2XV4 S;  1Z9C A;  5E8G A;  3BTL A;  3GBG A;  3QKX A;  2OUM A;  2HQR A;  4OU0 A;  5ED4 A;  2OJE D;  3BP8 A;  3CD6 I;  5D5W B;  3QYF A;  1BI3 A;  3PL8 A;  3RD3 A;  2LYC A;  1I50 J;  1ETX A;  3JRC A;  4I6Z A;  1LPQ A;  2I5U A;  4XRS G;  1ETY A;  4I7H A;  2GWR A;  1OR7 A;  2HPM A;  2PQ8 A;  1P2F A;  3V8K A;  3A2K A;  3GXO A;  1P4X A;  3ZN0 A;  2W48 A;  2JVH A;  2X48 A;  2L9R A;  2M4G A;  1D0X A;  5FLV A;  4JOM A;  5E1W A;  3CTA A;  3AAF A;  3RCO A;  2ZSI B;  4DYR A;  2CH0 A;  3SDG A;  3Q9S A;  4X0G A;  4OD5 A;  3ON2 A;  4CH7 A;  1PJR A;  2CO5 A;  1EH8 A;  3C18 A;  3U1K A;  1WVR A;  3S3O A;  1EV7 A;  4L9T A;  2LOO A;  1YW7 A;  3HC7 A;  1W5S A;  4J01 A;  4MEX F;  2IA2 A;  2W4S A;  2QSH X;  2KHM A;  4M3F A;  3H5A A;  2K85 A;  3E6M A;  4RAZ A;  3BG5 A;  1P9Q C;  1S7O A;  2E34 A;  4JL3 A;  3IUO A;  4A3J J;  4JP0 A;  1X58 A;  5FKK A;  3GF2 A;  1U8B A;  4LG3 A;  1JKR C;  2XPV A;  1IZ1 A;  1S8N A;  2X1E A;  3KKD A;  4IRH A;  3KYD B;  4BAY A;  5HSZ A;  2XF7 A;  1O3T A;  2VQG A;  1BJZ A;  5FRN A;  5J1R A;  1ZR4 A;  1HOM A;  1P7J A;  1JUP A;  1BI2 A;  2EWN A;  4BE2 A;  2E1M C;  1R1T A;  1IN4 A;  1Z0X A;  3I56 I;  3BZK A;  1BIB A;  1J09 A;  4Q4Z F;  4XN0 A;  1B8I B;  5ICF A;  2LRD A;  3SEZ A;  2QBY A;  4LB6 B;  1R22 A;  2J5O A;  3CDL A;  3BRU A;  1XSX A;  2Y69 H;  5DCM A;  3QYE A;  4LB5 A;  2Y0M A;  2W25 A;  2GFN A;  3HUG B;  2VE8 A;  3W6K B;  1XS9 A;  2ID6 A;  3K2A A;  1VQN I;  4C2M J;  2GIZ A;  3FXU A;  3GFM A;  5KCM A;  3K6G A;  5BPD A;  3CCQ I;  1BOA A;  1LE8 B;  4GDF A;  1STZ A;  2ZXH A;  3V7S A;  1PUF A;  2OA4 A;  2OZU A;  4CYC A;  3CCS I;  1SFE A;  2F5D A;  5IPA A;  3OYC A;  2FOK A;  3MZY A;  5K7F A;  3JRF A;  1MSE C;  2JJ7 A;  4G7H F;  4Y4R A;  3A1Y A;  5FKO A;  2IAI A;  3VOD A;  5HOO A;  3U21 A;  2ZJP F;  3W3C A;  2DA4 A;  2XGX A;  5DUK A;  2CV2 A;  4KUM A;  5DD4 A;  1O3R A;  4DZJ A;  1QU3 A;  3ZQG A;  2XAS A;  2E36 A;  5EYR A;  1YRN A;  1LFB A;  1MJB A;  2X6W A;  4IHW A;  1D8K A;  1VZ0 A;  3WTT C;  3CMA I;  2LKS A;  2G7L A;  