1Z77A

Crystal structure of transcriptional regulator protein from thermotoga maritima.
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
200
structure length
200
Chain Sequence
MLSKRDAILKAAVEVFGKKGYDRATTDEIAEKAGVAKGLIFHYFKNKEELYYQAYMSVTEKLQKEFENFLMKNRNRDIFDFMERWIEKKLEYSASHPEEADFLITLVSVDEGLRKRILLDLEKSQRVFFDFVREKLKDLDLAEDVTEEIALKFLMWFFSGFEEVYLRTYQGKPELLKRDMNTLVEEVKVMLRILKKGMTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords transcriptional regulator (TetR family)
publication title Crystal structure of a transcriptional regulator TM1030 from Thermotoga maritima solved by an unusual MAD experiment.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transcription
total genus 71
structure length 200
sequence length 200
ec nomenclature
pdb deposition date 2005-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1z77A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 1z77A02
2RASA 2Q24A 4NDLA 2X48A 1I6HJ 3E7QA 3F1BA 3NPIA 1MBFA 3G1LA 4G12A 4S0HB 2K9QA 1ZR2A 4XRSG 3HOZJ 1XG1A 3BCGA 5FHPA 5J3LA 3S1RJ 3HIMA 4MLOA 1LE8A 3HOYJ 2O7TA 1G2HA 3S16J 3HDDA 3SDGA 3JSJA 2GLOA 2XGCA 5DAJA 3Q0VA 1QPIA 1MBHA 3A01B 3O60A 2L0KA 5H9TA 4XRMA 2E2JJ 3BNIA 3FKIJ 1IC8A 1X58A 2XRLA 3V6GA 1TWCJ 3VOKA 2TRTA 2F07A 5EEAA 2XDNA 1Z77A 3IH2A 3CMYA 3B81A 4L5EA 1LFBA 2CRGA 2VI6A 1HOMA 5FKKA 2XB0X 1VF9A 2R5ZA 1OCTC 1UMQA 3DEWA 3KKCA 3VW1A 3Q0UA 1GV2A 3IUVA 3W6VA 5F1JA 2L7ZA 4C3JJ 4W1UA 3HM5A 2ECBA 5IOYA 4IHWA 1FTZA 3G7RA 3NAUA 1MBJA 1NTCA 4M3GA 3WHBA 3JRCA 4AF5A 2WGBA 2EZLA 2EZIA 2NVYJ 3HTJA 4A3GJ 5CXGA 3HKZN 4X1EA 2LP0A 1UI5A 5FJ8J 3JRHA 3GTQJ 1WH5A 4GCTA 2Y0SN 4BKXA 2IBDA 3S17J 1A5JA 2FD5A 3GTPJ 1UI6A 2NVXJ 1P7IA 3C2BA 1U78A 1ETWA 2CQXA 1JKOC 5FLVA 1IJWC 2QF7A 5IP6A 1GT0C 4GFLA 2LY9A 2H1KA 2HXOA 2PBXA 4BXXJ 2R5YB 2ELKA 3LHQA 3S14J 5HSZA 2JN6A 3FK6A 4MK6A 1IGNA 5F04A 1K83J 4M3DA 1B8IB 4MO7A 1HDPA 1POGA 5D1RA 3VUQA 2EZKA 3A03A 2XSDC 4BY7J 2E1OA 2K40A 1ETQA 2M2EA 3MKLA 4AC0A 1YRNB 5K7ZA 1HCRA 3HOVJ 1IDZA 3S5RA 2LFBA 3S1NJ 3C07A 1ETXA 4D7NA 2HOTA 1TWAJ 3BR3A 4IHXA 3PO2J 3RZOJ 3G56A 3VVZA 3O8GA 1ETKA 4V2GA 3LOCA 1I50J 1JJ8C 4D7MA 4NELA 2EBIA 4AYBN 4BBSJ 3CCYA 2OPTA 4DZPA 1W0UA 4A3DJ 2DTZA 5HAWA 1JTXA 1TWHJ 4D5CA 3TP0A 2L7MP 5FKOA 3LSJA 3OOUA 2CUEA 2HKUA 3G1OA 2R93J 3HTHA 2PMZN 1MH4A 2QWTA 4JX5A 4A93J 2XPUA 4A3FJ 4ABZA 3Q3SA 3LSPA 2EH3A 4ICHA 3LNQA 1RETA 4JX6A 1B8IA 3Q0WA 2YUSA 4NN1A 3BR0A 4A69C 1YRNA 1R9TJ 1ZQ3P 1ZR4A 1FTTA 2IEKA 1JT6A 5IP9J 3M3YJ 2VKEA 5K7HA 1IV6A 4A3MJ 3HOXJ 4FCYA 4C3IJ 3SJMA 1NK2P 1VFCA 3BHQA 1P7JA 2JJ7A 1ETOA 1HLVA 3EGQA 3NXCA 5E3LA 4DW6A 4BBRJ 5GP9A 4L62A 4DYQA 2FBQA 4PXIA 1JUSA 4UUSB 1JTYA 5F0HA 3CJDA 5FKNA 4M3BA 1FEXA 3BR1A 4FE4A 1ORKA 4AUXA 3EUPA 5FGLA 1JKPC 1HF0A 1ETYA 2ZOZA 4M3FA 2DMQA 2MSYA 3BTJA 3BJBA 2V57A 2OF7A 4V2FA 4UUTA 3B6AA 2QCOA 5DS9A 2XB5A 5AQCA 4CGRA 3ZQLA 1APLC 3LJLA 1TWFJ 9ANTA 4ME9A 3QPSA 1WGXA 5F0CA 2K9NA 5GPCA 3RQIA 3G1MA 3HE0A 1D5YA 3VOXA 3FK7A 1AHDP 1QVUA 1X2MA 3H0GJ 3P9TA 1MH3A 3S2HJ 3PPBA 3ON4A 4JL3A 1Q1VA 2Y9YA 4A3LJ 5C4JJ 4UUSA 3HGYA 2DA4A 1Y1WJ 1ZKGA 2XGDA 3D1NI 2DMUA 4XK4A 4BY1J 3A01A 3BR5A 5E3MA 2MGQA 2M0CA 2X9DA 5F0FA 4B4CA 1K61A 3BQYA 2DMPA 2XPWA 3JRFA 2NOGA 1TC3C 3QPLA 2DA6A 2UXPA 3GTLJ 3GZIA 3TW6A 5EGOB 1WI3A 3JR9A 4M3EA 4DZJA 2G3BA 2COBA 3HOUJ 2M34A 5EZHA 3M4OJ 5GPAA 2HXIA 5E3NA 2DMNA 1JT0A 2UXOA 2GFNA 3O8HA 2WV1A 4B1RA 4IHYA 3VVXA 2D5VA 2I10A 1ETVA 5M5WJ 2E2IJ 3BTCA 3S2DJ 4QTRA 2HYJA 2AO9A 2HOAA 5EFYA 2DA1A 2JMWA 2W48A 4JYKA 2UXIA 3IH4A 1A6IA 1BJZA 1UG2A 2E2HJ 2GUHA 3VP5A 3PO3J 3GTOJ 3TP3A 5DTDA 3NRGA 5CW8A 1U9OA 2FQ4A 5E3OA 3HOWJ 1Z0XA 5EF6A 4A3KJ 2HI3A 3ZQCA 1UHSA 2ME0A 2YVHA 2G7SA 4ACIA 2DA2A 2JK3A 2O7OA 4IEJA 5BNGA 3KKDA 1JKRC 1MNMC 1F43A 5EGOA 5M3FJ 2VKVA 1RKTA 1ENHA 2R7ZJ 2TCTA 1B72B 1GV5A 2O9LA 1QVTA 3JRAA 2DJNA 3HEFA 4XICA 5EDNA 3BTLA 3CDLA 5J1YA 3JREA 1JJ6C 4GFBA 4A3CJ 1W0TA 5HBUA 2ECCA 1SFOJ 1H88C 2KT0A 1JGGA 2G0EA 2HYTA 2QTQA 2QIBA 3SFIA 2DMTA 2R5YA 1OCPA 1RKWA 4UDSA 2HDDA 3GTGJ 5IPAA 1RESA 2VUMJ 3V78A 2MW8A 3S1QJ 4YZEA 5J1RA 1GVDA 2LD5A 3LSGA 4LOCA 3DPJA 1T56A 2DA5A 2Y31A 3VVYA 2NS7A 3HB9A 3JRDA 1VNDA 2R0QC 1Y1VJ 1H89C 3FIWA 1MBGA 4AC6A 1IUFA 2LLKA 2G7LA 5JLWA 4GFKA 2HOSA 3K7AJ 1QRYA 2HQ5A 3BT9A 1JKQC 1PUFB 5FKMA 3I4MJ 2PZ9A 3ANGA 3JRBA 5CXIA 4FTHA 4JX4A 1ZK8A 3H3VK 1BA5A 4QIWN 1B72A 4GCKA 3BG9A 1IRZA 2ID6A 2YVEA 2JWTA 2WB1N 3MVPA 5IP7J 5IYCJ 4CYCB 3GTKJ 1BW5A 2LVSA 1FIPA 1I3QJ 3BG5A 3FRQA 3RD3A 5M5XJ 1RPWA 1OJLA 2CJJA 4J19A 2XPVA 4JKZA 4A3BJ 1RR7A 1U9NA 2N8GA 2LTPA 5IOZA 2NP3A 3PM1A 4Y52J 2Y9ZA 2ME6A 2DG7A 3KNWA 1CQTA 2ZCXA 5D18A 2O8KA 4D5FA 2B63J 2OERA 3QKXA 3CWRA 2QOPA 1BL0A 3B6CA 5C4YA 1BW6A 1PUFA 3JRGA 5M5YJ 1IG7A 3VIBA 2FX0A 3MN2A 1HDDC 1MBEA 3BR6A 3MNLA 2UXHA 2Y30A 1X2NA 2LKXA 3DCFA 3BG3A 2AHQA 4CYCA 4C3HJ 3CRJA 2YU9J 2DN0A 2ZCNA 4JNNA 4A3IJ 3BQZA 2R92J 1DU6A 2L9RA 4XRSA 1GDTA 2W53A 1LFUP 1AU7A 1FIAA 4MIMA 3I4NJ 2P81A 3HBLA 3WHCA 3QBMA 2ID3A 3VW2A 2ZB9A 2EZHA 2K9SA 3NI7A 2NVQJ 1FJLA 2QKOA 3TEDA 1VI0A 1E3OC 1EF4A 2GBYA 5IYBJ 3IV5A 2OI8A 1TWGJ 3ZQHA 3ZOBA 2DG8A 3RKQA 1U8BA 3PASA 3KZ9A 1JUMA 3T6NA 1AKHB 2IAIA 2RAEA 2H8RA 3GTJJ 3GBGA 5EYRA 1WPKA 4I76A 3NNRA 3NARA 5EG0B 1F36A 2LR8A 2JA5J 3ZQIA 3ON2A 2M8GX 5FKLA 3UKGA 1GUUA 2GENA 5JLXA 4DYCA 1ZTRA 2EQRA 5C44J 3OSFA 2JA6J 2DA7A 3ANPA 2MG4A 2Y2ZA 1MSFC 1MSEC 3S1MJ 2L7FP 1H8AC 1ZGWA 5K58A 5F08A 1ITYA 5F27A 3FISA 3RZDJ 3S15J 5IYDJ 4RBOA 3AQSA 3BTIA 4HNVA 4DYRA 4I6ZA 1NK3P 2KDZA 3GTMJ 3L1PA 4Y7NJ 4FE7A 5D19A 2CUFA 4IHVA 3GEUA 5J1UA 3K2AA 1O4XA 4HKUA 1T33A 3VPRA 4A3JJ 1AKHA 5K7FA 2CU7A 2G7GA 2E19A 2LK2A 2X6OA 3F0CA 5EZGA 4FISA 2WAQN 4W97A 4EEFG 5EG0A 4MXMA 4QSHA 4RDUA 3COLA 1IDYA 4X6AJ 5C3EJ 2NX4A 1LE8B 2ZOYA 1WCMJ 4C2MJ 2GM4A 2RHAA 2XGEA 3HTAA 3OIOA 3BR2A 1MBKA 1WH7A 1XC5A 2CQQA 3CQZJ 4B3AA 3JRIA 4A3EJ 1XS9A 2JA8J 2NVTJ 4KWAA 3LSRA 5FMPA 2VPRA 5FLMJ 3AQTA 4JP0A 3E7LA 1SANA 1S7EA 3HGGA 3OSGA 2ZCMA 2YS9A 2JA7J 2D6YA 3HTIA 3IH3A 2WUIA 3TW7A 2FJ1A 3QQAA 3ZQFA 5HODA 4MFEA 4M6VA 2M9HA 4XIDA 1SGMA 3RH2A 2IU5A 2DA3A 2NP5A 2REKA 1JUPA 2NS8A 1DU0A 4MFDA 3VW0A 4GCLA 5M3MJ 2UXUA 3BRUA 1OFCX 3ZQGA 2R5ZB 5C4XJ 3LWJA 3A02A
chains in the Genus database with same CATH superfamily
4M6YA 3LFKA 3F8BA 2Q24A 5FLXZ 1I5ZA 1S5LC 1B59A 3BCBA 3WGHA 1I6HJ 3WU0A 4RAYA 1YJ9I 1W7PA 2GIVA 2ZJRF 2K9QA 4KUMA 2RN7A 3HOZJ 2H8WA 5J3LA 2XAUA 4ENNA 1LE8A 1FYLA 3WTTC 4PFPA 3VFZA 5B5EC 3TO9A 3H9JA 2GLOA 2QWWA 3TOBA 2XGCA 5DAJA 2K7LA 3Q0VA 1QPIA 3ERED 3T8TA 1MBHA 4NBQA 1BIAA 2LH9A 4G9YA 2V9PA 2DOAA 3B02A 1KONA 3F6VA 5B1BH 1OPCA 2BY3A 3ASNH 2TRTA 2F07A 3CCMI 2F5EA 2XDNA 1WRJA 4HF0A 3R60A 1DP3A 2Y48A 5FKKA 3VWBA 3CC7I 3DU6A 4U7DA 3IKTA 4WCGA 3KKCA 3DEWA 2ZXHA 1GV2A 1G59A 1I6XA 1UFMA 3W6VA 2CFXA 4F93B 1TBXA 4W1UA 5HVQC 4YFKF 2ECBA 5L3GA 4I2OA 1XGOA 4CICA 1DP7P 3NAUA 2IS6A 2L9VA 2XC7A 2DPUA 1MBJA 1BN5A 5FD5A 1Y8RB 2R7XA 3FWEA 1SFEA 3G3ZA 2DODA 2EZIA 3HKZN 4F3QA 1UI5A 3D0SA 3JRHA 2ZMEC 1WH5A 5D5WB 2EIKH 3ZMUA 3ROUA 1I1GA 2EA4A 2X4HA 1UB9A 1SEUA 1A5JA 1KU3A 3U9GA 4YEJA 2NVXJ 3K4MA 2D1HA 1VQ6I 4DBQA 1F5TA 2CQXA 2HZTA 4M71A 5D5XB 2K4JA 3KYDB 2LY9A 2H1KA 3IL2A 3LA7A 1A04A 1O3TA 1EH8A 3CUOA 1BOAA 3S14J 1MGTA 2VJJA 3FK6A 4MK6A 4IVNA 1U2WA 5F04A 1K83J 1B8IB 5D1RA 3M1CA 1LQ1A 4XKVA 3G6EI 4BY7J 1EKEA 2XROA 2K40A 4HLXA 4AC0A 3MKLA 2Q8KA 4LD5A 3V8KA 1QZEA 2OQRA 3HOVJ 3T5XA 3K6GA 4D7NA 3PQKA 3WTWC 5CVVA 4F52A 1FYMA 4NELA 1Z1DA 4AU7A 3ABTA 3CCYA 2M8EA 3A4CA 3KP5A 4YIRX 1VQMI 5DM6F 1BI2A 4A3DJ 2DTZA 3N4MA 5D6FA 1JTXA 3TDUC 2V26A 1OR7C 3LQRA 4D5CA 2OU2A 4FX0A 4GDFA 2R93J 1MH4A 4FASD 3H3ZA 4A93J 2CUZA 3FXOA 3JSOA 4UY8I 1RI7A 4PSWA 4A3FJ 1ERDA 3Q3SA 2IXSA 1FC3A 2FU4A 2IA2A 2YX4A 2XAFA 1IN4A 3LNQA 4PJ0C 1R00A 2EV5A 3BG6A 3Q0WA 5D5UB 2ELJA 2IGOA 2P7VB 1OCCH 2EINH 4XQFA 3HSRA 3V8LA 2DT7B 1YRNA 1KA8A 2R7FA 1X1DA 2A6EF 2A5WA 2LY1A 1FTTA 3C7JA 5IP9J 2BXYA 2VKEA 2KHMA 4DNCA 3SJMA 1HA8A 3F9KA 2WADA 1WJAA 3C18A 3MZ8A 1WI9A 5E3LA 3RCOA 4KMUX 2KDOA 3SZGA 4C9YA 1D1CA 4AIKA 4PXIA 1IUYA 3L2QA 1JUSA 4CZZA 4YIFA 5F0HA 2QKLB 4ZJZA 1FEXA 1WSUA 4JK1X 4AUXA 4FT8A 2EIMH 4BEHB 3H9GA 4M3FA 2MSYA 3KZYA 3T1BA 3WTUC 3KFWX 1KU2A 3AL0B 3K4BA 2XB5A 1T08B 3E6BA 4CGRA 4IO9F 1BJAA 1HW5A 1TW3A 3HHGA 5TISC 5CQGA 3K2ZA 3MZYA 4ME9A 3ABMH 4HNUA 1FNNA 2K9NA 4DBRA 3OYJA 3JTHA 5J6XA 1HSJA 2H6CA 3MCZA 1OYIA 2HKXA 1IV8A 3FK7A 1QVUA 4HOBA 3K8PC 3FXLA 3WODF 3EUHA 3PPBA 1RZ4A 2R3SA 2EV0A 4UUVA 2Y9YA 2PI0A 4KMFA 4RAZA 2CV1A 2KRHA 4A3LJ 1N78A 5C4JJ 5LFAA 4UUSA 1HW2A 5D8LB 3DKXA 3D1NI 1X1PA 4BYYA 1WJ5A 3BR5A 5E3MA 2MGQA 3P9CA 2KKOA 2X9DA 5F0FA 5L3BA 4IOCF 1K61A 2NNYA 2XRNA 4BGDA 3AG3H 3TGNA 3U1KA 4F55A 3J7AY 1HC8A 3H5NA 2FJI1 1PDNC 2BHZA 5EGOB 2ISZA 3F23A 3F21A 3K4JA 5ED4A 3HOUJ 5EZHA 3M4OJ 5B66C 2GXGA 2HXIA 2DMNA 3M8EA 3VYUB 4ENMA 4IHYA 1WJEA 1ETVA 2E2IJ 2HFHA 3GXOA 4KFCA 3E1SA 2IGNA 4QTRA 5JFRA 1ZLKA 2HOAA 5IT9K 1K6OA 2M1BA 2JMWA 3H0DA 3V4GA 2ZMEA 1A6IA 1UG2A 2GUHA 1FPQA 1XMXA 3PO3J 1LJ9A 3KZZA 2PMUA 3QWLA 3PNVA 5E3OA 5FD6A 1E17A 4ZDOA 2CWEA 1YHQI 2IPQX 3V7SA 3KYCB 2FSWA 3KZIC 4HSTA 3JAMK 3OWTA 1VQ4I 2JK3A 3OYDA 2O7OA 4CH7A 3WTZA 1SVLA 1NH3A 1A31A 5D4RA 2NRAC 3GUDA 2PBIA 1EJ9A 4HV5A 2MC3A 5EDNA 3W6JB 3CDLA 5LEKA 4HX4A 2KISA 1W0TA 1SFOJ 2A61A 3W2VA 5DDGA 3CMMA 1TQPA 4CDGA 5IPAA 4PJNA 3I55I 1T6SA 3CDIA 3S1QJ 5DCFA 4BS9A 2LD5A 2LOOA 2DA5A 3GYHX 2NS7A 2J5OA 1KGSA 2YU3A 3KLOA 1MMNA 3HJEA 5CVRA 2EILH 3ZMSA 2KPMA 3P7NA 4RLFA 5HDGA 2G7LA 3RPUD 1O57A 3H5AA 4GFKA 1NG6A 1BI3A 5DCMA 5DV5A 1PUFB 3RPUA 1P92A 3OYIA 4M9ZA 2B7EA 1BIBA 3OY9A 2BY1A 2QM3A 4FTHA 5CXIA 2DK8A 1MJAA 4JX4A 3L2WA 1ZK8A 4K2EA 2WBMA 3RKXA 1B9MA 2HZDA 1B72A 3H3VK 2V1DA 2KIUA 3BG9A 2YVEA 3FXMA 5IYCJ 2NAZA 2P5LC 1X19A 1BI0A 3KP6A 2BGCA 2DI3A 1I3QJ 3VDXA 3BG5A 1HKQA 2HTSA 3RD3A 3TO6A 1RPWA 1OJLA 