1Z77A

Crystal structure of transcriptional regulator protein from thermotoga maritima.
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
200
structure length
200
Chain Sequence
b'MLSKRDAILKAAVEVFGKKGYDRATTDEIAEKAGVAKGLIFHYFKNKEELYYQAYMSVTEKLQKEFENFLMKNRNRDIFDFMERWIEKKLEYSASHPEEADFLITLVSVDEGLRKRILLDLEKSQRVFFDFVREKLKDLDLAEDVTEEIALKFLMWFFSGFEEVYLRTYQGKPELLKRDMNTLVEEVKVMLRILKKGMTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords transcriptional regulator (TetR family)
publication title Crystal structure of a transcriptional regulator TM1030 from Thermotoga maritima solved by an unusual MAD experiment.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transcription
total genus 71
structure length 200
sequence length 200
ec nomenclature
pdb deposition date 2005-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1z77A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 1z77A02
1T33A 2UXUA 3VOXA 3S15J 3G56A 1ETQA 2LFBA 3S1MJ 2ME6A 3JSJA 1RPWA 4A3BJ 1TC3C 4ACIA 1RKWA 4M6VA 1P7JA 4FISA 3LSGA 2ID6A 2OERA 3F1BA 3BHQA 4QSHA 1AKHA 5F1JA 3G1OA 4DYRA 2HYJA 5C4JJ 1K61A 1X2MA 1IG7A 3GTGJ 1PUFB 3I4MJ 4A3FJ 4DZJA 3GTJJ 2QIBA 3SFIA 3BJBA 2DMTA 3G1LA 3HTHA 1JTXA 1H88C 1AU7A 3NI7A 3ZQIA 1LE8B 2NS7A 5CW8A 4FCYA 2DA6A 2FBQA 2GENA 5E3OA 1GVDA 3WHBA 4BBRJ 1POGA 1VFCA 3LJLA 1MNMC 1H89C 1HDDC 5EF6A 5M5XJ 3AQSA 3VVXA 2DA1A 1BW6A 3HOVJ 2JK3A 3JREA 2KT0A 2QCOA 1YRNA 1MBFA 3HKZN 1SGMA 3LSRA 1HLVA 2XGCA 3UKGA 2G3BA 3A01A 2W53A 3L1PA 5IPAA 3IH3A 4BY1J 3ZQGA 1MBEA 3LSJA 1SANA 1OCTC 4ME9A 4DYCA 5BNGA 2JJ7A 1G2HA 3VW2A 1Y1WJ 2CUFA 4JX5A 1ENHA 2X9DA 5C3EJ 1SFOJ 5IP9J 2YUSA 2L0KA 4X6AJ 2UXPA 3HOXJ 1VI0A 2EQRA 1IC8A 1GV5A 3MN2A 3S2HJ 2VUMJ 2WUIA 1Q1VA 2YVEA 2M9HA 1XG1A 4JX4A 3A02A 2XDNA 1JT6A 2QKOA 5EG0A 1F36A 4A93J 3BRUA 3GTLJ 1I3QJ 4MXMA 3BT9A 1VF9A 2HYTA 3I4NJ 3ANGA 2NP3A 2WV1A 1B72B 5DTDA 3F0CA 3JR9A 5M5WJ 3M4OJ 3O8GA 4D5FA 5DS9A 3CRJA 1JKQC 1MBHA 2XPWA 3JRFA 3GTOJ 2RHAA 2LR8A 3VW0A 1ZK8A 1IUFA 3BG3A 3TP0A 4L5EA 1IGNA 2WGBA 5E3LA 2DMQA 5IOZA 1BA5A 3PPBA 3V78A 5IYDJ 2LK2A 4I76A 5M5YJ 2F07A 2LLKA 1GUUA 2O9LA 3JRAA 2LY9A 3S5RA 2RAEA 1QRYA 1YRNB 1HDPA 2MGQA 2D6YA 3HB9A 3K7AJ 4UUSB 1OFCX 4J19A 1MH4A 1LFUP 3PO3J 3B6CA 3MNLA 2Y30A 4AYBN 2HQ5A 2R0QC 1JUSA 1I6HJ 2E19A 1GDTA 2AHQA 1E3OC 5GP9A 1CQTA 5IP7J 3HEFA 3ZQCA 1A5JA 2M34A 5EFYA 5FKKA 2WB1N 3BQZA 2R5ZA 5EZHA 4IHVA 4ICHA 2K9QA 4YZEA 2MW8A 4HNVA 3TEDA 3GTMJ 3SJMA 5C4YA 2EZIA 5J3LA 1ZKGA 4JX6A 3IV5A 2XSDC 3VOKA 5FKLA 3RZDJ 1WCMJ 4Y7NJ 1HCRA 1P7IA 3HTAA 1BW5A 4A3DJ 3FK6A 2Y0SN 1IV6A 1FJLA 2MSYA 2RASA 3PASA 3MVPA 3QPSA 1JKPC 2E1OA 3BCGA 4JNNA 1RETA 1K83J 2DN0A 2XGDA 5C4XJ 3GTKJ 5J1RA 5D18A 1RR7A 4BXXJ 2EH3A 3HE0A 2DG7A 1H8AC 1NTCA 1UMQA 4B1RA 5K58A 3OOUA 5EEAA 1OCPA 1X58A 4CYCA 2HI3A 4ABZA 5HODA 4I6ZA 5AQCA 4IHWA 2IU5A 1FIAA 2Y2ZA 5M3FJ 3O60A 4GFKA 2QWTA 3CCYA 5J1YA 4NELA 4PXIA 4IEJA 2HOSA 1JUMA 1ZTRA 4D7NA 2VI6A 4GCLA 2N8GA 4RBOA 3CWRA 2COBA 3Q0UA 2CUEA 3RZOJ 4DW6A 3BR1A 2R5YB 3LWJA 3LNQA 2GFNA 1X2NA 3G7RA 3CMYA 2UXHA 4XIDA 2HDDA 5EGOB 3S17J 3LSPA 2Y9ZA 3ON2A 4BY7J 5FKMA 2VPRA 3S1QJ 4A3EJ 4MLOA 2E2JJ 3O8HA 2LKXA 4GCTA 3FISA 3ZOBA 3AQTA 5FLVA 2DA7A 2H8RA 2XB5A 2PZ9A 2K9NA 3D1NI 2GLOA 4NN1A 4L62A 5H9TA 1TWHJ 3Q0WA 4NDLA 2GBYA 1ZGWA 5F0CA 1MBGA 3BTJA 4D7MA 5IYCJ 3HOWJ 5HAWA 2MG4A 2DJNA 4GFBA 1JTYA 4JYKA 2LD5A 4A3MJ 1S7EA 1U78A 3GTPJ 4G12A 3OSFA 1ETOA 1W0TA 2HXIA 2K40A 1BJZA 1AKHB 2B63J 3E7QA 1ZQ3P 4M3BA 2L7FP 2HOTA 1W0UA 4FTHA 1A6IA 5EZGA 1U8BA 4IHXA 3ZQHA 3OSGA 3DPJA 2CJJA 4Y52J 2O7OA 1I50J 4C3JJ 1TWCJ 3TW7A 1WH5A 2KDZA 5D19A 2Q24A 4M3EA 4M3GA 3H3VK 2K9SA 2IEKA 2VKEA 2NVTJ 4XK4A 5F0HA 2NX4A 3KZ9A 3BQYA 2OPTA 2CRGA 2NOGA 3CDLA 1BL0A 2E2HJ 3BR0A 3BG5A 2XPUA 2NVXJ 3QPLA 1IRZA 1JJ8C 3NPIA 1ORKA 2FD5A 2ZOYA 4XRSG 2JN6A 1LFBA 1TWAJ 3TP3A 1QPIA 2ZCMA 4A3KJ 3BR2A 1WI3A 4V2FA 1ITYA 4MFDA 3A01B 5C44J 5D1RA 3VVZA 1JKOC 4GCKA 3P9TA 1RKTA 4A3JJ 4AC6A 2HXOA 1MBKA 2QOPA 4GFLA 3TW6A 3A03A 1MSFC 4JKZA 3HDDA 3COLA 2OI8A 2LTPA 2EBIA 4DYQA 3B6AA 1PUFA 2G7SA 2HKUA 1Z77A 3HOYJ 5K7ZA 1MSEC 2DTZA 1LE8A 4QTRA 1MBJA 4W97A 5DAJA 4D5CA 2PBXA 2UXOA 3B81A 1HOMA 4JL3A 3HOUJ 5HBUA 4AC0A 1HF0A 2D5VA 4XRMA 2QF7A 5F08A 3HOZJ 5F04A 5EG0B 2X48A 5K7HA 1UI6A 3RH2A 4RDUA 3HBLA 3ON4A 1VNDA 5JLWA 2JWTA 2NS8A 2Y31A 3QQAA 2DA3A 3JRIA 2O7TA 3HGYA 4B3AA 3K2AA 1ETVA 4LOCA 3VW1A 1D5YA 1APLC 2H1KA 3LOCA 1GV2A 1IJWC 2EZLA 4B4CA 3HIMA 2HOAA 5HSZA 1UG2A 3BR5A 2JA8J 3CJDA 2FX0A 2CQQA 3NXCA 2DMPA 2GM4A 2P81A 3G1MA 2YU9J 4QIWN 2LVSA 1WH7A 1ZR4A 4A3IJ 4C3IJ 2ECBA 2O8KA 2TRTA 1FTZA 1JGGA 5IP6A 1MH3A 1QVTA 4XICA 1U9OA 3W6VA 2Y9YA 1GT0C 2LP0A 2XGEA 2XPVA 4A3CJ 1ETWA 4AF5A 1B8IA 2UXIA 1NK3P 3VP5A 2YVHA 3V6GA 2M2EA 1WGXA 4FE4A 5F27A 3BTCA 1JUPA 3WHCA 4XRSA 3Q3SA 2QTQA 3SDGA 4V2GA 2R5ZB 3T6NA 2L9RA 2TCTA 3JRHA 4M3DA 1WPKA 4C3HJ 3VPRA 1B72A 2L7MP 1XS9A 4FE7A 3CQZJ 5E3NA 3S16J 1ETYA 4UUTA 1DU6A 2IBDA 2CU7A 1ZR2A 1UHSA 3DEWA 2DMUA 3HTJA 4IHYA 3NAUA 3DCFA 1AHDP 2R92J 1NK2P 2R7ZJ 1TWGJ 2FJ1A 3C2BA 3IUVA 2NVYJ 2XRLA 4DZPA 5JLXA 1EF4A 3FRQA 4HKUA 3RKQA 5FGLA 2ID3A 2OF7A 4X1EA 2ECCA 4UUSA 3BR3A 4MFEA 2GUHA 3S14J 1DU0A 2JA6J 4M3FA 3ANPA 1IDYA 5E3MA 3QBMA 3FK7A 5FLMJ 3HGGA 2NP5A 3NRGA 3BTIA 5CXGA 3JRBA 1FEXA 4BBSJ 4CYCB 4CGRA 2ZCXA 4KWAA 2DA2A 3BTLA 3KKCA 2REKA 4AUXA 5IOYA 3QKXA 3GTQJ 2CQXA 2X6OA 5FKNA 2EZKA 4W1UA 5GPAA 5FHPA 2M8GX 2XB0X 3ZQFA 3ZQLA 1ETXA 5CXIA 5EDNA 5FMPA 3NNRA 1B8IB 2DG8A 1OJLA 2EZHA 4C2MJ 1IDZA 5F0FA 3BNIA 2W48A 2WAQN 5M3MJ 3LHQA 4MO7A 3NARA 2E2IJ 5GPCA 2I10A 1RESA 4JP0A 4A3LJ 1QVUA 2ZCNA 2ELKA 1TWFJ 3Q0VA 1Z0XA 4EEFG 3PO2J 3IH4A 3S2DJ 3KKDA 4MK6A 3VIBA 9ANTA 1T56A 3EGQA 3RD3A 2NVQJ 2AO9A 2G7LA 2M0CA 2R93J 2IAIA 5EYRA 2G0EA 3FKIJ 1FIPA 5FKOA 2VKVA 3S1RJ 3OIOA 3GZIA 1UI5A 2L7ZA 3JRGA 3JRDA 3HM5A 3BR6A 3M3YJ 3E7LA 2G7GA 3FIWA 3H0GJ 2FQ4A 4A69C 5K7FA 1O4XA 3EUPA 3GEUA 2DA5A 1R9TJ 1Y1VJ 4S0HB 3JRCA 5FJ8J 2YS9A 2DA4A 1ETKA 1F43A 1JKRC 2JA5J 2DMNA 3C07A 5IYBJ 2R5YA 3RQIA 2JMWA 2ZB9A 3KNWA 1JJ6C 5EGOA 3BG9A 3PM1A 2V57A 3S1NJ 4MIMA 3GBGA 4A3GJ 1U9NA 5J1UA 3IH2A 2JA7J 1FTTA 3VVYA 4UDSA 3VUQA 2PMZN 2ME0A 1XC5A 3MKLA 1JT0A 2ZOZA 3HTIA 4BKXA
chains in the Genus database with same CATH superfamily
1ETQA 2LFBA 1TLHB 2HVQA 3PNTA 2E1NA 2IT0A 1QPMA 2V1NA 2BZTA 3JSJA 5DUIA 1RKWA 3H1CA 4RMNA 4FISA 2OERA 2ID6A 2QZ8A 3F1BA 1TP4A 3BHQA 1ZGJA 5F1JA 3G1OA 4XQFA 1Y8RB 2GAUA 3GLXA 3EUHC 4UVBA 2VBZA 1K61A 1C0WA 4RAYA 5E8GA 3S2WA 4HSRA 1S6LA 3SFIA 2DMTA 2OV7A 3NI7A 1IN7A 2FBQA 2M7BA 5E3OA 3K6GA 3WHBA 1NHAA 3LJLA 1IRGA 2VB6A 5EJCA 1XSVA 2R7TA 1YQAA 5EF6A 3AQSA 4UV9A 3VVXA 1Y8QB 1R58A 1TQMA 2P5VA 1D3YA 4FT8A 2EV0A 2VQLA 5JHUA 3Q5FA 3SFZA 4IOAF 1EH6A 3I4PA 4LG3A 4ZDPA 2EINH 1GVJA 1YRNA 1MBFA 1WJFA 3HUGB 2LBFB 2M5WA 4AIJA 3BZKA 3A01A 4BACA 1PP7U 5IPAA 1QNTA 1MBEA 1OCTC 4BQAA 3IAS2 1PVEA 2OQRA 1RZ4A 5BNGA 1G2HA 4U0VA 4U87A 3T5XA 3WG9A 2EV5A 4YFNF 2BW3A 4PSXA 5J8FA 5KAFC 1Y6IA 1OCZH 2YUSA 4P55A 4J00A 4RGRA 2UXPA 1VI0A 1W7PB 4L9VA 3FZVA 2LYCA 3E0JB 1OQYA 2M9HA 1X1CA 4A5MA 3PL8A 2OUMA 4AIKA 5EG0A 2COMA 3BRUA 2EFWA 2IA0A 1S7OA 4CHUA 4HNUA 2JRTA 4EM1A 5GTIC 3GZ6A 2TDXA 1HBXG 2PI0A 2NP3A 2XGXA 5BS6A 5DTDA 3IWFA 4E7JA 2NNNA 1X1BA 3M8FA 5LGTA 1BN5A 1RC9A 2DK8A 4D5FA 3CRJA 5JHFA 2A61A 3DP7A 5GTHC 3DU6A 2QA4I 4ENJA 4HSTA 5E3LA 4QLCU 4DQ2A 5IOZA 2VLAA 2AQFA 3V78A 4I76A 2F07A 2LLKA 3EETA 2LY9A 2W00A 2RREA 4XONA 1YRNB 1XMKA 4PJMA 5DV5A 4NNJA 1HDPA 3HTUA 2KHMA 3FBIB 3UR3C 2XUBA 1OFCX 3PNYA 4BYYA 2E1MB 3FXOA 3RKYA 3VODA 4KT6A 4AYBN 1HKTA 2EWNA 1F4KA 2E19A 1D8KA 5GP9A 4BDYA 1SEUA 3TO7A 3BJ6A 4DBQA 2F4MB 3HEFA 3WTZA 2M34A 5EFYA 2WB1N 2R5ZA 4ZYGA 2GXBA 2CMPA 5F64A 1R1UA 3LFKA 5B5EC 3E3VA 5ILSA 4ICHA 1JGSA 3H5RA 3KFWX 2MW8A 4WIBA 4ZZDA 2P6SA 3GTMJ 2LKPA 1FYLA 2EZIA 2HOEA 5J3LA 3RTRA 2GXAA 4O6JA 5JFRA 4JX6A 3IV5A 2FQ3A 4XKBA 2K9MA 3RZDJ 3JTGA 1WCMJ 4Y7NJ 3ABLH 4KMUX 2IS2A 2XRNA 4RB0A 5ILVA 2KIQA 1TW3A 4A3DJ 4YFXF 5TRDA 2GA2A 5D5WB 3BCAA 4BHBA 1K83J 1YTYA 1IN4A 2DN0A 1VQ4I 4E70A 1RR7A 1R5HA 4CSWA 2YVXA 3T1BA 1OCPA 3K1MA 3VFZA 4BQOA 1XPXA 2LOOA 2Y75A 4R79A 4ABZA 5HODA 3LQRA 2DU9A 4I6ZA 4IHWA 2IU5A 1UCRA 3RKWA 5GAGJ 1XSDA 2VC1A 3DWLE 1QQIA 2WAEA 1FOXA 3FXMA 4NELA 3CP8A 4IEJA 3VYSB 4GCVA 4EQQA 4CA0A 1MMDA 1ZTRA 3LAJA 1LNWA 2HKXA 3OYBA 4QWQA 3LSHA 3Q0UA 4A12A 3RZOJ 3K4MA 5EEHA 5TGTA 2O8XA 4H4KC 3LL7A 3CMYA 5EGOB 3GF2A 3OV8A 4M9ZA 5K1YA 3CCUI 1MNEA 3R4KA 3HXLA 2VPRA 3S1QJ 2LC2A 4AWXB 1VZ0A 2Q1ZB 4U0WA 2H6BA 4GCTA 3I0TA 2R7DA 1U6GA 2DA7A 3PFYA 3F6OA 3D1NI 5FD6A 4HX8A 4AYBA 3IRRA 3A4CA 4L62A 4NDLA 3V8JA 4EV0A 5HDGA 3LA7A 1ZGWA 2P4WA 3BCBA 4BJ5C 2XAHA 1JTYA 1S9HA 1U78A 2WB1A 2BY3A 4G12A 1ETOA 1RUNA 2Z5UA 3CO6C 2B63J 3B73A 2XKOA 4FTHA 2CSOA 4EM2A 3BG7A 3TDUC 3CJNA 1U8BA 3ABKH 2R4GA 2CJJA 4AD9A 3OYLA 1O3QA 2K86A 2O7OA 5H20A 1I50J 1ON1A 4BHPA 3NWTA 1IRFA 2EFPA 1FOYA 4M3EA 3IL2A 2K9SA 3KZ9A 2QBYA 2OPTA 3CDLA 2M7AA 1BL0A 3KZIC 2CGPA 3JW4A 2JSPA 4HLYA 1R4MB 1HA8A 4ZYHA 3P5JA 3GXOA 2H1LA 1Y0NA 3RJPA 3K69A 1I5ZA 3KEYA 2XC7A 3ZMZA 1KONA 2ZOYA 3IKTA 1EV7A 4UUVA 4A3KJ 1WI3A 2A69F 1Z91A 3HOSA 3HHHA 1SVMA 4BH9A 1IRXA 4XLFA 1E3HA 1JKOC 1K79A 3AG3H 2KDOA 2VT2A 3VB2A 2ESNA 3QYFA 1MSFC 4JKZA 3N4MA 5F6FA 2KIFA 1JHFA 2B7EA 2IP2A 3CCQI 1EH8A 5K7ZA 2FU4A 4RGXA 4X0GA 2BEOA 2HYFA 2ZJQF 3I9V2 3V42A 3KP3A 3ZRGA 4RB1A 3HL2A 1T0FC 2J5PA 3HOUJ 5J40A 5HBUA 4EJVA 2D2WA 3LSIA 2GIZA 4XRMA 1YIJI 2AQEA 4CDGA 5GAHJ 3L2VA 3KP6A 5K7HA 4IZZA 3Q9SA 3RSNA 4AU7A 2JWTA 5JLWA 1SFXA 3K10A 2PJRB 3QPHA 4LOCA 3VW1A 1A31A 1K78B 4OAZA 1OLTA 3VEPA 3LOCA 1GV2A 1S3JA 3M8JA 3HIMA 2ZXWH 3ML6A 3VOEA 5HSZA 3NS4A 2CQQA 3NXCA 4XBFA 1FSEA 4DVYP 1R36A 3CC7I 3G1MA 3I59B 1WH7A 1ZR4A 2JSCA 2RDPA 4RLFA 3JSOA 1HW2A 3LAPA 2DFIA 4N4NB 4RGSA 5IP6A 4XICA 1U9OA 5HS7A 1GT0C 2XGEA 3DV8A 3KLNA 