1Z77A

Crystal structure of transcriptional regulator protein from thermotoga maritima.
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
200
structure length
200
Chain Sequence
MLSKRDAILKAAVEVFGKKGYDRATTDEIAEKAGVAKGLIFHYFKNKEELYYQAYMSVTEKLQKEFENFLMKNRNRDIFDFMERWIEKKLEYSASHPEEADFLITLVSVDEGLRKRILLDLEKSQRVFFDFVREKLKDLDLAEDVTEEIALKFLMWFFSGFEEVYLRTYQGKPELLKRDMNTLVEEVKVMLRILKKGMTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords transcriptional regulator (TetR family)
publication title Crystal structure of a transcriptional regulator TM1030 from Thermotoga maritima solved by an unusual MAD experiment.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 71
structure length 200
sequence length 200
ec nomenclature
pdb deposition date 2005-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1z77A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 1z77A02
2ME0A 4XK4A 4XRSA 1BW5A 1WH7A 2XPVA 3F0CA 1CQTA 3VVYA 4FISA 3GTLJ 4BY1J 4M3DA 5D19A 3NRGA 2HI3A 4QSHA 3JRAA 1ORKA 2O7OA 5F0CA 5E3NA 5GP9A 3FIWA 5EGOB 2O8KA 2IBDA 3BR3A 3LHQA 1SANA 1QRYA 1HOMA 1JT6A 4UDSA 2ECCA 1SFOJ 4BBSJ 4D5FA 1APLC 2K9SA 2NVYJ 4C2MJ 1VF9A 1AKHB 1I3QJ 4HNVA 5M5XJ 2LP0A 3HOUJ 3OSGA 2HOTA 3ON2A 1HF0A 5M5WJ 4A69C 4A93J 2E2IJ 5DTDA 1ETXA 3BHQA 3OSFA 2AO9A 5HBUA 3VVXA 1F36A 3A03A 3KKDA 2COBA 3FKIJ 1Z0XA 3O60A 3CRJA 4W97A 2LK2A 4MFEA 4A3KJ 2R92J 3JRIA 2R93J 1K61A 3ZQCA 4B1RA 3GTPJ 3AQSA 1U8BA 5M3MJ 1D5YA 2LLKA 3CDLA 3K2AA 3W6VA 5FGLA 2XGCA 3VOXA 4JP0A 4BXXJ 4V2FA 4A3FJ 3KNWA 2DMNA 1ZQ3P 3EGQA 5IP6A 1HLVA 1RR7A 2X48A 1E3OC 2NP3A 5FKNA 3G1MA 2FQ4A 3L1PA 5K7HA 3IH4A 4MFDA 3JRGA 2ID3A 4MO7A 3BQYA 3S17J 1TWHJ 1MNMC 3COLA 3NNRA 3TW7A 5C44J 1MH3A 1FTZA 4C3HJ 3CWRA 1DU6A 3JSJA 1BA5A 2L7MP 2X6OA 1NTCA 3NARA 2HOSA 5CW8A 4M3FA 3GTKJ 1XC5A 1JJ8C 4IHYA 1Q1VA 5K7ZA 2RAEA 3JRHA 3VW1A 2XPUA 2HDDA 3S5RA 1YRNB 1NK2P 4M6VA 3M3YJ 2FBQA 3G7RA 3Q0WA 2DA5A 3S2DJ 5EG0A 1W0UA 4B4CA 3IH3A 5IP9J 1A6IA 4Y52J 3GEUA 4CYCB 1AHDP 2G7LA 1RKTA 3HGGA 2OI8A 2WGBA 3S2HJ 2Y30A 3HKZN 4BKXA 4AUXA 1FEXA 3LSJA 1SGMA 2MSYA 3MN2A 4JNNA 2LFBA 2PZ9A 4BY7J 2JA7J 4A3IJ 1GUUA 3ANPA 1P7JA 4D7MA 1X2NA 1ZR2A 9ANTA 1RESA 2LY9A 3RZOJ 3LWJA 2JMWA 3BTIA 4IHWA 2L7FP 5C3EJ 3GTOJ 5IYDJ 3S1MJ 2HXOA 4C3IJ 2ZCMA 3HGYA 2X9DA 2MW8A 2M34A 3VPRA 3RKQA 3QQAA 3HOZJ 1S7EA 1ZKGA 4XRSG 2HYJA 2LR8A 4DZJA 4I6ZA 3BR2A 3VVZA 3BNIA 2K40A 2Y9YA 3T6NA 3Q0UA 3DCFA 2R5ZB 2K9QA 3LSPA 3A01A 3BR0A 2N8GA 1JJ6C 2LTPA 4UUTA 1IJWC 1QVTA 3FK7A 1JKQC 4A3MJ 1K83J 3BG9A 1U9OA 1BW6A 3D1NI 3BR1A 5EDNA 5F27A 2EQRA 3MVPA 1U78A 3BG5A 4XIDA 3S16J 4MXMA 3HIMA 3NXCA 1BL0A 3HM5A 4HKUA 1MBHA 1BJZA 5EZGA 3P9TA 2VPRA 4NELA 1B72A 2L0KA 3NAUA 3HB9A 5FHPA 1UG2A 1TWCJ 1JUSA 2L7ZA 4JKZA 2CQXA 2KDZA 4FTHA 5D1RA 1ZTRA 5FLVA 3CMYA 2EZKA 2VKEA 4I76A 4XICA 3CJDA 3RQIA 1JGGA 2XGEA 5IP7J 4CGRA 2M9HA 4L62A 2Q24A 2DA6A 1MSEC 2JA8J 5J1RA 3TP0A 3QKXA 1LE8A 5FKKA 1ETWA 4JX6A 3HTJA 2Y2ZA 2DA4A 4DYCA 1GV2A 5GPCA 2YVHA 1FIAA 1O4XA 1H89C 2VKVA 1ZR4A 2O7TA 4UUSB 1DU0A 2YS9A 2JA5J 3HOVJ 5C4YA 1PUFB 5FJ8J 2R5YB 4D5CA 2O9LA 4GCTA 1FIPA 3JRDA 3BG3A 1IV6A 4GCKA 4A3BJ 2QIBA 4FCYA 3VW2A 2YVEA 2EBIA 3AQTA 3PO3J 2QF7A 4J19A 3KKCA 1XG1A 1MBFA 3SFIA 2XGDA 2ME6A 4BBRJ 2XB0X 3GTJJ 1ENHA 2QOPA 1JUPA 1HCRA 4A3LJ 2VI6A 2XSDC 4Y7NJ 3FK6A 1R9TJ 4LOCA 3I4NJ 2DMUA 2OERA 1IDZA 3S15J 2Y9ZA 2CUEA 3GTMJ 5M5YJ 1LFBA 1OJLA 2OPTA 2H1KA 3B81A 2DA2A 1B8IB 5FLMJ 1Y1WJ 3CCYA 2G7SA 2ECBA 1IRZA 1LFUP 2UXIA 2RASA 3B6AA 4G12A 2K9NA 1W0TA 5EF6A 4A3EJ 5EGOA 4GFBA 2ZOYA 2P81A 2Y0SN 2CRGA 1ETOA 3O8GA 4AYBN 4B3AA 3M4OJ 1FTTA 3FISA 3JRBA 1ZGWA 3QBMA 5JLWA 1NK3P 5HAWA 1ETKA 2G0EA 2Y31A 3C2BA 5M3FJ 2GFNA 1GV5A 1TWGJ 2W53A 2MGQA 3E7LA 1AKHA 1EF4A 2JWTA 3LNQA 2YUSA 3GTQJ 5FKOA 4D7NA 5DS9A 1I50J 2H8RA 3A02A 1UMQA 1I6HJ 3LOCA 2G7GA 1TC3C 5IOYA 5CXIA 5BNGA 3ZQHA 2WUIA 4RBOA 2LVSA 3SJMA 3LJLA 5F04A 5IOZA 2XDNA 3SDGA 3GTGJ 1VNDA 2KT0A 4M3EA 3I4MJ 3S14J 2AHQA 4AC6A 3Q3SA 2JN6A 1IC8A 3BQZA 2WV1A 3LSRA 2NX4A 3IH2A 3VW0A 1PUFA 3BCGA 1JT0A 1VFCA 3H0GJ 3RZDJ 5J3LA 2DJNA 2IEKA 1WCMJ 5C4XJ 2FX0A 1RPWA 4NDLA 1IG7A 2NP5A 3HE0A 2CUFA 2MG4A 1HDDC 4ABZA 5AQCA 1JTYA 5IYCJ 3C07A 4JX5A 5J1YA 3V6GA 2FD5A 3H3VK 1ETVA 3RH2A 2B63J 1JKPC 4ME9A 3BR5A 1IDYA 3ZQLA 2ZCNA 3JRCA 1VI0A 2NVTJ 3QPLA 4PXIA 4S0HB 1A5JA 3HTIA 2DMPA 2DMQA 4DW6A 1WH5A 2D6YA 2QCOA 4EEFG 2JA6J 5EZHA 1JKOC 3ON4A 1AU7A 1GDTA 2HKUA 5IYBJ 4NN1A 4A3GJ 2M8GX 2NS7A 2DG7A 3MKLA 3DPJA 1T33A 3G56A 2DMTA 1X2MA 5D18A 2W48A 4ACIA 2IAIA 1IGNA 5F0FA 1YRNA 5JLXA 5HODA 2VUMJ 2M0CA 3PPBA 4JL3A 3O8HA 2QWTA 3LSGA 2PMZN 2EZHA 2TRTA 2NVQJ 2GENA 2CQQA 3HDDA 2I10A 1UI6A 3TP3A 4DYRA 2HQ5A 4IHVA 2REKA 2UXPA 4CYCA 5HSZA 1T56A 1WI3A 2CJJA 3RD3A 3HTHA 3PM1A 2DA1A 2OF7A 4FE7A 4V2GA 3K7AJ 2DTZA 4JX4A 1TWFJ 5J1UA 3ZQFA 4AF5A 4IHXA 2L9RA 2JJ7A 1JKRC 5EG0B 2ELKA 3WHBA 4C3JJ 5E3OA 3HTAA 2E1OA 5E3LA 3EUPA 3F1BA 1MH4A 1FJLA 1MSFC 5DAJA 4MLOA 3NPIA 2ZB9A 5CXGA 5EEAA 3DEWA 2XPWA 3S1NJ 3ZQGA 1JUMA 2FJ1A 2HYTA 2GBYA 3IV5A 4MK6A 1TWAJ 4KWAA 2GM4A 5F0HA 2LD5A 1XS9A 3ZOBA 4M3GA 1Y1VJ 4GFLA 1ETYA 3PO2J 5F08A 3ZQIA 2TCTA 2R5ZA 5FKMA 1G2HA 2IU5A 2XRLA 3WHCA 3TEDA 2QTQA 2RHAA 2UXHA 3HEFA 3VIBA 2M2EA 3QPSA 2QKOA 4QIWN 3OOUA 1P7IA 3HBLA 1RKWA 3BTCA 4W1UA 3HOYJ 3BJBA 3OIOA 4X6AJ 4L5EA 4A3DJ 3A01B 3BRUA 1QVUA 2ID6A 4RDUA 3FRQA 1MBGA 2CU7A 3JR9A 3HOWJ 3MNLA 2JK3A 3HOXJ 2E2JJ 4ICHA 2EZLA 3BTJA 2WAQN 3TW6A 5FKLA 3VUQA 2D5VA 4M3BA 1WPKA 1MBJA 3V78A 3VP5A 2F07A 1POGA 2NS8A 5FMPA 3CQZJ 2DA7A 2HXIA 2WB1N 4IEJA 3GBGA 5GPAA 2GUHA 5IPAA 2EZIA 1JTXA 3G1OA 4YZEA 1H8AC 2HOAA 4GCLA 1B72B 1QPIA 1UHSA 1OCTC 2UXOA 1RETA 1OFCX 2DN0A 1IUFA 4JYKA 3G1LA 4AC0A 1MBEA 1ITYA 3B6CA 3VOKA 1ZK8A 2NOGA 2G3BA 3GZIA 4DYQA 3NI7A 1X58A 2YU9J 5F1JA 3ANGA 3E7QA 1H88C 1U9NA 2E2HJ 5H9TA 4UUSA 3Q0VA 2EH3A 3BTLA 2R5YA 1LE8B 5K7FA 4A3CJ 2LKXA 2V57A 5EFYA 2NVXJ 2ZCXA 2DG8A 4A3JJ 3UKGA 3S1RJ 4GFKA 1MBKA 5EYRA 5K58A 1OCPA 4DZPA 5C4JJ 1F43A 3IUVA 2R0QC 3S1QJ 1HDPA 2XB5A 2ZOZA 1WGXA 2GLOA 2PBXA 4MIMA 2DA3A 3JRFA 3KZ9A 2R7ZJ 2E19A 5E3MA 3PASA 3BT9A 1GVDA 4FE4A 1GT0C 1B8IA 2UXUA 1UI5A 4X1EA 4XRMA 4QTRA 3BR6A 1ETQA 3JREA 1Z77A
chains in the Genus database with same CATH superfamily
2A3SA 1G3WA 2QSFX 4XK4A 4K2EA 2KIQA 2ZMEB 1V55H 3PNTA 1WH7A 2E1MC 1HKSA 3CUQA 3F0CA 4QLCU 4BY1J 4XBFA 4PDKA 2HI3A 3FBIB 2YU3A 4KICA 2VXDA 4U9NA 4ZDLA 2H6CA 5EGOB 2A2FX 1K78A 3K2ZA 5TGTA 1J75A 1JT6A 1L0OC 2ECCA 3LSMA 2K02A 2ZSHB 2DCEA 1APLC 1SMYF 3QU3A 1DP3A 2XKPA 1X1CA 1E2XA 3FMRA 5CYVA 3WGHA 4YIRX 4MNUA 2CW7A 2QSHX 2CUZA 5M5XJ 1BM9A 3J81Z 2FJI1 2D1VA 2HOTA 2QUFA 3K0LA 1HF0A 2IGKA 5M5WJ 2BHZA 5H6RA 4HSRA 1WKMA 3ZMZA 5FB2A 4A93J 4KIGA 3SYTA 4ITVA 2KRCA 4YG2F 2E2IJ 5DTDA 1AOYA 5FLXZ 3F3XA 2X85A 1SEUA 1LVAA 3A03A 1M1EB 3DEEA 1PP7U 3KKDA 2COBA 3V7SA 3KPHA 2PN6A 3BG6A 1Z0XA 2JZYA 3KCCA 1I6XA 4W97A 3KYDB 3TGNA 1J59A 4A3KJ 2R92J 1HKTA 4A6DA 1TNSA 3JRIA 3ZQCA 1U8BA 1E3HA 3K2AA 1D5YA 4ASNA 4U0YA 1X3UA 1V4RA 2P7CB 1T8IA 1G3TA 4V2FA 3KNWA 3LFUA 4BJ6C 5IP6A 3U2RA 2IP2A 2HOEA 2IS2A 3L2RA 3G1MA 3QAHA 4LLLA 2KJCA 4HX7A 3CDHA 2VT3A 3JRGA 5K5QA 4I7HA 3BQYA 3S17J 2X4HA 3ZQ7A 2D2WA 1R58A 2BVLA 4PSXA 5KVRA 1DU6A 4NQWB 3U1KA 3NARA 1NTCA 2YX7A 2HOSA 2ZNZA 1XC5A 1JJ8C 1VQKI 3F8FA 5HLGA 2DW4A 5K7ZA 4J00A 2FBIA 2NAZA 2XPUA 3VYSB 1YRNB 3RYPA 4E7IA 2PG4A 2GA2A 1PP8F 5KCMA 1YW7A 1MJAA 2W84A 1OCZH 2DA5A 4RA2A 1DUXC 4X0GA 4OMYA 4V19K 4M9SA 4RB1A 2HWVA 1XDUA 3G73A 3A2KA 1A6IA 5FROA 3C18A 1PUEE 1NH3A 1JHFA 3HGGA 1YJWI 2G7LA 3GEUA 3S2HJ 2K9MA 3HKZN 2KDOA 2K4JA 1SGMA 1G3SA 3FMQA 1CF7B 1W5SA 2MYSA 3MN2A 2LFBA 3CP8A 5E1WA 4XRFA 5E8GA 1V5GA 4BXUA 4A3IJ 2PZ9A 2BE5F 5F6FA 1YS6A 2V1UA 4M9XA 3IL2A 4P1WA 1X2NA 2LSOA 2JMWA 3HSRA 4KIBA 3OYBA 5ICGA 2NRAC 4UHTA 5C3EJ 4AVPA 4HRIA 3BZ6A 3GTOJ 5J6XA 2A5WA 2X9DA 1ZH5A 2MW8A 4A0YA 3HOZJ 5LGNA 3MEXA 2K40A 2KRFA 4BJTA 2E34A 3MWMA 1KZHA 2ZY9A 2KKOA 3EUHC 4XLPF 3Q0UA 4ZYAA 1YITI 2R7WA 2N8GA 4OAYA 3OY9A 4E4HA 4UUTA 3ELKA 5LLQA 3FK7A 3RPUD 1S3JA 2KZVA 2ZBKA 5CJ9A 3LSIA 2VBWA 2EQRA 3BG5A 1RIOH 4QPOA 2M7AA 1Z3XA 1R36A 1A36A 1MBHA 2VJIA 5EZGA 2VPRA 3BLYA 2V79A 4QWQA 4XORA 3KYLA 1E17A 1LFPA 3H35A 3NAUA 2CQKA 2A68F 5H20A 1JUSA 2L7ZA 2KDZA 5D1RA 2E7WA 2VBYA 4I76A 1BIBA 2DLLA 4IQJA 2V6CA 5DCFA 2R7TA 2BBYA 4LMYA 2Q24A 2DA6A 1S72I 5J1RA 4GYGA 2BHYA 2KRHA 3T0YA 3CJRB 2KISA 5FKKA 1ETWA 2QWWA 3HTJA 1CF7A 1KYWA 2EIJH 2DA4A 4A5MA 2HQNA 5TISC 1STZA 3U9GA 4OAZA 5GPCA 2PI0A 2VKVA 1I27A 3DLAA 2HZDA 2CO5A 4R1HA 2Z5UA 1DU0A 3CJNA 5FJ8J 2CQ7A 1FMVA 1K79A 2PJPA 3JRDA 1ZN2A 1IV6A 4IJAA 3E5UA 1IF1A 1PVEA 3BJOA 2QIBA 4FCYA 1BC7C 3ZMDA 3VW2A 2ICWG 2EBIA 1Z9CA 4FQGA 4EMSA 4E7JA 1RZ4A 2MLGA 4IRHA 3F6OA 3SFIA 1BIAA 3WG7H 2ME6A 3GTJJ 2IGOA 5DV5A 4CO8A 4A3LJ 2VI6A 2XSDC 2PX9A 4Y7NJ 4CA0A 1WHUA 3KZZA 5EJCA 4I98B 4M73A 2OERA 3BWGA 4DQ2A 2IT0A 1GVJA 4EGYA 1WWXA 3DTIA 3PJRA 4B43A 2PMZA 4EM1A 2MLKA 2W7NA 3CCYA 3K4JA 1OQYA 2R3SA 4NHJA 5D5VB 2UXIA 3W3CA 4G12A 2M7BA 4O3MA 4RGRA 3CC4I 2CRGA 1ETOA 3O8GA 1XGNA 4E7ZA 3FISA 1ZGWA 1UCRA 5JLWA 1A6QA 5DD8A 2RNGA 3C2BA 2GFNA 2UXNA 1QA6A 2YVXA 1AKHA 3DTEA 2Y69H 1B9MA 4IRVA 1R5HA 4U87A 1HSTA 5DS9A 4D7NA 2NS0A 2H8RA 1HBXG 3A02A 3ROUA 1X1DA 1BI2A 1TC3C 1WJEA 4F92B 4LIVA 5D8LB 2EV0A 2LVSA 2WY7Q 2BY3A 4HX8A 5F04A 1IN4A 3JTGA 1RNLA 2OZ6A 3R0JA 2VLAA 2OAZA 2COMA 1IC8A 3LSRA 2NX4A 3I71A 2QGUA 4P5OA 3K4MA 3H3UA 3SQNA 1GXPA 4LLNA 1JT0A 4BHPA 1KQ8A 3L2QA 2K86A 3K1PA 5BMZA 1WCMJ 2XAHA 1RPWA 3VYRB 5DCMB 1ZAOA 4ESBA 3MCZA 3BROA 3GYHX 5L3EA 1F5TA 3HHHA 1BR4A 3HRUA 2ADUA 2MH2A 3H3VK 4ENMA 1DGRM 1IDYA 2DPUA 4PXIA 1MIJA 2D6YA 4RS8A 3V8JA 3WU0A 2QCOA 5EZHA 1K6OA 4KJZA 3RI4A 5IYBJ 1FOWA 2XIGA 1D8JA 2QQ8A 3MAJA 2ZNYA 2EFWA 1TT0A 3OR2C 5AIQA 2LRDA 1CGPA 2W48A 2RREA 5LEJA 2F5FA 3IKTA 2XC7A 5HODA 1FOYA 2X1EA 3LSGA 3KZYA 1DDNA 3IHUA 