4JKZA 4A3BJ 1UHWA 2NOJB 3CUQA 4P5OA 3ZPLA 2P0WA 3FF5A 2HU9A 2PN6A 3WG7H 2FNPA 3CCVI 2D2WA 2F2EA 1OYYA 1FMVA 2TDXA 2ME6A 3OYBA 3KNWA 1CQTA 2ZCXA 2O8KA 2OERA 3QKXA 3CWRA 4BJTA 4NQWA 4II2A 3JW4A 3B73A 4BHCA 2XF7A 2ZNYA 2ACJA 3QU6A 3JAMZ 3ELKA 3JRGA 2FX0A 3PIOF 1MBEA 2NYXA 3SYTA 3AAFA 2RGVA 3DTEA 2UXHA 4L5JA 3CCJI 5ILUA 3JTGA 3GZ5A 3IRQA 4C3HJ 2XUBA 5F1RA 2QGUA 3LSMA 2DK5A 4LB6B 4N9IA 2WAEA 3BCAA 3N05A 2W53A 2V1UA 4L9VA 3HBLA 4RGSA 1WJDA 2XHKA 3QBMA 2ZB9A 3NI7A 2VKDA 1R5HA 2M7BA 1FJLA 3S2WA 2QKOA 2OI8A 1MMAA 5IYBJ 1XGSA 4G7OF 3ZOBA 1U8BA 4L0ZB 3PASA 3FXKA 1X1CA 4ZTFA 2X6YA 1FSEA 4Y4RA 4UVCA 4WIBA 2RAEA 1FT9A 1X1BA 2CW0F 3HTSB 4ZYGA 4G6QA 3OYMA 1I1SA 1ON1A 3KE2A 3DV8A 3EYIA 1WZ2A 3GLXA 5AIPA 1OQYA 3FDYA 2XAHA 3GFJA 2E7WA 4YFNF 3GFIA 4IRIA 2FBIA 3G2BA 3ANPA 3NWTA 1E2XA 3HKZA 1VQLI 3K70C 1MSEC 2VBWA 5JVTA 1NK3P 4QWQA 5J47A 5E8IA 1YLFA 1F4KA 3FXRA 2JA2A 4Y7NJ 4FE7A 2HVQA 4IJAA 2F6CA 3SQNA 1TNTA 3GEUA 1BM9A 4LG0B 1ZG1A 1LKXA 1VQ8I 3BP8A 2IVMA 5KAIC 4CHUA 2CSOA 4HX7A 4CYDA 3RKWA 1G4DA 2B3WA 4KT6A 4II3A 2WAQN 2B0LA 3MAJA 4RGXA 4QSHA 2F48A 3OYFA 4X6AJ 5C3EJ 1LE8B 1WCMJ 3WGGA 4HAMA 3QU3A 2P6TA 1BBYA 3BR2A 2AXLA 2CQQA 2NNNA 3DXJF 2NVTJ 4KWAA 2VPRA 5J40A 1QHGA 3GX4X 2BYVE 5ERIA 4IPAA 3K4NA 3MZHA 1SANA 4XLFA 2EV6A 2RVCA 1S7EA 4IRHA 4D9JA 3HGGA 2D6YA 1JGSA 2MBFA 1DDNA 3IH3A 1WQ2A 5B3SH 2K27A 5HODA 4GGGA 1IF1A 4LIVA 2REKA 2Q0OA 2NS8A 1IRXA 1DU0A 3ZR8X 2EWNA 4P1WA 2XASA 2Z3YA 1OFCX 3LSKA 2QA4I 3D5SC 2B9SA 1SMTA 2ZCNA 3BROA 1OCZH 1S3JA 4KIFA 4NDLA 2VT3A 2ELHA 3T8RA 3HPGA 2Z1DA 4BE1A 5HDKA 2F4OB 2A6HF 5L3FA 2XSJC 1R1TA 3S1RJ 4MHGA 4M6XA 3HOYJ 5DUKA 1Z7UA 4WXCA 1R4NB 4S04A 5HLIA 2HVRA 2P5KA 3A2KA 3U1DA 3A01B 2L0KA 4XRMA 1V4RA 3FKIJ 3M1EA 2COMA 3TDZC 1TWCJ 3VOKA 1E3HA 5D6EA 5EEAA 3CMYA 3B81A 2Z99A 4L5EA 3KIOA 3FHNA 2VI6A 1TL8A 4XN3A 4OMYA 5D4SA 3FXJA 2ISYA 2OAZA 1IO2A 3G71I 2OQGA 1XB4A 1OMIA 3CJQB 5CVUA 4RB3C 1WJBA 2L4MA 1FTZA 4NC6A 2FBHA 1USTA 2WV0A 3BC8A 2G9WA 5KAFC 4AF5A 3WE2A 1ON2A 4XLEA 2WGBA 1W1WE 3HTJA 2NVYJ 5CXGA 2LP0A 2STWA 2RQQA 3WU2C 5FJ8J 3GTQJ 4GCTA 4KA4A 3CESA 4BKXA 4XLNF 3J7YJ 4HSRA 1XSDA 2OD5A 4MQ9F 4Q48A 3ONQA 4OIRF 4C2TA 1U78A 4HG2A 2XDVA 3ZN1A 3GLLA 1ETWA 2VQHA 2RNJA 5ILVA 1IJWC 3DBLB 1GXPA 2HS5A 5IP6A 2HXOA 1Q1HA 3EPZA 3H5RA 4E7HA 3I9V2 4AWXB 2KLOA 2PBXA 4BXXJ 4PFOA 4AIDA 4LJZF 3VUQA 3V8JA 1POGA 3A1YA 5HLHA 1T8IA 2XSDC 4HDUA 2OCEA 5HS8A 3BPXA 1LUJB 2E1OA 1ETQA 2M2EA 2PJRA 3PL8A 1MJ9A 1YRNB 3DQVC 1T0FC 1HCRA 4A5NA 2QSHX 2ADUA 4I09A 1SD5A 5CQEA 3P5JA 4CCMA 2HOTA 4IF4A 5DM7F 3PO2J 5JVGF 4IRVA 1SAUA 3O8GA 1UZCA 4KT5C 3LOCA 3FX3A 5E8GA 3IC7A 2KJBA 2YX7A 4AYBN 4C2UA 1MMSA 2BOLA 4BBSJ 3TO7A 2LKSA 1TZLA 4E7SA 5HAWA 1QNTA 3TOAA 4EJOA 4M73A 3TP0A 4Y15A 4OAYA 3LSJA 4O3MA 1ZH5A 4M72A 4FX4A 1V54H 2IS2A 3HTHA 3K1MA 3I4PA 2L9NA 4JX5A 4ESJA 4CCNA 5J4YA 1OCRH 1X1AA 4ANJA 3W2WA 4ICHA 2YUSA 3ISPA 3DU5A 4ESFA 2P6SA 4U9NA 2OBPA 2ZJPF 2JZYA 1JHFA 1R9TJ 2AQFA 3FMSA 1ZQ3P 4EATA 1J5YA 4EM2A 2IEKA 1JT6A 2EFOA 3DKWA 1XMKA 3M7GA 1YI2I 1IV6A 4WF2A 4A3MJ 4FCYA 4C3IJ 1U8RA 1NK2P 1ZG5A 5IY5H 4BH9A 2X1DA 3I0TA 3S3NA 3E6DA 2BW3A 1SFKA 2MA3A 1KYZA 4L62A 2FBQA 2RKHA 1XCVA 1ZAOA 2OCCH 3K1PA 4C30A 3VB2A 3CC2I 4UUSB 4XNFA 4AVZA 3BZCA 3HIFA 5FKNA 4FE4A 2DAOA 1ORKA 2WC2A 3EUHC 3EUPA 3L2CA 1JKPC 3IAM2 1HF0A 2ZOZA 2QSFX 3BJBA 2C6YA 3MD2A 3I3LA 4V2FA 1X4PA 2BY0A 1V5GA 3DPUA 5H2FC 4I01A 3DEUA 1TP4A 3ZQLA 2DXIA 2LF8A 3GWZA 3S3OA 1APLC 4V19K 3LJLA 4GCVA 5KVRA 1WGXA 3KEYA 4EM1A 3OYGA 2KZGA 3EETA 3LL7A 1YITI 3RQIA 3ZXSA 3OS1A 2H94A 1KQ9A 3P9TA 1X2MA 3BPVA 3IRRA 2ZMEB 4YFXF 3V7CA 4M9XA 5JI6A 1YS6A 3HYIA 2GQQA 4PGHA 1ZN2A 2HTJA 3IP4B 3WU1B 1I3AA 5E1WA 4U0WA 2LSOA 2DMUA 4XK4A 3A01A 2RNGA 3F72A 1YG2A 4IL6C 3J81K 2DMPA 4IZZA 3T0YA 4IRGA 1QO0D 2EFNA 3LWFA 3GZIA 3K10A 3H35A 5GADJ 3E6MA 2G3BA 1M1EB 4XLCA 1SFXA 2M34A 3OS0A 4DIQA 1JT0A 2ZXWH 4LG3A 3O8HA 1SC7A 1LFPA 2A3SA 2I10A 2RV8A 4OMZA 2K02A 1KZHA 4MEXF 2V79A 5J8CA 2DOFA 2HDCA 3BTCA 3S2DJ 1ZHFA 3PSIA 3TQNA 5EFYA 4KN4X 3GF2A 1TT0A 2A05A 4JYKA 3IH4A 2E2HJ 3VP5A 2YPRA 1GLNA 3GTOJ 4RGRA 2PG4A 3K9TA 3DPLC 4ZYAA 3MMYB 5DTDA 3FZVA 3HHHA 1ZRDA 1ACIA 1U9OA 4PUSA 2K3PA 2NS0A 2VXZA 5EF6A 3GO5A 2HI3A 2HR3A 2ZFUA 4HW0A 1YE9A 3R61A 5LEJA 3ZQCA 2JPCA 5DCMB 2QUFA 3H36A 1IXRC 2G7SA 4ACIA 2YVHA 2DA2A 1QGPA 1Z6TA 3I71A 2Q1ZB 5CPRB 2LRDA 4A6EA 3VSKA 5M3FJ 2ZJQF 1DUXC 1ENHA 3ZMTA 2TCTA 1XSXA 1B72B 2R7ZJ 1AOYA 1GV5A 4XL9A 1QVTA 5DEQA 5BQTA 4XICA 3BTLA 4BL0B 2YVXA 2M4KA 1USSA 3ULQB 2F4MB 5J1YA 4HEA2 5HBUA 3BJAA 4BQAA 1WFXA 4A2UA 3TMOA 2QIBA 3SFIA 1T0FA 2DMTA 1IAWA 2LYCA 4RAGA 3GTGJ 1YYVA 1RESA 3BLYA 2Z5UA 3SFZA 2VUMJ 3V78A 4YZEA 3CUQB 3ABUA 3ZP5A 3P9KA 5EEGA 2G7HA 1EV7A 3HSFA 3VYTB 3DPJA 3CJRB 3H9QA 4ENJA 2Y31A 3HRUA 2VJ4A 3JRDA 1MKMA 2AXTC 4PJLA 5CJ9A 1FBQA 1XX5A 2X6XA 1H9TA 1BC7C 1RUNA 1IUFA 2L02A 2LLKA 3VSLA 3IWFA 4NQWB 5JLWA 3CUQC 2HOSA 3FBNB 2D1VA 2BBYA 2HQ5A 2LG4A 5F6FA 5FKMA 3J81Z 2WAQA 3I4MJ 2PZ9A 1PYVA 4NC7A 3REOA 3JRBA 3HTUA 4R8HA 3ZCOA 4O6JA 2E5NA 2VE9A 4U0VA 1RNLA 3MFKA 4QIWN 3L2RA 4N9HA 1IRZA 4A6DA 2WB1N 4IQJA 3JSPA 2OC6A 4ZDLA 3GTKJ 4LGWA 5LGNA 2X1EA 2O3FA 4P96A 2JRMA 3HRTA 5M5XJ 1J75A 1K4SA 2GWRA 2CFOA 4N4OB 1YQAA 4HQEA 5IOZA 3IWZA 3RI4A 4XKBA 2BVMA 1SD6A 2M5WA 1QZYA 3OYNA 2B63J 3EQLF 4D5FA 3M8FA 1BL0A 4RS8A 1P9QC 5FFZA 2JQ7A 1VQOI 4MQVA 4Q4ZF 1IRGA 1D0XA 3E97A 3FMQA 2CGPA 2XAGA 2RREA 1U5TA 3BR6A 2V6EA 1R1UA 1IN5A 2DFEA 4KNYA 1PP7U 2Y30A 1TNSA 4KJZA 2W82A 1D1AA 2Q2EB 2IRFG 2AHQA 4CYCA 3CRJA 4JNNA 2DN0A 2LF7A 2W1OA 4HX8A 1T39A 3QAHA 4IXAA 1YIJI 1U3EM 1LFUP 2V1XA 1FIAA 4MIMA 2DYRH 3VEPA 3OYCA 3LAJA 2ID3A 3VW2A 2K9SA 2NVQJ 3UNGC 4NB5A 3L7WA 4LLLA 3TEDA 1E3OC 3GCMA 1EF4A 1CF7A 1IRFA 2L54A 3RKQA 1WVRA 1BR2A 3KZ9A 2K5CA 3E5QA 1LEBA 3ERMA 1ZARA 1YX3A 3NQOA 2IAIA 2H8RA 4JQFA 3GTJJ 2OUMA 2HKOA 3GBGA 2IS4A 3KEOA 5EYRA 1T95A 2A5YB 2QQ9A 2L01A 4H0EA 2M4GA 1FP2A 3KCCA 4LFUA 3RTRA 2LMDA 4QLCU 2LR8A 3MWMA 4XLPF 2JA5J 2M8GX 5FKLA 3UKGA 4HV6A 3LAPA 3CCLI 2EQRA 1WWXA 2DA7A 1R49A 1LVKA 2Y2ZA 3RPQA 3PFYA 1YJNI 4CZCA 5K58A 5F27A 3FISA 3AQSA 1MW7A 3BTIA 4HNVA 4DYRA 1SD7A 2DLLA 2VC1A 1LNWA 2VOPA 3CJNA 4HPQA 5TGTA 3FBIB 2R7TA 2GIZA 1SVOA 3K2AA 4DOZA 4HKUA 4L0YB 1AKHA 2CQNA 2CU7A 2E19A 5BPDA 2LK2A 3IKVA 1FY7A 2VIXA 5D5VB 2ZBKA 3FM5A 4FISA 5AIQA 4MXMA 2GAUA 4FHTA 4RDUA 1IDYA 2NX4A 1S72I 4C2MJ 2RHAA 2XGEA 5EEHA 3OIOA 3ZQ7A 4A3EJ 5FMPA 3HXLA 3LSRA 3OYKA 3AQTA 2QQ8A 3L00A 5KCMA 2JVGA 4IHTA 2YS9A 2IS1A 3F6OA 1O3QA 2EK5A 1P4XA 3ZQFA 4RB0A 4AYBA 5LHIA 4MFEA 2VL8A 2M30A 2M9HA 4LLGF 1SGMA 2IU5A 2VJIA 3KPHA 1JUPA 3VW0A 4GCLA 3CC4I 1J9IA 3ZQGA 5C4XJ 3WGIA 2DYSH 4EGYA 2IA1A 3I64A 2RASA 1HXDA 1I27A 4AD9A 3E7QA 3HOSA 2LNBA 2CQKA 1R5GA 1MBFA 1YO5C 2JPBA 1ONVA 3RIRA 4PDKA 2W24A 1ZR2A 4XRSG 3R0AA 4ZC3A 2WY7Q 1XG1A 4BJ6C 3BCGA 1K6YA 4CUGA 3I56I 4HLYA 1D3YA 1SAXA 1QA6A 3HIMA 4J00A 4JBAA 2O7TA 1G2HA 3S16J 3QPHA 3HDDA 1MDMA 5HS7A 2EJRA 5HLTA 4BHPA 1XGNA 2ETHA 4KITB 1LVAA 1MNEA 2R7SA 1HKTA 5L3DA 1IC8A 1X58A 2QVOA 2E1NA 1D1BA 4ITVA 4QPOA 4HYEA 3SEQA 1LDJA 3BWGA 5K5QA 3GW2A 4Q47A 3OIPA 1RUOA 4HRIA 1OCTC 1UMQA 3VW1A 3Q0UA 5F1JA 3VYRB 4DJAA 1ODDA 5JR3A 4LIUA 4UV8A 3CO6C 1Z05A 2DT6A 3S3MA 5HNFA 2OA4A 3OYEA 3HL2A 4N4NB 3JRCA 1NTCA 2P4WA 2PJRB 3DPTA 3TL4X 3OYLA 3CDHA 3LFUA 2EZLA 1VTNC 3CTAA 3FMRA 1XDUA 4A3GJ 1D0YA 4X1EA 2FXAA 3DP7A 2QBYA 4BQQA 2A2FX 1AA7A 2UXNA 2EFQA 4E7LA 1YJWI 3S17J 1XD7A 1RIOH 1UI6A 2M87A 3KP3A 3ML6A 2HPMA 4PJJA 1W36D 4Q5SF 3C2BA 1S6LA 1ZYRF 2V9VA 1JKOC 4YRVA 1UCRA 2Q2EA 4OINF 1GT0C 5HS9A 4GFLA 1ZG3A 4ZYEA 3M8JA 4PGGA 1Z9CA 2XKPA 3E5XA 3WTVC 1K78B 2LKPA 4EM0B 3FM3A 3LHQA 5HSZA 2R5YB 1REPC 1MD0A 2JN6A 4L9NA 1IGNA 1VQ7I 3FXQA 3GVAA 4MO7A 5HDNA 1U0JA 3A03A 3ZGKA 2MH2A 2XAQA 4GO1A 5F64A 2P7CB 2CO5A 1IDZA 2MABA 1MMGA 4QPQA 2E1CA 3S1NJ 3C07A 5FGMA 2WTEA 3EUKL 1TWAJ 3BR3A 3NRVA 3J7ZI 4IHXA 4YELA 3VVZA 1ETKA 1ZRFA 1FSHA 1I50J 2HWVA 2R7VA 1PP8F 1X3UA 2UUZA 4BQNA 1IXSB 1J0RA 2XAJA 2OPTA 2VPLA 2BW3B 1XGMA 4DZPA 4TV7A 1FX7A 2K85A 1K79A 4ZZDA 1FYKA 1IN8A 2OV7A 5FKOA 4R1HA 2HKUA 3OOUA 1Z7LA 5TRDA 4CCKA 4P55A 3D5LA 3LMMA 3HPHA 3PFIA 2AQEA 1ZREA 4OD5A 2LBFA 3SZTA 2CV0A 2BZTA 4ABZA 1DGWY 3HRSA 4NHJA 2ZJ2A 4XORA 4EJWA 4GYIA 1RETA 4LB5A 3OL4A 1MNDA 4NN1A 1NG7A 5KNLA 2BV6A 4UVAA 5H6QA 4B47A 3HOTA 4CCLA 3BR0A 3WTSC 3GEZA 3CCEI 2A6TA 1ZR4A 1BR4A 3M3YJ 5K7HA 5HNHA 1V55H 1FOYA 1G8XA 3BHQA 3BJOA 1ETOA 4BACA 1HLVA 4PSXA 3NXCA 2L5QA 3IAS2 4BBRJ 1RR8C 4BDZA 1Z91A 3F8MA 1YFHA 2QENA 3CP2A 1JTYA 3E0JB 3CJDA 4U88A 4M3BA 3BR1A 4J01A 4GYGA 4RMNA 2XGXA 1ZLJA 5LD2C 1ETYA 1GVJA 1P4WA 5H20A 3BTJA 2H1LA 2FF4A 3TBIA 2ICWG 3L09A 2QCOA 2E5ZA 1BOBA 5AQCA 1GXQA 1TQIA 1H9GA 4A0ZA 4XSXF 2VJ5A 2WB1A 4YIIA 5F0CA 2VQLA 5GPCA 3ECOA 3LSIA 1D5YA 3VOXA 2X85A 3H0GJ 1MH3A 2PLYA 4I0AA 2V7FA 2ZCWA 2VB6A 4XM3A 1VQPI 4G8XA 3L2VA 4DGWB 1Q1VA 2L2OA 2HQNA 2Y0MA 2DJIA 1Y39A 5IT3A 1Y1WJ 1S29A 2HPIA 1BC8C 1R6RA 5E17F 1ZKGA 2XGDA 2Y69H 4BY1J 4U9LA 2MLKA 2M0CA 5J8FA 2ESNA 2W00A 4B4CA 3BQYA 1KU7A 2XPWA 1TC3C 1AWCA 1LDDA 2DA6A 5DYMA 2Z2SB 4KISA 3EDPA 3OYHA 4XLHA 3GTLJ 1UHMA 1O3RA 1R7JA 1WI3A 3JR9A 4M3EA 2DFFA 4DVYP 4XKCA 5GPAA 2XKOA 4P9FA 5E3NA 4A0YA 4B1RA 2VBXA 3VVXA 2NVUB 3OS2A 2GA1A 3RKYA 3OYAA 2L4AA 5FRMA 2X1CA 2DTRA 2XV4S 4BDYA 4EJUA 3ZMZA 3RQ4A 2W48A 5JHUA 1BJZA 2BEOA 5HOOA 4D0PA 4U0YA 3LA2A 3TP3A 4BHBA 1YW7A 4P9UA 2F5CA 4E7KA 1S7OA 2FQ4A 4RB1A 4EJTA 1MIJA 4XONA 3ZN0A 2Z33A 2I5UA 3SEZA 4A3KJ 2E34A 2O61A 2UV1A 3OOPA 4XSZF 4HF1A 1FBUA 1I39A 4RA2A 1F9NA 2MYSA 5BNGA 1WJCA 3FXUA 3KKDA 1STZA 1MNMC 2E60A 1X3ZB 3RDIA 1HW1A 3BOQA 2XIGA 3A0HC 1N77A 3I5UA 4F91B 3HZJA 2O9LA 3K4LA 3JRAA 3HEFA 1YW9A 1JJ6C 2MH9A 3AKZA 4GFBA 4FQGA 1JGGA 1H88C 4PK4A 4B48A 2HYTA 1K78A 2DQLA 3ABKH 3C2GA 5KHDA 2E36A 2BHYA 2R5YA 1OCPA 1PJRA 4ZDPA 4JOMA 3CF2A 1PVEA 2DT5A 1V3FA 3LSGA 