1Z77A

Crystal structure of transcriptional regulator protein from thermotoga maritima.
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
200
structure length
200
Chain Sequence
MLSKRDAILKAAVEVFGKKGYDRATTDEIAEKAGVAKGLIFHYFKNKEELYYQAYMSVTEKLQKEFENFLMKNRNRDIFDFMERWIEKKLEYSASHPEEADFLITLVSVDEGLRKRILLDLEKSQRVFFDFVREKLKDLDLAEDVTEEIALKFLMWFFSGFEEVYLRTYQGKPELLKRDMNTLVEEVKVMLRILKKGMTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords transcriptional regulator (TetR family)
publication title Crystal structure of a transcriptional regulator TM1030 from Thermotoga maritima solved by an unusual MAD experiment.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transcription
total genus 71
structure length 200
sequence length 200
ec nomenclature
pdb deposition date 2005-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1z77A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 1z77A02
1K83J 1EF4A 5EDNA 4NELA 2O7OA 1AHDP 4L62A 1MH4A 5F04A 3OIOA 4BKXA 2DN0A 2L9RA 3S14J 3PM1A 4JL3A 3S16J 2QIBA 1GUUA 1GVDA 3HOUJ 2WGBA 5D19A 5HAWA 5EZHA 4A3GJ 2R92J 1FTTA 2EBIA 2L7MP 4QTRA 2IEKA 3GTMJ 2DG8A 5FGLA 5IYDJ 3GTQJ 2DTZA 5J1YA 4BY1J 1FEXA 3S1MJ 1S7EA 2G7GA 1YRNB 3TP3A 3Q0VA 4I6ZA 1JTXA 2VKVA 3D1NI 2OPTA 3GTPJ 1MNMC 3MNLA 5M5YJ 2K40A 1TWFJ 1VI0A 1R9TJ 3CDLA 5DS9A 3OSFA 4BY7J 3JRIA 2DA7A 1TWHJ 5K7ZA 4CYCA 1ETWA 1Z0XA 2LKXA 3RZOJ 4A3BJ 5C4XJ 5CXIA 4D5FA 2JA6J 3LWJA 3RZDJ 2GBYA 1SGMA 3HOXJ 2G0EA 2LK2A 2HOTA 2R5YB 2G7SA 3L1PA 4FISA 2LVSA 2X48A 4ICHA 1ZK8A 4MO7A 2HYJA 5IYCJ 4A3LJ 1TC3C 5IP7J 4MK6A 4MFEA 2R93J 1MBGA 5GP9A 2R5ZA 4A3MJ 1HCRA 3TW7A 1I3QJ 3V78A 1MSFC 2Y0SN 1FTZA 4GCTA 3CMYA 4L5EA 2OERA 2LFBA 2NVQJ 4XRSA 3Q0UA 2G3BA 3VW0A 5EGOB 2LR8A 4JX6A 2GENA 5E3OA 3T6NA 4C3IJ 3VW1A 2NVYJ 4KWAA 2ECBA 1RESA 2G7LA 2FBQA 3HTAA 3ON2A 2XGDA 5J1UA 3BR6A 2VKEA 3NI7A 2XRLA 2DA1A 3QBMA 5M3FJ 2W48A 1APLC 1AKHB 1OCPA 1RKTA 2HQ5A 3CQZJ 1TWCJ 3JRBA 3G1OA 1W0TA 3LSRA 2XDNA 4GCLA 4X6AJ 4GCKA 3TEDA 4JP0A 2ZCNA 2M0CA 2YUSA 3E7QA 2LY9A 2YVEA 1ZTRA 4FE4A 3KKDA 5EFYA 1FIPA 1RR7A 1TWGJ 3HEFA 4NDLA 1OCTC 1JT0A 1G2HA 1ETXA 1LE8A 5C4JJ 2Q24A 3W6VA 4D5CA 5IP6A 3C07A 1B8IA 1IV6A 3HB9A 3ANPA 1IDZA 3JRHA 2CQXA 2E19A 5M5WJ 2NP5A 4NN1A 2UXOA 1QVUA 2GLOA 2CRGA 2DMTA 3VW2A 2JMWA 2XPVA 1BW6A 2MGQA 2TCTA 3QKXA 2GM4A 3G1LA 2YVHA 3HM5A 1QRYA 2DA6A 4M3DA 5AQCA 2UXHA 1ZQ3P 3A01B 4IHYA 3DPJA 3H0GJ 3B81A 2JWTA 2XPWA 4Y52J 3LNQA 2EZHA 2HDDA 4B3AA 4UUSA 3A02A 3FK7A 5HODA 3BR3A 2CUEA 1TWAJ 2FX0A 4FTHA 1U8BA 5M3MJ 3GTOJ 3HGGA 1I6HJ 2FQ4A 2JA7J 2NOGA 5FKKA 1ORKA 1JKOC 3CRJA 3SDGA 1GT0C 1D5YA 1GDTA 1P7IA 2OF7A 1A6IA 1AU7A 3HOYJ 3VVXA 2WB1N 3TW6A 2KDZA 1MSEC 2M8GX 4UDSA 2ZCMA 3FKIJ 4MFDA 4C3JJ 2GUHA 1K61A 2IBDA 3HBLA 2UXUA 3ZQIA 2QKOA 3JRDA 2ME6A 2PBXA 2K9QA 4DW6A 1YRNA 1OJLA 3BR5A 4JYKA 2MG4A 1WCMJ 3S5RA 3G7RA 3F0CA 2NS8A 1Q1VA 1UHSA 1MH3A 3LSGA 2LLKA 3PASA 4DYCA 3S1QJ 4S0HB 4A3FJ 1MBEA 5K58A 3BNIA 3LHQA 5F0FA 3HOVJ 4A3JJ 3PO2J 4A93J 3V6GA 2DG7A 5IOYA 4DYQA 1DU0A 1ITYA 5D18A 3IH4A 3VOKA 1U9OA 2R5YA 3AQSA 5J1RA 4B4CA 1NK3P 2ID3A 3ZQCA 3ANGA 2KT0A 2ME0A 5FKMA 2H8RA 3ZQGA 2W53A 5DTDA 4V2FA 2WV1A 1MBKA 2HOSA 3NNRA 2RAEA 3WHBA 2CU7A 1BW5A 2VPRA 3S2HJ 1A5JA 4CGRA 2DMPA 1IDYA 5F27A 1IGNA 1WGXA 2Y31A 3BT9A 5FKOA 5M5XJ 4DZPA 2REKA 3BJBA 1RKWA 1UI5A 3PPBA 5FKNA 3UKGA 1ETKA 1JUMA 1T33A 1CQTA 2PMZN 3NRGA 3BTLA 5EGOA 2HXIA 1ZKGA 3S17J 3BG9A 2DMNA 5CW8A 1JT6A 4BBSJ 3BTIA 4AF5A 1X2NA 1IUFA 5BNGA 3C2BA 1JJ6C 4IHXA 3M4OJ 3BQYA 1IRZA 2NX4A 2M9HA 4GFBA 4CYCB 3EGQA 2LTPA 2UXIA 1AKHA 1ENHA 3Q3SA 5EG0B 2Y9ZA 5C4YA 2QCOA 3KNWA 2O7TA 2HOAA 2EZKA 3LJLA 5HBUA 3BQZA 1XG1A 3BHQA 1GV5A 1BJZA 5FJ8J 2K9SA 5GPAA 3JREA 1BL0A 3RD3A 2VUMJ 2R5ZB 3M3YJ 2JA8J 3COLA 3LSPA 2JN6A 1OFCX 5E3LA 3VVZA 5DAJA 1JKQC 4A3KJ 4MIMA 4D7MA 3I4MJ 3K7AJ 3RQIA 1WI3A 2DMUA 2DA4A 4M3BA 3S1RJ 3BG5A 3FISA 4UUTA 2VI6A 4GFLA 3JSJA 4RBOA 3K2AA 1FJLA 3A01A 1POGA 4M3EA 3GBGA 4XK4A 2F07A 2M34A 3BG3A 1PUFA 3MVPA 1VFCA 4C3HJ 1B72B 2N8GA 1XC5A 2TRTA 3JRGA 2IAIA 3ZQHA 1RPWA 4C2MJ 2I10A 3QPLA 2HXOA 4BXXJ 2QF7A 1U78A 5CXGA 1X2MA 2O8KA 2QWTA 1ETVA 3MKLA 3O8HA 1Z77A 3QPSA 1MBHA 2XSDC 3JRAA 3CJDA 1Y1VJ 3I4NJ 2EQRA 5EYRA 4RDUA 4M3GA 3HE0A 1RETA 1IG7A 5JLXA 4QIWN 3GEUA 3ZQFA 9ANTA 4D7NA 3NAUA 1X58A 1HLVA 1ETOA 2NVXJ 2O9LA 3A03A 4HNVA 3JRFA 2ELKA 1JUPA 4AYBN 2NVTJ 5EEAA 2HYTA 2ZOYA 5J3LA 3ON4A 2NS7A 1NTCA 1ZR2A 3HOZJ 3AQTA 2EH3A 3NPIA 5IOZA 3BRUA 2HI3A 1WPKA 2XB0X 1HOMA 3BR0A 1BA5A 1JKRC 1SANA 4JNNA 1T56A 1E3OC 4HKUA 1HDPA 2ZCXA 5FLMJ 4UUSB 1LFUP 3HKZN 3ZQLA 3QQAA 5C3EJ 2OI8A 2D6YA 3KKCA 3G1MA 2FD5A 5IP9J 4A3IJ 3IH3A 1WH7A 4ABZA 1UG2A 3FIWA 3VOXA 4JX5A 2YU9J 5EF6A 4A3DJ 2H1KA 4M6VA 5FKLA 3HTIA 2WUIA 3OOUA 3NARA 3IH2A 4A3CJ 3HTJA 3HOWJ 5IPAA 3JR9A 3O60A 4IHWA 2XB5A 1Y1WJ 3SJMA 1H8AC 3TP0A 2GFNA 2B63J 1JUSA 4W1UA 3CWRA 4AUXA 1FIAA 4BBRJ 4W97A 2L7FP 4JKZA 3BTJA 2R0QC 3VP5A 3HTHA 1W0UA 4Y7NJ 4M3FA 2R7ZJ 4XRMA 2WAQN 2D5VA 2DJNA 4AC0A 3FRQA 5H9TA 4XICA 1VNDA 1O4XA 4DYRA 2ID6A 1XS9A 3KZ9A 3RH2A 3LOCA 3VUQA 5EG0A 4A3EJ 1UI6A 2PZ9A 5D1RA 3LSJA 2XGCA 3BR1A 4X1EA 2FJ1A 3WHCA 3VIBA 3HGYA 5E3NA 1HF0A 4MXMA 4AC6A 2DA5A 3S2DJ 1DU6A 3SFIA 1JGGA 4J19A 5F1JA 2QOPA 2L0KA 3E7LA 4JX4A 1ZR4A 2DA3A 1QPIA 3DCFA 2P81A 1F36A 4LOCA 1ZGWA 4ME9A 4GFKA 1H89C 2DA2A 1MBJA 2CQQA 5E3MA 2MW8A 1H88C 1NK2P 2EZLA 1QVTA 2ZOZA 1WH5A 3GZIA 4G12A 2JJ7A 3GTLJ 1I50J 3HDDA 5FMPA 3ZOBA 5HSZA 3O8GA 4IHVA 5EZGA 2K9NA 3OSGA 5K7HA 3BR2A 1MBFA 2L7ZA 4A69C 2E2JJ 5GPCA 2M2EA 5F0CA 3NXCA 2XPUA 1ETQA 4FE7A 2E2HJ 3EUPA 1UMQA 4B1RA 3Q0WA 3MN2A 2YS9A 3RKQA 2X6OA 5C44J 1B72A 2HKUA 1F43A 1JTYA 2ZB9A 2DMQA 3S1NJ 2JA5J 5JLWA 2E2IJ 4I76A 1IJWC 1HDDC 2UXPA 3IV5A 5K7FA 2LP0A 4EEFG 2X9DA 3VPRA 3JRCA 2LD5A 5F0HA 4XRSG 3P9TA 3G56A 4FCYA 1IC8A 3IUVA 4PXIA 2NP3A 1VF9A 3B6CA 2AHQA 4V2GA 3B6AA 4QSHA 1U9NA 3GTKJ 1GV2A 3DEWA 3FK6A 4IEJA 2RASA 2QTQA 1LE8B 3GTGJ 1B8IB 3VVYA 2XGEA 1P7JA 5FLVA 5FHPA 3S15J 1ETYA 2Y2ZA 3BCGA 4ACIA 3CCYA 4YZEA 2RHAA 5F08A 2COBA 2Y9YA 2IU5A 2CJJA 5IYBJ 2E1OA 1PUFB 1LFBA 4DZJA 3HIMA 2JK3A 1SFOJ 3F1BA 4XIDA 2V57A 2EZIA 2CUFA 2MSYA 2Y30A 4MLOA 3GTJJ 1JJ8C 2AO9A 1JKPC 3PO3J 3H3VK 2ECCA 3BTCA
chains in the Genus database with same CATH superfamily
1LFPA 5EDNA 3RYPA 2QWWA 2EFNA 5H6QA 2JRMA 2WV0A 2P6SA 1AHDP 1FLIA 4XLCA 3S14J 1ZRDA 4RGXA 2NNYA 1CF7A 2O5RA 1OMIA 1PJRA 3T5XA 2QIBA 1T95A 1GUUA 4AIJA 3HOUJ 3I9V2 5BPDA 1R22A 2L7MP 4LMYA 4QTRA 3L2UA 5FGLA 4PGHA 3AG3H 1YRNB 3TP3A 4BEHA 1SFXA 4IHSA 2P0WA 4HV5A 3MNLA 4RGUA 3WTXC 1IN7A 2ZSIB 2X6XA 4EQQA 1RRJA 5K5QA 3WTVC 3PIOF 2WC2A 1R9TJ 4CCLA 3JRIA 2CSOA 1Z7LA 5GAGJ 2O61A 2EIKH 3F8FA 2L9NA 3FXKA 3JCUC 1GHCA 5CXIA 1V4RA 2DYSH 2VC0A 4D5FA 2JA6J 4LITA 4P55A 2WTEA 4C30A 4KT6A 2GBYA 2FBHA 3OYDA 1BIBA 4KYWA 4EGZA 3IKVA 1SGMA 2HOTA 2QLZA 4E7JA 2G7SA 3M8FA 4AIKA 4EMSA 1XN7A 4A3LJ 2WB1A 4KMUX 4MK6A 2ACJA 1YQAA 2R93J 1MBGA 3LSMA 1FOKA 2EJRA 2Y0SN 5H20A 5JHFA 1LPQA 2CQKA 2NVQJ 4XRSA 3HOTA 2LKPA 2KRHA 4IRHA 3VODA 4JX6A 4BNCA 3IAM2 2NVYJ 1I1GA 2I8DA 3ZMVA 1EH8A 2WADA 4A0YA 5J1UA 4S05A 3Q5FA 1YJ9I 3AG2H 3KYLA 1UHWA 2L01A 5CVJA 1SEUA 5M3FJ 4U87A 1PDNC 2LY1A 2V7FA 5L3FA 1RR8C 1AKHB 3ZMTA 3CDHA 1VQ8I 1RKTA 2HQ5A 3CQZJ 3WE3A 1HW1A 3JRBA 1W0TA 2XDNA 2F2EA 3ZXSA 3TGNA 3REOA 4GCKA 2B0LA 4JP0A 1SAUA 2XHKA 1Z3YA 1NHAA 4RAYA 5DUKA 3E7QA 2H6CA 5B1BH 3RDIA 4FE4A 4EVIA 1TT5B 1HC8A 1FIPA 3NQOA 3VEPA 4F55A 1H9GA 1X1PA 3I53A 3KEYA 3M7GA 3SZPA 1LE8A 2LF8A 5C4JJ 1Z21A 3K4JA 1IV6A 5HDGA 1K78A 3KLNA 3V7CA 2UXOA 3FM3A 3KYCB 1LEAA 2CRGA 3M07A 3VW2A 2XPVA 1SVMA 2TCTA 2DAOA 4GDFA 1HQCA 4F7ZA 2GM4A 1W4MA 3HSRA 3HM5A 4MHGA 2LBFA 2P7CB 2XAQA 2UXHA 3G3ZA 3HTUA 3OR2C 1C0WA 4DJAA 3A02A 2CWEA 2V6EA 2FX0A 1VQMI 3AFHA 3ELKA 1JKOC 3CRJA 3SDGA 1GT0C 2FXAA 3ISPA 2QSHX 5HNHA 1GDTA 3LA7A 5TRDA 1AU7A 3HOYJ 3GCMA 2KIMA 1XGSA 3IC7A 1QQIA 2ZCMA 1S9HA 1K6OA 1YJWI 4BE2A 3ZQIA 3FXRA 4L0YB 2YR2A 1LKXA 3QOEA 2O3FA 2PBXA 1YRNA 3K4BA 3O3KA 5DCMB 1WCMJ 2BW3B 5ED4A 2R7SA 1E17A 3E5XA 2XRNA 3LSGA 4JQFA 4E6KG 3PASA 3FBIB 3SWHA 1MDMB 3S1QJ 4S0HB 3OYFA 1V5FA 4DOZA 4CUGA 3HOVJ 3PO2J 4A93J 3V6GA 1K6YA 4BUPA 5ICEA 3DBHB 4RLQA 5ILUA 1DU0A 5D18A 2H6BA 4MEYF 2CFOA 5ICFA 1XCBA 2KIFA 1NK3P 5FKMA 5LHIA 3J7AY 1DPRA 2X1EA 2K4BA 2GA2A 2HOSA 3NNRA 3VYUB 3TO9A 3WHBA 2FMYA 2VPRA 5D5UB 2MABA 4Y15A 5FRNA 1GXQA 1IDYA 1O57A 4CZCA 4RM3A 1Z6RA 4OWRB 1OKRA 4QPOA 2F6CA 2ZXWH 5FKNA 5J4YA 1ETKA 4A5NA 1CQTA 1T33A 1B1BA 3I54A 1ZH5A 1ZKGA 3BLYA 2KIUA 4OMZA 1Q1HA 4KMFA 4J01A 4P96A 5KAFC 4RGSA 1JT6A 4BBSJ 4AIHA 3VTIA 1X2NA 5BNGA 4HX4A 1Z9CA 3OYBA 3IKTA 1J7KA 1YS6A 1ZLJA 4ITVA 1AKHA 2FE3A 3IP4B 1OYWA 3PNYA 1D0YA 2RQPA 2O7TA 2JQ7A 2VN2A 3J80Z 3LJLA 2VBZA 1XG1A 4HSTA 4KISA 4ZDLA 2M0MA 5FJ8J 2J5OA 2JUCA 2K9SA 2DFHA 1VQOI 2R5ZB 3M3YJ 1D3YA 2JN6A 5F6FA 1OFCX 4KNYA 2GXGA 3ULQB 3VVZA 4UB8C 4KDPA 2AQEA 2XKPA 3PQKA 1X4OA 2KRFA 2HEOA 2DT5A 5DAJA 5BS6A 4A3KJ 4MIMA 4G7ZF 3K9TA 5JR3A 1ZG1A 1XMKA 2F4IA 4MNUA 4UV9A 4ZDPA 4D7MA 3J80K 2OV7A 1O3SA 1IW7F 1VQ7I 3KIOA 3LAJA 2DMUA 3ERED 1A36A 2PMZA 2HVRA 3DXJF 5HLGA 4M73A 1XGOA 3FISA 3GFMA 2Z16A 2K85A 1RI7A 2V1XA 3GWZA 1DP3A 4PDKA 2LKSA 4GCVA 1YYVA 2XAUA 5DV5A 5J6XA 4U0VA 1FY7A 4B8XA 1KONA 3WTWC 1XC5A 3K4CA 3KETA 1ZRFA 2I10A 3QPLA 4IOAF 2QF7A 5CXGA 2O8KA 3DEUA 5D4RA 2HVQA 3MKLA 3SXYA 3JRAA 1MBHA 3CC2I 4HV6A 1Y1VJ 4X0GA 3LQRA 4EJTA 5LGTA 1ZN2A 2LOOA 1ODDA 1N25A 3HE0A 2MA3A 4QIWN 2IA1A 3CO6C 2DQLA 2OC6A 4A0XA 2V6CA 1FC3A 1HLVA 1ETOA 3K8PC 3TMOA 1OCZH 2ELKA 4I01A 3S3NA 5DCMA 1QPMA 2E1NA 5J3LA 2KIQA 4HDVA 2EV0A 2BW3A 4IPAA 2NS7A 3HOZJ 5EJCA 1NG6A 2VT2A 1XX5A 2VBYA 1MDMA 4WXDA 1R1UA 4CHUA 2K9MA 1PYVA 1IXRC 2EWNA 3ASNH 3Q9SA 1FP1D 3HKZN 5CVUA 5LLQA 4UUSB 2R7RA 2E7WA 2J5PA 3LWFA 4E7LA 2FD5A 2OCEA 3F8NA 4A3IJ 1W36C 2LDUA 1UG2A 5K1YA 2IS4A 2WA0A 2H1KA 4A6EA 4OIQF 