2WB1 A;  3ZPL A;  2ZME B;  2KIU A;  2BE5 F;  1QRY A;  3O6B B;  1ORK A;  2PJP A;  1V5F A;  1O4X A;  2CU7 A;  3ZMS A;  5IOZ A;  4L9V A;  2DOA A;  2LSO A;  4DYC A;  5DS9 A;  4ZDO A;  4CCL A;  5CW8 A;  3W2W A;  2XSJ C;  2FX0 A;  1JT6 A;  2KRC A;  3PSI A;  1E0E A;  3PIO F;  4I0B A;  4JNN A;  1J7K A;  2FU4 A;  2VKH A;  4QWQ A;  4BJ5 C;  4LGW A;  1KON A;  4KT6 A;  1AOY A;  1ZH5 A;  3H92 A;  2QWT A;  1B9N A;  5HS8 A;  1HXD A;  3HTU A;  4KMU X;  4L5J A;  1NHA A;  4OWR B;  2UXN A;  3HOY J;  3JTG A;  2L7K A;  2M7B A;  2LKX A;  2UXH A;  1ON2 A;  3SZT A;  1XPX A;  3BJB A;  2V9P A;  3VWB A;  2UWM A;  4BHB A;  1WRJ A;  2XPW A;  1TZL A;  1WJC A;  1ZGA A;  1N75 A;  2EV0 A;  4L9J A;  4B1R A;  2BHZ A;  2WAF A;  4FX4 A;  3VOK A;  3DTE A;  4ASN A;  3GO5 A;  2EIL H;  4MFE A;  4MTE A;  1TWA J;  3RYR A;  1MBJ A;  3VYS B;  4HA8 A;  2WBM A;  4EJU A;  4KYW A;  4UHT A;  3BWG A;  4B09 A;  3RKQ A;  6PAX A;  1BL0 A;  5L3B A;  1MMN A;  3EUH A;  5JVT A;  1MMA A;  3VIB A;  2LG4 A;  3HE0 A;  5J1Y A;  2XAF A;  1J75 A;  2NVQ J;  3QOD A;  4C3I J;  1RES A;  2RRE A;  3K69 A;  2ADU A;  3MZ8 A;  5EG0 B;  4IQJ A;  1YS7 A;  4E7I A;  3DWL E;  1TWH J;  1R00 A;  1DP3 A;  3DP7 A;  3D1N I;  4EJO A;  2FJ1 A;  3CC4 I;  1MW7 A;  1SFK A;  1D0Z A;  3DF8 A;  3FXQ A;  4IOC F;  3TP0 A;  1QPI A;  2JN6 A;  4UUS A;  1YYV A;  3LA3 A;  2HYT A;  2VN2 A;  3VYU B;  2JRM A;  1NK2 P;  2RGV A;  4P9U A;  4ETS A;  2XUB A;  5JHF A;  2O61 A;  2Y30 A;  4XMY A;  2W57 A;  2DTR A;  4J19 A;  3WTS C;  5FGM A;  2FBH A;  1IN6 A;  4A6D A;  2K9L A;  3ZMV A;  2QUF A;  2RKH A;  5CLS A;  4HX7 A;  1ZGJ A;  5EGO B;  1UST A;  4XLA A;  3F6V A;  2JMW A;  1EH7 A;  5H20 A;  2VLA A;  4EVI A;  1N77 A;  3PQJ A;  3KP4 A;  2WUI A;  3KLN A;  4LFU A;  4C2T A;  1I3Q J;  5IP6 A;  4HF1 A;  1WJA A;  2P4W A;  2HQ5 A;  2ZXW H;  5KK1 A;  3VSK A;  4YIR X;  1IGN A;  4GFB A;  1CF7 B;  2XF6 A;  2A61 A;  4S04 A;  4NQW B;  1OJL A;  3VPR A;  4YG2 F;  1Y1V J;  4ENJ A;  1DU0 A;  2DMQ A;  3G1L A;  3KZZ A;  5EEG A;  5TRD A;  3BCG A;  4LG0 