1A35A 5D8KB 4ETSA 3VVYA 1T98A 2IP2A 5GTIC 3U21A 2NXNB 2W84A 1EA3A 2YR2A 1D5VA 1MBGA 5BMZA 1Z67A 2JVHA 2O03A 1P6RA 2HDWA 3QYBA 2V9KA 4N0BA 4UB6C 4WXDA 5H6RA 3CCQI 3CZ6A 3DFGA 1ZGJA 1QRYA 4CA0A 4WWCA 4MTEA 3ZMVA 2ZFWA 5EJCA 4LITA 3N97A 2K86A 5DD4A 3ANGA 1U5TB 4NUBA 5A2QZ 4RAFA 3EUAA 1ZELA 4F7ZA 4CGZA 1V5FA 2QKMB 3BZKA 1IN7A 1SVMA 3HUGA 1J7KA 4B44A 3Q5FA 3J80K 4UHTA 1H0MA 2VONA 2JWTA 3MVPA 4X0GA 5FHPA 1B6AA 4CYCB 3K4CA 4AVPA 3WTYC 2KJCA 2PMZA 2RDPA 1U5TC 2KZVA 5FB2A 1BW5A 1FIPA 1W7PD 2PFBA 3QP5A 2HQAA 4EQQA 2GA2A 3TKYA 2CJJA 2JSCA 4J19A 2IW5A 2ZKZA 2R4GA 4AIHA 2IGMA 1TW2A 3F8CA 2N8GA 1OCOH 2LTPA 1CF7B 1BR1A 1YIOA 2A68F 1O7FA 3O2PE 4Y17A 2Y9ZA 1ZGAA 2H6BA 1QHHD 3X2QH 2FOKA 2OZ6A 1R58A 4XN0A 4RGUA 2RQPA 4DQ2A 1WJFA 2UXXA 3CO7C 4ZZLA 4OOIA 2JT1A 1BW6A 3LA3A 4B8XA 2QYOA 1IG7A 4CCJA 1HDDC 3MNLA 1TLHB 4BXFA 3WTXC 5J4VA 2B1EA 3HRMA 4HF2A 4RLQA 4S05A 4LLNA 2FEZA 3DCFA 2YU9J 1FWZA 1G3YA 4A3IJ 1DU6A 2L9RA 1GHCA 3K0LA 1AU7A 3I59A 1Z3YA 3I4NJ 2V6CA 3WHCA 5FRNA 2VBYA 5LRSA 5LLQA 4I7HA 2BE5F 1VI0A 2GBYA 5DUIA 5K1YA 1TWGJ 3A0BC 3HG9A 2JUCA 3OR1C 3MKYB 2DG8A 1KYWA 2CQ7A 4XR6A 5JHFA 1W5SA 3AG4H 3M07A 4XBFA 3CCRI 4OIOF 1AKHB 2M3AA 5ICFA 2VC0A 3CP8A 3RYPA 1Y0NA 2CS3A 2DDAA 3VOEA 3OL3A 2W57A 2JSPA 1QBJA 1U6GA 1Y6IA 2GOXB 4I76A 3COAC 2VASA 4E4HA 4E7ZA 1BI1A 2MD5A 3ZQIA 3ON2A 3EYYA 2A69F 5JLXA 1ZTRA 3J80Z 5HLGA 5C44J 3F8NA 3O6BB 1XN7A 1G3SA 1MSFC 2L7FP 4M9SA 5GAGJ 1ZGWA 5F08A 1VZ0A 1ITYA 3ZQQA 3RZDJ 3S15J 4RBOA 1FLIA 2Z9OA 4I6ZA 3MEXA 4BQOA 3MKZA 1J09A 3KP7A 4KIGA 2DPDA 3LQQA 2QEXI 4Y13A 2CUFA 5E20A 2AS5F 4IHVA 2P8TA 1FMWA 4YG2F 3VPRA 4CO8A 2XVCA 2ZSIB 3AFHA 2X6OA 5E1XA 1R36A 3F0CA 5EZGA 3QRFF 5TJJA 4BUPA 4EEFG 5EG0A 4HDVA 1D0ZA 3E5UA 2PEXA 2ZOYA 3JCUC 2WWYA 4ZTJA 4HNTA 1MJBA 3DEEA 3W6KB 1MDMB 2CMPA 1XC5A 3JRIA 2JA8J 1VQNI 3FKJA 2VT2A 2FMYA 3CLQA 4Y3OA 4JP0A 3E7LA 4EMSA 2GZWA 1P2FA 2M7AA 3I58A 3OSGA 2ZY9A 2ZCMA 3SZPA 4ZYDA 4IHSA 2FJ1A 3QQAA 4UB8C 1MZBA 5E1ZB 3S93A 3RYRA 1EH7A 3RH2A 1CGPA 4MEYF 2ZSHB 1IXCA 4RB2C 4MFDA 5M3MJ 4F92B 1FZPB 1A36A 2OTJI 3BDDA 4CXFA 2UXUA 3LWJA 2JUGA 3KEQA 3MKWB 2PX9A 3DF8A 2Y75A 2GOMA 2DQRA 2X48A 3NPIA 3F1BA 1HQCA 3G1LA 4G12A 2K9MA 1XMAA 4S0HB 1HBXG 3OV8A 1OYWA 2HYFA 4MLOA 1TTYA 1QQIA 2EIJH 3PNYA 3S8PA 2HNHA 3SDGA 4B43A 3JSJA 1XDSA 2QBYB 2DCEA 2FBKA 2F5FA 3SWHA 3O60A 5FFXA 2F4IA 2XF6A 3E3VA 5H9TA 2DDBA 2E2JJ 3BNIA 2H09A 2XRLA 3V6GA 2QQAA 2L9SA 1Z77A 2KRFA 3IH2A 4LK1F 3G73A 4XRFA 1LFBA 3VTIA 4IOAF 2CRGA 4MTDA 1P4AA 3QODA 1K7AA 1HOMA 2LREA 2VBZA 2KIQA 2XB0X 5LHHA 1VF9A 2J5PA 3CLOA 3DBHB 4OWRB 3C3WA 3C1DA 4ESBA 2R5ZA 5GAEJ 3IUVA 1SMYF 5CVJA 3ZRGA 2L7ZA 1Y56A 1IW7F 4IKFA 2PFVA 1Z21A 4WX9A 4C3JJ 3AL0C 3CF5F 2KMUA 4EV0A 3WG9A 1W36C 3HM5A 5IOYA 4IHWA 4L9JA 2OJED 2VXDA 4ENKA 4U7BA 3G7RA 3WHBA 4M3GA 1KQ0A 4I02A 3O3KA 4NC8A 1R5ID 2F5DA 3GZNB 1K4TA 3ASOH 2D45A 3PQJA 2Y0SN 2IBDA 3BZ6A 4BAYA 2IT0A 1J59A 3DTKA 2FD5A 3GTPJ 3L9FA 2HQRA 2CUJA 3RSNA 1P7IA 5ILSA 3PSFA 5FLVA 1DPRA 2QF7A 4OAZA 2R7DA 2VKHA 5B1AH 4BE0A 1YX5A 2FQ3A 2LBFB 1RC9A 2E71A 1HSTA 2W4SA 1S9HA 2ELKA 2IGKA 3I54A 3OMYA 3DTIA 4M3DA 4XOTA 1HDPA 4ASNA 1O3SA 2EZKA 1Z6RA 1FOWA 3GFLA 1G6NA 4L18B 5K7ZA 3V42A 3CMEI 3S5RA 1DQUA 2LFBA 4E7IA 3K1NA 3J7AO 1ETXA 3RZOJ 4AM3A 3G56A 3RJPA 2H27A 4EJVA 2E1MB 4LK0F 3QP6A 4V2GA 3CCUI 1JJ8C 2KIMA 4D7MA 1JE8A 2E35A 2EBIA 3F3XA 5LGTA 2QQBA 1UJ8A 3DLAA 1W0UA 4XKWA 2ZNZA 4E6KG 1TWHJ 3QYFA 2E1MC 2L7MP 2CUEA 1IZ1A 3G1OA 2ZXIA 1S8NA 2PMZN 3H1CA 4I0BA 4G7HF 2QWTA 2XPUA 3C2HA 3ECHA 3LSPA 2EH3A 1Y8QB 3PIPF 2GXBA 2VODA 3F8FA 4JX6A 1B8IA 1PUEE 2EB7A 4B3XA 3GFMA 2R7OA 3R6SA 1XSVA 2V1NA 3OR2C 4RM2A 2DU9A 4A69C 1V5EA 1YTYA 2LC2A 4KDPA 2KQRA 5L3CA 3PJRA 2MFZA 2KIFA 1OR7A 3HOXJ 3H92A 1VFCA 1B1BA 1P7JA 2JJ7A 3BJ6A 1Y0UA 3EGQA 5LHGA 4OIQF 4DW6A 2A07F 5GP9A 4DYQA 1G3WA 1NHAA 3KP4A 1JHHA 1E3PA 3E6CC 1YS7A 5LBQA 1N75A 5L3EA 3G4SI 4L5IA 2X51A 3AG2H 3ZMDA 5FGLA 2IA0A 2DMQA 5LRRA 4D1QA 2V57A 2BXZA 2OF7A 4XMYA 4UUTA 3B6AA 5CVIA 5DS9A 5IT9Z 2L7KA 4PCQA 2M45A 1X3WB 2W25A 1LEAA 2JTVA 1TWFJ 3SDBA 4KYWA 9ANTA 2W85A 3QPSA 2BY2A 2HVSA 3IUOA 1YW8A 3G1MA 4LMYA 2E7XA 1LDKB 2RC4A 3DLLF 1JI8A 3HE0A 1R22A 1TQMA 1AHDP 1KQ8A 3WE3A 3S2HJ 2EA2A 3OIQA 1L0OC 4NNJA 2KP6A 1F1ZA 1L3LA 3ON4A 4JL3A 5LGUA 4H4KC 3AG1H 1XTAA 2F5VA 3HGYA 2DA4A 2QSGX 1FBSA 2I8DA 4HZFA 5ICGA 2WY8Q 2YSRA 2EPFA 5K5OA 3CD6I 4BEHA 3JRFA 2CH0A 2NOGA 3QPLA 3V7RA 3KETA 1B4AA 2FRHA 2UXPA 3TW6A 5E79C 1QU3A 1N25A 4DZJA 3KLNA 3NS4A 2COBA 2DFHA 2QZ8A 1SD4A 5CYVA 2UXOA 2GFNA 5K5RA 2WV1A 1Z3XA 2D5VA 4PJMA 5M5WJ 2FOWA 3QPTA 2HYJA 1B9NA 1D8KA 2AO9A 2CW8A 2ZO4A 3S32A 2DA1A 2P5VA 4A5MA 2UXIA 3CMAI 3DBRB 3VYSB 3FHZA 2CV2A 4UVBA 3NWSA 2M0MA 5BOXA 1D8JA 2FNAA 3NRGA 5ICEA 1XPXA 4XLAA 5ICCA 1SFUA 2MLGA 5CW8A 4I98B 4XOPA 1Z0XA 3K4KA 3HOWJ 2O5RA 2VE8A 3W3CA 1FOKA 1TT5B 4KICA 1UHSA 2ME0A 1VQKI 3CCSI 4IEJA 3LSTA 1OKRA 1JKRC 1F43A 2VN2A 5EGOA 1RRJA 1WKMA 2VKVA 1RKTA 5KK1A 3HUGB 2DJNA 5CKTA 2VLAA 2CYYA 1UAAA 4BU2A 3PUBA 3DWLE 4M74A 3JREA 5BS6A 4A3CJ 5GTHC 2ECCA 5DD8A 2KT0A 2G0EA 2VQCA 4OU0A 2QTQA 2ESHA 1RKWA 4UDSA 3HC7A 2HDDA 1OLTA 1W7PB 4EGZA 2MW8A 1QZZA 5J1RA 1GVDA 4GRIA 4CCOA 2OTLI 4OD4A 3DKYA 3SHFA 4LOCA 2ZXJA 4G94A 1T56A 2KRCA 3QYEA 4R79A 2O0YA 3HB9A 1VNDA 2LDUA 2R0QC 1Y1VJ 5CLSA 1H89C 4A0XA 3FIWA 4EVIA 2EFWA 1FP1D 6PAXA 4AC6A 1R4MB 2ZC2A 4WXHA 2KL4A 3K7AJ 3BT9A 4GXOA 1JKQC 2X0LA 1E0EA 1R23A 1R1VA 3QOEA 1BA5A 3CJTB 3KX2A 4GCKA 2DOEA 4PZJA 2ID6A 5IP7J 4KN7X 2EFPA 3GMEA 1W5TA 2FUG2 2LVSA 2R7WA 3KP2A 3UR3C 3M9AA 2VOOA 3FRQA 3PUFA 3I59B 2STTA 3HSEA 5BPIA 2XPVA 2IJLA 1RR7A 1YOVB 2L3DA 2O8XA 3QOPA 1U9NA 4WK8F 4Z6YA 2KFDA 2NP3A 3SXYA 4UXNA 2MD0A 2HOEA 3PM1A 4BNCA 5GAHJ 4Y52J 2DG7A 3MQ0A 3GZ6A 3ESWB 2QOPA 3B6CA 2Z16A 2QLZA 5C4YA 4CSWA 1PUFA 5M5YJ 2R7QA 3VIBA 3MN2A 4MNUA 2FA5A 1EH6A 2W7NA 3BY6A 4G6TB 1ZRCA 1X2NA 2LKXA 2G7UA 4AIJA 2X6WA 2BVLA 3BG3A 4UNOA 4G7ZF 4ZH4F 4O5VA 4ON0A 3BQZA 2R92J 1VQ5I 1OISA 3BG7A 3NEUA 1HKSA 4XRSA 1GDTA 1QPMA 2FMLA 2K3FA 2DBBA 2P81A 5A2QK 2EZHA 3R0JA 3P9IA 4L9TA 3IV5A 3ZQHA 1C0WA 3U2RA 2UZKA 1JUMA 1LPQA 1JXSA 5FLXK 3T6NA 3ABLH 4IQ4A 2HYGD 1UELB 2PJPA 1KU9A 3KYLA 1WPKA 2O6GE 1DPUA 3NARA 3PNTA 5EG0B 2VQGA 3NNRA 4KIBA 5E18F 1F36A 2R7UA 4I99C 4HA8A 2R7RA 3IHUA 2CG4A 2CW7A 1GUUA 2OZUA 2GENA 2LY2A 4DYCA 1WHUA 3OSFA 2JA6J 2MG4A 3LSHA 4FETA 1J2XA 3S1MJ 1H8AC 2Y0SA 3D5RC 4B09A 4U87A 5IYDJ 3H3UA 1S7AA 2K9LA 1XCBA 3R4KA 4A12A 5FO5A 2KDZA 2WAFA 4E70A 4E7JA 3L1PA 4OIPF 3GTMJ 4HQMA 2DFIA 3Q9SA 1FOXA 1R71A 5D19A 4RM3A 2FE3A 4HBLA 5J1UA 2WA0A 1T2KA 2HGCA 1O4XA 1LB2A 1W4MA 1T33A 4A3JJ 5K7FA 3Q9VA 2G7GA 3I53A 2HEOA 2JRTA 4ZYHA 3K70D 4BJ5C 4W97A 4C2MA 3COLA 2PQ8A 5AONA 2PMHA 3K69A 2GM4A 2XF5A 1IN6A 1G3TA 3HTAA 1MBKA 1WH7A 3CQZJ 3L2UA 4BE2A 4B3AA 3W2AA 5D18A 1XS9A 4UV9A 1O7LA 4G6DA 3VODA 1W5CC 4BXUA 5FLMJ 3F22A 2UWMA 1VQ9I 1UG0A 2V4JC 2JA7J 3HTIA 2GXAA 5FROA 1X4OA 2WUIA 2DO7A 3TW7A 4Y33A 4M6VA 2DW4A 4XIDA 4Z2YA 2DA3A 2NP5A 2K4BA 2MC4A 4MGRA 1DGRM 1A6QA 1T38A 2R5ZB 3BRUA 4LG0A 1MMDA 4IX7A 3A02A 1ULYA
chains in the Genus database with same CATH topology
2RASA 2Q24A 4NDLA 2X48A 1I6HJ 3E7QA 3F1BA 3NPIA 1MBFA 3G1LA 4G12A 4S0HB 2K9QA 1ZR2A 4XRSG 3HOZJ 1XG1A 3BCGA 5FHPA 5J3LA 3S1RJ 3HIMA 4MLOA 1LE8A 3HOYJ 2O7TA 1G2HA 3S16J 3HDDA 3SDGA 3JSJA 2GLOA 2XGCA 5DAJA 3Q0VA 1QPIA 1MBHA 3A01B 3O60A 2L0KA 5H9TA 4XRMA 2E2JJ 3BNIA 3FKIJ 1IC8A 1X58A 2XRLA 3V6GA 1TWCJ 3VOKA 2TRTA 2F07A 5EEAA 2XDNA 1Z77A 3IH2A 3CMYA 3B81A 4L5EA 1LFBA 2CRGA 2VI6A 1HOMA 5FKKA 2XB0X 1VF9A 2R5ZA 1OCTC 1UMQA 3DEWA 3KKCA 3VW1A 3Q0UA 1GV2A 3IUVA 3W6VA 5F1JA 2L7ZA 4C3JJ 4W1UA 3HM5A 2ECBA 5IOYA 4IHWA 1FTZA 3G7RA 3NAUA 1MBJA 1NTCA 4M3GA 3WHBA 3JRCA 4AF5A 2WGBA 2EZLA 2EZIA 2NVYJ 3HTJA 4A3GJ 5CXGA 3HKZN 4X1EA 2LP0A 1UI5A 5FJ8J 3JRHA 3GTQJ 1WH5A 4GCTA 2Y0SN 4BKXA 2IBDA 3S17J 1A5JA 2FD5A 3GTPJ 1UI6A 2NVXJ 1P7IA 3C2BA 1U78A 1ETWA 2CQXA 1JKOC 5FLVA 1IJWC 2QF7A 5IP6A 1GT0C 4GFLA 2LY9A 2H1KA 2HXOA 2PBXA 4BXXJ 2R5YB 2ELKA 3LHQA 3S14J 5HSZA 2JN6A 3FK6A 4MK6A 1IGNA 5F04A 1K83J 4M3DA 1B8IB 4MO7A 1HDPA 1POGA 5D1RA 3VUQA 2EZKA 3A03A 2XSDC 4BY7J 2E1OA 2K40A 1ETQA 2M2EA 3MKLA 4AC0A 1YRNB 5K7ZA 1HCRA 3HOVJ 1IDZA 3S5RA 2LFBA 3S1NJ 3C07A 1ETXA 4D7NA 2HOTA 1TWAJ 3BR3A 4IHXA 3PO2J 3RZOJ 3G56A 3VVZA 3O8GA 1ETKA 4V2GA 3LOCA 1I50J 1JJ8C 4D7MA 4NELA 2EBIA 4AYBN 4BBSJ 3CCYA 2OPTA 4DZPA 1W0UA 4A3DJ 2DTZA 5HAWA 1JTXA 1TWHJ 4D5CA 3TP0A 2L7MP 5FKOA 3LSJA 3OOUA 2CUEA 2HKUA 3G1OA 2R93J 3HTHA 2PMZN 1MH4A 2QWTA 4JX5A 4A93J 2XPUA 4A3FJ 4ABZA 3Q3SA 3LSPA 2EH3A 4ICHA 3LNQA 1RETA 4JX6A 1B8IA 3Q0WA 2YUSA 4NN1A 3BR0A 4A69C 1YRNA 1R9TJ 1ZQ3P 1ZR4A 1FTTA 2IEKA 1JT6A 5IP9J 3M3YJ 2VKEA 5K7HA 1IV6A 4A3MJ 3HOXJ 4FCYA 4C3IJ 3SJMA 1NK2P 1VFCA 3BHQA 1P7JA 2JJ7A 1ETOA 1HLVA 3EGQA 3NXCA 5E3LA 4DW6A 4BBRJ 5GP9A 4L62A 4DYQA 2FBQA 4PXIA 1JUSA 4UUSB 1JTYA 5F0HA 3CJDA 5FKNA 4M3BA 1FEXA 3BR1A 4FE4A 1ORKA 4AUXA 3EUPA 5FGLA 1JKPC 1HF0A 1ETYA 2ZOZA 4M3FA 2DMQA 2MSYA 3BTJA 3BJBA 2V57A 2OF7A 4V2FA 4UUTA 3B6AA 2QCOA 5DS9A 2XB5A 5AQCA 4CGRA 3ZQLA 1APLC 3LJLA 1TWFJ 9ANTA 4ME9A 3QPSA 1WGXA 5F0CA 2K9NA 5GPCA 3RQIA 3G1MA 3HE0A 1D5YA 3VOXA 3FK7A 1AHDP 1QVUA 1X2MA 3H0GJ 3P9TA 1MH3A 3S2HJ 3PPBA 3ON4A 4JL3A 1Q1VA 2Y9YA 4A3LJ 5C4JJ 4UUSA 3HGYA 2DA4A 1Y1WJ 1ZKGA 2XGDA 3D1NI 2DMUA 4XK4A 4BY1J 3A01A 3BR5A 5E3MA 2MGQA 2M0CA 2X9DA 5F0FA 4B4CA 1K61A 3BQYA 2DMPA 2XPWA 3JRFA 2NOGA 1TC3C 3QPLA 2DA6A 2UXPA 3GTLJ 3GZIA 3TW6A 5EGOB 1WI3A 3JR9A 4M3EA 4DZJA 2G3BA 2COBA 3HOUJ 2M34A 5EZHA 3M4OJ 5GPAA 2HXIA 5E3NA 2DMNA 1JT0A 2UXOA 2GFNA 3O8HA 2WV1A 4B1RA 4IHYA 3VVXA 2D5VA 2I10A 1ETVA 5M5WJ 2E2IJ 3BTCA 3S2DJ 4QTRA 2HYJA 2AO9A 2HOAA 5EFYA 2DA1A 2JMWA 2W48A 4JYKA 2UXIA 3IH4A 1A6IA 1BJZA 1UG2A 2E2HJ 2GUHA 3VP5A 3PO3J 3GTOJ 3TP3A 5DTDA 3NRGA 5CW8A 1U9OA 2FQ4A 5E3OA 3HOWJ 1Z0XA 5EF6A 4A3KJ 2HI3A 