2WBMA 3H92A 2HFHA 1XMAA 5JR3A 5L3CA 2OTJI 5IT9K 2HQ5A 2LY1A 4IVNA 5LGTA 4ZH4F 1F4KA 5ICFA 4L9NA 1Y0NA 2CJJA 1UZCA 4BU2A 2OF7A 3OWTA 4FE7A 3K7AJ 1LDDA 3ZQFA 1TWFJ 5FD6A 5AONA 4IHXA 4LG0A 2WADA 4HF1A 2XRNA 3HTAA 1MH4A 3I3LA 2F48A 5J47A 3FHZA 3NPIA 5B66C 2AXTC 1D8KA 2ZB9A 3OYKA 3OYGA 5CXGA 2M30A 1K7AA 5K5RA 3ECOA 2CS3A 3P9KA 2EFNA 4KWAA 3J80K 3DPUA 4M3GA 1ZYRF 5CPRB 5JHFA 2GIZA 3SZGA 3PO2J 2RDPA 3CO6C 2TCTA 3CP2A 2XRLA 2Z16A 4BEHB 1W5TA 2CSOA 2RNJA 2AQEA 1ZRDA 1TBXA 3HEFA 3I4PA 1YX3A 3DPLC 2V4JC 1Z7LA 3CCRI 4BE0A 3HZJA 2H09A 3ONQA 1P7IA 2DOFA 3S3OA 1EH8A 3OYLA 2QKLB 2VJ5A 4NUBA 3L2UA 2QBYB 2V9PA 1QVUA 2ID6A 4RDUA 3HOWJ 2CU7A 3JR9A 2JK3A 2KLOA 2CV0A 1LDKB 2E2JJ 3OL3A 4DNCA 1YW8A 5ERIA 3I59B 5FKLA 2FOKA 2LOOA 5LBQA 3PL8A 1MBJA 2VE8A 2XSJC 3VP5A 4LFUA 2HXIA 2WB1N 1SFUA 2GUHA 5E18F 4YFNF 1Z21A 2HOAA 4HQMA 2DN0A 1SD6A 4JYKA 3V7CA 3G1LA 1IN6A 1MBEA 1ITYA 3B6CA 3F21A 2R7UA 3LSHA 3GZIA 4XMYA 4MEXF 2YU9J 5F1JA 3ECHA 3WTVC 3BZKA 4WCGA 2NVUB 1H88C 1U9NA 5B1BH 3BP8A 3HRSA 5H9TA 4L5JA 1FBUA 2EH3A 3PUFA 3VWBA 3ZPLA 2R5YA 1LE8B 1UFMA 2M8EA 5CVIA 2MABA 2EFQA 2UWMA 1FSHA 2GWRA 1R23A 4A3CJ 4JOMA 2LKXA 2V57A 1QU3A 2P7VB 2NVXJ 2ZCXA 4F7ZA 1EH6A 2DG8A 2K3PA 3UKGA 3S1RJ 4GFKA 5K58A 2CUJA 2X1CA 4XSXF 5LRSA 4AD9A 2NOJB 2V9KA 4M6YA 4AIHA 1V5FA 4L0YB 3M1CA 1Y8RB 4O6JA 1Z6TA 3SZTA 2DA3A 3JRFA 2M87A 3KZ9A 3PASA 4CSWA 3Q9VA 1UI5A 5BQTA 2QBYA 2BXYA 1V5EA 1GLNA 2M3AA 1ETQA 1QQIA 2HQAA 1Z77A 2VOOA 2ME0A 5H2FC 2Y0SA 1BW5A 3G4SI 3NWTA 1WI9A 2XPVA 2L01A 1CQTA 4FISA 2JRTA 3GTLJ 2IW5A 3JRAA 3ESWB 3CF2A 2K3FA 2QLZA 2V7FA 5F0CA 2QA4I 4LIUA 4XM3A 2FMLA 2K5CA 3GFMA 2IBDA 1XSVA 3BR3A 4S05A 2VPLA 3ABKH 3HKZA 3LHQA 3P9IA 2IGMA 1SANA 1QRYA 4H4KC 2L02A 1MMNA 1USSA 2BY2A 2D1HA 4G8XA 4FASD 3WE3A 3L00A 4HF0A 5L3FA 2K9SA 3KP4A 4C2MJ 4OWRB 2M1BA 2WAEA 3ERMA 4II2A 2HKOA 4Q5SF 3RJPA 1VZ0A 2F2EA 2FQ3A 3BOQA 2R7DA 1NG7A 3UR3C 3E6CC 5CVVA 4PGGA 3KLOA 3ON2A 1UELB 4DBQA 1XGMA 4XKWA 2W24A 5D4SA 1YHQI 5ILSA 5DEQA 2YR2A 1R1TA 2AO9A 4GCVA 5HBUA 1Z7UA 1F36A 2A05A 2FNPA 2CYYA 5B1AH 3O60A 1WJDA 1X3ZB 1EH7A 1HKQA 1LNWA 4HEA2 3H5RA 1FBSA 4MFEA 4R79A 2E1MB 4I01A 4ENNA 2R93J 1K61A 3RSNA 5M3MJ 4EJUA 2G7UA 2BY0A 2XGCA 5FGLA 3VOXA 4BE1A 3GMEA 2AS5F 5F1RA 2UXXA 3R4KA 2OCCH 3ZR8X 1XGOA 4RB0A 2L2OA 1HLVA 2NP3A 5FKNA 4IKFA 2ZXJA 3A0HC 2JUCA 4GGGA 1KYZA 1C0WA 4MFDA 1R22A 1O57A 1REPC 2ID3A 2K85A 3K4KA 5DUIA 1D0ZA 4B09A 2XAUA 3CCSI 1MNMC 3TW7A 5C44J 1MH3A 4I0BA 1X1AA 2IA2A 2MH9A 4C3HJ 2RQPA 3WODF 2QQAA 1BA5A 3A0BC 2DK8A 4M3FA 3GTKJ 1U5TC 4IRGA 4AIKA 1Q1VA 4WXHA 3MKWB 3S5RA 3VSLA 3JTHA 4DJAA 4M6VA 1V3FA 1KONA 3M3YJ 3TBIA 2M4KA 1VQ4I 2FOWA 1WJ5A 4B4CA 4CCOA 3S93A 3DXJF 4CYCB 1BR2A 1RKTA 5LHHA 1I3AA 3WTSC 3GZ5A 1HW5A 2FXAA 3I0TA 3LSJA 3F72A 3KP3A 3HPHA 4OIRF 4BGDA 2MSYA 2OA4A 2WY8Q 2Y75A 3LQRA 2ZC2A 4N9IA 3VEPA 5LEKA 3FXMA 2JA7J 1GUUA 5KAIC 4LITA 3ANPA 2OC6A 4D7MA 1ZR2A 4XSZF 2VIXA 3LWJA 2DFIA 4IHWA 1TZLA 3K1MA 5IYDJ 3LA3A 1RRJA 2IPQX 3VDXA 1WJAA 3HGYA 1ZHFA 2XVCA 3RKQA 1H0MA 1X1BA 1DGWY 3DFGA 1ZKGA 2GQQA 2VKDA 2HYJA 4XRSG 4DZJA 5IT9Z 3BNIA 3K70C 1KU7A 2Y9YA 1KGSA 3E6DA 5HLIA 4PJNA 1VQ7I 4G9YA 3DCFA 4C30A 2R5ZB 3A01A 4E7KA 2IRFG 1RR8C 2LTPA 3FZVA 4WIBA 1IJWC 1IUYA 1QVTA 1SD5A 3ZP5A 4EATA 4A3MJ 1K83J 3BG9A 1U9OA 3DV8A 1MJBA 5EDNA 2M45A 2X6XA 5F27A 1U78A 4ZYHA 1FOXA 1XMXA 3S16J 4MXMA 3H36A 4Y4RA 2FNAA 4U0VA 3L2WA 1BJZA 1G4DA 1KQ0A 4EM2A 2Q1ZB 4XR6A 3J80Z 2A5YB 4NB5A 2L0KA 1LQ1A 5FHPA 4HLYA 5LFAA 4JKZA 4FTHA 5FLVA 5HOOA 2EZKA 3GZNB 4M74A 4XICA 2KZGA 2UV1A 3KX2A 5TRDA 2X1DA 2XGXA 1T38A 2XGEA 1IN7A 2JA8J 2DFEA 3QKXA 2KMUA 3KYCB 3LMMA 4RB2C 1FLIA 1IW7F 1IXCA 4WWCA 1O7FA 3I64A 2VODA 3CUQC 2K27A 2L9NA 2R4GA 1QHGA 2VXZA 1FIAA 3GFLA 2XAGA 3ERED 3I56I 3Q5FA 4UUSB 2B9SA 1O4XA 1B1BA 1PUFB 3OS1A 4BYYA 1XPXA 4D5CA 1R1VA 2P6TA 3BG3A 4YELA 1I1GA 2HTJA 1W36C 4A3BJ 2R7XA 4PJMA 4GCKA 1Z05A 1ULYA 2YVEA 3PO3J 1S5LC 4J19A 1O3TA 2QSGX 1XG1A 1MBFA 5DUKA 2O6GE 1ENHA 3HUGA 1HCRA 3RTRA 3DBHB 3FK6A 1R9TJ 2FU4A 4LOCA 2LYCA 3I4NJ 4CCMA 5GAEJ 2WC2A 4CUGA 1Y8QB 2ZCWA 1IDZA 2PMUA 3GTMJ 2ZMEA 2OPTA 2B7EA 1QZEA 2H1KA 4UB8C 3ML6A 5FLMJ 1XCBA 3KP2A 2L54A 2ECBA 2CW8A 1Y39A 4G6QA 4AIJA 5EF6A 5HNHA 1S7AA 5EGOA 4OIPF 3QP5A 2Y0SN 4AYBN 5BOXA 3VSKA 3M4OJ 2HVQA 4IX7A 4IOCF 3DKWA 4XN3A 1T6SA 4P55A 5HNFA 5M3FJ 3CCUI 1TWGJ 1LEBA 1XDSA 1FYKA 1P4WA 2MGQA 3BZCA 3E7LA 2GOXB 3GO5A 1EF4A 4BS9A 4KNYA 2A61A 4ENKA 2A07F 1W7PD 2KIFA 2G7GA 5IOYA 5CXIA 3PSIA 3MKYB 3SJMA 1WJBA 3K69A 3MD2A 3KIOA 3S14J 1WSUA 3MZYA 3BPXA 1P4AA 1UHWA 2XAFA 5KK1A 1HC8A 1ONVA 3E5XA 3IH2A 2BY1A 3J7ZI 1PUFA 1LPQA 3BCGA 2EIKH 3H0GJ 1GHCA 3IAS2 3V7RA 5CVUA 3PQKA 4BJ5C 3HE0A 1O3QA 1X4PA 1H9TA 1HDDC 4ABZA 4A0ZA 1JTYA 2KL4A 4JX5A 4M72A 5J1YA 3RH2A 3G71I 2ZO4A 1JKPC 1YLFA 2JQ7A 3ZQLA 4FT8A 2ZCNA 4G7OF 2H94A 3MFKA 3CJTB 2DAOA 3CCEI 1VQ8I 3JW4A 2NVTJ 3QPLA 3QYBA 1YQAA 4N4NB 3GLLA 1A5JA 3HTIA 3W2WA 4DW6A 2WB1A 2Z1DA 2O61A 1SD7A 2NNYA 4EEFG 2OTLI 2HKUA 1BI1A 2X6WA 4CHUA 4A3GJ 5E79C 4NQWA 3C2GA 3WGIA 2L5QA 2DG7A 3MKLA 3DPJA 1T33A 2KIMA 2DMTA 3G56A 2HYFA 4BUPA 4ACIA 5HDKA 3I55I 5F0FA 1LDJA 3BY6A 1YRNA 4UV8A 3TDZC 2QWTA 1TQIA 3IP4B 4IO9F 1SVMA 2L9VA 2EJRA 1TQMA 1QHHD 2Z3YA 1UI6A 2HDWA 3AKZA 2IXSA 2REKA 2V9VA 1FOKA 4XLHA 2PMHA 2OU2A 2RN7A 1WI3A 4HAMA 3IWZA 3WTWC 3RD3A 3PM1A 2RVCA 3OYNA 4AF5A 4JX4A 5J1UA 4PZJA 2L9RA 4HDVA 5CVRA 5EG0B 4DIQA 5E3OA 1PYVA 2E1OA 2DYSH 1XN7A 2LNBA 3EUPA 4RM2A 4Z6YA 3DF8A 3F1BA 2LG4A 4IPAA 2F4OB 1IZ1A 4EQQA 3OYHA 3MZ8A 3K4NA 3DEWA 5HS8A 2EB7A 2XPWA 1FWZA 4E7LA 3S1NJ 3ZQGA 4GO1A 1JUMA 4N9HA 2BW3B 3SXYA 1OYWA 2HYTA 3IV5A 5F0HA 5GTHC 1XS9A 4B47A 4OD4A 3LA7A 4UY8I 1O7LA 3CDIA 2XAQA 2QVOA 3WHCA 2RHAA 2M2EA 3GZ6A 3E1SA 3CJQB 2ZFUA 3VFZA 2VJJA 3HBLA 2B0LA 4XOTA 2E36A 4L5EA 2BGCA 4A3DJ 4CDGA 3MNLA 5JHUA 2NXNB 2FMYA 4ICHA 1S8NA 2EZLA 2WAQN 1VQOI 3TW6A 2VONA 4H0EA 1ZRCA 4M3BA 1B9NA 1TW2A 4HBLA 4IOAF 2IS1A 1WPKA 5JVGF 3V78A 2QEXI 1XMKA 5FMPA 2LF8A 4HV6A 1E3PA 5GPAA 3FXQA 5IPAA 3G1OA 3PFYA 1B72B 1MDMB 3QYEA 2P8TA 1IUFA 4AC0A 5ICCA 2BOLA 4A5NA 3WTUC 3VOKA 2G3BA 2F5EA 3QOEA 4F3QA 3NI7A 4D1QA 3ANGA 1UJ8A 3HYIA 1J2XA 2R7SA 1OKRA 3CMMA 3DWLE 3KEYA 1QGPA 3L9FA 2OUMA 2L3DA 1D0XA 2HPMA 4NNJA 3F8CA 2WWYA 4BACA 3N97A 1SMTA 1IXSB 3TMOA 1BN5A 3L7WA 5L3BA 1BR1A 3WTTC 3H9QA 5E1XA 1EV7A 1OCPA 4DZPA 1R7JA 2DI3A 4CZZA 5C4JJ 2XB5A 3RQ4A 5KNLA 1WGXA 2GLOA 2IJLA 2Z2SB 2E5NA 3K8PC 4NC6A 4U7BA 2DOAA 3RCOA 1ERDA 4LK1F 2QZ8A 2ISZA 2R7ZJ 1D1AA 3F8BA 1IRGA 1T98A 2LF7A 4PGHA 4F93B 5J8FA 2NYXA 2P0WA 2LH9A 2H27A 3PIPF 3M9AA 4XRMA 2NNNA 2XAJA 3CZ6A 3VODA 3JREA 1ZG1A 1HW2A 2E1CA 4G6DA 3QP6A 1OR7A 3SWHA 4GDFA 1Z3YA 3VVYA 1W7PB 5HLTA 4ETSA 1J7KA 4M3DA 2CFOA 5D5UB 4B3XA 4QSHA 1ORKA 2EPFA 3SHFA 4ZDPA 5GP9A 3N4MA 1RC9A 2FA5A 4Y17A 3D5RC 1ZRFA 2Z33A 3KEOA 3K10A 4F91B 4ESJA 2V1XA 3CC7I 4KA4A 4B8XA 4UDSA 1SFOJ 2GXBA 4Y15A 1ODDA 4BBSJ 4D5FA 4WK8F 3ULQB 1I3QJ 3LL7A 2V1NA 3PFIA 1FT9A 2OQRA 3O6BB 1ZARA 1QZYA 3QOPA 3RIRA 2LP0A 2YX4A 4XNFA 3OSGA 4YEJA 3HC7A 4F52A 1UB9A 4MQVA 1XCVA 3FXLA 3H9JA 3AG3H 2K9LA 2JPBA 5IT3A 3BHQA 4CICA 1X1PA 5DCMA 1W36D 4HYEA 3FKIJ 2P5LC 1KQ9A 1XX5A 3BPVA 5GADJ 2DT6A 4M71A 1U8RA 4YIIA 2O5RA 3GTPJ 2Q2EB 2IS4A 2LLKA 3CDLA 1G3YA 3W6VA 3S3MA 2Q8KA 1X19A 4JP0A 2DYRH 4RGUA 2K7LA 2DMNA 2ZKZA 1R5GA 2HR3A 4F55A 3P5JA 3MMYB 1RR7A 3WGGA 2X48A 1E3OC 3FHNA 2D45A 4KMUX 3J7AY 5K7HA 3IH4A 2ZJRF 1USTA 4HA8A 4DOZA 1DP7P 3HSEA 3COLA 3M8EA 3NNRA 3R60A 5F64A 4OINF 1FTZA 3ZMUA 2OQGA 4O5VA 1F1ZA 2L7MP 2X6OA 2KPMA 2CGPA 4IHYA 1XB4A 3BCAA 3JRHA 3VW1A 1LKXA 2PJRB 2HDDA 4XKCA 3ZXSA 4G6TB 3G7RA 4BQQA 2ZJ2A 3Q0WA 2FEZA 5ILUA 1FNNA 1YYVA 4MTDA 1J0RA 4CH7A 4NC7A 1JHHA 3IH3A 4Y33A 3TOBA 5IP9J 2OI8A 3P7NA 4CCNA 2Y30A 1R4NB 4AUXA 4A2UA 4BKXA 4U88A 4KISA 4JNNA 4ESFA 3RPUA 4HOBA 4FX4A 2R7VA 1YI2I 3BCBA 1I1SA 3BJAA 3BTIA 1BI3A 2B1EA 2L7FP 1S7OA 3S1MJ 4C3IJ 4BEHA 2XKOA 2VQHA 3RKXA 3VPRA 4CYDA 4I6ZA 2LR8A 3BR2A 4HX4A 4OMZA 2PEXA 2Y0MA 4E7HA 4RAGA 2DT7B 2Q2EA 2VBXA 4Y3OA 2CWEA 2QQBA 2HDCA 2K9QA 2MC4A 3FDYA 4D0PA 4E7SA 3BR0A 1U5TB 2A6HF 2MC3A 4A0XA 1R5ID 4XLAA 4LB5A 2VKHA 3OYMA 4P9UA 1JKQC 4AYBA 3I59A 3T5XA 3D1NI 3D0SA 3BR1A 4XIDA 2YSRA 4HW0A 3SEZA 3F22A 5J40A 4UV9A 3E5QA 2DQRA 2OV7A 3S2WA 1VQNI 5K1YA 4PFPA 4KFCA 4I2OA 3P9TA 1DQUA 1WJCA 5K5OA 2DFHA 2ZXIA 5LGUA 2L4MA 3HB9A 4I99C 1UG2A 2M4GA 1TWCJ 1PJRA 5TJJA 4YRVA 5E1ZB 3CMYA 1HA8A 3HIFA 2VKEA 4L9VA 5LD2C 3REOA 1YX5A 5FD5A 4OOIA 4CGRA 4L62A 3V8KA 2M9HA 4PJ0C 3EQLF 3IUOA 2OBPA 1MSEC 2HNHA 4MTEA 3ZGKA 4PUSA 3OV8A 5HDGA 3E97A 1LE8A 1A31A 4JX6A 3HRMA 4I02A 2XROA 2Y2ZA 2LBFB 1GV2A 5ILVA 3AL0C 4Q4ZF 5D6FA 4C2UA 1T0FA 2YS9A 3HOVJ 5C4YA 3QODA 2FUG2 2O9LA 2CMPA 4GCTA 1D1CA 3WTYC 4ENJA 1FC3A 4YIFA 1BC8C 1Z67A 3DKYA 3OIPA 1ZGAA 5LRRA 3TO7A 1P4XA 5CVJA 1VQ6I 3KKCA 5FFZA 5BPDA 4BBRJ 1ZREA 3VYUB 2QENA 1JUPA 2QOPA 3OL4A 2OZUA 3IAM2 2DMUA 5KHDA 3DU6A 5J4YA 5D5WB 1T08B 3S15J 2Y9ZA 2DBBA 5M5YJ 3B81A 3D5LA 2DA2A 2QKMB 4HNTA 1Y1WJ 1B8IB 1OCRH 1XSXA 2G7SA 5B5EC 2R7OA 5BPIA 5E8IA 1IRZA 1LFUP 2RASA 1IV8A 2W25A 5H6QA 2VQLA 3AG4H 2P81A 3V4GA 4ZDOA 2A6EF 2E1NA 4B3AA 5HS7A 1TLHB 1W5CC 4Q48A 3QBMA 3CUQB 2CFXA 1NK3P 1KU9A 3W2AA 3F8MA 1P92A 3GCMA 3QU6A 1T39A 2DDBA 3LQQA 2BYVE 2GAUA 1NHAA 4LJZF 2JWTA 3LNQA 1K78B 2VOPA 3EYIA 3CMEI 2JT1A 2EWNA 2YUSA 5HLHA 2L4AA 5FKOA 4BHBA 1I50J 1QPMA 2R7QA 1L3LA 3A4CA 3GTQJ 2EA2A 1UMQA 2DK5A 1I6HJ 3FWEA 3ZQHA 3ZN0A 3PIOF 3LJLA 1VQMI 2G9WA 4IF4A 2XDNA 2VE9A 1X4OA 1YW9A 1VNDA 2KT0A 3HHGA 1JGSA 4M3EA 3H1CA 3ZMVA 3I4MJ 4AC6A 3Q3SA 4KIFA 1N78A 3BQZA 3L09A 2WV1A 3O2PE 3LAJA 1QZZA 3E6MA 4DVYP 3L2VA 2LC2A 4ANJA 2Z9OA 1VFCA 1U0JA 4XLEA 5JVTA 3KZIC 5D5XB 2DJNA 5C4XJ 3ZMTA 2FX0A 4BL0B 5J8CA 3K1NA 1B6AA 4IXAA 2GZWA 2JPCA 4NDLA 2W82A 1IG7A 3S3NA 2NP5A 4P96A 2F5DA 2ZJQF 2LMDA 4ZC3A 5DM7F 5AQCA 4GYIA 5IYCJ 1OISA 3M7GA 