5FKLA 3HTIA 1XD7A 1Y39A 3A4CA 4ETSA 5J8FA 3COAC 4RA2A 3U2RA 4OD5A 3SJMA 1PUEE 1N77A 3CMMA 5KVRA 3WG9A 1YO5C 1SMYF 1KQ9A 3K10A 4AUXA 2KRCA 3CCMI 4BBRJ 2O0YA 5FRMA 3VP5A 3PFIA 2WAQN 3RCOA 4XRMA 3FRQA 5H9TA 4HF2A 1BI1A 4G7HF 4XM3A 2DLLA 2CO5A 4DBQA 3LOCA 4M74A 2FBKA 5GTIC 3R61A 4LG3A 5D1RA 1J5YA 4N9IA 4GYIA 3VOEA 2KKOA 1FYMA 1YS7A 1LB2A 3ABLH 1HSTA 2F4OB 2XF6A 4TV7A 5H6RA 1DU6A 4U0WA 1JGGA 3LAPA 3E7LA 1F9NA 3TO6A 3L2VA 4IOCF 3VFZA 4LFUA 4MGRA 1SD5A 2JVHA 1HSJA 4PGGA 3DCFA 2P81A 4PFPA 4LOCA 2RKHA 1D1AA 1QZZA 1MMGA 3MAJA 1BJAA 1FMWA 3GLXA 2EZLA 3WE2A 3K1PA 4LK0F 3CD6I 3P9IA 1JHHA 4G12A 1E0EA 1B9MA 2JTVA 3QPTA 3HDDA 5FMPA 3ZOBA 5HSZA 1NH3A 3K2ZA 1S7AA 2ZBKA 2M7BA 4G8XA 5EEGA 3BR2A 5HNFA 3K6GA 5GPCA 2M2EA 3E1SA 3D5SC 1EH7A 3FF5A 2XPUA 5FD6A 1A04A 3TBIA 4FE7A 4HF1A 2B3WA 4B1RA 4LD5A 3R0AA 3LFKA 3OR1C 3Q0WA 4AIDA 5C44J 2XUBA 3OYCA 2FRHA 3GZNB 2KHMA 4UV8A 4F92B 2A5YB 2I5UA 2CYYA 3MFKA 2DYRH 4E7ZA 4WX9A 5E1WA 2CW8A 3NWTA 2LP0A 4EEFG 5CPRB 2RNGA 4ZYDA 3ZN1A 2DOFA 2P5KA 1SFUA 4RAFA 3RKXA 2H09A 3P9TA 3G56A 4FCYA 1IC8A 2CV1A 3IUVA 3D5RC 1XSVA 2E1MC 4BH9A 1IN6A 3H5AA 3WGGA 1G4DA 5L3EA 1YJNI 3IWFA 2Y0SA 3DEWA 3FK6A 3KP5A 3T0YA 2VE9A 4V19K 2QTQA 1XSXA 2XKOA 1X4PA 2BHYA 2XGEA 1P7JA 1TLHB 5FHPA 2R4GA 3BCGA 4ACIA 3QU3A 3LA2A 3CCYA 4HYEA 4EM2A 2Y9YA 1U5TB 3L2CA 3SEZA 2E5NA 2JK3A 5KHDA 3G71I 2DK5A 2ZMEA 3JSPA 2Y30A 3GTJJ 1JKPC 1AWCA 2ECCA 2HZDA 2NVTJ 1K83J 2FU4A 2HYGD 3DLAA 1S3JA 3HG9A 2P4WA 1IXCA 2O7OA 4L62A 1MH4A 5F04A 2CQ7A 4R8HA 2GQQA 2EV6A 4BS9A 1J59A 2KL4A 3O2PE 1T38A 2QKLB 4XN0A 3R0JA 4J00A 1GVDA 2CGPA 4BJ6C 5HAWA 4A3GJ 5HS8A 2R92J 1FTTA 5DM6F 3T1BA 2EBIA 4YIFA 4FETA 3GTMJ 2DG8A 3S32A 5F1RA 5ICGA 2Q2EB 4HA8A 4AVPA 5IYDJ 4BQAA 5J1YA 4DBRA 1OCCH 2X4HA 3FXQA 3JW4A 3KX2A 3MWMA 4HLXA 4DIQA 1T98A 2PJPA 1W5SA 1IRXA 2RNJA 4PJJA 2VJJA 2QVOA 5CVRA 5EEHA 4A5MA 4PZJA 1MNMC 4LIUA 4EJOA 4C2UA 3A2KA 4D0PA 2JSPA 3S2WA 3ZN0A 2AQFA 2R7OA 3BOQA 2F5EA 5FGMA 4BY7J 2QQBA 2ZO4A 2HTJA 4HQMA 4CYCA 3RZOJ 4GGGA 1VQ9I 1Z0XA 2FEZA 3K0LA 2UZKA 4IRIA 1L3LA 2R7TA 1BOAA 3RZDJ 3H0DA 2A2FX 1X1CA 3HOXJ 2G0EA 2LK2A 4Q4ZF 2Z33A 4QLCU 5LGUA 4FISA 1BBYA 4KICA 3CC7I 3O6BB 1T0FA 5IYCJ 4MFEA 2BZTA 4U9LA 4GCTA 4L5EA 4FASD 3MKZA 2CMPA 3HRUA 1RIOH 1YW7A 2LR8A 2PMUA 2NNNA 4ENKA 4GRIA 4C3IJ 3T6NA 1TW2A 1VQ6I 4KWAA 2LMDA 2G7LA 2COMA 1V5GA 3DEEA 4DQ2A 2A5WA 1ZHFA 2XGDA 1YE9A 5J8CA 5LHHA 1SD6A 2XRLA 4XL9A 2CH0A 2PFBA 1APLC 2DDBA 3OL3A 2CQNA 3G1OA 2ESHA 1Y6IA 3OOPA 4H4KC 4XKWA 4XLPF 1R36A 5J4VA 1MD0A 3CZ6A 2XAFA 1BI3A 3CLQA 2M0CA 2ZCNA 2YUSA 4QWQA 2YVEA 1YX3A 1RUNA 1TWGJ 4NDLA 2FNPA 1JT0A 1G2HA 2Q24A 3W6VA 4D5CA 3CUQA 3P9CA 3K4LA 5CQEA 5KAIC 3V4GA 1FOYA 3W3CA 2KFDA 4DNCA 4F52A 2GZWA 5B1AH 1UELB 2GLOA 1WQ2A 2HDWA 2MGQA 2CW0F 1U5TA 3NEUA 2IGMA 2O03A 2QKMB 1HKSA 5ERIA 2STWA 1ACIA 4BDZA 1IRGA 2V9PA 2EINH 3A01B 3B73A 3DPJA 3B81A 2JWTA 4OIOF 3LNQA 2HDDA 3RTRA 1LDKB 3NWSA 1TWAJ 1Z1DA 3K4KA 3GTOJ 1ERDA 1OISA 2JA7J 1WJ5A 1MJ9A 4P9FA 3A0HC 4IRGA 4BL0B 2X6WA 3TW6A 2PBIA 3CMAI 4EM0B 1MSEC 4K2EA 3KP4A 4L18B 1QHHD 2HGCA 1K61A 2EA4A 4NC8A 4XOPA 1BM9A 4DW6A 3LQQA 2VQGA 3DKWA 2DU9A 3J7YJ 3F9KA 4AM3A 3S5RA 1OCOH 3F0CA 1BC8C 1Q1VA 2LLKA 5L3GA 2L54A 5FFXA 3M8EA 1YX5A 1QHGA 3S93A 3DBLB 3QODA 4ESFA 3LHQA 4A3JJ 4ZTFA 3VDXA 5BOXA 2XIGA 4ENJA 2A68F 4DYQA 2E71A 2P5LC 4KT5C 3IH4A 2OU2A 3GYHX 4RS8A 3ZQCA 1WSUA 5FLXZ 4Q5SF 3ANGA 2DT7B 2MD0A 3LSTA 3ZQGA 2W53A 2JT1A 4V2FA 2MC4A 3GZ5A 1HKQA 3ECHA 4LJZF 3OYMA 1USTA 5GADJ 1BW5A 3E3VA 1A5JA 3EYIA 2DMPA 1ZARA 2RVCA 2V26A 2Y31A 4YRVA 1YOVB 5M5XJ 1WFXA 4DZPA 3FZVA 1YFHA 1W5TA 1YW8A 3KP7A 5JVGF 3HSEA 4JOMA 2EV5A 3NRGA 2HXIA 4NC7A 3EUHA 3S17J 1QZEA 3BG9A 4I7HA 5FLXK 2DMNA 2QQAA 2CFXA 2VE8A 4NHJA 3C2BA 1JJ6C 3M4OJ 2NYXA 4IRVA 4PSXA 4M9ZA 2CG4A 3DPUA 4GFBA 1K79A 2LTPA 1EJ9A 2OQRA 2W85A 2EPFA 4KN7X 3HKZA 4PFOA 1Z3XA 3U1DA 2G7HA 4CCMA 2HOAA 2XGXA 3BC8A 2VT3A 4BAYA 3HSFA 4KJZA 4IXAA 3VYRB 3JREA 2YU3A 2MBFA 4G9YA 3L00A 3V42A 1KA8A 4GXOA 1I6XA 3DLLF 2BHZA 1P6RA 1W7PB 4XN3A 1J0RA 3QYEA 2IT0A 3ROUA 4E70A 1L0OC 4YEJA 3JTGA 1W7PD 2BGCA 3I4MJ 1ZLKA 4HPQA 3L09A 1LVAA 2K7LA 3BZKA 4CICA 4CCKA 2DBBA 2WAQA 4RB3C 2OZUA 4BE1A 3SZTA 3PIPF 3OYKA 4UUTA 2L4AA 2VI6A 3KE2A 2DOEA 3A01A 1POGA 4U7BA 3BDDA 2F07A 1TNTA 5AIQA 3BG3A 1PUFA 5IY5H 5AONA 3HL2A 1XDUA 3FKJA 3ZR8X 2UWMA 3CCVI 4C3HJ 4WCGA 1B72B 2PG4A 2TRTA 2IAIA 3WU2C 3M8JA 2RQQA 2HXOA 1DGWY 2DW4A 3SQNA 2QWTA 3V8LA 1ETVA 2DT6A 1Z77A 1HXDA 3QPSA 1OYYA 3I4NJ 2ESNA 3TO7A 3K70D 5EYRA 2K02A 4M3GA 1O7LA 5CVVA 5DD8A 1RETA 1WKMA 1IG7A 5HLTA 3ABUA 3DU5A 9ANTA 3RIRA 4M9XA 1X58A 1SD7A 2K27A 1R71A 4L0ZB 2L02A 6PAXA 3IWZA 4C2TA 1JUPA 4AYBN 2HYTA 1WJFA 3ZMSA 2L5QA 3RPUD 2IXSA 3ON4A 3QWLA 1XMAA 1RNLA 3AQTA 2E34A 1R00A 3P7NA 2C6YA 1KYZA 4BXUA 5IOZA 1HW2A 2HI3A 3W2WA 2QSFX 1WPKA 2GAUA 3ML6A 2XB0X 3K1NA 1P9QC 1HBXG 1JKRC 4UVBA 3CCQI 4HX7A 1SANA 2MH2A 4LLLA 3KPHA 5E1ZB 5FROA 1HA8A 2ZCXA 5L3CA 3RJPA 1YLFA 4IX7A 3ZQLA 2M4KA 3I59B 2Z9OA 4AU7A 3FIWA 3HTSB 2YU9J 5EF6A 1OLTA 4M6VA 1K4SA 2A05A 2WUIA 2FOKA 4CGZA 2ELHA 4A3CJ 3JR9A 3O60A 2ZFWA 2XB5A 4Z2YA 1G3WA 3BWGA 4OIRF 1LEBA 3TP0A 4EM1A 3VB2A 1UJ8A 5GTHC 3L2RA 5D6EA 4EJVA 1JUSA 2B63J 2ZMEC 2AS5F 3AL0B 3W6JB 3QPHA 4XSZF 3CJQB 4JKZA 3BTJA 2R0QC 2QBYB 2QQ9A 2PI0A 1DPUA 1W0UA 4OMYA 3HTHA 4IKFA 2D5VA 3GFIA 3ZCOA 1IF1A 1JXSA 1VNDA 5FD5A 3VWBA 1O4XA 5D8KB 4DYRA 1XS9A 3VUQA 2GIVA 5TJJA 2V1UA 3LSJA 2XGCA 3BR1A 2VC1A 1P92A 5ICCA 2ZJQF 4BHPA 3WHCA 4MXMA 3RKWA 3F3XA 2DA5A 4O6JA 3S2DJ 3SFIA 3DKYA 1KU3A 3QYBA 1WWXA 4JX4A 1ZR4A 1ZGWA 2R7DA 4ME9A 4XBFA 1VQ4I 2NS0A 1MBJA 3KZIC 5E79C 1KU9A 2CQQA 4U9NA 1W7PA 5E3MA 2F48A 2MW8A 2VXDA 5DCFA 1NK2P 1QVTA 3ZQQA 2ZOZA 2JRTA 1USSA 3HPHA 1DUXC 2LH9A 2JJ7A 3CJTB 2MLKA 1I50J 3VYSB 2D1HA 1P4AA 3UNGC 2K9NA 2X0LA 3OSGA 5E8GA 2Y69H 2HPIA 5K7HA 2STTA 1MBFA 2L7ZA 4A69C 4AVZA 1E2XA 5F0CA 3NXCA 5ILVA 3L2WA 4EGYA 3IAS2 4XRFA 5LD2C 2E2HJ 4G7OF 1T0FC 1QGPA 3H1CA 4XOTA 5D8LB 3RKQA 3JAMK 1B72A 1MNEA 1FBQA 1JTYA 1PP7U 2VQLA 2R7XA 3S1NJ 2LYCA 5HOOA 4ZC3A 4I76A 2UXPA 1Y0NA 3ABTA 2X1DA 2E36A 4OD4A 3OV8A 3C2GA 3R60A 3R6SA 1F1ZA 2DO7A 3JSOA 5K7FA 1BR4A 2GXBA 2X9DA 3VPRA 4II2A 3JRCA 2EFOA 2VODA 2KMUA 4UVAA 4IHTA 1VF9A 1X1AA 2AHQA 3CP2A 4V2GA 3DWLE 3RPUA 3HHHA 4ASNA 3FM5A 2VONA 3GTKJ 4XLFA 2AXLA 4QPQA 3KCCA 2KZGA 4G6QA 4KIBA 2GIZA 3IUOA 2E1CA 2MLGA 3VVYA 1D1CA 3QAHA 2EB7A 3HPGA 3A0BC 2ZJ2A 3HC7A 4YZEA 3IRRA 3PSFA 4LB5A 1G3YA 3QP5A 5F08A 2IS1A 1NG7A 3F72A 5FFZA 3KZZA 5IYBJ 3I71A 2KDOA 4DZJA 3F21A 2LRDA 1SFOJ 4WK8F 4XIDA 4G94A 5A2QK 5JHUA 1N78A 3F1BA 3I59A 2EZIA 2FUG2 1R4NB 3S2HJ 3BTCA 1BIAA 2XC7A 3CUQC 5J47A 2R7UA 1E3HA 3HOSA 4FX4A 2JVGA 3OIOA 2DN0A 3LA3A 2CV0A 4XR6A 3OS0A 1QU3A 4BYYA 1VZ0A 2MFZA 4PK4A 1U5TC 4JL3A 3HHGA 4HBLA 1K7AA 4JBAA 2M8EA 3CJNA 5EZHA 1QO0D 1EV7A 1UFMA 1R23A 4KIGA 2JSCA 3ECOA 3F8BA 3F8MA 2QBYA 2Z1DA 2DTZA 1SVLA 1FEXA 3V8KA 1W1WE 1S7EA 3J7ZI 2G7GA 2KJCA 1BN5A 1OR7A 3OYNA 4R1HA 1JTXA 2PFVA 2FF4A 2OPTA 3H36A 3CP8A 5LRRA 3W2AA 4YFXF 2Y0MA 1VI0A 3CDLA 2VQHA 2BBYA 2Q8KA 3IL2A 1TWHJ 5K7ZA 2LKXA 1ETWA 4UUVA 4P1WA 3LWJA 1FYKA 2EFWA 3F6OA 4FQGA 3WGIA 2R5YB 4UNOA 3B02A 1R5HA 2WBMA 2LVSA 1QA6A 1FNNA 2H1LA 3V7SA 4ICHA 2R7WA 2HYJA 3EUAA 4GO1A 1B9NA 3V7RA 4ZYAA 1TC3C 4XLHA 4PCQA 2DK8A 2QM3A 5GP9A 2R5ZA 4A3MJ 1LQ1A 1FTZA 3FBNB 2UXXA 3CMYA 4RM2A 2OERA 1N75A 4PJNA 2LFBA 3DKXA 4LG0B 3G73A 2OTLI 3DTIA 4NUBA 4MEXF 5L3DA 1MMDA 1WZ2A 1O7FA 4HNUA 3VW1A 2ECBA 1V3FA 4E4HA 3MKYB 5DYMA 2VKEA 4OIPF 3NI7A 2XSJC 2XROA 3BPVA 2P7VB 3DP7A 4CYDA 3S8PA 3QBMA 2W48A 2VLAA 1OCPA 1O3RA 2BY2A 2KISA 3H92A 5DD4A 1TWCJ 4Y13A 1HKTA 4GCLA 4X6AJ 3ABMH 4XLAA 3MZYA 3TEDA 4ZDOA 5HDNA 3MQ0A 4HX8A 3EUHC 4HW0A 1FOWA 4BACA 3N05A 5HDKA 2DDAA 4BDYA 2VJIA 1ZTRA 5EFYA 2VXZA 5CLSA 3E0JB 1IUYA 2M5WA 3HEFA 1G8XA 1XDSA 5LBQA 3Q9VA 3G6EI 3CCLI 1DP7P 3C07A 3ANPA 2M87A 3WGHA 2CUZA 3JRHA 1IDZA 2OBPA 2NP5A 4NN1A 4MQ9F 1G3SA 1QVUA 1ZAOA 2DMTA 2DOAA 3RQ4A 1BW6A 3H5RA 2AXTC 2PJRB 2HVSA 3CMEI 2IS2A 3QKXA 3G1LA 1A31A 1QRYA 4HNTA 1BC7C 3KLOA 4M3DA 1OYIA 3G2BA 4NQWB 5D5XB 5AQCA 2ZCWA 2V1NA 4XMYA 4IHYA 3MZHA 3H0GJ 1YIOA 2JPBA 2XPWA 4Y52J 1R5GA 1U3EM 1A6QA 2QEXI 2EZHA 4B3AA 4UUSA 3FK7A 3BR3A 2F4MB 2CUEA 4FTHA 1I6HJ 2M4GA 2NOGA 2M7AA 1ORKA 3QU6A 3FMRA 4FT8A 1D5YA 3LL7A 2FMLA 4F93B 1P7IA 1A6IA 2FQ3A 2IVMA 3VVXA 1BI0A 2ETHA 2M8GX 4UDSA 3FKIJ 1Y8QB 2VQCA 4HAMA 4MFDA 1TZLA 2IBDA 4C3JJ 4CCNA 2IRFG 3HBLA 2UXUA 4EJUA 5E1XA 3V8JA 3JRDA 3F22A 2KJBA 3TDZC 3H35A 2ZXHA 3DV8A 5LHGA 2K9QA 4BE0A 4RLFA 3OY9A 3BR5A 2W00A 2MG4A 4JYKA 2E60A 4BQNA 3FWEA 2XASA 4I09A 2DJIA 2NVUB 1UHSA 3FMQA 1MH3A 1UZCA 3GUDA 4DYCA 3ZMUA 4A3FJ 4LB6B 2DXIA 5K58A 1KQ0A 1FBUA 3W2VA 4ENMA 2DG7A 3C3WA 4F91B 1ITYA 1E3PA 4EJWA 1XTAA 2YSRA 3VOKA 1U9OA 2R5YA 5J1RA 1U6GA 2ME0A 1CF7B 2H8RA 5BMZA 3LSHA 2W24A 2WV1A 2DPDA 1U0JA 2W82A 1QZYA 2ZKZA 3FXLA 4IL6C 4AWXB 3E6CC 4CGRA 1Z6TA 5F27A 1IGNA 5FKOA 3DBRB 3BJBA 1RKWA 1FSEA 1R58A 1WVRA 1UI5A 2P5VA 3M1CA 4AYBA 1V55H 5J40A 2PMZN 3BTLA 4NB5A 3KP3A 2HZTA 3FXUA 3I4PA 3GZ6A 5CW8A 3BTIA 3E5UA 4AF5A 2OD5A 3KP2A 2NX4A 4IHXA 3AAFA 3BQYA 2FA5A 2R7FA 1Z05A 3I58A 1I5ZA 3IHUA 2NRAC 1ENHA 2GWRA 5EG0B 3OS1A 2Y9ZA 5C4YA 2ELJA 2JZYA 2X6YA 4O3MA 4CA0A 1UHMA 1XCVA 2VJ5A 5HBUA 1YIJI 2WY8Q 3BHQA 1TQPA 5AIPA 4NNJA 4PJLA 1BJZA 1SMTA 1YTYA 5GPAA 3RD3A 3LFUA 4UY8I 3KEOA 2ZXJA 1SVOA 2VUMJ 3COLA 3LSPA 3PNVA 3BG7A 3ONQA 1FSHA 2KP6A 2XF7A 3IRQA 1ZG3A 2KZVA 5KK1A 5LEKA 1J2XA 1DDNA 3K7AJ 4A0ZA 2DFFA 3RQIA 5FB2A 1SD4A 1JHFA 1WI3A 5D6FA 4ZZLA 2UXNA 2PJRA 2K3PA 1I27A 2DA4A 3BJAA 3KZYA 2EA2A 3KYDB 3M1EA 3CCUI 4DVYP 4M3BA 3S1RJ 1EH6A 4NQWA 4GFLA 1Y0UA 3PNTA 3JSJA 4RBOA 2NXNB 3K2AA 1T2KA 2ZFUA 2G9WA 2RV8A 3ERMA 1TW3A 1EA3A 5HS7A 3JRGA 1ZGJA 5KCMA 1RPWA 3D5LA 2P6TA 5CYVA 4C2MJ 1SFKA 2L7KA 1IXSB 2Y48A 4IQ4A 2L2OA 3VSKA 1U78A 1TQMA 2L3DA 