3ZQCA 1UHSA 2ME0A 2YVHA 2G7SA 4ACIA 2DA2A 2JK3A 2O7OA 4IEJA 5BNGA 3KKDA 1JKRC 1MNMC 1F43A 5EGOA 5M3FJ 2VKVA 1RKTA 1ENHA 2R7ZJ 2TCTA 1B72B 1GV5A 2O9LA 1QVTA 3JRAA 2DJNA 3HEFA 4XICA 5EDNA 3BTLA 3CDLA 5J1YA 3JREA 1JJ6C 4GFBA 4A3CJ 1W0TA 5HBUA 2ECCA 1SFOJ 1H88C 2KT0A 1JGGA 2G0EA 2HYTA 2QTQA 2QIBA 3SFIA 2DMTA 2R5YA 1OCPA 1RKWA 4UDSA 2HDDA 3GTGJ 5IPAA 1RESA 2VUMJ 3V78A 2MW8A 3S1QJ 4YZEA 5J1RA 1GVDA 2LD5A 3LSGA 4LOCA 3DPJA 1T56A 2DA5A 2Y31A 3VVYA 2NS7A 3HB9A 3JRDA 1VNDA 2R0QC 1Y1VJ 1H89C 3FIWA 1MBGA 4AC6A 1IUFA 2LLKA 2G7LA 5JLWA 4GFKA 2HOSA 3K7AJ 1QRYA 2HQ5A 3BT9A 1JKQC 1PUFB 5FKMA 3I4MJ 2PZ9A 3ANGA 3JRBA 5CXIA 4FTHA 4JX4A 1ZK8A 3H3VK 1BA5A 4QIWN 1B72A 4GCKA 3BG9A 1IRZA 2ID6A 2YVEA 2JWTA 2WB1N 3MVPA 5IP7J 5IYCJ 4CYCB 3GTKJ 1BW5A 2LVSA 1FIPA 1I3QJ 3BG5A 3FRQA 3RD3A 5M5XJ 1RPWA 1OJLA 2CJJA 4J19A 2XPVA 4JKZA 4A3BJ 1RR7A 1U9NA 2N8GA 2LTPA 5IOZA 2NP3A 3PM1A 4Y52J 2Y9ZA 2ME6A 2DG7A 3KNWA 1CQTA 2ZCXA 5D18A 2O8KA 4D5FA 2B63J 2OERA 3QKXA 3CWRA 2QOPA 1BL0A 3B6CA 5C4YA 1BW6A 1PUFA 3JRGA 5M5YJ 1IG7A 3VIBA 2FX0A 3MN2A 1HDDC 1MBEA 3BR6A 3MNLA 2UXHA 2Y30A 1X2NA 2LKXA 3DCFA 3BG3A 2AHQA 4CYCA 4C3HJ 3CRJA 2YU9J 2DN0A 2ZCNA 4JNNA 4A3IJ 3BQZA 2R92J 1DU6A 2L9RA 4XRSA 1GDTA 2W53A 1LFUP 1AU7A 1FIAA 4MIMA 3I4NJ 2P81A 3HBLA 3WHCA 3QBMA 2ID3A 3VW2A 2ZB9A 2EZHA 2K9SA 3NI7A 2NVQJ 1FJLA 2QKOA 3TEDA 1VI0A 1E3OC 1EF4A 2GBYA 5IYBJ 3IV5A 2OI8A 1TWGJ 3ZQHA 3ZOBA 2DG8A 3RKQA 1U8BA 3PASA 3KZ9A 1JUMA 3T6NA 1AKHB 2IAIA 2RAEA 2H8RA 3GTJJ 3GBGA 5EYRA 1WPKA 4I76A 3NNRA 3NARA 5EG0B 1F36A 2LR8A 2JA5J 3ZQIA 3ON2A 2M8GX 5FKLA 3UKGA 1GUUA 2GENA 5JLXA 4DYCA 1ZTRA 2EQRA 5C44J 3OSFA 2JA6J 2DA7A 3ANPA 2MG4A 2Y2ZA 1MSFC 1MSEC 3S1MJ 2L7FP 1H8AC 1ZGWA 5K58A 5F08A 1ITYA 5F27A 3FISA 3RZDJ 3S15J 5IYDJ 4RBOA 3AQSA 3BTIA 4HNVA 4DYRA 4I6ZA 1NK3P 2KDZA 3GTMJ 3L1PA 4Y7NJ 4FE7A 5D19A 2CUFA 4IHVA 3GEUA 5J1UA 3K2AA 1O4XA 4HKUA 1T33A 3VPRA 4A3JJ 1AKHA 5K7FA 2CU7A 2G7GA 2E19A 2LK2A 2X6OA 3F0CA 5EZGA 4FISA 2WAQN 4W97A 4EEFG 5EG0A 4MXMA 4QSHA 4RDUA 3COLA 1IDYA 4X6AJ 5C3EJ 2NX4A 1LE8B 2ZOYA 1WCMJ 4C2MJ 2GM4A 2RHAA 2XGEA 3HTAA 3OIOA 3BR2A 1MBKA 1WH7A 1XC5A 2CQQA 3CQZJ 4B3AA 3JRIA 4A3EJ 1XS9A 2JA8J 2NVTJ 4KWAA 3LSRA 5FMPA 2VPRA 5FLMJ 3AQTA 4JP0A 3E7LA 1SANA 1S7EA 3HGGA 3OSGA 2ZCMA 2YS9A 2JA7J 2D6YA 3HTIA 3IH3A 2WUIA 3TW7A 2FJ1A 3QQAA 3ZQFA 5HODA 4MFEA 4M6VA 2M9HA 4XIDA 1SGMA 3RH2A 2IU5A 2DA3A 2NP5A 2REKA 1JUPA 2NS8A 1DU0A 4MFDA 3VW0A 4GCLA 5M3MJ 2UXUA 3BRUA 1OFCX 3ZQGA 2R5ZB 5C4XJ 3LWJA 3A02A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RAS A;  2Q24 A;  4NDL A;  2X48 A;  1I6H J;  3E7Q A;  3F1B A;  3NPI A;  1MBF A;  3G1L A;  4G12 A;  4S0H B;  2K9Q A;  1ZR2 A;  4XRS G;  3HOZ J;  1XG1 A;  3BCG A;  5FHP A;  5J3L A;  3S1R J;  3HIM A;  4MLO A;  1LE8 A;  3HOY J;  2O7T A;  1G2H A;  3S16 J;  3HDD A;  3SDG A;  3JSJ A;  2GLO A;  2XGC A;  5DAJ A;  3Q0V A;  1QPI A;  1MBH A;  3A01 B;  3O60 A;  2L0K A;  5H9T A;  4XRM A;  2E2J J;  3BNI A;  3FKI J;  1IC8 A;  1X58 A;  2XRL A;  3V6G A;  1TWC J;  3VOK A;  2TRT A;  2F07 A;  5EEA A;  2XDN A;  1Z77 A;  3IH2 A;  3CMY A;  3B81 A;  4L5E A;  1LFB A;  2CRG A;  2VI6 A;  1HOM A;  5FKK A;  2XB0 X;  1VF9 A;  2R5Z A;  1OCT C;  1UMQ A;  3DEW A;  3KKC A;  3VW1 A;  3Q0U A;  1GV2 A;  3IUV A;  3W6V A;  5F1J A;  2L7Z A;  4C3J J;  4W1U A;  3HM5 A;  2ECB A;  5IOY A;  4IHW A;  1FTZ A;  3G7R A;  3NAU A;  1MBJ A;  1NTC A;  4M3G A;  3WHB A;  3JRC A;  4AF5 A;  2WGB A;  2EZL A;  2EZI A;  2NVY J;  3HTJ A;  4A3G J;  5CXG A;  3HKZ N;  4X1E A;  2LP0 A;  1UI5 A;  5FJ8 J;  3JRH A;  3GTQ J;  1WH5 A;  4GCT A;  2Y0S N;  4BKX A;  2IBD A;  3S17 J;  1A5J A;  2FD5 A;  3GTP J;  1UI6 A;  2NVX J;  1P7I A;  3C2B A;  1U78 A;  1ETW A;  2CQX A;  1JKO C;  5FLV A;  1IJW C;  2QF7 A;  5IP6 A;  1GT0 C;  4GFL A;  2LY9 A;  2H1K A;  2HXO A;  2PBX A;  4BXX J;  2R5Y B;  2ELK A;  3LHQ A;  3S14 J;  5HSZ A;  2JN6 A;  3FK6 A;  4MK6 A;  1IGN A;  5F04 A;  1K83 J;  4M3D A;  1B8I B;  4MO7 A;  1HDP A;  1POG A;  5D1R A;  3VUQ A;  2EZK A;  3A03 A;  2XSD C;  4BY7 J;  2E1O A;  2K40 A;  1ETQ A;  2M2E A;  3MKL A;  4AC0 A;  1YRN B;  5K7Z A;  1HCR A;  3HOV J;  1IDZ A;  3S5R A;  2LFB A;  3S1N J;  3C07 A;  1ETX A;  4D7N A;  2HOT A;  1TWA J;  3BR3 A;  4IHX A;  3PO2 J;  3RZO J;  3G56 A;  3VVZ A;  3O8G A;  1ETK A;  4V2G A;  3LOC A;  1I50 J;  1JJ8 C;  4D7M A;  4NEL A;  2EBI A;  4AYB N;  4BBS J;  3CCY A;  2OPT A;  4DZP A;  1W0U A;  4A3D J;  2DTZ A;  5HAW A;  1JTX A;  1TWH J;  4D5C A;  3TP0 A;  2L7M P;  5FKO A;  3LSJ A;  3OOU A;  2CUE A;  2HKU A;  3G1O A;  2R93 J;  3HTH A;  2PMZ N;  1MH4 A;  2QWT A;  4JX5 A;  4A93 J;  2XPU A;  4A3F J;  4ABZ A;  3Q3S A;  3LSP A;  2EH3 A;  4ICH A;  3LNQ A;  1RET A;  4JX6 A;  1B8I A;  3Q0W A;  2YUS A;  4NN1 A;  3BR0 A;  4A69 C;  1YRN A;  1R9T J;  1ZQ3 P;  1ZR4 A;  1FTT A;  2IEK A;  1JT6 A;  5IP9 J;  3M3Y J;  2VKE A;  5K7H A;  1IV6 A;  4A3M J;  3HOX J;  4FCY A;  4C3I J;  3SJM A;  1NK2 P;  1VFC A;  3BHQ A;  1P7J A;  2JJ7 A;  1ETO A;  1HLV A;  3EGQ A;  3NXC A;  5E3L A;  4DW6 A;  4BBR J;  5GP9 A;  4L62 A;  4DYQ A;  2FBQ A;  4PXI A;  1JUS A;  4UUS B;  1JTY A;  5F0H A;  3CJD A;  5FKN A;  4M3B A;  1FEX A;  3BR1 A;  4FE4 A;  1ORK A;  4AUX A;  3EUP A;  5FGL A;  1JKP C;  1HF0 A;  1ETY A;  2ZOZ A;  4M3F A;  2DMQ A;  2MSY A;  3BTJ A;  3BJB A;  2V57 A;  2OF7 A;  4V2F A;  4UUT A;  3B6A A;  2QCO A;  5DS9 A;  2XB5 A;  5AQC A;  4CGR A;  3ZQL A;  1APL C;  3LJL A;  1TWF J;  9ANT A;  4ME9 A;  3QPS A;  1WGX A;  5F0C A;  2K9N A;  5GPC A;  3RQI A;  3G1M A;  3HE0 A;  1D5Y A;  3VOX A;  3FK7 A;  1AHD P;  1QVU A;  1X2M A;  3H0G J;  3P9T A;  1MH3 A;  3S2H J;  3PPB A;  3ON4 A;  4JL3 A;  1Q1V A;  2Y9Y A;  4A3L J;  5C4J J;  4UUS A;  3HGY A;  2DA4 A;  1Y1W J;  1ZKG A;  2XGD A;  3D1N I;  2DMU A;  4XK4 A;  4BY1 J;  3A01 A;  3BR5 A;  5E3M A;  2MGQ A;  2M0C A;  2X9D A;  5F0F A;  4B4C A;  1K61 A;  3BQY A;  2DMP A;  2XPW A;  3JRF A;  2NOG A;  1TC3 C;  3QPL A;  2DA6 A;  2UXP A;  3GTL J;  3GZI A;  3TW6 A;  5EGO B;  1WI3 A;  3JR9 A;  4M3E A;  4DZJ A;  2G3B A;  2COB A;  3HOU J;  2M34 A;  5EZH A;  3M4O J;  5GPA A;  2HXI A;  5E3N A;  2DMN A;  1JT0 A;  2UXO A;  2GFN A;  3O8H A;  2WV1 A;  4B1R A;  4IHY A;  3VVX A;  2D5V A;  2I10 A;  1ETV A;  5M5W J;  2E2I J;  3BTC A;  3S2D J;  4QTR A;  2HYJ A;  2AO9 A;  2HOA A;  5EFY A;  2DA1 A;  2JMW A;  2W48 A;  4JYK A;  2UXI A;  3IH4 A;  1A6I A;  1BJZ A;  1UG2 A;  2E2H J;  2GUH A;  3VP5 A;  3PO3 J;  3GTO J;  3TP3 A;  5DTD A;  3NRG A;  5CW8 A;  1U9O A;  2FQ4 A;  5E3O A;  3HOW J;  1Z0X A;  5EF6 A;  4A3K J;  2HI3 A;  3ZQC A;  1UHS A;  2ME0 A;  2YVH A;  2G7S A;  4ACI A;  2DA2 A;  2JK3 A;  2O7O A;  4IEJ A;  5BNG A;  3KKD A;  1JKR C;  1MNM C;  1F43 A;  5EGO A;  5M3F J;  2VKV A;  1RKT A;  1ENH A;  2R7Z J;  2TCT A;  1B72 B;  1GV5 A;  2O9L A;  1QVT A;  3JRA A;  2DJN A;  3HEF A;  4XIC A;  5EDN A;  3BTL A;  3CDL A;  5J1Y A;  3JRE A;  1JJ6 C;  4GFB A;  4A3C J;  1W0T A;  5HBU A;  2ECC A;  1SFO J;  1H88 C;  2KT0 A;  1JGG A;  2G0E A;  2HYT A;  2QTQ A;  2QIB A;  3SFI A;  2DMT A;  2R5Y A;  1OCP A;  1RKW A;  4UDS A;  2HDD A;  3GTG J;  5IPA A;  1RES A;  2VUM J;  3V78 A;  2MW8 A;  3S1Q J;  4YZE A;  5J1R A;  1GVD A;  2LD5 A;  3LSG A;  4LOC A;  3DPJ A;  1T56 A;  2DA5 A;  2Y31 A;  3VVY A;  2NS7 A;  3HB9 A;  3JRD A;  1VND A;  2R0Q C;  1Y1V J;  1H89 C;  3FIW A;  1MBG A;  4AC6 A;  1IUF A;  2LLK A;  2G7L A;  5JLW A;  4GFK A;  2HOS A;  3K7A J;  1QRY A;  2HQ5 A;  3BT9 A;  1JKQ C;  1PUF B;  5FKM A;  3I4M J;  2PZ9 A;  3ANG A;  3JRB A;  5CXI A;  4FTH A;  4JX4 A;  1ZK8 A;  3H3V K;  1BA5 A;  4QIW N;  1B72 A;  4GCK A;  3BG9 A;  1IRZ A;  2ID6 A;  2YVE A;  2JWT A;  2WB1 N;  3MVP A;  5IP7 J;  5IYC J;  4CYC B;  3GTK J;  1BW5 A;  2LVS A;  1FIP A;  1I3Q J;  3BG5 A;  3FRQ A;  3RD3 A;  5M5X J;  1RPW A;  1OJL A;  2CJJ A;  4J19 A;  2XPV A;  4JKZ A;  4A3B J;  1RR7 A;  1U9N A;  2N8G A;  2LTP A;  5IOZ A;  2NP3 A;  3PM1 A;  4Y52 J;  2Y9Z A;  2ME6 A;  2DG7 A;  3KNW A;  1CQT A;  2ZCX A;  5D18 A;  2O8K A;  4D5F A;  2B63 J;  2OER A;  3QKX A;  3CWR A;  2QOP A;  1BL0 A;  3B6C A;  5C4Y A;  1BW6 A;  1PUF A;  3JRG A;  5M5Y J;  1IG7 A;  3VIB A;  2FX0 A;  3MN2 A;  1HDD C;  1MBE A;  3BR6 A;  3MNL A;  2UXH A;  2Y30 A;  1X2N A;  2LKX A;  3DCF A;  3BG3 A;  2AHQ A;  4CYC A;  4C3H J;  3CRJ A;  2YU9 J;  2DN0 A;  2ZCN A;  4JNN A;  4A3I J;  3BQZ A;  2R92 J;  1DU6 A;  2L9R A;  4XRS A;  1GDT A;  2W53 A;  1LFU P;  1AU7 A;  1FIA A;  4MIM A;  3I4N J;  2P81 A;  3HBL A;  3WHC A;  3QBM A;  2ID3 A;  3VW2 A;  2ZB9 A;  2EZH A;  2K9S A;  3NI7 A;  2NVQ J;  1FJL A;  2QKO A;  3TED A;  1VI0 A;  1E3O C;  1EF4 A;  2GBY A;  5IYB J;  3IV5 A;  2OI8 A;  1TWG J;  3ZQH A;  3ZOB A;  2DG8 A;  3RKQ A;  1U8B A;  3PAS A;  3KZ9 A;  1JUM A;  3T6N A;  1AKH B;  2IAI A;  2RAE A;  2H8R A;  3GTJ J;  3GBG A;  5EYR A;  1WPK A;  4I76 A;  3NNR A;  3NAR A;  5EG0 B;  1F36 A;  2LR8 A;  2JA5 J;  3ZQI A;  3ON2 A;  2M8G X;  5FKL A;  3UKG A;  1GUU A;  2GEN A;  5JLX A;  4DYC A;  1ZTR A;  2EQR A;  5C44 J;  3OSF A;  2JA6 J;  2DA7 A;  3ANP A;  2MG4 A;  2Y2Z A;  1MSF C;  1MSE C;  3S1M J;  2L7F P;  1H8A C;  1ZGW A;  5K58 A;  5F08 A;  1ITY A;  5F27 A;  3FIS A;  3RZD J;  3S15 J;  5IYD J;  4RBO A;  3AQS A;  3BTI A;  4HNV A;  4DYR A;  4I6Z A;  1NK3 P;  2KDZ A;  3GTM J;  3L1P A;  4Y7N J;  4FE7 A;  5D19 A;  2CUF A;  4IHV A;  3GEU A;  5J1U A;  3K2A A;  1O4X A;  4HKU A;  1T33 A;  3VPR A;  4A3J J;  1AKH A;  5K7F A;  2CU7 A;  2G7G A;  2E19 A;  2LK2 A;  2X6O A;  3F0C A;  5EZG A;  4FIS A;  2WAQ N;  4W97 A;  4EEF G;  5EG0 A;  4MXM A;  4QSH A;  4RDU A;  3COL A;  1IDY A;  4X6A J;  5C3E J;  2NX4 A;  1LE8 B;  2ZOY A;  1WCM J;  4C2M J;  2GM4 A;  2RHA A;  2XGE A;  3HTA A;  3OIO A;  3BR2 A;  1MBK A;  1WH7 A;  1XC5 A;  2CQQ A;  3CQZ J;  4B3A A;  3JRI A;  4A3E J;  1XS9 A;  2JA8 J;  2NVT J;  4KWA A;  3LSR A;  5FMP A;  2VPR A;  5FLM J;  3AQT A;  4JP0 A;  3E7L A;  1SAN A;  1S7E A;  3HGG A;  3OSG A;  2ZCM A;  2YS9 A;  2JA7 J;  2D6Y A;  3HTI A;  3IH3 A;  2WUI A;  3TW7 A;  2FJ1 A;  3QQA A;  3ZQF A;  5HOD A;  4MFE A;  4M6V A;  2M9H A;  4XID A;  1SGM A;  3RH2 A;  2IU5 A;  2DA3 A;  2NP5 A;  2REK A;  1JUP A;  2NS8 A;  1DU0 A;  4MFD A;  3VW0 A;  4GCL A;  5M3M J;  2UXU A;  3BRU A;  1OFC X;  3ZQG A;  2R5Z B;  5C4X J;  3LWJ A;  3A02 A; 