1Y56A 1QO0D 2WAQA 2FD5A 3OYJA 1FP1D 1ON1A 5HS9A 3GUDA 4NBQA 3JRCA 2JSCA 1VI0A 4OIOF 2CH0A 1MNEA 4MGRA 3AG1H 2DMPA 2DMQA 3T1BA 3ZQQA 1P9QC 1T2KA 3GF2A 3IC7A 4D9JA 4EJVA 1AU7A 2M8GX 1FSEA 2NS7A 1IO2A 3GEZA 1X2MA 2JRMA 4KMFA 2STWA 1IGNA 1I5ZA 2G7HA 3WG9A 1MKMA 3H5AA 3ABUA 2TRTA 2A69F 2NVQJ 2GENA 2CQQA 1MW7A 4WX9A 2ZJPF 2I10A 3HDDA 2M0MA 4DYRA 1O3RA 1MD0A 4BXFA 4CYCA 2KFDA 3JSPA 2DDAA 2DA1A 4V2GA 2Q0OA 2DTZA 4HV5A 3OYEA 2XDVA 2JJ7A 4L9TA 1J09A 1YIJI 1JKRC 1FPQA 1R1UA 2ELKA 2RC4A 3WHBA 4C3JJ 3AAFA 4ON0A 3QWLA 5E3LA 1ACIA 3H3ZA 4LD5A 3EETA 1FJLA 1MZBA 1SFXA 1FBQA 4GXOA 4MHGA 5EEAA 5FFXA 5GTIC 1XD7A 2FJ1A 3V8LA 1YG2A 2GBYA 4PSWA 3P9CA 2UUZA 4G94A 4MK6A 1TWAJ 2GM4A 2LD5A 1H9GA 3PSFA 1QNTA 3LSTA 1IRXA 3ZOBA 1Y1VJ 4CCKA 3TO6A 1AWCA 2J5OA 3ZQIA 2R5ZA 5FKMA 1G2HA 2W4SA 4IZZA 3SEQA 2V1DA 3M07A 3TEDA 4ZTFA 3GLXA 4A12A 2RKHA 1VQ9I 3OOUA 3BTCA 4W1UA 3C1DA 4X6AJ 1J5YA 3K6GA 4XLCA 2GXGA 2GXAA 1FY7A 3FRQA 1MBGA 4L0ZB 2OJED 2VB6A 4RLQA 4HLXA 3TOAA 3BTJA 1OYIA 3M8JA 4UUVA 4RLFA 3C7JA 1ZGJA 3SZPA 3IKVA 3ZRGA 1WQ2A 1TW3A 2ISYA 2V26A 3EDPA 2F07A 1POGA 4BDYA 2IA1A 4KYWA 2NS8A 2ELJA 3OIQA 3CQZJ 2DA7A 1YOVB 3HRTA 4IEJA 2FBHA 4LLGF 3GBGA 4M6XA 1IAWA 2EZIA 3TDUC 1JTXA 1FP2A 1U6GA 4EJTA 1HW1A 2EA4A 1QPIA 2F4MB 5GAGJ 3D5SC 2FF4A 3GW2A 4EGZA 2UXOA 1RETA 1ZLJA 4BQOA 1OFCX 4L9JA 2P5VA 3MQ0A 4BDZA 1Q1HA 1R00A 2NOGA 3SDBA 1RUNA 3QPHA 5A2QK 4LB6B 4I0AA 1X58A 3W6KB 2ZMEC 4N4OB 1I39A 3VTIA 1MMAA 3EUHA 2FSWA 3TO9A 2VL8A 4UUSA 3Q0VA 2ZXHA 3DBLB 2L7KA 2I8DA 2ESHA 3BTLA 3R6SA 3EYYA 4RM3A 3LAPA 3K4CA 2YPRA 4CZCA 2BEOA 3I53A 2X51A 4AVZA 5EFYA 3ASNH 4NC8A 2HS5A 1A04A 4A3JJ 3O3KA 3OYCA 1HQCA 4OU0A 2A6TA 1F43A 1BBYA 1UHMA 3IUVA 2R0QC 1RI7A 3CC2I 2ZOZA 3Q9SA 2DJIA 2Z99A 2PBXA 3DBRB 3E0JB 4MIMA 3J7YJ 3CTAA 3OS2A 3CMAI 2J5PA 4TV7A 1GVDA 1GT0C 3A1YA 4AU7A 3HOSA 5JFRA 1RUOA 1W1WE 2UXUA 1IN8A 2MFZA 2RV8A 2WAFA 2LKPA 3L2CA 4U0WA 4QTRA 3HIMA 1K4SA 4XRSA 2CG4A 4RAZA 5J4VA 4CCLA 5LHIA 4JBAA 4BNCA 1YFHA 3NS4A 3U1DA 1EKEA 4AIDA 5DYMA 1UAAA 4C9YA 3NRGA 2CV1A 1YJNI 5D19A 2O7OA 3BDDA 4KN7X 4DBRA 3S32A 4GRIA 3WTXC 3FXUA 2O03A 5E3NA 3B73A 3FIWA 4B44A 2O8KA 5D8KB 1Y0UA 3VYTB 5JI6A 1XGSA 1HOMA 1LUJB 2MD0A 4PCQA 2E60A 4DGWB 4L18B 1LEAA 2DTRA 2NVYJ 3DU5A 1VF9A 5E20A 3DTKA 1AKHB 3RKWA 1S29A 4HNVA 4ZZDA 3ABMH 5D6EA 2CV2A 1LJ9A 2HKXA 3LWFA 1R71A 2F6CA 3HOUJ 2VASA 4EVIA 4A69C 3CLQA 3DLLF 3COAC 1ETXA 3ZMSA 3QPTA 3OSFA 1MMDA 3CD6I 2BXZA 3VVXA 1LB2A 4C2MA 6PAXA 3AG2H 2KP6A 4QPQA 5FRMA 4FHTA 3HJEA 4WXCA 3F8NA 2LY2A 3CRJA 5L3DA 1G6NA 1MNDA 2F5CA 3ABTA 1OCOH 4HG2A 2LK2A 1YJ9I 2STTA 3M8FA 1DPUA 2BZTA 2R7FA 2E5ZA 3M1EA 3HXLA 3AQSA 4B1RA 4FX0A 2JTVA 3WU2C 1E0EA 3CCJI 2F4IA 1Z1DA 3DQVC 3HOTA 2PLYA 2HU9A 4XLFA 4BXXJ 3F6VA 4A3FJ 2KJBA 4RGXA 1ZQ3P 4UVCA 3EGQA 4ZJZA 3CO7C 1TP4A 3JSOA 3GFJA 2FQ4A 3L1PA 3NRVA 2XUBA 2HVRA 3W6JB 1U2WA 3OYIA 1OLTA 4MO7A 1TWHJ 2XF7A 4BHCA 2WV0A 3HSFA 4HNUA 3CWRA 3ASOH 3CCMI 1Y6IA 3FM5A 3JSJA 4IQ4A 5CW8A 3R61A 4BH9A 3EUKL 2RAEA 4LGWA 4BAYA 2GA1A 1NK2P 4R8HA 1O3SA 2FBQA 4PK4A 1SC7A 3S2DJ 3JCUC 1D1BA 5EG0A 1W0UA 2R7RA 1B59A 3KP5A 3JAMK 2ESNA 1S9HA 3MZHA 3AFHA 4Y52J 1AHDP 2WGBA 3E3VA 1FEXA 4XKVA 3K4LA 4HPQA 4PFOA 4LG0B 4BY7J 1Z6RA 2BW3A 2O3FA 4CCJA 1VTNC 1N77A 1P7JA 1WZ2A 3FXOA 1FX7A 1RESA 3CLOA 2LY9A 3HPGA 3K4BA 4RAFA 4E70A 1IN5A 2FBKA 4ZYDA 1K6YA 3RZOJ 3K70D 2O8XA 4N0BA 2OCEA 2HXOA 2ZCMA 3HG9A 3LSKA 2M34A 3QQAA 4B48A 1S7EA 2BVMA 3VVZA 1IXRC 1T95A 3CCQI 2I5UA 3W2VA 3T6NA 3S8PA 4CXFA 1P6RA 3LSPA 1JJ6C 3ISPA 3FMSA 1WFXA 3OR1C 2BV6A 2B3WA 4ZTJA 4UB6C 1BW6A 5FO5A 1J9IA 4AWXB 3VOEA 2DO7A 3MVPA 1TQPA 3RDIA 4MQ9F 1R4MB 3NXCA 3LA2A 2WA0A 1BL0A 4OD5A 3HM5A 2VC1A 2VBZA 4HKUA 1SD4A 2E35A 3KP6A 4NELA 1B72A 1MDMA 1YIOA 2RQQA 2HZTA 2PBIA 1TT5B 2EFPA 2CQXA 3RKYA 1ZTRA 4LK0F 2ACJA 3BJ6A 2PFBA 2O0YA 3BC8A 3TL4X 3CJDA 2HYGD 4BQNA 3FX3A 3RQIA 5IP7J 1JGGA 4CGZA 3I5UA 3TP0A 3T8RA 3GWZA 1A35A 4YFKF 5DDGA 2XV4S 2MA3A 1OR7C 4I09A 1XTAA 2QM3A 2DQLA 3KP7A 5IY5H 3FF5A 4DYCA 2YVHA 5GAHJ 1H89C 2JVGA 1R6RA 2O7TA 1ZR4A 4BE2A 4IL6C 1UG0A 3ZCOA 2JA5J 4XQFA 1MGTA 2R5YB 2VC0A 4XOPA 1FIPA 3IRQA 3CCVI 4UNOA 1ON2A 3CESA 4EJOA 2XF6A 1VQ5I 3PUBA 3GFIA 4HQEA 3BG7A 3AQTA 2QF7A 2ZXWH 3FXJA 3HTSB 2JA2A 1N75A 2MD5A 1KU2A 1YS7A 1TTYA 3DP7A 2XGDA 2XB0X 5A2QZ 3C3WA 3OYDA 3KE2A 3EPZA 3OYFA 4G7HF 5CQGA 2ELHA 2K4BA 3KETA 2FE3A 4WXDA 3C2HA 3TKYA 3FKJA 3GX4X 1TL8A 2CUEA 1LFBA 4Y13A 1OJLA 3J81K 1BOAA 3NEUA 1W7PA 1KU3A 2HGCA 3FM3A 4U9LA 1YE9A 1D3YA 3OOPA 1ZG3A 5FLXK 3B6AA 1W0TA 2K9NA 2V6EA 1SFKA 4A3EJ 2DXIA 4GFBA 2ZOYA 2FRHA 5BS6A 4UVBA 3F23A 1FTTA 4Z2YA 3JRBA 1FMWA 2VQCA 5HAWA 1ETKA 2G0EA 2Y31A 4JK1X 3OMYA 3AL0B 1GV5A 3RYRA 1ZLKA 2M5WA 2W53A 4HF2A 1G59A 5L3GA 3QRFF 4YFXF 4HZFA 5HVQC 5CKTA 4XONA 3LOCA 5D4RA 5FRNA 3IRRA 5BNGA 2WUIA 2XASA 3EUAA 4RBOA 1JE8A 3WE2A 3WU1B 3CUOA 5IOZA 3SDGA 3I54A 3OYAA 1FZPB 3GTGJ 4ZYEA 2Y48A 4PJJA 4UVAA 3V42A 1OMIA 2AHQA 1BI0A 2JN6A 5KAFC 5HDNA 3I9V2 3QYFA 4EV0A 3VW0A 1Z91A 2C6YA 2DOEA 2ZFWA 3PQJA 3CCLI 4LG3A 3RZDJ 5J3LA 2IEKA 1ZELA 4XKBA 3SFZA 3WTZA 1LVKA 3TQNA 1GXQA 3X2QH 2CUFA 2DT5A 2LREA 2MG4A 4AM3A 2HTSA 4UXNA 4EJWA 1P2FA 3C07A 1FYMA 3V6GA 2IA0A 1ETVA 3U21A 2B63J 4ME9A 2H1LA 3BR5A 4U7DA 4HDUA 1JXSA 1MJ9A 3H0DA 3G2BA 4KT6A 2GIVA 4S0HB 1D5VA 4XL9A 4RB3C 1WH5A 1VQPI 1HSJA 9ANTA 3FXRA 2JA6J 1JKOC 3ON4A 1GDTA 4NN1A 4PJLA 4A6EA 3B02A 3RPQA 5D18A 5ICEA 2IAIA 4EM0B 4XLNF 2EILH 2PJRA 3KEQA 1PDNC 5JLXA 4C2TA 2VUMJ 2L9SA 2DU9A 1W4MA 2M0CA 3O8HA 3PPBA 4JL3A 3T8TA 1FYLA 2KQRA 4IRIA 2PMZN 2EZHA 2JVHA 4E6KG 2X0LA 3GXOA 3TP3A 4Q47A 2IGNA 4IHVA 2W57A 2UZKA 2DFFA 2UXPA 2AQFA 5HSZA 1T56A 4FETA 3HTHA 1N25A 1MMSA 2EV5A 4RGSA 1SVLA 3DPTA 2XHKA 1G8XA 1SVOA 4ZZLA 1YO5C 4BQAA 1B4AA 2LKSA 2MBFA 3MKZA 1SAUA 2H8WA 1MSFC 4OIQF 5DAJA 2DODA 2QYOA 4MLOA 1NG6A 4S04A 3K9TA 1WRJA 5DM6F 2IS6A 1MMGA 1WVRA 5AIPA 2IVMA 2VN2A 4IHTA 5E17F 3PNVA 2W85A 1AA7A 1BOBA 3E6BA 3NQOA 5B3SH 4II3A 2PQ8A 2JUGA 4GFLA 1ETYA 5F08A 1TNTA 5EEHA 2IU5A 2HEOA 3H5NA 1U5TA 3LFKA 5CLSA 2QTQA 3HTUA 2UXHA 3VIBA 1OCCH 3KLNA 3QPSA 2QKOA 2OD5A 4RMNA 4QIWN 3JAMZ 3VB2A 1HXDA 1F9NA 1EJ9A 1RKWA 4ZYGA 2KHMA 3HOYJ 3OIOA 1WJFA 3J7AO 3BJBA 3F9KA 2W00A 1K4TA 3A01B 3BRUA 2RGVA 3HL2A 1T0FC 3HOXJ 2EFOA 3OS0A 2F5VA 2GOMA 1ZG5A 1S6LA 1U3EM 2EK5A 3VUQA 2D5VA 4KDPA 1R49A 2PFVA 4WF2A 2E71A 2AXLA 3IWFA 5CQEA 1SFEA 4KT5C 5LHGA 2EV6A 2WTEA 4YZEA 1H8AC 2XF5A 4MEYF 4GCLA 1UHSA 4JQFA 2DPDA 1OCTC 1X3WB 2KIUA 2P5KA 4L5IA 3ABLH 2ZSIB 3DEUA 2W1OA 3DKXA 1ZK8A 3PNYA 4DYQA 2P6SA 3G3ZA 1XSDA 1VQLI 2VQGA 4IHSA 3FBNB 2LBFA 3E7QA 4RAYA 3ZN1A 2E2HJ 2CW0F 2EIMH 4KN4X 2HPIA 2VT2A 2ETHA 4HSTA 2HQRA 1OYYA 1EA3A 2CQNA 1JI8A 1V54H 5K7FA 3CF5F 1DPRA 3NWSA 2QQ9A 4XN0A 3KFWX 4M9ZA 4P9FA 3R0AA 5ED4A 3H9GA 2HVSA 1MBKA 1OPCA 5EYRA 1SAXA 1IRFA 3S1QJ 1HDPA 2E7XA 5FGMA 4G7ZF 1QBJA 1KA8A 2TDXA 3UNGC 1YTYA 2JSPA 3N05A 2X6YA 5DD4A 5EEGA 3I58A 4KUMA 2E19A 5E3MA 3BT9A 4FE4A 1B8IA 2LDUA 1BJAA 3G6EI 4J01A 3FXKA 3HUGB 4X1EA 2H6BA 2EINH 2P4WA 1D0YA 3BR6A 2VJ4A 3GVAA 4KITB
chains in the Genus database with same CATH topology
2ME0A 4XK4A 4XRSA 1BW5A 1WH7A 2XPVA 3F0CA 1CQTA 3VVYA 4FISA 3GTLJ 4BY1J 4M3DA 5D19A 3NRGA 2HI3A 4QSHA 3JRAA 1ORKA 2O7OA 5F0CA 5E3NA 5GP9A 3FIWA 5EGOB 2O8KA 2IBDA 3BR3A 3LHQA 1SANA 1QRYA 1HOMA 1JT6A 4UDSA 2ECCA 1SFOJ 4BBSJ 4D5FA 1APLC 2K9SA 2NVYJ 4C2MJ 1VF9A 1AKHB 1I3QJ 4HNVA 5M5XJ 2LP0A 3HOUJ 3OSGA 2HOTA 3ON2A 1HF0A 5M5WJ 4A69C 4A93J 2E2IJ 5DTDA 1ETXA 3BHQA 3OSFA 2AO9A 5HBUA 3VVXA 1F36A 3A03A 3KKDA 2COBA 3FKIJ 1Z0XA 3O60A 3CRJA 4W97A 2LK2A 4MFEA 4A3KJ 2R92J 3JRIA 2R93J 1K61A 3ZQCA 4B1RA 3GTPJ 3AQSA 1U8BA 5M3MJ 1D5YA 2LLKA 3CDLA 3K2AA 3W6VA 5FGLA 2XGCA 3VOXA 4JP0A 4BXXJ 4V2FA 4A3FJ 3KNWA 2DMNA 1ZQ3P 3EGQA 5IP6A 1HLVA 1RR7A 2X48A 1E3OC 2NP3A 5FKNA 3G1MA 2FQ4A 3L1PA 5K7HA 3IH4A 4MFDA 3JRGA 2ID3A 4MO7A 3BQYA 3S17J 1TWHJ 1MNMC 3COLA 3NNRA 3TW7A 5C44J 1MH3A 1FTZA 4C3HJ 3CWRA 1DU6A 3JSJA 1BA5A 2L7MP 2X6OA 1NTCA 3NARA 2HOSA 5CW8A 4M3FA 3GTKJ 1XC5A 1JJ8C 4IHYA 1Q1VA 5K7ZA 2RAEA 3JRHA 3VW1A 2XPUA 2HDDA 3S5RA 1YRNB 1NK2P 4M6VA 3M3YJ 2FBQA 3G7RA 3Q0WA 2DA5A 3S2DJ 5EG0A 1W0UA 4B4CA 3IH3A 5IP9J 1A6IA 4Y52J 3GEUA 4CYCB 1AHDP 2G7LA 1RKTA 3HGGA 2OI8A 2WGBA 3S2HJ 2Y30A 3HKZN 4BKXA 4AUXA 1FEXA 3LSJA 1SGMA 2MSYA 3MN2A 4JNNA 2LFBA 2PZ9A 4BY7J 2JA7J 4A3IJ 1GUUA 3ANPA 1P7JA 4D7MA 1X2NA 1ZR2A 9ANTA 1RESA 2LY9A 3RZOJ 3LWJA 2JMWA 3BTIA 4IHWA 2L7FP 5C3EJ 3GTOJ 5IYDJ 3S1MJ 2HXOA 4C3IJ 2ZCMA 3HGYA 2X9DA 2MW8A 2M34A 3VPRA 3RKQA 3QQAA 3HOZJ 1S7EA 1ZKGA 4XRSG 2HYJA 2LR8A 4DZJA 4I6ZA 3BR2A 3VVZA 3BNIA 2K40A 2Y9YA 3T6NA 3Q0UA 3DCFA 2R5ZB 2K9QA 3LSPA 3A01A 3BR0A 2N8GA 1JJ6C 2LTPA 4UUTA 1IJWC 1QVTA 3FK7A 1JKQC 4A3MJ 1K83J 3BG9A 1U9OA 1BW6A 3D1NI 3BR1A 5EDNA 5F27A 2EQRA 3MVPA 1U78A 3BG5A 4XIDA 3S16J 4MXMA 3HIMA 3NXCA 1BL0A 3HM5A 4HKUA 1MBHA 1BJZA 5EZGA 3P9TA 2VPRA 4NELA 1B72A 2L0KA 3NAUA 3HB9A 5FHPA 1UG2A 1TWCJ 1JUSA 2L7ZA 4JKZA 2CQXA 2KDZA 4FTHA 5D1RA 1ZTRA 5FLVA 3CMYA 2EZKA 2VKEA 4I76A 4XICA 3CJDA 3RQIA 1JGGA 2XGEA 5IP7J 4CGRA 2M9HA 4L62A 2Q24A 2DA6A 1MSEC 2JA8J 5J1RA 3TP0A 3QKXA 1LE8A 5FKKA 1ETWA 4JX6A 3HTJA 2Y2ZA 2DA4A 4DYCA 1GV2A 5GPCA 2YVHA 1FIAA 1O4XA 1H89C 2VKVA 1ZR4A 2O7TA 4UUSB 1DU0A 2YS9A 2JA5J 3HOVJ 5C4YA 1PUFB 5FJ8J 2R5YB 4D5CA 2O9LA 4GCTA 1FIPA 3JRDA 3BG3A 1IV6A 4GCKA 4A3BJ 2QIBA 4FCYA 3VW2A 2YVEA 2EBIA 3AQTA 3PO3J 2QF7A 4J19A 3KKCA 1XG1A 1MBFA 3SFIA 2XGDA 2ME6A 4BBRJ 2XB0X 3GTJJ 1ENHA 2QOPA 1JUPA 1HCRA 4A3LJ 2VI6A 2XSDC 4Y7NJ 3FK6A 1R9TJ 4LOCA 3I4NJ 2DMUA 2OERA 1IDZA 3S15J 2Y9ZA 2CUEA 3GTMJ 5M5YJ 1LFBA 1OJLA 2OPTA 2H1KA 3B81A 2DA2A 1B8IB 5FLMJ 1Y1WJ 3CCYA 2G7SA 2ECBA 1IRZA 1LFUP 2UXIA 2RASA 3B6AA 4G12A 2K9NA 1W0TA 5EF6A 4A3EJ 5EGOA 4GFBA 2ZOYA 2P81A 2Y0SN 2CRGA 1ETOA 3O8GA 4AYBN 4B3AA 3M4OJ 1FTTA 3FISA 3JRBA 1ZGWA 3QBMA 5JLWA 1NK3P 5HAWA 