B;  4UDS A;  5DM7 F;  2KDO A;  1VF9 A;  3F21 A;  1HF0 A;  2FBQ A;  1QBJ A;  1K4T A;  1X3U A;  1RUN A;  3M1C A;  4B48 A;  4N0B A;  1G8X A;  4G9Y A;  1KU9 A;  1T8I A;  2BEO A;  2MFZ A;  2OAZ A;  3RKY A;  3ML6 A;  2ZJ2 A;  2RAS A;  1WGX A;  1W0T A;  3QPL A;  2IP2 A;  4D5C A;  3T1B A;  3AG2 H;  1IXS B;  4XLE A;  2EQR A;  1U5T C;  5K7Z A;  1LVK A;  1HW5 A;  2UXI A;  3D5R C;  2A5Y B;  3F8B A;  2Z3Y A;  1HKT A;  4HF2 A;  3L9F A;  3HYI A;  2R0Q C;  2JTV A;  2OF7 A;  2BHY A;  3JTH A;  4WXH A;  5DD8 A;  3TW7 A;  5JR3 A;  1SC7 A;  3DEW A;  1XD7 A;  4OMY A;  2BGC A;  2NXN B;  2DMN A;  3LST A;  5E3M A;  1A6Q A;  4BE1 A;  3FHZ A;  1VI0 A;  2QA4 I;  4MHG A;  3U9G A;  3LSI A;  3O3K A;  3D5L A;  3I59 A;  3F6O A;  5E1Z B;  1UFM A;  2FUG 2;  1VQ8 I;  1BBY A;  4ESB A;  1X4P A;  4ENK A;  3LSJ A;  2VKE A;  2UXU A;  3OYJ A;  2HDD A;  2O9L A;  2D2W A;  2IT0 A;  4HV6 A;  5M3F J;  2E35 A;  4M3E A;  2CRG A;  1MH4 A;  2R7F A;  3KP6 A;  1OMI A;  5JLX A;  2VBY A;  1X1D A;  3CJQ B;  3FWE A;  1Y1W J;  1R6R A;  5DUI A;  5FB2 A;  4A0Z A;  1ZG1 A;  1JI8 A;  5B1A H;  1WWX A;  2ZFU A;  1K61 A;  4ME9 A;  4ZDP A;  5IP7 J;  1ZRD A;  4OOI A;  5FJ8 J;  3HZJ A;  1MKM A;  1W1W E;  3OS0 A;  3OYF A;  1E2X A;  3GWZ A;  3RQ4 A;  4GO1 A;  1JT0 A;  2HOT A;  4A3G J;  3HTJ A;  4J00 A;  2LDU A;  2OD5 A;  1PDN C;  1S5L C;  4WX9 A;  3ZR8 X;  1JHH A;  3KPH A;  1FLI A;  1I6X A;  4IHS A;  2O03 A;  1QO0 D;  1Y0U A;  4BDZ A;  2DDB A;  3WE2 A;  2P5V A;  1YW9 A;  1Z7U A;  3MFK A;  3F72 A;  2WC2 A;  2VB6 A;  3WTY C;  4BS9 A;  4IRI A;  4BYY A;  1DP7 P;  2ZJQ F;  5CQE A;  2MG4 A;  5BMZ A;  3ZMU A;  3RTR A;  4DNC A;  2MLG A;  3ZN1 A;  2XAG A;  3S3N A;  1XMK A;  1NG6 A;  3R60 A;  2A2F X;  1Z1D A;  3G1M A;  1YW8 A;  2E2I J;  3S3M A;  3CP2 A;  3KP7 A;  3HUG A;  4M3D A;  3DLA A;  1S29 A;  2IS2 A;  3HDD A;  5LD2 C;  1HA8 A;  1LE8 A;  2CG4 A;  2ZCW A;  2K86 A;  1KU3 A;  3TO6 A;  1HKQ A;  3PO3 J;  2V4J C;  2VUM J;  1XMX A;  1FX7 A;  3BZC A;  3GFJ A;  3NXC A;  1T2K A;  3I53 A;  1GXQ A;  2FSW