#chains in the Genus database with same CATH topology
 4M6Y A;  3LFK A;  3F8B A;  2Q24 A;  5FLX Z;  1I5Z A;  1S5L C;  1B59 A;  3BCB A;  3WGH A;  1I6H J;  3WU0 A;  4RAY A;  1YJ9 I;  1W7P A;  2GIV A;  2ZJR F;  2K9Q A;  4KUM A;  2RN7 A;  3HOZ J;  2H8W A;  5J3L A;  2XAU A;  4ENN A;  1LE8 A;  1FYL A;  3WTT C;  4PFP A;  3VFZ A;  5B5E C;  3TO9 A;  3H9J A;  2GLO A;  2QWW A;  3TOB A;  2XGC A;  5DAJ A;  2K7L A;  3Q0V A;  1QPI A;  3ERE D;  3T8T A;  1MBH A;  4NBQ A;  1BIA A;  2LH9 A;  4G9Y A;  2V9P A;  2DOA A;  3B02 A;  1KON A;  3F6V A;  5B1B H;  1OPC A;  2BY3 A;  3ASN H;  2TRT A;  2F07 A;  3CCM I;  2F5E A;  2XDN A;  1WRJ A;  4HF0 A;  3R60 A;  1DP3 A;  2Y48 A;  5FKK A;  3VWB A;  3CC7 I;  3DU6 A;  4U7D A;  3IKT A;  4WCG A;  3KKC A;  3DEW A;  2ZXH A;  1GV2 A;  1G59 A;  1I6X A;  1UFM A;  3W6V A;  2CFX A;  4F93 B;  1TBX A;  4W1U A;  5HVQ C;  4YFK F;  2ECB A;  5L3G A;  4I2O A;  1XGO A;  4CIC A;  1DP7 P;  3NAU A;  2IS6 A;  2L9V A;  2XC7 A;  2DPU A;  1MBJ A;  1BN5 A;  5FD5 A;  1Y8R B;  2R7X A;  3FWE A;  1SFE A;  3G3Z A;  2DOD A;  2EZI A;  3HKZ N;  4F3Q A;  1UI5 A;  3D0S A;  3JRH A;  2ZME C;  1WH5 A;  5D5W B;  2EIK H;  3ZMU A;  3ROU A;  1I1G A;  2EA4 A;  2X4H A;  1UB9 A;  1SEU A;  1A5J A;  1KU3 A;  3U9G A;  4YEJ A;  2NVX J;  3K4M A;  2D1H A;  1VQ6 I;  4DBQ A;  1F5T A;  2CQX A;  2HZT A;  4M71 A;  5D5X B;  2K4J A;  3KYD B;  2LY9 A;  2H1K A;  3IL2 A;  3LA7 A;  1A04 A;  1O3T A;  1EH8 A;  3CUO A;  1BOA A;  3S14 J;  1MGT A;  2VJJ A;  3FK6 A;  4MK6 A;  4IVN A;  1U2W A;  5F04 A;  1K83 J;  1B8I B;  5D1R A;  3M1C A;  1LQ1 A;  4XKV A;  3G6E I;  4BY7 J;  1EKE A;  2XRO A;  2K40 A;  4HLX A;  4AC0 A;  3MKL A;  2Q8K A;  4LD5 A;  3V8K A;  1QZE A;  2OQR A;  3HOV J;  3T5X A;  3K6G A;  4D7N A;  3PQK A;  3WTW C;  5CVV A;  4F52 A;  1FYM A;  4NEL A;  1Z1D A;  4AU7 A;  3ABT A;  3CCY A;  2M8E A;  3A4C A;  3KP5 A;  4YIR X;  1VQM I;  5DM6 F;  1BI2 A;  4A3D J;  2DTZ A;  3N4M A;  5D6F A;  1JTX A;  3TDU C;  2V26 A;  1OR7 C;  3LQR A;  4D5C A;  2OU2 A;  4FX0 A;  4GDF A;  2R93 J;  1MH4 A;  4FAS D;  3H3Z A;  4A93 J;  2CUZ A;  3FXO A;  3JSO A;  4UY8 I;  1RI7 A;  4PSW A;  4A3F J;  1ERD A;  3Q3S A;  2IXS A;  1FC3 A;  2FU4 A;  2IA2 A;  2YX4 A;  2XAF A;  1IN4 A;  3LNQ A;  4PJ0 C;  1R00 A;  2EV5 A;  3BG6 A;  3Q0W A;  5D5U B;  2ELJ A;  2IGO A;  2P7V B;  1OCC H;  2EIN H;  4XQF A;  3HSR A;  3V8L A;  2DT7 B;  1YRN A;  1KA8 A;  2R7F A;  1X1D A;  2A6E F;  2A5W A;  2LY1 A;  1FTT A;  3C7J A;  5IP9 J;  2BXY A;  2VKE A;  2KHM A;  4DNC A;  3SJM A;  1HA8 A;  3F9K A;  2WAD A;  1WJA A;  3C18 A;  3MZ8 A;  1WI9 A;  5E3L A;  3RCO A;  4KMU X;  2KDO A;  3SZG A;  4C9Y A;  1D1C A;  4AIK A;  4PXI A;  1IUY A;  3L2Q A;  1JUS A;  4CZZ A;  4YIF A;  5F0H A;  2QKL B;  4ZJZ A;  1FEX A;  1WSU A;  4JK1 X;  4AUX A;  4FT8 A;  2EIM H;  4BEH B;  3H9G A;  4M3F A;  2MSY A;  3KZY A;  3T1B A;  3WTU C;  3KFW X;  1KU2 A;  3AL0 B;  3K4B A;  2XB5 A;  1T08 B;  3E6B A;  4CGR A;  4IO9 F;  1BJA A;  1HW5 A;  1TW3 A;  3HHG A;  5TIS C;  5CQG A;  3K2Z A;  3MZY A;  4ME9 A;  3ABM H;  4HNU A;  1FNN A;  2K9N A;  4DBR A;  3OYJ A;  3JTH A;  5J6X A;  1HSJ A;  2H6C A;  3MCZ A;  1OYI A;  2HKX A;  1IV8 A;  3FK7 A;  1QVU A;  4HOB A;  3K8P C;  3FXL A;  3WOD F;  3EUH A;  3PPB A;  1RZ4 A;  2R3S A;  2EV0 A;  4UUV A;  2Y9Y A;  2PI0 A;  4KMF A;  4RAZ A;  2CV1 A;  2KRH A;  4A3L J;  1N78 A;  5C4J J;  5LFA A;  4UUS A;  1HW2 A;  5D8L B;  3DKX A;  3D1N I;  1X1P A;  4BYY A;  1WJ5 A;  3BR5 A;  5E3M A;  2MGQ A;  3P9C A;  2KKO A;  2X9D A;  5F0F A;  5L3B A;  4IOC F;  1K61 A;  2NNY A;  2XRN A;  4BGD A;  3AG3 H;  3TGN A;  3U1K A;  4F55 A;  3J7A Y;  1HC8 A;  3H5N A;  2FJI 1;  1PDN C;  2BHZ A;  5EGO B;  2ISZ A;  3F23 A;  3F21 A;  3K4J A;  5ED4 A;  3HOU J;  5EZH A;  3M4O J;  5B66 C;  2GXG A;  2HXI A;  2DMN A;  3M8E A;  3VYU B;  4ENM A;  4IHY A;  1WJE A;  1ETV A;  2E2I J;  2HFH A;  3GXO A;  4KFC A;  3E1S A;  2IGN A;  4QTR A;  5JFR A;  1ZLK A;  2HOA A;  5IT9 K;  1K6O A;  2M1B A;  2JMW A;  3H0D A;  3V4G A;  2ZME A;  1A6I A;  1UG2 A;  2GUH A;  1FPQ A;  1XMX A;  3PO3 J;  1LJ9 A;  3KZZ A;  2PMU A;  3QWL A;  3PNV A;  5E3O A;  5FD6 A;  1E17 A;  4ZDO A;  2CWE A;  1YHQ I;  2IPQ X;  3V7S A;  3KYC B;  2FSW A;  3KZI C;  4HST A;  3JAM K;  3OWT A;  1VQ4 I;  2JK3 A;  3OYD A;  2O7O A;  4CH7 A;  3WTZ A;  1SVL A;  1NH3 A;  1A31 A;  5D4R A;  2NRA C;  3GUD A;  2PBI A;  1EJ9 A;  4HV5 A;  2MC3 A;  5EDN A;  3W6J B;  3CDL A;  5LEK A;  4HX4 A;  2KIS A;  1W0T A;  1SFO J;  2A61 A;  3W2V A;  5DDG A;  3CMM A;  1TQP A;  4CDG A;  5IPA A;  4PJN A;  3I55 I;  1T6S A;  3CDI A;  3S1Q J;  5DCF A;  4BS9 A;  2LD5 A;  2LOO A;  2DA5 A;  3GYH X;  2NS7 A;  2J5O A;  1KGS A;  2YU3 A;  3KLO A;  1MMN A;  3HJE A;  5CVR A;  2EIL H;  3ZMS A;  2KPM A;  3P7N A;  4RLF A;  5HDG A;  2G7L A;  3RPU D;  1O57 A;  3H5A A;  4GFK A;  1NG6 A;  1BI3 A;  5DCM A;  5DV5 A;  1PUF B;  3RPU A;  1P92 A;  3OYI A;  4M9Z A;  2B7E A;  1BIB A;  3OY9 A;  2BY1 A;  2QM3 A;  4FTH A;  5CXI A;  2DK8 A;  1MJA A;  4JX4 A;  3L2W A;  1ZK8 A;  4K2E A;  2WBM A;  3RKX A;  1B9M A;  2HZD A;  1B72 A;  3H3V K;  2V1D A;  2KIU A;  3BG9 A;  2YVE A;  3FXM A;  5IYC J;  2NAZ A;  2P5L C;  1X19 A;  1BI0 A;  3KP6 A;  2BGC A;  2DI3 A;  1I3Q J;  3VDX A;  3BG5 A;  1HKQ A;  2HTS A;  3RD3 A;  3TO6 A;  1RPW A;  1OJL A;  4JKZ A;  4A3B J;  1UHW A;  2NOJ B;  3CUQ A;  4P5O A;  3ZPL A;  2P0W A;  3FF5 A;  2HU9 A;  2PN6 A;  3WG7 H;  2FNP A;  3CCV I;  2D2W A;  2F2E A;  1OYY A;  1FMV A;  2TDX A;  2ME6 A;  3OYB A;  3KNW A;  1CQT A;  2ZCX A;  2O8K A;  2OER A;  3QKX A;  3CWR A;  4BJT A;  4NQW A;  4II2 A;  3JW4 A;  3B73 A;  4BHC A;  2XF7 A;  2ZNY A;  2ACJ A;  3QU6 A;  3JAM Z;  3ELK A;  3JRG A;  2FX0 A;  3PIO F;  1MBE A;  2NYX A;  3SYT A;  3AAF A;  2RGV A;  3DTE A;  2UXH A;  4L5J A;  3CCJ I;  5ILU A;  3JTG A;  3GZ5 A;  3IRQ A;  4C3H J;  2XUB A;  5F1R A;  2QGU A;  3LSM A;  2DK5 A;  4LB6 B;  4N9I A;  2WAE A;  3BCA A;  3N05 A;  2W53 A;  2V1U A;  4L9V A;  3HBL A;  4RGS A;  1WJD A;  2XHK A;  3QBM A;  2ZB9 A;  3NI7 A;  2VKD A;  1R5H A;  2M7B A;  1FJL A;  3S2W A;  2QKO A;  2OI8 A;  1MMA A;  5IYB J;  1XGS A;  4G7O F;  3ZOB A;  1U8B A;  4L0Z B;  3PAS A;  3FXK A;  1X1C A;  4ZTF A;  2X6Y A;  1FSE A;  4Y4R A;  4UVC A;  4WIB A;  2RAE A;  1FT9 A;  1X1B A;  2CW0 F;  3HTS B;  4ZYG A;  4G6Q A;  3OYM A;  1I1S A;  1ON1 A;  3KE2 A;  3DV8 A;  3EYI A;  1WZ2 A;  3GLX A;  5AIP A;  1OQY A;  3FDY A;  2XAH A;  3GFJ A;  2E7W A;  4YFN F;  3GFI A;  4IRI A;  2FBI A;  3G2B A;  3ANP A;  3NWT A;  1E2X A;  3HKZ A;  1VQL I;  3K70 C;  1MSE C;  2VBW A;  5JVT A;  1NK3 P;  4QWQ A;  5J47 A;  5E8I A;  1YLF A;  1F4K A;  3FXR A;  2JA2 A;  4Y7N J;  4FE7 A;  2HVQ A;  4IJA A;  2F6C A;  3SQN A;  1TNT A;  3GEU A;  1BM9 A;  4LG0 B;  1ZG1 A;  1LKX A;  1VQ8 I;  3BP8 A;  2IVM A;  5KAI C;  4CHU A;  2CSO A;  4HX7 A;  4CYD A;  3RKW A;  1G4D A;  2B3W A;  4KT6 A;  4II3 A;  2WAQ N;  2B0L A;  3MAJ A;  4RGX A;  4QSH A;  2F48 A;  3OYF A;  4X6A J;  5C3E J;  1LE8 B;  1WCM J;  3WGG A;  4HAM A;  3QU3 A;  2P6T A;  1BBY A;  3BR2 A;  2AXL A;  2CQQ A;  2NNN A;  3DXJ F;  2NVT J;  4KWA A;  2VPR A;  5J40 A;  1QHG A;  3GX4 X;  2BYV E;  5ERI A;  4IPA A;  3K4N A;  3MZH A;  1SAN A;  4XLF A;  2EV6 A;  2RVC A;  1S7E A;  4IRH A;  4D9J A;  3HGG A;  2D6Y A;  1JGS A;  2MBF A;  1DDN A;  3IH3 A;  1WQ2 A;  5B3S H;  2K27 A;  5HOD A;  4GGG A;  1IF1 A;  4LIV A;  2REK A;  2Q0O A;  2NS8 A;  1IRX A;  1DU0 A;  3ZR8 X;  2EWN A;  4P1W A;  2XAS A;  2Z3Y A;  1OFC X;  3LSK A;  2QA4 I;  3D5S C;  2B9S A;  1SMT A;  2ZCN A;  3BRO A;  1OCZ H;  1S3J A;  4KIF A;  4NDL A;  2VT3 A;  2ELH A;  3T8R A;  3HPG A;  2Z1D A;  4BE1 A;  5HDK A;  2F4O B;  2A6H F;  5L3F A;  2XSJ C;  1R1T A;  3S1R J;  4MHG A;  4M6X A;  3HOY J;  5DUK A;  1Z7U A;  4WXC A;  1R4N B;  4S04 A;  5HLI A;  2HVR A;  2P5K A;  3A2K A;  3U1D A;  3A01 B;  2L0K A;  4XRM A;  1V4R A;  3FKI J;  3M1E A;  2COM A;  3TDZ C;  1TWC J;  3VOK A;  1E3H A;  5D6E A;  5EEA A;  3CMY A;  3B81 A;  2Z99 A;  4L5E A;  3KIO A;  3FHN A;  2VI6 A;  1TL8 A;  4XN3 A;  4OMY A;  5D4S A;  3FXJ A;  2ISY A;  2OAZ A;  1IO2 A;  3G71 I;  2OQG A;  1XB4 A;  1OMI A;  3CJQ B;  5CVU A;  4RB3 C;  1WJB A;  2L4M A;  1FTZ A;  4NC6 A;  2FBH A;  1UST A;  2WV0 A;  3BC8 A;  2G9W A;  5KAF C;  4AF5 A;  3WE2 A;  1ON2 A;  4XLE A;  2WGB A;  1W1W E;  3HTJ A;  2NVY J;  5CXG A;  2LP0 A;  2STW A;  2RQQ A;  3WU2 C;  5FJ8 J;  3GTQ J;  4GCT A;  4KA4 A;  3CES A;  4BKX A;  4XLN F;  3J7Y J;  4HSR A;  1XSD A;  2OD5 A;  4MQ9 F;  4Q48 A;  3ONQ A;  4OIR F;  4C2T A;  1U78 A;  4HG2 A;  2XDV A;  3ZN1 A;  3GLL A;  1ETW A;  2VQH A;  2RNJ A;  5ILV A;  1IJW C;  3DBL B;  1GXP A;  2HS5 A;  5IP6 A;  2HXO A;  1Q1H A;  3EPZ A;  3H5R A;  4E7H A;  3I9V 2;  4AWX B;  2KLO A;  2PBX A;  4BXX J;  4PFO A;  4AID A;  4LJZ F;  3VUQ A;  3V8J A;  1POG A;  3A1Y A;  5HLH A;  1T8I A;  2XSD C;  4HDU A;  2OCE A;  5HS8 A;  3BPX A;  1LUJ B;  2E1O A;  1ETQ A;  2M2E A;  2PJR A;  3PL8 A;  1MJ9 A;  1YRN B;  3DQV C;  1T0F C;  1HCR A;  4A5N A;  2QSH X;  2ADU A;  4I09 A;  1SD5 A;  5CQE A;  