1ETKA 2G0EA 2Y31A 3C2BA 5M3FJ 2GFNA 1GV5A 1TWGJ 2W53A 2MGQA 3E7LA 1AKHA 1EF4A 2JWTA 3LNQA 2YUSA 3GTQJ 5FKOA 4D7NA 5DS9A 1I50J 2H8RA 3A02A 1UMQA 1I6HJ 3LOCA 2G7GA 1TC3C 5IOYA 5CXIA 5BNGA 3ZQHA 2WUIA 4RBOA 2LVSA 3SJMA 3LJLA 5F04A 5IOZA 2XDNA 3SDGA 3GTGJ 1VNDA 2KT0A 4M3EA 3I4MJ 3S14J 2AHQA 4AC6A 3Q3SA 2JN6A 1IC8A 3BQZA 2WV1A 3LSRA 2NX4A 3IH2A 3VW0A 1PUFA 3BCGA 1JT0A 1VFCA 3H0GJ 3RZDJ 5J3LA 2DJNA 2IEKA 1WCMJ 5C4XJ 2FX0A 1RPWA 4NDLA 1IG7A 2NP5A 3HE0A 2CUFA 2MG4A 1HDDC 4ABZA 5AQCA 1JTYA 5IYCJ 3C07A 4JX5A 5J1YA 3V6GA 2FD5A 3H3VK 1ETVA 3RH2A 2B63J 1JKPC 4ME9A 3BR5A 1IDYA 3ZQLA 2ZCNA 3JRCA 1VI0A 2NVTJ 3QPLA 4PXIA 4S0HB 1A5JA 3HTIA 2DMPA 2DMQA 4DW6A 1WH5A 2D6YA 2QCOA 4EEFG 2JA6J 5EZHA 1JKOC 3ON4A 1AU7A 1GDTA 2HKUA 5IYBJ 4NN1A 4A3GJ 2M8GX 2NS7A 2DG7A 3MKLA 3DPJA 1T33A 3G56A 2DMTA 1X2MA 5D18A 2W48A 4ACIA 2IAIA 1IGNA 5F0FA 1YRNA 5JLXA 5HODA 2VUMJ 2M0CA 3PPBA 4JL3A 3O8HA 2QWTA 3LSGA 2PMZN 2EZHA 2TRTA 2NVQJ 2GENA 2CQQA 3HDDA 2I10A 1UI6A 3TP3A 4DYRA 2HQ5A 4IHVA 2REKA 2UXPA 4CYCA 5HSZA 1T56A 1WI3A 2CJJA 3RD3A 3HTHA 3PM1A 2DA1A 2OF7A 4FE7A 4V2GA 3K7AJ 2DTZA 4JX4A 1TWFJ 5J1UA 3ZQFA 4AF5A 4IHXA 2L9RA 2JJ7A 1JKRC 5EG0B 2ELKA 3WHBA 4C3JJ 5E3OA 3HTAA 2E1OA 5E3LA 3EUPA 3F1BA 1MH4A 1FJLA 1MSFC 5DAJA 4MLOA 3NPIA 2ZB9A 5CXGA 5EEAA 3DEWA 2XPWA 3S1NJ 3ZQGA 1JUMA 2FJ1A 2HYTA 2GBYA 3IV5A 4MK6A 1TWAJ 4KWAA 2GM4A 5F0HA 2LD5A 1XS9A 3ZOBA 4M3GA 1Y1VJ 4GFLA 1ETYA 3PO2J 5F08A 3ZQIA 2TCTA 2R5ZA 5FKMA 1G2HA 2IU5A 2XRLA 3WHCA 3TEDA 2QTQA 2RHAA 2UXHA 3HEFA 3VIBA 2M2EA 3QPSA 2QKOA 4QIWN 3OOUA 1P7IA 3HBLA 1RKWA 3BTCA 4W1UA 3HOYJ 3BJBA 3OIOA 4X6AJ 4L5EA 4A3DJ 3A01B 3BRUA 1QVUA 2ID6A 4RDUA 3FRQA 1MBGA 2CU7A 3JR9A 3HOWJ 3MNLA 2JK3A 3HOXJ 2E2JJ 4ICHA 2EZLA 3BTJA 2WAQN 3TW6A 5FKLA 3VUQA 2D5VA 4M3BA 1WPKA 1MBJA 3V78A 3VP5A 2F07A 1POGA 2NS8A 5FMPA 3CQZJ 2DA7A 2HXIA 2WB1N 4IEJA 3GBGA 5GPAA 2GUHA 5IPAA 2EZIA 1JTXA 3G1OA 4YZEA 1H8AC 2HOAA 4GCLA 1B72B 1QPIA 1UHSA 1OCTC 2UXOA 1RETA 1OFCX 2DN0A 1IUFA 4JYKA 3G1LA 4AC0A 1MBEA 1ITYA 3B6CA 3VOKA 1ZK8A 2NOGA 2G3BA 3GZIA 4DYQA 3NI7A 1X58A 2YU9J 5F1JA 3ANGA 3E7QA 1H88C 1U9NA 2E2HJ 5H9TA 4UUSA 3Q0VA 2EH3A 3BTLA 2R5YA 1LE8B 5K7FA 4A3CJ 2LKXA 2V57A 5EFYA 2NVXJ 2ZCXA 2DG8A 4A3JJ 3UKGA 3S1RJ 4GFKA 1MBKA 5EYRA 5K58A 1OCPA 4DZPA 5C4JJ 1F43A 3IUVA 2R0QC 3S1QJ 1HDPA 2XB5A 2ZOZA 1WGXA 2GLOA 2PBXA 4MIMA 2DA3A 3JRFA 3KZ9A 2R7ZJ 2E19A 5E3MA 3PASA 3BT9A 1GVDA 4FE4A 1GT0C 1B8IA 2UXUA 1UI5A 4X1EA 4XRMA 4QTRA 3BR6A 1ETQA 3JREA 1Z77A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ME0 A;  4XK4 A;  4XRS A;  1BW5 A;  1WH7 A;  2XPV A;  3F0C A;  1CQT A;  3VVY A;  4FIS A;  3GTL J;  4BY1 J;  4M3D A;  5D19 A;  3NRG A;  2HI3 A;  4QSH A;  3JRA A;  1ORK A;  2O7O A;  5F0C A;  5E3N A;  5GP9 A;  3FIW A;  5EGO B;  2O8K A;  2IBD A;  3BR3 A;  3LHQ A;  1SAN A;  1QRY A;  1HOM A;  1JT6 A;  4UDS A;  2ECC A;  1SFO J;  4BBS J;  4D5F A;  1APL C;  2K9S A;  2NVY J;  4C2M J;  1VF9 A;  1AKH B;  1I3Q J;  4HNV A;  5M5X J;  2LP0 A;  3HOU J;  3OSG A;  2HOT A;  3ON2 A;  1HF0 A;  5M5W J;  4A69 C;  4A93 J;  2E2I J;  5DTD A;  1ETX A;  3BHQ A;  3OSF A;  2AO9 A;  5HBU A;  3VVX A;  1F36 A;  3A03 A;  3KKD A;  2COB A;  3FKI J;  1Z0X A;  3O60 A;  3CRJ A;  4W97 A;  2LK2 A;  4MFE A;  4A3K J;  2R92 J;  3JRI A;  2R93 J;  1K61 A;  3ZQC A;  4B1R A;  3GTP J;  3AQS A;  1U8B A;  5M3M J;  1D5Y A;  2LLK A;  3CDL A;  3K2A A;  3W6V A;  5FGL A;  2XGC A;  3VOX A;  4JP0 A;  4BXX J;  4V2F A;  4A3F J;  3KNW A;  2DMN A;  1ZQ3 P;  3EGQ A;  5IP6 A;  1HLV A;  1RR7 A;  2X48 A;  1E3O C;  2NP3 A;  5FKN A;  3G1M A;  2FQ4 A;  3L1P A;  5K7H A;  3IH4 A;  4MFD A;  3JRG A;  2ID3 A;  4MO7 A;  3BQY A;  3S17 J;  1TWH J;  1MNM C;  3COL A;  3NNR A;  3TW7 A;  5C44 J;  1MH3 A;  1FTZ A;  4C3H J;  3CWR A;  1DU6 A;  3JSJ A;  1BA5 A;  2L7M P;  2X6O A;  1NTC A;  3NAR A;  2HOS A;  5CW8 A;  4M3F A;  3GTK J;  1XC5 A;  1JJ8 C;  4IHY A;  1Q1V A;  5K7Z A;  2RAE A;  3JRH A;  3VW1 A;  2XPU A;  2HDD A;  3S5R A;  1YRN B;  1NK2 P;  4M6V A;  3M3Y J;  2FBQ A;  3G7R A;  3Q0W A;  2DA5 A;  3S2D J;  5EG0 A;  1W0U A;  4B4C A;  3IH3 A;  5IP9 J;  1A6I A;  4Y52 J;  3GEU A;  4CYC B;  1AHD P;  2G7L A;  1RKT A;  3HGG A;  2OI8 A;  2WGB A;  3S2H J;  2Y30 A;  3HKZ N;  4BKX A;  4AUX A;  1FEX A;  3LSJ A;  1SGM A;  2MSY A;  3MN2 A;  4JNN A;  2LFB A;  2PZ9 A;  4BY7 J;  2JA7 J;  4A3I J;  1GUU A;  3ANP A;  1P7J A;  4D7M A;  1X2N A;  1ZR2 A;  9ANT A;  1RES A;  2LY9 A;  3RZO J;  3LWJ A;  2JMW A;  3BTI A;  4IHW A;  2L7F P;  5C3E J;  3GTO J;  5IYD J;  3S1M J;  2HXO A;  4C3I J;  2ZCM A;  3HGY A;  2X9D A;  2MW8 A;  2M34 A;  3VPR A;  3RKQ A;  3QQA A;  3HOZ J;  1S7E A;  1ZKG A;  4XRS G;  2HYJ A;  2LR8 A;  4DZJ A;  4I6Z A;  3BR2 A;  3VVZ A;  3BNI A;  2K40 A;  2Y9Y A;  3T6N A;  3Q0U A;  3DCF A;  2R5Z B;  2K9Q A;  3LSP A;  3A01 A;  3BR0 A;  2N8G A;  1JJ6 C;  2LTP A;  4UUT A;  1IJW C;  1QVT A;  3FK7 A;  1JKQ C;  4A3M J;  1K83 J;  3BG9 A;  1U9O A;  1BW6 A;  3D1N I;  3BR1 A;  5EDN A;  5F27 A;  2EQR A;  3MVP A;  1U78 A;  3BG5 A;  4XID A;  3S16 J;  4MXM A;  3HIM A;  3NXC A;  1BL0 A;  3HM5 A;  4HKU A;  1MBH A;  1BJZ A;  5EZG A;  3P9T A;  2VPR A;  4NEL A;  1B72 A;  2L0K A;  3NAU A;  3HB9 A;  5FHP A;  1UG2 A;  1TWC J;  1JUS A;  2L7Z A;  4JKZ A;  2CQX A;  2KDZ A;  4FTH A;  5D1R A;  1ZTR A;  5FLV A;  3CMY A;  2EZK A;  2VKE A;  4I76 A;  4XIC A;  3CJD A;  3RQI A;  1JGG A;  2XGE A;  5IP7 J;  4CGR A;  2M9H A;  4L62 A;  2Q24 A;  2DA6 A;  1MSE C;  2JA8 J;  5J1R A;  3TP0 A;  3QKX A;  1LE8 A;  5FKK A;  1ETW A;  4JX6 A;  3HTJ A;  2Y2Z A;  2DA4 A;  4DYC A;  1GV2 A;  5GPC A;  2YVH A;  1FIA A;  1O4X A;  1H89 C;  2VKV A;  1ZR4 A;  2O7T A;  4UUS B;  1DU0 A;  2YS9 A;  2JA5 J;  3HOV J;  5C4Y A;  1PUF B;  5FJ8 J;  2R5Y B;  4D5C A;  2O9L A;  4GCT A;  1FIP A;  3JRD A;  3BG3 A;  1IV6 A;  4GCK A;  4A3B J;  2QIB A;  4FCY A;  3VW2 A;  2YVE A;  2EBI A;  3AQT A;  3PO3 J;  2QF7 A;  4J19 A;  3KKC A;  1XG1 A;  1MBF A;  3SFI A;  2XGD A;  2ME6 A;  4BBR J;  2XB0 X;  3GTJ J;  1ENH A;  2QOP A;  1JUP A;  1HCR A;  4A3L J;  2VI6 A;  2XSD C;  4Y7N J;  3FK6 A;  1R9T J;  4LOC A;  3I4N J;  2DMU A;  2OER A;  1IDZ A;  3S15 J;  2Y9Z A;  2CUE A;  3GTM J;  5M5Y J;  1LFB A;  1OJL A;  2OPT A;  2H1K A;  3B81 A;  2DA2 A;  1B8I B;  5FLM J;  1Y1W J;  3CCY A;  2G7S A;  2ECB A;  1IRZ A;  1LFU P;  2UXI A;  2RAS A;  3B6A A;  4G12 A;  2K9N A;  1W0T A;  5EF6 A;  4A3E J;  5EGO A;  4GFB A;  2ZOY A;  2P81 A;  2Y0S N;  2CRG A;  1ETO A;  3O8G A;  4AYB N;  4B3A A;  3M4O J;  1FTT A;  3FIS A;  3JRB A;  1ZGW A;  3QBM A;  5JLW A;  1NK3 P;  5HAW A;  1ETK A;  2G0E A;  2Y31 A;  3C2B A;  5M3F J;  2GFN A;  1GV5 A;  1TWG J;  2W53 A;  2MGQ A;  3E7L A;  1AKH A;  1EF4 A;  2JWT A;  3LNQ A;  2YUS A;  3GTQ J;  5FKO A;  4D7N A;  5DS9 A;  1I50 J;  2H8R A;  3A02 A;  1UMQ A;  1I6H J;  3LOC A;  2G7G A;  1TC3 C;  5IOY A;  5CXI A;  5BNG A;  3ZQH A;  2WUI A;  4RBO A;  2LVS A;  3SJM A;  3LJL A;  5F04 A;  5IOZ A;  2XDN A;  3SDG A;  3GTG J;  1VND A;  2KT0 A;  4M3E A;  3I4M J;  3S14 J;  2AHQ A;  4AC6 A;  3Q3S A;  2JN6 A;  1IC8 A;  3BQZ A;  2WV1 A;  3LSR A;  2NX4 A;  3IH2 A;  3VW0 A;  1PUF A;  3BCG A;  1JT0 A;  1VFC A;  3H0G J;  3RZD J;  5J3L A;  2DJN A;  2IEK A;  1WCM J;  5C4X J;  2FX0 A;  1RPW A;  4NDL A;  1IG7 A;  2NP5 A;  3HE0 A;  2CUF A;  2MG4 A;  1HDD C;  4ABZ A;  5AQC A;  1JTY A;  5IYC J;  3C07 A;  4JX5 A;  5J1Y A;  3V6G A;  2FD5 A;  3H3V K;  1ETV A;  3RH2 A;  2B63 J;  1JKP C;  4ME9 A;  3BR5 A;  1IDY A;  3ZQL A;  2ZCN A;  3JRC A;  1VI0 A;  2NVT J;  3QPL A;  4PXI A;  4S0H B;  1A5J A;  3HTI A;  2DMP A;  2DMQ A;  4DW6 A;  1WH5 A;  2D6Y A;  2QCO A;  4EEF G;  2JA6 J;  5EZH A;  1JKO C;  3ON4 A;  1AU7 A;  1GDT A;  2HKU A;  5IYB J;  4NN1 A;  4A3G J;  2M8G X;  2NS7 A;  2DG7 A;  3MKL A;  3DPJ A;  1T33 A;  3G56 A;  2DMT A;  1X2M A;  5D18 A;  2W48 A;  4ACI A;  2IAI A;  1IGN A;  5F0F A;  1YRN A;  5JLX A;  5HOD A;  2VUM J;  2M0C A;  3PPB A;  4JL3 A;  3O8H A;  2QWT A;  3LSG A;  2PMZ N;  2EZH A;  2TRT A;  2NVQ J;  2GEN A;  2CQQ A;  3HDD A;  2I10 A;  1UI6 A;  3TP3 A;  4DYR A;  2HQ5 A;  4IHV A;  2REK A;  2UXP A;  4CYC A;  5HSZ A;  1T56 A;  1WI3 A;  2CJJ A;  3RD3 A;  3HTH A;  3PM1 A;  2DA1 A;  2OF7 A;  4FE7 A;  4V2G A;  3K7A J;  2DTZ A;  4JX4 A;  1TWF J;  5J1U A;  3ZQF A;  4AF5 A;  4IHX A;  2L9R A;  2JJ7 A;  1JKR C;  5EG0 B;  2ELK A;  3WHB A;  4C3J J;  5E3O A;  3HTA A;  2E1O A;  5E3L A;  3EUP A;  3F1B A;  1MH4 A;  1FJL A;  1MSF C;  5DAJ A;  4MLO A;  3NPI A;  2ZB9 A;  5CXG A;  5EEA A;  3DEW A;  2XPW A;  3S1N J;  3ZQG A;  1JUM A;  2FJ1 A;  2HYT A;  2GBY A;  3IV5 A;  4MK6 A;  1TWA J;  4KWA A;  2GM4 A;  5F0H A;  2LD5 A;  1XS9 A;  3ZOB A;  4M3G A;  1Y1V J;  4GFL A;  1ETY A;  3PO2 J;  5F08 A;  3ZQI A;  2TCT A;  2R5Z A;  5FKM A;  1G2H A;  2IU5 A;  2XRL A;  3WHC A;  3TED A;  2QTQ A;  2RHA A;  2UXH A;  3HEF A;  3VIB A;  2M2E A;  3QPS A;  2QKO A;  4QIW N;  3OOU A;  1P7I A;  3HBL A;  1RKW A;  3BTC A;  4W1U A;  3HOY J;  3BJB A;  3OIO A;  4X6A J;  4L5E A;  4A3D J;  3A01 B;  3BRU A;  1QVU A;  2ID6 A;  4RDU A;  3FRQ A;  1MBG A;  2CU7 A;  3JR9 A;  3HOW J;  3MNL A;  2JK3 A;  3HOX J;  2E2J J;  4ICH A;  2EZL A;  3BTJ A;  2WAQ N;  3TW6 A;  5FKL A;  3VUQ A;  2D5V A;  4M3B A;  1WPK A;  1MBJ A;  3V78 A;  3VP5 A;  2F07 A;  1POG A;  2NS8 A;  5FMP A;  3CQZ J;  2DA7 A;  2HXI A;  2WB1 N;  4IEJ A;  3GBG A;  5GPA A;  2GUH A;  5IPA A;  2EZI A;  1JTX A;  3G1O A;  4YZE A;  1H8A C;  2HOA A;  4GCL A;  1B72 B;  1QPI A;  1UHS A;  1OCT C;  2UXO A;  1RET A;  1OFC X;  2DN0 A;  1IUF A;  4JYK A;  3G1L A;  4AC0 A;  1MBE A;  1ITY A;  3B6C A;  3VOK A;  1ZK8 A;  2NOG A;  2G3B A;  3GZI A;  4DYQ A;  3NI7 A;  1X58 A;  2YU9 J;  5F1J A;  3ANG A;  3E7Q A;  1H88 C;  1U9N A;  2E2H J;  5H9T A;  4UUS A;  3Q0V A;  2EH3 A;  3BTL A;  2R5Y A;  1LE8 B;  5K7F A;  4A3C J;  2LKX A;  2V57 A;  5EFY A;  2NVX J;  2ZCX A;  2DG8 A;  4A3J J;  3UKG A;  3S1R J;  4GFK A;  1MBK A;  5EYR A;  5K58 A;  1OCP A;  4DZP A;  5C4J J;  1F43 A;  3IUV A;  2R0Q C;  3S1Q J;  1HDP A;  2XB5 A;  2ZOZ A;  1WGX A;  2GLO A;  2PBX A;  4MIM A;  2DA3 A;  3JRF A;  3KZ9 A;  2R7Z J;  2E19 A;  5E3M A;  3PAS A;  3BT9 A;  1GVD A;  4FE4 A;  1GT0 C;  1B8I A;  2UXU A;  1UI5 A;  4X1E A;  4XRM A;  4QTR A;  3BR6 A;  1ETQ A;  3JRE A;  1Z77 A; 