A;  4LIU A;  3TW6 A;  3JSP A;  3F8M A;  2CMP A;  3WG7 H;  4HEA 2;  1JE8 A;  3G3Z A;  5HOD A;  3BJA A;  2KIQ A;  3Q5F A;  2UXX A;  4RLQ A;  2CQN A;  1IDY A;  2K3P A;  3SQN A;  4HLY A;  1U9N A;  3K1P A;  3CJD A;  3CCE I;  2STT A;  2JA7 J;  3S14 J;  3BPV A;  5CVI A;  2VJJ A;  3L09 A;  4XSX F;  1TW2 A;  2NAZ A;  3QP5 A;  3BNI A;  3DPL C;  3AQS A;  1RRJ A; 
#chains in the Genus database with same CATH homology
 1JKO C;  4A3M J;  3ZQF A;  3KNW A;  3HOX J;  2EZL A;  1H88 C;  2REK A;  5FMP A;  4MK6 A;  4JYK A;  2W53 A;  4L5E A;  1MSF C;  1FTZ A;  4NEL A;  4GCK A;  1SAN A;  3HTH A;  2XPU A;  4NDL A;  2ME0 A;  4QSH A;  5C4J J;  3ZQI A;  5F0F A;  1T56 A;  4MXM A;  4DYQ A;  2JA5 J;  1FIA A;  2F07 A;  2CQQ A;  2K9N A;  3JRE A;  3BTI A;  5FHP A;  3IUV A;  3WHB A;  3S2H J;  5IYD J;  3I4N J;  1IV6 A;  3OIO A;  5F27 A;  4W97 A;  2JK3 A;  4XIC A;  5C4Y A;  1PUF B;  1WI3 A;  3A02 A;  3GZI A;  2GBY A;  3G7R A;  3V6G A;  1ENH A;  2LLK A;  2K40 A;  3GTQ J;  2NS8 A;  3SJM A;  1ITY A;  3MVP A;  3CRJ A;  2WV1 A;  1SGM A;  1P7I A;  2NVY J;  4QIW N;  2ECC A;  3IH2 A;  1UI5 A;  2ELK A;  1OCP A;  2RHA A;  4JKZ A;  1ETV A;  1XC5 A;  3VVX A;  2XSD C;  3OSF A;  2XB5 A;  2NX4 A;  2UXP A;  1SFO J;  3S1R J;  3IH3 A;  1HCR A;  4DW6 A;  2WB1 N;  4BY7 J;  1TWG J;  2X6O A;  5EG0 A;  2D6Y A;  4CGR A;  2DG8 A;  3BTL A;  3GBG A;  3QKX A;  3HB9 A;  1MNM C;  2GLO A;  3B6A A;  3KKC A;  3RD3 A;  1I50 J;  1ETX A;  3JRC A;  4I6Z A;  9ANT A;  4XRS G;  1ETY A;  5FLM J;  3V78 A;  5E3O A;  4XRS A;  2R5Y B;  2LTP A;  3G56 A;  3ZOB A;  3LNQ A;  2PMZ N;  1IUF A;  4A3E J;  2W48 A;  3MN2 A;  3TED A;  1VFC A;  2X48 A;  2IU5 A;  4BKX A;  2DMT A;  4A3F J;  2L9R A;  2M2E A;  5EZG A;  1HDP A;  5FLV A;  3QBM A;  4BY1 J;  5C3E J;  1OFC X;  2IEK A;  2QOP A;  2DA3 A;  2DA1 A;  4DYR A;  1AKH B;  3G1O A;  3SDG A;  3PAS A;  3O8G A;  4IHY A;  3ON2 A;  4HNV A;  1GVD A;  3A01 A;  4A69 C;  3HOW J;  2DA2 A;  1R9T J;  1RR7 A;  3GTJ J;  3GTG J;  1GDT A;  3VW0 A;  3Q0W A;  5F08 A;  1WCM J;  2L7F P;  