3P5J A;  4CCM A;  2HOT A;  4IF4 A;  5DM7 F;  3PO2 J;  5JVG F;  4IRV A;  1SAU A;  3O8G A;  1UZC A;  4KT5 C;  3LOC A;  3FX3 A;  5E8G A;  3IC7 A;  2KJB A;  2YX7 A;  4AYB N;  4C2U A;  1MMS A;  2BOL A;  4BBS J;  3TO7 A;  2LKS A;  1TZL A;  4E7S A;  5HAW A;  1QNT A;  3TOA A;  4EJO A;  4M73 A;  3TP0 A;  4Y15 A;  4OAY A;  3LSJ A;  4O3M A;  1ZH5 A;  4M72 A;  4FX4 A;  1V54 H;  2IS2 A;  3HTH A;  3K1M A;  3I4P A;  2L9N A;  4JX5 A;  4ESJ A;  4CCN A;  5J4Y A;  1OCR H;  1X1A A;  4ANJ A;  3W2W A;  4ICH A;  2YUS A;  3ISP A;  3DU5 A;  4ESF A;  2P6S A;  4U9N A;  2OBP A;  2ZJP F;  2JZY A;  1JHF A;  1R9T J;  2AQF A;  3FMS A;  1ZQ3 P;  4EAT A;  1J5Y A;  4EM2 A;  2IEK A;  1JT6 A;  2EFO A;  3DKW A;  1XMK A;  3M7G A;  1YI2 I;  1IV6 A;  4WF2 A;  4A3M J;  4FCY A;  4C3I J;  1U8R A;  1NK2 P;  1ZG5 A;  5IY5 H;  4BH9 A;  2X1D A;  3I0T A;  3S3N A;  3E6D A;  2BW3 A;  1SFK A;  2MA3 A;  1KYZ A;  4L62 A;  2FBQ A;  2RKH A;  1XCV A;  1ZAO A;  2OCC H;  3K1P A;  4C30 A;  3VB2 A;  3CC2 I;  4UUS B;  4XNF A;  4AVZ A;  3BZC A;  3HIF A;  5FKN A;  4FE4 A;  2DAO A;  1ORK A;  2WC2 A;  3EUH C;  3EUP A;  3L2C A;  1JKP C;  3IAM 2;  1HF0 A;  2ZOZ A;  2QSF X;  3BJB A;  2C6Y A;  3MD2 A;  3I3L A;  4V2F A;  1X4P A;  2BY0 A;  1V5G A;  3DPU A;  5H2F C;  4I01 A;  3DEU A;  1TP4 A;  3ZQL A;  2DXI A;  2LF8 A;  3GWZ A;  3S3O A;  1APL C;  4V19 K;  3LJL A;  4GCV A;  5KVR A;  1WGX A;  3KEY A;  4EM1 A;  3OYG A;  2KZG A;  3EET A;  3LL7 A;  1YIT I;  3RQI A;  3ZXS A;  3OS1 A;  2H94 A;  1KQ9 A;  3P9T A;  1X2M A;  3BPV A;  3IRR A;  2ZME B;  4YFX F;  3V7C A;  4M9X A;  5JI6 A;  1YS6 A;  3HYI A;  2GQQ A;  4PGH A;  1ZN2 A;  2HTJ A;  3IP4 B;  3WU1 B;  1I3A A;  5E1W A;  4U0W A;  2LSO A;  2DMU A;  4XK4 A;  3A01 A;  2RNG A;  3F72 A;  1YG2 A;  4IL6 C;  3J81 K;  2DMP A;  4IZZ A;  3T0Y A;  4IRG A;  1QO0 D;  2EFN A;  3LWF A;  3GZI A;  3K10 A;  3H35 A;  5GAD J;  3E6M A;  2G3B A;  1M1E B;  4XLC A;  1SFX A;  2M34 A;  3OS0 A;  4DIQ A;  1JT0 A;  2ZXW H;  4LG3 A;  3O8H A;  1SC7 A;  1LFP A;  2A3S A;  2I10 A;  2RV8 A;  4OMZ A;  2K02 A;  1KZH A;  4MEX F;  2V79 A;  5J8C A;  2DOF A;  2HDC A;  3BTC A;  3S2D J;  1ZHF A;  3PSI A;  3TQN A;  5EFY A;  4KN4 X;  3GF2 A;  1TT0 A;  2A05 A;  4JYK A;  3IH4 A;  2E2H J;  3VP5 A;  2YPR A;  1GLN A;  3GTO J;  4RGR A;  2PG4 A;  3K9T A;  3DPL C;  4ZYA A;  3MMY B;  5DTD A;  3FZV A;  3HHH A;  1ZRD A;  1ACI A;  1U9O A;  4PUS A;  2K3P A;  2NS0 A;  2VXZ A;  5EF6 A;  3GO5 A;  2HI3 A;  2HR3 A;  2ZFU A;  4HW0 A;  1YE9 A;  3R61 A;  5LEJ A;  3ZQC A;  2JPC A;  5DCM B;  2QUF A;  3H36 A;  1IXR C;  2G7S A;  4ACI A;  2YVH A;  2DA2 A;  1QGP A;  1Z6T A;  3I71 A;  2Q1Z B;  5CPR B;  2LRD A;  4A6E A;  3VSK A;  5M3F J;  2ZJQ F;  1DUX C;  1ENH A;  3ZMT A;  2TCT A;  1XSX A;  1B72 B;  2R7Z J;  1AOY A;  1GV5 A;  4XL9 A;  1QVT A;  5DEQ A;  5BQT A;  4XIC A;  3BTL A;  4BL0 B;  2YVX A;  2M4K A;  1USS A;  3ULQ B;  2F4M B;  5J1Y A;  4HEA 2;  5HBU A;  3BJA A;  4BQA A;  1WFX A;  4A2U A;  3TMO A;  2QIB A;  3SFI A;  1T0F A;  2DMT A;  1IAW A;  2LYC A;  4RAG A;  3GTG J;  1YYV A;  1RES A;  3BLY A;  2Z5U A;  3SFZ A;  2VUM J;  3V78 A;  4YZE A;  3CUQ B;  3ABU A;  3ZP5 A;  3P9K A;  5EEG A;  2G7H A;  1EV7 A;  3HSF A;  3VYT B;  3DPJ A;  3CJR B;  3H9Q A;  4ENJ A;  2Y31 A;  3HRU A;  2VJ4 A;  3JRD A;  1MKM A;  2AXT C;  4PJL A;  5CJ9 A;  1FBQ A;  1XX5 A;  2X6X A;  1H9T A;  1BC7 C;  1RUN A;  1IUF A;  2L02 A;  2LLK A;  3VSL A;  3IWF A;  4NQW B;  5JLW A;  3CUQ C;  2HOS A;  3FBN B;  2D1V A;  2BBY A;  2HQ5 A;  2LG4 A;  5F6F A;  5FKM A;  3J81 Z;  2WAQ A;  3I4M J;  2PZ9 A;  1PYV A;  4NC7 A;  3REO A;  3JRB A;  3HTU A;  4R8H A;  3ZCO A;  4O6J A;  2E5N A;  2VE9 A;  4U0V A;  1RNL A;  3MFK A;  4QIW N;  3L2R A;  4N9H A;  1IRZ A;  4A6D A;  2WB1 N;  4IQJ A;  3JSP A;  2OC6 A;  4ZDL A;  3GTK J;  4LGW A;  5LGN A;  2X1E A;  2O3F A;  4P96 A;  2JRM A;  3HRT A;  5M5X J;  1J75 A;  1K4S A;  2GWR A;  2CFO A;  4N4O B;  1YQA A;  4HQE A;  5IOZ A;  3IWZ A;  3RI4 A;  4XKB A;  2BVM A;  1SD6 A;  2M5W A;  1QZY A;  3OYN A;  2B63 J;  3EQL F;  4D5F A;  3M8F A;  1BL0 A;  4RS8 A;  1P9Q C;  5FFZ A;  2JQ7 A;  1VQO I;  4MQV A;  4Q4Z F;  1IRG A;  1D0X A;  3E97 A;  3FMQ A;  2CGP A;  2XAG A;  2RRE A;  1U5T A;  3BR6 A;  2V6E A;  1R1U A;  1IN5 A;  2DFE A;  4KNY A;  1PP7 U;  2Y30 A;  1TNS A;  4KJZ A;  2W82 A;  1D1A A;  2Q2E B;  2IRF G;  2AHQ A;  4CYC A;  3CRJ A;  4JNN A;  2DN0 A;  2LF7 A;  2W1O A;  4HX8 A;  1T39 A;  3QAH A;  4IXA A;  1YIJ I;  1U3E M;  1LFU P;  2V1X A;  1FIA A;  4MIM A;  2DYR H;  3VEP A;  3OYC A;  3LAJ A;  2ID3 A;  3VW2 A;  2K9S A;  2NVQ J;  3UNG C;  4NB5 A;  3L7W A;  4LLL A;  3TED A;  1E3O C;  3GCM A;  1EF4 A;  1CF7 A;  1IRF A;  2L54 A;  3RKQ A;  1WVR A;  1BR2 A;  3KZ9 A;  2K5C A;  3E5Q A;  1LEB A;  3ERM A;  1ZAR A;  1YX3 A;  3NQO A;  2IAI A;  2H8R A;  4JQF A;  3GTJ J;  2OUM A;  2HKO A;  3GBG A;  2IS4 A;  3KEO A;  5EYR A;  1T95 A;  2A5Y B;  2QQ9 A;  2L01 A;  4H0E A;  2M4G A;  1FP2 A;  3KCC A;  4LFU A;  3RTR A;  2LMD A;  4QLC U;  2LR8 A;  3MWM A;  4XLP F;  2JA5 J;  2M8G X;  5FKL A;  3UKG A;  4HV6 A;  3LAP A;  3CCL I;  2EQR A;  1WWX A;  2DA7 A;  1R49 A;  1LVK A;  2Y2Z A;  3RPQ A;  3PFY A;  1YJN I;  4CZC A;  5K58 A;  5F27 A;  3FIS A;  3AQS A;  1MW7 A;  3BTI A;  4HNV A;  4DYR A;  1SD7 A;  2DLL A;  2VC1 A;  1LNW A;  2VOP A;  3CJN A;  4HPQ A;  5TGT A;  3FBI B;  2R7T A;  2GIZ A;  1SVO A;  3K2A A;  4DOZ A;  4HKU A;  4L0Y B;  1AKH A;  2CQN A;  2CU7 A;  2E19 A;  5BPD A;  2LK2 A;  3IKV A;  1FY7 A;  2VIX A;  5D5V B;  2ZBK A;  3FM5 A;  4FIS A;  5AIQ A;  4MXM A;  2GAU A;  4FHT A;  4RDU A;  1IDY A;  2NX4 A;  1S72 I;  4C2M J;  2RHA A;  2XGE A;  5EEH A;  3OIO A;  3ZQ7 A;  4A3E J;  5FMP A;  3HXL A;  3LSR A;  3OYK A;  3AQT A;  2QQ8 A;  3L00 A;  5KCM A;  2JVG A;  4IHT A;  2YS9 A;  2IS1 A;  3F6O A;  1O3Q A;  2EK5 A;  1P4X A;  3ZQF A;  4RB0 A;  4AYB A;  5LHI A;  4MFE A;  2VL8 A;  2M30 A;  2M9H A;  4LLG F;  1SGM A;  2IU5 A;  2VJI A;  3KPH A;  1JUP A;  3VW0 A;  4GCL A;  3CC4 I;  1J9I A;  3ZQG A;  5C4X J;  3WGI A;  2DYS H;  4EGY A;  2IA1 A;  3I64 A;  2RAS A;  1HXD A;  1I27 A;  4AD9 A;  3E7Q A;  3HOS A;  2LNB A;  2CQK A;  1R5G A;  1MBF A;  1YO5 C;  2JPB A;  1ONV A;  3RIR A;  4PDK A;  2W24 A;  1ZR2 A;  4XRS G;  3R0A A;  4ZC3 A;  2WY7 Q;  1XG1 A;  4BJ6 C;  3BCG A;  1K6Y A;  4CUG A;  3I56 I;  4HLY A;  1D3Y A;  1SAX A;  1QA6 A;  3HIM A;  4J00 A;  4JBA A;  2O7T A;  1G2H A;  3S16 J;  3QPH A;  3HDD A;  1MDM A;  5HS7 A;  2EJR A;  5HLT A;  4BHP A;  1XGN A;  2ETH A;  4KIT B;  1LVA A;  1MNE A;  2R7S A;  1HKT A;  5L3D A;  1IC8 A;  1X58 A;  2QVO A;  2E1N A;  1D1B A;  4ITV A;  4QPO A;  4HYE A;  3SEQ A;  1LDJ A;  3BWG A;  5K5Q A;  3GW2 A;  4Q47 A;  3OIP A;  1RUO A;  4HRI A;  1OCT C;  1UMQ A;  3VW1 A;  3Q0U A;  5F1J A;  3VYR B;  4DJA A;  1ODD A;  5JR3 A;  4LIU A;  4UV8 A;  3CO6 C;  1Z05 A;  2DT6 A;  3S3M A;  5HNF A;  2OA4 A;  3OYE A;  3HL2 A;  4N4N B;  3JRC A;  1NTC A;  2P4W A;  2PJR B;  3DPT A;  3TL4 X;  3OYL A;  3CDH A;  3LFU A;  2EZL A;  1VTN C;  3CTA A;  3FMR A;  1XDU A;  4A3G J;  1D0Y A;  4X1E A;  2FXA A;  3DP7 A;  2QBY A;  4BQQ A;  2A2F X;  1AA7 A;  2UXN A;  2EFQ A;  4E7L A;  1YJW I;  3S17 J;  1XD7 A;  1RIO H;  1UI6 A;  2M87 A;  3KP3 A;  3ML6 A;  2HPM A;  4PJJ A;  1W36 D;  4Q5S F;  3C2B A;  1S6L A;  1ZYR F;  2V9V A;  1JKO C;  4YRV A;  1UCR A;  2Q2E A;  4OIN F;  1GT0 C;  5HS9 A;  4GFL A;  1ZG3 A;  4ZYE A;  3M8J A;  4PGG A;  1Z9C A;  2XKP A;  3E5X A;  3WTV C;  1K78 B;  2LKP A;  4EM0 B;  3FM3 A;  3LHQ A;  5HSZ A;  2R5Y B;  1REP C;  1MD0 A;  2JN6 A;  4L9N A;  1IGN A;  1VQ7 I;  3FXQ A;  3GVA A;  4MO7 A;  5HDN A;  1U0J A;  3A03 A;  3ZGK A;  2MH2 A;  2XAQ A;  4GO1 A;  5F64 A;  2P7C B;  2CO5 A;  1IDZ A;  2MAB A;  1MMG A;  4QPQ A;  2E1C A;  3S1N J;  3C07 A;  5FGM A;  2WTE A;  3EUK L;  1TWA J;  3BR3 A;  3NRV A;  3J7Z I;  4IHX A;  4YEL A;  3VVZ A;  1ETK A;  1ZRF A;  1FSH A;  1I50 J;  2HWV A;  2R7V A;  1PP8 F;  1X3U A;  2UUZ A;  4BQN A;  1IXS B;  1J0R A;  2XAJ A;  2OPT A;  2VPL A;  2BW3 B;  1XGM A;  4DZP A;  4TV7 A;  1FX7 A;  2K85 A;  1K79 A;  4ZZD A;  1FYK A;  1IN8 A;  2OV7 A;  5FKO A;  4R1H A;  2HKU A;  3OOU A;  1Z7L A;  5TRD A;  4CCK A;  4P55 A;  3D5L A;  3LMM A;  3HPH A;  3PFI A;  2AQE A;  1ZRE A;  4OD5 A;  2LBF A;  3SZT A;  2CV0 A;  2BZT A;  4ABZ A;  1DGW Y;  3HRS A;  4NHJ A;  2ZJ2 A;  4XOR A;  4EJW A;  4GYI A;  1RET A;  4LB5 A;  3OL4 A;  1MND A;  4NN1 A;  1NG7 A;  5KNL A;  2BV6 A;  4UVA A;  5H6Q A;  4B47 A;  3HOT A;  4CCL A;  3BR0 A;  3WTS C;  3GEZ A;  3CCE I;  2A6T A;  1ZR4 A;  1BR4 A;  3M3Y J;  5K7H A;  5HNH A;  1V55 H;  1FOY A;  1G8X A;  3BHQ A;  3BJO A;  1ETO A;  4BAC A;  1HLV A;  4PSX A;  3NXC A;  2L5Q A;  3IAS 2;  4BBR J;  1RR8 C;  4BDZ A;  1Z91 A;  3F8M A;  1YFH A;  2QEN A;  3CP2 A;  1JTY A;  3E0J B;  3CJD A;  4U88 A;  4M3B A;  3BR1 A;  4J01 A;  4GYG A;  4RMN A;  2XGX A;  1ZLJ A;  5LD2 C;  1ETY A;  1GVJ A;  1P4W A;  5H20 A;  3BTJ A;  2H1L A;  2FF4 A;  3TBI A;  2ICW G;  3L09 A;  2QCO A;  2E5Z A;  1BOB A;  5AQC A;  1GXQ A;  1TQI A;  1H9G A;  4A0Z A;  4XSX F;  2VJ5 A;  2WB1 A;  4YII A;  5F0C A;  2VQL A;  5GPC A;  3ECO A;  3LSI A;  1D5Y A;  3VOX A;  2X85 A;  3H0G J;  1MH3 A;  2PLY A;  4I0A A;  2V7F A;  2ZCW A;  2VB6 A;  4XM3 A;  1VQP I;  4G8X A;  3L2V A;  4DGW B;  1Q1V A;  2L2O A;  2HQN A;  2Y0M A;  2DJI A;  1Y39 A;  5IT3 A;  1Y1W J;  1S29 A;  2HPI A;  1BC8 C;  1R6R A;  5E17 F;  1ZKG A;  2XGD A;  2Y69 H;  4BY1 J;  4U9L A;  2MLK A;  2M0C A;  5J8F A;  2ESN A;  2W00 A;  4B4C A;  3BQY A;  1KU7 A;  2XPW A;  1TC3 C;  1AWC A;  1LDD A;  2DA6 A;  5DYM A;  2Z2S B;  4KIS A;  3EDP A;  3OYH A;  4XLH A;  3GTL J;  1UHM A;  