#chains in the Genus database with same CATH topology
 2A3S A;  1G3W A;  2QSF X;  4XK4 A;  4K2E A;  2KIQ A;  2ZME B;  1V55 H;  3PNT A;  1WH7 A;  2E1M C;  1HKS A;  3CUQ A;  3F0C A;  4QLC U;  4BY1 J;  4XBF A;  4PDK A;  2HI3 A;  3FBI B;  2YU3 A;  4KIC A;  2VXD A;  4U9N A;  4ZDL A;  2H6C A;  5EGO B;  2A2F X;  1K78 A;  3K2Z A;  5TGT A;  1J75 A;  1JT6 A;  1L0O C;  2ECC A;  3LSM A;  2K02 A;  2ZSH B;  2DCE A;  1APL C;  1SMY F;  3QU3 A;  1DP3 A;  2XKP A;  1X1C A;  1E2X A;  3FMR A;  5CYV A;  3WGH A;  4YIR X;  4MNU A;  2CW7 A;  2QSH X;  2CUZ A;  5M5X J;  1BM9 A;  3J81 Z;  2FJI 1;  2D1V A;  2HOT A;  2QUF A;  3K0L A;  1HF0 A;  2IGK A;  5M5W J;  2BHZ A;  5H6R A;  4HSR A;  1WKM A;  3ZMZ A;  5FB2 A;  4A93 J;  4KIG A;  3SYT A;  4ITV A;  2KRC A;  4YG2 F;  2E2I J;  5DTD A;  1AOY A;  5FLX Z;  3F3X A;  2X85 A;  1SEU A;  1LVA A;  3A03 A;  1M1E B;  3DEE A;  1PP7 U;  3KKD A;  2COB A;  3V7S A;  3KPH A;  2PN6 A;  3BG6 A;  1Z0X A;  2JZY A;  3KCC A;  1I6X A;  4W97 A;  3KYD B;  3TGN A;  1J59 A;  4A3K J;  2R92 J;  1HKT A;  4A6D A;  1TNS A;  3JRI A;  3ZQC A;  1U8B A;  1E3H A;  3K2A A;  1D5Y A;  4ASN A;  4U0Y A;  1X3U A;  1V4R A;  2P7C B;  1T8I A;  1G3T A;  4V2F A;  3KNW A;  3LFU A;  4BJ6 C;  5IP6 A;  3U2R A;  2IP2 A;  2HOE A;  2IS2 A;  3L2R A;  3G1M A;  3QAH A;  4LLL A;  2KJC A;  4HX7 A;  3CDH A;  2VT3 A;  3JRG A;  5K5Q A;  4I7H A;  3BQY A;  3S17 J;  2X4H A;  3ZQ7 A;  2D2W A;  1R58 A;  2BVL A;  4PSX A;  5KVR A;  1DU6 A;  4NQW B;  3U1K A;  3NAR A;  1NTC A;  2YX7 A;  2HOS A;  2ZNZ A;  1XC5 A;  1JJ8 C;  1VQK I;  3F8F A;  5HLG A;  2DW4 A;  5K7Z A;  4J00 A;  2FBI A;  2NAZ A;  2XPU A;  3VYS B;  1YRN B;  3RYP A;  4E7I A;  2PG4 A;  2GA2 A;  1PP8 F;  5KCM A;  1YW7 A;  1MJA A;  2W84 A;  1OCZ H;  2DA5 A;  4RA2 A;  1DUX C;  4X0G A;  4OMY A;  4V19 K;  4M9S A;  4RB1 A;  2HWV A;  1XDU A;  3G73 A;  3A2K A;  1A6I A;  5FRO A;  3C18 A;  1PUE E;  1NH3 A;  1JHF A;  3HGG A;  1YJW I;  2G7L A;  3GEU A;  3S2H J;  2K9M A;  3HKZ N;  2KDO A;  2K4J A;  1SGM A;  1G3S A;  3FMQ A;  1CF7 B;  1W5S A;  2MYS A;  3MN2 A;  2LFB A;  3CP8 A;  5E1W A;  4XRF A;  5E8G A;  1V5G A;  4BXU A;  4A3I J;  2PZ9 A;  2BE5 F;  5F6F A;  1YS6 A;  2V1U A;  4M9X A;  3IL2 A;  4P1W A;  1X2N A;  2LSO A;  2JMW A;  3HSR A;  4KIB A;  3OYB A;  5ICG A;  2NRA C;  4UHT A;  5C3E J;  4AVP A;  4HRI A;  3BZ6 A;  3GTO J;  5J6X A;  2A5W A;  2X9D A;  1ZH5 A;  2MW8 A;  4A0Y A;  3HOZ J;  5LGN A;  3MEX A;  2K40 A;  2KRF A;  4BJT A;  2E34 A;  3MWM A;  1KZH A;  2ZY9 A;  2KKO A;  3EUH C;  4XLP F;  3Q0U A;  4ZYA A;  1YIT I;  2R7W A;  2N8G A;  4OAY A;  3OY9 A;  4E4H A;  4UUT A;  3ELK A;  5LLQ A;  3FK7 A;  3RPU D;  1S3J A;  2KZV A;  2ZBK A;  5CJ9 A;  3LSI A;  2VBW A;  2EQR A;  3BG5 A;  1RIO H;  4QPO A;  2M7A A;  1Z3X A;  1R36 A;  1A36 A;  1MBH A;  2VJI A;  5EZG A;  2VPR A;  3BLY A;  2V79 A;  4QWQ A;  4XOR A;  3KYL A;  1E17 A;  1LFP A;  3H35 A;  3NAU A;  2CQK A;  2A68 F;  5H20 A;  1JUS A;  2L7Z A;  2KDZ A;  5D1R A;  2E7W A;  2VBY A;  4I76 A;  1BIB A;  2DLL A;  4IQJ A;  2V6C A;  5DCF A;  2R7T A;  2BBY A;  4LMY A;  2Q24 A;  2DA6 A;  1S72 I;  5J1R A;  4GYG A;  2BHY A;  2KRH A;  3T0Y A;  3CJR B;  2KIS A;  5FKK A;  1ETW A;  2QWW A;  3HTJ A;  1CF7 A;  1KYW A;  2EIJ H;  2DA4 A;  4A5M A;  2HQN A;  5TIS C;  1STZ A;  3U9G A;  4OAZ A;  5GPC A;  2PI0 A;  2VKV A;  1I27 A;  3DLA A;  2HZD A;  2CO5 A;  4R1H A;  2Z5U A;  1DU0 A;  3CJN A;  5FJ8 J;  2CQ7 A;  1FMV A;  1K79 A;  2PJP A;  3JRD A;  1ZN2 A;  1IV6 A;  4IJA A;  3E5U A;  1IF1 A;  1PVE A;  3BJO A;  2QIB A;  4FCY A;  1BC7 C;  3ZMD A;  3VW2 A;  2ICW G;  2EBI A;  1Z9C A;  4FQG A;  4EMS A;  4E7J A;  1RZ4 A;  2MLG A;  4IRH A;  3F6O A;  3SFI A;  1BIA A;  3WG7 H;  2ME6 A;  3GTJ J;  2IGO A;  5DV5 A;  4CO8 A;  4A3L J;  2VI6 A;  2XSD C;  2PX9 A;  4Y7N J;  4CA0 A;  1WHU A;  3KZZ A;  5EJC A;  4I98 B;  4M73 A;  2OER A;  3BWG A;  4DQ2 A;  2IT0 A;  1GVJ A;  4EGY A;  1WWX A;  3DTI A;  3PJR A;  4B43 A;  2PMZ A;  4EM1 A;  2MLK A;  2W7N A;  3CCY A;  3K4J A;  1OQY A;  2R3S A;  4NHJ A;  5D5V B;  2UXI A;  3W3C A;  4G12 A;  2M7B A;  4O3M A;  4RGR A;  3CC4 I;  2CRG A;  1ETO A;  3O8G A;  1XGN A;  4E7Z A;  3FIS A;  1ZGW A;  1UCR A;  5JLW A;  1A6Q A;  5DD8 A;  2RNG A;  3C2B A;  2GFN A;  2UXN A;  1QA6 A;  2YVX A;  1AKH A;  3DTE A;  2Y69 H;  1B9M A;  4IRV A;  1R5H A;  4U87 A;  1HST A;  5DS9 A;  4D7N A;  2NS0 A;  2H8R A;  1HBX G;  3A02 A;  3ROU A;  1X1D A;  1BI2 A;  1TC3 C;  1WJE A;  4F92 B;  4LIV A;  5D8L B;  2EV0 A;  2LVS A;  2WY7 Q;  2BY3 A;  4HX8 A;  5F04 A;  1IN4 A;  3JTG A;  1RNL A;  2OZ6 A;  3R0J A;  2VLA A;  2OAZ A;  2COM A;  1IC8 A;  3LSR A;  2NX4 A;  3I71 A;  2QGU A;  4P5O A;  3K4M A;  3H3U A;  3SQN A;  1GXP A;  4LLN A;  1JT0 A;  4BHP A;  1KQ8 A;  3L2Q A;  2K86 A;  3K1P A;  5BMZ A;  1WCM J;  2XAH A;  1RPW A;  3VYR B;  5DCM B;  1ZAO A;  4ESB A;  3MCZ A;  3BRO A;  3GYH X;  5L3E A;  1F5T A;  3HHH A;  1BR4 A;  3HRU A;  2ADU A;  2MH2 A;  3H3V K;  4ENM A;  1DGR M;  1IDY A;  2DPU A;  4PXI A;  1MIJ A;  2D6Y A;  4RS8 A;  3V8J A;  3WU0 A;  2QCO A;  5EZH A;  1K6O A;  4KJZ A;  3RI4 A;  5IYB J;  1FOW A;  2XIG A;  1D8J A;  2QQ8 A;  3MAJ A;  2ZNY A;  2EFW A;  1TT0 A;  3OR2 C;  5AIQ A;  2LRD A;  1CGP A;  2W48 A;  2RRE A;  5LEJ A;  2F5F A;  3IKT A;  2XC7 A;  5HOD A;  1FOY A;  2X1E A;  3LSG A;  3KZY A;  1DDN A;  3IHU A;  2WBM A;  3H92 A;  2HFH A;  1XMA A;  5JR3 A;  5L3C A;  2OTJ I;  5IT9 K;  2HQ5 A;  2LY1 A;  4IVN A;  5LGT A;  4ZH4 F;  1F4K A;  5ICF A;  4L9N A;  1Y0N A;  2CJJ A;  1UZC A;  4BU2 A;  2OF7 A;  3OWT A;  4FE7 A;  3K7A J;  1LDD A;  3ZQF A;  1TWF J;  5FD6 A;  5AON A;  4IHX A;  4LG0 A;  2WAD A;  4HF1 A;  2XRN A;  3HTA A;  1MH4 A;  3I3L A;  2F48 A;  5J47 A;  3FHZ A;  3NPI A;  5B66 C;  2AXT C;  1D8K A;  2ZB9 A;  3OYK A;  3OYG A;  5CXG A;  2M30 A;  1K7A A;  5K5R A;  3ECO A;  2CS3 A;  3P9K A;  2EFN A;  4KWA A;  3J80 K;  3DPU A;  4M3G A;  1ZYR F;  5CPR B;  5JHF A;  2GIZ A;  3SZG A;  3PO2 J;  2RDP A;  3CO6 C;  2TCT A;  3CP2 A;  2XRL A;  2Z16 A;  4BEH B;  1W5T A;  2CSO A;  2RNJ A;  2AQE A;  1ZRD A;  1TBX A;  3HEF A;  3I4P A;  1YX3 A;  3DPL C;  2V4J C;  1Z7L A;  3CCR I;  4BE0 A;  3HZJ A;  2H09 A;  3ONQ A;  1P7I A;  2DOF A;  3S3O A;  1EH8 A;  3OYL A;  2QKL B;  2VJ5 A;  4NUB A;  3L2U A;  2QBY B;  2V9P A;  1QVU A;  2ID6 A;  4RDU A;  3HOW J;  2CU7 A;  3JR9 A;  2JK3 A;  2KLO A;  2CV0 A;  1LDK B;  2E2J J;  3OL3 A;  4DNC A;  1YW8 A;  5ERI A;  3I59 B;  5FKL A;  2FOK A;  2LOO A;  5LBQ A;  3PL8 A;  1MBJ A;  2VE8 A;  2XSJ C;  3VP5 A;  4LFU A;  2HXI A;  2WB1 N;  1SFU A;  2GUH A;  5E18 F;  4YFN F;  1Z21 A;  2HOA A;  4HQM A;  2DN0 A;  1SD6 A;  4JYK A;  3V7C A;  3G1L A;  1IN6 A;  1MBE A;  1ITY A;  3B6C A;  3F21 A;  2R7U A;  3LSH A;  3GZI A;  4XMY A;  4MEX F;  2YU9 J;  5F1J A;  3ECH A;  3WTV C;  3BZK A;  4WCG A;  2NVU B;  1H88 C;  1U9N A;  5B1B H;  3BP8 A;  3HRS A;  5H9T A;  4L5J A;  1FBU A;  2EH3 A;  3PUF A;  3VWB A;  3ZPL A;  2R5Y A;  1LE8 B;  1UFM A;  2M8E A;  5CVI A;  2MAB A;  2EFQ A;  2UWM A;  1FSH A;  2GWR A;  1R23 A;  4A3C J;  4JOM A;  2LKX A;  2V57 A;  1QU3 A;  2P7V B;  2NVX J;  2ZCX A;  4F7Z A;  1EH6 A;  2DG8 A;  2K3P A;  3UKG A;  3S1R J;  4GFK A;  5K58 A;  2CUJ A;  2X1C A;  4XSX F;  5LRS A;  4AD9 A;  2NOJ B;  2V9K A;  4M6Y A;  4AIH A;  1V5F A;  4L0Y B;  3M1C A;  1Y8R B;  4O6J A;  1Z6T A;  3SZT A;  2DA3 A;  3JRF A;  2M87 A;  3KZ9 A;  3PAS A;  4CSW A;  3Q9V A;  1UI5 A;  5BQT A;  2QBY A;  2BXY A;  1V5E A;  1GLN A;  2M3A A;  1ETQ A;  1QQI A;  2HQA A;  1Z77 A;  2VOO A;  2ME0 A;  5H2F C;  2Y0S A;  1BW5 A;  3G4S I;  3NWT A;  1WI9 A;  2XPV A;  2L01 A;  1CQT A;  4FIS A;  2JRT A;  3GTL J;  2IW5 A;  3JRA A;  3ESW B;  3CF2 A;  2K3F A;  2QLZ A;  2V7F A;  5F0C A;  2QA4 I;  4LIU A;  4XM3 A;  2FML A;  2K5C A;  3GFM A;  2IBD A;  1XSV A;  3BR3 A;  4S05 A;  2VPL A;  3ABK H;  3HKZ A;  3LHQ A;  3P9I A;  2IGM A;  1SAN A;  1QRY A;  4H4K C;  2L02 A;  1MMN A;  1USS A;  2BY2 A;  2D1H A;  4G8X A;  4FAS D;  3WE3 A;  3L00 A;  4HF0 A;  5L3F A;  2K9S A;  3KP4 A;  4C2M J;  4OWR B;  2M1B A;  2WAE A;  3ERM A;  4II2 A;  2HKO A;  4Q5S F;  3RJP A;  1VZ0 A;  2F2E A;  2FQ3 A;  3BOQ A;  2R7D A;  1NG7 A;  3UR3 C;  3E6C C;  5CVV A;  4PGG A;  3KLO A;  3ON2 A;  1UEL B;  4DBQ A;  1XGM A;  4XKW A;  2W24 A;  5D4S A;  1YHQ I;  5ILS A;  5DEQ A;  2YR2 A;  1R1T A;  2AO9 A;  4GCV A;  5HBU A;  1Z7U A;  1F36 A;  2A05 A;  2FNP A;  2CYY A;  5B1A H;  3O60 A;  1WJD A;  1X3Z B;  1EH7 A;  1HKQ A;  1LNW A;  4HEA 2;  3H5R A;  1FBS A;  4MFE A;  4R79 A;  2E1M B;  4I01 A;  4ENN A;  2R93 J;  1K61 A;  3RSN A;  5M3M J;  4EJU A;  2G7U A;  2BY0 A;  2XGC A;  5FGL A;  3VOX A;  4BE1 A;  3GME A;  2AS5 F;  5F1R A;  2UXX A;  3R4K A;  2OCC H;  3ZR8 X;  1XGO A;  4RB0 A;  2L2O A;  1HLV A;  2NP3 A;  5FKN A;  4IKF A;  2ZXJ A;  3A0H C;  2JUC A;  4GGG A;  1KYZ A;  1C0W A;  4MFD A;  1R22 A;  1O57 A;  1REP C;  2ID3 A;  2K85 A;  3K4K A;  5DUI A;  1D0Z A;  4B09 A;  2XAU A;  3CCS I;  1MNM C;  3TW7 A;  5C44 J;  1MH3 A;  4I0B A;  1X1A A;  2IA2 A;  2MH9 A;  4C3H J;  2RQP A;  3WOD F;  2QQA A;  