2H94A 1KYWA 3E97A 3CJDA 2JUGA 2XSDC 2EQRA 4II3A 1MW7A 4OU0A 4RDUA 4D1QA 4EV0A 3F23A 5HS9A 5B5EC 3HRMA 2RGVA 2RREA 4YFKF 3I0TA 4EATA 2LSOA 3GEUA 2IPQX 3GMEA 4Y4RA 3ZQFA 2IJLA 2E7XA 4D7NA 3NAUA 1SFEA 2NVXJ 2O9LA 1X19A 4Y33A 4ZTJA 5EEAA 1WJDA 2XVCA 2ZOYA 3N4MA 4N0BA 2Q2EA 1NTCA 3NPIA 3K70C 2EH3A 2EILH 3J81Z 2M3AA 3RSNA 1HOMA 5HVQC 3BR0A 4CXFA 4E7KA 2F5FA 2R7QA 4JNNA 1T56A 1SAXA 1E3OC 1HDPA 1VQLI 5FLMJ 1MKMA 1R7JA 2OI8A 3KKCA 5C3EJ 2D6YA 3M9AA 3G1MA 2NAZA 1UAAA 4ABZA 4BGDA 4JX5A 4A3DJ 3HIFA 3WTUC 3EYYA 2DODA 3J81K 4M72A 4IO9F 3OOUA 3NARA 5CKTA 1O3QA 3IH2A 1MMSA 3HTJA 5D4SA 3HOWJ 1ON2A 1KZHA 2GA1A 1Y1WJ 3NS4A 1H8AC 1R49A 4KIFA 1GVJA 2QENA 2K3FA 2HQAA 3QOPA 4UHTA 2BV6A 4W1UA 2BXZA 3J7AO 1FIAA 2BXYA 4HOBA 2BYVE 3CTAA 4M3FA 2R7ZJ 2DFIA 4BQQA 4AC0A 5DDGA 2IS6A 2YVXA 2A6EF 1FZPB 3C18A 1FP2A 2F5VA 2Z99A 3OL4A 3KZ9A 3RH2A 4PSWA 1GXPA 5GAHJ 5EG0A 2PZ9A 3BCBA 4WF2A 1YI2I 4MTEA 2FJ1A 3N97A 3VIBA 4B48A 2R7VA 1HF0A 3AL0C 4AC6A 1B4AA 1V5EA 4RB0A 4RB2C 4HRIA 2B1EA 2L9VA 2QOPA 4N4OB 4OAYA 3H3UA 2OJED 1OR7C 4GFKA 4O5VA 4WXCA 1H89C 2DA2A 1LNWA 4ENNA 4L9TA 4Y17A 5CVIA 3E6BA 4B09A 2EIJH 2VB6A 3E6DA 3CCSI 2Q0OA 1H88C 1B59A 3TKYA 2QSGX 3PUBA 3GFJA 5IT9Z 1IAWA 3GZIA 2DI3A 3RI4A 2DFEA 4KN4X 1IN5A 3SHFA 3GTLJ 3JTHA 4OINF 3TL4X 3TOBA 4RB1A 4IHVA 1VQKI 3GLLA 1TNSA 5LRSA 2LY2A 4L9JA 4U7DA 3RKYA 3WTZA 3MEXA 4LIVA 1ETQA 2CW7A 3DFGA 3E6MA 3H9JA 4HDUA 2IGOA 4KA4A 2HU9A 3EUPA 3OMYA 4RAZA 2YS9A 2X6OA 5JVTA 5IT9K 1F43A 2ZB9A 4N4NB 2DMQA 5LEJA 1P4WA 2JA5J 1G59A 2E2IJ 1TP4A 3E5QA 4B47A 1IJWC 5LGNA 1IV8A 4OOIA 3IV5A 1X3ZB 3ASOH 3QP6A 4CCJA 3ZQ7A 3GO5A 1ZELA 4ESJA 2LD5A 5F0HA 3GEZA 3EPZA 4Y3OA 2HDCA 2VASA 3GF2A 2NP3A 2A3SA 1D8KA 4ANJA 3I56I 3PQJA 3B6CA 4XQFA 4Q48A 3W6KB 1GV2A 1ULYA 2YX7A 2BVLA 4E7SA 4IEJA 1Z7UA 4A12A 2RASA 1LDJA 3PL8A 1FYLA 3GTGJ 1XPXA 2D1VA 1Z91A 2HQRA 4HZFA 4ZYEA 3K4MA 3WODF 1B8IB 5FLVA 1MNDA 1S5LC 2BE5F 4Z6YA 3S15J 1KQ8A 3SEQA 1ETYA 3VSLA 2P8TA 4HF0A 2FBIA 3HJEA 3VYTB 1S6LA 4HLYA 2M45A 4A6DA 2CJJA 4M6YA 2G7UA 3CC4I 5D5VB 3HIMA 3P9KA 1IO2A 1REPC 3TQNA 2DQRA 2YX4A 4Q47A 4ESBA 3GFLA 3TDUC 3H3VK 2KLOA 2HTSA 4P9UA 1LVKA 1X3UA 1EF4A 1J09A 4NELA 1I39A 3SZGA 3RYRA 2V9KA 1ZYRF 4E7HA 4BKXA 2L9RA 2BY0A 1LUJB 5JFRA 3PM1A 4WXHA 2MH9A 4LLNA 3S16J 3S3OA 3PJRA 2WGBA 5D19A 2VOOA 1XB4A 5H2FC 3C1DA 1WRJA 1HW5A 3C7JA 2E5ZA 2IEKA 3MD2A 3S3MA 3X2QH 1IZ1A 1U8RA 4KFCA 4YIRX 3GTQJ 4CSWA 4BY1J 3GW2A 3S1MJ 2B7EA 3BROA 3AKZA 3Q0VA 4I6ZA 4IQJA 1FX7A 2ZC2A 4CH7A 4ZYHA 2VKVA 3D1NI 3GTPJ 4PJ0C 5BPIA 1BR2A 5M5YJ 1KU2A 2K40A 2ZNYA 4I99C 1TWFJ 4OAZA 1W5CC 5DS9A 3OSFA 4CDGA 4U0YA 2Z2SB 2DA7A 2CS3A 4BJ5C 4A3BJ 5C4XJ 3EUKL 2A07F 1OCRH 5ILSA 1Y56A 4UXNA 4KITB 3GVAA 3ZP5A 3SYTA 3SFZA 3OS2A 5K5RA 3L1PA 1YG2A 1G3TA 1H0MA 2X48A 3CUOA 1VQPI 1JI8A 3H9GA 1ZK8A 3I3LA 4MO7A 3DPTA 5IP7J 3CCRI 1HCRA 3TW7A 1I3QJ 3V78A 1MSFC 3LMMA 1BI2A 4C2MA 2K4JA 2X1CA 3JAMZ 4YFNF 4IVNA 2WWYA 3Q0UA 1WJCA 2LNBA 2G3BA 1STZA 1FMVA 3VW0A 2D45A 5EGOB 1JGSA 2GENA 1AA7A 2IP2A 5E3OA 1MZBA 2ZNZA 5HLHA 1RESA 2FBQA 3HTAA 3ON2A 4L9VA 3ZRGA 3BR6A 2DCEA 2BEOA 2DA1A 3FXOA 3MZ8A 4G6TB 4YIIA 3HZJA 1FBSA 1VQNI 3I64A 1RZ4A 2JPCA 2ADUA 2QZ8A 2W4SA 2LC2A 1SC7A 3LSRA 1S7OA 3LSIA 4XKBA 4MTDA 3BCAA 2VJ4A 3GXOA 1IN8A 4M9SA 3H9QA 2VPLA 2LY9A 3G4SI 4BU2A 3UR3C 1MIJA 1OQYA 3OYGA 3KKDA 1FOXA 4DGWB 1RR7A 1EKEA 1D0XA 2ISYA 3OIQA 1OCTC 2XAGA 1KGSA 1ETXA 5IP6A 2W25A 4LLGF 3SDBA 5DM7F 1B8IA 3LSKA 3HB9A 4FX0A 1S8NA 5A2QZ 1MMNA 1KU7A 2CQXA 2E19A 5M5WJ 3CLOA 2OA4A 5E18F 3T8TA 1QBJA 2JMWA 5HLIA 2EIMH 2K86A 4B43A 4XKVA 3EETA 4PJMA 2YVHA 1ON1A 2DA6A 5DUIA 3R4KA 1ZQ3P 3ZPLA 5LFAA 2HKOA 4I0BA 1TT0A 3C2HA 3GX4X 3MMYB 3OYIA 3FHZA 5HODA 2OCCH 2OQGA 5B66C 1U8BA 5M3MJ 3HGGA 2FQ4A 5FKKA 3FDYA 1D8JA 1VQ5I 1X1DA 1UB9A 2HS5A 2OF7A 2FOWA 1CGPA 2EFPA 3OIPA 1M1EB 2WB1N 4B3XA 2KDZA 4L5IA 2QGUA 1R1VA 2PMHA 2M1BA 2UV1A 2CUJA 1ZG5A 4ZH4F 1IRFA 2YPRA 2FNAA 2QKOA 3HXLA 2Z5UA 4MQVA 4N9HA 4NC6A 2QA4I 3DTKA 2HFHA 2ME6A 1OJLA 3OYLA 2NOJB 3BP8A 2IGNA 1YHQI 2QQ8A 2VKDA 3G7RA 1P2FA 2NS8A 2EFQA 3U21A 3HYIA 3AG1H 2VIXA 4RAGA 2ZJRF 3CJRB 2JA2A 3EQLF 3H5NA 1MBEA 2ZMEB 3T8RA 3BNIA 5F0FA 1X3WB 2ZXIA 2RDPA 2BY1A 2W57A 2LREA 5IOYA 3FXMA 2A6TA 2BY3A 1TQIA 2HR3A 2OZ6A 1ONVA 3KEQA 3AQSA 4HQEA 4B4CA 1Y8RB 2ID3A 3L2QA 2KT0A 1WJEA 1OPCA 2MD5A 4IJAA 4B44A 2RC4A 1Z67A 5DTDA 3OYEA 5BQTA 1MBKA 1UG0A 1YITI 2RAEA 2CU7A 3U1KA 5D5WB 1GLNA 2WAFA 3K4NA 1WGXA 3BT9A 4AD9A 2REKA 3HUGB 3RPQA 3BJOA 3PPBA 1XGMA 3UKGA 1JUMA 2WAEA 3EDPA 1WHUA 3F6VA 2HKXA 5EGOA 5E8IA 2KPMA 3FMSA 4BXFA 1MGTA 1LJ9A 5TGTA 1D5VA 1IUFA 1D0ZA 2OAZA 1B6AA 1IRZA 2M9HA 2H8WA 4F3QA 4CYCB 3EGQA 2UXIA 4KUMA 3Q3SA 5KNLA 2RN7A 2V9VA 1FPQA 2QCOA 2MYSA 2Y75A 2VL8A 3CF2A 4XLNF 3KNWA 3TOAA 3P5JA 3WG7H 2EZKA 2HOEA 1FWZA 5TISC 4FHTA 2ZY9A 3BQZA 1GV5A 2LG4A 4YG2F 2GUHA 4D9JA 4ZJZA 3OYAA 1BL0A 2KQRA 1R6RA 2ZSHB 5GAEJ 2JA8J 1F4KA 1F5TA 5DEQA 5E3LA 2UUZA 1S72I 1T08B 2A6HF 2BOLA 2R3SA 3WU1B 1P4XA 4NBQA 1JKQC 1LDDA 3CCEI 2IGKA 1RC9A 3BG6A 2FSWA 3CF5F 3WTYC 2GOXB 2M30A 3BG5A 3K69A 2K9LA 3D0SA 2A61A 3BJ6A 2GOMA 4XNFA 1FJLA 4M3EA 3GBGA 4XK4A 5F64A 4IF4A 1BOBA 3NRVA 2M34A 3L7WA 3MVPA 2LF7A 2TDXA 1VFCA 4BQOA 2XAJA 2N8GA 1T39A 3I5UA 1BR1A 1ZGAA 3ZQHA 4BHCA 2W84A 4BXXJ 1IN4A 2O8XA 2IA0A 1X2MA 1R5ID 3O8HA 4RMNA 3U9GA 3ZGKA 1RUOA 4I2OA 2XF5A 4ZYGA 1J75A 4S04A 3CUQB 1XMXA 5JLXA 2VKHA 2WY7Q 2DPUA 4I02A 4LK1F 4UB6C 3A03A 4HNVA 3JRFA 2CV2A 3DPLC 2D2WA 2B9SA 2OUMA 2OTJI 4BHBA 1MJAA 3OYJA 1ZR2A 4XLEA 1W36D 4G6DA 3BRUA 2W7NA 2F5DA 1MJBA 5IT3A 1BA5A 4JK1X 4XKCA 3FHNA 3FX3A 1I3AA 2PQ8A 1XGNA 4HKUA 3BZCA 1TBXA 2ISZA 1D1BA 3QQAA 1V54H 3OWTA 2XAHA 5IP9J 3IH3A 1WH7A 1XSDA 3KP6A 3VOXA 3QRFF 1T8IA 3OYHA 5FO5A 1K4TA 4I98B 3DU6A 4C9YA 1JE8A 3MCZA 3F8CA 3K1MA 4M71A 4A2UA 5IPAA 1H9TA 4IHWA 1FT9A 3HUGA 2O6GE 2L9SA 2GFNA 4R79A 1YW9A 5E17F 2QYOA 2HWVA 4E7IA 3CWRA 4HG2A 4W97A 2L7FP 4HEA2 1DQUA 3L9FA 4LG0A 1UCRA 4Y7NJ 2IA2A 3ABKH 2DJNA 4ZZDA 1TTYA 2IW5A 3CCJI 4WWCA 4YELA 4XICA 4BEHB 3QYFA 1AOYA 2ID6A 4BJTA 2ICWG 4A3EJ 1UI6A 2HYFA 4PUSA 1R4MB 4X1EA 4CZZA 1WJAA 5E20A 4LGWA 2BVMA 3MKWB 3HGYA 5E3NA 2XV4S 2MC3A 1VTNC 4J19A 1I1SA 2L4MA 5F1JA 2L0KA 2HQNA 3ZMZA 3KFWX 1WI9A 5L3BA 2HPMA 2DA3A 1QPIA 1F36A 4L5JA 3I55I 3CDIA 1S29A 5B3SH 1WJBA 4IZZA 2V1DA 1WH5A 1MMAA 2V79A 3WTSC 4WIBA 1PP8F 3CESA 3O8GA 4XSXF 5EZGA 2K5CA 2X51A 4U88A 3PFYA 2QUFA 2E2JJ 3WU0A 3WTTC 3DF8A 2FJI1 2H27A 4M6XA 3DQVC 3FXJA 1UMQA 2V4JC 2E1MB 1O3TA 2HKUA 3MN2A 4H0EA 3AG4H 3BZ6A 1U2WA 3PUFA 3BY6A 2ZJPF 1A35A 5JLWA 2PN6A 4XONA 5CJ9A 1HDDC 2F5CA 3HRTA 2PLYA 5JI6A 5K5OA 3PSIA 2PX9A 3ESWB 4XORA 1QNTA 2W1OA 2PEXA 4XRSG 1TL8A 3DTEA 4PXIA 1X1BA 4GYGA 1ZRCA 4QSHA 3B6AA 1U9NA 1T6SA 2VOPA 1LE8B 3A1YA 2E35A 2VBXA 3CO7C 4UVCA 3HRSA 3H3ZA 4I0AA 3ZMDA 1DGRM 2VBWA 1K78B 2Y2ZA 2Q1ZB 1PVEA 4CO8A 2RHAA 1G6NA 2A69F 1R1TA 2COBA 2DTRA 2IU5A 2HNHA 4L9NA 2Z3YA 4ON0A 1ZREA 5CQGA 2E1OA 1PUFB 1LFBA 2XDVA 1LFUP 3BPXA 2LBFB 2V57A 2GXAA 1J9IA 4CCOA 2MSYA 2CUFA 4MLOA 4RGRA 4P5OA 3PO3J 1JJ8C 2AO9A 4HSRA 2EK5A 2X85A
chains in the Genus database with same CATH topology
1K83J 1EF4A 5EDNA 4NELA 2O7OA 1AHDP 4L62A 1MH4A 5F04A 3OIOA 4BKXA 2DN0A 2L9RA 3S14J 3PM1A 4JL3A 3S16J 2QIBA 1GUUA 1GVDA 3HOUJ 2WGBA 5D19A 5HAWA 5EZHA 4A3GJ 2R92J 1FTTA 2EBIA 2L7MP 4QTRA 2IEKA 3GTMJ 2DG8A 5FGLA 5IYDJ 3GTQJ 2DTZA 5J1YA 4BY1J 1FEXA 3S1MJ 1S7EA 2G7GA 1YRNB 3TP3A 3Q0VA 4I6ZA 1JTXA 2VKVA 3D1NI 2OPTA 3GTPJ 1MNMC 3MNLA 5M5YJ 2K40A 1TWFJ 1VI0A 1R9TJ 3CDLA 5DS9A 3OSFA 4BY7J 3JRIA 2DA7A 1TWHJ 5K7ZA 4CYCA 1ETWA 1Z0XA 2LKXA 3RZOJ 4A3BJ 5C4XJ 5CXIA 4D5FA 2JA6J 3LWJA 3RZDJ 2GBYA 1SGMA 3HOXJ 2G0EA 2LK2A 2HOTA 2R5YB 2G7SA 3L1PA 4FISA 2LVSA 2X48A 4ICHA 1ZK8A 4MO7A 2HYJA 5IYCJ 4A3LJ 1TC3C 5IP7J 4MK6A 4MFEA 2R93J 1MBGA 5GP9A 2R5ZA 4A3MJ 1HCRA 3TW7A 1I3QJ 3V78A 1MSFC 2Y0SN 1FTZA 4GCTA 3CMYA 4L5EA 2OERA 2LFBA 2NVQJ 4XRSA 3Q0UA 2G3BA 3VW0A 5EGOB 2LR8A 4JX6A 2GENA 5E3OA 3T6NA 4C3IJ 3VW1A 2NVYJ 4KWAA 2ECBA 1RESA 2G7LA 2FBQA 3HTAA 3ON2A 2XGDA 5J1UA 3BR6A 2VKEA 3NI7A 2XRLA 2DA1A 3QBMA 5M3FJ 2W48A 1APLC 1AKHB 1OCPA 1RKTA 2HQ5A 3CQZJ 1TWCJ 3JRBA 3G1OA 1W0TA 3LSRA 2XDNA 4GCLA 4X6AJ 4GCKA 3TEDA 4JP0A 2ZCNA 2M0CA 2YUSA 3E7QA 2LY9A 2YVEA 1ZTRA 4FE4A 3KKDA 5EFYA 1FIPA 1RR7A 1TWGJ 3HEFA 4NDLA 1OCTC 1JT0A 1G2HA 1ETXA 1LE8A 5C4JJ 2Q24A 3W6VA 4D5CA 5IP6A 3C07A 1B8IA 1IV6A 3HB9A 3ANPA 1IDZA 3JRHA 2CQXA 2E19A 5M5WJ 2NP5A 4NN1A 2UXOA 1QVUA 2GLOA 2CRGA 2DMTA 3VW2A 2JMWA 2XPVA 1BW6A 2MGQA 2TCTA 3QKXA 2GM4A 3G1LA 2YVHA 3HM5A 1QRYA 2DA6A 4M3DA 5AQCA 2UXHA 1ZQ3P 3A01B 4IHYA 3DPJA 3H0GJ 3B81A 2JWTA 2XPWA 4Y52J 3LNQA 2EZHA 2HDDA 4B3AA 4UUSA 3A02A 3FK7A 5HODA 3BR3A 2CUEA 1TWAJ 2FX0A 4FTHA 1U8BA 5M3MJ 3GTOJ 3HGGA 1I6HJ 2FQ4A 2JA7J 2NOGA 5FKKA 1ORKA 1JKOC 3CRJA 3SDGA 1GT0C 1D5YA 1GDTA 1P7IA 2OF7A 1A6IA 1AU7A 3HOYJ 3VVXA 2WB1N 3TW6A 2KDZA 1MSEC 2M8GX 4UDSA 2ZCMA 3FKIJ 4MFDA 4C3JJ 2GUHA 1K61A 2IBDA 3HBLA 2UXUA 3ZQIA 2QKOA 3JRDA 2ME6A 2PBXA 2K9QA 4DW6A 1YRNA 1OJLA 3BR5A 4JYKA 2MG4A 1WCMJ 3S5RA 3G7RA 3F0CA 2NS8A 1Q1VA 1UHSA 1MH3A 3LSGA 2LLKA 3PASA 4DYCA 3S1QJ 4S0HB 4A3FJ 1MBEA 5K58A 3BNIA 3LHQA 5F0FA 3HOVJ 4A3JJ 3PO2J 4A93J 3V6GA 2DG7A 5IOYA 4DYQA 1DU0A 1ITYA 5D18A 3IH4A 3VOKA 1U9OA 2R5YA 3AQSA 5J1RA 4B4CA 1NK3P 2ID3A 3ZQCA 3ANGA 2KT0A 2ME0A 5FKMA 2H8RA 3ZQGA 2W53A 5DTDA 4V2FA 2WV1A 1MBKA 2HOSA 3NNRA 2RAEA 3WHBA 2CU7A 1BW5A 2VPRA 3S2HJ 1A5JA 4CGRA 2DMPA 1IDYA 5F27A 1IGNA 1WGXA 2Y31A 3BT9A 5FKOA 5M5XJ 4DZPA 2REKA 3BJBA 1RKWA 1UI5A 3PPBA 5FKNA 3UKGA 1ETKA 1JUMA 1T33A 1CQTA 2PMZN 3NRGA 3BTLA 5EGOA 2HXIA 1ZKGA 3S17J 3BG9A 2DMNA 5CW8A 1JT6A 4BBSJ 3BTIA 4AF5A 1X2NA 1IUFA 5BNGA 3C2BA 1JJ6C 4IHXA 3M4OJ 3BQYA 1IRZA 2NX4A 2M9HA 4GFBA 4CYCB 3EGQA 2LTPA 2UXIA 1AKHA 1ENHA 3Q3SA 5EG0B 2Y9ZA 5C4YA 2QCOA 3KNWA 2O7TA 2HOAA 2EZKA 3LJLA 5HBUA 3BQZA 1XG1A 