3F21A 1ETWA 2QLZA 3FXQA 1TZLA 3V6GA 4XRSA 3BTCA 3DBRB 1XMAA 4LMYA 1KA8A 1Z6RA 2LF7A 1ZLJA 2DQRA 4BUPA 5HVQC 4KIGA 5D6FA 3NWSA 2TCTA 5KNLA 3VPRA 1B72A 2R7OA 1ZLKA 4UUTA 3CLQA 2IBDA 3ABMH 1HXDA 2HYGD 1S8NA 3DCFA 3OY9A 4L9NA 3ESWB 3OYEA 5BOXA 1TWGJ 4N4OB 1TT0A 1S7AA 3C2BA 1IO2A 4GXOA 3IUVA 2NVYJ 3VWBA 4XM3A 1XCBA 5FROA 1J2XA 3LMMA 3WGHA 1W36C 2ID3A 1FNNA 4X1EA 2ECCA 5JI6A 4CICA 3HIFA 3QODA 2GUHA 4UXNA 3S14J 1DU0A 2JA6J 4M3FA 1U3EM 4Y33A 2EIJH 3QRFF 5FLMJ 4LJZF 2BHZA 1IN8A 2E60A 5CXGA 3GZNB 2CUJA 5ICFA 2FMYA 4CGRA 3ERED 1AA7A 2CWEA 2DA2A 2PMHA 3KKCA 2REKA 3J81Z 2VXZA 3GTQJ 1BI3A 1W5TA 2EZKA 4ZDLA 4W1UA 4G7HF 3FXUA 2L3DA 5FHPA 1SMYF 3ZQLA 2P5LC 3BZ6A 1REPC 4MEYF 3JAMZ 4CCOA 2EZHA 4B43A 1IDZA 2LY2A 3QYEA 4U9NA 1R7JA 2M8EA 4KT5C 2W48A 4FQGA 3I5UA 1SFEA 4F3QA 1W7PD 3E5QA 3HRMA 4XNFA 2ZY9A 3LHQA 2I10A 4WXCA 4JP0A 3MKZA 1QVUA 4KICA 3GWZA 1WKMA 1TWFJ 1Z0XA 2X51A 4EEFG 3PO2J 4JOMA 3KKDA 2ZO4A 1XTAA 3EGQA 1IN5A 3RPUA 2NVQJ 2XDVA 1FOKA 2JQ7A 1FOWA 5EYRA 3CUQB 5FKOA 4ANJA 1OR7C 3S1RJ 1FX7A 3HRUA 3OYNA 2L7ZA 3GEUA 5K7FA 1KQ9A 1X4OA 2L2OA 1Y1VJ 2ZMEC 1KQ0A 4S0HB 4BJ6C 5IT3A 3BG6A 5FGMA 2PFBA 1YITI 1U2WA 3P9IA 1OYWA 3KP4A 1ETKA 4PDKA 4UHTA 1JKRC 2DMNA 2R5YA 3RQIA 5LLQA 4CCKA 4YIIA 2C6YA 3PM1A 4OIRF 3K4NA 1ZYRF 3S1NJ 1LQ1A 1QZYA 1X19A 2UUZA 2JA7J 4AIHA 1KGSA 3HOTA 2IS6A 4AVZA 3HKZA 4FETA 1N77A 2OZ6A 3E6MA 2UWMA 2V1DA 4BGDA 1OCOH 3C3WA 4ENNA 3VOXA 3G56A 2QM3A 3S1MJ 2ME6A 3BZCA 2IA1A 4A3BJ 3QP5A 4BEHB 3DKYA 3TBIA 3AFHA 4YFKF 5LGNA 1AKHA 1MDMA 3M7GA 5C4JJ 3L2WA 1PP8F 3L2RA 3V8KA 3WGIA 2Z99A 1IG7A 1PUFB 3I4MJ 1UG0A 4A3FJ 3BJBA 1BR2A 3G1LA 1J9IA 4OMYA 4D1QA 2NS7A 1T39A 4F55A 2DA6A 2GXGA 1SFUA 3FWEA 3WTXC 5CJ9A 1POGA 3N05A 1MNMC 1GXPA 1H89C 1HDDC 5HLHA 2LNBA 1F9NA 3HC7A 2DA1A 1LVAA 4WXDA 4DGWB 1NG6A 3KEOA 3M1CA 3SZPA 3QAHA 1TNTA 2DOEA 2BE5F 2P0WA 3FHNA 2JK3A 1LEBA 4AIDA 1RRJA 1OCCH 2QCOA 4NC8A 2DODA 2GWRA 5HS8A 1ZGAA 2XGCA 5D5XB 2L02A 2G3BA 4BY1J 2CQ7A 4EJUA 1SANA 5CVUA 1J75A 1FYKA 4ME9A 1FMWA 2MFZA 2K3PA 4CZCA 2HTJA 3I64A 2X9DA 2XAFA 3J81K 2WBMA 1OCRH 1WJ5A 2L0KA 3HOXJ 2RNJA 1N78A 1ZG3A 4M6YA 2WUIA 1Q1VA 1SVLA 2GQQA 2WY7Q 4LLLA 3H3ZA 3A02A 3JAMK 2CFXA 1BOBA 2JT1A 4RAFA 4OMZA 4A93J 4PK4A 3GTLJ 4I0AA 3V7CA 5DDGA 4MXMA 1O3SA 1VF9A 5LGUA 1Z67A 3PIPF 2XROA 1XDSA 1J0RA 1LKXA 3ASNH 4F93B 1T0FA 1MZBA 3SEQA 4IRHA 5HNFA 3WTSC 1I27A 2XPWA 4Z2YA 3GTOJ 2LR8A 2Z1DA 1ZK8A 2X1DA 3HZJA 1V5GA 4L5EA 4Q47A 2QENA 1BC8C 1R5ID 3IWZA 1CF7B 1BA5A 3EUKL 4LIUA 2QEXI 2K4BA 1GUUA 2O9LA 3JRAA 4PJ0C 3S5RA 1UELB 2BOLA 2FNAA 4G9YA 3SQNA 4LLNA 1FC3A 2MGQA 2AS5F 3K7AJ 4UUSB 4U7DA 4A0YA 2Z9OA 2ISYA 5DEQA 3PO3J 1T95A 5E20A 2HQ5A 2R0QC 1GDTA 3F72A 2PG4A 1XGMA 3I3LA 1A35A 3K4KA 2PLYA 1A5JA 2WC2A 1VQ8I 4HQEA 5FKKA 2KJBA 3BQZA 2BY0A 2XAJA 4HX7A 2VE8A 5EZHA 3MWMA 5DUKA 5H6RA 1FBUA 4HNVA 3E5UA 4ZTFA 3VSLA 2HQNA 2EPFA 1HQCA 1UZCA 4MQ9F 3DXJF 1ZKGA 3ZMVA 3RQ4A 4UY8I 2ZJPF 1ZRCA 1MMGA 2ZJRF 1SC7A 2YPRA 2ELJA 1HCRA 4EATA 1ZG5A 1F1ZA 1I6XA 4R1HA 3J7ZI 3FK6A 2Y0SN 1IV6A 4IRIA 3QPSA 1JKPC 2E1OA 1WWXA 2JZYA 1RETA 2OCCH 4JNNA 3W2WA 4E6KG 2XGDA 5D18A 1S5LC 3OS2A 3ZXSA 1MMAA 3HE0A 2DG7A 1NTCA 5D5UB 5K58A 3C2HA 5BPIA 3PSIA 3IKVA 1YW7A 2HI3A 1ZH5A 2HPIA 3PSFA 5LRSA 3T8RA 4JK1X 2Y2ZA 2KISA 2ZCWA 2M87A 2E1CA 2Y48A 1GXQA 2Y0MA 1PJRA 3F23A 2V1XA 2HOSA 2O5RA 5CVJA 4UVAA 3OIQA 4CH7A 2N8GA 2CUEA 3CCMI 4IXAA 3AG1H 5LEKA 3LWJA 2GFNA 2F5DA 2CW7A 2HDDA 3S17J 2Y9ZA 3FXKA 1Z21A 1FYMA 4ENKA 2L9VA 3J80Z 3C1DA 3BOQA 5JVGF 2BVLA 1IW7F 2BBYA 3I58A 4G6QA 2HZDA 4GO1A 5J6XA 5KVRA 3LA2A 2XB5A 3G2BA 1D1AA 5H9TA 3Q0WA 3KIOA 2O0YA 5DM6F 3ELKA 1YIOA 3DTEA 2B1EA 5HAWA 3SHFA 4DNCA 1K4TA 1S7EA 3COAC 3IP4B 1W0TA 2L54A 2LH9A 3GVAA 3OSFA 4HLXA 2Q2EA 2X1EA 4ESBA 3E7QA 4XLAA 1ZQ3P 2L7FP 4KITB 3KP2A 1R1TA 1VQ7I 3OYGA 3OSGA 3RCOA 1YOVB 3K2ZA 4C3JJ 3VTIA 1TWCJ 1OR7A 1BI2A 1WH5A 2KDZA 1YW8A 2Q24A 3CUOA 1SAUA 1WI9A 3H3VK 4F7ZA 2NNYA 2Y0SA 3EYIA 2NOGA 2OQGA 3K4JA 3P7NA 2E2HJ 3BR0A 1NG7A 2W85A 2V7FA 1DGWY 2F5CA 2ZMEA 3QPLA 4OWRB 1K4SA 1IRZA 4EVIA 3S93A 4XRSG 2JN6A 1LFBA 1TWAJ 5LHIA 5BPDA 3CLOA 2BY2A 2QQAA 3R61A 3ZN0A 4PFOA 1B59A 2GIVA 4EJOA 1DGRM 2LSOA 3NQOA 1OISA 3E6DA 3A01B 3C18A 1LJ9A 5DCMA 2FMLA 1MKMA 1VQPI 2XF5A 4DOZA 2QSHX 1RKTA 4A3JJ 4AC6A 5FLXK 2NVUB 5B66C 4BJTA 2Z2SB 3A03A 4I99C 3RPQA 1JXSA 3OYCA 4M73A 1QHGA 2EBIA 2F5EA 2BW3B 1G8XA 1Z77A 4OOIA 3HOYJ 1MMNA 4IL6C 1LE8A 2OTLI 2ICWG 2OBPA 3D0SA 3E1SA 3HG9A 4QTRA 3W2VA 5DAJA 5J8CA 1GHCA 3C7JA 4AC0A 3V4GA 4BDZA 4ZDOA 4R8HA 3VYRB 4YG2F 2VE9A 4C2MA 2QF7A 1RNLA 5F08A 5F04A 5EG0B 2X48A 3HOZJ 3RH2A 1DDNA 3HBLA 5HOOA 2XSJC 1FMVA 3U1DA 1UHWA 1VNDA 4B3AA 3L2UA 1T8IA 4I09A 4NUBA 4XN0A 1SMTA 1ON2A 3OL3A 2HGCA 3ZMSA 1ZELA 4XKCA 3SYTA 1IJWC 4XR6A 1VQ9I 1Y56A 3A0HC 2MYSA 3BR5A 1TNSA 2ZJ2A 2FX0A 3KP5A 3Q9VA 3ZR8X 1ONVA 4IJAA 2HTSA 1WVRA 2KPMA 3FMRA 5LFAA 3D5RC 4I0BA 2GM4A 5DD4A 4UNOA 4XORA 2IS4A 4U7BA 1ODDA 1L0OC 1V5FA 4A3IJ 2DYSH 3KLOA 2ECBA 3QOEA 3CTAA 1B9MA 1FTZA 2NS0A 2WAFA 5CYVA 1FLIA 1JGGA 1BC7C 2WADA 3W6VA 2XF7A 3K9TA 2XPVA 5B1BH 1T08B 1K6OA 2B3WA 3H9GA 4HV5A 4HRIA 4OD5A 1P4AA 4HDVA 4B48A 3F3XA 3J7YJ 2M2EA 3WHCA 3I55I 2A05A 2E5NA 4GGGA 4HAMA 4V2GA 2R5ZB 3T6NA 2L9RA 4M3DA 4C3HJ 1W5CC 2XKPA 2VN2A 4XSZF 3J80K 4C2UA 1O57A 4BE1A 2ESHA 1A04A 5K5QA 4RAZA 3ECOA 3OR2C 2E36A 4KUMA 3QPTA 2CU7A 3SDBA 4NHJA 3ABTA 1LEAA 3K8PC 2RGVA 2DMUA 2MH2A 2WAQA 3I71A 1AHDP 4IHYA 3HTJA 4A0XA 1NK2P 3SZGA 1U5TC 4EM0B 3WTUC 1X4PA 4QPOA 2UXNA 3BP8A 5KCMA 2DCEA 2F5FA 4KISA 3FRQA 1TBXA 4N0BA 3M9AA 1WJDA 2EFOA 2R7FA 2VQGA 2OF7A 3SEZA 3MAJA 2ZNYA 3BR3A 4ETSA 1HSJA 4G94A 3ANPA 1BOAA 4NBQA 1Q1HA 5HDNA 2W7NA 2Z33A 3U2RA 3NRGA 3CF2A 2ISZA 3L00A 3JRBA 2JVGA 1J09A 4KIFA 3ZGKA 4BBSJ 2R7WA 4C30A 2ZCXA 4J01A 3K4LA 2QQ8A 1LB2A 2XHKA 3BTLA 4I02A 2RV8A 1F5TA 3FKJA 5GADJ 4II3A 1R5GA 3UNGC 2KL4A 3G3ZA 3EQLF 5L3BA 5EDNA 3NNRA 4XLHA 1BI1A 1OJLA 3MKWB 4KNYA 5CVRA 2FBIA 4C2MJ 4F91B 1W4MA 4NQWA 3DBLB 3O2PE 2NOJB 5LBQA 2CS3A 4NB5A 5LHGA 4FX4A 4G6DA 3NARA 2F4IA 4JBAA 5GPCA 3K1PA 4IHSA 2DQLA 2ZXHA 3ZMDA 4A3LJ 2UV1A 2DT6A 1MD0A 4KIBA 3Q0VA 1YW9A 1T38A 1G3YA 1AWCA 3KEQA 4MK6A 4LK1F 3VIBA 3BROA 2CQNA 4A6EA 9ANTA 3RD3A 2AO9A 3QU3A 4FX0A 3V8LA 2VKVA 2R7QA 2BV6A 3JRGA 3HM5A 1R00A 4IPAA 2G7GA 2P8TA 3FIWA 5FRNA 2FQ4A 4A69C 3BPXA 5CQGA 1MJAA 2KRHA 5JVTA 3QP6A 2YSRA 5KAIC 4II2A 5FJ8J 3JRCA 4KDPA 4LB5A 2WY8Q 1AOYA 1P92A 4RM2A 2YS9A 4M9SA 2DA4A 1STZA 3C07A 1OYIA 2XAQA 2ZB9A 1JJ6C 3AL0B 2KIUA 3S32A 1YG2A 3H0DA 2EFNA 2QBYB 3GBGA 2HPMA 3F8NA 3J7AY 3LSTA 2E5ZA 3L2CA 4OIPF 3IH2A 4A3GJ 4KN7X 2PMUA 3H9QA 2PMZN 3TMOA 3CMAI 1R4NB 4P1WA 1VTNC 1JT0A 2V1UA 3IRQA 2YU3A 2ZOZA 4DIQA 4IQ4A 4NC6A 3HTIA 3DEEA 4YIRX 2QSFX 1T33A 2UXUA 3S15J 3JCUC 1DUXC 4Z6YA 1VQLI 2X4HA 1RPWA 3K4BA 4ACIA 1MIJA 4M6VA 1P7JA 3LSGA 1SAXA 1U0JA 1Z1DA 3HHGA 5D4RA 4I7HA 3EDPA 4WWCA 2Q0OA 2DFHA 1X2MA 3GTGJ 2MC3A 4DZJA 3GLLA 1ZG1A 1ZREA 1A6QA 2QIBA 2CYYA 3HTHA 2P7VB 4YIFA 5CW8A 2KRFA 4Q48A 4IHTA 4WX9A 2UXXA 4WF2A 1GVDA 4BBRJ 4F92B 5LHHA 3BJOA 2VJ5A 2IVMA 3SZTA 2M45A 5IT9Z 1BW6A 1UAAA 3HOVJ 1BI0A 4OD4A 1YJNI 4PJJA 3WTWC 1KZHA 3RDIA 2JVHA 2PX9A 4WXHA 3HKZN 2AXLA 2VODA 5FD5A 2DFEA 3LSRA 1HLVA 2W53A 2IGNA 5FO5A 1KU9A 4FHTA 3LSJA 4XLEA 3HRTA 5A2QK 2ZSHB 2NRAC 4LGWA 2M3AA 2DPDA 4MHGA 2JJ7A 4HEA2 4XOPA 2A68F 1Y1WJ 4HOBA 3F8BA 3BY6A 2RKHA 1ENHA 4LLGF 2LRDA 4RLQA 5C3EJ 1B6AA 1SFOJ 5IP9J 5E79C 2OU2A 1FT9A 1IC8A 2EQRA 4RM3A 1GV5A 3CJQB 3MN2A 3S2HJ 2CV0A 3ZMTA 1YJWI 1XB4A 3HSEA 2YVEA 3S8PA 1XG1A 3R60A 4ZZLA 3JSPA 3B02A 2QKOA 3H92A 1IXSB 1F36A 2KZVA 2ZXIA 4IRGA 4EMSA 4G8XA 4E7IA 2HYTA 3ANGA 1B72B 4CYDA 2PMZA 1D8JA 2E7XA 3MD2A 4BXFA 2I8DA 5M5WJ 3CC4I 3P9CA 3M4OJ 5DS9A 1OMIA 1JE8A 2E1MC 2ZC2A 3JRFA 2HZTA 5E8IA 2RHAA 3BG3A 2H94A 1E3PA 4I98B 2G7UA 4D9JA 4RB3C 2QQ9A 2DMQA 3PPBA 2FBKA 5J4VA 2HU9A 3OYAA 2FUG2 1Z7LA 3GMEA 4CO8A 4XLPF 3HB9A 4QPQA 4J19A 3WU0A 3NEUA 1MH4A 1LFUP 4GDFA 3WE2A 2Y30A 1I6HJ 1WHUA 3AKZA 2AHQA 1CQTA 1IAWA 2CV2A 2K4JA 3MQ0A 5IP7J 1D5VA 1G6NA 3DKWA 4HG2A 3H35A 4HQMA 3OYJA 3A0BC 4IHVA 1DPRA 4YZEA 3TEDA 1Y0UA 1L3LA 2FNPA 3EYYA 4HW0A 5ICCA 1FP2A 4MEXF 1D0XA 1KYZA 4YRVA 3T8TA 3H3UA 1HSTA 3CDIA 1WQ2A 1YO5C 1HW5A 4L0ZB 3FBNB 2DOAA 3HTAA 3KYDB 2QKLB 4ENMA 2MSYA 2RASA 1XGOA 2K85A 2OJED 3IHUA 3WU1B 5C4XJ 3QYBA 4D0PA 2W24A 4XLNF 1UJ8A 2EH3A 5E18F 1XGNA 2HQRA 4ASNA 3CJTB 1H8AC 1UMQA 1R23A 2A3SA 4CZZA 1X58A 1U5TA 4CYCA 3OS1A 3OYFA 2DTRA 5AQCA 3O6BB 3TO9A 4G7ZF 4L9TA 4UVCA 2VJIA 3VYTB 1FIAA 3CZ6A 2BGCA 2IS1A 4AVPA 2XAUA 3CCJI 2KMUA 1IF1A 2EFQA 2L9SA 3CCYA 3R0AA 3A1YA 4PJNA 5GAEJ 1UB9A 2JUCA 2JA2A 3FF5A 1S72I 2L9NA 1JUMA 5IT9K 4D7NA 3VDXA 2VI6A 4RBOA 3OYMA 2COBA 2Z16A 4MTDA 1U8RA 2VJJA 1KU2A 3PIOF 4DW6A 2R5YB 3ECHA 4OIOF 1XD7A 2GA1A 2IGOA 1X2NA 2UXHA 4XIDA 4PJLA 3LSPA 4BY7J 4HF1A 4I01A 2V4JC 2K9LA 3F8MA 4MLOA 3VYUB 4GYIA 3O8HA 1TQPA 4XLCA 5L3CA 2LKXA 1W5SA 3A2KA 4P9FA 3FISA 3IUOA 5FLVA 1FBQA 1ULYA 1M1EB 2PQ8A 5HLIA 2I5UA 3GX4X 2K9NA 2PZ9A 4P9UA 4NN1A 4IKFA 1BJAA 2KQRA 5F0CA 2E34A 3BTJA 4D7MA 5IYCJ 2MG4A 2DJNA 4B47A 2V6EA 5L3EA 4JYKA 2FOKA 2LD5A 4A3MJ 3GTPJ 2ZXJA 4KFCA 2K02A 1AKHB 5D6EA 4KN4X 3CMMA 4M3BA 1W0UA 1MDMB 2HOTA 1ERDA 1A6IA 5EZGA 4IHXA 2KZGA 1LFPA 3ZQHA 4Y52J 2MLKA 3KETA 1YI2I 1Y39A 3DPJA 2RN7A 2L7KA 4CUGA 4ON0A 5D19A 4M3GA 3FXJA 3K70C 2Z3YA 5F0HA 3S3MA 2NX4A 3BQYA 3BG5A 3GEZA 5CQEA 4EJTA 1QBJA 2ZNZA 5CKTA 2YR2A 1ORKA 3NPIA 2PN6A 2J5OA 3L09A 2A5WA 3TP3A 1QPIA 2ZCMA 2MLGA 3BR2A 4ZTJA 4ITVA 4CCMA 3KE2A 3G71I 4I2OA 3K4CA 1YS6A 1PUEE 2VKDA 4KMFA 3CP2A 2VONA 5C44J 4BQQA 3E6BA 2WV0A 2V9PA 4U9LA 3MKYB 2HXOA 1WSUA 4GFLA 1S29A 5FLXZ 1OKRA 3TW6A 2MABA 3MFKA 4HF2A 2LTPA 5E1XA 4BAYA 2OA4A 2LDUA 1IZ1A 3H5AA 4IO9F 3BC8A 3K70D 3FMQA 1MBJA 5J47A 4D5CA 4BQNA 2L4MA 2EILH 4ZC3A 2D5VA 2EA4A 2IA2A 2CW0F 2ZFUA 1VQNI 1T6SA 1UI6A 4A5NA 3KCCA 3ON4A 