5IOY A;  3BHQ A;  3PM1 A;  2E2J J;  2K9S A;  2NOG A;  1UI6 A;  2GUH A;  3HIM A;  3HKZ N;  2M8G X;  1RPW A;  5EDN A;  3HTA A;  2LFB A;  3QPS A;  1HLV A;  3UKG A;  2EH3 A;  3ZQL A;  2O7O A;  4M3F A;  4S0H B;  4A3B J;  5F04 A;  3VUQ A;  3E7Q A;  3JRI A;  2DTZ A;  4EEF G;  2GEN A;  4GFK A;  4JX5 A;  3BG5 A;  4FE7 A;  1QVT A;  2L7Z A;  2LK2 A;  4JL3 A;  3CWR A;  5CXG A;  4A3J J;  3BTC A;  4JP0 A;  1POG A;  1RKW A;  1X58 A;  5FKK A;  1U8B A;  2QF7 A;  5CXI A;  1JKR C;  2CUE A;  2XPV A;  4V2F A;  3KKD A;  2WAQ N;  1IDZ A;  5HSZ A;  4ABZ A;  5F1J A;  3VVZ A;  1BJZ A;  1GUU A;  5J1R A;  1ZR4 A;  1P7J A;  1HOM A;  1JUP A;  3LSP A;  3FIS A;  3B81 A;  4M3B A;  1Z0X A;  2ZOY A;  4IEJ A;  2YUS A;  4A3L J;  3A03 A;  2I10 A;  1B8I B;  5K7H A;  1MBH A;  5E3L A;  3VW2 A;  3BRU A;  3CDL A;  2GFN A;  2X9D A;  1A5J A;  1XS9 A;  2XB0 X;  2ID6 A;  3K2A A;  3NAR A;  1LFU P;  4JX6 A;  2VKV A;  4AC6 A;  1F36 A;  4C2M J;  1LE8 B;  2MGQ A;  4IHV A;  2GM4 A;  1NTC A;  1PUF A;  3HGY A;  1ZTR A;  4CYC A;  5EFY A;  5IPA A;  2R5Z A;  3S1M J;  4X6A J;  4LOC A;  5K7F A;  3LSR A;  2Y9Y A;  3JRF A;  1MSE C;  2DMU A;  2JJ7 A;  1JJ8 C;  4Y7N J;  4BBS J;  1U9O A;  5FKO A;  4AUX A;  2IAI A;  3BTJ A;  3FK6 A;  4JX4 A;  1XG1 A;  2JWT A;  5EEA A;  2O7T A;  3LOC A;  2DA4 A;  3HBL A;  1JTY A;  4DZJ A;  2KDZ A;  3GTO J;  3ZQG A;  2DA6 A;  4C3J J;  5EYR A;  2LR8 A;  3BR0 A;  1YRN A;  1LFB A;  3EUP A;  1ZKG A;  4QTR A;  4IHW A;  2TCT A;  2LP0 A;  4AC0 A;  2DN0 A;  2G7L A;  3VOX A;  4A3C J;  4GFL A;  1WH7 A;  5M5Y J;  2AHQ A;  1QRY A;  4ICH A;  3JRD A;  1ORK A;  2NS7 A;  3S16 J;  2NP5 A;  2YVE A;  1O4X A;  3I4M J;  1I6H J;  2CU7 A;  3TP3 A;  5IOZ A;  5EZH A;  4DYC A;  5DS9 A;  5C44 J;  2LVS A;  1JGG A;  5EF6 A;  5CW8 A;  5AQC A;  2VPR A;  4V2G A;  4B3A A;  2FX0 A;  1ETW A;  1JT6 A;  3BR1 A;  2HOA A;  2XRL A;  2L7M P;  2YVH A;  1TWC J;  3H3V K;  2Y0S N;  3RZD J;  4JNN A;  3FRQ A;  4FTH A;  2MSY A;  1HDD C;  5IYC J;  3VVY A;  2R5Y A;  1JKQ C;  2QWT A;  1AHD P;  1MBK A;  