3BHQA 1GV5A 1BJZA 5FJ8J 2K9SA 5GPAA 3JREA 1BL0A 3RD3A 2VUMJ 2R5ZB 3M3YJ 2JA8J 3COLA 3LSPA 2JN6A 1OFCX 5E3LA 3VVZA 5DAJA 1JKQC 4A3KJ 4MIMA 4D7MA 3I4MJ 3K7AJ 3RQIA 1WI3A 2DMUA 2DA4A 4M3BA 3S1RJ 3BG5A 3FISA 4UUTA 2VI6A 4GFLA 3JSJA 4RBOA 3K2AA 1FJLA 3A01A 1POGA 4M3EA 3GBGA 4XK4A 2F07A 2M34A 3BG3A 1PUFA 3MVPA 1VFCA 4C3HJ 1B72B 2N8GA 1XC5A 2TRTA 3JRGA 2IAIA 3ZQHA 1RPWA 4C2MJ 2I10A 3QPLA 2HXOA 4BXXJ 2QF7A 1U78A 5CXGA 1X2MA 2O8KA 2QWTA 1ETVA 3MKLA 3O8HA 1Z77A 3QPSA 1MBHA 2XSDC 3JRAA 3CJDA 1Y1VJ 3I4NJ 2EQRA 5EYRA 4RDUA 4M3GA 3HE0A 1RETA 1IG7A 5JLXA 4QIWN 3GEUA 3ZQFA 9ANTA 4D7NA 3NAUA 1X58A 1HLVA 1ETOA 2NVXJ 2O9LA 3A03A 4HNVA 3JRFA 2ELKA 1JUPA 4AYBN 2NVTJ 5EEAA 2HYTA 2ZOYA 5J3LA 3ON4A 2NS7A 1NTCA 1ZR2A 3HOZJ 3AQTA 2EH3A 3NPIA 5IOZA 3BRUA 2HI3A 1WPKA 2XB0X 1HOMA 3BR0A 1BA5A 1JKRC 1SANA 4JNNA 1T56A 1E3OC 4HKUA 1HDPA 2ZCXA 5FLMJ 4UUSB 1LFUP 3HKZN 3ZQLA 3QQAA 5C3EJ 2OI8A 2D6YA 3KKCA 3G1MA 2FD5A 5IP9J 4A3IJ 3IH3A 1WH7A 4ABZA 1UG2A 3FIWA 3VOXA 4JX5A 2YU9J 5EF6A 4A3DJ 2H1KA 4M6VA 5FKLA 3HTIA 2WUIA 3OOUA 3NARA 3IH2A 4A3CJ 3HTJA 3HOWJ 5IPAA 3JR9A 3O60A 4IHWA 2XB5A 1Y1WJ 3SJMA 1H8AC 3TP0A 2GFNA 2B63J 1JUSA 4W1UA 3CWRA 4AUXA 1FIAA 4BBRJ 4W97A 2L7FP 4JKZA 3BTJA 2R0QC 3VP5A 3HTHA 1W0UA 4Y7NJ 4M3FA 2R7ZJ 4XRMA 2WAQN 2D5VA 2DJNA 4AC0A 3FRQA 5H9TA 4XICA 1VNDA 1O4XA 4DYRA 2ID6A 1XS9A 3KZ9A 3RH2A 3LOCA 3VUQA 5EG0A 4A3EJ 1UI6A 2PZ9A 5D1RA 3LSJA 2XGCA 3BR1A 4X1EA 2FJ1A 3WHCA 3VIBA 3HGYA 5E3NA 1HF0A 4MXMA 4AC6A 2DA5A 3S2DJ 1DU6A 3SFIA 1JGGA 4J19A 5F1JA 2QOPA 2L0KA 3E7LA 4JX4A 1ZR4A 2DA3A 1QPIA 3DCFA 2P81A 1F36A 4LOCA 1ZGWA 4ME9A 4GFKA 1H89C 2DA2A 1MBJA 2CQQA 5E3MA 2MW8A 1H88C 1NK2P 2EZLA 1QVTA 2ZOZA 1WH5A 3GZIA 4G12A 2JJ7A 3GTLJ 1I50J 3HDDA 5FMPA 3ZOBA 5HSZA 3O8GA 4IHVA 5EZGA 2K9NA 3OSGA 5K7HA 3BR2A 1MBFA 2L7ZA 4A69C 2E2JJ 5GPCA 2M2EA 5F0CA 3NXCA 2XPUA 1ETQA 4FE7A 2E2HJ 3EUPA 1UMQA 4B1RA 3Q0WA 3MN2A 2YS9A 3RKQA 2X6OA 5C44J 1B72A 2HKUA 1F43A 1JTYA 2ZB9A 2DMQA 3S1NJ 2JA5J 5JLWA 2E2IJ 4I76A 1IJWC 1HDDC 2UXPA 3IV5A 5K7FA 2LP0A 4EEFG 2X9DA 3VPRA 3JRCA 2LD5A 5F0HA 4XRSG 3P9TA 3G56A 4FCYA 1IC8A 3IUVA 4PXIA 2NP3A 1VF9A 3B6CA 2AHQA 4V2GA 3B6AA 4QSHA 1U9NA 3GTKJ 1GV2A 3DEWA 3FK6A 4IEJA 2RASA 2QTQA 1LE8B 3GTGJ 1B8IB 3VVYA 2XGEA 1P7JA 5FLVA 5FHPA 3S15J 1ETYA 2Y2ZA 3BCGA 4ACIA 3CCYA 4YZEA 2RHAA 5F08A 2COBA 2Y9YA 2IU5A 2CJJA 5IYBJ 2E1OA 1PUFB 1LFBA 4DZJA 3HIMA 2JK3A 1SFOJ 3F1BA 4XIDA 2V57A 2EZIA 2CUFA 2MSYA 2Y30A 4MLOA 3GTJJ 1JJ8C 2AO9A 1JKPC 3PO3J 3H3VK 2ECCA 3BTCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K83 J;  1EF4 A;  5EDN A;  4NEL A;  2O7O A;  1AHD P;  4L62 A;  1MH4 A;  5F04 A;  3OIO A;  4BKX A;  2DN0 A;  2L9R A;  3S14 J;  3PM1 A;  4JL3 A;  3S16 J;  2QIB A;  1GUU A;  1GVD A;  3HOU J;  2WGB A;  5D19 A;  5HAW A;  5EZH A;  4A3G J;  2R92 J;  1FTT A;  2EBI A;  2L7M P;  4QTR A;  2IEK A;  3GTM J;  2DG8 A;  5FGL A;  5IYD J;  3GTQ J;  2DTZ A;  5J1Y A;  4BY1 J;  1FEX A;  3S1M J;  1S7E A;  2G7G A;  1YRN B;  3TP3 A;  3Q0V A;  4I6Z A;  1JTX A;  2VKV A;  3D1N I;  2OPT A;  3GTP J;  1MNM C;  3MNL A;  5M5Y J;  2K40 A;  1TWF J;  1VI0 A;  1R9T J;  3CDL A;  5DS9 A;  3OSF A;  4BY7 J;  3JRI A;  2DA7 A;  1TWH J;  5K7Z A;  4CYC A;  1ETW A;  1Z0X A;  2LKX A;  3RZO J;  4A3B J;  5C4X J;  5CXI A;  4D5F A;  2JA6 J;  3LWJ A;  3RZD J;  2GBY A;  1SGM A;  3HOX J;  2G0E A;  2LK2 A;  2HOT A;  2R5Y B;  2G7S A;  3L1P A;  4FIS A;  2LVS A;  2X48 A;  4ICH A;  1ZK8 A;  4MO7 A;  2HYJ A;  5IYC J;  4A3L J;  1TC3 C;  5IP7 J;  4MK6 A;  4MFE A;  2R93 J;  1MBG A;  5GP9 A;  2R5Z A;  4A3M J;  1HCR A;  3TW7 A;  1I3Q J;  3V78 A;  1MSF C;  2Y0S N;  1FTZ A;  4GCT A;  3CMY A;  4L5E A;  2OER A;  2LFB A;  2NVQ J;  4XRS A;  3Q0U A;  2G3B A;  3VW0 A;  5EGO B;  2LR8 A;  4JX6 A;  2GEN A;  5E3O A;  3T6N A;  4C3I J;  3VW1 A;  2NVY J;  4KWA A;  2ECB A;  1RES A;  2G7L A;  2FBQ A;  3HTA A;  3ON2 A;  2XGD A;  5J1U A;  3BR6 A;  2VKE A;  3NI7 A;  2XRL A;  2DA1 A;  3QBM A;  5M3F J;  2W48 A;  1APL C;  1AKH B;  1OCP A;  1RKT A;  2HQ5 A;  3CQZ J;  1TWC J;  3JRB A;  3G1O A;  1W0T A;  3LSR A;  2XDN A;  4GCL A;  4X6A J;  4GCK A;  3TED A;  4JP0 A;  2ZCN A;  2M0C A;  2YUS A;  3E7Q A;  2LY9 A;  2YVE A;  1ZTR A;  4FE4 A;  3KKD A;  5EFY A;  1FIP A;  1RR7 A;  1TWG J;  3HEF A;  4NDL A;  1OCT C;  1JT0 A;  1G2H A;  1ETX A;  1LE8 A;  5C4J J;  2Q24 A;  3W6V A;  4D5C A;  5IP6 A;  3C07 A;  1B8I A;  1IV6 A;  3HB9 A;  3ANP A;  1IDZ A;  3JRH A;  2CQX A;  2E19 A;  5M5W J;  2NP5 A;  4NN1 A;  2UXO A;  1QVU A;  2GLO A;  2CRG A;  2DMT A;  3VW2 A;  2JMW A;  2XPV A;  1BW6 A;  2MGQ A;  2TCT A;  3QKX A;  2GM4 A;  3G1L A;  2YVH A;  3HM5 A;  1QRY A;  2DA6 A;  4M3D A;  5AQC A;  2UXH A;  1ZQ3 P;  3A01 B;  4IHY A;  3DPJ A;  3H0G J;  3B81 A;  2JWT A;  2XPW A;  4Y52 J;  3LNQ A;  2EZH A;  2HDD A;  4B3A A;  4UUS A;  3A02 A;  3FK7 A;  5HOD A;  3BR3 A;  2CUE A;  1TWA J;  2FX0 A;  4FTH A;  1U8B A;  5M3M J;  3GTO J;  3HGG A;  1I6H J;  2FQ4 A;  2JA7 J;  2NOG A;  5FKK A;  1ORK A;  1JKO C;  3CRJ A;  3SDG A;  1GT0 C;  1D5Y A;  1GDT A;  1P7I A;  2OF7 A;  1A6I A;  1AU7 A;  3HOY J;  3VVX A;  2WB1 N;  3TW6 A;  2KDZ A;  1MSE C;  2M8G X;  4UDS A;  2ZCM A;  3FKI J;  4MFD A;  4C3J J;  2GUH A;  1K61 A;  2IBD A;  3HBL A;  2UXU A;  3ZQI A;  2QKO A;  3JRD A;  2ME6 A;  2PBX A;  2K9Q A;  4DW6 A;  1YRN A;  1OJL A;  3BR5 A;  4JYK A;  2MG4 A;  1WCM J;  3S5R A;  3G7R A;  3F0C A;  2NS8 A;  1Q1V A;  1UHS A;  1MH3 A;  3LSG A;  2LLK A;  3PAS A;  4DYC A;  3S1Q J;  4S0H B;  4A3F J;  1MBE A;  5K58 A;  3BNI A;  3LHQ A;  5F0F A;  3HOV J;  4A3J J;  3PO2 J;  4A93 J;  3V6G A;  2DG7 A;  5IOY A;  4DYQ A;  1DU0 A;  1ITY A;  5D18 A;  3IH4 A;  3VOK A;  1U9O A;  2R5Y A;  3AQS A;  5J1R A;  4B4C A;  1NK3 P;  2ID3 A;  3ZQC A;  3ANG A;  2KT0 A;  2ME0 A;  5FKM A;  2H8R A;  3ZQG A;  2W53 A;  5DTD A;  4V2F A;  2WV1 A;  1MBK A;  2HOS A;  3NNR A;  2RAE A;  3WHB A;  2CU7 A;  1BW5 A;  2VPR A;  3S2H J;  1A5J A;  4CGR A;  2DMP A;  1IDY A;  5F27 A;  1IGN A;  1WGX A;  2Y31 A;  3BT9 A;  5FKO A;  5M5X J;  4DZP A;  2REK A;  3BJB A;  1RKW A;  1UI5 A;  3PPB A;  5FKN A;  3UKG A;  1ETK A;  1JUM A;  1T33 A;  1CQT A;  2PMZ N;  3NRG A;  3BTL A;  5EGO A;  2HXI A;  1ZKG A;  3S17 J;  3BG9 A;  2DMN A;  5CW8 A;  1JT6 A;  4BBS J;  3BTI A;  4AF5 A;  1X2N A;  1IUF A;  5BNG A;  3C2B A;  1JJ6 C;  4IHX A;  3M4O J;  3BQY A;  1IRZ A;  2NX4 A;  2M9H A;  4GFB A;  4CYC B;  3EGQ A;  2LTP A;  2UXI A;  1AKH A;  1ENH A;  3Q3S A;  5EG0 B;  2Y9Z A;  5C4Y A;  2QCO A;  3KNW A;  2O7T A;  2HOA A;  2EZK A;  3LJL A;  5HBU A;  3BQZ A;  1XG1 A;  3BHQ A;  1GV5 A;  1BJZ A;  5FJ8 J;  2K9S A;  5GPA A;  3JRE A;  1BL0 A;  3RD3 A;  2VUM J;  2R5Z B;  3M3Y J;  2JA8 J;  3COL A;  3LSP A;  2JN6 A;  1OFC X;  5E3L A;  3VVZ A;  5DAJ A;  1JKQ C;  4A3K J;  4MIM A;  4D7M A;  3I4M J;  3K7A J;  3RQI A;  1WI3 A;  2DMU A;  2DA4 A;  4M3B A;  3S1R J;  3BG5 A;  3FIS A;  4UUT A;  2VI6 A;  4GFL A;  3JSJ A;  4RBO A;  3K2A A;  1FJL A;  3A01 A;  1POG A;  4M3E A;  3GBG A;  4XK4 A;  2F07 A;  2M34 A;  3BG3 A;  1PUF A;  3MVP A;  1VFC A;  4C3H J;  1B72 B;  2N8G A;  1XC5 A;  2TRT A;  3JRG A;  2IAI A;  3ZQH A;  1RPW A;  4C2M J;  2I10 A;  3QPL A;  2HXO A;  4BXX J;  2QF7 A;  1U78 A;  5CXG A;  1X2M A;  2O8K A;  2QWT A;  1ETV A;  3MKL A;  3O8H A;  1Z77 A;  3QPS A;  1MBH A;  2XSD C;  3JRA A;  3CJD A;  1Y1V J;  3I4N J;  2EQR A;  5EYR A;  4RDU A;  4M3G A;  3HE0 A;  1RET A;  1IG7 A;  5JLX A;  4QIW N;  3GEU A;  3ZQF A;  9ANT A;  4D7N A;  3NAU A;  1X58 A;  1HLV A;  1ETO A;  2NVX J;  2O9L A;  3A03 A;  4HNV A;  3JRF A;  2ELK A;  1JUP A;  4AYB N;  2NVT J;  5EEA A;  2HYT A;  2ZOY A;  5J3L A;  3ON4 A;  2NS7 A;  1NTC A;  1ZR2 A;  3HOZ J;  3AQT A;  2EH3 A;  3NPI A;  5IOZ A;  3BRU A;  2HI3 A;  1WPK A;  2XB0 X;  1HOM A;  3BR0 A;  1BA5 A;  1JKR C;  1SAN A;  4JNN A;  1T56 A;  1E3O C;  4HKU A;  1HDP A;  2ZCX A;  5FLM J;  4UUS B;  1LFU P;  3HKZ N;  3ZQL A;  3QQA A;  5C3E J;  2OI8 A;  2D6Y A;  3KKC A;  3G1M A;  2FD5 A;  5IP9 J;  4A3I J;  3IH3 A;  1WH7 A;  4ABZ A;  1UG2 A;  3FIW A;  3VOX A;  4JX5 A;  2YU9 J;  5EF6 A;  4A3D J;  2H1K A;  4M6V A;  5FKL A;  3HTI A;  2WUI A;  3OOU A;  3NAR A;  3IH2 A;  4A3C J;  3HTJ A;  3HOW J;  5IPA A;  3JR9 A;  3O60 A;  4IHW A;  2XB5 A;  1Y1W J;  3SJM A;  1H8A C;  3TP0 A;  2GFN A;  2B63 J;  1JUS A;  4W1U A;  3CWR A;  4AUX A;  1FIA A;  4BBR J;  4W97 A;  2L7F P;  4JKZ A;  3BTJ A;  2R0Q C;  3VP5 A;  3HTH A;  1W0U A;  4Y7N J;  4M3F A;  2R7Z J;  4XRM A;  2WAQ N;  2D5V A;  2DJN A;  4AC0 A;  3FRQ A;  5H9T A;  4XIC A;  1VND A;  1O4X A;  4DYR A;  2ID6 A;  1XS9 A;  3KZ9 A;  3RH2 A;  3LOC A;  3VUQ A;  5EG0 A;  4A3E J;  1UI6 A;  2PZ9 A;  5D1R A;  3LSJ A;  2XGC A;  3BR1 A;  4X1E A;  2FJ1 A;  3WHC A;  3VIB A;  3HGY A;  5E3N A;  1HF0 A;  4MXM A;  4AC6 A;  2DA5 A;  3S2D J;  1DU6 A;  3SFI A;  1JGG A;  4J19 A;  5F1J A;  2QOP A;  2L0K A;  3E7L A;  4JX4 A;  1ZR4 A;  2DA3 A;  1QPI A;  3DCF A;  2P81 A;  1F36 A;  4LOC A;  1ZGW A;  4ME9 A;  4GFK A;  1H89 C;  2DA2 A;  1MBJ A;  2CQQ A;  5E3M A;  2MW8 A;  1H88 C;  1NK2 P;  2EZL A;  1QVT A;  2ZOZ A;  1WH5 A;  3GZI A;  4G12 A;  2JJ7 A;  3GTL J;  1I50 J;  3HDD A;  5FMP A;  3ZOB A;  5HSZ A;  3O8G A;  4IHV A;  5EZG A;  2K9N A;  3OSG A;  5K7H A;  3BR2 A;  1MBF A;  2L7Z A;  4A69 C;  2E2J J;  5GPC A;  2M2E A;  5F0C A;  3NXC A;  2XPU A;  1ETQ A;  4FE7 A;  2E2H J;  3EUP A;  1UMQ A;  4B1R A;  3Q0W A;  3MN2 A;  2YS9 A;  3RKQ A;  2X6O A;  5C44 J;  1B72 A;  2HKU A;  1F43 A;  1JTY A;  2ZB9 A;  2DMQ A;  3S1N J;  2JA5 J;  5JLW A;  2E2I J;  4I76 A;  1IJW C;  1HDD C;  2UXP A;  3IV5 A;  5K7F A;  2LP0 A;  4EEF G;  2X9D A;  3VPR A;  3JRC A;  2LD5 A;  5F0H A;  4XRS G;  3P9T A;  3G56 A;  4FCY A;  1IC8 A;  3IUV A;  4PXI A;  2NP3 A;  1VF9 A;  3B6C A;  2AHQ A;  4V2G A;  3B6A A;  4QSH A;  1U9N A;  3GTK J;  1GV2 A;  3DEW A;  3FK6 A;  4IEJ A;  2RAS A;  2QTQ A;  1LE8 B;  3GTG J;  1B8I B;  3VVY A;  2XGE A;  1P7J A;  5FLV A;  5FHP A;  3S15 J;  1ETY A;  2Y2Z A;  3BCG A;  4ACI A;  3CCY A;  4YZE A;  2RHA A;  5F08 A;  2COB A;  2Y9Y A;  2IU5 A;  2CJJ A;  5IYB J;  2E1O A;  1PUF B;  1LFB A;  4DZJ A;  3HIM A;  2JK3 A;  1SFO J;  3F1B A;  4XID A;  2V57 A;  2EZI A;  2CUF A;  2MSY A;  2Y30 A;  4MLO A;  3GTJ J;  1JJ8 C;  2AO9 A;  1JKP C;  3PO3 J;  3H3V K;  2ECC A;  3BTC A; 