4Y13A 2HQAA 2X0LA 3DPTA 5H2FC 3F8CA 3FXLA 2OTJI 2L01A 3JRIA 2O7TA 2DA3A 3HGYA 3HUGA 1APLC 2H1KA 1YX5A 4FASD 3ULQB 2RNGA 2HOAA 5E1ZB 1UG2A 2BY1A 1Z3XA 2JA8J 4N9IA 3CJDA 4BS9A 2ADUA 3LA3A 4E4HA 4Q4ZF 3RIRA 3IAM2 3HSRA 4ZYEA 3ABUA 3OMYA 4C3IJ 2CFOA 1W7PA 4UB6C 4BL0B 1MJ9A 2O8KA 3J7AO 2VQCA 1MH3A 3TQNA 2HVRA 1G4DA 2A07F 2LP0A 2LMDA 1VQMI 1YE9A 1KYWA 4XRFA 1NK3P 1USTA 4FE4A 5F27A 1JUPA 2FXAA 3ZQ7A 3Q3SA 3CCRI 2P7CB 2QTQA 1LVKA 2KIMA 4RA2A 1FY7A 2MC4A 2YX4A 3JRHA 2L7MP 1XS9A 3U21A 3CQZJ 3I54A 1X1AA 1ETYA 3I53A 1B9NA 1DU6A 2K7LA 5LRRA 3CESA 3MCZA 2M30A 3OOPA 4HZFA 4HX4A 2PBIA 1K7AA 1UHSA 3DEWA 3FXRA 4OAYA 5D8LB 3N97A 1WJAA 3CC2I 3BWGA 3W6JB 2IW5A 5KHDA 5LEJA 2FJ1A 5K5RA 2CUZA 4M6XA 2XRLA 4XKWA 4DZPA 5JLXA 1EF4A 4HKUA 3H9JA 3RKQA 5FGLA 1WJBA 1G3SA 2DJIA 3T0YA 1I1SA 1VQ6I 4MFEA 1IDYA 5E3MA 1B1BA 1QU3A 1ACIA 3PQJA 3HGGA 1KU7A 2NP5A 3BTIA 3TKYA 3MMYB 2EIMH 4L9JA 2F2EA 2ZKZA 4KWAA 2FA5A 4BHCA 2XV4S 4K2EA 3F6VA 4Y3OA 2X6OA 5FKNA 3DLLF 1E0EA 1XDUA 2DFFA 2XB0X 2KRCA 4Y17A 1T98A 5CPRB 2V79A 1QA6A 2F5VA 2XVCA 1RUOA 3PNVA 1KQ8A 3CCVI 2QGUA 3NRVA 4L5IA 1X3UA 1IV8A 1EKEA 3KX2A 1P6RA 2VOOA 1WFXA 2W82A 3QOPA 1ZARA 2WAQN 5M3MJ 2FOWA 3CUQC 3IC7A 4MO7A 1NH3A 1VQOI 4CXFA 1RIOH 1QO0D 2ELKA 5AIPA 4ZYAA 2A6TA 2QKMB 5E17F 2HFHA 5HLTA 4IVNA 1RR8C 3R6SA 2JTVA 3IH4A 3S2DJ 3MZHA 2H8WA 1FSHA 4Y15A 1T56A 2WTEA 1UFMA 3DTKA 2G7LA 2QSGX 2ETHA 2IAIA 2RQPA 3RKXA 5DM7F 2G0EA 2LG4A 1FIPA 3OIOA 3U9GA 3HPHA 4ZH4F 3JRDA 3S3NA 3BR6A 3DQVC 3KZYA 4OINF 4CCNA 1O4XA 2FRHA 3HSFA 4CCLA 3FMSA 2DA5A 2Q2EB 4HYEA 2RC4A 1DQUA 1MGTA 2GOXB 1HKSA 3GO5A 5ILUA 1F43A 2JA5J 1YYVA 5IYBJ 2V9VA 4TV7A 4G6TB 2UZKA 2ZBKA 3KNWA 3DLAA 4XKVA 3BG9A 5EGOA 2HDWA 2MA3A 2V57A 4KJZA 1FZPB 4MIMA 1G3WA 3QU6A 1R1VA 1YLFA 4C2TA 1U9NA 5J1UA 3BLYA 1FTTA 1R71A 1IXCA 2ZMEB 1Z7UA 3ISPA 3BJAA 3WG7H 1O7FA 1XC5A 1VQ5I 2QWWA 3MKLA 4M9XA 2M1BA 1ZRFA 4B3XA 1RI7A 4RS8A 4L18B 3JTHA 2CH0A 5HNHA 2L5QA 5AIQA 2BYVE 3D5SC 3MZ8A 4XSXF 2F48A 3GYHX 1TC3C 2E7WA 4PZJA 2O6GE 5DCMB 2W84A 2JPBA 1X1PA 2VQHA 4QSHA 3V7RA 3OYIA 3WGGA 2X6WA 2DT5A 4DYRA 2HYJA 2IJLA 1UHMA 2R7RA 3DEUA 4HV6A 3CDHA 3GTJJ 4PGGA 1JTXA 1H88C 4PUSA 1Z05A 3ZQIA 1LE8B 1AU7A 4FCYA 1I1GA 2DI3A 3RYRA 2GENA 3QWLA 3ZPLA 2H27A 1VFCA 1JHHA 3GFJA 3KZZA 1ZN2A 1Z3YA 3I56I 5DCFA 5M5XJ 1EJ9A 1DPUA 4YEJA 1J7KA 2E71A 2KLOA 3L9FA 3CD6I 3PUFA 1O3TA 3E97A 3KP7A 1P9QC 3FM3A 3RPUD 3JREA 3L7WA 2GOMA 2KT0A 5FFXA 3TOAA 3TDZC 1TT5B 1D0YA 2PJPA 1SGMA 2FSWA 4F52A 1X1DA 3UKGA 2X6XA 3L1PA 3IH3A 3ZQGA 3DFGA 3FX3A 5CVVA 3V7SA 5A2QZ 2STTA 3P9KA 1J5YA 5D8KB 4DYCA 3PQKA 4V19K 3VW2A 1XX5A 2CUFA 1SFKA 4JX5A 4L0YB 1ZAOA 2D1VA 3VSKA 1YJ9I 4X6AJ 1QZEA 5LD2C 3TL4X 2VUMJ 2KKOA 4PFPA 2OCEA 2VBYA 2O03A 2ACJA 4P5OA 2GZWA 3BPVA 1IUYA 5B3SH 4JX4A 2XDNA 3D5LA 1O3RA 1JT6A 2E35A 1I3QJ 3BT9A 3R0JA 4PCQA 3I4NJ 4XN3A 1N25A 2ZSIB 2WV1A 1BIBA 2PJRA 2K5CA 3F0CA 3JR9A 1K78A 1QGPA 3EPZA 4OU0A 2A2FX 3O8GA 2VJ4A 1PYVA 4RGUA 1JKQC 1MBHA 3VW0A 1IUFA 2EJRA 4RAGA 3TP0A 1I39A 4CCJA 1IGNA 1SD5A 2WGBA 1X3WB 3BDDA 3I59A 5IYDJ 2VASA 2LK2A 5HDKA 5M5YJ 1DP3A 3OS0A 2DOFA 2RAEA 4M71A 4IX7A 2FBHA 1QRYA 2M4GA 3K0LA 2D6YA 3ERMA 1P4WA 2M0MA 2BVMA 3OR1C 4LB6B 1IN6A 1G3TA 1N75A 1MW7A 1YHQI 3B6CA 1LUJB 3MNLA 1JUSA 1YX3A 2HVSA 4HF0A 1E3OC 2IXSA 4XL9A 3CMEI 1T2KA 3ZQCA 4IF4A 2NAZA 4RB2C 1OYYA 1TW2A 1BM9A 2K9QA 3MEXA 4ESFA 2QVOA 4YELA 5HS9A 3SJMA 2DO7A 3W6KB 4S05A 5C4YA 5L3GA 3HRSA 1XGSA 5J4YA 1WJEA 3O3KA 3W2AA 2XSDC 3VOKA 4E7ZA 1KU3A 5FKLA 1V4RA 1P7IA 3M1EA 3U1KA 5B1AH 4MTEA 1EH7A 3EUHA 3OIPA 1BW5A 4NQWB 2VXDA 1E2XA 1EA3A 1FJLA 2BXYA 2HEOA 3PASA 2VBWA 1QHHD 1XSXA 3MVPA 2LREA 3TOBA 2NXNB 3BCGA 3KYCB 3GTKJ 3HYIA 5J1RA 2O61A 4BXXJ 5BMZA 1V55H 2W25A 4BU2A 1YS7A 3FM5A 4B1RA 3OOUA 5ERIA 1VQKI 3S3OA 5EEAA 2R3SA 3ZCOA 5DD8A 4UV8A 3W3CA 2JPCA 4LFUA 4LD5A 4N9HA 4ESJA 3WTTC 4O5VA 1WRJA 2H6CA 3E6CC 4WK8F 5M3FJ 3O60A 2MD0A 5EEGA 4GFKA 2QWTA 1D1BA 3DBHB 5J1YA 3C2GA 4MGRA 5ICGA 3GW2A 4P96A 2DK5A 2IPQX 4PXIA 3LFUA 5H6QA 1B4AA 2HDCA 1I3AA 4GCLA 4E7LA 3CWRA 2K27A 3L2QA 2MD5A 2V26A 3BR1A 3LNQA 2XIGA 3G7RA 1SD7A 1HKQA 3ON2A 1USSA 2VIXA 5FKMA 3WU2C 3ONQA 3FDYA 1P2FA 4A3EJ 3ZQQA 2FF4A 4Q5SF 2ELHA 2P6TA 3CO7C 2CW8A 2B0LA 5HLGA 1FP1D 2HWVA 1R49A 3ZOBA 4C9YA 5L3FA 3AQTA 2XASA 2H8RA 4WCGA 5TJJA 2F6CA 2GLOA 2VC0A 5E1WA 1TWHJ 2GBYA 3CUQA 4MNUA 1K6YA 1MBGA 2DBBA 1HW1A 2HR3A 3HOWJ 2LF8A 1E17A 4GFBA 1SD6A 2OC6A 3LQQA 4HPQA 2HXIA 2HKOA 2EV6A 2JRMA 2K40A 1BJZA 3REOA 3KYLA 2VPLA 2DDAA 4UB8C 5K5OA 4LK0F 1XMXA 4PGHA 2VL8A 4B8XA 3E5XA 3ROUA 3CCSI 1H9GA 2LY1A 3TW7A 4NC7A 4GYGA 2VKEA 2IEKA 2NVTJ 4XK4A 3LSKA 2CRGA 2HNHA 3K1NA 2AXTC 3ZMUA 2XPUA 4EGYA 2NVXJ 2DDBA 1P4XA 2Q8KA 1MJBA 1JJ8C 4G7OF 1BR4A 1FWZA 1ZHFA 2FD5A 3LSMA 4ZJZA 2OZUA 2DW4A 3OYDA 2EA2A 1W36D 2R7XA 4IQJA 4V2FA 1OPCA 2RVCA 3PFIA 1GLNA 4ZYDA 1ITYA 2EB7A 1LDJA 2R7VA 4MFDA 1WJCA 4BEHA 2OAZA 1TTYA 2VBXA 3HPGA 5D1RA 3VVZA 5ICEA 4GCKA 3P9TA 5AONA 1CGPA 1MBKA 3GFLA 1QZZA 2DPUA 3HJEA 1BR1A 2DT7B 4E7HA 2QOPA 3H36A 3HDDA 3COLA 3ZN1A 2OI8A 2W4SA 4DYQA 3B6AA 1PUFA 2G7SA 4DJAA 3OL4A 2HKUA 2HS5A 2X1CA 3X2QH 1MSEC 2DTZA 2F4OB 5KK1A 4HNTA 1TL8A 4W97A 1A36A 2PBXA 2CG4A 2D1HA 2UXOA 3B81A 2BXZA 3F8FA 3OWTA 1HOMA 4JL3A 1HF0A 1XN7A 3DPUA 2DLLA 2KFDA 3F9KA 4RDUA 2DAOA 4GRIA 1ZRDA 1SD4A 3LWFA 2Y31A 2NS8A 3QQAA 1FBSA 3CJRB 4BNCA 4LIVA 3K2AA 1ETVA 2IRFG 2X85A 3DPLC 1D5YA 1R6RA 2X6YA 3G73A 2W1OA 2EZLA 5FB2A 4B4CA 2WA0A 2W57A 4A2UA 4HDUA 4CGZA 5CLSA 1V54H 1H0MA 4E7KA 2XAGA 2DMPA 5IY5H 3TO6A 2P81A 1PDNC 6PAXA 5DYMA 1TQIA 1Z6TA 2YU9J 4QIWN 2LVSA 4LG0A 5ED4A 1D0ZA 3PUBA 2TRTA 2G9WA 2MH9A 2FE3A 2QUFA 1QVTA 2WWYA 1X3ZB 2Y9YA 5JR3A 3CF5F 3TGNA 4A3CJ 2XF6A 1LDDA 3GCMA 3GZ5A 1DP7P 4AM3A 4AF5A 1B8IA 2UXIA 3VP5A 3DTIA 5FFZA 2YVHA 1WGXA 4B09A 1HC8A 3SDGA 3AAFA 2A6HF 4H0EA 1Z9CA 1IXRC 1WPKA 1J59A 1G59A 2PEXA 2LKSA 4BE0A 4FE7A 3MZYA 1LPQA 4JQFA 4U88A 3EUAA 5E3NA 3S16J 4BE2A 2RQQA 1ZR2A 4OIQF 2STWA 2IGKA 3H5NA 2R7SA 4EJWA 3AG4H 3NAUA 4DBRA 2R92J 3SWHA 1CF7A 2R7ZJ 3HTSB 1R22A 5F1RA 3CCLI 4HA8A 2B9SA 2NYXA 4UUSA 2Y69H 2PFVA 3QBMA 3FK7A 1SVOA 4L5JA 5TISC 3DU5A 2L4AA 1FEXA 1U5TB 4M74A 1XCVA 4CYCB 4S04A 3DF8A 2JUGA 3F22A 4AUXA 5IOYA 3OYHA 3QKXA 2V6CA 4LG0B 2CQXA 5GPAA 2E2JJ 1MMSA 2KJCA 2VKHA 2M8GX 1MNDA 2EIKH 4MQVA 2DXIA 3ZQFA 1ETXA 2V9KA 4XOTA 4Y4RA 5CXIA 1V5EA 3G4SI 5FMPA 3KPHA 5BQTA 1BBYA 1O7LA 1BIAA 1FPQA 2CO5A 1B8IB 4PSWA 2DG8A 3OYKA 3M8EA 5F0FA 4M72A 3BNIA 5L3DA 3FHZA 4O3MA 2H09A 4U0YA 3ZP5A 1W1WE 4BXUA 3WODF 2E2IJ 3GFMA 1LDKB 1RESA 2A5YB 2VOPA 2ZCNA 4EGZA 1H9TA 2M4KA 5FRMA 2YX7A 3DKXA 2IGMA 3PJRA 2EK5A 2D45A 3CCEI 4IOCF 3RYPA 2FJI1 2M0CA 2R93J 3WTYC 2OD5A 3FKIJ 3AL0C 3GZIA 1UI5A 1D1CA 2QQBA 2MBFA 5D5VB 2KP6A 3E7LA 5D4SA 3M3YJ 4A6DA 2P5KA 2QYOA 2BHYA 3H0GJ 1V3FA 3WTVC 3EUPA 1R9TJ 3WE3A 3RI4A 3G6EI 2O3FA 2A6EF 2FEZA 4XMYA 4KYWA 3ASOH 4B44A 2CQKA 4E7SA 2JMWA 1JI8A 4IRVA 2K3FA 3SXYA 3GUDA 4A0ZA 2LBFA 3AG2H 4KA4A 2CV1A 2R7UA 2DYRH 2VT3A 4HBLA 3VVYA 5CVIA 4UDSA 3VUQA 1YFHA 4LITA 2ME0A 2G7HA 3GFIA 1WZ2A 3M07A 2ZFWA 4BKXA
chains in the Genus database with same CATH topology
1T33A 2UXUA 3VOXA 3S15J 3G56A 1ETQA 2LFBA 3S1MJ 2ME6A 3JSJA 1RPWA 4A3BJ 1TC3C 4ACIA 1RKWA 4M6VA 1P7JA 4FISA 3LSGA 2ID6A 2OERA 3F1BA 3BHQA 4QSHA 1AKHA 5F1JA 3G1OA 4DYRA 2HYJA 5C4JJ 1K61A 1X2MA 1IG7A 3GTGJ 1PUFB 3I4MJ 4A3FJ 4DZJA 3GTJJ 2QIBA 3SFIA 3BJBA 2DMTA 3G1LA 3HTHA 1JTXA 1H88C 1AU7A 3NI7A 3ZQIA 1LE8B 2NS7A 5CW8A 4FCYA 2DA6A 2FBQA 2GENA 5E3OA 1GVDA 3WHBA 4BBRJ 1POGA 1VFCA 3LJLA 1MNMC 1H89C 1HDDC 5EF6A 5M5XJ 3AQSA 3VVXA 2DA1A 1BW6A 3HOVJ 2JK3A 3JREA 2KT0A 2QCOA 1YRNA 1MBFA 3HKZN 1SGMA 3LSRA 1HLVA 2XGCA 3UKGA 2G3BA 3A01A 2W53A 3L1PA 5IPAA 3IH3A 4BY1J 3ZQGA 1MBEA 3LSJA 1SANA 1OCTC 4ME9A 4DYCA 5BNGA 2JJ7A 1G2HA 3VW2A 1Y1WJ 2CUFA 4JX5A 1ENHA 2X9DA 5C3EJ 1SFOJ 5IP9J 2YUSA 2L0KA 4X6AJ 2UXPA 3HOXJ 1VI0A 2EQRA 1IC8A 1GV5A 3MN2A 3S2HJ 2VUMJ 2WUIA 1Q1VA 2YVEA 2M9HA 1XG1A 4JX4A 3A02A 2XDNA 1JT6A 2QKOA 5EG0A 1F36A 4A93J 3BRUA 3GTLJ 1I3QJ 4MXMA 3BT9A 1VF9A 2HYTA 3I4NJ 3ANGA 2NP3A 2WV1A 1B72B 5DTDA 3F0CA 3JR9A 5M5WJ 3M4OJ 3O8GA 4D5FA 5DS9A 3CRJA 1JKQC 1MBHA 2XPWA 3JRFA 3GTOJ 2RHAA 2LR8A 3VW0A 1ZK8A 1IUFA 3BG3A 3TP0A 4L5EA 1IGNA 2WGBA 5E3LA 2DMQA 5IOZA 1BA5A 3PPBA 3V78A 5IYDJ 2LK2A 4I76A 5M5YJ 2F07A 2LLKA 1GUUA 2O9LA 3JRAA 2LY9A 3S5RA 2RAEA 1QRYA 1YRNB 1HDPA 2MGQA 2D6YA 3HB9A 3K7AJ 4UUSB 1OFCX 4J19A 1MH4A 1LFUP 3PO3J 3B6CA 3MNLA 2Y30A 4AYBN 2HQ5A 2R0QC 1JUSA 1I6HJ 2E19A 1GDTA 2AHQA 1E3OC 5GP9A 1CQTA 5IP7J 3HEFA 3ZQCA 1A5JA 2M34A 5EFYA 5FKKA 2WB1N 3BQZA 2R5ZA 5EZHA 4IHVA 4ICHA 2K9QA 4YZEA 2MW8A 4HNVA 3TEDA 3GTMJ 3SJMA 5C4YA 2EZIA 5J3LA 1ZKGA 4JX6A 3IV5A 2XSDC 3VOKA 5FKLA 3RZDJ 1WCMJ 4Y7NJ 1HCRA 1P7IA 3HTAA 1BW5A 4A3DJ 3FK6A 2Y0SN 1IV6A 1FJLA 2MSYA 2RASA 3PASA 3MVPA 3QPSA 1JKPC 2E1OA 3BCGA 4JNNA 1RETA 1K83J 2DN0A 2XGDA 5C4XJ 3GTKJ 5J1RA 5D18A 1RR7A 4BXXJ 2EH3A 3HE0A 2DG7A 1H8AC 1NTCA 1UMQA 4B1RA 5K58A 3OOUA 5EEAA 1OCPA 1X58A 4CYCA 2HI3A 4ABZA 5HODA 4I6ZA 5AQCA 4IHWA 2IU5A 1FIAA 2Y2ZA 5M3FJ 3O60A 4GFKA 2QWTA 3CCYA 5J1YA 4NELA 4PXIA 4IEJA 2HOSA 1JUMA 1ZTRA 4D7NA 2VI6A 4GCLA 2N8GA 4RBOA 3CWRA 2COBA 3Q0UA 2CUEA 3RZOJ 4DW6A 3BR1A 2R5YB 3LWJA 3LNQA 2GFNA 1X2NA 3G7RA 3CMYA 2UXHA 4XIDA 2HDDA 5EGOB 3S17J 3LSPA 2Y9ZA 3ON2A 4BY7J 5FKMA 2VPRA 3S1QJ 4A3EJ 4MLOA 2E2JJ 3O8HA 2LKXA 4GCTA 3FISA 3ZOBA 3AQTA 5FLVA 2DA7A 2H8RA 2XB5A 2PZ9A 2K9NA 3D1NI 2GLOA 4NN1A 4L62A 5H9TA 1TWHJ 3Q0WA 4NDLA 2GBYA 1ZGWA 5F0CA 1MBGA 3BTJA 4D7MA 5IYCJ 3HOWJ 5HAWA 2MG4A 2DJNA 4GFBA 1JTYA 4JYKA 2LD5A 4A3MJ 1S7EA 1U78A 3GTPJ 4G12A 3OSFA 1ETOA 1W0TA 2HXIA 2K40A 1BJZA 1AKHB 2B63J 3E7QA 1ZQ3P 4M3BA 2L7FP 2HOTA 1W0UA 4FTHA 1A6IA 5EZGA 1U8BA 4IHXA 3ZQHA 3OSGA 3DPJA 2CJJA 4Y52J 2O7OA 1I50J 4C3JJ 1TWCJ 3TW7A 1WH5A 2KDZA 5D19A 2Q24A 4M3EA 4M3GA 3H3VK 2K9SA 2IEKA 