1O3R A;  1R7J A;  1WI3 A;  3JR9 A;  4M3E A;  2DFF A;  4DVY P;  4XKC A;  5GPA A;  2XKO A;  4P9F A;  5E3N A;  4A0Y A;  4B1R A;  2VBX A;  3VVX A;  2NVU B;  3OS2 A;  2GA1 A;  3RKY A;  3OYA A;  2L4A A;  5FRM A;  2X1C A;  2DTR A;  2XV4 S;  4BDY A;  4EJU A;  3ZMZ A;  3RQ4 A;  2W48 A;  5JHU A;  1BJZ A;  2BEO A;  5HOO A;  4D0P A;  4U0Y A;  3LA2 A;  3TP3 A;  4BHB A;  1YW7 A;  4P9U A;  2F5C A;  4E7K A;  1S7O A;  2FQ4 A;  4RB1 A;  4EJT A;  1MIJ A;  4XON A;  3ZN0 A;  2Z33 A;  2I5U A;  3SEZ A;  4A3K J;  2E34 A;  2O61 A;  2UV1 A;  3OOP A;  4XSZ F;  4HF1 A;  1FBU A;  1I39 A;  4RA2 A;  1F9N A;  2MYS A;  5BNG A;  1WJC A;  3FXU A;  3KKD A;  1STZ A;  1MNM C;  2E60 A;  1X3Z B;  3RDI A;  1HW1 A;  3BOQ A;  2XIG A;  3A0H C;  1N77 A;  3I5U A;  4F91 B;  3HZJ A;  2O9L A;  3K4L A;  3JRA A;  3HEF A;  1YW9 A;  1JJ6 C;  2MH9 A;  3AKZ A;  4GFB A;  4FQG A;  1JGG A;  1H88 C;  4PK4 A;  4B48 A;  2HYT A;  1K78 A;  2DQL A;  3ABK H;  3C2G A;  5KHD A;  2E36 A;  2BHY A;  2R5Y A;  1OCP A;  1PJR A;  4ZDP A;  4JOM A;  3CF2 A;  1PVE A;  2DT5 A;  1V3F A;  3LSG A;  1A35 A;  5D8K B;  4ETS A;  3VVY A;  1T98 A;  2IP2 A;  5GTI C;  3U21 A;  2NXN B;  2W84 A;  1EA3 A;  2YR2 A;  1D5V A;  1MBG A;  5BMZ A;  1Z67 A;  2JVH A;  2O03 A;  1P6R A;  2HDW A;  3QYB A;  2V9K A;  4N0B A;  4UB6 C;  4WXD A;  5H6R A;  3CCQ I;  3CZ6 A;  3DFG A;  1ZGJ A;  1QRY A;  4CA0 A;  4WWC A;  4MTE A;  3ZMV A;  2ZFW A;  5EJC A;  4LIT A;  3N97 A;  2K86 A;  5DD4 A;  3ANG A;  1U5T B;  4NUB A;  5A2Q Z;  4RAF A;  3EUA A;  1ZEL A;  4F7Z A;  4CGZ A;  1V5F A;  2QKM B;  3BZK A;  1IN7 A;  1SVM A;  3HUG A;  1J7K A;  4B44 A;  3Q5F A;  3J80 K;  4UHT A;  1H0M A;  2VON A;  2JWT A;  3MVP A;  4X0G A;  5FHP A;  1B6A A;  4CYC B;  3K4C A;  4AVP A;  3WTY C;  2KJC A;  2PMZ A;  2RDP A;  1U5T C;  2KZV A;  5FB2 A;  1BW5 A;  1FIP A;  1W7P D;  2PFB A;  3QP5 A;  2HQA A;  4EQQ A;  2GA2 A;  3TKY A;  2CJJ A;  2JSC A;  4J19 A;  2IW5 A;  2ZKZ A;  2R4G A;  4AIH A;  2IGM A;  1TW2 A;  3F8C A;  2N8G A;  1OCO H;  2LTP A;  1CF7 B;  1BR1 A;  1YIO A;  2A68 F;  1O7F A;  3O2P E;  4Y17 A;  2Y9Z A;  1ZGA A;  2H6B A;  1QHH D;  3X2Q H;  2FOK A;  2OZ6 A;  1R58 A;  4XN0 A;  4RGU A;  2RQP A;  4DQ2 A;  1WJF A;  2UXX A;  3CO7 C;  4ZZL A;  4OOI A;  2JT1 A;  1BW6 A;  3LA3 A;  4B8X A;  2QYO A;  1IG7 A;  4CCJ A;  1HDD C;  3MNL A;  1TLH B;  4BXF A;  3WTX C;  5J4V A;  2B1E A;  3HRM A;  4HF2 A;  4RLQ A;  4S05 A;  4LLN A;  2FEZ A;  3DCF A;  2YU9 J;  1FWZ A;  1G3Y A;  4A3I J;  1DU6 A;  2L9R A;  1GHC A;  3K0L A;  1AU7 A;  3I59 A;  1Z3Y A;  3I4N J;  2V6C A;  3WHC A;  5FRN A;  2VBY A;  5LRS A;  5LLQ A;  4I7H A;  2BE5 F;  1VI0 A;  2GBY A;  5DUI A;  5K1Y A;  1TWG J;  3A0B C;  3HG9 A;  2JUC A;  3OR1 C;  3MKY B;  2DG8 A;  1KYW A;  2CQ7 A;  4XR6 A;  5JHF A;  1W5S A;  3AG4 H;  3M07 A;  4XBF A;  3CCR I;  4OIO F;  1AKH B;  2M3A A;  5ICF A;  2VC0 A;  3CP8 A;  3RYP A;  1Y0N A;  2CS3 A;  2DDA A;  3VOE A;  3OL3 A;  2W57 A;  2JSP A;  1QBJ A;  1U6G A;  1Y6I A;  2GOX B;  4I76 A;  3COA C;  2VAS A;  4E4H A;  4E7Z A;  1BI1 A;  2MD5 A;  3ZQI A;  3ON2 A;  3EYY A;  2A69 F;  5JLX A;  1ZTR A;  3J80 Z;  5HLG A;  5C44 J;  3F8N A;  3O6B B;  1XN7 A;  1G3S A;  1MSF C;  2L7F P;  4M9S A;  5GAG J;  1ZGW A;  5F08 A;  1VZ0 A;  1ITY A;  3ZQQ A;  3RZD J;  3S15 J;  4RBO A;  1FLI A;  2Z9O A;  4I6Z A;  3MEX A;  4BQO A;  3MKZ A;  1J09 A;  3KP7 A;  4KIG A;  2DPD A;  3LQQ A;  2QEX I;  4Y13 A;  2CUF A;  5E20 A;  2AS5 F;  4IHV A;  2P8T A;  1FMW A;  4YG2 F;  3VPR A;  4CO8 A;  2XVC A;  2ZSI B;  3AFH A;  2X6O A;  5E1X A;  1R36 A;  3F0C A;  5EZG A;  3QRF F;  5TJJ A;  4BUP A;  4EEF G;  5EG0 A;  4HDV A;  1D0Z A;  3E5U A;  2PEX A;  2ZOY A;  3JCU C;  2WWY A;  4ZTJ A;  4HNT A;  1MJB A;  3DEE A;  3W6K B;  1MDM B;  2CMP A;  1XC5 A;  3JRI A;  2JA8 J;  1VQN I;  3FKJ A;  2VT2 A;  2FMY A;  3CLQ A;  4Y3O A;  4JP0 A;  3E7L A;  4EMS A;  2GZW A;  1P2F A;  2M7A A;  3I58 A;  3OSG A;  2ZY9 A;  2ZCM A;  3SZP A;  4ZYD A;  4IHS A;  2FJ1 A;  3QQA A;  4UB8 C;  1MZB A;  5E1Z B;  3S93 A;  3RYR A;  1EH7 A;  3RH2 A;  1CGP A;  4MEY F;  2ZSH B;  1IXC A;  4RB2 C;  4MFD A;  5M3M J;  4F92 B;  1FZP B;  1A36 A;  2OTJ I;  3BDD A;  4CXF A;  2UXU A;  3LWJ A;  2JUG A;  3KEQ A;  3MKW B;  2PX9 A;  3DF8 A;  2Y75 A;  2GOM A;  2DQR A;  2X48 A;  3NPI A;  3F1B A;  1HQC A;  3G1L A;  4G12 A;  2K9M A;  1XMA A;  4S0H B;  1HBX G;  3OV8 A;  1OYW A;  2HYF A;  4MLO A;  1TTY A;  1QQI A;  2EIJ H;  3PNY A;  3S8P A;  2HNH A;  3SDG A;  4B43 A;  3JSJ A;  1XDS A;  2QBY B;  2DCE A;  2FBK A;  2F5F A;  3SWH A;  3O60 A;  5FFX A;  2F4I A;  2XF6 A;  3E3V A;  5H9T A;  2DDB A;  2E2J J;  3BNI A;  2H09 A;  2XRL A;  3V6G A;  2QQA A;  2L9S A;  1Z77 A;  2KRF A;  3IH2 A;  4LK1 F;  3G73 A;  4XRF A;  1LFB A;  3VTI A;  4IOA F;  2CRG A;  4MTD A;  1P4A A;  3QOD A;  1K7A A;  1HOM A;  2LRE A;  2VBZ A;  2KIQ A;  2XB0 X;  5LHH A;  1VF9 A;  2J5P A;  3CLO A;  3DBH B;  4OWR B;  3C3W A;  3C1D A;  4ESB A;  2R5Z A;  5GAE J;  3IUV A;  1SMY F;  5CVJ A;  3ZRG A;  2L7Z A;  1Y56 A;  1IW7 F;  4IKF A;  2PFV A;  1Z21 A;  4WX9 A;  4C3J J;  3AL0 C;  3CF5 F;  2KMU A;  4EV0 A;  3WG9 A;  1W36 C;  3HM5 A;  5IOY A;  4IHW A;  4L9J A;  2OJE D;  2VXD A;  4ENK A;  4U7B A;  3G7R A;  3WHB A;  4M3G A;  1KQ0 A;  4I02 A;  3O3K A;  4NC8 A;  1R5I D;  2F5D A;  3GZN B;  1K4T A;  3ASO H;  2D45 A;  3PQJ A;  2Y0S N;  2IBD A;  3BZ6 A;  4BAY A;  2IT0 A;  1J59 A;  3DTK A;  2FD5 A;  3GTP J;  3L9F A;  2HQR A;  2CUJ A;  3RSN A;  1P7I A;  5ILS A;  3PSF A;  5FLV A;  1DPR A;  2QF7 A;  4OAZ A;  2R7D A;  2VKH A;  5B1A H;  4BE0 A;  1YX5 A;  2FQ3 A;  2LBF B;  1RC9 A;  2E71 A;  1HST A;  2W4S A;  1S9H A;  2ELK A;  2IGK A;  3I54 A;  3OMY A;  3DTI A;  4M3D A;  4XOT A;  1HDP A;  4ASN A;  1O3S A;  2EZK A;  1Z6R A;  1FOW A;  3GFL A;  1G6N A;  4L18 B;  5K7Z A;  3V42 A;  3CME I;  3S5R A;  1DQU A;  2LFB A;  4E7I A;  3K1N A;  3J7A O;  1ETX A;  3RZO J;  4AM3 A;  3G56 A;  3RJP A;  2H27 A;  4EJV A;  2E1M B;  4LK0 F;  3QP6 A;  4V2G A;  3CCU I;  1JJ8 C;  2KIM A;  4D7M A;  1JE8 A;  2E35 A;  2EBI A;  3F3X A;  5LGT A;  2QQB A;  1UJ8 A;  3DLA A;  1W0U A;  4XKW A;  2ZNZ A;  4E6K G;  1TWH J;  3QYF A;  2E1M C;  2L7M P;  2CUE A;  1IZ1 A;  3G1O A;  2ZXI A;  1S8N A;  2PMZ N;  3H1C A;  4I0B A;  4G7H F;  2QWT A;  2XPU A;  3C2H A;  3ECH A;  3LSP A;  2EH3 A;  1Y8Q B;  3PIP F;  2GXB A;  2VOD A;  3F8F A;  4JX6 A;  1B8I A;  1PUE E;  2EB7 A;  4B3X A;  3GFM A;  2R7O A;  3R6S A;  1XSV A;  2V1N A;  3OR2 C;  4RM2 A;  2DU9 A;  4A69 C;  1V5E A;  1YTY A;  2LC2 A;  4KDP A;  2KQR A;  5L3C A;  3PJR A;  2MFZ A;  2KIF A;  1OR7 A;  3HOX J;  3H92 A;  1VFC A;  1B1B A;  1P7J A;  2JJ7 A;  3BJ6 A;  1Y0U A;  3EGQ A;  5LHG A;  4OIQ F;  4DW6 A;  2A07 F;  5GP9 A;  4DYQ A;  1G3W A;  1NHA A;  3KP4 A;  1JHH A;  1E3P A;  3E6C C;  1YS7 A;  5LBQ A;  1N75 A;  5L3E A;  3G4S I;  4L5I A;  2X51 A;  3AG2 H;  3ZMD A;  5FGL A;  2IA0 A;  2DMQ A;  5LRR A;  4D1Q A;  2V57 A;  2BXZ A;  2OF7 A;  4XMY A;  4UUT A;  3B6A A;  5CVI A;  5DS9 A;  5IT9 Z;  2L7K A;  4PCQ A;  2M45 A;  1X3W B;  2W25 A;  1LEA A;  2JTV A;  1TWF J;  3SDB A;  4KYW A;  9ANT A;  2W85 A;  3QPS A;  2BY2 A;  2HVS A;  3IUO A;  1YW8 A;  3G1M A;  4LMY A;  2E7X A;  1LDK B;  2RC4 A;  3DLL F;  1JI8 A;  3HE0 A;  1R22 A;  1TQM A;  1AHD P;  1KQ8 A;  3WE3 A;  3S2H J;  2EA2 A;  3OIQ A;  1L0O C;  4NNJ A;  2KP6 A;  1F1Z A;  1L3L A;  3ON4 A;  4JL3 A;  5LGU A;  4H4K C;  3AG1 H;  1XTA A;  2F5V A;  3HGY A;  2DA4 A;  2QSG X;  1FBS A;  2I8D A;  4HZF A;  5ICG A;  2WY8 Q;  2YSR A;  2EPF A;  5K5O A;  3CD6 I;  4BEH A;  3JRF A;  2CH0 A;  2NOG A;  3QPL A;  3V7R A;  3KET A;  1B4A A;  2FRH A;  2UXP A;  3TW6 A;  5E79 C;  1QU3 A;  1N25 A;  4DZJ A;  3KLN A;  3NS4 A;  2COB A;  2DFH A;  2QZ8 A;  1SD4 A;  5CYV A;  2UXO A;  2GFN A;  5K5R A;  2WV1 A;  1Z3X A;  2D5V A;  4PJM A;  5M5W J;  2FOW A;  3QPT A;  2HYJ A;  1B9N A;  1D8K A;  2AO9 A;  2CW8 A;  2ZO4 A;  3S32 A;  2DA1 A;  2P5V A;  4A5M A;  2UXI A;  3CMA I;  3DBR B;  3VYS B;  3FHZ A;  2CV2 A;  4UVB A;  3NWS A;  2M0M A;  5BOX A;  1D8J A;  2FNA A;  3NRG A;  5ICE A;  1XPX A;  4XLA A;  5ICC A;  1SFU A;  2MLG A;  5CW8 A;  4I98 B;  4XOP A;  1Z0X A;  3K4K A;  3HOW J;  2O5R A;  2VE8 A;  3W3C A;  1FOK A;  1TT5 B;  4KIC A;  1UHS A;  2ME0 A;  1VQK I;  3CCS I;  4IEJ A;  3LST A;  1OKR A;  1JKR C;  1F43 A;  2VN2 A;  5EGO A;  1RRJ A;  1WKM A;  2VKV A;  1RKT A;  5KK1 A;  3HUG B;  2DJN A;  5CKT A;  2VLA A;  2CYY A;  1UAA A;  4BU2 A;  3PUB A;  3DWL E;  4M74 A;  3JRE A;  5BS6 A;  4A3C J;  5GTH C;  2ECC A;  5DD8 A;  2KT0 A;  2G0E A;  2VQC A;  4OU0 A;  2QTQ A;  2ESH A;  1RKW A;  4UDS A;  3HC7 A;  2HDD A;  1OLT A;  1W7P B;  4EGZ A;  2MW8 A;  1QZZ A;  5J1R A;  1GVD A;  4GRI A;  4CCO A;  2OTL I;  4OD4 A;  3DKY A;  3SHF A;  4LOC A;  2ZXJ A;  4G94 A;  1T56 A;  2KRC A;  3QYE A;  4R79 A;  2O0Y A;  3HB9 A;  1VND A;  2LDU A;  2R0Q C;  1Y1V J;  5CLS A;  1H89 C;  4A0X A;  3FIW A;  4EVI A;  2EFW A;  1FP1 D;  6PAX A;  4AC6 A;  1R4M B;  2ZC2 A;  4WXH A;  2KL4 A;  3K7A J;  3BT9 A;  4GXO A;  1JKQ C;  2X0L A;  1E0E A;  1R23 A;  1R1V A;  3QOE A;  1BA5 A;  3CJT B;  3KX2 A;  4GCK A;  2DOE A;  4PZJ A;  2ID6 A;  5IP7 J;  4KN7 X;  2EFP A;  3GME A;  1W5T A;  2FUG 2;  2LVS A;  2R7W A;  3KP2 A;  3UR3 C;  3M9A A;  2VOO A;  3FRQ A;  3PUF A;  3I59 B;  2STT A;  3HSE A;  5BPI A;  2XPV A;  2IJL A;  1RR7 A;  1YOV B;  2L3D A;  2O8X A;  3QOP A;  1U9N A;  4WK8 F;  4Z6Y A;  2KFD A;  2NP3 A;  3SXY A;  4UXN A;  2MD0 A;  2HOE A;  3PM1 A;  4BNC A;  5GAH J;  4Y52 J;  2DG7 A;  3MQ0 A;  3GZ6 A;  3ESW B;  2QOP A;  3B6C A;  2Z16 A;  2QLZ A;  5C4Y A;  4CSW A;  1PUF A;  5M5Y J;  2R7Q A;  3VIB A;  3MN2 A;  4MNU A;  