#chains in the Genus database with same CATH topology
 1LFP A;  5EDN A;  3RYP A;  2QWW A;  2EFN A;  5H6Q A;  2JRM A;  2WV0 A;  2P6S A;  1AHD P;  1FLI A;  4XLC A;  3S14 J;  1ZRD A;  4RGX A;  2NNY A;  1CF7 A;  2O5R A;  1OMI A;  1PJR A;  3T5X A;  2QIB A;  1T95 A;  1GUU A;  4AIJ A;  3HOU J;  3I9V 2;  5BPD A;  1R22 A;  2L7M P;  4LMY A;  4QTR A;  3L2U A;  5FGL A;  4PGH A;  3AG3 H;  1YRN B;  3TP3 A;  4BEH A;  1SFX A;  4IHS A;  2P0W A;  4HV5 A;  3MNL A;  4RGU A;  3WTX C;  1IN7 A;  2ZSI B;  2X6X A;  4EQQ A;  1RRJ A;  5K5Q A;  3WTV C;  3PIO F;  2WC2 A;  1R9T J;  4CCL A;  3JRI A;  2CSO A;  1Z7L A;  5GAG J;  2O61 A;  2EIK H;  3F8F A;  2L9N A;  3FXK A;  3JCU C;  1GHC A;  5CXI A;  1V4R A;  2DYS H;  2VC0 A;  4D5F A;  2JA6 J;  4LIT A;  4P55 A;  2WTE A;  4C30 A;  4KT6 A;  2GBY A;  2FBH A;  3OYD A;  1BIB A;  4KYW A;  4EGZ A;  3IKV A;  1SGM A;  2HOT A;  2QLZ A;  4E7J A;  2G7S A;  3M8F A;  4AIK A;  4EMS A;  1XN7 A;  4A3L J;  2WB1 A;  4KMU X;  4MK6 A;  2ACJ A;  1YQA A;  2R93 J;  1MBG A;  3LSM A;  1FOK A;  2EJR A;  2Y0S N;  5H20 A;  5JHF A;  1LPQ A;  2CQK A;  2NVQ J;  4XRS A;  3HOT A;  2LKP A;  2KRH A;  4IRH A;  3VOD A;  4JX6 A;  4BNC A;  3IAM 2;  2NVY J;  1I1G A;  2I8D A;  3ZMV A;  1EH8 A;  2WAD A;  4A0Y A;  5J1U A;  4S05 A;  3Q5F A;  1YJ9 I;  3AG2 H;  3KYL A;  1UHW A;  2L01 A;  5CVJ A;  1SEU A;  5M3F J;  4U87 A;  1PDN C;  2LY1 A;  2V7F A;  5L3F A;  1RR8 C;  1AKH B;  3ZMT A;  3CDH A;  1VQ8 I;  1RKT A;  2HQ5 A;  3CQZ J;  3WE3 A;  1HW1 A;  3JRB A;  1W0T A;  2XDN A;  2F2E A;  3ZXS A;  3TGN A;  3REO A;  4GCK A;  2B0L A;  4JP0 A;  1SAU A;  2XHK A;  1Z3Y A;  1NHA A;  4RAY A;  5DUK A;  3E7Q A;  2H6C A;  5B1B H;  3RDI A;  4FE4 A;  4EVI A;  1TT5 B;  1HC8 A;  1FIP A;  3NQO A;  3VEP A;  4F55 A;  1H9G A;  1X1P A;  3I53 A;  3KEY A;  3M7G A;  3SZP A;  1LE8 A;  2LF8 A;  5C4J J;  1Z21 A;  3K4J A;  1IV6 A;  5HDG A;  1K78 A;  3KLN A;  3V7C A;  2UXO A;  3FM3 A;  3KYC B;  1LEA A;  2CRG A;  3M07 A;  3VW2 A;  2XPV A;  1SVM A;  2TCT A;  2DAO A;  4GDF A;  1HQC A;  4F7Z A;  2GM4 A;  1W4M A;  3HSR A;  3HM5 A;  4MHG A;  2LBF A;  2P7C B;  2XAQ A;  2UXH A;  3G3Z A;  3HTU A;  3OR2 C;  1C0W A;  4DJA A;  3A02 A;  2CWE A;  2V6E A;  2FX0 A;  1VQM I;  3AFH A;  3ELK A;  1JKO C;  3CRJ A;  3SDG A;  1GT0 C;  2FXA A;  3ISP A;  2QSH X;  5HNH A;  1GDT A;  3LA7 A;  5TRD A;  1AU7 A;  3HOY J;  3GCM A;  2KIM A;  1XGS A;  3IC7 A;  1QQI A;  2ZCM A;  1S9H A;  1K6O A;  1YJW I;  4BE2 A;  3ZQI A;  3FXR A;  4L0Y B;  2YR2 A;  1LKX A;  3QOE A;  2O3F A;  2PBX A;  1YRN A;  3K4B A;  3O3K A;  5DCM B;  1WCM J;  2BW3 B;  5ED4 A;  2R7S A;  1E17 A;  3E5X A;  2XRN A;  3LSG A;  4JQF A;  4E6K G;  3PAS A;  3FBI B;  3SWH A;  1MDM B;  3S1Q J;  4S0H B;  3OYF A;  1V5F A;  4DOZ A;  4CUG A;  3HOV J;  3PO2 J;  4A93 J;  3V6G A;  1K6Y A;  4BUP A;  5ICE A;  3DBH B;  4RLQ A;  5ILU A;  1DU0 A;  5D18 A;  2H6B A;  4MEY F;  2CFO A;  5ICF A;  1XCB A;  2KIF A;  1NK3 P;  5FKM A;  5LHI A;  3J7A Y;  1DPR A;  2X1E A;  2K4B A;  2GA2 A;  2HOS A;  3NNR A;  3VYU B;  3TO9 A;  3WHB A;  2FMY A;  2VPR A;  5D5U B;  2MAB A;  4Y15 A;  5FRN A;  1GXQ A;  1IDY A;  1O57 A;  4CZC A;  4RM3 A;  1Z6R A;  4OWR B;  1OKR A;  4QPO A;  2F6C A;  2ZXW H;  5FKN A;  5J4Y A;  1ETK A;  4A5N A;  1CQT A;  1T33 A;  1B1B A;  3I54 A;  1ZH5 A;  1ZKG A;  3BLY A;  2KIU A;  4OMZ A;  1Q1H A;  4KMF A;  4J01 A;  4P96 A;  5KAF C;  4RGS A;  1JT6 A;  4BBS J;  4AIH A;  3VTI A;  1X2N A;  5BNG A;  4HX4 A;  1Z9C A;  3OYB A;  3IKT A;  1J7K A;  1YS6 A;  1ZLJ A;  4ITV A;  1AKH A;  2FE3 A;  3IP4 B;  1OYW A;  3PNY A;  1D0Y A;  2RQP A;  2O7T A;  2JQ7 A;  2VN2 A;  3J80 Z;  3LJL A;  2VBZ A;  1XG1 A;  4HST A;  4KIS A;  4ZDL A;  2M0M A;  5FJ8 J;  2J5O A;  2JUC A;  2K9S A;  2DFH A;  1VQO I;  2R5Z B;  3M3Y J;  1D3Y A;  2JN6 A;  5F6F A;  1OFC X;  4KNY A;  2GXG A;  3ULQ B;  3VVZ A;  4UB8 C;  4KDP A;  2AQE A;  2XKP A;  3PQK A;  1X4O A;  2KRF A;  2HEO A;  2DT5 A;  5DAJ A;  5BS6 A;  4A3K J;  4MIM A;  4G7Z F;  3K9T A;  5JR3 A;  1ZG1 A;  1XMK A;  2F4I A;  4MNU A;  4UV9 A;  4ZDP A;  4D7M A;  3J80 K;  2OV7 A;  1O3S A;  1IW7 F;  1VQ7 I;  3KIO A;  3LAJ A;  2DMU A;  3ERE D;  1A36 A;  2PMZ A;  2HVR A;  3DXJ F;  5HLG A;  4M73 A;  1XGO A;  3FIS A;  3GFM A;  2Z16 A;  2K85 A;  1RI7 A;  2V1X A;  3GWZ A;  1DP3 A;  4PDK A;  2LKS A;  4GCV A;  1YYV A;  2XAU A;  5DV5 A;  5J6X A;  4U0V A;  1FY7 A;  4B8X A;  1KON A;  3WTW C;  1XC5 A;  3K4C A;  3KET A;  1ZRF A;  2I10 A;  3QPL A;  4IOA F;  2QF7 A;  5CXG A;  2O8K A;  3DEU A;  5D4R A;  2HVQ A;  3MKL A;  3SXY A;  3JRA A;  1MBH A;  3CC2 I;  4HV6 A;  1Y1V J;  4X0G A;  3LQR A;  4EJT A;  5LGT A;  1ZN2 A;  2LOO A;  1ODD A;  1N25 A;  3HE0 A;  2MA3 A;  4QIW N;  2IA1 A;  3CO6 C;  2DQL A;  2OC6 A;  4A0X A;  2V6C A;  1FC3 A;  1HLV A;  1ETO A;  3K8P C;  3TMO A;  1OCZ H;  2ELK A;  4I01 A;  3S3N A;  5DCM A;  1QPM A;  2E1N A;  5J3L A;  2KIQ A;  4HDV A;  2EV0 A;  2BW3 A;  4IPA A;  2NS7 A;  3HOZ J;  5EJC A;  1NG6 A;  2VT2 A;  1XX5 A;  2VBY A;  1MDM A;  4WXD A;  1R1U A;  4CHU A;  2K9M A;  1PYV A;  1IXR C;  2EWN A;  3ASN H;  3Q9S A;  1FP1 D;  3HKZ N;  5CVU A;  5LLQ A;  4UUS B;  2R7R A;  2E7W A;  2J5P A;  3LWF A;  4E7L A;  2FD5 A;  2OCE A;  3F8N A;  4A3I J;  1W36 C;  2LDU A;  1UG2 A;  5K1Y A;  2IS4 A;  2WA0 A;  2H1K A;  4A6E A;  4OIQ F;  5FKL A;  3HTI A;  1XD7 A;  1Y39 A;  3A4C A;  4ETS A;  5J8F A;  3COA C;  4RA2 A;  3U2R A;  4OD5 A;  3SJM A;  1PUE E;  1N77 A;  3CMM A;  5KVR A;  3WG9 A;  1YO5 C;  1SMY F;  1KQ9 A;  3K10 A;  4AUX A;  2KRC A;  3CCM I;  4BBR J;  2O0Y A;  5FRM A;  3VP5 A;  3PFI A;  2WAQ N;  3RCO A;  4XRM A;  3FRQ A;  5H9T A;  4HF2 A;  1BI1 A;  4G7H F;  4XM3 A;  2DLL A;  2CO5 A;  4DBQ A;  3LOC A;  4M74 A;  2FBK A;  5GTI C;  3R61 A;  4LG3 A;  5D1R A;  1J5Y A;  4N9I A;  4GYI A;  3VOE A;  2KKO A;  1FYM A;  1YS7 A;  1LB2 A;  3ABL H;  1HST A;  2F4O B;  2XF6 A;  4TV7 A;  5H6R A;  1DU6 A;  4U0W A;  1JGG A;  3LAP A;  3E7L A;  1F9N A;  3TO6 A;  3L2V A;  4IOC F;  3VFZ A;  4LFU A;  4MGR A;  1SD5 A;  2JVH A;  1HSJ A;  4PGG A;  3DCF A;  2P81 A;  4PFP A;  4LOC A;  2RKH A;  1D1A A;  1QZZ A;  1MMG A;  3MAJ A;  1BJA A;  1FMW A;  3GLX A;  2EZL A;  3WE2 A;  3K1P A;  4LK0 F;  3CD6 I;  3P9I A;  1JHH A;  4G12 A;  1E0E A;  1B9M A;  2JTV A;  3QPT A;  3HDD A;  5FMP A;  3ZOB A;  5HSZ A;  1NH3 A;  3K2Z A;  1S7A A;  2ZBK A;  2M7B A;  4G8X A;  5EEG A;  3BR2 A;  5HNF A;  3K6G A;  5GPC A;  2M2E A;  3E1S A;  3D5S C;  1EH7 A;  3FF5 A;  2XPU A;  5FD6 A;  1A04 A;  3TBI A;  4FE7 A;  4HF1 A;  2B3W A;  4B1R A;  4LD5 A;  3R0A A;  3LFK A;  3OR1 C;  3Q0W A;  4AID A;  5C44 J;  2XUB A;  3OYC A;  2FRH A;  3GZN B;  2KHM A;  4UV8 A;  4F92 B;  2A5Y B;  2I5U A;  2CYY A;  3MFK A;  2DYR H;  4E7Z A;  4WX9 A;  5E1W A;  2CW8 A;  3NWT A;  2LP0 A;  4EEF G;  5CPR B;  2RNG A;  4ZYD A;  3ZN1 A;  2DOF A;  2P5K A;  1SFU A;  4RAF A;  3RKX A;  2H09 A;  3P9T A;  3G56 A;  4FCY A;  1IC8 A;  2CV1 A;  3IUV A;  3D5R C;  1XSV A;  2E1M C;  4BH9 A;  1IN6 A;  3H5A A;  3WGG A;  1G4D A;  5L3E A;  1YJN I;  3IWF A;  2Y0S A;  3DEW A;  3FK6 A;  3KP5 A;  3T0Y A;  2VE9 A;  4V19 K;  2QTQ A;  1XSX A;  2XKO A;  1X4P A;  2BHY A;  2XGE A;  1P7J A;  1TLH B;  5FHP A;  2R4G A;  3BCG A;  4ACI A;  3QU3 A;  3LA2 A;  3CCY A;  4HYE A;  4EM2 A;  2Y9Y A;  1U5T B;  3L2C A;  3SEZ A;  2E5N A;  2JK3 A;  5KHD A;  3G71 I;  2DK5 A;  2ZME A;  3JSP A;  2Y30 A;  3GTJ J;  1JKP C;  1AWC A;  2ECC A;  2HZD A;  2NVT J;  1K83 J;  2FU4 A;  2HYG D;  3DLA A;  1S3J A;  3HG9 A;  2P4W A;  1IXC A;  2O7O A;  4L62 A;  1MH4 A;  5F04 A;  2CQ7 A;  4R8H A;  2GQQ A;  2EV6 A;  4BS9 A;  1J59 A;  2KL4 A;  3O2P E;  1T38 A;  2QKL B;  4XN0 A;  3R0J A;  4J00 A;  1GVD A;  2CGP A;  4BJ6 C;  5HAW A;  4A3G J;  5HS8 A;  2R92 J;  1FTT A;  5DM6 F;  3T1B A;  2EBI A;  4YIF A;  4FET A;  3GTM J;  2DG8 A;  3S32 A;  5F1R A;  5ICG A;  2Q2E B;  4HA8 A;  4AVP A;  5IYD J;  4BQA A;  5J1Y A;  4DBR A;  1OCC H;  2X4H A;  3FXQ A;  3JW4 A;  3KX2 A;  3MWM A;  4HLX A;  4DIQ A;  1T98 A;  2PJP A;  1W5S A;  1IRX A;  2RNJ A;  4PJJ A;  2VJJ A;  2QVO A;  5CVR A;  5EEH A;  4A5M A;  4PZJ A;  1MNM C;  4LIU A;  4EJO A;  4C2U A;  3A2K A;  4D0P A;  2JSP A;  3S2W A;  3ZN0 A;  2AQF A;  2R7O A;  3BOQ A;  2F5E A;  5FGM A;  4BY7 J;  2QQB A;  2ZO4 A;  2HTJ A;  4HQM A;  4CYC A;  3RZO J;  4GGG A;  1VQ9 I;  1Z0X A;  2FEZ A;  3K0L A;  2UZK A;  4IRI A;  1L3L A;  2R7T A;  1BOA A;  3RZD J;  3H0D A;  2A2F X;  1X1C A;  3HOX J;  2G0E A;  2LK2 A;  4Q4Z F;  2Z33 A;  4QLC U;  5LGU A;  4FIS A;  1BBY A;  4KIC A;  3CC7 I;  3O6B B;  1T0F A;  5IYC J;  4MFE A;  2BZT A;  4U9L A;  4GCT A;  4L5E A;  4FAS D;  3MKZ A;  2CMP A;  3HRU A;  1RIO H;  1YW7 A;  2LR8 A;  2PMU A;  2NNN A;  4ENK A;  4GRI A;  4C3I J;  3T6N A;  1TW2 A;  1VQ6 I;  4KWA A;  2LMD A;  2G7L A;  2COM A;  1V5G A;  3DEE A;  4DQ2 A;  2A5W A;  1ZHF A;  2XGD A;  1YE9 A;  5J8C A;  5LHH A;  1SD6 A;  2XRL A;  4XL9 A;  2CH0 A;  2PFB A;  1APL C;  2DDB A;  3OL3 A;  2CQN A;  3G1O A;  2ESH A;  1Y6I A;  3OOP A;  4H4K C;  4XKW A;  4XLP F;  1R36 A;  5J4V A;  1MD0 A;  3CZ6 A;  