1BA5 A;  3A0B C;  2DK8 A;  4M3F A;  3GTK J;  1U5T C;  4IRG A;  4AIK A;  1Q1V A;  4WXH A;  3MKW B;  3S5R A;  3VSL A;  3JTH A;  4DJA A;  4M6V A;  1V3F A;  1KON A;  3M3Y J;  3TBI A;  2M4K A;  1VQ4 I;  2FOW A;  1WJ5 A;  4B4C A;  4CCO A;  3S93 A;  3DXJ F;  4CYC B;  1BR2 A;  1RKT A;  5LHH A;  1I3A A;  3WTS C;  3GZ5 A;  1HW5 A;  2FXA A;  3I0T A;  3LSJ A;  3F72 A;  3KP3 A;  3HPH A;  4OIR F;  4BGD A;  2MSY A;  2OA4 A;  2WY8 Q;  2Y75 A;  3LQR A;  2ZC2 A;  4N9I A;  3VEP A;  5LEK A;  3FXM A;  2JA7 J;  1GUU A;  5KAI C;  4LIT A;  3ANP A;  2OC6 A;  4D7M A;  1ZR2 A;  4XSZ F;  2VIX A;  3LWJ A;  2DFI A;  4IHW A;  1TZL A;  3K1M A;  5IYD J;  3LA3 A;  1RRJ A;  2IPQ X;  3VDX A;  1WJA A;  3HGY A;  1ZHF A;  2XVC A;  3RKQ A;  1H0M A;  1X1B A;  1DGW Y;  3DFG A;  1ZKG A;  2GQQ A;  2VKD A;  2HYJ A;  4XRS G;  4DZJ A;  5IT9 Z;  3BNI A;  3K70 C;  1KU7 A;  2Y9Y A;  1KGS A;  3E6D A;  5HLI A;  4PJN A;  1VQ7 I;  4G9Y A;  3DCF A;  4C30 A;  2R5Z B;  3A01 A;  4E7K A;  2IRF G;  1RR8 C;  2LTP A;  3FZV A;  4WIB A;  1IJW C;  1IUY A;  1QVT A;  1SD5 A;  3ZP5 A;  4EAT A;  4A3M J;  1K83 J;  3BG9 A;  1U9O A;  3DV8 A;  1MJB A;  5EDN A;  2M45 A;  2X6X A;  5F27 A;  1U78 A;  4ZYH A;  1FOX A;  1XMX A;  3S16 J;  4MXM A;  3H36 A;  4Y4R A;  2FNA A;  4U0V A;  3L2W A;  1BJZ A;  1G4D A;  1KQ0 A;  4EM2 A;  2Q1Z B;  4XR6 A;  3J80 Z;  2A5Y B;  4NB5 A;  2L0K A;  1LQ1 A;  5FHP A;  4HLY A;  5LFA A;  4JKZ A;  4FTH A;  5FLV A;  5HOO A;  2EZK A;  3GZN B;  4M74 A;  4XIC A;  2KZG A;  2UV1 A;  3KX2 A;  5TRD A;  2X1D A;  2XGX A;  1T38 A;  2XGE A;  1IN7 A;  2JA8 J;  2DFE A;  3QKX A;  2KMU A;  3KYC B;  3LMM A;  4RB2 C;  1FLI A;  1IW7 F;  1IXC A;  4WWC A;  1O7F A;  3I64 A;  2VOD A;  3CUQ C;  2K27 A;  2L9N A;  2R4G A;  1QHG A;  2VXZ A;  1FIA A;  3GFL A;  2XAG A;  3ERE D;  3I56 I;  3Q5F A;  4UUS B;  2B9S A;  1O4X A;  1B1B A;  1PUF B;  3OS1 A;  4BYY A;  1XPX A;  4D5C A;  1R1V A;  2P6T A;  3BG3 A;  4YEL A;  1I1G A;  2HTJ A;  1W36 C;  4A3B J;  2R7X A;  4PJM A;  4GCK A;  1Z05 A;  1ULY A;  2YVE A;  3PO3 J;  1S5L C;  4J19 A;  1O3T A;  2QSG X;  1XG1 A;  1MBF A;  5DUK A;  2O6G E;  1ENH A;  3HUG A;  1HCR A;  3RTR A;  3DBH B;  3FK6 A;  1R9T J;  2FU4 A;  4LOC A;  2LYC A;  3I4N J;  4CCM A;  5GAE J;  2WC2 A;  4CUG A;  1Y8Q B;  2ZCW A;  1IDZ A;  2PMU A;  3GTM J;  2ZME A;  2OPT A;  2B7E A;  1QZE A;  2H1K A;  4UB8 C;  3ML6 A;  5FLM J;  1XCB A;  3KP2 A;  2L54 A;  2ECB A;  2CW8 A;  1Y39 A;  4G6Q A;  4AIJ A;  5EF6 A;  5HNH A;  1S7A A;  5EGO A;  4OIP F;  3QP5 A;  2Y0S N;  4AYB N;  5BOX A;  3VSK A;  3M4O J;  2HVQ A;  4IX7 A;  4IOC F;  3DKW A;  4XN3 A;  1T6S A;  4P55 A;  5HNF A;  5M3F J;  3CCU I;  1TWG J;  1LEB A;  1XDS A;  1FYK A;  1P4W A;  2MGQ A;  3BZC A;  3E7L A;  2GOX B;  3GO5 A;  1EF4 A;  4BS9 A;  4KNY A;  2A61 A;  4ENK A;  2A07 F;  1W7P D;  2KIF A;  2G7G A;  5IOY A;  5CXI A;  3PSI A;  3MKY B;  3SJM A;  1WJB A;  3K69 A;  3MD2 A;  3KIO A;  3S14 J;  1WSU A;  3MZY A;  3BPX A;  1P4A A;  1UHW A;  2XAF A;  5KK1 A;  1HC8 A;  1ONV A;  3E5X A;  3IH2 A;  2BY1 A;  3J7Z I;  1PUF A;  1LPQ A;  3BCG A;  2EIK H;  3H0G J;  1GHC A;  3IAS 2;  3V7R A;  5CVU A;  3PQK A;  4BJ5 C;  3HE0 A;  1O3Q A;  1X4P A;  1H9T A;  1HDD C;  4ABZ A;  4A0Z A;  1JTY A;  2KL4 A;  4JX5 A;  4M72 A;  5J1Y A;  3RH2 A;  3G71 I;  2ZO4 A;  1JKP C;  1YLF A;  2JQ7 A;  3ZQL A;  4FT8 A;  2ZCN A;  4G7O F;  2H94 A;  3MFK A;  3CJT B;  2DAO A;  3CCE I;  1VQ8 I;  3JW4 A;  2NVT J;  3QPL A;  3QYB A;  1YQA A;  4N4N B;  3GLL A;  1A5J A;  3HTI A;  3W2W A;  4DW6 A;  2WB1 A;  2Z1D A;  2O61 A;  1SD7 A;  2NNY A;  4EEF G;  2OTL I;  2HKU A;  1BI1 A;  2X6W A;  4CHU A;  4A3G J;  5E79 C;  4NQW A;  3C2G A;  3WGI A;  2L5Q A;  2DG7 A;  3MKL A;  3DPJ A;  1T33 A;  2KIM A;  2DMT A;  3G56 A;  2HYF A;  4BUP A;  4ACI A;  5HDK A;  3I55 I;  5F0F A;  1LDJ A;  3BY6 A;  1YRN A;  4UV8 A;  3TDZ C;  2QWT A;  1TQI A;  3IP4 B;  4IO9 F;  1SVM A;  2L9V A;  2EJR A;  1TQM A;  1QHH D;  2Z3Y A;  1UI6 A;  2HDW A;  3AKZ A;  2IXS A;  2REK A;  2V9V A;  1FOK A;  4XLH A;  2PMH A;  2OU2 A;  2RN7 A;  1WI3 A;  4HAM A;  3IWZ A;  3WTW C;  3RD3 A;  3PM1 A;  2RVC A;  3OYN A;  4AF5 A;  4JX4 A;  5J1U A;  4PZJ A;  2L9R A;  4HDV A;  5CVR A;  5EG0 B;  4DIQ A;  5E3O A;  1PYV A;  2E1O A;  2DYS H;  1XN7 A;  2LNB A;  3EUP A;  4RM2 A;  4Z6Y A;  3DF8 A;  3F1B A;  2LG4 A;  4IPA A;  2F4O B;  1IZ1 A;  4EQQ A;  3OYH A;  3MZ8 A;  3K4N A;  3DEW A;  5HS8 A;  2EB7 A;  2XPW A;  1FWZ A;  4E7L A;  3S1N J;  3ZQG A;  4GO1 A;  1JUM A;  4N9H A;  2BW3 B;  3SXY A;  1OYW A;  2HYT A;  3IV5 A;  5F0H A;  5GTH C;  1XS9 A;  4B47 A;  4OD4 A;  3LA7 A;  4UY8 I;  1O7L A;  3CDI A;  2XAQ A;  2QVO A;  3WHC A;  2RHA A;  2M2E A;  3GZ6 A;  3E1S A;  3CJQ B;  2ZFU A;  3VFZ A;  2VJJ A;  3HBL A;  2B0L A;  4XOT A;  2E36 A;  4L5E A;  2BGC A;  4A3D J;  4CDG A;  3MNL A;  5JHU A;  2NXN B;  2FMY A;  4ICH A;  1S8N A;  2EZL A;  2WAQ N;  1VQO I;  3TW6 A;  2VON A;  4H0E A;  1ZRC A;  4M3B A;  1B9N A;  1TW2 A;  4HBL A;  4IOA F;  2IS1 A;  1WPK A;  5JVG F;  3V78 A;  2QEX I;  1XMK A;  5FMP A;  2LF8 A;  4HV6 A;  1E3P A;  5GPA A;  3FXQ A;  5IPA A;  3G1O A;  3PFY A;  1B72 B;  1MDM B;  3QYE A;  2P8T A;  1IUF A;  4AC0 A;  5ICC A;  2BOL A;  4A5N A;  3WTU C;  3VOK A;  2G3B A;  2F5E A;  3QOE A;  4F3Q A;  3NI7 A;  4D1Q A;  3ANG A;  1UJ8 A;  3HYI A;  1J2X A;  2R7S A;  1OKR A;  3CMM A;  3DWL E;  3KEY A;  1QGP A;  3L9F A;  2OUM A;  2L3D A;  1D0X A;  2HPM A;  4NNJ A;  3F8C A;  2WWY A;  4BAC A;  3N97 A;  1SMT A;  1IXS B;  3TMO A;  1BN5 A;  3L7W A;  5L3B A;  1BR1 A;  3WTT C;  3H9Q A;  5E1X A;  1EV7 A;  1OCP A;  4DZP A;  1R7J A;  2DI3 A;  4CZZ A;  5C4J J;  2XB5 A;  3RQ4 A;  5KNL A;  1WGX A;  2GLO A;  2IJL A;  2Z2S B;  2E5N A;  3K8P C;  4NC6 A;  4U7B A;  2DOA A;  3RCO A;  1ERD A;  4LK1 F;  2QZ8 A;  2ISZ A;  2R7Z J;  1D1A A;  3F8B A;  1IRG A;  1T98 A;  2LF7 A;  4PGH A;  4F93 B;  5J8F A;  2NYX A;  2P0W A;  2LH9 A;  2H27 A;  3PIP F;  3M9A A;  4XRM A;  2NNN A;  2XAJ A;  3CZ6 A;  3VOD A;  3JRE A;  1ZG1 A;  1HW2 A;  2E1C A;  4G6D A;  3QP6 A;  1OR7 A;  3SWH A;  4GDF A;  1Z3Y A;  3VVY A;  1W7P B;  5HLT A;  4ETS A;  1J7K A;  4M3D A;  2CFO A;  5D5U B;  4B3X A;  4QSH A;  1ORK A;  2EPF A;  3SHF A;  4ZDP A;  5GP9 A;  3N4M A;  1RC9 A;  2FA5 A;  4Y17 A;  3D5R C;  1ZRF A;  2Z33 A;  3KEO A;  3K10 A;  4F91 B;  4ESJ A;  2V1X A;  3CC7 I;  4KA4 A;  4B8X A;  4UDS A;  1SFO J;  2GXB A;  4Y15 A;  1ODD A;  4BBS J;  4D5F A;  4WK8 F;  3ULQ B;  1I3Q J;  3LL7 A;  2V1N A;  3PFI A;  1FT9 A;  2OQR A;  3O6B B;  1ZAR A;  1QZY A;  3QOP A;  3RIR A;  2LP0 A;  2YX4 A;  4XNF A;  3OSG A;  4YEJ A;  3HC7 A;  4F52 A;  1UB9 A;  4MQV A;  1XCV A;  3FXL A;  3H9J A;  3AG3 H;  2K9L A;  2JPB A;  5IT3 A;  3BHQ A;  4CIC A;  1X1P A;  5DCM A;  1W36 D;  4HYE A;  3FKI J;  2P5L C;  1KQ9 A;  1XX5 A;  3BPV A;  5GAD J;  2DT6 A;  4M71 A;  1U8R A;  4YII A;  2O5R A;  3GTP J;  2Q2E B;  2IS4 A;  2LLK A;  3CDL A;  1G3Y A;  3W6V A;  3S3M A;  2Q8K A;  1X19 A;  4JP0 A;  2DYR H;  4RGU A;  2K7L A;  2DMN A;  2ZKZ A;  1R5G A;  2HR3 A;  4F55 A;  3P5J A;  3MMY B;  1RR7 A;  3WGG A;  2X48 A;  1E3O C;  3FHN A;  2D45 A;  4KMU X;  3J7A Y;  5K7H A;  3IH4 A;  2ZJR F;  1UST A;  4HA8 A;  4DOZ A;  1DP7 P;  3HSE A;  3COL A;  3M8E A;  3NNR A;  3R60 A;  5F64 A;  4OIN F;  1FTZ A;  3ZMU A;  2OQG A;  4O5V A;  1F1Z A;  2L7M P;  2X6O A;  2KPM A;  2CGP A;  4IHY A;  1XB4 A;  3BCA A;  3JRH A;  3VW1 A;  1LKX A;  2PJR B;  2HDD A;  4XKC A;  3ZXS A;  4G6T B;  3G7R A;  4BQQ A;  2ZJ2 A;  3Q0W A;  2FEZ A;  5ILU A;  1FNN A;  1YYV A;  4MTD A;  1J0R A;  4CH7 A;  4NC7 A;  1JHH A;  3IH3 A;  4Y33 A;  3TOB A;  5IP9 J;  2OI8 A;  3P7N A;  4CCN A;  2Y30 A;  1R4N B;  4AUX A;  4A2U A;  4BKX A;  4U88 A;  4KIS A;  4JNN A;  4ESF A;  3RPU A;  4HOB A;  4FX4 A;  2R7V A;  1YI2 I;  3BCB A;  1I1S A;  3BJA A;  3BTI A;  1BI3 A;  2B1E A;  2L7F P;  1S7O A;  3S1M J;  4C3I J;  4BEH A;  2XKO A;  2VQH A;  3RKX A;  3VPR A;  4CYD A;  4I6Z A;  2LR8 A;  3BR2 A;  4HX4 A;  4OMZ A;  2PEX A;  2Y0M A;  4E7H A;  4RAG A;  2DT7 B;  2Q2E A;  2VBX A;  4Y3O A;  2CWE A;  2QQB A;  2HDC A;  2K9Q A;  2MC4 A;  3FDY A;  4D0P A;  4E7S A;  3BR0 A;  1U5T B;  2A6H F;  2MC3 A;  4A0X A;  1R5I D;  4XLA A;  4LB5 A;  2VKH A;  3OYM A;  4P9U A;  1JKQ C;  4AYB A;  3I59 A;  3T5X A;  3D1N I;  3D0S A;  3BR1 A;  4XID A;  2YSR A;  4HW0 A;  3SEZ A;  3F22 A;  5J40 A;  4UV9 A;  3E5Q A;  2DQR A;  2OV7 A;  3S2W A;  1VQN I;  5K1Y A;  4PFP A;  4KFC A;  4I2O A;  3P9T A;  1DQU A;  1WJC A;  5K5O A;  2DFH A;  2ZXI A;  5LGU A;  2L4M A;  3HB9 A;  4I99 C;  1UG2 A;  2M4G A;  1TWC J;  1PJR A;  5TJJ A;  4YRV A;  5E1Z B;  3CMY A;  1HA8 A;  3HIF A;  2VKE A;  4L9V A;  5LD2 C;  3REO A;  1YX5 A;  5FD5 A;  4OOI A;  4CGR A;  4L62 A;  3V8K A;  2M9H A;  4PJ0 C;  3EQL F;  3IUO A;  2OBP A;  1MSE C;  2HNH A;  4MTE A;  3ZGK A;  4PUS A;  3OV8 A;  5HDG A;  3E97 A;  1LE8 A;  1A31 A;  4JX6 A;  3HRM A;  4I02 A;  2XRO A;  2Y2Z A;  2LBF B;  1GV2 A;  5ILV A;  3AL0 C;  4Q4Z F;  5D6F A;  4C2U A;  1T0F A;  2YS9 A;  3HOV J;  5C4Y A;  3QOD A;  2FUG 2;  2O9L A;  2CMP A;  4GCT A;  1D1C A;  3WTY C;  4ENJ A;  1FC3 A;  4YIF A;  1BC8 C;  1Z67 A;  3DKY A;  3OIP A;  1ZGA A;  5LRR A;  3TO7 A;  1P4X A;  5CVJ A;  1VQ6 I;  3KKC A;  5FFZ A;  5BPD A;  4BBR J;  1ZRE A;  3VYU B;  2QEN A;  1JUP A;  2QOP A;  3OL4 A;  2OZU A;  3IAM 2;  2DMU A;  5KHD A;  3DU6 A;  5J4Y A;  5D5W B;  1T08 B;  3S15 J;  2Y9Z A;  2DBB A;  5M5Y J;  3B81 A;  3D5L A;  2DA2 A;  2QKM B;  4HNT A;  1Y1W J;  1B8I B;  1OCR H;  1XSX A;  2G7S A;  5B5E C;  2R7O A;  5BPI A;  5E8I A;  1IRZ A;  1LFU P;  2RAS A;  1IV8 A;  2W25 A;  5H6Q A;  2VQL A;  3AG4 H;  2P81 A;  3V4G