2FA5 A;  1EH6 A;  2W7N A;  3BY6 A;  4G6T B;  1ZRC A;  1X2N A;  2LKX A;  2G7U A;  4AIJ A;  2X6W A;  2BVL A;  3BG3 A;  4UNO A;  4G7Z F;  4ZH4 F;  4O5V A;  4ON0 A;  3BQZ A;  2R92 J;  1VQ5 I;  1OIS A;  3BG7 A;  3NEU A;  1HKS A;  4XRS A;  1GDT A;  1QPM A;  2FML A;  2K3F A;  2DBB A;  2P81 A;  5A2Q K;  2EZH A;  3R0J A;  3P9I A;  4L9T A;  3IV5 A;  3ZQH A;  1C0W A;  3U2R A;  2UZK A;  1JUM A;  1LPQ A;  1JXS A;  5FLX K;  3T6N A;  3ABL H;  4IQ4 A;  2HYG D;  1UEL B;  2PJP A;  1KU9 A;  3KYL A;  1WPK A;  2O6G E;  1DPU A;  3NAR A;  3PNT A;  5EG0 B;  2VQG A;  3NNR A;  4KIB A;  5E18 F;  1F36 A;  2R7U A;  4I99 C;  4HA8 A;  2R7R A;  3IHU A;  2CG4 A;  2CW7 A;  1GUU A;  2OZU A;  2GEN A;  2LY2 A;  4DYC A;  1WHU A;  3OSF A;  2JA6 J;  2MG4 A;  3LSH A;  4FET A;  1J2X A;  3S1M J;  1H8A C;  2Y0S A;  3D5R C;  4B09 A;  4U87 A;  5IYD J;  3H3U A;  1S7A A;  2K9L A;  1XCB A;  3R4K A;  4A12 A;  5FO5 A;  2KDZ A;  2WAF A;  4E70 A;  4E7J A;  3L1P A;  4OIP F;  3GTM J;  4HQM A;  2DFI A;  3Q9S A;  1FOX A;  1R71 A;  5D19 A;  4RM3 A;  2FE3 A;  4HBL A;  5J1U A;  2WA0 A;  1T2K A;  2HGC A;  1O4X A;  1LB2 A;  1W4M A;  1T33 A;  4A3J J;  5K7F A;  3Q9V A;  2G7G A;  3I53 A;  2HEO A;  2JRT A;  4ZYH A;  3K70 D;  4BJ5 C;  4W97 A;  4C2M A;  3COL A;  2PQ8 A;  5AON A;  2PMH A;  3K69 A;  2GM4 A;  2XF5 A;  1IN6 A;  1G3T A;  3HTA A;  1MBK A;  1WH7 A;  3CQZ J;  3L2U A;  4BE2 A;  4B3A A;  3W2A A;  5D18 A;  1XS9 A;  4UV9 A;  1O7L A;  4G6D A;  3VOD A;  1W5C C;  4BXU A;  5FLM J;  3F22 A;  2UWM A;  1VQ9 I;  1UG0 A;  2V4J C;  2JA7 J;  3HTI A;  2GXA A;  5FRO A;  1X4O A;  2WUI A;  2DO7 A;  3TW7 A;  4Y33 A;  4M6V A;  2DW4 A;  4XID A;  4Z2Y A;  2DA3 A;  2NP5 A;  2K4B A;  2MC4 A;  4MGR A;  1DGR M;  1A6Q A;  1T38 A;  2R5Z B;  3BRU A;  4LG0 A;  1MMD A;  4IX7 A;  3A02 A;  1ULY A; 
#chains in the Genus database with same CATH homology
 2RAS A;  2Q24 A;  4NDL A;  2X48 A;  1I6H J;  3E7Q A;  3F1B A;  3NPI A;  1MBF A;  3G1L A;  4G12 A;  4S0H B;  2K9Q A;  1ZR2 A;  4XRS G;  3HOZ J;  1XG1 A;  3BCG A;  5FHP A;  5J3L A;  3S1R J;  3HIM A;  4MLO A;  1LE8 A;  3HOY J;  2O7T A;  1G2H A;  3S16 J;  3HDD A;  3SDG A;  3JSJ A;  2GLO A;  2XGC A;  5DAJ A;  3Q0V A;  1QPI A;  1MBH A;  3A01 B;  3O60 A;  2L0K A;  5H9T A;  4XRM A;  2E2J J;  3BNI A;  3FKI J;  1IC8 A;  1X58 A;  2XRL A;  3V6G A;  1TWC J;  3VOK A;  2TRT A;  2F07 A;  5EEA A;  2XDN A;  1Z77 A;  3IH2 A;  3CMY A;  3B81 A;  4L5E A;  1LFB A;  2CRG A;  2VI6 A;  1HOM A;  5FKK A;  2XB0 X;  1VF9 A;  2R5Z A;  1OCT C;  1UMQ A;  3DEW A;  3KKC A;  3VW1 A;  3Q0U A;  1GV2 A;  3IUV A;  3W6V A;  5F1J A;  2L7Z A;  4C3J J;  4W1U A;  3HM5 A;  2ECB A;  5IOY A;  4IHW A;  1FTZ A;  3G7R A;  3NAU A;  1MBJ A;  1NTC A;  4M3G A;  3WHB A;  3JRC A;  4AF5 A;  2WGB A;  2EZL A;  2EZI A;  2NVY J;  3HTJ A;  4A3G J;  5CXG A;  3HKZ N;  4X1E A;  2LP0 A;  1UI5 A;  5FJ8 J;  3JRH A;  3GTQ J;  1WH5 A;  4GCT A;  2Y0S N;  4BKX A;  2IBD A;  3S17 J;  1A5J A;  2FD5 A;  3GTP J;  1UI6 A;  2NVX J;  1P7I A;  3C2B A;  1U78 A;  1ETW A;  2CQX A;  1JKO C;  5FLV A;  1IJW C;  2QF7 A;  5IP6 A;  1GT0 C;  4GFL A;  2LY9 A;  2H1K A;  2HXO A;  2PBX A;  4BXX J;  2R5Y B;  2ELK A;  3LHQ A;  3S14 J;  5HSZ A;  2JN6 A;  3FK6 A;  4MK6 A;  1IGN A;  5F04 A;  1K83 J;  4M3D A;  1B8I B;  4MO7 A;  1HDP A;  1POG A;  5D1R A;  3VUQ A;  2EZK A;  3A03 A;  2XSD C;  4BY7 J;  2E1O A;  2K40 A;  1ETQ A;  2M2E A;  3MKL A;  4AC0 A;  1YRN B;  5K7Z A;  1HCR A;  3HOV J;  1IDZ A;  3S5R A;  2LFB A;  3S1N J;  3C07 A;  1ETX A;  4D7N A;  2HOT A;  1TWA J;  3BR3 A;  4IHX A;  3PO2 J;  3RZO J;  3G56 A;  3VVZ A;  3O8G A;  1ETK A;  4V2G A;  3LOC A;  1I50 J;  1JJ8 C;  4D7M A;  4NEL A;  2EBI A;  4AYB N;  4BBS J;  3CCY A;  2OPT A;  4DZP A;  1W0U A;  4A3D J;  2DTZ A;  5HAW A;  1JTX A;  1TWH J;  4D5C A;  3TP0 A;  2L7M P;  5FKO A;  3LSJ A;  3OOU A;  2CUE A;  2HKU A;  3G1O A;  2R93 J;  3HTH A;  2PMZ N;  1MH4 A;  2QWT A;  4JX5 A;  4A93 J;  2XPU A;  4A3F J;  4ABZ A;  3Q3S A;  3LSP A;  2EH3 A;  4ICH A;  3LNQ A;  1RET A;  4JX6 A;  1B8I A;  3Q0W A;  2YUS A;  4NN1 A;  3BR0 A;  4A69 C;  1YRN A;  1R9T J;  1ZQ3 P;  1ZR4 A;  1FTT A;  2IEK A;  1JT6 A;  5IP9 J;  3M3Y J;  2VKE A;  5K7H A;  1IV6 A;  4A3M J;  3HOX J;  4FCY A;  4C3I J;  3SJM A;  1NK2 P;  1VFC A;  3BHQ A;  1P7J A;  2JJ7 A;  1ETO A;  1HLV A;  3EGQ A;  3NXC A;  5E3L A;  4DW6 A;  4BBR J;  5GP9 A;  4L62 A;  4DYQ A;  2FBQ A;  4PXI A;  1JUS A;  4UUS B;  1JTY A;  5F0H A;  3CJD A;  5FKN A;  4M3B A;  1FEX A;  3BR1 A;  4FE4 A;  1ORK A;  4AUX A;  3EUP A;  5FGL A;  1JKP C;  1HF0 A;  1ETY A;  2ZOZ A;  4M3F A;  2DMQ A;  2MSY A;  3BTJ A;  3BJB A;  2V57 A;  2OF7 A;  4V2F A;  4UUT A;  3B6A A;  2QCO A;  5DS9 A;  2XB5 A;  5AQC A;  4CGR A;  3ZQL A;  1APL C;  3LJL A;  1TWF J;  9ANT A;  4ME9 A;  3QPS A;  1WGX A;  5F0C A;  2K9N A;  5GPC A;  3RQI A;  3G1M A;  3HE0 A;  1D5Y A;  3VOX A;  3FK7 A;  1AHD P;  1QVU A;  1X2M A;  3H0G J;  3P9T A;  1MH3 A;  3S2H J;  3PPB A;  3ON4 A;  4JL3 A;  1Q1V A;  2Y9Y A;  4A3L J;  5C4J J;  4UUS A;  3HGY A;  2DA4 A;  1Y1W J;  1ZKG A;  2XGD A;  3D1N I;  2DMU A;  4XK4 A;  4BY1 J;  3A01 A;  3BR5 A;  5E3M A;  2MGQ A;  2M0C A;  2X9D A;  5F0F A;  4B4C A;  1K61 A;  3BQY A;  2DMP A;  2XPW A;  3JRF A;  2NOG A;  1TC3 C;  3QPL A;  2DA6 A;  2UXP A;  3GTL J;  3GZI A;  3TW6 A;  5EGO B;  1WI3 A;  3JR9 A;  4M3E A;  4DZJ A;  2G3B A;  2COB A;  3HOU J;  2M34 A;  5EZH A;  3M4O J;  5GPA A;  2HXI A;  5E3N A;  2DMN A;  1JT0 A;  2UXO A;  2GFN A;  3O8H A;  2WV1 A;  4B1R A;  4IHY A;  3VVX A;  2D5V A;  2I10 A;  1ETV A;  5M5W J;  2E2I J;  3BTC A;  3S2D J;  4QTR A;  2HYJ A;  2AO9 A;  2HOA A;  5EFY A;  2DA1 A;  2JMW A;  2W48 A;  4JYK A;  2UXI A;  3IH4 A;  1A6I A;  1BJZ A;  1UG2 A;  2E2H J;  2GUH A;  3VP5 A;  3PO3 J;  3GTO J;  3TP3 A;  5DTD A;  3NRG A;  5CW8 A;  1U9O A;  2FQ4 A;  5E3O A;  3HOW J;  1Z0X A;  5EF6 A;  4A3K J;  2HI3 A;  3ZQC A;  1UHS A;  2ME0 A;  2YVH A;  2G7S A;  4ACI A;  2DA2 A;  2JK3 A;  2O7O A;  4IEJ A;  5BNG A;  3KKD A;  1JKR C;  1MNM C;  1F43 A;  5EGO A;  5M3F J;  2VKV A;  1RKT A;  1ENH A;  2R7Z J;  2TCT A;  1B72 B;  1GV5 A;  2O9L A;  1QVT A;  3JRA A;  2DJN A;  3HEF A;  4XIC A;  5EDN A;  3BTL A;  3CDL A;  5J1Y A;  3JRE A;  1JJ6 C;  4GFB A;  4A3C J;  1W0T A;  5HBU A;  2ECC A;  1SFO J;  1H88 C;  2KT0 A;  1JGG A;  2G0E A;  2HYT A;  2QTQ A;  2QIB A;  3SFI A;  2DMT A;  2R5Y A;  1OCP A;  1RKW A;  4UDS A;  2HDD A;  3GTG J;  5IPA A;  1RES A;  2VUM J;  3V78 A;  2MW8 A;  3S1Q J;  4YZE A;  5J1R A;  1GVD A;  2LD5 A;  3LSG A;  4LOC A;  3DPJ A;  1T56 A;  2DA5 A;  2Y31 A;  3VVY A;  2NS7 A;  3HB9 A;  3JRD A;  1VND A;  2R0Q C;  1Y1V J;  1H89 C;  3FIW A;  1MBG A;  4AC6 A;  1IUF A;  2LLK A;  2G7L A;  5JLW A;  4GFK A;  2HOS A;  3K7A J;  1QRY A;  2HQ5 A;  3BT9 A;  1JKQ C;  1PUF B;  5FKM A;  3I4M J;  2PZ9 A;  3ANG A;  3JRB A;  5CXI A;  4FTH A;  4JX4 A;  1ZK8 A;  3H3V K;  1BA5 A;  4QIW N;  1B72 A;  4GCK A;  3BG9 A;  1IRZ A;  2ID6 A;  2YVE A;  2JWT A;  2WB1 N;  3MVP A;  5IP7 J;  5IYC J;  4CYC B;  3GTK J;  1BW5 A;  2LVS A;  1FIP A;  1I3Q J;  3BG5 A;  3FRQ A;  3RD3 A;  5M5X J;  1RPW A;  1OJL A;  2CJJ A;  4J19 A;  2XPV A;  4JKZ A;  4A3B J;  1RR7 A;  1U9N A;  2N8G A;  2LTP A;  5IOZ A;  2NP3 A;  3PM1 A;  4Y52 J;  2Y9Z A;  2ME6 A;  2DG7 A;  3KNW A;  1CQT A;  2ZCX A;  5D18 A;  2O8K A;  4D5F A;  2B63 J;  2OER A;  3QKX A;  3CWR A;  2QOP A;  1BL0 A;  3B6C A;  5C4Y A;  1BW6 A;  1PUF A;  3JRG A;  5M5Y J;  1IG7 A;  3VIB A;  2FX0 A;  3MN2 A;  1HDD C;  1MBE A;  3BR6 A;  3MNL A;  2UXH A;  2Y30 A;  1X2N A;  2LKX A;  3DCF A;  3BG3 A;  2AHQ A;  4CYC A;  4C3H J;  3CRJ A;  2YU9 J;  2DN0 A;  2ZCN A;  4JNN A;  4A3I J;  3BQZ A;  2R92 J;  1DU6 A;  2L9R A;  4XRS A;  1GDT A;  2W53 A;  1LFU P;  1AU7 A;  1FIA A;  4MIM A;  3I4N J;  2P81 A;  3HBL A;  3WHC A;  3QBM A;  2ID3 A;  3VW2 A;  2ZB9 A;  2EZH A;  2K9S A;  3NI7 A;  2NVQ J;  1FJL A;  2QKO A;  3TED A;  1VI0 A;  1E3O C;  1EF4 A;  2GBY A;  5IYB J;  3IV5 A;  2OI8 A;  1TWG J;  3ZQH A;  3ZOB A;  2DG8 A;  3RKQ A;  1U8B A;  3PAS A;  3KZ9 A;  1JUM A;  3T6N A;  1AKH B;  2IAI A;  2RAE A;  2H8R A;  3GTJ J;  3GBG A;  5EYR A;  1WPK A;  4I76 A;  3NNR A;  3NAR A;  5EG0 B;  1F36 A;  2LR8 A;  2JA5 J;  3ZQI A;  3ON2 A;  2M8G X;  5FKL A;  3UKG A;  1GUU A;  2GEN A;  5JLX A;  4DYC A;  1ZTR A;  2EQR A;  5C44 J;  3OSF A;  2JA6 J;  2DA7 A;  3ANP A;  2MG4 A;  2Y2Z A;  1MSF C;  1MSE C;  3S1M J;  2L7F P;  1H8A C;  1ZGW A;  5K58 A;  5F08 A;  1ITY A;  5F27 A;  3FIS A;  3RZD J;  3S15 J;  5IYD J;  4RBO A;  3AQS A;  3BTI A;  4HNV A;  4DYR A;  4I6Z A;  1NK3 P;  2KDZ A;  3GTM J;  3L1P A;  4Y7N J;  4FE7 A;  5D19 A;  2CUF A;  4IHV A;  3GEU A;  5J1U A;  3K2A A;  1O4X A;  4HKU A;  1T33 A;  3VPR A;  4A3J J;  1AKH A;  5K7F A;  2CU7 A;  2G7G A;  2E19 A;  2LK2 A;  2X6O A;  3F0C A;  5EZG A;  4FIS A;  2WAQ N;  4W97 A;  4EEF G;  5EG0 A;  4MXM A;  4QSH A;  4RDU A;  3COL A;  1IDY A;  4X6A J;  5C3E J;  2NX4 A;  1LE8 B;  2ZOY A;  1WCM J;  4C2M J;  2GM4 A;  2RHA A;  2XGE A;  3HTA A;  3OIO A;  3BR2 A;  1MBK A;  1WH7 A;  1XC5 A;  2CQQ A;  3CQZ J;  4B3A A;  3JRI A;  4A3E J;  1XS9 A;  2JA8 J;  2NVT J;  4KWA A;  3LSR A;  5FMP A;  2VPR A;  5FLM J;  3AQT A;  4JP0 A;  3E7L A;  1SAN A;  1S7E A;  3HGG A;  3OSG A;  2ZCM A;  2YS9 A;  2JA7 J;  2D6Y A;  3HTI A;  3IH3 A;  2WUI A;  3TW7 A;  2FJ1 A;  3QQA A;  3ZQF A;  5HOD A;  4MFE A;  4M6V A;  2M9H A;  4XID A;  1SGM A;  3RH2 A;  2IU5 A;  2DA3 A;  2NP5 A;  2REK A;  1JUP A;  2NS8 A;  1DU0 A;  4MFD A;  3VW0 A;  4GCL A;  5M3M J;  2UXU A;  3BRU A;  1OFC X;  3ZQG A;  2R5Z B;  5C4X J;  3LWJ A;  3A02 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...