2XAF A;  1BI3 A;  3CLQ A;  2M0C A;  2ZCN A;  2YUS A;  4QWQ A;  2YVE A;  1YX3 A;  1RUN A;  1TWG J;  4NDL A;  2FNP A;  1JT0 A;  1G2H A;  2Q24 A;  3W6V A;  4D5C A;  3CUQ A;  3P9C A;  3K4L A;  5CQE A;  5KAI C;  3V4G A;  1FOY A;  3W3C A;  2KFD A;  4DNC A;  4F52 A;  2GZW A;  5B1A H;  1UEL B;  2GLO A;  1WQ2 A;  2HDW A;  2MGQ A;  2CW0 F;  1U5T A;  3NEU A;  2IGM A;  2O03 A;  2QKM B;  1HKS A;  5ERI A;  2STW A;  1ACI A;  4BDZ A;  1IRG A;  2V9P A;  2EIN H;  3A01 B;  3B73 A;  3DPJ A;  3B81 A;  2JWT A;  4OIO F;  3LNQ A;  2HDD A;  3RTR A;  1LDK B;  3NWS A;  1TWA J;  1Z1D A;  3K4K A;  3GTO J;  1ERD A;  1OIS A;  2JA7 J;  1WJ5 A;  1MJ9 A;  4P9F A;  3A0H C;  4IRG A;  4BL0 B;  2X6W A;  3TW6 A;  2PBI A;  3CMA I;  4EM0 B;  1MSE C;  4K2E A;  3KP4 A;  4L18 B;  1QHH D;  2HGC A;  1K61 A;  2EA4 A;  4NC8 A;  4XOP A;  1BM9 A;  4DW6 A;  3LQQ A;  2VQG A;  3DKW A;  2DU9 A;  3J7Y J;  3F9K A;  4AM3 A;  3S5R A;  1OCO H;  3F0C A;  1BC8 C;  1Q1V A;  2LLK A;  5L3G A;  2L54 A;  5FFX A;  3M8E A;  1YX5 A;  1QHG A;  3S93 A;  3DBL B;  3QOD A;  4ESF A;  3LHQ A;  4A3J J;  4ZTF A;  3VDX A;  5BOX A;  2XIG A;  4ENJ A;  2A68 F;  4DYQ A;  2E71 A;  2P5L C;  4KT5 C;  3IH4 A;  2OU2 A;  3GYH X;  4RS8 A;  3ZQC A;  1WSU A;  5FLX Z;  4Q5S F;  3ANG A;  2DT7 B;  2MD0 A;  3LST A;  3ZQG A;  2W53 A;  2JT1 A;  4V2F A;  2MC4 A;  3GZ5 A;  1HKQ A;  3ECH A;  4LJZ F;  3OYM A;  1UST A;  5GAD J;  1BW5 A;  3E3V A;  1A5J A;  3EYI A;  2DMP A;  1ZAR A;  2RVC A;  2V26 A;  2Y31 A;  4YRV A;  1YOV B;  5M5X J;  1WFX A;  4DZP A;  3FZV A;  1YFH A;  1W5T A;  1YW8 A;  3KP7 A;  5JVG F;  3HSE A;  4JOM A;  2EV5 A;  3NRG A;  2HXI A;  4NC7 A;  3EUH A;  3S17 J;  1QZE A;  3BG9 A;  4I7H A;  5FLX K;  2DMN A;  2QQA A;  2CFX A;  2VE8 A;  4NHJ A;  3C2B A;  1JJ6 C;  3M4O J;  2NYX A;  4IRV A;  4PSX A;  4M9Z A;  2CG4 A;  3DPU A;  4GFB A;  1K79 A;  2LTP A;  1EJ9 A;  2OQR A;  2W85 A;  2EPF A;  4KN7 X;  3HKZ A;  4PFO A;  1Z3X A;  3U1D A;  2G7H A;  4CCM A;  2HOA A;  2XGX A;  3BC8 A;  2VT3 A;  4BAY A;  3HSF A;  4KJZ A;  4IXA A;  3VYR B;  3JRE A;  2YU3 A;  2MBF A;  4G9Y A;  3L00 A;  3V42 A;  1KA8 A;  4GXO A;  1I6X A;  3DLL F;  2BHZ A;  1P6R A;  1W7P B;  4XN3 A;  1J0R A;  3QYE A;  2IT0 A;  3ROU A;  4E70 A;  1L0O C;  4YEJ A;  3JTG A;  1W7P D;  2BGC A;  3I4M J;  1ZLK A;  4HPQ A;  3L09 A;  1LVA A;  2K7L A;  3BZK A;  4CIC A;  4CCK A;  2DBB A;  2WAQ A;  4RB3 C;  2OZU A;  4BE1 A;  3SZT A;  3PIP F;  3OYK A;  4UUT A;  2L4A A;  2VI6 A;  3KE2 A;  2DOE A;  3A01 A;  1POG A;  4U7B A;  3BDD A;  2F07 A;  1TNT A;  5AIQ A;  3BG3 A;  1PUF A;  5IY5 H;  5AON A;  3HL2 A;  1XDU A;  3FKJ A;  3ZR8 X;  2UWM A;  3CCV I;  4C3H J;  4WCG A;  1B72 B;  2PG4 A;  2TRT A;  2IAI A;  3WU2 C;  3M8J A;  2RQQ A;  2HXO A;  1DGW Y;  2DW4 A;  3SQN A;  2QWT A;  3V8L A;  1ETV A;  2DT6 A;  1Z77 A;  1HXD A;  3QPS A;  1OYY A;  3I4N J;  2ESN A;  3TO7 A;  3K70 D;  5EYR A;  2K02 A;  4M3G A;  1O7L A;  5CVV A;  5DD8 A;  1RET A;  1WKM A;  1IG7 A;  5HLT A;  3ABU A;  3DU5 A;  9ANT A;  3RIR A;  4M9X A;  1X58 A;  1SD7 A;  2K27 A;  1R71 A;  4L0Z B;  2L02 A;  6PAX A;  3IWZ A;  4C2T A;  1JUP A;  4AYB N;  2HYT A;  1WJF A;  3ZMS A;  2L5Q A;  3RPU D;  2IXS A;  3ON4 A;  3QWL A;  1XMA A;  1RNL A;  3AQT A;  2E34 A;  1R00 A;  3P7N A;  2C6Y A;  1KYZ A;  4BXU A;  5IOZ A;  1HW2 A;  2HI3 A;  3W2W A;  2QSF X;  1WPK A;  2GAU A;  3ML6 A;  2XB0 X;  3K1N A;  1P9Q C;  1HBX G;  1JKR C;  4UVB A;  3CCQ I;  4HX7 A;  1SAN A;  2MH2 A;  4LLL A;  3KPH A;  5E1Z B;  5FRO A;  1HA8 A;  2ZCX A;  5L3C A;  3RJP A;  1YLF A;  4IX7 A;  3ZQL A;  2M4K A;  3I59 B;  2Z9O A;  4AU7 A;  3FIW A;  3HTS B;  2YU9 J;  5EF6 A;  1OLT A;  4M6V A;  1K4S A;  2A05 A;  2WUI A;  2FOK A;  4CGZ A;  2ELH A;  4A3C J;  3JR9 A;  3O60 A;  2ZFW A;  2XB5 A;  4Z2Y A;  1G3W A;  3BWG A;  4OIR F;  1LEB A;  3TP0 A;  4EM1 A;  3VB2 A;  1UJ8 A;  5GTH C;  3L2R A;  5D6E A;  4EJV A;  1JUS A;  2B63 J;  2ZME C;  2AS5 F;  3AL0 B;  3W6J B;  3QPH A;  4XSZ F;  3CJQ B;  4JKZ A;  3BTJ A;  2R0Q C;  2QBY B;  2QQ9 A;  2PI0 A;  1DPU A;  1W0U A;  4OMY A;  3HTH A;  4IKF A;  2D5V A;  3GFI A;  3ZCO A;  1IF1 A;  1JXS A;  1VND A;  5FD5 A;  3VWB A;  1O4X A;  5D8K B;  4DYR A;  1XS9 A;  3VUQ A;  2GIV A;  5TJJ A;  2V1U A;  3LSJ A;  2XGC A;  3BR1 A;  2VC1 A;  1P92 A;  5ICC A;  2ZJQ F;  4BHP A;  3WHC A;  4MXM A;  3RKW A;  3F3X A;  2DA5 A;  4O6J A;  3S2D J;  3SFI A;  3DKY A;  1KU3 A;  3QYB A;  1WWX A;  4JX4 A;  1ZR4 A;  1ZGW A;  2R7D A;  4ME9 A;  4XBF A;  1VQ4 I;  2NS0 A;  1MBJ A;  3KZI C;  5E79 C;  1KU9 A;  2CQQ A;  4U9N A;  1W7P A;  5E3M A;  2F48 A;  2MW8 A;  2VXD A;  5DCF A;  1NK2 P;  1QVT A;  3ZQQ A;  2ZOZ A;  2JRT A;  1USS A;  3HPH A;  1DUX C;  2LH9 A;  2JJ7 A;  3CJT B;  2MLK A;  1I50 J;  3VYS B;  2D1H A;  1P4A A;  3UNG C;  2K9N A;  2X0L A;  3OSG A;  5E8G A;  2Y69 H;  2HPI A;  5K7H A;  2STT A;  1MBF A;  2L7Z A;  4A69 C;  4AVZ A;  1E2X A;  5F0C A;  3NXC A;  5ILV A;  3L2W A;  4EGY A;  3IAS 2;  4XRF A;  5LD2 C;  2E2H J;  4G7O F;  1T0F C;  1QGP A;  3H1C A;  4XOT A;  5D8L B;  3RKQ A;  3JAM K;  1B72 A;  1MNE A;  1FBQ A;  1JTY A;  1PP7 U;  2VQL A;  2R7X A;  3S1N J;  2LYC A;  5HOO A;  4ZC3 A;  4I76 A;  2UXP A;  1Y0N A;  3ABT A;  2X1D A;  2E36 A;  4OD4 A;  3OV8 A;  3C2G A;  3R60 A;  3R6S A;  1F1Z A;  2DO7 A;  3JSO A;  5K7F A;  1BR4 A;  2GXB A;  2X9D A;  3VPR A;  4II2 A;  3JRC A;  2EFO A;  2VOD A;  2KMU A;  4UVA A;  4IHT A;  1VF9 A;  1X1A A;  2AHQ A;  3CP2 A;  4V2G A;  3DWL E;  3RPU A;  3HHH A;  4ASN A;  3FM5 A;  2VON A;  3GTK J;  4XLF A;  2AXL A;  4QPQ A;  3KCC A;  2KZG A;  4G6Q A;  4KIB A;  2GIZ A;  3IUO A;  2E1C A;  2MLG A;  3VVY A;  1D1C A;  3QAH A;  2EB7 A;  3HPG A;  3A0B C;  2ZJ2 A;  3HC7 A;  4YZE A;  3IRR A;  3PSF A;  4LB5 A;  1G3Y A;  3QP5 A;  5F08 A;  2IS1 A;  1NG7 A;  3F72 A;  5FFZ A;  3KZZ A;  5IYB J;  3I71 A;  2KDO A;  4DZJ A;  3F21 A;  2LRD A;  1SFO J;  4WK8 F;  4XID A;  4G94 A;  5A2Q K;  5JHU A;  1N78 A;  3F1B A;  3I59 A;  2EZI A;  2FUG 2;  1R4N B;  3S2H J;  3BTC A;  1BIA A;  2XC7 A;  3CUQ C;  5J47 A;  2R7U A;  1E3H A;  3HOS A;  4FX4 A;  2JVG A;  3OIO A;  2DN0 A;  3LA3 A;  2CV0 A;  4XR6 A;  3OS0 A;  1QU3 A;  4BYY A;  1VZ0 A;  2MFZ A;  4PK4 A;  1U5T C;  4JL3 A;  3HHG A;  4HBL A;  1K7A A;  4JBA A;  2M8E A;  3CJN A;  5EZH A;  1QO0 D;  1EV7 A;  1UFM A;  1R23 A;  4KIG A;  2JSC A;  3ECO A;  3F8B A;  3F8M A;  2QBY A;  2Z1D A;  2DTZ A;  1SVL A;  1FEX A;  3V8K A;  1W1W E;  1S7E A;  3J7Z I;  2G7G A;  2KJC A;  1BN5 A;  1OR7 A;  3OYN A;  4R1H A;  1JTX A;  2PFV A;  2FF4 A;  2OPT A;  3H36 A;  3CP8 A;  5LRR A;  3W2A A;  4YFX F;  2Y0M A;  1VI0 A;  3CDL A;  2VQH A;  2BBY A;  2Q8K A;  3IL2 A;  1TWH J;  5K7Z A;  2LKX A;  1ETW A;  4UUV A;  4P1W A;  3LWJ A;  1FYK A;  2EFW A;  3F6O A;  4FQG A;  3WGI A;  2R5Y B;  4UNO A;  3B02 A;  1R5H A;  2WBM A;  2LVS A;  1QA6 A;  1FNN A;  2H1L A;  3V7S A;  4ICH A;  2R7W A;  2HYJ A;  3EUA A;  4GO1 A;  1B9N A;  3V7R A;  4ZYA A;  1TC3 C;  4XLH A;  4PCQ A;  2DK8 A;  2QM3 A;  5GP9 A;  2R5Z A;  4A3M J;  1LQ1 A;  1FTZ A;  3FBN B;  2UXX A;  3CMY A;  4RM2 A;  2OER A;  1N75 A;  4PJN A;  2LFB A;  3DKX A;  4LG0 B;  3G73 A;  2OTL I;  3DTI A;  4NUB A;  4MEX F;  5L3D A;  1MMD A;  1WZ2 A;  1O7F A;  4HNU A;  3VW1 A;  2ECB A;  1V3F A;  4E4H A;  3MKY B;  5DYM A;  2VKE A;  4OIP F;  3NI7 A;  2XSJ C;  2XRO A;  3BPV A;  2P7V B;  3DP7 A;  4CYD A;  3S8P A;  3QBM A;  2W48 A;  2VLA A;  1OCP A;  1O3R A;  2BY2 A;  2KIS A;  3H92 A;  5DD4 A;  1TWC J;  4Y13 A;  1HKT A;  4GCL A;  4X6A J;  3ABM H;  4XLA A;  3MZY A;  3TED A;  4ZDO A;  5HDN A;  3MQ0 A;  4HX8 A;  3EUH C;  4HW0 A;  1FOW A;  4BAC A;  3N05 A;  5HDK A;  2DDA A;  4BDY A;  2VJI A;  1ZTR A;  5EFY A;  2VXZ A;  5CLS A;  3E0J B;  1IUY A;  2M5W A;  3HEF A;  1G8X A;  1XDS A;  5LBQ A;  3Q9V A;  3G6E I;  3CCL I;  1DP7 P;  3C07 A;  3ANP A;  2M87 A;  3WGH A;  2CUZ A;  3JRH A;  1IDZ A;  2OBP A;  2NP5 A;  4NN1 A;  4MQ9 F;  1G3S A;  1QVU A;  1ZAO A;  2DMT A;  2DOA A;  3RQ4 A;  1BW6 A;  3H5R A;  2AXT C;  2PJR B;  2HVS A;  3CME I;  2IS2 A;  3QKX A;  3G1L A;  1A31 A;  1QRY A;  4HNT A;  1BC7 C;  3KLO A;  4M3D A;  1OYI A;  3G2B A;  4NQW B;  5D5X B;  5AQC A;  2ZCW A;  2V1N A;  4XMY A;  4IHY A;  3MZH A;  3H0G J;  1YIO A;  2JPB A;  2XPW A;  4Y52 J;  1R5G A;  1U3E M;  1A6Q A;  2QEX I;  2EZH A;  4B3A A;  4UUS A;  3FK7 A;  3BR3 A;  2F4M B;  2CUE A;  4FTH A;  1I6H J;  2M4G A;  2NOG A;  2M7A A;  1ORK A;  3QU6 A;  3FMR A;  4FT8 A;  1D5Y A;  3LL7 A;  2FML A;  4F93 B;  1P7I A;  1A6I A;  2FQ3 A;  2IVM A;  3VVX A;  1BI0 A;  2ETH A;  2M8G X;  4UDS A;  3FKI J;  1Y8Q B;  2VQC A;  4HAM A;  4MFD A;  1TZL A;  2IBD A;  4C3J J;  4CCN A;  2IRF G;  3HBL A;  2UXU A;  4EJU A;  5E1X A;  3V8J A;  3JRD A;  3F22 A;  2KJB A;  3TDZ C;  3H35 A;  2ZXH A;  3DV8 A;  5LHG A;  2K9Q A;  4BE0 A;  4RLF A;  3OY9 A;  3BR5 A;  2W00 A;  2MG4 A;  4JYK A;  2E60 A;  4BQN A;  3FWE A;  2XAS A;  4I09 A;  2DJI A;  2NVU B;  1UHS A;  3FMQ A;  1MH3 A;  1UZC A;  3GUD A;  4DYC A;  3ZMU A;  4A3F J;  4LB6 B;  2DXI A;  5K58 A;  1KQ0 A;  1FBU A;  3W2V A;  4ENM A;  2DG7 A;  3C3W A;  4F91 B;  1ITY A;  1E3P A;  4EJW A;  1XTA A;  2YSR A;  3VOK A;  1U9O A;  2R5Y A;  5J1R A;  1U6G A;  2ME0 A;  1CF7 B;  2H8R A;  5BMZ A;  3LSH A;  2W24 A;  2WV1 A;  2DPD A;  1U0J A;  2W82 A;  1QZY A;  2ZKZ A;  3FXL A;  4IL6 C;  4AWX B;  3E6C C;  4CGR A;  1Z6T A;  5F27 A;  1IGN A;  5FKO A;  3DBR B;  3BJB A;  1RKW A;  1FSE A;  1R58 A;  1WVR A;  1UI5 A;  2P5V A;  3M1C A;  4AYB A;  1V55 H;  5J40 A;  2PMZ N;  3BTL A;  4NB5 A;  3KP3 A;  2HZT A;  3FXU A;  3I4P A;  3GZ6 A;  5CW8 A;  3BTI A;  3E5U A;  4AF5 A;  2OD5 A;  3KP2 A;  2NX4 A;  4IHX A;  3AAF A;  