2VKEA 2NVTJ 4XK4A 5F0HA 2NX4A 3KZ9A 3BQYA 2OPTA 2CRGA 2NOGA 3CDLA 1BL0A 2E2HJ 3BR0A 3BG5A 2XPUA 2NVXJ 3QPLA 1IRZA 1JJ8C 3NPIA 1ORKA 2FD5A 2ZOYA 4XRSG 2JN6A 1LFBA 1TWAJ 3TP3A 1QPIA 2ZCMA 4A3KJ 3BR2A 1WI3A 4V2FA 1ITYA 4MFDA 3A01B 5C44J 5D1RA 3VVZA 1JKOC 4GCKA 3P9TA 1RKTA 4A3JJ 4AC6A 2HXOA 1MBKA 2QOPA 4GFLA 3TW6A 3A03A 1MSFC 4JKZA 3HDDA 3COLA 2OI8A 2LTPA 2EBIA 4DYQA 3B6AA 1PUFA 2G7SA 2HKUA 1Z77A 3HOYJ 5K7ZA 1MSEC 2DTZA 1LE8A 4QTRA 1MBJA 4W97A 5DAJA 4D5CA 2PBXA 2UXOA 3B81A 1HOMA 4JL3A 3HOUJ 5HBUA 4AC0A 1HF0A 2D5VA 4XRMA 2QF7A 5F08A 3HOZJ 5F04A 5EG0B 2X48A 5K7HA 1UI6A 3RH2A 4RDUA 3HBLA 3ON4A 1VNDA 5JLWA 2JWTA 2NS8A 2Y31A 3QQAA 2DA3A 3JRIA 2O7TA 3HGYA 4B3AA 3K2AA 1ETVA 4LOCA 3VW1A 1D5YA 1APLC 2H1KA 3LOCA 1GV2A 1IJWC 2EZLA 4B4CA 3HIMA 2HOAA 5HSZA 1UG2A 3BR5A 2JA8J 3CJDA 2FX0A 2CQQA 3NXCA 2DMPA 2GM4A 2P81A 3G1MA 2YU9J 4QIWN 2LVSA 1WH7A 1ZR4A 4A3IJ 4C3IJ 2ECBA 2O8KA 2TRTA 1FTZA 1JGGA 5IP6A 1MH3A 1QVTA 4XICA 1U9OA 3W6VA 2Y9YA 1GT0C 2LP0A 2XGEA 2XPVA 4A3CJ 1ETWA 4AF5A 1B8IA 2UXIA 1NK3P 3VP5A 2YVHA 3V6GA 2M2EA 1WGXA 4FE4A 5F27A 3BTCA 1JUPA 3WHCA 4XRSA 3Q3SA 2QTQA 3SDGA 4V2GA 2R5ZB 3T6NA 2L9RA 2TCTA 3JRHA 4M3DA 1WPKA 4C3HJ 3VPRA 1B72A 2L7MP 1XS9A 4FE7A 3CQZJ 5E3NA 3S16J 1ETYA 4UUTA 1DU6A 2IBDA 2CU7A 1ZR2A 1UHSA 3DEWA 2DMUA 3HTJA 4IHYA 3NAUA 3DCFA 1AHDP 2R92J 1NK2P 2R7ZJ 1TWGJ 2FJ1A 3C2BA 3IUVA 2NVYJ 2XRLA 4DZPA 5JLXA 1EF4A 3FRQA 4HKUA 3RKQA 5FGLA 2ID3A 2OF7A 4X1EA 2ECCA 4UUSA 3BR3A 4MFEA 2GUHA 3S14J 1DU0A 2JA6J 4M3FA 3ANPA 1IDYA 5E3MA 3QBMA 3FK7A 5FLMJ 3HGGA 2NP5A 3NRGA 3BTIA 5CXGA 3JRBA 1FEXA 4BBSJ 4CYCB 4CGRA 2ZCXA 4KWAA 2DA2A 3BTLA 3KKCA 2REKA 4AUXA 5IOYA 3QKXA 3GTQJ 2CQXA 2X6OA 5FKNA 2EZKA 4W1UA 5GPAA 5FHPA 2M8GX 2XB0X 3ZQFA 3ZQLA 1ETXA 5CXIA 5EDNA 5FMPA 3NNRA 1B8IB 2DG8A 1OJLA 2EZHA 4C2MJ 1IDZA 5F0FA 3BNIA 2W48A 2WAQN 5M3MJ 3LHQA 4MO7A 3NARA 2E2IJ 5GPCA 2I10A 1RESA 4JP0A 4A3LJ 1QVUA 2ZCNA 2ELKA 1TWFJ 3Q0VA 1Z0XA 4EEFG 3PO2J 3IH4A 3S2DJ 3KKDA 4MK6A 3VIBA 9ANTA 1T56A 3EGQA 3RD3A 2NVQJ 2AO9A 2G7LA 2M0CA 2R93J 2IAIA 5EYRA 2G0EA 3FKIJ 1FIPA 5FKOA 2VKVA 3S1RJ 3OIOA 3GZIA 1UI5A 2L7ZA 3JRGA 3JRDA 3HM5A 3BR6A 3M3YJ 3E7LA 2G7GA 3FIWA 3H0GJ 2FQ4A 4A69C 5K7FA 1O4XA 3EUPA 3GEUA 2DA5A 1R9TJ 1Y1VJ 4S0HB 3JRCA 5FJ8J 2YS9A 2DA4A 1ETKA 1F43A 1JKRC 2JA5J 2DMNA 3C07A 5IYBJ 2R5YA 3RQIA 2JMWA 2ZB9A 3KNWA 1JJ6C 5EGOA 3BG9A 3PM1A 2V57A 3S1NJ 4MIMA 3GBGA 4A3GJ 1U9NA 5J1UA 3IH2A 2JA7J 1FTTA 3VVYA 4UDSA 3VUQA 2PMZN 2ME0A 1XC5A 3MKLA 1JT0A 2ZOZA 3HTIA 4BKXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T33 A;  2UXU A;  3VOX A;  3S15 J;  3G56 A;  1ETQ A;  2LFB A;  3S1M J;  2ME6 A;  3JSJ A;  1RPW A;  4A3B J;  1TC3 C;  4ACI A;  1RKW A;  4M6V A;  1P7J A;  4FIS A;  3LSG A;  2ID6 A;  2OER A;  3F1B A;  3BHQ A;  4QSH A;  1AKH A;  5F1J A;  3G1O A;  4DYR A;  2HYJ A;  5C4J J;  1K61 A;  1X2M A;  1IG7 A;  3GTG J;  1PUF B;  3I4M J;  4A3F J;  4DZJ A;  3GTJ J;  2QIB A;  3SFI A;  3BJB A;  2DMT A;  3G1L A;  3HTH A;  1JTX A;  1H88 C;  1AU7 A;  3NI7 A;  3ZQI A;  1LE8 B;  2NS7 A;  5CW8 A;  4FCY A;  2DA6 A;  2FBQ A;  2GEN A;  5E3O A;  1GVD A;  3WHB A;  4BBR J;  1POG A;  1VFC A;  3LJL A;  1MNM C;  1H89 C;  1HDD C;  5EF6 A;  5M5X J;  3AQS A;  3VVX A;  2DA1 A;  1BW6 A;  3HOV J;  2JK3 A;  3JRE A;  2KT0 A;  2QCO A;  1YRN A;  1MBF A;  3HKZ N;  1SGM A;  3LSR A;  1HLV A;  2XGC A;  3UKG A;  2G3B A;  3A01 A;  2W53 A;  3L1P A;  5IPA A;  3IH3 A;  4BY1 J;  3ZQG A;  1MBE A;  3LSJ A;  1SAN A;  1OCT C;  4ME9 A;  4DYC A;  5BNG A;  2JJ7 A;  1G2H A;  3VW2 A;  1Y1W J;  2CUF A;  4JX5 A;  1ENH A;  2X9D A;  5C3E J;  1SFO J;  5IP9 J;  2YUS A;  2L0K A;  4X6A J;  2UXP A;  3HOX J;  1VI0 A;  2EQR A;  1IC8 A;  1GV5 A;  3MN2 A;  3S2H J;  2VUM J;  2WUI A;  1Q1V A;  2YVE A;  2M9H A;  1XG1 A;  4JX4 A;  3A02 A;  2XDN A;  1JT6 A;  2QKO A;  5EG0 A;  1F36 A;  4A93 J;  3BRU A;  3GTL J;  1I3Q J;  4MXM A;  3BT9 A;  1VF9 A;  2HYT A;  3I4N J;  3ANG A;  2NP3 A;  2WV1 A;  1B72 B;  5DTD A;  3F0C A;  3JR9 A;  5M5W J;  3M4O J;  3O8G A;  4D5F A;  5DS9 A;  3CRJ A;  1JKQ C;  1MBH A;  2XPW A;  3JRF A;  3GTO J;  2RHA A;  2LR8 A;  3VW0 A;  1ZK8 A;  1IUF A;  3BG3 A;  3TP0 A;  4L5E A;  1IGN A;  2WGB A;  5E3L A;  2DMQ A;  5IOZ A;  1BA5 A;  3PPB A;  3V78 A;  5IYD J;  2LK2 A;  4I76 A;  5M5Y J;  2F07 A;  2LLK A;  1GUU A;  2O9L A;  3JRA A;  2LY9 A;  3S5R A;  2RAE A;  1QRY A;  1YRN B;  1HDP A;  2MGQ A;  2D6Y A;  3HB9 A;  3K7A J;  4UUS B;  1OFC X;  4J19 A;  1MH4 A;  1LFU P;  3PO3 J;  3B6C A;  3MNL A;  2Y30 A;  4AYB N;  2HQ5 A;  2R0Q C;  1JUS A;  1I6H J;  2E19 A;  1GDT A;  2AHQ A;  1E3O C;  5GP9 A;  1CQT A;  5IP7 J;  3HEF A;  3ZQC A;  1A5J A;  2M34 A;  5EFY A;  5FKK A;  2WB1 N;  3BQZ A;  2R5Z A;  5EZH A;  4IHV A;  4ICH A;  2K9Q A;  4YZE A;  2MW8 A;  4HNV A;  3TED A;  3GTM J;  3SJM A;  5C4Y A;  2EZI A;  5J3L A;  1ZKG A;  4JX6 A;  3IV5 A;  2XSD C;  3VOK A;  5FKL A;  3RZD J;  1WCM J;  4Y7N J;  1HCR A;  1P7I A;  3HTA A;  1BW5 A;  4A3D J;  3FK6 A;  2Y0S N;  1IV6 A;  1FJL A;  2MSY A;  2RAS A;  3PAS A;  3MVP A;  3QPS A;  1JKP C;  2E1O A;  3BCG A;  4JNN A;  1RET A;  1K83 J;  2DN0 A;  2XGD A;  5C4X J;  3GTK J;  5J1R A;  5D18 A;  1RR7 A;  4BXX J;  2EH3 A;  3HE0 A;  2DG7 A;  1H8A C;  1NTC A;  1UMQ A;  4B1R A;  5K58 A;  3OOU A;  5EEA A;  1OCP A;  1X58 A;  4CYC A;  2HI3 A;  4ABZ A;  5HOD A;  4I6Z A;  5AQC A;  4IHW A;  2IU5 A;  1FIA A;  2Y2Z A;  5M3F J;  3O60 A;  4GFK A;  2QWT A;  3CCY A;  5J1Y A;  4NEL A;  4PXI A;  4IEJ A;  2HOS A;  1JUM A;  1ZTR A;  4D7N A;  2VI6 A;  4GCL A;  2N8G A;  4RBO A;  3CWR A;  2COB A;  3Q0U A;  2CUE A;  3RZO J;  4DW6 A;  3BR1 A;  2R5Y B;  3LWJ A;  3LNQ A;  2GFN A;  1X2N A;  3G7R A;  3CMY A;  2UXH A;  4XID A;  2HDD A;  5EGO B;  3S17 J;  3LSP A;  2Y9Z A;  3ON2 A;  4BY7 J;  5FKM A;  2VPR A;  3S1Q J;  4A3E J;  4MLO A;  2E2J J;  3O8H A;  2LKX A;  4GCT A;  3FIS A;  3ZOB A;  3AQT A;  5FLV A;  2DA7 A;  2H8R A;  2XB5 A;  2PZ9 A;  2K9N A;  3D1N I;  2GLO A;  4NN1 A;  4L62 A;  5H9T A;  1TWH J;  3Q0W A;  4NDL A;  2GBY A;  1ZGW A;  5F0C A;  1MBG A;  3BTJ A;  4D7M A;  5IYC J;  3HOW J;  5HAW A;  2MG4 A;  2DJN A;  4GFB A;  1JTY A;  4JYK A;  2LD5 A;  4A3M J;  1S7E A;  1U78 A;  3GTP J;  4G12 A;  3OSF A;  1ETO A;  1W0T A;  2HXI A;  2K40 A;  1BJZ A;  1AKH B;  2B63 J;  3E7Q A;  1ZQ3 P;  4M3B A;  2L7F P;  2HOT A;  1W0U A;  4FTH A;  1A6I A;  5EZG A;  1U8B A;  4IHX A;  3ZQH A;  3OSG A;  3DPJ A;  2CJJ A;  4Y52 J;  2O7O A;  1I50 J;  4C3J J;  1TWC J;  3TW7 A;  1WH5 A;  2KDZ A;  5D19 A;  2Q24 A;  4M3E A;  4M3G A;  3H3V K;  2K9S A;  2IEK A;  2VKE A;  2NVT J;  4XK4 A;  5F0H A;  2NX4 A;  3KZ9 A;  3BQY A;  2OPT A;  2CRG A;  2NOG A;  3CDL A;  1BL0 A;  2E2H J;  3BR0 A;  3BG5 A;  2XPU A;  2NVX J;  3QPL A;  1IRZ A;  1JJ8 C;  3NPI A;  1ORK A;  2FD5 A;  2ZOY A;  4XRS G;  2JN6 A;  1LFB A;  1TWA J;  3TP3 A;  1QPI A;  2ZCM A;  4A3K J;  3BR2 A;  1WI3 A;  4V2F A;  1ITY A;  4MFD A;  3A01 B;  5C44 J;  5D1R A;  3VVZ A;  1JKO C;  4GCK A;  3P9T A;  1RKT A;  4A3J J;  4AC6 A;  2HXO A;  1MBK A;  2QOP A;  4GFL A;  3TW6 A;  3A03 A;  1MSF C;  4JKZ A;  3HDD A;  3COL A;  2OI8 A;  2LTP A;  2EBI A;  4DYQ A;  3B6A A;  1PUF A;  2G7S A;  2HKU A;  1Z77 A;  3HOY J;  5K7Z A;  1MSE C;  2DTZ A;  1LE8 A;  4QTR A;  1MBJ A;  4W97 A;  5DAJ A;  4D5C A;  2PBX A;  2UXO A;  3B81 A;  1HOM A;  4JL3 A;  3HOU J;  5HBU A;  4AC0 A;  1HF0 A;  2D5V A;  4XRM A;  2QF7 A;  5F08 A;  3HOZ J;  5F04 A;  5EG0 B;  2X48 A;  5K7H A;  1UI6 A;  3RH2 A;  4RDU A;  3HBL A;  3ON4 A;  1VND A;  5JLW A;  2JWT A;  2NS8 A;  2Y31 A;  3QQA A;  2DA3 A;  3JRI A;  2O7T A;  3HGY A;  4B3A A;  3K2A A;  1ETV A;  4LOC A;  3VW1 A;  1D5Y A;  1APL C;  2H1K A;  3LOC A;  1GV2 A;  1IJW C;  2EZL A;  4B4C A;  3HIM A;  2HOA A;  5HSZ A;  1UG2 A;  3BR5 A;  2JA8 J;  3CJD A;  2FX0 A;  2CQQ A;  3NXC A;  2DMP A;  2GM4 A;  2P81 A;  3G1M A;  2YU9 J;  4QIW N;  2LVS A;  1WH7 A;  1ZR4 A;  4A3I J;  4C3I J;  2ECB A;  2O8K A;  2TRT A;  1FTZ A;  1JGG A;  5IP6 A;  1MH3 A;  1QVT A;  4XIC A;  1U9O A;  3W6V A;  2Y9Y A;  1GT0 C;  2LP0 A;  2XGE A;  2XPV A;  4A3C J;  1ETW A;  4AF5 A;  1B8I A;  2UXI A;  1NK3 P;  3VP5 A;  2YVH A;  3V6G A;  2M2E A;  1WGX A;  4FE4 A;  5F27 A;  3BTC A;  1JUP A;  3WHC A;  4XRS A;  3Q3S A;  2QTQ A;  3SDG A;  4V2G A;  2R5Z B;  3T6N A;  2L9R A;  2TCT A;  3JRH A;  4M3D A;  1WPK A;  4C3H J;  3VPR A;  1B72 A;  2L7M P;  1XS9 A;  4FE7 A;  3CQZ J;  5E3N A;  3S16 J;  1ETY A;  4UUT A;  1DU6 A;  2IBD A;  2CU7 A;  1ZR2 A;  1UHS A;  3DEW A;  2DMU A;  3HTJ A;  4IHY A;  3NAU A;  3DCF A;  1AHD P;  2R92 J;  1NK2 P;  2R7Z J;  1TWG J;  2FJ1 A;  3C2B A;  3IUV A;  2NVY J;  2XRL A;  4DZP A;  5JLX A;  1EF4 A;  3FRQ A;  4HKU A;  3RKQ A;  5FGL A;  2ID3 A;  2OF7 A;  4X1E A;  2ECC A;  4UUS A;  3BR3 A;  4MFE A;  2GUH A;  3S14 J;  1DU0 A;  2JA6 J;  4M3F A;  3ANP A;  1IDY A;  5E3M A;  3QBM A;  3FK7 A;  5FLM J;  3HGG A;  2NP5 A;  3NRG A;  3BTI A;  5CXG A;  3JRB A;  1FEX A;  4BBS J;  4CYC B;  4CGR A;  2ZCX A;  4KWA A;  2DA2 A;  3BTL A;  3KKC A;  2REK A;  4AUX A;  5IOY A;  3QKX A;  3GTQ J;  2CQX A;  2X6O A;  5FKN A;  2EZK A;  4W1U A;  5GPA A;  5FHP A;  2M8G X;  2XB0 X;  3ZQF A;  3ZQL A;  1ETX A;  5CXI A;  5EDN A;  5FMP A;  3NNR A;  1B8I B;  2DG8 A;  1OJL A;  2EZH A;  4C2M J;  1IDZ A;  5F0F A;  3BNI A;  2W48 A;  2WAQ N;  5M3M J;  3LHQ A;  4MO7 A;  3NAR A;  2E2I J;  5GPC A;  2I10 A;  1RES A;  4JP0 A;  4A3L J;  1QVU A;  2ZCN A;  2ELK A;  1TWF J;  3Q0V A;  1Z0X A;  4EEF G;  3PO2 J;  3IH4 A;  3S2D J;  3KKD A;  4MK6 A;  3VIB A;  9ANT A;  1T56 A;  3EGQ A;  3RD3 A;  2NVQ J;  2AO9 A;  2G7L A;  2M0C A;  2R93 J;  2IAI A;  5EYR A;  2G0E A;  3FKI J;  1FIP A;  5FKO A;  2VKV A;  3S1R J;  3OIO A;  3GZI A;  1UI5 A;  2L7Z A;  3JRG A;  3JRD A;  3HM5 A;  3BR6 A;  3M3Y J;  3E7L A;  2G7G A;  3FIW A;  3H0G J;  2FQ4 A;  4A69 C;  5K7F A;  1O4X A;  3EUP A;  3GEU A;  2DA5 A;  1R9T J;  1Y1V J;  4S0H B;  3JRC A;  5FJ8 J;  2YS9 A;  2DA4 A;  1ETK A;  1F43 A;  1JKR C;  2JA5 J;  2DMN A;  3C07 A;  5IYB J;  2R5Y A;  3RQI A;  2JMW A;  2ZB9 A;  3KNW A;  1JJ6 C;  5EGO A;  3BG9 A;  3PM1 A;  2V57 A;  3S1N J;  4MIM A;  3GBG A;  4A3G J;  1U9N A;  5J1U A;  3IH2 A;  2JA7 J;  1FTT A;  3VVY A;  4UDS A;  3VUQ A;  2PMZ N;  2ME0 A;  1XC5 A;  3MKL A;  1JT0 A;  2ZOZ A;  3HTI A;  4BKX A; 