3FIW A;  4HKU A;  2R92 J;  5M3M J;  4NN1 A;  2YS9 A;  3HOY J;  3NPI A;  2EZH A;  2LKX A;  4IHX A;  5E3N A;  1EF4 A;  2UXH A;  3BJB A;  2UXO A;  2XPW A;  3HTI A;  4B1R A;  1IJW C;  3VOK A;  4XRM A;  1W0U A;  4Y52 J;  3JSJ A;  3LWJ A;  3SFI A;  1WH5 A;  1FTT A;  4MFE A;  1TWA J;  3RH2 A;  1NK3 P;  1MBJ A;  2FD5 A;  5IP9 J;  2DJN A;  1X2N A;  4X1E A;  1JKP C;  3RKQ A;  3ON4 A;  1BL0 A;  1UHS A;  3LHQ A;  3VIB A;  5JLW A;  3CQZ J;  4XID A;  2HYJ A;  2QIB A;  3HE0 A;  5J1Y A;  3IV5 A;  3WHC A;  2XGC A;  2NVQ J;  4C3I J;  4G12 A;  1RES A;  3O8H A;  4KWA A;  3NNR A;  5EG0 B;  2JA6 J;  4PXI A;  4FE4 A;  3HOV J;  1TWH J;  2CUF A;  2DMP A;  3GEU A;  3S2D J;  3D1N I;  2FJ1 A;  2XGE A;  5FKN A;  1FJL A;  1CQT A;  1QPI A;  3TP0 A;  2JN6 A;  4UUS A;  2Y9Z A;  3K7A J;  1D5Y A;  1ZQ3 P;  1MBG A;  2HYT A;  3QQA A;  1NK2 P;  2PZ9 A;  2HXO A;  3Q0V A;  3HEF A;  4FIS A;  2Y30 A;  3EGQ A;  3LSG A;  5M5W J;  4J19 A;  1B72 B;  3BG9 A;  1B8I A;  4BBR J;  2HOS A;  1ZR2 A;  3HOZ J;  1ETQ A;  2PBX A;  2IBD A;  5EGO B;  2ME6 A;  2ZOZ A;  2E19 A;  4D7M A;  2JA8 J;  5FKM A;  3BT9 A;  2ID3 A;  2JMW A;  2DA5 A;  3IH4 A;  1GT0 C;  2OER A;  3VW1 A;  2WUI A;  3NI7 A;  3CCY A;  4YZE A;  1BW5 A;  1I3Q J;  5DTD A;  5IP6 A;  3OSG A;  3S15 J;  2HQ5 A;  1IGN A;  1Z77 A;  2Q24 A;  4GFB A;  2K9Q A;  1RKT A;  2G3B A;  3RQI A;  3VPR A;  1OJL A;  3F0C A;  1Y1V J;  3H0G J;  1UG2 A;  2DMQ A;  3G1L A;  1DU0 A;  3BCG A;  4UDS A;  5GPC A;  5K58 A;  3W6V A;  1ZGW A;  2XDN A;  1VF9 A;  1HF0 A;  1Q1V A;  2FBQ A;  3GTM J;  3M3Y J;  1BA5 A;  2QKO A;  2N8G A;  2EBI A;  2EZK A;  1TC3 C;  3BR5 A;  1FEX A;  4XK4 A;  2E1O A;  1GV5 A;  3FKI J;  2EZI A;  3ZQH A;  2RAS A;  1WGX A;  1W0T A;  3FK7 A;  1ZK8 A;  4GCT A;  3QPL A;  3Q3S A;  4D5C A;  4I76 A;  2WGB A;  2EQR A;  5FGL A;  5K7Z A;  2ZCX A;  1S7E A;  2R7Z J;  2UXI A;  4B4C A;  4BXX J;  1IG7 A;  4A3D J;  2R93 J;  2R0Q C;  3BG3 A;  3HM5 A;  2OF7 A;  2M34 A;  4MLO A;  3TW7 A;  2HKU A;  3DEW A;  2G0E A;  4UUT A;  3T6N A;  2MW8 A;  1X2M