3BQY A;  2FA5 A;  2R7F A;  1Z05 A;  3I58 A;  1I5Z A;  3IHU A;  2NRA C;  1ENH A;  2GWR A;  5EG0 B;  3OS1 A;  2Y9Z A;  5C4Y A;  2ELJ A;  2JZY A;  2X6Y A;  4O3M A;  4CA0 A;  1UHM A;  1XCV A;  2VJ5 A;  5HBU A;  1YIJ I;  2WY8 Q;  3BHQ A;  1TQP A;  5AIP A;  4NNJ A;  4PJL A;  1BJZ A;  1SMT A;  1YTY A;  5GPA A;  3RD3 A;  3LFU A;  4UY8 I;  3KEO A;  2ZXJ A;  1SVO A;  2VUM J;  3COL A;  3LSP A;  3PNV A;  3BG7 A;  3ONQ A;  1FSH A;  2KP6 A;  2XF7 A;  3IRQ A;  1ZG3 A;  2KZV A;  5KK1 A;  5LEK A;  1J2X A;  1DDN A;  3K7A J;  4A0Z A;  2DFF A;  3RQI A;  5FB2 A;  1SD4 A;  1JHF A;  1WI3 A;  5D6F A;  4ZZL A;  2UXN A;  2PJR A;  2K3P A;  1I27 A;  2DA4 A;  3BJA A;  3KZY A;  2EA2 A;  3KYD B;  3M1E A;  3CCU I;  4DVY P;  4M3B A;  3S1R J;  1EH6 A;  4NQW A;  4GFL A;  1Y0U A;  3PNT A;  3JSJ A;  4RBO A;  2NXN B;  3K2A A;  1T2K A;  2ZFU A;  2G9W A;  2RV8 A;  3ERM A;  1TW3 A;  1EA3 A;  5HS7 A;  3JRG A;  1ZGJ A;  5KCM A;  1RPW A;  3D5L A;  2P6T A;  5CYV A;  4C2M J;  1SFK A;  2L7K A;  1IXS B;  2Y48 A;  4IQ4 A;  2L2O A;  3VSK A;  1U78 A;  1TQM A;  2L3D A;  2H94 A;  1KYW A;  3E97 A;  3CJD A;  2JUG A;  2XSD C;  2EQR A;  4II3 A;  1MW7 A;  4OU0 A;  4RDU A;  4D1Q A;  4EV0 A;  3F23 A;  5HS9 A;  5B5E C;  3HRM A;  2RGV A;  2RRE A;  4YFK F;  3I0T A;  4EAT A;  2LSO A;  3GEU A;  2IPQ X;  3GME A;  4Y4R A;  3ZQF A;  2IJL A;  2E7X A;  4D7N A;  3NAU A;  1SFE A;  2NVX J;  2O9L A;  1X19 A;  4Y33 A;  4ZTJ A;  5EEA A;  1WJD A;  2XVC A;  2ZOY A;  3N4M A;  4N0B A;  2Q2E A;  1NTC A;  3NPI A;  3K70 C;  2EH3 A;  2EIL H;  3J81 Z;  2M3A A;  3RSN A;  1HOM A;  5HVQ C;  3BR0 A;  4CXF A;  4E7K A;  2F5F A;  2R7Q A;  4JNN A;  1T56 A;  1SAX A;  1E3O C;  1HDP A;  1VQL I;  5FLM J;  1MKM A;  1R7J A;  2OI8 A;  3KKC A;  5C3E J;  2D6Y A;  3M9A A;  3G1M A;  2NAZ A;  1UAA A;  4ABZ A;  4BGD A;  4JX5 A;  4A3D J;  3HIF A;  3WTU C;  3EYY A;  2DOD A;  3J81 K;  4M72 A;  4IO9 F;  3OOU A;  3NAR A;  5CKT A;  1O3Q A;  3IH2 A;  1MMS A;  3HTJ A;  5D4S A;  3HOW J;  1ON2 A;  1KZH A;  2GA1 A;  1Y1W J;  3NS4 A;  1H8A C;  1R49 A;  4KIF A;  1GVJ A;  2QEN A;  2K3F A;  2HQA A;  3QOP A;  4UHT A;  2BV6 A;  4W1U A;  2BXZ A;  3J7A O;  1FIA A;  2BXY A;  4HOB A;  2BYV E;  3CTA A;  4M3F A;  2R7Z J;  2DFI A;  4BQQ A;  4AC0 A;  5DDG A;  2IS6 A;  2YVX A;  2A6E F;  1FZP B;  3C18 A;  1FP2 A;  2F5V A;  2Z99 A;  3OL4 A;  3KZ9 A;  3RH2 A;  4PSW A;  1GXP A;  5GAH J;  5EG0 A;  2PZ9 A;  3BCB A;  4WF2 A;  1YI2 I;  4MTE A;  2FJ1 A;  3N97 A;  3VIB A;  4B48 A;  2R7V A;  1HF0 A;  3AL0 C;  4AC6 A;  1B4A A;  1V5E A;  4RB0 A;  4RB2 C;  4HRI A;  2B1E A;  2L9V A;  2QOP A;  4N4O B;  4OAY A;  3H3U A;  2OJE D;  1OR7 C;  4GFK A;  4O5V A;  4WXC A;  1H89 C;  2DA2 A;  1LNW A;  4ENN A;  4L9T A;  4Y17 A;  5CVI A;  3E6B A;  4B09 A;  2EIJ H;  2VB6 A;  3E6D A;  3CCS I;  2Q0O A;  1H88 C;  1B59 A;  3TKY A;  2QSG X;  3PUB A;  3GFJ A;  5IT9 Z;  1IAW A;  3GZI A;  2DI3 A;  3RI4 A;  2DFE A;  4KN4 X;  1IN5 A;  3SHF A;  3GTL J;  3JTH A;  4OIN F;  3TL4 X;  3TOB A;  4RB1 A;  4IHV A;  1VQK I;  3GLL A;  1TNS A;  5LRS A;  2LY2 A;  4L9J A;  4U7D A;  3RKY A;  3WTZ A;  3MEX A;  4LIV A;  1ETQ A;  2CW7 A;  3DFG A;  3E6M A;  3H9J A;  4HDU A;  2IGO A;  4KA4 A;  2HU9 A;  3EUP A;  3OMY A;  4RAZ A;  2YS9 A;  2X6O A;  5JVT A;  5IT9 K;  1F43 A;  2ZB9 A;  4N4N B;  2DMQ A;  5LEJ A;  1P4W A;  2JA5 J;  1G59 A;  2E2I J;  1TP4 A;  3E5Q A;  4B47 A;  1IJW C;  5LGN A;  1IV8 A;  4OOI A;  3IV5 A;  1X3Z B;  3ASO H;  3QP6 A;  4CCJ A;  3ZQ7 A;  3GO5 A;  1ZEL A;  4ESJ A;  2LD5 A;  5F0H A;  3GEZ A;  3EPZ A;  4Y3O A;  2HDC A;  2VAS A;  3GF2 A;  2NP3 A;  2A3S A;  1D8K A;  4ANJ A;  3I56 I;  3PQJ A;  3B6C A;  4XQF A;  4Q48 A;  3W6K B;  1GV2 A;  1ULY A;  2YX7 A;  2BVL A;  4E7S A;  4IEJ A;  1Z7U A;  4A12 A;  2RAS A;  1LDJ A;  3PL8 A;  1FYL A;  3GTG J;  1XPX A;  2D1V A;  1Z91 A;  2HQR A;  4HZF A;  4ZYE A;  3K4M A;  3WOD F;  1B8I B;  5FLV A;  1MND A;  1S5L C;  2BE5 F;  4Z6Y A;  3S15 J;  1KQ8 A;  3SEQ A;  1ETY A;  3VSL A;  2P8T A;  4HF0 A;  2FBI A;  3HJE A;  3VYT B;  1S6L A;  4HLY A;  2M45 A;  4A6D A;  2CJJ A;  4M6Y A;  2G7U A;  3CC4 I;  5D5V B;  3HIM A;  3P9K A;  1IO2 A;  1REP C;  3TQN A;  2DQR A;  2YX4 A;  4Q47 A;  4ESB A;  3GFL A;  3TDU C;  3H3V K;  2KLO A;  2HTS A;  4P9U A;  1LVK A;  1X3U A;  1EF4 A;  1J09 A;  4NEL A;  1I39 A;  3SZG A;  3RYR A;  2V9K A;  1ZYR F;  4E7H A;  4BKX A;  2L9R A;  2BY0 A;  1LUJ B;  5JFR A;  3PM1 A;  4WXH A;  2MH9 A;  4LLN A;  3S16 J;  3S3O A;  3PJR A;  2WGB A;  5D19 A;  2VOO A;  1XB4 A;  5H2F C;  3C1D A;  1WRJ A;  1HW5 A;  3C7J A;  2E5Z A;  2IEK A;  3MD2 A;  3S3M A;  3X2Q H;  1IZ1 A;  1U8R A;  4KFC A;  4YIR X;  3GTQ J;  4CSW A;  4BY1 J;  3GW2 A;  3S1M J;  2B7E A;  3BRO A;  3AKZ A;  3Q0V A;  4I6Z A;  4IQJ A;  1FX7 A;  2ZC2 A;  4CH7 A;  4ZYH A;  2VKV A;  3D1N I;  3GTP J;  4PJ0 C;  5BPI A;  1BR2 A;  5M5Y J;  1KU2 A;  2K40 A;  2ZNY A;  4I99 C;  1TWF J;  4OAZ A;  1W5C C;  5DS9 A;  3OSF A;  4CDG A;  4U0Y A;  2Z2S B;  2DA7 A;  2CS3 A;  4BJ5 C;  4A3B J;  5C4X J;  3EUK L;  2A07 F;  1OCR H;  5ILS A;  1Y56 A;  4UXN A;  4KIT B;  3GVA A;  3ZP5 A;  3SYT A;  3SFZ A;  3OS2 A;  5K5R A;  3L1P A;  1YG2 A;  1G3T A;  1H0M A;  2X48 A;  3CUO A;  1VQP I;  1JI8 A;  3H9G A;  1ZK8 A;  3I3L A;  4MO7 A;  3DPT A;  5IP7 J;  3CCR I;  1HCR A;  3TW7 A;  1I3Q J;  3V78 A;  1MSF C;  3LMM A;  1BI2 A;  4C2M A;  2K4J A;  2X1C A;  3JAM Z;  4YFN F;  4IVN A;  2WWY A;  3Q0U A;  1WJC A;  2LNB A;  2G3B A;  1STZ A;  1FMV A;  3VW0 A;  2D45 A;  5EGO B;  1JGS A;  2GEN A;  1AA7 A;  2IP2 A;  5E3O A;  1MZB A;  2ZNZ A;  5HLH A;  1RES A;  2FBQ A;  3HTA A;  3ON2 A;  4L9V A;  3ZRG A;  3BR6 A;  2DCE A;  2BEO A;  2DA1 A;  3FXO A;  3MZ8 A;  4G6T B;  4YII A;  3HZJ A;  1FBS A;  1VQN I;  3I64 A;  1RZ4 A;  2JPC A;  2ADU A;  2QZ8 A;  2W4S A;  2LC2 A;  1SC7 A;  3LSR A;  1S7O A;  3LSI A;  4XKB A;  4MTD A;  3BCA A;  2VJ4 A;  3GXO A;  1IN8 A;  4M9S A;  3H9Q A;  2VPL A;  2LY9 A;  3G4S I;  4BU2 A;  3UR3 C;  1MIJ A;  1OQY A;  3OYG A;  3KKD A;  1FOX A;  4DGW B;  1RR7 A;  1EKE A;  1D0X A;  2ISY A;  3OIQ A;  1OCT C;  2XAG A;  1KGS A;  1ETX A;  5IP6 A;  2W25 A;  4LLG F;  3SDB A;  5DM7 F;  1B8I A;  3LSK A;  3HB9 A;  4FX0 A;  1S8N A;  5A2Q Z;  1MMN A;  1KU7 A;  2CQX A;  2E19 A;  5M5W J;  3CLO A;  2OA4 A;  5E18 F;  3T8T A;  1QBJ A;  2JMW A;  5HLI A;  2EIM H;  2K86 A;  4B43 A;  4XKV A;  3EET A;  4PJM A;  2YVH A;  1ON1 A;  2DA6 A;  5DUI A;  3R4K A;  1ZQ3 P;  3ZPL A;  5LFA A;  2HKO A;  4I0B A;  1TT0 A;  3C2H A;  3GX4 X;  3MMY B;  3OYI A;  3FHZ A;  5HOD A;  2OCC H;  2OQG A;  5B66 C;  1U8B A;  5M3M J;  3HGG A;  2FQ4 A;  5FKK A;  3FDY A;  1D8J A;  1VQ5 I;  1X1D A;  1UB9 A;  2HS5 A;  2OF7 A;  2FOW A;  1CGP A;  2EFP A;  3OIP A;  1M1E B;  2WB1 N;  4B3X A;  2KDZ A;  4L5I A;  2QGU A;  1R1V A;  2PMH A;  2M1B A;  2UV1 A;  2CUJ A;  1ZG5 A;  4ZH4 F;  1IRF A;  2YPR A;  2FNA A;  2QKO A;  3HXL A;  2Z5U A;  4MQV A;  4N9H A;  4NC6 A;  2QA4 I;  3DTK A;  2HFH A;  2ME6 A;  1OJL A;  3OYL A;  2NOJ B;  3BP8 A;  2IGN A;  1YHQ I;  2QQ8 A;  2VKD A;  3G7R A;  1P2F A;  2NS8 A;  2EFQ A;  3U21 A;  3HYI A;  3AG1 H;  2VIX A;  4RAG A;  2ZJR F;  3CJR B;  2JA2 A;  3EQL F;  3H5N A;  1MBE A;  2ZME B;  3T8R A;  3BNI A;  5F0F A;  1X3W B;  2ZXI A;  2RDP A;  2BY1 A;  2W57 A;  2LRE A;  5IOY A;  3FXM A;  2A6T A;  2BY3 A;  1TQI A;  2HR3 A;  2OZ6 A;  1ONV A;  3KEQ A;  3AQS A;  4HQE A;  4B4C A;  1Y8R B;  2ID3 A;  3L2Q A;  2KT0 A;  1WJE A;  1OPC A;  2MD5 A;  4IJA A;  4B44 A;  2RC4 A;  1Z67 A;  5DTD A;  3OYE A;  5BQT A;  1MBK A;  1UG0 A;  1YIT I;  2RAE A;  2CU7 A;  3U1K A;  5D5W B;  1GLN A;  2WAF A;  3K4N A;  1WGX A;  3BT9 A;  4AD9 A;  2REK A;  3HUG B;  3RPQ A;  3BJO A;  3PPB A;  1XGM A;  3UKG A;  1JUM A;  2WAE A;  3EDP A;  1WHU A;  3F6V A;  2HKX A;  5EGO A;  5E8I A;  2KPM A;  3FMS A;  4BXF A;  1MGT A;  1LJ9 A;  5TGT A;  1D5V A;  1IUF A;  1D0Z A;  2OAZ A;  1B6A A;  1IRZ A;  2M9H A;  2H8W A;  4F3Q A;  4CYC B;  3EGQ A;  2UXI A;  4KUM A;  3Q3S A;  5KNL A;  2RN7 A;  2V9V A;  1FPQ A;  2QCO A;  2MYS A;  2Y75 A;  2VL8 A;  3CF2 A;  4XLN F;  3KNW A;  3TOA A;  3P5J A;  3WG7 H;  2EZK A;  2HOE A;  1FWZ A;  5TIS C;  4FHT A;  2ZY9 A;  3BQZ A;  1GV5 A;  2LG4 A;  4YG2 F;  2GUH A;  4D9J A;  4ZJZ A;  3OYA A;  1BL0 A;  2KQR A;  1R6R A;  2ZSH B;  5GAE J;  2JA8 J;  1F4K A;  1F5T A;  5DEQ A;  5E3L A;  2UUZ A;  1S72 I;  1T08 B;  2A6H F;  2BOL A;  2R3S A;  3WU1 B;  1P4X A;  4NBQ A;  1JKQ C;  1LDD A;  3CCE I;  2IGK A;  1RC9 A;  3BG6 A;  2FSW A;  3CF5 F;  3WTY C;  2GOX B;  2M30 A;  3BG5 A;  3K69 A;  2K9L A;  3D0S A;  2A61 A;  3BJ6 A;  2GOM A;  4XNF A;  1FJL A;  4M3E A;  3GBG A;  4XK4 A;  5F64 A;  4IF4 A;  1BOB A;  3NRV A;  2M34 A;  3L7W A;  3MVP A;  2LF7 A;  2TDX A;  1VFC A;  4BQO A;  2XAJ A;  2N8G A;  1T39 A;  3I5U A;  1BR1 A;  1ZGA A;  3ZQH A;  4BHC A;  2W84 A;  4BXX J;  1IN4 A;  2O8X A;  2IA0 A;  1X2M A;  1R5I D;  3O8H A;  4RMN A;  3U9G A;  3ZGK A;  1RUO A;  4I2O A;  2XF5 A;  4ZYG A;  1J75 A;  4S04 A;  3CUQ B;  1XMX A;  5JLX A;  2VKH A;  2WY7 Q;  2DPU A;  4I02 A;  4LK1 F;  4UB6 C;  3A03 A;  4HNV A;  3JRF A;  2CV2 A;  3DPL C;  2D2W A;  2B9S A;  2OUM A;  2OTJ I;  4BHB A;  1MJA A;  3OYJ A;  1ZR2 A;  4XLE A;  1W36 D;  4G6D A;  3BRU A;  2W7N A;  2F5D A;  1MJB A;  5IT3 A;  1BA5 A;  4JK1 X;  4XKC A;  3FHN A;  3FX3 A;  1I3A A;  2PQ8 A;  1XGN A;  4HKU A;  3BZC A;  1TBX A;  2ISZ A;  1D1B A;  3QQA A;  1V54 H;  3OWT A;  2XAH A;  5IP9 J;  3IH3 A;  1WH7 A;  1XSD A;  3KP6 A;  3VOX A;  3QRF F;  1T8I A;  3OYH A;  5FO5 A;  1K4T A;  4I98 B;  3DU6 A;  4C9Y A;  1JE8 A;  3MCZ A;  3F8C A;  3K1M A;  4M71 A;  4A2U A;  5IPA A;  1H9T A;  4IHW A;  1FT9 A;  3HUG A;  