#chains in the Genus database with same CATH topology
 1ETQ A;  2LFB A;  1TLH B;  2HVQ A;  3PNT A;  2E1N A;  2IT0 A;  1QPM A;  2V1N A;  2BZT A;  3JSJ A;  5DUI A;  1RKW A;  3H1C A;  4RMN A;  4FIS A;  2OER A;  2ID6 A;  2QZ8 A;  3F1B A;  1TP4 A;  3BHQ A;  1ZGJ A;  5F1J A;  3G1O A;  4XQF A;  1Y8R B;  2GAU A;  3GLX A;  3EUH C;  4UVB A;  2VBZ A;  1K61 A;  1C0W A;  4RAY A;  5E8G A;  3S2W A;  4HSR A;  1S6L A;  3SFI A;  2DMT A;  2OV7 A;  3NI7 A;  1IN7 A;  2FBQ A;  2M7B A;  5E3O A;  3K6G A;  3WHB A;  1NHA A;  3LJL A;  1IRG A;  2VB6 A;  5EJC A;  1XSV A;  2R7T A;  1YQA A;  5EF6 A;  3AQS A;  4UV9 A;  3VVX A;  1Y8Q B;  1R58 A;  1TQM A;  2P5V A;  1D3Y A;  4FT8 A;  2EV0 A;  2VQL A;  5JHU A;  3Q5F A;  3SFZ A;  4IOA F;  1EH6 A;  3I4P A;  4LG3 A;  4ZDP A;  2EIN H;  1GVJ A;  1YRN A;  1MBF A;  1WJF A;  3HUG B;  2LBF B;  2M5W A;  4AIJ A;  3BZK A;  3A01 A;  4BAC A;  1PP7 U;  5IPA A;  1QNT A;  1MBE A;  1OCT C;  4BQA A;  3IAS 2;  1PVE A;  2OQR A;  1RZ4 A;  5BNG A;  1G2H A;  4U0V A;  4U87 A;  3T5X A;  3WG9 A;  2EV5 A;  4YFN F;  2BW3 A;  4PSX A;  5J8F A;  5KAF C;  1Y6I A;  1OCZ H;  2YUS A;  4P55 A;  4J00 A;  4RGR A;  2UXP A;  1VI0 A;  1W7P B;  4L9V A;  3FZV A;  2LYC A;  3E0J B;  1OQY A;  2M9H A;  1X1C A;  4A5M A;  3PL8 A;  2OUM A;  4AIK A;  5EG0 A;  2COM A;  3BRU A;  2EFW A;  2IA0 A;  1S7O A;  4CHU A;  4HNU A;  2JRT A;  4EM1 A;  5GTI C;  3GZ6 A;  2TDX A;  1HBX G;  2PI0 A;  2NP3 A;  2XGX A;  5BS6 A;  5DTD A;  3IWF A;  4E7J A;  2NNN A;  1X1B A;  3M8F A;  5LGT A;  1BN5 A;  1RC9 A;  2DK8 A;  4D5F A;  3CRJ A;  5JHF A;  2A61 A;  3DP7 A;  5GTH C;  3DU6 A;  2QA4 I;  4ENJ A;  4HST A;  5E3L A;  4QLC U;  4DQ2 A;  5IOZ A;  2VLA A;  2AQF A;  3V78 A;  4I76 A;  2F07 A;  2LLK A;  3EET A;  2LY9 A;  2W00 A;  2RRE A;  4XON A;  1YRN B;  1XMK A;  4PJM A;  5DV5 A;  4NNJ A;  1HDP A;  3HTU A;  2KHM A;  3FBI B;  3UR3 C;  2XUB A;  1OFC X;  3PNY A;  4BYY A;  2E1M B;  3FXO A;  3RKY A;  3VOD A;  4KT6 A;  4AYB N;  1HKT A;  2EWN A;  1F4K A;  2E19 A;  1D8K A;  5GP9 A;  4BDY A;  1SEU A;  3TO7 A;  3BJ6 A;  4DBQ A;  2F4M B;  3HEF A;  3WTZ A;  2M34 A;  5EFY A;  2WB1 N;  2R5Z A;  4ZYG A;  2GXB A;  2CMP A;  5F64 A;  1R1U A;  3LFK A;  5B5E C;  3E3V A;  5ILS A;  4ICH A;  1JGS A;  3H5R A;  3KFW X;  2MW8 A;  4WIB A;  4ZZD A;  2P6S A;  3GTM J;  2LKP A;  1FYL A;  2EZI A;  2HOE A;  5J3L A;  3RTR A;  2GXA A;  4O6J A;  5JFR A;  4JX6 A;  3IV5 A;  2FQ3 A;  4XKB A;  2K9M A;  3RZD J;  3JTG A;  1WCM J;  4Y7N J;  3ABL H;  4KMU X;  2IS2 A;  2XRN A;  4RB0 A;  5ILV A;  2KIQ A;  1TW3 A;  4A3D J;  4YFX F;  5TRD A;  2GA2 A;  5D5W B;  3BCA A;  4BHB A;  1K83 J;  1YTY A;  1IN4 A;  2DN0 A;  1VQ4 I;  4E70 A;  1RR7 A;  1R5H A;  4CSW A;  2YVX A;  3T1B A;  1OCP A;  3K1M A;  3VFZ A;  4BQO A;  1XPX A;  2LOO A;  2Y75 A;  4R79 A;  4ABZ A;  5HOD A;  3LQR A;  2DU9 A;  4I6Z A;  4IHW A;  2IU5 A;  1UCR A;  3RKW A;  5GAG J;  1XSD A;  2VC1 A;  3DWL E;  1QQI A;  2WAE A;  1FOX A;  3FXM A;  4NEL A;  3CP8 A;  4IEJ A;  3VYS B;  4GCV A;  4EQQ A;  4CA0 A;  1MMD A;  1ZTR A;  3LAJ A;  1LNW A;  2HKX A;  3OYB A;  4QWQ A;  3LSH A;  3Q0U A;  4A12 A;  3RZO J;  3K4M A;  5EEH A;  5TGT A;  2O8X A;  4H4K C;  3LL7 A;  3CMY A;  5EGO B;  3GF2 A;  3OV8 A;  4M9Z A;  5K1Y A;  3CCU I;  1MNE A;  3R4K A;  3HXL A;  2VPR A;  3S1Q J;  2LC2 A;  4AWX B;  1VZ0 A;  2Q1Z B;  4U0W A;  2H6B A;  4GCT A;  3I0T A;  2R7D A;  1U6G A;  2DA7 A;  3PFY A;  3F6O A;  3D1N I;  5FD6 A;  4HX8 A;  4AYB A;  3IRR A;  3A4C A;  4L62 A;  4NDL A;  3V8J A;  4EV0 A;  5HDG A;  3LA7 A;  1ZGW A;  2P4W A;  3BCB A;  4BJ5 C;  2XAH A;  1JTY A;  1S9H A;  1U78 A;  2WB1 A;  2BY3 A;  4G12 A;  1ETO A;  1RUN A;  2Z5U A;  3CO6 C;  2B63 J;  3B73 A;  2XKO A;  4FTH A;  2CSO A;  4EM2 A;  3BG7 A;  3TDU C;  3CJN A;  1U8B A;  3ABK H;  2R4G A;  2CJJ A;  4AD9 A;  3OYL A;  1O3Q A;  2K86 A;  2O7O A;  5H20 A;  1I50 J;  1ON1 A;  4BHP A;  3NWT A;  1IRF A;  2EFP A;  1FOY A;  4M3E A;  3IL2 A;  2K9S A;  3KZ9 A;  2QBY A;  2OPT A;  3CDL A;  2M7A A;  1BL0 A;  3KZI C;  2CGP A;  3JW4 A;  2JSP A;  4HLY A;  1R4M B;  1HA8 A;  4ZYH A;  3P5J A;  3GXO A;  2H1L A;  1Y0N A;  3RJP A;  3K69 A;  1I5Z A;  3KEY A;  2XC7 A;  3ZMZ A;  1KON A;  2ZOY A;  3IKT A;  1EV7 A;  4UUV A;  4A3K J;  1WI3 A;  2A69 F;  1Z91 A;  3HOS A;  3HHH A;  1SVM A;  4BH9 A;  1IRX A;  4XLF A;  1E3H A;  1JKO C;  1K79 A;  3AG3 H;  2KDO A;  2VT2 A;  3VB2 A;  2ESN A;  3QYF A;  1MSF C;  4JKZ A;  3N4M A;  5F6F A;  2KIF A;  1JHF A;  2B7E A;  2IP2 A;  3CCQ I;  1EH8 A;  5K7Z A;  2FU4 A;  4RGX A;  4X0G A;  2BEO A;  2HYF A;  2ZJQ F;  3I9V 2;  3V42 A;  3KP3 A;  3ZRG A;  4RB1 A;  3HL2 A;  1T0F C;  2J5P A;  3HOU J;  5J40 A;  5HBU A;  4EJV A;  2D2W A;  3LSI A;  2GIZ A;  4XRM A;  1YIJ I;  2AQE A;  4CDG A;  5GAH J;  3L2V A;  3KP6 A;  5K7H A;  4IZZ A;  3Q9S A;  3RSN A;  4AU7 A;  2JWT A;  5JLW A;  1SFX A;  3K10 A;  2PJR B;  3QPH A;  4LOC A;  3VW1 A;  1A31 A;  1K78 B;  4OAZ A;  1OLT A;  3VEP A;  3LOC A;  1GV2 A;  1S3J A;  3M8J A;  3HIM A;  2ZXW H;  3ML6 A;  3VOE A;  5HSZ A;  3NS4 A;  2CQQ A;  3NXC A;  4XBF A;  1FSE A;  4DVY P;  1R36 A;  3CC7 I;  3G1M A;  3I59 B;  1WH7 A;  1ZR4 A;  2JSC A;  2RDP A;  4RLF A;  3JSO A;  1HW2 A;  3LAP A;  2DFI A;  4N4N B;  4RGS A;  5IP6 A;  4XIC A;  1U9O A;  5HS7 A;  1GT0 C;  2XGE A;  3DV8 A;  3KLN A;  3F21 A;  1ETW A;  2QLZ A;  3FXQ A;  1TZL A;  3V6G A;  4XRS A;  3BTC A;  3DBR B;  1XMA A;  4LMY A;  1KA8 A;  1Z6R A;  2LF7 A;  1ZLJ A;  2DQR A;  4BUP A;  5HVQ C;  4KIG A;  5D6F A;  3NWS A;  2TCT A;  5KNL A;  3VPR A;  1B72 A;  2R7O A;  1ZLK A;  4UUT A;  3CLQ A;  2IBD A;  3ABM H;  1HXD A;  2HYG D;  1S8N A;  3DCF A;  3OY9 A;  4L9N A;  3ESW B;  3OYE A;  5BOX A;  1TWG J;  4N4O B;  1TT0 A;  1S7A A;  3C2B A;  1IO2 A;  4GXO A;  3IUV A;  2NVY J;  3VWB A;  4XM3 A;  1XCB A;  5FRO A;  1J2X A;  3LMM A;  3WGH A;  1W36 C;  2ID3 A;  1FNN A;  4X1E A;  2ECC A;  5JI6 A;  4CIC A;  3HIF A;  3QOD A;  2GUH A;  4UXN A;  3S14 J;  1DU0 A;  2JA6 J;  4M3F A;  1U3E M;  4Y33 A;  2EIJ H;  3QRF F;  5FLM J;  4LJZ F;  2BHZ A;  1IN8 A;  2E60 A;  5CXG A;  3GZN B;  2CUJ A;  5ICF A;  2FMY A;  4CGR A;  3ERE D;  1AA7 A;  2CWE A;  2DA2 A;  2PMH A;  3KKC A;  2REK A;  3J81 Z;  2VXZ A;  3GTQ J;  1BI3 A;  1W5T A;  2EZK A;  4ZDL A;  4W1U A;  4G7H F;  3FXU A;  2L3D A;  5FHP A;  1SMY F;  3ZQL A;  2P5L C;  3BZ6 A;  1REP C;  4MEY F;  3JAM Z;  4CCO A;  2EZH A;  4B43 A;  1IDZ A;  2LY2 A;  3QYE A;  4U9N A;  1R7J A;  2M8E A;  4KT5 C;  2W48 A;  4FQG A;  3I5U A;  1SFE A;  4F3Q A;  1W7P D;  3E5Q A;  3HRM A;  4XNF A;  2ZY9 A;  3LHQ A;  2I10 A;  4WXC A;  4JP0 A;  3MKZ A;  1QVU A;  4KIC A;  3GWZ A;  1WKM A;  1TWF J;  1Z0X A;  2X51 A;  4EEF G;  3PO2 J;  4JOM A;  3KKD A;  2ZO4 A;  1XTA A;  3EGQ A;  1IN5 A;  3RPU A;  2NVQ J;  2XDV A;  1FOK A;  2JQ7 A;  1FOW A;  5EYR A;  3CUQ B;  5FKO A;  4ANJ A;  1OR7 C;  3S1R J;  1FX7 A;  3HRU A;  3OYN A;  2L7Z A;  3GEU A;  5K7F A;  1KQ9 A;  1X4O A;  2L2O A;  1Y1V J;  2ZME C;  1KQ0 A;  4S0H B;  4BJ6 C;  5IT3 A;  3BG6 A;  5FGM A;  2PFB A;  1YIT I;  1U2W A;  3P9I A;  1OYW A;  3KP4 A;  1ETK A;  4PDK A;  4UHT A;  1JKR C;  2DMN A;  2R5Y A;  3RQI A;  5LLQ A;  4CCK A;  4YII A;  2C6Y A;  3PM1 A;  4OIR F;  3K4N A;  1ZYR F;  3S1N J;  1LQ1 A;  1QZY A;  1X19 A;  2UUZ A;  2JA7 J;  4AIH A;  1KGS A;  3HOT A;  2IS6 A;  4AVZ A;  3HKZ A;  4FET A;  1N77 A;  2OZ6 A;  3E6M A;  2UWM A;  2V1D A;  4BGD A;  1OCO H;  3C3W A;  4ENN A;  3VOX A;  3G56 A;  2QM3 A;  3S1M J;  2ME6 A;  3BZC A;  2IA1 A;  4A3B J;  3QP5 A;  4BEH B;  3DKY A;  3TBI A;  3AFH A;  4YFK F;  5LGN A;  1AKH A;  1MDM A;  3M7G A;  5C4J J;  3L2W A;  1PP8 F;  3L2R A;  3V8K A;  3WGI A;  2Z99 A;  1IG7 A;  1PUF B;  3I4M J;  1UG0 A;  4A3F J;  3BJB A;  1BR2 A;  3G1L A;  1J9I A;  4OMY A;  4D1Q A;  2NS7 A;  1T39 A;  4F55 A;  2DA6 A;  2GXG A;  1SFU A;  3FWE A;  3WTX C;  5CJ9 A;  1POG A;  3N05 A;  1MNM C;  1GXP A;  1H89 C;  1HDD C;  5HLH A;  2LNB A;  1F9N A;  3HC7 A;  2DA1 A;  1LVA A;  4WXD A;  4DGW B;  1NG6 A;  3KEO A;  3M1C A;  3SZP A;  3QAH A;  1TNT A;  2DOE A;  2BE5 F;  2P0W A;  3FHN A;  2JK3 A;  1LEB A;  4AID A;  1RRJ A;  1OCC H;  2QCO A;  4NC8 A;  2DOD A;  2GWR A;  5HS8 A;  1ZGA A;  2XGC A;  5D5X B;  2L02 A;  2G3B A;  4BY1 J;  2CQ7 A;  4EJU A;  1SAN A;  5CVU A;  1J75 A;  1FYK A;  4ME9 A;  1FMW A;  2MFZ A;  2K3P A;  4CZC A;  2HTJ A;  3I64 A;  2X9D A;  2XAF A;  3J81 K;  2WBM A;  1OCR H;  1WJ5 A;  2L0K A;  3HOX J;  2RNJ A;  1N78 A;  1ZG3 A;  4M6Y A;  2WUI A;  1Q1V A;  1SVL A;  2GQQ A;  2WY7 Q;  4LLL A;  3H3Z A;  3A02 A;  3JAM K;  2CFX A;  1BOB A;  2JT1 A;  4RAF A;  4OMZ A;  4A93 J;  4PK4 A;  3GTL J;  4I0A A;  3V7C A;  5DDG A;  4MXM A;  1O3S A;  1VF9 A;  5LGU A;  1Z67 A;  3PIP F;  2XRO A;  1XDS A;  1J0R A;  1LKX A;  3ASN H;  4F93 B;  1T0F A;  1MZB A;  3SEQ A;  4IRH A;  5HNF A;  3WTS C;  1I27 A;  2XPW A;  4Z2Y A;  3GTO J;  2LR8 A;  2Z1D A;  1ZK8 A;  2X1D A;  3HZJ A;  1V5G A;  4L5E A;  4Q47 A;  2QEN A;  1BC8 C;  1R5I D;  3IWZ A;  1CF7 B;  1BA5 A;  3EUK L;  4LIU A;  2QEX I;  2K4B A;  1GUU A;  2O9L A;  3JRA A;  