A;  4ZDO A;  2A6E F;  2E1N A;  4B3A A;  5HS7 A;  1TLH B;  1W5C C;  4Q48 A;  3QBM A;  3CUQ B;  2CFX A;  1NK3 P;  1KU9 A;  3W2A A;  3F8M A;  1P92 A;  3GCM A;  3QU6 A;  1T39 A;  2DDB A;  3LQQ A;  2BYV E;  2GAU A;  1NHA A;  4LJZ F;  2JWT A;  3LNQ A;  1K78 B;  2VOP A;  3EYI A;  3CME I;  2JT1 A;  2EWN A;  2YUS A;  5HLH A;  2L4A A;  5FKO A;  4BHB A;  1I50 J;  1QPM A;  2R7Q A;  1L3L A;  3A4C A;  3GTQ J;  2EA2 A;  1UMQ A;  2DK5 A;  1I6H J;  3FWE A;  3ZQH A;  3ZN0 A;  3PIO F;  3LJL A;  1VQM I;  2G9W A;  4IF4 A;  2XDN A;  2VE9 A;  1X4O A;  1YW9 A;  1VND A;  2KT0 A;  3HHG A;  1JGS A;  4M3E A;  3H1C A;  3ZMV A;  3I4M J;  4AC6 A;  3Q3S A;  4KIF A;  1N78 A;  3BQZ A;  3L09 A;  2WV1 A;  3O2P E;  3LAJ A;  1QZZ A;  3E6M A;  4DVY P;  3L2V A;  2LC2 A;  4ANJ A;  2Z9O A;  1VFC A;  1U0J A;  4XLE A;  5JVT A;  3KZI C;  5D5X B;  2DJN A;  5C4X J;  3ZMT A;  2FX0 A;  4BL0 B;  5J8C A;  3K1N A;  1B6A A;  4IXA A;  2GZW A;  2JPC A;  4NDL A;  2W82 A;  1IG7 A;  3S3N A;  2NP5 A;  4P96 A;  2F5D A;  2ZJQ F;  2LMD A;  4ZC3 A;  5DM7 F;  5AQC A;  4GYI A;  5IYC J;  1OIS A;  3M7G A;  1Y56 A;  1QO0 D;  2WAQ A;  2FD5 A;  3OYJ A;  1FP1 D;  1ON1 A;  5HS9 A;  3GUD A;  4NBQ A;  3JRC A;  2JSC A;  1VI0 A;  4OIO F;  2CH0 A;  1MNE A;  4MGR A;  3AG1 H;  2DMP A;  2DMQ A;  3T1B A;  3ZQQ A;  1P9Q C;  1T2K A;  3GF2 A;  3IC7 A;  4D9J A;  4EJV A;  1AU7 A;  2M8G X;  1FSE A;  2NS7 A;  1IO2 A;  3GEZ A;  1X2M A;  2JRM A;  4KMF A;  2STW A;  1IGN A;  1I5Z A;  2G7H A;  3WG9 A;  1MKM A;  3H5A A;  3ABU A;  2TRT A;  2A69 F;  2NVQ J;  2GEN A;  2CQQ A;  1MW7 A;  4WX9 A;  2ZJP F;  2I10 A;  3HDD A;  2M0M A;  4DYR A;  1O3R A;  1MD0 A;  4BXF A;  4CYC A;  2KFD A;  3JSP A;  2DDA A;  2DA1 A;  4V2G A;  2Q0O A;  2DTZ A;  4HV5 A;  3OYE A;  2XDV A;  2JJ7 A;  4L9T A;  1J09 A;  1YIJ I;  1JKR C;  1FPQ A;  1R1U A;  2ELK A;  2RC4 A;  3WHB A;  4C3J J;  3AAF A;  4ON0 A;  3QWL A;  5E3L A;  1ACI A;  3H3Z A;  4LD5 A;  3EET A;  1FJL A;  1MZB A;  1SFX A;  1FBQ A;  4GXO A;  4MHG A;  5EEA A;  5FFX A;  5GTI C;  1XD7 A;  2FJ1 A;  3V8L A;  1YG2 A;  2GBY A;  4PSW A;  3P9C A;  2UUZ A;  4G94 A;  4MK6 A;  1TWA J;  2GM4 A;  2LD5 A;  1H9G A;  3PSF A;  1QNT A;  3LST A;  1IRX A;  3ZOB A;  1Y1V J;  4CCK A;  3TO6 A;  1AWC A;  2J5O A;  3ZQI A;  2R5Z A;  5FKM A;  1G2H A;  2W4S A;  4IZZ A;  3SEQ A;  2V1D A;  3M07 A;  3TED A;  4ZTF A;  3GLX A;  4A12 A;  2RKH A;  1VQ9 I;  3OOU A;  3BTC A;  4W1U A;  3C1D A;  4X6A J;  1J5Y A;  3K6G A;  4XLC A;  2GXG A;  2GXA A;  1FY7 A;  3FRQ A;  1MBG A;  4L0Z B;  2OJE D;  2VB6 A;  4RLQ A;  4HLX A;  3TOA A;  3BTJ A;  1OYI A;  3M8J A;  4UUV A;  4RLF A;  3C7J A;  1ZGJ A;  3SZP A;  3IKV A;  3ZRG A;  1WQ2 A;  1TW3 A;  2ISY A;  2V26 A;  3EDP A;  2F07 A;  1POG A;  4BDY A;  2IA1 A;  4KYW A;  2NS8 A;  2ELJ A;  3OIQ A;  3CQZ J;  2DA7 A;  1YOV B;  3HRT A;  4IEJ A;  2FBH A;  4LLG F;  3GBG A;  4M6X A;  1IAW A;  2EZI A;  3TDU C;  1JTX A;  1FP2 A;  1U6G A;  4EJT A;  1HW1 A;  2EA4 A;  1QPI A;  2F4M B;  5GAG J;  3D5S C;  2FF4 A;  3GW2 A;  4EGZ A;  2UXO A;  1RET A;  1ZLJ A;  4BQO A;  1OFC X;  4L9J A;  2P5V A;  3MQ0 A;  4BDZ A;  1Q1H A;  1R00 A;  2NOG A;  3SDB A;  1RUN A;  3QPH A;  5A2Q K;  4LB6 B;  4I0A A;  1X58 A;  3W6K B;  2ZME C;  4N4O B;  1I39 A;  3VTI A;  1MMA A;  3EUH A;  2FSW A;  3TO9 A;  2VL8 A;  4UUS A;  3Q0V A;  2ZXH A;  3DBL B;  2L7K A;  2I8D A;  2ESH A;  3BTL A;  3R6S A;  3EYY A;  4RM3 A;  3LAP A;  3K4C A;  2YPR A;  4CZC A;  2BEO A;  3I53 A;  2X51 A;  4AVZ A;  5EFY A;  3ASN H;  4NC8 A;  2HS5 A;  1A04 A;  4A3J J;  3O3K A;  3OYC A;  1HQC A;  4OU0 A;  2A6T A;  1F43 A;  1BBY A;  1UHM A;  3IUV A;  2R0Q C;  1RI7 A;  3CC2 I;  2ZOZ A;  3Q9S A;  2DJI A;  2Z99 A;  2PBX A;  3DBR B;  3E0J B;  4MIM A;  3J7Y J;  3CTA A;  3OS2 A;  3CMA I;  2J5P A;  4TV7 A;  1GVD A;  1GT0 C;  3A1Y A;  4AU7 A;  3HOS A;  5JFR A;  1RUO A;  1W1W E;  2UXU A;  1IN8 A;  2MFZ A;  2RV8 A;  2WAF A;  2LKP A;  3L2C A;  4U0W A;  4QTR A;  3HIM A;  1K4S A;  4XRS A;  2CG4 A;  4RAZ A;  5J4V A;  4CCL A;  5LHI A;  4JBA A;  4BNC A;  1YFH A;  3NS4 A;  3U1D A;  1EKE A;  4AID A;  5DYM A;  1UAA A;  4C9Y A;  3NRG A;  2CV1 A;  1YJN I;  5D19 A;  2O7O A;  3BDD A;  4KN7 X;  4DBR A;  3S32 A;  4GRI A;  3WTX C;  3FXU A;  2O03 A;  5E3N A;  3B73 A;  3FIW A;  4B44 A;  2O8K A;  5D8K B;  1Y0U A;  3VYT B;  5JI6 A;  1XGS A;  1HOM A;  1LUJ B;  2MD0 A;  4PCQ A;  2E60 A;  4DGW B;  4L18 B;  1LEA A;  2DTR A;  2NVY J;  3DU5 A;  1VF9 A;  5E20 A;  3DTK A;  1AKH B;  3RKW A;  1S29 A;  4HNV A;  4ZZD A;  3ABM H;  5D6E A;  2CV2 A;  1LJ9 A;  2HKX A;  3LWF A;  1R71 A;  2F6C A;  3HOU J;  2VAS A;  4EVI A;  4A69 C;  3CLQ A;  3DLL F;  3COA C;  1ETX A;  3ZMS A;  3QPT A;  3OSF A;  1MMD A;  3CD6 I;  2BXZ A;  3VVX A;  1LB2 A;  4C2M A;  6PAX A;  3AG2 H;  2KP6 A;  4QPQ A;  5FRM A;  4FHT A;  3HJE A;  4WXC A;  3F8N A;  2LY2 A;  3CRJ A;  5L3D A;  1G6N A;  1MND A;  2F5C A;  3ABT A;  1OCO H;  4HG2 A;  2LK2 A;  1YJ9 I;  2STT A;  3M8F A;  1DPU A;  2BZT A;  2R7F A;  2E5Z A;  3M1E A;  3HXL A;  3AQS A;  4B1R A;  4FX0 A;  2JTV A;  3WU2 C;  1E0E A;  3CCJ I;  2F4I A;  1Z1D A;  3DQV C;  3HOT A;  2PLY A;  2HU9 A;  4XLF A;  4BXX J;  3F6V A;  4A3F J;  2KJB A;  4RGX A;  1ZQ3 P;  4UVC A;  3EGQ A;  4ZJZ A;  3CO7 C;  1TP4 A;  3JSO A;  3GFJ A;  2FQ4 A;  3L1P A;  3NRV A;  2XUB A;  2HVR A;  3W6J B;  1U2W A;  3OYI A;  1OLT A;  4MO7 A;  1TWH J;  2XF7 A;  4BHC A;  2WV0 A;  3HSF A;  4HNU A;  3CWR A;  3ASO H;  3CCM I;  1Y6I A;  3FM5 A;  3JSJ A;  4IQ4 A;  5CW8 A;  3R61 A;  4BH9 A;  3EUK L;  2RAE A;  4LGW A;  4BAY A;  2GA1 A;  1NK2 P;  4R8H A;  1O3S A;  2FBQ A;  4PK4 A;  1SC7 A;  3S2D J;  3JCU C;  1D1B A;  5EG0 A;  1W0U A;  2R7R A;  1B59 A;  3KP5 A;  3JAM K;  2ESN A;  1S9H A;  3MZH A;  3AFH A;  4Y52 J;  1AHD P;  2WGB A;  3E3V A;  1FEX A;  4XKV A;  3K4L A;  4HPQ A;  4PFO A;  4LG0 B;  4BY7 J;  1Z6R A;  2BW3 A;  2O3F A;  4CCJ A;  1VTN C;  1N77 A;  1P7J A;  1WZ2 A;  3FXO A;  1FX7 A;  1RES A;  3CLO A;  2LY9 A;  3HPG A;  3K4B A;  4RAF A;  4E70 A;  1IN5 A;  2FBK A;  4ZYD A;  1K6Y A;  3RZO J;  3K70 D;  2O8X A;  4N0B A;  2OCE A;  2HXO A;  2ZCM A;  3HG9 A;  3LSK A;  2M34 A;  3QQA A;  4B48 A;  1S7E A;  2BVM A;  3VVZ A;  1IXR C;  1T95 A;  3CCQ I;  2I5U A;  3W2V A;  3T6N A;  3S8P A;  4CXF A;  1P6R A;  3LSP A;  1JJ6 C;  3ISP A;  3FMS A;  1WFX A;  3OR1 C;  2BV6 A;  2B3W A;  4ZTJ A;  4UB6 C;  1BW6 A;  5FO5 A;  1J9I A;  4AWX B;  3VOE A;  2DO7 A;  3MVP A;  1TQP A;  3RDI A;  4MQ9 F;  1R4M B;  3NXC A;  3LA2 A;  2WA0 A;  1BL0 A;  4OD5 A;  3HM5 A;  2VC1 A;  2VBZ A;  4HKU A;  1SD4 A;  2E35 A;  3KP6 A;  4NEL A;  1B72 A;  1MDM A;  1YIO A;  2RQQ A;  2HZT A;  2PBI A;  1TT5 B;  2EFP A;  2CQX A;  3RKY A;  1ZTR A;  4LK0 F;  2ACJ A;  3BJ6 A;  2PFB A;  2O0Y A;  3BC8 A;  3TL4 X;  3CJD A;  2HYG D;  4BQN A;  3FX3 A;  3RQI A;  5IP7 J;  1JGG A;  4CGZ A;  3I5U A;  3TP0 A;  3T8R A;  3GWZ A;  1A35 A;  4YFK F;  5DDG A;  2XV4 S;  2MA3 A;  1OR7 C;  4I09 A;  1XTA A;  2QM3 A;  2DQL A;  3KP7 A;  5IY5 H;  3FF5 A;  4DYC A;  2YVH A;  5GAH J;  1H89 C;  2JVG A;  1R6R A;  2O7T A;  1ZR4 A;  4BE2 A;  4IL6 C;  1UG0 A;  3ZCO A;  2JA5 J;  4XQF A;  1MGT A;  2R5Y B;  2VC0 A;  4XOP A;  1FIP A;  3IRQ A;  3CCV I;  4UNO A;  1ON2 A;  3CES A;  4EJO A;  2XF6 A;  1VQ5 I;  3PUB A;  3GFI A;  4HQE A;  3BG7 A;  3AQT A;  2QF7 A;  2ZXW H;  3FXJ A;  3HTS B;  2JA2 A;  1N75 A;  2MD5 A;  1KU2 A;  1YS7 A;  1TTY A;  3DP7 A;  2XGD A;  2XB0 X;  5A2Q Z;  3C3W A;  3OYD A;  3KE2 A;  3EPZ A;  3OYF A;  4G7H F;  5CQG A;  2ELH A;  2K4B A;  3KET A;  2FE3 A;  4WXD A;  3C2H A;  3TKY A;  3FKJ A;  3GX4 X;  1TL8 A;  2CUE A;  1LFB A;  4Y13 A;  1OJL A;  3J81 K;  1BOA A;  3NEU A;  1W7P A;  1KU3 A;  2HGC A;  3FM3 A;  4U9L A;  1YE9 A;  1D3Y A;  3OOP A;  1ZG3 A;  5FLX K;  3B6A A;  1W0T A;  2K9N A;  2V6E A;  1SFK A;  4A3E J;  2DXI A;  4GFB A;  2ZOY A;  2FRH A;  5BS6 A;  4UVB A;  3F23 A;  1FTT A;  4Z2Y A;  3JRB A;  1FMW A;  2VQC A;  5HAW A;  1ETK A;  2G0E A;  2Y31 A;  4JK1 X;  3OMY A;  3AL0 B;  1GV5 A;  3RYR A;  1ZLK A;  2M5W A;  2W53 A;  4HF2 A;  1G59 A;  5L3G A;  3QRF F;  4YFX F;  4HZF A;  5HVQ C;  5CKT A;  4XON A;  3LOC A;  5D4R A;  5FRN A;  3IRR A;  5BNG A;  2WUI A;  2XAS A;  3EUA A;  4RBO A;  1JE8 A;  3WE2 A;  3WU1 B;  3CUO A;  5IOZ A;  3SDG A;  3I54 A;  3OYA A;  1FZP B;  3GTG J;  4ZYE A;  2Y48 A;  4PJJ A;  4UVA A;  3V42 A;  1OMI A;  2AHQ A;  1BI0 A;  2JN6 A;  5KAF C;  5HDN A;  3I9V 2;  3QYF A;  4EV0 A;  3VW0 A;  1Z91 A;  2C6Y A;  2DOE A;  2ZFW A;  3PQJ A;  3CCL I;  4LG3 A;  3RZD J;  5J3L A;  2IEK A;  1ZEL A;  4XKB A;  3SFZ A;  3WTZ A;  1LVK A;  3TQN A;  1GXQ A;  3X2Q H;  2CUF A;  2DT5 A;  2LRE A;  2MG4 A;  4AM3 A;  2HTS A;  4UXN A;  4EJW A;  1P2F A;  3C07 A;  1FYM A;  3V6G A;  2IA0 A;  1ETV A;  3U21 A;  2B63 J;  4ME9 A;  2H1L A;  3BR5 A;  4U7D A;  4HDU A;  1JXS A;  1MJ9 A;  3H0D A;  3G2B A;  4KT6 A;  2GIV A;  4S0H B;  1D5V A;  4XL9 A;  4RB3 C;  1WH5 A;  1VQP I;  1HSJ A;  9ANT A;  3FXR A;  2JA6 J;  1JKO C;  3ON4 A;  1GDT A;  4NN1 A;  4PJL A;  4A6E A;  3B02 A;  3RPQ A;  5D18 A;  5ICE A;  2IAI A;  4EM0 B;  4XLN F;  2EIL H;  2PJR A;  3KEQ A;  1PDN C;  5JLX A;  4C2T A;  2VUM J;  2L9S A;  2DU9 A;  1W4M A;  2M0C A;  3O8H A;  3PPB A;  4JL3 A;  3T8T A;  1FYL A;  2KQR A;  4IRI A;  2PMZ N;  2EZH A;  2JVH A;  4E6K G;  2X0L A;  3GXO A;  3TP3 A;  4Q47 A;  2IGN A;  4IHV A;  2W57 A;  2UZK A;  2DFF A;  2UXP A;  2AQF A;  5HSZ A;  1T56 A;  4FET A;  3HTH A;  1N25 A;  1MMS A;  2EV5 A;  4RGS A;  1SVL A;  3DPT A;  2XHK A;  1G8X A;  1SVO A;  4ZZL A;  1YO5 C;  4BQA A;  1B4A A;  2LKS A;  2MBF A;  3MKZ A;  1SAU A;  2H8W A;  1MSF C;  4OIQ F;  5DAJ A;  2DOD A;  