A;  2CJJ A;  2DMN A;  3M4O J;  2LY9 A;  1APL C;  5E3M A;  5J3L A;  2L0K A;  2H1K A;  1MBE A;  3O60 A;  3PPB A;  1VI0 A;  3ZQC A;  1RET A;  4MFD A;  4AYB N;  1A6I A;  3S5R A;  5H9T A;  1K83 J;  5IYB J;  1F43 A;  3COL A;  4DZP A;  4CYC B;  2HI3 A;  2R5Z B;  5D19 A;  3JRA A;  1BW6 A;  4D5F A;  3BR3 A;  2G7S A;  1T33 A;  2M9H A;  3LSJ A;  1WPK A;  2VKE A;  2UXU A;  3Q0U A;  2HDD A;  2NVX J;  5GPA A;  2O9L A;  3GTP J;  5M3F J;  2OPT A;  1JJ6 C;  4M3E A;  3MKL A;  3OOU A;  2CQX A;  2CRG A;  1MH4 A;  3GTK J;  1YRN B;  3BR6 A;  5JLX A;  5FKL A;  1AKH A;  2M0C A;  2ZCN A;  1Y1W J;  1H89 C;  2OI8 A;  4MIM A;  5F0H A;  1JUM A;  5HBU A;  1DU6 A;  5F0C A;  4D7N A;  1K61 A;  3DCF A;  5D18 A;  4ME9 A;  5IP7 J;  4AF5 A;  5FJ8 J;  5GP9 A;  5BNG A;  2VI6 A;  1VND A;  3CMY A;  5D1R A;  4M6V A;  3E7L A;  2DG7 A;  4M3G A;  2DA7 A;  3B6C A;  1UMQ A;  1JT0 A;  2HOT A;  4A3G J;  3HTJ A;  1JUS A;  3RZO J;  3NRG A;  1QVU A;  1E3O C;  2TRT A;  3AQT A;  4RBO A;  3S17 J;  2D5V A;  2ZB9 A;  4RDU A;  1B72 A;  3C07 A;  2O8K A;  3DPJ A;  2LD5 A;  2COB A;  2Y31 A;  4ACI A;  3BR2 A;  2ECB A;  1ETK A;  2P81 A;  1JTX A;  2G7G A;  1GV2 A;  5EGO A;  2KT0 A;  3BQY A;  5M5X J;  2HXI A;  1AU7 A;  1ETO A;  2MG4 A;  1G2H A;  2QTQ A;  1IC8 A;  4MO7 A;  3S1Q J;  2RAE A;  3C2B A;  3G1M A;  1FIP A;  2E2I J;  2AO9 A;  4M3D A;  3L1P A;  2YU9 J;  5J1U A;  3JR9 A;  3HDD A;  2E2H J;  1LE8 A;  2Y2Z A;  3A01 B;  3JRH A;  1IRZ A;  3ANP A;  3MNL A;  1OCT C;  2V57 A;  5DAJ A;  3PO3 J;  3VP5 A;  2VUM J;  3JRB A;  3HGG A;  3HOU J;  1H8A C;  4A93 J;  3ANG A;  4GCL A;  4L62 A;  3NXC A;  1MH3 A;  1MBF A;  3GTL J;  4C3H J;  3TW6 A;  4A3K J;  1U78 A;  5HAW A;  2B63 J;  2NVT J;  5HOD A;  4UUS B;  4A3I J;  3F1B A;  3NAU A;  1IDY A;  2QCO A;  2H8R A;  5C4X J;  1TWF J;  3S1N J;  3P9T A;  1U9N A;  3CJD A;  2JA7 J;  3BQZ A;  3S14 J;  3LJL A;  3PO2 J;  2ZCM A;  4W1U A;  3KZ9 A;  3JRG A;  2FQ4 A;  4FCY A;  3BNI A;  2NP3 A;  3AQS A;  2XGD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...