4PJ0 C;  3S5R A;  1UEL B;  2BOL A;  2FNA A;  4G9Y A;  3SQN A;  4LLN A;  1FC3 A;  2MGQ A;  2AS5 F;  3K7A J;  4UUS B;  4U7D A;  4A0Y A;  2Z9O A;  2ISY A;  5DEQ A;  3PO3 J;  1T95 A;  5E20 A;  2HQ5 A;  2R0Q C;  1GDT A;  3F72 A;  2PG4 A;  1XGM A;  3I3L A;  1A35 A;  3K4K A;  2PLY A;  1A5J A;  2WC2 A;  1VQ8 I;  4HQE A;  5FKK A;  2KJB A;  3BQZ A;  2BY0 A;  2XAJ A;  4HX7 A;  2VE8 A;  5EZH A;  3MWM A;  5DUK A;  5H6R A;  1FBU A;  4HNV A;  3E5U A;  4ZTF A;  3VSL A;  2HQN A;  2EPF A;  1HQC A;  1UZC A;  4MQ9 F;  3DXJ F;  1ZKG A;  3ZMV A;  3RQ4 A;  4UY8 I;  2ZJP F;  1ZRC A;  1MMG A;  2ZJR F;  1SC7 A;  2YPR A;  2ELJ A;  1HCR A;  4EAT A;  1ZG5 A;  1F1Z A;  1I6X A;  4R1H A;  3J7Z I;  3FK6 A;  2Y0S N;  1IV6 A;  4IRI A;  3QPS A;  1JKP C;  2E1O A;  1WWX A;  2JZY A;  1RET A;  2OCC H;  4JNN A;  3W2W A;  4E6K G;  2XGD A;  5D18 A;  1S5L C;  3OS2 A;  3ZXS A;  1MMA A;  3HE0 A;  2DG7 A;  1NTC A;  5D5U B;  5K58 A;  3C2H A;  5BPI A;  3PSI A;  3IKV A;  1YW7 A;  2HI3 A;  1ZH5 A;  2HPI A;  3PSF A;  5LRS A;  3T8R A;  4JK1 X;  2Y2Z A;  2KIS A;  2ZCW A;  2M87 A;  2E1C A;  2Y48 A;  1GXQ A;  2Y0M A;  1PJR A;  3F23 A;  2V1X A;  2HOS A;  2O5R A;  5CVJ A;  4UVA A;  3OIQ A;  4CH7 A;  2N8G A;  2CUE A;  3CCM I;  4IXA A;  3AG1 H;  5LEK A;  3LWJ A;  2GFN A;  2F5D A;  2CW7 A;  2HDD A;  3S17 J;  2Y9Z A;  3FXK A;  1Z21 A;  1FYM A;  4ENK A;  2L9V A;  3J80 Z;  3C1D A;  3BOQ A;  5JVG F;  2BVL A;  1IW7 F;  2BBY A;  3I58 A;  4G6Q A;  2HZD A;  4GO1 A;  5J6X A;  5KVR A;  3LA2 A;  2XB5 A;  3G2B A;  1D1A A;  5H9T A;  3Q0W A;  3KIO A;  2O0Y A;  5DM6 F;  3ELK A;  1YIO A;  3DTE A;  2B1E A;  5HAW A;  3SHF A;  4DNC A;  1K4T A;  1S7E A;  3COA C;  3IP4 B;  1W0T A;  2L54 A;  2LH9 A;  3GVA A;  3OSF A;  4HLX A;  2Q2E A;  2X1E A;  4ESB A;  3E7Q A;  4XLA A;  1ZQ3 P;  2L7F P;  4KIT B;  3KP2 A;  1R1T A;  1VQ7 I;  3OYG A;  3OSG A;  3RCO A;  1YOV B;  3K2Z A;  4C3J J;  3VTI A;  1TWC J;  1OR7 A;  1BI2 A;  1WH5 A;  2KDZ A;  1YW8 A;  2Q24 A;  3CUO A;  1SAU A;  1WI9 A;  3H3V K;  4F7Z A;  2NNY A;  2Y0S A;  3EYI A;  2NOG A;  2OQG A;  3K4J A;  3P7N A;  2E2H J;  3BR0 A;  1NG7 A;  2W85 A;  2V7F A;  1DGW Y;  2F5C A;  2ZME A;  3QPL A;  4OWR B;  1K4S A;  1IRZ A;  4EVI A;  3S93 A;  4XRS G;  2JN6 A;  1LFB A;  1TWA J;  5LHI A;  5BPD A;  3CLO A;  2BY2 A;  2QQA A;  3R61 A;  3ZN0 A;  4PFO A;  1B59 A;  2GIV A;  4EJO A;  1DGR M;  2LSO A;  3NQO A;  1OIS A;  3E6D A;  3A01 B;  3C18 A;  1LJ9 A;  5DCM A;  2FML A;  1MKM A;  1VQP I;  2XF5 A;  4DOZ A;  2QSH X;  1RKT A;  4A3J J;  4AC6 A;  5FLX K;  2NVU B;  5B66 C;  4BJT A;  2Z2S B;  3A03 A;  4I99 C;  3RPQ A;  1JXS A;  3OYC A;  4M73 A;  1QHG A;  2EBI A;  2F5E A;  2BW3 B;  1G8X A;  1Z77 A;  4OOI A;  3HOY J;  1MMN A;  4IL6 C;  1LE8 A;  2OTL I;  2ICW G;  2OBP A;  3D0S A;  3E1S A;  3HG9 A;  4QTR A;  3W2V A;  5DAJ A;  5J8C A;  1GHC A;  3C7J A;  4AC0 A;  3V4G A;  4BDZ A;  4ZDO A;  4R8H A;  3VYR B;  4YG2 F;  2VE9 A;  4C2M A;  2QF7 A;  1RNL A;  5F08 A;  5F04 A;  5EG0 B;  2X48 A;  3HOZ J;  3RH2 A;  1DDN A;  3HBL A;  5HOO A;  2XSJ C;  1FMV A;  3U1D A;  1UHW A;  1VND A;  4B3A A;  3L2U A;  1T8I A;  4I09 A;  4NUB A;  4XN0 A;  1SMT A;  1ON2 A;  3OL3 A;  2HGC A;  3ZMS A;  1ZEL A;  4XKC A;  3SYT A;  1IJW C;  4XR6 A;  1VQ9 I;  1Y56 A;  3A0H C;  2MYS A;  3BR5 A;  1TNS A;  2ZJ2 A;  2FX0 A;  3KP5 A;  3Q9V A;  3ZR8 X;  1ONV A;  4IJA A;  2HTS A;  1WVR A;  2KPM A;  3FMR A;  5LFA A;  3D5R C;  4I0B A;  2GM4 A;  5DD4 A;  4UNO A;  4XOR A;  2IS4 A;  4U7B A;  1ODD A;  1L0O C;  1V5F A;  4A3I J;  2DYS H;  3KLO A;  2ECB A;  3QOE A;  3CTA A;  1B9M A;  1FTZ A;  2NS0 A;  2WAF A;  5CYV A;  1FLI A;  1JGG A;  1BC7 C;  2WAD A;  3W6V A;  2XF7 A;  3K9T A;  2XPV A;  5B1B H;  1T08 B;  1K6O A;  2B3W A;  3H9G A;  4HV5 A;  4HRI A;  4OD5 A;  1P4A A;  4HDV A;  4B48 A;  3F3X A;  3J7Y J;  2M2E A;  3WHC A;  3I55 I;  2A05 A;  2E5N A;  4GGG A;  4HAM A;  4V2G A;  2R5Z B;  3T6N A;  2L9R A;  4M3D A;  4C3H J;  1W5C C;  2XKP A;  2VN2 A;  4XSZ F;  3J80 K;  4C2U A;  1O57 A;  4BE1 A;  2ESH A;  1A04 A;  5K5Q A;  4RAZ A;  3ECO A;  3OR2 C;  2E36 A;  4KUM A;  3QPT A;  2CU7 A;  3SDB A;  4NHJ A;  3ABT A;  1LEA A;  3K8P C;  2RGV A;  2DMU A;  2MH2 A;  2WAQ A;  3I71 A;  1AHD P;  4IHY A;  3HTJ A;  4A0X A;  1NK2 P;  3SZG A;  1U5T C;  4EM0 B;  3WTU C;  1X4P A;  4QPO A;  2UXN A;  3BP8 A;  5KCM A;  2DCE A;  2F5F A;  4KIS A;  3FRQ A;  1TBX A;  4N0B A;  3M9A A;  1WJD A;  2EFO A;  2R7F A;  2VQG A;  2OF7 A;  3SEZ A;  3MAJ A;  2ZNY A;  3BR3 A;  4ETS A;  1HSJ A;  4G94 A;  3ANP A;  1BOA A;  4NBQ A;  1Q1H A;  5HDN A;  2W7N A;  2Z33 A;  3U2R A;  3NRG A;  3CF2 A;  2ISZ A;  3L00 A;  3JRB A;  2JVG A;  1J09 A;  4KIF A;  3ZGK A;  4BBS J;  2R7W A;  4C30 A;  2ZCX A;  4J01 A;  3K4L A;  2QQ8 A;  1LB2 A;  2XHK A;  3BTL A;  4I02 A;  2RV8 A;  1F5T A;  3FKJ A;  5GAD J;  4II3 A;  1R5G A;  3UNG C;  2KL4 A;  3G3Z A;  3EQL F;  5L3B A;  5EDN A;  3NNR A;  4XLH A;  1BI1 A;  1OJL A;  3MKW B;  4KNY A;  5CVR A;  2FBI A;  4C2M J;  4F91 B;  1W4M A;  4NQW A;  3DBL B;  3O2P E;  2NOJ B;  5LBQ A;  2CS3 A;  4NB5 A;  5LHG A;  4FX4 A;  4G6D A;  3NAR A;  2F4I A;  4JBA A;  5GPC A;  3K1P A;  4IHS A;  2DQL A;  2ZXH A;  3ZMD A;  4A3L J;  2UV1 A;  2DT6 A;  1MD0 A;  4KIB A;  3Q0V A;  1YW9 A;  1T38 A;  1G3Y A;  1AWC A;  3KEQ A;  4MK6 A;  4LK1 F;  3VIB A;  3BRO A;  2CQN A;  4A6E A;  9ANT A;  3RD3 A;  2AO9 A;  3QU3 A;  4FX0 A;  3V8L A;  2VKV A;  2R7Q A;  2BV6 A;  3JRG A;  3HM5 A;  1R00 A;  4IPA A;  2G7G A;  2P8T A;  3FIW A;  5FRN A;  2FQ4 A;  4A69 C;  3BPX A;  5CQG A;  1MJA A;  2KRH A;  5JVT A;  3QP6 A;  2YSR A;  5KAI C;  4II2 A;  5FJ8 J;  3JRC A;  4KDP A;  4LB5 A;  2WY8 Q;  1AOY A;  1P92 A;  4RM2 A;  2YS9 A;  4M9S A;  2DA4 A;  1STZ A;  3C07 A;  1OYI A;  2XAQ A;  2ZB9 A;  1JJ6 C;  3AL0 B;  2KIU A;  3S32 A;  1YG2 A;  3H0D A;  2EFN A;  2QBY B;  3GBG A;  2HPM A;  3F8N A;  3J7A Y;  3LST A;  2E5Z A;  3L2C A;  4OIP F;  3IH2 A;  4A3G J;  4KN7 X;  2PMU A;  3H9Q A;  2PMZ N;  3TMO A;  3CMA I;  1R4N B;  4P1W A;  1VTN C;  1JT0 A;  2V1U A;  3IRQ A;  2YU3 A;  2ZOZ A;  4DIQ A;  4IQ4 A;  4NC6 A;  3HTI A;  3DEE A;  4YIR X;  2QSF X;  1T33 A;  2UXU A;  3S15 J;  3JCU C;  1DUX C;  4Z6Y A;  1VQL I;  2X4H A;  1RPW A;  3K4B A;  4ACI A;  1MIJ A;  4M6V A;  1P7J A;  3LSG A;  1SAX A;  1U0J A;  1Z1D A;  3HHG A;  5D4R A;  4I7H A;  3EDP A;  4WWC A;  2Q0O A;  2DFH A;  1X2M A;  3GTG J;  2MC3 A;  4DZJ A;  3GLL A;  1ZG1 A;  1ZRE A;  1A6Q A;  2QIB A;  2CYY A;  3HTH A;  2P7V B;  4YIF A;  5CW8 A;  2KRF A;  4Q48 A;  4IHT A;  4WX9 A;  2UXX A;  4WF2 A;  1GVD A;  4BBR J;  4F92 B;  5LHH A;  3BJO A;  2VJ5 A;  2IVM A;  3SZT A;  2M45 A;  5IT9 Z;  1BW6 A;  1UAA A;  3HOV J;  1BI0 A;  4OD4 A;  1YJN I;  4PJJ A;  3WTW C;  1KZH A;  3RDI A;  2JVH A;  2PX9 A;  4WXH A;  3HKZ N;  2AXL A;  2VOD A;  5FD5 A;  2DFE A;  3LSR A;  1HLV A;  2W53 A;  2IGN A;  5FO5 A;  1KU9 A;  4FHT A;  3LSJ A;  4XLE A;  3HRT A;  5A2Q K;  2ZSH B;  2NRA C;  4LGW A;  2M3A A;  2DPD A;  4MHG A;  2JJ7 A;  4HEA 2;  4XOP A;  2A68 F;  1Y1W J;  4HOB A;  3F8B A;  3BY6 A;  2RKH A;  1ENH A;  4LLG F;  2LRD A;  4RLQ A;  5C3E J;  1B6A A;  1SFO J;  5IP9 J;  5E79 C;  2OU2 A;  1FT9 A;  1IC8 A;  2EQR A;  4RM3 A;  1GV5 A;  3CJQ B;  3MN2 A;  3S2H J;  2CV0 A;  3ZMT A;  1YJW I;  1XB4 A;  3HSE A;  2YVE A;  3S8P A;  1XG1 A;  3R60 A;  4ZZL A;  3JSP A;  3B02 A;  2QKO A;  3H92 A;  1IXS B;  1F36 A;  2KZV A;  2ZXI A;  4IRG A;  4EMS A;  4G8X A;  4E7I A;  2HYT A;  3ANG A;  1B72 B;  4CYD A;  2PMZ A;  1D8J A;  2E7X A;  3MD2 A;  4BXF A;  2I8D A;  5M5W J;  3CC4 I;  3P9C A;  3M4O J;  5DS9 A;  1OMI A;  1JE8 A;  2E1M C;  2ZC2 A;  3JRF A;  2HZT A;  5E8I A;  2RHA A;  3BG3 A;  2H94 A;  1E3P A;  4I98 B;  2G7U A;  4D9J A;  4RB3 C;  2QQ9 A;  2DMQ A;  3PPB A;  2FBK A;  5J4V A;  2HU9 A;  3OYA A;  2FUG 2;  1Z7L A;  3GME A;  4CO8 A;  4XLP F;  3HB9 A;  4QPQ A;  4J19 A;  3WU0 A;  3NEU A;  1MH4 A;  1LFU P;  4GDF A;  3WE2 A;  2Y30 A;  1I6H J;  1WHU A;  3AKZ A;  2AHQ A;  1CQT A;  1IAW A;  2CV2 A;  2K4J A;  3MQ0 A;  5IP7 J;  1D5V A;  1G6N A;  3DKW A;  4HG2 A;  3H35 A;  4HQM A;  3OYJ A;  3A0B C;  4IHV A;  1DPR A;  4YZE A;  3TED A;  1Y0U A;  1L3L A;  2FNP A;  3EYY A;  4HW0 A;  5ICC A;  1FP2 A;  4MEX F;  1D0X A;  1KYZ A;  4YRV A;  3T8T A;  3H3U A;  1HST A;  3CDI A;  1WQ2 A;  1YO5 C;  1HW5 A;  4L0Z B;  3FBN B;  2DOA A;  3HTA A;  3KYD B;  2QKL B;  4ENM A;  2MSY A;  2RAS A;  1XGO A;  2K85 A;  2OJE D;  3IHU A;  3WU1 B;  5C4X J;  3QYB A;  4D0P A;  2W24 A;  4XLN F;  1UJ8 A;  2EH3 A;  5E18 F;  1XGN A;  2HQR A;  4ASN A;  3CJT B;  1H8A C;  1UMQ A;  1R23 A;  2A3S A;  4CZZ A;  1X58 A;  1U5T A;  4CYC A;  3OS1 A;  3OYF A;  2DTR A;  5AQC A;  3O6B B;  3TO9 A;  4G7Z F;  4L9T A;  4UVC A;  2VJI A;  3VYT B;  1FIA A;  3CZ6 A;  2BGC A;  2IS1 A;  4AVP A;  2XAU A;  3CCJ I;  2KMU A;  1IF1 A;  2EFQ A;  2L9S A;  3CCY A;  3R0A A;  3A1Y A;  4PJN A;  5GAE J;  1UB9 A;  2JUC A;  2JA2 A;  3FF5 A;  1S72 I;  2L9N A;  1JUM A;  5IT9 K;  4D7N A;  3VDX A;  2VI6 A;  4RBO A;  3OYM A;  2COB A;  2Z16 A;  4MTD A;  1U8R A;  2VJJ A;  1KU2 A;  3PIO F;  4DW6 A;  2R5Y B;  3ECH A;  4OIO F;  1XD7 A;  2GA1 A;  2IGO A;  1X2N A;  2UXH A;  4XID A;  4PJL A;  3LSP A;  4BY7 J;  4HF1 A;  4I01 A;  2V4J C;  2K9L A;  3F8M A;  4MLO A;  3VYU B;  4GYI A;  3O8H A;  1TQP A;  4XLC A;  5L3C A;  2LKX A;  1W5S A;  3A2K A;  4P9F A;  3FIS A;  3IUO A;  5FLV A;  1FBQ A;  1ULY A;  1M1E B;  2PQ8 A;  5HLI A;  2I5U A;  3GX4 X;  2K9N A;  2PZ9 A;  4P9U A;  4NN1 A;  4IKF A;  1BJA A;  2KQR A;  5F0C A;  2E34 A;  3BTJ A;  4D7M A;  5IYC J;  2MG4 A;  2DJN A;  4B47 A;  2V6E A;  5L3E A;  4JYK A;  2FOK A;  2LD5 A;  4A3M J;  3GTP J;  