2QYO A;  4MLO A;  1NG6 A;  4S04 A;  3K9T A;  1WRJ A;  5DM6 F;  2IS6 A;  1MMG A;  1WVR A;  5AIP A;  2IVM A;  2VN2 A;  4IHT A;  5E17 F;  3PNV A;  2W85 A;  1AA7 A;  1BOB A;  3E6B A;  3NQO A;  5B3S H;  4II3 A;  2PQ8 A;  2JUG A;  4GFL A;  1ETY A;  5F08 A;  1TNT A;  5EEH A;  2IU5 A;  2HEO A;  3H5N A;  1U5T A;  3LFK A;  5CLS A;  2QTQ A;  3HTU A;  2UXH A;  3VIB A;  1OCC H;  3KLN A;  3QPS A;  2QKO A;  2OD5 A;  4RMN A;  4QIW N;  3JAM Z;  3VB2 A;  1HXD A;  1F9N A;  1EJ9 A;  1RKW A;  4ZYG A;  2KHM A;  3HOY J;  3OIO A;  1WJF A;  3J7A O;  3BJB A;  3F9K A;  2W00 A;  1K4T A;  3A01 B;  3BRU A;  2RGV A;  3HL2 A;  1T0F C;  3HOX J;  2EFO A;  3OS0 A;  2F5V A;  2GOM A;  1ZG5 A;  1S6L A;  1U3E M;  2EK5 A;  3VUQ A;  2D5V A;  4KDP A;  1R49 A;  2PFV A;  4WF2 A;  2E71 A;  2AXL A;  3IWF A;  5CQE A;  1SFE A;  4KT5 C;  5LHG A;  2EV6 A;  2WTE A;  4YZE A;  1H8A C;  2XF5 A;  4MEY F;  4GCL A;  1UHS A;  4JQF A;  2DPD A;  1OCT C;  1X3W B;  2KIU A;  2P5K A;  4L5I A;  3ABL H;  2ZSI B;  3DEU A;  2W1O A;  3DKX A;  1ZK8 A;  3PNY A;  4DYQ A;  2P6S A;  3G3Z A;  1XSD A;  1VQL I;  2VQG A;  4IHS A;  3FBN B;  2LBF A;  3E7Q A;  4RAY A;  3ZN1 A;  2E2H J;  2CW0 F;  2EIM H;  4KN4 X;  2HPI A;  2VT2 A;  2ETH A;  4HST A;  2HQR A;  1OYY A;  1EA3 A;  2CQN A;  1JI8 A;  1V54 H;  5K7F A;  3CF5 F;  1DPR A;  3NWS A;  2QQ9 A;  4XN0 A;  3KFW X;  4M9Z A;  4P9F A;  3R0A A;  5ED4 A;  3H9G A;  2HVS A;  1MBK A;  1OPC A;  5EYR A;  1SAX A;  1IRF A;  3S1Q J;  1HDP A;  2E7X A;  5FGM A;  4G7Z F;  1QBJ A;  1KA8 A;  2TDX A;  3UNG C;  1YTY A;  2JSP A;  3N05 A;  2X6Y A;  5DD4 A;  5EEG A;  3I58 A;  4KUM A;  2E19 A;  5E3M A;  3BT9 A;  4FE4 A;  1B8I A;  2LDU A;  1BJA A;  3G6E I;  4J01 A;  3FXK A;  3HUG B;  4X1E A;  2H6B A;  2EIN H;  2P4W A;  1D0Y A;  3BR6 A;  2VJ4 A;  3GVA A;  4KIT B; 
#chains in the Genus database with same CATH homology
 2ME0 A;  4XK4 A;  4XRS A;  1BW5 A;  1WH7 A;  2XPV A;  3F0C A;  1CQT A;  3VVY A;  4FIS A;  3GTL J;  4BY1 J;  4M3D A;  5D19 A;  3NRG A;  2HI3 A;  4QSH A;  3JRA A;  1ORK A;  2O7O A;  5F0C A;  5E3N A;  5GP9 A;  3FIW A;  5EGO B;  2O8K A;  2IBD A;  3BR3 A;  3LHQ A;  1SAN A;  1QRY A;  1HOM A;  1JT6 A;  4UDS A;  2ECC A;  1SFO J;  4BBS J;  4D5F A;  1APL C;  2K9S A;  2NVY J;  4C2M J;  1VF9 A;  1AKH B;  1I3Q J;  4HNV A;  5M5X J;  2LP0 A;  3HOU J;  3OSG A;  2HOT A;  3ON2 A;  1HF0 A;  5M5W J;  4A69 C;  4A93 J;  2E2I J;  5DTD A;  1ETX A;  3BHQ A;  3OSF A;  2AO9 A;  5HBU A;  3VVX A;  1F36 A;  3A03 A;  3KKD A;  2COB A;  3FKI J;  1Z0X A;  3O60 A;  3CRJ A;  4W97 A;  2LK2 A;  4MFE A;  4A3K J;  2R92 J;  3JRI A;  2R93 J;  1K61 A;  3ZQC A;  4B1R A;  3GTP J;  3AQS A;  1U8B A;  5M3M J;  1D5Y A;  2LLK A;  3CDL A;  3K2A A;  3W6V A;  5FGL A;  2XGC A;  3VOX A;  4JP0 A;  4BXX J;  4V2F A;  4A3F J;  3KNW A;  2DMN A;  1ZQ3 P;  3EGQ A;  5IP6 A;  1HLV A;  1RR7 A;  2X48 A;  1E3O C;  2NP3 A;  5FKN A;  3G1M A;  2FQ4 A;  3L1P A;  5K7H A;  3IH4 A;  4MFD A;  3JRG A;  2ID3 A;  4MO7 A;  3BQY A;  3S17 J;  1TWH J;  1MNM C;  3COL A;  3NNR A;  3TW7 A;  5C44 J;  1MH3 A;  1FTZ A;  4C3H J;  3CWR A;  1DU6 A;  3JSJ A;  1BA5 A;  2L7M P;  2X6O A;  1NTC A;  3NAR A;  2HOS A;  5CW8 A;  4M3F A;  3GTK J;  1XC5 A;  1JJ8 C;  4IHY A;  1Q1V A;  5K7Z A;  2RAE A;  3JRH A;  3VW1 A;  2XPU A;  2HDD A;  3S5R A;  1YRN B;  1NK2 P;  4M6V A;  3M3Y J;  2FBQ A;  3G7R A;  3Q0W A;  2DA5 A;  3S2D J;  5EG0 A;  1W0U A;  4B4C A;  3IH3 A;  5IP9 J;  1A6I A;  4Y52 J;  3GEU A;  4CYC B;  1AHD P;  2G7L A;  1RKT A;  3HGG A;  2OI8 A;  2WGB A;  3S2H J;  2Y30 A;  3HKZ N;  4BKX A;  4AUX A;  1FEX A;  3LSJ A;  1SGM A;  2MSY A;  3MN2 A;  4JNN A;  2LFB A;  2PZ9 A;  4BY7 J;  2JA7 J;  4A3I J;  1GUU A;  3ANP A;  1P7J A;  4D7M A;  1X2N A;  1ZR2 A;  9ANT A;  1RES A;  2LY9 A;  3RZO J;  3LWJ A;  2JMW A;  3BTI A;  4IHW A;  2L7F P;  5C3E J;  3GTO J;  5IYD J;  3S1M J;  2HXO A;  4C3I J;  2ZCM A;  3HGY A;  2X9D A;  2MW8 A;  2M34 A;  3VPR A;  3RKQ A;  3QQA A;  3HOZ J;  1S7E A;  1ZKG A;  4XRS G;  2HYJ A;  2LR8 A;  4DZJ A;  4I6Z A;  3BR2 A;  3VVZ A;  3BNI A;  2K40 A;  2Y9Y A;  3T6N A;  3Q0U A;  3DCF A;  2R5Z B;  2K9Q A;  3LSP A;  3A01 A;  3BR0 A;  2N8G A;  1JJ6 C;  2LTP A;  4UUT A;  1IJW C;  1QVT A;  3FK7 A;  1JKQ C;  4A3M J;  1K83 J;  3BG9 A;  1U9O A;  1BW6 A;  3D1N I;  3BR1 A;  5EDN A;  5F27 A;  2EQR A;  3MVP A;  1U78 A;  3BG5 A;  4XID A;  3S16 J;  4MXM A;  3HIM A;  3NXC A;  1BL0 A;  3HM5 A;  4HKU A;  1MBH A;  1BJZ A;  5EZG A;  3P9T A;  2VPR A;  4NEL A;  1B72 A;  2L0K A;  3NAU A;  3HB9 A;  5FHP A;  1UG2 A;  1TWC J;  1JUS A;  2L7Z A;  4JKZ A;  2CQX A;  2KDZ A;  4FTH A;  5D1R A;  1ZTR A;  5FLV A;  3CMY A;  2EZK A;  2VKE A;  4I76 A;  4XIC A;  3CJD A;  3RQI A;  1JGG A;  2XGE A;  5IP7 J;  4CGR A;  2M9H A;  4L62 A;  2Q24 A;  2DA6 A;  1MSE C;  2JA8 J;  5J1R A;  3TP0 A;  3QKX A;  1LE8 A;  5FKK A;  1ETW A;  4JX6 A;  3HTJ A;  2Y2Z A;  2DA4 A;  4DYC A;  1GV2 A;  5GPC A;  2YVH A;  1FIA A;  1O4X A;  1H89 C;  2VKV A;  1ZR4 A;  2O7T A;  4UUS B;  1DU0 A;  2YS9 A;  2JA5 J;  3HOV J;  5C4Y A;  1PUF B;  5FJ8 J;  2R5Y B;  4D5C A;  2O9L A;  4GCT A;  1FIP A;  3JRD A;  3BG3 A;  1IV6 A;  4GCK A;  4A3B J;  2QIB A;  4FCY A;  3VW2 A;  2YVE A;  2EBI A;  3AQT A;  3PO3 J;  2QF7 A;  4J19 A;  3KKC A;  1XG1 A;  1MBF A;  3SFI A;  2XGD A;  2ME6 A;  4BBR J;  2XB0 X;  3GTJ J;  1ENH A;  2QOP A;  1JUP A;  1HCR A;  4A3L J;  2VI6 A;  2XSD C;  4Y7N J;  3FK6 A;  1R9T J;  4LOC A;  3I4N J;  2DMU A;  2OER A;  1IDZ A;  3S15 J;  2Y9Z A;  2CUE A;  3GTM J;  5M5Y J;  1LFB A;  1OJL A;  2OPT A;  2H1K A;  3B81 A;  2DA2 A;  1B8I B;  5FLM J;  1Y1W J;  3CCY A;  2G7S A;  2ECB A;  1IRZ A;  1LFU P;  2UXI A;  2RAS A;  3B6A A;  4G12 A;  2K9N A;  1W0T A;  5EF6 A;  4A3E J;  5EGO A;  4GFB A;  2ZOY A;  2P81 A;  2Y0S N;  2CRG A;  1ETO A;  3O8G A;  4AYB N;  4B3A A;  3M4O J;  1FTT A;  3FIS A;  3JRB A;  1ZGW A;  3QBM A;  5JLW A;  1NK3 P;  5HAW A;  1ETK A;  2G0E A;  2Y31 A;  3C2B A;  5M3F J;  2GFN A;  1GV5 A;  1TWG J;  2W53 A;  2MGQ A;  3E7L A;  1AKH A;  1EF4 A;  2JWT A;  3LNQ A;  2YUS A;  3GTQ J;  5FKO A;  4D7N A;  5DS9 A;  1I50 J;  2H8R A;  3A02 A;  1UMQ A;  1I6H J;  3LOC A;  2G7G A;  1TC3 C;  5IOY A;  5CXI A;  5BNG A;  3ZQH A;  2WUI A;  4RBO A;  2LVS A;  3SJM A;  3LJL A;  5F04 A;  5IOZ A;  2XDN A;  3SDG A;  3GTG J;  1VND A;  2KT0 A;  4M3E A;  3I4M J;  3S14 J;  2AHQ A;  4AC6 A;  3Q3S A;  2JN6 A;  1IC8 A;  3BQZ A;  2WV1 A;  3LSR A;  2NX4 A;  3IH2 A;  3VW0 A;  1PUF A;  3BCG A;  1JT0 A;  1VFC A;  3H0G J;  3RZD J;  5J3L A;  2DJN A;  2IEK A;  1WCM J;  5C4X J;  2FX0 A;  1RPW A;  4NDL A;  1IG7 A;  2NP5 A;  3HE0 A;  2CUF A;  2MG4 A;  1HDD C;  4ABZ A;  5AQC A;  1JTY A;  5IYC J;  3C07 A;  4JX5 A;  5J1Y A;  3V6G A;  2FD5 A;  3H3V K;  1ETV A;  3RH2 A;  2B63 J;  1JKP C;  4ME9 A;  3BR5 A;  1IDY A;  3ZQL A;  2ZCN A;  3JRC A;  1VI0 A;  2NVT J;  3QPL A;  4PXI A;  4S0H B;  1A5J A;  3HTI A;  2DMP A;  2DMQ A;  4DW6 A;  1WH5 A;  2D6Y A;  2QCO A;  4EEF G;  2JA6 J;  5EZH A;  1JKO C;  3ON4 A;  1AU7 A;  1GDT A;  2HKU A;  5IYB J;  4NN1 A;  4A3G J;  2M8G X;  2NS7 A;  2DG7 A;  3MKL A;  3DPJ A;  1T33 A;  3G56 A;  2DMT A;  1X2M A;  5D18 A;  2W48 A;  4ACI A;  2IAI A;  1IGN A;  5F0F A;  1YRN A;  5JLX A;  5HOD A;  2VUM J;  2M0C A;  3PPB A;  4JL3 A;  3O8H A;  2QWT A;  3LSG A;  2PMZ N;  2EZH A;  2TRT A;  2NVQ J;  2GEN A;  2CQQ A;  3HDD A;  2I10 A;  1UI6 A;  3TP3 A;  4DYR A;  2HQ5 A;  4IHV A;  2REK A;  2UXP A;  4CYC A;  5HSZ A;  1T56 A;  1WI3 A;  2CJJ A;  3RD3 A;  3HTH A;  3PM1 A;  2DA1 A;  2OF7 A;  4FE7 A;  4V2G A;  3K7A J;  2DTZ A;  4JX4 A;  1TWF J;  5J1U A;  3ZQF A;  4AF5 A;  4IHX A;  2L9R A;  2JJ7 A;  1JKR C;  5EG0 B;  2ELK A;  3WHB A;  4C3J J;  5E3O A;  3HTA A;  2E1O A;  5E3L A;  3EUP A;  3F1B A;  1MH4 A;  1FJL A;  1MSF C;  5DAJ A;  4MLO A;  3NPI A;  2ZB9 A;  5CXG A;  5EEA A;  3DEW A;  2XPW A;  3S1N J;  3ZQG A;  1JUM A;  2FJ1 A;  2HYT A;  2GBY A;  3IV5 A;  4MK6 A;  1TWA J;  4KWA A;  2GM4 A;  5F0H A;  2LD5 A;  1XS9 A;  3ZOB A;  4M3G A;  1Y1V J;  4GFL A;  1ETY A;  3PO2 J;  5F08 A;  3ZQI A;  2TCT A;  2R5Z A;  5FKM A;  1G2H A;  2IU5 A;  2XRL A;  3WHC A;  3TED A;  2QTQ A;  2RHA A;  2UXH A;  3HEF A;  3VIB A;  2M2E A;  3QPS A;  2QKO A;  4QIW N;  3OOU A;  1P7I A;  3HBL A;  1RKW A;  3BTC A;  4W1U A;  3HOY J;  3BJB A;  3OIO A;  4X6A J;  4L5E A;  4A3D J;  3A01 B;  3BRU A;  1QVU A;  2ID6 A;  4RDU A;  3FRQ A;  1MBG A;  2CU7 A;  3JR9 A;  3HOW J;  3MNL A;  2JK3 A;  3HOX J;  2E2J J;  4ICH A;  2EZL A;  3BTJ A;  2WAQ N;  3TW6 A;  5FKL A;  3VUQ A;  2D5V A;  4M3B A;  1WPK A;  1MBJ A;  3V78 A;  3VP5 A;  2F07 A;  1POG A;  2NS8 A;  5FMP A;  3CQZ J;  2DA7 A;  2HXI A;  2WB1 N;  4IEJ A;  3GBG A;  5GPA A;  2GUH A;  5IPA A;  2EZI A;  1JTX A;  3G1O A;  4YZE A;  1H8A C;  2HOA A;  4GCL A;  1B72 B;  1QPI A;  1UHS A;  1OCT C;  2UXO A;  1RET A;  1OFC X;  2DN0 A;  1IUF A;  4JYK A;  3G1L A;  4AC0 A;  1MBE A;  1ITY A;  3B6C A;  3VOK A;  1ZK8 A;  2NOG A;  2G3B A;  3GZI A;  4DYQ A;  3NI7 A;  1X58 A;  2YU9 J;  5F1J A;  3ANG A;  3E7Q A;  1H88 C;  1U9N A;  2E2H J;  5H9T A;  4UUS A;  3Q0V A;  2EH3 A;  3BTL A;  2R5Y A;  1LE8 B;  5K7F A;  4A3C J;  2LKX A;  2V57 A;  5EFY A;  2NVX J;  2ZCX A;  2DG8 A;  4A3J J;  3UKG A;  3S1R J;  4GFK A;  1MBK A;  5EYR A;  5K58 A;  1OCP A;  4DZP A;  5C4J J;  1F43 A;  3IUV A;  2R0Q C;  3S1Q J;  1HDP A;  2XB5 A;  2ZOZ A;  1WGX A;  2GLO A;  2PBX A;  4MIM A;  2DA3 A;  3JRF A;  3KZ9 A;  2R7Z J;  2E19 A;  5E3M A;  3PAS A;  3BT9 A;  1GVD A;  4FE4 A;  1GT0 C;  1B8I A;  2UXU A;  1UI5 A;  4X1E A;  4XRM A;  4QTR A;  3BR6 A;  1ETQ A;  3JRE A;  1Z77 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...