2O6G E;  2L9S A;  2GFN A;  4R79 A;  1YW9 A;  5E17 F;  2QYO A;  2HWV A;  4E7I A;  3CWR A;  4HG2 A;  4W97 A;  2L7F P;  4HEA 2;  1DQU A;  3L9F A;  4LG0 A;  1UCR A;  4Y7N J;  2IA2 A;  3ABK H;  2DJN A;  4ZZD A;  1TTY A;  2IW5 A;  3CCJ I;  4WWC A;  4YEL A;  4XIC A;  4BEH B;  3QYF A;  1AOY A;  2ID6 A;  4BJT A;  2ICW G;  4A3E J;  1UI6 A;  2HYF A;  4PUS A;  1R4M B;  4X1E A;  4CZZ A;  1WJA A;  5E20 A;  4LGW A;  2BVM A;  3MKW B;  3HGY A;  5E3N A;  2XV4 S;  2MC3 A;  1VTN C;  4J19 A;  1I1S A;  2L4M A;  5F1J A;  2L0K A;  2HQN A;  3ZMZ A;  3KFW X;  1WI9 A;  5L3B A;  2HPM A;  2DA3 A;  1QPI A;  1F36 A;  4L5J A;  3I55 I;  3CDI A;  1S29 A;  5B3S H;  1WJB A;  4IZZ A;  2V1D A;  1WH5 A;  1MMA A;  2V79 A;  3WTS C;  4WIB A;  1PP8 F;  3CES A;  3O8G A;  4XSX F;  5EZG A;  2K5C A;  2X51 A;  4U88 A;  3PFY A;  2QUF A;  2E2J J;  3WU0 A;  3WTT C;  3DF8 A;  2FJI 1;  2H27 A;  4M6X A;  3DQV C;  3FXJ A;  1UMQ A;  2V4J C;  2E1M B;  1O3T A;  2HKU A;  3MN2 A;  4H0E A;  3AG4 H;  3BZ6 A;  1U2W A;  3PUF A;  3BY6 A;  2ZJP F;  1A35 A;  5JLW A;  2PN6 A;  4XON A;  5CJ9 A;  1HDD C;  2F5C A;  3HRT A;  2PLY A;  5JI6 A;  5K5O A;  3PSI A;  2PX9 A;  3ESW B;  4XOR A;  1QNT A;  2W1O A;  2PEX A;  4XRS G;  1TL8 A;  3DTE A;  4PXI A;  1X1B A;  4GYG A;  1ZRC A;  4QSH A;  3B6A A;  1U9N A;  1T6S A;  2VOP A;  1LE8 B;  3A1Y A;  2E35 A;  2VBX A;  3CO7 C;  4UVC A;  3HRS A;  3H3Z A;  4I0A A;  3ZMD A;  1DGR M;  2VBW A;  1K78 B;  2Y2Z A;  2Q1Z B;  1PVE A;  4CO8 A;  2RHA A;  1G6N A;  2A69 F;  1R1T A;  2COB A;  2DTR A;  2IU5 A;  2HNH A;  4L9N A;  2Z3Y A;  4ON0 A;  1ZRE A;  5CQG A;  2E1O A;  1PUF B;  1LFB A;  2XDV A;  1LFU P;  3BPX A;  2LBF B;  2V57 A;  2GXA A;  1J9I A;  4CCO A;  2MSY A;  2CUF A;  4MLO A;  4RGR A;  4P5O A;  3PO3 J;  1JJ8 C;  2AO9 A;  4HSR A;  2EK5 A;  2X85 A; 
#chains in the Genus database with same CATH homology
 1K83 J;  1EF4 A;  5EDN A;  4NEL A;  2O7O A;  1AHD P;  4L62 A;  1MH4 A;  5F04 A;  3OIO A;  4BKX A;  2DN0 A;  2L9R A;  3S14 J;  3PM1 A;  4JL3 A;  3S16 J;  2QIB A;  1GUU A;  1GVD A;  3HOU J;  2WGB A;  5D19 A;  5HAW A;  5EZH A;  4A3G J;  2R92 J;  1FTT A;  2EBI A;  2L7M P;  4QTR A;  2IEK A;  3GTM J;  2DG8 A;  5FGL A;  5IYD J;  3GTQ J;  2DTZ A;  5J1Y A;  4BY1 J;  1FEX A;  3S1M J;  1S7E A;  2G7G A;  1YRN B;  3TP3 A;  3Q0V A;  4I6Z A;  1JTX A;  2VKV A;  3D1N I;  2OPT A;  3GTP J;  1MNM C;  3MNL A;  5M5Y J;  2K40 A;  1TWF J;  1VI0 A;  1R9T J;  3CDL A;  5DS9 A;  3OSF A;  4BY7 J;  3JRI A;  2DA7 A;  1TWH J;  5K7Z A;  4CYC A;  1ETW A;  1Z0X A;  2LKX A;  3RZO J;  4A3B J;  5C4X J;  5CXI A;  4D5F A;  2JA6 J;  3LWJ A;  3RZD J;  2GBY A;  1SGM A;  3HOX J;  2G0E A;  2LK2 A;  2HOT A;  2R5Y B;  2G7S A;  3L1P A;  4FIS A;  2LVS A;  2X48 A;  4ICH A;  1ZK8 A;  4MO7 A;  2HYJ A;  5IYC J;  4A3L J;  1TC3 C;  5IP7 J;  4MK6 A;  4MFE A;  2R93 J;  1MBG A;  5GP9 A;  2R5Z A;  4A3M J;  1HCR A;  3TW7 A;  1I3Q J;  3V78 A;  1MSF C;  2Y0S N;  1FTZ A;  4GCT A;  3CMY A;  4L5E A;  2OER A;  2LFB A;  2NVQ J;  4XRS A;  3Q0U A;  2G3B A;  3VW0 A;  5EGO B;  2LR8 A;  4JX6 A;  2GEN A;  5E3O A;  3T6N A;  4C3I J;  3VW1 A;  2NVY J;  4KWA A;  2ECB A;  1RES A;  2G7L A;  2FBQ A;  3HTA A;  3ON2 A;  2XGD A;  5J1U A;  3BR6 A;  2VKE A;  3NI7 A;  2XRL A;  2DA1 A;  3QBM A;  5M3F J;  2W48 A;  1APL C;  1AKH B;  1OCP A;  1RKT A;  2HQ5 A;  3CQZ J;  1TWC J;  3JRB A;  3G1O A;  1W0T A;  3LSR A;  2XDN A;  4GCL A;  4X6A J;  4GCK A;  3TED A;  4JP0 A;  2ZCN A;  2M0C A;  2YUS A;  3E7Q A;  2LY9 A;  2YVE A;  1ZTR A;  4FE4 A;  3KKD A;  5EFY A;  1FIP A;  1RR7 A;  1TWG J;  3HEF A;  4NDL A;  1OCT C;  1JT0 A;  1G2H A;  1ETX A;  1LE8 A;  5C4J J;  2Q24 A;  3W6V A;  4D5C A;  5IP6 A;  3C07 A;  1B8I A;  1IV6 A;  3HB9 A;  3ANP A;  1IDZ A;  3JRH A;  2CQX A;  2E19 A;  5M5W J;  2NP5 A;  4NN1 A;  2UXO A;  1QVU A;  2GLO A;  2CRG A;  2DMT A;  3VW2 A;  2JMW A;  2XPV A;  1BW6 A;  2MGQ A;  2TCT A;  3QKX A;  2GM4 A;  3G1L A;  2YVH A;  3HM5 A;  1QRY A;  2DA6 A;  4M3D A;  5AQC A;  2UXH A;  1ZQ3 P;  3A01 B;  4IHY A;  3DPJ A;  3H0G J;  3B81 A;  2JWT A;  2XPW A;  4Y52 J;  3LNQ A;  2EZH A;  2HDD A;  4B3A A;  4UUS A;  3A02 A;  3FK7 A;  5HOD A;  3BR3 A;  2CUE A;  1TWA J;  2FX0 A;  4FTH A;  1U8B A;  5M3M J;  3GTO J;  3HGG A;  1I6H J;  2FQ4 A;  2JA7 J;  2NOG A;  5FKK A;  1ORK A;  1JKO C;  3CRJ A;  3SDG A;  1GT0 C;  1D5Y A;  1GDT A;  1P7I A;  2OF7 A;  1A6I A;  1AU7 A;  3HOY J;  3VVX A;  2WB1 N;  3TW6 A;  2KDZ A;  1MSE C;  2M8G X;  4UDS A;  2ZCM A;  3FKI J;  4MFD A;  4C3J J;  2GUH A;  1K61 A;  2IBD A;  3HBL A;  2UXU A;  3ZQI A;  2QKO A;  3JRD A;  2ME6 A;  2PBX A;  2K9Q A;  4DW6 A;  1YRN A;  1OJL A;  3BR5 A;  4JYK A;  2MG4 A;  1WCM J;  3S5R A;  3G7R A;  3F0C A;  2NS8 A;  1Q1V A;  1UHS A;  1MH3 A;  3LSG A;  2LLK A;  3PAS A;  4DYC A;  3S1Q J;  4S0H B;  4A3F J;  1MBE A;  5K58 A;  3BNI A;  3LHQ A;  5F0F A;  3HOV J;  4A3J J;  3PO2 J;  4A93 J;  3V6G A;  2DG7 A;  5IOY A;  4DYQ A;  1DU0 A;  1ITY A;  5D18 A;  3IH4 A;  3VOK A;  1U9O A;  2R5Y A;  3AQS A;  5J1R A;  4B4C A;  1NK3 P;  2ID3 A;  3ZQC A;  3ANG A;  2KT0 A;  2ME0 A;  5FKM A;  2H8R A;  3ZQG A;  2W53 A;  5DTD A;  4V2F A;  2WV1 A;  1MBK A;  2HOS A;  3NNR A;  2RAE A;  3WHB A;  2CU7 A;  1BW5 A;  2VPR A;  3S2H J;  1A5J A;  4CGR A;  2DMP A;  1IDY A;  5F27 A;  1IGN A;  1WGX A;  2Y31 A;  3BT9 A;  5FKO A;  5M5X J;  4DZP A;  2REK A;  3BJB A;  1RKW A;  1UI5 A;  3PPB A;  5FKN A;  3UKG A;  1ETK A;  1JUM A;  1T33 A;  1CQT A;  2PMZ N;  3NRG A;  3BTL A;  5EGO A;  2HXI A;  1ZKG A;  3S17 J;  3BG9 A;  2DMN A;  5CW8 A;  1JT6 A;  4BBS J;  3BTI A;  4AF5 A;  1X2N A;  1IUF A;  5BNG A;  3C2B A;  1JJ6 C;  4IHX A;  3M4O J;  3BQY A;  1IRZ A;  2NX4 A;  2M9H A;  4GFB A;  4CYC B;  3EGQ A;  2LTP A;  2UXI A;  1AKH A;  1ENH A;  3Q3S A;  5EG0 B;  2Y9Z A;  5C4Y A;  2QCO A;  3KNW A;  2O7T A;  2HOA A;  2EZK A;  3LJL A;  5HBU A;  3BQZ A;  1XG1 A;  3BHQ A;  1GV5 A;  1BJZ A;  5FJ8 J;  2K9S A;  5GPA A;  3JRE A;  1BL0 A;  3RD3 A;  2VUM J;  2R5Z B;  3M3Y J;  2JA8 J;  3COL A;  3LSP A;  2JN6 A;  1OFC X;  5E3L A;  3VVZ A;  5DAJ A;  1JKQ C;  4A3K J;  4MIM A;  4D7M A;  3I4M J;  3K7A J;  3RQI A;  1WI3 A;  2DMU A;  2DA4 A;  4M3B A;  3S1R J;  3BG5 A;  3FIS A;  4UUT A;  2VI6 A;  4GFL A;  3JSJ A;  4RBO A;  3K2A A;  1FJL A;  3A01 A;  1POG A;  4M3E A;  3GBG A;  4XK4 A;  2F07 A;  2M34 A;  3BG3 A;  1PUF A;  3MVP A;  1VFC A;  4C3H J;  1B72 B;  2N8G A;  1XC5 A;  2TRT A;  3JRG A;  2IAI A;  3ZQH A;  1RPW A;  4C2M J;  2I10 A;  3QPL A;  2HXO A;  4BXX J;  2QF7 A;  1U78 A;  5CXG A;  1X2M A;  2O8K A;  2QWT A;  1ETV A;  3MKL A;  3O8H A;  1Z77 A;  3QPS A;  1MBH A;  2XSD C;  3JRA A;  3CJD A;  1Y1V J;  3I4N J;  2EQR A;  5EYR A;  4RDU A;  4M3G A;  3HE0 A;  1RET A;  1IG7 A;  5JLX A;  4QIW N;  3GEU A;  3ZQF A;  9ANT A;  4D7N A;  3NAU A;  1X58 A;  1HLV A;  1ETO A;  2NVX J;  2O9L A;  3A03 A;  4HNV A;  3JRF A;  2ELK A;  1JUP A;  4AYB N;  2NVT J;  5EEA A;  2HYT A;  2ZOY A;  5J3L A;  3ON4 A;  2NS7 A;  1NTC A;  1ZR2 A;  3HOZ J;  3AQT A;  2EH3 A;  3NPI A;  5IOZ A;  3BRU A;  2HI3 A;  1WPK A;  2XB0 X;  1HOM A;  3BR0 A;  1BA5 A;  1JKR C;  1SAN A;  4JNN A;  1T56 A;  1E3O C;  4HKU A;  1HDP A;  2ZCX A;  5FLM J;  4UUS B;  1LFU P;  3HKZ N;  3ZQL A;  3QQA A;  5C3E J;  2OI8 A;  2D6Y A;  3KKC A;  3G1M A;  2FD5 A;  5IP9 J;  4A3I J;  3IH3 A;  1WH7 A;  4ABZ A;  1UG2 A;  3FIW A;  3VOX A;  4JX5 A;  2YU9 J;  5EF6 A;  4A3D J;  2H1K A;  4M6V A;  5FKL A;  3HTI A;  2WUI A;  3OOU A;  3NAR A;  3IH2 A;  4A3C J;  3HTJ A;  3HOW J;  5IPA A;  3JR9 A;  3O60 A;  4IHW A;  2XB5 A;  1Y1W J;  3SJM A;  1H8A C;  3TP0 A;  2GFN A;  2B63 J;  1JUS A;  4W1U A;  3CWR A;  4AUX A;  1FIA A;  4BBR J;  4W97 A;  2L7F P;  4JKZ A;  3BTJ A;  2R0Q C;  3VP5 A;  3HTH A;  1W0U A;  4Y7N J;  4M3F A;  2R7Z J;  4XRM A;  2WAQ N;  2D5V A;  2DJN A;  4AC0 A;  3FRQ A;  5H9T A;  4XIC A;  1VND A;  1O4X A;  4DYR A;  2ID6 A;  1XS9 A;  3KZ9 A;  3RH2 A;  3LOC A;  3VUQ A;  5EG0 A;  4A3E J;  1UI6 A;  2PZ9 A;  5D1R A;  3LSJ A;  2XGC A;  3BR1 A;  4X1E A;  2FJ1 A;  3WHC A;  3VIB A;  3HGY A;  5E3N A;  1HF0 A;  4MXM A;  4AC6 A;  2DA5 A;  3S2D J;  1DU6 A;  3SFI A;  1JGG A;  4J19 A;  5F1J A;  2QOP A;  2L0K A;  3E7L A;  4JX4 A;  1ZR4 A;  2DA3 A;  1QPI A;  3DCF A;  2P81 A;  1F36 A;  4LOC A;  1ZGW A;  4ME9 A;  4GFK A;  1H89 C;  2DA2 A;  1MBJ A;  2CQQ A;  5E3M A;  2MW8 A;  1H88 C;  1NK2 P;  2EZL A;  1QVT A;  2ZOZ A;  1WH5 A;  3GZI A;  4G12 A;  2JJ7 A;  3GTL J;  1I50 J;  3HDD A;  5FMP A;  3ZOB A;  5HSZ A;  3O8G A;  4IHV A;  5EZG A;  2K9N A;  3OSG A;  5K7H A;  3BR2 A;  1MBF A;  2L7Z A;  4A69 C;  2E2J J;  5GPC A;  2M2E A;  5F0C A;  3NXC A;  2XPU A;  1ETQ A;  4FE7 A;  2E2H J;  3EUP A;  1UMQ A;  4B1R A;  3Q0W A;  3MN2 A;  2YS9 A;  3RKQ A;  2X6O A;  5C44 J;  1B72 A;  2HKU A;  1F43 A;  1JTY A;  2ZB9 A;  2DMQ A;  3S1N J;  2JA5 J;  5JLW A;  2E2I J;  4I76 A;  1IJW C;  1HDD C;  2UXP A;  3IV5 A;  5K7F A;  2LP0 A;  4EEF G;  2X9D A;  3VPR A;  3JRC A;  2LD5 A;  5F0H A;  4XRS G;  3P9T A;  3G56 A;  4FCY A;  1IC8 A;  3IUV A;  4PXI A;  2NP3 A;  1VF9 A;  3B6C A;  2AHQ A;  4V2G A;  3B6A A;  4QSH A;  1U9N A;  3GTK J;  1GV2 A;  3DEW A;  3FK6 A;  4IEJ A;  2RAS A;  2QTQ A;  1LE8 B;  3GTG J;  1B8I B;  3VVY A;  2XGE A;  1P7J A;  5FLV A;  5FHP A;  3S15 J;  1ETY A;  2Y2Z A;  3BCG A;  4ACI A;  3CCY A;  4YZE A;  2RHA A;  5F08 A;  2COB A;  2Y9Y A;  2IU5 A;  2CJJ A;  5IYB J;  2E1O A;  1PUF B;  1LFB A;  4DZJ A;  3HIM A;  2JK3 A;  1SFO J;  3F1B A;  4XID A;  2V57 A;  2EZI A;  2CUF A;  2MSY A;  2Y30 A;  4MLO A;  3GTJ J;  1JJ8 C;  2AO9 A;  1JKP C;  3PO3 J;  3H3V K;  2ECC A;  3BTC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...