2ZXJ A;  4KFC A;  2K02 A;  1AKH B;  5D6E A;  4KN4 X;  3CMM A;  4M3B A;  1W0U A;  1MDM B;  2HOT A;  1ERD A;  1A6I A;  5EZG A;  4IHX A;  2KZG A;  1LFP A;  3ZQH A;  4Y52 J;  2MLK A;  3KET A;  1YI2 I;  1Y39 A;  3DPJ A;  2RN7 A;  2L7K A;  4CUG A;  4ON0 A;  5D19 A;  4M3G A;  3FXJ A;  3K70 C;  2Z3Y A;  5F0H A;  3S3M A;  2NX4 A;  3BQY A;  3BG5 A;  3GEZ A;  5CQE A;  4EJT A;  1QBJ A;  2ZNZ A;  5CKT A;  2YR2 A;  1ORK A;  3NPI A;  2PN6 A;  2J5O A;  3L09 A;  2A5W A;  3TP3 A;  1QPI A;  2ZCM A;  2MLG A;  3BR2 A;  4ZTJ A;  4ITV A;  4CCM A;  3KE2 A;  3G71 I;  4I2O A;  3K4C A;  1YS6 A;  1PUE E;  2VKD A;  4KMF A;  3CP2 A;  2VON A;  5C44 J;  4BQQ A;  3E6B A;  2WV0 A;  2V9P A;  4U9L A;  3MKY B;  2HXO A;  1WSU A;  4GFL A;  1S29 A;  5FLX Z;  1OKR A;  3TW6 A;  2MAB A;  3MFK A;  4HF2 A;  2LTP A;  5E1X A;  4BAY A;  2OA4 A;  2LDU A;  1IZ1 A;  3H5A A;  4IO9 F;  3BC8 A;  3K70 D;  3FMQ A;  1MBJ A;  5J47 A;  4D5C A;  4BQN A;  2L4M A;  2EIL H;  4ZC3 A;  2D5V A;  2EA4 A;  2IA2 A;  2CW0 F;  2ZFU A;  1VQN I;  1T6S A;  1UI6 A;  4A5N A;  3KCC A;  3ON4 A;  4Y13 A;  2HQA A;  2X0L A;  3DPT A;  5H2F C;  3F8C A;  3FXL A;  2OTJ I;  2L01 A;  3JRI A;  2O7T A;  2DA3 A;  3HGY A;  3HUG A;  1APL C;  2H1K A;  1YX5 A;  4FAS D;  3ULQ B;  2RNG A;  2HOA A;  5E1Z B;  1UG2 A;  2BY1 A;  1Z3X A;  2JA8 J;  4N9I A;  3CJD A;  4BS9 A;  2ADU A;  3LA3 A;  4E4H A;  4Q4Z F;  3RIR A;  3IAM 2;  3HSR A;  4ZYE A;  3ABU A;  3OMY A;  4C3I J;  2CFO A;  1W7P A;  4UB6 C;  4BL0 B;  1MJ9 A;  2O8K A;  3J7A O;  2VQC A;  1MH3 A;  3TQN A;  2HVR A;  1G4D A;  2A07 F;  2LP0 A;  2LMD A;  1VQM I;  1YE9 A;  1KYW A;  4XRF A;  1NK3 P;  1UST A;  4FE4 A;  5F27 A;  1JUP A;  2FXA A;  3ZQ7 A;  3Q3S A;  3CCR I;  2P7C B;  2QTQ A;  1LVK A;  2KIM A;  4RA2 A;  1FY7 A;  2MC4 A;  2YX4 A;  3JRH A;  2L7M P;  1XS9 A;  3U21 A;  3CQZ J;  3I54 A;  1X1A A;  1ETY A;  3I53 A;  1B9N A;  1DU6 A;  2K7L A;  5LRR A;  3CES A;  3MCZ A;  2M30 A;  3OOP A;  4HZF A;  4HX4 A;  2PBI A;  1K7A A;  1UHS A;  3DEW A;  3FXR A;  4OAY A;  5D8L B;  3N97 A;  1WJA A;  3CC2 I;  3BWG A;  3W6J B;  2IW5 A;  5KHD A;  5LEJ A;  2FJ1 A;  5K5R A;  2CUZ A;  4M6X A;  2XRL A;  4XKW A;  4DZP A;  5JLX A;  1EF4 A;  4HKU A;  3H9J A;  3RKQ A;  5FGL A;  1WJB A;  1G3S A;  2DJI A;  3T0Y A;  1I1S A;  1VQ6 I;  4MFE A;  1IDY A;  5E3M A;  1B1B A;  1QU3 A;  1ACI A;  3PQJ A;  3HGG A;  1KU7 A;  2NP5 A;  3BTI A;  3TKY A;  3MMY B;  2EIM H;  4L9J A;  2F2E A;  2ZKZ A;  4KWA A;  2FA5 A;  4BHC A;  2XV4 S;  4K2E A;  3F6V A;  4Y3O A;  2X6O A;  5FKN A;  3DLL F;  1E0E A;  1XDU A;  2DFF A;  2XB0 X;  2KRC A;  4Y17 A;  1T98 A;  5CPR B;  2V79 A;  1QA6 A;  2F5V A;  2XVC A;  1RUO A;  3PNV A;  1KQ8 A;  3CCV I;  2QGU A;  3NRV A;  4L5I A;  1X3U A;  1IV8 A;  1EKE A;  3KX2 A;  1P6R A;  2VOO A;  1WFX A;  2W82 A;  3QOP A;  1ZAR A;  2WAQ N;  5M3M J;  2FOW A;  3CUQ C;  3IC7 A;  4MO7 A;  1NH3 A;  1VQO I;  4CXF A;  1RIO H;  1QO0 D;  2ELK A;  5AIP A;  4ZYA A;  2A6T A;  2QKM B;  5E17 F;  2HFH A;  5HLT A;  4IVN A;  1RR8 C;  3R6S A;  2JTV A;  3IH4 A;  3S2D J;  3MZH A;  2H8W A;  1FSH A;  4Y15 A;  1T56 A;  2WTE A;  1UFM A;  3DTK A;  2G7L A;  2QSG X;  2ETH A;  2IAI A;  2RQP A;  3RKX A;  5DM7 F;  2G0E A;  2LG4 A;  1FIP A;  3OIO A;  3U9G A;  3HPH A;  4ZH4 F;  3JRD A;  3S3N A;  3BR6 A;  3DQV C;  3KZY A;  4OIN F;  4CCN A;  1O4X A;  2FRH A;  3HSF A;  4CCL A;  3FMS A;  2DA5 A;  2Q2E B;  4HYE A;  2RC4 A;  1DQU A;  1MGT A;  2GOX B;  1HKS A;  3GO5 A;  5ILU A;  1F43 A;  2JA5 J;  1YYV A;  5IYB J;  2V9V A;  4TV7 A;  4G6T B;  2UZK A;  2ZBK A;  3KNW A;  3DLA A;  4XKV A;  3BG9 A;  5EGO A;  2HDW A;  2MA3 A;  2V57 A;  4KJZ A;  1FZP B;  4MIM A;  1G3W A;  3QU6 A;  1R1V A;  1YLF A;  4C2T A;  1U9N A;  5J1U A;  3BLY A;  1FTT A;  1R71 A;  1IXC A;  2ZME B;  1Z7U A;  3ISP A;  3BJA A;  3WG7 H;  1O7F A;  1XC5 A;  1VQ5 I;  2QWW A;  3MKL A;  4M9X A;  2M1B A;  1ZRF A;  4B3X A;  1RI7 A;  4RS8 A;  4L18 B;  3JTH A;  2CH0 A;  5HNH A;  2L5Q A;  5AIQ A;  2BYV E;  3D5S C;  3MZ8 A;  4XSX F;  2F48 A;  3GYH X;  1TC3 C;  2E7W A;  4PZJ A;  2O6G E;  5DCM B;  2W84 A;  2JPB A;  1X1P A;  2VQH A;  4QSH A;  3V7R A;  3OYI A;  3WGG A;  2X6W A;  2DT5 A;  4DYR A;  2HYJ A;  2IJL A;  1UHM A;  2R7R A;  3DEU A;  4HV6 A;  3CDH A;  3GTJ J;  4PGG A;  1JTX A;  1H88 C;  4PUS A;  1Z05 A;  3ZQI A;  1LE8 B;  1AU7 A;  4FCY A;  1I1G A;  2DI3 A;  3RYR A;  2GEN A;  3QWL A;  3ZPL A;  2H27 A;  1VFC A;  1JHH A;  3GFJ A;  3KZZ A;  1ZN2 A;  1Z3Y A;  3I56 I;  5DCF A;  5M5X J;  1EJ9 A;  1DPU A;  4YEJ A;  1J7K A;  2E71 A;  2KLO A;  3L9F A;  3CD6 I;  3PUF A;  1O3T A;  3E97 A;  3KP7 A;  1P9Q C;  3FM3 A;  3RPU D;  3JRE A;  3L7W A;  2GOM A;  2KT0 A;  5FFX A;  3TOA A;  3TDZ C;  1TT5 B;  1D0Y A;  2PJP A;  1SGM A;  2FSW A;  4F52 A;  1X1D A;  3UKG A;  2X6X A;  3L1P A;  3IH3 A;  3ZQG A;  3DFG A;  3FX3 A;  5CVV A;  3V7S A;  5A2Q Z;  2STT A;  3P9K A;  1J5Y A;  5D8K B;  4DYC A;  3PQK A;  4V19 K;  3VW2 A;  1XX5 A;  2CUF A;  1SFK A;  4JX5 A;  4L0Y B;  1ZAO A;  2D1V A;  3VSK A;  1YJ9 I;  4X6A J;  1QZE A;  5LD2 C;  3TL4 X;  2VUM J;  2KKO A;  4PFP A;  2OCE A;  2VBY A;  2O03 A;  2ACJ A;  4P5O A;  2GZW A;  3BPV A;  1IUY A;  5B3S H;  4JX4 A;  2XDN A;  3D5L A;  1O3R A;  1JT6 A;  2E35 A;  1I3Q J;  3BT9 A;  3R0J A;  4PCQ A;  3I4N J;  4XN3 A;  1N25 A;  2ZSI B;  2WV1 A;  1BIB A;  2PJR A;  2K5C A;  3F0C A;  3JR9 A;  1K78 A;  1QGP A;  3EPZ A;  4OU0 A;  2A2F X;  3O8G A;  2VJ4 A;  1PYV A;  4RGU A;  1JKQ C;  1MBH A;  3VW0 A;  1IUF A;  2EJR A;  4RAG A;  3TP0 A;  1I39 A;  4CCJ A;  1IGN A;  1SD5 A;  2WGB A;  1X3W B;  3BDD A;  3I59 A;  5IYD J;  2VAS A;  2LK2 A;  5HDK A;  5M5Y J;  1DP3 A;  3OS0 A;  2DOF A;  2RAE A;  4M71 A;  4IX7 A;  2FBH A;  1QRY A;  2M4G A;  3K0L A;  2D6Y A;  3ERM A;  1P4W A;  2M0M A;  2BVM A;  3OR1 C;  4LB6 B;  1IN6 A;  1G3T A;  1N75 A;  1MW7 A;  1YHQ I;  3B6C A;  1LUJ B;  3MNL A;  1JUS A;  1YX3 A;  2HVS A;  4HF0 A;  1E3O C;  2IXS A;  4XL9 A;  3CME I;  1T2K A;  3ZQC A;  4IF4 A;  2NAZ A;  4RB2 C;  1OYY A;  1TW2 A;  1BM9 A;  2K9Q A;  3MEX A;  4ESF A;  2QVO A;  4YEL A;  5HS9 A;  3SJM A;  2DO7 A;  3W6K B;  4S05 A;  5C4Y A;  5L3G A;  3HRS A;  1XGS A;  5J4Y A;  1WJE A;  3O3K A;  3W2A A;  2XSD C;  3VOK A;  4E7Z A;  1KU3 A;  5FKL A;  1V4R A;  1P7I A;  3M1E A;  3U1K A;  5B1A H;  4MTE A;  1EH7 A;  3EUH A;  3OIP A;  1BW5 A;  4NQW B;  2VXD A;  1E2X A;  1EA3 A;  1FJL A;  2BXY A;  2HEO A;  3PAS A;  2VBW A;  1QHH D;  1XSX A;  3MVP A;  2LRE A;  3TOB A;  2NXN B;  3BCG A;  3KYC B;  3GTK J;  3HYI A;  5J1R A;  2O61 A;  4BXX J;  5BMZ A;  1V55 H;  2W25 A;  4BU2 A;  1YS7 A;  3FM5 A;  4B1R A;  3OOU A;  5ERI A;  1VQK I;  3S3O A;  5EEA A;  2R3S A;  3ZCO A;  5DD8 A;  4UV8 A;  3W3C A;  2JPC A;  4LFU A;  4LD5 A;  4N9H A;  4ESJ A;  3WTT C;  4O5V A;  1WRJ A;  2H6C A;  3E6C C;  4WK8 F;  5M3F J;  3O60 A;  2MD0 A;  5EEG A;  4GFK A;  2QWT A;  1D1B A;  3DBH B;  5J1Y A;  3C2G A;  4MGR A;  5ICG A;  3GW2 A;  4P96 A;  2DK5 A;  2IPQ X;  4PXI A;  3LFU A;  5H6Q A;  1B4A A;  2HDC A;  1I3A A;  4GCL A;  4E7L A;  3CWR A;  2K27 A;  3L2Q A;  2MD5 A;  2V26 A;  3BR1 A;  3LNQ A;  2XIG A;  3G7R A;  1SD7 A;  1HKQ A;  3ON2 A;  1USS A;  2VIX A;  5FKM A;  3WU2 C;  3ONQ A;  3FDY A;  1P2F A;  4A3E J;  3ZQQ A;  2FF4 A;  4Q5S F;  2ELH A;  2P6T A;  3CO7 C;  2CW8 A;  2B0L A;  5HLG A;  1FP1 D;  2HWV A;  1R49 A;  3ZOB A;  4C9Y A;  5L3F A;  3AQT A;  2XAS A;  2H8R A;  4WCG A;  5TJJ A;  2F6C A;  2GLO A;  2VC0 A;  5E1W A;  1TWH J;  2GBY A;  3CUQ A;  4MNU A;  1K6Y A;  1MBG A;  2DBB A;  1HW1 A;  2HR3 A;  3HOW J;  2LF8 A;  1E17 A;  4GFB A;  1SD6 A;  2OC6 A;  3LQQ A;  4HPQ A;  2HXI A;  2HKO A;  2EV6 A;  2JRM A;  2K40 A;  1BJZ A;  3REO A;  3KYL A;  2VPL A;  2DDA A;  4UB8 C;  5K5O A;  4LK0 F;  1XMX A;  4PGH A;  2VL8 A;  4B8X A;  3E5X A;  3ROU A;  3CCS I;  1H9G A;  2LY1 A;  3TW7 A;  4NC7 A;  4GYG A;  2VKE A;  2IEK A;  2NVT J;  4XK4 A;  3LSK A;  2CRG A;  2HNH A;  3K1N A;  2AXT C;  3ZMU A;  2XPU A;  4EGY A;  2NVX J;  2DDB A;  1P4X A;  2Q8K A;  1MJB A;  1JJ8 C;  4G7O F;  1BR4 A;  1FWZ A;  1ZHF A;  2FD5 A;  3LSM A;  4ZJZ A;  2OZU A;  2DW4 A;  3OYD A;  2EA2 A;  1W36 D;  2R7X A;  4IQJ A;  4V2F A;  1OPC A;  2RVC A;  3PFI A;  1GLN A;  4ZYD A;  1ITY A;  2EB7 A;  1LDJ A;  2R7V A;  4MFD A;  1WJC A;  4BEH A;  2OAZ A;  1TTY A;  2VBX A;  3HPG A;  5D1R A;  3VVZ A;  5ICE A;  4GCK A;  3P9T A;  5AON A;  1CGP A;  1MBK A;  3GFL A;  1QZZ A;  2DPU A;  3HJE A;  1BR1 A;  2DT7 B;  4E7H A;  2QOP A;  3H36 A;  3HDD A;  3COL A;  3ZN1 A;  2OI8 A;  2W4S A;  4DYQ A;  3B6A A;  1PUF A;  2G7S A;  4DJA A;  3OL4 A;  2HKU A;  2HS5 A;  2X1C A;  3X2Q H;  1MSE C;  2DTZ A;  2F4O B;  5KK1 A;  4HNT A;  1TL8 A;  4W97 A;  1A36 A;  2PBX A;  2CG4 A;  2D1H A;  2UXO A;  3B81 A;  2BXZ A;  3F8F A;  3OWT A;  1HOM A;  4JL3 A;  1HF0 A;  1XN7 A;  3DPU A;  2DLL A;  2KFD A;  3F9K A;  4RDU A;  2DAO A;  4GRI A;  1ZRD A;  1SD4 A;  3LWF A;  2Y31 A;  2NS8 A;  3QQA A;  1FBS A;  3CJR B;  4BNC A;  4LIV A;  3K2A A;  1ETV A;  2IRF G;  2X85 A;  3DPL C;  1D5Y A;  1R6R A;  2X6Y A;  3G73 A;  2W1O A;  2EZL A;  5FB2 A;  4B4C A;  2WA0 A;  2W57 A;  4A2U A;  4HDU A;  4CGZ A;  5CLS A;  1V54 H;  1H0M A;  4E7K A;  2XAG A;  2DMP A;  5IY5 H;  3TO6 A;  2P81 A;  1PDN C;  6PAX A;  5DYM A;  1TQI A;  1Z6T A;  2YU9 J;  4QIW N;  2LVS A;  4LG0 A;  5ED4 A;  1D0Z A;  3PUB A;  2TRT A;  2G9W A;  2MH9 A;  2FE3 A;  2QUF A;  1QVT A;  2WWY A;  1X3Z B;  2Y9Y A;  5JR3 A;  3CF5 F;  3TGN A;  4A3C J;  2XF6 A;  1LDD A;  3GCM A;  3GZ5 A;  1DP7 P;  4AM3 A;  4AF5 A;  1B8I A;  2UXI A;  3VP5 A;  3DTI A;  5FFZ A;  2YVH A;  1WGX A;  4B09 A;  1HC8 A;  3SDG A;  3AAF A;  2A6H F;  4H0E A;  1Z9C A;  1IXR C;  1WPK A;  1J59 A;  1G59 A;  2PEX A;  2LKS A;  4BE0 A;  4FE7 A;  3MZY A;  1LPQ A;  4JQF A;  4U88 A;  3EUA A;  5E3N A;  3S16 J;  4BE2 A;  2RQQ A;  1ZR2 A;  4OIQ F;  2STW A;  2IGK A;  3H5N A;  2R7S A;  4EJW A;  3AG4 H;  3NAU A;  4DBR A;  2R92 J;  3SWH A;  1CF7 A;  2R7Z J;  3HTS B;  1R22 A;  5F1R A;  3CCL I;  4HA8 A;  2B9S A;  2NYX A;  4UUS A;  2Y69 H;  2PFV A;  3QBM A;  3FK7 A;  1SVO A;  4L5J A;  5TIS C;  3DU5 A;  2L4A A;  1FEX A;  1U5T B;  4M74 A;  1XCV A;  4CYC B;  4S04 A;  3DF8 A;  2JUG A;  3F22 A;  4AUX A;  5IOY A;  3OYH A;  3QKX A;  2V6C A;  4LG0 B;  2CQX A;  5GPA A;  2E2J J;  1MMS A;  2KJC A;  2VKH A;  2M8G X;  1MND A;  2EIK H;  4MQV A;  2DXI A;  3ZQF A;  1ETX A;  2V9K A;  4XOT A;  4Y4R A;  5CXI A;  1V5E A;  3G4S I;  5FMP A;  3KPH A;  5BQT A;  1BBY A;  1O7L A;  1BIA A;  1FPQ A;  2CO5 A;  1B8I B;  4PSW A;  2DG8 A;  3OYK A;  3M8E A;  5F0F A;  4M72 A;  3BNI A;  5L3D A;  3FHZ A;  4O3M A;  2H09 A;  4U0Y A;  3ZP5 A;  1W1W E;  4BXU A;  3WOD F;  2E2I J;  3GFM A;  1LDK B;  1RES A;  2A5Y B;  2VOP A;  2ZCN A;  4EGZ A;  1H9T A;  2M4K A;  5FRM A;  2YX7 A;  3DKX A;  2IGM A;  3PJR A;  2EK5 A;  2D45 A;  3CCE I;  4IOC F;  3RYP A;  2FJI 1;  2M0C A;  2R93 J;  3WTY C;  2OD5 A;  3FKI J;  3AL0 C;  3GZI A;  1UI5 A;  1D1C A;  2QQB A;  2MBF A;  5D5V B;  2KP6 A;  3E7L A;  5D4S A;  3M3Y J;  4A6D A;  2P5K A;  2QYO A;  2BHY A;  3H0G J;  1V3F A;  3WTV C;  3EUP A;  1R9T J;  3WE3 A;  3RI4 A;  3G6E I;  2O3F A;  2A6E F;  2FEZ A;  4XMY A;  4KYW A;  3ASO H;  4B44 A;  2CQK A;  4E7S A;  2JMW A;  1JI8 A;  4IRV A;  2K3F A;  3SXY A;  3GUD A;  4A0Z A;  2LBF A;  3AG2 H;  4KA4 A;  2CV1 A;  2R7U A;  2DYR H;  2VT3 A;  4HBL A;  3VVY A;  5CVI A;  4UDS A;  3VUQ A;  1YFH A;  4LIT A;  2ME0 A;  2G7H A;  3GFI A;  1WZ2 A;  3M07 A;  2ZFW A;  4BKX A; 
#chains in the Genus database with same CATH homology
 1T33 A;  2UXU A;  3VOX A;  3S15 J;  3G56 A;  1ETQ A;  2LFB A;  3S1M J;  2ME6 A;  3JSJ A;  1RPW A;  4A3B J;  1TC3 C;  4ACI A;  1RKW A;  4M6V A;  1P7J A;  4FIS A;  3LSG A;  2ID6 A;  2OER A;  3F1B A;  3BHQ A;  4QSH A;  1AKH A;  5F1J A;  3G1O A;  4DYR A;  2HYJ A;  5C4J J;  1K61 A;  1X2M A;  1IG7 A;  3GTG J;  1PUF B;  3I4M J;  4A3F J;  4DZJ A;  3GTJ J;  2QIB A;  3SFI A;  3BJB A;  2DMT A;  3G1L A;  3HTH A;  1JTX A;  1H88 C;  1AU7 A;  3NI7 A;  3ZQI A;  1LE8 B;  2NS7 A;  5CW8 A;  4FCY A;  2DA6 A;  2FBQ A;  2GEN A;  5E3O A;  1GVD A;  3WHB A;  4BBR J;  1POG A;  1VFC A;  3LJL A;  1MNM C;  1H89 C;  1HDD C;  5EF6 A;  5M5X J;  3AQS A;  3VVX A;  2DA1 A;  1BW6 A;  3HOV J;  2JK3 A;  3JRE A;  2KT0 A;  2QCO A;  1YRN A;  1MBF A;  3HKZ N;  1SGM A;  3LSR A;  1HLV A;  2XGC A;  3UKG A;  2G3B A;  3A01 A;  2W53 A;  3L1P A;  5IPA A;  3IH3 A;  4BY1 J;  3ZQG A;  1MBE A;  3LSJ A;  1SAN A;  1OCT C;  4ME9 A;  4DYC A;  5BNG A;  2JJ7 A;  1G2H A;  3VW2 A;  1Y1W J;  2CUF A;  4JX5 A;  1ENH A;  2X9D A;  5C3E J;  1SFO J;  5IP9 J;  2YUS A;  2L0K A;  4X6A J;  2UXP A;  3HOX J;  1VI0 A;  2EQR A;  1IC8 A;  1GV5 A;  3MN2 A;  3S2H J;  2VUM J;  2WUI A;  1Q1V A;  2YVE A;  2M9H A;  1XG1 A;  4JX4 A;  3A02 A;  2XDN A;  1JT6 A;  2QKO A;  5EG0 A;  1F36 A;  4A93 J;  3BRU A;  3GTL J;  1I3Q J;  4MXM A;  3BT9 A;  1VF9 A;  2HYT A;  3I4N J;  3ANG A;  2NP3 A;  2WV1 A;  1B72 B;  5DTD A;  3F0C A;  3JR9 A;  5M5W J;  3M4O J;  3O8G A;  4D5F A;  5DS9 A;  3CRJ A;  1JKQ C;  1MBH A;  2XPW A;  3JRF A;  3GTO J;  2RHA A;  2LR8 A;  3VW0 A;  1ZK8 A;  1IUF A;  3BG3 A;  3TP0 A;  4L5E A;  1IGN A;  2WGB A;  5E3L A;  2DMQ A;  5IOZ A;  1BA5 A;  3PPB A;  3V78 A;  5IYD J;  2LK2 A;  4I76 A;  5M5Y J;  2F07 A;  2LLK A;  1GUU A;  2O9L A;  3JRA A;  2LY9 A;  3S5R A;  2RAE A;  1QRY A;  1YRN B;  1HDP A;  2MGQ A;  2D6Y A;  3HB9 A;  3K7A J;  4UUS B;  1OFC X;  4J19 A;  1MH4 A;  1LFU P;  3PO3 J;  3B6C A;  3MNL A;  2Y30 A;  4AYB N;  2HQ5 A;  2R0Q C;  1JUS A;  1I6H J;  2E19 A;  1GDT A;  2AHQ A;  1E3O C;  5GP9 A;  1CQT A;  5IP7 J;  3HEF A;  3ZQC A;  1A5J A;  2M34 A;  5EFY A;  5FKK A;  2WB1 N;  3BQZ A;  2R5Z A;  5EZH A;  4IHV A;  4ICH A;  2K9Q A;  4YZE A;  2MW8 A;  4HNV A;  3TED A;  3GTM J;  3SJM A;  5C4Y A;  2EZI A;  5J3L A;  1ZKG A;  4JX6 A;  3IV5 A;  2XSD C;  3VOK A;  5FKL A;  3RZD J;  1WCM J;  4Y7N J;  1HCR A;  1P7I A;  3HTA A;  1BW5 A;  4A3D J;  3FK6 A;  2Y0S N;  1IV6 A;  1FJL A;  2MSY A;  2RAS A;  3PAS A;  3MVP A;  3QPS A;  1JKP C;  2E1O A;  3BCG A;  4JNN A;  1RET A;  1K83 J;  2DN0 A;  2XGD A;  5C4X J;  3GTK J;  5J1R A;  5D18 A;  1RR7 A;  4BXX J;  2EH3 A;  3HE0 A;  2DG7 A;  1H8A C;  1NTC A;  1UMQ A;  4B1R A;  5K58 A;  3OOU A;  5EEA A;  1OCP A;  1X58 A;  4CYC A;  2HI3 A;  4ABZ A;  5HOD A;  4I6Z A;  5AQC A;  4IHW A;  2IU5 A;  1FIA A;  2Y2Z A;  5M3F J;  3O60 A;  4GFK A;  2QWT A;  3CCY A;  5J1Y A;  4NEL A;  4PXI A;  4IEJ A;  2HOS A;  1JUM A;  1ZTR A;  4D7N A;  2VI6 A;  4GCL A;  2N8G A;  4RBO A;  3CWR A;  2COB A;  3Q0U A;  2CUE A;  3RZO J;  4DW6 A;  3BR1 A;  2R5Y B;  3LWJ A;  3LNQ A;  2GFN A;  1X2N A;  3G7R A;  3CMY A;  2UXH A;  4XID A;  2HDD A;  5EGO B;  3S17 J;  3LSP A;  2Y9Z A;  3ON2 A;  4BY7 J;  5FKM A;  2VPR A;  3S1Q J;  4A3E J;  4MLO A;  2E2J J;  3O8H A;  2LKX A;  4GCT A;  3FIS A;  3ZOB A;  3AQT A;  5FLV A;  2DA7 A;  2H8R A;  2XB5 A;  2PZ9 A;  2K9N A;  3D1N I;  2GLO A;  4NN1 A;  4L62 A;  5H9T A;  1TWH J;  3Q0W A;  4NDL A;  2GBY A;  1ZGW A;  5F0C A;  1MBG A;  3BTJ A;  4D7M A;  5IYC J;  3HOW J;  5HAW A;  2MG4 A;  2DJN A;  4GFB A;  1JTY A;  4JYK A;  2LD5 A;  4A3M J;  1S7E A;  1U78 A;  3GTP J;  4G12 A;  3OSF A;  1ETO A;  1W0T A;  2HXI A;  2K40 A;  1BJZ A;  1AKH B;  2B63 J;  3E7Q A;  1ZQ3 P;  4M3B A;  2L7F P;  2HOT A;  1W0U A;  4FTH A;  1A6I A;  5EZG A;  1U8B A;  4IHX A;  3ZQH A;  3OSG A;  3DPJ A;  2CJJ A;  4Y52 J;  2O7O A;  1I50 J;  4C3J J;  1TWC J;  3TW7 A;  1WH5 A;  2KDZ A;  5D19 A;  2Q24 A;  4M3E A;  4M3G A;  3H3V K;  2K9S A;  2IEK A;  2VKE A;  2NVT J;  4XK4 A;  5F0H A;  2NX4 A;  3KZ9 A;  3BQY A;  2OPT A;  2CRG A;  2NOG A;  3CDL A;  1BL0 A;  2E2H J;  3BR0 A;  3BG5 A;  2XPU A;  2NVX J;  3QPL A;  1IRZ A;  1JJ8 C;  3NPI A;  1ORK A;  2FD5 A;  2ZOY A;  4XRS G;  2JN6 A;  1LFB A;  1TWA J;  3TP3 A;  1QPI A;  2ZCM A;  4A3K J;  3BR2 A;  1WI3 A;  4V2F A;  1ITY A;  4MFD A;  3A01 B;  5C44 J;  5D1R A;  3VVZ A;  1JKO C;  4GCK A;  3P9T A;  1RKT A;  4A3J J;  4AC6 A;  2HXO A;  1MBK A;  2QOP A;  4GFL A;  3TW6 A;  3A03 A;  1MSF C;  4JKZ A;  3HDD A;  3COL A;  2OI8 A;  2LTP A;  2EBI A;  4DYQ A;  3B6A A;  1PUF A;  2G7S A;  2HKU A;  1Z77 A;  3HOY J;  5K7Z A;  1MSE C;  2DTZ A;  1LE8 A;  4QTR A;  1MBJ A;  4W97 A;  5DAJ A;  4D5C A;  2PBX A;  2UXO A;  3B81 A;  1HOM A;  4JL3 A;  3HOU J;  5HBU A;  4AC0 A;  1HF0 A;  2D5V A;  4XRM A;  2QF7 A;  5F08 A;  3HOZ J;  5F04 A;  5EG0 B;  2X48 A;  5K7H A;  1UI6 A;  3RH2 A;  4RDU A;  3HBL A;  3ON4 A;  1VND A;  5JLW A;  2JWT A;  2NS8 A;  2Y31 A;  3QQA A;  2DA3 A;  3JRI A;  2O7T A;  3HGY A;  4B3A A;  3K2A A;  1ETV A;  4LOC A;  3VW1 A;  1D5Y A;  1APL C;  2H1K A;  3LOC A;  1GV2 A;  1IJW C;  2EZL A;  4B4C A;  3HIM A;  2HOA A;  5HSZ A;  1UG2 A;  3BR5 A;  2JA8 J;  3CJD A;  2FX0 A;  2CQQ A;  3NXC A;  2DMP A;  2GM4 A;  2P81 A;  3G1M A;  2YU9 J;  4QIW N;  2LVS A;  1WH7 A;  1ZR4 A;  4A3I J;  4C3I J;  2ECB A;  2O8K A;  2TRT A;  1FTZ A;  1JGG A;  5IP6 A;  1MH3 A;  1QVT A;  4XIC A;  1U9O A;  3W6V A;  2Y9Y A;  1GT0 C;  2LP0 A;  2XGE A;  2XPV A;  4A3C J;  1ETW A;  4AF5 A;  1B8I A;  2UXI A;  1NK3 P;  3VP5 A;  2YVH A;  3V6G A;  2M2E A;  1WGX A;  4FE4 A;  5F27 A;  3BTC A;  1JUP A;  3WHC A;  4XRS A;  3Q3S A;  2QTQ A;  3SDG A;  4V2G A;  2R5Z B;  3T6N A;  2L9R A;  2TCT A;  3JRH A;  4M3D A;  1WPK A;  4C3H J;  3VPR A;  1B72 A;  2L7M P;  1XS9 A;  4FE7 A;  3CQZ J;  5E3N A;  3S16 J;  1ETY A;  4UUT A;  1DU6 A;  2IBD A;  2CU7 A;  1ZR2 A;  1UHS A;  3DEW A;  2DMU A;  3HTJ A;  4IHY A;  3NAU A;  3DCF A;  1AHD P;  2R92 J;  1NK2 P;  2R7Z J;  1TWG J;  2FJ1 A;  3C2B A;  3IUV A;  2NVY J;  2XRL A;  4DZP A;  5JLX A;  1EF4 A;  3FRQ A;  4HKU A;  3RKQ A;  5FGL A;  2ID3 A;  2OF7 A;  4X1E A;  2ECC A;  4UUS A;  3BR3 A;  4MFE A;  2GUH A;  3S14 J;  1DU0 A;  2JA6 J;  4M3F A;  3ANP A;  1IDY A;  5E3M A;  3QBM A;  3FK7 A;  5FLM J;  3HGG A;  2NP5 A;  3NRG A;  3BTI A;  5CXG A;  3JRB A;  1FEX A;  4BBS J;  4CYC B;  4CGR A;  2ZCX A;  4KWA A;  2DA2 A;  3BTL A;  3KKC A;  2REK A;  4AUX A;  5IOY A;  3QKX A;  3GTQ J;  2CQX A;  2X6O A;  5FKN A;  2EZK A;  4W1U A;  5GPA A;  5FHP A;  2M8G X;  2XB0 X;  3ZQF A;  3ZQL A;  1ETX A;  5CXI A;  5EDN A;  5FMP A;  3NNR A;  1B8I B;  2DG8 A;  1OJL A;  2EZH A;  4C2M J;  1IDZ A;  5F0F A;  3BNI A;  2W48 A;  2WAQ N;  5M3M J;  3LHQ A;  4MO7 A;  3NAR A;  2E2I J;  5GPC A;  2I10 A;  1RES A;  4JP0 A;  4A3L J;  1QVU A;  2ZCN A;  2ELK A;  1TWF J;  3Q0V A;  1Z0X A;  4EEF G;  3PO2 J;  3IH4 A;  3S2D J;  3KKD A;  4MK6 A;  3VIB A;  9ANT A;  1T56 A;  3EGQ A;  3RD3 A;  2NVQ J;  2AO9 A;  2G7L A;  2M0C A;  2R93 J;  2IAI A;  5EYR A;  2G0E A;  3FKI J;  1FIP A;  5FKO A;  2VKV A;  3S1R J;  3OIO A;  3GZI A;  1UI5 A;  2L7Z A;  3JRG A;  3JRD A;  3HM5 A;  3BR6 A;  3M3Y J;  3E7L A;  2G7G A;  3FIW A;  3H0G J;  2FQ4 A;  4A69 C;  5K7F A;  1O4X A;  3EUP A;  3GEU A;  2DA5 A;  1R9T J;  1Y1V J;  4S0H B;  3JRC A;  5FJ8 J;  2YS9 A;  2DA4 A;  1ETK A;  1F43 A;  1JKR C;  2JA5 J;  2DMN A;  3C07 A;  5IYB J;  2R5Y A;  3RQI A;  2JMW A;  2ZB9 A;  3KNW A;  1JJ6 C;  5EGO A;  3BG9 A;  3PM1 A;  2V57 A;  3S1N J;  4MIM A;  3GBG A;  4A3G J;  1U9N A;  5J1U A;  3IH2 A;  2JA7 J;  1FTT A;  3VVY A;  4UDS A;  3VUQ A;  2PMZ N;  2ME0 A;  1XC5 A;  3MKL A;  1JT0 A;  2ZOZ A;  3HTI A;  4BKX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...